5JPNC

Structure of human complement c4 rebuilt using imdff
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
290
structure length
290
Chain Sequence
APKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C4-A
publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
molecule tags Immune system
total genus 55
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jpnC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 5jpnC01
4ILWA 3HRZC 4FXKC 1PXUA 2WINB 1JB3A 3KLSA 2PN5A 5JPNC 5FO8B 2A74C 3L3OC 1D2BA 1OO9B 3V96A 1JC7A 1BV8A 3CKIB 1GXDC 3OHXC 3T4AC 5FOBB 3HS0C 2B39A 1UEAB 1AYOA 1BUVT 5FO9B 3MA2B 4FXGC 2XWBB 2XWJB 2A73B 3CU7A 2E2DC 1BQQT 3G6JB 2I07B 1EDYA 2J0TD 5FO7B 1XWEA 2TMPA 3I70A 5JPMC 1BR9A 4D94A 1UAPA 2ICEC 2WIIB 3FRPB 2QKIC 4LNVA
chains in the Genus database with same CATH superfamily
1PF3A 4A37A 3HRZC 1YEKL 2X41A 2IH1B 3IFPA 1G9NC 2CDGA 3H2PA 5IIEB 4C59B 1OO9B 3VD9A 5D7LE 5FW6A 3VE0B 2YMTA 4UDUB 1RZFL 5DVKA 2EQSA 2E2HB 4MLIA 5FO2A 4OJDH 3I73A 1R3IL 1TF4A 1FGVH 2KBGA 4N9OB 4MXQD 4PJHB 4IO9A 1G9MH 5IBUB 4H44C 1FNVA 4P04A 1J5DA 1KV3A 1U8JB 1XMEB 4DNRB 3BMWA 1O5DT 5DMGD 4Z77B 2YBRA 1K83B 3FT0A 4N5EC 4OD3L 1KN4H 4IU3A 2RDHA 3ATEA 4A93G 1OF2A 3TASA 1G94A 1H0DA 4ZFFA 5EEZA 4ELKA 4GKZB 1HNXQ 1OSPL 2NY2C 1UWVA 4R4FL 3UJTH 1I53A 5E8EB 5A7BA 1UOVA 5D7LA 3M1BA 2HWZL 1EFXA 3SZ6A 1DFXA 3V4UH 1C7SA 1EPFA 1WCBA 4XB3A 3U1PA 3FT3A 4HF5H 4P4KD 5BQ7B 5E0FA 1TDQA 5IMMA 5KVFH 4A3MB 4PJXA 4J2XA 1V9PA 2X3AA 1CLCA 4RGOH 4K0OA 1BQHG 2HT1A 4DR4Q 3I4MB 2EAEA 3OW7A 2LOEA 3BFQG 4FG0A 5F6HI 2BSTA 4OAWB 2RBLA 4PREB 1K9MC 3BFOA 4UOJA 2KA7A 3KPMB 4KKNA 5I9QB 3IRPX 2DEWX 2YZ8A 2I5YH 2KKQA 2V9RA 1RIUH 4POFA 3IFNH 2J6WA 1E40A 1HNXL 2DB8A 2F18A 2KPNA 1TY0A 4IIQB 4HUMB 1CXEA 3ZL2A 4K5PA 5IP7H 2FO4A 1JWUD 3ZO9A 2Z1KA 4PLKD 1YZZA 1VQ4A 4O9HL 1SSOA 1T1WB 4D7BA 3EYSL 3GIZH 4ZMNA 2AXGA 4DR4L 1QW8A 3KS0H 5K39B 4JUTA 3HKZB 1Q94B 4NBXB 3CN0A 1GY2A 2ZX9A 3L1OL 1NUDA 5F3BA 1USZA 4AX3A 4KZ0A 4Z23A 3QRLA 4JM2F 3MJGX 4PJ9B 3D07A 4NZ8A 2E5LQ 4M62H 3GNMH 2AXFB 3WTXA 3T65A 1FNLA 1XGPA 2WZAA 4R7NB 3UZQA 5AUMA 1CQFA 2EDTA 1NMCC 1H8SA 4FEIA 2F7PA 4FG2A 4R8NA 1NICA 1N59A 5DI8A 1QNKA 1IX2A 3D0VB 4BY1G 3ZYOA 2Z93A 3WDIA 3HG4A 3NACL 1I4FA 1YJWA 3SPGA 1B4JH 1EK3A 4Q5VA 5K36H 3KPSD 1JHTA 5CLWA 2Z6BA 4OF8A 2UUBQ 3U7YL 4KDWA 2ZT9C 5HGDB 5LWYH 1K3RA 3L9RA 2IHFA 5JJZA 1WE5A 4FNSA 2DTML 3OB0K 3GHPA 2VZUA 2YAMA 5D6CB 2HRLA 2TAAA 1B0WA 3PV0A 2Y5EA 3TBIB 2ZWKA 2E5LL 4NP4L 3V6BR 1FL5B 4NW2A 5K69A 1LWRA 2VCOA 3QUXC 3RWHB 4FQCH 5E1HB 2HCIA 3IVKB 2K6AA 3T4AC 5E9DA 3RDTC 1NH6A 1HZCA 1UA6H 4ZUJA 4GQZA 2Y7NA 4G80B 4QRPB 4FJ6A 1K85A 1LP9E 1RZJL 2UUBL 4R5VA 1H8OA 3C5SA 2ZCLH 3GSRB 3V9EA 1CT8B 2EACA 2BNRE 2PMZA 5TF1H 2DH2A 4KRPC 4PRPD 1JS4A 4NQDE 2WN2A 3TWYA 3NZ8A 5C44H 5FUOL 2LU3A 4K8JA 2BY1A 2QELA 3HFML 1RTNA 4NWTH 4MNQE 4ZUWA 4M6AA 3K5SA 4HUVA 4Z7UA 4TRPH 4LBEB 4XNQB 1QTYT 4RNRB 1B0GA 1AW7A 3CFKB 2EEDA 4LRIA 3V9FA 5AOKA 3RIFK 5TTRA 1EEYB 2MPAL 2LS01 4WTWA 3EYUH 2HHHQ 3NJKA 4I1NB 1QOKA 3OR7A 4ELMB 3PIQB 3QDMD 1IYVA 2R15A 4QHNB 1IC5L 4PWGA 4MZ9A 4R0LC 3NPZB 3TIDB 2H6PA 3K81A 4BQ8A 4RAHA 3TXAA 4JYAQ 5JDJA 2KEDA 4P48A 4YSSA 4G6FD 1KCVH 3EDEA 1JHKL 1T1ZA 1A6XA 3QUKA 4FQLL 1H5BC 2TRYA 3HHSB 3W37A 1UB6A 5TPWH 3IJSA 3UROR 3RPIA 4Y2OA 3VG0L 2B77A 1LTAD 4X6AH 3SKUD 1RCVD 4JVWA 4KY1L 3VFUB 5KVGE 1U4FA 1N4XH 1X5XA 3QPKA 5AVWB 3T09A 2XN9B 4JFFB 3NOIA 4CUCA 1L0XA 4H25A 1DUYB 4YWGH 3EJTA 5AW3B 4IBYA 2HHHL 5J0BA 3G6JB 3JC66 2AQTA 4XXWA 1QSFB 4DPAX 3QZPA 5ISZA 1GYAA 3NPSB 1SXBA 4GP8B 1G5AA 1TQCC 4BRVA 3KXFB 4ESKA 1DYQA 5EKLA 3F1ZA 2EECA 3CSTA 4R5XA 4JYAL 3VYTA 5F7KC 4Q7DA 4HIHA 2V2TA 1F2XK 1H6FA 1WZAA 2AJYL 1U8LA 4LKXA 3ZE0B 5B38G 2BPBA 3CCHB 3JBG7 1AEXA 4KDTA 4GBXD 4X7DC 3WFCL 2WQXA 1RK0B 2UY6A 5CMAA 1H9JA 3NT0A 1A7BA 1Q1BA 2FX8L 4NN5B 2JA9A 4YHLH 2C34A 3OZ9L 3TCLB 4HV8A 1JK8A 5ALBL 5EC1A 4RMBA 1E5UI 1NIDA 3FT2A 4MZ2A 4AEFA 2FO1A 3W5MA 4ZSOA 4JY6B 4LHUB 3PQYB 4LASL 2VITA 1BDOA 4K9EC 5AZEL 5IB1B 2PYEB 4JDEB 4OH2A 1DQLH 4AL8L 2Z0SA 4HCRA 3FN0H 2VRQA 5IGFA 3A23A 3EJCA 4QGTA 4LGSB 3KBEA 3JXAA 1TLMA 4FP5D 3G5XA 1BQUA 5BS0A 4I1RA 4PLNC 3FTYA 1EZVY 1WCQA 2E5EA 2GTWA 4RRPA 1NINA 3SY0B 3LRKA 4UINH 5CINH 1JMCA 4PJIE 1S7VA 1I1YB 2YU9H 3MLXH 3OKYA 5GGUA 2LFGA 4YSPA 5E95B 2F54B 3CD4A 4FHKA 1MIEH 2O6DA 2VDQL 4K5XA 2GCYA 3QDGA 5A2CA 5HHVL 1CLYH 1ETZB 3CIQA 5KSUA 3BAXA 4KKSA 3BDCA 2LQRA 3KYKH 2ICEB 2ORBL 4JRYD 4P2YA 2H5XA 3IT8D 5DQDL 4R9WA 2BA1A 3FTVA 4KKZA 2ARJQ 5I9OA 3DSNA 3OWEB 5AW4B 2FIKB 2H1PL 4QHLB 1ECZA 3CQZB 1K8IB 4RETB 3RZCD 2GT9A 3VXUA 1E9OA 2R1WB 5E6IC 4DP9X 1VIWA 4BK5C 5B8CC 1YNLH 1TTRA 3RWFB 4X7SL 1J5OH 4IDLA 1SVBA 4AH6A 5FYLL 3GTGH 3O3AB 3DO7A 3N6YA 3WTTA 1XTCD 4MMZC 5TQ2H 3B2UC 3WJMB 2DLIA 2NZ1A 1FNUA 5D70L 4P4KB 4BQCA 2CRIA 3LKSB 3P4MB 2VDQB 3HTLX 1L6ZA 1ML0D 3BGMA 5KSBE 3APCA 3TQYA 2VABA 4HT1L 1ASZA 4HZLA 5C71A 5F7HA 2X05A 5J9PB 3HMXL 1R6VA 4L9LC 5E6UB 3LKPA 4OJAA 1NCGA 3QQ3A 2IWHA 3RWCA 4A04A 2BCOA 2WD0A 3WI9A 5FYKH 3ZT6A 2EY5A 3MA9H 1TTUA 5MI0B 1W9XA 4HISA 3BRGC 1Q9OB 3R06A 5FCUH 1QRND 2AEIT 1U8NA 8PAZA 4AYMC 1Z5YD 7PAZA 1YC7A 3ILQD 3EFXD 3IDNB 3ZSTA 5JHDB 1FGVL 1U8HA 2CKZB 3BP6A 3GSWA 4YXLH 1G9ML 1EIBA 3EBAA 1Q3LA 1DQJA 1JWUB 1GGIH 5JXED 1CI5A 3FCSB 1YEFH 4NRZB 5FW7A 5KSBA 1KN4L 5C5MA 5D96C 3VMNA 3J7AV 3BT2H 4AQ8C 3VWJC 1U3HA 2TSAA 5IE8A 2NOYA 4RKLA 3UDXA 1P6WA 5E4AA 5HHNB 3QUMH 5AG9A 3PWJA 2YSSA 3UJTL 1CFQA 1CBJA 4HLZH 2ARJB 4Y19A 3V4UL 4WSKA 3QUYD 4HF5L 5KVFL 1T7XA 1ID2A 3T1FB 1CFTA 2ZP9A 4PV9B 4A3IH 5D7IA 4RGOL 1UGNA 1FF5A 4AGNA 4X9GA 1Y8OB 4KY6A 5GGQH 1CDBA 2D9UA 4WNQA 1A3VA 2G9HD 2NXYD 3UACA 2ENYA 2CPCA 4BSWB 3PJNA 1ZTMA 2P8LB 1ZEAH 1X5YA 2I5YL 1XSOA 2XWBA 4QYAA 3C5ZC 1RIUL 4PVNA 3ZDXE 1PZUB 3IFNL 4GXUN 3WYRA 3HG1A 5F8RC 2QMJA 2GI0A 5DHMC 2XV2A 2GA4B 2WXLA 1NBYA 2YPLD 1EFWA 4QJ3B 3IN2A 4J8QA 3OMIB 3GUTB 4RDQG 5HDBB 2YBGA 2VB5A 4TULH 3H9ZA 5E51A 2XOTA 1BPVA 1H8NA 4B9KC 1BG9A 3EOBA 3E6HB 3GIZL 3IETB 4IKJA 4FS0A 4ZMXA 3QNYB 1MJUH 3QEGH 1IILE 2Y7LA 3PAYA 3QNXA 4A3EG 4FNPA 4OIFA 5L0QB 2BDNA 4A3DG 1K8AC 5C3IA 3G7TA 4FQQB 5D5MF 3TEXA 3T08A 4FMFA 4OCLC 4M62L 3GNML 2FEDC 3KNBB 1AE2A 3V8CA 4Z76A 1FZJB 1IEBB 1X9NA 2NB0A 2PO6C 3BUYB 3V4VH 4OZFA 3IU3B 4JPQA 1MLCA 3PDOA 4LSPH 1IW7D 4F87A 1GOZA 1UKSA 3CRKC 1B4JL 2X4NA 4LESA 1WA1X 2UUAQ 2NY3C 2OJZH 3TPKA 3VI4E 4AQ1C 4MZIA 2E76C 3PJSA 4F91B 4I3SH 4KUZH 3SDCC 3I75A 4AGLA 5LWYL 4V2CB 4XPHH 2JNZA 5JQHC 2I7SA 4XVUC 2VUMH 1Q7YC 4FQ1H 4X3KA 1X5MA 4MMYA 1KPVA 4J4PD 3QUZA 4IRSA 2FH6A 5HHME 5D8JH 4AMKH 3MBWA 5LXVA 2WANA 3IDGA 3S3PA 1AC6A 1M7UA 2HA1A 2DICA 2IPTH 1DVFD 3S35X 4XO3A 4NB3A 2FO8A 4OLWH 1Y1UA 4G6FB 2NY5H 4FXGB 5EO9B 3VH8B 1HCVA 5D7KE 4FQCL 1P0SE 2D3NA 2F7RA 1JPSH 1MRFH 3BH9A 4NPSA 2EDLA 2VDLH 4K2UH 4E42B 5J3HC 1UA6L 3F01A 3HZXA 2DOCA 2VLKD 4R4CA 3ARBC 2UUAL 1S72A 1XH3A 3LIZL 1M7XA 2VZSA 5L4MA 2ITDA 3HPJA 3H54A 2IW3A 3F6LA 2WM0A 2ZCLL 1CI3M 4G7OC 3PABB 2AK4B 1M9SA 4P2OA 5C07A 5ELDA 2EE0A 4N9GA 1PG7H 3I6KB 5DZVA 5KYLA 2QGQA 2E59A 4QXTB 5TF1L 5FEBA 3QJTB 3RURA 3H7BB 1YN7A 4NWTL 1D9KB 1CQYA 4AT6A 4XXWC 3V0AC 4TRPL 1E9PA 4YHIA 4E36A 4XXCA 4GBXB 4R83A 1AZRA 1LYQA 1X7SA 4EZJA 3U9SA 4JN2A 2KJXA 1KNEA 1NFDE 3EYUL 3QAQA 4NKDA 2PLTA 2XKSA 4Q4IA 3TLRA 4GKSA 3PV7A 4Z7AA 1U36A 5DRZA 4XO8A 3HNTH 1MELA 3WHE0 4GAFB 1P7KB 2KQMA 4HHAB 3KBGA 3UXFA 1KCVL 3OWRA 3II1A 4G8GE 4GW1A 1LTBD 5C7XH 3BYYB 5TPWL 4DN4M 1E3FA 3MXPA 3EHBB 4UNVA 5IKCB 1IBMQ 1EGJA 4HSAC 3FQ2A 2EVBA 4A3LG 2WIIA 4YSDA 1XNRQ 1AQDA 2W91A 5C44B 1N4XL 2QLVB 3M6DA 4DJMA 5JIMA 2IT1A 3WUWB 5C09B 1NFDA 5IM7A 4BGDA 5EDXA 4YWGL 4QWWD 4LKCB 2R2BB 1DQDH 1R19A 2VMEA 1UQSA 4YZWA 1ILSA 1WTGT 3CZKA 2BE5C 1BGXH 2EEBA 1U92A 2XFXB 5CFAA 1RKNA 4PRNB 3KPPB 4X5RA 4A6YA 3Q8DA 1AXSA 1ZMYA 3O9WD 4ODXA 4HCIA 2IDFA 2YGQA 5DFTA 3V7AE 4OQTH 4UM9D 3WLWC 3DXJC 2VMFA 4H0IA 1NC2B 2D3JA 5I6WA 5FS5A 3V4PA 1IBML 4YHLL 4ZMVA 4AV5A 3OJVC 1XNRL 3HLAA 4BHUI 1SNPA 1J1XH 3ZKQD 3RY6C 2B2YA 4CKBA 4KU1A 4AIZB 2YXMA 2E7LA 1YHBA 4DT2A 4NO5A 5DYFA 3RZCB 5HI3D 5DJ8B 1MRCH 4XQNA 1ZA6B 1YEEH 4UNTA 4J3TA 1X3PA 1DQLL 4NN7B 3Q05A 2WWMD 3FN0L 1AIZA 2QADD 3CLWA 3MMEA 4G43B 1U58B 2DQCH 2VSDA 4NDMA 3RI5K 4ETQB 4PCSA 1WSST 1A4JA 2D4FA 3CDGA 3B1UA 4G8IA 3L17A 3RL2A 3CVIH 4BKLB 1RV6X 3KPOB 4DV3Q 3T77A 1A1MA 4FQHA 2OTWB 3M17B 4G7QB 4ZXBD 2BNQA 1ZSHA 3ILPA 1LE9B 3PIP3 1VFMA 5CINL 3ZE2F 4PJBB 1T03H 3MLXL 2IAMD 3QJZA 1I7TB 2APTA 1DQMH 3GZQA 5IJCC 4BH8B 5FO8B 1MIEL 1UYWH 2YK1H 2BP0A 1YHQA 1CLYL 3VFOB 1F77A 4AK2A 1XF5B 3ORJA 4X64Q 2HRHA 1NMAH 3KYKL 5JW4M 1MOEA 3U46A 2X6AA 3QJVB 5EIVA 1TCMA 2B63H 1MDAA 4JI0L 4JQXC 2BHZA 4AW7A 2VDMH 3HB3C 4J23A 3TO4D 2EDRA 1LV9A 3ETBJ 4MYWB 4DV3L 4OIAA 4WK0B 5AW9B 3D08A 2WXNA 4U3XA 4B3VA 2OQJB 1JV2B 3HI5H 1D7FA 4BBWA 3LKOA 4CGTA 2KCNA 3LY6A 3U2IA 1OCOB 4PJ5B 1FPTH 4R97B 5GS0D 1YNLL 2OX5A 4PWKA 3MRQB 3RA7H 4AQEB 1J5OL 2IC2A 1KTBA 5AG8A 1HTLD 4GAAA 3RVWD 3GDEA 2D3VA 1YSOA 4X3TA 2YU9B 5TQ2L 2ODIA 4L4TE 2W0LA 3QUYB 3HNSH 3K6NA 1U3HC 4HZAA 4V33A 4X64L 1OD7A 5FYKU 2ALWA 3SKNB 1BDYA 2Z9HA 3C87A 2X7LA 1T0PB 3FONA 4DR5Q 3GTLH 3HS0B 5GRVL 4NQCE 3HI6H 3S2CA 2LAGB 3GB7B 3GJEA 5KYWA 4HIJB 1B3IA 2CNZA 2OYMA 3HI1A 4LHJB 5M9OA 4IALA 5FYKL 4UOQA 1B4OA 2KZBA 4NN6C 2QF7A 3MA9L 4M1GH 5D4JA 4JPKH 5FCUL 2HJKB 4YBQC 3ARFA 3PNRB 1KJMB 1P4LA 4K3JH 4W9KC 1E7ZA 2JP1A 4N6RB 4J1UB 1HC1A 5ADOH 4UP8A 1Q8KA 3F5WA 2YPLB 4MD4A 2QJDA 3PY9A 4OJYA 1EHLL 1PD1A 1K8MA 3N43B 3OG6B 4JOIC 4EVOA 4NUJA 3TT3H 3OF6D 1GGIL 1O9WA 1S7RA 5A6LA 4I0PD 4OCMC 1YEFL 3QJXA 1G8ZD 1WD9A 5KW9H 4NQCA 3DSFH 3BT2L 5DJCB 4DR5L 3WEOA 2R23B 3ZE1F 2JK5A 2R4RH 2NXZB 3QUML 3STBD 2AEPH 2CHDA 3UAAA 3ZSSA 2Z64C 1ORSB 3FTZA 5B3JF 1TS2A 1YNTA 1OALA 4A93H 1ZGLB 4M5YH 3N44F 5HHOD 1WFJA 1CK1A 4YBLB 4HLEA 1XB6A 2JXMB 3MRRB 1U8MA 4LEEA 1B2TA 3TNMA 2MQGA 2VERN 5IT9c 1HOEA 2VR3A 5GGQL 4LGRB 4Q8BA 2CO7B 3EUDA 3DTXA 1STEA 4WV1A 2XC8A 3HE6A 4UU9A 2X42A 2YUVA 3QS3A 1ZEAL 3GMLA 3LEYH 3T0EA 4LDOB 4PLOB 1CGVA 4CMMB 4DPRA 1L9TA 1DVFB 1FP5A 2GVYA 3B9KB 3IFTA 4XX1E 4HJEA 3QUMB 3I91A 3QUZC 4FMVA 4IRSC 5DJ6B 5ITFB 1ED3A 3RWJB 4PV8A 4WSJA 1HCYA 2R4SH 3OHXC 3F2BA 1R3HB 4HH8A 4JM4H 4TULL 5FW8A 1O6SA 3TNNB 4ELME 4HKBA 4F7EA 4P23D 4Z7NB 1K4CA 1AG0A 3R7QA 4G82A 1UXSA 1MJUL 2E8ZA 1U4EA 3QEGL 4JM2D 3VFTB 4AYFA 4EBQH 5JIPA 1KABA 3NCYP 4A3IB 1T1YB 3UZVB 5DURD 1UH2A 5IBLC 2B14A 1AD9B 3K74B 3O11B 3ALWA 4G7VH 5C0FA 1BCPB 4J1MA 1W0VA 1JBJA 1I4PA 1CYXA 5F89A 2N49A 1ICWA 4G9FA 1DR9A 4DP1X 3QZMA 5I30H 4GO9A 3V4VL 2YD9A 4K3EH 4LSPL 3FXIC 2VQUA 4J3XA 4JFFE 2FQFA 3QQNA 2EYOA 2OJZL 3J80i 1N8OE 3DX1A 5ABAA 3ISYA 4I3SL 4KUZL 3G6JE 3D31A 4MS8D 4X99B 4I9WD 1BXUA 2AXWA 2H3KA 4XPHL 1BVLA 1J0YA 4FQ1L 1M1XB 3L3KA 4XP6L 4HKJA 4DCQA 1XF4B 3KXFE 4AMKL 5D8JL 4H13C 5HHQA 1IM9D 4JZJB 2GABA 3D50A 1I1RA 4BUQA 2IPTL 2HPOA 3ZE0E 1DJRD 2QDWA 4F2MA 4MFHA 5FV2A 5TDNA 4OLWL 2K78A 4Y4FD 3CV5A 2NY5L 2VB3X 5DT1H 4X4XB 3FCUB 2V3DA 5D71H 2XWRA 3DA0A 4EEEA 1JPSL 2YEVB 1MRFL 4U1KA 2VDLL 4K2UL 2Z0UA 4JANA 4P9MH 3VWKA 4MWFB 4C54A 3V4VB 5E6RB 2D0OA 4NQSA 3RWEB 3LXAA 1L9OA 3PQYE 1H3TA 4JZNB 4KD4A 1MJ7H 3V0VB 3KDFB 3MRDA 2M1KA 2JCCB 4HJTA 3IJ8A 1WIOA 2ZCKH 4WWNA 1L1OC 1PG7L 5GGSB 1SBBA 1GR7A 5DDHA 5DEZA 3V8OA 2VUMB 1N8ZA 1A0IA 5IGDA 2O5IC 1M2VB 5DTFA 1HI6A 3SYQA 2J1XA 3ZK0A 2GSIA 3G04B 4GW4A 1QG3A 1GYCA 2OCEA 3ENEA 3O9WB 4HJGA 1WFNA 2QZQA 1NC4B 2L55A 1AGFB 1EV2E 4ANXA 4HC1H 4XTRD 4EN3A 4RMVA 5EU6A 2NTFB 4KKUA 4YDJB 1U3JA 1EHXA 4PWHA 4LVOC 3SDXE 3OLDA 3X13B 3FBQA 2VDLB 3HNTL 3W39B 3W2DA 4LT7A 1LEIA 3QBTB 1WPCA 2XVGA 1KYOJ 1SJEA 2O26U 1HWGB 2C3GA 4EI0A 1HQMC 2OCCB 4HAEA 3GJFA 2X2HA 3LPPA 3IE9A 4KZCA 1ZLSL 3PWUA 3H3VC 1MCWW 1Y7VA 4DFHA 1IO4C 2NSXA 5C7XL 1BSIA 3BZ5A 5E1FA 5EPMA 2QADB 3BHBA 2E7LC 2X4TB 1V3LA 2ZAHA 3K4DA 5D3DA 1SHMA 1VFOA 2OXPA 2NY0B 4HXAH 1S3OA 1CC3A 1MPAH 2PUQT 5TJWK 4GG6E 4X6CF 5IT9E 1PYBA 2AQQA 4GN3B 1MCEA 4OUOA 4ZXBB 3FS9A 3LXCA 2D4DA 3SDXA 3IWVA 1DQDL 3CPWA 3WKQA 2PWFA 3CLFH 4BZ2L 2GIMA 1BGXL 2IAMB 3ET9F 3KL3A 4JLRA 2MFNA 3TOPA 3EO1A 5AYTA 3T2OA 5BCAA 2VNUD 4BBSH 5T1DH 4LDLB 1XZ0B 4QAMB 1ZYRC 8FABB 4L37B 1BMZA 3DV6A 1BQLH 1I6VC 1GUNA 4HKXB 4YHNB 1U4LA 4KMQA 3GSUB 3OMAB 3I6LE 4OQTL 2VLMD 2XBTA 4QY8A 4UDUC 3C8DA 2FB4L 2EKSB 4PHXA 2C4XA 3AW5A 5CGYD 1K73C 3MRPB 1I7RA 4QRTA 1Z5LA 5FM5O 3SKJH 4PPTA 3TO4B 4KXDA 1J1XL 1NCOA 2WVTA 4RSYA 5BOZG 2M2LA 4PEEA 4W6XB 3WD5H 1Z9FA 5CD5C 1MRCL 2P28B 1YEEL 1ZVSB 4NO2B 4WUUE 5D7IF 2Z6KC 2WO3B 1MVUB 1Z32X 5I17B 3MNVB 3VX1A 3QB3A 4WHTA 1FHGA 5DJDB 1IAKA 4Y5YB 2RAMA 1QLRA 1QYGH 2A9NH 2DQCL 3M4OH 3JTSB 3QPQD 4P5TD 2Y0SG 4Z7WB 4WFGE 3QZBA 1A1OA 4K3HA 3CVIL 2B2VA 3GTNA 2HT4D 2OWOA 2QDLA 2F19H 5CV6A 1TCRA 4AGQA 4ACTA 3K0YA 2A6HD 1KGYE 1F97A 5MENE 1WTQA 2WK2A 3PUYA 4QDGA 2HJLA 2QFPA 4CBPA 1T03L 2J7LA 4KUCF 3SHSA 1HCFX 2R0ZL 4XYOA 1T20A 2ZXBA 3EBIA 2DWEA 1DQML 1UYWL 1H9SB 2BSSA 5C0EB 2YK1L 4YHZH 4BYHA 2IADA 2QSVA 5EN2B 2IG2H 3TMEA 1UCBH 3NIGB 3VGHA 4MD0A 1NMAL 3MCKA 5KSVA 2XKUA 4TQUS 3BD3A 1SLXA 4NXKA 2OT2A 4HEME 5JHBA 2P24B 2VDML 1X65A 3BZFA 3HZYA 4GT0A 4X65Q 3FQRB 4IIQC 3CDZA 1AFPA 4LF3B 4PJGE 2WYTA 1HILA 1OP4A 1OW0A 2AAAA 3REWA 3P0YH 3UGXA 3HI5L 1W6LA 2CCWA 2G60L 4NRYB 4OCRH 1M6OB 3W11C 1FPTL 4N9TA 3P1VA 4XO5A 4ZS6D 2XXGA 4CADA 2EYTA 1R4QB 1KT2B 1X3DA 3I6GA 5HHOB 4PJ9C 1D5MB 1F8TH 2Z8SA 4CN6A 3BZEA 1J48A 5LMNW 4PW4A 1NLDH 4GAJH 2OMZA 2CNYA 5AZUA 5KVFE 3VXOA 3HI6L 3HBGA 3WTWA 2DNCA 5DLQE 3QEUA 4J28A 4XBGB 2LE9A 4ONHA 4BK8A 1QFUH 2A7BA 5ICXA 1JOKA 2WLJA 5DZAA 4X65L 1U9RA 1DQQB 1EEUA 2FJ2A 1QASA 2QVKA 4HKZA 1K8OA 2B63B 1M42A 2BZ7A 4QKTA 4YDVA 4G5AA 5EEYA 2HG0A 4IOFC 1N6VA 4KI5F 4M1GL 3BJUA 2A68D 2VDMB 4JPKL 2F1AA 2DQJH 3MWYW 5C4XG 3IPBA 4YO0B 2IHEA 5KWYC 1Z5HA 1A3RH 3D39A 4HSQA 4K3JL 5HGBB 5ICZB 2R7FA 2BWQA 4F7MA 2DY8A 3RGVA 1CQKA 5FDYA 3LSOA 2CBOA 5ADOL 3B7UX 4GG8A 4U1HB 3BUPA 1BWMA 3EYFA 3TT3L 2HTKC 4OELB 2NYZA 4JO2H 4C3HG 3CAMA 2N3JA 4RA8A 1JYNA 4H26B 1X3QA 1PZCA 2Q5BA 3DSFL 4QYOA 1J9TA 3K4ZA 5EUOB 5L7XH 5GAHC 1I7ZB 3L5JA 2R4RL 5IEKB 2NY1D 1U8PB 4IS6A 4WJ5B 2AEPL 3GTLB 1VQIA 1D7QA 5JHLH 3H6AA 1BJ1H 3IJHA 5AYUH 1HXMA 4W9FC 4M5YL 4OLYH 3VO0A 4KH9A 5I6PA 1A1NB 3JV6A 4EUPA 3GSNA 3FOMA 1X4ZA 5EC2A 5FB8B 1XPUA 4JRXA 2C7UA 2DY2A 3MRKA 1YMMD 2VE6B 3WHE1 3NK3A 3RVVD 2AVGA 2KEEA 2LAAA 4IDJH 4HHWA 4X0KA 2AK4E 1E4WH 5ESAB 4GS7B 1WYDA 4FFTA 1YVCA 2Q2IA 3I4NG 5C0BB 3ULVE 2K3TA 3BU2A 1PY9A 2HMID 5I6XB 3KGUA 3WKNA 3LEYL 1VADB 5KNBA 4YC2C 1CVRA 1IM9B 1MXGA 3CDCA 2XIIA 4DQOH 5EOTB 1PZKD 3K5NA 3GBNH 4Y4FB 2R4SL 4JM4L 5GRVK 5I74B 5J6GB 4A93B 1HXYD 1WWCA 1UNSA 1YJNA 1D7DA 1F1AA 2K6YA 2NUTB 3ISWA 3QWOB 5J11B 4B5EA 3W9DB 4BXXH 2XV0A 5T3XE 4EBQL 4MAYD 1FN4B 4PD4J 5GZOA 5L2KE 1PJ9A 2WYZA 3HS8A 3IBEA 1FYTA 3GK8H 4POZC 4AQAA 4G7VL 1HHHB 5I1DA 3ARUA 3JWNE 4A3EH 1NOLA 4JFEB 1NBQA 2QW7A 3MRGA 2BZCA 3H0TA 1PRTB 4W9CC 1BQHB 2BVQB 4B50A 5T1KA 5EH1A 5DC0A 5I30L 4K3EL 3FF7A 2GEEA 3KJ6H 5DGRA 3VDBA 2CIIA 5C09E 1L0WA 2WVSA 4ZW6A 4ZUIA 2IPKD 1WBZB 3ZL1A 3BP5A 4BFIB 2Z92A 5DJAB 3WOFA 3P1HA 4CJ1B 3RTQB 4DV0Q 1O7DC 5L2KA 1R3KA 1KJ2A 5GQOA 4OV6F 5KS9E 1JB7A 5AOIA 4NFBA 4P57A 3CHPA 3E2HB 4DSYA 4EN3C 5AAWC 3SKOA 3KM2A 1AR1D 3Q8AA 5DT1L 1CPUA 5D71L 3TA3B 4UQCA 1QILA 4LLYA 3O6LH 1HHIA 2XWEA 4P9ML 3CC5B 4X7TB 5I6KA 2BSRA 5D55A 2EDJA 2YWYA 2NY7H 3NXWA 1MJ7L 1GTFA 3V5KB 3BVWA 4WU5B 5KS9A 4DV0L 3FO1B 3FFDA 2ZCKL 5DK2B 3FT1A 3OSKA 4YEFA 2O6EA 4MIUA 1RZGB 2F8IA 2DV6A 1IL8A 1VQGA 4HN7A 2Y3NA 3CZFA 3L9BA 4XZUB 4JFOB 4H5SA 4PJ7B 1G7PA 5CF3A 4MTMA 3DI3B 3HC2A 5KSAD 4K5WA 1E27A 4XP4H 1BMWA 4HC1L 2H5UA 4PJBE 4YXKH 1D2OA 4HIQA 4FQXD 2AV1A 2ZXPA 2JJSA 1PPIA 5I66A 1EEID 1S9VB 1HQRB 3C09B 4FXKA 5BRZE 3D48R 4AKQA 1PQZB 3G71A 2GK0B 4MDIB 2XSCA 5E8OB 4AENB 1KJ3H 2V5RA 2AJZA 2YEZA 1URLA 2I60H 2OP4H 2ZM6Q 1J9CT 4D9RD 2IGLA 2A69D 1QP1A 5FV1L 1IMHC 4YPGA 2APVA 4ZZKA 2VY3A 3D6WA 1KB5A 5F8QC 5K9JH 1PGRB 1BVKA 4Y16D 1SY6L 1IAIH 1QLFA 1NMBH 3NIDE 3AZUA 3DARA 3BH8A 4HXAL 1AZQA 1MPAL 3O8XA 2K50A 3DKHA 3OMGA 3D4RA 2V2XB 1NFIB 3FQWB 4IUVA 3ETBF 4AV0A 3P75A 5HXMA 4PJ5E 4ID6A 3T8XB 1VQBA 1IEAA 1YN6A 1ZT1B 3A5VA 5SWSE 1IKLA 3IGAA 4A3LH 3HPLA 4C83B 2VO5A 3OR6A 2B2TA 3CLFL 5KUKA 2R7ZB 4U6TA 1KXTA 5BRZA 5JW5B 2E7MA 2B2VC 1ODUA 2K01A 3B9AA 1TLKA 3GXMA 3EYOA 4PJDF 5T1DL 1CT1D 5HVFB 1UXWB 5GGVH 12E8H 3QJHB 1FNFA 1F9QA 1NGXA 1PY0A 1BQLL 2ZM6L 4W4OA 3EN2A 1J1PH 4JFYA 5E7BA 4KJOA 1QVOB 5MI0C 4C1NK 4ABNA 1Y1WG 3GXNA 4IBTA 1MNUH 4ODVH 3M7NA 3BVDB 4AITA 4ADIA 4EI5C 4ZUUA 1AZBA 1U5KA 2M00A 2D7TH 2EADA 2XZQH 3SKJL 3UYRH 4FZEH 1YNTF 3AXLA 3WIFA 3IDMA 3PNWB 1O78A 5FA3A 1DN0A 2JELH 5D2LB 3WD5L 5GRUH 2QKIA 1ETB1 2XIBA 1FG9C 2XKNA 4FHBD 2O61A 1CLZH 4L3EE 4DW2H 3F2UA 3P73A 1QTPA 3II3A 2UXGA 5B3NA 2CD0A 1QYGL 2A9NL 3VI3B 1NBCA 2C9VA 2GJ6B 4YGVB 3B3IB 4C4BA 2P48B 2JA5G 1J05A 5DVLA 3QDJD 5MP6H 3CLEH 2Y2YA 3KR3H 4DERA 3U2SB 1IARB 4BBSB 1U8CA 3ARGA 3GXFA 1YRKA 2F19L 4ANWA 3WEBA 1P1VA 2DD8H 3D85D 2MCG1 1I82A 1WWBX 5TD4A 2ENBA 3L1GA 5ESQB 1HESA 1JZHA 3AMKA 2EY1A 4G1EA 1QOHA 5LCVH 4IRZA 5FYKE 4YHZL 3GXIA 3ZUNC 3L4VA 4F9LC 4L0YA 4UB0H 3PO2G 2IG2L 1A8JH 1UCBL 1NDGA 4IOAA 1CGUA 4H2CA 3KPRD 43CAA 1AANA 4N8X1 2A0LC 4ZX4A 4XVOA 3TX4A 5C0IA 2CWPA 4L18A 2NBFA 2I26N 1MHCB 1UE5A 1JZ3A 4HK3N 3RGVC 3M4OB 3AT0A 3ES6A 2WUBH 1G7MA 1X5KA 3PREA 4WHDA 4OCYH 3P0YL 4EI6A 3U79A 4OCRL 1YYCA 2NY1B 1XYIA 2CGYA 5MERB 1LYLA 4GLRH 1BO0A 1HIMH 2OMTA 1OO2A 1DM0B 2GAZA 1Y07A 2XCMC 3BZ4A 1D3CA 2IALB 1S9YB 3DUSA 4L4VA 3VQMA 2AZAA 1I8KB 4Z7NE 5TE7H 1IYUA 1I31A 1NLDL 3CE1A 1CSQA 4GAJL 3BWSA 4G2AA 3I9PA 1SNMA 1QA9B 2V5TA 2HT2D 3MRCA 3AABA 4XMPH 3WAJA 1R33A 1CHQD 1GKHA 2KBNA 1R5WB 2CMRH 3O6FA 4PGBA 1QFUL 4I89A 3FB5A 4BZ1A 1HAUA 1SMXA 5J12B 2VSMB 4RDBA 1Z2KA 4J3OG 4NRXB 5SX5H 3BKYH 4PLJD 1NDMB 1RJZA 1SVCP 2DQJL 3V5HB 3N04A 2B08A 1A3RL 4LSSH 3SQBB 4DN3L 3DUUA 3T8VA 4Z3IA 1ILQA 2Y7OA 1J0KA 3EYVB 4IGBB 1GZQB 1K2DA 1RJLB 3VNYA 3LVTA 4K5MA 5IHUH 5CBEE 3MR9B 4UTAH 4JO2L 4CKVX 5JJIA 1MAJA 4DNLA 2VLLA 3QFJE 3ZRSA 5C97A 4S11A 4NZDA 4N2NA 5FKAA 5L7XL 3KLAB 3OG4B 4XN1A 2X6VA 5E7NA 1GUSA 5JNYA 1MUJB 2A6IB 5JPMC 5AB1A 1IGYA 5AD0B 2Y3AA 2VC2H 5JHLL 5AYUL 2LABA 3LRSA 1WTOA 4OLYL 3ZKNC 4K6LA 1V5JA 3T51B 3HC0A 5I6MA 5KVEH 1CICA 3F7YA 1WGOA 4HJ1A 2Y7MA 3OB8A 5T1MA 2MHAA 4PCTA 3ULVC 1XB3A 2HP4A 2A6DA 3E6ZX 5LBSH 1R1CA 1JE4A 4DF9A 2HX9A 4PJ8C 3IN0A 3QJYA 1T5WA 1D9KC 3GBEA 4IDJL 3U30B 1FFQA 3VFRB 2Q2EB 1E4WL 2IPKB 1T22A 5GGSY 4O2CB 2CDFA 4G8EA 5GGTA 5H94B 1QLEH 4NUGH 5HPMB 5GADC 5KANG 4JZOB 3VRLE 1PZ3A 5F9JA 3QRBA 3P9LA 3K7UC 4GQPH 4NNYB 4OR1A 4DQOL 5CZRA 2YAOA 1DVYA 2VERA 4WTXA 3BIAX 3PWNA 3GBNL 4PMWA 4DP0X 1KGCD 2ZTDA 4B9GA 1G6RH 1L0QA 3T1YQ 4LL9A 5IGEA 2E74C 2WYHA 3MV8A 1QATA 1DEDA 2X2UA 3CSYA 2X6MA 4CVXA 3GMOB 1T0MB 2CVRA 3JWNC 3F7VA 4U6YA 2Y06H 4FKHA 3EHBC 1OXUA 1SJHD 1UUNA 3CMEA 2N01B 4KHXH 3LQZA 2GVBA 4ZODA 1SQ2N 5AKTA 3GK8L 3CXHK 1X9QA 3D09A 3NE5B 3C1EA 2JA8H 1A0QH 2X6UA 5I19H 1KY6A 5LNDA 3L3HB 4YFLF 2VMDA 2XPZA 3S8GB 4UBDD 1IU1A 2BWDA 5F1KC 4BGLA 4EIBA 1CE6A 1JPGA 1VMPA 5H1SE 1GW6A 3MRJB 3KJ6L 4F27A 1ZV5A 1KNOB 4S0HA 4KKAD 5KSAB 1XCQA 3T1YL 5CBAB 1I85C 5ID1B 3B43A 1T21B 2X9YA 2EYJA 2ICWJ 2ZXRA 3CFJB 3UG4A 1KIRB 1NIBA 3CFDA 3D18A 1PZID 4U0RB 4RGND 2XN2A 2QZ5A 4LEXH 4TVUA 1ZXTA 3MBXH 5JAVA 1BFOB 2IH3B 4EDXB 2JJSC 4FFWC 2PQAB 5FYJH 2QBWA 1N0XH 4QGYA 4YCUA 1BNZA 3PHQB 2Z0BA 2HVKB 3A4DA 1ZE3H 3T6ZA 5DHVB 4A3EB 4QLRA 5DQJA 2A74A 3O6LL 5LDSA 3Q5YA 4AYSA 1U8OA 3B7RL 4TKOB 3WMSA 1JPFB 3OGCA 3FB8B 1T3FA 1L4IA 4DNIA 2NY7L 1OAQH 4YDMA 4PV1C 2OSLA 3J80c 1GGUA 3Q3GB 5IMOA 3ARED 1B4RA 1SEQH 2XQ0A 3KUPA 2BM3A 3SGKA 1SEBA 2CHZA 3O8XC 1G7QA 3FOLA 2XZAH 2A77H 3D1MC 1E9QB 3N41B 4OLEA 2B2UA 1CXHA 1I1AC 1VERA 3NZUA 2XVSA 3TBVB 1AP2B 2UXTA 1SXCA 2Z31B 4XP4L 4XDXA 4YXKL 3A5ZB 1C1EH 2R59A 4P5SA 4WU7A 1F3JB 1WAEA 2DKUA 2P5WE 3W0WB 2A9BA 4FDWA 3PV6A 2G3ZA 4NQQA 4M93B 3F64A 4JCMA 4LCYB 1G5GA 4TNWK 2ZSVB 2H7WA 3C5JB 3IE4A 3NIGE 5CWSB 4MZ3A 4RFEA 5FUZH 1T83C 1E4XH 1CFBA 1KJ3L 1XVSA 4KX8A 4E9YA 2EVIA 5ABZA 2OP4L 2I60L 2EO1A 1J8HD 2ZUXA 4RGMB 3APDA 4MNGB 2NN6H 1WHOA 1R4PB 3HOXG 1RZKC 1HYSC 2AJ3B 5K9JL 4R97C 1JCKA 1IAIL 4M00A 4PMBA 1NMBL 1TVDA 3KWWB 5DHDA 1NCAH 3TVMD 5I73C 2KECA 3F3HA 3QDJB 1DSYA 4JFZH 2ZUTA 4LBAA 3NJGA 2RD0A 3QJSB 2FAUA 3DX4A 2P5WA 2WQAA 5JORB 4FDBA 5I28A 1HH6B 2F5BH 3MU3A 5CSZA 5T1LA 3FQUB 3O2DA 3HS0C 5HVHC 5I0WA 2FL5B 2Q3XA 2H41A 3LKNB 2UXDQ 1ZA3A 5I1EH 1PDQA 4NMZA 3D12B 4JQVA 4AXWB 4TLUA 2F0DA 5GGVL 12E8L 3L3JB 5K1VA 3D0AA 3KOJA 2BVOB 2E9JA 1G7JB 1P84J 3NCEB 3ZKXB 5IY5B 4ODVL 1CL7H 1MNUL 4ORZC 4PG2C 2H45A 5FYJD 2FJUB 3BCDA 2QR0B 2XZQL 2D7TL 3PHOA 3UYRL 1HS6A 3L3DB 2E6QA 4FZEL 4AGPA 5F2FA 5EG6C 1TQUA 4DR7Q 2HLEB 2W81C 2EDMA 4TQ8A 5IOPB 2X4SA 4Q6IA 5E8DH 2JELL 4FX5A 5GRUL 2B1HH 5I1IH 2V33A 2VLRA 3N50A 2WO4A 4LEOA 1M71A 1CLZL 4A38A 4DW2L 1PX3A 2UXDL 3PWPD 3TP6A 4LLVB 5LG6A 4GLXA 3ZL4H 4MX7A 2V3EA 3VXSA 1OLZA 5ACMA 4LF4Q 1Y1VG 3MKGA 1EXUA 5MP6L 3CLEL 5EUOE 5FECA 3KR3L 4L8SA 2F0GA 4YBLC 2VZAA 5B21A 4PNYA 4L3CA 1BAWA 1V3JA 3BO8B 2NLJB 2DD8L 4ICXA 4XNMA 4PGJA 3LNEA 2VL6A 3GTKB 1GVPA 1F4XH 1TWAH 4H02A 3O13A 2DM2A 1TKWB 3U50C 2MQCA 2VOTA 4HD5A 3PL6C 3Q8EA 4DR7L 4KKRA 1BOYA 4APQB 1YEWA 1HINH 2VTFA 2OTJA 5LCVL 2OJEB 5BVJA 4XBPA 1ZHLA 4PJAB 1DVXA 3VYSA 4UB0L 3O6FC 3X1EA 4GRLD 3C6LD 3NG5A 4F7PB 2ZCZA 1I3RA 1V1OA 4U49A 3T2PA 5I1LA 2Q20A 4QIWE 3ROLA 2BOSA 5K9KA 3OHMB 4PJFF 4LOFA 2FQDA 4LIQE 1BYNA 4Z7OF 3CU1A 5DO2D 5C0BE 4LF4L 4U1JA 4YVNA 1PYSB 3B9KC 3UAJA 4XCNB 5L8LB 4IPDA 4XN7A 1WYJA 2WVVB 4NI6A 2WUBL 1PEWA 4HDIA 1OXVA 2Z6FA 4OCYL 4K14A 2K70A 1YAZA 3DROA 3PPSA 4FF2A 2WKDA 4DV1Q 1DCLA 2V2WA 2E6PA 1HIML 3J80E 2OXHA 4YSTA 2WZ5A 1BBDH 1RU9L 1TVBA 5FKAC 3QNFA 1FZOB 1BCPC 1H3GA 3QHTC 5TE7L 1GJUA 2C1OB 1LD9B 4OZGB 4P2QB 1IKFH 1RD9D 3MNWA 1OOWA 1NPNA 4PI2A 2W5PA 4RWHA 1ZHBA 2D9QB 1PYWA 3P4LA 2CMRL 4WVRA 4XMPL 4LL4A 4YHKH 5IJVA 2DWYA 1ZGLP 4KI5D 4JFEE 3HC3H 3BKYL 4ZOBA 2N78A 1RHPA 4K5NA 1QQDA 2EIZB 4LSSL 5TDOA 4QOKB 4DV1L 1BVNP 1UT1A 2R39A 5T1GA 4GZYC 4JK0D 3PGFH 1LEKA 4MJIB 5EPLA 2WLLB 4H8QA 3SE0A 4UANA 4LLQA 5IHUL 3DIFB 3VSQA 3QORA 3DC0A 1D5XC 3AT9A 4R2GB 2RBMA 4G7ZC 1C5DB 2PZUA 1AVAA 4DH2A 4UTAL 3VD4A 3BISA 4NYLB 1EERB 1KTJA 4IMLB 5A2IH 4J3UA 2KCMA 2NX5D 4ABUA 3K6SB 1KBWA 1HA6A 4LCWA 4C3HH 2ITCA 3AB9A 2VR9A 4XTCS 1KTLA 1UKTA 4AG4H 5D1ZD 3LH8A 1AE3A 1C12A 4B9FA 2VC2L 2E9WA 4A3GG 4XHJC 4FN0A 3HZ3A 3KLHC 4DIXA 3OKDA 5DHEA 4HJJH 5KVEL 4N2FA 4NO0B 4QAWA 1MHHB 4BZYA 5KOMC 1YPZE 1MBYA 2YXWA 1XR9A 4NQTA 3MHBA 2ZUYA 5JQIB 3J7AF 3MV7B 1CDYA 2L04A 5LBSL 1LE5A 2Q10A 1F0LA 2YMOA 4V0BA 2CZNA 2EY2A 3DGGB 1STGA 4YIQA 3VR6A 1UJ3A 2F68X 3T2NH 1MEXL 1XTLA 4MRCA 1JNLH 4DP2X 5CEZD 4PYGA 4R8WH 2BSDA 3BRFA 1QLEL 4NUGL 2Z91B 5E00B 5I6YA 2L7QA 3AS1A 4CVZA 4PB9H 5IK3B 3LQAC 2DMGA 2ZIDA 3NFPB 3C08H 5C0NC 1JOOA 2XXMB 4MHHG 4PJ7E 2Z3FA 1YJ9A 1B3QA 4NS0A 2GIYA 2EYRA 3G9VA 5E6SB 1QG7A 1L2FA 4UAIA 4KK5C 3IJ9A 3TBWB 1YPZA 1I1FA 1G6RL 4TVPD 2ZYIA 3B2XA 2IANA 2VC2B 5IQ7H 4CC4C 2Q76A 4BY7G 4GLRI 1EQTA 3GGWA 1GIGH 3G5VB 2F0IA 4ZDHB 4DA2A 2QVTA 4ENZA 7CGTA 1JZEA 2Y06L 4N1HB 3RR5A 1VCIA 4KHXL 3H53A 3UTQB 1Q46A 2GHWB 1KLUA 3VXMD 3ETTA 1RH8A 4XAKD 3M7OA 3W5OA 2PPBC 1OTTD 1A0QL 2BVTA 3AREB 3BVVA 3EAKA 4BSVB 5I19L 3S34H 2BZDA 4P49A 5BXFB 4G7RB 3VDCA 5BUPA 1QLEB 5LAXA 4OZIB 1GGBH 1CFSA 3BPLB 1KGJA 3LNDA 2ZONA 3PXJA 3N91A 1SFHA 3CPLA 3QXVA 4KJQD 4TOYH 1NBVH 1XFPA 1FFNB 3BFWA 3HBPA 2FYYA 3CHRA 4HU2A 1SDAB 4HFWB 4FQPA 1DJYA 1KBPA 4F8PA 3NGBC 3UAEA 2BX5A 2Y6TE 3RUGB 4UYPA 5GGRY 1VKXB 4S1QH 3FQ1A 2L4NA 1G6RB 4FI7A 1KBBA 3DURA 2B2UC 6PCYA 1AIFB 1C7TA 1H9DA 4EN2A 3TZVD 5AVVB 4LEXL 3V0HA 5J13C 3CSBA 3JAMi 3EFOB 3MBXL 2WZPD 1RLBA 3WS6A 5FYJL 4Y52H 1H8LA 3OXSB 1J8HB 4IBLT 4KJYA 1N0XL 4ZW7A 3RLSA 3U6XA 3VRJA 1FORH 2YFOA 3DV4B 4B9CA 4D0CA 2JA8B 1E28B 3OAYK 3KHOA 3ICEA 3LRHA 1R4XA 2FLBT 2W60A 2CRMA 2VNCA 3FHEA 3DEPA 4IRJB 4XRCA 4YE0A 1HT6A 1MSPA 3SJVD 3TVMB 2X2JA 5IWLA 3IFOB 3PWLB 4P4RA 1PH2A 2BNUB 2DMCA 4PJEA 1FDLH 5D1XA 5GJTH 1OAQL 4O2FB 1G6VK 5GGRA 2HG5B 3EG9B 4I9XA 1PFBA 5FF6B 2GSGA 1ZV2A 1XH2A 4S1SH 3I3BA 1OPGH 3GLZA 3PUXA 1HEZA 3FDWA 1G7HB 5TF0A 4MCYA 1PCXA 2XZAL 2A77L 1NGWB 4JL2A 4YDKH 4EUPB 1E2ZA 4Q0XH 3QI9D 4R96B 3SKMA 1IGTA 1C1EL 1II3A 1WAPA 3U9WA 3K71B 1KLFA 1ZT4B 4RGOS 3QIWB 1IE4A 5J56B 3A56A 4LUOA 4CDFC 1NJIC 3NJJA 4I2XB 3EGDB 1CO1A 2RCNA 1DBAH 1DD2A 5MEPB 3W56A 1GOGA 1KYDA 4UI2A 3C2AH 3NJNA 3QHZH 5FUZL 4BFOA 1E4XL 3ZTNH 4YY3Q 3J81i 1S4IA 4KK8C 2D0HA 5D65A 1V3KA 1C5BH 3CZGA 4G7SB 5FOBA 5H8DA 1PH7A 4YHHQ 1HR0W 1J86A 1P6FA 4Q9BA 1NCAL 1RL1A 4JFZL 4WO4C 1A3ZA 1D5MC 2Z9TA 4NNXB 5CV8A 3GTMH 1B50A 2IWKA 3SYCA 3ZTJH 2PI2A 3UO1H 4DO6A 2A9MH 4ZAKD 1D6EB 3FTXA 1AP0A 5BZWB 2F5BL 2FUQA 4FNUA 1AQMA 4G6KH 3OYYA 3OOCA 4YIJA 2AQPA 4N6QA 5CCKH 5I1EL 5L6YH 1IXRA 4CDEC 3TRZA 1ET8A 2DJUA 4GOSA 3VFVB 1DEEB 3HUJF 3EOAA 2B3GA 1QO3A 5AB0A 4YY3L 4GRLB 3C6LB 1H19A 3T1HQ 2IFFH 4XNBA 3ARTA 2J73A 1WS8A 3F12B 3MRFB 1CL7L 4M4RB 4ADJA 1VENA 4PRDB 4ZQ3A 1N0LB 5DC2A 4YHHL 2ATPA 1XSIA 3VFMA 3IGUA 2FX7H 5BVJB 1MRDH 2O5ZH 1OGAD 1Y1WH 1CKNB 1AO7B 2NZ9D 4QL5A 3NP4A 4P74A 2VQ4A 2HDMA 1MLBA 5E8DL 3B6SB 1D5ZA 4HGWA 1AKJB 1NAMA 5I1IL 1VQDA 1GS7A 2GFBA 1AD0A 1JWSA 2N7BA 4NQVA 3TPUA 3QEQB 3UX9B 3UPRA 1YNXA 3EH5B 2CIKA 1GD7A 1N70A 1GZPB 1ND0A 3L0OA 1L3WA 1DL7H 5BZDB 1ZDQA 4KGLA 3C1FA 2IX1A 5GRJH 4MTKA 1RZIA 1X5JA 3T1HL 1EL0A 3JSSA 4X5XB 4A3JG 5EBLB 4JHZA 1FSKB 3GHBH 1LNUA 3VXPB 4GOPB 2F53D 2NUPA 4BWWA 2GITA 4Q2ZA 1F4XL 1XGQB 1JZ7A 1HE7A 3PYCA 4HJSA 4E9WA 5I6LA 1TT6A 1HINL 3X1NA 4B9XA 1KWKA 1HAWA 1JPST 2IH1A 3CVBA 3S5ZA 3C60D 2GBTA 4YAQB 3FU7B 1RPQA 5I6XC 4GEIA 1CDJA 3SGJA 1UH4A 2MKLC 2ZYHA 3Q1EA 5CJOH 1PTOH 3PDGA 2OMWA 3MXWH 3EJQA 1GUGA 1K5NB 3TBCA 3DETD 3NJLA 3PO2H 4JY4B 5D2NE 1CQVA 3ZJAA 5IGBA 4N87A 4PJHA 1U21A 3IPFA 2ZNXA 3V6OE 3ZTCC 5FWQA 1U8JA 3H9HA 4R4IA 3M88A 2CDEB 4FG4A 1JOIA 4FHJA 4PBDA 2NX5B 5EF3A 1SOQA 4X6EB 3O45A 3QORC 4WK4B 4APXB 4I5BB 3UO8B 5IREA 5SWZD 5D1ZB 3D3VD 2Y0SB 1KDJA 2X40A 1S8DB 4GKZA 4DOHE 4ZUTB 1BBDL 4X6DE 1K4DA 4DKDC 3BLKA 1XIWD 1TWAB 1M05B 4GNXB 1JB3A 3DIDA 1UZ8B 2VW6A 4L8BA 1OKEA 4M7ZB 5EZIH 1H3UA 1PG7W 1IKFL 2CCZA 1XHHA 3DX6B 2JKJA 1PRTC 3SDAC 2VLJB 3CDYA 5IR1B 1AG6A 5DEJA 1CGSH 1KAWA 5IP9H 2Y25A 2E9GA 3G5YB 4N0UE 4YHKL 3FB6A 3P77B 4AIMA 2YUZA 3HC3L 2V5MA 1T5KA 4QHMB 4FFVC 1H15B 3BSZH 4OAWA 4PREA 2QQLH 1CL7I 4U05A 1V8QA 4Y2DD 4DKEH 5ESVB 3RTQC 3ZN6A 4ZNCD 4Q52A 2YQ2A 2FYVA 3DRQA 5EKIA 4J3OH 2UY7B 3F84A 4PQXA 3PGFL 3ARVA 4POYA 5ACZB 5CBAE 2EYFA 3E2HC 4H8UA 3BSHA 3HKSA 4NQED 4DGUA 2LLNA 5EU4B 1ACZA 3D33A 2WJ7A 1QFWI 1EEFD 5ELCA 5KYYB 3TA3C 4N0UA 2AK1H 4PY8J 5IGXH 1T1WA 4X8XA 4RRPG 3KPNA 1WIPA 3RGHA 4AG4L 3K7AH 4K7PX 4LVNB 2V7HA 3VXMB 4WJWA 1I4QA 3QXDA 3G5ZB 3SCMD 5D1ZI 1P7HL 3OJDB 2AXFA 5E9NA 2XBDA 1CXFA 2ZTBA 4UIKH 2LW3A 4PZ6A 1EQQA 4NNPH 1AN8A 3TP7A 1IC7H 1HH9A 2NR6D 5C0JA 3L4CA 4ZMQA 4LJZC 4PWFA 3T2NL 1R24B 3L4UA 4LOUD 5C2BH 1T9HA 5DJXB 1JNLL 5C0AE 3S48A 3AU1B 3HOZG 3GMNB 2Z8RA 5EEWA 4ZUVB 4YWKA 4PB9L 1LP9F 3U6RB 2VKWA 1IFHH 4OFIA 3QP3A 3C08L 4TSSA 4J39A 2HFGH 3S2HH 3O4LE 1RF2D 3QO0B 5CJXC 4R1JA 4N0FA 3DTDA 3TFKC 3C09C 3F58H 3DOHA 2O6FA 3QK0A 2VQFQ 4LLWB 4OLXH 4LAAA 3BP4A 2IAAC 4QRRD 3W0WE 4GI9A 5IQ7L 1PAZA 3QIUA 5L88H 1OZTG 4GINA 1CF1A 3TP4A 1X5LA 1GIGL 4QHUB 2ZOTA 4Y9CA 4GSDH 3SJVB 1KJVA 1P2CB 3ASWA 2BOBB 1AHWB 2B2WA 2ZYSA 1A9BB 1EO5A 1CJYA 1Q9WB 4O1NA 4ZTPL 3V2TA 1O75A 4QRPA 4E5XB 4F37K 3OM3B 3S9DB 2DQEH 4QHKI 4TSCH 2RB8A 4MNGE 1ASYA 3S34L 2ZTEA 3U48A 4OF7A 9PCYA 3O4LA 1BXXA 1WTVA 2DKMA 1F3DJ 1GGBL 2VISA 2ZOKA 3GSXB 3ZR6A 4QRFA 3K72B 3L9AX 2V5SA 4AUYA 4TOYL 1U8KB 1NBVL 1UC6A 4WTZA 2VXUH 5CU5A 2VQFL 2QPUA 5ID0B 3MREB 2W38A 4HQQH 3HOVH 4J3OD 5IMLA 2C9QA 2CO6A 2EZ0C 5CS7A 2J8OA 4G9DB 4S1QL 3IJEB 4Y1AA 3T8MA 3QJFB 3AU0A 3H15A 3RFRA 1VPOH 3X14B 4UUJB 1J10A 3JV4A 3PIQA 4QHNA 1JORA 1LM0A 1VA9A 3AGWA 3IDJB 4OFVA 3TIDA 4WAFA 3KCPB 3E38A 4TSBH 4BD4A 5KYUA 2N56A 1BYPA 1FORL 2B15A 2X4UA 4Y5VB 5JA8B 4TUJA 1IHZA 4APVA 4W4NA 1SLWA 3FHAA 3WU1A 4Y4HA 1U3YA 3MBEB 4TL5A 5GRXG 3HHMA 1J11A 1SJMA 4IW4C 2FEEL 3ZTDC 1M6UA 2EJFC 1FDLL 5GJTL 4XNDA 3EGSB 3QISA 3BI9X 3A8KE 5D1QD 2XN9A 2HVJA 4YMPA 5D3IB 3IAPA 2BVPB 4UM8A 4AE1A 1RZ8B 2K75A 2ZP8A 3BSGA 4S1SL 1OPGL 5EZJB 4XH2B 2PZWA 2P26A 3PGDA 3DPBA 3ATFA 3AFQA 4D2NA 1SN8A 2MOQA 2IPUG 2MQ3A 4L8JA 4ZZFA 2EDDA 5GGVY 1AXTH 4YDKL 1PD6A 3IL8A 4I0CC 4Q0XL 4EF3A 3WSQH 1EVUA 3MPCA 5F1IA 2AGJH 3UP6A 5LKNA 1AZPA 2KC0A 1YEGH 3L3OA 2YD2A 3N0AA 3U9OA 1BBJB 1DBAL 3DX7B 3FT4B 3OIPA 2HFFA 1GGYA 1QVFA 4L3AA 4OFYD 3MZ5A 1TOXA 4JDTH 4HOMA 3C2AL 3ASNB 2IIJA 3QHZL 1LO5D 1KL9A 3ZTNL 1JTPA 3JZYA 4W1TA 2EIBA 2WV6D 4BFJA 1DHKA 1C5BL 3WEAA 3PIOA 4ZOAA 1VGEH 4X5WB 4D0DA 4QNPE 3VR4A 4XCFH 1E50A 4GQ9H 2ADIA 5DFWH 3EJPA 3FT9A 3U2JA 2IDTA 4OGXH 3PAZA 3UO1L 1R75A 2A9ML 5MHSE 2ADYA 3IJ7A 4L1HA 3UBXI 4QJ5B 4G6KL 5IQ9B 3HE7D 3HRPA 3NDZE 4ZPVB 1SJVA 4NZRH 5CCKL 4HFUH 5L6YL 3GFUA 1A22B 2X89D 4OZGE 4P2QE 4NCDA 3C60B 3T13A 1VACB 3GMQA 3AITA 2E27H 4MQXD 5J7CC 1QR1B 1CD8A 2IFFL 1XT5A 4XNXH 1U2CA 1AMXA 1YY9D 5DFVD 2ICEA 2OEOA 4IGBC 2Z1PA 4G3YH 3IS1X 2H0FA 2AKRA 2FX7L 1I9JH 1MRDL 1NOFA 2O5ZL 2P1YA 3LN5B 4GSUA 4Y4KA 5DD3H 3SGJC 2V17H 3S3BB 4YXHH 4DAPA 3OKNB 4QOKE 4LSTH 4JFXA 3BPNB 1JGEA 4H8PA 3ZYZA 5IB4A 5LMUQ 3SIKA 1XGTB 4J12A 3GTMB 1WHPA 2FEEI 2KL6A 3CC1A 2VL4A 1NAPA 2XWJB 3NWSA 1PLCA 7PCYA 5KEEA 3CCJA 1ZTXH 4JO3H 2DQFA 1DL7L 5GRJL 5C0GB 3S4SB 1KTDB 1F2YA 1QI5A 4AH2A 1W72H 3ELAT 5IROA 1MHEB 1IGCL 3GHBL 5JLZB 4U4IA 1Y1VH 4YNYB 1LDPH 3KPQA 3KW7A 4MCMA 3CHXA 5J9PA 3OKEB 1STBA 2P52A 2WCSA 3QXWA 4HXBH 3AAZA 4N5ED 3NP3A 2H26B 3RIFF 3U30C 3FVQA 1E2VA 2AP2A 2EDKA 3VJ6A 5D2NC 1E42A 1BZ9A 1EJOL 1X5GA 4JDVA 3GRWH 4Y2DB 3MTSA 5LMUL 1Y1WB 1AZCA 3MV7E 3WOVA 5IHZA 5AENA 3V6OC 4AYBE 3GD7A 2NY2D 1EY9A 1FH2A 5CJOL 2CRYA 2D7NA 3MXWL 1P4BH 2RF4A 4O5LH 2WXHA 3ULPA 3MUGA 4MTNA 4D9LH 4A2MA 1RUAH 1XBRA 1JE5A 1AYRA 1KIUB 3R8BA 2ROYA 1HWWA 2ZUSA 1JWUA 5GRWA 1GZHA 2BERA 1G9EA 1JWMB 3BESR 2OYLA 2NQDA 5D9SB 5EF0A 4LQ1A 2IWEA 3IXTB 4B96A 1G0YR 3E0GA 3F6JA 5HHNA 1Z6JT 2D3LA 4RMWA 5D6DA 2WAQA 4C3JG 4L3FA 3HMXA 2D7PA 4WW1A 5HJBA 4AYBA 3QOJA 5EZIL 5C6WH 3UTPE 5KVEE 3UZEA 1CGSL 1SHSA 2Q2UA 2K9UA 2VQ1B 1TO5A 1UGKA 2W80C 1PTOB 3H0GH 3ISRA 3ULAB 4XT3B 3KPSA 4N8VG 3PO2B 3UCQA 3BSZL 2QQLL 3IXAB 2NW3B 4FLHA 4BSWA 4W81A 4DKEL 1JK9B 3I02B 4K0KQ 1EZVX 2YFNA 3BWUF 4A39A 1P6AB 3EO9H 1C8QA 4U0RC 2RGSA 4F57H 4UDTB 5FDWA 5DO8A 2EYSA 4LLMB 5CJBA 2XT1B 1DZ1A 3MJ7B 3HZKB 4GO8A 4DR6Q 1CK0H 4L8DA 3RNQB 5I8CA 1OSYA 4KI0A 4LNRA 4AJWA 3DX9B 3V7AG 5A1AA 1D8LA 2AK1L 3AY4A 3AG2B 5IGXL 3NBHB 4HW6A 4GFXA 5DU7A 2G9DA 3QNYA 3KS0J 2APSA 1BM7A 1QHPA 2XPGB 3QIUC 3I2CH 4FKEA 2LFNA 3WFHB 4DK6C 1FGUA 2YMXH 4JPSA 4NLHA 3VFGH 1ZLWH 2Z4IA 3U0TB 4LCCB 4I4WB 5AW1B 4K0KL 1BAGA 1E24A 3RPBA 4MB1A 4JHWH 4UIKL 4MXVF 4A3GH 1FZJA 3B9EA 1IEBA 3FTGA 4PRPA 4JFQA 3SOTA 2R9HC 2HLFC 4GIPD 4NNPL 1M7DA 3R2TA 1IC7L 2X6CA 3HCVB 3Q2NA 1WWAX 4TQEH 5C2BL 4GJTB 2X4OA 3QUXD 4W6WB 2E4FA 2KCCA 3O2VL 3FTSA 2Z31C 4DR6L 4YSAA 3POHA 3RDTD 5I1AB 3KVQA 3QWNA 3HZVB 3H6MA 1H3VA 3RTLA 1IFHL 4QPEA 5LGHH 3SO5A 4NBZB 3I4LA 4JFPB 5I71C 3O3DB 4K9EH 2HFGL 2Y5TB 3QDMA 3TJPA 3CFTA 2EOTA 1WF5A 1IQDA 4M93C 1HZHL 1PL3A 1LMIA 3F58L 3US0A 3SD2A 1A7QH 4OLXL 3K7AB 1T7YA 1RUMH 4KRPD 4L0ZA 3UDFA 4CKQA 4LU5H 5CR3A 4JGUA 4QRAA 1A2TA 1CBVH 4FXGA 3S9WA 5EU5B 4JC0A 4I2XE 2XBZA 4RGMC 1M8AA 1ET6A 1UWGH 4RMFA 3G3LA 4GRWH 1RUPH 2F0EA 4Z7VE 1CKOA 3DECA 1MWOA 2BS71 1MI5B 4P5KB 2Y6SC 3MJ9A 2VM9A 5F0JB 4OZ4B 4TSCL 4UT6H 5LGJA 2JKNA 2MIZA 4ECNA 2BS8A 2ALYB 1DJZA 2QL1A 5HYJE 2DQHH 3AS3A 3I6KA 4QXTA 2NT1A 2ADJA 1D1KA 4LHQB 3KLDA 4ISVB 1IL1B 2VXUL 3EVQA 3UTTD 4N2OA 4HQQL 3S2HB 3SE3A 4EE2A 4HWEH 1EU3A 3KL0A 2DWDB 1KENH 5FIEA 5DJYB 3SN6N 2BSCA 3LX9A 3GTJH 3RHWF 1OQXA 2ZD0A 5DK0B 4Z7VA 3KDMA 4L5FH 1VPOL 1XTDA 1M57B 1P9MC 4HCFA 1W8NA 2DWTA 4BHUA 3MRNB 1V1PA 1A47A 4UAOC 4A1RA 1HNWQ 2Y5QA 2J4WH 3BC9A 3LNIA 4KKPA 4N5UA 4AIXA 3K5OA 1LO5B 2VR8A 4TSBL 3NMEA 3MRHA 3S5LB 1F11A 4DUXA 2CJTA 2YKKA 3ZU8A 3LIZA 2KUTA 5SWQA 3GTPB 4IHOA 1ACYH 4U673 1PTZA 1RCYA 3B37A 2E86A 4XMLH 2VL5B 1AO7E 2NYKA 4KMTH 4CBZA 4F7TA 3T16A 5GSVB 3OTTA 4X9YA 1TJGH 3KYMB 1T04B 1DZ0A 4FP8H 4DVRH 4AKOA 1FL6B 5JDSA 1OP5H 3HOVB 2MNUA 4OUUA 3QEQE 1LO0H 1JSYA 2FZ3A 4HUXB 1HNWL 2EYHA 3EZ8A 2ZUUA 4LPXA 3RX8A 3KYOB 4PJHF 5CZKA 4APQC 4JI5Q 5IG7B 4BFEA 1VQ8A 3BXNB 1PVOA 3APMA 2QGEA 1EQRA 1AXTL 2XICA 3JAMc 2DYPD 3CZEA 3VGGA 3FC8A 2AQ2A 3WSQL 5EHFA 2AGJL 2ZICA 1K6QH 4JRYA 4WENB 4L0PB 4I13B 1YEGL 5KANI 1TXKA 1ZANH 4PRHE 1NIFA 4UZUA 4DVBB 4BWGB 4O02A 2TMPA 1J0ZA 3GS4A 3Q5OA 2UXFA 3OKLB 1UD3A 4JDTL 1VAHA 1QRKA 2ZX7A 4FNTA 1UE7A 3MAQA 3CBRA 3D0LB 1NEZA 2G0LA 3RZCA 1ZJBA 3OIQA 4XP6H 1UASA 1ZPLA 4Y4KC 3HRZB 4HOXA 4IHBA 1X6OA 2X6GA 1EDHA 4JI5L 3FW6A 1NAKH 4XX1G 4XCFL 5HPOA 1HYRC 4GQ9L 1NTGA 1SYDA 3ZT5A 4A3CH 3BAJA 1AY1H 3OX8B 4ZMAT 1UE1A 4OGXL 1ML0A 3QQ4B 5FGBC 4XR8C 1T5XB 1F6LL 1G1CA 1QFHA 2BHFA 3M17A 4LLUA 5A3IC 3HW7A 5MEQB 3EW3B 4TNVK 3P2DA 4POUB 4HIIB 2G5RA 1E4HA 1S7XA 4NZRL 4HFUL 2MTPA 4DV4Q 5AEAA 3BZDB 2NNFA 1I7TA 5CYUA 5IROC 5JOFB 4FMKA 2F0TA 5B7MA 1AHKA 5JPNA 2E27L 5E6ID 5DD5H 1QRNA 4XNXL 2NY2B 2F03A 43C9B 1E1OA 2PW5A 2AEWA 4L2LA 4UOW0 3EGXB 4ZNEA 3AGVA 3B2UD 5FKPB 2ESVE 1ES0B 4QCLA 1JTOA 4G3YL 2EUXA 4RX4D 5HGHA 1XGUA 1I9JL 1TTCA 3FO2B 3OPUA 3VW3H 5DD3L 3PRZA 4R2GC 1ROWA 4AV4A 2V17L 5JXEA 3FKIG 1VQHA 3FPPA 5EV7A 4YXHL 3DYPA 4LSTL 2CH8A 4J7RA 3QXAB 5EJWA 4P5MB 3S5YA 5D7LD 1E5CA 3KGRA 3VD5A 5CC4A 3MRBB 3L13A 4LAJH 1VEOA 1Z3RA 1FQ9C 4GKLA 4DV4L 4AQEA 3MRQA 4JI7Q 2APXA 1FIGH 5IOCA 4JO3L 1ZTXL 3VXRE 1H95A 2C5DC 2CLVA 1BIIB 2KQ3A 1B4TA 3PCOB 3A5UA 3QUYA 3RLNA 1SUHA 1DANU 1W72L 4ZFOL 4LFHG 2DJFC 4XP1H 2CJSA 4JDZA 1ZAGA 5D7JA 1LDPL 5D6DC 3U7WH 4PGEA 4D8OA 3CFQA 3CCRA 3RU8H 4HXBL 3MFFB 3QH3B 4NUPA 2G9HA 3UZEC 2DLGA 2YOAA 5DS8A 5FO7B 2AQ1B 3F85A 4IK6A 4LHUG 3VWJD 1OE3A 4RZKA 1DYZA 3GRWL 4Z1PA 4WKZB 2Z4QB 5HYQB 4WW2A 1MCRA 2CLRA 5KYXB 2HJKA 1FVEA 3ARDD 4M7KH 3VXRA 4O5LL 2Q86B 4JI7L 4JB9H 1MW0A 3QHFH 2YPLA 4D9LL 1RUAL 2XJKA 4OZHA 3I56A 4IFDG 1E6JL 2KLRA 1MFAH 1M7IA 1NPUA 3SPVA 3DRTB 4QCIB 3WFHA 3CCEA 4QF1B 4QT5A 4X6BA 4ZMYA 4H8WC 3CUPB 5IQOA 3CSGA 1I7UA 2L0CA 5DJCA 2AUJD 1BQQT 1W72B 1MCSA 2KHAA 1WCMB 5AKSA 2A1WH 1Y1VB 4MQTB 5J1SC 1ID5I 2PP7A 4WHYG 3C5ZD 5IJKA 4DF7A 1N32Q 4V1DB 5HHPB 2JXMA 3WOEA 1QSEE 3JTBA 4G8FA 4KJWD 4P2RE 2CK0L 1VFBA 2WLIB 1EA9C 3BPLC 4JN1H 5J1ZA 3JAME 3MO1A 3T5WA 4O2DA 2X12A 3QUXB 4PAZA 3PP3H 2CO7A 3E0JA 1MCDA 4N0RA 4B0MM 3RMHA 2J7ZA 5ERWA 2Q8IB 1EO8H 2WXOA 1BD2E 3L95A 5L2JA 4FTVB 3EBGA 1A6AA 1RIVH 2YD6A 4J4PA 4GEJA 3H9SB 2UWEA 3ZDZB 5FAAA 1IVTA 3EO9L 4F57L 1SYVB 2F61A 2FEDD 1HSBA 5MEOB 4YGAB 1S7WA 2C9AA 4PRIB 1PH6A 2WNKA 2X4QA 1YDPB 5JVH3 1N32L 1ZS8A 2PO6D 2OW6A 3IJYA 3OKKB 4L29B 4M8RA 1CK0L 5E2JA 3RWJA 2OMVA 2Z4HA 3QIBA 1N2RB 4X7EC 4HCRH 3ZYYX 3G6JF 5I23A 1S5HA 3PXHA 3RI5F 3S3JA 3QT2A 4LARH 2NY3D 1ZLUH 3SGDH 1WLHA 2VLKA 5C0CB 4IRJC 3VFTA 3Q6FB 3SDCD 3CFBA 1VCAA 3DMMC 4KHTH 2SEBB 1OM9A 4CW1B 1OGPA 3CG8A 4CJ0B 5I9PA 4DAMA 3I2CL 4XVUD 1Z66A 4WTQA 2YMXL 4KX7A 3VFGL 3O11A 1MWAH 5I1CH 3H0GB 3ZE0F 3A3YB 4HK0A 2IMNA 4R0LB 1X3FA 3DBSA 2R7EA 4JHWL 4M5SA 4L1BA 4B9JA 1VFAA 3K2MC 3ESNA 5F3HB 2PYFA 1CYWA 4TQEL 4FABH 1WVLA 2WYIA 2EXDA 5I15H 4K94C 4S2SA 5GSRA 5H4YA 1NANI 1HQ4B 1QUNB 1TEGA 2C7FA 1H5BB 3ECWA 5CR8A 5DA4A 1CWVA 3FQYA 1I50H 2BNRD 5J3HD 3U58A 4P46D 1R3JB 4WORA 1M1XA 1U8IB 3ARBD 1IGMH 2OSYA 5LGHL 1SDDB 1XF4A 4NQDD 3HOZH 1IB5A 4K9EL 1F3RB 5IB2A 3O41B 1R5VB 4MNQD 3S96B 4FFYA 4AJVA 2WMPA 1PLBA 2BRRH 3GMRA 2CO4A 1A7QL 3FCTB 4NKIH 4RAVB 4U3SB 2IBZY 1KYOK 1KG0B 4OVUA 4BA0A 1JMXA 1RUML 4G11A 5DYOB 1J87A 2FK9A 3E80A 2AXJA 4LU5L 3I3DA 4R7XA 1BLNB 3U9UA 5M3MG 1CBVL 1I4HA 3V6FA 3WIHH 1UWGL 1WBYB 3WTSA 2ATKB 3WNLA 3UGUA 2Z4TA 3KJPA 1RUPL 4A3GB 1F2LA 3CZUB 4I1PA 4GUPB 5IHWA 1IAOB 1GKOA 2WAHA 1E7UA 3QQDB 4U1LA 5CEYA 5TE6H 4RISH 3V4VA 2RFXA 4GS3A 3BVGA 4UT6L 3A22A 4YLBA 7FABH 4JZNA 2WOBA 5C08E 3KDFA 1OSZA 4GLVB 1D6EC 3NHHA 2DQHL 3SE4A 1FL3A 5HGQA 2A6KA 3V6ZA 1RKRA 1HFUA 2JIXD 4YZFE 1D7CA 4HWEL 2OXGB 3E9IA 3O9WA 2P8PB 3HZMB 1FAKT 5DMYA 4WF7A 2AS5M 1JP5A 1LUZA 5DJ2B 1SYSB 2YLKA 4HUKB 4UM9A 4CDGC 1A63A 1HL4A 1DBMH 1DQVA 1NJ9B 2D03H 2NTFA 4L5FL 3DWAA 1LWHA 1UM6H 4NWUH 4YBHA 2J4WL 3X13A 4P5RA 1BEXA 1A8VA 4GRWB 5GS2H 1OAJA 2W0FA 4M8QB 4KKBC 5C08A 1A4KA 1NKOA 1F4AA 2V9UA 5EIIA 1UATA 3EFFB 3VVWA 1A21A 2BMKB 4F7CB 3VYNA 1VDZA 4DK3A 3IDYC 1G1OA 1XR8B 1ACYL 5IW6B 1DQKA 2BIIA 1PMRA 5CIPB 4XMLL 2HXAA 4OGYH 1KCRH 3P0GB 4KLKA 4NHUB 4KMTL 3D4CA 5B1BB 2QVIA 2ADGB 2DH3A 2DM4A 2J5LB 1TJGL 2P80D 3P3TA 4U31A 3WLWD 2QHRH 4DVRL 3KJOA 2R51A 4HEDA 1V8HA 2CCVA 2CDGB 3IFPB 3VYOA 3FU0A 4A2FA 4ZXBA 1X7QB 1Z47A 3VFPA 4GOPC 5IVXB 3GTJB 2BFVH 3SVMA 4QQBX 3DM3A 1VQPA 2X88A 1TYEB 3L45A 3VH8G 4FG6C 5E6IB 1SXTA 4E9XA 3F05A 5I0XA 2QQNH 3CPFA 2YBRB 2AUKA 1KZQA 4YHNA 1K6QL 4OBSA 3CN3A 3KVPA 5ITBH 1IBBA 5EQ0A 3D2UD 4O2EA 1DCZA 1OF2B 1BPLB 2DUDA 1YCSA 1ZANL 1JYXA 3NBNA 4MCZA 5JPNC 1EJFA 1H0DB 4MHHI 4ZFFB 2GI7A 1OQOA 3R2IA 5IODA 2NNRA 3NJMA 3TO4A 1HHGB 4MASA 2WBJC 5FOJA 5D7LB 4F33A 3M1BB 3QCVH 3ILQC 4IBZA 3C2SA 1Q90A 1WA0X 1WCBB 2YS4A 5KAQG 2C9XA 1Q12A 4NO2A 5IMMB 5BPPA 4EQNA 1JJGA 2W1NA 2WXKA 4PJXB 1DO6A 3CHOA 1MCFA 4KTEH 1BX2A 3L2PA 2IY5B 1M4VA 1NAKL 2YQ3A 4BCYA 1NM4A 4RHRA 4BZ2A 4Z7WA 5G5DB 2PPDA 5EZPA 4GNXC 1Z9OA 1KIQB 2BSTB 2X6BA 3BEWA 3R4DA 4XO4A 1AY1L 1RZPA 4M7ZC 1Z9MA 3AT8A 4UZGA 2XIWA 4OZFH 4KN7C 1MREH 3ABMB 4YH6A 5C3LD 3U4EA 2LMCB 3HB3D 1CIUA 5C8JB 2UZYA 1IFGA 5CN1A 3HHRB 3MCLH 5CGMA 4KNQA 1PZAA 1PLFA 5D96B 3P9WB 3V0IA 1QUQA 3VWJB 3CZSA 4K3DH 5D7JC 5HDBF 5DEGA 3JWNG 4D8PA 4X4YA 1B9NA 2QEJA 5DD5L 5GS2D 2LU7A 3QCUH 3N2JA 2A5HA 2AXGB 2W95A 3LEVH 4FLOA 4ODUA 2P45B 1U3HD 3ZYIA 2VMCA 3WUWG 3VW3L 5F3BB 4JX0A 2WC7A 3K8LA 2G3XA 4LF9Q 1LTXA 3OF6A 2OMXA 3EBHA 1SBSH 4I0PA 4LF3A 2J4XA 1E8XA 4EX5A 3HG2A 3K2KA 3T65B 1WDAA 5AUMB 2O5JC 4BE5A 4EVNB 4NRYA 1MF2H 3L2MA 2BXYA 2J57A 5DI8B 1N59B 3STBA 1RK1A 2D31A 1EOVA 1ADWA 2Z93B 5GHWH 5DM73 2XN1A 1FIGL 1I4FB 2XY2A 3C8HA 3R4RA 4A2DA 2FINB 4R90H 3PMFA 3K6FA 4F5CA 5IJDC 1U91B 3MV9E 3G6EA 4YBQD 1WFUA 2BSBA 2QT6A 1P7QD 4OCSH 4ZO9A 4KI1A 4EIUA 5CM1A 2YTYA 3FPYA 3TEHB 3L9RB 4XP1L 1A65A 3CFMA 3B2PA 3O4OC 1RD6A 4YDNA 3U7WL 1QB5D 1N26A 4KX9A 1I6HH 4MA3B 3RU8L 1DJIA 5IJKC 4LF9L 1DQQA 1T7ZA 1DVTA 1HUMA 1BBUA 4E9RA 4HWBH 1ONQA 2NQCA 5GJSH 4HPOH 5BO0D 5KG9A 2R1YA 5ICZA 2LFEA 4M7KL 1SE2A 5E9DB 1W3SA 2ZF9A 2Y7QA 4X4ME 3EYQC 3QHFL 3T04D 4U6VH 2R1XB 4ODHH 2ICWB 1MFAL 4QGUA 3IM1A 1PDKA 1XBDA 3GDBA 4WZ9A 3WNMA 4POGA 4WIQA 3C5SB 3HEJA 2F7QA 4HIPA 5B7FA 2E0PA 3N9GH 4P23A 1Q8IA 2K52A 3OJ2C 4AQ1B 4JM2A 2AITA 2F0LA 1I7ZA 1N6QH 2D7MA 2YLHA 2A1WL 3NZ8B 1VMCA 3ZXAC 3QIBC 3ZO0A 5E99H 1VQ5A 4HUVB 4Z7UB 1B0GB 1A1NA 3N44B 2F74A 4IU2A 3CSPA 4KBPA 5F70A 1KBKA 1P5VA 3S24A 2AF2A 3A4EA 3LZPA 5FB8A 3UC2A 3ULSB 1FL0A 1MI5E 3HR5A 5LO7A 4JN1L 1UA7A 3B2MA 4IRSD 4A6YH 4TS6A 1HK6A 1KFAH 4N3UA 1RHHA 2H6PB 3AU7A 5AALA 2F4IA 1EO8L 5HP5A 3D8GA 5DUMH 1RIVL 1PIFA 2KI6A 1CM9A 2RCSH 3QUKB 1XXFC 2TRHA 1TU2A 3VG9C 5IBLD 5EN3A 1IM9A 2F3IA 3H3VH 1DP0A 3CFEA 1QFWM 2I25N 3FO0H 3IJSB 3BPOC 2F3WA 2P44B 3GV3A 4Y2OB 3L5HA 5ECGA 4YSRA 3MX0A 2CUHA 1ORQA 1YEDB 1F1DA 3MNZA 4V2BA 5I8OH 1NUCA 1T0NA 5DVPA 2Q2HA 4Y4FA 3E9HA 1MVYA 5J6GA 1PW3A 4FF1A 3S3CB 4H25B 4JKLA 4HCRL 2ICWI 1OWWA 4OQ1A 4WRLA 1O6TA 4Y5VC 5HHMD 3KLKA 4LARL 3QWOA 3MBEC 4H1LA 5HBBA 5ISZB 1S7QA 1IYJB 4KHTL 4A3KG 4DV7Q 4TSAH 3H7LA 3G6DH 4HJUA 1MWAL 5I1CL 1R3LA 3K46A 3P20A 2V2TB 1QBBA 2FSDA 5D7KD 4LKXB 7TAAA 2WBWB 5DRWA 4HU8A 1FA4A 4GNKB 3I7FA 1BQHA 3HA0A 3BD4A 4FC3E 3B9VA 4DGVH 2UY6B 4FZ8H 1DQTA 5F3FA 4FABL 4ZFZA 5I15L 2JIXB 1K5WA 4HV8B 1JK8B 1BF4A 2X1PA 5ANME 1V1QA 5EC1B 1W16A 4HMCA 3SE4C 4HAFA 4J8RA 4TN9A 4XMZA 2X9XA 1YYLH 2HTLC 4BFIA 4NGHH 1RAMA 3TURA 5DJAA 1CD9B 4ZSOB 3WLBA 5TSSA 2VITB 4AYEC 4GRMA 4M1DH 4X3UA 4DV7L 2BRRL 3GSQA 4NKIL 4CU7A 4TMPA 1CXIA 3G5XB 1PFSA 4CBVA 2XQBH 2BVUA 1O7VA 1JOQA 2EVGA 1MWAB 2GTWB 2FJGB 2JSFA 5BN5A 1TQBB 3WIHL 4AJYV 4PJBF 3RX5A 3E9UA 1TQSA 5E70A 3TN0C 2WPGA 5GGUB 2O2LD 3JV5A 4X7TA 1YMHA 1KLGD 1AI1L 5TE6L 4KVCH 4RISL 2RCFA 3LN4B 5F0LB 3QDGB 1ICTA 4ODSH 2GCYB 5EBGA 7FABL 4GP4B 4PJCA 2XIDA 3NJHA 4G8GD 5EUKB 5KSUB 3T77B 1I50B 1SHWA 4WDIB 1UZGA 1WAAA 3TBSA 1MIUA 1GUWA 1KEGH 1ANUA 2EUVA 1TTAA 3TREA 4FQJH 3HOZB 1BZ7A 1OCZB 3UTSE 4DAVA 1TWFH 5AOZA 4BQ6A 3IMUA 1BXAA 1FYCA 1ASOA 4PJIB 1DBML 2D03L 4A3IG 1GUTA 2GT9B 3MLSH 1UM6L 4NWUL 4UMSA 3VXUB 1E9OB 5J6HA 1EO7A 4WI5A 5TE4H 3GUFA 4LQFH 1S9VA 3QJRB 4Z9KB 1SF5A 4NSKB 3RWDB 3CC2A 3KJ4C 3FUIA 4Q14A 2YSTA 4YLCA 5IEHA 1I3GH 3BPNC 5C3WA 3QZLA 4R4NC 3SGEH 3I50H 4BFKA 3BDOA 4OIBA 4DR1Q 1OTSC 5ELBA 2PF6A 3EJYC 5EIQA 4DAYB 2Z8WC 2J56A 4JG5A 4OGYL 1KCRL 3B4NA 2VABB 4LXFA 4UMGA 1ZYRD 4P5TA 2PPFA 3VGBA 3LKPB 2IVFC 2YN5A 2I27N 3QQ3B 3RWCB 3S37X 1MZYA 1CFNA 1PV4A 2QHRL 2V2XA 3FQWA 3C3LA 2ROXA 5TH2B 1YHAA 3OAUH 2V5YA 3R06B 5DHYB 1DO5A 2X28A 3GXUB 1U8NB 1WT5C 1WJJA 3H9YA 4HC1A 3WN6A 4RCOA 3DLQR 4NKMA 2BFVL