5JPNC

Structure of human complement c4 rebuilt using imdff
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
290
structure length
290
Chain Sequence
APKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Complement C4-A
total genus 55
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jpnC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 5jpnC01
2WIIB 1JB3A 2B39A 4FXKC 4LNVA 4FXGC 2PN5A 1UAPA 2J0TD 3OHXC 2ICEC 2WINB 4D94A 3CKIB 1D2BA 3HRZC 2QKIC 3G6JB 2A73B 1XWEA 4ILWA 1PXUA 2I07B 3HS0C 1AYOA 2A74C 3CU7A 2XWJB 3KLSA 5FO9B 1UEAB 1EDYA 3FRPB 3MA2B 2XWBB 5JPMC 1BV8A 3T4AC 1JC7A 5JPNC 1BUVT 2TMPA 5FOBB 5FO7B 1OO9B 5FO8B 1BQQT 1GXDC 1BR9A 3V96A 2E2DC 3L3OC 3I70A
chains in the Genus database with same CATH superfamily
4WI8A 5L2KA 5F7MC 2J3SA 4HJGB 5CEYB 1U8MA 4H8HA 1IGML 4K23L 4WGVB 3HKZG 3BH9B 2FJHB 3TA4D 5BVJB 3EDKA 3T4AB 2WB1E 2XG4B 5IGXH 3LNEA 4G8GD 5JIHA 4K71C 1DCLA 1DUYB 3I2ZA 4I4WA 2DQTH 4MA1B 3MRLB 1N12A 1YEKL 3CSTA 3GXTA 3QO1B 2PPBC 1R5WB 4JANB 4JHWH 5E2TH 4YSAA 5J6HB 4QXUL 1JRHI 2BCMA 3QZBA 4JBSA 3FUHA 7TAAA 3M4OB 4QOKE 4HN7A 2A6HD 3BOVA 3CXDH 2EQSA 1O6VA 2DJGC 3B9AA 1LEGA 3UAJC 5DD1H 4KNSA 4OSUH 4NIYE 2XRQD 3W81A 2JJQA 5SX5K 4HPOH 2XIDA 1OCWH 2BOBA 3HG1B 1PH8A 2VLRE 1DYZA 2AQ3A 2RKSA 1WICA 1EY8A 2EH7H 4JG2A 3URYA 2L1BA 4TNVK 1TR5A 3A4FA 1ASYA 2CUMA 1E2ZA 3UP1A 4F2MA 3VRJB 5K1NA 3L9RB 3UE1A 1ZE3C 4TQPA 1FFTB 2IAMD 4TLUA 2ZXDA 1XV8A 2Q8TA 3E6HB 2GEQA 1IBML 4BBRB 2K5HA 3DX6B 4IJ3C 1NGWA 5A2BA 3GD1C 1Q1BA 1J8HA 3BVGA 4Q5VA 4JB9L 5D7HA 1RD6A 4IIQA 2XWDA 3I2CH 1UWYA 3ZHFA 1JRHH 2IH8A 1BCPD 4MHHG 4DT2A 1P4BL 3DA0A 4ZQKA 1VEMA 2LU4A 2XTJD 4NMZA 4YHOH 5CMAB 2KC0A 2W9DH 3BPNB 2BNRE 4A37A 5L7XH 1LP9E 1I3RA 1L0XB 2EC9U 5L88L 4XNAA 4GNXA 4OZFH 4OLUH 5KSAB 3H7BA 2ZTEA 1UFUA 1YI2A 1C5BL 4LHQB 3TF4A 4CU6A 1Q94B 3LEXB 5T1MA 4MN3A 4HPHA 2VMDA 1N18A 4HKBB 4JGJA 3HRPA 3S88L 2PQAA 3BSZH 4PJ6A 5IB3A 1C5BH 4OO1I 4Y5YA 1VQ8A 3UO1L 3CDZA 1JJCB 3CCUA 4BBSG 4Y16A 3MU3A 2VLME 3BIKB 4DPGA 1KELH 4FNTA 2VSMB 2K5DA 1A7OL 5I9PA 4HJJL 4Z7WA 3V7MA 1AKJD 2WANA 4DPBX 2EACA 1PRTB 1PLCA 2ED8A 1B50A 2Y0SA 5E4AA 3MRDA 1T7YA 4JFPB 2R93G 1FVDB 4EI6A 2IGTA 1XGZA 3MUJA 4HC1H 4Y8AA 2ZXPA 1H8SA 5K5YA 4AUYA 5JMOC 4Q9RL 3KPLA 2XA8H 3ULPA 4GJTB 1ORQA 2VOTA 3K72A 1T03H 2Z7UA 4HKBA 2NY5C 4XNQA 5LQBL 3MNVB 2BK8A 3SK6A 1J0YA 3IDIB 3KYAA 3RR5A 2EE2A 3RBSA 3RNKB 4P2CG 4GBXC 4HIKA 4EI0A 1DO5A 3TP4A 4IPCA 4ZMQA 5JQHC 2A73A 1QSFB 1A1NB 1Z6HA 3NDZE 5TQ2L 2ZJSL 1XDTT 4XMUA 3F3HA 4X7EC 3BLPX 3QHFH 4GRWE 5BJTA 2MQ0A 3V0EA 4ENZA 1BZDA 3U6XA 5JQ6H 4MJIB 5JTWA 1BZOA 4OZHB 3UGXA 3Q1SH 4DV2Q 5JVH3 1DVSA 5KYYB 3UL4A 4LDCA 2NNFA 1YMHB 3D2TA 1UZ6F 3FVQA 3EUUA 3KLLA 5DHYB 3CPLA 4LEOA 4L9LC 1TFHA 4P04A 5LNEA 1S9KC 1KCSL 5C07A 4R4OA 2JK8A 4NNYB 2A5UA 1CBVH 1EQVA 3T1FA 1CQKA 1QSFA 1KN4L 4P2OA 2A6JB 3KD4A 4ADGA 1OPOA 3II3A 4HGKC 4TVUA 4HUVA 4PJFE 1MRDH 5AD0B 3WUWA 1J6QA 3DLLA 2R0WL 4RWSC 2HIVA 4XN5A 3IMWA 3MHZA 1BG9A 1F3JA 1PU0A 3Q6FA 4X0KA 4ZTOH 3TBTB 2FCBA 4LDOB 5FWRA 4P2QB 2Y5QA 2OMVA 5AW5B 4N5UA 2X69A 2GVYA 5HXMA 3P73A 3L3OB 4XX1E 4XN8A 5KJRH 3HR5A 4YC2C 1EUTA 3MRRA 3BE1H 4UTBH 3LKNB 1SBSL 4JFED 2ZF9A 4EDXA 4F58H 4MMZA 4O2FB 4EVNA 5I66A 3MAQA 1ODUA 1QWNA 4IUPA 2DQIL 4BQBA 5B7EA 1IZKA 4L1SA 3LQAH 5EN2A 3ZTCC 3BPCA 4BZ1L 3MLYH 5F72S 5ICXA 4LU5L 3UTTE 1EMTH 2P8PA 1FZMB 3FRUB 3K1DA 3SY0B 4JFDA 2NUTA 5D2NC 4JPKL 3AG1B 5I0VA 4FTVB 4NKDA 3U4EA 2EDBA 2K0RA 3JWDC 3B2DC 4WHTB 3IE4A 1R9FA 4GIOA 4JAMA 1I9RH 3KS0J 3RIAK 3HN5A 1T2XA 3MJ9L 1DVFD 5AVVB 3HUJA 2H6PA 4PJ9C 4L3CA 1P2CB 4ZYSA 5D71L 2CCVA 5J6SA 2OL3A 1B90A 1QNKA 2R7FA 4HSVA 5DR5L 5T8IA 2BNRD 4K9JA 4PW9A 1MW2A 1AOZA 1KDJA 1VMPA 1TETL 2BHUA 1D9KD 2V2XA 1KCWA 5IHZB 1CDJA 3LN5B 5ILTL 5CCKH 1BQSA 4NSKB 4YQXH 1OM9A 1ED3B 5D4IA 2ZSWA 3ZHLA 1NAMA 1CQVA 2AV1B 4FQXA 1IBHA 5J12C 4I89A 1KABA 3H94A 2JJSA 3K91A 3PCOB 5LAXB 4NS0A 2AQNA 3O2DH 1JPGB 1NCNA 2CM5A 3FS9A 1MCBA 2GW5A 1ETZA 1H5BA 1E8ZA 3U46A 3U9UA 5F6HI 5F6HJ 4CDGC 4KPHL 3SZ6A 1YPZE 1YMMA 1PCSA 5HGQA 2JKRM 3CHRA 4XWOC 1BFVL 1LLRD 3RVTC 3LS5H 3UZEC 4LDLB 4BZYA 5BO0D 5IW6A 2QHRH 4F7MA 2DLHA 4RQQA 4GMSL 3RWCA 2ITFA 3NSXA 5CC4A 2OXHB 2CUIA 4AZ8A 5A6MA 2P8MA 2BVPA 4GS7C 1BD2D 1IM9D 1IW7D 5DNFA 1KGJA 1B9KA 1CT8A 1WD8A 2AJSH 2MPMA 2DYPD 3RGVA 3VI4A 2NUPA 5I76B 5ITBL 3SKMA 2K4KA 3X3MA 3UBXI 3VFTB 4YHYB 3B3IB 2VDKL 1KFAL 1NPJA 1CVRA 4LSQL 1GM5A 4DGYH 2L0DA 4MMYB 2VAJA 4KTDL 4LOFA 4XP9H 2FB4L 2RFXA 4M7ZC 5I0XA 4R7XA 3BZEB 1HXMA 1TWGH 4X9FA 4KHPL 5E4EC 3V0VB 1A15A 1XMOL 1PZ5A 1F6AA 2P8MB 1J9OA 2F3IA 1I94L 3HG1D 3WHXA 5E8EA 4LVHB 3GIZH 3A23A 4N1EA 4NQXA 3EGXA 3GTOH 2HTKD 4BWWA 5DO2D 1Q3LA 5JEAH 1XCTB 2ZKYA 3CZGA 4B9FA 3CPUA 2LLGA 2G3ZA 1QVGA 3EOYG 1AZPA 3MV8A 1RZGA 5GXBB 5JW4R 4AIOA 1S78C 2AZAA 4L3EB 3S37L 1OCRB 2DWEA 3W37A 3A24A 5D1ZI 4FKHA 1AFVL 1IKOP 4NZ8A 4GAYB 4DV5L 5LG1A 5I17A 5CORA 5JO5A 1IZJA 5DJ0A 3LV3B 5HY6A 1JOQA 2X4UA 4AQEB 3OAUL 5EC2B 4ZO6A 1S9VA 3EJQA 3P2TA 3RI5K 4WWID 3OSOA 3DX9B 4JI1L 2OTJA 5LG6A 1PH1A 2A9MH 3CVDA 1AE3A 2H6UA 2XY2A 1QBMH 1PXUA 2BNRB 4G9FD 1QYGH 4W9IC 5IJVB 1ITBB 2J1KA 5IMMB 4W4NA 3HR6A 4WFHD 3BWUC 2GT9A 4JK1C 3F12B 3GZKA 4HUWB 5J6GB 1CICC 1M1XB 2FWUA 4I0PA 4QHMB 1KXQA 3QUMH 4NQVA 3PWPE 2FGWH 3OLEA 3A5UA 1KENH 1B0RA 2B1HH 3FBQA 5CLWA 1UD6A 3MNWB 1PQZA 2AGJL 1JSYA 3HE6D 4RCAA 5IF0A 2VR5A 2F19H 4HFUL 1T1XA 5FDWA 2X4UB 3ARFA 3KGTA 4M1CC 2R27A 3MUGB 3UPAA 1XH2A 4KTAA 3QA3B 2CGRH 1JGVH 3SOBH 3VG9B 1PKQB 3KXFD 3WNJA 5LDUA 2RALA 4FLSA 4X6DF 5C07E 4GAFB 1HZCA 2Z6KA 3GI8H 2KCCA 3RGVD 1U8QA 4RSYA 2QQKH 2R1YB 4U68A 4X5RA 1ROWA 4NXNQ 2AJXH 1NAML 3ULSB 4NDXA 3K6DA 5DQ9A 5ID0A 3H85A 1HKLH 2R0KL 3GRBA 1SYFA 5D93C 4JQIL 3QUGA 4B3MQ 3V6OA 1QNUA 3K2MC 1FNLA 3I3DA 1IGCL 1XNRL 4CDDC 5DEJA 5E7NA 4G7YL 1NCVA 5F3BB 1YEGH 4LVNC 4FHJA 4CJ0A 1KTJA 3VD4A 1YYMH 2XT1B 2PR4L 5CEZL 2D2CC 3GP7A 4N8X1 3DWQA 1KZQA 3S35X 2A69D 5I8KH 4O02L 4NCC1 3AREC 4WSGA 1ZT7A 3U4VA 1UEBA 3SGEI 3VYRA 2BSTB 2CHNA 4IKLA 3FQNB 4JQXC 3GZOA 5ESQA 4GRLB 4JM2D 3M1OA 2VGLM 4WJ5B 1V43A 4GKZB 4JFFB 2X1XR 3ATFA 1RQ5A 3UJIH 4LRIA 1EVTC 3WKQA 5FFOA 1G94A 2WWMD 2VO5A 3NHHA 2Y0SE 2FO4A 1G84A 2BIMA 4LJZC 1S5HB 4HUKB 4Y5VC 3OKNB 3MBXH 3GINA 3V5DB 1SMYC 3QVAA 3N1QC 1P1ZA 5GRJL 1BZQK 4YEEA 4JOIA 4W9CC 4K55A 4WWOA 4AUJA 2E2IB 3HUJE 4OIKA 2HJLA 4ZTEA 4YSPA 1KACB 5A6LA 1V5JA 2GA4B 4YDVA 1NC4D 5DZ9A 3RL2B 3G6JF 1M05B 5B39A 2ALAA 4QB4A 3EKCA 3KF8B 3CFIC 4AQ1C 1L9SA 5I82A 4ODHL 2XZQL 3OX8A 4OLWH 1VQAA 1BA9A 3K7AB 2WNGA 3ALXA 2PI2E 2QT6A 4NQDE 2RCSL 4P4KB 3HOZB 1TZGH 3PHSA 5CUSH 5TH2B 3VVWA 1F3DH 6CGTA 2HH0H 1ENCA 4HIXH 4IS6B 1P4LB 3F2DA 4HJGA 1U8KA 5AW9B 1EHLL 1CC3A 5HI3C 2GBAA 1NC2B 3PQYA 3NJKA 1OKEA 2V2XB 3FCSB 1ZXTA 4PBXA 4NZDA 4MGXA 5C7XH 1JHTB 1LWHA 1CBVL 4R7VA 3WKNA 2WYZA 2R92B 4XXWA 3EBEA 3MV9D 5D7SL 1KB3A 3V9EA 3IFLL 3QWQB 5KW9L 1VEPA 1EY6A 3S1NB 4J3UA 4EF3A 3BAIA 2NW2B 1EO5A 3D3VE 1HUMA 2F9BT 2LMCB 1IC4H 2HFEA 3V8CA 4N20A 2WY3B 5A16B 1ZT1A 3CHOA 4RX4A 2PTTB 1QD0A 3NFSL 2B59B 1U8KB 1DO6A 3CVHH 3QIUA 1LGVA 3UTOA 4HFUH 4NAJA 5FGCB 5AUMA 2NUTB 2FLRT 4JFDB 2LTQC 2RACA 3S5LG 4G7SB 4R6UA 1E9QB 2OJZL 2R56L 3GDCA 3Q44A 4LRNL 3WJMA 4PJDB 3W9DA 5JW4N 1XF2B 3OGOE 3L08A 4NQSB 3KOJA 2GK0B 2VR8A 4LK1C 4KITB 4M7KL 4M29A 4L1HA 4JPWL 5DLQE 3FCTB 4YHLL 1J0IA 3Q48A 2F8XC 2J56A 4GNKB 1IBLQ 4ONFL 5BZDB 3ZJYC 4L2YA 2RA4A 1VQ7A 5JOFB 4R4CA 1AH1A 5F7LB 5AW1B 2B2VA 3P7JA 1E5BA 4HT1H 3ARSA 2F68X 5F1OB 3UTTA 1PJWA 3BT2L 3VI3E 4KI0A 4Y19B 3ULVF 1TO5A 2CA3A 1MRCH 2QADB 1QR1A 2ZJRA 3ROLB 4FLHA 4U05A 1ESRA 3DOSA 2CU9A 2V2TA 1VZIA 3ARFD 5C6AA 1DBJL 4H1LA 5FFGA 5GIRA 4ADJA 2YWZA 3BT2H 3U48A 4A75A 2EE9A 1JE6A 4GEIA 1O7DE 1CTMA 1OALA 1EZ8A 4NPSA 2E4FA 3OKKB 1MEXH 2VDLB 3QS2A 4PRHB 3NA9L 1DJYA 3PJNA 2GKIA 1TJMA 3ECBA 4HK0A 2GBUA 1IGJB 1NIBA 2CM6A 3HEIB 2BXZA 3CFEA 2V7NA 2WXOA 3UDFA 4KRPD 3SDXB 2N7SA 2WXHA 2CIIA 3GT6A 3QXUA 4J7RA 1D5BB 1DFBL 1HHKB 4J6RH 3P1VA 2IPTH 1FNVA 5LGKA 3P0VH 4I0PB 2DNEA 1E28A 4XPHL 2ZWYA 3IDMA 2WACA 4NZRL 5DJ6A 2WWKO 2Z31A 43C9A 2QQLL 3OLGA 2WVSA 3BN3B 5TF0A 5DZPA 3QDGE 4FP5D 2E59A 2WBWB 4Q58C 4WENB 1E3ZA 1II3A 4D0DB 2BOLA 3PWLA 1J1XH 1CFMA 3QHZH 4WEBL 3SE9L 3WHE0 4Z8FL 2X70B 5IVXB 2CMRL 3QZWG 4C1NI 3OKOA 1WQVT 5EKLA 1CFQA 5FFLA 4PG3A 3BQVA 1T1ZA 1E8XA 3B7UX 3AG2B 3QPQC 5IEKA 4FNFA 5MERA 1I94Q 1AMYA 1P5VB 1HHJB 4IBTA 3QNYB 4KV5F 2NNAB 1GYAA 1IM3D 1RIPA 4KI5E 1DDHB 4OAWB 4PG2C 4XP1H 3MRDB 4UM9D 1CFTB 5FO9A 3LS5L 5FOBB 5AB0A 1YNXA 1A3UA 4OWWB 3S1QB 1OARL 5C7XL 4X3TA 2OQJB 1SVCP 3DX8B 3ZUNC 1K6QH 4LPYA 1EHLH 2YQ3A 5T1LA 3O4LE 3RDJA 3QXDB 1EVUA 4FQLL 5DZVA 3QB3A 5C86A 3IU4H 4AM0B 4UB0H 4J8QA 1NDGB 3ML8A 3SKJL 4OLXL 4R5XA 4Y1TA 3BU2A 3ISYA 5B8CB 3EZ8A 5GS1B 1IL8A 1KYOJ 4GRLA 4Y4HA 5D7IB 1NEUA 1QI5A 2CBQA 1YNJD 4GNXB 3FTGB 4PD4K 5FM5M 5MI0B 5HHPA 3AS2A 4WTZA 4WW1B 4WW2B 1SPDA 1W72H 4MMXA 2X9WA 3V0HA 3I85A 3EJYC 2AJYH 1X4XA 2OULB 2QBWA 2XFXB 3D3VD 5LUMA 4ACTA 5GGUB 3I9AA 4KK5D 2CCLA 4HS3B 1A62A 3SDZA 1ZLUK 1EGJL 3QG1A 3BDYH 4YO0B 2XYBA 3L13A 3UI2A 1RMFL 2OJZH 3BJLA 2DD8L 3MRPA 2D8KA 1Y1VB 2F5BL 3NCYS 4GAJH 1HU8A 4PR5A 5F9OH 5BZXA 1SXBA 4LKCA 1FHNA 2VDNB 1JNHA 4ZMAT 1ADQA 5EAYA 4GQRA 2DWDB 1B2WH 4DVBB 3N40P 2DTML 4KD3A 1YYLH 1KB5A 1YVLA 1BJMA 4G9DA 5CJOL 3WIHH 5I19H 3ZYJA 3GDEA 4KJYB 4UT6H 2EP6A 5HI3D 4PHZA 1N6QL 4NQCB 4A3EH 3ZDXB 1HZLA 4D9LL 3QEQD 1MSPA 1VGEL 5D6CB 4XNUH 5C1MB 4P48A 1ZA6B 3NN8A 1AQ8A 1BMZA 1NCAL 4PS8A 1MHPL 5H4ZA 3WCYA 4G7RB 2CH4A 5DT1L 1BVKB 3PABB 4Z7AA 1CMOA 2XQ0A 2LR4A 4AC4A 5FM8A 5JHDE 1CDUA 3ZL4H 3WTXA 2HTLD 2H4OA 3IKCA 1F4AA 4DK6A 2ZPKH 3P1HA 3JUYA 2PCYA 4D0BB 3E9HA 3FT1A 3PIPA 3DXAD 3GBML 4XHJC 3QIBC 5C0CE 2WQAA 2R7DA 2BLFA 2EIMB 4GUCA 4L4VE 5FO7A 4F7CA 5KYXA 3VUAA 2IDUA 4ILDA 2HJFB 3K8AA 3AS1A 1MFEL 4U1SB 4AMXA 4DR2L 3AWFA 3WI9A 1N34Q 3OKDA 1QBML 4LLYB 4PHXA 1H9SB 5AOKA 1KLGB 1T89A 4JKPH 3GDBA 1WZMA 1O9VA 3RY6A 4NRXA 5I9QB 4J4PA 2ZCKH 1GW6A 2OMBA 4NQEB 1D9KA 4G5ZH 3MLPA 1BMWA 4WK0B 3QIBD 2RQEA 4WUUB 4OQ1A 3FXIC 4H2CA 3PO3H 1LDPL 3OVUB 4JVPA 5FKPA 1X5AA 1CD1A 1Z1WA 4KZDL 1XH1A 2CALA 3SPHA 2Z6BA 4D8PA 1OHZA 4QWWC 2EVFA 1U4MA 2E2IH 1G7IA 3SE3C 5LBVA 3BUQA 4MXQC 2COQA 2Z7YA 4PLOB 1NUDA 1SNQA 2MJWA 2Y23A 4DOHE 4ID6A 3H3VC 1TQWA 1B9NA 4X98A 4GN5A 3RFZC 1UADC 1TWHB 1ZXKA 4LCWE 3F04A 4ZK8A 4M5ZH 4OFDA 5CCHE 2B0SH 3ARGA 4QRPB 3B2MA 4GKJQ 5J1AB 1CYWA 5GZNA 2UXDL 1KLUD 4NPKA 1HNXQ 1RUKH 2HDLA 1UOKA 5JIQA 1A14L 5GSVA 3QUZB 2QZQA 4NLAA 2R23B 3L3JA 3MREA 5G4OA 3VWJD 1RAMA 3K5LA 5CILH 3BH9A 4GOPA 2ZYHA 3BVVA 5TGBA 5TPWH 5BVJA 5IFHH 3VFUA 1HI6A 3FT0A 1FNUA 4ZMVA 2YEZA 3CMGA 4TUJB 1VEOA 4IALA 3SYOA 3V6BR 3VFWB 4AG4L 3TIDA 1VENA 2DLEA 1NQBA 1HCFX 2YXMA 4PJEF 1CT8B 3H0TA 3IJSA 1BGXH 1EXUB 3F7RA 3BCDA 4P23C 4HQQH 4IW4C 4XTRC 1NCHA 4KK8C 2YBRA 1MFBL 2OMWB 4WTZG 1UXSB 1TY2A 1M71B 1L5GA 1SDDA 1IKNC 2BZCA 3AC0A 4RWYH 4D7PA 1CFSB 4NCC2 4ZW7A 3ZJAA 3KYNB 1KYFA 4JFEB 2XXGA 1I4HA 2HTKC 2WLKA 3MV01 2AJUH 3VFSB 1I9EA 1QNZL 1T0NA 5IMLA 2JI1A 4LUVA 4JAMB 3S5YA 5E94B 4NUQA 3VGAB 1E5UI 5GZOC 5L4FA 2UZYA 3TNNA 3CSPA 2QQNL 2HN7A 2ZKXA 3BX7C 3CFQA 3P9MA 4FF3A 4UNIA 5F1IB 4A3DB 4APXB 5HD8D 3BEWA 1Q82C 1BBWA 3QIAA 1H0DA 2QADC 4UTAL 4S0SD 2FX7H 4R5TA 5I6KA 4TVPD 3WS6A 4YIQA 5ACZB 3LSOB 4WFGD 4LP8A 1QW9A 1G9NL 5AWNH 1B44D 3FT2B 5DZAA 4IRSA 3SO3C 1LTID 2W0PA 2FEEL 1J18A 2Y22A 3K4ZA 3QZMA 4AVHA 2F61A 4HH9B 2PZWA 1LO5A 2OTPA 4XRCA 1R4XA 5DEFB 4WFN3 4K73A 1LT4D 1PW3A 1OXVA 1YNLH 3F58L 3LDBB 3KWWA 4LSSH 3NELA 3DROB 1ENAA 3SGDH 4URTB 3TWCL 1BEXA 3B5TA 3O4LA 5HD8C 3ZYYX 1BWWA 2HTLC 4FQ1H 2B16A 3CF5A 2BNUB 1FFNA 5F70A 1KFAH 1CL7L 2R4RH 4G5ZL 1U93B 2OCCB 1SNMA 3FO1A 5D5ME 2ARJB 1M2OA 3P75A 5DVNA 4OZIA 3KCWA 2BOCA 2WNWA 4LQFL 2MHVA 1AXSB 3L6FB 3NCJL 1AKPA 3BE1L 3FYIB 1NR4A 1QWUA 1DONA 1EJ8A 4LSRH 5CP7A 3O8XC 1LEGB 2YGNA 3CXCA 3AM8A 1DLHA 4U7SA 5B38A 3HI6L 5IR1B 3FT3A 5IIFA 2YK1H 5GJTH 4NT6B 5BV7H 1RUPH 1DQIA 4IBLT 1LM8V 1UXWB 5HHNB 1AD9B 2OYLA 1FZJB 4XNYH 4XXCC 3ES6B 4YXKH 4GN4B 1DVFA 2FE0A 3JAMi 4PFEA 4ISVB 1R17A 3KL0A 5E99H 4ELMA 1AI1H 4S0TD 4I3SH 2G0LA 3GMLB 5HHOA 1RHHB 1WRFA 4Q56A 2B2TC 3WD5H 2W0FB 4N0RA 2B20A 4JJOA 4NN5C 4J15A 1K4CA 1U95A 2APWA 3LKRA 4XVSL 1FYTD 4CVXA 1P7HL 2WQ8A 3F6IA 3RVVC 5J06A 4JK0D 3ARDC 4K5PA 4OM1L 1A7BA 5I6YA 3ZLQC 1UUNA 4FQXD 4X66Q 4LLMB 4X6BB 5CILL 1ZJAA 5ITFB 1XL4A 2JA5G 5DHYA 1GYUA 3GJFA 3TA3D 2FBJL 1DBBL 4NN7C 3FW6A 1YG9A 2AABL 4UV7H 4G72B 4LCIL 3KBHE 4HCGA 5T5FH 3D85A 5K9OA 3SCMA 3IJ9A 4FCAA 4BYHA 5B38G 4G6AC 4DAMA 2CR0A 2KERA 1MJJB 2H1EA 3VD1A 4JRWA 3J81E 3S36X 5CBAB 2IMMA 3CQFA 3LX9A 1A4JB 3DHJA 3AJ7A 2Q8BL 2FSEA 2Q7NA 3U4BL 6FABH 3UBFA 5HHXL 1XQ4A 1PTZA 2OSLA 4JBMA 3HMWL 3KPNB 4NNPH 4X5LA 4HGWB 4YPGB 1EGJH 4HHAA 2DQIH 1RJLB 4JE0A 5ELNA 3CXFA 2IDCA 2Q0ZX 1N19A 1IAIL 1T66D 2H1PH 4MXVE 3SHSA 2EDOA 5E8PB 3SE4C 2A77H 4Q7DA 4JFXA 1YJWA 4XMPH 1CG9B 1ORSB 1VQMA 4IK6A 4J28A 5C0CD 1YNTA 2AXWA 2WKOA 1MLCB 2XWEA 2YD1A 1BECA 2QEXA 1DZBA 1RIUH 3C60A 4LCWB 1I9IH 2WHVA 4JI8Q 1CE1L 2ENPA 3OAWA 5IV2B 4OKVB 3DRTB 2JI3A 4N24A 3HZMA 4WV1C 1Q7YC 2RJMA 1FL3B 3O6FC 3QNZB 2XN9A 3H3PH 3FCSA 5DC9B 4M7KH 4YVNA 5FCSH 4XP5H 4BBSB 4ALAL 2OSLB 4X65Q 4EQOA 3ESMA 4UB0L 2F7QA 4FQ2H 1PH3A 1BFVH 5I5IA 5DFWH 2Z0BA 3O9WD 3P0GB 5JDSB 2F19L 3TWYA 3GD7A 4CVZB 5KYUB 2BA0A 2W95A 1T0OA 2DLTA 4U4BA 2UXCL 4IN3A 1Y1UA 4HWNA 1N32L 4I65A 1A6PA 1OPGL 4Z1PA 3Q9QA 3GIVA 4FYDA 4X8GA 3RU8H 3Q22A 2Y6SC 4HIIA 4JFYA 2BP0A 4OZFG 3ROOB 3VSQA 2D7PA 3MDJA 3C9NA 5DJAB 2KOLA 3IRCA 2AXFB 1CE1H 1NLBL 5KANG 1G291 1TQBC 1BX2B 1LT5D 3IS1X 1MSHA 5IP4A 4MJ6A 5T1DL 4U33A 3UZVA 4YSQA 3O13A 2F2HA 4O2EB 4C58B 4PCSA 3ULVC 2JH2A 2JK5A 3GHPA 3U46B 1B8AA 4HSPA 4I2XA 1WHOA 4FEMA 2CO3A 4I88A 3UJJH 1QKZH 5DK2B 2G3MA 1BCPB 1A1MB 2WQVA 5SWQA 5F3HA 1J5CA 4HYTB 2W5PA 3PUVA 2CJTA 3HE6A 3NEOA 4ZNEA 5IREA 1NEZB 3CXDL 1BSIA 3IAYA 3NWTA 2BH2A 1QI4A 2APSA 1PH6A 5ICUA 1JDDA 1Q1PA 5H37G 1TVXA 2FJSA 3QDMD 3QUYD 2WP3T 1LDPH 2J2ZB 3NT0A 4V2BA 2UWEF 2VQ1B 4I0CC 1PTOF 3U7WL 3VYPA 1PG7L 4B5ZA 4R9WA 3ZU8A 3MYJA 3VFPB 4NN7B 5DEFA 5GGQL 3UEQA 4C83A 3CN3A 5DS1A 1GGBL 5H4YA 4J1MA 1EEYA 3ZE1F 3P3YA 1EH9A 5AOZA 1OVZA 1XGTB 3P0YH 5GQBA 5IY5B 1LJMA 5M95B 1K8DA 1SNPA 2YZ8A 3FRPG 3ZHKA 3WENA 3G6AA 5ACZA 3GTPB 3D0VA 3NGBC 4A1RA 1HXYD 4QRSA 2G0KA 2X1PA 2YXWA 4WDIB 2ARJA 1OL0A 2HX7A 5F1KC 3SQBA 2MCMA 2PW1B 4XI5D 3I7FA 3T09A 5HYEA 4OCMC 7FABH 3MBWA 5A2FA 3SDCC 5KBPA 4CUCA 3ARFB 2EXWC 1P4BH 3NDYE 4WU7A 3TTYA 4EI6B 3T6XA 3WOEA 4KQ0A 2A74A 3LQAC 2XNAA 3D4ZA 1YEFL 3LH2L 4LSTL 5IYCH 4LOEA 5JDJA 3KW7A 2WXLA 3S3JA 1KNOA 4HWZA 3Q6GH 4MMZC 3CZKA 3PUXA 1K6QL 1G7PA 1Y69U 4KLKA 3PHOB 5ISZA 5IBUB 2XN9E 3CXHK 1HWHB 1ZLDA 2GFBA 2H26B 3CV5A 3MBEB 3GZQA 3Q8EA 5AVRB 3TCXA 2YK1L 3FH5A 1OARH 2YGVA 1QJOA 2V7HA 1AGBA 5GJTL 5B1AB 2HCCA 4F2ME 1KCBA 5FV2A 4JZJC 1T83C 3ESNA 4F9LA 4MQTB 2BS71 3ZZ1A 1A0QH 1MVYA 1OTUD 3M88A 5HHOB 4C4UA 1BQHA 2O4XA 3MRNB 3OM3B 3FH8A 2BCKA 2Y7QA 4K3HA 3SGJC 4N8VB 5LO7A 3KBPA 5HY9B 2W9EH 2EIFA 1PNDA 3BP4B 3ES6A 4FF2A 3TBWA 5EO9A 4Y19A 3BN9C 4YO0A 3U6XS 5JJZA 3QZOA 2XA8L 1OAXH 3AZUA 3QJVB 4H25B 3V5KA 4Y4KC 2UWEA 1BKBA 3VQLA 2K70A 4A38A 2NY7L 4JOIC 5AKVA 2B2YA 4A3DH 1XZ0B 4PJCE 4UOQA 2Z8LA 4IUNA 3JWNE 1WCMH 5KVEL 2K03A 4JN2B 1JE5A 4YDMA 5D7JB 5E6YA 3T6VA 3CFCL 1UATA 3DMUA 2WJ5A 2YC1B 4Y1AE 1MFDH 3VXSD 2Q76B 2BVQA 3BW9A 4YHHQ 1CXKA 5C4HA 3CVIL 4ZAKC 4N8VA 3C08H 5CIPH 3T13A 4Z5RB 3IDUA 1SMOA 2CO7B 4QHNB 3BHBB 4L4VD 1H15A 4BZ2L 4OZ4B 1NWOA 3WIAA 3WFEL 3D69A 1PYBA 3CZSA 4QRRE 4I7AA 1QSEB 1FNAA 4L0ZA 1MJUH 1OAZH 1J9TA 1QLRB 3IGAB 3RZCD 4RISH 5JXEC 5I6XB 1GYWA 2BXYA 4RZCA 4TUOA 3ZL1A 2KUTA 3G7LA 2WLHA 4XP6L 3G08A 3D18A 4IOIB 5M7QA 3FT3B 2A9NH 1TCRA 4BKSC 2WINA 4L5FE 5HPMB 2W88A 3S98A 3DX7B 5JQIB 1K8OA 5DFVD 1X9UA 5BN4A 4WHTA 1PYWA 1YUKB 2GG1A 2VITB 2RCFA 1S78D 3HVNA 3LNGA 5KYXB 4WEMB 2ZM6L 4B3RL 2VERN 4H26B 4DKEL 4ZO9A 4Q4EA 1XMQL 1NWPA 2DIEA 3JVFC 1MCOH 3DIDA 3SD2A 4AIZA 4RGMA 4PM1A 4U3SB 1D7FA 2B08A 2CWRA 4D0CA 2CUHA 1F0LA 2GI0A 3LN5A 2R7EA 4HIQA 4WUUE 3DWTA 4QHMA 2VDOB 4M1UB 1L9PA 4ZTPH 1TQVA 2AJSL 3KWTA 5ITBH 1I8MB 3KPRB 1I1FB 2C4FT 3F2CA 2G5BA 4JR9H 1JZGA 3D3RA 4OF5A 1FN4A 4LFBL 4UWQB 2DWTA 2MNWA 1S9WB 3V4VA 3EW3B 3D52A 5E8NA 4J8RB 2UZXB 1U4LA 2XYCA 3EYFB 3QJYA 1JD7A 4IPGA 2TAAA 3S35H 2I9TB 3IVKA 5D9SB 5IB1A 3TZVA 1VQLA 2JQMA 5AQ0A 1EUJA 2D0GA 5IM7B 4Z7QB 4XVJH 2FSEB 4D3CL 1OCCB 3RDTD 5F3HB 3J81j 3QH3A 2UUBQ 3IXAB 1B0GB 3L3GA 3QFJB 3IWUA 4X7DC 2SNSA 5EQ0A 3OB0H 1KIUA 1B4JH 4IDJL 1RZ7H 1TZOA 2MNUA 3QZWA 4NO3B 1JGLH 5E6ID 2XRAH 5C97A 3D6WA 5L9DL 1EXGA 1BW8A 3DX1A 4KZDH 4PU2A 1DSFL 4N8PA 1JHLL 4E9RA 1J9QA 4L4VA 4LESA 1QLEH 3ZTNH 4CMHC 1ZJBA 1CLOH 2KEDA 2XWRA 4OQTL 3GMNA 3UTTD 3HC4L 4DN3H 4LASL 4EGVA 3U58A 1WBZB 1AG6A 3HW7A 2J8UB 2IY5B 1UENA 3CC2A 1H3VA 3ARPA 2NY4C 1KC8C 1CK1A 3OB8A 4JM0A 1OD7A 4FXTA 2N88A 2DTSA 1BAFH 1QO3B 1OZUA 2AXJA 4JPWH 3WELA 2HG0A 5LAXA 5AD0A 1CLYH 2FLMA 4IOAA 3NIDB 4FHKA 4JVWA 5JDSA 4ZQTA 1R3HA 3OSKA 3RIFK 5CEYA 5F1IA 1CTOA 1GAFH 3GKWH 5KYLA 4A7GA 1MCQA 1YJDH 3NIDE 1OAUL 1JZ2A 2EXWD 4MCZA 3ZMRA 4ORGB 1LEIB 4RGOH 3NIFB 2N0KA 1AVAA 3PWUA 4KK9D 1KULA 4GW1A 3HNVL 1EHNA 2DEXX 2SDFA 4AC2A 5FB8B 1KNOB 1OLLA 4PP2A 3LEVL 5DVOA 3FTZA 3MLXL 3LQMA 4OLZL 3VJ6A 4YEFA 3C46A 2VXUH 3QO1A 4JANA 4RAVA 3VXNA 5IK3A 2YPVA 2VJ0A 4LF5L 3WN5A 3S9DB 1RUQH 5AW4B 1N59B 4M48L 5GRVK 1JN6B 2JSFA 4UAOC 3IMRA 4AL8L 2Q8IB 2CO4A 4JQIH 5D96B 1CGYA 3MC0B 1JGDA 4P0DA 3W0WD 2EC8A 2YO3A 2N1KA 1DBML 4ZNEE 5CJ8A 3KR3L 4HJEA 3DX0A 3N1FC 4KHXH 2VN5A 1SYDA 3GI8L 1WWCA 2F53A 3MUY1 4NUGH 2B9BA 3TS0A 3RPIA 2O61A 3QJHB 4PGJA 2ODHA 4X5WB 3FTYA 4JY5L 4G6FB 4W9HC 4UM9A 4Y5VA 1I4FB 2JJTA 4Z7QF 4N90E 2FBOJ 1FZOA 3N3EA 5T3XE 5FUCC 3BQUA 5B4MD 4E5XB 4OCXH 4WKZA 1MW0A 4NRZB 3BZKA 2G2NA 1VQ9A 1J8HB 2VUMB 4XN9A 4NM8H 2OMWA 4UYQA 5LBSL 4Y8DC 2EYHA 3TYFB 5IKCB 2CJUL 2UX6A 3DC0A 1OGTA 4OTXL 3KYOA 3VXUA 2AUKA 2DQDH 5IEKB 1M7IA 4A55A 2LLLA 2B2UA 5D7LD 1N5AB 1QOHA 3RYMA 4YSTA 2A9ML 4A2LA 2BRRL 3BEVB 3VFRA 2O5JC 4CSTA 1HH9B 1MI5E 3N42B 1M7UA 4HAFA 1X7QA 4XGZB 2YTYA 3VSUA 4PCKA 3C5ZC 2L8AA 3L2MA 5IJKA 3JYBA 4HVBA 4OLXH 1OSPL 1PLGH 2YGQA 1CGTA 3S16H 3ZKSD 2E2JB 2KBNA 3UH8A 1A2TA 2FDBP 3WIFA 3RIAF 3IJ8A 4IUVA 2XY1A 2YTVA 3VWKD 3OPUA 3RUGA 2MUYA 4V1DE 4GSQA 5D6CA 4UP7A 3TZDA 2Y07H 4XPGH 5AJ3L 1BM3H 4H8QA 3O2VH 3CHSA 2XETA 3L3HB 2HUHA 3QIUC 4NBZB 5F7EH 2GSIA 4IU3B 5I1LB 4ZI8A 4ODXB 4LE8A 1OTCA 3GM0A 2R0KH 4TL4A 4JS7A 3MRNA 5J12B 4ESKA 2MNAA 2FB4H 4R1JA 4LKXA 4UANA 3EOAB 2RDHA 2JQAA 3ZZSA 4DN3L 2OCJA 5GS0L 3HOWG 5IG7A 4FZEH 4Y4FB 4BGDA 1YBYA 2JLPA 3JV4A 2ADFL 5TE7L 2VYRE 5A3IC 2Z8SA 4IU2A 4R8WL 4APQD 3EOBB 4MNQE 5EU4B 2ZKHL 3CD6A 4FQJL 4BJLA 1I1AD 2OP4H 2WZAA 4ABQA 1W72B 3WDIA 2L7EA 1KRTA 2GSGA 1SYSA 5T1KB 3MJ8A 4M1DL 1CO1A 3I2CL 2TMPA 1S5IL 4U1GB 2WCSA 3KPNA 4YPGA 1T1ZB 4BBWA 4DP8X 2L3BA 3L4XA 1I50B 3TN2A 1FRGL 2B4CL 3JV6B 4Z77B 5JO5B 3L3IB 2F53E 5EZLB 3VYTA 2IMNA 5D72L 3CC1A 4DXGA 3M45A 4GKKQ 4FMVA 4XE0A 1CVSC 5IMKA 2AJZA 3H42L 2RQ8A 4M8QB 1RLBA 2ZX6A 4FFZA 4TNFA 4LFCQ 5FM4A 4O4YH 4DR6Q 3L9AX 5AW2B 2MPVA 1BFSA 3R93A 1M4KA 3TA3B 4KY7A 1J9CT 2GT9B 3TV3L 4TKWA 1OWRM 4L3FA 4OSUL 1MCJA 2HJLB 3QCTL 1SN5A 2HPTA 4FFTA 1SY6L 3UACA 3IJEA 5J11B 1WIUA 4Y9CA 3BDBA 1FL5A 2X28A 3KPSB 1UWFA 3N41B 3QQ4A 3T3MF 3HR5B 3BVMA 3LWEA 3L8QA 4FQCH 3N50A 1O75A 3MGAA 1NCUA 3OD3A 3BZDB 2VQFQ 5CD5D 1CDCA 4L0YA 2XIIA 4GOPC 1QP1A 1JZDC 1JS4A 3MA9H 4Y7NB 2W94A 3RWHB 4N0CC 1AYOA 5GAGC 3TYGL 1FH5L 3S4SB 1I4GA 2DQFA 1FIEA 1Q72H 1HTYA 4PVBA 2WVVB 1GUWA 4JDVA 5E2UL 1DQJB 2BVQB 3QDME 5DSCA 1JZHA 1BUVT 4PRIB 3PY9A 3UZQA 4N5EC 4PIBA 1SYVB 1IL1A 1H3WM 2H4EA 1VQDA 2WLIA 3CH1A 2VQ4A 2XKNA 4PRHD 5EZOL 4I48A 3DSFL 1HZKA 1L7IH 4P5TD 2QV4A 5D7LE 3VXRE 3EN2A 4DGIL 2CKBH 4MCZB 5J3HD 3AACA 2Q2HA 1PTOB 2YD6A 2E2HH 3W2DA 4J2QA 3OKEA 2Q7YB 1G9HA 2WKCA 1MFDL 2FJHA 2BSTA 4P72A 5AUMB 2YRBA 4N5ED 3L9YA 4P9MH 5DA0B 4AYSA 2QSCH 2ZSWB 3MV9E 1ED3A 4XMLH 4JFDE 1NINA 2Y2WA 3QXWA 2G9HB 3N43F 1MFUA 4FHBD 2YEVB 1BX2A 1KEML 3E2HB 2EJFC 1KTRL 3WSQL 1VRSA 4LHUB 3PUCA 2FR4B 4R0LC 1YEHH 3QJZA 3BDOA 1AQKL 1Z5YD 5FYKH 3QB7C 4TKOB 2W07A 3SQOL 2ZKHH 3WKMH 5C0XI 5C0XJ 2MOVA 3I4OA 1IT9H 4FQQA 3MFGB 3NCMA 4TSBL 5MEPB 5BZDA 1KBPA 4ZMTA 2ITDA 4PZ8A 5M3FB 3FQRA 1L7IL 5M3FG 2X40A 1DUYA 5MP6L 1NCTA 1E7UA 2XJKA 1NA8A 3SQOH 1N5YL 1CIDA 1NANI 4AV4A 1R0AH 4BA0A 4UM9B 3JWOH 1JVKA 1VZHA 1U92B 1ILSA 4PAZA 5F1NB 1L1OA 1OF0A 2HXAA 2BHZA 2Q1EA 5HDWA 2NZIA 2QLVB 1KSRA 5EIIB 2Z7WA 5AVQB 5SV3A 4IHOB 1OB0A 1PD0A 3DXJC 4YBLB 1NCBL 4FVMA 3V6OE 3VQ2C 1D6VL 1GHFL 5IB4A 1INQA 4JVZA 4ULLA 4UU9B 1K3IA 3D2UD 3WS3B 5B22A 2ZP0T 4K5VA 1UB6B 1F58L 4A3BB 1HT6A 2YMOA 2X3AA 4FFYA 2JIXB 4LVNB 4ZQKB 4OZIF 3VJ6B 1KIPB 5LN4A 3FP9A 3KLSX 3G48A 4B3SL 5T3XD 5I6NA 1G87A 1ZHLA 2WO4A 3P4MA 5KRUA 3H0TB 3WHXB 4CKCA 5EOTB 2BS8A 2R2BA 1NGWB 1ZV2A 1UASA 5D7KD 1JGEA 4W9FC 4A7TA 4OCWL 2BRRH 1BCPF 4P2OC 4AXWB 4ETYA 5EIIA 3MRQB 3RVWC 3OJDB 3K5MA 2VLLA 4YGAB 5IVXA 4HIHB 1H3TA 3FULA 4NZTL 2B2TA 2Z1PA 3OAYH 4MJ2A 3ZKND 4J1UA 1GGBH 3M4PA 1AS8A 5HHMD 1EEZB 3IAGC 3MGTB 2I7SA 1NFDE 3F2LA 3QXAB 3N06B 2V7HB 4AX3A 3UZVB 5BS0B 4H0LC 1UKSA 3NUCA 5I1CH 2ZF8A 5H2BA 2AK4D 2W0LA 1TENA 1WITA 2IG2H 2KBGA 3LNHA 2WZPD 4P2OD 2NNRA 4J4PC 1F2YA 4MTNA 2L7UA 1KB5H 4MCYB 5BS0E 1WWBX 2QQNH 3FAWA 4FNLL 3CCEA 1H15B 1AP2A 1WJ3A 1E3FA 4M9OA 4XZUA 2NW3A 5HVWA 1IAOA 2NPLX 3FH7A 2NVTH 1QNZH 3VFRB 3CQQA 3DO7A 1V3MA 4DAYB 1CSPA 5LGHH 5LHDA 3HE7B 2F6AA 3LQZB 1D5MA 1PH7A 3T71A 4PJHE 3ZTJH 5BOPA 1V3JA 5BQ7A 3FBKA 3BJ91 5HGDB 4A3JG 3LNNA 1CTNA 1K8DB 4LVOC 3I4MG 2P52A 1QPXA 5DCCA 5PAZA 4AJWA 4L5RC 3EYQC 1MLBA 2X4OB 4N2HA 3BFOA 4Z95L 1MN4A 4Q9RH 1CXHA 1ZEAL 4WEEA 4V11A 3WNNA 5L0QB 3QFGA 1X7SA 3C60C 2KLTA 4YNYB 4ZOBA 4DESA 1UKTA 1CG9A 1ORSA 2BIIA 4E0RA 1AGEA 4OD2B 4QUFA 3HN3A 4IO9A 2GK2A 3T1HL 3RX7A 1LEKA 5GROA 1EFID 1BJ1J 4GRLD 1KTKE 5T1MB 4QJ4B 2P48B 2R4SL 4JDTH 3EH4B 2NXYC 3I9GH 1TF4A 3W11D 3HOWB 1ES0A 4HIJB 5FCUL 1RZKL 2Z93B 1OTSD 3PSIA 5FO8B 3P3SA 4X4ME 4ZD3L 3ZKMC 4JI5L 2H26A 5C4XB 4G8FB 3UZEA 2JB5H 1UQSB 3NP4A 3RDTB 4IGBD 3ULUL 1OXTA 1PQZB 4QEGA 1JB7A 4TSCL 5ADPL 1ZHNA 2WZ0A 3W9EA 2ZKMX 1K8MA 4HCSA 1ONQB 4O02B 5E7BA 5M94B 1AY1L 1IC5L 3EJTA 1PAMA 1I6VC 2C1PB 4LFHD 4LRNH 3RPKA 4KMLB 4K5OA 3B9KD 1MW1A 5CGKA 2OMVB 2YS4A 4TNVF 2YAEA 3HOYB 4JBWA 2PP7A 4KK6C 3Q0HA 4PJAB 4HHAB 4D3CH 4PB0H 3CMOH 3TPUB 4PGBA 4JZNB 3H8NA 3VG0L 2F1AA 4XHQA 1RODA 4F87A 3F01A 4JRYD 4FYRA 3ZSSA 3ABKB 4GLRI 4YFDB 3FFDB 2NYZD 1CD8A 3ABLB 2G5RA 1FPTL 5EN2B 1CA5A 2UX7A 5I15L 1BZEA 1HEZB 1ZANH 3DSNA 1TYJA 2MQCA 5FYJH 1N70A 3OXRB 4GUQA 3AXLB 2D7TH 4HWBH 3QCVH 4OKVA 5IFJB 1JV2B 1UH3A 3IDJB 2OAAA 4TRPL 4PB9L 4FF9A 4A3JH 2EKSA 1RKNA 5CEXB 4RWYL 5CU5A 4JFXB 3DXAE 3J7YW 3TDQA 4LUOA 1FG2A 2NLJB 2WM0A 1GOFA 2WGNB 2XXCB 2X10A 2BERA 2EZ0D 3NJIA 1T20A 3MFFA 4E5XG 4EUPB 1N33L 4OW6A 4ACPA 1A6AA 2A9AA 3SY6A 1JQYD 5D2NB 1XIWA 1U3HC 1AW7A 5BZWB 4J39A 3F7VA 4JJ5A 3ATBA 4JZJB 2APBA 4KXZH 4B27A 5IHZA 1XF5B 1IEBB 3VGEA 1KDAA 3OMAB 4Z3HA 1PNCA 4AL8H 2H3KA 1E4XL 4KQ4L 2CA4A 2GVBA 3N6YA 5IMOB 1ESOA 1XPOA 2FEDD 5C0AE 3P69A 1ZGLA 3EDJA 3PWNB 4DU9A 2NY3C 4RGNE 3ASWA 1TS3A 1N34L 3MCYA 4GQQA 3UJIL 1DVFC 1IEAB 1QRNA 3CFBA 4NFBA 5IHBA 1V27A 4OZHE 2Z9HA 2NZ9C 3V4UL 4YWGL 1FLTX 4UBDD 2PPCA 3L1FA 1NPUA 2J8OA 1T6WA 1WWWX 3TRZA 1D5RA 1DSFH 5AJ3Q 1O6SB 3WY1A 5I0YA 2X42A 4NM4L 1STAA 2MHAA 3M7OA 3TFKC 1EV2E 1KXTB 4X62L 2NDFA 2Y5TB 3EBIA 3FOLB 2OL3H 4NIKB 1Z3GL 3RKDC 3SGJA 4JKWA 4MA7L 5EOTA 4ETQB 3U1PA 3DTXB 4BUGA 1FNGB 3K7UA 3KPRD 4BDVA 1JNJA 3C60B 4RNRB 5A2LH 5CCJA 1G9NH 5HVHB 2JB5L 5HJ3A 4JI0L 3WDHA 4C47A 5KVGH 1CFSA 2XTJE 4LMQI 1BJ8A 1UOWA 3QYNA 2GY7B 1DQTA 4XWOD 1UGKA 4KN4C 1F5WA 2V33A 5AVXB 3B2VH 3M7GA 1TWFB 1WG3A 2J2ZA 1IBGL 5CAYB 4K0OA 3O2DA 1X56A 5A2JH 2VDLL 2J55A 5HGBA 5DEZA 4YUEH 3E6HA 2WNXA 2GJ6B 4L63B 4C3IH 3OLIA 3IBEA 3ARBA 4P46A 1H6FA 1FFPB 1T21B 5JPMB 1L1OB 3AROA 4JQXA 2BDNH 5DC4B 1GKOA 3A22A 4APXA 2PWHA 4OGYL 5C0RL 1YNTF 2PYEA 4G7OC 1AOHA 1DYQA 3QAZB 1L7TL 3W38A 1N7ML 2JMRA 4CSPA 1RDPD 4KD4A 4H8VA 3V4VL 2J88L 1IE4A 1XTLA 2KPNA 5IP7G 3DMMD 3OKMA 2ISDA 1NOLA 2G60L 3BGFB 4JFHE 5JXEA 5E9NA 1A7NH 4X3KA 4YDLC 2JA5H 3MCG1 3B9VA 5DRNA 1AGCA 2MH4A 5J1AA 5DT1H 4KFZC 1V7ML 1HC1A 5DEGA 3RL1A 1EAPB 2GYSA 3J7ZC 4W9LC 2OM5A 4WIQA 2ZCZA 2XZZA 5BCAA 5CSGA 1HL9A 5EORH 1YSOA 3PQIA 1IBYA 1Z0MA 4R8WH 3GTKB 5J0BA 4FADA 3X17A 3F00A 3ZUCA 3E1F1 1Q8IA 3O0RH 1MI5B 1N5AA 5KSAC 3V79C 4LIQE 1VHPA 3L3IA 3NUKA 5EZLA 4LCCB 1Z9NA 5TQ0L 3NSJA 3BSGA 1SNRA 4YN3A 1SQMA 4XCFH 4GXVL 4DKFL 1NCCH 1SOKA 1RIVL 2K4AA 4OLUL 1BF2A 4X5PA 1HZHH 3AUVA 3PIP3 2E4TA 4NWUL 2OZ4L 5KYYA 4TQHA 5FOJA 1EFQA 2A83B 1DZ0A 4OR1A 2OR9L 4KUZL 3O3AA 1I82A 1HFUA 3CSGA 5T5FL 1A63A 3MV7E 1G0DA 3S2HB 5IGEA 1DUZB 4HUMB 4CAGA 2O61B 4ERSL 3K3QA 4BXXG 4RISL 4YCWA 2EEBA 2KJXA 2B2WA 2D3NA 1Q0XH 4FYQA 3NCCB 4H44C 3WFDH 1MIMH 1RJCA 4BEIA 5L2JA 4LF9Q 4YSDA 2XX1A 2H3NB 3EZJB 3L3DA 5CSZB 5GGRA 3G6JA 4YXHH 1W8OA 2FECL 4JPIA 4G6FD 5BV7C 1W6LA 4I5BA 3US9A 2RHSB 1OP5H 5KYWB 1WF5A 1NLBH 4X7SH 2AQ2A 4FCHA 5ETUA 3D08A 4C2MB 4NXML 2DBLH 3PXLA 3BFQG 3WBDA 4DAPA 2SNMA 1UACL 2EIDA 5EU7E 1IO4C 3ET9F 2AS5M 3FDTA 5EV7A 1Y8OB 3QORB 4MYPA 2KT6A 5KSBF 1L9NA 2VWEC 3FN0L 4NBYB 1P84K 5DJYB 4XZ4A 5IVZA 3WEMA 3OPZH 1ZA6A 3T08A 3O6ML 3QG7H 15C8L 3I02A 1A6VL 3T77B 3KPMB 3DVIA 4NKQB 2NBFA 1S46A 4M1GH 4MVBD 2G3XA 4X0KB 5CZVH 1D9KC 2BFGA 3V9CA 1JPSL 1F11A 2ZAHA 3VI4F 5HGTA 3ZTDC 1BD2B 2P8PB 4CJ2C 4GQZA 4YUEL 2UXGA 3EHBD 3A67L 5CLYA 1D2BA 1RVFH 4ZW6A 2X41A 4M8RA 4N8VG 3FTVA 4F7TA 2LSSA 3C3LA 2PMZB 3TH4T 1VMCA 3WNKA 1EQRA 4YIJA 5AZ2L 4KKTA 2CHZA 2NLJA 3PE9A 3QQDB 3Q6SA 2XN2A 1H3PH 1JNLH 1WS7A 5JOPD 4TMPA 2VZOA 4AM0Q 1U4PA 3I50H 4H4NA 4XPBH 2RMNA 4G1MB 3DVGB 5EU6D 1EEID 1G7JB 2QQLH 2R93H 1WFUA 4TLTA 5CJXC 3ZT7A 5KJ7E 2KYIA 3BKJL 3LB6D 1Z9LA 1LP9A 3D25A 3N43B 1NFKA 4W70A 4NN6B 1I8LC 1WYJA 3P0VL 5KYIA 1RY7B 4NLHA 2X3CA 2PYFB 1UWEH 5TDOA 2Y36H 5D1XD 2E2HB 1T83A 2YPLA 1DL7H 3K4AA 5DSCB 3IXAA 3JVGC 4FFWC 4RKLA 1MDAA 3BHBA 3V7AG 4FABL 3QR1A 4LU5H 3K0XA 3LYRA 2BW5A 2J44A 5CU9A 3SPIA 2RBLA 1LO3H 2A6JA 3EG9A 4B97A 1PZBA 1XF4A 1TWFH 4Z7QE 3J81c 5B3JE 1BIIB 5D9SA 3TZVB 1V8QA 1CLYL 3TEWA 3Q5OA 4PG2A 3RN2A 4JN1L 4KO9A 4XC1L 5GGTA 5LAPA 1NMBH 4NZUH 3KLHC 1J8HD 1AN8A 5JOFA 3RHWF 4Y4KA 1GIGL 1VCAA 4XH2A 2WIIB 5JXED 4RGNC 3U2SB 4FULA 4WI2A 1JBJA 4DV1L 2X44D 2WQUA 3VWJB 2CH8A 4LAJH 3GBLA 1QZHA 4DR7Q 5JORA 2UY6A 4ONGH 4EKJA 3UDXA 4KJPC 2QDWA 4FABH 12E8H 3UTSB 1AHWC 5FYJE 3KBFA 2V5YA 2HLEB 3BZ4A 3OR7B 2F0UA 5GZOA 5I1HL 1MXGA 4F24A 1RZ7L 3WL9A 2FUTA 5DRZB 3WO3B 3ZYOA 1SOQA 2WN3A 2WBKA 1MFCH 1B2TA 3KYOB 3BYYA 2LAAA 2WXPA 4R3SA 1RTNA 2KDYA 5F96H 1EIFA 4GUPB 2RHEA 4IFDI 4IFDJ 2CNZA 4NRXB 2WB1A 4ATTA 5JZ7D 4FXGA 2UU9L 1PD6A 2E7LA 2ZUQB 2NW2A 1T22A 3OZLA 1TZIA 2D7TL 3T65A 2DRUA 4KVPA 4XPFH 3CCMA 1DQLH 5C4JB 2OYMA 3RIKA 2XV0A 1PL3A 4TNEA 5FKAA 3PWUB 1IGJA 4RG1A 4PS4H 2AEOA 4I3GA 4XNDA 1A8ZA 1SE3A 4M3HA 3SDXE 3BZEA 3WIHL 5I19L 1J5EQ 1ZLUH 4PGEB 1Z9FA 1S7WA 3MX0A 1AG0A 1KJ3L 4Z9KB 5MERB 9CGTA 4MX7B 3OWEB 2ZOOA 3ULUE 4YXLH 3HLKA 2YJQA 5KBMA 2F0VA 1I3RB 3DO7B 5AFWA 4LLDB 1RZJH 4TSSA 3VA5A 1BMGA 1A1OB 2YD8A 5I75C 5L2KB 5I76A 1HUNA 1QB5D 5DM73 3QDAA 1U2HA 5EJWA 4FQJH 1JCKA 2JB6B 4POZD 1KNAA 4KKAD 4R26H 1ZDQA 1O7VA 2WBJC 3P4OB 4JPQA 1ZHKA 3O41B 4Q89A 2Y25A 2YYZA 1MLBB 1MWOA 2O6CA 2X4OA 3LPPA 4GH7B 1AMXA 5TTRA 4ZFQA 2NY5L 2VZTA 3VXMD 2OI9C 4H1LH 3RVXC 1S4ZA 3LMJL 3O8XB 4ZW5A 1D1KA 3UAJD 4DUVA 3CUPB 1FG9C 3S37H 3UIZA 3O0RL 2H1PL 1X3DA 3KF6B 4JN1H 4XC1H 2NVXB 4GB9A 3OKKA 5DK2A 5HHQA 3GTOB 1A2YA 2H0JA 1G1YA 4HBCL 3E6FA 1F02I 1Y6MR 4G2AA 4BFOA 4DUYL 1BQHB 3HMWH 2P5EB 2BNUA 4OI7A 4Z7NF 1I7TA 5M5XH 3KLAA 1A3LH 5DLMH 5DMGC 2NSXA 4WI4A 3PGCA 1HZHL 3FQ1A 4AH6A 2XKUA 2VDKB 2NXZB 4LLUA 4Z95H 3L5XH 5EEXA 3N04A 1LQSR 2JNZA 2Z31B 43C9B 1Q9KB 3IL8A 1ASZA 2DMGA 2BVTA 3MA7A 1CF8H 2Q8RE 2OMTB 3TREA 1ONQA 1CGXA 4JHZA 3RZCA 5FYLE 1FNGA 1I1RA 3WTUA 1V8HA 4E9YA 1OWWA 1IGTA 1ES0B 1F4YH 3ATEA 3NJVA 4JLRB 3VFGH 1HKLL 5C3EH 3RPIB 3T8XB 2JQOA 2PW1A 4WEBH 2QVIA 1PKOA 2CO7A 4QHNA 3S15H 1B4LA 4JHBA 2VQEL 2ERJB 2IPKB 2I25N 3UTQA 1G9EA 5DUBB 5DD5L 3AU1A 2HVBA 2BS9A 4TTGA 3ZE1B 1S8DA 4NZRH 1FCCA 1JI1A 1HXKA 3RFRA 5MENE 1YY9D 3O2WL 3OMNB 5IGCA 1OTSC 2GUYA 4HF5H 5HYIA 5EO0A 1I6HH 1NCDH 3MRJB 5F7DB 2OYPA 4N26A 3D18B 4IOIA 2VISB 1NMCB 3KEHA 3P73B 4LSVL 5JMRA 3BDYL 2AF2A 4JPSA 4MNGA 4RBPK 1LNUB 4L8SB 4OZFB 4PRNB 4HX1A 3PWJA 5E4XA 4KK7A 3EYSH 2HRHA 3O6FA 4KHPQ 1QVCA 1KXVC 1RZIA 2B2XH 3H55A 3TN0C 3VDCA 5C3EG 2V3FA 1S7RA 3WO4C 3RZDH 4HUUA 5CF3A 2KCTA 1DSYA 1KWKA 5BUAA 4K8RL 1A6AB 2X2IA 5GGVH 1MVUB 3PWLB 2VXUL 1BYNA 1FIGL 2Q7YA 3OKEB 3AFPA 1KOAA 3BWZA 3VM7A 1KRSA 5DLLA 4XYQA 1MWAH 3DRQB 3FFCA 4LQ1A 2IHEA 4X9YA 4FQ1L 4ERSH 1U6AH 5HURA 2VW4A 2OCFD 3SIKA 1HFNA 2YN5A 1NMBL 4KI5C 4NZUL 5CN2A 5EPJA 3HOZH 3X2QB 4BCZA 3U1QA 3HCVB 3K46A 5CR1A 1BAGA 5A43C 3HTLX 1LO5D 2FD6L 1NIDA 4KGJA 3G4SA 1EEQA 3QPXL 2MP1A 1DOLA 1KPUA 4OCRL 3V4LA 4ZFGL 4JKLA 4R26L 2ALYB 1PX8A 3H4FA 2AXGA 4OCXL 1PHJA 2FQFA 3VXRA 4C56B 2FX7L 1NGZA 2E9BA 2EJMA 4LGRB 1L1OC 4GFTB 3D87B 4XVUC 3KVPA 4GEJA 1RHFA 5HYJE 4NUGL 4M8UA 1IC4L 2UUBL 4A3DG 4LSUL 4AEIL 1T1XB 2HD3A 1KPVB 1QUNA 5FDWB 2UY6B 5I6LA 4I48B 2YPVH 3MNZA 3CFTA 1KNEA 2CRZA 4KQ4H 5ALBL 3VXOB 2BA1A 2BY1A 2WXGA 4X6CA 4JJHA 4A7QA 4HDIB 1ZGLP 4G8IA 2A6IB 1K85A 4JQIA 5DJCA 5EZPA 5F1SA 5E3FA 2BP5M 5IIEB 4PJGF 1ZTXH 3D0AA 2XICA 4NC1C 4FO2A 1U8PB 3HVDA 4A7GF 2VC2H 2WLNA 3CH8A 2XWBB 3V0GA 3QYMA 2DQEL 2NY3D 1ROCA 1SHSA 4TM9A 3QZNA 3TFBA 3FOLA 3QUXD 1MBYA 4N2GA 1S9VB 3GXDA 2VZ3A 3FU7B 3QG6B 2F0IA 3OW7A 2R93B 2J0TD 2QSVA 3G5ZA 3ZE0B 5HHOD 4ANXA 1DP0A 1Z0NA 3Q7JA 4AIMA 2JI2A 4PJHA 3ARDD 3HOGA 1LTGD 5TK4A 4ZO8A 5CV9A 5DJ8B 2NX5B 3QRLA 1BLNA 4A3BG 5D2LE 4ZTPL 1GCFA 2UUCL 1ADWA 3VH8A 1BOSA 1GZPB 5E95B 4AYEC 3KYNA 5C4XG 2JCCB 1V10A 1GRWA 1HPCA 1KEGH 5BUGA 2WD0A 1S3OA 2C5DC 2CLVA 4R96B 2WYIA 4KKRA 1IQWH 3OAUH 5G5DB 4RSVA 3LKOA 5E8EB 2MWCA 3FMGL 4B3SQ 1WTVA 3IJSB 2Z4HA 2UVEA 4F33A 5KNDA 3MLTA 4L1LA 5KUMA 1KEGL 2J72A 3ARWA 2LE9A 3ML9A 2A77L 3ECBB 4IK7A 2XXMB 2XIWA 4U6HA 4YHLH 3E6FB 2R1YA 2B2XL 2AJVH 4H20L 3ZKNC 2RDFA 3MYZA 2J71A 2VMJA 2YEQA 4BY7B 3MXNA 3TNMA 1HILA 5K36H 3QRFM 1N8ZA 1UZ8B 1B4JL 4IDJH 2IBBA 3BH8B 1FNEB 5LKNA 4BY7H 4A2MA 3FOMA 3T8MA 3L7ZC 5EIVA 1J7VR 5ABAA 4JI3L 4TVPE 2IFFH 5DEGB 2N7BA 2CQVA 3ZKXC 5EHFA 3GXNA 1E9PB 4RAHA 4JI6Q 3V0JA 1U58B 4PJ7A 4OKDA 1AQHA 4JI7Q 2B2YC 2VRKA 2K3HA 3WS3A 4IRJD 2E27H 2IOMA 5IG7B 3RWEA 1LYLA 3K6OA 1MHPH 3O3DB 1X9QA 3R7RA 1P69B 3KCPA 4I13B 4IMKC 2P42B 4AZUA 4OIIH 4JI8L 1IC7H 2YEZB 2ZNWA 3KYKL 3M17B 4TUJA 4UOJA 3VFWA 1I5FA 5J1ZA 1FCGA 4Z8FH 4YHOL 3VFGL 4P46B 3IJHA 3EF4A 5CZXD 3TC9A 4M93B 4N2OA 1ML0A 4LFAQ 5ELCA 4DJMA 3DROA 3HG5A 1IGIH 1MHEA 3VRLE 1JGIA 3HAEH 4LLVA 4HC1A 2D5DA 4G7HC 2BP8B 1NGXA 2IAAC 3ARVA 1DBKH 3MRIB 4FLRA 4QTHB 2BSEA 1HTPA 1WAEA 2QTEA 1AZBA 4EZJA 4KI5D 1X32A 3GXFA 4PBWD 3K8KA 3SGKC 1ID2A 5FXCH 4OXPA 3GSQB 5D1ZA 3S4SG 4B3RQ 2A4CA 1I7RA 4XNBA 5EFIA 2H2PD 2BH8A 1ET5A 1UD2A 4RMRA 4WU7B 3KWXA 4DV6L 4RAUC 4HXAL 4X99B 3VXSB 3MTXA 2UXBQ 3U30B 4YGVB 2WFWA 2WNKA 3SK4A 3QDGD 1IARB 3COOA 1USQA 3LKSA 4MD4B 3U2IA 2XV6B 4YXHL 3APDA 3E9UA 3OJMB 8CGTA 2KUMA 2AQSA 4LPCA 1QPKA 1W0VA 3T0EA 2K75A 4K3DL 5CWSB 2J1WA 1V1PB 2D9QB 3MRCA 3DV6A 3QIWA 3MLVH 4XX1G 1U8LB 1E5AA 3W0WB 4A66A 5ACLA 1L0YA 4IMLA 5I1CL 2EIJB 4JG0L 4QHPA 1JVLA 3FTXA 4WI3A 5DJYA 4HJTA 4OGXL 3S3SA 1XXGA 3CBJB 1DSWA 3C8DA 1U9RA 4HKZB 4W9DC 3CAMA 4MNQB 3CFCH 1NNXA 3EO9H 4M7JL 3NA4A 2IPKD 1SMAA 4EBQL 3IEAA 2E8ZA 3MNMA 5IGBA 3AVEA 4PJIB 4G7YH 4M7LL 2DIBA 4PMEA 3T2PA 1T2JA 3VE0A 2JELL 1PJ9A 3Q01A 4OX9L 4AYFA 3K6NA 5T3XL 2ICES 1TJHH 4UT9A 4L4TE 3CVHL 4L37B 3WN6A 1WYDA 1XIWC 3KBEA 4PJFB 5A2KH 2CJUH 3QUKA 2VUOA 1NFIB 4MB1A 5H94B 3W5NA 4W9KC 2DL2A 2GABA 5DMKB 3RA7L 2FYYB 3I02B 3IDGB 1ASQA 3QXTA 4YAQA 5A3ID 4V190 1FQ9C 4OZIE 1AZRA 1LP9B 3EDEA 4HS6B 1U4FA 4AV5A 4GKLA 3I74A 4CVWA 1VQ4A 4X6CE 3IJEB 3WIFB 4JPBW 2JFCA 1QHPA 1EYCA 2OMZA 3C5JA 3CZFA 4HS3A 4TQEL 3W2DH 1SVZA 1A5FL 2UZIH 3ZKXB 4DK3A 4YWLA 1EZSA 3KPRA 2XACC 5BXFB 3HS8A 5I30H 3MRGB 1QA9A 5ES4B 2HSIA 3CX2A 1CFNA 4HIXL 4PLNC 1E40A 1ZYRD 3BPOC 5JYMA 4GLXA 1GS7A 1QE6A 1OTUC 4XI5C 1CD1B 4DR1Q 5JW5B 4YQXL 5D1ZD 2EJGC 1FYCA 3NZUA 4ODHH 5IM7A 3ABMB 3NZSA 4RMWA 4DSYA 1IFGA 1HYSC 3DOIA 4BXVA 2E9JA 3SBRA 4HLJA 4AM0A 1NOFA 2A74C 5EZOH 3KFUA 3WAJA 1NGPH 1DEDA 5GS2D 4NW2A 3QPKA 4G8AC 2H2SC 1HXYA 3B2VL 1SMYD 1XD0A 1XXFC 3SBWC 5CP7B 1OANA 4QIRA 4UBDC 2PN5A 4Y2LA 1IV8A 3CMOL 2OZ4H 1NC2A 4DFAA 3HBQA 1EGJA 3GQBA 2MMXA 2DICA 3GPSA 4DGUA 5FGBC 3UAFA 2CAKA 3HA0A 4W6WB 1JVOA 4BWTA 2YV5A 5DEHA 2WSKA 4M3KB 3NGBB 5H35B 2B29A 4AYBA 4DZ8A 4TULH 4AYMC 5E8NB 3IFPA 3OAZK 2YOAA 3LXUX 5HHVH 2VR6A 2NT0A 2YPKB 3SDDB 3PS6A 2FNWA 3J80E 1UXSA 1WCMG 1PV4A 4FN0A 1BPLB 4LVHC 4K3JL 1GZQA 4QXVA 4ICWA 2OPCA 4ZMXA 5FB8A 2ZXWB 3TO2B 2WKOF 3NK3A 1QTSA 5C0XG 4IPDA 2I26N 4BK4A 3UTSD 1XYIA 5LVEA 3MWYW 2F54A 5L7XL 4GKJL 5KIXA 1KPRA 2PKDA 2R69H 4JHUA 4R4TA 4FQCL 4HCRL 1E6OH 2V2WA 4XN2A 1A2YB 3N1GC 2IH1B 5LMUQ 1CDBA 3LRHA 3SDYH 1RJYA 3QUZA 4OJAA 2B1HL 1IIKA 3HBGA 4PYHA 4U3HA 4YOKA 3QUML 2Y9RT 4GSRA 3B7TA 3AMKA 3Q2VA 5LCVA 2L7JA 2LXJA 2AMGA 2F8VA 2FIRT 1ZS8A 2YAQA 4HMDA 4K7PL 1JJ2A 3HAEG 5DD0H 3P3UA 4E5XA 2Y3AA 2A0LC 1BWMA 3GXPA 4N4YB 5AYQA 5F7NC 3U9SA 3VGHA 4WY7H 1GKEA 2A74B 1ZSDB 3KXFE 2OXPA 2EO1A 4OI8A 2ZYIA 4B08A 4YMPA 1AI1L 5KEEA 4KJWD 3A7AB 1WZAA 5L37A 1FVEA 2GUOA 1E7ZA 2WXIA 2YLKA 2IGFL 4GKSB 2BCKB 4RH4A 4X7TB 2IBZY 5F9WC 5KAQG 5D4HA 1CFVH 1HI6B 3QDJB 2GIXA 4DEWA 5CM1A 2L4OA 4MA7H 5GGVY 4C54A 1F41A 4MX7A 3RKPA 1Y18A 3IFNH 4IRZA 3QUMA 2X0VA 3B8YA 4HJ8A 2NB0A 4G5AA 2GJ6A 3VD2A 3DBXB 2EECA 4NQUA 5C0JB 3KBGA 3HI5H 2F0WA 2IBZX 4I18A 4XBEL 1MHHA 1E9PA 4G9FA 5FA4B 1I53A 3QRGH 4HKXB 3T3PF 1RIVH 4E42B 1NAKL 2WBXA 3CU7A 2AP2A 1OP3H 2VW6A 2SEBA 3INUH 3PP4L 1EDYA 5EEVA 4IIQB 3HHSB 1GJUA 3UBHA 3OR6A 3ZVVA 2X87A 3MVVA 1E50A 4W4OC 1GMEA 2A1WH 5AAMC 1CURA 1NIFA 3QUMB 3G9VA 4MQXD 3V05A 4OBSA 1EAQA 1PSKL 4HIPA 2JYOA 1YJNA 4X6FB 2X1OA 4K2LA 1FH5H 1NBCA 2Y1AA 4J3OF 1NBYB 2R39A 3H9SA 3M4YA 5T1JA 1ZIAA 1XGYL 5IYBG 2OMYB 3L45A 3VGAC 2ZWZA 4OIFA 1E3XA 5A1AA 4XN4A 2Q2TA 1T5WA 3O11B 2W65A 3HC3L 3DJRA 3RUZA 1KLGA 4RFNB 2A6ED 1CYGA 4JB9H 3U7YH 1NR2A 1T66C 2WZPA 3GMRA 4Z7WB 4MB5A 1PZ3A 3VCLA 1E1TA 3QUZD 4XN7A 1EIBA 5IQOA 4GW4A 4ODUB 1D3CA 4J4PD 3RVTD 1A2UA 2VQ1A 2V8MA 4PBVC 3P4NB 4O9HL 2NX5D 1S5HA 3GJFK 3NMEA 4NQDA 3RNQA 4Y4FC 5I1DA 1S7SA 2M8XA 3DJTA 4PW3A 1HJPA 4WFFE 4RESB 1BP3B 4FNRA 3QZLA 1Q38A 5BVPH 2RGSA 5IW1B 1STEA 3QOJA 5C3IA 3GSXB 1YC8A 4FG0A 4OTXH 4MXVF 3W57A 1XMWA 1KDIA 5FR3A 4Z7NB 5JHLL 4G83A 2X4RB 1YHBA 2PABA 3HPJA 5EEYA 5D5MA 4ZFFB 3EGDB 5F0PB 4QXTB 3K81C 4PWEA 3DI2B 1X3EA 4G8EA 3TM6A 3PWJB 1EJOH 2XTJB 2YGOA 5FYKL 3MJ7A 2LY7A 2IX0A 1WA1X 4CJ0B 1DLHB 4MNQA 5C44G 3FSAA 1WBXA 4YHIB 3H3VH 1RU9L 4BFNA 3MTSA 1JZJA 4JHAH 1JTPA 2XTJC 2CDFB 3C5ZB 5ID1A 2VB2X 1KJMB 5JLZB 1XGPA 1ZRUA 3PIO3 1N26A 1RURL 3VYOA 4G57A 4V33A 3P40A 4PGBB 4L37A 5EUKA 4IJTA 3S88H 1E90A 2M9VA 1MIEL 2IO5A 3P9WB 2V5TA 1RKRA 3KVQA 3F6JA 5K39A 1WP6A 2NY0B 5FKPB 3QC5X 5E1AB 4KY6A 1OO9B 1F9SA 3INUL 3SVMA 1FZKA 3CXHJ 3WIIH 3HOZG 3WLWC 1OQOA 3F7YB 3REWA 1GTFA 3C6LA 3OB0K 1NL0L 4XBEH 4J3OD 1UH4A 2QKSA 3HHMA 5FS5A 3RURA 1C08A 2A6DB 2Q8AL 3UE0A 2CDGB 2VDMH 3QFDB 5KNBA 2QCPX 4C1NK 2JCCA 4K94H 3NIDF 4OQTA 3X1BA 1FDLL 4FRWA 1Q9WA 3MCKA 4JRYE 4M02A 3HS0A 35C8H 2MTAA 3DPDA 2QSTA 3AU1B 3MA9L 1ZEAH 5EH1A 4DZ8B 2B2UC 3IMSA 1G6RA 4QRQA 2Y72A 2F0MA 4B3TL 3L1EA 1OO2A 5JPNC 5ADOL 4TVAB 2DS4A 1FZMA 3FRUA 3U82B 1W0WB 4AWJC 4ZMWA 4EO5A 4A3EB 3B34A 3CC5B 5FLMG 4DXFA 1AHWB 4KO7A 4DGYL 4FXDA 1N6VA 1SDYA 2R2HA 4LNVA 1X5LA 1E42A 4M00A 5D1QE 4N0UA 4AQ8A 4MNGB 3QUYB 3U4KA 4XWGH 4NPJA 3UERA 3Q43A 1KL9A 3R0MA 4UM8B 3DX4A 3P11H 3HP3A 1XGUB 1HNFA 4TN9A 3D07A 3NK4A 4MJJA 2PWDA 2WBJA 3ZDZF 3HB3B 2C34A 3A47A 2QF7A 3QHFL 3TEXA 3QR8A 4F1SA 4Z3IA 4HDIA 3HOXG 2N4IA 3BVUA 1UD8A 2WB7A 4PD4J 5ALCH 4EZMA 3F85A 3Q6FB 3TBTA 1NEZA 3PL6C 1JUFB 2L5TA 3CDGA 1XIWD 3U7YL 5IQLA 3QDJA 2CXKA 3N44B 1LTSD 3DPBA 3SDDD 1GC1L 1NGQH 1AXTL 3M17A 3GBNL 1QRKA 2TRYA 4HEMA 5D2LA 2K6YA 1J5OL 1IBZA 2Q6WA 2G30A 5B3SB 3ECVA 3HRZA 3AITA 1CFNB 2B1AH 4B41A 1WTPA 1YHAA 1GJIA 4JFFD 5C0BE 4PV1C 2XZQH 2V5MA 2A6EC 1RUQL 1GUGA 3WGUB 4XXEA 2VM4A 4AT6B 1HHIB 1MHCB 2DAVA 4IPHA 2OXHA 4HWZB 3BXNA 5DR5H 4ZS6C 3TS2A 1BXXA 4DR5L 1NEZG 4EX5A 5IOPB 1R5WA 1U41A 2ZCLL 4P3CL 1ZYRC 5IT9E 4ZXBA 1Q4NX 3R06A 4R7NB 4FKEA 4KNUA 3MBXL 1TPXB 4U3CA 2JA7H 2DDQL 1NDTA 2Q6WB 2R4SH 5GIRB 3F7PC 4BA8A 4FFWD 1BVNT 3B3IA 3GXMA 4IQZA 1VPOH 2B5IC 3L4ZA 4IRSD 4ZAKD 3TSSA 4Q6KA 3R0NA 1CQFA 3KPLB 5I74B 4OV5A 2RVLA 4JHAL 3HZMB 3I9IA 1X6OA 1HCVA 2FWSA 5F89B 3FONA 5HVGB 2OA9A 1UNSA 5L4IA 4LOVA 3MMEA 5D1ZB 3UDWA 3KK7A 2EDTA 2VB3X 3M6DA 1TVBA 3DIFA 4FI6A 1TOXA 5EUOF 4C83B 1I8LA 2GJJA 2YQ2A 4JO5A 1BFOA 1YEGL 4WWKD 2QTVA 3ZE1E 1OE1A 4DO6A 1TVDA 2XVSA 4MDRA 4OF3A 4HJ5A 1HAUA 5AKTA 4HXAH 1AGFA 1AQKH 1YEHL 4KHZA 3V0DA 1VGEH 5I24A 3SQBB 1YNJC 1BXVA 3GYRA 5BVPL 4BFIA 1KCLA 2R0WH 4FL4B 4GLAC 3HOUH 3NACH 1UEYA 1OXYA 1CDGA 5JHLA 4MHHI 3VTMA 1KN4H 3DV4B 2GSIB 4O2EA 2JA9A 2CDEA 2VXSH 3ILQD 3FPUB 1J10A 1E7VA 1KCSH 3KM2A 4HSQA 5DVKA 2WB1G 5AG8A 2FNBA 4J3OC 2NY2B 4LSRL 4GW5B 3EH1A 5CIPB 1Y1WG 4B9XA 2F5AH 3SBPA 4OLVL 3GJFB 4FNSA 3L5WB 2VQTA 2PW7A 3OXSB 1JJGA 3V0VA 4OVVA 1SN8A 2K9FB 1HN1A 2C3GA 3WV0A 3ZK0A 2G2PA 2OTLA 4LNRA 4LLDA 4WGKA 3QQ3A 4HMCA 1WC7B 2VAAB 1HESA 4MBOA 4ZO7A 3VWKC 1I3QB 1FSKB 3FRPB 3KJ6L 4FQIL 2MCG1 1WBYA 1O7SA 1X5KA 3BSZL 1HCZA 1FHGA 4QI3A 2WAQA 1TVHA 1PKQA 2X89D 2OF1A 2HG5B 4LOUD 3QCUL 3DI3B 2D62A 4KY2A 4N0FB 3BUTA 5GRUH 3TTSA 4FXGC 4MJ4A 2ZONA 3DK2A 4L8CA 4OB5H 3BQUD 3J27A 2XX0A 4POGA 1R3JB 1AZUA 3QWOB 3QE5A 3L5WA 4XAWL 3VRLF 1JICA 1NUGA 3D0FA 5B39G 3QQDA 4CMHB 3APCA 1XWEA 1MXDA 3S1MH 2UWEB 1SY6A 1MREL 4JFTA 5AKRA 1YNTB 4X3SA 1D5XB 2D4FA 4LSDA 1AO7B 4JM2C 4PEEA 4MAYD 4PJAF 3GIZL 3KW8A 4UCFA 4U1SA 3WJJA 3VO0A 3H9HA 1AS7A 3AMUA 5CFAA 5GGTH 3QAQA 3V0WH 1W91A 4X66L 2KPWA 1JWMD 3QRBA 2DM4A 2EE1A 4DN4M 4AYFB 1XF3A 2DEYX 3EH5B 4JRYB 1NEPA 4PLKD 5IJCC 4OONA 3C60D 5C6TH 2UZXA 3EYFA 3H6JA 4ZUIA 1WZLA 1GTNA 2UWEE 1KGCE 3MXGA 3D4DA 5EOCJ 3RZCB 4KKUA 2COVD 3PABA 3BVWA 5GSRA 1CGUA 1YN7B 2P5WD 4I3RH 1UC6A 5I8CB 2A83A 5E5RB 1NBQA 2H6OA 3DHUA 3PAYA 4AE0A 1A02N 2G75A 2NYYC 4CC4C 2VDPL 4RMTA 4Z7UA 5KSVB 3LNDA 1X3PA 4UOW1 4EXKA 2ZSVB 4O00A 3U9OA 3ULSA 3NPSC 3DHMA 1U8IA 1RUAL 2H32A 1RJLA 3HFML 4NKDB 2X9YA 1EY0A 2Q3AA 4PJXB 5I75B 4QRPD 1YEEL 4J3SA 5J4MA 2Y7LA 5HDBE 2HA1A 3PV0A 3OL2A 4K7FB 3PDOA 3H3PL 5CO1A 1W2KT 3MKGA 5K59E 2WTRB 4ODSH 3CLFL 3OQRA 3UGEA 5D7LB 3VFTA 5IGXL 2CBMA 2J5LC 4M6AA 4NZTH 5I0WA 2YKLH 1BVNP 2AERT 4E41E 2EKJA 1U8PA 4AQAA 2NY3B 5K1JA 1H9SA 1K5WA 1KGYE 2ID5A 2JCCE 4N22A 5IZ7A 4F9PA 2FMMA 3QJOA 3R8BB 4BH7A 3U2SA 2YLHA 3PWVA 1ZLVK 4IBYA 1F6AB 1UVQA 3DVFA 5EU4A 1XB3A 3MNZB 5IQNA 4UQ9A 3PNWB 4Z9CB 3MV7D 2FYYA 3IDGA 1UURA 1WV7T 2WAQG 1OGAE 2RCSH 4YAQB 1I9RL 1ODAA 4HAKA 4RGOL 2VSDA 4DTGH 4ZRZA 1AZQA 2J6WA 3CFMA 5L8KB 2F0NA 4HMJA 2O72A 4PGZA 4KROD 4ZPVB 3MGOA 3CC4A 1NLDL 2ATPA 3QJTB 4KV5E 4P49A 3RY4A 4UTBA 1FI8C 3BDXA 1S9YA 3QI9B 3PUUA 4TTDD 3S1NH 1PIGA 3FMGH 3UPRA 1K2DB 5IK3B 1WUZA 1HZBA 4OY9A 4OVUA 2OX5A 2WXFA 4U2YA 1EZLA 2VLJA 4IIQC 4PREB 2RAMA 4GS3A 2HT3D 2X12A 4KOCA 4TV3A 1IBDA 5BO1L 4TL5A 3ZT5A 3GB7B 3ZT6A 2KCMA 4JGMA 5DZNA 4DKTA 4LLWB 3DUSB 3S17B 1BBUA 2JKIS 3PWPD 2PMZE 4KROC 1MG3C 4OZGF 3HI5L 1K3BC 4CVUA 1S9YB 3QI9A 4J5VA 2V17L 3FQ2A 3PQYE 3QIUD 1A9VA 1RIHH 2O6DA 4YWKA 1HH9A 1FFPA 1T21A 5F8RC 2AQPA 4U1JB 2W60A 5JPMA 3TX4A 5CR8A 4NQEE 2CRIA 4XMLL 5EIIG 2P8LA 2IGFH 5A16A 1TO4A 5BV7L 1IAKB 1KLUA 5DDHB 1RIHL 4MCMA 1JL8A 4Y16C 5IBLD 2R3ZA 5E1FA 1IC7L 3KYKH 4BE5A 3ERSX 1TJIL 5DRWA 2IWHA 4QRAA 4YBQC 1ZK9A 3ETTA 2Z4QA 5A40E 5DHDA 1NAMH 1E28B 2ZUWA 3OKMB 3REVA 4ZFZB 4W1TA 4QIWE 1I1AC 3PAVA 1KYAA 4EN2A 2VDMB 1KJVB 1FC1A 1CUKA 2JA7G 2Y5TA 3K71A 2WXKA 1IVTA 1HA6A 1MAMH 5H8DA 3SDCB 1IM3B 1HOEA 5EIQA 3P77B 1DE4A 2P5EA 2EXYD 3D6CA 1KBGL 2W81C 3SEPA 3T0DA 1ZEQX 3SKNB 4P4KC 4KXDA 4TPRH 1Y14B 1CF8L 2EINB 3QEHA 3Q1EA 2C9UA 4DP5X 3EHBC 3QEQB 1HHHB 2DBJA 2HRGA 2VW9A 2V9RA 4HIEB 1U6AL 1ACYH 3I3EA 4F57L 4NNXA 4MBRA 3FEWX 5G4MA 4I18B 1PZUB 4MRCA 4UOW0 1BM7A 1ZKAA 4DAVA 3QR0A 1S3KL 3NIFE 1T9HA 5CV7A 3HG3A 2OT2A 1W6JA 4U6XB 1N2RB 1B53A 3NEXA 4ABWA 2BH0A 3DETC 5FF6A 1LYQA 3JUZA 4JMXA 4PRAB 2NYZA 2LHAA 3LZFL 3UYOD 5I5MA 3LTVA 3O45A 3BP4A 4F3FA 2P5ZX 3V95A 3GK8H 4NN5B 5FLUA 3BH8A 5BV7B 4HEPG 3HOXH 3LWUA 5AB2A 3IWVA 3GI9L 1BCPC 3L9RA 3F2BA 1J87A 1FNFA 2HX9A 3TO4A 1TSHA 4LIQL 2IJ0C 1H3GA 5FYLH 3UC0L 3HKZB 4E41D 3U4BH 4Y9BA 5HYFA 4DNTB 4LSVH 1BVLB 4F92B 2C7FA 4ZOAA 5FX3A 2HMID 4NWUH 5FUOL 1OK8A 1S7SB 2D31A 2EE3A 3GMPB 3I3BA 1STGA 1TQBB 3GMNB 3VD0A 2QPFA 4A3IB 4XCEB 3M86A 3V6OC 2PXYA 4MJID 4HJ0D 2OTUB 2NVYH 2WLJA 4GG6A 1XGQA 3VTTA 1SGKA 1Q8KA 1B6DA 3HOUB 1ZTXL 4GYBA 3NZ8A 5KSAD 1E