5JPNC

Structure of human complement c4 rebuilt using imdff
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
290
structure length
290
Chain Sequence
APKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Complement C4-A
publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
total genus 55
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jpnC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 5jpnC01
3OHXC 2XWJB 3MA2B 4D94A 2WINB 1D2BA 2TMPA 3CU7A 4FXKC 2PN5A 2WIIB 5JPMC 3L3OC 4FXGC 3HRZC 1BQQT 5FOBB 3KLSA 3CKIB 1BR9A 3FRPB 1BUVT 4ILWA 1XWEA 3V96A 3I70A 2XWBB 5FO8B 1AYOA 1JC7A 5FO9B 3T4AC 3G6JB 2E2DC 1PXUA 4LNVA 1BV8A 1UEAB 2J0TD 3HS0C 5JPNC 2I07B 1GXDC 1UAPA 2B39A 1JB3A 1OO9B 2ICEC 5FO7B 1EDYA 2A74C 2A73B 2QKIC
chains in the Genus database with same CATH superfamily
1QRNB 1XH0A 3KM2A 1L3NA 4R8IA 3QSKB 1CD1B 5D2LA 5LLIC 1D2BA 1MCJA 3ULJA 3BS1A 3MGOA 5AYUH 5BV7B 3K7UC 1CDHA 3BSZH 5D2NE 2XBDA 3IMVA 3L5WA 4FNPA 5GZOD 1WFOA 3DX9B 4XB8A 4HS8H 3CIQA 4QRPD 2R7ZH 4HGWB 2GAZA 4Z5RB 3T4AC 3A6CH 1AKJA 1UJ3C 2Z93A 3MFGA 1FGVH 4NPJA 3U36B 5I1KL 1AR1D 5KNCA 1Q9LA 2QGBA 4QTFA 5IBTH 4GMSH 1ONQA 2K4WA 1PKQB 5IB4B 3TMEA 4Y1TA 1JF1B 1T20A 2Y22A 1MNUH 3UAEA 4PG9A 2RCFA 3L3IB 1Z66A 3QARA 1SNCA 5CSZB 1XCQB 5GS0H 1KCWA 5EKKA 3C6LD 4NQEE 4JFQB 4UT6H 1INDL 4WJ4A 1MHCA 1NINA 4KTEH 3RDTD 5HY6A 1KSRA 2E74C 4IFDI 5L4JA 1UURA 5AUMB 2EUWA 3ND8A 1D6EB 2PMZB 3EA6A 1BBJB 2HG5B 2AC0A 2HRLA 1WAAA 1RUML 3B9EA 4OLXL 4XPTL 4R4OA 2Z8LA 4A3BB 1GGIH 2I5MX 1LP9E 3IGUA 2BJMH 2D0GA 2P5WE 3ZUCA 3OHXB 4NBZB 5KSBA 3R93A 3CD6A 4V0BA 1TQBB 4AT6B 4IBYA 5AZ2H 5BJTB 3GMNA 2VY3A 1WVLA 4P2AA 3HZVA 1QQDB 1ORSA 1Q8MA 5SX5K 1DJGA 1PJWA 5D7LB 4P2QE 1FR3A 3DV4A 5LL6X 3Q2LA 4OGYH 4K3HA 3CCSA 2CIKB 2OMVB 3CN2A 3CLFL 1V7NH 4YX2H 5K9JL 4WUUA 1R3LA 3P75A 1K8GA 1SAPA 1JRHH 1T80A 3NSXA 3TQYA 3NIGE 3V4VB 1D1IA 5CBAB 4W93A 5FA3B 1N0LB 2BE5D 2YEZA 4JZJC 3WFDL 4NKDB 5HDQH 1GHKA 5CFHA 5GISL 2IGFL 4PUBH 4DOHB 2VXVL 4TRPL 1JWSD 5E3FA 3OWEA 1S7RB 4ORGB 3ZDYB 5IB3B 5J6HA 4QIWB 4KMTH 1GGYA 4GXVH 4MSWA 3I8ZA 3CFDA 3GSNA 4J3OH 3GC3A 4R2GC 3KE0A 4ZFZA 4RMSA 2H32B 2E6QA 1BD2B 1VFUA 3MHZA 4L5FH 4PWEA 1S9KC 4KITB 3TZVD 5L2KD 1NBWA 1NMBL 2EO1A 5LMNL 1WBYA 3ND9A 5FXCH 1HI6A 4XNUL 1FNHA 1SNRA 1R5VA 2DWTA 4FP8L 5C7ZA 2Q87A 2Y2WA 3QUXA 4AYMC 2NY6D 4AQ8C 1UFUA 3GS0A 2JTDA 3LYRA 1J88A 1J0KA 4LSQL 3QS3A 5EF3A 4F15B 4L1DA 2FD6H 2VB3X 1R4XA 2CBMA 2OMTB 3M4OB 2IBZY 35C8L 4LP8A 4PJ6A 5CZKA 2RAMA 1IKOP 3KJPA 1CVRA 1C7TA 1JFQH 2B2XL 2BNRA 2MNUA 3IFLH 3NFNA 3BZEB 1JXGA 1B0GA 1ZIBA 5FR3A 4Z8FH 4D9LH 4JBSA 5BZWB 1QOHA 5EOTB 1LE5B 2H4EA 1EFXA 2FBJH 1Q1JL 1SOXA 1U8HA 4JHWL 4CU6A 4LF8Q 2XPYA 2Q9OA 4MMYA 2YAMA 4OH2A 2RALA 4JUSA 5B38G 4AQ8A 4QDGA 1HEJC 1MF2L 3VXQA 4A93B 3MXWL 2WPGA 3G5YB 1AQDA 1LTGD 5A2LH 1RHFA 1CGVA 5IYCG 5C0CE 4AYSA 3KBHE 2K14A 3PHOB 1ACCA 2NCEA 2BSDA 3CPLA 1PH1A 3LEYL 5F8RC 3I02A 3AJ7A 1KB9J 2R29A 3IGFA 1DQQA 3MJ7A 3STBD 1P4BL 4APXA 1GVIA 1TETH 4HMDA 4ANKA 3AQZA 1ZGLA 2PTVA 2FR4B 5IJKA 1FLRH 3VFVA 2VKWA 1DVZA 5F3FA 4BA8A 2E7MA 1URLA 4PRPD 5IR1A 4P4KD 4U1KA 4I18C 1JNHB 2BSBA 3L3JB 4H7BA 1O5PA 1C7YA 1BO0A 2F0VA 2CBTA 2K6ZA 4PJXF 4XGZB 5CF3A 1PIFA 4C3JB 3QFGA 4X7FC 1E5BA 1S7QB 2GYSA 4X50A 5E2JA 2MQ3A 1YBYA 2XV2A 3TP7A 3JV6B 3NIDB 4Y4FA 5FO9B 4Q9QH 3APCA 3NGBB 3MV8A 1T1XA 3ZIMA 4ZMTA 2HJKA 3V6ZA 2LFNA 1BKBA 1EJ6A 3VJ6A 4LT7A 1ZAGA 4OUUB 4IBWA 1LO0H 1NC4D 1W72A 3O6KH 2XSKA 1U8IA 4XOCA 5A16B 3V9EA 4AJ0A 3AADB 1J9TA 1A9EB 1KRTA 3GXNA 5F0JB 4JLRA 2W92A 4H02A 3VA6A 5I6XB 3DM1A 4I18A 5BXFB 1CGSL 2Z0SA 3V0WL 5ABZA 1P9MC 4YPGB 2WUBL 4LVHB 5IGDA 4RMVA 2ZCLH 1Q9OA 4HUUB 1DOKA 3LN5B 4NFCA 2V7NA 1QLRA 2XXGA 4M3HA 3AMUA 4GLXA 1C5CH 1B9MA 4ZTOH 4XQJA 1OT1A 4LLUA 2VDQH 1AIZA 3FQNA 2X2YA 4DP5X 1UHVA 1VS0A 2AQ3B 2ZXWB 3CZNA 1MCSA 3OKNB 3UROR 3C2AL 4JQIH 3DDGA 1ED3B 4PRDB 3OZKA 4BFEA 3QWNA 5E03A 1JYVA 4BDVA 4YHIB 3WO3B 1FNGB 1W0YT 3MUY1 2AMCB 3K6IA 1TXKA 4IRJD 1AFVL 5C8JB 4H88H 3NUCA 4WI5A 1E1TA 1CS6A 3BI9X 3U0TA 1N70A 3KJOA 3CVIL 3TGXA 5BZDA 4LFBL 3C08L 3X1EA 3SE9H 1UUPA 2D3JA 5E9DD 1F1DA 3GSUB 5FM8A 4CC4A 1UT9A 3T2NL 1JWUA 2XZZA 2Y7OA 2ZXRA 3ES6A 2ZTCA 3ABZA 4DZ8A 5CZVL 2E7DA 5FUOH 1SN2A 4P9HL 2I9LA 3RA7L 1U8PB 4HK0A 4M8RA 2HTKC 3FONB 3UBFA 2HT3D 1D5RA 4M6NL 4U1SA 2PQEA 1VZGA 1X3QA 3LXAA 3MV9A 1MI5D 3ARGB 5CU9A 2Q5BA 4AC2A 2WINB 4HIXL 5CLTA 3VQ2C 1HL5A 1J5OH 4ACTA 4UT9A 1OB0A 5TGBB 1EAJA 2A6HC 2IH1B 3L3KA 3TBBA 1I9RH 5C71A 1MJJB 3FMGH 1BCPC 2ADJB 1AYOA 1TO5A 5DMJB 2XBTA 2WO2B 2BXZA 5FOBA 2W38A 3EXLA 3HB3C 1ZA6B 4RA3A 4WO4C 1F3JA 3FTXA 5TDNB 4BFKA 4O2CB 2FGWH 2KBGA 2ZOKB 1U0QA 2CO3A 4HZLB 3RVXD 4S11A 3AT9A 1HHHA 4N0UA 3D85D 1VFBB 4NRYA 2OZ4A 5JIMA 3BRDA 1IM9A 4P3DA 4LW1A 1A7PH 1DJIA 4ZMWA 1FZKB 2Q0ZX 2AJUL 3FRUA 2XZAL 3GD1C 4JPBW 1AG6A 4GKJL 4YHKH 3UDXA 3BCFA 4QHPA 2J4XA 1FO0L 1HS6A 1U92B 3D50A 4N9GB 3WS3A 7TAAA 5IY0A 3I2CL 4B3EA 3N43B 4HS3B 2TRHA 1EXUA 1QSFD 1SGKA 1GUWA 1JZDC 4HIPA 1P53A 5I9QC 4HCIA 2YQBA 1CGYA 2JEBI 3T0XA 5FYLH 5AENA 1T1WA 4NGHH 1LK2A 4ZOBA 5BQ7B 1ZT7B 1KNEA 4KROD 4R7LA 1SXZA 4LLYA 4XP4H 2AJXL 4WNQA 1PV4A 8CGTA 2ADGB 3HG2A 1B8AA 1UA6L 2WQ8A 3IBOA 5EU3A 5IT9E 4TPRH 4HBQA 4JFED 4GN4B 2J12B 2ED8A 4P2CG 4HT1H 4JCVE 1MCOL 2XJKA 1SE4A 4P72A 2ZZUT 3F64A 1A1NA 3KPMA 4KFZC 5ELCA 4HJ5A 2GSIB 1DQLL 1CSQA 4KZCA 2QEJC 5EU7C 1U36A 1GYCA 5C7XL 1GZHA 4LLVA 4GP8B 2MQGA 1CLOH 2OXHB 1D2OA 2K05A 1BVKA 5JNYA 3MC0A 1GXDC 1XTCD 1I82A 4N6RA 4HJJL 5CU5A 4CADB 4MNHB 5CN1A 4IUPA 5C0IA 3HE6D 2CRYA 3FT1A 1MXDA 5T1LA 3SDYL 2VXSL 3GTJB 1OXVA 1FL5A 1N64L 2NNRA 3DPBA 5AW2B 1KG0A 2A0LC 3QDGD 1XTDA 1EYGA 2Y7QA 4J3TA 2EY5A 4JDEB 1D5XB 4S3SA 5F9OH 1EERB 3VR6A 4C1NI 1HTYA 3O2VL 5JHLL 3NDZE 3QQNA 3RUGA 5A7EA 5C6TL 1DJXA 4RQQB 4YHZH 3QNXB 2FATL 1HJCA 3UTSA 1D5ZC 1CK0L 3UPRA 2GJ6A 3I6KB 4YHPB 4G5AA 3SJVA 1ICWA 4L05A 9PCYA 3BPLC 3E0GA 4HA1A 4GNXB 3T1YL 4X9FA 2XOTA 4DV7Q 5BRZA 4I3SL 4QWWD 4XP1L 4F7MA 2NN6G 3L3DB 5C4XB 3V7AG 5CCKL 5E2TH 4FI8A 2J6WA 1B50A 4EOWL 2R27A 3E38A 2VW9A 4MZRA 3VMPA 2NT1A 5IHUH 3P9MA 3B56A 4POZC 2XN9B 4AENB 1U9KA 3GSWB 2NZHA 3P0VH 5EBGA 3S96B 3EIFA 5CGMA 5I1JH 3GDEA 3U9PL 2CO4A 5JDSB 2UZIH 3MNZB 1E67A 1XTLA 1D5ZA 4GO6B 2ZKWA 3ESOA 4KI5E 3JYBA 2PP7A 3PP3K 5C0AA 3GMOB 3IAPA 3ZZ1A 1MCLA 1NWOA 1KGCD 5KYUA 4QY8B 1S7XB 4QOKD 2O30A 2X5PA 5DRXB 4FFWC 5L88H 1OM3L 2AJZA 1AZNA 1REIA 3M3YH 1KC5L 2P7TA 1QASA 1U95B 1XF4B 1KEGL 4RSYA 4UNUA 5DWUH 2VDLB 1UWXK 1RUKH 4UM9A 4D0DA 5HHMB 5ISRA 2CHZA 3E6ZX 2BMKA 2VLKE 2WO3B 4OCNC 5E24E 1WFJA 3E2HC 3QUML 2E7CA 4H13C 3Q6FA 3GUTB 4NQQA 3K6DA 4PRNA 1B6UA 5E1IA 2Z0BA 1MSPA 3L1FA 1W6LA 5HGTA 2EE0A 2CGRH 4TQUS 2Z7ZA 3CSYA 3BVUA 3MR9A 2Z8VC 1YN6A 2DQDL 4ZMZA 1P4IH 4GW1A 4KKZA 1A4CA 1RZ8A 2CM6A 1B0RA 4ENZA 1KNAA 3FNKA 2NNCA 4RWHA 3VWKA 3O9WC 3ARFC 4XHQA 2X6UA 2NQCA 1I8IB 1HNYA 5D7IF 5AW9B 3B2MA 2XTJD 2F74B 3NCMA 1SJEA 2A9CA 5F88B 3RIKA 2HSIA 4JG9A 3OSOA 1MKFA 2OJZL 3FB6A 2WXFA 4OJYA 1GS7A 2O5ZH 1WK0A 2AQ2A 3ILQC 3QNFA 2PR4L 3K5RA 1IBZA 4M4PA 4OF5A 1MHEB 3FP9A 4MKTA 1IYVA 3EJCA 2G4GA 1AZRA 1M56B 3ALPA 1KZYA 3OW2A 1ETB1 1Q72L 3EFFB 4KKNA 4ZW7A 3ZL2A 3S8WA 3O9WA 4Q97A 3NK4A 5KVFL 2VLRA 4MDJB 3NJKA 3DTDA 2XDHA 2RH0A 1YMMD 4JM2A 4IDLA 3B8YA 5C08A 2WXHA 3QUZC 1XHHA 2EZ0C 3FS9A 3HN3A 4WU7A 2HFTA 1G7QA 3EGDA 5JW4N 2F1MA 1FYTB 1P7QB 1WA2X 2PW1A 3VRIA 4A7VA 3D2UD 4K7PH 5TE7H 4DR6L 3QNYA 2TSAA 4X7SL 2JA6H 1DDHA 2RD0A 1S4ZA 3MKGA 1KWKA 3VDBA 2R0KL 4YCUA 1EYDA 3CWGA 2GTQA 2VQEL 3N85H 5C0NC 2DJFC 4KJPD 4WWKA 2QPUA 2CJUH 5KVEE 5KBNC 1N5YL 3F65A 1XMEB 1QI3A 1W91A 4ZFOL 4QTHA 4FXGC 1FJGL 3JT0A 2PLTA 1CFTB 4UF7C 2XBZA 1KENL 5CCHE 4MQSB 4NNXA 3JTTB 3V96A 3ECUA 3I7FA 1U8CA 3WJJC 5L0QC 4K9EC 1UM5H 1ZHNA 2KDGA 4XH2B 1MZYA 4OZGA 1OV8A 2TRYA 1SYFA 4YFLF 3H3VI 1CI3M 4ANWA 1QUNA 4NQVA 3VXUA 3ASWA 4CC0A 3K59A 1TWAH 3PYCA 1CFNB 2CCZA 4DV5L 5DZNA 4KOBA 5D7JB 4ZW8A 4LARL 2DJUA 5SX4I 4XYQA 1G9MC 1ZSDB 3TV8A 1EY6A 3GKWL 4RRPA 3UYPA 3OV6A 1GAFL 3TIDB 2TMPA 1HH2P 3UZVB 3QVAA 4F8OA 3AVEA 3A0OA 2LV4A 2Z8SA 5D2NA 1A66A 5H2BA 2UWEE 2K1MA 2B2UA 1HHGA 5KANG 4A66A 3J07A 4LXFA 2UX6A 5BW7C 3TVMC 1IZ6A 1JGIA 4OZFB 4WW2F 1X3FA 1VGKB 3KLKA 3QRFM 3EADA 3NBHA 4XNQB 1MAJA 4Y4HB 5C3EH 3QIWD 4TVPH 4Y16C 4Y2NA 4X0KA 5F1OB 1FNEB 3PJNA 4GMTL 5GGSB 4XCNA 1AY1L 1N18A 4JE0A 4BFRA 4TNVF 1S7SA 4U1NB 1PD1A 2NVQH 1DVFA 3FU7A 4MMZB 1PBYA 4DQOL 5I1AA 3A8IE 2E6PA 3KXFB 5F1NA 5EPLA 2AJSH 2CO6A 1FFRA 2FLBT 2VZUA 4X8JB 2EVIA 3RRQA 3RWFB 4HVBA 5I75C 5KS9E 1P7KA 1THAA 4WU5B 2WCPA 4TSAH 4OGXH 5BW7A 4JFFA 1J9OA 2EYPA 2H1EA 3S36H 1NMAH 4S0HA 3CZFA 1LP9A 4IS6A 2P5WA 3IB4A 4GY4A 2V2TA 3FUDA 4OCWH 3V2AR 5A6MA 2PTTA 4HS6A 4WW1B 4Y16A 1X6NA 1YPZB 2KERA 5JPNC 3FT2B 3V7AE 2IF7A 3V6FB 4AMXA 5TE6H 3UG4A 4GSDH 4I0PB 4P2QA 4QB4A 1DCLA 1YMHA 2CKBA 3OC8A 2IAAC 1F3DJ 1JVKA 1KN4L 4CDGC 2VITB 1RP8A 3DA0A 3STLA 2WLJA 2ENYA 3ZY7A 2C1OB 2YD6A 4HN7A 4WI0A 4XP5L 1Y6NR 3Q1EA 3KPNA 1BGXH 3VE0B 3JAME 1GW0A 1J18A 1RERA 3JSSA 1HE7A 3WXVH 2BNQE 2ZWYA 3VXRD 1AP2B 1RZIA 4C4BA 2NZ9C 2GY7B 4QUOA 3CFJA 1LEGB 3HZMB 3ARDA 1DQMH 1U8KA 4YO0B 1R0AL 1NC2A 5JPNA 3IU4L 4NNYA 3TSSA 4PZ6A 1RUQH 3CK0H 4LLDB 4MZIA 3PXLA 4R9WA 1OO9B 3S5ZA 2WXRA 2D3VA 1EHKB 4F58L 2IH8A 1C8CA 3DRTA 4AMWA 3FTYA 3HMWH 1P7HL 4KHPL 5JW3L 2N4IA 2Z6KA 5J39A 3HOZG 5IYDG 2NW2A 5IGXL 1JPFA 3BEVB 3AU1B 1JN6A 2WO4A 4TTGA 1YEFH 1NFAA 2PCFB 5E1HB 4XMKL 3MOQA 5E8DH 3FPXA 1K8IB 4IGBB 4MMXC 5FEBA 3SGIA 1ADQL 4NT6B 1HU8A 4OHJA 3NZUA 3PV0A 2IQAB 1DLFH 3SE4C 2CSPA 2AUKA 1CFBA 1TZIB 4FNSA 4GP4B 1BBXC 1YJ9A 5FFOA 1Q90A 4OIAA 5F6HJ 3U1PA 5BUPA 2F5BH 3UJJH 1IL1A 5KYWB 4F27A 2W0LA 4JI1Q 3DX7A 1FZOA 2GTZA 1PZKD 1NIDA 1SUHA 1SBSL 1JR0D 1X4YA 2Y69B 3FFCD 4TKOB 5HGGS 1BOSA 1WCMB 4ZSOA 4FVMA 1H0DA 1AGCA 4H1LA 3V5DA 3F04A 4EIBA 1I7TB 4JFXA 1C1EH 1OIOA 4ZNEA 3PL6B 2ZJQA 1DONA 1EBAA 3O2DA 5E2UL 3QPQC 2Q86A 5E8OA 2LVEA 5JORB 2BY3A 4LUOA 1J9QA 1QTSA 5C0CA 4DV3L 2R1WB 1TTUA 4AKPA 5ISZE 4ZO6A 5IP7G 3NCCB 1XMOQ 1PFBA 4KRPC 5BUGA 5I16B 3C6LC 2HD3A 1BMGA 2L0DA 4G9FB 2YD8A 4CL7A 3SKOB 4Z9KB 4IDJL 3A22A 1A3ZA 1WZKA 2FT8A 1IQWL 5DHYA 2MKLC 4PV9A 2WKCA 3TEXA 3LEVH 5J6GA 3KLSA 4JM0A 4UP9A 3VWJB 4PP1C 4P07A 2CK2A 2ICWI 3FUNA 2D7PA 2XG4A 4JR9L 5C07E 1H5BB 4DVBA 3H0TB 1BZQK 5D72L 4A7UA 4RDQG 5KSAA 3EXJA 1FVEA 3SQOL 1MHWC 3P0YL 1FZMA 4DPRA 3LD8C 5C0FB 2O4EA 1HH9A 5ERWB 2JA8B 4WY7L 4EN3A 3DURA 2Y36H 1W2BA 3EJZC 3M1BA 4XCCH 1JP5A 4DGVH 1MFCH 2AJYH 2QLYA 4ERSL 4OFIA 1E9PA 2E6JA 1SLVA 4IIZA 3PWUA 1T9HA 3CBJB 1NFDE 3CFCH 3DBXA 3FU3A 4LGSB 4Y19E 5JPMC 2CHDA 4AQAA 2AXFB 2B2WA 5M3MB 1JHKL 3AB9A 5JQIB 1KJMB 5HGBA 4QF1B 3HFML 4FFZH 1E4HA 2BVPA 1OXSC 4Q2ZB 4A3FH 4TVUA 3SKJH 3NZ8B 4JZNA 3QR8A 1RURH 2LR4A 4HV8A 2D31B 4IFDG 1T03H 1AQHA 3ULVD 2TSSA 1FRGL 1R3KA 4TUUA 4XPBH 4HSPA 1SJHA 3ZSTA 1KMGA 3UPAA 2H7WA 3SYPA 3K8LA 1J1XL 1R24A 4W4OC 1GUTA 1RTOA 1N0XL 1SHXA 2IXQA 3RJQB 3SN6N 3MROB 4NFBA 3MMEA 1TWFB 2WZAA 2NDFA 1PY0A 1JOQA 3QULB 4UDTA 5DUBB 3TT1H 4LLQB 4CAGA 1GZPB 2NY6C 3MFGB 3MODH 5IK3B 1ET7A 5C6WH 2NN6H 1JGUL 1BUVT 4FFVC 1Q9LB 1J05B 1KLGD 3RY4A 1OGTB 3AY4C 3FH7A 4HC1H 5FHBL 5GHWH 4JVZA 4A2EA 1CFSB 3VTMA 4GAGH 4Q0XH 1X5ZA 1T20B 4WSJA 4JG2A 1G5GA 2D73A 1G84A 3J7AF 4MNOA 3SGJC 1A7NL 4JI3Q 3LKQA 4W6XB 2VSKB 2ICEC 4GBXB 4UOZA 5M5WB 5E1FA 4FHJA 3R7RA 3T6ZA 4DIXA 2R0WH 2FQFA 3ZZQA 1E7ZA 1DSFL 1AC0A 2F0NA 1YNTF 4RA8A 3HGBA 4WHTA 1HXMB 2ETWA 3BDBA 3EGXA 4XVTL 2X6VA 4EBQL 2KH2B 2HPTA 3W5OA 1ORSB 3WEAA 2FWOA 4F7PA 2E9JA 3M8OH 3ABMB 3GSRB 3GMLA 1GTNA 1NCCH 4PRHB 3S15B 3DTXB 3WUZA 3MJ9L 2IDCA 2V5RA 4G1EA 1BV8A 5FK9C 2XA3A 1JT8A 4I4WA 4HJ8A 4E0RB 1D9KC 2ICEA 2A69C 1BMZA 2Q2IA 1E8XA 4LO9A 4EZKA 5EZIL 2YEZB 3MCYA 4B5ZA 1JZ5A 4GW5A 4BBSG 4KLKA 4O0AA 1BQUA 3Q8DA 4XE0A 3HOUH 2OQJA 3PO3G 2R23A 4PD4K 3ZDYF 1R33A 1F2QA 2BZ7A 4XNMA 1S5CD 1RY7B 4O51A 3GNML 1J8KA 1KDCA 2P4AB 1GIGL 4P23D 4ZFZB 3RGVA 2HUGA 5I8EA 2F58L 3WE1A 3PIQB 1G51A 1FSKB 3KLQA 1LDPL 5FK9A 2F61A 2X41A 5ID0B 5I1KH 1QX1A 4RX4D 3WDJA 3RWCA 1T7YA 4M03A 3VA2C 2YD2A 4FKEA 4UMGA 4LCVA 1K4DB 3W2DL 4XTRD 1JGLH 4F93B 2KI6A 1JI1A 1TTCA 4G8FB 3BUYA 1NAPA 4JFOA 1HNXQ 1OCRB 3WIFB 3TJEL 1INDH 4MQ7A 4ZDHA 2XGTA 1MRDL 3WE6B 4NN5B 1IKFL 1NGXB 1UOKA 4MD4B 1E27B 2HJFB 3ARGD 1RUMH 4OLXH 2FE0A 4F33A 1A9BA 3HG1B 1I9IH 2IWGA 3HZYA 1IBGH 4FQJL 5EZJA 3E3QC 3GPEA 3S9DB 2VS1A 1IT9L 1L9OA 1FWXA 5B21A 3TBYB 5IW1B 2KT6A 3WNMA 5F9DC 4P06A 4TUOA 3CLFH 5C4JH 1KFAH 2HA1A 1PZAA 2X4PB 3UJIL 4DUWA 4GKNA 1K3BC 2I27N 4GLVB 3QQ3A 4BZYA 1YJNA 4ZUVA 3IDJB 3U9WA 2KCMA 3R2IA 4YSCA 4YWKA 2NY2B 5B38A 4TOYL 4XO4A 5CEYB 2XJLA 3NN8A 3QA3B 5DU7A 3UP6A 1OP9A 3BP7A 5ICXB 5T1KD 1CO1A 3CFKA 1ASPA 3N42F 1FV1A 2P24A 2WIIA 4TRPH 2VR8A 2FT7A 1DE4B 3BXNB 1VQOA 1S78D 3DX8A 4NXNL 2EJFC 3LIZL 2HWZL 2WVVB 4IJHA 5EPMB 1EJ8A 4K5VA 3P9LA 1VQBA 1MREH 2IPTL 2BVOA 2K9UA 2A74A 2XWRA 5IWAL 3MRPA 2B08A 4B3SL 4KDTA 1I94L 4QGTA 2F2HA 3EJUA 4J1UA 4LSDA 5DHVH 5I74C 5D4QA 3JV4A 1CJYA 4J3BA 4BFNA 4CVUA 2LLGA 1NMBH 2ED7A 1STAA 1C12A 4EI6A 2VCOA 2BS9A 3HFFA 5G4MA 1R34A 3CBRA 3CXDL 4PIBA 3X3GL 3PWJA 4EVNB 1ILSA 5M3FH 4KO7A 2AAAA 2FO4A 2PW2A 2E7LA 1WAEA 1NCJA 2OT2A 4PGEA 5H8DA 1NKOA 5BUAA 4X0NA 5LBSL 3OMGA 4DFIA 35C8H 4AC4A 3MBEA 1AGEB 2Y0SB 2XYBA 2MCPL 2B2XH 4ZQTA 5MHSD 2YLKA 5F21B 3RWDA 2V7NB 1KV3A 3EBGA 4XZUA 3DETD 3VGAB 2QBWA 1BBDL 5CSBA 1S8DA 4NO0B 1U4LA 1INQA 5E4OA 2BP8A 1MOEA 4JHWH 3TPKA 3KYOB 3JWOC 3RKDD 2VLKA 2CGYA 4JCLA 1S9WB 2FZ3A 5GRVL 3ZHKA 1MF2H 1IVLA 3EVQA 4ODXB 3MXWH 5MENB 2DY8A 4UAIA 1FIGL 2Z9HA 1PHJA 2XRAL 1IAIL 3BQVA 3SKUD 4TVAB 3GPSA 1R3HB 1QD0A 5B1CA 2HIXA 5AWNL 3U0TB 2DQCH 3ZDZE 5BZDB 3FBQA 4X98B 1ACXA 1KY7A 2KZ1B 3IETB 1P4BH 4JDVB 3JC66 3BLBA 3HC2A 2CE6A 3CHOA 4Q74A 4WKZB 3BKJH 3FSVA 4OGQC 5KUKA 4G11A 1DFBL 3BZFB 4BQ9A 3D9AL 2PABA 4UQ3A 5EGTA 4I3GA 2D4DA 3H0GH 4OCSH 1XMQQ 3L7ZC 2NYKA 4RAHA 4ZAKC 5HHVL 1E6OL 5IHZA 4HK0B 1FUNA 1AZQA 1A6TB 1T6BX 3RX8A 1KJ3H 1QEWA 2R93B 4M43L 1IBLL 4N8VG 3KYNB 4U1SB 3MV9B 1VQ8A 1LWRA 4IHOB 4YDLC 1RD9D 3QJXA 4G6JL 2XKSA 4WUKH 4JZOB 2L11A 1XF2A 2FJUB 1WIUA 2PKDA 3VGAC 1JB3A 1ZSHA 2EIZB 4RAUB 1NEZA 4YH6A 5GGUB 4BE6A 3QEQA 1K2DA 2NY4C 4JPKL 2JV6A 3WKQA 2RKSA 3ERXA 4POYA 3GTNA 1WOCA 3RVVD 5IB5B 4BCYA 2PO6C 2DB8A 3S34H 3S9WA 4XMTA 2VMEA 1I7UA 4TSCL 1Y18A 4Y2DB 3RVWD 5IYDH 1EO5A 1UASA 1PG7X 3R8BB 3KPOB 3PQIA 2AQ1A 3GI8H 1U3HD 2R1XB 3C2AH 5B8CB 5IQOA 2ZOLA 5E00B 4WWPA 4FZEL 3X14A 1ODAA 4NM8L 3F2CA 1TLMA 2I69A 4K3EH 4L2LA 1AFVH 4LU5L 3FQ1A 5JHDE 5JEAJ 1N9PA 3VXMD 4Y2LA 4XO5A 2ZKHL 2PO6A 3CVIH 3O11B 5HYEA 1B70B 3SBWA 3C08H 1QPXA 3UCRA 2ROXA 4N2MA 2VZ3A 5E2WL 1IC7H 2Q8BL 1KCRL 4N86A 5EU3B 3F5WA 4ZW3A 2CPUA 4LVOC 2BHYA 4P9HH 5I2XA 4MYWB 3I73A 2DWXA 3RA7H 2G2RA 4LCYB 3FCSB 5IMMB 2FUTA 5TDPA 2W9LA 2EDGA 2MHVA 3PF5A 1CF8L 4OF0A 4F87A 2KS0A 3HOYG 3PABA 3DHPA 3CCHB 1D5BA 1RTNA 4UTBH 3PE9A 1F3DH 1FBIL 2WCGA 4H8QA 4UQCA 4JKLA 1W15A 1YEJH 4YDKL 1EDQA 5IP7H 1CC3A 5IP4A 2L7QA 1N5AA 2UWEA 1QVOA 2YC1B 4P5TD 3HE7D 4R8WH 4HWBA 1HILB 5KG9B 3LNHA 3HNTL 1SQMA 1ULVA 1X5AA 2AXWA 2QQNL 2XNAB 2Z64C 2VR6A 2DLHA 1QFPA 1EHNA 1RI8A 5ID1B 2ID0A 3BVWA 3DX6B 1G6RA 3NE5B 3S4SB 2ADFL 5EA0H 1S9YB 2VC2L 1KBBA 2Y24A 3T1HQ 4KVPA 1V1PA 4DV2Q 2XTJC 2AJUH 1VQFA 1YY8B 2APSA 2X1WL 2L7EA 2XZAH 2H1PH 2ZJSL 4LPVA 5FGBC 3UTSB 3W11D 5C0DB 5CD5D 1G7JB 2FX7L 4M1UB 5FV2A 3ECBB 4AV4A 2PW5A 4MQXD 3RVTC 5KS9A 3L2MA 1FO0H 4YIJA 5KVFE 2R7ZB 4L3EE 3RILA 3TEHB 3RJOA 3TEWA 1A8VA 5FIEA 1YC8A 3BH9A 3S14H 4N1CA 2C9QA 4DW2H 1OAYH 1PRTF 4I48A 1GHFL 1OF0A 3PAVA 5IB1A 3QDHA 4BXSV 4RMWA 4G8GE 2DRUA 5HURA 1L7TH 3WL9B 4JBKA 2CHBD 5DM63 1UA6H 1QUQB 2XFXA 3ZTNL 2JJVA 5FGBA 3HPJA 5L2JA 1Q7YC 2K5NA 4GAJH 5IG7A 3U25A 1MCOH 1F4HA 1JTTA 2EDHA 4WFHD 4R7NA 5F7BA 2MQ0A 3EZJB 4H40A 1DQLH 2RFXA 2BNQA 5IY5B 1PFSA 2OMXB 2WLIA 1ZKOA 3DVNB 5KYUB 5IROD 2O61A 4FXLA 1OAXL 4TQPA 3ZR6A 4NKMA 4WTWA 3LB6C 4AQ1B 1I3QH 3HBQA 4KNTA 5EORL 4D9QE 2COQA 1T1YB 3QUYC 3U9UA 4W81A 1PLCA 1M9SA 2ADYA 2F53B 2E76C 1J1OL 3OOCA 1XCXA 2A9NL 5D4HA 5B4MD 4G8IA 3SDYH 3SD5A 4YSEA 1CQFA 3T65A 3FB8A 3VX0A 3MRRB 1WIPA 1N64H 4PCKA 4LEXH 5CV4A 3B9VA 4TLUA 5E6RB 3X1BA 5FHAL 1XVSA 4KK7A 3Q3GB 2EC9T 2HFEB 4UV4L 2NLJB 1CXHA 4GUOA 3D6CA 5C3WA 3EFDL 3GSXB 3O2VH 2N7AA 1J0IA 4RGMB 2XXCB 4GRWH 1MW3A 4J6RL 1A2TA 3VXTB 4KVNL 3KR3L 1M9WA 1T0OA 4LCWB 4LVNC 1ITBB 4R4NC 4W70A 3KF6A 3MEHA 1AZVA 1CK0H 3KS0J 2DM2A 3BAWA 1AHWB 4G7YH 1ZIAA 3BDOA 3AREB 4KUZH 3WTWA 4Q56A 1J8HD 4I3SH 1SJEB 2VUMG 3WOFA 1ERNA 1AXSB 2K7PA 1KYOK 1NDMA 1JXFA 1E4WL 5I6LA 2Y07L 5HHOB 3BP6B 3ILPA 1BFVL 3BGMA 5ETUB 4EOWH 3NXWA 1HCVA 1JZIA 5J56B 2F19L 3P1VA 2ROYA 3VFPB 5LDUA 1XEDA 1BIIA 1WT5A 1WTGT 4LZKA 2YD9A 2O6CA 1DVTA 3MLWL 3U9PH 4XDXA 4A3IB 3BLPX 3CUPB 4S1SH 1XD1A 1HNWL 4AK1A 1L0XB 4J6IA 2VR3A 2JJUA 4PGCA 3V0EA 3QXAA 5HI5C 4ABUA 2WQWA 2O5XL 5DK0B 1BNZA 1AS8A 5FCUL 2R2BA 5ISZA 5T5FL 1HC1A 4TNWK 1WWCA 4OLYL 4PLJD 1OM3H 2OMZB 2XETA 4M7LH 4DR3L 4G2AA 2WQXA 4FF2A 2I9TA 4X64L 1N9WA 4NP5A 5MEQB 2ZKXA 2Y7LA 3MRQB 3NRFA 4YIQA 4Z7UB 5HGAB 1DJRD 1UVQB 5GRJH 5L8LB 2VWEC 1KCKA 5C07A 5JXAL 3QUMH 3BIBX 1NAKL 4NS0A 3CCRA 3L3GB 4OZHB 4ZMVA 4XMPH 1WFQA 3ARVA 4L37A 4YHLL 2WAQB 1MCBA 2AQSA 4MCNA 4KY2A 1HQRA 5LHDA 2YA0A 3AGVA 4P46B 4PJHE 2DQDH 2DICA 1MXGA 1NGQH 2QMKA 1OTTC 4K5MA 1HEZA 4EKJA 2PZTA 2FIKB 5LJYH 1B9NA 4DXGA 2QF7A 4WJ3M 2W5PA 1NFDA 3IXTA 2F3IA 3O6MH 1ZHNB 2ZUWA 3VH8A 4OZGB 5I2YA 3F8TA 4K8IA 2COVD 4DP4X 4TNWF 4A3DH 4QYOB 2BIIA 4YOKA 1PZ3A 3G6EA 4JYAL 4L3CA 3SKMB 1TTBA 3ETBF 1BVSA 1Y6KR 2MFNA 4Q6IC 3W5MA 2YQ3A 3VXOA 3OMNB 3TZDA 1KXLA 1W0WB 3DGGB 3RWGA 2FINB 1TIID 2VM9A 4XI5C 1KJ2L 4LSPL 3VVWA 2JJSC 1JQYD 3EH3B 4NUPA 4I9XA 4PRID 3TDQA 5D2NB 2B15A 2CBOA 3BH8A 3SBPA 4DUZL 2QVTA 3VG9C 4NI6A 1Q72H 1SF3A 5D6CA 3RWJB 4C3IG 1EQWA 2QQQA 2G3MA 2ZKYA 4APQD 1T5XB 1QHPA 4KQ3L 1KIQB 1QP1A 2V3FA 5C9JA 2WYZA 1J6QA 5PCYA 3KG5A 4G1MA 3RX9A 3ARBA 1B9KA 1SLUA 5E6ZA 3GV3A 3F58H 3ULUF 4PJFE 4QHKI 3UDWC 3AUVA 4Q6IA 4ZUTB 2VDQB 3ECWA 4HMIA 1IARB 3OKOB 2VL6A 5I1AB 3DI3B 3ISYA 1ZOXA 4L5QA 4LCCC 3MNWA 2R0KH 4NQEB 4OI9A 1SYEA 2EQDA 1K5WA 4MX7B 3I74A 3K91A 1C16A 4GKOA 5J13C 3CCEA 3DX2A 1U2YA 1SYSA 1W8NA 3OZ9L 1CYWA 3ZQXA 3Q05A 3DMMB 2K3TA 3H7LA 1N5YH 1OHZA 2CO2A 2KHSA 2P5WB 2JA7H 4HU8A 3WNIA 1AD0B 3KPRE 1VMPA 3VYNA 4HSQA 1AH1A 1KENH 1CFVL 5I9PA 5BNXD 1FHGA 5CJXC 2CH4A 3DGCR 4TNEA 5DHMC 5T3XD 2CXGA 4PP2B 2LLNA 5J1AB 2X4QA 4N2AA 1CKOA 3TO2A 2A6IB 3NP3A 2DBLH 5E7BA 3CLEL 2Q2EB 1XSJA 3MLXL 1FH2A 2YGOA 1HINH 4FLQA 4HJIA 2R69H 4U3XA 4G6KH 5HHPB 3SYOA 4CNIB 1NSNH 1WC7A 4FNTA 3OMCA 2VDML 2B2VC 3D4GA 4UDUB 2AERT 3ABLB 4L18A 4DEUA 4W6WB 2F68X 2C34A 2VO5A 3GKWH 1GAFH 4WTZG 1GD7A 4XN1A 3AB0C 3JUYA 3L6FA 3QAQA 1NDGA 4BK5C 1U8KB 1BDOA 1GKHA 2NUPA 2E4FA 3CFUA 4OFDA 5CJXA 1JYNA 3T6VA 4NAQA 1JPTL 4OKDA 2KCNA 2AW2A 3I6LE 3TBCA 4AYBA 4CBZA 4F3FA 3WFCL 2QSCH 1MSHA 2ITDA 4DP6X 2VISA 3UH8A 4M8QA 3FB5B 3RN2A 3T4YB 4Z7AA 4Y4KB 1GJWA 4U6HA 1QB5D 3I4OA 1CDJA 4JFDD 1WIOA 1AY1H 3S24A 2FRGP 4HP5A 2B2VA 4I2XB 3LV3B 2WXKA 2AKRA 2ZSWA 5C3XA 1IM3B 1CWVA 1LO2L 1QBML 5LL6S 4TULL 4WEUD 1NMCB 2AMGA 1KXQE 4MD0B 1JERA 1VDGA 2E5EA 3BFQG 1UM6L 3MXNA 1XXFC 5IGFA 5D70H 1SYVA 2VAJA 2ZUXA 1SXSA 3X11B 1X9LA 3NSFA 1YJDL 3PXJA 2DEXX 2Z31D 1R5WB 2G30A 1MCEA 2H2SD 2OTPA 4V190 4NO2A 3LXUX 2X7LA 2IWHA 1UUNA 3T71A 1MNNA 1WO2A 5HDBB 4G5ZL 2YV5A 1H0DB 2VN6A 3MUUA 3HLAA 2K5HA 5EQ0A 4R0LC 4OQTL 2IOIA 4ODBD 4OO1G 4HULB 2QEXA 4WI9A 3EGSA 2X28A 3TFKC 5DJZA 4BY1H 1ORQA 1E9OB 4OM0L 4HZAA 1OP5H 2A6DB 1K5NA 5J3BA 1YNJD 1MCHA 1FCCA 3QO0B 1HDMB 1N36Q 3IU3A 3ULSA 3T08A 3FVQA 5IOKA 3ZTEA 3IDYC 3ZRSA 2F1EA 5TH2A 5I1GH 4G9DB 2F0FA 1BFOB 5AW4B 2NY1D 1T1ZB 4Z7WE 1R0AH 5J7CC 1KXTA 5KNDA 3Q2CA 3FF7A 5FW6A 3SDCB 3L9AX 4ZYKA 1DVYA 3H3PH 1KGXA 1ZLVK 5FFLA 4JG1L 5IVXF 4E6IA 4F58H 2WM0A 4FKKA 1U4MA 1MCIA 1IZKA 2M2DA 4AVIA 5KSAB 3L9RB 3QQDB 3RNQA 4A67A 2GITA 4P5MB 4O02L 3VYUA 3C8HA 3IDXH 3ZHLA 2PYEB 1J5IA 1JNJA 4GIAA 4HUCA 4Q58C 1PZBA 3BMVA 3HOYH 4E41D 2A9ML 3QG1A 4RGNE 1QKZL 4WAFA 3J7YW 3WYRA 4YK4C 3S3DB 5AG9A 1ADQH 4R1JA 3P4LA 4GLRI 1VCIA 3UFIA 4M1CD 5DLLA 2VZSA 3TO4A 2H3NA 4JY5L 2DQTL 4WEEA 3JVGA 2ZPKL 4MHHG 4AL8C 1CICC 4KZEH 2VXTH 3K1KC 3VR3A 2WC7A 4XVSH 3SDAD 2EDYA 3MXUA 2QGDA 3CFBA 4JZNB 4X6BA 4X3UA 1SNPA 4C57C 2EXTA 4BBRG 4HV8B 4P23C 5GRUH 4O2EA 1IBML 4Z95L 4JCWA 4HIHB 5D2LF 2CRIA 4LLWB 3EO0A 1MUJB 2XQYG 3SGDH 3T53B 3HR5A 4XP9L 4B7LA 3KLLA 1NOLA 5E2UH 3ZO0A 2IPKA 2BW4A 4FQCH 3O8XD 3BD3A 4BZ2H 1QHOA 3ZOAA 3MMEB 1RK0B 4NO5B 4UOJA 1K0RA 2IG2H 4BA2I 2NVYH 2Q2TA 3P77B 3WHXA 1M7XA 5CHNA 2VQ1A 1OO2A 2WB1A 3KPTA 1M6UA 1N68A 4IDJH 3J7ZC 3QEGL 2FT6A 3EJQA 2EDEA 3RLNA 2WSKA 5TQ2L 3VSUA 3S2AA 3HRZC 2DH3A 5JEAH 2N8NA 1H15B 1LYQA 2WGXA 3TP4A 3L95A 1WBZA 5GGRY 2OSLB 2C1PB 3T51B 4NXML 1KCSL 3D2TA 4JR9H 3V95A 1QYGL 1UCBL 1IXRA 5D72H 1C08B 1GZQB 1CM9A 2WN2A 3P0YH 3ERQA 4DR2Q 3S37X 1TS3A 1Z47A 1DBBH 1G9MH 1UQSA 1WAAF 4JFPA 5J12B 3UO8B 4J8RB 3WJLA 1FVDA 4M6ML 4WY7H 4P2OD 5I6YA 4GKSA 5KSBF 5JHLA 2JF1A 1S5IL 1C4QA 4ERSH 4MN3A 5LWYH 2F54B 2QHRH 4K8RC 4F24A 4EI5A 1PTZA 1EZ6A 1I7RB 2MHAB 2JK5B 2EC9U 3RY6A 3BWUF 6TAAA 3MFFA 4QKXB 2C3VA 2UYLB 1IW7C 3GZQA 3UGUA 1LE9B 3KLSX 1JHKH 4UIMA 2XPGA 3WLBA 2YPKA 1I8MA 3HFMH 3PO2G 1J0ZA 3KYMB 3FQTA 1UG9A 1PD0A 3CZGA 3FKIH 3L8QA 1SXBA 4X5XA 5DWPA 2DWDB 4EXPX 1UOVA 3GLDA 3P1HA 1T21A 2J57A 1GUNA 3T9WA 3UG3A 2SNSA 1O7DE 2Q7AA 3EQLC 3SCMD 3QORA 3CBKB 2A73B 1ZPLA 2CQAA 3RD4A 2BSCA 3NJJA 4TQEL 5L2KE 4YSRA 3NIFB 4IQZA 2JQOA 3WN5C 3VFMA 4QGYA 5JHDA 1MBYA 2AWNA 4NDXA 3ULVL 4O58L 2R61A 5I28A 4HOZA 3PCOB 3RHWF 4XXDB 2RHQB 1UD5A 5AOLA 1T22B 1BZ8A 2NZ1D 3POHA 2VUMH 3ZPDA 4KI0A 1ZHLB 2UVFA 5FHBH 3HW7A 1A2UA 1B4LA 2VQUA 3FFDB 1KLUB 5ELOA 1PVOA 3KJ6L 5ESVB 2EIJB 2QPFA 3ARSA 3D39D 2JA6B 4YJZL 2A2QT 1FE8H 4FEIA 1P2CA 4MQ7B 1STYA 4NWTL 1AQKL 1SBBB 3MAWA 2BOBB 3RJDA 3DETC 3TT3L 3GBNH 1YUKB 3HJEA 3RLOA 4O00A 1R75A 1T0NA 3N2JA 1PNCA 4X9IA 2IDQA 5DDHA 3OG6B 3KYHC 3S1RH 1DSFH 4B9YA 3QFDA 3OKEA 1M8AA 4K5NA 4F33B 2LKVA 2XIWA 4ME5A 3RKDC 2DUDA 1A9BB 4A68A 4U2ZA 4XVTH 3RL2A 3QRGL 1KB5H 4LF6Q 1WV7T 4PJIB 4EBQH 3KDMB 4BUQA 3IVKA 3PNWA 1YIJA 1H3PH 2P8MA 3FO0L 3WD5L 3LKPA 4AGOA 5DSCA 5DJDA 4UILL 3ZYIA 4NYLA 2NNXA 4B27A 4LNVA 4MRCA 1CLZH 3MJ9H 1QSEE 1LMIA 1KIUB 2LOEA 2IL8A 4KO5A 3UP1A 1TWAB 3IMTA 5EN2A 5FA4B 5I5RA 3NK3A 1WTOA 4ZFFB 3BP7B 5EZIH 5ACMA 2H2PC 5DD3L 4PRPE 2NR6C 1HE8A 2W81C 2NXZD 1HXYB 5DD1L 3CHRA 4LHUG 5D1QC 1XGRA 4QRFA 4O4YH 1DBKL 3QXDA 5DZLA 2V2XA 1TEFA 1FF5A 1XB8A 3TA3D 2EYOA 5CLZA 5HHNB 1AGFA 2AUJD 2WNWA 1GIGH 2WLLA 2F0WA 2A74B 2ZAGA 3M17B 2OXGA 3U1SL 3GO5A 3V6BR 4NQDD 2I25N 1Z5LB 3Q0HA 4J1UB 1HESA 1TMCB 1CCZA 1S9VB 2MJWA 4FQXB 4M29A 1ZT1B 5C3EB 1C7SA 1WE5A 2CLVA 1U8NA 1A6PA 1C12B 1FJ1A 3W2DH 1TEYA 3OLIA 3LWUA 1KIRB 4XOBA 4YR6B 4BSJA 2NR6A 5KW9L 2OYLA 5DR5H 4G8GA 4JDZA 4KH2A 2FWLB 2NVQB 3HCVA 1QZGA 2XQBH 4TNGA 4HJAA 2H0JA 3TJEH 1KTDB 5DD5H 1ILUA 1NAMH 4HCGA 3K2UH 1IKFH 2VZTA 1UWVA 4C3IH 2ICIA 4HJGB 1U41A 2P80A 5F6IC 3GHEL 5ALBH 1LO5A 1OTUC 4PJBB 5E6IB 1GTFA 3S8GB 1U3HC 4XZUB 5IESL 1CXKA 4U6XB 2KECA 1QTYT 5HGDA 3KW8A 4ZPVA 1G9HA 1P4LB 1Z9SA 3BZDA 3MOAL 3QH3B 4X5WB 2F0LA 1E5CA 3H6JA 4ODWB 3KHOA 3SD2A 3U7YH 4DF7A 3FQ2A 3UJIH 4UOW1 4HCRH 1MSGA 2MIZA 2EH7L 4MJJA 4HJ0D 1RZJC 2X0WA 5E9DE 2E46A 1DJZA 4ZMNA 3NMEA 2JKXA 2ALYB 3SBQA 1EX0A 3RR5A 1HN1A 2F0TA 3FOMA 3SQRA 2BVQB 4QL5A 4JI6Q 2VLLB 4HMJA 1S5HA 5FWQA 3TBWA 1FG2A 2JB6B 5TF1H 1XIWD 1XT5A 5HD8C 2OLDA 1PDKA 3LIZH 3QO2A 3F7YA 3J8F7 3QXWA 4C83B 3NHHA 4NN7B 5SWZB 1MI5E 5KSVB 3CC1A 4JW3A 1UOLA 4WORA 2VZAA 1WG3A 2DQFA 3EOTH 3LQMA 1QFHA 5EU5A 5JXEA 4N0YL 3AXLB 1IQDA 4L8BB 3IJYB 3E6FB 1G6VK 4PCYA 2X70B 3ATDA 2A6EC 3NCWA 5T1MB 1JZHA 4GIPD 4P5TC 3ZE0F 1B44D 3NSJA 4A2GA 3I2ZA 4A3EG 4YBHA 3INUL 3B9KA 3ZL4H 2LXKA 1I1FB 1T5WB 4JN1L 2OPCA 3RIAK 4IALA 4H5SB 4KTAA 5D1XE 5FX3A 1TITA 3H55A 2ARJB 3QUKA 4PBDA 4Z7VE 5DJ6B 2C26A 2VRAA 1MW0A 5LBSH 2ZUTA 5D1ZB 1F1GA 1LABA 1WD9A 3OW7A 1AO7E 2BS8A 4ZRZA 1F02I 1TLKA 5ILTL 1LD9B 2Y3AA 4B08A 1Y18B 4JK1C 1K73C 4QRBA 4JI4Q 1BEYH 4MQXC 5DCCA 3CVHA 4H44C 1D5MA 2CCLA 5K1JA 3QG7H 3ZE1E 5LDSA 4YEEA 3P4NA 3BFOA 5C44G 3L5XL 4KKQA 2BA1A 1QSFE 1OLLA 3HKZB 1TQOA 1YI2A 3RI5F 1N67A 3E0EA 4TLSA 3LDBC 2Y1AA 3FYEB 2OL3L 3U4EA 1BCPF 1HNZQ 1IAIH 3BKML 3RDJA 3VYPA 3VRJA 3HPLB 3O45A 5AWNH 1YVLA 4L3FA 4PJHA 4KPHH 4JFEE 1F9QA 3RIAF 5HYJA 3BVNB 3GLZA 4LDEB 2YXFA 3QQ4A 1TY2A 1B3IA 2DDQH 4DPCX 5IEKB 4F91B 3FZUD 5J57B 2X4UA 5IQ7L 2A83A 1DFBH 3N40P 5E0QA 3QIBD 3UAJD 4NJ9H 3AWEA 5DVPA 5HDLA 3E9HA 3RWHA 3MJ6A 1O75A 5FUZL 3B7TA 4GQPH 2G2RB 4OO1H 2YSSB 4GEJA 4X5LA 5HDRA 2YJLA 3MO1A 4PJ8A 4P2CB 3X2QB 4M43H 1MY5A 3GMRA 5IW3A 3UZQB 4WWOA 3TN0A 1NJ9A 4L0PB 5ELDA 4IJ3B 1JAEA 4Y7OC 5H35A 4G6JH 1S5BD 3UGEA 1EO8L 4RFEB 3BUTA 1J5DA 1H9RA 5B4MC 3CH1B 5ELIA 1P0SE 2J5LC 3QDGE 2E7HA 2IGTA 3WDHA 3UTTB 5K9KB 3LNEA 3B7UX 4ME3A 1V7ML 4LRNL 1E2WA 3JTSB 4OFYD 4ZS7L 1ZHKB 1IX2A 4AQOA 1J86A 3A4FA 3ASOB 4FNLL 4PJFA 4A3FB 3QDJD 2ZG2A 3KJ4B 3U2JA 2OMUB 3A67H 1UH2A 2GKIA 1GUSA 2E5LL 2YPLD 3D87B 3MRNB 3POCA 5CWSB 5IZ7A 3OR7B 3RUGF 4J2QA 5I73C 1LTAD 3SK4A 1C5DA 4KU1A 1J8IA 3O0RH 2WBJD 3OLEA 3CMGA 5JQ6L 1N34Q 3UAFA 4DGYL 3G08A 2FL5B 5A2KH 4NM8H 3NCFB 5LQBL 4DETA 1T2JA 4E36A 5K69A 3PXHA 4LU5H 4MS8D 5CMAB 2X88A 2BFVL 4P46D 4Y5XB 5HYSG 1KTKE 3KPRA 5DMGD 1SY6H 2YARA 4NKLA 3TASA 4OJEH 3X12A 3N55A 2OMNA 3C8KB 3ZN6A 2HKHL 4WEBL 4F8QA 4RIRA 3UOAB 4NQCB 5I1EH 4BBRH 1EQRA 1KCRH 4HD5A 2Q8BH 2FDBP 5A2JH 1ZVSB 4QOKE 1RZKC 2DKUA 3G6JE 1YDPB 1KGUA 3IEAA 3I75B 5IIFA 1CF8H 2IAMA 4MVBC 1HH6A 3ZYYX 4M5TA 3V0DA 4S0TD 2O61B 1SOQA 1LTID 3FTSA 1E0OB 3MRFB 4FEMA 3RVUD 1FBIH 5I8KL 4NKMB 4LASL 4A7SA 4OD3L 5J9PB 1MVUA 3QEHA 2W80C 3V5KA 5IBUB 4FNUA 4NOBA 5B3NA 2J73A 4HF5L 3W81A 4HUMB 1TZAA 4DV4L 2F8IA 2Q3AA 3GB7A 3HNTH 5HDWA 1OP5K 2BCKA 2QQNH 2CDEB 3E6HB 5I1HL 3BP4B 4GXFA 5A1AA 4F7XA 2E86A 1CQKA 3UTZA 4A6YL 4DEPB 3ENEA 3KLWA 1IILE 3Q9PA 2ADFH 2GT9A 3EYVA 3QWOA 5C09D 2N7BA 5J1SC 4NHUA 1G2SA 4P5KA 5E4EB 3FQUA 2I24N 2XG5B 2JKLA 1KIPB 4OX9Q 4IMLA 4KRMB 4QXTA 1ZTXE 3V6OE 5L4FA 3BVTA 1LK3L 2ZJSH 3HOUB 1R47A 4X65L 2GIXA 3T3MF 3ZE2E 3A24A 4YLCA 3QIUC 4RAVA 1ICFB 1KXQA 3QFJB 3ETTA 5JOPE 4K07A 2SEBA 4A7GA 4XVJL 4A1RA 5IYBG 2DL9A 4KRNA 2DY7A 1NKGA 5JR1L 2J43A 1ECZA 2R0ZH 2AFNA 3BDCA 1NDMB 2GHZA 2HYMA 3H9HB 4WFN3 3QDME 2BNUA 1TQSA 2HHHL 4N3UA 3CZLA 4ODVL 4OVVA 3EG9A 3JWOH 4QRTA 5TJWK 4APQC 4LF7Q 5I5JA 4C3HG 1DP0A 4HBCL 4DA2A 2V8MA 4Y5YC 5MEPA 5EBWA 1UM4L 1I8KB 3QIUA 5F9WB 4ZXBD 3UPCA 1XF3B 5D3IB 1CL7L 5HVGB 1S4IA 4BK8A 1WFIA 3VFGL 4QF4A 2DI9A 4JM2F 2MP1A 3UEQA 4FMFA 1OAXH 1TPXC 1DZBA 1OCCB 4LF3B 5H37G 1MFVA 5EG6C 4FQLL 3VR5A 3HNVL 5DJ8A 1LT3D 4Z7WA 5EORH 2MCMA 3P11L 2BW5A 2X9ZA 4PH8A 5E1GA 4C56B 4OCYL 2BINA 4FFYL 3X17A 1PEZA 3NFPB 3KLDA 4Y2OB 5C4JB 1J1OH 2OMBA 3S35L 5BVJA 3V52L 1KTJA 1QZHA 1RQ5A 1ZV2A 3CC5A 4DK0A 3HN8A 1JJ2A 4YZFE 4XX1E 5KJ7E 5FHAH 4TLKA 5GGSY 3CF5A 3DJTA 5LGHL 2LE9A 3CMAA 2OSXA 5KYIA 4IIQA 4RGNA 3RWIA 3VD3A 3AM8C 5MI0B 1IM3D 2ERJC 3CPFA 1HEZB 2H6PA 3BD4A 3ZDXE 4KVNH 3KR3H 3WO4B 3M86A 2F6AA 1UWGH 2OV0A 4BYHA 1FFOA 2DV6A 4I8DA 4MA3A 4RZKA 4Y19B 3MA9H 2CLZA 4HCEA 5AW7B 5A3IC 5SV3A 4OZGF 4UQ9A 2GCYB 3DO7A 3C5XA 3VSTA 3WI9A 5DHVB 1I4HA 5B7FA 4JPIB 4RFNC 2YRPA 3VDYA 1ZVHA 2RBMA 2PYKA 3W2DA 3ER0A 4PJDE 5CGYD 2F19H 2BIPA 1LL1A 3Q44A 4G8EB 2EDLA 4POUB 1RIHH 2BIMA 1ADWA 1WAPA 5M3FB 1HQMC 4M93C 4N2GA 1RP9A 2Z7YA 1NUNB 3CFEB 1J0YA 4IKIA 4J3UA 4MAYB 3K5LA 5T5NG 4IN3A 4QY7A 2YOCA 1SM3H 4C8XA 4ADJA 2XZQL 2PTUA 4E5XG 1GSKA 5DFVC 3O6FD 2O5XH 4PJXA 3ARBB 4YFEA 2EVBA 5EEWA 1KBGH 2I7SA 4OLYH 3DUSA 4AMKH 5GJSL 4RBPK 2ZUQC 3B83A 3FCGA 5IKCB 1G9NC 3DYOA 3MRBB 2DYPB 2LW3A 4YHNA 4FQ1L 3QOLA 1VEOA 1CDYA 1NANH 2VKXA 5KUMA 5I15L 4QGUA 2R2HB 2JNZA 4XPFL 2LU4A 4NAJA 1C16B 2Z31C 1IZJA 5JXAH 5EIVA 1NAKH 5HJ3A 1SYSB 3NQKA 5FB8B 3A8JE 4AKOA 1H6FA 5E8EA 2EOTA 1YHBA 3K0XA 4YHLH 2I07B 5KYLA 4MDIA 5LHY1 4PCTA 3BYTB 5CZRA 4FI6A 3O4LB 2J8OA 5JOEA 2OMYA 4BSWA 1LP9F 4JRWA 1JPGB 3FCTA 3MLSL 2F1BA 1WD1A 3MJGX 3SIKA 3FUJA 1AGDB 3I4NG 1FNWA 1PYWD 4DK3C 2GIMA 2X4RB 2X4QB 2YN5A 3D34A 3QCUL 3HNSL 4KWUA 4OONA 3HIZA 4YWGL 2VZOA 3H0GB 1E42A 1ACYL 2W0KA 3CXCA 2VABB 5J11B 3PWLA 4KFMA 3NIGF 4N2LA 4Y5VA 3FQXA 2NY1C 4IQHA 4DN3H 3BQUB 4AIXA 2IHFA 3SDXA 3ZHNA 2JI2A 2MQHA 1ZLDA 3PWPB 4BKSC 4ONFL 3AS0A 4CSPA 2K6WA 1VHPA 2B59A 3RURA 4EKXA 1KJ2H 3L6FB 3PQYB 1OW0A 3DRQB 5BR8Q 2J4WL 2FEEL 2PCPA 3AAZA 4WTZA 4ZBJA 3TS2A 3EF4A 5LGKA 3TZVA 5JOFB 3KZ8A 2M26A 3P73A 1ROWA 4DK3A 2YD3A 4WRLA 5TE4L 1PKQE 4M5SA 4KQ3H 3CU1A 5G55A 4UOQA 3T4AB 3VR4A 4JFWA 1E28A 1UJ3B 4FG4A 3BWZA 1PY4A 4DNLA 2R8SL 5F96L 3T6QC 2WXJA 2N56A 3VD7A 1NICA 4ZO9A 4ZOCA 4ICWA 1S7UB 1WCBA 2P5ED 3VFUA 4F57L 2CWPA 2N49A 4XNZB 2UY6B 3S16H 4A3EH 5K93A 2PQAA 1LTTD 5FO7B 3HKSA 2PXYB 3FSOA 5KVDL 3SDAC 5J06A 1I9EA 1TNMA 3EH5B 2VJ8A 1VQIA 1MHHA 3KCPB 4PM1A 4QCIB 5CINL 2R9HD 1CR9L 3OZ9H 3C75A 1VKXA 4J12A 3VACA 3DO3A 3Q43A 1EL0A 1FFNA 4IUQA 2Z0UA 3MXVH 2UVEA 3PS6A 2ES2A 1TJIH 1L0WA 4FLHA 1BX2A 4UV7L 4YNYB 4ZMAT 1CFVH 5CBAE 1KOAA 4MA1C 3GIZH 3C60A 2IBZX 4JL2A 4BA0A 5IW6A 2CCVA 5F9JA 2ICWA 1KT2B 5EO1A 4JC0A 1AJ7L 2WQAA 1JORA 4TL4A 3EGSB 2YPVH 1QSEA 3V4PH 3CLEH 5DJZB 4LRIC 4N26A 4KK9C 4QIWE 1X4ZA 4FQQB 1M7IB 4DR7L 2CW0D 4PMWA 4JZJB 5FLMH 3S1MH 1LEKB 3IU3B 3ULSB 4NC1E 4JNXA 1I6VC 1XNQL 5EEVA 4ZX6A 1BD2E 1E90A 1UACH 4FO2A 3MAQA 3KEDA 4RCNA 5TFSH 2KBNA 2E9GA 4NC0B 3GMPA 3TNNB 4KKAD 4R2GB 2XTIA 1KQSA 4G43B 1JPTH 4PJ9B 5DA4A 3OYYA 4NSKA 4R97C 4DJMA 4UTAL 4A75A 4G6MH 2D3LA 4FULA 2CDGB 3WFCH 3H7BA 5T33L 3SE0A 4KKLC 3VD5A 4XQQA 1U8JA 1UB5B 2R15A 4OLWL 1W80A 1UD3A 4GN3B 3HHRB 4LRIA 2DYRB 1NC4A 5DFWH 2G3XA 4PJEE 3FO1B 2V7HA 1TT2A 1KLUD 2XRQD 1JGDA 1XGQB 3D0FA 2EYJA 1DL7L 2J6EL 2WVSA 4NERA 3VO0A 2G5BB 1JCVA 2J1YA 1LO2H 1TZGL 4KV5E 4ZK8A 1NA8A 3GZKA 1QBMH 4X2UA 2PWDA 3BPNC 4F2EA 2XY1A 3T0VA 3NAAL 3TO4B 3ZW3A 2F7RA 1UM6H 4DPBX 4GB9A 1FO0B 3KLHC 3NTHA 3FYIB 3ULVE 2B5IB 2CDFB 3P4MB 1YJDH 3W38A 3SCMC 4JV5L 3S14B 1QW9A 4PREB 1I75A 2RA1A 4JI2Q 4O2EB 4P57A 1FVIA 2NYZA 3TP8A 3AZUA 3G5ZA 3Q13A 2V5MA 5AVQB 3TBTA 4B53A 1T2QL 1BVZA 3TC9A 1H8NA 2IJ0C 5E9DA 3FSWA 1XGUA 2XHNA 3P2DA 2NY3D 2XQYA 4PRBA 2L5TA 2EP6A 1BZ9A 5CFAA 4ZX3A 2PCXA 5G4OA 1ZYRC 2XWBB 5C4XG 2VUKA 1HXYD 1T0PB 1HKFA 3ZDZB 2B4CL 3PGCA 2VQ1B 4L8SC 1O7IA 1UE6A 1ZA3A 3EHBD 2ZCHL 4OIIH 2K75A 5D1XC 2XV0A 3GEWB 3NIDE 1I3QB 2D8KA 1HAWA 4RFBA 1MI5A 5SWSA 2GI7A 4FTVD 3FAXA 3U83A 4DZBA 3LXBA 3QXUA 2UZYB 5L8KB 2WLZA 4OLZH 4ULLA 1UFGA 3VUAA 4DR5Q 2A68D 3GTKH 2DQHL 3G5VB 1VQPA 2VLJD 4M3KB 4PR5B 4WGVB 1MG2C 4O02H 5EF1A 2WIMA 2PCYA 3EN2A 5ENWB 1SEBB 4V2BA 2PYFB 1R1CA 2LSSA 4OM1L 2CFMA 4K2UL 2EINB 4GRWB 2HH0L 4E9SA 4KZDH 4IOSA 5D1XA 4I1PA 3R4DA 1CTNA 1MCNA 2WVTA 4MBOA 4EI5B 4Y52H 4Z7VA 5C2BH 4U1JA 1PH7A 1HFUA 1II4E 3GTGH 1WZ1L 1B2WH 3CQQA 5CIPA 4F9PA 2C3VB 5DC4B 5E4XA 1N4XL 1TG8A 2NXZC 5E6ID 5EC2B 2WUCH 1F56A 2EKJA 1AO7A 1CIUA 4IOCA 1I8MB 3X3FH 1Z1WA 3DOIA 1AMXA 3FQTB 1J8RA 2X1PA 4HUXA 1N32Q 3TA3C 1FNSL 1FGNL 1Y0LB 2WJ7A 4OW6A 4F8LA 1PH4A 1TR7A 3UBXB 4PJ5A 1A4KB 1SJVA 4R4BA 4HJEA 1XH3A 4Z95H 3TEZA 3N41F 1QSFA 3D0LA 5D7SL 1YN7A 2QKSA 3RAJH 1AIFA 1GKEA 2BHZA 3GIVA 1PRTD 1HYRC 3E1ZA 4JFUA 4U3HA 4XP9H 2EJMA 1M2OA 3T77B 3K6SA 4YDNA 4LOFA 4Q4IA 3VFMB 2DIEA 4DKEL 1MN4A 1DHKA 4A3JG 7PCYA 3CFQA 3ECVA 3UIYA 2YWZA 3B2VL 1IE4A 4P8QA 3FT3A 4JFEA 1YEGL 5IOPB 5FKAA 2XT1B 2VM3A 3T8VA 5FLXL 1MLCB 5ELEA 1JRHI 4IW4C 4F20A 2E2IH 3MBWB 4U1LA 3SY0A 2DLFL 3MLZH 1A9VA 4C3HH 3AS2A 1EOTA 1P2CB 1QYGH 1UCBH 3QUMB 1M3IA 4I65A 1T0MA 1K8DB 1CT8A 2Y1ZA 3MNVA 4CDDC 1TXYA 1PU0A 2F18A 1I9JH 1QR4A 2C8NA 3IRZA 5CJBA 3KD4A 5DZPA 4ZUWB 4YXHL 1T7XA 4IM8A 2RHSB 3P4OA 1TCRB 1U91B 4M6MH 2G9HA 2MOVA 4HSVA 1OPOA 5D8JH 2ZOTA 1DOLA 5H37H 4KY6A 4XZ4A 3MGTA 3QJSB 4DV1L 2IFGA 2Q8AL 1QFWL 4YY3L 4P71A 1T04B 2BH0A 3QDGA 5DJDB 5DSCB 7CGTA 4POGA 1BLNA 3KPSD 3IAYA 4BFIA 4KUCF 4IMKC 3SKNA 4F7TA 4EQNA 4L4TB 5BS0B 4D2NA 4LF4L 3W82A 4A3DB 4WO4B 5E5MA 3O3AA 1YYML 2K8MA 3VFNA 1FD7D 5EN2B 3EJYD 1RZGA 4F7EA 4P2RB 1C8PA 1YEIL 4IK7A 1I4PA 4YL4A 3EYUL 2VE6A 1JV5B 4IRSD 2VDKH 3OJ2C 1XGRB 4AJWA 3VFRA 1PMRA 4RMQA 1JK9B 4XBPA 3WWVA 2B8OT 2WANA 3LPPA 3KWWA 4LHUA 2CIIA 3A21A 4XN5A 1UWYA 3C5JA 4IPDA 3IJ8A 5ELBA 3J7AV 4TQEH 4A3MH 1QVFA 4V1DD 5CXPA 4HCFA 1DQJB 3HKFA 2OXGB 4I5BB 4N2EA 3NJLA 4HIEA 4L3EB 4CN1A 1FAKT 5CLWA 3ULVH 4O58H 1RJCA 1W2KT 1BQSA 2AQQA 3PUVA 1U4FA 5DS1A 2R92H 4F9LC 3NPSC 4K55A 2L8AA 5T5FA 1KTKA 2WJ5A 1JGEB 5A2CA 1ZKAA 1Y1WH 5DJ2A 5AW1B 2E8ZA 3C2SA 3REVA 2A6KA 4X7EC 2ZXBA 5DRNB 4CU7A 4ZQKB 4B9PA 2E2DC 2FJHA 1K8AC 3SZKC 2CU9A 1NOAA 2WYTA 4QOKA 1OAUL 4X66L 2Q7NA 3G6JA 3IS0X 4NWTH 3MRMB 4NNPL 5ACLA 5BN4A 4KI5F 2XVSA 5EF2A 4WI2A 1A0IA 3DTUB 4IPCA 2R56H 3UEZA 3VG0H 3DK2A 3GBLA 3K46A 5EV7A 2CALA 1N59A 4DKFL 4ZFOB 2V9TA 3GJFH 3ML9A 1H6UA 5E9NA 4UMSA 5HGDB 4JRXB 3E0JA 3WD5H 3FO0H 4B3RQ 4P4RA 2AGJL 4QT5A 3MV7D 4UIKH 3KWXA 3L5JA 4AM0Q 1FPTL 4LFCQ 5KYYA 4KJQD 3WIAA 2YZ1A 4LIQL 2QKIC 3L81A 3VXSD 2R2EA 4N2FA 3S98A 4XB7A 4EVOA 2UU9L 4M62L 3DGDA 3QIBC 5DD3H 3UAJC 1I3UA 2FYVA 3V6OA 1GUOA 3F12A 5I71C 3KH4A 2EXSA 5C6PB 3HI1A 3WTYA 3BP5A 2DIJA 2LABA 1LNUA 3BPLB 3AQXA 3HOWG 4AL8H 3I4NH 2FEJA 2AS5M 2J8UE 1UXMA 1FAIH 3DARA 4L4VD 1IQDB 5LMUL 2XN9E 2J0TD 3KGUA 1PCSA 5KVGE 4AZ8A 1Q94B 2VAAB 4D3CH 4YWMA 3ULPA 1B6DA 2LVCA 3KOJA 2CZNA 2KZKA 3QDMA 2I46A 3GTMH 2DI7A 2V9UA 5EFIA 4MA7L 4N8VB 2NUCA 1E7VA 2FSEA 3FXIC 2P5ZX 5KW9H 1XQ4A 3DHJA 1NBCA 2J88H 2WWMC 2YK1L 43CAA 5LNDA 3U6RB 2NY7L 4JO3L 1K83H 3URYA 1J12A 2XVBA 1QZ1A 4HUVA 4IBQA 3ULUD 1Q4NX 3JWNG 2VT0A 5I76B 2ZM6L 3TESA 1NR4A 2I26N 3D2UA 3DIDA 1CQVA 3WAKA 5BN5A 1BQHA 2NB0A 1EO7A 4MJ6A 1F42A 1KJVB 4OJDH 3HVDA 4LF5L 2JXMB 4LPWA 3R7QA 5EULV 4UAOC 4JJ5A 5IESH 2N55A 5EH1A 3HBGA 2IBBA 1E0BA 4MZ9A 1JPST 3IE9A 3R19A 3WTTA 2APXA 3TBVA 3QI9A 1UB6B 3ESVF 2X4OA 3WTVA 4K9JA 3J81L 5AZUA 1BPVA 1OAQH 3AABA 1V27A 2QMJA 3GM0A 4PHXA 4JRYA 3JZYA 5CZXD 5ESQA 4BY1B 2HG0A 4XWGH 2GTWB 5AW3B 2ISDA 3BYYB 1Y69U 4HQQL 3U0WL 5AD0A 2ARWA 2C4FT 4PTUB 3HC4L 4KC3B 3C1EA 1M1XA 4HYTB 2ESVB 5C2UB 4DKAC 2KL6A 3QJOA 3CFIC 3QQ4B 3FW6A 4KOCA 1R9FA 4X99B 3ARFB 1WCMG 3PG2A 4B3TQ 3RZCA 4R4IA 3LQZB 3L7FA 2IWFA 2NDGA 3PHQB 5GSVB 3OKMA 1XR9B 5GSRB 2FFKB 3BSZL 2NXYC 1KGYE 3LZFL 4PJ8B 1DUYA 2JIXD 2EDNA 3L3OC 3GMRB 4B97A 4NZRH 2Y6SD 4MLIA 3A7LA 1V10A 3WELA 4N24A 3T0ED 1YY9D 4PJDA 4IURA 2FJGB 4MZ3A 2UXDL 3ZTJH 3B9AA 3HOYB 3INUH 5EWIH 2QZQA 2D0PA 4DUYL 4JY4A 3BRGC 5K1VA 5IBTL 4R4CA 3QIWA 2YWYA 3EJSA 3AU7A 2UWEF 2O93L 1O9WA 3CC2A 3W9EB 1VFAA 3D3VD 1HCZA 4BZ1H 1PIGA 3ESUF 1MNUL 2J25A 4X6DB 5GS0L 4J39A 3PWNB 4Z7QB 4JBMA 1W8EA 1T89A 5ILTH 1CZGA 4ENED 1XD0A 5KRUA 2CD0A 1KTCA 1XL6A 1TYEB 5FW7A 1USZA 4XR8C 5I66A 3ARQA 3T09A 2JA8G 3BMWA 2MQCA 1NIBA 3E8VA 3NYKA 1O9VA 3L5XH 1YEHL 1HKLH 2BJML 3RFRA 4OQTA 3TLRA 3IJSA 5C0XJ 4WFFE 5BV7C 5AZ2L 1JWMB 1K3ZA 1I4GA 2WOYA 3PDOB 2OL3H 5EU6D 4R8NA 2NT0A 3C9NA 3WEOA 5KS9F 2YGPA 2UZXA 1PH9A 3RKPA 3IDIB 1HSAB 1V7NL 3DHQA 5M5XH 1XH1A 1WITA 3PV6A 4MZ2A 3N1MC 2NVYB 2K9FB 4FXGB 3VGGA 4GOPC 1V05A 3WAJA 2YA2A 4WVRA 4BA1I 3X12B 5HYSA 2Q6WA 1NZRA 4ZXBC 1AGBB 4K7FA 4WFHE 5L0QB 4RIRB 2BX5A 5HDQL 3OTOL 2QW7A 3H9SB 4YEFA 3UYOD 4DF9A 1B53A 4MB3A 4PUBL 4ILWA 2JYOA 4DSYA 3BUQA 5DC9B 3L48A 2FQEA 2AQTA 4N2DA 1VQKA 2FSDA 3BPCB 1DANT 3ONAB 2DJMA 1HK6A 3W0WD 1ES0B 2IAMB 2GJZA 3DX9A 2WXNA 3SO3C 4HGWA 5FV1L 2AZUA 4Z5RA 2OQ0A 1EO8H 3OHXC 3KVQA 4J3WA 2DY2A 1LTRD 1TQBC 3U36A 3NPPA 1RVFL 3BSHA 3JWDC 4DP7X 4YE4H 4UOW0 1U2CA 1J5EQ 2WTOA 4M6AA 1KY6A 1AS7A 1PKQA 5IB4A 3TVMB 4AZUA 4CKEA 4U1IB 1JF1A 1G9EA 4Z7NB 1Z5YD 4WFED 5CSZA 3IJEA 3L3IA 1AR2A 1V7MH 3ZRCC 1XCQA 3KXFE 4LRNH 4R84A 4GQRA 4ZS7H 3F8UB 4FNLH 2MPVA 2YSTA 5LCVH 3FKIB 2Q2HA 2FD6L 1J5CA 5AUMA 1D6EA 2PMZA 4RMTA 2HG5A 1ZGLM 3M6DA 4KHZA 1DO5A 3ERSX 1E8WA 4IMLB 4PYHA 1KN2H 3IFLL 1JFQL 2QVKA 1XF5A 2I60L 1Q1PA 1CYGA 3CVCA 3MRIB 4LESA 1IGJB 3OHXA 1DN0A 2VN5A 2EIBA 2P48B 4AT6A 1MCDA 1YPZE 5BJTA 1KGIA 5CR1A 2VB2X 3DWPA 1QQDA 4XIGS 3G5WA 2B29A 5D7LA 3KWUA 1VZHA 1GOZA 4LMQI 1M6OB 2CIKA 2OMVA 3VTAA 5C0XG 4D7BA 5IIEB 4I13B 2BFVH 4HEME 3VB8A 1HIML 4YN3A 2VUMB 3B6YA 3H15A 2BNUB 3V4VA 4QR7A 4DK5A 5I8OH 1VSCA 5CBAA 3VD1A 1BYNA 4BXXG 1N0LA 4WEBH 4NKDA 4PGBB 4YHHQ 2ODHA 2EE9A 1PLBA 3O6FC 3A74A 1RZJH 2VO8A 1S7RA 1STEA 4K0KL 4CKVX 4MXWH 5IB3A 2CNYA 1VAHA 1ZLSH 1CDUA 1FLRL 3SDDB 3WIHL 3JWNE 3CCMA 3JXAA 3BGAA 1CGXA 4AH6A 3S1RB 2MGSA 3HG9A 3GTQH 1ZLUK 2AXHA 3LRLA 1DJWA 5LN4A 4A3JH 2WLMA 1BD2A 5MERB 5DUML 4LASH 4G72B 2BP0B 5E1AA 2VJXA 1KB5B 5FW8A 4OD3H 4Z7WB 4Q9QL 3BT2L 1JK8B 4J7RA 4LB8A 4W9EC 1H8LA 1SXCA 4XXWC 4DK1A 1H9DA 3DPDA 5I1HH 1LO0L 4PWHA 5BVJB 3VA5A 4A6YH 5IM7B 1I3RB 3R06B 3KEHA 3GXTA 4UINH 4B9ZA 3TH2T 4U6YB 3DDFA 4RGOS 2OMTA 4WUUD 4MMXB 4RGNB 1ETJA 3OTTA 4DV0L 2K4AA 1PG7W 2Q10A 3N40F 3BZEA 3SB3A 1C5CL 4TV3A 5DFAA 3EFXD 5DRWB 5BZWA 1LE5A 2R0LH 1NFDF 2KHIA 2YAPA 2E3VA 3AFQA 4HJ7A 4OWTB 4H0IA 3F85A 3ZX1A 1PZSA 4ECNA 2ZTEA 2UXFA 3G5YA 1KDAA 1YEWA 1QI4A 2VLME 4UQAA 2Q8RE 1CHPD 1X3EA 1S7VB 4J27A 4QRPB 3PHOA 4Z7OB 2VIRB 4H88L 1KHIA 3MLTB 2HLAB 2WFWA 3VD0A 3S2HH 2HPOA 3SE9L 1D5IH 2QR0B 3ZUNC 4AYDC 1AR1B 3O41B 3BE1L 5KVDE 3NESA 3ZXAC 2FR4A 4MAZA 1GO3E 1NAMB 1AE3A 3EBIA 1CL7H 3K2KA 2OP4H 2E59A 2OF1A 4C3IB 3PY9A 3QUXD 4Q5VA 3HEJA 1JNHA 1OD7A 2H8PB 2ZWKA 4L4JA 2K5QA 2WP3O 3C6LB 3OB0H 2RA4A 4LVHC 4QQBX 4M6OH 4RISL 3L08A 4XGZA 5CNHA 1N6QL 3UE1A 1S7QA 1PTOF 4B9FA 3BVDB 4X6EB 5CN2A 3RDTB 3K81C 2E7BA 3LKOB 3P11H 5FO9A 2RJMA 2B1HL 5IB2A 1J5OL 5EPKA 2BNRD 5AOIA 2VJ0A 1TEGA 1Y1DA 3CMEA 1DR9A 3LZNA 5M94B 4DR4L 1I9RL 4OUUA 3S35H 1FL0A 1LT6D 3FMGL 3F7LA 4TQ8A 3V8OA 3AXHA 5A16A 1EFXD 1FIEA 1Q9WA 5E94B 5FM4A 1BF4A 1RDPD 2Y0SG 2F8XC 4OR1A 5JJIA 5LGHH 3A8KE 3MVVA 1J10A 1CGTA 4YPGA 2OYMA 1UENA 1JSYA 2AQNA 4ZUJA 3T04D 2ZXDA 2HAZA 4A37A 3N0AA 1CFQB 2CW0C 1I1AC 5E4AA 3LHPL 3CX2A 3SGEH 4CRPA 2D9CA 1A7PL 2AQ3A 1JWSB 2BRQA 3OKNA 2XV6B 3E9IA 5HI4C 2YEVB 1ED3A 4Y5VB 3FQXB 4PJ7B 4AE0A 2UV3A 3CKIB 2HQLA 4KKAC 4QAMB 4YHIA 5C8JA 4TVSa 3AUWB 2EVFA 1C5BH 2V9QA 1NCAL 2B59B 2YTVA 1A1OA 3BAXA 4OD2B 2AI0L 5FYKU 2PCPB 3JTBA 5E1QA 5FYLL 2VDPL 4Y4FD 1OF2B 3TZVB 1E5AA 5L2KB 5GGVH 5E4IA 2O1AA 3FCBA 3C2PA 4JFDE 3GSUA 2GC4C 2IO5A 3IDGA 3MV8D 4ONGL 4RX4A 4XP4L 1F41A 5IOCA 4GRWE 3HOWH 2BM3A 1G7IB 2NY6B 2W0FA 4X4XB 2KKQA 2XN2A 4HT1L 1U8PA 1LTSD 4BRVA 1EUTA 2VQFL 5GJSH 1F4XH 3FONA 5EZPA 1IFHL 4APVA 1S5DD 3H3KA 3ARGA 2LQRA 2WINA 1TO4A 2GFBB 1TVHB 5ES4B 5I15H 1W16A 4B95C 2X44D 3DBSA 5TGBA 1XX8A 4IKNA 1DDTA 2IH1A 1MHHB 2WP3T 2VZVA 1MJJA 4XCEA 1JL8A 2IY5B 1QTPA 1KCUL 2XKNB 2YR3A 3JWNH 5ICYB 3U9SA 2ADJA 2GN5A 3C5ZC 1CMOA 1CZ8H 2Q7YB 4F80A 1CK1A 1DEEB 5JHMA 4MTMA 4OELB 4F1ZA 1U8QB 1ZA6A 5TDNA 2HDLA 3MLSH 4O2CA 5HYQB 2ZOKA 4HWNA 2NY3C 2CBPA 4ZUUB 1MHPH 3QCUH 2C4FU 1AZUA 1VFBA 1VFOA 3HNSH 3QYMA 2KEDA 4YWGH 4EMZA 3N44F 4UAHA 1RKRA 3DYMA 2A4ZA 1D9KB 1TTAA 4YHZL 5CEZD 3AG4B 3GJFK 1SOSA 2C3WA 5DHDA 9CGTA 3K80A 4R3SB 3ZBMA 1WZAA 4PRPB 5C5LA 1U92A 4LHQB 4N9GA 4GT7A 4P4KB 5DQ9B 4ONFH 3DEOA 2Z4QB 4HS3A 3PAZA 1PSKH 4ZMXA 3CCUA 3ARZA 5D1ZI 4G57A 1R46A 4XMUA 3OHMB 4HEPA 4X62Q 1ZT7A 3DVIA 5FDWB 1BECA 2OTUB 2BFGA 4OUOA 2F7IA 4QD2E 4XAWL 5TE4H 4FCAA 4M56A 4E41E 2ADGA 1WA1X 4GRLC 5I1JL 2D7MA 2X69A 2YN3A 2EIDA 3UYRH 4JVPA 2V7HB 3D25B 2GSIA 4RDQF 4BINA 3NJVA 1EIHA 2YLHA 3ESNA 1VQLA 3B2XA 3REWB 2BSTB 1Y1VH 5I0WA 3HG1E 5SX4H 4QNPE 2HTKD 5AL0A 5ACZB 4L5TA 3J80L 1F86A 2B0SL 2OXHA 5M95B 5CINH 1L7IH 1CR9H 4D0BB 4QTIL 3ILEA 6PAZA 1SE2A 2BXYA 2AMUA 3BAEH 4CADA 4BKLB 3CSFA 3TF7C 3FU9A 1T4KB 2MMXA 2A6HD 3US1A 2JKTM 3G04B 4N8X1 5F7EH 2VZ1A 1BCPD 4K0OA 3OAWA 5GRXG 5JIIA 3UG5A 5AJ3Q 2EE6A 3K5NA 5FLXE 2IFFL 4IRJB 4P57B 4JDEA 2CGRL 1GY2A 1D5XA 4BBRB 5BS0D 4RZCB 1X3PA 1L0QA 1AJ7H 1P4IL 3HB3D 1VDZA 1KXHA 2XN9C 2CMRH 2YFNA 5AKRA 2K4KA 4RQQA 5EUOB 3QNXA 5T3XH 4UQ2B 3OKLB 1SMAA 2R7ZG 3I6KA 4YHPA 2HT4C 2HFFB 4GNXA 2EDDA 5BZZA 3I6GB 2ICES 3ZDZF 5A2IH 5DA0B 2VN4A 1I53A 1ZA3B 3FRPB 4LKCB 4FXDA 3TYGL 1EQVA 2YXVA 1DANU 2KLTA 2ZXGA 2O5ZL 4GT0A 5B1KA 3TH3T 4JPVL 1MI5B 1SLWA 1F8TL 3IKKA 1XGPA 2J8UA 2EDBA 5T33H 5ITBL 2L4OA 2XN9A 4B96A 3S96A 4OLWH 5JDSA 1MJ7H 5IV2B 3MNZA 5DK2A 3QG6B 1R17A 1MAKA 3LKNB 5DURD 4E68A 5FYJE 3GMOA 1V3JA 3IWUA 3FTUA 1M53A 2Y0SE 2AJVL 2APVA 4QY8A 5T1LD 4A3GG 1S7XA 5C0BB 1TZGH 5DRXA 4BK4A 4GO8A 5IJVB 1BZDA 1N6VA 2AABH 3NA4A 3L2NA 1QLFB 2I0QA 1CXLA 1KDJA 2BPBA 3ISRA 4XVOA 1U95A 2NN6I 3D85B 4P9ML 5TE7L 4ONOA 2YHGA 4IRSC 1KTRL 2DM3A 4Z3GA 1T7WA 2DLGA 3JQOB 3N85L 2XWCA 3PGDB 5MENE 1G9NH 4MLSA 2HQEA 3LQAL 2GJ6D 4JRXD 4LFAQ 4NRZB 3UDIA 2CJUL 3QQ9C 4ZT1A 1ZHBB 3ZE1B 2TAAA 5BRZD 4R4BB 2BZDA 1DJYA 1HL9A 3D0LB 1E9QB 1AIFB 4GXUM 3OX8B 4G6FB 3LN4B 3K6SB 2A0LD 4KV6A 4J3OG 3MU3A 5ANMB 4QRRB 1I8IA 1KPUB 1WUNT 4AW7A 3MOBH 5L7XL 5EIIB 2OCJA 2CR0A 1SQ2N 2W9EH 2B4CH 2F74A 5C0XH 4P5RA 2PWHA 1GYUA 5F88A 2ZCHH 5C0AD 2C9VA 4U3SB 4U49A 2RBLA 2JKIS 1RJYB 2KQ3A 1VADB 4BXXH 4ZAKB 1MHEA 1EK3A 3QNZB 1EQTA 1VEPA 3BO8B 1VQ7A 1BPLB 3MNVB 3EFFA 2DQHH 2ZF8A 4LIQE 2ZXQA 4A2HA 4R83A 1EHXA 2BSSB 3QCVH 4M5YL 3HE7A 4HW6A 3V0FA 4POZD 1JJGA 3M1CA 3JAMc 3HE6B