5JPNC

Structure of human complement c4 rebuilt using imdff
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
290
structure length
290
Chain Sequence
b'APKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C4-A
publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
molecule tags Immune system
total genus 55
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jpnC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 5jpnC01
2ICEC 3KLSA 3G6JB 3L3OC 5JPNC 1AYOA 1EDYA 2QKIC 1JC7A 2B39A 5JPMC 3CKIB 3FRPB 1XWEA 2A73B 2WINB 1UEAB 3HS0C 5FO7B 5FO9B 5FO8B 2XWJB 4D94A 3CU7A 3HRZC 2I07B 5FOBB 1UAPA 2WIIB 1D2BA 1JB3A 1GXDC 3V96A 3OHXC 4FXKC 4ILWA 3T4AC 1BR9A 2J0TD 4FXGC 3I70A 4LNVA 2A74C 2PN5A 3MA2B 1OO9B 2E2DC 2XWBB 1BV8A 2TMPA 1BQQT 1PXUA 1BUVT
chains in the Genus database with same CATH superfamily
1O5PA 3MLUL 2RSOA 2DD8L 1HNXQ 4BBRB 1URZA 4OM0L 3RQ3A 1QSEB 2EP6A 5ETUB 3BWSA 3VWKB 4FDBA 2AQQA 3Q13A 3V5KB 1GO3E 3GMQA 3ZRFC 2E7BA 2D3VA 5F6IB 2YZ8A 2EJGC 3PCYA 1WWCA 2KYIA 3HG2A 1PFSA 3Q1EA 1PTOC 4IUUA 5DUJA 2X40A 5I66A 3OPUA 3S1MB 4F58L 1JAEA 1F4XL 1U2YA 2YYZA 3BU2A 3P9MB 4UUJB 2VL4A 5EPKA 1X7TA 5DVPA 1FYTE 2BP8B 5KG9A 3GXMA 4ODHH 5B39A 1VQ4A 1F41A 4JRFA 4NZJA 4TQPA 3NG5A 4U1NB 4IFDH 1RFDH 4G11A 5FGSA 5GZOC 5KIXA 2FX9H 4IEFA 2ICES 1KB9K 2UWEB 3KPLB 4UINH 2SDFA 2RQEA 3L5WB 4KY2A 4M29A 2DEWX 4YDKL 4BIKA 3DTUB 1JOIA 4I88A 1XD1A 5G2NA 3LD8C 1SBSL 3II1A 5BW7A 4NQQA 1NCBL 1WAAF 2CA3A 3BZ5A 3MRPB 4BKTC 12E8L 2DH3A 5EBMB 4TKOB 3FFCB 1HILB 2R93H 2ICWJ 2ZSWA 2NYYC 1PAMA 1A6ZB 2B9AA 1QMUA 5GGSY 3CCSA 4ANKA 4R4CA 4A7VA 4BUQA 3HOXG 3NVQA 3Q2NA 1MNUH 4MQ7B 4LL1A 3DWAA 1BBJA 2JSOA 3X14B 5E4WC 4XOCA 1SYCA 3KZ8A 1QA9B 1G7IA 3RWFA 4OZIB 4RFEB 5DJXA 4N20A 2XRAL 4L4TB 4EDWH 2WO2B 4FX5A 3P4MA 1JPTL 2AJXH 2LABA 5EA0H 1PKQB 3HNSL 1AC6A 4BFRA 4LAQH 1SXZA 4QHMA 1JG9A 3CSTA 4S11A 4QI3A 1EX0A 2P24A 2V37A 4TL5A 1WCBB 3O6FB 3SK8A 2KI6A 5FYJH 2K78A 3EFFB 4U3SB 5I1HL 1VGKA 2UUCL 3EGDB 1WK0A 1EEYB 4DKFH 4WDIA 4F2ME 1ORQB 3BD5A 4L8DA 1F9QA 1XMEB 4GLVB 4LLMB 5EU4A 5LBSH 4XYOA 2VLJE 3NA9L 4PCKA 4HHAA 4M8VA 4I7AA 1W91A 1A6UH 2CJTA 2PYEA 2FSEA 4XC1H 4WLCA 5J3HD 1JWMB 3IDXL 1G4MA 1MFBL 3GPSA 4NZFA 2Z91B 3M1CA 2LLLA 4YQXL 2K0RA 5SWSA 3IPBA 5GS1A 1INQB 1YITA 4KV5E 5I9OA 5KNCA 3H42L 4G6JL 1KFGA 1E4HA 1KEMH 5IQNA 4FFVD 3B6YA 4IDLA 4PBDA 5C0CA 3ULUC 4CU8A 3ULUL 2XG4A 4Q0FA 4AW4A 4UDTA 1B0IA 4DR2L 3QRGH 3TBYA 4H1LG 3ISWA 4KHPL 2ITCA 1T7WA 2NW3B 3VMOA 5I1AB 3QG7L 2E7LA 1KCRH 1BXAA 1XMQQ 3BKJH 4YFLI 1ZA3B 3RX9A 2A74B 1JORA 2AABH 2UUAQ 5F71A 4DVBB 3O6KH 4HAGA 1X5KA 1IM9B 5DR5H 3X2QB 4C3HH 5IB5B 4D9RD 1B4LA 2K5QA 1CKNB 4N0UA 2ZCHH 1UD2A 2ZOKB 3GHBL 4M7LT 4QGYA 4Z7VE 2VXTH 4PJGB 5L2KD 5DQ9A 1I1RA 1WC7A 2WZ0A 2JA6B 1DLFH 1E6JL 3I50H 5IYBG 4HV8B 1A3LL 1QWHA 3NDZE 3RDTB 2JEBI 3O81A 4D0CA 4AGQA 2FIKA 1KJ3H 4FYRA 2DQ6A 2F0FA 1NGXB 1KIPB 1MWAL 3MTRA 2QSCH 3OZ9L 1FBIL 3BJUA 1SN2A 1IYJB 2W0FB 3UBXA 3W0WA 5I17B 1JJGA 4A3DB 3I4NH 1Z9SA 4UT7L 1RUPH 1P7HL 5DD3H 1QP1A 4NYLA 1RU9L 5F2FA 4XXWA 5KSVB 3BLKA 3VDBA 1A15A 1O80A 1DGSA 1V05A 3L54A 3WGUB 3O8XB 4EPSA 1PSKL 3NZ8A 3P0YH 5EO9A 1G9ML 3P2BA 2HX9A 4J15A 4L4VA 3LQAH 1RZKH 3MI6A 2Z35A 2JK5B 1CZ8H 2IDUA 3GKWL 1GOHA 4IOFC 4AK1A 4F91B 3ARFC 3OXSB 5A2AA 4ZSOB 4YNYA 1SFOB 5HJ3A 4C4UA 4OLXL 4P3CL 4BINA 1QZHA 1JERA 3QUKB 4TTDD 4PJEB 2FECL 1CIUA 1WSST 4M9OA 1B2YA 3CFCL 2HMIC 2GI0A 2HRPL 2AHOB 1D5ZA 3BGAA 3CFEA 4AEIL 2E2DC 4EJ1C 3I6KA 2MHVA 4XT3B 3G7TA 3TBBA 1RIHH 1C5BH 4RGNC 4MNGA 2C1PA 1XNQL 3G5ZA 2XG5B 4YSTA 3RP1A 4BA2I 1INDH 3LKPB 4Z7NF 4F33B 2OULB 3JV6B 4JFFB 3EO9H 4Q6IB 1NCIA 1ZV2A 1TENA 2R7DA 3BVGA 1FZKB 4R9HA 4XE0A 2G3NA 3NGBB 5HD8D 2YD5A 2AUKA 5JW4M 1YPZA 4DESA 1CG9B 2GK2A 5HDBE 4ZQKA 1NMAH 1U3HD 4N87A 4O2EA 1ZT4A 3D48R 4DP4X 2JIXB 2NZ1A 5EFIA 4YHLH 4C58B 4EX5A 3ARPA 1VIWA 3VFMA 3D33A 4GRMB 3O3EA 1YQVL 5HBBA 4CJ2C 4J5VA 1BZOA 3AMKA 3MJ8B 5CD5C 1IBGH 2P80D 2XA8H 3TVMA 4F7PA 2OTWA 3NJMA 1VB9A 3P1HA 2PTUA 3NTCL 5T1LB 1GCFA 1UWVA 1NSNS 1HUMA 1IT9L 1L7TH 3EYSL 5DUBB 3HNVL 4LHUG 1FAIL 5E0FA 3RLSA 3K1KC 2B8GA 1PF3A 1EHXA 3MOAH 1NPUA 4NO3B 1LILA 3K81A 5TPWL 4AYBE 4DR3Q 4G8IA 2CO6B 3IMRA 2IPTH 4RDBA 4EQNA 2VO8A 4IU2A 4A3LG 1LTSD 3QHZH 5DVMA 2O26U 1ILPA 5C7ZA 3EZJB 5EEYA 1YEDA 1FGNL 4EUPH 2DQDH 1EQWA 1MFEH 3NFNA 5E6SB 4KHTL 2F1EA 4DP0X 1FIEA 3ULLA 4R84A 5IYCH 1A4KA 5ADPL 1FFTB 1NCCL 4JI1L 1SJMA 2B2VA 1R3JA 3K8MA 4PHXA 4DGIH 4CA4A 4LMQI 4FG6D 1XMQL 4MA8H 3ZZ1A 4Y4HD 1JWSD 1AZPA 2DW5A 3V4VB 4JNXA 4EI6A 1Q86C 2HVBA 2NY3D 4AQEB 3BCFA 4JR9L 5I82A 3HBPA 4OI7A 3KPRD 3RWEB 2CW0D 3QGVA 2ENJA 4D0DB 8FABB 1X6OA 2LE9A 3NAAL 4HUXB 1JN6A 4F8LA 3G5XB 4H0LC 3WTSA 3A21A 2GVAA 2ZNXA 1UKSA 1E3ZA 3J80L 4CMMB 1TPXC 4ULLA 1PZCA 4URTB 2X05A 1UD8A 3GTJB 4CKQA 1YNJC 3I55A 1QYGL 5GSVB 3HC0B 5KYUB 1J6QA 2RAMA 1GUTA 1MN4A 1FNVA 2Y2WA 3MYZA 4DXGA 3HZMB 5C09A 1VQLA 3WEAA 1I8KA 4GB9A 1NGQL 3OKLA 4PJ5D 4HWUA 3W3BA 2JJUA 3KL3A 1B4TA 4I0PC 4GOPC 1MLBA 4EVOA 1SF5A 1YN7B 3DX2A 2JA5H 4DPBX 3J81j 3ARGD 2ZPKL 2DLEA 2IH3B 4HPYH 3PL6B 1CD1A 3A54A 2VXVL 3L4VA 3W11D 1A9BA 2UX6A 2WKOF 1JGUL 2F74B 4J1MA 2EYFA 2J73A 2W9EH 4IIZA 4KC3B 4N9OB 3AY4C 4Y5XC 3ROOB 4YUEL 2AMGA 5E9DE 4YH6A 2WGNB 5EUOA 2EDYA 1U4FA 3BYYB 2CRMA 2I7OA 1VQPA 2F15A 1S5IH 2NQDA 4PVNA 1W9XA 2GITA 4PLKC 5JJLA 1BAGA 4MMYA 2ICEA 3RAJL 1XGYH 2AQ1B 2C3XA 2MNAA 3DWQA 5CR3A 2ZG3A 3HEIB 5I8CB 3KD4A 2OJZL 2Q76A 3X3GH 1KGXA 1ND0B 2SOBA 1XL6A 4Z0BH 3DV4A 3WO4C 3L3JB 3WFHB 5E8OA 1ETJA 3AB0C 4PJ9D 3VFNA 4FNFA 5J3BA 4OJAA 2JCCA 4JI3L 3NHHA 5D2NB 5TE7L 3ISYA 4NMZA 4NJAH 2VL6A 4LSQH 5FYJE 5L2JB 3NEMA 4FG2A 3TZUA 4WWPA 4DAMA 2JELL 2EYRB 3DVNA 3BP4B 4IKLA 4XTRC 3SGJC 1Q1EA 1H3UA 4LNRA 3MZ5A 3AM8C 3GSNH 3HHRB 3PF5A 2QEXA 1OPGL 5ITBL 5J6GB 4X99B 2Q1EA 3MREB 4ME3A 3RX7A 5IIFA 1ACXA 1ZE3C 4F27A 3N3EA 1DUZB 5FA3B 1TZIB 3BESR 1MFNA 3B2XA 4FI7A 1Y6MR 1MAMH 2NQ3A 5DJ6A 3MA9L 3SGEH 4DF9A 1U3NA 2YAQA 3QCUH 4G9DA 4BXXG 1S7QB 4JJHA 4PY7A 4XNZB 4CGUB 3RMHA 1A14H 1WBZB 4LGSB 5CFHA 4TNGA 2NX5A 4DO6A 1MCWM 2YEZA 1W0WA 4MCYA 4DK5A 3WTXA 3QG1A 2UYLB 1BFSA 3G6EA 4KNTA 5C2BL 1NIBA 4ZG1A 5IB2A 3V5HB 4TQIA 2DB8A 4FZ8H 5CMDA 2PF6A 2Y24A 5AJ3L 3MRDB 4N2FA 3II3A 3LKNB 5KTEL 4NENB 4N2DA 4FFZL 4N0YL 5D7HA 4GRLA 1KN2L 1IQDA 3ARBB 3T1YL 3BQUC 1CLYH 3MRCA 3HKFA 1G6RB 5JHMA 4QRFA 5HYFA 5B38B 2D62A 1Y8OB 1HQRB 1YEKL 2J71A 5KJRH 1SYDA 4AW7A 5IJCC 1N6UA 1EHNA 5FYKU 1FV1A 5AW5B 5HHXL 3MNWB 3H9ZA 2MHAA 2HT2C 3CX2A 4UPAA 4YSRA 4B9JA 1T21A 3NCJH 3AVEA 1SBBA 4KV6A 1YNTF 5HYIA 1MQKH 3FN0L 2QADB 3MJ6A 4QLWA 3OX8A 1Q0YL 3B7SA 3E38A 1UEBA 1J8HD 2EE0A 2ZYRA 1O5DT 5AKVA 2NDGA 1K3RA 4AIXA 1TNMA 3P11L 1RJTA 1BBDL 4BE5A 1VCAA 1QJOA 3AQYA 3QB7C 5JORA 4K73A 4P5MA 3CBRA 4KO6A 3OHMB 4DKDC 3VXTA 3FFOA 3IS0X 4PBWD 5CCKL 2I26N 4LQ1A 5IJBC 4RHRA 4GG6E 4JKMA 1P5VB 3TBWA 4S10A 4ZS6D 4G8FA 4QRRB 5C3XA 4HK3N 1UEAB 1JPSL 3BP5A 3MRRA 4GZYC 1T4WA 4M5SA 1H8NA 1SMYC 3MJ9L 1MJ8H 4A6YL 4LEOA 4DCQB 4HIXH 3DI3B 3E9IA 2ZM6L 3FOMA 1G5GA 3HG5A 4ODXA 2VL5A 2CLZA 4AQ1B 1J88A 2B2XH 3NSCA 4KRPB 2G2RB 1DFXA 3F7LA 3EROA 4OVVA 2MUYA 3HN3A 1QTPA 4Z9CB 1ZANH 4LB8A 5FUOH 5JW5A 1BVSA 3GV3A 5GROA 4DV2L 2B14A 3NJFA 4DO4A 1O9ZA 4J6IA 4I0CC 3MMEA 2UUBQ 3H0GG 2WD0A 3EFDL 4TRPH 5JW3H 3SK4A 1GC1H 2GFBA 3B6SA 5MP6L 2VLRA 1ACYH 1MJUH 5F8RC 1I4XA 2D7MA 5IVNA 5E5MA 4D0BB 3UG5A 3PP3K 2EIZA 1KYOK 2BNUB 2JA8B 3GBNL 3QJVB 4V1DA 1BPVA 1AHWA 1NINA 1BYNA 2OM5A 3UADA 1STYA 5G5DB 4IBUA 2R29A 4HH8A 2BDNA 1D2OA 1YZZA 2OAAA 1RK1A 3KYMA 6CGTA 1MFUA 5DQJA 2R92H 4HCRA 3QFGA 4TKWA 4PV8B 1JB7A 2XV0A 3BN9C 2FB4H 4ZUVB 3ZN6A 4FQ1H 3RWCA 1I1AA 2Q8BL 4Z7OB 4ZMXA 5FKAA 4MLIA 1FJGQ 3TX4A 5FB8B 2WB1A 1EJOH 3E3XA 2DTMH 3PJSB 3KLRA 4FI8A 4GEJA 3GRGA 5CR8A 3KLSA 4XPFH 1VHPA 4QYOA 2P8PA 3W5MA 4OCWL 1I8AA 1S6NA 3NCXA 2WFWA 4OEMB 5FO9B 4N28A 5DC2A 5T3ZL 4A37A 5DRZA 1OP4A 1YSOA 3O9WD 4DZ8A 1BWMA 4FCHA 4EN3A 2QTVA 2FYVA 2VZ3A 3FRPA 5E4EC 1ZGLP 3VA2C 1WFQA 2KENA 3KYNB 5F1KC 3ZGIA 4NQXA 4NRXB 4QXWA 2F54A 3V4LA 3HOYB 3DYPA 3QUXC 4EBQL 4R90H 5F9JB 4JRYE 4WV1A 1HAUA 1A4CA 3PV6A 3LWUA 2R61A 1O6TA 2DLTA 5M3MB 4B3VA 1UD5A 3FB8B 5TDNA 3WD5H 4DSYA 2Z8SA 2DQJH 3L7ZC 1OOAA 1TJGH 1FL0A 3FB5B 4OIKA 3G5WA 5D7IA 2R7FA 3D6CA 3HMWL 4NXKA 1K2DB 4ATWA 2OSLB 1FPTL 3HOZB 3LN4B 4M43H 5HHOD 2DUDA 1Q3LA 1RMFH 3K59A 4OQTL 5C0AE 3SE4C 3VE0A 4GRWB 4WO4D 5K9OB 2VLKD 1ADQA 3UTZB 5D1ZC 3DMUA 3TTSA 1TEFA 5EU6A 2NYKA 2JA7H 3PO2H 3HOWB 2CMRH 2DWEB 3FHQA 3HLAB 4QJ3B 4EI5B 4L5QA 1IGMH 1IBML 3TU6A 1MXGA 3O3AB 1CDBA 2LSSA 3T2NL 1MFVA 5DLQE 1EMTH 2KPNA 4R7XA 2UY7B 3VXUE 1X5GA 5C5LA 1IL1A 4H20H 3CXHK 3ZMRA 4YDVB 3E3QE 5GSRA 2DM2A 1RUKL 5I8OH 4PREA 3G5YA 3GDCA 2ZUVA 3KPQA 1UM5H 4LARL 4F15B 2WTRA 1WZ1H 3FFCE 3AS2A 4P46D 1TTRA 1QFHA 4YSEA 3M7FB 2GG1A 3K5MA 2V8LA 3T51B 3M46A 5I2XA 4LAAA 4G7ZC 3RVUD 3TJHD 4K5MA 4MA1C 1FVCB 4I4WA 4OZIE 1EFXB 2X38A 2G9HD 4B3EA 1D9KC 4RAVB 1QRNB 4G5AA 3C46A 4LSVH 4D7BA 2F58H 4KI5E 5E99H 3NK4A 3UZQA 4UDUA 5TF0A 4GN5A 5E6IB 4JI6Q 2H3XC 2WSPA 4OWTB 5NUCA 4EKJA 5DS8B 1HZ9A 3IRCA 3W57A 2ESVE 1H3PL 4NXMQ 5E8PA 5I74B 2PMZA 1FE8H 2YXWA 2VY3A 3UTOA 2APVA 3T3ME 3QS2A 1QFWM 2WLYA 3BJLA 1MD2D 4PGBA 4V0BA 4KNUA 2RDHA 5C1MB 5I9QC 2BIMA 2N56A 2BVPB 5D55A 2VXUH 1YCSA 2A69C 3FQTA 5CEXA 5D1QA 2F53E 3BEVB 2B15A 1J1OL 5D1ZI 2YGOA 2NY7H 5FLUA 3HAEA 2V6HA 1LDPH 4M7JH 2Y1VA 4LMQD 2CRYA 3MXUA 2OZNA 5SWQB 1KPVB 1T6BX 3VFPA 3PWVB 1IM3D 4GW1B 1NIDA 2QT6A 3PV7A 1KPRB 1CSPA 2KHSA 5ISZE 3P0GB 2VDQB 1ZK9A 3BAWA 1WI5A 4GPVA 1WTHA 2XWJA 4Y7NH 4RHSA 3VQ1C 1MG3C 3SDCB 2V5TA 3B7YA 1WISA 3HCVA 4G9FE 4ODUA 3IJ7A 3CRKC 3UC0H 4EQPA 3MV7D 1D6EC 3L6FA 1AFVL 1XZ0B 4OFPA 1E0OB 1I1FA 1UWEL 2QQKH 3ARYA 3T8VA 5EZIL 1CGSH 1WCMB 1FG2A 4P3DA 5E7BA 4QY8A 1HIML 2GIYA 3J81L 2EJFC 3H2WA 2VW6A 5HYEA 4PB9L 4PRIB 1S8DA 1L0YB 1KNAA 3ZRSA 1P9MA 4YSOA 3TEZA 3VVWA 1XIWA 2IG2H 4HQQH 1F2YA 1ITBB 5L7XL 3MCKB 1CT1D 2XTJE 3I9IA 3FK3A 1KG0B 3NH7H 2AXJA 3ESUF 5ADOH 1Z9LA 4Y19B 1DQMH 2NY2C 1A9EB 2GC7C 2B8FA 1RURL 3QUZC 3K5OA 1TU2A 4P57A 4JFWA 3MXVL 3O3DB 1OO9B 4FLSA 3REWA 2XACC 4OSUH 3Q06A 3OGCA 2Z7YA 2ADJA 1NAPA 1VFAB 3CCRA 4K3GA 1QE6A 1D3CA 1QBML 3FZUD 4RLDA 3TN0C 3OHXA 3VI4A 2Z0UA 1A3QA 5LGHH 4MAUH 2A5UA 4JI4L 2J1KA 2BIHA 4NRYB 2LR4A 4OCRL 2OSWA 2BVOB 3LQZB 4KJWC 1LP9E 3TREA 5D2LB 1M6OB 2HCZX 3NIGB 1DSFL 2FQGA 5J56B 1OXTA 3CH1A 3LPFA 2VO5A 4PJFB 2WZPA 1UXMA 2C7UA 3V96A 5DEFB 4XP1H 1V3KA 3KBEA 1D5RA 1KB3A 3BT0A 3DVGA 5D7IF 3DBXA 5IQ9A 1ET9A 5I19H 2PW5A 3JTSB 4NNPL 5D7EA 3OGOE 5B1AB 3VXOB 4BWGB 4IKJA 2Q8AH 4APQA 4GNKB 3G48A 2EYSB 4L8SA 1CA5A 1CDIA 2EH7H 2YFOA 4HAKA 1NGWA 1G7JB 5CYUA 2V33A 3MFGA 1XFPA 3U7WH 5HGDB 3V6ZB 1FGVL 1MCPH 1OGAD 1BREA 1JFQL 1LTGD 3DXAA 3D0VB 4LRIA 2YAMA 1STEA 1IARB 3A67H 1A7NL 4X5PA 4HIIB 4OFDA 4XPGL 3TV3H 5BO1L 3LOWA 5E08H 1C9OA 1HDMA 2JE8A 3QEQE 1TY0A 1UM4L 2CBPA 5F44A 2HFGL 2K5VA 4BQBA 3CDGA 3ARUA 5IV2A 2Z0SA 1TEGA 3SYQA 5AB1A 1W8OA 4AL8C 5L8JB 5E00A 4AL8L 4P5RA 1BD2E 3MOBL 4XO5A 2I9LA 4NXML 1KTKA 3F12A 1EIGA 4M6OL 4QJ4B 3HOVH 1KJVA 3O4LD 3VDCA 1HHIB 1AS7A 3ZL4H 1BFTA 1J1XL 1CFQA 3V4PA 2BSED 4YHMH 5IR1A 4P5TB 4FTVE 3DX6B 4TQEL 2VDPH 5I30L 3DMMB 1LYLA 1TS3A 2N7BA 2X6BA 3TT3L 3U1PA 2MCPH 4F37F 3SKOB 3P69A 3X3MA 1P7QB 2HJKB 3V6BR 1A4JB 3VFWB 2FZ3A 5TTRA 2OXGB 2KC0A 5I5MA 2ZX6A 3BH8B 4J8RA 4NIYE 4NCDA 3WN6A 4FGMA 5TH2B 1DN2A 3GLDA 5EO1B 2R56L 1UB6A 1GS7A 5C2UB 5JIPA 1EY9A 1B9ZA 2GVBA 1A2YA 4ZUUB 3T2PA 1E42A 3S3PA 1AOZA 3EH4B 3WHE1 1L7IH 3FQXA 2EO1A 4FQXA 3T1FB 1H95A 3U4BL 3ZDZB 3SY0A 4TSSA 1Z7TA 1K3IA 2HJFA 2JLLA 4XTRD 1K4DA 1CGXA 3W2DH 1QWYA 3CLEH 5EF3A 5AD0B 1JZ7A 4ALPA 2W9DH 4HKBA 3ZJAA 2NNAA 4O5LH 4JQIL 3CFKA 5AZ2L 1CURA 1BDYA 1WICA 4JM4L 1ZLEA 4NC1C 1Z9FA 2AJYH 4NQDB 5E1AA 3IGLA 3JQOB 5I6WA 3S36H 3AGWA 5EOQL 4N8VG 3QPXH 2DIJA 4ODSL 3N42B 4AIMA 4MIUA 1PFOA 2R0ZL 4X42A 5GRZA 1ZT7A 2MOQA 2VR7A 3STBD 3EXJA 3GMQB 4MXQD 4NHCL 3AACA 5BPPA 1CK1A 1B3QA 4FQIH 3KLAA 5GS2D 3NBHA 4KJOA 3H3PH 2FX8L 2ED6A 3SD5A 1HZAA 1NKGA 4NBYB 4YSCA 1I8MA 1PQZA 1TETH 3GYRA 1S3KH 4FQJH 4NI6A 4AXWB 3EUUA 5I66B 1DQKA 1V9PA 2RCSH 3D5OF 3RWIA 3EJZC 4B0MB 2R69L 4OV5A 1SFHA 4H88L 4NQED 2MCMA 2B2WA 2YGNA 4PJ8C 3HS0A 5HDLA 5E2JA 2R2CA 5B39B 4KGJA 3U4AA 3UJIH 2XRSD 3RIKA 4IU3A 4XRCA 4EOWL 4Y1AA 1CXLA 4XCCH 5GS0C 4WUKL 3U1SH 3U46A 2A3TA 3WLWD 4IEFB 2P9RA 4U6HA 4RGOS 2ICWA 2JKIS 5FEBA 1KACB 1ILUA 1NH6A 3GZQA 3PPSA 3Q43A 1JXJA 3VA6A 5C8JA 4WENB 5I1CL 1HCVA 1EU3A 1KXVC 3PAUA 2VDKL 3FT4B 5FPIA 4ZS7L 5KYYA 2GJJA 5D7SH 3QBTB 3HNTL 3QDGE 4GO8A 4YXLL 3VD7A 2XN9E 1NCWL 2CALA 1KJ2L 4KDTA 3VI4F 5IFJA 5JJIA 2F0QA 3VDYA 4O02L 5C07D 1RJLA 2ZSWB 2OL3L 1TR7A 1KCWA 5JIKA 5F3BA 1NAMA 1JXDA 3OG4B 5LO7A 1BBJB 1F5WA 1C9SA 3F2BA 3IT8D 1G7IB 2OPCA 3RWFB 1V1PB 2A4EA 2UZPA 5DJXB 4M5TA 5E4IA 3GTQB 3GQFA 3FU6A 4UQ9A 4DQAA 4AYSA 2GCYA 3OSOA 2XI9A 3P4MB 1F4HA 4AQZA 1HQ4A 1CBJA 3LH2L 5HHNA 5EO0A 2A4CA 3LKRA 4ICXA 4QHMB 5GRJL 4YL4A 3ZKXB 4LFCL 2JXMA 2BXZA 3KH4A 2P24B 2R3ZA 4B9YA 4ZFOA 3K91A 4M1UB 1P6WA 4MN3A 1PH4A 1A62A 2YKLH 2DKUA 3X1NA 1NCUA 5CEZH 3HKZG 4NZDA 3EIVA 4GMTL 4NZTH 3IXTA 4UY8C 1I4FA 4ES9A 1VGKB 1YEZA 3GTMH 3OR6A 4ZMZA 3KLWA 3PIP3 4MCZA 3UTTD 2J5WA 4UQIM 3BPNB 1HEZA 1VADA 4I77H 4UV7H 1KY7A 3QIBA 1RI8A 2YLKA 4L8DB 3K6OA 3T3PE 3I90A 2P5WD 5EU4B 4IOSD 1HTYA 3GI8H 4PJ7A 4HHAB 5DJ0A 2ES2A 1WD0A 1SLVA 2HPOA 2PYEB 3P3UA 2FSEB 3OJVC 3H4HA 2CIIA 5GGQL 2JTDA 5C4ZA 5I26A 3MV9D 1NEZG 2VB5A 4PMFA 2V4DA 2E8YA 3DIFA 4MJ2A 3KF8A 3E6FA 4BY7B 1S3RA 3MBEC 2VW7A 1PY0A 1NFDE 3I56A 1JE4A 1KBGH 3L3DA 3WUZA 5SWSB 3U9PL 1S5FD 2ZF9A 4A2EA 5GS1B 4LL4A 4X6EA 2F19L 4K6DA 1UCTA 1DO6A 5C0XG 4AQ8C 2Y25A 2FATH 3G04A 1JNLL 2NSQA 1VACA 4HU8A 5K5PA 5C0CB 4YFEA 1T1WA 3R7QA 1TZOA 2XG4B 2DZEA 5E23A 4GKKQ 2XLLA 4UDTB 5FW8A 5I71B 5L9DL 3TBYB 2EC9T 4G7OC 3N85L 3SE8L 4PMEA 2ITCB 1LTXA 1KENL 2DJSA 3BKMH 3QXAA 3P20A 4DKAA 5JR1L 3VD1A 2EE1A 5IFHH 4L18A 1NL0L 2FD6L 1K5WA 2FH6A 2BLFA 2NNFA 4GSXA 4C56D 4CGYB 2F5BH 4LASH 2RGSA 1J9SA 1TQBB 1MWOA 3F58L 4N0UB 1DL7H 5DQ9B 1WC7B 3ATBA 1L0PA 3II2A 3LGJA 4YE4L 4AH2A 3ZQ9A 4KZEH 3N6RA 4IJ3C 2PO6C 4G8GE 2GUOA 4BBWA 4D0CB 3UEZA 1FNGA 2FIKB 3M17A 3KS0H 5DVNA 4MNQD 3SE9H 4FD0A 2NY6D 5G4NA 1UWGL 1UZ8A 3UBXB 1NZRA 1UT9A 2XY2A 3GLEA 1Z9SB 3OV6A 1T2QL 2BNQE 2L8AA 3ARED 3KVPA 2P4AB 3LEVL 4NZ8A 5D1ZD 4NYLB 1O0VA 3EOBA 4DFIA 5IT9L 1JOOA 3UAFA 1BF4A 1Q0EA 5IESH 4KXCA 3U25A 4F92B 3EJSA 5EO9B 2XOTA 3D0LA 4L4VB 2F8IA 5FKPA 2Z35B 2QGEA 1NUDA 4S1SH 5HJ3B 4OGQC 2ICIA 1JGVL 4LF9L 1JQYD 1Q1JH 5TQ2H 4M3KB 3SJVD 5E2WH 1IKOP 4OR1A 5AOLA 1Z6JT 2XXCB 4HFUH 2HCIA 4C3JB 3PAYA 5F7FA 4A3EH 1PGRB 5DK3A 3CFEB 3DPDA 1UA7A 3WNMA 2WBJD 1C1EL 1L0QA 3EJRA 3I6KB 4PFEA 4W9CC 4XVJH 3WJMA 3HPLA 2Y5TA 4JFDE 1SNMA 2DM3A 4U1GB 1XCQA 4TQUS 4MNGB 1CICD 2C1PB 1EPFA 3WKPA 3F5WA 4B95C 5INDA 3CZUB 1XF1A 3ME0A 2XDHA 3EJTA 4WJKB 2NVXH 1D9KD 4IDJH 4KVCH 4LKCA 2ZQKA 5T3XH 3D9AH 3QJTB 2XPYA 2TSAA 4BK5C 2RHSB 2MRYA 2JQOA 5CV9A 3MFYA 1PRTD 1YPZB 1USQA 4DPCX 5H35A 3S36X 3QXWA 4ZQKB 4A4IA 4O2EB 1ZT4B 2H1XA 2YPLD 1HCFX 3HG1D 4WWID 1R5IA 5EFIB 3CPLB 1W72L 1QSFD 3ESPA 3LXUX 5LWYL 4DK6C 3MUZ1 3KJOA 2D7PA 1U3YA 2H1PH 3BSZA 4JFOA 4LVHC 1JE5A 2Y7OA 3FKIG 2EQSA 4OGYH 3SB3A 3TVMB 4F7PB 3S8WA 2OTWB 1F4AA 4R5XA 1YBYA 1EEFD 3VR2A 2J2ZA 1TZHB 1RLWA 3GMMA 4YBLB 5DMIL 2QVKA 1LE9A 2VQ1A 2LW3A 3AU0A 4GUCA 1R3LA 2NYZD 1EDHA 1IBLQ 5C0BB 3UZEC 3NUCA 2YSTA 1AQMA 3NBNA 5KSBA 1O9WA 4KK7A 3PMFA 3VCLA 4G8IB 4NSKA 3ULVC 3K0WA 5A3ID 3C60D 1K8GA 1DQDL 5GZNA 4A3IG 1CLOH 3J7ZC 4IU2B 5LGJA 5L2KA 1I5FA 3BC9A 5KVGE 2PP7A 1YEDB 4BSVB 3INUH 1PH9A 1I3UA 3NFNB 4YLBA 2DV6A 4MYWB 1Y0LB 5H8DA 2MCAA 4ELMF 5I1EH 1A4KB 1BQQT 2G5BA 4G7YL 1VFUA 3VWKC 4QTHA 1J0JA 1R3JB 1MSGA 5BRQA 1MRCH 3MRMA 1I3RB 1NOLA 2ATKA 3TYFA 1SRUA 5F6IC 1DUYA 1M4VA 4R3SA 3BAYA 5F9OH 3SDZA 5D1XA 1YO4A 4FLOA 1LGVA 1RH8A 2J1YA 4J1UA 5E5RB 2ZXRA 3IDNA 2X3CA 4ABUA 3MRHA 3IWUA 2BOBA 3CD6A 1JN6B 1NJ9A 1FVEB 2COVD 3H55A 4WTZG 3K71A 5C7XL 5IOPB 3J7YW 1A1NA 3H09A 3K6FA 2Q3XA 2DWDB 2EDQA 4JM0A 1F6FB 4NI3A 4PJHE 4YR6A 3FH8A 4P4RA 4U0RB 3FTGA 3HFZB 5DCCA 3N0AA 5HHQA 4W9ZA 2OXHB 3FBKA 3I8ZA 1PEWA 1SJVA 4DP5X 4PYGA 4AMKH 2O5XH 4J4PD 2K05A 2BHZA 5D7LD 5C09B 1I8KB 1CFTB 1TXKA 1JMXA 2OP4L 3OKLB 2DQGH 1S3OA 4R1JA 1MDTA 1D8LA 1MLBB 5B1CA 2AZAA 3RZDB 1F6LL 4PJXA 5PCYA 1HZLA 2B2YA 1CD1B 1W6LA 2BZCA 4QO1A 1A9BB 2FTAA 3DTXA 5HGAB 1I4HA 1X4XA 3ASOB 1WJJA 2Q20A 1ETZA 3GEFA 1A21A 4XPTL 1GOZA 5IODA 1J1PL 4OZFA 4ZW3A 1MW3A 5EZOL 5C4XB 1U3HA 5EUOB 2IDQA 1KPUA 2Y36H 3PUUA 3D2UD 4RMQA 1AR1C 4K23L 1FA4A 1G87A 1W2KT 1A7RH 4A2FA 2GITB 1GGTA 3OWFA 2DQCL 4HSPA 4KGLA 5DJDA 4MMYB 3OAZH 4N9PA 1PNDA 2ICEB 4XVTL 1E1TA 1EUTA 3KLQA 4OW6A 3ZTCC 3Q6GH 2P80A 4D9QD 1XVSA 2Q76B 2ZWNA 1I7TA 2WY3B 1OZUA 3VFTA 3NPSB 3QIWD 3JWNC 3UJTL 1Q9WA 3DV4B 3PJNA 4GBXD 4UU9A 4WW2F 1V8HA 4G7RB 3QOJA 1PY9A 2MTPA 2WTOA 1T6VN 4AY0A 3VFNB 2P8MA 4ZO9A 2JCCB 1XF5A 4O9HH 1M2VA 3DSNA 3O6FC 5JHLL 1E4WL 4GAYA 5CEZE 2QW7A 4A39A 1FLTX 3MV8D 1EUJA 2F1BA 1OTUC 4Z7UA 3CFUA 2QDVA 4LNRB 3O3BA 5BZWB 1NR2A 1GMIA 1KB5A 4S1QL 2WCPA 3SQOH 2OTJA 2BS8A 3PDDA 2PCFB 1U5KA 3ATAA 1KDIA 3SDXF 5E24E 4K94L 4KHXH 3LXCA 2KKQA 1EZVY 2MPMA 1ES0A 5DHDA 4G9DB 1AY1H 1QFWH 1X3PA 4PY7B 4FNSA 3FUMA 3MCG1 1B4JH 2NX5B 3GSVA 4E41B 2YEZB 4PJCF 1DD2A 4Y4HA 1K85A 1JWSA 5IB2B 1PLFA 4RISH 1B4OA 3PUYA 3S15H 2F0EA 3N2JA 1FIGL 3KPRA 2AJUH 1NC4D 3V8OA 2NR6C 3BUYA 4FTDA 1JRHH 4Y19E 2YSSA 1TMQA 4N0CD 4GRLB 4DP9X 1IQDB 1HEJC 3FAXA 1WAAE 2ZF8A 5AKRA 3MRCB 4YHKH 1AGFA 3APCA 3JUZA 2KS0A 5C08D 2GW5A 1K8AC 2OQ0A 5F89A 1IO4C 2F0MA 1M7XA 3IU3A 4K71B 2ZSVA 4G6FD 5IVXF 3F62A 4C4KT 4PVMA 5IJKC 3L2PA 4BH8A 1FV1B 3AXIA 4HEME 4OF6A 3L1OL 5C6TL 5D6DC 1G7MA 5M3FB 2MHAB 3GS4A 4YWMA 1TJHL 3CNKA 5DUPH 1T21B 2OSXA 2C9AA 3T09A 1SBBB 5L4FA 3A4FA 3K80C 5TK2A 3ARGA 5T5FA 3HZVA 3OX8B 1HYSC 4OGAC 4WWKA 1B0GB 3O45A 1S2EA 2ZKWA 4G4KA 3PGCA 1TT2A 2EVBA 2F0GA 1UT1A 1X6LA 2EE6A 1U3JA 3ZTJG 5JORB 3RDTC 3W9DA 5I1JL 4A3CG 1A6AA 1YMMD 3V79C 3VXTB 1X3FA 1FNSH 4AEHL 1W16A 4X5RA 3TBWB 2HQLA 4G8FB 3WFDH 1SNQA 3SQBA 3MRRB 3BP5B 1IBKQ 3F04A 2GTWB 2WNXA 4LEXH 2E6PA 5AYUH 2IQ9H 4R26H 4BZ2A 2A38A 3S2CA 1EIFA 4DR6Q 4HXBH 4KMTL 4LEOB 4ZPTA 3O8XC 3P02A 3KGTA 2QEJC 4RWYL 1KFAH 2XICA 4ODXB 5GS0D 1JK8A 2B3RA 2VL5B 2CLZB 4JS7A 3Q0AA 1H3VA 2TRHA 2VGLM 1BPLB 4PJ9A 4NPKA 3P9LA 4JMXA 4TLKA 5CIPA 3T0XA 3P2TA 3V0WL 3UZVA 1A3TA 1S40A 1HL5A 4IRZH 1VJSA 4Q7DA 3GTOH 5JW5B 3KJ6L 1UASA 4FZEH 4JG1H 1R3KA 4GKJL 3MMEB 1RZFL 1J9RA 4UTBH 4N5UA 4ZDHA 2JKXA 2GFBB 3B6SB 3FHAA 3PHQA 2VLRB 3QZWG 4LK1C 5E5MB 4BRVA 4XPHL 1SRDA 1FCCA 2YFNA 2A1WH 4TQ8A 3FTXA 1JPGB 2EIZB 1U92A 3FTZA 4HW6A 4I9XA 2NVTH 4Z76A 4V1DB 3F7VA 4HJJL 1AHWB 5AVQB 5IJVA 4KTAA 1W0VA 2KECA 4OELB 2A19A 4EZLA 5TE4H 5T3XE 4Q6IC 1ZLWH 2DLHA 1HXYB 1RK1B 2E7MA 3V6OC 2GKIA 3KYMB 2P47B 3NGBC 3RNQA 1L1OA 3WIIL 3H9HA 3CAFA 3B4NA 2Z1PA 4FF3A 1BG1A 1GZHA 3RWCB 1K73C 1I1AB 4LSRH 4KVNL 5FKAB 4AZUA 4Q8BA 2XZCL 3ZKMC 1TWGH 1Z47A 3O2DL 5C97A 1E6OL 3FH5A 4BE6A 1YMHA 2A68C 3WDNA 1RULL 3HB3B 2P8PB 3TBTA 4ALAH 3MLVL 5KBLA 3EXLA 2CBTA 4RZKA 2MNWA 1J11A 3RIAK 4HHWA 5IZ7A 1OD9A 1S72A 3MLYH 5DRZB 4DZ8B 4EN3B 2A9DA 2P42B 5I76A 2VQUA 5JUEL 1E30A 4N2CA 1RIUH 1KIQA 3CSGA 4NM4L 3CRLC 2WUBH 4PBVC 3ARRA 1YECH 5FYLE 3NQTA 1IIIA 3FU0A 5DVLA 4LVNB 3S5YA 3AFLA 4F7CB 5EKLA 1OT1A 1G0YR 1L6PA 5J1SC 4HEPG 3OZKA 5BV7H 4OZHF 3NK3A 4WV1B 3BISA 1XEUA 1PX3A 4Z7UF 4FHJA 3PV6B 1EGJA 1J8HA 4HUKB 1A0IA 5IHHA 5ELFA 5TDNB 3OJ2C 4QL5A 1CU4H 5T8IA 4G2AA 4UTAA 5CJQH 3N44F 1XF2A 5J13B 4U1IA 1Q0XL 2IX0A 2WAQE 5HHMD 4NHUA 3SGIA 3CSYA 3MNZB 4Y7MA 3D87B 3VE0B 1JNJA 4JKWA 1QHQA 3HPJA 3NSFA 4O2DA 3VH8G 4L5FH 1YA5A 3CFDA 2A7BA 1NMCC 4EIBA 5EU6B 2EDWA 4WU5A 4JN1L 3V4VL 4BDVA 4FQQA 2PKDA 4QOKB 2YUZA 4B9CA 1V7NH 4XXCC 2SNSA 1GYVA 5D7JD 1IL1B 4GFTB 3BVDB 5GSRB 3QI9C 5AVYB 4KKTA 4Z7NE 3ILQD 4P9MH 4PREB 3G5YB 4MJ5A 4JUTA 2ATWA 4X7DC 5DZLA 1N18A 3KPQB 4ANUA 1QZGA 4W1TA 3T6WA 2WTRB 2ZOWA 4QIWB 3AZUA 5GIRA 3S88L 5FHBL 2BP0A 5FXCH 1U8QA 4OFQA 1S5BD 4ZKBB 2DJFC 1G0XA 4YBHA 4K8RD 2PO6D 1DE4A 2Y69B 3QQ4A 4N2BA 4JI2Q 3FONA 3K6SA 3I2CH 2FUQA 1JOQA 2LXKA 1NANI 2I60L 4GW4A 4HGKC 3Q5OA 4I4WB 2EC9U 3F6LA 1FZJA 1SJHD 2FE0A 4H1LH 4IGBD 4IBQA 1WP6A 3WO3B 2AI0L 1ZOXA 3B1UA 3IS1X 4ZLTF 3BGFB 2NY4D 4JFVA 4UDUB 1F3DJ 3UZQB 1ZSDA 4GSDH 3OF6D 4EXKA 2V8MA 4ZTPH 3UTSD 5F7HA 2TMPA 2CRZA 4B27A 2ADFL 1TZ8A 3ZJYC 4ABWA 5E8PB 1SN0A 3BZDA 2IW3A 1BM3L 2PMZB 2AWNA 1WBXA 2DQFA 5K59F 3FP9A 2R8SH 1F02I 1F2QA 2CCVA 2RVLA 3ZT7A 4LLWA 5K36G 4IBZA 2VDOB 3LRKA 3VXRD 5BVPH 5CEXB 5D1QB 1YUHA 2IAMB 3TT1H 4PJAF 3PUVA 1HHKA 4FFYH 1SN8A 3H6JA 5D2NC 3VU2A 5JQ6L 1VFBA 2VMDA 3NABL 3VFPB 1EOVA 3ZOAA 3OB0H 3RPBA 2HLAA 5JLZA 2L9HA 1KXTA 3F8UB 1OXXK 2F68X 2ADGA 2JKJA 5F1SA 3TS2A 1U8NB 4JCLA 4LHQB 1TQCB 4AYFA 3HCVB 1NGZA 1K9TA 1NCNA 1TJIL 1KCUL 2F7IA 2KCTA 4ODUB 1OAXL 3CQZB 3L6FB 1FNUA 2E4FA 1I1FB 1HWWA 4MJIE 4WFHE 5HHOA 4Q9QL 3BDYL 4PG2C 4XNZC 3DHQA 2XYCA 4JVUA 4Z7WB 1FG2B 3CCJA 3DLLA 4WO4A 4UOQA 2VLKA 2FEDD 1HXMA 4ICWA 4QY8B 1QILA 3AQQA 2JEAI 3QUMH 1IE4A 4A7GF 1S8DB 3O3UN 3PDGA 4BCXA 4ADJA 2IHFA 1XIWB 1B8AA 3ARQA 3E9UA 5K1JA 1EEID 4XN7A 3TNMA 2O61A 1E3XA 1P4LB 1FCGA 1A2UA 4HWBA 4BWTA 5ECJE 3HE7D 1DCLA 2GJ6D 3ETSA 4L0PB 5I24A 3TF4A 3ULVD 5FUZL 3L3OA 3ZTDC 3U6RA 1TU2B 4P57B 1MCIA 1G6RL 4P46A 4AMWA 5B21A 4V11A 3REWB 4MB5A 3TWYA 3OGCB 1X9QA 2ADJB 3H3VI 3C5JA 2F4VL 2DQEL 5HYJB 3OHXB 4NKMA 4JQXA 3EH2A 5FYKL 1EY5A 2FMCA 1IZJA 4XCFH 2JF1A 3W0WE 1UA6L 5J1AA 1WBYA 5LNEA 1JHTA 2QADC 5LCVH 2E7HA 4DF7A 4YSUA 2G9HA 3L5IA 2WTPA 2VABB 3CUPA 2FL5A 2O4EA 3CH1B 4OD3L 2F4IA 2C7UB 1N8RC 3HUJA 1R47A 3DARA 3ZTNH 3RURA 3NUKA 1ZKAA 2IAND 2OJ1A 1SFDA 1PTOF 5EKIA 3DBXB 4DNTB 3QDJD 3WAJA 3SDDB 1LEIB 3MJGX 3BP7A 1TKWA 4APQB 2PABA 2XXGA 4L8SB 4A3LH 1QKZL 1NGWB 1JL8A 2AFNA 3MFGB 3FCUB 1ZDQA 4CBVA 2B63B 2UXCL 4ONHA 1SOSA 2MGSA 5F7EL 3UACA 3H9SD 1SDDA 1A8JH 1HI6A 2CR3A 4JI2L 3VW3H 2QPFA 4PJDA 5E2VH 4CN1A 4AQ1C 3EJPA 1HDMB 4OVUA 4ZMQA 4KRPC 1JYXA 3PFUA 4RGNA 3LZFH 4RWSC 3CDGB 4OB5L 4P9HH 1DBMH 4FNLH 4KDWA 1IM3A 2QILA 3CZJA 1UKTA 1DYQA 4BD4A 4HJTA 3T6VA 2I9LB 1AQHA 3F12B 4CJ0A 5JOPE 1JHLL 3ZHKA 2F1MA 2XFXA 5B8CC 1KJVB 4HG4J 2YJLA 2KL6A 3ZSTA 1CFQB 3V4PB 1A2TA 2NBFA 3P1VA 5F1NB 2WQUA 1WZLA 1TLMA 2YUVA 2X4RA 4YPGA 4JK0D 4NPYA 1AR1D 4AOFA 5HGTA 2VN3A 1CQKA 4XC3H 5T1MA 4R2GD 3U79A 2H1LM 3U0PA 1PMRA 1XB8A 2FZ3B 3FCSA 4HBCL 3ESOA 5KVFH 5C3LD 3QWQB 2M1KA 5G3LF 2A73A 3GJFH 2ZAHA 4JY6A 2FHCA 1UB6B 1WG3A 2DLFL 1OTTD 1A2YB 4P8QA 2A9NH 4X5WB 3FBQA 5A2KH 1AQKH 4NKLA 5ALCH 1E67A 4OO1H 3FQXB 4FQXB 1F58H 1O7DC 3CK0L 1LO3L 4NFDA 2GK0A 4JFHE 3SY0B 3UMNA 1N5YH 2HJFB 2BZ7A 1K4DB 1TWCH 3L4WA 3U9SA 2OK0H 4HKBB 2NNAB 2J8UA 3CFKB 3Q8CA 1ICWA 4KK6D 1G9HA 4J3VA 2KOLA 3J7AF 1A7OH 3O6ML 4LSTL 5E1AB 2OF1A 3SZKC 6TAAA 2WLHA 4LUZA 3T9WA 3GTPH 4ZTOH 2CO4A 1TMCB 2IOOA 4M5ZL 4RQQB 1ZT7B 1RF2D 4H25B 4EDXA 5LNDA 1EFWA 2VIRA 4I9WD 1VQEA 1SY6H 2ARJQ 2GSMB 3IBOA 3LS5L 3KLAB 1GYUA 3NBHB 3NQKA 3TO4D 5KVGL 2W94A 3GBDA 2OMWB 4I3RH 4JDEA 4JO1H 2PI2E 1I8MB 1IZKA 4JY5L 4HAEA 4FF4A 1KBWA 1RHFA 3ETBJ 3RWIB 3GSQA 5BZZA 4OV5B 3TESA 3S4SA 5GADC 4L5FE 3ULUF 4HUNB 3HS0B 3FYEB 3LMJH 3WWVA 1H6EA 1OGAA 4NLAA 1F77A 3EYQC 4IU3B 4PGJA 4XWGL 4EI5C 4N5EC 4Y1AB 2QCPX 2H6PA 1XT5A 3PO3G 2WWMD 3U46B 3FC8A 3Q6SA 4I2XE 2J6EL 5DA4A 2QSTA 4U6HB 2ICWB 2RIKA 3D4DA 5C8JB 4XXEA 3GBLA 1P6AB 1HH6A 2E6JA 3B8SA 4W81A 5KYYB 1UATA 1MFCL 5HHPA 4BY1G 5DJ2A 4F15C 2EDDA 3T4YA 3FSWA 4EKXA 1YYML 3VWJD 4TNVK 4IALA 2EICA 1J12A 5F9WB 5IFJB 3O4LA 3MRKB 4JFZH 2BSEA 3SK6A 1JZ8A 1MPAL 4NS0A 4Q0XL 5F3BB 1NAMB 2ILLA 2WVVA 1AGDA 3VGGA 5DWUH 4YXHH 1OP3H 2NNRA 2Z93A 4WHTA 2DQTL 5E9NA 4L1SA 3BVZA 1O7LA 2F3VA 3CVIL 1TNNA 4LU5H 2GCYB 3QQXA 5FW6A 5E6IC 1HFUA 1O9VA 4KXDA 4OLYL 1EJ8A 1HQ4B 3IEAA 2CG9X 3MGOA 3OSKA 4H8PA 5EO0B 4KOBA 3LKRB 1F2MA 5F7MC 5HHNB 5I74C 2FJGA 1N59A 2JXMB 4M7LL 1EAOA 4ANVA 1S5CD 3OMAB 3JWOC 1DQQA 4QMGA 1DTUA 4P75A 4IKIA 3RB7A 5IBUG 1BX2A 3JWOL 3PWUA 1UM6L 3IXTB 4PRHD 1LO5D 1I4FB 4N8CH 1BAFH 1CWVA 3OR6B 3ATDA 4QRPE 4MCZB 2NXZB 1PIGA 4PW9A 3QUYB 4O4YH 1HEZB 1VADB 2VWEE 3QIBB 2DNCA 3NACL 2PQEA 2X2JA 4ZRZA 1SDAB 1CO1A 1J7VR 3A47A 1Q1BA 4L3EB 3JC66 1TS2A 4PJ7B 5EBDA 5D5MF 5D4JA 1GS6X 2CIIB 4YWGL 1UVQA 4HX1A 4HOZA 3EJJX 1MW0A 2VDQL 4NKOB 5ALBH 3DIFB 1BLNA 3STBA 4KZDH 3KF8B 2PPDA 3E6FB 1MJJA 3SDCC 3L3DB 1FORH 4N3TA 3BXNA 2CJUH 3GMRA 4I13B 4I3SL 4X6EB 2HJLA 2AHIA 4RGTA 4JZOA 3G04B 3H0GH 1R9TB 4IS6A 1QPPA 4HLJA 2NY1D 1VACB 4GW5A 3MXPA 1HS6A 5E1HB 4JL2A 1T1WB 1ICFB 2KZBA 4WI6A 1BWWA 3LPPA 3PF4A 1DQIA 4RAUA 1QVOA 2R4RL 2EY5A 3QXAB 2YN3A 5I1LA 5IY5B 3UDWC 2O4XA 5D8JL 2IXQA 1EXHA 3BYTA 3GDBA 4TPRL 2GB2A 4OCXH 4N2OA 3WOEA 1HC1A 4BBSG 2MFNA 3QT2A 3FMCA 2YARA 2IGFL 1MEXL 1FNHA 2JJSA 4GKSA 2DF3A 4OIIL 2DEXX 2QDBA 5I2YA 3ILEA 5C07A 5T1KD 3DWPA 2H32H 1FLRH 3H7BB 2ZCZA 4AH2B 4LGRB 5JIIA 4IBVA 4P2CB 1E4KC 3LJ3A 1CIDA 3VB8A 2GUOB 4UT6A 5IW3A 2D9UA 1KCSH 3H3KA 1EHLH 1HZHL 3EOTL 4AYMC 2EJ1A 5KYNA 1MCLA 4OZGF 5JIMA 1UZ8B 5IQOA 4DTGL 4B60A 3ZYJA 2GTZA 4ORGA 1ZEAH 2F5AL 3GRWH 2VH5L 3B5GA 3BKCL 4JPVL 3L5JA 4MJ6A 1UQSA 4WVRA 4J8QA 3EOBB 2HB0A 2EEXA 3W5NA 3CN0A 2EIKB 3MUGA 4AQAA 5FKPB 3LNFA 4ES8A 3UP6A 1KGIA 4K7PL 3QI9D 1WTOA 3L3KA 5ELIA 2ORBL 3KBFA 2HPTA 1B3JA 3ZE1B 1PZID 4IPCA 3ZDYB 1RXLA 1A7PL 2BA1A 2KDYA 3GXIA 3IPFA 4M61B 5BOZG 1AI1L 1DJIA 2V3FA 3WJMB 3HI5L 3HPLB 3VR4A 4M3HA 3TJEH 3L9RB 4DPRA 4IOSA 3RGHA 4CC1A 1XCQB 3FUIA 1GW0A 2YEVB 3A4AA 3I6LE 3F5WB 5DAUA 5INDB 2BSBA 1Q12A 4KTEH 3ME0B 4RNRA 4KY1H 1D7BA 1OE1A 3MV9A 5IGXL 3P4OA 2BS71 4LKCB 4M8AA 2DIAA 4X3UA 4RDQF 3OBAA 1N4XL 3QZMA 4S1RL 2PCPA 5TF1H 3CCLA 5H35B 1GMEA 2E56A 4P5TC 2WB1E 4HS8H 3RVVD 2FDBP 1GSMA 1R5IB 3CQQA 3WSQH 3SPJA 2WKLA 4P72A 5LMUQ 4LRNH 3K8LA 3FQNA 4JFOB 3QRLA 3WY3A 3MR9A 5KVFE 4KK9D 3MA7A 1J10A 5IMKA 1DBAL 3D25A 3GSRA 1MVFA 4MASA 1LO0H 5IGDA 1ZLUH 5M5WB 1IYUA 3FCBA 3GMMB 3I9GH 5MENE 2VQ1B 3F84A 3NEEA 3FO0H 1RPKA 1R3LB 2HTLC 3WXWH 4CU6A 1PL3A 5ELBA 4RH6A 2F54E 2WXIA 5T33H 1OSPH 5KSBB 3I84A 4L29A 3Q8FA 3UAJD 3K5SA 43CAA 4JO8A 4C56A 3VCLB 4NSKB 2DQHL 1IC4H 1VPOL 3VGDA 2Q8IB 3M8OH 3M88A 5L2KB 2R0WL 1GUNA 4QNPF 5EJWA 1ID5I 3QJRB 5FCSH 1E40A 3KDFA 5D7IE 3SODB 3O41A 1K4CA 3NSDA 2X6VA 3K7AB 5F96L 5FLVA 4MNQA 2G5BB 4OQTA 5FYLL 5INCA 3D39D 3GBMH 2XSKA 1BG9A 2CR0A 2DBLH 4QTHB 4X6CA 3LH8A 4HD5A 3AREA 3MRMB 5D1ZA 5IF0B 1TFPA 1HVXA 2ATKB 4B3SL 2DS4A 2L11A 3TYFB 5D70L 1DUYB 3ELAT 1UYWL 4R3SB 3ZDWA 5ESAA 7FABL 4FQ2H 1CL7I 4IOCA 4LGPB 4U49A 3CN4A 4LESA 5LGKA 3IDNB 3MRHB 3BWUC 1BIIA 2BOBB 4ME5A 3D8GA 1FC2D 2O72A 1QZNA 2ZJSL 1J18A 4B53A 1F8TL 5FS5A 1WFTA 3K71B 1T80A 5E51A 1IYVA 5FFLA 4R4FL 2F0LA 2H1EA 2PO4A 2GJZB 2RA4A 4YR6B 1GW6A 2EEAA 4P4RB 4GT0A 7PCYA 2P28B 3DSFH 4MD5A 2O93L 2WBJA 1JF1B 4ZYSA 5IMOA 3SPVA 3HFFA 1THAA 2WXHA 2F7RA 4HSCX 1EVTC 1WTPA 4NAQA 5JZ7C 4QHKI 3S2DB 5BW7C 4U1KA 1U0LA 1PJWA 2J5LB 1QG3A 3S48A 2QHRL 2YPVH 4PJXB 1D9KA 1A6WH 1CHQD 4QTIL 2YXFA 4QO1B 1C08A 1O6VA 3DTXB 2WLZA 4PRPE 1WHOA 2VSCA 1ETZB 3DETD 4JZNA 1BKBA 1FD7D 2KHAA 4OZFB 4LF8L 1GSKA 2FGWL 3DX1A 1U3HB 4C4BA 5AQ0A 2YPLA 3HG1A 2N78A 5DJCA 1QSFA 1XTLA 1T04A 2WV3A 1N10A 2IMNA 2H6OA 3AITA 2BDOA 3ALWA 4JFPA 5IQ9B 4I85A 2NY0D 5AW4B 1GGIL 3IDJA 1DJZA 3KNBB 2JP1A 5LJYH 3US1A 1EIYB 1U4LA 4C3IB 1KMGA 2HIXA 1NNXA 1I7TB 1HOCA 4LPVA 4M8UA 3U4EA 3K6IA 3VFTB 1Q9WB 4MMZA 4UU9B 4XI5D 3J80c 2NYZA 3JTTB 4U0QB 3ZKXC 1EZ8A 3WXVL 3TP8A 4JBWA 2LVCA 2P8MB 5DK2B 1BZEA 4U4IA 5SX5H 1KYOJ 1CHPD 2AEQL 1XF5B 3KLKA 4FJZA 5DYOA 3RHWK 4EIGB 1FFQA 3CVHA 3DSNB 1SR3A 4WEBH 2EQDA 1TR5A 4LCVA 2RJMA 3C60A 5FV1L 3OKMA 4KAQH 5DMGD 1WUNT 2Y06L 3DURA 4LSPH 3N9GL 3FW6A 3O3BB 4U6XA 3MZGB 4Z3TA 1S78C 1KB5B 2B5IB 3AWEA 3QDME 2YQGA 1D6EA 4JI7Q 2H0JA 3FL7A 4OY9A 4IMKC 2R4SH 3IXAA 4OLUL 3GKZA 4PJBF 3BMWA 1LQBC 3LB6C 1XPUA 1YLBB 3RBGA 5EC2A 1MIML 2DYSB 5E6RB 3GSVB 1WFMA 4F20A 4AVIA 4NCC2 4Y4HB 5HTSA 4QJ5B 5I5IA 1JWSB 1GUOA 4GAJL 2UXDQ 2QGQA 1UJ3A 2NY3B 1HNWQ 2LS01 5GS1C 1DBKH 3MJ7A 3KPRB 4A63A 2JKNA 3I70A 4MHHG 4HCEA 2ZT9C 1UCBH 4YHOH 3BUYB 1N64H 1F9SA 3QJZA 4FXGB 4P59H 2YSSB 3WFBH 2J21A 4AKQA 4Y9CA 1DZ0A 3ZK0A 1EXUA 4DAYB 2VUMG 2EIFA 5KUMA 3QPKA 3ESMA 4IPHA 3NIDF 5I71C 1BOGA 1H6UA 2HRHA 5F89B 3B3IA 3VI4E 3IU3B 4JG0L 1VEPA 1P4IH 1Q8MA 2ZSVB 4FKHA 1NOFA 2FJSA 1RZPA 3DUSA 3WDIA 4ZMLA 2XU9A 4J4PA 3K1DA 3A3YB 5D7LA 3VSVA 3RUGA 4NP4L 3T0AA 1G7MB 3UBGA 2WUCL 4PJ5B 2FHTA 2DM4A 1SSOA 1JBJA 1KTDA 1O7VA 3GC3A 3RVXD 4QWWC 1FFRA 1TQBC 3WFCL 3ARGB 3UL4A 1K8IA 1EFQA 3F64A 4J3OD 3O45B 2F0HA 1NAKL 3EBIA 2WPGA 4KHZA 4M56A 3ZMNA 4L9LA 2H4EA 4DK1A 2FWSA 3W9DB 1A6AB 3B37A 5IHLB 2PW1A 4ZOBA 3D2UA 2KZKA 5KRUA 2BNRD 3CXHJ 4Z95H 3VXNA 2FJFA 4TUKH 1KWGA 5LXVA 2WVSA 4W9KC 4G5ZL 1AKJD 2NVYB 4OCLC 1J9QA 5IGGA 4LCIL 5ITFA 3DXAE 4UM8A 5KNDA 1ZHLB 4B9KC 1MCWW 2W92A 3VG0H 3QIWA 1FWXA 4NN5B 3U7YL 1B4RA 4GBXA 5B3JF 1TOXA 4IYKA 1NLBH 2OXPA 3MTXA 1F4YH 4TSCL 1JK8B 4ZO6A 3WI9A 5LNGA 5KBDA 4PJ9B 5CIPB 3IFNL 2C9UA 4PWJA 3UXFA 4X62Q 3KF6A 3BAJA 3UZVB 2W65B 2ITFA 2J4WL 2BVQA 4M1GH 1YEFH 1GD7A 1MZZA 4ENEC 3BVXA 1R3KB 3LKOA 3K6DA 1M57B 2VZ1A 1DP0A 3LPOA 1A1OA 4Q97A 4ZDHB 1G6ZA 1B2WL 4R4OA 3CCMA 3RB5A 1IEAA 1V8QA 1Q9LB 4PU2A 2I5YL 2Q8RE 2IOIA 4GLRI 2AS5M 5IM7A 1TWFB 4A3GB 1E50A 4U1GC 3W56A 2PLTA 4Z76B 1U92B 1AN8A 1UG9A 2YUXA 5IJVB 3F7VB 3RYMA 3CXDL 4Q6YA 4UIMB 3P7JA 3C75A 2WBWB 3QYCA 4DV7Q 4GQZA 3NSXA 1I4QA 3HBQA 4DPGA 2F1AA 1CDGA 3FH7A 1VQNA 2JJQA 3HC3H 3RNQB 1L1OB 4PJ6A 5TDPA 3H9HB 3GIVA 3FQUA 1MCOH 1Q4NX 3C2AH 3SO3B 3UIYA 5AVZB 4R97B 1NC4A 1SYSA 3WNIA 4Q56A 1TEYA 2VW9A 3DDFA 5TSSA 4KH9A 2VW4A 4LDOB 1YMHB 3RILA 4A2LA 5A2LH 1OARH 3TBTB 5KW9L 1PZ5B 5C08A 4YBLC 4I5BA 2XQ0A 4CVUA 1A6TA 4KXZI 3I4NG 1XPRA 5I76B 2EXWD 3ELQA 1UEYA 4XWOC 1CK0H 1KIQB 2EACA 3X11A 5INCB 1K9MC 4ZODA 3K81C 2WXJA 3S37H 2DOCA 5H4ZA 4JPBW 5HVFB 2ID0A 1X9UA 3EFXD 1YNLH 4JHUA 1J8HB 1A3RL 1IL2A 5I18L 5C4JH 5HXMA 1YNKH 4X4ZA 1I6HB 5JMRA 3HRZB 5EU7E 5BUGA 2VYRE 4TVPD 2B1OA 1SAPA 4XMKH 5BS0D 1XF2B 1YMMA 4U1IB 4DN3L 4Z3EA 5CUSH 4NHUB 2D7OA 1FDLH 4JHVA 5KSAD 2R69A 3CSYB 3VGFA 1MHWC 2B2VC 2WQ8A 3MBWA 3PCOB 2DY2A 1MCHA 3HPJB 4MJJA 5IUCA 3GD7A 1E4XL 1X5XA 2XV6B 1FF5A 1IBYA 4JO3H 5ICXA 4ZMOA 2D3NA 1Z3GH 4HMCA 3LKSA 4WU5B 2HWZL 2OMBA 3D6WA 4IK6A 4PLJC 4BDVB 4FQQB 1WDAA 5TQ0L 1GVPA 3GTKH 4KV5F 3TQYA 4ZO8A 1E2ZA 1RUML 4HLZH 4NPJA 1SMAA 4QDGA 1BQLL 1XMOL 1EAPA 4JOIA 5FK9C 5ICUA 3ESVF 4XXDA 4AUYA 1OAYL 2BIOA 4MJ5B 1HE8A 3EN2A 2VUOA 3AG1B 3BFWA 2YTXA 4N2GA 4AQYQ 4YAQA 4A3BB 1CXHA 4HMIA 1NFKA 5KS9A 3V2AR 5GIRB 4U0RC 4MQXD 3DV6A 5C0XH 1QLEH 1U8QB 2VDLH 4PM1A 5BRZE 3VQMA 1KGCD 4IFDI 5EEXA 1AGCA 4NUPA 1B44D 3G6DL 1DE4B 1PAZA 3QQ4B 3V0IA 2NOYA 3FONB 1XWEA 4GW4B 1DFBL 5E8NA 3Q9PA 1FZJB 1EO8L 4NFBA 2ZUTA 4KXAA 2VLMD 3JYBA 5CZRA 3CZSA 4G6AC 3RU8L 3DJRA 3DJTA 4CN4A 4DV0L 1ZSDB 2CGRL 2E2HB 1OCCB 3CN1A 1EU4A 4MHHI 2NTFA 4OI8A 3BZDB 1IAKB 4LNVA 3ZSSA 1A8ZA 1WBXB 2DQFB 3QJFB 1OAUL 3ZIYA 3D3RA 2EDGA 2QQNL 4BK4A 1VKXB 1UWXH 3S8FB 4ZMTA 1I9RH 1A9VA 1BBXC 1BCPD 2ICEC 4XTCS 4U31A 4X9BA 2OZ4A 4JI5Q 4LLWB 1YY8A 2AKWB 1TYEB 1JD9A 4JPKL 4JRXD 3NPSC 3FT3A 2YU9H 3O9WB 1ZGLA 1YUHB 3EYUL 2AJVL 3TCLB 1BO0A 1BEXA 2YXVA 4E9SA 1LO4L 1HHKB 2QQLL 4H0GA 3I73A 3QWRD 4A75A 4XR8C 3ZKQD 4ELME 3IDUA 3TYGH 1VFBB 1TS5A 4UT9H 2A8VA 5CP7A 3UTPE 2WJ7A 1M7DA 2HLAB 2EILB 5D4IA 5JLZB 1KXTB 4NWTL 4PJIA 2Z9HA 1KYDA 2ADGB 3FSOA 1JGDA 1S9VA 2ALWA 5SWZB 3OKNA 4NO5A 4AYFB 1K0RA 2EIDA 1NGZB 3QQ3A 1IQWH 1PLGH 4JM2C 5DMYA 5FECA 5DQDL 1AVAA 2EYPA 5HHOB 3G6JA 5ACZA 5D93B 3VG9B 1FYTD 4WO4B 3GM0A 3AUVA 2VLKB 1U8JA 1HXMB 5CILH 5KSUA 3VMNA 1X5MA 1P5UA 1X5LA 1DSWA 4G6KL 4UANA 3PWPE 3LSOA 4G59C 5GGRB 4H8HA 2W81C 5HDBF 5LBGA 4BV1A 1CZ8L 5I5JA 4XMXA 3RR5A 3AROA 5DYFA 3TNMB 2O61B 4OM1L 1E24A 5D7JA 5EOCJ 4QAWA 3KBHE 4GRLC 3A8JE 4PR5A 2D0PA 1XTCD 1FO0A 3JWNG 3EYVA 2AEPL 4NUJB 4JBMA 4FNUA 1E9PA 3L3OB 1DVFB 2CUIA 1CPUA 3U6RB 4OFKA 4P46B 4KUZL 4Y1TA 4JC0A 4DT2A 3LNEA 2CHNA 4K71C 3C5JB 3OAZK 1UAPA 1ASYA 1IGYB 1JTOA 2BSSA 4OJEH 1LK3L 3ABMB 3ER0A 1DBJH 2WQWA 4NKMB 5GRVL 3S96A 5GGRY 1YEGH 2PO6A 2J57A 2VXQH 5J1ZA 2ZTCA 3FKIH 3GSXA 1C4QA 1WEJH 4M6AA 5FF6A 5J1AB 1JHTB 4IGBA 1SJHA 4AJVA 4CC0A 1OCWH 1S7UA 2G9HB 2HKAA 3CUPB 5GHWH 2FL5B 3KLLA 3T2LA 5HGHA 2CU9A 4GAGH 2DMGA 4P2QE 4DAGH 3HUJB 1BA9A 3LNNA 3OF6A 3LNHA 3WKMH 3UTSA 4C2MH 3N91A 2MO0A 1TWGB 1UACH 1PDKA 3CLFL 2FQDA 3LKQA 4K3EL 3Q5YA 2CHWA 2FH8A 3KWUA 3J81c 1F4WL 5JVG3 1TKWB 4HYTB 4WI5A 4BCYA 1MRDL 2NXYD 2VKXA 2EDHA 1H9RA 4F9PA 1X5AA 5MERA 3HOXB 2B08A 2EDKA 4ONHB 3ZR6A 4P2OD 4YMPA 5F97E 5HI3C 4P4KD 2YGQA 1BZDA 4PG3A 5BN3A 4JKPL 1SDDB 4ODBD 3Q2VA 1HI6B 2X1XR 2VZAA 3VFUA 4F8OA 1B6DA 3X13B 3TP7A 1X4ZA 3L9BA 1FRGH 1JK9A 4X80H 4AKPA 4LLQA 3RPIA 3SDXE 4YHZH 2XTIA 2VLJD 2ZTBA 3SQRA 4YCVA 3KR3L 3IGKA 4B6ZA 3BDLA 4AITA 5BV7B 5JDSB 3E6ZX 1GIGH 4DK3C 2IPTL 3N43F 4LSSL 5EF0A 1D2PA 1IM3B 3OMGA 4N1EA 4CDEC 3RLOA 2X4PA 4E0RA 3S24A 1VGEH 1T22A 1FNWA 4PJCE 4R8WH 3H0TA 2XFXB 1MF2L 4S0HA 2MKWA 4BK5A 2A9CA 2BJMH 1RQ5A 3HC2A 2XQBH 3S37X 1IGFL 5ID1A 2WSDA 3MV7B 3KLHC 1PZUB 1L4IA 1W72A 1AHWC 3KWXA 3R0NA 2JB5H 4YPGB 4NPYB 4IW4C 4X66L 2IBZX 5T1MB 1NDMA 3TLRA 3U0PB 4DK6A 3FCSB 4MA8L 2BDNL 3B2VL 2R39A 3KDMA 3ZHNA 2ZAGA 3V4UL 2OJEA 2C8NA 1RZ8A 4NZRL 4BFEA 1EHKB 2A73B 4JY6B 4B3MQ 1IC7L 2EDEA 1YAIA 4HCRL 4A3DG 5IVXE 3WMPA 2ZUXA 3D3VE 3S3SA 1I1AC 5FKAC 1U4PA 1ZYRD 5ISRA 1W8NA 1YDPA 4ZFFA 5KSBE 2YR3A 4RFOH 2RMNA 4JJ5B 3ONAB 4NKDA 3MLUH 4JRWA 5HHVL 3HOUH 2WHVA 2DD8H 3U0WL 2GJ6A 3HB3C 1WPCA 4OM0H 4QHKJ 4YX2L 1BQKA 2E2IH 3PUXA 1XL4A 2ZNWA 3CZEA 2ATPA 2YAPA 5A2IH 3NRFA 4EN3C 4OV6F 3TONA 2J8UB 1E8XA 1EIHA 4TNEA 5IOKA 1PTOH 1IKMA 3EOYG 4LVNC 1KAAA 4F58H 1F4XH 4WV1C 5DHVH 1MQ8A 2HTKD 4AEFA 1GRWA 3LB6D 2A6EC 2W9EL 4RGMA 1IAOA 4H8QA 5T1GA 2VIRB 1Z2KA 2VM4A 3J07A 1A6VL 2UX7A 2F0NA 1RL1A 5D1XE 2IANA 2BIQA 1N0XL 1IJNA 4ONFL 4XMUA 1HH9A 3QDJA 5J13C 5LHY1 4I89A 3CHPA 1DLHA 4YDKH 3WOVA 4E9XA 1NSNL 2UU9Q 3GSQB 4X6DF 1AMYA 3L45A 1SBSH 2V7NA 3OMIB 1F1AA 4FXKA 4OCMC 4XO9A 3S4SB 2YWZA 2BRRL 1ADQL 1NCBH 1F9PA 4NQCE 4QIRA 12E8H 1OGAB 2ZCKL 3H9SA 5GGSA 2M2DA 4EAEA 2O1AA 1KGUA 1CCZA 2H6PB 4CSSA 2BW5A 1ZLWK 1AZQA 5C0GA 3KPLA 3FO2A 3MLWL 3L5WA 4NUMA 1TSHA 1HOEA 5A7BA 4EI0A 5C0FA 1SDYA 3BEWB 5HGGS 2XXMB 4AYID 3LHAA 2HT4C 1HH6B 2C9VA 3R0MA 4LLYB 2MQ3A 1UENA 5DJ2B 3MA2B 4ZUIA 2XV2A 4HG4K 2E74C 3T4YB 4DJMA 5EZLA 2XRAH 5DFVC 2CIKA 2WAHA 1MCEA 3O4LB 2R7EB 3MJWA 1JPTH 2AK4B 4DR4L 3AMLA 2O5JC 1GVIA 3TOPA 3LYRA 2WVVB 2ZE0A 2R0LL 1AGDB 2NVQB 4DP7X 4P2AA 1NCJA 1A14L 1F13A 1X3DA 3X14A 4Z6AT 5KANI 1CKMA 2BM3A 4WHTB 1XGRB 3T0EE 3A6BL 3BGFC 3EJYC 5HSFA 4X8JA 3W5OA 4UDUC 1H8SA 1NEUA 2RACA 2XKUA 3EFOB 1EZLA 3CQPA 2APXA 4PP1C 4W9DC 4WSKA 4F57L 5I1HH 4PAZA 2I46A 5HPOA 3UIZA 4K0KQ 3SK5A 3MGOB 3G9AB 2X12A 4JGJA 3B5TA 4YY3L 1N59B 4DQOL 4W9FC 4APXA 3EUDA 3NA9H 4B5ZA 3EGSA 4WZ9A 3C5XA 1DQQB 3VXQA 4N90D 5KVDL 4Z7UE 5KNBA 1BX2B 3IDXH 3UOAB 3ZTJH 1MFBH 3PWUB 2VDOL 4A3CH 2HH0L 3MRBA 3ZDXB 1I3QB 4UP9A 1MI5B 4QF4A 2IAMC 4XOEA 5D1QC 4YQXH 3VI3F 2KUMA 5HI4C 1TG8A 4JFEE 3VQLA 5JXAL 4LLMA 3PO2G 4XBPA 1QTYT 3H42H 3RI5K 1J48A 2FIRT 3CFIC 4G6JH 3NP4A 1AFPA 4MBOA 5GGTA 5LXGL 3FUEA 4YZFF 4DUYQ 1UA3A 1UVQB 4HX1B 2Z91A 3SPHA 2MJWA 4C54A 3ULUH 1BLNB 4W9JC 1MJJB 1TQCC 1A63A 4F5CE 3CIAA 1G9NC 3TO4A 4DN4L 3BXNB 1G9NL 1INQA 3MAQA 3GMRB 5JW4N 4YFDB 2HJLB 1HNFA 4JZOB 4TUUA 4MZ3A 5I6XB 1N19A 1HE7A 4IS6B 1PCSA 4NQEB 3SGEI 4WI4A 4XDXA 3CLWA 1Q1PA 4MZRA 3GZOA 1NR4A 5KEZA 2VR4A 3GHBH 4G7SB 5B22A 1I94L 1MI2A 2N49A 3OVUB 1P9MC 4RAUB 1QVOB 2YGPA 2NW3A 5DM63 1XIWC 4OF3A 2OYMA 5DO2D 5I1AA 5I1LB 1E6JH 1RZIA 3BDOA 5D6CA 4K15A 1A3LH 3DRTB 1R75A 2IDCA 1RTOA 1WAEA 2IXQB 4G7VL 1EBAA 5CHNA 3BYTB 5J9PA 4TTGA 2COQA 3BZ4A 2YRBA 1MWAH 3OZ9H 3V55A 1FBIH 5AWNL 3Q5TA 4X65L 4GKSB 4UT7H 4X83A 5F7NC 3RNKA 3TBSA 2ZJRA 1ACYL 4OH2A 2IIJA 3VWJA 1NJIC 3TZVD 5C07B 3OHXC 2UU9L 5E9DD 3FHWA 4X4KA 1LT3D 1SLXA 4HV8A 5A40E 1WFUA 1PSKH 4ZQTA 3I91A 1G9MH 1T83A 4BS9A 5FGCB 1WA0X 3GKWH 3SZ6A 3UROR 4J7RA 1GS8A 2BINA 2GTZB 2QVTA 4OLXH 4ORGB 4P3CH 3ZXAC 3GJFB 3VYUA 4MJ6B 1UQSB 3O2VL 3WFEL 4LK4A 3CFCH 3OB0K 2HRPH 3VFRA 4M48L 2O30A 3MLXL 5GJTL 2K1MA 4PJAE 2QEJA 2PZWA 3SDDC 4AEIH 4YSAA 4R4ND 3AYHB 1RCYA 3MUGB 5FUCC 3VFVA 4L8SC 4APQC 4AQAB 1KBPA 3G5VA 5FYJD 3L3KB 4UILL 4F9LA 3NWSA 2WXFA 1PV4A 4O0AA 1UD3A 4PRHA 1J5DA 1LO5A 3E9HA 1EQQA 4LRIC 3L7EA 4R7LA 3KL5A 4H8WL 1ECZA 3UTTB 4A3JH 5AB0A 4XQQA 2UWEF 5IYDG 1T7ZA 4NUGL 1IKFL 2P5WB 4QCLA 5C3TA 4PSRA 4DV4Q 3I3BA 5HYSG 2DJMA 1WO2A 4JG5A 2AERT 3A0JA 4CN6A 4RKBA 5M5YH 2G60L 3HI1A 1YQVH 5FGRA 4RNRB 5CJXA 2F7QA 3MV9B 3PU7A 4Q6IA 5MEOA 1BW8A 3P4OB 4NAJA 4RETB 3V6OA 1JICA 1FHGA 1OGPA 2O5YL 3NTCH 4JANB 4Y9GA 1UHVA 2PCPB 1IT9H 1KZQA 3EYSH 5DZVA 1Y6KR 4OLWL 4R7VA 3HNVH 3V4PL 2VDRB 1FAIH 3NJGA 3BVNB 1MOEA 2XJLA 2JQZA 2WP3T 5CSBA 5B1BB 3QO0A 4IJHA 2CPCA 5IT9c 1FZMA 2G2NA 4YDLC 5TPWH 4OZIF 3FQNB 4HH9A 3MR9B 3S1RB 3MA7B 4BZ1A 3D25B 2XXFA 3GSRB 3VVVA 5KYXA 2EVHA 1GGCL 1NGPL 1UT2A 4JI0L 1X44A 4S0SD 5A2BA 1QTSA 5F7LB 3FCTA 1O7ZA 4LCCA 1FGNH 2G9KA 2ZP9A 4TYUA 2A6HC 5I4DA 2Y7QA 1IC0A 4WWNA 3HTLX 1RLBA 4KHTH 4IFDJ 1H8LA 1OSZB 3AS0A 4GP8B 2K50A 43CAB 4C56B 4LEEA 1PFMA 4FQXC 3CX5K 3TZDA 1LT4D 1NBYA 1PLAA 3OLGA 2I9TB 2BWDA 5CP3H 1I9IL 3HN8A 2G4EA 4AJYV 5T1KA 3BIKA 4Z5RA 4JDZA 4JR9H 4L3AA 4JM2D 2HX7A 2PP8A 1RV6X 5I28A 5K36H 3LRGA 3NAAH 3WN5B 2W0LA 4MNQB 4YDZA 1IAIL 4MLSA 2CBOA 2NY6B 1J05B 2H6UA 3OMNB 4MD0A 5I8KL 1KNOA 2DJ4A 3FU9A 4X6CB 5HVHB 4N1CA 1R3IL 1JZHA 3AREB 5TFSH 2AXGA 4E5XA 2JA8G 5GRUL 3ZZSA 5IW1A 2CLVB 2Z3FA 4N2EA 1QYGH 4MZ9A 4YWLA 3CHSA 5ESAB 2D73A 2X89D 4AUJA 3PUWA 4DGWC 3RWEA 5EGTA 5JMOC 4GNXA 1BIIB 1MHHA 1WV7T 4UNIA 3T8MA 1MJ7H 4ZK8A 1CA6A 1NGQH 2A77L 3G5XA 5I1GL 3E5SA 3QI9A 2B2WC 2XFGB 3HS0C 3SJVB 2G5RA 2ZPKH 3VMPA 2R1YB 2Y7MA 2VXVH 5GSVA 1TY2A 1JGUH 5LQBL 4DV1Q 4MZIA 4MD5B 1JR0D 2GT9A 2WBJB 3NSYA 4YUEH 3DO3A 3ZYIA 5IMOB 3SPVB 4YDJA 1FC1A 4GKOA 5I16A 5FDWA 1CICB 2CBMA 1CYGA 4DR5Q 1SHWA 4FNQA 4EQ3A 3FUDA 4U1KB 5E1FA 1YN7A 3VR3A 5EBCA 3KYOA 3RAJH 1D9KB 4P71A 1WE5A 3LQMA 4PJGF 5F9WC 4KDTC 3HOYG 1C08B 2OJZH 2IT1A 3F7QA 4NN7B 3ROOA 1M8AA 3T6QC 2ZKHH 4JZNB 1PRTB 4JFQA 5CLTA 4FMFA 1ASQA 3BYYA 2XVSA 2YPLB 4WU7A 2QQKL 5M3MG 1NAML 3LEYL 3STZA 1J0KA 5DJCB 2CVRA 2Z4IA 1QSFB 1CGUA 1T04B 4JFPB 1QW8A 2WNGA 4FI6A 4WIQA 5TE7H 3TP4A 4JW0A 5E2TH 2R1WA 4Y9BA 5C3WA 3ULAB 3IDJB 1T5KA 2JELH 3HOZG 1ICTA 2C4FU 3C8KA 1H9JA 4MKMA 5JEAH 1HOCB 1J5IA 5M5XH 2IG2L 3U4EB 1OPGH 2HKHL 4MMZB 2B7DT 5GPRA 4HBQA 3MLZL 1ERNA 2C9SA 5IB1A 5ADOL 5D72L 2WYTA 3SDYL 1ZE3H 2FJHA 2K1BA 3HOWG 2EVGA 4ZFOL 3UAJA 3CVHB 3MA9H 2EC8A 3SPIA 1PH2A 1N68A 1VESA 4JRYD 4D9LL 5JDJA 1DCEA 4F8MA 4FXLA 4PJEF 4ODGA 1PLCA 1YVLA 3C60B 3BP4A 4GQQA 3OKMB 4ATTA 1SUHA 4X3SA 3DURB 4U6XB 4KKLC 2GEQA 3RVTD 5C2BH 2NXZC 3QUYC 3P2DA 4WO0A 3KJ4B 1BR9A 1RJZA 3QIBC 3AT9A 4OJYA 4WJG3 2ID5A 1RD9D 1XH3A 1XO8A 2HT3D 4YHHL 3BSHA 1DUZA 3OKEA 1FL6A 5FA3A 2WXKA 5HHOE 2P49B 5KTEH 1M6UA 2DI7A 5C0AD 4FFZH 4N0YH 3VTAA 2V3DA 3IXAB 3D39A 4PG2A 2W1NA 3ULUE 2JI2A 4PN6A 5EC2B 1F1GA 4O00A 1HXYD 4HJIA 3C09C 4NKIL 4UIKL 4V2CB 2CO3A 3V5HA 5CV8A 1UJ3B 4F37K 1YEKH 4PQXA 1LD9B 1KTRL 3MJ7B 3VXUD 2ADYA 1SOQA 3ARSA 3GTLH 4XNYL 4LP8A 4OGXL 5HHXH 1IVLA 3WIHA 1BFVL 4ZNEE 2ZP8A 4W9HC 3ULPA 3C6LD 4AI7A 4FQPA 1KIRA 1EXUB 2HUGA 3TC9A 3E8VA 2F8OA 3IFOA 4OJFL 3S34L 3ECQA 3FN0H 4TVUA 1Q0YH 2R2BA 4TSBL 1BOGB 2WXLA 3GZPA 3BVMA 4OONA 2OS7A 3HE6D 3TV3L 3SVMA 1BUVT 5B38A 3LIZA 2DIBA 3VRIA 1FNAA 1BBDH 3P11H 4RSVA 4DUZQ 3DUSB 1UE7A 2ROYA 4H4NA 1PH1A 4OZ4A 4XHQA 1U21A 3WFZA 3QUGA 3RIFF 5D7LB 3RUGB 5EKKA 1P8LA 1T20A 2P8LA 3CJJA 4GFXA 1CXFA 5CCKH 2P5EE 3FB7A 3SKUD 5F7KC 1KTDB 3BUIA 4AG4L 4JI8Q 2HA1A 1JPSH 4TNWF 3FSZA 3EIFA 4KI5D 1K8IB 1SMXA 4KNSA 2OMZA 2QGCA 3UGXA 3MJ9H 4CC4C 3JAMi 2J25A 2P7TA 4QHUA 1DN0A 3O2WL 3P4LA 4LQFL 4A6YH 4AC4A 4L9LB 2ESVD 1TDQA 1H3XA 4Y5YA 5DD0L 2E2JH 4WGWB 2PW1B 5DVOA 3D2UB 2WLMA 4H5SA 3VXNB 1ODUA 1HUNA 4DV1L 5BQDA 2FJFB 2B2TC 2L5TA 4WDIB 5K9JL 4L1HA 3P3YA 1AH1A 2DPKA 1WJ3A 5ITFB 1SF3A 4UM8B 1JUFA 3C6SA 2YXMA 4PJDE 2F53D 5MP6H 3QIWB 3WIAA 1WCMG 3R1GL 1XB6A 4GBXB 4QOKD 2A5HA 2YKKA 3RLFA 4WEEA 1TS4A 3BT2L 4RGNE 1LM8V 3FPYA 3PUCA 4I65A 3KF6B 2G2RA 4WUUE 3VXMA 3GBNH 5CGYD 5D5ME 4DUVA 4XMVA 2BOLA 2BVQB 4FO2A 2HT4D 1SXCA 4K3DH 1ZPUA 5ISZD 1QNZL 3MV8B 3NELA 2K33A 3KCWA 5DD1L 4Z8FL 2V5YA 3LKOB 3U50C 2X1OA 5TE6L 4XZUA 3G3LA 5AW3B 4G9FD 5B8CA 1IEAB 5FOJA 3A6CL 4PYHA 5B3SB 2N0MA 5AVUB 4D0BA 1N9WA 4L8JA 1QQDA 2BIIA 4H26A 2Q8BH 1R0AL 2ZOUA 3CPFA 3EAKA 2BNUA 3QPXL 1VF5C 4PD4K 3HEJA 3MBXL 1E8WA 4QXUL 1MVUA 5G5DA 1FL5A 4X8XA 1F1DA 4WNSA 2YD7A 5HJDA 1VLXA 1G2SA 2W07A 3GFUA 4OCWH 2OTLA 1JV2B 2IMMA 5E95B 4OD2A 4PS4L 5T3ZH 4ZD3L 5TDPB 2ZX9A 4GJTB 3I3EA 3FQUB 1T3FA 2DYPB 2XTJD 2I7SA 3ARZA 3LNDA 4XNUL 1Z9MA 1MBYA 1NC4B 4BY1H 1C7YA 1SYSB 3WHXA 3PJSA 1SN5A 3QO1B 4PS3A 3KFUA 4FFVC 4EBQH 3BSZL 4LPTA 4E9TA 2B9BA 5C08B 1S7TA 4I5BB 3GI9L 1A6TB 4WFGE 2HZHA 4G6FB 4TQHA 3U6XA 3V0EA 4RIRA 3KYNA 2RBMA 2L1BA 3HMWH 4DR7Q 3MV01 1Q90A 4LPWA 3X11B 4ZO7A 1MW2A 4FAAB 1FPTH 1WCQA 3ERQA 4FVMA 1VQAA 4NDXA 4W9IC 4OZGE 3CDZA 1F56A