5JPNC

Structure of human complement c4 rebuilt using imdff
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
290
structure length
290
Chain Sequence
APKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Complement C4-A
total genus 55
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jpnC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 5jpnC01
3KLSA 1BUVT 2J0TD 3CKIB 3MA2B 2B39A 4D94A 2I07B 4FXKC 1UAPA 3T4AC 3CU7A 3V96A 1JC7A 3HRZC 3I70A 1BQQT 3HS0C 1BR9A 5FO9B 1PXUA 2TMPA 4ILWA 1UEAB 1BV8A 4LNVA 5FO8B 2XWJB 2A73B 2WIIB 5FOBB 3OHXC 1JB3A 5JPNC 1XWEA 2QKIC 3L3OC 4FXGC 5JPMC 2WINB 2ICEC 3G6JB 2A74C 3FRPB 1OO9B 1D2BA 2PN5A 1GXDC 2XWBB 1AYOA 1EDYA 2E2DC 5FO7B
chains in the Genus database with same CATH superfamily
4KMLB 1EQWA 1UWEH 3GIZH 1D7DA 2V6HA 2G2PA 3GTQH 2WO4A 4AMKL 2EDGA 1QO3A 4G6JL 2F58L 4K23H 4KUCD 2PP7A 2XWJB 2LQRA 2NY5C 1IGTA 1M42A 1S46A 1BAGA 3N9GH 1PLBA 2OP4L 4RLDA 3FFCA 1M6OA 3LPFA 1H3TA 2G5UA 4Y5XB 3TO2A 2YEZB 3LPOA 2O1AA 3S96B 4M3KB 4N8X1 3E80A 3FN0H 1Y1VH 3DX6A 3HG1E 2AK4B 1J5HA 2IAMA 2VZAA 3NFNA 1BG9A 1BBUA 2WQ8A 4RH4A 2HA1A 5GRVK 1BXXA 4WZ9A 5A2JH 2Y3NA 5I8KH 5LGKA 1QSZA 4H2AA 2FIRT 4X7TB 1RUAH 5FLVA 4BY7G 3SOBH 3GHPA 2NW2B 1EEYA 4DTGL 4PAZA 1LV9A 4MHHG 2X4PA 4QOKE 2O5ZL 2VH5L 4W9EC 3R0NA 2BNQA 1WZKA 4ICWA 4JPSA 1BREA 1WFUA 5JOFB 2C35B 1G9EA 1JPTL 4M8QB 2FHBA 1PD6A 2P48B 1ET6A 1HWHB 1BWMA 3FONB 3E1ZA 4HDIB 2CKZB 3VFMA 5AUMA 4AQEB 4B5ZA 4ETQA 3CV5A 5C09E 3HMWH 4P5TA 4DXFA 2ESVD 1X3FA 4F15C 2FJSA 4H0IA 1IJNA 5A7BA 3ZMEA 4LB8A 2X4SB 3D5OF 2E9JA 3SJVB 3AQQA 5DHVH 3I2CH 2RFXB 4DEUA 4U1NA 4HUWB 4AYBG 4U1LA 4UT6L 43CAA 4YHNB 3MC0A 3KPLB 3QXAA 2FEDD 2AJYH 4HT1H 2AJXL 3QJOA 4LBEB 4FQ2L 3IMRA 4IUPA 1OL0A 1LACA 4HIMA 1HHGA 1THAA 3HE6D 5M3FB 1VGKB 3ISYA 4WTZG 4ELMB 1OO9B 1PLGH 2JA7B 3HNTH 1NMFA 3P0YH 4YBLB 2X42A 3EJTA 1ZIBA 1Q12A 4N2NA 4Z78B 2L7QA 3DEOA 3CHQA 2QQKL 3M85A 4JL1A 4BWUA 3ZKSD 3TV3L 4U7KA 2E2HB 5I15L 2XV2A 3Q8DA 1RUPH 2EKSA 2LGNA 2XACC 5DEJA 4MJ5A 1BVSA 1S5HA 1VJSA 2JKJA 2F19L 1EHLL 3T1HQ 1OQOA 3GXNA 1RZPA 2MOGA 1J18A 1NMBL 2XNAC 2YSTA 3EH4B 4MJ2A 4WNSA 1J0ZA 5GGVL 4ZD3H 4LK4A 4P5KA 4OWXB 1M90C 4OX9Q 3MNWB 1CWVA 2D03L 1AXIB 2A9CA 3CVIH 3GXTA 3P9WB 4Z7QF 5DT1H 3STLB 3SQRA 1UC6A 3FUJA 3UZQB 5C0AD 4M5YH 3IDJA 1AGEB 3MX0A 1KBKA 5D7IB 2VERA 5FYKH 1H3WM 4KXBA 3UTZA 1AGDB 4ZKCB 4XVJH 2PWHA 2NXZB 2QGEA 3ZQWA 2Q5BA 5HDBE 3ZSTA 2EUZA 5GGUA 2CKBB 5C0IB 3WHE1 4M6NL 4Z7UB 1FNGA 2M9VA 3APNA 1EWIA 3N44F 3K5NA 4WV1C 3V0VB 4XXCA 3I90A 1DSFH 3VB8A 1A66A 2A77L 4KJPD 4KKQA 2NY1B 1CDHA 5E4XA 1NTDA 4DP7X 4ZFOB 2GJ6E 3JQOB 3FB7B 3IFLL 2A74C 3KLKA 5JIKA 3RDTD 3RDJA 1FO0H 5FM8A 4R9HA 1RK1B 3DVIA 4LF8Q 2DJGC 1PFOA 2DV6A 1WJJA 2LAAA 1T03L 4NO3A 2NY4B 4R8WH 4OO1I 3KPPB 1A2YA 1N4XH 1MJCA 4Z6AT 3VSUA 1V7ML 4HULB 5IGBA 1AKJB 3FTYA 1QKZH 4FF2A 3B4NA 4WDIA 3H0GH 4OIIH 5ISZB 3TO4C 1E5AA 3N42F 1U8OA 1C16B 2ZICA 2NY7L 3U36B 4ODTL 1U3JA 1ZVNA 2WBJB 1YNND 3VYPA 1KLUA 3V2TA 4B9PA 3WN5A 2C9XA 1UOVA 2V7HA 3DHQA 1DBJH 2XZQL 2NY4D 2OTJA 3P3TA 2DEYX 1N36Q 1SE4A 4NXSA 4FLQA 4EZKA 4JYAQ 1W0VB 1XEUA 2X9XA 3TN2A 4PI0A 4DETA 1MHHA 3NIDB 3TBTA 3FULA 3WG7B 4EBQH 3GM8A 3BISA 5D7JB 4C3IG 1G6VK 1PKQE 4R2GC 4UIKL 4DK3C 4UM9A 4XXCC 2ATAA 2DWEA 1K8GA 3ARDA 2L1BA 4H02A 4M7ZB 1R24A 2IXQA 4YBHA 1KAWA 3QIBD 2H5XA 4G8AC 3EYQD 5AG9A 3MOBH 3HEJA 4TUKH 5IJVB 5AYUH 3BUBA 2BDNH 4K3DH 3JAML 2BP8B 1BCPF 2EIZA 1M71A 3LRHA 1JR0D 3MLSH 4Q0XH 1HL5A 2FIKA 3CCEA 3L81A 3FHWA 2BY1A 4RESB 4OZIE 1FDLL 5IFHH 4HC1H 2Y2YA 4HS6B 4R6UA 1GHJA 4ZMVA 2ZPKL 1JOQA 3VFMB 4KZEH 3D6WA 3DUHA 3GFUA 4WWKD 5C2BH 4UDUB 5LBSA 3UJTH 3QA3A 3CK0H 3D4ZA 4R26L 3BVZA 3VNZA 2V17L 3PWPB 3LH9A 3B7SA 1U30A 4WK0B 2VKWA 2E9GA 3P30H 4YGAB 2DJMA 1FWXA 3H42H 3BDYL 1GZQA 4KXCA 2LVEA 5T1DH 1YPZE 2W81C 3DX8B 4AQYL 4XBGB 1TZHB 4JFOA 3C6SA 3BPNB 4PD4J 3KPRE 2HWZL 1L9NA 2N49A 1JSYA 3MREB 5D7KD 1JXFA 3PDDA 4FLHA 2VAAA 5HDQL 4OFQA 1BNZA 2JCCF 2N4IA 2IT1A 2PO6C 4OZHE 5K1NA 2Y25A 2YBGA 3UBXB 2UUDH 4CSPA 4IU3B 3EBGA 5HI5C 2XVLA 4UOQA 4UQ3B 1IIIA 5KSVB 3AY4A 3PWVA 1K72A 4CNIA 3NCYS 3BSZL 5BVPL 1KHIA 2EC9T 4XHQA 2HN7B 2VXTH 2X6AA 4KJQD 2K7QA 3FSAA 3HC3H 4AUUA 1Y1UA 5AW1B 3ZHFA 5I4DA 2X1QA 2X1WL 1JB7A 5EHFA 1U8JA 3PJNA 3X2QB 2AXWA 4ODSH 1NH6A 2IBGA 1BVLB 5E08H 3MA9H 1T0NA 2WZPD 1FGUA 5H4ZA 1UD6A 4DV6L 3GTLB 5CBAE 3ENEA 3AFPA 1UCTA 5A2LH 3S37H 3NPSC 1PH5A 3TZUA 2LTQB 3OB0H 4JM4L 3WO4C 1FNGB 2GBTA 4OCRH 1E9QB 3QYCA 3LY6A 3CFIC 1NE3A 3M4QA 2FFKB 3ABLB 3B5HA 4O58H 4WCYL 5DD1H 4G7SB 2ORBL 5AUMB 4ETQB 2MEJB 4KO9A 1QRNB 1WZMA 3P0VL 2MWCA 3PDOA 3FU8A 5IK3A 3RA7L 3ZR5A 3UAJD 3BEWB 1FSKC 5SX4H 1FL3A 2X4UB 2IH3B 5ECGA 5FLUA 2ZOTA 4ZUTA 1F9PA 3NE5B 3GBDA 3PQYA 3DYMA 3U46A 3MZ5A 1DDHA 2YHGA 5E9AA 2DDQL 4G2AA 1U3HA 4U1MB 1HIMH 3PJSA 2VB5A 3SDXB 3SKOA 2RQXA 2QFRA 1FNVA 3A7LA 4JBSA 4OX9L 1DD2A 1RUQH 2Z35A 4NRXB 5C07A 1I3RA 4JG5A 4RWYH 1GC1H 1TNNA 1NCCH 4YSDA 3K6OA 3J7ZC 1OXYA 1I9RL 1NL0L 3DUSA 5J6HA 3EG9B 3FU7B 3OHXB 2J20A 4RISH 4JQIA 1CD0A 1OAQL 4PJAE 1BXAA 2NX5B 4UUJB 5JW4R 3TFKD 1V3MA 4BFFA 2AQ3B 2YAQA 4BXXH 5MEQB 1MCDA 2NW3A 4P46C 4P9HH 1EV2E 1HZBA 2HFEB 1R3LA 5E4WC 3VG9B 3WXWH 1Y14B 3KM2A 5GRJH 2VQ1A 3DJRA 4DR3Q 4RHRA 3NJHA 5GJSH 3MRMA 1M6OB 1JHKL 2JQAA 1JYVA 2O2LD 1KEML 1XWEA 4K8RL 4ZYKB 4DUZQ 1FFPB 1XCQA 4QHMA 2OPCA 3IFPA 4JKNA 5GGRY 4G3YL 1DL7L 4BFOA 1QWUA 3D12B 4XPAH 5EB9A 5HD8D 3ZN6A 3RTQC 4PLKC 3WDNA 3LEYH 3F3HA 5EO1A 3JWOC 3PAZA 2HUHA 2BOBB 1AHWC 2WYHA 2K3HA 4KKLD 1H15A 4MS6A 2UXBL 5MEPA 3U82B 4J5VA 1VERA 2BW4A 3VDBA 1N6VA 2P5EE 4E9YA 2HG5A 4YXHL 4YBQC 3U50C 5KAQF 1FG2A 3DV4A 1FJ1A 2JQZA 3V5HA 2FECI 1K9MC 2KPWA 4LSUH 1A15A 4CN4A 3HPJB 3GP7A 3GO1H 3OR6B 3MOAH 2XXCB 3TEZA 1KBVA 3VXNB 4M8QA 2HSIA 2UUAQ 4DZBA 1CICC 3IPFA 5BXFB 5SX5K 2IPKA 2JKRM 4NZJA 2IAAC 1SN2A 4F5CA 4YWLA 1WITA 3BJ91 2WK2A 2JE8A 2XQBH 4JOIA 1CDUA 2QKSA 4BD4A 2X4SA 2PXYC 4YPGB 5ESVA 3BAEL 4ZFZB 5JOPE 4JO3H 3ZMRA 3IDGA 3ZT5A 4FQXB 2YYZA 2X6CA 1DLHB 1GZPA 2VLLB 5L2JA 5I66B 3UOAB 2B2YC 1WQVT 2HJFA 3KZ8A 1NGYA 5F89A 4UYQA 5I1KL 1UG9A 4AIEA 4LF5L 5EIVA 4I77L 2JA6H 4OLUH 5F88B 3QUXB 4RMUA 4WUUB 4OZFB 1S7TB 1LEIA 1LK2A 3O13A 3V4VB 2XTSA 1B70B 4APQB 2QDBA 3S16B 2WXMA 3IMVA 3AU1B 4PRDA 2MOVA 4KTDL 1H5BC 5TE4H 4I3RL 1BBWA 1G51A 2D9UA 4F33A 1REIA 1VFBA 2DWXA 3B2XA 3C2AH 5DFAA 1Z9SA 3J7AV 1I9IL 3UP1A 4IKLA 3X11A 4CKCA 2C5DC 2WIIA 4UT6A 4GKOA 5HVGB 3FT9A 5DEGB 5AKTA 4R4TA 5I6WA 1YQVL 3MBWB 5AAMC 4Z7NE 4KHVA 4OIKA 1Q7YC 3S1QB 2MQHA 1KACB 1WIPA 2E27L 2EE0A 2PUQT 3EJUA 4PU2A 4X7DC 1I7ZB 4UY8C 1DJIA 3FKIH 4GLAC 1G1OA 2DQ6A 1FQ9C 2CUAA 2F54D 3H2WA 4GP8B 2YPLE 1HSBB 1TMCB 2B2YA 4O2FA 3NWTA 2G9HD 3UTTD 1BD2A 2X7LA 1T9HA 5KW9L 3O2VH 3W5OA 3SKJL 5K33A 1XNRL 2VDNB 3WAJA 1AN8A 4LMQI 2WWMD 2K9UA 3UIZA 1ET5A 3QDHA 1ACZA 1JCKA 1OTSC 4K7PX 4U0RB 2BE5C 3H91A 2AXJA 4NQTA 2JKSA 1FVEB 4XRCA 1X5MA 3CGTA 1A7NH 5DAUA 3OHXA 3SBQA 4TULH 3ZKMD 3J7HA 2YBRB 4RA3A 5LXGH 4YAQA 2R6GA 3MJ9A 2D73A 1Q94A 5HY9A 4WSJA 1GYUA 1VSCA 3OX8A 1ZHBA 3NRFA 2G9HB 4XP5L 3UTTB 2AC0A 4ES9A 1HPCA 4PLJC 2B2VA 1QMUA 3G5YA 1UD3A 1AGFB 1HQ4B 1LE5B 3COOA 4KZCA 3RHWF 1E3XA 1N36L 3IM1A 3UJIH 3G6JA 4UTAH 1Y1WG 4A3DH 1PLCA 3T0EA 3L2LA 1EUUA 1N0LB 5KIXA 2ITEA 4XTRC 5GZNC 5HYQA 1WD8A 1BAWA 1F1GA 3TEUA 3KYAA 3ZVVA 4JPIA 2V7HB 3NPZB 4OCWH 1AGDA 4QHNA 4K5WA 4HJ0D 2Q1EA 3VRLF 3S0PA 3GMRA 2O6EA 3D8MA 5HHMB 2MKWA 1LDPL 4KFZC 2OR9L 1MKHA 2F5AH 3KR3L 4YS4A 1KTLA 1WH0A 5DCCA 4OD1H 5D5MA 3RVWD 2EE3A 4QYAA 1J5IA 5G3LD 1E4HA 4Y1TA 4B0MB 3V9EA 4L9DA 4UM9B 3SDDD 4Y4HC 4C47A 4XN7A 3VWJC 1OAZH 4HCRL 4JZJC 4OKDA 2A69C 1X7TA 3OW2A 1FG2B 5FUCE 2Z9HA 5GROA 3US1A 2YR3A 3B8YA 4GRWB 3U7YL 4V190 5IR1A 3O3AA 1L1OB 2XKSA 5FUZL 4TVAB 1HR0W 4LLDB 4DSYA 3GTQB 4IW4C 1WJ3A 2J57A 4MCYA 5GAHC 1GGTA 2VJXA 3OKLB 3WEBA 4XNAA 4R4NC 2CR6A 1K8AC 3M7NA 4PJEF 1OD9A 1OTCA 2L15A 1F4YL 1JF1A 2F9BT 4FQQA 5F6HI 2GEEA 2R7DA 4K23L 3VWJD 4DP9X 4G8IA 4HUUA 3CNKA 1DJGA 5I1JH 3CQZB 3Q0AA 1P5VB 2Y7SA 4V33A 1JZJA 2N0MA 4FLOA 1IGYB 4NHUB 1A7BA 3FN0L 1M53A 1HS6A 2IGFH 4TUJB 5GRWA 3BWSA 1H8SA 1SDYA 4UWQB 1PZJD 3VFRA 4A2LA 3PSIA 2AQ2A 2Q76A 2NLJB 2GSGB 4XMPL 4DIXA 2NN6H 5D96C 1CF8L 1YQ2A 2R39A 4G6FB 5M3MH 1VFMA 3IJSB 3WEOA 1M71B 2QVMA 1FBIL 3V5KA 1IFRA 5CN2A 5IW6B 1UEBA 1S4ZA 1HNZQ 4IK6A 4JM2F 5IMMB 2AERT 1HNWQ 3QORC 1PZ3A 2O5ZH 2VH5H 2DQDL 1E6OH 3TREA 4X83A 3P4OA 1CPUA 1K3RA 1AKJD 3FBKA 4XXWA 4BFNA 4JFVA 2K01A 2J25A 4BFIA 3GGWB 3GRWH 4H8WH 3BQUA 2X9ZA 4A3LH 1T1ZA 3DRQA 2DRUA 4M5ZH 3PL6C 1NGWB 4QRAA 1T4WA 5ACZA 4GN4B 4W9FC 1GKOA 4XN4A 3W11D 3ES6A 4BSWA 3QUHA 4CDEC 5DD0L 1V1PA 3I2CL 3DETD 1AYOA 5DUBB 1U8CB 4KKSA 3TBYB 1ECZA 4XQJA 1RFDH 1G2SA 1BD2B 2FAUA 3LPWA 1MFBL 4D7PA 5MI0C 5IYBG 4NBYB 1J9TA 5I18L 3F6IA 2GIXA 3A0OA 3US9A 1E7VA 1ENFA 1BFTA 4UT7L 4AKQA 3S97C 3OWEB 3P0YL 5C0AA 4WW2F 1EFID 3CMGA 4JDVA 5KGUA 3HOXB 5JJIA 4OCXL 3OJVC 2PTUA 3KYNA 1BOGA 1U3HB 4DW2L 5AOMA 5IB3A 3QXDB 4KVNL 5IOPB 5D6CB 1IAKB 1UE5A 4DAPA 1SF3A 2OMVB 2XWJA 2F19H 4NSKB 4QHPA 3UZVB 1S7XA 2ROXA 5TE7L 3MV11 4Z77B 4LFAQ 2PZWA 3MTSA 4FKHA 1YNTB 4MHEA 1E5UI 4PY7A 1WFQA 2PR4H 5FYKD 5T8IA 4AIZA 5AEAA 1PTOB 5C3WA 5C09D 3U4VA 5E0FA 1A2UA 3ASOB 4ELDA 1FZOB 1WYDA 1ZXTA 3INUL 5A40E 5I6LA 1TVBA 2YLHA 1A6ZB 4O9HH 5E8DL 3SPCA 3MUUA 3WENA 1U3HD 3LZRA 2K9FB 3DGGA 2OXGA 4TXVB 2VR5A 4FFZA 1SE3A 4JI1L 2VAJA 3O11B 4EO5A 1WT5C 1DQQB 2CGRH 3UDWA 2TAAA 1AD0B 3LZNA 3MBEA 5I9PA 4DV3Q 2ADFL 4L9LA 3BAIA 2PWDA 3E8UH 4E5XB 4IUTA 4GS7C 4BA8A 4GT0A 2FL5B 1PJWA 1OTUC 4BRVA 4DFHA 5I15H 1JV5B 2HDLA 1ONQB 5DS2A 2IANE 4GKJQ 2A73A 1SEQH 1NFAA 1QG7A 1J8SA 2W65B 3C6EA 3CHRA 1FFPA 4FYQA 2EIFA 4E42A 3UDFA 3WXVL 5D55A 1VQMA 5T3ZE 4ODWA 3CP0A 2ICEC 2VABB 3QH3A 2AV7A 5FLXc 5C4XB 1RSFA 4MMZC 1QKZL 4HGWB 1NIDA 1OGPA 2QKIB 1B0IA 3SPVB 2BH0A 5IYCH 1F77A 4D8OA 3UEZA 3FH5A 1CFBA 2N1TE 1BQHA 4L48A 2X28A 3OKKB 1ID2A 3MXNA 4U6YA 3CVHH 1SJEA 1WWBX 3F6LA 3BKYH 3FU7A 2D9QB 3QWRD 5DA4A 3IJEB 5IWAL 3QUYB 2RQ8A 4FL4C 1JXJA 3T4YA 2NUTB 4QRRD 2WJ5A 3LNFA 5E9DD 5J3HC 2DQGH 1BF8A 2AK4D 4HOXA 1EA9C 1PKOA 1F58H 2WLMA 5TDNA 2L55A 1ZLUK 4FG2A 2JFCA 3K81C 4A55A 1QI4A 3GIVB 3MRFB 4O2EB 3SE4A 3ZDXF 3ZJYC 2YXMA 1SY6A 2B4CC 2VQ1B 3K5RA 1AANA 4LLWB 1E1OA 1FG9C 1KGCD 4FXDA 2V37A 4FFVC 3P77B 4DN4H 2ICEA 1HINH 5DJDB 2EDOA 5EO9B 3ASNB 3OAYH 4NP4H 4HJSA 1SHSA 3EJJX 3SIKA 4GAYA 2RA1A 3ER0A 3DSNA 5F9JA 4BELD 3MEFA 2XI9A 2SNMA 1MLCB 2VDOB 4TL5A 4EAEA 4KGJA 5CYUA 4KZEL 2J7ZA 2E4TA 2F0OA 4EQ2A 2VLMD 3FN9A 5E2WL 3LKQA 5I1LB 1O9VA 4DU9A 1E43A 1QFWL 1YNTF 1EZSA 2DYPD 1G4MA 1JPGA 1AHKA 3GS4A 3QCUH 5ANMB 5E1HB 2A0LD 2CDFA 3HR5A 4BH7A 3UYRL 3QHFH 1NC4B 4N2DA 1BMGA 1KCSL 3AUVA 1OXTA 4KUCF 4X4XA 9PCYA 2WXIA 2XN9B 4JPBW 5EU4A 5HHOE 1DUYA 3FO1A 4FFVD 4MCZA 3TO4A 3V10A 2EEFA 5T1MA 2EECA 3JWOL 1N2RA 4XBEL 4EBQL 5JPNA 5F9DC 4HAGA 4I2XB 5FW7A 4PP1C 4LF6Q 2CHBD 4G57A 1XBDA 2F7IA 2L7EA 4PM1A 1LTTD 5LN4A 2PNHA 3ROLA 1KFAL 3CZFA 1X3PA 5DJ8B 5A6IA 2PCFB 3GHEH 3GSQA 3HRZA 2DWDB 4KZDL 1UZGA 2NSQA 2GVAA 2O5XL 2CO1A 4PS4L 4DKFL 1IVLA 1WCQA 3EHBB 1CQKA 4A3IH 4XO8A 4MYWB 4UINH 1GGYA 3KYMA 1Z0NA 3QBTB 3UZVA 3L4CA 5IVNA 1H9KA 4I18C 1IFHH 4LGRB 4BHUA 1OAYH 5D4IA 3TP4A 2PCPB 3KLHD 1ONLA 5HGHB 4HIXL 3FSOA 4A2FA 5CZRA 3WN5B 3VG0H 1SM3H 1JHTB 5GGSY 1MCLA 3ELAT 4MAYC 3U7AA 3KJ6H 4PNYA 1O6VA 4DR1L 3HKSA 2Q8RE 4TS6A 4J8RB 3B9KC 3T2OA 1A3VA 1AR1C 1CL7I 1EAQA 1OPGL 3TWCH 3VO0A 4DV2L 4J4PA 2X4TA 1MCNA 2Z0BA 1TKWB 1YAZA 3SD2A 1UEMA 3U4BH 1AXTH 4U1SA 5J0BA 5DXWA 1EQRA 1XPUA 3MN8A 1CF1A 3WLBB 4IRJB 3NT0A 4ZMNA 4Y4FA 4RVBA 1IT9L 4J3XA 4J12A 1HA5A 5EO9A 3HZ3A 3K8MA 4IBVA 1Z32X 4O58L 4M43H 1SYSA 3CU7A 3UBXG 4MBRA 3H54A 1MLBA 5CJ5A 2ZOWA 2TSSA 4K94H 4XMLH 2PQAB 1LO3H 2G4EA 1CZ8L 1OV8A 3BIBX 3VXPB 2APVA 3TBSB 2DQCH 1Y69U 1IMHC 3U2JA 4FXKA 5INDA 1URZA 4I13B 1IM9D 1RSYA 3MHBA 4CRPA 4PUBH 5I71C 3MO1B 2VXTL 4MNGA 5IJDC 1HYSD 1QASA 2Y0SG 5BOJA 2WB1E 1QBLH 1RXLA 4O0AA 3GKZA 5ELDA 3MRPA 3N6YA 1YEFH 3QUZD 1HQRD 5EOCJ 1S8DB 2BHZA 5FYLD 3V5DA 4RX4A 4XCFL 4EEEA 1YEHL 5PAZA 2X1OA 5JR1H 5CEYA 3WFDL 2ZX6A 2AABH 4MAUH 4HK0A 3OJ2C 4Y4FC 1S72A 2KLTA 2OL3B 4UZSA 1VDZA 4LNRB 5BQ7A 2Z6BA 4WHTA 4FLSA 4H88H 1ZGLP 4FYTA 3S1RB 4FX5A 3W9EB 3NAAH 4HAEA 2NSMA 1AO7E 2UWEB 1OT1A 5IBTH 3DJ9A 3F85A 4TSAH 4JFFD 2B2UC 3BCFA 4IU3A 3V6ZA 4K55A 5F3BA 3H4FA 1WTPA 7CGTA 4ORZC 2PYKA 1J0HA 4PY7B 1G1KA 3NCXA 4I4WB 1U8KA 2VMJA 2HLAA 3RZCB 1QBAA 2BS9A 1L9MA 1K0SA 3CKIB 3HC4L 4D2NA 4GAFB 5TE6H 1QPKA 1MAMH 4LPUA 1AZPA 1UWXH 1JHKH 4KI5D 4I48B 3S34H 2H32A 1PXUA 35C8H 4WTZA 2MPAL 3VWKA 4Q9RH 1TZGH 2OXGB 5I75C 2IIJA 1VQBA 4KOCA 4U1LB 4FI7A 1NTGA 5I26A 4ZMAT 5C71A 3QO2A 5IB5B 1OSYA 3FQRA 2JLLA 1XZ0B 2K5VA 1PYBA 2VOTA 3FQYA 3KWVA 5DQ9B 1YYMH 3VXSA 3ZPDA 5CEZD 5IJVA 3RNUA 5L0QB 1P7QB 2EDYA 4YIJA 4Z9KB 3TQYA 2A0LC 1TTBA 2ZXBA 1ESRA 4H7VA 4Y5XC 3FUMA 2GY5A 5FF6A 3VD1A 1Q1BA 4HJ5A 2EYTA 3AREB 3KPMA 2F6AA 1OSZA 1YEDB 1YEJL 5DFTA 4JO2H 5GGSB 4ERSL 4JDEB 5E9DA 4QRRA 2EZ0D 3H09A 2OZ4L 1SXAA 5IOKA 3PAVA 1LO2H 3HZKA 4QLRA 4FF9A 1ASPA 3I85A 4OLWL 2Z8SA 4M93B 4P2RA 2PP8A 1M7UA 1NKRA 3TLRA 2DTMH 1RJLB 1XNRQ 5D1XE 4K6DA 1QWYA 3DJTA 2HB0A 2FQGA 4Y2DD 5C0GA 2J1XA 2X41A 4LXFA 1G7QB 1MVYA 1UJ3A 4WU5B 1DVFA 5C97A 2OP4H 2DN8A 1T4KA 3J80c 1TZHA 1XB6A 1ZJBA 2BSBA 3WEMA 1MFVA 3DM3A 2O6DA 2NUTA 2ARWA 4JRYE 4UDTB 2OZ4A 3W2DA 4I85A 5AB1A 4HIJA 1UAPA 3MRGA 4WHCA 4YHKH 4GRMB 1DSYA 1I8KA 3DKHA 2A4CA 2V5MA 4U2YA 4YDVA 5E8PB 3AY2A 1BV8A 3EDDA 3ROOB 5I1AB 4XNZC 4IURA 2N78A 1ZEAH 1YZZA 3EJZC 3OAUL 2XLLA 3OXRB 1AHMA 3SOBL 1QTPA 1ZGLM 1M2VA 4JANB 3QQDB 3H3VC 1BYOA 4AH6A 2WLYA 4UQCA 4JAMB 3MXVL 3NJJA 3T6ZA 3G4SA 2PYFA 3SDDC 1OM3L 4CL7A 3ESVF 3MRJB 4XMUA 4IBWA 4A2MA 2VL4A 4DV7L 5FYLH 3W1GA 2OSXA 6FABL 2K5HA 3B9DA 1TSRA 3A4DA 2PPEA 2WLNA 4ZPTB 3TJHC 1C7YA 4CDDC 3BVWA 3OZ9H 3GBNH 2F54E 1GTFA 3KYHC 3DHPA 3MDJA 1FVIA 1PFBA 4H5SA 4N8PA 1ZTMA 2AS5M 1CFTB 1N8RC 4N86A 3OMCA 1CE6B 1VRSA 1GD7A 4WFHD 5J6GB 4J2XA 3B3BA 3EN2A 4DNLA 3KJOA 3Q1EA 3FUDA 3HOYH 1BGXL 4DKAA 3C5JA 3SKNA 5DDHB 4I77H 3FKUS 3BP5A 3CFBB 3QI9C 4QEGA 1WI5A 4WV1B 5EU6A 4M1CD 1G94A 3X13A 2UUAL 4EZJA 1L3NA 5ELCA 3BZCA 3BAYA 1LEGA 1BCPB 5A1AA 4JN1H 4KTDH 1ZHKA 3E7JA 5E2TL 4AM0B 2DLEA 4H13C 2EIZB 1AS6A 1FA4A 3LGJA 3H6AA 1ASYA 4WU7B 4BZ1H 2NBFA 1W0WB 2B20A 2HFTA 5I30L 2R2HB 4ZW6A 3EYSH 2WNKA 4QRPE 2H0EA 4RZCA 2WFWA 4PMWA 1MY5A 1LXMA 1MFDL 3MGTA 4KJWD 5BOZG 5I17A 4CSZA 4Z78A 2O26U 1D9KD 3D05A 3NZ8A 3D0AA 4TTDD 1Q38A 3D1MC 1SUJA 3F58L 1HXMB 3FZUC 1A65A 2O4EA 3KEHA 5KVEH 1CFNB 4KKLC 4DAGH 5DT1L 1N12A 3QG6B 4KQ4L 3VFNA 1QYGL 2QCPX 2Z4HA 3MXGA 2D5DA 3OPOA 1FRGL 4L4VA 3HG1B 3L2PA 5TF1L 5D9SA 3WIIH 1DYQA 1CKMA 3NEOA 4W70A 3RGVC 3MAWA 3MEHA 2EKJA 2N01B 3WS3B 1T1YA 4NQXB 5JW4M 2Q7AA 2CHWA 1BP3B 4OZFA 3WTWA 1NDGB 2DQUL 1D9KB 1U91A 2E3VA 4HLZH 4ODVH 1YNJD 3Q8CA 3MRMB 3HOYB 2ZP8A 3H85A 3NBIA 1G0DA 2IALA 3ML8A 5ABAA 3SY0B 3VXPA 4GUPB 4GRWE 5IREA 2OJZL 3VH8B 5C44B 2FK9A 3K46A 3PCOB 4LT7A 3OKDB 4B3SQ 1P6WA 1J8IA 3APCA 3NN8A 3NOIA 1QSEE 2GSIA 3MVSA 3QB7C 1SNRA 4HGWA 4U4BA 4G7RB 5ID1A 4HKZA 4HJAA 3LX0A 1I4RA 4JFHE 2VN3A 3QPKA 4ODTH 4K0KQ 3S9WA 1NWPA 4X6CA 2OL3L 1T4KB 1Y8NB 2OXPA 1Q8MA 2CA4A 3R1GL 4GBXA 5AB0A 3NCMA 3VFTB 5I16A 2EIDA 1W2BA 3U4ZA 4P9HC 3KBPA 5C0BE 1JPFB 1S7SA 3K6DA 2WJ7A 3VXNA 3EJQA 1EPFA 4M48L 2ICCA 4OW6A 4G8GB 3GMQA 4P59L 1MAKA 2DL9A 3O2WH 2BSED 4OD1L 4ONGL 2WD0A 3V0GA 1AHWA 5AOKA 1J5OL 2YD7A 4MRCA 1G291 3L0OA 1KTJA 3C9NB 5F7YC 5CGYC 4YSQA 2MSPA 2BC4B 1Y1WB 1OAZL 1QHQA 4KKRA 1P84J 4PB0L 4WTQA 1IE4A 3TCTA 3ATFA 3D8GA 4DF9A 5D5ME 3D0LB 1G7MB 3BVVA 4X6AH 3FONA 4HDIA 3QJQB 3CHXA 3MLPA 2JK5B 2FJFA 1HI6B 2DQEH 1OAUH 2B1OA 2CMRL 3I6GA 3LKSB 4OF6A 4RFNB 3RIKA 1IKNA 4YLBA 3G7LA 1GS7A 4JREC 2CBOA 1MJ8L 4Q0XL 1D2PA 1GSMA 1NCNA 1JZ7A 1VADB 2VM9A 4HC1L 2KLRA 5F44A 1L0XB 5IB5A 2ZPKH 1A25A 1DDHB 3ESMA 4DR5L 1JZ4A 3GSUA 5IE8A 5C2BL 5D72H 1ZT7A 4UTBL 1YPZF 3HOZB 4P3WA 2V17H 4U1KA 3ZL4H 2YV5A 5I2YA 3EJYC 3SPJA 2C7UB 1YN6B 2XN9A 3QDGE 3V6OC 1I3RB 3Q2WA 2ZKHH 3MROA 4PJCF 4TSBH 3FDTA 2VERN 2UYLB 2F3WA 3UYPA 3BVNB 5KTEH 5DS1A 1MNUL 1E8XA 2AGJH 5MENA 1JNLH 1XF5A 3K1KC 4RCOA 4X6DB 1MFBH 3ESNA 3WO4B 1M2OA 1XGZA 1GO3E 3O3EA 2YC1B 3K4ZA 2K6AA 2LLGA 5EG6C 1R3JB 4JFFA 4NLHA 4JYAL 1H9MA 4TLKA 3D7PA 4IGBD 2J2ZA 4KMTL 4L8DA 2VDRB 3QCTL 2YRZA 3BE1L 1P6FA 1D1KA 2R15A 3RVUC 2CNYA 2PETA 2AXGA 4XMZA 3BRGC 4R4FH 1UWYA 4MNQD 1ZXKA 2MNJB 4BBRG 2NOYA 3FSWA 3OF6A 2XWCA 3KK7A 1JK9B 5DC0A 5JIPA 5BVPH 4LEXL 3I84A 4K2LA 1E50A 2KT6A 4BINA 3HZMA 1EY4A 5DM73 3PL6B 1TTCA 3WEXB 4AGNA 5F7FA 4AEHH 1JNHB 2KHJA 3D0VB 2HRHA 4RRPM 1H3UA 3LIZH 3JXAA 2RCSH 3MUY1 1NMCC 3K2MC 5B38B 4K7FA 3CZNA 4F58H 1KELL 4NDMA 4HUVA 4NC1C 3S16H 1DR9A 2SOBA 1T5EA 4UV4H 5DUPL 3QNYB 1FAIL 2VNCA 2OSLB 3KH4A 3KWXA 4TRPH 1DM0B 4PJHE 1GM5A 5E8DH 5C0CB 5JHAA 1CGSL 4N0UE 3OHXC 1PD1A 2WXHA 3I56A 3UTOA 2NNRA 3BO8B 2WNWA 5B1JC 4FDBA 2QPDB 2DGYA 3CN2A 3PL6D 2FGWH 1A7QH 5SWZB 3KCPA 3H53A 2ARJA 3GDEA 1U8NA 4PJFF 3E8UL 1W8EA 3WN6A 2BSCA 4X4YB 5HHPA 2P5WB 5G4MA 2IWEA 4YC2B 2AEPH 3BUDA 4QYOA 1CDBA 3DK2A 3HLKA 3QCVH 4PRHE 2FR4B 1NCJA 4R4CA 3BSGA 3T1YQ 5DJYB 1HH2P 3KDMA 4JM2B 2FEDC 4KXAA 1JZIA 3BG3A 5EBCA 5DDHA 4E41A 1KOAA 4PRHA 1OXVA 3EBIA 3FT0A 3QISA 5IP7G 4N9GA 1I4XA 4PGEA 3IJHB 4ZSOA 2HT4D 2VC2B 4HWUA 2NNXA 3PWPD 1JE6A 2GUOB 1QSED 2APXA 3KVQA 4QHUB 3L3KB 3LNIA 5H37G 4AH2A 4N0UB 3MI6A 4P5SA 4GSDH 3WNLA 4MZ2A 1V7NH 2EIMB 2WWNA 4PRHD 4JM2D 4HF5H 2ZJSH 3TT3H 2R7FA 1UXSB 2V2WB 2WQVA 5LNGA 4IJ3B 5FGBC 4CMHB 2WAQA 2KS0A 5D4HA 4I4WA 1E9OA 3S5LG 1N9PA 3R06B 1QVFA 3P73A 2AK1H 3JV0A 1BF2A 3LCYA 3R19A 4A7GF 4EUPB 5DJZA 3CBJB 2VLKA 5E8NA 2N56A 2QDWA 4JV5Q 2WC7A 1K8MA 1UA6L 1KRTA 1AH9A 4HKBA 5BRQA 3WGUB 2L5TA 3LNEA 1KCKA 1VMCA 3B6YA 2J8HA 5DVNA 3I75B 3A23A 4PWKA 2CCZA 3M7GA 3DURA 1INEH 2Q7NA 3JV6A 4JFPA 3IU4H 5HYSA 5I76A 4E9WA 2E2JB 2HKFL 4GMTH 4H8QA 1QSFD 2WVSA 2R2EB 5DMGC 2WQAA 2PKDA 3C5SB 5G4NA 1ZT4B 3CVHL 1F11B 3O8XC 1SFHA 3HEIB 1A4AA 1DFBH 2K0RA 4Q0FA 4Y2DA 4JCWA 4C56B 1XZWA 2NMSA 2BVYA 3E0EA 3P7JA 1I50H 5AW9B 3O11A 1TMQA 2D7TL 3DVGA 4KVPA 5KSBE 1NFDB 4Q9QL 3HG4A 3L6FB 4LSUL 1P2CB 3IRZA 1T1ZB 5JA8B 1FP5A 1UM5L 2VZVA 3PO3B 2YS4A 2VUMB 1MW1A 2VMDA 1SLWA 1CSQA 2FXQA 2IHEA 1E6JL 4B95C 4BGDA 3HW7A 4P9MH 4PJFB 2ATKA 3TA3B 3WHXA 1X5YA 3CMEA 1YYLH 1F6AA 4LUOA 2OTLA 4OLYH 5L9DH 1QLEB 5IVXA 4J2QA 1V1PB 5IY0A 2XQBL 4B7LA 2JLPA 4I65A 1RHPA 4A3MB 1CBJA 2O5XH 1VACB 3FF7A 1AVAA 3H4HA 3HKFA 2BVPA 5HDOA 4PS4H 3V5HB 5C8JB 4IJLA 3K81A 4Z7UA 5JPNC 3P3SA 4X5RA 3LXBA 1Q9LB 1CLZL 3QIWC 5DTFB 1CG9B 2ZM6Q 2ZXDA 2HUGA 3W81A 1GXDC 4DPRA 1CD1A 4Y0GA 2MIZA 3CPFA 3RY5A 2XZAH 3JBG7 3BGFC 3PHOA 3UADA 4FNSA 3IVKA 5HY6A 1F18A 4U49A 3BYYA 5B1AB 3KJ6L 4XCYA 2BOCA 1IAIH 3S4SG 5DM63 2CRIA 1BVKA 3VW3L 4WFED 1NSNS 3NQIA 2N7AA 3V2AR 3TWCL 5DQDL 4N9TA 3L1GA 3UPCA 2BSSA 3IDMB 3RU8L 3OSKA 1E40A 4LIQH 3GSXB 3QDJE 5CU5A 2BDNA 2VW4A 1RIHH 4HZ1A 4PWJA 1ZTXE 1NR4A 1PZ2A 4HMIA 3APDA 5D8JL 1YHQA 4DV0Q 2JB6B 4NM8H 4OQTL 1BX2A 1RJYA 3HNSH 4LK1C 1JOKA 25C8H 3FT2B 3RJOA 3CU1A 2KCNA 1S5BD 1KGXA 3RX5A 3IE9A 1U8QB 3BX7C 1VQKA 4XMLL 3UBGA 3EFFA 4TMPA 1ZE3H 1CFTA 4GBXD 5CBAB 1PAMA 1I7TA 3D4GA 3T6QC 3A7AB 2A9MH 1ASOA 5AJ3Q 1WBXA 4LOEA 1ZGLB 3A54A 3QXAB 2X3AA 4GRLD 4FQLH 1PG7X 2WIIB 4C55A 3Q5TA 1V43A 5GS0D 3LKOB 1TG8A 3A22A 1S3OA 4W9KC 3SJVD 4Q6KA 3RGBA 5JR1L 1NBYA 1MW3A 4HVBA 1LEGB 3JWDH 1DBML 4K3HA 1BAFH 3WDJA 3L4VA 4ES8A 3HS0B 4MS8D 1A3ZA 2FSDA 4UQAA 3HZVB 1TPXC 5J12B 1EEZA 4DK6C 1QLFB 3RLNA 4CBVA 2E2IB 3RDTB 3I50L 3BGAA 4L5QA 1MRDH 4DPCX 4TNWF 5MEOA 5AVXB 2QFPA 2D62A 3VSQA 1TR5A 3U4AA 3EYUL 4HXAH 4IPCA 4JPWH 4XN1A 4JRYA 2F53E 4K94L 5C92A 1KWKA 4FDWA 4QPEA 1E3PA 1VESA 2KLSA 2A19A 3URYA 2Y5TB 1MCWM 3VGAC 5GGTA 5I0YA 5JW5B 4F20A 1UXMA 1A22B 4AE0A 2WLKA 5DJ6B 3RUGE 4ZOCA 3QXWA 1D7FA 3AQYA 3DIDA 1ZS8A 5I71B 1ND0A 1DO5A 2BMKB 1AGFA 2EOTA 2BNQB 4KX9A 5TQ0L 1TEGA 1UD4A 4CBZA 4LQFH 4NQCA 2EIEA 1RIPA 4R4OA 3JTSB 5EBMB 4D0CB 1VFOA 2PP9A 2B7DT 1AGBB 1KPVA 2CDEA 3KCPB 4KK8C 4B53A 1HHIB 4TL4A 3WS6C 2XQ0A 5J3BA 4XDXA 1RU9H 4DK6A 3N40F 4DFAA 1D2OA 5I5RA 3O41B 1RZIA 3CC5A 4NWUL 5JQ6H 2F03A 5AD0A 3A6OA 1IBDA 4Y4FB 1PCSA 4Y19A 3MACH 3SN6N 2QILA 1OAXL 2GSIB 2V8MA 2MRYA 3V7AE 1P5UA 2NVTB 3HC0B 4B97A 3ZOAA 1IC1A 3DX6B 1NEZG 3CXDH 4BWWA 4NIKB 4DUXA 2AJ3B 1U92B 5JHDD 1E4XI 3KS0H 2PQAA 3FCGA 4YWGH 4A3FH 3KLHC 1T1XA 1E7UA 2UV3A 3UL4A 4P2RD 4KHXH 4RGNB 5TE6L 1F2QA 3VWJA 4H44C 2F7RA 12E8H 2YMXH 5DSCA 5CILL 3SDAA 1JFHA 1MF2H 3CDZA 1PZAA 1TZGL 1XF5B 1TO4A 1OZTG 4TKOB 2A6IB 1V27A 4XO3A 1H95A 3E6ZX 1GZHA 5DWUL 1ZLUH 3S36H 1PW3A 3F00A 4CVZA 2VWEE 3RVWC 2WXRA 1J5EQ 3QNFA 5DJCB 4OTXH 3IN2A 1VQ9A 3ULSA 1Z1WA 2PMZE 1EHKB 1WBZA 3ABGA 4LFHD 1Y6NR 2IGTA 3K3QA 4A6YL 3ZQ9A 4D0BA 5EN3A 4GSUA 4Z76B 3BFWA 2XBZA 1ONQA 1D6EC 1MRFH 3HKZB 4W9LC 3M4OH 1IILE 4N2EA 3KPLA 2W1NA 3MX0B 5F2DA 4M7JL 4HH9B 4EDWH 3AS2A 3OQRA 4M93C 4JOIC 3I8ZA 4YJZL 2QSCH 4M5ZL 4U1KB 4O02B 4AC2A 4GZYC 1EO8H 5HGAB 4PJBF 4CC4A 5IJBC 2QTEA 3FKIG 3C5ZA 3E8VA 3FO9B 1OO2A 3L3JB 2CO2A 4OV6F 1DEEA 4RZKA 1Y0LA 4NOBA 4JI7Q 2UXDQ 2DQHL 1U95B 4XC3H 2BNQD 2R7EA 4DPAX 2KL6A 3EJRA 4KPHH 2DL2A 3KPSE 5ICXB 2ZJRA 4TYUA 1DDTA 4IOAA 2VDNL 4MQXC 3REVB 3QFGA 1CICD 3KBXA 1B3JA 1ZHBB 5BW7A 5AB2A 2BP0B 4Z7OE 1IBLL 2PTVA 1JK8A 3K6IA 5CGBA 3QJFA 4ACPA 4XWGH 2B9AA 5CEXA 2WSPA 2CA3A 2IWKA 5LWYL 2ATPB 4RMTA 3G6DH 2VISA 4L4VD 4U6HA 3RE0A 4FF1A 1KPUB 2JA6G 1IZ6A 3VFWB 2FR4A 3MOQA 2BOBA 3N1FC 3IKKA 3A56A 1H9DA 4GW4B 1X56A 5I8OL 4MTKA 2QSQA 1CG9A 3AABA 3KJ4C 4NN7C 3U9UA 1XMOQ 1OTSD 3VYRA 4BY1B 1Q9KB 1E9PA 1LO4H 3RWJB 4ZFGL 2GC7C 4XPGL 4S0SD 1NZRA 4DAYA 5I2XA 4HJ8A 1BBXC 2NVXB 1FNUA 1AMYA 1RURH 2DICA 4K8JA 4POZD 4RAVA 1E27B 4JO4L 1WA0X 5NUCA 1XTMA 4JRWA 1UWVA 3O45A 4X8JA 3RTLA 3ULVC 2J1KA 3L2NA 1I1FB 1UWXK 2BMKA 4N26A 1PY4A 4A68A 1J05B 4EJ1C 1FRGH 1HQMC 4GFXA 4N0FB 3FQXA 3FUEA 4Y7OC 2B2WC 3K8LA 1HH6B 3BSHA 4OUUA 4D0DB 2WSDA 5IHUL 4PCSA 2NVTH 2EEXA 2QV4A 3T4AA 3CC2A 4JFXB 1JXGA 3MFGA 4F57L 2IQAA 4P5TB 4M3JA 3BOVA 5AD0B 2F8IA 1LTSD 1UUNA 3L1OH 3FPPA 3Q05A 2L0CA 4LF7L 2OJZH 3S17B 2V2TA 2Q8BH 3ALXA 4LSDA 4WWNA 4ZW3A 1KCBA 4F9LC 4UB0H 3U2SA 3ILPA 5I30H 4C3JB 1VCIA 3L4XA 5KJRL 3CLFL 4I7AA 3AADB 4LFBL 1QVOB 4Y4HD 4XBMA 5FM4A 2QADD 4LLMA 5GJTH 4H5SB 4L9LB 1KYAA 4WFFE 5KNBA 5LMNW 3ZHDA 5CAYB 3CBKB 5EZJB 4JFZH 5GADC 1YG9A 2ADIB 3RLOA 2JJTA 4RBPH 1QNUA 1JZDC 2OL3H 3T77A 1YNLH 5I82A 3WIIL 3RX8A 3BZ4A 5INCB 2VQTA 1VIWA 2NZ9C 4YZFE 3LHPH 4XMTA 1Z9PA 4Z3IA 3UJJL 4C4UA 1UXSA 2V2WA 4P59H 4XCNA 1MUJA 1D2BA 5FGSA 3VU1A 4QB4A 5FLXE 1TQBC 5EKKA 4K9EL 3RILA 1MREL 2ETWA 2HN7A 3QUZC 5C9JA 5CCKH 4BE5A 3P9LB 3KEDA 5HJ3A 1H9JA 1BLNB 2CM5A 4N4YB 5E8NB 3MGAA 1EHAA 4F2MB 4IKIA 2FJ2A 2E7MA 1W0WA 4DN4L 5EF2A 4XB3A 1I5FA 4O4YL 3AMLA 5C0BA 4Q8BA 3EHBC 5EPMA 3RNQA 5BR8L 4PJGA 1AOZA 4OM0H 3K6SB 3ZTNH 4LF6L 1OGAA 2R92B 2FO8A 2E56A 4MDJB 5IESH 3NDZE 2Y9RT 4JKPH 4UM9D 1XGPA 3OXRA 3FCSA 2AXFB 1QOHA 1CXHA 1DFXA 2A99A 1AQMA 5AAWA 3FHEA 4OJAA 3LNNA 4PV9B 4R96A 2ZOUA 4OLXH 5KUKA 5AZ2H 1C5BH 2V0AA 1CGTA 5K5PA 2A5HA 3B9KB 4HIQA 2PYFB 2HH0H 2WV3A 2ZOOA 2D7QA 4LSVL 1B3AA 1YNKH 4P2QA 3KGTA 4RA0C 4MD4A 5CFAA 2D0FA 5F6IB 2NY0D 4JFDA 5CSZA 3INOA 1MHPL 2VDRH 3HG9A 1CK0L 4R97B 3L7FB 1XX9C 2G0KA 2PYEA 2XVKA 2ES2A 5KYWB 2JK8A 4PWHA 1IKLA 2M26A 1OAUL 2Q2HA 2H0FA 1CGWA 2X2IA 1EDYA 1NCGA 1XD0A 3CZGA 1KEGL 4DKFH 1QZ1A 4G8GE 2BNUA 3GI8L 1JDCA 4XQNA 3WFEL 4FFYL 2VITB 5LL6X 4QRQB 1ZGLA 1P4IL 3D85D 3I3DA 4B3VA 5I1CL 5D3IB 1MFMA 2EZ0C 2ZUQB 1OCWH 3ZE2E 2E7LC 4XTRD 4ZODA 4G8FA 2B16A 4A3EG 1WC7A 2VDPL 1J8RA 3O6LL 3U48A 3VI3F 2XTJE 3QIAA 2NCMA 4GG8B 2F18A 2ZKHL 2EPBA 1SYGA 3LIZL 3CDFA 3O4OC 1D5IH 1FL3B 2X4UA 2HIXA 1ZLVK 2AGJL 5HGTA 3PUCA 3MLUH 1LT3D 3IJ8A 1E24A 3KOJA 5CV5A 1G6ZA 1NCBH 5C0JA 4A3GH 2XV3A 4LL4A 4RETB 4A7GA 4N6QA 1MIML 2XZCL 3IAQA 4A76A 3QUMH 2VDMH 1CGSH 1JE5A 4GH7B 5DHVA 3TA3D 4UQDA 1LP9A 1N59A 4L05A 4JCVE 1M3IA 1NIAA 1YC8A 2FB4H 4FQ1H 2YD6A 3MV7E 4LPTA 1UENA 5D2LB 3RZCC 1ETZB 4DGIL 5MERA 1DBAL 3S5YA 3RURA 1S9VA 1JYWA 1VA9A 4FYDA 2EILB 2ZXPA 5HDLA 4Q2ZA 5F8RC 3DV4B 5CINH 5KVFL 2R8SH 1JZ5A 4IUUA 5JEAG 2O5IC 3T1WA 1M3JA 5KBNC 4X62L 1R34A 3S98A 2CLVB 4ZNEA 2ERJB 3K59A 1OWRM 1SYVA 1AFVL 1T7ZA 3ZYIA 5SX4I 1LO0L 5C4ZA 5FGCB 2ITDB 5KVFE 2PI2E 4DZ8B 1FGNL 3BZ4B 1E7ZA 2R61A 3D48R 3HI5L 3PIQB 4OSUL 1I94L 5INCA 2V4LA 3O6FC 3P4MB 4YL9A 5DI8B 5HGGS 4F8NA 1ULVA 1EGJH 4YHYC 3DPBB 5DLQE 2NY0B 1UB6A 4QF1A 3S9DB 3L3DA 1YJ9A 3C8DA 4WJ4A 3R4RA 1Y8OB 2ZJSL 3TT3L 3MCLL 1G7JB 4Y2OA 5IBTL 4RFOL 3PWJA 3VFOA 4J39A 2WQRA 4GG6E 5I5MA 1SHMA 4PEEA 5A2FA 4PB9L 1JGUH 4QTIL 2FH6A 2YSSB 3V0WL 4BSJA 3TT1L 3S15H 1J6QA 4H20L 1BQHG 2R1WB 4OF0A 3AMUA 4NX0A 3HOVB 1RHHA 1FFQA 1NCWL 1HZKA 1N9WA 4U1GB 1JB3A 4Z7VF 3ULVF 3NZHL 4XCCH 4Q97A 1RP9A 5KOMC 1I4FA 5AVSB 2ZCZA 3FCSB 5DK0A 3FT4A 1J1OL 1YHPA 1ZPLA 5E2JA 2EXZA 5FCSH 2NY5L 5LGHL 2X3CA 1PX8A 4Q4EA 3GYRA 4AQ8A 4ZFFA 2JH2A 5AVWB 3TVMB 3LZPA 1BKBA 2IPKD 2Z9TA 4ZAIA 1Q46A 5TH2B 1B4OA 1RZ7L 3MBWA 4Z76A 3UZEA 4A4IA 4P57B 3TIEB 1KGUA 4QGTA 3ARYA 4C4BA 1KC5H 3NTIA 3HE7B 3HAEG 4DR2L 4PY8J 5ICYB 4PJHF 3L8QA 3AROA 1CLOH 5DYFA 3BFOA 5ENWA 3C6LC 5ANME 1NJIC 3TTSA 4XNZB 2WYTA 2EVGA 1CXFA 5EZOL 1CDYA 4FQPA 4OHJA 4AYFA 1PFNA 3L3JA 4G8IB 3DGGB 1DHKA 3MRHA 4A6YA 4OV5A 1B53A 4FN0A 4X6CE 3PF5A 3DBXB 4DV1L 1UOKA 2HT1A 2B3RA 1H19A 3V6OA 3JZ7A 4PJ5E 1ITCA 2RALA 2J1YA 3QRLA 1GGIL 2O5JC 2QQLL 3T6VA 1QUPA 4P49A 4W1TA 1K5WA 2XKNB 1GUTA 3CRKC 4NT6B 3DO7B 4MMXA 3JAMi 1YMME 3APMA 5HTSA 3OV6A 4GNXA 2EZVA 1MSHA 2NY6D 2VXQA 1JZ6A 2VSDA 1VQJA 3IYLW 1KABA 2FECL 2X4QA 4IMLA 3O8XB 4ZUSA 1BMWA 4CVWA 1ZEAL 3OAUH 5ALBH 2LV4A 4M29A 3S1NB 4PJ9A 3FRPG 2FNWA 4BZ2A 1ZVHA 3VAEA 5JUEH 1A6PA 3CAFA 4P3DA 1T0NB 3VGHA 2VXSL 3RWEB 2IOIA 3NN8B 2OQJA 2KHSA 1W2KT 4KH9A 5E8PA 3ROOA 3H3VH 2PYED 3ARED 2DYRB 1WCMB 2FWOB 2DYPB 4A39A 1JJ2A 1E9QA 1KT2A 1PQZB 1ZK9A 3TRZA 1DEEB 3O8XD 4MGXA 3UG3A 1ESOA 2NW2A 4KRNA 4FXGC 1BCPC 1U4RA 2YD5A 1FZKA 4L4JA 4ZOEA 1XXFC 3RQ3A 4AK2A 2FVNA 1PTOD 2WKDA 1I1FA 4PSPA 1B2WH 4C83A 3L1FA 3HMXL 5SWQA 1B9KA 4RAUB 5DJXB 5DHMC 4BWTA 1FJ1B 5A2AA 2MJWA 3AB0B 4DKEH 1Z2KA 3I72A 1UGNA 1W91A 3TASA 3EH5B 1Q72H 2IPUG 4UAOB 1QI3A 4YHOL 2ZUTA 4OVVA 4GRLA 1OP5H 2XWTB 2DWYA 2IPKB 3QSKB 4WKXA 1UHVA 5J56B 4HS8L 2FH8A 4X9HA 1O78A 2OTUB 3EO9H 4OJCA 5JW4N 3LD8C 2VJ8A 4RMWA 4X64L 3BWAA 1CMOA 3JWDL 1MVUA 1G7MA 3BZFA 1PLGL 2P1YA 5CZVL 5COYA 3QUMA 4Z7VE 4WORA 5KSUB 4JN1L 4BKTC 5E2TH 2L8AA 2QQKH 2Q2LA 3ARGD 3I50H 5C44G 4DP8X 1VPOH 2ZXWB 3BH9A 1BIHA 2CDFB 2DOCA 4FQJL 4JHWL 3W57A 3HNSL 1I94Q 1PS3A 3ZDWA 3GXIA 5IMOA 5IB1B 3C87A 3IF1A 3SQBA 2MPVA 4KKAD 3MLTA 5LCVL 3UG5A 4M9PA 5T1KD 5T1MB 3VXUE 5DHEA 2FSEB 5CJXC 1JI2A 2EIJB 4X9GA 5T5FL 3UAJA 5HVHB 2XPGB 1CJYA 3T13A 1XF4A 3JVGC 3A4AA 2ZKMX 1RZFL 1IAII 1N3NA 2G5DA 4LUVA 2VR6A 5D7IF 4DK0A 3Q6SA 2J1WA 3UXFA 1VFBB 5L8LB 3N1PC 5FHAL 3ARFC 1EGJA 1PTZA 2V7NB 4YSEA 1HOCB 1LLAA 1RUML 4PGDB 4LHUG 3JWNH 4GO8A 3VFPA 3VFNB 1S7VB 3FU9A 4M6NH 4GLRH 5IBLC 5MERB 2NVQB 1UYWL 2VL5B 2X6MA 2JIXD 3RIFK 2HRPH 2WWKO 5JHDE 1I6HH 4JY6B 1NANH 3CSPA 3TBYA 1XGTA 3N41F 3MFFB 2IFGA 4L8SB 2K6ZA 4R7XA 4A37A 4XBPB 1S5ED 1J48A 5F7DA 1D7CA 4OFPA 1GHFH 2QKIA 1F2ZA 4TQ8A 4LOVA 1JZ2A 4OIIL 4GXVH 1FLRH 3UTPE 3DBXA 2VDQH 1XXGA 2BHYA 5EUOE 3R1GH 5I1AA 4HMCA 1RPKA 2JIXB 4X5XB 1XVSA 4QI3A 1KTBA 1MCOH 4MA7H 4S1SL 4XVTL 2BVQB 2DEWX 1KF9B 4FG6D 4X6BB 3WE6A 1OF2A 1MSGA 1QFWM 4N8FA 2JI2A 5AAPA 4KNSA 2WCPA 1GHKA 2OXHB 3FT3A 4Y16A 2P5PA 3L7FA 1C16A 1U6AH 2WAHA 4KHPL 2WOBA 3Q01A 1T7WA 1BZ7B 3S2AA 3HZVA 3G6JB 3DC0A 4Z9CB 4KO7A 4PJ5B 3WNMA 2WZ6A 5CEZL 1BWWA 2CQAA 4N8UA 4DO5A 1G87A 4H8UA 1HCFX 2R1WA 4A7QA 3TBBA 2X38A 4B9FA 4ZPTA 1QD0A 4G8GA 4IMKC 4OF3A 5C3TA 4M8RA 2JWYA 5T1JA 1P0SE 1RJZA 3HN5A 4JFDD 3ILQD 3GM0A 3QFJE 2GI7A 3GIZL 4CDFC 3MLSL 3DM1A 2H9GA 1KJ2A 1SROA 5E5MB 2AAAA 2WKOA 1BF4A 1J9RA 3OKMB 1G9MC 1UT9A 2OL3A 3I4MB 3FYIB 3ATEA 4YHIA 4JQXC 1X5XA 4AY0A 4AEEA 1SNDA 3JTTB 4LEEA 4BDVB 3OLDA 4RAUA 5DJXA 1G6PA 4NO3B 5I23A 1NBCA 3WLWD 4RDQG 2AJVH 4BQBA 1O7IA 1TFHA 1LTXA 2IANA 2QADC 3K5LA 3MV9B 3REWB 3GMOA 1JNLL 2JB6A 1KPVB 1C12B 2NT1A 1I7ZA 4LLDA 3WY4A 3QZNA 2DJFC 1FNWA 4AC4A 1JBJA 1ZHKB 2Y7NA 3NP4A 4AM0A 3UDXA 2D0HA 3ZKND 4JR9H 1HHKB 1ED3A 3BPLC 1EDHA 4J3OD 5ESQA 4KN7C 4NQQA 1T3FA 3QQ9D 2NXYC 2VDLB 3VXSD 2BZ7A 4IMKA 3LKRB 1SSOA 3F04A 1F2LA 4XWGL 4N90E 5LAPA 2PWGA 3HAEB 3ZO0A 3W82A 1VFUA 3MXUA 1CLYL 2EKSB 2VRQA 3MKKA 2LABA 3NFSH 2OCJA 3CX5J 5IHLB 1Q82C 3AQXA 4YC2C 4Z5RA 1PH3A 1A6ZA 1QTYT 5FEBA 4FKKA 4ZTPL 2VN6A 5D7JA 2HFGL 3FTGA 4LARL 3RWDB 1JPTH 5FO2A 3OAYK 2Q0ZX 4GNXB 1NCIA 3CWGA 4X42A 4HH8A 1KGIA 3IXTB 3HMWL 3PNWA 4JDEA 2CLRA 3LKPB 5C0EA 5CF3A 2WPGA 4YSRA 1TS3A 4FFZH 4N1HB 2H4OA 4YBQD 3P4MA 1ZT4A 5FAAA 2XVSA 1KELH 2VLKE 4KX7A 1IL8A 1NUCA 2XG4A 4MXVE 2GIYA 1S3KL 2V2XB 1U8IA 1CD8A 5C5LA 4JFED 4OI9A 4QRPD 3K80C 2VDNH 3NCFB 1ET7A 2IAND 4L6TB 3N1GC 3QZWB 4HT1L 3GHBH 2UUCQ 3G9AB 5T5NG 5IMKA 5BZWA 3J07A 5GGUB 2WO2B 1P2CA 2XFGB 1OGTA 1S7WB 1XEDA 3CFQA 1CKOA 3PV6B 3VFPB 3ARFD 3KDFA 3CIQA 3E9IA 3ARQA 3QO1A 4P06A 5ICZA 2CHNA 3WUWB 3EFDL 1JMCA 1L4IA 1ZE3C 4KK7A 3FCUB 2K1BA 3NELA 4ZMLA 3FB7A 3FT1A 2CK0L 3HR5B 4M6MH 1SAPA 3FSVA 2DY7A 1T7VA 2X4PB 3E3XA 4NQCE 4L4VE 3QPXL 4AYBB 4IRJD 3A24A 4KX8A 5LAXB 3OGCA 5IODA 4RMRA 1A1MB 3O0RH 3CVHA 4Z7OB 2R0KL 1ZTXH 3MNZA 3EGXB 4KKUA 3ZZQA 1GJIA 2H3NA 5DTFA 3Q23A 1A8JH 1RZIB 3CC5B 1SYCA 4U33A 1W8OA 4IFDJ 4JFZL 5HHOA 2NTFA 3EAKA 3FQ1A 4AUYA 4UQ3A 1L0WA 1NMAH 5C0ND 3HOWG 4HYTB 1TYJA 4Y4KD 1EK3A 2J6EH 4OZ4A 3I9GH 1GC1L 1OW0A 2WZ0A 5I73B 5E7NA 3BRDA 1BQLL 3VX1A 4A3KG 1ZKAA 3DX1A 4FQHA 1JOIA 4XODA 3WFHA 2VLRB 1WT5A 4E41B 5F9JB 3QS3A 3BYTA 5KJ4A 4GXFA 5JTWA 3DJZA 5G2NA 2P44B 3P4NA 3WKPA 3BDCA 2JA5H 2AJSL 5F9WC 2B2TC 3UMTA 1DSFL 4WWKB 2VUMG 2BSRB 2E5LQ 2IVFC 3E6FA 4I0PD 2AK1L 1BM3L 4NENA 4JQIH 1JHTA 2F7OA 2Z1KA 3BHBA 5GSRA 3A5UA 4P9HL 2UUBQ 1PZ5B 1XCWA 3ZTJH 1N3NB 2LXKA 1ERNA 3EO1B 1J0IA 4DGUA 4MNOA 1WG3A 2OR7A 4A3MG 4LLQA 1YEIL 1N4XL 2ZTDA 3CG8A 1LP9E 2JJQA 1N2RB 4HX1A 5EORL 5JPNB 3B7TA 4MNQB 3ZTNL 3SDAC 3F7LA 4K8RH 1E27A 1TYRA 1G2TA 1R4XA 3DXAA 3DPDA 4L3CA 5FGBA 2YWYA 2YKKA 3GSQB 1P7QA 1A6TB 3TZVC 5HHOB 3DHJA 4FQIH 3RWFA 3O6ML 2RHSB 3L4YA 1B9ZA 3GMOB 4J3TA 1FAKT 2DWTA 4LHQB 4W9ZA 3UJJH 4MZRA 1EIGA 1D5ZA 1DUZA 4XPBL 3KYMB 3SBWA 4GQ9L 3S4SB 3WNJA 3DNKA 3VQ1C 3QW9A 3IDIB 4GJTB 3L7EA 2WUCL 1UM5H 4MNGB 3D18B 4DCQB 1TQBB 2R7ZH 1NEPA 1SMYD 4A7VA 1TETH 5I24A 3J80L 4P9ML 1A02N 3SDCB 1XF2B 4MA3A 2DYPA 3MOAL 1RH8A 4Z0BH 3E0JA 1XO8A 1AEXA 3L5WB 4KK8D 3ILPB 3IFDA 1WTWA 2BZCA 3B8SA 4PJ7A 5F9AC 5CEYB 2JN4A 3K2UL 1AZZC 2Y2TA 5ICXA 5DLLA 3L9YA 2DLFL 4GKNB 3V4LA 2G75A 4DK3A 5IESL 2NY1D 4JKPL 4K2KA 1EY6A 3IXTA 1OE1A 5I1CH 3QNYA 1L9RA 2YPKB 3ZSSA 2V5YA 5FIEA 2P3YA 1E5YA 3CLWA 4J7RA 4IJHA 2KZ1B 4BFRA 1BVZA 5A2KH 1A6AB 1VACA 2EO7A 2F53A 4B3SL 1C5BL 4JVWA 1B88A 2HRLA 3VFWA 4MQ7B 3PGCA 1XIWA 1KB3A 3GRWA 5JHLH 3QUMB 4RCNA 1VQPA 3EHBD 3DTXB 2CGYA 2EP6A 3CW2C 4BKLA 1WTLA 1TPXB 4MNGE 2G3NA 4OLUL 3W39B 3CRLC 5A2QL 2R92G 4QGUA 1Q9KA 2Q8AL 3HHRB 4DP2X 1QPPA 2LOEA 3UC0L 1LABA 5ITBL 4YPJA 4EI5D 1L3WA 1V1QA 2WVVB 3DGDA 3GKWH 3V0IA 3LVTA 2OULB 1H6FA 1JS4A 1YMHB 1J05A 3X3GL 1AD0A 2Z6KA 3ND9A 1BXTA 3ERXA 3MBEB 4BH7B 2C9RA 1EZLA 5SWQB 3KYOA 1LK2B 2YAFA 3HPJA 1UKTA 4GMSH 3CVCA 4Y19E 5EN2B 4OXPA 4JHAL 5DSCB 4IUVA 1ZLVH 3D9AL 4FXLA 4YSCA 5IEHB 2X6GA 4PGBB 3NJLA 3ATBA 1Y1VB 2ZUQC 4LCWA 2K3TA 2GFBB 4GRLB 4GSRA 1CL7L 1ES0B 1MWOA 2CCWA 2YXVA 1HKFA 2VIRA 1BEYH 3OTOL 1JV2A 4Y16D 3GSWB 1IO4C 1ZDSA 1VQ6A 4TTGA 4ANVA 1WF5A 5FW6A 4GKJL 2BHUA 2YPLB 3RIFF 5A3ID 1FN4B 4KXZH 5C07D 2W0FB 4A2DA 4JZNA 5E08L 3QORD 1NFDE 2D7MA 1BQHB 1HE7A 1RL1A 3NSJA 1R47A 2EYLA 3U1PA 4EF3A 4NBXB 1XAKA 5HI3C 3BU2A 1I7RA 4ZO6A 3T3MF 1AIFB 2VR9A 3DX3A 3IFOA 4AVIA 3ZTJG 2LW3A 1FFOA 2Z31B 2B8FA 2IQ9H 4AZUA 2VQEL 3LKOA 5IUCA 2IAMD 4KGLA 1E4KC 1F4XL 1L5GA 4JFQA 2EXSA 4DP6X 3FO0H 3CFJB 3OPUA 5CJQH 3RA7H 3NMEA 4QNPE 5HP5A 4IDJL 1CT8B 3TWYA 43C9B 1TWCH 3DTUB 5A3IC 4MIUA 1PCXA 2ID0A 2JIXA 1SN8A 5IGFA 2WP3O 2NDFA 1WA2X 5CLXA 3TC9A 1XF3A 1TQCB 3QZWA 1NCWH 3LN9A 1YECL 4UQ2A 3HPLA 4OJFH 4D9QE 4RKLA 2V5SA 3SZKC 4FEIA 2W38A 3WS3A 1HNGA 1BBDH 2R59A 1UACH 3EYFA 3FFOA 1UFGA 5I19L 5L6YH 3TN0D 1P4LB 2WXQA 1GC1C 2OR9H 4S1RH 4DPBX 1P4BL 2XJLA 1IGIH 3NSYA 4N2FA 1EGJL 5HHME 4DO4A 1G6RL 3QZWG 1NCOA 3UMNA 2AK4E 2WWOA 1LEKB 1NC2A 4KTGA 1OP5K 3QDJB 5CLWA 2AXHA 4C3IB 1I1AC 2OJEA 2BM3A 3WMSA 1FNEB 1B3QA 5IOCA 1RI8A 5EU3B 3IXAA 1LP9F 4IIQA 4P2OC 2Z91B 5B4MC 5IGGA 4R8IA 1AZRA 3CXDL 4N1EA 3LPPA 3SYCA 3TYFA 2J1ZA 1AGBA 4XNYL 1W6KA 1S9YB 1I8KB 2CO3A 5CP3A 4LAQH 2B2UA 5M9OA 4G5AA 4U0QB 1X9UA 3PP4H 1O7YA 3QZMA 1SNQA 2Z92B 4LF4L 2B4CH 2KC0A 2R23A 1KSRA 4PBWD 2UXCL 3TBCA 2JJWA 2D0OA 1XV8A 1UGKA 3FRPB 1ZA3A 4OGAD 2G3MA 4AGOA 5CILH 5M3MB 4CJ0B 1M56B 1TZIA 4KI5E 4X9BA 2VLRA 2MQGA 5JOPD 5FK9B 2WXPA 4XPAL 4RBPK 4DZ8A 4AV5A 4HSCX 3IGFA 4WU7A 2BNQE 1FVCB 1A6AA 2VXQH 1AW7A 1YIJA 2HX7A 4JBKA 3IN0A 4GIPD 5KYYB 3TS8A 1MVFA 4Z3JA 1A3QA 2WGXA 4W68A 5DHYB 5E2VL 3KWUA 3D3VD 2ZCHH 5CR1A 1NLBL 1K83B 3DX2A 5H8DA 4XPFH 5DC2A 3BN9C 4NFDA 3ZMNA 4ZX4A 3ORJA 4H0LC 3NPSB 1UVQA 2C3HA 3WJMB 5CJ8A 2VITA 4U3XA 3V4VA 5DFWH 2GCYA 2Q6WA 3WJJA 3G6JE 3W38A 1Z9NA 3RYMA 5BZDA 3GO1L 1CHQD 3CHOA 3SVMA 4BEIA 2NNAA 3NK4A 1YY8A 4GG8A 1FORH 4JKMA 4PG2A 5IQMA 1T1YB 1E6OL 4NQXA 5I0XA 5CKAA 4DV4L 2J4WL 3I9PA 2IEPA 3F83A 3QUKB 1XQ4A 2D4DA 1SDFA 1EO8L 1K5NA 1YN6A 4H8WL 2UZYA 4WWPA 2P43B 4EI6A 1T6WA 5JHDB 3UI2A 1DUZB 4QR7A 4PJIE 1D5MB 1LM0A 4EI0A 1CI5A 4GAGL 1HNFA 3KJ4B 3LX9A 5AWNH 3L13A 5ITBH 2VZTA 2O30A 4X5PA 4S0TD 1IFGA 4ANWA 3RZOB 2AV1A 2RBLA 4KH2A 3QIBB 3LTVA 4WTWA 2Y4SA 1YUKB 2GHZA 1ETZA 3EDFA 5C09B 4NKDA 5JHLA 5TFSH 1EU4A 2MO1A 4XR8C 1OPOA 2QELA 4PJ7B 3ES6B 3ZYJA 4RRPA 1G0YR 3GNMH 4P5TC 3HE7A 2ZYHA 5D7SH 1RZJH 3MRCA 5E70A 2P8MA 4G5ZH 1FJGL 3ARDC 2XSKA 4PIRF 5DJAB 2KDGA 1EIHA 3AG1B 4P46B 3Q48A 2Q86A 3KM1A 4ZQTA 3C2AL 1CO1A 2NX5D 5MP6L 1PMRA 1GGBL 2BPBA 1F00I 5DJ2A 4QHKI 1OK8A 5C4XH 4FP8H 1ZMYA 4K94C 3DWTA 1N5YL 3VRIA 2R93B 1KC8C 5LMNQ 5LBVA 2XRSD 1AQDB 5KSAB 1EMTH 3M1OA 7FABL 1H3XA 4LOUC 5F7EH 2IGLA 2A6KB 2PR4L 3B7UX 1LVEA 1UXWA 1O7VA 1M4VA 5IT9E 1F3RB 1BOGB 4A63A 5JIMA 4WSGA 4D9LH 2A1WL 5IVXB 4UAOC 5TJWK 4C54A 3QDMD 3VCLA 3INUH 2EDKA 4LSTH 5EOTB 3VB9A 2EYRA 3J81i 5FWRA 5AW4B 3GTNA 3SPIA 4X99A 1PZDA 2E59A 4NENB 4LLUB 5L2KB 5B3NA 3VVWA 1GY2A 5GQBA 3MUGB 2CGRL 1YZ6A 1X3QA 3A47A 3RBGA 5EDXA 3I74A 4FHKA 3UGUA 3ERSX 2QR0B 1CICB 3A67L 4NZFA 2D4FA 3KUPA 4IU2A 3IVKB 1OHZA 4L3FA 3LS4L 3VFVB 1SEQL 3F7PC 5HVWA 3V0FA 1JWUD 1JGEB 2ARJQ 5BVJB 4ELMF 2IQAB 3DI2B 4WI7A 3GXUB 3CIAA 3FB6A 2YTVA 1MI5B 3HJEA 4NM4H 3GV6A 1JF1B 4FQQB 4Y8DC 3II3A 4I3SL 4AQ1A 3HLAA 5I8CB 3KW7A 4WO4D 4R7VA 1MCSA 3IK2A 3WKMH 4S1SH 1AQHA 3VXME 3B2MA 3QDGB 2B08A 2EYHA 2EDQA 3KF8B 3F5WA 1MCKA 3VWKD 4BH8B 3QYMA 5JMOC 4F8TA 1IBGL 1W15A 4ABUA 5ISZE 2P9RA 2D2CC 5JDSB 4HG4J 1MREH 3EOAB 5IROC 4R97C 5F6HJ 3RRQA 3F62A 3C60A 1DQLL 4ZQKA 3BP4A 4L5FL 4OLEA 4IBLT 2W9DL 5CEZH 2ZUSA 5IHZB 2HFFB 3FUFA 3ARVA 3F05A 3L3OC 3BT2H 4JK1C 1UUPA 4DO6A 2Y6SC 3QDGD 3B9EA 2OI9C 3ZGHA 4XCNB 4DERA 4ZT1A 2X2YA 2X6LA 1JPSH 2K50A 4MWFA 3OX8B 5C9JB 2K6YA 5F0MB 4JM0A 3DVFA 3O4LA 4P5KB 3K0YA 1IAIM 4DF7A 1ZVSA 3GZQA 2YUWA 3PHQB 4GBXC 2BDOA 1KXTA 4X8XA 3QGVA 2NY2D 4LEBA 3ICEA 1N0LA 1QO3B 1TJHL 5C6TH 1NC2B 4JPVL 3WD5H 4UT9H 3UROR 3GZOA 3IKJA 1A9BB 3R7QA 2OYLA 4OZIB 4OLVL 2VWEC 5D7LB 3QEUB 3GTKB 5M5XH 2NN6I 4J15A 2PPBC 3MV8E 4UMGA 2AJZA 1CE6A 5DD6B 1TDQA 5KBPA 3N2JA 4JB9H 3FF8A 1CK0H 4M03A 2YRBA 3PL6A 3WEXA 1TS4A 3PFUA 3DBSA 1RD9D 4G6KL 1KIQB 4U7MA 3ABMB 3V9CA 4AGMA 1YMHA 4P5TD 2PW2B 1MCQA 4P5MA 1RQ5A 3KGSA 4R0LB 3LIUA 4YWKA 4L8SA 4F5CE 4KK5D 2I0QA 1E8ZA 2Q87A 3VXRD 1ACXA 1OE2A 1N67A 4CKVX 4AL8H 3O45B 3S2HB 2DQDH 3O3AB 4X8JB 3NESA 5KUMA 3T0WA 3S3CB 3VDAA 2LTQC 2SNSA 5TK4A 5GIRA 5IEHA 5F7HA 3D07A 5DEZA 1N26A 3U58A 3S1QH 1QR4A 3GRWL 2F7PA 2W91A 4MB4A 4WKZB 4QHLB 4MN3A 5F71A 1XGQB 1I85A 3IJ9A 3NRQA 4PI2A 4NUJB 4ZTOH 4U68A 2XSCA 5AVRB 4WO4B 3CFCH 4DQOL 5EIIA 4DUYL 4KTAA 5GISL 5IM7A 3DROB 1MJJA 1RLWA 1ZOXA 4YDLB 1F1AA 4XNBA 1W8NA 3PF4A 1J1XL 5IFJA 4WY7H 1J8HA 3CMOL 3WYRA 1RFDL 3ECBA 3PABB 4G8GD 4N2HA 4E9SA 3H56A 3GF8A 3L5JA 1I8UA 1YN7B 5IROD 1MIMH 2ERJC 5JOBA 3VWJB 2VSCA 2G2NA 4L29A 5EIIG 3DX9B 1ZYRD 4MASA 4O1NA 3NTCL 3BZ5A 2CUIA 5AFWA 2E7LA 2Y0SB 4W4OC 4UT7H 4JRXE 2NXYB 5DMKA 3FTXA 4ALAL 2RBMA 1MXGA 3GSNL 2QEJC 1QRND 4JHZA 3THML 1UZ8A 1C0AA 1A9EB 2B0SH 4OD2A 4PP2A 4CVZB 3VFSB 1KENL 4Y1AE 2ZUXA 4DGVL 4IIZA 3HAEH 5EBGA 2DLGA 3CN4A 3ZDZF 3IE4A 4EN3A 1X4XA 2HFGH 4LARH 1N32L 5B3JF 4B3EA 3PQYD 4IYKA 1U4LA 3LN4B 5C0AE 4LL9A 4F2FA 2EC8A 3ELQA 4PGDA 4TVPE 5TE7H 3W0WD 3O3EB 5CR3A 4LPVA 1BPLB 1FYTB 5BUPA 3L3IB 3WHE0 4P74A 1QBLL 5AW3B 3CSBA 2Z64C 4WUUD 4XTCS 1F97A 3HIZA 1SJEB 4OSUH 3TVMC 1NMAL 4APQD 2SEBD 1J7VR 1D5BA 2C3VB 2OMNA 3IMWA 4PJDB 5DYOA 4DEPB 4X7CC 1E8YA 4DR7Q 2XIDA 2XKUA 4RGMC 3RDTA 5I16B 2Z35B 2X87A 3R7RA 1OB1A 4OO1G 5KS9B 1JG9A 1ILSA 3W0WB 4JHUA 4P3CH 2Q8IB 4G80B 3GXPA 4Y4HA 4NKMB 1P7QD 4OU3A 5KYXA 2OK0L 2F0HA 2ADFH 1YY9D 2M8XA 2WN3A 3AXHA 2FWOA 1KGWA 3V0WH 3VJ6B 3TT1H 4JE0A 4LHUD 1V8QA 1UB5B 1TQOA 5ESAA 5IGXL 4QUOA 4M4PA 1R33A 4YHHL 2JXMA 2XBDA 3BUPA 4PJ8C 3G71A 1HFGA 4ANKA 2UZXA 3HC4H 1F3JB 4F7MB 3PHQA 5D1ZC 1IGMH 1B50A 5D6CA 4U1JB 5C7XL 2YA2A 4XP1H 4L3EE 1IC5L 3UTPD 1L0XA 4P72A 1S2EA 3MNMA 2H32H 2J8OA 2HVJA 4GAAA 4E5XG 5B7FA 3BVMA 5T1LA 5IP9H 1RZ8A 2YN5A 4NDXA 4NZRH 3U30B 1VQ4A 3BAKA 1HNZL 4Y19B 2C7UA 2QR0A 3PXJA 4I48A 2ENQA 3QNZA 1NSNH 4PD4K 4R4ND 4K4KA 1HZ9A 1YEWA 2CRZA 1PG7W 2F54A 3D51A 1QNZH 4PGCA 4IRZL 1TWCB 1PFCA 2N59A 4ERSH 4B6ZA 3AS3A 1AZUA 4R7NA 3L9RA 1KNOA 4XX5A 4MD5A 1B2YA 1M7IB 1BM3H 4QKTA 2E9IA 4HUXA 2MNUA 4N0FA 4QWWD 3P75A 5KVMC 1X9NA 4KY2A 2GJ6A 3H9SD 3KPSA 4PCKA 3O9WA 5ADPH 3ARBC 3OKNB 3OZKA 4GSXA 3ZDZB 1KN2H 3EDEA 1U8PA 2OJ1A 3FC8A 4A3GG 4RAUC 1TWAB 2W0KA 5HGDB 4FO2A 2PCPA 3RD4A 2FIKB 3TBWB 2P8PA 2AQ1B 2EY5A 4M7KL 3DYPA 5JDSA 5JXAH 1FJGQ 1IZKA 3I4NB 3ULSB 2ZXCA 3WDHA 1DZ0A 4L1LA 3GC3A 1NAMB 4UDUA 2JELL 3GTMB 1RV6X 3L4ZA 4NC1E 4QMEA 1AOHA 2CIIA 3IETB 5F96H 1STYA 4JKWA 5ALBL 1MG3C 1VCBC 3LRSA 3D2UA 4D8PA 4AXWB 2FX9H 1GW6A 1IM9A 1I7TB 1WS8A 5D7LD 1MFCH 3CH1A 4Z0XA 1DOLA 1WISA 2QJDA 1JE4A 1O9ZA 3JWOH 1HXKA 2F0CA 3CCHA 4MZ3A 1ZS8B 1RUKH 3ZX1A 4GUQA 3VMNA 4ZX6A 5C7ZA 4U6XA 1F45A 4Q9CA 3QVAA 3BKMH 1MW2A 1ZSDB 3WIAA 1ZHNA 3UC0H 3J7AF 4U31A 1A4CA 2C3XA 3CXFA 1KFAH 4JG9A 4M7LL 2F1MA 5GGRB 1KCUL 4FG4A 3LD8B 2Z8RA 3QPQC 4IBZA 1NBYB 1J11A 1PRTF 2VDPB 1K9TA 3QAQA 1GGCH 3TP8A 5D7HA 4B41A 3KPSD 1SVBA 3ULUF 2F52A 2ZSWB 2IX1A 1CR9L 3DXAB 1JC7A 1YUHB 1OAYL 4JHAH 5J57B 1XMEB 5CUSL 4PY8I 4MA1C 1N0XL 3IFNL 4YK4B 1I53A 1B4TA 3PU7A 3TCLB 4I1PA 5FYKU 1RJLA 4JO8A 1MI2A 2RF4A 3KXFB 5DGQA 3CE1A 3A4FA 4BCYA 4AGLA 2XDHA 3P1VA 2LS01 2X44D 4RGOL 3VFGH 5JHLL 4J6RL 5CC4A 3HOGA 1IYVA 3MUGA 4OY9A 2ZNXA 4APQC 5I1IH 3D3RA 1G7LB 3FQNB 4DQAA 1A3RH 1Q4NX 3IDYC 5C8JA 3WLWC 3JT0A 4M3HA 3ZTCC 3D85B 5E1AA 2XY1A 5HHVH 3L3KA 5E7FA 5TDOA 2ZT9C 3C5JB 3N43B 3SKNB 4WNJA 2WLLB 3IDNB 4RGMA 2ROYA 4DVRH 3B9KA 5DQJB 3QQXA 2YD9A 3OKEB 3FS9A 4WENB 5GZND 2CH4W 2VR8A 1WTHA 1W6JA 5FLMH 1CZ8H 1S7RA 1MJJB 3FO0L 3PHOB 5D6DA 2BWDA 1EFXD 4MJID 4HIHB 1DGSA 4JO1L 5B22A 1RP8A 2H32B 1N18A 1C9OA 3CFEB 4BK4A 3FO2B 3DX7B 2F7QA 3UTSA 1SMAA 3REWA 3Q44A 5MEND 1GYAA 3NACH 2DTSA 1L0PA 1TEFA 2BIMA 2LHAA 5TDPA 1SVCP 2Z6KC 3TBIB 3I6KA 2F0VA 1KJVB 5L6YL 3FT2A 5C3LD 4Y1SA 1KLGB 1U8HA 4GS3A 1FCCA 1K4CB 1RUMH 4YL4A 2XPGA 3AT0A 1I1RA 4NI3A 4APQA 3D4DA 2CZNA 4N6RB 4IUQA 1WTGT 4PR5B 4QDGA 4Q14A 1ODUA 2ZWLT 4CGTA 3VNYA 4WI9A 4PZ8A 5LVEA 1E2WA 2OMTB 3BPOB 5DRXA 1PDQA 4KO5A 2UZIH 3RPKA 3N04A 2I26N 1OWWA 5AVQB 3VXUA 4B7IA 4P4RA 4QTHA 4XMKH 1XH3A 2AMGA 1YEKL 5H1SE 4LLVA 4U2ZA 5E6ID 5HYJB 4JPKH 1P7BA 4PW4A 2ZXQA 3RPBA 2K8MA 3X3MA 2OMYA 4G9FB 3MRLB 4JQVA 2QVTA 4OGYL 1STNA 1G7IA 4Z7NB 2B4CL 4MB5A 2Z8LA 4POFA 2KBNA 2W92A 2BERA 3G5VB 3LKPA 4HMEA 4TVPH 5LO7A 3RL1B 5C0EB 2X4NA 1HZCA 2RCNA 2E86A 1IIKA 3GJEB 3VI3E 1E4XH 3CH8A 1FL5B 1Z7JA 4XB8A 4DVBB 5HURA 3K58A 1DVFD 4G7YL 4XNQB 1GUGA 1FYHB 4NC0B 3NPPA 4PRAA 2HQEA 4MAYB 5FO7A 3QHZL 4NPKA 1U41A 3J80i 5I17B 4F7TB 2P7TA 3J2PA 5F3HA 4M6OL 5E9NA 4D9QD 1F13A 4NNXA 2TRYA 4QMGA 1B0GB 3FQWA 4JDZB 3AQZA 5F1IA 1BBJA 2CM6A 4QIWB 4ZAKD 2FBRA 1SEBD 2P42B 3ZY7A 1PPIA 3CZKA 4JI5Q 5CZXC 4XPFL 5B1BB 1P5UC 3WNNA 3F7YA 4PB0H 3EOBA 1SOSA 4JO2L 3P69A 2HT2D 4ZO8A 1N33L 4QQBX 2L7JA 2MHAB 4XCEB 4HFUL 3O4LB 1T5WB 2F0QA 4HJ1A 4U7SA 3VI4B 5MI0B 2QQQA 3I9IA 1B4LA 3FQXB 2LVCA 1N5AA 3P3RA 1JWUB 4OJYA 1KNAA 4YFDB 1UA7A 4G1EA 1E1TA 3NGBB 2N3JA 4H1LB 1KJMB 2J4WH 3D0LA 2AKWB 2KUTA 4S1DD 4UIMA 5HI4D 4BCZA 4H1LH 4HALA 3O9WD 2EE9A 2ZD0A 2EJMA 3BP7A 4NCC2 2OTUA 4NHCL 2F1BA 3EFFB 5D1QE 2XXMB 1HHHA 4X98A 4WJ3M 4HJGA 1S3RA 3UDIA 4IKNA 4YHHQ 4CGYB 3MNVB 2XN0A 3CX2A 4X3SA 4BYHA 2EY2A 4QCIB 5KTEL 3MV8D 1OHQA 4XAWH 1X5JA 4FHBD 5E2VH 1EAJA 1HQRB 4ZFOL 4UU9B 5DD5H 3FFCE 2RDFA 4X3TA 1DVZA 1WK0A 3UTQB 3IF1B 2XWXA 3GNML 1G