5JPNC

Structure of human complement c4 rebuilt using imdff
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
290
structure length
290
Chain Sequence
APKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C4-A
publication title Re-evaluation of low-resolution crystal structures via interactive molecular-dynamics flexible fitting (iMDFF): a case study in complement C4.
pubmed doi rcsb
molecule tags Immune system
total genus 55
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jpnC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 5jpnC01
2PN5A 5FO8B 2B39A 1BQQT 2E2DC 1PXUA 3HS0C 5FOBB 5FO9B 3L3OC 1AYOA 2J0TD 1JB3A 2WINB 5JPNC 3T4AC 4D94A 2I07B 3CKIB 3MA2B 5JPMC 2TMPA 3CU7A 1EDYA 2QKIC 2A74C 3G6JB 3OHXC 2WIIB 1UEAB 1GXDC 3KLSA 4ILWA 3FRPB 4LNVA 1XWEA 1BUVT 1JC7A 2ICEC 4FXGC 2XWBB 3HRZC 5FO7B 1D2BA 2A73B 1BR9A 1UAPA 3I70A 4FXKC 3V96A 1OO9B 1BV8A 2XWJB
chains in the Genus database with same CATH superfamily
1MI5D 5DEHA 5DRWA 2B15A 2O72A 5JLZB 5IT9E 4JI4L 2HKFH 3WGUB 1EY7A 1FNWA 2HN7A 2EYMA 3NCJH 4H0GA 3GXFA 2R0LL 4AGLA 3IJ9A 3RJQB 2YRZA 3PXLA 3FTVA 5CSBA 5L4IA 1LTRD 1W9XA 1JPST 4FFWC 3DURA 4IZ8A 2C35B 1CK0H 3PYCA 5FW6A 1LYLA 4DT2A 3BDOA 4R2GB 2G4EA 3HE6C 3B5TA 3IRZA 4Q8BA 4DPCX 4QWWC 4DK6A 2DMCA 2Q8TA 2R92H 1BQUA 1GC1C 3C6LA 2G2NA 4YLQT 4HJEA 2D2OA 4YWLA 4JK1C 1ZYRD 2XKUA 3AWEA 4OCXH 4AGOA 3MLRH 5E95B 3R2TA 5GGQL 3I74A 3UZQA 4F8PA 4B96A 3QJQB 4U6YB 1HHKA 1Q1JH 2NY2B 4RRPM 1VQJA 5FB8A 4YH6A 4CC0A 1Y8OB 1KB5B 1DJYA 3RRQA 4S1QH 4YIQB 4O5LH 4NXSA 1LO2H 3AG3B 4KKLD 3B6SA 3HNVL 4MJ5A 3T0DA 3S9WA 2HX9A 3RWCA 2CR6A 3PL6A 4FQ1L 2V2TA 3ZDZF 3QJFB 4MMXB 3HZVB 5AKVA 1BA9A 1JC7A 4WHYG 2XLLA 1SBSL 2BNRE 1UWFA 1CG9A 2E27L 4K55A 2K9UA 4CDGC 1R4QB 1E5BA 2M1KA 4PB0H 4WI9A 5T5FH 4UP8A 1YNKH 4P2RA 2WWKT 2R1XA 3DSFH 3QXAA 2WAQA 4LEXH 3H91A 1YQVL 4DPRA 5ELDA 1O7IA 1XO8A 4Q4EA 4TPRH 1RUAL 2HWZH 3H9SE 2QSCH 3SOTA 4KPHL 2EYFA 2MOGA 5JNYA 3DROA 5HD8D 1NUFA 2C9OA 4ZNEA 5C07A 3HS8A 1VIWA 2CBTA 3NJKA 1TEFA 4K9EH 4DQAA 2G5UA 5E94B 5DVLA 5BN3A 3KF6B 5E6YA 2V17H 2CMRL 3UDWA 3O2VH 5F3BA 4JM2B 4WI0A 5JW4Q 1G7JB 3HAEH 4N2EA 2EYOA 1JVLA 1P2CB 2RJMA 4HKBB 5GGRB 3T65A 3TBSA 1E3FA 4FP5D 4ZXBB 3BCDA 1OKEA 2YAEA 3GKWH 4JANA 4JZJC 1YEIH 3E3QE 4D94A 3E1F1 5KG9B 2G3ZA 1TZGL 2RR3A 1DVFD 1S72A 1MZZA 4CSTA 3TYGL 1ZSDA 3VD9A 1OTTC 2N1KA 4O2DA 1UD8A 3DEOA 3A4DA 1X5YA 1XNQQ 2FH8A 4IEFB 2PWEA 4KLKA 3UBGA 3I4MB 1Q9OB 3VWJC 2OP4H 3BKJL 2CLVA 1RP8A 1HCZA 3G6DH 4Y5YC 2H1PH 4HEPG 1CZ8L 2E7HA 3Q06A 4QRBA 5KYIA 1MREL 3ER0A 2N7AA 3T2NL 3L3OC 3VXRD 5JOFA 3I73A 2ZXWB 1I5FA 5DZLA 1F1GA 1MAML 1QBAA 2D62A 2RHEA 1T5XB 4XAWL 3VG0L 4KVCL 3WTSA 3UC0H 3U50C 2YWZA 2X7LA 3M7OA 3VFMA 1VACA 4I9XA 3UACA 3I72A 4Q9RH 2F8IA 1WAPA 1XF5B 1IFHL 3DRQB 4RESB 1C7TA 2XXMB 1HJPA 1THAA 4DN3H 5I1JH 3WJMB 3TT3H 1MCWW 3H0GH 3VI4E 3KXFA 3HUJB 3N40F 5EU6A 1JGDA 5IF0B 4UIMA 1Q38A 3MLWH 2X10A 5K39B 1F13A 1BP3B 3V0GA 1EY0A 2IXQB 3HNTH 3GXMA 4HIXH 1SJHB 2EYLA 1XGTB 2BY0A 4YWGH 3TN0C 3QA3B 5D2NE 3ATBA 4GQQA 4MAZA 2F74A 4JE4B 5E9DA 3S1MB 3TASA 3WAKA 1OCZB 3HEJA 3U30B 2HJLA 3L7EB 3PWJA 4PJBB 4QXTB 5BQ7B 2NX5E 3KJ4C 4ZQKB 1IGYB 2RGSA 4MD5A 1LK3L 5HYSG 5IIFA 3F05A 2NY4C 4PY8J 2ICWA 2K45A 1KTRL 2C9UA 1QFWI 4O9HH 2W94A 2P7TB 4ZCKA 3KAAA 4GRLB 4PV9A 4Y16C 2KI6A 3WY3A 1VQGA 1SDFA 3QWOB 3US1A 1GIGL 4ZMZA 4TM9A 3SE3A 3FMGL 3QJHA 3VRLF 1NFDB 2YAQA 3LOWA 3MV11 1KGCD 2DJSA 2QF7A 1JB3A 4X99A 3SGKA 4M5ZH 4NKIH 4LPTA 4N9PA 1QHOA 4TTDD 4G8EB 3J80E 5EPMA 3UEQA 2NUTB 4YLBA 4F8NA 1Q46A 3U0PB 3AGVA 1A9EB 2FDBP 4F7MB 1I8LC 4PMEA 4JPIA 1A6TA 3CIQA 3MX0B 4LCIH 2N8NA 4IUVA 4MD0B 5D1ZA 3F7VA 3NSCA 5IYCG 3M8OL 3S1QH 1GCYA 2AXJA 3VFPB 3FT2A 2DI8A 2BSTB 4X9IA 2CIKA 3ZL4H 5JORB 3WN6A 3NELA 4DPAX 1G94A 1N36Q 4DKFL 4P71A 1TENA 5E70A 2FBOJ 3KPQA 1YN7B 2OZ4A 1ZT4A 1C1EH 2I26N 3W0WD 4CSSA 5I6XB 1DVTA 4NBYB 3W5MA 2ADJB 3BIBX 5IROC 4G7HC 5DRNB 4D9QE 3A4EA 5J6GA 1ICWA 3E0EA 2ODHA 4C59B 1MCSA 3TVMA 4FLQA 2IWFA 2NW2B 5H1SE 4OCLC 4F8QA 1L0XA 3VI3F 1YDPB 5JW5A 1GC1H 2DNCA 3HOGA 1YY9D 3MJ6A 1BNZA 1BLIA 1UNSA 2AQ1B 3BUQA 3EJSA 1KIRA 1LWHA 2WBJA 4B3SL 5KAQG 5FUOL 2XTIA 4XC1L 3PGZA 3L54A 1ACCA 3OKOB 3SPIA 2Z8LA 1AGDA 1KJMB 1XBRA 5E03A 3SBRA 3FK3A 4JPVH 4GRWF 1LEGB 4Y1AA 2IV9A 2NVXB 3BAWA 4YDJA 4X6CF 2R39A 3C8KA 4L29B 4LHJB 4P8QA 3QJSB 2EABA 5GGVL 1OK0A 5T1LA 2KEEA 1EZ8A 1I1CA 4XB3A 5J12B 1YHBA 3SE6A 5A43C 4ALPA 4EX5A 3L2NA 2FWUA 5E6IA 2YUWA 3ARGB 3WD5H 1BF8A 4J6HA 1PSKH 2JELH 5C6TL 1XEUA 5BVPL 4MAYB 4YC2B 1XF2B 5F0MB 2FX8H 2Y7SA 2B39A 2JQAA 1SRUA 2ZICA 3C60B 3QUHA 4GW1A 1UWGL 1DJIA 3L4TA 3KPRE 2E4TA 4JFEE 4YHNB 2QILA 3EFOB 4Y2DB 4QRRA 4J6RL 3D9AH 2V37A 3N91A 3A7AB 1U93B 1NEUA 3K0WA 2BK8A 2F3VA 2FHTA 2DL9A 3KEDA 3CZLA 4AQZA 1UZ8B 5AL0A 3FTGA 4ZUVA 2GK0A 2CK0L 2J1XA 1DANU 5EMYA 4GW4B 4KH9A 2VDNL 4X5WA 5HYJB 2EYHA 2J8UB 2XG5A 3TH2T 2YAPA 3FUMA 4AYDC 1MW2A 4MJIE 2X4PA 5KJRL 5LG6A 4H25B 1BMWA 1O5DT 3ESVF 4DAMA 3GGWA 1EUTA 3QIWC 3BQUA 3QEUA 1NAML 1NZRA 3FQUA 4LB8A 2R0ZH 3IJHA 1YNJC 4DXFA 3X3NA 4QIWB 2F0KA 4A2HA 2Q2UA 4XNXH 3PJSA 3VRJA 4TOYH 4RGMA 3BLPX 1EDYA 3E3QC 1X4XA 4K3GA 5FM4A 3CCSA 1AFPA 5D96B 5FLXc 4UILL 1D7BA 1TU2A 1OXTA 1XCTB 3QDAA 4EKXA 2CDGB 3CVDA 4N22A 2VITB 2GA4B 2XY2A 1K8OA 1ASOA 3QFDA 3QNYB 4FQ2L 4PJ9D 4TS6A 3HOXH 1Z9LA 5FM5M 3TT1L 4HGWA 4A2FA 2PNDA 5H35B 2RMNA 3QFJA 4WRLA 1OD9A 2W80C 3D50A 4HWEH 3HZ3A 2Z8VC 3PNWB 2NY0D 1NMBH 2ATWA 1T2JA 2F54D 2W59A 2EAEA 3I6LD 1DN0B 2VO8A 2JJQA 3LH2L 1QR1B 5ABAA 5SX4H 4UT7H 4N9GA 43CAA 3VD5A 2VDPL 4N1HB 1SNPA 1DUZB 1QZ1A 1FJGQ 2PPFA 5IHBA 4PRPD 1NCVA 1FYTA 2DLFH 4LASL 4E36A 1B3IA 4OFKA 5A2AA 1NR2A 1NKGA 3ERSX 1P7BA 3ZL1A 3KBXA 4JYAL 4TSSA 4DGZA 1CU4H 1YMHB 1UM5H 2QEJA 4NSKB 4HPOH 3HGBA 1JP5A 3D6CA 1QI3A 4P2QE 3EGXB 4HHWA 2AWNA 4M93B 5KS9E 4BUHA 2X2YA 4K8IA 1UYWL 3HRZB 1IEBA 1G1CA 4M7LT 5ENWB 3WXVL 4F91B 1OOAA 2BVQA 1P4LB 3GIZH 3EJYD 4FXLA 4JY4B 1WA1X 5I66A 1OTSD 3SPJA 4DV4L 1JOIA 4LHQB 1DDTA 3OHXC 3FB6A 2CIIA 4IOIA 1HXYD 4O2CA 3NACL 4QRTA 5CHNA 5D2NC 2X4TA 1F2YA 1XF3A 5L8JB 3OXRA 3NPPA 4JGUA 1KACB 5DRZB 3LKPA 2D4FA 2W9DH 1D5MA 1JGEA 2WUCH 4KQ3H 2OYKA 1JPFA 2C4FT 3MLVL 4ACTA 3MMEA 1HQRA 5DJ0B 3D39B 3GMOA 3CBKB 2J5WA 2H6PA 3OSVA 2EXYC 1FP5A 3KLAB 1LO5D 3NSXA 1IX2A 5AB9A 5C2UB 2YO3A 4OJDH 4QRQB 2PCPA 3UBFA 1M57B 3LN5B 4RAUC 4N86A 3UPAA 4N3UA 5K9KB 5HHME 3E7JA 1HJBC 4NZJA 3WELA 3MWYW 1FFOB 2A4CA 4PJIF 3N52A 2OMZA 4WGVB 1JYVA 2FSDA 2JLPA 2HVKA 2VQFQ 3E2HC 3FBQA 4K6DA 2KLRA 5M3MG 4XCYA 5EF0A 2R69L 1QSED 2ED9A 3X3GL 3T1HQ 4U6HB 2JKXA 3GTKB 1SROA 2IDSA 1PKOA 3ECWA 2ZTCA 4DF7A 3T77B 4AE0A 1BBUA 2AJVL 2WV3A 3PHSA 3C5XA 1X4ZA 3NDZE 4P99A 1E4KA 2K01A 1J9SA 1Z3RA 2CG9X 4C3IG 2PW1A 1U42A 2ZAIA 3VQ1C 1GSKA 2BSBA 5K9OB 1SM3H 2R7EA 2XZQH 3BUPA 3T6XA 4ZT1A 3NTIA 3Q8FA 3NN8B 3EJUA 3MRJA 1NJIC 2JA5H 3RURA 4TVSa 5IHHA 4NEHB 1PRTF 4OHJA 2X4SB 3QDGA 4GKNB 2A9MH 4GO8A 4LDOB 2GBVA 4MJJA 1ICTA 5DS2A 2VDKB 1DBJH 3EJPA 2VL5B 4G6FD 2G0KA 1PKQB 3M85A 3EFDL 1CA6A 1J5HA 1O9WA 5IB3B 3TXAA 2HLFC 4X62L 2IAMA 4PTUB 3CMAA 3RDTB 4PY8I 3SDYH 1PDKB 5FW8A 2YU9B 3LQZB 5FV1L 2BIHA 3HE6A 1VQIA 1VFAB 2OMUB 5FCUL 3K5RA 4WJ3M 3FCBA 3PG2A 3PWVA 5SWQB 2RDFA 1LLAA 3EXJA 1ET5A 4HJ8A 1ZXQA 2ZPKH 4G9DA 4I5BA 1PZ5B 4Z0XA 2A6KB 1W3SA 1F3JB 1SJEB 1CICD 4JRYE 5HVHC 3MODL 2DWDB 1MWAB 1BXTA 3FO0H 4R0LC 2B2TC 2GUOA 3V5KA 4DZ8B 5CBAB 4I0PA 4MJHA 1LHZA 3T2PA 4POZC 1SY6H 3ZBMA 1TT2A 4EUPB 2Z6KA 4DR1L 4OZIB 5FECB 4JI6L 3VQLA 1NCDL 2WMPB 1HA6A 3M1CA 4LHUD 3TTSA 3V96A 4OZHE 4MMZB 5FIEA 1U5KA 3B9VA 1L1OB 2IC2A 5HYEA 4JBSA 1L9OA 4F7KA 3P69A 4MCZB 1Z9NA 4G8GD 1PZCA 4BA8A 1R3HA 5LMNW 3L81A 3NIGF 5GJTH 4FA7B 2ZCKH 4LIQH 3BAJA 3RPIB 3C6SA 3WI9A 5FM8A 4QTIL 3Q6GL 4I13B 3NJJA 2XN2A 3RHWF 3WIHL 1LE9A 4X9HA 3D05A 2VQEL 2ZUQC 2ERJC 2GSIB 4OIJA 2IADA 1TCRB 2QADD 2D7TL 3HC4L 1F58H 4G7SB 3IBOA 3AQZA 3MAWA 3TM6A 4X98A 4JFVA 2OMWB 3SY0A 1J9RA 4GXFA 1JNNH 3P0YL 4LF9Q 4IHBA 5I1EL 3AXLB 1ZT7B 2CJUL 3BSHA 2J2ZB 3MRQA 3NFNA 3MJ7A 3J7AV 5CZKA 3KYNB 1JG9A 4HJ0D 4QTHB 4A3KG 3ZZ1A 4P74A 1F4XL 4P48A 4DP0X 5LO7A 5HVGB 5AW9B 1VEMA 2ZNWA 3SY6A 1YN6B 1DQIA 4GG8A 1IARB 5BRQA 1G6VK 1V3MA 5C0JB 3QVAA 2V7HB 1YEZA 1R9TH 2BH8A 1VFOA 1TQVA 2RDGA 3X12A 4X5PA 2ZKXA 1EJOH 3FUDA 1Z7TA 1ENFA 3ARWA 3L5XL 3PP4L 4FI7A 4UV7H 3G5ZA 3VW3H 3QDJA 3ZYZA 1YC8A 4DPBX 2X4RA 2XFXA 2LU7A 3M86A 2GJ6B 3O3UN 2XN9A 5HY9A 4V190 4WNJA 3BEWA 3LS5H 1YCSA 4FXGA 3VI3E 1EOTA 4Z0BH 1RLWA 3E6HB 4NQTA 5EKLA 4MS8D 4QRUA 1X9RA 3OAZK 4EI5B 1UD4A 4XN7A 3FMCA 5CZXC 5KBMA 3LXBA 4NXMQ 1FL3B 4U68A 1BCIA 2O5XL 2R2HA 3ZE1F 5ICZB 1FAKT 1RHPA 4QEGA 1ORSA 3GRBA 2FQFA 3BEVB 1QFOA 2LHAA 1K72A 1ZPUA 3K1KC 3WL9A 1EO5A 2YAMA 2WQRA 3MKKA 1RERA 3QK0A 4EVNB 5DEZA 2CPUA 3KWVA 4IFDJ 4GRWE 4KHXH 3F6IA 3HC0B 5TQ0L 4X9GA 5ESQB 4Z78B 4X6CE 2HLAA 4L8DA 1OANA 1DBBL 4XE0A 4Y7OC 4CDHA 3MLTA 4XRCA 3K6SA 5BV7H 1OZUA 1VQDA 3QHZH 1S6NA 2B59B 1TLMA 1JDCA 4U3SB 1PQZB 1AC6A 1QLRB 2NY7H 4TQIA 2FD6L 2OXHA 1YVCA 2OMVA 4HOXA 3SPVB 2NUPB 3VR3A 5D1XE 1PTOF 3QIBD 4L48A 3HIZA 3NIDF 3FOLB 1AZUA 2CD0A 4ZAIA 3HG5A 3KVDD 1EA9C 2X6BA 4OTXH 4WI2A 2WB1E 3LZNA 1AZCA 2O5IC 5HI3D 1GGCH 1DQJA 1W0VB 5IESH 3R2IA 2JIXB 4G6KL 4L2YA 2MO1A 3K2MC 4OLWH 1MDTA 1OXSC 1HH2P 3AU1B 3F2CA 3PF5A 1VJSA 1XNRL 1IW7D 4F1SA 1LT6D 4M1UB 4FQJH 3T2OA 4TLSA 4PMCA 4LL1A 3U4AA 5EBCA 3IDGA 3MTRA 4D7PA 1A7PH 2B9BA 4RCAA 5GIRA 3PRZA 1N59B 4X9BA 3RIAK 1QRNB 3GSVB 2AXWA 4YOKA 2XY1A 2NCMA 4X3UA 5KIXA 4PJ5D 5EB9A 3RGVB 1Z6HA 1PTZA 4KZDL 4BWWA 2E5LQ 5L2KE 4FYDA 4A3FB 2WQUA 2YPVA 5TFSH 3W39A 3QNXB 2PO6B 2D5DA 3KPMB 3QEHA 5DJ8A 1OCWL 2WLHA 1Y1VB 4Y5VB 2YLHA 4HLJA 4K23L 4JKMA 3HG1E 4G11A 5T1DL 3LRKA 3DMMC 5BO1L 4XO4A 2WZAA 3ZRCC 3QPKA 2H3KA 5BZDB 4GUQA 3BWAA 1AE3A 1I9RH 1Q1PA 1AG6A 5BRZD 1LMIA 3TZVC 1K4CB 1UVQA 2K52A 5T5FL 2XC8A 1B4JH 2Z65C 3PIQA 4NBZB 4UT6A 1EZVY 2Q76B 3OIQA 3M17A 5C08B 5IG7A 1BCPD 3NK4A 4U1MA 1VFUA 1JZIA 4UBDC 1GGIH 3DTXB 2Q20A 1X7QA 5IIEA 4NS0A 4JVZA 4NW2A 2PCYA 1I7UB 1ZV9A 4XZ4A 2G2PA 4Z3HA 4KJPC 5IROA 2N7BA 4IGBB 4Y2OB 4E9SA 5M5YH 1EHLL 1JE5A 2LSSA 5D55A 2Z93A 1YSOA 1G6RH 4FCAA 2XQ0A 5TDPB 5EC1B 4L3AA 4RFNB 1MJ7H 3UTQA 3S34H 4BKLA 5HHQA 4P3WA 4XVTL 5LVEA 2CW0C 2AK4B 1LE5B 3Q22A 1G9NC 4LRNL 4BE6A 3SK4A 4HIOA 1RURH 4QOKA 1N0LA 5IE8A 4PJHB 5JO5B 4LSSH 4XXWC 4BFGA 4V0BA 2B4CL 2OR9H 4PLNC 1IZJA 1KBPA 1OPGH 4J3XA 3V0HA 2HRHA 3ISYA 2ENYA 4UQ3B 2UWEF 2PZUA 3V4PH 5KVEL 1O7YA 1KBGH 1R3IL 1CFQA 5MEND 3NZUA 2ZXPA 1AD0B 2DQJL 1NOFA 2VLJA 2AUKA 3EJTA 4Z7VA 5SV3A 4ZMAT 2KZKA 2EH7L 2WXKA 1ZSHA 1IL1B 1FA4A 1ONQB 3DV4B 1XTDA 4N1CA 4PFEA 4XODA 3TA3D 4AQEA 3BYYA 2BNRA 5CV6A 1FDLH 3WNIA 1Q90A 4PW9A 3U1SH 1KJ2H 3US9A 2VDMH 3V52H 3I4MG 1FIGH 1TTRA 3EUUA 3GC3A 3P4NB 1X6NA 2JV6A 3SKOA 4RGND 1YEGL 4JDEA 5HPMB 4LFBL 5AUMA 3SO3B 3VQMA 2O6DA 2EDMA 3WEXA 3OLIA 3WY2A 2CQOA 5D6CB 6FABH 3DWQA 3HZYA 3IFLL 4D3CH 4LLVA 1EMTL 4FC3E 1F1DA 3DPDA 3KYAA 2QKSA 2UXGA 2M8XA 1M4KA 2AQTA 1G7HB 4C1NI 4XN9A 1HE8A 4K6LA 2Q87A 3DPBB 3IPFA 1BPLB 4ZFFB 2VDOB 2ILLA 4HZ1A 4M1CC 3QQ3B 1G2SA 3VSQA 1U4LA 4C3HH 2EECA 3P0VH 1NQBA 2EYPA 2NXZC 1B0GB 1CXKA 1Z66A 1M1XB 1P84K 2AEPL 1HS6A 3ALPA 4LFAQ 1UOKA 1STAA 2XV0A 5FFLA 2WQSA 3NWSA 5IT9c 4AM0A 5I28A 3W1BA 4Z0XB 2DDQL 5DJ6A 1JD7A 1I7RB 2WZ0A 4HHAA 1G0XA 1W2KT 3VXUD 1HYSC 2QSVA 1A25A 4BDVB 3GTGB 5C0IA 3F7PC 3QZOA 4RMVA 3K6NA 4UZSA 2W07A 3DUUB 1D5ZC 4AV0A 3GJFA 3G3LA 1Q9LB 1P5VB 1S9WB 3WUWA 2A9AA 4WJG3 1EYGA 3X14A 1F4AA 4GQ9L 4UUJA 3T53B 4S1DD 4IOSD 4BSWB 1S7SA 3AREB 1EZVX 3QUMA 1T20B 4OZFH 4Y4HD 5E2WL 4ZPTB 1MRCL 4XOBA 3TNMA 1WGOA 3A5VA 1E6OH 4L1TA 2OSYA 1GR7A 2BM3A 5AWNH 5TF1L 5IW3A 5DDHB 4PVLA 4OZGA 4GOPC 3U7YL 5IVNA 1LACA 3LPWA 2GTWA 5FKAA 3RFRA 5KYWB 4BSVB 4JZOA 2DRUA 5I76B 4E9RA 1KEML 2XICA 1H3VA 5EQ0A 2LT9A 4MSWA 4XVOA 3AW5A 4PRAA 1A8ZA 3MLYH 1JRHI 4JREC 1A3TA 2XPYA 4Z1PA 4JGNA 4PG2C 3FUEA 3FH7A 3IS0X 1R3KB 2NXYC 3B3IA 2HT4D 5I0WA 3PV6A 2JB5L 1MBYA 3VI4A 5D1XC 4YSAA 4A3JG 2VR8A 3WEMA 1QW8A 1IGJB 2EIZA 4RA0C 4F8LA 3S3JA 4IU3B 4FFYA 1E8WA 5KSUA 4O2EB 1YECH 2O2LD 3NIGE 4DNLA 1HFUA 3CPLA 4OFIA 3VGFA 2ZOLA 1PEWA 1SOKA 5EFIB 4A3BB 1CLZL 5HSFA 1C8CA 1S9YB 3BZDB 5IW6B 1N64L 4M48H 4MXVE 1XGUA 4XHJD 1TEYA 2K1MA 5DEJA 5E6ZA 1MFAH 2ZCLH 5GS1B 1RJLA 5C97A 5IFHH 3PO3H 2CA4A 2WC7A 2YPLD 1QMUA 5GRUL 3T0EC 2IQAA 3EDEA 2EDEA 4HUWB 3UTPD 2JQOA 4PR5B 2YBRA 4P5SA 3GBLA 3I6KB 3V6FB 2E2IB 4LL9A 4DKTA 4R7DB 2F1BA 3WMSA 3QZWA 5TE7L 1NUCA 5I1HH 1PVOA 3GTLB 2R83A 3P4MB 3GHPA 3DJZA 1A1OA 3HFFA 4KU1A 3ROOB 1WTQA 4XCEA 3L1EA 1MJUL 3S96A 4G72B 1RIVL 1TNNA 3V4VA 4IFDI 1K9MC 1XGZA 1W8OA 2E56A 3IDXL 4A4IA 2J6EH 4MAUL 4PJ8D 3SKNA 3VMPA 2DNEA 3DX3A 3II3A 4IS6B 5AVQB 1W6WA 3WLBA 4ALAL 5EEYA 2FBJL 1QNZL 4C58B 2PPBC 4KROD 3FZUD 4L8CA 3J81c 4R96A 2VDQH 1G9MH 4JVUA 4M61B 2RCSL 3BYTB 4DN4H 1PG7L 2D9UA 2DYPB 2FR4A 3ARFB 1S7VB 3RPKA 2H8PA 4C4BA 1NGXA 4M3HA 2RSOA 1SYFA 2XRQD 3AY2A 4LVOB 4EAEA 2GJZB 5IHUH 3T2LA 5DUMH 5C3IA 1O7DE 2YKLH 3MAQA 4NAJA 4MQXC 1A3RL 1HEZA 1ZHLB 5HTSA 1T22A 4WGWB 4ERSH 5IHZA 1EUJA 1D2OA 1TOXA 3I3DA 1I1FB 3RVXD 2I27N 5KSAB 1L9NA 1KDAA 4R7NB 1MNUH 3MREA 5EO1A 4C56B 2NY5H 4PJIE 3W81A 1G1KA 4XWOD 5AG9A 3S3DB 3TEHB 4KTAA 5J3HC 1CFNB 1IBHA 2TAAA 4RX4A 2Z31D 4XNZC 4BXXH 5TDOA 4MBOA 1SLUA 5D1QB 5AW0B 2FCBA 5T3ZD 5D3DA 1UFUA 5C0XH 4BBRB 2XVLA 3Q8BA 4W9CC 2VC2L 3BPLB 4XMXA 3VVWA 3RG1C 3OIPA 1DBML 1IT9L 3S14H 1A6ZA 5LAXA 2IANB 3DRTB 3RDJA 3VFRA 3CX5J 5JDSB 1AKPA 4KUCF 4KKRA 3BFOA 3ZE2F 4WI7A 2D8KA 4A93B 3NEOA 5DHVA 2NW3B 4XMPH 1USQA 3FT3A 1S5CD 1RJZB 3CVHH 3FUKA 1T0NB 2A7BA 4E9WA 2GVAA 3UJJH 4NPSA 4R4FH 4X8GA 2BSSB 1EQWA 2BRRL 3QORB 3D87B 3KPRA 3LNIA 4GI9A 3OR7B 3LDBB 4OVVA 3SE9L 3WSQH 4OCSL 2DZEA 4W9GC 1JUFB 5GRYA 3NRFA 5KNDA 1UXMA 3M7FB 4HLZH 4CADA 5HI5C 5GZNA 1RK0B 4B9FA 1AGBA 3J80c 4M7ZC 2JXMA 3AJ7A 3L4VA 3HE7A 5DQ9B 5EEXA 5KNBA 2VSDA 3R1GH 2CGRH 2AC0A 1OAYH 2Q2IA 4L9LC 3AS1A 4PJDB 4PGEA 1B3JA 4U49A 4YR6B 1QACA 4MJIA 4UWQB 4ZSOA 4PREA 4J3OF 2AQSA 5DD0L 3B6YA 5KVFL 4KJWD 5L6YH 1TZHB 1SDDA 1WCQA 2XIBA 5FA4B 4ODTL 5GSRA 2BP0B 2CPCA 4RMWA 2MJWA 2H32H 5IKCB 1I1AC 5J1AB 4HUXB 5EZLB 2ZWYA 5FYKE 1KXHA 1OSZA 5FYJE 4P2OD 4DIXA 5EBLB 1Q86C 1ZA3B 1ETZA 4O02B 4PPTA 3VUAA 5E8DH 3U36B 2YPKA 1WJJA 1PRTC 3CPUA 4JFXB 3SYQA 4ETQA 3FU8A 2Z7UA 3IDMA 4BFIA 2PXYB 4B9XA 3LPOA 2SEBB 3ME0A 4G5ZL 4NLHA 4B9CA 1SYVA 1AIZA 5C0GB 1NL0L 1MHEB 4L4TE 4Z3IA 3D8GA 4RBPH 4MA8H 4NO3B 4YDVB 2D0GA 3OR6A 4MRCA 2QR0A 1LLRD 5EBGA 4EE2A 4YVNA 2YD9A 4DV0L 4F15C 1UQSA 5EIQA 1OLZA 1BM7A 5G3LF 2NTSP 2O4EA 2V2XB 4IBWA 1HNZL 4KK6C 3EH5B 4YNYA 1ZVYA 2UWEE 4OLVL 1OP5H 1ZEAL 3FULA 1U8OB 5SX5H 2R0KH 3W11C 3EGDB 4K7PH 1E28A 2AZUA 2O6FA 4P2QA 2P46B 2FWSA 5KS9A 1WTGT 4M43L 4ZJ9A 4HSAC 5I5RA 3FSOA 1PJWA 4PJ6A 3PL6D 4YHLH 4PGDB 1T1ZA 3ARBC 2FGWL 2X4OB 5ID1A 3VJ6A 4LVNB 4PGZA 1DQLH 1LMKA 1VGEH 1VRSA 1JYXA 3ULVH 4Y4KA 1IC7L 1EVUA 4JO1H 4IJ3B 3CC5B 2BC4A 5I6OA 2P43B 3QXDB 3A8JE 1E8ZA 2VCOA 2BVEA 1PMRA 4P2RD 3AUWB 5CMDA 1T5WA 4TSCH 3D18B 1WICA 3L9RB 4L3CB 1EFWA 3BRFA 2CZNA 1EWIA 4AG4L 1Q1BA 3TWYA 2CDFA 1FO0A 4A7SA 5BW7C 1CIDA 3SGIA 1MDAA 2Z7WA 1W2BA 1MRDH 2HTLD 2Z1PA 3VYOA 3RWFB 3L4CA 5F1IA 1NMCC 4IJHA 1U58A 1BBDH 4PM1A 1FZMB 4PJ7F 2CGZA 3LXCA 5J11B 1LTSD 3C9NB 5E23A 3TO2B 2JKRM 3VWKB 4EOWH 2OK0H 2J0TD 5J89A 1MFMA 4R8NA 3E5SA 3E3XA 3QQDB 3Q9PA 4GAGL 1S5BD 1IAIL 4EUPG 3RVVC 5K1VA 4PZ8A 3F7LA 4YPGB 4NOFA 4HKZB 3VR2A 2XPGB 2NY6D 3E8UL 3D4WA 1W72H 1XXDC 2WIIA 5MP6L 4LSUL 4A76A 1XIWB 1QLFA 4PJEB 3T1WA 2GYSA 3EYQD 2L7UA 2JA8H 1XMOQ 1CF8L 1FORH 2A38A 3H55A 3QUYA 2AQPA 1XL4A 2AEIT 3CFBA 3VH8B 4CMMA 5KYXB 3APDA 2ATPB 2FUTA 1WEJH 3C2SA 5DYOB 3MVVA 1A3LH 4Y19E 3F7KA 1RIHL 3HEIB 4G6MH 5SWZB 4E41D 1O7DC 1AP2A 1A2YA 2D31A 3HVNA 4K8RD 5DUPL 2N7SA 4ODXB 2PWDA 1W8EA 3L2MA 2VXTL 1TJHL 3MFYA 3A6OA 4WWKD 1MG3C 1CE1H 5FLMH 4ODUB 5B7FA 2G3XA 1Z9MA 1WD9A 3MN8A 2HFEA 3T6WA 4IBUA 5DHYA 1CDBA 5T3ZL 2V3FA 1DVZA 4JRYA 3LMJL 3VFOA 5IFAH 4U1JA 3U46B 2WVTA 5DJZA 1ACYH 1OAXL 1PTOC 2Z8RA 1DLHB 4MNQE 5EU6D 1YVLA 1NBQA 2F7IA 4R83A 2OV0A 1BXUA 3MBEA 1N32L 3M46A 3RE0A 1Q9WB 4BA1I 3IF1B 3OPZL 2P8LA 1X55A 1QUNA 5M7QA 3NGBC 5F89A 4OAWB 5CO1A 4KJYB 1WA2X 4OZHA 5ALBL 4BK4A 5E9DD 1DQML 4HCRA 2VXQL 1SMXA 4MD4B 5AQ0A 4BCZA 4Q0FA 5FPIA 4O00A 2J5LC 4NDMA 1D9KC 2UXFA 2B2YC 1R3LB 3HPLA 2J88H 4OFVA 3DX1A 3I9PA 2WTRB 3D7PA 4MQTB 2FT7A 5E08L 2YSSB 4ZAKA 3WIAA 3WTWA 1N0XH 1KXVC 1OE3A 3LNEA 4LQFL 4Y5XC 5IT2L 2H9GB 4FHJA 5CKAA 4ABNA 1QLEH 3NABL 1Q0EA 1K85A 4TUJB 5JPMA 3HPJB 4ICWA 4TLKA 25C8H 5D7IB 5IJKC 3CMOH 5FAAA 3BDCA 1BJ8A 2CLRA 4RWYL 3VXOB 1S8DB 3QPXH 4FTVD 5JPNA 3MFGB 3ZDXB 5D1ZD 3IMUA 1EFXB 3REWB 3DVNB 2WVSA 3T3MF 1B88A 1UM6L 5GJSH 1TVHB 2D03H 5DO2D 2V5SA 2FWOB 1OHZA 3CFJB 3QG1A 3GZKA 5AKSA 5C0AA 5I1LB 5B1JA 1MKHA 3F64A 1K6QH 3DBXB 5L88H 2R8SL 3HKZG 1EAPA 2QQLH 1XGPB 4G8AC 1TWCH 1TQOA 2GVBA 5CV4A 3ARUA 4FLRA 4JFDB 5DQJB 1KYDA 2N4IA 3Q6FB 3S5YA 2A6DA 3RNKA 3R93A 4FULA 5I2IB 4GSDL 3L6FB 3ZX1A 4JBKA 1BOGB 1KPRB 1NUDA 3FQNA 1T0MB 2N56A 1A2UA 1AGCA 4A2EA 5I8KH 1IM3A 1E67A 5KYUB 4POGA 2XXFA 1U6AH 2WBJD 3ARDC 4WJ5B 4UTAH 2UXTA 3QR1A 2SOBA 2ZUXA 3ILPB 1O7ZA 2J21A 4UAHA 5EOTA 5JTWA 1E5CA 5CEYB 5C70A 1KDCA 5LMNQ 3EH2A 4HIDA 4XXDB 2R92B 2DKMA 2A6IA 2YAOA 4U2ZA 4GOPA 1CQVA 1WT5C 4EN2A 1Y1VG 3D4CA 4Y1AD 2BMKA 1QSFB 2F7RA 5DFTA 5HGHB 1U3HD 4X6CA 2CJSA 4P2CG 5JHAA 5T1LD 1H9RA 5B38A 5CEZD 3LN4A 1OE2A 5A2KH 3ONAB 1FFPB 5ETUB 1DQDL 3ZE2E 5IB2A 3SPCA 3CD4A 5ISZA 2ARJA 1AHWC 1FNLA 4G6AD 1B9KA 2QQQA 3S88L 2L1BA 3MR9A 1K2DA 3ZYOA 4S0SD 3HZMA 5E5RB 1NE3A 3N42F 2G60H 5DJCA 1KZQA 2M2LA 2WB1A 1UXLA 1I4PA 4QRRD 3CSFA 4ODWB 1GHFH 1XX8A 3WXWH 2OJ1A 3GT6A 3P2BA 3IL8A 1AGEB 4M5YL 5F2FA 3VGBA 2OZ4H 1WD0A 2IALB 3WMPA 4GLAC 1M1KC 4GAYA 5F96H 2EDFA 4X5XA 2RQ8A 2Z0BA 3G08B 4NHUA 2AK1H 4LCCB 3QUZA 1FL0A 1UA3A 3O9WA 3D85A 5ESAA 4FNPA 5EULV 4YSQA 4I18C 3RWGB 4PNYA 1UB5A 3P4OB 3AMUA 4JVPA 1WIOA 2K7PA 4XVSH 4N2OA 3RL2A 2Q2EB 4GNXA 1OB1B 2TSBA 3BISA 3HG1A 4QY7A 4RH4A 5AW4B 1NDMB 3OKYA 3HAEB 3PQYA 4ZZKA 3D3RA 3SXHA 1BEYL 3UTSE 5I18L 1NCNA 5CJXA 2C5CA 1WVLA 2BNUB 1WZLA 2AAVA 4KTYA 1UKQA 3RZCD 1JS4A 2XJKA 4FZ8H 8FABA 2WNGA 3O45A 1EIHA 1GS8A 1JQYD 5LMUL 4F7TB 1J9CT 4XE5B 3QFJD 4MB3A 1SNQA 4X4YA 2AJSH 4AJVA 4OCMC 1MIMH 4ZTOH 4TV3A 1E3PA 4K14A 2DLIA 5EO0B 4MNGA 4KXBA 4HX1B 1OV8A 1ZOXA 3SDCB 4AENA 1JRHH 4QHKI 4YUEL 1FVCB 2F8VA 4Z6AT 3J7YW 2P44B 1A4KA 1GYWA 4CW1B 4K8RL 5CWSB 1LTAD 4MB4A 3NCBB 1Y1WH 1IE4A 5CJQL 4XZUA 1SZNA 2AJZA 2HA1A 2CH4W 1E9QA 5GS0C 5NUCA 1OGSA 4LFCL 5JHDE 3RUGA 1KBVA 4AKQA 4MLSA 1GCFA 4XBPA 2CWPA 1FSKC 4AWJC 5CJ8A 4R5XA 1H9SB 3PWPE 4YHKL 3JTBA 3T2QA 3ESPA 3GMQA 3GO5A 4YFDB 3SVMA 4BY7H 1RKNA 4M7KL 2VLRE 5EEUA 3U58A 2F9BT 3GBDA 3V6OE 3DSNA 1MSPA 1Z9PA 3CRLC 5K1JA 3H0GB 5D7LE 5C09B 3NE5B 1VFBA 4KUZL 4PJFB 5E8NB 2OL3B 4DTGH 3WOFA 3POCA 1U91B 4GG6B 3DOSA 1IXRA 1M7XA 2OS7A 4TKOB 4MMYA 5DT1L 4BQBA 3E1ZA 1UCBH 3GQBA 4N0CC 1HHIA 3KJ6H 4RFOL 6TAAA 5ITFA 3CK0H 1TTCA 1EUUA 3LHPH 3MRMA 3UEZA 1ZS8A 1HQRD 3GWJA 1UA7A 1UUSA 5EZJA 3MXNA 3SYAA 4FGMA 1N70A 1IGML 5KYYA 1MFVA 3MA7A 4HC1L 5JIIA 2UZYB 4WENB 3OV6A 4Q0XH 4DJMA 4IFDH 1DVFB 2WINA 4TQEL 2YMTA 1RUMH 2YJQA 4BQ8A 3LEVL 2WKDA 2VERA 3N41B 4K3JL 4OFYD 2WJ5A 2VLKE 3DJSA 2DQFB 1VZIA 5IOPA 1U8QA 1PG7W 4HFUL 1X5GA 4D8PB 4PJ7E 2JI3A 2BSRB 1G1YA 2AV7B 2Y2WA 4L9LA 2F0WA 3NSJA 4PG3A 3OZ9L 3LZFH 5D5MA 1A7QL 5EA0L 1OAKL 4YCWA 3CFKB 4ZUIA 4C3JH 1IBLL 4OJFH 3MRDA 3ZHNA 5BJTA 1MLBB 4JHWL 4EQ2A 1P7QB 3S1QB 1F6FB 4G1MA 4H4NA 1ES0A 1I1AA 4WEBH 1OAQL 4Q6IC 2DIAA 1WTVA 3FFDA 2ZQKA 3L3HB 2F0IA 4ZBJA 3RWJB 4QL5A 1T83A 4NQDA 5B7MA 4U7KA 2Z3FA 5I16B 4HUUA 2FWLB 4Q58C 2DTMH 3I2ZA 3K4ZA 1VQFA 1N18A 3TONA 1MFCL 5FLXL 1AEXA 3FFOA 3CC7A 1SE4A 4A3BG 1MCCA 3QAQA 1RZKL 3ETTA 4PI0A 3IJYB 3ZMEA 1ED3B 3P9LA 2HKFL 4YHZH 1LO4H 4GB9A 4TQPA 3OKKA 2IMMA 1R4PB 3MRGB 5DZAA 5IMOA 3IJEB 1CFSB 1N26A 1S7WB 2IAMD 3UAJC 4GZYC 3RIAF 4AH2B 5CCKH 5KVDH 5MHSE 4IRJB 2NQCA 2YSTA 5EU3A 2E2DC 4CGYB 1H15B 3HE6D 2FJFA 3QUKA 1LO0H 4HKJA 4QWWD 3VFTA 1HI6B 5FK9A 1QI5A 4K07A 4PD4K 2HJKB 2H26A 3NBIA 4X6DB 4Q9QL 2IJ0C 1OY3B 1Y7VA 3LRMA 3OM3B 2W88A 3IDYB 1JPTL 5GRJL 1J05B 1RULH 2HQEA 4CKCA 2G5BB 3A67H 4ONOA 2ZX7A 4L4JA 2R23A 5HDRA 5IEHA 2DM3A 1KTKA 2VNUD 2IGLA 3LRSA 1PIFA 1ECZA 5SWSE 3HUJF 5DRXA 4A7QA 1JPSH 1AO7E 1FG2B 1OGTA 4I0KA 1CBVL 4P49A 2D3NA 5DMKA 5E8OB 3RWHA 5L9DH 2EE1A 2UXCQ 1JNHB 4R90H 2VSCA 3LKOA 2IBBA 2BY2A 1MHHA 4UZGA 2KDGA 3SDAC 4I65A 5F9JA 4K3HA 4NQEB 4PJBF 4YDNA 2J43A 4HUNB 3GV3A 1JCKB 3VD0A 3CX2A 5IBTH 3CFEB 2A6HC 1BUVT 2PQEA 5I2YA 3I4OA 2XWBB 1MHPL 2RQEA 4UM8A 1YNKL 4Y7MA 1L2FA 4RWSC 1NGYB 4WFHD 4KGJA 3ZHDA 1NBZB 4L23A 1SF5A 3LQAL 4M4PA 1KQSA 2YIHA 3BKMH 4ONHB 3E6FB 1ZVSB 2ZUUA 1NFDF 4J3OC 5D7KE 4H13C 1WC7B 3VYRA 5FO9B 4WY7L 3DXAB 2IV8A 2XBDA 4G6JH 5HGTA 1JGLH 2QQKH 2C8NA 5CN1A 3HG2A 2R2EA 4CHTB 5E0FA 4F9PC 4BBRG 2XSKA 4JO3H 1JVKA 4QHMB 1AQ8A 4G8FA 4ZW7A 2AGJL 4WHYH 4Z7OB 1BFVH 3MZTA 4EN3B 5B8CC 5DJ2A 4LNRB 5DJYB 4P3CH 4B9KC 4A93G 2HCIA 2JTDA 5T8IA 4N4YB 4ORGB 3SDDC 2YYZA 2JP1A 1OTTD 3INOA 1GPOL 1BF4A 1H5BA 4N0FB 4RAHA 1K8IB 2Q7NA 3HOXB 15C8L 1QEWA 4F1ZA 3LEXA 3UYRH 3TTYA 1BQHG 2WN2A 3AABA 1DOLA 5F7FA 2IPKD 4RWHA 4V1DD 3M45A 3V4UL 4N2CA 3BLKA 2WZPA 2NWGA 4Y2LA 4RMBA 3MCKA 1XZ0A 4X7FC 1L7TH 1XH1A 3TIDA 2YAHA 4LLQB 1G291 2VXSL 4XNQA 2X09A 4OGYH 5I74B 1X44A 1WSST 1YMMD 1ZY9A 3DGGB 4OKVB 4ZO6A 4FQXB 3CZUB 3S35X 2DQ6A 4OZ4B 2VRKA 2YBGA 4NQSB 4DUZL 1WBYA 2Z92A 3MLSL 4C4UA 4PJIA 1HIMH 1YNTB 3V6ZA 1YNLL 4IMLA 4ZW5A 4HIJB 3DX8B 5J6HA 3MUUA 4P46C 3MCLH 2Y7QA 5LNGA 3BKYH 4HSQA 1KEGH 3F5WB 3V6OC 3KM2A 1LP9A 1F3DJ 5FOJA 5EPLA 5ITBH 4FMKA 2O30A 4U0QB 4XN2A 4QY8A 1O7VA 1TT6A 1EYAA 2EE2A 2X0WA 3BP7B 4FRWA 1V1PA 2WLIA 2GFBA 3FTUA 5M3FH 4KRPC 1BD2A 1JWSD 3MLWL 3KJ4B 3NK9A 5C0ND 1K5NA 2BOBB 3TN0D 1UUNA 4LMQI 4N2AA 1WUZA 2R4SH 5HJ3B 3KS0H 3ZR5A 4Y16B 1JF1A 2NY4D 5JOPD 1NPJA 5HDBB 3M4OH 2DWEA 4O4YH 1A15A 3CCUA 1VFMA 4BFBD 3OYYA 4XO5A 1X5ZA 2WKOF 3CDZA 1I8AA 2VKXA 4FQIH 1R0AH 3F1ZA 2WTPA 3DVIA 2J8UF 4WFFE 4DETA 1N67A 3CH8A 1S9VB 1Y69U 4NJ9H 3BAYA 3FTSA 4Y5XA 3IJ8A 3KVQA 1X6LA 5BOJA 4WK2B 4C47A 4UNIA 1GYCA 1KCSH 1DLFL 1M7IA 3K8AA 2ZSWB 3WG7B 1S3OA 3L7FB 5KVGH 2XWCA 1KABA 2CKBB 4G8IB 3LSOA 4P9HL 1XX9C 2GUYA 4KHTH 1BM3L 1JZHA 2AABH 2WYHA 5T1KD 4F57H 4AQ1C 2X2IA 1SPDA 4KHPQ 3P11H 1CL7H 3P3SA 1KFGA 3QDMB 1KCBA 3DVGA 1E30A 4QRSA 4AYSA 2WM0A 2VN6A 4M8VA 3S3CB 1Q72H 5HHOD 3ESNA 2OYLA 4QHUB 1KFAL 3MEFA 5I0ZA 3O4OB 1JTPA 3WBDA 5ADOL 4HD5A 5C1MB 3SD5A 3U0WH 1T1YA 1GUOA 2QGEA 3LVTA 2PR4L 2P42B 4X6BB 1HH6B 5AZ2H 2PMZB 5IROD 2JA5B 3S5LA 4QT5A 4AMKL 5KSVB 1C5CL 2DAVA 3CSYB 1O78A 3QIAA 1Q81C 4MA3B 4GKKL 5I6MA 1I7ZB 3M4PA 2KBNA 2WWOA 5A2JH 3A8KE 1JJCB 3FQ1A 1U8NA 5DUBA 4C83A 1BZ9B 5DEGB 4V11A 4JR9H 4EXKA 1GC1L 3CLFH 4KITB 1JGUL 4PHZA 5F9AC 2CRYA 3GMLA 3IXTA 4YSOA 7FABL 3APCA 1GH7A 1NPNA 2CWRA 5IYCH 4YCUA 2JNZA 3EZJB 1U8MA 4ZODA 3S35H 4AVJA 2QHLA 2VN3A 3EYSL 3MXPA 3O2WL 4K73A 4O58H 1DO5A 3L3GA 2FECL 4WEEA 1G43A 2QKIB 4P5KB 4XT1B 2FLRT 2GJJA 3NFPA 2V7NB 2W9EH 4FJ6A 4Z7NB 2F4VL 3RY6C 2FYYA 4YHYB 1E90A 2CALA 4I1RA 4NX0A 4M6NH 4N0YL 3HN8A 1T04A 4KOCA 1XMWA 1TQCB 1ETJA 4A38A 5L7XH 2EE6A 3B5GA 1J1XH 2V5YA 2BNRD 3BLBA 3BAKA 1USZA 5I8OH 3U0TB 2R4RH 2EVBA 1MLCA 3SODB 4OGQC 3VH8G 2VW9A 2W60B 4HN7A 4UT6H 3TRZA 4DCQB 4J7RA 2A69C 2BX5A 1UOVA 2KCNA 3GTPH 2FX8L 2DW5A 4GNKB 1F86A 4WV1A 3EIFA 3OGOE 4RRPG 2W65B 1S9KC 4OBSA 5G5DB 3H9SD 3UROR 5C7XH 5I1KH 1LWJA 3CN4A 4NM4H 3MXVH 1EEZB 4XB7A 1N2RA 5IP7H 1C7YA 1F4YH 5IBUB 2PTVA 3UTZB 3QIWB 4ZYKB 2EOTA 3IGFA 4LLDB 4CJ2C 5DZOA 3VSVA 3SQOH 4OBRA 2RIKA 2UYLA 2XTLA 1JNJA 5B39B 1HZHH 3OJDB 2GTZA 3FHEA 4QF1B 4N1EA 3KLSA 5C8JA 3I2CH 1M6OB 3H4FA 1KELL 3PV0A 4JPQA 1E5UI 4DUYL 3GYRA 1YNJD 2IGFL 4UV4L 3I6GB 3UIZA 5A2LH 4KVNH 5HGDA 4PVMA 1DTUA 3EFXD 3Q9QA 5I9OA 3QO2A 1UACL 1R9TB 2JCCB 2V5RA 3F6JA 3IMTA 3OF6A 4P4KA 2NLJA 2Q8AH 3VB9A 4G80B 2NNFA 2FX9H 1CFTA 3FB7A 3KYOA 3MV7D 1FH5H 3MRCA 4AEIL 1HCYA 1VZGA 5I73B 2ATKA 3IDIA 4ZOBA 3NAAL 4GO9A 2E2HH 5LL6X 3FU0A 1L0WA 4H8WH 3TCLB 3PUXA 1A6PA 2D3VA 5MERA 1T2QH 4NFCA 5CF3A 2WSKA 2W38A 5CN3A 1Q0YL 4JJOA 1HKLL 2MCMA 4GBXB 4A3LG 3KLHD 2AJ3A 5D8JH 1ILSA 1KLGD 1BX2A 3PXJA 1HEJC 1E24A 1LTLA 3T6ZA 2LLGA 5DYFA 1NIFA 1XT5A 4EI6B 2X5PA 1IM9A 2VUKA 2PCFB 3LZRA 2EY2A 1BFSA 1HKFA 4PRDA 2I0QA 4YDKL 4NPYB 4ENZA 3X17A 1QQDA 5ICUA 2GHWB 3DHPA 4GIOA 1T21A 2C9QA 3RA7L 3HUJE 1UM5L 2F5AL 2TSAA 5BV7B 2EVGA 4APVA 2NYZA 4OZIF 4HPOL 1K73C 2C3XA 4JW3A 2ICEC 1KCVL 4NB3A 2YD7A 3ABMB 3CIAA 3HBPA 4AZ8B 5M9OA 4ANUA 5DJXB 2F0DA 2HYMA 1EJFA 3K6FA 3JAME 4XPFL 5CEXB 5DZJA 1RUPL 1QVOB 3B9KC 1PFSA 3OTOQ 4PJBE 1BQLL 4OM1H 3RNQB 4NKOB 2BO0A 2OX5A 4AUJA 1RZJC 4L4VB 4K3DL 2PNHA 2NX5D 3CXDL 4ID6A 5J13B 4ZZFA 5DVKA 4LWCA 4MTMA 4JG9A 5TGBB 2I46A 1NEZB 4HCFA 1YZZA 4MWFA 2Q7YB 3O6FA 3KL0A 3IFTA 2ZD0A 4BH8B 3K72B 3ULAB 4A2MA 2ZOUA 4UOZA 3Q5YA 3DM1A 2F7OA 4PCKA 3SKMB 1JJGA 4J3UA 2F0LA 4JI3Q 2EXYD 3GJFH 3X1GA 2A83A 4YO0B 2YPVL 3CU1A 3TBYA 1U21A 4N2FA 4WK4B 3FQTB 3BWUF 5HJGA 2VISB 2EYSA 1M05B 4G7RB 2VQ4A 4IDLA 1XB3A 3E2HB 4JFFB 4IMKC 1IHZA 3QUMH 2PTUA 4PGJA 4KJNA 1Q9KB 4BZYA 4QR7A 3GBNH 4RZKA 1EXUA 1NM9A 3MFFA 1HUMA 3QYNA 5DJDB 2OMTA 2WTOA 3LXUX 3UXFA 2A9CA 4PLJC 4TSBH 3OKNB 1JFQL 3L95A 2VABB 3K0XA 4HLEA 3J7ZC 2NY1C 1FGNH 4XCFL 4Q2ZB 4MCYB 2KQMA 2HT3C 1QA9A 2EDHA 4NIKB 3TOPA 3FQWB 2FO8A 5IT9L 2UY7B 5GGVY 2EYTA 4Q6IA 4YHOH 1QAWA 3LZLA 3VFWA 1NAPA 1M2VA 4X0NA 2K4KA 4CMHB 3UO1H 4X80L 1X5JA 1IL8A 2QVKA 4R2GC 5LGJB 2AJXL 1U8PA 2FZ3B 2XZQL 2OYMA 2G75B 5ID0A 1J0YA 1N8ZB 2APFA 4IOFC 4CVWA 3H94A 3L2PA 3VXMB 1KF9B 2V0AA 3PABB 5DA0B 1D7DA 1OAJA 2HLFD 5T3XE 4AXWA 1G6RB 3QR0A 4UOJA 4CSPA 1ACZA 3ZKSD 1AZVA 4R7LA 3IETA 2UUAQ 1IC4H 2CO1A 3GSXA 4EQ5A 3CFIC 3WS6C 2NY2C 5BS0B 2YD8A 1YJDC 1WWCA 5K5YA 1JZJA 2H2PC 2WK2A 3O8XA 1D6VL 2L7EA 1CXIA 1TFHA 3OOCA 1LEKA 1G7IA 2LVEA 5FYLE 2VS1A 3DX6A 2XWJA 3CAFA 3HAEG 3CD6A 3WE6A 1P4BH 5H8DA 3U6RB 1SXAA 3HFML 2UXBL 3H7LA 2K33A 4WHDA 2YUZA 3S0PA 3FO0L 4POZD 3ES6B 4KTDH 3V4PB 3LY6A 3W3AA 1YUKB 3EYVA 3OX8A 3ND9A 3OAWA 4FOMA 4XH2B 2D7MA 1E9OA 5GQOA 1SY6L 2ESVE 5F0LB 4TRDA 4OD2A 3AT0A 3HS0A 4QUFA 4JQIA 4WUUB 1I50H 1VQCA 1XCQB 4G9FA 4IDJH 3L17A 3MC0A 3STLA 1XD0A 1TR5A 2IOOA 4J27A 2RBLA 2EY5A 3G9AB 4OJEH 2RTTA 2DQMA 1CSQA 3KPRD 4M03A 4JFED 2QHRH 1KJ2B 4OH2A 1R17A 2VDMB 4W70A 2WSPA 3QIUB 1DHKA 5I1AB 5GS3A 1T7YA 4F7CA 5H2BB 2G5RA 1NLBH 2W0FA 3B34A 3MBWA 4YWMA 3SYOA 2BW4A 2ZX5A 1SJVA 3E80A 4HCSA 3V0IA 5FF6A 5HYJE 2AQ3A 1SSOA 2J8UE 5E1AA 2X42A 3GHEL 1C8PA 4H7VA 4B9GA 5JXEA 3L3KA 1UM4H 1KB3A 3FPPA 4MJID 4X7DC 3NEMA 4L3FA 2AEWA 3WN5B 5I8EA 1A3UA 1P1VA 4JKPL 5K9QG 2JK5A 3NENA 4EIBA 4X8XA 1JNNL 2D9QB 4QJ5B 2VGLM 4QIWE 3VMNA 2Z4TA 4ZXBC 1P5UA 3TCTA 1DDHB 2WWNA 3EJZC 4C3HB 3H0GG 4FYRA 1XJVA 4UQAA 5HXMA 4JRXB 3UTSA 5I17A 1K4DA 1FL6B 1AOZA 3T1FA 4ZX4A 2DYRB 5B8CA 4YY3Q 1U2YA 4XT3B 2WQVA 5E00B 1WTWA 2OMXB 5LGHH 2F54E 3EQLC 3GSNA 1BIHA 2N1TE 4XO3A 5G4MA 4KWUA 4GMTH 1RZGB 3AFLA 2VMFA 1VKXA 3U9OA 3DUHA 4JFPB 2GY7B 3NH7L 2IWKA 4LARH 4OQ1A 1A1NB 1D1KA 2FHBA 4UIKH 2C7UB 3QC5X 4L3EB 1U8LB 5J22A 3ATEA 4X5LA 5DHVH 2A73A 2VAAA 4GRMA 1BLNA 1HILB 1IGCL 4OZFB 4A3KH 1JAEA 4ZW6A 4AGQA 2DQDH 3D4YA 4NQCB 3GI8H 1B6UA 2DPKA 3EDKA 3WIIL 2B2WC 1U2HA 4E9LA 2AQRA 4PJHF 4PGBB 1WIUA 4GXVH 4AC4A 4Z8FL 2ITDA 2VDLH 1UWVA 3PWPA 3ZZQA 3S2CA 4P2QD 1QBLL 3FXIC 1V7MH 2J73A 2Y07H 3BUBA 2VLRA 4POFA 4P46A 4D0BB 2WN3A 4XC3H 3V6OA 4XNUH 2R93B 2HKHL 2JB6B 3HG0A 5EZOH 2WBWB 1LTGD 5IVXE 3A56A 4LF4L 2HT2C 2NTFB 3U30C 3CCQA 1EYDA 4N9OB 3M6DA 2ASBA 1NBVL 3D3VA 3RA7H 3HCVB 4NRXB 3FB5B 2ZG1A 4TNGA 1JWMB 4UM9A 3CKIB 1T5EA 2AANA 4A3MH 4UINH 2BERA 4QCIB 4UDUB 3D25B 1BBXC 4FLSA 2HDMA 2HAZA 3D0LB 3WFDH 3BO8A 3K0YA 5IESL 1SMAA 5EU4A 5DMIH 4KTEL 1T9HA 1DSYA 1IGTA 4NKDB 1BF5A 2MOQA 3ECBA 1UJ3B 3UL4A 1FG9C 1AG0A 1G7PA 1NCCL 1VQ5A 3IN0A 3PO3B 3V2AR 4OWTB 1KUMA 1CSPA 3UZEA 2HFFB 3G6JE 4M5TA 5BZZA 5IBLD 2DY7A 4BHUA 2VLKA 4XN1A 2DF3A 5HHMD 3GNML 1E5ZA 1UD5A 4JFHE 2CUHA 4H26B 3ZDYE 3PHQB 4ABVA 5EOCJ 3JWOC 4F3FA 1BZ7B 4HH8A 4ZMOA 1T3FB 2WLLA 4L8JA 4UQ9A 3V4VL 3RTQA 4DR2Q 4JV5Q 4ZMPA 3ARRA 4WCYL 1DSFH 5DVPA 2K28A 1NIAA 3DMMD 1NFAA 1I4FB 4HF5L 2Y3NA 4X8JA 4HFWB 4PEEA 2NQDA 3TZVD 2V5TA 1Q8KA 5C3WA 3C2AL 1JK8B 5J1ZA 3FT4B 1NY4A 2K32A 2Y2YA 1JF6A 4HPYH 4U1LB 5MEQA 1SFOH 1LV9A 4LP8A 5FWQA 4DKDC 3TWCL 3F58H 1RZFL 4CBPA 2VDQB 4UBDD 3GEWB 4HPHA 1AKJB 4PWJA 4PTTB 3UYPB 3HOZH 1A9BA 1PKQE 3MJWA 3STZA 1U92B 1I1YA 4F33A 5EIIA 2XXGA 1MFBL 3T04D 4KJPD 2W92A 2EUWA 3R4RA 3BVTA 3EO9L 4WW2A 4HIPA 4DK3C 2E7CA 2P5WA 2HXAA 4CAGA 3HMXH 5F3HB 2ORBH 4EQOA 1KB5H 1H3PL 2UY6A 3BDXA 5AZEH 3ZOAA 4PJCA 1B4OA 3P40A 4X6FB 1KCRL 2CW0D 1KPVA 5JW4M 3RU8L 5E4XA 3RVWD 4JRYD 2I60H 4XMKH 2H3NA 2VO5A 1A6WH 4R3SA 4YDZA 5CBAE 2KA7A 1MHWC 1T1XA 2XWZA 3M4QA 3NPSB 3T5WA 2OFQA 3UBXA 4OZIE 5J12C 5GS2D 2MTPA 4HWUA 1GZPA 3CZGA 2Y3AA 3RFZB 1TSRA 1CDYA 3ARGC 3KBFA 5ANHA 5IGGA 1Y6NR 2EEAA 3S14B 1YY8B 1D8LA 1ASPA 4MAYC 4YC2C 3ND8A 1GA2A 2ZG3A 5ICXB 3C60C 1EIYB 1HQ4B 4R4BB 1QFWL 1NCBH 4GLVB 1MFEL 2MPAH 4Y2DC 3CVHB 1HL8A 1NAKH 1SLWA 2XFGB 2DY2A 3HOXG 1L5GA 3V05A 3VR6A 4GKZB 3WKYA 4LCWA 2BFVH 2IOIA 3NCMA 1TJIL 3LNFA 1XNQL 1ERNA 2VMJA 2Q9OA 1KBWA 4Z7WB 3U1SL 1KTCA 1WCBA 2YEVB 5DS8B 3V52L 3KYHC 4AMWA 2ZAHA 4DNRB 2PW2A 1WFNA 1ZV5A 4IKNA 4TUOA 3MNDA 5DD5H 1ECYA 2CXKA 3LKSB 1UHVA 4AYFA 4BGLA 2O6PA 2PNRC 1KLFA 2ZIDA 4WFGE 4JPKL 4Y9GA 1A3ZA 3M1BA 3GTVA 4YCVA 2Y6SC 1PS3A 3B8SA 4X7TB 5AW8B 5MEPB 3Q8CA 3RL1B 3STBC 1IQDB 2YOAA 2EVIA 4HZLA 5A6LA 4DAYB 2YAFA 2Y1AA 4M1CD 3ARTA 2NY3B 4LSRH 1FNSL 2MH4A 4X4MA 4MCNA 2NXZD 2C4FU 2EH8L 2PYEA 2CGYA 3EG9B 4FQQB 5D96C 2ADIB 5FOBA 2H32B 2J4WL 4APQA 2VW4A 1K8GA 3S36X 2FMMA 1DEEA 2B2XL 1S78C 3UE0A 1A4AA 1FFQA 1O6TA 1OAUH 2WXRA 1DFBH 1A4BA 3QI9B 1HYSD 4R1JA 3MACL 2GJ6E 4NO2B 2WNWA 5LG1A 4U31A 5KN5B 4R4QA 5INCA 1FFNA 4LSVL 1FLRL 3K57A 1E5AA 1U8KB 4S1SH 1NA8A 3C5SB 3VFVB 1WBXA 4G42B 1TJGL 3U4EA 1IM3D 1D5XB 3HHSA 1U3NA 5HHOE 2DQHL 3VCLA 4ELKA 4LKCB 1W0YT 4TULH 2IH1A 4PRIB 1KJVB 3OAYH 2X88A 4XVJL 4JBMA 1AQMA 2BIMA 4HCRH 4PD4J 2YC1B 3LKRB 4UOW0 1YNND 1IBDA 2OQJB 4LF6Q 1AFVH 5DEFA 4M7JH 4HDIA 4A2GA 3ZUNC 4LF7Q 2HDLA 4NWTH 4IRSB 1BDYA 4LKXA 4XNBA 3VSTA 2ZKHH 35C8L 5AWNL 4YXKH 2A1AA 3LH9A 4N85A 5I1AA 1JOQA 1EL0A 3A54A 2XETA 4M93C 3PGFL 1HSAA 5COYA 2NXYB 3D51A 1CT8A 2GW5A 3HRZC 3KJOA 1I9IH 1CF1A 3HJ0A 4HT1L 1J9OA 4N24A 4QLRA 5JA9A 3NYKA 2TRYA 4TRPH 3IXAB 3MLYL 3LS4H 1HXMB 5GRZA 3NQTA 1VADB 3EYFA 1PFCA 4P5TB 5D1XD 5BZWA 2ZTEA 1E0OB 4APXA 1NEPA 5JUEH 3RX9A 2BRQA 4PUBH 4OV6F 4FFTA 1OALA 3PDGA 3MUJA 5KANG 4H5SB 4ZPVB 4OIFA 3IFPA 4GS7B 1N36L 3QO0A 4AT6A 3RVTC 1AR1B 1TDQA 4X2UA 3TNNB 4NQXB 5E2VL 3B9KA 2NR6A 4MRBA 3S37X 2D7OA 1S7QA 2WQWA 4JCWA 2NDGA 2E8YA 4ODVL 2H1EA 5F1NA 3UZVB 5TDNB 2WIMA 1TVXA 1FO0L 1F11A 1MQ8A 3T4AA 2EYRA 5IOKA 1ESOA 1QRNE 2BSCA 3A24A 3VFGL 4FADA 4AV4A 2BSED 1KNOA 4HMIA 4JBJA 2IX3A 2XKNA 3BAEL 3K4AA 2QCPX 3MA9L 5FCSH 3X1NA 4BFFA 2Y5EA 3ISWA 3P9MA 1WWAX 4R9HA 4AYBG 3DETC 1COBA 3BDBA 4PJDF 5L2KD 4LVHB 1IILE 2MJ8A 2J6WA 5I0VA 5CAYB 1BBWA 2VZAA 5E7FA 2X9ZA 1NGPH 2WLNA 3GBEA 5BRZE 4A3JH 1M7UA 4HW6A 4KI5F 4YBHA 4WVRA 3W37A 4IMKA 1PH3A 1MPAH 4A7GA 5GGTH 4P23C 3TZUA 5I1HL 4Q74A 3TBWA 2AKRA 3FTZA 1ZLDA 3C6LB 4U33A 2XRAH 2ZT9C 3BDYL 1NTDA 3FDTA 4P3DA 1PNCA 2PW7A 1MI5A 4ZFGH 1A6UL 3UZQB 5C08E 2EKJA 5AVVB 3IAPA 2GAZB 3BIKB 3FPXA 5E5MA 1JJUA 2Q0ZX 4RG1A 2ZCHH 4BEIA 2JI2A 5FB8B 4E68A 1F0LA 5E6SB 4CJ0A 2DQIL 3T0WA 1HXKA 5F71A 2Q8BH 5FUZL 2JA8B 2XKSA 1IQWH 5AAMA 4HWBA 4MJ5B 1XWVA 3B6SB 1WH0A 1F9QA 1CA5A 2E47A 5CSZA 5BUPA 3RWCB 3RDTC 5IMMA 1E0BA 3ECVA 4PRHB 4JK0D 2V2TB 1NOAA 1U0LA 5JW3L 4BUQA 4QB4A 1G6PA 1J6QA 2EDGA 1CG9B 1KG0A 3DI3B 5IBUG 2R1YA 3I8ZA 2AK4E 4M8RA 4GKLA 1MCNA 4JY6A 1OF2A 1KGUA 4PJHE 3VFSA 1BJ1H 4P2RB 2R1XB 1G9NL 3FF7A 2VNCA 3QXAB 2WAQB 1QWUA 3RBGA 4O42A 4ERSL 1UWEL 1AXTH 4W6XB 5J3HD 3OPUA 1JT8A 3T1YQ 3X13A 3JSSA 2Y7NA 4XPTH 2UUCQ 2FATL 3FNKA 4M3JA 3BVNA 3CFMA 4DO5A 5JNYB 2BCKB 2ZE0A 3BN9C 3DROB 4DGVL 3FKIG 1BAFL 4EBQL 5C07B 4MMZC 5DM63 5D72H 3WOVA 1L1OC 3ERQA 3B8YA 4MMXA 1LK2A 2XZZA 1LT4D 1PX8A 2EXZA 5DTFB 1GMIA 1JICA 3FPUB 5CV7A 5DD1L 5F3BB 5IJBC 3FU9A 2E6JA 3NRPA 4KKBC 2BDNL 1QKZL 2X87A 1Z5LA 4KQ4L 1M1SA 3GRWL 3T65B 5LQBL 5CV9A 5IGDA 2QW7A 4W9EC 4OFDA 3REVB 3K59A 4GIAA 4DFIA 1D7FA 4JANB 3K5SA 2ISDA 5KZCB 4IPHA 2VRQA 2WVVA 1BOYA 3U9SA 4TYUA 4ZX6A 4GY4A 4PWHA 1ZSDB 2ZONA 1E4WH 2JH2A 4WTWA 4JO4H 1JJ2A 5HI5D 3BWUC 3K2UH 2NZ1D 4NKQB 4ILWA 1MCPH 4G7YH 3AACA 1Y18A 3CVIL 4ZMQA 1RJCA 5KVFE 5A1AA 2ES2A 2ENPA 4AQ8C 4CKVX 4XNAA 1FGVL 1NIEA 1RMFH 1QLEB 4XVUC 3RILA 1N32Q 2CLVB 1M3JA 3R1GL 5E8EA 4NRZA 5HDQL 1J5OH 5AEAA 3DO7A 3O3EA 3BP5A 5IQ7H 3L9EA 1GGBH 1KYUA 4JM2A 2WXMA 1BPVA 2LGNA 2AJYL 2BS9A 2DQTH 3BI9X 2VT0A 1CGSH 3DX7A 1DJXA 2WKLA 4HKBA 1S5DD 4F58H 3S7GA 4NN5B 3OMCA 1G0YR 1NCOA 4ZXBA 1BGXL 1BFOA 1I1AD 2KVMA 3K8MA 2X7LB 3VFMB 2AS5M 2X05A 2VB3X 3CV5A 3BSZL 4TUUA 5IB4A 1V8HA 4HCEA 2PABA 3QYCA 4QRAA 4PS7A 1TWCB 4BY1H 1ZTXE 3R7QA 2F58H 4PJEF 4IPGA 4YX2H 5I30L 3LXAA 1QTYT 3GI9H 1TQBB 2DLEA 1X5XA 4JJHA 4RMUA 4IEFA 2F3IA 3KGUA 1KCUL 4I77L 1MIEH 3KXFB 4V33A 1Q9OA 2P5ED 1PYBA 4UIMB 4EI5C 2ZUTA 4CC4C 3VXRA 2WLMA 5DSCA 2AERT 1PW3A 3KHQA 4F15B 2AXFB 3F2UA 1CE6A 2F74B 2DJFC 4UNVA 4C4KT 2EP6A 2HJLB 5ALCL 3IU3B 4WNQB 5FV2A 4MD5B 4YFLI 5EPJA 3FEWX 4YN3A 1DFXA 2FHCA 1X9NA 2FHFA 1CK1A 2DH3A 5LWYL 4PV9B 4KK6D 1BSIA 3SHLA 2Z4QB 3TREA 2FJUB 2HG0A 1N34Q 4ODHL 5GADC 5J0BA 1DJZA 3QJHB 3LPFA 2VQFL 1IKFH 2R29L 3W11D 5LDUA 3L08A 3APMA 2MOVA 1TETH 2EDKA 3BWSA 4X99B 5F7EH 3GSOA 2KC0A 2R0KL 5EPMB 3BD4A 1XB6A 4ZDHB 3BP6A 1BO0A 2IHEA 1OP9A 4GINA 2I5MX 7PCYA 3ARBD 1XGTA 1ITCA 1KTLA 1DZBA 3D4GA 4W9FC 4JPIB 5FUCE 1A6TB 5IMLA 4ZUSA 1OP3H 5D1ZB 3F7VB 4PJBA 2Y06L 1DQLL 4ZQKA 1MVFA 1NGWA 5IP9H 4P5MB 3ZDWA 4EZJA 2E7BA 3NBNA 3FT2B 4HXAH 3I70A 1I9JH 4MJ4A 3ZKMD 4GRLA 2P7TA 5DQDL 2CIKB 2IF7A 1VENA 1A62A 4HMDA 3RGVC 5D3IB 3MRKA 2QMJA 1IYUA 1PXUA 2C3HA 2OI9B 3KPQB 3ROLA 1ZT4B 3CBJB 4YQXL 3P3RA 3RLFA 3GTKH 5J6GB 4HUKB 4Y5VC 5IQOA 4U4BA 5D7IF 3TVMB 4OF5A 3H9YA 2NUTA 1MRDL 2NYYC 5DA4A 1L0XB 2R69A 4Y4FB 1QB5D 3UO8B 3GD1C 1JWUD 1KIUA 1A9EA 1SHWA 2BHYA 3FKUS 3FS9A 1KIRB 1YYLL 3ECUA 4W68A 3DIFA 2WBJB 1UWXH 3WV0A 1S3RA 3ZDXF 3FN0H 5AG8A 3EHBB 5KTEL 4WJWA 1XDTT 4JJ5A 3F04A 4FAAB 3Q2CA 4QMGA 5M5WH 2QPUA 2PR9A 3RVVD 4ZMTA 1Z9OA 4GEIA 3ULUF 4HS6A 3MJ9H 5JORA 5MI0B 4J6IA 2C26A 4DR3Q 1W72L 3BD3A 2DJ4A 1JN6B 3T0VA 3U7WH 4MDRA 4YFEA 5T33L 1TS3A 1EJ6A 4YDJB 1E7VA 2VB2X 1KCWA 2BIIA 5IJDC 2CO6A 3C8KB 2AJUH 4DKEH 4IGBC 4NCC1 3ZE1B 3CBRA 1W16A 1U33A 1VSCA 4N90E 1MFDH 3D09A 4FNLL 2FJ2A 5E6IB 2WQ8A 4JPSA 2WZPD 1QASA 4OUUA 4EQ3A 2HRLA 4RFNC 1LGVA 2XTJB 1MFNA 2CCWA 2YHGA 4B3MQ 1EAOA 1K83H 4IN3A 2QPSA 1GUNA 4GW1B 1RXLA 5TH2A 2WB7A 4I7ZC 1Y1WB 3NSDA 5I0YA 4ZFOB 1JXDA 1NC4B 1RUKH 2PWHA 3RJOA 1OO2A 2VLLA 3MLZH 2C3WA 5GGSY 1T7XA 1KN4H 4D9RE 4LF9L 5E4EB 4WGKA 3DOHA 3WFHB 2K9FB 1LDPH 2PPEA 2PYFB 3BGMA 3ULJA 3CZNA 1QI4A 5LMUQ 3AG4B 3F84A 3FTGB 4ZUVB 5A2FA 4X5WB 5CD3A 4C3HG 2K0RA 4L29A 1IO4C 4BY7B 2IANE 4KHZA 3EOTH 1PTOD 5IFAL 1DJSA 1AXSA 2K6WA 2X4PB 5KOVC 2E9IA 5C9KA 3FBKA 2ZTBA 1PF3A 1H3XA 3DDFA 4UYPA 3K7AH 3BQUB 3N5AA 3EJCA 4DP6X 1A3QA 1YEHL 2KHIA 2ESVA 4NO0B 1RHFA 1GZHC 1M42A 3FB8A 3RWEB 5I8CA 5JXAH 3FQUB 1H19A 1UE5A 3IJHB 2I7SA 3IT8D 2Y7MA 1MGSA 2D7PA 5TK2A 2KOLA 3KUPA 3SO3C 4GLRI 3PJSB 4YHNA 3VRJB 3BH4A 4RGMB 5JDJA 4ZLTF 3SQBA 2VDRL 4BHUI 5I6YA 3OAUH 3PHOB 2NSXA 4N6QA 1MF2H 2BS8A 3EOAB 3IU4L 3R06B 3HZXA 3HZKA 2EXSA 3TJEH 2X2JA 1TU2B 2OCEA 3VYNA 3MOAL 4XBGA 1FJ1A 1ZDQA 4OZFG 1LTTD 4GW4A 5DAUA 3QFDB 2J88L 3UABA 1TIID 4N87A 4PJDE 5HYJA 3BVGA 3FHWA 4HGWB 5JHLH 3DARA 3GLDA 4NXML 1TZIA 3QFJB 1OTCA 4LAQH 4MXQD 4WO4C 2FB4H 4QAWA 1E3ZA 4Z3EA 2C7FA 5JQIB 1XXFC 5I1CL 4RCNA 3TBTB 2Z8WC 4M1GH 1EXHA 1MCQA 4B5ZA 1ADQH 3OLGA 1BAGA 1J0IA 1P6FA 5AAPA 4JHUA 4GPVA 3STBA 1LO3H 4HOMA 4YWKA 1JZ6A 4M62L 1FYTB 2R93G 4W9IC 1GJUA 5FYKD 3KOJA 3EW3B 4PJ9A 3Q43A 1JB7A 4OCYH 3WNOA 1U8JA 2PTTA 3FRPA 5FYJD 2D03L 4UMGA 2KHSA 4YHIB 1UH3A 5GPRA 1E9PA 2WACA 1J1PH 1M8AA 1WA0X 2CDGA 3QUXC 5KSVA 1JYWA 4LNQA 3C87A 4PN6A 2F54A 1E5YA 4UI2A 2MWCA 1WRFA 1INDH 2NNAB 4LU5H 4FL4B 3AREC 4U0RB 3PNWA 2HKAA 3NESA 1M90C 5DC9B 1SDAB 3ARDB 2BVQB 1N19A 4NJAH 4JDZB 5I66B 1KULA 4L4TD 4PRPA 1REIA 1MH5A 4FNFA 1QEXA 1X4YA 1NGZA 3S2HH 4KX9A 1GOFA 3FB6B 4QRTB 2CIIB 5F6HJ 2YWYA 3CFCL 3PO3G 3LWUA 1JGVL 3PCYA 5C86A 1T7ZA 2X4TB 1HCVA 4ICXA 3UBXI 1XF3B 3OXRB 3T0BA 3FO2A 1IBLQ 4PS4H 4UTAL 1TMCB 2JKNA 3LKPB 2BLFA 4Z3JA 4BFNA 1D5MB 3SBWA 1JGEB 3MUY1 1JPFB 3MMEB 1HQRB 4I3GA 2E5LL 3N85H 3PUVA 3GMOB 1KYOK 1WBZA 3L4XA 2YD6A 1FNUA 1Q0XL 4P59H 3SZ6A 4I3SH 5CS7A 1FR3A 2IEPA 1EANA 2Y5TA 4FKKA 4NHCL 2PCPB 2X4UA 3HRZA 1YUHB 1QCBD 1I4QA 2FT8A 3GDCA 3II2A 4N2BA 1HXYA 2YK1L 5DK2B 4NM8H 3ISRA 3VXSB 5H4YA 3NEEA 3PPSA 4DR6Q 3BPNB 3FFCD 3N1FC 4PJFF 3ZGIA 1JF5A 1JHKL 2V1CC 2OMZB 3P30L 5IVXA 4GG6F 2HVKB 1ZE3H 1PH8A 4YE4L 2CNYA 3WWVA 1JZ8A 2GCYA 5DK0A 1FPTL 4OLXL 5ACMA 3LRLA 5EJWA 1YI2A 4A7UA 2FX7L 2F0SA 4WEMB 5GS1C 3DO4A 1MNNA 1S7TB 1Z32X 1LO5A 2PN5A 4F9LC 1EBAA 4X5QA 4LUVA 4HJSA 3U48A 2NRDA 4DVRL 3SEBA 4UQBA 1HSBA 3G5VA 3K71A 4OLUH 2PW1B 4F7EB 3EGSA 3N6RA 1SHSA 2XBTA 2R7EB 4QRQA 3N41F 3MRJB 4RBPK 2ZJQA 1GJXA 2NN6I 1F90L 1QP1A 2CKNA 4I18B 3QDGB 4K3EH 3G6JA 1CCZA 4DV7L 1L4IA 3GZPA 2OLDA 5JW4R 3ABKB 1QSEA 1RZ7L 1JFHA 1VPOH 3BE1H 4GQRA 4D9LH 1UB6A 4JVWA 3C5JA 1XHHA 1E6JL 2FIKA 3ULPA 2IAMB 3U79A 4BXXG 4O51A 1A7NL 2AVGA 2OA9A 2ITEA 1G51A 5C0XG 4JFOB 1V3JA 2R56H 4L1HA 4P4KD 3PWVB 4A39A 2ZOWA 3ZQXA 2CHBD 1LTXA 4G9DB 4I5BB 4XNMB 1DP0A 4XPAH 5DR5L 3C46A 1WHOA 2SODB 5CIPH 4B50A 4OXPA 2Q3AA 3UTTD 2HRPH 3VACA 3V5KB 3HB3B 2GUOB 1EGJL 3ZKNC 3ARFC 4I0PB 3K3QA 5AKRA 1I85C 4JN2A 4JFZL 1DBKH 1GJWA 2X4SA 4G3YH 1AW7A 4JB9L 4LVOC 3VA7A 3OQRA 4N6RA 3MBXH 1PKQA 5SWZE 2O61B 1NTGA 4Y19D 3CDYA 1EU3A 1F2ZA 2OCFD 4QJ4B 1HFNA 4KD3A 4HLZG 4PTUA 4XN4A 3UGUA 5KSAC 3LQZA 4C56C 1N10A 1VFAA 2OMUA 1PFBA 1CICA 3SOBL 3R8QA 1F9PA 3BHBA 4OKDA 4X6DF 2EO9A 3JZYA 5FGBA 2R7ZB 4I3RH 3TURA 4FFZL 4I89A 1SN0A 1PAMA 2BVPA 1CLCA 2EXDA 2H6OA 3C6SB 2VMCA 1SJEA 5D1QC 3K74B 3U9PL 4FA6A 5BOZG 2Y36H 3T8VA 1LE9B 2XQYK 3P4LA 1UWYA 5KYLA 2EDLA 3BPLC 5GSVA 2JSFA 1LM8V 3LZPA 3PUZA 3LIZL 2WXQA 1E27B 3Q0HA 3V7AE 4DQOL 1IMHC 4TLTA 4H8HA 4FZEH 2K6AA 2NYZD 3AYHB 1OSYA 2IADB 4LHUA 4MNQD 5AOLA 4HG4K 5LHDA 4X98B 1RUQH 4N3TA 3ZKXB 3TSSA 4GSUA 4MN3A 4BRVA 4AYEC 3T6VA 4GP8B 3MRQB 3SDXB 2P24B 3NFNB 3MJ7B 4G8GA 5G4OA 2X0VA 4BINA 4CNIB 5F9DC 1KRSA 1LL1A 1RK1A 4KDTA 4HGKC 1XGQA 5M3FB 4JLRA 5FDWB 3NTCL 4PWFA 2ENJA 5CV5A 3QORC 5CJXC 1C9SA 2P47B 4XDXA 3DGDA 3LDBC 4GG8B 4GXUN 3KR3L 2BNQB 4AVIA 4ES9A 3RPIA 4YXHH 2D0OA 5IUCA 2YD2A 3B2VH 2BH2A 2JJTA 2Z6FA 3MO1A 3X12B 5IGEA 1GS7A 4DUZQ 4P9ML 4HIIB 4H0IA 1EZUA 2A1WL 3G5ZB 1A4CA 2CUIA 3M4OB 3O6KH 3QDJB 5ERWA 3VNYA 1GMEA 2X4RB 4JHAL 3G71A 5D7EA 3Q05A 1IYVA 2XN9B 4R26H 4N8VA 5D7IE 5HY9B 4KI5C 2QZ5A 3BEWB 5JEAH 5HYIA 3ULUE 2R2BA 3I90A 4RZCB 1ZT7A 2J2ZA 3T71A 2IDFA 2E7MA 4NZFA 4QTHA 3ZDXE 4QRUB 1INQB 2FGZA 3AXIA 3GK8H 4U2YA 2ZP0T 2I7OA 2R2HB 4ZO8A 3MGTB 5EORL 3GTGH 3LZFL 4Z7OF 5FYKL 1ORSB 3WL9B 4XX5A 1I9EA 2QDLA 3CE1A 3WFEH 4CVZA 2WOYA 5EBDA 3KDFA 4I1PA 1LABA 3K46A 4G7ZC 4JFDE 5K9JL 4TL5A 1SNMA 4H1LA 5HYSB 2UZXA 2NVYH 2CCLA 1IGIH 2XACC 4XMVA 4YS4A 2HLAB 2PXYC 4L8DB 4UB0H 5GQBA 3MLTB 4QHLA 4XRCB 4E5XA 3K6SB 1WTPA 1IC5L 3QZLA 4KY7A 2IWEA 4PJGB 3CLEL 2OXHB 3L5HA 2OMVB 4LEBA 5BO0D 5LXGL 1C48A 3PS6A 4HJAA 3AXHA 1N3NA 4FA8A 3QEGH 1TQUA 1T0PB 3H4HA 5INDA 2X6LA 5EOCH 3KG5A 5TQ2L 4C8XA 4CC4A 3UAJD 2NVTH 5BPPA 2I5YL 4TVPH 2B08A 2BY1A 2ITCA 4CU7A 1KNAA 1DL7H 4ULLA 4HIEA 3UPCA 2CDEB 5FLVA 3ASOB 4EVNA 1D6EA 4NZTL 3HC0A 1QSFE 5E99L 2G4GA 1YNTF 1NC2B 1DO6A 3N43B 1XEDA 5GIRB 2IQ9L 1H3UA 2WXIA 2FQEA 3Q8EA 5I19L 3QIBA 2B59A 4U3SA 4BH7B 3SO5A 2EIFA 4BK5C 2Y7OA 4XHQA 4KUCD 4HJJL 3ZO9A 4Y8DC 2EDJA 3P7JA 2WKGA 2VXVH 5AW2B 3W39B 4A3BH 2FNWA 3QEHB 1C5BH 1K0RA 4IJ3C 1U41A 4OX9Q 4GKKQ 3P73A 4LSTH 4WWOA 4JQVA 2CH4A 5D6DA 3RX7A 4KNQA 1FZKA 5DVNA 5CGYC 3ABLB 5L9DL 3H54A 2IFFH 3QCVL 2O4XA 4I2XB 3J7A5 3O3BB 4R90L 3SDAD 1UVQB 4PHXA 2XA3A 4JW0A 2KYIA 4ZOCA 3PIQB 2VUYA 3WEOA 4MXWH 3ZYIA 1TUPA 2HPTA 5KW9H 3M17B 1K8DA 5HDBF 3GTPB 2A6HD 5IG7B 4MNOA 4MDIA 4CL7A 1N59A 1F8TH 1NSNH 4XGZA 4U1MB 1RKRA 1ZLEA 3QXVA 2Z64C 1N6QH 1X7QB 5JIKA 1M53A 2FK9A 3I9GL 4S11A 5IIEB 5IR1B 1WI5A 3OWEB 3TO4C 4J3OD 4PBXA 2WAQG 5J11C 3BX7C 3VWKC 2PO6A 5FLMG 2TRHA 2DIJA 1TO5A 3DUZA 2Y6TE 4Y5VA 5BRZA 1ID2A 1F4WH 1ZANL 4N0UE 3C1FA 3HI1A 2DY8A 1CB4A 1FQ9C 1ROWA 1JGLL 2QQKL 1WAAF 2HG5B 3UTQB 3UTSD 1K4CA 4BKLB 5AB0A 5HHQB 2DQCH 4AEHL 1OSPH 3EYUL 2V3DA 1NGQL 1XIWC 4ILDA 4YDIL 5I1DA 1HL4A 4QOKB 1N0LB 2F53B 1PYWD 4HISA 3NEXA 4JN1H 5T1MA 4OV5B 5C08A 4WI3A 4Q6KA 1H8SA 3SDDD 1TITA 4L1BA 4B9IA 3DTXA 1CD8A 2E4FA 3FQYA 4BYHA 3H3KA 1CJYA 3RHWK 3A0JA 2E2HB 1CFQB 1A1MA 4FQLL 5C0BB 3CC1A 4WKZB 2R1WA 2VLJB 3DYPA 1NBWA 4JG1L 4Z7VB 4C1NK 2CFMA 4IGBA 5DD3L 2HH0H 5DHEA 4ANWA 4B3RQ 3FCSA 2DQUL 2R9HC 4JQIH 4DP8X 5TDPA 4AQEB 3BYYB 5G3LD 2BNRB 2N88A 4P4RB 2CHNA 1LE5A 2AK4A 4F2MB 5GS0L 3CVBA 3O6LL 3HHRB 3JWNH 3SKOB 4BIKA 5JHDD 4MQSB 2F0QA 3LB6C 2AI0H 4JDEB 8PAZA 1JI1A