1SNMA

Active site mutant glu-43 (right arrow) asp in staphylococcal nuclease displays nonlocal structural changes
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPDTKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THERMONUCLEASE PRECURSOR
publication title Active site mutant Glu-43 --> Asp in staphylococcal nuclease displays nonlocal structural changes.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
total genus 35
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1990-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1snmA00
1EY8A 2F0FA 3U9OA 2EYMA 1EZ6A 4KJNA 5ISRA 4ID6A 1KAAA 4IZ8A 5K5PA 4DU9A 1SNQA 4HMJA 1STAA 1SYEA 1TT2A 2O4XA 2F0VA 5CV5A 2F0GA 2LKVA 5DEHA 1SNMA 4MIUA 3EVQA 4KY6A 2F3WA 3MXPA 1EYAA 3OMGA 2F0DA 5IGCA 5EKKA 4HMIA 3NHHA 4PNYA 1SNCA 3SK5A 2ENBA 5IOCA 2EYPA 1A3TA 2F3VA 2F0JA 2F0IA 2PZTA 3D6CA 4S3SA 4ZUJA 2OEOA 2F0LA 3HEJA 4N9TA 1SYDA 5KIXA 5I6YA 1KDAA 3D4DA 1EY4A 3NXWA 3PMFA 3NP8A 4LAAA 5J1ZA 2F0NA 5C5MA 4E6IA 5KYIA 3SK6A 5IGGA 1STGA 5IIFA 3HZXA 2OXPA 1NUCA 4QB4A 3BDLA 3QOJA 5M9OA 4I65A 3T16A 2SNSA 5C3WA 3MHBA 2F0QA 1EY5A 2EYLA 2RBMA 5F2DA 5JOBA 1RKNA 5C5LA 2HQEA 4ZUIA 5C4HA 1AEXA 1F2YA 2PW7A 4RKLA 4WORA 5E3FA 3MEHA 1TQOA 5KGUA 4K14A 3R3OA 3TP6A 4K2LA 1SNDA 4EQPA 1KDBA 4K5WA 1SYCA 4R8NA 2F0HA 2KHSA 5J22A 1KDCA 4OL7A 2F0PA 2WACA 1EY6A 4WRDA 2M00A 4F7XA 3SHLA 5IGFA 5JAVA 2RDFA 1F2MA 3ERQA 3C1EA 3P1HA 5EGTA 5NUCA 3TMEA 4F8MA 3S9WA 5CV4A 3LX0A 4K5VA 5C6AA 3EJIA 1A2UA 2SOBA 5CV9A 3MZ5A 5IODA 3QB3A 4N9PA 3VA5A 5J39A 4EQOA 2RKSA 3P75A 4K2KA 5EKLA 1ENAA 1EY0A 3DHQA 4IUNA 4NDXA 1JOKA 4QF4A 5CV6A 1STYA 5CV7A 3T13A 1SNPA 1EZ8A 1A2TA 4KD3A 1JOOA 5I9OA 2EXZA 5E1FA 1TR5A 2OF1A 3E5SA 3OMCA 3BDCA 4K8JA 2PYKA 4KV6A 1A3UA 5IGDA 5DAUA 1ENCA 3DMUA 1KABA 3EROA 4G57A 5HGTA 2EY6A 1A3VA 1EYCA 4NMZA 2PZUA 5HURA 2EY5A 4KY7A 2PW5A 5C3XA 5CGKA 4EVOA 5KYLA 2PQEA 3RUZA 3C1FA 1EY7A 4KY5A 4TRDA 3SK4A 5CR3A 1NSNS 4NKLA 4PMBA 5I6WA 4KTAA 1JORA 1F2ZA 2EY1A 3V2TA 1EQVA 2F0MA 4B9WA 4PMCA 2SNMA 3OWFA 4YIJA 5I9PA 5IGEA 1SYBA 4KHVA 2EYHA 2EYOA 3OSOA 4K8IA 4NP5A 3SR1A 2F0TA 5CC4A 3TP8A 4B9XA 3NK9A 2EY2A 4K5XA 4ODGA 2EYFA 2F0OA 3NUCA 4IALA 1U9RA 4HTHA 2QDBA 5KRUA 2F0KA 1JOQA 1II3A 4RKBA 2EYJA 5IGBA 4KJOA 1SYFA 1STHA 2NUCA 3MVVA 4DFAA 3H6MA 2F0UA 4DF7A 5C4ZA 3ITPA 5KEEA 4EQNA 4J1MA 4ZQ3A 2KQ3A 2PZWA 4QMGA 1SYGA 2F0EA 2F0WA 3QOLA 4DGZA 1STBA 1EYDA 4J6HA 3NQTA 3TP5A 1IHZA 3SK8A 2F0SA 4ME5A 5CV8A 3TP7A 3D4WA 4H7BA 1SNOA 4K6DA 4KD4A 3D8GA 1EY9A 3SXHA 1STNA
chains in the Genus database with same CATH superfamily
1KRTA 3U9OA 1CQFA 5M5WB 4KJNA 4DV2L 4GOPB 1X54A 4BBRB 4A3FG 4DR1Q 1L1OB 4ZLTF 4AYBB 2F0VA 1F9SA 1KNEA 2TSSA 3S17B 1RF2D 1PYWD 3RLNA 4FVMA 5BN3A 5FO8B 3WWVA 2F3VA 5GAHC 2F0IA 3R2IA 1JJCB 2DJFC 3CW2C 2B29A 3GTGB 4QY7A 2K14A 2NVYH 4JI0Q 2UUBQ 3HZXA 2PI2A 3W2DA 1YNND 4MTKA 4IUTA 2B2YC 3EQLC 1PFNA 5C5LA 4A3DH 3J80c 4WORA 3ERSX 3H0GB 2A68C 3P20A 5ELCA 1UE1A 1VQJA 4IQZA 1A63A 5A2QE 4U68A 3K0YA 5CMDA 4FP5D 3VR2A 4A93H 3G4SA 5HY6A 3HKZB 1TS3A 4HCEA 2PMZB 3MZ5A 1QB5D 4EQOA 2R92H 1ENAA 1EY0A 3DHQA 4RGOS 3GTMH 3D6WA 1AZQA 1IBKL 1M1KC 4A3KB 3I7FA 5E1FA 4GLVB 4DAMA 5DAUA 3CP0A 1UE5A 4HIKA 1IBMQ 4POGA 2MO1A 1ESRA 3F2BA 1I4PA 3A8JE 3F2DA 4WJ3M 1BQQT 3D3RA 3PO3G 2CH4W 5M3FH 1EY7A 2WIIB 4JI8Q 5I6WA 3FPPA 4LF5L 4C1NI 4DXFA 5EAYA 1EQVA 1PZJD 2PNHA 2MO0A 4YIJA 5I9PA 4IOCA 1FL0A 1OXUA 4OIJA 4BY7B 1C4QA 2VQFL 2Q2UA 1S5FD 1PYSB 2QCPX 4A3DG 1IL2A 1PYBA 2UUCQ 1MBYA 1HXYD 1ASZA 3H6MA 5KEEA 1D5ZC 1I4RA 3DUZA 1IYJB 1EQRA 1BO0A 2GA4B 1O78A 1VMPA 2IHFA 1GJXA 1HCZA 1O7ZA 4DK0A 2B2TA 1IZ6A 5M5XH 1GUOA 5CBEE 1W6JA 1AH9A 4ZCKA 4A93G 1EY9A 2Z6KC 4L5TA 1YBYA 4IPHA 1PLFA 2K7VA 4HAEA 4DAPA 2R92G 4DAYA 4CHTB 1SROA 1KD1C 4C3JH 2ES2A 2AWOA 1F9RA 2R7DA 1GUWA 1C48A 2NBFA 3D31A 3S14H 1R4QB 1Z9FA 2BA0A 4JBJA 1EOTA 2KCMA 2L9HA 1NMGA 4A4IA 3HOVB 2OTJA 2D5DA 3GTKB 3CCQA 2YTVA 3M4PA 5G3LF 3PO2H 4R4QA 1ILQA 4A3JH 1GXDC 4A3IB 3CAMA 5M3FG 3U58A 4XYOA 3T16A 1TWCB 3DWAA 4GKKL 3MEHA 1WD0A 1N34Q 2QILA 4Y52H 5C4XH 2O5JC 1TWAH 3H91A 1WCMB 4JI5Q 3GTOH 3VA7A 1IBLL 5EGTA 1DONA 4HJAA 3LX0A 4HIMA 1A2UA 1N32Q 4CKEA 1F9PA 4X66Q 4GOPA 4DV6L 4JYAL 1L1OA 1HA6A 4RCNA 4FXDA 1SNPA 5LL6X 3K0XA 3ULJA 1VCIA 4DV7Q 2MNAA 2V1CC 1X3FA 1DGSA 1VQAA 2UXBQ 3Q8DA 1TY2A 4C3JG 2EY5A 2ZT9C 1SMYC 3CHBD 1MGSA 4EVOA 2A6HC 2JP1A 2A5HA 1EEID 1NSNS 4PMBA 4A3FB 1K8AC 1C0AA 1KLUD 4LJZC 4TKOB 1J6QA 3PO2G 4A3JG 4NXML 3HOUH 1SE3A 2HIVA 1CM9A 1MJCA 2KHIA 4IALA 1F2LA 1PA6A 1U9RA 3RR5A 4G7HC 3C46A 1ZYRD 1BCPD 5T1IA 1YHAA 1MD2D 3DM3A 3K58A 1VQLA 1C9OA 4QGUA 2LY7A 3S24A 3CCLA 5C4XG 4IPGA 4ZKCB 2P5ZX 3UDXA 4BXXH 3FVQA 4OX9L 3HGBA 1AFPA 2ZJPA 3NQIA 1E1OA 1KAAA 4DR7Q 4UP7A 2XNAC 3P7JA 4B3TQ 2G5DA 2WAQG 5DEHA 2B2WA 3RZDH 3PSIA 3NHHA 3GQBA 1T5EA 3LWEA 4LUVA 1K8MA 1G51A 1U0LA 1XYIA 3UE0A 3PV0A 3BDOA 2AMCB 3K59A 2SNSA 4IPDA 1MSHA 5IP7H 4DR6Q 1UAPA 3K81C 4IURA 3QR8A 3PO3B 2PNRC 4EQPA 1SMXA 4FF2A 1KDCA 4CGYB 1Z47A 4XIGS 3NELA 1YJ9A 1EFWA 3EJIA 2NVYB 2SOBA 4JG2A 2K52A 2X6LA 4QUFA 4NDXA 5CV6A 1VQCA 3EFXD 5CV7A 3RLOA 4A3DB 3CQZB 1TWHH 4OO1I 5I9OA 3X3MA 4BXXG 2OQ0A 2K5NA 1VQGA 1ENFA 1X55A 3F8TA 2WKCA 2KCTA 4ZK9B 2UUAL 1Y8PB 4KY7A 3DLLA 4O0AA 3MXNB 4A93B 5C4JH 3PIO3 2K03A 2NWGA 4KY5A 2Z4IA 3SK4A 2R92B 3TSSA 1G6PA 1IXRA 2EY1A 2VY3A 4PG3A 1CUKA 2Q8IB 4KHVA 1OXSC 5CC4A 5LHY1 1SFOB 2I07B 4DN4M 2DN8A 1H95A 1ML0D 4K5XA 1VQOA 2ZXRA 3NUCA 5IP7G 1LTTD 2K5WA 1II3A 1I50H 1N9WA 2UXCQ 5BN4A 1LT6D 5M3FB 1TY0A 3M4YA 3FEWX 2VQEQ 1HNXQ 4QMGA 2Q8RE 3URYA 4DGZA 5IYCG 1EYDA 1HNWL 3CPWA 1K0RA 3PQIA 2WB1E 3J81j 3D8GA 2JQOA 4KK7A 1FD7D 1PRTC 3MEFA 5K36H 2YU9H 4FO2A 3PF4A 1KNAA 1O7LA 1VQ6A 4JOIA 4ZYSA 1U5KA 2LKVA 4CBVA 1J9OA 5GROA 2B2VA 4M1UB 2NZOA 2K33A 1HFGA 1W2BA 3Q24A 4N9TA 3JAMi 3T1HQ 1SLJA 2YV5A 4JI4L 3QO2A 3B6YA 1EU4A 4JI6Q 1NMFA 1RHPA 2X69A 5GQOA 1IW7C 4C3JB 4JI1L 4YHHL 2NZHA 3PIPA 1FGUA 1UEBA 4JC0A 5KGUA 2VB3X 2R93H 3CD6A 3S14B 5I4DA 2G9HD 2K1BA 4K6LA 3OOCA 2KHSA 2PPBC 1DXMA 1U4PA 5NUCA 4FXGC 4YCWA 1EQTA 4A3JB 1M8AA 1H9SB 3UI2A 3A8KE 3K57A 3M7NA 4XQJA 4BBSG 1HQRD 4DUZL 5IT9L 1YJWA 1STYA 1E0BA 1L0YB 1XNQL 1EZ8A 1N8RC 4LF7L 3S2DH 2EXZA 2HD3A 4RHRA 1AP0A 2EIFA 5C4XB 1TWAB 1KABA 1EYCA 2BH8A 3GTOB 1BOSA 2A68D 3KBGA 4O2DA 1H9RA 1DOMA 1D1KA 2PQEA 4R4CA 3U50C 2SEBD 4KTAA 2Y0SE 2WAQB 4DKAC 1MHWC 1SJHD 5DM63 3M4QA 2F52A 5LMUQ 3GTQH 4DAVA 4IJHA 2JA8H 1N33L 4DV1L 3G6JB 3W1BA 5DM73 4NXNL 4IFDG 2R93G 2C35B 2JXMB 2HT1A 1CKOA 5H1SE 2XN9C 2Z9HA 4C3HG 3U9SA 3TP7A 1WJJA 1FNVA 2J7ZA 1O80A 2IL8A 1Z6HA 1EIYB 1FJGQ 5IT9E 4IUUA 4M8AA 1SYEA 2F0GA 1I6HH 2A74C 3GP7A 3MXNA 1WTXA 2K5QA 4DNRB 5I2XA 2F0DA 3GTLH 3I4MG 4QCLA 2PZTA 2KJXA 1X9NA 1B8AA 1ESFA 3A7AB 4X65Q 1X56A 4KMUC 3KK7A 1EWCA 4RGMA 1EY5A 5E7NA 1QNKA 5JEAH 1EWIA 4PZ8A 4JCVE 4IUVA 1BCPB 4RKLA 1SNDA 1QZGA 1SYCA 4LFBQ 3KF8B 4F88A 1QWYA 2RCNA 4K0KL 1VQNA 3T4AC 3E0JA 3W1GA 3D4RA 4A3EH 4IJLA 4MN3A 2ZM6L 2J0TD 2OCEA 2B2TC 4WFN3 4HSVA 4X3UA 3BVZA 4DR2L 1QNUA 1ICFB 4JV5L 4NW2A 5FLXc 2RF4A 1B9MA 3ND8A 1NY4A 4BA1I 5HURA 1GUNA 3PCOB 4JW0A 4DR4Q 3R93A 5FJ8H 3J7YW 3QIAA 1QOHA 3AEVA 3H09A 3PIOA 1I6VC 4CDFC 2LMCB 2KECA 2HCCA 3V2TA 3M3YH 4DR3Q 3S2HH 4P75A 1J5EQ 1TWHB 5ELDA 2EPBA 2FJ2A 2LXJA 4GKJL 4BWGB 1G2TA 2EYFA 4LNQA 3M9BA 2FHTA 1BBXC 4LF9Q 5JEAG 5KRUA 1TWGH 1WTRA 4LF4L 1AW7A 1H9SA 1VQHA 5C4ZA 1Q81C 2KHJA 2I5HA 4A3LH 1SMYD 2A6HD 2A69C 2JYOA 1JWSD 4YY3Q 2DNEA 2AQ1B 4GOPC 4DV0Q 1L1OC 1XNRL 2AUJD 2L12A 4PMWA 2VNUD 3T51B 3OMGA 4RFBA 1IL8A 2G9DA 2MQHA 3J80L 4BBSB 3CRKC 5AFWA 5CYUA 1EL0A 5LMNQ 3HEJA 3A5UA 4X64L 4LAAA 3H3VH 1HR0Q 1PH8A 2B8GA 1LACA 1TXYA 4LWCA 5FJ8G 3TS2A 4KHZA 5DLQE 2OXPA 4FF1A 1YHQA 2PI2E 2YU9B 4DV3Q 1RKNA 1HNZQ 1JWUD 4C3IG 1KL9A 5T1GA 1X32A 1I4QA 2KOLA 3ONAB 1GKHA 1Y8NB 3MTSA 4HR7B 2K28A 1WFQA 2F3IA 2WV6D 1X3GA 3BZCA 3VA5A 1P8LA 2JA5H 4K2KA 4A3LG 1JOKA 5FLMG 3FRPB 3E3XA 4DR1L 3W5OA 3RN5A 2R93B 2E2JH 4ME3A 3HOXH 2WB1G 1A6XA 1A3VA 3SGIA 4NMZA 2XRSD 1X3QA 4C3HB 2PW5A 2YYZA 2B2WC 4LF8Q 1MKHA 1YJNA 4GNXB 1SEBD 3BZDB 4JI0L 2UUBL 5CR3A 3PUVA 3J80E 4JPBW 2AWNA 5IWAQ 1HUNA 3KF6B 3S2DB 1SBBB 3NEMA 5L37A 3KF8A 3I4MB 1Q12A 5C0XH 1X3PA 4KJOA 3ITPA 3I4LA 3CCSA 4KKSA 3QOLA 4OIKA 1E3PA 1STBA 1ICWA 2LSSA 1HJPA 4H7BA 4OONA 3AFQA 4A3CH 1TWFH 2WKDA 3SK5A 1OXXK 1W3SA 1YHBA 4YCVA 3WDNA 3PF5A 2HHHQ 3GTQB 2JA5G 4ALPA 1GOZA 2KCNA 2MHVA 1IBML 2O4XA 1FVIA 2XWJB 4Y7NH 1LTRD 4IOAA 4OXPA 2I0QA 2ALYB 2ENBA 3HOXG 2IX3A 2F4VQ 1OO9B 4JI8L 4HEDA 1HPCA 3DWPA 3TZDA 3H15A 1D6EC 1PH9A 1A62A 2BCOA 2QF7A 4ABNA 2JN4A 2QEXA 2Q8TA 1PH6A 1QVCA 2RA4A 4B3SQ 1Y1VH 4HJ9A 1I94Q 5C4HA 1I4GA 1F2YA 1I6HB 1PRTD 1LYLA 2UXDQ 1MJEA 2UUCL 3GTLB 2F0HA 1U4LA 5C0XG 2NN6I 1YNXA 1F2MA 1JWMD 3TMEA 1UWVA 2VUMH 1PFBA 1BNZA 1GHKA 1BDOA 2A6EC 1VS0A 2O2LD 2RKSA 3UDGA 3HOZH 2Q2HA 3CMEA 1EQQA 3PIP3 1ZEQX 2MGSA 5EPKA 3A54A 1IW7D 4L63B 1G91A 2M9VA 1N36Q 4JOIC 1HZCA 1IYVA 2K04A 3X3NA 4A3BH 2B2VC 5C3XA 4XT3B 3KLRA 2ID0A 3QWNA 2Z6BA 2E2HH 1RIPA 1NTGA 2RDHA 3S16H 4V190 4FYDA 2K5HA 3SEBA 3NBIA 4YWKA 1KTKA 3VYSA 1N34L 3HS0C 1Y1VG 2Z8LA 3CC7A 4HTHA 3J7AF 1QE6A 4JI5L 1BCPF 2NUCA 3HKZE 4TQUS 4X62Q 1N32L 2E74C 1SYGA 4X66L 4OEMB 3RZOB 1NCVA 1NJIC 4BY1H 3M3YB 3S2HB 2ZTCA 4C3IB 4CDDC 2VUMG 1F77A 1STNA 2KEDA 3IAYA 3HOZG 4KLKA 5BR8Q 2YTXA 2UXBL 1ILPA 1LO5D 3WOFA 4MTNA 1TU2B 5CV5A 2KBNA 1TWGB 1B4OA 1EYAA 1O7YA 4PNYA 4A75A 1SNCA 2OWOA 4PV1C 3S1RB 1OXVA 3NXWA 2NYZD 3KF6A 3L3OC 4A3BG 1VQ8A 1M90C 2E2IH 1TVXA 2WB1B 4LFAQ 5F2DA 2K5VA 5LMNW 2Q2TA 3T56B 5CORA 1HR0W 4P73A 3FKIH 5EPJA 3VYUA 1KQSA 1BVSA 4AH6A 2I5MX 4RAUC 4WRDA 1JICA 3RD4A 3SHLA 4AQYQ 3K7AB 5ELFA 1CKNB 4A3MH 2ICIA 1KIXA 1Q86C 4XXEA 3F2CA 3BU2A 4FF3A 3T1YQ 4BY1G 2D9UA 1PFMA 4DR7L 3AFPA 4B3TL 2OF1A 1A3UA 4CJ1B 1TKWB 2RSNA 4G57A 2CVRA 3HOUG 3WOEA 1SR3A 4O42A 2BH2A 3S1NH 1VF5C 5KNDA 1GD7A 5EPLA 3OW2A 1X6OA 4GLAC 1EYGA 2C9OA 2JA5B 2KEEA 1G2SA 2HDLA 3I56A 4H0LC 4JBMA 4DR6L 1QCBD 3KOJA 1SYBA 4LUOA 1SXTA 3F2UA 2RCFA 2E2JB 4IO9A 3KYHC 4B9XA 3HOXB 2K32A 3NK9A 2EY2A 3R8BA 2F0OA 1I3QH 3S1QH 1WTPA 4JBWA 4UPAA 1JOQA 2CKZB 4RKBA 3IRBA 4DF7A 2L5TA 2FMCA 3FKIG 4BS9A 1SE4A 3TP5A 1VQMA 1NR4A 4JI3Q 3GTMB 1PH1A 4RCOA 3SXHA 3N6RA 2N49A 3OIPA 5DNFA 1M4VA 1DCZA 2JA6H 2IPKD 1STAA 1LLRD 1LT3D 3S15H 3STBC 1BR9A 4RA8A 3TEHB 1I5FA 4GN3B 4KY6A 2IWHA 4QL5A 4DNTB 1JCKB 1XX8A 2F0JA 4ZUJA 4MZ9A 1LTGD 1H9MA 3CU7A 1BUVT 5KIXA 1CSQA 1EY4A 1R4PB 5C5MA 4JI2Q 2QGQA 1TWFB 4PZ7A 2IW3A 4QB4A 3QOJA 2A69D 5C3WA 4HIDA 5IGCA 3C3LA 3K5NA 4PZ6A 4HJ8A 3LGJA 3H94A 4K2LA 4G7OC 2UXCL 4B3RQ 4HN7A 3NWTA 4OL7A 2VQEL 3R2TA 1HNXL 2N88A 1S5CD 1VDZA 3GTPH 4K5VA 5FKAC 4UY8C 5M5XB 4XDXA 3CCEA 2RQXA 1Y1VB 2E5LL 1NAPA 4OWWB 3J81i 1A2TA 1K8OA 5IYDH 4BBRH 1CI3M 3BDCA 1ONLA 2PYKA 1JJ2A 4DUYQ 1Q8KA 2JA6G 2EY6A 2PQAB 4MHEA 3HG9A 2PZUA 5D3IB 3AYHB 2VUMB 5CGKA 1Q8IA 3PO2B 2CWAA 3HOZB 4JI6L 3GTGH 3KUPA 3HOWH 4V0BA 2JA9A 1SAPA 4ZRZA 1OTCA 4Z9CB 2K50A 2EYOA 4C1NK 3TP8A 4LF7Q 1K83H 2FINB 3GTJH 1K0SA 3A7LA 1PH5A 2F03A 1CKNA 1GUGA 5K36G 4A3BB 5IGBA 1CT1D 1SYFA 2IX1A 5M3MH 1PTOC 3L9AX 4IN3A 1KRSA 5EQ0A 4N8X1 4XTCS 4DR5Q 1JORA 2CHBD 5TSSA 1HZ9A 1FYCA 4IZ8A 3MFGA 4KN4C 2X6GA 1PZID 4WJ4A 3CPFA 2E76C 5ELNA 3BG3A 2E75C 5IYDG 3MXPA 1SJED 1LABA 1YEZA 3NSWA 3AU7A 3TS0A 3I70A 1Y1WH 4S3SA 1A3TA 1PH2A 1E1TA 2F0LA 5AJ3Q 4BY1B 1AE2A 1WTVA 5E4XA 3K5MA 2IY5B 1G6ZA 4I7AA 1EWHA 3J7A5 4GLXA 1ZKOA 5LMUL 1B9NA 3ND9A 3HOWG 3HOUB 1KC8C 2H1EA 1AE3A 2PW7A 2QW7A 1FGBD 4K14A 2BA1A 2EOTA 1IYUA 3MAQA 1XPOA 4CKCA 1SN8A 3BVMA 3BVGA 2NVXH 3ICEA 3BYTB 5IT9c 2RDFA 5FLXL 4MNOA 3C1EA 1Q3LA 3Q0AA 3E9IA 4AIMA 2K05A 4RGNA 5M3MG 2E2IB 5IODA 3FPUB 1A15A 3P75A 3M85A 2K6AA 4FF4A 4KD3A 1XXGA 1FJGL 1JOOA 2EXDA 3PGZA 3D0FA 2DY7A 1B1ZA 2AUKA 3FKIB 3KDFB 1B2TA 4RMFA 2KA7A 2XTIA 3DMUA 4UDUC 3RZDB 1WVLA 2F4IA 1VQ7A 2DGYA 3IL8A 3NTKA 1X3EA 2JA8G 1RTOA 1T5XD 3C1FA 2NTSA 4TRDA 1Y1WG 1XJVA 3J7ZC 1D5MC 4IFDJ 2A6ED 1LUZA 4K8IA 1VQ9A 1UE7A 4HJ7A 2ZJRA 2UU9Q 1RCVD 4PQXA 1EU3A 2N78A 1Q90A 3A8IE 3CC4A 3JAMc 2HUGA 1WOCA 2KENA 4JI7Q 4XQQA 2QDBA 3S1NB 4LFCQ 2F0KA 4LF6Q 1YVCA 2D62A 1GHJA 3J81c 4ZQ3A 1I4HA 4DA2A 1XMOQ 3SK8A 3K7UC 5FLXE 1JT8A 4DK1A 2ATWA 1EY8A 4LK1C 2BOSA 3AMUA 3GO5A 1BF4A 5K5PA 4DV5Q 2PQAA 5COYA 1I3QB 3S1QB 3I4NH 4KHPQ 1B50A 5EBCA 1JE4A 2L55A 4L5SA 1CZGA 2K01A 4DR4L 2ASBA 3PUYA 2MP1A 3DWQA 1UNSA 5EKKA 3ZYYX 4B3MQ 5EBDA 2D0OA 2OEOA 3I91A 4O1NA 5JJZA 5C4JB 1CA6A 1KDAA 4HCSA 2VS1A 4RGTA 4DR3L 1LM0A 2R61A 1J5EL 4LMQD 1STGA 4P74A 2BE5C 3I72A 4QUCA 2JA6B 4R4TA 1V1OA 1QILA 4A3EG 1XTDA 1B3QA 2HCIA 5M5YH 3S15B 1S4ZA 4LF9L 5IYBH 4DV4L 1VF7A 3SDZA 5C44H 1H9KA 2OT2A 1I50B 5J22A 4F7XA 1WTHA 3TRZA 3DEPA 1XMQQ 3OTOQ 3M4OH 4IFDI 5D14A 5FO9B 2FXQA 1NNXA 3MA2B 1QVGA 4YY3L 3ULPA 4YWLA 2B63H 3NENA 4WJWA 3Q6SA 4DV0L 5CBAE 3T13A 3N52A 3L0OA 2R7ZH 1GM5A 4X3KA 4DV2Q 4KV6A 4L5RC 4H44C 1Q7YC 3VYTA 3QG1A 3I4NG 2WINB 5LMNL 1VQKA 3I8ZA 3GTPB 5KYLA 1HR0L 2KCCA 4EX5A 1TS2A 2OQKA 3EA6A 4H13C 2N8NA 1A0IA 3OWFA 4DV3L 1HNZL 4NP5A 2EYHA 3SR1A 1B3AA 1VQIA 2QKIC 2V4DA 5IY0A 1L0WA 1EIHA 1D2BA 1HZAA 3L2PA 3TN2A 3PO3H 3SE0A 2CQAA 1EFID 4A76A 5IYBG 3K5OA 1IKMA 1T9HA 2F0UA 2IX0A 5C44G 2CCZA 4JBKA 4N8FA 3LWUA 3U4VA 2KQ3A 3HOWB 3TDQA 5C3EH 1XWEA 4CJ0B 3MHBA 1VQFA 1S3OA 3KDFA 1EZ6A 1K83B 1WI5A 3CQZH 4ID6A 2B63G 2IT1A 1PZKD 1CFMA 3E9HA 3GTJB 1SNQA 1IBKQ 3G71A 2VW9A 4HIOA 3GV6A 3ER0A 1LTBD 1WD1A 1JC7A 2R7ZG 1VQPA 2DY8A 2PO4A 1UUPA 4FXKC 4LF8L 1G8ZD 1V1PB 5M3MB 5IOCA 1GO3E 3CCRA 3KFUA 4J8QA 2ZJQA 1FR3A 2C5CA 5E4WC 2AKWB 3A74A 5J1ZA 4P71A 2JJQA 5HGQA 5IWAL 2K5DA 1PH4A 2WFWA 4LF5Q 1TIID 4R9WA 1BXTA 1VQBA 4QIWE 2F0QA 1SFOH 1CHPD 1B70B 2RBMA 2VZAA 3VR4A 4ZUIA 1YNJC 3VR6A 2B3GA 3SVMA 2JA8B 1PRTF 3RN2A 4YWMA 2XSCA 3R3OA 3TP6A 2VQFQ 1MI2A 2MPMA 1Y1WB 2MUYA 1VMCA 3A0JA 3CKIB 3STBD 1RJTA 2WACA 3OYYA 1CHQD 2L11A 4F8MA 2J4XA 5C6AA 2EJMA 4OO1H 3BZKA 5J39A 5IP9H 3K6OA 3RNUA 2EQSA 1MSGA 2HHHL 3FMCA 2H5XA 5C3EG 3OMCA 2R6GA 2RDGA 1QUQB 2NVXB 1KAWA 1Q46A 1Y8OB 2LS01 2Y0SG 2F4VL 4H02A 3BJUA 2LFNA 3UE1A 1XTCD 1JE5A 1D1IA 2LXKA 4B3SL 2NVQH 1F2ZA 1I94L 1E22A 1EEFD 4AYBE 3OSOA 1D5XC 3NTHA 2F0TA 1SRUA 2XVSA 2UXDL 4A3CG 4GKKQ 3HKSA 3CC2A 1KXLA 3KJPA 4OWXB 4DFAA 1LV9A 1S40A 1WTQA 4EQNA 4J1MA 4IPCA 3IFTA 2L15A 1LTAD 4C2MH 1IBLQ 4X6AH 1PTOF 1CZWA 4J6HA 3NQTA 4A3EB 1VQ5A 4YCUA 2K4KA 5CV8A 3D4WA 2FMMA 4CJ2C 2XGTA 3NTIA 2E2DC 3GV3A 4DV6Q 3OHXC 2CW0C 2RHQB 4JYAQ 4OO1G 5EJWA 3TBIB 5BN5A 5IP9G 2B2UA 4RH6A 4DU9A 5GAEC 4RG1A 2JSOA 3A56A 4XYQA 1N36L 2VB2X 3A55A 2OTLA 2I46A 1W6KA 2F3WA 1RL2A 3G7LA 1Y69U 2PMZE 4G4KA 1SYDA 5G3LD 4ZKBB 1HTPA 2ZTDA 2NVTH 3NP8A 4E6IA 3S1MH 1PTOD 2JA7H 1KHIA 2QDLA 5C0XJ 4IUPA 5M9OA 3IKJA 5JVH3 1WTOA 2H4OA 5IIFA 3H3VI 4JK1C 4DV7L 1Y14B 3KJOA 3I4NB 2ZXPA 4NXMQ 3GD7A 3CCUA 1CKMA 1NR2A 1YI2A 3A5ZB 4C56C 1LTLA 1IKLA 4GNXA 2F0PA 5IGFA 1EY6A 1U4MA 4X62L 1YITA 3C2PA 3H3VC 2DJGC 3EN2A 3I90A 1PTOH 1ASYA 4A3GH 1Q1BA 3NE5B 1BKBA 4IUNA 3KLSX 4OX9Q 5BR8L 2HDMA 5M5YB 2KUMA 4R8IA 1V1PA 3HOYH 4X3TA 2CWPA 4P72A 5C44B 3EROA 1VQEA 5JJIA 2Z0SA 4XQNA 1VQDA 4CDCC 5IE8A 4GN5A 3M4OB 3I4OA 1HA5A 3FDTA 4UP8A 3RUZA 2A73B 1CK1A 2B63B 4ILWA 2B2YA 3ULLA 2B8FA 2AQ2B 1O7IA 4LFAL 2HQLA 4B9WA 4PMCA 2SNMA 2XWBB 3NWSA 3VR3A 2R7ZB 2JE6I 2D2CC 2JA7G 5JPMC 3G48A 3NBHB 3BS1A 3KLWA 3I73A 3PUXA 2CQOA 4AQYL 3MVVA 1STHA 2JK8A 2ICEC 5C0XI 4LW1A 5I2YA 1PH7A 2GVBA 4GS3A 2PZWA 1RDPD 5JJKA 1PDQA 1MIUA 1YNNC 1SE8A 4ME5A 3BYYB 1BBUA 5ELBA 3T1YL 4OHJA 2EJFC 4EQ5A 4ZAIA 5JVG3 4A3GG 4TVAB 1WYDA 4UHVA 5ISRA 3HFZB 1QUQA 1XPRA 1R9TH 1DM0B 1EIFA 3CCVA 4HMJA 1OXTA 1TT2A 2RSOA 2XIWA 4MIUA 3EVQA 1E24A 3HOYG 1A8VA 1STEA 4POFA 5IYCH 2EZVA 1JB7A 1RTNA 2EYPA 2UUAQ 4DPGA 1E7ZA 5C3EB 1WTWA 5I6YA 3PMFA 5KYIA 1YZ6A 3EIVA 4U673 1JJGA 4OELB 4APVA 1L0XB 1NUCA 3BDLA 1TS4A 2NTTA 2ZXOA 4A3MG 1E2ZA 4KI0A 1D8LA 1C7YA 5IGEA 2EYLA 2Y0SB 3E6ZX 3OW7A 1NE3A 1PFSA 4KKUA 3MXUA 2R3ZA 2VL6A 1DJRD 3TREA 1HFNA 3AB9A 5EKIA 1LTID 4L5QA 1JMCA 2Z6KA 1PV4A 3V05A 5A35A 2GN5A 4RWSC 4JI3L 2EE1A 3QB3A 1AN8A 1VQ4A 2N55A 1HNWQ 2GVAA 2QEJC 1JR0D 1K3BC 1HRJA 3I2ZA 3UDFA 3CF5A 1TS5A 2BE5D 4BA2I 4K8JA 2L4NA 2QA4A 4G7ZC 4Y7NB 1B53A 3G6EA 1ET6A 4BBSH 4JI2L 3VDYA 3RLFA 3OWEB 2DUDA 3DEOA 4JI4Q 4LUZA 1PMRA 2CFMA 4I7ZC 2E5LQ 1NBWA 5M5WH 3Q23A 5GADC 4YHHQ 4JI1Q 2TMPA 1SE2A 4ODGA 1QVFA 4B3RL 3S17H 4P2CB 2Z4HA 5KNBA 2EYJA 4Q5VA 1Q82C 3I3CA 3EBEA 4HJ5A 2EVBA 3FP9A 3T1HL 3NPPA 3CMAA 1CTMA 2F0WA 1PVOA 2NVQB 4GN4B 5GAGC 2I5LX 3VR5A 3K80C 1UE6A 1ZXTA 1SNOA 4TSSA 4DNIA 1PXUA 1L2FA 2F0FA 4DUZQ 2EYMA 1FNUA 1PRTB 1XNQQ 4IFDH 4IUQA 4DK6C 3I55A 2N3SA 4DUYL 2AQ3B 1S5BD 1SNMA 1Q1EA 1QG7A 3H0GH 4KKTA 2IHEA 4C3HH 5LL6S 4C2MB 2E2HB 4CDEC 2AHOB 1UEAB 3D4DA 1Z7TA 4KN7C 5IGGA 1GUTA 1LT5D 3S16B 3NBHA 2BDOA 3HP3A 3K5LA 2YTYA 5JOBA 1SDFA 2HQEA 4A3KH 2ZTEA 3I4MH 2JEAI 5KNCA 4K5WA 3QJYA 1N33Q 3FHWA 4R8NA 4DV1Q 4EGVA 4BBRG 4AYBG 5D65A 2R7FA 2M00A 1DOKA 5JAVA 3J7AV 1SSOA 4NXNQ 2VXWA 3P1HA 2NVTB 3S1MB 2BDNA 1CSPA 2SDFA 2JA7B 3LNNA 4OGQC 4DR5L 4DK3C 1RODA 2RHSB 4UAIA 1I4XA 4QF4A 2PCFB 2NB0A 3E5SA 2B39A 4JVZA 1P16A 1ZYRC 1BCPC 3F1ZA 4BY7H 1F9QA 1V1QA 5IGDA 1YNJD 1YIJA 1ENCA 5HGTA 1BBWA 4XT1B 1V43A 3V96A 3MFYA 5AJ3L 1EIGA 1X65A 4HSPA 3JAML 1PTOB 3K8AA 4A3GB 1FNWA 3H0GG 4NB3A 1CQVA 2E8GA 3CCJA 4F87A 3J81L 2A8VA 2F1MA 3HKZG 2NZ1D 2IJ0A 3HOYB 3U4ZA 5ELEA 5D3DA 1HH2P 1PH3A 1S5DD 1DYQA 1D7QA 1E2VA 1K73C 3JC66 4A3KG 3KLSA 3W3AA 1B7YB 4L8JA 3J80i 4A3MB 4K0KQ 2DNCA 3ZJYC 3HOVH 2XRQD 1CA5A 3GTKH 1J8IA 1K3RA 1JQYD 4X65L 4Q0FA 3L7ZC 4DXGA 2WP8J 4A3IH 4K6DA 4B08A 4OWTB 2ZM6Q 5J3BA 4GZYC 2L1BA 1TWCH 4DR2Q 1QZHA 4LFBL 3DM1A 4JV5Q 2RVLA 3OIQA 4BY7G 4HMIA 4QQBX 1WCMH 3D6CA 4R4OA 2EJGC 2MJ8A 3O13A 5JPNC 1LT4D 2F0NA 2O5IC 1C8CA 3CXCA 1QJOA 3TQYA 3SK6A 3JAME 1KLGD 3VYRA 1H9JA 4I65A 4X3SA 3TZUA 2UU9L 1R9TB 2CW0D 3UDIA 2NN6H 1AEXA 3CRLC 1HUMA 2JEBI 4JI7L 5E3FA 1TQOA 3J81E 4GKJQ 4LFCL 4LF6L 1KDBA 3KBXA 2KVMA 1JB3A 3GDEA 3AQQA 4FNFA 3T53B 4LF4Q 1DOLA 3ERQA 3S9WA 1DD2A 1XMOL 5CV4A 3PUWA 1EOVA 1XPUA 3DXJC 1HTLD 1GUSA 5CV9A 1EUJA 2WAQE 3RZOH 4N9PA 3CCMA 4C3IH 4A3FH 5EKLA 4R4IA 5FO7B 3HOVG 1U4RA 1DZ1A 1HQMC 4DV5L 1PHJA 1ET9A 3RMHA 3M7GA 4A3IG 5FOBB 4KHPL 1TR5A 4QIWB 2CH4A 2B2UC 4J15A 4DAYB 4DV4Q 1K9MC 4B3ML 3MXGA 1XNRQ 1GVPA 3MC0B 3OPOA 3PUZA 1AZPA 4CKBA 5FLMH 4ULLA 3S1RH 1WCMG 3IFDA 4NKLA 4RHSA 4X64Q 5ELOA 2A19A 2Z1CA 2F0MA 2K75A 2FFKB 2D0PA 2M2LA 1LTSD 1HZBA 3E0EA 3MWYW 3HRZC 4NPSA 2HIXA 1K8GA 2Q2IA 1S72A 1V8QA 1E2WA 5A2QL 2NN6G 4QJFA 1XMQL 5JJLA 3OTOL 1V9PA 4L6TB 3K7AH 4FDBA 1B44D 1K28A 2EDGA 3Q22A 2F0EA 4GNXC 5FK9C 1G291 2L0CA 1IHZA 1RD9D 2F0SA 5JEAJ 4R1JA 2MFIA 4UP9A 1S5ED 4KD4A 1HHVA 2A1AA
chains in the Genus database with same CATH topology
3U9OA 1CQFA 5M5WB 4KJNA 4BBRB 4ZLTF 4AYBB 2F0VA 1F9SA 1KNEA 2TSSA 3S17B 1RF2D 1PYWD 4FVMA 5BN3A 5FO8B 2F3VA 2F0IA 3R2IA 3GTGB 3HZXA 3W2DA 1YNND 4IUTA 2B2YC 3EQLC 1PFNA 5C5LA 4WORA 3H0GB 2A68C 3P20A 5ELCA 4IQZA 5A2QE 4U68A 3K0YA 5CMDA 4FP5D 3VR2A 3HKZB 1TS3A 4HCEA 2PMZB 3MZ5A 1QB5D 4EQOA 1ENAA 1EY0A 3DHQA 4RGOS 3D6WA 1AZQA 4A3KB 5E1FA 5DAUA 1ESRA 1I4PA 3A8JE 1BQQT 3D3RA 1EY7A 2WIIB 5I6WA 3FPPA 4C1NI 4DXFA 1EQVA 1PZJD 4YIJA 5I9PA 1OXUA 4OIJA 4BY7B 1C4QA 1S5FD 2QCPX 1MBYA 1HXYD 3H6MA 5KEEA 1D5ZC 1I4RA 3DUZA 1BO0A 2GA4B 1O78A 1VMPA 1GJXA 1HCZA 1O7ZA 4DK0A 2B2TA 1GUOA 5CBEE 1W6JA 1EY9A 4DAPA 1PLFA 2K7VA 4HAEA 4DAYA 4CHTB 2AWOA 1F9RA 1GUWA 1C48A 2NBFA 3D31A 1R4QB 2BA0A 1EOTA 2L9HA 3HOVB 2D5DA 3GTKB 5G3LF 1ILQA 4A3IB 1GXDC 4XYOA 3T16A 1TWCB 3DWAA 3MEHA 1WD0A 2QILA 2O5JC 3H91A 1WCMB 3VA7A 5EGTA 1DONA 3LX0A 1A2UA 4CKEA 1F9PA 1HA6A 4RCNA 4FXDA 1SNPA 5LL6X 1VCIA 1TY2A 4C3JG 2EY5A 2ZT9C 1SMYC 3CHBD 1MGSA 4EVOA 2A6HC 2JP1A 2A5HA 1EEID 1NSNS 4PMBA 4A3FB 1KLUD 4LJZC 4TKOB 1SE3A 1CM9A 4IALA 1F2LA 1U9RA 4G7HC 3C46A 1ZYRD 1BCPD 5T1IA 1MD2D 3K58A 2LY7A 4ZKCB 3FVQA 3HGBA 1AFPA 3NQIA 1KAAA 2XNAC 3P7JA 5DEHA 2B2WA 3NHHA 3GQBA 1T5EA 3LWEA 1K8MA 1XYIA 3PV0A 3BDOA 3K59A 2SNSA 1MSHA 1UAPA 4IURA 3PO3B 2PNRC 4EQPA 4FF2A 1KDCA 4CGYB 1Z47A 4XIGS 3EJIA 2NVYB 2SOBA 2X6LA 4QUFA 4NDXA 5CV6A 3EFXD 5CV7A 4A3DB 3CQZB 4OO1I 5I9OA 3X3MA 1ENFA 2WKCA 4ZK9B 1Y8PB 4KY7A 4A93B 3PIO3 2K03A 2NWGA 4KY5A 2Z4IA 3SK4A 2R92B 3TSSA 2EY1A 2Q8IB 4KHVA 5CC4A 1OXSC 5LHY1 1SFOB 2I07B 4DN4M 2DN8A 1ML0D 4K5XA 2ZXRA 3NUCA 1LTTD 2K5WA 1II3A 5BN4A 1LT6D 5M3FB 1TY0A 3M4YA 3FEWX 4QMGA 2Q8RE 3URYA 4DGZA 1EYDA 3D8GA 4KK7A 1FD7D 1PRTC 5K36H 4FO2A 1KNAA 1O7LA 4ZYSA 2LKVA 4CBVA 1J9OA 2B2VA 4M1UB 2K33A 1HFGA 3Q24A 4N9TA 3QO2A 1EU4A 1RHPA 2X69A 4C3JB 1IW7C 5KGUA 2VB3X 3S14B 5I4DA 2G9HD 2K1BA 4K6LA 3OOCA 2KHSA 2PPBC 1DXMA 1U4PA 5NUCA 4FXGC 1EQTA 4A3JB 1M8AA 1H9SB 3UI2A 3A8KE 3K57A 3M7NA 4XQJA 1HQRD 5IT9L 1STYA 1E0BA 1L0YB 1EZ8A 2EXZA 4RHRA 1AP0A 5C4XB 1TWAB 1KABA 1EYCA 3GTOB 1BOSA 2A68D 3KBGA 1H9RA 1DOMA 1D1KA 2PQEA 2SEBD 4KTAA 2WAQB 1SJHD 5DM63 4DAVA 3G6JB 5DM73 4IFDG 2JXMB 2XN9C 4C3HG 3U9SA 3TP7A 1FNVA 2J7ZA 1O80A 2IL8A 1Z6HA 5IT9E 4IUUA 4M8AA 1SYEA 2F0GA 2A74C 3GP7A 3MXNA 1WTXA 2K5QA 4DNRB 5I2XA 2F0DA 4QCLA 2PZTA 2KJXA 1ESFA 3A7AB 4KMUC 3KK7A 1EWCA 4RGMA 1EY5A 1QNKA 5JEAH 4IUVA 1BCPB 4RKLA 1SNDA 1SYCA 4F88A 1QWYA 3T4AC 3E0JA 3D4RA 4MN3A 2J0TD 4WFN3 2B2TC 4HSVA 4X3UA 3BVZA 1QNUA 4NW2A 1B9MA 3ND8A 4BA1I 5HURA 1GUNA 3R93A 3J7YW 3QIAA 1QOHA 3H09A 1I6VC 2LMCB 2KECA 2HCCA 3V2TA 1TWHB 5ELDA 2EPBA 2FJ2A 4BWGB 1G2TA 2EYFA 2FHTA 1BBXC 5JEAG 5KRUA 1WTRA 1AW7A 1H9SA 5C4ZA 1SMYD 2A6HD 2A69C 2JYOA 1JWSD 2DNEA 2AQ1B 2AUJD 2L12A 4PMWA 2VNUD 3T51B 3OMGA 4RFBA 1IL8A 2G9DA 3J80L 4BBSB 3CRKC 5AFWA 5CYUA 1EL0A 3HEJA 4LAAA 2B8GA 1LACA 4KHZA 2OXPA 4FF1A 2YU9B 1RKNA 1JWUD 4C3IG 5T1GA 1X32A 1I4QA 2KOLA 3ONAB 1Y8NB 3MTSA 4HR7B 2K28A 2WV6D 3VA5A 4K2KA 1JOKA 3FRPB 2R93B 1A6XA 1A3VA 4NMZA 2XRSD 1X3QA 4C3HB 2PW5A 2YYZA 2B2WC 1SEBD 3BZDB 5CR3A 3PUVA 3J80E 2AWNA 1HUNA 3S2DB 1SBBB 3KF8A 3I4MB 1Q12A 5C0XH 1X3PA 4KJOA 3ITPA 3I4LA 4KKSA 3QOLA 4OIKA 1STBA 1ICWA 4H7BA 3SK5A 2WKDA 1OXXK 3WDNA 3GTQB 1GOZA 2KCNA 2MHVA 2O4XA 2XWJB 1LTRD 2ENBA 2IX3A 1OO9B 3TZDA 4HEDA 1HPCA 3DWPA 1D6EC 2BCOA 2QF7A 4ABNA 2Q8TA 2RA4A 5C4HA 1I4GA 1F2YA 1I6HB 1PRTD 3GTLB 2F0HA 1U4LA 5C0XG 2NN6I 1F2MA 1JWMD 3TMEA 1PFBA 1BNZA 1GHKA 1BDOA 2A6EC 2O2LD 2RKSA 3PIP3 1ZEQX 2MGSA 5EPKA 3A54A 1IW7D 4L63B 1G91A 2M9VA 1IYVA 2K04A 3X3NA 2B2VC 5C3XA 4XT3B 3KLRA 2ID0A 3QWNA 2RDHA 4V190 4FYDA 3SEBA 3NBIA 1KTKA 3VYSA 3HS0C 2Z8LA 4HTHA 3J7AF 1QE6A 1BCPF 2NUCA 4TQUS 2E74C 1SYGA 3RZOB 1NCVA 3M3YB 3S2HB 4C3IB 1F77A 1STNA 2KEDA 3IAYA 1ILPA 1LO5D 3WOFA 1TU2B 5CV5A 1TWGB 1B4OA 1EYAA 1O7YA 4PNYA 1SNCA 4PV1C 3S1RB 1OXVA 2NYZD 3NXWA 3L3OC 1TVXA 2WB1B 5F2DA 3T56B 5CORA 5EPJA 3VYUA 4RAUC 4WRDA 1JICA 3RD4A 3SHLA 3K7AB 5ELFA 2ICIA 4XXEA 4FF3A 2D9UA 1PFMA 2OF1A 1A3UA 4CJ1B 1TKWB 2RSNA 4G57A 2CVRA 3WOEA 4O42A 1VF5C 5KNDA 5EPLA 2C9OA 2JA5B 2KEEA 1G2SA 2HDLA 4H0LC 1QCBD 1SYBA 1SXTA 3F2UA 2E2JB 4B9XA 3HOXB 2K32A 3NK9A 2EY2A 3R8BA 2F0OA 1WTPA 4JBWA 1JOQA 4RKBA 4DF7A 2L5TA 2FMCA 4BS9A 1SE4A 3TP5A 1NR4A 3GTMB 4RCOA 3SXHA 3N6RA 3OIPA 5DNFA 1M4VA 1DCZA 2IPKD 1STAA 1LLRD 1LT3D 1BR9A 4RA8A 2IWHA 4KY6A 4DNTB 1JCKB 1XX8A 2F0JA 4ZUJA 1LTGD 1H9MA 3CU7A 1BUVT 5KIXA 1EY4A 1R4PB 5C5MA 1TWFB 2IW3A 4QB4A 3QOJA 2A69D 5C3WA 5IGCA 3C3LA 3K5NA 3H94A 4K2LA 4G7OC 4HN7A 3NWTA 4OL7A 3R2TA 2N88A 1S5CD 1VDZA 4K5VA 5FKAC 5M5XB 4XDXA 2RQXA 1Y1VB 1NAPA 1A2TA 1K8OA 1CI3M 3BDCA 1ONLA 2PYKA 2EY6A 4MHEA 3HG9A 2PZUA 5D3IB 2VUMB 5CGKA 1Q8IA 3PO2B 3HOZB 3KUPA 4V0BA 1SAPA 4ZRZA 4Z9CB 4C1NK 2EYOA 3TP8A 2FINB 3A7LA 2F03A 1GUGA 5K36G 4A3BB 5IGBA 1CT1D 1SYFA 2IX1A 1PTOC 3L9AX 4IN3A 5EQ0A 4XTCS 1JORA 2CHBD 5TSSA 1FYCA 4IZ8A 3MFGA 4KN4C 2X6GA 1PZID 2E76C 3BG3A 2E75C 1SJED 1LABA 3MXPA 3NSWA 3AU7A 3I70A 4S3SA 1A3TA 2F0LA 4BY1B 1WTVA 5E4XA 3K5MA 1G6ZA 1EWHA 1ZKOA 1B9NA 3ND9A 3HOUB 2H1EA 2PW7A 1FGBD 4K14A 2BA1A 2EOTA 1IYUA 3MAQA 4CKCA 3BVMA 3BVGA 3BYTB 2RDFA 5FLXL 3C1EA 1Q3LA 3Q0AA 2K05A 4RGNA 2E2IB 5IODA 3FPUB 1A15A 3P75A 3M85A 2K6AA 4FF4A 4KD3A 1XXGA 1JOOA 2DY7A 1B1ZA 2AUKA 3FKIB 1B2TA 3RZDB 2KA7A 3DMUA 4UDUC 1WVLA 2F4IA 3IL8A 3NTKA 1RTOA 1T5XD 3C1FA 2NTSA 4TRDA 1D5MC 4IFDJ 2A6ED 4K8IA 1RCVD 4PQXA 1EU3A 3A8IE 1Q90A 2HUGA 4XQQA 2QDBA 3S1NB 2F0KA 2D62A 1GHJA 4ZQ3A 1I4HA 4DA2A 3SK8A 5FLXE 4DK1A 1EY8A 4LK1C 2BOSA 3AMUA 3GO5A 1BF4A 5K5PA 5COYA 1I3QB 3S1QB 1B50A 5EBCA 1JE4A 2L55A 1CZGA 2K01A 5EKKA 3PUYA 2MP1A 3DWQA 1UNSA 3ZYYX 5EBDA 2OEOA 4O1NA 3I91A 5JJZA 5C4JB 1CA6A 1KDAA 4HCSA 4RGTA 2R61A 4LMQD 1STGA 2BE5C 3I72A 4QUCA 2JA6B 1V1OA 1QILA 2HCIA 3S15B 1S4ZA 1VF7A 3SDZA 1H9KA 2OT2A 1I50B 5J22A 4F7XA 3DEPA 4IFDI 5D14A 5FO9B 3MA2B 4WJWA 3Q6SA 5CBAE 3T13A 3N52A 4X3KA 4KV6A 4H44C 3VYTA 3QG1A 2WINB 3I8ZA 3GTPB 5KYLA 2KCCA 1TS2A 3EA6A 4H13C 3OWFA 4NP5A 2EYHA 3SR1A 1B3AA 2V4DA 2QKIC 1EIHA 1D2BA 3TN2A 3SE0A 2CQAA 1EFID 1IKMA 3K5OA 2F0UA 2IX0A 3LWUA 2KQ3A 3HOWB 3TDQA 1XWEA 4CJ0B 3MHBA 1EZ6A 1K83B 4ID6A 2IT1A 1PZKD 1CFMA 3GTJB 1SNQA 3GV6A 1LTBD 1WD1A 1JC7A 2DY8A 2PO4A 1UUPA 4FXKC 1G8ZD 1V1PB 5M3MB 5IOCA 4J8QA 1FR3A 2C5CA 5E4WC 5J1ZA 2K5DA 1TIID 4R9WA 1BXTA 2F0QA 1CHPD 2RBMA 3VR4A 4ZUIA 1YNJC 3VR6A 3SVMA 2JA8B 1PRTF 2XSCA 3R3OA 3TP6A 1MI2A 2MPMA 1Y1WB 2MUYA 1VMCA 3CKIB 1RJTA 2WACA 1CHQD 2L11A 4F8MA 2J4XA 5C6AA 2EJMA 4OO1H 5J39A 3K6OA 1MSGA 3FMCA 3OMCA 2R6GA 2RDGA 2NVXB 2LS01 1Y8OB 2LFNA 1XTCD 1D1IA 1F2ZA 1EEFD 3OSOA 1D5XC 3NTHA 2F0TA 2XVSA 4DFAA 1LV9A 1WTQA 4EQNA 4J1MA 3IFTA 1LTAD 1PTOF 1CZWA 4J6HA 3NQTA 4A3EB 5CV8A 3D4WA 2FMMA 4CJ2C 3NTIA 2E2DC 3GV3A 4OO1G 3OHXC 2CW0C 5EJWA 3TBIB 5BN5A 2B2UA 4RH6A 4DU9A 2JSOA 3A56A 4XYQA 2VB2X 3A55A 2I46A 1W6KA 2F3WA 3G7LA 1Y69U 4G4KA 1SYDA 5G3LD 4ZKBB 1HTPA 3NP8A 4E6IA 1PTOD 5C0XJ 4IUPA 5M9OA 3IKJA 5JVH3 1WTOA 2H4OA 5IIFA 4JK1C 3I4NB 2ZXPA 3GD7A 1NR2A 4C56C 1IKLA 2F0PA 5IGFA 1EY6A 1U4MA 3C2PA 3H3VC 3I90A 1PTOH 1Q1BA 3NE5B 4IUNA 3KLSX 2HDMA 5M5YB 2KUMA 4R8IA 1V1PA 4X3TA 5C44B 3EROA 4XQNA 3M4OB 1HA5A 3FDTA 3RUZA 2A73B 1CK1A 2B63B 4ILWA 2B2YA 2B8FA 2AQ2B 4B9WA 4PMCA 2SNMA 2XWBB 3NWSA 3VR3A 2R7ZB 2JE6I 2D2CC 5JPMC 3BS1A 3I73A 3PUXA 3MVVA 1STHA 2ICEC 5C0XI 5I2YA 2PZWA 1RDPD 1PDQA 1YNNC 4ME5A 3BYYB 5ELBA 4OHJA 2EJFC 5JVG3 4ZAIA 5ISRA 1DM0B 4HMJA 1OXTA 1TT2A 2RSOA 2XIWA 4MIUA 3EVQA 1STEA 2EZVA 1RTNA 2EYPA 5C3EB 1WTWA 5I6YA 3PMFA 5KYIA 4U673 1L0XB 1NUCA 3BDLA 1TS4A 2NTTA 2ZXOA 1E2ZA 4KI0A 5IGEA 2EYLA 2Y0SB 3E6ZX 3OW7A 4KKUA 3MXUA 2R3ZA 1DJRD 1HFNA 3AB9A 5EKIA 1LTID 3V05A 5A35A 4RWSC 2EE1A 3QB3A 1AN8A 2N55A 2QEJC 1JR0D 1HRJA 1TS5A 2BE5D 4BA2I 4K8JA 2L4NA 4G7ZC 4Y7NB 1B53A 1ET6A 3RLFA 3OWEB 3DEOA 1PMRA 4I7ZC 3Q23A 2TMPA 1SE2A 4ODGA 4P2CB 2Z4HA 5KNBA 2EYJA 4Q5VA 3I3CA 2EVBA 3NPPA 1CTMA 2F0WA 2NVQB 3VR5A 1ZXTA 1SNOA 4TSSA 1PXUA 2F0FA 2EYMA 1FNUA 1PRTB 4IFDH 4IUQA 2AQ3B 1S5BD 1SNMA 1Q1EA 1QG7A 4KKTA 5LL6S 4C2MB 2E2HB 1UEAB 3D4DA 1Z7TA 4KN7C 5IGGA 1GUTA 1LT5D 3S16B 3NBHA 2BDOA 3HP3A 3K5LA 5JOBA 1SDFA 2HQEA 2JEAI 5KNCA 4K5WA 3QJYA 4R8NA 4EGVA 5D65A 5JAVA 2M00A 1DOKA 3J7AV 1SSOA 2VXWA 3P1HA 2NVTB 3S1MB 2BDNA 2SDFA 2JA7B 3LNNA 4OGQC 1RODA 4UAIA 1I4XA 4QF4A 2PCFB 2NB0A 3E5SA 2B39A 1ZYRC 1BCPC 1F9QA 5IGDA 1YNJD 1ENCA 5HGTA 4XT1B 1V43A 3V96A 3MFYA 1EIGA 4HSPA 3JAML 1PTOB 4A3GB 1FNWA 1CQVA 4F87A 3J81L 2F1MA 2NZ1D 2IJ0A 3HOYB 5ELEA 5D3DA 1S5DD 1DYQA 1E2VA 3KLSA 3W3AA 4L8JA 4A3MB 2DNCA 1J8IA 2XRQD 1CA5A 1JQYD 4Q0FA 3L7ZC 4DXGA 2WP8J 4K6DA 4B08A 4GZYC 2L1BA 3DM1A 2RVLA 3OIQA 4HMIA 3D6CA 2EJGC 2MJ8A 3O13A 5JPNC 1LT4D 2F0NA 2O5IC 1C8CA 1QJOA 3SK6A 3JAME 1KLGD 3VYRA 1H9JA 4I65A 4X3SA 3TZUA 1R9TB 2CW0D 2NN6H 1AEXA 3CRLC 1HUMA 2JEBI 5E3FA 1TQOA 3J81E 1KDBA 3KBXA 2KVMA 1JB3A 4FNFA 3T53B 1DOLA 3ERQA 3S9WA 1DD2A 5CV4A 3PUWA 3DXJC 1HTLD 1GUSA 5CV9A 4N9PA 5EKLA 5FO7B 1U4RA 1DZ1A 1HQMC 1ET9A 3RMHA 3M7GA 5FOBB 1TR5A 4QIWB 2B2UC 3MXGA 3MC0B 3OPOA 3PUZA 1AZPA 4CKBA 4ULLA 3IFDA 4NKLA 4RHSA 2Z1CA 2F0MA 2FFKB 2M2LA 1LTSD 3MWYW 3HRZC 1V8QA 1E2WA 5A2QL 2NN6G 4L6TB 1B44D 2EDGA 3Q22A 2F0EA 5FK9C 1G291 2L0CA 1IHZA 1RD9D 2F0SA 5JEAJ 1S5ED 4KD4A 1HHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY8 A;  2F0F A;  3U9O A;  2EYM A;  1EZ6 A;  4KJN A;  5ISR A;  4ID6 A;  1KAA A;  4IZ8 A;  5K5P A;  4DU9 A;  1SNQ A;  4HMJ A;  1STA A;  1SYE A;  1TT2 A;  2O4X A;  2F0V A;  5CV5 A;  2F0G A;  2LKV A;  5DEH A;  1SNM A;  4MIU A;  3EVQ A;  4KY6 A;  2F3W A;  3MXP A;  1EYA A;  3OMG A;  2F0D A;  5IGC A;  5EKK A;  4HMI A;  3NHH A;  4PNY A;  1SNC A;  3SK5 A;  2ENB A;  5IOC A;  2EYP A;  1A3T A;  2F3V A;  2F0J A;  2F0I A;  2PZT A;  3D6C A;  4S3S A;  4ZUJ A;  2OEO A;  2F0L A;  3HEJ A;  4N9T A;  1SYD A;  5KIX A;  5I6Y A;  1KDA A;  3D4D A;  1EY4 A;  3NXW A;  3PMF A;  3NP8 A;  4LAA A;  5J1Z A;  2F0N A;  5C5M A;  4E6I A;  5KYI A;  3SK6 A;  5IGG A;  1STG A;  5IIF A;  3HZX A;  2OXP A;  1NUC A;  4QB4 A;  3BDL A;  3QOJ A;  5M9O A;  4I65 A;  3T16 A;  2SNS A;  5C3W A;  3MHB A;  2F0Q A;  1EY5 A;  2EYL A;  2RBM A;  5F2D A;  5JOB A;  1RKN A;  5C5L A;  2HQE A;  4ZUI A;  5C4H A;  1AEX A;  1F2Y A;  2PW7 A;  4RKL A;  4WOR A;  5E3F A;  3MEH A;  1TQO A;  5KGU A;  4K14 A;  3R3O A;  3TP6 A;  4K2L A;  1SND A;  4EQP A;  1KDB A;  4K5W A;  1SYC A;  4R8N A;  2F0H A;  2KHS A;  5J22 A;  1KDC A;  4OL7 A;  2F0P A;  2WAC A;  1EY6 A;  4WRD A;  2M00 A;  4F7X A;  3SHL A;  5IGF A;  5JAV A;  2RDF A;  1F2M A;  3ERQ A;  3C1E A;  3P1H A;  5EGT A;  5NUC A;  3TME A;  4F8M A;  3S9W A;  5CV4 A;  3LX0 A;  4K5V A;  5C6A A;  3EJI A;  1A2U A;  2SOB A;  5CV9 A;  3MZ5 A;  5IOD A;  3QB3 A;  4N9P A;  3VA5 A;  5J39 A;  4EQO A;  2RKS A;  3P75 A;  4K2K A;  5EKL A;  1ENA A;  1EY0 A;  3DHQ A;  4IUN A;  4NDX A;  1JOK A;  4QF4 A;  5CV6 A;  1STY A;  5CV7 A;  3T13 A;  1SNP A;  1EZ8 A;  1A2T A;  4KD3 A;  1JOO A;  5I9O A;  2EXZ A;  5E1F A;  1TR5 A;  2OF1 A;  3E5S A;  3OMC A;  3BDC A;  4K8J A;  2PYK A;  4KV6 A;  1A3U A;  5IGD A;  5DAU A;  1ENC A;  3DMU A;  1KAB A;  3ERO A;  4G57 A;  5HGT A;  2EY6 A;  1A3V A;  1EYC A;  4NMZ A;  2PZU A;  5HUR A;  2EY5 A;  4KY7 A;  2PW5 A;  5C3X A;  5CGK A;  4EVO A;  5KYL A;  2PQE A;  3RUZ A;  3C1F A;  1EY7 A;  4KY5 A;  4TRD A;  3SK4 A;  5CR3 A;  1NSN S;  4NKL A;  4PMB A;  5I6W A;  4KTA A;  1JOR A;  1F2Z A;  2EY1 A;  3V2T A;  1EQV A;  2F0M A;  4B9W A;  4PMC A;  2SNM A;  3OWF A;  4YIJ A;  5I9P A;  5IGE A;  1SYB A;  4KHV A;  2EYH A;  2EYO A;  3OSO A;  4K8I A;  4NP5 A;  3SR1 A;  2F0T A;  5CC4 A;  3TP8 A;  4B9X A;  3NK9 A;  2EY2 A;  4K5X A;  4ODG A;  2EYF A;  2F0O A;  3NUC A;  4IAL A;  1U9R A;  4HTH A;  2QDB A;  5KRU A;  2F0K A;  1JOQ A;  1II3 A;  4RKB A;  2EYJ A;  5IGB A;  4KJO A;  1SYF A;  1STH A;  2NUC A;  3MVV A;  4DFA A;  3H6M A;  2F0U A;  4DF7 A;  5C4Z A;  3ITP A;  5KEE A;  4EQN A;  4J1M A;  4ZQ3 A;  2KQ3 A;  2PZW A;  4QMG A;  1SYG A;  2F0E A;  2F0W A;  3QOL A;  4DGZ A;  1STB A;  1EYD A;  4J6H A;  3NQT A;  3TP5 A;  1IHZ A;  3SK8 A;  2F0S A;  4ME5 A;  5CV8 A;  3TP7 A;  3D4W A;  4H7B A;  1SNO A;  4K6D A;  4KD4 A;  3D8G A;  1EY9 A;  3SXH A;  1STN A; 
#chains in the Genus database with same CATH topology
 1KRT A;  3U9O A;  1CQF A;  5M5W B;  4KJN A;  4DV2 L;  4GOP B;  1X54 A;  4BBR B;  4A3F G;  4DR1 Q;  1L1O B;  4ZLT F;  4AYB B;  2F0V A;  1F9S A;  1KNE A;  2TSS A;  3S17 B;  1RF2 D;  1PYW D;  3RLN A;  4FVM A;  5BN3 A;  5FO8 B;  3WWV A;  2F3V A;  5GAH C;  2F0I A;  3R2I A;  1JJC B;  2DJF C;  3CW2 C;  2B29 A;  3GTG B;  4QY7 A;  2K14 A;  2NVY H;  4JI0 Q;  2UUB Q;  3HZX A;  2PI2 A;  3W2D A;  1YNN D;  4MTK A;  4IUT A;  2B2Y C;  3EQL C;  1PFN A;  5C5L A;  4A3D H;  3J80 c;  4WOR A;  3ERS X;  3H0G B;  2A68 C;  3P20 A;  5ELC A;  1UE1 A;  1VQJ A;  4IQZ A;  1A63 A;  5A2Q E;  4U68 A;  3K0Y A;  5CMD A;  4FP5 D;  3VR2 A;  4A93 H;  3G4S A;  5HY6 A;  3HKZ B;  1TS3 A;  4HCE A;  2PMZ B;  3MZ5 A;  1QB5 D;  4EQO A;  2R92 H;  1ENA A;  1EY0 A;  3DHQ A;  4RGO S;  3GTM H;  3D6W A;  1AZQ A;  1IBK L;  1M1K C;  4A3K B;  3I7F A;  5E1F A;  4GLV B;  4DAM A;  5DAU A;  3CP0 A;  1UE5 A;  4HIK A;  1IBM Q;  4POG A;  2MO1 A;  1ESR A;  3F2B A;  1I4P A;  3A8J E;  3F2D A;  4WJ3 M;  1BQQ T;  3D3R A;  3PO3 G;  2CH4 W;  5M3F H;  1EY7 A;  2WII B;  4JI8 Q;  5I6W A;  3FPP A;  4LF5 L;  4C1N I;  4DXF A;  5EAY A;  1EQV A;  1PZJ D;  2PNH A;  2MO0 A;  4YIJ A;  5I9P A;  4IOC A;  1FL0 A;  1OXU A;  4OIJ A;  4BY7 B;  1C4Q A;  2VQF L;  2Q2U A;  1S5F D;  1PYS B;  2QCP X;  4A3D G;  1IL2 A;  1PYB A;  2UUC Q;  1MBY A;  1HXY D;  1ASZ A;  3H6M A;  5KEE A;  1D5Z C;  1I4R A;  3DUZ A;  1IYJ B;  1EQR A;  1BO0 A;  2GA4 B;  1O78 A;  1VMP A;  2IHF A;  1GJX A;  1HCZ A;  1O7Z A;  4DK0 A;  2B2T A;  1IZ6 A;  5M5X H;  1GUO A;  5CBE E;  1W6J A;  1AH9 A;  4ZCK A;  4A93 G;  1EY9 A;  2Z6K C;  4L5T A;  1YBY A;  4IPH A;  1PLF A;  2K7V A;  4HAE A;  4DAP A;  2R92 G;  4DAY A;  4CHT B;  1SRO A;  1KD1 C;  4C3J H;  2ES2 A;  2AWO A;  1F9R A;  2R7D A;  1GUW A;  1C48 A;  2NBF A;  3D31 A;  3S14 H;  1R4Q B;  1Z9F A;  2BA0 A;  4JBJ A;  1EOT A;  2KCM A;  2L9H A;  1NMG A;  4A4I A;  3HOV B;  2OTJ A;  2D5D A;  3GTK B;  3CCQ A;  2YTV A;  3M4P A;  5G3L F;  3PO2 H;  4R4Q A;  1ILQ A;  4A3J H;  1GXD C;  4A3I B;  3CAM A;  5M3F G;  3U58 A;  4XYO A;  3T16 A;  1TWC B;  3DWA A;  4GKK L;  3MEH A;  1WD0 A;  1N34 Q;  2QIL A;  4Y52 H;  5C4X H;  2O5J C;  1TWA H;  3H91 A;  1WCM B;  4JI5 Q;  3GTO H;  3VA7 A;  1IBL L;  5EGT A;  1DON A;  4HJA A;  3LX0 A;  4HIM A;  1A2U A;  1N32 Q;  4CKE A;  1F9P A;  4X66 Q;  4GOP A;  4DV6 L;  4JYA L;  1L1O A;  1HA6 A;  4RCN A;  4FXD A;  1SNP A;  5LL6 X;  3K0X A;  3ULJ A;  1VCI A;  4DV7 Q;  2MNA A;  2V1C C;  1X3F A;  1DGS A;  1VQA A;  2UXB Q;  3Q8D A;  1TY2 A;  4C3J G;  2EY5 A;  2ZT9 C;  1SMY C;  3CHB D;  1MGS A;  4EVO A;  2A6H C;  2JP1 A;  2A5H A;  1EEI D;  1NSN S;  4PMB A;  4A3F B;  1K8A C;  1C0A A;  1KLU D;  4LJZ C;  4TKO B;  1J6Q A;  3PO2 G;  4A3J G;  4NXM L;  3HOU H;  1SE3 A;  2HIV A;  1CM9 A;  1MJC A;  2KHI A;  4IAL A;  1F2L A;  1PA6 A;  1U9R A;  3RR5 A;  4G7H C;  3C46 A;  1ZYR D;  1BCP D;  5T1I A;  1YHA A;  1MD2 D;  3DM3 A;  3K58 A;  1VQL A;  1C9O A;  4QGU A;  2LY7 A;  3S24 A;  3CCL A;  5C4X G;  4IPG A;  4ZKC B;  2P5Z X;  3UDX A;  4BXX H;  3FVQ A;  4OX9 L;  3HGB A;  1AFP A;  2ZJP A;  3NQI A;  1E1O A;  1KAA A;  4DR7 Q;  4UP7 A;  2XNA C;  3P7J A;  4B3T Q;  2G5D A;  2WAQ G;  5DEH A;  2B2W A;  3RZD H;  3PSI A;  3NHH A;  3GQB A;  1T5E A;  3LWE A;  4LUV A;  1K8M A;  1G51 A;  1U0L A;  1XYI A;  3UE0 A;  3PV0 A;  3BDO A;  2AMC B;  3K59 A;  2SNS A;  4IPD A;  1MSH A;  5IP7 H;  4DR6 Q;  1UAP A;  3K81 C;  4IUR A;  3QR8 A;  3PO3 B;  2PNR C;  4EQP A;  1SMX A;  4FF2 A;  1KDC A;  4CGY B;  1Z47 A;  4XIG S;  3NEL A;  1YJ9 A;  1EFW A;  3EJI A;  2NVY B;  2SOB A;  4JG2 A;  2K52 A;  2X6L A;  4QUF A;  4NDX A;  5CV6 A;  1VQC A;  3EFX D;  5CV7 A;  3RLO A;  4A3D B;  3CQZ B;  1TWH H;  4OO1 I;  5I9O A;  3X3M A;  4BXX G;  2OQ0 A;  2K5N A;  1VQG A;  1ENF A;  1X55 A;  3F8T A;  2WKC A;  2KCT A;  4ZK9 B;  2UUA L;  1Y8P B;  4KY7 A;  3DLL A;  4O0A A;  3MXN B;  4A93 B;  5C4J H;  3PIO 3;  2K03 A;  2NWG A;  4KY5 A;  2Z4I A;  3SK4 A;  2R92 B;  3TSS A;  1G6P A;  1IXR A;  2EY1 A;  2VY3 A;  4PG3 A;  1CUK A;  2Q8I B;  4KHV A;  1OXS C;  5CC4 A;  5LHY 1;  1SFO B;  2I07 B;  4DN4 M;  2DN8 A;  1H95 A;  1ML0 D;  4K5X A;  1VQO A;  2ZXR A;  3NUC A;  5IP7 G;  1LTT D;  2K5W A;  1II3 A;  1I50 H;  1N9W A;  2UXC Q;  5BN4 A;  1LT6 D;  5M3F B;  1TY0 A;  3M4Y A;  3FEW X;  2VQE Q;  1HNX Q;  4QMG A;  2Q8R E;  3URY A;  4DGZ A;  5IYC G;  1EYD A;  1HNW L;  3CPW A;  1K0R A;  3PQI A;  2WB1 E;  3J81 j;  3D8G A;  2JQO A;  4KK7 A;  1FD7 D;  1PRT C;  3MEF A;  5K36 H;  2YU9 H;  4FO2 A;  3PF4 A;  1KNA A;  1O7L A;  1VQ6 A;  4JOI A;  4ZYS A;  1U5K A;  2LKV A;  4CBV A;  1J9O A;  5GRO A;  2B2V A;  4M1U B;  2NZO A;  2K33 A;  1HFG A;  1W2B A;  3Q24 A;  4N9T A;  3JAM i;  3T1H Q;  1SLJ A;  2YV5 A;  4JI4 L;  3QO2 A;  3B6Y A;  1EU4 A;  4JI6 Q;  1NMF A;  1RHP A;  2X69 A;  5GQO A;  1IW7 C;  4C3J B;  4JI1 L;  4YHH L;  2NZH A;  3PIP A;  1FGU A;  1UEB A;  4JC0 A;  5KGU A;  2VB3 X;  2R93 H;  3CD6 A;  3S14 B;  5I4D A;  2G9H D;  2K1B A;  4K6L A;  3OOC A;  2KHS A;  2PPB C;  1DXM A;  1U4P A;  5NUC A;  4FXG C;  4YCW A;  1EQT A;  4A3J B;  1M8A A;  1H9S B;  3UI2 A;  3A8K E;  3K57 A;  3M7N A;  4XQJ A;  4BBS G;  1HQR D;  4DUZ L;  5IT9 L;  1YJW A;  1STY A;  1E0B A;  1L0Y B;  1XNQ L;  1EZ8 A;  1N8R C;  4LF7 L;  3S2D H;  2EXZ A;  2HD3 A;  4RHR A;  1AP0 A;  2EIF A;  5C4X B;  1TWA B;  1KAB A;  1EYC A;  2BH8 A;  3GTO B;  1BOS A;  2A68 D;  3KBG A;  4O2D A;  1H9R A;  1DOM A;  1D1K A;  2PQE A;  4R4C A;  3U50 C;  2SEB D;  4KTA A;  2Y0S E;  2WAQ B;  4DKA C;  1MHW C;  1SJH D;  5DM6 3;  3M4Q A;  2F52 A;  5LMU Q;  3GTQ H;  4DAV A;  4IJH A;  2JA8 H;  1N33 L;  4DV1 L;  3G6J B;  3W1B A;  5DM7 3;  4NXN L;  4IFD G;  2R93 G;  2C35 B;  2JXM B;  2HT1 A;  1CKO A;  5H1S E;  2XN9 C;  2Z9H A;  4C3H G;  3U9S A;  3TP7 A;  1WJJ A;  1FNV A;  2J7Z A;  1O80 A;  2IL8 A;  1Z6H A;  1EIY B;  1FJG Q;  5IT9 E;  4IUU A;  4M8A A;  1SYE A;  2F0G A;  1I6H H;  2A74 C;  3GP7 A;  3MXN A;  1WTX A;  2K5Q A;  4DNR B;  5I2X A;  2F0D A;  3GTL H;  3I4M G;  4QCL A;  2PZT A;  2KJX A;  1X9N A;  1B8A A;  1ESF A;  3A7A B;  4X65 Q;  1X56 A;  4KMU C;  3KK7 A;  1EWC A;  4RGM A;  1EY5 A;  5E7N A;  1QNK A;  5JEA H;  1EWI A;  4PZ8 A;  4JCV E;  4IUV A;  1BCP B;  4RKL A;  1SND A;  1QZG A;  1SYC A;  4LFB Q;  3KF8 B;  4F88 A;  1QWY A;  2RCN A;  4K0K L;  1VQN A;  3T4A C;  3E0J A;  3W1G A;  3D4R A;  4A3E H;  4IJL A;  4MN3 A;  2ZM6 L;  2J0T D;  2OCE A;  2B2T C;  4WFN 3;  4HSV A;  4X3U A;  3BVZ A;  4DR2 L;  1QNU A;  1ICF B;  4JV5 L;  4NW2 A;  5FLX c;  2RF4 A;  1B9M A;  3ND8 A;  1NY4 A;  4BA1 I;  5HUR A;  1GUN A;  3PCO B;  4JW0 A;  4DR4 Q;  3R93 A;  5FJ8 H;  3J7Y W;  3QIA A;  1QOH A;  3AEV A;  3H09 A;  3PIO A;  1I6V C;  4CDF C;  2LMC B;  2KEC A;  2HCC A;  3V2T A;  3M3Y H;  4DR3 Q;  3S2H H;  4P75 A;  1J5E Q;  1TWH B;  5ELD A;  2EPB A;  2FJ2 A;  2LXJ A;  4GKJ L;  4BWG B;  1G2T A;  2EYF A;  4LNQ A;  3M9B A;  2FHT A;  1BBX C;  4LF9 Q;  5JEA G;  5KRU A;  1TWG H;  1WTR A;  4LF4 L;  1AW7 A;  1H9S A;  1VQH A;  5C4Z A;  1Q81 C;  2KHJ A;  2I5H A;  4A3L H;  1SMY D;  2A6H D;  2A69 C;  2JYO A;  1JWS D;  4YY3 Q;  2DNE A;  2AQ1 B;  4GOP C;  4DV0 Q;  1L1O C;  1XNR L;  2AUJ D;  2L12 A;  4PMW A;  2VNU D;  3T51 B;  3OMG A;  4RFB A;  1IL8 A;  2G9D A;  2MQH A;  3J80 L;  4BBS B;  3CRK C;  5AFW A;  5CYU A;  1EL0 A;  5LMN Q;  3HEJ A;  3A5U A;  4X64 L;  4LAA A;  3H3V H;  1HR0 Q;  1PH8 A;  2B8G A;  1LAC A;  1TXY A;  4LWC A;  5FJ8 G;  3TS2 A;  4KHZ A;  5DLQ E;  2OXP A;  4FF1 A;  1YHQ A;  2PI2 E;  2YU9 B;  4DV3 Q;  1RKN A;  1HNZ Q;  1JWU D;  4C3I G;  1KL9 A;  5T1G A;  1X32 A;  1I4Q A;  2KOL A;  3ONA B;  1GKH A;  1Y8N B;  3MTS A;  4HR7 B;  2K28 A;  1WFQ A;  2F3I A;  2WV6 D;  1X3G A;  3BZC A;  3VA5 A;  1P8L A;  2JA5 H;  4K2K A;  4A3L G;  1JOK A;  5FLM G;  3FRP B;  3E3X A;  4DR1 L;  3W5O A;  3RN5 A;  2R93 B;  2E2J H;  4ME3 A;  3HOX H;  2WB1 G;  1A6X A;  1A3V A;  3SGI A;  4NMZ A;  2XRS D;  1X3Q A;  4C3H B;  2PW5 A;  2YYZ A;  2B2W C;  4LF8 Q;  1MKH A;  1YJN A;  4GNX B;  1SEB D;  3BZD B;  4JI0 L;  2UUB L;  5CR3 A;  3PUV A;  3J80 E;  4JPB W;  2AWN A;  5IWA Q;  1HUN A;  3KF6 B;  3S2D B;  1SBB B;  3NEM A;  5L37 A;  3KF8 A;  3I4M B;  1Q12 A;  5C0X H;  1X3P A;  4KJO A;  3ITP A;  3I4L A;  3CCS A;  4KKS A;  3QOL A;  4OIK A;  1E3P A;  1STB A;  1ICW A;  2LSS A;  1HJP A;  4H7B A;  4OON A;  3AFQ A;  4A3C H;  1TWF H;  2WKD A;  3SK5 A;  1OXX K;  1W3S A;  1YHB A;  4YCV A;  3WDN A;  3PF5 A;  2HHH Q;  3GTQ B;  2JA5 G;  4ALP A;  1GOZ A;  2KCN A;  2MHV A;  1IBM L;  2O4X A;  1FVI A;  2XWJ B;  4Y7N H;  1LTR D;  4IOA A;  4OXP A;  2I0Q A;  2ALY B;  2ENB A;  3HOX G;  2IX3 A;  2F4V Q;  1OO9 B;  4JI8 L;  4HED A;  1HPC A;  3DWP A;  3TZD A;  3H15 A;  1D6E C;  1PH9 A;  1A62 A;  2BCO A;  2QF7 A;  4ABN A;  2JN4 A;  2QEX A;  2Q8T A;  1PH6 A;  1QVC A;  2RA4 A;  4B3S Q;  1Y1V H;  4HJ9 A;  1I94 Q;  5C4H A;  1I4G A;  1F2Y A;  1I6H B;  1PRT D;  1LYL A;  2UXD Q;  1MJE A;  2UUC L;  3GTL B;  2F0H A;  1U4L A;  5C0X G;  2NN6 I;  1YNX A;  1F2M A;  1JWM D;  3TME A;  1UWV A;  2VUM H;  1PFB A;  1BNZ A;  1GHK A;  1BDO A;  2A6E C;  1VS0 A;  2O2L D;  2RKS A;  3UDG A;  3HOZ H;  2Q2H A;  3CME A;  1EQQ A;  3PIP 3;  1ZEQ X;  2MGS A;  5EPK A;  3A54 A;  1IW7 D;  4L63 B;  1G91 A;  2M9V A;  1N36 Q;  4JOI C;  1HZC A;  1IYV A;  2K04 A;  3X3N A;  4A3B H;  2B2V C;  5C3X A;  4XT3 B;  3KLR A;  2ID0 A;  3QWN A;  2Z6B A;  2E2H H;  1RIP A;  1NTG A;  2RDH A;  3S16 H;  4V19 0;  4FYD A;  2K5H A;  3SEB A;  3NBI A;  4YWK A;  1KTK A;  3VYS A;  1N34 L;  3HS0 C;  1Y1V G;  2Z8L A;  3CC7 A;  4HTH A;  3J7A F;  1QE6 A;  4JI5 L;  1BCP F;  2NUC A;  3HKZ E;  4TQU S;  4X62 Q;  1N32 L;  2E74 C;  1SYG A;  4X66 L;  4OEM B;  3RZO B;  1NCV A;  1NJI C;  4BY1 H;  3M3Y B;  3S2H B;  2ZTC A;  4C3I B;  4CDD C;  2VUM G;  1F77 A;  1STN A;  2KED A;  3IAY A;  3HOZ G;  4KLK A;  5BR8 Q;  2YTX A;  2UXB L;  1ILP A;  1LO5 D;  3WOF A;  4MTN A;  1TU2 B;  5CV5 A;  2KBN A;  1TWG B;  1B4O A;  1EYA A;  1O7Y A;  4PNY A;  4A75 A;  1SNC A;  2OWO A;  4PV1 C;  3S1R B;  1OXV A;  3NXW A;  2NYZ D;  3KF6 A;  3L3O C;  4A3B G;  1VQ8 A;  1M90 C;  2E2I H;  1TVX A;  2WB1 B;  4LFA Q;  5F2D A;  2K5V A;  5LMN W;  2Q2T A;  3T56 B;  5COR A;  1HR0 W;  4P73 A;  3FKI H;  5EPJ A;  3VYU A;  1KQS A;  1BVS A;  4AH6 A;  2I5M X;  4RAU C;  4WRD A;  1JIC A;  3RD4 A;  3SHL A;  4AQY Q;  3K7A B;  5ELF A;  1CKN B;  4A3M H;  2ICI A;  1KIX A;  1Q86 C;  4XXE A;  3F2C A;  3BU2 A;  4FF3 A;  3T1Y Q;  4BY1 G;  2D9U A;  1PFM A;  4DR7 L;  3AFP A;  4B3T L;  2OF1 A;  1A3U A;  4CJ1 B;  1TKW B;  2RSN A;  4G57 A;  2CVR A;  3HOU G;  3WOE A;  1SR3 A;  4O42 A;  2BH2 A;  3S1N H;  1VF5 C;  5KND A;  1GD7 A;  5EPL A;  3OW2 A;  1X6O A;  4GLA C;  1EYG A;  2C9O A;  2JA5 B;  2KEE A;  1G2S A;  2HDL A;  3I56 A;  4H0L C;  4JBM A;  4DR6 L;  1QCB D;  3KOJ A;  1SYB A;  4LUO A;  1SXT A;  3F2U A;  2RCF A;  2E2J B;  4IO9 A;  3KYH C;  4B9X A;  3HOX B;  2K32 A;  3NK9 A;  2EY2 A;  3R8B A;  2F0O A;  1I3Q H;  3S1Q H;  1WTP A;  4JBW A;  4UPA A;  1JOQ A;  2CKZ B;  4RKB A;  3IRB A;  4DF7 A;  2L5T A;  2FMC A;  3FKI G;  4BS9 A;  1SE4 A;  3TP5 A;  1VQM A;  1NR4 A;  4JI3 Q;  3GTM B;  1PH1 A;  4RCO A;  3SXH A;  3N6R A;  2N49 A;  3OIP A;  5DNF A;  1M4V A;  1DCZ A;  2JA6 H;  2IPK D;  1STA A;  1LLR D;  1LT3 D;  3S15 H;  3STB C;  1BR9 A;  4RA8 A;  3TEH B;  1I5F A;  4GN3 B;  4KY6 A;  2IWH A;  4QL5 A;  4DNT B;  1JCK B;  1XX8 A;  2F0J A;  4ZUJ A;  4MZ9 A;  1LTG D;  1H9M A;  3CU7 A;  1BUV T;  5KIX A;  1CSQ A;  1EY4 A;  1R4P B;  5C5M A;  4JI2 Q;  2QGQ A;  1TWF B;  4PZ7 A;  2IW3 A;  4QB4 A;  3QOJ A;  2A69 D;  5C3W A;  4HID A;  5IGC A;  3C3L A;  3K5N A;  4PZ6 A;  4HJ8 A;  3LGJ A;  3H94 A;  4K2L A;  4G7O C;  2UXC L;  4B3R Q;  4HN7 A;  3NWT A;  4OL7 A;  2VQE L;  3R2T A;  1HNX L;  2N88 A;  1S5C D;  1VDZ A;  3GTP H;  4K5V A;  5FKA C;  4UY8 C;  5M5X B;  4XDX A;  3CCE A;  2RQX A;  1Y1V B;  2E5L L;  1NAP A;  4OWW B;  3J81 i;  1A2T A;  1K8O A;  5IYD H;  4BBR H;  1CI3 M;  3BDC A;  1ONL A;  2PYK A;  1JJ2 A;  4DUY Q;  1Q8K A;  2JA6 G;  2EY6 A;  2PQA B;  4MHE A;  3HG9 A;  2PZU A;  5D3I B;  3AYH B;  2VUM B;  5CGK A;  1Q8I A;  3PO2 B;  2CWA A;  3HOZ B;  4JI6 L;  3GTG H;  3KUP A;  3HOW H;  4V0B A;  2JA9 A;  1SAP A;  4ZRZ A;  1OTC A;  4Z9C B;  2K50 A;  2EYO A;  4C1N K;  3TP8 A;  4LF7 Q;  1K83 H;  2FIN B;  3GTJ H;  1K0S A;  3A7L A;  1PH5 A;  2F03 A;  1CKN A;  1GUG A;  5K36 G;  4A3B B;  5IGB A;  1CT1 D;  1SYF A;  2IX1 A;  5M3M H;  1PTO C;  3L9A X;  4IN3 A;  1KRS A;  5EQ0 A;  4N8X 1;  4XTC S;  4DR5 Q;  1JOR A;  2CHB D;  5TSS A;  1HZ9 A;  1FYC A;  4IZ8 A;  3MFG A;  4KN4 C;  2X6G A;  1PZI D;  4WJ4 A;  3CPF A;  2E76 C;  5ELN A;  3BG3 A;  2E75 C;  5IYD G;  3MXP A;  1SJE D;  1LAB A;  1YEZ A;  3NSW A;  3AU7 A;  3TS0 A;  3I70 A;  1Y1W H;  4S3S A;  1A3T A;  1PH2 A;  1E1T A;  2F0L A;  5AJ3 Q;  4BY1 B;  1AE2 A;  1WTV A;  5E4X A;  3K5M A;  2IY5 B;  1G6Z A;  4I7A A;  1EWH A;  3J7A 5;  4GLX A;  1ZKO A;  5LMU L;  1B9N A;  3ND9 A;  3HOW G;  3HOU B;  1KC8 C;  2H1E A;  1AE3 A;  2PW7 A;  2QW7 A;  1FGB D;  4K14 A;  2BA1 A;  2EOT A;  1IYU A;  3MAQ A;  1XPO A;  4CKC A;  1SN8 A;  3BVM A;  3BVG A;  2NVX H;  3ICE A;  3BYT B;  5IT9 c;  2RDF A;  5FLX L;  4MNO A;  3C1E A;  1Q3L A;  3Q0A A;  3E9I A;  4AIM A;  2K05 A;  4RGN A;  5M3M G;  2E2I B;  5IOD A;  3FPU B;  1A15 A;  3P75 A;  3M85 A;  2K6A A;  4FF4 A;  4KD3 A;  1XXG A;  1FJG L;  1JOO A;  2EXD A;  3PGZ A;  3D0F A;  2DY7 A;  1B1Z A;  2AUK A;  3FKI B;  3KDF B;  1B2T A;  4RMF A;  2KA7 A;  2XTI A;  3DMU A;  4UDU C;  3RZD B;  1WVL A;  2F4I A;  1VQ7 A;  2DGY A;  3IL8 A;  3NTK A;  1X3E A;  2JA8 G;  1RTO A;  1T5X D;  3C1F A;  2NTS A;  4TRD A;  1Y1W G;  1XJV A;  3J7Z C;  1D5M C;  4IFD J;  2A6E D;  1LUZ A;  4K8I A;  1VQ9 A;  1UE7 A;  4HJ7 A;  2ZJR A;  2UU9 Q;  1RCV D;  4PQX A;  1EU3 A;  2N78 A;  1Q90 A;  3A8I E;  3CC4 A;  3JAM c;  2HUG A;  1WOC A;  2KEN A;  4JI7 Q;  4XQQ A;  2QDB A;  3S1N B;  4LFC Q;  2F0K A;  4LF6 Q;  1YVC A;  2D62 A;  1GHJ A;  3J81 c;  4ZQ3 A;  1I4H A;  4DA2 A;  1XMO Q;  3SK8 A;  3K7U C;  5FLX E;  1JT8 A;  4DK1 A;  2ATW A;  1EY8 A;  4LK1 C;  2BOS A;  3AMU A;  3GO5 A;  1BF4 A;  5K5P A;  4DV5 Q;  2PQA A;  5COY A;  1I3Q B;  3S1Q B;  3I4N H;  4KHP Q;  1B50 A;  5EBC A;  1JE4 A;  2L55 A;  4L5S A;  1CZG A;  2K01 A;  4DR4 L;  2ASB A;  3PUY A;  2MP1 A;  3DWQ A;  1UNS A;  5EKK A;  3ZYY X;  4B3M Q;  5EBD A;  2D0O A;  2OEO A;  3I91 A;  4O1N A;  5JJZ A;  5C4J B;  1CA6 A;  1KDA A;  4HCS A;  2VS1 A;  4RGT A;  4DR3 L;  1LM0 A;  2R61 A;  1J5E L;  4LMQ D;  1STG A;  4P74 A;  2BE5 C;  3I72 A;  4QUC A;  2JA6 B;  4R4T A;  1V1O A;  1QIL A;  4A3E G;  1XTD A;  1B3Q A;  2HCI A;  5M5Y H;  3S15 B;  1S4Z A;  4LF9 L;  5IYB H;  4DV4 L;  1VF7 A;  3SDZ A;  5C44 H;  1H9K A;  2OT2 A;  1I50 B;  5J22 A;  4F7X A;  1WTH A;  3TRZ A;  3DEP A;  1XMQ Q;  3OTO Q;  3M4O H;  4IFD I;  5D14 A;  5FO9 B;  2FXQ A;  1NNX A;  3MA2 B;  1QVG A;  4YY3 L;  3ULP A;  4YWL A;  2B63 H;  3NEN A;  4WJW A;  3Q6S A;  4DV0 L;  5CBA E;  3T13 A;  3N52 A;  3L0O A;  2R7Z H;  1GM5 A;  4X3K A;  4DV2 Q;  4KV6 A;  4L5R C;  4H44 C;  1Q7Y C;  3VYT A;  3QG1 A;  3I4N G;  2WIN B;  5LMN L;  1VQK A;  3I8Z A;  3GTP B;  5KYL A;  1HR0 L;  2KCC A;  4EX5 A;  1TS2 A;  2OQK A;  3EA6 A;  4H13 C;  2N8N A;  1A0I A;  3OWF A;  4DV3 L;  1HNZ L;  4NP5 A;  2EYH A;  3SR1 A;  1B3A A;  1VQI A;  2QKI C;  2V4D A;  5IY0 A;  1L0W A;  1EIH A;  1D2B A;  1HZA A;  3L2P A;  3TN2 A;  3PO3 H;  3SE0 A;  2CQA A;  1EFI D;  4A76 A;  5IYB G;  3K5O A;  1IKM A;  1T9H A;  2F0U A;  2IX0 A;  5C44 G;  2CCZ A;  4JBK A;  4N8F A;  3LWU A;  3U4V A;  2KQ3 A;  3HOW B;  3TDQ A;  5C3E H;  1XWE A;  4CJ0 B;  3MHB A;  1VQF A;  1S3O A;  3KDF A;  1EZ6 A;  1K83 B;  1WI5 A;  3CQZ H;  4ID6 A;  2B63 G;  2IT1 A;  1PZK D;  1CFM A;  3E9H A;  3GTJ B;  1SNQ A;  1IBK Q;  3G71 A;  2VW9 A;  4HIO A;  3GV6 A;  3ER0 A;  1LTB D;  1WD1 A;  1JC7 A;  2R7Z G;  1VQP A;  2DY8 A;  2PO4 A;  1UUP A;  4FXK C;  4LF8 L;  1G8Z D;  1V1P B;  5M3M B;  5IOC A;  1GO3 E;  3CCR A;  3KFU A;  4J8Q A;  2ZJQ A;  1FR3 A;  2C5C A;  5E4W C;  2AKW B;  3A74 A;  5J1Z A;  4P71 A;  2JJQ A;  5HGQ A;  5IWA L;  2K5D A;  1PH4 A;  2WFW A;  4LF5 Q;  1TII D;  4R9W A;  1BXT A;  1VQB A;  4QIW E;  2F0Q A;  1SFO H;  1CHP D;  1B70 B;  2RBM A;  2VZA A;  3VR4 A;  4ZUI A;  1YNJ C;  3VR6 A;  2B3G A;  3SVM A;  2JA8 B;  1PRT F;  3RN2 A;  4YWM A;  2XSC A;  3R3O A;  3TP6 A;  2VQF Q;  1MI2 A;  2MPM A;  1Y1W B;  2MUY A;  1VMC A;  3A0J A;  3CKI B;  3STB D;  1RJT A;  2WAC A;  3OYY A;  1CHQ D;  2L11 A;  4F8M A;  2J4X A;  5C6A A;  2EJM A;  4OO1 H;  3BZK A;  5J39 A;  5IP9 H;  3K6O A;  3RNU A;  2EQS A;  1MSG A;  2HHH L;  3FMC A;  2H5X A;  5C3E G;  3OMC A;  2R6G A;  2RDG A;  1QUQ B;  2NVX B;  1KAW A;  1Q46 A;  1Y8O B;  2LS0 1;  2Y0S G;  2F4V L;  4H02 A;  3BJU A;  2LFN A;  3UE1 A;  1XTC D;  1JE5 A;  1D1I A;  2LXK A;  4B3S L;  2NVQ H;  1F2Z A;  1I94 L;  1E22 A;  1EEF D;  4AYB E;  3OSO A;  1D5X C;  3NTH A;  2F0T A;  1SRU A;  2XVS A;  2UXD L;  4A3C G;  4GKK Q;  3HKS A;  3CC2 A;  1KXL A;  3KJP A;  4OWX B;  4DFA A;  1LV9 A;  1S40 A;  1WTQ A;  4EQN A;  4J1M A;  4IPC A;  3IFT A;  2L15 A;  1LTA D;  4C2M H;  1IBL Q;  4X6A H;  1PTO F;  1CZW A;  4J6H A;  3NQT A;  4A3E B;  1VQ5 A;  4YCU A;  2K4K A;  5CV8 A;  3D4W A;  2FMM A;  4CJ2 C;  2XGT A;  3NTI A;  2E2D C;  3GV3 A;  4DV6 Q;  3OHX C;  2CW0 C;  2RHQ B;  4JYA Q;  4OO1 G;  5EJW A;  3TBI B;  5BN5 A;  5IP9 G;  2B2U A;  4RH6 A;  4DU9 A;  5GAE C;  4RG1 A;  2JSO A;  3A56 A;  4XYQ A;  1N36 L;  2VB2 X;  3A55 A;  2OTL A;  2I46 A;  1W6K A;  2F3W A;  1RL2 A;  3G7L A;  1Y69 U;  2PMZ E;  4G4K A;  1SYD A;  5G3L D;  4ZKB B;  1HTP A;  2ZTD A;  2NVT H;  3NP8 A;  4E6I A;  3S1M H;  1PTO D;  2JA7 H;  1KHI A;  2QDL A;  5C0X J;  4IUP A;  5M9O A;  3IKJ A;  5JVH 3;  1WTO A;  2H4O A;  5IIF A;  3H3V I;  4JK1 C;  4DV7 L;  1Y14 B;  3KJO A;  3I4N B;  2ZXP A;  4NXM Q;  3GD7 A;  3CCU A;  1CKM A;  1NR2 A;  1YI2 A;  3A5Z B;  4C56 C;  1LTL A;  1IKL A;  4GNX A;  2F0P A;  5IGF A;  1EY6 A;  1U4M A;  4X62 L;  1YIT A;  3C2P A;  3H3V C;  2DJG C;  3EN2 A;  3I90 A;  1PTO H;  1ASY A;  4A3G H;  1Q1B A;  3NE5 B;  1BKB A;  4IUN A;  3KLS X;  4OX9 Q;  5BR8 L;  2HDM A;  5M5Y B;  2KUM A;  4R8I A;  1V1P A;  3HOY H;  4X3T A;  2CWP A;  4P72 A;  5C44 B;  3ERO A;  1VQE A;  5JJI A;  2Z0S A;  4XQN A;  1VQD A;  4CDC C;  5IE8 A;  4GN5 A;  3M4O B;  3I4O A;  1HA5 A;  3FDT A;  4UP8 A;  3RUZ A;  2A73 B;  1CK1 A;  2B63 B;  4ILW A;  2B2Y A;  3ULL A;  2B8F A;  2AQ2 B;  1O7I A;  4LFA L;  2HQL A;  4B9W A;  4PMC A;  2SNM A;  2XWB B;  3NWS A;  3VR3 A;  2R7Z B;  2JE6 I;  2D2C C;  2JA7 G;  5JPM C;  3G48 A;  3NBH B;  3BS1 A;  3KLW A;  3I73 A;  3PUX A;  2CQO A;  4AQY L;  3MVV A;  1STH A;  2JK8 A;  2ICE C;  5C0X I;  4LW1 A;  5I2Y A;  1PH7 A;  2GVB A;  4GS3 A;  2PZW A;  1RDP D;  5JJK A;  1PDQ A;  1MIU A;  1YNN C;  1SE8 A;  4ME5 A;  3BYY B;  1BBU A;  5ELB A;  3T1Y L;  4OHJ A;  2EJF C;  4EQ5 A;  4ZAI A;  5JVG 3;  4A3G G;  4TVA B;  1WYD A;  4UHV A;  5ISR A;  3HFZ B;  1QUQ A;  1XPR A;  1R9T H;  1DM0 B;  1EIF A;  3CCV A;  4HMJ A;  1OXT A;  1TT2 A;  2RSO A;  2XIW A;  4MIU A;  3EVQ A;  1E24 A;  3HOY G;  1A8V A;  1STE A;  4POF A;  5IYC H;  2EZV A;  1JB7 A;  1RTN A;  2EYP A;  2UUA Q;  4DPG A;  1E7Z A;  5C3E B;  1WTW A;  5I6Y A;  3PMF A;  5KYI A;  1YZ6 A;  3EIV A;  4U67 3;  1JJG A;  4OEL B;  4APV A;  1L0X B;  1NUC A;  3BDL A;  1TS4 A;  2NTT A;  2ZXO A;  4A3M G;  1E2Z A;  4KI0 A;  1D8L A;  1C7Y A;  5IGE A;  2EYL A;  2Y0S B;  3E6Z X;  3OW7 A;  1NE3 A;  1PFS A;  4KKU A;  3MXU A;  2R3Z A;  2VL6 A;  1DJR D;  3TRE A;  1HFN A;  3AB9 A;  5EKI A;  1LTI D;  4L5Q A;  1JMC A;  2Z6K A;  1PV4 A;  3V05 A;  5A35 A;  2GN5 A;  4RWS C;  4JI3 L;  2EE1 A;  3QB3 A;  1AN8 A;  1VQ4 A;  2N55 A;  1HNW Q;  2GVA A;  2QEJ C;  1JR0 D;  1K3B C;  1HRJ A;  3I2Z A;  3UDF A;  3CF5 A;  1TS5 A;  2BE5 D;  4BA2 I;  4K8J A;  2L4N A;  2QA4 A;  4G7Z C;  4Y7N B;  1B53 A;  3G6E A;  1ET6 A;  4BBS H;  4JI2 L;  3VDY A;  3RLF A;  3OWE B;  2DUD A;  3DEO A;  4JI4 Q;  4LUZ A;  1PMR A;  2CFM A;  4I7Z C;  2E5L Q;  1NBW A;  5M5W H;  3Q23 A;  5GAD C;  4YHH Q;  4JI1 Q;  2TMP A;  1SE2 A;  4ODG A;  1QVF A;  4B3R L;  3S17 H;  4P2C B;  2Z4H A;  5KNB A;  2EYJ A;  4Q5V A;  1Q82 C;  3I3C A;  3EBE A;  4HJ5 A;  2EVB A;  3FP9 A;  3T1H L;  3NPP A;  3CMA A;  1CTM A;  2F0W A;  1PVO A;  2NVQ B;  4GN4 B;  5GAG C;  2I5L X;  3VR5 A;  3K80 C;  1UE6 A;  1ZXT A;  1SNO A;  4TSS A;  4DNI A;  1PXU A;  1L2F A;  2F0F A;  4DUZ Q;  2EYM A;  1FNU A;  1PRT B;  1XNQ Q;  4IFD H;  4IUQ A;  4DK6 C;  3I55 A;  2N3S A;  4DUY L;  2AQ3 B;  1S5B D;  1SNM A;  1Q1E A;  1QG7 A;  3H0G H;  4KKT A;  2IHE A;  4C3H H;  5LL6 S;  4C2M B;  2E2H B;  4CDE C;  2AHO B;  1UEA B;  3D4D A;  1Z7T A;  4KN7 C;  5IGG A;  1GUT A;  1LT5 D;  3S16 B;  3NBH A;  2BDO A;  3HP3 A;  3K5L A;  2YTY A;  5JOB A;  1SDF A;  2HQE A;  4A3K H;  2ZTE A;  3I4M H;  2JEA I;  5KNC A;  4K5W A;  3QJY A;  1N33 Q;  3FHW A;  4R8N A;  4DV1 Q;  4EGV A;  4BBR G;  4AYB G;  5D65 A;  2R7F A;  2M00 A;  1DOK A;  5JAV A;  3J7A V;  1SSO A;  4NXN Q;  2VXW A;  3P1H A;  2NVT B;  3S1M B;  2BDN A;  1CSP A;  2SDF A;  2JA7 B;  3LNN A;  4OGQ C;  4DR5 L;  4DK3 C;  1ROD A;  2RHS B;  4UAI A;  1I4X A;  4QF4 A;  2PCF B;  2NB0 A;  3E5S A;  2B39 A;  4JVZ A;  1P16 A;  1ZYR C;  1BCP C;  3F1Z A;  4BY7 H;  1F9Q A;  1V1Q A;  5IGD A;  1YNJ D;  1YIJ A;  1ENC A;  5HGT A;  1BBW A;  4XT1 B;  1V43 A;  3V96 A;  3MFY A;  5AJ3 L;  1EIG A;  1X65 A;  4HSP A;  3JAM L;  1PTO B;  3K8A A;  4A3G B;  1FNW A;  3H0G G;  4NB3 A;  1CQV A;  2E8G A;  3CCJ A;  4F87 A;  3J81 L;  2A8V A;  2F1M A;  3HKZ G;  2NZ1 D;  2IJ0 A;  3HOY B;  3U4Z A;  5ELE A;  5D3D A;  1HH2 P;  1PH3 A;  1S5D D;  1DYQ A;  1D7Q A;  1E2V A;  1K73 C;  3JC6 6;  4A3K G;  3KLS A;  3W3A A;  1B7Y B;  4L8J A;  3J80 i;  4A3M B;  4K0K Q;  2DNC A;  3ZJY C;  3HOV H;  2XRQ D;  1CA5 A;  3GTK H;  1J8I A;  1K3R A;  1JQY D;  4X65 L;  4Q0F A;  3L7Z C;  4DXG A;  2WP8 J;  4A3I H;  4K6D A;  4B08 A;  4OWT B;  2ZM6 Q;  5J3B A;  4GZY C;  2L1B A;  1TWC H;  4DR2 Q;  1QZH A;  4LFB L;  3DM1 A;  4JV5 Q;  2RVL A;  3OIQ A;  4BY7 G;  4HMI A;  4QQB X;  1WCM H;  3D6C A;  4R4O A;  2EJG C;  2MJ8 A;  3O13 A;  5JPN C;  1LT4 D;  2F0N A;  2O5I C;  1C8C A;  3CXC A;  1QJO A;  3TQY A;  3SK6 A;  3JAM E;  1KLG D;  3VYR A;  1H9J A;  4I65 A;  4X3S A;  3TZU A;  2UU9 L;  1R9T B;  2CW0 D;  3UDI A;  2NN6 H;  1AEX A;  3CRL C;  1HUM A;  2JEB I;  4JI7 L;  5E3F A;  1TQO A;  3J81 E;  4GKJ Q;  4LFC L;  4LF6 L;  1KDB A;  3KBX A;  2KVM A;  1JB3 A;  3GDE A;  3AQQ A;  4FNF A;  3T53 B;  4LF4 Q;  1DOL A;  3ERQ A;  3S9W A;  1DD2 A;  1XMO L;  5CV4 A;  3PUW A;  1EOV A;  1XPU A;  3DXJ C;  1HTL D;  1GUS A;  5CV9 A;  1EUJ A;  2WAQ E;  3RZO H;  4N9P A;  3CCM A;  4C3I H;  4A3F H;  5EKL A;  4R4I A;  5FO7 B;  3HOV G;  1U4R A;  1DZ1 A;  1HQM C;  4DV5 L;  1PHJ A;  1ET9 A;  3RMH A;  3M7G A;  4A3I G;  5FOB B;  4KHP L;  1TR5 A;  4QIW B;  2CH4 A;  2B2U C;  4J15 A;  4DAY B;  4DV4 Q;  1K9M C;  4B3M L;  3MXG A;  1XNR Q;  1GVP A;  3MC0 B;  3OPO A;  3PUZ A;  1AZP A;  4CKB A;  5FLM H;  4ULL A;  3S1R H;  1WCM G;  3IFD A;  4NKL A;  4RHS A;  4X64 Q;  5ELO A;  2A19 A;  2Z1C A;  2F0M A;  2K75 A;  2FFK B;  2D0P A;  2M2L A;  1LTS D;  1HZB A;  3E0E A;  3MWY W;  3HRZ C;  4NPS A;  2HIX A;  1K8G A;  2Q2I A;  1S72 A;  1V8Q A;  1E2W A;  5A2Q L;  2NN6 G;  4QJF A;  1XMQ L;  5JJL A;  3OTO L;  1V9P A;  4L6T B;  3K7A H;  4FDB A;  1B44 D;  1K28 A;  2EDG A;  3Q22 A;  2F0E A;  4GNX C;  5FK9 C;  1G29 1;  2L0C A;  1IHZ A;  1RD9 D;  2F0S A;  5JEA J;  4R1J A;  2MFI A;  4UP9 A;  1S5E D;  4KD4 A;  1HHV A;  2A1A A; 
#chains in the Genus database with same CATH homology
 3U9O A;  1CQF A;  5M5W B;  4KJN A;  4BBR B;  4ZLT F;  4AYB B;  2F0V A;  1F9S A;  1KNE A;  2TSS A;  3S17 B;  1RF2 D;  1PYW D;  4FVM A;  5BN3 A;  5FO8 B;  2F3V A;  2F0I A;  3R2I A;  3GTG B;  3HZX A;  3W2D A;  1YNN D;  4IUT A;  2B2Y C;  3EQL C;  1PFN A;  5C5L A;  4WOR A;  3H0G B;  2A68 C;  3P20 A;  5ELC A;  4IQZ A;  5A2Q E;  4U68 A;  3K0Y A;  5CMD A;  4FP5 D;  3VR2 A;  3HKZ B;  1TS3 A;  4HCE A;  2PMZ B;  3MZ5 A;  1QB5 D;  4EQO A;  1ENA A;  1EY0 A;  3DHQ A;  4RGO S;  3D6W A;  1AZQ A;  4A3K B;  5E1F A;  5DAU A;  1ESR A;  1I4P A;  3A8J E;  1BQQ T;  3D3R A;  1EY7 A;  2WII B;  5I6W A;  3FPP A;  4C1N I;  4DXF A;  1EQV A;  1PZJ D;  4YIJ A;  5I9P A;  1OXU A;  4OIJ A;  4BY7 B;  1C4Q A;  1S5F D;  2QCP X;  1MBY A;  1HXY D;  3H6M A;  5KEE A;  1D5Z C;  1I4R A;  3DUZ A;  1BO0 A;  2GA4 B;  1O78 A;  1VMP A;  1GJX A;  1HCZ A;  1O7Z A;  4DK0 A;  2B2T A;  1GUO A;  5CBE E;  1W6J A;  1EY9 A;  4DAP A;  1PLF A;  2K7V A;  4HAE A;  4DAY A;  4CHT B;  2AWO A;  1F9R A;  1GUW A;  1C48 A;  2NBF A;  3D31 A;  1R4Q B;  2BA0 A;  1EOT A;  2L9H A;  3HOV B;  2D5D A;  3GTK B;  5G3L F;  1ILQ A;  4A3I B;  1GXD C;  4XYO A;  3T16 A;  1TWC B;  3DWA A;  3MEH A;  1WD0 A;  2QIL A;  2O5J C;  3H91 A;  1WCM B;  3VA7 A;  5EGT A;  1DON A;  3LX0 A;  1A2U A;  4CKE A;  1F9P A;  1HA6 A;  4RCN A;  4FXD A;  1SNP A;  5LL6 X;  1VCI A;  1TY2 A;  4C3J G;  2EY5 A;  2ZT9 C;  1SMY C;  3CHB D;  1MGS A;  4EVO A;  2A6H C;  2JP1 A;  2A5H A;  1EEI D;  1NSN S;  4PMB A;  4A3F B;  1KLU D;  4LJZ C;  4TKO B;  1SE3 A;  1CM9 A;  4IAL A;  1F2L A;  1U9R A;  4G7H C;  3C46 A;  1ZYR D;  1BCP D;  5T1I A;  1MD2 D;  3K58 A;  2LY7 A;  4ZKC B;  3FVQ A;  3HGB A;  1AFP A;  3NQI A;  1KAA A;  2XNA C;  3P7J A;  5DEH A;  2B2W A;  3NHH A;  3GQB A;  1T5E A;  3LWE A;  1K8M A;  1XYI A;  3PV0 A;  3BDO A;  3K59 A;  2SNS A;  1MSH A;  1UAP A;  4IUR A;  3PO3 B;  2PNR C;  4EQP A;  4FF2 A;  1KDC A;  4CGY B;  1Z47 A;  4XIG S;  3EJI A;  2NVY B;  2SOB A;  2X6L A;  4QUF A;  4NDX A;  5CV6 A;  3EFX D;  5CV7 A;  4A3D B;  3CQZ B;  4OO1 I;  5I9O A;  3X3M A;  1ENF A;  2WKC A;  4ZK9 B;  1Y8P B;  4KY7 A;  4A93 B;  3PIO 3;  2K03 A;  2NWG A;  4KY5 A;  2Z4I A;  3SK4 A;  2R92 B;  3TSS A;  2EY1 A;  2Q8I B;  4KHV A;  5CC4 A;  1OXS C;  5LHY 1;  1SFO B;  2I07 B;  4DN4 M;  2DN8 A;  1ML0 D;  4K5X A;  2ZXR A;  3NUC A;  1LTT D;  2K5W A;  1II3 A;  5BN4 A;  1LT6 D;  5M3F B;  1TY0 A;  3M4Y A;  3FEW X;  4QMG A;  2Q8R E;  3URY A;  4DGZ A;  1EYD A;  3D8G A;  4KK7 A;  1FD7 D;  1PRT C;  5K36 H;  4FO2 A;  1KNA A;  1O7L A;  4ZYS A;  2LKV A;  4CBV A;  1J9O A;  2B2V A;  4M1U B;  2K33 A;  1HFG A;  3Q24 A;  4N9T A;  3QO2 A;  1EU4 A;  1RHP A;  2X69 A;  4C3J B;  1IW7 C;  5KGU A;  2VB3 X;  3S14 B;  5I4D A;  2G9H D;  2K1B A;  4K6L A;  3OOC A;  2KHS A;  2PPB C;  1DXM A;  1U4P A;  5NUC A;  4FXG C;  1EQT A;  4A3J B;  1M8A A;  1H9S B;  3UI2 A;  3A8K E;  3K57 A;  3M7N A;  4XQJ A;  1HQR D;  5IT9 L;  1STY A;  1E0B A;  1L0Y B;  1EZ8 A;  2EXZ A;  4RHR A;  1AP0 A;  5C4X B;  1TWA B;  1KAB A;  1EYC A;  3GTO B;  1BOS A;  2A68 D;  3KBG A;  1H9R A;  1DOM A;  1D1K A;  2PQE A;  2SEB D;  4KTA A;  2WAQ B;  1SJH D;  5DM6 3;  4DAV A;  3G6J B;  5DM7 3;  4IFD G;  2JXM B;  2XN9 C;  4C3H G;  3U9S A;  3TP7 A;  1FNV A;  2J7Z A;  1O80 A;  2IL8 A;  1Z6H A;  5IT9 E;  4IUU A;  4M8A A;  1SYE A;  2F0G A;  2A74 C;  3GP7 A;  3MXN A;  1WTX A;  2K5Q A;  4DNR B;  5I2X A;  2F0D A;  4QCL A;  2PZT A;  2KJX A;  1ESF A;  3A7A B;  4KMU C;  3KK7 A;  1EWC A;  4RGM A;  1EY5 A;  1QNK A;  5JEA H;  4IUV A;  1BCP B;  4RKL A;  1SND A;  1SYC A;  4F88 A;  1QWY A;  3T4A C;  3E0J A;  3D4R A;  4MN3 A;  2J0T D;  4WFN 3;  2B2T C;  4HSV A;  4X3U A;  3BVZ A;  1QNU A;  4NW2 A;  1B9M A;  3ND8 A;  4BA1 I;  5HUR A;  1GUN A;  3R93 A;  3J7Y W;  3QIA A;  1QOH A;  3H09 A;  1I6V C;  2LMC B;  2KEC A;  2HCC A;  3V2T A;  1TWH B;  5ELD A;  2EPB A;  2FJ2 A;  4BWG B;  1G2T A;  2EYF A;  2FHT A;  1BBX C;  5JEA G;  5KRU A;  1WTR A;  1AW7 A;  1H9S A;  5C4Z A;  1SMY D;  2A6H D;  2A69 C;  2JYO A;  1JWS D;  2DNE A;  2AQ1 B;  2AUJ D;  2L12 A;  4PMW A;  2VNU D;  3T51 B;  3OMG A;  4RFB A;  1IL8 A;  2G9D A;  3J80 L;  4BBS B;  3CRK C;  5AFW A;  5CYU A;  1EL0 A;  3HEJ A;  4LAA A;  2B8G A;  1LAC A;  4KHZ A;  2OXP A;  4FF1 A;  2YU9 B;  1RKN A;  1JWU D;  4C3I G;  5T1G A;  1X32 A;  1I4Q A;  2KOL A;  3ONA B;  1Y8N B;  3MTS A;  4HR7 B;  2K28 A;  2WV6 D;  3VA5 A;  4K2K A;  1JOK A;  3FRP B;  2R93 B;  1A6X A;  1A3V A;  4NMZ A;  2XRS D;  1X3Q A;  4C3H B;  2PW5 A;  2YYZ A;  2B2W C;  1SEB D;  3BZD B;  5CR3 A;  3PUV A;  3J80 E;  2AWN A;  1HUN A;  3S2D B;  1SBB B;  3KF8 A;  3I4M B;  1Q12 A;  5C0X H;  1X3P A;  4KJO A;  3ITP A;  3I4L A;  4KKS A;  3QOL A;  4OIK A;  1STB A;  1ICW A;  4H7B A;  3SK5 A;  2WKD A;  1OXX K;  3WDN A;  3GTQ B;  1GOZ A;  2KCN A;  2MHV A;  2O4X A;  2XWJ B;  1LTR D;  2ENB A;  2IX3 A;  1OO9 B;  3TZD A;  4HED A;  1HPC A;  3DWP A;  1D6E C;  2BCO A;  2QF7 A;  4ABN A;  2Q8T A;  2RA4 A;  5C4H A;  1I4G A;  1F2Y A;  1I6H B;  1PRT D;  3GTL B;  2F0H A;  1U4L A;  5C0X G;  2NN6 I;  1F2M A;  1JWM D;  3TME A;  1PFB A;  1BNZ A;  1GHK A;  1BDO A;  2A6E C;  2O2L D;  2RKS A;  3PIP 3;  1ZEQ X;  2MGS A;  5EPK A;  3A54 A;  1IW7 D;  4L63 B;  1G91 A;  2M9V A;  1IYV A;  2K04 A;  3X3N A;  2B2V C;  5C3X A;  4XT3 B;  3KLR A;  2ID0 A;  3QWN A;  2RDH A;  4V19 0;  4FYD A;  3SEB A;  3NBI A;  1KTK A;  3VYS A;  3HS0 C;  2Z8L A;  4HTH A;  3J7A F;  1QE6 A;  1BCP F;  2NUC A;  4TQU S;  2E74 C;  1SYG A;  3RZO B;  1NCV A;  3M3Y B;  3S2H B;  4C3I B;  1F77 A;  1STN A;  2KED A;  3IAY A;  1ILP A;  1LO5 D;  3WOF A;  1TU2 B;  5CV5 A;  1TWG B;  1B4O A;  1EYA A;  1O7Y A;  4PNY A;  1SNC A;  4PV1 C;  3S1R B;  1OXV A;  2NYZ D;  3NXW A;  3L3O C;  1TVX A;  2WB1 B;  5F2D A;  3T56 B;  5COR A;  5EPJ A;  3VYU A;  4RAU C;  4WRD A;  1JIC A;  3RD4 A;  3SHL A;  3K7A B;  5ELF A;  2ICI A;  4XXE A;  4FF3 A;  2D9U A;  1PFM A;  2OF1 A;  1A3U A;  4CJ1 B;  1TKW B;  2RSN A;  4G57 A;  2CVR A;  3WOE A;  4O42 A;  1VF5 C;  5KND A;  5EPL A;  2C9O A;  2JA5 B;  2KEE A;  1G2S A;  2HDL A;  4H0L C;  1QCB D;  1SYB A;  1SXT A;  3F2U A;  2E2J B;  4B9X A;  3HOX B;  2K32 A;  3NK9 A;  2EY2 A;  3R8B A;  2F0O A;  1WTP A;  4JBW A;  1JOQ A;  4RKB A;  4DF7 A;  2L5T A;  2FMC A;  4BS9 A;  1SE4 A;  3TP5 A;  1NR4 A;  3GTM B;  4RCO A;  3SXH A;  3N6R A;  3OIP A;  5DNF A;  1M4V A;  1DCZ A;  2IPK D;  1STA A;  1LLR D;  1LT3 D;  1BR9 A;  4RA8 A;  2IWH A;  4KY6 A;  4DNT B;  1JCK B;  1XX8 A;  2F0J A;  4ZUJ A;  1LTG D;  1H9M A;  3CU7 A;  1BUV T;  5KIX A;  1EY4 A;  1R4P B;  5C5M A;  1TWF B;  2IW3 A;  4QB4 A;  3QOJ A;  2A69 D;  5C3W A;  5IGC A;  3C3L A;  3K5N A;  3H94 A;  4K2L A;  4G7O C;  4HN7 A;  3NWT A;  4OL7 A;  3R2T A;  2N88 A;  1S5C D;  1VDZ A;  4K5V A;  5FKA C;  5M5X B;  4XDX A;  2RQX A;  1Y1V B;  1NAP A;  1A2T A;  1K8O A;  1CI3 M;  3BDC A;  1ONL A;  2PYK A;  2EY6 A;  4MHE A;  3HG9 A;  2PZU A;  5D3I B;  2VUM B;  5CGK A;  1Q8I A;  3PO2 B;  3HOZ B;  3KUP A;  4V0B A;  1SAP A;  4ZRZ A;  4Z9C B;  4C1N K;  2EYO A;  3TP8 A;  2FIN B;  3A7L A;  2F03 A;  1GUG A;  5K36 G;  4A3B B;  5IGB A;  1CT1 D;  1SYF A;  2IX1 A;  1PTO C;  3L9A X;  4IN3 A;  5EQ0 A;  4XTC S;  1JOR A;  2CHB D;  5TSS A;  1FYC A;  4IZ8 A;  3MFG A;  4KN4 C;  2X6G A;  1PZI D;  2E76 C;  3BG3 A;  2E75 C;  1SJE D;  1LAB A;  3MXP A;  3NSW A;  3AU7 A;  3I70 A;  4S3S A;  1A3T A;  2F0L A;  4BY1 B;  1WTV A;  5E4X A;  3K5M A;  1G6Z A;  1EWH A;  1ZKO A;  1B9N A;  3ND9 A;  3HOU B;  2H1E A;  2PW7 A;  1FGB D;  4K14 A;  2BA1 A;  2EOT A;  1IYU A;  3MAQ A;  4CKC A;  3BVM A;  3BVG A;  3BYT B;  2RDF A;  5FLX L;  3C1E A;  1Q3L A;  3Q0A A;  2K05 A;  4RGN A;  2E2I B;  5IOD A;  3FPU B;  1A15 A;  3P75 A;  3M85 A;  2K6A A;  4FF4 A;  4KD3 A;  1XXG A;  1JOO A;  2DY7 A;  1B1Z A;  2AUK A;  3FKI B;  1B2T A;  3RZD B;  2KA7 A;  3DMU A;  4UDU C;  1WVL A;  2F4I A;  3IL8 A;  3NTK A;  1RTO A;  1T5X D;  3C1F A;  2NTS A;  4TRD A;  1D5M C;  4IFD J;  2A6E D;  4K8I A;  1RCV D;  4PQX A;  1EU3 A;  3A8I E;  1Q90 A;  2HUG A;  4XQQ A;  2QDB A;  3S1N B;  2F0K A;  2D62 A;  1GHJ A;  4ZQ3 A;  1I4H A;  4DA2 A;  3SK8 A;  5FLX E;  4DK1 A;  1EY8 A;  4LK1 C;  2BOS A;  3AMU A;  3GO5 A;  1BF4 A;  5K5P A;  5COY A;  1I3Q B;  3S1Q B;  1B50 A;  5EBC A;  1JE4 A;  2L55 A;  1CZG A;  2K01 A;  5EKK A;  3PUY A;  2MP1 A;  3DWQ A;  1UNS A;  3ZYY X;  5EBD A;  2OEO A;  4O1N A;  3I91 A;  5JJZ A;  5C4J B;  1CA6 A;  1KDA A;  4HCS A;  4RGT A;  2R61 A;  4LMQ D;  1STG A;  2BE5 C;  3I72 A;  4QUC A;  2JA6 B;  1V1O A;  1QIL A;  2HCI A;  3S15 B;  1S4Z A;  1VF7 A;  3SDZ A;  1H9K A;  2OT2 A;  1I50 B;  5J22 A;  4F7X A;  3DEP A;  4IFD I;  5D14 A;  5FO9 B;  3MA2 B;  4WJW A;  3Q6S A;  5CBA E;  3T13 A;  3N52 A;  4X3K A;  4KV6 A;  4H44 C;  3VYT A;  3QG1 A;  2WIN B;  3I8Z A;  3GTP B;  5KYL A;  2KCC A;  1TS2 A;  3EA6 A;  4H13 C;  3OWF A;  4NP5 A;  2EYH A;  3SR1 A;  1B3A A;  2V4D A;  2QKI C;  1EIH A;  1D2B A;  3TN2 A;  3SE0 A;  2CQA A;  1EFI D;  1IKM A;  3K5O A;  2F0U A;  2IX0 A;  3LWU A;  2KQ3 A;  3HOW B;  3TDQ A;  1XWE A;  4CJ0 B;  3MHB A;  1EZ6 A;  1K83 B;  4ID6 A;  2IT1 A;  1PZK D;  1CFM A;  3GTJ B;  1SNQ A;  3GV6 A;  1LTB D;  1WD1 A;  1JC7 A;  2DY8 A;  2PO4 A;  1UUP A;  4FXK C;  1G8Z D;  1V1P B;  5M3M B;  5IOC A;  4J8Q A;  1FR3 A;  2C5C A;  5E4W C;  5J1Z A;  2K5D A;  1TII D;  4R9W A;  1BXT A;  2F0Q A;  1CHP D;  2RBM A;  3VR4 A;  4ZUI A;  1YNJ C;  3VR6 A;  3SVM A;  2JA8 B;  1PRT F;  2XSC A;  3R3O A;  3TP6 A;  1MI2 A;  2MPM A;  1Y1W B;  2MUY A;  1VMC A;  3CKI B;  1RJT A;  2WAC A;  1CHQ D;  2L11 A;  4F8M A;  2J4X A;  5C6A A;  2EJM A;  4OO1 H;  5J39 A;  3K6O A;  1MSG A;  3FMC A;  3OMC A;  2R6G A;  2RDG A;  2NVX B;  2LS0 1;  1Y8O B;  2LFN A;  1XTC D;  1D1I A;  1F2Z A;  1EEF D;  3OSO A;  1D5X C;  3NTH A;  2F0T A;  2XVS A;  4DFA A;  1LV9 A;  1WTQ A;  4EQN A;  4J1M A;  3IFT A;  1LTA D;  1PTO F;  1CZW A;  4J6H A;  3NQT A;  4A3E B;  5CV8 A;  3D4W A;  2FMM A;  4CJ2 C;  3NTI A;  2E2D C;  3GV3 A;  4OO1 G;  3OHX C;  2CW0 C;  5EJW A;  3TBI B;  5BN5 A;  2B2U A;  4RH6 A;  4DU9 A;  2JSO A;  3A56 A;  4XYQ A;  2VB2 X;  3A55 A;  2I46 A;  1W6K A;  2F3W A;  3G7L A;  1Y69 U;  4G4K A;  1SYD A;  5G3L D;  4ZKB B;  1HTP A;  3NP8 A;  4E6I A;  1PTO D;  5C0X J;  4IUP A;  5M9O A;  3IKJ A;  5JVH 3;  1WTO A;  2H4O A;  5IIF A;  4JK1 C;  3I4N B;  2ZXP A;  3GD7 A;  1NR2 A;  4C56 C;  1IKL A;  2F0P A;  5IGF A;  1EY6 A;  1U4M A;  3C2P A;  3H3V C;  3I90 A;  1PTO H;  1Q1B A;  3NE5 B;  4IUN A;  3KLS X;  2HDM A;  5M5Y B;  2KUM A;  4R8I A;  1V1P A;  4X3T A;  5C44 B;  3ERO A;  4XQN A;  3M4O B;  1HA5 A;  3FDT A;  3RUZ A;  2A73 B;  1CK1 A;  2B63 B;  4ILW A;  2B2Y A;  2B8F A;  2AQ2 B;  4B9W A;  4PMC A;  2SNM A;  2XWB B;  3NWS A;  3VR3 A;  2R7Z B;  2JE6 I;  2D2C C;  5JPM C;  3BS1 A;  3I73 A;  3PUX A;  3MVV A;  1STH A;  2ICE C;  5C0X I;  5I2Y A;  2PZW A;  1RDP D;  1PDQ A;  1YNN C;  4ME5 A;  3BYY B;  5ELB A;  4OHJ A;  2EJF C;  5JVG 3;  4ZAI A;  5ISR A;  1DM0 B;  4HMJ A;  1OXT A;  1TT2 A;  2RSO A;  2XIW A;  4MIU A;  3EVQ A;  1STE A;  2EZV A;  1RTN A;  2EYP A;  5C3E B;  1WTW A;  5I6Y A;  3PMF A;  5KYI A;  4U67 3;  1L0X B;  1NUC A;  3BDL A;  1TS4 A;  2NTT A;  2ZXO A;  1E2Z A;  4KI0 A;  5IGE A;  2EYL A;  2Y0S B;  3E6Z X;  3OW7 A;  4KKU A;  3MXU A;  2R3Z A;  1DJR D;  1HFN A;  3AB9 A;  5EKI A;  1LTI D;  3V05 A;  5A35 A;  4RWS C;  2EE1 A;  3QB3 A;  1AN8 A;  2N55 A;  2QEJ C;  1JR0 D;  1HRJ A;  1TS5 A;  2BE5 D;  4BA2 I;  4K8J A;  2L4N A;  4G7Z C;  4Y7N B;  1B53 A;  1ET6 A;  3RLF A;  3OWE B;  3DEO A;  1PMR A;  4I7Z C;  3Q23 A;  2TMP A;  1SE2 A;  4ODG A;  4P2C B;  2Z4H A;  5KNB A;  2EYJ A;  4Q5V A;  3I3C A;  2EVB A;  3NPP A;  1CTM A;  2F0W A;  2NVQ B;  3VR5 A;  1ZXT A;  1SNO A;  4TSS A;  1PXU A;  2F0F A;  2EYM A;  1FNU A;  1PRT B;  4IFD H;  4IUQ A;  2AQ3 B;  1S5B D;  1SNM A;  1Q1E A;  1QG7 A;  4KKT A;  5LL6 S;  4C2M B;  2E2H B;  1UEA B;  3D4D A;  1Z7T A;  4KN7 C;  5IGG A;  1GUT A;  1LT5 D;  3S16 B;  3NBH A;  2BDO A;  3HP3 A;  3K5L A;  5JOB A;  1SDF A;  2HQE A;  2JEA I;  5KNC A;  4K5W A;  3QJY A;  4R8N A;  4EGV A;  5D65 A;  5JAV A;  2M00 A;  1DOK A;  3J7A V;  1SSO A;  2VXW A;  3P1H A;  2NVT B;  3S1M B;  2BDN A;  2SDF A;  2JA7 B;  3LNN A;  4OGQ C;  1ROD A;  4UAI A;  1I4X A;  4QF4 A;  2PCF B;  2NB0 A;  3E5S A;  2B39 A;  1ZYR C;  1BCP C;  1F9Q A;  5IGD A;  1YNJ D;  1ENC A;  5HGT A;  4XT1 B;  1V43 A;  3V96 A;  3MFY A;  1EIG A;  4HSP A;  3JAM L;  1PTO B;  4A3G B;  1FNW A;  1CQV A;  4F87 A;  3J81 L;  2F1M A;  2NZ1 D;  2IJ0 A;  3HOY B;  5ELE A;  5D3D A;  1S5D D;  1DYQ A;  1E2V A;  3KLS A;  3W3A A;  4L8J A;  4A3M B;  2DNC A;  1J8I A;  2XRQ D;  1CA5 A;  1JQY D;  4Q0F A;  3L7Z C;  4DXG A;  2WP8 J;  4K6D A;  4B08 A;  4GZY C;  2L1B A;  3DM1 A;  2RVL A;  3OIQ A;  4HMI A;  3D6C A;  2EJG C;  2MJ8 A;  3O13 A;  5JPN C;  1LT4 D;  2F0N A;  2O5I C;  1C8C A;  1QJO A;  3SK6 A;  3JAM E;  1KLG D;  3VYR A;  1H9J A;  4I65 A;  4X3S A;  3TZU A;  1R9T B;  2CW0 D;  2NN6 H;  1AEX A;  3CRL C;  1HUM A;  2JEB I;  5E3F A;  1TQO A;  3J81 E;  1KDB A;  3KBX A;  2KVM A;  1JB3 A;  4FNF A;  3T53 B;  1DOL A;  3ERQ A;  3S9W A;  1DD2 A;  5CV4 A;  3PUW A;  3DXJ C;  1HTL D;  1GUS A;  5CV9 A;  4N9P A;  5EKL A;  5FO7 B;  1U4R A;  1DZ1 A;  1HQM C;  1ET9 A;  3RMH A;  3M7G A;  5FOB B;  1TR5 A;  4QIW B;  2B2U C;  3MXG A;  3MC0 B;  3OPO A;  3PUZ A;  1AZP A;  4CKB A;  4ULL A;  3IFD A;  4NKL A;  4RHS A;  2Z1C A;  2F0M A;  2FFK B;  2M2L A;  1LTS D;  3MWY W;  3HRZ C;  1V8Q A;  1E2W A;  5A2Q L;  2NN6 G;  4L6T B;  1B44 D;  2EDG A;  3Q22 A;  2F0E A;  5FK9 C;  1G29 1;  2L0C A;  1IHZ A;  1RD9 D;  2F0S A;  5JEA J;  1S5E D;  4KD4 A;  1HHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...