1SNMA

Active site mutant glu-43 (right arrow) asp in staphylococcal nuclease displays nonlocal structural changes
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPDTKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (phosphoric diester)
molecule keywords THERMONUCLEASE PRECURSOR
publication title Active site mutant Glu-43 --> Asp in staphylococcal nuclease displays nonlocal structural changes.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1990-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1snmA00
1ENAA 1AEXA 4DFAA 5IIFA 5CV8A 2F0SA 2NUCA 4E6IA 4F8MA 3QOJA 1F2YA 1TR5A 5E3FA 4K8IA 4QF4A 2PQEA 5E1FA 5K5PA 5J39A 1SYGA 1STNA 4EVOA 1RKNA 5IGDA 3NQTA 2F0NA 2F0KA 2F0TA 4K5WA 1NSNS 1SNOA 4OL7A 4LAAA 3SK8A 3T16A 3TP6A 5KEEA 3S9WA 1SNQA 3OSOA 3HEJA 1F2ZA 4EQNA 5HURA 4ID6A 5CV5A 4WRDA 1EY7A 4K5XA 2LKVA 3QOLA 4KJOA 5C5MA 2OF1A 1A2UA 2EYLA 5C5LA 4EQPA 4KTAA 3TP8A 3OMCA 4RKBA 2PYKA 1EY6A 4HMIA 3MVVA 4QB4A 1STYA 3C1EA 5C3WA 3RUZA 1EY5A 1EY8A 4HMJA 5CV7A 5DAUA 5IODA 1EZ6A 3U9OA 3MXPA 4NMZA 5IGFA 1NUCA 4N9PA 3D6CA 3TP7A 3OWFA 1KDCA 2EY5A 1II3A 3BDLA 4K6DA 2F0OA 3OMGA 3MEHA 3SK5A 2EY1A 3P1HA 3SHLA 4MIUA 2EYOA 4G57A 5HGTA 1KDAA 1A3UA 2EYHA 2M00A 2PW7A 2WACA 3DMUA 3R3OA 4KJNA 4IZ8A 5CV6A 5EGTA 5JAVA 3SR1A 4ZUIA 3D4DA 4B9XA 4F7XA 5CGKA 2PW5A 3D4WA 3P75A 2RDFA 4S3SA 3V2TA 5KIXA 3NXWA 5EKLA 5KYLA 1SYEA 4HTHA 2F0PA 2HQEA 1EYDA 2F0MA 5IGBA 5J22A 3D8GA 3EVQA 3NP8A 4KY6A 3EROA 3NUCA 4PMBA 2EYJA 2EY2A 1EY9A 5JOBA 1TT2A 4KD3A 2SOBA 5IGEA 5IOCA 1JORA 4K14A 1KAAA 5EKKA 3EJIA 3ITPA 1SYCA 3QB3A 2PZTA 5CV4A 3ERQA 4N9TA 5KRUA 5ISRA 4KV6A 1EY0A 3BDCA 2EXZA 2EYMA 1SYFA 1JOKA 2F3VA 2F0GA 2PZWA 4NKLA 4NP5A 4H7BA 4WORA 2OEOA 4PMCA 5CC4A 5KGUA 2KHSA 3MHBA 1ENCA 2SNSA 4NDXA 2F0HA 1KDBA 4J1MA 2F0QA 2RBMA 1SNCA 2EYFA 3C1FA 4KD4A 4KY7A 3VA5A 2F0FA 2ENBA 2PZUA 1JOOA 2QDBA 3E5SA 3HZXA 1SNPA 3LX0A 4ZUJA 5J1ZA 5C4HA 1JOQA 1TQOA 4IUNA 2RKSA 2F0EA 3H6MA 3TP5A 4RKLA 5CV9A 5I6YA 5IGCA 5M9OA 4K5VA 1EY4A 1A2TA 4ME5A 2OXPA 4TRDA 3SXHA 1SNMA 5IGGA 1SYBA 2O4XA 3NHHA 4K8JA 4ODGA 5I9PA 4J6HA 2SNMA 4ZQ3A 1EYCA 2EY6A 4KHVA 4DU9A 3SK4A 4EQOA 5C3XA 2F0VA 4K2LA 5I6WA 1A3TA 2EYPA 3DHQA 4I65A 1STGA 1U9RA 1F2MA 5CR3A 1EQVA 4DF7A 3SK6A 4QMGA 4B9WA 1STHA 4PNYA 2F0LA 2F0UA 2F0WA 4K2KA 2F0DA 3NK9A 2F3WA 4R8NA 5NUCA 4YIJA 1SNDA 5KYIA 1A3VA 4KY5A 1SYDA 5DEHA 1STAA 3TMEA 5C4ZA 1EYAA 5I9OA 1KABA 2F0JA 4IALA 1EZ8A 3PMFA 5F2DA 5C6AA 3MZ5A 1IHZA 2F0IA 4DGZA 3T13A 1STBA 2KQ3A
chains in the Genus database with same CATH superfamily
1ENAA 1AEXA 3L0OA 3HOYG 1N9WA 4C56C 1VQIA 4X3UA 4CJ1B 1YNNC 4NPSA 4FNFA 4GLAC 4A76A 1Z47A 2D0PA 4IFDI 2J0TD 3QG1A 1V9PA 1VQ4A 4FO2A 4B3TL 3H3VH 2OTLA 5EPLA 1S4ZA 3TSSA 1EIHA 5C0XH 4DA2A 3S14B 2BE5C 3S24A 2EDGA 2R93H 1QNUA 4BWGB 4X64L 4EGVA 4DAMA 3IFDA 4O2DA 4QQBX 1ML0D 1QB5D 4FXGC 4LWCA 1WTPA 3NBHA 3PQIA 4UY8C 5JAVA 3GO5A 3OTOQ 2YTXA 3GTLH 1M90C 4ZYSA 1D1IA 2ZTDA 3GV6A 2UXCL 4BY7B 4DK1A 1BDOA 2NVXB 1LTID 1J5EQ 2YV5A 3CCQA 2XN9C 2VS1A 2KUMA 2K4KA 1IBKQ 1IKMA 4N8X1 4A3EG 4LF5L 5EPKA 4LFAL 2OEOA 3KLRA 2SNSA 3URYA 1AE2A 4OO1G 4BXXH 4B3SQ 3VA5A 2B8GA 1JOOA 2KBNA 3K57A 1JJ2A 2LSSA 1LTLA 3ZYYX 1EY4A 1TWAB 4TRDA 2VUMG 1QG7A 3Q24A 4K8JA 2WB1B 1K28A 1HR0Q 3CCMA 1BCPD 1FNUA 1CA6A 2EYPA 2L11A 1LTGD 1U4RA 3PIOA 2M2LA 4LW1A 2UUAL 4P71A 3DWPA 3RZOH 1PDQA 1JICA 4DR4L 3GV3A 3MXGA 2F0WA 1LYLA 3BVZA 4BY1G 4R8NA 4IPCA 4MNOA 2XIWA 3CMEA 3PF5A 4XIGS 1LV9A 1AZQA 5L37A 1D5MC 2C35B 2IHEA 4YY3L 4DGZA 2QW7A 3D3RA 3N6RA 3OW7A 2NUCA 1BUVT 3TEHB 2DNCA 1HR0W 1HFNA 2UUBL 4MHEA 1VMCA 3PUVA 3JAML 3NQTA 4A93B 1WFQA 2K05A 3S15B 4RHRA 1JWUD 2JA9A 3NTIA 2Y0SB 4WRDA 1CKMA 1EY7A 2F4VL 4K5XA 2LKVA 4EQPA 2N8NA 3RR5A 5BR8L 2UXBQ 4BBRG 3TDQA 1O80A 2XGTA 5D3DA 4XQJA 3K80C 1VQLA 2B2VA 3HOUG 2ATWA 1WTVA 3H94A 1TWHB 2EY5A 3H15A 3MFGA 2IW3A 1D5ZC 2E2JB 4FYDA 4JI7Q 4DNIA 3P1HA 4JI8Q 4G57A 1KDAA 2EYHA 3AMUA 5GAHC 4YWLA 3CMAA 2K6AA 2NVQH 3D4WA 2FMMA 4CKBA 3G71A 2PNHA 5I2XA 1PYSB 1WOCA 1FJGQ 1BXTA 5LMUQ 5D3IB 1IBML 2B63B 4CDCC 3CC2A 4Y7NB 3DM3A 1HZ9A 1VQPA 1XXGA 4R4CA 4WORA 2ALYB 3D31A 1HUMA 2D2CC 3E0JA 3OWEB 4IPHA 1QCBD 4NDXA 2ES2A 1SE3A 1PFNA 1B3AA 3J81L 4JG2A 1LLRD 3PGZA 4H44C 3S17B 2RKSA 4DV2Q 3U9SA 1YI2A 1E0BA 2EJMA 3FPPA 3S16B 3I4MB 4C3IG 2SNMA 4ZQ3A 2RHSB 2JA6B 3A8JE 2VQFL 3GTMB 4A3IH 4DF7A 4QMGA 1E7ZA 5JVG3 3BJUA 5GROA 2YU9H 4X6AH 1IW7D 1CFMA 3J81i 1B44D 2DJGC 3TMEA 1UAPA 3HOYB 4QY7A 1KABA 1NR2A 1EZ8A 2AKWB 4OELB 2A6HC 1QZHA 1CT1D 4BBSH 4K8IA 4R9WA 1H9MA 1GHKA 3EIVA 3RLFA 3T16A 4K5WA 3NENA 1J8IA 4XXEA 1FL0A 1SNQA 3OSOA 5ELDA 3ULLA 1UE1A 4CHTB 4JBJA 2UU9L 2A8VA 3GTGB 3OTOL 3W2DA 4LUZA 3HOZB 2EOTA 4DUZQ 3Q6SA 1CHQD 3QIAA 5IODA 4GOPA 4FF3A 3U9OA 5LL6X 4NMZA 3FKIH 4DKAC 1WJJA 5C4XH 4FXKC 1OXXK 1WD0A 5IYCG 4NXNQ 4TKOB 1J5EL 4A3KH 1VQ8A 4PZ8A 3QO2A 1A3UA 1I4RA 1CHPD 4JOIA 2WP8J 5JJIA 1KNEA 4LJZC 1I94Q 1D8LA 5EAYA 4B3SL 3WOFA 1YIJA 3S2HB 3BU2A 4DNRB 1ASYA 4WJ3M 1FD7D 4Y52H 1UEBA 4OIKA 2IPKD 4PMBA 4Z9CB 1JB3A 1G8ZD 5FJ8H 4A3GH 5EKKA 4ZLTF 3T51B 4DR3Q 4HIDA 5KGUA 2UUCQ 2NN6H 3TQYA 4UP8A 5LMNW 3C1FA 2VUMB 3KDFA 1K0SA 3KLSX 1O7LA 1X3FA 5J1ZA 2CVRA 2RF4A 3DWQA 4KN7C 5C4JH 1G6ZA 2KA7A 5IGCA 4A3BG 1QUQA 1DONA 1PTOC 5M5XB 5IWAL 5C3XA 4XQNA 3GP7A 4YWKA 1PV4A 2RCNA 4BY1B 3R93A 3S1QH 3UDIA 2JA8H 4B9WA 1LT6D 1VMPA 4FP5D 3RMHA 1Q1BA 2CH4A 2Q2HA 1W2BA 1U4LA 2UXBL 1DXMA 4BA1I 2NTTA 1M8AA 3AQQA 4X3TA 3TZUA 5I4DA 3G6EA 1V1PA 2HCCA 2KVMA 1B2TA 2Z6KA 5FKAC 5IIFA 3U58A 3HKSA 1Q3LA 4FVMA 1Z7TA 4AH6A 4POGA 1X6OA 3K5OA 4OL7A 2PMZE 3AEVA 4BBRB 4JI7L 4WFN3 5C0XG 1X3QA 5C3EH 2JXMB 2AUKA 1F9QA 5C5MA 1U0LA 4HSVA 3HOUB 2R93G 4G7ZC 1I3QB 4M8AA 3VDYA 4QB4A 1ZXTA 5DAUA 5CV7A 4LFBQ 1Q7YC 5CORA 4GNXC 1JB7A 1Q81C 4GLVB 1FJGL 2B2VC 1LTAD 1SJED 2VY3A 1BBUA 5BN3A 2R6GA 1K9MC 4IURA 4JCVE 1VQNA 2PW7A 5IT9L 1SBBB 4LF4Q 4C3JB 1A62A 1MI2A 3KF8B 4A4IA 1N34Q 2K33A 2HQEA 1RTNA 3K5MA 3ER0A 3W5OA 4A3JB 1JORA 1X3EA 4K14A 3H0GH 1B70B 2L4NA 4KV6A 2EXZA 3SE0A 3G4SA 3EFXD 2KHIA 4B3TQ 1HFGA 3IKJA 4OWXB 2F0QA 2QILA 1LO5D 3E5SA 3HZXA 3IAYA 4IQZA 4C3IB 1DZ1A 1B7YB 1KC8C 3FRPB 4K5VA 2B2UA 2OTJA 3PUYA 1MD2D 1NR4A 3IRBA 1H9JA 1WTHA 3KYHC 5DM63 5IYBH 1WTRA 1N36Q 4O1NA 2QKIC 5EPJA 3F2CA 4BY7G 1GM5A 1STGA 1U9RA 4QGUA 4DUYQ 4RGOS 2B2YA 2EXDA 3I3CA 4PNYA 1SEBD 5ELFA 3F2BA 2A69C 3BS1A 1GUSA 3Q22A 1SNDA 1TY2A 1LTTD 4BS9A 3E9HA 2UXCQ 1AZPA 2L5TA 4A3MG 2WKCA 1HXYD 2PQAA 2E2DC 4UDUC 2K1BA 4DUZL 2B39A 4RAUC 3CC7A 2DGYA 1SMYC 1XMQQ 1F9PA 1VQEA 2A68D 4HJ8A 4E6IA 2C9OA 1JT8A 4CBVA 1SYGA 4OXPA 4ZAIA 4NXNL 4LF5Q 5KEEA 1Y8PB 1H9RA 4CGYB 2E2HH 2XRQD 2QEJC 4FDBA 1I5FA 5JEAH 3M3YH 5C5LA 3U4ZA 3ONAB 1WTOA 4IOCA 2JQOA 3TP8A 2FJ2A 2J4XA 4U68A 1QJOA 1UE6A 3J80E 3CRLC 4HMJA 5FLMH 3UDFA 4TQUS 3BVGA 3I90A 1ENFA 4HCSA 1K83H 1TIID 4L5QA 4GOPC 2JJQA 1GUWA 2UUAQ 2LXKA 2F0OA 3U4VA 3QR8A 2FFKB 2GVBA 3SK5A 3C3LA 1ESRA 4KHPL 1K8OA 4DR4Q 2N3SA 1PH4A 3SHLA 4A3LH 2EYOA 3KDFB 2WFWA 5HGTA 4X65Q 3R3OA 2HT1A 1PZID 4JBKA 3PV0A 5M5YB 2HD3A 1B50A 1HRJA 1QUQB 3V2TA 1I4HA 2RDFA 4S3SA 4KI0A 2H5XA 4YY3Q 1Q82C 4JOIC 4RWSC 3M4YA 1OXTA 4KD3A 1TU2B 1WYDA 1I4GA 5JJLA 2GVAA 3QB3A 2PI2A 4HR7B 3GTPB 4O42A 1KNAA 1ZKOA 2OWOA 3HKZE 5KNBA 2Q2TA 1SYFA 3G7LA 4NP5A 4H7BA 4QCLA 1WD1A 2F4VQ 2HHHL 3VR2A 5BR8Q 1BNZA 4KLKA 3MAQA 1XNQQ 4A3BB 2X6GA 3AFQA 3Q0AA 1LTRD 2QA4A 3IFTA 5M9OA 1NAPA 1NBWA 2R7ZH 1PRTC 3UE0A 1GJXA 4A3IG 3GTJH 1FGBD 1O7YA 3CD6A 3K7AB 3UDGA 4B3MQ 3DM1A 1BCPC 4JC0A 4QIWE 5CBAE 2F0UA 4BA2I 2F0DA 2F3WA 3M85A 4ZK9B 3OHXC 4OWTB 3HGBA 5IE8A 1E24A 1YNJD 3JAME 3KLWA 3STBD 1GO3E 1LT4D 2PMZB 1NMGA 2N55A 1STAA 4OONA 3RLNA 3VYTA 4DV1Q 1EFWA 4J15A 1IL2A 4BBSG 4GZYC 4LFBL 1LT3D 3S1NH 3J7AF 3L3OC 4DFAA 4X3KA 3D4RA 4QF4A 5K5PA 1STNA 2EIFA 2IJ0A 2F0TA 2AQ3B 2R93B 4IJLA 2H1EA 4UPAA 1BF4A 3PO2H 1A0IA 2QCPX 1E1TA 2UXDQ 4KTAA 4LF4L 4RCOA 4P2CB 1N34L 3K7UC 2ZTCA 1HA5A 1BO0A 1STYA 2YTYA 3P7JA 4Q0FA 5C4XG 4JBWA 1DGSA 1M4VA 1C7YA 4OHJA 1NUCA 5IP9H 4IJHA 3M9BA 4A3KG 2MQHA 2DJFC 2K01A 2L55A 1L0YB 2JA7H 4AIMA 4YCWA 2VQFQ 3GTLB 4L6TB 5DNFA 1X3PA 2RQXA 4DV7Q 3NBIA 3VR3A 3J7A5 1TS2A 5CMDA 2M00A 1L0WA 4C1NI 4B9XA 1ASZA 4JI5Q 3GTQH 2PW5A 2Z4HA 1VQ6A 2JP1A 3D8GA 1ET9A 3HOVG 4LF9L 3NUCA 2EYJA 4XYOA 3MFYA 2HCIA 3HOZG 1X56A 2DY8A 1J9OA 1VQJA 1PTOF 1N36L 3CPFA 1XPRA 1KD1C 3DWAA 4NKLA 2K5WA 4DUYL 2CW0D 4KKUA 2F0HA 4J1MA 2UU9Q 4A3FH 1YBYA 2PQAB 1XNRL 3RZDH 3PIP3 3RZOB 1FR3A 3G48A 3R8BA 5A2QL 3SXHA 1N32Q 1B9NA 5I9PA 4C2MH 1Y1WH 1XMQL 2F0VA 4IOAA 3M4OH 1NMFA 1Y1VH 3EA6A 2F03A 1AW7A 4HJ9A 4C1NK 3CCEA 5M3FH 3KFUA 4CKCA 4A3MB 1WI5A 3BZDB 3K6OA 4IUQA 1CI3M 5KYIA 4NB3A 2RVLA 2R3ZA 4IUTA 1VCIA 1SFOB 5JPMC 4XDXA 3KF6A 4H0LC 4H02A 2RDGA 2OCEA 1MJEA 1CA5A 1IKLA 3S1RH 2I46A 5C3EG 4IUUA 1ILQA 2LY7A 4EX5A 2WINB 3KK7A 4Q5VA 2A5HA 1S5BD 1EYGA 3KBGA 4EQNA 1CZGA 4X65L 1B9MA 3QWNA 1A2UA 2PYKA 1EY6A 3HOWH 2F3IA 2PPBC 2O5JC 4OEMB 5IWAQ 1GXDC 3PO3H 2CQAA 2NVQB 1TWCH 1X3GA 3GQBA 1M1KC 3HFZB 4WJ4A 3BZKA 1WVLA 2VZAA 4DN4M 3VA7A 2Z1CA 3T53B 2BOSA 2X6LA 2G9DA 2R92G 4RCNA 5CGKA 1XPUA 1QE6A 3CCRA 3H09A 1XNQL 3FPUB 1HTPA 3ULPA 2IWHA 1CM9A 2E76C 1HPCA 3H0GG 3HOXH 3EROA 1B1ZA 3MA2B 4NXMQ 2SOBA 4IFDH 2F1MA 1QNKA 3OIQA 4CKEA 3EJIA 1N33Q 1LUZA 2EYMA 1XPOA 1JMCA 5IP7H 4B3ML 3K5NA 2D0OA 3S2DH 1RJTA 2QDBA 1YVCA 4IUNA 3MEFA 4ME3A 4A3IB 1YNND 5IYBG 1EFID 2OXPA 4C3JG 4DV1L 5IGGA 4P74A 5COYA 1NCVA 2EY6A 1EIFA 5CBEE 3TS0A 4A3DH 1E2ZA 4B3RQ 1EWCA 4XT3B 4X66Q 4A3JG 4V0BA 1HZAA 4HEDA 5M5WH 3RNUA 4GKJL 3DUZA 3NK9A 1HNZQ 3CKIB 1I6HB 5CYUA 4JI1L 4BBSB 5C44H 2Q8IB 3M4QA 2L0CA 4FXDA 2UXDL 1RD9D 3K59A 3KF8A 2B2TA 2MUYA 1RODA 3U50C 4LF6L 1PLFA 3ICEA 1JQYD 1ONLA 5J39A 1TS3A 2CQOA 4IPGA 5HGQA 1EQRA 4DV7L 3H91A 3FKIB 4ID6A 2H4OA 5C4XB 3CAMA 1BQQT 4HJAA 4AQYQ 5FLMG 1CSQA 1Q90A 2ICIA 2ZM6Q 4RKBA 4JI5L 3D0FA 4A3KB 3I4OA 3WWVA 3NELA 3X3MA 1CKOA 4IUPA 2R61A 1MGSA 2CHBD 5IT9E 2Q8TA 3OWFA 1ILPA 1II3A 5KNCA 4A3LG 3Q8DA 1KQSA 4OO1I 1CUKA 1CZWA 3MEHA 4HAEA 1SN8A 4J8QA 4LMQD 4KKSA 4JI0Q 3L9AX 4K0KL 5CV6A 3ERSX 4UP9A 4A3GB 1Y14B 3D4DA 4DR1Q 4IUVA 3HOVB 1G51A 2JYOA 5EKLA 3V96A 2KCNA 2VQEQ 1FYCA 3EVQA 3NP8A 3T1HQ 2HIXA 4L63B 4UAIA 1TWFH 4XTCS 4ZCKA 4DAYB 3CPWA 1N32L 5EJWA 5AJ3Q 2R7DA 2GN5A 4R4IA 1HJPA 1PRTF 5ISRA 1NY4A 2CWPA 5C4JB 2N78A 2OT2A 4HN7A 4YWMA 3WDNA 3J80c 3I4MH 1WTXA 2CFMA 4KKTA 2XRSD 1OTCA 1NTGA 1BCPF 1SNCA 2JA6H 2D5DA 3T1YL 2N49A 4PZ7A 2VNUD 3KF6B 3CW2C 1TQOA 3A8KE 2IX3A 1B53A 3S1QB 3BG3A 2JA8B 1JWSD 3TREA 4ILWA 2NVYB 5JJKA 1WCMH 4MN3A 2WAQE 1VDZA 1RCVD 1W3SA 5ELCA 4KHPQ 4DR6Q 3K0YA 5EBDA 1VQHA 1W6JA 5G3LF 1RTOA 3A0JA 3W3AA 3PUXA 1GUOA 3NWTA 1Q12A 1PMRA 2QGQA 1PH2A 1CQVA 2GA4B 4JI6Q 3PIO3 5C0XJ 1EEFD 5F2DA 4QJFA 1IHZA 2JSOA 5C3EB 2MP1A 1PZJD 1SE4A 1UE7A 4LK1C 2IL8A 5E1FA 3ZJYC 1PXUA 1RKNA 2MPMA 3BVMA 3PO2G 1DD2A 3SK8A 2A68C 2CH4W 2HHHQ 3CCSA 1STEA 1TWGH 1Z9FA 1Q46A 3SGIA 3GTOH 2JA5H 1HUNA 3KUPA 3OIPA 5IP9G 1EEID 1XJVA 1GUGA 1X54A 2JA7G 1MJCA 1ZEQX 2K7VA 1Z6HA 1KXLA 2TSSA 1K0RA 1PTOH 3D6CA 1YITA 2N88A 1JCKB 1CSPA 4NXML 3BYTB 4A75A 2R92B 1A63A 3J81j 4HJ7A 1N33L 3E9IA 4MIUA 2AWOA 4A3EH 1L1OA 1BKBA 5EGTA 3H0GB 4JW0A 2YTVA 2NBFA 1C9OA 4LFCQ 4YCVA 3VYUA 2MGSA 3LNNA 1F2LA 3IL8A 4F87A 1EY9A 1B8AA 3LWUA 3ULJA 2NYZD 3L2PA 5GAGC 4B3RL 2F3VA 3I91A 4X66L 4A3FG 3W1BA 1VQCA 5EKIA 4F88A 1T5XD 3KOJA 1DOLA 1F77A 3HRZC 4KY7A 1HNZL 1HZCA 1PFMA 2IX1A 3FMCA 5I6YA 1ESFA 2XWBB 5CV9A 2HDMA 3PCOB 4I7ZC 1I4QA 4RG1A 4L8JA 1CTMA 3NHHA 1MKHA 3MWYW 1WTWA 2NVTH 4P75A 1YEZA 3SK4A 5HY6A 5M3FG 3DHQA 1MIUA 3F2UA 4MTKA 1V43A 3NQIA 1PZKD 4BXXG 1TVXA 5JVH3 4DAPA 4YIJA 1A3VA 4CJ0B 4AQYL 2ZM6L 3VR5A 4LF9Q 5M3MH 1YJWA 2MJ8A 3MZ5A 1GD7A 2F0IA 4JI3L 4JYAQ 2KQ3A 3M3YB 3STBC 3T56B 1I3QH 3TN2A 4F8MA 1P16A 4LF8Q 1EU4A 5FLXE 1H95A 1LABA 1YHBA 1D6EC 3S9WA 1AFPA 2ZXPA 4LF7Q 4JVZA 4JI0L 1D2BA 1K83B 2A73B 2Z4IA 1C0AA 1EOTA 1XNRQ 3W1GA 2I5HA 3GTKH 4UHVA 4DR1L 1KRTA 2YYZA 1EQTA 2Q2UA 3PO3G 1HH2P 2VQEL 1G6PA 3T1HL 1KDCA 1JE4A 4JI4L 1DM0B 4X3SA 4R8IA 1EL0A 4OGQC 1HNWL 5AJ3L 3F8TA 4RHSA 1UE5A 4X62Q 3R2IA 2QF7A 4IZ8A 4ZUIA 3A74A 3HOXG 1S5DD 2L12A 5KYLA 2F0PA 4HIMA 2JN4A 5J22A 4IO9A 1IXRA 2EY2A 3P20A 1HZBA 1PA6A 5IOCA 1VQOA 4DV4Q 5I2YA 3K81C 2ICEC 3I4NH 3ITPA 5CV4A 1YNXA 2XSCA 1IZ6A 4RGMA 4JI2Q 1QWYA 5A2QE 2A6ED 1IBLQ 2F0GA 4PMCA 1QVFA 1G291 3C46A 4DR6L 2G9HD 4I7AA 1WTQA 2BDOA 2WB1E 2K14A 1TY0A 1K3BC 3GTJB 1D5XC 2G5DA 2PZUA 4DV3Q 3WOEA 2QEXA 1KL9A 1QVCA 4JI6L 1MBYA 1UWVA 4APVA 5H1SE 1UUPA 3H3VI 4ODGA 4A3DG 1SAPA 1SSOA 3HKZG 5C0XI 4DK0A 4KHVA 5GAEC 4R4OA 1EQVA 4P73A 4K2KA 2VW9A 3S1NB 2JK8A 3S1MH 5NUCA 1T5EA 2FXQA 3AU7A 1VQDA 1S5FD 1G2SA 1G2TA 1CKNB 4DPGA 1H9SB 3PO2B 4CDEC 5CV8A 4L5RC 1EIYB 5IGDA 4OX9Q 3R2TA 1L1OB 5IYCH 1A15A 1PH1A 5DM73 2XTIA 3K8AA 4R4TA 1FNVA 3CQZH 2LS01 1I4PA 1B3QA 1MSHA 2KCCA 2JA7B 2XVSA 1O7ZA 3CXCA 1VF7A 1E2WA 4JK1C 4LFCL 1EY5A 3T4AC 1RIPA 2VB2X 1AE3A 1EIGA 2K5DA 4G7OC 3GTQB 4LUVA 1I50H 2NZHA 1E2VA 3B6YA 2IY5B 1KLUD 3A7LA 4MTNA 2ZXOA 4OIJA 2Z6KC 4GKJQ 2PCFB 4JI1Q 2K28A 4F7XA 4GKKL 4IPDA 1R9TH 1N8RC 3P75A 2E5LL 5KIXA 2WKDA 3FKIG 5IGBA 5BN5A 1SE8A 4LF6Q 3FP9A 4FF2A 5IYDH 1Q8KA 3K58A 1XWEA 1KAAA 4DV5Q 2BA1A 3JC66 4A3FB 3M7GA 2MNAA 2Z8LA 3RZDB 1EQQA 2EJFC 2PZWA 1S3OA 4CDFC 4C2MB 1NNXA 5IY0A 4PQXA 4DV0L 1PH5A 1Y1WB 1O7IA 4JV5Q 3H3VC 2BA0A 3OPOA 2PNRC 2K52A 2B8FA 3M4OB 1JOQA 1SNPA 1Y1VB 1SE2A 2F0EA 1WCMG 2CCZA 5FJ8G 1A2TA 5M3FB 4A3GG 4R1JA 2EVBA 4JYAL 3J81E 1A3TA 2NN6G 1FVIA 5LHY1 4LF8L 2B29A 1PH3A 1OO9B 1GKHA 3OOCA 1PH6A 4K0KQ 4LF7L 3I55A 4C3HH 1W6KA 3S1RB 4KY5A 1JJCB 1IYJB 2AWNA 4HCEA 1UEAB 1U4MA 2MFIA 2B2WA 1E22A 2JA8G 3HOWB 2B2UC 3J80L 4DAYA 4A3CH 1Y8OB 2Z0SA 2E2IH 2JA5G 4X62L 2FINB 3PO3B 3T1YQ 2EYLA 3A7AB 1TWCB 1SROA 2B2YC 3A55A 2K32A 4HMIA 3CRKC 1EY8A 3DEOA 2E75C 3GDEA 2LXJA 4KHZA 3MC0B 1XMOQ 2MHVA 1IW7C 1QILA 1GUNA 4DV4L 4QUCA 4JBMA 2Q8RE 2NZ1D 3OMGA 3S14H 2EY1A 3J80i 4GN4B 4JI2L 3CC4A 3HOXB 2NZOA 1VF5C 2F4IA 3CF5A 1IBLL 4IN3A 5DLQE 2O2LD 1BBXC 1PRTD 3NTKA 4DXFA 1GUTA 1SYEA 4DV3L 4U673 1KAWA 3DXJC 1ZYRD 2NWGA 3TRZA 2Z9HA 1LTSD 1UNSA 4KMUC 3KJPA 4XT1B 1RHPA 2ZJQA 1IL8A 2BH8A 1CQFA 2Q2IA 4OWWB 3S2DB 4L5TA 3NPPA 4DR7Q 5TSSA 3UE1A 1EY0A 1K8GA 4BY7H 2K50A 1KIXA 2PO4A 2NVXH 4G4KA 2TMPA 4DR5Q 5ELBA 3BYYB 2F0FA 4A3DB 3HKZB 1HTLD 1IYVA 1YJNA 4ME5A 5G3LD 3PSIA 5M5WB 4A3MH 4DV6Q 1TS5A 1OXSC 5I6WA 5C44B 1EWIA 4V190 5K36H 4RFBA 5J3BA 2OQ0A 1H9KA 1SFOH 4OX9L 1TWAH 3K0XA 2ID0A 3J7AV 2DUDA 4GNXA 5FO9B 2WV6D 5E4XA 5M3MG 1YJ9A 5JEAJ 1SYDA 4G7HC 1V8QA 5ELNA 1LM0A 4QIWB 4B08A 4DK3C 2V4DA 3C2PA 2YU9B 4CDDC 3QOJA 1F2YA 2MO0A 5E3FA 4HIOA 4RH6A 1ICFB 3JAMi 3NTHA 2AHOB 1DJRD 1SNOA 2AQ2B 3VYSA 2BE5D 1BVSA 1HQRD 5HURA 1NE3A 3CHBD 2M9VA 3NE5B 1RL2A 3I70A 3MVVA 1KHIA 3TBIB 2NN6I 4A93H 3RUZA 2DY7A 3BDOA 3MXPA 3MTSA 3S15H 3EN2A 3OYYA 3TP7A 2ZXRA 1FGUA 5E4WC 4DV5L 2JEBI 3RLOA 2ZT9C 3PF4A 2K5VA 5AFWA 5JEAG 4KK7A 2KOLA 2RSNA 3Q23A 1FNWA 3DMUA 1TWFB 1TWHH 1GOZA 1DCZA 5E7NA 1S40A 4JV5L 2E2JH 5FLXc 2V1CC 3I4NG 4JI3Q 3HG9A 4KY6A 1ICWA 3MXNA 5JOBA 5D14A 1XTDA 1SYCA 2MO1A 2PZTA 3RN2A 1HNXQ 1VQ5A 3HP3A 1EWHA 3CU7A 1BOSA 1G91A 1XYIA 1SRUA 1WCMB 1KDBA 1SXTA 2B63H 2EYFA 2O5IC 2E8GA 1AH9A 4Y7NH 3F2DA 3NSWA 1X9NA 1XX8A 2P5ZX 3FDTA 4GLXA 1SNMA 1SYBA 3RD4A 1K3RA 1I6HH 1PH9A 4JI4Q 3UI2A 2K75A 1EYCA 1HNWQ 3NBHB 4PV1C 2ZTEA 2VB3X 2C5CA 4N8FA 1DOKA 3RN5A 3S17H 2OQKA 3CCLA 4RGTA 1STHA 3S16H 4XQQA 3D6WA 3E3XA 1VQ9A 1U4PA 2I07B 2XNAC 2I0QA 4DXGA 1LACA 1Y69U 5DEHA 2XWJB 2WAQG 3GTMH 4IALA 2R7ZG 1I6VC 1TWGB 3T13A 1XMOL 3AYHB 3I72A 4K6LA 3PUWA 5KNDA 3GTOB 2JA5B 2A1AA 2F0NA 1RF2D 3TS2A 3TP6A 4DK6C 1R4PB 1IBKL 3HOYH 4NW2A 1PFSA 4POFA 2B2WC 5LMNQ 1PTOB 2WIIB 2JEAI 4H13C 3MXUA 2ASBA 2ZJPA 4HJ5A 3OMCA 3A8IE 5FOBB 2KHJA 1EZ6A 1B4OA 4R4QA 4A3EB 3HOVH 3ND8A 1HR0L 3BZCA 3BDLA 4K6DA 3GTGH 4GN5A 3HOZH 1AP0A 2NTSA 2EQSA 4DR7L 1PHJA 1S5CD 1R4QB 1X65A 1JC7A 2E74C 1MHWC 1C8CA 4GS3A 1E3PA 4DR5L 3NXWA 1X32A 5IYDG 1EUJA 4PMWA 1K73C 1SDFA 1TT2A 2DN8A 2VL6A 1CKNA 2SEBD 4UP7A 3SVMA 4DV6L 2HQLA 5KRUA 1H9SA 4N9TA 1GHJA 3I73A 1PH8A 3I56A 3S2HH 1LTBD 1JOKA 2HUGA 2NB0A 3JAMc 4GNXB 2NVYH 1TS4A 5GQOA 4KN4C 3E6ZX 2K03A 2NVTB 1KRSA 2A6EC 2ENBA 3A5UA 4ULLA 1VQAA 1QZGA 4OO1H 3TP5A 1TKWB 2RA4A 2O4XA 2D62A 3A5ZB 4QUFA 2VUMH 1E1OA 2IT1A 4RA8A 1NJIC 1CK1A 3KBXA 5M3MB 3CCJA 3L7ZC 4JI8L 3J7YW 1SR3A 5A35A 3VYRA 1GVPA 4C3HG 4GKKQ 3I2ZA 5M5XH 1S5ED 2FHTA 2KJXA 1VQFA 1ET6A 1MSGA 5BN4A 2A6HD 2E5LQ 4DR2Q 4BY1H 1OXUA 2AMCB 3FHWA 5I9OA 1F9RA 3PMFA 5C6AA 2EJGC 1Y1WG 4AYBG 5FO8B 1KTKA 3G6JB 2KECA 4YHHQ 3KLSA 5LMUL 1Y1VG 2F0SA 4A3CG 5ELEA 1TR5A 1X55A 1YHAA 3GTKB 2PQEA 1DYQA 4EVOA 4AYBE 1OXVA 2F0KA 1NSNS 2JE6I 1BBWA 2ZJRA 3I4LA 2F52A 3HEJA 1F2ZA 3AFPA 1VS0A 2BH2A 5CV5A 3KJOA 4DV0Q 3EQLC 4KJOA 1EOVA 1VQMA 2X69A 2R92H 3MXNB 1P8LA 3J81c 3F1ZA 3C1EA 2R7FA 5C3WA 2J7ZA 1SLJA 4DV2L 4BBRH 3CCUA 2E2HB 4N9PA 2K5HA 2LMCB 2LFNA 1YNJC 3HOUH 3HS0C 3O13A 3SDZA 1HA6A 4IFDJ 2K5QA 1YHQA 1SJHD 2B2TC 1HNXL 1V1QA 2D9UA 4ZRZA 1C48A 2K5NA 4PZ6A 5IGFA 4FF4A 1JWMD 3HOWG 3I4NB 5T1GA 3X3NA 5D65A 4HTHA 4X64Q 3SEBA 4DAVA 3M4PA 1EYDA 1PYWD 5IGEA 4WJWA 2L9HA 4C3JH 2HDLA 1JJGA 2DNEA 3PIPA 2RHQB 3SK6A 5CC4A 4L5SA 1XTCD 3V05A 4HSPA 4RMFA 4A3JH 3FEWX 2A74C 1D7QA 4GN3B 1QOHA 4GOPB 2VXWA 5EBCA 4ZUJA 1PTOD 2IX0A 5C4HA 4FF1A 3A54A 2B3GA 4LNQA 4DNTB 4IFDG 4ABNA 4MZ9A 1PH7A 5K36G 1VQBA 4P72A 4LUOA 3S1MB 3QJYA 3M7NA 4C3IH 3I7FA 4LFAQ 1Q1EA 2WB1G 5IP7G 1F2MA 1K8AC 5CR3A 5FO7B 1DOMA 2KCTA 2WAQB 5JJZA 4PG3A 5LMNL 2R7ZB 4TVAB 1I94L 2CW0C 1JR0D 1EYAA 2EE1A 3J7ZC 1C4QA 4ALPA 3CQZB 3FVQA 1HHVA 2L15A 4YCUA 1EU3A 1A8VA 4TSSA 2BCOA 3DEPA 2EZVA 5FK9C 1F9SA 1A6XA 4DR3L 4LAAA 1L0XB 2UUCL 2FMCA 4JPBW 5C44G 1PRTB 2PI2E 3A56A 3QOLA 3NEMA 4A93G 2OF1A 5LL6S 1J6QA 3VR6A 1I50B 2KEDA 3ND9A 4EQ5A 2Y0SG 4ZKCB 3NWSA 1U5KA 2I5MX 1BCPB 5EQ0A 1VQKA 1QVGA 5ELOA 3VR4A 2UUBQ 3K5LA 2Y0SE 1YZ6A 1R9TB 1L2FA 2KENA 5GADC 1V1OA 3TZDA 3E0EA 3CCVA 1LT5D 4KJNA 2WACA 1HCZA 5JPNC 3SR1A 1PFBA 1PVOA 1V1PB 3EBEA 2RCFA 2Z6BA 2KEEA 1O78A 1T9HA 2F0MA 4QL5A 1JE5A 4M1UB 2BDNA 3DLLA 5M5YH 1KLGD 3ERQA 1PYBA 2CWAA 1ZYRC 3BDCA 3GD7A 2A19A 1VQGA 2B63G 1HQMC 4CJ2C 2AQ1B 2SDFA 2CKZB 1K8MA 2RDHA 2KHSA 3MHBA 3CP0A 2QDLA 1ENCA 4XYQA 2RBMA 3OW2A 4KD4A 1AN8A 3LX0A 1S72A 3GTPH 3H6MA 4RKLA 4DR2L 1L1OC 4RGNA 2I5LX 1IYUA 1IBMQ 2KCMA 2IHFA 4J6HA 2AUJD 4A3BH 2EPBA 4DU9A 4EQOA 2L1BA 1BR9A 2K04A 4K2LA 1SMXA 5T1IA 2A69D 4C3HB 4YHHL 4I65A 1Q8IA 3I4MG 3LWEA 3UDXA 1Q86C 1Y8NB 4ZKBB 2JA6G 2F0LA 1VQ7A 1D1KA 2RSOA 3N52A 5IT9c 1SMYD 4AYBB 4HIKA 5FLXL 1RDPD 1I4XA 5C4ZA 4O0AA 3K7AH 3PUZA 2F0JA 2E2IB 2HIVA 1TXYA 3AB9A 3LGJA 1STBA 3I8ZA
chains in the Genus database with same CATH topology
1ENAA 1AEXA 4C56C 4X3UA 4CJ1B 1YNNC 4FNFA 1Z47A 4IFDI 2J0TD 3QG1A 4FO2A 5EPLA 1S4ZA 3TSSA 1EIHA 5C0XH 4DA2A 3S14B 2BE5C 2EDGA 1QNUA 4BWGB 4EGVA 3IFDA 1ML0D 1QB5D 4FXGC 1WTPA 3NBHA 5JAVA 3GO5A 4ZYSA 1D1IA 3GV6A 4BY7B 4DK1A 1BDOA 2NVXB 1LTID 2XN9C 2KUMA 1IKMA 5EPKA 2OEOA 3KLRA 2SNSA 3URYA 4OO1G 3VA5A 2B8GA 1JOOA 3K57A 3ZYYX 1EY4A 1TWAB 4TRDA 1QG7A 3Q24A 4K8JA 2WB1B 1BCPD 1FNUA 1CA6A 2EYPA 2L11A 1LTGD 1U4RA 2M2LA 3DWPA 1PDQA 1JICA 3GV3A 3MXGA 2F0WA 3BVZA 4R8NA 2XIWA 4XIGS 1LV9A 1AZQA 1D5MC 4DGZA 3N6RA 3D3RA 3OW7A 2NUCA 1BUVT 2DNCA 1HFNA 4MHEA 1VMCA 3PUVA 3JAML 3NQTA 4A93B 2K05A 3S15B 4RHRA 1JWUD 3NTIA 2Y0SB 4WRDA 1EY7A 4K5XA 2LKVA 4EQPA 3TDQA 1O80A 5D3DA 4XQJA 2B2VA 1WTVA 3H94A 1TWHB 2EY5A 3MFGA 2IW3A 1D5ZC 2E2JB 4FYDA 3P1HA 4G57A 1KDAA 2EYHA 3AMUA 2K6AA 3D4WA 2FMMA 4CKBA 5I2XA 1BXTA 5D3IB 2B63B 4Y7NB 1XXGA 4WORA 3D31A 1HUMA 2D2CC 3E0JA 3OWEB 4NDXA 1QCBD 1SE3A 1PFNA 1B3AA 3J81L 1LLRD 4H44C 3S17B 2RKSA 3U9SA 1E0BA 2EJMA 3FPPA 3S16B 3I4MB 4C3IG 2SNMA 4ZQ3A 2JA6B 3A8JE 3GTMB 4DF7A 4QMGA 5JVG3 1IW7D 1CFMA 1B44D 3TMEA 1UAPA 3HOYB 1KABA 1NR2A 1EZ8A 2A6HC 1CT1D 4K8IA 4R9WA 1H9MA 1GHKA 3RLFA 3T16A 4K5WA 1J8IA 4XXEA 1SNQA 3OSOA 5ELDA 4CHTB 3GTGB 3W2DA 3HOZB 2EOTA 3Q6SA 1CHQD 3QIAA 5IODA 4FF3A 3U9OA 5LL6X 4NMZA 4FXKC 1OXXK 1WD0A 4TKOB 3QO2A 1A3UA 1I4RA 1CHPD 2WP8J 1KNEA 4LJZC 3WOFA 3S2HB 4DNRB 1FD7D 4OIKA 2IPKD 4PMBA 4Z9CB 1JB3A 1G8ZD 5EKKA 4ZLTF 3T51B 5KGUA 2NN6H 3C1FA 2VUMB 3KLSX 1O7LA 5J1ZA 2CVRA 3DWQA 4KN7C 1G6ZA 2KA7A 5IGCA 1DONA 1PTOC 5M5XB 5C3XA 4XQNA 3GP7A 4BY1B 3R93A 4B9WA 1LT6D 1VMPA 4FP5D 3RMHA 1Q1BA 1U4LA 1DXMA 4BA1I 2NTTA 1M8AA 4X3TA 3TZUA 5I4DA 1V1PA 2HCCA 2KVMA 1B2TA 5FKAC 5IIFA 1Q3LA 4FVMA 1Z7TA 3K5OA 4OL7A 4BBRB 4WFN3 5C0XG 1X3QA 2JXMB 2AUKA 1F9QA 5C5MA 4HSVA 3HOUB 4G7ZC 1I3QB 4M8AA 4QB4A 1ZXTA 5DAUA 5CV7A 5CORA 2B2VC 1LTAD 1SJED 5BN3A 2R6GA 4IURA 2PW7A 5IT9L 1SBBB 4C3JB 1MI2A 2K33A 2HQEA 1RTNA 3K5MA 4A3JB 1JORA 4K14A 2L4NA 4KV6A 2EXZA 3SE0A 3EFXD 1HFGA 3IKJA 2F0QA 2QILA 1LO5D 3E5SA 3HZXA 3IAYA 4IQZA 4C3IB 1DZ1A 3FRPB 4K5VA 2B2UA 3PUYA 1MD2D 1NR4A 1H9JA 5DM63 1WTRA 4O1NA 2QKIC 5EPJA 1STGA 1U9RA 4RGOS 2B2YA 3I3CA 4PNYA 1SEBD 5ELFA 2A69C 3BS1A 1GUSA 3Q22A 1SNDA 1TY2A 1LTTD 4BS9A 1AZPA 2L5TA 2WKCA 1HXYD 2E2DC 4UDUC 2K1BA 2B39A 4RAUC 1SMYC 1F9PA 2A68D 4E6IA 2C9OA 4CBVA 1SYGA 4ZAIA 5KEEA 1Y8PB 1H9RA 4CGYB 2XRQD 2QEJC 5JEAH 5C5LA 1WTOA 3ONAB 3TP8A 2FJ2A 2J4XA 4U68A 1QJOA 3J80E 3CRLC 4HMJA 4TQUS 3BVGA 3I90A 1ENFA 4HCSA 1TIID 1GUWA 2F0OA 2FFKB 1K8OA 3SK5A 3C3LA 1ESRA 3SHLA 2EYOA 5HGTA 3R3OA 1PZID 3PV0A 5M5YB 1B50A 1HRJA 3V2TA 1I4HA 2RDFA 4S3SA 4KI0A 4RWSC 3M4YA 1OXTA 4KD3A 1TU2B 1I4GA 3QB3A 4HR7B 3GTPB 4O42A 1KNAA 1ZKOA 5KNBA 1SYFA 3G7LA 4NP5A 4H7BA 4QCLA 1WD1A 3VR2A 1BNZA 4A3BB 3MAQA 2X6GA 3Q0AA 1LTRD 3IFTA 5M9OA 1NAPA 1PRTC 1GJXA 1FGBD 1O7YA 3K7AB 3DM1A 1BCPC 5CBAE 2F0UA 4BA2I 2F0DA 2F3WA 3M85A 4ZK9B 3OHXC 3HGBA 1YNJD 3JAME 1LT4D 2PMZB 2N55A 1STAA 3VYTA 4GZYC 1LT3D 3J7AF 3L3OC 4DFAA 4X3KA 3D4RA 4QF4A 5K5PA 1STNA 2IJ0A 2F0TA 2AQ3B 2R93B 2H1EA 1BF4A 2QCPX 4KTAA 4RCOA 4P2CB 1HA5A 1BO0A 1STYA 3P7JA 4Q0FA 4JBWA 1M4VA 4OHJA 1NUCA 2K01A 2L55A 1L0YB 3GTLB 4L6TB 5DNFA 1X3PA 2RQXA 3NBIA 3VR3A 1TS2A 5CMDA 2M00A 4C1NI 4B9XA 2PW5A 2Z4HA 2JP1A 3D8GA 1ET9A 3NUCA 2EYJA 4XYOA 3MFYA 2HCIA 2DY8A 1J9OA 1PTOF 3DWAA 4NKLA 2K5WA 2CW0D 4KKUA 2F0HA 4J1MA 3PIP3 3RZOB 1FR3A 3R8BA 5A2QL 3SXHA 1B9NA 5I9PA 2F0VA 3EA6A 2F03A 1AW7A 4C1NK 4CKCA 4A3MB 3BZDB 3K6OA 4IUQA 1CI3M 5KYIA 2RVLA 2R3ZA 4IUTA 1VCIA 1SFOB 5JPMC 4XDXA 4H0LC 2RDGA 1CA5A 1IKLA 2I46A 4IUUA 1ILQA 2LY7A 2WINB 3KK7A 4Q5VA 2A5HA 1S5BD 3KBGA 4EQNA 1CZGA 1B9MA 3QWNA 1A2UA 2PYKA 1EY6A 2PPBC 2O5JC 1GXDC 2CQAA 2NVQB 3GQBA 1WVLA 4DN4M 3VA7A 2Z1CA 3T53B 2BOSA 2X6LA 2G9DA 4RCNA 5CGKA 1QE6A 3H09A 3FPUB 1HTPA 2IWHA 1CM9A 2E76C 1HPCA 3EROA 1B1ZA 3MA2B 2SOBA 4IFDH 2F1MA 1QNKA 3OIQA 4CKEA 3EJIA 2EYMA 3K5NA 1RJTA 2QDBA 4IUNA 4A3IB 1YNND 1EFID 2OXPA 4C3JG 5IGGA 5COYA 1NCVA 2EY6A 5CBEE 1E2ZA 1EWCA 4XT3B 4V0BA 4HEDA 3DUZA 3NK9A 3CKIB 1I6HB 5CYUA 4BBSB 2Q8IB 2L0CA 4FXDA 1RD9D 3K59A 3KF8A 2B2TA 2MUYA 1RODA 1PLFA 1JQYD 1ONLA 5J39A 1TS3A 3H91A 3FKIB 4ID6A 2H4OA 5C4XB 1BQQT 1Q90A 2ICIA 4RKBA 4A3KB 3X3MA 4IUPA 2R61A 1MGSA 2CHBD 5IT9E 2Q8TA 3OWFA 1ILPA 1II3A 5KNCA 4OO1I 1CZWA 3MEHA 4HAEA 4J8QA 4LMQD 4KKSA 3L9AX 5CV6A 4A3GB 3D4DA 4IUVA 3HOVB 2JYOA 5EKLA 3V96A 2KCNA 1FYCA 3EVQA 3NP8A 4L63B 4UAIA 4XTCS 5EJWA 1PRTF 5ISRA 5C4JB 4HN7A 2OT2A 3WDNA 1WTXA 4KKTA 2XRSD 1BCPF 1SNCA 2D5DA 2VNUD 1TQOA 3A8KE 2IX3A 1B53A 3S1QB 3BG3A 2JA8B 1JWSD 4ILWA 2NVYB 4MN3A 1VDZA 1RCVD 5ELCA 3K0YA 5EBDA 1W6JA 5G3LF 1RTOA 3W3AA 3PUXA 1GUOA 3NWTA 1Q12A 1PMRA 1CQVA 2GA4B 3PIO3 5C0XJ 1EEFD 5F2DA 1IHZA 2JSOA 5C3EB 2MP1A 1PZJD 1SE4A 4LK1C 2IL8A 5E1FA 1PXUA 1RKNA 2MPMA 3BVMA 1DD2A 3SK8A 2A68C 1STEA 1HUNA 3KUPA 3OIPA 1EEID 1GUGA 1ZEQX 2K7VA 1Z6HA 2TSSA 1PTOH 3D6CA 2N88A 1JCKB 3BYTB 2R92B 4MIUA 2AWOA 5EGTA 3H0GB 2NBFA 3VYUA 2MGSA 3LNNA 1F2LA 3IL8A 4F87A 1EY9A 3LWUA 2NYZD 2F3VA 3I91A 5EKIA 4F88A 1T5XD 1DOLA 1F77A 3HRZC 4KY7A 1PFMA 2IX1A 3FMCA 5I6YA 1ESFA 2XWBB 5CV9A 2HDMA 4I7ZC 1I4QA 4L8JA 1CTMA 3NHHA 3MWYW 1WTWA 3SK4A 3DHQA 3F2UA 1V43A 3NQIA 1PZKD 1TVXA 5JVH3 4DAPA 4YIJA 1A3VA 4CJ0B 3VR5A 2MJ8A 3MZ5A 2F0IA 2KQ3A 3M3YB 3T56B 3TN2A 4F8MA 1EU4A 5FLXE 1LABA 1D6EC 3S9WA 1AFPA 2ZXPA 1D2BA 1K83B 2A73B 2Z4IA 1EOTA 2YYZA 1EQTA 1KDCA 1JE4A 1DM0B 4X3SA 4R8IA 1EL0A 4OGQC 4RHSA 3R2IA 2QF7A 4IZ8A 4ZUIA 1S5DD 2L12A 5KYLA 2F0PA 5J22A 2EY2A 3P20A 5IOCA 5I2YA 2ICEC 3ITPA 5CV4A 2XSCA 4RGMA 1QWYA 5A2QE 2A6ED 2F0GA 4PMCA 1G291 3C46A 2G9HD 1WTQA 2BDOA 1TY0A 3GTJB 1D5XC 2PZUA 3WOEA 1MBYA 1UUPA 4ODGA 1SAPA 1SSOA 5C0XI 4DK0A 4KHVA 1EQVA 4K2KA 3S1NB 5NUCA 1T5EA 3AU7A 1S5FD 1G2SA 1G2TA 1H9SB 3PO2B 5CV8A 5IGDA 3R2TA 1A15A 5DM73 1FNVA 2LS01 1I4PA 1MSHA 2KCCA 2JA7B 2XVSA 1O7ZA 1VF7A 1E2WA 4JK1C 1EY5A 3T4AC 2VB2X 1EIGA 2K5DA 4G7OC 3GTQB 1E2VA 1KLUD 3A7LA 4OIJA 2ZXOA 2PCFB 2K28A 4F7XA 3P75A 5KIXA 2WKDA 5IGBA 5BN5A 4FF2A 3K58A 1XWEA 1KAAA 2BA1A 4A3FB 3M7GA 2Z8LA 3RZDB 2EJFC 2PZWA 4C2MB 4PQXA 1Y1WB 3H3VC 2BA0A 3OPOA 2PNRC 3M4OB 2B8FA 1JOQA 1SNPA 1Y1VB 1SE2A 2F0EA 1A2TA 5M3FB 2EVBA 3J81E 1A3TA 2NN6G 5LHY1 1OO9B 3OOCA 1W6KA 3S1RB 4KY5A 2AWNA 4HCEA 1UEAB 1U4MA 2B2WA 3HOWB 2B2UC 3J80L 4DAYA 1Y8OB 2FINB 3PO3B 2EYLA 3A7AB 1TWCB 3A55A 2B2YC 4HMIA 2K32A 3CRKC 1EY8A 3DEOA 2E75C 4KHZA 3MC0B 2MHVA 1IW7C 1QILA 1GUNA 4QUCA 2Q8RE 2NZ1D 3OMGA 2EY1A 3HOXB 1VF5C 2F4IA 4IN3A 2O2LD 1BBXC 1PRTD 3NTKA 4DXFA 1GUTA 1SYEA 4U673 3DXJC 1ZYRD 2NWGA 1LTSD 1UNSA 4KMUC 4XT1B 1RHPA 1IL8A 1CQFA 3S2DB 3NPPA 5TSSA 1EY0A 2PO4A 4G4KA 2TMPA 5ELBA 3BYYB 2F0FA 4A3DB 3HKZB 1HTLD 1IYVA 4ME5A 5G3LD 5M5WB 1TS5A 1OXSC 5I6WA 5C44B 4V190 5K36H 4RFBA 1H9KA 3J7AV 2ID0A 5FO9B 2WV6D 5E4XA 5JEAJ 1SYDA 4G7HC 1V8QA 4B08A 4QIWB 2V4DA 3C2PA 2YU9B 3QOJA 1F2YA 5E3FA 4RH6A 3NTHA 1DJRD 1SNOA 2AQ2B 3VYSA 2BE5D 1HQRD 5HURA 3CHBD 2M9VA 3NE5B 3I70A 3MVVA 3TBIB 2NN6I 3RUZA 2DY7A 3BDOA 3MXPA 3MTSA 3TP7A 2ZXRA 5E4WC 2JEBI 2ZT9C 5AFWA 5JEAG 4KK7A 2KOLA 2RSNA 3Q23A 1FNWA 3DMUA 1TWFB 1GOZA 1DCZA 3HG9A 4KY6A 1ICWA 3MXNA 5JOBA 5D14A 1SYCA 2PZTA 3HP3A 1EWHA 3CU7A 1BOSA 1G91A 1XYIA 1WCMB 1KDBA 1SXTA 2EYFA 2O5IC 3NSWA 1XX8A 3FDTA 1SNMA 1SYBA 3RD4A 3UI2A 1EYCA 4PV1C 2VB3X 2C5CA 1DOKA 4RGTA 1STHA 4XQQA 3D6WA 1U4PA 2I07B 2XNAC 4DXGA 1LACA 1Y69U 5DEHA 2XWJB 4IALA 1I6VC 1TWGB 3T13A 3I72A 4K6LA 3PUWA 5KNDA 3GTOB 2JA5B 2F0NA 1RF2D 3TP6A 1R4PB 4NW2A 2B2WC 1PTOB 2WIIB 2JEAI 4H13C 3MXUA 3OMCA 3A8IE 5FOBB 1EZ6A 1B4OA 4A3EB 3ND8A 3BDLA 4K6DA 1AP0A 2NTSA 1S5CD 1R4QB 1JC7A 2E74C 1C8CA 3NXWA 1X32A 4PMWA 1SDFA 1TT2A 2DN8A 2SEBD 3SVMA 5KRUA 1H9SA 4N9TA 1GHJA 3I73A 1LTBD 1JOKA 2HUGA 2NB0A 1TS4A 4KN4C 3E6ZX 2K03A 2NVTB 2A6EC 2ENBA 4ULLA 4OO1H 3TP5A 1TKWB 2RA4A 2O4XA 2D62A 4QUFA 2IT1A 4RA8A 1CK1A 3KBXA 5M3MB 3L7ZC 3J7YW 5A35A 3VYRA 4C3HG 1S5ED 2FHTA 2KJXA 5BN4A 1ET6A 1MSGA 2A6HD 1OXUA 5I9OA 1F9RA 3PMFA 5C6AA 2EJGC 5FO8B 1KTKA 3G6JB 2KECA 3KLSA 2F0SA 5ELEA 1TR5A 3GTKB 2PQEA 1DYQA 4EVOA 1OXVA 2F0KA 1NSNS 2JE6I 3I4LA 3HEJA 1F2ZA 5CV5A 3EQLC 4KJOA 2X69A 5C3WA 3C1EA 2J7ZA 2E2HB 4N9PA 2LMCB 2LFNA 1YNJC 3HS0C 3O13A 3SDZA 1HA6A 4IFDJ 2K5QA 1SJHD 2B2TC 2D9UA 4ZRZA 1C48A 5IGFA 4FF4A 1JWMD 3I4NB 5T1GA 3X3NA 5D65A 4HTHA 3SEBA 4DAVA 1EYDA 1PYWD 5IGEA 4WJWA 2L9HA 2HDLA 2DNEA 3SK6A 5CC4A 1XTCD 3V05A 4HSPA 3FEWX 2A74C 1QOHA 2VXWA 5EBCA 4ZUJA 1PTOD 2IX0A 5C4HA 4FF1A 3A54A 4DNTB 4IFDG 4ABNA 5K36G 3S1MB 3QJYA 3M7NA 1Q1EA 1F2MA 5CR3A 5FO7B 1DOMA 2WAQB 5JJZA 2R7ZB 2CW0C 1JR0D 1EYAA 2EE1A 1C4QA 3CQZB 3FVQA 1HHVA 1EU3A 4TSSA 2EZVA 2BCOA 3DEPA 5FK9C 1F9SA 1A6XA 4LAAA 1L0XB 2FMCA 1PRTB 3A56A 3QOLA 2OF1A 5LL6S 3VR6A 1I50B 2KEDA 3ND9A 4ZKCB 3NWSA 1BCPB 5EQ0A 3VR4A 3K5LA 1R9TB 1V1OA 3TZDA 1LT5D 4KJNA 2WACA 1HCZA 5JPNC 3SR1A 1PFBA 1V1PB 2KEEA 1O78A 2F0MA 4M1UB 2BDNA 1KLGD 3ERQA 1ZYRC 3BDCA 3GD7A 1HQMC 4CJ2C 2AQ1B 2SDFA 1K8MA 2RDHA 2KHSA 3MHBA 1ENCA 4XYQA 2RBMA 4KD4A 1AN8A 3LX0A 3H6MA 4RKLA 4RGNA 1IYUA 4J6HA 2AUJD 2EPBA 4EQOA 4DU9A 2L1BA 1BR9A 2K04A 4K2LA 5T1IA 2A69D 4C3HB 4I65A 1Q8IA 3LWEA 4ZKBB 1Y8NB 2F0LA 1D1KA 2RSOA 3N52A 1SMYD 4AYBB 5FLXL 1RDPD 1I4XA 5C4ZA 3PUZA 2F0JA 2E2IB 3AB9A 1STBA 3I8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ENA A;  1AEX A;  4DFA A;  5IIF A;  5CV8 A;  2F0S A;  2NUC A;  4E6I A;  4F8M A;  3QOJ A;  1F2Y A;  1TR5 A;  5E3F A;  4K8I A;  4QF4 A;  2PQE A;  5E1F A;  5K5P A;  5J39 A;  1SYG A;  1STN A;  4EVO A;  1RKN A;  5IGD A;  3NQT A;  2F0N A;  2F0K A;  2F0T A;  4K5W A;  1NSN S;  1SNO A;  4OL7 A;  4LAA A;  3SK8 A;  3T16 A;  3TP6 A;  5KEE A;  3S9W A;  1SNQ A;  3OSO A;  3HEJ A;  1F2Z A;  4EQN A;  5HUR A;  4ID6 A;  5CV5 A;  4WRD A;  1EY7 A;  4K5X A;  2LKV A;  3QOL A;  4KJO A;  5C5M A;  2OF1 A;  1A2U A;  2EYL A;  5C5L A;  4EQP A;  4KTA A;  3TP8 A;  3OMC A;  4RKB A;  2PYK A;  1EY6 A;  4HMI A;  3MVV A;  4QB4 A;  1STY A;  3C1E A;  5C3W A;  3RUZ A;  1EY5 A;  1EY8 A;  4HMJ A;  5CV7 A;  5DAU A;  5IOD A;  1EZ6 A;  3U9O A;  3MXP A;  4NMZ A;  5IGF A;  1NUC A;  4N9P A;  3D6C A;  3TP7 A;  3OWF A;  1KDC A;  2EY5 A;  1II3 A;  3BDL A;  4K6D A;  2F0O A;  3OMG A;  3MEH A;  3SK5 A;  2EY1 A;  3P1H A;  3SHL A;  4MIU A;  2EYO A;  4G57 A;  5HGT A;  1KDA A;  1A3U A;  2EYH A;  2M00 A;  2PW7 A;  2WAC A;  3DMU A;  3R3O A;  4KJN A;  4IZ8 A;  5CV6 A;  5EGT A;  5JAV A;  3SR1 A;  4ZUI A;  3D4D A;  4B9X A;  4F7X A;  5CGK A;  2PW5 A;  3D4W A;  3P75 A;  2RDF A;  4S3S A;  3V2T A;  5KIX A;  3NXW A;  5EKL A;  5KYL A;  1SYE A;  4HTH A;  2F0P A;  2HQE A;  1EYD A;  2F0M A;  5IGB A;  5J22 A;  3D8G A;  3EVQ A;  3NP8 A;  4KY6 A;  3ERO A;  3NUC A;  4PMB A;  2EYJ A;  2EY2 A;  1EY9 A;  5JOB A;  1TT2 A;  4KD3 A;  2SOB A;  5IGE A;  5IOC A;  1JOR A;  4K14 A;  1KAA A;  5EKK A;  3EJI A;  3ITP A;  1SYC A;  3QB3 A;  2PZT A;  5CV4 A;  3ERQ A;  4N9T A;  5KRU A;  5ISR A;  4KV6 A;  1EY0 A;  3BDC A;  2EXZ A;  2EYM A;  1SYF A;  1JOK A;  2F3V A;  2F0G A;  2PZW A;  4NKL A;  4NP5 A;  4H7B A;  4WOR A;  2OEO A;  4PMC A;  5CC4 A;  5KGU A;  2KHS A;  3MHB A;  1ENC A;  2SNS A;  4NDX A;  2F0H A;  1KDB A;  4J1M A;  2F0Q A;  2RBM A;  1SNC A;  2EYF A;  3C1F A;  4KD4 A;  4KY7 A;  3VA5 A;  2F0F A;  2ENB A;  2PZU A;  1JOO A;  2QDB A;  3E5S A;  3HZX A;  1SNP A;  3LX0 A;  4ZUJ A;  5J1Z A;  5C4H A;  1JOQ A;  1TQO A;  4IUN A;  2RKS A;  2F0E A;  3H6M A;  3TP5 A;  4RKL A;  5CV9 A;  5I6Y A;  5IGC A;  5M9O A;  4K5V A;  1EY4 A;  1A2T A;  4ME5 A;  2OXP A;  4TRD A;  3SXH A;  1SNM A;  5IGG A;  1SYB A;  2O4X A;  3NHH A;  4K8J A;  4ODG A;  5I9P A;  4J6H A;  2SNM A;  4ZQ3 A;  1EYC A;  2EY6 A;  4KHV A;  4DU9 A;  3SK4 A;  4EQO A;  5C3X A;  2F0V A;  4K2L A;  5I6W A;  1A3T A;  2EYP A;  3DHQ A;  4I65 A;  1STG A;  1U9R A;  1F2M A;  5CR3 A;  1EQV A;  4DF7 A;  3SK6 A;  4QMG A;  4B9W A;  1STH A;  4PNY A;  2F0L A;  2F0U A;  2F0W A;  4K2K A;  2F0D A;  3NK9 A;  2F3W A;  4R8N A;  5NUC A;  4YIJ A;  1SND A;  5KYI A;  1A3V A;  4KY5 A;  1SYD A;  5DEH A;  1STA A;  3TME A;  5C4Z A;  1EYA A;  5I9O A;  1KAB A;  2F0J A;  4IAL A;  1EZ8 A;  3PMF A;  5F2D A;  5C6A A;  3MZ5 A;  1IHZ A;  2F0I A;  4DGZ A;  3T13 A;  1STB A;  2KQ3 A; 
#chains in the Genus database with same CATH topology
 1ENA A;  1AEX A;  3L0O A;  3HOY G;  1N9W A;  4C56 C;  1VQI A;  4X3U A;  4CJ1 B;  1YNN C;  4NPS A;  4FNF A;  4GLA C;  4A76 A;  1Z47 A;  2D0P A;  4IFD I;  2J0T D;  3QG1 A;  1V9P A;  1VQ4 A;  4FO2 A;  4B3T L;  3H3V H;  2OTL A;  5EPL A;  1S4Z A;  3TSS A;  1EIH A;  5C0X H;  4DA2 A;  3S14 B;  2BE5 C;  3S24 A;  2EDG A;  2R93 H;  1QNU A;  4BWG B;  4X64 L;  4EGV A;  4DAM A;  3IFD A;  4O2D A;  4QQB X;  1ML0 D;  1QB5 D;  4FXG C;  4LWC A;  1WTP A;  3NBH A;  3PQI A;  4UY8 C;  5JAV A;  3GO5 A;  3OTO Q;  2YTX A;  3GTL H;  1M90 C;  4ZYS A;  1D1I A;  2ZTD A;  3GV6 A;  2UXC L;  4BY7 B;  4DK1 A;  1BDO A;  2NVX B;  1LTI D;  1J5E Q;  2YV5 A;  3CCQ A;  2XN9 C;  2VS1 A;  2KUM A;  2K4K A;  1IBK Q;  1IKM A;  4N8X 1;  4A3E G;  4LF5 L;  5EPK A;  4LFA L;  2OEO A;  3KLR A;  2SNS A;  3URY A;  1AE2 A;  4OO1 G;  4BXX H;  4B3S Q;  3VA5 A;  2B8G A;  1JOO A;  2KBN A;  3K57 A;  1JJ2 A;  2LSS A;  1LTL A;  3ZYY X;  1EY4 A;  1TWA B;  4TRD A;  2VUM G;  1QG7 A;  3Q24 A;  4K8J A;  2WB1 B;  1K28 A;  1HR0 Q;  3CCM A;  1BCP D;  1FNU A;  1CA6 A;  2EYP A;  2L11 A;  1LTG D;  1U4R A;  3PIO A;  2M2L A;  4LW1 A;  2UUA L;  4P71 A;  3DWP A;  3RZO H;  1PDQ A;  1JIC A;  4DR4 L;  3GV3 A;  3MXG A;  2F0W A;  1LYL A;  3BVZ A;  4BY1 G;  4R8N A;  4IPC A;  4MNO A;  2XIW A;  3CME A;  3PF5 A;  4XIG S;  1LV9 A;  1AZQ A;  5L37 A;  1D5M C;  2C35 B;  2IHE A;  4YY3 L;  4DGZ A;  2QW7 A;  3D3R A;  3N6R A;  3OW7 A;  2NUC A;  1BUV T;  3TEH B;  2DNC A;  1HR0 W;  1HFN A;  2UUB L;  4MHE A;  1VMC A;  3PUV A;  3JAM L;  3NQT A;  4A93 B;  1WFQ A;  2K05 A;  3S15 B;  4RHR A;  1JWU D;  2JA9 A;  3NTI A;  2Y0S B;  4WRD A;  1CKM A;  1EY7 A;  2F4V L;  4K5X A;  2LKV A;  4EQP A;  2N8N A;  3RR5 A;  5BR8 L;  2UXB Q;  4BBR G;  3TDQ A;  1O80 A;  2XGT A;  5D3D A;  4XQJ A;  3K80 C;  1VQL A;  2B2V A;  3HOU G;  2ATW A;  1WTV A;  3H94 A;  1TWH B;  2EY5 A;  3H15 A;  3MFG A;  2IW3 A;  1D5Z C;  2E2J B;  4FYD A;  4JI7 Q;  4DNI A;  3P1H A;  4JI8 Q;  4G57 A;  1KDA A;  2EYH A;  3AMU A;  5GAH C;  4YWL A;  3CMA A;  2K6A A;  2NVQ H;  3D4W A;  2FMM A;  4CKB A;  3G71 A;  2PNH A;  5I2X A;  1PYS B;  1WOC A;  1FJG Q;  1BXT A;  5LMU Q;  5D3I B;  1IBM L;  2B63 B;  4CDC C;  3CC2 A;  4Y7N B;  3DM3 A;  1HZ9 A;  1VQP A;  1XXG A;  4R4C A;  4WOR A;  2ALY B;  3D31 A;  1HUM A;  2D2C C;  3E0J A;  3OWE B;  4IPH A;  1QCB D;  4NDX A;  2ES2 A;  1SE3 A;  1PFN A;  1B3A A;  3J81 L;  4JG2 A;  1LLR D;  3PGZ A;  4H44 C;  3S17 B;  2RKS A;  4DV2 Q;  3U9S A;  1YI2 A;  1E0B A;  2EJM A;  3FPP A;  3S16 B;  3I4M B;  4C3I G;  2SNM A;  4ZQ3 A;  2RHS B;  2JA6 B;  3A8J E;  2VQF L;  3GTM B;  4A3I H;  4DF7 A;  4QMG A;  1E7Z A;  5JVG 3;  3BJU A;  5GRO A;  2YU9 H;  4X6A H;  1IW7 D;  1CFM A;  3J81 i;  1B44 D;  2DJG C;  3TME A;  1UAP A;  3HOY B;  4QY7 A;  1KAB A;  1NR2 A;  1EZ8 A;  2AKW B;  4OEL B;  2A6H C;  1QZH A;  1CT1 D;  4BBS H;  4K8I A;  4R9W A;  1H9M A;  1GHK A;  3EIV A;  3RLF A;  3T16 A;  4K5W A;  3NEN A;  1J8I A;  4XXE A;  1FL0 A;  1SNQ A;  3OSO A;  5ELD A;  3ULL A;  1UE1 A;  4CHT B;  4JBJ A;  2UU9 L;  2A8V A;  3GTG B;  3OTO L;  3W2D A;  4LUZ A;  3HOZ B;  2EOT A;  4DUZ Q;  3Q6S A;  1CHQ D;  3QIA A;  5IOD A;  4GOP A;  4FF3 A;  3U9O A;  5LL6 X;  4NMZ A;  3FKI H;  4DKA C;  1WJJ A;  5C4X H;  4FXK C;  1OXX K;  1WD0 A;  5IYC G;  4NXN Q;  4TKO B;  1J5E L;  4A3K H;  1VQ8 A;  4PZ8 A;  3QO2 A;  1A3U A;  1I4R A;  1CHP D;  4JOI A;  2WP8 J;  5JJI A;  1KNE A;  4LJZ C;  1I94 Q;  1D8L A;  5EAY A;  4B3S L;  3WOF A;  1YIJ A;  3S2H B;  3BU2 A;  4DNR B;  1ASY A;  4WJ3 M;  1FD7 D;  4Y52 H;  1UEB A;  4OIK A;  2IPK D;  4PMB A;  4Z9C B;  1JB3 A;  1G8Z D;  5FJ8 H;  4A3G H;  5EKK A;  4ZLT F;  3T51 B;  4DR3 Q;  4HID A;  5KGU A;  2UUC Q;  2NN6 H;  3TQY A;  4UP8 A;  5LMN W;  3C1F A;  2VUM B;  3KDF A;  1K0S A;  3KLS X;  1O7L A;  1X3F A;  5J1Z A;  2CVR A;  2RF4 A;  3DWQ A;  4KN7 C;  5C4J H;  1G6Z A;  2KA7 A;  5IGC A;  4A3B G;  1QUQ A;  1DON A;  1PTO C;  5M5X B;  5IWA L;  5C3X A;  4XQN A;  3GP7 A;  4YWK A;  1PV4 A;  2RCN A;  4BY1 B;  3R93 A;  3S1Q H;  3UDI A;  2JA8 H;  4B9W A;  1LT6 D;  1VMP A;  4FP5 D;  3RMH A;  1Q1B A;  2CH4 A;  2Q2H A;  1W2B A;  1U4L A;  2UXB L;  1DXM A;  4BA1 I;  2NTT A;  1M8A A;  3AQQ A;  4X3T A;  3TZU A;  5I4D A;  3G6E A;  1V1P A;  2HCC A;  2KVM A;  1B2T A;  2Z6K A;  5FKA C;  5IIF A;  3U58 A;  3HKS A;  1Q3L A;  4FVM A;  1Z7T A;  4AH6 A;  4POG A;  1X6O A;  3K5O A;  4OL7 A;  2PMZ E;  3AEV A;  4BBR B;  4JI7 L;  4WFN 3;  5C0X G;  1X3Q A;  5C3E H;  2JXM B;  2AUK A;  1F9Q A;  5C5M A;  1U0L A;  4HSV A;  3HOU B;  2R93 G;  4G7Z C;  1I3Q B;  4M8A A;  3VDY A;  4QB4 A;  1ZXT A;  5DAU A;  5CV7 A;  4LFB Q;  1Q7Y C;  5COR A;  4GNX C;  1JB7 A;  1Q81 C;  4GLV B;  1FJG L;  2B2V C;  1LTA D;  1SJE D;  2VY3 A;  1BBU A;  5BN3 A;  2R6G A;  1K9M C;  4IUR A;  4JCV E;  1VQN A;  2PW7 A;  5IT9 L;  1SBB B;  4LF4 Q;  4C3J B;  1A62 A;  1MI2 A;  3KF8 B;  4A4I A;  1N34 Q;  2K33 A;  2HQE A;  1RTN A;  3K5M A;  3ER0 A;  3W5O A;  4A3J B;  1JOR A;  1X3E A;  4K14 A;  3H0G H;  1B70 B;  2L4N A;  4KV6 A;  2EXZ A;  3SE0 A;  3G4S A;  3EFX D;  2KHI A;  4B3T Q;  1HFG A;  3IKJ A;  4OWX B;  2F0Q A;  2QIL A;  1LO5 D;  3E5S A;  3HZX A;  3IAY A;  4IQZ A;  4C3I B;  1DZ1 A;  1B7Y B;  1KC8 C;  3FRP B;  4K5V A;  2B2U A;  2OTJ A;  3PUY A;  1MD2 D;  1NR4 A;  3IRB A;  1H9J A;  1WTH A;  3KYH C;  5DM6 3;  5IYB H;  1WTR A;  1N36 Q;  4O1N A;  2QKI C;  5EPJ A;  3F2C A;  4BY7 G;  1GM5 A;  1STG A;  1U9R A;  4QGU A;  4DUY Q;  4RGO S;  2B2Y A;  2EXD A;  3I3C A;  4PNY A;  1SEB D;  5ELF A;  3F2B A;  2A69 C;  3BS1 A;  1GUS A;  3Q22 A;  1SND A;  1TY2 A;  1LTT D;  4BS9 A;  3E9H A;  2UXC Q;  1AZP A;  2L5T A;  4A3M G;  2WKC A;  1HXY D;  2PQA A;  2E2D C;  4UDU C;  2K1B A;  4DUZ L;  2B39 A;  4RAU C;  3CC7 A;  2DGY A;  1SMY C;  1XMQ Q;  1F9P A;  1VQE A;  2A68 D;  4HJ8 A;  4E6I A;  2C9O A;  1JT8 A;  4CBV A;  1SYG A;  4OXP A;  4ZAI A;  4NXN L;  4LF5 Q;  5KEE A;  1Y8P B;  1H9R A;  4CGY B;  2E2H H;  2XRQ D;  2QEJ C;  4FDB A;  1I5F A;  5JEA H;  3M3Y H;  5C5L A;  3U4Z A;  3ONA B;  1WTO A;  4IOC A;  2JQO A;  3TP8 A;  2FJ2 A;  2J4X A;  4U68 A;  1QJO A;  1UE6 A;  3J80 E;  3CRL C;  4HMJ A;  5FLM H;  3UDF A;  4TQU S;  3BVG A;  3I90 A;  1ENF A;  4HCS A;  1K83 H;  1TII D;  4L5Q A;  4GOP C;  2JJQ A;  1GUW A;  2UUA Q;  2LXK A;  2F0O A;  3U4V A;  3QR8 A;  2FFK B;  2GVB A;  3SK5 A;  3C3L A;  1ESR A;  4KHP L;  1K8O A;  4DR4 Q;  2N3S A;  1PH4 A;  3SHL A;  4A3L H;  2EYO A;  3KDF B;  2WFW A;  5HGT A;  4X65 Q;  3R3O A;  2HT1 A;  1PZI D;  4JBK A;  3PV0 A;  5M5Y B;  2HD3 A;  1B50 A;  1HRJ A;  1QUQ B;  3V2T A;  1I4H A;  2RDF A;  4S3S A;  4KI0 A;  2H5X A;  4YY3 Q;  1Q82 C;  4JOI C;  4RWS C;  3M4Y A;  1OXT A;  4KD3 A;  1TU2 B;  1WYD A;  1I4G A;  5JJL A;  2GVA A;  3QB3 A;  2PI2 A;  4HR7 B;  3GTP B;  4O42 A;  1KNA A;  1ZKO A;  2OWO A;  3HKZ E;  5KNB A;  2Q2T A;  1SYF A;  3G7L A;  4NP5 A;  4H7B A;  4QCL A;  1WD1 A;  2F4V Q;  2HHH L;  3VR2 A;  5BR8 Q;  1BNZ A;  4KLK A;  3MAQ A;  1XNQ Q;  4A3B B;  2X6G A;  3AFQ A;  3Q0A A;  1LTR D;  2QA4 A;  3IFT A;  5M9O A;  1NAP A;  1NBW A;  2R7Z H;  1PRT C;  3UE0 A;  1GJX A;  4A3I G;  3GTJ H;  1FGB D;  1O7Y A;  3CD6 A;  3K7A B;  3UDG A;  4B3M Q;  3DM1 A;  1BCP C;  4JC0 A;  4QIW E;  5CBA E;  2F0U A;  4BA2 I;  2F0D A;  2F3W A;  3M85 A;  4ZK9 B;  3OHX C;  4OWT B;  3HGB A;  5IE8 A;  1E24 A;  1YNJ D;  3JAM E;  3KLW A;  3STB D;  1GO3 E;  1LT4 D;  2PMZ B;  1NMG A;  2N55 A;  1STA A;  4OON A;  3RLN A;  3VYT A;  4DV1 Q;  1EFW A;  4J15 A;  1IL2 A;  4BBS G;  4GZY C;  4LFB L;  1LT3 D;  3S1N H;  3J7A F;  3L3O C;  4DFA A;  4X3K A;  3D4R A;  4QF4 A;  5K5P A;  1STN A;  2EIF A;  2IJ0 A;  2F0T A;  2AQ3 B;  2R93 B;  4IJL A;  2H1E A;  4UPA A;  1BF4 A;  3PO2 H;  1A0I A;  2QCP X;  1E1T A;  2UXD Q;  4KTA A;  4LF4 L;  4RCO A;  4P2C B;  1N34 L;  3K7U C;  2ZTC A;  1HA5 A;  1BO0 A;  1STY A;  2YTY A;  3P7J A;  4Q0F A;  5C4X G;  4JBW A;  1DGS A;  1M4V A;  1C7Y A;  4OHJ A;  1NUC A;  5IP9 H;  4IJH A;  3M9B A;  4A3K G;  2MQH A;  2DJF C;  2K01 A;  2L55 A;  1L0Y B;  2JA7 H;  4AIM A;  4YCW A;  2VQF Q;  3GTL B;  4L6T B;  5DNF A;  1X3P A;  2RQX A;  4DV7 Q;  3NBI A;  3VR3 A;  3J7A 5;  1TS2 A;  5CMD A;  2M00 A;  1L0W A;  4C1N I;  4B9X A;  1ASZ A;  4JI5 Q;  3GTQ H;  2PW5 A;  2Z4H A;  1VQ6 A;  2JP1 A;  3D8G A;  1ET9 A;  3HOV G;  4LF9 L;  3NUC A;  2EYJ A;  4XYO A;  3MFY A;  2HCI A;  3HOZ G;  1X56 A;  2DY8 A;  1J9O A;  1VQJ A;  1PTO F;  1N36 L;  3CPF A;  1XPR A;  1KD1 C;  3DWA A;  4NKL A;  2K5W A;  4DUY L;  2CW0 D;  4KKU A;  2F0H A;  4J1M A;  2UU9 Q;  4A3F H;  1YBY A;  2PQA B;  1XNR L;  3RZD H;  3PIP 3;  3RZO B;  1FR3 A;  3G48 A;  3R8B A;  5A2Q L;  3SXH A;  1N32 Q;  1B9N A;  5I9P A;  4C2M H;  1Y1W H;  1XMQ L;  2F0V A;  4IOA A;  3M4O H;  1NMF A;  1Y1V H;  3EA6 A;  2F03 A;  1AW7 A;  4HJ9 A;  4C1N K;  3CCE A;  5M3F H;  3KFU A;  4CKC A;  4A3M B;  1WI5 A;  3BZD B;  3K6O A;  4IUQ A;  1CI3 M;  5KYI A;  4NB3 A;  2RVL A;  2R3Z A;  4IUT A;  1VCI A;  1SFO B;  5JPM C;  4XDX A;  3KF6 A;  4H0L C;  4H02 A;  2RDG A;  2OCE A;  1MJE A;  1CA5 A;  1IKL A;  3S1R H;  2I46 A;  5C3E G;  4IUU A;  1ILQ A;  2LY7 A;  4EX5 A;  2WIN B;  3KK7 A;  4Q5V A;  2A5H A;  1S5B D;  1EYG A;  3KBG A;  4EQN A;  1CZG A;  4X65 L;  1B9M A;  3QWN A;  1A2U A;  2PYK A;  1EY6 A;  3HOW H;  2F3I A;  2PPB C;  2O5J C;  4OEM B;  5IWA Q;  1GXD C;  3PO3 H;  2CQA A;  2NVQ B;  1TWC H;  1X3G A;  3GQB A;  1M1K C;  3HFZ B;  4WJ4 A;  3BZK A;  1WVL A;  2VZA A;  4DN4 M;  3VA7 A;  2Z1C A;  3T53 B;  2BOS A;  2X6L A;  2G9D A;  2R92 G;  4RCN A;  5CGK A;  1XPU A;  1QE6 A;  3CCR A;  3H09 A;  1XNQ L;  3FPU B;  1HTP A;  3ULP A;  2IWH A;  1CM9 A;  2E76 C;  1HPC A;  3H0G G;  3HOX H;  3ERO A;  1B1Z A;  3MA2 B;  4NXM Q;  2SOB A;  4IFD H;  2F1M A;  1QNK A;  3OIQ A;  4CKE A;  3EJI A;  1N33 Q;  1LUZ A;  2EYM A;  1XPO A;  1JMC A;  5IP7 H;  4B3M L;  3K5N A;  2D0O A;  3S2D H;  1RJT A;  2QDB A;  1YVC A;  4IUN A;  3MEF A;  4ME3 A;  4A3I B;  1YNN D;  5IYB G;  1EFI D;  2OXP A;  4C3J G;  4DV1 L;  5IGG A;  4P74 A;  5COY A;  1NCV A;  2EY6 A;  1EIF A;  5CBE E;  3TS0 A;  4A3D H;  1E2Z A;  4B3R Q;  1EWC A;  4XT3 B;  4X66 Q;  4A3J G;  4V0B A;  1HZA A;  4HED A;  5M5W H;  3RNU A;  4GKJ L;  3DUZ A;  3NK9 A;  1HNZ Q;  3CKI B;  1I6H B;  5CYU A;  4JI1 L;  4BBS B;  5C44 H;  2Q8I B;  3M4Q A;  2L0C A;  4FXD A;  2UXD L;  1RD9 D;  3K59 A;  3KF8 A;  2B2T A;  2MUY A;  1ROD A;  3U50 C;  4LF6 L;  1PLF A;  3ICE A;  1JQY D;  1ONL A;  5J39 A;  1TS3 A;  2CQO A;  4IPG A;  5HGQ A;  1EQR A;  4DV7 L;  3H91 A;  3FKI B;  4ID6 A;  2H4O A;  5C4X B;  3CAM A;  1BQQ T;  4HJA A;  4AQY Q;  5FLM G;  1CSQ A;  1Q90 A;  2ICI A;  2ZM6 Q;  4RKB A;  4JI5 L;  3D0F A;  4A3K B;  3I4O A;  3WWV A;  3NEL A;  3X3M A;  1CKO A;  4IUP A;  2R61 A;  1MGS A;  2CHB D;  5IT9 E;  2Q8T A;  3OWF A;  1ILP A;  1II3 A;  5KNC A;  4A3L G;  3Q8D A;  1KQS A;  4OO1 I;  1CUK A;  1CZW A;  3MEH A;  4HAE A;  1SN8 A;  4J8Q A;  4LMQ D;  4KKS A;  4JI0 Q;  3L9A X;  4K0K L;  5CV6 A;  3ERS X;  4UP9 A;  4A3G B;  1Y14 B;  3D4D A;  4DR1 Q;  4IUV A;  3HOV B;  1G51 A;  2JYO A;  5EKL A;  3V96 A;  2KCN A;  2VQE Q;  1FYC A;  3EVQ A;  3NP8 A;  3T1H Q;  2HIX A;  4L63 B;  4UAI A;  1TWF H;  4XTC S;  4ZCK A;  4DAY B;  3CPW A;  1N32 L;  5EJW A;  5AJ3 Q;  2R7D A;  2GN5 A;  4R4I A;  1HJP A;  1PRT F;  5ISR A;  1NY4 A;  2CWP A;  5C4J B;  2N78 A;  2OT2 A;  4HN7 A;  4YWM A;  3WDN A;  3J80 c;  3I4M H;  1WTX A;  2CFM A;  4KKT A;  2XRS D;  1OTC A;  1NTG A;  1BCP F;  1SNC A;  2JA6 H;  2D5D A;  3T1Y L;  2N49 A;  4PZ7 A;  2VNU D;  3KF6 B;  3CW2 C;  1TQO A;  3A8K E;  2IX3 A;  1B53 A;  3S1Q B;  3BG3 A;  2JA8 B;  1JWS D;  3TRE A;  4ILW A;  2NVY B;  5JJK A;  1WCM H;  4MN3 A;  2WAQ E;  1VDZ A;  1RCV D;  1W3S A;  5ELC A;  4KHP Q;  4DR6 Q;  3K0Y A;  5EBD A;  1VQH A;  1W6J A;  5G3L F;  1RTO A;  3A0J A;  3W3A A;  3PUX A;  1GUO A;  3NWT A;  1Q12 A;  1PMR A;  2QGQ A;  1PH2 A;  1CQV A;  2GA4 B;  4JI6 Q;  3PIO 3;  5C0X J;  1EEF D;  5F2D A;  4QJF A;  1IHZ A;  2JSO A;  5C3E B;  2MP1 A;  1PZJ D;  1SE4 A;  1UE7 A;  4LK1 C;  2IL8 A;  5E1F A;  3ZJY C;  1PXU A;  1RKN A;  2MPM A;  3BVM A;  3PO2 G;  1DD2 A;  3SK8 A;  2A68 C;  2CH4 W;  2HHH Q;  3CCS A;  1STE A;  1TWG H;  1Z9F A;  1Q46 A;  3SGI A;  3GTO H;  2JA5 H;  1HUN A;  3KUP A;  3OIP A;  5IP9 G;  1EEI D;  1XJV A;  1GUG A;  1X54 A;  2JA7 G;  1MJC A;  1ZEQ X;  2K7V A;  1Z6H A;  1KXL A;  2TSS A;  1K0R A;  1PTO H;  3D6C A;  1YIT A;  2N88 A;  1JCK B;  1CSP A;  4NXM L;  3BYT B;  4A75 A;  2R92 B;  1A63 A;  3J81 j;  4HJ7 A;  1N33 L;  3E9I A;  4MIU A;  2AWO A;  4A3E H;  1L1O A;  1BKB A;  5EGT A;  3H0G B;  4JW0 A;  2YTV A;  2NBF A;  1C9O A;  4LFC Q;  4YCV A;  3VYU A;  2MGS A;  3LNN A;  1F2L A;  3IL8 A;  4F87 A;  1EY9 A;  1B8A A;  3LWU A;  3ULJ A;  2NYZ D;  3L2P A;  5GAG C;  4B3R L;  2F3V A;  3I91 A;  4X66 L;  4A3F G;  3W1B A;  1VQC A;  5EKI A;  4F88 A;  1T5X D;  3KOJ A;  1DOL A;  1F77 A;  3HRZ C;  4KY7 A;  1HNZ L;  1HZC A;  1PFM A;  2IX1 A;  3FMC A;  5I6Y A;  1ESF A;  2XWB B;  5CV9 A;  2HDM A;  3PCO B;  4I7Z C;  1I4Q A;  4RG1 A;  4L8J A;  1CTM A;  3NHH A;  1MKH A;  3MWY W;  1WTW A;  2NVT H;  4P75 A;  1YEZ A;  3SK4 A;  5HY6 A;  5M3F G;  3DHQ A;  1MIU A;  3F2U A;  4MTK A;  1V43 A;  3NQI A;  1PZK D;  4BXX G;  1TVX A;  5JVH 3;  4DAP A;  4YIJ A;  1A3V A;  4CJ0 B;  4AQY L;  2ZM6 L;  3VR5 A;  4LF9 Q;  5M3M H;  1YJW A;  2MJ8 A;  3MZ5 A;  1GD7 A;  2F0I A;  4JI3 L;  4JYA Q;  2KQ3 A;  3M3Y B;  3STB C;  3T56 B;  1I3Q H;  3TN2 A;  4F8M A;  1P16 A;  4LF8 Q;  1EU4 A;  5FLX E;  1H95 A;  1LAB A;  1YHB A;  1D6E C;  3S9W A;  1AFP A;  2ZXP A;  4LF7 Q;  4JVZ A;  4JI0 L;  1D2B A;  1K83 B;  2A73 B;  2Z4I A;  1C0A A;  1EOT A;  1XNR Q;  3W1G A;  2I5H A;  3GTK H;  4UHV A;  4DR1 L;  1KRT A;  2YYZ A;  1EQT A;  2Q2U A;  3PO3 G;  1HH2 P;  2VQE L;  1G6P A;  3T1H L;  1KDC A;  1JE4 A;  4JI4 L;  1DM0 B;  4X3S A;  4R8I A;  1EL0 A;  4OGQ C;  1HNW L;  5AJ3 L;  3F8T A;  4RHS A;  1UE5 A;  4X62 Q;  3R2I A;  2QF7 A;  4IZ8 A;  4ZUI A;  3A74 A;  3HOX G;  1S5D D;  2L12 A;  5KYL A;  2F0P A;  4HIM A;  2JN4 A;  5J22 A;  4IO9 A;  1IXR A;  2EY2 A;  3P20 A;  1HZB A;  1PA6 A;  5IOC A;  1VQO A;  4DV4 Q;  5I2Y A;  3K81 C;  2ICE C;  3I4N H;  3ITP A;  5CV4 A;  1YNX A;  2XSC A;  1IZ6 A;  4RGM A;  4JI2 Q;  1QWY A;  5A2Q E;  2A6E D;  1IBL Q;  2F0G A;  4PMC A;  1QVF A;  1G29 1;  3C46 A;  4DR6 L;  2G9H D;  4I7A A;  1WTQ A;  2BDO A;  2WB1 E;  2K14 A;  1TY0 A;  1K3B C;  3GTJ B;  1D5X C;  2G5D A;  2PZU A;  4DV3 Q;  3WOE A;  2QEX A;  1KL9 A;  1QVC A;  4JI6 L;  1MBY A;  1UWV A;  4APV A;  5H1S E;  1UUP A;  3H3V I;  4ODG A;  4A3D G;  1SAP A;  1SSO A;  3HKZ G;  5C0X I;  4DK0 A;  4KHV A;  5GAE C;  4R4O A;  1EQV A;  4P73 A;  4K2K A;  2VW9 A;  3S1N B;  2JK8 A;  3S1M H;  5NUC A;  1T5E A;  2FXQ A;  3AU7 A;  1VQD A;  1S5F D;  1G2S A;  1G2T A;  1CKN B;  4DPG A;  1H9S B;  3PO2 B;  4CDE C;  5CV8 A;  4L5R C;  1EIY B;  5IGD A;  4OX9 Q;  3R2T A;  1L1O B;  5IYC H;  1A15 A;  1PH1 A;  5DM7 3;  2XTI A;  3K8A A;  4R4T A;  1FNV A;  3CQZ H;  2LS0 1;  1I4P A;  1B3Q A;  1MSH A;  2KCC A;  2JA7 B;  2XVS A;  1O7Z A;  3CXC A;  1VF7 A;  1E2W A;  4JK1 C;  4LFC L;  1EY5 A;  3T4A C;  1RIP A;  2VB2 X;  1AE3 A;  1EIG A;  2K5D A;  4G7O C;  3GTQ B;  4LUV A;  1I50 H;  2NZH A;  1E2V A;  3B6Y A;  2IY5 B;  1KLU D;  3A7L A;  4MTN A;  2ZXO A;  4OIJ A;  2Z6K C;  4GKJ Q;  2PCF B;  4JI1 Q;  2K28 A;  4F7X A;  4GKK L;  4IPD A;  1R9T H;  1N8R C;  3P75 A;  2E5L L;  5KIX A;  2WKD A;  3FKI G;  5IGB A;  5BN5 A;  1SE8 A;  4LF6 Q;  3FP9 A;  4FF2 A;  5IYD H;  1Q8K A;  3K58 A;  1XWE A;  1KAA A;  4DV5 Q;  2BA1 A;  3JC6 6;  4A3F B;  3M7G A;  2MNA A;  2Z8L A;  3RZD B;  1EQQ A;  2EJF C;  2PZW A;  1S3O A;  4CDF C;  4C2M B;  1NNX A;  5IY0 A;  4PQX A;  4DV0 L;  1PH5 A;  1Y1W B;  1O7I A;  4JV5 Q;  3H3V C;  2BA0 A;  3OPO A;  2PNR C;  2K52 A;  2B8F A;  3M4O B;  1JOQ A;  1SNP A;  1Y1V B;  1SE2 A;  2F0E A;  1WCM G;  2CCZ A;  5FJ8 G;  1A2T A;  5M3F B;  4A3G G;  4R1J A;  2EVB A;  4JYA L;  3J81 E;  1A3T A;  2NN6 G;  1FVI A;  5LHY 1;  4LF8 L;  2B29 A;  1PH3 A;  1OO9 B;  1GKH A;  3OOC A;  1PH6 A;  4K0K Q;  4LF7 L;  3I55 A;  4C3H H;  1W6K A;  3S1R B;  4KY5 A;  1JJC B;  1IYJ B;  2AWN A;  4HCE A;  1UEA B;  1U4M A;  2MFI A;  2B2W A;  1E22 A;  2JA8 G;  3HOW B;  2B2U C;  3J80 L;  4DAY A;  4A3C H;  1Y8O B;  2Z0S A;  2E2I H;  2JA5 G;  4X62 L;  2FIN B;  3PO3 B;  3T1Y Q;  2EYL A;  3A7A B;  1TWC B;  1SRO A;  2B2Y C;  3A55 A;  2K32 A;  4HMI A;  3CRK C;  1EY8 A;  3DEO A;  2E75 C;  3GDE A;  2LXJ A;  4KHZ A;  3MC0 B;  1XMO Q;  2MHV A;  1IW7 C;  1QIL A;  1GUN A;  4DV4 L;  4QUC A;  4JBM A;  2Q8R E;  2NZ1 D;  3OMG A;  3S14 H;  2EY1 A;  3J80 i;  4GN4 B;  4JI2 L;  3CC4 A;  3HOX B;  2NZO A;  1VF5 C;  2F4I A;  3CF5 A;  1IBL L;  4IN3 A;  5DLQ E;  2O2L D;  1BBX C;  1PRT D;  3NTK A;  4DXF A;  1GUT A;  1SYE A;  4DV3 L;  4U67 3;  1KAW A;  3DXJ C;  1ZYR D;  2NWG A;  3TRZ A;  2Z9H A;  1LTS D;  1UNS A;  4KMU C;  3KJP A;  4XT1 B;  1RHP A;  2ZJQ A;  1IL8 A;  2BH8 A;  1CQF A;  2Q2I A;  4OWW B;  3S2D B;  4L5T A;  3NPP A;  4DR7 Q;  5TSS A;  3UE1 A;  1EY0 A;  1K8G A;  4BY7 H;  2K50 A;  1KIX A;  2PO4 A;  2NVX H;  4G4K A;  2TMP A;  4DR5 Q;  5ELB A;  3BYY B;  2F0F A;  4A3D B;  3HKZ B;  1HTL D;  1IYV A;  1YJN A;  4ME5 A;  5G3L D;  3PSI A;  5M5W B;  4A3M H;  4DV6 Q;  1TS5 A;  1OXS C;  5I6W A;  5C44 B;  1EWI A;  4V19 0;  5K36 H;  4RFB A;  5J3B A;  2OQ0 A;  1H9K A;  1SFO H;  4OX9 L;  1TWA H;  3K0X A;  2ID0 A;  3J7A V;  2DUD A;  4GNX A;  5FO9 B;  2WV6 D;  5E4X A;  5M3M G;  1YJ9 A;  5JEA J;  1SYD A;  4G7H C;  1V8Q A;  5ELN A;  1LM0 A;  4QIW B;  4B08 A;  4DK3 C;  2V4D A;  3C2P A;  2YU9 B;  4CDD C;  3QOJ A;  1F2Y A;  2MO0 A;  5E3F A;  4HIO A;  4RH6 A;  1ICF B;  3JAM i;  3NTH A;  2AHO B;  1DJR D;  1SNO A;  2AQ2 B;  3VYS A;  2BE5 D;  1BVS A;  1HQR D;  5HUR A;  1NE3 A;  3CHB D;  2M9V A;  3NE5 B;  1RL2 A;  3I70 A;  3MVV A;  1KHI A;  3TBI B;  2NN6 I;  4A93 H;  3RUZ A;  2DY7 A;  3BDO A;  3MXP A;  3MTS A;  3S15 H;  3EN2 A;  3OYY A;  3TP7 A;  2ZXR A;  1FGU A;  5E4W C;  4DV5 L;  2JEB I;  3RLO A;  2ZT9 C;  3PF4 A;  2K5V A;  5AFW A;  5JEA G;  4KK7 A;  2KOL A;  2RSN A;  3Q23 A;  1FNW A;  3DMU A;  1TWF B;  1TWH H;  1GOZ A;  1DCZ A;  5E7N A;  1S40 A;  4JV5 L;  2E2J H;  5FLX c;  2V1C C;  3I4N G;  4JI3 Q;  3HG9 A;  4KY6 A;  1ICW A;  3MXN A;  5JOB A;  5D14 A;  1XTD A;  1SYC A;  2MO1 A;  2PZT A;  3RN2 A;  1HNX Q;  1VQ5 A;  3HP3 A;  1EWH A;  3CU7 A;  1BOS A;  1G91 A;  1XYI A;  1SRU A;  1WCM B;  1KDB A;  1SXT A;  2B63 H;  2EYF A;  2O5I C;  2E8G A;  1AH9 A;  4Y7N H;  3F2D A;  3NSW A;  1X9N A;  1XX8 A;  2P5Z X;  3FDT A;  4GLX A;  1SNM A;  1SYB A;  3RD4 A;  1K3R A;  1I6H H;  1PH9 A;  4JI4 Q;  3UI2 A;  2K75 A;  1EYC A;  1HNW Q;  3NBH B;  4PV1 C;  2ZTE A;  2VB3 X;  2C5C A;  4N8F A;  1DOK A;  3RN5 A;  3S17 H;  2OQK A;  3CCL A;  4RGT A;  1STH A;  3S16 H;  4XQQ A;  3D6W A;  3E3X A;  1VQ9 A;  1U4P A;  2I07 B;  2XNA C;  2I0Q A;  4DXG A;  1LAC A;  1Y69 U;  5DEH A;  2XWJ B;  2WAQ G;  3GTM H;  4IAL A;  2R7Z G;  1I6V C;  1TWG B;  3T13 A;  1XMO L;  3AYH B;  3I72 A;  4K6L A;  3PUW A;  5KND A;  3GTO B;  2JA5 B;  2A1A A;  2F0N A;  1RF2 D;  3TS2 A;  3TP6 A;  4DK6 C;  1R4P B;  1IBK L;  3HOY H;  4NW2 A;  1PFS A;  4POF A;  2B2W C;  5LMN Q;  1PTO B;  2WII B;  2JEA I;  4H13 C;  3MXU A;  2ASB A;  2ZJP A;  4HJ5 A;  3OMC A;  3A8I E;  5FOB B;  2KHJ A;  1EZ6 A;  1B4O A;  4R4Q A;  4A3E B;  3HOV H;  3ND8 A;  1HR0 L;  3BZC A;  3BDL A;  4K6D A;  3GTG H;  4GN5 A;  3HOZ H;  1AP0 A;  2NTS A;  2EQS A;  4DR7 L;  1PHJ A;  1S5C D;  1R4Q B;  1X65 A;  1JC7 A;  2E74 C;  1MHW C;  1C8C A;  4GS3 A;  1E3P A;  4DR5 L;  3NXW A;  1X32 A;  5IYD G;  1EUJ A;  4PMW A;  1K73 C;  1SDF A;  1TT2 A;  2DN8 A;  2VL6 A;  1CKN A;  2SEB D;  4UP7 A;  3SVM A;  4DV6 L;  2HQL A;  5KRU A;  1H9S A;  4N9T A;  1GHJ A;  3I73 A;  1PH8 A;  3I56 A;  3S2H H;  1LTB D;  1JOK A;  2HUG A;  2NB0 A;  3JAM c;  4GNX B;  2NVY H;  1TS4 A;  5GQO A;  4KN4 C;  3E6Z X;  2K03 A;  2NVT B;  1KRS A;  2A6E C;  2ENB A;  3A5U A;  4ULL A;  1VQA A;  1QZG A;  4OO1 H;  3TP5 A;  1TKW B;  2RA4 A;  2O4X A;  2D62 A;  3A5Z B;  4QUF A;  2VUM H;  1E1O A;  2IT1 A;  4RA8 A;  1NJI C;  1CK1 A;  3KBX A;  5M3M B;  3CCJ A;  3L7Z C;  4JI8 L;  3J7Y W;  1SR3 A;  5A35 A;  3VYR A;  1GVP A;  4C3H G;  4GKK Q;  3I2Z A;  5M5X H;  1S5E D;  2FHT A;  2KJX A;  1VQF A;  1ET6 A;  1MSG A;  5BN4 A;  2A6H D;  2E5L Q;  4DR2 Q;  4BY1 H;  1OXU A;  2AMC B;  3FHW A;  5I9O A;  1F9R A;  3PMF A;  5C6A A;  2EJG C;  1Y1W G;  4AYB G;  5FO8 B;  1KTK A;  3G6J B;  2KEC A;  4YHH Q;  3KLS A;  5LMU L;  1Y1V G;  2F0S A;  4A3C G;  5ELE A;  1TR5 A;  1X55 A;  1YHA A;  3GTK B;  2PQE A;  1DYQ A;  4EVO A;  4AYB E;  1OXV A;  2F0K A;  1NSN S;  2JE6 I;  1BBW A;  2ZJR A;  3I4L A;  2F52 A;  3HEJ A;  1F2Z A;  3AFP A;  1VS0 A;  2BH2 A;  5CV5 A;  3KJO A;  4DV0 Q;  3EQL C;  4KJO A;  1EOV A;  1VQM A;  2X69 A;  2R92 H;  3MXN B;  1P8L A;  3J81 c;  3F1Z A;  3C1E A;  2R7F A;  5C3W A;  2J7Z A;  1SLJ A;  4DV2 L;  4BBR H;  3CCU A;  2E2H B;  4N9P A;  2K5H A;  2LMC B;  2LFN A;  1YNJ C;  3HOU H;  3HS0 C;  3O13 A;  3SDZ A;  1HA6 A;  4IFD J;  2K5Q A;  1YHQ A;  1SJH D;  2B2T C;  1HNX L;  1V1Q A;  2D9U A;  4ZRZ A;  1C48 A;  2K5N A;  4PZ6 A;  5IGF A;  4FF4 A;  1JWM D;  3HOW G;  3I4N B;  5T1G A;  3X3N A;  5D65 A;  4HTH A;  4X64 Q;  3SEB A;  4DAV A;  3M4P A;  1EYD A;  1PYW D;  5IGE A;  4WJW A;  2L9H A;  4C3J H;  2HDL A;  1JJG A;  2DNE A;  3PIP A;  2RHQ B;  3SK6 A;  5CC4 A;  4L5S A;  1XTC D;  3V05 A;  4HSP A;  4RMF A;  4A3J H;  3FEW X;  2A74 C;  1D7Q A;  4GN3 B;  1QOH A;  4GOP B;  2VXW A;  5EBC A;  4ZUJ A;  1PTO D;  2IX0 A;  5C4H A;  4FF1 A;  3A54 A;  2B3G A;  4LNQ A;  4DNT B;  4IFD G;  4ABN A;  4MZ9 A;  1PH7 A;  5K36 G;  1VQB A;  4P72 A;  4LUO A;  3S1M B;  3QJY A;  3M7N A;  4C3I H;  3I7F A;  4LFA Q;  1Q1E A;  2WB1 G;  5IP7 G;  1F2M A;  1K8A C;  5CR3 A;  5FO7 B;  1DOM A;  2KCT A;  2WAQ B;  5JJZ A;  4PG3 A;  5LMN L;  2R7Z B;  4TVA B;  1I94 L;  2CW0 C;  1JR0 D;  1EYA A;  2EE1 A;  3J7Z C;  1C4Q A;  4ALP A;  3CQZ B;  3FVQ A;  1HHV A;  2L15 A;  4YCU A;  1EU3 A;  1A8V A;  4TSS A;  2BCO A;  3DEP A;  2EZV A;  5FK9 C;  1F9S A;  1A6X A;  4DR3 L;  4LAA A;  1L0X B;  2UUC L;  2FMC A;  4JPB W;  5C44 G;  1PRT B;  2PI2 E;  3A56 A;  3QOL A;  3NEM A;  4A93 G;  2OF1 A;  5LL6 S;  1J6Q A;  3VR6 A;  1I50 B;  2KED A;  3ND9 A;  4EQ5 A;  2Y0S G;  4ZKC B;  3NWS A;  1U5K A;  2I5M X;  1BCP B;  5EQ0 A;  1VQK A;  1QVG A;  5ELO A;  3VR4 A;  2UUB Q;  3K5L A;  2Y0S E;  1YZ6 A;  1R9T B;  1L2F A;  2KEN A;  5GAD C;  1V1O A;  3TZD A;  3E0E A;  3CCV A;  1LT5 D;  4KJN A;  2WAC A;  1HCZ A;  5JPN C;  3SR1 A;  1PFB A;  1PVO A;  1V1P B;  3EBE A;  2RCF A;  2Z6B A;  2KEE A;  1O78 A;  1T9H A;  2F0M A;  4QL5 A;  1JE5 A;  4M1U B;  2BDN A;  3DLL A;  5M5Y H;  1KLG D;  3ERQ A;  1PYB A;  2CWA A;  1ZYR C;  3BDC A;  3GD7 A;  2A19 A;  1VQG A;  2B63 G;  1HQM C;  4CJ2 C;  2AQ1 B;  2SDF A;  2CKZ B;  1K8M A;  2RDH A;  2KHS A;  3MHB A;  3CP0 A;  2QDL A;  1ENC A;  4XYQ A;  2RBM A;  3OW2 A;  4KD4 A;  1AN8 A;  3LX0 A;  1S72 A;  3GTP H;  3H6M A;  4RKL A;  4DR2 L;  1L1O C;  4RGN A;  2I5L X;  1IYU A;  1IBM Q;  2KCM A;  2IHF A;  4J6H A;  2AUJ D;  4A3B H;  2EPB A;  4DU9 A;  4EQO A;  2L1B A;  1BR9 A;  2K04 A;  4K2L A;  1SMX A;  5T1I A;  2A69 D;  4C3H B;  4YHH L;  4I65 A;  1Q8I A;  3I4M G;  3LWE A;  3UDX A;  1Q86 C;  1Y8N B;  4ZKB B;  2JA6 G;  2F0L A;  1VQ7 A;  1D1K A;  2RSO A;  3N52 A;  5IT9 c;  1SMY D;  4AYB B;  4HIK A;  5FLX L;  1RDP D;  1I4X A;  5C4Z A;  4O0A A;  3K7A H;  3PUZ A;  2F0J A;  2E2I B;  2HIV A;  1TXY A;  3AB9 A;  3LGJ A;  1STB A;  3I8Z A; 
#chains in the Genus database with same CATH homology
 1ENA A;  1AEX A;  4C56 C;  4X3U A;  4CJ1 B;  1YNN C;  4FNF A;  1Z47 A;  4IFD I;  2J0T D;  3QG1 A;  4FO2 A;  5EPL A;  1S4Z A;  3TSS A;  1EIH A;  5C0X H;  4DA2 A;  3S14 B;  2BE5 C;  2EDG A;  1QNU A;  4BWG B;  4EGV A;  3IFD A;  1ML0 D;  1QB5 D;  4FXG C;  1WTP A;  3NBH A;  5JAV A;  3GO5 A;  4ZYS A;  1D1I A;  3GV6 A;  4BY7 B;  4DK1 A;  1BDO A;  2NVX B;  1LTI D;  2XN9 C;  2KUM A;  1IKM A;  5EPK A;  2OEO A;  3KLR A;  2SNS A;  3URY A;  4OO1 G;  3VA5 A;  2B8G A;  1JOO A;  3K57 A;  3ZYY X;  1EY4 A;  1TWA B;  4TRD A;  1QG7 A;  3Q24 A;  4K8J A;  2WB1 B;  1BCP D;  1FNU A;  1CA6 A;  2EYP A;  2L11 A;  1LTG D;  1U4R A;  2M2L A;  3DWP A;  1PDQ A;  1JIC A;  3GV3 A;  3MXG A;  2F0W A;  3BVZ A;  4R8N A;  2XIW A;  4XIG S;  1LV9 A;  1AZQ A;  1D5M C;  4DGZ A;  3N6R A;  3D3R A;  3OW7 A;  2NUC A;  1BUV T;  2DNC A;  1HFN A;  4MHE A;  1VMC A;  3PUV A;  3JAM L;  3NQT A;  4A93 B;  2K05 A;  3S15 B;  4RHR A;  1JWU D;  3NTI A;  2Y0S B;  4WRD A;  1EY7 A;  4K5X A;  2LKV A;  4EQP A;  3TDQ A;  1O80 A;  5D3D A;  4XQJ A;  2B2V A;  1WTV A;  3H94 A;  1TWH B;  2EY5 A;  3MFG A;  2IW3 A;  1D5Z C;  2E2J B;  4FYD A;  3P1H A;  4G57 A;  1KDA A;  2EYH A;  3AMU A;  2K6A A;  3D4W A;  2FMM A;  4CKB A;  5I2X A;  1BXT A;  5D3I B;  2B63 B;  4Y7N B;  1XXG A;  4WOR A;  3D31 A;  1HUM A;  2D2C C;  3E0J A;  3OWE B;  4NDX A;  1QCB D;  1SE3 A;  1PFN A;  1B3A A;  3J81 L;  1LLR D;  4H44 C;  3S17 B;  2RKS A;  3U9S A;  1E0B A;  2EJM A;  3FPP A;  3S16 B;  3I4M B;  4C3I G;  2SNM A;  4ZQ3 A;  2JA6 B;  3A8J E;  3GTM B;  4DF7 A;  4QMG A;  5JVG 3;  1IW7 D;  1CFM A;  1B44 D;  3TME A;  1UAP A;  3HOY B;  1KAB A;  1NR2 A;  1EZ8 A;  2A6H C;  1CT1 D;  4K8I A;  4R9W A;  1H9M A;  1GHK A;  3RLF A;  3T16 A;  4K5W A;  1J8I A;  4XXE A;  1SNQ A;  3OSO A;  5ELD A;  4CHT B;  3GTG B;  3W2D A;  3HOZ B;  2EOT A;  3Q6S A;  1CHQ D;  3QIA A;  5IOD A;  4FF3 A;  3U9O A;  5LL6 X;  4NMZ A;  4FXK C;  1OXX K;  1WD0 A;  4TKO B;  3QO2 A;  1A3U A;  1I4R A;  1CHP D;  2WP8 J;  1KNE A;  4LJZ C;  3WOF A;  3S2H B;  4DNR B;  1FD7 D;  4OIK A;  2IPK D;  4PMB A;  4Z9C B;  1JB3 A;  1G8Z D;  5EKK A;  4ZLT F;  3T51 B;  5KGU A;  2NN6 H;  3C1F A;  2VUM B;  3KLS X;  1O7L A;  5J1Z A;  2CVR A;  3DWQ A;  4KN7 C;  1G6Z A;  2KA7 A;  5IGC A;  1DON A;  1PTO C;  5M5X B;  5C3X A;  4XQN A;  3GP7 A;  4BY1 B;  3R93 A;  4B9W A;  1LT6 D;  1VMP A;  4FP5 D;  3RMH A;  1Q1B A;  1U4L A;  1DXM A;  4BA1 I;  2NTT A;  1M8A A;  4X3T A;  3TZU A;  5I4D A;  1V1P A;  2HCC A;  2KVM A;  1B2T A;  5FKA C;  5IIF A;  1Q3L A;  4FVM A;  1Z7T A;  3K5O A;  4OL7 A;  4BBR B;  4WFN 3;  5C0X G;  1X3Q A;  2JXM B;  2AUK A;  1F9Q A;  5C5M A;  4HSV A;  3HOU B;  4G7Z C;  1I3Q B;  4M8A A;  4QB4 A;  1ZXT A;  5DAU A;  5CV7 A;  5COR A;  2B2V C;  1LTA D;  1SJE D;  5BN3 A;  2R6G A;  4IUR A;  2PW7 A;  5IT9 L;  1SBB B;  4C3J B;  1MI2 A;  2K33 A;  2HQE A;  1RTN A;  3K5M A;  4A3J B;  1JOR A;  4K14 A;  2L4N A;  4KV6 A;  2EXZ A;  3SE0 A;  3EFX D;  1HFG A;  3IKJ A;  2F0Q A;  2QIL A;  1LO5 D;  3E5S A;  3HZX A;  3IAY A;  4IQZ A;  4C3I B;  1DZ1 A;  3FRP B;  4K5V A;  2B2U A;  3PUY A;  1MD2 D;  1NR4 A;  1H9J A;  5DM6 3;  1WTR A;  4O1N A;  2QKI C;  5EPJ A;  1STG A;  1U9R A;  4RGO S;  2B2Y A;  3I3C A;  4PNY A;  1SEB D;  5ELF A;  2A69 C;  3BS1 A;  1GUS A;  3Q22 A;  1SND A;  1TY2 A;  1LTT D;  4BS9 A;  1AZP A;  2L5T A;  2WKC A;  1HXY D;  2E2D C;  4UDU C;  2K1B A;  2B39 A;  4RAU C;  1SMY C;  1F9P A;  2A68 D;  4E6I A;  2C9O A;  4CBV A;  1SYG A;  4ZAI A;  5KEE A;  1Y8P B;  1H9R A;  4CGY B;  2XRQ D;  2QEJ C;  5JEA H;  5C5L A;  1WTO A;  3ONA B;  3TP8 A;  2FJ2 A;  2J4X A;  4U68 A;  1QJO A;  3J80 E;  3CRL C;  4HMJ A;  4TQU S;  3BVG A;  3I90 A;  1ENF A;  4HCS A;  1TII D;  1GUW A;  2F0O A;  2FFK B;  1K8O A;  3SK5 A;  3C3L A;  1ESR A;  3SHL A;  2EYO A;  5HGT A;  3R3O A;  1PZI D;  3PV0 A;  5M5Y B;  1B50 A;  1HRJ A;  3V2T A;  1I4H A;  2RDF A;  4S3S A;  4KI0 A;  4RWS C;  3M4Y A;  1OXT A;  4KD3 A;  1TU2 B;  1I4G A;  3QB3 A;  4HR7 B;  3GTP B;  4O42 A;  1KNA A;  1ZKO A;  5KNB A;  1SYF A;  3G7L A;  4NP5 A;  4H7B A;  4QCL A;  1WD1 A;  3VR2 A;  1BNZ A;  4A3B B;  3MAQ A;  2X6G A;  3Q0A A;  1LTR D;  3IFT A;  5M9O A;  1NAP A;  1PRT C;  1GJX A;  1FGB D;  1O7Y A;  3K7A B;  3DM1 A;  1BCP C;  5CBA E;  2F0U A;  4BA2 I;  2F0D A;  2F3W A;  3M85 A;  4ZK9 B;  3OHX C;  3HGB A;  1YNJ D;  3JAM E;  1LT4 D;  2PMZ B;  2N55 A;  1STA A;  3VYT A;  4GZY C;  1LT3 D;  3J7A F;  3L3O C;  4DFA A;  4X3K A;  3D4R A;  4QF4 A;  5K5P A;  1STN A;  2IJ0 A;  2F0T A;  2AQ3 B;  2R93 B;  2H1E A;  1BF4 A;  2QCP X;  4KTA A;  4RCO A;  4P2C B;  1HA5 A;  1BO0 A;  1STY A;  3P7J A;  4Q0F A;  4JBW A;  1M4V A;  4OHJ A;  1NUC A;  2K01 A;  2L55 A;  1L0Y B;  3GTL B;  4L6T B;  5DNF A;  1X3P A;  2RQX A;  3NBI A;  3VR3 A;  1TS2 A;  5CMD A;  2M00 A;  4C1N I;  4B9X A;  2PW5 A;  2Z4H A;  2JP1 A;  3D8G A;  1ET9 A;  3NUC A;  2EYJ A;  4XYO A;  3MFY A;  2HCI A;  2DY8 A;  1J9O A;  1PTO F;  3DWA A;  4NKL A;  2K5W A;  2CW0 D;  4KKU A;  2F0H A;  4J1M A;  3PIP 3;  3RZO B;  1FR3 A;  3R8B A;  5A2Q L;  3SXH A;  1B9N A;  5I9P A;  2F0V A;  3EA6 A;  2F03 A;  1AW7 A;  4C1N K;  4CKC A;  4A3M B;  3BZD B;  3K6O A;  4IUQ A;  1CI3 M;  5KYI A;  2RVL A;  2R3Z A;  4IUT A;  1VCI A;  1SFO B;  5JPM C;  4XDX A;  4H0L C;  2RDG A;  1CA5 A;  1IKL A;  2I46 A;  4IUU A;  1ILQ A;  2LY7 A;  2WIN B;  3KK7 A;  4Q5V A;  2A5H A;  1S5B D;  3KBG A;  4EQN A;  1CZG A;  1B9M A;  3QWN A;  1A2U A;  2PYK A;  1EY6 A;  2PPB C;  2O5J C;  1GXD C;  2CQA A;  2NVQ B;  3GQB A;  1WVL A;  4DN4 M;  3VA7 A;  2Z1C A;  3T53 B;  2BOS A;  2X6L A;  2G9D A;  4RCN A;  5CGK A;  1QE6 A;  3H09 A;  3FPU B;  1HTP A;  2IWH A;  1CM9 A;  2E76 C;  1HPC A;  3ERO A;  1B1Z A;  3MA2 B;  2SOB A;  4IFD H;  2F1M A;  1QNK A;  3OIQ A;  4CKE A;  3EJI A;  2EYM A;  3K5N A;  1RJT A;  2QDB A;  4IUN A;  4A3I B;  1YNN D;  1EFI D;  2OXP A;  4C3J G;  5IGG A;  5COY A;  1NCV A;  2EY6 A;  5CBE E;  1E2Z A;  1EWC A;  4XT3 B;  4V0B A;  4HED A;  3DUZ A;  3NK9 A;  3CKI B;  1I6H B;  5CYU A;  4BBS B;  2Q8I B;  2L0C A;  4FXD A;  1RD9 D;  3K59 A;  3KF8 A;  2B2T A;  2MUY A;  1ROD A;  1PLF A;  1JQY D;  1ONL A;  5J39 A;  1TS3 A;  3H91 A;  3FKI B;  4ID6 A;  2H4O A;  5C4X B;  1BQQ T;  1Q90 A;  2ICI A;  4RKB A;  4A3K B;  3X3M A;  4IUP A;  2R61 A;  1MGS A;  2CHB D;  5IT9 E;  2Q8T A;  3OWF A;  1ILP A;  1II3 A;  5KNC A;  4OO1 I;  1CZW A;  3MEH A;  4HAE A;  4J8Q A;  4LMQ D;  4KKS A;  3L9A X;  5CV6 A;  4A3G B;  3D4D A;  4IUV A;  3HOV B;  2JYO A;  5EKL A;  3V96 A;  2KCN A;  1FYC A;  3EVQ A;  3NP8 A;  4L63 B;  4UAI A;  4XTC S;  5EJW A;  1PRT F;  5ISR A;  5C4J B;  4HN7 A;  2OT2 A;  3WDN A;  1WTX A;  4KKT A;  2XRS D;  1BCP F;  1SNC A;  2D5D A;  2VNU D;  1TQO A;  3A8K E;  2IX3 A;  1B53 A;  3S1Q B;  3BG3 A;  2JA8 B;  1JWS D;  4ILW A;  2NVY B;  4MN3 A;  1VDZ A;  1RCV D;  5ELC A;  3K0Y A;  5EBD A;  1W6J A;  5G3L F;  1RTO A;  3W3A A;  3PUX A;  1GUO A;  3NWT A;  1Q12 A;  1PMR A;  1CQV A;  2GA4 B;  3PIO 3;  5C0X J;  1EEF D;  5F2D A;  1IHZ A;  2JSO A;  5C3E B;  2MP1 A;  1PZJ D;  1SE4 A;  4LK1 C;  2IL8 A;  5E1F A;  1PXU A;  1RKN A;  2MPM A;  3BVM A;  1DD2 A;  3SK8 A;  2A68 C;  1STE A;  1HUN A;  3KUP A;  3OIP A;  1EEI D;  1GUG A;  1ZEQ X;  2K7V A;  1Z6H A;  2TSS A;  1PTO H;  3D6C A;  2N88 A;  1JCK B;  3BYT B;  2R92 B;  4MIU A;  2AWO A;  5EGT A;  3H0G B;  2NBF A;  3VYU A;  2MGS A;  3LNN A;  1F2L A;  3IL8 A;  4F87 A;  1EY9 A;  3LWU A;  2NYZ D;  2F3V A;  3I91 A;  5EKI A;  4F88 A;  1T5X D;  1DOL A;  1F77 A;  3HRZ C;  4KY7 A;  1PFM A;  2IX1 A;  3FMC A;  5I6Y A;  1ESF A;  2XWB B;  5CV9 A;  2HDM A;  4I7Z C;  1I4Q A;  4L8J A;  1CTM A;  3NHH A;  3MWY W;  1WTW A;  3SK4 A;  3DHQ A;  3F2U A;  1V43 A;  3NQI A;  1PZK D;  1TVX A;  5JVH 3;  4DAP A;  4YIJ A;  1A3V A;  4CJ0 B;  3VR5 A;  2MJ8 A;  3MZ5 A;  2F0I A;  2KQ3 A;  3M3Y B;  3T56 B;  3TN2 A;  4F8M A;  1EU4 A;  5FLX E;  1LAB A;  1D6E C;  3S9W A;  1AFP A;  2ZXP A;  1D2B A;  1K83 B;  2A73 B;  2Z4I A;  1EOT A;  2YYZ A;  1EQT A;  1KDC A;  1JE4 A;  1DM0 B;  4X3S A;  4R8I A;  1EL0 A;  4OGQ C;  4RHS A;  3R2I A;  2QF7 A;  4IZ8 A;  4ZUI A;  1S5D D;  2L12 A;  5KYL A;  2F0P A;  5J22 A;  2EY2 A;  3P20 A;  5IOC A;  5I2Y A;  2ICE C;  3ITP A;  5CV4 A;  2XSC A;  4RGM A;  1QWY A;  5A2Q E;  2A6E D;  2F0G A;  4PMC A;  1G29 1;  3C46 A;  2G9H D;  1WTQ A;  2BDO A;  1TY0 A;  3GTJ B;  1D5X C;  2PZU A;  3WOE A;  1MBY A;  1UUP A;  4ODG A;  1SAP A;  1SSO A;  5C0X I;  4DK0 A;  4KHV A;  1EQV A;  4K2K A;  3S1N B;  5NUC A;  1T5E A;  3AU7 A;  1S5F D;  1G2S A;  1G2T A;  1H9S B;  3PO2 B;  5CV8 A;  5IGD A;  3R2T A;  1A15 A;  5DM7 3;  1FNV A;  2LS0 1;  1I4P A;  1MSH A;  2KCC A;  2JA7 B;  2XVS A;  1O7Z A;  1VF7 A;  1E2W A;  4JK1 C;  1EY5 A;  3T4A C;  2VB2 X;  1EIG A;  2K5D A;  4G7O C;  3GTQ B;  1E2V A;  1KLU D;  3A7L A;  4OIJ A;  2ZXO A;  2PCF B;  2K28 A;  4F7X A;  3P75 A;  5KIX A;  2WKD A;  5IGB A;  5BN5 A;  4FF2 A;  3K58 A;  1XWE A;  1KAA A;  2BA1 A;  4A3F B;  3M7G A;  2Z8L A;  3RZD B;  2EJF C;  2PZW A;  4C2M B;  4PQX A;  1Y1W B;  3H3V C;  2BA0 A;  3OPO A;  2PNR C;  3M4O B;  2B8F A;  1JOQ A;  1SNP A;  1Y1V B;  1SE2 A;  2F0E A;  1A2T A;  5M3F B;  2EVB A;  3J81 E;  1A3T A;  2NN6 G;  5LHY 1;  1OO9 B;  3OOC A;  1W6K A;  3S1R B;  4KY5 A;  2AWN A;  4HCE A;  1UEA B;  1U4M A;  2B2W A;  3HOW B;  2B2U C;  3J80 L;  4DAY A;  1Y8O B;  2FIN B;  3PO3 B;  2EYL A;  3A7A B;  1TWC B;  3A55 A;  2B2Y C;  4HMI A;  2K32 A;  3CRK C;  1EY8 A;  3DEO A;  2E75 C;  4KHZ A;  3MC0 B;  2MHV A;  1IW7 C;  1QIL A;  1GUN A;  4QUC A;  2Q8R E;  2NZ1 D;  3OMG A;  2EY1 A;  3HOX B;  1VF5 C;  2F4I A;  4IN3 A;  2O2L D;  1BBX C;  1PRT D;  3NTK A;  4DXF A;  1GUT A;  1SYE A;  4U67 3;  3DXJ C;  1ZYR D;  2NWG A;  1LTS D;  1UNS A;  4KMU C;  4XT1 B;  1RHP A;  1IL8 A;  1CQF A;  3S2D B;  3NPP A;  5TSS A;  1EY0 A;  2PO4 A;  4G4K A;  2TMP A;  5ELB A;  3BYY B;  2F0F A;  4A3D B;  3HKZ B;  1HTL D;  1IYV A;  4ME5 A;  5G3L D;  5M5W B;  1TS5 A;  1OXS C;  5I6W A;  5C44 B;  4V19 0;  5K36 H;  4RFB A;  1H9K A;  3J7A V;  2ID0 A;  5FO9 B;  2WV6 D;  5E4X A;  5JEA J;  1SYD A;  4G7H C;  1V8Q A;  4B08 A;  4QIW B;  2V4D A;  3C2P A;  2YU9 B;  3QOJ A;  1F2Y A;  5E3F A;  4RH6 A;  3NTH A;  1DJR D;  1SNO A;  2AQ2 B;  3VYS A;  2BE5 D;  1HQR D;  5HUR A;  3CHB D;  2M9V A;  3NE5 B;  3I70 A;  3MVV A;  3TBI B;  2NN6 I;  3RUZ A;  2DY7 A;  3BDO A;  3MXP A;  3MTS A;  3TP7 A;  2ZXR A;  5E4W C;  2JEB I;  2ZT9 C;  5AFW A;  5JEA G;  4KK7 A;  2KOL A;  2RSN A;  3Q23 A;  1FNW A;  3DMU A;  1TWF B;  1GOZ A;  1DCZ A;  3HG9 A;  4KY6 A;  1ICW A;  3MXN A;  5JOB A;  5D14 A;  1SYC A;  2PZT A;  3HP3 A;  1EWH A;  3CU7 A;  1BOS A;  1G91 A;  1XYI A;  1WCM B;  1KDB A;  1SXT A;  2EYF A;  2O5I C;  3NSW A;  1XX8 A;  3FDT A;  1SNM A;  1SYB A;  3RD4 A;  3UI2 A;  1EYC A;  4PV1 C;  2VB3 X;  2C5C A;  1DOK A;  4RGT A;  1STH A;  4XQQ A;  3D6W A;  1U4P A;  2I07 B;  2XNA C;  4DXG A;  1LAC A;  1Y69 U;  5DEH A;  2XWJ B;  4IAL A;  1I6V C;  1TWG B;  3T13 A;  3I72 A;  4K6L A;  3PUW A;  5KND A;  3GTO B;  2JA5 B;  2F0N A;  1RF2 D;  3TP6 A;  1R4P B;  4NW2 A;  2B2W C;  1PTO B;  2WII B;  2JEA I;  4H13 C;  3MXU A;  3OMC A;  3A8I E;  5FOB B;  1EZ6 A;  1B4O A;  4A3E B;  3ND8 A;  3BDL A;  4K6D A;  1AP0 A;  2NTS A;  1S5C D;  1R4Q B;  1JC7 A;  2E74 C;  1C8C A;  3NXW A;  1X32 A;  4PMW A;  1SDF A;  1TT2 A;  2DN8 A;  2SEB D;  3SVM A;  5KRU A;  1H9S A;  4N9T A;  1GHJ A;  3I73 A;  1LTB D;  1JOK A;  2HUG A;  2NB0 A;  1TS4 A;  4KN4 C;  3E6Z X;  2K03 A;  2NVT B;  2A6E C;  2ENB A;  4ULL A;  4OO1 H;  3TP5 A;  1TKW B;  2RA4 A;  2O4X A;  2D62 A;  4QUF A;  2IT1 A;  4RA8 A;  1CK1 A;  3KBX A;  5M3M B;  3L7Z C;  3J7Y W;  5A35 A;  3VYR A;  4C3H G;  1S5E D;  2FHT A;  2KJX A;  5BN4 A;  1ET6 A;  1MSG A;  2A6H D;  1OXU A;  5I9O A;  1F9R A;  3PMF A;  5C6A A;  2EJG C;  5FO8 B;  1KTK A;  3G6J B;  2KEC A;  3KLS A;  2F0S A;  5ELE A;  1TR5 A;  3GTK B;  2PQE A;  1DYQ A;  4EVO A;  1OXV A;  2F0K A;  1NSN S;  2JE6 I;  3I4L A;  3HEJ A;  1F2Z A;  5CV5 A;  3EQL C;  4KJO A;  2X69 A;  5C3W A;  3C1E A;  2J7Z A;  2E2H B;  4N9P A;  2LMC B;  2LFN A;  1YNJ C;  3HS0 C;  3O13 A;  3SDZ A;  1HA6 A;  4IFD J;  2K5Q A;  1SJH D;  2B2T C;  2D9U A;  4ZRZ A;  1C48 A;  5IGF A;  4FF4 A;  1JWM D;  3I4N B;  5T1G A;  3X3N A;  5D65 A;  4HTH A;  3SEB A;  4DAV A;  1EYD A;  1PYW D;  5IGE A;  4WJW A;  2L9H A;  2HDL A;  2DNE A;  3SK6 A;  5CC4 A;  1XTC D;  3V05 A;  4HSP A;  3FEW X;  2A74 C;  1QOH A;  2VXW A;  5EBC A;  4ZUJ A;  1PTO D;  2IX0 A;  5C4H A;  4FF1 A;  3A54 A;  4DNT B;  4IFD G;  4ABN A;  5K36 G;  3S1M B;  3QJY A;  3M7N A;  1Q1E A;  1F2M A;  5CR3 A;  5FO7 B;  1DOM A;  2WAQ B;  5JJZ A;  2R7Z B;  2CW0 C;  1JR0 D;  1EYA A;  2EE1 A;  1C4Q A;  3CQZ B;  3FVQ A;  1HHV A;  1EU3 A;  4TSS A;  2EZV A;  2BCO A;  3DEP A;  5FK9 C;  1F9S A;  1A6X A;  4LAA A;  1L0X B;  2FMC A;  1PRT B;  3A56 A;  3QOL A;  2OF1 A;  5LL6 S;  3VR6 A;  1I50 B;  2KED A;  3ND9 A;  4ZKC B;  3NWS A;  1BCP B;  5EQ0 A;  3VR4 A;  3K5L A;  1R9T B;  1V1O A;  3TZD A;  1LT5 D;  4KJN A;  2WAC A;  1HCZ A;  5JPN C;  3SR1 A;  1PFB A;  1V1P B;  2KEE A;  1O78 A;  2F0M A;  4M1U B;  2BDN A;  1KLG D;  3ERQ A;  1ZYR C;  3BDC A;  3GD7 A;  1HQM C;  4CJ2 C;  2AQ1 B;  2SDF A;  1K8M A;  2RDH A;  2KHS A;  3MHB A;  1ENC A;  4XYQ A;  2RBM A;  4KD4 A;  1AN8 A;  3LX0 A;  3H6M A;  4RKL A;  4RGN A;  1IYU A;  4J6H A;  2AUJ D;  2EPB A;  4EQO A;  4DU9 A;  2L1B A;  1BR9 A;  2K04 A;  4K2L A;  5T1I A;  2A69 D;  4C3H B;  4I65 A;  1Q8I A;  3LWE A;  4ZKB B;  1Y8N B;  2F0L A;  1D1K A;  2RSO A;  3N52 A;  1SMY D;  4AYB B;  5FLX L;  1RDP D;  1I4X A;  5C4Z A;  3PUZ A;  2F0J A;  2E2I B;  3AB9 A;  1STB A;  3I8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...