3WOEA

Crystal structure of p23-45 gp39 (6-109) bound to thermus thermophilus rna polymerase beta-flap domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
GPIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-directed RNA polymerase subunit beta
publication title Structural basis for promoter specificity switching of RNA polymerase by a phage factor.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase/transcription
total genus 32
structure length 130
sequence length 130
chains with identical sequence C
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-12-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.150 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3woeA00
3HOXB 3S16B 2JA8B 2O5JC 3HKZB 2NVTB 4A3IB 3GTJB 1Y1VB 4A3JB 2NVQB 2PPBC 3S1MB 5C3EB 2NVYB 2B63B 3GTOB 4BBRB 1SFOB 3WOEA 3S15B 4A93B 2CW0C 4C3JB 4JK1C 1I50B 3GTQB 3M3YB 3GTMB 3K7AB 3S17B 3I4MB 3FKIB 2A6HC 5C4XB 4A3FB 2JA7B 4Y7NB 1Y1WB 4BBSB 4LK1C 2VUMB 2A68C 4G7ZC 3S2DB 5M5YB 4C2MB 3EQLC 1YNNC 4QIWB 4LJZC 5C4JB 3I4NB 4BY1B 3S2HB 2R92B 1WCMB 2A6EC 5M5WB 2R7ZB 2Y0SB 3S14B 1K83B 4C3HB 3HOYB 3PO2B 4KN7C 1TWCB 3H3VC 4A3DB 5M3MB 2R93B 2NVXB 2E2IB 1SMYC 1R9TB 3PO3B 1YNJC 3RZDB 1TWGB 3HOVB 3CQZB 1I3QB 1ZYRC 3GTPB 3RZOB 4KN4C 3DXJC 4A3KB 2A69C 3GTLB 3GTGB 3S1QB 2JA5B 2WB1B 1TWFB 2JA6B 1TWHB 2E2JB 1TWAB 4A3MB 1HQMC 3WOFA 2E2HB 3GTKB 2O5IC 4G7OC 2WAQB 2LY7A 4GZYC 3HOUB 3M4OB 2PMZB 4BY7B 3H0GB 4C3IB 3HOWB 4A3GB 1I6VC 5C44B 4G7HC 4A3EB 1IW7C 3S1NB 3HOZB 3S1RB 5M3FB 2BE5C 1I6HB 2YU9B 4A3BB 3TBIB 4KMUC 4AYBB 5M5XB
chains in the Genus database with same CATH superfamily
1O7YA 4IFDJ 1VQBA 2ZJQA 1MHWC 4QGUA 4IPGA 2NZHA 4JI8L 2F0GA 2UUAL 4PNYA 3PO3H 3K7AH 5KYLA 4LF5Q 1RIPA 1YZ6A 5ELNA 5FO8B 1SNPA 4WJWA 1U5KA 3GTOB 3KLRA 4J8QA 1B3AA 1Q1BA 1T5XD 2HHHL 2WV6D 4DR1Q 3BVGA 3MXGA 1SFOH 2F0OA 1E22A 5IT9E 1ENCA 3GTMB 3IFTA 2E74C 3HOWH 3U58A 1YJ9A 1Q8IA 4DR4L 4XYOA 1EY7A 3CU7A 5M3FH 2FXQA 2H4OA 2BOSA 5IP7G 1DONA 2K32A 4J6HA 3NBHB 3K5OA 1TQOA 4LJZC 2LKVA 1PTOB 3PO2G 1E2WA 2CQAA 3L3OC 1PZKD 4QIWE 4KKTA 4J15A 4XT3B 5FOBB 5M5WB 5I4DA 1S4ZA 4ZRZA 3SE0A 1JQYD 4PMWA 2K5QA 2EVBA 1C9OA 3KF8B 2E5LL 2PCFB 2JEBI 2YTVA 3KBXA 3TRZA 4IPDA 1GJXA 1EYDA 1SNDA 2K5HA 4UAIA 2QEJC 4A3MG 3RNUA 1FR3A 4X65Q 3CAMA 4DV6L 2IX3A 5CV5A 3GD7A 1IZ6A 3MTSA 2L15A 2MO1A 2CQOA 1ASYA 3T13A 4L6TB 4LFCQ 5CR3A 4H02A 1JC7A 3BS1A 2BH8A 3HOVG 5K36H 4UP8A 2EYOA 2Q2HA 1SYBA 2UUCQ 1SYCA 3HOUB 1D5MC 2EXZA 1W6KA 4X64L 1S5FD 4A3GB 1WOCA 5C44B 3S1NB 2ZJRA 2CWAA 1X3FA 3DLLA 1NMGA 3DWAA 4GLVB 4DR6Q 5KYIA 1DCZA 3T1HL 2DJGC 1VQ7A 4OX9Q 2DJFC 5IY0A 4AYBB 3UI2A 3E6ZX 3U9OA 1EZ8A 1W2BA 3I2ZA 1X56A 1K8AC 4LF7Q 1ET6A 2JA5H 1RODA 3I4MG 5C3EB 1PXUA 1NR4A 1CT1D 3TS0A 5EQ0A 3FPPA 4BBRB 1KDAA 4A93B 1XPOA 2HDMA 3GV6A 3GQBA 5CV9A 3M3YB 2M2LA 4RHRA 1A62A 4KD4A 1PFNA 2XRQD 4K2LA 3RUZA 4APVA 1PLFA 3K5LA 2WKDA 4CJ1B 5C0XG 1MSGA 1EQQA 2JA7B 1HNWL 2F0QA 2KVMA 2EIFA 3VA5A 2NUCA 2CW0D 4X3KA 4QB4A 4R8IA 2R92G 1CUKA 1RL2A 1CZGA 4U68A 1GUSA 3NBHA 4Y7NH 3LNNA 3C2PA 2KJXA 5BN5A 1VQCA 5M9OA 3VR3A 5KIXA 4P2CB 1XMOQ 2K4KA 2B39A 3PF4A 2CCZA 5FLMG 2OXPA 1WD0A 4EVOA 3UE1A 1K9MC 2UXDL 2A5HA 5A2QL 4PZ7A 3CW2C 2IPKD 3D4RA 4EQNA 2F0PA 4YY3Q 1NY4A 4R4IA 1VQ5A 1FYCA 1ASZA 3VR4A 5M5YH 2RKSA 1U4PA 1KRTA 2EYJA 2WAQG 1EY8A 2K1BA 3CCMA 4RH6A 3NWSA 4R9WA 4CKBA 4CBVA 1VQDA 2RF4A 3GTLB 3S1QB 4HN7A 4HIKA 3JAML 1TWFB 3HOZG 3F2UA 3T1YQ 2G9DA 3W1BA 4EQOA 3CCSA 1VQ4A 4FF1A 4F8MA 2E2HB 4JPBW 3GTKB 2F4VL 4HMIA 1D5ZC 3E0EA 1TWHH 3SK5A 3ONAB 3M4OB 1G6ZA 4NXNL 4AQYL 2ZXPA 1HR0Q 3HOYH 2A19A 5IYBH 1IHZA 2MGSA 2F0KA 1VQIA 3P7JA 4O0AA 1IKMA 1HH2P 4Y52H 4C3JG 4PMBA 1WTHA 1HA6A 4FO2A 2K5VA 2AUKA 1IBMQ 5C44G 1YJNA 4JW0A 3NENA 4DK1A 1KHIA 2H1EA 1CKNB 4AYBG 1HTPA 5C0XJ 4BXXG 4JI6L 1TY0A 2I5LX 2B2YC 5GAHC 1O7IA 1STBA 2K7VA 4YWMA 4DAPA 5AJ3Q 2F0HA 1JWSD 2CW0C 2XVSA 1WFQA 1STYA 1OTCA 1X65A 1PYSB 1I50H 1SNMA 3AMUA 3M85A 3U4ZA 2F3IA 4LF6L 3AU7A 4IQZA 3T56B 1K73C 1NCVA 3F8TA 1KD1C 4C56C 3FKIH 2HIXA 1YBYA 1O7ZA 5LMNL 4DAYA 5JEAG 3JC66 3F2CA 3I90A 4B9WA 3SVMA 5E4XA 1LTAD 2EYHA 1RDPD 4N9PA 4JI1L 3TN2A 4RKBA 4P74A 3VR5A 1K3RA 1X6OA 4GKJL 1EFWA 3G6JB 1D6EC 1HFGA 5GAGC 1JJGA 1CQFA 4C1NI 4LF9Q 1HRJA 2PZTA 1K83B 3R3OA 4PQXA 3LGJA 1EY9A 2B2UA 5CBEE 2NVXB 5ELOA 2A6ED 1B4OA 3S9WA 4X66Q 3NSWA 2RQXA 3R2IA 2R93H 3VYRA 3HEJA 3M7NA 4FF2A 2RCNA 3QO2A 4KN4C 1VQ8A 1N9WA 2TMPA 1EIHA 5D14A 1D1KA 4JI5Q 3RZOH 5ELDA 2B2WA 1MIUA 3HKZG 4UP9A 3W3AA 2E2JH 5COYA 3H0GB 4CDCC 5IYCG 3HOWB 2KHIA 1KABA 1DOMA 4H0LC 3NBIA 4CJ0B 4XT1B 2J0TD 4KKSA 5M3FB 5M5XB 5DM73 4DV2Q 4GLAC 4A3IB 1CKNA 4A3JB 4B3TQ 1BO0A 5IGEA 5DM63 3HOXH 2CWPA 3NXWA 2OTLA 5C4XG 2ES2A 1X55A 2B63B 1O7LA 4JBJA 2X6LA 1OXXK 1X54A 1SYGA 4BBSG 3I3CA 2JQOA 4X3SA 2JK8A 3MVVA 3H3VI 1WTXA 5D65A 2D9UA 1QE6A 1WTPA 1SYDA 3DUZA 1GUGA 5CORA 3CP0A 3E9IA 4K2KA 1A63A 3HKSA 5IGBA 1JICA 1VS0A 2RBMA 3EA6A 3T4AC 3BJUA 2E8GA 3FVQA 4P75A 1U4LA 2K01A 4KKUA 3CPWA 2JEAI 4NB3A 4JI0L 3W2DA 2BE5D 5D3DA 1HNZQ 2Z1CA 3A7LA 1F9RA 1I4GA 4C3HG 5IT9L 3ULPA 1PH6A 5ELEA 2QEXA 2D2CC 5D3IB 4OL7A 4NXML 3ICEA 3D0FA 1VF7A 4GKKL 2A6EC 3GP7A 2NWGA 3TS2A 4DR2Q 4FYDA 1VQJA 3D8GA 4BWGB 3S14B 4A3CG 2ZTDA 2HT1A 2Y0SE 4ODGA 5J1ZA 4MNOA 5A2QE 4OGQC 1S5DD 1P8LA 4X3TA 3ZJYC 1IYJB 3J81c 1IBLQ 1Q46A 2K03A 5KNCA 1SEBD 4LFBL 4BS9A 4DF7A 1CSQA 2AQ3B 5CV6A 1I3QB 2O4XA 4GN5A 1FVIA 2K75A 1QVGA 3HP3A 1WTQA 3J80c 3IKJA 1TY2A 2K6AA 3P75A 4WFN3 4QY7A 3PO3G 3V05A 4ZQ3A 4K0KQ 2WB1E 3WOFA 2ZM6Q 4QMGA 3GTGH 3J7A5 4ME3A 4DV3L 1SR3A 1U0LA 2DGYA 3V96A 2JSOA 1O78A 1DOLA 1QILA 1KAAA 1KDBA 1PH1A 3PUYA 1OXVA 5K5PA 4L5TA 1SBBB 2F1MA 2EY6A 1Z6HA 3TSSA 4ZK9B 3H0GG 3HOWG 4HAEA 4A3EH 2JA8B 2O5JC 1VQKA 1HFNA 3SHLA 3NQTA 1LT3D 1FL0A 1HZBA 5M3FG 5BN3A 2PQEA 1C4QA 2ZXOA 1DZ1A 2KQ3A 2VZAA 2EPBA 1II3A 2FINB 1O80A 4TSSA 1Y1VH 4A3IG 1JE5A 3S15B 1I5FA 1SLJA 4XDXA 2GA4B 3QG1A 3NEMA 1VQHA 1NSNS 5EKLA 4MZ9A 5DNFA 2VL6A 1N33Q 2KCNA 4DAMA 3BYTB 3TZDA 4Q0FA 1CA5A 1BUVT 2AMCB 2B2TA 3D6WA 1BXTA 1UUPA 4A3FH 4ID6A 5M5YB 2Z6KC 3SK6A 2OF1A 3CC4A 4XQNA 4JI7Q 5A35A 3CCJA 1QWYA 1WVLA 1E1TA 5I6YA 3SK4A 2V1CC 3HG9A 1YVCA 2NN6I 1CK1A 4K8JA 3WDNA 3R93A 4RCNA 2IY5B 2IJ0A 5K36G 3QWNA 1JMCA 2Z6BA 3HOYB 4LUOA 3PO2B 1MI2A 1HQRD 1OXUA 1XX8A 4PZ8A 2IT1A 3A5UA 2HDLA 2OEOA 1PRTB 1VQOA 1PH4A 2DN8A 5M3MH 3Q6SA 1QB5D 5IODA 4A4IA 3TP7A 1MJEA 5IIFA 2SNSA 4I7ZC 1Y69U 1V9PA 3ND9A 2PI2E 4F88A 2SDFA 1CFMA 4JBWA 4A3MB 2CH4W 1V1OA 2JA5G 1ONLA 1YI2A 2Q2TA 4UPAA 5BR8Q 4LFAQ 2K04A 1XYIA 1QJOA 2PMZB 1LACA 1EY6A 1F77A 1QNKA 2EE1A 2F0MA 1K8MA 2ZJPA 4GLXA 2PYKA 4MHEA 1HR0W 3IFDA 4OELB 3S1RB 1FJGQ 1MGSA 4HMJA 4JVZA 3AFPA 5IWAL 1JB7A 2N49A 1YJWA 3RN5A 4IALA 3A56A 4KY6A 1PH5A 5EPJA 1H9RA 1TS3A 1IW7D 2NVTH 3UDIA 3GTJH 2SNMA 4QCLA 1WD1A 2B2VC 3UDGA 3KJOA 2ENBA 5I2YA 2BCOA 2F0WA 2OT2A 3PIOA 2EJGC 4LF4L 1KLUD 2N88A 3OWEB 4J1MA 3GTQB 2C5CA 5LHY1 4L5RC 2R61A 4ZUJA 4K6DA 1Q90A 1M4VA 3I4MB 1WTVA 4DV4Q 4RGTA 3KUPA 4DR1L 2F0UA 3CKIB 4FXGC 1PH7A 1QUQB 1Y1WH 1MBYA 2YTYA 3NTIA 4KTAA 1LT6D 1LV9A 3PIO3 3A7AB 2QGQA 4GNXB 4JI4L 3I73A 4HIOA 4GOPC 2L11A 3S2HB 4RAUC 2RSOA 2IHEA 2KEEA 3H94A 3VYUA 1IYVA 2R92B 3NTKA 2K14A 5DAUA 1MD2D 4DNIA 3L9AX 1VQGA 1XNRQ 1WCMH 1SNCA 1EY5A 3RR5A 4EGVA 2FMMA 3CRKC 4KN7C 2LFNA 2B8FA 3L2PA 1BR9A 1K0RA 4DUZL 1PFMA 3J7AF 1GOZA 2WAQE 4JI8Q 2AUJD 2UUAQ 1H9SB 1EU3A 3HOYG 5IYBG 1V8QA 2E2IH 1N36L 3J80L 1LM0A 3W5OA 2CKZB 3PUWA 2V4DA 1SXTA 1QZGA 3QOLA 1EQVA 4P72A 5C4JH 5LMNW 1PFSA 3CQZH 4X65L 1G291 2KCTA 2HHHQ 2JJQA 2DUDA 1SAPA 2WAQB 2LY7A 2OWOA 3KDFB 3J80i 2QA4A 4DU9A 5JPNC 4LFCL 1Y8OB 3NWTA 4CKEA 1IW7C 2K5DA 1TU2B 3KBGA 3PUZA 3HOZB 3D31A 1KLGD 2PI2A 1Q81C 1AE2A 3SEBA 3HFZB 3K57A 1UWVA 4V190 1SRUA 3S16B 4QL5A 3NUCA 4KHZA 4AYBE 4A3BH 4OONA 2UUBQ 2XWJB 1SMXA 3FKIG 2KUMA 3R8BA 3FP9A 1LTBD 4BA1I 1YHQA 4TQUS 1LTGD 1HPCA 1PH8A 4RGNA 1IBKL 4B9XA 4C3JB 2D0PA 4LF7L 1FGBD 1L2FA 2C35B 1BQQT 5DLQE 4YHHL 1MJCA 2LMCB 3P20A 2VXWA 1IL8A 1E24A 4QJFA 4LF8L 3ND8A 4I65A 4DUYQ 2Q2IA 3U50C 4V0BA 3SGIA 2QW7A 4OO1I 5IGGA 3S24A 1EQTA 2FMCA 1XJVA 3DWPA 1QUQA 3EIVA 5IOCA 2VUMB 4NKLA 4LNQA 1S5ED 4DR7Q 4E6IA 4JC0A 1PVOA 2CVRA 3RLFA 1F9QA 1V1PB 3LWEA 1B2TA 1GHJA 4GNXA 1Q12A 1TS4A 3F2BA 1KC8C 2RDHA 2KHJA 4DPGA 5F2DA 2F03A 2R93G 1EY4A 1SJHD 5G3LD 4HJ8A 1B50A 3CCEA 4B3SL 2L0CA 3BDLA 1B9MA 1Q86C 2BA1A 4IZ8A 5C6AA 1YHAA 2XGTA 1XMOL 2F0TA 2Q8IB 4NPSA 1TWCB 1NE3A 4RG1A 4LWCA 1H9SA 4ZCKA 3BDCA 1PMRA 2EZVA 3KF6B 3U4VA 3NK9A 3MFYA 3VR2A 5LL6S 3DXJC 4DR3L 1AH9A 4GN3B 1TWGH 1TKWB 3KF8A 1SMYD 4IUQA 1VQEA 3HOXG 3KDFA 2WFWA 3Q24A 1BBWA 4K14A 4X62L 3G6EA 2R7ZH 1GD7A 1PRTF 2AHOB 3DM1A 4ULLA 1UE5A 4N9TA 4QUFA 4IFDI 1HTLD 1HNWQ 2SEBD 2KA7A 3K5MA 4BY7H 4PG3A 1D7QA 2MPMA 4C3IH 1AW7A 4JYAL 1S5CD 4FVMA 1BCPD 3HKZB 2J7ZA 1H9KA 1T5EA 1I6HH 4DXGA 3T51B 1J5EQ 2QF7A 2DY7A 5L37A 2DNCA 3WOEA 2NVQH 4DNTB 1Q8KA 3PIPA 3S1MH 2NVYH 4L8JA 2UXDQ 4RKLA 1Y8PB 5KGUA 1SSOA 2GVAA 4JOIC 5JJIA 1JE4A 5C4XB 5IP7H 1IYUA 4BBSB 1HZ9A 3S17H 1ML0D 1AP0A 4RGOS 1HCZA 1V1PA 4HR7B 3S2DB 5CGKA 2ZTEA 1W6JA 4N8X1 2VS1A 3EQLC 2R7FA 3PIP3 1FD7D 2BA0A 2VUMG 1BBXC 4KJNA 4C2MH 2RDFA 4FF3A 4L5QA 2F4VQ 5CV7A 3GDEA 1UAPA 1VQAA 4BY1H 3Q22A 1L1OC 4NXNQ 4AQYQ 2L1BA 1G6PA 2NYZD 1VMCA 1YNND 3BZDB 3A8IE 4XYQA 4DFAA 1M8AA 4C3HB 1AFPA 2Q8TA 1GXDC 1TS5A 2IX0A 1SMYC 1K3BC 3L0OA 4PMCA 3KF6A 3H3VH 2EY5A 3RZDB 1KNEA 5C3WA 4YWLA 4HTHA 1XNQL 4JI6Q 3D4DA 3GTPB 1CZWA 3J80E 2RHQB 4B3ML 2BDNA 4A3KB 4JG2A 3HOVH 4TKOB 3I4NH 4WJ3M 5GROA 3CC7A 3G7LA 4A75A 3LWUA 1TXYA 1CA6A 1U9RA 5I9OA 3CMEA 1XWEA 1BCPC 4K6LA 1Y1VG 3IAYA 3AYHB 1XTCD 4KK7A 3MXUA 4YCWA 4JI5L 3VYTA 1GUTA 3PO3B 5IYDH 3K7AB 1F9SA 5LMNQ 2I46A 1PV4A 3F1ZA 2L55A 2MP1A 4JBKA 1CI3M 2YU9H 2ALYB 1VQFA 1PFBA 1ILQA 4JI1Q 2B2TC 4A3FG 3J7ZC 1Z9FA 1SFOB 1BKBA 4GKJQ 2CHBD 1C0AA 2KCCA 3NP8A 2F0JA 1E1OA 5JPMC 3GTOH 1XMQQ 2I0QA 2KENA 4IO9A 2VQEL 2UXCQ 1B70B 2R6GA 4K8IA 2UU9L 4A3LH 3ULJA 4TVAB 1EL0A 3GTMH 3OPOA 1HNXQ 2N55A 3D6CA 5FLXc 5E1FA 4O2DA 4G7ZC 4DGZA 4DXFA 3TP6A 2D62A 3M4QA 4DV7L 3SK8A 1JT8A 2HCIA 1ESRA 1YNNC 1M90C 4HCEA 5C4JB 2RA4A 1F2ZA 2QKIC 1DD2A 5EJWA 3MEFA 4L5SA 5T1GA 5CYUA 5FLMH 1PTOH 2RVLA 4DR5L 3PCOB 5I2XA 2DNEA 4R4TA 1VMPA 5M5WH 1N34L 4POGA 2AQ2B 4Q5VA 4IPHA 2NTSA 3N52A 4M8AA 1GM5A 2O2LD 5JJLA 4ZAIA 3OW7A 5H1SE 1EWCA 4ZYSA 3EVQA 1SE8A 3A8JE 4OIJA 5C3XA 4JV5Q 1J9OA 1JOKA 3TREA 1EIGA 1R4PB 1B1ZA 5CBAE 2XSCA 2LSSA 3P1HA 3M7GA 3BDOA 3KFUA 2K28A 4HCSA 4UY8C 1BOSA 3K7UC 1WTRA 4N8FA 2BDOA 1YNJD 2O5IC 4G7OC 2JP1A 4QUCA 4A3KG 3J81j 4HIMA 1ZYRD 4DV0L 2A74C 4H13C 4G7HC 3OMGA 2EY1A 1X9NA 3HOUH 2N8NA 5GAEC 4A76A 1P16A 4KJOA 2E75C 5C0XI 3TBIB 4KMUC 4A3GH 2JA5B 1CQVA 3NE5B 5E4WC 5C44H 3S1NH 2OTJA 1RF2D 2NN6H 4DV5Q 2ZXRA 4GN4B 4LUZA 1CKOA 1FNUA 1U4MA 3KLSA 2B2YA 1J8IA 2NBFA 1LLRD 5DEHA 3BVZA 4NXMQ 2JA6H 3DWQA 4GKKQ 1KIXA 1HUMA 2FHTA 1YHBA 5C3EH 1X3PA 4QQBX 4BBRH 1NAPA 2A8VA 1STEA 5E7NA 4A93H 3NHHA 2PNHA 1NMFA 1I94L 1RKNA 5TSSA 3M9BA 3GV3A 3M3YH 3PQIA 4Y7NB 3OOCA 4CGYB 5C4HA 5E3FA 4CDFC 4LFBQ 5FK9C 1WCMG 2JA7H 4WJ4A 2WP8J 2F0SA 1N33L 3Q0AA 1SNOA 1Q7YC 1G51A 1TR5A 2EYLA 5C4ZA 4X3UA 3C1FA 1N32Q 2A68D 1JJ2A 2MJ8A 4DV3Q 4HJ5A 5HGQA 4JI2Q 2EJMA 2R7ZB 1QVCA 5ISRA 2Q2UA 4CKCA 3I70A 3X3NA 4ALPA 2J4XA 1PTOD 2HQEA 4IUTA 2Q8RE 2UXBQ 3H3VC 3FHWA 3C3LA 4XQQA 1GUOA 1HJPA 2F0EA 4DK3C 1YNJC 5LMUL 2HIVA 4FDBA 1KNAA 1PH9A 4IUUA 1ZYRC 1UNSA 5EKIA 4FXDA 3K6OA 4FNFA 4KLKA 1JJCB 1PYWD 1QOHA 1TWHB 3PGZA 2JA9A 3ER0A 4A3BG 4H7BA 1GUNA 5CV8A 1BDOA 3GTLH 3DEOA 3TZUA 1ICFB 3S1QH 4DKAC 4B3RL 2I5HA 5IYCH 2E2HH 3GTKH 1UE6A 1X32A 3GO5A 3I8ZA 4ZUIA 3DMUA 2PMZE 3HRZC 3M4OH 3K81C 1WI5A 4CDDC 1D8LA 1C48A 1EU4A 3QJYA 3DHQA 3KYHC 1EEID 4P73A 4DV1Q 3E3XA 4JI3L 1FJGL 2VB3X 2PPBC 1E0BA 1K28A 1X3EA 2CH4A 1SN8A 1S3OA 1K8OA 1A15A 1I4PA 4JK1C 3F2DA 1I50B 2XRSD 3K58A 3OTOL 1AE3A 1CKMA 2N3SA 2OQKA 3E9HA 5ELBA 2JYOA 5G3LF 2AKWB 3QOJA 1EOTA 1I4HA 3FKIB 2EYMA 3CCLA 2RCFA 4AH6A 4R1JA 1YIJA 3OIQA 4LK1C 1CTMA 2A68C 1LUZA 4DNRB 1EWHA 4DK0A 2Y0SG 1EYAA 5IP9H 3CXCA 3I4NB 4LF5L 1PTOC 1LYLA 2VW9A 1KAWA 1LTLA 2VQFQ 3B6YA 1EIYB 1JR0D 3K59A 1KQSA 5JJKA 4CDEC 3W1GA 5JJZA 3DEPA 2PQAB 4OWWB 3Q8DA 1L0WA 3L7ZC 3JAMc 2WB1G 1KTKA 3OIPA 3K8AA 3OSOA 1H95A 2R7ZG 1ENFA 2R93B 5IWAQ 5GADC 3J7YW 5AFWA 2N78A 1K83H 3A8KE 3VA7A 3FMCA 2Z4IA 2NVXH 4BY7G 4OHJA 2Z0SA 2LS01 1EEFD 2EXDA 4C3IG 3RZOB 3A0JA 1E7ZA 4KHPQ 1CHQD 4WRDA 2XWBB 2K05A 1QG7A 3CMAA 1BCPF 4LF4Q 2E2JB 1J6QA 4OO1H 3I4OA 2CFMA 2A73B 2F0IA 1Z47A 2I07B 3J81L 1B53A 1SE2A 3CCRA 1W3SA 3SDZA 2QCPX 2GN5A 4POFA 1H9JA 2ICIA 4KD3A 4OWTB 4A3DH 1G8ZD 3H0GH 3CF5A 3J81i 1LTSD 3HOXB 3PUXA 4WORA 5KEEA 1JOQA 4KY7A 4JI4Q 5M5XH 1AEXA 2AWOA 4A3IH 1A2UA 3CCUA 1HUNA 4A3JH 1I4QA 3MHBA 1RHPA 4DR4Q 3G71A 3OHXC 5EBCA 2B63H 1G2SA 5J3BA 2UUBL 1EYCA 4EQ5A 2MQHA 5EAYA 5KRUA 2UUCL 1VQNA 1NJIC 1MSHA 4DUZQ 4BY1G 4F87A 1B7YB 1LT5D 1EQRA 2Z6KA 5FO7B 4ZKCB 1N36Q 2FFKB 4DR6L 4IJLA 2WIIB 5CC4A 3LX0A 4DUYL 4OX9L 3CD6A 3QIAA 2PNRC 4XQJA 3BZKA 4QIWB 2ZT9C 4GOPB 1LTID 4IFDH 1EZ6A 2YV5A 4FF4A 2E5LQ 4DR7L 2RHSB 1XPRA 4ME5A 1S40A 4R8NA 1VQMA 1PDQA 2F52A 3TDQA 4NDXA 1L0XB 3HZXA 2PQAA 3I4NG 3VDYA 4ZKBB 1VQPA 1ZXTA 5IGCA 1RCVD 2LXKA 4DV6Q 2VB2X 1EWIA 2L4NA 3AQQA 3NELA 1WTOA 3S14H 1TIID 3E0JA 3I72A 4KI0A 5IE8A 2B2UC 4HIDA 2KBNA 2QDLA 4IUNA 5FJ8H 1EFID 3K0YA 3ZYYX 5IYDG 3GTGB 4UP7A 1IBKQ 2L9HA 4X64Q 2JA6B 1I3QH 1H9MA 3AB9A 1DJRD 2OCEA 4YHHQ 3ERQA 1STNA 1SYFA 4LF8Q 3T1HQ 4H44C 4MIUA 4YWKA 2B2WC 2HQLA 2B8GA 4A3EB 1I4XA 3RLOA 3WWVA 1JORA 3MXNB 4K5WA 1FNWA 2ZTCA 4YY3L 1R9TH 4DAVA 3OYYA 4A3LG 2IL8A 1X3QA 1Y1VB 2X69A 2Z8LA 2B2VA 2PW5A 1E2VA 3HKZE 1TS2A 2ICEC 4OWXB 2JA8H 3EBEA 3D3RA 1V1QA 4MTKA 1G2TA 1SJED 4B3SQ 4OIKA 5J22A 1B8AA 4DAYB 3T1YL 4KHVA 1J5EL 3BVMA 3S15H 1F9PA 3AEVA 5EGTA 3I56A 1D2BA 3T53B 1DYQA 4FXKC 5IT9c 5KNBA 3RMHA 4A3FB 4IJHA 4XIGS 4NMZA 5FLXE 1BF4A 1SE4A 1HR0L 3RLNA 1F2MA 1YNXA 1CHPD 2JXMB 4HJAA 3K0XA 1ZKOA 3T16A 2MFIA 4CJ2C 4DR3Q 4GOPA 3VYSA 4X6AH 1IBML 1SE3A 2XN9C 5I6WA 3ERSX 4LUVA 3J7AV 2F0LA 4MTNA 3CCQA 1ENAA 3RD4A 3IRBA 2L12A 4X62Q 1UEAB 4LW1A 4GS3A 5CMDA 1Z7TA 2HCCA 3TMEA 5AJ3L 2F3VA 1CM9A 1TVXA 1VDZA 1VQLA 2QILA 5BN4A 1M1KC 1NTGA 3EFXD 2EYPA 2XIWA 4JCVE 4JYAQ 2E76C 1ILPA 5M3MB 1KXLA 4EX5A 3BU2A 3JAMi 3PO2H 4O1NA 1BVSA 1C7YA 1KL9A 1ESFA 2OQ0A 3HOUG 2ID0A 5T1IA 4YCVA 4A3GG 4RFBA 3FDTA 2PZWA 3K5NA 1XXGA 2NN6G 4M1UB 3TEHB 3ITPA 3BZCA 1V43A 1QCBD 3KK7A 2HUGA 2B3GA 3J81E 2F0DA 1JWUD 2JA6G 4A3MH 1A8VA 1STGA 3MXPA 1HZAA 3A54A 4RMFA 2R3ZA 5C3EG 3MWYW 3MXNA 1SROA 4LF9L 4BBRG 4A93G 2IHFA 2MUYA 2GVBA 1LT4D 2NVTB 1F2YA 2D0OA 2WACA 4A3EG 3S1RH 3NPPA 3GTJB 2XNAC 1Q1EA 4X66L 5KNDA 3BG3A 2JN4A 5EPLA 2JA7G 1A6XA 3UDFA 5JAVA 1TT2A 4R4OA 1YITA 1DXMA 1TWAH 4IOCA 4HJ9A 1NR2A 4OEMB 4LF6Q 4ILWA 1STAA 2QDBA 3C1EA 1A3UA 1QNUA 5JVG3 3GTQH 3VR6A 5HGTA 2JE6I 4IPCA 1Y1WB 3MAQA 3UE0A 4IURA 1XPUA 1KRSA 3URYA 3G48A 1XMQL 1STHA 4Z9CB 3I4MH 3MC0B 2ATWA 2UXCL 1XNQQ 1HZCA 3R2TA 3HGBA 1OXSC 1PTOF 2EY2A 3OMCA 4DV2L 5FO9B 4B3MQ 1IKLA 1HNXL 2NTTA 4B3TL 4NW2A 3I91A 1B9NA 1HXYD 1YEZA 5I9PA 2EYFA 3UDXA 1S5BD 1AZPA 2K52A 1QVFA 4JBMA 1L1OB 1WCMB 5C0XH 3S2HH 2LXJA 3BYYB 4K5XA 3A5ZB 1LO5D 1A3TA 3M4PA 2R92H 2VNUD 2FJ2A 4DN4M 4A3DB 4IN3A 5GQOA 2E2IB 1Y14B 1CSPA 1LTRD 3K80C 3H09A 1PH3A 2RDGA 3EN2A 2VY3A 4I7AA 4RCOA 1D1IA 1PZID 4HSPA 3H15A 3CQZB 3CRLC 5M3MG 2PZUA 3SR1A 1PZJD 4IUVA 1PH2A 2IX1A 3PUVA 4R4CA 1HNZL 5J39A 4YCUA 3M4YA 2YYZA 1JCKB 3D4WA 3I7FA 2MNAA 2EOTA 3H6MA 3SXHA 1BCPB 2VQEQ 4JV5L 1PRTD 2F0FA 4HEDA 4GZYC 2UU9Q 3A74A 3PV0A 1I6VC 2YTXA 2A69D 4DR2L 2KCMA 4EQPA 4XXEA 3CHBD 3RN2A 5JEAJ 3Q23A 1VQ6A 4A3BB 3NTHA 2MO0A 3KLSX 3OWFA 4DV7Q 2K33A 4KV6A 3HOZH 4R4QA 1IBLL 1B44D 5EPKA 4YIJA 1DGSA 4C1NK 2C9OA 3S16H 5NUCA 1D5XC 2Z4HA 2AWNA 3PF5A 3FPUB 3X3MA 4P71A 4DV5L 4DR5Q 3ULLA 1KDCA 1OO9B 4TRDA 2K5WA 5IP9G 4F7XA 4U673 2ASBA 1G91A 4DA2A 4JOIA 3QB3A 2G9HD 5CV4A 1VQ9A 4K0KL 1N34Q 2ZM6L 3U9SA 2F4IA 1AZQA 4C3JH 1VCIA 3TP5A 4K5VA 1NUCA 1BBUA 3MZ5A 4UHVA 4JI0Q 4ABNA 1S72A 2H5XA 2WKCA 3MFGA 1UE1A 3AFQA 4BXXH 4HJ7A 1Y1WG 3HS0C 4HSVA 2VUMH 2EQSA 2A6HD 2KOLA 3OW2A 4IOAA 1NNXA 4IUPA 4KY5A 4OXPA 1L1OA 1A0IA 2PW7A 1E3PA 3C46A 1RJTA 4G57A 4DV0Q 1GKHA 1GUWA 3EROA 1RTOA 3JAME 2Y0SB 2HD3A 2WINB 4OO1G 5C5LA 1GVPA 1QZHA 1N32L 4JI2L 1LTTD 3KLWA 5JEAH 1ICWA 4LAAA 1R9TB 3CCVA 5HY6A 5JVH3 3H91A 1TWCH 1TWGB 1PRTC 4A3DG 5EKKA 2SOBA 2UXBL 4XTCS 1N8RC 4O42A 1ZEQX 3PSIA 4JI7L 4RA8A 1PYBA 2A69C 3G4SA 3I4LA 2WB1B 2PO4A 3DM3A 2K50A 1I94Q 4A3JG 4BY7B 1RD9D 2TSSA 4C3IB 1FGUA 4QF4A 2B63G 2P5ZX 1A2TA 2KECA 1EYGA 1LABA 4L63B 2BE5C 1JOOA 1I6HB 1EIFA 2X6GA 1PHJA 2DY8A 4PV1C 1K8GA 2AQ1B 2IWHA 3STBD 1ET9A 2F0VA 2R7DA 3N6RA 1SYEA 2M00A 1U4RA 4CHTB 1PA6A 2NVQB 3FEWX 4UDUC 4AIMA 5C5MA 2NZOA 3MEHA 3S1MB 3PMFA 2NVYB 4PZ6A 1X3GA 1TWFH 1JWMD 1SNQA 5FKAC 2EJFC 5HURA 2Z9HA 1Q3LA 3CPFA 1Y8NB 1WYDA 2BH2A 4DV1L 4IFDG 4RGMA 3E5SA 1HHVA 3A55A 2K5NA 4S3SA 5EBDA 5BR8L 3S17B 4RWSC 4LFAL 1AN8A 1E2ZA 4MN3A 2A6HC 3TP8A 3TQYA 1EOVA 1EY0A 2IW3A 1K0SA 1R4QB 2E2DC 2NZ1D 5LMUQ 3FRPB 5JOBA 5C4XH 1OXTA 1DM0B 3MA2B 4C2MB 4BBSH 1GO3E 2I5MX 5ELFA 3S2DH 1SDFA 4GNXC 4BY1B 4ZLTF 4RHSA 1UEBA 1VF5C 5FJ8G 3QR8A 4B3RQ 3IL8A 4B08A 1IXRA 5FLXL 5IGFA 2RSNA 1Q82C 2KHSA 1L0YB 3V2TA 2MHVA 3CC2A 4G4KA 1WJJA 1B3QA 2VQFL 3O13A 1WTWA 1NBWA 3NQIA 2A1AA 4LMQD 2NB0A 1C8CA 2EDGA 4DV4L 1JB3A 1T9HA 4C3HH 5LL6X 3KJPA 3I55A 4JI3Q 3HOVB 1MKHA 1F2LA 3RZDH 2M9VA 2B29A 1BNZA 1RTNA 3OTOQ 3GTPH 1TWAB 1HQMC 4FP5D 4A3KH 4A3CH 2JA8G 2L5TA 1HA5A 1DOKA 1I4RA 2D5DA 1A3VA 3STBC 1UE7A 2F0NA 4KHPL 1XTDA 3EJIA 2XTIA 4DK6C 1EUJA 3KOJA 5ELCA 1XNRL 1FNVA 2F3WA 4BA2I 5IGDA 1GHKA 2G5DA 2KEDA 2YU9B 4NP5A 1IL2A
chains in the Genus database with same CATH topology
1O7YA 4IFDJ 2F0GA 4PNYA 5KYLA 5FO8B 1SNPA 4WJWA 3GTOB 3KLRA 4J8QA 1B3AA 1Q1BA 1T5XD 2WV6D 3BVGA 3MXGA 2F0OA 5IT9E 1ENCA 3GTMB 3IFTA 2E74C 1Q8IA 4XYOA 1EY7A 3CU7A 2H4OA 2BOSA 1DONA 2K32A 4J6HA 3K5OA 1TQOA 4LJZC 2LKVA 1PTOB 1E2WA 2CQAA 3L3OC 1PZKD 4KKTA 4XT3B 5FOBB 5M5WB 5I4DA 1S4ZA 4ZRZA 3SE0A 1JQYD 4PMWA 2K5QA 2EVBA 2PCFB 2JEBI 3KBXA 1GJXA 1EYDA 1SNDA 4UAIA 2QEJC 1FR3A 2IX3A 5CV5A 3GD7A 3MTSA 3T13A 4L6TB 5CR3A 1JC7A 3BS1A 5K36H 2EYOA 1SYBA 1SYCA 3HOUB 1D5MC 2EXZA 1W6KA 1S5FD 4A3GB 5C44B 3S1NB 3DWAA 5KYIA 1DCZA 4AYBB 3UI2A 3E6ZX 3U9OA 1EZ8A 1ET6A 1RODA 5C3EB 1PXUA 1NR4A 1CT1D 5EQ0A 3FPPA 4BBRB 1KDAA 4A93B 2HDMA 3GV6A 3GQBA 5CV9A 3M3YB 2M2LA 4RHRA 4KD4A 1PFNA 2XRQD 4K2LA 3RUZA 1PLFA 3K5LA 2WKDA 4CJ1B 5C0XG 1MSGA 2JA7B 2F0QA 2KVMA 3VA5A 2NUCA 2CW0D 4X3KA 4QB4A 4R8IA 1CZGA 4U68A 1GUSA 3NBHA 3LNNA 3C2PA 2KJXA 5BN5A 5M9OA 3VR3A 5KIXA 4P2CB 2B39A 1WD0A 2OXPA 4EVOA 2A5HA 5A2QL 4EQNA 3D4RA 2IPKD 2F0PA 1FYCA 3VR4A 2RKSA 1U4PA 2EYJA 1EY8A 2K1BA 4RH6A 3NWSA 4CKBA 4R9WA 4CBVA 3GTLB 3S1QB 4HN7A 3JAML 1TWFB 3F2UA 2G9DA 4EQOA 4FF1A 4F8MA 2E2HB 3GTKB 4HMIA 1D5ZC 3SK5A 3ONAB 3M4OB 1G6ZA 2ZXPA 1IHZA 2MGSA 2F0KA 3P7JA 1IKMA 4C3JG 4PMBA 1HA6A 4FO2A 2AUKA 4DK1A 2H1EA 1HTPA 5C0XJ 1TY0A 2B2YC 1STBA 2K7VA 4DAPA 2F0HA 1JWSD 2CW0C 2XVSA 1STYA 1SNMA 3AMUA 3M85A 3AU7A 4IQZA 3T56B 1NCVA 4C56C 1O7ZA 4DAYA 5JEAG 3I90A 4B9WA 3SVMA 5E4XA 1LTAD 2EYHA 1RDPD 4N9PA 3TN2A 4RKBA 3VR5A 3G6JB 1D6EC 1HFGA 1CQFA 4C1NI 1HRJA 2PZTA 1K83B 3R3OA 4PQXA 1EY9A 2B2UA 5CBEE 2NVXB 2A6ED 1B4OA 3S9WA 3NSWA 2RQXA 3R2IA 3VYRA 3HEJA 3M7NA 4FF2A 3QO2A 4KN4C 2TMPA 1EIHA 5D14A 1D1KA 5ELDA 2B2WA 3W3AA 5COYA 3H0GB 3HOWB 1KABA 1DOMA 4H0LC 3NBIA 4CJ0B 4XT1B 2J0TD 4KKSA 5M3FB 5M5XB 5DM73 4A3IB 4A3JB 1BO0A 5IGEA 5DM63 3NXWA 2B63B 1O7LA 2X6LA 1OXXK 1SYGA 3I3CA 4X3SA 3MVVA 1WTXA 5D65A 2D9UA 1QE6A 1WTPA 1SYDA 3DUZA 1GUGA 5CORA 4K2KA 5IGBA 1JICA 2RBMA 3EA6A 3T4AC 3FVQA 1U4LA 2K01A 4KKUA 2JEAI 3W2DA 2BE5D 5D3DA 2Z1CA 3A7LA 1F9RA 1I4GA 4C3HG 5IT9L 5ELEA 2D2CC 5D3IB 4OL7A 1VF7A 2A6EC 3GP7A 2NWGA 4FYDA 3D8GA 4BWGB 3S14B 4ODGA 5J1ZA 5A2QE 4OGQC 1S5DD 4X3TA 2K03A 5KNCA 1SEBD 4BS9A 4DF7A 5CV6A 2AQ3B 1I3QB 2O4XA 3HP3A 1WTQA 3IKJA 1TY2A 2K6AA 3P75A 4WFN3 3V05A 4ZQ3A 3WOFA 4QMGA 3V96A 2JSOA 1O78A 1DOLA 1QILA 1KAAA 1KDBA 3PUYA 1OXVA 5K5PA 1SBBB 2F1MA 2EY6A 3TSSA 1Z6HA 4ZK9B 4HAEA 2JA8B 2O5JC 1HFNA 3SHLA 3NQTA 1LT3D 5BN3A 2PQEA 1C4QA 2ZXOA 1DZ1A 2KQ3A 2EPBA 1II3A 2FINB 1O80A 4TSSA 3S15B 4XDXA 2GA4B 3QG1A 1NSNS 5EKLA 5DNFA 2KCNA 3BYTB 3TZDA 4Q0FA 1CA5A 1BUVT 2B2TA 3D6WA 1BXTA 1UUPA 4ID6A 5M5YB 3SK6A 2OF1A 4XQNA 5A35A 1QWYA 1WVLA 5I6YA 3SK4A 3HG9A 2NN6I 1CK1A 4K8JA 3WDNA 3R93A 4RCNA 2IJ0A 5K36G 3QWNA 3HOYB 3PO2B 1MI2A 1HQRD 1OXUA 1XX8A 2IT1A 2HDLA 2OEOA 1PRTB 2DN8A 3Q6SA 1QB5D 5IODA 3TP7A 5IIFA 2SNSA 4I7ZC 1Y69U 3ND9A 4F88A 2SDFA 1CFMA 4JBWA 4A3MB 1V1OA 1ONLA 2K04A 1XYIA 1QJOA 2PMZB 1LACA 1EY6A 1F77A 1QNKA 2EE1A 2F0MA 1K8MA 2PYKA 4MHEA 3IFDA 3S1RB 1MGSA 4HMJA 4IALA 3A56A 4KY6A 5EPJA 1H9RA 1TS3A 1IW7D 2SNMA 4QCLA 1WD1A 2B2VC 2ENBA 5I2YA 2BCOA 2F0WA 2OT2A 2EJGC 1KLUD 2N88A 4J1MA 3OWEB 3GTQB 2C5CA 5LHY1 2R61A 4ZUJA 4K6DA 1Q90A 1M4VA 3I4MB 1WTVA 4RGTA 3KUPA 2F0UA 3CKIB 4FXGC 1MBYA 3NTIA 4KTAA 1LT6D 1LV9A 3PIO3 3A7AB 3I73A 2L11A 3S2HB 4RAUC 2RSOA 1IYVA 2KEEA 3H94A 3VYUA 2R92B 3NTKA 5DAUA 1MD2D 3L9AX 1SNCA 1EY5A 4EGVA 2FMMA 3CRKC 4KN7C 2LFNA 2B8FA 1BR9A 3J7AF 1PFMA 1GOZA 2AUJD 1H9SB 1EU3A 1V8QA 3J80L 3PUWA 2V4DA 1SXTA 3QOLA 1EQVA 1G291 1SAPA 2WAQB 2LY7A 4DU9A 5JPNC 1Y8OB 3NWTA 4CKEA 1IW7C 2K5DA 1TU2B 3KBGA 3PUZA 3HOZB 3D31A 1KLGD 3SEBA 3K57A 4V190 3S16B 3NUCA 4KHZA 2XWJB 2KUMA 3R8BA 1LTBD 4BA1I 4TQUS 1LTGD 1HPCA 4RGNA 4B9XA 4C3JB 1FGBD 1BQQT 2LMCB 3P20A 2VXWA 1IL8A 3ND8A 4I65A 4V0BA 4OO1I 5IGGA 1EQTA 2FMCA 3DWPA 5IOCA 2VUMB 4NKLA 1S5ED 4E6IA 2CVRA 3RLFA 1F9QA 1V1PB 3LWEA 1B2TA 1GHJA 1Q12A 1TS4A 2RDHA 5F2DA 2F03A 1EY4A 1SJHD 5G3LD 1B50A 2L0CA 3BDLA 1B9MA 2BA1A 4IZ8A 5C6AA 2F0TA 2Q8IB 1TWCB 1H9SA 3BDCA 1PMRA 2EZVA 3NK9A 3MFYA 3VR2A 5LL6S 3DXJC 1TKWB 3KF8A 1SMYD 4IUQA 3Q24A 4K14A 1PRTF 3DM1A 4ULLA 4N9TA 4QUFA 4IFDI 1HTLD 2SEBD 2KA7A 3K5MA 2MPMA 1AW7A 1S5CD 1BCPD 3HKZB 4FVMA 2J7ZA 1H9KA 1T5EA 4DXGA 3T51B 2QF7A 2DY7A 2DNCA 3WOEA 4DNTB 4L8JA 4RKLA 1Y8PB 5KGUA 1SSOA 1JE4A 5C4XB 1IYUA 4BBSB 1ML0D 1AP0A 4RGOS 1HCZA 1V1PA 4HR7B 3S2DB 5CGKA 1W6JA 3EQLC 3PIP3 1FD7D 2BA0A 1BBXC 4KJNA 2RDFA 4FF3A 5CV7A 1UAPA 3Q22A 2L1BA 2NYZD 1VMCA 1YNND 3BZDB 3A8IE 4XYQA 4DFAA 1M8AA 4C3HB 1AFPA 2Q8TA 1GXDC 1TS5A 2IX0A 1SMYC 4PMCA 2EY5A 3RZDB 1KNEA 5C3WA 4HTHA 3D4DA 3GTPB 1CZWA 3J80E 2BDNA 4A3KB 4TKOB 3G7LA 3LWUA 1CA6A 1U9RA 5I9OA 1XWEA 1BCPC 4K6LA 3IAYA 1XTCD 4KK7A 3MXUA 3VYTA 1GUTA 3PO3B 3K7AB 1F9SA 2I46A 2L55A 2MP1A 1CI3M 1PFBA 1ILQA 2B2TC 1SFOB 2CHBD 2KCCA 3NP8A 2F0JA 5JPMC 2R6GA 4K8IA 1EL0A 3OPOA 2N55A 3D6CA 5E1FA 4G7ZC 4DGZA 4DXFA 3TP6A 2D62A 3SK8A 2HCIA 1ESRA 1YNNC 4HCEA 5C4JB 2RA4A 1F2ZA 2QKIC 1DD2A 5EJWA 5T1GA 5CYUA 1PTOH 2RVLA 5I2XA 2DNEA 1VMPA 2AQ2B 4Q5VA 2NTSA 3N52A 4M8AA 2O2LD 4ZAIA 3OW7A 1EWCA 4ZYSA 3EVQA 3A8JE 4OIJA 5C3XA 1J9OA 1JOKA 1EIGA 1R4PB 1B1ZA 5CBAE 2XSCA 3P1HA 3M7GA 3BDOA 2K28A 4HCSA 1BOSA 1WTRA 2BDOA 1YNJD 2O5IC 4G7OC 2JP1A 4QUCA 1ZYRD 2A74C 4H13C 4G7HC 3OMGA 2EY1A 4KJOA 2E75C 5C0XI 3TBIB 4KMUC 2JA5B 1CQVA 3NE5B 5E4WC 1RF2D 2NN6H 2ZXRA 1FNUA 1U4MA 3KLSA 2B2YA 1J8IA 2NBFA 1LLRD 5DEHA 3BVZA 3DWQA 1HUMA 2FHTA 1X3PA 1NAPA 1STEA 3NHHA 1RKNA 5TSSA 3GV3A 4Y7NB 3OOCA 4CGYB 5C4HA 5E3FA 5FK9C 2WP8J 2F0SA 3Q0AA 1SNOA 1TR5A 2EYLA 5C4ZA 4X3UA 3C1FA 2A68D 2MJ8A 2EJMA 2R7ZB 5ISRA 4CKCA 3I70A 3X3NA 2J4XA 1PTOD 2HQEA 4IUTA 2Q8RE 3H3VC 3C3LA 4XQQA 1GUOA 2F0EA 1YNJC 1KNAA 4IUUA 1ZYRC 1UNSA 5EKIA 4FXDA 3K6OA 4FNFA 1PYWD 1QOHA 1TWHB 4H7BA 1GUNA 5CV8A 1BDOA 3DEOA 3TZUA 1X32A 3GO5A 3I8ZA 4ZUIA 3DMUA 3HRZC 1C48A 1EU4A 3QJYA 3DHQA 1EEID 2VB3X 2PPBC 1E0BA 1K8OA 1A15A 1I4PA 4JK1C 1I50B 2XRSD 3K58A 5ELBA 2JYOA 5G3LF 3QOJA 1EOTA 1I4HA 3FKIB 2EYMA 3OIQA 4LK1C 1CTMA 2A68C 4DNRB 1EWHA 4DK0A 1EYAA 3I4NB 1PTOC 1JR0D 3K59A 5JJZA 3DEPA 3L7ZC 1KTKA 3OIPA 3OSOA 1ENFA 2R93B 3J7YW 5AFWA 3A8KE 3VA7A 3FMCA 2Z4IA 4OHJA 2LS01 1EEFD 4C3IG 3RZOB 4WRDA 1CHQD 2XWBB 2K05A 1QG7A 1BCPF 2E2JB 4OO1H 2F0IA 2A73B 1Z47A 2I07B 3J81L 1B53A 1SE2A 3SDZA 2QCPX 1H9JA 2ICIA 4KD3A 1G8ZD 1LTSD 3HOXB 3PUXA 4WORA 5KEEA 1JOQA 4KY7A 1AEXA 2AWOA 1A2UA 1HUNA 1I4QA 3MHBA 1RHPA 3OHXC 5EBCA 1G2SA 1EYCA 5KRUA 1MSHA 4F87A 1LT5D 5FO7B 4ZKCB 2FFKB 5CC4A 2WIIB 3LX0A 3QIAA 2PNRC 4XQJA 4QIWB 2ZT9C 4IFDH 1LTID 1EZ6A 4FF4A 4ME5A 4R8NA 1PDQA 3TDQA 4NDXA 1L0XB 3HZXA 4ZKBB 1ZXTA 5IGCA 1RCVD 2VB2X 2L4NA 1WTOA 1TIID 3E0JA 3I72A 4KI0A 2B2UC 4IUNA 1EFID 3K0YA 3ZYYX 3GTGB 2L9HA 2JA6B 1H9MA 3AB9A 1DJRD 3ERQA 1STNA 1SYFA 4H44C 4MIUA 2B2WC 2B8GA 4A3EB 1I4XA 1JORA 4K5WA 1FNWA 4DAVA 2IL8A 1X3QA 1Y1VB 2X69A 2Z8LA 2B2VA 2PW5A 1E2VA 1TS2A 2ICEC 3D3RA 1G2TA 1SJED 4OIKA 5J22A 4KHVA 3BVMA 1F9PA 5EGTA 1D2BA 3T53B 1DYQA 4FXKC 5KNBA 3RMHA 4A3FB 4XIGS 4NMZA 5FLXE 1BF4A 1SE4A 1F2MA 1CHPD 2JXMB 1ZKOA 3T16A 4CJ2C 3VYSA 1SE3A 2XN9C 5I6WA 3J7AV 2F0LA 1ENAA 3RD4A 2L12A 1UEAB 5CMDA 1Z7TA 2HCCA 3TMEA 2F3VA 1CM9A 1TVXA 1VDZA 2QILA 5BN4A 3EFXD 2EYPA 2XIWA 2E76C 1ILPA 5M3MB 4O1NA 1ESFA 2ID0A 5T1IA 4RFBA 3FDTA 2PZWA 3K5NA 1XXGA 2NN6G 4M1UB 3ITPA 1V43A 1QCBD 3KK7A 2HUGA 3J81E 2F0DA 1JWUD 1STGA 3MXPA 3A54A 2R3ZA 3MWYW 3MXNA 2MUYA 1LT4D 2NVTB 1F2YA 2WACA 3GTJB 3NPPA 2XNAC 1Q1EA 5KNDA 3BG3A 5EPLA 1A6XA 5JAVA 1TT2A 1DXMA 1NR2A 4ILWA 1STAA 2QDBA 3C1EA 1A3UA 1QNUA 5JVG3 3VR6A 5HGTA 2JE6I 1Y1WB 3MAQA 4IURA 3URYA 1STHA 4Z9CB 3MC0B 3R2TA 3HGBA 1OXSC 1PTOF 2EY2A 3OMCA 5FO9B 1IKLA 2NTTA 4NW2A 3I91A 1B9NA 1HXYD 5I9PA 2EYFA 1S5BD 1AZPA 5C0XH 1WCMB 4K5XA 3BYYB 1LO5D 1A3TA 2VNUD 2FJ2A 4DN4M 4A3DB 4IN3A 2E2IB 1LTRD 3H09A 2RDGA 4RCOA 1D1IA 1PZID 4HSPA 3CQZB 3CRLC 2PZUA 3SR1A 1PZJD 4IUVA 2IX1A 3PUVA 5J39A 3M4YA 2YYZA 1JCKB 3D4WA 2EOTA 3H6MA 3SXHA 1BCPB 1PRTD 2F0FA 4HEDA 4GZYC 3PV0A 1I6VC 2A69D 4EQPA 4XXEA 3CHBD 5JEAJ 3Q23A 4A3BB 3NTHA 3KLSX 3OWFA 2K33A 4KV6A 1B44D 5EPKA 4YIJA 4C1NK 2C9OA 5NUCA 1D5XC 2Z4HA 2AWNA 3FPUB 3X3MA 1KDCA 1OO9B 4TRDA 2K5WA 4U673 4F7XA 1G91A 4DA2A 3QB3A 2G9HD 5CV4A 3U9SA 2F4IA 1AZQA 1VCIA 3TP5A 4K5VA 1NUCA 3MZ5A 4ABNA 2WKCA 3MFGA 3HS0C 4HSVA 2A6HD 2KOLA 4IUPA 4KY5A 2PW7A 3C46A 1RJTA 4G57A 1GUWA 3EROA 1RTOA 3JAME 2Y0SB 2WINB 4OO1G 5C5LA 1LTTD 5JEAH 1ICWA 4LAAA 1R9TB 5JVH3 3H91A 1TWGB 1PRTC 5EKKA 2SOBA 4XTCS 4O42A 1ZEQX 4RA8A 2A69C 3I4LA 2WB1B 2PO4A 4BY7B 1RD9D 2TSSA 4C3IB 4QF4A 1A2TA 2KECA 1LABA 4L63B 2BE5C 1JOOA 1I6HB 2X6GA 2DY8A 4PV1C 2AQ1B 2IWHA 1ET9A 2F0VA 4CHTB 3N6RA 1SYEA 2M00A 1U4RA 2NVQB 3FEWX 4UDUC 5C5MA 3MEHA 3S1MB 3PMFA 2NVYB 1JWMD 1SNQA 5FKAC 2EJFC 5HURA 1Q3LA 1Y8NB 4IFDG 4RGMA 3E5SA 1HHVA 3A55A 4S3SA 5EBDA 3S17B 4RWSC 1AN8A 1E2ZA 4MN3A 2A6HC 3TP8A 1EY0A 2IW3A 1R4QB 2E2DC 2NZ1D 3FRPB 5JOBA 1OXTA 1DM0B 3MA2B 4C2MB 5ELFA 1SDFA 4BY1B 4ZLTF 4RHSA 1VF5C 3IL8A 4B08A 5FLXL 5IGFA 2RSNA 2KHSA 1L0YB 3V2TA 2MHVA 4G4KA 3O13A 1WTWA 3NQIA 4LMQD 2NB0A 1C8CA 2EDGA 1JB3A 5LL6X 3HOVB 1F2LA 2M9VA 1BNZA 1RTNA 1TWAB 1HQMC 4FP5D 2L5TA 1HA5A 1DOKA 1I4RA 2D5DA 1A3VA 2F0NA 3EJIA 5ELCA 1FNVA 2F3WA 4BA2I 5IGDA 1GHKA 2KEDA 2YU9B 4NP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOX B;  3S16 B;  2JA8 B;  2O5J C;  3HKZ B;  2NVT B;  4A3I B;  3GTJ B;  1Y1V B;  4A3J B;  2NVQ B;  2PPB C;  3S1M B;  5C3E B;  2NVY B;  2B63 B;  3GTO B;  4BBR B;  1SFO B;  3WOE A;  3S15 B;  4A93 B;  2CW0 C;  4C3J B;  4JK1 C;  1I50 B;  3GTQ B;  3M3Y B;  3GTM B;  3K7A B;  3S17 B;  3I4M B;  3FKI B;  2A6H C;  5C4X B;  4A3F B;  2JA7 B;  4Y7N B;  1Y1W B;  4BBS B;  4LK1 C;  2VUM B;  2A68 C;  4G7Z C;  3S2D B;  5M5Y B;  4C2M B;  3EQL C;  1YNN C;  4QIW B;  4LJZ C;  5C4J B;  3I4N B;  4BY1 B;  3S2H B;  2R92 B;  1WCM B;  2A6E C;  5M5W B;  2R7Z B;  2Y0S B;  3S14 B;  1K83 B;  4C3H B;  3HOY B;  3PO2 B;  4KN7 C;  1TWC B;  3H3V C;  4A3D B;  5M3M B;  2R93 B;  2NVX B;  2E2I B;  1SMY C;  1R9T B;  3PO3 B;  1YNJ C;  3RZD B;  1TWG B;  3HOV B;  3CQZ B;  1I3Q B;  1ZYR C;  3GTP B;  3RZO B;  4KN4 C;  3DXJ C;  4A3K B;  2A69 C;  3GTL B;  3GTG B;  3S1Q B;  2JA5 B;  2WB1 B;  1TWF B;  2JA6 B;  1TWH B;  2E2J B;  1TWA B;  4A3M B;  1HQM C;  3WOF A;  2E2H B;  3GTK B;  2O5I C;  4G7O C;  2WAQ B;  2LY7 A;  4GZY C;  3HOU B;  3M4O B;  2PMZ B;  4BY7 B;  3H0G B;  4C3I B;  3HOW B;  4A3G B;  1I6V C;  5C44 B;  4G7H C;  4A3E B;  1IW7 C;  3S1N B;  3HOZ B;  3S1R B;  5M3F B;  2BE5 C;  1I6H B;  2YU9 B;  4A3B B;  3TBI B;  4KMU C;  4AYB B;  5M5X B; 
#chains in the Genus database with same CATH topology
 1O7Y A;  4IFD J;  1VQB A;  2ZJQ A;  1MHW C;  4QGU A;  4IPG A;  2NZH A;  4JI8 L;  2F0G A;  2UUA L;  4PNY A;  3PO3 H;  3K7A H;  5KYL A;  4LF5 Q;  1RIP A;  1YZ6 A;  5ELN A;  5FO8 B;  1SNP A;  4WJW A;  1U5K A;  3GTO B;  3KLR A;  4J8Q A;  1B3A A;  1Q1B A;  1T5X D;  2HHH L;  2WV6 D;  4DR1 Q;  3BVG A;  3MXG A;  1SFO H;  2F0O A;  1E22 A;  5IT9 E;  1ENC A;  3GTM B;  3IFT A;  2E74 C;  3HOW H;  3U58 A;  1YJ9 A;  1Q8I A;  4DR4 L;  4XYO A;  1EY7 A;  3CU7 A;  5M3F H;  2FXQ A;  2H4O A;  2BOS A;  5IP7 G;  1DON A;  2K32 A;  4J6H A;  3NBH B;  3K5O A;  1TQO A;  4LJZ C;  2LKV A;  1PTO B;  3PO2 G;  1E2W A;  2CQA A;  3L3O C;  1PZK D;  4QIW E;  4KKT A;  4J15 A;  4XT3 B;  5FOB B;  5M5W B;  5I4D A;  1S4Z A;  4ZRZ A;  3SE0 A;  1JQY D;  4PMW A;  2K5Q A;  2EVB A;  1C9O A;  3KF8 B;  2E5L L;  2PCF B;  2JEB I;  2YTV A;  3KBX A;  3TRZ A;  4IPD A;  1GJX A;  1EYD A;  1SND A;  2K5H A;  4UAI A;  2QEJ C;  4A3M G;  3RNU A;  1FR3 A;  4X65 Q;  3CAM A;  4DV6 L;  2IX3 A;  5CV5 A;  3GD7 A;  1IZ6 A;  3MTS A;  2L15 A;  2MO1 A;  2CQO A;  1ASY A;  3T13 A;  4L6T B;  4LFC Q;  5CR3 A;  4H02 A;  1JC7 A;  3BS1 A;  2BH8 A;  3HOV G;  5K36 H;  4UP8 A;  2EYO A;  2Q2H A;  1SYB A;  2UUC Q;  1SYC A;  3HOU B;  1D5M C;  2EXZ A;  1W6K A;  4X64 L;  1S5F D;  4A3G B;  1WOC A;  5C44 B;  3S1N B;  2ZJR A;  2CWA A;  1X3F A;  3DLL A;  1NMG A;  3DWA A;  4GLV B;  4DR6 Q;  5KYI A;  1DCZ A;  3T1H L;  2DJG C;  1VQ7 A;  4OX9 Q;  2DJF C;  5IY0 A;  4AYB B;  3UI2 A;  3E6Z X;  3U9O A;  1EZ8 A;  1W2B A;  3I2Z A;  1X56 A;  1K8A C;  4LF7 Q;  1ET6 A;  2JA5 H;  1ROD A;  3I4M G;  5C3E B;  1PXU A;  1NR4 A;  1CT1 D;  3TS0 A;  5EQ0 A;  3FPP A;  4BBR B;  1KDA A;  4A93 B;  1XPO A;  2HDM A;  3GV6 A;  3GQB A;  5CV9 A;  3M3Y B;  2M2L A;  4RHR A;  1A62 A;  4KD4 A;  1PFN A;  2XRQ D;  4K2L A;  3RUZ A;  4APV A;  1PLF A;  3K5L A;  2WKD A;  4CJ1 B;  5C0X G;  1MSG A;  1EQQ A;  2JA7 B;  1HNW L;  2F0Q A;  2KVM A;  2EIF A;  3VA5 A;  2NUC A;  2CW0 D;  4X3K A;  4QB4 A;  4R8I A;  2R92 G;  1CUK A;  1RL2 A;  1CZG A;  4U68 A;  1GUS A;  3NBH A;  4Y7N H;  3LNN A;  3C2P A;  2KJX A;  5BN5 A;  1VQC A;  5M9O A;  3VR3 A;  5KIX A;  4P2C B;  1XMO Q;  2K4K A;  2B39 A;  3PF4 A;  2CCZ A;  5FLM G;  2OXP A;  1WD0 A;  4EVO A;  3UE1 A;  1K9M C;  2UXD L;  2A5H A;  5A2Q L;  4PZ7 A;  3CW2 C;  2IPK D;  3D4R A;  4EQN A;  2F0P A;  4YY3 Q;  1NY4 A;  4R4I A;  1VQ5 A;  1FYC A;  1ASZ A;  3VR4 A;  5M5Y H;  2RKS A;  1U4P A;  1KRT A;  2EYJ A;  2WAQ G;  1EY8 A;  2K1B A;  3CCM A;  4RH6 A;  3NWS A;  4R9W A;  4CKB A;  4CBV A;  1VQD A;  2RF4 A;  3GTL B;  3S1Q B;  4HN7 A;  4HIK A;  3JAM L;  1TWF B;  3HOZ G;  3F2U A;  3T1Y Q;  2G9D A;  3W1B A;  4EQO A;  3CCS A;  1VQ4 A;  4FF1 A;  4F8M A;  2E2H B;  4JPB W;  3GTK B;  2F4V L;  4HMI A;  1D5Z C;  3E0E A;  1TWH H;  3SK5 A;  3ONA B;  3M4O B;  1G6Z A;  4NXN L;  4AQY L;  2ZXP A;  1HR0 Q;  3HOY H;  2A19 A;  5IYB H;  1IHZ A;  2MGS A;  2F0K A;  1VQI A;  3P7J A;  4O0A A;  1IKM A;  1HH2 P;  4Y52 H;  4C3J G;  4PMB A;  1WTH A;  1HA6 A;  4FO2 A;  2K5V A;  2AUK A;  1IBM Q;  5C44 G;  1YJN A;  4JW0 A;  3NEN A;  4DK1 A;  1KHI A;  2H1E A;  1CKN B;  4AYB G;  1HTP A;  5C0X J;  4BXX G;  4JI6 L;  1TY0 A;  2I5L X;  2B2Y C;  5GAH C;  1O7I A;  1STB A;  2K7V A;  4YWM A;  4DAP A;  5AJ3 Q;  2F0H A;  1JWS D;  2CW0 C;  2XVS A;  1WFQ A;  1STY A;  1OTC A;  1X65 A;  1PYS B;  1I50 H;  1SNM A;  3AMU A;  3M85 A;  3U4Z A;  2F3I A;  4LF6 L;  3AU7 A;  4IQZ A;  3T56 B;  1K73 C;  1NCV A;  3F8T A;  1KD1 C;  4C56 C;  3FKI H;  2HIX A;  1YBY A;  1O7Z A;  5LMN L;  4DAY A;  5JEA G;  3JC6 6;  3F2C A;  3I90 A;  4B9W A;  3SVM A;  5E4X A;  1LTA D;  2EYH A;  1RDP D;  4N9P A;  4JI1 L;  3TN2 A;  4RKB A;  4P74 A;  3VR5 A;  1K3R A;  1X6O A;  4GKJ L;  1EFW A;  3G6J B;  1D6E C;  1HFG A;  5GAG C;  1JJG A;  1CQF A;  4C1N I;  4LF9 Q;  1HRJ A;  2PZT A;  1K83 B;  3R3O A;  4PQX A;  3LGJ A;  1EY9 A;  2B2U A;  5CBE E;  2NVX B;  5ELO A;  2A6E D;  1B4O A;  3S9W A;  4X66 Q;  3NSW A;  2RQX A;  3R2I A;  2R93 H;  3VYR A;  3HEJ A;  3M7N A;  4FF2 A;  2RCN A;  3QO2 A;  4KN4 C;  1VQ8 A;  1N9W A;  2TMP A;  1EIH A;  5D14 A;  1D1K A;  4JI5 Q;  3RZO H;  5ELD A;  2B2W A;  1MIU A;  3HKZ G;  4UP9 A;  3W3A A;  2E2J H;  5COY A;  3H0G B;  4CDC C;  5IYC G;  3HOW B;  2KHI A;  1KAB A;  1DOM A;  4H0L C;  3NBI A;  4CJ0 B;  4XT1 B;  2J0T D;  4KKS A;  5M3F B;  5M5X B;  5DM7 3;  4DV2 Q;  4GLA C;  4A3I B;  1CKN A;  4A3J B;  4B3T Q;  1BO0 A;  5IGE A;  5DM6 3;  3HOX H;  2CWP A;  3NXW A;  2OTL A;  5C4X G;  2ES2 A;  1X55 A;  2B63 B;  1O7L A;  4JBJ A;  2X6L A;  1OXX K;  1X54 A;  1SYG A;  4BBS G;  3I3C A;  2JQO A;  4X3S A;  2JK8 A;  3MVV A;  3H3V I;  1WTX A;  5D65 A;  2D9U A;  1QE6 A;  1WTP A;  1SYD A;  3DUZ A;  1GUG A;  5COR A;  3CP0 A;  3E9I A;  4K2K A;  1A63 A;  3HKS A;  5IGB A;  1JIC A;  1VS0 A;  2RBM A;  3EA6 A;  3T4A C;  3BJU A;  2E8G A;  3FVQ A;  4P75 A;  1U4L A;  2K01 A;  4KKU A;  3CPW A;  2JEA I;  4NB3 A;  4JI0 L;  3W2D A;  2BE5 D;  5D3D A;  1HNZ Q;  2Z1C A;  3A7L A;  1F9R A;  1I4G A;  4C3H G;  5IT9 L;  3ULP A;  1PH6 A;  5ELE A;  2QEX A;  2D2C C;  5D3I B;  4OL7 A;  4NXM L;  3ICE A;  3D0F A;  1VF7 A;  4GKK L;  2A6E C;  3GP7 A;  2NWG A;  3TS2 A;  4DR2 Q;  4FYD A;  1VQJ A;  3D8G A;  4BWG B;  3S14 B;  4A3C G;  2ZTD A;  2HT1 A;  2Y0S E;  4ODG A;  5J1Z A;  4MNO A;  5A2Q E;  4OGQ C;  1S5D D;  1P8L A;  4X3T A;  3ZJY C;  1IYJ B;  3J81 c;  1IBL Q;  1Q46 A;  2K03 A;  5KNC A;  1SEB D;  4LFB L;  4BS9 A;  4DF7 A;  1CSQ A;  2AQ3 B;  5CV6 A;  1I3Q B;  2O4X A;  4GN5 A;  1FVI A;  2K75 A;  1QVG A;  3HP3 A;  1WTQ A;  3J80 c;  3IKJ A;  1TY2 A;  2K6A A;  3P75 A;  4WFN 3;  4QY7 A;  3PO3 G;  3V05 A;  4ZQ3 A;  4K0K Q;  2WB1 E;  3WOF A;  2ZM6 Q;  4QMG A;  3GTG H;  3J7A 5;  4ME3 A;  4DV3 L;  1SR3 A;  1U0L A;  2DGY A;  3V96 A;  2JSO A;  1O78 A;  1DOL A;  1QIL A;  1KAA A;  1KDB A;  1PH1 A;  3PUY A;  1OXV A;  5K5P A;  4L5T A;  1SBB B;  2F1M A;  2EY6 A;  1Z6H A;  3TSS A;  4ZK9 B;  3H0G G;  3HOW G;  4HAE A;  4A3E H;  2JA8 B;  2O5J C;  1VQK A;  1HFN A;  3SHL A;  3NQT A;  1LT3 D;  1FL0 A;  1HZB A;  5M3F G;  5BN3 A;  2PQE A;  1C4Q A;  2ZXO A;  1DZ1 A;  2KQ3 A;  2VZA A;  2EPB A;  1II3 A;  2FIN B;  1O80 A;  4TSS A;  1Y1V H;  4A3I G;  1JE5 A;  3S15 B;  1I5F A;  1SLJ A;  4XDX A;  2GA4 B;  3QG1 A;  3NEM A;  1VQH A;  1NSN S;  5EKL A;  4MZ9 A;  5DNF A;  2VL6 A;  1N33 Q;  2KCN A;  4DAM A;  3BYT B;  3TZD A;  4Q0F A;  1CA5 A;  1BUV T;  2AMC B;  2B2T A;  3D6W A;  1BXT A;  1UUP A;  4A3F H;  4ID6 A;  5M5Y B;  2Z6K C;  3SK6 A;  2OF1 A;  3CC4 A;  4XQN A;  4JI7 Q;  5A35 A;  3CCJ A;  1QWY A;  1WVL A;  1E1T A;  5I6Y A;  3SK4 A;  2V1C C;  3HG9 A;  1YVC A;  2NN6 I;  1CK1 A;  4K8J A;  3WDN A;  3R93 A;  4RCN A;  2IY5 B;  2IJ0 A;  5K36 G;  3QWN A;  1JMC A;  2Z6B A;  3HOY B;  4LUO A;  3PO2 B;  1MI2 A;  1HQR D;  1OXU A;  1XX8 A;  4PZ8 A;  2IT1 A;  3A5U A;  2HDL A;  2OEO A;  1PRT B;  1VQO A;  1PH4 A;  2DN8 A;  5M3M H;  3Q6S A;  1QB5 D;  5IOD A;  4A4I A;  3TP7 A;  1MJE A;  5IIF A;  2SNS A;  4I7Z C;  1Y69 U;  1V9P A;  3ND9 A;  2PI2 E;  4F88 A;  2SDF A;  1CFM A;  4JBW A;  4A3M B;  2CH4 W;  1V1O A;  2JA5 G;  1ONL A;  1YI2 A;  2Q2T A;  4UPA A;  5BR8 Q;  4LFA Q;  2K04 A;  1XYI A;  1QJO A;  2PMZ B;  1LAC A;  1EY6 A;  1F77 A;  1QNK A;  2EE1 A;  2F0M A;  1K8M A;  2ZJP A;  4GLX A;  2PYK A;  4MHE A;  1HR0 W;  3IFD A;  4OEL B;  3S1R B;  1FJG Q;  1MGS A;  4HMJ A;  4JVZ A;  3AFP A;  5IWA L;  1JB7 A;  2N49 A;  1YJW A;  3RN5 A;  4IAL A;  3A56 A;  4KY6 A;  1PH5 A;  5EPJ A;  1H9R A;  1TS3 A;  1IW7 D;  2NVT H;  3UDI A;  3GTJ H;  2SNM A;  4QCL A;  1WD1 A;  2B2V C;  3UDG A;  3KJO A;  2ENB A;  5I2Y A;  2BCO A;  2F0W A;  2OT2 A;  3PIO A;  2EJG C;  4LF4 L;  1KLU D;  2N88 A;  3OWE B;  4J1M A;  3GTQ B;  2C5C A;  5LHY 1;  4L5R C;  2R61 A;  4ZUJ A;  4K6D A;  1Q90 A;  1M4V A;  3I4M B;  1WTV A;  4DV4 Q;  4RGT A;  3KUP A;  4DR1 L;  2F0U A;  3CKI B;  4FXG C;  1PH7 A;  1QUQ B;  1Y1W H;  1MBY A;  2YTY A;  3NTI A;  4KTA A;  1LT6 D;  1LV9 A;  3PIO 3;  3A7A B;  2QGQ A;  4GNX B;  4JI4 L;  3I73 A;  4HIO A;  4GOP C;  2L11 A;  3S2H B;  4RAU C;  2RSO A;  2IHE A;  2KEE A;  3H94 A;  3VYU A;  1IYV A;  2R92 B;  3NTK A;  2K14 A;  5DAU A;  1MD2 D;  4DNI A;  3L9A X;  1VQG A;  1XNR Q;  1WCM H;  1SNC A;  1EY5 A;  3RR5 A;  4EGV A;  2FMM A;  3CRK C;  4KN7 C;  2LFN A;  2B8F A;  3L2P A;  1BR9 A;  1K0R A;  4DUZ L;  1PFM A;  3J7A F;  1GOZ A;  2WAQ E;  4JI8 Q;  2AUJ D;  2UUA Q;  1H9S B;  1EU3 A;  3HOY G;  5IYB G;  1V8Q A;  2E2I H;  1N36 L;  3J80 L;  1LM0 A;  3W5O A;  2CKZ B;  3PUW A;  2V4D A;  1SXT A;  1QZG A;  3QOL A;  1EQV A;  4P72 A;  5C4J H;  5LMN W;  1PFS A;  3CQZ H;  4X65 L;  1G29 1;  2KCT A;  2HHH Q;  2JJQ A;  2DUD A;  1SAP A;  2WAQ B;  2LY7 A;  2OWO A;  3KDF B;  3J80 i;  2QA4 A;  4DU9 A;  5JPN C;  4LFC L;  1Y8O B;  3NWT A;  4CKE A;  1IW7 C;  2K5D A;  1TU2 B;  3KBG A;  3PUZ A;  3HOZ B;  3D31 A;  1KLG D;  2PI2 A;  1Q81 C;  1AE2 A;  3SEB A;  3HFZ B;  3K57 A;  1UWV A;  4V19 0;  1SRU A;  3S16 B;  4QL5 A;  3NUC A;  4KHZ A;  4AYB E;  4A3B H;  4OON A;  2UUB Q;  2XWJ B;  1SMX A;  3FKI G;  2KUM A;  3R8B A;  3FP9 A;  1LTB D;  4BA1 I;  1YHQ A;  4TQU S;  1LTG D;  1HPC A;  1PH8 A;  4RGN A;  1IBK L;  4B9X A;  4C3J B;  2D0P A;  4LF7 L;  1FGB D;  1L2F A;  2C35 B;  1BQQ T;  5DLQ E;  4YHH L;  1MJC A;  2LMC B;  3P20 A;  2VXW A;  1IL8 A;  1E24 A;  4QJF A;  4LF8 L;  3ND8 A;  4I65 A;  4DUY Q;  2Q2I A;  3U50 C;  4V0B A;  3SGI A;  2QW7 A;  4OO1 I;  5IGG A;  3S24 A;  1EQT A;  2FMC A;  1XJV A;  3DWP A;  1QUQ A;  3EIV A;  5IOC A;  2VUM B;  4NKL A;  4LNQ A;  1S5E D;  4DR7 Q;  4E6I A;  4JC0 A;  1PVO A;  2CVR A;  3RLF A;  1F9Q A;  1V1P B;  3LWE A;  1B2T A;  1GHJ A;  4GNX A;  1Q12 A;  1TS4 A;  3F2B A;  1KC8 C;  2RDH A;  2KHJ A;  4DPG A;  5F2D A;  2F03 A;  2R93 G;  1EY4 A;  1SJH D;  5G3L D;  4HJ8 A;  1B50 A;  3CCE A;  4B3S L;  2L0C A;  3BDL A;  1B9M A;  1Q86 C;  2BA1 A;  4IZ8 A;  5C6A A;  1YHA A;  2XGT A;  1XMO L;  2F0T A;  2Q8I B;  4NPS A;  1TWC B;  1NE3 A;  4RG1 A;  4LWC A;  1H9S A;  4ZCK A;  3BDC A;  1PMR A;  2EZV A;  3KF6 B;  3U4V A;  3NK9 A;  3MFY A;  3VR2 A;  5LL6 S;  3DXJ C;  4DR3 L;  1AH9 A;  4GN3 B;  1TWG H;  1TKW B;  3KF8 A;  1SMY D;  4IUQ A;  1VQE A;  3HOX G;  3KDF A;  2WFW A;  3Q24 A;  1BBW A;  4K14 A;  4X62 L;  3G6E A;  2R7Z H;  1GD7 A;  1PRT F;  2AHO B;  3DM1 A;  4ULL A;  1UE5 A;  4N9T A;  4QUF A;  4IFD I;  1HTL D;  1HNW Q;  2SEB D;  2KA7 A;  3K5M A;  4BY7 H;  4PG3 A;  1D7Q A;  2MPM A;  4C3I H;  1AW7 A;  4JYA L;  1S5C D;  4FVM A;  1BCP D;  3HKZ B;  2J7Z A;  1H9K A;  1T5E A;  1I6H H;  4DXG A;  3T51 B;  1J5E Q;  2QF7 A;  2DY7 A;  5L37 A;  2DNC A;  3WOE A;  2NVQ H;  4DNT B;  1Q8K A;  3PIP A;  3S1M H;  2NVY H;  4L8J A;  2UXD Q;  4RKL A;  1Y8P B;  5KGU A;  1SSO A;  2GVA A;  4JOI C;  5JJI A;  1JE4 A;  5C4X B;  5IP7 H;  1IYU A;  4BBS B;  1HZ9 A;  3S17 H;  1ML0 D;  1AP0 A;  4RGO S;  1HCZ A;  1V1P A;  4HR7 B;  3S2D B;  5CGK A;  2ZTE A;  1W6J A;  4N8X 1;  2VS1 A;  3EQL C;  2R7F A;  3PIP 3;  1FD7 D;  2BA0 A;  2VUM G;  1BBX C;  4KJN A;  4C2M H;  2RDF A;  4FF3 A;  4L5Q A;  2F4V Q;  5CV7 A;  3GDE A;  1UAP A;  1VQA A;  4BY1 H;  3Q22 A;  1L1O C;  4NXN Q;  4AQY Q;  2L1B A;  1G6P A;  2NYZ D;  1VMC A;  1YNN D;  3BZD B;  3A8I E;  4XYQ A;  4DFA A;  1M8A A;  4C3H B;  1AFP A;  2Q8T A;  1GXD C;  1TS5 A;  2IX0 A;  1SMY C;  1K3B C;  3L0O A;  4PMC A;  3KF6 A;  3H3V H;  2EY5 A;  3RZD B;  1KNE A;  5C3W A;  4YWL A;  4HTH A;  1XNQ L;  4JI6 Q;  3D4D A;  3GTP B;  1CZW A;  3J80 E;  2RHQ B;  4B3M L;  2BDN A;  4A3K B;  4JG2 A;  3HOV H;  4TKO B;  3I4N H;  4WJ3 M;  5GRO A;  3CC7 A;  3G7L A;  4A75 A;  3LWU A;  1TXY A;  1CA6 A;  1U9R A;  5I9O A;  3CME A;  1XWE A;  1BCP C;  4K6L A;  1Y1V G;  3IAY A;  3AYH B;  1XTC D;  4KK7 A;  3MXU A;  4YCW A;  4JI5 L;  3VYT A;  1GUT A;  3PO3 B;  5IYD H;  3K7A B;  1F9S A;  5LMN Q;  2I46 A;  1PV4 A;  3F1Z A;  2L55 A;  2MP1 A;  4JBK A;  1CI3 M;  2YU9 H;  2ALY B;  1VQF A;  1PFB A;  1ILQ A;  4JI1 Q;  2B2T C;  4A3F G;  3J7Z C;  1Z9F A;  1SFO B;  1BKB A;  4GKJ Q;  2CHB D;  1C0A A;  2KCC A;  3NP8 A;  2F0J A;  1E1O A;  5JPM C;  3GTO H;  1XMQ Q;  2I0Q A;  2KEN A;  4IO9 A;  2VQE L;  2UXC Q;  1B70 B;  2R6G A;  4K8I A;  2UU9 L;  4A3L H;  3ULJ A;  4TVA B;  1EL0 A;  3GTM H;  3OPO A;  1HNX Q;  2N55 A;  3D6C A;  5FLX c;  5E1F A;  4O2D A;  4G7Z C;  4DGZ A;  4DXF A;  3TP6 A;  2D62 A;  3M4Q A;  4DV7 L;  3SK8 A;  1JT8 A;  2HCI A;  1ESR A;  1YNN C;  1M90 C;  4HCE A;  5C4J B;  2RA4 A;  1F2Z A;  2QKI C;  1DD2 A;  5EJW A;  3MEF A;  4L5S A;  5T1G A;  5CYU A;  5FLM H;  1PTO H;  2RVL A;  4DR5 L;  3PCO B;  5I2X A;  2DNE A;  4R4T A;  1VMP A;  5M5W H;  1N34 L;  4POG A;  2AQ2 B;  4Q5V A;  4IPH A;  2NTS A;  3N52 A;  4M8A A;  1GM5 A;  2O2L D;  5JJL A;  4ZAI A;  3OW7 A;  5H1S E;  1EWC A;  4ZYS A;  3EVQ A;  1SE8 A;  3A8J E;  4OIJ A;  5C3X A;  4JV5 Q;  1J9O A;  1JOK A;  3TRE A;  1EIG A;  1R4P B;  1B1Z A;  5CBA E;  2XSC A;  2LSS A;  3P1H A;  3M7G A;  3BDO A;  3KFU A;  2K28 A;  4HCS A;  4UY8 C;  1BOS A;  3K7U C;  1WTR A;  4N8F A;  2BDO A;  1YNJ D;  2O5I C;  4G7O C;  2JP1 A;  4QUC A;  4A3K G;  3J81 j;  4HIM A;  1ZYR D;  4DV0 L;  2A74 C;  4H13 C;  4G7H C;  3OMG A;  2EY1 A;  1X9N A;  3HOU H;  2N8N A;  5GAE C;  4A76 A;  1P16 A;  4KJO A;  2E75 C;  5C0X I;  3TBI B;  4KMU C;  4A3G H;  2JA5 B;  1CQV A;  3NE5 B;  5E4W C;  5C44 H;  3S1N H;  2OTJ A;  1RF2 D;  2NN6 H;  4DV5 Q;  2ZXR A;  4GN4 B;  4LUZ A;  1CKO A;  1FNU A;  1U4M A;  3KLS A;  2B2Y A;  1J8I A;  2NBF A;  1LLR D;  5DEH A;  3BVZ A;  4NXM Q;  2JA6 H;  3DWQ A;  4GKK Q;  1KIX A;  1HUM A;  2FHT A;  1YHB A;  5C3E H;  1X3P A;  4QQB X;  4BBR H;  1NAP A;  2A8V A;  1STE A;  5E7N A;  4A93 H;  3NHH A;  2PNH A;  1NMF A;  1I94 L;  1RKN A;  5TSS A;  3M9B A;  3GV3 A;  3M3Y H;  3PQI A;  4Y7N B;  3OOC A;  4CGY B;  5C4H A;  5E3F A;  4CDF C;  4LFB Q;  5FK9 C;  1WCM G;  2JA7 H;  4WJ4 A;  2WP8 J;  2F0S A;  1N33 L;  3Q0A A;  1SNO A;  1Q7Y C;  1G51 A;  1TR5 A;  2EYL A;  5C4Z A;  4X3U A;  3C1F A;  1N32 Q;  2A68 D;  1JJ2 A;  2MJ8 A;  4DV3 Q;  4HJ5 A;  5HGQ A;  4JI2 Q;  2EJM A;  2R7Z B;  1QVC A;  5ISR A;  2Q2U A;  4CKC A;  3I70 A;  3X3N A;  4ALP A;  2J4X A;  1PTO D;  2HQE A;  4IUT A;  2Q8R E;  2UXB Q;  3H3V C;  3FHW A;  3C3L A;  4XQQ A;  1GUO A;  1HJP A;  2F0E A;  4DK3 C;  1YNJ C;  5LMU L;  2HIV A;  4FDB A;  1KNA A;  1PH9 A;  4IUU A;  1ZYR C;  1UNS A;  5EKI A;  4FXD A;  3K6O A;  4FNF A;  4KLK A;  1JJC B;  1PYW D;  1QOH A;  1TWH B;  3PGZ A;  2JA9 A;  3ER0 A;  4A3B G;  4H7B A;  1GUN A;  5CV8 A;  1BDO A;  3GTL H;  3DEO A;  3TZU A;  1ICF B;  3S1Q H;  4DKA C;  4B3R L;  2I5H A;  5IYC H;  2E2H H;  3GTK H;  1UE6 A;  1X32 A;  3GO5 A;  3I8Z A;  4ZUI A;  3DMU A;  2PMZ E;  3HRZ C;  3M4O H;  3K81 C;  1WI5 A;  4CDD C;  1D8L A;  1C48 A;  1EU4 A;  3QJY A;  3DHQ A;  3KYH C;  1EEI D;  4P73 A;  4DV1 Q;  3E3X A;  4JI3 L;  1FJG L;  2VB3 X;  2PPB C;  1E0B A;  1K28 A;  1X3E A;  2CH4 A;  1SN8 A;  1S3O A;  1K8O A;  1A15 A;  1I4P A;  4JK1 C;  3F2D A;  1I50 B;  2XRS D;  3K58 A;  3OTO L;  1AE3 A;  1CKM A;  2N3S A;  2OQK A;  3E9H A;  5ELB A;  2JYO A;  5G3L F;  2AKW B;  3QOJ A;  1EOT A;  1I4H A;  3FKI B;  2EYM A;  3CCL A;  2RCF A;  4AH6 A;  4R1J A;  1YIJ A;  3OIQ A;  4LK1 C;  1CTM A;  2A68 C;  1LUZ A;  4DNR B;  1EWH A;  4DK0 A;  2Y0S G;  1EYA A;  5IP9 H;  3CXC A;  3I4N B;  4LF5 L;  1PTO C;  1LYL A;  2VW9 A;  1KAW A;  1LTL A;  2VQF Q;  3B6Y A;  1EIY B;  1JR0 D;  3K59 A;  1KQS A;  5JJK A;  4CDE C;  3W1G A;  5JJZ A;  3DEP A;  2PQA B;  4OWW B;  3Q8D A;  1L0W A;  3L7Z C;  3JAM c;  2WB1 G;  1KTK A;  3OIP A;  3K8A A;  3OSO A;  1H95 A;  2R7Z G;  1ENF A;  2R93 B;  5IWA Q;  5GAD C;  3J7Y W;  5AFW A;  2N78 A;  1K83 H;  3A8K E;  3VA7 A;  3FMC A;  2Z4I A;  2NVX H;  4BY7 G;  4OHJ A;  2Z0S A;  2LS0 1;  1EEF D;  2EXD A;  4C3I G;  3RZO B;  3A0J A;  1E7Z A;  4KHP Q;  1CHQ D;  4WRD A;  2XWB B;  2K05 A;  1QG7 A;  3CMA A;  1BCP F;  4LF4 Q;  2E2J B;  1J6Q A;  4OO1 H;  3I4O A;  2CFM A;  2A73 B;  2F0I A;  1Z47 A;  2I07 B;  3J81 L;  1B53 A;  1SE2 A;  3CCR A;  1W3S A;  3SDZ A;  2QCP X;  2GN5 A;  4POF A;  1H9J A;  2ICI A;  4KD3 A;  4OWT B;  4A3D H;  1G8Z D;  3H0G H;  3CF5 A;  3J81 i;  1LTS D;  3HOX B;  3PUX A;  4WOR A;  5KEE A;  1JOQ A;  4KY7 A;  4JI4 Q;  5M5X H;  1AEX A;  2AWO A;  4A3I H;  1A2U A;  3CCU A;  1HUN A;  4A3J H;  1I4Q A;  3MHB A;  1RHP A;  4DR4 Q;  3G71 A;  3OHX C;  5EBC A;  2B63 H;  1G2S A;  5J3B A;  2UUB L;  1EYC A;  4EQ5 A;  2MQH A;  5EAY A;  5KRU A;  2UUC L;  1VQN A;  1NJI C;  1MSH A;  4DUZ Q;  4BY1 G;  4F87 A;  1B7Y B;  1LT5 D;  1EQR A;  2Z6K A;  5FO7 B;  4ZKC B;  1N36 Q;  2FFK B;  4DR6 L;  4IJL A;  2WII B;  5CC4 A;  3LX0 A;  4DUY L;  4OX9 L;  3CD6 A;  3QIA A;  2PNR C;  4XQJ A;  3BZK A;  4QIW B;  2ZT9 C;  4GOP B;  1LTI D;  4IFD H;  1EZ6 A;  2YV5 A;  4FF4 A;  2E5L Q;  4DR7 L;  2RHS B;  1XPR A;  4ME5 A;  1S40 A;  4R8N A;  1VQM A;  1PDQ A;  2F52 A;  3TDQ A;  4NDX A;  1L0X B;  3HZX A;  2PQA A;  3I4N G;  3VDY A;  4ZKB B;  1VQP A;  1ZXT A;  5IGC A;  1RCV D;  2LXK A;  4DV6 Q;  2VB2 X;  1EWI A;  2L4N A;  3AQQ A;  3NEL A;  1WTO A;  3S14 H;  1TII D;  3E0J A;  3I72 A;  4KI0 A;  5IE8 A;  2B2U C;  4HID A;  2KBN A;  2QDL A;  4IUN A;  5FJ8 H;  1EFI D;  3K0Y A;  3ZYY X;  5IYD G;  3GTG B;  4UP7 A;  1IBK Q;  2L9H A;  4X64 Q;  2JA6 B;  1I3Q H;  1H9M A;  3AB9 A;  1DJR D;  2OCE A;  4YHH Q;  3ERQ A;  1STN A;  1SYF A;  4LF8 Q;  3T1H Q;  4H44 C;  4MIU A;  4YWK A;  2B2W C;  2HQL A;  2B8G A;  4A3E B;  1I4X A;  3RLO A;  3WWV A;  1JOR A;  3MXN B;  4K5W A;  1FNW A;  2ZTC A;  4YY3 L;  1R9T H;  4DAV A;  3OYY A;  4A3L G;  2IL8 A;  1X3Q A;  1Y1V B;  2X69 A;  2Z8L A;  2B2V A;  2PW5 A;  1E2V A;  3HKZ E;  1TS2 A;  2ICE C;  4OWX B;  2JA8 H;  3EBE A;  3D3R A;  1V1Q A;  4MTK A;  1G2T A;  1SJE D;  4B3S Q;  4OIK A;  5J22 A;  1B8A A;  4DAY B;  3T1Y L;  4KHV A;  1J5E L;  3BVM A;  3S15 H;  1F9P A;  3AEV A;  5EGT A;  3I56 A;  1D2B A;  3T53 B;  1DYQ A;  4FXK C;  5IT9 c;  5KNB A;  3RMH A;  4A3F B;  4IJH A;  4XIG S;  4NMZ A;  5FLX E;  1BF4 A;  1SE4 A;  1HR0 L;  3RLN A;  1F2M A;  1YNX A;  1CHP D;  2JXM B;  4HJA A;  3K0X A;  1ZKO A;  3T16 A;  2MFI A;  4CJ2 C;  4DR3 Q;  4GOP A;  3VYS A;  4X6A H;  1IBM L;  1SE3 A;  2XN9 C;  5I6W A;  3ERS X;  4LUV A;  3J7A V;  2F0L A;  4MTN A;  3CCQ A;  1ENA A;  3RD4 A;  3IRB A;  2L12 A;  4X62 Q;  1UEA B;  4LW1 A;  4GS3 A;  5CMD A;  1Z7T A;  2HCC A;  3TME A;  5AJ3 L;  2F3V A;  1CM9 A;  1TVX A;  1VDZ A;  1VQL A;  2QIL A;  5BN4 A;  1M1K C;  1NTG A;  3EFX D;  2EYP A;  2XIW A;  4JCV E;  4JYA Q;  2E76 C;  1ILP A;  5M3M B;  1KXL A;  4EX5 A;  3BU2 A;  3JAM i;  3PO2 H;  4O1N A;  1BVS A;  1C7Y A;  1KL9 A;  1ESF A;  2OQ0 A;  3HOU G;  2ID0 A;  5T1I A;  4YCV A;  4A3G G;  4RFB A;  3FDT A;  2PZW A;  3K5N A;  1XXG A;  2NN6 G;  4M1U B;  3TEH B;  3ITP A;  3BZC A;  1V43 A;  1QCB D;  3KK7 A;  2HUG A;  2B3G A;  3J81 E;  2F0D A;  1JWU D;  2JA6 G;  4A3M H;  1A8V A;  1STG A;  3MXP A;  1HZA A;  3A54 A;  4RMF A;  2R3Z A;  5C3E G;  3MWY W;  3MXN A;  1SRO A;  4LF9 L;  4BBR G;  4A93 G;  2IHF A;  2MUY A;  2GVB A;  1LT4 D;  2NVT B;  1F2Y A;  2D0O A;  2WAC A;  4A3E G;  3S1R H;  3NPP A;  3GTJ B;  2XNA C;  1Q1E A;  4X66 L;  5KND A;  3BG3 A;  2JN4 A;  5EPL A;  2JA7 G;  1A6X A;  3UDF A;  5JAV A;  1TT2 A;  4R4O A;  1YIT A;  1DXM A;  1TWA H;  4IOC A;  4HJ9 A;  1NR2 A;  4OEM B;  4LF6 Q;  4ILW A;  1STA A;  2QDB A;  3C1E A;  1A3U A;  1QNU A;  5JVG 3;  3GTQ H;  3VR6 A;  5HGT A;  2JE6 I;  4IPC A;  1Y1W B;  3MAQ A;  3UE0 A;  4IUR A;  1XPU A;  1KRS A;  3URY A;  3G48 A;  1XMQ L;  1STH A;  4Z9C B;  3I4M H;  3MC0 B;  2ATW A;  2UXC L;  1XNQ Q;  1HZC A;  3R2T A;  3HGB A;  1OXS C;  1PTO F;  2EY2 A;  3OMC A;  4DV2 L;  5FO9 B;  4B3M Q;  1IKL A;  1HNX L;  2NTT A;  4B3T L;  4NW2 A;  3I91 A;  1B9N A;  1HXY D;  1YEZ A;  5I9P A;  2EYF A;  3UDX A;  1S5B D;  1AZP A;  2K52 A;  1QVF A;  4JBM A;  1L1O B;  1WCM B;  5C0X H;  3S2H H;  2LXJ A;  3BYY B;  4K5X A;  3A5Z B;  1LO5 D;  1A3T A;  3M4P A;  2R92 H;  2VNU D;  2FJ2 A;  4DN4 M;  4A3D B;  4IN3 A;  5GQO A;  2E2I B;  1Y14 B;  1CSP A;  1LTR D;  3K80 C;  3H09 A;  1PH3 A;  2RDG A;  3EN2 A;  2VY3 A;  4I7A A;  4RCO A;  1D1I A;  1PZI D;  4HSP A;  3H15 A;  3CQZ B;  3CRL C;  5M3M G;  2PZU A;  3SR1 A;  1PZJ D;  4IUV A;  1PH2 A;  2IX1 A;  3PUV A;  4R4C A;  1HNZ L;  5J39 A;  4YCU A;  3M4Y A;  2YYZ A;  1JCK B;  3D4W A;  3I7F A;  2MNA A;  2EOT A;  3H6M A;  3SXH A;  1BCP B;  2VQE Q;  4JV5 L;  1PRT D;  2F0F A;  4HED A;  4GZY C;  2UU9 Q;  3A74 A;  3PV0 A;  1I6V C;  2YTX A;  2A69 D;  4DR2 L;  2KCM A;  4EQP A;  4XXE A;  3CHB D;  3RN2 A;  5JEA J;  3Q23 A;  1VQ6 A;  4A3B B;  3NTH A;  2MO0 A;  3KLS X;  3OWF A;  4DV7 Q;  2K33 A;  4KV6 A;  3HOZ H;  4R4Q A;  1IBL L;  1B44 D;  5EPK A;  4YIJ A;  1DGS A;  4C1N K;  2C9O A;  3S16 H;  5NUC A;  1D5X C;  2Z4H A;  2AWN A;  3PF5 A;  3FPU B;  3X3M A;  4P71 A;  4DV5 L;  4DR5 Q;  3ULL A;  1KDC A;  1OO9 B;  4TRD A;  2K5W A;  5IP9 G;  4F7X A;  4U67 3;  2ASB A;  1G91 A;  4DA2 A;  4JOI A;  3QB3 A;  2G9H D;  5CV4 A;  1VQ9 A;  4K0K L;  1N34 Q;  2ZM6 L;  3U9S A;  2F4I A;  1AZQ A;  4C3J H;  1VCI A;  3TP5 A;  4K5V A;  1NUC A;  1BBU A;  3MZ5 A;  4UHV A;  4JI0 Q;  4ABN A;  1S72 A;  2H5X A;  2WKC A;  3MFG A;  1UE1 A;  3AFQ A;  4BXX H;  4HJ7 A;  1Y1W G;  3HS0 C;  4HSV A;  2VUM H;  2EQS A;  2A6H D;  2KOL A;  3OW2 A;  4IOA A;  1NNX A;  4IUP A;  4KY5 A;  4OXP A;  1L1O A;  1A0I A;  2PW7 A;  1E3P A;  3C46 A;  1RJT A;  4G57 A;  4DV0 Q;  1GKH A;  1GUW A;  3ERO A;  1RTO A;  3JAM E;  2Y0S B;  2HD3 A;  2WIN B;  4OO1 G;  5C5L A;  1GVP A;  1QZH A;  1N32 L;  4JI2 L;  1LTT D;  3KLW A;  5JEA H;  1ICW A;  4LAA A;  1R9T B;  3CCV A;  5HY6 A;  5JVH 3;  3H91 A;  1TWC H;  1TWG B;  1PRT C;  4A3D G;  5EKK A;  2SOB A;  2UXB L;  4XTC S;  1N8R C;  4O42 A;  1ZEQ X;  3PSI A;  4JI7 L;  4RA8 A;  1PYB A;  2A69 C;  3G4S A;  3I4L A;  2WB1 B;  2PO4 A;  3DM3 A;  2K50 A;  1I94 Q;  4A3J G;  4BY7 B;  1RD9 D;  2TSS A;  4C3I B;  1FGU A;  4QF4 A;  2B63 G;  2P5Z X;  1A2T A;  2KEC A;  1EYG A;  1LAB A;  4L63 B;  2BE5 C;  1JOO A;  1I6H B;  1EIF A;  2X6G A;  1PHJ A;  2DY8 A;  4PV1 C;  1K8G A;  2AQ1 B;  2IWH A;  3STB D;  1ET9 A;  2F0V A;  2R7D A;  3N6R A;  1SYE A;  2M00 A;  1U4R A;  4CHT B;  1PA6 A;  2NVQ B;  3FEW X;  4UDU C;  4AIM A;  5C5M A;  2NZO A;  3MEH A;  3S1M B;  3PMF A;  2NVY B;  4PZ6 A;  1X3G A;  1TWF H;  1JWM D;  1SNQ A;  5FKA C;  2EJF C;  5HUR A;  2Z9H A;  1Q3L A;  3CPF A;  1Y8N B;  1WYD A;  2BH2 A;  4DV1 L;  4IFD G;  4RGM A;  3E5S A;  1HHV A;  3A55 A;  2K5N A;  4S3S A;  5EBD A;  5BR8 L;  3S17 B;  4RWS C;  4LFA L;  1AN8 A;  1E2Z A;  4MN3 A;  2A6H C;  3TP8 A;  3TQY A;  1EOV A;  1EY0 A;  2IW3 A;  1K0S A;  1R4Q B;  2E2D C;  2NZ1 D;  5LMU Q;  3FRP B;  5JOB A;  5C4X H;  1OXT A;  1DM0 B;  3MA2 B;  4C2M B;  4BBS H;  1GO3 E;  2I5M X;  5ELF A;  3S2D H;  1SDF A;  4GNX C;  4BY1 B;  4ZLT F;  4RHS A;  1UEB A;  1VF5 C;  5FJ8 G;  3QR8 A;  4B3R Q;  3IL8 A;  4B08 A;  1IXR A;  5FLX L;  5IGF A;  2RSN A;  1Q82 C;  2KHS A;  1L0Y B;  3V2T A;  2MHV A;  3CC2 A;  4G4K A;  1WJJ A;  1B3Q A;  2VQF L;  3O13 A;  1WTW A;  1NBW A;  3NQI A;  2A1A A;  4LMQ D;  2NB0 A;  1C8C A;  2EDG A;  4DV4 L;  1JB3 A;  1T9H A;  4C3H H;  5LL6 X;  3KJP A;  3I55 A;  4JI3 Q;  3HOV B;  1MKH A;  1F2L A;  3RZD H;  2M9V A;  2B29 A;  1BNZ A;  1RTN A;  3OTO Q;  3GTP H;  1TWA B;  1HQM C;  4FP5 D;  4A3K H;  4A3C H;  2JA8 G;  2L5T A;  1HA5 A;  1DOK A;  1I4R A;  2D5D A;  1A3V A;  3STB C;  1UE7 A;  2F0N A;  4KHP L;  1XTD A;  3EJI A;  2XTI A;  4DK6 C;  1EUJ A;  3KOJ A;  5ELC A;  1XNR L;  1FNV A;  2F3W A;  4BA2 I;  5IGD A;  1GHK A;  2G5D A;  2KED A;  2YU9 B;  4NP5 A;  1IL2 A; 
#chains in the Genus database with same CATH homology
 1O7Y A;  4IFD J;  2F0G A;  4PNY A;  5KYL A;  5FO8 B;  1SNP A;  4WJW A;  3GTO B;  3KLR A;  4J8Q A;  1B3A A;  1Q1B A;  1T5X D;  2WV6 D;  3BVG A;  3MXG A;  2F0O A;  5IT9 E;  1ENC A;  3GTM B;  3IFT A;  2E74 C;  1Q8I A;  4XYO A;  1EY7 A;  3CU7 A;  2H4O A;  2BOS A;  1DON A;  2K32 A;  4J6H A;  3K5O A;  1TQO A;  4LJZ C;  2LKV A;  1PTO B;  1E2W A;  2CQA A;  3L3O C;  1PZK D;  4KKT A;  4XT3 B;  5FOB B;  5M5W B;  5I4D A;  1S4Z A;  4ZRZ A;  3SE0 A;  1JQY D;  4PMW A;  2K5Q A;  2EVB A;  2PCF B;  2JEB I;  3KBX A;  1GJX A;  1EYD A;  1SND A;  4UAI A;  2QEJ C;  1FR3 A;  2IX3 A;  5CV5 A;  3GD7 A;  3MTS A;  3T13 A;  4L6T B;  5CR3 A;  1JC7 A;  3BS1 A;  5K36 H;  2EYO A;  1SYB A;  1SYC A;  3HOU B;  1D5M C;  2EXZ A;  1W6K A;  1S5F D;  4A3G B;  5C44 B;  3S1N B;  3DWA A;  5KYI A;  1DCZ A;  4AYB B;  3UI2 A;  3E6Z X;  3U9O A;  1EZ8 A;  1ET6 A;  1ROD A;  5C3E B;  1PXU A;  1NR4 A;  1CT1 D;  5EQ0 A;  3FPP A;  4BBR B;  1KDA A;  4A93 B;  2HDM A;  3GV6 A;  3GQB A;  5CV9 A;  3M3Y B;  2M2L A;  4RHR A;  4KD4 A;  1PFN A;  2XRQ D;  4K2L A;  3RUZ A;  1PLF A;  3K5L A;  2WKD A;  4CJ1 B;  5C0X G;  1MSG A;  2JA7 B;  2F0Q A;  2KVM A;  3VA5 A;  2NUC A;  2CW0 D;  4X3K A;  4QB4 A;  4R8I A;  1CZG A;  4U68 A;  1GUS A;  3NBH A;  3LNN A;  3C2P A;  2KJX A;  5BN5 A;  5M9O A;  3VR3 A;  5KIX A;  4P2C B;  2B39 A;  1WD0 A;  2OXP A;  4EVO A;  2A5H A;  5A2Q L;  4EQN A;  3D4R A;  2IPK D;  2F0P A;  1FYC A;  3VR4 A;  2RKS A;  1U4P A;  2EYJ A;  1EY8 A;  2K1B A;  4RH6 A;  3NWS A;  4CKB A;  4R9W A;  4CBV A;  3GTL B;  3S1Q B;  4HN7 A;  3JAM L;  1TWF B;  3F2U A;  2G9D A;  4EQO A;  4FF1 A;  4F8M A;  2E2H B;  3GTK B;  4HMI A;  1D5Z C;  3SK5 A;  3ONA B;  3M4O B;  1G6Z A;  2ZXP A;  1IHZ A;  2MGS A;  2F0K A;  3P7J A;  1IKM A;  4C3J G;  4PMB A;  1HA6 A;  4FO2 A;  2AUK A;  4DK1 A;  2H1E A;  1HTP A;  5C0X J;  1TY0 A;  2B2Y C;  1STB A;  2K7V A;  4DAP A;  2F0H A;  1JWS D;  2CW0 C;  2XVS A;  1STY A;  1SNM A;  3AMU A;  3M85 A;  3AU7 A;  4IQZ A;  3T56 B;  1NCV A;  4C56 C;  1O7Z A;  4DAY A;  5JEA G;  3I90 A;  4B9W A;  3SVM A;  5E4X A;  1LTA D;  2EYH A;  1RDP D;  4N9P A;  3TN2 A;  4RKB A;  3VR5 A;  3G6J B;  1D6E C;  1HFG A;  1CQF A;  4C1N I;  1HRJ A;  2PZT A;  1K83 B;  3R3O A;  4PQX A;  1EY9 A;  2B2U A;  5CBE E;  2NVX B;  2A6E D;  1B4O A;  3S9W A;  3NSW A;  2RQX A;  3R2I A;  3VYR A;  3HEJ A;  3M7N A;  4FF2 A;  3QO2 A;  4KN4 C;  2TMP A;  1EIH A;  5D14 A;  1D1K A;  5ELD A;  2B2W A;  3W3A A;  5COY A;  3H0G B;  3HOW B;  1KAB A;  1DOM A;  4H0L C;  3NBI A;  4CJ0 B;  4XT1 B;  2J0T D;  4KKS A;  5M3F B;  5M5X B;  5DM7 3;  4A3I B;  4A3J B;  1BO0 A;  5IGE A;  5DM6 3;  3NXW A;  2B63 B;  1O7L A;  2X6L A;  1OXX K;  1SYG A;  3I3C A;  4X3S A;  3MVV A;  1WTX A;  5D65 A;  2D9U A;  1QE6 A;  1WTP A;  1SYD A;  3DUZ A;  1GUG A;  5COR A;  4K2K A;  5IGB A;  1JIC A;  2RBM A;  3EA6 A;  3T4A C;  3FVQ A;  1U4L A;  2K01 A;  4KKU A;  2JEA I;  3W2D A;  2BE5 D;  5D3D A;  2Z1C A;  3A7L A;  1F9R A;  1I4G A;  4C3H G;  5IT9 L;  5ELE A;  2D2C C;  5D3I B;  4OL7 A;  1VF7 A;  2A6E C;  3GP7 A;  2NWG A;  4FYD A;  3D8G A;  4BWG B;  3S14 B;  4ODG A;  5J1Z A;  5A2Q E;  4OGQ C;  1S5D D;  4X3T A;  2K03 A;  5KNC A;  1SEB D;  4BS9 A;  4DF7 A;  5CV6 A;  2AQ3 B;  1I3Q B;  2O4X A;  3HP3 A;  1WTQ A;  3IKJ A;  1TY2 A;  2K6A A;  3P75 A;  4WFN 3;  3V05 A;  4ZQ3 A;  3WOF A;  4QMG A;  3V96 A;  2JSO A;  1O78 A;  1DOL A;  1QIL A;  1KAA A;  1KDB A;  3PUY A;  1OXV A;  5K5P A;  1SBB B;  2F1M A;  2EY6 A;  3TSS A;  1Z6H A;  4ZK9 B;  4HAE A;  2JA8 B;  2O5J C;  1HFN A;  3SHL A;  3NQT A;  1LT3 D;  5BN3 A;  2PQE A;  1C4Q A;  2ZXO A;  1DZ1 A;  2KQ3 A;  2EPB A;  1II3 A;  2FIN B;  1O80 A;  4TSS A;  3S15 B;  4XDX A;  2GA4 B;  3QG1 A;  1NSN S;  5EKL A;  5DNF A;  2KCN A;  3BYT B;  3TZD A;  4Q0F A;  1CA5 A;  1BUV T;  2B2T A;  3D6W A;  1BXT A;  1UUP A;  4ID6 A;  5M5Y B;  3SK6 A;  2OF1 A;  4XQN A;  5A35 A;  1QWY A;  1WVL A;  5I6Y A;  3SK4 A;  3HG9 A;  2NN6 I;  1CK1 A;  4K8J A;  3WDN A;  3R93 A;  4RCN A;  2IJ0 A;  5K36 G;  3QWN A;  3HOY B;  3PO2 B;  1MI2 A;  1HQR D;  1OXU A;  1XX8 A;  2IT1 A;  2HDL A;  2OEO A;  1PRT B;  2DN8 A;  3Q6S A;  1QB5 D;  5IOD A;  3TP7 A;  5IIF A;  2SNS A;  4I7Z C;  1Y69 U;  3ND9 A;  4F88 A;  2SDF A;  1CFM A;  4JBW A;  4A3M B;  1V1O A;  1ONL A;  2K04 A;  1XYI A;  1QJO A;  2PMZ B;  1LAC A;  1EY6 A;  1F77 A;  1QNK A;  2EE1 A;  2F0M A;  1K8M A;  2PYK A;  4MHE A;  3IFD A;  3S1R B;  1MGS A;  4HMJ A;  4IAL A;  3A56 A;  4KY6 A;  5EPJ A;  1H9R A;  1TS3 A;  1IW7 D;  2SNM A;  4QCL A;  1WD1 A;  2B2V C;  2ENB A;  5I2Y A;  2BCO A;  2F0W A;  2OT2 A;  2EJG C;  1KLU D;  2N88 A;  4J1M A;  3OWE B;  3GTQ B;  2C5C A;  5LHY 1;  2R61 A;  4ZUJ A;  4K6D A;  1Q90 A;  1M4V A;  3I4M B;  1WTV A;  4RGT A;  3KUP A;  2F0U A;  3CKI B;  4FXG C;  1MBY A;  3NTI A;  4KTA A;  1LT6 D;  1LV9 A;  3PIO 3;  3A7A B;  3I73 A;  2L11 A;  3S2H B;  4RAU C;  2RSO A;  1IYV A;  2KEE A;  3H94 A;  3VYU A;  2R92 B;  3NTK A;  5DAU A;  1MD2 D;  3L9A X;  1SNC A;  1EY5 A;  4EGV A;  2FMM A;  3CRK C;  4KN7 C;  2LFN A;  2B8F A;  1BR9 A;  3J7A F;  1PFM A;  1GOZ A;  2AUJ D;  1H9S B;  1EU3 A;  1V8Q A;  3J80 L;  3PUW A;  2V4D A;  1SXT A;  3QOL A;  1EQV A;  1G29 1;  1SAP A;  2WAQ B;  2LY7 A;  4DU9 A;  5JPN C;  1Y8O B;  3NWT A;  4CKE A;  1IW7 C;  2K5D A;  1TU2 B;  3KBG A;  3PUZ A;  3HOZ B;  3D31 A;  1KLG D;  3SEB A;  3K57 A;  4V19 0;  3S16 B;  3NUC A;  4KHZ A;  2XWJ B;  2KUM A;  3R8B A;  1LTB D;  4BA1 I;  4TQU S;  1LTG D;  1HPC A;  4RGN A;  4B9X A;  4C3J B;  1FGB D;  1BQQ T;  2LMC B;  3P20 A;  2VXW A;  1IL8 A;  3ND8 A;  4I65 A;  4V0B A;  4OO1 I;  5IGG A;  1EQT A;  2FMC A;  3DWP A;  5IOC A;  2VUM B;  4NKL A;  1S5E D;  4E6I A;  2CVR A;  3RLF A;  1F9Q A;  1V1P B;  3LWE A;  1B2T A;  1GHJ A;  1Q12 A;  1TS4 A;  2RDH A;  5F2D A;  2F03 A;  1EY4 A;  1SJH D;  5G3L D;  1B50 A;  2L0C A;  3BDL A;  1B9M A;  2BA1 A;  4IZ8 A;  5C6A A;  2F0T A;  2Q8I B;  1TWC B;  1H9S A;  3BDC A;  1PMR A;  2EZV A;  3NK9 A;  3MFY A;  3VR2 A;  5LL6 S;  3DXJ C;  1TKW B;  3KF8 A;  1SMY D;  4IUQ A;  3Q24 A;  4K14 A;  1PRT F;  3DM1 A;  4ULL A;  4N9T A;  4QUF A;  4IFD I;  1HTL D;  2SEB D;  2KA7 A;  3K5M A;  2MPM A;  1AW7 A;  1S5C D;  1BCP D;  3HKZ B;  4FVM A;  2J7Z A;  1H9K A;  1T5E A;  4DXG A;  3T51 B;  2QF7 A;  2DY7 A;  2DNC A;  3WOE A;  4DNT B;  4L8J A;  4RKL A;  1Y8P B;  5KGU A;  1SSO A;  1JE4 A;  5C4X B;  1IYU A;  4BBS B;  1ML0 D;  1AP0 A;  4RGO S;  1HCZ A;  1V1P A;  4HR7 B;  3S2D B;  5CGK A;  1W6J A;  3EQL C;  3PIP 3;  1FD7 D;  2BA0 A;  1BBX C;  4KJN A;  2RDF A;  4FF3 A;  5CV7 A;  1UAP A;  3Q22 A;  2L1B A;  2NYZ D;  1VMC A;  1YNN D;  3BZD B;  3A8I E;  4XYQ A;  4DFA A;  1M8A A;  4C3H B;  1AFP A;  2Q8T A;  1GXD C;  1TS5 A;  2IX0 A;  1SMY C;  4PMC A;  2EY5 A;  3RZD B;  1KNE A;  5C3W A;  4HTH A;  3D4D A;  3GTP B;  1CZW A;  3J80 E;  2BDN A;  4A3K B;  4TKO B;  3G7L A;  3LWU A;  1CA6 A;  1U9R A;  5I9O A;  1XWE A;  1BCP C;  4K6L A;  3IAY A;  1XTC D;  4KK7 A;  3MXU A;  3VYT A;  1GUT A;  3PO3 B;  3K7A B;  1F9S A;  2I46 A;  2L55 A;  2MP1 A;  1CI3 M;  1PFB A;  1ILQ A;  2B2T C;  1SFO B;  2CHB D;  2KCC A;  3NP8 A;  2F0J A;  5JPM C;  2R6G A;  4K8I A;  1EL0 A;  3OPO A;  2N55 A;  3D6C A;  5E1F A;  4G7Z C;  4DGZ A;  4DXF A;  3TP6 A;  2D62 A;  3SK8 A;  2HCI A;  1ESR A;  1YNN C;  4HCE A;  5C4J B;  2RA4 A;  1F2Z A;  2QKI C;  1DD2 A;  5EJW A;  5T1G A;  5CYU A;  1PTO H;  2RVL A;  5I2X A;  2DNE A;  1VMP A;  2AQ2 B;  4Q5V A;  2NTS A;  3N52 A;  4M8A A;  2O2L D;  4ZAI A;  3OW7 A;  1EWC A;  4ZYS A;  3EVQ A;  3A8J E;  4OIJ A;  5C3X A;  1J9O A;  1JOK A;  1EIG A;  1R4P B;  1B1Z A;  5CBA E;  2XSC A;  3P1H A;  3M7G A;  3BDO A;  2K28 A;  4HCS A;  1BOS A;  1WTR A;  2BDO A;  1YNJ D;  2O5I C;  4G7O C;  2JP1 A;  4QUC A;  1ZYR D;  2A74 C;  4H13 C;  4G7H C;  3OMG A;  2EY1 A;  4KJO A;  2E75 C;  5C0X I;  3TBI B;  4KMU C;  2JA5 B;  1CQV A;  3NE5 B;  5E4W C;  1RF2 D;  2NN6 H;  2ZXR A;  1FNU A;  1U4M A;  3KLS A;  2B2Y A;  1J8I A;  2NBF A;  1LLR D;  5DEH A;  3BVZ A;  3DWQ A;  1HUM A;  2FHT A;  1X3P A;  1NAP A;  1STE A;  3NHH A;  1RKN A;  5TSS A;  3GV3 A;  4Y7N B;  3OOC A;  4CGY B;  5C4H A;  5E3F A;  5FK9 C;  2WP8 J;  2F0S A;  3Q0A A;  1SNO A;  1TR5 A;  2EYL A;  5C4Z A;  4X3U A;  3C1F A;  2A68 D;  2MJ8 A;  2EJM A;  2R7Z B;  5ISR A;  4CKC A;  3I70 A;  3X3N A;  2J4X A;  1PTO D;  2HQE A;  4IUT A;  2Q8R E;  3H3V C;  3C3L A;  4XQQ A;  1GUO A;  2F0E A;  1YNJ C;  1KNA A;  4IUU A;  1ZYR C;  1UNS A;  5EKI A;  4FXD A;  3K6O A;  4FNF A;  1PYW D;  1QOH A;  1TWH B;  4H7B A;  1GUN A;  5CV8 A;  1BDO A;  3DEO A;  3TZU A;  1X32 A;  3GO5 A;  3I8Z A;  4ZUI A;  3DMU A;  3HRZ C;  1C48 A;  1EU4 A;  3QJY A;  3DHQ A;  1EEI D;  2VB3 X;  2PPB C;  1E0B A;  1K8O A;  1A15 A;  1I4P A;  4JK1 C;  1I50 B;  2XRS D;  3K58 A;  5ELB A;  2JYO A;  5G3L F;  3QOJ A;  1EOT A;  1I4H A;  3FKI B;  2EYM A;  3OIQ A;  4LK1 C;  1CTM A;  2A68 C;  4DNR B;  1EWH A;  4DK0 A;  1EYA A;  3I4N B;  1PTO C;  1JR0 D;  3K59 A;  5JJZ A;  3DEP A;  3L7Z C;  1KTK A;  3OIP A;  3OSO A;  1ENF A;  2R93 B;  3J7Y W;  5AFW A;  3A8K E;  3VA7 A;  3FMC A;  2Z4I A;  4OHJ A;  2LS0 1;  1EEF D;  4C3I G;  3RZO B;  4WRD A;  1CHQ D;  2XWB B;  2K05 A;  1QG7 A;  1BCP F;  2E2J B;  4OO1 H;  2F0I A;  2A73 B;  1Z47 A;  2I07 B;  3J81 L;  1B53 A;  1SE2 A;  3SDZ A;  2QCP X;  1H9J A;  2ICI A;  4KD3 A;  1G8Z D;  1LTS D;  3HOX B;  3PUX A;  4WOR A;  5KEE A;  1JOQ A;  4KY7 A;  1AEX A;  2AWO A;  1A2U A;  1HUN A;  1I4Q A;  3MHB A;  1RHP A;  3OHX C;  5EBC A;  1G2S A;  1EYC A;  5KRU A;  1MSH A;  4F87 A;  1LT5 D;  5FO7 B;  4ZKC B;  2FFK B;  5CC4 A;  2WII B;  3LX0 A;  3QIA A;  2PNR C;  4XQJ A;  4QIW B;  2ZT9 C;  4IFD H;  1LTI D;  1EZ6 A;  4FF4 A;  4ME5 A;  4R8N A;  1PDQ A;  3TDQ A;  4NDX A;  1L0X B;  3HZX A;  4ZKB B;  1ZXT A;  5IGC A;  1RCV D;  2VB2 X;  2L4N A;  1WTO A;  1TII D;  3E0J A;  3I72 A;  4KI0 A;  2B2U C;  4IUN A;  1EFI D;  3K0Y A;  3ZYY X;  3GTG B;  2L9H A;  2JA6 B;  1H9M A;  3AB9 A;  1DJR D;  3ERQ A;  1STN A;  1SYF A;  4H44 C;  4MIU A;  2B2W C;  2B8G A;  4A3E B;  1I4X A;  1JOR A;  4K5W A;  1FNW A;  4DAV A;  2IL8 A;  1X3Q A;  1Y1V B;  2X69 A;  2Z8L A;  2B2V A;  2PW5 A;  1E2V A;  1TS2 A;  2ICE C;  3D3R A;  1G2T A;  1SJE D;  4OIK A;  5J22 A;  4KHV A;  3BVM A;  1F9P A;  5EGT A;  1D2B A;  3T53 B;  1DYQ A;  4FXK C;  5KNB A;  3RMH A;  4A3F B;  4XIG S;  4NMZ A;  5FLX E;  1BF4 A;  1SE4 A;  1F2M A;  1CHP D;  2JXM B;  1ZKO A;  3T16 A;  4CJ2 C;  3VYS A;  1SE3 A;  2XN9 C;  5I6W A;  3J7A V;  2F0L A;  1ENA A;  3RD4 A;  2L12 A;  1UEA B;  5CMD A;  1Z7T A;  2HCC A;  3TME A;  2F3V A;  1CM9 A;  1TVX A;  1VDZ A;  2QIL A;  5BN4 A;  3EFX D;  2EYP A;  2XIW A;  2E76 C;  1ILP A;  5M3M B;  4O1N A;  1ESF A;  2ID0 A;  5T1I A;  4RFB A;  3FDT A;  2PZW A;  3K5N A;  1XXG A;  2NN6 G;  4M1U B;  3ITP A;  1V43 A;  1QCB D;  3KK7 A;  2HUG A;  3J81 E;  2F0D A;  1JWU D;  1STG A;  3MXP A;  3A54 A;  2R3Z A;  3MWY W;  3MXN A;  2MUY A;  1LT4 D;  2NVT B;  1F2Y A;  2WAC A;  3GTJ B;  3NPP A;  2XNA C;  1Q1E A;  5KND A;  3BG3 A;  5EPL A;  1A6X A;  5JAV A;  1TT2 A;  1DXM A;  1NR2 A;  4ILW A;  1STA A;  2QDB A;  3C1E A;  1A3U A;  1QNU A;  5JVG 3;  3VR6 A;  5HGT A;  2JE6 I;  1Y1W B;  3MAQ A;  4IUR A;  3URY A;  1STH A;  4Z9C B;  3MC0 B;  3R2T A;  3HGB A;  1OXS C;  1PTO F;  2EY2 A;  3OMC A;  5FO9 B;  1IKL A;  2NTT A;  4NW2 A;  3I91 A;  1B9N A;  1HXY D;  5I9P A;  2EYF A;  1S5B D;  1AZP A;  5C0X H;  1WCM B;  4K5X A;  3BYY B;  1LO5 D;  1A3T A;  2VNU D;  2FJ2 A;  4DN4 M;  4A3D B;  4IN3 A;  2E2I B;  1LTR D;  3H09 A;  2RDG A;  4RCO A;  1D1I A;  1PZI D;  4HSP A;  3CQZ B;  3CRL C;  2PZU A;  3SR1 A;  1PZJ D;  4IUV A;  2IX1 A;  3PUV A;  5J39 A;  3M4Y A;  2YYZ A;  1JCK B;  3D4W A;  2EOT A;  3H6M A;  3SXH A;  1BCP B;  1PRT D;  2F0F A;  4HED A;  4GZY C;  3PV0 A;  1I6V C;  2A69 D;  4EQP A;  4XXE A;  3CHB D;  5JEA J;  3Q23 A;  4A3B B;  3NTH A;  3KLS X;  3OWF A;  2K33 A;  4KV6 A;  1B44 D;  5EPK A;  4YIJ A;  4C1N K;  2C9O A;  5NUC A;  1D5X C;  2Z4H A;  2AWN A;  3FPU B;  3X3M A;  1KDC A;  1OO9 B;  4TRD A;  2K5W A;  4U67 3;  4F7X A;  1G91 A;  4DA2 A;  3QB3 A;  2G9H D;  5CV4 A;  3U9S A;  2F4I A;  1AZQ A;  1VCI A;  3TP5 A;  4K5V A;  1NUC A;  3MZ5 A;  4ABN A;  2WKC A;  3MFG A;  3HS0 C;  4HSV A;  2A6H D;  2KOL A;  4IUP A;  4KY5 A;  2PW7 A;  3C46 A;  1RJT A;  4G57 A;  1GUW A;  3ERO A;  1RTO A;  3JAM E;  2Y0S B;  2WIN B;  4OO1 G;  5C5L A;  1LTT D;  5JEA H;  1ICW A;  4LAA A;  1R9T B;  5JVH 3;  3H91 A;  1TWG B;  1PRT C;  5EKK A;  2SOB A;  4XTC S;  4O42 A;  1ZEQ X;  4RA8 A;  2A69 C;  3I4L A;  2WB1 B;  2PO4 A;  4BY7 B;  1RD9 D;  2TSS A;  4C3I B;  4QF4 A;  1A2T A;  2KEC A;  1LAB A;  4L63 B;  2BE5 C;  1JOO A;  1I6H B;  2X6G A;  2DY8 A;  4PV1 C;  2AQ1 B;  2IWH A;  1ET9 A;  2F0V A;  4CHT B;  3N6R A;  1SYE A;  2M00 A;  1U4R A;  2NVQ B;  3FEW X;  4UDU C;  5C5M A;  3MEH A;  3S1M B;  3PMF A;  2NVY B;  1JWM D;  1SNQ A;  5FKA C;  2EJF C;  5HUR A;  1Q3L A;  1Y8N B;  4IFD G;  4RGM A;  3E5S A;  1HHV A;  3A55 A;  4S3S A;  5EBD A;  3S17 B;  4RWS C;  1AN8 A;  1E2Z A;  4MN3 A;  2A6H C;  3TP8 A;  1EY0 A;  2IW3 A;  1R4Q B;  2E2D C;  2NZ1 D;  3FRP B;  5JOB A;  1OXT A;  1DM0 B;  3MA2 B;  4C2M B;  5ELF A;  1SDF A;  4BY1 B;  4ZLT F;  4RHS A;  1VF5 C;  3IL8 A;  4B08 A;  5FLX L;  5IGF A;  2RSN A;  2KHS A;  1L0Y B;  3V2T A;  2MHV A;  4G4K A;  3O13 A;  1WTW A;  3NQI A;  4LMQ D;  2NB0 A;  1C8C A;  2EDG A;  1JB3 A;  5LL6 X;  3HOV B;  1F2L A;  2M9V A;  1BNZ A;  1RTN A;  1TWA B;  1HQM C;  4FP5 D;  2L5T A;  1HA5 A;  1DOK A;  1I4R A;  2D5D A;  1A3V A;  2F0N A;  3EJI A;  5ELC A;  1FNV A;  2F3W A;  4BA2 I;  5IGD A;  1GHK A;  2KED A;  2YU9 B;  4NP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...