3WOEA

Crystal structure of p23-45 gp39 (6-109) bound to thermus thermophilus rna polymerase beta-flap domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
GPIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase subunit beta
publication title Structural basis for promoter specificity switching of RNA polymerase by a phage factor.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 32
structure length 130
sequence length 130
chains with identical sequence C
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-12-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.150 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3woeA00
2PMZB 3RZDB 3RZOB 3PO3B 4A3DB 3PO2B 5M5YB 3HOUB 3K7AB 3S15B 2PPBC 2VUMB 2O5JC 1I3QB 3CQZB 1WCMB 1Y1WB 2JA8B 3S1QB 4LJZC 2YU9B 2CW0C 3HOWB 2R92B 3S1NB 1I50B 2BE5C 4BY1B 2E2JB 3S2HB 5M5WB 3GTLB 2A68C 4KN4C 2NVQB 2JA5B 4G7ZC 2O5IC 4A3GB 3TBIB 2E2HB 3FKIB 2NVTB 4A3EB 3S1RB 5C4JB 3S16B 2E2IB 1I6VC 3HOXB 2NVYB 4KMUC 4BBRB 3GTPB 3GTKB 4C2MB 4C3JB 3DXJC 4A3IB 3WOEA 5M5XB 2WAQB 3GTGB 4A3JB 3S14B 1TWHB 4A93B 1YNJC 3GTJB 3M3YB 4A3FB 4G7OC 4LK1C 2Y0SB 1ZYRC 4BBSB 3GTQB 1IW7C 2JA7B 2LY7A 5C4XB 5M3FB 2A6EC 4Y7NB 2B63B 3H0GB 2JA6B 3GTMB 1SFOB 3S17B 1Y1VB 4GZYC 1TWCB 4A3BB 5C44B 3I4NB 4A3KB 4G7HC 3WOFA 2R93B 1SMYC 3HOYB 2A69C 4A3MB 1YNNC 3I4MB 3HKZB 3H3VC 4AYBB 5M3MB 4KN7C 2A6HC 2R7ZB 3S1MB 4QIWB 5C3EB 1K83B 4JK1C 4C3HB 3M4OB 1HQMC 3HOVB 4C3IB 4BY7B 3EQLC 2WB1B 1TWGB 3HOZB 2NVXB 1R9TB 3S2DB 1TWFB 3GTOB 1TWAB 1I6HB
chains in the Genus database with same CATH superfamily
4RHRA 3S15H 4XT1B 1YJNA 1DJRD 3S15B 4WJ4A 1F9QA 3BJUA 2ALYB 1EWIA 1J9OA 1U9RA 4X62Q 3CCVA 1Q46A 2XWBB 1RIPA 1X65A 1KQSA 3PIP3 4M8AA 5T1GA 4BY1B 2G9DA 4ME3A 3GO5A 1M4VA 2Q2HA 1VQ8A 3GTLB 3OPOA 2A68C 4P72A 4HN7A 4A3LG 4NDXA 4LFBQ 3UDGA 2R6GA 5EPKA 1V1QA 1NNXA 2EY1A 2Z6KC 1CM9A 2ZT9C 4FXKC 2ZXPA 3K5MA 4KMUC 4DXFA 5KGUA 4JI6Q 3G48A 2A73B 4R8NA 5EAYA 4A93H 4UHVA 4LF7Q 4GKJL 4HIDA 1SYBA 4A93B 4CDCC 3K81C 4DK3C 2EY2A 5ELOA 2F3WA 1BCPC 1YNND 5HURA 5AJ3L 2UUBQ 3U9OA 4G7OC 3SK4A 5FJ8G 1EWHA 1X3QA 2B63G 4P75A 1MSHA 1EOVA 1RL2A 1CQVA 3PMFA 5TSSA 1AP0A 3NTIA 5C44H 1YBYA 3GTGH 5C44B 3TS2A 4JI1L 4DR5L 1UUPA 4EVOA 4NW2A 1Y1WG 3O13A 3I2ZA 3EIVA 2UUAQ 5JJZA 1PH4A 2SOBA 4GOPB 3OW7A 4DR3L 2KCNA 4O42A 3W3AA 5JJKA 4DNIA 4JI3L 3MZ5A 5C4ZA 4QL5A 3PQIA 1TS4A 2OXPA 4X3UA 5C4HA 4DUYL 1S3OA 1A8VA 4A3DH 4A3DB 2JA8G 1XPUA 4LF9Q 1UE1A 2D2CC 4JOIC 1U0LA 4XT3B 1OTCA 3L3OC 1OXVA 1WCMB 2HDMA 4JG2A 1VQ6A 5ELNA 1LTBD 3LWEA 1ASZA 1VQNA 5GQOA 2B2UA 3FPPA 2CFMA 2JEBI 4CKBA 1CA6A 2K04A 1JC7A 3V2TA 1HJPA 5K36G 1NUCA 2JEAI 2TMPA 2MO0A 4IFDJ 1HNXL 1Z7TA 2PO4A 2XWJB 3A54A 4XXEA 4BBSG 1TR5A 4A3EH 2L9HA 4CDFC 1PH5A 5JVG3 1MIUA 3QO2A 4A3EB 1ZYRD 2UXBQ 2N55A 2E8GA 1SE4A 2EPBA 3CRKC 4EQNA 4X66L 3NENA 4LF8Q 2QW7A 1DYQA 1LT4D 2K01A 4FP5D 2ZJQA 1H95A 4B3TQ 1KLGD 4FXDA 4DV3Q 4YY3Q 4DR2Q 4IPDA 3SGIA 1SSOA 5IWAL 1ICWA 2F03A 1BVSA 3M3YH 1STAA 1SYCA 3D4WA 4LAAA 5IGBA 3M3YB 1WD0A 1GUWA 1PXUA 3CPWA 2VNUD 2C5CA 3UDIA 2Y0SB 2FMCA 4A3CG 1XPOA 5KYIA 1VQ7A 4ID6A 1C4QA 3E3XA 1M1KC 4POGA 4N8X1 3C46A 4X65L 2VL6A 3PUXA 5I6WA 4JV5L 5A2QL 3IFDA 5EPLA 1VQFA 4PNYA 4DAMA 5LL6X 1CT1D 2F0WA 3AYHB 4A3MG 3BVGA 4G7HC 2VXWA 1CKMA 2F0QA 1C8CA 3K8AA 1HR0Q 5M3MH 5M3MB 3U50C 1ET6A 2HQLA 3HOZG 3T51B 4NP5A 2ICIA 1VQMA 3SK5A 3AEVA 1J5EQ 1L0YB 3FP9A 5KIXA 4KHPL 2ENBA 1YZ6A 1I4RA 5A2QE 3HRZC 4OO1G 1I3QH 1X6OA 3NBHA 2L5TA 3VR2A 1I3QB 4QQBX 4LUVA 3FMCA 2RDGA 1GHKA 4P2CB 5M9OA 5JJLA 5GADC 3D3RA 3OYYA 3IAYA 1CUKA 1ML0D 3GDEA 4FF1A 1ENFA 3QJYA 2KEDA 3I91A 2EXZA 4J8QA 4HJAA 3ZYYX 2EYHA 3FKIH 3OHXC 1T5EA 1S72A 5GROA 3B6YA 2Z1CA 3TBIB 3FKIB 3OTOL 3HOXG 1AE2A 3EN2A 3HOWH 5EKIA 3S1NH 1Y8NB 4DUZL 3AB9A 3NUCA 4GNXC 2OQ0A 3ERQA 3FDTA 3S2HH 5I6YA 5LMUL 4CHTB 4KTAA 5ELDA 2P5ZX 3AFPA 3VA5A 3RLNA 1RD9D 4JI0L 2X6GA 1YNJC 3RN2A 4N9TA 4FDBA 1DGSA 4B08A 4LF8L 1T5XD 3HS0C 1PMRA 4L5RC 1EYAA 3AMUA 1SNMA 3WWVA 1IW7C 2JA7B 4FXGC 4B3SQ 2BCOA 5BR8Q 1CHPD 2JSOA 2OT2A 4JI8Q 5IP7H 2NTTA 3ONAB 1KDAA 4IN3A 4IUTA 5KYLA 3KF8A 1TWCH 1F9PA 3HP3A 1O7ZA 1TWCB 1Q1EA 4YWLA 5JPNC 3CC7A 4WRDA 4CDDC 1XMOL 2XNAC 4IUUA 1K8AC 5JOBA 1PFSA 4R8IA 4CJ1B 2JYOA 2N3SA 1LABA 1HZAA 3NWSA 4Z9CB 3HOVH 1ILPA 1QNUA 1TQOA 1PLFA 3RN5A 1TWGH 3HOVB 4O0AA 5EGTA 1TWGB 3D6WA 1JOQA 1L0XB 4L5TA 1G6ZA 3NEMA 3G4SA 3DEPA 4DGZA 2MGSA 3PUZA 5FKAC 5CV5A 2CCZA 2NN6G 4NKLA 2BH2A 3L7ZC 1Q90A 1CKNA 3Q23A 4PV1C 2IX1A 1MKHA 1RDPD 4P74A 3H3VI 1FJGL 4AH6A 2E2JB 2Q2UA 3K5NA 1STNA 5C0XJ 1Z6HA 4EQOA 4IZ8A 1YJWA 4CKCA 1GD7A 1GUNA 4DR1L 4KN4C 1KNEA 1WTOA 2K6AA 3CMEA 1ZKOA 4KKUA 3I4LA 1E1TA 2V1CC 5ELFA 1Q81C 1L2FA 4A3LH 1PH3A 2PZUA 3A8IE 4RGMA 5I9PA 1YHQA 1I94Q 4YIJA 5CC4A 2B2UC 3GTKB 4DR4L 5EQ0A 4ZUJA 2RVLA 1NR2A 2L55A 4A3JG 1D7QA 5E7NA 4IURA 5LHY1 2OWOA 4LNQA 4IUQA 2IW3A 1G51A 1EQVA 1X3GA 1BBWA 2UU9Q 3GTJH 1F9SA 4DR6L 1E2VA 3MHBA 2NB0A 3GTJB 3KBXA 3BVZA 1VQJA 4R4OA 4DV0L 1B53A 1WOCA 2UXCL 2F0FA 1PRTB 5FJ8H 1IBMQ 1IKLA 1M8AA 4DV1L 2B63H 2F0JA 1JOKA 2K75A 1L1OA 1FYCA 2B63B 5HGTA 1Y1VH 3GTMB 3NSWA 5C5LA 3KUPA 3IRBA 1Y1VB 4RKLA 1GO3E 3PGZA 1H9KA 1QVGA 3I4MG 1SEBD 2R93H 3TQYA 2R93B 4F7XA 4ZLTF 2IHFA 2LSSA 4KK7A 5C3EG 5FOBB 4X64Q 1KD1C 5LMNQ 3X3NA 4OX9L 3QWNA 2EY6A 2TSSA 2SNSA 5E3FA 1AE3A 2XN9C 3M4OB 2SEBD 4EQPA 2AQ3B 1TKWB 4Q0FA 3W2DA 1BUVT 2JP1A 4A3BH 3RZOH 2VUMG 2PQAA 1A62A 3RZOB 4OIJA 1TU2B 4B3MQ 1D5XC 4V0BA 2KECA 1AZQA 3C1EA 3CQZH 2B39A 1BO0A 4JI2Q 2JA8H 2KCTA 3CQZB 2ZM6L 3GV3A 1PH2A 2JA8B 4DR7L 4RKBA 1E2ZA 1EY7A 4QF4A 2XRQD 4K0KQ 4HCSA 3ERSX 4CDEC 1GUSA 2XRSD 3ULJA 2I0QA 1EWCA 1PFMA 4PZ8A 2HCCA 3MEFA 3EJIA 4OONA 1WTRA 3PO3H 1U4LA 5CBEE 5K36H 4HEDA 4GKKL 3TDQA 3AU7A 4OWXB 3Q24A 4KJNA 2QEJC 3S16H 3KLSA 3EVQA 3S16B 2FXQA 3LGJA 4NXNQ 3ER0A 1WVLA 2A6ED 2I5HA 1EY5A 2E5LQ 1VQDA 4IJHA 4BWGB 2AQ2B 3WDNA 1BXTA 1W3SA 3H3VH 1PYBA 3OWEB 2O2LD 1LO5D 3DM3A 1W6JA 1SAPA 3KLRA 1XTDA 3NXWA 4A3FG 5IYDG 2MPMA 3CU7A 2Z4HA 3J7AF 5IOCA 4HMIA 1K9MC 1QE6A 4E6IA 4DK0A 4C3IG 5CGKA 4HTHA 3RMHA 4LUOA 3G6JB 1IHZA 2F0IA 1EL0A 1WTXA 4A3CH 1QVCA 2PYKA 4IOCA 2J4XA 2L4NA 3BU2A 1XNQL 3BDOA 3S17H 4LF5Q 3S17B 1U4PA 4I7ZC 1UE7A 1A2TA 4P71A 1B50A 3IFTA 2RHQB 2VQFQ 2EYMA 1JWMD 3N6RA 2Z8LA 3C2PA 4IQZA 2RF4A 4A3MH 5IYCG 2DN8A 4BA2I 4A3MB 1YEZA 5ISRA 3A7AB 1D1KA 4KY7A 4L8JA 2QF7A 1F77A 3M7GA 1E24A 4BY7H 3BZCA 4HCEA 2EQSA 4BY7B 3HOZH 5FO8B 4JBWA 2B3GA 2WKCA 1ZEQX 3NQIA 3HOZB 2PI2A 1S5BD 1V9PA 3I4NH 3R2TA 2QILA 1VMCA 1STEA 2JA9A 3T1HL 5D3DA 1H9SB 1LTAD 3MXPA 4MNOA 4MIUA 2NBFA 1PVOA 3F8TA 1BQQT 5BN4A 1EYDA 2I5MX 1DM0B 3FHWA 3PUYA 4IALA 1ENAA 2BOSA 1QNKA 5E1FA 3BDLA 4JI5Q 3S1MH 1JR0D 2O4XA 3KF6B 2N8NA 2F0SA 4B9WA 4JVZA 5IY0A 4IFDI 5C5MA 2IWHA 2OCEA 1TWFH 1NE3A 1EEID 1EU3A 1EIYB 1KRTA 1AFPA 4K8IA 2XIWA 1EU4A 1P16A 2WINB 5KNDA 1KAWA 1FNWA 4BBRG 4KJOA 5GAGC 1SROA 5E4XA 3HOXH 1UWVA 4IUPA 2HHHQ 5C0XG 3HOXB 3C3LA 1MI2A 1VQLA 2H5XA 4BY1H 1FVIA 2ATWA 3CCUA 3DXJC 2EJFC 3TMEA 1GKHA 3SK6A 2KVMA 3GTLH 4RA8A 3U58A 2F0UA 3BZDB 2WKDA 2KCCA 3VA7A 1RKNA 4R4TA 1PTOB 2F0OA 2F0VA 3R93A 4IUNA 1BKBA 5C4XG 2F4VQ 3OWFA 4HIOA 3W1GA 3T1YQ 4BXXG 5K5PA 4HAEA 3KDFB 5CV6A 3PCOB 4ME5A 1VQEA 4OEMB 4GLXA 2VY3A 3PIO3 1QWYA 2Z4IA 1PYSB 4RH6A 3PO2G 1SN8A 1DZ1A 1FNUA 2A1AA 3J81j 1K8OA 1HNWL 1NY4A 4ZAIA 2R3ZA 1A3VA 5I4DA 1TS3A 3HOYH 1X55A 1O7YA 4IJLA 3SR1A 3HOYB 1NSNS 5CMDA 1B8AA 4U673 2CW0D 3DLLA 1D8LA 1Y8PB 1E22A 5CYUA 2WB1G 3G6EA 4UP8A 3I90A 2F0GA 1PA6A 2UXDQ 5FLMG 3T16A 2B2YA 1PDQA 4LFCQ 1D2BA 1EUJA 3K7AH 2VW9A 3VDYA 4YHHQ 1D6EC 3I73A 3K7AB 1XNRQ 4ZKCB 2AHOB 4WFN3 4YCVA 1XMQL 2YU9H 2K5HA 4DV5Q 3CHBD 2ES2A 4LF6Q 2NN6H 2YU9B 2EIFA 4KV6A 3NE5B 4LWCA 2PZWA 3MTSA 1S4ZA 1JWUD 2Z6BA 2NVQH 1K8MA 3TN2A 2NVQB 1PZID 3C1FA 2ZTEA 3I72A 2E74C 1W6KA 4H44C 3F1ZA 1XJVA 4FVMA 3J7ZC 2CHBD 2F0TA 1MGSA 2EY5A 1Q3LA 4DV4Q 1WCMH 4DPGA 1Q8IA 4H0LC 4PZ7A 4JI7Q 5KNCA 4KLKA 4G57A 4A3IH 3A7LA 1NAPA 4A3IB 4CGYB 1GOZA 4A3JH 4WJ3M 1TWHH 4IFDH 3QOLA 4RCOA 2UUCQ 4A3JB 1TWHB 1I5FA 3A5ZB 1QB5D 3U4ZA 4X62L 2E76C 1N32Q 1N33Q 1EY6A 4DA2A 4DV7Q 4QB4A 1T9HA 1ASYA 1ICFB 2ZXOA 4J6HA 3CXCA 4A75A 3KLSX 4QGUA 3K0YA 5ELCA 4A3KG 1CSQA 2Z9HA 2ZTDA 1HXYD 4GNXB 4F87A 4LFBL 4DKAC 2KOLA 2XSCA 1R4PB 2I46A 4B3RQ 3TS0A 3CAMA 3OMCA 1PH6A 3MA2B 4L5QA 2PCFB 1SMYC 3FPUB 2R7ZG 3I4MB 4C3HG 2KJXA 2EJGC 2YTYA 3HGBA 4KHZA 4JI6L 5C3EH 2A6HC 4HIKA 4GN4B 5C3EB 5IGFA 2NZHA 1JQYD 3PF5A 1N36Q 1QCBD 3LWUA 3CCRA 4LF7L 4ZK9B 3S2DH 1TWAH 4J15A 4HJ7A 3S2DB 3HOUG 1TWAB 5IGCA 1PRTD 3V05A 3TRZA 2UUBL 2VUMH 3KYHC 4TVAB 4EQ5A 3K57A 2VUMB 3SE0A 4YWMA 2IT1A 4XYOA 5ELEA 2QDLA 4K5VA 4OL7A 3FEWX 2LS01 4OELB 2WB1E 1XXGA 2BE5D 3KK7A 4K14A 3H91A 3D6CA 2ZJPA 4IO9A 2PMZE 5KEEA 3OOCA 4MN3A 4GOPC 3UI2A 4A3GG 2NZOA 3DMUA 1SJHD 2UUAL 1A0IA 1EZ6A 2E2HH 1A63A 3A5UA 1NMFA 3JAME 2E2HB 5J22A 2OTJA 2E2DC 4L63B 5M3FG 3CPFA 1JB7A 1YHBA 1PTOF 2CWAA 2JA6G 1KDBA 2SDFA 4K8JA 1GUOA 1MD2D 1SE2A 1VDZA 2IY5B 1Q7YC 3CCEA 2KUMA 1ET9A 4K5WA 4H13C 2J7ZA 2FJ2A 4KD3A 1S40A 3P75A 2K52A 1QG7A 1R4QB 3D0FA 4LF9L 1KLUD 3RR5A 1GUGA 4PQXA 4A3FH 2R7FA 2A69D 3STBD 5IYDH 4A3FB 2M9VA 1IXRA 1LT6D 4DXGA 2KCMA 2EYOA 1X32A 1YITA 2X69A 3E5SA 1SMXA 2FMMA 1WD1A 2VS1A 2HD3A 1IBKQ 1XX8A 5GAEC 2K14A 2M2LA 3I55A 2MQHA 4UP9A 2A74C 3GQBA 4RGTA 1N32L 1XWEA 1KABA 1RF2D 4V190 2K32A 2UXBL 1K8GA 3JAMi 4KKSA 5IYCH 2JA7H 4KN7C 4B3TL 4J1MA 5CV8A 2DUDA 4YY3L 4DV3L 4DV2Q 3DEOA 3HG9A 3ITPA 1I4XA 2RKSA 3AFQA 4ULLA 4DR2L 4AQYQ 1BDOA 2XVSA 1U5KA 3L2PA 1I6HH 1H9RA 2VQEQ 1OXXK 2A68D 4DN4M 4CKEA 3RZDH 4QMGA 1I6HB 1EZ8A 4NMZA 1UE5A 3RZDB 3CP0A 1WTWA 3QIAA 2HIXA 4X3KA 1Y14B 3HEJA 1MSGA 2YYZA 3D31A 4ZRZA 3PUVA 4LJZC 1SDFA 3L0OA 3BZKA 1NR4A 1LTID 4I65A 4IPHA 2AQ1B 2K50A 4FNFA 2JN4A 1LYLA 2B2YC 2K5VA 2L12A 1DXMA 4QUCA 3GV6A 1EYCA 3CCLA 2K5NA 2MP1A 3SDZA 1HR0L 1BCPD 4JBJA 3NPPA 4ZCKA 1LLRD 2QGQA 2YTVA 3CF5A 1E0BA 1HA5A 1PH9A 3BVMA 3NHHA 4BBRB 2MJ8A 1S5DD 5CORA 2L1BA 4C1NK 1JJ2A 1OXTA 1J5EL 5C44G 2KHSA 3W5OA 1NMGA 5C0XH 2E2JH 1KNAA 1IZ6A 2WFWA 1HNZQ 4A4IA 1EYGA 3UDXA 1V1PB 1PHJA 3S14H 3S14B 3R8BA 1C9OA 4YCWA 2LMCB 2EYJA 3CC4A 1SNCA 2F0DA 1QUQB 1S5CD 2JJQA 2FINB 3ND9A 5JAVA 1S5FD 1O80A 2EYFA 5C4XH 3J7YW 1K0SA 3GTKH 1TS2A 5G3LF 5C4XB 4DK1A 4BXXH 4FF2A 4DV6Q 4K6DA 4CJ2C 5FLXL 4A3DG 2Q8IB 1SFOB 1Z9FA 3K7UC 1K3BC 1GXDC 3I8ZA 4CBVA 1EY0A 4AYBG 3TP5A 2QEXA 3K80C 5IP9G 1D5ZC 1B9NA 1YNNC 2G9HD 2ICEC 2WP8J 1RHPA 1HFGA 4WJWA 2CVRA 3RUZA 2HDLA 4H7BA 5C6AA 1IBKL 2D62A 3FRPB 1EQQA 4JK1C 1EY4A 1PTOD 3PIPA 3KOJA 2PNHA 3GTMH 2WB1B 1XTCD 3CCJA 1G2SA 4LF4Q 1AW7A 1G291 2PMZB 3CC2A 3DM1A 5M5YH 4JYAQ 5FLXE 2B2VA 5M5YB 2AWOA 1B7YB 1I4PA 1OXUA 1HZBA 4OO1I 5NUCA 4QUFA 2FHTA 1Y1WH 3BG3A 3GP7A 5FLXc 2JE6I 4B3SL 1Y1WB 5BR8L 1I50H 2AKWB 4X3TA 5KRUA 4GS3A 1N34Q 4JI8L 4ABNA 1I50B 1B2TA 1QOHA 1ESFA 1FGBD 2IL8A 1RTNA 5BN5A 1KIXA 1VQ5A 3M4OH 4XTCS 1DOKA 1H9SA 5DM73 4L6TB 1WTQA 2F52A 2A8VA 2IX0A 5GAHC 4K6LA 1F2LA 1GUTA 2MFIA 5F2DA 4LFAQ 2RCFA 2QKIC 4G7ZC 4K2KA 5T1IA 4YWKA 3BYTB 3KF6A 1VQPA 1NJIC 4ZQ3A 3I70A 3SHLA 5IODA 1Q8KA 2RDHA 1GJXA 2EOTA 3ULLA 1SYFA 1SJED 1SNQA 2WAQG 1WFQA 4KD4A 1TXYA 3J80i 3AQQA 3MXNB 1SXTA 3KBGA 1VQBA 1JOOA 4KKTA 4DU9A 4RGNA 4FF3A 4JW0A 2G5DA 3WOEA 3VYTA 1G8ZD 5BN3A 3VYRA 1TT2A 4RGOS 2GN5A 4BBSH 1TY2A 1ZYRC 4BBSB 4DAVA 1JCKB 2YTXA 3H0GG 4UAIA 1EQRA 4DFAA 4WORA 3S24A 4PMCA 2Q8TA 1A15A 3ND8A 3I7FA 1QZGA 3E9IA 1UNSA 2NTSA 3LX0A 1X3EA 4DAYB 3TEHB 4JPBW 4A3KH 1KL9A 2F1MA 3M7NA 4A3KB 2B2TA 3V96A 3KDFA 4HR7B 3WOFA 1I94L 3R2IA 4C1NI 2ZXRA 1N8RC 5EPJA 5DNFA 2R7ZH 3DUZA 2EZVA 2R7ZB 2N88A 4C3HH 2QDBA 3CRLC 2B8GA 4ZKBB 4C3HB 3EQLC 3RLFA 1JJCB 4BA1I 1VQIA 3M9BA 2UU9L 2KHJA 5IIFA 3HKSA 3KLWA 1TVXA 3D4RA 4GLAC 1X56A 3H6MA 3HOUB 4GKJQ 4MZ9A 1I4HA 2LFNA 3HOWG 2R92G 3A55A 2IJ0A 1STYA 2KQ3A 2NN6I 1IBML 3S1QB 2OEOA 5AJ3Q 5CV9A 4XQJA 3NWTA 2HT1A 2RCNA 4PMBA 2BE5C 3A8KE 1BCPB 2WIIB 3P7JA 4GN3B 1GHJA 2F0LA 1I4QA 1QVFA 5G3LD 4QCLA 1VQOA 1LTLA 3G71A 4DK6C 4A3GH 1UAPA 1EY8A 1BF4A 5IYBG 2DJGC 2F0KA 1QILA 4A3GB 4X64L 4JI1Q 4DR5Q 5LMNL 2E2IH 4UPAA 3F2UA 2E2IB 4OO1H 1IW7D 1H9JA 4C3JG 2PNRC 4QJFA 5IP7G 3M4PA 3RLOA 4DR3Q 1IYUA 1LACA 1V8QA 1B4OA 4JI3Q 4HJ9A 2N49A 1STHA 4B3ML 4UP7A 4Q5VA 5DEHA 5IT9L 5LL6S 4JI2L 2B8FA 4DUYQ 4C56C 4YCUA 3H94A 4K0KL 3GTQH 1YHAA 1WYDA 2D5DA 2KA7A 4S3SA 3GTQB 1C7YA 1CZWA 3ICEA 2WAQE 5DM63 3T56B 2X6LA 4Y7NH 1EEFD 3UE0A 3SK8A 2IX3A 4Y7NB 1PRTF 1M90C 5COYA 3TP7A 4FF4A 1LT5D 4GZYC 1JT8A 2AMCB 1SRUA 2GA4B 1JMCA 5IGDA 2HQEA 1PTOH 2MHVA 3MXGA 1BBXC 2M00A 5J1ZA 2V4DA 4NXNL 1HNXQ 1EIHA 1JORA 1SE3A 5IT9E 2E5LL 1SNDA 3H3VC 1U4RA 4GNXA 4UDUC 3MWYW 3NK9A 5IT9c 2AWNA 1PZKD 2NUCA 5AFWA 4X66Q 3MAQA 2RQXA 1GVPA 3I4OA 2NVXH 2HCIA 2NVXB 3A74A 3CMAA 4IUVA 3NTKA 1ZXTA 5JJIA 5IWAQ 1E2WA 1LV9A 4GLVB 1JE4A 2D9UA 3EFXD 1ONLA 1B44D 2DY7A 5EBDA 3ULPA 1JE5A 4JI4Q 1SYGA 2K03A 2KEEA 2KBNA 2RSOA 5M5WH 1L1OC 1QZHA 4LF5L 5M5WB 2ASBA 4X65Q 2F0EA 1CA5A 4QY7A 1NTGA 5CV7A 5EJWA 4GN5A 2VQFL 1XPRA 3I56A 3K58A 2CH4W 1VS0A 2BDNA 2LKVA 4JV5Q 2B2VC 2YV5A 5C3WA 2WV6D 1WI5A 5D3IB 2NVTH 1L0WA 1IYJB 2NZ1D 1VQAA 1YIJA 2NVTB 1LTRD 4XYQA 4F88A 4KY6A 4LW1A 3EROA 1WJJA 4JC0A 5CR3A 3GTPH 4IOAA 2AUKA 2RBMA 3GTPB 2PZTA 1Y1VG 4N8FA 2PQEA 1KAAA 4OWTB 1YNXA 5IGGA 2L0CA 3F2CA 1V43A 1HR0W 2K05A 2BA0A 3GTGB 2R93G 2K7VA 1DCZA 1STBA 2CQOA 3RNUA 4KHPQ 1LTSD 3NQTA 1C48A 4RFBA 2H4OA 2ZTCA 1Z47A 4RAUC 4JI5L 1W2BA 1A3UA 1Q82C 1MJEA 3A8JE 4G4KA 2JQOA 4A3BG 3LNNA 4RCNA 2GVAA 4A76A 1DD2A 4MHEA 3OMGA 4TKOB 1EIGA 2XGTA 1VQHA 2HHHL 3OW2A 4L5SA 2I07B 3MFYA 2EJMA 2EDGA 1II3A 3OTOQ 4O1NA 1PZJD 5IP9H 4AYBB 1EFWA 2EVBA 4RWSC 4XDXA 1HRJA 3KFUA 2F3IA 2NYZD 1FNVA 1PTOC 4DUZQ 5FO9B 3PO3G 4EGVA 2DNEA 1VQKA 2GVBA 1BCPF 4DNRB 5LMUQ 2B2TC 3UDFA 2L11A 4H02A 1VQCA 5HGQA 2F4VL 1UEBA 3CCMA 4JI0Q 3T1YL 2O5JC 1X54A 1QJOA 3QG1A 3I4MH 1JJGA 4QIWE 5L37A 2VZAA 1SLJA 3E0JA 4KY5A 3TP6A 2AUJD 3URYA 1EY9A 1SNOA 2QA4A 2D0OA 3M4YA 1O78A 2JA5G 1MJCA 5DLQE 3A56A 4IPCA 1JB3A 4R4QA 2MO1A 3PSIA 3JAML 3H15A 2SNMA 2H1EA 3JC66 4M1UB 1EQTA 3Q8DA 3HZXA 2HUGA 3CCQA 1CK1A 4BS9A 3GD7A 1E1OA 5C4JH 4JI4L 4PMWA 3OIQA 5C4JB 2F0MA 3W1BA 1XMOQ 1P8LA 2UXDL 2DY8A 2N78A 4C2MH 5C0XI 4C2MB 5JEAG 4LFCL 3OIPA 1D1IA 2QCPX 2WAQB 1FR3A 1EOTA 4APVA 1KRSA 1ENCA 4YHHL 4OGQC 1HCZA 1XNRL 3DHQA 4XQQA 1J6QA 4DV5L 4LF6L 3DWPA 2DNCA 4LMQD 2EYLA 3K6OA 1F2MA 4ILWA 1BNZA 1LTGD 4BY7G 2L15A 5DAUA 2LXJA 1AZPA 5H1SE 3PV0A 2LY7A 3JAMc 1V1PA 1VQ4A 4X6AH 1F9RA 2A6EC 3H0GH 1K28A 2EXDA 3H0GB 3I4NG 4N9PA 4UY8C 4AIMA 3U4VA 1FJGQ 1QUQA 1OO9B 3SXHA 3MFGA 5A35A 1AN8A 4DAPA 3HKZG 2RHSB 1PV4A 4DV4L 4DR1Q 2F4IA 1CI3M 1CZGA 4JI7L 2OF1A 3QB3A 1PFBA 2EYPA 5ELBA 2K5QA 1VF5C 4C3IH 3X3MA 1SE8A 3TZUA 4C3IB 1GM5A 4DR4Q 2UUCL 5FO7B 3J7A5 1OXSC 1B3AA 3MEHA 5J3BA 3BS1A 1HQRD 1KTKA 1TS5A 1N33L 2PPBC 1Y69U 4DV7L 1HA6A 4DR6Q 4BY1G 4XQNA 4JBKA 2R92H 5D65A 3CKIB 4DV0Q 3HOWB 2R92B 3S1NB 1E3PA 2HIVA 2FFKB 2Q8RE 3J7AV 2B2WA 2UXCQ 1B9MA 1EIFA 2LXKA 3VR3A 1RODA 3N52A 3S2HB 3VR4A 1MHWC 4DV1Q 1PYWD 1A2UA 4B3RL 1ESRA 1LTTD 3M4QA 1X9NA 5JPMC 2O5IC 4POFA 1O7IA 1SNPA 1I4GA 3NELA 3PUWA 3VR6A 5IYBH 4RMFA 1IL2A 1DONA 2F0NA 2MNAA 2NWGA 4PZ6A 2NVYH 3OSOA 1A3TA 1IBLQ 1I6VC 2NVYB 2CQAA 4HIMA 1HH2P 2ID0A 4C3JH 1TY0A 1N36L 2OTLA 3F2BA 3NBIA 1CHQD 4C3JB 4OX9Q 4O2DA 3L9AX 4A93G 4ZUIA 3E9HA 1HZCA 1J8IA 4TQUS 1VF7A 1UEAB 3HOYG 5LMNW 2CKZB 3I3CA 3P1HA 1CQFA 4HSVA 3IL8A 2CWPA 5HY6A 3MXNA 5J39A 1B70B 3G7LA 1RTOA 1PH1A 4B9XA 5C3XA 2KENA 4BBRH 2ZM6Q 4CJ0B 3F2DA 4DR7Q 1VCIA 1UE6A 1K3RA 1RCVD 4X3SA 2VB3X 2DGYA 3CD6A 2F0HA 1LT3D 3J80L 1A6XA 1KDCA 1F2YA 3VYUA 1HUMA 1WTVA 4GKKQ 5IGEA 2K5DA 1Q12A 4DAYA 4QIWB 3NBHB 2ZJRA 2PW7A 1AH9A 1HQMC 1R9TH 3DWQA 1SFOH 2OQKA 4OHJA 4HJ8A 1R9TB 3J81L 3Q0AA 3QOJA 3PO2H 3HKZE 1WCMG 4LUZA 3NTHA 3PO2B 1JWSD 1SYDA 4OWWB 3D8GA 1BBUA 3DWAA 2Z6KA 3EA6A 3KJOA 1SR3A 1KC8C 1G6PA 3J80E 4A3IG 2CW0C 4XIGS 1CSPA 3BYYB 4ALPA 1KHIA 3SVMA 3H09A 3CCSA 4IFDG 3J80c 4RHSA 4HMJA 1BR9A 1VQGA 3A0JA 2B29A 1XNQQ 3K5LA 1IKMA 3D4DA 4NB3A 1B1ZA 4FO2A 4A3EG 2C35B 1SBBB 1U4MA 2JXMB 5FLMH 2R7DA 3K59A 2D0PA 3HFZB 4JBMA 3J81E 5I2XA 2C9OA 1CTMA 2CH4A 4DV2L 2Z0SA 3T13A 3J81c 4AQYL 4R9WA 1IL8A 3TREA 2VQEL 1PH7A 2K1BA 2F0PA 3ZJYC 2K28A 1NCVA 3PIOA 1DOLA 1V1OA 4NXMQ 5I2YA 1EFID 1CKOA 1RJTA 2Y0SG 1SMYD 3FVQA 2XTIA 1IBLL 1Y8OB 3KF8B 2BH8A 3K5OA 3MXUA 2J0TD 4MTNA 3T1HQ 4ODGA 1LM0A 2BA1A 1JICA 1IYVA 2A6HD 3MC0B 1HZ9A 5EKLA 1HFNA 1X3PA 3BDCA 3RD4A 3SEBA 4R4CA 2DJFC 4A3BB 1YVCA 5M3MG 1H9MA 5KNBA 4JOIA 1G2TA 5FK9C 1KXLA 3J81i 1AEXA 1VQ9A 2Q2IA 1VMPA 4EX5A 1K83H 1HNZL 4TRDA 2IHEA 1K83B 2Q2TA 1D5MC 4HSPA 3R3OA 4ZYSA 1HUNA 3GTOH 2JK8A 1CKNB 3GTOB 3KJPA 2PI2E 3NP8A 3MVVA 3PO3B 2K4KA 4Y52H 1YI2A 2WACA 3Q22A 2IPKD 2RA4A 1PH8A 1HTLD 4IPGA 2BDOA 4DV6L 1C0AA 1O7LA 5CBAE 1X3FA 4OIKA 4PG3A 2K33A 2VB2X 5EBCA 4DF7A 4DNTB 2JA5H 3CW2C 3FKIG 3T4AC 2JA5B 2EE1A 3PF4A 3HOUH 1PRTC 5I9OA 4TSSA 4NPSA 3S1RH 1HNWQ 4AYBE 1XYIA 4R4IA 1FGUA 3S1RB 1HTPA 3IKJA 3S1QH 1WTPA 3K0XA 1NBWA 2PW5A 2E75C 3Q6SA 3QR8A 1E7ZA 2B2WC 2F3VA 1STGA 3TSSA 5IE8A 5M5XH 2I5LX 4LF4L 4K2LA 1WTHA 5M5XB 1G91A 4F8MA 4RG1A 4JYAL 5JEAH 4K5XA 2K5WA 3P20A 3TZDA 1FD7D 3U9SA 2RSNA 1Q86C 1YJ9A 5JEAJ 1YNJD 1L1OB 4FYDA 1K73C 1DOMA 4KHVA 2A5HA 2JA7G 1K0RA 3M85A 5EKKA 1N34L 3VYSA 3E6ZX 4LK1C 2RDFA 3EBEA 5M3FH 1XMQQ 2R61A 5M3FB 5E4WC 1MBYA 2JA6H 1LUZA 4HJ5A 4I7AA 4NXML 2JA6B 1HPCA 1CFMA 4U68A 4GOPA 1S5ED 4LFAL 1FL0A 3TP8A 3UE1A 3I4NB 3E0EA 4P73A 2Y0SE 2A19A 5D14A 3S9WA 4R1JA 4OXPA 2KHIA 5JVH3 5CV4A 2A69C 3STBC 3HKZB 1N9WA 2PQAB 1BOSA 1ILQA 4JCVE 3HOVG 3VR5A 4KI0A 1PFNA 3T53B 1B3QA 3S1MB 1SYEA 1F2ZA 2MUYA 1TIID 1Q1BA 1TWFB 1HHVA 4MTKA
chains in the Genus database with same CATH topology
4RHRA 4XT1B 1DJRD 3S15B 1F9QA 1J9OA 1U9RA 2XWBB 3PIP3 4M8AA 5T1GA 4BY1B 2G9DA 3GO5A 1M4VA 3GTLB 3OPOA 2A68C 4HN7A 4NDXA 2R6GA 5EPKA 2EY1A 1CM9A 2ZT9C 4FXKC 2ZXPA 3K5MA 4KMUC 4DXFA 5KGUA 2A73B 4R8NA 1SYBA 4A93B 2EY2A 2F3WA 1BCPC 1YNND 5HURA 3U9OA 4G7OC 3SK4A 1EWHA 1X3QA 1MSHA 1CQVA 3PMFA 5TSSA 1AP0A 3NTIA 5C44B 1UUPA 4EVOA 4NW2A 3O13A 5JJZA 2SOBA 3OW7A 2KCNA 4O42A 3W3AA 3MZ5A 5C4ZA 1TS4A 2OXPA 4X3UA 5C4HA 4A3DB 2D2CC 4XT3B 3L3OC 1OXVA 1WCMB 2HDMA 1LTBD 3LWEA 2B2UA 3FPPA 2JEBI 4CKBA 1CA6A 2K04A 1JC7A 3V2TA 5K36G 1NUCA 2JEAI 2TMPA 4IFDJ 1Z7TA 2PO4A 2XWJB 3A54A 4XXEA 1TR5A 2L9HA 5JVG3 3QO2A 4A3EB 1ZYRD 2N55A 1SE4A 2EPBA 3CRKC 4EQNA 1DYQA 1LT4D 2K01A 4FP5D 1KLGD 4FXDA 1SSOA 1ICWA 2F03A 1STAA 1SYCA 3D4WA 4LAAA 5IGBA 3M3YB 1WD0A 1GUWA 1PXUA 2VNUD 2C5CA 2Y0SB 2FMCA 5KYIA 4ID6A 1C4QA 3C46A 3PUXA 5I6WA 5A2QL 3IFDA 5EPLA 4PNYA 5LL6X 1CT1D 2F0WA 3BVGA 4G7HC 2VXWA 2F0QA 1C8CA 5M3MB 1ET6A 3T51B 4NP5A 2ICIA 3SK5A 1L0YB 5KIXA 2ENBA 1I4RA 5A2QE 3HRZC 4OO1G 3NBHA 2L5TA 3VR2A 1I3QB 3FMCA 2RDGA 1GHKA 4P2CB 5M9OA 3D3RA 3IAYA 1ML0D 4FF1A 1ENFA 3QJYA 2KEDA 3I91A 2EXZA 4J8QA 3ZYYX 2EYHA 3OHXC 1T5EA 2Z1CA 3TBIB 3FKIB 5EKIA 1Y8NB 3AB9A 3NUCA 3ERQA 3FDTA 5I6YA 4CHTB 4KTAA 5ELDA 3VA5A 1RD9D 2X6GA 1YNJC 4N9TA 4B08A 1T5XD 3HS0C 1PMRA 1EYAA 3AMUA 1SNMA 1IW7C 2JA7B 4FXGC 2BCOA 1CHPD 2JSOA 2OT2A 2NTTA 3ONAB 1KDAA 4IN3A 4IUTA 5KYLA 3KF8A 1F9PA 3HP3A 1O7ZA 1TWCB 1Q1EA 5JPNC 4WRDA 2XNAC 4IUUA 5JOBA 4R8IA 4CJ1B 2JYOA 1LABA 3NWSA 4Z9CB 1ILPA 1QNUA 1TQOA 1PLFA 3HOVB 5EGTA 1TWGB 3D6WA 1JOQA 1L0XB 1G6ZA 3DEPA 4DGZA 2MGSA 3PUZA 5FKAC 5CV5A 2NN6G 4NKLA 3L7ZC 1Q90A 3Q23A 4PV1C 2IX1A 1RDPD 2E2JB 3K5NA 1STNA 5C0XJ 1Z6HA 4EQOA 4IZ8A 4CKCA 1GUNA 4KN4C 1KNEA 1WTOA 2K6AA 1ZKOA 4KKUA 3I4LA 5ELFA 2PZUA 3A8IE 4RGMA 5I9PA 4YIJA 5CC4A 2B2UC 3GTKB 5EQ0A 4ZUJA 2RVLA 1NR2A 2L55A 4IURA 5LHY1 4IUQA 2IW3A 1EQVA 1F9SA 1E2VA 3MHBA 2NB0A 3GTJB 3KBXA 3BVZA 1B53A 2F0FA 1PRTB 1IKLA 1M8AA 2F0JA 1JOKA 1FYCA 2B63B 5HGTA 3GTMB 3NSWA 5C5LA 3KUPA 1Y1VB 4RKLA 1H9KA 1SEBD 2R93B 4F7XA 4ZLTF 4KK7A 5FOBB 3X3NA 3QWNA 2EY6A 2TSSA 5E3FA 2SNSA 2XN9C 3M4OB 2SEBD 4EQPA 2AQ3B 1TKWB 4Q0FA 3W2DA 1BUVT 2JP1A 3RZOB 4OIJA 1TU2B 1D5XC 4V0BA 2KECA 1AZQA 3C1EA 2B39A 1BO0A 3CQZB 3GV3A 2JA8B 4RKBA 1E2ZA 1EY7A 4QF4A 2XRQD 4HCSA 1GUSA 2XRSD 1EWCA 1PFMA 2HCCA 3EJIA 1WTRA 1U4LA 5CBEE 5K36H 4HEDA 3TDQA 3AU7A 3Q24A 4KJNA 2QEJC 3KLSA 3EVQA 3S16B 1WVLA 2A6ED 1EY5A 4BWGB 2AQ2B 3WDNA 1BXTA 3OWEB 2O2LD 1LO5D 1W6JA 1SAPA 3KLRA 3NXWA 2MPMA 3CU7A 2Z4HA 3J7AF 5IOCA 4HMIA 1QE6A 4E6IA 4DK0A 4C3IG 5CGKA 4HTHA 3RMHA 3G6JB 1IHZA 2F0IA 1EL0A 1WTXA 2PYKA 2J4XA 2L4NA 3BDOA 3S17B 1U4PA 4I7ZC 1A2TA 1B50A 3IFTA 2EYMA 1JWMD 3N6RA 2Z8LA 3C2PA 4IQZA 4BA2I 2DN8A 4A3MB 5ISRA 3A7AB 1D1KA 4KY7A 4L8JA 2QF7A 1F77A 3M7GA 4HCEA 4BY7B 5FO8B 4JBWA 2WKCA 1ZEQX 3NQIA 3HOZB 1S5BD 3R2TA 2QILA 1VMCA 1STEA 5D3DA 1H9SB 1LTAD 3MXPA 4MIUA 2NBFA 1BQQT 5BN4A 1EYDA 1DM0B 4IALA 3PUYA 1ENAA 2BOSA 1QNKA 5E1FA 3BDLA 1JR0D 2O4XA 2F0SA 4B9WA 4IFDI 5C5MA 2IWHA 1EEID 1EU3A 1AFPA 4K8IA 2XIWA 1EU4A 2WINB 5KNDA 1FNWA 4KJOA 5E4XA 4IUPA 5C0XG 3HOXB 3C3LA 1MI2A 3DXJC 2EJFC 3TMEA 3SK6A 2KVMA 4RA8A 2F0UA 3BZDB 2WKDA 2KCCA 3VA7A 1RKNA 1PTOB 2F0OA 2F0VA 3R93A 4IUNA 3OWFA 5K5PA 4HAEA 5CV6A 4ME5A 3PIO3 1QWYA 2Z4IA 4RH6A 1DZ1A 1FNUA 1K8OA 4ZAIA 2R3ZA 1A3VA 5I4DA 1TS3A 1O7YA 3SR1A 3HOYB 1NSNS 5CMDA 4U673 2CW0D 1Y8PB 5CYUA 3I90A 2F0GA 3T16A 2B2YA 1PDQA 1D2BA 1D6EC 3I73A 3K7AB 4ZKCB 4WFN3 3CHBD 2NN6H 2YU9B 4KV6A 3NE5B 2PZWA 3MTSA 1S4ZA 1JWUD 1K8MA 3TN2A 2NVQB 1PZID 3C1FA 3I72A 2E74C 1W6KA 4H44C 4FVMA 2CHBD 2F0TA 1MGSA 2EY5A 1Q3LA 1Q8IA 4H0LC 5KNCA 4G57A 3A7LA 1NAPA 4A3IB 4CGYB 1GOZA 4IFDH 3QOLA 4RCOA 4A3JB 1TWHB 1QB5D 2E76C 1EY6A 4DA2A 4QB4A 2ZXOA 4J6HA 3KLSX 3K0YA 5ELCA 1HXYD 4F87A 2KOLA 2XSCA 1R4PB 2I46A 3OMCA 3MA2B 2PCFB 1SMYC 3FPUB 3I4MB 4C3HG 2KJXA 2EJGC 3HGBA 4KHZA 2A6HC 5C3EB 5IGFA 1JQYD 1QCBD 3LWUA 4ZK9B 3S2DB 1TWAB 5IGCA 1PRTD 3V05A 3K57A 2VUMB 3SE0A 2IT1A 4XYOA 5ELEA 4K5VA 4OL7A 3FEWX 2LS01 1XXGA 2BE5D 3KK7A 4K14A 3H91A 3D6CA 5KEEA 3OOCA 4MN3A 3UI2A 3DMUA 1SJHD 1EZ6A 3JAME 2E2HB 5J22A 2E2DC 4L63B 1PTOF 1KDBA 2SDFA 4K8JA 1GUOA 1MD2D 1SE2A 1VDZA 2KUMA 1ET9A 4K5WA 4H13C 2J7ZA 2FJ2A 4KD3A 3P75A 1QG7A 1R4QB 1KLUD 1GUGA 4PQXA 2A69D 4A3FB 2M9VA 1LT6D 4DXGA 2EYOA 1X32A 2X69A 3E5SA 1WD1A 2FMMA 1XX8A 2M2LA 2A74C 3GQBA 4RGTA 1XWEA 1KABA 1RF2D 4V190 2K32A 4KKSA 4KN7C 4J1MA 5CV8A 3DEOA 1I4XA 3HG9A 3ITPA 2RKSA 4ULLA 1BDOA 2XVSA 1H9RA 1OXXK 2A68D 4DN4M 4CKEA 1I6HB 4QMGA 1EZ8A 4NMZA 3RZDB 1WTWA 3QIAA 4X3KA 3HEJA 1MSGA 2YYZA 3D31A 4ZRZA 3PUVA 4LJZC 1SDFA 1NR4A 1LTID 4I65A 2AQ1B 4FNFA 2B2YC 2L12A 1DXMA 4QUCA 3GV6A 1EYCA 2MP1A 3SDZA 1BCPD 3NPPA 1LLRD 1E0BA 1HA5A 3BVMA 3NHHA 4BBRB 2MJ8A 1S5DD 5CORA 2L1BA 4C1NK 1OXTA 5C0XH 2KHSA 1KNAA 1V1PB 3S14B 3R8BA 2LMCB 2EYJA 1SNCA 2F0DA 1S5CD 2FINB 3ND9A 5JAVA 1S5FD 1O80A 2EYFA 3J7YW 1TS2A 5G3LF 5C4XB 4DK1A 4FF2A 4K6DA 4CJ2C 5FLXL 2Q8IB 1SFOB 1GXDC 3I8ZA 4CBVA 1EY0A 3TP5A 1D5ZC 1B9NA 1YNNC 2G9HD 2ICEC 2WP8J 1RHPA 1HFGA 4WJWA 2CVRA 3RUZA 2HDLA 4H7BA 5C6AA 2D62A 3FRPB 4JK1C 1EY4A 1PTOD 2WB1B 1XTCD 1G2SA 1AW7A 1G291 2PMZB 3DM1A 5FLXE 2B2VA 5M5YB 2AWOA 1I4PA 1OXUA 4OO1I 5NUCA 4QUFA 2FHTA 3BG3A 3GP7A 2JE6I 1Y1WB 4X3TA 5KRUA 4ABNA 1I50B 1B2TA 1QOHA 1ESFA 1FGBD 5BN5A 1RTNA 2IL8A 4XTCS 1DOKA 1H9SA 5DM73 4L6TB 1WTQA 2IX0A 4K6LA 1F2LA 1GUTA 5F2DA 4G7ZC 2QKIC 4K2KA 5T1IA 3BYTB 4ZQ3A 3I70A 3SHLA 5IODA 2RDHA 1GJXA 2EOTA 1SYFA 1SJED 1SNQA 4KD4A 1SXTA 3KBGA 4KKTA 1JOOA 4DU9A 4RGNA 4FF3A 3WOEA 3VYTA 1G8ZD 5BN3A 3VYRA 1TT2A 4RGOS 1TY2A 1ZYRC 4BBSB 4DAVA 1JCKB 4UAIA 4DFAA 4WORA 4PMCA 2Q8TA 1A15A 3ND8A 1UNSA 2NTSA 3LX0A 2F1MA 3M7NA 4A3KB 2B2TA 3V96A 4HR7B 3WOFA 3R2IA 4C1NI 2ZXRA 5EPJA 5DNFA 3DUZA 2EZVA 2R7ZB 2N88A 2QDBA 3CRLC 2B8GA 4ZKBB 4C3HB 3EQLC 3RLFA 4BA1I 5IIFA 1TVXA 3D4RA 3HOUB 3H6MA 1I4HA 2LFNA 3A55A 2IJ0A 1STYA 2KQ3A 2NN6I 3S1QB 2OEOA 5CV9A 4XQJA 3NWTA 4PMBA 2BE5C 3A8KE 1BCPB 2WIIB 3P7JA 1GHJA 2F0LA 1I4QA 5G3LD 4QCLA 1UAPA 1EY8A 1BF4A 2F0KA 1QILA 4A3GB 3F2UA 2E2IB 4OO1H 1IW7D 1H9JA 4C3JG 2PNRC 1IYUA 1LACA 1V8QA 1B4OA 1STHA 4Q5VA 5DEHA 5IT9L 5LL6S 2B8FA 4C56C 3H94A 2D5DA 2KA7A 4S3SA 3GTQB 1CZWA 5DM63 3T56B 2X6LA 1EEFD 3SK8A 2IX3A 4Y7NB 1PRTF 5COYA 3TP7A 4FF4A 1LT5D 4GZYC 2GA4B 5IGDA 2HQEA 1PTOH 2MHVA 3MXGA 1BBXC 2M00A 5J1ZA 2V4DA 1JORA 1EIHA 1SE3A 5IT9E 1SNDA 3H3VC 1U4RA 4UDUC 3MWYW 3NK9A 2AWNA 1PZKD 2NUCA 5AFWA 3MAQA 2RQXA 2HCIA 2NVXB 4IUVA 3NTKA 1ZXTA 1E2WA 1LV9A 1JE4A 2D9UA 3EFXD 1ONLA 1B44D 2DY7A 5EBDA 1SYGA 2K03A 2KEEA 2RSOA 5M5WB 1CA5A 2F0EA 5CV7A 5EJWA 3K58A 2LKVA 2BDNA 2B2VC 5C3WA 2WV6D 5D3IB 2NZ1D 2NVTB 1LTRD 4XYQA 4F88A 4KY6A 3EROA 5CR3A 2AUKA 2RBMA 3GTPB 2PZTA 2PQEA 1KAAA 5IGGA 2L0CA 1V43A 2K05A 2BA0A 3GTGB 2K7VA 1DCZA 1STBA 1LTSD 3NQTA 1C48A 4RFBA 2H4OA 1Z47A 4RAUC 1A3UA 3A8JE 4G4KA 3LNNA 4RCNA 1DD2A 4MHEA 3OMGA 4TKOB 1EIGA 2I07B 3MFYA 2EJMA 2EDGA 1II3A 4O1NA 1PZJD 4AYBB 2EVBA 4RWSC 4XDXA 1HRJA 2NYZD 1FNVA 1PTOC 5FO9B 4EGVA 2DNEA 1BCPF 4DNRB 2B2TC 2L11A 2O5JC 1QJOA 3QG1A 3E0JA 4KY5A 3TP6A 2AUJD 3URYA 1EY9A 1SNOA 3M4YA 1O78A 3A56A 1JB3A 3JAML 2SNMA 2H1EA 4M1UB 1EQTA 3HZXA 2HUGA 1CK1A 4BS9A 3GD7A 4PMWA 3OIQA 5C4JB 2F0MA 2DY8A 5C0XI 4C2MB 5JEAG 3OIPA 1D1IA 2QCPX 2WAQB 1FR3A 1EOTA 1ENCA 4OGQC 1HCZA 3DHQA 4XQQA 3DWPA 2DNCA 4LMQD 2EYLA 3K6OA 1F2MA 4ILWA 1BNZA 1LTGD 5DAUA 1AZPA 3PV0A 2LY7A 1V1PA 1F9RA 2A6EC 3H0GB 4N9PA 1OO9B 3SXHA 3MFGA 5A35A 1AN8A 4DAPA 2F4IA 1CI3M 1CZGA 2OF1A 3QB3A 1PFBA 2EYPA 5ELBA 2K5QA 1VF5C 3X3MA 3TZUA 4C3IB 5FO7B 1OXSC 1B3AA 3MEHA 3BS1A 1HQRD 1KTKA 1TS5A 2PPBC 1Y69U 1HA6A 4XQNA 5D65A 3CKIB 3HOWB 2R92B 3S1NB 2FFKB 2Q8RE 3J7AV 2B2WA 1B9MA 3VR3A 1RODA 3N52A 3S2HB 3VR4A 1PYWD 1A2UA 1ESRA 1LTTD 5JPMC 2O5IC 1SNPA 1I4GA 3PUWA 3VR6A 1DONA 2F0NA 2NWGA 3OSOA 1A3TA 1I6VC 2NVYB 2CQAA 2ID0A 1TY0A 3NBIA 1CHQD 4C3JB 3L9AX 4ZUIA 1J8IA 4TQUS 1VF7A 1UEAB 3I3CA 3P1HA 1CQFA 4HSVA 3IL8A 3MXNA 5J39A 3G7LA 1RTOA 4B9XA 5C3XA 4CJ0B 1VCIA 1RCVD 4X3SA 2VB3X 2F0HA 1LT3D 3J80L 1A6XA 1KDCA 1F2YA 3VYUA 1HUMA 1WTVA 5IGEA 2K5DA 1Q12A 4DAYA 4QIWB 2PW7A 1HQMC 3DWQA 4OHJA 1R9TB 3J81L 3Q0AA 3QOJA 3NTHA 3PO2B 1JWSD 1SYDA 3D8GA 3DWAA 3EA6A 3J80E 2CW0C 4XIGS 3BYYB 3SVMA 3H09A 4IFDG 4RHSA 4HMJA 1BR9A 1IKMA 3K5LA 3D4DA 1B1ZA 4FO2A 3K59A 1SBBB 1U4MA 2JXMB 3J81E 5I2XA 2C9OA 1CTMA 3T13A 4R9WA 1IL8A 2K1BA 2F0PA 2K28A 1NCVA 1DOLA 1V1OA 5I2YA 1EFID 1RJTA 1SMYD 3FVQA 1Y8OB 3K5OA 3MXUA 2J0TD 4ODGA 2BA1A 1JICA 1IYVA 2A6HD 3MC0B 5EKLA 1HFNA 1X3PA 3BDCA 3RD4A 3SEBA 4A3BB 1H9MA 5KNBA 1G2TA 5FK9C 1AEXA 1VMPA 4TRDA 1K83B 1D5MC 4HSPA 3R3OA 4ZYSA 1HUNA 3GTOB 3NP8A 3MVVA 3PO3B 2WACA 3Q22A 2IPKD 2RA4A 1HTLD 2BDOA 1O7LA 5CBAE 4OIKA 2K33A 2VB2X 5EBCA 4DF7A 4DNTB 3T4AC 2JA5B 2EE1A 1PRTC 5I9OA 4TSSA 1XYIA 3S1RB 1HTPA 3IKJA 1WTPA 2PW5A 2E75C 3Q6SA 2B2WC 2F3VA 1STGA 3TSSA 4K2LA 1G91A 5M5XB 4F8MA 5JEAH 4K5XA 2K5WA 3P20A 3TZDA 1FD7D 3U9SA 2RSNA 5JEAJ 1YNJD 4FYDA 1DOMA 4KHVA 2A5HA 3M85A 5EKKA 3VYSA 3E6ZX 4LK1C 2RDFA 2R61A 5M3FB 5E4WC 1MBYA 2JA6B 1HPCA 1CFMA 4U68A 1S5ED 3TP8A 3I4NB 5D14A 3S9WA 5JVH3 5CV4A 2A69C 3HKZB 1BOSA 1ILQA 3VR5A 4KI0A 1PFNA 3T53B 3S1MB 1SYEA 1F2ZA 2MUYA 1TIID 1Q1BA 1TWFB 1HHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMZ B;  3RZD B;  3RZO B;  3PO3 B;  4A3D B;  3PO2 B;  5M5Y B;  3HOU B;  3K7A B;  3S15 B;  2PPB C;  2VUM B;  2O5J C;  1I3Q B;  3CQZ B;  1WCM B;  1Y1W B;  2JA8 B;  3S1Q B;  4LJZ C;  2YU9 B;  2CW0 C;  3HOW B;  2R92 B;  3S1N B;  1I50 B;  2BE5 C;  4BY1 B;  2E2J B;  3S2H B;  5M5W B;  3GTL B;  2A68 C;  4KN4 C;  2NVQ B;  2JA5 B;  4G7Z C;  2O5I C;  4A3G B;  3TBI B;  2E2H B;  3FKI B;  2NVT B;  4A3E B;  3S1R B;  5C4J B;  3S16 B;  2E2I B;  1I6V C;  3HOX B;  2NVY B;  4KMU C;  4BBR B;  3GTP B;  3GTK B;  4C2M B;  4C3J B;  3DXJ C;  4A3I B;  3WOE A;  5M5X B;  2WAQ B;  3GTG B;  4A3J B;  3S14 B;  1TWH B;  4A93 B;  1YNJ C;  3GTJ B;  3M3Y B;  4A3F B;  4G7O C;  4LK1 C;  2Y0S B;  1ZYR C;  4BBS B;  3GTQ B;  1IW7 C;  2JA7 B;  2LY7 A;  5C4X B;  5M3F B;  2A6E C;  4Y7N B;  2B63 B;  3H0G B;  2JA6 B;  3GTM B;  1SFO B;  3S17 B;  1Y1V B;  4GZY C;  1TWC B;  4A3B B;  5C44 B;  3I4N B;  4A3K B;  4G7H C;  3WOF A;  2R93 B;  1SMY C;  3HOY B;  2A69 C;  4A3M B;  1YNN C;  3I4M B;  3HKZ B;  3H3V C;  4AYB B;  5M3M B;  4KN7 C;  2A6H C;  2R7Z B;  3S1M B;  4QIW B;  5C3E B;  1K83 B;  4JK1 C;  4C3H B;  3M4O B;  1HQM C;  3HOV B;  4C3I B;  4BY7 B;  3EQL C;  2WB1 B;  1TWG B;  3HOZ B;  2NVX B;  1R9T B;  3S2D B;  1TWF B;  3GTO B;  1TWA B;  1I6H B; 
#chains in the Genus database with same CATH topology
 4RHR A;  3S15 H;  4XT1 B;  1YJN A;  1DJR D;  3S15 B;  4WJ4 A;  1F9Q A;  3BJU A;  2ALY B;  1EWI A;  1J9O A;  1U9R A;  4X62 Q;  3CCV A;  1Q46 A;  2XWB B;  1RIP A;  1X65 A;  1KQS A;  3PIP 3;  4M8A A;  5T1G A;  4BY1 B;  2G9D A;  4ME3 A;  3GO5 A;  1M4V A;  2Q2H A;  1VQ8 A;  3GTL B;  3OPO A;  2A68 C;  4P72 A;  4HN7 A;  4A3L G;  4NDX A;  4LFB Q;  3UDG A;  2R6G A;  5EPK A;  1V1Q A;  1NNX A;  2EY1 A;  2Z6K C;  1CM9 A;  2ZT9 C;  4FXK C;  2ZXP A;  3K5M A;  4KMU C;  4DXF A;  5KGU A;  4JI6 Q;  3G48 A;  2A73 B;  4R8N A;  5EAY A;  4A93 H;  4UHV A;  4LF7 Q;  4GKJ L;  4HID A;  1SYB A;  4A93 B;  4CDC C;  3K81 C;  4DK3 C;  2EY2 A;  5ELO A;  2F3W A;  1BCP C;  1YNN D;  5HUR A;  5AJ3 L;  2UUB Q;  3U9O A;  4G7O C;  3SK4 A;  5FJ8 G;  1EWH A;  1X3Q A;  2B63 G;  4P75 A;  1MSH A;  1EOV A;  1RL2 A;  1CQV A;  3PMF A;  5TSS A;  1AP0 A;  3NTI A;  5C44 H;  1YBY A;  3GTG H;  5C44 B;  3TS2 A;  4JI1 L;  4DR5 L;  1UUP A;  4EVO A;  4NW2 A;  1Y1W G;  3O13 A;  3I2Z A;  3EIV A;  2UUA Q;  5JJZ A;  1PH4 A;  2SOB A;  4GOP B;  3OW7 A;  4DR3 L;  2KCN A;  4O42 A;  3W3A A;  5JJK A;  4DNI A;  4JI3 L;  3MZ5 A;  5C4Z A;  4QL5 A;  3PQI A;  1TS4 A;  2OXP A;  4X3U A;  5C4H A;  4DUY L;  1S3O A;  1A8V A;  4A3D H;  4A3D B;  2JA8 G;  1XPU A;  4LF9 Q;  1UE1 A;  2D2C C;  4JOI C;  1U0L A;  4XT3 B;  1OTC A;  3L3O C;  1OXV A;  1WCM B;  2HDM A;  4JG2 A;  1VQ6 A;  5ELN A;  1LTB D;  3LWE A;  1ASZ A;  1VQN A;  5GQO A;  2B2U A;  3FPP A;  2CFM A;  2JEB I;  4CKB A;  1CA6 A;  2K04 A;  1JC7 A;  3V2T A;  1HJP A;  5K36 G;  1NUC A;  2JEA I;  2TMP A;  2MO0 A;  4IFD J;  1HNX L;  1Z7T A;  2PO4 A;  2XWJ B;  3A54 A;  4XXE A;  4BBS G;  1TR5 A;  4A3E H;  2L9H A;  4CDF C;  1PH5 A;  5JVG 3;  1MIU A;  3QO2 A;  4A3E B;  1ZYR D;  2UXB Q;  2N55 A;  2E8G A;  1SE4 A;  2EPB A;  3CRK C;  4EQN A;  4X66 L;  3NEN A;  4LF8 Q;  2QW7 A;  1DYQ A;  1LT4 D;  2K01 A;  4FP5 D;  2ZJQ A;  1H95 A;  4B3T Q;  1KLG D;  4FXD A;  4DV3 Q;  4YY3 Q;  4DR2 Q;  4IPD A;  3SGI A;  1SSO A;  5IWA L;  1ICW A;  2F03 A;  1BVS A;  3M3Y H;  1STA A;  1SYC A;  3D4W A;  4LAA A;  5IGB A;  3M3Y B;  1WD0 A;  1GUW A;  1PXU A;  3CPW A;  2VNU D;  2C5C A;  3UDI A;  2Y0S B;  2FMC A;  4A3C G;  1XPO A;  5KYI A;  1VQ7 A;  4ID6 A;  1C4Q A;  3E3X A;  1M1K C;  4POG A;  4N8X 1;  3C46 A;  4X65 L;  2VL6 A;  3PUX A;  5I6W A;  4JV5 L;  5A2Q L;  3IFD A;  5EPL A;  1VQF A;  4PNY A;  4DAM A;  5LL6 X;  1CT1 D;  2F0W A;  3AYH B;  4A3M G;  3BVG A;  4G7H C;  2VXW A;  1CKM A;  2F0Q A;  1C8C A;  3K8A A;  1HR0 Q;  5M3M H;  5M3M B;  3U50 C;  1ET6 A;  2HQL A;  3HOZ G;  3T51 B;  4NP5 A;  2ICI A;  1VQM A;  3SK5 A;  3AEV A;  1J5E Q;  1L0Y B;  3FP9 A;  5KIX A;  4KHP L;  2ENB A;  1YZ6 A;  1I4R A;  5A2Q E;  3HRZ C;  4OO1 G;  1I3Q H;  1X6O A;  3NBH A;  2L5T A;  3VR2 A;  1I3Q B;  4QQB X;  4LUV A;  3FMC A;  2RDG A;  1GHK A;  4P2C B;  5M9O A;  5JJL A;  5GAD C;  3D3R A;  3OYY A;  3IAY A;  1CUK A;  1ML0 D;  3GDE A;  4FF1 A;  1ENF A;  3QJY A;  2KED A;  3I91 A;  2EXZ A;  4J8Q A;  4HJA A;  3ZYY X;  2EYH A;  3FKI H;  3OHX C;  1T5E A;  1S72 A;  5GRO A;  3B6Y A;  2Z1C A;  3TBI B;  3FKI B;  3OTO L;  3HOX G;  1AE2 A;  3EN2 A;  3HOW H;  5EKI A;  3S1N H;  1Y8N B;  4DUZ L;  3AB9 A;  3NUC A;  4GNX C;  2OQ0 A;  3ERQ A;  3FDT A;  3S2H H;  5I6Y A;  5LMU L;  4CHT B;  4KTA A;  5ELD A;  2P5Z X;  3AFP A;  3VA5 A;  3RLN A;  1RD9 D;  4JI0 L;  2X6G A;  1YNJ C;  3RN2 A;  4N9T A;  4FDB A;  1DGS A;  4B08 A;  4LF8 L;  1T5X D;  3HS0 C;  1PMR A;  4L5R C;  1EYA A;  3AMU A;  1SNM A;  3WWV A;  1IW7 C;  2JA7 B;  4FXG C;  4B3S Q;  2BCO A;  5BR8 Q;  1CHP D;  2JSO A;  2OT2 A;  4JI8 Q;  5IP7 H;  2NTT A;  3ONA B;  1KDA A;  4IN3 A;  4IUT A;  5KYL A;  3KF8 A;  1TWC H;  1F9P A;  3HP3 A;  1O7Z A;  1TWC B;  1Q1E A;  4YWL A;  5JPN C;  3CC7 A;  4WRD A;  4CDD C;  1XMO L;  2XNA C;  4IUU A;  1K8A C;  5JOB A;  1PFS A;  4R8I A;  4CJ1 B;  2JYO A;  2N3S A;  1LAB A;  1HZA A;  3NWS A;  4Z9C B;  3HOV H;  1ILP A;  1QNU A;  1TQO A;  1PLF A;  3RN5 A;  1TWG H;  3HOV B;  4O0A A;  5EGT A;  1TWG B;  3D6W A;  1JOQ A;  1L0X B;  4L5T A;  1G6Z A;  3NEM A;  3G4S A;  3DEP A;  4DGZ A;  2MGS A;  3PUZ A;  5FKA C;  5CV5 A;  2CCZ A;  2NN6 G;  4NKL A;  2BH2 A;  3L7Z C;  1Q90 A;  1CKN A;  3Q23 A;  4PV1 C;  2IX1 A;  1MKH A;  1RDP D;  4P74 A;  3H3V I;  1FJG L;  4AH6 A;  2E2J B;  2Q2U A;  3K5N A;  1STN A;  5C0X J;  1Z6H A;  4EQO A;  4IZ8 A;  1YJW A;  4CKC A;  1GD7 A;  1GUN A;  4DR1 L;  4KN4 C;  1KNE A;  1WTO A;  2K6A A;  3CME A;  1ZKO A;  4KKU A;  3I4L A;  1E1T A;  2V1C C;  5ELF A;  1Q81 C;  1L2F A;  4A3L H;  1PH3 A;  2PZU A;  3A8I E;  4RGM A;  5I9P A;  1YHQ A;  1I94 Q;  4YIJ A;  5CC4 A;  2B2U C;  3GTK B;  4DR4 L;  5EQ0 A;  4ZUJ A;  2RVL A;  1NR2 A;  2L55 A;  4A3J G;  1D7Q A;  5E7N A;  4IUR A;  5LHY 1;  2OWO A;  4LNQ A;  4IUQ A;  2IW3 A;  1G51 A;  1EQV A;  1X3G A;  1BBW A;  2UU9 Q;  3GTJ H;  1F9S A;  4DR6 L;  1E2V A;  3MHB A;  2NB0 A;  3GTJ B;  3KBX A;  3BVZ A;  1VQJ A;  4R4O A;  4DV0 L;  1B53 A;  1WOC A;  2UXC L;  2F0F A;  1PRT B;  5FJ8 H;  1IBM Q;  1IKL A;  1M8A A;  4DV1 L;  2B63 H;  2F0J A;  1JOK A;  2K75 A;  1L1O A;  1FYC A;  2B63 B;  5HGT A;  1Y1V H;  3GTM B;  3NSW A;  5C5L A;  3KUP A;  3IRB A;  1Y1V B;  4RKL A;  1GO3 E;  3PGZ A;  1H9K A;  1QVG A;  3I4M G;  1SEB D;  2R93 H;  3TQY A;  2R93 B;  4F7X A;  4ZLT F;  2IHF A;  2LSS A;  4KK7 A;  5C3E G;  5FOB B;  4X64 Q;  1KD1 C;  5LMN Q;  3X3N A;  4OX9 L;  3QWN A;  2EY6 A;  2TSS A;  2SNS A;  5E3F A;  1AE3 A;  2XN9 C;  3M4O B;  2SEB D;  4EQP A;  2AQ3 B;  1TKW B;  4Q0F A;  3W2D A;  1BUV T;  2JP1 A;  4A3B H;  3RZO H;  2VUM G;  2PQA A;  1A62 A;  3RZO B;  4OIJ A;  1TU2 B;  4B3M Q;  1D5X C;  4V0B A;  2KEC A;  1AZQ A;  3C1E A;  3CQZ H;  2B39 A;  1BO0 A;  4JI2 Q;  2JA8 H;  2KCT A;  3CQZ B;  2ZM6 L;  3GV3 A;  1PH2 A;  2JA8 B;  4DR7 L;  4RKB A;  1E2Z A;  1EY7 A;  4QF4 A;  2XRQ D;  4K0K Q;  4HCS A;  3ERS X;  4CDE C;  1GUS A;  2XRS D;  3ULJ A;  2I0Q A;  1EWC A;  1PFM A;  4PZ8 A;  2HCC A;  3MEF A;  3EJI A;  4OON A;  1WTR A;  3PO3 H;  1U4L A;  5CBE E;  5K36 H;  4HED A;  4GKK L;  3TDQ A;  3AU7 A;  4OWX B;  3Q24 A;  4KJN A;  2QEJ C;  3S16 H;  3KLS A;  3EVQ A;  3S16 B;  2FXQ A;  3LGJ A;  4NXN Q;  3ER0 A;  1WVL A;  2A6E D;  2I5H A;  1EY5 A;  2E5L Q;  1VQD A;  4IJH A;  4BWG B;  2AQ2 B;  3WDN A;  1BXT A;  1W3S A;  3H3V H;  1PYB A;  3OWE B;  2O2L D;  1LO5 D;  3DM3 A;  1W6J A;  1SAP A;  3KLR A;  1XTD A;  3NXW A;  4A3F G;  5IYD G;  2MPM A;  3CU7 A;  2Z4H A;  3J7A F;  5IOC A;  4HMI A;  1K9M C;  1QE6 A;  4E6I A;  4DK0 A;  4C3I G;  5CGK A;  4HTH A;  3RMH A;  4LUO A;  3G6J B;  1IHZ A;  2F0I A;  1EL0 A;  1WTX A;  4A3C H;  1QVC A;  2PYK A;  4IOC A;  2J4X A;  2L4N A;  3BU2 A;  1XNQ L;  3BDO A;  3S17 H;  4LF5 Q;  3S17 B;  1U4P A;  4I7Z C;  1UE7 A;  1A2T A;  4P71 A;  1B50 A;  3IFT A;  2RHQ B;  2VQF Q;  2EYM A;  1JWM D;  3N6R A;  2Z8L A;  3C2P A;  4IQZ A;  2RF4 A;  4A3M H;  5IYC G;  2DN8 A;  4BA2 I;  4A3M B;  1YEZ A;  5ISR A;  3A7A B;  1D1K A;  4KY7 A;  4L8J A;  2QF7 A;  1F77 A;  3M7G A;  1E24 A;  4BY7 H;  3BZC A;  4HCE A;  2EQS A;  4BY7 B;  3HOZ H;  5FO8 B;  4JBW A;  2B3G A;  2WKC A;  1ZEQ X;  3NQI A;  3HOZ B;  2PI2 A;  1S5B D;  1V9P A;  3I4N H;  3R2T A;  2QIL A;  1VMC A;  1STE A;  2JA9 A;  3T1H L;  5D3D A;  1H9S B;  1LTA D;  3MXP A;  4MNO A;  4MIU A;  2NBF A;  1PVO A;  3F8T A;  1BQQ T;  5BN4 A;  1EYD A;  2I5M X;  1DM0 B;  3FHW A;  3PUY A;  4IAL A;  1ENA A;  2BOS A;  1QNK A;  5E1F A;  3BDL A;  4JI5 Q;  3S1M H;  1JR0 D;  2O4X A;  3KF6 B;  2N8N A;  2F0S A;  4B9W A;  4JVZ A;  5IY0 A;  4IFD I;  5C5M A;  2IWH A;  2OCE A;  1TWF H;  1NE3 A;  1EEI D;  1EU3 A;  1EIY B;  1KRT A;  1AFP A;  4K8I A;  2XIW A;  1EU4 A;  1P16 A;  2WIN B;  5KND A;  1KAW A;  1FNW A;  4BBR G;  4KJO A;  5GAG C;  1SRO A;  5E4X A;  3HOX H;  1UWV A;  4IUP A;  2HHH Q;  5C0X G;  3HOX B;  3C3L A;  1MI2 A;  1VQL A;  2H5X A;  4BY1 H;  1FVI A;  2ATW A;  3CCU A;  3DXJ C;  2EJF C;  3TME A;  1GKH A;  3SK6 A;  2KVM A;  3GTL H;  4RA8 A;  3U58 A;  2F0U A;  3BZD B;  2WKD A;  2KCC A;  3VA7 A;  1RKN A;  4R4T A;  1PTO B;  2F0O A;  2F0V A;  3R93 A;  4IUN A;  1BKB A;  5C4X G;  2F4V Q;  3OWF A;  4HIO A;  3W1G A;  3T1Y Q;  4BXX G;  5K5P A;  4HAE A;  3KDF B;  5CV6 A;  3PCO B;  4ME5 A;  1VQE A;  4OEM B;  4GLX A;  2VY3 A;  3PIO 3;  1QWY A;  2Z4I A;  1PYS B;  4RH6 A;  3PO2 G;  1SN8 A;  1DZ1 A;  1FNU A;  2A1A A;  3J81 j;  1K8O A;  1HNW L;  1NY4 A;  4ZAI A;  2R3Z A;  1A3V A;  5I4D A;  1TS3 A;  3HOY H;  1X55 A;  1O7Y A;  4IJL A;  3SR1 A;  3HOY B;  1NSN S;  5CMD A;  1B8A A;  4U67 3;  2CW0 D;  3DLL A;  1D8L A;  1Y8P B;  1E22 A;  5CYU A;  2WB1 G;  3G6E A;  4UP8 A;  3I90 A;  2F0G A;  1PA6 A;  2UXD Q;  5FLM G;  3T16 A;  2B2Y A;  1PDQ A;  4LFC Q;  1D2B A;  1EUJ A;  3K7A H;  2VW9 A;  3VDY A;  4YHH Q;  1D6E C;  3I73 A;  3K7A B;  1XNR Q;  4ZKC B;  2AHO B;  4WFN 3;  4YCV A;  1XMQ L;  2YU9 H;  2K5H A;  4DV5 Q;  3CHB D;  2ES2 A;  4LF6 Q;  2NN6 H;  2YU9 B;  2EIF A;  4KV6 A;  3NE5 B;  4LWC A;  2PZW A;  3MTS A;  1S4Z A;  1JWU D;  2Z6B A;  2NVQ H;  1K8M A;  3TN2 A;  2NVQ B;  1PZI D;  3C1F A;  2ZTE A;  3I72 A;  2E74 C;  1W6K A;  4H44 C;  3F1Z A;  1XJV A;  4FVM A;  3J7Z C;  2CHB D;  2F0T A;  1MGS A;  2EY5 A;  1Q3L A;  4DV4 Q;  1WCM H;  4DPG A;  1Q8I A;  4H0L C;  4PZ7 A;  4JI7 Q;  5KNC A;  4KLK A;  4G57 A;  4A3I H;  3A7L A;  1NAP A;  4A3I B;  4CGY B;  1GOZ A;  4A3J H;  4WJ3 M;  1TWH H;  4IFD H;  3QOL A;  4RCO A;  2UUC Q;  4A3J B;  1TWH B;  1I5F A;  3A5Z B;  1QB5 D;  3U4Z A;  4X62 L;  2E76 C;  1N32 Q;  1N33 Q;  1EY6 A;  4DA2 A;  4DV7 Q;  4QB4 A;  1T9H A;  1ASY A;  1ICF B;  2ZXO A;  4J6H A;  3CXC A;  4A75 A;  3KLS X;  4QGU A;  3K0Y A;  5ELC A;  4A3K G;  1CSQ A;  2Z9H A;  2ZTD A;  1HXY D;  4GNX B;  4F87 A;  4LFB L;  4DKA C;  2KOL A;  2XSC A;  1R4P B;  2I46 A;  4B3R Q;  3TS0 A;  3CAM A;  3OMC A;  1PH6 A;  3MA2 B;  4L5Q A;  2PCF B;  1SMY C;  3FPU B;  2R7Z G;  3I4M B;  4C3H G;  2KJX A;  2EJG C;  2YTY A;  3HGB A;  4KHZ A;  4JI6 L;  5C3E H;  2A6H C;  4HIK A;  4GN4 B;  5C3E B;  5IGF A;  2NZH A;  1JQY D;  3PF5 A;  1N36 Q;  1QCB D;  3LWU A;  3CCR A;  4LF7 L;  4ZK9 B;  3S2D H;  1TWA H;  4J15 A;  4HJ7 A;  3S2D B;  3HOU G;  1TWA B;  5IGC A;  1PRT D;  3V05 A;  3TRZ A;  2UUB L;  2VUM H;  3KYH C;  4TVA B;  4EQ5 A;  3K57 A;  2VUM B;  3SE0 A;  4YWM A;  2IT1 A;  4XYO A;  5ELE A;  2QDL A;  4K5V A;  4OL7 A;  3FEW X;  2LS0 1;  4OEL B;  2WB1 E;  1XXG A;  2BE5 D;  3KK7 A;  4K14 A;  3H91 A;  3D6C A;  2ZJP A;  4IO9 A;  2PMZ E;  5KEE A;  3OOC A;  4MN3 A;  4GOP C;  3UI2 A;  4A3G G;  2NZO A;  3DMU A;  1SJH D;  2UUA L;  1A0I A;  1EZ6 A;  2E2H H;  1A63 A;  3A5U A;  1NMF A;  3JAM E;  2E2H B;  5J22 A;  2OTJ A;  2E2D C;  4L63 B;  5M3F G;  3CPF A;  1JB7 A;  1YHB A;  1PTO F;  2CWA A;  2JA6 G;  1KDB A;  2SDF A;  4K8J A;  1GUO A;  1MD2 D;  1SE2 A;  1VDZ A;  2IY5 B;  1Q7Y C;  3CCE A;  2KUM A;  1ET9 A;  4K5W A;  4H13 C;  2J7Z A;  2FJ2 A;  4KD3 A;  1S40 A;  3P75 A;  2K52 A;  1QG7 A;  1R4Q B;  3D0F A;  4LF9 L;  1KLU D;  3RR5 A;  1GUG A;  4PQX A;  4A3F H;  2R7F A;  2A69 D;  3STB D;  5IYD H;  4A3F B;  2M9V A;  1IXR A;  1LT6 D;  4DXG A;  2KCM A;  2EYO A;  1X32 A;  1YIT A;  2X69 A;  3E5S A;  1SMX A;  2FMM A;  1WD1 A;  2VS1 A;  2HD3 A;  1IBK Q;  1XX8 A;  5GAE C;  2K14 A;  2M2L A;  3I55 A;  2MQH A;  4UP9 A;  2A74 C;  3GQB A;  4RGT A;  1N32 L;  1XWE A;  1KAB A;  1RF2 D;  4V19 0;  2K32 A;  2UXB L;  1K8G A;  3JAM i;  4KKS A;  5IYC H;  2JA7 H;  4KN7 C;  4B3T L;  4J1M A;  5CV8 A;  2DUD A;  4YY3 L;  4DV3 L;  4DV2 Q;  3DEO A;  3HG9 A;  3ITP A;  1I4X A;  2RKS A;  3AFQ A;  4ULL A;  4DR2 L;  4AQY Q;  1BDO A;  2XVS A;  1U5K A;  3L2P A;  1I6H H;  1H9R A;  2VQE Q;  1OXX K;  2A68 D;  4DN4 M;  4CKE A;  3RZD H;  4QMG A;  1I6H B;  1EZ8 A;  4NMZ A;  1UE5 A;  3RZD B;  3CP0 A;  1WTW A;  3QIA A;  2HIX A;  4X3K A;  1Y14 B;  3HEJ A;  1MSG A;  2YYZ A;  3D31 A;  4ZRZ A;  3PUV A;  4LJZ C;  1SDF A;  3L0O A;  3BZK A;  1NR4 A;  1LTI D;  4I65 A;  4IPH A;  2AQ1 B;  2K50 A;  4FNF A;  2JN4 A;  1LYL A;  2B2Y C;  2K5V A;  2L12 A;  1DXM A;  4QUC A;  3GV6 A;  1EYC A;  3CCL A;  2K5N A;  2MP1 A;  3SDZ A;  1HR0 L;  1BCP D;  4JBJ A;  3NPP A;  4ZCK A;  1LLR D;  2QGQ A;  2YTV A;  3CF5 A;  1E0B A;  1HA5 A;  1PH9 A;  3BVM A;  3NHH A;  4BBR B;  2MJ8 A;  1S5D D;  5COR A;  2L1B A;  4C1N K;  1JJ2 A;  1OXT A;  1J5E L;  5C44 G;  2KHS A;  3W5O A;  1NMG A;  5C0X H;  2E2J H;  1KNA A;  1IZ6 A;  2WFW A;  1HNZ Q;  4A4I A;  1EYG A;  3UDX A;  1V1P B;  1PHJ A;  3S14 H;  3S14 B;  3R8B A;  1C9O A;  4YCW A;  2LMC B;  2EYJ A;  3CC4 A;  1SNC A;  2F0D A;  1QUQ B;  1S5C D;  2JJQ A;  2FIN B;  3ND9 A;  5JAV A;  1S5F D;  1O80 A;  2EYF A;  5C4X H;  3J7Y W;  1K0S A;  3GTK H;  1TS2 A;  5G3L F;  5C4X B;  4DK1 A;  4BXX H;  4FF2 A;  4DV6 Q;  4K6D A;  4CJ2 C;  5FLX L;  4A3D G;  2Q8I B;  1SFO B;  1Z9F A;  3K7U C;  1K3B C;  1GXD C;  3I8Z A;  4CBV A;  1EY0 A;  4AYB G;  3TP5 A;  2QEX A;  3K80 C;  5IP9 G;  1D5Z C;  1B9N A;  1YNN C;  2G9H D;  2ICE C;  2WP8 J;  1RHP A;  1HFG A;  4WJW A;  2CVR A;  3RUZ A;  2HDL A;  4H7B A;  5C6A A;  1IBK L;  2D62 A;  3FRP B;  1EQQ A;  4JK1 C;  1EY4 A;  1PTO D;  3PIP A;  3KOJ A;  2PNH A;  3GTM H;  2WB1 B;  1XTC D;  3CCJ A;  1G2S A;  4LF4 Q;  1AW7 A;  1G29 1;  2PMZ B;  3CC2 A;  3DM1 A;  5M5Y H;  4JYA Q;  5FLX E;  2B2V A;  5M5Y B;  2AWO A;  1B7Y B;  1I4P A;  1OXU A;  1HZB A;  4OO1 I;  5NUC A;  4QUF A;  2FHT A;  1Y1W H;  3BG3 A;  3GP7 A;  5FLX c;  2JE6 I;  4B3S L;  1Y1W B;  5BR8 L;  1I50 H;  2AKW B;  4X3T A;  5KRU A;  4GS3 A;  1N34 Q;  4JI8 L;  4ABN A;  1I50 B;  1B2T A;  1QOH A;  1ESF A;  1FGB D;  2IL8 A;  1RTN A;  5BN5 A;  1KIX A;  1VQ5 A;  3M4O H;  4XTC S;  1DOK A;  1H9S A;  5DM7 3;  4L6T B;  1WTQ A;  2F52 A;  2A8V A;  2IX0 A;  5GAH C;  4K6L A;  1F2L A;  1GUT A;  2MFI A;  5F2D A;  4LFA Q;  2RCF A;  2QKI C;  4G7Z C;  4K2K A;  5T1I A;  4YWK A;  3BYT B;  3KF6 A;  1VQP A;  1NJI C;  4ZQ3 A;  3I70 A;  3SHL A;  5IOD A;  1Q8K A;  2RDH A;  1GJX A;  2EOT A;  3ULL A;  1SYF A;  1SJE D;  1SNQ A;  2WAQ G;  1WFQ A;  4KD4 A;  1TXY A;  3J80 i;  3AQQ A;  3MXN B;  1SXT A;  3KBG A;  1VQB A;  1JOO A;  4KKT A;  4DU9 A;  4RGN A;  4FF3 A;  4JW0 A;  2G5D A;  3WOE A;  3VYT A;  1G8Z D;  5BN3 A;  3VYR A;  1TT2 A;  4RGO S;  2GN5 A;  4BBS H;  1TY2 A;  1ZYR C;  4BBS B;  4DAV A;  1JCK B;  2YTX A;  3H0G G;  4UAI A;  1EQR A;  4DFA A;  4WOR A;  3S24 A;  4PMC A;  2Q8T A;  1A15 A;  3ND8 A;  3I7F A;  1QZG A;  3E9I A;  1UNS A;  2NTS A;  3LX0 A;  1X3E A;  4DAY B;  3TEH B;  4JPB W;  4A3K H;  1KL9 A;  2F1M A;  3M7N A;  4A3K B;  2B2T A;  3V96 A;  3KDF A;  4HR7 B;  3WOF A;  1I94 L;  3R2I A;  4C1N I;  2ZXR A;  1N8R C;  5EPJ A;  5DNF A;  2R7Z H;  3DUZ A;  2EZV A;  2R7Z B;  2N88 A;  4C3H H;  2QDB A;  3CRL C;  2B8G A;  4ZKB B;  4C3H B;  3EQL C;  3RLF A;  1JJC B;  4BA1 I;  1VQI A;  3M9B A;  2UU9 L;  2KHJ A;  5IIF A;  3HKS A;  3KLW A;  1TVX A;  3D4R A;  4GLA C;  1X56 A;  3H6M A;  3HOU B;  4GKJ Q;  4MZ9 A;  1I4H A;  2LFN A;  3HOW G;  2R92 G;  3A55 A;  2IJ0 A;  1STY A;  2KQ3 A;  2NN6 I;  1IBM L;  3S1Q B;  2OEO A;  5AJ3 Q;  5CV9 A;  4XQJ A;  3NWT A;  2HT1 A;  2RCN A;  4PMB A;  2BE5 C;  3A8K E;  1BCP B;  2WII B;  3P7J A;  4GN3 B;  1GHJ A;  2F0L A;  1I4Q A;  1QVF A;  5G3L D;  4QCL A;  1VQO A;  1LTL A;  3G71 A;  4DK6 C;  4A3G H;  1UAP A;  1EY8 A;  1BF4 A;  5IYB G;  2DJG C;  2F0K A;  1QIL A;  4A3G B;  4X64 L;  4JI1 Q;  4DR5 Q;  5LMN L;  2E2I H;  4UPA A;  3F2U A;  2E2I B;  4OO1 H;  1IW7 D;  1H9J A;  4C3J G;  2PNR C;  4QJF A;  5IP7 G;  3M4P A;  3RLO A;  4DR3 Q;  1IYU A;  1LAC A;  1V8Q A;  1B4O A;  4JI3 Q;  4HJ9 A;  2N49 A;  1STH A;  4B3M L;  4UP7 A;  4Q5V A;  5DEH A;  5IT9 L;  5LL6 S;  4JI2 L;  2B8F A;  4DUY Q;  4C56 C;  4YCU A;  3H94 A;  4K0K L;  3GTQ H;  1YHA A;  1WYD A;  2D5D A;  2KA7 A;  4S3S A;  3GTQ B;  1C7Y A;  1CZW A;  3ICE A;  2WAQ E;  5DM6 3;  3T56 B;  2X6L A;  4Y7N H;  1EEF D;  3UE0 A;  3SK8 A;  2IX3 A;  4Y7N B;  1PRT F;  1M90 C;  5COY A;  3TP7 A;  4FF4 A;  1LT5 D;  4GZY C;  1JT8 A;  2AMC B;  1SRU A;  2GA4 B;  1JMC A;  5IGD A;  2HQE A;  1PTO H;  2MHV A;  3MXG A;  1BBX C;  2M00 A;  5J1Z A;  2V4D A;  4NXN L;  1HNX Q;  1EIH A;  1JOR A;  1SE3 A;  5IT9 E;  2E5L L;  1SND A;  3H3V C;  1U4R A;  4GNX A;  4UDU C;  3MWY W;  3NK9 A;  5IT9 c;  2AWN A;  1PZK D;  2NUC A;  5AFW A;  4X66 Q;  3MAQ A;  2RQX A;  1GVP A;  3I4O A;  2NVX H;  2HCI A;  2NVX B;  3A74 A;  3CMA A;  4IUV A;  3NTK A;  1ZXT A;  5JJI A;  5IWA Q;  1E2W A;  1LV9 A;  4GLV B;  1JE4 A;  2D9U A;  3EFX D;  1ONL A;  1B44 D;  2DY7 A;  5EBD A;  3ULP A;  1JE5 A;  4JI4 Q;  1SYG A;  2K03 A;  2KEE A;  2KBN A;  2RSO A;  5M5W H;  1L1O C;  1QZH A;  4LF5 L;  5M5W B;  2ASB A;  4X65 Q;  2F0E A;  1CA5 A;  4QY7 A;  1NTG A;  5CV7 A;  5EJW A;  4GN5 A;  2VQF L;  1XPR A;  3I56 A;  3K58 A;  2CH4 W;  1VS0 A;  2BDN A;  2LKV A;  4JV5 Q;  2B2V C;  2YV5 A;  5C3W A;  2WV6 D;  1WI5 A;  5D3I B;  2NVT H;  1L0W A;  1IYJ B;  2NZ1 D;  1VQA A;  1YIJ A;  2NVT B;  1LTR D;  4XYQ A;  4F88 A;  4KY6 A;  4LW1 A;  3ERO A;  1WJJ A;  4JC0 A;  5CR3 A;  3GTP H;  4IOA A;  2AUK A;  2RBM A;  3GTP B;  2PZT A;  1Y1V G;  4N8F A;  2PQE A;  1KAA A;  4OWT B;  1YNX A;  5IGG A;  2L0C A;  3F2C A;  1V43 A;  1HR0 W;  2K05 A;  2BA0 A;  3GTG B;  2R93 G;  2K7V A;  1DCZ A;  1STB A;  2CQO A;  3RNU A;  4KHP Q;  1LTS D;  3NQT A;  1C48 A;  4RFB A;  2H4O A;  2ZTC A;  1Z47 A;  4RAU C;  4JI5 L;  1W2B A;  1A3U A;  1Q82 C;  1MJE A;  3A8J E;  4G4K A;  2JQO A;  4A3B G;  3LNN A;  4RCN A;  2GVA A;  4A76 A;  1DD2 A;  4MHE A;  3OMG A;  4TKO B;  1EIG A;  2XGT A;  1VQH A;  2HHH L;  3OW2 A;  4L5S A;  2I07 B;  3MFY A;  2EJM A;  2EDG A;  1II3 A;  3OTO Q;  4O1N A;  1PZJ D;  5IP9 H;  4AYB B;  1EFW A;  2EVB A;  4RWS C;  4XDX A;  1HRJ A;  3KFU A;  2F3I A;  2NYZ D;  1FNV A;  1PTO C;  4DUZ Q;  5FO9 B;  3PO3 G;  4EGV A;  2DNE A;  1VQK A;  2GVB A;  1BCP F;  4DNR B;  5LMU Q;  2B2T C;  3UDF A;  2L11 A;  4H02 A;  1VQC A;  5HGQ A;  2F4V L;  1UEB A;  3CCM A;  4JI0 Q;  3T1Y L;  2O5J C;  1X54 A;  1QJO A;  3QG1 A;  3I4M H;  1JJG A;  4QIW E;  5L37 A;  2VZA A;  1SLJ A;  3E0J A;  4KY5 A;  3TP6 A;  2AUJ D;  3URY A;  1EY9 A;  1SNO A;  2QA4 A;  2D0O A;  3M4Y A;  1O78 A;  2JA5 G;  1MJC A;  5DLQ E;  3A56 A;  4IPC A;  1JB3 A;  4R4Q A;  2MO1 A;  3PSI A;  3JAM L;  3H15 A;  2SNM A;  2H1E A;  3JC6 6;  4M1U B;  1EQT A;  3Q8D A;  3HZX A;  2HUG A;  3CCQ A;  1CK1 A;  4BS9 A;  3GD7 A;  1E1O A;  5C4J H;  4JI4 L;  4PMW A;  3OIQ A;  5C4J B;  2F0M A;  3W1B A;  1XMO Q;  1P8L A;  2UXD L;  2DY8 A;  2N78 A;  4C2M H;  5C0X I;  4C2M B;  5JEA G;  4LFC L;  3OIP A;  1D1I A;  2QCP X;  2WAQ B;  1FR3 A;  1EOT A;  4APV A;  1KRS A;  1ENC A;  4YHH L;  4OGQ C;  1HCZ A;  1XNR L;  3DHQ A;  4XQQ A;  1J6Q A;  4DV5 L;  4LF6 L;  3DWP A;  2DNC A;  4LMQ D;  2EYL A;  3K6O A;  1F2M A;  4ILW A;  1BNZ A;  1LTG D;  4BY7 G;  2L15 A;  5DAU A;  2LXJ A;  1AZP A;  5H1S E;  3PV0 A;  2LY7 A;  3JAM c;  1V1P A;  1VQ4 A;  4X6A H;  1F9R A;  2A6E C;  3H0G H;  1K28 A;  2EXD A;  3H0G B;  3I4N G;  4N9P A;  4UY8 C;  4AIM A;  3U4V A;  1FJG Q;  1QUQ A;  1OO9 B;  3SXH A;  3MFG A;  5A35 A;  1AN8 A;  4DAP A;  3HKZ G;  2RHS B;  1PV4 A;  4DV4 L;  4DR1 Q;  2F4I A;  1CI3 M;  1CZG A;  4JI7 L;  2OF1 A;  3QB3 A;  1PFB A;  2EYP A;  5ELB A;  2K5Q A;  1VF5 C;  4C3I H;  3X3M A;  1SE8 A;  3TZU A;  4C3I B;  1GM5 A;  4DR4 Q;  2UUC L;  5FO7 B;  3J7A 5;  1OXS C;  1B3A A;  3MEH A;  5J3B A;  3BS1 A;  1HQR D;  1KTK A;  1TS5 A;  1N33 L;  2PPB C;  1Y69 U;  4DV7 L;  1HA6 A;  4DR6 Q;  4BY1 G;  4XQN A;  4JBK A;  2R92 H;  5D65 A;  3CKI B;  4DV0 Q;  3HOW B;  2R92 B;  3S1N B;  1E3P A;  2HIV A;  2FFK B;  2Q8R E;  3J7A V;  2B2W A;  2UXC Q;  1B9M A;  1EIF A;  2LXK A;  3VR3 A;  1ROD A;  3N52 A;  3S2H B;  3VR4 A;  1MHW C;  4DV1 Q;  1PYW D;  1A2U A;  4B3R L;  1ESR A;  1LTT D;  3M4Q A;  1X9N A;  5JPM C;  2O5I C;  4POF A;  1O7I A;  1SNP A;  1I4G A;  3NEL A;  3PUW A;  3VR6 A;  5IYB H;  4RMF A;  1IL2 A;  1DON A;  2F0N A;  2MNA A;  2NWG A;  4PZ6 A;  2NVY H;  3OSO A;  1A3T A;  1IBL Q;  1I6V C;  2NVY B;  2CQA A;  4HIM A;  1HH2 P;  2ID0 A;  4C3J H;  1TY0 A;  1N36 L;  2OTL A;  3F2B A;  3NBI A;  1CHQ D;  4C3J B;  4OX9 Q;  4O2D A;  3L9A X;  4A93 G;  4ZUI A;  3E9H A;  1HZC A;  1J8I A;  4TQU S;  1VF7 A;  1UEA B;  3HOY G;  5LMN W;  2CKZ B;  3I3C A;  3P1H A;  1CQF A;  4HSV A;  3IL8 A;  2CWP A;  5HY6 A;  3MXN A;  5J39 A;  1B70 B;  3G7L A;  1RTO A;  1PH1 A;  4B9X A;  5C3X A;  2KEN A;  4BBR H;  2ZM6 Q;  4CJ0 B;  3F2D A;  4DR7 Q;  1VCI A;  1UE6 A;  1K3R A;  1RCV D;  4X3S A;  2VB3 X;  2DGY A;  3CD6 A;  2F0H A;  1LT3 D;  3J80 L;  1A6X A;  1KDC A;  1F2Y A;  3VYU A;  1HUM A;  1WTV A;  4GKK Q;  5IGE A;  2K5D A;  1Q12 A;  4DAY A;  4QIW B;  3NBH B;  2ZJR A;  2PW7 A;  1AH9 A;  1HQM C;  1R9T H;  3DWQ A;  1SFO H;  2OQK A;  4OHJ A;  4HJ8 A;  1R9T B;  3J81 L;  3Q0A A;  3QOJ A;  3PO2 H;  3HKZ E;  1WCM G;  4LUZ A;  3NTH A;  3PO2 B;  1JWS D;  1SYD A;  4OWW B;  3D8G A;  1BBU A;  3DWA A;  2Z6K A;  3EA6 A;  3KJO A;  1SR3 A;  1KC8 C;  1G6P A;  3J80 E;  4A3I G;  2CW0 C;  4XIG S;  1CSP A;  3BYY B;  4ALP A;  1KHI A;  3SVM A;  3H09 A;  3CCS A;  4IFD G;  3J80 c;  4RHS A;  4HMJ A;  1BR9 A;  1VQG A;  3A0J A;  2B29 A;  1XNQ Q;  3K5L A;  1IKM A;  3D4D A;  4NB3 A;  1B1Z A;  4FO2 A;  4A3E G;  2C35 B;  1SBB B;  1U4M A;  2JXM B;  5FLM H;  2R7D A;  3K59 A;  2D0P A;  3HFZ B;  4JBM A;  3J81 E;  5I2X A;  2C9O A;  1CTM A;  2CH4 A;  4DV2 L;  2Z0S A;  3T13 A;  3J81 c;  4AQY L;  4R9W A;  1IL8 A;  3TRE A;  2VQE L;  1PH7 A;  2K1B A;  2F0P A;  3ZJY C;  2K28 A;  1NCV A;  3PIO A;  1DOL A;  1V1O A;  4NXM Q;  5I2Y A;  1EFI D;  1CKO A;  1RJT A;  2Y0S G;  1SMY D;  3FVQ A;  2XTI A;  1IBL L;  1Y8O B;  3KF8 B;  2BH8 A;  3K5O A;  3MXU A;  2J0T D;  4MTN A;  3T1H Q;  4ODG A;  1LM0 A;  2BA1 A;  1JIC A;  1IYV A;  2A6H D;  3MC0 B;  1HZ9 A;  5EKL A;  1HFN A;  1X3P A;  3BDC A;  3RD4 A;  3SEB A;  4R4C A;  2DJF C;  4A3B B;  1YVC A;  5M3M G;  1H9M A;  5KNB A;  4JOI A;  1G2T A;  5FK9 C;  1KXL A;  3J81 i;  1AEX A;  1VQ9 A;  2Q2I A;  1VMP A;  4EX5 A;  1K83 H;  1HNZ L;  4TRD A;  2IHE A;  1K83 B;  2Q2T A;  1D5M C;  4HSP A;  3R3O A;  4ZYS A;  1HUN A;  3GTO H;  2JK8 A;  1CKN B;  3GTO B;  3KJP A;  2PI2 E;  3NP8 A;  3MVV A;  3PO3 B;  2K4K A;  4Y52 H;  1YI2 A;  2WAC A;  3Q22 A;  2IPK D;  2RA4 A;  1PH8 A;  1HTL D;  4IPG A;  2BDO A;  4DV6 L;  1C0A A;  1O7L A;  5CBA E;  1X3F A;  4OIK A;  4PG3 A;  2K33 A;  2VB2 X;  5EBC A;  4DF7 A;  4DNT B;  2JA5 H;  3CW2 C;  3FKI G;  3T4A C;  2JA5 B;  2EE1 A;  3PF4 A;  3HOU H;  1PRT C;  5I9O A;  4TSS A;  4NPS A;  3S1R H;  1HNW Q;  4AYB E;  1XYI A;  4R4I A;  1FGU A;  3S1R B;  1HTP A;  3IKJ A;  3S1Q H;  1WTP A;  3K0X A;  1NBW A;  2PW5 A;  2E75 C;  3Q6S A;  3QR8 A;  1E7Z A;  2B2W C;  2F3V A;  1STG A;  3TSS A;  5IE8 A;  5M5X H;  2I5L X;  4LF4 L;  4K2L A;  1WTH A;  5M5X B;  1G91 A;  4F8M A;  4RG1 A;  4JYA L;  5JEA H;  4K5X A;  2K5W A;  3P20 A;  3TZD A;  1FD7 D;  3U9S A;  2RSN A;  1Q86 C;  1YJ9 A;  5JEA J;  1YNJ D;  1L1O B;  4FYD A;  1K73 C;  1DOM A;  4KHV A;  2A5H A;  2JA7 G;  1K0R A;  3M85 A;  5EKK A;  1N34 L;  3VYS A;  3E6Z X;  4LK1 C;  2RDF A;  3EBE A;  5M3F H;  1XMQ Q;  2R61 A;  5M3F B;  5E4W C;  1MBY A;  2JA6 H;  1LUZ A;  4HJ5 A;  4I7A A;  4NXM L;  2JA6 B;  1HPC A;  1CFM A;  4U68 A;  4GOP A;  1S5E D;  4LFA L;  1FL0 A;  3TP8 A;  3UE1 A;  3I4N B;  3E0E A;  4P73 A;  2Y0S E;  2A19 A;  5D14 A;  3S9W A;  4R1J A;  4OXP A;  2KHI A;  5JVH 3;  5CV4 A;  2A69 C;  3STB C;  3HKZ B;  1N9W A;  2PQA B;  1BOS A;  1ILQ A;  4JCV E;  3HOV G;  3VR5 A;  4KI0 A;  1PFN A;  3T53 B;  1B3Q A;  3S1M B;  1SYE A;  1F2Z A;  2MUY A;  1TII D;  1Q1B A;  1TWF B;  1HHV A;  4MTK A; 
#chains in the Genus database with same CATH homology
 4RHR A;  4XT1 B;  1DJR D;  3S15 B;  1F9Q A;  1J9O A;  1U9R A;  2XWB B;  3PIP 3;  4M8A A;  5T1G A;  4BY1 B;  2G9D A;  3GO5 A;  1M4V A;  3GTL B;  3OPO A;  2A68 C;  4HN7 A;  4NDX A;  2R6G A;  5EPK A;  2EY1 A;  1CM9 A;  2ZT9 C;  4FXK C;  2ZXP A;  3K5M A;  4KMU C;  4DXF A;  5KGU A;  2A73 B;  4R8N A;  1SYB A;  4A93 B;  2EY2 A;  2F3W A;  1BCP C;  1YNN D;  5HUR A;  3U9O A;  4G7O C;  3SK4 A;  1EWH A;  1X3Q A;  1MSH A;  1CQV A;  3PMF A;  5TSS A;  1AP0 A;  3NTI A;  5C44 B;  1UUP A;  4EVO A;  4NW2 A;  3O13 A;  5JJZ A;  2SOB A;  3OW7 A;  2KCN A;  4O42 A;  3W3A A;  3MZ5 A;  5C4Z A;  1TS4 A;  2OXP A;  4X3U A;  5C4H A;  4A3D B;  2D2C C;  4XT3 B;  3L3O C;  1OXV A;  1WCM B;  2HDM A;  1LTB D;  3LWE A;  2B2U A;  3FPP A;  2JEB I;  4CKB A;  1CA6 A;  2K04 A;  1JC7 A;  3V2T A;  5K36 G;  1NUC A;  2JEA I;  2TMP A;  4IFD J;  1Z7T A;  2PO4 A;  2XWJ B;  3A54 A;  4XXE A;  1TR5 A;  2L9H A;  5JVG 3;  3QO2 A;  4A3E B;  1ZYR D;  2N55 A;  1SE4 A;  2EPB A;  3CRK C;  4EQN A;  1DYQ A;  1LT4 D;  2K01 A;  4FP5 D;  1KLG D;  4FXD A;  1SSO A;  1ICW A;  2F03 A;  1STA A;  1SYC A;  3D4W A;  4LAA A;  5IGB A;  3M3Y B;  1WD0 A;  1GUW A;  1PXU A;  2VNU D;  2C5C A;  2Y0S B;  2FMC A;  5KYI A;  4ID6 A;  1C4Q A;  3C46 A;  3PUX A;  5I6W A;  5A2Q L;  3IFD A;  5EPL A;  4PNY A;  5LL6 X;  1CT1 D;  2F0W A;  3BVG A;  4G7H C;  2VXW A;  2F0Q A;  1C8C A;  5M3M B;  1ET6 A;  3T51 B;  4NP5 A;  2ICI A;  3SK5 A;  1L0Y B;  5KIX A;  2ENB A;  1I4R A;  5A2Q E;  3HRZ C;  4OO1 G;  3NBH A;  2L5T A;  3VR2 A;  1I3Q B;  3FMC A;  2RDG A;  1GHK A;  4P2C B;  5M9O A;  3D3R A;  3IAY A;  1ML0 D;  4FF1 A;  1ENF A;  3QJY A;  2KED A;  3I91 A;  2EXZ A;  4J8Q A;  3ZYY X;  2EYH A;  3OHX C;  1T5E A;  2Z1C A;  3TBI B;  3FKI B;  5EKI A;  1Y8N B;  3AB9 A;  3NUC A;  3ERQ A;  3FDT A;  5I6Y A;  4CHT B;  4KTA A;  5ELD A;  3VA5 A;  1RD9 D;  2X6G A;  1YNJ C;  4N9T A;  4B08 A;  1T5X D;  3HS0 C;  1PMR A;  1EYA A;  3AMU A;  1SNM A;  1IW7 C;  2JA7 B;  4FXG C;  2BCO A;  1CHP D;  2JSO A;  2OT2 A;  2NTT A;  3ONA B;  1KDA A;  4IN3 A;  4IUT A;  5KYL A;  3KF8 A;  1F9P A;  3HP3 A;  1O7Z A;  1TWC B;  1Q1E A;  5JPN C;  4WRD A;  2XNA C;  4IUU A;  5JOB A;  4R8I A;  4CJ1 B;  2JYO A;  1LAB A;  3NWS A;  4Z9C B;  1ILP A;  1QNU A;  1TQO A;  1PLF A;  3HOV B;  5EGT A;  1TWG B;  3D6W A;  1JOQ A;  1L0X B;  1G6Z A;  3DEP A;  4DGZ A;  2MGS A;  3PUZ A;  5FKA C;  5CV5 A;  2NN6 G;  4NKL A;  3L7Z C;  1Q90 A;  3Q23 A;  4PV1 C;  2IX1 A;  1RDP D;  2E2J B;  3K5N A;  1STN A;  5C0X J;  1Z6H A;  4EQO A;  4IZ8 A;  4CKC A;  1GUN A;  4KN4 C;  1KNE A;  1WTO A;  2K6A A;  1ZKO A;  4KKU A;  3I4L A;  5ELF A;  2PZU A;  3A8I E;  4RGM A;  5I9P A;  4YIJ A;  5CC4 A;  2B2U C;  3GTK B;  5EQ0 A;  4ZUJ A;  2RVL A;  1NR2 A;  2L55 A;  4IUR A;  5LHY 1;  4IUQ A;  2IW3 A;  1EQV A;  1F9S A;  1E2V A;  3MHB A;  2NB0 A;  3GTJ B;  3KBX A;  3BVZ A;  1B53 A;  2F0F A;  1PRT B;  1IKL A;  1M8A A;  2F0J A;  1JOK A;  1FYC A;  2B63 B;  5HGT A;  3GTM B;  3NSW A;  5C5L A;  3KUP A;  1Y1V B;  4RKL A;  1H9K A;  1SEB D;  2R93 B;  4F7X A;  4ZLT F;  4KK7 A;  5FOB B;  3X3N A;  3QWN A;  2EY6 A;  2TSS A;  5E3F A;  2SNS A;  2XN9 C;  3M4O B;  2SEB D;  4EQP A;  2AQ3 B;  1TKW B;  4Q0F A;  3W2D A;  1BUV T;  2JP1 A;  3RZO B;  4OIJ A;  1TU2 B;  1D5X C;  4V0B A;  2KEC A;  1AZQ A;  3C1E A;  2B39 A;  1BO0 A;  3CQZ B;  3GV3 A;  2JA8 B;  4RKB A;  1E2Z A;  1EY7 A;  4QF4 A;  2XRQ D;  4HCS A;  1GUS A;  2XRS D;  1EWC A;  1PFM A;  2HCC A;  3EJI A;  1WTR A;  1U4L A;  5CBE E;  5K36 H;  4HED A;  3TDQ A;  3AU7 A;  3Q24 A;  4KJN A;  2QEJ C;  3KLS A;  3EVQ A;  3S16 B;  1WVL A;  2A6E D;  1EY5 A;  4BWG B;  2AQ2 B;  3WDN A;  1BXT A;  3OWE B;  2O2L D;  1LO5 D;  1W6J A;  1SAP A;  3KLR A;  3NXW A;  2MPM A;  3CU7 A;  2Z4H A;  3J7A F;  5IOC A;  4HMI A;  1QE6 A;  4E6I A;  4DK0 A;  4C3I G;  5CGK A;  4HTH A;  3RMH A;  3G6J B;  1IHZ A;  2F0I A;  1EL0 A;  1WTX A;  2PYK A;  2J4X A;  2L4N A;  3BDO A;  3S17 B;  1U4P A;  4I7Z C;  1A2T A;  1B50 A;  3IFT A;  2EYM A;  1JWM D;  3N6R A;  2Z8L A;  3C2P A;  4IQZ A;  4BA2 I;  2DN8 A;  4A3M B;  5ISR A;  3A7A B;  1D1K A;  4KY7 A;  4L8J A;  2QF7 A;  1F77 A;  3M7G A;  4HCE A;  4BY7 B;  5FO8 B;  4JBW A;  2WKC A;  1ZEQ X;  3NQI A;  3HOZ B;  1S5B D;  3R2T A;  2QIL A;  1VMC A;  1STE A;  5D3D A;  1H9S B;  1LTA D;  3MXP A;  4MIU A;  2NBF A;  1BQQ T;  5BN4 A;  1EYD A;  1DM0 B;  4IAL A;  3PUY A;  1ENA A;  2BOS A;  1QNK A;  5E1F A;  3BDL A;  1JR0 D;  2O4X A;  2F0S A;  4B9W A;  4IFD I;  5C5M A;  2IWH A;  1EEI D;  1EU3 A;  1AFP A;  4K8I A;  2XIW A;  1EU4 A;  2WIN B;  5KND A;  1FNW A;  4KJO A;  5E4X A;  4IUP A;  5C0X G;  3HOX B;  3C3L A;  1MI2 A;  3DXJ C;  2EJF C;  3TME A;  3SK6 A;  2KVM A;  4RA8 A;  2F0U A;  3BZD B;  2WKD A;  2KCC A;  3VA7 A;  1RKN A;  1PTO B;  2F0O A;  2F0V A;  3R93 A;  4IUN A;  3OWF A;  5K5P A;  4HAE A;  5CV6 A;  4ME5 A;  3PIO 3;  1QWY A;  2Z4I A;  4RH6 A;  1DZ1 A;  1FNU A;  1K8O A;  4ZAI A;  2R3Z A;  1A3V A;  5I4D A;  1TS3 A;  1O7Y A;  3SR1 A;  3HOY B;  1NSN S;  5CMD A;  4U67 3;  2CW0 D;  1Y8P B;  5CYU A;  3I90 A;  2F0G A;  3T16 A;  2B2Y A;  1PDQ A;  1D2B A;  1D6E C;  3I73 A;  3K7A B;  4ZKC B;  4WFN 3;  3CHB D;  2NN6 H;  2YU9 B;  4KV6 A;  3NE5 B;  2PZW A;  3MTS A;  1S4Z A;  1JWU D;  1K8M A;  3TN2 A;  2NVQ B;  1PZI D;  3C1F A;  3I72 A;  2E74 C;  1W6K A;  4H44 C;  4FVM A;  2CHB D;  2F0T A;  1MGS A;  2EY5 A;  1Q3L A;  1Q8I A;  4H0L C;  5KNC A;  4G57 A;  3A7L A;  1NAP A;  4A3I B;  4CGY B;  1GOZ A;  4IFD H;  3QOL A;  4RCO A;  4A3J B;  1TWH B;  1QB5 D;  2E76 C;  1EY6 A;  4DA2 A;  4QB4 A;  2ZXO A;  4J6H A;  3KLS X;  3K0Y A;  5ELC A;  1HXY D;  4F87 A;  2KOL A;  2XSC A;  1R4P B;  2I46 A;  3OMC A;  3MA2 B;  2PCF B;  1SMY C;  3FPU B;  3I4M B;  4C3H G;  2KJX A;  2EJG C;  3HGB A;  4KHZ A;  2A6H C;  5C3E B;  5IGF A;  1JQY D;  1QCB D;  3LWU A;  4ZK9 B;  3S2D B;  1TWA B;  5IGC A;  1PRT D;  3V05 A;  3K57 A;  2VUM B;  3SE0 A;  2IT1 A;  4XYO A;  5ELE A;  4K5V A;  4OL7 A;  3FEW X;  2LS0 1;  1XXG A;  2BE5 D;  3KK7 A;  4K14 A;  3H91 A;  3D6C A;  5KEE A;  3OOC A;  4MN3 A;  3UI2 A;  3DMU A;  1SJH D;  1EZ6 A;  3JAM E;  2E2H B;  5J22 A;  2E2D C;  4L63 B;  1PTO F;  1KDB A;  2SDF A;  4K8J A;  1GUO A;  1MD2 D;  1SE2 A;  1VDZ A;  2KUM A;  1ET9 A;  4K5W A;  4H13 C;  2J7Z A;  2FJ2 A;  4KD3 A;  3P75 A;  1QG7 A;  1R4Q B;  1KLU D;  1GUG A;  4PQX A;  2A69 D;  4A3F B;  2M9V A;  1LT6 D;  4DXG A;  2EYO A;  1X32 A;  2X69 A;  3E5S A;  1WD1 A;  2FMM A;  1XX8 A;  2M2L A;  2A74 C;  3GQB A;  4RGT A;  1XWE A;  1KAB A;  1RF2 D;  4V19 0;  2K32 A;  4KKS A;  4KN7 C;  4J1M A;  5CV8 A;  3DEO A;  1I4X A;  3HG9 A;  3ITP A;  2RKS A;  4ULL A;  1BDO A;  2XVS A;  1H9R A;  1OXX K;  2A68 D;  4DN4 M;  4CKE A;  1I6H B;  4QMG A;  1EZ8 A;  4NMZ A;  3RZD B;  1WTW A;  3QIA A;  4X3K A;  3HEJ A;  1MSG A;  2YYZ A;  3D31 A;  4ZRZ A;  3PUV A;  4LJZ C;  1SDF A;  1NR4 A;  1LTI D;  4I65 A;  2AQ1 B;  4FNF A;  2B2Y C;  2L12 A;  1DXM A;  4QUC A;  3GV6 A;  1EYC A;  2MP1 A;  3SDZ A;  1BCP D;  3NPP A;  1LLR D;  1E0B A;  1HA5 A;  3BVM A;  3NHH A;  4BBR B;  2MJ8 A;  1S5D D;  5COR A;  2L1B A;  4C1N K;  1OXT A;  5C0X H;  2KHS A;  1KNA A;  1V1P B;  3S14 B;  3R8B A;  2LMC B;  2EYJ A;  1SNC A;  2F0D A;  1S5C D;  2FIN B;  3ND9 A;  5JAV A;  1S5F D;  1O80 A;  2EYF A;  3J7Y W;  1TS2 A;  5G3L F;  5C4X B;  4DK1 A;  4FF2 A;  4K6D A;  4CJ2 C;  5FLX L;  2Q8I B;  1SFO B;  1GXD C;  3I8Z A;  4CBV A;  1EY0 A;  3TP5 A;  1D5Z C;  1B9N A;  1YNN C;  2G9H D;  2ICE C;  2WP8 J;  1RHP A;  1HFG A;  4WJW A;  2CVR A;  3RUZ A;  2HDL A;  4H7B A;  5C6A A;  2D62 A;  3FRP B;  4JK1 C;  1EY4 A;  1PTO D;  2WB1 B;  1XTC D;  1G2S A;  1AW7 A;  1G29 1;  2PMZ B;  3DM1 A;  5FLX E;  2B2V A;  5M5Y B;  2AWO A;  1I4P A;  1OXU A;  4OO1 I;  5NUC A;  4QUF A;  2FHT A;  3BG3 A;  3GP7 A;  2JE6 I;  1Y1W B;  4X3T A;  5KRU A;  4ABN A;  1I50 B;  1B2T A;  1QOH A;  1ESF A;  1FGB D;  5BN5 A;  1RTN A;  2IL8 A;  4XTC S;  1DOK A;  1H9S A;  5DM7 3;  4L6T B;  1WTQ A;  2IX0 A;  4K6L A;  1F2L A;  1GUT A;  5F2D A;  4G7Z C;  2QKI C;  4K2K A;  5T1I A;  3BYT B;  4ZQ3 A;  3I70 A;  3SHL A;  5IOD A;  2RDH A;  1GJX A;  2EOT A;  1SYF A;  1SJE D;  1SNQ A;  4KD4 A;  1SXT A;  3KBG A;  4KKT A;  1JOO A;  4DU9 A;  4RGN A;  4FF3 A;  3WOE A;  3VYT A;  1G8Z D;  5BN3 A;  3VYR A;  1TT2 A;  4RGO S;  1TY2 A;  1ZYR C;  4BBS B;  4DAV A;  1JCK B;  4UAI A;  4DFA A;  4WOR A;  4PMC A;  2Q8T A;  1A15 A;  3ND8 A;  1UNS A;  2NTS A;  3LX0 A;  2F1M A;  3M7N A;  4A3K B;  2B2T A;  3V96 A;  4HR7 B;  3WOF A;  3R2I A;  4C1N I;  2ZXR A;  5EPJ A;  5DNF A;  3DUZ A;  2EZV A;  2R7Z B;  2N88 A;  2QDB A;  3CRL C;  2B8G A;  4ZKB B;  4C3H B;  3EQL C;  3RLF A;  4BA1 I;  5IIF A;  1TVX A;  3D4R A;  3HOU B;  3H6M A;  1I4H A;  2LFN A;  3A55 A;  2IJ0 A;  1STY A;  2KQ3 A;  2NN6 I;  3S1Q B;  2OEO A;  5CV9 A;  4XQJ A;  3NWT A;  4PMB A;  2BE5 C;  3A8K E;  1BCP B;  2WII B;  3P7J A;  1GHJ A;  2F0L A;  1I4Q A;  5G3L D;  4QCL A;  1UAP A;  1EY8 A;  1BF4 A;  2F0K A;  1QIL A;  4A3G B;  3F2U A;  2E2I B;  4OO1 H;  1IW7 D;  1H9J A;  4C3J G;  2PNR C;  1IYU A;  1LAC A;  1V8Q A;  1B4O A;  1STH A;  4Q5V A;  5DEH A;  5IT9 L;  5LL6 S;  2B8F A;  4C56 C;  3H94 A;  2D5D A;  2KA7 A;  4S3S A;  3GTQ B;  1CZW A;  5DM6 3;  3T56 B;  2X6L A;  1EEF D;  3SK8 A;  2IX3 A;  4Y7N B;  1PRT F;  5COY A;  3TP7 A;  4FF4 A;  1LT5 D;  4GZY C;  2GA4 B;  5IGD A;  2HQE A;  1PTO H;  2MHV A;  3MXG A;  1BBX C;  2M00 A;  5J1Z A;  2V4D A;  1JOR A;  1EIH A;  1SE3 A;  5IT9 E;  1SND A;  3H3V C;  1U4R A;  4UDU C;  3MWY W;  3NK9 A;  2AWN A;  1PZK D;  2NUC A;  5AFW A;  3MAQ A;  2RQX A;  2HCI A;  2NVX B;  4IUV A;  3NTK A;  1ZXT A;  1E2W A;  1LV9 A;  1JE4 A;  2D9U A;  3EFX D;  1ONL A;  1B44 D;  2DY7 A;  5EBD A;  1SYG A;  2K03 A;  2KEE A;  2RSO A;  5M5W B;  1CA5 A;  2F0E A;  5CV7 A;  5EJW A;  3K58 A;  2LKV A;  2BDN A;  2B2V C;  5C3W A;  2WV6 D;  5D3I B;  2NZ1 D;  2NVT B;  1LTR D;  4XYQ A;  4F88 A;  4KY6 A;  3ERO A;  5CR3 A;  2AUK A;  2RBM A;  3GTP B;  2PZT A;  2PQE A;  1KAA A;  5IGG A;  2L0C A;  1V43 A;  2K05 A;  2BA0 A;  3GTG B;  2K7V A;  1DCZ A;  1STB A;  1LTS D;  3NQT A;  1C48 A;  4RFB A;  2H4O A;  1Z47 A;  4RAU C;  1A3U A;  3A8J E;  4G4K A;  3LNN A;  4RCN A;  1DD2 A;  4MHE A;  3OMG A;  4TKO B;  1EIG A;  2I07 B;  3MFY A;  2EJM A;  2EDG A;  1II3 A;  4O1N A;  1PZJ D;  4AYB B;  2EVB A;  4RWS C;  4XDX A;  1HRJ A;  2NYZ D;  1FNV A;  1PTO C;  5FO9 B;  4EGV A;  2DNE A;  1BCP F;  4DNR B;  2B2T C;  2L11 A;  2O5J C;  1QJO A;  3QG1 A;  3E0J A;  4KY5 A;  3TP6 A;  2AUJ D;  3URY A;  1EY9 A;  1SNO A;  3M4Y A;  1O78 A;  3A56 A;  1JB3 A;  3JAM L;  2SNM A;  2H1E A;  4M1U B;  1EQT A;  3HZX A;  2HUG A;  1CK1 A;  4BS9 A;  3GD7 A;  4PMW A;  3OIQ A;  5C4J B;  2F0M A;  2DY8 A;  5C0X I;  4C2M B;  5JEA G;  3OIP A;  1D1I A;  2QCP X;  2WAQ B;  1FR3 A;  1EOT A;  1ENC A;  4OGQ C;  1HCZ A;  3DHQ A;  4XQQ A;  3DWP A;  2DNC A;  4LMQ D;  2EYL A;  3K6O A;  1F2M A;  4ILW A;  1BNZ A;  1LTG D;  5DAU A;  1AZP A;  3PV0 A;  2LY7 A;  1V1P A;  1F9R A;  2A6E C;  3H0G B;  4N9P A;  1OO9 B;  3SXH A;  3MFG A;  5A35 A;  1AN8 A;  4DAP A;  2F4I A;  1CI3 M;  1CZG A;  2OF1 A;  3QB3 A;  1PFB A;  2EYP A;  5ELB A;  2K5Q A;  1VF5 C;  3X3M A;  3TZU A;  4C3I B;  5FO7 B;  1OXS C;  1B3A A;  3MEH A;  3BS1 A;  1HQR D;  1KTK A;  1TS5 A;  2PPB C;  1Y69 U;  1HA6 A;  4XQN A;  5D65 A;  3CKI B;  3HOW B;  2R92 B;  3S1N B;  2FFK B;  2Q8R E;  3J7A V;  2B2W A;  1B9M A;  3VR3 A;  1ROD A;  3N52 A;  3S2H B;  3VR4 A;  1PYW D;  1A2U A;  1ESR A;  1LTT D;  5JPM C;  2O5I C;  1SNP A;  1I4G A;  3PUW A;  3VR6 A;  1DON A;  2F0N A;  2NWG A;  3OSO A;  1A3T A;  1I6V C;  2NVY B;  2CQA A;  2ID0 A;  1TY0 A;  3NBI A;  1CHQ D;  4C3J B;  3L9A X;  4ZUI A;  1J8I A;  4TQU S;  1VF7 A;  1UEA B;  3I3C A;  3P1H A;  1CQF A;  4HSV A;  3IL8 A;  3MXN A;  5J39 A;  3G7L A;  1RTO A;  4B9X A;  5C3X A;  4CJ0 B;  1VCI A;  1RCV D;  4X3S A;  2VB3 X;  2F0H A;  1LT3 D;  3J80 L;  1A6X A;  1KDC A;  1F2Y A;  3VYU A;  1HUM A;  1WTV A;  5IGE A;  2K5D A;  1Q12 A;  4DAY A;  4QIW B;  2PW7 A;  1HQM C;  3DWQ A;  4OHJ A;  1R9T B;  3J81 L;  3Q0A A;  3QOJ A;  3NTH A;  3PO2 B;  1JWS D;  1SYD A;  3D8G A;  3DWA A;  3EA6 A;  3J80 E;  2CW0 C;  4XIG S;  3BYY B;  3SVM A;  3H09 A;  4IFD G;  4RHS A;  4HMJ A;  1BR9 A;  1IKM A;  3K5L A;  3D4D A;  1B1Z A;  4FO2 A;  3K59 A;  1SBB B;  1U4M A;  2JXM B;  3J81 E;  5I2X A;  2C9O A;  1CTM A;  3T13 A;  4R9W A;  1IL8 A;  2K1B A;  2F0P A;  2K28 A;  1NCV A;  1DOL A;  1V1O A;  5I2Y A;  1EFI D;  1RJT A;  1SMY D;  3FVQ A;  1Y8O B;  3K5O A;  3MXU A;  2J0T D;  4ODG A;  2BA1 A;  1JIC A;  1IYV A;  2A6H D;  3MC0 B;  5EKL A;  1HFN A;  1X3P A;  3BDC A;  3RD4 A;  3SEB A;  4A3B B;  1H9M A;  5KNB A;  1G2T A;  5FK9 C;  1AEX A;  1VMP A;  4TRD A;  1K83 B;  1D5M C;  4HSP A;  3R3O A;  4ZYS A;  1HUN A;  3GTO B;  3NP8 A;  3MVV A;  3PO3 B;  2WAC A;  3Q22 A;  2IPK D;  2RA4 A;  1HTL D;  2BDO A;  1O7L A;  5CBA E;  4OIK A;  2K33 A;  2VB2 X;  5EBC A;  4DF7 A;  4DNT B;  3T4A C;  2JA5 B;  2EE1 A;  1PRT C;  5I9O A;  4TSS A;  1XYI A;  3S1R B;  1HTP A;  3IKJ A;  1WTP A;  2PW5 A;  2E75 C;  3Q6S A;  2B2W C;  2F3V A;  1STG A;  3TSS A;  4K2L A;  1G91 A;  5M5X B;  4F8M A;  5JEA H;  4K5X A;  2K5W A;  3P20 A;  3TZD A;  1FD7 D;  3U9S A;  2RSN A;  5JEA J;  1YNJ D;  4FYD A;  1DOM A;  4KHV A;  2A5H A;  3M85 A;  5EKK A;  3VYS A;  3E6Z X;  4LK1 C;  2RDF A;  2R61 A;  5M3F B;  5E4W C;  1MBY A;  2JA6 B;  1HPC A;  1CFM A;  4U68 A;  1S5E D;  3TP8 A;  3I4N B;  5D14 A;  3S9W A;  5JVH 3;  5CV4 A;  2A69 C;  3HKZ B;  1BOS A;  1ILQ A;  3VR5 A;  4KI0 A;  1PFN A;  3T53 B;  3S1M B;  1SYE A;  1F2Z A;  2MUY A;  1TII D;  1Q1B A;  1TWF B;  1HHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...