1SNPA

Protein stability in staphylococcal nuclease
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Coupling between trans/cis proline isomerization and protein stability in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
total genus 36
structure length 130
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1996-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1snpA00
2F0IA 4KHVA 3NHHA 4K8JA 4NKLA 3C1EA 5EKKA 5IGGA 4K5XA 2F0OA 5J22A 5CV5A 1SNDA 2EYHA 5IGDA 2F3VA 4PMBA 1EY8A 4N9PA 5IIFA 2PW5A 1TT2A 1NSNS 4HMIA 4ZUIA 2PW7A 2PZUA 1TQOA 2F0JA 4ODGA 5C4ZA 5K5PA 4MIUA 4EQPA 5IODA 3S9WA 5C3XA 2F3WA 5E3FA 3SK8A 4KY6A 2RKSA 3DHQA 3QB3A 3SK5A 1A2UA 2OEOA 4KD4A 3HEJA 2EY6A 2O4XA 1STAA 4KJNA 3V2TA 5I9PA 1A3VA 2ENBA 2F0NA 5I9OA 5JAVA 1JOQA 3MEHA 5JOBA 4S3SA 3ERQA 5HGTA 1II3A 1SYCA 1RKNA 2OXPA 3DMUA 3HZXA 3NQTA 1KAAA 3OWFA 1EZ8A 3MZ5A 5CV9A 4RKLA 5DEHA 3SXHA 5IGCA 5IOCA 1EQVA 3NXWA 4KTAA 4NMZA 2SNMA 2M00A 3D4DA 4PNYA 3EJIA 5J1ZA 4EQNA 5KGUA 4B9WA 3OSOA 4KV6A 3D4WA 4QB4A 1EYAA 5I6YA 5C6AA 2KQ3A 4J1MA 5CV7A 2EYLA 1F2YA 2F0VA 4YIJA 1EY6A 5EKLA 3SK6A 1SNCA 1STGA 1EY5A 4F8MA 1EY9A 2EYPA 4TRDA 3SHLA 2F0UA 5KIXA 4QMGA 1JOOA 2F0GA 2EYOA 1SNQA 5NUCA 4KJOA 2PZTA 1TR5A 2OF1A 4IZ8A 4KY5A 4DF7A 3P75A 1KDBA 3NP8A 3BDCA 1KDCA 4IUNA 5C3WA 2F0SA 5I6WA 1A3TA 1SYDA 2F0TA 3MXPA 5DAUA 2F0MA 4ZQ3A 2RDFA 4HMJA 1SNOA 4K2LA 1U9RA 2EXZA 4ZUJA 2EY1A 2PQEA 3BDLA 4NDXA 3VA5A 2EY5A 3E5SA 5C4HA 5M9OA 5IGFA 5J39A 1STHA 2F0KA 4J6HA 3T16A 1JOKA 1SYEA 4K6DA 3RUZA 5CGKA 5KEEA 5C5MA 3R3OA 2EYJA 4EVOA 5HURA 2PZWA 3EVQA 4B9XA 5EGTA 3TMEA 1A3UA 4IALA 1NUCA 5ISRA 4ME5A 1EY7A 2PYKA 4F7XA 5KRUA 1JORA 5C5LA 3NUCA 3ITPA 4HTHA 4DGZA 3U9OA 4I65A 5F2DA 4N9TA 3TP6A 1F2MA 1STBA 2SOBA 1EY0A 3H6MA 4K8IA 4E6IA 2EYFA 3C1FA 4LAAA 2F0DA 1KDAA 3T13A 3P1HA 4NP5A 5CR3A 2NUCA 3TP5A 3NK9A 1EYCA 1SYGA 2HQEA 3QOJA 3OMGA 4WRDA 5CV6A 2RBMA 1ENAA 4K14A 4DU9A 4KD3A 3SR1A 3LX0A 1F2ZA 3D8GA 3SK4A 1SNMA 1IHZA 1SYFA 2F0EA 2KHSA 4K2KA 1ENCA 4OL7A 1EY4A 5E1FA 2F0WA 3QOLA 5CC4A 5CV4A 1EYDA 1EZ6A 1AEXA 1SYBA 4K5WA 4EQOA 3EROA 3TP8A 1STYA 5CV8A 2EYMA 1A2TA 3TP7A 5IGEA 5IGBA 2SNSA 4H7BA 1KABA 1STNA 5KYIA 2WACA 2F0LA 3OMCA 4PMCA 3D6CA 3PMFA 2F0FA 2QDBA 2EY2A 4G57A 4DFAA 2F0PA 4WORA 4RKBA 3MVVA 3MHBA 4R8NA 5KYLA 2LKVA 4QF4A 4KY7A 1SNPA 2F0QA 4ID6A 2F0HA 4K5VA
chains in the Genus database with same CATH superfamily
3BZKA 4AIMA 5EKKA 3KJPA 4AQYL 1LT5D 2QDLA 4DR4L 3UDIA 4BBRB 4JBMA 1GHKA 2Y0SE 4C3IH 1S40A 4C56C 3I90A 4DV5Q 1X56A 4LF6L 1PH1A 5FO8B 3ICEA 2NVXH 3OYYA 3K5NA 3GTGH 1CI3M 3MA2B 4PNYA 1H95A 3V96A 3H0GH 3PUYA 1EQRA 3LGJA 3GV3A 4PV1C 1N9WA 3WWVA 4KKSA 4ZAIA 2LS01 5EKLA 2P5ZX 1Q86C 4FYDA 4GOPA 1SXTA 1N34L 3R93A 2DY8A 2ALYB 4ABNA 1HCZA 1HFGA 1YJWA 1SE3A 1D6EC 2D62A 4YCUA 3IFDA 1GUSA 2BE5C 3R2IA 1CKMA 3RLFA 3MAQA 2N3SA 2K1BA 3E0EA 4XXEA 2RA4A 1L0WA 1STHA 3D4RA 4A3MH 3KBGA 4LF4L 1BBWA 1MKHA 1IBML 3GTJB 1HNWL 2K4KA 4A3FH 3GD7A 4LWCA 3VYUA 4JI2L 5C0XJ 2AKWB 4N9TA 1F2MA 4DK6C 1KL9A 2PNHA 1XNQQ 3FMCA 3L9AX 5LHY1 1EYGA 4KHPQ 3M9BA 3BZCA 2D0OA 4JI7Q 3M3YB 1VF7A 3TZUA 4R1JA 1SR3A 4HAEA 2NZHA 2E2IH 2KCMA 3RLOA 3DM1A 2Q2HA 1C4QA 1ENCA 1I5FA 3PUZA 1EY4A 1X65A 1K8OA 1T5XD 3K7UC 2L15A 1AEXA 4EQOA 4X64L 5IGEA 2HHHQ 2YU9H 1TWFH 3F2CA 4JC0A 4PMCA 4JPBW 2RVLA 5GADC 2F0PA 3IKJA 3NWTA 3MHBA 1SN8A 3IAYA 5LMNW 1B44D 3HOYG 4DAVA 3C1EA 3UDFA 4C1NI 4K5XA 5J22A 4LF9Q 1SNDA 2AQ2B 1LTID 2F3VA 4HMIA 1GO3E 2H5XA 4DNTB 1IBKL 1Y1VG 3FRPB 1N36Q 2UU9Q 1YITA 3KLRA 3DWQA 3L2PA 4DR3L 4A3GH 3W5OA 4OXPA 1KTKA 4YWMA 5D65A 2OT2A 1SE8A 5M9OA 2KENA 2BA1A 4A75A 3D4DA 2JA5G 3EJIA 1FGBD 5LL6S 5C6AA 2QKIC 2WB1G 1EY5A 4LFAQ 1RJTA 1E0BA 3RZOH 5C3EH 5LMUL 3KOJA 3EA6A 4NXNL 3D6WA 1BCPF 4A3BG 2BA0A 2EXDA 1KDBA 1O7LA 1YZ6A 2JEBI 4BBSG 1WTWA 2AHOB 4AYBE 1V1QA 2B63G 4DAMA 1N32Q 5J39A 2SDFA 5FO7B 2K5VA 2K5DA 1Q90A 1Q8KA 4B9XA 4FO2A 2F03A 3S15H 2EZVA 4IALA 1TWGB 4CJ0B 3H3VH 1C9OA 5C4JB 5I2YA 1IYVA 2EJMA 4Y7NH 2K7VA 1VQFA 1AP0A 1DCZA 2WAQG 1WCMH 4RMFA 4EGVA 1R9TB 1PZJD 2SOBA 1Q82C 3T1HL 4HJAA 3P1HA 2I5LX 1AE3A 3QWNA 1MBYA 3EIVA 3CCUA 3RZDB 2DGYA 4L8JA 2D0PA 4K2KA 3T1YQ 2ZT9C 3I72A 4OL7A 4H0LC 1L0YB 3GTMH 3BJUA 5CV4A 3S1RH 1BO0A 2JA9A 3CRLC 3EROA 1O7YA 2PQAA 1L1OC 3GTKB 3SEBA 3GTQH 1IKMA 4CKEA 3F2UA 4KN7C 4KY7A 1P8LA 3M4QA 3PIPA 3MWYW 5M3MH 4NXML 4IOAA 4C3HH 1MJCA 4K8JA 4KHVA 4NKLA 1Y1WH 1OO9B 2D2CC 1HR0Q 1V1PB 5ELCA 3IL8A 1WI5A 5IGDA 5IIFA 5C4ZA 3AFQA 3CP0A 4TKOB 5IT9L 2KHIA 4RA8A 1Y1VB 5M5XH 4DV1Q 1Y14B 2A6HC 2EY6A 2NVYB 1JOQA 2E2HB 1B3AA 4RGMA 4DXGA 5JPMC 1II3A 3GTPB 2JA7H 3KFUA 3SE0A 4PMWA 5AJ3Q 5J1ZA 2CQAA 1IYJB 3CRKC 2HIXA 1EYAA 1UEAB 4EX5A 4G7HC 2FFKB 1VQOA 2WB1B 4G7ZC 1I4HA 2UXDQ 1VQMA 1OXSC 2OQKA 3RNUA 4KY5A 2YV5A 4TQUS 2OQ0A 1UEBA 3J81L 3CQZH 3L0OA 1RTNA 1I50B 2IT1A 1SFOB 2F0SA 2Z4IA 4BBSB 1HUNA 4IPHA 3T53B 1VQGA 4IN3A 3BDLA 1SEBD 3CMEA 4DV3Q 3MTSA 4HJ5A 4O0AA 1TWHB 3A8KE 4RCOA 3T16A 4JBKA 1HFNA 1J9OA 2Y0SG 4DV7Q 3A5ZB 5IP9G 4DK0A 4ZKCB 4A4IA 2B8GA 2VQEQ 4A3EH 1HNZQ 4IPCA 4L5RC 1MSHA 5DNFA 2R7ZH 2ZM6Q 5M5YH 1K73C 4A3IB 1N33L 4RHSA 2LFNA 3L7ZC 3TP6A 2WAQB 2RSOA 2TMPA 4FP5D 2VB3X 4L5SA 1EU4A 2VUMB 4KLKA 3SGIA 1TWAB 3E9IA 4P71A 2NN6G 1PZKD 2AQ1B 5AFWA 2G5DA 3SK4A 1RD9D 2KHSA 3C46A 1BQQT 4I7ZC 3SDZA 4GN5A 1HXYD 4OO1I 1A2TA 1CHQD 1VQKA 2HIVA 1BKBA 2Z6KC 4IFDH 2WP8J 2NVQB 4OO1H 5JEAH 2H1EA 4RKBA 1LTAD 5IY0A 3PSIA 3BZDB 1SDFA 2K03A 4GLVB 2Z1CA 2C9OA 1F9PA 4LF7L 3SVMA 4OELB 4LF8Q 4DR5L 1EL0A 4DV4L 1X9NA 1RIPA 2XNAC 4BY1H 2KA7A 4C3IG 3KYHC 4X62L 2FJ2A 2FMMA 3TREA 5J3BA 3PO3G 1HZCA 3J80i 4DA2A 4X6AH 1E1TA 1JE4A 3QB3A 5LL6X 3HEJA 3CCRA 4Q0FA 1PFNA 2A69C 2J7ZA 5HGTA 1YNJC 3GTOB 3CCJA 4FF4A 1NCVA 4EQ5A 4A3LH 2MUYA 4V190 2PI2A 4EQNA 1UNSA 4QB4A 2ZTEA 2CWPA 4DNIA 5I6YA 2LXKA 4MNOA 3KUPA 4B3RQ 3HOYH 4NB3A 1PH6A 4B3MQ 2WFWA 3HOWH 1BVSA 1PDQA 2CHBD 3GDEA 2VQFQ 3K7AH 3S1MH 5NUCA 3J7AV 3CHBD 1LV9A 2FINB 5T1GA 4LUVA 1PRTC 2A68C 2R7DA 1SYDA 5BR8L 2K32A 5JJZA 1NY4A 1VQCA 1KRTA 1HR0W 3RD4A 5JJLA 1SNOA 3VA5A 3Q24A 1STEA 3Q23A 2B39A 4A3MG 3NBHB 4OHJA 3I55A 1YIJA 2JA5H 1YEZA 3KF6B 4DR6L 4A3JH 4I7AA 2Y0SB 2AQ3B 1YNND 4A3FG 5JVH3 3UDXA 2K5QA 1A0IA 1D5XC 1H9KA 2KECA 5A2QE 4IUUA 1ET6A 4DV2L 3STBC 5C44B 3U9OA 5F2DA 2SEBD 4QQBX 1B50A 1WYDA 5IYCH 1ILPA 1I4GA 5M5WB 2V4DA 2Q2UA 2MJ8A 4JOIA 1PTOF 4DUZL 3TDQA 3U9SA 3S17H 3EFXD 1VQIA 2DN8A 1I3QB 3HKZE 3U4VA 3CC2A 5CC4A 1JMCA 1SYBA 4TSSA 5H1SE 4AYBG 5IGBA 2N49A 3AU7A 2F0LA 3OMCA 1HA5A 2ZXOA 4X65Q 2F1MA 1W6JA 3MVVA 1QB5D 2L5TA 3TS0A 1K8AC 1JWSD 3VYRA 4C1NK 4GZYC 2UUCQ 1HUMA 1ML0D 2A8VA 5CV5A 2JK8A 1GM5A 3ZYYX 2F4VL 4X62Q 1KC8C 4C3IB 1HJPA 3X3NA 1EWHA 4A3GG 2K14A 3I4MH 2M2LA 1SMYC 1LLRD 4IUQA 1JR0D 5GROA 2X69A 3GTGB 2LSSA 3H0GB 4CJ2C 1KAWA 4GKKQ 1MIUA 4N8FA 4A3KG 5CV7A 5C3EG 2EYLA 1F2YA 1SNCA 1S5CD 4DV6L 1JCKB 2JA6H 4C2MH 4A3CH 3NENA 1PHJA 5KIXA 1PLFA 5DM73 2OCEA 2NTSA 1EIFA 1U4MA 4QL5A 1HQRD 2LXJA 4RGTA 3K8AA 2HT1A 1SBBB 5FLXE 1YNXA 2CW0D 4JYAL 1F9QA 1NAPA 3FPUB 3TZDA 4A3MB 1JWMD 5JVG3 4V0BA 2EDGA 1G51A 2VZAA 1TIID 2UXBL 4HEDA 4A3FB 1BOSA 1MD2D 1BXTA 4UP9A 2R92H 5A35A 2PYKA 1RCVD 3AFPA 4DV2Q 1WCMG 1I6VC 1YHBA 5G3LD 1G291 4K8IA 4HJ7A 3CCSA 4A3DG 1EEFD 2ZJRA 4Q5VA 4JI6L 2E2IB 3CU7A 1WD1A 2I5MX 2RBMA 4K14A 3H3VC 1F2ZA 2Z6BA 1IW7D 2HDMA 1E7ZA 3HOZB 4IOCA 1LTSD 2F0WA 3OW2A 1X55A 1TWFB 1ICWA 4H7BA 4AYBB 1D2BA 2KCCA 3D6CA 5KNBA 3PMFA 3DEPA 5M3MG 1I6HH 2CFMA 4C3HG 1JE5A 3I4OA 1Y1WG 4JI8L 1F9SA 1H9SA 5IP7H 2KCNA 1B9NA 2EOTA 2RQXA 4FF3A 1TWCH 3W1GA 2PW5A 4DUYL 1G91A 4ZYSA 1B4OA 2F0JA 2R93H 2NN6H 4MIUA 1LO5D 1HRJA 1HPCA 1MJEA 3MC0B 4N8X1 2JSOA 1O80A 1PH4A 5C0XI 5I2XA 1VMPA 2L0CA 2JA7G 1QNUA 1X3EA 5IYBH 1VQNA 5EGTA 5C0XH 3S16H 2CQOA 1PH7A 3A0JA 1XPUA 1X3FA 3KF8A 1DJRD 2Z4HA 1Q12A 4LUOA 1J6QA 3PF4A 1VQ4A 4B3SQ 2ZTDA 1N8RC 1XJVA 1JOOA 2KUMA 3PO3H 1R4QB 4IUNA 4R4CA 4DR1Q 1E1OA 1I4QA 2DNCA 1YJ9A 2JN4A 4LFCQ 3HOXB 4KK7A 4K2LA 2IY5B 2IL8A 5IGFA 5EAYA 1PYSB 2WIIB 4K6DA 4DAPA 1QG7A 4EVOA 4A3EG 3S15B 1JB3A 2O5JC 2N8NA 1CQFA 1Q46A 1JB7A 2OTLA 1PZID 4ZLTF 4OX9L 2R7ZG 4JI5Q 2IX3A 4GLXA 4ME5A 3NTKA 2AWOA 1K3BC 5KRUA 4Y7NB 1WTRA 1PH8A 1WCMB 3MXNA 1PFSA 2B29A 2PMZE 2UUAL 2JA8B 4GKJQ 1A62A 1ET9A 1XNRQ 3QOJA 1BCPD 3PO2H 3D31A 1SJED 3A8IE 4GNXC 4K0KL 2XTIA 3CXCA 1B1ZA 3HOUH 3GTMB 4DV0L 3S1RB 3CAMA 2FXQA 4K5WA 3S1QH 1S5DD 1AZQA 4IFDG 4G4KA 2UXCQ 1XTDA 5JEAG 3S2DH 4OO1G 1CTMA 1UAPA 1D7QA 4JBJA 1B9MA 1VQEA 3A7LA 3H09A 4RFBA 2BOSA 1OXXK 2IHFA 3OW7A 3ULJA 4BY1G 3S2HH 1QJOA 3G71A 2RHQB 4N9PA 1XMOL 5ELDA 2GVBA 4XDXA 5M5XB 3KK7A 1SJHD 5C3XA 2L1BA 4R4IA 3NWSA 1U0LA 4FF2A 4MTKA 3V2TA 2IJ0A 5JOBA 4A3LG 3L3OC 2OXPA 3DMUA 3U50C 5EJWA 2E5LL 4RKLA 4X3TA 3FP9A 2R6GA 2B3GA 2RCNA 1AE2A 3F2DA 1O78A 2Q2IA 2B8FA 5HY6A 2NWGA 3HKZG 3UI2A 4AQYQ 3HOWG 1PVOA 3HP3A 4DR4Q 4TRDA 2JYOA 1FL0A 1SNQA 2PZTA 1K83H 3CQZB 4X66L 5CORA 2BE5D 1VQHA 3VDYA 4QGUA 2VS1A 4LF6Q 4U68A 1KDCA 1ZYRD 1V43A 1YJNA 2B2TC 1FNWA 1LUZA 1U9RA 2YTXA 1HA6A 5C4HA 1K0RA 2N88A 4JI4L 2F0KA 1CKOA 1QUQB 4A3JG 2LY7A 5C5MA 1QE6A 1D8LA 1OXVA 3HOVH 4O2DA 4ME3A 4A3KH 4PG3A 4GNXB 1I94L 1N34Q 1S5BD 1EY7A 5M5YB 1TKWB 1GUNA 5ELFA 4M1UB 3ITPA 5IYCG 1T5EA 2JJQA 4I65A 4JI0L 4ZRZA 1RL2A 3DWAA 1D1KA 2F0DA 4BA1I 1KDAA 2X6LA 4AH6A 3A74A 2NUCA 3QJYA 3M4OH 3Q6SA 1B70B 4XT3B 2JE6I 4K0KQ 4XYOA 4LF4Q 1KNAA 1UWVA 5I6WA 4FNFA 1IBMQ 1EYDA 3CPWA 1CQVA 5CV8A 1HNWQ 3CPFA 2HQLA 4YWKA 1CKNB 1E22A 4IURA 4JI2Q 2A73B 4WJWA 3WDNA 1XTCD 3PUVA 2L12A 2ICEC 4A3DH 2E75C 1E2VA 4BY1B 1VQ5A 2F0OA 1GUOA 2MQHA 3DLLA 4O42A 2B2VA 4GN4B 4KKTA 2XGTA 4ODGA 4FDBA 3I4MG 1XPRA 5IODA 1AW7A 2NZ1D 4KY6A 2N78A 1QZHA 4X64Q 2NVTH 3A55A 2R3ZA 4S3SA 3GV6A 1WD0A 3H15A 2BH8A 1KAAA 2XRQD 1GHJA 3OPOA 5E4XA 2B2WC 1EQVA 3B6YA 3NELA 4B9WA 1G2TA 1C0AA 2B2UC 2JA6G 4WJ4A 4A3CG 3HOYB 2K52A 3HKZB 3DM3A 2BDNA 2CH4A 3M4YA 4F8MA 4NW2A 2QILA 3K7AB 3S1MB 1PXUA 1IBLL 4QMGA 4OIKA 3GTJH 1IBKQ 2WKCA 1BUVT 4X66Q 1TS2A 4DR3Q 4POGA 1MGSA 2K50A 1VQLA 1UE1A 1OXUA 3TSSA 3OOCA 4ZUJA 3DWPA 5FOBB 2EY5A 2J4XA 2Q2TA 4J6HA 3CD6A 2JA5B 1VCIA 2RF4A 2R92G 4OWWB 1VQ6A 3I70A 5LMUQ 1CT1D 2VL6A 1GOZA 5EPLA 4NXNQ 5I4DA 2IPKD 4DR2L 4A3BB 1X54A 3DUZA 3KDFB 3QIAA 2UUBL 3T13A 3URYA 2B63B 3OMGA 3TEHB 4DU9A 1CA5A 3S17B 3KLSA 3PUXA 1BBUA 3S14B 5IYDH 4HN7A 5EBDA 1J5EL 1VQJA 2EE1A 3ULPA 3TP8A 5FLMH 1OTCA 2B2YC 2VXWA 3M7GA 5ELOA 5IP7G 2GA4B 1L1OB 3T1HQ 1UE5A 3IRBA 1ASYA 1CSQA 2IW3A 1LACA 2R93G 1XWEA 1KD1C 1K9MC 1FJGL 3F2BA 5K5PA 3GQBA 3S9WA 5IT9E 3PIO3 2K05A 2VB2X 4L6TB 3SK5A 5IYBG 4DR7L 3JAML 4K6LA 3RLNA 1STAA 5C0XG 4HIMA 4B3TL 1A3VA 4FXKC 1PTOD 4BA2I 3ERQA 4OGQC 3J80c 1QVFA 5CV9A 4JW0A 5IGCA 1YVCA 4KTAA 4CDCC 1Z6HA 3J80E 4NXMQ 4UAIA 4KV6A 3D4WA 1DGSA 1DONA 2JA6B 1BBXC 4J15A 4GLAC 3RMHA 1NMFA 3T4AC 4FXDA 3JC66 2TSSA 1YNNC 1C8CA 2IHEA 4DAYB 3P75A 3T51B 3K59A 5M3FG 3NEMA 4F87A 3MXGA 3W1BA 2F0TA 1R9TH 2I46A 2HCIA 1E3PA 3K58A 2Z8LA 3V05A 3FEWX 4JV5L 1XPOA 3VR3A 1F77A 3RZDH 3J81i 2I5HA 3VA7A 2R92B 4GOPC 2KBNA 4YY3L 4CGYB 5FKAC 3NTIA 1AZPA 1QNKA 1LTBD 1QWYA 5C5LA 1Y8NB 5COYA 1WJJA 1O7IA 1X3QA 3LWUA 1I4PA 2UUBQ 3PO2G 2RSNA 2ID0A 3S1NH 3HOUG 2F3IA 3BVZA 4KD3A 3G4SA 2E2JH 1X32A 3PV0A 2PI2E 3FDTA 2XSCA 3QOLA 1EZ6A 2F52A 3FKIH 4YCWA 4ALPA 1SE4A 3J7AF 4IPDA 3S24A 4LFBL 1A63A 1HZAA 3A56A 1SAPA 2A6EC 1N33Q 1A8VA 3E9HA 2KVMA 1I4RA 5GQOA 1V1PA 2F0QA 3QO2A 4M8AA 2RCFA 3GTLH 2Q8IB 5EPKA 3OTOL 4WFN3 1PH3A 1TWCB 4UPAA 4QUFA 3G6EA 3JAMi 2JEAI 1WTVA 1EY8A 3R8BA 2OTJA 1TT2A 4BWGB 3ND9A 1B53A 2FMCA 1BNZA 3K6OA 4RG1A 1FGUA 1ENFA 5EQ0A 3K57A 3MFGA 2OWOA 1DYQA 5JEAJ 4XQNA 4X3SA 3KBXA 3S16B 3I3CA 1SYCA 4LAAA 3HZXA 4FF1A 1F2LA 5IWAL 3PIP3 4IJHA 2JP1A 2SNMA 2ATWA 1WFQA 4CDDC 2CW0C 5C4XH 5DM63 5LMNL 4LF7Q 1EY6A 3SK6A 4DR5Q 3J7A5 1S4ZA 2L11A 4DV4Q 1EY9A 1HNXL 2CH4W 3OHXC 4DPGA 1HTLD 4JCVE 3PO3B 4P75A 4IZ8A 4GOPB 4YCVA 1H9JA 1B7YB 1LT6D 1IL2A 4A3IH 4JG2A 4JI3L 2NVXB 4YHHL 1VQDA 1EIGA 2PQEA 1Z9FA 3VR5A 1PRTB 3HOVG 2VUMH 3E6ZX 2WV6D 3ULLA 1TWAH 5CBAE 2ZXPA 2NTTA 5KEEA 1VS0A 1IW7C 1D1IA 3RN2A 4ZKBB 3BYYB 1A3UA 3FPPA 2K33A 4UDUC 4MHEA 2N55A 1XMQL 4DGZA 1Y8OB 2H4OA 4JVZA 5FLXc 3H6MA 2EVBA 2EYFA 3C1FA 3EN2A 3RR5A 5BR8Q 1WTHA 4J8QA 3PO2B 2BH2A 4RHRA 3TN2A 2HUGA 2QA4A 1WTXA 1PH5A 1ILQA 1PTOH 1MI2A 1KLUD 1IHZA 4DR6Q 4CHTB 3S1QB 1CSPA 4DV5L 1LT4D 1SSOA 1UE6A 2CKZB 3S2DB 1YBYA 4RWSC 2VW9A 1RODA 1STNA 1DM0B 1QVGA 3H91A 3K5MA 1EIHA 1XXGA 3S2HB 2E8GA 1DOMA 4K5VA 2F0IA 3NHHA 4PZ7A 1C48A 4CKCA 4KHZA 4PZ6A 1TS4A 2VNUD 1EU3A 4DUZQ 2PZUA 3CC4A 1CHPD 3D0FA 1U4RA 3C3LA 1A15A 3QR8A 1TU2B 2A5HA 2RKSA 4CJ1B 1X3GA 2OEOA 4KD4A 2YU9B 1Y8PB 5I9PA 2O2LD 4ZCKA 3AQQA 3HKSA 3PQIA 1FNVA 5K36H 2QW7A 3FVQA 3NQTA 1LTRD 4IUVA 3I56A 2RHSB 2I07B 4BY7H 4P74A 1UUPA 4JI1L 2K28A 1PRTF 2KQ3A 1AH9A 4A93H 4X3KA 1S5FD 3K80C 3SHLA 2F4VQ 1G8ZD 1VQAA 1K83B 2NYZD 5E7NA 3E3XA 4A3GB 2DJGC 1ZXTA 2LMCB 1Y69U 4QY7A 2XN9C 4UY8C 3NBHA 1XNQL 3Q8DA 1JQYD 4KHPL 1KNEA 1PYWD 1LTLA 1QVCA 1LTGD 4CBVA 3BVMA 3KF6A 4R4TA 5FJ8G 1ESFA 1ZKOA 4IUPA 1ICFB 4LUZA 5CGKA 1BCPC 2EYJA 1KRSA 4A3KB 3RZOB 5C3EB 2PZWA 3EVQA 4OWXB 4DV6Q 1I3QH 4RAUC 2NZOA 4FXGC 4OIJA 4R9WA 4RCNA 2MPMA 4XYQA 1DXMA 2PNRC 5ISRA 2HHHL 2PO4A 1U4LA 2CVRA 3NUCA 1PH2A 1QZGA 4HTHA 2Z6KA 1BF4A 2E74C 1S72A 5BN4A 1L0XB 1S5ED 1EY0A 3BG3A 5M3FH 1OXTA 3M4OB 5CR3A 3TP5A 1HQMC 2JXMB 4JYAQ 4JK1C 4LF9L 4IJLA 1M1KC 1ENAA 5IYDG 4U673 3I91A 5E4WC 3UE1A 4DK3C 4QIWE 4HSVA 5FLMG 1N36L 4MN3A 1PYBA 1RF2D 3CW2C 3M85A 2UU9L 2PPBC 2UXBQ 2K04A 4RH6A 2V1CC 3K0YA 2BDOA 2WACA 1H9RA 3CCEA 3BS1A 4LK1C 2EY2A 2PQAB 4WORA 5KYLA 5CMDA 5EKIA 3RN5A 2IX1A 1SNPA 2AUKA 1VF5C 4ID6A 2QEXA 4A3DB 2XVSA 3U58A 1GKHA 2DY7A 4JI6Q 5G3LF 2EYHA 4LFAL 2G9DA 1NSNS 3PCOB 1JICA 4OWTB 3SK8A 5BN5A 3DXJC 4HCSA 2NVTB 1VQ7A 1K8MA 3AYHB 4HIDA 2F0NA 5JAVA 4ULLA 3GTQB 2AMCB 3CCQA 4XIGS 1CA6A 1ZYRC 3OWFA 5DEHA 5KYIA 1N32L 5M3MB 4C3HB 1K3RA 4JI8Q 5BN3A 1Y1WB 2KHJA 5KGUA 3E0JA 4OEMB 1KXLA 3OSOA 4JI1Q 2F0VA 4KKUA 1JJGA 4G7OC 3VR6A 2YTYA 2EIFA 4DUYQ 1PFMA 1BCPB 1IKLA 2L9HA 1QCBD 5D3IB 4XQJA 1YI2A 3NP8A 2JA7B 3HGBA 2IWHA 4HMJA 1B2TA 3I4NH 2Z0SA 1NMGA 1JJ2A 3CC7A 3E5SA 4UP7A 1ESRA 1JOKA 1SYEA 3PGZA 3J7YW 3T1YL 1EWCA 1FD7D 1PA6A 3HOZH 1GUTA 1ZEQX 2AUJD 3PIOA 1NUCA 1Q3LA 1TVXA 4F7XA 3CCLA 2KCTA 1Q1BA 2E76C 4PZ8A 1IYUA 3K5LA 2ZJPA 4H44C 1Q7YC 1STBA 3K0XA 1WTPA 1U4PA 5EPJA 4C3JH 1Z47A 4TVAB 2K5HA 3M7NA 1LM0A 1HR0L 1V1OA 3IFTA 1GUGA 3SR1A 3I2ZA 2F0EA 1SYFA 3K5OA 3FKIG 5E1FA 4DV1L 4A3EB 1S3OA 1B8AA 2D9UA 4OX9Q 2R7ZB 1E2WA 3TP7A 1NBWA 3H94A 1CZGA 4PQXA 5JJIA 2QDBA 5AJ3L 4R8NA 4QF4A 1K28A 2UUAQ 2ASBA 1GD7A 5JPNC 5KNCA 2AWNA 4CDEC 4JOIC 4HIKA 1XX8A 1VQPA 2PCFB 3NSWA 4PMBA 2UXDL 1CZWA 4LMQD 4EQPA 1VMCA 3O13A 3BU2A 4DV0Q 2M9VA 4BBRH 1LTTD 1W3SA 5ELBA 3ZJYC 1EFID 4CKBA 3HS0C 1EZ8A 3R2TA 2FHTA 3NXWA 3HOXH 4DV3L 5C4XG 2M00A 1D5ZC 2XWBB 2HCCA 1SE2A 1VDZA 1NTGA 4DV7L 4J1MA 3H3VI 2EYPA 3G7LA 1XMOQ 1M4VA 2G9HD 1HNZL 2VQEL 3W3AA 1A6XA 4L5QA 2EYOA 1M8AA 4KJOA 3T56B 2ZM6L 4WJ3M 1IXRA 1ONLA 4L63B 4A3IG 4HJ9A 5GAGC 1PFBA 1YHQA 2RDHA 3I7FA 2F0MA 3TS2A 2X6GA 2JA8H 2VUMG 1CUKA 1LT3D 2EXZA 3N6RA 2E5LQ 1CFMA 5L37A 2HD3A 2MO0A 3G48A 1F9RA 3HOWB 4ILWA 1CK1A 1G6ZA 3TMEA 3X3MA 1JC7A 1LYLA 5T1IA 1H9MA 1IL8A 3GO5A 2K5NA 5DLQE 2YTVA 5IE8A 1EQTA 5EBCA 1DOLA 1HZ9A 5ELEA 3VR4A 3AEVA 4NP5A 3S1NB 4POFA 1KLGD 4LF8L 4LNQA 4WRDA 2HDLA 2EPBA 2XWJB 5CV6A 4JI4Q 3M3YH 2E2JB 3LX0A 4A3JB 5FJ8H 1G2SA 3D3RA 4DXFA 3FKIB 2K01A 4YWLA 1NJIC 1YHAA 3ERSX 1I94Q 2CCZA 2EYMA 2Q8TA 4BXXH 2C5CA 3CMAA 2XIWA 1FVIA 1DOKA 2MO1A 2SNSA 1KABA 1C7YA 3OIPA 1PTOC 2F0FA 4G57A 4DFAA 1GVPA 4JI0Q 3J80L 5CYUA 2O5IC 3NBIA 4P73A 3GTLB 2QCPX 4KI0A 3A8JE 3W2DA 4GS3A 1DD2A 4H13C 3LNNA 3UE0A 4B3RL 2CWAA 4DN4M 1MHWC 4B3ML 4ZUIA 3CKIB 3GP7A 2R7FA 2VQFL 5E3FA 4KN4C 1HTPA 4GN3B 1QILA 4LF5L 3TRZA 1AFPA 3DHQA 3TBIB 1A2UA 5K36G 5I9OA 1SROA 1TS5A 2EJFC 4BY7G 1MSGA 1J8IA 3P20A 1PV4A 5IOCA 4MTNA 5C4XB 4A93G 1EOTA 1FYCA 4YIJA 2MNAA 3A54A 1JT8A 5IT9c 3F8TA 1RTOA 3I4LA 1O7ZA 1RDPD 2QEJC 3I4MB 2KEEA 2A6HD 5C44G 2OF1A 3ONAB 5C3WA 4Z9CB 5DAUA 4LW1A 1QUQA 2RDFA 1SRUA 3J81j 1G6PA 5CBEE 1T9HA 2DUDA 4KMUC 3KLWA 2IX0A 2NBFA 5TSSA 4XQQA 2RDGA 3RUZA 1P16A 4GNXA 3R3OA 2BCOA 4C2MB 1U5KA 1BR9A 5A2QL 2A1AA 1M90C 4IFDI 1IBLQ 3U4ZA 3J81c 1TWGH 5C4JH 4X65L 2QGQA 3J81E 2WKDA 2UUCL 1PTOB 2F4IA 3AB9A 3NK9A 1SLJA 4OONA 1TXYA 2MGSA 2L55A 3A7AB 1Q1EA 1CKNA 1Q8IA 1WOCA 3VR2A 1EQQA 1KIXA 3GTKH 4DR2Q 3H0GG 4DK1A 2KEDA 1I4XA 1LABA 3C2PA 4IO9A 1PH9A 4GKKL 4MZ9A 4DNRB 1PMRA 3QG1A 1VQ9A 1H9SB 3BYTB 2EJGC 2PW7A 1IZ6A 1TQOA 1K8GA 2F3WA 3JAMc 1J5EQ 1RHPA 3WOEA 4LF5Q 1Y1VH 2ENBA 4IQZA 2NVYH 3JAME 1AN8A 3PUWA 2E2HH 1I6HB 1RKNA 2JQOA 3SXHA 2B2TA 1Z7TA 3MZ5A 4BY7B 5D3DA 1FR3A 3GTPH 1TY0A 1W6KA 3NQIA 2KOLA 4A93B 4QIWB 1UE7A 3KF8B 1STGA 3Q0AA 1FJGQ 1EWIA 4A76A 2R93B 1KHIA 3MFYA 4B08A 4H02A 2F0UA 3CF5A 1JJCB 2GN5A 1FNUA 4DKAC 2F0GA 3CCVA 1HHVA 2DJFC 1TR5A 4IFDJ 4DF7A 1NR2A 4DR7Q 4XT1B 5FO9B 2PMZB 2A69D 2L4NA 3BDCA 1YNJD 3CCMA 4B3TQ 1EEID 4A3BH 1QOHA 3I4NG 3MXPA 1I50H 1SFOH 5FLXL 4BBSH 3DEOA 3OIQA 3G6JB 1VQBA 2B63H 5JJKA 2Q8RE 1NE3A 2D5DA 2WINB 3AMUA 1E2ZA 1TWHH 5HURA 3HOZG 4FVMA 3S14H 2NB0A 1EIYB 4APVA 1GXDC 3HRZC 2ZXRA 3ER0A 1JWUD 1NR4A 3EQLC 1JORA 3KDFA 4RGOS 1EUJA 1PRTD 2A68D 4C3JG 1HH2P 2MHVA 4RGNA 4BS9A 5M3FB 4E6IA 5D14A 1TS3A 1E24A 3MXNB 2EQSA 1V9PA 4ZK9B 2HQEA 4L5TA 1GJXA 2QF7A 4JV5Q 1GUWA 2R61A 3UDGA 4X3UA 3D8GA 2GVAA 2MP1A 4HIOA 2KJXA 3MXUA 2ICIA 1TY2A 2J0TD 2WB1E 4IUTA 4YY3Q 3STBD 3HG9A 1STYA 3M4PA 4HJ8A 2A6ED 1L1OA 4UP8A 3I73A 2I0QA 2NVQH 1CM9A 2LKVA 1HZBA 2B2WA 5KNDA 1D5MC 3Q22A 4QCLA 2F0HA 5IGGA 3ND8A 2B2UA 3VYSA 4B3SL 3HOUB 4HSPA 4BBRG 3BVGA 5GAEC 1K0SA 4HR7B 4LJZC 1X6OA 2VY3A 1DZ1A 1V8QA 1EOVA 4KJNA 2E2DC 2O4XA 4LFBQ 4DR1L 3MEHA 4LFCL 1B3QA 3NPPA 3HOXG 2Z9HA 3A5UA 1WVLA 3GTOH 4NMZA 1NNXA 2WAQE 4HCEA 4R8IA 3K81C 3OTOQ 2K75A 4P2CB 1Q81C 2B2VC 3F1ZA 3VYTA 4DAYA 4JI5L 2ZTCA 5GAHC 4QUCA 2K6AA 3HFZB 1BDOA 1SMYD 5FK9C 2JA8G 4NPSA 1A3TA 4GKJL 3I4NB 4ZQ3A 4IPGA 5IWAQ 3P7JA 1XNRL 2EY1A 4NDXA 1L2FA 4CDFC 3N52A 5LMNQ 4P72A 3KLSX 2DNEA 3TQYA 3BDOA 1HNXQ 5IP9H 3KJOA 4O1NA 2ZJQA 4QJFA 2YYZA 2UXCL 2B2YA 1X3PA 4F88A 1R4PB 3MEFA 4Y52H 5C44H 4C3JB 3PF5A 3I8ZA 2A74C 3WOFA 4JI3Q 5HGQA 4XTCS 2K5WA 4YHHQ 1XYIA 4JI7L 1VQ8A 1WTOA 1EYCA 1SYGA 2NN6I 2ES2A 5M5WH 3OWEB 3EBEA 3HOVB 3NTHA 1SNMA 2A19A 3J7ZC 3LWEA 4R4QA 1EFWA 5ELNA 2XRSD 4BXXG 1W2BA 1WTQA 1KQSA 1SMXA 4JBWA 4UHVA 1XMQQ 3NE5B 2MFIA 2C35B 1ASZA 3FHWA 4R4OA
chains in the Genus database with same CATH topology
5EKKA 1LT5D 4BBRB 1GHKA 4C56C 3I90A 5FO8B 3K5NA 1CI3M 3MA2B 4PNYA 3V96A 3PUYA 4PV1C 3GV3A 4KKSA 4ZAIA 2LS01 5EKLA 4FYDA 1SXTA 3R93A 2DY8A 4ABNA 1HCZA 1HFGA 1SE3A 1D6EC 2D62A 3IFDA 1GUSA 2BE5C 3R2IA 3RLFA 3MAQA 2K1BA 4XXEA 2RA4A 1STHA 3D4RA 3KBGA 3GTJB 3GD7A 3VYUA 5C0XJ 4N9TA 1F2MA 3FMCA 3L9AX 5LHY1 3M3YB 1VF7A 3TZUA 4HAEA 3DM1A 1C4QA 1ENCA 3PUZA 1EY4A 1K8OA 1T5XD 1AEXA 4EQOA 5IGEA 4PMCA 2RVLA 2F0PA 3IKJA 3NWTA 3MHBA 3IAYA 1B44D 4DAVA 3C1EA 4C1NI 4K5XA 5J22A 1SNDA 2AQ2B 1LTID 2F3VA 4HMIA 4DNTB 3FRPB 3KLRA 3DWQA 1KTKA 5D65A 2OT2A 5M9OA 2BA1A 3D4DA 3EJIA 1FGBD 5LL6S 5C6AA 2QKIC 1EY5A 1RJTA 1E0BA 3EA6A 3D6WA 1BCPF 2BA0A 1KDBA 1O7LA 2JEBI 1WTWA 5J39A 2SDFA 5FO7B 2K5DA 1Q90A 4B9XA 4FO2A 2F03A 2EZVA 4IALA 1TWGB 4CJ0B 5C4JB 5I2YA 1IYVA 2EJMA 1AP0A 2K7VA 1DCZA 1R9TB 4EGVA 1PZJD 2SOBA 3P1HA 3QWNA 1MBYA 3RZDB 4L8JA 4K2KA 2ZT9C 3I72A 4OL7A 4H0LC 1L0YB 5CV4A 1BO0A 3CRLC 3EROA 1O7YA 3GTKB 3SEBA 1IKMA 4CKEA 3F2UA 4KN7C 4KY7A 3MWYW 4KHVA 4K8JA 4NKLA 1OO9B 2D2CC 1V1PB 5ELCA 3IL8A 5IGDA 5IIFA 5C4ZA 5IT9L 4TKOB 4RA8A 1Y1VB 2A6HC 2EY6A 2NVYB 1JOQA 2E2HB 1B3AA 4RGMA 4DXGA 5JPMC 1II3A 3GTPB 3SE0A 4PMWA 5J1ZA 2CQAA 3CRKC 1EYAA 1UEAB 4G7HC 2FFKB 2WB1B 4G7ZC 1I4HA 1OXSC 4KY5A 4TQUS 3J81L 1RTNA 1I50B 2IT1A 1SFOB 2F0SA 2Z4IA 4BBSB 1HUNA 3T53B 4IN3A 3BDLA 1SEBD 3MTSA 3T16A 1TWHB 3A8KE 4RCOA 1HFNA 1J9OA 4DK0A 4ZKCB 2B8GA 1MSHA 5DNFA 4A3IB 4RHSA 2LFNA 3TP6A 3L7ZC 2WAQB 2RSOA 2TMPA 4FP5D 2VB3X 1EU4A 2VUMB 1TWAB 2NN6G 1PZKD 2AQ1B 5AFWA 3SK4A 1RD9D 2KHSA 3C46A 1BQQT 4I7ZC 3SDZA 1HXYD 4OO1I 1A2TA 1CHQD 4IFDH 2WP8J 2NVQB 4OO1H 5JEAH 2H1EA 4RKBA 1LTAD 3BZDB 1SDFA 2K03A 2Z1CA 2C9OA 1F9PA 3SVMA 1EL0A 2XNAC 4C3IG 2KA7A 2FJ2A 2FMMA 4DA2A 1JE4A 3QB3A 5LL6X 3HEJA 4Q0FA 1PFNA 2A69C 2J7ZA 5HGTA 1YNJC 3GTOB 4FF4A 1NCVA 2MUYA 4V190 4EQNA 1UNSA 4QB4A 5I6YA 3KUPA 1PDQA 2CHBD 5NUCA 3J7AV 3CHBD 1LV9A 2FINB 5T1GA 1PRTC 2A68C 1SYDA 2K32A 5JJZA 3RD4A 1SNOA 3VA5A 3Q24A 1STEA 3Q23A 2B39A 4OHJA 2Y0SB 2AQ3B 1YNND 5JVH3 2K5QA 1H9KA 1D5XC 2KECA 5A2QE 4IUUA 1ET6A 5C44B 3U9OA 5F2DA 2SEBD 1B50A 1ILPA 1I4GA 5M5WB 2V4DA 2MJ8A 1PTOF 3TDQA 3U9SA 3EFXD 2DN8A 1I3QB 5CC4A 1SYBA 4TSSA 5IGBA 3AU7A 2F0LA 3OMCA 1HA5A 2ZXOA 2F1MA 1W6JA 3MVVA 1QB5D 2L5TA 1JWSD 4C1NK 3VYRA 4GZYC 1HUMA 1ML0D 5CV5A 3ZYYX 4C3IB 3X3NA 1EWHA 2M2LA 1SMYC 1LLRD 4IUQA 1JR0D 2X69A 3GTGB 3H0GB 4CJ2C 5CV7A 2EYLA 1F2YA 1SNCA 1S5CD 1JCKB 5KIXA 1PLFA 5DM73 2NTSA 1U4MA 1HQRD 4RGTA 1SBBB 5FLXE 2CW0D 1F9QA 1NAPA 3FPUB 3TZDA 4A3MB 1JWMD 5JVG3 4V0BA 2EDGA 1TIID 4HEDA 4A3FB 1BOSA 1BXTA 1MD2D 5A35A 2PYKA 1RCVD 1I6VC 5G3LD 1G291 4K8IA 1EEFD 4Q5VA 2E2IB 3CU7A 1WD1A 2RBMA 4K14A 3H3VC 1F2ZA 1IW7D 2HDMA 3HOZB 1LTSD 2F0WA 1TWFB 1ICWA 4H7BA 4AYBB 1D2BA 2KCCA 3D6CA 5KNBA 3PMFA 3DEPA 4C3HG 1F9SA 1H9SA 2KCNA 1B9NA 2EOTA 2RQXA 4FF3A 2PW5A 1G91A 4ZYSA 1B4OA 2F0JA 2NN6H 4MIUA 1LO5D 1HRJA 1HPCA 3MC0B 2JSOA 1O80A 5C0XI 5I2XA 1VMPA 2L0CA 1QNUA 5EGTA 5C0XH 3KF8A 1DJRD 2Z4HA 1Q12A 1JOOA 2KUMA 1R4QB 4IUNA 2DNCA 1I4QA 3HOXB 4KK7A 4K2LA 2IL8A 5IGFA 2WIIB 4K6DA 4DAPA 1QG7A 4EVOA 3S15B 1JB3A 2O5JC 1CQFA 1PZID 4ZLTF 2IX3A 4ME5A 3NTKA 2AWOA 5KRUA 4Y7NB 1WTRA 1WCMB 3MXNA 2JA8B 1ET9A 3QOJA 1BCPD 3D31A 1SJED 3A8IE 1B1ZA 3GTMB 3S1RB 4K5WA 1S5DD 1AZQA 4IFDG 4G4KA 4OO1G 5JEAG 1CTMA 1UAPA 1B9MA 3H09A 3A7LA 4RFBA 2BOSA 1OXXK 3OW7A 1QJOA 4N9PA 5ELDA 4XDXA 5M5XB 3KK7A 1SJHD 5C3XA 2L1BA 3NWSA 4FF2A 3V2TA 2IJ0A 5JOBA 3L3OC 2OXPA 3DMUA 5EJWA 4RKLA 4X3TA 2R6GA 1O78A 2B8FA 2NWGA 3UI2A 3HP3A 4TRDA 2JYOA 1SNQA 2PZTA 3CQZB 5CORA 2BE5D 4U68A 1KDCA 1ZYRD 1V43A 2B2TC 1FNWA 1U9RA 1HA6A 5C4HA 2N88A 2F0KA 2LY7A 5C5MA 1QE6A 1OXVA 1S5BD 1EY7A 5M5YB 1TKWB 1GUNA 5ELFA 4M1UB 3ITPA 1T5EA 4I65A 4ZRZA 3DWAA 1D1KA 2F0DA 4BA1I 1KDAA 2X6LA 2NUCA 3QJYA 3Q6SA 4XT3B 2JE6I 4XYOA 1KNAA 5I6WA 4FNFA 1EYDA 1CQVA 5CV8A 4IURA 2A73B 4WJWA 3WDNA 1XTCD 3PUVA 2L12A 2ICEC 2E75C 1E2VA 4BY1B 2F0OA 1GUOA 4O42A 2B2VA 4KKTA 4ODGA 5IODA 1AW7A 2NZ1D 4KY6A 3A55A 2R3ZA 4S3SA 3GV6A 1WD0A 1KAAA 2XRQD 1GHJA 3OPOA 5E4XA 2B2WC 1EQVA 4B9WA 1G2TA 2B2UC 3HOYB 3HKZB 2BDNA 3M4YA 4F8MA 4NW2A 2QILA 3K7AB 3S1MB 1PXUA 4QMGA 4OIKA 2WKCA 1BUVT 1TS2A 1MGSA 1OXUA 3TSSA 3OOCA 4ZUJA 3DWPA 5FOBB 2EY5A 2J4XA 4J6HA 2JA5B 1VCIA 3I70A 1CT1D 1GOZA 5EPLA 5I4DA 2IPKD 4A3BB 3DUZA 3QIAA 3T13A 3URYA 2B63B 3OMGA 4DU9A 1CA5A 3S17B 3KLSA 3PUXA 3S14B 4HN7A 5EBDA 2EE1A 3TP8A 2B2YC 2VXWA 3M7GA 2GA4B 2IW3A 1LACA 1XWEA 5K5PA 3GQBA 3S9WA 5IT9E 3PIO3 2K05A 2VB2X 4L6TB 3SK5A 3JAML 4K6LA 1STAA 5C0XG 1A3VA 4FXKC 1PTOD 4BA2I 3ERQA 4OGQC 5CV9A 5IGCA 4KTAA 1Z6HA 3J80E 4UAIA 4KV6A 3D4WA 1DONA 2JA6B 1BBXC 3RMHA 3T4AC 4FXDA 2TSSA 1YNNC 1C8CA 3P75A 3T51B 3K59A 4F87A 3MXGA 2F0TA 2I46A 2HCIA 3K58A 2Z8LA 3V05A 3FEWX 3VR3A 1F77A 3VA7A 2R92B 4CGYB 5FKAC 3NTIA 1AZPA 1QNKA 1LTBD 1QWYA 5C5LA 1Y8NB 5COYA 1X3QA 3LWUA 1I4PA 2RSNA 2ID0A 4KD3A 3BVZA 1X32A 3PV0A 3FDTA 2XSCA 3QOLA 1EZ6A 1SE4A 3J7AF 3A56A 1SAPA 2A6EC 2KVMA 1I4RA 1V1PA 2F0QA 3QO2A 4M8AA 2Q8IB 5EPKA 4WFN3 1TWCB 4QUFA 2JEAI 1WTVA 1EY8A 3R8BA 1TT2A 4BWGB 3ND9A 1B53A 2FMCA 1BNZA 3K6OA 1ENFA 5EQ0A 3K57A 3MFGA 1DYQA 5JEAJ 4XQNA 4X3SA 3KBXA 3S16B 3I3CA 1SYCA 4LAAA 3HZXA 4FF1A 1F2LA 3PIP3 2JP1A 2SNMA 2CW0C 5DM63 1EY6A 3SK6A 1S4ZA 2L11A 1EY9A 3OHXC 1HTLD 3PO3B 4IZ8A 1H9JA 1LT6D 2NVXB 1EIGA 2PQEA 3VR5A 1PRTB 3E6ZX 2WV6D 5CBAE 5KEEA 2ZXPA 2NTTA 1IW7C 1D1IA 4ZKBB 3BYYB 1A3UA 3FPPA 2K33A 4UDUC 4MHEA 2N55A 4DGZA 1Y8OB 2H4OA 3H6MA 2EVBA 2EYFA 3C1FA 3PO2B 4J8QA 4RHRA 3TN2A 2HUGA 1WTXA 1ILQA 1PTOH 1MI2A 1KLUD 1IHZA 4CHTB 3S1QB 1LT4D 1SSOA 3S2DB 4RWSC 1RODA 1STNA 1DM0B 3H91A 3K5MA 1EIHA 1XXGA 3S2HB 1DOMA 4K5VA 2F0IA 3NHHA 1C48A 4CKCA 4KHZA 1TS4A 2VNUD 1EU3A 2PZUA 3C3LA 1CHPD 1U4RA 1A15A 1TU2B 2A5HA 2RKSA 4CJ1B 2OEOA 4KD4A 2YU9B 1Y8PB 5I9PA 2O2LD 1FNVA 5K36H 3FVQA 3NQTA 1LTRD 4IUVA 2I07B 1UUPA 2K28A 1PRTF 2KQ3A 4X3KA 1S5FD 3SHLA 1G8ZD 1K83B 2NYZD 4A3GB 2LMCB 1ZXTA 1Y69U 2XN9C 3NBHA 1JQYD 1KNEA 1PYWD 1LTGD 4CBVA 3BVMA 1ESFA 1ZKOA 4IUPA 5CGKA 1BCPC 2EYJA 4A3KB 3RZOB 5C3EB 2PZWA 3EVQA 4RAUC 4FXGC 4OIJA 4R9WA 4RCNA 2MPMA 4XYQA 1DXMA 2PNRC 5ISRA 2PO4A 1U4LA 2CVRA 3NUCA 4HTHA 1BF4A 2E74C 5BN4A 1L0XB 1S5ED 1EY0A 3BG3A 1OXTA 3M4OB 5CR3A 3TP5A 1HQMC 2JXMB 4JK1C 1ENAA 4U673 3I91A 5E4WC 4HSVA 4MN3A 1RF2D 3M85A 2PPBC 2K04A 4RH6A 3K0YA 2BDOA 2WACA 1H9RA 3BS1A 4LK1C 2EY2A 4WORA 5KYLA 5CMDA 5EKIA 2IX1A 1SNPA 2AUKA 1VF5C 4ID6A 4A3DB 2XVSA 2DY7A 5G3LF 2EYHA 2G9DA 1NSNS 1JICA 3SK8A 5BN5A 3DXJC 4HCSA 2NVTB 1K8MA 2F0NA 5JAVA 4ULLA 3GTQB 4XIGS 1CA6A 1ZYRC 3OWFA 5DEHA 5KYIA 5M3MB 4C3HB 5BN3A 1Y1WB 5KGUA 3E0JA 3OSOA 2F0VA 4KKUA 4G7OC 3VR6A 1PFMA 1BCPB 1IKLA 2L9HA 1QCBD 5D3IB 4XQJA 3NP8A 2JA7B 3HGBA 2IWHA 4HMJA 1B2TA 3E5SA 1ESRA 1JOKA 1SYEA 3J7YW 1EWCA 1FD7D 1GUTA 1ZEQX 2AUJD 1NUCA 1Q3LA 1TVXA 4F7XA 1Q1BA 2E76C 1IYUA 3K5LA 4H44C 1STBA 1WTPA 1U4PA 5EPJA 1Z47A 3M7NA 1V1OA 3IFTA 1GUGA 3SR1A 2F0EA 1SYFA 3K5OA 5E1FA 4A3EB 2D9UA 2R7ZB 1E2WA 3TP7A 3H94A 1CZGA 4PQXA 2QDBA 4R8NA 4QF4A 5JPNC 5KNCA 2AWNA 1XX8A 2PCFB 3NSWA 4PMBA 1CZWA 4LMQD 4EQPA 1VMCA 3O13A 2M9VA 1LTTD 5ELBA 1EFID 4CKBA 3HS0C 1EZ8A 3R2TA 2FHTA 3NXWA 2M00A 1D5ZC 2XWBB 2HCCA 1SE2A 1VDZA 4J1MA 2EYPA 3G7LA 1M4VA 2G9HD 3W3AA 1A6XA 2EYOA 1M8AA 4KJOA 3T56B 1ONLA 4L63B 1PFBA 2RDHA 2F0MA 2X6GA 3N6RA 1LT3D 2EXZA 1CFMA 1F9RA 3HOWB 4ILWA 1CK1A 1G6ZA 3TMEA 3X3MA 1JC7A 5T1IA 1H9MA 1IL8A 3GO5A 1EQTA 5EBCA 1DOLA 5ELEA 3VR4A 4NP5A 3S1NB 1KLGD 4WRDA 2HDLA 2EPBA 2XWJB 5CV6A 2E2JB 3LX0A 4A3JB 1G2SA 3D3RA 4DXFA 3FKIB 2K01A 2EYMA 2Q8TA 2C5CA 2XIWA 1DOKA 2SNSA 1KABA 3OIPA 1PTOC 2F0FA 4G57A 4DFAA 3GTLB 2O5IC 3J80L 5CYUA 3NBIA 2QCPX 4KI0A 3A8JE 3W2DA 1DD2A 4H13C 3LNNA 4DN4M 4ZUIA 3CKIB 3GP7A 5E3FA 4KN4C 1HTPA 1QILA 1AFPA 3DHQA 3TBIB 1A2UA 5K36G 5I9OA 1TS5A 2EJFC 1MSGA 1J8IA 3P20A 5IOCA 5C4XB 1EOTA 1FYCA 4YIJA 3A54A 1RTOA 3I4LA 1O7ZA 1RDPD 2QEJC 3I4MB 2KEEA 2A6HD 2OF1A 3ONAB 5C3WA 4Z9CB 5DAUA 2RDFA 5CBEE 4KMUC 2IX0A 2NBFA 5TSSA 4XQQA 2RDGA 3RUZA 3R3OA 2BCOA 4C2MB 1BR9A 5A2QL 4IFDI 3J81E 2WKDA 1PTOB 2F4IA 3AB9A 3NK9A 2MGSA 2L55A 3A7AB 1Q1EA 1Q8IA 3VR2A 4DK1A 2KEDA 1I4XA 1LABA 3C2PA 4DNRB 1PMRA 3QG1A 1H9SB 3BYTB 2EJGC 2PW7A 1TQOA 2F3WA 1RHPA 3WOEA 2ENBA 4IQZA 3JAME 1AN8A 3PUWA 1I6HB 1RKNA 3SXHA 2B2TA 1Z7TA 3MZ5A 4BY7B 5D3DA 1FR3A 1TY0A 1W6KA 3NQIA 2KOLA 4A93B 4QIWB 1STGA 3Q0AA 2R93B 3MFYA 4B08A 2F0UA 1FNUA 2F0GA 1HHVA 1TR5A 4IFDJ 4DF7A 1NR2A 4XT1B 5FO9B 2PMZB 2A69D 2L4NA 3BDCA 1YNJD 1EEID 1QOHA 3MXPA 5FLXL 3DEOA 3OIQA 3G6JB 2Q8RE 2D5DA 2WINB 3AMUA 1E2ZA 5HURA 4FVMA 2NB0A 1GXDC 3HRZC 2ZXRA 1JWUD 1NR4A 3EQLC 1JORA 4RGOS 1PRTD 2A68D 4C3JG 2MHVA 4RGNA 4BS9A 5M3FB 4E6IA 5D14A 1TS3A 4ZK9B 2HQEA 1GJXA 2QF7A 1GUWA 2R61A 4X3UA 3D8GA 2MP1A 2KJXA 3MXUA 2ICIA 1TY2A 2J0TD 4IUTA 3HG9A 1STYA 2A6ED 3I73A 1CM9A 2LKVA 2B2WA 5KNDA 1D5MC 3Q22A 4QCLA 2F0HA 5IGGA 3ND8A 2B2UA 3VYSA 3HOUB 4HSPA 3BVGA 4HR7B 4LJZC 1DZ1A 1V8QA 4KJNA 2E2DC 2O4XA 3MEHA 3NPPA 1WVLA 4NMZA 4HCEA 4R8IA 4P2CB 2B2VC 3VYTA 4DAYA 4QUCA 2K6AA 1BDOA 1SMYD 5FK9C 1A3TA 3I4NB 4ZQ3A 3P7JA 2EY1A 4NDXA 3N52A 3KLSX 2DNEA 3BDOA 4O1NA 2YYZA 2B2YA 1X3PA 4F88A 1R4PB 4C3JB 3I8ZA 2A74C 3WOFA 4XTCS 2K5WA 1XYIA 1WTOA 1EYCA 1SYGA 2NN6I 3OWEB 3HOVB 3NTHA 1SNMA 3LWEA 2XRSD 1WTQA 4JBWA 3NE5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0I A;  4KHV A;  3NHH A;  4K8J A;  4NKL A;  3C1E A;  5EKK A;  5IGG A;  4K5X A;  2F0O A;  5J22 A;  5CV5 A;  1SND A;  2EYH A;  5IGD A;  2F3V A;  4PMB A;  1EY8 A;  4N9P A;  5IIF A;  2PW5 A;  1TT2 A;  1NSN S;  4HMI A;  4ZUI A;  2PW7 A;  2PZU A;  1TQO A;  2F0J A;  4ODG A;  5C4Z A;  5K5P A;  4MIU A;  4EQP A;  5IOD A;  3S9W A;  5C3X A;  2F3W A;  5E3F A;  3SK8 A;  4KY6 A;  2RKS A;  3DHQ A;  3QB3 A;  3SK5 A;  1A2U A;  2OEO A;  4KD4 A;  3HEJ A;  2EY6 A;  2O4X A;  1STA A;  4KJN A;  3V2T A;  5I9P A;  1A3V A;  2ENB A;  2F0N A;  5I9O A;  5JAV A;  1JOQ A;  3MEH A;  5JOB A;  4S3S A;  3ERQ A;  5HGT A;  1II3 A;  1SYC A;  1RKN A;  2OXP A;  3DMU A;  3HZX A;  3NQT A;  1KAA A;  3OWF A;  1EZ8 A;  3MZ5 A;  5CV9 A;  4RKL A;  5DEH A;  3SXH A;  5IGC A;  5IOC A;  1EQV A;  3NXW A;  4KTA A;  4NMZ A;  2SNM A;  2M00 A;  3D4D A;  4PNY A;  3EJI A;  5J1Z A;  4EQN A;  5KGU A;  4B9W A;  3OSO A;  4KV6 A;  3D4W A;  4QB4 A;  1EYA A;  5I6Y A;  5C6A A;  2KQ3 A;  4J1M A;  5CV7 A;  2EYL A;  1F2Y A;  2F0V A;  4YIJ A;  1EY6 A;  5EKL A;  3SK6 A;  1SNC A;  1STG A;  1EY5 A;  4F8M A;  1EY9 A;  2EYP A;  4TRD A;  3SHL A;  2F0U A;  5KIX A;  4QMG A;  1JOO A;  2F0G A;  2EYO A;  1SNQ A;  5NUC A;  4KJO A;  2PZT A;  1TR5 A;  2OF1 A;  4IZ8 A;  4KY5 A;  4DF7 A;  3P75 A;  1KDB A;  3NP8 A;  3BDC A;  1KDC A;  4IUN A;  5C3W A;  2F0S A;  5I6W A;  1A3T A;  1SYD A;  2F0T A;  3MXP A;  5DAU A;  2F0M A;  4ZQ3 A;  2RDF A;  4HMJ A;  1SNO A;  4K2L A;  1U9R A;  2EXZ A;  4ZUJ A;  2EY1 A;  2PQE A;  3BDL A;  4NDX A;  3VA5 A;  2EY5 A;  3E5S A;  5C4H A;  5M9O A;  5IGF A;  5J39 A;  1STH A;  2F0K A;  4J6H A;  3T16 A;  1JOK A;  1SYE A;  4K6D A;  3RUZ A;  5CGK A;  5KEE A;  5C5M A;  3R3O A;  2EYJ A;  4EVO A;  5HUR A;  2PZW A;  3EVQ A;  4B9X A;  5EGT A;  3TME A;  1A3U A;  4IAL A;  1NUC A;  5ISR A;  4ME5 A;  1EY7 A;  2PYK A;  4F7X A;  5KRU A;  1JOR A;  5C5L A;  3NUC A;  3ITP A;  4HTH A;  4DGZ A;  3U9O A;  4I65 A;  5F2D A;  4N9T A;  3TP6 A;  1F2M A;  1STB A;  2SOB A;  1EY0 A;  3H6M A;  4K8I A;  4E6I A;  2EYF A;  3C1F A;  4LAA A;  2F0D A;  1KDA A;  3T13 A;  3P1H A;  4NP5 A;  5CR3 A;  2NUC A;  3TP5 A;  3NK9 A;  1EYC A;  1SYG A;  2HQE A;  3QOJ A;  3OMG A;  4WRD A;  5CV6 A;  2RBM A;  1ENA A;  4K14 A;  4DU9 A;  4KD3 A;  3SR1 A;  3LX0 A;  1F2Z A;  3D8G A;  3SK4 A;  1SNM A;  1IHZ A;  1SYF A;  2F0E A;  2KHS A;  4K2K A;  1ENC A;  4OL7 A;  1EY4 A;  5E1F A;  2F0W A;  3QOL A;  5CC4 A;  5CV4 A;  1EYD A;  1EZ6 A;  1AEX A;  1SYB A;  4K5W A;  4EQO A;  3ERO A;  3TP8 A;  1STY A;  5CV8 A;  2EYM A;  1A2T A;  3TP7 A;  5IGE A;  5IGB A;  2SNS A;  4H7B A;  1KAB A;  1STN A;  5KYI A;  2WAC A;  2F0L A;  3OMC A;  4PMC A;  3D6C A;  3PMF A;  2F0F A;  2QDB A;  2EY2 A;  4G57 A;  4DFA A;  2F0P A;  4WOR A;  4RKB A;  3MVV A;  3MHB A;  4R8N A;  5KYL A;  2LKV A;  4QF4 A;  4KY7 A;  1SNP A;  2F0Q A;  4ID6 A;  2F0H A;  4K5V A; 
#chains in the Genus database with same CATH topology
 3BZK A;  4AIM A;  5EKK A;  3KJP A;  4AQY L;  1LT5 D;  2QDL A;  4DR4 L;  3UDI A;  4BBR B;  4JBM A;  1GHK A;  2Y0S E;  4C3I H;  1S40 A;  4C56 C;  3I90 A;  4DV5 Q;  1X56 A;  4LF6 L;  1PH1 A;  5FO8 B;  3ICE A;  2NVX H;  3OYY A;  3K5N A;  3GTG H;  1CI3 M;  3MA2 B;  4PNY A;  1H95 A;  3V96 A;  3H0G H;  3PUY A;  1EQR A;  3LGJ A;  3GV3 A;  4PV1 C;  1N9W A;  3WWV A;  4KKS A;  4ZAI A;  2LS0 1;  5EKL A;  2P5Z X;  1Q86 C;  4FYD A;  4GOP A;  1SXT A;  1N34 L;  3R93 A;  2DY8 A;  2ALY B;  4ABN A;  1HCZ A;  1HFG A;  1YJW A;  1SE3 A;  1D6E C;  2D62 A;  4YCU A;  3IFD A;  1GUS A;  2BE5 C;  3R2I A;  1CKM A;  3RLF A;  3MAQ A;  2N3S A;  2K1B A;  3E0E A;  4XXE A;  2RA4 A;  1L0W A;  1STH A;  3D4R A;  4A3M H;  3KBG A;  4LF4 L;  1BBW A;  1MKH A;  1IBM L;  3GTJ B;  1HNW L;  2K4K A;  4A3F H;  3GD7 A;  4LWC A;  3VYU A;  4JI2 L;  5C0X J;  2AKW B;  4N9T A;  1F2M A;  4DK6 C;  1KL9 A;  2PNH A;  1XNQ Q;  3FMC A;  3L9A X;  5LHY 1;  1EYG A;  4KHP Q;  3M9B A;  3BZC A;  2D0O A;  4JI7 Q;  3M3Y B;  1VF7 A;  3TZU A;  4R1J A;  1SR3 A;  4HAE A;  2NZH A;  2E2I H;  2KCM A;  3RLO A;  3DM1 A;  2Q2H A;  1C4Q A;  1ENC A;  1I5F A;  3PUZ A;  1EY4 A;  1X65 A;  1K8O A;  1T5X D;  3K7U C;  2L15 A;  1AEX A;  4EQO A;  4X64 L;  5IGE A;  2HHH Q;  2YU9 H;  1TWF H;  3F2C A;  4JC0 A;  4PMC A;  4JPB W;  2RVL A;  5GAD C;  2F0P A;  3IKJ A;  3NWT A;  3MHB A;  1SN8 A;  3IAY A;  5LMN W;  1B44 D;  3HOY G;  4DAV A;  3C1E A;  3UDF A;  4C1N I;  4K5X A;  5J22 A;  4LF9 Q;  1SND A;  2AQ2 B;  1LTI D;  2F3V A;  4HMI A;  1GO3 E;  2H5X A;  4DNT B;  1IBK L;  1Y1V G;  3FRP B;  1N36 Q;  2UU9 Q;  1YIT A;  3KLR A;  3DWQ A;  3L2P A;  4DR3 L;  4A3G H;  3W5O A;  4OXP A;  1KTK A;  4YWM A;  5D65 A;  2OT2 A;  1SE8 A;  5M9O A;  2KEN A;  2BA1 A;  4A75 A;  3D4D A;  2JA5 G;  3EJI A;  1FGB D;  5LL6 S;  5C6A A;  2QKI C;  2WB1 G;  1EY5 A;  4LFA Q;  1RJT A;  1E0B A;  3RZO H;  5C3E H;  5LMU L;  3KOJ A;  3EA6 A;  4NXN L;  3D6W A;  1BCP F;  4A3B G;  2BA0 A;  2EXD A;  1KDB A;  1O7L A;  1YZ6 A;  2JEB I;  4BBS G;  1WTW A;  2AHO B;  4AYB E;  1V1Q A;  2B63 G;  4DAM A;  1N32 Q;  5J39 A;  2SDF A;  5FO7 B;  2K5V A;  2K5D A;  1Q90 A;  1Q8K A;  4B9X A;  4FO2 A;  2F03 A;  3S15 H;  2EZV A;  4IAL A;  1TWG B;  4CJ0 B;  3H3V H;  1C9O A;  5C4J B;  5I2Y A;  1IYV A;  2EJM A;  4Y7N H;  2K7V A;  1VQF A;  1AP0 A;  1DCZ A;  2WAQ G;  1WCM H;  4RMF A;  4EGV A;  1R9T B;  1PZJ D;  2SOB A;  1Q82 C;  3T1H L;  4HJA A;  3P1H A;  2I5L X;  1AE3 A;  3QWN A;  1MBY A;  3EIV A;  3CCU A;  3RZD B;  2DGY A;  4L8J A;  2D0P A;  4K2K A;  3T1Y Q;  2ZT9 C;  3I72 A;  4OL7 A;  4H0L C;  1L0Y B;  3GTM H;  3BJU A;  5CV4 A;  3S1R H;  1BO0 A;  2JA9 A;  3CRL C;  3ERO A;  1O7Y A;  2PQA A;  1L1O C;  3GTK B;  3SEB A;  3GTQ H;  1IKM A;  4CKE A;  3F2U A;  4KN7 C;  4KY7 A;  1P8L A;  3M4Q A;  3PIP A;  3MWY W;  5M3M H;  4NXM L;  4IOA A;  4C3H H;  1MJC A;  4K8J A;  4KHV A;  4NKL A;  1Y1W H;  1OO9 B;  2D2C C;  1HR0 Q;  1V1P B;  5ELC A;  3IL8 A;  1WI5 A;  5IGD A;  5IIF A;  5C4Z A;  3AFQ A;  3CP0 A;  4TKO B;  5IT9 L;  2KHI A;  4RA8 A;  1Y1V B;  5M5X H;  4DV1 Q;  1Y14 B;  2A6H C;  2EY6 A;  2NVY B;  1JOQ A;  2E2H B;  1B3A A;  4RGM A;  4DXG A;  5JPM C;  1II3 A;  3GTP B;  2JA7 H;  3KFU A;  3SE0 A;  4PMW A;  5AJ3 Q;  5J1Z A;  2CQA A;  1IYJ B;  3CRK C;  2HIX A;  1EYA A;  1UEA B;  4EX5 A;  4G7H C;  2FFK B;  1VQO A;  2WB1 B;  4G7Z C;  1I4H A;  2UXD Q;  1VQM A;  1OXS C;  2OQK A;  3RNU A;  4KY5 A;  2YV5 A;  4TQU S;  2OQ0 A;  1UEB A;  3J81 L;  3CQZ H;  3L0O A;  1RTN A;  1I50 B;  2IT1 A;  1SFO B;  2F0S A;  2Z4I A;  4BBS B;  1HUN A;  4IPH A;  3T53 B;  1VQG A;  4IN3 A;  3BDL A;  1SEB D;  3CME A;  4DV3 Q;  3MTS A;  4HJ5 A;  4O0A A;  1TWH B;  3A8K E;  4RCO A;  3T16 A;  4JBK A;  1HFN A;  1J9O A;  2Y0S G;  4DV7 Q;  3A5Z B;  5IP9 G;  4DK0 A;  4ZKC B;  4A4I A;  2B8G A;  2VQE Q;  4A3E H;  1HNZ Q;  4IPC A;  4L5R C;  1MSH A;  5DNF A;  2R7Z H;  2ZM6 Q;  5M5Y H;  1K73 C;  4A3I B;  1N33 L;  4RHS A;  2LFN A;  3L7Z C;  3TP6 A;  2WAQ B;  2RSO A;  2TMP A;  4FP5 D;  2VB3 X;  4L5S A;  1EU4 A;  2VUM B;  4KLK A;  3SGI A;  1TWA B;  3E9I A;  4P71 A;  2NN6 G;  1PZK D;  2AQ1 B;  5AFW A;  2G5D A;  3SK4 A;  1RD9 D;  2KHS A;  3C46 A;  1BQQ T;  4I7Z C;  3SDZ A;  4GN5 A;  1HXY D;  4OO1 I;  1A2T A;  1CHQ D;  1VQK A;  2HIV A;  1BKB A;  2Z6K C;  4IFD H;  2WP8 J;  2NVQ B;  4OO1 H;  5JEA H;  2H1E A;  4RKB A;  1LTA D;  5IY0 A;  3PSI A;  3BZD B;  1SDF A;  2K03 A;  4GLV B;  2Z1C A;  2C9O A;  1F9P A;  4LF7 L;  3SVM A;  4OEL B;  4LF8 Q;  4DR5 L;  1EL0 A;  4DV4 L;  1X9N A;  1RIP A;  2XNA C;  4BY1 H;  2KA7 A;  4C3I G;  3KYH C;  4X62 L;  2FJ2 A;  2FMM A;  3TRE A;  5J3B A;  3PO3 G;  1HZC A;  3J80 i;  4DA2 A;  4X6A H;  1E1T A;  1JE4 A;  3QB3 A;  5LL6 X;  3HEJ A;  3CCR A;  4Q0F A;  1PFN A;  2A69 C;  2J7Z A;  5HGT A;  1YNJ C;  3GTO B;  3CCJ A;  4FF4 A;  1NCV A;  4EQ5 A;  4A3L H;  2MUY A;  4V19 0;  2PI2 A;  4EQN A;  1UNS A;  4QB4 A;  2ZTE A;  2CWP A;  4DNI A;  5I6Y A;  2LXK A;  4MNO A;  3KUP A;  4B3R Q;  3HOY H;  4NB3 A;  1PH6 A;  4B3M Q;  2WFW A;  3HOW H;  1BVS A;  1PDQ A;  2CHB D;  3GDE A;  2VQF Q;  3K7A H;  3S1M H;  5NUC A;  3J7A V;  3CHB D;  1LV9 A;  2FIN B;  5T1G A;  4LUV A;  1PRT C;  2A68 C;  2R7D A;  1SYD A;  5BR8 L;  2K32 A;  5JJZ A;  1NY4 A;  1VQC A;  1KRT A;  1HR0 W;  3RD4 A;  5JJL A;  1SNO A;  3VA5 A;  3Q24 A;  1STE A;  3Q23 A;  2B39 A;  4A3M G;  3NBH B;  4OHJ A;  3I55 A;  1YIJ A;  2JA5 H;  1YEZ A;  3KF6 B;  4DR6 L;  4A3J H;  4I7A A;  2Y0S B;  2AQ3 B;  1YNN D;  4A3F G;  5JVH 3;  3UDX A;  2K5Q A;  1A0I A;  1D5X C;  1H9K A;  2KEC A;  5A2Q E;  4IUU A;  1ET6 A;  4DV2 L;  3STB C;  5C44 B;  3U9O A;  5F2D A;  2SEB D;  4QQB X;  1B50 A;  1WYD A;  5IYC H;  1ILP A;  1I4G A;  5M5W B;  2V4D A;  2Q2U A;  2MJ8 A;  4JOI A;  1PTO F;  4DUZ L;  3TDQ A;  3U9S A;  3S17 H;  3EFX D;  1VQI A;  2DN8 A;  1I3Q B;  3HKZ E;  3U4V A;  3CC2 A;  5CC4 A;  1JMC A;  1SYB A;  4TSS A;  5H1S E;  4AYB G;  5IGB A;  2N49 A;  3AU7 A;  2F0L A;  3OMC A;  1HA5 A;  2ZXO A;  4X65 Q;  2F1M A;  1W6J A;  3MVV A;  1QB5 D;  2L5T A;  3TS0 A;  1K8A C;  1JWS D;  3VYR A;  4C1N K;  4GZY C;  2UUC Q;  1HUM A;  1ML0 D;  2A8V A;  5CV5 A;  2JK8 A;  1GM5 A;  3ZYY X;  2F4V L;  4X62 Q;  1KC8 C;  4C3I B;  1HJP A;  3X3N A;  1EWH A;  4A3G G;  2K14 A;  3I4M H;  2M2L A;  1SMY C;  1LLR D;  4IUQ A;  1JR0 D;  5GRO A;  2X69 A;  3GTG B;  2LSS A;  3H0G B;  4CJ2 C;  1KAW A;  4GKK Q;  1MIU A;  4N8F A;  4A3K G;  5CV7 A;  5C3E G;  2EYL A;  1F2Y A;  1SNC A;  1S5C D;  4DV6 L;  1JCK B;  2JA6 H;  4C2M H;  4A3C H;  3NEN A;  1PHJ A;  5KIX A;  1PLF A;  5DM7 3;  2OCE A;  2NTS A;  1EIF A;  1U4M A;  4QL5 A;  1HQR D;  2LXJ A;  4RGT A;  3K8A A;  2HT1 A;  1SBB B;  5FLX E;  1YNX A;  2CW0 D;  4JYA L;  1F9Q A;  1NAP A;  3FPU B;  3TZD A;  4A3M B;  1JWM D;  5JVG 3;  4V0B A;  2EDG A;  1G51 A;  2VZA A;  1TII D;  2UXB L;  4HED A;  4A3F B;  1BOS A;  1MD2 D;  1BXT A;  4UP9 A;  2R92 H;  5A35 A;  2PYK A;  1RCV D;  3AFP A;  4DV2 Q;  1WCM G;  1I6V C;  1YHB A;  5G3L D;  1G29 1;  4K8I A;  4HJ7 A;  3CCS A;  4A3D G;  1EEF D;  2ZJR A;  4Q5V A;  4JI6 L;  2E2I B;  3CU7 A;  1WD1 A;  2I5M X;  2RBM A;  4K14 A;  3H3V C;  1F2Z A;  2Z6B A;  1IW7 D;  2HDM A;  1E7Z A;  3HOZ B;  4IOC A;  1LTS D;  2F0W A;  3OW2 A;  1X55 A;  1TWF B;  1ICW A;  4H7B A;  4AYB B;  1D2B A;  2KCC A;  3D6C A;  5KNB A;  3PMF A;  3DEP A;  5M3M G;  1I6H H;  2CFM A;  4C3H G;  1JE5 A;  3I4O A;  1Y1W G;  4JI8 L;  1F9S A;  1H9S A;  5IP7 H;  2KCN A;  1B9N A;  2EOT A;  2RQX A;  4FF3 A;  1TWC H;  3W1G A;  2PW5 A;  4DUY L;  1G91 A;  4ZYS A;  1B4O A;  2F0J A;  2R93 H;  2NN6 H;  4MIU A;  1LO5 D;  1HRJ A;  1HPC A;  1MJE A;  3MC0 B;  4N8X 1;  2JSO A;  1O80 A;  1PH4 A;  5C0X I;  5I2X A;  1VMP A;  2L0C A;  2JA7 G;  1QNU A;  1X3E A;  5IYB H;  1VQN A;  5EGT A;  5C0X H;  3S16 H;  2CQO A;  1PH7 A;  3A0J A;  1XPU A;  1X3F A;  3KF8 A;  1DJR D;  2Z4H A;  1Q12 A;  4LUO A;  1J6Q A;  3PF4 A;  1VQ4 A;  4B3S Q;  2ZTD A;  1N8R C;  1XJV A;  1JOO A;  2KUM A;  3PO3 H;  1R4Q B;  4IUN A;  4R4C A;  4DR1 Q;  1E1O A;  1I4Q A;  2DNC A;  1YJ9 A;  2JN4 A;  4LFC Q;  3HOX B;  4KK7 A;  4K2L A;  2IY5 B;  2IL8 A;  5IGF A;  5EAY A;  1PYS B;  2WII B;  4K6D A;  4DAP A;  1QG7 A;  4EVO A;  4A3E G;  3S15 B;  1JB3 A;  2O5J C;  2N8N A;  1CQF A;  1Q46 A;  1JB7 A;  2OTL A;  1PZI D;  4ZLT F;  4OX9 L;  2R7Z G;  4JI5 Q;  2IX3 A;  4GLX A;  4ME5 A;  3NTK A;  2AWO A;  1K3B C;  5KRU A;  4Y7N B;  1WTR A;  1PH8 A;  1WCM B;  3MXN A;  1PFS A;  2B29 A;  2PMZ E;  2UUA L;  2JA8 B;  4GKJ Q;  1A62 A;  1ET9 A;  1XNR Q;  3QOJ A;  1BCP D;  3PO2 H;  3D31 A;  1SJE D;  3A8I E;  4GNX C;  4K0K L;  2XTI A;  3CXC A;  1B1Z A;  3HOU H;  3GTM B;  4DV0 L;  3S1R B;  3CAM A;  2FXQ A;  4K5W A;  3S1Q H;  1S5D D;  1AZQ A;  4IFD G;  4G4K A;  2UXC Q;  1XTD A;  5JEA G;  3S2D H;  4OO1 G;  1CTM A;  1UAP A;  1D7Q A;  4JBJ A;  1B9M A;  1VQE A;  3A7L A;  3H09 A;  4RFB A;  2BOS A;  1OXX K;  2IHF A;  3OW7 A;  3ULJ A;  4BY1 G;  3S2H H;  1QJO A;  3G71 A;  2RHQ B;  4N9P A;  1XMO L;  5ELD A;  2GVB A;  4XDX A;  5M5X B;  3KK7 A;  1SJH D;  5C3X A;  2L1B A;  4R4I A;  3NWS A;  1U0L A;  4FF2 A;  4MTK A;  3V2T A;  2IJ0 A;  5JOB A;  4A3L G;  3L3O C;  2OXP A;  3DMU A;  3U50 C;  5EJW A;  2E5L L;  4RKL A;  4X3T A;  3FP9 A;  2R6G A;  2B3G A;  2RCN A;  1AE2 A;  3F2D A;  1O78 A;  2Q2I A;  2B8F A;  5HY6 A;  2NWG A;  3HKZ G;  3UI2 A;  4AQY Q;  3HOW G;  1PVO A;  3HP3 A;  4DR4 Q;  4TRD A;  2JYO A;  1FL0 A;  1SNQ A;  2PZT A;  1K83 H;  3CQZ B;  4X66 L;  5COR A;  2BE5 D;  1VQH A;  3VDY A;  4QGU A;  2VS1 A;  4LF6 Q;  4U68 A;  1KDC A;  1ZYR D;  1V43 A;  1YJN A;  2B2T C;  1FNW A;  1LUZ A;  1U9R A;  2YTX A;  1HA6 A;  5C4H A;  1K0R A;  2N88 A;  4JI4 L;  2F0K A;  1CKO A;  1QUQ B;  4A3J G;  2LY7 A;  5C5M A;  1QE6 A;  1D8L A;  1OXV A;  3HOV H;  4O2D A;  4ME3 A;  4A3K H;  4PG3 A;  4GNX B;  1I94 L;  1N34 Q;  1S5B D;  1EY7 A;  5M5Y B;  1TKW B;  1GUN A;  5ELF A;  4M1U B;  3ITP A;  5IYC G;  1T5E A;  2JJQ A;  4I65 A;  4JI0 L;  4ZRZ A;  1RL2 A;  3DWA A;  1D1K A;  2F0D A;  4BA1 I;  1KDA A;  2X6L A;  4AH6 A;  3A74 A;  2NUC A;  3QJY A;  3M4O H;  3Q6S A;  1B70 B;  4XT3 B;  2JE6 I;  4K0K Q;  4XYO A;  4LF4 Q;  1KNA A;  1UWV A;  5I6W A;  4FNF A;  1IBM Q;  1EYD A;  3CPW A;  1CQV A;  5CV8 A;  1HNW Q;  3CPF A;  2HQL A;  4YWK A;  1CKN B;  1E22 A;  4IUR A;  4JI2 Q;  2A73 B;  4WJW A;  3WDN A;  1XTC D;  3PUV A;  2L12 A;  2ICE C;  4A3D H;  2E75 C;  1E2V A;  4BY1 B;  1VQ5 A;  2F0O A;  1GUO A;  2MQH A;  3DLL A;  4O42 A;  2B2V A;  4GN4 B;  4KKT A;  2XGT A;  4ODG A;  4FDB A;  3I4M G;  1XPR A;  5IOD A;  1AW7 A;  2NZ1 D;  4KY6 A;  2N78 A;  1QZH A;  4X64 Q;  2NVT H;  3A55 A;  2R3Z A;  4S3S A;  3GV6 A;  1WD0 A;  3H15 A;  2BH8 A;  1KAA A;  2XRQ D;  1GHJ A;  3OPO A;  5E4X A;  2B2W C;  1EQV A;  3B6Y A;  3NEL A;  4B9W A;  1G2T A;  1C0A A;  2B2U C;  2JA6 G;  4WJ4 A;  4A3C G;  3HOY B;  2K52 A;  3HKZ B;  3DM3 A;  2BDN A;  2CH4 A;  3M4Y A;  4F8M A;  4NW2 A;  2QIL A;  3K7A B;  3S1M B;  1PXU A;  1IBL L;  4QMG A;  4OIK A;  3GTJ H;  1IBK Q;  2WKC A;  1BUV T;  4X66 Q;  1TS2 A;  4DR3 Q;  4POG A;  1MGS A;  2K50 A;  1VQL A;  1UE1 A;  1OXU A;  3TSS A;  3OOC A;  4ZUJ A;  3DWP A;  5FOB B;  2EY5 A;  2J4X A;  2Q2T A;  4J6H A;  3CD6 A;  2JA5 B;  1VCI A;  2RF4 A;  2R92 G;  4OWW B;  1VQ6 A;  3I70 A;  5LMU Q;  1CT1 D;  2VL6 A;  1GOZ A;  5EPL A;  4NXN Q;  5I4D A;  2IPK D;  4DR2 L;  4A3B B;  1X54 A;  3DUZ A;  3KDF B;  3QIA A;  2UUB L;  3T13 A;  3URY A;  2B63 B;  3OMG A;  3TEH B;  4DU9 A;  1CA5 A;  3S17 B;  3KLS A;  3PUX A;  1BBU A;  3S14 B;  5IYD H;  4HN7 A;  5EBD A;  1J5E L;  1VQJ A;  2EE1 A;  3ULP A;  3TP8 A;  5FLM H;  1OTC A;  2B2Y C;  2VXW A;  3M7G A;  5ELO A;  5IP7 G;  2GA4 B;  1L1O B;  3T1H Q;  1UE5 A;  3IRB A;  1ASY A;  1CSQ A;  2IW3 A;  1LAC A;  2R93 G;  1XWE A;  1KD1 C;  1K9M C;  1FJG L;  3F2B A;  5K5P A;  3GQB A;  3S9W A;  5IT9 E;  3PIO 3;  2K05 A;  2VB2 X;  4L6T B;  3SK5 A;  5IYB G;  4DR7 L;  3JAM L;  4K6L A;  3RLN A;  1STA A;  5C0X G;  4HIM A;  4B3T L;  1A3V A;  4FXK C;  1PTO D;  4BA2 I;  3ERQ A;  4OGQ C;  3J80 c;  1QVF A;  5CV9 A;  4JW0 A;  5IGC A;  1YVC A;  4KTA A;  4CDC C;  1Z6H A;  3J80 E;  4NXM Q;  4UAI A;  4KV6 A;  3D4W A;  1DGS A;  1DON A;  2JA6 B;  1BBX C;  4J15 A;  4GLA C;  3RMH A;  1NMF A;  3T4A C;  4FXD A;  3JC6 6;  2TSS A;  1YNN C;  1C8C A;  2IHE A;  4DAY B;  3P75 A;  3T51 B;  3K59 A;  5M3F G;  3NEM A;  4F87 A;  3MXG A;  3W1B A;  2F0T A;  1R9T H;  2I46 A;  2HCI A;  1E3P A;  3K58 A;  2Z8L A;  3V05 A;  3FEW X;  4JV5 L;  1XPO A;  3VR3 A;  1F77 A;  3RZD H;  3J81 i;  2I5H A;  3VA7 A;  2R92 B;  4GOP C;  2KBN A;  4YY3 L;  4CGY B;  5FKA C;  3NTI A;  1AZP A;  1QNK A;  1LTB D;  1QWY A;  5C5L A;  1Y8N B;  5COY A;  1WJJ A;  1O7I A;  1X3Q A;  3LWU A;  1I4P A;  2UUB Q;  3PO2 G;  2RSN A;  2ID0 A;  3S1N H;  3HOU G;  2F3I A;  3BVZ A;  4KD3 A;  3G4S A;  2E2J H;  1X32 A;  3PV0 A;  2PI2 E;  3FDT A;  2XSC A;  3QOL A;  1EZ6 A;  2F52 A;  3FKI H;  4YCW A;  4ALP A;  1SE4 A;  3J7A F;  4IPD A;  3S24 A;  4LFB L;  1A63 A;  1HZA A;  3A56 A;  1SAP A;  2A6E C;  1N33 Q;  1A8V A;  3E9H A;  2KVM A;  1I4R A;  5GQO A;  1V1P A;  2F0Q A;  3QO2 A;  4M8A A;  2RCF A;  3GTL H;  2Q8I B;  5EPK A;  3OTO L;  4WFN 3;  1PH3 A;  1TWC B;  4UPA A;  4QUF A;  3G6E A;  3JAM i;  2JEA I;  1WTV A;  1EY8 A;  3R8B A;  2OTJ A;  1TT2 A;  4BWG B;  3ND9 A;  1B53 A;  2FMC A;  1BNZ A;  3K6O A;  4RG1 A;  1FGU A;  1ENF A;  5EQ0 A;  3K57 A;  3MFG A;  2OWO A;  1DYQ A;  5JEA J;  4XQN A;  4X3S A;  3KBX A;  3S16 B;  3I3C A;  1SYC A;  4LAA A;  3HZX A;  4FF1 A;  1F2L A;  5IWA L;  3PIP 3;  4IJH A;  2JP1 A;  2SNM A;  2ATW A;  1WFQ A;  4CDD C;  2CW0 C;  5C4X H;  5DM6 3;  5LMN L;  4LF7 Q;  1EY6 A;  3SK6 A;  4DR5 Q;  3J7A 5;  1S4Z A;  2L11 A;  4DV4 Q;  1EY9 A;  1HNX L;  2CH4 W;  3OHX C;  4DPG A;  1HTL D;  4JCV E;  3PO3 B;  4P75 A;  4IZ8 A;  4GOP B;  4YCV A;  1H9J A;  1B7Y B;  1LT6 D;  1IL2 A;  4A3I H;  4JG2 A;  4JI3 L;  2NVX B;  4YHH L;  1VQD A;  1EIG A;  2PQE A;  1Z9F A;  3VR5 A;  1PRT B;  3HOV G;  2VUM H;  3E6Z X;  2WV6 D;  3ULL A;  1TWA H;  5CBA E;  2ZXP A;  2NTT A;  5KEE A;  1VS0 A;  1IW7 C;  1D1I A;  3RN2 A;  4ZKB B;  3BYY B;  1A3U A;  3FPP A;  2K33 A;  4UDU C;  4MHE A;  2N55 A;  1XMQ L;  4DGZ A;  1Y8O B;  2H4O A;  4JVZ A;  5FLX c;  3H6M A;  2EVB A;  2EYF A;  3C1F A;  3EN2 A;  3RR5 A;  5BR8 Q;  1WTH A;  4J8Q A;  3PO2 B;  2BH2 A;  4RHR A;  3TN2 A;  2HUG A;  2QA4 A;  1WTX A;  1PH5 A;  1ILQ A;  1PTO H;  1MI2 A;  1KLU D;  1IHZ A;  4DR6 Q;  4CHT B;  3S1Q B;  1CSP A;  4DV5 L;  1LT4 D;  1SSO A;  1UE6 A;  2CKZ B;  3S2D B;  1YBY A;  4RWS C;  2VW9 A;  1ROD A;  1STN A;  1DM0 B;  1QVG A;  3H91 A;  3K5M A;  1EIH A;  1XXG A;  3S2H B;  2E8G A;  1DOM A;  4K5V A;  2F0I A;  3NHH A;  4PZ7 A;  1C48 A;  4CKC A;  4KHZ A;  4PZ6 A;  1TS4 A;  2VNU D;  1EU3 A;  4DUZ Q;  2PZU A;  3CC4 A;  1CHP D;  3D0F A;  1U4R A;  3C3L A;  1A15 A;  3QR8 A;  1TU2 B;  2A5H A;  2RKS A;  4CJ1 B;  1X3G A;  2OEO A;  4KD4 A;  2YU9 B;  1Y8P B;  5I9P A;  2O2L D;  4ZCK A;  3AQQ A;  3HKS A;  3PQI A;  1FNV A;  5K36 H;  2QW7 A;  3FVQ A;  3NQT A;  1LTR D;  4IUV A;  3I56 A;  2RHS B;  2I07 B;  4BY7 H;  4P74 A;  1UUP A;  4JI1 L;  2K28 A;  1PRT F;  2KQ3 A;  1AH9 A;  4A93 H;  4X3K A;  1S5F D;  3K80 C;  3SHL A;  2F4V Q;  1G8Z D;  1VQA A;  1K83 B;  2NYZ D;  5E7N A;  3E3X A;  4A3G B;  2DJG C;  1ZXT A;  2LMC B;  1Y69 U;  4QY7 A;  2XN9 C;  4UY8 C;  3NBH A;  1XNQ L;  3Q8D A;  1JQY D;  4KHP L;  1KNE A;  1PYW D;  1LTL A;  1QVC A;  1LTG D;  4CBV A;  3BVM A;  3KF6 A;  4R4T A;  5FJ8 G;  1ESF A;  1ZKO A;  4IUP A;  1ICF B;  4LUZ A;  5CGK A;  1BCP C;  2EYJ A;  1KRS A;  4A3K B;  3RZO B;  5C3E B;  2PZW A;  3EVQ A;  4OWX B;  4DV6 Q;  1I3Q H;  4RAU C;  2NZO A;  4FXG C;  4OIJ A;  4R9W A;  4RCN A;  2MPM A;  4XYQ A;  1DXM A;  2PNR C;  5ISR A;  2HHH L;  2PO4 A;  1U4L A;  2CVR A;  3NUC A;  1PH2 A;  1QZG A;  4HTH A;  2Z6K A;  1BF4 A;  2E74 C;  1S72 A;  5BN4 A;  1L0X B;  1S5E D;  1EY0 A;  3BG3 A;  5M3F H;  1OXT A;  3M4O B;  5CR3 A;  3TP5 A;  1HQM C;  2JXM B;  4JYA Q;  4JK1 C;  4LF9 L;  4IJL A;  1M1K C;  1ENA A;  5IYD G;  4U67 3;  3I91 A;  5E4W C;  3UE1 A;  4DK3 C;  4QIW E;  4HSV A;  5FLM G;  1N36 L;  4MN3 A;  1PYB A;  1RF2 D;  3CW2 C;  3M85 A;  2UU9 L;  2PPB C;  2UXB Q;  2K04 A;  4RH6 A;  2V1C C;  3K0Y A;  2BDO A;  2WAC A;  1H9R A;  3CCE A;  3BS1 A;  4LK1 C;  2EY2 A;  2PQA B;  4WOR A;  5KYL A;  5CMD A;  5EKI A;  3RN5 A;  2IX1 A;  1SNP A;  2AUK A;  1VF5 C;  4ID6 A;  2QEX A;  4A3D B;  2XVS A;  3U58 A;  1GKH A;  2DY7 A;  4JI6 Q;  5G3L F;  2EYH A;  4LFA L;  2G9D A;  1NSN S;  3PCO B;  1JIC A;  4OWT B;  3SK8 A;  5BN5 A;  3DXJ C;  4HCS A;  2NVT B;  1VQ7 A;  1K8M A;  3AYH B;  4HID A;  2F0N A;  5JAV A;  4ULL A;  3GTQ B;  2AMC B;  3CCQ A;  4XIG S;  1CA6 A;  1ZYR C;  3OWF A;  5DEH A;  5KYI A;  1N32 L;  5M3M B;  4C3H B;  1K3R A;  4JI8 Q;  5BN3 A;  1Y1W B;  2KHJ A;  5KGU A;  3E0J A;  4OEM B;  1KXL A;  3OSO A;  4JI1 Q;  2F0V A;  4KKU A;  1JJG A;  4G7O C;  3VR6 A;  2YTY A;  2EIF A;  4DUY Q;  1PFM A;  1BCP B;  1IKL A;  2L9H A;  1QCB D;  5D3I B;  4XQJ A;  1YI2 A;  3NP8 A;  2JA7 B;  3HGB A;  2IWH A;  4HMJ A;  1B2T A;  3I4N H;  2Z0S A;  1NMG A;  1JJ2 A;  3CC7 A;  3E5S A;  4UP7 A;  1ESR A;  1JOK A;  1SYE A;  3PGZ A;  3J7Y W;  3T1Y L;  1EWC A;  1FD7 D;  1PA6 A;  3HOZ H;  1GUT A;  1ZEQ X;  2AUJ D;  3PIO A;  1NUC A;  1Q3L A;  1TVX A;  4F7X A;  3CCL A;  2KCT A;  1Q1B A;  2E76 C;  4PZ8 A;  1IYU A;  3K5L A;  2ZJP A;  4H44 C;  1Q7Y C;  1STB A;  3K0X A;  1WTP A;  1U4P A;  5EPJ A;  4C3J H;  1Z47 A;  4TVA B;  2K5H A;  3M7N A;  1LM0 A;  1HR0 L;  1V1O A;  3IFT A;  1GUG A;  3SR1 A;  3I2Z A;  2F0E A;  1SYF A;  3K5O A;  3FKI G;  5E1F A;  4DV1 L;  4A3E B;  1S3O A;  1B8A A;  2D9U A;  4OX9 Q;  2R7Z B;  1E2W A;  3TP7 A;  1NBW A;  3H94 A;  1CZG A;  4PQX A;  5JJI A;  2QDB A;  5AJ3 L;  4R8N A;  4QF4 A;  1K28 A;  2UUA Q;  2ASB A;  1GD7 A;  5JPN C;  5KNC A;  2AWN A;  4CDE C;  4JOI C;  4HIK A;  1XX8 A;  1VQP A;  2PCF B;  3NSW A;  4PMB A;  2UXD L;  1CZW A;  4LMQ D;  4EQP A;  1VMC A;  3O13 A;  3BU2 A;  4DV0 Q;  2M9V A;  4BBR H;  1LTT D;  1W3S A;  5ELB A;  3ZJY C;  1EFI D;  4CKB A;  3HS0 C;  1EZ8 A;  3R2T A;  2FHT A;  3NXW A;  3HOX H;  4DV3 L;  5C4X G;  2M00 A;  1D5Z C;  2XWB B;  2HCC A;  1SE2 A;  1VDZ A;  1NTG A;  4DV7 L;  4J1M A;  3H3V I;  2EYP A;  3G7L A;  1XMO Q;  1M4V A;  2G9H D;  1HNZ L;  2VQE L;  3W3A A;  1A6X A;  4L5Q A;  2EYO A;  1M8A A;  4KJO A;  3T56 B;  2ZM6 L;  4WJ3 M;  1IXR A;  1ONL A;  4L63 B;  4A3I G;  4HJ9 A;  5GAG C;  1PFB A;  1YHQ A;  2RDH A;  3I7F A;  2F0M A;  3TS2 A;  2X6G A;  2JA8 H;  2VUM G;  1CUK A;  1LT3 D;  2EXZ A;  3N6R A;  2E5L Q;  1CFM A;  5L37 A;  2HD3 A;  2MO0 A;  3G48 A;  1F9R A;  3HOW B;  4ILW A;  1CK1 A;  1G6Z A;  3TME A;  3X3M A;  1JC7 A;  1LYL A;  5T1I A;  1H9M A;  1IL8 A;  3GO5 A;  2K5N A;  5DLQ E;  2YTV A;  5IE8 A;  1EQT A;  5EBC A;  1DOL A;  1HZ9 A;  5ELE A;  3VR4 A;  3AEV A;  4NP5 A;  3S1N B;  4POF A;  1KLG D;  4LF8 L;  4LNQ A;  4WRD A;  2HDL A;  2EPB A;  2XWJ B;  5CV6 A;  4JI4 Q;  3M3Y H;  2E2J B;  3LX0 A;  4A3J B;  5FJ8 H;  1G2S A;  3D3R A;  4DXF A;  3FKI B;  2K01 A;  4YWL A;  1NJI C;  1YHA A;  3ERS X;  1I94 Q;  2CCZ A;  2EYM A;  2Q8T A;  4BXX H;  2C5C A;  3CMA A;  2XIW A;  1FVI A;  1DOK A;  2MO1 A;  2SNS A;  1KAB A;  1C7Y A;  3OIP A;  1PTO C;  2F0F A;  4G57 A;  4DFA A;  1GVP A;  4JI0 Q;  3J80 L;  5CYU A;  2O5I C;  3NBI A;  4P73 A;  3GTL B;  2QCP X;  4KI0 A;  3A8J E;  3W2D A;  4GS3 A;  1DD2 A;  4H13 C;  3LNN A;  3UE0 A;  4B3R L;  2CWA A;  4DN4 M;  1MHW C;  4B3M L;  4ZUI A;  3CKI B;  3GP7 A;  2R7F A;  2VQF L;  5E3F A;  4KN4 C;  1HTP A;  4GN3 B;  1QIL A;  4LF5 L;  3TRZ A;  1AFP A;  3DHQ A;  3TBI B;  1A2U A;  5K36 G;  5I9O A;  1SRO A;  1TS5 A;  2EJF C;  4BY7 G;  1MSG A;  1J8I A;  3P20 A;  1PV4 A;  5IOC A;  4MTN A;  5C4X B;  4A93 G;  1EOT A;  1FYC A;  4YIJ A;  2MNA A;  3A54 A;  1JT8 A;  5IT9 c;  3F8T A;  1RTO A;  3I4L A;  1O7Z A;  1RDP D;  2QEJ C;  3I4M B;  2KEE A;  2A6H D;  5C44 G;  2OF1 A;  3ONA B;  5C3W A;  4Z9C B;  5DAU A;  4LW1 A;  1QUQ A;  2RDF A;  1SRU A;  3J81 j;  1G6P A;  5CBE E;  1T9H A;  2DUD A;  4KMU C;  3KLW A;  2IX0 A;  2NBF A;  5TSS A;  4XQQ A;  2RDG A;  3RUZ A;  1P16 A;  4GNX A;  3R3O A;  2BCO A;  4C2M B;  1U5K A;  1BR9 A;  5A2Q L;  2A1A A;  1M90 C;  4IFD I;  1IBL Q;  3U4Z A;  3J81 c;  1TWG H;  5C4J H;  4X65 L;  2QGQ A;  3J81 E;  2WKD A;  2UUC L;  1PTO B;  2F4I A;  3AB9 A;  3NK9 A;  1SLJ A;  4OON A;  1TXY A;  2MGS A;  2L55 A;  3A7A B;  1Q1E A;  1CKN A;  1Q8I A;  1WOC A;  3VR2 A;  1EQQ A;  1KIX A;  3GTK H;  4DR2 Q;  3H0G G;  4DK1 A;  2KED A;  1I4X A;  1LAB A;  3C2P A;  4IO9 A;  1PH9 A;  4GKK L;  4MZ9 A;  4DNR B;  1PMR A;  3QG1 A;  1VQ9 A;  1H9S B;  3BYT B;  2EJG C;  2PW7 A;  1IZ6 A;  1TQO A;  1K8G A;  2F3W A;  3JAM c;  1J5E Q;  1RHP A;  3WOE A;  4LF5 Q;  1Y1V H;  2ENB A;  4IQZ A;  2NVY H;  3JAM E;  1AN8 A;  3PUW A;  2E2H H;  1I6H B;  1RKN A;  2JQO A;  3SXH A;  2B2T A;  1Z7T A;  3MZ5 A;  4BY7 B;  5D3D A;  1FR3 A;  3GTP H;  1TY0 A;  1W6K A;  3NQI A;  2KOL A;  4A93 B;  4QIW B;  1UE7 A;  3KF8 B;  1STG A;  3Q0A A;  1FJG Q;  1EWI A;  4A76 A;  2R93 B;  1KHI A;  3MFY A;  4B08 A;  4H02 A;  2F0U A;  3CF5 A;  1JJC B;  2GN5 A;  1FNU A;  4DKA C;  2F0G A;  3CCV A;  1HHV A;  2DJF C;  1TR5 A;  4IFD J;  4DF7 A;  1NR2 A;  4DR7 Q;  4XT1 B;  5FO9 B;  2PMZ B;  2A69 D;  2L4N A;  3BDC A;  1YNJ D;  3CCM A;  4B3T Q;  1EEI D;  4A3B H;  1QOH A;  3I4N G;  3MXP A;  1I50 H;  1SFO H;  5FLX L;  4BBS H;  3DEO A;  3OIQ A;  3G6J B;  1VQB A;  2B63 H;  5JJK A;  2Q8R E;  1NE3 A;  2D5D A;  2WIN B;  3AMU A;  1E2Z A;  1TWH H;  5HUR A;  3HOZ G;  4FVM A;  3S14 H;  2NB0 A;  1EIY B;  4APV A;  1GXD C;  3HRZ C;  2ZXR A;  3ER0 A;  1JWU D;  1NR4 A;  3EQL C;  1JOR A;  3KDF A;  4RGO S;  1EUJ A;  1PRT D;  2A68 D;  4C3J G;  1HH2 P;  2MHV A;  4RGN A;  4BS9 A;  5M3F B;  4E6I A;  5D14 A;  1TS3 A;  1E24 A;  3MXN B;  2EQS A;  1V9P A;  4ZK9 B;  2HQE A;  4L5T A;  1GJX A;  2QF7 A;  4JV5 Q;  1GUW A;  2R61 A;  3UDG A;  4X3U A;  3D8G A;  2GVA A;  2MP1 A;  4HIO A;  2KJX A;  3MXU A;  2ICI A;  1TY2 A;  2J0T D;  2WB1 E;  4IUT A;  4YY3 Q;  3STB D;  3HG9 A;  1STY A;  3M4P A;  4HJ8 A;  2A6E D;  1L1O A;  4UP8 A;  3I73 A;  2I0Q A;  2NVQ H;  1CM9 A;  2LKV A;  1HZB A;  2B2W A;  5KND A;  1D5M C;  3Q22 A;  4QCL A;  2F0H A;  5IGG A;  3ND8 A;  2B2U A;  3VYS A;  4B3S L;  3HOU B;  4HSP A;  4BBR G;  3BVG A;  5GAE C;  1K0S A;  4HR7 B;  4LJZ C;  1X6O A;  2VY3 A;  1DZ1 A;  1V8Q A;  1EOV A;  4KJN A;  2E2D C;  2O4X A;  4LFB Q;  4DR1 L;  3MEH A;  4LFC L;  1B3Q A;  3NPP A;  3HOX G;  2Z9H A;  3A5U A;  1WVL A;  3GTO H;  4NMZ A;  1NNX A;  2WAQ E;  4HCE A;  4R8I A;  3K81 C;  3OTO Q;  2K75 A;  4P2C B;  1Q81 C;  2B2V C;  3F1Z A;  3VYT A;  4DAY A;  4JI5 L;  2ZTC A;  5GAH C;  4QUC A;  2K6A A;  3HFZ B;  1BDO A;  1SMY D;  5FK9 C;  2JA8 G;  4NPS A;  1A3T A;  4GKJ L;  3I4N B;  4ZQ3 A;  4IPG A;  5IWA Q;  3P7J A;  1XNR L;  2EY1 A;  4NDX A;  1L2F A;  4CDF C;  3N52 A;  5LMN Q;  4P72 A;  3KLS X;  2DNE A;  3TQY A;  3BDO A;  1HNX Q;  5IP9 H;  3KJO A;  4O1N A;  2ZJQ A;  4QJF A;  2YYZ A;  2UXC L;  2B2Y A;  1X3P A;  4F88 A;  1R4P B;  3MEF A;  4Y52 H;  5C44 H;  4C3J B;  3PF5 A;  3I8Z A;  2A74 C;  3WOF A;  4JI3 Q;  5HGQ A;  4XTC S;  2K5W A;  4YHH Q;  1XYI A;  4JI7 L;  1VQ8 A;  1WTO A;  1EYC A;  1SYG A;  2NN6 I;  2ES2 A;  5M5W H;  3OWE B;  3EBE A;  3HOV B;  3NTH A;  1SNM A;  2A19 A;  3J7Z C;  3LWE A;  4R4Q A;  1EFW A;  5ELN A;  2XRS D;  4BXX G;  1W2B A;  1WTQ A;  1KQS A;  1SMX A;  4JBW A;  4UHV A;  1XMQ Q;  3NE5 B;  2MFI A;  2C35 B;  1ASZ A;  3FHW A;  4R4O A; 
#chains in the Genus database with same CATH homology
 5EKK A;  1LT5 D;  4BBR B;  1GHK A;  4C56 C;  3I90 A;  5FO8 B;  3K5N A;  1CI3 M;  3MA2 B;  4PNY A;  3V96 A;  3PUY A;  4PV1 C;  3GV3 A;  4KKS A;  4ZAI A;  2LS0 1;  5EKL A;  4FYD A;  1SXT A;  3R93 A;  2DY8 A;  4ABN A;  1HCZ A;  1HFG A;  1SE3 A;  1D6E C;  2D62 A;  3IFD A;  1GUS A;  2BE5 C;  3R2I A;  3RLF A;  3MAQ A;  2K1B A;  4XXE A;  2RA4 A;  1STH A;  3D4R A;  3KBG A;  3GTJ B;  3GD7 A;  3VYU A;  5C0X J;  4N9T A;  1F2M A;  3FMC A;  3L9A X;  5LHY 1;  3M3Y B;  1VF7 A;  3TZU A;  4HAE A;  3DM1 A;  1C4Q A;  1ENC A;  3PUZ A;  1EY4 A;  1K8O A;  1T5X D;  1AEX A;  4EQO A;  5IGE A;  4PMC A;  2RVL A;  2F0P A;  3IKJ A;  3NWT A;  3MHB A;  3IAY A;  1B44 D;  4DAV A;  3C1E A;  4C1N I;  4K5X A;  5J22 A;  1SND A;  2AQ2 B;  1LTI D;  2F3V A;  4HMI A;  4DNT B;  3FRP B;  3KLR A;  3DWQ A;  1KTK A;  5D65 A;  2OT2 A;  5M9O A;  2BA1 A;  3D4D A;  3EJI A;  1FGB D;  5LL6 S;  5C6A A;  2QKI C;  1EY5 A;  1RJT A;  1E0B A;  3EA6 A;  3D6W A;  1BCP F;  2BA0 A;  1KDB A;  1O7L A;  2JEB I;  1WTW A;  5J39 A;  2SDF A;  5FO7 B;  2K5D A;  1Q90 A;  4B9X A;  4FO2 A;  2F03 A;  2EZV A;  4IAL A;  1TWG B;  4CJ0 B;  5C4J B;  5I2Y A;  1IYV A;  2EJM A;  1AP0 A;  2K7V A;  1DCZ A;  1R9T B;  4EGV A;  1PZJ D;  2SOB A;  3P1H A;  3QWN A;  1MBY A;  3RZD B;  4L8J A;  4K2K A;  2ZT9 C;  3I72 A;  4OL7 A;  4H0L C;  1L0Y B;  5CV4 A;  1BO0 A;  3CRL C;  3ERO A;  1O7Y A;  3GTK B;  3SEB A;  1IKM A;  4CKE A;  3F2U A;  4KN7 C;  4KY7 A;  3MWY W;  4KHV A;  4K8J A;  4NKL A;  1OO9 B;  2D2C C;  1V1P B;  5ELC A;  3IL8 A;  5IGD A;  5IIF A;  5C4Z A;  5IT9 L;  4TKO B;  4RA8 A;  1Y1V B;  2A6H C;  2EY6 A;  2NVY B;  1JOQ A;  2E2H B;  1B3A A;  4RGM A;  4DXG A;  5JPM C;  1II3 A;  3GTP B;  3SE0 A;  4PMW A;  5J1Z A;  2CQA A;  3CRK C;  1EYA A;  1UEA B;  4G7H C;  2FFK B;  2WB1 B;  4G7Z C;  1I4H A;  1OXS C;  4KY5 A;  4TQU S;  3J81 L;  1RTN A;  1I50 B;  2IT1 A;  1SFO B;  2F0S A;  2Z4I A;  4BBS B;  1HUN A;  3T53 B;  4IN3 A;  3BDL A;  1SEB D;  3MTS A;  3T16 A;  1TWH B;  3A8K E;  4RCO A;  1HFN A;  1J9O A;  4DK0 A;  4ZKC B;  2B8G A;  1MSH A;  5DNF A;  4A3I B;  4RHS A;  2LFN A;  3TP6 A;  3L7Z C;  2WAQ B;  2RSO A;  2TMP A;  4FP5 D;  2VB3 X;  1EU4 A;  2VUM B;  1TWA B;  2NN6 G;  1PZK D;  2AQ1 B;  5AFW A;  3SK4 A;  1RD9 D;  2KHS A;  3C46 A;  1BQQ T;  4I7Z C;  3SDZ A;  1HXY D;  4OO1 I;  1A2T A;  1CHQ D;  4IFD H;  2WP8 J;  2NVQ B;  4OO1 H;  5JEA H;  2H1E A;  4RKB A;  1LTA D;  3BZD B;  1SDF A;  2K03 A;  2Z1C A;  2C9O A;  1F9P A;  3SVM A;  1EL0 A;  2XNA C;  4C3I G;  2KA7 A;  2FJ2 A;  2FMM A;  4DA2 A;  1JE4 A;  3QB3 A;  5LL6 X;  3HEJ A;  4Q0F A;  1PFN A;  2A69 C;  2J7Z A;  5HGT A;  1YNJ C;  3GTO B;  4FF4 A;  1NCV A;  2MUY A;  4V19 0;  4EQN A;  1UNS A;  4QB4 A;  5I6Y A;  3KUP A;  1PDQ A;  2CHB D;  5NUC A;  3J7A V;  3CHB D;  1LV9 A;  2FIN B;  5T1G A;  1PRT C;  2A68 C;  1SYD A;  2K32 A;  5JJZ A;  3RD4 A;  1SNO A;  3VA5 A;  3Q24 A;  1STE A;  3Q23 A;  2B39 A;  4OHJ A;  2Y0S B;  2AQ3 B;  1YNN D;  5JVH 3;  2K5Q A;  1H9K A;  1D5X C;  2KEC A;  5A2Q E;  4IUU A;  1ET6 A;  5C44 B;  3U9O A;  5F2D A;  2SEB D;  1B50 A;  1ILP A;  1I4G A;  5M5W B;  2V4D A;  2MJ8 A;  1PTO F;  3TDQ A;  3U9S A;  3EFX D;  2DN8 A;  1I3Q B;  5CC4 A;  1SYB A;  4TSS A;  5IGB A;  3AU7 A;  2F0L A;  3OMC A;  1HA5 A;  2ZXO A;  2F1M A;  1W6J A;  3MVV A;  1QB5 D;  2L5T A;  1JWS D;  4C1N K;  3VYR A;  4GZY C;  1HUM A;  1ML0 D;  5CV5 A;  3ZYY X;  4C3I B;  3X3N A;  1EWH A;  2M2L A;  1SMY C;  1LLR D;  4IUQ A;  1JR0 D;  2X69 A;  3GTG B;  3H0G B;  4CJ2 C;  5CV7 A;  2EYL A;  1F2Y A;  1SNC A;  1S5C D;  1JCK B;  5KIX A;  1PLF A;  5DM7 3;  2NTS A;  1U4M A;  1HQR D;  4RGT A;  1SBB B;  5FLX E;  2CW0 D;  1F9Q A;  1NAP A;  3FPU B;  3TZD A;  4A3M B;  1JWM D;  5JVG 3;  4V0B A;  2EDG A;  1TII D;  4HED A;  4A3F B;  1BOS A;  1BXT A;  1MD2 D;  5A35 A;  2PYK A;  1RCV D;  1I6V C;  5G3L D;  1G29 1;  4K8I A;  1EEF D;  4Q5V A;  2E2I B;  3CU7 A;  1WD1 A;  2RBM A;  4K14 A;  3H3V C;  1F2Z A;  1IW7 D;  2HDM A;  3HOZ B;  1LTS D;  2F0W A;  1TWF B;  1ICW A;  4H7B A;  4AYB B;  1D2B A;  2KCC A;  3D6C A;  5KNB A;  3PMF A;  3DEP A;  4C3H G;  1F9S A;  1H9S A;  2KCN A;  1B9N A;  2EOT A;  2RQX A;  4FF3 A;  2PW5 A;  1G91 A;  4ZYS A;  1B4O A;  2F0J A;  2NN6 H;  4MIU A;  1LO5 D;  1HRJ A;  1HPC A;  3MC0 B;  2JSO A;  1O80 A;  5C0X I;  5I2X A;  1VMP A;  2L0C A;  1QNU A;  5EGT A;  5C0X H;  3KF8 A;  1DJR D;  2Z4H A;  1Q12 A;  1JOO A;  2KUM A;  1R4Q B;  4IUN A;  2DNC A;  1I4Q A;  3HOX B;  4KK7 A;  4K2L A;  2IL8 A;  5IGF A;  2WII B;  4K6D A;  4DAP A;  1QG7 A;  4EVO A;  3S15 B;  1JB3 A;  2O5J C;  1CQF A;  1PZI D;  4ZLT F;  2IX3 A;  4ME5 A;  3NTK A;  2AWO A;  5KRU A;  4Y7N B;  1WTR A;  1WCM B;  3MXN A;  2JA8 B;  1ET9 A;  3QOJ A;  1BCP D;  3D31 A;  1SJE D;  3A8I E;  1B1Z A;  3GTM B;  3S1R B;  4K5W A;  1S5D D;  1AZQ A;  4IFD G;  4G4K A;  4OO1 G;  5JEA G;  1CTM A;  1UAP A;  1B9M A;  3H09 A;  3A7L A;  4RFB A;  2BOS A;  1OXX K;  3OW7 A;  1QJO A;  4N9P A;  5ELD A;  4XDX A;  5M5X B;  3KK7 A;  1SJH D;  5C3X A;  2L1B A;  3NWS A;  4FF2 A;  3V2T A;  2IJ0 A;  5JOB A;  3L3O C;  2OXP A;  3DMU A;  5EJW A;  4RKL A;  4X3T A;  2R6G A;  1O78 A;  2B8F A;  2NWG A;  3UI2 A;  3HP3 A;  4TRD A;  2JYO A;  1SNQ A;  2PZT A;  3CQZ B;  5COR A;  2BE5 D;  4U68 A;  1KDC A;  1ZYR D;  1V43 A;  2B2T C;  1FNW A;  1U9R A;  1HA6 A;  5C4H A;  2N88 A;  2F0K A;  2LY7 A;  5C5M A;  1QE6 A;  1OXV A;  1S5B D;  1EY7 A;  5M5Y B;  1TKW B;  1GUN A;  5ELF A;  4M1U B;  3ITP A;  1T5E A;  4I65 A;  4ZRZ A;  3DWA A;  1D1K A;  2F0D A;  4BA1 I;  1KDA A;  2X6L A;  2NUC A;  3QJY A;  3Q6S A;  4XT3 B;  2JE6 I;  4XYO A;  1KNA A;  5I6W A;  4FNF A;  1EYD A;  1CQV A;  5CV8 A;  4IUR A;  2A73 B;  4WJW A;  3WDN A;  1XTC D;  3PUV A;  2L12 A;  2ICE C;  2E75 C;  1E2V A;  4BY1 B;  2F0O A;  1GUO A;  4O42 A;  2B2V A;  4KKT A;  4ODG A;  5IOD A;  1AW7 A;  2NZ1 D;  4KY6 A;  3A55 A;  2R3Z A;  4S3S A;  3GV6 A;  1WD0 A;  1KAA A;  2XRQ D;  1GHJ A;  3OPO A;  5E4X A;  2B2W C;  1EQV A;  4B9W A;  1G2T A;  2B2U C;  3HOY B;  3HKZ B;  2BDN A;  3M4Y A;  4F8M A;  4NW2 A;  2QIL A;  3K7A B;  3S1M B;  1PXU A;  4QMG A;  4OIK A;  2WKC A;  1BUV T;  1TS2 A;  1MGS A;  1OXU A;  3TSS A;  3OOC A;  4ZUJ A;  3DWP A;  5FOB B;  2EY5 A;  2J4X A;  4J6H A;  2JA5 B;  1VCI A;  3I70 A;  1CT1 D;  1GOZ A;  5EPL A;  5I4D A;  2IPK D;  4A3B B;  3DUZ A;  3QIA A;  3T13 A;  3URY A;  2B63 B;  3OMG A;  4DU9 A;  1CA5 A;  3S17 B;  3KLS A;  3PUX A;  3S14 B;  4HN7 A;  5EBD A;  2EE1 A;  3TP8 A;  2B2Y C;  2VXW A;  3M7G A;  2GA4 B;  2IW3 A;  1LAC A;  1XWE A;  5K5P A;  3GQB A;  3S9W A;  5IT9 E;  3PIO 3;  2K05 A;  2VB2 X;  4L6T B;  3SK5 A;  3JAM L;  4K6L A;  1STA A;  5C0X G;  1A3V A;  4FXK C;  1PTO D;  4BA2 I;  3ERQ A;  4OGQ C;  5CV9 A;  5IGC A;  4KTA A;  1Z6H A;  3J80 E;  4UAI A;  4KV6 A;  3D4W A;  1DON A;  2JA6 B;  1BBX C;  3RMH A;  3T4A C;  4FXD A;  2TSS A;  1YNN C;  1C8C A;  3P75 A;  3T51 B;  3K59 A;  4F87 A;  3MXG A;  2F0T A;  2I46 A;  2HCI A;  3K58 A;  2Z8L A;  3V05 A;  3FEW X;  3VR3 A;  1F77 A;  3VA7 A;  2R92 B;  4CGY B;  5FKA C;  3NTI A;  1AZP A;  1QNK A;  1LTB D;  1QWY A;  5C5L A;  1Y8N B;  5COY A;  1X3Q A;  3LWU A;  1I4P A;  2RSN A;  2ID0 A;  4KD3 A;  3BVZ A;  1X32 A;  3PV0 A;  3FDT A;  2XSC A;  3QOL A;  1EZ6 A;  1SE4 A;  3J7A F;  3A56 A;  1SAP A;  2A6E C;  2KVM A;  1I4R A;  1V1P A;  2F0Q A;  3QO2 A;  4M8A A;  2Q8I B;  5EPK A;  4WFN 3;  1TWC B;  4QUF A;  2JEA I;  1WTV A;  1EY8 A;  3R8B A;  1TT2 A;  4BWG B;  3ND9 A;  1B53 A;  2FMC A;  1BNZ A;  3K6O A;  1ENF A;  5EQ0 A;  3K57 A;  3MFG A;  1DYQ A;  5JEA J;  4XQN A;  4X3S A;  3KBX A;  3S16 B;  3I3C A;  1SYC A;  4LAA A;  3HZX A;  4FF1 A;  1F2L A;  3PIP 3;  2JP1 A;  2SNM A;  2CW0 C;  5DM6 3;  1EY6 A;  3SK6 A;  1S4Z A;  2L11 A;  1EY9 A;  3OHX C;  1HTL D;  3PO3 B;  4IZ8 A;  1H9J A;  1LT6 D;  2NVX B;  1EIG A;  2PQE A;  3VR5 A;  1PRT B;  3E6Z X;  2WV6 D;  5CBA E;  5KEE A;  2ZXP A;  2NTT A;  1IW7 C;  1D1I A;  4ZKB B;  3BYY B;  1A3U A;  3FPP A;  2K33 A;  4UDU C;  4MHE A;  2N55 A;  4DGZ A;  1Y8O B;  2H4O A;  3H6M A;  2EVB A;  2EYF A;  3C1F A;  3PO2 B;  4J8Q A;  4RHR A;  3TN2 A;  2HUG A;  1WTX A;  1ILQ A;  1PTO H;  1MI2 A;  1KLU D;  1IHZ A;  4CHT B;  3S1Q B;  1LT4 D;  1SSO A;  3S2D B;  4RWS C;  1ROD A;  1STN A;  1DM0 B;  3H91 A;  3K5M A;  1EIH A;  1XXG A;  3S2H B;  1DOM A;  4K5V A;  2F0I A;  3NHH A;  1C48 A;  4CKC A;  4KHZ A;  1TS4 A;  2VNU D;  1EU3 A;  2PZU A;  3C3L A;  1CHP D;  1U4R A;  1A15 A;  1TU2 B;  2A5H A;  2RKS A;  4CJ1 B;  2OEO A;  4KD4 A;  2YU9 B;  1Y8P B;  5I9P A;  2O2L D;  1FNV A;  5K36 H;  3FVQ A;  3NQT A;  1LTR D;  4IUV A;  2I07 B;  1UUP A;  2K28 A;  1PRT F;  2KQ3 A;  4X3K A;  1S5F D;  3SHL A;  1G8Z D;  1K83 B;  2NYZ D;  4A3G B;  2LMC B;  1ZXT A;  1Y69 U;  2XN9 C;  3NBH A;  1JQY D;  1KNE A;  1PYW D;  1LTG D;  4CBV A;  3BVM A;  1ESF A;  1ZKO A;  4IUP A;  5CGK A;  1BCP C;  2EYJ A;  4A3K B;  3RZO B;  5C3E B;  2PZW A;  3EVQ A;  4RAU C;  4FXG C;  4OIJ A;  4R9W A;  4RCN A;  2MPM A;  4XYQ A;  1DXM A;  2PNR C;  5ISR A;  2PO4 A;  1U4L A;  2CVR A;  3NUC A;  4HTH A;  1BF4 A;  2E74 C;  5BN4 A;  1L0X B;  1S5E D;  1EY0 A;  3BG3 A;  1OXT A;  3M4O B;  5CR3 A;  3TP5 A;  1HQM C;  2JXM B;  4JK1 C;  1ENA A;  4U67 3;  3I91 A;  5E4W C;  4HSV A;  4MN3 A;  1RF2 D;  3M85 A;  2PPB C;  2K04 A;  4RH6 A;  3K0Y A;  2BDO A;  2WAC A;  1H9R A;  3BS1 A;  4LK1 C;  2EY2 A;  4WOR A;  5KYL A;  5CMD A;  5EKI A;  2IX1 A;  1SNP A;  2AUK A;  1VF5 C;  4ID6 A;  4A3D B;  2XVS A;  2DY7 A;  5G3L F;  2EYH A;  2G9D A;  1NSN S;  1JIC A;  3SK8 A;  5BN5 A;  3DXJ C;  4HCS A;  2NVT B;  1K8M A;  2F0N A;  5JAV A;  4ULL A;  3GTQ B;  4XIG S;  1CA6 A;  1ZYR C;  3OWF A;  5DEH A;  5KYI A;  5M3M B;  4C3H B;  5BN3 A;  1Y1W B;  5KGU A;  3E0J A;  3OSO A;  2F0V A;  4KKU A;  4G7O C;  3VR6 A;  1PFM A;  1BCP B;  1IKL A;  2L9H A;  1QCB D;  5D3I B;  4XQJ A;  3NP8 A;  2JA7 B;  3HGB A;  2IWH A;  4HMJ A;  1B2T A;  3E5S A;  1ESR A;  1JOK A;  1SYE A;  3J7Y W;  1EWC A;  1FD7 D;  1GUT A;  1ZEQ X;  2AUJ D;  1NUC A;  1Q3L A;  1TVX A;  4F7X A;  1Q1B A;  2E76 C;  1IYU A;  3K5L A;  4H44 C;  1STB A;  1WTP A;  1U4P A;  5EPJ A;  1Z47 A;  3M7N A;  1V1O A;  3IFT A;  1GUG A;  3SR1 A;  2F0E A;  1SYF A;  3K5O A;  5E1F A;  4A3E B;  2D9U A;  2R7Z B;  1E2W A;  3TP7 A;  3H94 A;  1CZG A;  4PQX A;  2QDB A;  4R8N A;  4QF4 A;  5JPN C;  5KNC A;  2AWN A;  1XX8 A;  2PCF B;  3NSW A;  4PMB A;  1CZW A;  4LMQ D;  4EQP A;  1VMC A;  3O13 A;  2M9V A;  1LTT D;  5ELB A;  1EFI D;  4CKB A;  3HS0 C;  1EZ8 A;  3R2T A;  2FHT A;  3NXW A;  2M00 A;  1D5Z C;  2XWB B;  2HCC A;  1SE2 A;  1VDZ A;  4J1M A;  2EYP A;  3G7L A;  1M4V A;  2G9H D;  3W3A A;  1A6X A;  2EYO A;  1M8A A;  4KJO A;  3T56 B;  1ONL A;  4L63 B;  1PFB A;  2RDH A;  2F0M A;  2X6G A;  3N6R A;  1LT3 D;  2EXZ A;  1CFM A;  1F9R A;  3HOW B;  4ILW A;  1CK1 A;  1G6Z A;  3TME A;  3X3M A;  1JC7 A;  5T1I A;  1H9M A;  1IL8 A;  3GO5 A;  1EQT A;  5EBC A;  1DOL A;  5ELE A;  3VR4 A;  4NP5 A;  3S1N B;  1KLG D;  4WRD A;  2HDL A;  2EPB A;  2XWJ B;  5CV6 A;  2E2J B;  3LX0 A;  4A3J B;  1G2S A;  3D3R A;  4DXF A;  3FKI B;  2K01 A;  2EYM A;  2Q8T A;  2C5C A;  2XIW A;  1DOK A;  2SNS A;  1KAB A;  3OIP A;  1PTO C;  2F0F A;  4G57 A;  4DFA A;  3GTL B;  2O5I C;  3J80 L;  5CYU A;  3NBI A;  2QCP X;  4KI0 A;  3A8J E;  3W2D A;  1DD2 A;  4H13 C;  3LNN A;  4DN4 M;  4ZUI A;  3CKI B;  3GP7 A;  5E3F A;  4KN4 C;  1HTP A;  1QIL A;  1AFP A;  3DHQ A;  3TBI B;  1A2U A;  5K36 G;  5I9O A;  1TS5 A;  2EJF C;  1MSG A;  1J8I A;  3P20 A;  5IOC A;  5C4X B;  1EOT A;  1FYC A;  4YIJ A;  3A54 A;  1RTO A;  3I4L A;  1O7Z A;  1RDP D;  2QEJ C;  3I4M B;  2KEE A;  2A6H D;  2OF1 A;  3ONA B;  5C3W A;  4Z9C B;  5DAU A;  2RDF A;  5CBE E;  4KMU C;  2IX0 A;  2NBF A;  5TSS A;  4XQQ A;  2RDG A;  3RUZ A;  3R3O A;  2BCO A;  4C2M B;  1BR9 A;  5A2Q L;  4IFD I;  3J81 E;  2WKD A;  1PTO B;  2F4I A;  3AB9 A;  3NK9 A;  2MGS A;  2L55 A;  3A7A B;  1Q1E A;  1Q8I A;  3VR2 A;  4DK1 A;  2KED A;  1I4X A;  1LAB A;  3C2P A;  4DNR B;  1PMR A;  3QG1 A;  1H9S B;  3BYT B;  2EJG C;  2PW7 A;  1TQO A;  2F3W A;  1RHP A;  3WOE A;  2ENB A;  4IQZ A;  3JAM E;  1AN8 A;  3PUW A;  1I6H B;  1RKN A;  3SXH A;  2B2T A;  1Z7T A;  3MZ5 A;  4BY7 B;  5D3D A;  1FR3 A;  1TY0 A;  1W6K A;  3NQI A;  2KOL A;  4A93 B;  4QIW B;  1STG A;  3Q0A A;  2R93 B;  3MFY A;  4B08 A;  2F0U A;  1FNU A;  2F0G A;  1HHV A;  1TR5 A;  4IFD J;  4DF7 A;  1NR2 A;  4XT1 B;  5FO9 B;  2PMZ B;  2A69 D;  2L4N A;  3BDC A;  1YNJ D;  1EEI D;  1QOH A;  3MXP A;  5FLX L;  3DEO A;  3OIQ A;  3G6J B;  2Q8R E;  2D5D A;  2WIN B;  3AMU A;  1E2Z A;  5HUR A;  4FVM A;  2NB0 A;  1GXD C;  3HRZ C;  2ZXR A;  1JWU D;  1NR4 A;  3EQL C;  1JOR A;  4RGO S;  1PRT D;  2A68 D;  4C3J G;  2MHV A;  4RGN A;  4BS9 A;  5M3F B;  4E6I A;  5D14 A;  1TS3 A;  4ZK9 B;  2HQE A;  1GJX A;  2QF7 A;  1GUW A;  2R61 A;  4X3U A;  3D8G A;  2MP1 A;  2KJX A;  3MXU A;  2ICI A;  1TY2 A;  2J0T D;  4IUT A;  3HG9 A;  1STY A;  2A6E D;  3I73 A;  1CM9 A;  2LKV A;  2B2W A;  5KND A;  1D5M C;  3Q22 A;  4QCL A;  2F0H A;  5IGG A;  3ND8 A;  2B2U A;  3VYS A;  3HOU B;  4HSP A;  3BVG A;  4HR7 B;  4LJZ C;  1DZ1 A;  1V8Q A;  4KJN A;  2E2D C;  2O4X A;  3MEH A;  3NPP A;  1WVL A;  4NMZ A;  4HCE A;  4R8I A;  4P2C B;  2B2V C;  3VYT A;  4DAY A;  4QUC A;  2K6A A;  1BDO A;  1SMY D;  5FK9 C;  1A3T A;  3I4N B;  4ZQ3 A;  3P7J A;  2EY1 A;  4NDX A;  3N52 A;  3KLS X;  2DNE A;  3BDO A;  4O1N A;  2YYZ A;  2B2Y A;  1X3P A;  4F88 A;  1R4P B;  4C3J B;  3I8Z A;  2A74 C;  3WOF A;  4XTC S;  2K5W A;  1XYI A;  1WTO A;  1EYC A;  1SYG A;  2NN6 I;  3OWE B;  3HOV B;  3NTH A;  1SNM A;  3LWE A;  2XRS D;  1WTQ A;  4JBW A;  3NE5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...