1SNPA

Protein stability in staphylococcal nuclease
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
130
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Coupling between trans/cis proline isomerization and protein stability in staphylococcal nuclease.
pubmed rcsb
total genus 36
structure length 130
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1996-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1snpA00
5DEHA 5EKKA 4ZQ3A 2EYLA 3TP7A 4KV6A 3SK4A 3NK9A 1EY0A 5C4HA 2F3WA 3V2TA 5I6WA 1STYA 4LAAA 3MZ5A 3TP6A 3HEJA 5C3XA 5JAVA 3QOLA 5IOCA 2PYKA 3E5SA 2EYMA 5M9OA 1EY4A 4KY5A 1SYDA 3D4WA 2OF1A 1SNQA 4DU9A 5C5MA 5E3FA 1SNMA 4N9PA 3T13A 2LKVA 4HTHA 4NKLA 3EROA 1JOQA 1RKNA 4KJOA 5KIXA 3VA5A 1STBA 1EYDA 2OXPA 5ISRA 3BDLA 1SYGA 2F0QA 4PMCA 5I9OA 3MXPA 3ERQA 3ITPA 2F0GA 3LX0A 1F2ZA 4G57A 5C5LA 5KYIA 4RKBA 2F0NA 3NP8A 5I6YA 2EYJA 1F2MA 2PQEA 1II3A 3NUCA 3BDCA 4IZ8A 5J1ZA 1SYFA 2EY6A 3MEHA 4DGZA 3SHLA 4IALA 4EQNA 4ID6A 5KEEA 5IGEA 1SYCA 2SNSA 4PMBA 5J22A 1EY8A 1STNA 4K6DA 3SK8A 3TP5A 3DHQA 3TP8A 3R3OA 4K5XA 2HQEA 1KABA 3P75A 5HGTA 5C4ZA 4EVOA 1EQVA 4KJNA 2ENBA 3S9WA 2F0IA 1TT2A 1TQOA 4KD3A 4DF7A 5KRUA 4KTAA 2F0VA 3PMFA 4B9WA 1A3VA 1KDBA 3D4DA 3D6CA 3C1EA 3DMUA 3EVQA 2F0JA 5CGKA 4WORA 1JOOA 1SNDA 4TRDA 4H7BA 4K8IA 5I9PA 2WACA 2RKSA 4J6HA 1ENAA 3OWFA 3C1FA 3NHHA 1KAAA 1EYAA 3QB3A 4R8NA 5IGCA 4ME5A 4NMZA 1SNOA 1SNPA 3QOJA 4EQOA 4J1MA 4QB4A 4KD4A 5CC4A 4K5VA 3D8GA 5CR3A 5IIFA 1KDAA 5EKLA 4E6IA 4K5WA 2RDFA 1AEXA 3T16A 2O4XA 5C3WA 1EY6A 2F0PA 3MHBA 1STGA 3OSOA 2QDBA 2F0DA 4K8JA 4PNYA 4S3SA 4ODGA 3P1HA 5JOBA 4ZUIA 3RUZA 2EY2A 4ZUJA 5KGUA 2EYFA 2EY5A 4KHVA 5CV4A 2F0TA 5CV8A 5DAUA 4F8MA 4WRDA 5IGGA 2F0HA 2EXZA 2EYHA 3SK6A 1A3UA 2SNMA 4K2KA 5CV7A 3SXHA 3TMEA 2PW5A 1U9RA 2M00A 2PZWA 3EJIA 4HMJA 5IGDA 1F2YA 1SYEA 2F0KA 1EYCA 3OMGA 2RBMA 2F0LA 4RKLA 2F0MA 5K5PA 3H6MA 3U9OA 5C6AA 5IGBA 1A2TA 1EY5A 3NQTA 1JOKA 1A3TA 1STHA 5E1FA 2F0SA 2PZUA 1A2UA 1TR5A 5NUCA 4EQPA 5IODA 1NSNS 2EYPA 4QF4A 5IGFA 3NXWA 1EY9A 2EYOA 1STAA 1NUCA 1EY7A 1SNCA 2F0OA 2KHSA 4NDXA 4NP5A 4HMIA 5CV9A 3MVVA 2SOBA 5HURA 4KY7A 3OMCA 2NUCA 4YIJA 4KY6A 4MIUA 2F0FA 4K14A 4OL7A 3SK5A 2F3VA 2F0EA 2EY1A 3HZXA 2PZTA 1JORA 4IUNA 5KYLA 3SR1A 5EGTA 4F7XA 2PW7A 4N9TA 2OEOA 1SYBA 1EZ8A 4QMGA 4K2LA 2KQ3A 5J39A 1EZ6A 4I65A 4DFAA 2F0WA 1ENCA 1KDCA 5CV6A 4B9XA 2F0UA 5F2DA 5CV5A 1IHZA
chains in the Genus database with same CATH superfamily
3MTSA 4DNRB 2F4VQ 1KNAA 1STYA 3S2HB 4KN7C 4PMWA 3UE0A 3HKSA 3RR5A 1GO3E 1LTGD 4DV5Q 1O7YA 1HNWQ 3GTPH 2PYKA 1F77A 3KBGA 1EY4A 4K0KL 1N32L 4LF9L 2OF1A 2AQ2B 4DV2L 4MN3A 2FXQA 1DM0B 4GKJL 4C3HB 1H95A 3BG3A 4LF8Q 2RHQB 1S5BD 3VA5A 5EPKA 4OGQC 1HQMC 2UXDL 1G6PA 5ELEA 5ELDA 3ERQA 5ELCA 1C9OA 3TQYA 2VNUD 3S17H 3S1NB 5AFWA 3MEHA 1C48A 4LF7L 2ALYB 1PH2A 5JPNC 5E4XA 2R7DA 3PF5A 3HG9A 1AH9A 1U5KA 5C4JB 1QNKA 2J4XA 1Y8OB 2R93B 4X3KA 3TSSA 1TY2A 3CQZH 4R9WA 4DXGA 2NYZD 4QUFA 1HPCA 4B9WA 1PTOF 4RGMA 2JSOA 1TS3A 5JJKA 1SMYD 4WJ4A 1GUOA 3UI2A 2JA6G 1I94L 1CA5A 4B3SQ 1BXTA 3AB9A 4PV1C 1LABA 1PHJA 2JA9A 4H02A 1HNZL 3NSWA 1FNUA 4JG2A 2R3ZA 4PZ7A 4KD4A 1JB7A 1FJGQ 1YJNA 3OYYA 3JAME 4LFBQ 1SAPA 3GTPB 5C3WA 2ZJRA 4KKUA 1VQOA 2JQOA 4NB3A 4UPAA 1NR4A 4NW2A 3VYUA 1J8IA 2IX0A 4YCVA 2SNMA 2PNRC 2GVAA 2BA0A 3EJIA 3PUWA 2N88A 1EUJA 5FO9B 2KEDA 4OIJA 1CK1A 2PZUA 2A68C 3QIAA 4RCOA 2VQEL 2D62A 1PFMA 4YWLA 2KCTA 2EYOA 4NDXA 4KHPQ 1Q1EA 2R92H 4B3MQ 3HS0C 3A54A 3OMCA 1KHIA 1X3QA 3VYTA 1JMCA 4OO1G 2CCZA 2N3SA 1Y1VH 4O1NA 3IRBA 4PZ6A 2L15A 2CH4W 3CQZB 5H1SE 3GTGB 1GUGA 2B3GA 5C0XG 4DAYA 2YU9H 4DR4Q 3STBD 2F3WA 3S2HH 2B2VC 1OXTA 3DUZA 4Y7NH 4A93G 4JCVE 3C3LA 5JAVA 1FGUA 1HR0W 1JJGA 3WOFA 2UUBQ 2EYMA 4CDFC 2MNAA 1NMGA 4X65L 2PPBC 2GA4B 1OO9B 3I4NH 1KLGD 1QWYA 4HSPA 3S1MB 4RGTA 1F2ZA 3Q0AA 1RDPD 3W1BA 5IP7H 2KJXA 1BKBA 5IE8A 4RCNA 1CFMA 1WYDA 2MQHA 1NR2A 5GROA 2MGSA 2PO4A 1U4LA 4K5XA 2HQEA 2NVQB 4YWMA 4OHJA 1G8ZD 3A55A 4GNXA 1I3QH 1D5XC 1P8LA 1ICWA 3NQIA 4FDBA 3UDGA 2I5MX 5I2XA 1YITA 4A3LH 4R4TA 1PV4A 4A3BB 1YNND 1ZYRD 3AFQA 1HTLD 4K8IA 5I9PA 5AJ3L 2L5TA 2UUCL 1YJ9A 1LV9A 4C3JH 4HIOA 1HA5A 4Q0FA 4UAIA 2RA4A 5CR3A 4OWTB 2RDFA 4YHHQ 1TVXA 4KMUC 2FMCA 3FHWA 4S3SA 3FDTA 1EIFA 4YCWA 2EY2A 3UDFA 1I6HH 4JI5Q 2DY7A 3S16B 2OQKA 2NWGA 2YTXA 4DR5L 2CKZB 5IGDA 1CKOA 2RBMA 3RZDH 1DOLA 3NTIA 1EQRA 2VW9A 5C44B 4DV2Q 2EVBA 4DV6L 1PZID 4RH6A 4DR7Q 4FF1A 1LLRD 2AWNA 4O2DA 1Z6HA 3DEOA 1DGSA 3S1MH 1TWCH 2E2DC 3HOXB 2AQ3B 2K5DA 1RTNA 4A3DH 1SROA 3J80E 1Q46A 2JE6I 2D9UA 2VZAA 2XVSA 2HT1A 3RN5A 2OT2A 2OTJA 5JVG3 3G4SA 4IPCA 3TN2A 4KN4C 3I72A 2VS1A 1V1QA 4X64Q 3D4WA 1VQNA 2TSSA 5E3FA 3GQBA 2QA4A 4N8X1 4IUTA 4OXPA 4FXKC 5ISRA 1IBML 4TKOB 1AW7A 5FOBB 1Y1WG 2D2CC 1FJGL 2B8GA 4A3FG 1EOTA 2EJMA 2F03A 3M9BA 3V96A 1SMXA 2CFMA 3VR3A 5GAEC 1B8AA 4UP8A 4X3UA 4IPGA 2JN4A 3HKZG 2DJGC 4XDXA 3BVZA 4MTNA 1PFSA 5M3FB 1STNA 3I3CA 1L1OA 1E1OA 3HGBA 3SEBA 4KTAA 2NB0A 1UE7A 4C3IB 3D4DA 1Q86C 3DMUA 2H5XA 4A3CH 2F3IA 3F2CA 2Q8RE 2KEEA 4ZRZA 1Z7TA 2WACA 4J6HA 2NTSA 2B2WA 5LMUL 1LTSD 4JC0A 5D3IB 1RL2A 4A3MG 1EL0A 2Z0SA 4A3GG 1BDOA 2QEJC 1M4VA 4K5WA 3AQQA 4A75A 4A3JB 1I6VC 1M8AA 2AQ1B 2K32A 2F0DA 4A76A 2HIVA 1ZEQX 1F9SA 1I6HB 2EY5A 5CBAE 1YNNC 5C44G 3I2ZA 4JI7L 4FP5D 1EFID 2NN6G 3CRLC 3TREA 3E9IA 3LWEA 1FNWA 4AQYQ 2K03A 4JI3Q 1BOSA 1HNXL 3FP9A 1VQDA 1XTDA 1SJHD 3TS0A 4JI0Q 3K59A 1FL0A 1STAA 4FVMA 2IL8A 4POGA 1B70B 2CW0C 1PH3A 4RAUC 4A3MH 2EJFC 1MD2D 1KRSA 2UUCQ 4BBSG 4FO2A 1Q3LA 2ZTDA 4YCUA 1XPRA 2B2YC 4OX9Q 2L11A 5J39A 1EZ6A 1KTKA 3D0FA 1TIID 1U4RA 2Z6KC 3G7LA 3KLSX 4GKKQ 1S4ZA 1WTXA 3AMUA 5BR8Q 5LMNL 3C46A 4JV5L 4P73A 4R4IA 1IL2A 5C3XA 3IAYA 3QOLA 5ELOA 2K7VA 2PMZB 5M9OA 2E2IH 2XSCA 1B7YB 2D0OA 5C5MA 1IBKQ 5M3FH 5HGQA 3G71A 3DM1A 1VQGA 1B3AA 1CHQD 1BUVT 1RHPA 1JWSD 1CQVA 5I9OA 1HFNA 2VL6A 4NXNL 1VQPA 5C5LA 1LT6D 3D31A 4LFCQ 2K28A 3I70A 3NP8A 2NZHA 3KFUA 3SHLA 3MA2B 3BZCA 1SE3A 3URYA 4ZKCB 3J80L 3HOYG 2ZJQA 4CBVA 4X62L 3KLRA 3F2UA 4P2CB 4JI4L 1IKMA 3BJUA 3FPUB 1VQCA 1I5FA 3J7YW 3NWTA 3A7AB 1W3SA 3IFTA 2DUDA 1D7QA 1S40A 1LUZA 4QIWB 4DR6Q 3L0OA 1CUKA 3OWFA 1EWIA 4BBRH 3CMEA 4A3IB 4H0LC 4I7ZC 3VA7A 3U58A 3L2PA 1PRTB 4XTCS 4PG3A 3D8GA 3CP0A 1R4QB 2HDMA 3H0GG 3PO2H 2EZVA 5IYDG 3P1HA 4ZUIA 1HH2P 3B6YA 5CV4A 1RJTA 2K50A 1A3UA 2G9HD 4HMJA 1U9RA 2NN6I 3I90A 4DA2A 4DK6C 2KCCA 1W6JA 1H9SB 2EYPA 3IKJA 1E0BA 1LTLA 4R4CA 3HKZE 2C35B 2UXCL 3F8TA 3ULJA 4A3EH 1RODA 2KOLA 4PQXA 3GDEA 3SK5A 2LS01 2EY1A 2QGQA 1AP0A 4L8JA 3HOUH 4A3CG 1HJPA 4CDEC 4GNXB 3QR8A 1ILPA 4C3JB 2F0WA 3CCLA 2PCFB 1O78A 1O7LA 4A3GH 1B4OA 3MWYW 3PUZA 4LUVA 2A19A 4QJFA 4A3BH 4QCLA 1K83B 2VQEQ 2J7ZA 4ZKBB 1JE5A 1JR0D 1C0AA 1HRJA 4B3ML 1XTCD 3HOZH 3PO3H 4DU9A 4JI3L 3STBC 4OO1H 2NVXB 1HZCA 1BCPC 1XMOQ 4A3EG 3H09A 1PYWD 3MXGA 2Q2UA 2MFIA 2K5HA 1CQFA 3S24A 2EYJA 5J1ZA 3CCRA 1YHQA 1RTOA 3MFYA 1ZKOA 5IGEA 1XNQQ 1SYCA 4LF5L 3CF5A 3TP5A 3TP8A 4DV4Q 4U673 2IPKD 4KJNA 1Z9FA 2QW7A 4H44C 3TZUA 1HNXQ 1X3EA 3EVQA 1JC7A 1YJWA 2B2YA 4LUOA 4TRDA 3E3XA 3KBXA 2N78A 1EYAA 4KHZA 3H0GB 2IX3A 5DM73 5IIFA 3W3AA 1IKLA 4QY7A 2BH8A 2O4XA 1N36Q 1DJRD 3PUXA 4K8JA 4DAPA 2R7FA 2BOSA 1G51A 1JT8A 1BNZA 2VXWA 2FFKB 3R93A 3AU7A 1EU4A 2LXJA 3MFGA 1C8CA 1H9JA 2ZM6Q 1WTOA 1FVIA 3HKZB 3UDXA 4JBWA 1EEID 4M8AA 3S1QH 4A3LG 5E1FA 2K14A 1VQ6A 2F0SA 4GS3A 3UDIA 1TR5A 4MNOA 4BY7H 3NELA 1DONA 2VQFQ 5IT9L 3A8IE 1AE3A 1OXVA 2F0OA 3CC4A 4UY8C 2SOBA 4C3IG 5D14A 1I4HA 1VQEA 2F3VA 1HQRD 2PW7A 2OEOA 2K4KA 2V1CC 1LO5D 4IPHA 1BBUA 4DK1A 4AYBB 4X62Q 3ULLA 3GTLH 4MTKA 2I5LX 3NK9A 2K52A 2HUGA 5I6WA 4P75A 4RFBA 4DV6Q 4DR7L 3M85A 1JWUD 3NEMA 2Y0SG 4B3RL 3KF6A 4HTHA 1Q1BA 1JOQA 3GO5A 4J8QA 1EWHA 5KIXA 1K3BC 3TEHB 2UXCQ 5KNBA 1S72A 1PMRA 1ICFB 2DN8A 2RCNA 1KXLA 3IL8A 1H9MA 3K5MA 3SGIA 2DGYA 4DV7Q 3M4OH 1KAWA 1T9HA 3QJYA 5A2QE 2HIXA 2N55A 2FINB 3J81E 1C4QA 1S5ED 5M3MG 1G6ZA 4OO1I 1TQOA 3E0JA 1GUNA 2F0JA 5HY6A 1J9OA 1QE6A 2GVBA 3O13A 4IJHA 1BCPF 3ER0A 1ENAA 5K36H 1DD2A 4BXXG 2DNCA 3GTJH 2PQAA 1WCMB 5IT9c 5CC4A 1UEAB 1BVSA 2V4DA 2M9VA 3I4MB 3H15A 2UXBQ 2D5DA 3T1YQ 4RMFA 1K9MC 1XX8A 2A68D 3PSIA 4A3IG 1J5EL 3NE5B 3TMEA 1NTGA 1XYIA 4LW1A 3I4NG 1X65A 1I4PA 1TXYA 4CJ0B 5LMUQ 1BCPB 1ET9A 2NVTB 4JI1Q 3HOWG 5IGFA 2E2JH 3DWAA 5CV9A 4KY7A 1V9PA 1MI2A 4K14A 3PO2B 3KJOA 1VF5C 1VQ8A 1A15A 1ENCA 4B9XA 4JI8Q 3K0YA 3RZOH 4JI7Q 2WAQE 3MXNB 2EQSA 2Q2HA 1PH6A 1GOZA 4LAAA 3MZ5A 4DV1Q 1PH1A 5COYA 2BE5D 1N32Q 1SJED 2AWOA 3RN2A 3Q23A 1PTOD 4DUZL 5FLMH 3K7UC 1L0XB 1T5XD 2K5NA 4QGUA 2HDLA 4KLKA 1LTBD 1OXXK 1VMCA 2R7ZG 4DR4L 1CZWA 1IW7C 4BY1B 1WTVA 2RSNA 1STBA 1K73C 3BVGA 5FK9C 5EPJA 3KF6B 3IFDA 2A8VA 2TMPA 4G7ZC 4OONA 4DKAC 2G5DA 4IZ8A 3CPWA 3KOJA 5CORA 2A6ED 3A5ZB 3FEWX 1R9TB 1PRTC 1HA6A 3RD4A 4BS9A 1EY8A 4N8FA 3DHQA 4K0KQ 2B29A 2X69A 3OTOL 4HIKA 2F0IA 2XNAC 1MSHA 1OXSC 1A3VA 3ONAB 2K5VA 1XXGA 1LTTD 2XWBB 4P74A 1VQAA 4I7AA 1WCMG 4BA1I 4XT1B 3LWUA 1AFPA 1GHKA 4R8NA 2B8FA 5IGCA 1PVOA 2VUMG 4IUUA 1NMFA 5DLQE 4V190 4DV0Q 2D0PA 3OOCA 2F0PA 2XRQD 1PTOB 1K83H 5M3FG 1Q8IA 1A8VA 2A6HC 3SVMA 5C4XB 5CV7A 1EU3A 3L7ZC 3VR4A 4RKLA 3EA6A 3H6MA 5K5PA 1GJXA 2H1EA 3N52A 3K8AA 2AKWB 4A3FH 4EQPA 3HOYH 1K8AC 3H94A 1UWVA 1SNCA 5LMNW 4PZ8A 2BH2A 2PI2A 3JAMc 1D1KA 1MKHA 5E4WC 4F7XA 4JYAQ 4QQBX 1Q90A 1KDCA 5CV6A 3GTMH 2MHVA 2JXMB 4DN4M 2E75C 3J7AF 4R4QA 2B63B 4RHSA 4KV6A 2HCCA 4QL5A 5C4HA 4G4KA 3BS1A 2JA6H 1J5EQ 4KK7A 3TP6A 4RGNA 1E2WA 1L2FA 2WKDA 1ESRA 3WWVA 1VQ4A 5IOCA 5IP9H 1N33L 4MZ9A 1CI3M 2I0QA 1GUWA 1DOKA 1VCIA 1Y8NB 1NY4A 3OPOA 5M5YB 1J6QA 2ZTCA 3S1QB 3S1NH 1U4PA 4BBSB 3ITPA 4LF6L 3BVMA 3LX0A 1ASZA 3HOUG 5I6YA 4V0BA 3VDYA 1I50B 1K0RA 2WV6D 4C2MB 1E7ZA 3AYHB 4GLAC 5GQOA 2SNSA 2QF7A 5IP9G 2RDGA 5JVH3 3CCVA 1IBLQ 1GHJA 5LHY1 1KABA 3M3YH 3J7ZC 4DUYL 2NN6H 4G7OC 2YYZA 3M7NA 4ABNA 1O7IA 3PIP3 3ERSX 4Z9CB 4BWGB 2YTVA 1SNDA 3EBEA 4YWKA 4IPDA 3QB3A 3EN2A 1KAAA 4HIMA 1K8MA 2MP1A 2UU9L 4JBMA 2EE1A 2QDLA 4X66Q 2KCMA 3Q24A 4DV4L 4A93H 3W2DA 5ELFA 1K8OA 4JI5L 1JB3A 5JOBA 4P72A 4KHVA 3V05A 2R7ZH 3BYYB 1FNVA 4A3KB 1GUTA 2A1AA 1UEBA 2JA8H 1PH9A 1PH7A 3DWQA 2F0MA 3K81C 1IL8A 2VQFL 3I4MG 3U4ZA 1NSNS 4QUCA 4QF4A 1X56A 3HOVG 3PO3B 3L9AX 2R92B 1NBWA 2HHHL 5HURA 1N36L 2RHSB 1HFGA 4DR1Q 1X6OA 2R93H 5FLXc 4CDCC 5EAYA 4DV0L 2PZTA 4GOPA 3QG1A 3SR1A 5JPMC 5EGTA 1WTHA 2A73B 1YIJA 2B63G 1WCMH 3TZDA 4DV5L 2WINB 3HP3A 4YY3Q 2WP8J 3H91A 3I7FA 2YU9B 2EYLA 4A3JH 1SDFA 3F2DA 1PDQA 2ZJPA 2E74C 4OWWB 2CHBD 4OEMB 2NVXH 3TDQA 1OTCA 3CC2A 3H0GH 1JQYD 1VQBA 5FLXE 3KLWA 4XT3B 1SNQA 1YNXA 3K5LA 4HJ5A 3J81i 2Z9HA 4WJ3M 4IURA 1MBYA 3I4LA 1N34Q 3BDLA 1XPOA 1KIXA 1TU2B 1ZYRC 2O2LD 3MXPA 5GAGC 4IFDJ 1CT1D 2JP1A 2AUKA 4ULLA 2Z8LA 1GKHA 2JA5B 5K36G 2R61A 2NZ1D 3NUCA 2EY6A 4IQZA 4JYAL 2I5HA 4CJ2C 4LF8L 2XN9C 2P5ZX 4PMBA 4BY1G 1LYLA 2CQAA 5J3BA 2ATWA 4X64L 2WB1G 4LFCL 1IXRA 1LTID 2CQOA 2BA1A 4CJ1B 1KDBA 1N33Q 1F2LA 2XWJB 1IBMQ 4LFBL 3H3VH 5C44H 1SMYC 3T53B 3KJPA 3M4QA 4DR2Q 1WTQA 1GUSA 3FKIH 2C9OA 2K05A 4GOPB 3HOZB 5EBDA 3GV3A 2KCNA 5FLXL 1G291 4DAMA 2R7ZB 2UXBL 4JBKA 4H13C 2JK8A 1STGA 4A3KH 2QDBA 2O5JC 4ODGA 1V1OA 1HNZQ 2K01A 4KKTA 2B2VA 3K6OA 3SDZA 3NENA 2EYHA 3SK6A 2KVMA 1SFOH 1PYBA 2E5LL 2Z1CA 1HR0Q 1B9MA 1F9PA 1G2SA 4JI6Q 1A2TA 1PH8A 1CKMA 1SN8A 5T1GA 3J7AV 1SR3A 4OELB 2KUMA 3NXWA 4ZAIA 4DPGA 4EGVA 1NUCA 3DLLA 2LFNA 2PI2E 2WAQB 4KY6A 2OCEA 1RCVD 3K5OA 2RCFA 1EYGA 4N9TA 3E0EA 4WFN3 4HJ9A 2IY5B 2IHFA 2VUMB 3J81j 4AH6A 1BF4A 4LUZA 5BR8L 1UE1A 5LMNQ 1IBLL 3TP7A 4RG1A 1WFQA 4X65Q 1EOVA 1X55A 1V8QA 4JI1L 1EIHA 1E3PA 1CZGA 4LFAQ 4A3IH 3S15H 2I46A 1K0SA 4N9PA 5C4XG 1DZ1A 2ZXPA 1TS2A 2PQAB 1B2TA 5C3EB 4HEDA 4GLVB 2ICIA 1Y1WB 1Y1VG 3ICEA 4GKKL 3CD6A 5L37A 3DEPA 1Y8PB 1HCZA 1NAPA 1X3GA 4EQNA 2ES2A 1QG7A 4JV5Q 4ID6A 4C2MH 3WDNA 1ONLA 2L12A 4QIWE 4C1NI 2UUAL 1NE3A 1YVCA 1DYQA 1E2VA 2J0TD 1HUMA 1CHPD 3NTHA 4U68A 1EQQA 4BBSH 2F0VA 3FRPB 3D6CA 1P16A 1EIYB 3PUYA 2Q8IB 2HHHQ 1BBWA 1KLUD 2Y0SE 4JBJA 4DR1L 2VB3X 4J1MA 4K5VA 3S1RB 3ZYYX 1A62A 3ULPA 2E2HH 3GTGH 1Z47A 1Y14B 4NPSA 4Y7NB 1MIUA 5GAHC 3BDOA 3CRKC 1KL9A 3MC0B 5DAUA 5IGGA 2K5QA 1C7YA 4CKCA 2RVLA 3K7AH 2M00A 1B9NA 1SYEA 4EX5A 1I4GA 2L0CA 1GVPA 3I73A 1HZBA 5C6AA 4C3JG 2RQXA 2FJ2A 2QILA 2PNHA 2ZM6L 1N34L 3PF4A 2B2TC 2VY3A 1N8RC 2F0FA 4OL7A 4FXGC 2B2TA 5M5WH 1RF2D 4HR7B 1K28A 2AHOB 2ZXOA 4LJZC 1XNRL 4K2LA 4R1JA 4C56C 1PFBA 4DFAA 2SEBD 4GN3B 4JI2L 5LL6X 1U4MA 1VQ9A 1R9TH 1LT3D 2IX1A 4R4OA 1EY0A 1UE5A 1LM0A 1SE2A 2QEXA 3C2PA 2JA7G 2WB1E 2JJQA 3CC7A 1LT5D 3KF8B 3CCSA 2KHJA 4JI6L 2EDGA 2B39A 3I8ZA 1TS5A 3LGJA 4K6LA 4XIGS 1SNMA 3T13A 2JA8B 4A3KG 4BY7G 4NKLA 5IYDH 3EROA 3T1HL 5E7NA 1WJJA 5C3EG 1I50H 1TY0A 1L1OB 1IZ6A 1K8GA 3NWSA 1MSGA 2ZXRA 1MHWC 4IUVA 2K33A 2EIFA 3WOEA 1VF7A 4OIKA 4NXMQ 2R92G 1B53A 5T1IA 3S14B 1UE6A 1T5EA 3MXUA 1E24A 1A6XA 1SE8A 3S1RH 1HR0L 5C0XJ 1BQQT 2Q2IA 5C4ZA 5FO8B 4IOCA 4A3BG 1EQVA 3HRZC 1SEBD 3CPFA 1NNXA 3OW2A 2F1MA 3NTKA 3PMFA 1HZ9A 4GN5A 1G91A 3FVQA 3PV0A 5JEAH 2JA5H 1S5CD 1EIGA 1EFWA 2NZOA 4LF6Q 1MJCA 1RIPA 4AIMA 1H9KA 4L5TA 1O80A 1SNOA 4P71A 1SNPA 2KENA 2R93G 4DR3Q 3U50C 3Q8DA 3PCOB 3I56A 1EY6A 2LXKA 4LMQD 3D3RA 4XQJA 2X6GA 4FYDA 4ZUJA 1PLFA 2EYFA 2MO1A 4F8MA 3OHXC 1B3QA 2Q2TA 4LF4Q 3EIVA 3HOZG 1E2ZA 4K2KA 4EVOA 5M5WB 2K6AA 1F9QA 4X3SA 4BXXH 4DV3Q 3D6WA 2A69C 1CSQA 2IWHA 1JJ2A 2ASBA 1EY9A 1W2BA 1EY7A 1HZAA 3FMCA 3K80C 1XWEA 4KHPL 5IYCG 1VQ7A 4YIJA 2FHTA 2K75A 3GTMB 3HZXA 2F4VL 3PIPA 2VB2X 1TWFB 4IUPA 4L6TB 1DOMA 4UHVA 1VMPA 4JVZA 4GOPC 1HNWL 1JWMD 4UP7A 4LF9Q 1S5DD 1D1IA 1BO0A 2WFWA 2Z4HA 2A6HD 3GP7A 2XGTA 3ND8A 4B3RQ 5M5YH 2UXDQ 3PUVA 2HQLA 3VR5A 3GTJB 2MUYA 1GXDC 1SSOA 1YBYA 1SFOB 4FF3A 3S15B 1Q12A 4IFDI 1RKNA 2A6EC 3E9HA 3PQIA 3R8BA 3ZJYC 4XQNA 4FF2A 2QKIC 1EYDA 3KLSA 2NBFA 2F0QA 2NVTH 1QVFA 4GZYC 2IHEA 2F0GA 4AYBE 4RKBA 1LTAD 1F2MA 1XNRQ 3VR2A 2NVYB 5IWAQ 5IYCH 5A2QL 1WVLA 2PMZE 1TWAB 2K5WA 3MEFA 3R3OA 1EEFD 1B50A 3P75A 5EJWA 1CKNB 1FYCA 2JEBI 2ENBA 4C1NK 1TT2A 1HTPA 4C3IH 3C1EA 5JJIA 5D3DA 2AUJD 1ESFA 5TSSA 3KDFA 4A3GB 5JEAJ 3HOVB 4JI4Q 3UE1A 3TBIB 3F1ZA 1ASYA 4A3JG 4EQOA 1LACA 1PA6A 1XMQQ 3VYSA 1GD7A 1KDAA 4E6IA 1R4PB 3T16A 3PIO3 1Y69U 2G9DA 5I4DA 4ALPA 4DR6L 1E22A 4YHHL 3CW2C 3LNNA 3PGZA 5CV8A 5CMDA 3Q6SA 4TQUS 1QUQA 2EXZA 1QNUA 1TWFH 3J81c 2PW5A 5FJ8H 1F2YA 1PXUA 4DR2L 2F0LA 2E8GA 4JOIC 4XQQA 2OWOA 3GV6A 2HCIA 1A3TA 4JOIA 1A2UA 4UDUC 1Q8KA 1V1PB 5C3EH 4L5RC 4A4IA 4APVA 4BA2I 4O0AA 2NUCA 1X9NA 4HCEA 2GN5A 1D5MC 5C4XH 5JEAG 5EBCA 2JA5G 3FKIG 4QMGA 2EXDA 1QVGA 2A74C 1IHZA 4ZQ3A 3GTLB 3DWPA 4L5QA 2L4NA 2BDOA 4OWXB 3GD7A 2LSSA 2BDNA 3T51B 3SE0A 1IYJB 3CCMA 1VDZA 4IUQA 3MAQA 1HXYD 3A8KE 2JYOA 4FXDA 2L55A 4KY5A 1WD0A 4DV3L 4GN4B 3CHBD 5M5XH 3U9SA 3U4VA 2OXPA 4EQ5A 4A3DG 2QCPX 4IN3A 5C0XH 2PQEA 5BN5A 1II3A 3KUPA 4HN7A 4CDDC 4GLXA 1WOCA 4B3TQ 4IALA 1CA6A 4CKEA 1YI2A 3CKIB 5IYBG 4K6DA 2UUAQ 2CH4A 2B2WC 3N6RA 3W1GA 3VYRA 4XYQA 2AMCB 3Q22A 3TRZA 2O5IC 3S9WA 1NCVA 3I4OA 4KD3A 4TVAB 2SDFA 2CWAA 4RGOS 1N9WA 4WORA 4C3HH 1PH4A 5FKAC 1D8LA 3OWEB 3EFXD 3ND9A 2YTYA 4WJWA 5IP7G 3GTKB 4HAEA 1UUPA 4DXFA 4DR5Q 1AEXA 2LMCB 3G6JB 3X3NA 4IOAA 1W6KA 1ZXTA 4X3TA 1EQTA 1PZJD 5IWAL 1VQIA 1IYVA 4UP9A 1EYCA 2IT1A 1AN8A 2Q8TA 2OTLA 3M4PA 1EY5A 1JOKA 5D65A 4BBRB 1MGSA 1PTOC 5IT9E 3AEVA 1YNJC 1LTRD 2DY8A 5M5XB 3X3MA 1HUNA 2DNEA 2XRSD 4POFA 1IYUA 2B2UC 2YV5A 2F0EA 3PIOA 4IUNA 5KYLA 1XMQL 1KNEA 1Y1VB 4HCSA 4OX9L 4A3MB 3JAMi 4NXNQ 2F0UA 3BZKA 3BYTB 2ZT9C 3V2TA 3GTQB 3HEJA 2XTIA 4IJLA 1X3PA 1STEA 3RZOB 4F88A 3T1HQ 2NTTA 4R8IA 1VS0A 2H4OA 3J80c 1KRTA 1SYGA 2X6LA 2E2IB 5I2YA 3T4AC 4B3SL 3S2DB 1MJEA 4G57A 4DAVA 4NXML 1XJVA 3M3YB 1AZPA 3A8JE 3J7A5 1D6EC 1SYFA 5FJ8G 1GM5A 5C0XI 1VQMA 3MXNA 2NVYH 1DCZA 3GTKH 2C5CA 5J22A 1F9RA 4G7HC 3CU7A 3KYHC 1L0YB 3CXCA 3VR6A 4RA8A 3K0XA 3R2IA 1I4XA 3NBHB 5CGKA 1WTRA 1BR9A 1JOOA 1TWHB 4H7BA 2E76C 2IW3A 3KK7A 3C1FA 3NHHA 1I94Q 3HOYB 3T1YL 3FPPA 4ME5A 1PYSB 3CMAA 3GTQH 1QJOA 1TS4A 4LNQA 5EKLA 3HOVH 1RD9D 2L1BA 3CAMA 4HJ7A 1QB5D 3PO3G 5KGUA 1A63A 4BY1H 3E6ZX 1I3QB 2FMMA 4HIDA 1KQSA 2JA7B 5A35A 1DXMA 2BCOA 3OMGA 2F0KA 2MO0A 5KNDA 1M1KC 1Q82C 2R6GA 1PRTF 1O7ZA 4BBRG 5IGBA 3K57A 3P7JA 2KHIA 3TS2A 3D4RA 2UU9Q 1M90C 3M7GA 5IYBH 4DR3L 4BY7B 2KECA 3HFZB 1FR3A 1B1ZA 1JCKB 2Z6BA 3MVVA 4JK1C 4HSVA 2LY7A 2MJ8A 4MIUA 4A3FB 1CM9A 1VQFA 1X32A 4AYBG 2KQ3A 2IJ0A 5DEHA 3HOXH 1IBKL 3SK4A 1XPUA 4RHRA 2JA6B 2WKCA 2Y0SB 1HHVA 4ZYSA 1D2BA 2KA7A 3NBHA 5DNFA 4LF5Q 2BE5C 1WTPA 5JJZA 3FKIB 4JI8L 1SYDA 3R2TA 1IW7D 5IY0A 4M1UB 2JEAI 3AFPA 1VQ5A 1LT4D 4KJOA 1L0WA 4DV1L 2WB1B 4B08A 3I91A 4KKSA 3CCQA 1XMOL 1A0IA 3I4MH 3S2DH 3K5NA 4DNIA 5CYUA 3HOWH 3HOXG 5ELBA 1ET6A 4DNTB 5C4JH 3OTOQ 1Q81C 4J15A 1SLJA 3J81L 4DGZA 1PRTD 2EPBA 3CCUA 2RSOA 4ILWA 3HOUB 5KEEA 1VQJA 1S3OA 5FLMG 1WTWA 2B2UA 3NPPA 1QCBD 1PH5A 2OQ0A 4A3DB 4A3EB 3T56B 3NBIA 1YZ6A 5HGTA 1SRUA 1QVCA 4DF7A 4IFDH 3BU2A 5KRUA 1QOHA 2L9HA 4O42A 1CKNA 2E2JB 1CSPA 1KD1C 1TWHH 4DK0A 5GADC 2RKSA 4Y52H 3L3OC 3KDFB 3I55A 1KC8C 1TWGH 1ML0D 1UNSA 4QB4A 3RLNA 2XIWA 2KBNA 1ILQA 1VQHA 3OSOA 4A93B 4XYOA 4MHEA 4TSSA 1JJCB 4CKBA 1X54A 3A0JA 3M4OB 3CCEA 3RUZA 2WIIB 4ZK9B 4JW0A 4CGYB 3I4NB 1Y1WH 4WRDA 5EPLA 4HJAA 5EKIA 2CWPA 3SXHA 1NJIC 1TKWB 3OIPA 5BN3A 5G3LD 4FNFA 1I4QA 1PZKD 1D5ZC 3HOWB 1EWCA 3U9OA 3P20A 4ZCKA 3OW7A 5IODA 4RWSC 4GKJQ 4F87A 2KHSA 3PO2G 1PFNA 5DM63 4IFDG 3EQLC 2VUMH 1H9RA 1UAPA 1JORA 1YHBA 1X3FA 3GTOB 1TWAH 3A56A 3K7AB 4IO9A 3OIQA 1VQLA 1SYBA 4LF7Q 3G6EA 3RNUA 5LL6S 5F2DA 5CV5A 4DAYB 2E5LQ 3H3VC 5EKKA 2MPMA 1JICA 1YEZA 2E2HB 2K04A 2Z4IA 4Q5VA 1S5FD 3G48A 4KI0A 5M3MH 3A5UA 2ID0A 2F4IA 1QZGA 3E5SA 1QILA 2LKVA 2EOTA 3A74A 5EQ0A 3JC66 1XNQL 4PMCA 3A7LA 4C3HG 3DM3A 1L1OC 1PTOH 5KYIA 4B3TL 2F0NA 3DXJC 1E1TA 5G3LF 2NVQH 3BDCA 3K58A 4FF4A 4JPBW 1I4RA 1TWGB 2I07B 3SK8A 4DV7L 3J80i 4LFAL 1VQKA 3S16H 4LWCA 4HJ8A 1WI5A 2DJFC 5FO7B 1JE4A 4X6AH 1ENFA 1U0LA 5ELNA 5BN4A 3W5OA 3JAML 1FGBD 3RMHA 1TWCB 2RDHA 3CCJA 1K3RA 2M2LA 2A5HA 1V1PA 4AQYL 1AE2A 4L63B 4NMZA 4DUYQ 1B44D 3QOJA 4L5SA 4ME3A 4XXEA 5M3MB 1V43A 3S17B 1OXUA 3MHBA 2B63H 2K1BA 4PNYA 1YHAA 2RF4A 4ZLTF 1SE4A 2A69D 2F0TA 3H3VI 2F0HA 3GTOH 4X66L 5JJLA 2PZWA 2CVRA 3KF8A 1H9SA 2CW0D 3RZDB 2UUBL 1CTMA 2EJGC 2N8NA 3NQTA 3QO2A 5NUCA 1FD7D 1STHA 3RLFA 4LF4L 2JA7H 1Q7YC 1BBXC 4CHTB 4DUZQ 1SXTA 1QUQB 4YY3L 1BCPD 4NP5A 2Z6KA 4JI0L 5AJ3Q 4HMIA 3M4YA 1WD1A 2N49A 5CBEE 2ZTEA 2ICEC 2F52A 4LK1C 1QZHA 1AZQA 1SBBB 3S14H 4GNXC 2HD3A 4JI2Q 1EZ8A 2WAQG 1G2TA 3F2BA 3RLOA 5KNCA 1YNJD 4I65A 2JA8G 3BZDB 3QWNA 4DK3C
chains in the Genus database with same CATH topology
3MTSA 4DNRB 1KNAA 1STYA 3S2HB 4KN7C 4PMWA 1LTGD 1O7YA 2PYKA 1F77A 3KBGA 1EY4A 2OF1A 2AQ2B 4MN3A 1DM0B 4C3HB 3BG3A 3VA5A 1S5BD 5EPKA 4OGQC 1HQMC 5ELEA 5ELDA 3ERQA 5ELCA 2VNUD 3S1NB 5AFWA 3MEHA 1C48A 5JPNC 5E4XA 3HG9A 5C4JB 1QNKA 2J4XA 1Y8OB 2R93B 4X3KA 3TSSA 1TY2A 4R9WA 4DXGA 2NYZD 4QUFA 1HPCA 4B9WA 1PTOF 4RGMA 2JSOA 1TS3A 1SMYD 1GUOA 3UI2A 1CA5A 1BXTA 3AB9A 4PV1C 1LABA 3NSWA 1FNUA 2R3ZA 4KD4A 3JAME 1SAPA 3GTPB 5C3WA 4KKUA 1NR4A 4NW2A 3VYUA 1J8IA 2IX0A 2SNMA 2PNRC 2BA0A 3EJIA 3PUWA 2N88A 5FO9B 2KEDA 4OIJA 1CK1A 2PZUA 2A68C 3QIAA 4RCOA 2D62A 1PFMA 2EYOA 4NDXA 1Q1EA 3HS0C 3A54A 3OMCA 1X3QA 3VYTA 4OO1G 4O1NA 3CQZB 3GTGB 1GUGA 5C0XG 4DAYA 2F3WA 2B2VC 1OXTA 3DUZA 3C3LA 5JAVA 3WOFA 2EYMA 2PPBC 2GA4B 1OO9B 1KLGD 1QWYA 4HSPA 3S1MB 4RGTA 1F2ZA 3Q0AA 1RDPD 2KJXA 4RCNA 1CFMA 1NR2A 2MGSA 2PO4A 1U4LA 4K5XA 2HQEA 2NVQB 1G8ZD 3A55A 4OHJA 1D5XC 1ICWA 3NQIA 5I2XA 4A3BB 1YNND 1ZYRD 1HTLD 4K8IA 5I9PA 2L5TA 1LV9A 1HA5A 4Q0FA 4UAIA 2RA4A 5CR3A 2RDFA 1TVXA 4KMUC 2FMCA 4S3SA 3FDTA 2EY2A 2DY7A 3S16B 2NWGA 5IGDA 2RBMA 1DOLA 3NTIA 5C44B 2EVBA 1PZID 4RH6A 4FF1A 1LLRD 2AWNA 1Z6HA 3DEOA 2E2DC 3HOXB 2AQ3B 2K5DA 1RTNA 3J80E 2JE6I 2D9UA 2XVSA 2OT2A 5JVG3 3TN2A 4KN4C 3I72A 3D4WA 2TSSA 5E3FA 3GQBA 4IUTA 5ISRA 4FXKC 4TKOB 1AW7A 5FOBB 2D2CC 2B8GA 1EOTA 2EJMA 2F03A 3V96A 3VR3A 4X3UA 4XDXA 3BVZA 5M3FB 1STNA 3I3CA 3HGBA 3SEBA 4KTAA 2NB0A 4C3IB 3D4DA 3DMUA 2Q8RE 2KEEA 4ZRZA 1Z7TA 2WACA 4J6HA 2NTSA 2B2WA 1LTSD 5D3IB 1EL0A 1BDOA 2QEJC 1M4VA 4K5WA 4A3JB 1I6VC 1M8AA 2AQ1B 2K32A 2F0DA 1ZEQX 1F9SA 1I6HB 2EY5A 5CBAE 1YNNC 4FP5D 1EFID 2NN6G 3CRLC 3LWEA 1FNWA 2K03A 1BOSA 1SJHD 3K59A 1STAA 4FVMA 2IL8A 2CW0C 4RAUC 2EJFC 1MD2D 4FO2A 1Q3LA 2B2YC 2L11A 5J39A 1EZ6A 1KTKA 1TIID 1U4RA 3G7LA 3KLSX 1S4ZA 1WTXA 3AMUA 3C46A 5C3XA 3IAYA 3QOLA 2K7VA 2PMZB 5M9OA 2XSCA 5C5MA 3DM1A 1B3AA 1CHQD 1BUVT 1RHPA 1JWSD 1CQVA 5I9OA 1HFNA 5C5LA 1LT6D 3D31A 2K28A 3I70A 3NP8A 3SHLA 3MA2B 1SE3A 3URYA 4ZKCB 3J80L 4CBVA 3KLRA 3F2UA 4P2CB 1IKMA 3FPUB 3J7YW 3NWTA 3A7AB 3IFTA 4QIWB 3OWFA 4A3IB 4H0LC 4I7ZC 3VA7A 1PRTB 4XTCS 3D8GA 1R4QB 2HDMA 2EZVA 3P1HA 4ZUIA 5CV4A 1RJTA 1A3UA 2G9HD 1U9RA 4HMJA 2NN6I 3I90A 4DA2A 2KCCA 1W6JA 1H9SB 2EYPA 3IKJA 1E0BA 1RODA 2KOLA 4PQXA 3SK5A 2LS01 2EY1A 1AP0A 4L8JA 1ILPA 4C3JB 2F0WA 2PCFB 1O78A 1O7LA 1B4OA 3MWYW 3PUZA 4QCLA 1K83B 2J7ZA 4ZKBB 1JR0D 1HRJA 1XTCD 4DU9A 4OO1H 2NVXB 1BCPC 3H09A 1PYWD 3MXGA 1CQFA 2EYJA 5J1ZA 1RTOA 3MFYA 1ZKOA 5IGEA 1SYCA 3TP5A 3TP8A 4U673 2IPKD 4KJNA 4H44C 3TZUA 3EVQA 1JC7A 2B2YA 4TRDA 3KBXA 1EYAA 4KHZA 3H0GB 2IX3A 5DM73 5IIFA 3W3AA 1IKLA 2O4XA 1DJRD 3PUXA 4K8JA 4DAPA 2BOSA 1BNZA 2VXWA 2FFKB 3R93A 3AU7A 1EU4A 3MFGA 1C8CA 1H9JA 1WTOA 3HKZB 4JBWA 1EEID 4M8AA 5E1FA 2F0SA 1TR5A 1DONA 5IT9L 3A8IE 1OXVA 2F0OA 2SOBA 4C3IG 5D14A 1I4HA 2F3VA 1HQRD 2PW7A 2OEOA 1LO5D 4DK1A 4AYBB 3NK9A 5I6WA 2HUGA 4RFBA 3M85A 1JWUD 4HTHA 1Q1BA 1JOQA 3GO5A 4J8QA 1EWHA 5KIXA 5KNBA 1PMRA 2DN8A 3IL8A 1H9MA 3K5MA 3QJYA 5A2QE 2N55A 3J81E 2FINB 1C4QA 1S5ED 1G6ZA 4OO1I 1TQOA 3E0JA 1GUNA 2F0JA 1J9OA 1QE6A 3O13A 1BCPF 1ENAA 5K36H 1DD2A 2DNCA 1WCMB 5CC4A 1UEAB 2V4DA 2M9VA 3I4MB 2D5DA 1XX8A 2A68D 3NE5B 3TMEA 1XYIA 1I4PA 4CJ0B 1BCPB 1ET9A 2NVTB 5IGFA 3DWAA 5CV9A 4KY7A 1MI2A 4K14A 3PO2B 1VF5C 1A15A 1ENCA 4B9XA 3K0YA 1GOZA 4LAAA 3MZ5A 5COYA 2BE5D 1SJED 2AWOA 3Q23A 1PTOD 1L0XB 1T5XD 2HDLA 1LTBD 1OXXK 1VMCA 1CZWA 1IW7C 4BY1B 1WTVA 2RSNA 1STBA 3BVGA 5FK9C 5EPJA 3IFDA 2TMPA 4G7ZC 4IZ8A 5CORA 2A6ED 3FEWX 1R9TB 1PRTC 1HA6A 3RD4A 4BS9A 1EY8A 3DHQA 2X69A 2F0IA 2XNAC 1MSHA 1OXSC 1A3VA 3ONAB 1XXGA 1LTTD 2XWBB 4BA1I 4XT1B 3LWUA 1AFPA 1GHKA 4R8NA 2B8FA 5IGCA 4IUUA 4V190 3OOCA 2F0PA 2XRQD 1PTOB 1Q8IA 2A6HC 3SVMA 5C4XB 5CV7A 1EU3A 3L7ZC 3VR4A 4RKLA 3EA6A 3H6MA 5K5PA 1GJXA 2H1EA 3N52A 4EQPA 3H94A 1SNCA 1D1KA 5E4WC 4F7XA 1Q90A 1KDCA 5CV6A 2MHVA 2JXMB 4DN4M 2E75C 3J7AF 2B63B 4RHSA 4KV6A 2HCCA 5C4HA 4G4KA 3BS1A 4KK7A 3TP6A 4RGNA 1E2WA 2WKDA 1ESRA 5IOCA 1CI3M 1GUWA 1DOKA 1VCIA 1Y8NB 3OPOA 5M5YB 3S1QB 1U4PA 4BBSB 3ITPA 3BVMA 3LX0A 5I6YA 4V0BA 1I50B 2WV6D 4C2MB 2SNSA 2QF7A 2RDGA 5JVH3 1GHJA 5LHY1 1KABA 2NN6H 4G7OC 2YYZA 3M7NA 4ABNA 3PIP3 4Z9CB 4BWGB 1SNDA 3QB3A 1KAAA 1K8MA 2MP1A 2EE1A 3Q24A 3W2DA 5ELFA 1K8OA 1JB3A 5JOBA 4KHVA 3V05A 3BYYB 1FNVA 4A3KB 1GUTA 3DWQA 2F0MA 1IL8A 1NSNS 4QUCA 4QF4A 3PO3B 3L9AX 2R92B 5HURA 1HFGA 2PZTA 3QG1A 3SR1A 5JPMC 5EGTA 2A73B 3TZDA 2WINB 3HP3A 2WP8J 3H91A 2YU9B 2EYLA 1SDFA 1PDQA 2E74C 2CHBD 3TDQA 1JQYD 5FLXE 4XT3B 1SNQA 3K5LA 4IURA 1MBYA 3I4LA 3BDLA 1TU2B 1ZYRC 2O2LD 3MXPA 4IFDJ 1CT1D 2JP1A 2AUKA 4ULLA 2Z8LA 2JA5B 5K36G 2R61A 2NZ1D 3NUCA 2EY6A 4IQZA 4CJ2C 2XN9C 4PMBA 2CQAA 1LTID 2BA1A 4CJ1B 1KDBA 1F2LA 2XWJB 1SMYC 3T53B 1WTQA 1GUSA 2C9OA 2K05A 3HOZB 5EBDA 3GV3A 2KCNA 5FLXL 1G291 2R7ZB 4H13C 1STGA 2QDBA 2O5JC 4ODGA 1V1OA 2K01A 4KKTA 2B2VA 3K6OA 3SDZA 2EYHA 3SK6A 2KVMA 2Z1CA 1B9MA 1F9PA 1G2SA 1A2TA 5T1GA 3J7AV 2KUMA 3NXWA 4ZAIA 4EGVA 1NUCA 2LFNA 2WAQB 4KY6A 1RCVD 3K5OA 4N9TA 4WFN3 2VUMB 1BF4A 3TP7A 1V8QA 1EIHA 1CZGA 2I46A 4N9PA 1DZ1A 2ZXPA 1TS2A 1B2TA 5C3EB 4HEDA 2ICIA 1Y1WB 3DEPA 1Y8PB 1HCZA 1NAPA 4EQNA 1QG7A 4ID6A 3WDNA 1ONLA 2L12A 4C1NI 1DYQA 1E2VA 2J0TD 1HUMA 1CHPD 3NTHA 4U68A 2F0VA 3FRPB 3D6CA 3PUYA 2Q8IB 1KLUD 2VB3X 4J1MA 4K5VA 3S1RB 3ZYYX 1Z47A 4Y7NB 3BDOA 3CRKC 3MC0B 5DAUA 5IGGA 2K5QA 4CKCA 2RVLA 2M00A 1B9NA 1SYEA 1I4GA 2L0CA 3I73A 5C6AA 4C3JG 2RQXA 2FJ2A 2QILA 2B2TC 2F0FA 4OL7A 4FXGC 2B2TA 1RF2D 4HR7B 2ZXOA 4LJZC 4K2LA 4C56C 1PFBA 4DFAA 2SEBD 5LL6X 1U4MA 1LT3D 2IX1A 1EY0A 1SE2A 3C2PA 1LT5D 2EDGA 2B39A 3I8ZA 1TS5A 4K6LA 4XIGS 1SNMA 2JA8B 3T13A 4NKLA 3EROA 1TY0A 3NWSA 1MSGA 2ZXRA 4IUVA 2K33A 3WOEA 1VF7A 4OIKA 1B53A 5T1IA 3S14B 1T5EA 3MXUA 1A6XA 5C0XJ 1BQQT 5C4ZA 5FO8B 1EQVA 3HRZC 1SEBD 2F1MA 3NTKA 3PMFA 1G91A 3FVQA 3PV0A 5JEAH 1S5CD 1EIGA 1H9KA 1O80A 1SNOA 1SNPA 1EY6A 4LMQD 3D3RA 4XQJA 2X6GA 4FYDA 4ZUJA 1PLFA 2EYFA 4F8MA 3OHXC 1E2ZA 4K2KA 4EVOA 5M5WB 2K6AA 1F9QA 4X3SA 3D6WA 2A69C 2IWHA 1EY9A 1EY7A 3FMCA 1XWEA 4YIJA 2FHTA 3GTMB 3HZXA 2VB2X 1TWFB 4IUPA 4L6TB 1DOMA 1VMPA 1JWMD 1S5DD 1D1IA 1BO0A 2Z4HA 2A6HD 3GP7A 3ND8A 3PUVA 3VR5A 3GTJB 2MUYA 1GXDC 1SSOA 1SFOB 4FF3A 3S15B 1Q12A 4IFDI 1RKNA 2A6EC 4XQNA 3R8BA 4FF2A 2QKIC 1EYDA 3KLSA 2NBFA 2F0QA 4GZYC 2F0GA 4RKBA 1LTAD 1F2MA 3VR2A 2NVYB 5A2QL 1WVLA 1TWAB 2K5WA 3R3OA 1EEFD 1B50A 3P75A 5EJWA 1FYCA 2JEBI 2ENBA 4C1NK 1TT2A 1HTPA 3C1EA 5D3DA 2AUJD 1ESFA 5TSSA 4A3GB 5JEAJ 3HOVB 3TBIB 4EQOA 1LACA 3VYSA 1KDAA 4E6IA 1R4PB 3T16A 3PIO3 1Y69U 2G9DA 5I4DA 3LNNA 5CV8A 5CMDA 3Q6SA 4TQUS 2EXZA 1QNUA 2PW5A 1F2YA 1PXUA 2F0LA 4XQQA 3GV6A 2HCIA 1A3TA 1A2UA 4UDUC 1V1PB 4BA2I 2NUCA 4HCEA 1D5MC 5JEAG 5EBCA 4QMGA 2A74C 1IHZA 4ZQ3A 3GTLB 3DWPA 2L4NA 2BDOA 3GD7A 2BDNA 3T51B 3SE0A 1VDZA 4IUQA 3MAQA 1HXYD 3A8KE 2JYOA 4FXDA 2L55A 4KY5A 1WD0A 3CHBD 3U9SA 2OXPA 2QCPX 4IN3A 5C0XH 2PQEA 5BN5A 1II3A 3KUPA 4HN7A 4IALA 1CA6A 4CKEA 3CKIB 4K6DA 2B2WC 3N6RA 3VYRA 4XYQA 3Q22A 2O5IC 3S9WA 1NCVA 4KD3A 2SDFA 4RGOS 4WORA 5FKAC 3OWEB 3EFXD 3ND9A 4WJWA 3GTKB 4HAEA 1UUPA 4DXFA 1AEXA 2LMCB 3G6JB 3X3NA 1W6KA 1ZXTA 4X3TA 1EQTA 1PZJD 1IYVA 1EYCA 2IT1A 1AN8A 2Q8TA 1EY5A 1JOKA 5D65A 4BBRB 1MGSA 1PTOC 5IT9E 1YNJC 1LTRD 2DY8A 5M5XB 3X3MA 1HUNA 2DNEA 2XRSD 1IYUA 2B2UC 2F0EA 4IUNA 5KYLA 1KNEA 1Y1VB 4HCSA 4A3MB 2F0UA 3BYTB 2ZT9C 3V2TA 3GTQB 3HEJA 1X3PA 1STEA 3RZOB 4F88A 2NTTA 4R8IA 2H4OA 1SYGA 2X6LA 2E2IB 5I2YA 3T4AC 3S2DB 4G57A 4DAVA 3M3YB 1AZPA 3A8JE 1D6EC 1SYFA 5C0XI 3MXNA 1DCZA 2C5CA 5J22A 1F9RA 4G7HC 3CU7A 1L0YB 3VR6A 4RA8A 3R2IA 1I4XA 5CGKA 1WTRA 1BR9A 1JOOA 1TWHB 4H7BA 2E76C 2IW3A 3KK7A 3C1FA 3NHHA 3HOYB 3FPPA 4ME5A 1QJOA 1TS4A 5EKLA 1RD9D 2L1BA 1QB5D 5KGUA 3E6ZX 1I3QB 2FMMA 2JA7B 5A35A 1DXMA 2BCOA 3OMGA 2F0KA 5KNDA 2R6GA 1PRTF 1O7ZA 5IGBA 3K57A 3P7JA 3D4RA 3M7GA 4BY7B 2KECA 1FR3A 1B1ZA 1JCKB 4JK1C 3MVVA 4HSVA 2LY7A 2MJ8A 4MIUA 4A3FB 1CM9A 1X32A 2KQ3A 2IJ0A 5DEHA 3SK4A 2JA6B 4RHRA 2WKCA 2Y0SB 1HHVA 4ZYSA 1D2BA 2KA7A 3NBHA 5DNFA 2BE5C 1WTPA 5JJZA 3FKIB 1SYDA 3R2TA 1IW7D 4M1UB 2JEAI 1LT4D 4KJOA 2WB1B 4B08A 3I91A 4KKSA 3K5NA 5CYUA 5ELBA 1ET6A 4DNTB 3J81L 4DGZA 1PRTD 2EPBA 2RSOA 4ILWA 3HOUB 5KEEA 1WTWA 2B2UA 3NPPA 1QCBD 4A3DB 4A3EB 3T56B 3NBIA 5HGTA 4IFDH 4DF7A 5KRUA 1QOHA 2L9HA 4O42A 2E2JB 4DK0A 2RKSA 3L3OC 1ML0D 1UNSA 4QB4A 2XIWA 1ILQA 3OSOA 4A93B 4XYOA 4MHEA 4TSSA 3M4OB 4CKBA 3RUZA 2WIIB 4ZK9B 4CGYB 3I4NB 4WRDA 5EPLA 5EKIA 3SXHA 1TKWB 3OIPA 5BN3A 5G3LD 4FNFA 1PZKD 1I4QA 1D5ZC 3HOWB 1EWCA 3U9OA 3P20A 3OW7A 5IODA 4RWSC 4F87A 2KHSA 1PFNA 5DM63 4IFDG 3EQLC 1H9RA 1UAPA 1JORA 3GTOB 3A56A 3K7AB 3OIQA 1SYBA 5LL6S 5F2DA 5CV5A 3H3VC 5EKKA 2MPMA 1JICA 2E2HB 2K04A 2Z4IA 4Q5VA 1S5FD 4KI0A 2ID0A 2F4IA 3E5SA 1QILA 2LKVA 2EOTA 5EQ0A 4PMCA 3A7LA 4C3HG 1PTOH 5KYIA 2F0NA 3DXJC 5G3LF 3BDCA 3K58A 4FF4A 1I4RA 1TWGB 2I07B 3SK8A 5FO7B 1JE4A 1ENFA 5BN4A 3JAML 1FGBD 3RMHA 1TWCB 2RDHA 2M2LA 2A5HA 1V1PA 4L63B 4NMZA 1B44D 3QOJA 4XXEA 5M3MB 1V43A 3S17B 1OXUA 3MHBA 2K1BA 4PNYA 4ZLTF 1SE4A 2A69D 2F0TA 2F0HA 2PZWA 2CVRA 3KF8A 1H9SA 2CW0D 3RZDB 1CTMA 2EJGC 3NQTA 3QO2A 5NUCA 1FD7D 1STHA 3RLFA 1BBXC 4CHTB 1SXTA 1BCPD 4NP5A 4HMIA 3M4YA 1WD1A 5CBEE 2ICEC 4LK1C 1AZQA 1SBBB 1EZ8A 1G2TA 5KNCA 1YNJD 4I65A 3BZDB 3QWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DEH A;  5EKK A;  4ZQ3 A;  2EYL A;  3TP7 A;  4KV6 A;  3SK4 A;  3NK9 A;  1EY0 A;  5C4H A;  2F3W A;  3V2T A;  5I6W A;  1STY A;  4LAA A;  3MZ5 A;  3TP6 A;  3HEJ A;  5C3X A;  5JAV A;  3QOL A;  5IOC A;  2PYK A;  3E5S A;  2EYM A;  5M9O A;  1EY4 A;  4KY5 A;  1SYD A;  3D4W A;  2OF1 A;  1SNQ A;  4DU9 A;  5C5M A;  5E3F A;  1SNM A;  4N9P A;  3T13 A;  2LKV A;  4HTH A;  4NKL A;  3ERO A;  1JOQ A;  1RKN A;  4KJO A;  5KIX A;  3VA5 A;  1STB A;  1EYD A;  2OXP A;  5ISR A;  3BDL A;  1SYG A;  2F0Q A;  4PMC A;  5I9O A;  3MXP A;  3ERQ A;  3ITP A;  2F0G A;  3LX0 A;  1F2Z A;  4G57 A;  5C5L A;  5KYI A;  4RKB A;  2F0N A;  3NP8 A;  5I6Y A;  2EYJ A;  1F2M A;  2PQE A;  1II3 A;  3NUC A;  3BDC A;  4IZ8 A;  5J1Z A;  1SYF A;  2EY6 A;  3MEH A;  4DGZ A;  3SHL A;  4IAL A;  4EQN A;  4ID6 A;  5KEE A;  5IGE A;  1SYC A;  2SNS A;  4PMB A;  5J22 A;  1EY8 A;  1STN A;  4K6D A;  3SK8 A;  3TP5 A;  3DHQ A;  3TP8 A;  3R3O A;  4K5X A;  2HQE A;  1KAB A;  3P75 A;  5HGT A;  5C4Z A;  4EVO A;  1EQV A;  4KJN A;  2ENB A;  3S9W A;  2F0I A;  1TT2 A;  1TQO A;  4KD3 A;  4DF7 A;  5KRU A;  4KTA A;  2F0V A;  3PMF A;  4B9W A;  1A3V A;  1KDB A;  3D4D A;  3D6C A;  3C1E A;  3DMU A;  3EVQ A;  2F0J A;  5CGK A;  4WOR A;  1JOO A;  1SND A;  4TRD A;  4H7B A;  4K8I A;  5I9P A;  2WAC A;  2RKS A;  4J6H A;  1ENA A;  3OWF A;  3C1F A;  3NHH A;  1KAA A;  1EYA A;  3QB3 A;  4R8N A;  5IGC A;  4ME5 A;  4NMZ A;  1SNO A;  1SNP A;  3QOJ A;  4EQO A;  4J1M A;  4QB4 A;  4KD4 A;  5CC4 A;  4K5V A;  3D8G A;  5CR3 A;  5IIF A;  1KDA A;  5EKL A;  4E6I A;  4K5W A;  2RDF A;  1AEX A;  3T16 A;  2O4X A;  5C3W A;  1EY6 A;  2F0P A;  3MHB A;  1STG A;  3OSO A;  2QDB A;  2F0D A;  4K8J A;  4PNY A;  4S3S A;  4ODG A;  3P1H A;  5JOB A;  4ZUI A;  3RUZ A;  2EY2 A;  4ZUJ A;  5KGU A;  2EYF A;  2EY5 A;  4KHV A;  5CV4 A;  2F0T A;  5CV8 A;  5DAU A;  4F8M A;  4WRD A;  5IGG A;  2F0H A;  2EXZ A;  2EYH A;  3SK6 A;  1A3U A;  2SNM A;  4K2K A;  5CV7 A;  3SXH A;  3TME A;  2PW5 A;  1U9R A;  2M00 A;  2PZW A;  3EJI A;  4HMJ A;  5IGD A;  1F2Y A;  1SYE A;  2F0K A;  1EYC A;  3OMG A;  2RBM A;  2F0L A;  4RKL A;  2F0M A;  5K5P A;  3H6M A;  3U9O A;  5C6A A;  5IGB A;  1A2T A;  1EY5 A;  3NQT A;  1JOK A;  1A3T A;  1STH A;  5E1F A;  2F0S A;  2PZU A;  1A2U A;  1TR5 A;  5NUC A;  4EQP A;  5IOD A;  1NSN S;  2EYP A;  4QF4 A;  5IGF A;  3NXW A;  1EY9 A;  2EYO A;  1STA A;  1NUC A;  1EY7 A;  1SNC A;  2F0O A;  2KHS A;  4NDX A;  4NP5 A;  4HMI A;  5CV9 A;  3MVV A;  2SOB A;  5HUR A;  4KY7 A;  3OMC A;  2NUC A;  4YIJ A;  4KY6 A;  4MIU A;  2F0F A;  4K14 A;  4OL7 A;  3SK5 A;  2F3V A;  2F0E A;  2EY1 A;  3HZX A;  2PZT A;  1JOR A;  4IUN A;  5KYL A;  3SR1 A;  5EGT A;  4F7X A;  2PW7 A;  4N9T A;  2OEO A;  1SYB A;  1EZ8 A;  4QMG A;  4K2L A;  2KQ3 A;  5J39 A;  1EZ6 A;  4I65 A;  4DFA A;  2F0W A;  1ENC A;  1KDC A;  5CV6 A;  4B9X A;  2F0U A;  5F2D A;  5CV5 A;  1IHZ A; 
#chains in the Genus database with same CATH topology
 3MTS A;  4DNR B;  2F4V Q;  1KNA A;  1STY A;  3S2H B;  4KN7 C;  4PMW A;  3UE0 A;  3HKS A;  3RR5 A;  1GO3 E;  1LTG D;  4DV5 Q;  1O7Y A;  1HNW Q;  3GTP H;  2PYK A;  1F77 A;  3KBG A;  1EY4 A;  4K0K L;  1N32 L;  4LF9 L;  2OF1 A;  2AQ2 B;  4DV2 L;  4MN3 A;  2FXQ A;  1DM0 B;  4GKJ L;  4C3H B;  1H95 A;  3BG3 A;  4LF8 Q;  2RHQ B;  1S5B D;  3VA5 A;  5EPK A;  4OGQ C;  1HQM C;  2UXD L;  1G6P A;  5ELE A;  5ELD A;  3ERQ A;  5ELC A;  1C9O A;  3TQY A;  2VNU D;  3S17 H;  3S1N B;  5AFW A;  3MEH A;  1C48 A;  4LF7 L;  2ALY B;  1PH2 A;  5JPN C;  5E4X A;  2R7D A;  3PF5 A;  3HG9 A;  1AH9 A;  1U5K A;  5C4J B;  1QNK A;  2J4X A;  1Y8O B;  2R93 B;  4X3K A;  3TSS A;  1TY2 A;  3CQZ H;  4R9W A;  4DXG A;  2NYZ D;  4QUF A;  1HPC A;  4B9W A;  1PTO F;  4RGM A;  2JSO A;  1TS3 A;  5JJK A;  1SMY D;  4WJ4 A;  1GUO A;  3UI2 A;  2JA6 G;  1I94 L;  1CA5 A;  4B3S Q;  1BXT A;  3AB9 A;  4PV1 C;  1LAB A;  1PHJ A;  2JA9 A;  4H02 A;  1HNZ L;  3NSW A;  1FNU A;  4JG2 A;  2R3Z A;  4PZ7 A;  4KD4 A;  1JB7 A;  1FJG Q;  1YJN A;  3OYY A;  3JAM E;  4LFB Q;  1SAP A;  3GTP B;  5C3W A;  2ZJR A;  4KKU A;  1VQO A;  2JQO A;  4NB3 A;  4UPA A;  1NR4 A;  4NW2 A;  3VYU A;  1J8I A;  2IX0 A;  4YCV A;  2SNM A;  2PNR C;  2GVA A;  2BA0 A;  3EJI A;  3PUW A;  2N88 A;  1EUJ A;  5FO9 B;  2KED A;  4OIJ A;  1CK1 A;  2PZU A;  2A68 C;  3QIA A;  4RCO A;  2VQE L;  2D62 A;  1PFM A;  4YWL A;  2KCT A;  2EYO A;  4NDX A;  4KHP Q;  1Q1E A;  2R92 H;  4B3M Q;  3HS0 C;  3A54 A;  3OMC A;  1KHI A;  1X3Q A;  3VYT A;  1JMC A;  4OO1 G;  2CCZ A;  2N3S A;  1Y1V H;  4O1N A;  3IRB A;  4PZ6 A;  2L15 A;  2CH4 W;  3CQZ B;  5H1S E;  3GTG B;  1GUG A;  2B3G A;  5C0X G;  4DAY A;  2YU9 H;  4DR4 Q;  3STB D;  2F3W A;  3S2H H;  2B2V C;  1OXT A;  3DUZ A;  4Y7N H;  4A93 G;  4JCV E;  3C3L A;  5JAV A;  1FGU A;  1HR0 W;  1JJG A;  3WOF A;  2UUB Q;  2EYM A;  4CDF C;  2MNA A;  1NMG A;  4X65 L;  2PPB C;  2GA4 B;  1OO9 B;  3I4N H;  1KLG D;  1QWY A;  4HSP A;  3S1M B;  4RGT A;  1F2Z A;  3Q0A A;  1RDP D;  3W1B A;  5IP7 H;  2KJX A;  1BKB A;  5IE8 A;  4RCN A;  1CFM A;  1WYD A;  2MQH A;  1NR2 A;  5GRO A;  2MGS A;  2PO4 A;  1U4L A;  4K5X A;  2HQE A;  2NVQ B;  4YWM A;  4OHJ A;  1G8Z D;  3A55 A;  4GNX A;  1I3Q H;  1D5X C;  1P8L A;  1ICW A;  3NQI A;  4FDB A;  3UDG A;  2I5M X;  5I2X A;  1YIT A;  4A3L H;  4R4T A;  1PV4 A;  4A3B B;  1YNN D;  1ZYR D;  3AFQ A;  1HTL D;  4K8I A;  5I9P A;  5AJ3 L;  2L5T A;  2UUC L;  1YJ9 A;  1LV9 A;  4C3J H;  4HIO A;  1HA5 A;  4Q0F A;  4UAI A;  2RA4 A;  5CR3 A;  4OWT B;  2RDF A;  4YHH Q;  1TVX A;  4KMU C;  2FMC A;  3FHW A;  4S3S A;  3FDT A;  1EIF A;  4YCW A;  2EY2 A;  3UDF A;  1I6H H;  4JI5 Q;  2DY7 A;  3S16 B;  2OQK A;  2NWG A;  2YTX A;  4DR5 L;  2CKZ B;  5IGD A;  1CKO A;  2RBM A;  3RZD H;  1DOL A;  3NTI A;  1EQR A;  2VW9 A;  5C44 B;  4DV2 Q;  2EVB A;  4DV6 L;  1PZI D;  4RH6 A;  4DR7 Q;  4FF1 A;  1LLR D;  2AWN A;  4O2D A;  1Z6H A;  3DEO A;  1DGS A;  3S1M H;  1TWC H;  2E2D C;  3HOX B;  2AQ3 B;  2K5D A;  1RTN A;  4A3D H;  1SRO A;  3J80 E;  1Q46 A;  2JE6 I;  2D9U A;  2VZA A;  2XVS A;  2HT1 A;  3RN5 A;  2OT2 A;  2OTJ A;  5JVG 3;  3G4S A;  4IPC A;  3TN2 A;  4KN4 C;  3I72 A;  2VS1 A;  1V1Q A;  4X64 Q;  3D4W A;  1VQN A;  2TSS A;  5E3F A;  3GQB A;  2QA4 A;  4N8X 1;  4IUT A;  4OXP A;  4FXK C;  5ISR A;  1IBM L;  4TKO B;  1AW7 A;  5FOB B;  1Y1W G;  2D2C C;  1FJG L;  2B8G A;  4A3F G;  1EOT A;  2EJM A;  2F03 A;  3M9B A;  3V96 A;  1SMX A;  2CFM A;  3VR3 A;  5GAE C;  1B8A A;  4UP8 A;  4X3U A;  4IPG A;  2JN4 A;  3HKZ G;  2DJG C;  4XDX A;  3BVZ A;  4MTN A;  1PFS A;  5M3F B;  1STN A;  3I3C A;  1L1O A;  1E1O A;  3HGB A;  3SEB A;  4KTA A;  2NB0 A;  1UE7 A;  4C3I B;  3D4D A;  1Q86 C;  3DMU A;  2H5X A;  4A3C H;  2F3I A;  3F2C A;  2Q8R E;  2KEE A;  4ZRZ A;  1Z7T A;  2WAC A;  4J6H A;  2NTS A;  2B2W A;  5LMU L;  1LTS D;  4JC0 A;  5D3I B;  1RL2 A;  4A3M G;  1EL0 A;  2Z0S A;  4A3G G;  1BDO A;  2QEJ C;  1M4V A;  4K5W A;  3AQQ A;  4A75 A;  4A3J B;  1I6V C;  1M8A A;  2AQ1 B;  2K32 A;  2F0D A;  4A76 A;  2HIV A;  1ZEQ X;  1F9S A;  1I6H B;  2EY5 A;  5CBA E;  1YNN C;  5C44 G;  3I2Z A;  4JI7 L;  4FP5 D;  1EFI D;  2NN6 G;  3CRL C;  3TRE A;  3E9I A;  3LWE A;  1FNW A;  4AQY Q;  2K03 A;  4JI3 Q;  1BOS A;  1HNX L;  3FP9 A;  1VQD A;  1XTD A;  1SJH D;  3TS0 A;  4JI0 Q;  3K59 A;  1FL0 A;  1STA A;  4FVM A;  2IL8 A;  4POG A;  1B70 B;  2CW0 C;  1PH3 A;  4RAU C;  4A3M H;  2EJF C;  1MD2 D;  1KRS A;  2UUC Q;  4BBS G;  4FO2 A;  1Q3L A;  2ZTD A;  4YCU A;  1XPR A;  2B2Y C;  4OX9 Q;  2L11 A;  5J39 A;  1EZ6 A;  1KTK A;  3D0F A;  1TII D;  1U4R A;  2Z6K C;  3G7L A;  3KLS X;  4GKK Q;  1S4Z A;  1WTX A;  3AMU A;  5BR8 Q;  5LMN L;  3C46 A;  4JV5 L;  4P73 A;  4R4I A;  1IL2 A;  5C3X A;  3IAY A;  3QOL A;  5ELO A;  2K7V A;  2PMZ B;  5M9O A;  2E2I H;  2XSC A;  1B7Y B;  2D0O A;  5C5M A;  1IBK Q;  5M3F H;  5HGQ A;  3G71 A;  3DM1 A;  1VQG A;  1B3A A;  1CHQ D;  1BUV T;  1RHP A;  1JWS D;  1CQV A;  5I9O A;  1HFN A;  2VL6 A;  4NXN L;  1VQP A;  5C5L A;  1LT6 D;  3D31 A;  4LFC Q;  2K28 A;  3I70 A;  3NP8 A;  2NZH A;  3KFU A;  3SHL A;  3MA2 B;  3BZC A;  1SE3 A;  3URY A;  4ZKC B;  3J80 L;  3HOY G;  2ZJQ A;  4CBV A;  4X62 L;  3KLR A;  3F2U A;  4P2C B;  4JI4 L;  1IKM A;  3BJU A;  3FPU B;  1VQC A;  1I5F A;  3J7Y W;  3NWT A;  3A7A B;  1W3S A;  3IFT A;  2DUD A;  1D7Q A;  1S40 A;  1LUZ A;  4QIW B;  4DR6 Q;  3L0O A;  1CUK A;  3OWF A;  1EWI A;  4BBR H;  3CME A;  4A3I B;  4H0L C;  4I7Z C;  3VA7 A;  3U58 A;  3L2P A;  1PRT B;  4XTC S;  4PG3 A;  3D8G A;  3CP0 A;  1R4Q B;  2HDM A;  3H0G G;  3PO2 H;  2EZV A;  5IYD G;  3P1H A;  4ZUI A;  1HH2 P;  3B6Y A;  5CV4 A;  1RJT A;  2K50 A;  1A3U A;  2G9H D;  4HMJ A;  1U9R A;  2NN6 I;  3I90 A;  4DA2 A;  4DK6 C;  2KCC A;  1W6J A;  1H9S B;  2EYP A;  3IKJ A;  1E0B A;  1LTL A;  4R4C A;  3HKZ E;  2C35 B;  2UXC L;  3F8T A;  3ULJ A;  4A3E H;  1ROD A;  2KOL A;  4PQX A;  3GDE A;  3SK5 A;  2LS0 1;  2EY1 A;  2QGQ A;  1AP0 A;  4L8J A;  3HOU H;  4A3C G;  1HJP A;  4CDE C;  4GNX B;  3QR8 A;  1ILP A;  4C3J B;  2F0W A;  3CCL A;  2PCF B;  1O78 A;  1O7L A;  4A3G H;  1B4O A;  3MWY W;  3PUZ A;  4LUV A;  2A19 A;  4QJF A;  4A3B H;  4QCL A;  1K83 B;  2VQE Q;  2J7Z A;  4ZKB B;  1JE5 A;  1JR0 D;  1C0A A;  1HRJ A;  4B3M L;  1XTC D;  3HOZ H;  3PO3 H;  4DU9 A;  4JI3 L;  3STB C;  4OO1 H;  2NVX B;  1HZC A;  1BCP C;  1XMO Q;  4A3E G;  3H09 A;  1PYW D;  3MXG A;  2Q2U A;  2MFI A;  2K5H A;  1CQF A;  3S24 A;  2EYJ A;  5J1Z A;  3CCR A;  1YHQ A;  1RTO A;  3MFY A;  1ZKO A;  5IGE A;  1XNQ Q;  1SYC A;  4LF5 L;  3CF5 A;  3TP5 A;  3TP8 A;  4DV4 Q;  4U67 3;  2IPK D;  4KJN A;  1Z9F A;  2QW7 A;  4H44 C;  3TZU A;  1HNX Q;  1X3E A;  3EVQ A;  1JC7 A;  1YJW A;  2B2Y A;  4LUO A;  4TRD A;  3E3X A;  3KBX A;  2N78 A;  1EYA A;  4KHZ A;  3H0G B;  2IX3 A;  5DM7 3;  5IIF A;  3W3A A;  1IKL A;  4QY7 A;  2BH8 A;  2O4X A;  1N36 Q;  1DJR D;  3PUX A;  4K8J A;  4DAP A;  2R7F A;  2BOS A;  1G51 A;  1JT8 A;  1BNZ A;  2VXW A;  2FFK B;  3R93 A;  3AU7 A;  1EU4 A;  2LXJ A;  3MFG A;  1C8C A;  1H9J A;  2ZM6 Q;  1WTO A;  1FVI A;  3HKZ B;  3UDX A;  4JBW A;  1EEI D;  4M8A A;  3S1Q H;  4A3L G;  5E1F A;  2K14 A;  1VQ6 A;  2F0S A;  4GS3 A;  3UDI A;  1TR5 A;  4MNO A;  4BY7 H;  3NEL A;  1DON A;  2VQF Q;  5IT9 L;  3A8I E;  1AE3 A;  1OXV A;  2F0O A;  3CC4 A;  4UY8 C;  2SOB A;  4C3I G;  5D14 A;  1I4H A;  1VQE A;  2F3V A;  1HQR D;  2PW7 A;  2OEO A;  2K4K A;  2V1C C;  1LO5 D;  4IPH A;  1BBU A;  4DK1 A;  4AYB B;  4X62 Q;  3ULL A;  3GTL H;  4MTK A;  2I5L X;  3NK9 A;  2K52 A;  2HUG A;  5I6W A;  4P75 A;  4RFB A;  4DV6 Q;  4DR7 L;  3M85 A;  1JWU D;  3NEM A;  2Y0S G;  4B3R L;  3KF6 A;  4HTH A;  1Q1B A;  1JOQ A;  3GO5 A;  4J8Q A;  1EWH A;  5KIX A;  1K3B C;  3TEH B;  2UXC Q;  5KNB A;  1S72 A;  1PMR A;  1ICF B;  2DN8 A;  2RCN A;  1KXL A;  3IL8 A;  1H9M A;  3K5M A;  3SGI A;  2DGY A;  4DV7 Q;  3M4O H;  1KAW A;  1T9H A;  3QJY A;  5A2Q E;  2HIX A;  2N55 A;  2FIN B;  3J81 E;  1C4Q A;  1S5E D;  5M3M G;  1G6Z A;  4OO1 I;  1TQO A;  3E0J A;  1GUN A;  2F0J A;  5HY6 A;  1J9O A;  1QE6 A;  2GVB A;  3O13 A;  4IJH A;  1BCP F;  3ER0 A;  1ENA A;  5K36 H;  1DD2 A;  4BXX G;  2DNC A;  3GTJ H;  2PQA A;  1WCM B;  5IT9 c;  5CC4 A;  1UEA B;  1BVS A;  2V4D A;  2M9V A;  3I4M B;  3H15 A;  2UXB Q;  2D5D A;  3T1Y Q;  4RMF A;  1K9M C;  1XX8 A;  2A68 D;  3PSI A;  4A3I G;  1J5E L;  3NE5 B;  3TME A;  1NTG A;  1XYI A;  4LW1 A;  3I4N G;  1X65 A;  1I4P A;  1TXY A;  4CJ0 B;  5LMU Q;  1BCP B;  1ET9 A;  2NVT B;  4JI1 Q;  3HOW G;  5IGF A;  2E2J H;  3DWA A;  5CV9 A;  4KY7 A;  1V9P A;  1MI2 A;  4K14 A;  3PO2 B;  3KJO A;  1VF5 C;  1VQ8 A;  1A15 A;  1ENC A;  4B9X A;  4JI8 Q;  3K0Y A;  3RZO H;  4JI7 Q;  2WAQ E;  3MXN B;  2EQS A;  2Q2H A;  1PH6 A;  1GOZ A;  4LAA A;  3MZ5 A;  4DV1 Q;  1PH1 A;  5COY A;  2BE5 D;  1N32 Q;  1SJE D;  2AWO A;  3RN2 A;  3Q23 A;  1PTO D;  4DUZ L;  5FLM H;  3K7U C;  1L0X B;  1T5X D;  2K5N A;  4QGU A;  2HDL A;  4KLK A;  1LTB D;  1OXX K;  1VMC A;  2R7Z G;  4DR4 L;  1CZW A;  1IW7 C;  4BY1 B;  1WTV A;  2RSN A;  1STB A;  1K73 C;  3BVG A;  5FK9 C;  5EPJ A;  3KF6 B;  3IFD A;  2A8V A;  2TMP A;  4G7Z C;  4OON A;  4DKA C;  2G5D A;  4IZ8 A;  3CPW A;  3KOJ A;  5COR A;  2A6E D;  3A5Z B;  3FEW X;  1R9T B;  1PRT C;  1HA6 A;  3RD4 A;  4BS9 A;  1EY8 A;  4N8F A;  3DHQ A;  4K0K Q;  2B29 A;  2X69 A;  3OTO L;  4HIK A;  2F0I A;  2XNA C;  1MSH A;  1OXS C;  1A3V A;  3ONA B;  2K5V A;  1XXG A;  1LTT D;  2XWB B;  4P74 A;  1VQA A;  4I7A A;  1WCM G;  4BA1 I;  4XT1 B;  3LWU A;  1AFP A;  1GHK A;  4R8N A;  2B8F A;  5IGC A;  1PVO A;  2VUM G;  4IUU A;  1NMF A;  5DLQ E;  4V19 0;  4DV0 Q;  2D0P A;  3OOC A;  2F0P A;  2XRQ D;  1PTO B;  1K83 H;  5M3F G;  1Q8I A;  1A8V A;  2A6H C;  3SVM A;  5C4X B;  5CV7 A;  1EU3 A;  3L7Z C;  3VR4 A;  4RKL A;  3EA6 A;  3H6M A;  5K5P A;  1GJX A;  2H1E A;  3N52 A;  3K8A A;  2AKW B;  4A3F H;  4EQP A;  3HOY H;  1K8A C;  3H94 A;  1UWV A;  1SNC A;  5LMN W;  4PZ8 A;  2BH2 A;  2PI2 A;  3JAM c;  1D1K A;  1MKH A;  5E4W C;  4F7X A;  4JYA Q;  4QQB X;  1Q90 A;  1KDC A;  5CV6 A;  3GTM H;  2MHV A;  2JXM B;  4DN4 M;  2E75 C;  3J7A F;  4R4Q A;  2B63 B;  4RHS A;  4KV6 A;  2HCC A;  4QL5 A;  5C4H A;  4G4K A;  3BS1 A;  2JA6 H;  1J5E Q;  4KK7 A;  3TP6 A;  4RGN A;  1E2W A;  1L2F A;  2WKD A;  1ESR A;  3WWV A;  1VQ4 A;  5IOC A;  5IP9 H;  1N33 L;  4MZ9 A;  1CI3 M;  2I0Q A;  1GUW A;  1DOK A;  1VCI A;  1Y8N B;  1NY4 A;  3OPO A;  5M5Y B;  1J6Q A;  2ZTC A;  3S1Q B;  3S1N H;  1U4P A;  4BBS B;  3ITP A;  4LF6 L;  3BVM A;  3LX0 A;  1ASZ A;  3HOU G;  5I6Y A;  4V0B A;  3VDY A;  1I50 B;  1K0R A;  2WV6 D;  4C2M B;  1E7Z A;  3AYH B;  4GLA C;  5GQO A;  2SNS A;  2QF7 A;  5IP9 G;  2RDG A;  5JVH 3;  3CCV A;  1IBL Q;  1GHJ A;  5LHY 1;  1KAB A;  3M3Y H;  3J7Z C;  4DUY L;  2NN6 H;  4G7O C;  2YYZ A;  3M7N A;  4ABN A;  1O7I A;  3PIP 3;  3ERS X;  4Z9C B;  4BWG B;  2YTV A;  1SND A;  3EBE A;  4YWK A;  4IPD A;  3QB3 A;  3EN2 A;  1KAA A;  4HIM A;  1K8M A;  2MP1 A;  2UU9 L;  4JBM A;  2EE1 A;  2QDL A;  4X66 Q;  2KCM A;  3Q24 A;  4DV4 L;  4A93 H;  3W2D A;  5ELF A;  1K8O A;  4JI5 L;  1JB3 A;  5JOB A;  4P72 A;  4KHV A;  3V05 A;  2R7Z H;  3BYY B;  1FNV A;  4A3K B;  1GUT A;  2A1A A;  1UEB A;  2JA8 H;  1PH9 A;  1PH7 A;  3DWQ A;  2F0M A;  3K81 C;  1IL8 A;  2VQF L;  3I4M G;  3U4Z A;  1NSN S;  4QUC A;  4QF4 A;  1X56 A;  3HOV G;  3PO3 B;  3L9A X;  2R92 B;  1NBW A;  2HHH L;  5HUR A;  1N36 L;  2RHS B;  1HFG A;  4DR1 Q;  1X6O A;  2R93 H;  5FLX c;  4CDC C;  5EAY A;  4DV0 L;  2PZT A;  4GOP A;  3QG1 A;  3SR1 A;  5JPM C;  5EGT A;  1WTH A;  2A73 B;  1YIJ A;  2B63 G;  1WCM H;  3TZD A;  4DV5 L;  2WIN B;  3HP3 A;  4YY3 Q;  2WP8 J;  3H91 A;  3I7F A;  2YU9 B;  2EYL A;  4A3J H;  1SDF A;  3F2D A;  1PDQ A;  2ZJP A;  2E74 C;  4OWW B;  2CHB D;  4OEM B;  2NVX H;  3TDQ A;  1OTC A;  3CC2 A;  3H0G H;  1JQY D;  1VQB A;  5FLX E;  3KLW A;  4XT3 B;  1SNQ A;  1YNX A;  3K5L A;  4HJ5 A;  3J81 i;  2Z9H A;  4WJ3 M;  4IUR A;  1MBY A;  3I4L A;  1N34 Q;  3BDL A;  1XPO A;  1KIX A;  1TU2 B;  1ZYR C;  2O2L D;  3MXP A;  5GAG C;  4IFD J;  1CT1 D;  2JP1 A;  2AUK A;  4ULL A;  2Z8L A;  1GKH A;  2JA5 B;  5K36 G;  2R61 A;  2NZ1 D;  3NUC A;  2EY6 A;  4IQZ A;  4JYA L;  2I5H A;  4CJ2 C;  4LF8 L;  2XN9 C;  2P5Z X;  4PMB A;  4BY1 G;  1LYL A;  2CQA A;  5J3B A;  2ATW A;  4X64 L;  2WB1 G;  4LFC L;  1IXR A;  1LTI D;  2CQO A;  2BA1 A;  4CJ1 B;  1KDB A;  1N33 Q;  1F2L A;  2XWJ B;  1IBM Q;  4LFB L;  3H3V H;  5C44 H;  1SMY C;  3T53 B;  3KJP A;  3M4Q A;  4DR2 Q;  1WTQ A;  1GUS A;  3FKI H;  2C9O A;  2K05 A;  4GOP B;  3HOZ B;  5EBD A;  3GV3 A;  2KCN A;  5FLX L;  1G29 1;  4DAM A;  2R7Z B;  2UXB L;  4JBK A;  4H13 C;  2JK8 A;  1STG A;  4A3K H;  2QDB A;  2O5J C;  4ODG A;  1V1O A;  1HNZ Q;  2K01 A;  4KKT A;  2B2V A;  3K6O A;  3SDZ A;  3NEN A;  2EYH A;  3SK6 A;  2KVM A;  1SFO H;  1PYB A;  2E5L L;  2Z1C A;  1HR0 Q;  1B9M A;  1F9P A;  1G2S A;  4JI6 Q;  1A2T A;  1PH8 A;  1CKM A;  1SN8 A;  5T1G A;  3J7A V;  1SR3 A;  4OEL B;  2KUM A;  3NXW A;  4ZAI A;  4DPG A;  4EGV A;  1NUC A;  3DLL A;  2LFN A;  2PI2 E;  2WAQ B;  4KY6 A;  2OCE A;  1RCV D;  3K5O A;  2RCF A;  1EYG A;  4N9T A;  3E0E A;  4WFN 3;  4HJ9 A;  2IY5 B;  2IHF A;  2VUM B;  3J81 j;  4AH6 A;  1BF4 A;  4LUZ A;  5BR8 L;  1UE1 A;  5LMN Q;  1IBL L;  3TP7 A;  4RG1 A;  1WFQ A;  4X65 Q;  1EOV A;  1X55 A;  1V8Q A;  4JI1 L;  1EIH A;  1E3P A;  1CZG A;  4LFA Q;  4A3I H;  3S15 H;  2I46 A;  1K0S A;  4N9P A;  5C4X G;  1DZ1 A;  2ZXP A;  1TS2 A;  2PQA B;  1B2T A;  5C3E B;  4HED A;  4GLV B;  2ICI A;  1Y1W B;  1Y1V G;  3ICE A;  4GKK L;  3CD6 A;  5L37 A;  3DEP A;  1Y8P B;  1HCZ A;  1NAP A;  1X3G A;  4EQN A;  2ES2 A;  1QG7 A;  4JV5 Q;  4ID6 A;  4C2M H;  3WDN A;  1ONL A;  2L12 A;  4QIW E;  4C1N I;  2UUA L;  1NE3 A;  1YVC A;  1DYQ A;  1E2V A;  2J0T D;  1HUM A;  1CHP D;  3NTH A;  4U68 A;  1EQQ A;  4BBS H;  2F0V A;  3FRP B;  3D6C A;  1P16 A;  1EIY B;  3PUY A;  2Q8I B;  2HHH Q;  1BBW A;  1KLU D;  2Y0S E;  4JBJ A;  4DR1 L;  2VB3 X;  4J1M A;  4K5V A;  3S1R B;  3ZYY X;  1A62 A;  3ULP A;  2E2H H;  3GTG H;  1Z47 A;  1Y14 B;  4NPS A;  4Y7N B;  1MIU A;  5GAH C;  3BDO A;  3CRK C;  1KL9 A;  3MC0 B;  5DAU A;  5IGG A;  2K5Q A;  1C7Y A;  4CKC A;  2RVL A;  3K7A H;  2M00 A;  1B9N A;  1SYE A;  4EX5 A;  1I4G A;  2L0C A;  1GVP A;  3I73 A;  1HZB A;  5C6A A;  4C3J G;  2RQX A;  2FJ2 A;  2QIL A;  2PNH A;  2ZM6 L;  1N34 L;  3PF4 A;  2B2T C;  2VY3 A;  1N8R C;  2F0F A;  4OL7 A;  4FXG C;  2B2T A;  5M5W H;  1RF2 D;  4HR7 B;  1K28 A;  2AHO B;  2ZXO A;  4LJZ C;  1XNR L;  4K2L A;  4R1J A;  4C56 C;  1PFB A;  4DFA A;  2SEB D;  4GN3 B;  4JI2 L;  5LL6 X;  1U4M A;  1VQ9 A;  1R9T H;  1LT3 D;  2IX1 A;  4R4O A;  1EY0 A;  1UE5 A;  1LM0 A;  1SE2 A;  2QEX A;  3C2P A;  2JA7 G;  2WB1 E;  2JJQ A;  3CC7 A;  1LT5 D;  3KF8 B;  3CCS A;  2KHJ A;  4JI6 L;  2EDG A;  2B39 A;  3I8Z A;  1TS5 A;  3LGJ A;  4K6L A;  4XIG S;  1SNM A;  3T13 A;  2JA8 B;  4A3K G;  4BY7 G;  4NKL A;  5IYD H;  3ERO A;  3T1H L;  5E7N A;  1WJJ A;  5C3E G;  1I50 H;  1TY0 A;  1L1O B;  1IZ6 A;  1K8G A;  3NWS A;  1MSG A;  2ZXR A;  1MHW C;  4IUV A;  2K33 A;  2EIF A;  3WOE A;  1VF7 A;  4OIK A;  4NXM Q;  2R92 G;  1B53 A;  5T1I A;  3S14 B;  1UE6 A;  1T5E A;  3MXU A;  1E24 A;  1A6X A;  1SE8 A;  3S1R H;  1HR0 L;  5C0X J;  1BQQ T;  2Q2I A;  5C4Z A;  5FO8 B;  4IOC A;  4A3B G;  1EQV A;  3HRZ C;  1SEB D;  3CPF A;  1NNX A;  3OW2 A;  2F1M A;  3NTK A;  3PMF A;  1HZ9 A;  4GN5 A;  1G91 A;  3FVQ A;  3PV0 A;  5JEA H;  2JA5 H;  1S5C D;  1EIG A;  1EFW A;  2NZO A;  4LF6 Q;  1MJC A;  1RIP A;  4AIM A;  1H9K A;  4L5T A;  1O80 A;  1SNO A;  4P71 A;  1SNP A;  2KEN A;  2R93 G;  4DR3 Q;  3U50 C;  3Q8D A;  3PCO B;  3I56 A;  1EY6 A;  2LXK A;  4LMQ D;  3D3R A;  4XQJ A;  2X6G A;  4FYD A;  4ZUJ A;  1PLF A;  2EYF A;  2MO1 A;  4F8M A;  3OHX C;  1B3Q A;  2Q2T A;  4LF4 Q;  3EIV A;  3HOZ G;  1E2Z A;  4K2K A;  4EVO A;  5M5W B;  2K6A A;  1F9Q A;  4X3S A;  4BXX H;  4DV3 Q;  3D6W A;  2A69 C;  1CSQ A;  2IWH A;  1JJ2 A;  2ASB A;  1EY9 A;  1W2B A;  1EY7 A;  1HZA A;  3FMC A;  3K80 C;  1XWE A;  4KHP L;  5IYC G;  1VQ7 A;  4YIJ A;  2FHT A;  2K75 A;  3GTM B;  3HZX A;  2F4V L;  3PIP A;  2VB2 X;  1TWF B;  4IUP A;  4L6T B;  1DOM A;  4UHV A;  1VMP A;  4JVZ A;  4GOP C;  1HNW L;  1JWM D;  4UP7 A;  4LF9 Q;  1S5D D;  1D1I A;  1BO0 A;  2WFW A;  2Z4H A;  2A6H D;  3GP7 A;  2XGT A;  3ND8 A;  4B3R Q;  5M5Y H;  2UXD Q;  3PUV A;  2HQL A;  3VR5 A;  3GTJ B;  2MUY A;  1GXD C;  1SSO A;  1YBY A;  1SFO B;  4FF3 A;  3S15 B;  1Q12 A;  4IFD I;  1RKN A;  2A6E C;  3E9H A;  3PQI A;  3R8B A;  3ZJY C;  4XQN A;  4FF2 A;  2QKI C;  1EYD A;  3KLS A;  2NBF A;  2F0Q A;  2NVT H;  1QVF A;  4GZY C;  2IHE A;  2F0G A;  4AYB E;  4RKB A;  1LTA D;  1F2M A;  1XNR Q;  3VR2 A;  2NVY B;  5IWA Q;  5IYC H;  5A2Q L;  1WVL A;  2PMZ E;  1TWA B;  2K5W A;  3MEF A;  3R3O A;  1EEF D;  1B50 A;  3P75 A;  5EJW A;  1CKN B;  1FYC A;  2JEB I;  2ENB A;  4C1N K;  1TT2 A;  1HTP A;  4C3I H;  3C1E A;  5JJI A;  5D3D A;  2AUJ D;  1ESF A;  5TSS A;  3KDF A;  4A3G B;  5JEA J;  3HOV B;  4JI4 Q;  3UE1 A;  3TBI B;  3F1Z A;  1ASY A;  4A3J G;  4EQO A;  1LAC A;  1PA6 A;  1XMQ Q;  3VYS A;  1GD7 A;  1KDA A;  4E6I A;  1R4P B;  3T16 A;  3PIO 3;  1Y69 U;  2G9D A;  5I4D A;  4ALP A;  4DR6 L;  1E22 A;  4YHH L;  3CW2 C;  3LNN A;  3PGZ A;  5CV8 A;  5CMD A;  3Q6S A;  4TQU S;  1QUQ A;  2EXZ A;  1QNU A;  1TWF H;  3J81 c;  2PW5 A;  5FJ8 H;  1F2Y A;  1PXU A;  4DR2 L;  2F0L A;  2E8G A;  4JOI C;  4XQQ A;  2OWO A;  3GV6 A;  2HCI A;  1A3T A;  4JOI A;  1A2U A;  4UDU C;  1Q8K A;  1V1P B;  5C3E H;  4L5R C;  4A4I A;  4APV A;  4BA2 I;  4O0A A;  2NUC A;  1X9N A;  4HCE A;  2GN5 A;  1D5M C;  5C4X H;  5JEA G;  5EBC A;  2JA5 G;  3FKI G;  4QMG A;  2EXD A;  1QVG A;  2A74 C;  1IHZ A;  4ZQ3 A;  3GTL B;  3DWP A;  4L5Q A;  2L4N A;  2BDO A;  4OWX B;  3GD7 A;  2LSS A;  2BDN A;  3T51 B;  3SE0 A;  1IYJ B;  3CCM A;  1VDZ A;  4IUQ A;  3MAQ A;  1HXY D;  3A8K E;  2JYO A;  4FXD A;  2L55 A;  4KY5 A;  1WD0 A;  4DV3 L;  4GN4 B;  3CHB D;  5M5X H;  3U9S A;  3U4V A;  2OXP A;  4EQ5 A;  4A3D G;  2QCP X;  4IN3 A;  5C0X H;  2PQE A;  5BN5 A;  1II3 A;  3KUP A;  4HN7 A;  4CDD C;  4GLX A;  1WOC A;  4B3T Q;  4IAL A;  1CA6 A;  4CKE A;  1YI2 A;  3CKI B;  5IYB G;  4K6D A;  2UUA Q;  2CH4 A;  2B2W C;  3N6R A;  3W1G A;  3VYR A;  4XYQ A;  2AMC B;  3Q22 A;  3TRZ A;  2O5I C;  3S9W A;  1NCV A;  3I4O A;  4KD3 A;  4TVA B;  2SDF A;  2CWA A;  4RGO S;  1N9W A;  4WOR A;  4C3H H;  1PH4 A;  5FKA C;  1D8L A;  3OWE B;  3EFX D;  3ND9 A;  2YTY A;  4WJW A;  5IP7 G;  3GTK B;  4HAE A;  1UUP A;  4DXF A;  4DR5 Q;  1AEX A;  2LMC B;  3G6J B;  3X3N A;  4IOA A;  1W6K A;  1ZXT A;  4X3T A;  1EQT A;  1PZJ D;  5IWA L;  1VQI A;  1IYV A;  4UP9 A;  1EYC A;  2IT1 A;  1AN8 A;  2Q8T A;  2OTL A;  3M4P A;  1EY5 A;  1JOK A;  5D65 A;  4BBR B;  1MGS A;  1PTO C;  5IT9 E;  3AEV A;  1YNJ C;  1LTR D;  2DY8 A;  5M5X B;  3X3M A;  1HUN A;  2DNE A;  2XRS D;  4POF A;  1IYU A;  2B2U C;  2YV5 A;  2F0E A;  3PIO A;  4IUN A;  5KYL A;  1XMQ L;  1KNE A;  1Y1V B;  4HCS A;  4OX9 L;  4A3M B;  3JAM i;  4NXN Q;  2F0U A;  3BZK A;  3BYT B;  2ZT9 C;  3V2T A;  3GTQ B;  3HEJ A;  2XTI A;  4IJL A;  1X3P A;  1STE A;  3RZO B;  4F88 A;  3T1H Q;  2NTT A;  4R8I A;  1VS0 A;  2H4O A;  3J80 c;  1KRT A;  1SYG A;  2X6L A;  2E2I B;  5I2Y A;  3T4A C;  4B3S L;  3S2D B;  1MJE A;  4G57 A;  4DAV A;  4NXM L;  1XJV A;  3M3Y B;  1AZP A;  3A8J E;  3J7A 5;  1D6E C;  1SYF A;  5FJ8 G;  1GM5 A;  5C0X I;  1VQM A;  3MXN A;  2NVY H;  1DCZ A;  3GTK H;  2C5C A;  5J22 A;  1F9R A;  4G7H C;  3CU7 A;  3KYH C;  1L0Y B;  3CXC A;  3VR6 A;  4RA8 A;  3K0X A;  3R2I A;  1I4X A;  3NBH B;  5CGK A;  1WTR A;  1BR9 A;  1JOO A;  1TWH B;  4H7B A;  2E76 C;  2IW3 A;  3KK7 A;  3C1F A;  3NHH A;  1I94 Q;  3HOY B;  3T1Y L;  3FPP A;  4ME5 A;  1PYS B;  3CMA A;  3GTQ H;  1QJO A;  1TS4 A;  4LNQ A;  5EKL A;  3HOV H;  1RD9 D;  2L1B A;  3CAM A;  4HJ7 A;  1QB5 D;  3PO3 G;  5KGU A;  1A63 A;  4BY1 H;  3E6Z X;  1I3Q B;  2FMM A;  4HID A;  1KQS A;  2JA7 B;  5A35 A;  1DXM A;  2BCO A;  3OMG A;  2F0K A;  2MO0 A;  5KND A;  1M1K C;  1Q82 C;  2R6G A;  1PRT F;  1O7Z A;  4BBR G;  5IGB A;  3K57 A;  3P7J A;  2KHI A;  3TS2 A;  3D4R A;  2UU9 Q;  1M90 C;  3M7G A;  5IYB H;  4DR3 L;  4BY7 B;  2KEC A;  3HFZ B;  1FR3 A;  1B1Z A;  1JCK B;  2Z6B A;  3MVV A;  4JK1 C;  4HSV A;  2LY7 A;  2MJ8 A;  4MIU A;  4A3F B;  1CM9 A;  1VQF A;  1X32 A;  4AYB G;  2KQ3 A;  2IJ0 A;  5DEH A;  3HOX H;  1IBK L;  3SK4 A;  1XPU A;  4RHR A;  2JA6 B;  2WKC A;  2Y0S B;  1HHV A;  4ZYS A;  1D2B A;  2KA7 A;  3NBH A;  5DNF A;  4LF5 Q;  2BE5 C;  1WTP A;  5JJZ A;  3FKI B;  4JI8 L;  1SYD A;  3R2T A;  1IW7 D;  5IY0 A;  4M1U B;  2JEA I;  3AFP A;  1VQ5 A;  1LT4 D;  4KJO A;  1L0W A;  4DV1 L;  2WB1 B;  4B08 A;  3I91 A;  4KKS A;  3CCQ A;  1XMO L;  1A0I A;  3I4M H;  3S2D H;  3K5N A;  4DNI A;  5CYU A;  3HOW H;  3HOX G;  5ELB A;  1ET6 A;  4DNT B;  5C4J H;  3OTO Q;  1Q81 C;  4J15 A;  1SLJ A;  3J81 L;  4DGZ A;  1PRT D;  2EPB A;  3CCU A;  2RSO A;  4ILW A;  3HOU B;  5KEE A;  1VQJ A;  1S3O A;  5FLM G;  1WTW A;  2B2U A;  3NPP A;  1QCB D;  1PH5 A;  2OQ0 A;  4A3D B;  4A3E B;  3T56 B;  3NBI A;  1YZ6 A;  5HGT A;  1SRU A;  1QVC A;  4DF7 A;  4IFD H;  3BU2 A;  5KRU A;  1QOH A;  2L9H A;  4O42 A;  1CKN A;  2E2J B;  1CSP A;  1KD1 C;  1TWH H;  4DK0 A;  5GAD C;  2RKS A;  4Y52 H;  3L3O C;  3KDF B;  3I55 A;  1KC8 C;  1TWG H;  1ML0 D;  1UNS A;  4QB4 A;  3RLN A;  2XIW A;  2KBN A;  1ILQ A;  1VQH A;  3OSO A;  4A93 B;  4XYO A;  4MHE A;  4TSS A;  1JJC B;  4CKB A;  1X54 A;  3A0J A;  3M4O B;  3CCE A;  3RUZ A;  2WII B;  4ZK9 B;  4JW0 A;  4CGY B;  3I4N B;  1Y1W H;  4WRD A;  5EPL A;  4HJA A;  5EKI A;  2CWP A;  3SXH A;  1NJI C;  1TKW B;  3OIP A;  5BN3 A;  5G3L D;  4FNF A;  1I4Q A;  1PZK D;  1D5Z C;  3HOW B;  1EWC A;  3U9O A;  3P20 A;  4ZCK A;  3OW7 A;  5IOD A;  4RWS C;  4GKJ Q;  4F87 A;  2KHS A;  3PO2 G;  1PFN A;  5DM6 3;  4IFD G;  3EQL C;  2VUM H;  1H9R A;  1UAP A;  1JOR A;  1YHB A;  1X3F A;  3GTO B;  1TWA H;  3A56 A;  3K7A B;  4IO9 A;  3OIQ A;  1VQL A;  1SYB A;  4LF7 Q;  3G6E A;  3RNU A;  5LL6 S;  5F2D A;  5CV5 A;  4DAY B;  2E5L Q;  3H3V C;  5EKK A;  2MPM A;  1JIC A;  1YEZ A;  2E2H B;  2K04 A;  2Z4I A;  4Q5V A;  1S5F D;  3G48 A;  4KI0 A;  5M3M H;  3A5U A;  2ID0 A;  2F4I A;  1QZG A;  3E5S A;  1QIL A;  2LKV A;  2EOT A;  3A74 A;  5EQ0 A;  3JC6 6;  1XNQ L;  4PMC A;  3A7L A;  4C3H G;  3DM3 A;  1L1O C;  1PTO H;  5KYI A;  4B3T L;  2F0N A;  3DXJ C;  1E1T A;  5G3L F;  2NVQ H;  3BDC A;  3K58 A;  4FF4 A;  4JPB W;  1I4R A;  1TWG B;  2I07 B;  3SK8 A;  4DV7 L;  3J80 i;  4LFA L;  1VQK A;  3S16 H;  4LWC A;  4HJ8 A;  1WI5 A;  2DJF C;  5FO7 B;  1JE4 A;  4X6A H;  1ENF A;  1U0L A;  5ELN A;  5BN4 A;  3W5O A;  3JAM L;  1FGB D;  3RMH A;  1TWC B;  2RDH A;  3CCJ A;  1K3R A;  2M2L A;  2A5H A;  1V1P A;  4AQY L;  1AE2 A;  4L63 B;  4NMZ A;  4DUY Q;  1B44 D;  3QOJ A;  4L5S A;  4ME3 A;  4XXE A;  5M3M B;  1V43 A;  3S17 B;  1OXU A;  3MHB A;  2B63 H;  2K1B A;  4PNY A;  1YHA A;  2RF4 A;  4ZLT F;  1SE4 A;  2A69 D;  2F0T A;  3H3V I;  2F0H A;  3GTO H;  4X66 L;  5JJL A;  2PZW A;  2CVR A;  3KF8 A;  1H9S A;  2CW0 D;  3RZD B;  2UUB L;  1CTM A;  2EJG C;  2N8N A;  3NQT A;  3QO2 A;  5NUC A;  1FD7 D;  1STH A;  3RLF A;  4LF4 L;  2JA7 H;  1Q7Y C;  1BBX C;  4CHT B;  4DUZ Q;  1SXT A;  1QUQ B;  4YY3 L;  1BCP D;  4NP5 A;  2Z6K A;  4JI0 L;  5AJ3 Q;  4HMI A;  3M4Y A;  1WD1 A;  2N49 A;  5CBE E;  2ZTE A;  2ICE C;  2F52 A;  4LK1 C;  1QZH A;  1AZQ A;  1SBB B;  3S14 H;  4GNX C;  2HD3 A;  4JI2 Q;  1EZ8 A;  2WAQ G;  1G2T A;  3F2B A;  3RLO A;  5KNC A;  1YNJ D;  4I65 A;  2JA8 G;  3BZD B;  3QWN A;  4DK3 C; 
#chains in the Genus database with same CATH homology
 3MTS A;  4DNR B;  1KNA A;  1STY A;  3S2H B;  4KN7 C;  4PMW A;  1LTG D;  1O7Y A;  2PYK A;  1F77 A;  3KBG A;  1EY4 A;  2OF1 A;  2AQ2 B;  4MN3 A;  1DM0 B;  4C3H B;  3BG3 A;  3VA5 A;  1S5B D;  5EPK A;  4OGQ C;  1HQM C;  5ELE A;  5ELD A;  3ERQ A;  5ELC A;  2VNU D;  3S1N B;  5AFW A;  3MEH A;  1C48 A;  5JPN C;  5E4X A;  3HG9 A;  5C4J B;  1QNK A;  2J4X A;  1Y8O B;  2R93 B;  4X3K A;  3TSS A;  1TY2 A;  4R9W A;  4DXG A;  2NYZ D;  4QUF A;  1HPC A;  4B9W A;  1PTO F;  4RGM A;  2JSO A;  1TS3 A;  1SMY D;  1GUO A;  3UI2 A;  1CA5 A;  1BXT A;  3AB9 A;  4PV1 C;  1LAB A;  3NSW A;  1FNU A;  2R3Z A;  4KD4 A;  3JAM E;  1SAP A;  3GTP B;  5C3W A;  4KKU A;  1NR4 A;  4NW2 A;  3VYU A;  1J8I A;  2IX0 A;  2SNM A;  2PNR C;  2BA0 A;  3EJI A;  3PUW A;  2N88 A;  5FO9 B;  2KED A;  4OIJ A;  1CK1 A;  2PZU A;  2A68 C;  3QIA A;  4RCO A;  2D62 A;  1PFM A;  2EYO A;  4NDX A;  1Q1E A;  3HS0 C;  3A54 A;  3OMC A;  1X3Q A;  3VYT A;  4OO1 G;  4O1N A;  3CQZ B;  3GTG B;  1GUG A;  5C0X G;  4DAY A;  2F3W A;  2B2V C;  1OXT A;  3DUZ A;  3C3L A;  5JAV A;  3WOF A;  2EYM A;  2PPB C;  2GA4 B;  1OO9 B;  1KLG D;  1QWY A;  4HSP A;  3S1M B;  4RGT A;  1F2Z A;  3Q0A A;  1RDP D;  2KJX A;  4RCN A;  1CFM A;  1NR2 A;  2MGS A;  2PO4 A;  1U4L A;  4K5X A;  2HQE A;  2NVQ B;  1G8Z D;  3A55 A;  4OHJ A;  1D5X C;  1ICW A;  3NQI A;  5I2X A;  4A3B B;  1YNN D;  1ZYR D;  1HTL D;  4K8I A;  5I9P A;  2L5T A;  1LV9 A;  1HA5 A;  4Q0F A;  4UAI A;  2RA4 A;  5CR3 A;  2RDF A;  1TVX A;  4KMU C;  2FMC A;  4S3S A;  3FDT A;  2EY2 A;  2DY7 A;  3S16 B;  2NWG A;  5IGD A;  2RBM A;  1DOL A;  3NTI A;  5C44 B;  2EVB A;  1PZI D;  4RH6 A;  4FF1 A;  1LLR D;  2AWN A;  1Z6H A;  3DEO A;  2E2D C;  3HOX B;  2AQ3 B;  2K5D A;  1RTN A;  3J80 E;  2JE6 I;  2D9U A;  2XVS A;  2OT2 A;  5JVG 3;  3TN2 A;  4KN4 C;  3I72 A;  3D4W A;  2TSS A;  5E3F A;  3GQB A;  4IUT A;  5ISR A;  4FXK C;  4TKO B;  1AW7 A;  5FOB B;  2D2C C;  2B8G A;  1EOT A;  2EJM A;  2F03 A;  3V96 A;  3VR3 A;  4X3U A;  4XDX A;  3BVZ A;  5M3F B;  1STN A;  3I3C A;  3HGB A;  3SEB A;  4KTA A;  2NB0 A;  4C3I B;  3D4D A;  3DMU A;  2Q8R E;  2KEE A;  4ZRZ A;  1Z7T A;  2WAC A;  4J6H A;  2NTS A;  2B2W A;  1LTS D;  5D3I B;  1EL0 A;  1BDO A;  2QEJ C;  1M4V A;  4K5W A;  4A3J B;  1I6V C;  1M8A A;  2AQ1 B;  2K32 A;  2F0D A;  1ZEQ X;  1F9S A;  1I6H B;  2EY5 A;  5CBA E;  1YNN C;  4FP5 D;  1EFI D;  2NN6 G;  3CRL C;  3LWE A;  1FNW A;  2K03 A;  1BOS A;  1SJH D;  3K59 A;  1STA A;  4FVM A;  2IL8 A;  2CW0 C;  4RAU C;  2EJF C;  1MD2 D;  4FO2 A;  1Q3L A;  2B2Y C;  2L11 A;  5J39 A;  1EZ6 A;  1KTK A;  1TII D;  1U4R A;  3G7L A;  3KLS X;  1S4Z A;  1WTX A;  3AMU A;  3C46 A;  5C3X A;  3IAY A;  3QOL A;  2K7V A;  2PMZ B;  5M9O A;  2XSC A;  5C5M A;  3DM1 A;  1B3A A;  1CHQ D;  1BUV T;  1RHP A;  1JWS D;  1CQV A;  5I9O A;  1HFN A;  5C5L A;  1LT6 D;  3D31 A;  2K28 A;  3I70 A;  3NP8 A;  3SHL A;  3MA2 B;  1SE3 A;  3URY A;  4ZKC B;  3J80 L;  4CBV A;  3KLR A;  3F2U A;  4P2C B;  1IKM A;  3FPU B;  3J7Y W;  3NWT A;  3A7A B;  3IFT A;  4QIW B;  3OWF A;  4A3I B;  4H0L C;  4I7Z C;  3VA7 A;  1PRT B;  4XTC S;  3D8G A;  1R4Q B;  2HDM A;  2EZV A;  3P1H A;  4ZUI A;  5CV4 A;  1RJT A;  1A3U A;  2G9H D;  1U9R A;  4HMJ A;  2NN6 I;  3I90 A;  4DA2 A;  2KCC A;  1W6J A;  1H9S B;  2EYP A;  3IKJ A;  1E0B A;  1ROD A;  2KOL A;  4PQX A;  3SK5 A;  2LS0 1;  2EY1 A;  1AP0 A;  4L8J A;  1ILP A;  4C3J B;  2F0W A;  2PCF B;  1O78 A;  1O7L A;  1B4O A;  3MWY W;  3PUZ A;  4QCL A;  1K83 B;  2J7Z A;  4ZKB B;  1JR0 D;  1HRJ A;  1XTC D;  4DU9 A;  4OO1 H;  2NVX B;  1BCP C;  3H09 A;  1PYW D;  3MXG A;  1CQF A;  2EYJ A;  5J1Z A;  1RTO A;  3MFY A;  1ZKO A;  5IGE A;  1SYC A;  3TP5 A;  3TP8 A;  4U67 3;  2IPK D;  4KJN A;  4H44 C;  3TZU A;  3EVQ A;  1JC7 A;  2B2Y A;  4TRD A;  3KBX A;  1EYA A;  4KHZ A;  3H0G B;  2IX3 A;  5DM7 3;  5IIF A;  3W3A A;  1IKL A;  2O4X A;  1DJR D;  3PUX A;  4K8J A;  4DAP A;  2BOS A;  1BNZ A;  2VXW A;  2FFK B;  3R93 A;  3AU7 A;  1EU4 A;  3MFG A;  1C8C A;  1H9J A;  1WTO A;  3HKZ B;  4JBW A;  1EEI D;  4M8A A;  5E1F A;  2F0S A;  1TR5 A;  1DON A;  5IT9 L;  3A8I E;  1OXV A;  2F0O A;  2SOB A;  4C3I G;  5D14 A;  1I4H A;  2F3V A;  1HQR D;  2PW7 A;  2OEO A;  1LO5 D;  4DK1 A;  4AYB B;  3NK9 A;  5I6W A;  2HUG A;  4RFB A;  3M85 A;  1JWU D;  4HTH A;  1Q1B A;  1JOQ A;  3GO5 A;  4J8Q A;  1EWH A;  5KIX A;  5KNB A;  1PMR A;  2DN8 A;  3IL8 A;  1H9M A;  3K5M A;  3QJY A;  5A2Q E;  2N55 A;  3J81 E;  2FIN B;  1C4Q A;  1S5E D;  1G6Z A;  4OO1 I;  1TQO A;  3E0J A;  1GUN A;  2F0J A;  1J9O A;  1QE6 A;  3O13 A;  1BCP F;  1ENA A;  5K36 H;  1DD2 A;  2DNC A;  1WCM B;  5CC4 A;  1UEA B;  2V4D A;  2M9V A;  3I4M B;  2D5D A;  1XX8 A;  2A68 D;  3NE5 B;  3TME A;  1XYI A;  1I4P A;  4CJ0 B;  1BCP B;  1ET9 A;  2NVT B;  5IGF A;  3DWA A;  5CV9 A;  4KY7 A;  1MI2 A;  4K14 A;  3PO2 B;  1VF5 C;  1A15 A;  1ENC A;  4B9X A;  3K0Y A;  1GOZ A;  4LAA A;  3MZ5 A;  5COY A;  2BE5 D;  1SJE D;  2AWO A;  3Q23 A;  1PTO D;  1L0X B;  1T5X D;  2HDL A;  1LTB D;  1OXX K;  1VMC A;  1CZW A;  1IW7 C;  4BY1 B;  1WTV A;  2RSN A;  1STB A;  3BVG A;  5FK9 C;  5EPJ A;  3IFD A;  2TMP A;  4G7Z C;  4IZ8 A;  5COR A;  2A6E D;  3FEW X;  1R9T B;  1PRT C;  1HA6 A;  3RD4 A;  4BS9 A;  1EY8 A;  3DHQ A;  2X69 A;  2F0I A;  2XNA C;  1MSH A;  1OXS C;  1A3V A;  3ONA B;  1XXG A;  1LTT D;  2XWB B;  4BA1 I;  4XT1 B;  3LWU A;  1AFP A;  1GHK A;  4R8N A;  2B8F A;  5IGC A;  4IUU A;  4V19 0;  3OOC A;  2F0P A;  2XRQ D;  1PTO B;  1Q8I A;  2A6H C;  3SVM A;  5C4X B;  5CV7 A;  1EU3 A;  3L7Z C;  3VR4 A;  4RKL A;  3EA6 A;  3H6M A;  5K5P A;  1GJX A;  2H1E A;  3N52 A;  4EQP A;  3H94 A;  1SNC A;  1D1K A;  5E4W C;  4F7X A;  1Q90 A;  1KDC A;  5CV6 A;  2MHV A;  2JXM B;  4DN4 M;  2E75 C;  3J7A F;  2B63 B;  4RHS A;  4KV6 A;  2HCC A;  5C4H A;  4G4K A;  3BS1 A;  4KK7 A;  3TP6 A;  4RGN A;  1E2W A;  2WKD A;  1ESR A;  5IOC A;  1CI3 M;  1GUW A;  1DOK A;  1VCI A;  1Y8N B;  3OPO A;  5M5Y B;  3S1Q B;  1U4P A;  4BBS B;  3ITP A;  3BVM A;  3LX0 A;  5I6Y A;  4V0B A;  1I50 B;  2WV6 D;  4C2M B;  2SNS A;  2QF7 A;  2RDG A;  5JVH 3;  1GHJ A;  5LHY 1;  1KAB A;  2NN6 H;  4G7O C;  2YYZ A;  3M7N A;  4ABN A;  3PIP 3;  4Z9C B;  4BWG B;  1SND A;  3QB3 A;  1KAA A;  1K8M A;  2MP1 A;  2EE1 A;  3Q24 A;  3W2D A;  5ELF A;  1K8O A;  1JB3 A;  5JOB A;  4KHV A;  3V05 A;  3BYY B;  1FNV A;  4A3K B;  1GUT A;  3DWQ A;  2F0M A;  1IL8 A;  1NSN S;  4QUC A;  4QF4 A;  3PO3 B;  3L9A X;  2R92 B;  5HUR A;  1HFG A;  2PZT A;  3QG1 A;  3SR1 A;  5JPM C;  5EGT A;  2A73 B;  3TZD A;  2WIN B;  3HP3 A;  2WP8 J;  3H91 A;  2YU9 B;  2EYL A;  1SDF A;  1PDQ A;  2E74 C;  2CHB D;  3TDQ A;  1JQY D;  5FLX E;  4XT3 B;  1SNQ A;  3K5L A;  4IUR A;  1MBY A;  3I4L A;  3BDL A;  1TU2 B;  1ZYR C;  2O2L D;  3MXP A;  4IFD J;  1CT1 D;  2JP1 A;  2AUK A;  4ULL A;  2Z8L A;  2JA5 B;  5K36 G;  2R61 A;  2NZ1 D;  3NUC A;  2EY6 A;  4IQZ A;  4CJ2 C;  2XN9 C;  4PMB A;  2CQA A;  1LTI D;  2BA1 A;  4CJ1 B;  1KDB A;  1F2L A;  2XWJ B;  1SMY C;  3T53 B;  1WTQ A;  1GUS A;  2C9O A;  2K05 A;  3HOZ B;  5EBD A;  3GV3 A;  2KCN A;  5FLX L;  1G29 1;  2R7Z B;  4H13 C;  1STG A;  2QDB A;  2O5J C;  4ODG A;  1V1O A;  2K01 A;  4KKT A;  2B2V A;  3K6O A;  3SDZ A;  2EYH A;  3SK6 A;  2KVM A;  2Z1C A;  1B9M A;  1F9P A;  1G2S A;  1A2T A;  5T1G A;  3J7A V;  2KUM A;  3NXW A;  4ZAI A;  4EGV A;  1NUC A;  2LFN A;  2WAQ B;  4KY6 A;  1RCV D;  3K5O A;  4N9T A;  4WFN 3;  2VUM B;  1BF4 A;  3TP7 A;  1V8Q A;  1EIH A;  1CZG A;  2I46 A;  4N9P A;  1DZ1 A;  2ZXP A;  1TS2 A;  1B2T A;  5C3E B;  4HED A;  2ICI A;  1Y1W B;  3DEP A;  1Y8P B;  1HCZ A;  1NAP A;  4EQN A;  1QG7 A;  4ID6 A;  3WDN A;  1ONL A;  2L12 A;  4C1N I;  1DYQ A;  1E2V A;  2J0T D;  1HUM A;  1CHP D;  3NTH A;  4U68 A;  2F0V A;  3FRP B;  3D6C A;  3PUY A;  2Q8I B;  1KLU D;  2VB3 X;  4J1M A;  4K5V A;  3S1R B;  3ZYY X;  1Z47 A;  4Y7N B;  3BDO A;  3CRK C;  3MC0 B;  5DAU A;  5IGG A;  2K5Q A;  4CKC A;  2RVL A;  2M00 A;  1B9N A;  1SYE A;  1I4G A;  2L0C A;  3I73 A;  5C6A A;  4C3J G;  2RQX A;  2FJ2 A;  2QIL A;  2B2T C;  2F0F A;  4OL7 A;  4FXG C;  2B2T A;  1RF2 D;  4HR7 B;  2ZXO A;  4LJZ C;  4K2L A;  4C56 C;  1PFB A;  4DFA A;  2SEB D;  5LL6 X;  1U4M A;  1LT3 D;  2IX1 A;  1EY0 A;  1SE2 A;  3C2P A;  1LT5 D;  2EDG A;  2B39 A;  3I8Z A;  1TS5 A;  4K6L A;  4XIG S;  1SNM A;  2JA8 B;  3T13 A;  4NKL A;  3ERO A;  1TY0 A;  3NWS A;  1MSG A;  2ZXR A;  4IUV A;  2K33 A;  3WOE A;  1VF7 A;  4OIK A;  1B53 A;  5T1I A;  3S14 B;  1T5E A;  3MXU A;  1A6X A;  5C0X J;  1BQQ T;  5C4Z A;  5FO8 B;  1EQV A;  3HRZ C;  1SEB D;  2F1M A;  3NTK A;  3PMF A;  1G91 A;  3FVQ A;  3PV0 A;  5JEA H;  1S5C D;  1EIG A;  1H9K A;  1O80 A;  1SNO A;  1SNP A;  1EY6 A;  4LMQ D;  3D3R A;  4XQJ A;  2X6G A;  4FYD A;  4ZUJ A;  1PLF A;  2EYF A;  4F8M A;  3OHX C;  1E2Z A;  4K2K A;  4EVO A;  5M5W B;  2K6A A;  1F9Q A;  4X3S A;  3D6W A;  2A69 C;  2IWH A;  1EY9 A;  1EY7 A;  3FMC A;  1XWE A;  4YIJ A;  2FHT A;  3GTM B;  3HZX A;  2VB2 X;  1TWF B;  4IUP A;  4L6T B;  1DOM A;  1VMP A;  1JWM D;  1S5D D;  1D1I A;  1BO0 A;  2Z4H A;  2A6H D;  3GP7 A;  3ND8 A;  3PUV A;  3VR5 A;  3GTJ B;  2MUY A;  1GXD C;  1SSO A;  1SFO B;  4FF3 A;  3S15 B;  1Q12 A;  4IFD I;  1RKN A;  2A6E C;  4XQN A;  3R8B A;  4FF2 A;  2QKI C;  1EYD A;  3KLS A;  2NBF A;  2F0Q A;  4GZY C;  2F0G A;  4RKB A;  1LTA D;  1F2M A;  3VR2 A;  2NVY B;  5A2Q L;  1WVL A;  1TWA B;  2K5W A;  3R3O A;  1EEF D;  1B50 A;  3P75 A;  5EJW A;  1FYC A;  2JEB I;  2ENB A;  4C1N K;  1TT2 A;  1HTP A;  3C1E A;  5D3D A;  2AUJ D;  1ESF A;  5TSS A;  4A3G B;  5JEA J;  3HOV B;  3TBI B;  4EQO A;  1LAC A;  3VYS A;  1KDA A;  4E6I A;  1R4P B;  3T16 A;  3PIO 3;  1Y69 U;  2G9D A;  5I4D A;  3LNN A;  5CV8 A;  5CMD A;  3Q6S A;  4TQU S;  2EXZ A;  1QNU A;  2PW5 A;  1F2Y A;  1PXU A;  2F0L A;  4XQQ A;  3GV6 A;  2HCI A;  1A3T A;  1A2U A;  4UDU C;  1V1P B;  4BA2 I;  2NUC A;  4HCE A;  1D5M C;  5JEA G;  5EBC A;  4QMG A;  2A74 C;  1IHZ A;  4ZQ3 A;  3GTL B;  3DWP A;  2L4N A;  2BDO A;  3GD7 A;  2BDN A;  3T51 B;  3SE0 A;  1VDZ A;  4IUQ A;  3MAQ A;  1HXY D;  3A8K E;  2JYO A;  4FXD A;  2L55 A;  4KY5 A;  1WD0 A;  3CHB D;  3U9S A;  2OXP A;  2QCP X;  4IN3 A;  5C0X H;  2PQE A;  5BN5 A;  1II3 A;  3KUP A;  4HN7 A;  4IAL A;  1CA6 A;  4CKE A;  3CKI B;  4K6D A;  2B2W C;  3N6R A;  3VYR A;  4XYQ A;  3Q22 A;  2O5I C;  3S9W A;  1NCV A;  4KD3 A;  2SDF A;  4RGO S;  4WOR A;  5FKA C;  3OWE B;  3EFX D;  3ND9 A;  4WJW A;  3GTK B;  4HAE A;  1UUP A;  4DXF A;  1AEX A;  2LMC B;  3G6J B;  3X3N A;  1W6K A;  1ZXT A;  4X3T A;  1EQT A;  1PZJ D;  1IYV A;  1EYC A;  2IT1 A;  1AN8 A;  2Q8T A;  1EY5 A;  1JOK A;  5D65 A;  4BBR B;  1MGS A;  1PTO C;  5IT9 E;  1YNJ C;  1LTR D;  2DY8 A;  5M5X B;  3X3M A;  1HUN A;  2DNE A;  2XRS D;  1IYU A;  2B2U C;  2F0E A;  4IUN A;  5KYL A;  1KNE A;  1Y1V B;  4HCS A;  4A3M B;  2F0U A;  3BYT B;  2ZT9 C;  3V2T A;  3GTQ B;  3HEJ A;  1X3P A;  1STE A;  3RZO B;  4F88 A;  2NTT A;  4R8I A;  2H4O A;  1SYG A;  2X6L A;  2E2I B;  5I2Y A;  3T4A C;  3S2D B;  4G57 A;  4DAV A;  3M3Y B;  1AZP A;  3A8J E;  1D6E C;  1SYF A;  5C0X I;  3MXN A;  1DCZ A;  2C5C A;  5J22 A;  1F9R A;  4G7H C;  3CU7 A;  1L0Y B;  3VR6 A;  4RA8 A;  3R2I A;  1I4X A;  5CGK A;  1WTR A;  1BR9 A;  1JOO A;  1TWH B;  4H7B A;  2E76 C;  2IW3 A;  3KK7 A;  3C1F A;  3NHH A;  3HOY B;  3FPP A;  4ME5 A;  1QJO A;  1TS4 A;  5EKL A;  1RD9 D;  2L1B A;  1QB5 D;  5KGU A;  3E6Z X;  1I3Q B;  2FMM A;  2JA7 B;  5A35 A;  1DXM A;  2BCO A;  3OMG A;  2F0K A;  5KND A;  2R6G A;  1PRT F;  1O7Z A;  5IGB A;  3K57 A;  3P7J A;  3D4R A;  3M7G A;  4BY7 B;  2KEC A;  1FR3 A;  1B1Z A;  1JCK B;  4JK1 C;  3MVV A;  4HSV A;  2LY7 A;  2MJ8 A;  4MIU A;  4A3F B;  1CM9 A;  1X32 A;  2KQ3 A;  2IJ0 A;  5DEH A;  3SK4 A;  2JA6 B;  4RHR A;  2WKC A;  2Y0S B;  1HHV A;  4ZYS A;  1D2B A;  2KA7 A;  3NBH A;  5DNF A;  2BE5 C;  1WTP A;  5JJZ A;  3FKI B;  1SYD A;  3R2T A;  1IW7 D;  4M1U B;  2JEA I;  1LT4 D;  4KJO A;  2WB1 B;  4B08 A;  3I91 A;  4KKS A;  3K5N A;  5CYU A;  5ELB A;  1ET6 A;  4DNT B;  3J81 L;  4DGZ A;  1PRT D;  2EPB A;  2RSO A;  4ILW A;  3HOU B;  5KEE A;  1WTW A;  2B2U A;  3NPP A;  1QCB D;  4A3D B;  4A3E B;  3T56 B;  3NBI A;  5HGT A;  4IFD H;  4DF7 A;  5KRU A;  1QOH A;  2L9H A;  4O42 A;  2E2J B;  4DK0 A;  2RKS A;  3L3O C;  1ML0 D;  1UNS A;  4QB4 A;  2XIW A;  1ILQ A;  3OSO A;  4A93 B;  4XYO A;  4MHE A;  4TSS A;  3M4O B;  4CKB A;  3RUZ A;  2WII B;  4ZK9 B;  4CGY B;  3I4N B;  4WRD A;  5EPL A;  5EKI A;  3SXH A;  1TKW B;  3OIP A;  5BN3 A;  5G3L D;  4FNF A;  1PZK D;  1I4Q A;  1D5Z C;  3HOW B;  1EWC A;  3U9O A;  3P20 A;  3OW7 A;  5IOD A;  4RWS C;  4F87 A;  2KHS A;  1PFN A;  5DM6 3;  4IFD G;  3EQL C;  1H9R A;  1UAP A;  1JOR A;  3GTO B;  3A56 A;  3K7A B;  3OIQ A;  1SYB A;  5LL6 S;  5F2D A;  5CV5 A;  3H3V C;  5EKK A;  2MPM A;  1JIC A;  2E2H B;  2K04 A;  2Z4I A;  4Q5V A;  1S5F D;  4KI0 A;  2ID0 A;  2F4I A;  3E5S A;  1QIL A;  2LKV A;  2EOT A;  5EQ0 A;  4PMC A;  3A7L A;  4C3H G;  1PTO H;  5KYI A;  2F0N A;  3DXJ C;  5G3L F;  3BDC A;  3K58 A;  4FF4 A;  1I4R A;  1TWG B;  2I07 B;  3SK8 A;  5FO7 B;  1JE4 A;  1ENF A;  5BN4 A;  3JAM L;  1FGB D;  3RMH A;  1TWC B;  2RDH A;  2M2L A;  2A5H A;  1V1P A;  4L63 B;  4NMZ A;  1B44 D;  3QOJ A;  4XXE A;  5M3M B;  1V43 A;  3S17 B;  1OXU A;  3MHB A;  2K1B A;  4PNY A;  4ZLT F;  1SE4 A;  2A69 D;  2F0T A;  2F0H A;  2PZW A;  2CVR A;  3KF8 A;  1H9S A;  2CW0 D;  3RZD B;  1CTM A;  2EJG C;  3NQT A;  3QO2 A;  5NUC A;  1FD7 D;  1STH A;  3RLF A;  1BBX C;  4CHT B;  1SXT A;  1BCP D;  4NP5 A;  4HMI A;  3M4Y A;  1WD1 A;  5CBE E;  2ICE C;  4LK1 C;  1AZQ A;  1SBB B;  1EZ8 A;  1G2T A;  5KNC A;  1YNJ D;  4I65 A;  3BZD B;  3QWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...