1PRTD

The crystal structure of pertussis toxin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
DVPYVLVKTNMVVTSVAMKPYEVTPTRMLVCGIAAKLGAAASSPDAHVPFCFGKDLKRPGSSPMEVMLRAVFMQQRPLRMFLGPKQLTFEGKPALELIRMVECSGKQDCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
publication title The crystal structure of pertussis toxin.
pubmed doi rcsb
source organism Bordetella pertussis
total genus 25
structure length 110
sequence length 110
chains with identical sequence E, J, K
ec nomenclature
pdb deposition date 1993-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09275 Pertus-S4-tox Pertussis toxin S4 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1prtD00
1B1ZA 2IPKD 1DYQA 1LTGD 1PYWD 1PTOD 1SE4A 1T5XD 2RDGA 1L0YB 1TS5A 1FNUA 1JCKB 1PTOH 1FNVA 1KLUD 1EFID 1SE3A 1D6EC 3URYA 1EWCA 1BCPD 2QILA 1CK1A 1F77A 1UNSA 1PTOF 1KTKA 2SEBD 1D5XC 1FD7D 1LTBD 1RDPD 3DWQA 1BXTA 2XRSD 3MC0B 1V1OA 1G8ZD 1JWMD 1L0XB 1V1PB 1FNWA 3GP7A 4L6TB 1BCPC 1JQYD 2O2LD 4DXFA 1TS3A 1HXYD 1CHQD 1XTCD 2QEJC 1EEID 2AQ2B 1HA5A 1I4HA 2AQ3B 1ET6A 5ELDA 1EEFD 3BVGA 4C56C 1V1PA 2J4XA 3EFXD 3OWEB 4OHJA 3V05A 4BWGB 5ELCA 1CT1D 1KLGD 1TY2A 5D3DA 1LTTD 1UUPA 1I4QA 3EA6A 3DWPA 1ET9A 2TSSA 1ESFA 1SXTA 1DJRD 1TY0A 3O13A 4RHRA 5I4DA 4L63B 1EU3A 2CHBD 1CQVA 1ENFA 1HQRD 3BZDB 1SE2A 1M4VA 1JWUD 1PRTB 3BYTB 1BCPF 1I4PA 1SJHD 3R2TA 1SEBD 1JR0D 1S5DD 1B44D 1I4GA 2WV6D 1D5MC 1I4RA 1LO5D 5FKAC 3TSSA 1PTOB 1I4XA 1PZKD 2IJ0A 1LT6D 5FK9C 1SBBB 5ELBA 1FGBD 1STEA 4O1NA 1LT4D 3W2DA 4TSSA 2G9HD 2R61A 1AN8A 1LTID 1PZID 1JWSD 1S5CD 1SJED 3MFGA 1PRTD 4RCOA 4RHSA 1LLRD 1GOZA 1LTAD 1RCVD 3BYYB 2ICIA 4RH6A 2NTTA 3KLSX 1CHPD 5TSSA 4ZYSA 4Z9CB 1S5BD 1S5ED 3DWAA 3BVZA 1RF2D 1PRTF 2XRQD 1LT5D 1AW7A 1TS2A 1PRTC 1LTRD 1MD2D 1LT3D 2Z8LA 1PZJD 4RGNA 3R8BA 5ELEA 1QILA 3BVMA 1LTSD 1TS4A 3R2IA 2AQ1B 1S5FD 2RDHA 2XN9C 1BCPB 5D3IB 2XNAC 1D5ZC 1PTOC 1XXGA 3CHBD 1HTLD 4RGTA 1RD9D 1EU4A 4RGMA 4UDUC 3SEBA 4DXGA 2NTSA 4RFBA 5ELFA 4RGOS 4K6LA
chains in the Genus database with same CATH superfamily
3LWEA 1LTGD 2K75A 2RDGA 4A3IB 1H9KA 1DCZA 1W6KA 3I4MH 4ULLA 2PZTA 2ZXRA 3MA2B 4X64Q 4U673 1N8RC 1NY4A 1CSQA 5COYA 1FJGL 1K83B 1UNSA 4B3RL 4JI6L 3FRPB 1D8LA 5I9OA 2Z1CA 3DLLA 5BR8L 3HOXH 2BE5D 3KUPA 4L5QA 5I9PA 4WJ4A 3CCSA 1EY4A 1Y1VB 3NQTA 1F2YA 2RCNA 4XIGS 3AQQA 4DK3C 4LWCA 1Y1WH 3PUWA 4IPHA 3KLWA 4JI2Q 4QMGA 4POGA 1VMPA 1VQIA 3EIVA 4V190 1O7YA 1CKNA 4JC0A 3CP0A 3LNNA 3PUZA 2K03A 3S2HB 4KY7A 2CH4W 2PMZB 4LF6L 5J1ZA 1SEBD 4DR1Q 1BBUA 3HKSA 4HJAA 1WI5A 2HIXA 4GOPC 4BBSB 1KL9A 2NVYH 3C1FA 1GUWA 2KQ3A 5JPMC 4NPSA 2L5TA 1JE5A 5FO7B 1FGUA 3CQZB 3H3VH 3QJYA 4GN5A 4P72A 1YZ6A 5LL6S 4G7HC 2LKVA 1B7YB 4Q5VA 2ATWA 1SE8A 2KECA 2RQXA 2L4NA 5CGKA 4LFAL 2JP1A 3OW7A 2JA7B 3BDOA 4EVOA 1Q86C 4BY1H 5KIXA 4RGNA 4NXML 1QILA 4DR7L 2JE6I 1F9SA 1C48A 4P73A 2GA4B 3DUZA 1NUCA 4KKTA 2OTJA 1WTHA 2JYOA 3I72A 4LFBL 4X66Q 2Z6BA 1ZEQX 4KTAA 5F2DA 1PTOD 2Y0SE 3JAMc 2VUMB 3ULPA 1EFID 1RJTA 1D6EC 1YI2A 2HQEA 1SYFA 2MHVA 4OO1I 5GAGC 4DAYA 3D3RA 2BCOA 2SEBD 3HOVB 1YNJC 1HNXQ 1G8ZD 2B2WC 1FNWA 5ISRA 2E2HB 1BCPC 4DXFA 1GUSA 4CKBA 3J81c 5NUCA 4OX9Q 4ZAIA 1HPCA 2PO4A 2IY5B 4C56C 2RKSA 2PZUA 4V0BA 1QWYA 3NBHA 3GTJB 3KF8B 2BDOA 1TY2A 5DAUA 4NDXA 1A3UA 4XT3B 3KK7A 4LF5Q 3T1YL 1Q46A 1SNDA 4CDCC 5C0XJ 2EY5A 3F2DA 2E76C 4B3MQ 4HSVA 3D6CA 3DMUA 1SE2A 4OIJA 1PRTB 5C3EG 4DV7Q 1N36L 1VQ9A 1M1KC 1AP0A 1QNUA 1WTVA 1B3AA 3CMEA 4K5XA 2ZXOA 4KY6A 3LX0A 2NB0A 1KC8C 1GUOA 4DNIA 5FK9C 2PW5A 4M1UB 5ELBA 1U4RA 1YITA 5C3WA 1VQCA 1NR2A 1L1OB 4DAPA 1FR3A 1RHPA 5CBEE 1UE6A 4DV1L 4GLXA 3S24A 1X6OA 3VA7A 4C1NK 1XWEA 2E75C 3BS1A 5IGEA 3DWAA 3E3XA 3M4PA 5M5XH 3S17H 3GTMB 1AW7A 1JB7A 4ABNA 1AZPA 3H0GB 3R8BA 5ELEA 4DK6C 1SAPA 2EY6A 4GLAC 1AEXA 5FOBB 5AFWA 1IBMQ 1F9QA 3M3YH 3TDQA 3OYYA 4JI1L 1RKNA 3K7AB 4RGMA 3WWVA 3M7NA 1QG7A 2K14A 2EZVA 2L1BA 1F2MA 2VY3A 4RKLA 1EWIA 1Z47A 5LMNW 1CKNB 5FLXE 4LF4Q 3TP5A 1CK1A 1G6PA 1Q1BA 1PTOF 1WTWA 3IRBA 2A5HA 2E2JB 1J6QA 1RDPD 2HCIA 1R9TH 1PH4A 4HEDA 4KHPL 4DR1L 2KOLA 3S16B 1XTCD 5I6YA 3RR5A 2UU9L 1A15A 3EN2A 2VNUD 3CRKC 4A3DH 2EIFA 3DWPA 3M85A 1SDFA 3A5UA 3HOUB 4GKJQ 2VQFQ 2NVTH 4DV4Q 2F0JA 1VQHA 2F1MA 4G7ZC 5D65A 3EROA 1I4PA 2LS01 4HIKA 4FO2A 4HR7B 4A3GG 2XGTA 5FKAC 1MKHA 3KF6A 5IIFA 4A75A 4EQNA 4DNTB 5C3EH 4O0AA 3J7YW 2KCNA 2WP8J 2R93B 1B9MA 1XNQQ 3W2DA 5C4JH 4FXDA 1LTID 4A3BG 1PRTD 2KBNA 1EQRA 4HIMA 3ICEA 2OQ0A 1GOZA 1GO3E 3K5NA 1SR3A 5IE8A 4AH6A 1FYCA 2JA5G 1I6VC 3ND8A 4DAMA 4DAYB 1MSHA 1LT5D 3U50C 3G6JB 4BBRB 5CR3A 1IBLL 3HOZG 4AQYQ 1PDQA 4LFCL 3BG3A 2K5HA 5IT9L 4R8IA 1F2LA 1V8QA 3GV6A 1HNXL 1C0AA 5EBCA 4YIJA 2K5VA 1IKLA 3NBHB 3BDCA 1WCMB 1TWGB 1F2ZA 1PFBA 2KEEA 4IUQA 3PO2G 4RGOS 2Q8TA 4OEMB 4R4CA 4OX9L 2AKWB 5A2QL 3T1HL 3SK4A 3I8ZA 1PYWD 2WACA 3Q8DA 3Q0AA 3PUYA 2D5DA 1KLUD 1WD0A 4IO9A 4PMCA 1STGA 1YNND 3NK9A 4A3KB 1GHJA 5IP7G 2B2TC 4GKKL 4LF5L 2EY2A 2Y0SG 2BOSA 3CAMA 1U4MA 2IW3A 4Y7NH 4B3ML 3RN5A 2XRSD 4JI7Q 3EVQA 1IHZA 1SYEA 5FJ8G 1H9JA 2ENBA 3DM1A 3T51B 4C3JB 1CHQD 4K5WA 1OXVA 2VZAA 2WKCA 2B63B 3HKZB 4H44C 4DR3Q 1E1TA 2VS1A 4APVA 3ER0A 5DLQE 4ZUJA 4LUOA 1WVLA 4X3UA 2J7ZA 2K5WA 3M9BA 5C0XI 1ESFA 3GTOH 2NN6G 4N8X1 2Q2TA 2CQOA 3BZDB 3MXPA 2IT1A 5C5MA 4DR6L 1U4PA 1PH2A 4CKCA 1BCPF 4C3HG 2EDGA 2KCTA 4A3MB 2CCZA 2ZM6Q 2IX3A 1UAPA 3ND9A 5EJWA 1S5DD 1EZ8A 2E2IB 3VR3A 4YHHQ 3S1NH 4IFDG 1QUQB 2F0GA 3ZYYX 1O7IA 4O1NA 2IX0A 2DY8A 1IBML 5KNDA 1STAA 1G291 4A93G 2L11A 1HCZA 1TU2B 1QE6A 4MZ9A 1ASZA 2ES2A 4GS3A 1KD1C 3DEOA 1CUKA 2ZXPA 4UP9A 1ILPA 4DA2A 3MAQA 1Q82C 1DZ1A 5JJKA 3VYUA 1TWFH 1S5BD 3TQYA 1VQNA 5CV6A 2EOTA 3HOWG 4LNQA 3AMUA 1PRTF 4A3BH 1SNQA 3CPFA 1SMYD 5LHY1 2RVLA 4OIKA 2Z4HA 4A3GB 1XX8A 2JA5H 3S2DH 1N34Q 4LF8Q 3CD6A 4I65A 1IYUA 3HOYH 3C2PA 5IGBA 4AYBB 2D0PA 3FKIG 2NTSA 4RFBA 1YHQA 3HOZH 1N32L 4JW0A 2KEDA 3KJPA 3T53B 1C9OA 4IURA 3S1MB 1T5XD 4B3SL 2K5NA 2DJGC 3IAYA 4OWWB 1JJGA 4MN3A 3PO2H 4A3EB 5FO9B 2PQAA 1B3QA 3F2UA 4HTHA 4HJ8A 1ZYRD 3OMGA 2VQFL 4X62Q 1JC7A 1KTKA 4DV4L 3K0XA 2ZTEA 3OWFA 4GN3B 3KF6B 3I4MG 1A2TA 5IP7H 2MJ8A 4EGVA 3CCMA 3MXGA 4XQNA 1DONA 2F0HA 2VQEL 1HA5A 1I3QB 2AQ3B 4TVAB 3MEHA 1OXTA 1EEFD 2NVXH 2K50A 3G48A 1V1PA 5FJ8H 3BZCA 4BS9A 4HCSA 5D3DA 2BE5C 2A1AA 3MXUA 5LMNQ 3NWTA 4QIWE 4DU9A 2E74C 2JQOA 2NBFA 3G4SA 3WOEA 2UXCQ 3BYTB 4YY3L 1K8MA 1RTOA 2BA1A 1PLFA 1ICWA 1E0BA 3A54A 5M5YH 1I4GA 1UE5A 1YEZA 2EYMA 3OHXC 4KI0A 3GTGH 3D6WA 2YU9H 1UWVA 2EYLA 4DR4Q 1EYCA 1TWAH 3UE1A 4C3HH 1SYDA 2E8GA 2LFNA 3V2TA 4G7OC 3KFUA 4H13C 4KHVA 4L5SA 2E5LL 5CBAE 4YCWA 4IFDH 4RHSA 2A73B 4UY8C 1EZ6A 3BYYB 5ELNA 3MVVA 3VDYA 2Z6KC 3TP7A 2L15A 1WTRA 4X65L 4A93H 1EIFA 3C1EA 4NXNQ 2PPBC 4K2LA 1PFMA 3PSIA 1I5FA 2JA6B 3K5OA 1LT3D 4X3KA 3E6ZX 3NBIA 1SLJA 1U0LA 4WORA 2K5DA 1HA6A 2XNAC 3HG9A 4GLVB 3U4VA 3UDFA 1JJ2A 1D7QA 3K59A 2SNMA 1IL8A 5CV7A 5JJLA 2QA4A 4BY1G 1S4ZA 1PA6A 3QOJA 1E22A 4PQXA 4KV6A 4IUVA 1B1ZA 3A55A 4DR3L 1TWCB 5AJ3Q 3ITPA 2WINB 3H6MA 3K58A 1TS5A 4QQBX 1PTOH 1F9PA 1FNVA 3U58A 3FKIH 5J22A 5M3MG 4FP5D 4K0KL 5DEHA 1N9WA 3HOWB 1Z7TA 4JV5Q 2D0OA 3RUZA 1FD7D 3NTIA 2DGYA 1UEAB 2ZM6L 3S1RB 2O2LD 2VXWA 3KDFA 4A3JH 4YHHL 2RF4A 1I4HA 1ET6A 2B29A 4DN4M 1H95A 2GVBA 1YJ9A 1TIID 4BA1I 5IOCA 1LTTD 3CC2A 5KRUA 1TWHB 2P5ZX 1TR5A 4IJHA 5JPNC 3GTLB 1DJRD 4IOAA 1F9RA 2I0QA 3TBIB 2A6ED 1ENFA 4KJNA 1JWUD 4JI5Q 1QZGA 2HHHQ 2C5CA 3D4WA 5FLXL 5EKKA 3S14B 3OTOQ 1BF4A 1VQBA 1PYSB 1I4XA 1G51A 1JT8A 3CCEA 3UI2A 1EY9A 2OQKA 1JOOA 4A3CG 1PYBA 4TSSA 5EGTA 3MFGA 3L0OA 1CFMA 5LL6X 2B2VC 4JI8Q 4CGYB 3HOXB 1T9HA 2PQAB 3U9SA 1ZXTA 3NHHA 2NTTA 2XIWA 4OL7A 1NE3A 5CV9A 4HSPA 3MWYW 3K8AA 2F3WA 1QZHA 1Y1WB 5IYCH 4FF4A 1AE3A 2WAQB 3OIPA 3VYSA 1B9NA 2PYKA 5JEAJ 1KDAA 3FVQA 3GO5A 3NWSA 3OOCA 1FL0A 4ME5A 5C4XG 2L9HA 1YNXA 2FXQA 2ASBA 2B39A 2BA0A 3PV0A 2F03A 5M3FG 3GTKH 4CDDC 2NVYB 4DV5L 3A74A 1B2TA 2WB1E 5KYIA 1C4QA 2JA8G 5LMNL 1BVSA 1KRSA 2Q8IB 3K7UC 1BBWA 2TMPA 3A8IE 1EUJA 1YBYA 3DWQA 2IWHA 4Y52H 1K0RA 1PH1A 1L0XB 3K81C 1I94Q 1U9RA 4L6TB 4R4IA 5M3MH 3JAMi 4R4TA 3UDGA 1SSOA 4JOIC 1TS3A 3AYHB 2B2UC 4KN7C 3F2CA 2AQ2B 1BKBA 3SK6A 4MTKA 4CJ0B 1AZQA 3GTPH 4HN7A 1XMOL 1PHJA 4ALPA 2IHEA 4BA2I 2CWAA 4F87A 3EA6A 1IBKQ 1Q90A 4DPGA 4HMIA 2TSSA 4P74A 1NSNS 2AMCB 2B2YA 2PI2E 1A2UA 3FMCA 3M7GA 4JI3Q 4HMJA 5G3LD 1HZBA 2OF1A 2R6GA 2XWJB 3J80c 2KVMA 2GVAA 1GXDC 3J81i 1M4VA 1VS0A 3PF4A 3R93A 4A3DG 4KD3A 1VQMA 3S1QH 5E1FA 1QOHA 4ILWA 2M00A 1GUTA 5DM73 5C3XA 3GTJH 2AUKA 1D1IA 4GNXB 2UUAQ 4YCVA 1FGBD 3STBD 4P75A 4XDXA 5IODA 4MIUA 2K52A 1XTDA 4DNRB 1KHIA 4KMUC 3QO2A 4CBVA 1RIPA 3L3OC 4KD4A 2XTIA 5AJ3L 2CFMA 1J5EQ 4A3CH 4LAAA 2UUCQ 3L2PA 4OWXB 3TZDA 3VYTA 1HHVA 4KY5A 1PRTC 2QDLA 1DGSA 4O2DA 4DR2L 2K6AA 2KA7A 3IL8A 4QB4A 2EJGC 2F0PA 4DV0L 3A7LA 2F0SA 5C4HA 4FVMA 4LUZA 2RDHA 4PNYA 5D3IB 2MNAA 1SFOH 4DR5Q 1IYJB 3I7FA 2R7ZG 3QOLA 4L5RC 4HIOA 1L1OC 5IYDG 1NTGA 2Z4IA 1MJEA 2JSOA 2IPKD 4EQOA 2QEXA 1STBA 3P20A 4I7ZC 3H0GH 3G71A 4X64L 1QCBD 1A8VA 2ZJQA 5C4XH 4MNOA 4C3IG 1K0SA 2FHTA 2NYZD 2JA9A 4KKSA 5M3FH 4ZRZA 2EYFA 3K7AH 3JAME 1V1OA 4L5TA 1YNNC 3Q6SA 4DAVA 2JA8H 3RLOA 3OTOL 3KLSA 3S17B 3ULLA 1HH2P 1NMFA 5KYLA 3OPOA 2K33A 4B08A 3I3CA 4BY7G 2Q2IA 4QUFA 1Z9FA 2KENA 4JI2L 3GTQB 2HDLA 1ET9A 4YWLA 1Y8PB 4FNFA 1QNKA 3J81E 3M3YB 1VQ6A 4L63B 4JI8L 4DK0A 3C3LA 4N8FA 1WD1A 1TKWB 1E7ZA 3RLFA 1GUNA 2HIVA 2DNEA 3S16H 1JR0D 3A56A 5G3LF 3TSSA 1TXYA 2IJ0A 2HUGA 1HNWQ 2WIIB 4POFA 4NB3A 3NSWA 3AFQA 1LT4D 4A76A 2F3VA 2WFWA 3U9OA 1R9TB 4UAIA 1X3PA 4K8IA 3P1HA 3NEMA 5KNCA 5IP9H 2PMZE 1V1QA 2Q2HA 1RF2D 1TS2A 3Q22A 3WDNA 3QB3A 1YHAA 4QY7A 4UP7A 1S72A 1X54A 2QGQA 3I2ZA 4KJOA 4QJFA 4JBKA 2NVTB 1GM5A 1I94L 1JORA 4IZ8A 3PMFA 1A63A 1B70B 1WOCA 2RDFA 5GAHC 1SMYC 1QVFA 3D0FA 4JI4Q 3GDEA 4X66L 2AHOB 2FJ2A 1WFQA 2ZTDA 1VQEA 2A74C 1SE4A 3PQIA 2D2CC 2R7ZH 2KCCA 1FNUA 2JJQA 1E2WA 1IBKL 5C3EB 5IYDH 3HOYG 4O42A 4DUZQ 3C46A 2VB3X 1F77A 4JI3L 2UUBQ 5C4JB 1IZ6A 3FPUB 4ZLTF 1D5XC 1LTBD 2CH4A 1BXTA 1MBYA 1PFSA 3PGZA 4X3TA 4CJ1B 2NZ1D 4HJ7A 1YHBA 3B6YA 4DUYQ 1VQ4A 2QDBA 4K6DA 4C3IH 1VQJA 4DF7A 2VW9A 3E9HA 1ZYRC 1D1KA 1EEID 3IKJA 1HR0Q 5GADC 1GKHA 2HCCA 1UUPA 3I4NG 1O80A 4ZKBB 2NZOA 4IFDJ 1VQ8A 4CDFC 3MZ5A 1TY0A 4BY7H 1VF5C 4DV7L 5C0XH 3E9IA 2Z6KA 4JVZA 1J5EL 1WTOA 2V4DA 1X3FA 1MHWC 1D5MC 1CZWA 1EY6A 3S15H 5C44G 1SBBB 4DV3Q 2UXBQ 4F88A 4JCVE 1JOKA 2F52A 1VQFA 2A19A 2NWGA 4JG2A 4Y7NB 3UE0A 4IUUA 1JMCA 3CCRA 1MIUA 3BU2A 3TP8A 3PIO3 1Q8KA 4A3MH 2OEOA 2XSCA 3VR4A 1NMGA 1S3OA 1NCVA 1R4QB 3NELA 1Q8IA 2L0CA 1D2BA 5CV5A 1VQ5A 2R92H 4RWSC 2AWNA 3R2IA 4IPCA 1SNOA 3L9AX 3GTOB 2B3GA 5EPJA 3PIOA 3TS0A 1CKOA 1VF7A 1E1OA 2F0DA 4KKUA 1EWHA 1Y69U 2F4VQ 1A0IA 2K01A 2K04A 3RN2A 3PO3G 3S1NB 1X65A 3TZUA 4LF4L 2KHSA 3M4YA 2QKIC 3VR2A 3M4OH 5FLMH 3AFPA 2MUYA 1XPUA 2Q8RE 3E0JA 4A3FG 2MO0A 4JI6Q 2K05A 1QVCA 3N6RA 5CV8A 3CRLC 5BR8Q 3M4QA 2G9DA 4HIDA 4QGUA 1TWFB 5K36G 4AIMA 3L7ZC 1EY5A 4A3BB 2EJMA 5JOBA 3EFXD 5IT9c 1VCIA 3RZDH 1CI3M 3BJUA 3H09A 1CZGA 3BDLA 1I4QA 1IXRA 1KDCA 2JA5B 1BNZA 4GKJL 4A3JG 2MPMA 3O13A 1V9PA 5ELOA 3A8KE 2ZJRA 2CQAA 1U5KA 5JAVA 1CA5A 4XQJA 1B50A 1HQRD 1G2SA 4R8NA 3HOYB 2X6GA 3I55A 2Z9HA 3I4NH 3HOZB 4I7AA 5EPKA 4MHEA 4R4OA 1I3QH 5JJIA 1WYDA 2WV6D 2F0NA 5GROA 2D9UA 4GOPA 2M2LA 1YVCA 2A6EC 1OXXK 3PO2B 2KCMA 1LUZA 4RCNA 4JYAQ 3SE0A 1XNQL 1PV4A 4ZKCB 3RZOH 4WJ3M 1Y1VG 1AN8A 1ICFB 1VQAA 2YV5A 3NENA 4UP8A 3SHLA 1O78A 3MFYA 1GJXA 3ERQA 5C44H 4HJ5A 2F0KA 4HCEA 4JI4L 4J1MA 4LFAQ 1E2VA 5M5WH 4ZYSA 2Y0SB 3J7AF 3F1ZA 2NVXB 5J39A 3GV3A 3P75A 1MD2D 1C7YA 2Z8LA 4DUZL 1X3QA 2K7VA 4DV2Q 2H1EA 4NXMQ 3RLNA 4AQYL 2F0VA 4DR7Q 2UUBL 2XN9C 4BBSG 1PH5A 1ENCA 1II3A 3JC66 3TP6A 1O7LA 5CV4A 4XYOA 3CC4A 1HQMC 3IFDA 2I07B 3BZKA 1X32A 5IYCG 5T1GA 4K6LA 4R4QA 2BDNA 3FP9A 4XT1B 5IYBG 4LFBQ 3GTGB 3RNUA 4TQUS 5FO8B 4C2MH 2YU9B 1JCKB 4FDBA 3RMHA 1LM0A 3KBXA 1I6HB 2OCEA 1TWAB 4C3HB 3J81j 1IYVA 2NVQH 2R7DA 2JEAI 1PH7A 4IJLA 2JA7G 3PO3H 2HQLA 4JI7L 4TKOB 2VB2X 2NN6I 1BBXC 4B3TQ 1IW7C 1SROA 2B2WA 3I91A 1S40A 1M90C 1K73C 1NJIC 4A93B 2FFKB 4A3FH 2JXMB 2KHJA 1I50H 2XWBB 5ELDA 1HZCA 4K2KA 3OWEB 4OHJA 2UXBL 1P8LA 4K5VA 5ELCA 2KJXA 3E5SA 3I4LA 4OO1G 1G2TA 3T13A 5K36H 2B8FA 4RHRA 2DJFC 1PH6A 1CSPA 2FINB 2BH8A 2VUMG 1RTNA 1EQVA 5E3FA 3D31A 3S1RH 4R1JA 5CYUA 3W1BA 2MP1A 1SJHD 2L12A 1PH3A 1SNCA 1G6ZA 3AEVA 3OMCA 1I4RA 3CKIB 5DM63 4A3IH 3HOVG 3R3OA 1PTOB 2MGSA 1PZKD 1PH8A 3HKZE 3FKIB 1E2ZA 2F0MA 1VQLA 2NUCA 3JAML 1ILQA 1K83H 3DXJC 3CCJA 2G9HD 1G91A 1K8OA 1S5CD 4DV1Q 1AFPA 2D62A 4RCOA 3OIQA 1DOMA 1RCVD 1EIYB 1YIJA 4RH6A 3VR5A 2F4VL 3TRZA 3STBC 1SMXA 2A68D 4MTNA 3SR1A 4A3JB 4LF7Q 3S14H 1Y1VH 2PCFB 2PNHA 4IUTA 3ZJYC 5I2YA 3I4MB 3OSOA 2QCPX 3J81L 4DK1A 2L55A 3TEHB 4LMQD 1TS4A 2EYJA 1E24A 4IALA 2EQSA 4H02A 4G57A 3N52A 3V96A 1N34L 4LF8L 2C9OA 4JI1Q 1BQQT 3J7AV 1WTXA 1EU4A 3KOJA 4ID6A 5EAYA 4E6IA 2ZJPA 3S2HH 3CU7A 2EXZA 2LXKA 1A3VA 3W5OA 4X3SA 2M9VA 5M9OA 5D14A 3PF5A 1VQPA 5C4ZA 3IFTA 4BBSH 1X55A 1L0YB 1EYDA 2A6HD 4F8MA 2H5XA 1MGSA 1SYBA 2YYZA 1UE1A 3EQLC 4FF2A 4X62L 5IYBH 3LWUA 3CQZH 1BDOA 1SNMA 1X3GA 4GOPB 3H0GG 1V1PB 1HR0W 2K32A 3EBEA 4KHPQ 3CXCA 1HXYD 4AYBE 5JVG3 3RD4A 1DOLA 2JA7H 2UU9Q 1E3PA 1UEBA 4BWGB 4A3LH 3VR6A 3HGBA 1IW7D 4JYAL 1MI2A 2YTXA 4P71A 2ZTCA 1HFNA 2A69C 3K6OA 2CKZB 1VMCA 5HGQA 2UXCL 2PW7A 1HUNA 2DUDA 3H3VC 4OO1H 2VL6A 1TT2A 5EKLA 2N78A 2F0EA 1VDZA 2I5LX 5HGTA 4F7XA 3GTKB 1BR9A 1CKMA 3H3VI 4BY1B 2VUMH 4DV2L 1LT6D 2K28A 3NXWA 2AUJD 3HP3A 5BN5A 5E4WC 4DR4L 1ONLA 2LXJA 5C5LA 2RHSB 3J80i 1PFNA 3PIP3 1CQFA 1GHKA 1K3BC 2DY7A 4C1NI 1PZID 1SJED 3HOVH 3GD7A 5KGUA 3X3NA 2K1BA 2PNRC 5M3MB 2E2HH 2SNSA 1Q12A 3SGIA 4NXNL 2LY7A 3GTPB 3HOUG 1Y8NB 1EL0A 5E4XA 2CW0D 3PUXA 1EY8A 4JK1C 1ML0D 4XXEA 5JEAG 1LTSD 3PIPA 1IBLQ 4LFCQ 1S5FD 1BCPB 1XXGA 4GNXC 5IP9G 5BN4A 4B3TL 1KNEA 5FLXc 1FVIA 3SEBA 4DXGA 4JPBW 2LSSA 3CMAA 1KXLA 3S1QB 1LV9A 2R93G 4PZ7A 3PUVA 5IWAQ 1SNPA 1XMQQ 1DYQA 1GUGA 3T1HQ 3TN2A 4Q0FA 1H9RA 3W3AA 4DGZA 3VA5A 2K5QA 1UE7A 1EWCA 2GN5A 2F0WA 1PMRA 4GKKQ 2B2TA 3K5LA 3I73A 3K57A 4JV5L 3KDFB 5A35A 4P2CB 5JVH3 3MXNA 3MC0B 1W6JA 2EYPA 3TREA 5GAEC 1H9SA 3UDIA 4BBRG 4RA8A 1JQYD 1ZKOA 4N9PA 4UHVA 4IOCA 3CCQA 3GTMH 3BVGA 3P7JA 1LACA 2EYHA 1EY7A 1B8AA 5I6WA 1WCMG 4JBMA 2N55A 4L8JA 4KLKA 1JB3A 1SFOB 1SN8A 3DM3A 1BOSA 1SXTA 4BXXG 5I4DA 4QL5A 2CHBD 2ZT9C 4KHZA 2KUMA 1EYAA 1MJCA 4JI5L 4DR6Q 4A3KG 2HHHL 2OTLA 1WJJA 4LF7L 2F4IA 4YWMA 1LO5D 3J7ZC 5M5XB 2A69D 1NNXA 1HZ9A 4ME3A 3J80E 4JBJA 4OELB 3CCUA 5C4XB 3GTQH 1KNAA 4LUVA 1VQGA 5C0XG 2OXPA 4C3JG 2HT1A 1B53A 1OO9B 5M3FB 2B63G 5T1IA 2E2JH 3HKZG 3ULJA 5CC4A 2AWOA 1QUQA 2UXDQ 1W3SA 1STYA 2JA8B 3KJOA 4X6AH 3G7LA 4Z9CB 5CORA 2XRQD 4OGQC 3SVMA 5H1SE 1ASYA 1TVXA 2X6LA 5I2XA 5HY6A 1EIGA 1Q1EA 4WFN3 4A3MG 3F8TA 1ESRA 1IKMA 3HOUH 1WTPA 2O5JC 4TRDA 1RD9D 3D4DA 5GQOA 2I5MX 2R92G 1K28A 1Y14B 5JEAH 1N32Q 4PZ8A 4ODGA 1XYIA 3QWNA 1N33Q 3HEJA 2DNCA 2NZHA 2IHFA 4B3SQ 1YNJD 1OTCA 4QF4A 1PH9A 3A8JE 2PZWA 5K5PA 4KK7A 2O4XA 3URYA 4A3DB 3CW2C 1BCPD 1Y8OB 4QIWB 1BO0A 1HNZQ 4RKBA 2R93H 2I46A 2WAQE 2JK8A 4B9XA 4XTCS 4LF9Q 1VQKA 3K5MA 3GP7A 1Q3LA 2K4KA 2SDFA 3SXHA 4IUPA 5FLMG 4EQPA 4OXPA 2VQEQ 1BUVT 5CMDA 4UPAA 2J4XA 2LMCB 3H15A 3TMEA 3V05A 3VYRA 1KLGD 4AYBG 4BBRH 4H0LC 3I4OA 3EJIA 2B2YC 3J7A5 1LABA 2EXDA 2IL8A 3NUCA 4GN4B 4XQQA 1SRUA 5IGFA 2ICEC 1A6XA 2EPBA 5L37A 2WB1G 1JJCB 5JJZA 3SDZA 1WCMH 1TWGH 2MO1A 5LMUQ 3FEWX 2PI2A 4A3EG 3SK8A 1JE4A 4YY3Q 2HD3A 3A5ZB 2OT2A 3MHBA 2EJFC 1KRTA 1KQSA 5IGCA 4BXXH 2R7ZB 1X9NA 5EBDA 1K3RA 4WRDA 4ZCKA 2UUAL 1PVOA 1LTLA 1KAAA 1QJOA 4PG3A 4PZ6A 4S3SA 4PMWA 4A3KH 1K8GA 3NTKA 3NE5B 1PXUA 1C8CA 1H9MA 2DN8A 4KN4C 2E5LQ 2YTYA 4QUCA 4LW1A 1LLRD 2MQHA 2ID0A 3I90A 3E0EA 4C3IB 4A4IA 4IUNA 5IWAL 1XMQL 3KLSX 1CHPD 4C3JH 2UUCL 5BN3A 1GD7A 1S5ED 3HZXA 3S9WA 4X65Q 2B63H 5KEEA 3QG1A 3MXNB 3BVMA 1H9SB 1CTMA 3H91A 4JI0Q 3CCLA 2RSOA 2AQ1B 2QF7A 4NP5A 4DR5L 1KAWA 1MSGA 5DNFA 3X3MA 3CF5A 5IY0A 4RGTA 4OWTB 3H94A 4BY7B 3W1GA 2JN4A 2O5IC 4NW2A 4FXGC 4IN3A 4DFAA 3NPPA 3T56B 1XNRQ 4PV1C 4DV6Q 3FDTA 1U4LA 1W2BA 2E2IH 3F2BA 4FF3A 3CPWA 2F0TA 3S15B 4QCLA 2F0IA 1KDBA 1HRJA 5E7NA 3KYHC 3FHWA 2N88A 2YTVA 3Q23A 4K0KQ 3HFZB 1J8IA 2B8GA 4ZK9B 2IX1A 2RCFA 1Q7YC 3FPPA 1QB5D 3T16A 2H4OA 2RBMA 3DHQA 4H7BA 5IGDA 2JA6G 1JWMD 1HJPA 1IL2A 1M8AA 2R3ZA 3QR8A 1V43A 2J0TD 2F0QA 1EQQA 2QEJC 1DXMA 4XYQA 2F0FA 1DD2A 2PQEA 2F0UA 3D8GA 4K8JA 4U68A 3G6EA 2R92B 1CT1D 4A3GH 3I70A 1FJGQ 1KABA 3UDXA 1HFGA 2UXDL 2BH2A 4B3RQ 1RODA 2F3IA 1EU3A 1CQVA 1AH9A 1YJNA 1A62A 3R2TA 1OXUA 1DOKA 4CKEA 5IGGA 3S1MH 3ERSX 4NMZA 4GZYC 2EYOA 1HNWL 1EY0A 3PCOB 4M8AA 4YCUA 5HURA 2KHIA 4A3EH 1STEA 3M4OB 4HJ9A 4EX5A 1KIXA 2A8VA 4FXKC 1K8AC 4WJWA 2E2DC 3S2DB 3NTHA 3T4AC 1X3EA 2C35B 4IQZA 1WTQA 4A3IG 3K80C 1LTAD 2ICIA 3ONAB 2B2VA 4LF6Q 1N33L 4EQ5A 1SYCA 3BVZA 2RA4A 3KBGA 1EQTA 2WB1B 4YWKA 5J3BA 2HDMA 1TQOA 1LTRD 2CVRA 2SOBA 4LJZC 3Q24A 3RZDB 1GVPA 4CDEC 4JBWA 1HNZL 4HAEA 4LK1C 1HZAA 4K14A 2A68C 3MEFA 1K9MC 3HRZC 5EKIA 1OXSC 2R7FA 4FYDA 4R9WA 1LYLA 4LF9L 1CM9A 3TS2A 4IPDA 3I4NB 5ELFA 2EY1A 3SK5A 3MTSA 2N8NA 2RSNA 4PMBA 3D4RA 1A3TA 4G4KA 1NBWA 1P16A 4IPGA 1CA6A 4DV5Q 1L2FA 1SE3A 2EVBA 3CC7A 4N9TA 2QILA 3HOXG 1JOQA 1XPOA 3AU7A 3RZOB 3AB9A 3LGJA 1EOVA 4ZUIA 1ENAA 2A6HC 5LMUL 3NP8A 5C44B 4DUYL 1SYGA 1Y1WG 3KLRA 2G5DA 4NKLA 1O7ZA 2WAQG 3A0JA 4J15A 5M5WB 3QIAA 4CJ2C 3OW2A 1HR0L 2NN6H 4JOIA 1L0WA 2B2UA 5M5YB 2EE1A 1XMOQ 2JA6H 1I6HH 2V1CC 3DEPA 4CHTB 3GQBA 2JEBI 1EYGA 4RG1A 1VQDA 2X69A 3NQIA 1J9OA 1NAPA 4DKAC 5IT9E 2OWOA 1XJVA 4A3LG 2CWPA 1EIHA 1B44D 1TWCH 1STNA 4ZQ3A 4C2MB 3A7AB 2WKDA 4DV3L 5A2QE 1NR4A 2Z0SA 1VQOA 4JI0L 3CCVA 4IFDI 1B4OA 4J8QA 1YJWA 1VQ7A 2NVQB 3HOWH 2R61A 1STHA 1DM0B 3WOFA 3PO3B 4GNXA 1JWSD 3T1YQ 1EOTA 4RAUC 3KF8A 5C6AA 1JICA 4J6HA 2RHQB 1XNRL 1XPRA 1X56A 4DV6L 3K0YA 2F0OA 5TSSA 1N36Q 4A3FB 4OONA 1I50B 2F0LA 5EPLA 2ALYB 1HUMA 1HTPA 1Z6HA 4DR2Q 1PZJD 2I5HA 1R4PB 2XVSA 2Q2UA 2FMCA 1AE2A 1Q81C 4DV0Q 1TWHH 2N49A 4B9WA 3U4ZA 4RMFA 3I56A 1D5ZC 1PTOC 3HS0C 3GTLH 3CHBD 1HTLD 5KNBA 1RL2A 2CW0C 1T5EA 1QVGA 2QW7A 2N3SA 1EFWA 2MFIA 5EQ0A 2FMMA 4UDUC 4FF1A 1L1OA 3J80L
chains in the Genus database with same CATH topology
3LWEA 1LTGD 2RDGA 4A3IB 1H9KA 1DCZA 1W6KA 4ULLA 2PZTA 2ZXRA 3MA2B 4U673 5COYA 1K83B 1UNSA 3FRPB 5I9OA 2Z1CA 2BE5D 3KUPA 5I9PA 1EY4A 1Y1VB 3NQTA 1F2YA 4XIGS 3PUWA 4QMGA 1VMPA 4V190 1O7YA 3S2HB 3LNNA 3PUZA 2K03A 4KY7A 2PMZB 5J1ZA 1SEBD 4BBSB 3C1FA 1GUWA 2KQ3A 5JPMC 2L5TA 5FO7B 3CQZB 3QJYA 5LL6S 4G7HC 2LKVA 4Q5VA 2KECA 2RQXA 2L4NA 5CGKA 2JP1A 3OW7A 2JA7B 3BDOA 4EVOA 5KIXA 4RGNA 1QILA 2JE6I 1F9SA 1C48A 2GA4B 3DUZA 1NUCA 4KKTA 2JYOA 3I72A 1ZEQX 4KTAA 5F2DA 1PTOD 2VUMB 1EFID 1RJTA 1D6EC 2HQEA 1SYFA 2MHVA 4OO1I 4DAYA 3D3RA 2BCOA 2SEBD 3HOVB 1YNJC 1G8ZD 2B2WC 1FNWA 5ISRA 2E2HB 1BCPC 4DXFA 1GUSA 4CKBA 5NUCA 4ZAIA 1HPCA 2PO4A 4C56C 2RKSA 2PZUA 4V0BA 1QWYA 3NBHA 3GTJB 2BDOA 1TY2A 5DAUA 4NDXA 1A3UA 4XT3B 3KK7A 1SNDA 5C0XJ 2EY5A 2E76C 4HSVA 3D6CA 3DMUA 1SE2A 4OIJA 1PRTB 1AP0A 1QNUA 1WTVA 1B3AA 4K5XA 2ZXOA 4KY6A 3LX0A 2NB0A 1GUOA 5FK9C 2PW5A 4M1UB 5ELBA 1U4RA 5C3WA 1NR2A 4DAPA 1FR3A 1RHPA 5CBEE 3VA7A 4C1NK 1XWEA 2E75C 3BS1A 5IGEA 3DWAA 3GTMB 1AW7A 4ABNA 1AZPA 3H0GB 3R8BA 5ELEA 1SAPA 2EY6A 1AEXA 5FOBB 5AFWA 1F9QA 3TDQA 1RKNA 3K7AB 4RGMA 3M7NA 1QG7A 2EZVA 2L1BA 1F2MA 4RKLA 1Z47A 5FLXE 3TP5A 1CK1A 1Q1BA 1PTOF 1WTWA 2A5HA 2E2JB 1RDPD 2HCIA 4HEDA 2KOLA 3S16B 1XTCD 5I6YA 1A15A 2VNUD 3CRKC 3DWPA 3M85A 1SDFA 3HOUB 2F0JA 2F1MA 4G7ZC 5D65A 3EROA 1I4PA 2LS01 4FO2A 4HR7B 5FKAC 5IIFA 4EQNA 4DNTB 3J7YW 2KCNA 2WP8J 2R93B 1B9MA 3W2DA 4FXDA 1LTID 1PRTD 1GOZA 3K5NA 1FYCA 1I6VC 3ND8A 1MSHA 1LT5D 3G6JB 4BBRB 5CR3A 1PDQA 3BG3A 5IT9L 4R8IA 1F2LA 1V8QA 3GV6A 5EBCA 4YIJA 1IKLA 3BDCA 1WCMB 1TWGB 1F2ZA 1PFBA 2KEEA 4IUQA 4RGOS 2Q8TA 5A2QL 3SK4A 3I8ZA 1PYWD 2WACA 3Q0AA 3PUYA 2D5DA 1KLUD 1WD0A 4PMCA 1STGA 1YNND 3NK9A 4A3KB 1GHJA 2B2TC 2EY2A 2BOSA 1U4MA 2IW3A 2XRSD 3EVQA 1IHZA 1SYEA 1H9JA 2ENBA 3DM1A 3T51B 4C3JB 1CHQD 4K5WA 1OXVA 2WKCA 2B63B 3HKZB 4H44C 4ZUJA 1WVLA 4X3UA 2J7ZA 2K5WA 5C0XI 1ESFA 2NN6G 3BZDB 3MXPA 2IT1A 5C5MA 1U4PA 4CKCA 1BCPF 4C3HG 2EDGA 4A3MB 2IX3A 1UAPA 3ND9A 5EJWA 1S5DD 1EZ8A 2E2IB 3VR3A 4IFDG 2F0GA 3ZYYX 4O1NA 2IX0A 2DY8A 5KNDA 1STAA 1G291 2L11A 1HCZA 1TU2B 1QE6A 3DEOA 2ZXPA 1ILPA 4DA2A 3MAQA 1DZ1A 3VYUA 1S5BD 5CV6A 2EOTA 3AMUA 1PRTF 1SNQA 1SMYD 5LHY1 2RVLA 4OIKA 2Z4HA 4A3GB 1XX8A 4I65A 1IYUA 3C2PA 5IGBA 4AYBB 2NTSA 4RFBA 2KEDA 3T53B 4IURA 3S1MB 1T5XD 3IAYA 4MN3A 4A3EB 5FO9B 4HTHA 3F2UA 1ZYRD 3OMGA 1JC7A 1KTKA 3OWFA 1A2TA 2MJ8A 4EGVA 3MXGA 4XQNA 1DONA 2F0HA 1HA5A 1I3QB 2AQ3B 3MEHA 1OXTA 1EEFD 1V1PA 4BS9A 4HCSA 5D3DA 2BE5C 3MXUA 3NWTA 4DU9A 2E74C 2NBFA 3WOEA 3BYTB 1K8MA 1RTOA 2BA1A 1PLFA 1ICWA 1E0BA 3A54A 1I4GA 2EYMA 3OHXC 4KI0A 3D6WA 2EYLA 1EYCA 1SYDA 2LFNA 3V2TA 4G7OC 4H13C 4KHVA 5CBAE 4IFDH 4RHSA 2A73B 1EZ6A 3BYYB 3MVVA 3TP7A 1WTRA 3C1EA 2PPBC 4K2LA 1PFMA 2JA6B 3K5OA 1LT3D 4X3KA 3E6ZX 3NBIA 4WORA 2K5DA 1HA6A 2XNAC 3HG9A 3K59A 2SNMA 1IL8A 5CV7A 1S4ZA 3QOJA 4PQXA 4KV6A 4IUVA 1B1ZA 3A55A 1TWCB 3ITPA 2WINB 3H6MA 3K58A 1TS5A 1PTOH 1F9PA 1FNVA 5J22A 4FP5D 5DEHA 3HOWB 1Z7TA 3RUZA 1FD7D 3NTIA 1UEAB 3S1RB 2O2LD 2VXWA 1I4HA 1ET6A 4DN4M 4BA1I 1TIID 5IOCA 1LTTD 5KRUA 1TWHB 1TR5A 5JPNC 3GTLB 1DJRD 1F9RA 3TBIB 2A6ED 1ENFA 4KJNA 1JWUD 2C5CA 3D4WA 5FLXL 5EKKA 3S14B 1BF4A 1I4XA 3UI2A 1EY9A 1JOOA 4TSSA 5EGTA 3MFGA 1CFMA 5LL6X 2B2VC 4CGYB 3HOXB 3U9SA 1ZXTA 3NHHA 2NTTA 2XIWA 4OL7A 5CV9A 4HSPA 3MWYW 2F3WA 1Y1WB 4FF4A 2WAQB 3OIPA 3VYSA 1B9NA 2PYKA 5JEAJ 1KDAA 3FVQA 3GO5A 3NWSA 3OOCA 4ME5A 2L9HA 2B39A 2BA0A 3PV0A 2F03A 2NVYB 1B2TA 5KYIA 1C4QA 2Q8IB 2TMPA 3A8IE 3DWQA 2IWHA 1L0XB 1U9RA 4L6TB 1SSOA 1TS3A 2B2UC 4KN7C 2AQ2B 3SK6A 1AZQA 4CJ0B 4HN7A 4BA2I 4F87A 3EA6A 1Q90A 4HMIA 2TSSA 1NSNS 3M7GA 2B2YA 1A2UA 3FMCA 4HMJA 5G3LD 2OF1A 2R6GA 2XWJB 2KVMA 1GXDC 1M4VA 3R93A 4KD3A 5E1FA 1QOHA 4ILWA 2M00A 1GUTA 5DM73 5C3XA 2AUKA 1D1IA 1FGBD 4XDXA 5IODA 4MIUA 4DNRB 4KMUC 3QO2A 4CBVA 3L3OC 4KD4A 4LAAA 3TZDA 3VYTA 1HHVA 4KY5A 1PRTC 2K6AA 2KA7A 3IL8A 4QB4A 2EJGC 2F0PA 3A7LA 2F0SA 5C4HA 4FVMA 2RDHA 4PNYA 5D3IB 3QOLA 2Z4IA 2JSOA 2IPKD 4EQOA 1STBA 3P20A 4I7ZC 1QCBD 4C3IG 2FHTA 2NYZD 4KKSA 4ZRZA 2EYFA 3JAME 1V1OA 1YNNC 3Q6SA 4DAVA 3KLSA 3S17B 5KYLA 3OPOA 2K33A 4B08A 3I3CA 4QUFA 3GTQB 2HDLA 1ET9A 1Y8PB 4FNFA 1QNKA 3J81E 3M3YB 4L63B 4DK0A 3C3LA 1WD1A 1TKWB 3RLFA 1GUNA 2DNEA 1JR0D 3A56A 5G3LF 3TSSA 2IJ0A 2HUGA 2WIIB 3NSWA 1LT4D 2F3VA 3U9OA 1R9TB 4UAIA 1X3PA 4K8IA 3P1HA 5KNCA 1RF2D 1TS2A 3Q22A 3WDNA 3QB3A 4KJOA 2NVTB 1JORA 4IZ8A 3PMFA 2RDFA 1SMYC 2FJ2A 2A74C 1SE4A 2D2CC 2KCCA 1FNUA 1E2WA 5C3EB 4O42A 3C46A 2VB3X 1F77A 5C4JB 3FPUB 4ZLTF 1D5XC 1LTBD 1BXTA 1MBYA 4X3TA 4CJ1B 2NZ1D 2QDBA 4K6DA 4DF7A 1ZYRC 1D1KA 1EEID 3IKJA 2HCCA 1UUPA 1O80A 4ZKBB 4IFDJ 3MZ5A 1TY0A 1VF5C 5C0XH 1WTOA 2V4DA 1D5MC 1CZWA 1EY6A 1SBBB 4F88A 1JOKA 2NWGA 4Y7NB 4IUUA 3TP8A 3PIO3 2OEOA 2XSCA 3VR4A 1NCVA 1R4QB 1Q8IA 2L0CA 1D2BA 5CV5A 4RWSC 2AWNA 3R2IA 1SNOA 3L9AX 3GTOB 5EPJA 2F0DA 1VF7A 4KKUA 1EWHA 1Y69U 2K01A 2K04A 3S1NB 3TZUA 2KHSA 3M4YA 2QKIC 3VR2A 2MUYA 2Q8RE 3E0JA 2K05A 3N6RA 5CV8A 3CRLC 2G9DA 1TWFB 5K36G 3L7ZC 1EY5A 4A3BB 2EJMA 5JOBA 3EFXD 1VCIA 1CI3M 3H09A 1CZGA 3BDLA 1I4QA 1KDCA 2JA5B 1BNZA 2MPMA 3O13A 3A8KE 2CQAA 5JAVA 1CA5A 4XQJA 1B50A 1HQRD 1G2SA 4R8NA 3HOYB 2X6GA 3HOZB 5EPKA 4MHEA 2WV6D 2F0NA 2D9UA 2M2LA 2A6EC 1OXXK 3PO2B 4RCNA 3SE0A 4ZKCB 1AN8A 3SHLA 1O78A 3MFYA 1GJXA 3ERQA 2F0KA 4HCEA 4J1MA 1E2VA 4ZYSA 2Y0SB 3J7AF 2NVXB 5J39A 3GV3A 3P75A 1MD2D 2Z8LA 1X3QA 2K7VA 2H1EA 2F0VA 2XN9C 1ENCA 1II3A 3TP6A 1O7LA 5CV4A 4XYOA 1HQMC 3IFDA 2I07B 1X32A 5T1GA 4K6LA 2BDNA 4XT1B 3GTGB 4TQUS 5FO8B 2YU9B 1JCKB 3RMHA 3KBXA 1I6HB 1TWAB 4C3HB 1IYVA 2JEAI 4TKOB 2VB2X 2NN6I 1BBXC 1IW7C 2B2WA 3I91A 4A93B 2FFKB 2JXMB 2XWBB 5ELDA 4K2KA 3OWEB 4OHJA 4K5VA 5ELCA 2KJXA 3E5SA 3I4LA 4OO1G 1G2TA 3T13A 5K36H 2B8FA 4RHRA 2FINB 1RTNA 1EQVA 5E3FA 3D31A 5CYUA 2MP1A 1SJHD 2L12A 1SNCA 1G6ZA 3OMCA 1I4RA 3CKIB 5DM63 3R3OA 1PTOB 2MGSA 1PZKD 3FKIB 1E2ZA 2F0MA 2NUCA 3JAML 1ILQA 3DXJC 2G9HD 1G91A 1K8OA 1S5CD 1AFPA 2D62A 4RCOA 3OIQA 1DOMA 1RCVD 4RH6A 3VR5A 2A68D 3SR1A 4A3JB 2PCFB 4IUTA 5I2YA 3I4MB 3OSOA 2QCPX 3J81L 4DK1A 2L55A 4LMQD 1TS4A 2EYJA 4IALA 4G57A 3N52A 3V96A 2C9OA 1BQQT 3J7AV 1WTXA 1EU4A 4ID6A 4E6IA 3CU7A 2EXZA 1A3VA 4X3SA 2M9VA 5M9OA 5D14A 5C4ZA 3IFTA 1L0YB 1EYDA 2A6HD 4F8MA 1MGSA 1SYBA 2YYZA 3EQLC 4FF2A 3LWUA 1BDOA 1SNMA 1V1PB 2K32A 1HXYD 5JVG3 3RD4A 1DOLA 4BWGB 3VR6A 3HGBA 1IW7D 1MI2A 1HFNA 2A69C 3K6OA 1VMCA 2PW7A 1HUNA 3H3VC 4OO1H 1TT2A 5EKLA 2F0EA 1VDZA 5HGTA 4F7XA 3GTKB 1BR9A 4BY1B 1LT6D 2K28A 2AUJD 3NXWA 3HP3A 5BN5A 5E4WC 1ONLA 5C5LA 1PFNA 3PIP3 1CQFA 1GHKA 2DY7A 4C1NI 1PZID 1SJED 3GD7A 5KGUA 3X3NA 2K1BA 2PNRC 5M3MB 2SNSA 1Q12A 2LY7A 3GTPB 1Y8NB 1EL0A 5E4XA 2CW0D 3PUXA 1EY8A 4JK1C 1ML0D 4XXEA 5JEAG 1LTSD 1S5FD 1BCPB 1XXGA 5BN4A 1KNEA 3SEBA 4DXGA 3S1QB 1LV9A 3PUVA 1SNPA 1DYQA 1GUGA 3TN2A 4Q0FA 1H9RA 3W3AA 4DGZA 3VA5A 2K5QA 1EWCA 2F0WA 1PMRA 2B2TA 3K5LA 3I73A 3K57A 5A35A 4P2CB 5JVH3 3MXNA 3MC0B 1W6JA 2EYPA 1H9SA 4RA8A 1JQYD 1ZKOA 4N9PA 3BVGA 3P7JA 1LACA 2EYHA 1EY7A 5I6WA 2N55A 4L8JA 1JB3A 1SFOB 1BOSA 1SXTA 5I4DA 2CHBD 2ZT9C 4KHZA 2KUMA 1EYAA 2F4IA 1LO5D 5M5XB 2A69D 3J80E 5C4XB 1KNAA 5C0XG 2OXPA 4C3JG 1B53A 1OO9B 5M3FB 5T1IA 5CC4A 2AWOA 2JA8B 1STYA 3G7LA 4Z9CB 5CORA 2XRQD 4OGQC 3SVMA 1TVXA 2X6LA 5I2XA 1EIGA 1Q1EA 4WFN3 1ESRA 1IKMA 1WTPA 2O5JC 4TRDA 1RD9D 3D4DA 5JEAH 4ODGA 1XYIA 3QWNA 3HEJA 2DNCA 1YNJD 4QF4A 3A8JE 2PZWA 5K5PA 4KK7A 2O4XA 3URYA 4A3DB 1BCPD 1Y8OB 4QIWB 1BO0A 4RKBA 2I46A 4B9XA 4XTCS 3K5MA 3GP7A 1Q3LA 2SDFA 3SXHA 4IUPA 4EQPA 1BUVT 5CMDA 2J4XA 2LMCB 3TMEA 3V05A 3VYRA 1KLGD 4H0LC 3EJIA 2B2YC 1LABA 2IL8A 3NUCA 4XQQA 5IGFA 2ICEC 1A6XA 2EPBA 5JJZA 3SDZA 3FEWX 3SK8A 1JE4A 2OT2A 3MHBA 2EJFC 5IGCA 2R7ZB 5EBDA 4WRDA 1KAAA 1QJOA 4S3SA 4PMWA 3NTKA 3NE5B 1PXUA 1C8CA 1H9MA 2DN8A 4KN4C 4QUCA 1LLRD 2ID0A 3I90A 4C3IB 4IUNA 3KLSX 1CHPD 5BN3A 1S5ED 3HZXA 3S9WA 5KEEA 3QG1A 3BVMA 1H9SB 1CTMA 3H91A 2RSOA 2AQ1B 2QF7A 4NP5A 3X3MA 1MSGA 5DNFA 4RGTA 3H94A 4BY7B 2O5IC 4NW2A 4FXGC 4IN3A 4DFAA 3NPPA 3T56B 4PV1C 3FDTA 1U4LA 4FF3A 2F0TA 3S15B 4QCLA 2F0IA 1KDBA 1HRJA 2N88A 3Q23A 1J8IA 2B8GA 4ZK9B 2IX1A 3FPPA 1QB5D 3T16A 2H4OA 2RBMA 3DHQA 4H7BA 5IGDA 1JWMD 1M8AA 2R3ZA 1V43A 2J0TD 2F0QA 2QEJC 1DXMA 4XYQA 2F0FA 1DD2A 2PQEA 2F0UA 3D8GA 4K8JA 4U68A 2R92B 1CT1D 3I70A 1KABA 1HFGA 1RODA 1EU3A 1CQVA 3R2TA 1OXUA 1DOKA 4CKEA 5IGGA 4NMZA 4GZYC 2EYOA 1EY0A 4M8AA 5HURA 3M4OB 1STEA 4FXKC 4WJWA 2E2DC 3S2DB 3NTHA 3T4AC 4IQZA 1WTQA 1LTAD 2ICIA 3ONAB 2B2VA 1SYCA 3BVZA 2RA4A 3KBGA 1EQTA 2WB1B 2HDMA 1TQOA 1LTRD 2CVRA 2SOBA 4LJZC 3Q24A 3RZDB 4JBWA 4HAEA 4LK1C 4K14A 2A68C 3HRZC 5EKIA 1OXSC 4FYDA 4R9WA 1CM9A 3I4NB 5ELFA 2EY1A 3SK5A 3MTSA 2RSNA 4PMBA 3D4RA 1A3TA 4G4KA 1CA6A 1SE3A 2EVBA 4N9TA 2QILA 1JOQA 3AU7A 3RZOB 3AB9A 4ZUIA 1ENAA 2A6HC 3NP8A 5C44B 1SYGA 3KLRA 4NKLA 1O7ZA 5M5WB 3QIAA 4CJ2C 2NN6H 2B2UA 5M5YB 2EE1A 3DEPA 4CHTB 3GQBA 2JEBI 2X69A 3NQIA 1J9OA 1NAPA 5IT9E 1EIHA 1B44D 1STNA 4ZQ3A 4C2MB 3A7AB 2WKDA 5A2QE 1NR4A 4IFDI 1B4OA 4J8QA 2NVQB 2R61A 1STHA 1DM0B 3WOFA 3PO3B 1JWSD 1EOTA 4RAUC 3KF8A 5C6AA 1JICA 4J6HA 3K0YA 2F0OA 5TSSA 4A3FB 1I50B 2F0LA 5EPLA 1HUMA 1HTPA 1Z6HA 1PZJD 1R4PB 2XVSA 2FMCA 4B9WA 1D5ZC 1PTOC 3HS0C 3CHBD 1HTLD 5KNBA 2CW0C 1T5EA 5EQ0A 2FMMA 4UDUC 4FF1A 3J80L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B1Z A;  2IPK D;  1DYQ A;  1LTG D;  1PYW D;  1PTO D;  1SE4 A;  1T5X D;  2RDG A;  1L0Y B;  1TS5 A;  1FNU A;  1JCK B;  1PTO H;  1FNV A;  1KLU D;  1EFI D;  1SE3 A;  1D6E C;  3URY A;  1EWC A;  1BCP D;  2QIL A;  1CK1 A;  1F77 A;  1UNS A;  1PTO F;  1KTK A;  2SEB D;  1D5X C;  1FD7 D;  1LTB D;  1RDP D;  3DWQ A;  1BXT A;  2XRS D;  3MC0 B;  1V1O A;  1G8Z D;  1JWM D;  1L0X B;  1V1P B;  1FNW A;  3GP7 A;  4L6T B;  1BCP C;  1JQY D;  2O2L D;  4DXF A;  1TS3 A;  1HXY D;  1CHQ D;  1XTC D;  2QEJ C;  1EEI D;  2AQ2 B;  1HA5 A;  1I4H A;  2AQ3 B;  1ET6 A;  5ELD A;  1EEF D;  3BVG A;  4C56 C;  1V1P A;  2J4X A;  3EFX D;  3OWE B;  4OHJ A;  3V05 A;  4BWG B;  5ELC A;  1CT1 D;  1KLG D;  1TY2 A;  5D3D A;  1LTT D;  1UUP A;  1I4Q A;  3EA6 A;  3DWP A;  1ET9 A;  2TSS A;  1ESF A;  1SXT A;  1DJR D;  1TY0 A;  3O13 A;  4RHR A;  5I4D A;  4L63 B;  1EU3 A;  2CHB D;  1CQV A;  1ENF A;  1HQR D;  3BZD B;  1SE2 A;  1M4V A;  1JWU D;  1PRT B;  3BYT B;  1BCP F;  1I4P A;  1SJH D;  3R2T A;  1SEB D;  1JR0 D;  1S5D D;  1B44 D;  1I4G A;  2WV6 D;  1D5M C;  1I4R A;  1LO5 D;  5FKA C;  3TSS A;  1PTO B;  1I4X A;  1PZK D;  2IJ0 A;  1LT6 D;  5FK9 C;  1SBB B;  5ELB A;  1FGB D;  1STE A;  4O1N A;  1LT4 D;  3W2D A;  4TSS A;  2G9H D;  2R61 A;  1AN8 A;  1LTI D;  1PZI D;  1JWS D;  1S5C D;  1SJE D;  3MFG A;  1PRT D;  4RCO A;  4RHS A;  1LLR D;  1GOZ A;  1LTA D;  1RCV D;  3BYY B;  2ICI A;  4RH6 A;  2NTT A;  3KLS X;  1CHP D;  5TSS A;  4ZYS A;  4Z9C B;  1S5B D;  1S5E D;  3DWA A;  3BVZ A;  1RF2 D;  1PRT F;  2XRQ D;  1LT5 D;  1AW7 A;  1TS2 A;  1PRT C;  1LTR D;  1MD2 D;  1LT3 D;  2Z8L A;  1PZJ D;  4RGN A;  3R8B A;  5ELE A;  1QIL A;  3BVM A;  1LTS D;  1TS4 A;  3R2I A;  2AQ1 B;  1S5F D;  2RDH A;  2XN9 C;  1BCP B;  5D3I B;  2XNA C;  1D5Z C;  1PTO C;  1XXG A;  3CHB D;  1HTL D;  4RGT A;  1RD9 D;  1EU4 A;  4RGM A;  4UDU C;  3SEB A;  4DXG A;  2NTS A;  4RFB A;  5ELF A;  4RGO S;  4K6L A; 
#chains in the Genus database with same CATH topology
 3LWE A;  1LTG D;  2K75 A;  2RDG A;  4A3I B;  1H9K A;  1DCZ A;  1W6K A;  3I4M H;  4ULL A;  2PZT A;  2ZXR A;  3MA2 B;  4X64 Q;  4U67 3;  1N8R C;  1NY4 A;  1CSQ A;  5COY A;  1FJG L;  1K83 B;  1UNS A;  4B3R L;  4JI6 L;  3FRP B;  1D8L A;  5I9O A;  2Z1C A;  3DLL A;  5BR8 L;  3HOX H;  2BE5 D;  3KUP A;  4L5Q A;  5I9P A;  4WJ4 A;  3CCS A;  1EY4 A;  1Y1V B;  3NQT A;  1F2Y A;  2RCN A;  4XIG S;  3AQQ A;  4DK3 C;  4LWC A;  1Y1W H;  3PUW A;  4IPH A;  3KLW A;  4JI2 Q;  4QMG A;  4POG A;  1VMP A;  1VQI A;  3EIV A;  4V19 0;  1O7Y A;  1CKN A;  4JC0 A;  3CP0 A;  3LNN A;  3PUZ A;  2K03 A;  3S2H B;  4KY7 A;  2CH4 W;  2PMZ B;  4LF6 L;  5J1Z A;  1SEB D;  4DR1 Q;  1BBU A;  3HKS A;  4HJA A;  1WI5 A;  2HIX A;  4GOP C;  4BBS B;  1KL9 A;  2NVY H;  3C1F A;  1GUW A;  2KQ3 A;  5JPM C;  4NPS A;  2L5T A;  1JE5 A;  5FO7 B;  1FGU A;  3CQZ B;  3H3V H;  3QJY A;  4GN5 A;  4P72 A;  1YZ6 A;  5LL6 S;  4G7H C;  2LKV A;  1B7Y B;  4Q5V A;  2ATW A;  1SE8 A;  2KEC A;  2RQX A;  2L4N A;  5CGK A;  4LFA L;  2JP1 A;  3OW7 A;  2JA7 B;  3BDO A;  4EVO A;  1Q86 C;  4BY1 H;  5KIX A;  4RGN A;  4NXM L;  1QIL A;  4DR7 L;  2JE6 I;  1F9S A;  1C48 A;  4P73 A;  2GA4 B;  3DUZ A;  1NUC A;  4KKT A;  2OTJ A;  1WTH A;  2JYO A;  3I72 A;  4LFB L;  4X66 Q;  2Z6B A;  1ZEQ X;  4KTA A;  5F2D A;  1PTO D;  2Y0S E;  3JAM c;  2VUM B;  3ULP A;  1EFI D;  1RJT A;  1D6E C;  1YI2 A;  2HQE A;  1SYF A;  2MHV A;  4OO1 I;  5GAG C;  4DAY A;  3D3R A;  2BCO A;  2SEB D;  3HOV B;  1YNJ C;  1HNX Q;  1G8Z D;  2B2W C;  1FNW A;  5ISR A;  2E2H B;  1BCP C;  4DXF A;  1GUS A;  4CKB A;  3J81 c;  5NUC A;  4OX9 Q;  4ZAI A;  1HPC A;  2PO4 A;  2IY5 B;  4C56 C;  2RKS A;  2PZU A;  4V0B A;  1QWY A;  3NBH A;  3GTJ B;  3KF8 B;  2BDO A;  1TY2 A;  5DAU A;  4NDX A;  1A3U A;  4XT3 B;  3KK7 A;  4LF5 Q;  3T1Y L;  1Q46 A;  1SND A;  4CDC C;  5C0X J;  2EY5 A;  3F2D A;  2E76 C;  4B3M Q;  4HSV A;  3D6C A;  3DMU A;  1SE2 A;  4OIJ A;  1PRT B;  5C3E G;  4DV7 Q;  1N36 L;  1VQ9 A;  1M1K C;  1AP0 A;  1QNU A;  1WTV A;  1B3A A;  3CME A;  4K5X A;  2ZXO A;  4KY6 A;  3LX0 A;  2NB0 A;  1KC8 C;  1GUO A;  4DNI A;  5FK9 C;  2PW5 A;  4M1U B;  5ELB A;  1U4R A;  1YIT A;  5C3W A;  1VQC A;  1NR2 A;  1L1O B;  4DAP A;  1FR3 A;  1RHP A;  5CBE E;  1UE6 A;  4DV1 L;  4GLX A;  3S24 A;  1X6O A;  3VA7 A;  4C1N K;  1XWE A;  2E75 C;  3BS1 A;  5IGE A;  3DWA A;  3E3X A;  3M4P A;  5M5X H;  3S17 H;  3GTM B;  1AW7 A;  1JB7 A;  4ABN A;  1AZP A;  3H0G B;  3R8B A;  5ELE A;  4DK6 C;  1SAP A;  2EY6 A;  4GLA C;  1AEX A;  5FOB B;  5AFW A;  1IBM Q;  1F9Q A;  3M3Y H;  3TDQ A;  3OYY A;  4JI1 L;  1RKN A;  3K7A B;  4RGM A;  3WWV A;  3M7N A;  1QG7 A;  2K14 A;  2EZV A;  2L1B A;  1F2M A;  2VY3 A;  4RKL A;  1EWI A;  1Z47 A;  5LMN W;  1CKN B;  5FLX E;  4LF4 Q;  3TP5 A;  1CK1 A;  1G6P A;  1Q1B A;  1PTO F;  1WTW A;  3IRB A;  2A5H A;  2E2J B;  1J6Q A;  1RDP D;  2HCI A;  1R9T H;  1PH4 A;  4HED A;  4KHP L;  4DR1 L;  2KOL A;  3S16 B;  1XTC D;  5I6Y A;  3RR5 A;  2UU9 L;  1A15 A;  3EN2 A;  2VNU D;  3CRK C;  4A3D H;  2EIF A;  3DWP A;  3M85 A;  1SDF A;  3A5U A;  3HOU B;  4GKJ Q;  2VQF Q;  2NVT H;  4DV4 Q;  2F0J A;  1VQH A;  2F1M A;  4G7Z C;  5D65 A;  3ERO A;  1I4P A;  2LS0 1;  4HIK A;  4FO2 A;  4HR7 B;  4A3G G;  2XGT A;  5FKA C;  1MKH A;  3KF6 A;  5IIF A;  4A75 A;  4EQN A;  4DNT B;  5C3E H;  4O0A A;  3J7Y W;  2KCN A;  2WP8 J;  2R93 B;  1B9M A;  1XNQ Q;  3W2D A;  5C4J H;  4FXD A;  1LTI D;  4A3B G;  1PRT D;  2KBN A;  1EQR A;  4HIM A;  3ICE A;  2OQ0 A;  1GOZ A;  1GO3 E;  3K5N A;  1SR3 A;  5IE8 A;  4AH6 A;  1FYC A;  2JA5 G;  1I6V C;  3ND8 A;  4DAM A;  4DAY B;  1MSH A;  1LT5 D;  3U50 C;  3G6J B;  4BBR B;  5CR3 A;  1IBL L;  3HOZ G;  4AQY Q;  1PDQ A;  4LFC L;  3BG3 A;  2K5H A;  5IT9 L;  4R8I A;  1F2L A;  1V8Q A;  3GV6 A;  1HNX L;  1C0A A;  5EBC A;  4YIJ A;  2K5V A;  1IKL A;  3NBH B;  3BDC A;  1WCM B;  1TWG B;  1F2Z A;  1PFB A;  2KEE A;  4IUQ A;  3PO2 G;  4RGO S;  2Q8T A;  4OEM B;  4R4C A;  4OX9 L;  2AKW B;  5A2Q L;  3T1H L;  3SK4 A;  3I8Z A;  1PYW D;  2WAC A;  3Q8D A;  3Q0A A;  3PUY A;  2D5D A;  1KLU D;  1WD0 A;  4IO9 A;  4PMC A;  1STG A;  1YNN D;  3NK9 A;  4A3K B;  1GHJ A;  5IP7 G;  2B2T C;  4GKK L;  4LF5 L;  2EY2 A;  2Y0S G;  2BOS A;  3CAM A;  1U4M A;  2IW3 A;  4Y7N H;  4B3M L;  3RN5 A;  2XRS D;  4JI7 Q;  3EVQ A;  1IHZ A;  1SYE A;  5FJ8 G;  1H9J A;  2ENB A;  3DM1 A;  3T51 B;  4C3J B;  1CHQ D;  4K5W A;  1OXV A;  2VZA A;  2WKC A;  2B63 B;  3HKZ B;  4H44 C;  4DR3 Q;  1E1T A;  2VS1 A;  4APV A;  3ER0 A;  5DLQ E;  4ZUJ A;  4LUO A;  1WVL A;  4X3U A;  2J7Z A;  2K5W A;  3M9B A;  5C0X I;  1ESF A;  3GTO H;  2NN6 G;  4N8X 1;  2Q2T A;  2CQO A;  3BZD B;  3MXP A;  2IT1 A;  5C5M A;  4DR6 L;  1U4P A;  1PH2 A;  4CKC A;  1BCP F;  4C3H G;  2EDG A;  2KCT A;  4A3M B;  2CCZ A;  2ZM6 Q;  2IX3 A;  1UAP A;  3ND9 A;  5EJW A;  1S5D D;  1EZ8 A;  2E2I B;  3VR3 A;  4YHH Q;  3S1N H;  4IFD G;  1QUQ B;  2F0G A;  3ZYY X;  1O7I A;  4O1N A;  2IX0 A;  2DY8 A;  1IBM L;  5KND A;  1STA A;  1G29 1;  4A93 G;  2L11 A;  1HCZ A;  1TU2 B;  1QE6 A;  4MZ9 A;  1ASZ A;  2ES2 A;  4GS3 A;  1KD1 C;  3DEO A;  1CUK A;  2ZXP A;  4UP9 A;  1ILP A;  4DA2 A;  3MAQ A;  1Q82 C;  1DZ1 A;  5JJK A;  3VYU A;  1TWF H;  1S5B D;  3TQY A;  1VQN A;  5CV6 A;  2EOT A;  3HOW G;  4LNQ A;  3AMU A;  1PRT F;  4A3B H;  1SNQ A;  3CPF A;  1SMY D;  5LHY 1;  2RVL A;  4OIK A;  2Z4H A;  4A3G B;  1XX8 A;  2JA5 H;  3S2D H;  1N34 Q;  4LF8 Q;  3CD6 A;  4I65 A;  1IYU A;  3HOY H;  3C2P A;  5IGB A;  4AYB B;  2D0P A;  3FKI G;  2NTS A;  4RFB A;  1YHQ A;  3HOZ H;  1N32 L;  4JW0 A;  2KED A;  3KJP A;  3T53 B;  1C9O A;  4IUR A;  3S1M B;  1T5X D;  4B3S L;  2K5N A;  2DJG C;  3IAY A;  4OWW B;  1JJG A;  4MN3 A;  3PO2 H;  4A3E B;  5FO9 B;  2PQA A;  1B3Q A;  3F2U A;  4HTH A;  4HJ8 A;  1ZYR D;  3OMG A;  2VQF L;  4X62 Q;  1JC7 A;  1KTK A;  4DV4 L;  3K0X A;  2ZTE A;  3OWF A;  4GN3 B;  3KF6 B;  3I4M G;  1A2T A;  5IP7 H;  2MJ8 A;  4EGV A;  3CCM A;  3MXG A;  4XQN A;  1DON A;  2F0H A;  2VQE L;  1HA5 A;  1I3Q B;  2AQ3 B;  4TVA B;  3MEH A;  1OXT A;  1EEF D;  2NVX H;  2K50 A;  3G48 A;  1V1P A;  5FJ8 H;  3BZC A;  4BS9 A;  4HCS A;  5D3D A;  2BE5 C;  2A1A A;  3MXU A;  5LMN Q;  3NWT A;  4QIW E;  4DU9 A;  2E74 C;  2JQO A;  2NBF A;  3G4S A;  3WOE A;  2UXC Q;  3BYT B;  4YY3 L;  1K8M A;  1RTO A;  2BA1 A;  1PLF A;  1ICW A;  1E0B A;  3A54 A;  5M5Y H;  1I4G A;  1UE5 A;  1YEZ A;  2EYM A;  3OHX C;  4KI0 A;  3GTG H;  3D6W A;  2YU9 H;  1UWV A;  2EYL A;  4DR4 Q;  1EYC A;  1TWA H;  3UE1 A;  4C3H H;  1SYD A;  2E8G A;  2LFN A;  3V2T A;  4G7O C;  3KFU A;  4H13 C;  4KHV A;  4L5S A;  2E5L L;  5CBA E;  4YCW A;  4IFD H;  4RHS A;  2A73 B;  4UY8 C;  1EZ6 A;  3BYY B;  5ELN A;  3MVV A;  3VDY A;  2Z6K C;  3TP7 A;  2L15 A;  1WTR A;  4X65 L;  4A93 H;  1EIF A;  3C1E A;  4NXN Q;  2PPB C;  4K2L A;  1PFM A;  3PSI A;  1I5F A;  2JA6 B;  3K5O A;  1LT3 D;  4X3K A;  3E6Z X;  3NBI A;  1SLJ A;  1U0L A;  4WOR A;  2K5D A;  1HA6 A;  2XNA C;  3HG9 A;  4GLV B;  3U4V A;  3UDF A;  1JJ2 A;  1D7Q A;  3K59 A;  2SNM A;  1IL8 A;  5CV7 A;  5JJL A;  2QA4 A;  4BY1 G;  1S4Z A;  1PA6 A;  3QOJ A;  1E22 A;  4PQX A;  4KV6 A;  4IUV A;  1B1Z A;  3A55 A;  4DR3 L;  1TWC B;  5AJ3 Q;  3ITP A;  2WIN B;  3H6M A;  3K58 A;  1TS5 A;  4QQB X;  1PTO H;  1F9P A;  1FNV A;  3U58 A;  3FKI H;  5J22 A;  5M3M G;  4FP5 D;  4K0K L;  5DEH A;  1N9W A;  3HOW B;  1Z7T A;  4JV5 Q;  2D0O A;  3RUZ A;  1FD7 D;  3NTI A;  2DGY A;  1UEA B;  2ZM6 L;  3S1R B;  2O2L D;  2VXW A;  3KDF A;  4A3J H;  4YHH L;  2RF4 A;  1I4H A;  1ET6 A;  2B29 A;  4DN4 M;  1H95 A;  2GVB A;  1YJ9 A;  1TII D;  4BA1 I;  5IOC A;  1LTT D;  3CC2 A;  5KRU A;  1TWH B;  2P5Z X;  1TR5 A;  4IJH A;  5JPN C;  3GTL B;  1DJR D;  4IOA A;  1F9R A;  2I0Q A;  3TBI B;  2A6E D;  1ENF A;  4KJN A;  1JWU D;  4JI5 Q;  1QZG A;  2HHH Q;  2C5C A;  3D4W A;  5FLX L;  5EKK A;  3S14 B;  3OTO Q;  1BF4 A;  1VQB A;  1PYS B;  1I4X A;  1G51 A;  1JT8 A;  3CCE A;  3UI2 A;  1EY9 A;  2OQK A;  1JOO A;  4A3C G;  1PYB A;  4TSS A;  5EGT A;  3MFG A;  3L0O A;  1CFM A;  5LL6 X;  2B2V C;  4JI8 Q;  4CGY B;  3HOX B;  1T9H A;  2PQA B;  3U9S A;  1ZXT A;  3NHH A;  2NTT A;  2XIW A;  4OL7 A;  1NE3 A;  5CV9 A;  4HSP A;  3MWY W;  3K8A A;  2F3W A;  1QZH A;  1Y1W B;  5IYC H;  4FF4 A;  1AE3 A;  2WAQ B;  3OIP A;  3VYS A;  1B9N A;  2PYK A;  5JEA J;  1KDA A;  3FVQ A;  3GO5 A;  3NWS A;  3OOC A;  1FL0 A;  4ME5 A;  5C4X G;  2L9H A;  1YNX A;  2FXQ A;  2ASB A;  2B39 A;  2BA0 A;  3PV0 A;  2F03 A;  5M3F G;  3GTK H;  4CDD C;  2NVY B;  4DV5 L;  3A74 A;  1B2T A;  2WB1 E;  5KYI A;  1C4Q A;  2JA8 G;  5LMN L;  1BVS A;  1KRS A;  2Q8I B;  3K7U C;  1BBW A;  2TMP A;  3A8I E;  1EUJ A;  1YBY A;  3DWQ A;  2IWH A;  4Y52 H;  1K0R A;  1PH1 A;  1L0X B;  3K81 C;  1I94 Q;  1U9R A;  4L6T B;  4R4I A;  5M3M H;  3JAM i;  4R4T A;  3UDG A;  1SSO A;  4JOI C;  1TS3 A;  3AYH B;  2B2U C;  4KN7 C;  3F2C A;  2AQ2 B;  1BKB A;  3SK6 A;  4MTK A;  4CJ0 B;  1AZQ A;  3GTP H;  4HN7 A;  1XMO L;  1PHJ A;  4ALP A;  2IHE A;  4BA2 I;  2CWA A;  4F87 A;  3EA6 A;  1IBK Q;  1Q90 A;  4DPG A;  4HMI A;  2TSS A;  4P74 A;  1NSN S;  2AMC B;  2B2Y A;  2PI2 E;  1A2U A;  3FMC A;  3M7G A;  4JI3 Q;  4HMJ A;  5G3L D;  1HZB A;  2OF1 A;  2R6G A;  2XWJ B;  3J80 c;  2KVM A;  2GVA A;  1GXD C;  3J81 i;  1M4V A;  1VS0 A;  3PF4 A;  3R93 A;  4A3D G;  4KD3 A;  1VQM A;  3S1Q H;  5E1F A;  1QOH A;  4ILW A;  2M00 A;  1GUT A;  5DM7 3;  5C3X A;  3GTJ H;  2AUK A;  1D1I A;  4GNX B;  2UUA Q;  4YCV A;  1FGB D;  3STB D;  4P75 A;  4XDX A;  5IOD A;  4MIU A;  2K52 A;  1XTD A;  4DNR B;  1KHI A;  4KMU C;  3QO2 A;  4CBV A;  1RIP A;  3L3O C;  4KD4 A;  2XTI A;  5AJ3 L;  2CFM A;  1J5E Q;  4A3C H;  4LAA A;  2UUC Q;  3L2P A;  4OWX B;  3TZD A;  3VYT A;  1HHV A;  4KY5 A;  1PRT C;  2QDL A;  1DGS A;  4O2D A;  4DR2 L;  2K6A A;  2KA7 A;  3IL8 A;  4QB4 A;  2EJG C;  2F0P A;  4DV0 L;  3A7L A;  2F0S A;  5C4H A;  4FVM A;  4LUZ A;  2RDH A;  4PNY A;  5D3I B;  2MNA A;  1SFO H;  4DR5 Q;  1IYJ B;  3I7F A;  2R7Z G;  3QOL A;  4L5R C;  4HIO A;  1L1O C;  5IYD G;  1NTG A;  2Z4I A;  1MJE A;  2JSO A;  2IPK D;  4EQO A;  2QEX A;  1STB A;  3P20 A;  4I7Z C;  3H0G H;  3G71 A;  4X64 L;  1QCB D;  1A8V A;  2ZJQ A;  5C4X H;  4MNO A;  4C3I G;  1K0S A;  2FHT A;  2NYZ D;  2JA9 A;  4KKS A;  5M3F H;  4ZRZ A;  2EYF A;  3K7A H;  3JAM E;  1V1O A;  4L5T A;  1YNN C;  3Q6S A;  4DAV A;  2JA8 H;  3RLO A;  3OTO L;  3KLS A;  3S17 B;  3ULL A;  1HH2 P;  1NMF A;  5KYL A;  3OPO A;  2K33 A;  4B08 A;  3I3C A;  4BY7 G;  2Q2I A;  4QUF A;  1Z9F A;  2KEN A;  4JI2 L;  3GTQ B;  2HDL A;  1ET9 A;  4YWL A;  1Y8P B;  4FNF A;  1QNK A;  3J81 E;  3M3Y B;  1VQ6 A;  4L63 B;  4JI8 L;  4DK0 A;  3C3L A;  4N8F A;  1WD1 A;  1TKW B;  1E7Z A;  3RLF A;  1GUN A;  2HIV A;  2DNE A;  3S16 H;  1JR0 D;  3A56 A;  5G3L F;  3TSS A;  1TXY A;  2IJ0 A;  2HUG A;  1HNW Q;  2WII B;  4POF A;  4NB3 A;  3NSW A;  3AFQ A;  1LT4 D;  4A76 A;  2F3V A;  2WFW A;  3U9O A;  1R9T B;  4UAI A;  1X3P A;  4K8I A;  3P1H A;  3NEM A;  5KNC A;  5IP9 H;  2PMZ E;  1V1Q A;  2Q2H A;  1RF2 D;  1TS2 A;  3Q22 A;  3WDN A;  3QB3 A;  1YHA A;  4QY7 A;  4UP7 A;  1S72 A;  1X54 A;  2QGQ A;  3I2Z A;  4KJO A;  4QJF A;  4JBK A;  2NVT B;  1GM5 A;  1I94 L;  1JOR A;  4IZ8 A;  3PMF A;  1A63 A;  1B70 B;  1WOC A;  2RDF A;  5GAH C;  1SMY C;  1QVF A;  3D0F A;  4JI4 Q;  3GDE A;  4X66 L;  2AHO B;  2FJ2 A;  1WFQ A;  2ZTD A;  1VQE A;  2A74 C;  1SE4 A;  3PQI A;  2D2C C;  2R7Z H;  2KCC A;  1FNU A;  2JJQ A;  1E2W A;  1IBK L;  5C3E B;  5IYD H;  3HOY G;  4O42 A;  4DUZ Q;  3C46 A;  2VB3 X;  1F77 A;  4JI3 L;  2UUB Q;  5C4J B;  1IZ6 A;  3FPU B;  4ZLT F;  1D5X C;  1LTB D;  2CH4 A;  1BXT A;  1MBY A;  1PFS A;  3PGZ A;  4X3T A;  4CJ1 B;  2NZ1 D;  4HJ7 A;  1YHB A;  3B6Y A;  4DUY Q;  1VQ4 A;  2QDB A;  4K6D A;  4C3I H;  1VQJ A;  4DF7 A;  2VW9 A;  3E9H A;  1ZYR C;  1D1K A;  1EEI D;  3IKJ A;  1HR0 Q;  5GAD C;  1GKH A;  2HCC A;  1UUP A;  3I4N G;  1O80 A;  4ZKB B;  2NZO A;  4IFD J;  1VQ8 A;  4CDF C;  3MZ5 A;  1TY0 A;  4BY7 H;  1VF5 C;  4DV7 L;  5C0X H;  3E9I A;  2Z6K A;  4JVZ A;  1J5E L;  1WTO A;  2V4D A;  1X3F A;  1MHW C;  1D5M C;  1CZW A;  1EY6 A;  3S15 H;  5C44 G;  1SBB B;  4DV3 Q;  2UXB Q;  4F88 A;  4JCV E;  1JOK A;  2F52 A;  1VQF A;  2A19 A;  2NWG A;  4JG2 A;  4Y7N B;  3UE0 A;  4IUU A;  1JMC A;  3CCR A;  1MIU A;  3BU2 A;  3TP8 A;  3PIO 3;  1Q8K A;  4A3M H;  2OEO A;  2XSC A;  3VR4 A;  1NMG A;  1S3O A;  1NCV A;  1R4Q B;  3NEL A;  1Q8I A;  2L0C A;  1D2B A;  5CV5 A;  1VQ5 A;  2R92 H;  4RWS C;  2AWN A;  3R2I A;  4IPC A;  1SNO A;  3L9A X;  3GTO B;  2B3G A;  5EPJ A;  3PIO A;  3TS0 A;  1CKO A;  1VF7 A;  1E1O A;  2F0D A;  4KKU A;  1EWH A;  1Y69 U;  2F4V Q;  1A0I A;  2K01 A;  2K04 A;  3RN2 A;  3PO3 G;  3S1N B;  1X65 A;  3TZU A;  4LF4 L;  2KHS A;  3M4Y A;  2QKI C;  3VR2 A;  3M4O H;  5FLM H;  3AFP A;  2MUY A;  1XPU A;  2Q8R E;  3E0J A;  4A3F G;  2MO0 A;  4JI6 Q;  2K05 A;  1QVC A;  3N6R A;  5CV8 A;  3CRL C;  5BR8 Q;  3M4Q A;  2G9D A;  4HID A;  4QGU A;  1TWF B;  5K36 G;  4AIM A;  3L7Z C;  1EY5 A;  4A3B B;  2EJM A;  5JOB A;  3EFX D;  5IT9 c;  1VCI A;  3RZD H;  1CI3 M;  3BJU A;  3H09 A;  1CZG A;  3BDL A;  1I4Q A;  1IXR A;  1KDC A;  2JA5 B;  1BNZ A;  4GKJ L;  4A3J G;  2MPM A;  3O13 A;  1V9P A;  5ELO A;  3A8K E;  2ZJR A;  2CQA A;  1U5K A;  5JAV A;  1CA5 A;  4XQJ A;  1B50 A;  1HQR D;  1G2S A;  4R8N A;  3HOY B;  2X6G A;  3I55 A;  2Z9H A;  3I4N H;  3HOZ B;  4I7A A;  5EPK A;  4MHE A;  4R4O A;  1I3Q H;  5JJI A;  1WYD A;  2WV6 D;  2F0N A;  5GRO A;  2D9U A;  4GOP A;  2M2L A;  1YVC A;  2A6E C;  1OXX K;  3PO2 B;  2KCM A;  1LUZ A;  4RCN A;  4JYA Q;  3SE0 A;  1XNQ L;  1PV4 A;  4ZKC B;  3RZO H;  4WJ3 M;  1Y1V G;  1AN8 A;  1ICF B;  1VQA A;  2YV5 A;  3NEN A;  4UP8 A;  3SHL A;  1O78 A;  3MFY A;  1GJX A;  3ERQ A;  5C44 H;  4HJ5 A;  2F0K A;  4HCE A;  4JI4 L;  4J1M A;  4LFA Q;  1E2V A;  5M5W H;  4ZYS A;  2Y0S B;  3J7A F;  3F1Z A;  2NVX B;  5J39 A;  3GV3 A;  3P75 A;  1MD2 D;  1C7Y A;  2Z8L A;  4DUZ L;  1X3Q A;  2K7V A;  4DV2 Q;  2H1E A;  4NXM Q;  3RLN A;  4AQY L;  2F0V A;  4DR7 Q;  2UUB L;  2XN9 C;  4BBS G;  1PH5 A;  1ENC A;  1II3 A;  3JC6 6;  3TP6 A;  1O7L A;  5CV4 A;  4XYO A;  3CC4 A;  1HQM C;  3IFD A;  2I07 B;  3BZK A;  1X32 A;  5IYC G;  5T1G A;  4K6L A;  4R4Q A;  2BDN A;  3FP9 A;  4XT1 B;  5IYB G;  4LFB Q;  3GTG B;  3RNU A;  4TQU S;  5FO8 B;  4C2M H;  2YU9 B;  1JCK B;  4FDB A;  3RMH A;  1LM0 A;  3KBX A;  1I6H B;  2OCE A;  1TWA B;  4C3H B;  3J81 j;  1IYV A;  2NVQ H;  2R7D A;  2JEA I;  1PH7 A;  4IJL A;  2JA7 G;  3PO3 H;  2HQL A;  4JI7 L;  4TKO B;  2VB2 X;  2NN6 I;  1BBX C;  4B3T Q;  1IW7 C;  1SRO A;  2B2W A;  3I91 A;  1S40 A;  1M90 C;  1K73 C;  1NJI C;  4A93 B;  2FFK B;  4A3F H;  2JXM B;  2KHJ A;  1I50 H;  2XWB B;  5ELD A;  1HZC A;  4K2K A;  3OWE B;  4OHJ A;  2UXB L;  1P8L A;  4K5V A;  5ELC A;  2KJX A;  3E5S A;  3I4L A;  4OO1 G;  1G2T A;  3T13 A;  5K36 H;  2B8F A;  4RHR A;  2DJF C;  1PH6 A;  1CSP A;  2FIN B;  2BH8 A;  2VUM G;  1RTN A;  1EQV A;  5E3F A;  3D31 A;  3S1R H;  4R1J A;  5CYU A;  3W1B A;  2MP1 A;  1SJH D;  2L12 A;  1PH3 A;  1SNC A;  1G6Z A;  3AEV A;  3OMC A;  1I4R A;  3CKI B;  5DM6 3;  4A3I H;  3HOV G;  3R3O A;  1PTO B;  2MGS A;  1PZK D;  1PH8 A;  3HKZ E;  3FKI B;  1E2Z A;  2F0M A;  1VQL A;  2NUC A;  3JAM L;  1ILQ A;  1K83 H;  3DXJ C;  3CCJ A;  2G9H D;  1G91 A;  1K8O A;  1S5C D;  4DV1 Q;  1AFP A;  2D62 A;  4RCO A;  3OIQ A;  1DOM A;  1RCV D;  1EIY B;  1YIJ A;  4RH6 A;  3VR5 A;  2F4V L;  3TRZ A;  3STB C;  1SMX A;  2A68 D;  4MTN A;  3SR1 A;  4A3J B;  4LF7 Q;  3S14 H;  1Y1V H;  2PCF B;  2PNH A;  4IUT A;  3ZJY C;  5I2Y A;  3I4M B;  3OSO A;  2QCP X;  3J81 L;  4DK1 A;  2L55 A;  3TEH B;  4LMQ D;  1TS4 A;  2EYJ A;  1E24 A;  4IAL A;  2EQS A;  4H02 A;  4G57 A;  3N52 A;  3V96 A;  1N34 L;  4LF8 L;  2C9O A;  4JI1 Q;  1BQQ T;  3J7A V;  1WTX A;  1EU4 A;  3KOJ A;  4ID6 A;  5EAY A;  4E6I A;  2ZJP A;  3S2H H;  3CU7 A;  2EXZ A;  2LXK A;  1A3V A;  3W5O A;  4X3S A;  2M9V A;  5M9O A;  5D14 A;  3PF5 A;  1VQP A;  5C4Z A;  3IFT A;  4BBS H;  1X55 A;  1L0Y B;  1EYD A;  2A6H D;  4F8M A;  2H5X A;  1MGS A;  1SYB A;  2YYZ A;  1UE1 A;  3EQL C;  4FF2 A;  4X62 L;  5IYB H;  3LWU A;  3CQZ H;  1BDO A;  1SNM A;  1X3G A;  4GOP B;  3H0G G;  1V1P B;  1HR0 W;  2K32 A;  3EBE A;  4KHP Q;  3CXC A;  1HXY D;  4AYB E;  5JVG 3;  3RD4 A;  1DOL A;  2JA7 H;  2UU9 Q;  1E3P A;  1UEB A;  4BWG B;  4A3L H;  3VR6 A;  3HGB A;  1IW7 D;  4JYA L;  1MI2 A;  2YTX A;  4P71 A;  2ZTC A;  1HFN A;  2A69 C;  3K6O A;  2CKZ B;  1VMC A;  5HGQ A;  2UXC L;  2PW7 A;  1HUN A;  2DUD A;  3H3V C;  4OO1 H;  2VL6 A;  1TT2 A;  5EKL A;  2N78 A;  2F0E A;  1VDZ A;  2I5L X;  5HGT A;  4F7X A;  3GTK B;  1BR9 A;  1CKM A;  3H3V I;  4BY1 B;  2VUM H;  4DV2 L;  1LT6 D;  2K28 A;  3NXW A;  2AUJ D;  3HP3 A;  5BN5 A;  5E4W C;  4DR4 L;  1ONL A;  2LXJ A;  5C5L A;  2RHS B;  3J80 i;  1PFN A;  3PIP 3;  1CQF A;  1GHK A;  1K3B C;  2DY7 A;  4C1N I;  1PZI D;  1SJE D;  3HOV H;  3GD7 A;  5KGU A;  3X3N A;  2K1B A;  2PNR C;  5M3M B;  2E2H H;  2SNS A;  1Q12 A;  3SGI A;  4NXN L;  2LY7 A;  3GTP B;  3HOU G;  1Y8N B;  1EL0 A;  5E4X A;  2CW0 D;  3PUX A;  1EY8 A;  4JK1 C;  1ML0 D;  4XXE A;  5JEA G;  1LTS D;  3PIP A;  1IBL Q;  4LFC Q;  1S5F D;  1BCP B;  1XXG A;  4GNX C;  5IP9 G;  5BN4 A;  4B3T L;  1KNE A;  5FLX c;  1FVI A;  3SEB A;  4DXG A;  4JPB W;  2LSS A;  3CMA A;  1KXL A;  3S1Q B;  1LV9 A;  2R93 G;  4PZ7 A;  3PUV A;  5IWA Q;  1SNP A;  1XMQ Q;  1DYQ A;  1GUG A;  3T1H Q;  3TN2 A;  4Q0F A;  1H9R A;  3W3A A;  4DGZ A;  3VA5 A;  2K5Q A;  1UE7 A;  1EWC A;  2GN5 A;  2F0W A;  1PMR A;  4GKK Q;  2B2T A;  3K5L A;  3I73 A;  3K57 A;  4JV5 L;  3KDF B;  5A35 A;  4P2C B;  5JVH 3;  3MXN A;  3MC0 B;  1W6J A;  2EYP A;  3TRE A;  5GAE C;  1H9S A;  3UDI A;  4BBR G;  4RA8 A;  1JQY D;  1ZKO A;  4N9P A;  4UHV A;  4IOC A;  3CCQ A;  3GTM H;  3BVG A;  3P7J A;  1LAC A;  2EYH A;  1EY7 A;  1B8A A;  5I6W A;  1WCM G;  4JBM A;  2N55 A;  4L8J A;  4KLK A;  1JB3 A;  1SFO B;  1SN8 A;  3DM3 A;  1BOS A;  1SXT A;  4BXX G;  5I4D A;  4QL5 A;  2CHB D;  2ZT9 C;  4KHZ A;  2KUM A;  1EYA A;  1MJC A;  4JI5 L;  4DR6 Q;  4A3K G;  2HHH L;  2OTL A;  1WJJ A;  4LF7 L;  2F4I A;  4YWM A;  1LO5 D;  3J7Z C;  5M5X B;  2A69 D;  1NNX A;  1HZ9 A;  4ME3 A;  3J80 E;  4JBJ A;  4OEL B;  3CCU A;  5C4X B;  3GTQ H;  1KNA A;  4LUV A;  1VQG A;  5C0X G;  2OXP A;  4C3J G;  2HT1 A;  1B53 A;  1OO9 B;  5M3F B;  2B63 G;  5T1I A;  2E2J H;  3HKZ G;  3ULJ A;  5CC4 A;  2AWO A;  1QUQ A;  2UXD Q;  1W3S A;  1STY A;  2JA8 B;  3KJO A;  4X6A H;  3G7L A;  4Z9C B;  5COR A;  2XRQ D;  4OGQ C;  3SVM A;  5H1S E;  1ASY A;  1TVX A;  2X6L A;  5I2X A;  5HY6 A;  1EIG A;  1Q1E A;  4WFN 3;  4A3M G;  3F8T A;  1ESR A;  1IKM A;  3HOU H;  1WTP A;  2O5J C;  4TRD A;  1RD9 D;  3D4D A;  5GQO A;  2I5M X;  2R92 G;  1K28 A;  1Y14 B;  5JEA H;  1N32 Q;  4PZ8 A;  4ODG A;  1XYI A;  3QWN A;  1N33 Q;  3HEJ A;  2DNC A;  2NZH A;  2IHF A;  4B3S Q;  1YNJ D;  1OTC A;  4QF4 A;  1PH9 A;  3A8J E;  2PZW A;  5K5P A;  4KK7 A;  2O4X A;  3URY A;  4A3D B;  3CW2 C;  1BCP D;  1Y8O B;  4QIW B;  1BO0 A;  1HNZ Q;  4RKB A;  2R93 H;  2I46 A;  2WAQ E;  2JK8 A;  4B9X A;  4XTC S;  4LF9 Q;  1VQK A;  3K5M A;  3GP7 A;  1Q3L A;  2K4K A;  2SDF A;  3SXH A;  4IUP A;  5FLM G;  4EQP A;  4OXP A;  2VQE Q;  1BUV T;  5CMD A;  4UPA A;  2J4X A;  2LMC B;  3H15 A;  3TME A;  3V05 A;  3VYR A;  1KLG D;  4AYB G;  4BBR H;  4H0L C;  3I4O A;  3EJI A;  2B2Y C;  3J7A 5;  1LAB A;  2EXD A;  2IL8 A;  3NUC A;  4GN4 B;  4XQQ A;  1SRU A;  5IGF A;  2ICE C;  1A6X A;  2EPB A;  5L37 A;  2WB1 G;  1JJC B;  5JJZ A;  3SDZ A;  1WCM H;  1TWG H;  2MO1 A;  5LMU Q;  3FEW X;  2PI2 A;  4A3E G;  3SK8 A;  1JE4 A;  4YY3 Q;  2HD3 A;  3A5Z B;  2OT2 A;  3MHB A;  2EJF C;  1KRT A;  1KQS A;  5IGC A;  4BXX H;  2R7Z B;  1X9N A;  5EBD A;  1K3R A;  4WRD A;  4ZCK A;  2UUA L;  1PVO A;  1LTL A;  1KAA A;  1QJO A;  4PG3 A;  4PZ6 A;  4S3S A;  4PMW A;  4A3K H;  1K8G A;  3NTK A;  3NE5 B;  1PXU A;  1C8C A;  1H9M A;  2DN8 A;  4KN4 C;  2E5L Q;  2YTY A;  4QUC A;  4LW1 A;  1LLR D;  2MQH A;  2ID0 A;  3I90 A;  3E0E A;  4C3I B;  4A4I A;  4IUN A;  5IWA L;  1XMQ L;  3KLS X;  1CHP D;  4C3J H;  2UUC L;  5BN3 A;  1GD7 A;  1S5E D;  3HZX A;  3S9W A;  4X65 Q;  2B63 H;  5KEE A;  3QG1 A;  3MXN B;  3BVM A;  1H9S B;  1CTM A;  3H91 A;  4JI0 Q;  3CCL A;  2RSO A;  2AQ1 B;  2QF7 A;  4NP5 A;  4DR5 L;  1KAW A;  1MSG A;  5DNF A;  3X3M A;  3CF5 A;  5IY0 A;  4RGT A;  4OWT B;  3H94 A;  4BY7 B;  3W1G A;  2JN4 A;  2O5I C;  4NW2 A;  4FXG C;  4IN3 A;  4DFA A;  3NPP A;  3T56 B;  1XNR Q;  4PV1 C;  4DV6 Q;  3FDT A;  1U4L A;  1W2B A;  2E2I H;  3F2B A;  4FF3 A;  3CPW A;  2F0T A;  3S15 B;  4QCL A;  2F0I A;  1KDB A;  1HRJ A;  5E7N A;  3KYH C;  3FHW A;  2N88 A;  2YTV A;  3Q23 A;  4K0K Q;  3HFZ B;  1J8I A;  2B8G A;  4ZK9 B;  2IX1 A;  2RCF A;  1Q7Y C;  3FPP A;  1QB5 D;  3T16 A;  2H4O A;  2RBM A;  3DHQ A;  4H7B A;  5IGD A;  2JA6 G;  1JWM D;  1HJP A;  1IL2 A;  1M8A A;  2R3Z A;  3QR8 A;  1V43 A;  2J0T D;  2F0Q A;  1EQQ A;  2QEJ C;  1DXM A;  4XYQ A;  2F0F A;  1DD2 A;  2PQE A;  2F0U A;  3D8G A;  4K8J A;  4U68 A;  3G6E A;  2R92 B;  1CT1 D;  4A3G H;  3I70 A;  1FJG Q;  1KAB A;  3UDX A;  1HFG A;  2UXD L;  2BH2 A;  4B3R Q;  1ROD A;  2F3I A;  1EU3 A;  1CQV A;  1AH9 A;  1YJN A;  1A62 A;  3R2T A;  1OXU A;  1DOK A;  4CKE A;  5IGG A;  3S1M H;  3ERS X;  4NMZ A;  4GZY C;  2EYO A;  1HNW L;  1EY0 A;  3PCO B;  4M8A A;  4YCU A;  5HUR A;  2KHI A;  4A3E H;  1STE A;  3M4O B;  4HJ9 A;  4EX5 A;  1KIX A;  2A8V A;  4FXK C;  1K8A C;  4WJW A;  2E2D C;  3S2D B;  3NTH A;  3T4A C;  1X3E A;  2C35 B;  4IQZ A;  1WTQ A;  4A3I G;  3K80 C;  1LTA D;  2ICI A;  3ONA B;  2B2V A;  4LF6 Q;  1N33 L;  4EQ5 A;  1SYC A;  3BVZ A;  2RA4 A;  3KBG A;  1EQT A;  2WB1 B;  4YWK A;  5J3B A;  2HDM A;  1TQO A;  1LTR D;  2CVR A;  2SOB A;  4LJZ C;  3Q24 A;  3RZD B;  1GVP A;  4CDE C;  4JBW A;  1HNZ L;  4HAE A;  4LK1 C;  1HZA A;  4K14 A;  2A68 C;  3MEF A;  1K9M C;  3HRZ C;  5EKI A;  1OXS C;  2R7F A;  4FYD A;  4R9W A;  1LYL A;  4LF9 L;  1CM9 A;  3TS2 A;  4IPD A;  3I4N B;  5ELF A;  2EY1 A;  3SK5 A;  3MTS A;  2N8N A;  2RSN A;  4PMB A;  3D4R A;  1A3T A;  4G4K A;  1NBW A;  1P16 A;  4IPG A;  1CA6 A;  4DV5 Q;  1L2F A;  1SE3 A;  2EVB A;  3CC7 A;  4N9T A;  2QIL A;  3HOX G;  1JOQ A;  1XPO A;  3AU7 A;  3RZO B;  3AB9 A;  3LGJ A;  1EOV A;  4ZUI A;  1ENA A;  2A6H C;  5LMU L;  3NP8 A;  5C44 B;  4DUY L;  1SYG A;  1Y1W G;  3KLR A;  2G5D A;  4NKL A;  1O7Z A;  2WAQ G;  3A0J A;  4J15 A;  5M5W B;  3QIA A;  4CJ2 C;  3OW2 A;  1HR0 L;  2NN6 H;  4JOI A;  1L0W A;  2B2U A;  5M5Y B;  2EE1 A;  1XMO Q;  2JA6 H;  1I6H H;  2V1C C;  3DEP A;  4CHT B;  3GQB A;  2JEB I;  1EYG A;  4RG1 A;  1VQD A;  2X69 A;  3NQI A;  1J9O A;  1NAP A;  4DKA C;  5IT9 E;  2OWO A;  1XJV A;  4A3L G;  2CWP A;  1EIH A;  1B44 D;  1TWC H;  1STN A;  4ZQ3 A;  4C2M B;  3A7A B;  2WKD A;  4DV3 L;  5A2Q E;  1NR4 A;  2Z0S A;  1VQO A;  4JI0 L;  3CCV A;  4IFD I;  1B4O A;  4J8Q A;  1YJW A;  1VQ7 A;  2NVQ B;  3HOW H;  2R61 A;  1STH A;  1DM0 B;  3WOF A;  3PO3 B;  4GNX A;  1JWS D;  3T1Y Q;  1EOT A;  4RAU C;  3KF8 A;  5C6A A;  1JIC A;  4J6H A;  2RHQ B;  1XNR L;  1XPR A;  1X56 A;  4DV6 L;  3K0Y A;  2F0O A;  5TSS A;  1N36 Q;  4A3F B;  4OON A;  1I50 B;  2F0L A;  5EPL A;  2ALY B;  1HUM A;  1HTP A;  1Z6H A;  4DR2 Q;  1PZJ D;  2I5H A;  1R4P B;  2XVS A;  2Q2U A;  2FMC A;  1AE2 A;  1Q81 C;  4DV0 Q;  1TWH H;  2N49 A;  4B9W A;  3U4Z A;  4RMF A;  3I56 A;  1D5Z C;  1PTO C;  3HS0 C;  3GTL H;  3CHB D;  1HTL D;  5KNB A;  1RL2 A;  2CW0 C;  1T5E A;  1QVG A;  2QW7 A;  2N3S A;  1EFW A;  2MFI A;  5EQ0 A;  2FMM A;  4UDU C;  4FF1 A;  1L1O A;  3J80 L; 
#chains in the Genus database with same CATH homology
 3LWE A;  1LTG D;  2RDG A;  4A3I B;  1H9K A;  1DCZ A;  1W6K A;  4ULL A;  2PZT A;  2ZXR A;  3MA2 B;  4U67 3;  5COY A;  1K83 B;  1UNS A;  3FRP B;  5I9O A;  2Z1C A;  2BE5 D;  3KUP A;  5I9P A;  1EY4 A;  1Y1V B;  3NQT A;  1F2Y A;  4XIG S;  3PUW A;  4QMG A;  1VMP A;  4V19 0;  1O7Y A;  3S2H B;  3LNN A;  3PUZ A;  2K03 A;  4KY7 A;  2PMZ B;  5J1Z A;  1SEB D;  4BBS B;  3C1F A;  1GUW A;  2KQ3 A;  5JPM C;  2L5T A;  5FO7 B;  3CQZ B;  3QJY A;  5LL6 S;  4G7H C;  2LKV A;  4Q5V A;  2KEC A;  2RQX A;  2L4N A;  5CGK A;  2JP1 A;  3OW7 A;  2JA7 B;  3BDO A;  4EVO A;  5KIX A;  4RGN A;  1QIL A;  2JE6 I;  1F9S A;  1C48 A;  2GA4 B;  3DUZ A;  1NUC A;  4KKT A;  2JYO A;  3I72 A;  1ZEQ X;  4KTA A;  5F2D A;  1PTO D;  2VUM B;  1EFI D;  1RJT A;  1D6E C;  2HQE A;  1SYF A;  2MHV A;  4OO1 I;  4DAY A;  3D3R A;  2BCO A;  2SEB D;  3HOV B;  1YNJ C;  1G8Z D;  2B2W C;  1FNW A;  5ISR A;  2E2H B;  1BCP C;  4DXF A;  1GUS A;  4CKB A;  5NUC A;  4ZAI A;  1HPC A;  2PO4 A;  4C56 C;  2RKS A;  2PZU A;  4V0B A;  1QWY A;  3NBH A;  3GTJ B;  2BDO A;  1TY2 A;  5DAU A;  4NDX A;  1A3U A;  4XT3 B;  3KK7 A;  1SND A;  5C0X J;  2EY5 A;  2E76 C;  4HSV A;  3D6C A;  3DMU A;  1SE2 A;  4OIJ A;  1PRT B;  1AP0 A;  1QNU A;  1WTV A;  1B3A A;  4K5X A;  2ZXO A;  4KY6 A;  3LX0 A;  2NB0 A;  1GUO A;  5FK9 C;  2PW5 A;  4M1U B;  5ELB A;  1U4R A;  5C3W A;  1NR2 A;  4DAP A;  1FR3 A;  1RHP A;  5CBE E;  3VA7 A;  4C1N K;  1XWE A;  2E75 C;  3BS1 A;  5IGE A;  3DWA A;  3GTM B;  1AW7 A;  4ABN A;  1AZP A;  3H0G B;  3R8B A;  5ELE A;  1SAP A;  2EY6 A;  1AEX A;  5FOB B;  5AFW A;  1F9Q A;  3TDQ A;  1RKN A;  3K7A B;  4RGM A;  3M7N A;  1QG7 A;  2EZV A;  2L1B A;  1F2M A;  4RKL A;  1Z47 A;  5FLX E;  3TP5 A;  1CK1 A;  1Q1B A;  1PTO F;  1WTW A;  2A5H A;  2E2J B;  1RDP D;  2HCI A;  4HED A;  2KOL A;  3S16 B;  1XTC D;  5I6Y A;  1A15 A;  2VNU D;  3CRK C;  3DWP A;  3M85 A;  1SDF A;  3HOU B;  2F0J A;  2F1M A;  4G7Z C;  5D65 A;  3ERO A;  1I4P A;  2LS0 1;  4FO2 A;  4HR7 B;  5FKA C;  5IIF A;  4EQN A;  4DNT B;  3J7Y W;  2KCN A;  2WP8 J;  2R93 B;  1B9M A;  3W2D A;  4FXD A;  1LTI D;  1PRT D;  1GOZ A;  3K5N A;  1FYC A;  1I6V C;  3ND8 A;  1MSH A;  1LT5 D;  3G6J B;  4BBR B;  5CR3 A;  1PDQ A;  3BG3 A;  5IT9 L;  4R8I A;  1F2L A;  1V8Q A;  3GV6 A;  5EBC A;  4YIJ A;  1IKL A;  3BDC A;  1WCM B;  1TWG B;  1F2Z A;  1PFB A;  2KEE A;  4IUQ A;  4RGO S;  2Q8T A;  5A2Q L;  3SK4 A;  3I8Z A;  1PYW D;  2WAC A;  3Q0A A;  3PUY A;  2D5D A;  1KLU D;  1WD0 A;  4PMC A;  1STG A;  1YNN D;  3NK9 A;  4A3K B;  1GHJ A;  2B2T C;  2EY2 A;  2BOS A;  1U4M A;  2IW3 A;  2XRS D;  3EVQ A;  1IHZ A;  1SYE A;  1H9J A;  2ENB A;  3DM1 A;  3T51 B;  4C3J B;  1CHQ D;  4K5W A;  1OXV A;  2WKC A;  2B63 B;  3HKZ B;  4H44 C;  4ZUJ A;  1WVL A;  4X3U A;  2J7Z A;  2K5W A;  5C0X I;  1ESF A;  2NN6 G;  3BZD B;  3MXP A;  2IT1 A;  5C5M A;  1U4P A;  4CKC A;  1BCP F;  4C3H G;  2EDG A;  4A3M B;  2IX3 A;  1UAP A;  3ND9 A;  5EJW A;  1S5D D;  1EZ8 A;  2E2I B;  3VR3 A;  4IFD G;  2F0G A;  3ZYY X;  4O1N A;  2IX0 A;  2DY8 A;  5KND A;  1STA A;  1G29 1;  2L11 A;  1HCZ A;  1TU2 B;  1QE6 A;  3DEO A;  2ZXP A;  1ILP A;  4DA2 A;  3MAQ A;  1DZ1 A;  3VYU A;  1S5B D;  5CV6 A;  2EOT A;  3AMU A;  1PRT F;  1SNQ A;  1SMY D;  5LHY 1;  2RVL A;  4OIK A;  2Z4H A;  4A3G B;  1XX8 A;  4I65 A;  1IYU A;  3C2P A;  5IGB A;  4AYB B;  2NTS A;  4RFB A;  2KED A;  3T53 B;  4IUR A;  3S1M B;  1T5X D;  3IAY A;  4MN3 A;  4A3E B;  5FO9 B;  4HTH A;  3F2U A;  1ZYR D;  3OMG A;  1JC7 A;  1KTK A;  3OWF A;  1A2T A;  2MJ8 A;  4EGV A;  3MXG A;  4XQN A;  1DON A;  2F0H A;  1HA5 A;  1I3Q B;  2AQ3 B;  3MEH A;  1OXT A;  1EEF D;  1V1P A;  4BS9 A;  4HCS A;  5D3D A;  2BE5 C;  3MXU A;  3NWT A;  4DU9 A;  2E74 C;  2NBF A;  3WOE A;  3BYT B;  1K8M A;  1RTO A;  2BA1 A;  1PLF A;  1ICW A;  1E0B A;  3A54 A;  1I4G A;  2EYM A;  3OHX C;  4KI0 A;  3D6W A;  2EYL A;  1EYC A;  1SYD A;  2LFN A;  3V2T A;  4G7O C;  4H13 C;  4KHV A;  5CBA E;  4IFD H;  4RHS A;  2A73 B;  1EZ6 A;  3BYY B;  3MVV A;  3TP7 A;  1WTR A;  3C1E A;  2PPB C;  4K2L A;  1PFM A;  2JA6 B;  3K5O A;  1LT3 D;  4X3K A;  3E6Z X;  3NBI A;  4WOR A;  2K5D A;  1HA6 A;  2XNA C;  3HG9 A;  3K59 A;  2SNM A;  1IL8 A;  5CV7 A;  1S4Z A;  3QOJ A;  4PQX A;  4KV6 A;  4IUV A;  1B1Z A;  3A55 A;  1TWC B;  3ITP A;  2WIN B;  3H6M A;  3K58 A;  1TS5 A;  1PTO H;  1F9P A;  1FNV A;  5J22 A;  4FP5 D;  5DEH A;  3HOW B;  1Z7T A;  3RUZ A;  1FD7 D;  3NTI A;  1UEA B;  3S1R B;  2O2L D;  2VXW A;  1I4H A;  1ET6 A;  4DN4 M;  4BA1 I;  1TII D;  5IOC A;  1LTT D;  5KRU A;  1TWH B;  1TR5 A;  5JPN C;  3GTL B;  1DJR D;  1F9R A;  3TBI B;  2A6E D;  1ENF A;  4KJN A;  1JWU D;  2C5C A;  3D4W A;  5FLX L;  5EKK A;  3S14 B;  1BF4 A;  1I4X A;  3UI2 A;  1EY9 A;  1JOO A;  4TSS A;  5EGT A;  3MFG A;  1CFM A;  5LL6 X;  2B2V C;  4CGY B;  3HOX B;  3U9S A;  1ZXT A;  3NHH A;  2NTT A;  2XIW A;  4OL7 A;  5CV9 A;  4HSP A;  3MWY W;  2F3W A;  1Y1W B;  4FF4 A;  2WAQ B;  3OIP A;  3VYS A;  1B9N A;  2PYK A;  5JEA J;  1KDA A;  3FVQ A;  3GO5 A;  3NWS A;  3OOC A;  4ME5 A;  2L9H A;  2B39 A;  2BA0 A;  3PV0 A;  2F03 A;  2NVY B;  1B2T A;  5KYI A;  1C4Q A;  2Q8I B;  2TMP A;  3A8I E;  3DWQ A;  2IWH A;  1L0X B;  1U9R A;  4L6T B;  1SSO A;  1TS3 A;  2B2U C;  4KN7 C;  2AQ2 B;  3SK6 A;  1AZQ A;  4CJ0 B;  4HN7 A;  4BA2 I;  4F87 A;  3EA6 A;  1Q90 A;  4HMI A;  2TSS A;  1NSN S;  3M7G A;  2B2Y A;  1A2U A;  3FMC A;  4HMJ A;  5G3L D;  2OF1 A;  2R6G A;  2XWJ B;  2KVM A;  1GXD C;  1M4V A;  3R93 A;  4KD3 A;  5E1F A;  1QOH A;  4ILW A;  2M00 A;  1GUT A;  5DM7 3;  5C3X A;  2AUK A;  1D1I A;  1FGB D;  4XDX A;  5IOD A;  4MIU A;  4DNR B;  4KMU C;  3QO2 A;  4CBV A;  3L3O C;  4KD4 A;  4LAA A;  3TZD A;  3VYT A;  1HHV A;  4KY5 A;  1PRT C;  2K6A A;  2KA7 A;  3IL8 A;  4QB4 A;  2EJG C;  2F0P A;  3A7L A;  2F0S A;  5C4H A;  4FVM A;  2RDH A;  4PNY A;  5D3I B;  3QOL A;  2Z4I A;  2JSO A;  2IPK D;  4EQO A;  1STB A;  3P20 A;  4I7Z C;  1QCB D;  4C3I G;  2FHT A;  2NYZ D;  4KKS A;  4ZRZ A;  2EYF A;  3JAM E;  1V1O A;  1YNN C;  3Q6S A;  4DAV A;  3KLS A;  3S17 B;  5KYL A;  3OPO A;  2K33 A;  4B08 A;  3I3C A;  4QUF A;  3GTQ B;  2HDL A;  1ET9 A;  1Y8P B;  4FNF A;  1QNK A;  3J81 E;  3M3Y B;  4L63 B;  4DK0 A;  3C3L A;  1WD1 A;  1TKW B;  3RLF A;  1GUN A;  2DNE A;  1JR0 D;  3A56 A;  5G3L F;  3TSS A;  2IJ0 A;  2HUG A;  2WII B;  3NSW A;  1LT4 D;  2F3V A;  3U9O A;  1R9T B;  4UAI A;  1X3P A;  4K8I A;  3P1H A;  5KNC A;  1RF2 D;  1TS2 A;  3Q22 A;  3WDN A;  3QB3 A;  4KJO A;  2NVT B;  1JOR A;  4IZ8 A;  3PMF A;  2RDF A;  1SMY C;  2FJ2 A;  2A74 C;  1SE4 A;  2D2C C;  2KCC A;  1FNU A;  1E2W A;  5C3E B;  4O42 A;  3C46 A;  2VB3 X;  1F77 A;  5C4J B;  3FPU B;  4ZLT F;  1D5X C;  1LTB D;  1BXT A;  1MBY A;  4X3T A;  4CJ1 B;  2NZ1 D;  2QDB A;  4K6D A;  4DF7 A;  1ZYR C;  1D1K A;  1EEI D;  3IKJ A;  2HCC A;  1UUP A;  1O80 A;  4ZKB B;  4IFD J;  3MZ5 A;  1TY0 A;  1VF5 C;  5C0X H;  1WTO A;  2V4D A;  1D5M C;  1CZW A;  1EY6 A;  1SBB B;  4F88 A;  1JOK A;  2NWG A;  4Y7N B;  4IUU A;  3TP8 A;  3PIO 3;  2OEO A;  2XSC A;  3VR4 A;  1NCV A;  1R4Q B;  1Q8I A;  2L0C A;  1D2B A;  5CV5 A;  4RWS C;  2AWN A;  3R2I A;  1SNO A;  3L9A X;  3GTO B;  5EPJ A;  2F0D A;  1VF7 A;  4KKU A;  1EWH A;  1Y69 U;  2K01 A;  2K04 A;  3S1N B;  3TZU A;  2KHS A;  3M4Y A;  2QKI C;  3VR2 A;  2MUY A;  2Q8R E;  3E0J A;  2K05 A;  3N6R A;  5CV8 A;  3CRL C;  2G9D A;  1TWF B;  5K36 G;  3L7Z C;  1EY5 A;  4A3B B;  2EJM A;  5JOB A;  3EFX D;  1VCI A;  1CI3 M;  3H09 A;  1CZG A;  3BDL A;  1I4Q A;  1KDC A;  2JA5 B;  1BNZ A;  2MPM A;  3O13 A;  3A8K E;  2CQA A;  5JAV A;  1CA5 A;  4XQJ A;  1B50 A;  1HQR D;  1G2S A;  4R8N A;  3HOY B;  2X6G A;  3HOZ B;  5EPK A;  4MHE A;  2WV6 D;  2F0N A;  2D9U A;  2M2L A;  2A6E C;  1OXX K;  3PO2 B;  4RCN A;  3SE0 A;  4ZKC B;  1AN8 A;  3SHL A;  1O78 A;  3MFY A;  1GJX A;  3ERQ A;  2F0K A;  4HCE A;  4J1M A;  1E2V A;  4ZYS A;  2Y0S B;  3J7A F;  2NVX B;  5J39 A;  3GV3 A;  3P75 A;  1MD2 D;  2Z8L A;  1X3Q A;  2K7V A;  2H1E A;  2F0V A;  2XN9 C;  1ENC A;  1II3 A;  3TP6 A;  1O7L A;  5CV4 A;  4XYO A;  1HQM C;  3IFD A;  2I07 B;  1X32 A;  5T1G A;  4K6L A;  2BDN A;  4XT1 B;  3GTG B;  4TQU S;  5FO8 B;  2YU9 B;  1JCK B;  3RMH A;  3KBX A;  1I6H B;  1TWA B;  4C3H B;  1IYV A;  2JEA I;  4TKO B;  2VB2 X;  2NN6 I;  1BBX C;  1IW7 C;  2B2W A;  3I91 A;  4A93 B;  2FFK B;  2JXM B;  2XWB B;  5ELD A;  4K2K A;  3OWE B;  4OHJ A;  4K5V A;  5ELC A;  2KJX A;  3E5S A;  3I4L A;  4OO1 G;  1G2T A;  3T13 A;  5K36 H;  2B8F A;  4RHR A;  2FIN B;  1RTN A;  1EQV A;  5E3F A;  3D31 A;  5CYU A;  2MP1 A;  1SJH D;  2L12 A;  1SNC A;  1G6Z A;  3OMC A;  1I4R A;  3CKI B;  5DM6 3;  3R3O A;  1PTO B;  2MGS A;  1PZK D;  3FKI B;  1E2Z A;  2F0M A;  2NUC A;  3JAM L;  1ILQ A;  3DXJ C;  2G9H D;  1G91 A;  1K8O A;  1S5C D;  1AFP A;  2D62 A;  4RCO A;  3OIQ A;  1DOM A;  1RCV D;  4RH6 A;  3VR5 A;  2A68 D;  3SR1 A;  4A3J B;  2PCF B;  4IUT A;  5I2Y A;  3I4M B;  3OSO A;  2QCP X;  3J81 L;  4DK1 A;  2L55 A;  4LMQ D;  1TS4 A;  2EYJ A;  4IAL A;  4G57 A;  3N52 A;  3V96 A;  2C9O A;  1BQQ T;  3J7A V;  1WTX A;  1EU4 A;  4ID6 A;  4E6I A;  3CU7 A;  2EXZ A;  1A3V A;  4X3S A;  2M9V A;  5M9O A;  5D14 A;  5C4Z A;  3IFT A;  1L0Y B;  1EYD A;  2A6H D;  4F8M A;  1MGS A;  1SYB A;  2YYZ A;  3EQL C;  4FF2 A;  3LWU A;  1BDO A;  1SNM A;  1V1P B;  2K32 A;  1HXY D;  5JVG 3;  3RD4 A;  1DOL A;  4BWG B;  3VR6 A;  3HGB A;  1IW7 D;  1MI2 A;  1HFN A;  2A69 C;  3K6O A;  1VMC A;  2PW7 A;  1HUN A;  3H3V C;  4OO1 H;  1TT2 A;  5EKL A;  2F0E A;  1VDZ A;  5HGT A;  4F7X A;  3GTK B;  1BR9 A;  4BY1 B;  1LT6 D;  2K28 A;  2AUJ D;  3NXW A;  3HP3 A;  5BN5 A;  5E4W C;  1ONL A;  5C5L A;  1PFN A;  3PIP 3;  1CQF A;  1GHK A;  2DY7 A;  4C1N I;  1PZI D;  1SJE D;  3GD7 A;  5KGU A;  3X3N A;  2K1B A;  2PNR C;  5M3M B;  2SNS A;  1Q12 A;  2LY7 A;  3GTP B;  1Y8N B;  1EL0 A;  5E4X A;  2CW0 D;  3PUX A;  1EY8 A;  4JK1 C;  1ML0 D;  4XXE A;  5JEA G;  1LTS D;  1S5F D;  1BCP B;  1XXG A;  5BN4 A;  1KNE A;  3SEB A;  4DXG A;  3S1Q B;  1LV9 A;  3PUV A;  1SNP A;  1DYQ A;  1GUG A;  3TN2 A;  4Q0F A;  1H9R A;  3W3A A;  4DGZ A;  3VA5 A;  2K5Q A;  1EWC A;  2F0W A;  1PMR A;  2B2T A;  3K5L A;  3I73 A;  3K57 A;  5A35 A;  4P2C B;  5JVH 3;  3MXN A;  3MC0 B;  1W6J A;  2EYP A;  1H9S A;  4RA8 A;  1JQY D;  1ZKO A;  4N9P A;  3BVG A;  3P7J A;  1LAC A;  2EYH A;  1EY7 A;  5I6W A;  2N55 A;  4L8J A;  1JB3 A;  1SFO B;  1BOS A;  1SXT A;  5I4D A;  2CHB D;  2ZT9 C;  4KHZ A;  2KUM A;  1EYA A;  2F4I A;  1LO5 D;  5M5X B;  2A69 D;  3J80 E;  5C4X B;  1KNA A;  5C0X G;  2OXP A;  4C3J G;  1B53 A;  1OO9 B;  5M3F B;  5T1I A;  5CC4 A;  2AWO A;  2JA8 B;  1STY A;  3G7L A;  4Z9C B;  5COR A;  2XRQ D;  4OGQ C;  3SVM A;  1TVX A;  2X6L A;  5I2X A;  1EIG A;  1Q1E A;  4WFN 3;  1ESR A;  1IKM A;  1WTP A;  2O5J C;  4TRD A;  1RD9 D;  3D4D A;  5JEA H;  4ODG A;  1XYI A;  3QWN A;  3HEJ A;  2DNC A;  1YNJ D;  4QF4 A;  3A8J E;  2PZW A;  5K5P A;  4KK7 A;  2O4X A;  3URY A;  4A3D B;  1BCP D;  1Y8O B;  4QIW B;  1BO0 A;  4RKB A;  2I46 A;  4B9X A;  4XTC S;  3K5M A;  3GP7 A;  1Q3L A;  2SDF A;  3SXH A;  4IUP A;  4EQP A;  1BUV T;  5CMD A;  2J4X A;  2LMC B;  3TME A;  3V05 A;  3VYR A;  1KLG D;  4H0L C;  3EJI A;  2B2Y C;  1LAB A;  2IL8 A;  3NUC A;  4XQQ A;  5IGF A;  2ICE C;  1A6X A;  2EPB A;  5JJZ A;  3SDZ A;  3FEW X;  3SK8 A;  1JE4 A;  2OT2 A;  3MHB A;  2EJF C;  5IGC A;  2R7Z B;  5EBD A;  4WRD A;  1KAA A;  1QJO A;  4S3S A;  4PMW A;  3NTK A;  3NE5 B;  1PXU A;  1C8C A;  1H9M A;  2DN8 A;  4KN4 C;  4QUC A;  1LLR D;  2ID0 A;  3I90 A;  4C3I B;  4IUN A;  3KLS X;  1CHP D;  5BN3 A;  1S5E D;  3HZX A;  3S9W A;  5KEE A;  3QG1 A;  3BVM A;  1H9S B;  1CTM A;  3H91 A;  2RSO A;  2AQ1 B;  2QF7 A;  4NP5 A;  3X3M A;  1MSG A;  5DNF A;  4RGT A;  3H94 A;  4BY7 B;  2O5I C;  4NW2 A;  4FXG C;  4IN3 A;  4DFA A;  3NPP A;  3T56 B;  4PV1 C;  3FDT A;  1U4L A;  4FF3 A;  2F0T A;  3S15 B;  4QCL A;  2F0I A;  1KDB A;  1HRJ A;  2N88 A;  3Q23 A;  1J8I A;  2B8G A;  4ZK9 B;  2IX1 A;  3FPP A;  1QB5 D;  3T16 A;  2H4O A;  2RBM A;  3DHQ A;  4H7B A;  5IGD A;  1JWM D;  1M8A A;  2R3Z A;  1V43 A;  2J0T D;  2F0Q A;  2QEJ C;  1DXM A;  4XYQ A;  2F0F A;  1DD2 A;  2PQE A;  2F0U A;  3D8G A;  4K8J A;  4U68 A;  2R92 B;  1CT1 D;  3I70 A;  1KAB A;  1HFG A;  1ROD A;  1EU3 A;  1CQV A;  3R2T A;  1OXU A;  1DOK A;  4CKE A;  5IGG A;  4NMZ A;  4GZY C;  2EYO A;  1EY0 A;  4M8A A;  5HUR A;  3M4O B;  1STE A;  4FXK C;  4WJW A;  2E2D C;  3S2D B;  3NTH A;  3T4A C;  4IQZ A;  1WTQ A;  1LTA D;  2ICI A;  3ONA B;  2B2V A;  1SYC A;  3BVZ A;  2RA4 A;  3KBG A;  1EQT A;  2WB1 B;  2HDM A;  1TQO A;  1LTR D;  2CVR A;  2SOB A;  4LJZ C;  3Q24 A;  3RZD B;  4JBW A;  4HAE A;  4LK1 C;  4K14 A;  2A68 C;  3HRZ C;  5EKI A;  1OXS C;  4FYD A;  4R9W A;  1CM9 A;  3I4N B;  5ELF A;  2EY1 A;  3SK5 A;  3MTS A;  2RSN A;  4PMB A;  3D4R A;  1A3T A;  4G4K A;  1CA6 A;  1SE3 A;  2EVB A;  4N9T A;  2QIL A;  1JOQ A;  3AU7 A;  3RZO B;  3AB9 A;  4ZUI A;  1ENA A;  2A6H C;  3NP8 A;  5C44 B;  1SYG A;  3KLR A;  4NKL A;  1O7Z A;  5M5W B;  3QIA A;  4CJ2 C;  2NN6 H;  2B2U A;  5M5Y B;  2EE1 A;  3DEP A;  4CHT B;  3GQB A;  2JEB I;  2X69 A;  3NQI A;  1J9O A;  1NAP A;  5IT9 E;  1EIH A;  1B44 D;  1STN A;  4ZQ3 A;  4C2M B;  3A7A B;  2WKD A;  5A2Q E;  1NR4 A;  4IFD I;  1B4O A;  4J8Q A;  2NVQ B;  2R61 A;  1STH A;  1DM0 B;  3WOF A;  3PO3 B;  1JWS D;  1EOT A;  4RAU C;  3KF8 A;  5C6A A;  1JIC A;  4J6H A;  3K0Y A;  2F0O A;  5TSS A;  4A3F B;  1I50 B;  2F0L A;  5EPL A;  1HUM A;  1HTP A;  1Z6H A;  1PZJ D;  1R4P B;  2XVS A;  2FMC A;  4B9W A;  1D5Z C;  1PTO C;  3HS0 C;  3CHB D;  1HTL D;  5KNB A;  2CW0 C;  1T5E A;  5EQ0 A;  2FMM A;  4UDU C;  4FF1 A;  3J80 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...