4IUNA

Crystal structure of staphylococcal nuclease variant delta+phs r126e at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLEKAEAQAKKEKLNIWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS R126E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iunA00
1TQOA 2QDBA 4IALA 1SNQA 1II3A 1STBA 1SNDA 4DU9A 2F0LA 4F7XA 4IUNA 5J1ZA 5M9OA 2SNMA 4HTHA 2SOBA 5I6YA 1TR5A 1TT2A 4RKLA 5CR3A 2F0EA 2KHSA 2RBMA 3NUCA 2NUCA 3NP8A 3SK5A 2F0WA 4I65A 3HZXA 5IGGA 1EY4A 2F0SA 2PZWA 4PNYA 5CC4A 5IIFA 5HGTA 5IGBA 3BDLA 1SYFA 2EY6A 4K2LA 2LKVA 1A3UA 1SYCA 2PYKA 3MVVA 3EROA 4PMCA 5DEHA 3SXHA 3TP5A 4EQPA 3D4DA 1STGA 3PMFA 5C5LA 1NUCA 2RKSA 3QOLA 5K5PA 3C1EA 3BDCA 3D4WA 2PZTA 2EYJA 4NP5A 5EKLA 5IOCA 1JORA 1SYDA 4H7BA 4KY7A 4R8NA 3SK6A 3SHLA 3TP8A 2ENBA 4LAAA 4WRDA 3RUZA 5C3XA 2EY2A 2PW7A 4DGZA 1EY9A 3OWFA 3S9WA 1AEXA 2EY5A 3SK8A 1STNA 5C4ZA 5KEEA 3OMCA 5I9OA 3R3OA 5KGUA 3ERQA 3E5SA 1F2YA 3NXWA 2HQEA 1EY8A 4QMGA 5DAUA 5KRUA 1A3TA 1ENAA 1EY7A 4HMIA 3MEHA 5CV8A 4MIUA 1F2ZA 4QF4A 2F0IA 4TRDA 4ME5A 4ZQ3A 5EKKA 5CV5A 3T13A 3P75A 4KTAA 5IGEA 4K5XA 1KDBA 3DMUA 2EYMA 2SNSA 4RKBA 2F0QA 4ID6A 4EQNA 3HEJA 5IGCA 4IZ8A 2F0NA 2F0OA 4YIJA 4DFAA 1EY0A 5CGKA 3OSOA 1EYDA 3TMEA 1RKNA 3NK9A 3MHBA 2OF1A 2M00A 3QOJA 4J1MA 1ENCA 3LX0A 5IODA 5JAVA 5KIXA 3P1HA 4HMJA 2EYLA 2EXZA 4DF7A 3SK4A 3T16A 1EZ8A 3NQTA 3D8GA 4J6HA 5CV6A 4KJOA 4OL7A 1JOQA 5C3WA 5I6WA 1A3VA 2OXPA 4KHVA 5IGDA 1NSNS 4NDXA 5HURA 4K5VA 2F0FA 2EYHA 1EY5A 3D6CA 3QB3A 4K14A 4N9TA 4KV6A 1EZ6A 3EVQA 2F0TA 3SR1A 5KYIA 4E6IA 5I9PA 1SNPA 3DHQA 4KD4A 4QB4A 3TP7A 5NUCA 5J22A 5EGTA 5ISRA 3U9OA 3ITPA 4NMZA 2PW5A 5E1FA 4ZUJA 4B9WA 1KDCA 1KAAA 1SNCA 3EJIA 2KQ3A 5IGFA 1JOOA 1STYA 1STAA 5CV9A 4ODGA 2F0UA 4F8MA 3MXPA 5J39A 1EY6A 1A2UA 4KJNA 2F0KA 3C1FA 4NKLA 2EYPA 3V2TA 3OMGA 4S3SA 1EYAA 4K5WA 2OEOA 1JOKA 4K2KA 5C6AA 2O4XA 5CV4A 4EQOA 2F0PA 4B9XA 2EYFA 1SYEA 1SYGA 2F0HA 5F2DA 1KDAA 2EY1A 2RDFA 2F3WA 5KYLA 1SYBA 1F2MA 2F0VA 4PMBA 2WACA 3MZ5A 4K8JA 4EVOA 1EYCA 4KY5A 2F0DA 4KD3A 3TP6A 3VA5A 5CV7A 5E3FA 2EYOA 2F0MA 1STHA 2PZUA 1SNMA 1KABA 1SNOA 2PQEA 3H6MA 2F3VA 3NHHA 5JOBA 4K6DA 5C5MA 1IHZA 2F0JA 4K8IA 2F0GA 4KY6A 4N9PA 1A2TA 4ZUIA 1U9RA 4G57A 4WORA 1EQVA 5C4HA
chains in the Genus database with same CATH superfamily
1TQOA 2JSOA 2B63H 2N3SA 3NQIA 4KN7C 4RA8A 1OXSC 2EIFA 1KC8C 1SMYC 3HOZH 4LW1A 5IIFA 1BOSA 3R2IA 2X6GA 1ESFA 3CC4A 1TWGB 4GN3B 5C5LA 3F2UA 1IBKL 1HNWQ 3NTKA 2JJQA 2K7VA 4FF4A 4HEDA 2B2VA 4GLAC 3W1BA 2BOSA 4BY1B 4IFDI 4DGZA 1XMQL 2R92B 1MIUA 1L0YB 1LABA 5HY6A 1TWGH 4IQZA 3Q23A 3PO3B 3DXJC 2R93G 2A69C 1EY7A 3AU7A 3D3RA 1AE3A 2JEAI 2IHFA 3NEMA 5GAEC 1BCPC 3AMUA 3DUZA 4BY1H 1FVIA 1VDZA 1V1PA 4WFN3 2R92H 4RKBA 5ELDA 1FJGL 5IGCA 1YJWA 1F77A 2IL8A 3PO3H 2K52A 1T5XD 1NCVA 3OSOA 2MFIA 2HCCA 4X3UA 4DV5Q 1IXRA 2MUYA 3I73A 3CCMA 1GVPA 2IPKD 3MXGA 4BBSH 4LF8L 1RF2D 3CCRA 4L63B 2E76C 3J7ZC 1NSNS 3D6CA 1IBMQ 3EVQA 4KD4A 2D0PA 2KJXA 3WWVA 3J7AV 2JA6G 4JI8L 5COYA 2UUBQ 3QJYA 3AQQA 5JEAH 5CV9A 4ODGA 4U673 1YHAA 1HZ9A 1VQ4A 4IUTA 2A74C 1A2UA 1YJNA 4G7ZC 1VQCA 4JI5L 4S3SA 1EYAA 4K5WA 3FDTA 1JOKA 4RGTA 3ICEA 1PMRA 3CXCA 2EY1A 3HOYG 4Y52H 4DV3Q 4DKAC 1WCMG 2F3IA 3TP6A 1E2VA 3SVMA 3I8ZA 2M9VA 3BG3A 3MC0B 2Z0SA 2L55A 2R93B 2CWAA 4ABNA 4UY8C 4RH6A 5IYCH 4GNXB 4WORA 2EJFC 3K5OA 1C4QA 1II3A 1G2TA 1V8QA 1SNDA 4A3BG 4HCEA 3QG1A 2R93H 1YHQA 3HOXG 2CHBD 2F0EA 2JE6I 5ELCA 4DUYQ 2F0WA 2EJMA 1J6QA 3KLSA 4A76A 1HQMC 3NTIA 4R4QA 3J81j 2PQAA 2RKSA 3QOLA 1AE2A 2NTTA 4LUVA 3D4WA 4NP5A 1YJ9A 1JORA 4R8NA 1TS5A 2IX1A 2BE5D 1KQSA 2JA7G 3OWFA 3S9WA 3LWEA 2NWGA 2JA6B 1STNA 4AQYQ 4PZ6A 2I0QA 1EL0A 3I72A 2R7DA 1J5EL 4CJ1B 2G9HD 3MEHA 1QG7A 1SLJA 1QWYA 5IGEA 4J8QA 1G2SA 2SNSA 3HEJA 1P8LA 4JI0Q 1B3AA 2F0OA 4DFAA 3J81L 3H94A 1IBKQ 3CCSA 2OWOA 4X62Q 1SXTA 4UHVA 3HOYB 3LNNA 1WCMB 3I4MG 5CMDA 1XMQQ 4C3JG 4PMWA 2A6EC 4JI6L 4KJOA 2NVXB 2OXPA 1XX8A 3CD6A 2FMMA 5KYIA 2EJGC 1FGUA 4AYBE 3Q22A 1WCMH 3NBIA 5E1FA 4A3BB 1YZ6A 1X3GA 2NVXH 3RLNA 3HOXB 1STAA 4RFBA 3U9SA 2Z6KA 3CQZB 4RAUC 5J39A 4A75A 4KJNA 4CKBA 4XT1B 4A3BH 1GD7A 4CKCA 4A3MG 2O4XA 3HOXH 4N8X1 3O13A 2F0PA 2JK8A 3BVMA 1SYEA 5F2DA 3G6EA 1F9SA 3TDQA 2JA7B 1HUMA 3C3LA 3UDGA 1YNNC 5DM63 4EVOA 1VQPA 2JA9A 1SDFA 3CC2A 3CMAA 2PQEA 2IWHA 1CQFA 1YEZA 4K6DA 5IYDH 2PPBC 3MTSA 5M3FG 3OTOL 2EXDA 4HIMA 3MAQA 1SNQA 4OEMB 2F0LA 1LT6D 2SNMA 3FMCA 4JI5Q 2K32A 2Q8TA 2OT2A 2E74C 1A63A 2PZWA 5CC4A 4DR7L 2K5NA 3W3AA 2LFNA 3I4MB 5CBEE 3ND8A 1RD9D 1O78A 3D4DA 4IN3A 4C3JB 2L12A 3JC66 2XIWA 1WYDA 1WTRA 3FVQA 4DAVA 3S2DB 3M4QA 3SK6A 2ENBA 1L2FA 3GTPB 3KF8B 1CHPD 1FR3A 3D0FA 1VQEA 1UUPA 3V05A 1BQQT 4C3JH 3TEHB 2B8GA 5GQOA 4RGMA 1E22A 2G9DA 3PCOB 1JJ2A 2B2VC 1KRTA 3S2DH 4TRDA 3F2DA 4RGNA 5FK9C 4OHJA 1FNWA 1JJGA 2Y0SE 4H0LC 4M1UB 1BKBA 3GTPH 4DXGA 4C3HG 4EQNA 1ESRA 2ZM6L 4QIWE 4A3MB 4B3RL 2JEBI 3HOVG 5C44G 3VR5A 4HMJA 3QWNA 3GTMB 5CV6A 2XWJB 1ET6A 1RODA 4A3MH 2ALYB 1U4LA 4A3KG 1HNXL 4K5VA 4P74A 1JB3A 3QB3A 1WD0A 1J5EQ 2Z4IA 2ZJQA 2F0TA 5LL6S 2K01A 4F87A 5M3MB 2UU9Q 1X32A 4UP8A 2YTYA 3GTMH 2A73B 1EEID 3KLWA 2UXBL 2QA4A 2WAQB 1NMGA 5A35A 1LLRD 1MHWC 1EY6A 1NTGA 4B3ML 1YNXA 5M3MH 4AH6A 3GTKB 1DM0B 1JE4A 2K5HA 2VL6A 5IWAL 1GM5A 2K1BA 1UE7A 1SR3A 2L15A 3KBGA 4JI6Q 1JB7A 4N8FA 5D65A 1TVXA 1JE5A 2R7ZB 2CQOA 1WTWA 1IBLL 2K6AA 1CKNB 2WACA 2E75C 3HGBA 4Z9CB 1F9PA 3GTKH 3WOEA 1EWCA 5G3LD 1XNQQ 4ZAIA 3H09A 3MEFA 4CGYB 4CDFC 1K28A 4ZUIA 2R7ZH 5ISRA 3K6OA 4C3HB 3E3XA 3BZCA 3IFDA 1JMCA 2RSOA 4HTHA 3VR3A 3F8TA 3HOUG 3OW7A 1B44D 3A74A 1D5XC 3JAML 3I4NG 5LMNW 1PH6A 4C3HH 1K8OA 3AYHB 1EUJA 3MXNA 3W1GA 2ES2A 3HOWG 1PRTC 2QW7A 1YI2A 3E0JA 4OONA 2E2DC 4DNTB 3RR5A 1KAWA 3KFUA 3OTOQ 5E7NA 3FHWA 1RIPA 3NXWA 4QMGA 2N55A 1SE3A 4DV6L 1S3OA 4Y7NH 3K7UC 5EKKA 1WTVA 1X6OA 3I90A 4DR7Q 4UAIA 3VYUA 1BCPB 2WV6D 5C0XG 1F2LA 1GUGA 4YIJA 2ZJPA 4HIOA 1D6EC 2VY3A 3K58A 1VQKA 1MBYA 2Q2HA 3RMHA 4OL7A 4L8JA 3T53B 1EY5A 3PQIA 5G3LF 2CH4A 1Q90A 5NUCA 3N52A 1B9MA 2MPMA 4FVMA 1N33Q 3DM3A 3R2TA 3VA7A 3HOUB 1RJTA 2ZM6Q 1TS2A 4G4KA 3KK7A 5DNFA 2F0KA 4JI2Q 2EYPA 2XTIA 3QR8A 3RNUA 1VQGA 4WJ4A 4DAYB 3H91A 3HOUH 5CV4A 1B8AA 2F0HA 5IP7G 1Y1WH 5EJWA 3WOFA 2F0VA 1HNXQ 4HSVA 1SRUA 2I5LX 1LM0A 1Q1EA 5FO9B 2HCIA 3GV3A 2L11A 2VUMG 2A69D 1DCZA 2Q2TA 3FPPA 3TS0A 1SE4A 1BCPD 3NELA 1WVLA 1KLGD 3P7JA 3T56B 5C4HA 3ERSX 4B3MQ 3T1HL 3IL8A 5EBDA 5EQ0A 4A3LH 1NY4A 2NUCA 1BF4A 5IGBA 4DV1L 1CUKA 2J0TD 4OGQC 2ZTDA 4X3SA 4DV7Q 3EQLC 3NTHA 1WI5A 4YCUA 1IL2A 1K9MC 2YU9B 1NUCA 2ZJRA 5C0XH 3BDCA 2EYJA 3TS2A 4KY7A 1H9SA 2Q2IA 3X3MA 4JI1L 1EY9A 1SFOB 1LTGD 1NJIC 3OMCA 2YU9H 1D7QA 1IKLA 1LT4D 1PTOF 1S4ZA 1F2YA 4ZCKA 5DAUA 4DAPA 3VYRA 1RL2A 2IX3A 4LF6L 4ME5A 3T13A 4MN3A 1SFOH 1CM9A 3KJPA 2NVTB 1A6XA 1I5FA 3BYTB 3PUVA 1Z6HA 1Z9FA 4B3SL 1RTOA 4B08A 3Q0AA 3MHBA 5A2QL 5KIXA 2EOTA 2QF7A 1VQOA 1U4PA 3KDFB 3NQTA 2KOLA 2NVTH 2B63G 2EVBA 4QUCA 2FHTA 5GROA 1Q7YC 3KLRA 2VUMB 5LMNL 1PXUA 4OX9L 1CFMA 1HA6A 1V9PA 4L5QA 2EYHA 5HURA 3DM1A 4DV6Q 3HOZG 4P75A 3FRPB 2CQAA 2E2IB 5J22A 2Q8IB 1SN8A 1U5KA 2VUMH 4IJHA 3PGZA 1PLFA 3K0XA 1E0BA 4F8MA 2NZ1D 1T9HA 3TREA 2E2IH 3BVGA 1HHVA 3VYSA 1N8RC 4FP5D 1GUNA 3MXUA 3CCLA 1HUNA 5JJZA 1EYGA 1PH3A 1ASYA 2VW9A 2KEEA 2PCFB 4JK1C 3MFYA 4JYAL 1PVOA 2VB2X 2RF4A 3URYA 2R92G 1K8MA 5C0XI 5CV7A 3IRBA 1H9RA 4DUZQ 1PHJA 4CKEA 2IY5B 1TXYA 1SNMA 4JBKA 2EDGA 3H6MA 1OXVA 2ICEC 4K8IA 4EQ5A 1O7YA 2L5TA 4A3CH 1XXGA 2F03A 4XQNA 1GOZA 3BYYB 5ELFA 4DK1A 4MHEA 4IUNA 4BBSG 3K5MA 3OYYA 1F9RA 2WB1G 1DZ1A 2D5DA 2NZHA 4JPBW 3GD7A 3MVVA 1S5ED 4NPSA 4HJ5A 1WTXA 1TWCB 2O5IC 4YWMA 3F2BA 3S1MB 1HPCA 2A6ED 2PZTA 1G291 1XTCD 3SHLA 5JEAG 5C3XA 2LXKA 3HOZB 3KUPA 3J81E 1FD7D 1CZGA 1Q1BA 3F1ZA 4HIKA 1JT8A 1TWCH 2ZXPA 3NBHB 3S1MH 3T1HQ 5CYUA 2HQEA 1A3TA 1G6ZA 1QUQA 5CV8A 2EZVA 5ELEA 3PUWA 4BA1I 2LSSA 3NBHA 4KTAA 1R4QB 4DV1Q 2Z1CA 1WTOA 2D62A 3HKZG 1H95A 5DLQE 4JI0L 2NYZD 5JEAJ 3G6JB 1EIGA 1Y8OB 1SROA 3J81c 4X62L 1GUWA 5JAVA 5IYCG 1O7LA 1XTDA 1YNND 4P2CB 4JI1Q 4JI3L 4UP9A 2R3ZA 3RLFA 1G51A 1PH5A 4EGVA 1JOQA 1RTNA 1V1PB 1JQYD 5C3WA 3PSIA 2K33A 4K14A 4PQXA 1Q8IA 2IX0A 4LF6Q 2HHHL 1SE8A 2IHEA 4LJZC 1Q46A 3CRLC 1BBUA 3OIPA 3PO2B 4NXNQ 5DM73 1C48A 1D1KA 2AWOA 5LL6X 4BBSB 4IPCA 2X69A 2WB1B 3GQBA 2H5XA 4B3SQ 3EN2A 3GO5A 4A3JG 4NKLA 4HAEA 2CVRA 3RN2A 2N49A 4TKOB 1W2BA 1ICWA 3PO2H 3LGJA 3G7LA 3TQYA 4POFA 2MQHA 4KKUA 5LMNQ 1M90C 1SYGA 4DN4M 1TS4A 4LF5Q 4OX9Q 4DV2L 1B50A 1FNVA 2WP8J 5BN4A 4KD3A 2ASBA 5E3FA 1QE6A 1S5BD 4IUUA 1A15A 1KABA 3L9AX 1JCKB 2KCNA 1VQ5A 4KN4C 5CBAE 2UXCL 3I3CA 3SXHA 5C3EG 1E24A 5GAGC 3HKZB 4GOPC 4DK3C 1PDQA 4IUQA 3CPFA 2XWBB 3A8IE 2AUKA 3FP9A 4V0BA 2B2UA 3NUCA 4ZKBB 2F0SA 5I2YA 4GKJL 1E2ZA 2QCPX 1KNEA 4JYAQ 4EQPA 1K3BC 4JBWA 4IUPA 1FGBD 3BS1A 2RSNA 1I6HB 3WDNA 3TP8A 1QB5D 3KOJA 2DUDA 4ZRZA 1PRTB 2DNEA 3E6ZX 2A68C 1AEXA 3I91A 2L4NA 4BY7B 3H3VC 3I4OA 1BR9A 1Y14B 3S1QB 3K59A 3FEWX 1I6HH 2PQAB 4A3JB 2H4OA 2WKCA 4I7ZC 4A4IA 1N34Q 4BY7H 1X3EA 3GV6A 2JN4A 3S1QH 1HR0W 3K80C 5IYDG 5K36H 2M00A 3VR6A 4A3JH 3SK4A 1ILPA 1ET9A 4APVA 4IURA 5JPMC 1UWVA 1QZHA 5IY0A 1Z7TA 2PI2E 5EPKA 1AW7A 3T51B 4I7AA 1W6KA 1NNXA 2UU9L 2B2WA 5C3EB 1Y1VB 5IP9G 1MJEA 1Y8NB 3A56A 2KCCA 2X6LA 1STEA 2AHOB 4IOCA 4XDXA 1NMFA 2I5MX 5C3EH 1LTSD 1Y1VH 2DN8A 3OMGA 4DR5L 4JI3Q 2HIVA 1PRTD 1V1QA 2B3GA 2K05A 2KENA 4NW2A 2RDFA 1V43A 5ELBA 5IT9L 3MZ5A 3L0OA 4RHSA 1QZGA 3DWAA 2HHHQ 3D4RA 3JAME 1XNQL 1STHA 1J8IA 4RG1A 1HCZA 2VXWA 4G7OC 1WJJA 4LFBL 1VCIA 1B7YB 5EPJA 1K3RA 4MZ9A 4XTCS 4A3DB 1TU2B 1Q81C 5E4WC 1QVGA 2PMZB 4LK1C 1VF5C 2WINB 4DV2Q 3RZOB 3JAMc 4A3DH 4DV0L 4LMQD 3BVZA 1B3QA 4R9WA 3CKIB 1EU3A 1VQLA 4H7BA 3J80i 4LAAA 3RUZA 1SAPA 1VQIA 4XT3B 1JWUD 2L0CA 2UXCQ 3KF6A 3RZOH 2EY5A 5M3MG 1AH9A 4A3FB 3R3OA 1X9NA 4LFAL 1AP0A 3M4YA 4MIUA 4LF4L 1F2ZA 3S24A 1LACA 2WAQG 2E5LQ 2IW3A 3E0EA 2KHIA 3SGIA 5IP9H 4GKJQ 5JJLA 3I55A 1AN8A 3K57A 4A3FH 5FJ8G 1PFNA 3TMEA 1K0RA 1LTRD 1A0IA 4L5RC 4RCOA 2R7ZG 2EXZA 4RHRA 3RD4A 5KNBA 1U0LA 4JVZA 1BDOA 1A3VA 1Y69U 5IGDA 1KLUD 3HKSA 2UXDL 1ENFA 4V190 3SR1A 1EIFA 4UDUC 2VZAA 4RMFA 4DR4L 4IOAA 3S14B 4E6IA 4JI4L 5I9PA 1R9TB 1N33L 3EBEA 2BA0A 4QB4A 3U50C 1C7YA 2L9HA 3G4SA 1ASZA 1NR4A 1JOOA 5FO8B 4KKTA 4A3IB 1WTPA 1HQRD 1XWEA 4JI2L 5EBCA 3S14H 1R9TH 4TQUS 5AFWA 3OIQA 4C56C 3Q6SA 4A3IH 5C4JB 4BA2I 5ELNA 4LF9L 4JBMA 2KVMA 1HR0L 3OPOA 1JWSD 2QDLA 4U68A 2K4KA 3K8AA 1G91A 4X64L 4BBRG 4PV1C 4IPHA 3PUZA 3L2PA 1QVFA 2XSCA 1IHZA 2F0JA 5C4JH 3J7A5 4G57A 1CT1D 2C35B 4QL5A 5M5WB 1WTHA 2CFMA 4F7XA 1PH7A 3CCJA 1JC7A 1CA6A 4DR5Q 1PZKD 5IGGA 3HS0C 3FPUB 2B8FA 4PNYA 5CORA 4DV7L 3BDLA 1G6PA 5M5WH 1GKHA 1HRJA 4GN4B 2UUAL 5FJ8H 3CCVA 2Q2UA 5IOCA 2B2UC 1LO5D 3AFQA 1XNRQ 1QJOA 1BUVT 1A8VA 4WJWA 4AIMA 2NN6G 3PIO3 4LFBQ 4H13C 1I4GA 5A2QE 1M8AA 2E2JB 3DWQA 4PZ7A 3TRZA 4JCVE 2F4VL 1Q8KA 2VNUD 3MXNB 2XRSD 4L6TB 5CV5A 3OW2A 2Q8RE 1Y1WG 1KDBA 1UAPA 1HH2P 2F0QA 3UDXA 3CP0A 4IZ8A 4O0AA 2E2JH 1QNUA 4JW0A 1EY0A 1MGSA 4DV0Q 3ULPA 1D8LA 4O42A 4C1NI 1GHJA 4Y7NB 4J1MA 4QJFA 4OO1H 2QKIC 2RDGA 5T1IA 1D5ZC 1XPRA 4BBRB 4J15A 2PI2A 1RHPA 2K5DA 4KHPL 4A3LG 4C2MH 2ID0A 4LFAQ 2F0FA 3SDZA 1FL0A 4LF4Q 1BBWA 2EPBA 3U9OA 4BBRH 1MD2D 4GNXC 2V1CC 5H1SE 2WKDA 1CI3M 2B39A 3MXPA 5E4XA 4M8AA 3C46A 4AYBB 2B2WC 1SJED 4QGUA 4RCNA 3RN5A 1ZEQX 2Z9HA 1SE2A 2K5VA 1H9MA 1PFBA 5IYBH 2KECA 2F3WA 4DK0A 1YIJA 2UXDQ 3I4LA 3OWEB 4GS3A 4DR4Q 5C0XJ 1NR2A 4JI4Q 1EWHA 4DUZL 1CKOA 4MTKA 2HDMA 4OELB 3CU7A 4QQBX 5C5MA 3KJOA 3V96A 2MP1A 1SMYD 2RVLA 1H9JA 1Y1WB 1EQVA 2NN6H 4LFCQ 2ZXOA 4FDBA 3PUYA 2PNRC 4KMUC 1N32L 1HXYD 2J7ZA 3VR2A 3NSWA 1QOHA 2K03A 3DEPA 2ZT9C 4FF2A 4HCSA 1SYFA 4LF9Q 4GKKL 4WJ3M 2LXJA 1HR0Q 2NBFA 4GOPA 1DONA 4DV4Q 4X64Q 1E1TA 1GUOA 2WIIB 4XYOA 2JQOA 3PF4A 2OTLA 4FYDA 1I4XA 1S72A 1X3FA 3E5SA 2A6HC 5KRUA 4UPAA 2K5QA 4G7HC 3U4ZA 2MO1A 4K6LA 1IYJB 2G5DA 1HJPA 4IO9A 1PH2A 1H9SB 4LWCA 2OQKA 2RA4A 1K8GA 2NZOA 2UUAQ 4R4IA 3K5NA 1YNJC 3M7NA 1ENCA 2Y0SB 1Q82C 1C9OA 2QEXA 3EA6A 3S15H 3U58A 1XJVA 1F9QA 4A3CG 1EZ8A 5FLMG 1FNUA 4QIWB 1L1OA 3PUXA 3J80E 4NDXA 2F4VQ 1PZJD 4KV6A 1OXUA 2L1BA 1EFWA 4EX5A 3H0GB 1MJCA 4NXNL 1JWMD 2PW5A 2B2YA 3RLOA 4A93G 2M2LA 2F0UA 1ZXTA 2NN6I 1LTID 1VQAA 1BNZA 4P73A 2ATWA 3C1FA 1HZBA 2JA5B 4DR1L 3H0GH 2OEOA 1CZWA 1K0SA 4LF5L 4KHPQ 1KDAA 4GZYC 1F2MA 1LUZA 2I07B 2KHJA 1P16A 2JA5H 5M5XH 4OWTB 1BCPF 3STBC 1MKHA 1DJRD 2FFKB 4JV5L 2AQ1B 2EQSA 3QIAA 3VYTA 2HDLA 3I2ZA 1GJXA 4C3IH 3GP7A 5BR8L 1ICFB 2DJGC 3F2CA 3CRKC 2I46A 1OTCA 2CKZB 1JICA 1I4PA 4OXPA 3I56A 2R6GA 1MSHA 1NE3A 2TSSA 1KRSA 1Y8PB 4DNRB 3BZKA 1VF7A 2LKVA 1A3UA 1SYCA 1ZYRC 2PYKA 4YCWA 5DEHA 4LF7Q 4GLVB 5IE8A 3C1EA 1NBWA 1E2WA 1TWHB 4OWXB 4RGOS 4WRDA 2F1MA 3W5OA 1CQVA 4IFDH 5FLMH 4P71A 2DY8A 4TSSA 3AEVA 3PIOA 3PO2G 1HTLD 1SSOA 4NB3A 3SE0A 3S1RB 1VQMA 1EY8A 1N32Q 1GXDC 4XYQA 1TWHH 4A93B 1LV9A 1OXXK 2BDOA 3A55A 2F52A 2F0IA 3CC7A 1YITA 3P75A 1N34L 2EYMA 3CW2C 4P72A 3NENA 4GKKQ 2MO0A 4DPGA 2B2TA 3S1RH 5CGKA 5M5YB 1RKNA 1PV4A 4A93H 3NWTA 2K75A 1X3PA 2GVAA 1H9KA 5FLXL 1LTBD 1QUQB 3T4AC 2GN5A 4DNIA 3I70A 2J4XA 2K14A 1G8ZD 4KK7A 3N6RA 5KNDA 2H1EA 4JC0A 1CTMA 2A5HA 5M5YH 4XIGS 1HFGA 1B2TA 4DR3Q 4FNFA 3TP7A 2BH8A 2CW0C 2KA7A 4FO2A 1KDCA 4ZK9B 1KAAA 4R1JA 5IT9E 1OXTA 2KQ3A 3A0JA 1STYA 4DR2L 1E3PA 1EFID 2XN9C 1N36L 2VQFL 3TZUA 1PTOC 3CCQA 1IZ6A 4QUFA 4OIJA 4K2KA 5C6AA 4KLKA 5GADC 5ELOA 4B9XA 5KYLA 1QNKA 2IJ0A 4MTNA 1AZQA 4KY5A 5IT9c 2F0DA 1O7ZA 4BY7G 2HQLA 3DEOA 1CA5A 1M1KC 3A5ZB 3NHHA 4ILWA 5K36G 2UUCL 3V2TA 2QDBA 4R4TA 2YV5A 3J80L 2WFWA 2E8GA 1DOMA 1LTTD 4HR7B 5J1ZA 4DR1Q 4RKLA 2KHSA 2RBMA 5BN3A 3E9IA 1TS3A 3CAMA 4X3KA 1DXMA 4R4OA 4K2LA 2QILA 1KXLA 4H44C 1STGA 1TKWB 5K5PA 2SDFA 5EKLA 1CSQA 5FO7B 4JV5Q 4ZLTF 3SEBA 2JA8G 2DGYA 3HG9A 3GTQB 1CHQD 1CKMA 1GUSA 3SK8A 2LMCB 1Y1VG 5BR8Q 2N8NA 1R4PB 4ALPA 1PH1A 1J9OA 1UEAB 4HMIA 4X6AH 2E5LL 4DA2A 3GTQH 4L5TA 3W2DA 4LNQA 3P20A 4QCLA 1O80A 4KHZA 2AUJD 4ZKCB 1L0XB 2NTSA 1A62A 2OF1A 3QOJA 3LX0A 2DY7A 3GTLB 5I4DA 2JXMB 1LTLA 4DF7A 2HT1A 1WD1A 5LHY1 1B9NA 1IW7C 2OQ0A 3OHXC 1E1OA 4FXGC 2WAQE 1KIXA 1VQ7A 3AFPA 1YHBA 5JPNC 3DLLA 3GTLH 1JJCB 4B9WA 1ML0D 4MNOA 4A3DG 3EJIA 2YYZA 4A3GG 1DOLA 1X54A 2XVSA 1L1OC 5LMUQ 2K50A 2P5ZX 3G71A 4BS9A 1C0AA 4GNXA 4NXMQ 2HUGA 4PZ8A 2B2YC 2RCFA 3IFTA 2HD3A 2EYFA 4R8IA 3M4PA 2JA8B 1PH4A 4K0KQ 3NPPA 1PYWD 3L3OC 4DAMA 1KNAA 2PZUA 4A3FG 2OTJA 1XMOL 3S1NB 4N9PA 4DR2Q 1KTKA 2XGTA 3HRZC 2QGQA 2JA8H 1N36Q 2VQFQ 3GTOB 2AQ3B 1STBA 3HP3A 1QCBD 2ZTCA 1WOCA 3S17B 1HZCA 1TR5A 1TT2A 5CR3A 1N9WA 1Q12A 3NP8A 2JYOA 1EIHA 2NVQB 3S1NH 1EY4A 3EFXD 2NVYB 3ULJA 2JA6H 3GTOH 2F4IA 3EROA 4IUVA 5FOBB 2K28A 2KCTA 3AB9A 1ILQA 4IPDA 5TSSA 3S17H 2V4DA 1XNRL 2NVQH 2TMPA 4YY3L 1LYLA 2PW7A 1DOKA 2DJFC 2NVYH 2UUCQ 1TY2A 1UEBA 4FF3A 1MSGA 3EIVA 1CSPA 1RCVD 1HTPA 4A3GB 2E2HB 4L5SA 1QILA 3UE0A 3TBIB 4QF4A 2GA4B 2OCEA 4A3IG 2I5HA 3HOYH 1U4MA 1IYVA 5T1GA 3K7AB 2AKWB 4Q0FA 4ID6A 1FJGQ 3M7GA 1S5DD 3KF6B 1TY0A 2CH4W 2E2HH 4A3GH 3X3NA 3NK9A 3KBXA 1NAPA 1I50B 1HZAA 5EAYA 2EYLA 1O7IA 3K7AH 2CWPA 3T16A 3D8GA 4J6HA 2RQXA 4ME3A 1RDPD 1SMXA 2B2TC 2K04A 4LF8Q 4FF1A 3CQZH 3PIP3 1EZ6A 2YTVA 4JI7L 4RWSC 1I50H 4JOIA 1IYUA 1EQTA 4Q5VA 1C8CA 4DXFA 1I6VC 5AJ3L 4JI8Q 2BA1A 1TWAB 2K5WA 2JP1A 4CBVA 2JA7H 1HA5A 3BJUA 1PRTF 1IKMA 3M9BA 2Z4HA 4HJ8A 1TWAH 1I4RA 3J7YW 2MJ8A 5BN5A 1KHIA 2VQEL 1K8AC 5JVG3 2KEDA 2RHQB 3BZDB 3TSSA 4DK6C 2EYOA 4CDEC 1X56A 3MWYW 2A6HD 1BO0A 1V1OA 2F3VA 4JG2A 4LFCL 3I4MH 1SBBB 4OO1G 3KF8A 1D5MC 3SK5A 2HIXA 1YNJD 2QEJC 4I65A 5EKIA 2AQ2B 4XQQA 5HGTA 2AMCB 2EY6A 2EE1A 3BU2A 4O2DA 4DV4L 3FKIG 1YVCA 3ZJYC 2KCMA 1VMPA 1K73C 1UE1A 1S40A 2A8VA 2EY2A 1XMOQ 1I3QB 1DYQA 1VQHA 1EQRA 5I9OA 1M4VA 1IL8A 4BWGB 1L0WA 1TIID 5M3FB 1PZID 5IYBG 4IJLA 1B70B 3I7FA 1I3QH 4K5XA 3DMUA 4QY7A 3MA2B 4AYBG 4X65L 2KUMA 1GO3E 1PFSA 3UDFA 1PFMA 5FKAC 3M85A 5M3FH 1GUTA 1VQ6A 3KLSX 4YY3Q 3G48A 1AFPA 3STBD 2O5JC 4KHVA 2O2LD 3A8JE 4UP7A 2BE5C 3J81i 1SNPA 3A8KE 1EQQA 5EGTA 3ONAB 1BBXC 4YCVA 1HNZL 4NMZA 3ULLA 4CDCC 4B3TL 1SNCA 2AWNA 1CKNA 3CCUA 5C4XG 1XYIA 4C2MB 1T5EA 4X3TA 1U4RA 2CCZA 1ZYRD 3ND9A 4A3EG 2FMCA 1PTOB 3FKIB 5L37A 1UE6A 3VDYA 4EQOA 3HOVB 5C44B 4KKSA 4GN5A 4K8JA 3IKJA 3K0YA 4ULLA 4JI7Q 1HFNA 3VA5A 4HJAA 1PTOH 3FKIH 2DNCA 2F0MA 5AJ3Q 4A3KB 3CHBD 4HN7A 3HOVH 2ICIA 5C44H 4GLXA 3A54A 4HIDA 1U9RA 1XPOA 1KD1C 4YWLA 3VR4A 3A5UA 3U4VA 1VQJA 4LUOA 5M9OA 2SOBA 1Q86C 3UE1A 4CJ2C 4A3KH 5D14A 1D1IA 2SEBD 2YTXA 1LT3D 4XXEA 3S2HB 2VQEQ 1WTQA 3ER0A 2A1AA 4PMCA 2Y0SG 4LF7L 1EWIA 3MFGA 3LWUA 1TWFB 3PMFA 1B4OA 3CCEA 4CJ0B 1BXTA 4R4CA 1W6JA 3GTJB 3S2HH 1VQ9A 4DR6L 2CW0D 5C4ZA 3ZYYX 1EOTA 1MI2A 1TWFH 4CDDC 3D31A 5KGUA 3T1YL 3H0GG 5FLXE 5C4XB 1ENAA 2MNAA 3B6YA 4GOPB 4BXXG 2D2CC 4X66L 1PTOD 4FXDA 3GTJH 3D6WA 3M3YB 4A3EB 4HJ9A 4FXKC 3S16B 2JA5G 1OO9B 2F0NA 4XQJA 5I2XA 5C4XH 1EYDA 4OWWB 2VB3X 3BDOA 4B3RQ 1Q3LA 2LY7A 3I4NB 4OO1I 3HFZB 2N78A 3P1HA 2Z8LA 4C3IG 2C9OA 4H02A 5FLXc 4YHHL 3Q24A 3M3YH 4A3EH 2MHVA 3HOWB 1CK1A 3S16H 2WB1E 3C2PA 2Z6KC 4JBJA 3GTGB 4DR3L 1I94L 3K81C 3I4NH 2C5CA 3K5LA 2VS1A 4DAYA 3R93A 3S15B 1VQDA 3PIPA 4HJ7A 3ITPA 4X65Q 3HOWH 5IGFA 4KI0A 1PA6A 1BVSA 5JVH3 2PNHA 3A7AB 3IAYA 3H3VH 2N88A 2UXBQ 2A19A 3GTGH 4LUZA 4ZYSA 1L1OB 4JOIC 4IFDG 1GHKA 5KNCA 3QO2A 1ONLA 1DGSA 5IWAQ 2D9UA 1LTAD 1YBYA 2XNAC 3KYHC 4F88A 3GDEA 3E9HA 1E7ZA 1SYBA 4PMBA 1IBLQ 1HNWL 1ZKOA 2FXQA 3HKZE 3TN2A 1HNZQ 2LS01 1EEFD 5JOBA 4B3TQ 4IFDJ 2F0GA 4HSPA 1A2TA 4O1NA 1X55A 1FYCA 1PYBA 4TVAB 4IALA 3CMEA 2RDHA 4DU9A 5M5XB 1VQNA 3J80c 5I6YA 3H15A 3M4OB 1VQBA 4BXXH 3HZXA 1X65A 2BDNA 2R61A 4C3IB 1B1ZA 2A68D 3TP5A 2D0OA 3J7AF 5J3BA 4YWKA 3TZDA 1IW7D 2PO4A 1W3SA 2ZTEA 3M4OH 1PYSB 4DV5L 3PF5A 1SYDA 5HGQA 1S5FD 1PH8A 2MGSA 2FJ2A 2Z6BA 3DWPA 1X3QA 5KEEA 3PV0A 1SJHD 3JAMi 1VQFA 3RZDB 3ERQA 1IBML 3A7LA 3KDFA 5D3DA 4CHTB 5IP7H 1DD2A 4ZQ3A 1UNSA 5JJIA 1B53A 1EU4A 2UUBL 1QVCA 3UI2A 1EOVA 3RZDH 2BH2A 3H3VI 1XPUA 1WFQA 1JR0D 2B29A 5IODA 2FINB 1S5CD 2IT1A 4PG3A 3OOCA 4DR6Q 1I4QA 1LT5D 5I6WA 1K83B 5EPLA 4IPGA 3T1YQ 1UE5A 5GAHC 4C1NK 3Q8DA 4N9TA 4DV3L 1KL9A 4BY1G 2RCNA 2RHSB 3CF5A 4X66Q 1VQ8A 3DHQA 1I4HA 2NB0A 4ZUJA 3L7ZC 5D3IB 2XRQD 3PO3G 2GVBA 2KBNA 3UDIA 1K83H 5LMUL 5JJKA 1VS0A 1AZPA 4YHHQ 1EIYB 4NXML 4DUYL 1D2BA 1PH9A 3CPWA 3NE5B 4POGA 4K0KL 1I94Q 1EYCA 3R8BA 2B63B 1VMCA 3NWSA 2ZXRA 4OIKA 1SNOA 1Z47A 2BCOA 4KY6A 2PMZE 1SEBD 2R7FA 4AQYL
chains in the Genus database with same CATH topology
1TQOA 2JSOA 3NQIA 4KN7C 4RA8A 1OXSC 1SMYC 5IIFA 1BOSA 3R2IA 2X6GA 1ESFA 1TWGB 5C5LA 3F2UA 3NTKA 2K7VA 4FF4A 4HEDA 2B2VA 2BOSA 4BY1B 4IFDI 4DGZA 2R92B 1L0YB 1LABA 4IQZA 3Q23A 3PO3B 3DXJC 2A69C 1EY7A 3AU7A 3D3RA 2JEAI 3AMUA 1BCPC 3DUZA 1VDZA 1V1PA 4WFN3 4RKBA 5ELDA 5IGCA 1F77A 2IL8A 1T5XD 1NCVA 3OSOA 2HCCA 4X3UA 2MUYA 3I73A 2IPKD 3MXGA 1RF2D 4L63B 2E76C 1NSNS 3D6CA 3EVQA 4KD4A 2KJXA 3J7AV 5COYA 3QJYA 5JEAH 5CV9A 4ODGA 4U673 4IUTA 2A74C 1A2UA 4G7ZC 4S3SA 1EYAA 4K5WA 3FDTA 1JOKA 4RGTA 1PMRA 2EY1A 3TP6A 1E2VA 3SVMA 3I8ZA 2M9VA 3BG3A 3MC0B 2R93B 2L55A 4ABNA 4RH6A 4WORA 2EJFC 3K5OA 1C4QA 1II3A 1G2TA 1V8QA 1SNDA 4HCEA 3QG1A 2CHBD 2F0EA 2JE6I 5ELCA 2F0WA 2EJMA 3KLSA 1HQMC 3NTIA 2RKSA 2NTTA 3QOLA 3D4WA 4NP5A 1JORA 4R8NA 1TS5A 2IX1A 2BE5D 3OWFA 3S9WA 3LWEA 2NWGA 2JA6B 1STNA 1EL0A 3I72A 4CJ1B 2G9HD 3MEHA 1QG7A 1QWYA 5IGEA 4J8QA 1G2SA 2SNSA 3HEJA 1B3AA 2F0OA 4DFAA 3J81L 3H94A 1SXTA 3HOYB 3LNNA 1WCMB 5CMDA 4C3JG 4PMWA 2A6EC 4KJOA 2NVXB 2OXPA 1XX8A 2FMMA 5KYIA 2EJGC 3Q22A 3NBIA 5E1FA 4A3BB 3HOXB 1STAA 4RFBA 3U9SA 3CQZB 4RAUC 5J39A 4KJNA 4CKBA 4XT1B 4CKCA 2O4XA 3O13A 2F0PA 3BVMA 1SYEA 5F2DA 1F9SA 3TDQA 2JA7B 1HUMA 3C3LA 1YNNC 5DM63 4EVOA 1SDFA 2PQEA 2IWHA 1CQFA 4K6DA 2PPBC 3MTSA 3MAQA 1SNQA 2F0LA 1LT6D 2SNMA 3FMCA 2K32A 2Q8TA 2OT2A 2E74C 2PZWA 5CC4A 3W3AA 2LFNA 3I4MB 5CBEE 3ND8A 4C3JB 1RD9D 1O78A 3D4DA 4IN3A 2L12A 2XIWA 1WTRA 3FVQA 4DAVA 3S2DB 3SK6A 2ENBA 3GTPB 1CHPD 1FR3A 1UUPA 3V05A 1BQQT 2B8GA 4RGMA 2G9DA 2B2VC 4TRDA 4RGNA 5FK9C 4OHJA 1FNWA 4H0LC 4M1UB 4DXGA 4C3HG 4EQNA 1ESRA 4A3MB 2JEBI 3VR5A 4HMJA 3QWNA 3GTMB 5CV6A 2XWJB 1ET6A 1RODA 1U4LA 4K5VA 1JB3A 3QB3A 1WD0A 2Z4IA 2F0TA 5LL6S 2K01A 4F87A 5M3MB 1X32A 2A73B 1EEID 2WAQB 5A35A 1LLRD 1EY6A 3GTKB 1DM0B 1JE4A 2K1BA 3KBGA 5D65A 1TVXA 2R7ZB 1WTWA 2K6AA 2WACA 2E75C 3HGBA 4Z9CB 1F9PA 3WOEA 1EWCA 5G3LD 4ZAIA 3H09A 4CGYB 4ZUIA 5ISRA 3K6OA 4C3HB 3IFDA 2RSOA 4HTHA 3VR3A 3OW7A 1B44D 1D5XC 3JAML 1K8OA 3MXNA 1PRTC 3E0JA 2E2DC 4DNTB 3NXWA 4QMGA 2N55A 1SE3A 5EKKA 1WTVA 3I90A 4UAIA 3VYUA 1BCPB 2WV6D 5C0XG 1F2LA 1GUGA 4YIJA 1D6EC 3K58A 1MBYA 3RMHA 4OL7A 4L8JA 3T53B 1EY5A 5G3LF 1Q90A 5NUCA 3N52A 1B9MA 2MPMA 4FVMA 3R2TA 3VA7A 3HOUB 1RJTA 1TS2A 4G4KA 3KK7A 5DNFA 2F0KA 2EYPA 3H91A 5CV4A 2F0HA 5EJWA 3WOFA 2F0VA 4HSVA 1Q1EA 5FO9B 2HCIA 3GV3A 2L11A 2A69D 1DCZA 3FPPA 1SE4A 1BCPD 1WVLA 1KLGD 3P7JA 3T56B 5C4HA 3IL8A 5EBDA 5EQ0A 2NUCA 1BF4A 5IGBA 2J0TD 4OGQC 4X3SA 3EQLC 3NTHA 2YU9B 1NUCA 5C0XH 3BDCA 2EYJA 4KY7A 1H9SA 3X3MA 1EY9A 1SFOB 1LTGD 3OMCA 1IKLA 1LT4D 1PTOF 1S4ZA 1F2YA 5DAUA 4DAPA 3VYRA 2IX3A 4ME5A 3T13A 4MN3A 1CM9A 2NVTB 1A6XA 3BYTB 3PUVA 1Z6HA 1RTOA 4B08A 3Q0AA 3MHBA 5A2QL 5KIXA 2EOTA 2QF7A 1U4PA 3NQTA 2KOLA 2EVBA 4QUCA 2FHTA 3KLRA 2VUMB 1PXUA 1CFMA 1HA6A 2EYHA 5HURA 3DM1A 3FRPB 2CQAA 2E2IB 5J22A 2Q8IB 1PLFA 1E0BA 4F8MA 2NZ1D 3BVGA 1HHVA 3VYSA 4FP5D 1GUNA 3MXUA 1HUNA 5JJZA 2KEEA 2PCFB 4JK1C 3MFYA 2VB2X 3URYA 1K8MA 5C0XI 5CV7A 1H9RA 4CKEA 1SNMA 2EDGA 3H6MA 1OXVA 2ICEC 4K8IA 1O7YA 2L5TA 1XXGA 2F03A 4XQNA 1GOZA 3BYYB 5ELFA 4DK1A 4MHEA 4IUNA 3K5MA 1F9RA 1DZ1A 2D5DA 3GD7A 3MVVA 1S5ED 1WTXA 1TWCB 2O5IC 3S1MB 1HPCA 2A6ED 2PZTA 1G291 1XTCD 3SHLA 5JEAG 5C3XA 3HOZB 3KUPA 3J81E 1FD7D 1CZGA 1Q1BA 2ZXPA 5CYUA 2HQEA 1A3TA 1G6ZA 5CV8A 2EZVA 5ELEA 3PUWA 4BA1I 3NBHA 4KTAA 1R4QB 2Z1CA 1WTOA 2D62A 2NYZD 5JEAJ 3G6JB 1EIGA 1Y8OB 1GUWA 5JAVA 1O7LA 1YNND 4P2CB 2R3ZA 3RLFA 4EGVA 1JOQA 1RTNA 1V1PB 1JQYD 5C3WA 2K33A 4K14A 4PQXA 1Q8IA 2IX0A 4LJZC 3CRLC 3OIPA 3PO2B 5DM73 1C48A 1D1KA 2AWOA 5LL6X 4BBSB 2X69A 2WB1B 3GQBA 3GO5A 4NKLA 4HAEA 2CVRA 4TKOB 1ICWA 3G7LA 4KKUA 1SYGA 4DN4M 1TS4A 1B50A 1FNVA 2WP8J 5BN4A 4KD3A 5E3FA 1QE6A 1S5BD 4IUUA 1A15A 1KABA 3L9AX 1JCKB 2KCNA 4KN4C 5CBAE 3I3CA 3SXHA 3HKZB 1PDQA 4IUQA 2XWBB 3A8IE 2AUKA 4V0BA 2B2UA 3NUCA 4ZKBB 2F0SA 5I2YA 1E2ZA 2QCPX 1KNEA 4EQPA 4JBWA 4IUPA 1FGBD 3BS1A 2RSNA 1I6HB 3WDNA 3TP8A 1QB5D 4ZRZA 1PRTB 2DNEA 3E6ZX 2A68C 1AEXA 3I91A 2L4NA 4BY7B 3H3VC 1BR9A 3S1QB 3K59A 3FEWX 4A3JB 2H4OA 2WKCA 4I7ZC 3GV6A 5K36H 2M00A 3VR6A 3SK4A 1ILPA 1ET9A 4IURA 5JPMC 1Z7TA 5EPKA 1AW7A 3T51B 1W6KA 2B2WA 5C3EB 1Y1VB 1Y8NB 3A56A 2KCCA 2X6LA 1STEA 4XDXA 1LTSD 2DN8A 3OMGA 1PRTD 2K05A 4NW2A 2RDFA 1V43A 5ELBA 5IT9L 3MZ5A 4RHSA 3DWAA 3D4RA 3JAME 1STHA 1J8IA 1HCZA 2VXWA 4G7OC 1VCIA 5EPJA 4XTCS 4A3DB 1TU2B 5E4WC 2PMZB 4LK1C 1VF5C 2WINB 3RZOB 4LMQD 3BVZA 4R9WA 3CKIB 1EU3A 4H7BA 4LAAA 3RUZA 1SAPA 4XT3B 1JWUD 2L0CA 2EY5A 4A3FB 3R3OA 1AP0A 3M4YA 4MIUA 1F2ZA 1LACA 2IW3A 1AN8A 3K57A 1PFNA 3TMEA 1LTRD 4RCOA 2EXZA 4RHRA 3RD4A 5KNBA 1BDOA 1A3VA 1Y69U 5IGDA 1KLUD 1ENFA 4V190 3SR1A 4UDUC 3S14B 4E6IA 5I9PA 1R9TB 4QB4A 2BA0A 2L9HA 1NR4A 1JOOA 5FO8B 4KKTA 4A3IB 1WTPA 1HQRD 1XWEA 5EBCA 4TQUS 5AFWA 3OIQA 4C56C 3Q6SA 5C4JB 4BA2I 2KVMA 3OPOA 1JWSD 4U68A 1G91A 4PV1C 3PUZA 2XSCA 1IHZA 2F0JA 4G57A 1CT1D 5M5WB 4F7XA 1JC7A 1CA6A 1PZKD 5IGGA 3HS0C 3FPUB 2B8FA 4PNYA 5CORA 3BDLA 1HRJA 5IOCA 2B2UC 1LO5D 1QJOA 1BUVT 3PIO3 4WJWA 2NN6G 4H13C 1I4GA 5A2QE 1M8AA 2E2JB 3DWQA 2VNUD 2XRSD 4L6TB 5CV5A 2Q8RE 1KDBA 1UAPA 2F0QA 4IZ8A 1QNUA 1EY0A 1MGSA 4O42A 4C1NI 1GHJA 4Y7NB 4J1MA 4OO1H 2QKIC 2RDGA 5T1IA 1D5ZC 4BBRB 1RHPA 2K5DA 2ID0A 2F0FA 3SDZA 2EPBA 3U9OA 1MD2D 2WKDA 1CI3M 2B39A 3MXPA 5E4XA 4M8AA 3C46A 4AYBB 2B2WC 1SJED 4RCNA 1ZEQX 1SE2A 1H9MA 1PFBA 2KECA 2F3WA 4DK0A 3I4LA 3OWEB 5C0XJ 1NR2A 1EWHA 2HDMA 3CU7A 5C5MA 3V96A 2MP1A 1SMYD 2RVLA 1H9JA 1Y1WB 1EQVA 2NN6H 2ZXOA 3PUYA 2PNRC 4KMUC 1HXYD 2J7ZA 3VR2A 3NSWA 1QOHA 2K03A 3DEPA 2ZT9C 4FF2A 4HCSA 1SYFA 2NBFA 1DONA 1GUOA 2WIIB 4XYOA 4FYDA 1I4XA 3E5SA 2A6HC 5KRUA 2K5QA 4G7HC 4K6LA 1H9SB 2RA4A 3K5NA 1YNJC 3M7NA 1ENCA 2Y0SB 3EA6A 1F9QA 1EZ8A 1FNUA 4QIWB 3J80E 3PUXA 4NDXA 1PZJD 4KV6A 1OXUA 2L1BA 3H0GB 1JWMD 2PW5A 2B2YA 2M2LA 2F0UA 1ZXTA 2NN6I 1LTID 1BNZA 3C1FA 2JA5B 2OEOA 1CZWA 1KDAA 4GZYC 1F2MA 2I07B 1BCPF 1DJRD 2FFKB 2AQ1B 3QIAA 3VYTA 2HDLA 1GJXA 3GP7A 3CRKC 2I46A 1JICA 1I4PA 2R6GA 1MSHA 2TSSA 1Y8PB 4DNRB 1VF7A 2LKVA 1A3UA 1SYCA 1ZYRC 2PYKA 5DEHA 3C1EA 1E2WA 1TWHB 4RGOS 4WRDA 2F1MA 1CQVA 4IFDH 2DY8A 4TSSA 1HTLD 1SSOA 3SE0A 3S1RB 1EY8A 1GXDC 4XYQA 4A93B 1LV9A 1OXXK 2BDOA 3A55A 2F0IA 3P75A 2EYMA 2B2TA 5CGKA 5M5YB 1RKNA 3NWTA 1X3PA 1H9KA 5FLXL 1LTBD 3T4AC 3I70A 2J4XA 1G8ZD 4KK7A 3N6RA 5KNDA 2H1EA 1CTMA 2A5HA 4XIGS 1HFGA 1B2TA 4FNFA 3TP7A 2CW0C 2KA7A 4FO2A 1KDCA 4ZK9B 1KAAA 5IT9E 1OXTA 2KQ3A 1STYA 1EFID 2XN9C 3TZUA 1PTOC 4QUFA 4OIJA 4K2KA 5C6AA 4B9XA 5KYLA 1QNKA 2IJ0A 1AZQA 4KY5A 2F0DA 1O7ZA 3DEOA 1CA5A 3NHHA 4ILWA 5K36G 3V2TA 2QDBA 3J80L 1DOMA 1LTTD 4HR7B 5J1ZA 4RKLA 2KHSA 2RBMA 5BN3A 1TS3A 4X3KA 1DXMA 4K2LA 2QILA 4H44C 1STGA 1TKWB 5K5PA 2SDFA 5EKLA 5FO7B 4ZLTF 3SEBA 3HG9A 3GTQB 1CHQD 1GUSA 3SK8A 2LMCB 1R4PB 1J9OA 1UEAB 4HMIA 4DA2A 3W2DA 3P20A 4QCLA 1O80A 4KHZA 2AUJD 4ZKCB 1L0XB 2NTSA 2OF1A 3QOJA 3LX0A 2DY7A 3GTLB 5I4DA 2JXMB 4DF7A 1WD1A 5LHY1 1B9NA 1IW7C 3OHXC 4FXGC 5JPNC 4B9WA 1ML0D 3EJIA 2YYZA 1DOLA 2XVSA 4BS9A 2HUGA 2B2YC 3IFTA 2EYFA 4R8IA 2JA8B 3NPPA 1PYWD 3L3OC 1KNAA 2PZUA 3S1NB 4N9PA 1KTKA 3HRZC 3GTOB 2AQ3B 1STBA 3HP3A 1QCBD 3S17B 1TR5A 1TT2A 5CR3A 1Q12A 3NP8A 2JYOA 1EIHA 2NVQB 1EY4A 3EFXD 2NVYB 2F4IA 3EROA 4IUVA 5FOBB 2K28A 3AB9A 1ILQA 5TSSA 2V4DA 2TMPA 2PW7A 1DOKA 1TY2A 4FF3A 1MSGA 1RCVD 1HTPA 4A3GB 2E2HB 1QILA 3TBIB 4QF4A 2GA4B 1U4MA 1IYVA 5T1GA 3K7AB 4Q0FA 4ID6A 3M7GA 1S5DD 1TY0A 3X3NA 3NK9A 3KBXA 1NAPA 1I50B 2EYLA 3T16A 3D8GA 4J6HA 2RQXA 1RDPD 2B2TC 2K04A 4FF1A 3PIP3 1EZ6A 4RWSC 1IYUA 1EQTA 4Q5VA 1C8CA 4DXFA 1I6VC 2BA1A 1TWAB 2K5WA 2JP1A 4CBVA 1HA5A 1PRTF 1IKMA 2Z4HA 1I4RA 3J7YW 2MJ8A 5BN5A 5JVG3 2KEDA 3BZDB 3TSSA 2EYOA 3MWYW 2A6HD 1BO0A 1V1OA 2F3VA 1SBBB 4OO1G 3KF8A 1D5MC 3SK5A 1YNJD 2QEJC 4I65A 5EKIA 2AQ2B 4XQQA 5HGTA 2EY6A 2EE1A 1VMPA 2EY2A 1I3QB 1DYQA 5I9OA 1M4VA 1IL8A 4BWGB 1TIID 5M3FB 1PZID 4K5XA 3DMUA 3MA2B 2KUMA 1PFMA 5FKAC 3M85A 1GUTA 3KLSX 1AFPA 2O5JC 4KHVA 2O2LD 3A8JE 2BE5C 1SNPA 3A8KE 5EGTA 3ONAB 1BBXC 4NMZA 1SNCA 2AWNA 1XYIA 4C2MB 1T5EA 4X3TA 1U4RA 1ZYRD 3ND9A 2FMCA 1PTOB 3FKIB 4EQOA 3HOVB 5C44B 4KKSA 4K8JA 3IKJA 3K0YA 4ULLA 1HFNA 3VA5A 1PTOH 2DNCA 2F0MA 4A3KB 3CHBD 4HN7A 2ICIA 3A54A 1U9RA 3VR4A 5M9OA 2SOBA 4CJ2C 5D14A 1D1IA 2SEBD 1LT3D 4XXEA 3S2HB 1WTQA 4PMCA 3MFGA 3LWUA 1TWFB 3PMFA 1B4OA 4CJ0B 1BXTA 1W6JA 3GTJB 2CW0D 5C4ZA 3ZYYX 1EOTA 1MI2A 3D31A 5KGUA 5FLXE 5C4XB 1ENAA 2D2CC 1PTOD 4FXDA 3D6WA 3M3YB 4A3EB 4FXKC 3S16B 1OO9B 2F0NA 4XQJA 5I2XA 1EYDA 2VB3X 3BDOA 1Q3LA 2LY7A 3I4NB 4OO1I 3P1HA 4C3IG 2Z8LA 2C9OA 3Q24A 2MHVA 3HOWB 1CK1A 3C2PA 3GTGB 2C5CA 3K5LA 4DAYA 3R93A 3S15B 3ITPA 5IGFA 4KI0A 5JVH3 3A7AB 3IAYA 2N88A 4ZYSA 4IFDG 1GHKA 5KNCA 3QO2A 1ONLA 2D9UA 1LTAD 2XNAC 4F88A 1SYBA 4PMBA 1ZKOA 3TN2A 2LS01 1EEFD 5JOBA 4IFDJ 2F0GA 4HSPA 1A2TA 4O1NA 1FYCA 4IALA 2RDHA 4DU9A 5M5XB 5I6YA 3M4OB 3HZXA 2BDNA 2R61A 4C3IB 1B1ZA 2A68D 3TP5A 3J7AF 3TZDA 1IW7D 2PO4A 1SYDA 1S5FD 2MGSA 2FJ2A 3DWPA 1X3QA 5KEEA 3PV0A 1SJHD 3RZDB 3ERQA 3A7LA 5D3DA 4CHTB 1DD2A 4ZQ3A 1UNSA 1B53A 1EU4A 3UI2A 1JR0D 5IODA 2FINB 1S5CD 2IT1A 3OOCA 1I4QA 1LT5D 5I6WA 1K83B 5EPLA 4C1NK 4N9TA 3DHQA 1I4HA 2NB0A 4ZUJA 3L7ZC 5D3IB 2XRQD 1AZPA 1D2BA 3NE5B 1EYCA 3R8BA 2B63B 1VMCA 3NWSA 2ZXRA 4OIKA 1SNOA 1Z47A 2BCOA 4KY6A 1SEBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TQO A;  2QDB A;  4IAL A;  1SNQ A;  1II3 A;  1STB A;  1SND A;  4DU9 A;  2F0L A;  4F7X A;  4IUN A;  5J1Z A;  5M9O A;  2SNM A;  4HTH A;  2SOB A;  5I6Y A;  1TR5 A;  1TT2 A;  4RKL A;  5CR3 A;  2F0E A;  2KHS A;  2RBM A;  3NUC A;  2NUC A;  3NP8 A;  3SK5 A;  2F0W A;  4I65 A;  3HZX A;  5IGG A;  1EY4 A;  2F0S A;  2PZW A;  4PNY A;  5CC4 A;  5IIF A;  5HGT A;  5IGB A;  3BDL A;  1SYF A;  2EY6 A;  4K2L A;  2LKV A;  1A3U A;  1SYC A;  2PYK A;  3MVV A;  3ERO A;  4PMC A;  5DEH A;  3SXH A;  3TP5 A;  4EQP A;  3D4D A;  1STG A;  3PMF A;  5C5L A;  1NUC A;  2RKS A;  3QOL A;  5K5P A;  3C1E A;  3BDC A;  3D4W A;  2PZT A;  2EYJ A;  4NP5 A;  5EKL A;  5IOC A;  1JOR A;  1SYD A;  4H7B A;  4KY7 A;  4R8N A;  3SK6 A;  3SHL A;  3TP8 A;  2ENB A;  4LAA A;  4WRD A;  3RUZ A;  5C3X A;  2EY2 A;  2PW7 A;  4DGZ A;  1EY9 A;  3OWF A;  3S9W A;  1AEX A;  2EY5 A;  3SK8 A;  1STN A;  5C4Z A;  5KEE A;  3OMC A;  5I9O A;  3R3O A;  5KGU A;  3ERQ A;  3E5S A;  1F2Y A;  3NXW A;  2HQE A;  1EY8 A;  4QMG A;  5DAU A;  5KRU A;  1A3T A;  1ENA A;  1EY7 A;  4HMI A;  3MEH A;  5CV8 A;  4MIU A;  1F2Z A;  4QF4 A;  2F0I A;  4TRD A;  4ME5 A;  4ZQ3 A;  5EKK A;  5CV5 A;  3T13 A;  3P75 A;  4KTA A;  5IGE A;  4K5X A;  1KDB A;  3DMU A;  2EYM A;  2SNS A;  4RKB A;  2F0Q A;  4ID6 A;  4EQN A;  3HEJ A;  5IGC A;  4IZ8 A;  2F0N A;  2F0O A;  4YIJ A;  4DFA A;  1EY0 A;  5CGK A;  3OSO A;  1EYD A;  3TME A;  1RKN A;  3NK9 A;  3MHB A;  2OF1 A;  2M00 A;  3QOJ A;  4J1M A;  1ENC A;  3LX0 A;  5IOD A;  5JAV A;  5KIX A;  3P1H A;  4HMJ A;  2EYL A;  2EXZ A;  4DF7 A;  3SK4 A;  3T16 A;  1EZ8 A;  3NQT A;  3D8G A;  4J6H A;  5CV6 A;  4KJO A;  4OL7 A;  1JOQ A;  5C3W A;  5I6W A;  1A3V A;  2OXP A;  4KHV A;  5IGD A;  1NSN S;  4NDX A;  5HUR A;  4K5V A;  2F0F A;  2EYH A;  1EY5 A;  3D6C A;  3QB3 A;  4K14 A;  4N9T A;  4KV6 A;  1EZ6 A;  3EVQ A;  2F0T A;  3SR1 A;  5KYI A;  4E6I A;  5I9P A;  1SNP A;  3DHQ A;  4KD4 A;  4QB4 A;  3TP7 A;  5NUC A;  5J22 A;  5EGT A;  5ISR A;  3U9O A;  3ITP A;  4NMZ A;  2PW5 A;  5E1F A;  4ZUJ A;  4B9W A;  1KDC A;  1KAA A;  1SNC A;  3EJI A;  2KQ3 A;  5IGF A;  1JOO A;  1STY A;  1STA A;  5CV9 A;  4ODG A;  2F0U A;  4F8M A;  3MXP A;  5J39 A;  1EY6 A;  1A2U A;  4KJN A;  2F0K A;  3C1F A;  4NKL A;  2EYP A;  3V2T A;  3OMG A;  4S3S A;  1EYA A;  4K5W A;  2OEO A;  1JOK A;  4K2K A;  5C6A A;  2O4X A;  5CV4 A;  4EQO A;  2F0P A;  4B9X A;  2EYF A;  1SYE A;  1SYG A;  2F0H A;  5F2D A;  1KDA A;  2EY1 A;  2RDF A;  2F3W A;  5KYL A;  1SYB A;  1F2M A;  2F0V A;  4PMB A;  2WAC A;  3MZ5 A;  4K8J A;  4EVO A;  1EYC A;  4KY5 A;  2F0D A;  4KD3 A;  3TP6 A;  3VA5 A;  5CV7 A;  5E3F A;  2EYO A;  2F0M A;  1STH A;  2PZU A;  1SNM A;  1KAB A;  1SNO A;  2PQE A;  3H6M A;  2F3V A;  3NHH A;  5JOB A;  4K6D A;  5C5M A;  1IHZ A;  2F0J A;  4K8I A;  2F0G A;  4KY6 A;  4N9P A;  1A2T A;  4ZUI A;  1U9R A;  4G57 A;  4WOR A;  1EQV A;  5C4H A; 
#chains in the Genus database with same CATH topology
 1TQO A;  2JSO A;  2B63 H;  2N3S A;  3NQI A;  4KN7 C;  4RA8 A;  1OXS C;  2EIF A;  1KC8 C;  1SMY C;  3HOZ H;  4LW1 A;  5IIF A;  1BOS A;  3R2I A;  2X6G A;  1ESF A;  3CC4 A;  1TWG B;  4GN3 B;  5C5L A;  3F2U A;  1IBK L;  1HNW Q;  3NTK A;  2JJQ A;  2K7V A;  4FF4 A;  4HED A;  2B2V A;  4GLA C;  3W1B A;  2BOS A;  4BY1 B;  4IFD I;  4DGZ A;  1XMQ L;  2R92 B;  1MIU A;  1L0Y B;  1LAB A;  5HY6 A;  1TWG H;  4IQZ A;  3Q23 A;  3PO3 B;  3DXJ C;  2R93 G;  2A69 C;  1EY7 A;  3AU7 A;  3D3R A;  1AE3 A;  2JEA I;  2IHF A;  3NEM A;  5GAE C;  1BCP C;  3AMU A;  3DUZ A;  4BY1 H;  1FVI A;  1VDZ A;  1V1P A;  4WFN 3;  2R92 H;  4RKB A;  5ELD A;  1FJG L;  5IGC A;  1YJW A;  1F77 A;  2IL8 A;  3PO3 H;  2K52 A;  1T5X D;  1NCV A;  3OSO A;  2MFI A;  2HCC A;  4X3U A;  4DV5 Q;  1IXR A;  2MUY A;  3I73 A;  3CCM A;  1GVP A;  2IPK D;  3MXG A;  4BBS H;  4LF8 L;  1RF2 D;  3CCR A;  4L63 B;  2E76 C;  3J7Z C;  1NSN S;  3D6C A;  1IBM Q;  3EVQ A;  4KD4 A;  2D0P A;  2KJX A;  3WWV A;  3J7A V;  2JA6 G;  4JI8 L;  5COY A;  2UUB Q;  3QJY A;  3AQQ A;  5JEA H;  5CV9 A;  4ODG A;  4U67 3;  1YHA A;  1HZ9 A;  1VQ4 A;  4IUT A;  2A74 C;  1A2U A;  1YJN A;  4G7Z C;  1VQC A;  4JI5 L;  4S3S A;  1EYA A;  4K5W A;  3FDT A;  1JOK A;  4RGT A;  3ICE A;  1PMR A;  3CXC A;  2EY1 A;  3HOY G;  4Y52 H;  4DV3 Q;  4DKA C;  1WCM G;  2F3I A;  3TP6 A;  1E2V A;  3SVM A;  3I8Z A;  2M9V A;  3BG3 A;  3MC0 B;  2Z0S A;  2L55 A;  2R93 B;  2CWA A;  4ABN A;  4UY8 C;  4RH6 A;  5IYC H;  4GNX B;  4WOR A;  2EJF C;  3K5O A;  1C4Q A;  1II3 A;  1G2T A;  1V8Q A;  1SND A;  4A3B G;  4HCE A;  3QG1 A;  2R93 H;  1YHQ A;  3HOX G;  2CHB D;  2F0E A;  2JE6 I;  5ELC A;  4DUY Q;  2F0W A;  2EJM A;  1J6Q A;  3KLS A;  4A76 A;  1HQM C;  3NTI A;  4R4Q A;  3J81 j;  2PQA A;  2RKS A;  3QOL A;  1AE2 A;  2NTT A;  4LUV A;  3D4W A;  4NP5 A;  1YJ9 A;  1JOR A;  4R8N A;  1TS5 A;  2IX1 A;  2BE5 D;  1KQS A;  2JA7 G;  3OWF A;  3S9W A;  3LWE A;  2NWG A;  2JA6 B;  1STN A;  4AQY Q;  4PZ6 A;  2I0Q A;  1EL0 A;  3I72 A;  2R7D A;  1J5E L;  4CJ1 B;  2G9H D;  3MEH A;  1QG7 A;  1SLJ A;  1QWY A;  5IGE A;  4J8Q A;  1G2S A;  2SNS A;  3HEJ A;  1P8L A;  4JI0 Q;  1B3A A;  2F0O A;  4DFA A;  3J81 L;  3H94 A;  1IBK Q;  3CCS A;  2OWO A;  4X62 Q;  1SXT A;  4UHV A;  3HOY B;  3LNN A;  1WCM B;  3I4M G;  5CMD A;  1XMQ Q;  4C3J G;  4PMW A;  2A6E C;  4JI6 L;  4KJO A;  2NVX B;  2OXP A;  1XX8 A;  3CD6 A;  2FMM A;  5KYI A;  2EJG C;  1FGU A;  4AYB E;  3Q22 A;  1WCM H;  3NBI A;  5E1F A;  4A3B B;  1YZ6 A;  1X3G A;  2NVX H;  3RLN A;  3HOX B;  1STA A;  4RFB A;  3U9S A;  2Z6K A;  3CQZ B;  4RAU C;  5J39 A;  4A75 A;  4KJN A;  4CKB A;  4XT1 B;  4A3B H;  1GD7 A;  4CKC A;  4A3M G;  2O4X A;  3HOX H;  4N8X 1;  3O13 A;  2F0P A;  2JK8 A;  3BVM A;  1SYE A;  5F2D A;  3G6E A;  1F9S A;  3TDQ A;  2JA7 B;  1HUM A;  3C3L A;  3UDG A;  1YNN C;  5DM6 3;  4EVO A;  1VQP A;  2JA9 A;  1SDF A;  3CC2 A;  3CMA A;  2PQE A;  2IWH A;  1CQF A;  1YEZ A;  4K6D A;  5IYD H;  2PPB C;  3MTS A;  5M3F G;  3OTO L;  2EXD A;  4HIM A;  3MAQ A;  1SNQ A;  4OEM B;  2F0L A;  1LT6 D;  2SNM A;  3FMC A;  4JI5 Q;  2K32 A;  2Q8T A;  2OT2 A;  2E74 C;  1A63 A;  2PZW A;  5CC4 A;  4DR7 L;  2K5N A;  3W3A A;  2LFN A;  3I4M B;  5CBE E;  3ND8 A;  1RD9 D;  1O78 A;  3D4D A;  4IN3 A;  4C3J B;  2L12 A;  3JC6 6;  2XIW A;  1WYD A;  1WTR A;  3FVQ A;  4DAV A;  3S2D B;  3M4Q A;  3SK6 A;  2ENB A;  1L2F A;  3GTP B;  3KF8 B;  1CHP D;  1FR3 A;  3D0F A;  1VQE A;  1UUP A;  3V05 A;  1BQQ T;  4C3J H;  3TEH B;  2B8G A;  5GQO A;  4RGM A;  1E22 A;  2G9D A;  3PCO B;  1JJ2 A;  2B2V C;  1KRT A;  3S2D H;  4TRD A;  3F2D A;  4RGN A;  5FK9 C;  4OHJ A;  1FNW A;  1JJG A;  2Y0S E;  4H0L C;  4M1U B;  1BKB A;  3GTP H;  4DXG A;  4C3H G;  4EQN A;  1ESR A;  2ZM6 L;  4QIW E;  4A3M B;  4B3R L;  2JEB I;  3HOV G;  5C44 G;  3VR5 A;  4HMJ A;  3QWN A;  3GTM B;  5CV6 A;  2XWJ B;  1ET6 A;  1ROD A;  4A3M H;  2ALY B;  1U4L A;  4A3K G;  1HNX L;  4K5V A;  4P74 A;  1JB3 A;  3QB3 A;  1WD0 A;  1J5E Q;  2Z4I A;  2ZJQ A;  2F0T A;  5LL6 S;  2K01 A;  4F87 A;  5M3M B;  2UU9 Q;  1X32 A;  4UP8 A;  2YTY A;  3GTM H;  2A73 B;  1EEI D;  3KLW A;  2UXB L;  2QA4 A;  2WAQ B;  1NMG A;  5A35 A;  1LLR D;  1MHW C;  1EY6 A;  1NTG A;  4B3M L;  1YNX A;  5M3M H;  4AH6 A;  3GTK B;  1DM0 B;  1JE4 A;  2K5H A;  2VL6 A;  5IWA L;  1GM5 A;  2K1B A;  1UE7 A;  1SR3 A;  2L15 A;  3KBG A;  4JI6 Q;  1JB7 A;  4N8F A;  5D65 A;  1TVX A;  1JE5 A;  2R7Z B;  2CQO A;  1WTW A;  1IBL L;  2K6A A;  1CKN B;  2WAC A;  2E75 C;  3HGB A;  4Z9C B;  1F9P A;  3GTK H;  3WOE A;  1EWC A;  5G3L D;  1XNQ Q;  4ZAI A;  3H09 A;  3MEF A;  4CGY B;  4CDF C;  1K28 A;  4ZUI A;  2R7Z H;  5ISR A;  3K6O A;  4C3H B;  3E3X A;  3BZC A;  3IFD A;  1JMC A;  2RSO A;  4HTH A;  3VR3 A;  3F8T A;  3HOU G;  3OW7 A;  1B44 D;  3A74 A;  1D5X C;  3JAM L;  3I4N G;  5LMN W;  1PH6 A;  4C3H H;  1K8O A;  3AYH B;  1EUJ A;  3MXN A;  3W1G A;  2ES2 A;  3HOW G;  1PRT C;  2QW7 A;  1YI2 A;  3E0J A;  4OON A;  2E2D C;  4DNT B;  3RR5 A;  1KAW A;  3KFU A;  3OTO Q;  5E7N A;  3FHW A;  1RIP A;  3NXW A;  4QMG A;  2N55 A;  1SE3 A;  4DV6 L;  1S3O A;  4Y7N H;  3K7U C;  5EKK A;  1WTV A;  1X6O A;  3I90 A;  4DR7 Q;  4UAI A;  3VYU A;  1BCP B;  2WV6 D;  5C0X G;  1F2L A;  1GUG A;  4YIJ A;  2ZJP A;  4HIO A;  1D6E C;  2VY3 A;  3K58 A;  1VQK A;  1MBY A;  2Q2H A;  3RMH A;  4OL7 A;  4L8J A;  3T53 B;  1EY5 A;  3PQI A;  5G3L F;  2CH4 A;  1Q90 A;  5NUC A;  3N52 A;  1B9M A;  2MPM A;  4FVM A;  1N33 Q;  3DM3 A;  3R2T A;  3VA7 A;  3HOU B;  1RJT A;  2ZM6 Q;  1TS2 A;  4G4K A;  3KK7 A;  5DNF A;  2F0K A;  4JI2 Q;  2EYP A;  2XTI A;  3QR8 A;  3RNU A;  1VQG A;  4WJ4 A;  4DAY B;  3H91 A;  3HOU H;  5CV4 A;  1B8A A;  2F0H A;  5IP7 G;  1Y1W H;  5EJW A;  3WOF A;  2F0V A;  1HNX Q;  4HSV A;  1SRU A;  2I5L X;  1LM0 A;  1Q1E A;  5FO9 B;  2HCI A;  3GV3 A;  2L11 A;  2VUM G;  2A69 D;  1DCZ A;  2Q2T A;  3FPP A;  3TS0 A;  1SE4 A;  1BCP D;  3NEL A;  1WVL A;  1KLG D;  3P7J A;  3T56 B;  5C4H A;  3ERS X;  4B3M Q;  3T1H L;  3IL8 A;  5EBD A;  5EQ0 A;  4A3L H;  1NY4 A;  2NUC A;  1BF4 A;  5IGB A;  4DV1 L;  1CUK A;  2J0T D;  4OGQ C;  2ZTD A;  4X3S A;  4DV7 Q;  3EQL C;  3NTH A;  1WI5 A;  4YCU A;  1IL2 A;  1K9M C;  2YU9 B;  1NUC A;  2ZJR A;  5C0X H;  3BDC A;  2EYJ A;  3TS2 A;  4KY7 A;  1H9S A;  2Q2I A;  3X3M A;  4JI1 L;  1EY9 A;  1SFO B;  1LTG D;  1NJI C;  3OMC A;  2YU9 H;  1D7Q A;  1IKL A;  1LT4 D;  1PTO F;  1S4Z A;  1F2Y A;  4ZCK A;  5DAU A;  4DAP A;  3VYR A;  1RL2 A;  2IX3 A;  4LF6 L;  4ME5 A;  3T13 A;  4MN3 A;  1SFO H;  1CM9 A;  3KJP A;  2NVT B;  1A6X A;  1I5F A;  3BYT B;  3PUV A;  1Z6H A;  1Z9F A;  4B3S L;  1RTO A;  4B08 A;  3Q0A A;  3MHB A;  5A2Q L;  5KIX A;  2EOT A;  2QF7 A;  1VQO A;  1U4P A;  3KDF B;  3NQT A;  2KOL A;  2NVT H;  2B63 G;  2EVB A;  4QUC A;  2FHT A;  5GRO A;  1Q7Y C;  3KLR A;  2VUM B;  5LMN L;  1PXU A;  4OX9 L;  1CFM A;  1HA6 A;  1V9P A;  4L5Q A;  2EYH A;  5HUR A;  3DM1 A;  4DV6 Q;  3HOZ G;  4P75 A;  3FRP B;  2CQA A;  2E2I B;  5J22 A;  2Q8I B;  1SN8 A;  1U5K A;  2VUM H;  4IJH A;  3PGZ A;  1PLF A;  3K0X A;  1E0B A;  4F8M A;  2NZ1 D;  1T9H A;  3TRE A;  2E2I H;  3BVG A;  1HHV A;  3VYS A;  1N8R C;  4FP5 D;  1GUN A;  3MXU A;  3CCL A;  1HUN A;  5JJZ A;  1EYG A;  1PH3 A;  1ASY A;  2VW9 A;  2KEE A;  2PCF B;  4JK1 C;  3MFY A;  4JYA L;  1PVO A;  2VB2 X;  2RF4 A;  3URY A;  2R92 G;  1K8M A;  5C0X I;  5CV7 A;  3IRB A;  1H9R A;  4DUZ Q;  1PHJ A;  4CKE A;  2IY5 B;  1TXY A;  1SNM A;  4JBK A;  2EDG A;  3H6M A;  1OXV A;  2ICE C;  4K8I A;  4EQ5 A;  1O7Y A;  2L5T A;  4A3C H;  1XXG A;  2F03 A;  4XQN A;  1GOZ A;  3BYY B;  5ELF A;  4DK1 A;  4MHE A;  4IUN A;  4BBS G;  3K5M A;  3OYY A;  1F9R A;  2WB1 G;  1DZ1 A;  2D5D A;  2NZH A;  4JPB W;  3GD7 A;  3MVV A;  1S5E D;  4NPS A;  4HJ5 A;  1WTX A;  1TWC B;  2O5I C;  4YWM A;  3F2B A;  3S1M B;  1HPC A;  2A6E D;  2PZT A;  1G29 1;  1XTC D;  3SHL A;  5JEA G;  5C3X A;  2LXK A;  3HOZ B;  3KUP A;  3J81 E;  1FD7 D;  1CZG A;  1Q1B A;  3F1Z A;  4HIK A;  1JT8 A;  1TWC H;  2ZXP A;  3NBH B;  3S1M H;  3T1H Q;  5CYU A;  2HQE A;  1A3T A;  1G6Z A;  1QUQ A;  5CV8 A;  2EZV A;  5ELE A;  3PUW A;  4BA1 I;  2LSS A;  3NBH A;  4KTA A;  1R4Q B;  4DV1 Q;  2Z1C A;  1WTO A;  2D62 A;  3HKZ G;  1H95 A;  5DLQ E;  4JI0 L;  2NYZ D;  5JEA J;  3G6J B;  1EIG A;  1Y8O B;  1SRO A;  3J81 c;  4X62 L;  1GUW A;  5JAV A;  5IYC G;  1O7L A;  1XTD A;  1YNN D;  4P2C B;  4JI1 Q;  4JI3 L;  4UP9 A;  2R3Z A;  3RLF A;  1G51 A;  1PH5 A;  4EGV A;  1JOQ A;  1RTN A;  1V1P B;  1JQY D;  5C3W A;  3PSI A;  2K33 A;  4K14 A;  4PQX A;  1Q8I A;  2IX0 A;  4LF6 Q;  2HHH L;  1SE8 A;  2IHE A;  4LJZ C;  1Q46 A;  3CRL C;  1BBU A;  3OIP A;  3PO2 B;  4NXN Q;  5DM7 3;  1C48 A;  1D1K A;  2AWO A;  5LL6 X;  4BBS B;  4IPC A;  2X69 A;  2WB1 B;  3GQB A;  2H5X A;  4B3S Q;  3EN2 A;  3GO5 A;  4A3J G;  4NKL A;  4HAE A;  2CVR A;  3RN2 A;  2N49 A;  4TKO B;  1W2B A;  1ICW A;  3PO2 H;  3LGJ A;  3G7L A;  3TQY A;  4POF A;  2MQH A;  4KKU A;  5LMN Q;  1M90 C;  1SYG A;  4DN4 M;  1TS4 A;  4LF5 Q;  4OX9 Q;  4DV2 L;  1B50 A;  1FNV A;  2WP8 J;  5BN4 A;  4KD3 A;  2ASB A;  5E3F A;  1QE6 A;  1S5B D;  4IUU A;  1A15 A;  1KAB A;  3L9A X;  1JCK B;  2KCN A;  1VQ5 A;  4KN4 C;  5CBA E;  2UXC L;  3I3C A;  3SXH A;  5C3E G;  1E24 A;  5GAG C;  3HKZ B;  4GOP C;  4DK3 C;  1PDQ A;  4IUQ A;  3CPF A;  2XWB B;  3A8I E;  2AUK A;  3FP9 A;  4V0B A;  2B2U A;  3NUC A;  4ZKB B;  2F0S A;  5I2Y A;  4GKJ L;  1E2Z A;  2QCP X;  1KNE A;  4JYA Q;  4EQP A;  1K3B C;  4JBW A;  4IUP A;  1FGB D;  3BS1 A;  2RSN A;  1I6H B;  3WDN A;  3TP8 A;  1QB5 D;  3KOJ A;  2DUD A;  4ZRZ A;  1PRT B;  2DNE A;  3E6Z X;  2A68 C;  1AEX A;  3I91 A;  2L4N A;  4BY7 B;  3H3V C;  3I4O A;  1BR9 A;  1Y14 B;  3S1Q B;  3K59 A;  3FEW X;  1I6H H;  2PQA B;  4A3J B;  2H4O A;  2WKC A;  4I7Z C;  4A4I A;  1N34 Q;  4BY7 H;  1X3E A;  3GV6 A;  2JN4 A;  3S1Q H;  1HR0 W;  3K80 C;  5IYD G;  5K36 H;  2M00 A;  3VR6 A;  4A3J H;  3SK4 A;  1ILP A;  1ET9 A;  4APV A;  4IUR A;  5JPM C;  1UWV A;  1QZH A;  5IY0 A;  1Z7T A;  2PI2 E;  5EPK A;  1AW7 A;  3T51 B;  4I7A A;  1W6K A;  1NNX A;  2UU9 L;  2B2W A;  5C3E B;  1Y1V B;  5IP9 G;  1MJE A;  1Y8N B;  3A56 A;  2KCC A;  2X6L A;  1STE A;  2AHO B;  4IOC A;  4XDX A;  1NMF A;  2I5M X;  5C3E H;  1LTS D;  1Y1V H;  2DN8 A;  3OMG A;  4DR5 L;  4JI3 Q;  2HIV A;  1PRT D;  1V1Q A;  2B3G A;  2K05 A;  2KEN A;  4NW2 A;  2RDF A;  1V43 A;  5ELB A;  5IT9 L;  3MZ5 A;  3L0O A;  4RHS A;  1QZG A;  3DWA A;  2HHH Q;  3D4R A;  3JAM E;  1XNQ L;  1STH A;  1J8I A;  4RG1 A;  1HCZ A;  2VXW A;  4G7O C;  1WJJ A;  4LFB L;  1VCI A;  1B7Y B;  5EPJ A;  1K3R A;  4MZ9 A;  4XTC S;  4A3D B;  1TU2 B;  1Q81 C;  5E4W C;  1QVG A;  2PMZ B;  4LK1 C;  1VF5 C;  2WIN B;  4DV2 Q;  3RZO B;  3JAM c;  4A3D H;  4DV0 L;  4LMQ D;  3BVZ A;  1B3Q A;  4R9W A;  3CKI B;  1EU3 A;  1VQL A;  4H7B A;  3J80 i;  4LAA A;  3RUZ A;  1SAP A;  1VQI A;  4XT3 B;  1JWU D;  2L0C A;  2UXC Q;  3KF6 A;  3RZO H;  2EY5 A;  5M3M G;  1AH9 A;  4A3F B;  3R3O A;  1X9N A;  4LFA L;  1AP0 A;  3M4Y A;  4MIU A;  4LF4 L;  1F2Z A;  3S24 A;  1LAC A;  2WAQ G;  2E5L Q;  2IW3 A;  3E0E A;  2KHI A;  3SGI A;  5IP9 H;  4GKJ Q;  5JJL A;  3I55 A;  1AN8 A;  3K57 A;  4A3F H;  5FJ8 G;  1PFN A;  3TME A;  1K0R A;  1LTR D;  1A0I A;  4L5R C;  4RCO A;  2R7Z G;  2EXZ A;  4RHR A;  3RD4 A;  5KNB A;  1U0L A;  4JVZ A;  1BDO A;  1A3V A;  1Y69 U;  5IGD A;  1KLU D;  3HKS A;  2UXD L;  1ENF A;  4V19 0;  3SR1 A;  1EIF A;  4UDU C;  2VZA A;  4RMF A;  4DR4 L;  4IOA A;  3S14 B;  4E6I A;  4JI4 L;  5I9P A;  1R9T B;  1N33 L;  3EBE A;  2BA0 A;  4QB4 A;  3U50 C;  1C7Y A;  2L9H A;  3G4S A;  1ASZ A;  1NR4 A;  1JOO A;  5FO8 B;  4KKT A;  4A3I B;  1WTP A;  1HQR D;  1XWE A;  4JI2 L;  5EBC A;  3S14 H;  1R9T H;  4TQU S;  5AFW A;  3OIQ A;  4C56 C;  3Q6S A;  4A3I H;  5C4J B;  4BA2 I;  5ELN A;  4LF9 L;  4JBM A;  2KVM A;  1HR0 L;  3OPO A;  1JWS D;  2QDL A;  4U68 A;  2K4K A;  3K8A A;  1G91 A;  4X64 L;  4BBR G;  4PV1 C;  4IPH A;  3PUZ A;  3L2P A;  1QVF A;  2XSC A;  1IHZ A;  2F0J A;  5C4J H;  3J7A 5;  4G57 A;  1CT1 D;  2C35 B;  4QL5 A;  5M5W B;  1WTH A;  2CFM A;  4F7X A;  1PH7 A;  3CCJ A;  1JC7 A;  1CA6 A;  4DR5 Q;  1PZK D;  5IGG A;  3HS0 C;  3FPU B;  2B8F A;  4PNY A;  5COR A;  4DV7 L;  3BDL A;  1G6P A;  5M5W H;  1GKH A;  1HRJ A;  4GN4 B;  2UUA L;  5FJ8 H;  3CCV A;  2Q2U A;  5IOC A;  2B2U C;  1LO5 D;  3AFQ A;  1XNR Q;  1QJO A;  1BUV T;  1A8V A;  4WJW A;  4AIM A;  2NN6 G;  3PIO 3;  4LFB Q;  4H13 C;  1I4G A;  5A2Q E;  1M8A A;  2E2J B;  3DWQ A;  4PZ7 A;  3TRZ A;  4JCV E;  2F4V L;  1Q8K A;  2VNU D;  3MXN B;  2XRS D;  4L6T B;  5CV5 A;  3OW2 A;  2Q8R E;  1Y1W G;  1KDB A;  1UAP A;  1HH2 P;  2F0Q A;  3UDX A;  3CP0 A;  4IZ8 A;  4O0A A;  2E2J H;  1QNU A;  4JW0 A;  1EY0 A;  1MGS A;  4DV0 Q;  3ULP A;  1D8L A;  4O42 A;  4C1N I;  1GHJ A;  4Y7N B;  4J1M A;  4QJF A;  4OO1 H;  2QKI C;  2RDG A;  5T1I A;  1D5Z C;  1XPR A;  4BBR B;  4J15 A;  2PI2 A;  1RHP A;  2K5D A;  4KHP L;  4A3L G;  4C2M H;  2ID0 A;  4LFA Q;  2F0F A;  3SDZ A;  1FL0 A;  4LF4 Q;  1BBW A;  2EPB A;  3U9O A;  4BBR H;  1MD2 D;  4GNX C;  2V1C C;  5H1S E;  2WKD A;  1CI3 M;  2B39 A;  3MXP A;  5E4X A;  4M8A A;  3C46 A;  4AYB B;  2B2W C;  1SJE D;  4QGU A;  4RCN A;  3RN5 A;  1ZEQ X;  2Z9H A;  1SE2 A;  2K5V A;  1H9M A;  1PFB A;  5IYB H;  2KEC A;  2F3W A;  4DK0 A;  1YIJ A;  2UXD Q;  3I4L A;  3OWE B;  4GS3 A;  4DR4 Q;  5C0X J;  1NR2 A;  4JI4 Q;  1EWH A;  4DUZ L;  1CKO A;  4MTK A;  2HDM A;  4OEL B;  3CU7 A;  4QQB X;  5C5M A;  3KJO A;  3V96 A;  2MP1 A;  1SMY D;  2RVL A;  1H9J A;  1Y1W B;  1EQV A;  2NN6 H;  4LFC Q;  2ZXO A;  4FDB A;  3PUY A;  2PNR C;  4KMU C;  1N32 L;  1HXY D;  2J7Z A;  3VR2 A;  3NSW A;  1QOH A;  2K03 A;  3DEP A;  2ZT9 C;  4FF2 A;  4HCS A;  1SYF A;  4LF9 Q;  4GKK L;  4WJ3 M;  2LXJ A;  1HR0 Q;  2NBF A;  4GOP A;  1DON A;  4DV4 Q;  4X64 Q;  1E1T A;  1GUO A;  2WII B;  4XYO A;  2JQO A;  3PF4 A;  2OTL A;  4FYD A;  1I4X A;  1S72 A;  1X3F A;  3E5S A;  2A6H C;  5KRU A;  4UPA A;  2K5Q A;  4G7H C;  3U4Z A;  2MO1 A;  4K6L A;  1IYJ B;  2G5D A;  1HJP A;  4IO9 A;  1PH2 A;  1H9S B;  4LWC A;  2OQK A;  2RA4 A;  1K8G A;  2NZO A;  2UUA Q;  4R4I A;  3K5N A;  1YNJ C;  3M7N A;  1ENC A;  2Y0S B;  1Q82 C;  1C9O A;  2QEX A;  3EA6 A;  3S15 H;  3U58 A;  1XJV A;  1F9Q A;  4A3C G;  1EZ8 A;  5FLM G;  1FNU A;  4QIW B;  1L1O A;  3PUX A;  3J80 E;  4NDX A;  2F4V Q;  1PZJ D;  4KV6 A;  1OXU A;  2L1B A;  1EFW A;  4EX5 A;  3H0G B;  1MJC A;  4NXN L;  1JWM D;  2PW5 A;  2B2Y A;  3RLO A;  4A93 G;  2M2L A;  2F0U A;  1ZXT A;  2NN6 I;  1LTI D;  1VQA A;  1BNZ A;  4P73 A;  2ATW A;  3C1F A;  1HZB A;  2JA5 B;  4DR1 L;  3H0G H;  2OEO A;  1CZW A;  1K0S A;  4LF5 L;  4KHP Q;  1KDA A;  4GZY C;  1F2M A;  1LUZ A;  2I07 B;  2KHJ A;  1P16 A;  2JA5 H;  5M5X H;  4OWT B;  1BCP F;  3STB C;  1MKH A;  1DJR D;  2FFK B;  4JV5 L;  2AQ1 B;  2EQS A;  3QIA A;  3VYT A;  2HDL A;  3I2Z A;  1GJX A;  4C3I H;  3GP7 A;  5BR8 L;  1ICF B;  2DJG C;  3F2C A;  3CRK C;  2I46 A;  1OTC A;  2CKZ B;  1JIC A;  1I4P A;  4OXP A;  3I56 A;  2R6G A;  1MSH A;  1NE3 A;  2TSS A;  1KRS A;  1Y8P B;  4DNR B;  3BZK A;  1VF7 A;  2LKV A;  1A3U A;  1SYC A;  1ZYR C;  2PYK A;  4YCW A;  5DEH A;  4LF7 Q;  4GLV B;  5IE8 A;  3C1E A;  1NBW A;  1E2W A;  1TWH B;  4OWX B;  4RGO S;  4WRD A;  2F1M A;  3W5O A;  1CQV A;  4IFD H;  5FLM H;  4P71 A;  2DY8 A;  4TSS A;  3AEV A;  3PIO A;  3PO2 G;  1HTL D;  1SSO A;  4NB3 A;  3SE0 A;  3S1R B;  1VQM A;  1EY8 A;  1N32 Q;  1GXD C;  4XYQ A;  1TWH H;  4A93 B;  1LV9 A;  1OXX K;  2BDO A;  3A55 A;  2F52 A;  2F0I A;  3CC7 A;  1YIT A;  3P75 A;  1N34 L;  2EYM A;  3CW2 C;  4P72 A;  3NEN A;  4GKK Q;  2MO0 A;  4DPG A;  2B2T A;  3S1R H;  5CGK A;  5M5Y B;  1RKN A;  1PV4 A;  4A93 H;  3NWT A;  2K75 A;  1X3P A;  2GVA A;  1H9K A;  5FLX L;  1LTB D;  1QUQ B;  3T4A C;  2GN5 A;  4DNI A;  3I70 A;  2J4X A;  2K14 A;  1G8Z D;  4KK7 A;  3N6R A;  5KND A;  2H1E A;  4JC0 A;  1CTM A;  2A5H A;  5M5Y H;  4XIG S;  1HFG A;  1B2T A;  4DR3 Q;  4FNF A;  3TP7 A;  2BH8 A;  2CW0 C;  2KA7 A;  4FO2 A;  1KDC A;  4ZK9 B;  1KAA A;  4R1J A;  5IT9 E;  1OXT A;  2KQ3 A;  3A0J A;  1STY A;  4DR2 L;  1E3P A;  1EFI D;  2XN9 C;  1N36 L;  2VQF L;  3TZU A;  1PTO C;  3CCQ A;  1IZ6 A;  4QUF A;  4OIJ A;  4K2K A;  5C6A A;  4KLK A;  5GAD C;  5ELO A;  4B9X A;  5KYL A;  1QNK A;  2IJ0 A;  4MTN A;  1AZQ A;  4KY5 A;  5IT9 c;  2F0D A;  1O7Z A;  4BY7 G;  2HQL A;  3DEO A;  1CA5 A;  1M1K C;  3A5Z B;  3NHH A;  4ILW A;  5K36 G;  2UUC L;  3V2T A;  2QDB A;  4R4T A;  2YV5 A;  3J80 L;  2WFW A;  2E8G A;  1DOM A;  1LTT D;  4HR7 B;  5J1Z A;  4DR1 Q;  4RKL A;  2KHS A;  2RBM A;  5BN3 A;  3E9I A;  1TS3 A;  3CAM A;  4X3K A;  1DXM A;  4R4O A;  4K2L A;  2QIL A;  1KXL A;  4H44 C;  1STG A;  1TKW B;  5K5P A;  2SDF A;  5EKL A;  1CSQ A;  5FO7 B;  4JV5 Q;  4ZLT F;  3SEB A;  2JA8 G;  2DGY A;  3HG9 A;  3GTQ B;  1CHQ D;  1CKM A;  1GUS A;  3SK8 A;  2LMC B;  1Y1V G;  5BR8 Q;  2N8N A;  1R4P B;  4ALP A;  1PH1 A;  1J9O A;  1UEA B;  4HMI A;  4X6A H;  2E5L L;  4DA2 A;  3GTQ H;  4L5T A;  3W2D A;  4LNQ A;  3P20 A;  4QCL A;  1O80 A;  4KHZ A;  2AUJ D;  4ZKC B;  1L0X B;  2NTS A;  1A62 A;  2OF1 A;  3QOJ A;  3LX0 A;  2DY7 A;  3GTL B;  5I4D A;  2JXM B;  1LTL A;  4DF7 A;  2HT1 A;  1WD1 A;  5LHY 1;  1B9N A;  1IW7 C;  2OQ0 A;  3OHX C;  1E1O A;  4FXG C;  2WAQ E;  1KIX A;  1VQ7 A;  3AFP A;  1YHB A;  5JPN C;  3DLL A;  3GTL H;  1JJC B;  4B9W A;  1ML0 D;  4MNO A;  4A3D G;  3EJI A;  2YYZ A;  4A3G G;  1DOL A;  1X54 A;  2XVS A;  1L1O C;  5LMU Q;  2K50 A;  2P5Z X;  3G71 A;  4BS9 A;  1C0A A;  4GNX A;  4NXM Q;  2HUG A;  4PZ8 A;  2B2Y C;  2RCF A;  3IFT A;  2HD3 A;  2EYF A;  4R8I A;  3M4P A;  2JA8 B;  1PH4 A;  4K0K Q;  3NPP A;  1PYW D;  3L3O C;  4DAM A;  1KNA A;  2PZU A;  4A3F G;  2OTJ A;  1XMO L;  3S1N B;  4N9P A;  4DR2 Q;  1KTK A;  2XGT A;  3HRZ C;  2QGQ A;  2JA8 H;  1N36 Q;  2VQF Q;  3GTO B;  2AQ3 B;  1STB A;  3HP3 A;  1QCB D;  2ZTC A;  1WOC A;  3S17 B;  1HZC A;  1TR5 A;  1TT2 A;  5CR3 A;  1N9W A;  1Q12 A;  3NP8 A;  2JYO A;  1EIH A;  2NVQ B;  3S1N H;  1EY4 A;  3EFX D;  2NVY B;  3ULJ A;  2JA6 H;  3GTO H;  2F4I A;  3ERO A;  4IUV A;  5FOB B;  2K28 A;  2KCT A;  3AB9 A;  1ILQ A;  4IPD A;  5TSS A;  3S17 H;  2V4D A;  1XNR L;  2NVQ H;  2TMP A;  4YY3 L;  1LYL A;  2PW7 A;  1DOK A;  2DJF C;  2NVY H;  2UUC Q;  1TY2 A;  1UEB A;  4FF3 A;  1MSG A;  3EIV A;  1CSP A;  1RCV D;  1HTP A;  4A3G B;  2E2H B;  4L5S A;  1QIL A;  3UE0 A;  3TBI B;  4QF4 A;  2GA4 B;  2OCE A;  4A3I G;  2I5H A;  3HOY H;  1U4M A;  1IYV A;  5T1G A;  3K7A B;  2AKW B;  4Q0F A;  4ID6 A;  1FJG Q;  3M7G A;  1S5D D;  3KF6 B;  1TY0 A;  2CH4 W;  2E2H H;  4A3G H;  3X3N A;  3NK9 A;  3KBX A;  1NAP A;  1I50 B;  1HZA A;  5EAY A;  2EYL A;  1O7I A;  3K7A H;  2CWP A;  3T16 A;  3D8G A;  4J6H A;  2RQX A;  4ME3 A;  1RDP D;  1SMX A;  2B2T C;  2K04 A;  4LF8 Q;  4FF1 A;  3CQZ H;  3PIP 3;  1EZ6 A;  2YTV A;  4JI7 L;  4RWS C;  1I50 H;  4JOI A;  1IYU A;  1EQT A;  4Q5V A;  1C8C A;  4DXF A;  1I6V C;  5AJ3 L;  4JI8 Q;  2BA1 A;  1TWA B;  2K5W A;  2JP1 A;  4CBV A;  2JA7 H;  1HA5 A;  3BJU A;  1PRT F;  1IKM A;  3M9B A;  2Z4H A;  4HJ8 A;  1TWA H;  1I4R A;  3J7Y W;  2MJ8 A;  5BN5 A;  1KHI A;  2VQE L;  1K8A C;  5JVG 3;  2KED A;  2RHQ B;  3BZD B;  3TSS A;  4DK6 C;  2EYO A;  4CDE C;  1X56 A;  3MWY W;  2A6H D;  1BO0 A;  1V1O A;  2F3V A;  4JG2 A;  4LFC L;  3I4M H;  1SBB B;  4OO1 G;  3KF8 A;  1D5M C;  3SK5 A;  2HIX A;  1YNJ D;  2QEJ C;  4I65 A;  5EKI A;  2AQ2 B;  4XQQ A;  5HGT A;  2AMC B;  2EY6 A;  2EE1 A;  3BU2 A;  4O2D A;  4DV4 L;  3FKI G;  1YVC A;  3ZJY C;  2KCM A;  1VMP A;  1K73 C;  1UE1 A;  1S40 A;  2A8V A;  2EY2 A;  1XMO Q;  1I3Q B;  1DYQ A;  1VQH A;  1EQR A;  5I9O A;  1M4V A;  1IL8 A;  4BWG B;  1L0W A;  1TII D;  5M3F B;  1PZI D;  5IYB G;  4IJL A;  1B70 B;  3I7F A;  1I3Q H;  4K5X A;  3DMU A;  4QY7 A;  3MA2 B;  4AYB G;  4X65 L;  2KUM A;  1GO3 E;  1PFS A;  3UDF A;  1PFM A;  5FKA C;  3M85 A;  5M3F H;  1GUT A;  1VQ6 A;  3KLS X;  4YY3 Q;  3G48 A;  1AFP A;  3STB D;  2O5J C;  4KHV A;  2O2L D;  3A8J E;  4UP7 A;  2BE5 C;  3J81 i;  1SNP A;  3A8K E;  1EQQ A;  5EGT A;  3ONA B;  1BBX C;  4YCV A;  1HNZ L;  4NMZ A;  3ULL A;  4CDC C;  4B3T L;  1SNC A;  2AWN A;  1CKN A;  3CCU A;  5C4X G;  1XYI A;  4C2M B;  1T5E A;  4X3T A;  1U4R A;  2CCZ A;  1ZYR D;  3ND9 A;  4A3E G;  2FMC A;  1PTO B;  3FKI B;  5L37 A;  1UE6 A;  3VDY A;  4EQO A;  3HOV B;  5C44 B;  4KKS A;  4GN5 A;  4K8J A;  3IKJ A;  3K0Y A;  4ULL A;  4JI7 Q;  1HFN A;  3VA5 A;  4HJA A;  1PTO H;  3FKI H;  2DNC A;  2F0M A;  5AJ3 Q;  4A3K B;  3CHB D;  4HN7 A;  3HOV H;  2ICI A;  5C44 H;  4GLX A;  3A54 A;  4HID A;  1U9R A;  1XPO A;  1KD1 C;  4YWL A;  3VR4 A;  3A5U A;  3U4V A;  1VQJ A;  4LUO A;  5M9O A;  2SOB A;  1Q86 C;  3UE1 A;  4CJ2 C;  4A3K H;  5D14 A;  1D1I A;  2SEB D;  2YTX A;  1LT3 D;  4XXE A;  3S2H B;  2VQE Q;  1WTQ A;  3ER0 A;  2A1A A;  4PMC A;  2Y0S G;  4LF7 L;  1EWI A;  3MFG A;  3LWU A;  1TWF B;  3PMF A;  1B4O A;  3CCE A;  4CJ0 B;  1BXT A;  4R4C A;  1W6J A;  3GTJ B;  3S2H H;  1VQ9 A;  4DR6 L;  2CW0 D;  5C4Z A;  3ZYY X;  1EOT A;  1MI2 A;  1TWF H;  4CDD C;  3D31 A;  5KGU A;  3T1Y L;  3H0G G;  5FLX E;  5C4X B;  1ENA A;  2MNA A;  3B6Y A;  4GOP B;  4BXX G;  2D2C C;  4X66 L;  1PTO D;  4FXD A;  3GTJ H;  3D6W A;  3M3Y B;  4A3E B;  4HJ9 A;  4FXK C;  3S16 B;  2JA5 G;  1OO9 B;  2F0N A;  4XQJ A;  5I2X A;  5C4X H;  1EYD A;  4OWW B;  2VB3 X;  3BDO A;  4B3R Q;  1Q3L A;  2LY7 A;  3I4N B;  4OO1 I;  3HFZ B;  2N78 A;  3P1H A;  2Z8L A;  4C3I G;  2C9O A;  4H02 A;  5FLX c;  4YHH L;  3Q24 A;  3M3Y H;  4A3E H;  2MHV A;  3HOW B;  1CK1 A;  3S16 H;  2WB1 E;  3C2P A;  2Z6K C;  4JBJ A;  3GTG B;  4DR3 L;  1I94 L;  3K81 C;  3I4N H;  2C5C A;  3K5L A;  2VS1 A;  4DAY A;  3R93 A;  3S15 B;  1VQD A;  3PIP A;  4HJ7 A;  3ITP A;  4X65 Q;  3HOW H;  5IGF A;  4KI0 A;  1PA6 A;  1BVS A;  5JVH 3;  2PNH A;  3A7A B;  3IAY A;  3H3V H;  2N88 A;  2UXB Q;  2A19 A;  3GTG H;  4LUZ A;  4ZYS A;  1L1O B;  4JOI C;  4IFD G;  1GHK A;  5KNC A;  3QO2 A;  1ONL A;  1DGS A;  5IWA Q;  2D9U A;  1LTA D;  1YBY A;  2XNA C;  3KYH C;  4F88 A;  3GDE A;  3E9H A;  1E7Z A;  1SYB A;  4PMB A;  1IBL Q;  1HNW L;  1ZKO A;  2FXQ A;  3HKZ E;  3TN2 A;  1HNZ Q;  2LS0 1;  1EEF D;  5JOB A;  4B3T Q;  4IFD J;  2F0G A;  4HSP A;  1A2T A;  4O1N A;  1X55 A;  1FYC A;  1PYB A;  4TVA B;  4IAL A;  3CME A;  2RDH A;  4DU9 A;  5M5X B;  1VQN A;  3J80 c;  5I6Y A;  3H15 A;  3M4O B;  1VQB A;  4BXX H;  3HZX A;  1X65 A;  2BDN A;  2R61 A;  4C3I B;  1B1Z A;  2A68 D;  3TP5 A;  2D0O A;  3J7A F;  5J3B A;  4YWK A;  3TZD A;  1IW7 D;  2PO4 A;  1W3S A;  2ZTE A;  3M4O H;  1PYS B;  4DV5 L;  3PF5 A;  1SYD A;  5HGQ A;  1S5F D;  1PH8 A;  2MGS A;  2FJ2 A;  2Z6B A;  3DWP A;  1X3Q A;  5KEE A;  3PV0 A;  1SJH D;  3JAM i;  1VQF A;  3RZD B;  3ERQ A;  1IBM L;  3A7L A;  3KDF A;  5D3D A;  4CHT B;  5IP7 H;  1DD2 A;  4ZQ3 A;  1UNS A;  5JJI A;  1B53 A;  1EU4 A;  2UUB L;  1QVC A;  3UI2 A;  1EOV A;  3RZD H;  2BH2 A;  3H3V I;  1XPU A;  1WFQ A;  1JR0 D;  2B29 A;  5IOD A;  2FIN B;  1S5C D;  2IT1 A;  4PG3 A;  3OOC A;  4DR6 Q;  1I4Q A;  1LT5 D;  5I6W A;  1K83 B;  5EPL A;  4IPG A;  3T1Y Q;  1UE5 A;  5GAH C;  4C1N K;  3Q8D A;  4N9T A;  4DV3 L;  1KL9 A;  4BY1 G;  2RCN A;  2RHS B;  3CF5 A;  4X66 Q;  1VQ8 A;  3DHQ A;  1I4H A;  2NB0 A;  4ZUJ A;  3L7Z C;  5D3I B;  2XRQ D;  3PO3 G;  2GVB A;  2KBN A;  3UDI A;  1K83 H;  5LMU L;  5JJK A;  1VS0 A;  1AZP A;  4YHH Q;  1EIY B;  4NXM L;  4DUY L;  1D2B A;  1PH9 A;  3CPW A;  3NE5 B;  4POG A;  4K0K L;  1I94 Q;  1EYC A;  3R8B A;  2B63 B;  1VMC A;  3NWS A;  2ZXR A;  4OIK A;  1SNO A;  1Z47 A;  2BCO A;  4KY6 A;  2PMZ E;  1SEB D;  2R7F A;  4AQY L; 
#chains in the Genus database with same CATH homology
 1TQO A;  2JSO A;  3NQI A;  4KN7 C;  4RA8 A;  1OXS C;  1SMY C;  5IIF A;  1BOS A;  3R2I A;  2X6G A;  1ESF A;  1TWG B;  5C5L A;  3F2U A;  3NTK A;  2K7V A;  4FF4 A;  4HED A;  2B2V A;  2BOS A;  4BY1 B;  4IFD I;  4DGZ A;  2R92 B;  1L0Y B;  1LAB A;  4IQZ A;  3Q23 A;  3PO3 B;  3DXJ C;  2A69 C;  1EY7 A;  3AU7 A;  3D3R A;  2JEA I;  3AMU A;  1BCP C;  3DUZ A;  1VDZ A;  1V1P A;  4WFN 3;  4RKB A;  5ELD A;  5IGC A;  1F77 A;  2IL8 A;  1T5X D;  1NCV A;  3OSO A;  2HCC A;  4X3U A;  2MUY A;  3I73 A;  2IPK D;  3MXG A;  1RF2 D;  4L63 B;  2E76 C;  1NSN S;  3D6C A;  3EVQ A;  4KD4 A;  2KJX A;  3J7A V;  5COY A;  3QJY A;  5JEA H;  5CV9 A;  4ODG A;  4U67 3;  4IUT A;  2A74 C;  1A2U A;  4G7Z C;  4S3S A;  1EYA A;  4K5W A;  3FDT A;  1JOK A;  4RGT A;  1PMR A;  2EY1 A;  3TP6 A;  1E2V A;  3SVM A;  3I8Z A;  2M9V A;  3BG3 A;  3MC0 B;  2R93 B;  2L55 A;  4ABN A;  4RH6 A;  4WOR A;  2EJF C;  3K5O A;  1C4Q A;  1II3 A;  1G2T A;  1V8Q A;  1SND A;  4HCE A;  3QG1 A;  2CHB D;  2F0E A;  2JE6 I;  5ELC A;  2F0W A;  2EJM A;  3KLS A;  1HQM C;  3NTI A;  2RKS A;  2NTT A;  3QOL A;  3D4W A;  4NP5 A;  1JOR A;  4R8N A;  1TS5 A;  2IX1 A;  2BE5 D;  3OWF A;  3S9W A;  3LWE A;  2NWG A;  2JA6 B;  1STN A;  1EL0 A;  3I72 A;  4CJ1 B;  2G9H D;  3MEH A;  1QG7 A;  1QWY A;  5IGE A;  4J8Q A;  1G2S A;  2SNS A;  3HEJ A;  1B3A A;  2F0O A;  4DFA A;  3J81 L;  3H94 A;  1SXT A;  3HOY B;  3LNN A;  1WCM B;  5CMD A;  4C3J G;  4PMW A;  2A6E C;  4KJO A;  2NVX B;  2OXP A;  1XX8 A;  2FMM A;  5KYI A;  2EJG C;  3Q22 A;  3NBI A;  5E1F A;  4A3B B;  3HOX B;  1STA A;  4RFB A;  3U9S A;  3CQZ B;  4RAU C;  5J39 A;  4KJN A;  4CKB A;  4XT1 B;  4CKC A;  2O4X A;  3O13 A;  2F0P A;  3BVM A;  1SYE A;  5F2D A;  1F9S A;  3TDQ A;  2JA7 B;  1HUM A;  3C3L A;  1YNN C;  5DM6 3;  4EVO A;  1SDF A;  2PQE A;  2IWH A;  1CQF A;  4K6D A;  2PPB C;  3MTS A;  3MAQ A;  1SNQ A;  2F0L A;  1LT6 D;  2SNM A;  3FMC A;  2K32 A;  2Q8T A;  2OT2 A;  2E74 C;  2PZW A;  5CC4 A;  3W3A A;  2LFN A;  3I4M B;  5CBE E;  3ND8 A;  4C3J B;  1RD9 D;  1O78 A;  3D4D A;  4IN3 A;  2L12 A;  2XIW A;  1WTR A;  3FVQ A;  4DAV A;  3S2D B;  3SK6 A;  2ENB A;  3GTP B;  1CHP D;  1FR3 A;  1UUP A;  3V05 A;  1BQQ T;  2B8G A;  4RGM A;  2G9D A;  2B2V C;  4TRD A;  4RGN A;  5FK9 C;  4OHJ A;  1FNW A;  4H0L C;  4M1U B;  4DXG A;  4C3H G;  4EQN A;  1ESR A;  4A3M B;  2JEB I;  3VR5 A;  4HMJ A;  3QWN A;  3GTM B;  5CV6 A;  2XWJ B;  1ET6 A;  1ROD A;  1U4L A;  4K5V A;  1JB3 A;  3QB3 A;  1WD0 A;  2Z4I A;  2F0T A;  5LL6 S;  2K01 A;  4F87 A;  5M3M B;  1X32 A;  2A73 B;  1EEI D;  2WAQ B;  5A35 A;  1LLR D;  1EY6 A;  3GTK B;  1DM0 B;  1JE4 A;  2K1B A;  3KBG A;  5D65 A;  1TVX A;  2R7Z B;  1WTW A;  2K6A A;  2WAC A;  2E75 C;  3HGB A;  4Z9C B;  1F9P A;  3WOE A;  1EWC A;  5G3L D;  4ZAI A;  3H09 A;  4CGY B;  4ZUI A;  5ISR A;  3K6O A;  4C3H B;  3IFD A;  2RSO A;  4HTH A;  3VR3 A;  3OW7 A;  1B44 D;  1D5X C;  3JAM L;  1K8O A;  3MXN A;  1PRT C;  3E0J A;  2E2D C;  4DNT B;  3NXW A;  4QMG A;  2N55 A;  1SE3 A;  5EKK A;  1WTV A;  3I90 A;  4UAI A;  3VYU A;  1BCP B;  2WV6 D;  5C0X G;  1F2L A;  1GUG A;  4YIJ A;  1D6E C;  3K58 A;  1MBY A;  3RMH A;  4OL7 A;  4L8J A;  3T53 B;  1EY5 A;  5G3L F;  1Q90 A;  5NUC A;  3N52 A;  1B9M A;  2MPM A;  4FVM A;  3R2T A;  3VA7 A;  3HOU B;  1RJT A;  1TS2 A;  4G4K A;  3KK7 A;  5DNF A;  2F0K A;  2EYP A;  3H91 A;  5CV4 A;  2F0H A;  5EJW A;  3WOF A;  2F0V A;  4HSV A;  1Q1E A;  5FO9 B;  2HCI A;  3GV3 A;  2L11 A;  2A69 D;  1DCZ A;  3FPP A;  1SE4 A;  1BCP D;  1WVL A;  1KLG D;  3P7J A;  3T56 B;  5C4H A;  3IL8 A;  5EBD A;  5EQ0 A;  2NUC A;  1BF4 A;  5IGB A;  2J0T D;  4OGQ C;  4X3S A;  3EQL C;  3NTH A;  2YU9 B;  1NUC A;  5C0X H;  3BDC A;  2EYJ A;  4KY7 A;  1H9S A;  3X3M A;  1EY9 A;  1SFO B;  1LTG D;  3OMC A;  1IKL A;  1LT4 D;  1PTO F;  1S4Z A;  1F2Y A;  5DAU A;  4DAP A;  3VYR A;  2IX3 A;  4ME5 A;  3T13 A;  4MN3 A;  1CM9 A;  2NVT B;  1A6X A;  3BYT B;  3PUV A;  1Z6H A;  1RTO A;  4B08 A;  3Q0A A;  3MHB A;  5A2Q L;  5KIX A;  2EOT A;  2QF7 A;  1U4P A;  3NQT A;  2KOL A;  2EVB A;  4QUC A;  2FHT A;  3KLR A;  2VUM B;  1PXU A;  1CFM A;  1HA6 A;  2EYH A;  5HUR A;  3DM1 A;  3FRP B;  2CQA A;  2E2I B;  5J22 A;  2Q8I B;  1PLF A;  1E0B A;  4F8M A;  2NZ1 D;  3BVG A;  1HHV A;  3VYS A;  4FP5 D;  1GUN A;  3MXU A;  1HUN A;  5JJZ A;  2KEE A;  2PCF B;  4JK1 C;  3MFY A;  2VB2 X;  3URY A;  1K8M A;  5C0X I;  5CV7 A;  1H9R A;  4CKE A;  1SNM A;  2EDG A;  3H6M A;  1OXV A;  2ICE C;  4K8I A;  1O7Y A;  2L5T A;  1XXG A;  2F03 A;  4XQN A;  1GOZ A;  3BYY B;  5ELF A;  4DK1 A;  4MHE A;  4IUN A;  3K5M A;  1F9R A;  1DZ1 A;  2D5D A;  3GD7 A;  3MVV A;  1S5E D;  1WTX A;  1TWC B;  2O5I C;  3S1M B;  1HPC A;  2A6E D;  2PZT A;  1G29 1;  1XTC D;  3SHL A;  5JEA G;  5C3X A;  3HOZ B;  3KUP A;  3J81 E;  1FD7 D;  1CZG A;  1Q1B A;  2ZXP A;  5CYU A;  2HQE A;  1A3T A;  1G6Z A;  5CV8 A;  2EZV A;  5ELE A;  3PUW A;  4BA1 I;  3NBH A;  4KTA A;  1R4Q B;  2Z1C A;  1WTO A;  2D62 A;  2NYZ D;  5JEA J;  3G6J B;  1EIG A;  1Y8O B;  1GUW A;  5JAV A;  1O7L A;  1YNN D;  4P2C B;  2R3Z A;  3RLF A;  4EGV A;  1JOQ A;  1RTN A;  1V1P B;  1JQY D;  5C3W A;  2K33 A;  4K14 A;  4PQX A;  1Q8I A;  2IX0 A;  4LJZ C;  3CRL C;  3OIP A;  3PO2 B;  5DM7 3;  1C48 A;  1D1K A;  2AWO A;  5LL6 X;  4BBS B;  2X69 A;  2WB1 B;  3GQB A;  3GO5 A;  4NKL A;  4HAE A;  2CVR A;  4TKO B;  1ICW A;  3G7L A;  4KKU A;  1SYG A;  4DN4 M;  1TS4 A;  1B50 A;  1FNV A;  2WP8 J;  5BN4 A;  4KD3 A;  5E3F A;  1QE6 A;  1S5B D;  4IUU A;  1A15 A;  1KAB A;  3L9A X;  1JCK B;  2KCN A;  4KN4 C;  5CBA E;  3I3C A;  3SXH A;  3HKZ B;  1PDQ A;  4IUQ A;  2XWB B;  3A8I E;  2AUK A;  4V0B A;  2B2U A;  3NUC A;  4ZKB B;  2F0S A;  5I2Y A;  1E2Z A;  2QCP X;  1KNE A;  4EQP A;  4JBW A;  4IUP A;  1FGB D;  3BS1 A;  2RSN A;  1I6H B;  3WDN A;  3TP8 A;  1QB5 D;  4ZRZ A;  1PRT B;  2DNE A;  3E6Z X;  2A68 C;  1AEX A;  3I91 A;  2L4N A;  4BY7 B;  3H3V C;  1BR9 A;  3S1Q B;  3K59 A;  3FEW X;  4A3J B;  2H4O A;  2WKC A;  4I7Z C;  3GV6 A;  5K36 H;  2M00 A;  3VR6 A;  3SK4 A;  1ILP A;  1ET9 A;  4IUR A;  5JPM C;  1Z7T A;  5EPK A;  1AW7 A;  3T51 B;  1W6K A;  2B2W A;  5C3E B;  1Y1V B;  1Y8N B;  3A56 A;  2KCC A;  2X6L A;  1STE A;  4XDX A;  1LTS D;  2DN8 A;  3OMG A;  1PRT D;  2K05 A;  4NW2 A;  2RDF A;  1V43 A;  5ELB A;  5IT9 L;  3MZ5 A;  4RHS A;  3DWA A;  3D4R A;  3JAM E;  1STH A;  1J8I A;  1HCZ A;  2VXW A;  4G7O C;  1VCI A;  5EPJ A;  4XTC S;  4A3D B;  1TU2 B;  5E4W C;  2PMZ B;  4LK1 C;  1VF5 C;  2WIN B;  3RZO B;  4LMQ D;  3BVZ A;  4R9W A;  3CKI B;  1EU3 A;  4H7B A;  4LAA A;  3RUZ A;  1SAP A;  4XT3 B;  1JWU D;  2L0C A;  2EY5 A;  4A3F B;  3R3O A;  1AP0 A;  3M4Y A;  4MIU A;  1F2Z A;  1LAC A;  2IW3 A;  1AN8 A;  3K57 A;  1PFN A;  3TME A;  1LTR D;  4RCO A;  2EXZ A;  4RHR A;  3RD4 A;  5KNB A;  1BDO A;  1A3V A;  1Y69 U;  5IGD A;  1KLU D;  1ENF A;  4V19 0;  3SR1 A;  4UDU C;  3S14 B;  4E6I A;  5I9P A;  1R9T B;  4QB4 A;  2BA0 A;  2L9H A;  1NR4 A;  1JOO A;  5FO8 B;  4KKT A;  4A3I B;  1WTP A;  1HQR D;  1XWE A;  5EBC A;  4TQU S;  5AFW A;  3OIQ A;  4C56 C;  3Q6S A;  5C4J B;  4BA2 I;  2KVM A;  3OPO A;  1JWS D;  4U68 A;  1G91 A;  4PV1 C;  3PUZ A;  2XSC A;  1IHZ A;  2F0J A;  4G57 A;  1CT1 D;  5M5W B;  4F7X A;  1JC7 A;  1CA6 A;  1PZK D;  5IGG A;  3HS0 C;  3FPU B;  2B8F A;  4PNY A;  5COR A;  3BDL A;  1HRJ A;  5IOC A;  2B2U C;  1LO5 D;  1QJO A;  1BUV T;  3PIO 3;  4WJW A;  2NN6 G;  4H13 C;  1I4G A;  5A2Q E;  1M8A A;  2E2J B;  3DWQ A;  2VNU D;  2XRS D;  4L6T B;  5CV5 A;  2Q8R E;  1KDB A;  1UAP A;  2F0Q A;  4IZ8 A;  1QNU A;  1EY0 A;  1MGS A;  4O42 A;  4C1N I;  1GHJ A;  4Y7N B;  4J1M A;  4OO1 H;  2QKI C;  2RDG A;  5T1I A;  1D5Z C;  4BBR B;  1RHP A;  2K5D A;  2ID0 A;  2F0F A;  3SDZ A;  2EPB A;  3U9O A;  1MD2 D;  2WKD A;  1CI3 M;  2B39 A;  3MXP A;  5E4X A;  4M8A A;  3C46 A;  4AYB B;  2B2W C;  1SJE D;  4RCN A;  1ZEQ X;  1SE2 A;  1H9M A;  1PFB A;  2KEC A;  2F3W A;  4DK0 A;  3I4L A;  3OWE B;  5C0X J;  1NR2 A;  1EWH A;  2HDM A;  3CU7 A;  5C5M A;  3V96 A;  2MP1 A;  1SMY D;  2RVL A;  1H9J A;  1Y1W B;  1EQV A;  2NN6 H;  2ZXO A;  3PUY A;  2PNR C;  4KMU C;  1HXY D;  2J7Z A;  3VR2 A;  3NSW A;  1QOH A;  2K03 A;  3DEP A;  2ZT9 C;  4FF2 A;  4HCS A;  1SYF A;  2NBF A;  1DON A;  1GUO A;  2WII B;  4XYO A;  4FYD A;  1I4X A;  3E5S A;  2A6H C;  5KRU A;  2K5Q A;  4G7H C;  4K6L A;  1H9S B;  2RA4 A;  3K5N A;  1YNJ C;  3M7N A;  1ENC A;  2Y0S B;  3EA6 A;  1F9Q A;  1EZ8 A;  1FNU A;  4QIW B;  3J80 E;  3PUX A;  4NDX A;  1PZJ D;  4KV6 A;  1OXU A;  2L1B A;  3H0G B;  1JWM D;  2PW5 A;  2B2Y A;  2M2L A;  2F0U A;  1ZXT A;  2NN6 I;  1LTI D;  1BNZ A;  3C1F A;  2JA5 B;  2OEO A;  1CZW A;  1KDA A;  4GZY C;  1F2M A;  2I07 B;  1BCP F;  1DJR D;  2FFK B;  2AQ1 B;  3QIA A;  3VYT A;  2HDL A;  1GJX A;  3GP7 A;  3CRK C;  2I46 A;  1JIC A;  1I4P A;  2R6G A;  1MSH A;  2TSS A;  1Y8P B;  4DNR B;  1VF7 A;  2LKV A;  1A3U A;  1SYC A;  1ZYR C;  2PYK A;  5DEH A;  3C1E A;  1E2W A;  1TWH B;  4RGO S;  4WRD A;  2F1M A;  1CQV A;  4IFD H;  2DY8 A;  4TSS A;  1HTL D;  1SSO A;  3SE0 A;  3S1R B;  1EY8 A;  1GXD C;  4XYQ A;  4A93 B;  1LV9 A;  1OXX K;  2BDO A;  3A55 A;  2F0I A;  3P75 A;  2EYM A;  2B2T A;  5CGK A;  5M5Y B;  1RKN A;  3NWT A;  1X3P A;  1H9K A;  5FLX L;  1LTB D;  3T4A C;  3I70 A;  2J4X A;  1G8Z D;  4KK7 A;  3N6R A;  5KND A;  2H1E A;  1CTM A;  2A5H A;  4XIG S;  1HFG A;  1B2T A;  4FNF A;  3TP7 A;  2CW0 C;  2KA7 A;  4FO2 A;  1KDC A;  4ZK9 B;  1KAA A;  5IT9 E;  1OXT A;  2KQ3 A;  1STY A;  1EFI D;  2XN9 C;  3TZU A;  1PTO C;  4QUF A;  4OIJ A;  4K2K A;  5C6A A;  4B9X A;  5KYL A;  1QNK A;  2IJ0 A;  1AZQ A;  4KY5 A;  2F0D A;  1O7Z A;  3DEO A;  1CA5 A;  3NHH A;  4ILW A;  5K36 G;  3V2T A;  2QDB A;  3J80 L;  1DOM A;  1LTT D;  4HR7 B;  5J1Z A;  4RKL A;  2KHS A;  2RBM A;  5BN3 A;  1TS3 A;  4X3K A;  1DXM A;  4K2L A;  2QIL A;  4H44 C;  1STG A;  1TKW B;  5K5P A;  2SDF A;  5EKL A;  5FO7 B;  4ZLT F;  3SEB A;  3HG9 A;  3GTQ B;  1CHQ D;  1GUS A;  3SK8 A;  2LMC B;  1R4P B;  1J9O A;  1UEA B;  4HMI A;  4DA2 A;  3W2D A;  3P20 A;  4QCL A;  1O80 A;  4KHZ A;  2AUJ D;  4ZKC B;  1L0X B;  2NTS A;  2OF1 A;  3QOJ A;  3LX0 A;  2DY7 A;  3GTL B;  5I4D A;  2JXM B;  4DF7 A;  1WD1 A;  5LHY 1;  1B9N A;  1IW7 C;  3OHX C;  4FXG C;  5JPN C;  4B9W A;  1ML0 D;  3EJI A;  2YYZ A;  1DOL A;  2XVS A;  4BS9 A;  2HUG A;  2B2Y C;  3IFT A;  2EYF A;  4R8I A;  2JA8 B;  3NPP A;  1PYW D;  3L3O C;  1KNA A;  2PZU A;  3S1N B;  4N9P A;  1KTK A;  3HRZ C;  3GTO B;  2AQ3 B;  1STB A;  3HP3 A;  1QCB D;  3S17 B;  1TR5 A;  1TT2 A;  5CR3 A;  1Q12 A;  3NP8 A;  2JYO A;  1EIH A;  2NVQ B;  1EY4 A;  3EFX D;  2NVY B;  2F4I A;  3ERO A;  4IUV A;  5FOB B;  2K28 A;  3AB9 A;  1ILQ A;  5TSS A;  2V4D A;  2TMP A;  2PW7 A;  1DOK A;  1TY2 A;  4FF3 A;  1MSG A;  1RCV D;  1HTP A;  4A3G B;  2E2H B;  1QIL A;  3TBI B;  4QF4 A;  2GA4 B;  1U4M A;  1IYV A;  5T1G A;  3K7A B;  4Q0F A;  4ID6 A;  3M7G A;  1S5D D;  1TY0 A;  3X3N A;  3NK9 A;  3KBX A;  1NAP A;  1I50 B;  2EYL A;  3T16 A;  3D8G A;  4J6H A;  2RQX A;  1RDP D;  2B2T C;  2K04 A;  4FF1 A;  3PIP 3;  1EZ6 A;  4RWS C;  1IYU A;  1EQT A;  4Q5V A;  1C8C A;  4DXF A;  1I6V C;  2BA1 A;  1TWA B;  2K5W A;  2JP1 A;  4CBV A;  1HA5 A;  1PRT F;  1IKM A;  2Z4H A;  1I4R A;  3J7Y W;  2MJ8 A;  5BN5 A;  5JVG 3;  2KED A;  3BZD B;  3TSS A;  2EYO A;  3MWY W;  2A6H D;  1BO0 A;  1V1O A;  2F3V A;  1SBB B;  4OO1 G;  3KF8 A;  1D5M C;  3SK5 A;  1YNJ D;  2QEJ C;  4I65 A;  5EKI A;  2AQ2 B;  4XQQ A;  5HGT A;  2EY6 A;  2EE1 A;  1VMP A;  2EY2 A;  1I3Q B;  1DYQ A;  5I9O A;  1M4V A;  1IL8 A;  4BWG B;  1TII D;  5M3F B;  1PZI D;  4K5X A;  3DMU A;  3MA2 B;  2KUM A;  1PFM A;  5FKA C;  3M85 A;  1GUT A;  3KLS X;  1AFP A;  2O5J C;  4KHV A;  2O2L D;  3A8J E;  2BE5 C;  1SNP A;  3A8K E;  5EGT A;  3ONA B;  1BBX C;  4NMZ A;  1SNC A;  2AWN A;  1XYI A;  4C2M B;  1T5E A;  4X3T A;  1U4R A;  1ZYR D;  3ND9 A;  2FMC A;  1PTO B;  3FKI B;  4EQO A;  3HOV B;  5C44 B;  4KKS A;  4K8J A;  3IKJ A;  3K0Y A;  4ULL A;  1HFN A;  3VA5 A;  1PTO H;  2DNC A;  2F0M A;  4A3K B;  3CHB D;  4HN7 A;  2ICI A;  3A54 A;  1U9R A;  3VR4 A;  5M9O A;  2SOB A;  4CJ2 C;  5D14 A;  1D1I A;  2SEB D;  1LT3 D;  4XXE A;  3S2H B;  1WTQ A;  4PMC A;  3MFG A;  3LWU A;  1TWF B;  3PMF A;  1B4O A;  4CJ0 B;  1BXT A;  1W6J A;  3GTJ B;  2CW0 D;  5C4Z A;  3ZYY X;  1EOT A;  1MI2 A;  3D31 A;  5KGU A;  5FLX E;  5C4X B;  1ENA A;  2D2C C;  1PTO D;  4FXD A;  3D6W A;  3M3Y B;  4A3E B;  4FXK C;  3S16 B;  1OO9 B;  2F0N A;  4XQJ A;  5I2X A;  1EYD A;  2VB3 X;  3BDO A;  1Q3L A;  2LY7 A;  3I4N B;  4OO1 I;  3P1H A;  4C3I G;  2Z8L A;  2C9O A;  3Q24 A;  2MHV A;  3HOW B;  1CK1 A;  3C2P A;  3GTG B;  2C5C A;  3K5L A;  4DAY A;  3R93 A;  3S15 B;  3ITP A;  5IGF A;  4KI0 A;  5JVH 3;  3A7A B;  3IAY A;  2N88 A;  4ZYS A;  4IFD G;  1GHK A;  5KNC A;  3QO2 A;  1ONL A;  2D9U A;  1LTA D;  2XNA C;  4F88 A;  1SYB A;  4PMB A;  1ZKO A;  3TN2 A;  2LS0 1;  1EEF D;  5JOB A;  4IFD J;  2F0G A;  4HSP A;  1A2T A;  4O1N A;  1FYC A;  4IAL A;  2RDH A;  4DU9 A;  5M5X B;  5I6Y A;  3M4O B;  3HZX A;  2BDN A;  2R61 A;  4C3I B;  1B1Z A;  2A68 D;  3TP5 A;  3J7A F;  3TZD A;  1IW7 D;  2PO4 A;  1SYD A;  1S5F D;  2MGS A;  2FJ2 A;  3DWP A;  1X3Q A;  5KEE A;  3PV0 A;  1SJH D;  3RZD B;  3ERQ A;  3A7L A;  5D3D A;  4CHT B;  1DD2 A;  4ZQ3 A;  1UNS A;  1B53 A;  1EU4 A;  3UI2 A;  1JR0 D;  5IOD A;  2FIN B;  1S5C D;  2IT1 A;  3OOC A;  1I4Q A;  1LT5 D;  5I6W A;  1K83 B;  5EPL A;  4C1N K;  4N9T A;  3DHQ A;  1I4H A;  2NB0 A;  4ZUJ A;  3L7Z C;  5D3I B;  2XRQ D;  1AZP A;  1D2B A;  3NE5 B;  1EYC A;  3R8B A;  2B63 B;  1VMC A;  3NWS A;  2ZXR A;  4OIK A;  1SNO A;  1Z47 A;  2BCO A;  4KY6 A;  1SEB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...