4IUNA

Crystal structure of staphylococcal nuclease variant delta+phs r126e at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
b'ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLEKAEAQAKKEKLNIWSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS R126E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iunA00
4OL7A 2PQEA 4J6HA 5CGKA 5CV8A 1EYCA 2F0SA 5J39A 4PNYA 5KEEA 2F0MA 5DEHA 4QB4A 4DF7A 1STAA 4F7XA 5IGGA 5KGUA 3H6MA 3NQTA 1STGA 2PZWA 4DGZA 5C3WA 5K5PA 3QOLA 1A3VA 5J1ZA 3TP6A 1EY7A 3ITPA 5KYLA 5I6WA 1STHA 2EY5A 2F0PA 2OXPA 3DHQA 3DMUA 4K6DA 5E3FA 3T16A 4IUNA 4EQPA 5C4HA 1EZ8A 5CC4A 3C1FA 4K5WA 4R8NA 1SYGA 2SNSA 2F0GA 2OEOA 1KDAA 2QDBA 2O4XA 3BDLA 4ODGA 1NUCA 4KJNA 1SNOA 5CV6A 5C5MA 2F0FA 1EYDA 3NHHA 3NP8A 3V2TA 5DAUA 3S9WA 2NUCA 3P1HA 4N9PA 2WACA 5E1FA 2F0IA 3BDCA 3MVVA 5EKKA 4NMZA 1F2MA 1EY9A 2EYJA 1U9RA 5M9OA 3TP7A 4MIUA 2PYKA 2EYMA 5J22A 2EYPA 4ME5A 4E6IA 2PZUA 2F0TA 1F2ZA 5C6AA 3QOJA 1SYFA 2F0UA 2RDFA 4J1MA 3HZXA 4KY6A 1ENCA 3MXPA 3SK4A 4EQOA 1SNMA 1SYEA 2EYOA 3OSOA 3P75A 5HGTA 4H7BA 1EYAA 2PW5A 1AEXA 4QMGA 3D4WA 5C4ZA 1KABA 3D8GA 2EY6A 2F0KA 4NP5A 5C3XA 1EY0A 5F2DA 1JORA 4B9XA 4PMBA 5CV4A 2OF1A 4DFAA 1EY5A 3PMFA 1STYA 4ZQ3A 1EY8A 3SK6A 2KQ3A 4NDXA 1STBA 2F0VA 4K8IA 4F8MA 4KY5A 5CV5A 1SYDA 3LX0A 1SNPA 5ISRA 3R3OA 4HMIA 2PW7A 5I6YA 1A2TA 3MZ5A 1NSNS 2EY1A 4KHVA 4NKLA 2F0LA 4S3SA 3SHLA 2F0HA 3QB3A 1ENAA 4K8JA 4ZUJA 1STNA 4PMCA 3ERQA 3SK8A 3TP8A 4KD4A 1SNQA 2F0EA 2F0QA 3T13A 5JOBA 5EKLA 4K14A 5EGTA 2F0OA 3D6CA 3MEHA 1SYBA 1SNDA 2RBMA 3OMCA 4KJOA 4KY7A 4N9TA 5KYIA 2SNMA 1IHZA 5CR3A 3U9OA 2EXZA 4IALA 3C1EA 3E5SA 4ID6A 4B9WA 5IODA 4HMJA 5JAVA 5IGDA 4YIJA 2EYLA 3SR1A 3TP5A 3NUCA 1JOKA 3EROA 2RKSA 1SYCA 1F2YA 1TT2A 4KV6A 3SK5A 4EVOA 1A3TA 2F3WA 1A2UA 1KDBA 2ENBA 4RKLA 1JOQA 3NK9A 3VA5A 5I9PA 2LKVA 1RKNA 4TRDA 4WRDA 5IGFA 5HURA 1KDCA 2HQEA 3EJIA 3TMEA 5CV9A 2EY2A 5C5LA 1A3UA 4HTHA 5KIXA 4I65A 4IZ8A 1JOOA 5KRUA 3EVQA 1KAAA 1EQVA 3NXWA 5I9OA 3HEJA 4RKBA 3SXHA 4EQNA 5IOCA 1EY6A 4K2KA 4ZUIA 2F0NA 1II3A 2F0DA 2SOBA 1SNCA 2F3VA 2EYHA 4KTAA 2M00A 4DU9A 5IIFA 1EY4A 1TQOA 2KHSA 3OWFA 4KD3A 4K5VA 4LAAA 4K2LA 5IGCA 2F0JA 4G57A 2PZTA 1EZ6A 5NUCA 3MHBA 5IGEA 5CV7A 3RUZA 4QF4A 5IGBA 1TR5A 2F0WA 2EYFA 4WORA 4K5XA 3OMGA 3D4DA
chains in the Genus database with same CATH superfamily
1MJCA 3J81i 3CU7A 4PQXA 1HNXL 3K57A 3CF5A 2UUAQ 3ICEA 4OIKA 2A74C 4IOAA 3K59A 4RWSC 3RZDH 1G51A 3MXGA 1WTHA 1H9JA 2B2YC 3I4OA 3RZDB 2WP8J 1B50A 1U4PA 3TRZA 4H13C 4C56C 4ODGA 2IJ0A 1B9MA 1EWIA 1SSOA 2I0QA 1FJGL 4JC0A 2D0OA 1FR3A 4LMQD 1PRTD 5M9OA 2O5IC 5JEAJ 3K0YA 3BZDB 4ZKCB 3Q6SA 4IFDG 2PW5A 1YI2A 3T51B 4Y52H 4LJZC 4DAYA 2BA0A 1XTCD 1U4MA 5M3FH 1EIHA 2UUAL 4C3HG 1B53A 1MKHA 4NDXA 1Q81C 5CV5A 3I56A 4GNXA 5M3FB 1D1KA 3R3OA 5DM63 4X3TA 3ONAB 2DNCA 5A2QE 1QVFA 1LT4D 4BY7G 1FVIA 3VR5A 3W1BA 5AJ3Q 3UDGA 3S1QH 1TWGH 1S3OA 5EGTA 3D6CA 4LUOA 3J80c 2Y0SB 1LACA 4RGNA 3ZJYC 3LWEA 3U9OA 2E74C 3CCRA 2EXZA 3S1QB 3KF6B 4HCSA 4JI7Q 4ID6A 3GTMH 3PUWA 5A35A 4LWCA 1JQYD 2NZHA 4JI3Q 2XWJB 1JOQA 1XNQL 3VA5A 4GNXB 4HSVA 3GTMB 1I4XA 2BDNA 2UXDQ 1KD1C 4C3JH 5KRUA 3CCMA 5IYCG 1RL2A 5I9OA 1PYSB 1OXSC 1DYQA 2CQOA 4A3FB 5EAYA 3J7AF 2K32A 4C3JB 3L0OA 1GD7A 2E2JH 1B3QA 2VNUD 3GTOH 5AJ3L 3CXCA 1Q46A 4DR5L 1ENFA 4HAEA 3CHBD 4H44C 1TR5A 1CUKA 1JC7A 3M4OH 2EJMA 1I6HH 2PNHA 3GTOB 4P71A 3R8BA 2PI2A 4A3LG 4DF7A 2RCNA 1VQAA 3M4OB 2NVXH 1I6HB 5J1ZA 5KNCA 3T1HQ 1JJGA 2HCIA 3STBD 2E76C 2NVXB 1EYGA 2A6HD 1I4QA 4ZRZA 5C5MA 2MQHA 4BA2I 1EYDA 1Q82C 4AYBG 1WCMH 1XX8A 1HRJA 4NMZA 2JA8G 4HR7B 1F2MA 2H1EA 1VQNA 1EY9A 1HNZQ 1F2LA 3K7AH 3AFPA 3CPWA 3DWAA 4DN4M 1BXTA 4NW2A 1PZID 2F0TA 4OELB 3HKSA 4LF6L 4EQOA 4LFCQ 3MXPA 3K7AB 5TSSA 2RF4A 4HSPA 1B44D 2K5WA 4ZCKA 1U4LA 3I4MH 1EEFD 1RDPD 2K28A 5F2DA 4X64L 1B9NA 4X65Q 2KBNA 4C3IG 4KHZA 4X6AH 3I4MB 4A3EH 1ZKOA 2B2WC 2A19A 1KQSA 2AQ1B 3TN2A 2CW0C 4FXDA 4RCNA 3TP8A 3S17H 2BH8A 4JI0Q 3G71A 2JA5H 3G6JB 1X3QA 2OT2A 2IWHA 5C0XI 1AP0A 1NTGA 2NVYH 1RD9D 3S17B 4DAPA 1HNZL 3C1EA 3G6EA 3BVMA 5JAVA 1E2ZA 3U9SA 3VYUA 2JA5B 2B2TC 4N8FA 1Z7TA 3OTOQ 2WIIB 5BR8Q 2NVYB 2KHJA 4LFCL 2VUMH 1PH9A 1KDBA 1CKNB 4HN7A 1RKNA 3Q8DA 3SDZA 2YYZA 3FDTA 5IP9G 1PV4A 3TEHB 2K01A 1YHBA 2VUMB 2FFKB 1HZ9A 3LGJA 2BOSA 3HEJA 3BYTB 1JB7A 1E1OA 5BN3A 1VQOA 4GOPB 3FPUB 4MTKA 3KLSA 1EY4A 3D3RA 1J6QA 2PMZB 3K80C 2DJFC 2XNAC 2IX1A 1GUSA 3NQIA 1VQ4A 2E2IH 5IWAL 2YTXA 4DV4L 3J81c 1M4VA 3HOUG 2YTVA 3KOJA 3O13A 5CV8A 4A4IA 4JI8Q 2E2IB 3I91A 2KCNA 3NBHB 1UE5A 5FKAC 3CAMA 5LL6S 2E2DC 4BWGB 2KHIA 1EY7A 4BY1G 4CDDC 5KYLA 5BR8L 1TVXA 2EY5A 1HPCA 4FF3A 3I3CA 1EZ8A 3E9IA 5CC4A 1OTCA 1H9SB 3R2TA 1G6ZA 3LNNA 2F4VL 2L12A 1LV9A 2F0GA 1DGSA 3AYHB 1M8AA 3K5NA 1LTBD 3V2TA 2QF7A 4GLVB 1O7IA 1K8AC 1HR0Q 1VS0A 1X56A 1MI2A 4G7OC 4RGMA 5EKIA 3MXNA 4C1NI 2V4DA 4FXKC 5C4ZA 3PO3G 2BA1A 4B9XA 1VQIA 1PTOC 5CBAE 5DLQE 4DFAA 4DR4Q 4GKKQ 1XPOA 4HJAA 1S5DD 2I46A 2NZ1D 4J8QA 4LF8Q 4IUQA 2OQKA 4DR1Q 5HGQA 1Y1VG 4PMCA 2B39A 3V96A 3M7GA 4EQ5A 1PYBA 4UY8C 2VS1A 3T13A 3AFQA 1HHVA 4KY7A 4R8IA 4AH6A 5CORA 5D3IB 1YIJA 3IFTA 2Z9HA 4DNRB 1V1PB 1V43A 4HMJA 1FGUA 1Z6HA 3TP5A 2ZTDA 5JJZA 4L63B 1IZ6A 1NNXA 4IUVA 4OWXB 5GQOA 2NTTA 5FLMG 2DGYA 3EFXD 4P74A 5LMUL 1IBLQ 3EJIA 2PCFB 5KIXA 4OO1I 3EVQA 1L0WA 4HEDA 2EJGC 3SXHA 4ZUIA 1HFGA 2F0NA 5FO7B 3GTPH 1J5EQ 4KHPL 2CVRA 4DKAC 4OIJA 5EPLA 3FHWA 1QG7A 3S2DH 4IPDA 2IL8A 3GTPB 5GAEC 1M90C 4WORA 4KHVA 1ZXTA 4V0BA 1UAPA 4IFDH 2HD3A 3S2DB 1TKWB 5KGUA 2NZOA 4IPCA 1MHWC 4QJFA 4JBKA 4C3HH 3NTKA 2A5HA 4OEMB 1HXYD 2BCOA 2F0PA 4RGTA 3CMEA 3AU7A 4KK7A 1GUGA 1PVOA 2A69D 4C3HB 1RJTA 1IBLL 3IFDA 4BY7H 4A3IG 1L2FA 1EUJA 3BDLA 3E9HA 2PI2E 5KNBA 1ZYRC 1F9SA 1QZHA 5E1FA 2K7VA 4BY7B 1J5EL 4PV1C 3W5OA 3Q24A 1QOHA 2Z6KA 3D0FA 4OONA 3QOJA 3MC0B 4CDFC 1BCPF 1PRTC 1YITA 4MN3A 1Q86C 2Q2TA 1VQPA 1EFWA 1R4PB 5I2XA 4JCVE 5LMNQ 2F0KA 4A3FG 5IP7G 2KVMA 3TS0A 4OWTB 4DV0Q 1OXVA 5IYCH 3RMHA 4JI4Q 5T1IA 4K8IA 2Q2IA 3Q0AA 5GADC 3KDFA 2CH4A 2PW7A 3I55A 4L6TB 1AE2A 4NKLA 2WAQG 2EPBA 4O42A 2E5LQ 3DEOA 3T56B 2HHHQ 4KMUC 4DV2Q 2QDLA 1WJJA 3OMCA 2CCZA 1JE4A 1N9WA 1WOCA 1Y8PB 3F2BA 4A3LH 1VQCA 1EU4A 3UE0A 2JXMB 5KNDA 3MXUA 1EIGA 3F2CA 2R93G 4X3SA 2KEDA 5ELOA 4CKCA 3BS1A 3FKIG 3DWQA 1TY0A 2CW0D 2MUYA 4B3TQ 1JWSD 4U68A 5C5LA 2XRSD 4X62Q 3NEMA 1MSHA 2ATWA 2C5CA 2PMZE 4H0LC 3MWYW 1PH4A 4JI4L 1NR2A 2EIFA 2JA8H 1ESRA 1EOVA 3R93A 4KKTA 3J80i 5IGCA 1WVLA 1TWFH 1U4RA 4AYBB 3T4AC 4MZ9A 4FDBA 3RUZA 3L3OC 2E5LL 2JA8B 1UUPA 2HHHL 1SJHD 2I07B 4J6HA 4JBJA 1TWFB 2KCMA 2HIXA 2VQFL 5IGGA 3MA2B 3HOZG 5K5PA 4C3IH 3TP6A 3ITPA 2N3SA 1H9RA 1R4QB 3DMUA 1G291 3AQQA 4IUNA 2ZT9C 2CQAA 2K5QA 3GQBA 5HY6A 3FEWX 4R8NA 3FRPB 4C3IB 1B3AA 3V05A 2KJXA 1A62A 4A3MG 2EE1A 4ABNA 3STBC 4C2MH 3NHHA 1OXUA 1UNSA 2D62A 1LT5D 3P1HA 1PDQA 1XMOQ 2JA5G 3BVGA 2I5LX 2L11A 3NBIA 1MD2D 1KLUD 4DK3C 4BBSG 3RN5A 4HIMA 4Q0FA 4C2MB 2ZXOA 3H3VC 4L5SA 2PZUA 3HP3A 3HZXA 1ESFA 3KF8B 1N8RC 1K8OA 3NSWA 5D14A 2AMCB 1K8MA 2R6GA 3P7JA 5IP9H 1DXMA 2K5NA 2AHOB 3MAQA 3UDFA 1CSQA 1SBBB 2XIWA 1TXYA 2GVAA 4A75A 5JPNC 3HOYG 2WB1B 3K8AA 2VL6A 3L9AX 3K5OA 4GLXA 4ZUJA 3ND9A 3CMAA 4DR6L 4KI0A 3HOUH 1S40A 2HDLA 4BBRG 1VQLA 3N6RA 3J81j 1SN8A 4JI1Q 1BBUA 2JJQA 4DV7Q 2G9HD 3AMUA 4BY1H 2B2VA 4K0KL 4POGA 2ZJQA 1VCIA 2NN6I 2AKWB 1Y69U 4A93G 4WRDA 4OWWB 4JOIC 4BY1B 3RN2A 3I72A 3NXWA 1JT8A 2ZJPA 4LNQA 3KLWA 3PCOB 1N32L 2SOBA 4DU9A 1SNCA 4R1JA 1GUOA 4LAAA 4DAVA 1MBYA 2PZTA 1SEBD 5C44G 1T5XD 1A63A 2DUDA 3I4LA 4RA8A 2L55A 3D4DA 1PTOF 1SE8A 4FF4A 3KFUA 4NPSA 2Q8TA 4QL5A 3PO3H 5DEHA 1G2TA 4JI1L 1UEBA 3H94A 4DV7L 2K33A 4JI6Q 3PO3B 4FP5D 1AZPA 4YHHQ 1M1KC 2UUCQ 3OW7A 2JK8A 4GN5A 2YTYA 1Y1VH 1O7LA 2NBFA 3CD6A 1JJCB 4KJNA 2PNRC 4IURA 3GDEA 1SE4A 3RZOH 2KCTA 1Y1VB 1B1ZA 3EA6A 4G7ZC 3HRZC 4R4CA 4F88A 4LF4L 4A3DG 3RZOB 5G3LF 4KY6A 2L5TA 4H7BA 3SGIA 5FLMH 2ALYB 2GN5A 1P8LA 1KRSA 1ZYRD 1GM5A 1IBMQ 3ER0A 1A8VA 1S5CD 4DPGA 1LT6D 3DWPA 2QGQA 1A2TA 3MZ5A 5IYBG 1I94L 4H02A 4M1UB 4DV5Q 2R61A 2L0CA 1CM9A 2J7ZA 1ICFB 3SVMA 2HCCA 2DJGC 1HA5A 4CDEC 3MEFA 1LTRD 3JAML 2MPMA 2IY5B 2Q2HA 3KF6A 3QO2A 1EEID 1U0LA 3K81C 1CHPD 5CMDA 1CQVA 2G9DA 5FK9C 2LKVA 3Q23A 1WTXA 2KUMA 3A5ZB 5CV9A 1PTOH 4A3IH 4BXXG 1IL8A 1JOOA 1W6JA 1IBML 2IPKD 1OO9B 1FNUA 4AYBE 5J3BA 4ZLTF 1PTOB 2F3VA 4A3IB 2M00A 4ULLA 1ASYA 3OWFA 4K5VA 1D5ZC 1SR3A 2YU9H 4UAIA 3LWUA 4DV5L 1LABA 5ELBA 1IYVA 5IGBA 4OX9Q 1O78A 2NWGA 1LLRD 1DOLA 1Y8NB 2YU9B 3DM1A 4B08A 4PNYA 1MJEA 2F1MA 3W3AA 1H9KA 5IP7H 4A3FH 1X9NA 1TWCH 4DUYQ 4HCEA 3CCEA 2PZWA 4LFAQ 1Y1WG 2VXWA 1SROA 2OXPA 1IBKQ 3IKJA 2B8GA 1TWCB 1WTVA 1TS3A 1UE6A 2WKDA 2FMMA 1PXUA 1I5FA 2KEEA 2OQ0A 1BOSA 3QIAA 2NTSA 2A69C 2ICIA 2K50A 2WAQB 1JMCA 4I7AA 2Z1CA 4MIUA 1CK1A 4JI2Q 1QB5D 4JI7L 2R93H 3IAYA 3SK4A 4RGOS 3FKIH 1CTMA 2Z6BA 3ND8A 4LUZA 4JI3L 5EPJA 1LTGD 1SE3A 2R93B 2MGSA 4PG3A 1Q90A 3PUVA 2UXDL 1VQJA 1RHPA 3FKIB 3PMFA 2H4OA 3TQYA 1EY8A 4LFAL 5DNFA 1VQ8A 4F8MA 4JV5Q 2WFWA 3X3NA 1SNPA 5I6YA 2EY1A 4R4TA 1CT1D 4K8JA 4QIWB 2A8VA 3SK8A 1EL0A 2WKCA 4FXGC 5ELEA 3BU2A 3CP0A 1W6KA 5EKLA 2UXBQ 1DD2A 3I90A 3I7FA 4CJ1B 3E5SA 3GD7A 3HOZH 4JI2L 1WTPA 3KBXA 3ULLA 2VB2X 5M3MG 4GKJQ 1A2UA 1NJIC 1CKNA 5I9PA 3T1HL 4CHTB 3HOZB 1X32A 1K28A 1EQTA 1PRTB 3A0JA 1YHAA 3CPFA 3M4PA 4A3MH 1A15A 4PZ7A 3IRBA 1KXLA 5C0XG 3S15H 2VQEQ 5IT9c 4KTAA 4LW1A 4HIKA 4GOPA 4DNTB 4A3MB 3GO5A 4BBSH 5FLXc 2F0JA 3S15B 1EZ6A 2EVBA 1AH9A 1VQFA 1LTLA 1TS4A 2E75C 2UXBL 4BBSB 1KC8C 5M5XH 5E7NA 2P5ZX 1LUZA 2X69A 4N8X1 1KL9A 1EWHA 3NBHA 3M3YH 1JWUD 3A74A 1PLFA 4NXNQ 1STEA 5M5XB 4X65L 4DV1Q 2WB1G 3H91A 5JVG3 4GKJL 4CJ0B 1QVGA 3M3YB 1LTID 3HOYH 1D2BA 2RSOA 1H9SA 3RD4A 1TY2A 2FHTA 4ALPA 5H1SE 4JI5Q 5JJLA 3BVZA 3HKZB 3HOYB 1GHJA 1QZGA 4UP8A 4JI0L 2KCCA 3WWVA 3BDCA 5FOBB 4BBRH 1CFMA 1VMPA 4JBMA 4I7ZC 4E6IA 1QVCA 5C6AA 1VQEA 4DR7Q 4BBRB 3OTOL 1QILA 1BR9A 3OSOA 2XSCA 4A93H 4YY3Q 2JQOA 2OCEA 4NB3A 1G91A 4A3GG 1D5MC 2AUJD 2RDHA 2AUKA 4R4QA 3JAME 1C4QA 3PUYA 2Q8RE 3SK6A 4A93B 1VQBA 3R2IA 4K6LA 3VA7A 3J7ZC 2BH2A 2F0HA 3UDIA 4KD4A 5ELDA 5C44H 3EBEA 4OHJA 4JI5L 4BS9A 1SNDA 2HT1A 1IHZA 2ASBA 4UPAA 5FJ8G 5C44B 4LF7Q 1HUNA 3H3VH 4JI8L 1V1PA 1HQRD 1X3FA 1JWMD 5D3DA 4HJ8A 1BNZA 3SK5A 2R7DA 2F3WA 3D6WA 3PUXA 2ZXPA 1FGBD 1F77A 3C3LA 4XT3B 2RHSB 3I2ZA 2MJ8A 3M7NA 4UHVA 2KENA 2Y0SE 4M8AA 4CBVA 4J15A 1EY6A 2KA7A 1YNJC 4U673 1SAPA 5IIFA 1BKBA 1W3SA 1HR0L 1O80A 4A3DH 1AW7A 2F0WA 2MHVA 2EYFA 1BBXC 3I70A 1RIPA 1XXGA 2QW7A 2DN8A 2TSSA 4OO1G 4A3DB 1N33Q 1F9QA 4LF7L 1STAA 3H6MA 4DGZA 1A3VA 1GUWA 4DR4L 4GKKL 2LS01 4K6DA 3A8JE 2O2LD 4V190 4XYOA 1X3PA 2AQ3B 1L1OC 1S5BD 2C9OA 1MIUA 5IYBH 4LF8L 2JE6I 1YJNA 1IL2A 4DR1L 2QDBA 4X3UA 1SNOA 1C9OA 4CDCC 5DAUA 1ICWA 5AFWA 3UE1A 5I2YA 1HA6A 1L0YB 1UWVA 3ZYYX 1N36Q 1VQ7A 1I3QH 1MGSA 2JP1A 1SYFA 2WINB 2RDFA 5JPMC 4XDXA 5HGTA 1EYAA 3A55A 1AEXA 1PHJA 1I3QB 2EOTA 2LXKA 4XTCS 4BXXH 3VYTA 3WOFA 2J4XA 2OTLA 1GXDC 1X55A 1STYA 4ZYSA 1PH7A 3T1YQ 1PH6A 3K58A 3URYA 2QKIC 3GP7A 2R3ZA 1K0RA 3KUPA 2B2YA 2CWPA 4YCWA 3ULPA 5JOBA 3KLSX 3UI2A 5GROA 4K14A 1KNAA 4ILWA 2SNMA 5CR3A 4MHEA 1CSPA 1G8ZD 4HJ5A 3G7LA 2DNEA 3K6OA 1VQGA 3FVQA 3L7ZC 1Y1WH 3EROA 1SYCA 1T5EA 4B3SQ 4EVOA 1HH2P 2AWOA 2JN4A 1FYCA 3KYHC 5BN4A 2MP1A 1Y1WB 1F9PA 1EQVA 3T1YL 1YEZA 4JG2A 5CBEE 3PV0A 1PYWD 1PH8A 4Y7NH 1QJOA 5IYDG 5JJKA 2EYHA 1C48A 4CJ2C 1GUNA 4C1NK 4Q5VA 1X3GA 3MHBA 4Y7NB 4AQYQ 2N78A 1JJ2A 1BQQT 3NPPA 4ZK9B 4RH6A 2F0MA 4QB4A 5LMNL 1R9TH 1B2TA 1PH2A 3E0JA 3QOLA 2C35B 4DV0L 1ASZA 1NCVA 2E8GA 1HNWQ 3QJYA 4FF1A 1QUQB 4R4IA 5C4HA 1R9TB 2RVLA 3K5LA 3C1FA 2AQ2B 1Z9FA 2NYZD 4DA2A 1E3PA 4NXMQ 3UDXA 3GTLH 2NB0A 2D0PA 2NUCA 4B3RQ 4DV2L 3MVVA 3RLNA 4TKOB 5EBCA 1B7YB 1EU3A 2Z4HA 3VYSA 3GTLB 1CZWA 1RTOA 2FINB 3D4RA 2EYPA 1DZ1A 1SJED 1XMQQ 2MFIA 1PH3A 4AQYL 5K36G 2R92G 5M3MH 3KF8A 4A3KG 4FF2A 1AZQA 1KABA 1PH1A 4B3TL 3P20A 1IXRA 1IKMA 3IL8A 4KKSA 4PMBA 1JORA 1WTRA 5M3MB 5EBDA 4X62L 3CCVA 2EZVA 4LF5Q 5C0XH 2F0VA 2A73B 4IUPA 4KY5A 1SYDA 5D65A 1WTOA 1K3BC 5ISRA 1C0AA 3GV3A 3BG3A 3JAMi 1NSNS 4S3SA 1VQ5A 2F0LA 4JYAQ 2A1AA 2TMPA 4A76A 1D1IA 3A7AB 4X66Q 1TS5A 2VB3X 1SYBA 3BDOA 1PFSA 1WD1A 4IALA 1IW7C 2B3GA 1D6EC 2B8FA 3EN2A 2XTIA 1YHQA 3WDNA 2AWNA 3NK9A 2KECA 4TRDA 3DEPA 3K0XA 2ZM6Q 3A8IE 1QNUA 3HKZG 1GUTA 4I65A 5COYA 4WJWA 1QWYA 3M4YA 1Q3LA 4K2KA 2CKZB 1XMOL 1LT3D 2I5MX 3X3MA 1JE5A 4JVZA 4L5TA 4RHSA 2B2WA 5FO9B 4APVA 1L0XB 2NN6G 1NAPA 3TDQA 3S1NH 1PA6A 1VF7A 3HFZB 4KLKA 2M9VA 3H09A 4ZAIA 1EFID 1VMCA 2PPBC 1WTQA 3S1NB 4MNOA 1LTAD 4A3GH 1YNJD 2JA6B 5I6WA 3OIQA 4DR2Q 5E3FA 3J7YW 2B2TA 4A3GB 2OWOA 1SYGA 3OOCA 2OEOA 2O4XA 3GTJB 2M2LA 1O7YA 2B2UC 4GS3A 3J7AV 4PMWA 4IJLA 1V1QA 4UP7A 1JICA 2UU9Q 1Y14B 5FJ8H 2EYJA 3HOWB 3CKIB 1PZJD 4UP9A 3TP7A 4P72A 2CFMA 3K5MA 1OXTA 2SDFA 1SYEA 3S1RH 1CA6A 5C4XG 1KIXA 4NP5A 4L8JA 4XQNA 5C4JH 2K52A 1I4RA 2OF1A 1EY5A 3VR2A 2CH4W 3S1RB 1E2VA 2K75A 5FO8B 1XNRQ 1RTNA 3RLOA 4DR2L 3KBGA 1LTTD 2LXJA 5C4JB 3CC7A 4IPGA 2OTJA 3VR4A 2K1BA 5I4DA 2BDOA 2PQAB 1UE7A 1I6VC 1YJWA 1TU2B 2LY7A 5KYIA 2ES2A 2UU9L 2NVTH 1DCZA 4OO1H 4P75A 3RR5A 2Q8IB 1IYUA 1JOKA 1SFOH 2NVTB 1S5ED 4TVAB 3J80L 4JI6L 2K4KA 4YHHL 2UUCL 3JC66 4LUVA 4DXGA 3U4ZA 1SFOB 3TS2A 1XNRL 2UXCQ 4RKBA 1TIID 1VQ6A 2Z6KC 2K05A 2A6ED 1N34Q 2A68C 2RSNA 2JEAI 2BE5C 1TQOA 2D9UA 3OHXC 3T53B 1ONLA 4CGYB 4IFDJ 1VF5C 1E7ZA 1MSGA 4WJ4A 1CA5A 4K5XA 3WOEA 2L9HA 4P73A 1S72A 1AE3A 1EYCA 5JEAG 3CRLC 1CKOA 3H0GG 4QY7A 2L15A 2CHBD 1FL0A 1PFNA 2QCPX 3E3XA 4JPBW 3QG1A 3EIVA 1XNQQ 3DHQA 1A0IA 1HTLD 2K03A 1JCKB 4DK1A 1YVCA 3MFYA 4IFDI 4LK1C 1VQDA 1PRTF 2JA7G 2G5DA 3OYYA 3GTQH 3F2DA 2UXCL 4RCOA 4HIOA 4TQUS 2WACA 1YJ9A 5EPKA 3VR3A 1N34L 3E0EA 5CYUA 1P16A 4DR5Q 3GTQB 5J22A 2EYMA 1L1OA 1UEAB 3BJUA 4POFA 1VQHA 4JW0A 4FVMA 1CZGA 3NE5B 1ENCA 2ICEC 3SEBA 4DUZQ 1EIFA 3S14H 2GVBA 1E2WA 4QMGA 1TWGB 2EY6A 4DAYB 4IPHA 4EGVA 2HQLA 3TBIB 3RNUA 3S14B 4F87A 2KQ3A 2VY3A 1GOZA 2H5XA 5C3EH 5IYDH 1XPUA 3JAMc 4HMIA 1D7QA 1X54A 1BCPC 2IX0A 4PZ6A 2ZJRA 5JVH3 1W2BA 1L1OB 5C3EB 2F0EA 1V8QA 4AIMA 2DY7A 2F0QA 1Z47A 4OX9L 3NWSA 1KNEA 1SLJA 1D5XC 2F0OA 3MEHA 3PIOA 4N9TA 1RF2D 2E2HH 1ILPA 4R4OA 1HZBA 3J7A5 1FNWA 5IGDA 3A5UA 4LF6Q 4DUYL 2E2HB 2E2JB 1F2YA 5IT9L 2WB1E 2RDGA 1A3TA 1HFNA 1YNNC 4DUZL 1A6XA 5FLXL 1IBKL 5M5YH 1KDCA 2HQEA 4X64Q 2CWAA 3BYYB 1J9OA 2QEXA 1KAAA 2XRQD 4DR3Q 5E4WC 1WD0A 5M5YB 5IOCA 1IW7D 3PSIA 4HIDA 5M5WH 1KLGD 4KKUA 3NWTA 2Z8LA 3CCSA 3BZKA 2RCFA 5NUCA 3DLLA 2RQXA 5CV7A 5M5WB 1I4GA 3OMGA 5K36H 3U58A 2R92H 5JJIA 4A3KH 4GZYC 2K5DA 3FP9A 4L5QA 3TSSA 1WCMB 1QNKA 2R92B 1T9HA 1STGA 4A3KB 1VQKA 1HUMA 4A3BG 5LL6X 3J81L 1HZAA 1ML0D 1PZKD 1B8AA 3NTHA 1AN8A 3NENA 1G2SA 2K5HA 4JV5L 1Q1BA 2X6GA 5C0XJ 2UUBQ 1NR4A 3ULJA 1WTWA 1GJXA 4XQQA 1E24A 1NUCA 1HTPA 1K3RA 4DR3L 3NP8A 2MNAA 1YZ6A 1V1OA 5L37A 4A3JG 2B2VC 3OIPA 4ZKBB 4IO9A 3PUZA 2LFNA 4A3EB 5IWAQ 4DV4Q 1NE3A 3HG9A 3TZDA 4J1MA 3S9WA 4JK1C 2LSSA 3F2UA 4RAUC 3D8GA 2EQSA 2SEBD 4XYQA 4Z9CB 1OXXK 1O7ZA 4ZQ3A 5GAGC 3I8ZA 3AEVA 4QCLA 1Q1EA 1Q7YC 3LX0A 1PH5A 1BVSA 2VQEL 2R7ZG 4DXFA 2UUBL 2F4VQ 1B70B 2LMCB 1E22A 1LTSD 3PIPA 1PFBA 1C7YA 1NMFA 1SNQA 2NN6H 3J80E 5IE8A 3S16H 4P2CB 4RMFA 4LF9Q 4WFN3 3A56A 4KJOA 1HCZA 2JA6G 2JSOA 2B63G 3TZUA 3NTIA 2PO4A 3S16B 3W2DA 4NXNL 4TSSA 4KN7C 3M85A 4DV1L 2ZTCA 5DM73 3PF4A 1H9MA 4A3CH 1SE2A 2K5VA 5HURA 3FMCA 3TMEA 2EY2A 2I5HA 3HOVG 1J8IA 3S2HH 3HOXG 3HOWG 4EQNA 1SDFA 1V9PA 2MO1A 2KHSA 3S2HB 4K2LA 3S24A 2IHEA 5IGEA 2ZTEA 1SMYC 2EXDA 4FYDA 2L1BA 4O2DA 4DR7L 4LF9L 4OXPA 5C4XH 5J39A 3I4NG 1RCVD 5KEEA 1DOMA 4YY3L 4HJ9A 1U5KA 4F7XA 1GKHA 2IX3A 4FNFA 2A68D 1JB3A 2BE5D 5C4XB 4RHRA 4IQZA 5LMUQ 1QE6A 4K5WA 4DK0A 1XJVA 5T1GA 3VYRA 1VQMA 3M9BA 4OGQC 1IYJB 1CI3M 3PIO3 4IOCA 5CV6A 2F4IA 1IKLA 3F1ZA 2D2CC 4KHPQ 4JOIA 3DXJC 2EDGA 3OWEB 5EKKA 3PO2G 4XQJA 3MFGA 3AB9A 1KAWA 4GN3B 3L2PA 1KHIA 4ME5A 4GNXC 2F52A 3MXNB 3PGZA 5ELFA 1SNMA 3P75A 2EYOA 4X3KA 2FMCA 3H15A 2Z0SA 3VDYA 2B2UA 3PO2B 1TWHH 1CKMA 5C3XA 3KLRA 3HGBA 5CV4A 2WAQE 3CCQA 3G48A 1GO3E 4RFBA 1D8LA 2JYOA 1TWHB 1SXTA 3PQIA 3CQZH 1VDZA 1EIYB 4HJ7A 2DY8A 5IT9E 3ERQA 4YWLA 3CQZB 5EJWA 5FLXE 1HZCA 1GVPA 1ZEQX 2K6AA 2K04A 5JEAH 3H0GH 2N88A 4GLAC 3GV6A 3VR6A 2Z4IA 2F03A 1N33L 2EYLA 1VQ9A 4KV6A 1NMGA 2K14A 1BCPD 3H0GB 2O5JC 3RLFA 3QR8A 4QIWE 2V1CC 2N55A 4YCUA 1Q8KA 3TREA 5IY0A 5M3FG 1ET6A 2JA7H 1NBWA 4FO2A 3U4VA 1XTDA 1QCBD 1TS2A 3C2PA 1ILQA 1II3A 2QILA 3CW2C 2WV6D 3ERSX 2JA7B 3A8KE 2RA4A 3J81E 2L4NA 2Y0SG 1YNND 3CC2A 1PMRA 4UDUC 1EWCA 4QF4A 2RHQB 1Q8IA 2A6EC 1JR0D 1N36L 1F9RA 1LM0A 4OL7A 2VW9A 1XWEA 5CGKA 1EOTA 2F0SA 1SRUA 3OPOA 2N49A 1WI5A 1UE1A 3W1GA 5C3WA 2ID0A 4XT1B 1STHA 3T16A 1QUQA 1BO0A 1E1TA 3PIP3 5C3EG 2XVSA 5LHY1 3GTKH 2SNSA 4C3JG 2MO0A 3A7LA 1GHKA 2F0FA 5ELNA 4XXEA 4N9PA 3GTKB 4DAMA 4G7HC 1LYLA 1RODA 1F2ZA 2XWBB 2JEBI 2F0UA 3KJPA 4B3MQ 2JA9A 1H95A 5ELCA 4B3SL 3DM3A 2VQFQ 3D4WA 4MTNA 2F3IA 3HKZE 1EY0A 4YWMA 4JBWA 5EQ0A 2HUGA 4GOPC 3S1MH 1STBA 4DV6Q 3KDFB 1HQMC 1X65A 2FXQA 4BA1I 2HIVA 1K73C 1HR0W 2IW3A 1BF4A 3SHLA 3S1MB 4IUTA 4O0AA 1WCMG 1I4PA 1AFPA 2QEJC 2RBMA 4XIGS 3SE0A 2B29A 1G6PA 5GAHC 3MTSA 4A3BH 1SMXA 5A2QL 3PF5A 3NUCA 4B3ML 3B6YA 4QUCA 1B4OA 3BZCA 1HNWL 2ENBA 5IGFA 3I4MG 3F8TA 4DNIA 4A3BB 4DV3Q 4WJ3M 1LO5D 1X6OA 4NXML 3K7UC 4IJHA 1XPRA 1Y8OB 4A3EG 5E4XA 4DV6L 1KTKA 1TWAH 4A3JH 4B3RL 4IN3A 3HS0C 2GA4B 4KD3A 4G57A 4DR6Q 1TWAB 4A3JB 1I4HA 1XMQL 1BCPB 1X3EA 2A6HC 2PQEA 4EX5A 1CQFA 1DOKA 4R9WA 3NQTA 4K0KQ 1ET9A 1KRTA 3N52A 4LF5L 1C8CA 1K9MC 2VUMG 3GTGH 4EQPA 4L5RC 5BN5A 3FPPA 1SMYD 1XYIA 2R7ZH 4DV3L 1FNVA 4QQBX 4JYAL 1KDAA 3M4QA 3GTGB 2NVQH 4CKBA 1EQRA 1S5FD 2KOLA 1N32Q 2R7ZB 4X66L 2F0IA 2JA6H 3QWNA 2B63H 1U9RA 2NVQB 2XGTA 1WYDA 1NY4A 1YBYA 2PYKA 1K83H 3CCLA 3KK7A 4GN4B 1WFQA 2IHFA 4QUFA 1K8GA 1DONA 4YCVA 1PTOD 3C46A 3D31A 4O1NA 2B63B 3CCUA 3EQLC 3GTJH 1K83B 4A3CG 2ZM6L 3HOUB 4QGUA 2FJ2A 3HOVH 2IT1A 3HOXH 1FD7D 1YNXA 2YV5A 3HOWH 4LFBQ 2N8NA 3CCJA 3CRKC 1E0BA 4G4KA 3HOVB 3SR1A 3CC4A 3HOXB 3KJOA 1I50H 1ENAA 2PQAA 2J0TD 3QB3A 1STNA 4KN4C 1BUVT 1EQQA 2ZXRA 3NELA 1I50B 4CKEA 5LMNW 2QA4A 1HNXQ 3I4NH 2X6LA 3E6ZX 4LF4Q 4B9WA 5IODA 1K0SA 4YIJA 1CHQD 1BDOA 2RKSA 1TT2A 5G3LD 3I4NB 3G4SA 1S4ZA 4ME3A 1DM0B 4RKLA 3A54A 2Q2UA 4YWKA 2XN9C 2EJFC 4IUUA 3Q22A 1Q12A 2D5DA 1A3UA 4HTHA 4IZ8A 4PZ8A 1HJPA 3H3VI 4DK6C 1FJGQ 4LFBL 3DUZA 1DJRD 2HDMA 2F0DA 3PO2H 2R7FA 1BBWA 1I94Q 3I73A 3U50C 4RG1A 1PFMA 2VZAA 3OW2A
chains in the Genus database with same CATH topology
3CU7A 4PQXA 3K57A 4OIKA 2A74C 3K59A 4RWSC 3MXGA 1H9JA 2B2YC 3RZDB 2WP8J 1B50A 1U4PA 4H13C 4C56C 4ODGA 2IJ0A 1B9MA 1SSOA 1FR3A 4LMQD 1PRTD 5M9OA 2O5IC 5JEAJ 3K0YA 3BZDB 4ZKCB 3Q6SA 4IFDG 2PW5A 3T51B 4LJZC 4DAYA 2BA0A 1XTCD 1U4MA 1EIHA 4C3HG 1B53A 4NDXA 5CV5A 5M3FB 1D1KA 3R3OA 5DM63 4X3TA 3ONAB 2DNCA 5A2QE 1LT4D 3VR5A 5EGTA 3D6CA 2Y0SB 1LACA 4RGNA 3LWEA 3U9OA 2E74C 2EXZA 3S1QB 4HCSA 4ID6A 3PUWA 5A35A 1JQYD 2XWJB 1JOQA 3VA5A 4HSVA 3GTMB 1I4XA 2BDNA 5KRUA 5I9OA 1OXSC 1DYQA 4A3FB 3J7AF 2K32A 4C3JB 2VNUD 1ENFA 4HAEA 3CHBD 4H44C 1TR5A 1JC7A 2EJMA 3GTOB 3R8BA 4DF7A 3M4OB 1I6HB 5J1ZA 5KNCA 2HCIA 2E76C 2NVXB 2A6HD 1I4QA 4ZRZA 5C5MA 4BA2I 1EYDA 1XX8A 1HRJA 4NMZA 4HR7B 1F2MA 2H1EA 1EY9A 1F2LA 3DWAA 4DN4M 1BXTA 4NW2A 1PZID 2F0TA 4EQOA 3MXPA 3K7AB 5TSSA 4HSPA 1B44D 2K5WA 1U4LA 1EEFD 1RDPD 2K28A 5F2DA 1B9NA 4C3IG 4KHZA 3I4MB 1ZKOA 2B2WC 2AQ1B 3TN2A 2CW0C 4FXDA 4RCNA 3TP8A 3G6JB 1X3QA 2OT2A 2IWHA 5C0XI 1AP0A 1RD9D 3S17B 4DAPA 3C1EA 3BVMA 5JAVA 1E2ZA 3U9SA 3VYUA 2JA5B 2B2TC 1Z7TA 2WIIB 2NVYB 1KDBA 4HN7A 1RKNA 3SDZA 2YYZA 3FDTA 2K01A 2VUMB 2FFKB 2BOSA 3HEJA 3BYTB 5BN3A 3FPUB 3KLSA 1EY4A 3D3RA 2PMZB 2XNAC 2IX1A 1GUSA 3NQIA 1M4VA 3O13A 5CV8A 2E2IB 3I91A 2KCNA 5FKAC 5LL6S 2E2DC 4BWGB 1EY7A 5KYLA 1TVXA 2EY5A 1HPCA 4FF3A 3I3CA 1EZ8A 5CC4A 1H9SB 3R2TA 1G6ZA 3LNNA 2L12A 1LV9A 2F0GA 1M8AA 3K5NA 1LTBD 3V2TA 2QF7A 1MI2A 4G7OC 4RGMA 5EKIA 3MXNA 4C1NI 2V4DA 4FXKC 5C4ZA 2BA1A 5CBAE 4B9XA 1PTOC 4DFAA 1S5DD 2I46A 2NZ1D 4J8QA 4IUQA 4PMCA 2B39A 3V96A 3M7GA 3T13A 1HHVA 4KY7A 4R8IA 5CORA 5D3IB 3IFTA 4DNRB 1V1PB 1V43A 4HMJA 1Z6HA 3TP5A 5JJZA 4L63B 4IUVA 2NTTA 3EFXD 3EJIA 2PCFB 5KIXA 4OO1I 3EVQA 4HEDA 2EJGC 3SXHA 4ZUIA 1HFGA 2F0NA 5FO7B 2CVRA 4OIJA 5EPLA 1QG7A 2IL8A 3GTPB 4WORA 4KHVA 1ZXTA 4V0BA 1UAPA 4IFDH 3S2DB 1TKWB 5KGUA 3NTKA 2A5HA 1HXYD 2BCOA 2F0PA 4RGTA 3AU7A 4KK7A 1GUGA 2A69D 4C3HB 1RJTA 3IFDA 3BDLA 5KNBA 1ZYRC 1F9SA 5E1FA 2K7VA 4BY7B 4PV1C 3Q24A 1QOHA 3QOJA 3MC0B 1BCPF 1PRTC 4MN3A 1R4PB 5I2XA 2F0KA 2KVMA 1OXVA 3RMHA 5T1IA 4K8IA 3Q0AA 2PW7A 4L6TB 4NKLA 2EPBA 4O42A 3DEOA 3T56B 4KMUC 3OMCA 1JE4A 1Y8PB 1EU4A 5KNDA 2JXMB 3MXUA 1EIGA 4X3SA 2KEDA 4CKCA 3BS1A 3DWQA 1TY0A 2CW0D 2MUYA 1JWSD 4U68A 5C5LA 2XRSD 1MSHA 2C5CA 4H0LC 3MWYW 1NR2A 1ESRA 3R93A 4KKTA 5IGCA 1WVLA 1U4RA 4AYBB 3T4AC 3RUZA 3L3OC 2JA8B 1UUPA 1SJHD 2I07B 4J6HA 1TWFB 5IGGA 3MA2B 5K5PA 3TP6A 3ITPA 1H9RA 1R4QB 3DMUA 1G291 4IUNA 2ZT9C 2CQAA 2K5QA 3GQBA 3FEWX 4R8NA 3FRPB 4C3IB 1B3AA 3V05A 2KJXA 2EE1A 4ABNA 3NHHA 1OXUA 1UNSA 2D62A 1LT5D 3P1HA 1PDQA 3BVGA 2L11A 3NBIA 1MD2D 1KLUD 4Q0FA 4C2MB 2ZXOA 3H3VC 2PZUA 3HP3A 3HZXA 1ESFA 1K8OA 3NSWA 5D14A 1K8MA 2R6GA 3P7JA 1DXMA 3MAQA 1SBBB 2XIWA 5JPNC 2WB1B 3L9AX 3K5OA 4ZUJA 3ND9A 4KI0A 2HDLA 3N6RA 2G9HD 3AMUA 2B2VA 1VCIA 2NN6I 1Y69U 4WRDA 4BY1B 3I72A 3NXWA 2SOBA 4DU9A 1SNCA 1GUOA 4LAAA 4DAVA 1MBYA 2PZTA 1SEBD 1T5XD 3I4LA 4RA8A 2L55A 3D4DA 1PTOF 4FF4A 2Q8TA 5DEHA 1G2TA 3H94A 2K33A 3PO3B 4FP5D 1AZPA 3OW7A 1O7LA 2NBFA 4KJNA 2PNRC 4IURA 1SE4A 1Y1VB 1B1ZA 3EA6A 4G7ZC 3HRZC 4F88A 3RZOB 5G3LF 4KY6A 2L5TA 4H7BA 1ZYRD 1S5CD 1LT6D 3DWPA 1A2TA 3MZ5A 4M1UB 2R61A 2L0CA 1CM9A 2J7ZA 3SVMA 2HCCA 1HA5A 3JAML 1LTRD 2MPMA 3QO2A 1EEID 1CHPD 5CMDA 1CQVA 2G9DA 5FK9C 2LKVA 3Q23A 1WTXA 2KUMA 5CV9A 1PTOH 1IL8A 1JOOA 1W6JA 2IPKD 1OO9B 1FNUA 4ZLTF 1PTOB 2F3VA 4A3IB 2M00A 4ULLA 3OWFA 4K5VA 1D5ZC 4UAIA 3LWUA 1LABA 5ELBA 1IYVA 5IGBA 1O78A 2NWGA 1LLRD 1DOLA 1Y8NB 2YU9B 3DM1A 4B08A 4PNYA 2F1MA 3W3AA 1H9KA 4HCEA 2PZWA 2VXWA 2OXPA 3IKJA 2B8GA 1TWCB 1WTVA 1TS3A 2WKDA 2FMMA 1PXUA 2KEEA 1BOSA 3QIAA 2NTSA 2A69C 2ICIA 2WAQB 2Z1CA 4MIUA 1CK1A 1QB5D 3IAYA 3SK4A 4RGOS 1CTMA 3ND8A 5EPJA 1LTGD 1SE3A 2R93B 2MGSA 1Q90A 3PUVA 1RHPA 3FKIB 3PMFA 2H4OA 1EY8A 5DNFA 4F8MA 3X3NA 1SNPA 5I6YA 2EY1A 1CT1D 4K8JA 4QIWB 1EL0A 3SK8A 2WKCA 4FXGC 5ELEA 1W6KA 5EKLA 1DD2A 3I90A 4CJ1B 3E5SA 3GD7A 1WTPA 3KBXA 2VB2X 1A2UA 5I9PA 4CHTB 3HOZB 1X32A 1EQTA 1PRTB 1A15A 5C0XG 4KTAA 4DNTB 4A3MB 3GO5A 2F0JA 3S15B 1EZ6A 2EVBA 1TS4A 2E75C 4BBSB 2X69A 1EWHA 3NBHA 1JWUD 1PLFA 1STEA 5M5XB 3H91A 5JVG3 4CJ0B 3M3YB 1LTID 1D2BA 2RSOA 1H9SA 3RD4A 1TY2A 2FHTA 3BVZA 3HKZB 3HOYB 1GHJA 2KCCA 3BDCA 5FOBB 1CFMA 1VMPA 4I7ZC 4E6IA 5C6AA 4BBRB 1QILA 1BR9A 3OSOA 2XSCA 1G91A 1D5MC 2AUJD 2RDHA 2AUKA 3JAME 1C4QA 3PUYA 2Q8RE 3SK6A 4A93B 3R2IA 4K6LA 3VA7A 2F0HA 4KD4A 5ELDA 4OHJA 4BS9A 1SNDA 1IHZA 5C44B 1HUNA 1V1PA 1HQRD 1JWMD 5D3DA 1BNZA 3SK5A 2F3WA 3D6WA 3PUXA 2ZXPA 1FGBD 1F77A 3C3LA 4XT3B 2MJ8A 3M7NA 4M8AA 4CBVA 1EY6A 2KA7A 1YNJC 4U673 1SAPA 5IIFA 1O80A 1AW7A 2F0WA 2MHVA 2EYFA 1BBXC 3I70A 1XXGA 2DN8A 2TSSA 4OO1G 4A3DB 1F9QA 1STAA 3H6MA 4DGZA 1A3VA 1GUWA 2LS01 4K6DA 3A8JE 2O2LD 4V190 4XYOA 1X3PA 2AQ3B 1S5BD 2C9OA 2JE6I 2QDBA 4X3UA 1SNOA 5DAUA 1ICWA 5AFWA 5I2YA 1HA6A 1L0YB 3ZYYX 1MGSA 2JP1A 1SYFA 2WINB 2RDFA 5JPMC 4XDXA 5HGTA 1EYAA 3A55A 1AEXA 1I3QB 2EOTA 4XTCS 3VYTA 3WOFA 2J4XA 1GXDC 1STYA 4ZYSA 3K58A 3URYA 2QKIC 3GP7A 2R3ZA 3KUPA 2B2YA 5JOBA 3KLSX 3UI2A 4K14A 1KNAA 4ILWA 2SNMA 5CR3A 4MHEA 1G8ZD 3G7LA 2DNEA 3K6OA 3FVQA 3L7ZC 3EROA 1SYCA 1T5EA 4EVOA 2AWOA 1FYCA 5BN4A 2MP1A 1Y1WB 1F9PA 1EQVA 5CBEE 3PV0A 1PYWD 1QJOA 2EYHA 1C48A 4CJ2C 1GUNA 4C1NK 4Q5VA 3MHBA 4Y7NB 1BQQT 3NPPA 4ZK9B 4RH6A 2F0MA 4QB4A 1B2TA 3E0JA 3QOLA 1NCVA 3QJYA 4FF1A 5C4HA 1R9TB 2RVLA 3K5LA 3C1FA 2AQ2B 2NYZD 4DA2A 2NB0A 2NUCA 3MVVA 4TKOB 5EBCA 1EU3A 2Z4HA 3GTLB 3VYSA 1CZWA 1RTOA 2FINB 3D4RA 2EYPA 1DZ1A 1SJED 5K36G 3KF8A 4FF2A 1AZQA 1KABA 3P20A 1IKMA 3IL8A 4KKSA 4PMBA 1JORA 1WTRA 5M3MB 5EBDA 2EZVA 5C0XH 2F0VA 2A73B 4IUPA 4KY5A 1SYDA 5D65A 1WTOA 5ISRA 3GV3A 3BG3A 1NSNS 4S3SA 2F0LA 2TMPA 1D1IA 3A7AB 1TS5A 2VB3X 1SYBA 3BDOA 1WD1A 4IALA 1IW7C 1D6EC 2B8FA 3WDNA 2AWNA 3NK9A 2KECA 4TRDA 3DEPA 3A8IE 1QNUA 1GUTA 4I65A 5COYA 4WJWA 1QWYA 3M4YA 1Q3LA 4K2KA 1LT3D 3X3MA 4RHSA 2B2WA 5FO9B 1L0XB 2NN6G 1NAPA 3TDQA 1VF7A 2M9VA 3H09A 4ZAIA 1EFID 1VMCA 2PPBC 1WTQA 3S1NB 1LTAD 1YNJD 2JA6B 5I6WA 3OIQA 5E3FA 3J7YW 2B2TA 4A3GB 1SYGA 3OOCA 2OEOA 2O4XA 3GTJB 2M2LA 1O7YA 2B2UC 3J7AV 4PMWA 1JICA 2EYJA 3HOWB 3CKIB 1PZJD 3TP7A 3K5MA 1OXTA 2SDFA 1SYEA 1CA6A 4NP5A 4L8JA 4XQNA 1I4RA 2OF1A 1EY5A 3VR2A 3S1RB 1E2VA 5FO8B 1RTNA 3KBGA 1LTTD 5C4JB 3VR4A 2K1BA 5I4DA 2BDOA 1I6VC 1TU2B 2LY7A 5KYIA 4OO1H 1DCZA 2Q8IB 1IYUA 1JOKA 2NVTB 1S5ED 3J80L 4DXGA 1SFOB 4RKBA 1TIID 2K05A 2A6ED 2A68C 2RSNA 2JEAI 2BE5C 1TQOA 2D9UA 3OHXC 3T53B 1ONLA 4CGYB 4IFDJ 1VF5C 1MSGA 1CA5A 4K5XA 3WOEA 2L9HA 1EYCA 5JEAG 3CRLC 2CHBD 1PFNA 2QCPX 3QG1A 3DHQA 1HTLD 2K03A 1JCKB 4DK1A 3MFYA 4IFDI 4LK1C 1PRTF 4RCOA 4TQUS 2WACA 5EPKA 3VR3A 5CYUA 3GTQB 5J22A 2EYMA 1UEAB 4FVMA 1CZGA 3NE5B 1ENCA 2ICEC 3SEBA 1E2WA 4QMGA 1TWGB 2EY6A 4EGVA 3TBIB 3S14B 4F87A 2KQ3A 1GOZA 4HMIA 1BCPC 2IX0A 5JVH3 5C3EB 2F0EA 1V8QA 2DY7A 2F0QA 1Z47A 3NWSA 1KNEA 1D5XC 2F0OA 3MEHA 4N9TA 1RF2D 1ILPA 1FNWA 5IGDA 2E2HB 2E2JB 1F2YA 5IT9L 2RDGA 1A3TA 1HFNA 1YNNC 1A6XA 5FLXL 1KDCA 2HQEA 3BYYB 1J9OA 1KAAA 2XRQD 5E4WC 1WD0A 5M5YB 5IOCA 1IW7D 1KLGD 4KKUA 3NWTA 2Z8LA 5NUCA 2RQXA 5CV7A 5M5WB 1I4GA 3OMGA 5K36H 4GZYC 2K5DA 3TSSA 1WCMB 1QNKA 2R92B 1STGA 4A3KB 1HUMA 5LL6X 3J81L 1ML0D 1PZKD 3NTHA 1AN8A 1G2SA 1Q1BA 2X6GA 5C0XJ 1NR4A 1WTWA 1GJXA 4XQQA 1NUCA 1HTPA 3NP8A 1V1OA 2B2VC 3OIPA 4ZKBB 3PUZA 2LFNA 4A3EB 3HG9A 3TZDA 4J1MA 3S9WA 4JK1C 3F2UA 4RAUC 3D8GA 2SEBD 4XYQA 4Z9CB 1OXXK 1O7ZA 4ZQ3A 3I8ZA 4QCLA 1Q1EA 3LX0A 4DXFA 2LMCB 1LTSD 1PFBA 1SNQA 3J80E 2NN6H 4P2CB 4WFN3 3A56A 4KJOA 1HCZA 2JSOA 3TZUA 3NTIA 2PO4A 3S16B 3W2DA 4TSSA 4KN7C 3M85A 5DM73 1H9MA 1SE2A 5HURA 3FMCA 3TMEA 2EY2A 1J8IA 4EQNA 1SDFA 2KHSA 3S2HB 4K2LA 5IGEA 4FYDA 1SMYC 2L1BA 5J39A 1RCVD 5KEEA 1DOMA 4F7XA 2IX3A 4FNFA 2A68D 1JB3A 2BE5D 5C4XB 4RHRA 4IQZA 1QE6A 4K5WA 4DK0A 5T1GA 3VYRA 4OGQC 1CI3M 3PIO3 5CV6A 2F4IA 1IKLA 2D2CC 3DXJC 2EDGA 3OWEB 5EKKA 4XQJA 3MFGA 3AB9A 4ME5A 5ELFA 1SNMA 2EYOA 3P75A 4X3KA 2FMCA 2B2UA 5C3XA 3KLRA 3HGBA 5CV4A 4RFBA 2JYOA 1TWHB 1SXTA 1VDZA 2DY8A 5IT9E 3ERQA 3CQZB 5EJWA 5FLXE 1ZEQX 2K6AA 2K04A 5JEAH 2N88A 3GV6A 3VR6A 2Z4IA 2F03A 2EYLA 4KV6A 1BCPD 3H0GB 2O5JC 3RLFA 2N55A 1ET6A 4FO2A 1QCBD 1TS2A 3C2PA 1ILQA 1II3A 2QILA 2WV6D 2JA7B 3A8KE 2RA4A 3J81E 2L4NA 1YNND 1PMRA 4UDUC 1EWCA 4QF4A 1Q8IA 2A6EC 1JR0D 1F9RA 4OL7A 1XWEA 5CGKA 1EOTA 2F0SA 3OPOA 5C3WA 2ID0A 4XT1B 1STHA 3T16A 1BO0A 3PIP3 2XVSA 5LHY1 2SNSA 4C3JG 3A7LA 1GHKA 2F0FA 4XXEA 4N9PA 3GTKB 4G7HC 1RODA 1F2ZA 2XWBB 2JEBI 2F0UA 5ELCA 3D4WA 1EY0A 4JBWA 5EQ0A 2HUGA 1STBA 1HQMC 4BA1I 2IW3A 1BF4A 3SHLA 3S1MB 4IUTA 1I4PA 1AFPA 2QEJC 2RBMA 4XIGS 3SE0A 3MTSA 5A2QL 3NUCA 4QUCA 1B4OA 2ENBA 5IGFA 4A3BB 1LO5D 1Y8OB 5E4XA 1KTKA 4IN3A 3HS0C 2GA4B 4KD3A 4G57A 1TWAB 4A3JB 1I4HA 1BCPB 2A6HC 2PQEA 1CQFA 1DOKA 4R9WA 3NQTA 1ET9A 3N52A 1C8CA 4EQPA 5BN5A 3FPPA 1SMYD 1XYIA 1FNVA 1KDAA 3GTGB 4CKBA 2R7ZB 1S5FD 2KOLA 2F0IA 3QWNA 1U9RA 2NVQB 2PYKA 3KK7A 4QUFA 1DONA 1PTOD 3C46A 3D31A 4O1NA 2B63B 3EQLC 1K83B 3HOUB 2FJ2A 2IT1A 1FD7D 3CRKC 1E0BA 4G4KA 3HOVB 3SR1A 3HOXB 3QB3A 1ENAA 4KN4C 2J0TD 1STNA 1BUVT 2ZXRA 1I50B 4CKEA 2X6LA 3E6ZX 4B9WA 5IODA 4YIJA 1CHQD 1BDOA 2RKSA 1TT2A 5G3LD 3I4NB 1S4ZA 1DM0B 4RKLA 3A54A 2XN9C 2EJFC 4IUUA 3Q22A 1Q12A 2D5DA 1A3UA 4HTHA 4IZ8A 3DUZA 1DJRD 2HDMA 2F0DA 3I73A 1PFMA 3PO2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OL7 A;  2PQE A;  4J6H A;  5CGK A;  5CV8 A;  1EYC A;  2F0S A;  5J39 A;  4PNY A;  5KEE A;  2F0M A;  5DEH A;  4QB4 A;  4DF7 A;  1STA A;  4F7X A;  5IGG A;  5KGU A;  3H6M A;  3NQT A;  1STG A;  2PZW A;  4DGZ A;  5C3W A;  5K5P A;  3QOL A;  1A3V A;  5J1Z A;  3TP6 A;  1EY7 A;  3ITP A;  5KYL A;  5I6W A;  1STH A;  2EY5 A;  2F0P A;  2OXP A;  3DHQ A;  3DMU A;  4K6D A;  5E3F A;  3T16 A;  4IUN A;  4EQP A;  5C4H A;  1EZ8 A;  5CC4 A;  3C1F A;  4K5W A;  4R8N A;  1SYG A;  2SNS A;  2F0G A;  2OEO A;  1KDA A;  2QDB A;  2O4X A;  3BDL A;  4ODG A;  1NUC A;  4KJN A;  1SNO A;  5CV6 A;  5C5M A;  2F0F A;  1EYD A;  3NHH A;  3NP8 A;  3V2T A;  5DAU A;  3S9W A;  2NUC A;  3P1H A;  4N9P A;  2WAC A;  5E1F A;  2F0I A;  3BDC A;  3MVV A;  5EKK A;  4NMZ A;  1F2M A;  1EY9 A;  2EYJ A;  1U9R A;  5M9O A;  3TP7 A;  4MIU A;  2PYK A;  2EYM A;  5J22 A;  2EYP A;  4ME5 A;  4E6I A;  2PZU A;  2F0T A;  1F2Z A;  5C6A A;  3QOJ A;  1SYF A;  2F0U A;  2RDF A;  4J1M A;  3HZX A;  4KY6 A;  1ENC A;  3MXP A;  3SK4 A;  4EQO A;  1SNM A;  1SYE A;  2EYO A;  3OSO A;  3P75 A;  5HGT A;  4H7B A;  1EYA A;  2PW5 A;  1AEX A;  4QMG A;  3D4W A;  5C4Z A;  1KAB A;  3D8G A;  2EY6 A;  2F0K A;  4NP5 A;  5C3X A;  1EY0 A;  5F2D A;  1JOR A;  4B9X A;  4PMB A;  5CV4 A;  2OF1 A;  4DFA A;  1EY5 A;  3PMF A;  1STY A;  4ZQ3 A;  1EY8 A;  3SK6 A;  2KQ3 A;  4NDX A;  1STB A;  2F0V A;  4K8I A;  4F8M A;  4KY5 A;  5CV5 A;  1SYD A;  3LX0 A;  1SNP A;  5ISR A;  3R3O A;  4HMI A;  2PW7 A;  5I6Y A;  1A2T A;  3MZ5 A;  1NSN S;  2EY1 A;  4KHV A;  4NKL A;  2F0L A;  4S3S A;  3SHL A;  2F0H A;  3QB3 A;  1ENA A;  4K8J A;  4ZUJ A;  1STN A;  4PMC A;  3ERQ A;  3SK8 A;  3TP8 A;  4KD4 A;  1SNQ A;  2F0E A;  2F0Q A;  3T13 A;  5JOB A;  5EKL A;  4K14 A;  5EGT A;  2F0O A;  3D6C A;  3MEH A;  1SYB A;  1SND A;  2RBM A;  3OMC A;  4KJO A;  4KY7 A;  4N9T A;  5KYI A;  2SNM A;  1IHZ A;  5CR3 A;  3U9O A;  2EXZ A;  4IAL A;  3C1E A;  3E5S A;  4ID6 A;  4B9W A;  5IOD A;  4HMJ A;  5JAV A;  5IGD A;  4YIJ A;  2EYL A;  3SR1 A;  3TP5 A;  3NUC A;  1JOK A;  3ERO A;  2RKS A;  1SYC A;  1F2Y A;  1TT2 A;  4KV6 A;  3SK5 A;  4EVO A;  1A3T A;  2F3W A;  1A2U A;  1KDB A;  2ENB A;  4RKL A;  1JOQ A;  3NK9 A;  3VA5 A;  5I9P A;  2LKV A;  1RKN A;  4TRD A;  4WRD A;  5IGF A;  5HUR A;  1KDC A;  2HQE A;  3EJI A;  3TME A;  5CV9 A;  2EY2 A;  5C5L A;  1A3U A;  4HTH A;  5KIX A;  4I65 A;  4IZ8 A;  1JOO A;  5KRU A;  3EVQ A;  1KAA A;  1EQV A;  3NXW A;  5I9O A;  3HEJ A;  4RKB A;  3SXH A;  4EQN A;  5IOC A;  1EY6 A;  4K2K A;  4ZUI A;  2F0N A;  1II3 A;  2F0D A;  2SOB A;  1SNC A;  2F3V A;  2EYH A;  4KTA A;  2M00 A;  4DU9 A;  5IIF A;  1EY4 A;  1TQO A;  2KHS A;  3OWF A;  4KD3 A;  4K5V A;  4LAA A;  4K2L A;  5IGC A;  2F0J A;  4G57 A;  2PZT A;  1EZ6 A;  5NUC A;  3MHB A;  5IGE A;  5CV7 A;  3RUZ A;  4QF4 A;  5IGB A;  1TR5 A;  2F0W A;  2EYF A;  4WOR A;  4K5X A;  3OMG A;  3D4D A; 
#chains in the Genus database with same CATH topology
 1MJC A;  3J81 i;  3CU7 A;  4PQX A;  1HNX L;  3K57 A;  3CF5 A;  2UUA Q;  3ICE A;  4OIK A;  2A74 C;  4IOA A;  3K59 A;  4RWS C;  3RZD H;  1G51 A;  3MXG A;  1WTH A;  1H9J A;  2B2Y C;  3I4O A;  3RZD B;  2WP8 J;  1B50 A;  1U4P A;  3TRZ A;  4H13 C;  4C56 C;  4ODG A;  2IJ0 A;  1B9M A;  1EWI A;  1SSO A;  2I0Q A;  1FJG L;  4JC0 A;  2D0O A;  1FR3 A;  4LMQ D;  1PRT D;  5M9O A;  2O5I C;  5JEA J;  3K0Y A;  3BZD B;  4ZKC B;  3Q6S A;  4IFD G;  2PW5 A;  1YI2 A;  3T51 B;  4Y52 H;  4LJZ C;  4DAY A;  2BA0 A;  1XTC D;  1U4M A;  5M3F H;  1EIH A;  2UUA L;  4C3H G;  1B53 A;  1MKH A;  4NDX A;  1Q81 C;  5CV5 A;  3I56 A;  4GNX A;  5M3F B;  1D1K A;  3R3O A;  5DM6 3;  4X3T A;  3ONA B;  2DNC A;  5A2Q E;  1QVF A;  1LT4 D;  4BY7 G;  1FVI A;  3VR5 A;  3W1B A;  5AJ3 Q;  3UDG A;  3S1Q H;  1TWG H;  1S3O A;  5EGT A;  3D6C A;  4LUO A;  3J80 c;  2Y0S B;  1LAC A;  4RGN A;  3ZJY C;  3LWE A;  3U9O A;  2E74 C;  3CCR A;  2EXZ A;  3S1Q B;  3KF6 B;  4HCS A;  4JI7 Q;  4ID6 A;  3GTM H;  3PUW A;  5A35 A;  4LWC A;  1JQY D;  2NZH A;  4JI3 Q;  2XWJ B;  1JOQ A;  1XNQ L;  3VA5 A;  4GNX B;  4HSV A;  3GTM B;  1I4X A;  2BDN A;  2UXD Q;  1KD1 C;  4C3J H;  5KRU A;  3CCM A;  5IYC G;  1RL2 A;  5I9O A;  1PYS B;  1OXS C;  1DYQ A;  2CQO A;  4A3F B;  5EAY A;  3J7A F;  2K32 A;  4C3J B;  3L0O A;  1GD7 A;  2E2J H;  1B3Q A;  2VNU D;  3GTO H;  5AJ3 L;  3CXC A;  1Q46 A;  4DR5 L;  1ENF A;  4HAE A;  3CHB D;  4H44 C;  1TR5 A;  1CUK A;  1JC7 A;  3M4O H;  2EJM A;  1I6H H;  2PNH A;  3GTO B;  4P71 A;  3R8B A;  2PI2 A;  4A3L G;  4DF7 A;  2RCN A;  1VQA A;  3M4O B;  2NVX H;  1I6H B;  5J1Z A;  5KNC A;  3T1H Q;  1JJG A;  2HCI A;  3STB D;  2E76 C;  2NVX B;  1EYG A;  2A6H D;  1I4Q A;  4ZRZ A;  5C5M A;  2MQH A;  4BA2 I;  1EYD A;  1Q82 C;  4AYB G;  1WCM H;  1XX8 A;  1HRJ A;  4NMZ A;  2JA8 G;  4HR7 B;  1F2M A;  2H1E A;  1VQN A;  1EY9 A;  1HNZ Q;  1F2L A;  3K7A H;  3AFP A;  3CPW A;  3DWA A;  4DN4 M;  1BXT A;  4NW2 A;  1PZI D;  2F0T A;  4OEL B;  3HKS A;  4LF6 L;  4EQO A;  4LFC Q;  3MXP A;  3K7A B;  5TSS A;  2RF4 A;  4HSP A;  1B44 D;  2K5W A;  4ZCK A;  1U4L A;  3I4M H;  1EEF D;  1RDP D;  2K28 A;  5F2D A;  4X64 L;  1B9N A;  4X65 Q;  2KBN A;  4C3I G;  4KHZ A;  4X6A H;  3I4M B;  4A3E H;  1ZKO A;  2B2W C;  2A19 A;  1KQS A;  2AQ1 B;  3TN2 A;  2CW0 C;  4FXD A;  4RCN A;  3TP8 A;  3S17 H;  2BH8 A;  4JI0 Q;  3G71 A;  2JA5 H;  3G6J B;  1X3Q A;  2OT2 A;  2IWH A;  5C0X I;  1AP0 A;  1NTG A;  2NVY H;  1RD9 D;  3S17 B;  4DAP A;  1HNZ L;  3C1E A;  3G6E A;  3BVM A;  5JAV A;  1E2Z A;  3U9S A;  3VYU A;  2JA5 B;  2B2T C;  4N8F A;  1Z7T A;  3OTO Q;  2WII B;  5BR8 Q;  2NVY B;  2KHJ A;  4LFC L;  2VUM H;  1PH9 A;  1KDB A;  1CKN B;  4HN7 A;  1RKN A;  3Q8D A;  3SDZ A;  2YYZ A;  3FDT A;  5IP9 G;  1PV4 A;  3TEH B;  2K01 A;  1YHB A;  2VUM B;  2FFK B;  1HZ9 A;  3LGJ A;  2BOS A;  3HEJ A;  3BYT B;  1JB7 A;  1E1O A;  5BN3 A;  1VQO A;  4GOP B;  3FPU B;  4MTK A;  3KLS A;  1EY4 A;  3D3R A;  1J6Q A;  2PMZ B;  3K80 C;  2DJF C;  2XNA C;  2IX1 A;  1GUS A;  3NQI A;  1VQ4 A;  2E2I H;  5IWA L;  2YTX A;  4DV4 L;  3J81 c;  1M4V A;  3HOU G;  2YTV A;  3KOJ A;  3O13 A;  5CV8 A;  4A4I A;  4JI8 Q;  2E2I B;  3I91 A;  2KCN A;  3NBH B;  1UE5 A;  5FKA C;  3CAM A;  5LL6 S;  2E2D C;  4BWG B;  2KHI A;  1EY7 A;  4BY1 G;  4CDD C;  5KYL A;  5BR8 L;  1TVX A;  2EY5 A;  1HPC A;  4FF3 A;  3I3C A;  1EZ8 A;  3E9I A;  5CC4 A;  1OTC A;  1H9S B;  3R2T A;  1G6Z A;  3LNN A;  2F4V L;  2L12 A;  1LV9 A;  2F0G A;  1DGS A;  3AYH B;  1M8A A;  3K5N A;  1LTB D;  3V2T A;  2QF7 A;  4GLV B;  1O7I A;  1K8A C;  1HR0 Q;  1VS0 A;  1X56 A;  1MI2 A;  4G7O C;  4RGM A;  5EKI A;  3MXN A;  4C1N I;  2V4D A;  4FXK C;  5C4Z A;  3PO3 G;  2BA1 A;  4B9X A;  1VQI A;  1PTO C;  5CBA E;  5DLQ E;  4DFA A;  4DR4 Q;  4GKK Q;  1XPO A;  4HJA A;  1S5D D;  2I46 A;  2NZ1 D;  4J8Q A;  4LF8 Q;  4IUQ A;  2OQK A;  4DR1 Q;  5HGQ A;  1Y1V G;  4PMC A;  2B39 A;  3V96 A;  3M7G A;  4EQ5 A;  1PYB A;  4UY8 C;  2VS1 A;  3T13 A;  3AFQ A;  1HHV A;  4KY7 A;  4R8I A;  4AH6 A;  5COR A;  5D3I B;  1YIJ A;  3IFT A;  2Z9H A;  4DNR B;  1V1P B;  1V43 A;  4HMJ A;  1FGU A;  1Z6H A;  3TP5 A;  2ZTD A;  5JJZ A;  4L63 B;  1IZ6 A;  1NNX A;  4IUV A;  4OWX B;  5GQO A;  2NTT A;  5FLM G;  2DGY A;  3EFX D;  4P74 A;  5LMU L;  1IBL Q;  3EJI A;  2PCF B;  5KIX A;  4OO1 I;  3EVQ A;  1L0W A;  4HED A;  2EJG C;  3SXH A;  4ZUI A;  1HFG A;  2F0N A;  5FO7 B;  3GTP H;  1J5E Q;  4KHP L;  2CVR A;  4DKA C;  4OIJ A;  5EPL A;  3FHW A;  1QG7 A;  3S2D H;  4IPD A;  2IL8 A;  3GTP B;  5GAE C;  1M90 C;  4WOR A;  4KHV A;  1ZXT A;  4V0B A;  1UAP A;  4IFD H;  2HD3 A;  3S2D B;  1TKW B;  5KGU A;  2NZO A;  4IPC A;  1MHW C;  4QJF A;  4JBK A;  4C3H H;  3NTK A;  2A5H A;  4OEM B;  1HXY D;  2BCO A;  2F0P A;  4RGT A;  3CME A;  3AU7 A;  4KK7 A;  1GUG A;  1PVO A;  2A69 D;  4C3H B;  1RJT A;  1IBL L;  3IFD A;  4BY7 H;  4A3I G;  1L2F A;  1EUJ A;  3BDL A;  3E9H A;  2PI2 E;  5KNB A;  1ZYR C;  1F9S A;  1QZH A;  5E1F A;  2K7V A;  4BY7 B;  1J5E L;  4PV1 C;  3W5O A;  3Q24 A;  1QOH A;  2Z6K A;  3D0F A;  4OON A;  3QOJ A;  3MC0 B;  4CDF C;  1BCP F;  1PRT C;  1YIT A;  4MN3 A;  1Q86 C;  2Q2T A;  1VQP A;  1EFW A;  1R4P B;  5I2X A;  4JCV E;  5LMN Q;  2F0K A;  4A3F G;  5IP7 G;  2KVM A;  3TS0 A;  4OWT B;  4DV0 Q;  1OXV A;  5IYC H;  3RMH A;  4JI4 Q;  5T1I A;  4K8I A;  2Q2I A;  3Q0A A;  5GAD C;  3KDF A;  2CH4 A;  2PW7 A;  3I55 A;  4L6T B;  1AE2 A;  4NKL A;  2WAQ G;  2EPB A;  4O42 A;  2E5L Q;  3DEO A;  3T56 B;  2HHH Q;  4KMU C;  4DV2 Q;  2QDL A;  1WJJ A;  3OMC A;  2CCZ A;  1JE4 A;  1N9W A;  1WOC A;  1Y8P B;  3F2B A;  4A3L H;  1VQC A;  1EU4 A;  3UE0 A;  2JXM B;  5KND A;  3MXU A;  1EIG A;  3F2C A;  2R93 G;  4X3S A;  2KED A;  5ELO A;  4CKC A;  3BS1 A;  3FKI G;  3DWQ A;  1TY0 A;  2CW0 D;  2MUY A;  4B3T Q;  1JWS D;  4U68 A;  5C5L A;  2XRS D;  4X62 Q;  3NEM A;  1MSH A;  2ATW A;  2C5C A;  2PMZ E;  4H0L C;  3MWY W;  1PH4 A;  4JI4 L;  1NR2 A;  2EIF A;  2JA8 H;  1ESR A;  1EOV A;  3R93 A;  4KKT A;  3J80 i;  5IGC A;  1WVL A;  1TWF H;  1U4R A;  4AYB B;  3T4A C;  4MZ9 A;  4FDB A;  3RUZ A;  3L3O C;  2E5L L;  2JA8 B;  1UUP A;  2HHH L;  1SJH D;  2I07 B;  4J6H A;  4JBJ A;  1TWF B;  2KCM A;  2HIX A;  2VQF L;  5IGG A;  3MA2 B;  3HOZ G;  5K5P A;  4C3I H;  3TP6 A;  3ITP A;  2N3S A;  1H9R A;  1R4Q B;  3DMU A;  1G29 1;  3AQQ A;  4IUN A;  2ZT9 C;  2CQA A;  2K5Q A;  3GQB A;  5HY6 A;  3FEW X;  4R8N A;  3FRP B;  4C3I B;  1B3A A;  3V05 A;  2KJX A;  1A62 A;  4A3M G;  2EE1 A;  4ABN A;  3STB C;  4C2M H;  3NHH A;  1OXU A;  1UNS A;  2D62 A;  1LT5 D;  3P1H A;  1PDQ A;  1XMO Q;  2JA5 G;  3BVG A;  2I5L X;  2L11 A;  3NBI A;  1MD2 D;  1KLU D;  4DK3 C;  4BBS G;  3RN5 A;  4HIM A;  4Q0F A;  4C2M B;  2ZXO A;  3H3V C;  4L5S A;  2PZU A;  3HP3 A;  3HZX A;  1ESF A;  3KF8 B;  1N8R C;  1K8O A;  3NSW A;  5D14 A;  2AMC B;  1K8M A;  2R6G A;  3P7J A;  5IP9 H;  1DXM A;  2K5N A;  2AHO B;  3MAQ A;  3UDF A;  1CSQ A;  1SBB B;  2XIW A;  1TXY A;  2GVA A;  4A75 A;  5JPN C;  3HOY G;  2WB1 B;  3K8A A;  2VL6 A;  3L9A X;  3K5O A;  4GLX A;  4ZUJ A;  3ND9 A;  3CMA A;  4DR6 L;  4KI0 A;  3HOU H;  1S40 A;  2HDL A;  4BBR G;  1VQL A;  3N6R A;  3J81 j;  1SN8 A;  4JI1 Q;  1BBU A;  2JJQ A;  4DV7 Q;  2G9H D;  3AMU A;  4BY1 H;  2B2V A;  4K0K L;  4POG A;  2ZJQ A;  1VCI A;  2NN6 I;  2AKW B;  1Y69 U;  4A93 G;  4WRD A;  4OWW B;  4JOI C;  4BY1 B;  3RN2 A;  3I72 A;  3NXW A;  1JT8 A;  2ZJP A;  4LNQ A;  3KLW A;  3PCO B;  1N32 L;  2SOB A;  4DU9 A;  1SNC A;  4R1J A;  1GUO A;  4LAA A;  4DAV A;  1MBY A;  2PZT A;  1SEB D;  5C44 G;  1T5X D;  1A63 A;  2DUD A;  3I4L A;  4RA8 A;  2L55 A;  3D4D A;  1PTO F;  1SE8 A;  4FF4 A;  3KFU A;  4NPS A;  2Q8T A;  4QL5 A;  3PO3 H;  5DEH A;  1G2T A;  4JI1 L;  1UEB A;  3H94 A;  4DV7 L;  2K33 A;  4JI6 Q;  3PO3 B;  4FP5 D;  1AZP A;  4YHH Q;  1M1K C;  2UUC Q;  3OW7 A;  2JK8 A;  4GN5 A;  2YTY A;  1Y1V H;  1O7L A;  2NBF A;  3CD6 A;  1JJC B;  4KJN A;  2PNR C;  4IUR A;  3GDE A;  1SE4 A;  3RZO H;  2KCT A;  1Y1V B;  1B1Z A;  3EA6 A;  4G7Z C;  3HRZ C;  4R4C A;  4F88 A;  4LF4 L;  4A3D G;  3RZO B;  5G3L F;  4KY6 A;  2L5T A;  4H7B A;  3SGI A;  5FLM H;  2ALY B;  2GN5 A;  1P8L A;  1KRS A;  1ZYR D;  1GM5 A;  1IBM Q;  3ER0 A;  1A8V A;  1S5C D;  4DPG A;  1LT6 D;  3DWP A;  2QGQ A;  1A2T A;  3MZ5 A;  5IYB G;  1I94 L;  4H02 A;  4M1U B;  4DV5 Q;  2R61 A;  2L0C A;  1CM9 A;  2J7Z A;  1ICF B;  3SVM A;  2HCC A;  2DJG C;  1HA5 A;  4CDE C;  3MEF A;  1LTR D;  3JAM L;  2MPM A;  2IY5 B;  2Q2H A;  3KF6 A;  3QO2 A;  1EEI D;  1U0L A;  3K81 C;  1CHP D;  5CMD A;  1CQV A;  2G9D A;  5FK9 C;  2LKV A;  3Q23 A;  1WTX A;  2KUM A;  3A5Z B;  5CV9 A;  1PTO H;  4A3I H;  4BXX G;  1IL8 A;  1JOO A;  1W6J A;  1IBM L;  2IPK D;  1OO9 B;  1FNU A;  4AYB E;  5J3B A;  4ZLT F;  1PTO B;  2F3V A;  4A3I B;  2M00 A;  4ULL A;  1ASY A;  3OWF A;  4K5V A;  1D5Z C;  1SR3 A;  2YU9 H;  4UAI A;  3LWU A;  4DV5 L;  1LAB A;  5ELB A;  1IYV A;  5IGB A;  4OX9 Q;  1O78 A;  2NWG A;  1LLR D;  1DOL A;  1Y8N B;  2YU9 B;  3DM1 A;  4B08 A;  4PNY A;  1MJE A;  2F1M A;  3W3A A;  1H9K A;  5IP7 H;  4A3F H;  1X9N A;  1TWC H;  4DUY Q;  4HCE A;  3CCE A;  2PZW A;  4LFA Q;  1Y1W G;  2VXW A;  1SRO A;  2OXP A;  1IBK Q;  3IKJ A;  2B8G A;  1TWC B;  1WTV A;  1TS3 A;  1UE6 A;  2WKD A;  2FMM A;  1PXU A;  1I5F A;  2KEE A;  2OQ0 A;  1BOS A;  3QIA A;  2NTS A;  2A69 C;  2ICI A;  2K50 A;  2WAQ B;  1JMC A;  4I7A A;  2Z1C A;  4MIU A;  1CK1 A;  4JI2 Q;  1QB5 D;  4JI7 L;  2R93 H;  3IAY A;  3SK4 A;  4RGO S;  3FKI H;  1CTM A;  2Z6B A;  3ND8 A;  4LUZ A;  4JI3 L;  5EPJ A;  1LTG D;  1SE3 A;  2R93 B;  2MGS A;  4PG3 A;  1Q90 A;  3PUV A;  2UXD L;  1VQJ A;  1RHP A;  3FKI B;  3PMF A;  2H4O A;  3TQY A;  1EY8 A;  4LFA L;  5DNF A;  1VQ8 A;  4F8M A;  4JV5 Q;  2WFW A;  3X3N A;  1SNP A;  5I6Y A;  2EY1 A;  4R4T A;  1CT1 D;  4K8J A;  4QIW B;  2A8V A;  3SK8 A;  1EL0 A;  2WKC A;  4FXG C;  5ELE A;  3BU2 A;  3CP0 A;  1W6K A;  5EKL A;  2UXB Q;  1DD2 A;  3I90 A;  3I7F A;  4CJ1 B;  3E5S A;  3GD7 A;  3HOZ H;  4JI2 L;  1WTP A;  3KBX A;  3ULL A;  2VB2 X;  5M3M G;  4GKJ Q;  1A2U A;  1NJI C;  1CKN A;  5I9P A;  3T1H L;  4CHT B;  3HOZ B;  1X32 A;  1K28 A;  1EQT A;  1PRT B;  3A0J A;  1YHA A;  3CPF A;  3M4P A;  4A3M H;  1A15 A;  4PZ7 A;  3IRB A;  1KXL A;  5C0X G;  3S15 H;  2VQE Q;  5IT9 c;  4KTA A;  4LW1 A;  4HIK A;  4GOP A;  4DNT B;  4A3M B;  3GO5 A;  4BBS H;  5FLX c;  2F0J A;  3S15 B;  1EZ6 A;  2EVB A;  1AH9 A;  1VQF A;  1LTL A;  1TS4 A;  2E75 C;  2UXB L;  4BBS B;  1KC8 C;  5M5X H;  5E7N A;  2P5Z X;  1LUZ A;  2X69 A;  4N8X 1;  1KL9 A;  1EWH A;  3NBH A;  3M3Y H;  1JWU D;  3A74 A;  1PLF A;  4NXN Q;  1STE A;  5M5X B;  4X65 L;  4DV1 Q;  2WB1 G;  3H91 A;  5JVG 3;  4GKJ L;  4CJ0 B;  1QVG A;  3M3Y B;  1LTI D;  3HOY H;  1D2B A;  2RSO A;  1H9S A;  3RD4 A;  1TY2 A;  2FHT A;  4ALP A;  5H1S E;  4JI5 Q;  5JJL A;  3BVZ A;  3HKZ B;  3HOY B;  1GHJ A;  1QZG A;  4UP8 A;  4JI0 L;  2KCC A;  3WWV A;  3BDC A;  5FOB B;  4BBR H;  1CFM A;  1VMP A;  4JBM A;  4I7Z C;  4E6I A;  1QVC A;  5C6A A;  1VQE A;  4DR7 Q;  4BBR B;  3OTO L;  1QIL A;  1BR9 A;  3OSO A;  2XSC A;  4A93 H;  4YY3 Q;  2JQO A;  2OCE A;  4NB3 A;  1G91 A;  4A3G G;  1D5M C;  2AUJ D;  2RDH A;  2AUK A;  4R4Q A;  3JAM E;  1C4Q A;  3PUY A;  2Q8R E;  3SK6 A;  4A93 B;  1VQB A;  3R2I A;  4K6L A;  3VA7 A;  3J7Z C;  2BH2 A;  2F0H A;  3UDI A;  4KD4 A;  5ELD A;  5C44 H;  3EBE A;  4OHJ A;  4JI5 L;  4BS9 A;  1SND A;  2HT1 A;  1IHZ A;  2ASB A;  4UPA A;  5FJ8 G;  5C44 B;  4LF7 Q;  1HUN A;  3H3V H;  4JI8 L;  1V1P A;  1HQR D;  1X3F A;  1JWM D;  5D3D A;  4HJ8 A;  1BNZ A;  3SK5 A;  2R7D A;  2F3W A;  3D6W A;  3PUX A;  2ZXP A;  1FGB D;  1F77 A;  3C3L A;  4XT3 B;  2RHS B;  3I2Z A;  2MJ8 A;  3M7N A;  4UHV A;  2KEN A;  2Y0S E;  4M8A A;  4CBV A;  4J15 A;  1EY6 A;  2KA7 A;  1YNJ C;  4U67 3;  1SAP A;  5IIF A;  1BKB A;  1W3S A;  1HR0 L;  1O80 A;  4A3D H;  1AW7 A;  2F0W A;  2MHV A;  2EYF A;  1BBX C;  3I70 A;  1RIP A;  1XXG A;  2QW7 A;  2DN8 A;  2TSS A;  4OO1 G;  4A3D B;  1N33 Q;  1F9Q A;  4LF7 L;  1STA A;  3H6M A;  4DGZ A;  1A3V A;  1GUW A;  4DR4 L;  4GKK L;  2LS0 1;  4K6D A;  3A8J E;  2O2L D;  4V19 0;  4XYO A;  1X3P A;  2AQ3 B;  1L1O C;  1S5B D;  2C9O A;  1MIU A;  5IYB H;  4LF8 L;  2JE6 I;  1YJN A;  1IL2 A;  4DR1 L;  2QDB A;  4X3U A;  1SNO A;  1C9O A;  4CDC C;  5DAU A;  1ICW A;  5AFW A;  3UE1 A;  5I2Y A;  1HA6 A;  1L0Y B;  1UWV A;  3ZYY X;  1N36 Q;  1VQ7 A;  1I3Q H;  1MGS A;  2JP1 A;  1SYF A;  2WIN B;  2RDF A;  5JPM C;  4XDX A;  5HGT A;  1EYA A;  3A55 A;  1AEX A;  1PHJ A;  1I3Q B;  2EOT A;  2LXK A;  4XTC S;  4BXX H;  3VYT A;  3WOF A;  2J4X A;  2OTL A;  1GXD C;  1X55 A;  1STY A;  4ZYS A;  1PH7 A;  3T1Y Q;  1PH6 A;  3K58 A;  3URY A;  2QKI C;  3GP7 A;  2R3Z A;  1K0R A;  3KUP A;  2B2Y A;  2CWP A;  4YCW A;  3ULP A;  5JOB A;  3KLS X;  3UI2 A;  5GRO A;  4K14 A;  1KNA A;  4ILW A;  2SNM A;  5CR3 A;  4MHE A;  1CSP A;  1G8Z D;  4HJ5 A;  3G7L A;  2DNE A;  3K6O A;  1VQG A;  3FVQ A;  3L7Z C;  1Y1W H;  3ERO A;  1SYC A;  1T5E A;  4B3S Q;  4EVO A;  1HH2 P;  2AWO A;  2JN4 A;  1FYC A;  3KYH C;  5BN4 A;  2MP1 A;  1Y1W B;  1F9P A;  1EQV A;  3T1Y L;  1YEZ A;  4JG2 A;  5CBE E;  3PV0 A;  1PYW D;  1PH8 A;  4Y7N H;  1QJO A;  5IYD G;  5JJK A;  2EYH A;  1C48 A;  4CJ2 C;  1GUN A;  4C1N K;  4Q5V A;  1X3G A;  3MHB A;  4Y7N B;  4AQY Q;  2N78 A;  1JJ2 A;  1BQQ T;  3NPP A;  4ZK9 B;  4RH6 A;  2F0M A;  4QB4 A;  5LMN L;  1R9T H;  1B2T A;  1PH2 A;  3E0J A;  3QOL A;  2C35 B;  4DV0 L;  1ASZ A;  1NCV A;  2E8G A;  1HNW Q;  3QJY A;  4FF1 A;  1QUQ B;  4R4I A;  5C4H A;  1R9T B;  2RVL A;  3K5L A;  3C1F A;  2AQ2 B;  1Z9F A;  2NYZ D;  4DA2 A;  1E3P A;  4NXM Q;  3UDX A;  3GTL H;  2NB0 A;  2D0P A;  2NUC A;  4B3R Q;  4DV2 L;  3MVV A;  3RLN A;  4TKO B;  5EBC A;  1B7Y B;  1EU3 A;  2Z4H A;  3VYS A;  3GTL B;  1CZW A;  1RTO A;  2FIN B;  3D4R A;  2EYP A;  1DZ1 A;  1SJE D;  1XMQ Q;  2MFI A;  1PH3 A;  4AQY L;  5K36 G;  2R92 G;  5M3M H;  3KF8 A;  4A3K G;  4FF2 A;  1AZQ A;  1KAB A;  1PH1 A;  4B3T L;  3P20 A;  1IXR A;  1IKM A;  3IL8 A;  4KKS A;  4PMB A;  1JOR A;  1WTR A;  5M3M B;  5EBD A;  4X62 L;  3CCV A;  2EZV A;  4LF5 Q;  5C0X H;  2F0V A;  2A73 B;  4IUP A;  4KY5 A;  1SYD A;  5D65 A;  1WTO A;  1K3B C;  5ISR A;  1C0A A;  3GV3 A;  3BG3 A;  3JAM i;  1NSN S;  4S3S A;  1VQ5 A;  2F0L A;  4JYA Q;  2A1A A;  2TMP A;  4A76 A;  1D1I A;  3A7A B;  4X66 Q;  1TS5 A;  2VB3 X;  1SYB A;  3BDO A;  1PFS A;  1WD1 A;  4IAL A;  1IW7 C;  2B3G A;  1D6E C;  2B8F A;  3EN2 A;  2XTI A;  1YHQ A;  3WDN A;  2AWN A;  3NK9 A;  2KEC A;  4TRD A;  3DEP A;  3K0X A;  2ZM6 Q;  3A8I E;  1QNU A;  3HKZ G;  1GUT A;  4I65 A;  5COY A;  4WJW A;  1QWY A;  3M4Y A;  1Q3L A;  4K2K A;  2CKZ B;  1XMO L;  1LT3 D;  2I5M X;  3X3M A;  1JE5 A;  4JVZ A;  4L5T A;  4RHS A;  2B2W A;  5FO9 B;  4APV A;  1L0X B;  2NN6 G;  1NAP A;  3TDQ A;  3S1N H;  1PA6 A;  1VF7 A;  3HFZ B;  4KLK A;  2M9V A;  3H09 A;  4ZAI A;  1EFI D;  1VMC A;  2PPB C;  1WTQ A;  3S1N B;  4MNO A;  1LTA D;  4A3G H;  1YNJ D;  2JA6 B;  5I6W A;  3OIQ A;  4DR2 Q;  5E3F A;  3J7Y W;  2B2T A;  4A3G B;  2OWO A;  1SYG A;  3OOC A;  2OEO A;  2O4X A;  3GTJ B;  2M2L A;  1O7Y A;  2B2U C;  4GS3 A;  3J7A V;  4PMW A;  4IJL A;  1V1Q A;  4UP7 A;  1JIC A;  2UU9 Q;  1Y14 B;  5FJ8 H;  2EYJ A;  3HOW B;  3CKI B;  1PZJ D;  4UP9 A;  3TP7 A;  4P72 A;  2CFM A;  3K5M A;  1OXT A;  2SDF A;  1SYE A;  3S1R H;  1CA6 A;  5C4X G;  1KIX A;  4NP5 A;  4L8J A;  4XQN A;  5C4J H;  2K52 A;  1I4R A;  2OF1 A;  1EY5 A;  3VR2 A;  2CH4 W;  3S1R B;  1E2V A;  2K75 A;  5FO8 B;  1XNR Q;  1RTN A;  3RLO A;  4DR2 L;  3KBG A;  1LTT D;  2LXJ A;  5C4J B;  3CC7 A;  4IPG A;  2OTJ A;  3VR4 A;  2K1B A;  5I4D A;  2BDO A;  2PQA B;  1UE7 A;  1I6V C;  1YJW A;  1TU2 B;  2LY7 A;  5KYI A;  2ES2 A;  2UU9 L;  2NVT H;  1DCZ A;  4OO1 H;  4P75 A;  3RR5 A;  2Q8I B;  1IYU A;  1JOK A;  1SFO H;  2NVT B;  1S5E D;  4TVA B;  3J80 L;  4JI6 L;  2K4K A;  4YHH L;  2UUC L;  3JC6 6;  4LUV A;  4DXG A;  3U4Z A;  1SFO B;  3TS2 A;  1XNR L;  2UXC Q;  4RKB A;  1TII D;  1VQ6 A;  2Z6K C;  2K05 A;  2A6E D;  1N34 Q;  2A68 C;  2RSN A;  2JEA I;  2BE5 C;  1TQO A;  2D9U A;  3OHX C;  3T53 B;  1ONL A;  4CGY B;  4IFD J;  1VF5 C;  1E7Z A;  1MSG A;  4WJ4 A;  1CA5 A;  4K5X A;  3WOE A;  2L9H A;  4P73 A;  1S72 A;  1AE3 A;  1EYC A;  5JEA G;  3CRL C;  1CKO A;  3H0G G;  4QY7 A;  2L15 A;  2CHB D;  1FL0 A;  1PFN A;  2QCP X;  3E3X A;  4JPB W;  3QG1 A;  3EIV A;  1XNQ Q;  3DHQ A;  1A0I A;  1HTL D;  2K03 A;  1JCK B;  4DK1 A;  1YVC A;  3MFY A;  4IFD I;  4LK1 C;  1VQD A;  1PRT F;  2JA7 G;  2G5D A;  3OYY A;  3GTQ H;  3F2D A;  2UXC L;  4RCO A;  4HIO A;  4TQU S;  2WAC A;  1YJ9 A;  5EPK A;  3VR3 A;  1N34 L;  3E0E A;  5CYU A;  1P16 A;  4DR5 Q;  3GTQ B;  5J22 A;  2EYM A;  1L1O A;  1UEA B;  3BJU A;  4POF A;  1VQH A;  4JW0 A;  4FVM A;  1CZG A;  3NE5 B;  1ENC A;  2ICE C;  3SEB A;  4DUZ Q;  1EIF A;  3S14 H;  2GVB A;  1E2W A;  4QMG A;  1TWG B;  2EY6 A;  4DAY B;  4IPH A;  4EGV A;  2HQL A;  3TBI B;  3RNU A;  3S14 B;  4F87 A;  2KQ3 A;  2VY3 A;  1GOZ A;  2H5X A;  5C3E H;  5IYD H;  1XPU A;  3JAM c;  4HMI A;  1D7Q A;  1X54 A;  1BCP C;  2IX0 A;  4PZ6 A;  2ZJR A;  5JVH 3;  1W2B A;  1L1O B;  5C3E B;  2F0E A;  1V8Q A;  4AIM A;  2DY7 A;  2F0Q A;  1Z47 A;  4OX9 L;  3NWS A;  1KNE A;  1SLJ A;  1D5X C;  2F0O A;  3MEH A;  3PIO A;  4N9T A;  1RF2 D;  2E2H H;  1ILP A;  4R4O A;  1HZB A;  3J7A 5;  1FNW A;  5IGD A;  3A5U A;  4LF6 Q;  4DUY L;  2E2H B;  2E2J B;  1F2Y A;  5IT9 L;  2WB1 E;  2RDG A;  1A3T A;  1HFN A;  1YNN C;  4DUZ L;  1A6X A;  5FLX L;  1IBK L;  5M5Y H;  1KDC A;  2HQE A;  4X64 Q;  2CWA A;  3BYY B;  1J9O A;  2QEX A;  1KAA A;  2XRQ D;  4DR3 Q;  5E4W C;  1WD0 A;  5M5Y B;  5IOC A;  1IW7 D;  3PSI A;  4HID A;  5M5W H;  1KLG D;  4KKU A;  3NWT A;  2Z8L A;  3CCS A;  3BZK A;  2RCF A;  5NUC A;  3DLL A;  2RQX A;  5CV7 A;  5M5W B;  1I4G A;  3OMG A;  5K36 H;  3U58 A;  2R92 H;  5JJI A;  4A3K H;  4GZY C;  2K5D A;  3FP9 A;  4L5Q A;  3TSS A;  1WCM B;  1QNK A;  2R92 B;  1T9H A;  1STG A;  4A3K B;  1VQK A;  1HUM A;  4A3B G;  5LL6 X;  3J81 L;  1HZA A;  1ML0 D;  1PZK D;  1B8A A;  3NTH A;  1AN8 A;  3NEN A;  1G2S A;  2K5H A;  4JV5 L;  1Q1B A;  2X6G A;  5C0X J;  2UUB Q;  1NR4 A;  3ULJ A;  1WTW A;  1GJX A;  4XQQ A;  1E24 A;  1NUC A;  1HTP A;  1K3R A;  4DR3 L;  3NP8 A;  2MNA A;  1YZ6 A;  1V1O A;  5L37 A;  4A3J G;  2B2V C;  3OIP A;  4ZKB B;  4IO9 A;  3PUZ A;  2LFN A;  4A3E B;  5IWA Q;  4DV4 Q;  1NE3 A;  3HG9 A;  3TZD A;  4J1M A;  3S9W A;  4JK1 C;  2LSS A;  3F2U A;  4RAU C;  3D8G A;  2EQS A;  2SEB D;  4XYQ A;  4Z9C B;  1OXX K;  1O7Z A;  4ZQ3 A;  5GAG C;  3I8Z A;  3AEV A;  4QCL A;  1Q1E A;  1Q7Y C;  3LX0 A;  1PH5 A;  1BVS A;  2VQE L;  2R7Z G;  4DXF A;  2UUB L;  2F4V Q;  1B70 B;  2LMC B;  1E22 A;  1LTS D;  3PIP A;  1PFB A;  1C7Y A;  1NMF A;  1SNQ A;  2NN6 H;  3J80 E;  5IE8 A;  3S16 H;  4P2C B;  4RMF A;  4LF9 Q;  4WFN 3;  3A56 A;  4KJO A;  1HCZ A;  2JA6 G;  2JSO A;  2B63 G;  3TZU A;  3NTI A;  2PO4 A;  3S16 B;  3W2D A;  4NXN L;  4TSS A;  4KN7 C;  3M85 A;  4DV1 L;  2ZTC A;  5DM7 3;  3PF4 A;  1H9M A;  4A3C H;  1SE2 A;  2K5V A;  5HUR A;  3FMC A;  3TME A;  2EY2 A;  2I5H A;  3HOV G;  1J8I A;  3S2H H;  3HOX G;  3HOW G;  4EQN A;  1SDF A;  1V9P A;  2MO1 A;  2KHS A;  3S2H B;  4K2L A;  3S24 A;  2IHE A;  5IGE A;  2ZTE A;  1SMY C;  2EXD A;  4FYD A;  2L1B A;  4O2D A;  4DR7 L;  4LF9 L;  4OXP A;  5C4X H;  5J39 A;  3I4N G;  1RCV D;  5KEE A;  1DOM A;  4YY3 L;  4HJ9 A;  1U5K A;  4F7X A;  1GKH A;  2IX3 A;  4FNF A;  2A68 D;  1JB3 A;  2BE5 D;  5C4X B;  4RHR A;  4IQZ A;  5LMU Q;  1QE6 A;  4K5W A;  4DK0 A;  1XJV A;  5T1G A;  3VYR A;  1VQM A;  3M9B A;  4OGQ C;  1IYJ B;  1CI3 M;  3PIO 3;  4IOC A;  5CV6 A;  2F4I A;  1IKL A;  3F1Z A;  2D2C C;  4KHP Q;  4JOI A;  3DXJ C;  2EDG A;  3OWE B;  5EKK A;  3PO2 G;  4XQJ A;  3MFG A;  3AB9 A;  1KAW A;  4GN3 B;  3L2P A;  1KHI A;  4ME5 A;  4GNX C;  2F52 A;  3MXN B;  3PGZ A;  5ELF A;  1SNM A;  3P75 A;  2EYO A;  4X3K A;  2FMC A;  3H15 A;  2Z0S A;  3VDY A;  2B2U A;  3PO2 B;  1TWH H;  1CKM A;  5C3X A;  3KLR A;  3HGB A;  5CV4 A;  2WAQ E;  3CCQ A;  3G48 A;  1GO3 E;  4RFB A;  1D8L A;  2JYO A;  1TWH B;  1SXT A;  3PQI A;  3CQZ H;  1VDZ A;  1EIY B;  4HJ7 A;  2DY8 A;  5IT9 E;  3ERQ A;  4YWL A;  3CQZ B;  5EJW A;  5FLX E;  1HZC A;  1GVP A;  1ZEQ X;  2K6A A;  2K04 A;  5JEA H;  3H0G H;  2N88 A;  4GLA C;  3GV6 A;  3VR6 A;  2Z4I A;  2F03 A;  1N33 L;  2EYL A;  1VQ9 A;  4KV6 A;  1NMG A;  2K14 A;  1BCP D;  3H0G B;  2O5J C;  3RLF A;  3QR8 A;  4QIW E;  2V1C C;  2N55 A;  4YCU A;  1Q8K A;  3TRE A;  5IY0 A;  5M3F G;  1ET6 A;  2JA7 H;  1NBW A;  4FO2 A;  3U4V A;  1XTD A;  1QCB D;  1TS2 A;  3C2P A;  1ILQ A;  1II3 A;  2QIL A;  3CW2 C;  2WV6 D;  3ERS X;  2JA7 B;  3A8K E;  2RA4 A;  3J81 E;  2L4N A;  2Y0S G;  1YNN D;  3CC2 A;  1PMR A;  4UDU C;  1EWC A;  4QF4 A;  2RHQ B;  1Q8I A;  2A6E C;  1JR0 D;  1N36 L;  1F9R A;  1LM0 A;  4OL7 A;  2VW9 A;  1XWE A;  5CGK A;  1EOT A;  2F0S A;  1SRU A;  3OPO A;  2N49 A;  1WI5 A;  1UE1 A;  3W1G A;  5C3W A;  2ID0 A;  4XT1 B;  1STH A;  3T16 A;  1QUQ A;  1BO0 A;  1E1T A;  3PIP 3;  5C3E G;  2XVS A;  5LHY 1;  3GTK H;  2SNS A;  4C3J G;  2MO0 A;  3A7L A;  1GHK A;  2F0F A;  5ELN A;  4XXE A;  4N9P A;  3GTK B;  4DAM A;  4G7H C;  1LYL A;  1ROD A;  1F2Z A;  2XWB B;  2JEB I;  2F0U A;  3KJP A;  4B3M Q;  2JA9 A;  1H95 A;  5ELC A;  4B3S L;  3DM3 A;  2VQF Q;  3D4W A;  4MTN A;  2F3I A;  3HKZ E;  1EY0 A;  4YWM A;  4JBW A;  5EQ0 A;  2HUG A;  4GOP C;  3S1M H;  1STB A;  4DV6 Q;  3KDF B;  1HQM C;  1X65 A;  2FXQ A;  4BA1 I;  2HIV A;  1K73 C;  1HR0 W;  2IW3 A;  1BF4 A;  3SHL A;  3S1M B;  4IUT A;  4O0A A;  1WCM G;  1I4P A;  1AFP A;  2QEJ C;  2RBM A;  4XIG S;  3SE0 A;  2B29 A;  1G6P A;  5GAH C;  3MTS A;  4A3B H;  1SMX A;  5A2Q L;  3PF5 A;  3NUC A;  4B3M L;  3B6Y A;  4QUC A;  1B4O A;  3BZC A;  1HNW L;  2ENB A;  5IGF A;  3I4M G;  3F8T A;  4DNI A;  4A3B B;  4DV3 Q;  4WJ3 M;  1LO5 D;  1X6O A;  4NXM L;  3K7U C;  4IJH A;  1XPR A;  1Y8O B;  4A3E G;  5E4X A;  4DV6 L;  1KTK A;  1TWA H;  4A3J H;  4B3R L;  4IN3 A;  3HS0 C;  2GA4 B;  4KD3 A;  4G57 A;  4DR6 Q;  1TWA B;  4A3J B;  1I4H A;  1XMQ L;  1BCP B;  1X3E A;  2A6H C;  2PQE A;  4EX5 A;  1CQF A;  1DOK A;  4R9W A;  3NQT A;  4K0K Q;  1ET9 A;  1KRT A;  3N52 A;  4LF5 L;  1C8C A;  1K9M C;  2VUM G;  3GTG H;  4EQP A;  4L5R C;  5BN5 A;  3FPP A;  1SMY D;  1XYI A;  2R7Z H;  4DV3 L;  1FNV A;  4QQB X;  4JYA L;  1KDA A;  3M4Q A;  3GTG B;  2NVQ H;  4CKB A;  1EQR A;  1S5F D;  2KOL A;  1N32 Q;  2R7Z B;  4X66 L;  2F0I A;  2JA6 H;  3QWN A;  2B63 H;  1U9R A;  2NVQ B;  2XGT A;  1WYD A;  1NY4 A;  1YBY A;  2PYK A;  1K83 H;  3CCL A;  3KK7 A;  4GN4 B;  1WFQ A;  2IHF A;  4QUF A;  1K8G A;  1DON A;  4YCV A;  1PTO D;  3C46 A;  3D31 A;  4O1N A;  2B63 B;  3CCU A;  3EQL C;  3GTJ H;  1K83 B;  4A3C G;  2ZM6 L;  3HOU B;  4QGU A;  2FJ2 A;  3HOV H;  2IT1 A;  3HOX H;  1FD7 D;  1YNX A;  2YV5 A;  3HOW H;  4LFB Q;  2N8N A;  3CCJ A;  3CRK C;  1E0B A;  4G4K A;  3HOV B;  3SR1 A;  3CC4 A;  3HOX B;  3KJO A;  1I50 H;  1ENA A;  2PQA A;  2J0T D;  3QB3 A;  1STN A;  4KN4 C;  1BUV T;  1EQQ A;  2ZXR A;  3NEL A;  1I50 B;  4CKE A;  5LMN W;  2QA4 A;  1HNX Q;  3I4N H;  2X6L A;  3E6Z X;  4LF4 Q;  4B9W A;  5IOD A;  1K0S A;  4YIJ A;  1CHQ D;  1BDO A;  2RKS A;  1TT2 A;  5G3L D;  3I4N B;  3G4S A;  1S4Z A;  4ME3 A;  1DM0 B;  4RKL A;  3A54 A;  2Q2U A;  4YWK A;  2XN9 C;  2EJF C;  4IUU A;  3Q22 A;  1Q12 A;  2D5D A;  1A3U A;  4HTH A;  4IZ8 A;  4PZ8 A;  1HJP A;  3H3V I;  4DK6 C;  1FJG Q;  4LFB L;  3DUZ A;  1DJR D;  2HDM A;  2F0D A;  3PO2 H;  2R7F A;  1BBW A;  1I94 Q;  3I73 A;  3U50 C;  4RG1 A;  1PFM A;  2VZA A;  3OW2 A; 
#chains in the Genus database with same CATH homology
 3CU7 A;  4PQX A;  3K57 A;  4OIK A;  2A74 C;  3K59 A;  4RWS C;  3MXG A;  1H9J A;  2B2Y C;  3RZD B;  2WP8 J;  1B50 A;  1U4P A;  4H13 C;  4C56 C;  4ODG A;  2IJ0 A;  1B9M A;  1SSO A;  1FR3 A;  4LMQ D;  1PRT D;  5M9O A;  2O5I C;  5JEA J;  3K0Y A;  3BZD B;  4ZKC B;  3Q6S A;  4IFD G;  2PW5 A;  3T51 B;  4LJZ C;  4DAY A;  2BA0 A;  1XTC D;  1U4M A;  1EIH A;  4C3H G;  1B53 A;  4NDX A;  5CV5 A;  5M3F B;  1D1K A;  3R3O A;  5DM6 3;  4X3T A;  3ONA B;  2DNC A;  5A2Q E;  1LT4 D;  3VR5 A;  5EGT A;  3D6C A;  2Y0S B;  1LAC A;  4RGN A;  3LWE A;  3U9O A;  2E74 C;  2EXZ A;  3S1Q B;  4HCS A;  4ID6 A;  3PUW A;  5A35 A;  1JQY D;  2XWJ B;  1JOQ A;  3VA5 A;  4HSV A;  3GTM B;  1I4X A;  2BDN A;  5KRU A;  5I9O A;  1OXS C;  1DYQ A;  4A3F B;  3J7A F;  2K32 A;  4C3J B;  2VNU D;  1ENF A;  4HAE A;  3CHB D;  4H44 C;  1TR5 A;  1JC7 A;  2EJM A;  3GTO B;  3R8B A;  4DF7 A;  3M4O B;  1I6H B;  5J1Z A;  5KNC A;  2HCI A;  2E76 C;  2NVX B;  2A6H D;  1I4Q A;  4ZRZ A;  5C5M A;  4BA2 I;  1EYD A;  1XX8 A;  1HRJ A;  4NMZ A;  4HR7 B;  1F2M A;  2H1E A;  1EY9 A;  1F2L A;  3DWA A;  4DN4 M;  1BXT A;  4NW2 A;  1PZI D;  2F0T A;  4EQO A;  3MXP A;  3K7A B;  5TSS A;  4HSP A;  1B44 D;  2K5W A;  1U4L A;  1EEF D;  1RDP D;  2K28 A;  5F2D A;  1B9N A;  4C3I G;  4KHZ A;  3I4M B;  1ZKO A;  2B2W C;  2AQ1 B;  3TN2 A;  2CW0 C;  4FXD A;  4RCN A;  3TP8 A;  3G6J B;  1X3Q A;  2OT2 A;  2IWH A;  5C0X I;  1AP0 A;  1RD9 D;  3S17 B;  4DAP A;  3C1E A;  3BVM A;  5JAV A;  1E2Z A;  3U9S A;  3VYU A;  2JA5 B;  2B2T C;  1Z7T A;  2WII B;  2NVY B;  1KDB A;  4HN7 A;  1RKN A;  3SDZ A;  2YYZ A;  3FDT A;  2K01 A;  2VUM B;  2FFK B;  2BOS A;  3HEJ A;  3BYT B;  5BN3 A;  3FPU B;  3KLS A;  1EY4 A;  3D3R A;  2PMZ B;  2XNA C;  2IX1 A;  1GUS A;  3NQI A;  1M4V A;  3O13 A;  5CV8 A;  2E2I B;  3I91 A;  2KCN A;  5FKA C;  5LL6 S;  2E2D C;  4BWG B;  1EY7 A;  5KYL A;  1TVX A;  2EY5 A;  1HPC A;  4FF3 A;  3I3C A;  1EZ8 A;  5CC4 A;  1H9S B;  3R2T A;  1G6Z A;  3LNN A;  2L12 A;  1LV9 A;  2F0G A;  1M8A A;  3K5N A;  1LTB D;  3V2T A;  2QF7 A;  1MI2 A;  4G7O C;  4RGM A;  5EKI A;  3MXN A;  4C1N I;  2V4D A;  4FXK C;  5C4Z A;  2BA1 A;  5CBA E;  4B9X A;  1PTO C;  4DFA A;  1S5D D;  2I46 A;  2NZ1 D;  4J8Q A;  4IUQ A;  4PMC A;  2B39 A;  3V96 A;  3M7G A;  3T13 A;  1HHV A;  4KY7 A;  4R8I A;  5COR A;  5D3I B;  3IFT A;  4DNR B;  1V1P B;  1V43 A;  4HMJ A;  1Z6H A;  3TP5 A;  5JJZ A;  4L63 B;  4IUV A;  2NTT A;  3EFX D;  3EJI A;  2PCF B;  5KIX A;  4OO1 I;  3EVQ A;  4HED A;  2EJG C;  3SXH A;  4ZUI A;  1HFG A;  2F0N A;  5FO7 B;  2CVR A;  4OIJ A;  5EPL A;  1QG7 A;  2IL8 A;  3GTP B;  4WOR A;  4KHV A;  1ZXT A;  4V0B A;  1UAP A;  4IFD H;  3S2D B;  1TKW B;  5KGU A;  3NTK A;  2A5H A;  1HXY D;  2BCO A;  2F0P A;  4RGT A;  3AU7 A;  4KK7 A;  1GUG A;  2A69 D;  4C3H B;  1RJT A;  3IFD A;  3BDL A;  5KNB A;  1ZYR C;  1F9S A;  5E1F A;  2K7V A;  4BY7 B;  4PV1 C;  3Q24 A;  1QOH A;  3QOJ A;  3MC0 B;  1BCP F;  1PRT C;  4MN3 A;  1R4P B;  5I2X A;  2F0K A;  2KVM A;  1OXV A;  3RMH A;  5T1I A;  4K8I A;  3Q0A A;  2PW7 A;  4L6T B;  4NKL A;  2EPB A;  4O42 A;  3DEO A;  3T56 B;  4KMU C;  3OMC A;  1JE4 A;  1Y8P B;  1EU4 A;  5KND A;  2JXM B;  3MXU A;  1EIG A;  4X3S A;  2KED A;  4CKC A;  3BS1 A;  3DWQ A;  1TY0 A;  2CW0 D;  2MUY A;  1JWS D;  4U68 A;  5C5L A;  2XRS D;  1MSH A;  2C5C A;  4H0L C;  3MWY W;  1NR2 A;  1ESR A;  3R93 A;  4KKT A;  5IGC A;  1WVL A;  1U4R A;  4AYB B;  3T4A C;  3RUZ A;  3L3O C;  2JA8 B;  1UUP A;  1SJH D;  2I07 B;  4J6H A;  1TWF B;  5IGG A;  3MA2 B;  5K5P A;  3TP6 A;  3ITP A;  1H9R A;  1R4Q B;  3DMU A;  1G29 1;  4IUN A;  2ZT9 C;  2CQA A;  2K5Q A;  3GQB A;  3FEW X;  4R8N A;  3FRP B;  4C3I B;  1B3A A;  3V05 A;  2KJX A;  2EE1 A;  4ABN A;  3NHH A;  1OXU A;  1UNS A;  2D62 A;  1LT5 D;  3P1H A;  1PDQ A;  3BVG A;  2L11 A;  3NBI A;  1MD2 D;  1KLU D;  4Q0F A;  4C2M B;  2ZXO A;  3H3V C;  2PZU A;  3HP3 A;  3HZX A;  1ESF A;  1K8O A;  3NSW A;  5D14 A;  1K8M A;  2R6G A;  3P7J A;  1DXM A;  3MAQ A;  1SBB B;  2XIW A;  5JPN C;  2WB1 B;  3L9A X;  3K5O A;  4ZUJ A;  3ND9 A;  4KI0 A;  2HDL A;  3N6R A;  2G9H D;  3AMU A;  2B2V A;  1VCI A;  2NN6 I;  1Y69 U;  4WRD A;  4BY1 B;  3I72 A;  3NXW A;  2SOB A;  4DU9 A;  1SNC A;  1GUO A;  4LAA A;  4DAV A;  1MBY A;  2PZT A;  1SEB D;  1T5X D;  3I4L A;  4RA8 A;  2L55 A;  3D4D A;  1PTO F;  4FF4 A;  2Q8T A;  5DEH A;  1G2T A;  3H94 A;  2K33 A;  3PO3 B;  4FP5 D;  1AZP A;  3OW7 A;  1O7L A;  2NBF A;  4KJN A;  2PNR C;  4IUR A;  1SE4 A;  1Y1V B;  1B1Z A;  3EA6 A;  4G7Z C;  3HRZ C;  4F88 A;  3RZO B;  5G3L F;  4KY6 A;  2L5T A;  4H7B A;  1ZYR D;  1S5C D;  1LT6 D;  3DWP A;  1A2T A;  3MZ5 A;  4M1U B;  2R61 A;  2L0C A;  1CM9 A;  2J7Z A;  3SVM A;  2HCC A;  1HA5 A;  3JAM L;  1LTR D;  2MPM A;  3QO2 A;  1EEI D;  1CHP D;  5CMD A;  1CQV A;  2G9D A;  5FK9 C;  2LKV A;  3Q23 A;  1WTX A;  2KUM A;  5CV9 A;  1PTO H;  1IL8 A;  1JOO A;  1W6J A;  2IPK D;  1OO9 B;  1FNU A;  4ZLT F;  1PTO B;  2F3V A;  4A3I B;  2M00 A;  4ULL A;  3OWF A;  4K5V A;  1D5Z C;  4UAI A;  3LWU A;  1LAB A;  5ELB A;  1IYV A;  5IGB A;  1O78 A;  2NWG A;  1LLR D;  1DOL A;  1Y8N B;  2YU9 B;  3DM1 A;  4B08 A;  4PNY A;  2F1M A;  3W3A A;  1H9K A;  4HCE A;  2PZW A;  2VXW A;  2OXP A;  3IKJ A;  2B8G A;  1TWC B;  1WTV A;  1TS3 A;  2WKD A;  2FMM A;  1PXU A;  2KEE A;  1BOS A;  3QIA A;  2NTS A;  2A69 C;  2ICI A;  2WAQ B;  2Z1C A;  4MIU A;  1CK1 A;  1QB5 D;  3IAY A;  3SK4 A;  4RGO S;  1CTM A;  3ND8 A;  5EPJ A;  1LTG D;  1SE3 A;  2R93 B;  2MGS A;  1Q90 A;  3PUV A;  1RHP A;  3FKI B;  3PMF A;  2H4O A;  1EY8 A;  5DNF A;  4F8M A;  3X3N A;  1SNP A;  5I6Y A;  2EY1 A;  1CT1 D;  4K8J A;  4QIW B;  1EL0 A;  3SK8 A;  2WKC A;  4FXG C;  5ELE A;  1W6K A;  5EKL A;  1DD2 A;  3I90 A;  4CJ1 B;  3E5S A;  3GD7 A;  1WTP A;  3KBX A;  2VB2 X;  1A2U A;  5I9P A;  4CHT B;  3HOZ B;  1X32 A;  1EQT A;  1PRT B;  1A15 A;  5C0X G;  4KTA A;  4DNT B;  4A3M B;  3GO5 A;  2F0J A;  3S15 B;  1EZ6 A;  2EVB A;  1TS4 A;  2E75 C;  4BBS B;  2X69 A;  1EWH A;  3NBH A;  1JWU D;  1PLF A;  1STE A;  5M5X B;  3H91 A;  5JVG 3;  4CJ0 B;  3M3Y B;  1LTI D;  1D2B A;  2RSO A;  1H9S A;  3RD4 A;  1TY2 A;  2FHT A;  3BVZ A;  3HKZ B;  3HOY B;  1GHJ A;  2KCC A;  3BDC A;  5FOB B;  1CFM A;  1VMP A;  4I7Z C;  4E6I A;  5C6A A;  4BBR B;  1QIL A;  1BR9 A;  3OSO A;  2XSC A;  1G91 A;  1D5M C;  2AUJ D;  2RDH A;  2AUK A;  3JAM E;  1C4Q A;  3PUY A;  2Q8R E;  3SK6 A;  4A93 B;  3R2I A;  4K6L A;  3VA7 A;  2F0H A;  4KD4 A;  5ELD A;  4OHJ A;  4BS9 A;  1SND A;  1IHZ A;  5C44 B;  1HUN A;  1V1P A;  1HQR D;  1JWM D;  5D3D A;  1BNZ A;  3SK5 A;  2F3W A;  3D6W A;  3PUX A;  2ZXP A;  1FGB D;  1F77 A;  3C3L A;  4XT3 B;  2MJ8 A;  3M7N A;  4M8A A;  4CBV A;  1EY6 A;  2KA7 A;  1YNJ C;  4U67 3;  1SAP A;  5IIF A;  1O80 A;  1AW7 A;  2F0W A;  2MHV A;  2EYF A;  1BBX C;  3I70 A;  1XXG A;  2DN8 A;  2TSS A;  4OO1 G;  4A3D B;  1F9Q A;  1STA A;  3H6M A;  4DGZ A;  1A3V A;  1GUW A;  2LS0 1;  4K6D A;  3A8J E;  2O2L D;  4V19 0;  4XYO A;  1X3P A;  2AQ3 B;  1S5B D;  2C9O A;  2JE6 I;  2QDB A;  4X3U A;  1SNO A;  5DAU A;  1ICW A;  5AFW A;  5I2Y A;  1HA6 A;  1L0Y B;  3ZYY X;  1MGS A;  2JP1 A;  1SYF A;  2WIN B;  2RDF A;  5JPM C;  4XDX A;  5HGT A;  1EYA A;  3A55 A;  1AEX A;  1I3Q B;  2EOT A;  4XTC S;  3VYT A;  3WOF A;  2J4X A;  1GXD C;  1STY A;  4ZYS A;  3K58 A;  3URY A;  2QKI C;  3GP7 A;  2R3Z A;  3KUP A;  2B2Y A;  5JOB A;  3KLS X;  3UI2 A;  4K14 A;  1KNA A;  4ILW A;  2SNM A;  5CR3 A;  4MHE A;  1G8Z D;  3G7L A;  2DNE A;  3K6O A;  3FVQ A;  3L7Z C;  3ERO A;  1SYC A;  1T5E A;  4EVO A;  2AWO A;  1FYC A;  5BN4 A;  2MP1 A;  1Y1W B;  1F9P A;  1EQV A;  5CBE E;  3PV0 A;  1PYW D;  1QJO A;  2EYH A;  1C48 A;  4CJ2 C;  1GUN A;  4C1N K;  4Q5V A;  3MHB A;  4Y7N B;  1BQQ T;  3NPP A;  4ZK9 B;  4RH6 A;  2F0M A;  4QB4 A;  1B2T A;  3E0J A;  3QOL A;  1NCV A;  3QJY A;  4FF1 A;  5C4H A;  1R9T B;  2RVL A;  3K5L A;  3C1F A;  2AQ2 B;  2NYZ D;  4DA2 A;  2NB0 A;  2NUC A;  3MVV A;  4TKO B;  5EBC A;  1EU3 A;  2Z4H A;  3GTL B;  3VYS A;  1CZW A;  1RTO A;  2FIN B;  3D4R A;  2EYP A;  1DZ1 A;  1SJE D;  5K36 G;  3KF8 A;  4FF2 A;  1AZQ A;  1KAB A;  3P20 A;  1IKM A;  3IL8 A;  4KKS A;  4PMB A;  1JOR A;  1WTR A;  5M3M B;  5EBD A;  2EZV A;  5C0X H;  2F0V A;  2A73 B;  4IUP A;  4KY5 A;  1SYD A;  5D65 A;  1WTO A;  5ISR A;  3GV3 A;  3BG3 A;  1NSN S;  4S3S A;  2F0L A;  2TMP A;  1D1I A;  3A7A B;  1TS5 A;  2VB3 X;  1SYB A;  3BDO A;  1WD1 A;  4IAL A;  1IW7 C;  1D6E C;  2B8F A;  3WDN A;  2AWN A;  3NK9 A;  2KEC A;  4TRD A;  3DEP A;  3A8I E;  1QNU A;  1GUT A;  4I65 A;  5COY A;  4WJW A;  1QWY A;  3M4Y A;  1Q3L A;  4K2K A;  1LT3 D;  3X3M A;  4RHS A;  2B2W A;  5FO9 B;  1L0X B;  2NN6 G;  1NAP A;  3TDQ A;  1VF7 A;  2M9V A;  3H09 A;  4ZAI A;  1EFI D;  1VMC A;  2PPB C;  1WTQ A;  3S1N B;  1LTA D;  1YNJ D;  2JA6 B;  5I6W A;  3OIQ A;  5E3F A;  3J7Y W;  2B2T A;  4A3G B;  1SYG A;  3OOC A;  2OEO A;  2O4X A;  3GTJ B;  2M2L A;  1O7Y A;  2B2U C;  3J7A V;  4PMW A;  1JIC A;  2EYJ A;  3HOW B;  3CKI B;  1PZJ D;  3TP7 A;  3K5M A;  1OXT A;  2SDF A;  1SYE A;  1CA6 A;  4NP5 A;  4L8J A;  4XQN A;  1I4R A;  2OF1 A;  1EY5 A;  3VR2 A;  3S1R B;  1E2V A;  5FO8 B;  1RTN A;  3KBG A;  1LTT D;  5C4J B;  3VR4 A;  2K1B A;  5I4D A;  2BDO A;  1I6V C;  1TU2 B;  2LY7 A;  5KYI A;  4OO1 H;  1DCZ A;  2Q8I B;  1IYU A;  1JOK A;  2NVT B;  1S5E D;  3J80 L;  4DXG A;  1SFO B;  4RKB A;  1TII D;  2K05 A;  2A6E D;  2A68 C;  2RSN A;  2JEA I;  2BE5 C;  1TQO A;  2D9U A;  3OHX C;  3T53 B;  1ONL A;  4CGY B;  4IFD J;  1VF5 C;  1MSG A;  1CA5 A;  4K5X A;  3WOE A;  2L9H A;  1EYC A;  5JEA G;  3CRL C;  2CHB D;  1PFN A;  2QCP X;  3QG1 A;  3DHQ A;  1HTL D;  2K03 A;  1JCK B;  4DK1 A;  3MFY A;  4IFD I;  4LK1 C;  1PRT F;  4RCO A;  4TQU S;  2WAC A;  5EPK A;  3VR3 A;  5CYU A;  3GTQ B;  5J22 A;  2EYM A;  1UEA B;  4FVM A;  1CZG A;  3NE5 B;  1ENC A;  2ICE C;  3SEB A;  1E2W A;  4QMG A;  1TWG B;  2EY6 A;  4EGV A;  3TBI B;  3S14 B;  4F87 A;  2KQ3 A;  1GOZ A;  4HMI A;  1BCP C;  2IX0 A;  5JVH 3;  5C3E B;  2F0E A;  1V8Q A;  2DY7 A;  2F0Q A;  1Z47 A;  3NWS A;  1KNE A;  1D5X C;  2F0O A;  3MEH A;  4N9T A;  1RF2 D;  1ILP A;  1FNW A;  5IGD A;  2E2H B;  2E2J B;  1F2Y A;  5IT9 L;  2RDG A;  1A3T A;  1HFN A;  1YNN C;  1A6X A;  5FLX L;  1KDC A;  2HQE A;  3BYY B;  1J9O A;  1KAA A;  2XRQ D;  5E4W C;  1WD0 A;  5M5Y B;  5IOC A;  1IW7 D;  1KLG D;  4KKU A;  3NWT A;  2Z8L A;  5NUC A;  2RQX A;  5CV7 A;  5M5W B;  1I4G A;  3OMG A;  5K36 H;  4GZY C;  2K5D A;  3TSS A;  1WCM B;  1QNK A;  2R92 B;  1STG A;  4A3K B;  1HUM A;  5LL6 X;  3J81 L;  1ML0 D;  1PZK D;  3NTH A;  1AN8 A;  1G2S A;  1Q1B A;  2X6G A;  5C0X J;  1NR4 A;  1WTW A;  1GJX A;  4XQQ A;  1NUC A;  1HTP A;  3NP8 A;  1V1O A;  2B2V C;  3OIP A;  4ZKB B;  3PUZ A;  2LFN A;  4A3E B;  3HG9 A;  3TZD A;  4J1M A;  3S9W A;  4JK1 C;  3F2U A;  4RAU C;  3D8G A;  2SEB D;  4XYQ A;  4Z9C B;  1OXX K;  1O7Z A;  4ZQ3 A;  3I8Z A;  4QCL A;  1Q1E A;  3LX0 A;  4DXF A;  2LMC B;  1LTS D;  1PFB A;  1SNQ A;  3J80 E;  2NN6 H;  4P2C B;  4WFN 3;  3A56 A;  4KJO A;  1HCZ A;  2JSO A;  3TZU A;  3NTI A;  2PO4 A;  3S16 B;  3W2D A;  4TSS A;  4KN7 C;  3M85 A;  5DM7 3;  1H9M A;  1SE2 A;  5HUR A;  3FMC A;  3TME A;  2EY2 A;  1J8I A;  4EQN A;  1SDF A;  2KHS A;  3S2H B;  4K2L A;  5IGE A;  4FYD A;  1SMY C;  2L1B A;  5J39 A;  1RCV D;  5KEE A;  1DOM A;  4F7X A;  2IX3 A;  4FNF A;  2A68 D;  1JB3 A;  2BE5 D;  5C4X B;  4RHR A;  4IQZ A;  1QE6 A;  4K5W A;  4DK0 A;  5T1G A;  3VYR A;  4OGQ C;  1CI3 M;  3PIO 3;  5CV6 A;  2F4I A;  1IKL A;  2D2C C;  3DXJ C;  2EDG A;  3OWE B;  5EKK A;  4XQJ A;  3MFG A;  3AB9 A;  4ME5 A;  5ELF A;  1SNM A;  2EYO A;  3P75 A;  4X3K A;  2FMC A;  2B2U A;  5C3X A;  3KLR A;  3HGB A;  5CV4 A;  4RFB A;  2JYO A;  1TWH B;  1SXT A;  1VDZ A;  2DY8 A;  5IT9 E;  3ERQ A;  3CQZ B;  5EJW A;  5FLX E;  1ZEQ X;  2K6A A;  2K04 A;  5JEA H;  2N88 A;  3GV6 A;  3VR6 A;  2Z4I A;  2F03 A;  2EYL A;  4KV6 A;  1BCP D;  3H0G B;  2O5J C;  3RLF A;  2N55 A;  1ET6 A;  4FO2 A;  1QCB D;  1TS2 A;  3C2P A;  1ILQ A;  1II3 A;  2QIL A;  2WV6 D;  2JA7 B;  3A8K E;  2RA4 A;  3J81 E;  2L4N A;  1YNN D;  1PMR A;  4UDU C;  1EWC A;  4QF4 A;  1Q8I A;  2A6E C;  1JR0 D;  1F9R A;  4OL7 A;  1XWE A;  5CGK A;  1EOT A;  2F0S A;  3OPO A;  5C3W A;  2ID0 A;  4XT1 B;  1STH A;  3T16 A;  1BO0 A;  3PIP 3;  2XVS A;  5LHY 1;  2SNS A;  4C3J G;  3A7L A;  1GHK A;  2F0F A;  4XXE A;  4N9P A;  3GTK B;  4G7H C;  1ROD A;  1F2Z A;  2XWB B;  2JEB I;  2F0U A;  5ELC A;  3D4W A;  1EY0 A;  4JBW A;  5EQ0 A;  2HUG A;  1STB A;  1HQM C;  4BA1 I;  2IW3 A;  1BF4 A;  3SHL A;  3S1M B;  4IUT A;  1I4P A;  1AFP A;  2QEJ C;  2RBM A;  4XIG S;  3SE0 A;  3MTS A;  5A2Q L;  3NUC A;  4QUC A;  1B4O A;  2ENB A;  5IGF A;  4A3B B;  1LO5 D;  1Y8O B;  5E4X A;  1KTK A;  4IN3 A;  3HS0 C;  2GA4 B;  4KD3 A;  4G57 A;  1TWA B;  4A3J B;  1I4H A;  1BCP B;  2A6H C;  2PQE A;  1CQF A;  1DOK A;  4R9W A;  3NQT A;  1ET9 A;  3N52 A;  1C8C A;  4EQP A;  5BN5 A;  3FPP A;  1SMY D;  1XYI A;  1FNV A;  1KDA A;  3GTG B;  4CKB A;  2R7Z B;  1S5F D;  2KOL A;  2F0I A;  3QWN A;  1U9R A;  2NVQ B;  2PYK A;  3KK7 A;  4QUF A;  1DON A;  1PTO D;  3C46 A;  3D31 A;  4O1N A;  2B63 B;  3EQL C;  1K83 B;  3HOU B;  2FJ2 A;  2IT1 A;  1FD7 D;  3CRK C;  1E0B A;  4G4K A;  3HOV B;  3SR1 A;  3HOX B;  3QB3 A;  1ENA A;  4KN4 C;  2J0T D;  1STN A;  1BUV T;  2ZXR A;  1I50 B;  4CKE A;  2X6L A;  3E6Z X;  4B9W A;  5IOD A;  4YIJ A;  1CHQ D;  1BDO A;  2RKS A;  1TT2 A;  5G3L D;  3I4N B;  1S4Z A;  1DM0 B;  4RKL A;  3A54 A;  2XN9 C;  2EJF C;  4IUU A;  3Q22 A;  1Q12 A;  2D5D A;  1A3U A;  4HTH A;  4IZ8 A;  3DUZ A;  1DJR D;  2HDM A;  2F0D A;  3I73 A;  1PFM A;  3PO2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...