4IUNA

Crystal structure of staphylococcal nuclease variant delta+phs r126e at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLEKAEAQAKKEKLNIWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS R126E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iunA00
3TP7A 1TT2A 3NP8A 3QOLA 4EVOA 2PW5A 4QF4A 5CV6A 5KYLA 3EVQA 2EY1A 2PW7A 2PZUA 3H6MA 3TP6A 1F2ZA 2EYMA 1STGA 2SNMA 2F3VA 4I65A 2NUCA 3QOJA 5IOCA 4IALA 1SNDA 2EY6A 1NUCA 1EYCA 4ZUJA 3T13A 2F0PA 3BDCA 3RUZA 5EKLA 5CGKA 2RBMA 1EQVA 3HZXA 5C5MA 1SNOA 1KAAA 1STHA 2EY5A 4KJNA 4KHVA 4K6DA 3D4WA 3EROA 4PMCA 4R8NA 5CV4A 4RKBA 3TP5A 1KDBA 5IIFA 4N9PA 1SNMA 3NXWA 2KQ3A 2EYFA 4ZUIA 4ME5A 4F7XA 1RKNA 1EY0A 2OF1A 4HTHA 1SYCA 1KDAA 2WACA 3MHBA 5DEHA 4K2KA 4KD3A 5IGCA 2QDBA 5K5PA 2F0TA 2O4XA 5IGEA 2F0NA 1SYGA 4K5WA 2KHSA 2F0QA 3NHHA 4KD4A 4K8JA 5CV7A 3D4DA 1SNCA 2RKSA 5HURA 2EYOA 3OSOA 3SK4A 3S9WA 4RKLA 2M00A 1IHZA 5NUCA 2PZWA 5JAVA 4G57A 1SNQA 5I9PA 1JORA 2F0GA 5C3WA 4OL7A 2PYKA 1A3UA 4NDXA 1NSNS 2F0DA 4TRDA 1SYDA 3D6CA 4PMBA 2F3WA 3LX0A 4K14A 1SYFA 5CV5A 1EY6A 4J6HA 2F0SA 3TMEA 5IGFA 1JOKA 5J39A 5KEEA 1EYDA 3SK5A 2EY2A 2F0FA 5M9OA 1A3TA 3DMUA 2RDFA 3T16A 4EQPA 1EYAA 4ZQ3A 5E3FA 5CC4A 1SNPA 5F2DA 5KGUA 1AEXA 1ENAA 1A2UA 4IZ8A 1EY7A 3D8GA 3P1HA 3SR1A 3TP8A 1U9RA 3QB3A 1EY5A 4K5XA 4B9XA 4S3SA 5C3XA 5KRUA 1STNA 2F0HA 5J22A 3SK8A 1JOQA 2EYPA 2F0KA 1EY8A 3OMCA 3PMFA 3R3OA 4IUNA 4QMGA 5KIXA 3V2TA 1A3VA 2OEOA 1STBA 2F0UA 4ODGA 1SYBA 1II3A 5J1ZA 5KYIA 5CR3A 4EQNA 2F0IA 5C4HA 4J1MA 4F8MA 4NKLA 3C1EA 1A2TA 4K2LA 5EKKA 3SHLA 1F2YA 4NMZA 4YIJA 3U9OA 4LAAA 1EZ6A 4KV6A 5C6AA 4HMJA 2ENBA 4HMIA 4KY7A 1EZ8A 2F0JA 4WRDA 4MIUA 4N9TA 2F0LA 4KTAA 5JOBA 1EY9A 2SNSA 5C4ZA 2F0WA 1EY4A 2EYJA 5IGGA 3BDLA 3MXPA 4B9WA 3ITPA 5CV9A 3MVVA 4QB4A 3SXHA 4EQOA 5HGTA 5I6YA 5IODA 1F2MA 2F0OA 4PNYA 3VA5A 2SOBA 3NQTA 4KY6A 2PZTA 2F0MA 5CV8A 3MZ5A 2F0VA 2OXPA 5DAUA 5I9OA 3EJIA 1JOOA 1SYEA 4K5VA 5EGTA 3OMGA 3SK6A 5I6WA 1TQOA 5E1FA 2EYLA 3NK9A 2EXZA 4DF7A 4E6IA 5IGDA 3C1FA 3MEHA 1KABA 3NUCA 4K8IA 5C5LA 4NP5A 4DU9A 2PQEA 2F0EA 3E5SA 4DFAA 2HQEA 1TR5A 4H7BA 4DGZA 3DHQA 1ENCA 2LKVA 3ERQA 4KJOA 1STYA 3HEJA 4ID6A 4KY5A 1STAA 2EYHA 4WORA 5IGBA 3OWFA 3P75A 1KDCA 5ISRA
chains in the Genus database with same CATH superfamily
4HSPA 2KCMA 3RZOB 5D3IB 3S14H 1BF4A 5M3FG 5IOCA 2PNRC 1SNDA 3S24A 2RBMA 3QIAA 2CVRA 2MJ8A 3T1HL 1SN8A 5C4XB 2PPBC 3H3VH 4UPAA 5GQOA 5IIFA 1LTAD 2EZVA 1F2LA 1QE6A 2KQ3A 2OF1A 4GNXB 4ABNA 3G6EA 4JCVE 4OO1G 5AJ3Q 3L7ZC 3EQLC 5NUCA 2WB1B 4G57A 4AYBB 2Z8LA 1EL0A 4JI0L 4UAIA 5LL6S 4UP9A 2XRSD 1YNNC 2N3SA 4ILWA 2LFNA 4P72A 5EQ0A 2Z6KC 3CCRA 3HOXH 1SNPA 1DM0B 3GTOB 1V8QA 1CTMA 4ME3A 1ENAA 1EY7A 1FNVA 1TKWB 3SK8A 1FJGQ 3VYTA 1EY8A 4QUFA 1B8AA 2VQEL 2AWNA 2KCCA 4UDUC 4MNOA 1DYQA 4O1NA 4C1NI 4HIKA 2YTYA 3H15A 2DN8A 3S15B 4FXDA 2UUCL 2A68D 4DK3C 4HMIA 3CMEA 3PF4A 1I4PA 4R1JA 2MQHA 3V96A 3H0GB 4C3JH 2J0TD 1V1OA 2KVMA 2YV5A 1H95A 2L5TA 2F4VQ 5LL6X 3W2DA 1G2SA 5I6WA 1TQOA 4IFDG 3CRLC 2B2VA 1QWYA 4DU9A 1J8IA 2NZHA 1BKBA 1I3QB 4UP8A 1K8OA 1HZ9A 1TWAH 4IOCA 4KY5A 1PFMA 5C44H 4JOIA 2QILA 3GTMB 4K6LA 4DR1L 2N8NA 5G3LD 2KJXA 2PZUA 4JI3Q 4IUUA 2Y0SG 4UY8C 2NUCA 1PLFA 1VQLA 5FLXc 4ZUJA 4DNRB 1J6QA 3BZKA 4A3IH 3TREA 3K80C 1VQKA 4YWMA 2FMCA 2G9DA 4YWKA 4RKBA 3OYYA 3HOWG 1S5BD 1X56A 4KN4C 4MHEA 5KNCA 1PH3A 3JC66 1WTHA 1PRTF 4GNXC 3HOUG 3RZOH 1GD7A 1KDAA 2MUYA 4K2KA 1AH9A 5K5PA 1SE3A 2A6EC 2E2JB 4IJHA 4RMFA 1PTOB 3S1QB 1M4VA 2K4KA 1HPCA 1YJWA 1VMPA 3MXNB 4LW1A 3STBC 3HOVG 5C4XH 1SNQA 1YNND 4RA8A 3CPFA 2K01A 1HTPA 1OXTA 4JI8Q 1TY0A 2VY3A 3KDFB 5ELNA 2B29A 1JOKA 5C0XH 2M9VA 3W5OA 1SMXA 1MI2A 2BCOA 1UE1A 1DZ1A 5E3FA 1JE4A 1AEXA 2AQ3B 1OO9B 1QNKA 3HOYG 4XTCS 4C56C 1VQNA 2F0HA 2F0KA 2NVQB 3IFDA 1YVCA 3U50C 5C4JB 3FPPA 1ZKOA 3SE0A 1HQMC 1MIUA 1I5FA 1IKMA 4A3DB 5CR3A 3A5ZB 1Y14B 2BA0A 3P7JA 4K2LA 1BBXC 1CKNA 2K03A 2GVBA 4DAYB 4GZYC 5JJKA 3GTOH 2AHOB 4EQ5A 1K83B 1S5CD 1HNXL 4RGNA 1BR9A 2K52A 5A2QL 4CBVA 2R92B 1H9RA 2BH2A 5CV9A 3MVVA 2V1CC 4A4IA 1UEBA 4DK1A 3J80i 1JCKB 2I5LX 1B44D 1CQVA 3UDXA 4DR4L 3CHBD 5CBAE 3C1FA 3A56A 2BA1A 3JAMi 1EIFA 2QKIC 1N32Q 3PO2G 1PA6A 1I4XA 3BYTB 3BS1A 1K3BC 1W6JA 3CP0A 3D3RA 3H0GH 3K59A 2HHHL 2VZAA 5KNBA 2O5IC 3KBGA 2LSSA 1ASZA 1Y1WB 3HFZB 1EWCA 5D65A 3HOXG 2F3VA 4JYAL 1Q8IA 3FEWX 1XYIA 1ESFA 3ULJA 2G9HD 5EKLA 4EX5A 1PH9A 1WJJA 1I3QH 5HURA 1V1PB 4TQUS 4BY7B 1G91A 1VQDA 4X3KA 2RDHA 2O5JC 2KBNA 3GTMH 1CKMA 3BG3A 4KD3A 2MHVA 2QDBA 4DR5L 1ZEQX 3TS0A 4DUZL 1M90C 2IL8A 2KECA 3STBD 1PTOC 2WAQB 4CJ1B 4C3JG 4BBSG 3N6RA 4UP7A 1Y8NB 1I50B 1A63A 3FMCA 3W1BA 4TRDA 1BDOA 3EA6A 1PDQA 4B3SL 3VA7A 2JP1A 2I5HA 3M85A 2A69D 5IGFA 5J39A 1XX8A 5KEEA 1HNZL 2EE1A 5DLQE 1SXTA 2YYZA 1GUGA 3DMUA 4C3HB 4POGA 2E2JH 1VDZA 1PTOH 4AH6A 3S1QH 3EN2A 1E0BA 1EOVA 1CSPA 4KHPL 3CW2C 5TSSA 4PMWA 2VQFQ 4KN7C 1A3VA 3NWSA 4BY1G 1PFSA 1RTOA 1D2BA 2KHIA 5EKKA 4A3IG 1K8MA 1N9WA 2I07B 3CCLA 3VYUA 2ZT9C 1PZJD 4N9TA 1NE3A 4ZLTF 1MSHA 3R2IA 1SLJA 1E24A 1I4RA 4X62L 2NVQH 5HGTA 5C4JH 4QY7A 3NTIA 1QNUA 4OXPA 1ENFA 3K0XA 5M5YB 3AMUA 2SEBD 2A73B 4IQZA 3ICEA 4A3DH 2UXDL 4OX9L 2NN6I 1NCVA 3CCQA 3OIPA 4RCNA 4O2DA 2ZTDA 4L5QA 2PQEA 4NP5A 1KRTA 1K83H 4L63B 2R7ZH 4H7BA 4DGZA 3DHQA 1LT5D 2R92H 2RSNA 1STAA 3Q0AA 1N33Q 1NTGA 1W3SA 4JV5L 1L0XB 5C0XG 3QOLA 3RLFA 4B3TL 2ZJQA 1P8LA 4DXFA 3NBIA 2SNMA 4M8AA 2ZXOA 1XMQL 2B63B 2H1EA 2EY6A 2D62A 1NUCA 3T13A 4GKJL 2WB1G 1Y8PB 4AYBG 1SNOA 2CW0C 4KJNA 4R8NA 4DV7Q 3MXGA 3CCJA 5CYUA 2EYFA 1SFOB 4H44C 1VQHA 4CDDC 3DWPA 3OHXC 1DGSA 5DEHA 5A2QE 1Y1WH 2F3IA 2B2WC 3HKZE 1AE2A 1C4QA 2WKDA 4QIWE 3PO3B 1LLRD 4DV0L 3S17B 1G6PA 3CCUA 4KKUA 1SNCA 5IP9H 2Z1CA 2JJQA 1VQMA 2Q2UA 4U68A 2IPKD 4IPDA 4NDXA 4KHZA 3TSSA 1I6HB 1IBLL 1IXRA 1UAPA 1IBKL 5JJLA 4L5SA 2K7VA 4ALPA 1A6XA 4JI4L 4Y7NB 4G7HC 2KENA 1VQOA 1H9SA 4LF9L 3H0GG 3P1HA 1J9OA 4S3SA 1I50H 1RCVD 1N34Q 4B3MQ 4DV5Q 1RHPA 1L2FA 2EJFC 1QUQB 3GTQB 3S2DB 2UU9L 1STBA 1HJPA 1JT8A 3HRZC 1FD7D 4EQNA 1WTRA 3PUVA 1XNQQ 1JWSD 1KIXA 3SHLA 3M7NA 5M5XB 2ZTCA 3PUZA 3I3CA 4C3HH 1Q12A 4JG2A 2IY5B 2WAQE 4H0LC 3A74A 1CI3M 1TWFB 2N78A 1HNWQ 2Q8TA 5JPMC 1ASYA 3QO2A 3SGIA 4KTAA 1YNJD 4OELB 1EY4A 2K33A 3BDLA 3PF5A 4JI1L 3ITPA 2KUMA 1SROA 4X6AH 4HAEA 2PZTA 4L5RC 3HOVB 3A8JE 2FXQA 5EGTA 2B3GA 1HZCA 4HSVA 4DF7A 2PMZE 5FLXL 2UXBQ 1Q90A 4DFAA 3WDNA 3DLLA 1X65A 1TR5A 2K6AA 2UXCL 1O7ZA 3F8TA 2XRQD 1RIPA 4FF4A 2BDNA 1CUKA 3HOYB 5M5YH 1V9PA 4QF4A 1O7LA 2K05A 5KYLA 2D9UA 1WTQA 2RF4A 1ET6A 1NR2A 3BZCA 3TP6A 1PZID 5GADC 2K04A 1K28A 4YWLA 1AZPA 1KD1C 1E1OA 1L0YB 4JC0A 2F0PA 1UE7A 2CW0D 4ZCKA 1NAPA 1K3RA 4FF3A 1E3PA 5M3MB 2IJ0A 1SNMA 1BNZA 1HUMA 1EEID 3NELA 1FNUA 3SVMA 1OXXK 2XSCA 3UI2A 1SYCA 3T51B 1G51A 2R3ZA 3MHBA 5IGEA 3DWAA 2QA4A 3C2PA 3GQBA 4KLKA 5CV7A 1TS4A 2FHTA 2OQKA 4MN3A 2LS01 1IHZA 2M00A 3FRPB 1CZWA 5EPKA 3L3OC 1NSNS 4A3DG 3PO2B 1Y1VB 1SFOH 3MAQA 4DV1Q 4DA2A 5AJ3L 3E9IA 2ZM6Q 1Q3LA 3PO3H 3S17H 4WJ4A 3RD4A 5ELFA 3OTOQ 1B3QA 4IZ8A 3T56B 4K5XA 1STNA 1AP0A 2EYPA 3PMFA 1I6HH 2LMCB 1FNWA 1V1QA 1MD2D 2K32A 2OEOA 2F0UA 5C3EB 4ODGA 2FJ2A 5KYIA 1R9TB 1IBMQ 1AE3A 1L1OA 1D5MC 4NMZA 4Y7NH 1D1KA 3J80c 4NXMQ 2ICIA 2ENBA 5BR8Q 1FJGL 4DV4Q 3KFUA 2BE5D 2EYJA 3KLWA 4OONA 3MFYA 3JAMc 3AEVA 1ONLA 1Z47A 3GTQH 3S2DH 1Y1WG 2WP8J 1CKNB 1MSGA 2F4IA 2NB0A 4BBSB 2L11A 2KCNA 1EUJA 1EQQA 2JQOA 2LXKA 5IP9G 5A35A 3HOWH 5M5XH 1HXYD 1TWFH 2F0EA 3WOEA 2VNUD 4PZ6A 3NBHA 3U4ZA 4BY7G 4EGVA 2Y0SE 4RFBA 3MEFA 2A1AA 1S5ED 2B2UC 5ISRA 1D7QA 1YITA 2ZXRA 3ULPA 2B2VC 3HOVH 4GLAC 1PRTB 1SAPA 4JVZA 4FF2A 1TS2A 4DPGA 4K0KQ 2WAQG 2RDGA 5FJ8H 1E22A 1YNXA 3OWEB 4BY1B 4IOAA 4YY3Q 1VQ6A 1KAAA 1STHA 2EY5A 5C5LA 4K6DA 1N36Q 4A3BB 4JI3L 4DK6C 1LTTD 3HOYH 2OCEA 1DOMA 4FO2A 3J81c 3I72A 1WOCA 1X3GA 2O4XA 4HCEA 4K5WA 2RSOA 1HFGA 3CAMA 4QUCA 5M5WH 4PG3A 4DKAC 3L9AX 4DAPA 4AQYQ 3K81C 5M3MH 4FP5D 2GN5A 5FLXE 4A3MG 1Z7TA 3TN2A 4OIKA 1IKLA 2F0SA 3I90A 5K36G 2EY2A 3VR2A 3K5MA 1EQTA 3R93A 3I4LA 4LF5Q 1H9MA 1HR0Q 2OTLA 1QG7A 4G4KA 3SR1A 4XXEA 4WJ3M 1JOQA 3J81j 4R4IA 4JI8L 2EJGC 1HR0W 1LT4D 2Q2IA 1QZGA 4QCLA 1E2VA 3V2TA 1QVFA 3PO2H 1Y1VH 1PZKD 4DV3Q 1PMRA 1F2YA 4P71A 3WOFA 2NZ1D 3J7ZC 2QGQA 1JWUD 3G7LA 4WRDA 1M1KC 1YHAA 3E3XA 3M9BA 1VQ5A 3NPPA 1QCBD 5C3EH 1R9TH 1BVSA 3A7AB 3SEBA 2B63G 2OWOA 1O7IA 4LF4Q 3LWUA 1TXYA 1BO0A 1XPRA 3QR8A 4DR3Q 3HEJA 4ID6A 4CHTB 1EYGA 5G3LF 1XTCD 3A8KE 5EPJA 1JC7A 2PQAA 4JI2Q 4EVOA 4BBSH 2JSOA 3PO3G 4GOPA 4Z9CB 1PRTC 1VQCA 2EYMA 3G48A 3A0JA 1K0SA 3QOJA 1ESRA 5IWAL 2VS1A 2ZJPA 3MFGA 4IO9A 1UWVA 1WD1A 3PUYA 5CGKA 4RGOS 2RHSB 3HZXA 3IRBA 5C5MA 1Q81C 1MGSA 4H02A 3HG9A 1JJCB 1EOTA 1XXGA 4LNQA 3KYHC 3TQYA 2Q8RE 2B2TC 2XWJB 2RCFA 4R9WA 4POFA 2MO0A 4ZUIA 3AQQA 1B2TA 1RODA 1OXVA 3I8ZA 1KLUD 2XTIA 5BN3A 1I94Q 4BWGB 4K8JA 4BY1H 2FINB 3W1GA 2E76C 4RKLA 3GO5A 2PZWA 1HA6A 4I7ZC 4A3BH 1VQ9A 4PMBA 4IPGA 4V0BA 4GKKQ 1WYDA 1CZGA 2PI2E 1K8GA 5FOBB 2EDGA 1O78A 1Q86C 4A3LH 1B1ZA 1F9QA 4FDBA 1GUNA 1T5EA 2KOLA 2RCNA 3R2TA 2JN4A 3LGJA 4FYDA 3KF8A 3TEHB 4UHVA 3U4VA 3RLOA 1EWHA 1H9SB 3PV0A 5FJ8G 4J1MA 4F8MA 3FKIG 2R7FA 4YIJA 4KV6A 1WVLA 1MJCA 2NN6H 2VQFL 4GS3A 1RDPD 4YCUA 1PH5A 2Z4IA 4X64Q 2R93B 4B3RQ 4NW2A 2CWPA 3M4PA 4YHHL 4A75A 1MHWC 4TSSA 3NQTA 2F0MA 1LTLA 5LMNL 4DR7Q 2QW7A 3ULLA 2EOTA 4O42A 3OW2A 1P16A 3NSWA 3KF6A 5M3MG 3N52A 2Z9HA 4P74A 1PYWD 3C46A 4V190 4P2CB 2WB1E 3TP7A 3NP8A 4AYBE 3CC2A 2B2YC 2K5NA 3H3VI 4HJ5A 3EVQA 1X3FA 3H6MA 1JR0D 3VYSA 1EIYB 3CQZB 2Z6KA 3A55A 3I91A 2XVSA 1DOKA 4DR6Q 2I0QA 1SE8A 3S15H 1QILA 2K28A 4PMCA 1BOSA 2K75A 1Y1VG 3VYRA 3GD7A 1BBWA 2X6GA 1TY2A 3UDFA 5KNDA 4JI7Q 2WACA 4Q0FA 4HN7A 1PH7A 1J5EQ 3F1ZA 4JPBW 4G7ZC 4DV7L 1Q1EA 2L9HA 2YTVA 1VQIA 2RKSA 1SBBB 3SK4A 1VF5C 1B70B 4OWWB 1R4PB 1A3UA 3TZUA 5C3EG 4LF7Q 3D6CA 3P20A 1LTSD 4K14A 2QEJC 1EY6A 3ER0A 3D6WA 5IY0A 1VMCA 3J80L 2BDOA 2JA7B 5F2DA 3E0JA 2A6ED 4GN4B 1U4PA 3UE0A 4LFBQ 5C3XA 5GAGC 3JAML 1BCPB 3M4QA 4A3JB 1PH2A 3PUWA 4QMGA 5KIXA 1IYJB 2E75C 2OTJA 1LV9A 4ZK9B 1KNAA 2YU9B 4HJ8A 1ET9A 1F9PA 3QJYA 1CK1A 1E2WA 3HS0C 4PZ8A 2Q2TA 3J7AF 4IUPA 3K0YA 3IKJA 4KY7A 3IAYA 2NVTB 5DM63 1N34L 1VQ4A 4DV5L 1MBYA 1HRJA 4A93G 3K7UC 5JOBA 1L0WA 3G71A 5IGGA 3MXPA 4EQOA 5GAEC 2B39A 1XNQL 4LK1C 2NVXB 3K5NA 1L1OB 1Q8KA 5DAUA 1STEA 3I4MB 4BS9A 1HNWL 4A3MB 5FKAC 1Y8OB 2Z6BA 5H1SE 3GTGB 3K7AB 5HGQA 4A3BG 1STYA 1LUZA 2H5XA 4R4OA 2HDMA 3M4YA 1QVCA 2R93H 3BVZA 3LWEA 2DNCA 4CDEC 1PHJA 2OQ0A 3VR5A 3J81L 2UXBL 1AW7A 3I7FA 1TWGB 4NB3A 1Q7YC 2D0OA 1S5DD 4A3LG 1SRUA 3NBHB 3MA2B 4DN4M 4LJZC 1TU2B 3DM3A 4X65Q 1CKOA 1KC8C 3FHWA 2JYOA 1C48A 4DXGA 3TP5A 4IJLA 1GKHA 1JJ2A 4XDXA 2IX1A 2NWGA 2L15A 4LF6Q 4RGMA 5ELOA 1PFBA 4HJ9A 4DR2Q 2NN6G 3R8BA 2H4OA 4JBJA 3CQZH 4ZYSA 4CJ2C 5E4WC 4KI0A 2JA5G 3RNUA 2OT2A 4OEMB 1I4HA 1ML0D 4OL7A 5IYCH 1RF2D 4QJFA 1G8ZD 2HD3A 1SYFA 4ULLA 2ZTEA 2D2CC 4X66Q 3M4OB 1IW7C 1XWEA 5KGUA 2ID0A 2IWHA 5I2XA 2MPMA 1PTOD 3BU2A 4U673 3S1NB 1BCPC 2A19A 2XIWA 4A3KG 5IT9E 1A15A 4QQBX 1LABA 2RHQB 1ILQA 2ZM6L 4BY7H 3OTOL 1PVOA 1A2TA 3BVGA 2JA7H 2DJGC 5C6AA 4A3FG 3HOZB 4DNIA 2F0JA 2EIFA 1UE5A 1S3OA 1HFNA 5COYA 1EY9A 4TKOB 3RN2A 5ELEA 4A3JH 2WIIB 1IBML 3RMHA 4R4CA 1NMGA 1L1OC 1XNRQ 4KY6A 5CV8A 2YU9H 4NXML 4FF1A 5BR8L 4CDFC 4DV4L 4RH6A 5BN4A 5CMDA 3NUCA 3D4RA 2MNAA 2NVTH 3K5LA 5E7NA 3E5SA 2UUAQ 4O0AA 3EFXD 1Q82C 1ILPA 3J80E 3PUXA 4R8IA 1WTXA 2RQXA 1X3EA 3I73A 1BCPF 3T4AC 2NVXH 1TT2A 4JI5Q 3KDFA 2PW5A 1SDFA 3I4MH 1KAWA 1X3QA 1HNZQ 3JAME 2CQAA 1CA5A 4I7AA 4A3MH 3X3MA 4DUYQ 5LMUQ 1TWHB 3ONAB 1KTKA 2KHJA 3K7AH 3GTGH 2PQAB 5K36H 4TVAB 3EROA 1X9NA 3TS2A 1DXMA 2N49A 3FKIB 1NJIC 2WFWA 4GOPB 4F7XA 4K0KL 1RKNA 1PH8A 4P75A 2UUBL 3T53B 4RAUC 1TWGH 4YY3L 1LTBD 3AYHB 1HCZA 2F0QA 4DAYA 3PIOA 3IL8A 5I9PA 1QJOA 3CCMA 1SE2A 1E7ZA 1JB3A 5L37A 2KEEA 1VQ8A 2UXDQ 4J6HA 4OX9Q 1GOZA 5DM73 3ZYYX 5M9OA 4DV2Q 2C5CA 4ZQ3A 1Z6HA 5ELBA 2A6HC 4DK0A 3J81E 2B63H 3T1YQ 2R93G 5IT9c 4IUNA 3R3OA 1B3AA 4JI6Q 1VS0A 1JJGA 4NXNQ 1II3A 1EQRA 4IUTA 1HR0L 2DNEA 3M4OH 4C2MB 3M3YB 2CQOA 1NY4A 4XIGS 3VDYA 3HP3A 4WJWA 2F0LA 2KEDA 1H9KA 1V1PA 3S1NH 4IPHA 3K5OA 1OXUA 4DV3L 5I6YA 2VB3X 4ZAIA 3Q8DA 2XWBB 2B2WA 4XT1B 5I4DA 1G6ZA 3OMGA 4C1NK 4DV0Q 2Z0SA 3PIO3 2B8FA 3GTPB 3HOZH 1EIGA 5IYCG 2LKVA 2J7ZA 4C3IB 5IGBA 3OWFA 2IW3A 1XPUA 5CV6A 4LF4L 4ZKCB 1TVXA 2EY1A 2PW7A 3NEMA 1SE4A 3LNNA 1AFPA 4DR3L 2JEBI 3S1MB 4LF9Q 5IYDG 1NMFA 2E5LQ 4JI2L 1B9NA 3U9SA 4DV6Q 2AWOA 3QG1A 1YJ9A 2F4VL 1EY0A 2EXDA 4A93B 3NE5B 2SDFA 1RD9D 2JA7G 3ERSX 3S1RB 2M2LA 1ICWA 2HDLA 1I4QA 3EIVA 1JQYD 1AN8A 1HTLD 4KD4A 2VL6A 1TWHH 3I2ZA 4A3JG 2R6GA 5FK9C 2F0GA 4N8FA 4XYQA 3FKIH 2IHEA 3SDZA 1EFWA 4JOIC 1I94L 2EVBA 1DONA 3RLNA 2DGYA 2CKZB 1SJED 2A68C 3UE1A 2BH8A 1FYCA 2RDFA 4MZ9A 2Q8IB 5CC4A 4M1UB 4QL5A 4XYOA 1GUWA 3TP8A 3B6YA 4CDCC 1JMCA 4GKKL 2UXCQ 2N55A 4CJ0B 1IYVA 1CA6A 4MTNA 3I4MG 1NNXA 5J3BA 1SYBA 1PH6A 2ES2A 2F0IA 5C4HA 4LMQD 4A3GB 3WWVA 3Q24A 2K14A 4J15A 4DAMA 3AFPA 4IURA 4A3EB 1VQ7A 2WINB 1RJTA 5C4ZA 2F0WA 2AUKA 2JE6I 2A8VA 1VQJA 2HCCA 1GVPA 3KUPA 2AKWB 1LTGD 1RTNA 2JA5B 2GVAA 3NTHA 1O80A 4K5VA 1JOOA 3F2BA 1HHVA 4OO1I 1D8LA 4HIOA 3KLSA 2L0CA 4C2MH 5IODA 3M3YH 1B53A 4X64L 4B3RL 1MKHA 2K5WA 3CU7A 4P73A 2EYHA 2EJMA 4DR7L 1TWCB 4H13C 1GM5A 1WTVA 1W2BA 4Q5VA 1XJVA 1WD0A 3CF5A 2I46A 3GV3A 1YEZA 4MTKA 2JK8A 1XMOQ 4A3KB 3A7LA 2EQSA 4IALA 3CPWA 1YZ6A 3GTPH 2ASBA 3TDQA 2HQLA 3OIQA 1SMYC 3D4WA 1MJEA 4C3IH 3DXJC 1QUQA 2CH4A 4A3FB 3CRKC 3EBEA 1I6VC 3M7GA 1GJXA 4DAVA 2Q2HA 4DR6L 2JA6G 1FGBD 2F0TA 3AU7A 2IX3A 2WKCA 3A8IE 1C0AA 3S1MH 2EYOA 1N32L 3S9WA 1I4GA 1JORA 1UNSA 1YHBA 1FGUA 1EU4A 3MWYW 1R4QB 4JI7L 1G291 3GTLB 1KQSA 4J8QA 1X54A 1J5EL 3CD6A 4A93H 1F9SA 1UUPA 4IFDI 5EAYA 1EYDA 3S1RH 1UE6A 1GXDC 4CKBA 4F87A 3HOZG 5JPNC 3T16A 2FMMA 1A2UA 1JWMD 4OWXB 4LF7L 3QB3A 5GAHC 1EY5A 5J22A 1HH2P 2B2UA 3GP7A 1CT1D 1U4RA 2MP1A 3OOCA 3C3LA 5JVH3 4LF8Q 3VR6A 1B50A 1XTDA 1KL9A 3GDEA 4NKLA 3C1EA 1VQBA 2E2IB 3CC4A 4LFBL 1EZ8A 1WTOA 1IYUA 2K5HA 4X3UA 4IN3A 1WTWA 5AFWA 4LFAQ 4LFCQ 4HCSA 4IPCA 3F2CA 5CBEE 4PQXA 1S72A 4X3TA 3A5UA 3V05A 1HQRD 1F2MA 4Y52H 1WCMB 2C9OA 3MZ5A 2OXPA 2DY8A 3EJIA 1SYEA 2NZOA 5FLMG 4A3GH 4E6IA 1GHJA 2EXZA 4LUOA 3TZDA 2K50A 3MEHA 1EWIA 4A3EH 5BN5A 5JEAG 1N8RC 3S16B 1LTID 1ENCA 3ERQA 1FVIA 4JBKA 2D0PA 3T1HQ 1DCZA 1Z9FA 3D31A 2JA5H 2AMCB 1STGA 1IL8A 1GHKA 1S5FD 1SSOA 1SMYD 5JJIA 1HZBA 3BVMA 1U4LA 3K6OA 4WFN3 1OXSC 1KXLA 1TS3A 2B8GA 2A69C 3CMAA 3I4NB 1TWCH 4JI0Q 2HIXA 4X65L 3URYA 4A3KH 1PRTD 1H9JA 3NHHA 2K5VA 5IE8A 2MO1A 3GTKB 2F1MA 3PIPA 5ELCA 1K8AC 3IFTA 5JAVA 1CHQD 3PQIA 4N8X1 5IT9L 5C3WA 2DJFC 4LF6L 1X6OA 1N33L 1SYDA 4DR2L 3G6JB 2RVLA 2QEXA 4A3FH 2F3WA 4LWCA 2A5HA 3I70A 3KLRA 3TMEA 1B4OA 4FXKC 1EFID 2I5MX 3OW7A 4XQQA 4A3CH 4GLVB 2VQEQ 2R7ZB 1VQGA 2N88A 2Z4HA 4RHRA 1EYAA 4RCOA 4A76A 2NTTA 4XT3B 2UUCQ 1U9RA 2HIVA 3L0OA 4X66L 3K8AA 1QB5D 2NVYB 2QF7A 3HKZB 3GTLH 3MTSA 5D14A 4QIWB 1BBUA 2LY7A 5J1ZA 1EU3A 4YCWA 3CCVA 2L12A 2PI2A 1OTCA 3E0EA 2JA8B 4LUVA 3G4SA 5IWAQ 1EZ6A 2E2HB 3I56A 3GV6A 4C3IG 4B9WA 2XN9C 3DM1A 3SXHA 2B2TA 3J7AV 1VQPA 2TSSA 2F0OA 1BQQT 5T1GA 4F88A 3BJUA 2PO4A 5CORA 4XQNA 1FL0A 3F2UA 3PIP3 4OIJA 3NK9A 2HUGA 2E2IH 1EIHA 4DR1Q 4IFDJ 1VQAA 1B9MA 1LM0A 3PGZA 4RWSC 1PH1A 2YTXA 4OGQC 1XNRL 4R4QA 4WORA 4B3ML 2DUDA 3FVQA 3P75A 2P5ZX 3J7YW 4XQJA 2R61A 1EEFD 3MC0B 1WCMH 2IX0A 1WFQA 4RGTA 5ELDA 1F2ZA 2AQ1B 4ZRZA 4BBRB 4GNXA 3K57A 2UUAL 5IYBH 3KK7A 2ATWA 1EYCA 5E4XA 3J81i 5GROA 2E8GA 3S16H 3A54A 4JI5L 5EJWA 1PXUA 1NR4A 4N9PA 4B08A 2VUMB 2LXJA 1KRSA 2PMZB 4HTHA 1YBYA 4OHJA 5JEAJ 4DUYL 5IGCA 5LMUL 1X3PA 2F0NA 1SYGA 2ICEC 3D4DA 5M3FB 3FDTA 5C44G 2AQ2B 3DEPA 5EBDA 1PFNA 1A0IA 1C8CA 2CFMA 2L1BA 3BYYB 1FR3A 3DWQA 3I4OA 4YHHQ 3I4NH 2KCTA 5HY6A 2PNHA 4A3GG 5LMNQ 4IUVA 1S4ZA 3AB9A 1SJHD 2A74C 2D5DA 3BZDB 2F0FA 1PTOF 1JB7A 4A3EG 3FPUB 4FXGC 1Y69U 4AIMA 1YNJC 5LMNW 3GTKH 1F9RA 1PYBA 3Q22A 4B9XA 1E1TA 1X55A 2QCPX 5KRUA 1IZ6A 2NTSA 5C0XI 1K0RA 2HT1A 1HNXQ 2B2YA 1YIJA 2E74C 4DV2L 4LUZA 4PV1C 4BXXH 4GN3B 5C4XG 3MXUA 1U4MA 3NENA 1IL2A 3U9OA 4CGYB 1O7YA 4GLXA 1ZXTA 3T1YL 4JI6L 4DR4Q 1A62A 1DOLA 4L6TB 2J4XA 3RZDB 2JA6B 4GN5A 3S2HB 4NXNL 4QB4A 1QOHA 3PSIA 4JBWA 2NVYH 1WI5A 3VA5A 5IYDH 4DV1L 1C7YA 3Q6SA 2KA7A 1CQFA 1KNEA 1LO5D 5IP7H 2HHHQ 3SK6A 1DD2A 2CHBD 1D5XC 2JA8H 3H91A 2MGSA 3CKIB 4HJ7A 1ICFB 2E2DC 3TRZA 3ND8A 4L5TA 2HQEA 1YHQA 2E2HH 1GUSA 4JYAQ 2DY7A 4KJOA 1QZHA 3GTJB 4JBMA 2VW9A 1PH4A 2PCFB 4KMUC 4A3CG 1LTRD 3VR3A 1XPOA 1S40A 2JEAI 2AUJD 1CM9A 1JE5A 1LT6D 3BDCA 4DR5Q 1EQVA 2L55A 3UDGA 4DUZQ 5CV4A 1YI2A 2WV6D 5T1IA 3NXWA 3MXNA 4DNTB 1GO3E 3F2DA 4G7OC 4B3SQ 4RHSA 3E9HA 2E5LL 2KHSA 4BBRH 2JXMB 2Y0SB 4DV6L 1PYSB 2IHFA 4JK1C 3KOJA 1PV4A 2O2LD 2FFKB 5FO7B 1Q46A 3UDIA 2PYKA 2CWAA 2F0DA 4KHPQ 3CXCA 2VUMH 3ND9A 4BA1I 3BDOA 3HOWB 3LX0A 1BXTA 2ALYB 3L2PA 1C9OA 1LT3D 3HOUB 4FNFA 1A3TA 2JA9A 1UEAB 4EQPA 4L8JA 4R4TA 5FO9B 1E2ZA 5M3FH 4ZKBB 2QDLA 2R7DA 5JJZA 1T9HA 2BE5C 3D8GA 3ZJYC 1VCIA 3FP9A 1LACA 3HKSA 3NQIA 1N36L 3VR4A 1WCMG 4CKEA 4JW0A 2K1BA 3K58A 4QGUA 1TIID 1NBWA 1JICA 3H94A 4X62Q 5IYBG 1GUOA 4HJAA 4FVMA 2X69A 3U58A 3CCSA 4LAAA 1TS5A 4HMJA 1WTPA 1IW7D 2NBFA 3Q23A 4OO1H 4IUQA 2SNSA 1M8AA 4AQYL 3NWTA 1ZYRC 1SEBD 1BCPD 1D6EC 1CSQA 2SOBA 5M5WB 2XGTA 3KLSX 3S14B 2VB2X 4JV5Q 1W6KA 2K5DA 4X3SA 2EYLA 2CCZA 5LHY1 5FO8B 3RN5A 4B3TQ 3RR5A 4BA2I 4LF5L 2HCIA 5D3DA 3CC7A 1XMQQ 1Q1BA 3RZDH 1DJRD 5I2YA 2JA6H 3I4NG 4GKJQ 3S2HH 3E6ZX 1D5ZC 4HR7B 1G2TA 3KF8B 1HA5A 5EBCA 5C0XJ 2C35B 3O13A 4I65A 4OWTB 3RUZA 2G5DA 3NTKA 2BOSA 4NPSA 4KHVA 1CFMA 1KDBA 3GTJH 4BXXG 2ZXPA 1B7YB 4ME5A 1XMOL 1YJNA 3PCOB 1U0LA 1BUVT 2R7ZG 3CCEA 1IBLQ 2R92G 3D0FA 1U5KA 1IBKQ 2VXWA 4HIDA 1KLGD 3HOXB 1D1IA 4IFDH 3H09A 3OSOA 4JI4Q 1K73C 3KF6B 1V43A 2V4DA 3J7A5 1F77A 2F52A 3HKZG 1HUNA 3I55A 1VQFA 5IP7G 5CV5A 2JA8G 2CH4W 3KBXA 2K5QA 4GOPC 3SK5A 1LYLA 2UU9Q 5EPLA 3X3NA 3HGBA 3QWNA 1RL2A 2ZJRA 2NYZD 4PZ7A 4KK7A 4C3JB 3KJOA 5FLMH 3OMCA 3TBIB 1VF7A 3KJPA 2EPBA 2L4NA 5DNFA 4KKSA 4JI1Q 5JEAH 1GUTA 1X32A 3HOUH 4YCVA 5JVG3 2IT1A 1A8VA 4MIUA 1CHPD 2F03A 1ZYRD 3AFQA 1TWAB 2A6HD 1KHIA 4LF8L 2X6LA 3DEOA 4RG1A 4CKCA 5C44B 4HIMA 4PNYA 4KKTA 2TMPA 2UUBQ 5I9OA 2F0VA 2XNAC 3OPOA 4BBRG 5E1FA 1QVGA 5IGDA 1VQEA 5EKIA 4LFCL 4K8IA 1KABA 2MFIA 4A3IB 2RA4A 4LFAL 1T5XD 3DUZA 1K9MC 4HEDA 1AZQA 2GA4B 3H3VC 4APVA 1HZAA 2VUMG 1SR3A 1KDCA 4C3HG 3W3AA
chains in the Genus database with same CATH topology
4HSPA 3RZOB 5D3IB 1BF4A 5IOCA 2PNRC 1SNDA 2RBMA 3QIAA 2CVRA 2MJ8A 5C4XB 2PPBC 5IIFA 1LTAD 2EZVA 1F2LA 1QE6A 2KQ3A 2OF1A 4ABNA 4OO1G 3L7ZC 3EQLC 5NUCA 2WB1B 4G57A 4AYBB 2Z8LA 1EL0A 4UAIA 5LL6S 2XRSD 1YNNC 4ILWA 2LFNA 5EQ0A 1SNPA 1DM0B 3GTOB 1V8QA 1CTMA 1ENAA 1EY7A 1FNVA 1TKWB 3SK8A 3VYTA 1EY8A 4QUFA 2AWNA 2KCCA 4UDUC 1DYQA 4O1NA 4C1NI 2DN8A 3S15B 4FXDA 2A68D 4HMIA 1I4PA 3V96A 3H0GB 2J0TD 1V1OA 2KVMA 2L5TA 5LL6X 3W2DA 1G2SA 5I6WA 1TQOA 4IFDG 3CRLC 2B2VA 1QWYA 4DU9A 1J8IA 1I3QB 1K8OA 4KY5A 1PFMA 2QILA 3GTMB 4K6LA 5G3LD 2KJXA 2PZUA 4IUUA 2NUCA 1PLFA 4ZUJA 4DNRB 2FMCA 2G9DA 4RKBA 1S5BD 4KN4C 4MHEA 5KNCA 1PRTF 1KDAA 2MUYA 4K2KA 5K5PA 1SE3A 2A6EC 2E2JB 1PTOB 3S1QB 1M4VA 1HPCA 1VMPA 1SNQA 1YNND 4RA8A 2K01A 1HTPA 1OXTA 1TY0A 1JOKA 5C0XH 2M9VA 1MI2A 2BCOA 1DZ1A 5E3FA 1JE4A 1AEXA 2AQ3B 1OO9B 1QNKA 4XTCS 4C56C 2F0HA 2F0KA 2NVQB 3IFDA 5C4JB 3FPPA 1ZKOA 3SE0A 1HQMC 1IKMA 4A3DB 5CR3A 2BA0A 3P7JA 4K2LA 1BBXC 2K03A 4GZYC 1K83B 1S5CD 4RGNA 1BR9A 5A2QL 4CBVA 2R92B 1H9RA 5CV9A 3MVVA 4DK1A 1JCKB 1B44D 1CQVA 3CHBD 5CBAE 3C1FA 3A56A 2BA1A 2QKIC 1I4XA 3BYTB 3BS1A 1W6JA 3D3RA 3K59A 2O5IC 5KNBA 3KBGA 1Y1WB 1EWCA 5D65A 2F3VA 1Q8IA 3FEWX 1XYIA 1ESFA 2G9HD 5EKLA 5HURA 1V1PB 4TQUS 4BY7B 1G91A 4X3KA 2RDHA 2O5JC 3BG3A 4KD3A 2MHVA 2QDBA 1ZEQX 2IL8A 2KECA 1PTOC 2WAQB 4CJ1B 4C3JG 3N6RA 1Y8NB 1I50B 3FMCA 4TRDA 1BDOA 3EA6A 1PDQA 3VA7A 2JP1A 3M85A 2A69D 5IGFA 5J39A 1XX8A 5KEEA 2EE1A 1SXTA 2YYZA 1GUGA 3DMUA 4C3HB 1VDZA 1PTOH 1E0BA 5TSSA 4PMWA 4KN7C 1A3VA 3NWSA 1RTOA 1D2BA 5EKKA 1K8MA 2I07B 3VYUA 2ZT9C 1PZJD 4N9TA 4ZLTF 1MSHA 3R2IA 1I4RA 5HGTA 3NTIA 1QNUA 1ENFA 5M5YB 3AMUA 2SEBD 2A73B 4IQZA 2NN6I 1NCVA 3OIPA 4RCNA 4NP5A 2PQEA 4L63B 4H7BA 4DGZA 3DHQA 1LT5D 2RSNA 1STAA 3Q0AA 1L0XB 5C0XG 3QOLA 3RLFA 4DXFA 3NBIA 2SNMA 4M8AA 2ZXOA 2B63B 2H1EA 2EY6A 2D62A 1NUCA 3T13A 1Y8PB 1SNOA 2CW0C 4KJNA 4R8NA 3MXGA 5CYUA 2EYFA 1SFOB 4H44C 3DWPA 3OHXC 5DEHA 5A2QE 2B2WC 2WKDA 1C4QA 3PO3B 1LLRD 3S17B 4KKUA 1SNCA 2Z1CA 4U68A 2IPKD 4NDXA 4KHZA 3TSSA 1I6HB 1UAPA 2K7VA 1A6XA 4Y7NB 4G7HC 1H9SA 3P1HA 1J9OA 4S3SA 1RCVD 1RHPA 2EJFC 3GTQB 3S2DB 1STBA 3HRZC 1FD7D 4EQNA 1WTRA 3PUVA 1JWSD 3SHLA 3M7NA 5M5XB 3PUZA 3I3CA 1Q12A 4H0LC 1CI3M 1TWFB 2Q8TA 5JPMC 3QO2A 4KTAA 1YNJD 1EY4A 2K33A 3BDLA 3ITPA 2KUMA 4HAEA 2PZTA 3HOVB 3A8JE 5EGTA 4DF7A 4HSVA 5FLXL 1Q90A 4DFAA 3WDNA 1TR5A 2K6AA 1O7ZA 2XRQD 4FF4A 2BDNA 3HOYB 4QF4A 1O7LA 2K05A 5KYLA 2D9UA 1WTQA 1ET6A 1NR2A 3TP6A 1PZID 2K04A 1AZPA 1L0YB 2F0PA 2CW0D 1NAPA 4FF3A 5M3MB 2IJ0A 1SNMA 1BNZA 1HUMA 1EEID 1FNUA 3SVMA 1OXXK 2XSCA 3UI2A 1SYCA 3T51B 2R3ZA 3MHBA 5IGEA 3DWAA 3C2PA 3GQBA 5CV7A 1TS4A 2FHTA 4MN3A 2LS01 1IHZA 2M00A 3FRPB 1CZWA 5EPKA 3L3OC 1NSNS 3PO2B 1Y1VB 3MAQA 4DA2A 1Q3LA 3RD4A 5ELFA 4IZ8A 3T56B 4K5XA 1STNA 1AP0A 2EYPA 3PMFA 2LMCB 1FNWA 1MD2D 2K32A 2OEOA 2F0UA 5C3EB 4ODGA 2FJ2A 5KYIA 1R9TB 1D5MC 4NMZA 1D1KA 2ICIA 2ENBA 2BE5D 2EYJA 3MFYA 1ONLA 1Z47A 2WP8J 2F4IA 1MSGA 2NB0A 4BBSB 2L11A 2KCNA 5A35A 1HXYD 2F0EA 3WOEA 2VNUD 3NBHA 4EGVA 4RFBA 1S5ED 2B2UC 5ISRA 2ZXRA 2B2VC 1PRTB 1SAPA 4FF2A 1TS2A 2RDGA 4BY1B 3OWEB 1KAAA 1STHA 2EY5A 5C5LA 4K6DA 4A3BB 1LTTD 1DOMA 4FO2A 3I72A 2O4XA 4HCEA 4K5WA 2RSOA 1HFGA 4QUCA 3L9AX 4DAPA 4FP5D 5FLXE 1Z7TA 3TN2A 4OIKA 1IKLA 2F0SA 3I90A 5K36G 2EY2A 3VR2A 3K5MA 1EQTA 3R93A 3I4LA 1H9MA 1QG7A 4G4KA 3SR1A 4XXEA 1JOQA 2EJGC 1LT4D 4QCLA 1E2VA 3V2TA 1PZKD 1PMRA 1F2YA 3WOFA 2NZ1D 1JWUD 3G7LA 4WRDA 3NPPA 1QCBD 3A7AB 3SEBA 3LWUA 1BO0A 3HEJA 4ID6A 4CHTB 5G3LF 1XTCD 3A8KE 5EPJA 1JC7A 4EVOA 2JSOA 4Z9CB 1PRTC 2EYMA 3QOJA 1ESRA 3MFGA 1WD1A 3PUYA 5CGKA 4RGOS 3HZXA 5C5MA 1MGSA 3HG9A 1XXGA 1EOTA 2Q8RE 2B2TC 2XWJB 4R9WA 4ZUIA 1B2TA 1RODA 1OXVA 3I8ZA 1KLUD 5BN3A 4BWGB 4K8JA 2FINB 2E76C 4RKLA 3GO5A 2PZWA 1HA6A 4I7ZC 4PMBA 4V0BA 1CZGA 5FOBB 2EDGA 1O78A 1B1ZA 1F9QA 1GUNA 1T5EA 2KOLA 3R2TA 4FYDA 3KF8A 1EWHA 1H9SB 3PV0A 4J1MA 4F8MA 4YIJA 4KV6A 1WVLA 2NN6H 1RDPD 2Z4IA 2R93B 4NW2A 4TSSA 3NQTA 2F0MA 2EOTA 4O42A 3NSWA 3N52A 1PYWD 3C46A 4V190 4P2CB 3TP7A 3NP8A 2B2YC 3EVQA 3H6MA 1JR0D 3VYSA 3CQZB 3A55A 3I91A 2XVSA 1DOKA 1QILA 2K28A 4PMCA 1BOSA 3VYRA 3GD7A 2X6GA 1TY2A 5KNDA 2WACA 4Q0FA 4HN7A 4G7ZC 1Q1EA 2L9HA 2RKSA 1SBBB 3SK4A 1VF5C 1R4PB 1A3UA 3TZUA 3D6CA 3P20A 1LTSD 4K14A 2QEJC 1EY6A 3D6WA 1VMCA 3J80L 2BDOA 2JA7B 5F2DA 3E0JA 2A6ED 1U4PA 5C3XA 3JAML 1BCPB 4A3JB 3PUWA 4QMGA 5KIXA 2E75C 1LV9A 4ZK9B 1KNAA 2YU9B 1ET9A 1F9PA 1CK1A 1E2WA 3HS0C 3QJYA 3J7AF 4IUPA 3K0YA 3IKJA 4KY7A 3IAYA 2NVTB 5DM63 1HRJA 1MBYA 5JOBA 5IGGA 3MXPA 4EQOA 2B39A 4LK1C 2NVXB 3K5NA 5DAUA 1STEA 3I4MB 4BS9A 4A3MB 5FKAC 1Y8OB 3GTGB 3K7AB 1STYA 2HDMA 3M4YA 3BVZA 3LWEA 2DNCA 3VR5A 3J81L 1AW7A 1TWGB 1S5DD 3MA2B 4DN4M 4LJZC 1TU2B 2JYOA 1C48A 4DXGA 3TP5A 2IX1A 4XDXA 2NWGA 4RGMA 1PFBA 2NN6G 3R8BA 2H4OA 4ZYSA 4CJ2C 5E4WC 4KI0A 2OT2A 1I4HA 1ML0D 4OL7A 1RF2D 1G8ZD 1SYFA 4ULLA 2D2CC 3M4OB 1IW7C 1XWEA 5KGUA 2ID0A 2IWHA 5I2XA 2MPMA 1PTOD 4U673 3S1NB 1BCPC 2XIWA 5IT9E 1A15A 1LABA 1ILQA 1A2TA 3BVGA 5C6AA 3HOZB 2F0JA 1HFNA 5COYA 1EY9A 4TKOB 5ELEA 2WIIB 3RMHA 4KY6A 5CV8A 4FF1A 4RH6A 5BN4A 5CMDA 3NUCA 3D4RA 3K5LA 3E5SA 3EFXD 1ILPA 3J80E 3PUXA 4R8IA 1WTXA 2RQXA 3I73A 1BCPF 3T4AC 1TT2A 2PW5A 1SDFA 1X3QA 3JAME 2CQAA 1CA5A 3X3MA 1TWHB 3ONAB 1KTKA 5K36H 3EROA 1DXMA 3FKIB 4F7XA 1RKNA 3T53B 4RAUC 1LTBD 1HCZA 2F0QA 4DAYA 3IL8A 5I9PA 1QJOA 1SE2A 1JB3A 2KEEA 4J6HA 1GOZA 5DM73 3ZYYX 5M9OA 2C5CA 4ZQ3A 1Z6HA 5ELBA 2A6HC 4DK0A 3J81E 4IUNA 3R3OA 1B3AA 1II3A 4IUTA 2DNEA 4C2MB 3M3YB 4XIGS 3HP3A 4WJWA 2F0LA 2KEDA 1H9KA 1V1PA 3K5OA 1OXUA 5I6YA 2VB3X 4ZAIA 2XWBB 2B2WA 5I4DA 4XT1B 1G6ZA 3OMGA 4C1NK 3PIO3 2B8FA 3GTPB 1EIGA 2LKVA 2J7ZA 4C3IB 5IGBA 3OWFA 2IW3A 5CV6A 4ZKCB 1TVXA 2EY1A 2PW7A 1SE4A 3LNNA 1AFPA 2JEBI 3S1MB 1B9NA 3U9SA 2AWOA 3QG1A 1EY0A 4A93B 3NE5B 2SDFA 1RD9D 3S1RB 2M2LA 1ICWA 2HDLA 1I4QA 1JQYD 1AN8A 1HTLD 4KD4A 2R6GA 5FK9C 2F0GA 4XYQA 3SDZA 2EVBA 1DONA 1SJED 2A68C 1FYCA 2RDFA 2Q8IB 5CC4A 4M1UB 4XYOA 1GUWA 3TP8A 2N55A 4CJ0B 1IYVA 1CA6A 1SYBA 2F0IA 5C4HA 4LMQD 4A3GB 3Q24A 4IURA 4A3EB 2WINB 1RJTA 5C4ZA 2F0WA 2AUKA 2JE6I 2HCCA 3KUPA 1LTGD 1RTNA 2JA5B 3NTHA 1O80A 4K5VA 1JOOA 1HHVA 4OO1I 3KLSA 2L0CA 5IODA 1B53A 2K5WA 3CU7A 2EYHA 2EJMA 1TWCB 4H13C 1WTVA 4Q5VA 1WD0A 2I46A 3GV3A 4A3KB 3A7LA 4IALA 3TDQA 3OIQA 1SMYC 3D4WA 3DXJC 4A3FB 3CRKC 1I6VC 3M7GA 1GJXA 4DAVA 1FGBD 2F0TA 3AU7A 2IX3A 2WKCA 3A8IE 2EYOA 3S9WA 1I4GA 1JORA 1UNSA 1EU4A 3MWYW 1R4QB 1G291 3GTLB 4J8QA 1F9SA 1UUPA 4IFDI 1EYDA 1GXDC 4CKBA 4F87A 5JPNC 3T16A 2FMMA 1A2UA 1JWMD 3QB3A 1EY5A 5J22A 2B2UA 3GP7A 1CT1D 1U4RA 2MP1A 3OOCA 3C3LA 5JVH3 3VR6A 1B50A 4NKLA 3C1EA 2E2IB 1EZ8A 1WTOA 1IYUA 4X3UA 4IN3A 1WTWA 5AFWA 4HCSA 5CBEE 4PQXA 4X3TA 3V05A 1HQRD 1F2MA 1WCMB 2C9OA 3MZ5A 2OXPA 2DY8A 3EJIA 1SYEA 4E6IA 1GHJA 2EXZA 3TZDA 3MEHA 5BN5A 5JEAG 3S16B 1LTID 1ENCA 3ERQA 1DCZA 3D31A 1STGA 1IL8A 1GHKA 1S5FD 1SSOA 1SMYD 3BVMA 3K6OA 1U4LA 4WFN3 1OXSC 1TS3A 2B8GA 2A69C 3I4NB 3URYA 1PRTD 1H9JA 3NHHA 3GTKB 2F1MA 5ELCA 3IFTA 5JAVA 1CHQD 5IT9L 5C3WA 1SYDA 3G6JB 2RVLA 2F3WA 2A5HA 3I70A 3KLRA 3TMEA 1B4OA 4FXKC 1EFID 3OW7A 4XQQA 2R7ZB 2N88A 2Z4HA 4RHRA 1EYAA 4RCOA 2NTTA 4XT3B 1U9RA 1QB5D 2NVYB 2QF7A 3HKZB 3MTSA 5D14A 4QIWB 2LY7A 5J1ZA 1EU3A 2L12A 2JA8B 1EZ6A 2E2HB 3GV6A 4C3IG 4B9WA 2XN9C 3DM1A 3SXHA 2B2TA 3J7AV 2TSSA 2F0OA 1BQQT 5T1GA 4F88A 2PO4A 5CORA 4XQNA 3F2UA 3PIP3 4OIJA 3NK9A 2HUGA 1EIHA 4IFDJ 1B9MA 4RWSC 4OGQC 4WORA 3FVQA 3P75A 3J7YW 4XQJA 2R61A 1EEFD 3MC0B 2IX0A 4RGTA 5ELDA 1F2ZA 2AQ1B 4ZRZA 4BBRB 3K57A 3KK7A 1EYCA 5E4XA 3A54A 5EJWA 1PXUA 1NR4A 4N9PA 4B08A 2VUMB 2PMZB 4HTHA 4OHJA 5JEAJ 5IGCA 1X3PA 2F0NA 1SYGA 2ICEC 3D4DA 5M3FB 3FDTA 2AQ2B 3DEPA 5EBDA 1PFNA 1C8CA 2L1BA 3BYYB 1FR3A 3DWQA 4IUVA 1S4ZA 3AB9A 1SJHD 2A74C 2D5DA 3BZDB 2F0FA 1PTOF 3FPUB 4FXGC 1Y69U 1YNJC 1F9RA 3Q22A 4B9XA 2QCPX 5KRUA 2NTSA 5C0XI 2B2YA 2E74C 4PV1C 3MXUA 1U4MA 3U9OA 4CGYB 1O7YA 1ZXTA 1DOLA 4L6TB 2J4XA 3RZDB 2JA6B 3S2HB 4QB4A 1QOHA 4JBWA 3VA5A 3Q6SA 2KA7A 1CQFA 1KNEA 1LO5D 3SK6A 1DD2A 2CHBD 1D5XC 3H91A 2MGSA 3CKIB 2E2DC 3ND8A 2HQEA 1GUSA 2DY7A 4KJOA 3GTJB 2PCFB 4KMUC 1LTRD 3VR3A 2JEAI 2AUJD 1CM9A 1LT6D 3BDCA 1EQVA 2L55A 5CV4A 2WV6D 5T1IA 3NXWA 3MXNA 4DNTB 4G7OC 4RHSA 2KHSA 2JXMB 2Y0SB 4JK1C 2O2LD 2FFKB 5FO7B 2PYKA 2F0DA 3ND9A 4BA1I 3BDOA 3HOWB 3LX0A 1BXTA 1LT3D 3HOUB 4FNFA 1A3TA 1UEAB 4EQPA 4L8JA 5FO9B 1E2ZA 4ZKBB 5JJZA 2BE5C 3D8GA 1VCIA 1LACA 3NQIA 3VR4A 4CKEA 2K1BA 3K58A 1TIID 1JICA 3H94A 1GUOA 4FVMA 2X69A 4LAAA 1TS5A 4HMJA 1WTPA 1IW7D 2NBFA 3Q23A 4OO1H 4IUQA 2SNSA 1M8AA 3NWTA 1ZYRC 1SEBD 1BCPD 1D6EC 2SOBA 5M5WB 3KLSX 3S14B 2VB2X 1W6KA 2K5DA 4X3SA 2EYLA 5LHY1 5FO8B 4BA2I 2HCIA 5D3DA 1Q1BA 1DJRD 5I2YA 3E6ZX 1D5ZC 4HR7B 1G2TA 1HA5A 5EBCA 5C0XJ 3O13A 4I65A 3RUZA 3NTKA 2BOSA 4KHVA 1CFMA 1KDBA 2ZXPA 4ME5A 1BUVT 2VXWA 1KLGD 3HOXB 1D1IA 4IFDH 3H09A 3OSOA 1V43A 2V4DA 1F77A 1HUNA 5CV5A 3KBXA 2K5QA 3SK5A 5EPLA 3X3NA 3HGBA 3QWNA 2NYZD 4KK7A 4C3JB 3OMCA 3TBIB 1VF7A 2EPBA 2L4NA 5DNFA 4KKSA 5JEAH 1GUTA 1X32A 5JVG3 2IT1A 4MIUA 1CHPD 2F03A 1ZYRD 1TWAB 2A6HD 2X6LA 3DEOA 4CKCA 5C44B 4PNYA 4KKTA 2TMPA 5I9OA 2F0VA 2XNAC 3OPOA 5E1FA 5IGDA 5EKIA 4K8IA 1KABA 4A3IB 2RA4A 1T5XD 3DUZA 4HEDA 1AZQA 2GA4B 3H3VC 1KDCA 4C3HG 3W3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TP7 A;  1TT2 A;  3NP8 A;  3QOL A;  4EVO A;  2PW5 A;  4QF4 A;  5CV6 A;  5KYL A;  3EVQ A;  2EY1 A;  2PW7 A;  2PZU A;  3H6M A;  3TP6 A;  1F2Z A;  2EYM A;  1STG A;  2SNM A;  2F3V A;  4I65 A;  2NUC A;  3QOJ A;  5IOC A;  4IAL A;  1SND A;  2EY6 A;  1NUC A;  1EYC A;  4ZUJ A;  3T13 A;  2F0P A;  3BDC A;  3RUZ A;  5EKL A;  5CGK A;  2RBM A;  1EQV A;  3HZX A;  5C5M A;  1SNO A;  1KAA A;  1STH A;  2EY5 A;  4KJN A;  4KHV A;  4K6D A;  3D4W A;  3ERO A;  4PMC A;  4R8N A;  5CV4 A;  4RKB A;  3TP5 A;  1KDB A;  5IIF A;  4N9P A;  1SNM A;  3NXW A;  2KQ3 A;  2EYF A;  4ZUI A;  4ME5 A;  4F7X A;  1RKN A;  1EY0 A;  2OF1 A;  4HTH A;  1SYC A;  1KDA A;  2WAC A;  3MHB A;  5DEH A;  4K2K A;  4KD3 A;  5IGC A;  2QDB A;  5K5P A;  2F0T A;  2O4X A;  5IGE A;  2F0N A;  1SYG A;  4K5W A;  2KHS A;  2F0Q A;  3NHH A;  4KD4 A;  4K8J A;  5CV7 A;  3D4D A;  1SNC A;  2RKS A;  5HUR A;  2EYO A;  3OSO A;  3SK4 A;  3S9W A;  4RKL A;  2M00 A;  1IHZ A;  5NUC A;  2PZW A;  5JAV A;  4G57 A;  1SNQ A;  5I9P A;  1JOR A;  2F0G A;  5C3W A;  4OL7 A;  2PYK A;  1A3U A;  4NDX A;  1NSN S;  2F0D A;  4TRD A;  1SYD A;  3D6C A;  4PMB A;  2F3W A;  3LX0 A;  4K14 A;  1SYF A;  5CV5 A;  1EY6 A;  4J6H A;  2F0S A;  3TME A;  5IGF A;  1JOK A;  5J39 A;  5KEE A;  1EYD A;  3SK5 A;  2EY2 A;  2F0F A;  5M9O A;  1A3T A;  3DMU A;  2RDF A;  3T16 A;  4EQP A;  1EYA A;  4ZQ3 A;  5E3F A;  5CC4 A;  1SNP A;  5F2D A;  5KGU A;  1AEX A;  1ENA A;  1A2U A;  4IZ8 A;  1EY7 A;  3D8G A;  3P1H A;  3SR1 A;  3TP8 A;  1U9R A;  3QB3 A;  1EY5 A;  4K5X A;  4B9X A;  4S3S A;  5C3X A;  5KRU A;  1STN A;  2F0H A;  5J22 A;  3SK8 A;  1JOQ A;  2EYP A;  2F0K A;  1EY8 A;  3OMC A;  3PMF A;  3R3O A;  4IUN A;  4QMG A;  5KIX A;  3V2T A;  1A3V A;  2OEO A;  1STB A;  2F0U A;  4ODG A;  1SYB A;  1II3 A;  5J1Z A;  5KYI A;  5CR3 A;  4EQN A;  2F0I A;  5C4H A;  4J1M A;  4F8M A;  4NKL A;  3C1E A;  1A2T A;  4K2L A;  5EKK A;  3SHL A;  1F2Y A;  4NMZ A;  4YIJ A;  3U9O A;  4LAA A;  1EZ6 A;  4KV6 A;  5C6A A;  4HMJ A;  2ENB A;  4HMI A;  4KY7 A;  1EZ8 A;  2F0J A;  4WRD A;  4MIU A;  4N9T A;  2F0L A;  4KTA A;  5JOB A;  1EY9 A;  2SNS A;  5C4Z A;  2F0W A;  1EY4 A;  2EYJ A;  5IGG A;  3BDL A;  3MXP A;  4B9W A;  3ITP A;  5CV9 A;  3MVV A;  4QB4 A;  3SXH A;  4EQO A;  5HGT A;  5I6Y A;  5IOD A;  1F2M A;  2F0O A;  4PNY A;  3VA5 A;  2SOB A;  3NQT A;  4KY6 A;  2PZT A;  2F0M A;  5CV8 A;  3MZ5 A;  2F0V A;  2OXP A;  5DAU A;  5I9O A;  3EJI A;  1JOO A;  1SYE A;  4K5V A;  5EGT A;  3OMG A;  3SK6 A;  5I6W A;  1TQO A;  5E1F A;  2EYL A;  3NK9 A;  2EXZ A;  4DF7 A;  4E6I A;  5IGD A;  3C1F A;  3MEH A;  1KAB A;  3NUC A;  4K8I A;  5C5L A;  4NP5 A;  4DU9 A;  2PQE A;  2F0E A;  3E5S A;  4DFA A;  2HQE A;  1TR5 A;  4H7B A;  4DGZ A;  3DHQ A;  1ENC A;  2LKV A;  3ERQ A;  4KJO A;  1STY A;  3HEJ A;  4ID6 A;  4KY5 A;  1STA A;  2EYH A;  4WOR A;  5IGB A;  3OWF A;  3P75 A;  1KDC A;  5ISR A; 
#chains in the Genus database with same CATH topology
 4HSP A;  2KCM A;  3RZO B;  5D3I B;  3S14 H;  1BF4 A;  5M3F G;  5IOC A;  2PNR C;  1SND A;  3S24 A;  2RBM A;  3QIA A;  2CVR A;  2MJ8 A;  3T1H L;  1SN8 A;  5C4X B;  2PPB C;  3H3V H;  4UPA A;  5GQO A;  5IIF A;  1LTA D;  2EZV A;  1F2L A;  1QE6 A;  2KQ3 A;  2OF1 A;  4GNX B;  4ABN A;  3G6E A;  4JCV E;  4OO1 G;  5AJ3 Q;  3L7Z C;  3EQL C;  5NUC A;  2WB1 B;  4G57 A;  4AYB B;  2Z8L A;  1EL0 A;  4JI0 L;  4UAI A;  5LL6 S;  4UP9 A;  2XRS D;  1YNN C;  2N3S A;  4ILW A;  2LFN A;  4P72 A;  5EQ0 A;  2Z6K C;  3CCR A;  3HOX H;  1SNP A;  1DM0 B;  3GTO B;  1V8Q A;  1CTM A;  4ME3 A;  1ENA A;  1EY7 A;  1FNV A;  1TKW B;  3SK8 A;  1FJG Q;  3VYT A;  1EY8 A;  4QUF A;  1B8A A;  2VQE L;  2AWN A;  2KCC A;  4UDU C;  4MNO A;  1DYQ A;  4O1N A;  4C1N I;  4HIK A;  2YTY A;  3H15 A;  2DN8 A;  3S15 B;  4FXD A;  2UUC L;  2A68 D;  4DK3 C;  4HMI A;  3CME A;  3PF4 A;  1I4P A;  4R1J A;  2MQH A;  3V96 A;  3H0G B;  4C3J H;  2J0T D;  1V1O A;  2KVM A;  2YV5 A;  1H95 A;  2L5T A;  2F4V Q;  5LL6 X;  3W2D A;  1G2S A;  5I6W A;  1TQO A;  4IFD G;  3CRL C;  2B2V A;  1QWY A;  4DU9 A;  1J8I A;  2NZH A;  1BKB A;  1I3Q B;  4UP8 A;  1K8O A;  1HZ9 A;  1TWA H;  4IOC A;  4KY5 A;  1PFM A;  5C44 H;  4JOI A;  2QIL A;  3GTM B;  4K6L A;  4DR1 L;  2N8N A;  5G3L D;  2KJX A;  2PZU A;  4JI3 Q;  4IUU A;  2Y0S G;  4UY8 C;  2NUC A;  1PLF A;  1VQL A;  5FLX c;  4ZUJ A;  4DNR B;  1J6Q A;  3BZK A;  4A3I H;  3TRE A;  3K80 C;  1VQK A;  4YWM A;  2FMC A;  2G9D A;  4YWK A;  4RKB A;  3OYY A;  3HOW G;  1S5B D;  1X56 A;  4KN4 C;  4MHE A;  5KNC A;  1PH3 A;  3JC6 6;  1WTH A;  1PRT F;  4GNX C;  3HOU G;  3RZO H;  1GD7 A;  1KDA A;  2MUY A;  4K2K A;  1AH9 A;  5K5P A;  1SE3 A;  2A6E C;  2E2J B;  4IJH A;  4RMF A;  1PTO B;  3S1Q B;  1M4V A;  2K4K A;  1HPC A;  1YJW A;  1VMP A;  3MXN B;  4LW1 A;  3STB C;  3HOV G;  5C4X H;  1SNQ A;  1YNN D;  4RA8 A;  3CPF A;  2K01 A;  1HTP A;  1OXT A;  4JI8 Q;  1TY0 A;  2VY3 A;  3KDF B;  5ELN A;  2B29 A;  1JOK A;  5C0X H;  2M9V A;  3W5O A;  1SMX A;  1MI2 A;  2BCO A;  1UE1 A;  1DZ1 A;  5E3F A;  1JE4 A;  1AEX A;  2AQ3 B;  1OO9 B;  1QNK A;  3HOY G;  4XTC S;  4C56 C;  1VQN A;  2F0H A;  2F0K A;  2NVQ B;  3IFD A;  1YVC A;  3U50 C;  5C4J B;  3FPP A;  1ZKO A;  3SE0 A;  1HQM C;  1MIU A;  1I5F A;  1IKM A;  4A3D B;  5CR3 A;  3A5Z B;  1Y14 B;  2BA0 A;  3P7J A;  4K2L A;  1BBX C;  1CKN A;  2K03 A;  2GVB A;  4DAY B;  4GZY C;  5JJK A;  3GTO H;  2AHO B;  4EQ5 A;  1K83 B;  1S5C D;  1HNX L;  4RGN A;  1BR9 A;  2K52 A;  5A2Q L;  4CBV A;  2R92 B;  1H9R A;  2BH2 A;  5CV9 A;  3MVV A;  2V1C C;  4A4I A;  1UEB A;  4DK1 A;  3J80 i;  1JCK B;  2I5L X;  1B44 D;  1CQV A;  3UDX A;  4DR4 L;  3CHB D;  5CBA E;  3C1F A;  3A56 A;  2BA1 A;  3JAM i;  1EIF A;  2QKI C;  1N32 Q;  3PO2 G;  1PA6 A;  1I4X A;  3BYT B;  3BS1 A;  1K3B C;  1W6J A;  3CP0 A;  3D3R A;  3H0G H;  3K59 A;  2HHH L;  2VZA A;  5KNB A;  2O5I C;  3KBG A;  2LSS A;  1ASZ A;  1Y1W B;  3HFZ B;  1EWC A;  5D65 A;  3HOX G;  2F3V A;  4JYA L;  1Q8I A;  3FEW X;  1XYI A;  1ESF A;  3ULJ A;  2G9H D;  5EKL A;  4EX5 A;  1PH9 A;  1WJJ A;  1I3Q H;  5HUR A;  1V1P B;  4TQU S;  4BY7 B;  1G91 A;  1VQD A;  4X3K A;  2RDH A;  2O5J C;  2KBN A;  3GTM H;  1CKM A;  3BG3 A;  4KD3 A;  2MHV A;  2QDB A;  4DR5 L;  1ZEQ X;  3TS0 A;  4DUZ L;  1M90 C;  2IL8 A;  2KEC A;  3STB D;  1PTO C;  2WAQ B;  4CJ1 B;  4C3J G;  4BBS G;  3N6R A;  4UP7 A;  1Y8N B;  1I50 B;  1A63 A;  3FMC A;  3W1B A;  4TRD A;  1BDO A;  3EA6 A;  1PDQ A;  4B3S L;  3VA7 A;  2JP1 A;  2I5H A;  3M85 A;  2A69 D;  5IGF A;  5J39 A;  1XX8 A;  5KEE A;  1HNZ L;  2EE1 A;  5DLQ E;  1SXT A;  2YYZ A;  1GUG A;  3DMU A;  4C3H B;  4POG A;  2E2J H;  1VDZ A;  1PTO H;  4AH6 A;  3S1Q H;  3EN2 A;  1E0B A;  1EOV A;  1CSP A;  4KHP L;  3CW2 C;  5TSS A;  4PMW A;  2VQF Q;  4KN7 C;  1A3V A;  3NWS A;  4BY1 G;  1PFS A;  1RTO A;  1D2B A;  2KHI A;  5EKK A;  4A3I G;  1K8M A;  1N9W A;  2I07 B;  3CCL A;  3VYU A;  2ZT9 C;  1PZJ D;  4N9T A;  1NE3 A;  4ZLT F;  1MSH A;  3R2I A;  1SLJ A;  1E24 A;  1I4R A;  4X62 L;  2NVQ H;  5HGT A;  5C4J H;  4QY7 A;  3NTI A;  1QNU A;  4OXP A;  1ENF A;  3K0X A;  5M5Y B;  3AMU A;  2SEB D;  2A73 B;  4IQZ A;  3ICE A;  4A3D H;  2UXD L;  4OX9 L;  2NN6 I;  1NCV A;  3CCQ A;  3OIP A;  4RCN A;  4O2D A;  2ZTD A;  4L5Q A;  2PQE A;  4NP5 A;  1KRT A;  1K83 H;  4L63 B;  2R7Z H;  4H7B A;  4DGZ A;  3DHQ A;  1LT5 D;  2R92 H;  2RSN A;  1STA A;  3Q0A A;  1N33 Q;  1NTG A;  1W3S A;  4JV5 L;  1L0X B;  5C0X G;  3QOL A;  3RLF A;  4B3T L;  2ZJQ A;  1P8L A;  4DXF A;  3NBI A;  2SNM A;  4M8A A;  2ZXO A;  1XMQ L;  2B63 B;  2H1E A;  2EY6 A;  2D62 A;  1NUC A;  3T13 A;  4GKJ L;  2WB1 G;  1Y8P B;  4AYB G;  1SNO A;  2CW0 C;  4KJN A;  4R8N A;  4DV7 Q;  3MXG A;  3CCJ A;  5CYU A;  2EYF A;  1SFO B;  4H44 C;  1VQH A;  4CDD C;  3DWP A;  3OHX C;  1DGS A;  5DEH A;  5A2Q E;  1Y1W H;  2F3I A;  2B2W C;  3HKZ E;  1AE2 A;  1C4Q A;  2WKD A;  4QIW E;  3PO3 B;  1LLR D;  4DV0 L;  3S17 B;  1G6P A;  3CCU A;  4KKU A;  1SNC A;  5IP9 H;  2Z1C A;  2JJQ A;  1VQM A;  2Q2U A;  4U68 A;  2IPK D;  4IPD A;  4NDX A;  4KHZ A;  3TSS A;  1I6H B;  1IBL L;  1IXR A;  1UAP A;  1IBK L;  5JJL A;  4L5S A;  2K7V A;  4ALP A;  1A6X A;  4JI4 L;  4Y7N B;  4G7H C;  2KEN A;  1VQO A;  1H9S A;  4LF9 L;  3H0G G;  3P1H A;  1J9O A;  4S3S A;  1I50 H;  1RCV D;  1N34 Q;  4B3M Q;  4DV5 Q;  1RHP A;  1L2F A;  2EJF C;  1QUQ B;  3GTQ B;  3S2D B;  2UU9 L;  1STB A;  1HJP A;  1JT8 A;  3HRZ C;  1FD7 D;  4EQN A;  1WTR A;  3PUV A;  1XNQ Q;  1JWS D;  1KIX A;  3SHL A;  3M7N A;  5M5X B;  2ZTC A;  3PUZ A;  3I3C A;  4C3H H;  1Q12 A;  4JG2 A;  2IY5 B;  2WAQ E;  4H0L C;  3A74 A;  1CI3 M;  1TWF B;  2N78 A;  1HNW Q;  2Q8T A;  5JPM C;  1ASY A;  3QO2 A;  3SGI A;  4KTA A;  1YNJ D;  4OEL B;  1EY4 A;  2K33 A;  3BDL A;  3PF5 A;  4JI1 L;  3ITP A;  2KUM A;  1SRO A;  4X6A H;  4HAE A;  2PZT A;  4L5R C;  3HOV B;  3A8J E;  2FXQ A;  5EGT A;  2B3G A;  1HZC A;  4HSV A;  4DF7 A;  2PMZ E;  5FLX L;  2UXB Q;  1Q90 A;  4DFA A;  3WDN A;  3DLL A;  1X65 A;  1TR5 A;  2K6A A;  2UXC L;  1O7Z A;  3F8T A;  2XRQ D;  1RIP A;  4FF4 A;  2BDN A;  1CUK A;  3HOY B;  5M5Y H;  1V9P A;  4QF4 A;  1O7L A;  2K05 A;  5KYL A;  2D9U A;  1WTQ A;  2RF4 A;  1ET6 A;  1NR2 A;  3BZC A;  3TP6 A;  1PZI D;  5GAD C;  2K04 A;  1K28 A;  4YWL A;  1AZP A;  1KD1 C;  1E1O A;  1L0Y B;  4JC0 A;  2F0P A;  1UE7 A;  2CW0 D;  4ZCK A;  1NAP A;  1K3R A;  4FF3 A;  1E3P A;  5M3M B;  2IJ0 A;  1SNM A;  1BNZ A;  1HUM A;  1EEI D;  3NEL A;  1FNU A;  3SVM A;  1OXX K;  2XSC A;  3UI2 A;  1SYC A;  3T51 B;  1G51 A;  2R3Z A;  3MHB A;  5IGE A;  3DWA A;  2QA4 A;  3C2P A;  3GQB A;  4KLK A;  5CV7 A;  1TS4 A;  2FHT A;  2OQK A;  4MN3 A;  2LS0 1;  1IHZ A;  2M00 A;  3FRP B;  1CZW A;  5EPK A;  3L3O C;  1NSN S;  4A3D G;  3PO2 B;  1Y1V B;  1SFO H;  3MAQ A;  4DV1 Q;  4DA2 A;  5AJ3 L;  3E9I A;  2ZM6 Q;  1Q3L A;  3PO3 H;  3S17 H;  4WJ4 A;  3RD4 A;  5ELF A;  3OTO Q;  1B3Q A;  4IZ8 A;  3T56 B;  4K5X A;  1STN A;  1AP0 A;  2EYP A;  3PMF A;  1I6H H;  2LMC B;  1FNW A;  1V1Q A;  1MD2 D;  2K32 A;  2OEO A;  2F0U A;  5C3E B;  4ODG A;  2FJ2 A;  5KYI A;  1R9T B;  1IBM Q;  1AE3 A;  1L1O A;  1D5M C;  4NMZ A;  4Y7N H;  1D1K A;  3J80 c;  4NXM Q;  2ICI A;  2ENB A;  5BR8 Q;  1FJG L;  4DV4 Q;  3KFU A;  2BE5 D;  2EYJ A;  3KLW A;  4OON A;  3MFY A;  3JAM c;  3AEV A;  1ONL A;  1Z47 A;  3GTQ H;  3S2D H;  1Y1W G;  2WP8 J;  1CKN B;  1MSG A;  2F4I A;  2NB0 A;  4BBS B;  2L11 A;  2KCN A;  1EUJ A;  1EQQ A;  2JQO A;  2LXK A;  5IP9 G;  5A35 A;  3HOW H;  5M5X H;  1HXY D;  1TWF H;  2F0E A;  3WOE A;  2VNU D;  4PZ6 A;  3NBH A;  3U4Z A;  4BY7 G;  4EGV A;  2Y0S E;  4RFB A;  3MEF A;  2A1A A;  1S5E D;  2B2U C;  5ISR A;  1D7Q A;  1YIT A;  2ZXR A;  3ULP A;  2B2V C;  3HOV H;  4GLA C;  1PRT B;  1SAP A;  4JVZ A;  4FF2 A;  1TS2 A;  4DPG A;  4K0K Q;  2WAQ G;  2RDG A;  5FJ8 H;  1E22 A;  1YNX A;  3OWE B;  4BY1 B;  4IOA A;  4YY3 Q;  1VQ6 A;  1KAA A;  1STH A;  2EY5 A;  5C5L A;  4K6D A;  1N36 Q;  4A3B B;  4JI3 L;  4DK6 C;  1LTT D;  3HOY H;  2OCE A;  1DOM A;  4FO2 A;  3J81 c;  3I72 A;  1WOC A;  1X3G A;  2O4X A;  4HCE A;  4K5W A;  2RSO A;  1HFG A;  3CAM A;  4QUC A;  5M5W H;  4PG3 A;  4DKA C;  3L9A X;  4DAP A;  4AQY Q;  3K81 C;  5M3M H;  4FP5 D;  2GN5 A;  5FLX E;  4A3M G;  1Z7T A;  3TN2 A;  4OIK A;  1IKL A;  2F0S A;  3I90 A;  5K36 G;  2EY2 A;  3VR2 A;  3K5M A;  1EQT A;  3R93 A;  3I4L A;  4LF5 Q;  1H9M A;  1HR0 Q;  2OTL A;  1QG7 A;  4G4K A;  3SR1 A;  4XXE A;  4WJ3 M;  1JOQ A;  3J81 j;  4R4I A;  4JI8 L;  2EJG C;  1HR0 W;  1LT4 D;  2Q2I A;  1QZG A;  4QCL A;  1E2V A;  3V2T A;  1QVF A;  3PO2 H;  1Y1V H;  1PZK D;  4DV3 Q;  1PMR A;  1F2Y A;  4P71 A;  3WOF A;  2NZ1 D;  3J7Z C;  2QGQ A;  1JWU D;  3G7L A;  4WRD A;  1M1K C;  1YHA A;  3E3X A;  3M9B A;  1VQ5 A;  3NPP A;  1QCB D;  5C3E H;  1R9T H;  1BVS A;  3A7A B;  3SEB A;  2B63 G;  2OWO A;  1O7I A;  4LF4 Q;  3LWU A;  1TXY A;  1BO0 A;  1XPR A;  3QR8 A;  4DR3 Q;  3HEJ A;  4ID6 A;  4CHT B;  1EYG A;  5G3L F;  1XTC D;  3A8K E;  5EPJ A;  1JC7 A;  2PQA A;  4JI2 Q;  4EVO A;  4BBS H;  2JSO A;  3PO3 G;  4GOP A;  4Z9C B;  1PRT C;  1VQC A;  2EYM A;  3G48 A;  3A0J A;  1K0S A;  3QOJ A;  1ESR A;  5IWA L;  2VS1 A;  2ZJP A;  3MFG A;  4IO9 A;  1UWV A;  1WD1 A;  3PUY A;  5CGK A;  4RGO S;  2RHS B;  3HZX A;  3IRB A;  5C5M A;  1Q81 C;  1MGS A;  4H02 A;  3HG9 A;  1JJC B;  1EOT A;  1XXG A;  4LNQ A;  3KYH C;  3TQY A;  2Q8R E;  2B2T C;  2XWJ B;  2RCF A;  4R9W A;  4POF A;  2MO0 A;  4ZUI A;  3AQQ A;  1B2T A;  1ROD A;  1OXV A;  3I8Z A;  1KLU D;  2XTI A;  5BN3 A;  1I94 Q;  4BWG B;  4K8J A;  4BY1 H;  2FIN B;  3W1G A;  2E76 C;  4RKL A;  3GO5 A;  2PZW A;  1HA6 A;  4I7Z C;  4A3B H;  1VQ9 A;  4PMB A;  4IPG A;  4V0B A;  4GKK Q;  1WYD A;  1CZG A;  2PI2 E;  1K8G A;  5FOB B;  2EDG A;  1O78 A;  1Q86 C;  4A3L H;  1B1Z A;  1F9Q A;  4FDB A;  1GUN A;  1T5E A;  2KOL A;  2RCN A;  3R2T A;  2JN4 A;  3LGJ A;  4FYD A;  3KF8 A;  3TEH B;  4UHV A;  3U4V A;  3RLO A;  1EWH A;  1H9S B;  3PV0 A;  5FJ8 G;  4J1M A;  4F8M A;  3FKI G;  2R7F A;  4YIJ A;  4KV6 A;  1WVL A;  1MJC A;  2NN6 H;  2VQF L;  4GS3 A;  1RDP D;  4YCU A;  1PH5 A;  2Z4I A;  4X64 Q;  2R93 B;  4B3R Q;  4NW2 A;  2CWP A;  3M4P A;  4YHH L;  4A75 A;  1MHW C;  4TSS A;  3NQT A;  2F0M A;  1LTL A;  5LMN L;  4DR7 Q;  2QW7 A;  3ULL A;  2EOT A;  4O42 A;  3OW2 A;  1P16 A;  3NSW A;  3KF6 A;  5M3M G;  3N52 A;  2Z9H A;  4P74 A;  1PYW D;  3C46 A;  4V19 0;  4P2C B;  2WB1 E;  3TP7 A;  3NP8 A;  4AYB E;  3CC2 A;  2B2Y C;  2K5N A;  3H3V I;  4HJ5 A;  3EVQ A;  1X3F A;  3H6M A;  1JR0 D;  3VYS A;  1EIY B;  3CQZ B;  2Z6K A;  3A55 A;  3I91 A;  2XVS A;  1DOK A;  4DR6 Q;  2I0Q A;  1SE8 A;  3S15 H;  1QIL A;  2K28 A;  4PMC A;  1BOS A;  2K75 A;  1Y1V G;  3VYR A;  3GD7 A;  1BBW A;  2X6G A;  1TY2 A;  3UDF A;  5KND A;  4JI7 Q;  2WAC A;  4Q0F A;  4HN7 A;  1PH7 A;  1J5E Q;  3F1Z A;  4JPB W;  4G7Z C;  4DV7 L;  1Q1E A;  2L9H A;  2YTV A;  1VQI A;  2RKS A;  1SBB B;  3SK4 A;  1VF5 C;  1B70 B;  4OWW B;  1R4P B;  1A3U A;  3TZU A;  5C3E G;  4LF7 Q;  3D6C A;  3P20 A;  1LTS D;  4K14 A;  2QEJ C;  1EY6 A;  3ER0 A;  3D6W A;  5IY0 A;  1VMC A;  3J80 L;  2BDO A;  2JA7 B;  5F2D A;  3E0J A;  2A6E D;  4GN4 B;  1U4P A;  3UE0 A;  4LFB Q;  5C3X A;  5GAG C;  3JAM L;  1BCP B;  3M4Q A;  4A3J B;  1PH2 A;  3PUW A;  4QMG A;  5KIX A;  1IYJ B;  2E75 C;  2OTJ A;  1LV9 A;  4ZK9 B;  1KNA A;  2YU9 B;  4HJ8 A;  1ET9 A;  1F9P A;  3QJY A;  1CK1 A;  1E2W A;  3HS0 C;  4PZ8 A;  2Q2T A;  3J7A F;  4IUP A;  3K0Y A;  3IKJ A;  4KY7 A;  3IAY A;  2NVT B;  5DM6 3;  1N34 L;  1VQ4 A;  4DV5 L;  1MBY A;  1HRJ A;  4A93 G;  3K7U C;  5JOB A;  1L0W A;  3G71 A;  5IGG A;  3MXP A;  4EQO A;  5GAE C;  2B39 A;  1XNQ L;  4LK1 C;  2NVX B;  3K5N A;  1L1O B;  1Q8K A;  5DAU A;  1STE A;  3I4M B;  4BS9 A;  1HNW L;  4A3M B;  5FKA C;  1Y8O B;  2Z6B A;  5H1S E;  3GTG B;  3K7A B;  5HGQ A;  4A3B G;  1STY A;  1LUZ A;  2H5X A;  4R4O A;  2HDM A;  3M4Y A;  1QVC A;  2R93 H;  3BVZ A;  3LWE A;  2DNC A;  4CDE C;  1PHJ A;  2OQ0 A;  3VR5 A;  3J81 L;  2UXB L;  1AW7 A;  3I7F A;  1TWG B;  4NB3 A;  1Q7Y C;  2D0O A;  1S5D D;  4A3L G;  1SRU A;  3NBH B;  3MA2 B;  4DN4 M;  4LJZ C;  1TU2 B;  3DM3 A;  4X65 Q;  1CKO A;  1KC8 C;  3FHW A;  2JYO A;  1C48 A;  4DXG A;  3TP5 A;  4IJL A;  1GKH A;  1JJ2 A;  4XDX A;  2IX1 A;  2NWG A;  2L15 A;  4LF6 Q;  4RGM A;  5ELO A;  1PFB A;  4HJ9 A;  4DR2 Q;  2NN6 G;  3R8B A;  2H4O A;  4JBJ A;  3CQZ H;  4ZYS A;  4CJ2 C;  5E4W C;  4KI0 A;  2JA5 G;  3RNU A;  2OT2 A;  4OEM B;  1I4H A;  1ML0 D;  4OL7 A;  5IYC H;  1RF2 D;  4QJF A;  1G8Z D;  2HD3 A;  1SYF A;  4ULL A;  2ZTE A;  2D2C C;  4X66 Q;  3M4O B;  1IW7 C;  1XWE A;  5KGU A;  2ID0 A;  2IWH A;  5I2X A;  2MPM A;  1PTO D;  3BU2 A;  4U67 3;  3S1N B;  1BCP C;  2A19 A;  2XIW A;  4A3K G;  5IT9 E;  1A15 A;  4QQB X;  1LAB A;  2RHQ B;  1ILQ A;  2ZM6 L;  4BY7 H;  3OTO L;  1PVO A;  1A2T A;  3BVG A;  2JA7 H;  2DJG C;  5C6A A;  4A3F G;  3HOZ B;  4DNI A;  2F0J A;  2EIF A;  1UE5 A;  1S3O A;  1HFN A;  5COY A;  1EY9 A;  4TKO B;  3RN2 A;  5ELE A;  4A3J H;  2WII B;  1IBM L;  3RMH A;  4R4C A;  1NMG A;  1L1O C;  1XNR Q;  4KY6 A;  5CV8 A;  2YU9 H;  4NXM L;  4FF1 A;  5BR8 L;  4CDF C;  4DV4 L;  4RH6 A;  5BN4 A;  5CMD A;  3NUC A;  3D4R A;  2MNA A;  2NVT H;  3K5L A;  5E7N A;  3E5S A;  2UUA Q;  4O0A A;  3EFX D;  1Q82 C;  1ILP A;  3J80 E;  3PUX A;  4R8I A;  1WTX A;  2RQX A;  1X3E A;  3I73 A;  1BCP F;  3T4A C;  2NVX H;  1TT2 A;  4JI5 Q;  3KDF A;  2PW5 A;  1SDF A;  3I4M H;  1KAW A;  1X3Q A;  1HNZ Q;  3JAM E;  2CQA A;  1CA5 A;  4I7A A;  4A3M H;  3X3M A;  4DUY Q;  5LMU Q;  1TWH B;  3ONA B;  1KTK A;  2KHJ A;  3K7A H;  3GTG H;  2PQA B;  5K36 H;  4TVA B;  3ERO A;  1X9N A;  3TS2 A;  1DXM A;  2N49 A;  3FKI B;  1NJI C;  2WFW A;  4GOP B;  4F7X A;  4K0K L;  1RKN A;  1PH8 A;  4P75 A;  2UUB L;  3T53 B;  4RAU C;  1TWG H;  4YY3 L;  1LTB D;  3AYH B;  1HCZ A;  2F0Q A;  4DAY A;  3PIO A;  3IL8 A;  5I9P A;  1QJO A;  3CCM A;  1SE2 A;  1E7Z A;  1JB3 A;  5L37 A;  2KEE A;  1VQ8 A;  2UXD Q;  4J6H A;  4OX9 Q;  1GOZ A;  5DM7 3;  3ZYY X;  5M9O A;  4DV2 Q;  2C5C A;  4ZQ3 A;  1Z6H A;  5ELB A;  2A6H C;  4DK0 A;  3J81 E;  2B63 H;  3T1Y Q;  2R93 G;  5IT9 c;  4IUN A;  3R3O A;  1B3A A;  4JI6 Q;  1VS0 A;  1JJG A;  4NXN Q;  1II3 A;  1EQR A;  4IUT A;  1HR0 L;  2DNE A;  3M4O H;  4C2M B;  3M3Y B;  2CQO A;  1NY4 A;  4XIG S;  3VDY A;  3HP3 A;  4WJW A;  2F0L A;  2KED A;  1H9K A;  1V1P A;  3S1N H;  4IPH A;  3K5O A;  1OXU A;  4DV3 L;  5I6Y A;  2VB3 X;  4ZAI A;  3Q8D A;  2XWB B;  2B2W A;  4XT1 B;  5I4D A;  1G6Z A;  3OMG A;  4C1N K;  4DV0 Q;  2Z0S A;  3PIO 3;  2B8F A;  3GTP B;  3HOZ H;  1EIG A;  5IYC G;  2LKV A;  2J7Z A;  4C3I B;  5IGB A;  3OWF A;  2IW3 A;  1XPU A;  5CV6 A;  4LF4 L;  4ZKC B;  1TVX A;  2EY1 A;  2PW7 A;  3NEM A;  1SE4 A;  3LNN A;  1AFP A;  4DR3 L;  2JEB I;  3S1M B;  4LF9 Q;  5IYD G;  1NMF A;  2E5L Q;  4JI2 L;  1B9N A;  3U9S A;  4DV6 Q;  2AWO A;  3QG1 A;  1YJ9 A;  2F4V L;  1EY0 A;  2EXD A;  4A93 B;  3NE5 B;  2SDF A;  1RD9 D;  2JA7 G;  3ERS X;  3S1R B;  2M2L A;  1ICW A;  2HDL A;  1I4Q A;  3EIV A;  1JQY D;  1AN8 A;  1HTL D;  4KD4 A;  2VL6 A;  1TWH H;  3I2Z A;  4A3J G;  2R6G A;  5FK9 C;  2F0G A;  4N8F A;  4XYQ A;  3FKI H;  2IHE A;  3SDZ A;  1EFW A;  4JOI C;  1I94 L;  2EVB A;  1DON A;  3RLN A;  2DGY A;  2CKZ B;  1SJE D;  2A68 C;  3UE1 A;  2BH8 A;  1FYC A;  2RDF A;  4MZ9 A;  2Q8I B;  5CC4 A;  4M1U B;  4QL5 A;  4XYO A;  1GUW A;  3TP8 A;  3B6Y A;  4CDC C;  1JMC A;  4GKK L;  2UXC Q;  2N55 A;  4CJ0 B;  1IYV A;  1CA6 A;  4MTN A;  3I4M G;  1NNX A;  5J3B A;  1SYB A;  1PH6 A;  2ES2 A;  2F0I A;  5C4H A;  4LMQ D;  4A3G B;  3WWV A;  3Q24 A;  2K14 A;  4J15 A;  4DAM A;  3AFP A;  4IUR A;  4A3E B;  1VQ7 A;  2WIN B;  1RJT A;  5C4Z A;  2F0W A;  2AUK A;  2JE6 I;  2A8V A;  1VQJ A;  2HCC A;  1GVP A;  3KUP A;  2AKW B;  1LTG D;  1RTN A;  2JA5 B;  2GVA A;  3NTH A;  1O80 A;  4K5V A;  1JOO A;  3F2B A;  1HHV A;  4OO1 I;  1D8L A;  4HIO A;  3KLS A;  2L0C A;  4C2M H;  5IOD A;  3M3Y H;  1B53 A;  4X64 L;  4B3R L;  1MKH A;  2K5W A;  3CU7 A;  4P73 A;  2EYH A;  2EJM A;  4DR7 L;  1TWC B;  4H13 C;  1GM5 A;  1WTV A;  1W2B A;  4Q5V A;  1XJV A;  1WD0 A;  3CF5 A;  2I46 A;  3GV3 A;  1YEZ A;  4MTK A;  2JK8 A;  1XMO Q;  4A3K B;  3A7L A;  2EQS A;  4IAL A;  3CPW A;  1YZ6 A;  3GTP H;  2ASB A;  3TDQ A;  2HQL A;  3OIQ A;  1SMY C;  3D4W A;  1MJE A;  4C3I H;  3DXJ C;  1QUQ A;  2CH4 A;  4A3F B;  3CRK C;  3EBE A;  1I6V C;  3M7G A;  1GJX A;  4DAV A;  2Q2H A;  4DR6 L;  2JA6 G;  1FGB D;  2F0T A;  3AU7 A;  2IX3 A;  2WKC A;  3A8I E;  1C0A A;  3S1M H;  2EYO A;  1N32 L;  3S9W A;  1I4G A;  1JOR A;  1UNS A;  1YHB A;  1FGU A;  1EU4 A;  3MWY W;  1R4Q B;  4JI7 L;  1G29 1;  3GTL B;  1KQS A;  4J8Q A;  1X54 A;  1J5E L;  3CD6 A;  4A93 H;  1F9S A;  1UUP A;  4IFD I;  5EAY A;  1EYD A;  3S1R H;  1UE6 A;  1GXD C;  4CKB A;  4F87 A;  3HOZ G;  5JPN C;  3T16 A;  2FMM A;  1A2U A;  1JWM D;  4OWX B;  4LF7 L;  3QB3 A;  5GAH C;  1EY5 A;  5J22 A;  1HH2 P;  2B2U A;  3GP7 A;  1CT1 D;  1U4R A;  2MP1 A;  3OOC A;  3C3L A;  5JVH 3;  4LF8 Q;  3VR6 A;  1B50 A;  1XTD A;  1KL9 A;  3GDE A;  4NKL A;  3C1E A;  1VQB A;  2E2I B;  3CC4 A;  4LFB L;  1EZ8 A;  1WTO A;  1IYU A;  2K5H A;  4X3U A;  4IN3 A;  1WTW A;  5AFW A;  4LFA Q;  4LFC Q;  4HCS A;  4IPC A;  3F2C A;  5CBE E;  4PQX A;  1S72 A;  4X3T A;  3A5U A;  3V05 A;  1HQR D;  1F2M A;  4Y52 H;  1WCM B;  2C9O A;  3MZ5 A;  2OXP A;  2DY8 A;  3EJI A;  1SYE A;  2NZO A;  5FLM G;  4A3G H;  4E6I A;  1GHJ A;  2EXZ A;  4LUO A;  3TZD A;  2K50 A;  3MEH A;  1EWI A;  4A3E H;  5BN5 A;  5JEA G;  1N8R C;  3S16 B;  1LTI D;  1ENC A;  3ERQ A;  1FVI A;  4JBK A;  2D0P A;  3T1H Q;  1DCZ A;  1Z9F A;  3D31 A;  2JA5 H;  2AMC B;  1STG A;  1IL8 A;  1GHK A;  1S5F D;  1SSO A;  1SMY D;  5JJI A;  1HZB A;  3BVM A;  1U4L A;  3K6O A;  4WFN 3;  1OXS C;  1KXL A;  1TS3 A;  2B8G A;  2A69 C;  3CMA A;  3I4N B;  1TWC H;  4JI0 Q;  2HIX A;  4X65 L;  3URY A;  4A3K H;  1PRT D;  1H9J A;  3NHH A;  2K5V A;  5IE8 A;  2MO1 A;  3GTK B;  2F1M A;  3PIP A;  5ELC A;  1K8A C;  3IFT A;  5JAV A;  1CHQ D;  3PQI A;  4N8X 1;  5IT9 L;  5C3W A;  2DJF C;  4LF6 L;  1X6O A;  1N33 L;  1SYD A;  4DR2 L;  3G6J B;  2RVL A;  2QEX A;  4A3F H;  2F3W A;  4LWC A;  2A5H A;  3I70 A;  3KLR A;  3TME A;  1B4O A;  4FXK C;  1EFI D;  2I5M X;  3OW7 A;  4XQQ A;  4A3C H;  4GLV B;  2VQE Q;  2R7Z B;  1VQG A;  2N88 A;  2Z4H A;  4RHR A;  1EYA A;  4RCO A;  4A76 A;  2NTT A;  4XT3 B;  2UUC Q;  1U9R A;  2HIV A;  3L0O A;  4X66 L;  3K8A A;  1QB5 D;  2NVY B;  2QF7 A;  3HKZ B;  3GTL H;  3MTS A;  5D14 A;  4QIW B;  1BBU A;  2LY7 A;  5J1Z A;  1EU3 A;  4YCW A;  3CCV A;  2L12 A;  2PI2 A;  1OTC A;  3E0E A;  2JA8 B;  4LUV A;  3G4S A;  5IWA Q;  1EZ6 A;  2E2H B;  3I56 A;  3GV6 A;  4C3I G;  4B9W A;  2XN9 C;  3DM1 A;  3SXH A;  2B2T A;  3J7A V;  1VQP A;  2TSS A;  2F0O A;  1BQQ T;  5T1G A;  4F88 A;  3BJU A;  2PO4 A;  5COR A;  4XQN A;  1FL0 A;  3F2U A;  3PIP 3;  4OIJ A;  3NK9 A;  2HUG A;  2E2I H;  1EIH A;  4DR1 Q;  4IFD J;  1VQA A;  1B9M A;  1LM0 A;  3PGZ A;  4RWS C;  1PH1 A;  2YTX A;  4OGQ C;  1XNR L;  4R4Q A;  4WOR A;  4B3M L;  2DUD A;  3FVQ A;  3P75 A;  2P5Z X;  3J7Y W;  4XQJ A;  2R61 A;  1EEF D;  3MC0 B;  1WCM H;  2IX0 A;  1WFQ A;  4RGT A;  5ELD A;  1F2Z A;  2AQ1 B;  4ZRZ A;  4BBR B;  4GNX A;  3K57 A;  2UUA L;  5IYB H;  3KK7 A;  2ATW A;  1EYC A;  5E4X A;  3J81 i;  5GRO A;  2E8G A;  3S16 H;  3A54 A;  4JI5 L;  5EJW A;  1PXU A;  1NR4 A;  4N9P A;  4B08 A;  2VUM B;  2LXJ A;  1KRS A;  2PMZ B;  4HTH A;  1YBY A;  4OHJ A;  5JEA J;  4DUY L;  5IGC A;  5LMU L;  1X3P A;  2F0N A;  1SYG A;  2ICE C;  3D4D A;  5M3F B;  3FDT A;  5C44 G;  2AQ2 B;  3DEP A;  5EBD A;  1PFN A;  1A0I A;  1C8C A;  2CFM A;  2L1B A;  3BYY B;  1FR3 A;  3DWQ A;  3I4O A;  4YHH Q;  3I4N H;  2KCT A;  5HY6 A;  2PNH A;  4A3G G;  5LMN Q;  4IUV A;  1S4Z A;  3AB9 A;  1SJH D;  2A74 C;  2D5D A;  3BZD B;  2F0F A;  1PTO F;  1JB7 A;  4A3E G;  3FPU B;  4FXG C;  1Y69 U;  4AIM A;  1YNJ C;  5LMN W;  3GTK H;  1F9R A;  1PYB A;  3Q22 A;  4B9X A;  1E1T A;  1X55 A;  2QCP X;  5KRU A;  1IZ6 A;  2NTS A;  5C0X I;  1K0R A;  2HT1 A;  1HNX Q;  2B2Y A;  1YIJ A;  2E74 C;  4DV2 L;  4LUZ A;  4PV1 C;  4BXX H;  4GN3 B;  5C4X G;  3MXU A;  1U4M A;  3NEN A;  1IL2 A;  3U9O A;  4CGY B;  1O7Y A;  4GLX A;  1ZXT A;  3T1Y L;  4JI6 L;  4DR4 Q;  1A62 A;  1DOL A;  4L6T B;  2J4X A;  3RZD B;  2JA6 B;  4GN5 A;  3S2H B;  4NXN L;  4QB4 A;  1QOH A;  3PSI A;  4JBW A;  2NVY H;  1WI5 A;  3VA5 A;  5IYD H;  4DV1 L;  1C7Y A;  3Q6S A;  2KA7 A;  1CQF A;  1KNE A;  1LO5 D;  5IP7 H;  2HHH Q;  3SK6 A;  1DD2 A;  2CHB D;  1D5X C;  2JA8 H;  3H91 A;  2MGS A;  3CKI B;  4HJ7 A;  1ICF B;  2E2D C;  3TRZ A;  3ND8 A;  4L5T A;  2HQE A;  1YHQ A;  2E2H H;  1GUS A;  4JYA Q;  2DY7 A;  4KJO A;  1QZH A;  3GTJ B;  4JBM A;  2VW9 A;  1PH4 A;  2PCF B;  4KMU C;  4A3C G;  1LTR D;  3VR3 A;  1XPO A;  1S40 A;  2JEA I;  2AUJ D;  1CM9 A;  1JE5 A;  1LT6 D;  3BDC A;  4DR5 Q;  1EQV A;  2L55 A;  3UDG A;  4DUZ Q;  5CV4 A;  1YI2 A;  2WV6 D;  5T1I A;  3NXW A;  3MXN A;  4DNT B;  1GO3 E;  3F2D A;  4G7O C;  4B3S Q;  4RHS A;  3E9H A;  2E5L L;  2KHS A;  4BBR H;  2JXM B;  2Y0S B;  4DV6 L;  1PYS B;  2IHF A;  4JK1 C;  3KOJ A;  1PV4 A;  2O2L D;  2FFK B;  5FO7 B;  1Q46 A;  3UDI A;  2PYK A;  2CWA A;  2F0D A;  4KHP Q;  3CXC A;  2VUM H;  3ND9 A;  4BA1 I;  3BDO A;  3HOW B;  3LX0 A;  1BXT A;  2ALY B;  3L2P A;  1C9O A;  1LT3 D;  3HOU B;  4FNF A;  1A3T A;  2JA9 A;  1UEA B;  4EQP A;  4L8J A;  4R4T A;  5FO9 B;  1E2Z A;  5M3F H;  4ZKB B;  2QDL A;  2R7D A;  5JJZ A;  1T9H A;  2BE5 C;  3D8G A;  3ZJY C;  1VCI A;  3FP9 A;  1LAC A;  3HKS A;  3NQI A;  1N36 L;  3VR4 A;  1WCM G;  4CKE A;  4JW0 A;  2K1B A;  3K58 A;  4QGU A;  1TII D;  1NBW A;  1JIC A;  3H94 A;  4X62 Q;  5IYB G;  1GUO A;  4HJA A;  4FVM A;  2X69 A;  3U58 A;  3CCS A;  4LAA A;  1TS5 A;  4HMJ A;  1WTP A;  1IW7 D;  2NBF A;  3Q23 A;  4OO1 H;  4IUQ A;  2SNS A;  1M8A A;  4AQY L;  3NWT A;  1ZYR C;  1SEB D;  1BCP D;  1D6E C;  1CSQ A;  2SOB A;  5M5W B;  2XGT A;  3KLS X;  3S14 B;  2VB2 X;  4JV5 Q;  1W6K A;  2K5D A;  4X3S A;  2EYL A;  2CCZ A;  5LHY 1;  5FO8 B;  3RN5 A;  4B3T Q;  3RR5 A;  4BA2 I;  4LF5 L;  2HCI A;  5D3D A;  3CC7 A;  1XMQ Q;  1Q1B A;  3RZD H;  1DJR D;  5I2Y A;  2JA6 H;  3I4N G;  4GKJ Q;  3S2H H;  3E6Z X;  1D5Z C;  4HR7 B;  1G2T A;  3KF8 B;  1HA5 A;  5EBC A;  5C0X J;  2C35 B;  3O13 A;  4I65 A;  4OWT B;  3RUZ A;  2G5D A;  3NTK A;  2BOS A;  4NPS A;  4KHV A;  1CFM A;  1KDB A;  3GTJ H;  4BXX G;  2ZXP A;  1B7Y B;  4ME5 A;  1XMO L;  1YJN A;  3PCO B;  1U0L A;  1BUV T;  2R7Z G;  3CCE A;  1IBL Q;  2R92 G;  3D0F A;  1U5K A;  1IBK Q;  2VXW A;  4HID A;  1KLG D;  3HOX B;  1D1I A;  4IFD H;  3H09 A;  3OSO A;  4JI4 Q;  1K73 C;  3KF6 B;  1V43 A;  2V4D A;  3J7A 5;  1F77 A;  2F52 A;  3HKZ G;  1HUN A;  3I55 A;  1VQF A;  5IP7 G;  5CV5 A;  2JA8 G;  2CH4 W;  3KBX A;  2K5Q A;  4GOP C;  3SK5 A;  1LYL A;  2UU9 Q;  5EPL A;  3X3N A;  3HGB A;  3QWN A;  1RL2 A;  2ZJR A;  2NYZ D;  4PZ7 A;  4KK7 A;  4C3J B;  3KJO A;  5FLM H;  3OMC A;  3TBI B;  1VF7 A;  3KJP A;  2EPB A;  2L4N A;  5DNF A;  4KKS A;  4JI1 Q;  5JEA H;  1GUT A;  1X32 A;  3HOU H;  4YCV A;  5JVG 3;  2IT1 A;  1A8V A;  4MIU A;  1CHP D;  2F03 A;  1ZYR D;  3AFQ A;  1TWA B;  2A6H D;  1KHI A;  4LF8 L;  2X6L A;  3DEO A;  4RG1 A;  4CKC A;  5C44 B;  4HIM A;  4PNY A;  4KKT A;  2TMP A;  2UUB Q;  5I9O A;  2F0V A;  2XNA C;  3OPO A;  4BBR G;  5E1F A;  1QVG A;  5IGD A;  1VQE A;  5EKI A;  4LFC L;  4K8I A;  1KAB A;  2MFI A;  4A3I B;  2RA4 A;  4LFA L;  1T5X D;  3DUZ A;  1K9M C;  4HED A;  1AZQ A;  2GA4 B;  3H3V C;  4APV A;  1HZA A;  2VUM G;  1SR3 A;  1KDC A;  4C3H G;  3W3A A; 
#chains in the Genus database with same CATH homology
 4HSP A;  3RZO B;  5D3I B;  1BF4 A;  5IOC A;  2PNR C;  1SND A;  2RBM A;  3QIA A;  2CVR A;  2MJ8 A;  5C4X B;  2PPB C;  5IIF A;  1LTA D;  2EZV A;  1F2L A;  1QE6 A;  2KQ3 A;  2OF1 A;  4ABN A;  4OO1 G;  3L7Z C;  3EQL C;  5NUC A;  2WB1 B;  4G57 A;  4AYB B;  2Z8L A;  1EL0 A;  4UAI A;  5LL6 S;  2XRS D;  1YNN C;  4ILW A;  2LFN A;  5EQ0 A;  1SNP A;  1DM0 B;  3GTO B;  1V8Q A;  1CTM A;  1ENA A;  1EY7 A;  1FNV A;  1TKW B;  3SK8 A;  3VYT A;  1EY8 A;  4QUF A;  2AWN A;  2KCC A;  4UDU C;  1DYQ A;  4O1N A;  4C1N I;  2DN8 A;  3S15 B;  4FXD A;  2A68 D;  4HMI A;  1I4P A;  3V96 A;  3H0G B;  2J0T D;  1V1O A;  2KVM A;  2L5T A;  5LL6 X;  3W2D A;  1G2S A;  5I6W A;  1TQO A;  4IFD G;  3CRL C;  2B2V A;  1QWY A;  4DU9 A;  1J8I A;  1I3Q B;  1K8O A;  4KY5 A;  1PFM A;  2QIL A;  3GTM B;  4K6L A;  5G3L D;  2KJX A;  2PZU A;  4IUU A;  2NUC A;  1PLF A;  4ZUJ A;  4DNR B;  2FMC A;  2G9D A;  4RKB A;  1S5B D;  4KN4 C;  4MHE A;  5KNC A;  1PRT F;  1KDA A;  2MUY A;  4K2K A;  5K5P A;  1SE3 A;  2A6E C;  2E2J B;  1PTO B;  3S1Q B;  1M4V A;  1HPC A;  1VMP A;  1SNQ A;  1YNN D;  4RA8 A;  2K01 A;  1HTP A;  1OXT A;  1TY0 A;  1JOK A;  5C0X H;  2M9V A;  1MI2 A;  2BCO A;  1DZ1 A;  5E3F A;  1JE4 A;  1AEX A;  2AQ3 B;  1OO9 B;  1QNK A;  4XTC S;  4C56 C;  2F0H A;  2F0K A;  2NVQ B;  3IFD A;  5C4J B;  3FPP A;  1ZKO A;  3SE0 A;  1HQM C;  1IKM A;  4A3D B;  5CR3 A;  2BA0 A;  3P7J A;  4K2L A;  1BBX C;  2K03 A;  4GZY C;  1K83 B;  1S5C D;  4RGN A;  1BR9 A;  5A2Q L;  4CBV A;  2R92 B;  1H9R A;  5CV9 A;  3MVV A;  4DK1 A;  1JCK B;  1B44 D;  1CQV A;  3CHB D;  5CBA E;  3C1F A;  3A56 A;  2BA1 A;  2QKI C;  1I4X A;  3BYT B;  3BS1 A;  1W6J A;  3D3R A;  3K59 A;  2O5I C;  5KNB A;  3KBG A;  1Y1W B;  1EWC A;  5D65 A;  2F3V A;  1Q8I A;  3FEW X;  1XYI A;  1ESF A;  2G9H D;  5EKL A;  5HUR A;  1V1P B;  4TQU S;  4BY7 B;  1G91 A;  4X3K A;  2RDH A;  2O5J C;  3BG3 A;  4KD3 A;  2MHV A;  2QDB A;  1ZEQ X;  2IL8 A;  2KEC A;  1PTO C;  2WAQ B;  4CJ1 B;  4C3J G;  3N6R A;  1Y8N B;  1I50 B;  3FMC A;  4TRD A;  1BDO A;  3EA6 A;  1PDQ A;  3VA7 A;  2JP1 A;  3M85 A;  2A69 D;  5IGF A;  5J39 A;  1XX8 A;  5KEE A;  2EE1 A;  1SXT A;  2YYZ A;  1GUG A;  3DMU A;  4C3H B;  1VDZ A;  1PTO H;  1E0B A;  5TSS A;  4PMW A;  4KN7 C;  1A3V A;  3NWS A;  1RTO A;  1D2B A;  5EKK A;  1K8M A;  2I07 B;  3VYU A;  2ZT9 C;  1PZJ D;  4N9T A;  4ZLT F;  1MSH A;  3R2I A;  1I4R A;  5HGT A;  3NTI A;  1QNU A;  1ENF A;  5M5Y B;  3AMU A;  2SEB D;  2A73 B;  4IQZ A;  2NN6 I;  1NCV A;  3OIP A;  4RCN A;  4NP5 A;  2PQE A;  4L63 B;  4H7B A;  4DGZ A;  3DHQ A;  1LT5 D;  2RSN A;  1STA A;  3Q0A A;  1L0X B;  5C0X G;  3QOL A;  3RLF A;  4DXF A;  3NBI A;  2SNM A;  4M8A A;  2ZXO A;  2B63 B;  2H1E A;  2EY6 A;  2D62 A;  1NUC A;  3T13 A;  1Y8P B;  1SNO A;  2CW0 C;  4KJN A;  4R8N A;  3MXG A;  5CYU A;  2EYF A;  1SFO B;  4H44 C;  3DWP A;  3OHX C;  5DEH A;  5A2Q E;  2B2W C;  2WKD A;  1C4Q A;  3PO3 B;  1LLR D;  3S17 B;  4KKU A;  1SNC A;  2Z1C A;  4U68 A;  2IPK D;  4NDX A;  4KHZ A;  3TSS A;  1I6H B;  1UAP A;  2K7V A;  1A6X A;  4Y7N B;  4G7H C;  1H9S A;  3P1H A;  1J9O A;  4S3S A;  1RCV D;  1RHP A;  2EJF C;  3GTQ B;  3S2D B;  1STB A;  3HRZ C;  1FD7 D;  4EQN A;  1WTR A;  3PUV A;  1JWS D;  3SHL A;  3M7N A;  5M5X B;  3PUZ A;  3I3C A;  1Q12 A;  4H0L C;  1CI3 M;  1TWF B;  2Q8T A;  5JPM C;  3QO2 A;  4KTA A;  1YNJ D;  1EY4 A;  2K33 A;  3BDL A;  3ITP A;  2KUM A;  4HAE A;  2PZT A;  3HOV B;  3A8J E;  5EGT A;  4DF7 A;  4HSV A;  5FLX L;  1Q90 A;  4DFA A;  3WDN A;  1TR5 A;  2K6A A;  1O7Z A;  2XRQ D;  4FF4 A;  2BDN A;  3HOY B;  4QF4 A;  1O7L A;  2K05 A;  5KYL A;  2D9U A;  1WTQ A;  1ET6 A;  1NR2 A;  3TP6 A;  1PZI D;  2K04 A;  1AZP A;  1L0Y B;  2F0P A;  2CW0 D;  1NAP A;  4FF3 A;  5M3M B;  2IJ0 A;  1SNM A;  1BNZ A;  1HUM A;  1EEI D;  1FNU A;  3SVM A;  1OXX K;  2XSC A;  3UI2 A;  1SYC A;  3T51 B;  2R3Z A;  3MHB A;  5IGE A;  3DWA A;  3C2P A;  3GQB A;  5CV7 A;  1TS4 A;  2FHT A;  4MN3 A;  2LS0 1;  1IHZ A;  2M00 A;  3FRP B;  1CZW A;  5EPK A;  3L3O C;  1NSN S;  3PO2 B;  1Y1V B;  3MAQ A;  4DA2 A;  1Q3L A;  3RD4 A;  5ELF A;  4IZ8 A;  3T56 B;  4K5X A;  1STN A;  1AP0 A;  2EYP A;  3PMF A;  2LMC B;  1FNW A;  1MD2 D;  2K32 A;  2OEO A;  2F0U A;  5C3E B;  4ODG A;  2FJ2 A;  5KYI A;  1R9T B;  1D5M C;  4NMZ A;  1D1K A;  2ICI A;  2ENB A;  2BE5 D;  2EYJ A;  3MFY A;  1ONL A;  1Z47 A;  2WP8 J;  2F4I A;  1MSG A;  2NB0 A;  4BBS B;  2L11 A;  2KCN A;  5A35 A;  1HXY D;  2F0E A;  3WOE A;  2VNU D;  3NBH A;  4EGV A;  4RFB A;  1S5E D;  2B2U C;  5ISR A;  2ZXR A;  2B2V C;  1PRT B;  1SAP A;  4FF2 A;  1TS2 A;  2RDG A;  4BY1 B;  3OWE B;  1KAA A;  1STH A;  2EY5 A;  5C5L A;  4K6D A;  4A3B B;  1LTT D;  1DOM A;  4FO2 A;  3I72 A;  2O4X A;  4HCE A;  4K5W A;  2RSO A;  1HFG A;  4QUC A;  3L9A X;  4DAP A;  4FP5 D;  5FLX E;  1Z7T A;  3TN2 A;  4OIK A;  1IKL A;  2F0S A;  3I90 A;  5K36 G;  2EY2 A;  3VR2 A;  3K5M A;  1EQT A;  3R93 A;  3I4L A;  1H9M A;  1QG7 A;  4G4K A;  3SR1 A;  4XXE A;  1JOQ A;  2EJG C;  1LT4 D;  4QCL A;  1E2V A;  3V2T A;  1PZK D;  1PMR A;  1F2Y A;  3WOF A;  2NZ1 D;  1JWU D;  3G7L A;  4WRD A;  3NPP A;  1QCB D;  3A7A B;  3SEB A;  3LWU A;  1BO0 A;  3HEJ A;  4ID6 A;  4CHT B;  5G3L F;  1XTC D;  3A8K E;  5EPJ A;  1JC7 A;  4EVO A;  2JSO A;  4Z9C B;  1PRT C;  2EYM A;  3QOJ A;  1ESR A;  3MFG A;  1WD1 A;  3PUY A;  5CGK A;  4RGO S;  3HZX A;  5C5M A;  1MGS A;  3HG9 A;  1XXG A;  1EOT A;  2Q8R E;  2B2T C;  2XWJ B;  4R9W A;  4ZUI A;  1B2T A;  1ROD A;  1OXV A;  3I8Z A;  1KLU D;  5BN3 A;  4BWG B;  4K8J A;  2FIN B;  2E76 C;  4RKL A;  3GO5 A;  2PZW A;  1HA6 A;  4I7Z C;  4PMB A;  4V0B A;  1CZG A;  5FOB B;  2EDG A;  1O78 A;  1B1Z A;  1F9Q A;  1GUN A;  1T5E A;  2KOL A;  3R2T A;  4FYD A;  3KF8 A;  1EWH A;  1H9S B;  3PV0 A;  4J1M A;  4F8M A;  4YIJ A;  4KV6 A;  1WVL A;  2NN6 H;  1RDP D;  2Z4I A;  2R93 B;  4NW2 A;  4TSS A;  3NQT A;  2F0M A;  2EOT A;  4O42 A;  3NSW A;  3N52 A;  1PYW D;  3C46 A;  4V19 0;  4P2C B;  3TP7 A;  3NP8 A;  2B2Y C;  3EVQ A;  3H6M A;  1JR0 D;  3VYS A;  3CQZ B;  3A55 A;  3I91 A;  2XVS A;  1DOK A;  1QIL A;  2K28 A;  4PMC A;  1BOS A;  3VYR A;  3GD7 A;  2X6G A;  1TY2 A;  5KND A;  2WAC A;  4Q0F A;  4HN7 A;  4G7Z C;  1Q1E A;  2L9H A;  2RKS A;  1SBB B;  3SK4 A;  1VF5 C;  1R4P B;  1A3U A;  3TZU A;  3D6C A;  3P20 A;  1LTS D;  4K14 A;  2QEJ C;  1EY6 A;  3D6W A;  1VMC A;  3J80 L;  2BDO A;  2JA7 B;  5F2D A;  3E0J A;  2A6E D;  1U4P A;  5C3X A;  3JAM L;  1BCP B;  4A3J B;  3PUW A;  4QMG A;  5KIX A;  2E75 C;  1LV9 A;  4ZK9 B;  1KNA A;  2YU9 B;  1ET9 A;  1F9P A;  1CK1 A;  1E2W A;  3HS0 C;  3QJY A;  3J7A F;  4IUP A;  3K0Y A;  3IKJ A;  4KY7 A;  3IAY A;  2NVT B;  5DM6 3;  1HRJ A;  1MBY A;  5JOB A;  5IGG A;  3MXP A;  4EQO A;  2B39 A;  4LK1 C;  2NVX B;  3K5N A;  5DAU A;  1STE A;  3I4M B;  4BS9 A;  4A3M B;  5FKA C;  1Y8O B;  3GTG B;  3K7A B;  1STY A;  2HDM A;  3M4Y A;  3BVZ A;  3LWE A;  2DNC A;  3VR5 A;  3J81 L;  1AW7 A;  1TWG B;  1S5D D;  3MA2 B;  4DN4 M;  4LJZ C;  1TU2 B;  2JYO A;  1C48 A;  4DXG A;  3TP5 A;  2IX1 A;  4XDX A;  2NWG A;  4RGM A;  1PFB A;  2NN6 G;  3R8B A;  2H4O A;  4ZYS A;  4CJ2 C;  5E4W C;  4KI0 A;  2OT2 A;  1I4H A;  1ML0 D;  4OL7 A;  1RF2 D;  1G8Z D;  1SYF A;  4ULL A;  2D2C C;  3M4O B;  1IW7 C;  1XWE A;  5KGU A;  2ID0 A;  2IWH A;  5I2X A;  2MPM A;  1PTO D;  4U67 3;  3S1N B;  1BCP C;  2XIW A;  5IT9 E;  1A15 A;  1LAB A;  1ILQ A;  1A2T A;  3BVG A;  5C6A A;  3HOZ B;  2F0J A;  1HFN A;  5COY A;  1EY9 A;  4TKO B;  5ELE A;  2WII B;  3RMH A;  4KY6 A;  5CV8 A;  4FF1 A;  4RH6 A;  5BN4 A;  5CMD A;  3NUC A;  3D4R A;  3K5L A;  3E5S A;  3EFX D;  1ILP A;  3J80 E;  3PUX A;  4R8I A;  1WTX A;  2RQX A;  3I73 A;  1BCP F;  3T4A C;  1TT2 A;  2PW5 A;  1SDF A;  1X3Q A;  3JAM E;  2CQA A;  1CA5 A;  3X3M A;  1TWH B;  3ONA B;  1KTK A;  5K36 H;  3ERO A;  1DXM A;  3FKI B;  4F7X A;  1RKN A;  3T53 B;  4RAU C;  1LTB D;  1HCZ A;  2F0Q A;  4DAY A;  3IL8 A;  5I9P A;  1QJO A;  1SE2 A;  1JB3 A;  2KEE A;  4J6H A;  1GOZ A;  5DM7 3;  3ZYY X;  5M9O A;  2C5C A;  4ZQ3 A;  1Z6H A;  5ELB A;  2A6H C;  4DK0 A;  3J81 E;  4IUN A;  3R3O A;  1B3A A;  1II3 A;  4IUT A;  2DNE A;  4C2M B;  3M3Y B;  4XIG S;  3HP3 A;  4WJW A;  2F0L A;  2KED A;  1H9K A;  1V1P A;  3K5O A;  1OXU A;  5I6Y A;  2VB3 X;  4ZAI A;  2XWB B;  2B2W A;  5I4D A;  4XT1 B;  1G6Z A;  3OMG A;  4C1N K;  3PIO 3;  2B8F A;  3GTP B;  1EIG A;  2LKV A;  2J7Z A;  4C3I B;  5IGB A;  3OWF A;  2IW3 A;  5CV6 A;  4ZKC B;  1TVX A;  2EY1 A;  2PW7 A;  1SE4 A;  3LNN A;  1AFP A;  2JEB I;  3S1M B;  1B9N A;  3U9S A;  2AWO A;  3QG1 A;  1EY0 A;  4A93 B;  3NE5 B;  2SDF A;  1RD9 D;  3S1R B;  2M2L A;  1ICW A;  2HDL A;  1I4Q A;  1JQY D;  1AN8 A;  1HTL D;  4KD4 A;  2R6G A;  5FK9 C;  2F0G A;  4XYQ A;  3SDZ A;  2EVB A;  1DON A;  1SJE D;  2A68 C;  1FYC A;  2RDF A;  2Q8I B;  5CC4 A;  4M1U B;  4XYO A;  1GUW A;  3TP8 A;  2N55 A;  4CJ0 B;  1IYV A;  1CA6 A;  1SYB A;  2F0I A;  5C4H A;  4LMQ D;  4A3G B;  3Q24 A;  4IUR A;  4A3E B;  2WIN B;  1RJT A;  5C4Z A;  2F0W A;  2AUK A;  2JE6 I;  2HCC A;  3KUP A;  1LTG D;  1RTN A;  2JA5 B;  3NTH A;  1O80 A;  4K5V A;  1JOO A;  1HHV A;  4OO1 I;  3KLS A;  2L0C A;  5IOD A;  1B53 A;  2K5W A;  3CU7 A;  2EYH A;  2EJM A;  1TWC B;  4H13 C;  1WTV A;  4Q5V A;  1WD0 A;  2I46 A;  3GV3 A;  4A3K B;  3A7L A;  4IAL A;  3TDQ A;  3OIQ A;  1SMY C;  3D4W A;  3DXJ C;  4A3F B;  3CRK C;  1I6V C;  3M7G A;  1GJX A;  4DAV A;  1FGB D;  2F0T A;  3AU7 A;  2IX3 A;  2WKC A;  3A8I E;  2EYO A;  3S9W A;  1I4G A;  1JOR A;  1UNS A;  1EU4 A;  3MWY W;  1R4Q B;  1G29 1;  3GTL B;  4J8Q A;  1F9S A;  1UUP A;  4IFD I;  1EYD A;  1GXD C;  4CKB A;  4F87 A;  5JPN C;  3T16 A;  2FMM A;  1A2U A;  1JWM D;  3QB3 A;  1EY5 A;  5J22 A;  2B2U A;  3GP7 A;  1CT1 D;  1U4R A;  2MP1 A;  3OOC A;  3C3L A;  5JVH 3;  3VR6 A;  1B50 A;  4NKL A;  3C1E A;  2E2I B;  1EZ8 A;  1WTO A;  1IYU A;  4X3U A;  4IN3 A;  1WTW A;  5AFW A;  4HCS A;  5CBE E;  4PQX A;  4X3T A;  3V05 A;  1HQR D;  1F2M A;  1WCM B;  2C9O A;  3MZ5 A;  2OXP A;  2DY8 A;  3EJI A;  1SYE A;  4E6I A;  1GHJ A;  2EXZ A;  3TZD A;  3MEH A;  5BN5 A;  5JEA G;  3S16 B;  1LTI D;  1ENC A;  3ERQ A;  1DCZ A;  3D31 A;  1STG A;  1IL8 A;  1GHK A;  1S5F D;  1SSO A;  1SMY D;  3BVM A;  3K6O A;  1U4L A;  4WFN 3;  1OXS C;  1TS3 A;  2B8G A;  2A69 C;  3I4N B;  3URY A;  1PRT D;  1H9J A;  3NHH A;  3GTK B;  2F1M A;  5ELC A;  3IFT A;  5JAV A;  1CHQ D;  5IT9 L;  5C3W A;  1SYD A;  3G6J B;  2RVL A;  2F3W A;  2A5H A;  3I70 A;  3KLR A;  3TME A;  1B4O A;  4FXK C;  1EFI D;  3OW7 A;  4XQQ A;  2R7Z B;  2N88 A;  2Z4H A;  4RHR A;  1EYA A;  4RCO A;  2NTT A;  4XT3 B;  1U9R A;  1QB5 D;  2NVY B;  2QF7 A;  3HKZ B;  3MTS A;  5D14 A;  4QIW B;  2LY7 A;  5J1Z A;  1EU3 A;  2L12 A;  2JA8 B;  1EZ6 A;  2E2H B;  3GV6 A;  4C3I G;  4B9W A;  2XN9 C;  3DM1 A;  3SXH A;  2B2T A;  3J7A V;  2TSS A;  2F0O A;  1BQQ T;  5T1G A;  4F88 A;  2PO4 A;  5COR A;  4XQN A;  3F2U A;  3PIP 3;  4OIJ A;  3NK9 A;  2HUG A;  1EIH A;  4IFD J;  1B9M A;  4RWS C;  4OGQ C;  4WOR A;  3FVQ A;  3P75 A;  3J7Y W;  4XQJ A;  2R61 A;  1EEF D;  3MC0 B;  2IX0 A;  4RGT A;  5ELD A;  1F2Z A;  2AQ1 B;  4ZRZ A;  4BBR B;  3K57 A;  3KK7 A;  1EYC A;  5E4X A;  3A54 A;  5EJW A;  1PXU A;  1NR4 A;  4N9P A;  4B08 A;  2VUM B;  2PMZ B;  4HTH A;  4OHJ A;  5JEA J;  5IGC A;  1X3P A;  2F0N A;  1SYG A;  2ICE C;  3D4D A;  5M3F B;  3FDT A;  2AQ2 B;  3DEP A;  5EBD A;  1PFN A;  1C8C A;  2L1B A;  3BYY B;  1FR3 A;  3DWQ A;  4IUV A;  1S4Z A;  3AB9 A;  1SJH D;  2A74 C;  2D5D A;  3BZD B;  2F0F A;  1PTO F;  3FPU B;  4FXG C;  1Y69 U;  1YNJ C;  1F9R A;  3Q22 A;  4B9X A;  2QCP X;  5KRU A;  2NTS A;  5C0X I;  2B2Y A;  2E74 C;  4PV1 C;  3MXU A;  1U4M A;  3U9O A;  4CGY B;  1O7Y A;  1ZXT A;  1DOL A;  4L6T B;  2J4X A;  3RZD B;  2JA6 B;  3S2H B;  4QB4 A;  1QOH A;  4JBW A;  3VA5 A;  3Q6S A;  2KA7 A;  1CQF A;  1KNE A;  1LO5 D;  3SK6 A;  1DD2 A;  2CHB D;  1D5X C;  3H91 A;  2MGS A;  3CKI B;  2E2D C;  3ND8 A;  2HQE A;  1GUS A;  2DY7 A;  4KJO A;  3GTJ B;  2PCF B;  4KMU C;  1LTR D;  3VR3 A;  2JEA I;  2AUJ D;  1CM9 A;  1LT6 D;  3BDC A;  1EQV A;  2L55 A;  5CV4 A;  2WV6 D;  5T1I A;  3NXW A;  3MXN A;  4DNT B;  4G7O C;  4RHS A;  2KHS A;  2JXM B;  2Y0S B;  4JK1 C;  2O2L D;  2FFK B;  5FO7 B;  2PYK A;  2F0D A;  3ND9 A;  4BA1 I;  3BDO A;  3HOW B;  3LX0 A;  1BXT A;  1LT3 D;  3HOU B;  4FNF A;  1A3T A;  1UEA B;  4EQP A;  4L8J A;  5FO9 B;  1E2Z A;  4ZKB B;  5JJZ A;  2BE5 C;  3D8G A;  1VCI A;  1LAC A;  3NQI A;  3VR4 A;  4CKE A;  2K1B A;  3K58 A;  1TII D;  1JIC A;  3H94 A;  1GUO A;  4FVM A;  2X69 A;  4LAA A;  1TS5 A;  4HMJ A;  1WTP A;  1IW7 D;  2NBF A;  3Q23 A;  4OO1 H;  4IUQ A;  2SNS A;  1M8A A;  3NWT A;  1ZYR C;  1SEB D;  1BCP D;  1D6E C;  2SOB A;  5M5W B;  3KLS X;  3S14 B;  2VB2 X;  1W6K A;  2K5D A;  4X3S A;  2EYL A;  5LHY 1;  5FO8 B;  4BA2 I;  2HCI A;  5D3D A;  1Q1B A;  1DJR D;  5I2Y A;  3E6Z X;  1D5Z C;  4HR7 B;  1G2T A;  1HA5 A;  5EBC A;  5C0X J;  3O13 A;  4I65 A;  3RUZ A;  3NTK A;  2BOS A;  4KHV A;  1CFM A;  1KDB A;  2ZXP A;  4ME5 A;  1BUV T;  2VXW A;  1KLG D;  3HOX B;  1D1I A;  4IFD H;  3H09 A;  3OSO A;  1V43 A;  2V4D A;  1F77 A;  1HUN A;  5CV5 A;  3KBX A;  2K5Q A;  3SK5 A;  5EPL A;  3X3N A;  3HGB A;  3QWN A;  2NYZ D;  4KK7 A;  4C3J B;  3OMC A;  3TBI B;  1VF7 A;  2EPB A;  2L4N A;  5DNF A;  4KKS A;  5JEA H;  1GUT A;  1X32 A;  5JVG 3;  2IT1 A;  4MIU A;  1CHP D;  2F03 A;  1ZYR D;  1TWA B;  2A6H D;  2X6L A;  3DEO A;  4CKC A;  5C44 B;  4PNY A;  4KKT A;  2TMP A;  5I9O A;  2F0V A;  2XNA C;  3OPO A;  5E1F A;  5IGD A;  5EKI A;  4K8I A;  1KAB A;  4A3I B;  2RA4 A;  1T5X D;  3DUZ A;  4HED A;  1AZQ A;  2GA4 B;  3H3V C;  1KDC A;  4C3H G;  3W3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...