2B2VA

Crystal structure analysis of human chd1 chromodomains 1 and 2 bound to histone h3 resi 1-15 mek4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
175
structure length
175
Chain Sequence
b'EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 52
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2vA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2vA01
1WTVA 5T1IA 2NZ1D 2JP1A 5COYA 2RVLA 1CA5A 1B50A 2HDMA 2MJ8A 1RJTA 1ML0D 2RSOA 4CJ2C 2L9HA 1G91A 3IFDA 3H91A 5EQ0A 1ESRA 1A15A 1HFNA 1F9RA 2FJ2A 1SSOA 3P7JA 2B2UA 4RWSC 5CBAE 1DOMA 3D6WA 4NW2A 1EIHA 3GV3A 1U4PA 2KOLA 3R93A 1AZQA 1X32A 1B2TA 1EOTA 1WTQA 1WTPA 1QE6A 4OIKA 4X3TA 4XT1B 1NAPA 1PFNA 1CM9A 3SVMA 1PDQA 2Q8RE 1U4MA 1WTRA 1NR2A 1DOKA 2R3ZA 1SAPA 5AFWA 1LV9A 2FMMA 2FHTA 5EKIA 4RAUC 4CJ0B 4O42A 2RA4A 1PFBA 2B2WC 3TN2A 1Q3LA 1G2SA 3FDTA 3MTSA 2CVRA 1WVLA 4RA8A 1NCVA 3QO2A 1G6ZA 2JYOA 1WD1A 2HCCA 3I90A 2K05A 2L11A 2B2TC 5E4WC 4CJ1B 1X3PA 2KEEA 1F9PA 5EPLA 5JJZA 2X6LA 4IUQA 2DY8A 4UAIA 1WTWA 1BNZA 1DONA 2K1BA 2KVMA 4DN4M 4X3UA 1PFMA 2MPMA 5EPJA 2BDNA 1RTOA 3KUPA 1WTOA 2K04A 5D65A 2N55A 2K03A 2B2WA 3G7LA 4ZKCB 3IL8A 4HCSA 1VMPA 2K28A 1XYIA 1QG7A 2H1EA 4XDXA 1E0BA 3I3CA 4OIJA 1AZPA 4LMQD 4HSVA 3LWEA 2MP1A 2B2TA 5EJWA 4QUFA 3ONAB 2K01A 3KBXA 1DZ1A 1O7ZA 1O7YA 3MWYW 2J7ZA 1F9QA 3I8ZA 4R8IA 1EIGA 1C8CA 1J9OA 4IUUA 4X3KA 1WTXA 2M2LA 2X69A 5CBEE 4HAEA 1CA6A 2HCIA 1NR4A 1SDFA 2DY7A 2FFKB 1AP0A 1HUNA 3I91A 1KNAA 2EPBA 3GV6A 4ZK9B 2VXWA 1RODA 3F2UA 5T1GA 1IKLA 5CMDA 1EL0A 2EOTA 1HHVA 2HDLA 2X6GA 1X3QA 1QNKA 3UI2A 3Q6SA 2N88A 1JE4A 1HUMA 1ICWA 4MN3A 1BBXC 4HEDA 1XX8A 1U4RA 5DNFA 1HRJA 1PLFA 1TVXA 2KEDA 2B2YC 2KUMA 2D9UA 1U4LA 1HFGA 2EE1A 4MHEA 1EQTA 2Q8TA 4ZKBB 5D14A 5EPKA 1RHPA 2B2VC 2SDFA 1JICA 1MSGA 2HUGA 1RTNA 1MI2A 1F2LA 4IUVA 1J8IA 1ILQA 1MGSA 1ILPA 2IL8A 1O80A 2NYZD 1GUWA 1HA6A 3DEPA 2L1BA 2KECA 5CORA 1IKMA 1S4ZA 2NWGA 2FINB 2MGSA 1BO0A 3DM1A 3FPUB 1VMCA 3HP3A 4QUCA 1B3AA 1IL8A 5E4XA 2B2YA 1M8AA 4IUTA 4IURA 1ZXTA 1DOLA 2L12A 4U68A 4ZAIA 2RSNA 2L4NA 2XIWA 4XT3B 1MSHA 4R9WA 1G2TA 1B53A 3N52A 4IUPA 1WD0A 4X3SA 2B2VA 2B2UC 3DEOA 1B4OA 1KNEA 1F9SA 1BF4A 4ZLTF 3TZDA
chains in the Genus database with same CATH superfamily
3PGZA 4JK1C 1B50A 2RVLA 5CV6A 1UUPA 1EWHA 4GNXA 3E9IA 2JSOA 1H9MA 3IAYA 2F3IA 3PUYA 4LF6Q 3GO5A 1N32Q 5HGQA 1KLUD 5IP9G 3J81L 1JJ2A 2BDOA 3GTGB 2EJFC 4JPBW 5FKAC 2KHSA 1BCPB 1CSQA 1SE3A 4XYQA 4WJ4A 1TT2A 1TY2A 3SVMA 4JI4L 5F2DA 1TWHB 1K0SA 1Q86C 3PIO3 5FOBB 5C44H 3OOCA 5EKIA 3C3LA 4RKLA 1E22A 2PNHA 3CU7A 2I07B 2Z1CA 1TWCB 1FNVA 3T4AC 3K6OA 4NXMQ 1STHA 4LUOA 3TRZA 3K5OA 3HZXA 2K52A 4IUQA 4JV5Q 1I94L 4BBSH 2KVMA 3M85A 2J0TD 3ND8A 1K3BC 1WTHA 5G3LF 4DAVA 1QG7A 3I72A 3KBGA 4NP5A 1AZPA 1ONLA 1K8OA 2EDGA 4N8X1 3S15B 5CV9A 1IYJB 5M3MG 4K8IA 4R8IA 1EU4A 4DR6Q 3TMEA 3K81C 4UDUC 5EKKA 1I4XA 1ASZA 2G9DA 3L0OA 4LW1A 3L2PA 3I91A 1VQIA 1HUNA 4ZK9B 1BOSA 4HCEA 4DK1A 2D5DA 4L8JA 1E3PA 2EYOA 1IBLQ 4JI3L 2UXCL 3PV0A 3CC7A 2B8FA 1GHJA 1XPRA 4HEDA 2EIFA 2EQSA 2HHHL 2ENBA 1FR3A 1LTBD 3EIVA 1HZBA 3MXGA 3JAML 1MGSA 5A2QE 2NWGA 2O2LD 2Y0SB 4QUCA 3MFYA 4A3GG 3K80C 3RMHA 2EXDA 4RKBA 2QKIC 3KDFB 3ITPA 3PMFA 4A93G 2VNUD 3CMEA 1YNJD 1Q46A 1KHIA 1FL0A 1SROA 4QF4A 1WTVA 4Y52H 2EYFA 4BY1B 2LMCB 1XJVA 3ULLA 5EKLA 1JC7A 5C3EG 2JA7H 1Y8OB 1YI2A 1BCPD 2ZJRA 4DR5Q 4EVOA 3S1MH 2RDGA 2RDHA 3H0GB 2FJ2A 5IGEA 2CW0D 2JA5G 2IHEA 1UEBA 3EJIA 3GV3A 2I46A 2OQKA 1B1ZA 2PMZB 3P1HA 3IFTA 3LNNA 3QG1A 4GOPB 1AZQA 3PO2H 1YNJC 4FP5D 1WTPA 4A3BH 4JC0A 2VB2X 1H9KA 3RZDB 4DXGA 3V2TA 3VYUA 1S5BD 4HN7A 4X66L 2F52A 5BN5A 3J80c 4A3JH 1BCPC 5IWAQ 1D1KA 2RQXA 4PZ7A 4CDDC 3L9AX 2KCCA 2LSSA 2CW0C 2OEOA 3QO2A 4QJFA 1OXVA 1HCZA 2WV6D 1HNZQ 4AYBE 1XNQQ 4GKJL 4FYDA 2AQ2B 3TP5A 5IE8A 4ODGA 2NVTB 3CMAA 4IFDJ 3PSIA 1AFPA 2B2WA 4A3MG 1RIPA 4PMWA 1PH2A 3BS1A 2VUMB 3AYHB 4OIJA 1V1QA 3HOXB 2NN6G 3TEHB 4Q5VA 4DR7L 5TSSA 4K8JA 1NBWA 4BA2I 2F4VQ 4OWTB 3T1YL 2MNAA 2Q2UA 3VA7A 1E2WA 1I4GA 1HHVA 2GVAA 4DV1L 1HUMA 3NWTA 3F2BA 1BDOA 4KMUC 3A5ZB 4GKKQ 4GLXA 1K83H 2XWJB 3M4QA 5M5WB 3J7AF 5FJ8H 1R9TH 3I7FA 1RHPA 3HKSA 1LLRD 3GTOH 1SNDA 2IL8A 1BBWA 1L2FA 2KECA 4B08A 3EBEA 3DM1A 4RHRA 1I6HH 1HQMC 1FJGL 2OTJA 3EA6A 1M8AA 4IUTA 3KFUA 5IP9H 1KTKA 4DR1Q 3M3YB 1MSHA 1V43A 1IW7D 4X3SA 5IYCG 1VQ6A 3HOZG 3K58A 1BF4A 1KDCA 1STEA 3PO3B 3QOJA 3PF4A 4K14A 2DJFC 1OXXK 3O13A 5DEHA 4A3CG 4NPSA 1Z47A 3SK5A 1B7YB 1W3SA 4G4KA 2YU9H 3P7JA 2WIIB 2QCPX 2JA8G 1PH5A 1IW7C 2QA4A 5KYLA 5LMNW 1Q82C 1B2TA 1WTQA 1JWSD 5EBCA 3KLWA 1PDQA 3OMGA 3RN5A 1GXDC 4GOPC 2OF1A 1DOKA 1EQRA 3A55A 1SAPA 3D4RA 2JA6H 4DAYA 5FLXE 3S17H 2QGQA 1PVOA 1X54A 5FLXc 1EY5A 3P20A 1TS2A 1QVGA 2AKWB 2D0PA 5CR3A 1I3QB 4A3EH 1HQRD 4WJ3M 2L11A 3C1FA 1X3PA 1X3EA 1F9PA 1STAA 5ELBA 1BNZA 4J6HA 4YCVA 4A3DG 1Y1WG 3HOWB 2JXMB 5BN4A 4DV5Q 2DUDA 4DK3C 5ISRA 1E2ZA 1Y14B 3M4YA 1LUZA 1CQVA 4R4OA 4RHSA 4EQ5A 1VMPA 1XYIA 3S14H 2IPKD 5AJ3L 2GVBA 3OTOL 2Z6KA 2F3VA 3MAQA 2MFIA 5K5PA 1EYAA 4IPHA 2F1MA 4FXKC 2EY5A 5ELOA 3SE0A 3HKZG 4DNRB 1M90C 5IIFA 2CWPA 4B3TQ 2GA4B 1XMQL 1YJNA 4JBJA 2CCZA 5CMDA 4ME3A 3H15A 4A3GH 3UI2A 2N3SA 1XX8A 1JT8A 4AQYL 2KUMA 3MXPA 4R1JA 3QJYA 1VQNA 4ZKBB 4B9XA 1CI3M 5JJLA 2IT1A 4IALA 2UXBL 2WACA 3S9WA 3A0JA 3CRKC 3KK7A 1LTGD 5T1IA 4R4CA 2H4OA 4FDBA 2L4NA 4R9WA 2ICIA 4FNFA 2A73B 1XPOA 1E1OA 2ZM6Q 2R93H 1LACA 1CSPA 2EYJA 3GD7A 4KD4A 3ERQA 2NVXB 4ALPA 4XIGS 1DM0B 4DV4Q 3X3MA 3R2IA 3SXHA 5I6WA 4A75A 3T51B 4LJZC 1XTCD 4HIOA 2CH4A 4CKEA 4JI1Q 4BS9A 4R8NA 1QWYA 2B63B 1HA5A 1ENAA 4OIKA 1GUGA 1JORA 2CWAA 4KI0A 1WTRA 3D31A 4K2KA 3VYRA 3S16H 3CRLC 3I4OA 2I0QA 4KHPL 4FF2A 1UE1A 5JEAH 1DXMA 2AUKA 1LTLA 2Y0SE 2NN6H 4B3ML 4DUZQ 1R4PB 3J81E 1K8GA 5JJZA 2IX3A 1O7LA 1TWAB 2K7VA 2QDLA 5D65A 3E0EA 4B3SQ 1D8LA 1KAAA 4ILWA 4XDXA 2VB3X 4HSVA 2OT2A 2AMCB 1EZ8A 2F0QA 4TSSA 1EFWA 1W6JA 2WFWA 1PZKD 4NMZA 4N9TA 4KK7A 2X69A 2ZXRA 4HAEA 1ESFA 4KLKA 3SDZA 2PMZE 4ID6A 5C3WA 3TS0A 4OO1H 4JG2A 3PQIA 3TZUA 4ZRZA 3H3VI 4TRDA 4DV0L 5H1SE 3K59A 4K0KQ 2F0LA 1IXRA 2N88A 1JE4A 1I50H 5ELEA 1WCMB 3HOXH 1D5MC 1SLJA 1TVXA 2XNAC 5EAYA 5CC4A 2PNRC 5IYCH 1TU2B 4HJ7A 4JI2L 3HOZH 4JI7Q 1I5FA 1IYVA 2D2CC 1SYCA 4HR7B 2OCEA 3UDFA 2QILA 3V05A 4X62Q 2LY7A 1SYEA 1XTDA 1SNMA 4BBSG 1PH9A 4A3CH 2O5JC 3S1NH 1CA5A 1GD7A 1D1IA 5HURA 2K50A 5C0XH 1YJ9A 1SYGA 1B8AA 2UUCQ 5I9OA 4ZLTF 1O7IA 3NXWA 2IWHA 1VQOA 3MXNB 1LT5D 5COYA 1X3FA 4X64L 1L1OB 2EJGC 3JAME 1SR3A 3I56A 4OXPA 1JB3A 1F9RA 4BA1I 1QVFA 4L6TB 1A3VA 3A56A 4ZUIA 1LTID 4AYBB 2N78A 1Y1WH 2E5LQ 4K2LA 1PFNA 4LF9Q 3SK6A 4LF8L 1SFOB 1NR2A 3URYA 5JAVA 2SNSA 3NP8A 3J80i 5M5XB 5EBDA 4GN5A 3L7ZC 2UXDQ 5J39A 2GN5A 4KY6A 1Q12A 3T56B 2EYMA 3AMUA 2M9VA 2EZVA 2L55A 4CJ1B 5IP7G 3BZCA 4C3IG 4JVZA 3CW2C 2K1BA 1LO5D 4PMBA 2ZJQA 4X3UA 2V1CC 1K8MA 3S2HH 1XMOL 1VQEA 4H02A 4C3HB 1QUQA 3I3CA 2E75C 4LMQD 1N34L 2EY2A 4RCOA 4FXGC 2O5IC 5M5YB 2B2TA 5EJWA 3CP0A 3S1QH 2UU9Q 3X3NA 4GN4B 4HMIA 2F0UA 2G5DA 2Z4HA 4IUUA 2UUAQ 3DLLA 3CXCA 3GTQH 3PUWA 1CA6A 4Y7NB 2Q2TA 5LL6X 3CQZB 1NE3A 4FF4A 1LABA 1EY6A 2NUCA 1A6XA 2C5CA 2VL6A 2VQFQ 4B3RQ 4RH6A 3PIP3 4HSPA 2EYHA 3T13A 3J7A5 4K5XA 2E2DC 3J7YW 4FO2A 4A3JG 2VW9A 4A3LH 1JQYD 3WOEA 4BBRB 2NVQH 1KRTA 3ND9A 2Q8TA 1EQTA 4P2CB 3BYTB 3KJOA 2KENA 4NXML 2K33A 1PHJA 5CV5A 4JI6Q 2IY5B 4XQQA 4DR2Q 2A5HA 3OPOA 5C4XH 2FINB 5M3FH 4OX9L 3AFPA 2BCOA 2E2HB 1P16A 1IL2A 3NTHA 2XIWA 1S5DD 4XXEA 1A2UA 3NEMA 3IRBA 4KJNA 3FPPA 1U5KA 3EN2A 1Q81C 4JOIC 2NZ1D 3HOUB 3TP8A 4C3JG 4DR6L 4L5SA 2F0VA 3R2TA 2LFNA 2MJ8A 1RJTA 1R4QB 2CHBD 2F0WA 3FVQA 3VR6A 1LT4D 5GAGC 3ZJYC 2PZTA 3BU2A 1MJEA 4MIUA 3W2DA 1BCPF 1JE5A 3G6JB 5CBAE 3I4MB 3CC4A 1L1OC 1CHPD 1VQPA 3NSWA 4H44C 3F2DA 4GS3A 3CCLA 1SN8A 1PH1A 3FEWX 1DCZA 4YCWA 1Q7YC 5E1FA 4KY7A 2WKDA 1EY0A 1VQKA 1PMRA 3NELA 2NVYH 4DKAC 5EGTA 3I90A 1H95A 4IPDA 5HGTA 4AH6A 1AE3A 1IHZA 4EGVA 2DY8A 4P73A 1EYGA 3CD6A 3NPPA 2K6AA 1DGSA 4A3IH 2K5DA 3CPWA 2VQEQ 1EWIA 1PFMA 2OWOA 1AEXA 3DHQA 1S72A 3KF6A 1N33L 3G7LA 2A19A 1VQHA 4QUFA 3RZOH 3G71A 1O7YA 4V0BA 4NDXA 4CDFC 1YNND 3HRZC 4WFN3 1II3A 1Y1VB 3ZYYX 2XRSD 3NTKA 1CUKA 3N6RA 1LTTD 1SE8A 5CBEE 5I4DA 1NR4A 3WDNA 4DR4Q 2LS01 1TS4A 2PZUA 5M3MB 3UE1A 2EYLA 3FMCA 2EPBA 1C48A 5BR8L 5T1GA 1M1KC 2Z9HA 4JCVE 2DJGC 2X6GA 4XQJA 2PI2E 2B39A 1T5EA 3BYYB 2QF7A 2JA6G 1H9SB 2B2YC 3T1HQ 5E3FA 1YNNC 3M9BA 1XNRL 1SBBB 4A3EG 3GTPH 4GNXB 1HNZL 1SJHD 4DV7Q 4NXNQ 1XNQL 4DNTB 1N9WA 2RCNA 3NBHA 1B3AA 2SEBD 4JI5Q 2L12A 5ELFA 3HOVH 1KC8C 1WCMH 4XT3B 1ZEQX 3KF6B 2B2VA 2F0TA 4PZ8A 5GQOA 1Z9FA 3NENA 3KLRA 1GUOA 2EXZA 2NTTA 1I4HA 3G48A 2R7FA 2NZOA 3TQYA 4A93B 3M7NA 4JYAQ 2JP1A 1X3GA 2J4XA 4IPCA 1EU3A 2LXJA 1YBYA 3CCRA 5FLMG 3IFDA 3K5LA 3VR5A 1HNWL 2JN4A 5C3EB 4B9WA 3F8TA 2NB0A 2G9HD 3R93A 1IBMQ 3NWSA 2PYKA 1JOOA 5IP7H 3CCMA 5E7NA 1EQQA 2JA5B 4C3IH 1NAPA 5L37A 3VA5A 2Q8RE 1KQSA 4YHHL 2ZJPA 4NB3A 2K32A 5CV4A 3M7GA 2QW7A 4KV6A 3MTSA 2TMPA 1GHKA 1GUTA 2HCCA 2ZXOA 3Q22A 1TY0A 3HOYB 5EPLA 1JJCB 3QR8A 4DR1L 5IGGA 4UAIA 3G4SA 1PRTF 4H7BA 1O78A 3PF5A 3HGBA 4TVAB 2HIVA 1SMYD 3K7UC 4K6DA 4F88A 3K7AB 5GAEC 2BH2A 4LFCL 1SFOH 2R93G 4N8FA 5IT9L 1VQ9A 2F0DA 5C6AA 4I7AA 3JC66 4OHJA 2YTVA 4JI4Q 4A3MB 1J9OA 3VR3A 3OIPA 2F0KA 4DGZA 1G8ZD 1CKMA 4PMCA 2A6HD 5LHY1 4LF5Q 1XWEA 2FFKB 1AP0A 1SMYC 1V8QA 2EOTA 3I4NH 1I94Q 3AFQA 2R7DA 3Q6SA 4BY7B 3OIQA 4JI8Q 1HRJA 2DNCA 4LFBL 2KEDA 4A3KB 4MTNA 1U4LA 3U9SA 3VDYA 5JEAG 4RG1A 5D14A 3H0GG 4CDCC 4QIWB 2A6HC 4EQNA 5J3BA 4QGUA 4C3JH 1RDPD 1LTRD 3CQZH 4F8MA 4X65L 3LGJA 1BO0A 1Z6HA 1V1OA 3R3OA 1PH8A 1I4QA 1Z7TA 4RGTA 4ZAIA 4GNXC 1VQ5A 4C2MH 3GTLB 1BBUA 1PTOB 1E24A 3N52A 3D6CA 1TWFH 3B6YA 3RN2A 3ER0A 4JI3Q 1YIJA 5C4HA 1X56A 4ABNA 3VYSA 2RCFA 4ME5A 2HHHQ 3A5UA 3H3VC 1E7ZA 1ML0D 5M9OA 4CHTB 3OHXC 4OO1G 2K5VA 1L0YB 3BZKA 2B2UA 3D8GA 4XYOA 2VUMG 1VF7A 2R7ZB 1G51A 3HOXG 4DK0A 1TWGH 1A63A 4ULLA 5JJIA 2JA8B 1PH4A 2DNEA 1D7QA 5C4JB 2AQ3B 4KN4C 1P8LA 2PW7A 1D5XC 1G2SA 5IGBA 3NTIA 3EFXD 3UDGA 2K05A 2WAQG 2KEEA 5DAUA 3M4OH 5C0XG 5KNDA 2F0JA 1JOKA 3CCEA 1STNA 2H5XA 1RTOA 4Z9CB 4A3DB 1TKWB 3HG9A 1K3RA 2LXKA 1E0BA 2N49A 1KDBA 3H6MA 4IOAA 4RFBA 1AN8A 3KBXA 3K57A 1A8VA 2A74C 4RGOS 3FKIB 4C1NK 2VY3A 3GTGH 3HKZB 3PO3G 3S2DB 1FGUA 2ALYB 1GM5A 1QNKA 4DR3L 2K5HA 1PA6A 1TWHH 5CV7A 4YWKA 4QL5A 1LT3D 1RD9D 3HFZB 4KD3A 2R92B 1TWCH 1MSGA 3MEFA 1PTOD 2E2IB 4DR7Q 2F03A 5FO9B 1ILPA 1OXTA 3DEPA 3I73A 1F2YA 3HP3A 5FLMH 2E2JB 3GTKB 1T9HA 3T1YQ 4B3SL 1XPUA 1EFID 4YWLA 1GO3E 4DV6Q 1KRSA 1WD0A 3S1RB 4L5QA 5C5MA 4YY3L 3GQBA 4DV1Q 4A3FB 4X6AH 3D4WA 1S3OA 1PTOC 1HJPA 3S15H 4DAYB 3RLOA 4CJ2C 1C4QA 4LF7L 2L9HA 1V1PA 1PH3A 1VQ7A 3H91A 2ZTDA 1HFNA 1TS3A 1PV4A 4H0LC 4IFDH 1B3QA 2D0OA 2F0MA 2NBFA 4K0KL 4ZQ3A 3ICEA 1BXTA 1YVCA 2KOLA 1VQ8A 4DUYQ 4IN3A 2YTYA 2E8GA 4A3LG 5LMNL 1SRUA 1HR0W 1SYBA 2JEAI 3V96A 2FHTA 3K5MA 2F0OA 2B2WC 3C46A 1UE7A 2CVRA 5C4XG 5M3FG 2XRQD 2OQ0A 1D2BA 4NKLA 5HY6A 2PQAA 2DN8A 5IGFA 4K6LA 4PNYA 5GROA 3AQQA 5JJKA 1OO9B 2UUBL 4HCSA 3CC2A 3GTJB 2XSCA 1E2VA 4PV1C 4BY1H 1VDZA 4HIMA 2ZT9C 3Q8DA 3D3RA 1DZ1A 3SK8A 4A76A 1CKNA 2AQ1B 3H0GH 2YYZA 1JMCA 3T16A 3J81c 1EY8A 3CHBD 5ELCA 3CCQA 3PUXA 4G7OC 3RZDH 4POGA 1X3QA 5LL6S 1EIYB 3J80L 3E3XA 2KQ3A 1EY4A 1Q8IA 2KCMA 5AJ3Q 4LF4Q 5C44B 1IZ6A 3Q23A 1LM0A 1F2LA 4A3IG 2NVTH 2EVBA 3C2PA 5D3DA 2CQAA 4DK6C 3OWEB 3CPFA 4R4TA 4BBSB 3ERSX 3CCVA 1ICFB 1XMQQ 4OEMB 4GZYC 3UDIA 5J22A 2VUMH 3I55A 2NTSA 1PYWD 2F0GA 4N9PA 2UUAL 4IZ8A 2WB1B 3AU7A 1BQQT 1EUJA 2RSOA 1HZCA 1TS5A 1SE2A 3R8BA 1JWUD 3OYYA 5LMUQ 2UXBQ 1A15A 2ZTEA 1EIHA 1PTOH 4UPAA 4DV2Q 2F0NA 4P72A 2KJXA 4E6IA 1SYFA 3BVMA 4JBKA 4DPGA 4HIDA 4JI0L 3DUZA 4CBVA 1L0XB 4K5VA 4H13C 3W1BA 1BUVT 5M5WH 1WJJA 4QIWE 3A7AB 1UAPA 2E76C 4S3SA 1JOQA 2PQEA 2QEJC 4JI6L 2WINB 2RA4A 1PFBA 1AE2A 3E0JA 2NZHA 3JAMc 2B29A 3HOVG 3BJUA 2RHSB 2Z6KC 2R6GA 1PYBA 5E4WC 3J7ZC 1WCMG 3A8IE 1VQMA 5JVH3 3M3YH 4DN4M 2BDNA 3KUPA 3DMUA 4DAPA 4DV3L 5K36G 1YEZA 1N36L 4ZKCB 3PO3H 2F0PA 3MEHA 2RBMA 1VCIA 2AWNA 1J5EL 1IBKQ 4IJHA 3MZ5A 3TP7A 4DA2A 3RLNA 1SNPA 1EIGA 1WTXA 4OONA 2NN6I 2JA7B 1KLGD 1FNUA 1SDFA 4WORA 3S1MB 4B3MQ 1X65A 3BDLA 4RMFA 3OW7A 2HDLA 3PO2B 1DD2A 1BBXC 4A3BB 4FVMA 5IT9E 3ULJA 1Y8PB 3FHWA 5FLXL 4A3JB 1HNXQ 1HR0Q 2SDFA 5JOBA 4UY8C 1I3QH 4LF6L 2HUGA 1N32L 4IUVA 1VQGA 1O80A 4GLAC 4P75A 2XTIA 5EQ0A 4AYBG 1SJED 3HOWH 4OO1I 1EEID 5D3IB 2IX0A 2RSNA 1HZ9A 3ULPA 4IUNA 4TKOB 1STBA 1B53A 4G7ZC 3MC0B 2IJ0A 4DV0Q 2ASBA 3A8KE 1NNXA 2JQOA 4CDEC 3EROA 4JI2Q 2A6ED 3QOLA 4KTAA 2I5HA 4JV5L 5IY0A 3HKZE 1SSOA 3PIOA 1CZGA 4V190 3I4NG 4FF3A 4BXXH 1RCVD 3DXJC 3KF8A 5C0XI 4A3FH 4X3TA 1B70B 1PH7A 3CCJA 1SXTA 1CFMA 5JPNC 1Y69U 2A6EC 1QUQB 2OTLA 1WFQA 1EZ6A 3GTMB 1SYDA 1K83B 4CJ0B 1KXLA 4O42A 1GKHA 1R9TB 1RKNA 2IHFA 2XN9C 3GTOB 4X64Q 4UHVA 1WTWA 1SNOA 1IBLL 1I6HB 4LFAQ 1U9RA 5ELDA 4BBRG 2I5LX 3U58A 1OXUA 4PQXA 2KBNA 1KDAA 2K04A 3HS0C 2Q8IB 4G7HC 3IL8A 1N8RC 4YCUA 2NVXH 1JWMD 1F2MA 1J6QA 3MWYW 2MUYA 5KNCA 4QB4A 1SNQA 2L0CA 2YU9B 2K14A 4DNIA 1KD1C 1KNAA 2B63H 3SK4A 1K9MC 3F2UA 2L15A 1IKLA 1LYLA 3QB3A 2MO0A 3GTJH 1I4RA 3P75A 4PZ6A 4FXDA 2OXPA 3KOJA 1XMOQ 1HFGA 2EE1A 2N8NA 3OSOA 5IYBG 1N34Q 3I4MG 2JA6B 3S17B 4WJWA 1MBYA 4DR5L 2KA7A 1GUSA 2B8GA 3CF5A 3W3AA 1GJXA 3KLSX 1GUWA 5CV8A 3MXUA 4A3EB 4R4QA 4XTCS 1VMCA 4ZUJA 2P5ZX 2VZAA 1IL8A 3LX0A 3E9HA 4IURA 1ZXTA 3OW2A 1A3TA 1TWAH 2KHJA 2YV5A 4U673 1YITA 1STGA 3NHHA 4IUPA 2BE5D 4LUZA 1HTPA 3EQLC 1YJWA 1F9SA 4DF7A 3S14B 5IWAL 1B44D 3RD4A 1C0AA 3NUCA 2HDMA 5JVG3 4LF5L 1NJIC 1MD2D 1PFSA 1WI5A 1ESRA 1QOHA 2BA1A 2AWOA 4RWSC 1SE4A 2IW3A 1WYDA 3MFGA 3WOFA 3BVGA 1NMFA 2BE5C 1U4PA 3F1ZA 4JI8L 4OX9Q 3KDFA 3E5SA 1D6EC 3GP7A 4A3GB 1EY7A 2TSSA 3BVZA 4F7XA 1EYCA 4J15A 4HJ8A 3A8JE 1Y1VG 5K36H 3AEVA 4L5RC 3I4LA 5KGUA 2F4VL 2CQOA 2K5QA 3D0FA 1X9NA 1PH6A 2WKCA 1OXSC 2B2TC 1ENCA 4GOPA 1Q8KA 5FO8B 4QMGA 1QB5D 1U0LA 4HJ5A 4GKKL 3BDCA 2K28A 5KEEA 1EYDA 2WB1E 2R93B 2MP1A 2DGYA 3ONAB 1HH2P 3LWUA 4APVA 1TIID 1F9QA 3I8ZA 1G291 4IFDG 3QIAA 2A1AA 4LNQA 2Q2IA 2HQLA 4C56C 4IOCA 3NBHB 4BWGB 4POFA 2DY7A 1FNWA 1GUNA 3J81i 3SGIA 1F2ZA 1PLFA 1N33Q 4MTKA 5M5XH 2FMCA 1IYUA 4JW0A 3S16B 3FP9A 4O1NA 3K0XA 2Y0SG 4OELB 2JEBI 1PTOF 1QZGA 1S4ZA 2V4DA 3E6ZX 5ELNA 1PZJD 5GAHC 4MZ9A 1T5XD 2AHOB 2XGTA 1EIFA 5IGCA 3F2CA 1G2TA 3KJPA 1JCKB 5BR8Q 4BY1G 1S40A 4QCLA 4C3HH 2I5MX 1CKOA 5KIXA 3J80E 5M5YH 3DM3A 1E1TA 4P71A 2L5TA 4CKCA 3HOYG 1XNRQ 4HJ9A 2XVSA 4KY5A 2HQEA 4LAAA 4Y7NH 2BH8A 2ZTCA 1K28A 1YZ6A 2HIXA 5KNBA 3D6WA 4NW2A 4DV5L 3NBIA 3KLSA 1X32A 2RKSA 3NQTA 1PRTB 1CM9A 4BBRH 3A54A 1I50B 2UXCQ 1U4MA 4KKSA 1A0IA 1CK1A 2FMMA 2WP8J 1VQ4A 5IYDG 1W6KA 2RHQB 1FD7D 3HOZB 1KL9A 4LWCA 1D5ZC 1AW7A 4B3TL 2E2HH 3JAMi 4BY7G 4DV6L 1DONA 4A3KG 1HNWQ 3S1NB 2F0HA 5G3LD 1NTGA 2WAQB 4DXFA 3J7AV 5I2YA 2K03A 1V9PA 2H1EA 3GTMH 3NE5B 3HOUH 2KCTA 2IX1A 1CHQD 2K01A 4YHHQ 2J7ZA 4JBMA 2MQHA 5IOCA 1C8CA 4HTHA 5IYBH 3I4MH 1UNSA 3DWAA 4DUYL 3TP6A 5JEAJ 2Q2HA 3L3OC 1UEAB 2BOSA 1AH9A 3I2ZA 4OGQC 3MA2B 4DFAA 2ZM6L 1ZKOA 1NUCA 4KHVA 2K4KA 5DNFA 5BN3A 3W1GA 4KKTA 1Y1WB 2F3WA 4LFCQ 4EX5A 3MHBA 1QJOA 2B2VC 4DV4L 4X66Q 2CH4W 1VQCA 3H94A 2R7ZG 1J8IA 2PZWA 2NYZD 1IKMA 4JI1L 3G6EA 5E4XA 5C5LA 1ET6A 4GKJQ 3Q24A 4IO9A 3DEOA 3S2HB 1H9JA 1YHAA 1Q1BA 1QILA 4LFBQ 1BR9A 4O0AA 4XQNA 2ICEC 2F0SA 3BG3A 1Y1VH 3S1QB 1SMXA 4DUZL 1TQOA 3C1EA 1PRTD 3WWVA 1G6PA 5M3MH 1TR5A 1K73C 3GTQB 2EY1A 3KYHC 2JK8A 1DOMA 1LTAD 4X65Q 3HEJA 1EOTA 3I70A 1C7YA 1KAWA 2A69D 5KYIA 4XT1B 3U4ZA 3SEBA 3BDOA 1EWCA 4LF4L 1CZWA 3OWFA 2RDFA 5AFWA 1SNCA 5C0XJ 2NVQB 4RAUC 2ATWA 2O4XA 3VR4A 3M4PA 1VQAA 1PRTC 3TN2A 5IODA 3FKIG 3PCOB 3TBIB 4RA8A 3PUVA 1EOVA 2E74C 3DWPA 3HOWG 5GADC 2JYOA 1WD1A 1I4PA 1K8AC 2Z0SA 1DYQA 2A69C 4QY7A 5C4XB 4WRDA 5M3FB 3W5OA 3H3VH 1FJGQ 1S5FD 1WTOA 1DJRD 2R92G 4O2DA 4I65A 4JI7L 4A93H 5DLQE 2PI2A 3FRPB 2JE6I 1QCBD 3H09A 2RF4A 1FYCA 4KJOA 4LK1C 4X62L 1QNUA 5LMUL 1VQLA 4TQUS 1M4VA 4X3KA 3UE0A 1A62A 2EY6A 3UDXA 4DV2L 4BXXG 5C3EH 3IKJA 3STBD 5A2QL 1JJGA 1UE5A 1ZYRD 4A4IA 1CTMA 2SNMA 1ENFA 4EQOA 4A3FG 1NY4A 2JA5H 4L63B 2UUCL 5C3XA 1F77A 1MHWC 3RUZA 1W2BA 3MVVA 4ZCKA 5J1ZA 1JICA 2M00A 3STBC 4J1MA 2B3GA 1VF5C 4M1UB 1GVPA 1ILQA 1ZYRC 1V1PB 2NVYB 1VQDA 2F0IA 3CCUA 2QEXA 3HOYH 1UE6A 2Z4IA 3SR1A 2HD3A 4U68A 2E5LL 3K7AH 4M8AA 4A3IB 4LF9L 2F0EA 4OWWB 1RL2A 2B2UC 1IBKL 1GOZA 4DR3Q 4IPGA 3TZDA 4A3MH 2UXDL 3RZOB 3OTOQ 5IGDA 1G91A 5IYDH 1NSNS 3A74A 3VR2A 5I6YA 2B63G 4LUVA 2C9OA 1B9MA 2PQAB 1X6OA 5JPMC 4FF1A 1YHBA 4JOIA 1QE6A 4BY7H 1PXUA 2JA9A 1EEFD 4A3KH 5C4ZA 1LTSD 2VS1A 1HNXL 1HR0L 4L5TA 5FO7B 1B9NA 2R3ZA 2UU9L 1LV9A 3MXNA 5CYUA 4YY3Q 4YWMA 4MNOA 3TSSA 4AQYQ 2AUJD 1QVCA 1L1OA 1WVLA 1FVIA 2YTXA 1CKNB 3GTPB 4UP9A 4HIKA 4LF7Q 2PCFB 3TS2A 4IFDI 4EQPA 2X6LA 2VQFL 2FXQA 4B3RL 3GTLH 3EVQA 2MHVA 2KCNA 2Z6BA 3HOVB 2MPMA 5EPJA 1BKBA 4RGMA 2N55A 2MO1A 3K8AA 4C1NI 5C44G 1ET9A 1ASYA 5LMNQ 3OMCA 4IJLA 3LWEA 2F0FA 2EJMA 1K0RA 1O7ZA 3PIPA 4DR2L 1VQJA 3DWQA 4IQZA 2EYPA 4RCNA 3CCSA 5CGKA 2HCIA 4HJAA 3Q0AA 1TXYA 1C9OA 2R7ZH 1EL0A 2JA8H 2SOBA 1A3UA 2WB1G 2A68D 3RR5A 4C3IB 2UUBQ 3U50C 4OL7A 5C4JH 1S5ED 3U9OA 3TDQA 2XWBB 5EPKA 1MI2A 3QWNA 2PPBC 4KHPQ 4LFAL 2L1BA 4DU9A 5CORA 1Q90A 3FPUB 3S24A 2WAQE 2B2YA 1RF2D 1DOLA 1XXGA 4I7ZC 2A68C 1VQFA 4A3DH 1OTCA 2KHIA 1YHQA 2JJQA 4YIJA 1KNEA 4K5WA 5IT9c 2F4IA 1FGBD 3A7LA 3D4DA 3BZDB 4OWXB 3FKIH 3CAMA 2CFMA 4F87A 2ID0A 2R61A 2VQEL 1LT6D 3K5NA 3S2DH 1Y8NB 4G57A 3SHLA 1SEBD 2ES2A 3J81j 1HZAA 4CKBA 3I4NB 1A2TA 1VQBA 1HTLD 2JA7G 1PYSB 2R92H 5A35A 1HPCA 4J8QA 2E2IH 1Q3LA 4UP7A 3FDTA 4ZYSA 1X55A 2BA0A 1CQFA 2PO4A 4DR4L 1NCVA 1G6ZA 1KABA 1JB7A 4C3JB 3PO2G 2E2JH 3NK9A 3GTKH 4A3BG 2CKZB 3K0YA 2PW5A 5NUCA 4P74A 1VS0A 4C3HG 3CKIB 1CT1D 3S1RH 1NMGA 1MKHA 4C2MB 3T1HL 1EQVA 4R4IA 4KHZA 1YNXA 4UP8A 2Z8LA 1TWFB 4JI0Q 1H9RA 4JBWA 4RGNA 4DV7L 4NXNL 2D62A 3VYTA 2M2LA 4KKUA 1UWVA 3NQIA 3RNUA 2K5WA 1I6VC 4JI5L 4KN7C 5I2XA 2ZXPA 3GV6A 2VXWA 3RLFA 1RODA 1EY9A 1Q1EA 5DM73 1ICWA 1HXYD 1TWGB 2C35B 2QDBA 4MN3A 4PG3A 1U4RA 4JYAL 4DV3Q 4Q0FA 1QZHA 2D9UA 1N36Q 1MJCA 3AB9A 4MHEA 4LF8Q 1S5CD 5FK9C 4HMJA 4DAMA 1MIUA 4GLVB 3U4VA 1J5EQ 4CGYB 1RTNA 1HA6A 2K5NA 1BVSA 2K75A 1KIXA 1IBML 2MGSA 2LKVA 1L0WA 3T53B 5I9PA 5DM63 2A8VA 3M4OB 4QQBX 1JR0D 1STYA 3KF8B 3HOUG 1WOCA 4AIMA 5FJ8G 3PUZA 1B4OA 1H9SA 4GN3B 5KRUA 2HT1A 1PZID 3TREA 3GDEA
chains in the Genus database with same CATH topology
4JK1C 1B50A 2RVLA 5CV6A 1UUPA 1EWHA 2JSOA 1H9MA 3IAYA 3PUYA 3GO5A 3J81L 1KLUD 2BDOA 3GTGB 2EJFC 5FKAC 2KHSA 1BCPB 4XYQA 1SE3A 1TT2A 1TY2A 3SVMA 5F2DA 1TWHB 3PIO3 5FOBB 3OOCA 5EKIA 3C3LA 4RKLA 3CU7A 2I07B 2Z1CA 1TWCB 1FNVA 3T4AC 3K6OA 1STHA 3K5OA 3HZXA 4IUQA 2KVMA 3M85A 2J0TD 3ND8A 5G3LF 4DAVA 1QG7A 3I72A 3KBGA 4NP5A 1AZPA 1ONLA 1K8OA 2EDGA 3S15B 5CV9A 4R8IA 4K8IA 1EU4A 3TMEA 4UDUC 5EKKA 1I4XA 1HUNA 2G9DA 3I91A 4ZK9B 1BOSA 4HCEA 4DK1A 2D5DA 4L8JA 2EYOA 3PV0A 2B8FA 1GHJA 4HEDA 2ENBA 1FR3A 1LTBD 3MXGA 3JAML 1MGSA 5A2QE 2NWGA 2O2LD 2Y0SB 4QUCA 3MFYA 3RMHA 4RKBA 2QKIC 3ITPA 3PMFA 2VNUD 1YNJD 4QF4A 1WTVA 2EYFA 4BY1B 2LMCB 5EKLA 1JC7A 1Y8OB 1BCPD 4EVOA 2RDGA 2RDHA 3H0GB 2FJ2A 5IGEA 2CW0D 3EJIA 3GV3A 2I46A 1B1ZA 2PMZB 3P1HA 3IFTA 3LNNA 3QG1A 1AZQA 1YNJC 4FP5D 1WTPA 2VB2X 1H9KA 3RZDB 4DXGA 3V2TA 3VYUA 1S5BD 4HN7A 5BN5A 1BCPC 1D1KA 2RQXA 3L9AX 2KCCA 2CW0C 2OEOA 3QO2A 1OXVA 1HCZA 2WV6D 4FYDA 2AQ2B 3TP5A 2NVTB 4ODGA 4IFDJ 1AFPA 2B2WA 4PMWA 2VUMB 3BS1A 4OIJA 3HOXB 2NN6G 4Q5VA 5TSSA 4K8JA 4BA2I 3VA7A 1E2WA 1I4GA 1HHVA 1HUMA 3NWTA 1BDOA 4KMUC 2XWJB 5M5WB 3J7AF 1RHPA 1LLRD 1SNDA 2IL8A 2KECA 4B08A 4RHRA 3DM1A 1HQMC 3EA6A 1M8AA 4IUTA 1KTKA 3M3YB 1MSHA 1V43A 1IW7D 4X3SA 3K58A 1BF4A 1KDCA 1STEA 3PO3B 3QOJA 4K14A 1OXXK 3O13A 5DEHA 1Z47A 3SK5A 4G4KA 3P7JA 2WIIB 2QCPX 1IW7C 5KYLA 1B2TA 1WTQA 1JWSD 5EBCA 1PDQA 3OMGA 1GXDC 2OF1A 1DOKA 3A55A 1SAPA 3D4RA 4DAYA 5FLXE 1EY5A 3P20A 1TS2A 5CR3A 1I3QB 1HQRD 2L11A 3C1FA 1X3PA 1F9PA 1STAA 5ELBA 1BNZA 4J6HA 3HOWB 2JXMB 5BN4A 5ISRA 1E2ZA 3M4YA 1CQVA 4RHSA 1VMPA 1XYIA 2IPKD 2F3VA 3MAQA 5K5PA 1EYAA 2F1MA 4FXKC 2EY5A 3SE0A 4DNRB 5IIFA 2GA4B 5CMDA 3UI2A 1XX8A 2KUMA 3MXPA 3QJYA 4ZKBB 4B9XA 1CI3M 2IT1A 4IALA 2WACA 3S9WA 3KK7A 3CRKC 1LTGD 5T1IA 2H4OA 2L4NA 4R9WA 2ICIA 4FNFA 2A73B 1LACA 2EYJA 3GD7A 4KD4A 3ERQA 2NVXB 4XIGS 1DM0B 3X3MA 3R2IA 3SXHA 5I6WA 3T51B 4LJZC 1XTCD 4CKEA 4BS9A 4R8NA 1QWYA 2B63B 1HA5A 1ENAA 4OIKA 1GUGA 1JORA 4KI0A 1WTRA 3D31A 4K2KA 3VYRA 3CRLC 4FF2A 5JEAH 1DXMA 2AUKA 2NN6H 1R4PB 3J81E 5JJZA 2IX3A 1O7LA 1TWAB 2K7VA 5D65A 1KAAA 4ILWA 4XDXA 2VB3X 4HSVA 2OT2A 1EZ8A 2F0QA 4TSSA 1W6JA 1PZKD 4NMZA 4N9TA 4KK7A 2X69A 2ZXRA 4HAEA 1ESFA 3SDZA 4ID6A 5C3WA 4OO1H 3TZUA 4ZRZA 4TRDA 3K59A 2F0LA 2N88A 1JE4A 5ELEA 1WCMB 1D5MC 1TVXA 2XNAC 5CC4A 2PNRC 1IYVA 1TU2B 2D2CC 1SYCA 4HR7B 2QILA 3V05A 2LY7A 1SYEA 1SNMA 2O5JC 1CA5A 1D1IA 5HURA 5C0XH 1SYGA 5I9OA 4ZLTF 3NXWA 2IWHA 1LT5D 5COYA 2EJGC 3JAME 1JB3A 1F9RA 4BA1I 4L6TB 1A3VA 3A56A 4ZUIA 1LTID 4AYBB 4K2LA 1PFNA 3SK6A 1SFOB 1NR2A 3URYA 5JAVA 2SNSA 3NP8A 5M5XB 5EBDA 3L7ZC 5J39A 4KY6A 1Q12A 3T56B 2EYMA 3AMUA 2M9VA 2EZVA 2L55A 4CJ1B 4C3IG 2K1BA 1LO5D 4PMBA 4X3UA 1K8MA 4C3HB 3I3CA 2E75C 4LMQD 2EY2A 4RCOA 4FXGC 2O5IC 5M5YB 2B2TA 5EJWA 3X3NA 4HMIA 2F0UA 2Z4HA 4IUUA 3PUWA 1CA6A 4Y7NB 5LL6X 3CQZB 4FF4A 1LABA 1EY6A 2NUCA 1A6XA 2C5CA 4RH6A 3PIP3 4HSPA 2EYHA 3T13A 4K5XA 2E2DC 3J7YW 4FO2A 1JQYD 3WOEA 4BBRB 3ND9A 2Q8TA 1EQTA 4P2CB 3BYTB 2K33A 5CV5A 4XQQA 2A5HA 3OPOA 2FINB 2BCOA 2E2HB 3NTHA 2XIWA 1S5DD 4XXEA 1A2UA 4KJNA 3FPPA 2NZ1D 3HOUB 3TP8A 4C3JG 2F0VA 3R2TA 2LFNA 2MJ8A 1RJTA 1R4QB 2CHBD 2F0WA 3FVQA 3VR6A 1LT4D 2PZTA 4MIUA 3W2DA 1BCPF 3G6JB 5CBAE 3I4MB 1CHPD 3NSWA 4H44C 3FEWX 1DCZA 5E1FA 4KY7A 2WKDA 1EY0A 1PMRA 5EGTA 3I90A 5HGTA 1IHZA 4EGVA 2DY8A 3NPPA 2K6AA 2K5DA 1PFMA 1AEXA 3DHQA 3G7LA 4QUFA 1O7YA 4V0BA 4NDXA 1YNND 3HRZC 4WFN3 1II3A 1Y1VB 3ZYYX 2XRSD 3NTKA 3N6RA 1LTTD 5CBEE 5I4DA 1NR4A 3WDNA 2LS01 1TS4A 2PZUA 5M3MB 2EYLA 3FMCA 2EPBA 1C48A 5T1GA 2X6GA 4XQJA 2B39A 1T5EA 3BYYB 2QF7A 1H9SB 2B2YC 5E3FA 1YNNC 1SBBB 1SJHD 4DNTB 3NBHA 1B3AA 2SEBD 2L12A 5ELFA 4XT3B 1ZEQX 2B2VA 2F0TA 3KLRA 1GUOA 2EXZA 2NTTA 1I4HA 4A93B 3M7NA 2JP1A 2J4XA 1EU3A 3IFDA 3K5LA 3VR5A 5C3EB 4B9WA 2NB0A 2G9HD 3R93A 3NWSA 2PYKA 1JOOA 2JA5B 1NAPA 3VA5A 2Q8RE 2K32A 5CV4A 3M7GA 4KV6A 3MTSA 2TMPA 1GHKA 1GUTA 2HCCA 2ZXOA 3Q22A 1TY0A 3HOYB 5EPLA 5IGGA 4UAIA 1PRTF 4H7BA 1O78A 3HGBA 1SMYD 4K6DA 4F88A 3K7AB 5IT9L 2F0DA 5C6AA 4OHJA 4A3MB 1J9OA 3VR3A 3OIPA 2F0KA 4DGZA 1G8ZD 4PMCA 2A6HD 5LHY1 1XWEA 2FFKB 1AP0A 1SMYC 1V8QA 2EOTA 3Q6SA 4BY7B 3OIQA 1HRJA 2DNCA 2KEDA 4A3KB 1U4LA 3U9SA 5JEAG 5D14A 4QIWB 2A6HC 4EQNA 1RDPD 1LTRD 4F8MA 1BO0A 1Z6HA 1V1OA 3R3OA 1I4QA 4RGTA 1Z7TA 4ZAIA 3GTLB 1PTOB 3N52A 3D6CA 5C4HA 4ABNA 3VYSA 4ME5A 3H3VC 1ML0D 5M9OA 4CHTB 3OHXC 4OO1G 1L0YB 2B2UA 3D8GA 4XYOA 1VF7A 2R7ZB 4DK0A 4ULLA 2JA8B 2DNEA 5C4JB 2AQ3B 4KN4C 2PW7A 1D5XC 1G2SA 5IGBA 3NTIA 3EFXD 2K05A 2KEEA 5DAUA 5C0XG 5KNDA 2F0JA 1JOKA 1STNA 4Z9CB 1RTOA 4A3DB 1TKWB 3HG9A 1E0BA 1KDBA 3H6MA 4RFBA 1AN8A 3KBXA 3K57A 2A74C 4RGOS 3FKIB 4C1NK 3HKZB 3S2DB 1QNKA 5CV7A 1LT3D 1RD9D 4KD3A 2R92B 1MSGA 1PTOD 2E2IB 2F03A 5FO9B 1ILPA 1OXTA 3DEPA 3I73A 1F2YA 3HP3A 2E2JB 3GTKB 1EFID 1WD0A 3S1RB 5C5MA 3GQBA 4A3FB 3D4WA 1PTOC 4CJ2C 1C4QA 2L9HA 1V1PA 3H91A 1HFNA 1TS3A 4H0LC 4IFDH 2F0MA 2NBFA 4ZQ3A 1BXTA 2KOLA 4IN3A 1SYBA 2JEAI 3V96A 2FHTA 3K5MA 2F0OA 2B2WC 3C46A 2CVRA 2XRQD 1D2BA 4NKLA 5IGFA 2DN8A 4K6LA 4PNYA 1OO9B 4HCSA 3GTJB 2XSCA 1E2VA 4PV1C 1VDZA 2ZT9C 3D3RA 1DZ1A 3SK8A 2AQ1B 2YYZA 3T16A 1EY8A 3CHBD 5ELCA 3PUXA 4G7OC 1X3QA 5LL6S 3J80L 2KQ3A 1EY4A 1Q8IA 5C44B 3Q23A 1F2LA 2EVBA 3C2PA 5D3DA 2CQAA 3OWEB 4BBSB 4GZYC 5J22A 2NTSA 1PYWD 2F0GA 4N9PA 4IZ8A 2WB1B 3AU7A 1BQQT 2RSOA 1TS5A 1SE2A 3R8BA 1JWUD 1A15A 1EIHA 1PTOH 2F0NA 2KJXA 4E6IA 1SYFA 3BVMA 3DUZA 4CBVA 1L0XB 4K5VA 4H13C 1BUVT 3A7AB 1UAPA 2E76C 4S3SA 1JOQA 2PQEA 2QEJC 2WINB 2RA4A 1PFBA 3E0JA 2R6GA 5E4WC 3A8IE 5JVH3 4DN4M 2BDNA 3KUPA 3DMUA 4DAPA 5K36G 4ZKCB 2F0PA 3MEHA 2RBMA 1VCIA 2AWNA 3MZ5A 3TP7A 4DA2A 1SNPA 1EIGA 1WTXA 2NN6I 2JA7B 1KLGD 1FNUA 1SDFA 4WORA 3S1MB 3BDLA 3OW7A 2HDLA 3PO2B 1DD2A 1BBXC 4A3BB 4FVMA 5IT9E 1Y8PB 5FLXL 4A3JB 2SDFA 5JOBA 2HUGA 4IUVA 1O80A 5EQ0A 1SJED 4OO1I 1EEID 5D3IB 2IX0A 2RSNA 4IUNA 4TKOB 1STBA 1B53A 4G7ZC 3MC0B 2IJ0A 3A8KE 3EROA 2A6ED 3QOLA 4KTAA 1SSOA 1CZGA 4V190 4FF3A 1RCVD 3DXJC 3KF8A 5C0XI 4X3TA 1SXTA 1CFMA 5JPNC 1Y69U 2A6EC 1EZ6A 3GTMB 1SYDA 1K83B 4CJ0B 4O42A 1R9TB 1RKNA 2XN9C 3GTOB 1WTWA 1SNOA 1I6HB 1U9RA 5ELDA 1OXUA 4PQXA 1KDAA 2K04A 3HS0C 2Q8IB 4G7HC 3IL8A 1JWMD 1F2MA 3MWYW 2MUYA 5KNCA 4QB4A 1SNQA 2L0CA 2YU9B 1KNAA 3SK4A 3F2UA 3QB3A 1IKLA 1I4RA 3P75A 4FXDA 2OXPA 1HFGA 2EE1A 3OSOA 2JA6B 3S17B 4WJWA 1MBYA 2KA7A 1GUSA 2B8GA 3W3AA 1GJXA 3KLSX 1GUWA 5CV8A 3MXUA 4A3EB 4XTCS 1VMCA 4ZUJA 1IL8A 3LX0A 4IURA 1ZXTA 1A3TA 4U673 1STGA 3NHHA 4IUPA 2BE5D 1HTPA 3EQLC 1F9SA 4DF7A 3S14B 1B44D 3RD4A 3NUCA 2HDMA 5JVG3 1MD2D 1ESRA 1QOHA 2BA1A 2AWOA 4RWSC 1SE4A 2IW3A 3MFGA 3WOFA 3BVGA 2BE5C 1U4PA 3E5SA 1D6EC 3GP7A 4A3GB 1EY7A 2TSSA 3BVZA 4F7XA 1EYCA 3A8JE 5K36H 3I4LA 5KGUA 2K5QA 2WKCA 1OXSC 2B2TC 1ENCA 5FO8B 4QMGA 1QB5D 3BDCA 5KEEA 2K28A 1EYDA 2R93B 2MP1A 3ONAB 3LWUA 1TIID 1F9QA 3I8ZA 1G291 4IFDG 3QIAA 4C56C 4BWGB 2DY7A 1FNWA 1GUNA 1F2ZA 1PLFA 2FMCA 1IYUA 3S16B 4O1NA 2JEBI 1PTOF 1S4ZA 2V4DA 3E6ZX 1PZJD 1T5XD 5IGCA 1G2TA 1JCKB 4QCLA 5KIXA 3J80E 2L5TA 4CKCA 2XVSA 4KY5A 2HQEA 4LAAA 5KNBA 3D6WA 4NW2A 3NBIA 3KLSA 1X32A 2RKSA 3NQTA 1PRTB 1CM9A 3A54A 1I50B 1U4MA 4KKSA 1CK1A 2FMMA 2WP8J 1W6KA 1FD7D 3HOZB 1D5ZC 1AW7A 1DONA 3S1NB 2F0HA 5G3LD 2WAQB 4DXFA 3J7AV 5I2YA 2K03A 2H1EA 3NE5B 2IX1A 1CHQD 2K01A 2J7ZA 5IOCA 1C8CA 4HTHA 1UNSA 3DWAA 3TP6A 5JEAJ 3L3OC 1UEAB 2BOSA 4OGQC 3MA2B 4DFAA 1ZKOA 1NUCA 4KHVA 5DNFA 5BN3A 1Y1WB 4KKTA 2F3WA 3MHBA 1QJOA 2B2VC 3H94A 1J8IA 2PZWA 2NYZD 1IKMA 5E4XA 5C5LA 1ET6A 3Q24A 3DEOA 3S2HB 1H9JA 1Q1BA 1QILA 1BR9A 4XQNA 2ICEC 2F0SA 3BG3A 3S1QB 1TQOA 3C1EA 1PRTD 1TR5A 3GTQB 2EY1A 1DOMA 1LTAD 3HEJA 1EOTA 3I70A 2A69D 5KYIA 4XT1B 3SEBA 3BDOA 1EWCA 1CZWA 3OWFA 2RDFA 5AFWA 1SNCA 5C0XJ 2NVQB 4RAUC 2O4XA 3VR4A 1PRTC 3TN2A 5IODA 3TBIB 4RA8A 3PUVA 2E74C 3DWPA 2JYOA 1WD1A 1I4PA 1DYQA 2A69C 5C4XB 4WRDA 5M3FB 1S5FD 1WTOA 1DJRD 4I65A 3FRPB 2JE6I 1QCBD 3H09A 1FYCA 4KJOA 4LK1C 1QNUA 4TQUS 1M4VA 4X3KA 2EY6A 3IKJA 5A2QL 1ZYRD 1CTMA 2SNMA 1ENFA 4EQOA 4L63B 5C3XA 1F77A 3RUZA 3MVVA 5J1ZA 1JICA 2M00A 4J1MA 1VF5C 4M1UB 1ILQA 1ZYRC 1V1PB 2NVYB 2F0IA 2Z4IA 3SR1A 4U68A 4M8AA 4A3IB 2F0EA 2B2UC 1GOZA 3TZDA 3RZOB 5IGDA 1G91A 1NSNS 3VR2A 5I6YA 2C9OA 1B9MA 5JPMC 4FF1A 1QE6A 1PXUA 1EEFD 5C4ZA 1LTSD 5FO7B 1B9NA 2R3ZA 1LV9A 3MXNA 5CYUA 3TSSA 2AUJD 1WVLA 3GTPB 2PCFB 4IFDI 4EQPA 2X6LA 3EVQA 2MHVA 2KCNA 3HOVB 2MPMA 5EPJA 4RGMA 2N55A 4C1NI 1ET9A 3OMCA 3LWEA 2F0FA 2EJMA 1O7ZA 3DWQA 4IQZA 2EYPA 4RCNA 5CGKA 2HCIA 3Q0AA 1EL0A 2SOBA 1A3UA 2A68D 4C3IB 4OL7A 1S5ED 3U9OA 3TDQA 2XWBB 5EPKA 1MI2A 3QWNA 2PPBC 2L1BA 4DU9A 5CORA 1Q90A 3FPUB 2B2YA 1RF2D 1DOLA 1XXGA 4I7ZC 2A68C 4YIJA 1KNEA 4K5WA 2F4IA 1FGBD 3A7LA 3D4DA 3BZDB 4F87A 2ID0A 2R61A 1LT6D 3K5NA 1Y8NB 4G57A 3SHLA 1SEBD 4CKBA 3I4NB 1A2TA 1HTLD 5A35A 1HPCA 4J8QA 1Q3LA 3FDTA 4ZYSA 2BA0A 1CQFA 2PO4A 1NCVA 1G6ZA 1KABA 4C3JB 3NK9A 3K0YA 2PW5A 5NUCA 4C3HG 3CKIB 1CT1D 4C2MB 1EQVA 4KHZA 2Z8LA 1TWFB 1H9RA 4JBWA 4RGNA 2D62A 3VYTA 2M2LA 4KKUA 3NQIA 2K5WA 1I6VC 4KN7C 5I2XA 2ZXPA 3GV6A 2VXWA 3RLFA 1RODA 1EY9A 1Q1EA 5DM73 1ICWA 1HXYD 1TWGB 4MN3A 2QDBA 1U4RA 4Q0FA 2D9UA 3AB9A 4MHEA 1S5CD 5FK9C 4HMJA 4CGYB 1RTNA 1HA6A 2MGSA 2LKVA 3T53B 5I9PA 5DM63 3M4OB 1JR0D 1STYA 3PUZA 1B4OA 1H9SA 5KRUA 1PZID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTV A;  5T1I A;  2NZ1 D;  2JP1 A;  5COY A;  2RVL A;  1CA5 A;  1B50 A;  2HDM A;  2MJ8 A;  1RJT A;  1ML0 D;  2RSO A;  4CJ2 C;  2L9H A;  1G91 A;  3IFD A;  3H91 A;  5EQ0 A;  1ESR A;  1A15 A;  1HFN A;  1F9R A;  2FJ2 A;  1SSO A;  3P7J A;  2B2U A;  4RWS C;  5CBA E;  1DOM A;  3D6W A;  4NW2 A;  1EIH A;  3GV3 A;  1U4P A;  2KOL A;  3R93 A;  1AZQ A;  1X32 A;  1B2T A;  1EOT A;  1WTQ A;  1WTP A;  1QE6 A;  4OIK A;  4X3T A;  4XT1 B;  1NAP A;  1PFN A;  1CM9 A;  3SVM A;  1PDQ A;  2Q8R E;  1U4M A;  1WTR A;  1NR2 A;  1DOK A;  2R3Z A;  1SAP A;  5AFW A;  1LV9 A;  2FMM A;  2FHT A;  5EKI A;  4RAU C;  4CJ0 B;  4O42 A;  2RA4 A;  1PFB A;  2B2W C;  3TN2 A;  1Q3L A;  1G2S A;  3FDT A;  3MTS A;  2CVR A;  1WVL A;  4RA8 A;  1NCV A;  3QO2 A;  1G6Z A;  2JYO A;  1WD1 A;  2HCC A;  3I90 A;  2K05 A;  2L11 A;  2B2T C;  5E4W C;  4CJ1 B;  1X3P A;  2KEE A;  1F9P A;  5EPL A;  5JJZ A;  2X6L A;  4IUQ A;  2DY8 A;  4UAI A;  1WTW A;  1BNZ A;  1DON A;  2K1B A;  2KVM A;  4DN4 M;  4X3U A;  1PFM A;  2MPM A;  5EPJ A;  2BDN A;  1RTO A;  3KUP A;  1WTO A;  2K04 A;  5D65 A;  2N55 A;  2K03 A;  2B2W A;  3G7L A;  4ZKC B;  3IL8 A;  4HCS A;  1VMP A;  2K28 A;  1XYI A;  1QG7 A;  2H1E A;  4XDX A;  1E0B A;  3I3C A;  4OIJ A;  1AZP A;  4LMQ D;  4HSV A;  3LWE A;  2MP1 A;  2B2T A;  5EJW A;  4QUF A;  3ONA B;  2K01 A;  3KBX A;  1DZ1 A;  1O7Z A;  1O7Y A;  3MWY W;  2J7Z A;  1F9Q A;  3I8Z A;  4R8I A;  1EIG A;  1C8C A;  1J9O A;  4IUU A;  4X3K A;  1WTX A;  2M2L A;  2X69 A;  5CBE E;  4HAE A;  1CA6 A;  2HCI A;  1NR4 A;  1SDF A;  2DY7 A;  2FFK B;  1AP0 A;  1HUN A;  3I91 A;  1KNA A;  2EPB A;  3GV6 A;  4ZK9 B;  2VXW A;  1ROD A;  3F2U A;  5T1G A;  1IKL A;  5CMD A;  1EL0 A;  2EOT A;  1HHV A;  2HDL A;  2X6G A;  1X3Q A;  1QNK A;  3UI2 A;  3Q6S A;  2N88 A;  1JE4 A;  1HUM A;  1ICW A;  4MN3 A;  1BBX C;  4HED A;  1XX8 A;  1U4R A;  5DNF A;  1HRJ A;  1PLF A;  1TVX A;  2KED A;  2B2Y C;  2KUM A;  2D9U A;  1U4L A;  1HFG A;  2EE1 A;  4MHE A;  1EQT A;  2Q8T A;  4ZKB B;  5D14 A;  5EPK A;  1RHP A;  2B2V C;  2SDF A;  1JIC A;  1MSG A;  2HUG A;  1RTN A;  1MI2 A;  1F2L A;  4IUV A;  1J8I A;  1ILQ A;  1MGS A;  1ILP A;  2IL8 A;  1O80 A;  2NYZ D;  1GUW A;  1HA6 A;  3DEP A;  2L1B A;  2KEC A;  5COR A;  1IKM A;  1S4Z A;  2NWG A;  2FIN B;  2MGS A;  1BO0 A;  3DM1 A;  3FPU B;  1VMC A;  3HP3 A;  4QUC A;  1B3A A;  1IL8 A;  5E4X A;  2B2Y A;  1M8A A;  4IUT A;  4IUR A;  1ZXT A;  1DOL A;  2L12 A;  4U68 A;  4ZAI A;  2RSN A;  2L4N A;  2XIW A;  4XT3 B;  1MSH A;  4R9W A;  1G2T A;  1B53 A;  3N52 A;  4IUP A;  1WD0 A;  4X3S A;  2B2V A;  2B2U C;  3DEO A;  1B4O A;  1KNE A;  1F9S A;  1BF4 A;  4ZLT F;  3TZD A; 
#chains in the Genus database with same CATH topology
 3PGZ A;  4JK1 C;  1B50 A;  2RVL A;  5CV6 A;  1UUP A;  1EWH A;  4GNX A;  3E9I A;  2JSO A;  1H9M A;  3IAY A;  2F3I A;  3PUY A;  4LF6 Q;  3GO5 A;  1N32 Q;  5HGQ A;  1KLU D;  5IP9 G;  3J81 L;  1JJ2 A;  2BDO A;  3GTG B;  2EJF C;  4JPB W;  5FKA C;  2KHS A;  1BCP B;  1CSQ A;  1SE3 A;  4XYQ A;  4WJ4 A;  1TT2 A;  1TY2 A;  3SVM A;  4JI4 L;  5F2D A;  1TWH B;  1K0S A;  1Q86 C;  3PIO 3;  5FOB B;  5C44 H;  3OOC A;  5EKI A;  3C3L A;  4RKL A;  1E22 A;  2PNH A;  3CU7 A;  2I07 B;  2Z1C A;  1TWC B;  1FNV A;  3T4A C;  3K6O A;  4NXM Q;  1STH A;  4LUO A;  3TRZ A;  3K5O A;  3HZX A;  2K52 A;  4IUQ A;  4JV5 Q;  1I94 L;  4BBS H;  2KVM A;  3M85 A;  2J0T D;  3ND8 A;  1K3B C;  1WTH A;  5G3L F;  4DAV A;  1QG7 A;  3I72 A;  3KBG A;  4NP5 A;  1AZP A;  1ONL A;  1K8O A;  2EDG A;  4N8X 1;  3S15 B;  5CV9 A;  1IYJ B;  5M3M G;  4K8I A;  4R8I A;  1EU4 A;  4DR6 Q;  3TME A;  3K81 C;  4UDU C;  5EKK A;  1I4X A;  1ASZ A;  2G9D A;  3L0O A;  4LW1 A;  3L2P A;  3I91 A;  1VQI A;  1HUN A;  4ZK9 B;  1BOS A;  4HCE A;  4DK1 A;  2D5D A;  4L8J A;  1E3P A;  2EYO A;  1IBL Q;  4JI3 L;  2UXC L;  3PV0 A;  3CC7 A;  2B8F A;  1GHJ A;  1XPR A;  4HED A;  2EIF A;  2EQS A;  2HHH L;  2ENB A;  1FR3 A;  1LTB D;  3EIV A;  1HZB A;  3MXG A;  3JAM L;  1MGS A;  5A2Q E;  2NWG A;  2O2L D;  2Y0S B;  4QUC A;  3MFY A;  4A3G G;  3K80 C;  3RMH A;  2EXD A;  4RKB A;  2QKI C;  3KDF B;  3ITP A;  3PMF A;  4A93 G;  2VNU D;  3CME A;  1YNJ D;  1Q46 A;  1KHI A;  1FL0 A;  1SRO A;  4QF4 A;  1WTV A;  4Y52 H;  2EYF A;  4BY1 B;  2LMC B;  1XJV A;  3ULL A;  5EKL A;  1JC7 A;  5C3E G;  2JA7 H;  1Y8O B;  1YI2 A;  1BCP D;  2ZJR A;  4DR5 Q;  4EVO A;  3S1M H;  2RDG A;  2RDH A;  3H0G B;  2FJ2 A;  5IGE A;  2CW0 D;  2JA5 G;  2IHE A;  1UEB A;  3EJI A;  3GV3 A;  2I46 A;  2OQK A;  1B1Z A;  2PMZ B;  3P1H A;  3IFT A;  3LNN A;  3QG1 A;  4GOP B;  1AZQ A;  3PO2 H;  1YNJ C;  4FP5 D;  1WTP A;  4A3B H;  4JC0 A;  2VB2 X;  1H9K A;  3RZD B;  4DXG A;  3V2T A;  3VYU A;  1S5B D;  4HN7 A;  4X66 L;  2F52 A;  5BN5 A;  3J80 c;  4A3J H;  1BCP C;  5IWA Q;  1D1K A;  2RQX A;  4PZ7 A;  4CDD C;  3L9A X;  2KCC A;  2LSS A;  2CW0 C;  2OEO A;  3QO2 A;  4QJF A;  1OXV A;  1HCZ A;  2WV6 D;  1HNZ Q;  4AYB E;  1XNQ Q;  4GKJ L;  4FYD A;  2AQ2 B;  3TP5 A;  5IE8 A;  4ODG A;  2NVT B;  3CMA A;  4IFD J;  3PSI A;  1AFP A;  2B2W A;  4A3M G;  1RIP A;  4PMW A;  1PH2 A;  3BS1 A;  2VUM B;  3AYH B;  4OIJ A;  1V1Q A;  3HOX B;  2NN6 G;  3TEH B;  4Q5V A;  4DR7 L;  5TSS A;  4K8J A;  1NBW A;  4BA2 I;  2F4V Q;  4OWT B;  3T1Y L;  2MNA A;  2Q2U A;  3VA7 A;  1E2W A;  1I4G A;  1HHV A;  2GVA A;  4DV1 L;  1HUM A;  3NWT A;  3F2B A;  1BDO A;  4KMU C;  3A5Z B;  4GKK Q;  4GLX A;  1K83 H;  2XWJ B;  3M4Q A;  5M5W B;  3J7A F;  5FJ8 H;  1R9T H;  3I7F A;  1RHP A;  3HKS A;  1LLR D;  3GTO H;  1SND A;  2IL8 A;  1BBW A;  1L2F A;  2KEC A;  4B08 A;  3EBE A;  3DM1 A;  4RHR A;  1I6H H;  1HQM C;  1FJG L;  2OTJ A;  3EA6 A;  1M8A A;  4IUT A;  3KFU A;  5IP9 H;  1KTK A;  4DR1 Q;  3M3Y B;  1MSH A;  1V43 A;  1IW7 D;  4X3S A;  5IYC G;  1VQ6 A;  3HOZ G;  3K58 A;  1BF4 A;  1KDC A;  1STE A;  3PO3 B;  3QOJ A;  3PF4 A;  4K14 A;  2DJF C;  1OXX K;  3O13 A;  5DEH A;  4A3C G;  4NPS A;  1Z47 A;  3SK5 A;  1B7Y B;  1W3S A;  4G4K A;  2YU9 H;  3P7J A;  2WII B;  2QCP X;  2JA8 G;  1PH5 A;  1IW7 C;  2QA4 A;  5KYL A;  5LMN W;  1Q82 C;  1B2T A;  1WTQ A;  1JWS D;  5EBC A;  3KLW A;  1PDQ A;  3OMG A;  3RN5 A;  1GXD C;  4GOP C;  2OF1 A;  1DOK A;  1EQR A;  3A55 A;  1SAP A;  3D4R A;  2JA6 H;  4DAY A;  5FLX E;  3S17 H;  2QGQ A;  1PVO A;  1X54 A;  5FLX c;  1EY5 A;  3P20 A;  1TS2 A;  1QVG A;  2AKW B;  2D0P A;  5CR3 A;  1I3Q B;  4A3E H;  1HQR D;  4WJ3 M;  2L11 A;  3C1F A;  1X3P A;  1X3E A;  1F9P A;  1STA A;  5ELB A;  1BNZ A;  4J6H A;  4YCV A;  4A3D G;  1Y1W G;  3HOW B;  2JXM B;  5BN4 A;  4DV5 Q;  2DUD A;  4DK3 C;  5ISR A;  1E2Z A;  1Y14 B;  3M4Y A;  1LUZ A;  1CQV A;  4R4O A;  4RHS A;  4EQ5 A;  1VMP A;  1XYI A;  3S14 H;  2IPK D;  5AJ3 L;  2GVB A;  3OTO L;  2Z6K A;  2F3V A;  3MAQ A;  2MFI A;  5K5P A;  1EYA A;  4IPH A;  2F1M A;  4FXK C;  2EY5 A;  5ELO A;  3SE0 A;  3HKZ G;  4DNR B;  1M90 C;  5IIF A;  2CWP A;  4B3T Q;  2GA4 B;  1XMQ L;  1YJN A;  4JBJ A;  2CCZ A;  5CMD A;  4ME3 A;  3H15 A;  4A3G H;  3UI2 A;  2N3S A;  1XX8 A;  1JT8 A;  4AQY L;  2KUM A;  3MXP A;  4R1J A;  3QJY A;  1VQN A;  4ZKB B;  4B9X A;  1CI3 M;  5JJL A;  2IT1 A;  4IAL A;  2UXB L;  2WAC A;  3S9W A;  3A0J A;  3CRK C;  3KK7 A;  1LTG D;  5T1I A;  4R4C A;  2H4O A;  4FDB A;  2L4N A;  4R9W A;  2ICI A;  4FNF A;  2A73 B;  1XPO A;  1E1O A;  2ZM6 Q;  2R93 H;  1LAC A;  1CSP A;  2EYJ A;  3GD7 A;  4KD4 A;  3ERQ A;  2NVX B;  4ALP A;  4XIG S;  1DM0 B;  4DV4 Q;  3X3M A;  3R2I A;  3SXH A;  5I6W A;  4A75 A;  3T51 B;  4LJZ C;  1XTC D;  4HIO A;  2CH4 A;  4CKE A;  4JI1 Q;  4BS9 A;  4R8N A;  1QWY A;  2B63 B;  1HA5 A;  1ENA A;  4OIK A;  1GUG A;  1JOR A;  2CWA A;  4KI0 A;  1WTR A;  3D31 A;  4K2K A;  3VYR A;  3S16 H;  3CRL C;  3I4O A;  2I0Q A;  4KHP L;  4FF2 A;  1UE1 A;  5JEA H;  1DXM A;  2AUK A;  1LTL A;  2Y0S E;  2NN6 H;  4B3M L;  4DUZ Q;  1R4P B;  3J81 E;  1K8G A;  5JJZ A;  2IX3 A;  1O7L A;  1TWA B;  2K7V A;  2QDL A;  5D65 A;  3E0E A;  4B3S Q;  1D8L A;  1KAA A;  4ILW A;  4XDX A;  2VB3 X;  4HSV A;  2OT2 A;  2AMC B;  1EZ8 A;  2F0Q A;  4TSS A;  1EFW A;  1W6J A;  2WFW A;  1PZK D;  4NMZ A;  4N9T A;  4KK7 A;  2X69 A;  2ZXR A;  4HAE A;  1ESF A;  4KLK A;  3SDZ A;  2PMZ E;  4ID6 A;  5C3W A;  3TS0 A;  4OO1 H;  4JG2 A;  3PQI A;  3TZU A;  4ZRZ A;  3H3V I;  4TRD A;  4DV0 L;  5H1S E;  3K59 A;  4K0K Q;  2F0L A;  1IXR A;  2N88 A;  1JE4 A;  1I50 H;  5ELE A;  1WCM B;  3HOX H;  1D5M C;  1SLJ A;  1TVX A;  2XNA C;  5EAY A;  5CC4 A;  2PNR C;  5IYC H;  1TU2 B;  4HJ7 A;  4JI2 L;  3HOZ H;  4JI7 Q;  1I5F A;  1IYV A;  2D2C C;  1SYC A;  4HR7 B;  2OCE A;  3UDF A;  2QIL A;  3V05 A;  4X62 Q;  2LY7 A;  1SYE A;  1XTD A;  1SNM A;  4BBS G;  1PH9 A;  4A3C H;  2O5J C;  3S1N H;  1CA5 A;  1GD7 A;  1D1I A;  5HUR A;  2K50 A;  5C0X H;  1YJ9 A;  1SYG A;  1B8A A;  2UUC Q;  5I9O A;  4ZLT F;  1O7I A;  3NXW A;  2IWH A;  1VQO A;  3MXN B;  1LT5 D;  5COY A;  1X3F A;  4X64 L;  1L1O B;  2EJG C;  3JAM E;  1SR3 A;  3I56 A;  4OXP A;  1JB3 A;  1F9R A;  4BA1 I;  1QVF A;  4L6T B;  1A3V A;  3A56 A;  4ZUI A;  1LTI D;  4AYB B;  2N78 A;  1Y1W H;  2E5L Q;  4K2L A;  1PFN A;  4LF9 Q;  3SK6 A;  4LF8 L;  1SFO B;  1NR2 A;  3URY A;  5JAV A;  2SNS A;  3NP8 A;  3J80 i;  5M5X B;  5EBD A;  4GN5 A;  3L7Z C;  2UXD Q;  5J39 A;  2GN5 A;  4KY6 A;  1Q12 A;  3T56 B;  2EYM A;  3AMU A;  2M9V A;  2EZV A;  2L55 A;  4CJ1 B;  5IP7 G;  3BZC A;  4C3I G;  4JVZ A;  3CW2 C;  2K1B A;  1LO5 D;  4PMB A;  2ZJQ A;  4X3U A;  2V1C C;  1K8M A;  3S2H H;  1XMO L;  1VQE A;  4H02 A;  4C3H B;  1QUQ A;  3I3C A;  2E75 C;  4LMQ D;  1N34 L;  2EY2 A;  4RCO A;  4FXG C;  2O5I C;  5M5Y B;  2B2T A;  5EJW A;  3CP0 A;  3S1Q H;  2UU9 Q;  3X3N A;  4GN4 B;  4HMI A;  2F0U A;  2G5D A;  2Z4H A;  4IUU A;  2UUA Q;  3DLL A;  3CXC A;  3GTQ H;  3PUW A;  1CA6 A;  4Y7N B;  2Q2T A;  5LL6 X;  3CQZ B;  1NE3 A;  4FF4 A;  1LAB A;  1EY6 A;  2NUC A;  1A6X A;  2C5C A;  2VL6 A;  2VQF Q;  4B3R Q;  4RH6 A;  3PIP 3;  4HSP A;  2EYH A;  3T13 A;  3J7A 5;  4K5X A;  2E2D C;  3J7Y W;  4FO2 A;  4A3J G;  2VW9 A;  4A3L H;  1JQY D;  3WOE A;  4BBR B;  2NVQ H;  1KRT A;  3ND9 A;  2Q8T A;  1EQT A;  4P2C B;  3BYT B;  3KJO A;  2KEN A;  4NXM L;  2K33 A;  1PHJ A;  5CV5 A;  4JI6 Q;  2IY5 B;  4XQQ A;  4DR2 Q;  2A5H A;  3OPO A;  5C4X H;  2FIN B;  5M3F H;  4OX9 L;  3AFP A;  2BCO A;  2E2H B;  1P16 A;  1IL2 A;  3NTH A;  2XIW A;  1S5D D;  4XXE A;  1A2U A;  3NEM A;  3IRB A;  4KJN A;  3FPP A;  1U5K A;  3EN2 A;  1Q81 C;  4JOI C;  2NZ1 D;  3HOU B;  3TP8 A;  4C3J G;  4DR6 L;  4L5S A;  2F0V A;  3R2T A;  2LFN A;  2MJ8 A;  1RJT A;  1R4Q B;  2CHB D;  2F0W A;  3FVQ A;  3VR6 A;  1LT4 D;  5GAG C;  3ZJY C;  2PZT A;  3BU2 A;  1MJE A;  4MIU A;  3W2D A;  1BCP F;  1JE5 A;  3G6J B;  5CBA E;  3I4M B;  3CC4 A;  1L1O C;  1CHP D;  1VQP A;  3NSW A;  4H44 C;  3F2D A;  4GS3 A;  3CCL A;  1SN8 A;  1PH1 A;  3FEW X;  1DCZ A;  4YCW A;  1Q7Y C;  5E1F A;  4KY7 A;  2WKD A;  1EY0 A;  1VQK A;  1PMR A;  3NEL A;  2NVY H;  4DKA C;  5EGT A;  3I90 A;  1H95 A;  4IPD A;  5HGT A;  4AH6 A;  1AE3 A;  1IHZ A;  4EGV A;  2DY8 A;  4P73 A;  1EYG A;  3CD6 A;  3NPP A;  2K6A A;  1DGS A;  4A3I H;  2K5D A;  3CPW A;  2VQE Q;  1EWI A;  1PFM A;  2OWO A;  1AEX A;  3DHQ A;  1S72 A;  3KF6 A;  1N33 L;  3G7L A;  2A19 A;  1VQH A;  4QUF A;  3RZO H;  3G71 A;  1O7Y A;  4V0B A;  4NDX A;  4CDF C;  1YNN D;  3HRZ C;  4WFN 3;  1II3 A;  1Y1V B;  3ZYY X;  2XRS D;  3NTK A;  1CUK A;  3N6R A;  1LTT D;  1SE8 A;  5CBE E;  5I4D A;  1NR4 A;  3WDN A;  4DR4 Q;  2LS0 1;  1TS4 A;  2PZU A;  5M3M B;  3UE1 A;  2EYL A;  3FMC A;  2EPB A;  1C48 A;  5BR8 L;  5T1G A;  1M1K C;  2Z9H A;  4JCV E;  2DJG C;  2X6G A;  4XQJ A;  2PI2 E;  2B39 A;  1T5E A;  3BYY B;  2QF7 A;  2JA6 G;  1H9S B;  2B2Y C;  3T1H Q;  5E3F A;  1YNN C;  3M9B A;  1XNR L;  1SBB B;  4A3E G;  3GTP H;  4GNX B;  1HNZ L;  1SJH D;  4DV7 Q;  4NXN Q;  1XNQ L;  4DNT B;  1N9W A;  2RCN A;  3NBH A;  1B3A A;  2SEB D;  4JI5 Q;  2L12 A;  5ELF A;  3HOV H;  1KC8 C;  1WCM H;  4XT3 B;  1ZEQ X;  3KF6 B;  2B2V A;  2F0T A;  4PZ8 A;  5GQO A;  1Z9F A;  3NEN A;  3KLR A;  1GUO A;  2EXZ A;  2NTT A;  1I4H A;  3G48 A;  2R7F A;  2NZO A;  3TQY A;  4A93 B;  3M7N A;  4JYA Q;  2JP1 A;  1X3G A;  2J4X A;  4IPC A;  1EU3 A;  2LXJ A;  1YBY A;  3CCR A;  5FLM G;  3IFD A;  3K5L A;  3VR5 A;  1HNW L;  2JN4 A;  5C3E B;  4B9W A;  3F8T A;  2NB0 A;  2G9H D;  3R93 A;  1IBM Q;  3NWS A;  2PYK A;  1JOO A;  5IP7 H;  3CCM A;  5E7N A;  1EQQ A;  2JA5 B;  4C3I H;  1NAP A;  5L37 A;  3VA5 A;  2Q8R E;  1KQS A;  4YHH L;  2ZJP A;  4NB3 A;  2K32 A;  5CV4 A;  3M7G A;  2QW7 A;  4KV6 A;  3MTS A;  2TMP A;  1GHK A;  1GUT A;  2HCC A;  2ZXO A;  3Q22 A;  1TY0 A;  3HOY B;  5EPL A;  1JJC B;  3QR8 A;  4DR1 L;  5IGG A;  4UAI A;  3G4S A;  1PRT F;  4H7B A;  1O78 A;  3PF5 A;  3HGB A;  4TVA B;  2HIV A;  1SMY D;  3K7U C;  4K6D A;  4F88 A;  3K7A B;  5GAE C;  2BH2 A;  4LFC L;  1SFO H;  2R93 G;  4N8F A;  5IT9 L;  1VQ9 A;  2F0D A;  5C6A A;  4I7A A;  3JC6 6;  4OHJ A;  2YTV A;  4JI4 Q;  4A3M B;  1J9O A;  3VR3 A;  3OIP A;  2F0K A;  4DGZ A;  1G8Z D;  1CKM A;  4PMC A;  2A6H D;  5LHY 1;  4LF5 Q;  1XWE A;  2FFK B;  1AP0 A;  1SMY C;  1V8Q A;  2EOT A;  3I4N H;  1I94 Q;  3AFQ A;  2R7D A;  3Q6S A;  4BY7 B;  3OIQ A;  4JI8 Q;  1HRJ A;  2DNC A;  4LFB L;  2KED A;  4A3K B;  4MTN A;  1U4L A;  3U9S A;  3VDY A;  5JEA G;  4RG1 A;  5D14 A;  3H0G G;  4CDC C;  4QIW B;  2A6H C;  4EQN A;  5J3B A;  4QGU A;  4C3J H;  1RDP D;  1LTR D;  3CQZ H;  4F8M A;  4X65 L;  3LGJ A;  1BO0 A;  1Z6H A;  1V1O A;  3R3O A;  1PH8 A;  1I4Q A;  1Z7T A;  4RGT A;  4ZAI A;  4GNX C;  1VQ5 A;  4C2M H;  3GTL B;  1BBU A;  1PTO B;  1E24 A;  3N52 A;  3D6C A;  1TWF H;  3B6Y A;  3RN2 A;  3ER0 A;  4JI3 Q;  1YIJ A;  5C4H A;  1X56 A;  4ABN A;  3VYS A;  2RCF A;  4ME5 A;  2HHH Q;  3A5U A;  3H3V C;  1E7Z A;  1ML0 D;  5M9O A;  4CHT B;  3OHX C;  4OO1 G;  2K5V A;  1L0Y B;  3BZK A;  2B2U A;  3D8G A;  4XYO A;  2VUM G;  1VF7 A;  2R7Z B;  1G51 A;  3HOX G;  4DK0 A;  1TWG H;  1A63 A;  4ULL A;  5JJI A;  2JA8 B;  1PH4 A;  2DNE A;  1D7Q A;  5C4J B;  2AQ3 B;  4KN4 C;  1P8L A;  2PW7 A;  1D5X C;  1G2S A;  5IGB A;  3NTI A;  3EFX D;  3UDG A;  2K05 A;  2WAQ G;  2KEE A;  5DAU A;  3M4O H;  5C0X G;  5KND A;  2F0J A;  1JOK A;  3CCE A;  1STN A;  2H5X A;  1RTO A;  4Z9C B;  4A3D B;  1TKW B;  3HG9 A;  1K3R A;  2LXK A;  1E0B A;  2N49 A;  1KDB A;  3H6M A;  4IOA A;  4RFB A;  1AN8 A;  3KBX A;  3K57 A;  1A8V A;  2A74 C;  4RGO S;  3FKI B;  4C1N K;  2VY3 A;  3GTG H;  3HKZ B;  3PO3 G;  3S2D B;  1FGU A;  2ALY B;  1GM5 A;  1QNK A;  4DR3 L;  2K5H A;  1PA6 A;  1TWH H;  5CV7 A;  4YWK A;  4QL5 A;  1LT3 D;  1RD9 D;  3HFZ B;  4KD3 A;  2R92 B;  1TWC H;  1MSG A;  3MEF A;  1PTO D;  2E2I B;  4DR7 Q;  2F03 A;  5FO9 B;  1ILP A;  1OXT A;  3DEP A;  3I73 A;  1F2Y A;  3HP3 A;  5FLM H;  2E2J B;  3GTK B;  1T9H A;  3T1Y Q;  4B3S L;  1XPU A;  1EFI D;  4YWL A;  1GO3 E;  4DV6 Q;  1KRS A;  1WD0 A;  3S1R B;  4L5Q A;  5C5M A;  4YY3 L;  3GQB A;  4DV1 Q;  4A3F B;  4X6A H;  3D4W A;  1S3O A;  1PTO C;  1HJP A;  3S15 H;  4DAY B;  3RLO A;  4CJ2 C;  1C4Q A;  4LF7 L;  2L9H A;  1V1P A;  1PH3 A;  1VQ7 A;  3H91 A;  2ZTD A;  1HFN A;  1TS3 A;  1PV4 A;  4H0L C;  4IFD H;  1B3Q A;  2D0O A;  2F0M A;  2NBF A;  4K0K L;  4ZQ3 A;  3ICE A;  1BXT A;  1YVC A;  2KOL A;  1VQ8 A;  4DUY Q;  4IN3 A;  2YTY A;  2E8G A;  4A3L G;  5LMN L;  1SRU A;  1HR0 W;  1SYB A;  2JEA I;  3V96 A;  2FHT A;  3K5M A;  2F0O A;  2B2W C;  3C46 A;  1UE7 A;  2CVR A;  5C4X G;  5M3F G;  2XRQ D;  2OQ0 A;  1D2B A;  4NKL A;  5HY6 A;  2PQA A;  2DN8 A;  5IGF A;  4K6L A;  4PNY A;  5GRO A;  3AQQ A;  5JJK A;  1OO9 B;  2UUB L;  4HCS A;  3CC2 A;  3GTJ B;  2XSC A;  1E2V A;  4PV1 C;  4BY1 H;  1VDZ A;  4HIM A;  2ZT9 C;  3Q8D A;  3D3R A;  1DZ1 A;  3SK8 A;  4A76 A;  1CKN A;  2AQ1 B;  3H0G H;  2YYZ A;  1JMC A;  3T16 A;  3J81 c;  1EY8 A;  3CHB D;  5ELC A;  3CCQ A;  3PUX A;  4G7O C;  3RZD H;  4POG A;  1X3Q A;  5LL6 S;  1EIY B;  3J80 L;  3E3X A;  2KQ3 A;  1EY4 A;  1Q8I A;  2KCM A;  5AJ3 Q;  4LF4 Q;  5C44 B;  1IZ6 A;  3Q23 A;  1LM0 A;  1F2L A;  4A3I G;  2NVT H;  2EVB A;  3C2P A;  5D3D A;  2CQA A;  4DK6 C;  3OWE B;  3CPF A;  4R4T A;  4BBS B;  3ERS X;  3CCV A;  1ICF B;  1XMQ Q;  4OEM B;  4GZY C;  3UDI A;  5J22 A;  2VUM H;  3I55 A;  2NTS A;  1PYW D;  2F0G A;  4N9P A;  2UUA L;  4IZ8 A;  2WB1 B;  3AU7 A;  1BQQ T;  1EUJ A;  2RSO A;  1HZC A;  1TS5 A;  1SE2 A;  3R8B A;  1JWU D;  3OYY A;  5LMU Q;  2UXB Q;  1A15 A;  2ZTE A;  1EIH A;  1PTO H;  4UPA A;  4DV2 Q;  2F0N A;  4P72 A;  2KJX A;  4E6I A;  1SYF A;  3BVM A;  4JBK A;  4DPG A;  4HID A;  4JI0 L;  3DUZ A;  4CBV A;  1L0X B;  4K5V A;  4H13 C;  3W1B A;  1BUV T;  5M5W H;  1WJJ A;  4QIW E;  3A7A B;  1UAP A;  2E76 C;  4S3S A;  1JOQ A;  2PQE A;  2QEJ C;  4JI6 L;  2WIN B;  2RA4 A;  1PFB A;  1AE2 A;  3E0J A;  2NZH A;  3JAM c;  2B29 A;  3HOV G;  3BJU A;  2RHS B;  2Z6K C;  2R6G A;  1PYB A;  5E4W C;  3J7Z C;  1WCM G;  3A8I E;  1VQM A;  5JVH 3;  3M3Y H;  4DN4 M;  2BDN A;  3KUP A;  3DMU A;  4DAP A;  4DV3 L;  5K36 G;  1YEZ A;  1N36 L;  4ZKC B;  3PO3 H;  2F0P A;  3MEH A;  2RBM A;  1VCI A;  2AWN A;  1J5E L;  1IBK Q;  4IJH A;  3MZ5 A;  3TP7 A;  4DA2 A;  3RLN A;  1SNP A;  1EIG A;  1WTX A;  4OON A;  2NN6 I;  2JA7 B;  1KLG D;  1FNU A;  1SDF A;  4WOR A;  3S1M B;  4B3M Q;  1X65 A;  3BDL A;  4RMF A;  3OW7 A;  2HDL A;  3PO2 B;  1DD2 A;  1BBX C;  4A3B B;  4FVM A;  5IT9 E;  3ULJ A;  1Y8P B;  3FHW A;  5FLX L;  4A3J B;  1HNX Q;  1HR0 Q;  2SDF A;  5JOB A;  4UY8 C;  1I3Q H;  4LF6 L;  2HUG A;  1N32 L;  4IUV A;  1VQG A;  1O80 A;  4GLA C;  4P75 A;  2XTI A;  5EQ0 A;  4AYB G;  1SJE D;  3HOW H;  4OO1 I;  1EEI D;  5D3I B;  2IX0 A;  2RSN A;  1HZ9 A;  3ULP A;  4IUN A;  4TKO B;  1STB A;  1B53 A;  4G7Z C;  3MC0 B;  2IJ0 A;  4DV0 Q;  2ASB A;  3A8K E;  1NNX A;  2JQO A;  4CDE C;  3ERO A;  4JI2 Q;  2A6E D;  3QOL A;  4KTA A;  2I5H A;  4JV5 L;  5IY0 A;  3HKZ E;  1SSO A;  3PIO A;  1CZG A;  4V19 0;  3I4N G;  4FF3 A;  4BXX H;  1RCV D;  3DXJ C;  3KF8 A;  5C0X I;  4A3F H;  4X3T A;  1B70 B;  1PH7 A;  3CCJ A;  1SXT A;  1CFM A;  5JPN C;  1Y69 U;  2A6E C;  1QUQ B;  2OTL A;  1WFQ A;  1EZ6 A;  3GTM B;  1SYD A;  1K83 B;  4CJ0 B;  1KXL A;  4O42 A;  1GKH A;  1R9T B;  1RKN A;  2IHF A;  2XN9 C;  3GTO B;  4X64 Q;  4UHV A;  1WTW A;  1SNO A;  1IBL L;  1I6H B;  4LFA Q;  1U9R A;  5ELD A;  4BBR G;  2I5L X;  3U58 A;  1OXU A;  4PQX A;  2KBN A;  1KDA A;  2K04 A;  3HS0 C;  2Q8I B;  4G7H C;  3IL8 A;  1N8R C;  4YCU A;  2NVX H;  1JWM D;  1F2M A;  1J6Q A;  3MWY W;  2MUY A;  5KNC A;  4QB4 A;  1SNQ A;  2L0C A;  2YU9 B;  2K14 A;  4DNI A;  1KD1 C;  1KNA A;  2B63 H;  3SK4 A;  1K9M C;  3F2U A;  2L15 A;  1IKL A;  1LYL A;  3QB3 A;  2MO0 A;  3GTJ H;  1I4R A;  3P75 A;  4PZ6 A;  4FXD A;  2OXP A;  3KOJ A;  1XMO Q;  1HFG A;  2EE1 A;  2N8N A;  3OSO A;  5IYB G;  1N34 Q;  3I4M G;  2JA6 B;  3S17 B;  4WJW A;  1MBY A;  4DR5 L;  2KA7 A;  1GUS A;  2B8G A;  3CF5 A;  3W3A A;  1GJX A;  3KLS X;  1GUW A;  5CV8 A;  3MXU A;  4A3E B;  4R4Q A;  4XTC S;  1VMC A;  4ZUJ A;  2P5Z X;  2VZA A;  1IL8 A;  3LX0 A;  3E9H A;  4IUR A;  1ZXT A;  3OW2 A;  1A3T A;  1TWA H;  2KHJ A;  2YV5 A;  4U67 3;  1YIT A;  1STG A;  3NHH A;  4IUP A;  2BE5 D;  4LUZ A;  1HTP A;  3EQL C;  1YJW A;  1F9S A;  4DF7 A;  3S14 B;  5IWA L;  1B44 D;  3RD4 A;  1C0A A;  3NUC A;  2HDM A;  5JVG 3;  4LF5 L;  1NJI C;  1MD2 D;  1PFS A;  1WI5 A;  1ESR A;  1QOH A;  2BA1 A;  2AWO A;  4RWS C;  1SE4 A;  2IW3 A;  1WYD A;  3MFG A;  3WOF A;  3BVG A;  1NMF A;  2BE5 C;  1U4P A;  3F1Z A;  4JI8 L;  4OX9 Q;  3KDF A;  3E5S A;  1D6E C;  3GP7 A;  4A3G B;  1EY7 A;  2TSS A;  3BVZ A;  4F7X A;  1EYC A;  4J15 A;  4HJ8 A;  3A8J E;  1Y1V G;  5K36 H;  3AEV A;  4L5R C;  3I4L A;  5KGU A;  2F4V L;  2CQO A;  2K5Q A;  3D0F A;  1X9N A;  1PH6 A;  2WKC A;  1OXS C;  2B2T C;  1ENC A;  4GOP A;  1Q8K A;  5FO8 B;  4QMG A;  1QB5 D;  1U0L A;  4HJ5 A;  4GKK L;  3BDC A;  2K28 A;  5KEE A;  1EYD A;  2WB1 E;  2R93 B;  2MP1 A;  2DGY A;  3ONA B;  1HH2 P;  3LWU A;  4APV A;  1TII D;  1F9Q A;  3I8Z A;  1G29 1;  4IFD G;  3QIA A;  2A1A A;  4LNQ A;  2Q2I A;  2HQL A;  4C56 C;  4IOC A;  3NBH B;  4BWG B;  4POF A;  2DY7 A;  1FNW A;  1GUN A;  3J81 i;  3SGI A;  1F2Z A;  1PLF A;  1N33 Q;  4MTK A;  5M5X H;  2FMC A;  1IYU A;  4JW0 A;  3S16 B;  3FP9 A;  4O1N A;  3K0X A;  2Y0S G;  4OEL B;  2JEB I;  1PTO F;  1QZG A;  1S4Z A;  2V4D A;  3E6Z X;  5ELN A;  1PZJ D;  5GAH C;  4MZ9 A;  1T5X D;  2AHO B;  2XGT A;  1EIF A;  5IGC A;  3F2C A;  1G2T A;  3KJP A;  1JCK B;  5BR8 Q;  4BY1 G;  1S40 A;  4QCL A;  4C3H H;  2I5M X;  1CKO A;  5KIX A;  3J80 E;  5M5Y H;  3DM3 A;  1E1T A;  4P71 A;  2L5T A;  4CKC A;  3HOY G;  1XNR Q;  4HJ9 A;  2XVS A;  4KY5 A;  2HQE A;  4LAA A;  4Y7N H;  2BH8 A;  2ZTC A;  1K28 A;  1YZ6 A;  2HIX A;  5KNB A;  3D6W A;  4NW2 A;  4DV5 L;  3NBI A;  3KLS A;  1X32 A;  2RKS A;  3NQT A;  1PRT B;  1CM9 A;  4BBR H;  3A54 A;  1I50 B;  2UXC Q;  1U4M A;  4KKS A;  1A0I A;  1CK1 A;  2FMM A;  2WP8 J;  1VQ4 A;  5IYD G;  1W6K A;  2RHQ B;  1FD7 D;  3HOZ B;  1KL9 A;  4LWC A;  1D5Z C;  1AW7 A;  4B3T L;  2E2H H;  3JAM i;  4BY7 G;  4DV6 L;  1DON A;  4A3K G;  1HNW Q;  3S1N B;  2F0H A;  5G3L D;  1NTG A;  2WAQ B;  4DXF A;  3J7A V;  5I2Y A;  2K03 A;  1V9P A;  2H1E A;  3GTM H;  3NE5 B;  3HOU H;  2KCT A;  2IX1 A;  1CHQ D;  2K01 A;  4YHH Q;  2J7Z A;  4JBM A;  2MQH A;  5IOC A;  1C8C A;  4HTH A;  5IYB H;  3I4M H;  1UNS A;  3DWA A;  4DUY L;  3TP6 A;  5JEA J;  2Q2H A;  3L3O C;  1UEA B;  2BOS A;  1AH9 A;  3I2Z A;  4OGQ C;  3MA2 B;  4DFA A;  2ZM6 L;  1ZKO A;  1NUC A;  4KHV A;  2K4K A;  5DNF A;  5BN3 A;  3W1G A;  4KKT A;  1Y1W B;  2F3W A;  4LFC Q;  4EX5 A;  3MHB A;  1QJO A;  2B2V C;  4DV4 L;  4X66 Q;  2CH4 W;  1VQC A;  3H94 A;  2R7Z G;  1J8I A;  2PZW A;  2NYZ D;  1IKM A;  4JI1 L;  3G6E A;  5E4X A;  5C5L A;  1ET6 A;  4GKJ Q;  3Q24 A;  4IO9 A;  3DEO A;  3S2H B;  1H9J A;  1YHA A;  1Q1B A;  1QIL A;  4LFB Q;  1BR9 A;  4O0A A;  4XQN A;  2ICE C;  2F0S A;  3BG3 A;  1Y1V H;  3S1Q B;  1SMX A;  4DUZ L;  1TQO A;  3C1E A;  1PRT D;  3WWV A;  1G6P A;  5M3M H;  1TR5 A;  1K73 C;  3GTQ B;  2EY1 A;  3KYH C;  2JK8 A;  1DOM A;  1LTA D;  4X65 Q;  3HEJ A;  1EOT A;  3I70 A;  1C7Y A;  1KAW A;  2A69 D;  5KYI A;  4XT1 B;  3U4Z A;  3SEB A;  3BDO A;  1EWC A;  4LF4 L;  1CZW A;  3OWF A;  2RDF A;  5AFW A;  1SNC A;  5C0X J;  2NVQ B;  4RAU C;  2ATW A;  2O4X A;  3VR4 A;  3M4P A;  1VQA A;  1PRT C;  3TN2 A;  5IOD A;  3FKI G;  3PCO B;  3TBI B;  4RA8 A;  3PUV A;  1EOV A;  2E74 C;  3DWP A;  3HOW G;  5GAD C;  2JYO A;  1WD1 A;  1I4P A;  1K8A C;  2Z0S A;  1DYQ A;  2A69 C;  4QY7 A;  5C4X B;  4WRD A;  5M3F B;  3W5O A;  3H3V H;  1FJG Q;  1S5F D;  1WTO A;  1DJR D;  2R92 G;  4O2D A;  4I65 A;  4JI7 L;  4A93 H;  5DLQ E;  2PI2 A;  3FRP B;  2JE6 I;  1QCB D;  3H09 A;  2RF4 A;  1FYC A;  4KJO A;  4LK1 C;  4X62 L;  1QNU A;  5LMU L;  1VQL A;  4TQU S;  1M4V A;  4X3K A;  3UE0 A;  1A62 A;  2EY6 A;  3UDX A;  4DV2 L;  4BXX G;  5C3E H;  3IKJ A;  3STB D;  5A2Q L;  1JJG A;  1UE5 A;  1ZYR D;  4A4I A;  1CTM A;  2SNM A;  1ENF A;  4EQO A;  4A3F G;  1NY4 A;  2JA5 H;  4L63 B;  2UUC L;  5C3X A;  1F77 A;  1MHW C;  3RUZ A;  1W2B A;  3MVV A;  4ZCK A;  5J1Z A;  1JIC A;  2M00 A;  3STB C;  4J1M A;  2B3G A;  1VF5 C;  4M1U B;  1GVP A;  1ILQ A;  1ZYR C;  1V1P B;  2NVY B;  1VQD A;  2F0I A;  3CCU A;  2QEX A;  3HOY H;  1UE6 A;  2Z4I A;  3SR1 A;  2HD3 A;  4U68 A;  2E5L L;  3K7A H;  4M8A A;  4A3I B;  4LF9 L;  2F0E A;  4OWW B;  1RL2 A;  2B2U C;  1IBK L;  1GOZ A;  4DR3 Q;  4IPG A;  3TZD A;  4A3M H;  2UXD L;  3RZO B;  3OTO Q;  5IGD A;  1G91 A;  5IYD H;  1NSN S;  3A74 A;  3VR2 A;  5I6Y A;  2B63 G;  4LUV A;  2C9O A;  1B9M A;  2PQA B;  1X6O A;  5JPM C;  4FF1 A;  1YHB A;  4JOI A;  1QE6 A;  4BY7 H;  1PXU A;  2JA9 A;  1EEF D;  4A3K H;  5C4Z A;  1LTS D;  2VS1 A;  1HNX L;  1HR0 L;  4L5T A;  5FO7 B;  1B9N A;  2R3Z A;  2UU9 L;  1LV9 A;  3MXN A;  5CYU A;  4YY3 Q;  4YWM A;  4MNO A;  3TSS A;  4AQY Q;  2AUJ D;  1QVC A;  1L1O A;  1WVL A;  1FVI A;  2YTX A;  1CKN B;  3GTP B;  4UP9 A;  4HIK A;  4LF7 Q;  2PCF B;  3TS2 A;  4IFD I;  4EQP A;  2X6L A;  2VQF L;  2FXQ A;  4B3R L;  3GTL H;  3EVQ A;  2MHV A;  2KCN A;  2Z6B A;  3HOV B;  2MPM A;  5EPJ A;  1BKB A;  4RGM A;  2N55 A;  2MO1 A;  3K8A A;  4C1N I;  5C44 G;  1ET9 A;  1ASY A;  5LMN Q;  3OMC A;  4IJL A;  3LWE A;  2F0F A;  2EJM A;  1K0R A;  1O7Z A;  3PIP A;  4DR2 L;  1VQJ A;  3DWQ A;  4IQZ A;  2EYP A;  4RCN A;  3CCS A;  5CGK A;  2HCI A;  4HJA A;  3Q0A A;  1TXY A;  1C9O A;  2R7Z H;  1EL0 A;  2JA8 H;  2SOB A;  1A3U A;  2WB1 G;  2A68 D;  3RR5 A;  4C3I B;  2UUB Q;  3U50 C;  4OL7 A;  5C4J H;  1S5E D;  3U9O A;  3TDQ A;  2XWB B;  5EPK A;  1MI2 A;  3QWN A;  2PPB C;  4KHP Q;  4LFA L;  2L1B A;  4DU9 A;  5COR A;  1Q90 A;  3FPU B;  3S24 A;  2WAQ E;  2B2Y A;  1RF2 D;  1DOL A;  1XXG A;  4I7Z C;  2A68 C;  1VQF A;  4A3D H;  1OTC A;  2KHI A;  1YHQ A;  2JJQ A;  4YIJ A;  1KNE A;  4K5W A;  5IT9 c;  2F4I A;  1FGB D;  3A7L A;  3D4D A;  3BZD B;  4OWX B;  3FKI H;  3CAM A;  2CFM A;  4F87 A;  2ID0 A;  2R61 A;  2VQE L;  1LT6 D;  3K5N A;  3S2D H;  1Y8N B;  4G57 A;  3SHL A;  1SEB D;  2ES2 A;  3J81 j;  1HZA A;  4CKB A;  3I4N B;  1A2T A;  1VQB A;  1HTL D;  2JA7 G;  1PYS B;  2R92 H;  5A35 A;  1HPC A;  4J8Q A;  2E2I H;  1Q3L A;  4UP7 A;  3FDT A;  4ZYS A;  1X55 A;  2BA0 A;  1CQF A;  2PO4 A;  4DR4 L;  1NCV A;  1G6Z A;  1KAB A;  1JB7 A;  4C3J B;  3PO2 G;  2E2J H;  3NK9 A;  3GTK H;  4A3B G;  2CKZ B;  3K0Y A;  2PW5 A;  5NUC A;  4P74 A;  1VS0 A;  4C3H G;  3CKI B;  1CT1 D;  3S1R H;  1NMG A;  1MKH A;  4C2M B;  3T1H L;  1EQV A;  4R4I A;  4KHZ A;  1YNX A;  4UP8 A;  2Z8L A;  1TWF B;  4JI0 Q;  1H9R A;  4JBW A;  4RGN A;  4DV7 L;  4NXN L;  2D62 A;  3VYT A;  2M2L A;  4KKU A;  1UWV A;  3NQI A;  3RNU A;  2K5W A;  1I6V C;  4JI5 L;  4KN7 C;  5I2X A;  2ZXP A;  3GV6 A;  2VXW A;  3RLF A;  1ROD A;  1EY9 A;  1Q1E A;  5DM7 3;  1ICW A;  1HXY D;  1TWG B;  2C35 B;  2QDB A;  4MN3 A;  4PG3 A;  1U4R A;  4JYA L;  4DV3 Q;  4Q0F A;  1QZH A;  2D9U A;  1N36 Q;  1MJC A;  3AB9 A;  4MHE A;  4LF8 Q;  1S5C D;  5FK9 C;  4HMJ A;  4DAM A;  1MIU A;  4GLV B;  3U4V A;  1J5E Q;  4CGY B;  1RTN A;  1HA6 A;  2K5N A;  1BVS A;  2K75 A;  1KIX A;  1IBM L;  2MGS A;  2LKV A;  1L0W A;  3T53 B;  5I9P A;  5DM6 3;  2A8V A;  3M4O B;  4QQB X;  1JR0 D;  1STY A;  3KF8 B;  3HOU G;  1WOC A;  4AIM A;  5FJ8 G;  3PUZ A;  1B4O A;  1H9S A;  4GN3 B;  5KRU A;  2HT1 A;  1PZI D;  3TRE A;  3GDE A; 
#chains in the Genus database with same CATH homology
 4JK1 C;  1B50 A;  2RVL A;  5CV6 A;  1UUP A;  1EWH A;  2JSO A;  1H9M A;  3IAY A;  3PUY A;  3GO5 A;  3J81 L;  1KLU D;  2BDO A;  3GTG B;  2EJF C;  5FKA C;  2KHS A;  1BCP B;  4XYQ A;  1SE3 A;  1TT2 A;  1TY2 A;  3SVM A;  5F2D A;  1TWH B;  3PIO 3;  5FOB B;  3OOC A;  5EKI A;  3C3L A;  4RKL A;  3CU7 A;  2I07 B;  2Z1C A;  1TWC B;  1FNV A;  3T4A C;  3K6O A;  1STH A;  3K5O A;  3HZX A;  4IUQ A;  2KVM A;  3M85 A;  2J0T D;  3ND8 A;  5G3L F;  4DAV A;  1QG7 A;  3I72 A;  3KBG A;  4NP5 A;  1AZP A;  1ONL A;  1K8O A;  2EDG A;  3S15 B;  5CV9 A;  4R8I A;  4K8I A;  1EU4 A;  3TME A;  4UDU C;  5EKK A;  1I4X A;  1HUN A;  2G9D A;  3I91 A;  4ZK9 B;  1BOS A;  4HCE A;  4DK1 A;  2D5D A;  4L8J A;  2EYO A;  3PV0 A;  2B8F A;  1GHJ A;  4HED A;  2ENB A;  1FR3 A;  1LTB D;  3MXG A;  3JAM L;  1MGS A;  5A2Q E;  2NWG A;  2O2L D;  2Y0S B;  4QUC A;  3MFY A;  3RMH A;  4RKB A;  2QKI C;  3ITP A;  3PMF A;  2VNU D;  1YNJ D;  4QF4 A;  1WTV A;  2EYF A;  4BY1 B;  2LMC B;  5EKL A;  1JC7 A;  1Y8O B;  1BCP D;  4EVO A;  2RDG A;  2RDH A;  3H0G B;  2FJ2 A;  5IGE A;  2CW0 D;  3EJI A;  3GV3 A;  2I46 A;  1B1Z A;  2PMZ B;  3P1H A;  3IFT A;  3LNN A;  3QG1 A;  1AZQ A;  1YNJ C;  4FP5 D;  1WTP A;  2VB2 X;  1H9K A;  3RZD B;  4DXG A;  3V2T A;  3VYU A;  1S5B D;  4HN7 A;  5BN5 A;  1BCP C;  1D1K A;  2RQX A;  3L9A X;  2KCC A;  2CW0 C;  2OEO A;  3QO2 A;  1OXV A;  1HCZ A;  2WV6 D;  4FYD A;  2AQ2 B;  3TP5 A;  2NVT B;  4ODG A;  4IFD J;  1AFP A;  2B2W A;  4PMW A;  2VUM B;  3BS1 A;  4OIJ A;  3HOX B;  2NN6 G;  4Q5V A;  5TSS A;  4K8J A;  4BA2 I;  3VA7 A;  1E2W A;  1I4G A;  1HHV A;  1HUM A;  3NWT A;  1BDO A;  4KMU C;  2XWJ B;  5M5W B;  3J7A F;  1RHP A;  1LLR D;  1SND A;  2IL8 A;  2KEC A;  4B08 A;  4RHR A;  3DM1 A;  1HQM C;  3EA6 A;  1M8A A;  4IUT A;  1KTK A;  3M3Y B;  1MSH A;  1V43 A;  1IW7 D;  4X3S A;  3K58 A;  1BF4 A;  1KDC A;  1STE A;  3PO3 B;  3QOJ A;  4K14 A;  1OXX K;  3O13 A;  5DEH A;  1Z47 A;  3SK5 A;  4G4K A;  3P7J A;  2WII B;  2QCP X;  1IW7 C;  5KYL A;  1B2T A;  1WTQ A;  1JWS D;  5EBC A;  1PDQ A;  3OMG A;  1GXD C;  2OF1 A;  1DOK A;  3A55 A;  1SAP A;  3D4R A;  4DAY A;  5FLX E;  1EY5 A;  3P20 A;  1TS2 A;  5CR3 A;  1I3Q B;  1HQR D;  2L11 A;  3C1F A;  1X3P A;  1F9P A;  1STA A;  5ELB A;  1BNZ A;  4J6H A;  3HOW B;  2JXM B;  5BN4 A;  5ISR A;  1E2Z A;  3M4Y A;  1CQV A;  4RHS A;  1VMP A;  1XYI A;  2IPK D;  2F3V A;  3MAQ A;  5K5P A;  1EYA A;  2F1M A;  4FXK C;  2EY5 A;  3SE0 A;  4DNR B;  5IIF A;  2GA4 B;  5CMD A;  3UI2 A;  1XX8 A;  2KUM A;  3MXP A;  3QJY A;  4ZKB B;  4B9X A;  1CI3 M;  2IT1 A;  4IAL A;  2WAC A;  3S9W A;  3KK7 A;  3CRK C;  1LTG D;  5T1I A;  2H4O A;  2L4N A;  4R9W A;  2ICI A;  4FNF A;  2A73 B;  1LAC A;  2EYJ A;  3GD7 A;  4KD4 A;  3ERQ A;  2NVX B;  4XIG S;  1DM0 B;  3X3M A;  3R2I A;  3SXH A;  5I6W A;  3T51 B;  4LJZ C;  1XTC D;  4CKE A;  4BS9 A;  4R8N A;  1QWY A;  2B63 B;  1HA5 A;  1ENA A;  4OIK A;  1GUG A;  1JOR A;  4KI0 A;  1WTR A;  3D31 A;  4K2K A;  3VYR A;  3CRL C;  4FF2 A;  5JEA H;  1DXM A;  2AUK A;  2NN6 H;  1R4P B;  3J81 E;  5JJZ A;  2IX3 A;  1O7L A;  1TWA B;  2K7V A;  5D65 A;  1KAA A;  4ILW A;  4XDX A;  2VB3 X;  4HSV A;  2OT2 A;  1EZ8 A;  2F0Q A;  4TSS A;  1W6J A;  1PZK D;  4NMZ A;  4N9T A;  4KK7 A;  2X69 A;  2ZXR A;  4HAE A;  1ESF A;  3SDZ A;  4ID6 A;  5C3W A;  4OO1 H;  3TZU A;  4ZRZ A;  4TRD A;  3K59 A;  2F0L A;  2N88 A;  1JE4 A;  5ELE A;  1WCM B;  1D5M C;  1TVX A;  2XNA C;  5CC4 A;  2PNR C;  1IYV A;  1TU2 B;  2D2C C;  1SYC A;  4HR7 B;  2QIL A;  3V05 A;  2LY7 A;  1SYE A;  1SNM A;  2O5J C;  1CA5 A;  1D1I A;  5HUR A;  5C0X H;  1SYG A;  5I9O A;  4ZLT F;  3NXW A;  2IWH A;  1LT5 D;  5COY A;  2EJG C;  3JAM E;  1JB3 A;  1F9R A;  4BA1 I;  4L6T B;  1A3V A;  3A56 A;  4ZUI A;  1LTI D;  4AYB B;  4K2L A;  1PFN A;  3SK6 A;  1SFO B;  1NR2 A;  3URY A;  5JAV A;  2SNS A;  3NP8 A;  5M5X B;  5EBD A;  3L7Z C;  5J39 A;  4KY6 A;  1Q12 A;  3T56 B;  2EYM A;  3AMU A;  2M9V A;  2EZV A;  2L55 A;  4CJ1 B;  4C3I G;  2K1B A;  1LO5 D;  4PMB A;  4X3U A;  1K8M A;  4C3H B;  3I3C A;  2E75 C;  4LMQ D;  2EY2 A;  4RCO A;  4FXG C;  2O5I C;  5M5Y B;  2B2T A;  5EJW A;  3X3N A;  4HMI A;  2F0U A;  2Z4H A;  4IUU A;  3PUW A;  1CA6 A;  4Y7N B;  5LL6 X;  3CQZ B;  4FF4 A;  1LAB A;  1EY6 A;  2NUC A;  1A6X A;  2C5C A;  4RH6 A;  3PIP 3;  4HSP A;  2EYH A;  3T13 A;  4K5X A;  2E2D C;  3J7Y W;  4FO2 A;  1JQY D;  3WOE A;  4BBR B;  3ND9 A;  2Q8T A;  1EQT A;  4P2C B;  3BYT B;  2K33 A;  5CV5 A;  4XQQ A;  2A5H A;  3OPO A;  2FIN B;  2BCO A;  2E2H B;  3NTH A;  2XIW A;  1S5D D;  4XXE A;  1A2U A;  4KJN A;  3FPP A;  2NZ1 D;  3HOU B;  3TP8 A;  4C3J G;  2F0V A;  3R2T A;  2LFN A;  2MJ8 A;  1RJT A;  1R4Q B;  2CHB D;  2F0W A;  3FVQ A;  3VR6 A;  1LT4 D;  2PZT A;  4MIU A;  3W2D A;  1BCP F;  3G6J B;  5CBA E;  3I4M B;  1CHP D;  3NSW A;  4H44 C;  3FEW X;  1DCZ A;  5E1F A;  4KY7 A;  2WKD A;  1EY0 A;  1PMR A;  5EGT A;  3I90 A;  5HGT A;  1IHZ A;  4EGV A;  2DY8 A;  3NPP A;  2K6A A;  2K5D A;  1PFM A;  1AEX A;  3DHQ A;  3G7L A;  4QUF A;  1O7Y A;  4V0B A;  4NDX A;  1YNN D;  3HRZ C;  4WFN 3;  1II3 A;  1Y1V B;  3ZYY X;  2XRS D;  3NTK A;  3N6R A;  1LTT D;  5CBE E;  5I4D A;  1NR4 A;  3WDN A;  2LS0 1;  1TS4 A;  2PZU A;  5M3M B;  2EYL A;  3FMC A;  2EPB A;  1C48 A;  5T1G A;  2X6G A;  4XQJ A;  2B39 A;  1T5E A;  3BYY B;  2QF7 A;  1H9S B;  2B2Y C;  5E3F A;  1YNN C;  1SBB B;  1SJH D;  4DNT B;  3NBH A;  1B3A A;  2SEB D;  2L12 A;  5ELF A;  4XT3 B;  1ZEQ X;  2B2V A;  2F0T A;  3KLR A;  1GUO A;  2EXZ A;  2NTT A;  1I4H A;  4A93 B;  3M7N A;  2JP1 A;  2J4X A;  1EU3 A;  3IFD A;  3K5L A;  3VR5 A;  5C3E B;  4B9W A;  2NB0 A;  2G9H D;  3R93 A;  3NWS A;  2PYK A;  1JOO A;  2JA5 B;  1NAP A;  3VA5 A;  2Q8R E;  2K32 A;  5CV4 A;  3M7G A;  4KV6 A;  3MTS A;  2TMP A;  1GHK A;  1GUT A;  2HCC A;  2ZXO A;  3Q22 A;  1TY0 A;  3HOY B;  5EPL A;  5IGG A;  4UAI A;  1PRT F;  4H7B A;  1O78 A;  3HGB A;  1SMY D;  4K6D A;  4F88 A;  3K7A B;  5IT9 L;  2F0D A;  5C6A A;  4OHJ A;  4A3M B;  1J9O A;  3VR3 A;  3OIP A;  2F0K A;  4DGZ A;  1G8Z D;  4PMC A;  2A6H D;  5LHY 1;  1XWE A;  2FFK B;  1AP0 A;  1SMY C;  1V8Q A;  2EOT A;  3Q6S A;  4BY7 B;  3OIQ A;  1HRJ A;  2DNC A;  2KED A;  4A3K B;  1U4L A;  3U9S A;  5JEA G;  5D14 A;  4QIW B;  2A6H C;  4EQN A;  1RDP D;  1LTR D;  4F8M A;  1BO0 A;  1Z6H A;  1V1O A;  3R3O A;  1I4Q A;  4RGT A;  1Z7T A;  4ZAI A;  3GTL B;  1PTO B;  3N52 A;  3D6C A;  5C4H A;  4ABN A;  3VYS A;  4ME5 A;  3H3V C;  1ML0 D;  5M9O A;  4CHT B;  3OHX C;  4OO1 G;  1L0Y B;  2B2U A;  3D8G A;  4XYO A;  1VF7 A;  2R7Z B;  4DK0 A;  4ULL A;  2JA8 B;  2DNE A;  5C4J B;  2AQ3 B;  4KN4 C;  2PW7 A;  1D5X C;  1G2S A;  5IGB A;  3NTI A;  3EFX D;  2K05 A;  2KEE A;  5DAU A;  5C0X G;  5KND A;  2F0J A;  1JOK A;  1STN A;  4Z9C B;  1RTO A;  4A3D B;  1TKW B;  3HG9 A;  1E0B A;  1KDB A;  3H6M A;  4RFB A;  1AN8 A;  3KBX A;  3K57 A;  2A74 C;  4RGO S;  3FKI B;  4C1N K;  3HKZ B;  3S2D B;  1QNK A;  5CV7 A;  1LT3 D;  1RD9 D;  4KD3 A;  2R92 B;  1MSG A;  1PTO D;  2E2I B;  2F03 A;  5FO9 B;  1ILP A;  1OXT A;  3DEP A;  3I73 A;  1F2Y A;  3HP3 A;  2E2J B;  3GTK B;  1EFI D;  1WD0 A;  3S1R B;  5C5M A;  3GQB A;  4A3F B;  3D4W A;  1PTO C;  4CJ2 C;  1C4Q A;  2L9H A;  1V1P A;  3H91 A;  1HFN A;  1TS3 A;  4H0L C;  4IFD H;  2F0M A;  2NBF A;  4ZQ3 A;  1BXT A;  2KOL A;  4IN3 A;  1SYB A;  2JEA I;  3V96 A;  2FHT A;  3K5M A;  2F0O A;  2B2W C;  3C46 A;  2CVR A;  2XRQ D;  1D2B A;  4NKL A;  5IGF A;  2DN8 A;  4K6L A;  4PNY A;  1OO9 B;  4HCS A;  3GTJ B;  2XSC A;  1E2V A;  4PV1 C;  1VDZ A;  2ZT9 C;  3D3R A;  1DZ1 A;  3SK8 A;  2AQ1 B;  2YYZ A;  3T16 A;  1EY8 A;  3CHB D;  5ELC A;  3PUX A;  4G7O C;  1X3Q A;  5LL6 S;  3J80 L;  2KQ3 A;  1EY4 A;  1Q8I A;  5C44 B;  3Q23 A;  1F2L A;  2EVB A;  3C2P A;  5D3D A;  2CQA A;  3OWE B;  4BBS B;  4GZY C;  5J22 A;  2NTS A;  1PYW D;  2F0G A;  4N9P A;  4IZ8 A;  2WB1 B;  3AU7 A;  1BQQ T;  2RSO A;  1TS5 A;  1SE2 A;  3R8B A;  1JWU D;  1A15 A;  1EIH A;  1PTO H;  2F0N A;  2KJX A;  4E6I A;  1SYF A;  3BVM A;  3DUZ A;  4CBV A;  1L0X B;  4K5V A;  4H13 C;  1BUV T;  3A7A B;  1UAP A;  2E76 C;  4S3S A;  1JOQ A;  2PQE A;  2QEJ C;  2WIN B;  2RA4 A;  1PFB A;  3E0J A;  2R6G A;  5E4W C;  3A8I E;  5JVH 3;  4DN4 M;  2BDN A;  3KUP A;  3DMU A;  4DAP A;  5K36 G;  4ZKC B;  2F0P A;  3MEH A;  2RBM A;  1VCI A;  2AWN A;  3MZ5 A;  3TP7 A;  4DA2 A;  1SNP A;  1EIG A;  1WTX A;  2NN6 I;  2JA7 B;  1KLG D;  1FNU A;  1SDF A;  4WOR A;  3S1M B;  3BDL A;  3OW7 A;  2HDL A;  3PO2 B;  1DD2 A;  1BBX C;  4A3B B;  4FVM A;  5IT9 E;  1Y8P B;  5FLX L;  4A3J B;  2SDF A;  5JOB A;  2HUG A;  4IUV A;  1O80 A;  5EQ0 A;  1SJE D;  4OO1 I;  1EEI D;  5D3I B;  2IX0 A;  2RSN A;  4IUN A;  4TKO B;  1STB A;  1B53 A;  4G7Z C;  3MC0 B;  2IJ0 A;  3A8K E;  3ERO A;  2A6E D;  3QOL A;  4KTA A;  1SSO A;  1CZG A;  4V19 0;  4FF3 A;  1RCV D;  3DXJ C;  3KF8 A;  5C0X I;  4X3T A;  1SXT A;  1CFM A;  5JPN C;  1Y69 U;  2A6E C;  1EZ6 A;  3GTM B;  1SYD A;  1K83 B;  4CJ0 B;  4O42 A;  1R9T B;  1RKN A;  2XN9 C;  3GTO B;  1WTW A;  1SNO A;  1I6H B;  1U9R A;  5ELD A;  1OXU A;  4PQX A;  1KDA A;  2K04 A;  3HS0 C;  2Q8I B;  4G7H C;  3IL8 A;  1JWM D;  1F2M A;  3MWY W;  2MUY A;  5KNC A;  4QB4 A;  1SNQ A;  2L0C A;  2YU9 B;  1KNA A;  3SK4 A;  3F2U A;  3QB3 A;  1IKL A;  1I4R A;  3P75 A;  4FXD A;  2OXP A;  1HFG A;  2EE1 A;  3OSO A;  2JA6 B;  3S17 B;  4WJW A;  1MBY A;  2KA7 A;  1GUS A;  2B8G A;  3W3A A;  1GJX A;  3KLS X;  1GUW A;  5CV8 A;  3MXU A;  4A3E B;  4XTC S;  1VMC A;  4ZUJ A;  1IL8 A;  3LX0 A;  4IUR A;  1ZXT A;  1A3T A;  4U67 3;  1STG A;  3NHH A;  4IUP A;  2BE5 D;  1HTP A;  3EQL C;  1F9S A;  4DF7 A;  3S14 B;  1B44 D;  3RD4 A;  3NUC A;  2HDM A;  5JVG 3;  1MD2 D;  1ESR A;  1QOH A;  2BA1 A;  2AWO A;  4RWS C;  1SE4 A;  2IW3 A;  3MFG A;  3WOF A;  3BVG A;  2BE5 C;  1U4P A;  3E5S A;  1D6E C;  3GP7 A;  4A3G B;  1EY7 A;  2TSS A;  3BVZ A;  4F7X A;  1EYC A;  3A8J E;  5K36 H;  3I4L A;  5KGU A;  2K5Q A;  2WKC A;  1OXS C;  2B2T C;  1ENC A;  5FO8 B;  4QMG A;  1QB5 D;  3BDC A;  5KEE A;  2K28 A;  1EYD A;  2R93 B;  2MP1 A;  3ONA B;  3LWU A;  1TII D;  1F9Q A;  3I8Z A;  1G29 1;  4IFD G;  3QIA A;  4C56 C;  4BWG B;  2DY7 A;  1FNW A;  1GUN A;  1F2Z A;  1PLF A;  2FMC A;  1IYU A;  3S16 B;  4O1N A;  2JEB I;  1PTO F;  1S4Z A;  2V4D A;  3E6Z X;  1PZJ D;  1T5X D;  5IGC A;  1G2T A;  1JCK B;  4QCL A;  5KIX A;  3J80 E;  2L5T A;  4CKC A;  2XVS A;  4KY5 A;  2HQE A;  4LAA A;  5KNB A;  3D6W A;  4NW2 A;  3NBI A;  3KLS A;  1X32 A;  2RKS A;  3NQT A;  1PRT B;  1CM9 A;  3A54 A;  1I50 B;  1U4M A;  4KKS A;  1CK1 A;  2FMM A;  2WP8 J;  1W6K A;  1FD7 D;  3HOZ B;  1D5Z C;  1AW7 A;  1DON A;  3S1N B;  2F0H A;  5G3L D;  2WAQ B;  4DXF A;  3J7A V;  5I2Y A;  2K03 A;  2H1E A;  3NE5 B;  2IX1 A;  1CHQ D;  2K01 A;  2J7Z A;  5IOC A;  1C8C A;  4HTH A;  1UNS A;  3DWA A;  3TP6 A;  5JEA J;  3L3O C;  1UEA B;  2BOS A;  4OGQ C;  3MA2 B;  4DFA A;  1ZKO A;  1NUC A;  4KHV A;  5DNF A;  5BN3 A;  1Y1W B;  4KKT A;  2F3W A;  3MHB A;  1QJO A;  2B2V C;  3H94 A;  1J8I A;  2PZW A;  2NYZ D;  1IKM A;  5E4X A;  5C5L A;  1ET6 A;  3Q24 A;  3DEO A;  3S2H B;  1H9J A;  1Q1B A;  1QIL A;  1BR9 A;  4XQN A;  2ICE C;  2F0S A;  3BG3 A;  3S1Q B;  1TQO A;  3C1E A;  1PRT D;  1TR5 A;  3GTQ B;  2EY1 A;  1DOM A;  1LTA D;  3HEJ A;  1EOT A;  3I70 A;  2A69 D;  5KYI A;  4XT1 B;  3SEB A;  3BDO A;  1EWC A;  1CZW A;  3OWF A;  2RDF A;  5AFW A;  1SNC A;  5C0X J;  2NVQ B;  4RAU C;  2O4X A;  3VR4 A;  1PRT C;  3TN2 A;  5IOD A;  3TBI B;  4RA8 A;  3PUV A;  2E74 C;  3DWP A;  2JYO A;  1WD1 A;  1I4P A;  1DYQ A;  2A69 C;  5C4X B;  4WRD A;  5M3F B;  1S5F D;  1WTO A;  1DJR D;  4I65 A;  3FRP B;  2JE6 I;  1QCB D;  3H09 A;  1FYC A;  4KJO A;  4LK1 C;  1QNU A;  4TQU S;  1M4V A;  4X3K A;  2EY6 A;  3IKJ A;  5A2Q L;  1ZYR D;  1CTM A;  2SNM A;  1ENF A;  4EQO A;  4L63 B;  5C3X A;  1F77 A;  3RUZ A;  3MVV A;  5J1Z A;  1JIC A;  2M00 A;  4J1M A;  1VF5 C;  4M1U B;  1ILQ A;  1ZYR C;  1V1P B;  2NVY B;  2F0I A;  2Z4I A;  3SR1 A;  4U68 A;  4M8A A;  4A3I B;  2F0E A;  2B2U C;  1GOZ A;  3TZD A;  3RZO B;  5IGD A;  1G91 A;  1NSN S;  3VR2 A;  5I6Y A;  2C9O A;  1B9M A;  5JPM C;  4FF1 A;  1QE6 A;  1PXU A;  1EEF D;  5C4Z A;  1LTS D;  5FO7 B;  1B9N A;  2R3Z A;  1LV9 A;  3MXN A;  5CYU A;  3TSS A;  2AUJ D;  1WVL A;  3GTP B;  2PCF B;  4IFD I;  4EQP A;  2X6L A;  3EVQ A;  2MHV A;  2KCN A;  3HOV B;  2MPM A;  5EPJ A;  4RGM A;  2N55 A;  4C1N I;  1ET9 A;  3OMC A;  3LWE A;  2F0F A;  2EJM A;  1O7Z A;  3DWQ A;  4IQZ A;  2EYP A;  4RCN A;  5CGK A;  2HCI A;  3Q0A A;  1EL0 A;  2SOB A;  1A3U A;  2A68 D;  4C3I B;  4OL7 A;  1S5E D;  3U9O A;  3TDQ A;  2XWB B;  5EPK A;  1MI2 A;  3QWN A;  2PPB C;  2L1B A;  4DU9 A;  5COR A;  1Q90 A;  3FPU B;  2B2Y A;  1RF2 D;  1DOL A;  1XXG A;  4I7Z C;  2A68 C;  4YIJ A;  1KNE A;  4K5W A;  2F4I A;  1FGB D;  3A7L A;  3D4D A;  3BZD B;  4F87 A;  2ID0 A;  2R61 A;  1LT6 D;  3K5N A;  1Y8N B;  4G57 A;  3SHL A;  1SEB D;  4CKB A;  3I4N B;  1A2T A;  1HTL D;  5A35 A;  1HPC A;  4J8Q A;  1Q3L A;  3FDT A;  4ZYS A;  2BA0 A;  1CQF A;  2PO4 A;  1NCV A;  1G6Z A;  1KAB A;  4C3J B;  3NK9 A;  3K0Y A;  2PW5 A;  5NUC A;  4C3H G;  3CKI B;  1CT1 D;  4C2M B;  1EQV A;  4KHZ A;  2Z8L A;  1TWF B;  1H9R A;  4JBW A;  4RGN A;  2D62 A;  3VYT A;  2M2L A;  4KKU A;  3NQI A;  2K5W A;  1I6V C;  4KN7 C;  5I2X A;  2ZXP A;  3GV6 A;  2VXW A;  3RLF A;  1ROD A;  1EY9 A;  1Q1E A;  5DM7 3;  1ICW A;  1HXY D;  1TWG B;  4MN3 A;  2QDB A;  1U4R A;  4Q0F A;  2D9U A;  3AB9 A;  4MHE A;  1S5C D;  5FK9 C;  4HMJ A;  4CGY B;  1RTN A;  1HA6 A;  2MGS A;  2LKV A;  3T53 B;  5I9P A;  5DM6 3;  3M4O B;  1JR0 D;  1STY A;  3PUZ A;  1B4O A;  1H9S A;  5KRU A;  1PZI D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...