2B2VA

Crystal structure analysis of human chd1 chromodomains 1 and 2 bound to histone h3 resi 1-15 mek4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
175
structure length
175
Chain Sequence
EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
molecule keywords Chromodomain-helicase-DNA-binding protein 1
total genus 52
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2vA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2vA01
1G2TA 1HUMA 1QNKA 1DZ1A 1B4OA 2IL8A 3GV6A 1J8IA 1EL0A 4ZLTF 5EPLA 4IUTA 4X3TA 1A15A 5EQ0A 2B2VC 3DM1A 3Q6SA 2VXWA 1HUNA 2DY8A 1O7ZA 1KNAA 1U4LA 3D6WA 2CVRA 2MGSA 1WTVA 4ZKBB 1PLFA 2FINB 4HEDA 2BDNA 1XYIA 1B50A 4U68A 2B2VA 3ONAB 3SVMA 1CM9A 4IUPA 2NWGA 1ESRA 5T1GA 1SAPA 2N88A 2B2UA 3I90A 2B2WA 1PDQA 3I8ZA 1B2TA 2MP1A 1G2SA 2JP1A 4LMQD 5CMDA 2X6GA 4ZK9B 3I3CA 4IUUA 1EQTA 2B2UC 2K04A 2KOLA 5EKIA 1J9OA 2B2WC 1WD1A 2L12A 2KVMA 1LV9A 4ZAIA 2RA4A 1X3PA 1DOKA 2L4NA 4QUFA 1F9QA 1VMPA 2EOTA 1BF4A 5E4WC 1F9PA 1RTOA 4CJ1B 1DONA 3P7JA 4XT1B 1NR4A 1SSOA 2H1EA 3TN2A 1GUWA 2NYZD 4OIJA 2N55A 2HCCA 1NR2A 1PFNA 4XT3B 1HFNA 1KNEA 1AZQA 5CBEE 2KEDA 1IKMA 1CA5A 1WTXA 3LWEA 4RWSC 1WTWA 1EIHA 2FJ2A 1BO0A 4NW2A 2K1BA 3IFDA 2KEEA 4HCSA 4IUVA 2X6LA 2B2TC 3TZDA 2K05A 3DEOA 1IKLA 1NAPA 2HDLA 2B2YC 1WTQA 4R8IA 5D14A 1WVLA 1MSHA 4QUCA 2X69A 2FFKB 3KBXA 4IUQA 4X3SA 1ILPA 4RA8A 1WTPA 1HHVA 1HRJA 4MN3A 2DY7A 1BNZA 3MTSA 1DOLA 1X3QA 2K28A 3R93A 4CJ2C 3MWYW 2EE1A 2NZ1D 1RHPA 2B2YA 1JICA 1QG7A 2RSNA 1EOTA 5AFWA 2R3ZA 5E4XA 4IURA 4X3UA 2L11A 1IL8A 1B53A 1ICWA 4HSVA 1MI2A 5COYA 1U4MA 1AP0A 3I91A 2RSOA 1U4PA 2MJ8A 5D65A 3KUPA 2D9UA 4RAUC 2HDMA 1XX8A 2K01A 5DNFA 3FPUB 4O42A 1G91A 3DEPA 1F9SA 2J7ZA 1Q3LA 2EPBA 2FHTA 1ZXTA 4DN4M 2HUGA 2XIWA 3F2UA 4OIKA 1O80A 5CBAE 3HP3A 3FDTA 1CA6A 1E0BA 1F2LA 1SDFA 4MHEA 4XDXA 1C8CA 2B2TA 1EIGA 1PFBA 1S4ZA 1BBXC 2FMMA 1WD0A 4UAIA 5EPKA 1U4RA 1VMCA 3H91A 1TVXA 3UI2A 2KUMA 1HFGA 2HCIA 1DOMA 1F9RA 2L9HA 2M2LA 5JJZA 2SDFA 1B3AA 1JE4A 1O7YA 5CORA 1AZPA 3IL8A 1ILQA 1G6ZA 2L1BA 5T1IA 2Q8RE 2Q8TA 1QE6A 5EJWA 1M8AA 1RTNA 3G7LA 3GV3A 1RODA 4CJ0B 1MSGA 1HA6A 1PFMA 2JYOA 4X3KA 1WTRA 3N52A 4HAEA 2KECA 4R9WA 1WTOA 1ML0D 1NCVA 1X32A 3QO2A 2MPMA 5EPJA 2RVLA 1RJTA 1MGSA 2K03A 4ZKCB
chains in the Genus database with same CATH superfamily
4C2MB 3O13A 2CQOA 1JJGA 1MHWC 1HZAA 1U9RA 1DYQA 1PVOA 4KN4C 1WCMB 5C3EB 4HJAA 2H4OA 1ET6A 1X3GA 2D62A 5IGEA 2K5HA 2KCNA 2Z4IA 1TWCH 5M5XH 3CD6A 1BOSA 3KDFB 5C0XI 5TSSA 2PPBC 4GLVB 2OQKA 3H0GH 3TP7A 1HPCA 1EIFA 3M3YH 2K33A 1QUQA 3NBIA 2IHEA 3D0FA 1YJWA 4X62Q 3M4QA 1R9TB 2Q2HA 2Z6KA 1PH4A 2SNMA 1X3PA 1VMPA 1YJNA 5IY0A 4B3TQ 2F0OA 2R93G 1PZKD 2RHQB 1IBML 1DONA 4ZCKA 2AHOB 3W5OA 1HCZA 2PW5A 4FNFA 4P74A 2E74C 1PXUA 1X9NA 5IYBG 2NVQB 1Y1WH 1LUZA 2O5IC 1X54A 3NELA 2JK8A 2QW7A 3F2DA 2F0EA 4MTNA 1IKLA 3W1GA 1IYVA 4A3EB 3ND8A 1EY4A 4B3ML 2XRSD 4MN3A 3GTKB 1OO9B 1QZHA 2NN6G 2HIVA 3OTOQ 5HY6A 4HJ5A 4TRDA 3SEBA 3PO2H 2CFMA 2QKIC 4HSVA 4OO1H 3KF6A 3BYTB 3GTKH 2JA5B 2AMCB 4MZ9A 1PH9A 1O78A 3P75A 4DV5Q 2EY5A 2LS01 1D5ZC 2KHJA 2NB0A 4A3EH 1STBA 1M4VA 2BA0A 2N78A 2JA8G 3MA2B 4MTKA 1X65A 1S40A 1E0BA 4O1NA 1Q1BA 1JJ2A 3DMUA 5LHY1 4IFDI 3K7AH 3H91A 1I94Q 4RGNA 5ELCA 1D2BA 3CHBD 3CXCA 2JA7G 2WB1B 1EQQA 3GTMB 2XN9C 3I4LA 2E5LQ 4IFDH 3OTOL 1SFOH 4HTHA 4IUNA 1PH1A 5C6AA 2A6EC 3HOWG 1LO5D 4V190 4PNYA 2LSSA 3I72A 4K2LA 5C44G 1VQCA 3HOWB 1CZWA 4A3DH 4OEMB 1T9HA 4F88A 4DR4Q 4JI2L 3K5MA 4FXGC 4QQBX 4RHRA 4CDFC 4FO2A 2PZTA 1JOOA 3MVVA 2EDGA 5FJ8G 1S5BD 2XGTA 1YJ9A 3NWSA 1O7ZA 3EIVA 1RL2A 1WTVA 1QNUA 4HEDA 3W1BA 2ZM6L 1X55A 4IUPA 3I73A 3Q8DA 5JVG3 1B2TA 2JP1A 1EY9A 4LMQD 4CKCA 1STGA 3F2BA 2KOLA 2Z6BA 3OHXC 1HH2P 3DLLA 4JYAQ 5M5WH 1SSOA 2JN4A 3PV0A 2D2CC 3K0YA 5J22A 4A3EG 5GAEC 1E1TA 3RZDB 1KDAA 1BXTA 1GUTA 4RWSC 3SGIA 5CV5A 2KEEA 4QL5A 1N8RC 4B08A 4I7AA 2PNRC 1X56A 1II3A 3KBXA 4PZ8A 3U4ZA 1A2UA 1X3QA 3A54A 2K28A 3KOJA 4IFDG 5J39A 2B2YA 2RSNA 2MHVA 3KJOA 1VQAA 3HOYG 1EEFD 5M3MG 3VA5A 1H9MA 1VQJA 5JPMC 1A3VA 4MNOA 1HNZL 1F9SA 3EA6A 1Q3LA 1S5FD 1ZXTA 3SE0A 5FJ8H 3HP3A 2EJGC 1FL0A 1H95A 2FMMA 2A69C 5I4DA 5IOCA 4K8JA 3R8BA 1AZPA 3OW7A 5M3MB 5CORA 1Q82C 3HOYB 5CGKA 3AU7A 1JQYD 2SOBA 3MEFA 2CH4A 2ICIA 1GJXA 3BJUA 3D4DA 4JOIC 2LKVA 5IWAL 4H7BA 3NUCA 5KNDA 1PZID 2NVYB 3S16B 5C3WA 1B70B 4IJLA 1PA6A 1V1QA 1Q46A 2R7ZB 1XPUA 4GKKQ 1GUGA 5IE8A 1ET9A 3TP6A 2B39A 5IP7H 4HJ8A 1I3QH 1A3UA 1GO3E 1V8QA 4DV3Q 2R7ZH 4G57A 2VQEL 4U68A 3K8AA 5E7NA 4P73A 3NQIA 1QOHA 2NWGA 1SJHD 5ELOA 2YU9B 3I90A 2Z6KC 3I8ZA 3PO3B 2ZTDA 5IT9L 4BY7G 1GUOA 3GD7A 4A3BB 4A3IH 4QMGA 1GHKA 5M3MH 1CKNB 1L1OC 1STHA 4L5TA 2Y0SE 2N55A 4C3JH 1DXMA 2IX1A 1IBLL 1X3FA 4A3KH 2CW0C 1WTXA 1VQMA 1LT3D 2Q2IA 5KRUA 3CMEA 5JJLA 2DGYA 1MD2D 3TZDA 2AKWB 4PV1C 4R8IA 3S14H 1MBYA 4EQ5A 1DOLA 4CJ2C 1F2YA 5CV8A 5I6YA 1U5KA 5AFWA 5IODA 3FPPA 4YCWA 3E3XA 5GAHC 4DV0Q 4C56C 1LLRD 3I91A 4JK1C 1Z6HA 3FHWA 2XRQD 4RKBA 1L2FA 3HOZH 1OXVA 1CSQA 3X3NA 2ATWA 2EPBA 4KHPL 1GOZA 1PRTC 1XPOA 1OXXK 1CA6A 3URYA 3J80i 1F2LA 2EJFC 1BCPD 3TP8A 3RZDH 5M5YB 1OXUA 3T13A 3NE5B 2Z8LA 1VQNA 2L5TA 1U4RA 2BH8A 4A93B 2TMPA 5C0XG 1DOMA 3KF8A 3A8KE 3H6MA 4ZYSA 1XWEA 2NVTH 1B44D 1E1OA 5HGQA 1RKNA 2L55A 3HGBA 4KJOA 2A69D 3GTGH 1BBWA 5IGFA 5C5LA 3MZ5A 3CCQA 1GVPA 1Y8NB 4R9WA 4XYOA 4LF4L 1MGSA 3M85A 3NBHB 1HNWL 2KCMA 4C3HG 3PIOA 4PZ7A 1Q1EA 4OWTB 4OGQC 3AEVA 3J81E 1KNAA 4LF9Q 2VY3A 2K4KA 3HZXA 2NUCA 3SVMA 3K5LA 2GN5A 1LTRD 4PQXA 4ODGA 4A3DB 2A6HC 2OTJA 2Z0SA 3HOWH 1JOKA 4DUYL 5CMDA 1H9JA 4ZK9B 3LWUA 5EKKA 2KA7A 5NUCA 3E6ZX 2QILA 4JI5Q 1KXLA 1K8OA 5FOBB 1S72A 3K7AB 1K0SA 2KCTA 1PYBA 3TREA 3PUWA 3SDZA 5GQOA 1CUKA 3LWEA 3D4WA 3IFDA 3JAMi 3GTOH 3EBEA 1KHIA 4DK1A 1YNNC 2B2TC 2B2YC 4JI4L 4N9TA 3V96A 1LTAD 3G6JB 4PMWA 5M3FH 1HRJA 1SROA 5BR8Q 2VNUD 4KK7A 3R93A 3TQYA 1ZYRD 4IZ8A 5FO8B 1Q86C 1ZYRC 4JI3L 1ICWA 4DK0A 1MI2A 5LMUL 2Z1CA 2OEOA 1Q12A 2RSOA 4AYBG 5M9OA 3C1FA 3G71A 3I4NH 4BA2I 1G91A 4YHHQ 4OO1I 1PH3A 3KDFA 4L5RC 2UXDQ 3WOFA 2HUGA 2XIWA 2GVBA 1Y1WB 2OTLA 2G5DA 4KLKA 2O4XA 3VR3A 2UUBQ 4BBSG 5EPKA 4XQQA 1F2MA 2PMZB 4JBMA 1F9RA 1FD7D 1UE6A 3L7ZC 4OWXB 1BCPC 2Q8RE 3J81L 1QVGA 2A68C 5L37A 3BDLA 2WB1E 4A3MG 4DK3C 2A5HA 2JA6G 2A68D 3P1HA 1XTDA 3S1RB 2AUJD 4H44C 1RJTA 3H0GB 1PTOC 4DR5Q 5K36H 1LTSD 1I4XA 3S15H 1TWCB 3BZDB 4ZRZA 1RDPD 4JYAL 2WP8J 3QWNA 1QUQB 5CV7A 4DV4Q 2ENBA 4R4IA 3S1NH 2BCOA 5AJ3Q 2MGSA 2XVSA 4JV5Q 3H3VH 2R7FA 3HOZG 1JB3A 1HZBA 5JOBA 1O7LA 3EVQA 5EKLA 3UDIA 4B9WA 4A3BG 4R1JA 4GLXA 2DNCA 2AUKA 1VQHA 2N49A 3FKIG 3S17B 2R6GA 3H15A 4EGVA 4X66L 2B2WC 4K2KA 4JI6L 2CW0D 3I4MH 2NVTB 2PQEA 1TWFB 2ZXPA 1SYFA 3CRLC 3NTHA 4RG1A 1RTOA 1Q8KA 3PUXA 4CJ1B 2M00A 4DV6Q 4DV2Q 3TN2A 4LUVA 1FJGL 4A4IA 2IT1A 1AZQA 5CBEE 1BCPB 1STEA 2QEXA 1FJGQ 1BO0A 1EU4A 3MXNA 1E3PA 4NP5A 3OPOA 5IGGA 2E2HB 3SK4A 1STAA 2R7ZG 1B3QA 4DNIA 4IUQA 1ILPA 1HHVA 2VW9A 3HOZB 1G291 1RF2D 4QJFA 1EYCA 3MWYW 4FF2A 1TWAH 3GTPH 1ESFA 2UXCQ 3F1ZA 1EFWA 2WAQE 1C9OA 1AP0A 2YTXA 2IX3A 1HNZQ 2AQ3B 1U4PA 2F0PA 3HG9A 4JVZA 2ZTCA 4JG2A 2HDMA 4DV2L 1JR0D 3S24A 2J7ZA 1QILA 4EVOA 4DN4M 4V0BA 1SEBD 3A7LA 2Z9HA 1KQSA 5JEAH 1GKHA 1BBXC 4C1NI 1I4QA 1WD0A 4JV5L 3AFQA 5AJ3L 1Q90A 4B9XA 2K14A 3NENA 2Q2UA 2SDFA 4FXKC 4H13C 1R4PB 3NP8A 5E1FA 3PQIA 1NE3A 4POGA 2Q8TA 4A3IB 4BBSB 3DWQA 4GZYC 1N9WA 3D31A 1KIXA 3TRZA 1HXYD 1WTRA 1VQ7A 5BN3A 3QG1A 1B8AA 2NVXH 4ZUJA 3EN2A 3NQTA 1W2BA 2RVLA 3JC66 1JWSD 1Y8OB 2F0HA 3HOVH 2F0IA 2P5ZX 1HZ9A 2WIIB 3DUZA 1L0XB 2I5LX 3WWVA 4Y7NB 4A3JG 1SR3A 5GADC 1KAAA 1D5XC 4XIGS 1XMOQ 1SYCA 1SNDA 2EY6A 3H3VI 4ZKBB 2F4VQ 3ONAB 1SE2A 2CWAA 4BWGB 1YVCA 3J7AV 5T1GA 1PH5A 2N88A 4EQOA 1PTOH 3MXUA 1KAWA 2MP1A 1G2SA 1WTHA 1N36L 4LAAA 1YBYA 5K5PA 1PH6A 3M7GA 2LMCB 4HSPA 1B7YB 4QUFA 1DOKA 3HOYH 4DPGA 1UEAB 4BXXG 1EZ8A 3K5NA 3IAYA 1PFNA 2CH4W 4JI8L 5CV6A 1WTWA 2Y0SB 1EIHA 1FGUA 3MXGA 4WJWA 4P72A 2UUCQ 2X6LA 4A3DG 1Y14B 3WOEA 1HJPA 2FFKB 1JJCB 1V9PA 3OWEB 4WORA 4X3SA 4LF8L 2Q8IB 2LFNA 2DY7A 1JOQA 3HOXH 3MTSA 1PYSB 3KF6B 3BVZA 4LF8Q 3RLOA 2RDHA 3HEJA 1SYGA 2IX0A 5E4XA 4LF6L 1K28A 4KY6A 4RKLA 3CKIB 3CMAA 2WB1G 4TKOB 4LF5Q 4A3CG 2K01A 3FPUB 4UP7A 4LFAQ 4KHVA 4KD4A 1K8MA 2XWJB 4KTAA 3STBC 3RZOB 4FF4A 1DGSA 1PFBA 4PZ6A 2E2IH 3BVMA 1AN8A 4BY7B 5ELFA 1K8AC 2YV5A 2C5CA 1CKOA 3LGJA 4HCEA 1SRUA 1QZGA 2IW3A 4A3JH 4OO1G 2AWNA 4CJ0B 1MSGA 1PFMA 2JYOA 1LABA 1UNSA 3PUYA 1YITA 1WTOA 2B29A 1X32A 4RHSA 4XQJA 1CHPD 1E2ZA 4FDBA 5HGTA 1YZ6A 3S2DH 1C7YA 4WFN3 2PCFB 1PHJA 2F0FA 1QNKA 3OMGA 3CPWA 4UP8A 3PUVA 3J81c 2NN6I 1GM5A 3KLWA 1A15A 1KLUD 4FP5D 4C3JG 1ASYA 4LWCA 1ZEQX 3D6WA 3I4OA 1YI2A 2B63G 5JEAJ 4KI0A 3PCOB 4CKEA 4IOCA 3MC0B 4RCOA 3U9SA 5DM63 1ESRA 4M1UB 2B2UA 3OIQA 2B2WA 2KQ3A 1CQFA 2VS1A 4KV6A 1SMYC 3T51B 2J0TD 2K50A 4R4OA 4DR1L 1BDOA 3NXWA 3RN2A 4FF3A 1SFOB 1LV9A 2RDGA 4DR1Q 1IBKQ 1HR0W 1F9QA 3GTMH 5I2XA 1EEID 2UU9L 4B3RL 2L15A 2E2JB 3PMFA 1HR0L 1H9SB 2NYZD 4OIJA 2CQAA 1Y8PB 5EAYA 1CA5A 3SK8A 1K83B 4GN4B 1L1OA 4K5VA 5C4XH 1HTLD 1TWHB 4IPCA 2VB3X 4IUVA 1WFQA 1QVCA 3DEOA 3HRZC 4ME5A 4S3SA 4AIMA 1WVLA 4OWWB 3OYYA 1PH7A 2UUBL 1QWYA 3DWPA 4A3FB 1YNJD 1BNZA 2JA5H 1YNJC 1JICA 1QG7A 2HQLA 3PO2B 1NUCA 4DUZQ 2R3ZA 2JE6I 5IT9c 4TVAB 3E5SA 4GOPA 1V1OA 3H09A 4G7ZC 2JSOA 2PW7A 4KHZA 1LT6D 3KUPA 1BKBA 3D6CA 5DNFA 4JI3Q 4LFBL 1TS4A 5GAGC 3UDGA 4GKKL 3F2UA 1P16A 1AH9A 2NVQH 1C8CA 4LF5L 1I4HA 3ZJYC 1FGBD 2VQEQ 4F87A 1C0AA 4UAIA 5C4JH 2LY7A 4CGYB 5LL6S 3A56A 4IJHA 4HIKA 3BVGA 4B3SQ 2QEJC 1R9TH 2TSSA 4HAEA 3M3YB 4KD3A 1ML0D 1NCVA 1E7ZA 2XWBB 2PMZE 2B8FA 1DJRD 1SYBA 2EYMA 4E6IA 4RGMA 4IN3A 3D3RA 4C3IH 1PRTD 1TY0A 3Q23A 2IL8A 1NMGA 1I4RA 1UUPA 3J80E 4LNQA 5IGDA 1E2VA 3LNNA 2VUMG 3E9HA 3OMCA 5C3EH 1N36Q 5C44B 1XYIA 3MAQA 5FLMH 4Y52H 2E75C 4UPAA 4JI0Q 1I6HH 4JI6Q 4C2MH 4RGTA 1TS5A 3HOUG 1E2WA 1NBWA 5CR3A 1IBKL 4K14A 4DUZL 1HZCA 4IUUA 3L2PA 2F0LA 1J9OA 2L4NA 3UDFA 4JW0A 4DV0L 1A3TA 2IPKD 4LF7L 1EFID 3X3MA 4DV4L 1SNCA 3QB3A 2PYKA 2R92H 4UHVA 2YTYA 2WACA 3P20A 1B1ZA 4NW2A 4BY1H 3T53B 4XQNA 3BYYB 1LTTD 2K32A 2K05A 3NBHA 2SNSA 1WTPA 3TP5A 4K5XA 4JCVE 3NEMA 2ZXRA 4X6AH 3RLFA 3PIPA 2A19A 3QIAA 2JA8H 3T56B 5IIFA 5IT9E 1LACA 4IQZA 2B3GA 3G48A 2JA6H 5BN5A 2KENA 2MJ8A 4LF7Q 3HOUB 2RCFA 2EYHA 2M9VA 1N33L 3MFGA 3DEPA 4Q0FA 1K0RA 3G6EA 1A62A 1TWHH 1PMRA 1YHBA 5C4XB 4C3IG 3M4OH 1AE2A 1SJED 3K7UC 5JJIA 3K81C 1WOCA 3A5ZB 2ASBA 2JA7B 1XNRL 5KNBA 2L0CA 3I2ZA 2QA4A 2O5JC 5JJKA 1KD1C 4KKSA 1M8AA 3GV3A 5FO9B 2MNAA 4DAVA 3KLSX 2IJ0A 3CF5A 2WKCA 4GN3B 2ZJPA 4K6DA 1IYUA 3IKJA 4H02A 1H9KA 2JXMB 4X64Q 3V2TA 1XXGA 1EL0A 4QIWB 1ENFA 5EQ0A 1JMCA 2FMCA 2VXWA 5IYBH 1ONLA 4KJNA 5J3BA 1PLFA 4IOAA 4BY1G 2HIXA 3A55A 1SE3A 4AYBE 4LFAL 3S2DB 4IPGA 1I50H 1P8LA 1N32Q 1JE5A 2UXBL 4A3GG 1I4PA 3I4MG 1H9RA 3NHHA 1KL9A 1LT4D 1D7QA 2X6GA 1SMXA 1BBUA 3MEHA 1TY2A 4A3JB 1S5CD 1A2TA 3OWFA 1STYA 2R92G 2PNHA 4C3HH 4J1MA 3CRKC 3BZCA 4H0LC 1JWMD 1GUWA 3GTLH 1B9NA 2MO1A 2EY1A 4A3MH 2B63H 4O0AA 2FJ2A 4B3MQ 1CK1A 3RZOH 1A63A 2KHIA 1VQGA 3HKZB 1QVFA 2UU9Q 5IP9H 1XNRQ 2PQAA 2A1AA 3SK5A 4JI7Q 4G4KA 2RQXA 4GNXC 1NY4A 1Z9FA 4KY5A 1IXRA 4UP9A 4DAMA 3FRPB 3UDXA 4BS9A 1RHPA 4HIDA 4ALPA 4UY8C 4LUOA 1EIYB 2HHHL 1EOTA 2AWOA 3EFXD 3K5OA 3S9WA 4Z9CB 4EQNA 2L11A 3S2HH 2KCCA 4RGOS 4DAPA 2JQOA 4WRDA 4B3RQ 2H5XA 3G4SA 1LTID 3Q0AA 4J6HA 2FHTA 1YNXA 5C4HA 3NWTA 1Q7YC 1UE7A 1WI5A 4MHEA 3CCJA 4GOPB 4A3MB 2DJGC 2OT2A 3IFTA 5IYCH 1DD2A 2NTTA 2L9HA 2UXDL 1B3AA 1JE4A 3V05A 4DXFA 1ILQA 3GTJH 3HFZB 2PI2E 5T1IA 2F03A 2OWOA 5EBDA 2R61A 3WDNA 4U673 2AQ1B 1VS0A 4DV3L 1QCBD 4OONA 2K5NA 5I6WA 4XXEA 2LXJA 3NTIA 4JBWA 3BG3A 4X65L 1I50B 4ZKCB 3T1YL 1IHZA 1K73C 2OCEA 4JI5L 1J8IA 3J7AF 3FVQA 1SYEA 4J8QA 5A35A 2NN6H 1HUNA 2K75A 3KLSA 3TZUA 1U4LA 5ELNA 3RN5A 2CVRA 1FNUA 3KF8B 3OOCA 1SNQA 2MFIA 3QJYA 3K6OA 1IW7C 1WJJA 3HOVB 1PRTF 2RCNA 4NXNQ 1ENCA 4DA2A 4EQPA 2PO4A 2NVXB 5DM73 4NXNL 3VYTA 5JEAG 3PF4A 3RR5A 2F52A 5CV4A 4OL7A 3L9AX 4ZAIA 1MJCA 4GKJL 1SE4A 2KHSA 1TQOA 3VYRA 4GOPC 4A3LH 1K9MC 2I5MX 2QF7A 4DUYQ 1L1OB 1STNA 4XT1B 4R4QA 2EIFA 2VUMH 4DR6L 2VB2X 4HN7A 1MJEA 2PZUA 2Y0SG 2F0UA 3HOXG 4CDDC 5IGCA 3M4OB 1YIJA 4LF4Q 4OHJA 1SYDA 4FXDA 3GDEA 4DV6L 5D14A 2BDOA 1TR5A 1ASZA 4WJ3M 4RA8A 1VCIA 2RKSA 3SR1A 5D3IB 3FKIH 4R4CA 4NDXA 3S1MB 2IY5B 3GTQB 2JEAI 3AYHB 3IRBA 3GTPB 4YY3L 2IHFA 1U4MA 3H94A 4GN5A 2F4VL 4DR2L 1HA5A 3M4PA 4CKBA 3EJIA 5C4ZA 1BQQT 5DAUA 3TSSA 1D8LA 3SK6A 3PGZA 4BY1B 1A0IA 2N8NA 5G3LF 1EY5A 2OXPA 4YCVA 1RIPA 2MUYA 4PMCA 1EWCA 1VMCA 3S1QH 1SNOA 4YHHL 2F0TA 4BXXH 1G6ZA 2JA9A 2L1BA 3CCUA 1M1KC 4NXMQ 2ID0A 5CYUA 1WYDA 3EQLC 4DR3Q 1NTGA 4CDCC 4EX5A 2WAQG 5GROA 1EY0A 5FKAC 4DR3L 4CBVA 1EYGA 1JB7A 2K03A 3A7AB 4A75A 2EVBA 1CQVA 1CSPA 3UE0A 1D1IA 2CKZB 1LM0A 1ICFB 4RCNA 4JI2Q 4LW1A 4PMBA 3S1NB 3BDCA 3ND9A 5C0XJ 3U4VA 1G51A 2EJMA 4N8FA 4DAYB 3JAML 2F0NA 3S15B 4C3IB 3R2TA 4UDUC 1QB5D 1T5EA 1BCPF 1HTPA 3AMUA 1GD7A 1AW7A 3NK9A 1M90C 3I56A 4DK6C 5J1ZA 2A8VA 2F3IA 4DR2Q 2NTSA 2R93H 1VQPA 3I3CA 1EQTA 2B2UC 2BH2A 2UUAL 2ES2A 2K5DA 3AQQA 4YY3Q 3HOVG 2L12A 2KVMA 1D6EC 4HIOA 1YNND 5ELEA 3HKZE 5E4WC 3T4AC 1RCVD 1Y1VH 1GHJA 3FMCA 4LF9L 1EUJA 4K0KQ 1K3BC 2K1BA 2A6HD 1HNWQ 3I4NB 3C3LA 1H9SA 4DR6Q 2I5HA 2DN8A 1CTMA 2QGQA 4N9PA 3L0OA 3CCEA 5E3FA 1XMQL 3S1MH 2BA1A 2E5LL 3SHLA 3FKIB 5KNCA 2MQHA 5I2YA 2MO0A 4I65A 5A2QE 1VF7A 1NSNS 5M3FB 4QCLA 4DU9A 3RLNA 5CC4A 1X3EA 4IPDA 3GTOB 4KN7C 1K83H 2B2TA 4GS3A 4NPSA 1SN8A 4KHPQ 2VUMB 4P2CB 3TBIB 1N34L 4R4TA 2WKDA 1AFPA 1NMFA 2BE5C 1VQ9A 4QF4A 3QOLA 3B6YA 3IL8A 3K0XA 1KDBA 4DF7A 3T1HQ 3T1YQ 1RTNA 3FEWX 2I07B 1UE5A 3A8JE 4JPBW 2MPMA 1R4QB 3HKZG 4AH6A 2ZJRA 4APVA 1EZ6A 4K5WA 1S3OA 4CDEC 1FYCA 3GV6A 5JAVA 5EPLA 2B2VC 1HR0Q 3DM1A 3Q6SA 1SNMA 3KLRA 2WFWA 4Q5VA 1VQDA 2BDNA 4X62L 4G7OC 1Z47A 2ICEC 1XNQQ 1XTCD 4IFDJ 4AYBB 1XMOL 2IWHA 4F8MA 1I5FA 4DAYA 3T16A 3H3VC 4NKLA 2B8GA 5IGBA 3GTGB 1Y1VG 1PH8A 4A3GB 1LYLA 4KMUC 1FR3A 2HT1A 4J15A 2EYLA 2EOTA 3PO2G 2VZAA 3MXNB 3GO5A 4HJ9A 1F2ZA 1U0LA 1NR4A 3CC7A 4A93H 4BY7H 2EYFA 2G9HD 4DV1Q 2PQAB 3BDOA 1KNEA 4TSSA 1W6JA 1LTGD 2ZJQA 2E8GA 3JAMc 4LFCQ 1NAPA 4GNXB 1MSHA 3GP7A 3ZYYX 3JAME 4OX9Q 1IBLQ 4JI4Q 1PH2A 1VQEA 2NZ1D 1PTOF 3PF5A 2CHBD 1A8VA 4IURA 4X3UA 4L8JA 1C4QA 5FK9C 2EY2A 4ID6A 5ELDA 2CWPA 1SXTA 5K36G 3ICEA 2HD3A 2F0JA 1PRTB 2B63B 3R3OA 4C3JB 5H1SE 1EY7A 4XTCS 1SNPA 3OIPA 2KUMA 1HFGA 5M3FG 2K5VA 1O7YA 3OSOA 1Y69U 4LF6Q 4A3BH 5DLQE 1VQ4A 4A3GH 1KDCA 3Q22A 4DKAC 4DV7Q 1BR9A 3CC2A 3KBGA 3KJPA 1YHQA 1GUNA 4ILWA 3A8IE 2F0KA 2YU9H 3NPPA 3E9IA 1UE1A 1OXSC 1G2TA 1HUMA 4B3SL 1UEBA 4LUZA 2K52A 4ME3A 3J80L 2JA5G 2I46A 1I3QB 3ULLA 2QDLA 3CP0A 1B50A 2FINB 3E0JA 3BS1A 4K8IA 3LX0A 1CM9A 4Y7NH 4L5SA 1SAPA 5KIXA 1MIUA 1N33Q 3J80c 3CU7A 2D5DA 1TS3A 2LXKA 1HNXQ 1OXTA 5EKIA 1WD1A 4DR5L 1RD9D 4BBSH 2F4IA 5I9OA 4F7XA 1BF4A 1IZ6A 5LMUQ 4JBKA 2JA7H 5IP9G 2FXQA 4DR7Q 4XT3B 3D8GA 2KEDA 4L6TB 1JCKB 2N3SA 4O2DA 1QJOA 5BR8L 5FLXL 2NZHA 2EQSA 3BZKA 1E24A 2HDLA 2HHHQ 1VQFA 3HOUH 1GXDC 4FF1A 4JC0A 4ZQ3A 3AFPA 1HNXL 3T1HL 4CHTB 2WAQB 2JA8B 2K5WA 4GNXA 1L0YB 1BVSA 1K3RA 2D0OA 4ULLA 1IL8A 1TWAB 1EOVA 1AE3A 3NSWA 2QCPX 4NMZA 3PIO3 3SXHA 4DXGA 2E76C 4JI1L 2GA4B 1EWHA 3ULJA 3KK7A 3MHBA 3UE1A 5IYDH 2E2HH 5C0XH 5CBAE 2BE5D 5IP7G 4BA1I 5JVH3 3CCMA 1EYDA 1CKNA 2ZTEA 5EBCA 4AQYQ 1Y1VB 2C35B 1VQKA 1TVXA 4YIJA 3UI2A 5M5WB 1CZGA 1C48A 2NZOA 3NTKA 1ENAA 3CAMA 2EZVA 4DR4L 3I7FA 3TMEA 3VDYA 1HA6A 3N52A 2R93B 1J5EQ 5KGUA 3QO2A 1EY8A 2I0QA 2F0WA 2PI2A 4M8AA 4L63B 1I6HB 1B4OA 3PSIA 5IWAQ 1E22A 4X64L 5C44H 1YEZA 3RD4A 4X3TA 1IL2A 4YCUA 3TDQA 2DY8A 5C3XA 2ZXOA 2KBNA 1KABA 1LT5D 5D3DA 2A6ED 1KLGD 2UUAQ 3TEHB 3GQBA 3K80C 1EYAA 1PZJD 1VF5C 3W3AA 5C3EG 2F0DA 2QDBA 4A3LG 3S1RH 4DFAA 4GKJQ 2F3VA 2F0SA 2XTIA 2RBMA 4OXPA 1ZKOA 4K6LA 1DCZA 3U58A 1F9PA 4KKTA 5C4JB 3S1QB 2H1EA 2R7DA 2XSCA 3K58A 1FVIA 4LJZC 3TS0A 4QB4A 1JWUD 3J7YW 4HCSA 2J4XA 3M7NA 3R2IA 2VL6A 1WTQA 3ER0A 2EYPA 2YTVA 1LTBD 4TQUS 3VR4A 1UAPA 3VYUA 1D1KA 2EE1A 3GTQH 3I4NG 4RFBA 4B3TL 1B53A 3A5UA 2OQ0A 5D65A 4A3FH 3C2PA 2D9UA 3VR5A 4O42A 5I9PA 3DM3A 1XPRA 1KC8C 3D4RA 1B9MA 2E2DC 1JT8A 1Q8IA 1EIGA 1VQIA 3CCSA 2WINB 5FO7B 4C1NK 2E2JH 2JJQA 2HCIA 4HJ7A 4ZUIA 3STBD 1EQVA 2ZM6Q 1CKMA 3VA7A 1KTKA 2SEBD 3E0EA 3C1EA 2EXDA 4DR7L 5G3LD 1CFMA 3VR2A 1IYJB 4X3KA 2K6AA 4HR7B 4I7ZC 2DUDA 1VQBA 1CI3M 5KYLA 1O7IA 2WV6D 1I94L 1V1PA 2GVAA 2V1CC 3PIP3 1J6QA 4HIMA 1NNXA 4R8NA 4FYDA 3J7A5 3J81i 5M5XB 1IW7D 4DV7L 2RDFA 1L0WA 1MKHA 1J5EL 2G9DA 4DNTB 1WCMH 5KEEA 3M4YA 1TT2A 3RUZA 3N6RA 2Z4HA 1S5DD 2EYOA 5KYIA 4QY7A 4JBJA 1V43A 3AB9A 1TXYA 1W3SA 1EQRA 3KFUA 1VQ6A 1KRSA 5LMNL 4QIWE 3HKSA 2ZT9C 4N8X1 1D5MC 1VQLA 4HMIA 1A6XA 3A0JA 1HQMC 3GTJB 5EGTA 3BU2A 3QOJA 4DV5L 4LK1C 3HS0C 3MXPA 2HCCA 2Q2TA 4IALA 2E2IB 5M5YH 1TWGH 5HURA 3L3OC 1V1PB 3J7ZC 3ERQA 1IBMQ 5LMNW 4A3KG 3FP9A 4KKUA 4YWLA 3DWAA 3EROA 2D0PA 3ERSX 2F0GA 2A74C 5JPNC 3S2HB 2F3WA 4A3IG 2YYZA 4YWKA 5COYA 5LL6X 5C5MA 1PFSA 2F0MA 2EXZA 3HOXB 3CCLA 4RAUC 1XX8A 2ALYB 3S14B 1SE8A 1EU3A 2F0QA 1TS2A 3KYHC 1LTLA 4OIKA 1O80A 3Q24A 3CPFA 1VQ5A 3FDTA 2F1MA 2JEBI 1GUSA 5FLXc 5C4XG 1S4ZA 3W2DA 1WCMG 3M9BA 4KY7A 4A3KB 1Z7TA 4OX9L 3GTLB 4HMJA 2VQFQ 4YWMA 1G8ZD 1FNVA 2M2LA 1Q81C 4C3HB 5ISRA 4MIUA 3G7LA 1VQ8A 4FVMA 1SBBB 3F8TA 4P75A 1TKWB 4IPHA 1YHAA 1SMYD 3PO3H 5DEHA 2KECA 1DM0B 4BBRH 4PG3A 5EPJA 4RMFA 1PTOB 1JORA 3CQZH 5IYDG 1DZ1A 4ZLTF 4G7HC 4IUTA 4A93G 1HQRD 4NB3A 3K59A 2A73B 2DNEA 1TU2B 2VQFL 2RHSB 1EY6A 2XNAC 3RMHA 1OTCA 1S5ED 2B2VA 1X6OA 3S16H 1VQOA 2NVYH 3CQZB 4JI0L 2C9OA 1AEXA 1PDQA 1KRTA 4BBRB 4IO9A 2AQ2B 1PYWD 4JOIA 5CV9A 2NBFA 1I6VC 2K04A 4ABNA 1CHQD 5A2QL 2RA4A 2UXCL 1SLJA 5LMNQ 3OW2A 5BN4A 2CCZA 1I4GA 4RH6A 3CC4A 2PZWA 1FNWA 4JI7L 3DXJC 3P7JA 3U9OA 3F2CA 1NR2A 1HFNA 1IKMA 5FLXE 3MFYA 3RNUA 4QGUA 3I55A 2K7VA 5FLMG 3H0GG 2OF1A 1N34Q 3K57A 4QUCA 2X69A 3CCVA 4GLAC 5F2DA 3A74A 2JA6B 5ELBA 1G6PA 4K0KL 4A3CH 1CT1D 4XYQA 1W6KA 3VR6A 4X66Q 2BOSA 1EWIA 1UWVA 2EYJA 4BBRG 4P71A 4WJ4A 2K5QA 3PO3G 3CW2C 1N32L 4POFA 3ULPA 2UXBQ 4JI8Q 4DV1L 1PV4A 3ITPA 1PTOD 5IYCG 4L5QA 1Y1WG 3QR8A 3DHQA 3CCRA 1XMQQ 1T5XD 4JI1Q 4AQYL 1SDFA 2HQEA 4XDXA 2R92B 1TWGB 1NJIC 3VYSA 2V4DA 1VDZA 2F0VA 5JJZA 1TIID 4DGZA 1XJVA 3C46A 4LFBQ 1TWFH 4OELB 4A76A 1JC7A 3I4MB 1XNQL 1QE6A 5EJWA 1RODA 3U50C 2O2LD 2UUCL 3PUZA 3S17H 3TS2A 4X65Q 3J81j 2RF4A 2DJFC 1F77A 2KJXA 4DNRB 3I70A 1BUVT 4A3FG 1K8GA 4LFCL 4NXML
chains in the Genus database with same CATH topology
4C2MB 3O13A 1U9RA 1DYQA 4KN4C 1WCMB 5C3EB 2H4OA 1ET6A 2D62A 5IGEA 2KCNA 2Z4IA 1BOSA 5C0XI 5TSSA 2PPBC 3TP7A 1HPCA 2K33A 3NBIA 1R9TB 2SNMA 1X3PA 1VMPA 2F0OA 1PZKD 1DONA 1HCZA 2PW5A 4FNFA 2E74C 1PXUA 2NVQB 2O5IC 2F0EA 1IKLA 1IYVA 4A3EB 3ND8A 1EY4A 2XRSD 4MN3A 3GTKB 1OO9B 2NN6G 4TRDA 3SEBA 2QKIC 4HSVA 4OO1H 3BYTB 2JA5B 1O78A 3P75A 2EY5A 2LS01 1D5ZC 2NB0A 1STBA 1M4VA 2BA0A 3MA2B 1E0BA 4O1NA 1Q1BA 3DMUA 5LHY1 4IFDI 3H91A 4RGNA 5ELCA 1D2BA 3CHBD 2WB1B 3GTMB 2XN9C 3I4LA 4IFDH 4HTHA 4IUNA 5C6AA 2A6EC 1LO5D 4V190 4PNYA 3I72A 4K2LA 3HOWB 1CZWA 4F88A 3K5MA 4FXGC 4RHRA 4FO2A 2PZTA 1JOOA 3MVVA 2EDGA 1S5BD 3NWSA 1O7ZA 1WTVA 1QNUA 4HEDA 4IUPA 3I73A 5JVG3 1B2TA 2JP1A 1EY9A 4LMQD 4CKCA 1STGA 2KOLA 3OHXC 1SSOA 3PV0A 2D2CC 3K0YA 5J22A 3RZDB 1KDAA 1BXTA 1GUTA 4RWSC 5CV5A 2KEEA 4B08A 2PNRC 1II3A 3KBXA 1A2UA 1X3QA 3A54A 2K28A 4IFDG 5J39A 2B2YA 2RSNA 2MHVA 1EEFD 3VA5A 1H9MA 5JPMC 1A3VA 1F9SA 3EA6A 1Q3LA 1S5FD 1ZXTA 3SE0A 3HP3A 2EJGC 2FMMA 2A69C 5I4DA 5IOCA 4K8JA 3R8BA 1AZPA 3OW7A 5M3MB 5CORA 3HOYB 5CGKA 3AU7A 1JQYD 2SOBA 2ICIA 1GJXA 3D4DA 2LKVA 4H7BA 3NUCA 5KNDA 1PZID 2NVYB 3S16B 5C3WA 2R7ZB 1GUGA 1ET9A 3TP6A 2B39A 1A3UA 1V8QA 4G57A 4U68A 3NQIA 1QOHA 2NWGA 1SJHD 2YU9B 3I90A 3I8ZA 3PO3B 5IT9L 1GUOA 3GD7A 4A3BB 4QMGA 1GHKA 1STHA 2N55A 1DXMA 2IX1A 2CW0C 1WTXA 1LT3D 5KRUA 1MD2D 3TZDA 4PV1C 4R8IA 1MBYA 1DOLA 4CJ2C 1F2YA 5CV8A 5I6YA 5AFWA 5IODA 3FPPA 4C56C 1LLRD 3I91A 1Z6HA 4JK1C 4RKBA 2XRQD 1OXVA 3X3NA 2EPBA 1GOZA 1PRTC 1CA6A 1OXXK 3URYA 1F2LA 2EJFC 1BCPD 3TP8A 5M5YB 1OXUA 3T13A 3NE5B 2Z8LA 2L5TA 1U4RA 4A93B 2TMPA 5C0XG 1DOMA 3KF8A 3A8KE 3H6MA 4ZYSA 1XWEA 1B44D 1RKNA 2L55A 3HGBA 4KJOA 2A69D 5IGFA 5C5LA 3MZ5A 1Y8NB 4R9WA 4XYOA 1MGSA 3M85A 4C3HG 1Q1EA 4OGQC 3J81E 1KNAA 3HZXA 2NUCA 3SVMA 3K5LA 1LTRD 4PQXA 4ODGA 4A3DB 2A6HC 1JOKA 5CMDA 1H9JA 4ZK9B 3LWUA 5EKKA 2KA7A 5NUCA 3E6ZX 2QILA 1K8OA 5FOBB 3K7AB 3PUWA 3SDZA 3LWEA 3D4WA 3IFDA 4DK1A 1YNNC 2B2TC 2B2YC 4N9TA 3V96A 1LTAD 3G6JB 4PMWA 1HRJA 2VNUD 4KK7A 3R93A 1ZYRD 4IZ8A 5FO8B 1ZYRC 1ICWA 4DK0A 1MI2A 2Z1CA 2OEOA 1Q12A 2RSOA 5M9OA 3C1FA 1G91A 4BA2I 4OO1I 3WOFA 2HUGA 2XIWA 1Y1WB 3VR3A 2O4XA 5EPKA 4XQQA 1F2MA 2PMZB 1F9RA 1FD7D 3L7ZC 1BCPC 2Q8RE 3J81L 2A68C 3BDLA 2A5HA 2A68D 3P1HA 3S1RB 2AUJD 4H44C 1RJTA 3H0GB 1PTOC 5K36H 1LTSD 1I4XA 1TWCB 3BZDB 4ZRZA 1RDPD 2WP8J 3QWNA 5CV7A 2ENBA 2BCOA 2MGSA 2XVSA 1JB3A 5JOBA 1O7LA 3EVQA 5EKLA 4B9WA 2DNCA 2AUKA 3S17B 2R6GA 4EGVA 2B2WC 4K2KA 2CW0D 2NVTB 2PQEA 1TWFB 2ZXPA 1SYFA 3CRLC 3NTHA 1RTOA 4CJ1B 3PUXA 2M00A 3TN2A 2IT1A 1AZQA 5CBEE 1BCPB 1STEA 1BO0A 1EU4A 3MXNA 4NP5A 3OPOA 5IGGA 2E2HB 3SK4A 1STAA 4IUQA 1ILPA 1HHVA 3HOZB 1G291 1RF2D 1EYCA 3MWYW 4FF2A 1ESFA 1AP0A 2IX3A 2AQ3B 1U4PA 2F0PA 3HG9A 2HDMA 1JR0D 2J7ZA 1QILA 4EVOA 4DN4M 4V0BA 1SEBD 3A7LA 5JEAH 1BBXC 4C1NI 1I4QA 1WD0A 1Q90A 4B9XA 2SDFA 4FXKC 4H13C 1R4PB 3NP8A 5E1FA 4BBSB 2Q8TA 4A3IB 3DWQA 4GZYC 3D31A 1HXYD 1WTRA 5BN3A 3QG1A 4ZUJA 3NQTA 2RVLA 1JWSD 1Y8OB 2F0HA 2F0IA 2WIIB 3DUZA 4Y7NB 1L0XB 1KAAA 1D5XC 4XIGS 1SYCA 1SNDA 2EY6A 4ZKBB 3ONAB 1SE2A 4BWGB 3J7AV 5T1GA 2N88A 4EQOA 1PTOH 3MXUA 2MP1A 1G2SA 4LAAA 5K5PA 3M7GA 2LMCB 4HSPA 4QUFA 1DOKA 1UEAB 1EZ8A 3K5NA 3IAYA 1PFNA 5CV6A 1WTWA 2Y0SB 1EIHA 3MXGA 4WJWA 2X6LA 3WOEA 2FFKB 3OWEB 4X3SA 4WORA 2Q8IB 2LFNA 2DY7A 1JOQA 3MTSA 3BVZA 2RDHA 3HEJA 1SYGA 2IX0A 5E4XA 4KY6A 4RKLA 3CKIB 4TKOB 2K01A 3FPUB 4KHVA 4KD4A 1K8MA 2XWJB 4KTAA 3RZOB 4FF4A 1PFBA 3BVMA 1AN8A 4BY7B 5ELFA 2C5CA 4HCEA 2IW3A 4OO1G 2AWNA 4CJ0B 1MSGA 1PFMA 2JYOA 1LABA 1UNSA 3PUYA 1WTOA 1X32A 4RHSA 4XQJA 1CHPD 1E2ZA 5HGTA 4WFN3 2PCFB 2F0FA 1QNKA 3OMGA 3PUVA 2NN6I 1A15A 1KLUD 4FP5D 4C3JG 1ZEQX 3D6WA 5JEAJ 4KI0A 4CKEA 3MC0B 4RCOA 3U9SA 5DM63 1ESRA 4M1UB 2B2UA 3OIQA 2B2WA 2KQ3A 1CQFA 4KV6A 1SMYC 3T51B 2J0TD 1BDOA 3NXWA 4FF3A 1SFOB 1LV9A 2RDGA 1F9QA 5I2XA 1EEID 2E2JB 3PMFA 1H9SB 2NYZD 4OIJA 2CQAA 1Y8PB 1CA5A 3SK8A 1K83B 4K5VA 1HTLD 1TWHB 4IUVA 2VB3X 3DEOA 3HRZC 4ME5A 4S3SA 1WVLA 1QWYA 3DWPA 4A3FB 1YNJD 1BNZA 1YNJC 1JICA 1QG7A 3PO2B 1NUCA 2R3ZA 2JE6I 3E5SA 1V1OA 3H09A 4G7ZC 2JSOA 2PW7A 4KHZA 1LT6D 3KUPA 3D6CA 5DNFA 1TS4A 3F2UA 1C8CA 1I4HA 1FGBD 4F87A 4UAIA 2LY7A 4CGYB 5LL6S 3A56A 3BVGA 2QEJC 2TSSA 4HAEA 3M3YB 4KD3A 1ML0D 1NCVA 2XWBB 2B8FA 1DJRD 1SYBA 2EYMA 4E6IA 4RGMA 4IN3A 3D3RA 1PRTD 1TY0A 3Q23A 2IL8A 1I4RA 1UUPA 3J80E 5IGDA 1E2VA 3LNNA 3OMCA 5C44B 1XYIA 3MAQA 2E75C 4RGTA 1TS5A 1E2WA 5CR3A 4K14A 4IUUA 2F0LA 1J9OA 2L4NA 1A3TA 2IPKD 1EFID 3X3MA 1SNCA 3QB3A 2PYKA 3P20A 2WACA 4NW2A 1B1ZA 3T53B 4XQNA 3BYYB 1LTTD 2K32A 2K05A 3NBHA 2SNSA 1WTPA 3TP5A 4K5XA 2ZXRA 3RLFA 3QIAA 3T56B 5IIFA 5IT9E 1LACA 4IQZA 5BN5A 2MJ8A 3HOUB 2EYHA 2M9VA 3MFGA 3DEPA 4Q0FA 1PMRA 5C4XB 4C3IG 1SJED 2JA7B 5KNBA 2L0CA 2O5JC 4KKSA 1M8AA 3GV3A 5FO9B 4DAVA 3KLSX 2IJ0A 2WKCA 4K6DA 1IYUA 3IKJA 1H9KA 2JXMB 3V2TA 1XXGA 1EL0A 4QIWB 1ENFA 5EQ0A 2FMCA 2VXWA 1ONLA 4KJNA 1PLFA 3A55A 1SE3A 3S2DB 1I4PA 1H9RA 3NHHA 1LT4D 2X6GA 3MEHA 1TY2A 4A3JB 1S5CD 1A2TA 3OWFA 1STYA 4J1MA 3CRKC 4H0LC 1JWMD 1GUWA 1B9NA 2EY1A 2FJ2A 1CK1A 3HKZB 3SK5A 4G4KA 2RQXA 4KY5A 3FRPB 4BS9A 1RHPA 1EOTA 2AWOA 3EFXD 3K5OA 3S9WA 4Z9CB 4EQNA 2L11A 2KCCA 4RGOS 4DAPA 4WRDA 1LTID 3Q0AA 4J6HA 2FHTA 5C4HA 3NWTA 4MHEA 4A3MB 2OT2A 3IFTA 1DD2A 2NTTA 2L9HA 1B3AA 3V05A 1JE4A 4DXFA 1ILQA 5T1IA 2F03A 5EBDA 2R61A 3WDNA 4U673 2AQ1B 1QCBD 5I6WA 4XXEA 3NTIA 4JBWA 3BG3A 1I50B 4ZKCB 1IHZA 1J8IA 3J7AF 3FVQA 1SYEA 4J8QA 5A35A 2NN6H 1HUNA 3KLSA 3TZUA 1U4LA 2CVRA 1FNUA 3OOCA 1SNQA 3QJYA 3K6OA 1IW7C 3HOVB 1PRTF 1ENCA 4DA2A 4EQPA 2PO4A 2NVXB 5DM73 3VYTA 5JEAG 5CV4A 4OL7A 3L9AX 4ZAIA 1SE4A 2KHSA 1TQOA 3VYRA 2QF7A 1STNA 4XT1B 2VB2X 4HN7A 2PZUA 2F0UA 3M4OB 5IGCA 4OHJA 1SYDA 4FXDA 5D14A 2BDOA 1TR5A 4RA8A 1VCIA 2RKSA 3SR1A 5D3IB 4NDXA 3S1MB 3GTQB 2JEAI 3GTPB 3H94A 1U4MA 1HA5A 5C4ZA 4CKBA 3EJIA 1BQQT 5DAUA 3TSSA 3SK6A 4BY1B 5G3LF 1EY5A 2OXPA 2MUYA 4PMCA 1EWCA 1VMCA 1SNOA 2F0TA 1G6ZA 2L1BA 2ID0A 5CYUA 3EQLC 1EY0A 5FKAC 4CBVA 2K03A 3A7AB 2EVBA 1CQVA 1D1IA 4RCNA 4PMBA 3S1NB 3BDCA 3ND9A 5C0XJ 2EJMA 3JAML 2F0NA 3S15B 4C3IB 3R2TA 4UDUC 1QB5D 1T5EA 1BCPF 1HTPA 3AMUA 1AW7A 3NK9A 5J1ZA 2NTSA 3I3CA 1EQTA 2B2UC 2K5DA 2L12A 2KVMA 1D6EC 1YNND 5ELEA 5E4WC 3T4AC 1RCVD 1GHJA 3FMCA 2K1BA 2A6HD 3I4NB 3C3LA 1H9SA 2DN8A 1CTMA 4N9PA 5E3FA 2BA1A 3SHLA 3FKIB 5KNCA 5I2YA 4I65A 5A2QE 1VF7A 1NSNS 5M3FB 4QCLA 4DU9A 5CC4A 3GTOB 4KN7C 2B2TA 2VUMB 4P2CB 3TBIB 2WKDA 1AFPA 2BE5C 4QF4A 3QOLA 3IL8A 1KDBA 4DF7A 1RTNA 3FEWX 2I07B 3A8JE 2MPMA 1R4QB 1EZ6A 4K5WA 5JAVA 1FYCA 3GV6A 5EPLA 2B2VC 3DM1A 3Q6SA 1SNMA 3KLRA 4Q5VA 2BDNA 4G7OC 1Z47A 2ICEC 1XTCD 4IFDJ 4AYBB 2IWHA 4F8MA 4DAYA 3T16A 3H3VC 4NKLA 2B8GA 5IGBA 3GTGB 4A3GB 4KMUC 1FR3A 2EYLA 2EOTA 3GO5A 1F2ZA 1NR4A 2EYFA 2G9HD 3BDOA 1KNEA 4TSSA 1W6JA 1LTGD 1NAPA 1MSHA 3GP7A 3ZYYX 3JAME 2NZ1D 1PTOF 2CHBD 4IURA 4X3UA 4L8JA 1C4QA 5FK9C 2EY2A 4ID6A 5ELDA 1SXTA 5K36G 2F0JA 1PRTB 2B63B 3R3OA 4C3JB 1EY7A 4XTCS 1SNPA 3OIPA 2KUMA 1HFGA 1O7YA 3OSOA 1Y69U 1KDCA 3Q22A 1BR9A 3KBGA 1GUNA 4ILWA 3A8IE 2F0KA 3NPPA 1OXSC 1G2TA 1HUMA 3J80L 2I46A 1I3QB 1B50A 2FINB 3E0JA 3BS1A 4K8IA 3LX0A 1CM9A 1SAPA 5KIXA 3CU7A 2D5DA 1TS3A 1OXTA 5EKIA 1WD1A 1RD9D 2F4IA 5I9OA 4F7XA 1BF4A 4XT3B 3D8GA 2KEDA 4L6TB 1JCKB 1QJOA 5FLXL 2HDLA 1GXDC 4FF1A 4ZQ3A 4CHTB 2WAQB 2JA8B 2K5WA 1L0YB 4ULLA 1IL8A 1TWAB 3NSWA 2QCPX 4NMZA 3PIO3 3SXHA 4DXGA 2E76C 2GA4B 1EWHA 3KK7A 3MHBA 5C0XH 5CBAE 2BE5D 4BA1I 5JVH3 1EYDA 5EBCA 1Y1VB 1TVXA 4YIJA 3UI2A 5M5WB 1CZGA 1C48A 3NTKA 1ENAA 2EZVA 3TMEA 1HA6A 3N52A 2R93B 5KGUA 3QO2A 1EY8A 2F0WA 4M8AA 4L63B 1I6HB 1B4OA 3RD4A 4X3TA 3TDQA 2DY8A 5C3XA 2ZXOA 1KABA 1LT5D 5D3DA 2A6ED 1KLGD 3GQBA 1EYAA 1PZJD 1VF5C 3W3AA 2F0DA 2QDBA 4DFAA 2F3VA 2F0SA 2RBMA 1ZKOA 4K6LA 1DCZA 1F9PA 4KKTA 5C4JB 3S1QB 2H1EA 2XSCA 3K58A 4LJZC 4QB4A 1JWUD 3J7YW 4HCSA 2J4XA 3M7NA 3R2IA 1WTQA 2EYPA 1LTBD 4TQUS 3VR4A 1UAPA 3VYUA 1D1KA 2EE1A 4RFBA 1B53A 5D65A 3C2PA 2D9UA 3VR5A 4O42A 5I9PA 3D4RA 1B9MA 2E2DC 1Q8IA 1EIGA 2WINB 5FO7B 4C1NK 2HCIA 4ZUIA 1EQVA 3VA7A 1KTKA 2SEBD 3C1EA 5G3LD 1CFMA 3VR2A 4X3KA 2K6AA 4HR7B 4I7ZC 1CI3M 5KYLA 2WV6D 1V1PA 3PIP3 4R8NA 4FYDA 5M5XB 1IW7D 2RDFA 2G9DA 4DNTB 5KEEA 3M4YA 1TT2A 3RUZA 3N6RA 2Z4HA 1S5DD 2EYOA 5KYIA 1V43A 3AB9A 2ZT9C 1D5MC 4HMIA 1A6XA 1HQMC 3GTJB 5EGTA 3QOJA 4LK1C 3HS0C 3MXPA 2HCCA 4IALA 2E2IB 5HURA 3L3OC 1V1PB 3ERQA 4KKUA 3DWAA 3EROA 2F0GA 2A74C 5JPNC 3S2HB 2F3WA 2YYZA 5COYA 5LL6X 5C5MA 2F0MA 2EXZA 3HOXB 4RAUC 1XX8A 3S14B 1EU3A 2F0QA 1TS2A 4OIKA 1O80A 3Q24A 3FDTA 2F1MA 2JEBI 1GUSA 1S4ZA 3W2DA 4A3KB 4KY7A 1Z7TA 3GTLB 4HMJA 1G8ZD 1FNVA 2M2LA 4C3HB 5ISRA 4MIUA 3G7LA 4FVMA 1SBBB 1TKWB 1SMYD 5DEHA 2KECA 1DM0B 5EPJA 1PTOB 1JORA 1DZ1A 4ZLTF 4G7HC 4IUTA 1HQRD 3K59A 2A73B 2DNEA 1TU2B 1EY6A 2XNAC 3RMHA 1S5ED 2B2VA 3CQZB 2C9OA 1AEXA 1PDQA 4BBRB 2AQ2B 1PYWD 5CV9A 2NBFA 1I6VC 2K04A 4ABNA 1CHQD 5A2QL 2RA4A 5BN4A 1I4GA 4RH6A 2PZWA 1FNWA 3DXJC 3P7JA 3U9OA 1NR2A 1HFNA 1IKMA 5FLXE 3MFYA 2K7VA 2OF1A 3K57A 4QUCA 2X69A 5F2DA 2JA6B 5ELBA 1CT1D 4XYQA 1W6KA 3VR6A 2BOSA 2EYJA 2K5QA 3ITPA 1PTOD 3DHQA 1T5XD 1SDFA 2HQEA 4XDXA 2R92B 1TWGB 3VYSA 2V4DA 1VDZA 2F0VA 5JJZA 1TIID 4DGZA 3C46A 1JC7A 3I4MB 1QE6A 5EJWA 1RODA 2O2LD 3PUZA 1F77A 2KJXA 4DNRB 3I70A 1BUVT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2T A;  1HUM A;  1QNK A;  1DZ1 A;  1B4O A;  2IL8 A;  3GV6 A;  1J8I A;  1EL0 A;  4ZLT F;  5EPL A;  4IUT A;  4X3T A;  1A15 A;  5EQ0 A;  2B2V C;  3DM1 A;  3Q6S A;  2VXW A;  1HUN A;  2DY8 A;  1O7Z A;  1KNA A;  1U4L A;  3D6W A;  2CVR A;  2MGS A;  1WTV A;  4ZKB B;  1PLF A;  2FIN B;  4HED A;  2BDN A;  1XYI A;  1B50 A;  4U68 A;  2B2V A;  3ONA B;  3SVM A;  1CM9 A;  4IUP A;  2NWG A;  1ESR A;  5T1G A;  1SAP A;  2N88 A;  2B2U A;  3I90 A;  2B2W A;  1PDQ A;  3I8Z A;  1B2T A;  2MP1 A;  1G2S A;  2JP1 A;  4LMQ D;  5CMD A;  2X6G A;  4ZK9 B;  3I3C A;  4IUU A;  1EQT A;  2B2U C;  2K04 A;  2KOL A;  5EKI A;  1J9O A;  2B2W C;  1WD1 A;  2L12 A;  2KVM A;  1LV9 A;  4ZAI A;  2RA4 A;  1X3P A;  1DOK A;  2L4N A;  4QUF A;  1F9Q A;  1VMP A;  2EOT A;  1BF4 A;  5E4W C;  1F9P A;  1RTO A;  4CJ1 B;  1DON A;  3P7J A;  4XT1 B;  1NR4 A;  1SSO A;  2H1E A;  3TN2 A;  1GUW A;  2NYZ D;  4OIJ A;  2N55 A;  2HCC A;  1NR2 A;  1PFN A;  4XT3 B;  1HFN A;  1KNE A;  1AZQ A;  5CBE E;  2KED A;  1IKM A;  1CA5 A;  1WTX A;  3LWE A;  4RWS C;  1WTW A;  1EIH A;  2FJ2 A;  1BO0 A;  4NW2 A;  2K1B A;  3IFD A;  2KEE A;  4HCS A;  4IUV A;  2X6L A;  2B2T C;  3TZD A;  2K05 A;  3DEO A;  1IKL A;  1NAP A;  2HDL A;  2B2Y C;  1WTQ A;  4R8I A;  5D14 A;  1WVL A;  1MSH A;  4QUC A;  2X69 A;  2FFK B;  3KBX A;  4IUQ A;  4X3S A;  1ILP A;  4RA8 A;  1WTP A;  1HHV A;  1HRJ A;  4MN3 A;  2DY7 A;  1BNZ A;  3MTS A;  1DOL A;  1X3Q A;  2K28 A;  3R93 A;  4CJ2 C;  3MWY W;  2EE1 A;  2NZ1 D;  1RHP A;  2B2Y A;  1JIC A;  1QG7 A;  2RSN A;  1EOT A;  5AFW A;  2R3Z A;  5E4X A;  4IUR A;  4X3U A;  2L11 A;  1IL8 A;  1B53 A;  1ICW A;  4HSV A;  1MI2 A;  5COY A;  1U4M A;  1AP0 A;  3I91 A;  2RSO A;  1U4P A;  2MJ8 A;  5D65 A;  3KUP A;  2D9U A;  4RAU C;  2HDM A;  1XX8 A;  2K01 A;  5DNF A;  3FPU B;  4O42 A;  1G91 A;  3DEP A;  1F9S A;  2J7Z A;  1Q3L A;  2EPB A;  2FHT A;  1ZXT A;  4DN4 M;  2HUG A;  2XIW A;  3F2U A;  4OIK A;  1O80 A;  5CBA E;  3HP3 A;  3FDT A;  1CA6 A;  1E0B A;  1F2L A;  1SDF A;  4MHE A;  4XDX A;  1C8C A;  2B2T A;  1EIG A;  1PFB A;  1S4Z A;  1BBX C;  2FMM A;  1WD0 A;  4UAI A;  5EPK A;  1U4R A;  1VMC A;  3H91 A;  1TVX A;  3UI2 A;  2KUM A;  1HFG A;  2HCI A;  1DOM A;  1F9R A;  2L9H A;  2M2L A;  5JJZ A;  2SDF A;  1B3A A;  1JE4 A;  1O7Y A;  5COR A;  1AZP A;  3IL8 A;  1ILQ A;  1G6Z A;  2L1B A;  5T1I A;  2Q8R E;  2Q8T A;  1QE6 A;  5EJW A;  1M8A A;  1RTN A;  3G7L A;  3GV3 A;  1ROD A;  4CJ0 B;  1MSG A;  1HA6 A;  1PFM A;  2JYO A;  4X3K A;  1WTR A;  3N52 A;  4HAE A;  2KEC A;  4R9W A;  1WTO A;  1ML0 D;  1NCV A;  1X32 A;  3QO2 A;  2MPM A;  5EPJ A;  2RVL A;  1RJT A;  1MGS A;  2K03 A;  4ZKC B; 
#chains in the Genus database with same CATH topology
 4C2M B;  3O13 A;  2CQO A;  1JJG A;  1MHW C;  1HZA A;  1U9R A;  1DYQ A;  1PVO A;  4KN4 C;  1WCM B;  5C3E B;  4HJA A;  2H4O A;  1ET6 A;  1X3G A;  2D62 A;  5IGE A;  2K5H A;  2KCN A;  2Z4I A;  1TWC H;  5M5X H;  3CD6 A;  1BOS A;  3KDF B;  5C0X I;  5TSS A;  2PPB C;  4GLV B;  2OQK A;  3H0G H;  3TP7 A;  1HPC A;  1EIF A;  3M3Y H;  2K33 A;  1QUQ A;  3NBI A;  2IHE A;  3D0F A;  1YJW A;  4X62 Q;  3M4Q A;  1R9T B;  2Q2H A;  2Z6K A;  1PH4 A;  2SNM A;  1X3P A;  1VMP A;  1YJN A;  5IY0 A;  4B3T Q;  2F0O A;  2R93 G;  1PZK D;  2RHQ B;  1IBM L;  1DON A;  4ZCK A;  2AHO B;  3W5O A;  1HCZ A;  2PW5 A;  4FNF A;  4P74 A;  2E74 C;  1PXU A;  1X9N A;  5IYB G;  2NVQ B;  1Y1W H;  1LUZ A;  2O5I C;  1X54 A;  3NEL A;  2JK8 A;  2QW7 A;  3F2D A;  2F0E A;  4MTN A;  1IKL A;  3W1G A;  1IYV A;  4A3E B;  3ND8 A;  1EY4 A;  4B3M L;  2XRS D;  4MN3 A;  3GTK B;  1OO9 B;  1QZH A;  2NN6 G;  2HIV A;  3OTO Q;  5HY6 A;  4HJ5 A;  4TRD A;  3SEB A;  3PO2 H;  2CFM A;  2QKI C;  4HSV A;  4OO1 H;  3KF6 A;  3BYT B;  3GTK H;  2JA5 B;  2AMC B;  4MZ9 A;  1PH9 A;  1O78 A;  3P75 A;  4DV5 Q;  2EY5 A;  2LS0 1;  1D5Z C;  2KHJ A;  2NB0 A;  4A3E H;  1STB A;  1M4V A;  2BA0 A;  2N78 A;  2JA8 G;  3MA2 B;  4MTK A;  1X65 A;  1S40 A;  1E0B A;  4O1N A;  1Q1B A;  1JJ2 A;  3DMU A;  5LHY 1;  4IFD I;  3K7A H;  3H91 A;  1I94 Q;  4RGN A;  5ELC A;  1D2B A;  3CHB D;  3CXC A;  2JA7 G;  2WB1 B;  1EQQ A;  3GTM B;  2XN9 C;  3I4L A;  2E5L Q;  4IFD H;  3OTO L;  1SFO H;  4HTH A;  4IUN A;  1PH1 A;  5C6A A;  2A6E C;  3HOW G;  1LO5 D;  4V19 0;  4PNY A;  2LSS A;  3I72 A;  4K2L A;  5C44 G;  1VQC A;  3HOW B;  1CZW A;  4A3D H;  4OEM B;  1T9H A;  4F88 A;  4DR4 Q;  4JI2 L;  3K5M A;  4FXG C;  4QQB X;  4RHR A;  4CDF C;  4FO2 A;  2PZT A;  1JOO A;  3MVV A;  2EDG A;  5FJ8 G;  1S5B D;  2XGT A;  1YJ9 A;  3NWS A;  1O7Z A;  3EIV A;  1RL2 A;  1WTV A;  1QNU A;  4HED A;  3W1B A;  2ZM6 L;  1X55 A;  4IUP A;  3I73 A;  3Q8D A;  5JVG 3;  1B2T A;  2JP1 A;  1EY9 A;  4LMQ D;  4CKC A;  1STG A;  3F2B A;  2KOL A;  2Z6B A;  3OHX C;  1HH2 P;  3DLL A;  4JYA Q;  5M5W H;  1SSO A;  2JN4 A;  3PV0 A;  2D2C C;  3K0Y A;  5J22 A;  4A3E G;  5GAE C;  1E1T A;  3RZD B;  1KDA A;  1BXT A;  1GUT A;  4RWS C;  3SGI A;  5CV5 A;  2KEE A;  4QL5 A;  1N8R C;  4B08 A;  4I7A A;  2PNR C;  1X56 A;  1II3 A;  3KBX A;  4PZ8 A;  3U4Z A;  1A2U A;  1X3Q A;  3A54 A;  2K28 A;  3KOJ A;  4IFD G;  5J39 A;  2B2Y A;  2RSN A;  2MHV A;  3KJO A;  1VQA A;  3HOY G;  1EEF D;  5M3M G;  3VA5 A;  1H9M A;  1VQJ A;  5JPM C;  1A3V A;  4MNO A;  1HNZ L;  1F9S A;  3EA6 A;  1Q3L A;  1S5F D;  1ZXT A;  3SE0 A;  5FJ8 H;  3HP3 A;  2EJG C;  1FL0 A;  1H95 A;  2FMM A;  2A69 C;  5I4D A;  5IOC A;  4K8J A;  3R8B A;  1AZP A;  3OW7 A;  5M3M B;  5COR A;  1Q82 C;  3HOY B;  5CGK A;  3AU7 A;  1JQY D;  2SOB A;  3MEF A;  2CH4 A;  2ICI A;  1GJX A;  3BJU A;  3D4D A;  4JOI C;  2LKV A;  5IWA L;  4H7B A;  3NUC A;  5KND A;  1PZI D;  2NVY B;  3S16 B;  5C3W A;  1B70 B;  4IJL A;  1PA6 A;  1V1Q A;  1Q46 A;  2R7Z B;  1XPU A;  4GKK Q;  1GUG A;  5IE8 A;  1ET9 A;  3TP6 A;  2B39 A;  5IP7 H;  4HJ8 A;  1I3Q H;  1A3U A;  1GO3 E;  1V8Q A;  4DV3 Q;  2R7Z H;  4G57 A;  2VQE L;  4U68 A;  3K8A A;  5E7N A;  4P73 A;  3NQI A;  1QOH A;  2NWG A;  1SJH D;  5ELO A;  2YU9 B;  3I90 A;  2Z6K C;  3I8Z A;  3PO3 B;  2ZTD A;  5IT9 L;  4BY7 G;  1GUO A;  3GD7 A;  4A3B B;  4A3I H;  4QMG A;  1GHK A;  5M3M H;  1CKN B;  1L1O C;  1STH A;  4L5T A;  2Y0S E;  2N55 A;  4C3J H;  1DXM A;  2IX1 A;  1IBL L;  1X3F A;  4A3K H;  2CW0 C;  1WTX A;  1VQM A;  1LT3 D;  2Q2I A;  5KRU A;  3CME A;  5JJL A;  2DGY A;  1MD2 D;  3TZD A;  2AKW B;  4PV1 C;  4R8I A;  3S14 H;  1MBY A;  4EQ5 A;  1DOL A;  4CJ2 C;  1F2Y A;  5CV8 A;  5I6Y A;  1U5K A;  5AFW A;  5IOD A;  3FPP A;  4YCW A;  3E3X A;  5GAH C;  4DV0 Q;  4C56 C;  1LLR D;  3I91 A;  4JK1 C;  1Z6H A;  3FHW A;  2XRQ D;  4RKB A;  1L2F A;  3HOZ H;  1OXV A;  1CSQ A;  3X3N A;  2ATW A;  2EPB A;  4KHP L;  1GOZ A;  1PRT C;  1XPO A;  1OXX K;  1CA6 A;  3URY A;  3J80 i;  1F2L A;  2EJF C;  1BCP D;  3TP8 A;  3RZD H;  5M5Y B;  1OXU A;  3T13 A;  3NE5 B;  2Z8L A;  1VQN A;  2L5T A;  1U4R A;  2BH8 A;  4A93 B;  2TMP A;  5C0X G;  1DOM A;  3KF8 A;  3A8K E;  3H6M A;  4ZYS A;  1XWE A;  2NVT H;  1B44 D;  1E1O A;  5HGQ A;  1RKN A;  2L55 A;  3HGB A;  4KJO A;  2A69 D;  3GTG H;  1BBW A;  5IGF A;  5C5L A;  3MZ5 A;  3CCQ A;  1GVP A;  1Y8N B;  4R9W A;  4XYO A;  4LF4 L;  1MGS A;  3M85 A;  3NBH B;  1HNW L;  2KCM A;  4C3H G;  3PIO A;  4PZ7 A;  1Q1E A;  4OWT B;  4OGQ C;  3AEV A;  3J81 E;  1KNA A;  4LF9 Q;  2VY3 A;  2K4K A;  3HZX A;  2NUC A;  3SVM A;  3K5L A;  2GN5 A;  1LTR D;  4PQX A;  4ODG A;  4A3D B;  2A6H C;  2OTJ A;  2Z0S A;  3HOW H;  1JOK A;  4DUY L;  5CMD A;  1H9J A;  4ZK9 B;  3LWU A;  5EKK A;  2KA7 A;  5NUC A;  3E6Z X;  2QIL A;  4JI5 Q;  1KXL A;  1K8O A;  5FOB B;  1S72 A;  3K7A B;  1K0S A;  2KCT A;  1PYB A;  3TRE A;  3PUW A;  3SDZ A;  5GQO A;  1CUK A;  3LWE A;  3D4W A;  3IFD A;  3JAM i;  3GTO H;  3EBE A;  1KHI A;  4DK1 A;  1YNN C;  2B2T C;  2B2Y C;  4JI4 L;  4N9T A;  3V96 A;  1LTA D;  3G6J B;  4PMW A;  5M3F H;  1HRJ A;  1SRO A;  5BR8 Q;  2VNU D;  4KK7 A;  3R93 A;  3TQY A;  1ZYR D;  4IZ8 A;  5FO8 B;  1Q86 C;  1ZYR C;  4JI3 L;  1ICW A;  4DK0 A;  1MI2 A;  5LMU L;  2Z1C A;  2OEO A;  1Q12 A;  2RSO A;  4AYB G;  5M9O A;  3C1F A;  3G71 A;  3I4N H;  4BA2 I;  1G91 A;  4YHH Q;  4OO1 I;  1PH3 A;  3KDF A;  4L5R C;  2UXD Q;  3WOF A;  2HUG A;  2XIW A;  2GVB A;  1Y1W B;  2OTL A;  2G5D A;  4KLK A;  2O4X A;  3VR3 A;  2UUB Q;  4BBS G;  5EPK A;  4XQQ A;  1F2M A;  2PMZ B;  4JBM A;  1F9R A;  1FD7 D;  1UE6 A;  3L7Z C;  4OWX B;  1BCP C;  2Q8R E;  3J81 L;  1QVG A;  2A68 C;  5L37 A;  3BDL A;  2WB1 E;  4A3M G;  4DK3 C;  2A5H A;  2JA6 G;  2A68 D;  3P1H A;  1XTD A;  3S1R B;  2AUJ D;  4H44 C;  1RJT A;  3H0G B;  1PTO C;  4DR5 Q;  5K36 H;  1LTS D;  1I4X A;  3S15 H;  1TWC B;  3BZD B;  4ZRZ A;  1RDP D;  4JYA L;  2WP8 J;  3QWN A;  1QUQ B;  5CV7 A;  4DV4 Q;  2ENB A;  4R4I A;  3S1N H;  2BCO A;  5AJ3 Q;  2MGS A;  2XVS A;  4JV5 Q;  3H3V H;  2R7F A;  3HOZ G;  1JB3 A;  1HZB A;  5JOB A;  1O7L A;  3EVQ A;  5EKL A;  3UDI A;  4B9W A;  4A3B G;  4R1J A;  4GLX A;  2DNC A;  2AUK A;  1VQH A;  2N49 A;  3FKI G;  3S17 B;  2R6G A;  3H15 A;  4EGV A;  4X66 L;  2B2W C;  4K2K A;  4JI6 L;  2CW0 D;  3I4M H;  2NVT B;  2PQE A;  1TWF B;  2ZXP A;  1SYF A;  3CRL C;  3NTH A;  4RG1 A;  1RTO A;  1Q8K A;  3PUX A;  4CJ1 B;  2M00 A;  4DV6 Q;  4DV2 Q;  3TN2 A;  4LUV A;  1FJG L;  4A4I A;  2IT1 A;  1AZQ A;  5CBE E;  1BCP B;  1STE A;  2QEX A;  1FJG Q;  1BO0 A;  1EU4 A;  3MXN A;  1E3P A;  4NP5 A;  3OPO A;  5IGG A;  2E2H B;  3SK4 A;  1STA A;  2R7Z G;  1B3Q A;  4DNI A;  4IUQ A;  1ILP A;  1HHV A;  2VW9 A;  3HOZ B;  1G29 1;  1RF2 D;  4QJF A;  1EYC A;  3MWY W;  4FF2 A;  1TWA H;  3GTP H;  1ESF A;  2UXC Q;  3F1Z A;  1EFW A;  2WAQ E;  1C9O A;  1AP0 A;  2YTX A;  2IX3 A;  1HNZ Q;  2AQ3 B;  1U4P A;  2F0P A;  3HG9 A;  4JVZ A;  2ZTC A;  4JG2 A;  2HDM A;  4DV2 L;  1JR0 D;  3S24 A;  2J7Z A;  1QIL A;  4EVO A;  4DN4 M;  4V0B A;  1SEB D;  3A7L A;  2Z9H A;  1KQS A;  5JEA H;  1GKH A;  1BBX C;  4C1N I;  1I4Q A;  1WD0 A;  4JV5 L;  3AFQ A;  5AJ3 L;  1Q90 A;  4B9X A;  2K14 A;  3NEN A;  2Q2U A;  2SDF A;  4FXK C;  4H13 C;  1R4P B;  3NP8 A;  5E1F A;  3PQI A;  1NE3 A;  4POG A;  2Q8T A;  4A3I B;  4BBS B;  3DWQ A;  4GZY C;  1N9W A;  3D31 A;  1KIX A;  3TRZ A;  1HXY D;  1WTR A;  1VQ7 A;  5BN3 A;  3QG1 A;  1B8A A;  2NVX H;  4ZUJ A;  3EN2 A;  3NQT A;  1W2B A;  2RVL A;  3JC6 6;  1JWS D;  1Y8O B;  2F0H A;  3HOV H;  2F0I A;  2P5Z X;  1HZ9 A;  2WII B;  3DUZ A;  1L0X B;  2I5L X;  3WWV A;  4Y7N B;  4A3J G;  1SR3 A;  5GAD C;  1KAA A;  1D5X C;  4XIG S;  1XMO Q;  1SYC A;  1SND A;  2EY6 A;  3H3V I;  4ZKB B;  2F4V Q;  3ONA B;  1SE2 A;  2CWA A;  4BWG B;  1YVC A;  3J7A V;  5T1G A;  1PH5 A;  2N88 A;  4EQO A;  1PTO H;  3MXU A;  1KAW A;  2MP1 A;  1G2S A;  1WTH A;  1N36 L;  4LAA A;  1YBY A;  5K5P A;  1PH6 A;  3M7G A;  2LMC B;  4HSP A;  1B7Y B;  4QUF A;  1DOK A;  3HOY H;  4DPG A;  1UEA B;  4BXX G;  1EZ8 A;  3K5N A;  3IAY A;  1PFN A;  2CH4 W;  4JI8 L;  5CV6 A;  1WTW A;  2Y0S B;  1EIH A;  1FGU A;  3MXG A;  4WJW A;  4P72 A;  2UUC Q;  2X6L A;  4A3D G;  1Y14 B;  3WOE A;  1HJP A;  2FFK B;  1JJC B;  1V9P A;  3OWE B;  4WOR A;  4X3S A;  4LF8 L;  2Q8I B;  2LFN A;  2DY7 A;  1JOQ A;  3HOX H;  3MTS A;  1PYS B;  3KF6 B;  3BVZ A;  4LF8 Q;  3RLO A;  2RDH A;  3HEJ A;  1SYG A;  2IX0 A;  5E4X A;  4LF6 L;  1K28 A;  4KY6 A;  4RKL A;  3CKI B;  3CMA A;  2WB1 G;  4TKO B;  4LF5 Q;  4A3C G;  2K01 A;  3FPU B;  4UP7 A;  4LFA Q;  4KHV A;  4KD4 A;  1K8M A;  2XWJ B;  4KTA A;  3STB C;  3RZO B;  4FF4 A;  1DGS A;  1PFB A;  4PZ6 A;  2E2I H;  3BVM A;  1AN8 A;  4BY7 B;  5ELF A;  1K8A C;  2YV5 A;  2C5C A;  1CKO A;  3LGJ A;  4HCE A;  1SRU A;  1QZG A;  2IW3 A;  4A3J H;  4OO1 G;  2AWN A;  4CJ0 B;  1MSG A;  1PFM A;  2JYO A;  1LAB A;  1UNS A;  3PUY A;  1YIT A;  1WTO A;  2B29 A;  1X32 A;  4RHS A;  4XQJ A;  1CHP D;  1E2Z A;  4FDB A;  5HGT A;  1YZ6 A;  3S2D H;  1C7Y A;  4WFN 3;  2PCF B;  1PHJ A;  2F0F A;  1QNK A;  3OMG A;  3CPW A;  4UP8 A;  3PUV A;  3J81 c;  2NN6 I;  1GM5 A;  3KLW A;  1A15 A;  1KLU D;  4FP5 D;  4C3J G;  1ASY A;  4LWC A;  1ZEQ X;  3D6W A;  3I4O A;  1YI2 A;  2B63 G;  5JEA J;  4KI0 A;  3PCO B;  4CKE A;  4IOC A;  3MC0 B;  4RCO A;  3U9S A;  5DM6 3;  1ESR A;  4M1U B;  2B2U A;  3OIQ A;  2B2W A;  2KQ3 A;  1CQF A;  2VS1 A;  4KV6 A;  1SMY C;  3T51 B;  2J0T D;  2K50 A;  4R4O A;  4DR1 L;  1BDO A;  3NXW A;  3RN2 A;  4FF3 A;  1SFO B;  1LV9 A;  2RDG A;  4DR1 Q;  1IBK Q;  1HR0 W;  1F9Q A;  3GTM H;  5I2X A;  1EEI D;  2UU9 L;  4B3R L;  2L15 A;  2E2J B;  3PMF A;  1HR0 L;  1H9S B;  2NYZ D;  4OIJ A;  2CQA A;  1Y8P B;  5EAY A;  1CA5 A;  3SK8 A;  1K83 B;  4GN4 B;  1L1O A;  4K5V A;  5C4X H;  1HTL D;  1TWH B;  4IPC A;  2VB3 X;  4IUV A;  1WFQ A;  1QVC A;  3DEO A;  3HRZ C;  4ME5 A;  4S3S A;  4AIM A;  1WVL A;  4OWW B;  3OYY A;  1PH7 A;  2UUB L;  1QWY A;  3DWP A;  4A3F B;  1YNJ D;  1BNZ A;  2JA5 H;  1YNJ C;  1JIC A;  1QG7 A;  2HQL A;  3PO2 B;  1NUC A;  4DUZ Q;  2R3Z A;  2JE6 I;  5IT9 c;  4TVA B;  3E5S A;  4GOP A;  1V1O A;  3H09 A;  4G7Z C;  2JSO A;  2PW7 A;  4KHZ A;  1LT6 D;  3KUP A;  1BKB A;  3D6C A;  5DNF A;  4JI3 Q;  4LFB L;  1TS4 A;  5GAG C;  3UDG A;  4GKK L;  3F2U A;  1P16 A;  1AH9 A;  2NVQ H;  1C8C A;  4LF5 L;  1I4H A;  3ZJY C;  1FGB D;  2VQE Q;  4F87 A;  1C0A A;  4UAI A;  5C4J H;  2LY7 A;  4CGY B;  5LL6 S;  3A56 A;  4IJH A;  4HIK A;  3BVG A;  4B3S Q;  2QEJ C;  1R9T H;  2TSS A;  4HAE A;  3M3Y B;  4KD3 A;  1ML0 D;  1NCV A;  1E7Z A;  2XWB B;  2PMZ E;  2B8F A;  1DJR D;  1SYB A;  2EYM A;  4E6I A;  4RGM A;  4IN3 A;  3D3R A;  4C3I H;  1PRT D;  1TY0 A;  3Q23 A;  2IL8 A;  1NMG A;  1I4R A;  1UUP A;  3J80 E;  4LNQ A;  5IGD A;  1E2V A;  3LNN A;  2VUM G;  3E9H A;  3OMC A;  5C3E H;  1N36 Q;  5C44 B;  1XYI A;  3MAQ A;  5FLM H;  4Y52 H;  2E75 C;  4UPA A;  4JI0 Q;  1I6H H;  4JI6 Q;  4C2M H;  4RGT A;  1TS5 A;  3HOU G;  1E2W A;  1NBW A;  5CR3 A;  1IBK L;  4K14 A;  4DUZ L;  1HZC A;  4IUU A;  3L2P A;  2F0L A;  1J9O A;  2L4N A;  3UDF A;  4JW0 A;  4DV0 L;  1A3T A;  2IPK D;  4LF7 L;  1EFI D;  3X3M A;  4DV4 L;  1SNC A;  3QB3 A;  2PYK A;  2R92 H;  4UHV A;  2YTY A;  2WAC A;  3P20 A;  1B1Z A;  4NW2 A;  4BY1 H;  3T53 B;  4XQN A;  3BYY B;  1LTT D;  2K32 A;  2K05 A;  3NBH A;  2SNS A;  1WTP A;  3TP5 A;  4K5X A;  4JCV E;  3NEM A;  2ZXR A;  4X6A H;  3RLF A;  3PIP A;  2A19 A;  3QIA A;  2JA8 H;  3T56 B;  5IIF A;  5IT9 E;  1LAC A;  4IQZ A;  2B3G A;  3G48 A;  2JA6 H;  5BN5 A;  2KEN A;  2MJ8 A;  4LF7 Q;  3HOU B;  2RCF A;  2EYH A;  2M9V A;  1N33 L;  3MFG A;  3DEP A;  4Q0F A;  1K0R A;  3G6E A;  1A62 A;  1TWH H;  1PMR A;  1YHB A;  5C4X B;  4C3I G;  3M4O H;  1AE2 A;  1SJE D;  3K7U C;  5JJI A;  3K81 C;  1WOC A;  3A5Z B;  2ASB A;  2JA7 B;  1XNR L;  5KNB A;  2L0C A;  3I2Z A;  2QA4 A;  2O5J C;  5JJK A;  1KD1 C;  4KKS A;  1M8A A;  3GV3 A;  5FO9 B;  2MNA A;  4DAV A;  3KLS X;  2IJ0 A;  3CF5 A;  2WKC A;  4GN3 B;  2ZJP A;  4K6D A;  1IYU A;  3IKJ A;  4H02 A;  1H9K A;  2JXM B;  4X64 Q;  3V2T A;  1XXG A;  1EL0 A;  4QIW B;  1ENF A;  5EQ0 A;  1JMC A;  2FMC A;  2VXW A;  5IYB H;  1ONL A;  4KJN A;  5J3B A;  1PLF A;  4IOA A;  4BY1 G;  2HIX A;  3A55 A;  1SE3 A;  4AYB E;  4LFA L;  3S2D B;  4IPG A;  1I50 H;  1P8L A;  1N32 Q;  1JE5 A;  2UXB L;  4A3G G;  1I4P A;  3I4M G;  1H9R A;  3NHH A;  1KL9 A;  1LT4 D;  1D7Q A;  2X6G A;  1SMX A;  1BBU A;  3MEH A;  1TY2 A;  4A3J B;  1S5C D;  1A2T A;  3OWF A;  1STY A;  2R92 G;  2PNH A;  4C3H H;  4J1M A;  3CRK C;  3BZC A;  4H0L C;  1JWM D;  1GUW A;  3GTL H;  1B9N A;  2MO1 A;  2EY1 A;  4A3M H;  2B63 H;  4O0A A;  2FJ2 A;  4B3M Q;  1CK1 A;  3RZO H;  1A63 A;  2KHI A;  1VQG A;  3HKZ B;  1QVF A;  2UU9 Q;  5IP9 H;  1XNR Q;  2PQA A;  2A1A A;  3SK5 A;  4JI7 Q;  4G4K A;  2RQX A;  4GNX C;  1NY4 A;  1Z9F A;  4KY5 A;  1IXR A;  4UP9 A;  4DAM A;  3FRP B;  3UDX A;  4BS9 A;  1RHP A;  4HID A;  4ALP A;  4UY8 C;  4LUO A;  1EIY B;  2HHH L;  1EOT A;  2AWO A;  3EFX D;  3K5O A;  3S9W A;  4Z9C B;  4EQN A;  2L11 A;  3S2H H;  2KCC A;  4RGO S;  4DAP A;  2JQO A;  4WRD A;  4B3R Q;  2H5X A;  3G4S A;  1LTI D;  3Q0A A;  4J6H A;  2FHT A;  1YNX A;  5C4H A;  3NWT A;  1Q7Y C;  1UE7 A;  1WI5 A;  4MHE A;  3CCJ A;  4GOP B;  4A3M B;  2DJG C;  2OT2 A;  3IFT A;  5IYC H;  1DD2 A;  2NTT A;  2L9H A;  2UXD L;  1B3A A;  1JE4 A;  3V05 A;  4DXF A;  1ILQ A;  3GTJ H;  3HFZ B;  2PI2 E;  5T1I A;  2F03 A;  2OWO A;  5EBD A;  2R61 A;  3WDN A;  4U67 3;  2AQ1 B;  1VS0 A;  4DV3 L;  1QCB D;  4OON A;  2K5N A;  5I6W A;  4XXE A;  2LXJ A;  3NTI A;  4JBW A;  3BG3 A;  4X65 L;  1I50 B;  4ZKC B;  3T1Y L;  1IHZ A;  1K73 C;  2OCE A;  4JI5 L;  1J8I A;  3J7A F;  3FVQ A;  1SYE A;  4J8Q A;  5A35 A;  2NN6 H;  1HUN A;  2K75 A;  3KLS A;  3TZU A;  1U4L A;  5ELN A;  3RN5 A;  2CVR A;  1FNU A;  3KF8 B;  3OOC A;  1SNQ A;  2MFI A;  3QJY A;  3K6O A;  1IW7 C;  1WJJ A;  3HOV B;  1PRT F;  2RCN A;  4NXN Q;  1ENC A;  4DA2 A;  4EQP A;  2PO4 A;  2NVX B;  5DM7 3;  4NXN L;  3VYT A;  5JEA G;  3PF4 A;  3RR5 A;  2F52 A;  5CV4 A;  4OL7 A;  3L9A X;  4ZAI A;  1MJC A;  4GKJ L;  1SE4 A;  2KHS A;  1TQO A;  3VYR A;  4GOP C;  4A3L H;  1K9M C;  2I5M X;  2QF7 A;  4DUY Q;  1L1O B;  1STN A;  4XT1 B;  4R4Q A;  2EIF A;  2VUM H;  4DR6 L;  2VB2 X;  4HN7 A;  1MJE A;  2PZU A;  2Y0S G;  2F0U A;  3HOX G;  4CDD C;  5IGC A;  3M4O B;  1YIJ A;  4LF4 Q;  4OHJ A;  1SYD A;  4FXD A;  3GDE A;  4DV6 L;  5D14 A;  2BDO A;  1TR5 A;  1ASZ A;  4WJ3 M;  4RA8 A;  1VCI A;  2RKS A;  3SR1 A;  5D3I B;  3FKI H;  4R4C A;  4NDX A;  3S1M B;  2IY5 B;  3GTQ B;  2JEA I;  3AYH B;  3IRB A;  3GTP B;  4YY3 L;  2IHF A;  1U4M A;  3H94 A;  4GN5 A;  2F4V L;  4DR2 L;  1HA5 A;  3M4P A;  4CKB A;  3EJI A;  5C4Z A;  1BQQ T;  5DAU A;  3TSS A;  1D8L A;  3SK6 A;  3PGZ A;  4BY1 B;  1A0I A;  2N8N A;  5G3L F;  1EY5 A;  2OXP A;  4YCV A;  1RIP A;  2MUY A;  4PMC A;  1EWC A;  1VMC A;  3S1Q H;  1SNO A;  4YHH L;  2F0T A;  4BXX H;  1G6Z A;  2JA9 A;  2L1B A;  3CCU A;  1M1K C;  4NXM Q;  2ID0 A;  5CYU A;  1WYD A;  3EQL C;  4DR3 Q;  1NTG A;  4CDC C;  4EX5 A;  2WAQ G;  5GRO A;  1EY0 A;  5FKA C;  4DR3 L;  4CBV A;  1EYG A;  1JB7 A;  2K03 A;  3A7A B;  4A75 A;  2EVB A;  1CQV A;  1CSP A;  3UE0 A;  1D1I A;  2CKZ B;  1LM0 A;  1ICF B;  4RCN A;  4JI2 Q;  4LW1 A;  4PMB A;  3S1N B;  3BDC A;  3ND9 A;  5C0X J;  3U4V A;  1G51 A;  2EJM A;  4N8F A;  4DAY B;  3JAM L;  2F0N A;  3S15 B;  4C3I B;  3R2T A;  4UDU C;  1QB5 D;  1T5E A;  1BCP F;  1HTP A;  3AMU A;  1GD7 A;  1AW7 A;  3NK9 A;  1M90 C;  3I56 A;  4DK6 C;  5J1Z A;  2A8V A;  2F3I A;  4DR2 Q;  2NTS A;  2R93 H;  1VQP A;  3I3C A;  1EQT A;  2B2U C;  2BH2 A;  2UUA L;  2ES2 A;  2K5D A;  3AQQ A;  4YY3 Q;  3HOV G;  2L12 A;  2KVM A;  1D6E C;  4HIO A;  1YNN D;  5ELE A;  3HKZ E;  5E4W C;  3T4A C;  1RCV D;  1Y1V H;  1GHJ A;  3FMC A;  4LF9 L;  1EUJ A;  4K0K Q;  1K3B C;  2K1B A;  2A6H D;  1HNW Q;  3I4N B;  3C3L A;  1H9S A;  4DR6 Q;  2I5H A;  2DN8 A;  1CTM A;  2QGQ A;  4N9P A;  3L0O A;  3CCE A;  5E3F A;  1XMQ L;  3S1M H;  2BA1 A;  2E5L L;  3SHL A;  3FKI B;  5KNC A;  2MQH A;  5I2Y A;  2MO0 A;  4I65 A;  5A2Q E;  1VF7 A;  1NSN S;  5M3F B;  4QCL A;  4DU9 A;  3RLN A;  5CC4 A;  1X3E A;  4IPD A;  3GTO B;  4KN7 C;  1K83 H;  2B2T A;  4GS3 A;  4NPS A;  1SN8 A;  4KHP Q;  2VUM B;  4P2C B;  3TBI B;  1N34 L;  4R4T A;  2WKD A;  1AFP A;  1NMF A;  2BE5 C;  1VQ9 A;  4QF4 A;  3QOL A;  3B6Y A;  3IL8 A;  3K0X A;  1KDB A;  4DF7 A;  3T1H Q;  3T1Y Q;  1RTN A;  3FEW X;  2I07 B;  1UE5 A;  3A8J E;  4JPB W;  2MPM A;  1R4Q B;  3HKZ G;  4AH6 A;  2ZJR A;  4APV A;  1EZ6 A;  4K5W A;  1S3O A;  4CDE C;  1FYC A;  3GV6 A;  5JAV A;  5EPL A;  2B2V C;  1HR0 Q;  3DM1 A;  3Q6S A;  1SNM A;  3KLR A;  2WFW A;  4Q5V A;  1VQD A;  2BDN A;  4X62 L;  4G7O C;  1Z47 A;  2ICE C;  1XNQ Q;  1XTC D;  4IFD J;  4AYB B;  1XMO L;  2IWH A;  4F8M A;  1I5F A;  4DAY A;  3T16 A;  3H3V C;  4NKL A;  2B8G A;  5IGB A;  3GTG B;  1Y1V G;  1PH8 A;  4A3G B;  1LYL A;  4KMU C;  1FR3 A;  2HT1 A;  4J15 A;  2EYL A;  2EOT A;  3PO2 G;  2VZA A;  3MXN B;  3GO5 A;  4HJ9 A;  1F2Z A;  1U0L A;  1NR4 A;  3CC7 A;  4A93 H;  4BY7 H;  2EYF A;  2G9H D;  4DV1 Q;  2PQA B;  3BDO A;  1KNE A;  4TSS A;  1W6J A;  1LTG D;  2ZJQ A;  2E8G A;  3JAM c;  4LFC Q;  1NAP A;  4GNX B;  1MSH A;  3GP7 A;  3ZYY X;  3JAM E;  4OX9 Q;  1IBL Q;  4JI4 Q;  1PH2 A;  1VQE A;  2NZ1 D;  1PTO F;  3PF5 A;  2CHB D;  1A8V A;  4IUR A;  4X3U A;  4L8J A;  1C4Q A;  5FK9 C;  2EY2 A;  4ID6 A;  5ELD A;  2CWP A;  1SXT A;  5K36 G;  3ICE A;  2HD3 A;  2F0J A;  1PRT B;  2B63 B;  3R3O A;  4C3J B;  5H1S E;  1EY7 A;  4XTC S;  1SNP A;  3OIP A;  2KUM A;  1HFG A;  5M3F G;  2K5V A;  1O7Y A;  3OSO A;  1Y69 U;  4LF6 Q;  4A3B H;  5DLQ E;  1VQ4 A;  4A3G H;  1KDC A;  3Q22 A;  4DKA C;  4DV7 Q;  1BR9 A;  3CC2 A;  3KBG A;  3KJP A;  1YHQ A;  1GUN A;  4ILW A;  3A8I E;  2F0K A;  2YU9 H;  3NPP A;  3E9I A;  1UE1 A;  1OXS C;  1G2T A;  1HUM A;  4B3S L;  1UEB A;  4LUZ A;  2K52 A;  4ME3 A;  3J80 L;  2JA5 G;  2I46 A;  1I3Q B;  3ULL A;  2QDL A;  3CP0 A;  1B50 A;  2FIN B;  3E0J A;  3BS1 A;  4K8I A;  3LX0 A;  1CM9 A;  4Y7N H;  4L5S A;  1SAP A;  5KIX A;  1MIU A;  1N33 Q;  3J80 c;  3CU7 A;  2D5D A;  1TS3 A;  2LXK A;  1HNX Q;  1OXT A;  5EKI A;  1WD1 A;  4DR5 L;  1RD9 D;  4BBS H;  2F4I A;  5I9O A;  4F7X A;  1BF4 A;  1IZ6 A;  5LMU Q;  4JBK A;  2JA7 H;  5IP9 G;  2FXQ A;  4DR7 Q;  4XT3 B;  3D8G A;  2KED A;  4L6T B;  1JCK B;  2N3S A;  4O2D A;  1QJO A;  5BR8 L;  5FLX L;  2NZH A;  2EQS A;  3BZK A;  1E24 A;  2HDL A;  2HHH Q;  1VQF A;  3HOU H;  1GXD C;  4FF1 A;  4JC0 A;  4ZQ3 A;  3AFP A;  1HNX L;  3T1H L;  4CHT B;  2WAQ B;  2JA8 B;  2K5W A;  4GNX A;  1L0Y B;  1BVS A;  1K3R A;  2D0O A;  4ULL A;  1IL8 A;  1TWA B;  1EOV A;  1AE3 A;  3NSW A;  2QCP X;  4NMZ A;  3PIO 3;  3SXH A;  4DXG A;  2E76 C;  4JI1 L;  2GA4 B;  1EWH A;  3ULJ A;  3KK7 A;  3MHB A;  3UE1 A;  5IYD H;  2E2H H;  5C0X H;  5CBA E;  2BE5 D;  5IP7 G;  4BA1 I;  5JVH 3;  3CCM A;  1EYD A;  1CKN A;  2ZTE A;  5EBC A;  4AQY Q;  1Y1V B;  2C35 B;  1VQK A;  1TVX A;  4YIJ A;  3UI2 A;  5M5W B;  1CZG A;  1C48 A;  2NZO A;  3NTK A;  1ENA A;  3CAM A;  2EZV A;  4DR4 L;  3I7F A;  3TME A;  3VDY A;  1HA6 A;  3N52 A;  2R93 B;  1J5E Q;  5KGU A;  3QO2 A;  1EY8 A;  2I0Q A;  2F0W A;  2PI2 A;  4M8A A;  4L63 B;  1I6H B;  1B4O A;  3PSI A;  5IWA Q;  1E22 A;  4X64 L;  5C44 H;  1YEZ A;  3RD4 A;  4X3T A;  1IL2 A;  4YCU A;  3TDQ A;  2DY8 A;  5C3X A;  2ZXO A;  2KBN A;  1KAB A;  1LT5 D;  5D3D A;  2A6E D;  1KLG D;  2UUA Q;  3TEH B;  3GQB A;  3K80 C;  1EYA A;  1PZJ D;  1VF5 C;  3W3A A;  5C3E G;  2F0D A;  2QDB A;  4A3L G;  3S1R H;  4DFA A;  4GKJ Q;  2F3V A;  2F0S A;  2XTI A;  2RBM A;  4OXP A;  1ZKO A;  4K6L A;  1DCZ A;  3U58 A;  1F9P A;  4KKT A;  5C4J B;  3S1Q B;  2H1E A;  2R7D A;  2XSC A;  3K58 A;  1FVI A;  4LJZ C;  3TS0 A;  4QB4 A;  1JWU D;  3J7Y W;  4HCS A;  2J4X A;  3M7N A;  3R2I A;  2VL6 A;  1WTQ A;  3ER0 A;  2EYP A;  2YTV A;  1LTB D;  4TQU S;  3VR4 A;  1UAP A;  3VYU A;  1D1K A;  2EE1 A;  3GTQ H;  3I4N G;  4RFB A;  4B3T L;  1B53 A;  3A5U A;  2OQ0 A;  5D65 A;  4A3F H;  3C2P A;  2D9U A;  3VR5 A;  4O42 A;  5I9P A;  3DM3 A;  1XPR A;  1KC8 C;  3D4R A;  1B9M A;  2E2D C;  1JT8 A;  1Q8I A;  1EIG A;  1VQI A;  3CCS A;  2WIN B;  5FO7 B;  4C1N K;  2E2J H;  2JJQ A;  2HCI A;  4HJ7 A;  4ZUI A;  3STB D;  1EQV A;  2ZM6 Q;  1CKM A;  3VA7 A;  1KTK A;  2SEB D;  3E0E A;  3C1E A;  2EXD A;  4DR7 L;  5G3L D;  1CFM A;  3VR2 A;  1IYJ B;  4X3K A;  2K6A A;  4HR7 B;  4I7Z C;  2DUD A;  1VQB A;  1CI3 M;  5KYL A;  1O7I A;  2WV6 D;  1I94 L;  1V1P A;  2GVA A;  2V1C C;  3PIP 3;  1J6Q A;  4HIM A;  1NNX A;  4R8N A;  4FYD A;  3J7A 5;  3J81 i;  5M5X B;  1IW7 D;  4DV7 L;  2RDF A;  1L0W A;  1MKH A;  1J5E L;  2G9D A;  4DNT B;  1WCM H;  5KEE A;  3M4Y A;  1TT2 A;  3RUZ A;  3N6R A;  2Z4H A;  1S5D D;  2EYO A;  5KYI A;  4QY7 A;  4JBJ A;  1V43 A;  3AB9 A;  1TXY A;  1W3S A;  1EQR A;  3KFU A;  1VQ6 A;  1KRS A;  5LMN L;  4QIW E;  3HKS A;  2ZT9 C;  4N8X 1;  1D5M C;  1VQL A;  4HMI A;  1A6X A;  3A0J A;  1HQM C;  3GTJ B;  5EGT A;  3BU2 A;  3QOJ A;  4DV5 L;  4LK1 C;  3HS0 C;  3MXP A;  2HCC A;  2Q2T A;  4IAL A;  2E2I B;  5M5Y H;  1TWG H;  5HUR A;  3L3O C;  1V1P B;  3J7Z C;  3ERQ A;  1IBM Q;  5LMN W;  4A3K G;  3FP9 A;  4KKU A;  4YWL A;  3DWA A;  3ERO A;  2D0P A;  3ERS X;  2F0G A;  2A74 C;  5JPN C;  3S2H B;  2F3W A;  4A3I G;  2YYZ A;  4YWK A;  5COY A;  5LL6 X;  5C5M A;  1PFS A;  2F0M A;  2EXZ A;  3HOX B;  3CCL A;  4RAU C;  1XX8 A;  2ALY B;  3S14 B;  1SE8 A;  1EU3 A;  2F0Q A;  1TS2 A;  3KYH C;  1LTL A;  4OIK A;  1O80 A;  3Q24 A;  3CPF A;  1VQ5 A;  3FDT A;  2F1M A;  2JEB I;  1GUS A;  5FLX c;  5C4X G;  1S4Z A;  3W2D A;  1WCM G;  3M9B A;  4KY7 A;  4A3K B;  1Z7T A;  4OX9 L;  3GTL B;  4HMJ A;  2VQF Q;  4YWM A;  1G8Z D;  1FNV A;  2M2L A;  1Q81 C;  4C3H B;  5ISR A;  4MIU A;  3G7L A;  1VQ8 A;  4FVM A;  1SBB B;  3F8T A;  4P75 A;  1TKW B;  4IPH A;  1YHA A;  1SMY D;  3PO3 H;  5DEH A;  2KEC A;  1DM0 B;  4BBR H;  4PG3 A;  5EPJ A;  4RMF A;  1PTO B;  1JOR A;  3CQZ H;  5IYD G;  1DZ1 A;  4ZLT F;  4G7H C;  4IUT A;  4A93 G;  1HQR D;  4NB3 A;  3K59 A;  2A73 B;  2DNE A;  1TU2 B;  2VQF L;  2RHS B;  1EY6 A;  2XNA C;  3RMH A;  1OTC A;  1S5E D;  2B2V A;  1X6O A;  3S16 H;  1VQO A;  2NVY H;  3CQZ B;  4JI0 L;  2C9O A;  1AEX A;  1PDQ A;  1KRT A;  4BBR B;  4IO9 A;  2AQ2 B;  1PYW D;  4JOI A;  5CV9 A;  2NBF A;  1I6V C;  2K04 A;  4ABN A;  1CHQ D;  5A2Q L;  2RA4 A;  2UXC L;  1SLJ A;  5LMN Q;  3OW2 A;  5BN4 A;  2CCZ A;  1I4G A;  4RH6 A;  3CC4 A;  2PZW A;  1FNW A;  4JI7 L;  3DXJ C;  3P7J A;  3U9O A;  3F2C A;  1NR2 A;  1HFN A;  1IKM A;  5FLX E;  3MFY A;  3RNU A;  4QGU A;  3I55 A;  2K7V A;  5FLM G;  3H0G G;  2OF1 A;  1N34 Q;  3K57 A;  4QUC A;  2X69 A;  3CCV A;  4GLA C;  5F2D A;  3A74 A;  2JA6 B;  5ELB A;  1G6P A;  4K0K L;  4A3C H;  1CT1 D;  4XYQ A;  1W6K A;  3VR6 A;  4X66 Q;  2BOS A;  1EWI A;  1UWV A;  2EYJ A;  4BBR G;  4P71 A;  4WJ4 A;  2K5Q A;  3PO3 G;  3CW2 C;  1N32 L;  4POF A;  3ULP A;  2UXB Q;  4JI8 Q;  4DV1 L;  1PV4 A;  3ITP A;  1PTO D;  5IYC G;  4L5Q A;  1Y1W G;  3QR8 A;  3DHQ A;  3CCR A;  1XMQ Q;  1T5X D;  4JI1 Q;  4AQY L;  1SDF A;  2HQE A;  4XDX A;  2R92 B;  1TWG B;  1NJI C;  3VYS A;  2V4D A;  1VDZ A;  2F0V A;  5JJZ A;  1TII D;  4DGZ A;  1XJV A;  3C46 A;  4LFB Q;  1TWF H;  4OEL B;  4A76 A;  1JC7 A;  3I4M B;  1XNQ L;  1QE6 A;  5EJW A;  1ROD A;  3U50 C;  2O2L D;  2UUC L;  3PUZ A;  3S17 H;  3TS2 A;  4X65 Q;  3J81 j;  2RF4 A;  2DJF C;  1F77 A;  2KJX A;  4DNR B;  3I70 A;  1BUV T;  4A3F G;  1K8G A;  4LFC L;  4NXM L; 
#chains in the Genus database with same CATH homology
 4C2M B;  3O13 A;  1U9R A;  1DYQ A;  4KN4 C;  1WCM B;  5C3E B;  2H4O A;  1ET6 A;  2D62 A;  5IGE A;  2KCN A;  2Z4I A;  1BOS A;  5C0X I;  5TSS A;  2PPB C;  3TP7 A;  1HPC A;  2K33 A;  3NBI A;  1R9T B;  2SNM A;  1X3P A;  1VMP A;  2F0O A;  1PZK D;  1DON A;  1HCZ A;  2PW5 A;  4FNF A;  2E74 C;  1PXU A;  2NVQ B;  2O5I C;  2F0E A;  1IKL A;  1IYV A;  4A3E B;  3ND8 A;  1EY4 A;  2XRS D;  4MN3 A;  3GTK B;  1OO9 B;  2NN6 G;  4TRD A;  3SEB A;  2QKI C;  4HSV A;  4OO1 H;  3BYT B;  2JA5 B;  1O78 A;  3P75 A;  2EY5 A;  2LS0 1;  1D5Z C;  2NB0 A;  1STB A;  1M4V A;  2BA0 A;  3MA2 B;  1E0B A;  4O1N A;  1Q1B A;  3DMU A;  5LHY 1;  4IFD I;  3H91 A;  4RGN A;  5ELC A;  1D2B A;  3CHB D;  2WB1 B;  3GTM B;  2XN9 C;  3I4L A;  4IFD H;  4HTH A;  4IUN A;  5C6A A;  2A6E C;  1LO5 D;  4V19 0;  4PNY A;  3I72 A;  4K2L A;  3HOW B;  1CZW A;  4F88 A;  3K5M A;  4FXG C;  4RHR A;  4FO2 A;  2PZT A;  1JOO A;  3MVV A;  2EDG A;  1S5B D;  3NWS A;  1O7Z A;  1WTV A;  1QNU A;  4HED A;  4IUP A;  3I73 A;  5JVG 3;  1B2T A;  2JP1 A;  1EY9 A;  4LMQ D;  4CKC A;  1STG A;  2KOL A;  3OHX C;  1SSO A;  3PV0 A;  2D2C C;  3K0Y A;  5J22 A;  3RZD B;  1KDA A;  1BXT A;  1GUT A;  4RWS C;  5CV5 A;  2KEE A;  4B08 A;  2PNR C;  1II3 A;  3KBX A;  1A2U A;  1X3Q A;  3A54 A;  2K28 A;  4IFD G;  5J39 A;  2B2Y A;  2RSN A;  2MHV A;  1EEF D;  3VA5 A;  1H9M A;  5JPM C;  1A3V A;  1F9S A;  3EA6 A;  1Q3L A;  1S5F D;  1ZXT A;  3SE0 A;  3HP3 A;  2EJG C;  2FMM A;  2A69 C;  5I4D A;  5IOC A;  4K8J A;  3R8B A;  1AZP A;  3OW7 A;  5M3M B;  5COR A;  3HOY B;  5CGK A;  3AU7 A;  1JQY D;  2SOB A;  2ICI A;  1GJX A;  3D4D A;  2LKV A;  4H7B A;  3NUC A;  5KND A;  1PZI D;  2NVY B;  3S16 B;  5C3W A;  2R7Z B;  1GUG A;  1ET9 A;  3TP6 A;  2B39 A;  1A3U A;  1V8Q A;  4G57 A;  4U68 A;  3NQI A;  1QOH A;  2NWG A;  1SJH D;  2YU9 B;  3I90 A;  3I8Z A;  3PO3 B;  5IT9 L;  1GUO A;  3GD7 A;  4A3B B;  4QMG A;  1GHK A;  1STH A;  2N55 A;  1DXM A;  2IX1 A;  2CW0 C;  1WTX A;  1LT3 D;  5KRU A;  1MD2 D;  3TZD A;  4PV1 C;  4R8I A;  1MBY A;  1DOL A;  4CJ2 C;  1F2Y A;  5CV8 A;  5I6Y A;  5AFW A;  5IOD A;  3FPP A;  4C56 C;  1LLR D;  3I91 A;  1Z6H A;  4JK1 C;  4RKB A;  2XRQ D;  1OXV A;  3X3N A;  2EPB A;  1GOZ A;  1PRT C;  1CA6 A;  1OXX K;  3URY A;  1F2L A;  2EJF C;  1BCP D;  3TP8 A;  5M5Y B;  1OXU A;  3T13 A;  3NE5 B;  2Z8L A;  2L5T A;  1U4R A;  4A93 B;  2TMP A;  5C0X G;  1DOM A;  3KF8 A;  3A8K E;  3H6M A;  4ZYS A;  1XWE A;  1B44 D;  1RKN A;  2L55 A;  3HGB A;  4KJO A;  2A69 D;  5IGF A;  5C5L A;  3MZ5 A;  1Y8N B;  4R9W A;  4XYO A;  1MGS A;  3M85 A;  4C3H G;  1Q1E A;  4OGQ C;  3J81 E;  1KNA A;  3HZX A;  2NUC A;  3SVM A;  3K5L A;  1LTR D;  4PQX A;  4ODG A;  4A3D B;  2A6H C;  1JOK A;  5CMD A;  1H9J A;  4ZK9 B;  3LWU A;  5EKK A;  2KA7 A;  5NUC A;  3E6Z X;  2QIL A;  1K8O A;  5FOB B;  3K7A B;  3PUW A;  3SDZ A;  3LWE A;  3D4W A;  3IFD A;  4DK1 A;  1YNN C;  2B2T C;  2B2Y C;  4N9T A;  3V96 A;  1LTA D;  3G6J B;  4PMW A;  1HRJ A;  2VNU D;  4KK7 A;  3R93 A;  1ZYR D;  4IZ8 A;  5FO8 B;  1ZYR C;  1ICW A;  4DK0 A;  1MI2 A;  2Z1C A;  2OEO A;  1Q12 A;  2RSO A;  5M9O A;  3C1F A;  1G91 A;  4BA2 I;  4OO1 I;  3WOF A;  2HUG A;  2XIW A;  1Y1W B;  3VR3 A;  2O4X A;  5EPK A;  4XQQ A;  1F2M A;  2PMZ B;  1F9R A;  1FD7 D;  3L7Z C;  1BCP C;  2Q8R E;  3J81 L;  2A68 C;  3BDL A;  2A5H A;  2A68 D;  3P1H A;  3S1R B;  2AUJ D;  4H44 C;  1RJT A;  3H0G B;  1PTO C;  5K36 H;  1LTS D;  1I4X A;  1TWC B;  3BZD B;  4ZRZ A;  1RDP D;  2WP8 J;  3QWN A;  5CV7 A;  2ENB A;  2BCO A;  2MGS A;  2XVS A;  1JB3 A;  5JOB A;  1O7L A;  3EVQ A;  5EKL A;  4B9W A;  2DNC A;  2AUK A;  3S17 B;  2R6G A;  4EGV A;  2B2W C;  4K2K A;  2CW0 D;  2NVT B;  2PQE A;  1TWF B;  2ZXP A;  1SYF A;  3CRL C;  3NTH A;  1RTO A;  4CJ1 B;  3PUX A;  2M00 A;  3TN2 A;  2IT1 A;  1AZQ A;  5CBE E;  1BCP B;  1STE A;  1BO0 A;  1EU4 A;  3MXN A;  4NP5 A;  3OPO A;  5IGG A;  2E2H B;  3SK4 A;  1STA A;  4IUQ A;  1ILP A;  1HHV A;  3HOZ B;  1G29 1;  1RF2 D;  1EYC A;  3MWY W;  4FF2 A;  1ESF A;  1AP0 A;  2IX3 A;  2AQ3 B;  1U4P A;  2F0P A;  3HG9 A;  2HDM A;  1JR0 D;  2J7Z A;  1QIL A;  4EVO A;  4DN4 M;  4V0B A;  1SEB D;  3A7L A;  5JEA H;  1BBX C;  4C1N I;  1I4Q A;  1WD0 A;  1Q90 A;  4B9X A;  2SDF A;  4FXK C;  4H13 C;  1R4P B;  3NP8 A;  5E1F A;  4BBS B;  2Q8T A;  4A3I B;  3DWQ A;  4GZY C;  3D31 A;  1HXY D;  1WTR A;  5BN3 A;  3QG1 A;  4ZUJ A;  3NQT A;  2RVL A;  1JWS D;  1Y8O B;  2F0H A;  2F0I A;  2WII B;  3DUZ A;  4Y7N B;  1L0X B;  1KAA A;  1D5X C;  4XIG S;  1SYC A;  1SND A;  2EY6 A;  4ZKB B;  3ONA B;  1SE2 A;  4BWG B;  3J7A V;  5T1G A;  2N88 A;  4EQO A;  1PTO H;  3MXU A;  2MP1 A;  1G2S A;  4LAA A;  5K5P A;  3M7G A;  2LMC B;  4HSP A;  4QUF A;  1DOK A;  1UEA B;  1EZ8 A;  3K5N A;  3IAY A;  1PFN A;  5CV6 A;  1WTW A;  2Y0S B;  1EIH A;  3MXG A;  4WJW A;  2X6L A;  3WOE A;  2FFK B;  3OWE B;  4X3S A;  4WOR A;  2Q8I B;  2LFN A;  2DY7 A;  1JOQ A;  3MTS A;  3BVZ A;  2RDH A;  3HEJ A;  1SYG A;  2IX0 A;  5E4X A;  4KY6 A;  4RKL A;  3CKI B;  4TKO B;  2K01 A;  3FPU B;  4KHV A;  4KD4 A;  1K8M A;  2XWJ B;  4KTA A;  3RZO B;  4FF4 A;  1PFB A;  3BVM A;  1AN8 A;  4BY7 B;  5ELF A;  2C5C A;  4HCE A;  2IW3 A;  4OO1 G;  2AWN A;  4CJ0 B;  1MSG A;  1PFM A;  2JYO A;  1LAB A;  1UNS A;  3PUY A;  1WTO A;  1X32 A;  4RHS A;  4XQJ A;  1CHP D;  1E2Z A;  5HGT A;  4WFN 3;  2PCF B;  2F0F A;  1QNK A;  3OMG A;  3PUV A;  2NN6 I;  1A15 A;  1KLU D;  4FP5 D;  4C3J G;  1ZEQ X;  3D6W A;  5JEA J;  4KI0 A;  4CKE A;  3MC0 B;  4RCO A;  3U9S A;  5DM6 3;  1ESR A;  4M1U B;  2B2U A;  3OIQ A;  2B2W A;  2KQ3 A;  1CQF A;  4KV6 A;  1SMY C;  3T51 B;  2J0T D;  1BDO A;  3NXW A;  4FF3 A;  1SFO B;  1LV9 A;  2RDG A;  1F9Q A;  5I2X A;  1EEI D;  2E2J B;  3PMF A;  1H9S B;  2NYZ D;  4OIJ A;  2CQA A;  1Y8P B;  1CA5 A;  3SK8 A;  1K83 B;  4K5V A;  1HTL D;  1TWH B;  4IUV A;  2VB3 X;  3DEO A;  3HRZ C;  4ME5 A;  4S3S A;  1WVL A;  1QWY A;  3DWP A;  4A3F B;  1YNJ D;  1BNZ A;  1YNJ C;  1JIC A;  1QG7 A;  3PO2 B;  1NUC A;  2R3Z A;  2JE6 I;  3E5S A;  1V1O A;  3H09 A;  4G7Z C;  2JSO A;  2PW7 A;  4KHZ A;  1LT6 D;  3KUP A;  3D6C A;  5DNF A;  1TS4 A;  3F2U A;  1C8C A;  1I4H A;  1FGB D;  4F87 A;  4UAI A;  2LY7 A;  4CGY B;  5LL6 S;  3A56 A;  3BVG A;  2QEJ C;  2TSS A;  4HAE A;  3M3Y B;  4KD3 A;  1ML0 D;  1NCV A;  2XWB B;  2B8F A;  1DJR D;  1SYB A;  2EYM A;  4E6I A;  4RGM A;  4IN3 A;  3D3R A;  1PRT D;  1TY0 A;  3Q23 A;  2IL8 A;  1I4R A;  1UUP A;  3J80 E;  5IGD A;  1E2V A;  3LNN A;  3OMC A;  5C44 B;  1XYI A;  3MAQ A;  2E75 C;  4RGT A;  1TS5 A;  1E2W A;  5CR3 A;  4K14 A;  4IUU A;  2F0L A;  1J9O A;  2L4N A;  1A3T A;  2IPK D;  1EFI D;  3X3M A;  1SNC A;  3QB3 A;  2PYK A;  3P20 A;  2WAC A;  4NW2 A;  1B1Z A;  3T53 B;  4XQN A;  3BYY B;  1LTT D;  2K32 A;  2K05 A;  3NBH A;  2SNS A;  1WTP A;  3TP5 A;  4K5X A;  2ZXR A;  3RLF A;  3QIA A;  3T56 B;  5IIF A;  5IT9 E;  1LAC A;  4IQZ A;  5BN5 A;  2MJ8 A;  3HOU B;  2EYH A;  2M9V A;  3MFG A;  3DEP A;  4Q0F A;  1PMR A;  5C4X B;  4C3I G;  1SJE D;  2JA7 B;  5KNB A;  2L0C A;  2O5J C;  4KKS A;  1M8A A;  3GV3 A;  5FO9 B;  4DAV A;  3KLS X;  2IJ0 A;  2WKC A;  4K6D A;  1IYU A;  3IKJ A;  1H9K A;  2JXM B;  3V2T A;  1XXG A;  1EL0 A;  4QIW B;  1ENF A;  5EQ0 A;  2FMC A;  2VXW A;  1ONL A;  4KJN A;  1PLF A;  3A55 A;  1SE3 A;  3S2D B;  1I4P A;  1H9R A;  3NHH A;  1LT4 D;  2X6G A;  3MEH A;  1TY2 A;  4A3J B;  1S5C D;  1A2T A;  3OWF A;  1STY A;  4J1M A;  3CRK C;  4H0L C;  1JWM D;  1GUW A;  1B9N A;  2EY1 A;  2FJ2 A;  1CK1 A;  3HKZ B;  3SK5 A;  4G4K A;  2RQX A;  4KY5 A;  3FRP B;  4BS9 A;  1RHP A;  1EOT A;  2AWO A;  3EFX D;  3K5O A;  3S9W A;  4Z9C B;  4EQN A;  2L11 A;  2KCC A;  4RGO S;  4DAP A;  4WRD A;  1LTI D;  3Q0A A;  4J6H A;  2FHT A;  5C4H A;  3NWT A;  4MHE A;  4A3M B;  2OT2 A;  3IFT A;  1DD2 A;  2NTT A;  2L9H A;  1B3A A;  3V05 A;  1JE4 A;  4DXF A;  1ILQ A;  5T1I A;  2F03 A;  5EBD A;  2R61 A;  3WDN A;  4U67 3;  2AQ1 B;  1QCB D;  5I6W A;  4XXE A;  3NTI A;  4JBW A;  3BG3 A;  1I50 B;  4ZKC B;  1IHZ A;  1J8I A;  3J7A F;  3FVQ A;  1SYE A;  4J8Q A;  5A35 A;  2NN6 H;  1HUN A;  3KLS A;  3TZU A;  1U4L A;  2CVR A;  1FNU A;  3OOC A;  1SNQ A;  3QJY A;  3K6O A;  1IW7 C;  3HOV B;  1PRT F;  1ENC A;  4DA2 A;  4EQP A;  2PO4 A;  2NVX B;  5DM7 3;  3VYT A;  5JEA G;  5CV4 A;  4OL7 A;  3L9A X;  4ZAI A;  1SE4 A;  2KHS A;  1TQO A;  3VYR A;  2QF7 A;  1STN A;  4XT1 B;  2VB2 X;  4HN7 A;  2PZU A;  2F0U A;  3M4O B;  5IGC A;  4OHJ A;  1SYD A;  4FXD A;  5D14 A;  2BDO A;  1TR5 A;  4RA8 A;  1VCI A;  2RKS A;  3SR1 A;  5D3I B;  4NDX A;  3S1M B;  3GTQ B;  2JEA I;  3GTP B;  3H94 A;  1U4M A;  1HA5 A;  5C4Z A;  4CKB A;  3EJI A;  1BQQ T;  5DAU A;  3TSS A;  3SK6 A;  4BY1 B;  5G3L F;  1EY5 A;  2OXP A;  2MUY A;  4PMC A;  1EWC A;  1VMC A;  1SNO A;  2F0T A;  1G6Z A;  2L1B A;  2ID0 A;  5CYU A;  3EQL C;  1EY0 A;  5FKA C;  4CBV A;  2K03 A;  3A7A B;  2EVB A;  1CQV A;  1D1I A;  4RCN A;  4PMB A;  3S1N B;  3BDC A;  3ND9 A;  5C0X J;  2EJM A;  3JAM L;  2F0N A;  3S15 B;  4C3I B;  3R2T A;  4UDU C;  1QB5 D;  1T5E A;  1BCP F;  1HTP A;  3AMU A;  1AW7 A;  3NK9 A;  5J1Z A;  2NTS A;  3I3C A;  1EQT A;  2B2U C;  2K5D A;  2L12 A;  2KVM A;  1D6E C;  1YNN D;  5ELE A;  5E4W C;  3T4A C;  1RCV D;  1GHJ A;  3FMC A;  2K1B A;  2A6H D;  3I4N B;  3C3L A;  1H9S A;  2DN8 A;  1CTM A;  4N9P A;  5E3F A;  2BA1 A;  3SHL A;  3FKI B;  5KNC A;  5I2Y A;  4I65 A;  5A2Q E;  1VF7 A;  1NSN S;  5M3F B;  4QCL A;  4DU9 A;  5CC4 A;  3GTO B;  4KN7 C;  2B2T A;  2VUM B;  4P2C B;  3TBI B;  2WKD A;  1AFP A;  2BE5 C;  4QF4 A;  3QOL A;  3IL8 A;  1KDB A;  4DF7 A;  1RTN A;  3FEW X;  2I07 B;  3A8J E;  2MPM A;  1R4Q B;  1EZ6 A;  4K5W A;  5JAV A;  1FYC A;  3GV6 A;  5EPL A;  2B2V C;  3DM1 A;  3Q6S A;  1SNM A;  3KLR A;  4Q5V A;  2BDN A;  4G7O C;  1Z47 A;  2ICE C;  1XTC D;  4IFD J;  4AYB B;  2IWH A;  4F8M A;  4DAY A;  3T16 A;  3H3V C;  4NKL A;  2B8G A;  5IGB A;  3GTG B;  4A3G B;  4KMU C;  1FR3 A;  2EYL A;  2EOT A;  3GO5 A;  1F2Z A;  1NR4 A;  2EYF A;  2G9H D;  3BDO A;  1KNE A;  4TSS A;  1W6J A;  1LTG D;  1NAP A;  1MSH A;  3GP7 A;  3ZYY X;  3JAM E;  2NZ1 D;  1PTO F;  2CHB D;  4IUR A;  4X3U A;  4L8J A;  1C4Q A;  5FK9 C;  2EY2 A;  4ID6 A;  5ELD A;  1SXT A;  5K36 G;  2F0J A;  1PRT B;  2B63 B;  3R3O A;  4C3J B;  1EY7 A;  4XTC S;  1SNP A;  3OIP A;  2KUM A;  1HFG A;  1O7Y A;  3OSO A;  1Y69 U;  1KDC A;  3Q22 A;  1BR9 A;  3KBG A;  1GUN A;  4ILW A;  3A8I E;  2F0K A;  3NPP A;  1OXS C;  1G2T A;  1HUM A;  3J80 L;  2I46 A;  1I3Q B;  1B50 A;  2FIN B;  3E0J A;  3BS1 A;  4K8I A;  3LX0 A;  1CM9 A;  1SAP A;  5KIX A;  3CU7 A;  2D5D A;  1TS3 A;  1OXT A;  5EKI A;  1WD1 A;  1RD9 D;  2F4I A;  5I9O A;  4F7X A;  1BF4 A;  4XT3 B;  3D8G A;  2KED A;  4L6T B;  1JCK B;  1QJO A;  5FLX L;  2HDL A;  1GXD C;  4FF1 A;  4ZQ3 A;  4CHT B;  2WAQ B;  2JA8 B;  2K5W A;  1L0Y B;  4ULL A;  1IL8 A;  1TWA B;  3NSW A;  2QCP X;  4NMZ A;  3PIO 3;  3SXH A;  4DXG A;  2E76 C;  2GA4 B;  1EWH A;  3KK7 A;  3MHB A;  5C0X H;  5CBA E;  2BE5 D;  4BA1 I;  5JVH 3;  1EYD A;  5EBC A;  1Y1V B;  1TVX A;  4YIJ A;  3UI2 A;  5M5W B;  1CZG A;  1C48 A;  3NTK A;  1ENA A;  2EZV A;  3TME A;  1HA6 A;  3N52 A;  2R93 B;  5KGU A;  3QO2 A;  1EY8 A;  2F0W A;  4M8A A;  4L63 B;  1I6H B;  1B4O A;  3RD4 A;  4X3T A;  3TDQ A;  2DY8 A;  5C3X A;  2ZXO A;  1KAB A;  1LT5 D;  5D3D A;  2A6E D;  1KLG D;  3GQB A;  1EYA A;  1PZJ D;  1VF5 C;  3W3A A;  2F0D A;  2QDB A;  4DFA A;  2F3V A;  2F0S A;  2RBM A;  1ZKO A;  4K6L A;  1DCZ A;  1F9P A;  4KKT A;  5C4J B;  3S1Q B;  2H1E A;  2XSC A;  3K58 A;  4LJZ C;  4QB4 A;  1JWU D;  3J7Y W;  4HCS A;  2J4X A;  3M7N A;  3R2I A;  1WTQ A;  2EYP A;  1LTB D;  4TQU S;  3VR4 A;  1UAP A;  3VYU A;  1D1K A;  2EE1 A;  4RFB A;  1B53 A;  5D65 A;  3C2P A;  2D9U A;  3VR5 A;  4O42 A;  5I9P A;  3D4R A;  1B9M A;  2E2D C;  1Q8I A;  1EIG A;  2WIN B;  5FO7 B;  4C1N K;  2HCI A;  4ZUI A;  1EQV A;  3VA7 A;  1KTK A;  2SEB D;  3C1E A;  5G3L D;  1CFM A;  3VR2 A;  4X3K A;  2K6A A;  4HR7 B;  4I7Z C;  1CI3 M;  5KYL A;  2WV6 D;  1V1P A;  3PIP 3;  4R8N A;  4FYD A;  5M5X B;  1IW7 D;  2RDF A;  2G9D A;  4DNT B;  5KEE A;  3M4Y A;  1TT2 A;  3RUZ A;  3N6R A;  2Z4H A;  1S5D D;  2EYO A;  5KYI A;  1V43 A;  3AB9 A;  2ZT9 C;  1D5M C;  4HMI A;  1A6X A;  1HQM C;  3GTJ B;  5EGT A;  3QOJ A;  4LK1 C;  3HS0 C;  3MXP A;  2HCC A;  4IAL A;  2E2I B;  5HUR A;  3L3O C;  1V1P B;  3ERQ A;  4KKU A;  3DWA A;  3ERO A;  2F0G A;  2A74 C;  5JPN C;  3S2H B;  2F3W A;  2YYZ A;  5COY A;  5LL6 X;  5C5M A;  2F0M A;  2EXZ A;  3HOX B;  4RAU C;  1XX8 A;  3S14 B;  1EU3 A;  2F0Q A;  1TS2 A;  4OIK A;  1O80 A;  3Q24 A;  3FDT A;  2F1M A;  2JEB I;  1GUS A;  1S4Z A;  3W2D A;  4A3K B;  4KY7 A;  1Z7T A;  3GTL B;  4HMJ A;  1G8Z D;  1FNV A;  2M2L A;  4C3H B;  5ISR A;  4MIU A;  3G7L A;  4FVM A;  1SBB B;  1TKW B;  1SMY D;  5DEH A;  2KEC A;  1DM0 B;  5EPJ A;  1PTO B;  1JOR A;  1DZ1 A;  4ZLT F;  4G7H C;  4IUT A;  1HQR D;  3K59 A;  2A73 B;  2DNE A;  1TU2 B;  1EY6 A;  2XNA C;  3RMH A;  1S5E D;  2B2V A;  3CQZ B;  2C9O A;  1AEX A;  1PDQ A;  4BBR B;  2AQ2 B;  1PYW D;  5CV9 A;  2NBF A;  1I6V C;  2K04 A;  4ABN A;  1CHQ D;  5A2Q L;  2RA4 A;  5BN4 A;  1I4G A;  4RH6 A;  2PZW A;  1FNW A;  3DXJ C;  3P7J A;  3U9O A;  1NR2 A;  1HFN A;  1IKM A;  5FLX E;  3MFY A;  2K7V A;  2OF1 A;  3K57 A;  4QUC A;  2X69 A;  5F2D A;  2JA6 B;  5ELB A;  1CT1 D;  4XYQ A;  1W6K A;  3VR6 A;  2BOS A;  2EYJ A;  2K5Q A;  3ITP A;  1PTO D;  3DHQ A;  1T5X D;  1SDF A;  2HQE A;  4XDX A;  2R92 B;  1TWG B;  3VYS A;  2V4D A;  1VDZ A;  2F0V A;  5JJZ A;  1TII D;  4DGZ A;  3C46 A;  1JC7 A;  3I4M B;  1QE6 A;  5EJW A;  1ROD A;  2O2L D;  3PUZ A;  1F77 A;  2KJX A;  4DNR B;  3I70 A;  1BUV T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...