2B2VA

Crystal structure analysis of human chd1 chromodomains 1 and 2 bound to histone h3 resi 1-15 mek4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
175
structure length
175
Chain Sequence
EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2vA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2vA01
3P7JA 4IUTA 5EPLA 2XIWA 1DONA 2K03A 1MI2A 3QO2A 4R9WA 2MP1A 4UAIA 5T1IA 1U4MA 4ZK9B 4CJ2C 4QUCA 5EKIA 2HUGA 1ILPA 1ZXTA 1DOKA 2FHTA 2L4NA 1QNKA 1RJTA 5CBAE 4X3TA 1X32A 1ILQA 2NYZD 1CA6A 1WTVA 1EL0A 2K05A 1SSOA 2B2YA 1J9OA 1BO0A 1MSHA 2EOTA 1Q3LA 2VXWA 3KBXA 2H1EA 1KNAA 2MPMA 3KUPA 2Q8TA 4ZAIA 1U4LA 3TN2A 1CA5A 2FFKB 3N52A 1U4RA 1G2SA 2B2TA 2N88A 3LWEA 4XT1B 1RTOA 4RAUC 3DEOA 1WD0A 2M2LA 4CJ1B 2BDNA 1PFMA 5T1GA 2L9HA 3I8ZA 2B2UC 2IL8A 1HFGA 1ICWA 1VMCA 1AP0A 2HDLA 5EPJA 1KNEA 3UI2A 2X69A 3R93A 4CJ0B 1WTRA 3HP3A 1QG7A 2RSNA 1F9PA 2KECA 1PDQA 1O80A 2RA4A 1IKLA 2HCCA 1B4OA 1BNZA 3ONAB 1RODA 1X3QA 4QUFA 4RWSC 1F9RA 5E4XA 1LV9A 1A15A 1EQTA 3I90A 4LMQD 4ZKBB 1G91A 1SAPA 1F2LA 3I3CA 2CVRA 2MGSA 3MTSA 4RA8A 4IUVA 1HA6A 1WTWA 4OIJA 1WTOA 2JYOA 1O7ZA 3DM1A 5EJWA 1E0BA 3D6WA 2FMMA 4O42A 1HUMA 2B2VC 1B53A 1M8AA 2J7ZA 2FJ2A 2JP1A 2Q8RE 3TZDA 3I91A 1DZ1A 1JE4A 1G6ZA 1EOTA 2L1BA 1B50A 1ML0D 1WTXA 2EE1A 3DEPA 4OIKA 1AZQA 1WTQA 1F9QA 1XX8A 1XYIA 1X3PA 2B2UA 1PLFA 3GV3A 1ESRA 2RVLA 4MN3A 4XT3B 1IKMA 5EQ0A 1WD1A 1HRJA 1C8CA 2HCIA 1J8IA 2SDFA 1PFBA 5JJZA 3FDTA 3G7LA 2K1BA 1G2TA 3FPUB 4NW2A 1GUWA 1DOLA 2DY8A 4IUPA 2B2WC 3IL8A 3IFDA 1VMPA 2D9UA 4MHEA 1WVLA 1O7YA 1B3AA 4U68A 1SDFA 2L11A 1BBXC 4HEDA 2L12A 1AZPA 1RTNA 2HDMA 2K01A 4HCSA 1S4ZA 5EPKA 2MJ8A 4XDXA 3SVMA 5D14A 2B2VA 2NWGA 5E4WC 1MSGA 2K28A 2R3ZA 1NR4A 1MGSA 1QE6A 3GV6A 4IURA 5CORA 1IL8A 4IUQA 2KOLA 5CBEE 4X3KA 1TVXA 1U4PA 1RHPA 1BF4A 1EIHA 2DY7A 1NAPA 5D65A 5DNFA 4ZKCB 1F9SA 2B2YC 2K04A 2KVMA 1WTPA 1JICA 5COYA 4ZLTF 2X6GA 3F2UA 4R8IA 2EPBA 2B2TC 1NR2A 3H91A 1HFNA 4X3UA 5CMDA 2KEDA 4DN4M 1HUNA 3MWYW 4X3SA 1B2TA 2B2WA 2KEEA 1CM9A 2FINB 1EIGA 2N55A 2X6LA 1HHVA 1DOMA 4HAEA 1NCVA 4IUUA 2NZ1D 4HSVA 1PFNA 5AFWA 2RSOA 3Q6SA 2KUMA
chains in the Genus database with same CATH superfamily
4FF3A 2PZTA 4HJ5A 5CV9A 3RZOH 2F0EA 2ICEC 2PI2E 3I55A 3X3MA 2EYHA 2QCPX 1IYJB 1R9TB 3MXGA 1DOKA 4PZ6A 2BDOA 1BBWA 1I94Q 4LF4Q 2F0PA 2E2DC 2K05A 1BO0A 1O78A 3GTJB 3FPPA 2VXWA 2XWJB 1E2VA 2JA7H 3OSOA 3ICEA 1PRTF 3HOVH 2YU9H 2EDGA 4OGQC 1TWFH 1OTCA 1JORA 4R8NA 2IL8A 2R92G 2F0UA 2MHVA 1X6OA 2Z1CA 1CUKA 2YV5A 1EWHA 1KRTA 1IBLQ 2JA5B 3J7A5 4HJ9A 1LACA 3HOWG 2R6GA 1AN8A 4OWWB 2F52A 2CWPA 3H0GG 4IUVA 2ZM6L 3W1BA 1IBKQ 3TZUA 2AWNA 3VYSA 3CRLC 2FMMA 2I07B 4OO1I 2YYZA 1ET9A 1M8AA 3T1YQ 2L0CA 4NKLA 3OWFA 1OXXK 3CC2A 1WTQA 2Q2TA 3L2PA 1JWSD 2D62A 4Y7NH 4BBSB 2RVLA 3NTKA 4EVOA 5JAVA 4DAMA 1Y1WG 4B3SQ 5L37A 3CPFA 4ABNA 1CZGA 4EQPA 1K9MC 3PV0A 1SFOH 3GQBA 2F0NA 3SK5A 1HTLD 1O7YA 1IBMQ 5C5LA 2XVSA 1F2ZA 1NY4A 4B3SL 1STGA 1VQAA 2B8GA 3CP0A 1VQJA 3EQLC 2EY6A 2HDMA 1YNXA 1LUZA 3SVMA 2ZJQA 2O4XA 4N8FA 5CR3A 4A3BG 2JA5H 4BY7B 1GUSA 1IL8A 2RDHA 5J22A 1MIUA 4YY3L 3J7ZC 3K7UC 3I4NH 2J0TD 3PF5A 4ZLTF 1S40A 4Z9CB 2JEAI 3PF4A 4A93G 4DV4Q 2AWOA 2IW3A 1HPCA 3H15A 3J81j 1PFSA 4LUZA 5GADC 4WFN3 3SHLA 2OTLA 1CT1D 4GKKL 2LY7A 5EPLA 2VB3X 1L0XB 4ME5A 1QNUA 1Y8PB 5H1SE 4QUCA 1HH2P 2NVXH 4UP9A 2L4NA 4A3LH 4FF1A 1SJED 2NVTB 3MFYA 1VS0A 1KIXA 4B3TQ 4GN3B 3ND9A 4LF6L 3H3VH 1MJEA 1ASYA 1XPOA 3C46A 2H4OA 2QILA 4KK7A 1ZEQX 1S3OA 2N88A 2F0KA 2MNAA 4BBRB 2UXDL 1L0YB 2AQ2B 2L5TA 5IWAL 2H5XA 1ICWA 2PCFB 4DK6C 4CBVA 4JI1L 1PH6A 5ELBA 3UDIA 3W1GA 3S1NH 1STNA 1BNZA 1S5CD 2I0QA 4YHHL 2PNHA 2QW7A 2E2IB 4RKLA 1VQOA 3I2ZA 4HSPA 4A3KH 1WTWA 1CKMA 4GN4B 1KDAA 2C35B 4BY1H 3E0EA 3P20A 3VR3A 1I4XA 3JAME 2EYJA 2LSSA 4X66Q 1EOTA 4LF7L 3M7GA 3CCJA 3PCOB 5ELFA 1CKNA 2RKSA 1Q1EA 3OIQA 3VYRA 4JI4Q 3HGBA 2NVTH 3UDXA 3J7YW 1C8CA 1H9JA 3I4MB 2WB1E 3CCSA 4I7AA 4RMFA 1LM0A 2BOSA 1A3UA 3FEWX 5LMNQ 4GNXB 4KI0A 4BA2I 1K3BC 1KAWA 3KDFA 3PIO3 2A6HD 2IHEA 3QB3A 2PQAA 4JI7Q 1MKHA 1K0SA 3VA7A 3AB9A 1RIPA 4LUOA 3WWVA 1DXMA 1SBBB 1UE7A 4DKAC 5CORA 3AU7A 3E9HA 3FRPB 4X3KA 4KY7A 2N49A 3S16B 2KVMA 5C3EB 3M85A 3RLNA 1YI2A 2WAQE 3E0JA 2HT1A 4LWCA 4DR2Q 2CFMA 1TT2A 2RF4A 2DJGC 1DOMA 2CH4A 4C3IB 1KLUD 1EY5A 3P7JA 4UDUC 2UUCL 4FNFA 3I4MH 3VYUA 2N8NA 1HR0W 4A75A 2BA1A 2YTVA 2A69C 3LX0A 3GTMH 5ELEA 3S2HB 1RL2A 1RDPD 5A2QL 2NN6I 1T9HA 5BN3A 4C3JH 1E1TA 4XTCS 4HJAA 4GKJL 1SYDA 1FD7D 2WKDA 2DN8A 5I2YA 1U4RA 3HOXG 2K5DA 2VQFQ 4B08A 1VQEA 1W6JA 2PPBC 3ULLA 1KL9A 2R7FA 4IUNA 4JI8Q 2QKIC 2RSNA 3TREA 1O80A 3ER0A 4ODGA 5IP7H 3M4PA 1SE4A 4DPGA 2ZJPA 1X3QA 2F1MA 4DR5Q 1A15A 2E2JH 1I50B 1GKHA 1I6HH 1K83H 4C3IH 3CCEA 5AJ3L 4DR5L 2LS01 4YWMA 1PH4A 2L1BA 3L3OC 1EY4A 4F87A 4FXDA 1LTAD 3S2HH 4ULLA 2PQEA 1HR0L 4J8QA 4XT3B 1JJ2A 4EQ5A 2UXCL 4QGUA 4A76A 4LUVA 1R4QB 1D1KA 3FDTA 3G7LA 1FNWA 2K5QA 5HURA 4OXPA 4MTKA 2A69D 3G6EA 1VQ8A 1X3EA 2L11A 2NTSA 5M5XB 3CQZH 5C5MA 4A3EH 4IJHA 2NBFA 5DEHA 3S1QB 4K5XA 3WDNA 3BZDB 4A3DH 5D14A 5I2XA 5A2QE 2R3ZA 1KHIA 1X56A 4KTAA 3BDOA 5IT9L 1HNWQ 2IX1A 2DY7A 4ZUIA 3HS0C 2JA6H 4ZUJA 1I50H 1P8LA 1SNPA 2X6GA 1Q1BA 3AFQA 4A3GB 3KFUA 1Y1VB 3EVQA 3D4WA 4X3SA 1I5FA 1UWVA 3HOZB 1STEA 5K36H 2F0FA 1PH2A 1TWGB 2UUBL 2NZ1D 3C1EA 2Y0SB 3MEFA 1BKBA 3J7AV 1Y8OB 2I46A 5DAUA 1BCPB 1LO5D 1FVIA 1HZAA 5IYBG 4DAVA 4JI3L 1GXDC 1ZXTA 2ID0A 4A3CH 1IL2A 5M5XH 2B2YA 3KLSX 1K8GA 1WCMB 1S5ED 4IFDJ 3F8TA 1U4LA 4P2CB 3K5NA 2F0VA 3PUVA 3OHXC 2F0MA 1E22A 4XQNA 4IFDH 5T1GA 2Q2HA 3BZCA 4X64Q 1QB5D 1EQVA 3FHWA 3K5LA 3HOYB 3A7AB 3R93A 1H9MA 4B3ML 5JJKA 4XQJA 2SNSA 3EIVA 4A3GH 3K7AH 3U9OA 5IYCH 2BH2A 4WJ3M 2OT2A 1KQSA 2R7ZG 1F2LA 4K0KL 1L1OA 4JI2Q 4C3HH 1E0BA 1HUMA 2HD3A 5IT9E 3I91A 1DZ1A 1SMXA 2F03A 2EY5A 1EZ6A 2P5ZX 3DWPA 4IPHA 3NTIA 1O7IA 1PRTB 1XX8A 1YEZA 4DAPA 1MJCA 5IOCA 4H02A 1TY2A 1YITA 5EQ0A 4LF9Q 3SDZA 1STAA 2HCIA 5IYDH 2ALYB 1STHA 1WCMH 2I5LX 4RKBA 1JWMD 1LTTD 1QVCA 1B3AA 4AYBB 3HEJA 4NMZA 2B63G 3RZDB 1SMYC 1DM0B 3S1MB 2D0OA 5C0XI 4B3RL 1HTPA 4L5TA 5JPMC 1SYCA 2PW5A 5I6YA 1TWCB 1TS5A 1X3GA 2F0DA 2AUJD 2B2YC 2HQEA 2Q8IB 3CKIB 3OW7A 4R8IA 2ZTDA 4R4QA 2K5HA 4DN4M 3NQIA 2Q2IA 3GTOH 4K6DA 1FNVA 5G3LD 1JMCA 3EA6A 4O1NA 4IPCA 1KXLA 2G9DA 5C0XJ 5HGQA 1EEFD 1Z47A 4IUUA 5IODA 3Q23A 1PXUA 3NK9A 5C0XH 3A7LA 1YHBA 3NENA 4CJ2C 2FHTA 1QZGA 2Z4IA 4JI5Q 1BXTA 1YJ9A 3MXNB 5IGEA 1YIJA 1L1OC 4A3IH 3KYHC 2PZWA 2Z6KA 1SSOA 1WOCA 2VQEL 3U4ZA 2V4DA 4LF8Q 1YVCA 2V1CC 3CHBD 2B2TA 1AE3A 1RTOA 1Y14B 4GS3A 1WD0A 2K32A 3T1HQ 5KYIA 1UAPA 5ISRA 2JN4A 5JJLA 1SNCA 1AEXA 1TWCH 4L6TB 1SMYD 4QIWB 4JV5Q 4OL7A 2SEBD 4K5WA 1B70B 4DV2L 1HCZA 4QUFA 1HQRD 4B9XA 2XSCA 4RCOA 3K6OA 2R93H 4O2DA 4OIJA 5C44B 3RN2A 2JYOA 4LFCQ 4LF5Q 3HOVG 4EQNA 1NMGA 3TP8A 5M3FH 4DNTB 1EQQA 4KJNA 4IPDA 1OO9B 4R4CA 1VQ7A 3PO3B 4LW1A 4LFCL 1EIFA 1Z9FA 3NHHA 1LTBD 4A3MH 1PTOC 5M3MH 1A0IA 1PFBA 3VDYA 5GAGC 1GUOA 3FPUB 4FXGC 4NW2A 3TP7A 1J5EQ 2GVBA 3I7FA 5LL6S 2KHIA 1ONLA 1TXYA 4LNQA 3H6MA 1J5EL 5FLXc 3I72A 4H44C 4XDXA 4P72A 1EEID 4F7XA 3J81c 2ZXOA 4P71A 3DM3A 3SK6A 3GTLH 1JB3A 4RFBA 1RHPA 2E74C 1TWHB 1WJJA 1NAPA 5DNFA 1TR5A 2Z6KC 4APVA 4DAYA 1TS4A 1GM5A 5LHY1 1QJOA 1CI3M 1Z7TA 1PH9A 2B2TC 4CKBA 1TU2B 2PI2A 4DV6Q 3M7NA 1HHVA 3A56A 4QMGA 1EYDA 3MC0B 1I6VC 4PMCA 5FJ8H 4OO1G 1GUGA 2Z4HA 4DV0Q 1FGUA 4MHEA 2F4VQ 4IUTA 2KCNA 1WYDA 2UU9L 1STYA 3CMAA 1VQNA 4UAIA 4HTHA 2RCNA 2K52A 1TWAB 2XRSD 3V05A 1F77A 3I4NG 1ILQA 2NYZD 5C4XH 1CA6A 1WTVA 1ENCA 3S2DB 5EPJA 3J81i 1VQDA 1GOZA 4XIGS 2MPMA 3A54A 2Q8TA 3S14H 2UUAL 1CA5A 1U9RA 1S5FD 3HOUB 1PTOD 2EQSA 4DXGA 4BXXG 1PVOA 1JOKA 2F3WA 3KF6A 2A8VA 5J1ZA 2NVQH 1V43A 3GTPH 3FKIH 2EIFA 1JWUD 1ESFA 4DF7A 4PZ8A 3M4OB 3KOJA 1SYEA 2A74C 1PA6A 4A3LG 1JOOA 3K0YA 4DV5Q 3I4OA 3NPPA 1HJPA 2WB1G 1UE5A 5JOBA 1EQTA 4Q5VA 2L15A 4I7ZC 4P75A 3I3CA 3TBIB 3NE5B 3GTKB 4E6IA 1WFQA 1F2YA 3K0XA 4KY6A 4DV5L 3TSSA 5DM73 1PTOF 5M5YH 2J7ZA 3SGIA 1R4PB 2LMCB 2K7VA 1I4GA 3NEMA 4OIKA 4M8AA 2ZJRA 5BN4A 1W6KA 3MXUA 2K5WA 1PZKD 2G5DA 1D2BA 2ZM6Q 2QEXA 3K59A 1N9WA 3A5ZB 5GAEC 4MTNA 4A3KG 2WAQG 3M4YA 4BY1G 1BBXC 3N6RA 1AZPA 2EXZA 2UXBQ 2EYFA 4JI0Q 3KF8A 4ALPA 1QVFA 3AEVA 4HJ8A 3K58A 2K28A 2KHSA 1JOQA 1SNQA 2JSOA 5CV7A 1R9TH 2UXBL 3F2BA 4JI0L 2B39A 1TVXA 1HXYD 4JOIA 4A3JG 3IAYA 2RBMA 2EVBA 1F9SA 1PMRA 1HQMC 4HR7B 4J6HA 1V1PA 3GTJH 1H9KA 2B29A 1WTHA 1ZKOA 5TSSA 3KBGA 3RLOA 2OQKA 3BYYB 1LTGD 3M3YB 3D0FA 4HIDA 3P1HA 3ZYYX 1XNQL 4ID6A 2K75A 2ASBA 1RCVD 3HKZB 4HSVA 3OIPA 4YY3Q 4NXML 2K03A 5IGBA 3QG1A 3I56A 1GUTA 5EBDA 3A55A 5C4ZA 3H3VI 3VR6A 2ATWA 1XTDA 3T16A 2EOTA 1SEBD 3K5MA 4QL5A 1YNJC 4GKKQ 3NQTA 4XT1B 4CKCA 4N9PA 1AW7A 4ZYSA 1VQPA 1YZ6A 4BBSH 1KNEA 4IN3A 4CDEC 3GO5A 1SNDA 4X6AH 2R92B 1II3A 1ET6A 4LF6Q 2KECA 1M90C 4NDXA 2YTYA 3JAMc 5F2DA 1HZCA 3AQQA 2A6HC 3V96A 5I4DA 3EJIA 3M3YH 3TRZA 4C3JG 4JC0A 1QWYA 1QUQB 3HOWB 1SROA 4A4IA 1SAPA 1HZBA 2Z6BA 1X55A 3C1FA 2QA4A 2UXDQ 5IWAQ 1CKNB 5ELDA 5EJWA 3GTQB 4LFAL 3H0GB 5IGFA 1JE5A 2LXJA 2N3SA 4IQZA 1EY9A 2KBNA 4JI1Q 4LFBQ 4AH6A 4BY7H 2EYOA 4K8JA 2WIIB 3DWQA 4JYAL 4JOIC 4DNIA 1S5DD 3IFTA 2D5DA 3MHBA 3OTOL 4YHHQ 4LFBL 4C2MB 4X65L 4JBMA 5CGKA 2OXPA 3KDFB 1C0AA 2PQAB 1I3QB 1Y1WB 2NN6G 2DY8A 2D9UA 2BE5C 1D8LA 1N33L 2MO1A 1A62A 1K73C 4CDFC 4LF7Q 2L12A 1UNSA 3ULPA 2IX0A 1UEBA 3JAMi 1S4ZA 1QUQA 3A8IE 2CWAA 1E24A 2R92H 3MEHA 4R4TA 1YNJD 3CCQA 2K6AA 1BOSA 4A3BB 2EY1A 1EIHA 1EWCA 3CPWA 1RKNA 1YNNC 1E7ZA 5KEEA 1D5ZC 3CC4A 4Y52H 5KGUA 1NR2A 1CQVA 2K50A 2KEDA 3UE0A 3HKZE 1KD1C 4A3EG 4J15A 4BBRH 4A93B 1D1IA 1EY0A 1EYCA 4XYQA 4A3DG 1T5EA 3CCMA 2JA9A 1B44D 1DD2A 2PZUA 4XQQA 3DUZA 4NP5A 4R9WA 1CSQA 1RF2D 2EJGC 1VQMA 4F8MA 3PMFA 1VQ9A 4X3TA 3S1RB 2JA6G 2E2IH 4A3FG 2F4IA 3FVQA 4V190 3WOFA 1QZHA 1O7LA 3NWTA 4JBWA 5K36G 1PV4A 5J39A 2UUCQ 5EBCA 1B9MA 2BE5D 2RHSB 5M5WB 2M00A 2HDLA 4A3BH 1C7YA 1SE2A 4UP7A 5C6AA 3VA5A 2OTJA 4G57A 1VQFA 4PQXA 4A3CG 4GKJQ 2AUKA 4RWSC 1F9RA 2O5JC 1W2BA 4LMQD 4A93H 4DUZL 3MTSA 3P75A 1A3TA 4PMWA 3GD7A 1MBYA 1YNND 2EYPA 3I4LA 2ICIA 2VS1A 3D4DA 4IFDG 2KCMA 4X62L 2HIXA 4S3SA 2XTIA 3A8JE 3S1RH 3S16H 4G4KA 1GO3E 5C3EH 5E7NA 5EAYA 1NNXA 2NUCA 2K1BA 5IYCG 3BDCA 2IT1A 5AJ3Q 4L5QA 1Q81C 1N34L 4C3HG 2JA8G 1YJWA 4BA1I 1SRUA 1RTNA 3BDLA 4QB4A 4TQUS 1GD7A 1HR0Q 1SN8A 5IP9H 2E2HB 3PO2G 2UXCQ 1A63A 3T4AC 1BR9A 5CBEE 2KJXA 4OWXB 3F1ZA 4DR1L 4FVMA 2K04A 4UPAA 2EJFC 1XTCD 3M4QA 4GLAC 3VR4A 4JVZA 2VY3A 2ZTCA 1B2TA 1NBWA 2KEEA 1CM9A 2X6LA 5KNBA 1KABA 1WI5A 3D8GA 3NELA 1SYFA 1HNXL 1NSNS 5IGDA 4POFA 2EJMA 5EKIA 2HUGA 2K14A 1IXRA 3QOLA 1GUNA 4KV6A 4KD3A 2K4KA 3AYHB 1EFID 1Q8KA 1JJCB 2A19A 2UUBQ 4OEMB 2A6ED 3LWEA 3RLFA 3ZJYC 3KJPA 4IFDI 1CSPA 3F2CA 2E2HH 3HOXB 2M2LA 1EYGA 1PFMA 3G48A 4JG2A 3I8ZA 4JI3Q 1P16A 1E3PA 2QDLA 1XNRL 5C0XG 1SLJA 4CJ0B 1FL0A 5FLMH 3HRZC 3DLLA 5C4HA 1L1OB 1MHWC 1S72A 2ZTEA 2RQXA 1QCBD 4A3IG 3OW2A 5C3WA 2VUMG 1G91A 3D6CA 1DCZA 2EY2A 3S1QH 1XPUA 3BG3A 3D6WA 3BVMA 3TQYA 2F0TA 2JP1A 3PUZA 2DUDA 1B50A 1VQ6A 1OXSC 2EE1A 3DEPA 4B3MQ 1B8AA 5IY0A 4RCNA 2O5IC 4DR3L 1FNUA 5CV6A 5FO9B 1IW7D 1TS2A 2ZT9C 2ZXRA 4K0KQ 1PYWD 1C48A 5GQOA 1Y1VH 1GUWA 4IUPA 2Q2UA 4KHPL 1B7YB 3G71A 2XWBB 3HOZH 1TKWB 1EY6A 1TWGH 4FXKC 2NTTA 5M3FG 1JC7A 3CAMA 2AMCB 2MJ8A 2B2VA 2F3IA 4JI6L 1NR4A 2KCCA 4IURA 1PTOB 4IOAA 3KLWA 4PZ7A 1H9SA 2WINB 3BZKA 4ZKCB 5M3MG 4B9WA 2K33A 3SR1A 2RHQB 1YJNA 1K8OA 4DV7L 2WACA 5CMDA 3SK4A 2YTXA 1EU4A 1JCKB 4B3RQ 4C56C 1NCVA 3TS0A 1U5KA 4L63B 4CJ1B 3HOYH 4JW0A 4LK1C 2F0HA 5GROA 2DJFC 3D31A 4FF2A 5T1IA 1U4MA 2F0OA 1EFWA 2CCZA 2B8FA 1EZ8A 1DJRD 4PNYA 1VDZA 2OQ0A 3AMUA 1EL0A 1HNZL 2IX3A 4PV1C 1J9OA 4GOPA 1Q3LA 1S5BD 4HJ7A 1IHZA 2Y0SE 3N52A 1PH5A 3TP6A 5FO7B 1Q46A 4UP8A 2F0WA 2LKVA 3V2TA 1VF5C 3DEOA 2VW9A 5LMUL 2BDNA 3CW2C 1PTOH 2O2LD 3LWUA 3MXPA 4R4IA 1CHQD 4F88A 5J3BA 1BVSA 5HGTA 3Q22A 2VNUD 2A5HA 2IY5B 3CU7A 3K80C 3NXWA 2RA4A 1B4OA 1CQFA 1NTGA 2VQEQ 5C4XG 3D3RA 3MAQA 3I90A 2CVRA 3RZDH 2R7ZB 1O7ZA 3U58A 1E1OA 3S1MH 5BN5A 2B2VC 1B53A 2JEBI 5G3LF 1EWIA 5ELNA 3FKIG 4DV2Q 2EXDA 2WP8J 4JPBW 4ZRZA 4QY7A 1PZID 2JK8A 1B3QA 1DOLA 4EGVA 3IFDA 1JQYD 1VQCA 2JA7G 3ERSX 2IWHA 2Z9HA 2CKZB 2B63B 4H13C 2OCEA 1M1KC 5HY6A 1I4RA 3PSIA 4DAYB 1KDBA 3U9SA 4EQOA 5BR8Q 1DGSA 3NSWA 4OX9L 3TDQA 4GN5A 3HFZB 1VCIA 4GOPC 1LYLA 1N32Q 4AYBE 4IZ8A 5BR8L 2FMCA 3ITPA 2RDGA 3H91A 4UHVA 1HUNA 5FLXL 1N32L 3KLSA 2EYLA 1YHQA 3J81L 2PNRC 2M9VA 4MIUA 3PUYA 4I65A 3Q6SA 4DR6L 2KUMA 2HQLA 4CHTB 3TS2A 1MI2A 1K8MA 2F0SA 1NMFA 4ZK9B 4GZYC 3OOCA 1RJTA 3J80c 1ASZA 5IGCA 3KF6B 1BBUA 4C1NI 5C44H 1KNAA 4V0BA 3GP7A 4ZAIA 3VYTA 3PIPA 3VR5A 5C4JB 1G2SA 4KKTA 4RGMA 3PO3H 1K28A 2PYKA 2XRQD 2UU9Q 2QF7A 4RH6A 2DNEA 3RNUA 2JA5G 3HP3A 3RZOB 1ENAA 1YHAA 4JBKA 3ONAB 3NBHB 1RODA 2F0IA 2UUAQ 3EROA 4K2LA 5DM63 1PH3A 4DUYL 2F3VA 3KK7A 3GDEA 2MQHA 3SEBA 1MD2D 4POGA 1SNOA 1VF7A 3J80i 3HOVB 3K81C 1XWEA 2YU9B 4K2KA 4DV3Q 4QIWE 2IHFA 4BBSG 3TP5A 1TWHH 1TS3A 1IKMA 1WD1A 4DV3L 1CK1A 2FXQA 5FLXE 3GTGB 3S17B 2LXKA 1G291 1NUCA 3J81E 4HN7A 1D6EC 2E75C 5C4JH 3IL8A 3KF8B 3X3NA 1VMPA 2QEJC 4U68A 2MO0A 1LTLA 4HEDA 3NBHA 3Q8DA 4QCLA 2VB2X 4L8JA 4RGOS 4BY7G 4RGNA 2A1AA 3MZ5A 4DV1Q 1V1PB 4WJWA 2HHHL 1TWAH 2EZVA 5CV5A 3MA2B 4Y7NB 4DV1L 3EN2A 2R7DA 1VQBA 3S2DH 1A8VA 3QWNA 3DWAA 3KLRA 3DMUA 1WTPA 1V8QA 3E9IA 3W3AA 3PGZA 4DK1A 2EPBA 3HOUH 1I94L 1SFOB 5JEAJ 4LF4L 4X3UA 1AFPA 1EY8A 3RMHA 4ME3A 2N55A 3IRBA 3A8KE 1C4QA 5JEAH 4RG1A 3Q0AA 2DNCA 3J7AF 1GHJA 1G51A 1LLRD 2KHJA 4UY8C 2GVAA 3M4OH 3GTGH 3S17H 3A74A 2XNAC 4KJOA 4P74A 3SK8A 3CCUA 4RHSA 1LT5D 5I6WA 2PO4A 2VZAA 5JVG3 3CC7A 3I4NB 1IBLL 3GTKH 1XNQQ 1VQ5A 1CZWA 2FFKB 4BBRG 1K3RA 4NXMQ 5KYLA 1IBKL 1F2MA 1Z6HA 4DR4Q 4JCVE 1TIID 3UI2A 2ES2A 3T1YL 3E6ZX 4RHRA 1QG7A 2PMZB 1PDQA 2E76C 4DR4L 4OHJA 5CYUA 2NVXB 4FDBA 3Q24A 2AQ1B 2WB1B 2J4XA 1K0RA 3DHQA 1IBML 4OO1H 1NE3A 1IYVA 5GAHC 4GLVB 1E2WA 1IYUA 3JAML 2B2UA 3I4MG 1W3SA 2ENBA 3IKJA 3OPOA 5K5PA 2C9OA 4RGTA 1Q90A 1HRJA 3T51B 4QQBX 3CCRA 3S1NB 5JJIA 1I4QA 3RN5A 4LFAQ 5I9PA 4G7ZC 4QF4A 1PH8A 4BXXH 4TSSA 4A3KB 5FKAC 2WAQB 1OXVA 1NJIC 4BY1B 4JYAQ 4HCSA 4LJZC 2HIVA 1JB7A 4DV4L 3OTOQ 1KTKA 3SXHA 4HIKA 3EFXD 4YWLA 4DXFA 4X65Q 1MGSA 1QE6A 4IUQA 4HIOA 2QGQA 5C3EG 4YCVA 1SYBA 5IP7G 4A3JB 5M9OA 1N33Q 4Q0FA 2NZHA 2CH4W 1VQKA 4B3TL 2OWOA 5LMNW 1V1QA 1A3VA 2B2WA 4C3IG 1JJGA 2A73B 2LFNA 1STBA 4HAEA 3DXJC 3A5UA 3L9AX 1I4HA 2RSOA 5IP9G 3C3LA 2Z8LA 3K8AA 1X65A 1D5MC 2BA0A 1ILPA 4TKOB 5CBAE 1K8AC 3HOWH 1B9NA 1RD9D 3OMCA 3CF5A 3GTQH 1LT4D 1EIYB 3H0GH 1EOVA 1X54A 3TN2A 3R2IA 2AKWB 4FP5D 3VR2A 4RAUC 3S15B 4OONA 2PMZE 1A6XA 3G4SA 2L9HA 2B2UC 4C2MH 4X66L 2X69A 4A3JH 1H9RA 1XMOQ 1F9PA 1XXGA 3BVZA 1B1ZA 2HCCA 1I3QH 4KHVA 1Y1WH 4JI4L 1FR3A 3GTMB 1J6QA 1XMOL 2E5LQ 2F0GA 3CCLA 2MGSA 4C3JB 4GLXA 1JT8A 5LMNL 4P73A 1EQRA 3H3VC 2E5LL 2FJ2A 1JE4A 1ML0D 5EKKA 4JI7L 4IJLA 1AH9A 3NTHA 1F9QA 1L2FA 4L5SA 5FLMG 4IOCA 3STBC 4YCWA 4DUZQ 2E8GA 2KA7A 2BH8A 4CDCC 4CDDC 2NVYB 3CCVA 2IJ0A 2B2WC 2C5CA 3BJUA 2GN5A 2RDFA 2E2JB 3S15H 4H0LC 4KD4A 4X62Q 1G6PA 1I6HB 1K83B 4TRDA 5CC4A 1UEAB 1IZ6A 1SE3A 4GNXA 4DR2L 3FMCA 2NWGA 5E4WC 1MSGA 3G6JB 4AQYQ 2DGYA 1KLGD 4HMJA 2L55A 5E1FA 1N34Q 2XGTA 2A6EC 2I5MX 4BS9A 4A3GG 4K6LA 4G7OC 1Y1VG 4AQYL 5D3IB 3HOZG 3R2TA 1H95A 2Y0SG 3CQZB 4A3EB 1EU3A 5M5WH 1SE8A 5IGGA 1X9NA 2VQFL 4DR1Q 4A3DB 2XIWA 3AFPA 1ZYRC 1A2TA 3EBEA 3E5SA 2OF1A 2NVYH 4JI8L 4J1MA 1X32A 5IYDG 2NN6H 1WCMG 5NUCA 3UE1A 2F0QA 2JA6B 4A3FB 1MSHA 1GJXA 3STBD 1G8ZD 1HNXQ 1ICFB 2K5VA 1HA5A 4KLKA 1Q8IA 2JE6I 1IW7C 5EKLA 1A2UA 3HOYG 4YCUA 3HG9A 1AP0A 3T53B 2Z0SA 3S24A 2GA4B 4WORA 3PIP3 1QILA 4LAAA 4NB3A 5LL6X 5E4XA 3QIAA 3KJOA 4NPSA 4ZKBB 5ELOA 4RA8A 3U4VA 2I5HA 5CV4A 1WTOA 3QOJA 4FYDA 4GNXC 1Y8NB 3ULJA 4JBJA 4O42A 1XNRQ 1G6ZA 3NWSA 4O0AA 3OWEB 1BQQT 4HCEA 3WOEA 1WTXA 4QJFA 5E3FA 1VQIA 2QDBA 1EUJA 1X3FA 3F2DA 4L5RC 4A3FH 1D5XC 3B6YA 5IT9c 1G2TA 1HNWL 1V9PA 1N8RC 1ZYRD 4AIMA 3K7AB 4AYBG 1PYBA 1WVLA 2D0PA 2XN9C 3PUXA 5FK9C 3O13A 2IPKD 3C2PA 1E2ZA 3L0OA 4C3HB 2JA8B 1BDOA 2NB0A 1ENFA 3E3XA 3R3OA 4DR3Q 1N36Q 5EPKA 1H9SB 1Q82C 3SE0A 1OXUA 2F0LA 3PO2B 2KOLA 5JVH3 1N36L 1TY0A 3I70A 4ILWA 1GVPA 4C1NK 1PZJD 4KHPQ 2WFWA 3PUWA 1LTID 2R61A 5KRUA 2R93G 2A68C 3MWYW 2JJQA 2FINB 4DK0A 3HOXH 2KQ3A 3W2DA 1VQ4A 4JI6Q 4G7HC 1LT6D 4OELB 3R8BA 3A0JA 3NBIA 4ZQ3A 1DONA 3W5OA 3QO2A 4N8X1 4U673 2MP1A 5IE8A 1M4VA 4X64L 4GOPB 3QR8A 1SJHD 3BS1A 4A3MG 4DV7Q 2CQAA 3BYTB 2WKCA 3L7ZC 1U0LA 3KUPA 2JA8H 1AE2A 1L0WA 3FP9A 1HZ9A 3LNNA 3GTOB 4IO9A 4KKSA 4JI2L 4H7BA 4WRDA 2TSSA 1QOHA 1FJGQ 2PW7A 3PO2H 4M1UB 4XXEA 1HFGA 4ZCKA 3MVVA 3D4RA 1HNZQ 5KIXA 1CKOA 1FJGL 1IKLA 1VQLA 1LV9A 4LF9L 1V1OA 5C44G 5ELCA 2AHOB 4A3IB 1PH1A 4HMIA 4DFAA 1HA6A 4HIMA 2VUMB 5LMUQ 3PO3G 3H94A 3LGJA 3TZDA 1XPRA 4KY5A 4DNRB 3URYA 1UE6A 1XMQQ 5FJ8G 4OWTB 4YIJA 4XYOA 1Y69U 1AZQA 2CW0C 2A68D 1FYCA 1XYIA 1PLFA 2K5NA 3TMEA 4DA2A 2SOBA 3PIOA 4MN3A 1XMQL 2OEOA 1J8IA 2B3GA 3MFGA 5JJZA 3NP8A 1BUVT 1DYQA 2R93B 3BU2A 2KCTA 1EYAA 3UDFA 1CFMA 5M3FB 2VL6A 4MZ9A 2TMPA 2BCOA 5KNCA 5IYBH 4K8IA 2D2CC 1BCPC 1BF4A 1KDCA 2CHBD 2CQOA 4A3MB 2SNMA 1JICA 5M3MB 4CGYB 3F2UA 1LT3D 1YBYA 4JI5L 3BVGA 2VUMH 1TQOA 1VQHA 1QVGA 1HFNA 3HKSA 1SXTA 1EIGA 1FGBD 1LTRD 4LF8L 1PH7A 3K57A 3U50C 5A35A 4OX9Q 4MNOA 4IPGA 3M9BA 5JPNC 3T1HL 1GHKA 3S9WA 4K14A 1PYSB 3CD6A 1PHJA 1QNKA 1Q86C 3GTLB 1Q12A 1LTSD 3H09A 2CW0D 3ERQA 3OYYA 4KN4C 4DGZA 4KN7C 3RR5A 4JV5L 3KBXA 2WV6D 2R7ZH 3HOUG 2H1EA 1KRSA 1D7QA 3MXNA 3CMEA 4DR6Q 4CKEA 5JEAG 4JK1C 4LF5L 4EX5A 2AQ3B 1VMCA 4N9TA 3J80L 1WTRA 4DK3C 4DU9A 1PRTC 1XJVA 1VQGA 1SR3A 3T13A 4R1JA 4FO2A 3T56B 5C4XB 3TEHB 1C9OA 1BCPD 3CRKC 5I9OA 1JR0D 4WJ4A 3DM1A 2B63H 5EGTA 3S14B 3ND8A 3UDGA 2Q8RE 1Q7YC 2N78A 2MUYA 3QJYA 2F0JA 3I73A 1UE1A 1UUPA 3CXCA 1KAAA 4K5VA 1LABA 2NVQB 2EYMA 4TVAB 1X3PA 3GTPB 3GV3A 1ESRA 3FKIB 4YWKA 4DUYQ 1SNMA 2SDFA 2G9HD 2KENA 5CV8A 3RD4A 4NXNQ 5FOBB 3K5OA 5DLQE 2JXMB 1SDFA 1BCPF 4NXNL 5KNDA 2JA7B 2K01A 4KMUC 3RUZA 5D3DA 5M5YB 5C3XA 4DV6L 4PMBA 1EY7A 4FF4A 1TWFB 3GV6A 1KC8C 1SYGA 5FO8B 1U4PA 4DV0L 2F4VL 2NZOA 5D65A 2MFIA 2RCFA 1I4PA 2JQOA 3PQIA 5COYA 4DR7Q 5IIFA 4KKUA 4PG3A 4KHZA 1PRTD 3JC66 3HZXA 1CHPD 4DR7L 3J80E 3OMGA 3HKZG 3NUCA 1T5XD 4BWGB 4R4OA 2HHHQ 1OXTA 1PFNA 5AFWA 1CTMA 4IALA 2ZXPA
chains in the Genus database with same CATH topology
4FF3A 2PZTA 5CV9A 2F0EA 2ICEC 3X3MA 2EYHA 2QCPX 1R9TB 3MXGA 1DOKA 2BDOA 2F0PA 2E2DC 2K05A 1BO0A 1O78A 3GTJB 3FPPA 2VXWA 2XWJB 1E2VA 3OSOA 1PRTF 2EDGA 4OGQC 1JORA 4R8NA 2IL8A 2F0UA 2MHVA 2Z1CA 1EWHA 2JA5B 1LACA 2R6GA 1AN8A 4IUVA 3TZUA 2AWNA 3VYSA 3CRLC 2FMMA 2I07B 4OO1I 2YYZA 1ET9A 1M8AA 2L0CA 4NKLA 3OWFA 1OXXK 1WTQA 1JWSD 2D62A 4BBSB 2RVLA 3NTKA 4EVOA 5JAVA 4ABNA 4EQPA 1CZGA 3PV0A 3GQBA 2F0NA 3SK5A 1HTLD 1O7YA 5C5LA 2XVSA 1F2ZA 1STGA 2B8GA 3EQLC 2EY6A 2HDMA 3SVMA 2O4XA 5CR3A 4BY7B 1GUSA 1IL8A 2RDHA 5J22A 2J0TD 4ZLTF 4Z9CB 2JEAI 2AWOA 2IW3A 1HPCA 4WFN3 3SHLA 1CT1D 2LY7A 5EPLA 2VB3X 1L0XB 4ME5A 1QNUA 1Y8PB 4QUCA 2L4NA 4FF1A 1SJED 2NVTB 3MFYA 3ND9A 3C46A 2H4OA 2QILA 4KK7A 1ZEQX 2N88A 2F0KA 4BBRB 1L0YB 2AQ2B 2L5TA 1ICWA 2PCFB 4CBVA 5ELBA 1STNA 1BNZA 1S5CD 2E2IB 4RKLA 4HSPA 1WTWA 1KDAA 3P20A 3VR3A 1I4XA 3JAME 2EYJA 1EOTA 3M7GA 5ELFA 2RKSA 1Q1EA 3OIQA 3VYRA 3HGBA 3J7YW 1C8CA 1H9JA 3I4MB 2BOSA 1A3UA 3FEWX 4KI0A 4BA2I 3PIO3 2A6HD 3QB3A 3VA7A 3AB9A 1DXMA 1SBBB 5CORA 3AU7A 3FRPB 4X3KA 4KY7A 3S16B 2KVMA 5C3EB 3M85A 3E0JA 1TT2A 1DOMA 4C3IB 1KLUD 1EY5A 3P7JA 4UDUC 4FNFA 3VYUA 2BA1A 2A69C 3LX0A 5ELEA 3S2HB 1RDPD 5A2QL 2NN6I 5BN3A 4XTCS 1SYDA 1FD7D 2WKDA 2DN8A 5I2YA 1U4RA 2K5DA 4B08A 1W6JA 2PPBC 4IUNA 2QKIC 2RSNA 1O80A 4ODGA 1SE4A 1X3QA 2F1MA 1A15A 1I50B 2LS01 2L1BA 3L3OC 1EY4A 4F87A 4FXDA 1LTAD 4ULLA 2PQEA 4J8QA 4XT3B 1R4QB 1D1KA 3FDTA 3G7LA 1FNWA 2K5QA 5HURA 2A69D 2L11A 2NTSA 5M5XB 5C5MA 2NBFA 5DEHA 3S1QB 4K5XA 3WDNA 3BZDB 5D14A 5I2XA 5A2QE 2R3ZA 4KTAA 3BDOA 5IT9L 2IX1A 2DY7A 4ZUIA 3HS0C 4ZUJA 1SNPA 2X6GA 1Q1BA 4A3GB 1Y1VB 3EVQA 3D4WA 4X3SA 3HOZB 1STEA 5K36H 2F0FA 1TWGB 2NZ1D 3C1EA 2Y0SB 3J7AV 1Y8OB 2I46A 5DAUA 1BCPB 1LO5D 4DAVA 1GXDC 1ZXTA 2ID0A 2B2YA 3KLSX 1WCMB 1S5ED 4IFDJ 1U4LA 4P2CB 3K5NA 2F0VA 3PUVA 3OHXC 2F0MA 4XQNA 4IFDH 5T1GA 1QB5D 1EQVA 3K5LA 3HOYB 3A7AB 3R93A 1H9MA 4XQJA 2SNSA 3U9OA 2OT2A 1F2LA 1E0BA 1HUMA 5IT9E 3I91A 1DZ1A 2F03A 2EY5A 1EZ6A 3DWPA 3NTIA 1PRTB 1XX8A 4DAPA 5IOCA 1TY2A 5EQ0A 3SDZA 1STAA 2HCIA 1STHA 4RKBA 1JWMD 1LTTD 1B3AA 4AYBB 3HEJA 4NMZA 3RZDB 1SMYC 1DM0B 3S1MB 5C0XI 1HTPA 5JPMC 1SYCA 2PW5A 5I6YA 1TWCB 1TS5A 2F0DA 2AUJD 2B2YC 2HQEA 2Q8IB 3CKIB 3OW7A 4R8IA 4DN4M 3NQIA 4K6DA 1FNVA 5G3LD 3EA6A 4O1NA 2G9DA 5C0XJ 1EEFD 1Z47A 4IUUA 5IODA 3Q23A 1PXUA 3NK9A 5C0XH 3A7LA 4CJ2C 2FHTA 2Z4IA 1BXTA 5IGEA 2PZWA 1SSOA 2V4DA 3CHBD 2B2TA 1RTOA 1WD0A 2K32A 5KYIA 1UAPA 5ISRA 1SNCA 1AEXA 4L6TB 1SMYD 4QIWB 4OL7A 2SEBD 4K5WA 1HCZA 4QUFA 1HQRD 4B9XA 2XSCA 4RCOA 3K6OA 4OIJA 5C44B 2JYOA 4EQNA 3TP8A 4DNTB 4KJNA 1OO9B 3PO3B 3NHHA 1LTBD 1PTOC 1PFBA 1GUOA 3FPUB 4FXGC 4NW2A 3TP7A 5LL6S 1ONLA 3H6MA 3I72A 4H44C 4XDXA 1EEID 4F7XA 2ZXOA 3SK6A 1JB3A 4RFBA 1RHPA 2E74C 1TWHB 1NAPA 5DNFA 1TR5A 4DAYA 1TS4A 5LHY1 1QJOA 1CI3M 1Z7TA 2B2TC 4CKBA 1TU2B 3M7NA 1HHVA 3A56A 4QMGA 1EYDA 3MC0B 1I6VC 4PMCA 4OO1G 1GUGA 2Z4HA 4MHEA 4IUTA 2KCNA 1STYA 4UAIA 4HTHA 1TWAB 2XRSD 3V05A 1F77A 1ILQA 2NYZD 1CA6A 1WTVA 1ENCA 3S2DB 5EPJA 1GOZA 4XIGS 2MPMA 3A54A 2Q8TA 1CA5A 1U9RA 1S5FD 3HOUB 1PTOD 4DXGA 1JOKA 2F3WA 5J1ZA 1V43A 1JWUD 1ESFA 4DF7A 3M4OB 1SYEA 2A74C 1JOOA 3K0YA 3NPPA 5JOBA 1EQTA 4Q5VA 4I7ZC 3I3CA 3TBIB 3NE5B 3GTKB 4E6IA 1F2YA 4KY6A 3TSSA 5DM73 1PTOF 2J7ZA 1R4PB 2LMCB 2K7VA 1I4GA 4OIKA 4M8AA 5BN4A 1W6KA 3MXUA 2K5WA 1PZKD 1D2BA 3K59A 3M4YA 1BBXC 3N6RA 1AZPA 2EXZA 2EYFA 3KF8A 3K58A 2K28A 2KHSA 1JOQA 1SNQA 2JSOA 5CV7A 2B39A 1TVXA 1HXYD 3IAYA 2RBMA 2EVBA 1F9SA 1PMRA 1HQMC 4HR7B 4J6HA 1V1PA 1H9KA 5TSSA 1ZKOA 3KBGA 3BYYB 1LTGD 3M3YB 3P1HA 3ZYYX 4ID6A 1RCVD 3HKZB 4HSVA 3OIPA 2K03A 5IGBA 3QG1A 1GUTA 5EBDA 3A55A 5C4ZA 3VR6A 3T16A 2EOTA 1SEBD 3K5MA 1YNJC 3NQTA 4XT1B 4CKCA 4N9PA 1AW7A 4ZYSA 1KNEA 4IN3A 3GO5A 1SNDA 2R92B 1ET6A 1II3A 2KECA 4NDXA 5F2DA 2A6HC 3V96A 5I4DA 3EJIA 4C3JG 3HOWB 1QWYA 1SAPA 3C1FA 5ELDA 5EJWA 3GTQB 3H0GB 5IGFA 4IQZA 1EY9A 2EYOA 4K8JA 2WIIB 3DWQA 1S5DD 3IFTA 2D5DA 3MHBA 4C2MB 5CGKA 2OXPA 1I3QB 1Y1WB 2NN6G 2DY8A 2D9UA 2BE5C 2L12A 1UNSA 2IX0A 1S4ZA 3A8IE 3MEHA 1YNJD 2K6AA 1BOSA 4A3BB 2EY1A 1EIHA 1EWCA 1RKNA 1YNNC 5KEEA 1D5ZC 5KGUA 1NR2A 1CQVA 2KEDA 4A93B 1D1IA 1EY0A 1EYCA 4XYQA 1T5EA 1B44D 1DD2A 2PZUA 4XQQA 3DUZA 4NP5A 4R9WA 1RF2D 2EJGC 4F8MA 3PMFA 4X3TA 3S1RB 2F4IA 3FVQA 4V190 3WOFA 1O7LA 3NWTA 4JBWA 5K36G 5J39A 5EBCA 1B9MA 2BE5D 5M5WB 2M00A 2HDLA 1SE2A 5C6AA 3VA5A 4G57A 4PQXA 2AUKA 4RWSC 1F9RA 2O5JC 4LMQD 3MTSA 3P75A 1A3TA 4PMWA 3GD7A 1MBYA 1YNND 2EYPA 3I4LA 2ICIA 3D4DA 4IFDG 4S3SA 3A8JE 4G4KA 2NUCA 2K1BA 3BDCA 2IT1A 4C3HG 4BA1I 1RTNA 3BDLA 4QB4A 4TQUS 2E2HB 3T4AC 1BR9A 5CBEE 2KJXA 4FVMA 2K04A 2EJFC 1XTCD 3VR4A 1B2TA 2KEEA 1CM9A 2X6LA 5KNBA 1KABA 3D8GA 1SYFA 5IGDA 1NSNS 2EJMA 5EKIA 2HUGA 3QOLA 1GUNA 4KV6A 4KD3A 1EFID 2A6ED 3LWEA 3RLFA 4IFDI 3HOXB 2M2LA 1PFMA 3I8ZA 5C0XG 4CJ0B 3HRZC 5C4HA 2RQXA 1QCBD 5C3WA 1G91A 3D6CA 1DCZA 2EY2A 3BG3A 3D6WA 3BVMA 2F0TA 2JP1A 3PUZA 1B50A 1OXSC 2EE1A 3DEPA 4RCNA 2O5IC 1FNUA 5CV6A 5FO9B 1IW7D 1TS2A 2ZT9C 2ZXRA 1PYWD 1C48A 1GUWA 4IUPA 2XWBB 1TKWB 1EY6A 4FXKC 2NTTA 1JC7A 2MJ8A 2B2VA 1NR4A 2KCCA 4IURA 1PTOB 1H9SA 2WINB 4ZKCB 4B9WA 2K33A 3SR1A 1K8OA 2WACA 5CMDA 3SK4A 1EU4A 1JCKB 4C56C 1NCVA 4L63B 4CJ1B 4LK1C 2F0HA 3D31A 4FF2A 5T1IA 1U4MA 2F0OA 2B8FA 1EZ8A 1DJRD 4PNYA 1VDZA 3AMUA 1EL0A 2IX3A 4PV1C 1J9OA 1Q3LA 1S5BD 1IHZA 3N52A 3TP6A 5FO7B 2F0WA 2LKVA 3V2TA 1VF5C 3DEOA 2BDNA 3LWUA 1PTOH 2O2LD 3MXPA 1CHQD 4F88A 5HGTA 3Q22A 2VNUD 2A5HA 3CU7A 3NXWA 2RA4A 1B4OA 1CQFA 3D3RA 3MAQA 3I90A 2CVRA 2R7ZB 1O7ZA 5BN5A 2B2VC 1B53A 2JEBI 5G3LF 2WP8J 4ZRZA 1PZID 1DOLA 4EGVA 3IFDA 1JQYD 2IWHA 2B63B 4H13C 1I4RA 1KDBA 3U9SA 4EQOA 3NSWA 3TDQA 1VCIA 4IZ8A 2FMCA 3ITPA 2RDGA 3H91A 1HUNA 5FLXL 3KLSA 2EYLA 3J81L 2PNRC 2M9VA 4MIUA 3PUYA 4I65A 3Q6SA 2KUMA 4CHTB 1MI2A 1K8MA 2F0SA 4ZK9B 4GZYC 3OOCA 1RJTA 5IGCA 4C1NI 1KNAA 4V0BA 3GP7A 4ZAIA 3VYTA 3VR5A 5C4JB 1G2SA 4KKTA 4RGMA 2PYKA 2XRQD 2QF7A 4RH6A 2DNEA 3HP3A 3RZOB 1ENAA 3ONAB 1RODA 2F0IA 3EROA 4K2LA 5DM63 2F3VA 3KK7A 3SEBA 1MD2D 1SNOA 1VF7A 3HOVB 1XWEA 2YU9B 4K2KA 3TP5A 1TS3A 1IKMA 1WD1A 1CK1A 3GTGB 5FLXE 3S17B 1G291 1NUCA 3J81E 4HN7A 1D6EC 2E75C 3IL8A 3X3NA 1VMPA 2QEJC 4U68A 4HEDA 3NBHA 4QCLA 2VB2X 4L8JA 4RGOS 4RGNA 3MZ5A 1V1PB 4WJWA 2EZVA 5CV5A 3MA2B 4Y7NB 3QWNA 3DWAA 3KLRA 3DMUA 1WTPA 1V8QA 3W3AA 4DK1A 2EPBA 1SFOB 5JEAJ 1AFPA 4X3UA 1EY8A 3RMHA 2N55A 3A8KE 1C4QA 5JEAH 3Q0AA 2DNCA 3J7AF 1GHJA 1LLRD 2XNAC 4KJOA 3SK8A 4RHSA 1LT5D 5I6WA 2PO4A 5JVG3 3I4NB 1CZWA 2FFKB 5KYLA 1F2MA 1Z6HA 1TIID 3UI2A 3E6ZX 4RHRA 1QG7A 2PMZB 1PDQA 2E76C 4OHJA 5CYUA 2NVXB 3Q24A 2AQ1B 2WB1B 2J4XA 3DHQA 4OO1H 1IYVA 1E2WA 1IYUA 3JAML 2B2UA 2ENBA 3IKJA 3OPOA 5K5PA 2C9OA 4RGTA 1Q90A 1HRJA 3T51B 3S1NB 1I4QA 5I9PA 4G7ZC 4QF4A 4TSSA 4A3KB 5FKAC 2WAQB 1OXVA 4BY1B 4HCSA 4LJZC 1KTKA 3SXHA 3EFXD 4DXFA 1MGSA 1QE6A 4IUQA 1SYBA 4A3JB 5M9OA 4Q0FA 1A3VA 2B2WA 4C3IG 2A73B 2LFNA 1STBA 4HAEA 3DXJC 3L9AX 1I4HA 2RSOA 3C3LA 2Z8LA 1D5MC 2BA0A 1ILPA 4TKOB 5CBAE 1B9NA 1RD9D 3OMCA 1LT4D 3TN2A 3R2IA 4FP5D 3VR2A 4RAUC 3S15B 1A6XA 2L9HA 2B2UC 2X69A 1H9RA 1F9PA 1XXGA 3BVZA 1B1ZA 2HCCA 4KHVA 3GTMB 1FR3A 2F0GA 2MGSA 4C3JB 3H3VC 2FJ2A 1JE4A 1ML0D 5EKKA 3NTHA 1F9QA 2KA7A 2NVYB 2IJ0A 2B2WC 2C5CA 2RDFA 2E2JB 4H0LC 4KD4A 1I6HB 1K83B 4TRDA 5CC4A 1UEAB 1SE3A 3FMCA 2NWGA 5E4WC 1MSGA 3G6JB 1KLGD 4HMJA 2L55A 5E1FA 2A6EC 4BS9A 4K6LA 4G7OC 5D3IB 3R2TA 3CQZB 4A3EB 1EU3A 5IGGA 4A3DB 2XIWA 1ZYRC 1A2TA 3E5SA 2OF1A 4J1MA 1X32A 2NN6H 5NUCA 2F0QA 2JA6B 4A3FB 1MSHA 1GJXA 1G8ZD 1HA5A 1Q8IA 2JE6I 1IW7C 5EKLA 1A2UA 3HG9A 1AP0A 3T53B 2GA4B 4WORA 3PIP3 1QILA 4LAAA 5LL6X 5E4XA 3QIAA 4ZKBB 4RA8A 5CV4A 1WTOA 3QOJA 4FYDA 1Y8NB 4O42A 1G6ZA 3NWSA 3OWEB 1BQQT 4HCEA 3WOEA 1WTXA 5E3FA 2QDBA 1D5XC 1G2TA 1ZYRD 3K7AB 1WVLA 2XN9C 3PUXA 5FK9C 3O13A 2IPKD 3C2PA 1E2ZA 4C3HB 2JA8B 1BDOA 2NB0A 1ENFA 3R3OA 5EPKA 1H9SB 3SE0A 1OXUA 2F0LA 3PO2B 2KOLA 5JVH3 1TY0A 3I70A 4ILWA 4C1NK 1PZJD 3PUWA 1LTID 2R61A 5KRUA 2A68C 3MWYW 2FINB 4DK0A 2KQ3A 3W2DA 4G7HC 1LT6D 3R8BA 3NBIA 4ZQ3A 1DONA 3QO2A 4U673 2MP1A 1M4VA 1SJHD 3BS1A 2CQAA 3BYTB 2WKCA 3L7ZC 3KUPA 3LNNA 3GTOB 4KKSA 4H7BA 4WRDA 2TSSA 1QOHA 2PW7A 4M1UB 4XXEA 1HFGA 3MVVA 3D4RA 5KIXA 1IKLA 1LV9A 1V1OA 5ELCA 4A3IB 4HMIA 4DFAA 1HA6A 2VUMB 3H94A 3TZDA 4KY5A 4DNRB 3URYA 4YIJA 4XYOA 1Y69U 1AZQA 2CW0C 2A68D 1FYCA 1XYIA 1PLFA 4DA2A 3TMEA 2SOBA 4MN3A 2OEOA 1J8IA 3MFGA 5JJZA 3NP8A 1BUVT 1DYQA 2R93B 1EYAA 1CFMA 5M3FB 2TMPA 2BCOA 5KNCA 4K8IA 2D2CC 1BCPC 1BF4A 1KDCA 2CHBD 4A3MB 2SNMA 1JICA 5M3MB 4CGYB 3F2UA 1LT3D 3BVGA 1TQOA 1HFNA 1SXTA 1EIGA 1FGBD 1LTRD 3K57A 5A35A 5JPNC 1GHKA 3S9WA 4K14A 1QNKA 3GTLB 1Q12A 1LTSD 3H09A 2CW0D 3ERQA 4DGZA 4KN4C 4KN7C 3KBXA 2WV6D 2H1EA 3MXNA 4CKEA 5JEAG 4JK1C 2AQ3B 1VMCA 4N9TA 3J80L 1WTRA 4DU9A 1PRTC 3T13A 4FO2A 3T56B 5C4XB 1BCPD 3CRKC 5I9OA 1JR0D 3DM1A 5EGTA 3S14B 3ND8A 2Q8RE 2MUYA 3QJYA 2F0JA 3I73A 1UUPA 4K5VA 1KAAA 1LABA 2NVQB 2EYMA 1X3PA 3GTPB 3GV3A 1ESRA 3FKIB 1SNMA 2SDFA 2G9HD 3RD4A 5CV8A 5FOBB 3K5OA 2JXMB 1SDFA 1BCPF 5KNDA 2JA7B 2K01A 4KMUC 3RUZA 5D3DA 5M5YB 5C3XA 4PMBA 1EY7A 4FF4A 1TWFB 3GV6A 1SYGA 5FO8B 1U4PA 5D65A 1I4PA 5COYA 5IIFA 4KKUA 4KHZA 1PRTD 3HZXA 1CHPD 3J80E 3OMGA 3NUCA 1T5XD 4BWGB 1OXTA 1PFNA 5AFWA 1CTMA 4IALA 2ZXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P7J A;  4IUT A;  5EPL A;  2XIW A;  1DON A;  2K03 A;  1MI2 A;  3QO2 A;  4R9W A;  2MP1 A;  4UAI A;  5T1I A;  1U4M A;  4ZK9 B;  4CJ2 C;  4QUC A;  5EKI A;  2HUG A;  1ILP A;  1ZXT A;  1DOK A;  2FHT A;  2L4N A;  1QNK A;  1RJT A;  5CBA E;  4X3T A;  1X32 A;  1ILQ A;  2NYZ D;  1CA6 A;  1WTV A;  1EL0 A;  2K05 A;  1SSO A;  2B2Y A;  1J9O A;  1BO0 A;  1MSH A;  2EOT A;  1Q3L A;  2VXW A;  3KBX A;  2H1E A;  1KNA A;  2MPM A;  3KUP A;  2Q8T A;  4ZAI A;  1U4L A;  3TN2 A;  1CA5 A;  2FFK B;  3N52 A;  1U4R A;  1G2S A;  2B2T A;  2N88 A;  3LWE A;  4XT1 B;  1RTO A;  4RAU C;  3DEO A;  1WD0 A;  2M2L A;  4CJ1 B;  2BDN A;  1PFM A;  5T1G A;  2L9H A;  3I8Z A;  2B2U C;  2IL8 A;  1HFG A;  1ICW A;  1VMC A;  1AP0 A;  2HDL A;  5EPJ A;  1KNE A;  3UI2 A;  2X69 A;  3R93 A;  4CJ0 B;  1WTR A;  3HP3 A;  1QG7 A;  2RSN A;  1F9P A;  2KEC A;  1PDQ A;  1O80 A;  2RA4 A;  1IKL A;  2HCC A;  1B4O A;  1BNZ A;  3ONA B;  1ROD A;  1X3Q A;  4QUF A;  4RWS C;  1F9R A;  5E4X A;  1LV9 A;  1A15 A;  1EQT A;  3I90 A;  4LMQ D;  4ZKB B;  1G91 A;  1SAP A;  1F2L A;  3I3C A;  2CVR A;  2MGS A;  3MTS A;  4RA8 A;  4IUV A;  1HA6 A;  1WTW A;  4OIJ A;  1WTO A;  2JYO A;  1O7Z A;  3DM1 A;  5EJW A;  1E0B A;  3D6W A;  2FMM A;  4O42 A;  1HUM A;  2B2V C;  1B53 A;  1M8A A;  2J7Z A;  2FJ2 A;  2JP1 A;  2Q8R E;  3TZD A;  3I91 A;  1DZ1 A;  1JE4 A;  1G6Z A;  1EOT A;  2L1B A;  1B50 A;  1ML0 D;  1WTX A;  2EE1 A;  3DEP A;  4OIK A;  1AZQ A;  1WTQ A;  1F9Q A;  1XX8 A;  1XYI A;  1X3P A;  2B2U A;  1PLF A;  3GV3 A;  1ESR A;  2RVL A;  4MN3 A;  4XT3 B;  1IKM A;  5EQ0 A;  1WD1 A;  1HRJ A;  1C8C A;  2HCI A;  1J8I A;  2SDF A;  1PFB A;  5JJZ A;  3FDT A;  3G7L A;  2K1B A;  1G2T A;  3FPU B;  4NW2 A;  1GUW A;  1DOL A;  2DY8 A;  4IUP A;  2B2W C;  3IL8 A;  3IFD A;  1VMP A;  2D9U A;  4MHE A;  1WVL A;  1O7Y A;  1B3A A;  4U68 A;  1SDF A;  2L11 A;  1BBX C;  4HED A;  2L12 A;  1AZP A;  1RTN A;  2HDM A;  2K01 A;  4HCS A;  1S4Z A;  5EPK A;  2MJ8 A;  4XDX A;  3SVM A;  5D14 A;  2B2V A;  2NWG A;  5E4W C;  1MSG A;  2K28 A;  2R3Z A;  1NR4 A;  1MGS A;  1QE6 A;  3GV6 A;  4IUR A;  5COR A;  1IL8 A;  4IUQ A;  2KOL A;  5CBE E;  4X3K A;  1TVX A;  1U4P A;  1RHP A;  1BF4 A;  1EIH A;  2DY7 A;  1NAP A;  5D65 A;  5DNF A;  4ZKC B;  1F9S A;  2B2Y C;  2K04 A;  2KVM A;  1WTP A;  1JIC A;  5COY A;  4ZLT F;  2X6G A;  3F2U A;  4R8I A;  2EPB A;  2B2T C;  1NR2 A;  3H91 A;  1HFN A;  4X3U A;  5CMD A;  2KED A;  4DN4 M;  1HUN A;  3MWY W;  4X3S A;  1B2T A;  2B2W A;  2KEE A;  1CM9 A;  2FIN B;  1EIG A;  2N55 A;  2X6L A;  1HHV A;  1DOM A;  4HAE A;  1NCV A;  4IUU A;  2NZ1 D;  4HSV A;  1PFN A;  5AFW A;  2RSO A;  3Q6S A;  2KUM A; 
#chains in the Genus database with same CATH topology
 4FF3 A;  2PZT A;  4HJ5 A;  5CV9 A;  3RZO H;  2F0E A;  2ICE C;  2PI2 E;  3I55 A;  3X3M A;  2EYH A;  2QCP X;  1IYJ B;  1R9T B;  3MXG A;  1DOK A;  4PZ6 A;  2BDO A;  1BBW A;  1I94 Q;  4LF4 Q;  2F0P A;  2E2D C;  2K05 A;  1BO0 A;  1O78 A;  3GTJ B;  3FPP A;  2VXW A;  2XWJ B;  1E2V A;  2JA7 H;  3OSO A;  3ICE A;  1PRT F;  3HOV H;  2YU9 H;  2EDG A;  4OGQ C;  1TWF H;  1OTC A;  1JOR A;  4R8N A;  2IL8 A;  2R92 G;  2F0U A;  2MHV A;  1X6O A;  2Z1C A;  1CUK A;  2YV5 A;  1EWH A;  1KRT A;  1IBL Q;  2JA5 B;  3J7A 5;  4HJ9 A;  1LAC A;  3HOW G;  2R6G A;  1AN8 A;  4OWW B;  2F52 A;  2CWP A;  3H0G G;  4IUV A;  2ZM6 L;  3W1B A;  1IBK Q;  3TZU A;  2AWN A;  3VYS A;  3CRL C;  2FMM A;  2I07 B;  4OO1 I;  2YYZ A;  1ET9 A;  1M8A A;  3T1Y Q;  2L0C A;  4NKL A;  3OWF A;  1OXX K;  3CC2 A;  1WTQ A;  2Q2T A;  3L2P A;  1JWS D;  2D62 A;  4Y7N H;  4BBS B;  2RVL A;  3NTK A;  4EVO A;  5JAV A;  4DAM A;  1Y1W G;  4B3S Q;  5L37 A;  3CPF A;  4ABN A;  1CZG A;  4EQP A;  1K9M C;  3PV0 A;  1SFO H;  3GQB A;  2F0N A;  3SK5 A;  1HTL D;  1O7Y A;  1IBM Q;  5C5L A;  2XVS A;  1F2Z A;  1NY4 A;  4B3S L;  1STG A;  1VQA A;  2B8G A;  3CP0 A;  1VQJ A;  3EQL C;  2EY6 A;  2HDM A;  1YNX A;  1LUZ A;  3SVM A;  2ZJQ A;  2O4X A;  4N8F A;  5CR3 A;  4A3B G;  2JA5 H;  4BY7 B;  1GUS A;  1IL8 A;  2RDH A;  5J22 A;  1MIU A;  4YY3 L;  3J7Z C;  3K7U C;  3I4N H;  2J0T D;  3PF5 A;  4ZLT F;  1S40 A;  4Z9C B;  2JEA I;  3PF4 A;  4A93 G;  4DV4 Q;  2AWO A;  2IW3 A;  1HPC A;  3H15 A;  3J81 j;  1PFS A;  4LUZ A;  5GAD C;  4WFN 3;  3SHL A;  2OTL A;  1CT1 D;  4GKK L;  2LY7 A;  5EPL A;  2VB3 X;  1L0X B;  4ME5 A;  1QNU A;  1Y8P B;  5H1S E;  4QUC A;  1HH2 P;  2NVX H;  4UP9 A;  2L4N A;  4A3L H;  4FF1 A;  1SJE D;  2NVT B;  3MFY A;  1VS0 A;  1KIX A;  4B3T Q;  4GN3 B;  3ND9 A;  4LF6 L;  3H3V H;  1MJE A;  1ASY A;  1XPO A;  3C46 A;  2H4O A;  2QIL A;  4KK7 A;  1ZEQ X;  1S3O A;  2N88 A;  2F0K A;  2MNA A;  4BBR B;  2UXD L;  1L0Y B;  2AQ2 B;  2L5T A;  5IWA L;  2H5X A;  1ICW A;  2PCF B;  4DK6 C;  4CBV A;  4JI1 L;  1PH6 A;  5ELB A;  3UDI A;  3W1G A;  3S1N H;  1STN A;  1BNZ A;  1S5C D;  2I0Q A;  4YHH L;  2PNH A;  2QW7 A;  2E2I B;  4RKL A;  1VQO A;  3I2Z A;  4HSP A;  4A3K H;  1WTW A;  1CKM A;  4GN4 B;  1KDA A;  2C35 B;  4BY1 H;  3E0E A;  3P20 A;  3VR3 A;  1I4X A;  3JAM E;  2EYJ A;  2LSS A;  4X66 Q;  1EOT A;  4LF7 L;  3M7G A;  3CCJ A;  3PCO B;  5ELF A;  1CKN A;  2RKS A;  1Q1E A;  3OIQ A;  3VYR A;  4JI4 Q;  3HGB A;  2NVT H;  3UDX A;  3J7Y W;  1C8C A;  1H9J A;  3I4M B;  2WB1 E;  3CCS A;  4I7A A;  4RMF A;  1LM0 A;  2BOS A;  1A3U A;  3FEW X;  5LMN Q;  4GNX B;  4KI0 A;  4BA2 I;  1K3B C;  1KAW A;  3KDF A;  3PIO 3;  2A6H D;  2IHE A;  3QB3 A;  2PQA A;  4JI7 Q;  1MKH A;  1K0S A;  3VA7 A;  3AB9 A;  1RIP A;  4LUO A;  3WWV A;  1DXM A;  1SBB B;  1UE7 A;  4DKA C;  5COR A;  3AU7 A;  3E9H A;  3FRP B;  4X3K A;  4KY7 A;  2N49 A;  3S16 B;  2KVM A;  5C3E B;  3M85 A;  3RLN A;  1YI2 A;  2WAQ E;  3E0J A;  2HT1 A;  4LWC A;  4DR2 Q;  2CFM A;  1TT2 A;  2RF4 A;  2DJG C;  1DOM A;  2CH4 A;  4C3I B;  1KLU D;  1EY5 A;  3P7J A;  4UDU C;  2UUC L;  4FNF A;  3I4M H;  3VYU A;  2N8N A;  1HR0 W;  4A75 A;  2BA1 A;  2YTV A;  2A69 C;  3LX0 A;  3GTM H;  5ELE A;  3S2H B;  1RL2 A;  1RDP D;  5A2Q L;  2NN6 I;  1T9H A;  5BN3 A;  4C3J H;  1E1T A;  4XTC S;  4HJA A;  4GKJ L;  1SYD A;  1FD7 D;  2WKD A;  2DN8 A;  5I2Y A;  1U4R A;  3HOX G;  2K5D A;  2VQF Q;  4B08 A;  1VQE A;  1W6J A;  2PPB C;  3ULL A;  1KL9 A;  2R7F A;  4IUN A;  4JI8 Q;  2QKI C;  2RSN A;  3TRE A;  1O80 A;  3ER0 A;  4ODG A;  5IP7 H;  3M4P A;  1SE4 A;  4DPG A;  2ZJP A;  1X3Q A;  2F1M A;  4DR5 Q;  1A15 A;  2E2J H;  1I50 B;  1GKH A;  1I6H H;  1K83 H;  4C3I H;  3CCE A;  5AJ3 L;  4DR5 L;  2LS0 1;  4YWM A;  1PH4 A;  2L1B A;  3L3O C;  1EY4 A;  4F87 A;  4FXD A;  1LTA D;  3S2H H;  4ULL A;  2PQE A;  1HR0 L;  4J8Q A;  4XT3 B;  1JJ2 A;  4EQ5 A;  2UXC L;  4QGU A;  4A76 A;  4LUV A;  1R4Q B;  1D1K A;  3FDT A;  3G7L A;  1FNW A;  2K5Q A;  5HUR A;  4OXP A;  4MTK A;  2A69 D;  3G6E A;  1VQ8 A;  1X3E A;  2L11 A;  2NTS A;  5M5X B;  3CQZ H;  5C5M A;  4A3E H;  4IJH A;  2NBF A;  5DEH A;  3S1Q B;  4K5X A;  3WDN A;  3BZD B;  4A3D H;  5D14 A;  5I2X A;  5A2Q E;  2R3Z A;  1KHI A;  1X56 A;  4KTA A;  3BDO A;  5IT9 L;  1HNW Q;  2IX1 A;  2DY7 A;  4ZUI A;  3HS0 C;  2JA6 H;  4ZUJ A;  1I50 H;  1P8L A;  1SNP A;  2X6G A;  1Q1B A;  3AFQ A;  4A3G B;  3KFU A;  1Y1V B;  3EVQ A;  3D4W A;  4X3S A;  1I5F A;  1UWV A;  3HOZ B;  1STE A;  5K36 H;  2F0F A;  1PH2 A;  1TWG B;  2UUB L;  2NZ1 D;  3C1E A;  2Y0S B;  3MEF A;  1BKB A;  3J7A V;  1Y8O B;  2I46 A;  5DAU A;  1BCP B;  1LO5 D;  1FVI A;  1HZA A;  5IYB G;  4DAV A;  4JI3 L;  1GXD C;  1ZXT A;  2ID0 A;  4A3C H;  1IL2 A;  5M5X H;  2B2Y A;  3KLS X;  1K8G A;  1WCM B;  1S5E D;  4IFD J;  3F8T A;  1U4L A;  4P2C B;  3K5N A;  2F0V A;  3PUV A;  3OHX C;  2F0M A;  1E22 A;  4XQN A;  4IFD H;  5T1G A;  2Q2H A;  3BZC A;  4X64 Q;  1QB5 D;  1EQV A;  3FHW A;  3K5L A;  3HOY B;  3A7A B;  3R93 A;  1H9M A;  4B3M L;  5JJK A;  4XQJ A;  2SNS A;  3EIV A;  4A3G H;  3K7A H;  3U9O A;  5IYC H;  2BH2 A;  4WJ3 M;  2OT2 A;  1KQS A;  2R7Z G;  1F2L A;  4K0K L;  1L1O A;  4JI2 Q;  4C3H H;  1E0B A;  1HUM A;  2HD3 A;  5IT9 E;  3I91 A;  1DZ1 A;  1SMX A;  2F03 A;  2EY5 A;  1EZ6 A;  2P5Z X;  3DWP A;  4IPH A;  3NTI A;  1O7I A;  1PRT B;  1XX8 A;  1YEZ A;  4DAP A;  1MJC A;  5IOC A;  4H02 A;  1TY2 A;  1YIT A;  5EQ0 A;  4LF9 Q;  3SDZ A;  1STA A;  2HCI A;  5IYD H;  2ALY B;  1STH A;  1WCM H;  2I5L X;  4RKB A;  1JWM D;  1LTT D;  1QVC A;  1B3A A;  4AYB B;  3HEJ A;  4NMZ A;  2B63 G;  3RZD B;  1SMY C;  1DM0 B;  3S1M B;  2D0O A;  5C0X I;  4B3R L;  1HTP A;  4L5T A;  5JPM C;  1SYC A;  2PW5 A;  5I6Y A;  1TWC B;  1TS5 A;  1X3G A;  2F0D A;  2AUJ D;  2B2Y C;  2HQE A;  2Q8I B;  3CKI B;  3OW7 A;  4R8I A;  2ZTD A;  4R4Q A;  2K5H A;  4DN4 M;  3NQI A;  2Q2I A;  3GTO H;  4K6D A;  1FNV A;  5G3L D;  1JMC A;  3EA6 A;  4O1N A;  4IPC A;  1KXL A;  2G9D A;  5C0X J;  5HGQ A;  1EEF D;  1Z47 A;  4IUU A;  5IOD A;  3Q23 A;  1PXU A;  3NK9 A;  5C0X H;  3A7L A;  1YHB A;  3NEN A;  4CJ2 C;  2FHT A;  1QZG A;  2Z4I A;  4JI5 Q;  1BXT A;  1YJ9 A;  3MXN B;  5IGE A;  1YIJ A;  1L1O C;  4A3I H;  3KYH C;  2PZW A;  2Z6K A;  1SSO A;  1WOC A;  2VQE L;  3U4Z A;  2V4D A;  4LF8 Q;  1YVC A;  2V1C C;  3CHB D;  2B2T A;  1AE3 A;  1RTO A;  1Y14 B;  4GS3 A;  1WD0 A;  2K32 A;  3T1H Q;  5KYI A;  1UAP A;  5ISR A;  2JN4 A;  5JJL A;  1SNC A;  1AEX A;  1TWC H;  4L6T B;  1SMY D;  4QIW B;  4JV5 Q;  4OL7 A;  2SEB D;  4K5W A;  1B70 B;  4DV2 L;  1HCZ A;  4QUF A;  1HQR D;  4B9X A;  2XSC A;  4RCO A;  3K6O A;  2R93 H;  4O2D A;  4OIJ A;  5C44 B;  3RN2 A;  2JYO A;  4LFC Q;  4LF5 Q;  3HOV G;  4EQN A;  1NMG A;  3TP8 A;  5M3F H;  4DNT B;  1EQQ A;  4KJN A;  4IPD A;  1OO9 B;  4R4C A;  1VQ7 A;  3PO3 B;  4LW1 A;  4LFC L;  1EIF A;  1Z9F A;  3NHH A;  1LTB D;  4A3M H;  1PTO C;  5M3M H;  1A0I A;  1PFB A;  3VDY A;  5GAG C;  1GUO A;  3FPU B;  4FXG C;  4NW2 A;  3TP7 A;  1J5E Q;  2GVB A;  3I7F A;  5LL6 S;  2KHI A;  1ONL A;  1TXY A;  4LNQ A;  3H6M A;  1J5E L;  5FLX c;  3I72 A;  4H44 C;  4XDX A;  4P72 A;  1EEI D;  4F7X A;  3J81 c;  2ZXO A;  4P71 A;  3DM3 A;  3SK6 A;  3GTL H;  1JB3 A;  4RFB A;  1RHP A;  2E74 C;  1TWH B;  1WJJ A;  1NAP A;  5DNF A;  1TR5 A;  2Z6K C;  4APV A;  4DAY A;  1TS4 A;  1GM5 A;  5LHY 1;  1QJO A;  1CI3 M;  1Z7T A;  1PH9 A;  2B2T C;  4CKB A;  1TU2 B;  2PI2 A;  4DV6 Q;  3M7N A;  1HHV A;  3A56 A;  4QMG A;  1EYD A;  3MC0 B;  1I6V C;  4PMC A;  5FJ8 H;  4OO1 G;  1GUG A;  2Z4H A;  4DV0 Q;  1FGU A;  4MHE A;  2F4V Q;  4IUT A;  2KCN A;  1WYD A;  2UU9 L;  1STY A;  3CMA A;  1VQN A;  4UAI A;  4HTH A;  2RCN A;  2K52 A;  1TWA B;  2XRS D;  3V05 A;  1F77 A;  3I4N G;  1ILQ A;  2NYZ D;  5C4X H;  1CA6 A;  1WTV A;  1ENC A;  3S2D B;  5EPJ A;  3J81 i;  1VQD A;  1GOZ A;  4XIG S;  2MPM A;  3A54 A;  2Q8T A;  3S14 H;  2UUA L;  1CA5 A;  1U9R A;  1S5F D;  3HOU B;  1PTO D;  2EQS A;  4DXG A;  4BXX G;  1PVO A;  1JOK A;  2F3W A;  3KF6 A;  2A8V A;  5J1Z A;  2NVQ H;  1V43 A;  3GTP H;  3FKI H;  2EIF A;  1JWU D;  1ESF A;  4DF7 A;  4PZ8 A;  3M4O B;  3KOJ A;  1SYE A;  2A74 C;  1PA6 A;  4A3L G;  1JOO A;  3K0Y A;  4DV5 Q;  3I4O A;  3NPP A;  1HJP A;  2WB1 G;  1UE5 A;  5JOB A;  1EQT A;  4Q5V A;  2L15 A;  4I7Z C;  4P75 A;  3I3C A;  3TBI B;  3NE5 B;  3GTK B;  4E6I A;  1WFQ A;  1F2Y A;  3K0X A;  4KY6 A;  4DV5 L;  3TSS A;  5DM7 3;  1PTO F;  5M5Y H;  2J7Z A;  3SGI A;  1R4P B;  2LMC B;  2K7V A;  1I4G A;  3NEM A;  4OIK A;  4M8A A;  2ZJR A;  5BN4 A;  1W6K A;  3MXU A;  2K5W A;  1PZK D;  2G5D A;  1D2B A;  2ZM6 Q;  2QEX A;  3K59 A;  1N9W A;  3A5Z B;  5GAE C;  4MTN A;  4A3K G;  2WAQ G;  3M4Y A;  4BY1 G;  1BBX C;  3N6R A;  1AZP A;  2EXZ A;  2UXB Q;  2EYF A;  4JI0 Q;  3KF8 A;  4ALP A;  1QVF A;  3AEV A;  4HJ8 A;  3K58 A;  2K28 A;  2KHS A;  1JOQ A;  1SNQ A;  2JSO A;  5CV7 A;  1R9T H;  2UXB L;  3F2B A;  4JI0 L;  2B39 A;  1TVX A;  1HXY D;  4JOI A;  4A3J G;  3IAY A;  2RBM A;  2EVB A;  1F9S A;  1PMR A;  1HQM C;  4HR7 B;  4J6H A;  1V1P A;  3GTJ H;  1H9K A;  2B29 A;  1WTH A;  1ZKO A;  5TSS A;  3KBG A;  3RLO A;  2OQK A;  3BYY B;  1LTG D;  3M3Y B;  3D0F A;  4HID A;  3P1H A;  3ZYY X;  1XNQ L;  4ID6 A;  2K75 A;  2ASB A;  1RCV D;  3HKZ B;  4HSV A;  3OIP A;  4YY3 Q;  4NXM L;  2K03 A;  5IGB A;  3QG1 A;  3I56 A;  1GUT A;  5EBD A;  3A55 A;  5C4Z A;  3H3V I;  3VR6 A;  2ATW A;  1XTD A;  3T16 A;  2EOT A;  1SEB D;  3K5M A;  4QL5 A;  1YNJ C;  4GKK Q;  3NQT A;  4XT1 B;  4CKC A;  4N9P A;  1AW7 A;  4ZYS A;  1VQP A;  1YZ6 A;  4BBS H;  1KNE A;  4IN3 A;  4CDE C;  3GO5 A;  1SND A;  4X6A H;  2R92 B;  1II3 A;  1ET6 A;  4LF6 Q;  2KEC A;  1M90 C;  4NDX A;  2YTY A;  3JAM c;  5F2D A;  1HZC A;  3AQQ A;  2A6H C;  3V96 A;  5I4D A;  3EJI A;  3M3Y H;  3TRZ A;  4C3J G;  4JC0 A;  1QWY A;  1QUQ B;  3HOW B;  1SRO A;  4A4I A;  1SAP A;  1HZB A;  2Z6B A;  1X55 A;  3C1F A;  2QA4 A;  2UXD Q;  5IWA Q;  1CKN B;  5ELD A;  5EJW A;  3GTQ B;  4LFA L;  3H0G B;  5IGF A;  1JE5 A;  2LXJ A;  2N3S A;  4IQZ A;  1EY9 A;  2KBN A;  4JI1 Q;  4LFB Q;  4AH6 A;  4BY7 H;  2EYO A;  4K8J A;  2WII B;  3DWQ A;  4JYA L;  4JOI C;  4DNI A;  1S5D D;  3IFT A;  2D5D A;  3MHB A;  3OTO L;  4YHH Q;  4LFB L;  4C2M B;  4X65 L;  4JBM A;  5CGK A;  2OXP A;  3KDF B;  1C0A A;  2PQA B;  1I3Q B;  1Y1W B;  2NN6 G;  2DY8 A;  2D9U A;  2BE5 C;  1D8L A;  1N33 L;  2MO1 A;  1A62 A;  1K73 C;  4CDF C;  4LF7 Q;  2L12 A;  1UNS A;  3ULP A;  2IX0 A;  1UEB A;  3JAM i;  1S4Z A;  1QUQ A;  3A8I E;  2CWA A;  1E24 A;  2R92 H;  3MEH A;  4R4T A;  1YNJ D;  3CCQ A;  2K6A A;  1BOS A;  4A3B B;  2EY1 A;  1EIH A;  1EWC A;  3CPW A;  1RKN A;  1YNN C;  1E7Z A;  5KEE A;  1D5Z C;  3CC4 A;  4Y52 H;  5KGU A;  1NR2 A;  1CQV A;  2K50 A;  2KED A;  3UE0 A;  3HKZ E;  1KD1 C;  4A3E G;  4J15 A;  4BBR H;  4A93 B;  1D1I A;  1EY0 A;  1EYC A;  4XYQ A;  4A3D G;  1T5E A;  3CCM A;  2JA9 A;  1B44 D;  1DD2 A;  2PZU A;  4XQQ A;  3DUZ A;  4NP5 A;  4R9W A;  1CSQ A;  1RF2 D;  2EJG C;  1VQM A;  4F8M A;  3PMF A;  1VQ9 A;  4X3T A;  3S1R B;  2JA6 G;  2E2I H;  4A3F G;  2F4I A;  3FVQ A;  4V19 0;  3WOF A;  1QZH A;  1O7L A;  3NWT A;  4JBW A;  5K36 G;  1PV4 A;  5J39 A;  2UUC Q;  5EBC A;  1B9M A;  2BE5 D;  2RHS B;  5M5W B;  2M00 A;  2HDL A;  4A3B H;  1C7Y A;  1SE2 A;  4UP7 A;  5C6A A;  3VA5 A;  2OTJ A;  4G57 A;  1VQF A;  4PQX A;  4A3C G;  4GKJ Q;  2AUK A;  4RWS C;  1F9R A;  2O5J C;  1W2B A;  4LMQ D;  4A93 H;  4DUZ L;  3MTS A;  3P75 A;  1A3T A;  4PMW A;  3GD7 A;  1MBY A;  1YNN D;  2EYP A;  3I4L A;  2ICI A;  2VS1 A;  3D4D A;  4IFD G;  2KCM A;  4X62 L;  2HIX A;  4S3S A;  2XTI A;  3A8J E;  3S1R H;  3S16 H;  4G4K A;  1GO3 E;  5C3E H;  5E7N A;  5EAY A;  1NNX A;  2NUC A;  2K1B A;  5IYC G;  3BDC A;  2IT1 A;  5AJ3 Q;  4L5Q A;  1Q81 C;  1N34 L;  4C3H G;  2JA8 G;  1YJW A;  4BA1 I;  1SRU A;  1RTN A;  3BDL A;  4QB4 A;  4TQU S;  1GD7 A;  1HR0 Q;  1SN8 A;  5IP9 H;  2E2H B;  3PO2 G;  2UXC Q;  1A63 A;  3T4A C;  1BR9 A;  5CBE E;  2KJX A;  4OWX B;  3F1Z A;  4DR1 L;  4FVM A;  2K04 A;  4UPA A;  2EJF C;  1XTC D;  3M4Q A;  4GLA C;  3VR4 A;  4JVZ A;  2VY3 A;  2ZTC A;  1B2T A;  1NBW A;  2KEE A;  1CM9 A;  2X6L A;  5KNB A;  1KAB A;  1WI5 A;  3D8G A;  3NEL A;  1SYF A;  1HNX L;  1NSN S;  5IGD A;  4POF A;  2EJM A;  5EKI A;  2HUG A;  2K14 A;  1IXR A;  3QOL A;  1GUN A;  4KV6 A;  4KD3 A;  2K4K A;  3AYH B;  1EFI D;  1Q8K A;  1JJC B;  2A19 A;  2UUB Q;  4OEM B;  2A6E D;  3LWE A;  3RLF A;  3ZJY C;  3KJP A;  4IFD I;  1CSP A;  3F2C A;  2E2H H;  3HOX B;  2M2L A;  1EYG A;  1PFM A;  3G48 A;  4JG2 A;  3I8Z A;  4JI3 Q;  1P16 A;  1E3P A;  2QDL A;  1XNR L;  5C0X G;  1SLJ A;  4CJ0 B;  1FL0 A;  5FLM H;  3HRZ C;  3DLL A;  5C4H A;  1L1O B;  1MHW C;  1S72 A;  2ZTE A;  2RQX A;  1QCB D;  4A3I G;  3OW2 A;  5C3W A;  2VUM G;  1G91 A;  3D6C A;  1DCZ A;  2EY2 A;  3S1Q H;  1XPU A;  3BG3 A;  3D6W A;  3BVM A;  3TQY A;  2F0T A;  2JP1 A;  3PUZ A;  2DUD A;  1B50 A;  1VQ6 A;  1OXS C;  2EE1 A;  3DEP A;  4B3M Q;  1B8A A;  5IY0 A;  4RCN A;  2O5I C;  4DR3 L;  1FNU A;  5CV6 A;  5FO9 B;  1IW7 D;  1TS2 A;  2ZT9 C;  2ZXR A;  4K0K Q;  1PYW D;  1C48 A;  5GQO A;  1Y1V H;  1GUW A;  4IUP A;  2Q2U A;  4KHP L;  1B7Y B;  3G71 A;  2XWB B;  3HOZ H;  1TKW B;  1EY6 A;  1TWG H;  4FXK C;  2NTT A;  5M3F G;  1JC7 A;  3CAM A;  2AMC B;  2MJ8 A;  2B2V A;  2F3I A;  4JI6 L;  1NR4 A;  2KCC A;  4IUR A;  1PTO B;  4IOA A;  3KLW A;  4PZ7 A;  1H9S A;  2WIN B;  3BZK A;  4ZKC B;  5M3M G;  4B9W A;  2K33 A;  3SR1 A;  2RHQ B;  1YJN A;  1K8O A;  4DV7 L;  2WAC A;  5CMD A;  3SK4 A;  2YTX A;  1EU4 A;  1JCK B;  4B3R Q;  4C56 C;  1NCV A;  3TS0 A;  1U5K A;  4L63 B;  4CJ1 B;  3HOY H;  4JW0 A;  4LK1 C;  2F0H A;  5GRO A;  2DJF C;  3D31 A;  4FF2 A;  5T1I A;  1U4M A;  2F0O A;  1EFW A;  2CCZ A;  2B8F A;  1EZ8 A;  1DJR D;  4PNY A;  1VDZ A;  2OQ0 A;  3AMU A;  1EL0 A;  1HNZ L;  2IX3 A;  4PV1 C;  1J9O A;  4GOP A;  1Q3L A;  1S5B D;  4HJ7 A;  1IHZ A;  2Y0S E;  3N52 A;  1PH5 A;  3TP6 A;  5FO7 B;  1Q46 A;  4UP8 A;  2F0W A;  2LKV A;  3V2T A;  1VF5 C;  3DEO A;  2VW9 A;  5LMU L;  2BDN A;  3CW2 C;  1PTO H;  2O2L D;  3LWU A;  3MXP A;  4R4I A;  1CHQ D;  4F88 A;  5J3B A;  1BVS A;  5HGT A;  3Q22 A;  2VNU D;  2A5H A;  2IY5 B;  3CU7 A;  3K80 C;  3NXW A;  2RA4 A;  1B4O A;  1CQF A;  1NTG A;  2VQE Q;  5C4X G;  3D3R A;  3MAQ A;  3I90 A;  2CVR A;  3RZD H;  2R7Z B;  1O7Z A;  3U58 A;  1E1O A;  3S1M H;  5BN5 A;  2B2V C;  1B53 A;  2JEB I;  5G3L F;  1EWI A;  5ELN A;  3FKI G;  4DV2 Q;  2EXD A;  2WP8 J;  4JPB W;  4ZRZ A;  4QY7 A;  1PZI D;  2JK8 A;  1B3Q A;  1DOL A;  4EGV A;  3IFD A;  1JQY D;  1VQC A;  2JA7 G;  3ERS X;  2IWH A;  2Z9H A;  2CKZ B;  2B63 B;  4H13 C;  2OCE A;  1M1K C;  5HY6 A;  1I4R A;  3PSI A;  4DAY B;  1KDB A;  3U9S A;  4EQO A;  5BR8 Q;  1DGS A;  3NSW A;  4OX9 L;  3TDQ A;  4GN5 A;  3HFZ B;  1VCI A;  4GOP C;  1LYL A;  1N32 Q;  4AYB E;  4IZ8 A;  5BR8 L;  2FMC A;  3ITP A;  2RDG A;  3H91 A;  4UHV A;  1HUN A;  5FLX L;  1N32 L;  3KLS A;  2EYL A;  1YHQ A;  3J81 L;  2PNR C;  2M9V A;  4MIU A;  3PUY A;  4I65 A;  3Q6S A;  4DR6 L;  2KUM A;  2HQL A;  4CHT B;  3TS2 A;  1MI2 A;  1K8M A;  2F0S A;  1NMF A;  4ZK9 B;  4GZY C;  3OOC A;  1RJT A;  3J80 c;  1ASZ A;  5IGC A;  3KF6 B;  1BBU A;  4C1N I;  5C44 H;  1KNA A;  4V0B A;  3GP7 A;  4ZAI A;  3VYT A;  3PIP A;  3VR5 A;  5C4J B;  1G2S A;  4KKT A;  4RGM A;  3PO3 H;  1K28 A;  2PYK A;  2XRQ D;  2UU9 Q;  2QF7 A;  4RH6 A;  2DNE A;  3RNU A;  2JA5 G;  3HP3 A;  3RZO B;  1ENA A;  1YHA A;  4JBK A;  3ONA B;  3NBH B;  1ROD A;  2F0I A;  2UUA Q;  3ERO A;  4K2L A;  5DM6 3;  1PH3 A;  4DUY L;  2F3V A;  3KK7 A;  3GDE A;  2MQH A;  3SEB A;  1MD2 D;  4POG A;  1SNO A;  1VF7 A;  3J80 i;  3HOV B;  3K81 C;  1XWE A;  2YU9 B;  4K2K A;  4DV3 Q;  4QIW E;  2IHF A;  4BBS G;  3TP5 A;  1TWH H;  1TS3 A;  1IKM A;  1WD1 A;  4DV3 L;  1CK1 A;  2FXQ A;  5FLX E;  3GTG B;  3S17 B;  2LXK A;  1G29 1;  1NUC A;  3J81 E;  4HN7 A;  1D6E C;  2E75 C;  5C4J H;  3IL8 A;  3KF8 B;  3X3N A;  1VMP A;  2QEJ C;  4U68 A;  2MO0 A;  1LTL A;  4HED A;  3NBH A;  3Q8D A;  4QCL A;  2VB2 X;  4L8J A;  4RGO S;  4BY7 G;  4RGN A;  2A1A A;  3MZ5 A;  4DV1 Q;  1V1P B;  4WJW A;  2HHH L;  1TWA H;  2EZV A;  5CV5 A;  3MA2 B;  4Y7N B;  4DV1 L;  3EN2 A;  2R7D A;  1VQB A;  3S2D H;  1A8V A;  3QWN A;  3DWA A;  3KLR A;  3DMU A;  1WTP A;  1V8Q A;  3E9I A;  3W3A A;  3PGZ A;  4DK1 A;  2EPB A;  3HOU H;  1I94 L;  1SFO B;  5JEA J;  4LF4 L;  4X3U A;  1AFP A;  1EY8 A;  3RMH A;  4ME3 A;  2N55 A;  3IRB A;  3A8K E;  1C4Q A;  5JEA H;  4RG1 A;  3Q0A A;  2DNC A;  3J7A F;  1GHJ A;  1G51 A;  1LLR D;  2KHJ A;  4UY8 C;  2GVA A;  3M4O H;  3GTG H;  3S17 H;  3A74 A;  2XNA C;  4KJO A;  4P74 A;  3SK8 A;  3CCU A;  4RHS A;  1LT5 D;  5I6W A;  2PO4 A;  2VZA A;  5JVG 3;  3CC7 A;  3I4N B;  1IBL L;  3GTK H;  1XNQ Q;  1VQ5 A;  1CZW A;  2FFK B;  4BBR G;  1K3R A;  4NXM Q;  5KYL A;  1IBK L;  1F2M A;  1Z6H A;  4DR4 Q;  4JCV E;  1TII D;  3UI2 A;  2ES2 A;  3T1Y L;  3E6Z X;  4RHR A;  1QG7 A;  2PMZ B;  1PDQ A;  2E76 C;  4DR4 L;  4OHJ A;  5CYU A;  2NVX B;  4FDB A;  3Q24 A;  2AQ1 B;  2WB1 B;  2J4X A;  1K0R A;  3DHQ A;  1IBM L;  4OO1 H;  1NE3 A;  1IYV A;  5GAH C;  4GLV B;  1E2W A;  1IYU A;  3JAM L;  2B2U A;  3I4M G;  1W3S A;  2ENB A;  3IKJ A;  3OPO A;  5K5P A;  2C9O A;  4RGT A;  1Q90 A;  1HRJ A;  3T51 B;  4QQB X;  3CCR A;  3S1N B;  5JJI A;  1I4Q A;  3RN5 A;  4LFA Q;  5I9P A;  4G7Z C;  4QF4 A;  1PH8 A;  4BXX H;  4TSS A;  4A3K B;  5FKA C;  2WAQ B;  1OXV A;  1NJI C;  4BY1 B;  4JYA Q;  4HCS A;  4LJZ C;  2HIV A;  1JB7 A;  4DV4 L;  3OTO Q;  1KTK A;  3SXH A;  4HIK A;  3EFX D;  4YWL A;  4DXF A;  4X65 Q;  1MGS A;  1QE6 A;  4IUQ A;  4HIO A;  2QGQ A;  5C3E G;  4YCV A;  1SYB A;  5IP7 G;  4A3J B;  5M9O A;  1N33 Q;  4Q0F A;  2NZH A;  2CH4 W;  1VQK A;  4B3T L;  2OWO A;  5LMN W;  1V1Q A;  1A3V A;  2B2W A;  4C3I G;  1JJG A;  2A73 B;  2LFN A;  1STB A;  4HAE A;  3DXJ C;  3A5U A;  3L9A X;  1I4H A;  2RSO A;  5IP9 G;  3C3L A;  2Z8L A;  3K8A A;  1X65 A;  1D5M C;  2BA0 A;  1ILP A;  4TKO B;  5CBA E;  1K8A C;  3HOW H;  1B9N A;  1RD9 D;  3OMC A;  3CF5 A;  3GTQ H;  1LT4 D;  1EIY B;  3H0G H;  1EOV A;  1X54 A;  3TN2 A;  3R2I A;  2AKW B;  4FP5 D;  3VR2 A;  4RAU C;  3S15 B;  4OON A;  2PMZ E;  1A6X A;  3G4S A;  2L9H A;  2B2U C;  4C2M H;  4X66 L;  2X69 A;  4A3J H;  1H9R A;  1XMO Q;  1F9P A;  1XXG A;  3BVZ A;  1B1Z A;  2HCC A;  1I3Q H;  4KHV A;  1Y1W H;  4JI4 L;  1FR3 A;  3GTM B;  1J6Q A;  1XMO L;  2E5L Q;  2F0G A;  3CCL A;  2MGS A;  4C3J B;  4GLX A;  1JT8 A;  5LMN L;  4P73 A;  1EQR A;  3H3V C;  2E5L L;  2FJ2 A;  1JE4 A;  1ML0 D;  5EKK A;  4JI7 L;  4IJL A;  1AH9 A;  3NTH A;  1F9Q A;  1L2F A;  4L5S A;  5FLM G;  4IOC A;  3STB C;  4YCW A;  4DUZ Q;  2E8G A;  2KA7 A;  2BH8 A;  4CDC C;  4CDD C;  2NVY B;  3CCV A;  2IJ0 A;  2B2W C;  2C5C A;  3BJU A;  2GN5 A;  2RDF A;  2E2J B;  3S15 H;  4H0L C;  4KD4 A;  4X62 Q;  1G6P A;  1I6H B;  1K83 B;  4TRD A;  5CC4 A;  1UEA B;  1IZ6 A;  1SE3 A;  4GNX A;  4DR2 L;  3FMC A;  2NWG A;  5E4W C;  1MSG A;  3G6J B;  4AQY Q;  2DGY A;  1KLG D;  4HMJ A;  2L55 A;  5E1F A;  1N34 Q;  2XGT A;  2A6E C;  2I5M X;  4BS9 A;  4A3G G;  4K6L A;  4G7O C;  1Y1V G;  4AQY L;  5D3I B;  3HOZ G;  3R2T A;  1H95 A;  2Y0S G;  3CQZ B;  4A3E B;  1EU3 A;  5M5W H;  1SE8 A;  5IGG A;  1X9N A;  2VQF L;  4DR1 Q;  4A3D B;  2XIW A;  3AFP A;  1ZYR C;  1A2T A;  3EBE A;  3E5S A;  2OF1 A;  2NVY H;  4JI8 L;  4J1M A;  1X32 A;  5IYD G;  2NN6 H;  1WCM G;  5NUC A;  3UE1 A;  2F0Q A;  2JA6 B;  4A3F B;  1MSH A;  1GJX A;  3STB D;  1G8Z D;  1HNX Q;  1ICF B;  2K5V A;  1HA5 A;  4KLK A;  1Q8I A;  2JE6 I;  1IW7 C;  5EKL A;  1A2U A;  3HOY G;  4YCU A;  3HG9 A;  1AP0 A;  3T53 B;  2Z0S A;  3S24 A;  2GA4 B;  4WOR A;  3PIP 3;  1QIL A;  4LAA A;  4NB3 A;  5LL6 X;  5E4X A;  3QIA A;  3KJO A;  4NPS A;  4ZKB B;  5ELO A;  4RA8 A;  3U4V A;  2I5H A;  5CV4 A;  1WTO A;  3QOJ A;  4FYD A;  4GNX C;  1Y8N B;  3ULJ A;  4JBJ A;  4O42 A;  1XNR Q;  1G6Z A;  3NWS A;  4O0A A;  3OWE B;  1BQQ T;  4HCE A;  3WOE A;  1WTX A;  4QJF A;  5E3F A;  1VQI A;  2QDB A;  1EUJ A;  1X3F A;  3F2D A;  4L5R C;  4A3F H;  1D5X C;  3B6Y A;  5IT9 c;  1G2T A;  1HNW L;  1V9P A;  1N8R C;  1ZYR D;  4AIM A;  3K7A B;  4AYB G;  1PYB A;  1WVL A;  2D0P A;  2XN9 C;  3PUX A;  5FK9 C;  3O13 A;  2IPK D;  3C2P A;  1E2Z A;  3L0O A;  4C3H B;  2JA8 B;  1BDO A;  2NB0 A;  1ENF A;  3E3X A;  3R3O A;  4DR3 Q;  1N36 Q;  5EPK A;  1H9S B;  1Q82 C;  3SE0 A;  1OXU A;  2F0L A;  3PO2 B;  2KOL A;  5JVH 3;  1N36 L;  1TY0 A;  3I70 A;  4ILW A;  1GVP A;  4C1N K;  1PZJ D;  4KHP Q;  2WFW A;  3PUW A;  1LTI D;  2R61 A;  5KRU A;  2R93 G;  2A68 C;  3MWY W;  2JJQ A;  2FIN B;  4DK0 A;  3HOX H;  2KQ3 A;  3W2D A;  1VQ4 A;  4JI6 Q;  4G7H C;  1LT6 D;  4OEL B;  3R8B A;  3A0J A;  3NBI A;  4ZQ3 A;  1DON A;  3W5O A;  3QO2 A;  4N8X 1;  4U67 3;  2MP1 A;  5IE8 A;  1M4V A;  4X64 L;  4GOP B;  3QR8 A;  1SJH D;  3BS1 A;  4A3M G;  4DV7 Q;  2CQA A;  3BYT B;  2WKC A;  3L7Z C;  1U0L A;  3KUP A;  2JA8 H;  1AE2 A;  1L0W A;  3FP9 A;  1HZ9 A;  3LNN A;  3GTO B;  4IO9 A;  4KKS A;  4JI2 L;  4H7B A;  4WRD A;  2TSS A;  1QOH A;  1FJG Q;  2PW7 A;  3PO2 H;  4M1U B;  4XXE A;  1HFG A;  4ZCK A;  3MVV A;  3D4R A;  1HNZ Q;  5KIX A;  1CKO A;  1FJG L;  1IKL A;  1VQL A;  1LV9 A;  4LF9 L;  1V1O A;  5C44 G;  5ELC A;  2AHO B;  4A3I B;  1PH1 A;  4HMI A;  4DFA A;  1HA6 A;  4HIM A;  2VUM B;  5LMU Q;  3PO3 G;  3H94 A;  3LGJ A;  3TZD A;  1XPR A;  4KY5 A;  4DNR B;  3URY A;  1UE6 A;  1XMQ Q;  5FJ8 G;  4OWT B;  4YIJ A;  4XYO A;  1Y69 U;  1AZQ A;  2CW0 C;  2A68 D;  1FYC A;  1XYI A;  1PLF A;  2K5N A;  3TME A;  4DA2 A;  2SOB A;  3PIO A;  4MN3 A;  1XMQ L;  2OEO A;  1J8I A;  2B3G A;  3MFG A;  5JJZ A;  3NP8 A;  1BUV T;  1DYQ A;  2R93 B;  3BU2 A;  2KCT A;  1EYA A;  3UDF A;  1CFM A;  5M3F B;  2VL6 A;  4MZ9 A;  2TMP A;  2BCO A;  5KNC A;  5IYB H;  4K8I A;  2D2C C;  1BCP C;  1BF4 A;  1KDC A;  2CHB D;  2CQO A;  4A3M B;  2SNM A;  1JIC A;  5M3M B;  4CGY B;  3F2U A;  1LT3 D;  1YBY A;  4JI5 L;  3BVG A;  2VUM H;  1TQO A;  1VQH A;  1QVG A;  1HFN A;  3HKS A;  1SXT A;  1EIG A;  1FGB D;  1LTR D;  4LF8 L;  1PH7 A;  3K57 A;  3U50 C;  5A35 A;  4OX9 Q;  4MNO A;  4IPG A;  3M9B A;  5JPN C;  3T1H L;  1GHK A;  3S9W A;  4K14 A;  1PYS B;  3CD6 A;  1PHJ A;  1QNK A;  1Q86 C;  3GTL B;  1Q12 A;  1LTS D;  3H09 A;  2CW0 D;  3ERQ A;  3OYY A;  4KN4 C;  4DGZ A;  4KN7 C;  3RR5 A;  4JV5 L;  3KBX A;  2WV6 D;  2R7Z H;  3HOU G;  2H1E A;  1KRS A;  1D7Q A;  3MXN A;  3CME A;  4DR6 Q;  4CKE A;  5JEA G;  4JK1 C;  4LF5 L;  4EX5 A;  2AQ3 B;  1VMC A;  4N9T A;  3J80 L;  1WTR A;  4DK3 C;  4DU9 A;  1PRT C;  1XJV A;  1VQG A;  1SR3 A;  3T13 A;  4R1J A;  4FO2 A;  3T56 B;  5C4X B;  3TEH B;  1C9O A;  1BCP D;  3CRK C;  5I9O A;  1JR0 D;  4WJ4 A;  3DM1 A;  2B63 H;  5EGT A;  3S14 B;  3ND8 A;  3UDG A;  2Q8R E;  1Q7Y C;  2N78 A;  2MUY A;  3QJY A;  2F0J A;  3I73 A;  1UE1 A;  1UUP A;  3CXC A;  1KAA A;  4K5V A;  1LAB A;  2NVQ B;  2EYM A;  4TVA B;  1X3P A;  3GTP B;  3GV3 A;  1ESR A;  3FKI B;  4YWK A;  4DUY Q;  1SNM A;  2SDF A;  2G9H D;  2KEN A;  5CV8 A;  3RD4 A;  4NXN Q;  5FOB B;  3K5O A;  5DLQ E;  2JXM B;  1SDF A;  1BCP F;  4NXN L;  5KND A;  2JA7 B;  2K01 A;  4KMU C;  3RUZ A;  5D3D A;  5M5Y B;  5C3X A;  4DV6 L;  4PMB A;  1EY7 A;  4FF4 A;  1TWF B;  3GV6 A;  1KC8 C;  1SYG A;  5FO8 B;  1U4P A;  4DV0 L;  2F4V L;  2NZO A;  5D65 A;  2MFI A;  2RCF A;  1I4P A;  2JQO A;  3PQI A;  5COY A;  4DR7 Q;  5IIF A;  4KKU A;  4PG3 A;  4KHZ A;  1PRT D;  3JC6 6;  3HZX A;  1CHP D;  4DR7 L;  3J80 E;  3OMG A;  3HKZ G;  3NUC A;  1T5X D;  4BWG B;  4R4O A;  2HHH Q;  1OXT A;  1PFN A;  5AFW A;  1CTM A;  4IAL A;  2ZXP A; 
#chains in the Genus database with same CATH homology
 4FF3 A;  2PZT A;  5CV9 A;  2F0E A;  2ICE C;  3X3M A;  2EYH A;  2QCP X;  1R9T B;  3MXG A;  1DOK A;  2BDO A;  2F0P A;  2E2D C;  2K05 A;  1BO0 A;  1O78 A;  3GTJ B;  3FPP A;  2VXW A;  2XWJ B;  1E2V A;  3OSO A;  1PRT F;  2EDG A;  4OGQ C;  1JOR A;  4R8N A;  2IL8 A;  2F0U A;  2MHV A;  2Z1C A;  1EWH A;  2JA5 B;  1LAC A;  2R6G A;  1AN8 A;  4IUV A;  3TZU A;  2AWN A;  3VYS A;  3CRL C;  2FMM A;  2I07 B;  4OO1 I;  2YYZ A;  1ET9 A;  1M8A A;  2L0C A;  4NKL A;  3OWF A;  1OXX K;  1WTQ A;  1JWS D;  2D62 A;  4BBS B;  2RVL A;  3NTK A;  4EVO A;  5JAV A;  4ABN A;  4EQP A;  1CZG A;  3PV0 A;  3GQB A;  2F0N A;  3SK5 A;  1HTL D;  1O7Y A;  5C5L A;  2XVS A;  1F2Z A;  1STG A;  2B8G A;  3EQL C;  2EY6 A;  2HDM A;  3SVM A;  2O4X A;  5CR3 A;  4BY7 B;  1GUS A;  1IL8 A;  2RDH A;  5J22 A;  2J0T D;  4ZLT F;  4Z9C B;  2JEA I;  2AWO A;  2IW3 A;  1HPC A;  4WFN 3;  3SHL A;  1CT1 D;  2LY7 A;  5EPL A;  2VB3 X;  1L0X B;  4ME5 A;  1QNU A;  1Y8P B;  4QUC A;  2L4N A;  4FF1 A;  1SJE D;  2NVT B;  3MFY A;  3ND9 A;  3C46 A;  2H4O A;  2QIL A;  4KK7 A;  1ZEQ X;  2N88 A;  2F0K A;  4BBR B;  1L0Y B;  2AQ2 B;  2L5T A;  1ICW A;  2PCF B;  4CBV A;  5ELB A;  1STN A;  1BNZ A;  1S5C D;  2E2I B;  4RKL A;  4HSP A;  1WTW A;  1KDA A;  3P20 A;  3VR3 A;  1I4X A;  3JAM E;  2EYJ A;  1EOT A;  3M7G A;  5ELF A;  2RKS A;  1Q1E A;  3OIQ A;  3VYR A;  3HGB A;  3J7Y W;  1C8C A;  1H9J A;  3I4M B;  2BOS A;  1A3U A;  3FEW X;  4KI0 A;  4BA2 I;  3PIO 3;  2A6H D;  3QB3 A;  3VA7 A;  3AB9 A;  1DXM A;  1SBB B;  5COR A;  3AU7 A;  3FRP B;  4X3K A;  4KY7 A;  3S16 B;  2KVM A;  5C3E B;  3M85 A;  3E0J A;  1TT2 A;  1DOM A;  4C3I B;  1KLU D;  1EY5 A;  3P7J A;  4UDU C;  4FNF A;  3VYU A;  2BA1 A;  2A69 C;  3LX0 A;  5ELE A;  3S2H B;  1RDP D;  5A2Q L;  2NN6 I;  5BN3 A;  4XTC S;  1SYD A;  1FD7 D;  2WKD A;  2DN8 A;  5I2Y A;  1U4R A;  2K5D A;  4B08 A;  1W6J A;  2PPB C;  4IUN A;  2QKI C;  2RSN A;  1O80 A;  4ODG A;  1SE4 A;  1X3Q A;  2F1M A;  1A15 A;  1I50 B;  2LS0 1;  2L1B A;  3L3O C;  1EY4 A;  4F87 A;  4FXD A;  1LTA D;  4ULL A;  2PQE A;  4J8Q A;  4XT3 B;  1R4Q B;  1D1K A;  3FDT A;  3G7L A;  1FNW A;  2K5Q A;  5HUR A;  2A69 D;  2L11 A;  2NTS A;  5M5X B;  5C5M A;  2NBF A;  5DEH A;  3S1Q B;  4K5X A;  3WDN A;  3BZD B;  5D14 A;  5I2X A;  5A2Q E;  2R3Z A;  4KTA A;  3BDO A;  5IT9 L;  2IX1 A;  2DY7 A;  4ZUI A;  3HS0 C;  4ZUJ A;  1SNP A;  2X6G A;  1Q1B A;  4A3G B;  1Y1V B;  3EVQ A;  3D4W A;  4X3S A;  3HOZ B;  1STE A;  5K36 H;  2F0F A;  1TWG B;  2NZ1 D;  3C1E A;  2Y0S B;  3J7A V;  1Y8O B;  2I46 A;  5DAU A;  1BCP B;  1LO5 D;  4DAV A;  1GXD C;  1ZXT A;  2ID0 A;  2B2Y A;  3KLS X;  1WCM B;  1S5E D;  4IFD J;  1U4L A;  4P2C B;  3K5N A;  2F0V A;  3PUV A;  3OHX C;  2F0M A;  4XQN A;  4IFD H;  5T1G A;  1QB5 D;  1EQV A;  3K5L A;  3HOY B;  3A7A B;  3R93 A;  1H9M A;  4XQJ A;  2SNS A;  3U9O A;  2OT2 A;  1F2L A;  1E0B A;  1HUM A;  5IT9 E;  3I91 A;  1DZ1 A;  2F03 A;  2EY5 A;  1EZ6 A;  3DWP A;  3NTI A;  1PRT B;  1XX8 A;  4DAP A;  5IOC A;  1TY2 A;  5EQ0 A;  3SDZ A;  1STA A;  2HCI A;  1STH A;  4RKB A;  1JWM D;  1LTT D;  1B3A A;  4AYB B;  3HEJ A;  4NMZ A;  3RZD B;  1SMY C;  1DM0 B;  3S1M B;  5C0X I;  1HTP A;  5JPM C;  1SYC A;  2PW5 A;  5I6Y A;  1TWC B;  1TS5 A;  2F0D A;  2AUJ D;  2B2Y C;  2HQE A;  2Q8I B;  3CKI B;  3OW7 A;  4R8I A;  4DN4 M;  3NQI A;  4K6D A;  1FNV A;  5G3L D;  3EA6 A;  4O1N A;  2G9D A;  5C0X J;  1EEF D;  1Z47 A;  4IUU A;  5IOD A;  3Q23 A;  1PXU A;  3NK9 A;  5C0X H;  3A7L A;  4CJ2 C;  2FHT A;  2Z4I A;  1BXT A;  5IGE A;  2PZW A;  1SSO A;  2V4D A;  3CHB D;  2B2T A;  1RTO A;  1WD0 A;  2K32 A;  5KYI A;  1UAP A;  5ISR A;  1SNC A;  1AEX A;  4L6T B;  1SMY D;  4QIW B;  4OL7 A;  2SEB D;  4K5W A;  1HCZ A;  4QUF A;  1HQR D;  4B9X A;  2XSC A;  4RCO A;  3K6O A;  4OIJ A;  5C44 B;  2JYO A;  4EQN A;  3TP8 A;  4DNT B;  4KJN A;  1OO9 B;  3PO3 B;  3NHH A;  1LTB D;  1PTO C;  1PFB A;  1GUO A;  3FPU B;  4FXG C;  4NW2 A;  3TP7 A;  5LL6 S;  1ONL A;  3H6M A;  3I72 A;  4H44 C;  4XDX A;  1EEI D;  4F7X A;  2ZXO A;  3SK6 A;  1JB3 A;  4RFB A;  1RHP A;  2E74 C;  1TWH B;  1NAP A;  5DNF A;  1TR5 A;  4DAY A;  1TS4 A;  5LHY 1;  1QJO A;  1CI3 M;  1Z7T A;  2B2T C;  4CKB A;  1TU2 B;  3M7N A;  1HHV A;  3A56 A;  4QMG A;  1EYD A;  3MC0 B;  1I6V C;  4PMC A;  4OO1 G;  1GUG A;  2Z4H A;  4MHE A;  4IUT A;  2KCN A;  1STY A;  4UAI A;  4HTH A;  1TWA B;  2XRS D;  3V05 A;  1F77 A;  1ILQ A;  2NYZ D;  1CA6 A;  1WTV A;  1ENC A;  3S2D B;  5EPJ A;  1GOZ A;  4XIG S;  2MPM A;  3A54 A;  2Q8T A;  1CA5 A;  1U9R A;  1S5F D;  3HOU B;  1PTO D;  4DXG A;  1JOK A;  2F3W A;  5J1Z A;  1V43 A;  1JWU D;  1ESF A;  4DF7 A;  3M4O B;  1SYE A;  2A74 C;  1JOO A;  3K0Y A;  3NPP A;  5JOB A;  1EQT A;  4Q5V A;  4I7Z C;  3I3C A;  3TBI B;  3NE5 B;  3GTK B;  4E6I A;  1F2Y A;  4KY6 A;  3TSS A;  5DM7 3;  1PTO F;  2J7Z A;  1R4P B;  2LMC B;  2K7V A;  1I4G A;  4OIK A;  4M8A A;  5BN4 A;  1W6K A;  3MXU A;  2K5W A;  1PZK D;  1D2B A;  3K59 A;  3M4Y A;  1BBX C;  3N6R A;  1AZP A;  2EXZ A;  2EYF A;  3KF8 A;  3K58 A;  2K28 A;  2KHS A;  1JOQ A;  1SNQ A;  2JSO A;  5CV7 A;  2B39 A;  1TVX A;  1HXY D;  3IAY A;  2RBM A;  2EVB A;  1F9S A;  1PMR A;  1HQM C;  4HR7 B;  4J6H A;  1V1P A;  1H9K A;  5TSS A;  1ZKO A;  3KBG A;  3BYY B;  1LTG D;  3M3Y B;  3P1H A;  3ZYY X;  4ID6 A;  1RCV D;  3HKZ B;  4HSV A;  3OIP A;  2K03 A;  5IGB A;  3QG1 A;  1GUT A;  5EBD A;  3A55 A;  5C4Z A;  3VR6 A;  3T16 A;  2EOT A;  1SEB D;  3K5M A;  1YNJ C;  3NQT A;  4XT1 B;  4CKC A;  4N9P A;  1AW7 A;  4ZYS A;  1KNE A;  4IN3 A;  3GO5 A;  1SND A;  2R92 B;  1ET6 A;  1II3 A;  2KEC A;  4NDX A;  5F2D A;  2A6H C;  3V96 A;  5I4D A;  3EJI A;  4C3J G;  3HOW B;  1QWY A;  1SAP A;  3C1F A;  5ELD A;  5EJW A;  3GTQ B;  3H0G B;  5IGF A;  4IQZ A;  1EY9 A;  2EYO A;  4K8J A;  2WII B;  3DWQ A;  1S5D D;  3IFT A;  2D5D A;  3MHB A;  4C2M B;  5CGK A;  2OXP A;  1I3Q B;  1Y1W B;  2NN6 G;  2DY8 A;  2D9U A;  2BE5 C;  2L12 A;  1UNS A;  2IX0 A;  1S4Z A;  3A8I E;  3MEH A;  1YNJ D;  2K6A A;  1BOS A;  4A3B B;  2EY1 A;  1EIH A;  1EWC A;  1RKN A;  1YNN C;  5KEE A;  1D5Z C;  5KGU A;  1NR2 A;  1CQV A;  2KED A;  4A93 B;  1D1I A;  1EY0 A;  1EYC A;  4XYQ A;  1T5E A;  1B44 D;  1DD2 A;  2PZU A;  4XQQ A;  3DUZ A;  4NP5 A;  4R9W A;  1RF2 D;  2EJG C;  4F8M A;  3PMF A;  4X3T A;  3S1R B;  2F4I A;  3FVQ A;  4V19 0;  3WOF A;  1O7L A;  3NWT A;  4JBW A;  5K36 G;  5J39 A;  5EBC A;  1B9M A;  2BE5 D;  5M5W B;  2M00 A;  2HDL A;  1SE2 A;  5C6A A;  3VA5 A;  4G57 A;  4PQX A;  2AUK A;  4RWS C;  1F9R A;  2O5J C;  4LMQ D;  3MTS A;  3P75 A;  1A3T A;  4PMW A;  3GD7 A;  1MBY A;  1YNN D;  2EYP A;  3I4L A;  2ICI A;  3D4D A;  4IFD G;  4S3S A;  3A8J E;  4G4K A;  2NUC A;  2K1B A;  3BDC A;  2IT1 A;  4C3H G;  4BA1 I;  1RTN A;  3BDL A;  4QB4 A;  4TQU S;  2E2H B;  3T4A C;  1BR9 A;  5CBE E;  2KJX A;  4FVM A;  2K04 A;  2EJF C;  1XTC D;  3VR4 A;  1B2T A;  2KEE A;  1CM9 A;  2X6L A;  5KNB A;  1KAB A;  3D8G A;  1SYF A;  5IGD A;  1NSN S;  2EJM A;  5EKI A;  2HUG A;  3QOL A;  1GUN A;  4KV6 A;  4KD3 A;  1EFI D;  2A6E D;  3LWE A;  3RLF A;  4IFD I;  3HOX B;  2M2L A;  1PFM A;  3I8Z A;  5C0X G;  4CJ0 B;  3HRZ C;  5C4H A;  2RQX A;  1QCB D;  5C3W A;  1G91 A;  3D6C A;  1DCZ A;  2EY2 A;  3BG3 A;  3D6W A;  3BVM A;  2F0T A;  2JP1 A;  3PUZ A;  1B50 A;  1OXS C;  2EE1 A;  3DEP A;  4RCN A;  2O5I C;  1FNU A;  5CV6 A;  5FO9 B;  1IW7 D;  1TS2 A;  2ZT9 C;  2ZXR A;  1PYW D;  1C48 A;  1GUW A;  4IUP A;  2XWB B;  1TKW B;  1EY6 A;  4FXK C;  2NTT A;  1JC7 A;  2MJ8 A;  2B2V A;  1NR4 A;  2KCC A;  4IUR A;  1PTO B;  1H9S A;  2WIN B;  4ZKC B;  4B9W A;  2K33 A;  3SR1 A;  1K8O A;  2WAC A;  5CMD A;  3SK4 A;  1EU4 A;  1JCK B;  4C56 C;  1NCV A;  4L63 B;  4CJ1 B;  4LK1 C;  2F0H A;  3D31 A;  4FF2 A;  5T1I A;  1U4M A;  2F0O A;  2B8F A;  1EZ8 A;  1DJR D;  4PNY A;  1VDZ A;  3AMU A;  1EL0 A;  2IX3 A;  4PV1 C;  1J9O A;  1Q3L A;  1S5B D;  1IHZ A;  3N52 A;  3TP6 A;  5FO7 B;  2F0W A;  2LKV A;  3V2T A;  1VF5 C;  3DEO A;  2BDN A;  3LWU A;  1PTO H;  2O2L D;  3MXP A;  1CHQ D;  4F88 A;  5HGT A;  3Q22 A;  2VNU D;  2A5H A;  3CU7 A;  3NXW A;  2RA4 A;  1B4O A;  1CQF A;  3D3R A;  3MAQ A;  3I90 A;  2CVR A;  2R7Z B;  1O7Z A;  5BN5 A;  2B2V C;  1B53 A;  2JEB I;  5G3L F;  2WP8 J;  4ZRZ A;  1PZI D;  1DOL A;  4EGV A;  3IFD A;  1JQY D;  2IWH A;  2B63 B;  4H13 C;  1I4R A;  1KDB A;  3U9S A;  4EQO A;  3NSW A;  3TDQ A;  1VCI A;  4IZ8 A;  2FMC A;  3ITP A;  2RDG A;  3H91 A;  1HUN A;  5FLX L;  3KLS A;  2EYL A;  3J81 L;  2PNR C;  2M9V A;  4MIU A;  3PUY A;  4I65 A;  3Q6S A;  2KUM A;  4CHT B;  1MI2 A;  1K8M A;  2F0S A;  4ZK9 B;  4GZY C;  3OOC A;  1RJT A;  5IGC A;  4C1N I;  1KNA A;  4V0B A;  3GP7 A;  4ZAI A;  3VYT A;  3VR5 A;  5C4J B;  1G2S A;  4KKT A;  4RGM A;  2PYK A;  2XRQ D;  2QF7 A;  4RH6 A;  2DNE A;  3HP3 A;  3RZO B;  1ENA A;  3ONA B;  1ROD A;  2F0I A;  3ERO A;  4K2L A;  5DM6 3;  2F3V A;  3KK7 A;  3SEB A;  1MD2 D;  1SNO A;  1VF7 A;  3HOV B;  1XWE A;  2YU9 B;  4K2K A;  3TP5 A;  1TS3 A;  1IKM A;  1WD1 A;  1CK1 A;  3GTG B;  5FLX E;  3S17 B;  1G29 1;  1NUC A;  3J81 E;  4HN7 A;  1D6E C;  2E75 C;  3IL8 A;  3X3N A;  1VMP A;  2QEJ C;  4U68 A;  4HED A;  3NBH A;  4QCL A;  2VB2 X;  4L8J A;  4RGO S;  4RGN A;  3MZ5 A;  1V1P B;  4WJW A;  2EZV A;  5CV5 A;  3MA2 B;  4Y7N B;  3QWN A;  3DWA A;  3KLR A;  3DMU A;  1WTP A;  1V8Q A;  3W3A A;  4DK1 A;  2EPB A;  1SFO B;  5JEA J;  1AFP A;  4X3U A;  1EY8 A;  3RMH A;  2N55 A;  3A8K E;  1C4Q A;  5JEA H;  3Q0A A;  2DNC A;  3J7A F;  1GHJ A;  1LLR D;  2XNA C;  4KJO A;  3SK8 A;  4RHS A;  1LT5 D;  5I6W A;  2PO4 A;  5JVG 3;  3I4N B;  1CZW A;  2FFK B;  5KYL A;  1F2M A;  1Z6H A;  1TII D;  3UI2 A;  3E6Z X;  4RHR A;  1QG7 A;  2PMZ B;  1PDQ A;  2E76 C;  4OHJ A;  5CYU A;  2NVX B;  3Q24 A;  2AQ1 B;  2WB1 B;  2J4X A;  3DHQ A;  4OO1 H;  1IYV A;  1E2W A;  1IYU A;  3JAM L;  2B2U A;  2ENB A;  3IKJ A;  3OPO A;  5K5P A;  2C9O A;  4RGT A;  1Q90 A;  1HRJ A;  3T51 B;  3S1N B;  1I4Q A;  5I9P A;  4G7Z C;  4QF4 A;  4TSS A;  4A3K B;  5FKA C;  2WAQ B;  1OXV A;  4BY1 B;  4HCS A;  4LJZ C;  1KTK A;  3SXH A;  3EFX D;  4DXF A;  1MGS A;  1QE6 A;  4IUQ A;  1SYB A;  4A3J B;  5M9O A;  4Q0F A;  1A3V A;  2B2W A;  4C3I G;  2A73 B;  2LFN A;  1STB A;  4HAE A;  3DXJ C;  3L9A X;  1I4H A;  2RSO A;  3C3L A;  2Z8L A;  1D5M C;  2BA0 A;  1ILP A;  4TKO B;  5CBA E;  1B9N A;  1RD9 D;  3OMC A;  1LT4 D;  3TN2 A;  3R2I A;  4FP5 D;  3VR2 A;  4RAU C;  3S15 B;  1A6X A;  2L9H A;  2B2U C;  2X69 A;  1H9R A;  1F9P A;  1XXG A;  3BVZ A;  1B1Z A;  2HCC A;  4KHV A;  3GTM B;  1FR3 A;  2F0G A;  2MGS A;  4C3J B;  3H3V C;  2FJ2 A;  1JE4 A;  1ML0 D;  5EKK A;  3NTH A;  1F9Q A;  2KA7 A;  2NVY B;  2IJ0 A;  2B2W C;  2C5C A;  2RDF A;  2E2J B;  4H0L C;  4KD4 A;  1I6H B;  1K83 B;  4TRD A;  5CC4 A;  1UEA B;  1SE3 A;  3FMC A;  2NWG A;  5E4W C;  1MSG A;  3G6J B;  1KLG D;  4HMJ A;  2L55 A;  5E1F A;  2A6E C;  4BS9 A;  4K6L A;  4G7O C;  5D3I B;  3R2T A;  3CQZ B;  4A3E B;  1EU3 A;  5IGG A;  4A3D B;  2XIW A;  1ZYR C;  1A2T A;  3E5S A;  2OF1 A;  4J1M A;  1X32 A;  2NN6 H;  5NUC A;  2F0Q A;  2JA6 B;  4A3F B;  1MSH A;  1GJX A;  1G8Z D;  1HA5 A;  1Q8I A;  2JE6 I;  1IW7 C;  5EKL A;  1A2U A;  3HG9 A;  1AP0 A;  3T53 B;  2GA4 B;  4WOR A;  3PIP 3;  1QIL A;  4LAA A;  5LL6 X;  5E4X A;  3QIA A;  4ZKB B;  4RA8 A;  5CV4 A;  1WTO A;  3QOJ A;  4FYD A;  1Y8N B;  4O42 A;  1G6Z A;  3NWS A;  3OWE B;  1BQQ T;  4HCE A;  3WOE A;  1WTX A;  5E3F A;  2QDB A;  1D5X C;  1G2T A;  1ZYR D;  3K7A B;  1WVL A;  2XN9 C;  3PUX A;  5FK9 C;  3O13 A;  2IPK D;  3C2P A;  1E2Z A;  4C3H B;  2JA8 B;  1BDO A;  2NB0 A;  1ENF A;  3R3O A;  5EPK A;  1H9S B;  3SE0 A;  1OXU A;  2F0L A;  3PO2 B;  2KOL A;  5JVH 3;  1TY0 A;  3I70 A;  4ILW A;  4C1N K;  1PZJ D;  3PUW A;  1LTI D;  2R61 A;  5KRU A;  2A68 C;  3MWY W;  2FIN B;  4DK0 A;  2KQ3 A;  3W2D A;  4G7H C;  1LT6 D;  3R8B A;  3NBI A;  4ZQ3 A;  1DON A;  3QO2 A;  4U67 3;  2MP1 A;  1M4V A;  1SJH D;  3BS1 A;  2CQA A;  3BYT B;  2WKC A;  3L7Z C;  3KUP A;  3LNN A;  3GTO B;  4KKS A;  4H7B A;  4WRD A;  2TSS A;  1QOH A;  2PW7 A;  4M1U B;  4XXE A;  1HFG A;  3MVV A;  3D4R A;  5KIX A;  1IKL A;  1LV9 A;  1V1O A;  5ELC A;  4A3I B;  4HMI A;  4DFA A;  1HA6 A;  2VUM B;  3H94 A;  3TZD A;  4KY5 A;  4DNR B;  3URY A;  4YIJ A;  4XYO A;  1Y69 U;  1AZQ A;  2CW0 C;  2A68 D;  1FYC A;  1XYI A;  1PLF A;  4DA2 A;  3TME A;  2SOB A;  4MN3 A;  2OEO A;  1J8I A;  3MFG A;  5JJZ A;  3NP8 A;  1BUV T;  1DYQ A;  2R93 B;  1EYA A;  1CFM A;  5M3F B;  2TMP A;  2BCO A;  5KNC A;  4K8I A;  2D2C C;  1BCP C;  1BF4 A;  1KDC A;  2CHB D;  4A3M B;  2SNM A;  1JIC A;  5M3M B;  4CGY B;  3F2U A;  1LT3 D;  3BVG A;  1TQO A;  1HFN A;  1SXT A;  1EIG A;  1FGB D;  1LTR D;  3K57 A;  5A35 A;  5JPN C;  1GHK A;  3S9W A;  4K14 A;  1QNK A;  3GTL B;  1Q12 A;  1LTS D;  3H09 A;  2CW0 D;  3ERQ A;  4DGZ A;  4KN4 C;  4KN7 C;  3KBX A;  2WV6 D;  2H1E A;  3MXN A;  4CKE A;  5JEA G;  4JK1 C;  2AQ3 B;  1VMC A;  4N9T A;  3J80 L;  1WTR A;  4DU9 A;  1PRT C;  3T13 A;  4FO2 A;  3T56 B;  5C4X B;  1BCP D;  3CRK C;  5I9O A;  1JR0 D;  3DM1 A;  5EGT A;  3S14 B;  3ND8 A;  2Q8R E;  2MUY A;  3QJY A;  2F0J A;  3I73 A;  1UUP A;  4K5V A;  1KAA A;  1LAB A;  2NVQ B;  2EYM A;  1X3P A;  3GTP B;  3GV3 A;  1ESR A;  3FKI B;  1SNM A;  2SDF A;  2G9H D;  3RD4 A;  5CV8 A;  5FOB B;  3K5O A;  2JXM B;  1SDF A;  1BCP F;  5KND A;  2JA7 B;  2K01 A;  4KMU C;  3RUZ A;  5D3D A;  5M5Y B;  5C3X A;  4PMB A;  1EY7 A;  4FF4 A;  1TWF B;  3GV6 A;  1SYG A;  5FO8 B;  1U4P A;  5D65 A;  1I4P A;  5COY A;  5IIF A;  4KKU A;  4KHZ A;  1PRT D;  3HZX A;  1CHP D;  3J80 E;  3OMG A;  3NUC A;  1T5X D;  4BWG B;  1OXT A;  1PFN A;  5AFW A;  1CTM A;  4IAL A;  2ZXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...