2L55A

Solution structure of the c-terminal domain of silb from cupriavidus metallidurans
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
GPEHRAVGRIQSIGERSLIIAHEAIPSAQWGAMTMEFAAPPAGLPQGLKAGDRVAFSFRLDPHGMATLVTVAPQVQTAGAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords SilB,Silver efflux protein, MFP component of the three compo
publication title Structural and Metal Binding Characterization of the C-Terminal Metallochaperone Domain of Membrane Fusion Protein SilB from Cupriavidus metallidurans CH34.
pubmed doi rcsb
source organism Cupriavidus metallidurans
total genus 13
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l55A00
2QCPX 3TDQA 1ZEQX 2VB3X 3E6ZX 2VB2X 2L55A
chains in the Genus database with same CATH superfamily
4C1NK 2QCPX 4KLKA 4OEMB 4LFBL 5JJZA 3SHLA 3F2CA 1LT6D 3NBHA 1KTKA 2HDMA 1JJGA 3WDNA 4IFDH 3H94A 2F0HA 3HKZE 5I6YA 1STBA 4IUTA 3GTKB 1WTHA 1CQVA 4BY7H 1STHA 1GUGA 5CR3A 3EN2A 2UUAQ 1GHKA 3A8JE 3NBHB 3OIPA 1EU3A 4WFN3 2D0OA 2Y0SB 1I4HA 1U0LA 4V190 4IFDG 5C44B 1D1KA 4A3GH 1TT2A 1UE1A 2NYZD 4Y7NH 2MFIA 5ELCA 4DU9A 3I3CA 1VQPA 4DR6L 3I4NB 1UUPA 2F0WA 2B63G 1G2SA 4DV4Q 4Q5VA 3SK5A 1J5EL 4DK3C 3CQZH 3K80C 4LW1A 3S15H 4YWKA 3J81i 4UAIA 1I4PA 3I56A 1IYJB 3S2DB 1PZKD 4ZKBB 4HMIA 2Q2HA 4A3GG 2R6GA 1SROA 3CRLC 4A76A 1Z47A 3I70A 2ZJQA 5IYDH 4F87A 2MPMA 3GTJH 3J7AF 3M85A 4JBWA 2R7ZH 1SDFA 2PMZE 2CH4A 3GTMB 4HJ5A 1IZ6A 1BCPF 5CV8A 5M5YB 3SE0A 3VYSA 3PMFA 1S5CD 5CBAE 4FVMA 1IKMA 2IPKD 2JA5B 5I9PA 2EOTA 1QVFA 4DV1Q 3S24A 2X6LA 3G4SA 1XNRL 1EY6A 2Z6KA 1QILA 2ID0A 1M8AA 3KBGA 5JPMC 1A3UA 3U9OA 3S2HH 1EY4A 2CCZA 4V0BA 2ZXPA 1S5DD 1Y1WB 1SR3A 5IYDG 2F0FA 4Z9CB 4A3BG 3NPPA 1QZGA 1PH2A 1STAA 1D6EC 2OWOA 5FLXE 2R7ZG 3GTQB 3H6MA 4RG1A 2IX3A 4LF4Q 1CKOA 2IHFA 4EQ5A 4IUVA 2EJGC 5AJ3Q 2OCEA 1H9RA 1NR2A 3K5MA 4DK1A 1H9MA 3RLFA 4HTHA 2VQEQ 2FMCA 4GLXA 3F1ZA 3M7NA 5LL6S 1RTOA 1EQTA 1MSGA 2ZXOA 4DNIA 3F2BA 2NZHA 3BVZA 1KC8C 1A62A 1R9TB 1IL2A 1HUNA 1BKBA 2DY8A 4M8AA 4WJ3M 5BR8Q 5IYCH 1F2MA 3GTOB 3M4QA 3HZXA 4UPAA 4PMWA 1ESRA 4P72A 3G6EA 2PZWA 3KK7A 3PIOA 1SRUA 1Q1EA 1NNXA 3NTKA 2WAQG 1TS3A 3W5OA 1GM5A 1KRSA 2HQEA 3K5NA 3VA7A 3R8BA 3ITPA 2RA4A 3DWPA 2E74C 2Q8RE 3S1MH 2K4KA 4UP8A 5EKLA 4HIOA 2KVMA 1NMGA 4DV2Q 2VS1A 4C2MB 4OELB 5IYCG 5EKIA 2IT1A 2WB1B 1TY0A 1B9NA 1KLUD 3NEMA 4QUFA 3MAQA 1RKNA 1I4XA 2HHHQ 1WD0A 3K57A 5ELOA 4RCOA 1RCVD 2F0JA 4EX5A 1P16A 4HSVA 4X3SA 5JEAH 2I5HA 2SOBA 5FLMH 1NE3A 1T5EA 4KHZA 3UE1A 1EFWA 4PZ7A 1TXYA 5HGTA 4DV1L 4DAYA 2FFKB 1QWYA 1PTOC 1YITA 3J7YW 1JQYD 4PQXA 2CQAA 2KQ3A 3NQIA 2JSOA 1F9SA 5D65A 3HOVH 3OPOA 1G6ZA 3Q6SA 1PTOH 2E2JB 2ZM6Q 3TP5A 2F0QA 2LXJA 5NUCA 4DAYB 2B3GA 4JV5Q 1GVPA 1NJIC 4LF4L 2SNMA 1XNQQ 4JI1Q 2Z8LA 5JEAG 4GNXB 5FLMG 5EBDA 1N32Q 4DR4L 4DA2A 2VQEL 3EQLC 4A3MB 2EY1A 5D3DA 5K36G 4TQUS 1F2ZA 1VQ5A 5M5WH 2ATWA 3MVVA 1NR4A 4JOIC 2J0TD 4HCSA 1VQ6A 3HOVG 4HIDA 1D5XC 1VS0A 4ZLTF 4J6HA 4LFCQ 2JA7B 4DXGA 2R93B 1AZQA 4DNTB 3A56A 4RA8A 4C3JH 5BR8L 1MJEA 4O1NA 3GTLB 2NVTB 1W3SA 4B3TQ 1SNOA 1Q1BA 4JBKA 3KF8B 3PUYA 1VQNA 3QJYA 3IAYA 3PSIA 1FR3A 4LF5Q 1H9SA 3R2IA 4KY5A 1V1OA 2VUMB 4P74A 5DM73 3G6JB 3Q24A 1V8QA 5I6WA 1LTRD 3TDQA 4A3FB 4KMUC 1XJVA 4HJAA 1SSOA 4FNFA 1H9SB 5FLXc 3EROA 1EWHA 2AUJD 1WTPA 1ONLA 4DAVA 3R93A 1KAAA 1TU2B 2WAQE 3IL8A 1JOOA 4N8X1 1MJCA 1IBKQ 4HMJA 4A3JH 4K5VA 3TP8A 5C3WA 3T56B 2A5HA 1OXSC 2CW0C 4KY7A 2F0SA 2R92B 1CT1D 2RDGA 2DUDA 2YU9B 3UDIA 3K7AH 2JA6B 3HOWG 1FVIA 1MBYA 2Z4IA 2Z6KC 1D7QA 1DOLA 1SAPA 1VQ7A 1BUVT 1TS2A 2RSNA 4CGYB 2EYJA 1EIFA 1ASZA 1K83B 1VQLA 1X3PA 4X66Q 4U68A 1RJTA 1F9PA 4F88A 4YCWA 2NVYB 4JV5L 4OO1I 2Q8IB 1UEAB 4JI1L 4A3JG 1HTLD 3NENA 2I5MX 3D6CA 1NMFA 1RDPD 2PMZB 1EU4A 4RGTA 1GJXA 1E0BA 3DMUA 2F0VA 3DM3A 1F2LA 2HT1A 2NZ1D 3FVQA 4PMBA 4DFAA 3M3YB 5JJKA 1TWAH 1JB3A 3D0FA 4LJZC 4LF9L 2OQ0A 1IW7D 1QE6A 4LFCL 4IPDA 3S1NB 2PW5A 2A73B 5T1IA 1VQ4A 3CC4A 3QOJA 3GD7A 1K28A 1Q81C 2PQEA 2EYOA 4E6IA 2RHSB 1HRJA 3I91A 4NPSA 2AQ2B 5J22A 4IZ8A 4XYOA 2QILA 3P20A 2XRSD 1I94Q 3TEHB 4QF4A 5ELDA 1VQEA 3S17H 4DR1Q 3I4OA 3VR6A 1CI3M 5IP7H 4JI6Q 3DXJC 3MFYA 2N78A 2NTTA 4MIUA 2BE5D 1C4QA 1KL9A 2Z0SA 4X65Q 4L8JA 2MHVA 1K0RA 3A7LA 4FF1A 4R4OA 1KDAA 5GAEC 2M00A 2PQAA 5G3LF 3NQTA 3CCMA 3K5OA 1JWMD 2CHBD 1CK1A 3HOYG 3GTPB 2CFMA 1CSQA 3NK9A 3KDFA 4OIJA 1ENCA 2K5NA 3NWSA 1IBKL 2PQAB 5IP7G 1L1OB 1JOQA 2A6ED 1I50B 5IGGA 4DNRB 5KNDA 1V9PA 1KIXA 1LT5D 4OXPA 1YNJD 2I07B 4R9WA 3OTOL 2A6HD 5GQOA 3CXCA 4BBRH 2NUCA 1DYQA 4KI0A 1VQAA 4XQJA 4DR7Q 1PHJA 3H91A 2IJ0A 4LFAL 1HNXQ 4X66L 2F0PA 4IOCA 1YJNA 5M3MB 1KHIA 1K0SA 4DV7L 1ZYRC 1YJWA 2IX1A 1VQFA 5J3BA 4JI8Q 2WV6D 2NVQH 1HA5A 1VQGA 3CMAA 3SK4A 4KTAA 4BBRG 3KJOA 2B63B 1A0IA 5C4JB 3FKIB 1K8GA 4A93H 4R1JA 4G57A 3MXPA 4RFBA 2M9VA 2F0TA 1DOMA 1N8RC 2OTJA 1E7ZA 1CKNB 1KNAA 4HJ8A 4DR5Q 1LO5D 3DEOA 1SNPA 2DN8A 4TVAB 3BYYB 1VQBA 4RGOS 5DNFA 5CC4A 5JVG3 3K6OA 2CWAA 2FJ2A 1F9QA 2IWHA 3FDTA 4XQQA 4QCLA 3HOZG 1SNQA 1O7LA 1AE3A 1JWSD 1MKHA 2JYOA 3DLLA 2AQ3B 2F03A 3OWFA 5FLXL 3Q22A 1WCMB 5GAHC 2IY5B 4NKLA 4JI0Q 3OSOA 4JI6L 1PYSB 1JMCA 4PG3A 2F0NA 5M5XB 4NXML 4KN4C 1C9OA 4X65L 1PMRA 1S4ZA 1TY2A 2L4NA 3ONAB 4A3EG 1TWGB 5CMDA 4A3BB 4DR3Q 1IL8A 1U4PA 1XWEA 4LF7Q 1ILQA 4P71A 1TWCB 4HSPA 4RGNA 1PVOA 2JA8G 2K6AA 1WD1A 1J9OA 3ZYYX 1YZ6A 2IL8A 5LHY1 3QO2A 4A3IG 1EZ6A 5C4ZA 1B3QA 5M3FG 5C3EH 5IGCA 5IOCA 4CHTB 4BA1I 1N33Q 4CDDC 5ISRA 2UU9Q 2A69D 3PO2H 2RCFA 4BBSB 4LUOA 4K0KQ 1JE4A 3GP7A 4GOPA 1HNXL 4FF2A 1XYIA 4XXEA 4P2CB 3J80E 4ID6A 1B8AA 4JI7L 3S16H 5LMNQ 3K0XA 5BN4A 2WAQB 4JI3L 4JI8L 3KJPA 3LWEA 1D5ZC 2F4VL 4JI4L 4IFDI 3A54A 2RSOA 1YI2A 4RMFA 3PO2G 1I6VC 3E0EA 4NW2A 1W6KA 5IGFA 4GS3A 2UUBQ 4AYBE 1Q82C 1N36L 4ZRZA 1PFBA 1J6QA 1MSHA 3NSWA 2F1MA 3MWYW 4JCVE 2E5LQ 2MO0A 2B2VA 1X55A 1XTDA 1G91A 1I3QH 3CCRA 3LWUA 4EQOA 2QDLA 1N34L 1F2YA 2QW7A 2CQOA 1PH3A 1FJGL 1O7IA 2BCOA 3OWEB 3SEBA 1FNVA 1PH4A 5FO7B 1KLGD 1PH8A 1HXYD 1PRTB 3VR3A 1BVSA 2EQSA 3N6RA 1V1PB 2YTYA 1IBMQ 2NWGA 2RDHA 1SYEA 2G9HD 3M9BA 2A74C 3A0JA 1UWVA 1RODA 3WOFA 3PO3B 4S3SA 2CH4W 3MFGA 4C3IH 3A74A 1PRTF 2D0PA 2EJMA 1B3AA 5IIFA 4HIKA 3MA2B 4WORA 1SE3A 1VQHA 4BY1H 2B2TC 4F8MA 1M90C 4JI5Q 1LLRD 2B2WA 5C5LA 4ZK9B 4KD4A 1OXVA 1PH9A 1N33L 5C4XG 3MEHA 3ERSX 2F0GA 3D8GA 2K5DA 2N3SA 4K0KL 1IXRA 4OWTB 1UNSA 4P73A 1GD7A 3U4VA 5D14A 1PFMA 4DF7A 4CDFC 1VQDA 1FL0A 3TQYA 4C3IG 1HUMA 2YYZA 4C3HH 2G5DA 4DUZL 1IHZA 1HPCA 3N52A 2DY7A 4Q0FA 4APVA 4RCNA 4HIMA 4BY7G 1LV9A 4BWGB 3I4MH 1SYGA 3L9AX 3EJIA 4CKCA 2F52A 1Q90A 4JPBW 5ELBA 4QY7A 1X32A 3GTGH 1HFNA 1JJ2A 1MI2A 2HIXA 1BCPB 1TKWB 2V1CC 4A3DB 2M2LA 5ELFA 3CCQA 1XX8A 2PNRC 1SFOH 3A5UA 2L15A 3OOCA 1L2FA 3BZKA 3TZDA 4YY3Q 4L5RC 3HGBA 4OONA 2F3VA 2E5LL 4C3HG 1A2TA 3S14H 2KCMA 2R61A 4EGVA 1K8MA 2Q2TA 3CCSA 2UXBQ 1Q8KA 3HFZB 3MXNA 2RBMA 2AMCB 4ULLA 1HR0L 2VB3X 5E1FA 4A3KB 3E5SA 3PUWA 5G3LD 1X3GA 3NTIA 5CV9A 4ZQ3A 5C4HA 3S1RH 4B3MQ 1Q46A 1J8IA 4WJ4A 3TRZA 2F0KA 4B9WA 3HOWB 1IBLL 1EEID 3MXNB 2K05A 4OL7A 1IBML 3TP7A 3AB9A 3X3MA 4DAMA 4L5TA 1EEFD 3J80c 3LNNA 3RZOH 2K03A 2F0IA 3RD4A 1P8LA 3SXHA 5IYBH 4K8IA 5KNCA 2DNCA 3CCVA 3Q23A 3DEPA 1PZJD 2EYMA 3QB3A 4LUZA 4CJ1B 3K5LA 5M9OA 1D5MC 2OT2A 2UXDQ 3RUZA 1I6HH 2UUAL 2EVBA 3IFDA 4I65A 3O13A 2AKWB 2F0UA 3KLSX 3RZDB 4X3TA 3F2DA 3MZ5A 4FP5D 2B39A 3I72A 2MO1A 3D4DA 1XMOQ 5FO8B 2X69A 2K5QA 1K3BC 2D62A 1ICWA 5EPLA 1G6PA 2AWNA 4GOPC 1PFNA 3KLWA 2C9OA 4R4CA 1BBUA 2J7ZA 2OXPA 5IYBG 3NE5B 2HIVA 1HZAA 3DUZA 1E1TA 4U673 1D8LA 4K2KA 3H0GH 1OXXK 1E2WA 3BS1A 4DK6C 3FPUB 4WJWA 3S1QB 3A7AB 4GN5A 1X65A 4K2LA 5T1GA 4DV4L 3KYHC 4F7XA 2HQLA 1BBWA 2ZXRA 3HOXB 3NHHA 2Z1CA 3KBXA 4K5WA 2F0OA 1R4PB 4FXKC 1II3A 3HOYB 2MQHA 3T13A 1EY7A 2B2VC 4KV6A 1GUTA 3CC7A 4EQNA 4FF3A 1KRTA 3ULPA 4XTCS 5CYUA 4B3SQ 1CTMA 4O42A 4MNOA 1CM9A 1FYCA 2RKSA 2PYKA 1G2TA 4KJNA 2LMCB 3EFXD 2NVXH 1U4LA 1B4OA 3M4PA 4AYBB 3I8ZA 4GNXA 2LXKA 4X6AH 1NBWA 2KOLA 3J7ZC 3AEVA 5KIXA 2BH2A 5JPNC 3HOUB 1CZGA 2XGTA 3W1BA 4EQPA 1IW7C 5J39A 1A63A 1H9KA 5FKAC 3HG9A 3GTKH 1ASYA 5AJ3L 1C7YA 1UE5A 4J8QA 3AFQA 2VZAA 1GUNA 2UXDL 3T1HQ 2RQXA 4JVZA 2L9HA 3PIP3 1O7ZA 1XPOA 2B2WC 2L12A 4YHHQ 4DPGA 4CDCC 1TVXA 4JYAQ 2SNSA 3A5ZB 3KF8A 2KEEA 2MUYA 4ZAIA 1QB5D 5C44H 2KHIA 4JC0A 1T5XD 4N8FA 2D5DA 1FNUA 1HZCA 1X3QA 4DV5Q 3M4YA 2BDNA 5CGKA 2EYHA 5JOBA 3HOZB 2BE5C 1EY8A 3L7ZC 1WTQA 1HA6A 4R8NA 3I4NH 3EBEA 4AQYQ 4HCEA 1PXUA 1VF5C 4KHPQ 4KKTA 4O0AA 4CJ2C 1X3EA 2IX0A 2SDFA 3K59A 2E2IB 4BS9A 1EYCA 4X64Q 5KYIA 3S2DH 1E2ZA 4JK1C 2MP1A 1VQ8A 2XIWA 4C3JG 4DV2L 4A3EB 3VR4A 4QUCA 3L2PA 2A6EC 1V43A 2TSSA 1STEA 1X56A 3NUCA 3RLOA 1Y1VB 2R3ZA 1YNJC 4NB3A 3MC0B 3C1FA 2A6HC 2QA4A 1S5ED 2F3IA 3I4NG 3ULJA 3GTMH 2JA8B 2HHHL 3PCOB 1HCZA 2F0EA 5M5YH 1TWFH 1OTCA 3C3LA 1T9HA 2N55A 4A3IB 3J80L 4J15A 5M3FB 3H15A 2GVAA 4N9PA 2JA5H 4DN4M 4B3SL 1YNND 4LAAA 1BNZA 2N88A 2R7FA 3JC66 3M4OB 2A1AA 3BYTB 1Y1WH 3DHQA 5IGBA 3I2ZA 1VQCA 3J80i 1PRTD 4NP5A 4ALPA 2ZM6L 3VYTA 1SNCA 5GADC 5C3XA 1AE2A 2C5CA 1AZPA 3GTQH 4ZYSA 2LSSA 3T1YQ 1STNA 5EKKA 5I4DA 4TSSA 3KUPA 1L0XB 1XNQL 3ER0A 2JN4A 1HNWQ 1N32L 4FXGC 3T1HL 3MEFA 1YHQA 2K7VA 1NSNS 2P5ZX 3PO2B 4YHHL 3GQBA 2RCNA 1R9TH 2EE1A 3GV6A 1QNUA 1PH1A 2L55A 1QOHA 2YTVA 3DWAA 2K01A 4K6LA 1WVLA 5CORA 1KDCA 1QNKA 3GTOH 1B9MA 4M1UB 1S3OA 2BDOA 1GHJA 4XDXA 3S16B 4B3TL 5IP9H 3CPFA 2ZTDA 2ZJRA 1PH7A 2LS01 5F2DA 3CPWA 1LTSD 1EZ8A 2MGSA 5FK9C 5DLQE 5IGEA 4J1MA 4DGZA 1VQMA 4N9TA 2KCTA 2EY2A 1BR9A 3ERQA 2MJ8A 4LF5L 2SEBD 1EY5A 1EYDA 1O7YA 1JB7A 4X64L 3AFPA 2K50A 3U4ZA 1QVGA 1W2BA 2A19A 3BVGA 1KDBA 3ZJYC 5JJLA 3STBC 5JVH3 1HQMC 3PQIA 3PV0A 5COYA 1BCPD 1L1OA 5IP9G 2UXCQ 5IODA 4KHVA 2JXMB 2XNAC 2NB0A 2A69C 4I7ZC 4TRDA 4NMZA 2LFNA 2NBFA 3TREA 2WKDA 3K7UC 3T16A 4DV6Q 4CDEC 4OIKA 1Y69U 2GN5A 4PMCA 5C4XB 1SEBD 3D31A 1WOCA 2WB1G 3OW2A 1Y14B 2E2JH 4B3RQ 2QEXA 4GNXC 1CA5A 1F9RA 2VB2X 1B1ZA 3CCEA 1LTID 3C46A 2YV5A 3T1YL 1XXGA 2AUKA 4LUVA 2I5LX 3BZCA 4DV3Q 3T4AC 4MN3A 5H1SE 3NP8A 1HTPA 3BJUA 4BY7B 1HNWL 1SNMA 5A2QE 4A3MH 1QUQB 3TMEA 2A68D 1CKNA 4IALA 1B44D 3VA5A 2FXQA 1EWCA 3SR1A 3MXGA 1DXMA 2VW9A 2JA7H 1OXUA 4UY8C 2G9DA 2R93H 5TSSA 1D1IA 1JC7A 1GXDC 1SLJA 1EYAA 3GTLH 2PW7A 4R8IA 1BOSA 2NVTH 1SYFA 4A3GB 4H13C 3CF5A 5CBEE 4Y7NB 1PZID 4QL5A 1YEZA 3ND9A 1XMQQ 5GAGC 5EQ0A 3AYHB 3JAMc 1EY9A 2WACA 1SNDA 1I94L 4DR1L 4RAUC 3Q8DA 3KLRA 5EJWA 2B2YA 4A93G 1JE5A 1K8OA 2VUMH 1MHWC 3ND8A 3CQZB 2JA7G 4GN3B 3TSSA 1VQIA 3S15B 1ET9A 1EIYB 1TS4A 1HR0W 1VMCA 4DR2Q 4ME5A 4A3FH 3EVQA 5IGDA 1KNEA 5IE8A 4B08A 3U58A 1RD9D 3SDZA 4FXDA 3GTJB 1B2TA 4R4QA 1RF2D 4K8JA 2R7ZB 1NAPA 1JR0D 4XYQA 3HKZG 1TIID 4ME3A 1ILPA 1GKHA 1DGSA 1PDQA 2RHQB 1XPRA 3ICEA 2ZTEA 1LUZA 2CKZB 1KXLA 2VUMG 2D2CC 2KA7A 5FOBB 5E3FA 4DV0Q 2I46A 4YWMA 4KKUA 1X54A 2R92H 3HRZC 2JA6H 3OW7A 1A3TA 2C35B 4K5XA 4A3FG 2YU9H 3S2HB 3ULLA 2KBNA 5C0XH 4H7BA 1JCKB 3P75A 4LFBQ 3A8IE 1G51A 3E0JA 5HGQA 1SJHD 4DR7L 5I2YA 4UP9A 5FJ8H 2NVYH 2H5XA 1S40A 1A2UA 4DV3L 1ZXTA 3LX0A 1PFSA 4L5QA 5C3EG 2JA6G 3M3YH 2KHSA 4FO2A 1EYGA 4A3LH 5EBCA 3RLNA 4ILWA 4IUPA 1SE4A 3QIAA 2Q8TA 4IOAA 4DUYQ 1JICA 3S1NH 1TWHH 5K5PA 4X62Q 5FJ8G 1A3VA 3J7A5 4GKJQ 1X3FA 4JI2Q 4DR5L 1GO3E 1C48A 2E2HH 3P7JA 5HY6A 2NN6H 3A55A 4RKBA 4A3LG 1J5EQ 4A75A 3OYYA 4A3CH 2QEJC 1BQQT 2UUCQ 4C1NI 3J81j 3LGJA 1V1PA 1ZYRD 4JI0L 2KECA 4YCUA 1VCIA 3S1MB 2WKCA 3PUXA 2FMMA 3E3XA 3GV3A 3FMCA 2VL6A 1XTCD 3DM1A 4JBJA 5KEEA 4IPGA 1OO9B 3GTPH 3TZUA 5C6AA 3W2DA 4DR3L 3BG3A 3K81C 1GUSA 2RDFA 2OQKA 3AQQA 4LF7L 3FPPA 3R3OA 3H3VC 1ENFA 4HJ9A 3RR5A 2XWJB 1I50H 2ICIA 3H3VH 2JE6I 3C2PA 5DEHA 4IJLA 2V4DA 3PIPA 4AIMA 5I9OA 4QJFA 4IURA 4BXXH 3GO5A 4RHRA 3QWNA 2EIFA 1LTAD 4QGUA 2UU9L 2EXZA 4PZ8A 3HOVB 4IQZA 1A8VA 5HURA 5IT9E 1PTOB 1EL0A 1H95A 2B8FA 1HZ9A 2KHJA 5M3MH 1ZKOA 1PH5A 1B7YB 1U4RA 3X3NA 3I55A 3G71A 1WTVA 3TN2A 4YCVA 1UE6A 2ES2A 3TS0A 5CV6A 1AN8A 2VY3A 2WINB 2Z4HA 5DAUA 4JOIA 4PNYA 4BY1G 5LMNL 3OMGA 1EQQA 3QOLA 1PV4A 4BXXG 1U9RA 1PA6A 4GLAC 2B63H 1PTOF 4BA2I 5C4JH 5M5WB 3FKIH 3JAML 1VQOA 2X6GA 4DUYL 3TBIB 1XPUA 1JJCB 2UUBL 4KKSA 5M3MG 4X62L 4C3JB 1SXTA 4GKJL 4JI2L 3J81L 3BDOA 2GA4B 3RN2A 2XTIA 1LTTD 3PF4A 1A15A 3JAMi 4UP7A 1FGUA 2D9UA 3HEJA 4LNQA 2EY5A 3I4MG 1WCMH 4QMGA 3FKIG 2PO4A 1QG7A 3UDFA 2L5TA 2OEOA 1LM0A 2UUCL 1GOZA 1CHQD 3EIVA 5M5XH 2E2DC 3H09A 2B2YC 1B50A 1SMXA 1SYDA 4H44C 3BZDB 1BDOA 1TWGH 1KD1C 4IPHA 2L11A 4A3BH 3A8KE 1HZBA 4AH6A 1KAWA 3OHXC 3CU7A 2F3WA 1TWCH 4HR7B 4R4TA 1EIHA 1TWFB 1WCMG 2BH8A 1B70B 4ZUIA 4A3JB 4G4KA 3F2UA 1NTGA 5GROA 1HQRD 2FINB 4OWXB 3UDXA 4JI5L 3D3RA 2KJXA 3NTHA 5KGUA 3D4WA 5CV4A 1LYLA 4JBMA 5C0XJ 3K7AB 2K5HA 3I73A 4BBSH 2EYLA 3KLSA 1YNXA 1CUKA 1EQRA 3F8TA 2BOSA 4Y52H 4HAEA 2K14A 1WJJA 4ZCKA 2IHEA 4DR4Q 1YJ9A 1LT3D 1SMYD 1IYVA 2CVRA 2DJFC 4I7AA 5IWAQ 5FO9B 4UDUC 4HJ7A 1K73C 1SBBB 3CD6A 4NXNQ 3EA6A 1TWAB 2QGQA 4BBSG 2EXDA 1AP0A 1QZHA 4TKOB 2PI2E 4LF6Q 1Q12A 1CA6A 5LMUQ 3BDCA 2EJFC 1NCVA 1SJED 4DXFA 1YNNC 4YY3L 4K6DA 2H1EA 1EWIA 1NY4A 4GN4B 4IPCA 2VQFQ 4MHEA 1HNZQ 2R7DA 2DNEA 3HS0C 3TP6A 3H0GG 4DAPA 3S17B 2UXBL 4G7ZC 4MTKA 3V96A 1PRTC 2O4XA 1VQ9A 2L1BA 2QF7A 1CZWA 3NXWA 1M1KC 1VQJA 4B3ML 1ICFB 5A2QL 5I2XA 5IT9c 1CQFA 3QR8A 4YWLA 2DGYA 3VDYA 1E24A 1LTLA 1CKMA 2NZOA 3NELA 5EPKA 4LMQD 4POGA 1HH2P 1EY0A 2B29A 1SE8A 3L3OC 4RHSA 3PO3H 4ODGA 1S72A 3G7LA 2PNHA 3BDLA 4PV1C 5J1ZA 2E75C 1YVCA 2KUMA 4MTNA 4FF4A 5L37A 3CKIB 2K5WA 5K36H 4OWWB 3AU7A 4YIJA 3V05A 4BBRB 1VQKA 1SYCA 3CCUA 3E9HA 4CKBA 3RNUA 1IYUA 2KEDA 4UHVA 3T51B 1UAPA 2WFWA 4IFDJ 4NDXA 2K33A 1FNWA 1XMOL 3IFTA 1UEBA 1CHPD 2N49A 3CCLA 3PO3G 4OX9Q 1DJRD 3PF5A 1BF4A 4GZYC 2O2LD 5C5MA 1PYWD 3K0YA 2E8GA 2NVQB 4QIWB 1Z9FA 2QKIC 5IWAL 1KQSA 2PZTA 3FP9A 1BCPC 4LF9Q 4C56C 4NXNL 2ASBA 4A93B 1AEXA 2RF4A 2Y0SG 4A3DH 4LF6L 1Z7TA 2N8NA 4L6TB 1QJOA 5LMUL 2GVBA 2JA9A 1U4MA 2XWBB 4LF8Q 3KFUA 2EYFA 5C44G 2ALYB 2WIIB 2EZVA 1ESFA 5E4WC 1RL2A 2EY6A 4IO9A 3K8AA 2VQFL 1DOKA 2HCCA 3HKZB 5CV5A 1HNZL 1EUJA 2BA0A 2B8GA 1L0YB 3JAME 3MTSA 4A3KH 1CSPA 4XT1B 3FEWX 4A3DG 1C0AA 1BO0A 1I4RA 1TQOA 1SN8A 2FHTA 5EGTA 5A35A 3HOWH 2XVSA 3FRPB 3J81E 4KD3A 1S5BD 3CRKC 4XIGS 3U50C 1UE7A 2F0LA 1GUWA 2JJQA 1LT4D 2A68C 4LWCA 1EQVA 1RTNA 2EYPA 3FHWA 1X6OA 3Q0AA 1E1OA 3P1HA 4IUNA 4L63B 5DM63 4A3KG 1VMPA 3OTOQ 2JA5G 3R2TA 5C3EB 3U9SA 4CKEA 4LK1C 1BBXC 2A8VA 2K52A 4GKKQ 1YBYA 3RZDH 3T53B 2OTLA 1OXTA 2ZTCA 1Y1WG 4LFAQ 3IRBA 2E76C 1K3RA 1STYA 4JYAL 1KABA 1WTWA 5EAYA 4ZUJA 2B2UA 3CC2A 1E3PA 4DV7Q 4OX9L 2HDLA 1PTOD 4FDBA 2ZJPA 4DV5L 3L0OA 2F0MA 3NWTA 1L0WA 5BN3A 2HCIA 1EOVA 4AQYL 3NBIA 1IKLA 3CHBD 3VYRA 4CBVA 3S1QH 4KHPL 2HUGA 3KOJA 2KCNA 2KENA 2F0DA 1TWHB 3URYA 3HOXH 4IN3A 1BXTA 2JQOA 3PUVA 5KYLA 4C2MH 4JG2A 1GUOA 3VR5A 2AWOA 4LF8L 1WTOA 1G291 3MXUA 3PGZA 2E2HB 1Q86C 2ENBA 3HOYH 2K75A 5KNBA 1CFMA 4G7OC 4P75A 1I3QB 5IT9L 3PIO3 1VF7A 2AHOB 2PI2A 5KRUA 4KY6A 1MD2D 1WI5A 4NXMQ 2O5JC 3QG1A 2K1BA 3HOXG 4POFA 2K32A 1YHBA 2QDBA 4RH6A 1H9JA 3WOEA 2Y0SE 3HKSA 4OO1H 3OMCA 4X3KA 1STGA 1S5FD 2JP1A 3VYUA 1RIPA 1B53A 1PLFA 5AFWA 2K04A 3RMHA 1Q7YC 4HEDA 2Q2IA 5LL6X 1Z6HA 4ZKCB 3HOUH 1LTBD 3J7AV 2Z6BA 1YHAA 3I7FA 1QUQA 2LKVA 5JEAJ 4QB4A 2B2TA 2VNUD 3UI2A 1G8ZD 5ELEA 1I4GA 4C3IB 2XSCA 1EIGA 1Y8PB 4BY1B 2J4XA 3KDFB 1Q8IA 5JAVA 4OO1G 2EDGA 1RHPA 3IKJA 3W1GA 4CJ0B 1TS5A 1ENAA 4GKKL 2L0CA 4PZ6A 1F77A 4AYBG 3E6ZX 2OF1A 5LMNW 3PUZA 1MGSA 1WTXA 3K58A 1A6XA 3HOUG 2XRQD 3SK6A 5E7NA 4X3UA 2AQ1B 2CW0D 4JI7Q 1PH6A 4H0LC 3M7GA 2MNAA 3SVMA 5C0XI 3HOZH 1WYDA 3KF6A 1EFID 4C3HB 4JI3Q 3MHBA 2F4VQ 3E9IA 4JI4Q 1JOKA 4MZ9A 2CWPA 4A3MG 3I4MB 2I0QA 1Q3LA 4EVOA 4H02A 2RVLA 2K5VA 2E2IH 1HHVA 3GTGB 1QCBD 1FD7D 3KF6B 1N36Q 4OHJA 2R93G 3J81c 4A4IA 1SYBA 1SFOB 4A3EH 2BA1A 3WWVA 4GLVB 1Y1VH 1LTGD 1O80A 3I4LA 1HFGA 3S14B 2Z9HA 3W3AA 1YIJA 3CAMA 2Q2UA 4R4IA 4KJOA 2UXCL 3V2TA 5ELNA 2JA8H 2ZT9C 1N34Q 3C1EA 1K8AC 4G7HC 4A3IH 1FJGQ 3CMEA 1WTRA 5M3FH 2JK8A 2VXWA 1AW7A 2YTXA 4QQBX 1AFPA 4DV6L 4HN7A 3S1RB 3GDEA 4DK0A 3M4OH 1ML0D 2NN6I 1I5FA 1Y1VG 3D4RA 2DJGC 4XT3B 5D3IB 3CCJA 3VR2A 4ABNA 1DD2A 1K83H 3UDGA 1N9WA 3RZOB 4B3RL 3UE0A 3S9WA 4DKAC 1E2VA 1PYBA 2JEBI 3STBD 1AH9A 4RKLA 4FYDA 1DONA 2NTSA 3OIQA 1EOTA 2LY7A 1K9MC 1Y8NB 2ICEC 5JJIA 2O5IC 1I6HB 2R92G 1C8CA 2IW3A 1WFQA 1V1QA 4RWSC 3RN5A 1R4QB 5C0XG 2WB1E 2HD3A 1X9NA 4B9XA 3H3VI 1ET6A 1M4VA 4L5SA 1Y8OB 3D6WA 1HJPA 3B6YA 3SK8A 4DUZQ 2B2UC 4O2DA 4GOPB 2TMPA 4DR6Q 1XMQL 2JEAI 3AMUA 4KK7A 2F4IA 3I90A 4RGMA 1FGBD 3H0GB 4XQNA 4WRDA 3TS2A 1TR5A 3BU2A 3BVMA 2PZUA 1I4QA 1DZ1A 1JWUD 1JT8A 5IY0A 1LABA 1U5KA 5BN5A 3DWQA 1LACA 1MIUA 4DR2L 2WP8J 1ZEQX 4IUQA 2H4OA 1JORA 5E4XA 1DCZA 1O78A 1D2BA 3CP0A 4K14A 4OGQC 4IUUA 1L1OC 1HR0Q 1VDZA 2NN6G 1DM0B 4JW0A 2XN9C 4QIWE 3G48A 4A3CG 2PCFB 2K28A 5CV7A 3CW2C 1SE2A 1W6JA 4IJHA 2EPBA 1XNRQ 1IBLQ 1E22A 2KCCA 4DV0L 3HP3A 4KN7C 5C4XH 2PPBC 1QVCA 5EPJA 2NVXB 1SMYC 1NUCA 3SGIA
chains in the Genus database with same CATH topology
4C1NK 2QCPX 5JJZA 3SHLA 1LT6D 3NBHA 1KTKA 2HDMA 3WDNA 4IFDH 3H94A 2F0HA 5I6YA 1STBA 4IUTA 3GTKB 1CQVA 1STHA 1GUGA 5CR3A 1GHKA 3A8JE 3OIPA 1EU3A 4WFN3 2Y0SB 1I4HA 4V190 4IFDG 5C44B 1D1KA 1TT2A 2NYZD 5ELCA 4DU9A 3I3CA 3I4NB 1UUPA 2F0WA 1G2SA 4Q5VA 3SK5A 3S2DB 4UAIA 1I4PA 1PZKD 4ZKBB 4HMIA 2R6GA 3CRLC 1Z47A 3I70A 4F87A 2MPMA 3J7AF 3M85A 4JBWA 1SDFA 3GTMB 1BCPF 5CV8A 5M5YB 3SE0A 3VYSA 3PMFA 1S5CD 5CBAE 4FVMA 1IKMA 2IPKD 2JA5B 5I9PA 2EOTA 2X6LA 1EY6A 3KBGA 1QILA 2ID0A 1M8AA 5JPMC 1A3UA 3U9OA 1EY4A 4V0BA 2ZXPA 1S5DD 1Y1WB 2F0FA 4Z9CB 3NPPA 1STAA 1D6EC 5FLXE 3GTQB 3H6MA 2IX3A 4IUVA 2EJGC 1H9RA 1NR2A 3K5MA 4DK1A 1H9MA 3RLFA 4HTHA 2FMCA 3M7NA 5LL6S 1RTOA 1EQTA 1MSGA 2ZXOA 3BVZA 1R9TB 1HUNA 2DY8A 4M8AA 1F2MA 3GTOB 3HZXA 4PMWA 1ESRA 2PZWA 3KK7A 1Q1EA 3NTKA 1TS3A 2HQEA 3K5NA 3VA7A 3R8BA 3ITPA 2RA4A 3DWPA 2E74C 2Q8RE 5EKLA 2KVMA 4C2MB 5EKIA 2IT1A 2WB1B 1TY0A 1B9NA 1KLUD 4QUFA 3MAQA 1RKNA 1I4XA 1WD0A 3K57A 4RCOA 1RCVD 2F0JA 5JEAH 4HSVA 4X3SA 2SOBA 1T5EA 4KHZA 5HGTA 4DAYA 2FFKB 1QWYA 1PTOC 3J7YW 1JQYD 4PQXA 2CQAA 2KQ3A 3NQIA 2JSOA 1F9SA 5D65A 3OPOA 1G6ZA 3Q6SA 1PTOH 2E2JB 3TP5A 2F0QA 5NUCA 2SNMA 2Z8LA 5JEAG 5EBDA 4DA2A 3EQLC 4A3MB 2EY1A 5D3DA 5K36G 4TQUS 1F2ZA 3MVVA 1NR4A 2J0TD 4HCSA 1D5XC 4ZLTF 4J6HA 2JA7B 4DXGA 2R93B 1AZQA 4DNTB 3A56A 4RA8A 3GTLB 4O1NA 2NVTB 1SNOA 1Q1BA 3PUYA 3QJYA 3IAYA 1FR3A 1H9SA 3R2IA 4KY5A 1V1OA 2VUMB 5DM73 3G6JB 3Q24A 1V8QA 5I6WA 1LTRD 3TDQA 4A3FB 4KMUC 1SSOA 4FNFA 1H9SB 3EROA 1EWHA 2AUJD 1WTPA 1ONLA 4DAVA 3R93A 1KAAA 1TU2B 3IL8A 1JOOA 4HMJA 4K5VA 3TP8A 5C3WA 3T56B 2A5HA 1OXSC 2CW0C 4KY7A 2F0SA 2R92B 1CT1D 2RDGA 2JA6B 2YU9B 1MBYA 2Z4IA 1DOLA 1SAPA 1BUVT 1TS2A 2RSNA 4CGYB 2EYJA 1K83B 1X3PA 4U68A 1RJTA 1F9PA 4F88A 2NVYB 4OO1I 2Q8IB 1UEAB 1HTLD 3D6CA 1RDPD 2PMZB 1EU4A 4RGTA 1GJXA 1E0BA 3DMUA 2F0VA 1F2LA 2NZ1D 3FVQA 4PMBA 4DFAA 3M3YB 1JB3A 4LJZC 1IW7D 1QE6A 3S1NB 2PW5A 2A73B 5T1IA 3QOJA 3GD7A 2PQEA 2EYOA 4E6IA 1HRJA 3I91A 2AQ2B 5J22A 4IZ8A 4XYOA 2QILA 3P20A 2XRSD 4QF4A 5ELDA 3VR6A 1CI3M 3DXJC 3MFYA 2NTTA 4MIUA 2BE5D 1C4QA 4L8JA 2MHVA 3A7LA 4FF1A 1KDAA 2M00A 5G3LF 3NQTA 3K5OA 1JWMD 2CHBD 1CK1A 3GTPB 3NK9A 4OIJA 1ENCA 3NWSA 1JOQA 2A6ED 5IGGA 1I50B 4DNRB 5KNDA 1LT5D 1YNJD 2I07B 4R9WA 2A6HD 2NUCA 1DYQA 4KI0A 4XQJA 3H91A 2IJ0A 2F0PA 5M3MB 1ZYRC 2IX1A 2WV6D 1HA5A 3SK4A 4KTAA 2B63B 5C4JB 3FKIB 4G57A 3MXPA 4RFBA 2M9VA 2F0TA 1DOMA 1KNAA 1LO5D 3DEOA 1SNPA 2DN8A 5DNFA 3BYYB 4RGOS 5CC4A 5JVG3 3K6OA 2FJ2A 2IWHA 1F9QA 4XQQA 3FDTA 4QCLA 1SNQA 1O7LA 1JWSD 2JYOA 2AQ3B 2F03A 3OWFA 5FLXL 3Q22A 1WCMB 4NKLA 3OSOA 2F0NA 5M5XB 4KN4C 1PMRA 1S4ZA 1TY2A 2L4NA 3ONAB 1TWGB 5CMDA 4A3BB 1IL8A 1U4PA 1XWEA 1ILQA 1TWCB 4HSPA 4RGNA 2K6AA 1WD1A 1J9OA 3ZYYX 2IL8A 5LHY1 3QO2A 1EZ6A 5C4ZA 5IGCA 5IOCA 4CHTB 4BA1I 5ISRA 2A69D 4BBSB 1JE4A 3GP7A 4FF2A 1XYIA 4XXEA 4P2CB 3J80E 4ID6A 5BN4A 2WAQB 3LWEA 1D5ZC 4IFDI 3A54A 2RSOA 1I6VC 4NW2A 1W6KA 5IGFA 4ZRZA 1PFBA 1MSHA 3NSWA 2F1MA 3MWYW 2B2VA 1G91A 3LWUA 4EQOA 1F2YA 2BCOA 3OWEB 3SEBA 1FNVA 5FO7B 1KLGD 1HXYD 1PRTB 3VR3A 3N6RA 1V1PB 2NWGA 2RDHA 1SYEA 2G9HD 2A74C 1RODA 3WOFA 3PO3B 4S3SA 3MFGA 1PRTF 2EJMA 1B3AA 5IIFA 3MA2B 4WORA 1SE3A 2B2TC 4F8MA 1LLRD 2B2WA 5C5LA 4ZK9B 4KD4A 1OXVA 3MEHA 2F0GA 3D8GA 2K5DA 1UNSA 5D14A 1PFMA 4DF7A 4C3IG 1HUMA 2YYZA 1IHZA 1HPCA 3N52A 2DY7A 4Q0FA 4RCNA 1LV9A 4BWGB 1SYGA 3L9AX 3EJIA 4CKCA 1Q90A 5ELBA 1X32A 1HFNA 1MI2A 1BCPB 1TKWB 4A3DB 2M2LA 5ELFA 1XX8A 2PNRC 3OOCA 3TZDA 3HGBA 2F3VA 4C3HG 1A2TA 2R61A 4EGVA 1K8MA 3MXNA 2RBMA 4ULLA 2VB3X 5E1FA 4A3KB 3E5SA 3PUWA 5G3LD 3NTIA 5CV9A 4ZQ3A 5C4HA 1J8IA 2F0KA 4B9WA 3HOWB 1EEID 2K05A 4OL7A 3TP7A 3AB9A 3X3MA 1EEFD 3LNNA 2K03A 2F0IA 3RD4A 3SXHA 4K8IA 5KNCA 2DNCA 3Q23A 3DEPA 1PZJD 2EYMA 3QB3A 4CJ1B 3K5LA 5M9OA 1D5MC 2OT2A 3RUZA 2EVBA 3IFDA 4I65A 3O13A 3KLSX 2F0UA 3RZDB 4X3TA 3MZ5A 4FP5D 2B39A 3I72A 3D4DA 5FO8B 2X69A 2K5QA 2D62A 1ICWA 5EPLA 2AWNA 1PFNA 2C9OA 2J7ZA 2OXPA 3NE5B 3DUZA 4U673 4K2KA 1OXXK 1E2WA 3BS1A 3FPUB 4WJWA 3S1QB 3A7AB 4K2LA 5T1GA 4F7XA 2ZXRA 3HOXB 3NHHA 2Z1CA 3KBXA 4K5WA 2F0OA 1R4PB 4FXKC 1II3A 3HOYB 3T13A 1EY7A 2B2VC 4KV6A 1GUTA 4EQNA 4FF3A 4XTCS 5CYUA 1CTMA 4O42A 1CM9A 1FYCA 2RKSA 2PYKA 1G2TA 4KJNA 2LMCB 3EFXD 1U4LA 1B4OA 4AYBB 3I8ZA 2KOLA 5KIXA 5JPNC 3HOUB 1CZGA 4EQPA 1IW7C 5J39A 1H9KA 5FKAC 3HG9A 4J8QA 1GUNA 2RQXA 2L9HA 3PIP3 1O7ZA 2B2WC 2L12A 1TVXA 2SNSA 3KF8A 2KEEA 2MUYA 4ZAIA 1QB5D 1T5XD 2D5DA 1FNUA 1X3QA 3M4YA 2BDNA 5CGKA 2EYHA 5JOBA 3HOZB 2BE5C 1EY8A 3L7ZC 1WTQA 1HA6A 4R8NA 4HCEA 1PXUA 1VF5C 4KKTA 4CJ2C 2IX0A 2SDFA 3K59A 2E2IB 4BS9A 1EYCA 5KYIA 1E2ZA 4JK1C 2MP1A 2XIWA 4C3JG 4A3EB 3VR4A 4QUCA 2A6EC 1V43A 2TSSA 1STEA 3NUCA 1Y1VB 2R3ZA 1YNJC 3MC0B 3C1FA 2A6HC 1S5ED 2JA8B 1HCZA 2F0EA 3C3LA 2N55A 4A3IB 3J80L 5M3FB 4N9PA 4DN4M 1YNND 4LAAA 1BNZA 2N88A 3M4OB 3BYTB 3DHQA 5IGBA 1PRTD 4NP5A 3VYTA 1SNCA 5C3XA 2C5CA 1AZPA 4ZYSA 1STNA 5EKKA 5I4DA 4TSSA 3KUPA 1L0XB 4FXGC 2K7VA 1NSNS 3PO2B 3GQBA 2EE1A 3GV6A 1QNUA 2L55A 1QOHA 3DWAA 2K01A 4K6LA 1WVLA 5CORA 1KDCA 1QNKA 1B9MA 4M1UB 2BDOA 1GHJA 4XDXA 3S16B 2LS01 5F2DA 1LTSD 1EZ8A 2MGSA 5FK9C 5IGEA 4J1MA 4DGZA 4N9TA 2EY2A 1BR9A 3ERQA 2MJ8A 2SEBD 1EY5A 1EYDA 1O7YA 3BVGA 1KDBA 5JVH3 1HQMC 3PV0A 5COYA 1BCPD 5IODA 4KHVA 2JXMB 2XNAC 2NB0A 2A69C 4I7ZC 4TRDA 4NMZA 2LFNA 2NBFA 2WKDA 3T16A 4OIKA 1Y69U 4PMCA 5C4XB 1SEBD 3D31A 1CA5A 1F9RA 2VB2X 1B1ZA 1LTID 3C46A 1XXGA 2AUKA 3T4AC 4MN3A 3NP8A 1HTPA 4BY7B 1SNMA 5A2QE 3TMEA 2A68D 4IALA 1B44D 3VA5A 1EWCA 3SR1A 3MXGA 1DXMA 1OXUA 2G9DA 5TSSA 1D1IA 1JC7A 1GXDC 1EYAA 2PW7A 4R8IA 1BOSA 1SYFA 4A3GB 4H13C 5CBEE 4Y7NB 1PZID 3ND9A 5EQ0A 1EY9A 2WACA 1SNDA 4RAUC 3KLRA 5EJWA 2B2YA 1K8OA 3ND8A 3CQZB 3TSSA 3S15B 1ET9A 1TS4A 1VMCA 4ME5A 3EVQA 5IGDA 1KNEA 4B08A 1RD9D 3SDZA 4FXDA 3GTJB 1B2TA 1RF2D 4K8JA 2R7ZB 1NAPA 1JR0D 4XYQA 1TIID 1ILPA 1PDQA 2D2CC 2KA7A 5FOBB 5E3FA 2I46A 4KKUA 3HRZC 1A3TA 3OW7A 3S2HB 4K5XA 5C0XH 4H7BA 1JCKB 3P75A 3A8IE 3E0JA 1SJHD 5I2YA 1A2UA 1ZXTA 3LX0A 2KHSA 4FO2A 5EBCA 4ILWA 4IUPA 1SE4A 3QIAA 2Q8TA 1JICA 5K5PA 1A3VA 1C48A 3P7JA 2NN6H 3A55A 4RKBA 2QEJC 1BQQT 4C1NI 1V1PA 1ZYRD 2KECA 3S1MB 1VCIA 2WKCA 3PUXA 2FMMA 3GV3A 3FMCA 1XTCD 3DM1A 5KEEA 1OO9B 5C6AA 3TZUA 3W2DA 3BG3A 1GUSA 2RDFA 3FPPA 3R3OA 3H3VC 1ENFA 2XWJB 2ICIA 2JE6I 3C2PA 5DEHA 2V4DA 5I9OA 4IURA 3GO5A 4RHRA 3QWNA 1LTAD 2EXZA 3HOVB 4IQZA 5HURA 5IT9E 1PTOB 1EL0A 2B8FA 1ZKOA 1WTVA 1U4RA 3X3NA 3TN2A 5CV6A 1AN8A 2WINB 2Z4HA 5DAUA 4PNYA 3OMGA 3QOLA 1U9RA 4BA2I 1PTOF 5M5WB 3JAML 2X6GA 3TBIB 4KKSA 4C3JB 1SXTA 3J81L 3BDOA 2GA4B 1LTTD 1A15A 2D9UA 3HEJA 2EY5A 4QMGA 2PO4A 1QG7A 2L5TA 2OEOA 1GOZA 1CHQD 2E2DC 3H09A 2B2YC 1B50A 1SYDA 4H44C 3BZDB 1BDOA 2L11A 3A8KE 3CU7A 3OHXC 2F3WA 4HR7B 1EIHA 1TWFB 4ZUIA 4A3JB 4G4KA 3F2UA 1HQRD 2FINB 3D3RA 2KJXA 3NTHA 5KGUA 3D4WA 5CV4A 5C0XJ 3K7AB 3I73A 2EYLA 3KLSA 2BOSA 4HAEA 1LT3D 1SMYD 1IYVA 2CVRA 5FO9B 4UDUC 1SBBB 3EA6A 1TWAB 1AP0A 4TKOB 1Q12A 1CA6A 3BDCA 2EJFC 1NCVA 1SJED 4DXFA 1YNNC 4K6DA 2H1EA 4MHEA 2DNEA 3HS0C 3TP6A 4DAPA 3S17B 4G7ZC 3V96A 1PRTC 2O4XA 2L1BA 2QF7A 1CZWA 3NXWA 5A2QL 5I2XA 1CQFA 5EPKA 4LMQD 1EY0A 3L3OC 4RHSA 4ODGA 3G7LA 3BDLA 4PV1C 5J1ZA 2E75C 2KUMA 4FF4A 3CKIB 2K5WA 5K36H 3AU7A 4YIJA 3V05A 4BBRB 1SYCA 4CKBA 1IYUA 2KEDA 3T51B 1UAPA 4IFDJ 4NDXA 2K33A 1FNWA 3IFTA 1CHPD 1DJRD 1BF4A 4GZYC 2O2LD 5C5MA 1PYWD 3K0YA 2NVQB 4QIWB 2QKIC 2PZTA 1BCPC 4C56C 4A93B 1AEXA 1Z7TA 4L6TB 1QJOA 1U4MA 2XWBB 2EYFA 2WIIB 2EZVA 1ESFA 5E4WC 2EY6A 1DOKA 2HCCA 3HKZB 5CV5A 2BA0A 2B8GA 1L0YB 3JAME 3MTSA 4XT1B 3FEWX 1BO0A 1I4RA 1TQOA 2FHTA 5EGTA 5A35A 2XVSA 3FRPB 3J81E 4KD3A 1S5BD 3CRKC 4XIGS 2F0LA 1GUWA 1LT4D 2A68C 1EQVA 1RTNA 2EYPA 3Q0AA 4IUNA 3P1HA 4L63B 5DM63 1VMPA 3R2TA 5C3EB 3U9SA 4CKEA 4LK1C 1BBXC 3T53B 1OXTA 2E76C 1STYA 1KABA 1WTWA 4ZUJA 2B2UA 2HDLA 1PTOD 2F0MA 3NWTA 5BN3A 2HCIA 3NBIA 1IKLA 3CHBD 3VYRA 4CBVA 2HUGA 2KCNA 2F0DA 1TWHB 3URYA 4IN3A 1BXTA 3PUVA 5KYLA 3VR5A 1GUOA 2AWOA 1WTOA 1G291 3MXUA 2E2HB 2ENBA 5KNBA 1CFMA 4G7OC 1I3QB 5IT9L 3PIO3 1VF7A 5KRUA 4KY6A 1MD2D 2O5JC 3QG1A 2K1BA 2K32A 2QDBA 3WOEA 4RH6A 1H9JA 4OO1H 3OMCA 4X3KA 1STGA 1S5FD 2JP1A 3VYUA 1B53A 1PLFA 5AFWA 2K04A 3RMHA 4HEDA 5LL6X 1Z6HA 4ZKCB 1LTBD 3J7AV 2LKVA 5JEAJ 4QB4A 2B2TA 2VNUD 3UI2A 1G8ZD 5ELEA 1I4GA 4C3IB 2XSCA 1EIGA 1Y8PB 4BY1B 2J4XA 1Q8IA 5JAVA 4OO1G 2EDGA 1RHPA 3IKJA 4CJ0B 1TS5A 1ENAA 2L0CA 1F77A 3E6ZX 2OF1A 3PUZA 1MGSA 1WTXA 3K58A 1A6XA 2XRQD 3SK6A 4X3UA 2AQ1B 2CW0D 4H0LC 3M7GA 3SVMA 5C0XI 4C3HB 1EFID 3MHBA 1JOKA 3I4MB 1Q3LA 4EVOA 2RVLA 1HHVA 3GTGB 1QCBD 1FD7D 4OHJA 1SYBA 1SFOB 2BA1A 1LTGD 1O80A 3I4LA 1HFGA 3S14B 3W3AA 4KJOA 3V2TA 2ZT9C 3C1EA 4G7HC 1WTRA 2VXWA 1AW7A 1AFPA 4HN7A 3S1RB 4DK0A 1ML0D 2NN6I 3D4RA 4XT3B 5D3IB 3VR2A 4ABNA 1DD2A 3RZOB 3S9WA 1E2VA 2JEBI 4RKLA 4FYDA 1DONA 2NTSA 3OIQA 1EOTA 2LY7A 1Y8NB 2ICEC 2O5IC 1I6HB 1C8CA 2IW3A 4RWSC 1R4QB 5C0XG 4B9XA 1ET6A 1M4VA 1Y8OB 3D6WA 3SK8A 2B2UC 2TMPA 2JEAI 3AMUA 4KK7A 2F4IA 3I90A 4RGMA 1FGBD 3H0GB 4XQNA 4WRDA 1TR5A 3BVMA 2PZUA 1I4QA 1DZ1A 1JWUD 1LABA 5BN5A 3DWQA 1LACA 2WP8J 1ZEQX 4IUQA 2H4OA 1JORA 5E4XA 1DCZA 1O78A 1D2BA 4K14A 4OGQC 4IUUA 1VDZA 2NN6G 1DM0B 2XN9C 2PCFB 2K28A 5CV7A 1SE2A 1W6JA 2EPBA 2KCCA 3HP3A 4KN7C 2PPBC 5EPJA 2NVXB 1SMYC 1NUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QCP X;  3TDQ A;  1ZEQ X;  2VB3 X;  3E6Z X;  2VB2 X;  2L55 A; 
#chains in the Genus database with same CATH topology
 4C1N K;  2QCP X;  4KLK A;  4OEM B;  4LFB L;  5JJZ A;  3SHL A;  3F2C A;  1LT6 D;  3NBH A;  1KTK A;  2HDM A;  1JJG A;  3WDN A;  4IFD H;  3H94 A;  2F0H A;  3HKZ E;  5I6Y A;  1STB A;  4IUT A;  3GTK B;  1WTH A;  1CQV A;  4BY7 H;  1STH A;  1GUG A;  5CR3 A;  3EN2 A;  2UUA Q;  1GHK A;  3A8J E;  3NBH B;  3OIP A;  1EU3 A;  4WFN 3;  2D0O A;  2Y0S B;  1I4H A;  1U0L A;  4V19 0;  4IFD G;  5C44 B;  1D1K A;  4A3G H;  1TT2 A;  1UE1 A;  2NYZ D;  4Y7N H;  2MFI A;  5ELC A;  4DU9 A;  3I3C A;  1VQP A;  4DR6 L;  3I4N B;  1UUP A;  2F0W A;  2B63 G;  1G2S A;  4DV4 Q;  4Q5V A;  3SK5 A;  1J5E L;  4DK3 C;  3CQZ H;  3K80 C;  4LW1 A;  3S15 H;  4YWK A;  3J81 i;  4UAI A;  1I4P A;  3I56 A;  1IYJ B;  3S2D B;  1PZK D;  4ZKB B;  4HMI A;  2Q2H A;  4A3G G;  2R6G A;  1SRO A;  3CRL C;  4A76 A;  1Z47 A;  3I70 A;  2ZJQ A;  5IYD H;  4F87 A;  2MPM A;  3GTJ H;  3J7A F;  3M85 A;  4JBW A;  2R7Z H;  1SDF A;  2PMZ E;  2CH4 A;  3GTM B;  4HJ5 A;  1IZ6 A;  1BCP F;  5CV8 A;  5M5Y B;  3SE0 A;  3VYS A;  3PMF A;  1S5C D;  5CBA E;  4FVM A;  1IKM A;  2IPK D;  2JA5 B;  5I9P A;  2EOT A;  1QVF A;  4DV1 Q;  3S24 A;  2X6L A;  3G4S A;  1XNR L;  1EY6 A;  2Z6K A;  1QIL A;  2ID0 A;  1M8A A;  3KBG A;  5JPM C;  1A3U A;  3U9O A;  3S2H H;  1EY4 A;  2CCZ A;  4V0B A;  2ZXP A;  1S5D D;  1Y1W B;  1SR3 A;  5IYD G;  2F0F A;  4Z9C B;  4A3B G;  3NPP A;  1QZG A;  1PH2 A;  1STA A;  1D6E C;  2OWO A;  5FLX E;  2R7Z G;  3GTQ B;  3H6M A;  4RG1 A;  2IX3 A;  4LF4 Q;  1CKO A;  2IHF A;  4EQ5 A;  4IUV A;  2EJG C;  5AJ3 Q;  2OCE A;  1H9R A;  1NR2 A;  3K5M A;  4DK1 A;  1H9M A;  3RLF A;  4HTH A;  2VQE Q;  2FMC A;  4GLX A;  3F1Z A;  3M7N A;  5LL6 S;  1RTO A;  1EQT A;  1MSG A;  2ZXO A;  4DNI A;  3F2B A;  2NZH A;  3BVZ A;  1KC8 C;  1A62 A;  1R9T B;  1IL2 A;  1HUN A;  1BKB A;  2DY8 A;  4M8A A;  4WJ3 M;  5BR8 Q;  5IYC H;  1F2M A;  3GTO B;  3M4Q A;  3HZX A;  4UPA A;  4PMW A;  1ESR A;  4P72 A;  3G6E A;  2PZW A;  3KK7 A;  3PIO A;  1SRU A;  1Q1E A;  1NNX A;  3NTK A;  2WAQ G;  1TS3 A;  3W5O A;  1GM5 A;  1KRS A;  2HQE A;  3K5N A;  3VA7 A;  3R8B A;  3ITP A;  2RA4 A;  3DWP A;  2E74 C;  2Q8R E;  3S1M H;  2K4K A;  4UP8 A;  5EKL A;  4HIO A;  2KVM A;  1NMG A;  4DV2 Q;  2VS1 A;  4C2M B;  4OEL B;  5IYC G;  5EKI A;  2IT1 A;  2WB1 B;  1TY0 A;  1B9N A;  1KLU D;  3NEM A;  4QUF A;  3MAQ A;  1RKN A;  1I4X A;  2HHH Q;  1WD0 A;  3K57 A;  5ELO A;  4RCO A;  1RCV D;  2F0J A;  4EX5 A;  1P16 A;  4HSV A;  4X3S A;  5JEA H;  2I5H A;  2SOB A;  5FLM H;  1NE3 A;  1T5E A;  4KHZ A;  3UE1 A;  1EFW A;  4PZ7 A;  1TXY A;  5HGT A;  4DV1 L;  4DAY A;  2FFK B;  1QWY A;  1PTO C;  1YIT A;  3J7Y W;  1JQY D;  4PQX A;  2CQA A;  2KQ3 A;  3NQI A;  2JSO A;  1F9S A;  5D65 A;  3HOV H;  3OPO A;  1G6Z A;  3Q6S A;  1PTO H;  2E2J B;  2ZM6 Q;  3TP5 A;  2F0Q A;  2LXJ A;  5NUC A;  4DAY B;  2B3G A;  4JV5 Q;  1GVP A;  1NJI C;  4LF4 L;  2SNM A;  1XNQ Q;  4JI1 Q;  2Z8L A;  5JEA G;  4GNX B;  5FLM G;  5EBD A;  1N32 Q;  4DR4 L;  4DA2 A;  2VQE L;  3EQL C;  4A3M B;  2EY1 A;  5D3D A;  5K36 G;  4TQU S;  1F2Z A;  1VQ5 A;  5M5W H;  2ATW A;  3MVV A;  1NR4 A;  4JOI C;  2J0T D;  4HCS A;  1VQ6 A;  3HOV G;  4HID A;  1D5X C;  1VS0 A;  4ZLT F;  4J6H A;  4LFC Q;  2JA7 B;  4DXG A;  2R93 B;  1AZQ A;  4DNT B;  3A56 A;  4RA8 A;  4C3J H;  5BR8 L;  1MJE A;  4O1N A;  3GTL B;  2NVT B;  1W3S A;  4B3T Q;  1SNO A;  1Q1B A;  4JBK A;  3KF8 B;  3PUY A;  1VQN A;  3QJY A;  3IAY A;  3PSI A;  1FR3 A;  4LF5 Q;  1H9S A;  3R2I A;  4KY5 A;  1V1O A;  2VUM B;  4P74 A;  5DM7 3;  3G6J B;  3Q24 A;  1V8Q A;  5I6W A;  1LTR D;  3TDQ A;  4A3F B;  4KMU C;  1XJV A;  4HJA A;  1SSO A;  4FNF A;  1H9S B;  5FLX c;  3ERO A;  1EWH A;  2AUJ D;  1WTP A;  1ONL A;  4DAV A;  3R93 A;  1KAA A;  1TU2 B;  2WAQ E;  3IL8 A;  1JOO A;  4N8X 1;  1MJC A;  1IBK Q;  4HMJ A;  4A3J H;  4K5V A;  3TP8 A;  5C3W A;  3T56 B;  2A5H A;  1OXS C;  2CW0 C;  4KY7 A;  2F0S A;  2R92 B;  1CT1 D;  2RDG A;  2DUD A;  2YU9 B;  3UDI A;  3K7A H;  2JA6 B;  3HOW G;  1FVI A;  1MBY A;  2Z4I A;  2Z6K C;  1D7Q A;  1DOL A;  1SAP A;  1VQ7 A;  1BUV T;  1TS2 A;  2RSN A;  4CGY B;  2EYJ A;  1EIF A;  1ASZ A;  1K83 B;  1VQL A;  1X3P A;  4X66 Q;  4U68 A;  1RJT A;  1F9P A;  4F88 A;  4YCW A;  2NVY B;  4JV5 L;  4OO1 I;  2Q8I B;  1UEA B;  4JI1 L;  4A3J G;  1HTL D;  3NEN A;  2I5M X;  3D6C A;  1NMF A;  1RDP D;  2PMZ B;  1EU4 A;  4RGT A;  1GJX A;  1E0B A;  3DMU A;  2F0V A;  3DM3 A;  1F2L A;  2HT1 A;  2NZ1 D;  3FVQ A;  4PMB A;  4DFA A;  3M3Y B;  5JJK A;  1TWA H;  1JB3 A;  3D0F A;  4LJZ C;  4LF9 L;  2OQ0 A;  1IW7 D;  1QE6 A;  4LFC L;  4IPD A;  3S1N B;  2PW5 A;  2A73 B;  5T1I A;  1VQ4 A;  3CC4 A;  3QOJ A;  3GD7 A;  1K28 A;  1Q81 C;  2PQE A;  2EYO A;  4E6I A;  2RHS B;  1HRJ A;  3I91 A;  4NPS A;  2AQ2 B;  5J22 A;  4IZ8 A;  4XYO A;  2QIL A;  3P20 A;  2XRS D;  1I94 Q;  3TEH B;  4QF4 A;  5ELD A;  1VQE A;  3S17 H;  4DR1 Q;  3I4O A;  3VR6 A;  1CI3 M;  5IP7 H;  4JI6 Q;  3DXJ C;  3MFY A;  2N78 A;  2NTT A;  4MIU A;  2BE5 D;  1C4Q A;  1KL9 A;  2Z0S A;  4X65 Q;  4L8J A;  2MHV A;  1K0R A;  3A7L A;  4FF1 A;  4R4O A;  1KDA A;  5GAE C;  2M00 A;  2PQA A;  5G3L F;  3NQT A;  3CCM A;  3K5O A;  1JWM D;  2CHB D;  1CK1 A;  3HOY G;  3GTP B;  2CFM A;  1CSQ A;  3NK9 A;  3KDF A;  4OIJ A;  1ENC A;  2K5N A;  3NWS A;  1IBK L;  2PQA B;  5IP7 G;  1L1O B;  1JOQ A;  2A6E D;  1I50 B;  5IGG A;  4DNR B;  5KND A;  1V9P A;  1KIX A;  1LT5 D;  4OXP A;  1YNJ D;  2I07 B;  4R9W A;  3OTO L;  2A6H D;  5GQO A;  3CXC A;  4BBR H;  2NUC A;  1DYQ A;  4KI0 A;  1VQA A;  4XQJ A;  4DR7 Q;  1PHJ A;  3H91 A;  2IJ0 A;  4LFA L;  1HNX Q;  4X66 L;  2F0P A;  4IOC A;  1YJN A;  5M3M B;  1KHI A;  1K0S A;  4DV7 L;  1ZYR C;  1YJW A;  2IX1 A;  1VQF A;  5J3B A;  4JI8 Q;  2WV6 D;  2NVQ H;  1HA5 A;  1VQG A;  3CMA A;  3SK4 A;  4KTA A;  4BBR G;  3KJO A;  2B63 B;  1A0I A;  5C4J B;  3FKI B;  1K8G A;  4A93 H;  4R1J A;  4G57 A;  3MXP A;  4RFB A;  2M9V A;  2F0T A;  1DOM A;  1N8R C;  2OTJ A;  1E7Z A;  1CKN B;  1KNA A;  4HJ8 A;  4DR5 Q;  1LO5 D;  3DEO A;  1SNP A;  2DN8 A;  4TVA B;  3BYY B;  1VQB A;  4RGO S;  5DNF A;  5CC4 A;  5JVG 3;  3K6O A;  2CWA A;  2FJ2 A;  1F9Q A;  2IWH A;  3FDT A;  4XQQ A;  4QCL A;  3HOZ G;  1SNQ A;  1O7L A;  1AE3 A;  1JWS D;  1MKH A;  2JYO A;  3DLL A;  2AQ3 B;  2F03 A;  3OWF A;  5FLX L;  3Q22 A;  1WCM B;  5GAH C;  2IY5 B;  4NKL A;  4JI0 Q;  3OSO A;  4JI6 L;  1PYS B;  1JMC A;  4PG3 A;  2F0N A;  5M5X B;  4NXM L;  4KN4 C;  1C9O A;  4X65 L;  1PMR A;  1S4Z A;  1TY2 A;  2L4N A;  3ONA B;  4A3E G;  1TWG B;  5CMD A;  4A3B B;  4DR3 Q;  1IL8 A;  1U4P A;  1XWE A;  4LF7 Q;  1ILQ A;  4P71 A;  1TWC B;  4HSP A;  4RGN A;  1PVO A;  2JA8 G;  2K6A A;  1WD1 A;  1J9O A;  3ZYY X;  1YZ6 A;  2IL8 A;  5LHY 1;  3QO2 A;  4A3I G;  1EZ6 A;  5C4Z A;  1B3Q A;  5M3F G;  5C3E H;  5IGC A;  5IOC A;  4CHT B;  4BA1 I;  1N33 Q;  4CDD C;  5ISR A;  2UU9 Q;  2A69 D;  3PO2 H;  2RCF A;  4BBS B;  4LUO A;  4K0K Q;  1JE4 A;  3GP7 A;  4GOP A;  1HNX L;  4FF2 A;  1XYI A;  4XXE A;  4P2C B;  3J80 E;  4ID6 A;  1B8A A;  4JI7 L;  3S16 H;  5LMN Q;  3K0X A;  5BN4 A;  2WAQ B;  4JI3 L;  4JI8 L;  3KJP A;  3LWE A;  1D5Z C;  2F4V L;  4JI4 L;  4IFD I;  3A54 A;  2RSO A;  1YI2 A;  4RMF A;  3PO2 G;  1I6V C;  3E0E A;  4NW2 A;  1W6K A;  5IGF A;  4GS3 A;  2UUB Q;  4AYB E;  1Q82 C;  1N36 L;  4ZRZ A;  1PFB A;  1J6Q A;  1MSH A;  3NSW A;  2F1M A;  3MWY W;  4JCV E;  2E5L Q;  2MO0 A;  2B2V A;  1X55 A;  1XTD A;  1G91 A;  1I3Q H;  3CCR A;  3LWU A;  4EQO A;  2QDL A;  1N34 L;  1F2Y A;  2QW7 A;  2CQO A;  1PH3 A;  1FJG L;  1O7I A;  2BCO A;  3OWE B;  3SEB A;  1FNV A;  1PH4 A;  5FO7 B;  1KLG D;  1PH8 A;  1HXY D;  1PRT B;  3VR3 A;  1BVS A;  2EQS A;  3N6R A;  1V1P B;  2YTY A;  1IBM Q;  2NWG A;  2RDH A;  1SYE A;  2G9H D;  3M9B A;  2A74 C;  3A0J A;  1UWV A;  1ROD A;  3WOF A;  3PO3 B;  4S3S A;  2CH4 W;  3MFG A;  4C3I H;  3A74 A;  1PRT F;  2D0P A;  2EJM A;  1B3A A;  5IIF A;  4HIK A;  3MA2 B;  4WOR A;  1SE3 A;  1VQH A;  4BY1 H;  2B2T C;  4F8M A;  1M90 C;  4JI5 Q;  1LLR D;  2B2W A;  5C5L A;  4ZK9 B;  4KD4 A;  1OXV A;  1PH9 A;  1N33 L;  5C4X G;  3MEH A;  3ERS X;  2F0G A;  3D8G A;  2K5D A;  2N3S A;  4K0K L;  1IXR A;  4OWT B;  1UNS A;  4P73 A;  1GD7 A;  3U4V A;  5D14 A;  1PFM A;  4DF7 A;  4CDF C;  1VQD A;  1FL0 A;  3TQY A;  4C3I G;  1HUM A;  2YYZ A;  4C3H H;  2G5D A;  4DUZ L;  1IHZ A;  1HPC A;  3N52 A;  2DY7 A;  4Q0F A;  4APV A;  4RCN A;  4HIM A;  4BY7 G;  1LV9 A;  4BWG B;  3I4M H;  1SYG A;  3L9A X;  3EJI A;  4CKC A;  2F52 A;  1Q90 A;  4JPB W;  5ELB A;  4QY7 A;  1X32 A;  3GTG H;  1HFN A;  1JJ2 A;  1MI2 A;  2HIX A;  1BCP B;  1TKW B;  2V1C C;  4A3D B;  2M2L A;  5ELF A;  3CCQ A;  1XX8 A;  2PNR C;  1SFO H;  3A5U A;  2L15 A;  3OOC A;  1L2F A;  3BZK A;  3TZD A;  4YY3 Q;  4L5R C;  3HGB A;  4OON A;  2F3V A;  2E5L L;  4C3H G;  1A2T A;  3S14 H;  2KCM A;  2R61 A;  4EGV A;  1K8M A;  2Q2T A;  3CCS A;  2UXB Q;  1Q8K A;  3HFZ B;  3MXN A;  2RBM A;  2AMC B;  4ULL A;  1HR0 L;  2VB3 X;  5E1F A;  4A3K B;  3E5S A;  3PUW A;  5G3L D;  1X3G A;  3NTI A;  5CV9 A;  4ZQ3 A;  5C4H A;  3S1R H;  4B3M Q;  1Q46 A;  1J8I A;  4WJ4 A;  3TRZ A;  2F0K A;  4B9W A;  3HOW B;  1IBL L;  1EEI D;  3MXN B;  2K05 A;  4OL7 A;  1IBM L;  3TP7 A;  3AB9 A;  3X3M A;  4DAM A;  4L5T A;  1EEF D;  3J80 c;  3LNN A;  3RZO H;  2K03 A;  2F0I A;  3RD4 A;  1P8L A;  3SXH A;  5IYB H;  4K8I A;  5KNC A;  2DNC A;  3CCV A;  3Q23 A;  3DEP A;  1PZJ D;  2EYM A;  3QB3 A;  4LUZ A;  4CJ1 B;  3K5L A;  5M9O A;  1D5M C;  2OT2 A;  2UXD Q;  3RUZ A;  1I6H H;  2UUA L;  2EVB A;  3IFD A;  4I65 A;  3O13 A;  2AKW B;  2F0U A;  3KLS X;  3RZD B;  4X3T A;  3F2D A;  3MZ5 A;  4FP5 D;  2B39 A;  3I72 A;  2MO1 A;  3D4D A;  1XMO Q;  5FO8 B;  2X69 A;  2K5Q A;  1K3B C;  2D62 A;  1ICW A;  5EPL A;  1G6P A;  2AWN A;  4GOP C;  1PFN A;  3KLW A;  2C9O A;  4R4C A;  1BBU A;  2J7Z A;  2OXP A;  5IYB G;  3NE5 B;  2HIV A;  1HZA A;  3DUZ A;  1E1T A;  4U67 3;  1D8L A;  4K2K A;  3H0G H;  1OXX K;  1E2W A;  3BS1 A;  4DK6 C;  3FPU B;  4WJW A;  3S1Q B;  3A7A B;  4GN5 A;  1X65 A;  4K2L A;  5T1G A;  4DV4 L;  3KYH C;  4F7X A;  2HQL A;  1BBW A;  2ZXR A;  3HOX B;  3NHH A;  2Z1C A;  3KBX A;  4K5W A;  2F0O A;  1R4P B;  4FXK C;  1II3 A;  3HOY B;  2MQH A;  3T13 A;  1EY7 A;  2B2V C;  4KV6 A;  1GUT A;  3CC7 A;  4EQN A;  4FF3 A;  1KRT A;  3ULP A;  4XTC S;  5CYU A;  4B3S Q;  1CTM A;  4O42 A;  4MNO A;  1CM9 A;  1FYC A;  2RKS A;  2PYK A;  1G2T A;  4KJN A;  2LMC B;  3EFX D;  2NVX H;  1U4L A;  1B4O A;  3M4P A;  4AYB B;  3I8Z A;  4GNX A;  2LXK A;  4X6A H;  1NBW A;  2KOL A;  3J7Z C;  3AEV A;  5KIX A;  2BH2 A;  5JPN C;  3HOU B;  1CZG A;  2XGT A;  3W1B A;  4EQP A;  1IW7 C;  5J39 A;  1A63 A;  1H9K A;  5FKA C;  3HG9 A;  3GTK H;  1ASY A;  5AJ3 L;  1C7Y A;  1UE5 A;  4J8Q A;  3AFQ A;  2VZA A;  1GUN A;  2UXD L;  3T1H Q;  2RQX A;  4JVZ A;  2L9H A;  3PIP 3;  1O7Z A;  1XPO A;  2B2W C;  2L12 A;  4YHH Q;  4DPG A;  4CDC C;  1TVX A;  4JYA Q;  2SNS A;  3A5Z B;  3KF8 A;  2KEE A;  2MUY A;  4ZAI A;  1QB5 D;  5C44 H;  2KHI A;  4JC0 A;  1T5X D;  4N8F A;  2D5D A;  1FNU A;  1HZC A;  1X3Q A;  4DV5 Q;  3M4Y A;  2BDN A;  5CGK A;  2EYH A;  5JOB A;  3HOZ B;  2BE5 C;  1EY8 A;  3L7Z C;  1WTQ A;  1HA6 A;  4R8N A;  3I4N H;  3EBE A;  4AQY Q;  4HCE A;  1PXU A;  1VF5 C;  4KHP Q;  4KKT A;  4O0A A;  4CJ2 C;  1X3E A;  2IX0 A;  2SDF A;  3K59 A;  2E2I B;  4BS9 A;  1EYC A;  4X64 Q;  5KYI A;  3S2D H;  1E2Z A;  4JK1 C;  2MP1 A;  1VQ8 A;  2XIW A;  4C3J G;  4DV2 L;  4A3E B;  3VR4 A;  4QUC A;  3L2P A;  2A6E C;  1V43 A;  2TSS A;  1STE A;  1X56 A;  3NUC A;  3RLO A;  1Y1V B;  2R3Z A;  1YNJ C;  4NB3 A;  3MC0 B;  3C1F A;  2A6H C;  2QA4 A;  1S5E D;  2F3I A;  3I4N G;  3ULJ A;  3GTM H;  2JA8 B;  2HHH L;  3PCO B;  1HCZ A;  2F0E A;  5M5Y H;  1TWF H;  1OTC A;  3C3L A;  1T9H A;  2N55 A;  4A3I B;  3J80 L;  4J15 A;  5M3F B;  3H15 A;  2GVA A;  4N9P A;  2JA5 H;  4DN4 M;  4B3S L;  1YNN D;  4LAA A;  1BNZ A;  2N88 A;  2R7F A;  3JC6 6;  3M4O B;  2A1A A;  3BYT B;  1Y1W H;  3DHQ A;  5IGB A;  3I2Z A;  1VQC A;  3J80 i;  1PRT D;  4NP5 A;  4ALP A;  2ZM6 L;  3VYT A;  1SNC A;  5GAD C;  5C3X A;  1AE2 A;  2C5C A;  1AZP A;  3GTQ H;  4ZYS A;  2LSS A;  3T1Y Q;  1STN A;  5EKK A;  5I4D A;  4TSS A;  3KUP A;  1L0X B;  1XNQ L;  3ER0 A;  2JN4 A;  1HNW Q;  1N32 L;  4FXG C;  3T1H L;  3MEF A;  1YHQ A;  2K7V A;  1NSN S;  2P5Z X;  3PO2 B;  4YHH L;  3GQB A;  2RCN A;  1R9T H;  2EE1 A;  3GV6 A;  1QNU A;  1PH1 A;  2L55 A;  1QOH A;  2YTV A;  3DWA A;  2K01 A;  4K6L A;  1WVL A;  5COR A;  1KDC A;  1QNK A;  3GTO H;  1B9M A;  4M1U B;  1S3O A;  2BDO A;  1GHJ A;  4XDX A;  3S16 B;  4B3T L;  5IP9 H;  3CPF A;  2ZTD A;  2ZJR A;  1PH7 A;  2LS0 1;  5F2D A;  3CPW A;  1LTS D;  1EZ8 A;  2MGS A;  5FK9 C;  5DLQ E;  5IGE A;  4J1M A;  4DGZ A;  1VQM A;  4N9T A;  2KCT A;  2EY2 A;  1BR9 A;  3ERQ A;  2MJ8 A;  4LF5 L;  2SEB D;  1EY5 A;  1EYD A;  1O7Y A;  1JB7 A;  4X64 L;  3AFP A;  2K50 A;  3U4Z A;  1QVG A;  1W2B A;  2A19 A;  3BVG A;  1KDB A;  3ZJY C;  5JJL A;  3STB C;  5JVH 3;  1HQM C;  3PQI A;  3PV0 A;  5COY A;  1BCP D;  1L1O A;  5IP9 G;  2UXC Q;  5IOD A;  4KHV A;  2JXM B;  2XNA C;  2NB0 A;  2A69 C;  4I7Z C;  4TRD A;  4NMZ A;  2LFN A;  2NBF A;  3TRE A;  2WKD A;  3K7U C;  3T16 A;  4DV6 Q;  4CDE C;  4OIK A;  1Y69 U;  2GN5 A;  4PMC A;  5C4X B;  1SEB D;  3D31 A;  1WOC A;  2WB1 G;  3OW2 A;  1Y14 B;  2E2J H;  4B3R Q;  2QEX A;  4GNX C;  1CA5 A;  1F9R A;  2VB2 X;  1B1Z A;  3CCE A;  1LTI D;  3C46 A;  2YV5 A;  3T1Y L;  1XXG A;  2AUK A;  4LUV A;  2I5L X;  3BZC A;  4DV3 Q;  3T4A C;  4MN3 A;  5H1S E;  3NP8 A;  1HTP A;  3BJU A;  4BY7 B;  1HNW L;  1SNM A;  5A2Q E;  4A3M H;  1QUQ B;  3TME A;  2A68 D;  1CKN A;  4IAL A;  1B44 D;  3VA5 A;  2FXQ A;  1EWC A;  3SR1 A;  3MXG A;  1DXM A;  2VW9 A;  2JA7 H;  1OXU A;  4UY8 C;  2G9D A;  2R93 H;  5TSS A;  1D1I A;  1JC7 A;  1GXD C;  1SLJ A;  1EYA A;  3GTL H;  2PW7 A;  4R8I A;  1BOS A;  2NVT H;  1SYF A;  4A3G B;  4H13 C;  3CF5 A;  5CBE E;  4Y7N B;  1PZI D;  4QL5 A;  1YEZ A;  3ND9 A;  1XMQ Q;  5GAG C;  5EQ0 A;  3AYH B;  3JAM c;  1EY9 A;  2WAC A;  1SND A;  1I94 L;  4DR1 L;  4RAU C;  3Q8D A;  3KLR A;  5EJW A;  2B2Y A;  4A93 G;  1JE5 A;  1K8O A;  2VUM H;  1MHW C;  3ND8 A;  3CQZ B;  2JA7 G;  4GN3 B;  3TSS A;  1VQI A;  3S15 B;  1ET9 A;  1EIY B;  1TS4 A;  1HR0 W;  1VMC A;  4DR2 Q;  4ME5 A;  4A3F H;  3EVQ A;  5IGD A;  1KNE A;  5IE8 A;  4B08 A;  3U58 A;  1RD9 D;  3SDZ A;  4FXD A;  3GTJ B;  1B2T A;  4R4Q A;  1RF2 D;  4K8J A;  2R7Z B;  1NAP A;  1JR0 D;  4XYQ A;  3HKZ G;  1TII D;  4ME3 A;  1ILP A;  1GKH A;  1DGS A;  1PDQ A;  2RHQ B;  1XPR A;  3ICE A;  2ZTE A;  1LUZ A;  2CKZ B;  1KXL A;  2VUM G;  2D2C C;  2KA7 A;  5FOB B;  5E3F A;  4DV0 Q;  2I46 A;  4YWM A;  4KKU A;  1X54 A;  2R92 H;  3HRZ C;  2JA6 H;  3OW7 A;  1A3T A;  2C35 B;  4K5X A;  4A3F G;  2YU9 H;  3S2H B;  3ULL A;  2KBN A;  5C0X H;  4H7B A;  1JCK B;  3P75 A;  4LFB Q;  3A8I E;  1G51 A;  3E0J A;  5HGQ A;  1SJH D;  4DR7 L;  5I2Y A;  4UP9 A;  5FJ8 H;  2NVY H;  2H5X A;  1S40 A;  1A2U A;  4DV3 L;  1ZXT A;  3LX0 A;  1PFS A;  4L5Q A;  5C3E G;  2JA6 G;  3M3Y H;  2KHS A;  4FO2 A;  1EYG A;  4A3L H;  5EBC A;  3RLN A;  4ILW A;  4IUP A;  1SE4 A;  3QIA A;  2Q8T A;  4IOA A;  4DUY Q;  1JIC A;  3S1N H;  1TWH H;  5K5P A;  4X62 Q;  5FJ8 G;  1A3V A;  3J7A 5;  4GKJ Q;  1X3F A;  4JI2 Q;  4DR5 L;  1GO3 E;  1C48 A;  2E2H H;  3P7J A;  5HY6 A;  2NN6 H;  3A55 A;  4RKB A;  4A3L G;  1J5E Q;  4A75 A;  3OYY A;  4A3C H;  2QEJ C;  1BQQ T;  2UUC Q;  4C1N I;  3J81 j;  3LGJ A;  1V1P A;  1ZYR D;  4JI0 L;  2KEC A;  4YCU A;  1VCI A;  3S1M B;  2WKC A;  3PUX A;  2FMM A;  3E3X A;  3GV3 A;  3FMC A;  2VL6 A;  1XTC D;  3DM1 A;  4JBJ A;  5KEE A;  4IPG A;  1OO9 B;  3GTP H;  3TZU A;  5C6A A;  3W2D A;  4DR3 L;  3BG3 A;  3K81 C;  1GUS A;  2RDF A;  2OQK A;  3AQQ A;  4LF7 L;  3FPP A;  3R3O A;  3H3V C;  1ENF A;  4HJ9 A;  3RR5 A;  2XWJ B;  1I50 H;  2ICI A;  3H3V H;  2JE6 I;  3C2P A;  5DEH A;  4IJL A;  2V4D A;  3PIP A;  4AIM A;  5I9O A;  4QJF A;  4IUR A;  4BXX H;  3GO5 A;  4RHR A;  3QWN A;  2EIF A;  1LTA D;  4QGU A;  2UU9 L;  2EXZ A;  4PZ8 A;  3HOV B;  4IQZ A;  1A8V A;  5HUR A;  5IT9 E;  1PTO B;  1EL0 A;  1H95 A;  2B8F A;  1HZ9 A;  2KHJ A;  5M3M H;  1ZKO A;  1PH5 A;  1B7Y B;  1U4R A;  3X3N A;  3I55 A;  3G71 A;  1WTV A;  3TN2 A;  4YCV A;  1UE6 A;  2ES2 A;  3TS0 A;  5CV6 A;  1AN8 A;  2VY3 A;  2WIN B;  2Z4H A;  5DAU A;  4JOI A;  4PNY A;  4BY1 G;  5LMN L;  3OMG A;  1EQQ A;  3QOL A;  1PV4 A;  4BXX G;  1U9R A;  1PA6 A;  4GLA C;  2B63 H;  1PTO F;  4BA2 I;  5C4J H;  5M5W B;  3FKI H;  3JAM L;  1VQO A;  2X6G A;  4DUY L;  3TBI B;  1XPU A;  1JJC B;  2UUB L;  4KKS A;  5M3M G;  4X62 L;  4C3J B;  1SXT A;  4GKJ L;  4JI2 L;  3J81 L;  3BDO A;  2GA4 B;  3RN2 A;  2XTI A;  1LTT D;  3PF4 A;  1A15 A;  3JAM i;  4UP7 A;  1FGU A;  2D9U A;  3HEJ A;  4LNQ A;  2EY5 A;  3I4M G;  1WCM H;  4QMG A;  3FKI G;  2PO4 A;  1QG7 A;  3UDF A;  2L5T A;  2OEO A;  1LM0 A;  2UUC L;  1GOZ A;  1CHQ D;  3EIV A;  5M5X H;  2E2D C;  3H09 A;  2B2Y C;  1B50 A;  1SMX A;  1SYD A;  4H44 C;  3BZD B;  1BDO A;  1TWG H;  1KD1 C;  4IPH A;  2L11 A;  4A3B H;  3A8K E;  1HZB A;  4AH6 A;  1KAW A;  3OHX C;  3CU7 A;  2F3W A;  1TWC H;  4HR7 B;  4R4T A;  1EIH A;  1TWF B;  1WCM G;  2BH8 A;  1B70 B;  4ZUI A;  4A3J B;  4G4K A;  3F2U A;  1NTG A;  5GRO A;  1HQR D;  2FIN B;  4OWX B;  3UDX A;  4JI5 L;  3D3R A;  2KJX A;  3NTH A;  5KGU A;  3D4W A;  5CV4 A;  1LYL A;  4JBM A;  5C0X J;  3K7A B;  2K5H A;  3I73 A;  4BBS H;  2EYL A;  3KLS A;  1YNX A;  1CUK A;  1EQR A;  3F8T A;  2BOS A;  4Y52 H;  4HAE A;  2K14 A;  1WJJ A;  4ZCK A;  2IHE A;  4DR4 Q;  1YJ9 A;  1LT3 D;  1SMY D;  1IYV A;  2CVR A;  2DJF C;  4I7A A;  5IWA Q;  5FO9 B;  4UDU C;  4HJ7 A;  1K73 C;  1SBB B;  3CD6 A;  4NXN Q;  3EA6 A;  1TWA B;  2QGQ A;  4BBS G;  2EXD A;  1AP0 A;  1QZH A;  4TKO B;  2PI2 E;  4LF6 Q;  1Q12 A;  1CA6 A;  5LMU Q;  3BDC A;  2EJF C;  1NCV A;  1SJE D;  4DXF A;  1YNN C;  4YY3 L;  4K6D A;  2H1E A;  1EWI A;  1NY4 A;  4GN4 B;  4IPC A;  2VQF Q;  4MHE A;  1HNZ Q;  2R7D A;  2DNE A;  3HS0 C;  3TP6 A;  3H0G G;  4DAP A;  3S17 B;  2UXB L;  4G7Z C;  4MTK A;  3V96 A;  1PRT C;  2O4X A;  1VQ9 A;  2L1B A;  2QF7 A;  1CZW A;  3NXW A;  1M1K C;  1VQJ A;  4B3M L;  1ICF B;  5A2Q L;  5I2X A;  5IT9 c;  1CQF A;  3QR8 A;  4YWL A;  2DGY A;  3VDY A;  1E24 A;  1LTL A;  1CKM A;  2NZO A;  3NEL A;  5EPK A;  4LMQ D;  4POG A;  1HH2 P;  1EY0 A;  2B29 A;  1SE8 A;  3L3O C;  4RHS A;  3PO3 H;  4ODG A;  1S72 A;  3G7L A;  2PNH A;  3BDL A;  4PV1 C;  5J1Z A;  2E75 C;  1YVC A;  2KUM A;  4MTN A;  4FF4 A;  5L37 A;  3CKI B;  2K5W A;  5K36 H;  4OWW B;  3AU7 A;  4YIJ A;  3V05 A;  4BBR B;  1VQK A;  1SYC A;  3CCU A;  3E9H A;  4CKB A;  3RNU A;  1IYU A;  2KED A;  4UHV A;  3T51 B;  1UAP A;  2WFW A;  4IFD J;  4NDX A;  2K33 A;  1FNW A;  1XMO L;  3IFT A;  1UEB A;  1CHP D;  2N49 A;  3CCL A;  3PO3 G;  4OX9 Q;  1DJR D;  3PF5 A;  1BF4 A;  4GZY C;  2O2L D;  5C5M A;  1PYW D;  3K0Y A;  2E8G A;  2NVQ B;  4QIW B;  1Z9F A;  2QKI C;  5IWA L;  1KQS A;  2PZT A;  3FP9 A;  1BCP C;  4LF9 Q;  4C56 C;  4NXN L;  2ASB A;  4A93 B;  1AEX A;  2RF4 A;  2Y0S G;  4A3D H;  4LF6 L;  1Z7T A;  2N8N A;  4L6T B;  1QJO A;  5LMU L;  2GVB A;  2JA9 A;  1U4M A;  2XWB B;  4LF8 Q;  3KFU A;  2EYF A;  5C44 G;  2ALY B;  2WII B;  2EZV A;  1ESF A;  5E4W C;  1RL2 A;  2EY6 A;  4IO9 A;  3K8A A;  2VQF L;  1DOK A;  2HCC A;  3HKZ B;  5CV5 A;  1HNZ L;  1EUJ A;  2BA0 A;  2B8G A;  1L0Y B;  3JAM E;  3MTS A;  4A3K H;  1CSP A;  4XT1 B;  3FEW X;  4A3D G;  1C0A A;  1BO0 A;  1I4R A;  1TQO A;  1SN8 A;  2FHT A;  5EGT A;  5A35 A;  3HOW H;  2XVS A;  3FRP B;  3J81 E;  4KD3 A;  1S5B D;  3CRK C;  4XIG S;  3U50 C;  1UE7 A;  2F0L A;  1GUW A;  2JJQ A;  1LT4 D;  2A68 C;  4LWC A;  1EQV A;  1RTN A;  2EYP A;  3FHW A;  1X6O A;  3Q0A A;  1E1O A;  3P1H A;  4IUN A;  4L63 B;  5DM6 3;  4A3K G;  1VMP A;  3OTO Q;  2JA5 G;  3R2T A;  5C3E B;  3U9S A;  4CKE A;  4LK1 C;  1BBX C;  2A8V A;  2K52 A;  4GKK Q;  1YBY A;  3RZD H;  3T53 B;  2OTL A;  1OXT A;  2ZTC A;  1Y1W G;  4LFA Q;  3IRB A;  2E76 C;  1K3R A;  1STY A;  4JYA L;  1KAB A;  1WTW A;  5EAY A;  4ZUJ A;  2B2U A;  3CC2 A;  1E3P A;  4DV7 Q;  4OX9 L;  2HDL A;  1PTO D;  4FDB A;  2ZJP A;  4DV5 L;  3L0O A;  2F0M A;  3NWT A;  1L0W A;  5BN3 A;  2HCI A;  1EOV A;  4AQY L;  3NBI A;  1IKL A;  3CHB D;  3VYR A;  4CBV A;  3S1Q H;  4KHP L;  2HUG A;  3KOJ A;  2KCN A;  2KEN A;  2F0D A;  1TWH B;  3URY A;  3HOX H;  4IN3 A;  1BXT A;  2JQO A;  3PUV A;  5KYL A;  4C2M H;  4JG2 A;  1GUO A;  3VR5 A;  2AWO A;  4LF8 L;  1WTO A;  1G29 1;  3MXU A;  3PGZ A;  2E2H B;  1Q86 C;  2ENB A;  3HOY H;  2K75 A;  5KNB A;  1CFM A;  4G7O C;  4P75 A;  1I3Q B;  5IT9 L;  3PIO 3;  1VF7 A;  2AHO B;  2PI2 A;  5KRU A;  4KY6 A;  1MD2 D;  1WI5 A;  4NXM Q;  2O5J C;  3QG1 A;  2K1B A;  3HOX G;  4POF A;  2K32 A;  1YHB A;  2QDB A;  4RH6 A;  1H9J A;  3WOE A;  2Y0S E;  3HKS A;  4OO1 H;  3OMC A;  4X3K A;  1STG A;  1S5F D;  2JP1 A;  3VYU A;  1RIP A;  1B53 A;  1PLF A;  5AFW A;  2K04 A;  3RMH A;  1Q7Y C;  4HED A;  2Q2I A;  5LL6 X;  1Z6H A;  4ZKC B;  3HOU H;  1LTB D;  3J7A V;  2Z6B A;  1YHA A;  3I7F A;  1QUQ A;  2LKV A;  5JEA J;  4QB4 A;  2B2T A;  2VNU D;  3UI2 A;  1G8Z D;  5ELE A;  1I4G A;  4C3I B;  2XSC A;  1EIG A;  1Y8P B;  4BY1 B;  2J4X A;  3KDF B;  1Q8I A;  5JAV A;  4OO1 G;  2EDG A;  1RHP A;  3IKJ A;  3W1G A;  4CJ0 B;  1TS5 A;  1ENA A;  4GKK L;  2L0C A;  4PZ6 A;  1F77 A;  4AYB G;  3E6Z X;  2OF1 A;  5LMN W;  3PUZ A;  1MGS A;  1WTX A;  3K58 A;  1A6X A;  3HOU G;  2XRQ D;  3SK6 A;  5E7N A;  4X3U A;  2AQ1 B;  2CW0 D;  4JI7 Q;  1PH6 A;  4H0L C;  3M7G A;  2MNA A;  3SVM A;  5C0X I;  3HOZ H;  1WYD A;  3KF6 A;  1EFI D;  4C3H B;  4JI3 Q;  3MHB A;  2F4V Q;  3E9I A;  4JI4 Q;  1JOK A;  4MZ9 A;  2CWP A;  4A3M G;  3I4M B;  2I0Q A;  1Q3L A;  4EVO A;  4H02 A;  2RVL A;  2K5V A;  2E2I H;  1HHV A;  3GTG B;  1QCB D;  1FD7 D;  3KF6 B;  1N36 Q;  4OHJ A;  2R93 G;  3J81 c;  4A4I A;  1SYB A;  1SFO B;  4A3E H;  2BA1 A;  3WWV A;  4GLV B;  1Y1V H;  1LTG D;  1O80 A;  3I4L A;  1HFG A;  3S14 B;  2Z9H A;  3W3A A;  1YIJ A;  3CAM A;  2Q2U A;  4R4I A;  4KJO A;  2UXC L;  3V2T A;  5ELN A;  2JA8 H;  2ZT9 C;  1N34 Q;  3C1E A;  1K8A C;  4G7H C;  4A3I H;  1FJG Q;  3CME A;  1WTR A;  5M3F H;  2JK8 A;  2VXW A;  1AW7 A;  2YTX A;  4QQB X;  1AFP A;  4DV6 L;  4HN7 A;  3S1R B;  3GDE A;  4DK0 A;  3M4O H;  1ML0 D;  2NN6 I;  1I5F A;  1Y1V G;  3D4R A;  2DJG C;  4XT3 B;  5D3I B;  3CCJ A;  3VR2 A;  4ABN A;  1DD2 A;  1K83 H;  3UDG A;  1N9W A;  3RZO B;  4B3R L;  3UE0 A;  3S9W A;  4DKA C;  1E2V A;  1PYB A;  2JEB I;  3STB D;  1AH9 A;  4RKL A;  4FYD A;  1DON A;  2NTS A;  3OIQ A;  1EOT A;  2LY7 A;  1K9M C;  1Y8N B;  2ICE C;  5JJI A;  2O5I C;  1I6H B;  2R92 G;  1C8C A;  2IW3 A;  1WFQ A;  1V1Q A;  4RWS C;  3RN5 A;  1R4Q B;  5C0X G;  2WB1 E;  2HD3 A;  1X9N A;  4B9X A;  3H3V I;  1ET6 A;  1M4V A;  4L5S A;  1Y8O B;  3D6W A;  1HJP A;  3B6Y A;  3SK8 A;  4DUZ Q;  2B2U C;  4O2D A;  4GOP B;  2TMP A;  4DR6 Q;  1XMQ L;  2JEA I;  3AMU A;  4KK7 A;  2F4I A;  3I90 A;  4RGM A;  1FGB D;  3H0G B;  4XQN A;  4WRD A;  3TS2 A;  1TR5 A;  3BU2 A;  3BVM A;  2PZU A;  1I4Q A;  1DZ1 A;  1JWU D;  1JT8 A;  5IY0 A;  1LAB A;  1U5K A;  5BN5 A;  3DWQ A;  1LAC A;  1MIU A;  4DR2 L;  2WP8 J;  1ZEQ X;  4IUQ A;  2H4O A;  1JOR A;  5E4X A;  1DCZ A;  1O78 A;  1D2B A;  3CP0 A;  4K14 A;  4OGQ C;  4IUU A;  1L1O C;  1HR0 Q;  1VDZ A;  2NN6 G;  1DM0 B;  4JW0 A;  2XN9 C;  4QIW E;  3G48 A;  4A3C G;  2PCF B;  2K28 A;  5CV7 A;  3CW2 C;  1SE2 A;  1W6J A;  4IJH A;  2EPB A;  1XNR Q;  1IBL Q;  1E22 A;  2KCC A;  4DV0 L;  3HP3 A;  4KN7 C;  5C4X H;  2PPB C;  1QVC A;  5EPJ A;  2NVX B;  1SMY C;  1NUC A;  3SGI A; 
#chains in the Genus database with same CATH homology
 4C1N K;  2QCP X;  5JJZ A;  3SHL A;  1LT6 D;  3NBH A;  1KTK A;  2HDM A;  3WDN A;  4IFD H;  3H94 A;  2F0H A;  5I6Y A;  1STB A;  4IUT A;  3GTK B;  1CQV A;  1STH A;  1GUG A;  5CR3 A;  1GHK A;  3A8J E;  3OIP A;  1EU3 A;  4WFN 3;  2Y0S B;  1I4H A;  4V19 0;  4IFD G;  5C44 B;  1D1K A;  1TT2 A;  2NYZ D;  5ELC A;  4DU9 A;  3I3C A;  3I4N B;  1UUP A;  2F0W A;  1G2S A;  4Q5V A;  3SK5 A;  3S2D B;  4UAI A;  1I4P A;  1PZK D;  4ZKB B;  4HMI A;  2R6G A;  3CRL C;  1Z47 A;  3I70 A;  4F87 A;  2MPM A;  3J7A F;  3M85 A;  4JBW A;  1SDF A;  3GTM B;  1BCP F;  5CV8 A;  5M5Y B;  3SE0 A;  3VYS A;  3PMF A;  1S5C D;  5CBA E;  4FVM A;  1IKM A;  2IPK D;  2JA5 B;  5I9P A;  2EOT A;  2X6L A;  1EY6 A;  3KBG A;  1QIL A;  2ID0 A;  1M8A A;  5JPM C;  1A3U A;  3U9O A;  1EY4 A;  4V0B A;  2ZXP A;  1S5D D;  1Y1W B;  2F0F A;  4Z9C B;  3NPP A;  1STA A;  1D6E C;  5FLX E;  3GTQ B;  3H6M A;  2IX3 A;  4IUV A;  2EJG C;  1H9R A;  1NR2 A;  3K5M A;  4DK1 A;  1H9M A;  3RLF A;  4HTH A;  2FMC A;  3M7N A;  5LL6 S;  1RTO A;  1EQT A;  1MSG A;  2ZXO A;  3BVZ A;  1R9T B;  1HUN A;  2DY8 A;  4M8A A;  1F2M A;  3GTO B;  3HZX A;  4PMW A;  1ESR A;  2PZW A;  3KK7 A;  1Q1E A;  3NTK A;  1TS3 A;  2HQE A;  3K5N A;  3VA7 A;  3R8B A;  3ITP A;  2RA4 A;  3DWP A;  2E74 C;  2Q8R E;  5EKL A;  2KVM A;  4C2M B;  5EKI A;  2IT1 A;  2WB1 B;  1TY0 A;  1B9N A;  1KLU D;  4QUF A;  3MAQ A;  1RKN A;  1I4X A;  1WD0 A;  3K57 A;  4RCO A;  1RCV D;  2F0J A;  5JEA H;  4HSV A;  4X3S A;  2SOB A;  1T5E A;  4KHZ A;  5HGT A;  4DAY A;  2FFK B;  1QWY A;  1PTO C;  3J7Y W;  1JQY D;  4PQX A;  2CQA A;  2KQ3 A;  3NQI A;  2JSO A;  1F9S A;  5D65 A;  3OPO A;  1G6Z A;  3Q6S A;  1PTO H;  2E2J B;  3TP5 A;  2F0Q A;  5NUC A;  2SNM A;  2Z8L A;  5JEA G;  5EBD A;  4DA2 A;  3EQL C;  4A3M B;  2EY1 A;  5D3D A;  5K36 G;  4TQU S;  1F2Z A;  3MVV A;  1NR4 A;  2J0T D;  4HCS A;  1D5X C;  4ZLT F;  4J6H A;  2JA7 B;  4DXG A;  2R93 B;  1AZQ A;  4DNT B;  3A56 A;  4RA8 A;  3GTL B;  4O1N A;  2NVT B;  1SNO A;  1Q1B A;  3PUY A;  3QJY A;  3IAY A;  1FR3 A;  1H9S A;  3R2I A;  4KY5 A;  1V1O A;  2VUM B;  5DM7 3;  3G6J B;  3Q24 A;  1V8Q A;  5I6W A;  1LTR D;  3TDQ A;  4A3F B;  4KMU C;  1SSO A;  4FNF A;  1H9S B;  3ERO A;  1EWH A;  2AUJ D;  1WTP A;  1ONL A;  4DAV A;  3R93 A;  1KAA A;  1TU2 B;  3IL8 A;  1JOO A;  4HMJ A;  4K5V A;  3TP8 A;  5C3W A;  3T56 B;  2A5H A;  1OXS C;  2CW0 C;  4KY7 A;  2F0S A;  2R92 B;  1CT1 D;  2RDG A;  2JA6 B;  2YU9 B;  1MBY A;  2Z4I A;  1DOL A;  1SAP A;  1BUV T;  1TS2 A;  2RSN A;  4CGY B;  2EYJ A;  1K83 B;  1X3P A;  4U68 A;  1RJT A;  1F9P A;  4F88 A;  2NVY B;  4OO1 I;  2Q8I B;  1UEA B;  1HTL D;  3D6C A;  1RDP D;  2PMZ B;  1EU4 A;  4RGT A;  1GJX A;  1E0B A;  3DMU A;  2F0V A;  1F2L A;  2NZ1 D;  3FVQ A;  4PMB A;  4DFA A;  3M3Y B;  1JB3 A;  4LJZ C;  1IW7 D;  1QE6 A;  3S1N B;  2PW5 A;  2A73 B;  5T1I A;  3QOJ A;  3GD7 A;  2PQE A;  2EYO A;  4E6I A;  1HRJ A;  3I91 A;  2AQ2 B;  5J22 A;  4IZ8 A;  4XYO A;  2QIL A;  3P20 A;  2XRS D;  4QF4 A;  5ELD A;  3VR6 A;  1CI3 M;  3DXJ C;  3MFY A;  2NTT A;  4MIU A;  2BE5 D;  1C4Q A;  4L8J A;  2MHV A;  3A7L A;  4FF1 A;  1KDA A;  2M00 A;  5G3L F;  3NQT A;  3K5O A;  1JWM D;  2CHB D;  1CK1 A;  3GTP B;  3NK9 A;  4OIJ A;  1ENC A;  3NWS A;  1JOQ A;  2A6E D;  5IGG A;  1I50 B;  4DNR B;  5KND A;  1LT5 D;  1YNJ D;  2I07 B;  4R9W A;  2A6H D;  2NUC A;  1DYQ A;  4KI0 A;  4XQJ A;  3H91 A;  2IJ0 A;  2F0P A;  5M3M B;  1ZYR C;  2IX1 A;  2WV6 D;  1HA5 A;  3SK4 A;  4KTA A;  2B63 B;  5C4J B;  3FKI B;  4G57 A;  3MXP A;  4RFB A;  2M9V A;  2F0T A;  1DOM A;  1KNA A;  1LO5 D;  3DEO A;  1SNP A;  2DN8 A;  5DNF A;  3BYY B;  4RGO S;  5CC4 A;  5JVG 3;  3K6O A;  2FJ2 A;  2IWH A;  1F9Q A;  4XQQ A;  3FDT A;  4QCL A;  1SNQ A;  1O7L A;  1JWS D;  2JYO A;  2AQ3 B;  2F03 A;  3OWF A;  5FLX L;  3Q22 A;  1WCM B;  4NKL A;  3OSO A;  2F0N A;  5M5X B;  4KN4 C;  1PMR A;  1S4Z A;  1TY2 A;  2L4N A;  3ONA B;  1TWG B;  5CMD A;  4A3B B;  1IL8 A;  1U4P A;  1XWE A;  1ILQ A;  1TWC B;  4HSP A;  4RGN A;  2K6A A;  1WD1 A;  1J9O A;  3ZYY X;  2IL8 A;  5LHY 1;  3QO2 A;  1EZ6 A;  5C4Z A;  5IGC A;  5IOC A;  4CHT B;  4BA1 I;  5ISR A;  2A69 D;  4BBS B;  1JE4 A;  3GP7 A;  4FF2 A;  1XYI A;  4XXE A;  4P2C B;  3J80 E;  4ID6 A;  5BN4 A;  2WAQ B;  3LWE A;  1D5Z C;  4IFD I;  3A54 A;  2RSO A;  1I6V C;  4NW2 A;  1W6K A;  5IGF A;  4ZRZ A;  1PFB A;  1MSH A;  3NSW A;  2F1M A;  3MWY W;  2B2V A;  1G91 A;  3LWU A;  4EQO A;  1F2Y A;  2BCO A;  3OWE B;  3SEB A;  1FNV A;  5FO7 B;  1KLG D;  1HXY D;  1PRT B;  3VR3 A;  3N6R A;  1V1P B;  2NWG A;  2RDH A;  1SYE A;  2G9H D;  2A74 C;  1ROD A;  3WOF A;  3PO3 B;  4S3S A;  3MFG A;  1PRT F;  2EJM A;  1B3A A;  5IIF A;  3MA2 B;  4WOR A;  1SE3 A;  2B2T C;  4F8M A;  1LLR D;  2B2W A;  5C5L A;  4ZK9 B;  4KD4 A;  1OXV A;  3MEH A;  2F0G A;  3D8G A;  2K5D A;  1UNS A;  5D14 A;  1PFM A;  4DF7 A;  4C3I G;  1HUM A;  2YYZ A;  1IHZ A;  1HPC A;  3N52 A;  2DY7 A;  4Q0F A;  4RCN A;  1LV9 A;  4BWG B;  1SYG A;  3L9A X;  3EJI A;  4CKC A;  1Q90 A;  5ELB A;  1X32 A;  1HFN A;  1MI2 A;  1BCP B;  1TKW B;  4A3D B;  2M2L A;  5ELF A;  1XX8 A;  2PNR C;  3OOC A;  3TZD A;  3HGB A;  2F3V A;  4C3H G;  1A2T A;  2R61 A;  4EGV A;  1K8M A;  3MXN A;  2RBM A;  4ULL A;  2VB3 X;  5E1F A;  4A3K B;  3E5S A;  3PUW A;  5G3L D;  3NTI A;  5CV9 A;  4ZQ3 A;  5C4H A;  1J8I A;  2F0K A;  4B9W A;  3HOW B;  1EEI D;  2K05 A;  4OL7 A;  3TP7 A;  3AB9 A;  3X3M A;  1EEF D;  3LNN A;  2K03 A;  2F0I A;  3RD4 A;  3SXH A;  4K8I A;  5KNC A;  2DNC A;  3Q23 A;  3DEP A;  1PZJ D;  2EYM A;  3QB3 A;  4CJ1 B;  3K5L A;  5M9O A;  1D5M C;  2OT2 A;  3RUZ A;  2EVB A;  3IFD A;  4I65 A;  3O13 A;  3KLS X;  2F0U A;  3RZD B;  4X3T A;  3MZ5 A;  4FP5 D;  2B39 A;  3I72 A;  3D4D A;  5FO8 B;  2X69 A;  2K5Q A;  2D62 A;  1ICW A;  5EPL A;  2AWN A;  1PFN A;  2C9O A;  2J7Z A;  2OXP A;  3NE5 B;  3DUZ A;  4U67 3;  4K2K A;  1OXX K;  1E2W A;  3BS1 A;  3FPU B;  4WJW A;  3S1Q B;  3A7A B;  4K2L A;  5T1G A;  4F7X A;  2ZXR A;  3HOX B;  3NHH A;  2Z1C A;  3KBX A;  4K5W A;  2F0O A;  1R4P B;  4FXK C;  1II3 A;  3HOY B;  3T13 A;  1EY7 A;  2B2V C;  4KV6 A;  1GUT A;  4EQN A;  4FF3 A;  4XTC S;  5CYU A;  1CTM A;  4O42 A;  1CM9 A;  1FYC A;  2RKS A;  2PYK A;  1G2T A;  4KJN A;  2LMC B;  3EFX D;  1U4L A;  1B4O A;  4AYB B;  3I8Z A;  2KOL A;  5KIX A;  5JPN C;  3HOU B;  1CZG A;  4EQP A;  1IW7 C;  5J39 A;  1H9K A;  5FKA C;  3HG9 A;  4J8Q A;  1GUN A;  2RQX A;  2L9H A;  3PIP 3;  1O7Z A;  2B2W C;  2L12 A;  1TVX A;  2SNS A;  3KF8 A;  2KEE A;  2MUY A;  4ZAI A;  1QB5 D;  1T5X D;  2D5D A;  1FNU A;  1X3Q A;  3M4Y A;  2BDN A;  5CGK A;  2EYH A;  5JOB A;  3HOZ B;  2BE5 C;  1EY8 A;  3L7Z C;  1WTQ A;  1HA6 A;  4R8N A;  4HCE A;  1PXU A;  1VF5 C;  4KKT A;  4CJ2 C;  2IX0 A;  2SDF A;  3K59 A;  2E2I B;  4BS9 A;  1EYC A;  5KYI A;  1E2Z A;  4JK1 C;  2MP1 A;  2XIW A;  4C3J G;  4A3E B;  3VR4 A;  4QUC A;  2A6E C;  1V43 A;  2TSS A;  1STE A;  3NUC A;  1Y1V B;  2R3Z A;  1YNJ C;  3MC0 B;  3C1F A;  2A6H C;  1S5E D;  2JA8 B;  1HCZ A;  2F0E A;  3C3L A;  2N55 A;  4A3I B;  3J80 L;  5M3F B;  4N9P A;  4DN4 M;  1YNN D;  4LAA A;  1BNZ A;  2N88 A;  3M4O B;  3BYT B;  3DHQ A;  5IGB A;  1PRT D;  4NP5 A;  3VYT A;  1SNC A;  5C3X A;  2C5C A;  1AZP A;  4ZYS A;  1STN A;  5EKK A;  5I4D A;  4TSS A;  3KUP A;  1L0X B;  4FXG C;  2K7V A;  1NSN S;  3PO2 B;  3GQB A;  2EE1 A;  3GV6 A;  1QNU A;  2L55 A;  1QOH A;  3DWA A;  2K01 A;  4K6L A;  1WVL A;  5COR A;  1KDC A;  1QNK A;  1B9M A;  4M1U B;  2BDO A;  1GHJ A;  4XDX A;  3S16 B;  2LS0 1;  5F2D A;  1LTS D;  1EZ8 A;  2MGS A;  5FK9 C;  5IGE A;  4J1M A;  4DGZ A;  4N9T A;  2EY2 A;  1BR9 A;  3ERQ A;  2MJ8 A;  2SEB D;  1EY5 A;  1EYD A;  1O7Y A;  3BVG A;  1KDB A;  5JVH 3;  1HQM C;  3PV0 A;  5COY A;  1BCP D;  5IOD A;  4KHV A;  2JXM B;  2XNA C;  2NB0 A;  2A69 C;  4I7Z C;  4TRD A;  4NMZ A;  2LFN A;  2NBF A;  2WKD A;  3T16 A;  4OIK A;  1Y69 U;  4PMC A;  5C4X B;  1SEB D;  3D31 A;  1CA5 A;  1F9R A;  2VB2 X;  1B1Z A;  1LTI D;  3C46 A;  1XXG A;  2AUK A;  3T4A C;  4MN3 A;  3NP8 A;  1HTP A;  4BY7 B;  1SNM A;  5A2Q E;  3TME A;  2A68 D;  4IAL A;  1B44 D;  3VA5 A;  1EWC A;  3SR1 A;  3MXG A;  1DXM A;  1OXU A;  2G9D A;  5TSS A;  1D1I A;  1JC7 A;  1GXD C;  1EYA A;  2PW7 A;  4R8I A;  1BOS A;  1SYF A;  4A3G B;  4H13 C;  5CBE E;  4Y7N B;  1PZI D;  3ND9 A;  5EQ0 A;  1EY9 A;  2WAC A;  1SND A;  4RAU C;  3KLR A;  5EJW A;  2B2Y A;  1K8O A;  3ND8 A;  3CQZ B;  3TSS A;  3S15 B;  1ET9 A;  1TS4 A;  1VMC A;  4ME5 A;  3EVQ A;  5IGD A;  1KNE A;  4B08 A;  1RD9 D;  3SDZ A;  4FXD A;  3GTJ B;  1B2T A;  1RF2 D;  4K8J A;  2R7Z B;  1NAP A;  1JR0 D;  4XYQ A;  1TII D;  1ILP A;  1PDQ A;  2D2C C;  2KA7 A;  5FOB B;  5E3F A;  2I46 A;  4KKU A;  3HRZ C;  1A3T A;  3OW7 A;  3S2H B;  4K5X A;  5C0X H;  4H7B A;  1JCK B;  3P75 A;  3A8I E;  3E0J A;  1SJH D;  5I2Y A;  1A2U A;  1ZXT A;  3LX0 A;  2KHS A;  4FO2 A;  5EBC A;  4ILW A;  4IUP A;  1SE4 A;  3QIA A;  2Q8T A;  1JIC A;  5K5P A;  1A3V A;  1C48 A;  3P7J A;  2NN6 H;  3A55 A;  4RKB A;  2QEJ C;  1BQQ T;  4C1N I;  1V1P A;  1ZYR D;  2KEC A;  3S1M B;  1VCI A;  2WKC A;  3PUX A;  2FMM A;  3GV3 A;  3FMC A;  1XTC D;  3DM1 A;  5KEE A;  1OO9 B;  5C6A A;  3TZU A;  3W2D A;  3BG3 A;  1GUS A;  2RDF A;  3FPP A;  3R3O A;  3H3V C;  1ENF A;  2XWJ B;  2ICI A;  2JE6 I;  3C2P A;  5DEH A;  2V4D A;  5I9O A;  4IUR A;  3GO5 A;  4RHR A;  3QWN A;  1LTA D;  2EXZ A;  3HOV B;  4IQZ A;  5HUR A;  5IT9 E;  1PTO B;  1EL0 A;  2B8F A;  1ZKO A;  1WTV A;  1U4R A;  3X3N A;  3TN2 A;  5CV6 A;  1AN8 A;  2WIN B;  2Z4H A;  5DAU A;  4PNY A;  3OMG A;  3QOL A;  1U9R A;  4BA2 I;  1PTO F;  5M5W B;  3JAM L;  2X6G A;  3TBI B;  4KKS A;  4C3J B;  1SXT A;  3J81 L;  3BDO A;  2GA4 B;  1LTT D;  1A15 A;  2D9U A;  3HEJ A;  2EY5 A;  4QMG A;  2PO4 A;  1QG7 A;  2L5T A;  2OEO A;  1GOZ A;  1CHQ D;  2E2D C;  3H09 A;  2B2Y C;  1B50 A;  1SYD A;  4H44 C;  3BZD B;  1BDO A;  2L11 A;  3A8K E;  3CU7 A;  3OHX C;  2F3W A;  4HR7 B;  1EIH A;  1TWF B;  4ZUI A;  4A3J B;  4G4K A;  3F2U A;  1HQR D;  2FIN B;  3D3R A;  2KJX A;  3NTH A;  5KGU A;  3D4W A;  5CV4 A;  5C0X J;  3K7A B;  3I73 A;  2EYL A;  3KLS A;  2BOS A;  4HAE A;  1LT3 D;  1SMY D;  1IYV A;  2CVR A;  5FO9 B;  4UDU C;  1SBB B;  3EA6 A;  1TWA B;  1AP0 A;  4TKO B;  1Q12 A;  1CA6 A;  3BDC A;  2EJF C;  1NCV A;  1SJE D;  4DXF A;  1YNN C;  4K6D A;  2H1E A;  4MHE A;  2DNE A;  3HS0 C;  3TP6 A;  4DAP A;  3S17 B;  4G7Z C;  3V96 A;  1PRT C;  2O4X A;  2L1B A;  2QF7 A;  1CZW A;  3NXW A;  5A2Q L;  5I2X A;  1CQF A;  5EPK A;  4LMQ D;  1EY0 A;  3L3O C;  4RHS A;  4ODG A;  3G7L A;  3BDL A;  4PV1 C;  5J1Z A;  2E75 C;  2KUM A;  4FF4 A;  3CKI B;  2K5W A;  5K36 H;  3AU7 A;  4YIJ A;  3V05 A;  4BBR B;  1SYC A;  4CKB A;  1IYU A;  2KED A;  3T51 B;  1UAP A;  4IFD J;  4NDX A;  2K33 A;  1FNW A;  3IFT A;  1CHP D;  1DJR D;  1BF4 A;  4GZY C;  2O2L D;  5C5M A;  1PYW D;  3K0Y A;  2NVQ B;  4QIW B;  2QKI C;  2PZT A;  1BCP C;  4C56 C;  4A93 B;  1AEX A;  1Z7T A;  4L6T B;  1QJO A;  1U4M A;  2XWB B;  2EYF A;  2WII B;  2EZV A;  1ESF A;  5E4W C;  2EY6 A;  1DOK A;  2HCC A;  3HKZ B;  5CV5 A;  2BA0 A;  2B8G A;  1L0Y B;  3JAM E;  3MTS A;  4XT1 B;  3FEW X;  1BO0 A;  1I4R A;  1TQO A;  2FHT A;  5EGT A;  5A35 A;  2XVS A;  3FRP B;  3J81 E;  4KD3 A;  1S5B D;  3CRK C;  4XIG S;  2F0L A;  1GUW A;  1LT4 D;  2A68 C;  1EQV A;  1RTN A;  2EYP A;  3Q0A A;  4IUN A;  3P1H A;  4L63 B;  5DM6 3;  1VMP A;  3R2T A;  5C3E B;  3U9S A;  4CKE A;  4LK1 C;  1BBX C;  3T53 B;  1OXT A;  2E76 C;  1STY A;  1KAB A;  1WTW A;  4ZUJ A;  2B2U A;  2HDL A;  1PTO D;  2F0M A;  3NWT A;  5BN3 A;  2HCI A;  3NBI A;  1IKL A;  3CHB D;  3VYR A;  4CBV A;  2HUG A;  2KCN A;  2F0D A;  1TWH B;  3URY A;  4IN3 A;  1BXT A;  3PUV A;  5KYL A;  3VR5 A;  1GUO A;  2AWO A;  1WTO A;  1G29 1;  3MXU A;  2E2H B;  2ENB A;  5KNB A;  1CFM A;  4G7O C;  1I3Q B;  5IT9 L;  3PIO 3;  1VF7 A;  5KRU A;  4KY6 A;  1MD2 D;  2O5J C;  3QG1 A;  2K1B A;  2K32 A;  2QDB A;  3WOE A;  4RH6 A;  1H9J A;  4OO1 H;  3OMC A;  4X3K A;  1STG A;  1S5F D;  2JP1 A;  3VYU A;  1B53 A;  1PLF A;  5AFW A;  2K04 A;  3RMH A;  4HED A;  5LL6 X;  1Z6H A;  4ZKC B;  1LTB D;  3J7A V;  2LKV A;  5JEA J;  4QB4 A;  2B2T A;  2VNU D;  3UI2 A;  1G8Z D;  5ELE A;  1I4G A;  4C3I B;  2XSC A;  1EIG A;  1Y8P B;  4BY1 B;  2J4X A;  1Q8I A;  5JAV A;  4OO1 G;  2EDG A;  1RHP A;  3IKJ A;  4CJ0 B;  1TS5 A;  1ENA A;  2L0C A;  1F77 A;  3E6Z X;  2OF1 A;  3PUZ A;  1MGS A;  1WTX A;  3K58 A;  1A6X A;  2XRQ D;  3SK6 A;  4X3U A;  2AQ1 B;  2CW0 D;  4H0L C;  3M7G A;  3SVM A;  5C0X I;  4C3H B;  1EFI D;  3MHB A;  1JOK A;  3I4M B;  1Q3L A;  4EVO A;  2RVL A;  1HHV A;  3GTG B;  1QCB D;  1FD7 D;  4OHJ A;  1SYB A;  1SFO B;  2BA1 A;  1LTG D;  1O80 A;  3I4L A;  1HFG A;  3S14 B;  3W3A A;  4KJO A;  3V2T A;  2ZT9 C;  3C1E A;  4G7H C;  1WTR A;  2VXW A;  1AW7 A;  1AFP A;  4HN7 A;  3S1R B;  4DK0 A;  1ML0 D;  2NN6 I;  3D4R A;  4XT3 B;  5D3I B;  3VR2 A;  4ABN A;  1DD2 A;  3RZO B;  3S9W A;  1E2V A;  2JEB I;  4RKL A;  4FYD A;  1DON A;  2NTS A;  3OIQ A;  1EOT A;  2LY7 A;  1Y8N B;  2ICE C;  2O5I C;  1I6H B;  1C8C A;  2IW3 A;  4RWS C;  1R4Q B;  5C0X G;  4B9X A;  1ET6 A;  1M4V A;  1Y8O B;  3D6W A;  3SK8 A;  2B2U C;  2TMP A;  2JEA I;  3AMU A;  4KK7 A;  2F4I A;  3I90 A;  4RGM A;  1FGB D;  3H0G B;  4XQN A;  4WRD A;  1TR5 A;  3BVM A;  2PZU A;  1I4Q A;  1DZ1 A;  1JWU D;  1LAB A;  5BN5 A;  3DWQ A;  1LAC A;  2WP8 J;  1ZEQ X;  4IUQ A;  2H4O A;  1JOR A;  5E4X A;  1DCZ A;  1O78 A;  1D2B A;  4K14 A;  4OGQ C;  4IUU A;  1VDZ A;  2NN6 G;  1DM0 B;  2XN9 C;  2PCF B;  2K28 A;  5CV7 A;  1SE2 A;  1W6J A;  2EPB A;  2KCC A;  3HP3 A;  4KN7 C;  2PPB C;  5EPJ A;  2NVX B;  1SMY C;  1NUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...