2L55A

Solution structure of the c-terminal domain of silb from cupriavidus metallidurans
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
82
structure length
82
Chain Sequence
GPEHRAVGRIQSIGERSLIIAHEAIPSAQWGAMTMEFAAPPAGLPQGLKAGDRVAFSFRLDPHGMATLVTVAPQVQTAGAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SilB,Silver efflux protein, MFP component of the three compo
publication title Structural and Metal Binding Characterization of the C-Terminal Metallochaperone Domain of Membrane Fusion Protein SilB from Cupriavidus metallidurans CH34.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Metal binding protein
total genus 13
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l55A00
2QCPX 2L55A 1ZEQX 2VB3X 3E6ZX 2VB2X 3TDQA
chains in the Genus database with same CATH superfamily
3FKIH 1K3BC 4QQBX 3J81c 4ULLA 1VQJA 4LUVA 2K04A 4A3IB 3SR1A 4RCOA 2B8GA 1FNVA 2B2YA 4TSSA 1BF4A 3MFGA 5CMDA 1BCPC 1NNXA 1J5EQ 5FKAC 4LF6Q 1D2BA 4OELB 2Z8LA 4KD4A 3PCOB 5IYCH 2IX3A 5FLMH 3CCRA 2JA8B 4ZQ3A 1AW7A 1VQ8A 4K6LA 1EYAA 3L0OA 4DAVA 1XMQL 1LACA 1P8LA 1NJIC 4ZUJA 1YJNA 4NP5A 1AE2A 4LFBQ 2IW3A 3KJPA 1VMPA 4PMCA 4DR3L 3HOWH 1J8IA 4BY1B 2UU9Q 2CKZB 2M9VA 2R7FA 1E2WA 1PRTF 1YZ6A 1EY4A 2MUYA 2WV6D 4RAUC 1GO3E 2X69A 2C35B 3GTPB 5ELDA 3W1GA 1LT4D 1ZYRC 1YHAA 2L0CA 1X3FA 1UEBA 5I2XA 2TMPA 4R4IA 2KQ3A 3HOWB 5C5MA 1R4PB 1GJXA 2HQLA 3T4AC 5FO9B 4PG3A 1XMQQ 2NVYB 1CQVA 4WFN3 1L0XB 4KY6A 1JWSD 3NBIA 5E4WC 4DAPA 2E2JB 1DM0B 2P5ZX 2F1MA 2HIXA 1K9MC 3Q23A 4DR3Q 1Y1VB 4A3DB 2ALYB 2QEXA 2YV5A 2X6LA 1DJRD 2R7ZH 4LWCA 1B50A 1EEID 4BWGB 4JI5L 4CJ2C 5CR3A 3D3RA 5M3MB 2A6HC 3SDZA 1LUZA 3Q0AA 1OXXK 1AN8A 4B9WA 3J7ZC 4A3CH 5T1IA 3PUXA 4CDCC 1B3QA 3M4PA 1HFNA 2KCNA 4QJFA 5F2DA 3GTJB 5EKKA 4I7AA 1IKLA 1ESFA 1JOOA 1WCMH 2L9HA 1EL0A 2E74C 1VQCA 4JK1C 4IPHA 3J7AV 2NZOA 2JA8G 3LWEA 3OW2A 3CW2C 1UE5A 3I4NH 1EY6A 3H3VI 3UI2A 5IT9E 1EU3A 1Y1WH 1TS5A 1EFWA 4JI5Q 2K5HA 3RLOA 4Y52H 5DEHA 4AH6A 4A3KB 2ICIA 1GD7A 3OW7A 4BY1G 2EZVA 1SE8A 2F3WA 2L5TA 4HAEA 4X65L 2K5WA 5KNCA 2Q2TA 1KXLA 1XTCD 4IUTA 5KNDA 3NQTA 1CZWA 3HGBA 2F0KA 3J80E 2K5DA 1L0YB 2KEEA 4H13C 5EPLA 1IXRA 3A54A 4J15A 1FGUA 1LT5D 4LF7L 2PPBC 1VS0A 1PFBA 4KMUC 3K8AA 3HZXA 4DNIA 1J6QA 4X62L 1HHVA 4IUVA 5C4JB 5IYDH 3S2DH 1CKOA 1Y1VG 2GA4B 2I5MX 3MAQA 4A3DG 2R93B 3KYHC 1EZ8A 4JI0Q 5JVG3 4X65Q 4E6IA 2RA4A 2RDGA 4GOPC 3IFTA 5M3MG 3MWYW 2EJFC 2AWNA 1PZKD 1MHWC 2BOSA 2HCIA 2B2TC 5IGGA 1II3A 5IGBA 1ET9A 3K57A 2LFNA 1BVSA 1CQFA 3S14H 2DGYA 1KQSA 4HMIA 1HXYD 1LO5D 3T16A 1SE3A 1SMXA 1HR0L 2PYKA 3CPFA 4DAMA 3H3VH 1PH4A 4LF7Q 4V0BA 2N49A 1PTOB 2QDLA 4JBJA 1GKHA 4X62Q 3PUZA 1CFMA 1KNEA 4JG2A 4AYBG 2XWJB 2Z4HA 3CCEA 4IOAA 3CC7A 1LTAD 2CQAA 4JI6L 4OWWB 5I2YA 1LYLA 2HT1A 4J6HA 3MZ5A 2WFWA 1JMCA 2A6ED 4QF4A 5KRUA 4DV6L 4R9WA 4QIWE 4LFCL 2A68C 2NYZD 1HR0Q 2ZXRA 1GM5A 3QOJA 1TKWB 3EN2A 2VY3A 2D0OA 3P1HA 1X32A 4HIMA 5K36H 3CMEA 2X6GA 1W6KA 2FHTA 5GQOA 1B53A 4P73A 3RZDB 1EQRA 1TR5A 1D7QA 3EVQA 2ES2A 3PIO3 4JVZA 3HOXH 1TU2B 1PH8A 1NUCA 3FEWX 3CCVA 2UXCQ 4OONA 1EYCA 4LF5L 2BDNA 2Q2HA 3KDFB 1U0LA 2CQOA 3PV0A 2R93G 1TT2A 2A69C 2EYFA 3WWVA 3VA7A 1X3QA 2K03A 1FL0A 5C44H 2DNEA 3AB9A 3BVGA 4EQOA 2F0EA 4M8AA 4DV6Q 4A3MH 3HS0C 1EIGA 4OHJA 4LF8L 4LFCQ 1C0AA 3HKZG 1QNUA 3BVZA 1WTQA 1IW7C 2A1AA 4JI8L 3I4MB 4HMJA 3R3OA 2EJGC 1K73C 4NXML 3CD6A 3L9AX 2J7ZA 2L15A 4LW1A 4C3HB 1XMOL 1FVIA 2Z6KC 4GLXA 4LF5Q 3HKSA 3RZOH 4BBRH 1WJJA 2DN8A 2RDHA 4L5QA 1SNDA 3PIP3 3GTQB 2XWBB 1LTTD 1YJWA 1YHQA 3I70A 2OWOA 4X66L 2JA6H 4A4IA 4OO1G 1B7YB 1C48A 1F9QA 2Z6BA 1KDBA 3X3NA 4A3JB 1RCVD 4LF8Q 5IOCA 2NVTB 3U4ZA 3AFPA 5CV6A 2AQ2B 2KHJA 3LGJA 2XVSA 4JI8Q 1M4VA 3FP9A 1HNZL 2CW0D 4LMQD 3GTMB 4NXMQ 3TN2A 1WTWA 5CORA 1X56A 4JI2L 3U9OA 3MXNB 2K5NA 3SK4A 1ZEQX 1XMOQ 1FYCA 2IPKD 1E22A 4DR7L 2F0WA 4ILWA 5FOBB 5DM63 2DNCA 4A76A 1KIXA 3UDIA 2D62A 3OWFA 4U68A 1YNNC 1RKNA 1E2VA 1YNJC 2K05A 4KKUA 5CC4A 3RN2A 3GTLB 4RGTA 5EBDA 4X66Q 3PGZA 5EKLA 3CMAA 3PO3B 2RQXA 3H09A 1PRTC 3A8KE 3S1NH 2JA9A 2B63H 4RGOS 1N34L 5CV8A 5M5WH 1HNZQ 1MI2A 3UE0A 1SBBB 3GV6A 3D4WA 1SNCA 4B3RL 2KOLA 4ZLTF 3S15B 1BBWA 3HOYB 2MO0A 3I4MG 1X54A 4JI2Q 1SSOA 4OIJA 4POFA 1D1IA 2I0QA 1B44D 1BCPB 4B3TL 1W3SA 4DR7Q 1MSHA 2NVXB 4IPCA 4ZAIA 1JT8A 1JWMD 5A2QL 1EIYB 3HOVB 4ABNA 4AIMA 1LTID 2MPMA 5ELCA 1ICWA 4C3HG 5KIXA 1K0SA 3LNNA 1S40A 3RUZA 3OHXC 4WJ4A 2EYHA 2B2VC 3CXCA 4ME3A 1QWYA 1N34Q 4YWLA 3NPPA 1WYDA 3QJYA 2KBNA 1R9TH 2Z1CA 1LM0A 4B3RQ 4DA2A 1NR4A 3VA5A 3W3AA 4RMFA 4IUQA 5IGEA 3M85A 3KDFA 4X3TA 1PH7A 2KENA 4B3TQ 3GTGH 2KUMA 1VQOA 5IWAL 4DR6L 1F2LA 2LKVA 1PXUA 3ND9A 1HCZA 4TVAB 3JAME 2NB0A 4Z9CB 5DLQE 3ULPA 4N8X1 2KCCA 3STBD 1I4HA 3H3VC 3JAMi 3MXGA 1A3TA 5M5XH 1E3PA 2JSOA 2OQ0A 1B9MA 2XSCA 4QL5A 1JC7A 1T9HA 1TVXA 5DNFA 4ZUIA 5CBAE 3N52A 2O5IC 2R92H 3NENA 5IWAQ 1TWFH 2OT2A 4DR6Q 1PTOD 3T1HL 2FJ2A 3HOYG 3GV3A 4C3JH 3DXJC 1EQQA 1N9WA 2EXZA 3NELA 3ITPA 2O4XA 1TY2A 2KEDA 3D4DA 1TWGB 3HOVG 2WAQB 3KF8B 4AYBE 1G6ZA 4A3FH 3HOZG 2N3SA 1AP0A 1PFNA 2EY5A 2F0LA 1YNXA 3K5LA 5CYUA 4DR5L 3MXNA 1CSQA 4OL7A 3I56A 5M3FB 1XPRA 2V4DA 4O42A 3PQIA 3BYTB 1NAPA 1KAAA 3ER0A 2IJ0A 3SVMA 1HR0W 3FRPB 4QY7A 1PH2A 4GKKL 4IFDG 4KJOA 5FO7B 4XDXA 3T1HQ 1GUTA 1LT6D 5C0XG 4YCUA 1QVCA 3RLNA 4CBVA 1QG7A 1QB5D 1DOMA 5IP7G 1W2BA 1CA5A 2Q8TA 2SDFA 5JJZA 4DV2L 1I3QB 3PUWA 1B4OA 4KHZA 3L2PA 4K14A 2RF4A 2VW9A 4O1NA 2DY7A 3GTOB 4KKSA 1N8RC 2JYOA 4DR5Q 3IKJA 2PI2A 4IALA 1E7ZA 1QE6A 4A3GH 2AMCB 2DY8A 2QEJC 3MTSA 1C8CA 1DZ1A 2JA5H 3HKZE 4DV4L 1Z6HA 2J4XA 4GKKQ 4LFAL 2DJGC 1V43A 3AQQA 3HOUB 1SE4A 1OXTA 5JEAG 4XT1B 1FJGL 4N9PA 3KF6B 1C7YA 3TZDA 4DV2Q 2LXKA 3I4LA 4XYQA 4A3GB 3TBIB 1SYGA 1Q86C 1VQBA 4KY5A 1WFQA 1J9OA 2JA5B 1V1OA 1K8OA 1G6PA 2UUAL 2Z0SA 2WAQG 4L6TB 3VR4A 2WP8J 3X3MA 3CC4A 1A8VA 2WKDA 2XIWA 2OEOA 5EJWA 1FGBD 1N32L 2K7VA 4DV4Q 4B3ML 1U4PA 1LTBD 3BDCA 4LFAQ 5M3FG 4HTHA 2VUMB 3S1QB 1RDPD 1M8AA 1IYJB 4A93H 3EBEA 2IL8A 1K8AC 1I6HH 2ZT9C 3S24A 5D3DA 1FJGQ 1FNWA 4O2DA 3ERSX 1X3EA 4DK6C 2NVQH 5IYBH 4I65A 4UAIA 4IN3A 3G6EA 3G71A 3FKIB 2OQKA 1A15A 1JOKA 1TIID 1F9PA 1FR3A 3AU7A 2UUAQ 4QCLA 2EY1A 1O7IA 2N8NA 1K0RA 1VQEA 1PH1A 5LHY1 1I4QA 1G2TA 3QR8A 3CCJA 1L1OC 1E0BA 1EWHA 3EIVA 2F0IA 4FVMA 1N32Q 4A3LG 1EIHA 3OTOL 2F0OA 3MVVA 4B3MQ 2OCEA 1QJOA 4RCNA 1YI2A 1TWCH 4UP9A 4Y7NH 3KF8A 4DV7L 4IFDJ 2CH4W 1SJED 1HTLD 4DK1A 4Q5VA 3PO2H 5C0XJ 4LF9L 5KGUA 2YTVA 1NSNS 2WKCA 1BCPD 3HOUG 4U673 5E7NA 4GS3A 4TQUS 4B3SL 1PV4A 3FHWA 4ZK9B 1UE7A 1HUMA 1VQPA 3BDOA 2ZTEA 4HJ8A 4IJHA 5JJIA 4QUCA 3CQZH 1MKHA 3CRLC 1L2FA 1VF7A 4F7XA 2YTYA 1V1QA 1ZKOA 3DMUA 3DUZA 3OTOQ 2BE5D 2B8FA 1SXTA 2HCCA 1X55A 2VS1A 4MHEA 3I91A 3CCUA 3S1RH 1G8ZD 4DV7Q 1XWEA 3NP8A 2B2YC 3D31A 3NTKA 1ZYRD 4A3IG 5FLXE 4LF9Q 2C5CA 2N78A 3T13A 4A75A 5JEAJ 2IHFA 1AEXA 1SYFA 3W5OA 5GAEC 4XXEA 4DV3L 5NUCA 4B3SQ 1F77A 1U4LA 1EFID 2RCFA 5ELNA 4JBKA 2R7ZB 1EY9A 1SFOH 1HJPA 4HJAA 2RCNA 3I7FA 3TP8A 1I50H 1JR0D 3PF4A 1PTOF 3NEMA 4DXGA 4ALPA 3E6ZX 1A3UA 4DXFA 3OPOA 2F0TA 2K6AA 4K2KA 3O13A 4G4KA 1RTNA 4NB3A 1H9KA 3KF6A 2AQ3B 2KECA 5C3EH 4QB4A 1M1KC 2BA1A 4CJ1B 4OO1I 1YEZA 5EAYA 1WCMB 3BZKA 1TS3A 5IT9L 5IYCG 5FLMG 3MXPA 2SNMA 3TRZA 3I4NB 5ELOA 2CHBD 4H7BA 2G9DA 5COYA 2E2HH 3K5OA 4DV3Q 2IY5B 1R4QB 1WTRA 1Y1WB 1V1PA 2D2CC 2XNAC 3HP3A 3J80i 3HOWG 2PI2E 5C6AA 1F2ZA 4G7OC 4CDFC 3Q24A 3J80L 5CBEE 2Q8RE 1HZBA 5E3FA 1MJCA 3ZJYC 1STNA 2Y0SB 3M9BA 1OO9B 3KJOA 1PLFA 2F0UA 3SE0A 5BR8L 2EYMA 2KCTA 1QUQB 3I90A 1TY0A 3VYSA 2BDOA 5K5PA 4ZCKA 2MO1A 1VQ5A 3KFUA 4QMGA 1EWIA 4RGNA 5C4XH 2K50A 3S17H 4HJ9A 1CI3M 1FNUA 2ID0A 4IPGA 3M3YH 3FDTA 2KA7A 1SAPA 3S2DB 4DGZA 4K5WA 4JV5L 2I07B 3V2TA 4CKCA 5KYIA 3ERQA 3PF5A 2R7ZG 2A6EC 4C3IH 4QUFA 4CKBA 4DUZL 5M5YH 1WD0A 5IP9H 1XPUA 4K8IA 3PMFA 2L55A 4GLVB 4P2CB 5BR8Q 2OF1A 2E8GA 3S14B 4MIUA 4OO1H 2Q2UA 4IO9A 1Z7TA 2EJMA 3IFDA 4A3KG 4L5TA 2IT1A 4MTNA 3S2HH 3A8JE 1GUGA 1Z47A 4K5XA 4DR2L 3WOEA 3ZYYX 1KAWA 2YTXA 3H15A 1WCMG 4MN3A 3N6RA 3M4OH 1DD2A 4P72A 3K58A 3FVQA 3DWPA 2EYPA 2M2LA 4IUPA 4JV5Q 1SR3A 2DUDA 1TXYA 1EY5A 3SK6A 1F9SA 4XIGS 1CT1D 3I55A 4DUZQ 3G4SA 4F88A 3U50C 1EQVA 1OXVA 1NBWA 5JJKA 1EYDA 5FO8B 4PQXA 2WAQE 1N33L 4JI6Q 2I5HA 1JOQA 4X3SA 1Q1BA 3DM3A 3SGIA 1I4PA 2HHHL 2AKWB 3DWAA 2ATWA 1MD2D 3QO2A 1KNAA 4DR2Q 2G9HD 1SN8A 4JCVE 3BU2A 4KLKA 1S72A 4WJ3M 1PFMA 3SK8A 2F3VA 1VQKA 2OTLA 3UDFA 4BY7H 1BXTA 3HOXB 4R4TA 1DYQA 3E5SA 2YU9H 5EKIA 1ENFA 1S5DD 3M7GA 2BCOA 2FXQA 4OXPA 1Y69U 3ULLA 3OWEB 1UNSA 1MIUA 3T53B 4RKBA 4HIKA 5C44B 4DV1L 1GVPA 3H0GH 1SNPA 1IYUA 3MXUA 1BCPF 3OMGA 1O7YA 3K7UC 2CW0C 1JE5A 4GNXB 3K5NA 4A3MB 1YIJA 1N33Q 1EUJA 3R93A 5JPMC 1YITA 2HHHQ 3W2DA 1QCBD 4FO2A 1HNWL 5ELBA 5GADC 4FF3A 2JA7H 2RSNA 4ZRZA 1TWAH 2RDFA 4JPBW 2PO4A 5FJ8G 3EQLC 3KLWA 2WINB 1JCKB 3C46A 1PH9A 5I4DA 1CSPA 3F2CA 3QB3A 2ICEC 4YCWA 2F4VL 2K75A 2VQFL 4IFDI 1I4GA 3TSSA 4LNQA 2LXJA 4IURA 3RZOB 4GN3B 1QUQA 3I72A 3K0YA 5C0XI 4BBRB 4KTAA 1S5FD 4BBSH 2GVAA 2JA7B 1JE4A 4ME5A 2JA6B 3DLLA 3VYUA 2B2VA 4BXXH 4RHSA 2B2WA 1D6EC 2M00A 5LL6S 2RSOA 4YY3L 1HNWQ 1EIFA 1GHKA 2G5DA 1L0WA 2BA0A 1X3GA 4CJ0B 1NMFA 1RIPA 2VXWA 4HR7B 1STYA 1RJTA 4OIKA 3FPUB 5K36G 2HIVA 2FMCA 4DNRB 2F4VQ 3TEHB 2VQFQ 3DWQA 2HDMA 5J1ZA 3J7A5 1SLJA 1EY0A 1DOLA 5DAUA 4DV0L 5CV5A 3K80C 3G7LA 1TWHH 4H0LC 1WTOA 1QVFA 3NWTA 4XQNA 5CV4A 1DXMA 4UP8A 2AWOA 5C4HA 4FP5D 3CU7A 2F0NA 2D9UA 1LV9A 1SMYD 2LSSA 4HCSA 5C44G 2B63B 1G2SA 2F0FA 3S1NB 4YY3Q 4DNTB 1O7LA 1WOCA 3CHBD 5M5WB 4A3MG 1M90C 5ELFA 4RHRA 1BNZA 4TRDA 1F9RA 1B70B 1Y14B 4DF7A 1A62A 4MNOA 2F3IA 4XTCS 1G291 1L1OB 2RVLA 3A0JA 4KV6A 4A3JG 3F1ZA 4DAYB 2ZXOA 2A19A 3D6WA 3HG9A 2YYZA 4DFAA 4UPAA 3STBC 5CV9A 1A0IA 5IP7H 2CWPA 3K0XA 4DV0Q 4A3BH 1KHIA 4J1MA 3K6OA 2F0GA 3Q8DA 3HEJA 1I6VC 3A7LA 4BBRG 2H5XA 2CVRA 2B3GA 2VZAA 3R2IA 3CP0A 3FPPA 2EXDA 1KLGD 4JI4L 2JA6G 3UDXA 5HGQA 4C2MH 5IGFA 1R9TB 5ISRA 1WTXA 1IBML 2FINB 4CDDC 3TP7A 1B8AA 5C3XA 3CCLA 1PTOC 1Z9FA 2F52A 3S1MH 4JOIA 1D8LA 3B6YA 2UUBL 3TP6A 3RR5A 3GTGB 1I4RA 5BN4A 1RTOA 2IHEA 3PO3G 5H1SE 3JAML 1UUPA 1S5ED 4YWKA 4GNXA 5HY6A 2UXBL 4DK0A 1DOKA 1X6OA 3KLSA 3J7YW 3D8GA 3SXHA 2MP1A 1GUOA 1U5KA 1AE3A 1KTKA 2F0HA 1U4MA 2DJFC 2MFIA 2ENBA 2RKSA 3MFYA 3OOCA 1IZ6A 4J8QA 4XQQA 2XGTA 3CF5A 1K83H 1HFGA 4JI7L 1EU4A 1XYIA 2E2DC 2QKIC 4YHHL 5M5XB 4JI4Q 3F2DA 1UAPA 4PZ7A 2RHQB 3H94A 4NW2A 3R8BA 4QIWB 1IBMQ 4A3EH 1DONA 2WIIB 4ZKCB 2E2IH 2B63G 2UUBQ 2IWHA 3C3LA 1NCVA 1T5XD 4YIJA 3GTKH 2R92B 1KRTA 1ENAA 2PMZB 4P71A 3UE1A 4C1NI 4ZYSA 4NXNL 1TWFB 4BS9A 2PZWA 4L5RC 3BJUA 4LJZC 1AZQA 5AJ3L 4C3JB 4EGVA 2UXBQ 3UDGA 4YWMA 1SYCA 3IRBA 2OTJA 3PUVA 2Q2IA 4G7ZC 3J81E 1Y8NB 3PUYA 2AUJD 4FF1A 4A3FB 3S16H 4NMZA 2CFMA 1E1TA 1ASZA 4EQ5A 5DM73 4JI7Q 1JORA 4OWTB 4GN4B 3K7AH 4UP7A 4YHHQ 3J81i 3RN5A 3VDYA 1Q8KA 4HEDA 4R4QA 5KYLA 2NN6G 4DU9A 4AQYL 4A3LH 1TQOA 5BN5A 1CK1A 2QDBA 1VCIA 4NXNQ 1MSGA 1X3PA 3JAMc 1VDZA 5JVH3 5AJ3Q 1KLUD 1CHQD 4O0AA 2JJQA 3E0EA 4K8JA 4GOPB 1XNQL 2NZ1D 4N9TA 2K01A 2O2LD 2ZTDA 4HJ5A 3L7ZC 3IAYA 1PA6A 1WTPA 1L1OA 4ZKBB 4JBMA 1GUWA 3QG1A 1PYSB 3DM1A 3F2BA 3QWNA 4DAYA 1XPOA 1KABA 4AQYQ 5CGKA 4FDBA 4WJWA 1VMCA 1QILA 2L11A 3NBHB 1MBYA 4QGUA 4DV5L 2WB1B 1JJGA 1A2UA 1ILPA 4DK3C 2JP1A 2RHSB 2EOTA 4DKAC 2K32A 5L37A 2B2UC 4A3IH 2ZJRA 1XNQQ 4C3JG 3NQIA 5T1GA 3TS0A 2BH8A 1BDOA 2E76C 4DPGA 4TKOB 4FNFA 4P74A 1RF2D 1H9MA 3KK7A 1PYBA 2JA8H 4NDXA 1PVOA 3C2PA 3NHHA 3T56B 5IGCA 2CWAA 3VR6A 1KL9A 3EROA 3SEBA 2F0PA 4LK1C 4BY1H 4DV5Q 4IPDA 3VR5A 1CA6A 5EPKA 3VYTA 1QNKA 1EY8A 1RD9D 3ND8A 4A93B 2QF7A 2NWGA 3CPWA 4MZ9A 1BUVT 1I6HB 3A74A 4APVA 1STHA 3GTPH 1HA6A 1XTDA 3BG3A 4YCVA 2F0SA 2RBMA 1VQFA 4FXKC 2E75C 2NVQB 1O78A 1NY4A 1BQQT 3S9WA 3NE5B 2EYJA 1XXGA 4KJNA 3JC66 3E0JA 2PCFB 2V1CC 3ICEA 1VF5C 5CV7A 2IX0A 2UXDL 3MC0B 2NTTA 1RL2A 2BE5C 1U4RA 1NE3A 2AQ1B 1ILQA 3BZCA 2NBFA 3NUCA 2NVYH 3GD7A 4B08A 4DR1L 2E2JH 2B39A 1Y1VH 3A5UA 4A3DH 4A3GG 1TWCB 1PYWD 4Y7NB 5M3MH 2CCZA 2JA5G 3G6JB 3PO2B 3KBGA 2OXPA 2WB1G 1XX8A 4MTKA 1UE6A 1WD1A 3J81j 3EJIA 1Q8IA 2NUCA 1EOVA 4V190 4UY8C 1Y8PB 1SROA 1EY7A 3K5MA 4H02A 5EQ0A 4JI1L 3TS2A 5D3IB 1QZHA 3C1FA 3GTJH 2UXDQ 1PZJD 2VUMG 3CQZB 3RLFA 3R2TA 4FXGC 4RKLA 5C4ZA 4HJ7A 1D1KA 4DR1Q 1VQ6A 1OXUA 1SNMA 5IE8A 1B2TA 2KCMA 1I5FA 2EE1A 3OSOA 4GOPA 2PW7A 3LX0A 2B2TA 5FLXL 3S1RB 2R6GA 4A3KH 3J7AF 3D4RA 3FKIG 1TS2A 2CH4A 1V9PA 2EY2A 2VB3X 2F4IA 2LY7A 3OYYA 2HUGA 5BN3A 1T5EA 1WI5A 2A6HD 2MJ8A 5C3WA 4A93G 4KK7A 3TMEA 4PZ6A 1DCZA 1HZ9A 1SFOB 1BR9A 5JOBA 1WVLA 1JICA 4PMWA 4JI1Q 3U9SA 5G3LD 2KHSA 1E1OA 3IL8A 4K6DA 1Y8OB 5D65A 1PRTB 5IYBG 1NMGA 4CDEC 4AYBB 3NBHA 1YJ9A 1I50B 4IQZA 3TP5A 3A8IE 5EPJA 1CKNB 5HGTA 4DUYL 4CKEA 4K5VA 2UUCL 1D5ZC 4JI0L 1CTMA 4K0KL 4LAAA 3VR2A 1OXSC 2QGQA 4OGQC 5C3EB 4DR4L 2SOBA 3KBXA 1WTVA 1X9NA 4JYAL 5C4JH 4XT3B 2VB2X 2E5LL 2F03A 2R93H 1G51A 4IZ8A 2R61A 5I9OA 4RWSC 4KY7A 3BYYB 1Q12A 1I94L 4H44C 4RG1A 2O5JC 3BZDB 2E2HB 1KC8C 1HPCA 3W1BA 1ESRA 2H1EA 4IUUA 3PO2G 1IBKL 4B9XA 5J22A 4R8IA 4P75A 1Q7YC 5IIFA 5FK9C 1UE1A 1XJVA 1E24A 2JE6I 2TSSA 4KHPL 4GN5A 2MHVA 2PQEA 1XNRL 4IOCA 1G91A 1D5MC 1JWUD 3AFQA 1GHJA 1HTPA 3RMHA 4DUYQ 1C9OA 2UUCQ 1PTOH 1Q1EA 1ENCA 4K0KQ 2K4KA 1IKMA 2FFKB 5FLXc 2I46A 4DR4Q 4JYAQ 1HH2P 4IJLA 2AUKA 2E5LQ 3HKZB 2PZTA 1GOZA 1PDQA 1EEFD 4C56C 1I94Q 1S5CD 1LT3D 3SHLA 5A35A 5C4XB 2K52A 3S17B 4I7ZC 2HD3A 1B3AA 3BDLA 3VYRA 1A2TA 3A55A 5FJ8H 1LLRD 3P7JA 3M3YB 1EZ6A 5EGTA 1BKBA 4JI3L 1IBKQ 4A3CG 5IT9c 3D0FA 1ONLA 1HA5A 1NR2A 1LTSD 5LMNW 1VQGA 4EQPA 4C3IB 5I9PA 4KHPQ 1XNRQ 1ASYA 3M7NA 5M5YB 3I4NG 2Z6KA 3I4OA 3GDEA 2UXCL 4XYOA 4GKJL 1K8MA 4PNYA 1S5BD 4G7HC 3J80c 3RZDH 1SNQA 1Y1WG 1LTLA 3OIQA 1UEAB 1VQNA 3S2HB 1OTCA 5C3EG 1TS4A 2K5QA 5C5LA 1VQLA 4GZYC 5TSSA 1PH6A 4PZ8A 1VQDA 2XRSD 3NTIA 3L3OC 1ML0D 2Y0SG 3E9HA 4JI3Q 3M4OB 1I4XA 3QIAA 4R1JA 1Q90A 1CUKA 2K14A 2PMZE 2QCPX 5M9OA 1AFPA 1C4QA 3LWUA 1Q3LA 1X65A 3Q6SA 2A5HA 3KLRA 4NPSA 3I4MH 4ID6A 3K81C 1A6XA 2A68D 4RGMA 1BBXC 4GKJQ 3EFXD 4HIDA 4UHVA 2A74C 2L12A 3NWSA 1A3VA 3CKIB 3A5ZB 5IYDG 2ZM6L 4C3HH 3FMCA 3P20A 2F0JA 1SYEA 3I3CA 4HSVA 4OX9L 4X3UA 1KDCA 2H4OA 1CKMA 2QA4A 2ZXPA 1CKNA 4OEMB 3GTQH 1HNXL 3CCQA 3URYA 3GP7A 5C4XG 1LTRD 1IL2A 2I5LX 1E2ZA 1BBUA 4BY7B 1K28A 3CCMA 4LF4L 4BA2I 2QILA 1H95A 4GLAC 4A3JH 2YU9B 1O80A 2HQEA 2A69D 2NVTH 1K3RA 1Q46A 3GQBA 1H9SB 4K2LA 4DN4M 1EQTA 1ET6A 1IBLL 3PIOA 3GTMH 3H0GB 1JB7A 4C3IG 4HCEA 4KN7C 2J0TD 1Q81C 4EVOA 1IW7D 5IP9G 3HFZB 2ZM6Q 5I6WA 1VQ9A 4DV1Q 4OX9Q 1STBA 1TWAB 1GUSA 2NN6I 1HNXQ 2IX1A 4F87A 1EYGA 2KJXA 3GTLH 4OWXB 2N55A 1UWVA 2WB1E 1VQ7A 4LF4Q 1Q82C 3WOFA 3PO3H 4R4CA 2A8VA 2PNHA 1CHPD 2F0MA 1MJEA 2PQAB 3K59A 4RH6A 1PMRA 1CZGA 3KOJA 4RFBA 4F8MA 1QVGA 1IBLQ 1KRSA 4BBSB 1A63A 2SNSA 2JEAI 5JJLA 3MA2B 2WACA 3Q22A 3D6CA 1SMYC 2ZJPA 3S15H 3HOYH 1LTGD 3A7AB 2EYOA 4N8FA 1N36L 1EOTA 2NZHA 3QOLA 3U58A 3PIPA 2NVXH 5G3LF 3HOXG 3H6MA 1O7ZA 3HOVH 2BH2A 1YVCA 3HOZH 3T1YL 1D5XC 5A2QE 3E9IA 3CCSA 1QZGA 1HQMC 1S4ZA 2EQSA 2HDLA 5GAGC 2LS01 1YNND 3AMUA 2PNRC 1P16A 5LL6X 2XTIA 5E1FA 1YNJD 3PSIA 2N88A 3V96A 3A56A 2EVBA 4BY7G 1TWHB 2EIFA 5LMUL 4IFDH 1PRTD 2VL6A 1WTHA 2LMCB 2B29A 1PHJA 3HOZB 5C0XH 4EQNA 3OIPA 3H91A 1N36Q 1F2MA 4S3SA 1VQHA 3H0GG 4JBWA 5IODA 1W6JA 3OMCA 4POGA 2VNUD 4CHTB 1VQMA 2F0QA 2NN6H 2JK8A 1SYDA 3TDQA 3T1YQ 1VQ4A 1PFSA 1SNOA 2B2WC 2R7DA 3KLSX 5E4XA 1SJHD 1JQYD 2JA7G 3CC2A 3ONAB 4X64L 1SYBA 3V05A 5JAVA 3CRKC 2K5VA 2EDGA 2K1BA 1B1ZA 4M1UB 2EYLA 2Q8IB 5GAHC 5LMUQ 4A3BB 1MGSA 2PZUA 2F0DA 4KI0A 3AEVA 1HRJA 4PV1C 1PZID 4JC0A 4XQJA 5JEAH 4BBSG 3E3XA 5KNBA 2L1BA 4C2MB 4BXXG 1VQIA 1VQAA 5AFWA 1IYVA 1AH9A 1SE2A 3DHQA 3S1MB 3I73A 1H9SA 1TWGH 5I6YA 2KHIA 5KEEA 3U4VA 4L63B 1LABA 1STEA 2JN4A 5D14A 4X64Q 5IGDA 3F8TA 1BOSA 1H9JA 2ZTCA 2JEBI 1B9NA 3P75A 3TQYA 4EX5A 1K8GA 4CGYB 1GXDC 5M3FH 3MEFA 1NTGA 2KVMA 3NXWA 4Q0FA 3DEOA 1K83B 2D5DA 1YBYA 3MHBA 1IL8A 1S3OA 5LMNL 4UDUC 1CM9A 3CAMA 4KHVA 4A3EB 1FD7D 3VR3A 2FMMA 4FF4A 2NTSA 2E2IB 1IHZA 2PQAA 4FF2A 5J39A 2VQEL 4RA8A 1SEBD 4R4OA 3RNUA 1I3QH 1STAA 2QW7A 1JJ2A 3GTKB 2PW5A 3G48A 1SDFA 1JB3A 4LUZA 2B2UA 2SEBD 3BVMA 3GTOH 5GROA 2ASBA 2L4NA 4L8JA 4PMBA 3J81L 1HZAA 2EY6A 2Y0SE 3EA6A 1SRUA 1YHBA 2Z4IA 4JOIC 3ULJA 2MGSA 3TZUA 1HUNA 4KN4C 2GN5A 3S16B 3M4YA 4X6AH 2R3ZA 1PH5A 3F2UA 4KKTA 4GNXC 4A3BG 3K7AB 4L5SA 5LMNQ 5IY0A 3HOUH 2XRQD 4FYDA 3SK5A 1F2YA 3M4QA 4HN7A 5EBCA 2JXMB 2Z9HA 1ZXTA 4ODGA 3I8ZA 2VQEQ 1RODA 1H9RA 2A73B 2XN9C 5HURA 1AZPA 1RHPA 2MQHA 4HSPA 1U9RA 1JJCB 2K28A 4R8NA 2C9OA 5JPNC 4KD3A 3TREA 2EPBA 4C1NK 2AHOB 4WRDA 1KDAA 1STGA 4WORA 1KD1C 4FXDA 3KUPA 4NKLA 2MNAA 1J5EL 4X3KA 3C1EA 1GUNA 3WDNA 4LF6L 1V8QA 2F0VA 2R92G 4JW0A 3GO5A 3I2ZA 2K33A 4LUOA 1DGSA 4HIOA 1ICFB 5J3BA 4BA1I 2VUMH 3T51B 3S1QH 3RD4A 1HZCA 3MEHA 3NSWA 1EWCA 2GVBA 4G57A 3BS1A 4LFBL 3DEPA 3NK9A 1HQRD 3NTHA 2UU9L 3AYHB 4A3EG 1BO0A 1PH3A 4A3FG 2JQOA 2D0PA 5ELEA 1V1PB 2ZJQA 1QOHA 4IUNA 3HRZC
chains in the Genus database with same CATH topology
4ULLA 2K04A 4A3IB 3SR1A 4RCOA 2B8GA 1FNVA 2B2YA 4TSSA 1BF4A 3MFGA 5CMDA 1BCPC 5FKAC 1D2BA 2Z8LA 4KD4A 2IX3A 2JA8B 4ZQ3A 1AW7A 4K6LA 1EYAA 4DAVA 1LACA 4ZUJA 4NP5A 2IW3A 1VMPA 4PMCA 1J8IA 4BY1B 2M9VA 1E2WA 1PRTF 1EY4A 2MUYA 2WV6D 4RAUC 2X69A 3GTPB 5ELDA 1LT4D 1ZYRC 2L0CA 5I2XA 2TMPA 2KQ3A 3HOWB 5C5MA 1R4PB 1GJXA 3T4AC 5FO9B 2NVYB 1CQVA 4WFN3 1L0XB 4KY6A 1JWSD 3NBIA 5E4WC 4DAPA 2E2JB 1DM0B 2F1MA 3Q23A 1Y1VB 4A3DB 2X6LA 1DJRD 1B50A 1EEID 4BWGB 4CJ2C 5CR3A 3D3RA 5M3MB 2A6HC 3SDZA 3Q0AA 1OXXK 1AN8A 4B9WA 5T1IA 3PUXA 1HFNA 2KCNA 5F2DA 3GTJB 5EKKA 1IKLA 1ESFA 1JOOA 2L9HA 1EL0A 2E74C 4JK1C 3J7AV 3LWEA 1EY6A 3UI2A 5IT9E 1EU3A 1TS5A 5DEHA 4A3KB 2ICIA 3OW7A 2EZVA 2F3WA 2L5TA 4HAEA 2K5WA 5KNCA 1XTCD 4IUTA 5KNDA 3NQTA 1CZWA 3HGBA 2F0KA 3J80E 2K5DA 1L0YB 2KEEA 4H13C 5EPLA 3A54A 1LT5D 2PPBC 1PFBA 4KMUC 3HZXA 1HHVA 4IUVA 5C4JB 2GA4B 2R93B 3MAQA 1EZ8A 5JVG3 4E6IA 2RA4A 2RDGA 3IFTA 3MWYW 2EJFC 2AWNA 1PZKD 2BOSA 2HCIA 2B2TC 5IGGA 1II3A 5IGBA 1ET9A 3K57A 2LFNA 1CQFA 4HMIA 1HXYD 1LO5D 3T16A 1SE3A 2PYKA 4V0BA 1PTOB 3PUZA 1CFMA 1KNEA 2XWJB 2Z4HA 1LTAD 2CQAA 5I2YA 4J6HA 3MZ5A 2A6ED 4QF4A 5KRUA 4R9WA 2A68C 2NYZD 2ZXRA 3QOJA 1TKWB 3P1HA 1X32A 5K36H 2X6GA 1W6KA 2FHTA 1B53A 3RZDB 1TR5A 3EVQA 3PIO3 1TU2B 1NUCA 3FEWX 1EYCA 2BDNA 3PV0A 1TT2A 2A69C 2EYFA 3VA7A 1X3QA 2K03A 2DNEA 3AB9A 3BVGA 4EQOA 2F0EA 4M8AA 3HS0C 1EIGA 4OHJA 1QNUA 3BVZA 1WTQA 1IW7C 3I4MB 4HMJA 3R3OA 2EJGC 3L9AX 2J7ZA 4C3HB 2DN8A 2RDHA 1SNDA 3PIP3 3GTQB 2XWBB 1LTTD 3I70A 4OO1G 1C48A 1F9QA 1KDBA 3X3NA 4A3JB 1RCVD 5IOCA 2NVTB 5CV6A 2AQ2B 2XVSA 1M4VA 2CW0D 4LMQD 3GTMB 3TN2A 1WTWA 5CORA 3U9OA 3SK4A 1ZEQX 1FYCA 2IPKD 2F0WA 4ILWA 5FOBB 5DM63 2DNCA 2D62A 3OWFA 4U68A 1YNNC 1RKNA 1E2VA 1YNJC 2K05A 4KKUA 5CC4A 3GTLB 4RGTA 5EBDA 5EKLA 3PO3B 2RQXA 3H09A 1PRTC 3A8KE 4RGOS 5CV8A 1MI2A 1SBBB 3GV6A 3D4WA 1SNCA 2KOLA 4ZLTF 3S15B 3HOYB 1SSOA 4OIJA 1D1IA 1B44D 1BCPB 2NVXB 1MSHA 4ZAIA 1JWMD 5A2QL 3HOVB 4ABNA 1LTID 2MPMA 5ELCA 1ICWA 4C3HG 5KIXA 3LNNA 3RUZA 3OHXC 2EYHA 2B2VC 1QWYA 3NPPA 3QJYA 2Z1CA 4DA2A 1NR4A 3VA5A 3W3AA 4IUQA 5IGEA 3M85A 4X3TA 2KUMA 1F2LA 2LKVA 1PXUA 3ND9A 1HCZA 3JAME 2NB0A 4Z9CB 2KCCA 1I4HA 3H3VC 3MXGA 1A3TA 2JSOA 1B9MA 2XSCA 1JC7A 1TVXA 5DNFA 4ZUIA 5CBAE 3N52A 2O5IC 2OT2A 1PTOD 2FJ2A 3GV3A 3DXJC 2EXZA 3ITPA 2O4XA 1TY2A 2KEDA 3D4DA 1TWGB 2WAQB 1G6ZA 1AP0A 1PFNA 2EY5A 2F0LA 3K5LA 5CYUA 3MXNA 4OL7A 5M3FB 2V4DA 4O42A 3BYTB 1NAPA 1KAAA 2IJ0A 3SVMA 3FRPB 4IFDG 4KJOA 5FO7B 4XDXA 1GUTA 1LT6D 5C0XG 4CBVA 1QG7A 1QB5D 1DOMA 1CA5A 2Q8TA 2SDFA 5JJZA 1I3QB 3PUWA 1B4OA 4KHZA 4K14A 4O1NA 2DY7A 3GTOB 4KKSA 2JYOA 3IKJA 4IALA 1QE6A 2DY8A 2QEJC 3MTSA 1C8CA 1DZ1A 1Z6HA 2J4XA 1V43A 3HOUB 1SE4A 1OXTA 5JEAG 4XT1B 4N9PA 3TZDA 3I4LA 4XYQA 4A3GB 3TBIB 1SYGA 4KY5A 1J9OA 2JA5B 1V1OA 1K8OA 4L6TB 3VR4A 2WP8J 3X3MA 2WKDA 2XIWA 2OEOA 5EJWA 1FGBD 2K7VA 1U4PA 1LTBD 3BDCA 4HTHA 2VUMB 3S1QB 1RDPD 1M8AA 2IL8A 2ZT9C 5D3DA 1FNWA 4I65A 4UAIA 4IN3A 3FKIB 1TIID 1A15A 1JOKA 1F9PA 1FR3A 3AU7A 4QCLA 2EY1A 5LHY1 1I4QA 1G2TA 1E0BA 1EWHA 2F0IA 4FVMA 1EIHA 2F0OA 3MVVA 1QJOA 4RCNA 3KF8A 4IFDJ 1SJED 1HTLD 4DK1A 4Q5VA 5C0XJ 5KGUA 1NSNS 2WKCA 1BCPD 4U673 4TQUS 4ZK9B 1HUMA 3BDOA 4QUCA 3CRLC 1VF7A 4F7XA 1ZKOA 3DMUA 3DUZA 2BE5D 2B8FA 1SXTA 2HCCA 4MHEA 3I91A 1G8ZD 1XWEA 3NP8A 2B2YC 3D31A 3NTKA 1ZYRD 5FLXE 2C5CA 3T13A 5JEAJ 1AEXA 1SYFA 4XXEA 5NUCA 1F77A 1U4LA 1EFID 2R7ZB 1EY9A 3TP8A 1JR0D 1PTOF 4DXGA 3E6ZX 1A3UA 4DXFA 3OPOA 2F0TA 2K6AA 4K2KA 3O13A 1RTNA 4G4KA 1H9KA 2AQ3B 2KECA 4QB4A 2BA1A 4CJ1B 4OO1I 1WCMB 1TS3A 5IT9L 3MXPA 2SNMA 3I4NB 2CHBD 4H7BA 2G9DA 5COYA 3K5OA 1R4QB 1WTRA 1Y1WB 1V1PA 2D2CC 2XNAC 3HP3A 5C6AA 1F2ZA 4G7OC 3Q24A 3J80L 5CBEE 2Q8RE 5E3FA 1STNA 2Y0SB 1OO9B 1PLFA 2F0UA 3SE0A 2EYMA 3I90A 1TY0A 3VYSA 2BDOA 5K5PA 4QMGA 4RGNA 1CI3M 1FNUA 2ID0A 3FDTA 2KA7A 1SAPA 3S2DB 4DGZA 4K5WA 2I07B 3V2TA 4CKCA 5KYIA 3ERQA 2A6EC 4QUFA 4CKBA 1WD0A 4K8IA 3PMFA 2L55A 4P2CB 2OF1A 3S14B 4OO1H 4MIUA 1Z7TA 2EJMA 3IFDA 2IT1A 3A8JE 1GUGA 1Z47A 4K5XA 3WOEA 3ZYYX 4MN3A 3N6RA 1DD2A 3K58A 3FVQA 3DWPA 2EYPA 2M2LA 4IUPA 1EY5A 3SK6A 1F9SA 4XIGS 1CT1D 4F88A 1EQVA 1OXVA 1EYDA 5FO8B 4PQXA 1JOQA 4X3SA 1Q1BA 1I4PA 3DWAA 1MD2D 3QO2A 1KNAA 2G9HD 1PFMA 3SK8A 2F3VA 1BXTA 3HOXB 1DYQA 3E5SA 5EKIA 1ENFA 1S5DD 3M7GA 2BCOA 1Y69U 3OWEB 1UNSA 3T53B 4RKBA 5C44B 1SNPA 1IYUA 3MXUA 1BCPF 3OMGA 1O7YA 2CW0C 3K5NA 4A3MB 3R93A 5JPMC 3W2DA 1QCBD 4FO2A 5ELBA 4FF3A 2RSNA 4ZRZA 2RDFA 2PO4A 3EQLC 2WINB 1JCKB 3C46A 5I4DA 3QB3A 2ICEC 4IFDI 1I4GA 3TSSA 3RZOB 4IURA 3I72A 3K0YA 5C0XI 4BBRB 4KTAA 1S5FD 2JA7B 1JE4A 4ME5A 2JA6B 3VYUA 2B2VA 4RHSA 2B2WA 1D6EC 2M00A 5LL6S 2RSOA 1GHKA 2BA0A 4CJ0B 2VXWA 4HR7B 1STYA 1RJTA 4OIKA 3FPUB 5K36G 2FMCA 4DNRB 3DWQA 2HDMA 5J1ZA 1EY0A 1DOLA 5DAUA 5CV5A 3G7LA 4H0LC 1WTOA 3NWTA 4XQNA 5CV4A 1DXMA 2AWOA 5C4HA 4FP5D 3CU7A 2F0NA 2D9UA 1LV9A 1SMYD 3S1NB 4HCSA 2B63B 1G2SA 2F0FA 4DNTB 1O7LA 5M5WB 3CHBD 5ELFA 4RHRA 1BNZA 4TRDA 1F9RA 4DF7A 4XTCS 1G291 2RVLA 4KV6A 2ZXOA 3D6WA 3HG9A 2YYZA 4DFAA 5CV9A 4J1MA 3K6OA 2F0GA 3HEJA 1I6VC 3A7LA 2CVRA 3R2IA 3FPPA 1KLGD 5IGFA 1R9TB 5ISRA 1WTXA 2FINB 3TP7A 5C3XA 1PTOC 3TP6A 3GTGB 1I4RA 5BN4A 1RTOA 3JAML 1UUPA 1S5ED 4DK0A 1DOKA 3KLSA 3J7YW 3D8GA 3SXHA 2MP1A 1GUOA 1KTKA 2F0HA 1U4MA 2ENBA 2RKSA 3MFYA 3OOCA 4J8QA 4XQQA 1HFGA 1EU4A 1XYIA 2E2DC 2QKIC 5M5XB 1UAPA 3R8BA 4NW2A 3H94A 4QIWB 1DONA 2WIIB 4ZKCB 2IWHA 3C3LA 1NCVA 1T5XD 4YIJA 2R92B 1ENAA 2PMZB 4C1NI 4ZYSA 1TWFB 4BS9A 2PZWA 4LJZC 1AZQA 4C3JB 4EGVA 1SYCA 3PUVA 4G7ZC 3J81E 1Y8NB 3PUYA 2AUJD 4FF1A 4A3FB 4NMZA 5DM73 1JORA 4HEDA 5KYLA 2NN6G 4DU9A 1TQOA 5BN5A 1CK1A 2QDBA 1VCIA 1MSGA 1X3PA 5JVH3 1VDZA 1KLUD 1CHQD 4K8JA 2NZ1D 4N9TA 2K01A 2O2LD 3L7ZC 3IAYA 1WTPA 4ZKBB 1GUWA 3QG1A 3DM1A 3QWNA 4DAYA 1KABA 5CGKA 4WJWA 1VMCA 1QILA 2L11A 1MBYA 2WB1B 1A2UA 1ILPA 2JP1A 2EOTA 2K32A 2B2UC 4C3JG 3NQIA 5T1GA 1BDOA 2E76C 4TKOB 4FNFA 1RF2D 1H9MA 3KK7A 4NDXA 3C2PA 3NHHA 3T56B 5IGCA 3VR6A 3EROA 3SEBA 2F0PA 4LK1C 1CA6A 3VR5A 5EPKA 3VYTA 1QNKA 1EY8A 1RD9D 3ND8A 4A93B 2QF7A 2NWGA 1BUVT 1I6HB 1STHA 1HA6A 3BG3A 2F0SA 2RBMA 4FXKC 2E75C 2NVQB 1O78A 1BQQT 3S9WA 3NE5B 2EYJA 1XXGA 4KJNA 3E0JA 2PCFB 1VF5C 5CV7A 2IX0A 3MC0B 2NTTA 2BE5C 1U4RA 2AQ1B 1ILQA 2NBFA 3NUCA 3GD7A 4B08A 2B39A 1TWCB 1PYWD 4Y7NB 3G6JB 3PO2B 3KBGA 2OXPA 1XX8A 1WD1A 3EJIA 1Q8IA 2NUCA 4V190 1Y8PB 1EY7A 3K5MA 5EQ0A 5D3IB 3C1FA 1PZJD 3CQZB 3RLFA 3R2TA 4FXGC 4RKLA 5C4ZA 1D1KA 1OXUA 1SNMA 1B2TA 2EE1A 3OSOA 2PW7A 3LX0A 2B2TA 5FLXL 3S1RB 2R6GA 3J7AF 3D4RA 1TS2A 2EY2A 2VB3X 2F4IA 2LY7A 2HUGA 5BN3A 1T5EA 2A6HD 2MJ8A 5C3WA 4KK7A 3TMEA 1DCZA 1SFOB 1BR9A 5JOBA 1WVLA 1JICA 4PMWA 3U9SA 5G3LD 2KHSA 3IL8A 4K6DA 1Y8OB 5D65A 1PRTB 4AYBB 3NBHA 1I50B 4IQZA 3TP5A 3A8IE 5EPJA 5HGTA 4CKEA 4K5VA 1D5ZC 1CTMA 4LAAA 3VR2A 1OXSC 4OGQC 5C3EB 2SOBA 3KBXA 1WTVA 4XT3B 2VB2X 2F03A 4IZ8A 2R61A 5I9OA 4RWSC 4KY7A 3BYYB 1Q12A 4H44C 2O5JC 3BZDB 2E2HB 1HPCA 1ESRA 2H1EA 4IUUA 4B9XA 5J22A 4R8IA 5IIFA 5FK9C 2JE6I 2TSSA 2MHVA 2PQEA 1G91A 1D5MC 1JWUD 1GHJA 1HTPA 3RMHA 1PTOH 1Q1EA 1ENCA 1IKMA 2FFKB 2I46A 2AUKA 3HKZB 2PZTA 1GOZA 1PDQA 1EEFD 4C56C 1S5CD 1LT3D 3SHLA 5A35A 5C4XB 3S17B 4I7ZC 1B3AA 3BDLA 3VYRA 1A2TA 3A55A 1LLRD 3P7JA 3M3YB 1EZ6A 5EGTA 1ONLA 1HA5A 1NR2A 1LTSD 4EQPA 4C3IB 5I9PA 3M7NA 5M5YB 4XYOA 1K8MA 4PNYA 1S5BD 4G7HC 1SNQA 3OIQA 1UEAB 3S2HB 1TS4A 2K5QA 5C5LA 4GZYC 5TSSA 2XRSD 3NTIA 3L3OC 1ML0D 3M4OB 1I4XA 3QIAA 1Q90A 2QCPX 5M9OA 1AFPA 1C4QA 3LWUA 1Q3LA 3Q6SA 2A5HA 3KLRA 4ID6A 1A6XA 2A68D 4RGMA 1BBXC 3EFXD 2A74C 2L12A 3NWSA 1A3VA 3CKIB 3FMCA 3P20A 2F0JA 1SYEA 3I3CA 4HSVA 4X3UA 1KDCA 2H4OA 2ZXPA 3URYA 3GP7A 1LTRD 1E2ZA 4BY7B 4BA2I 2QILA 2YU9B 1O80A 2HQEA 2A69D 3GQBA 1H9SB 4K2LA 4DN4M 1EQTA 1ET6A 3H0GB 4C3IG 4HCEA 4KN7C 2J0TD 4EVOA 1IW7D 5I6WA 1STBA 1TWAB 1GUSA 2NN6I 2IX1A 4F87A 2KJXA 2N55A 3WOFA 1CHPD 2F0MA 3K59A 4RH6A 1PMRA 1CZGA 4RFBA 4F8MA 4BBSB 2SNSA 2JEAI 3MA2B 2WACA 3Q22A 3D6CA 1SMYC 1LTGD 3A7AB 2EYOA 1EOTA 3QOLA 5G3LF 3H6MA 1O7ZA 1D5XC 5A2QE 1HQMC 1S4ZA 2HDLA 2LS01 1YNND 3AMUA 2PNRC 5LL6X 5E1FA 1YNJD 2N88A 3V96A 3A56A 2EVBA 1TWHB 4IFDH 1PRTD 2LMCB 3HOZB 5C0XH 4EQNA 3OIPA 3H91A 1F2MA 4S3SA 4JBWA 5IODA 1W6JA 3OMCA 2VNUD 4CHTB 2F0QA 2NN6H 1SYDA 3TDQA 1SNOA 2B2WC 3KLSX 5E4XA 1SJHD 1JQYD 3ONAB 1SYBA 3V05A 5JAVA 3CRKC 2EDGA 2K1BA 1B1ZA 4M1UB 2EYLA 2Q8IB 4A3BB 1MGSA 2PZUA 2F0DA 4KI0A 1HRJA 4PV1C 1PZID 4XQJA 5JEAH 5KNBA 2L1BA 4C2MB 5AFWA 1IYVA 1SE2A 3DHQA 3S1MB 3I73A 1H9SA 5I6YA 5KEEA 4L63B 1LABA 1STEA 5D14A 5IGDA 1BOSA 1H9JA 2JEBI 1B9NA 3P75A 4CGYB 1GXDC 2KVMA 3NXWA 4Q0FA 3DEOA 1K83B 2D5DA 3MHBA 1IL8A 4UDUC 1CM9A 4KHVA 4A3EB 1FD7D 3VR3A 2FMMA 4FF4A 2NTSA 2E2IB 1IHZA 4FF2A 5J39A 4RA8A 1SEBD 1STAA 3GTKB 2PW5A 1SDFA 1JB3A 2B2UA 2SEBD 3BVMA 2L4NA 4L8JA 4PMBA 3J81L 2EY6A 3EA6A 2Z4IA 2MGSA 3TZUA 1HUNA 4KN4C 3S16B 3M4YA 2R3ZA 3F2UA 4KKTA 3K7AB 2XRQD 4FYDA 3SK5A 1F2YA 4HN7A 5EBCA 2JXMB 1ZXTA 4ODGA 3I8ZA 1RODA 5HURA 1H9RA 2A73B 2XN9C 1AZPA 1RHPA 4HSPA 1U9RA 2K28A 4R8NA 2C9OA 5JPNC 4KD3A 2EPBA 4C1NK 4WRDA 1KDAA 1STGA 4WORA 4FXDA 3KUPA 4NKLA 4X3KA 3C1EA 1GUNA 3WDNA 1V8QA 2F0VA 3GO5A 2K33A 4BA1I 3T51B 3RD4A 3MEHA 3NSWA 1EWCA 4G57A 3BS1A 3DEPA 3NK9A 1HQRD 3NTHA 1BO0A 5ELEA 1V1PB 1QOHA 4IUNA 3HRZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QCP X;  2L55 A;  1ZEQ X;  2VB3 X;  3E6Z X;  2VB2 X;  3TDQ A; 
#chains in the Genus database with same CATH topology
 3FKI H;  1K3B C;  4QQB X;  3J81 c;  4ULL A;  1VQJ A;  4LUV A;  2K04 A;  4A3I B;  3SR1 A;  4RCO A;  2B8G A;  1FNV A;  2B2Y A;  4TSS A;  1BF4 A;  3MFG A;  5CMD A;  1BCP C;  1NNX A;  1J5E Q;  5FKA C;  4LF6 Q;  1D2B A;  4OEL B;  2Z8L A;  4KD4 A;  3PCO B;  5IYC H;  2IX3 A;  5FLM H;  3CCR A;  2JA8 B;  4ZQ3 A;  1AW7 A;  1VQ8 A;  4K6L A;  1EYA A;  3L0O A;  4DAV A;  1XMQ L;  1LAC A;  1P8L A;  1NJI C;  4ZUJ A;  1YJN A;  4NP5 A;  1AE2 A;  4LFB Q;  2IW3 A;  3KJP A;  1VMP A;  4PMC A;  4DR3 L;  3HOW H;  1J8I A;  4BY1 B;  2UU9 Q;  2CKZ B;  2M9V A;  2R7F A;  1E2W A;  1PRT F;  1YZ6 A;  1EY4 A;  2MUY A;  2WV6 D;  4RAU C;  1GO3 E;  2X69 A;  2C35 B;  3GTP B;  5ELD A;  3W1G A;  1LT4 D;  1ZYR C;  1YHA A;  2L0C A;  1X3F A;  1UEB A;  5I2X A;  2TMP A;  4R4I A;  2KQ3 A;  3HOW B;  5C5M A;  1R4P B;  1GJX A;  2HQL A;  3T4A C;  5FO9 B;  4PG3 A;  1XMQ Q;  2NVY B;  1CQV A;  4WFN 3;  1L0X B;  4KY6 A;  1JWS D;  3NBI A;  5E4W C;  4DAP A;  2E2J B;  1DM0 B;  2P5Z X;  2F1M A;  2HIX A;  1K9M C;  3Q23 A;  4DR3 Q;  1Y1V B;  4A3D B;  2ALY B;  2QEX A;  2YV5 A;  2X6L A;  1DJR D;  2R7Z H;  4LWC A;  1B50 A;  1EEI D;  4BWG B;  4JI5 L;  4CJ2 C;  5CR3 A;  3D3R A;  5M3M B;  2A6H C;  3SDZ A;  1LUZ A;  3Q0A A;  1OXX K;  1AN8 A;  4B9W A;  3J7Z C;  4A3C H;  5T1I A;  3PUX A;  4CDC C;  1B3Q A;  3M4P A;  1HFN A;  2KCN A;  4QJF A;  5F2D A;  3GTJ B;  5EKK A;  4I7A A;  1IKL A;  1ESF A;  1JOO A;  1WCM H;  2L9H A;  1EL0 A;  2E74 C;  1VQC A;  4JK1 C;  4IPH A;  3J7A V;  2NZO A;  2JA8 G;  3LWE A;  3OW2 A;  3CW2 C;  1UE5 A;  3I4N H;  1EY6 A;  3H3V I;  3UI2 A;  5IT9 E;  1EU3 A;  1Y1W H;  1TS5 A;  1EFW A;  4JI5 Q;  2K5H A;  3RLO A;  4Y52 H;  5DEH A;  4AH6 A;  4A3K B;  2ICI A;  1GD7 A;  3OW7 A;  4BY1 G;  2EZV A;  1SE8 A;  2F3W A;  2L5T A;  4HAE A;  4X65 L;  2K5W A;  5KNC A;  2Q2T A;  1KXL A;  1XTC D;  4IUT A;  5KND A;  3NQT A;  1CZW A;  3HGB A;  2F0K A;  3J80 E;  2K5D A;  1L0Y B;  2KEE A;  4H13 C;  5EPL A;  1IXR A;  3A54 A;  4J15 A;  1FGU A;  1LT5 D;  4LF7 L;  2PPB C;  1VS0 A;  1PFB A;  4KMU C;  3K8A A;  3HZX A;  4DNI A;  1J6Q A;  4X62 L;  1HHV A;  4IUV A;  5C4J B;  5IYD H;  3S2D H;  1CKO A;  1Y1V G;  2GA4 B;  2I5M X;  3MAQ A;  4A3D G;  2R93 B;  3KYH C;  1EZ8 A;  4JI0 Q;  5JVG 3;  4X65 Q;  4E6I A;  2RA4 A;  2RDG A;  4GOP C;  3IFT A;  5M3M G;  3MWY W;  2EJF C;  2AWN A;  1PZK D;  1MHW C;  2BOS A;  2HCI A;  2B2T C;  5IGG A;  1II3 A;  5IGB A;  1ET9 A;  3K57 A;  2LFN A;  1BVS A;  1CQF A;  3S14 H;  2DGY A;  1KQS A;  4HMI A;  1HXY D;  1LO5 D;  3T16 A;  1SE3 A;  1SMX A;  1HR0 L;  2PYK A;  3CPF A;  4DAM A;  3H3V H;  1PH4 A;  4LF7 Q;  4V0B A;  2N49 A;  1PTO B;  2QDL A;  4JBJ A;  1GKH A;  4X62 Q;  3PUZ A;  1CFM A;  1KNE A;  4JG2 A;  4AYB G;  2XWJ B;  2Z4H A;  3CCE A;  4IOA A;  3CC7 A;  1LTA D;  2CQA A;  4JI6 L;  4OWW B;  5I2Y A;  1LYL A;  2HT1 A;  4J6H A;  3MZ5 A;  2WFW A;  1JMC A;  2A6E D;  4QF4 A;  5KRU A;  4DV6 L;  4R9W A;  4QIW E;  4LFC L;  2A68 C;  2NYZ D;  1HR0 Q;  2ZXR A;  1GM5 A;  3QOJ A;  1TKW B;  3EN2 A;  2VY3 A;  2D0O A;  3P1H A;  1X32 A;  4HIM A;  5K36 H;  3CME A;  2X6G A;  1W6K A;  2FHT A;  5GQO A;  1B53 A;  4P73 A;  3RZD B;  1EQR A;  1TR5 A;  1D7Q A;  3EVQ A;  2ES2 A;  3PIO 3;  4JVZ A;  3HOX H;  1TU2 B;  1PH8 A;  1NUC A;  3FEW X;  3CCV A;  2UXC Q;  4OON A;  1EYC A;  4LF5 L;  2BDN A;  2Q2H A;  3KDF B;  1U0L A;  2CQO A;  3PV0 A;  2R93 G;  1TT2 A;  2A69 C;  2EYF A;  3WWV A;  3VA7 A;  1X3Q A;  2K03 A;  1FL0 A;  5C44 H;  2DNE A;  3AB9 A;  3BVG A;  4EQO A;  2F0E A;  4M8A A;  4DV6 Q;  4A3M H;  3HS0 C;  1EIG A;  4OHJ A;  4LF8 L;  4LFC Q;  1C0A A;  3HKZ G;  1QNU A;  3BVZ A;  1WTQ A;  1IW7 C;  2A1A A;  4JI8 L;  3I4M B;  4HMJ A;  3R3O A;  2EJG C;  1K73 C;  4NXM L;  3CD6 A;  3L9A X;  2J7Z A;  2L15 A;  4LW1 A;  4C3H B;  1XMO L;  1FVI A;  2Z6K C;  4GLX A;  4LF5 Q;  3HKS A;  3RZO H;  4BBR H;  1WJJ A;  2DN8 A;  2RDH A;  4L5Q A;  1SND A;  3PIP 3;  3GTQ B;  2XWB B;  1LTT D;  1YJW A;  1YHQ A;  3I70 A;  2OWO A;  4X66 L;  2JA6 H;  4A4I A;  4OO1 G;  1B7Y B;  1C48 A;  1F9Q A;  2Z6B A;  1KDB A;  3X3N A;  4A3J B;  1RCV D;  4LF8 Q;  5IOC A;  2NVT B;  3U4Z A;  3AFP A;  5CV6 A;  2AQ2 B;  2KHJ A;  3LGJ A;  2XVS A;  4JI8 Q;  1M4V A;  3FP9 A;  1HNZ L;  2CW0 D;  4LMQ D;  3GTM B;  4NXM Q;  3TN2 A;  1WTW A;  5COR A;  1X56 A;  4JI2 L;  3U9O A;  3MXN B;  2K5N A;  3SK4 A;  1ZEQ X;  1XMO Q;  1FYC A;  2IPK D;  1E22 A;  4DR7 L;  2F0W A;  4ILW A;  5FOB B;  5DM6 3;  2DNC A;  4A76 A;  1KIX A;  3UDI A;  2D62 A;  3OWF A;  4U68 A;  1YNN C;  1RKN A;  1E2V A;  1YNJ C;  2K05 A;  4KKU A;  5CC4 A;  3RN2 A;  3GTL B;  4RGT A;  5EBD A;  4X66 Q;  3PGZ A;  5EKL A;  3CMA A;  3PO3 B;  2RQX A;  3H09 A;  1PRT C;  3A8K E;  3S1N H;  2JA9 A;  2B63 H;  4RGO S;  1N34 L;  5CV8 A;  5M5W H;  1HNZ Q;  1MI2 A;  3UE0 A;  1SBB B;  3GV6 A;  3D4W A;  1SNC A;  4B3R L;  2KOL A;  4ZLT F;  3S15 B;  1BBW A;  3HOY B;  2MO0 A;  3I4M G;  1X54 A;  4JI2 Q;  1SSO A;  4OIJ A;  4POF A;  1D1I A;  2I0Q A;  1B44 D;  1BCP B;  4B3T L;  1W3S A;  4DR7 Q;  1MSH A;  2NVX B;  4IPC A;  4ZAI A;  1JT8 A;  1JWM D;  5A2Q L;  1EIY B;  3HOV B;  4ABN A;  4AIM A;  1LTI D;  2MPM A;  5ELC A;  1ICW A;  4C3H G;  5KIX A;  1K0S A;  3LNN A;  1S40 A;  3RUZ A;  3OHX C;  4WJ4 A;  2EYH A;  2B2V C;  3CXC A;  4ME3 A;  1QWY A;  1N34 Q;  4YWL A;  3NPP A;  1WYD A;  3QJY A;  2KBN A;  1R9T H;  2Z1C A;  1LM0 A;  4B3R Q;  4DA2 A;  1NR4 A;  3VA5 A;  3W3A A;  4RMF A;  4IUQ A;  5IGE A;  3M85 A;  3KDF A;  4X3T A;  1PH7 A;  2KEN A;  4B3T Q;  3GTG H;  2KUM A;  1VQO A;  5IWA L;  4DR6 L;  1F2L A;  2LKV A;  1PXU A;  3ND9 A;  1HCZ A;  4TVA B;  3JAM E;  2NB0 A;  4Z9C B;  5DLQ E;  3ULP A;  4N8X 1;  2KCC A;  3STB D;  1I4H A;  3H3V C;  3JAM i;  3MXG A;  1A3T A;  5M5X H;  1E3P A;  2JSO A;  2OQ0 A;  1B9M A;  2XSC A;  4QL5 A;  1JC7 A;  1T9H A;  1TVX A;  5DNF A;  4ZUI A;  5CBA E;  3N52 A;  2O5I C;  2R92 H;  3NEN A;  5IWA Q;  1TWF H;  2OT2 A;  4DR6 Q;  1PTO D;  3T1H L;  2FJ2 A;  3HOY G;  3GV3 A;  4C3J H;  3DXJ C;  1EQQ A;  1N9W A;  2EXZ A;  3NEL A;  3ITP A;  2O4X A;  1TY2 A;  2KED A;  3D4D A;  1TWG B;  3HOV G;  2WAQ B;  3KF8 B;  4AYB E;  1G6Z A;  4A3F H;  3HOZ G;  2N3S A;  1AP0 A;  1PFN A;  2EY5 A;  2F0L A;  1YNX A;  3K5L A;  5CYU A;  4DR5 L;  3MXN A;  1CSQ A;  4OL7 A;  3I56 A;  5M3F B;  1XPR A;  2V4D A;  4O42 A;  3PQI A;  3BYT B;  1NAP A;  1KAA A;  3ER0 A;  2IJ0 A;  3SVM A;  1HR0 W;  3FRP B;  4QY7 A;  1PH2 A;  4GKK L;  4IFD G;  4KJO A;  5FO7 B;  4XDX A;  3T1H Q;  1GUT A;  1LT6 D;  5C0X G;  4YCU A;  1QVC A;  3RLN A;  4CBV A;  1QG7 A;  1QB5 D;  1DOM A;  5IP7 G;  1W2B A;  1CA5 A;  2Q8T A;  2SDF A;  5JJZ A;  4DV2 L;  1I3Q B;  3PUW A;  1B4O A;  4KHZ A;  3L2P A;  4K14 A;  2RF4 A;  2VW9 A;  4O1N A;  2DY7 A;  3GTO B;  4KKS A;  1N8R C;  2JYO A;  4DR5 Q;  3IKJ A;  2PI2 A;  4IAL A;  1E7Z A;  1QE6 A;  4A3G H;  2AMC B;  2DY8 A;  2QEJ C;  3MTS A;  1C8C A;  1DZ1 A;  2JA5 H;  3HKZ E;  4DV4 L;  1Z6H A;  2J4X A;  4GKK Q;  4LFA L;  2DJG C;  1V43 A;  3AQQ A;  3HOU B;  1SE4 A;  1OXT A;  5JEA G;  4XT1 B;  1FJG L;  4N9P A;  3KF6 B;  1C7Y A;  3TZD A;  4DV2 Q;  2LXK A;  3I4L A;  4XYQ A;  4A3G B;  3TBI B;  1SYG A;  1Q86 C;  1VQB A;  4KY5 A;  1WFQ A;  1J9O A;  2JA5 B;  1V1O A;  1K8O A;  1G6P A;  2UUA L;  2Z0S A;  2WAQ G;  4L6T B;  3VR4 A;  2WP8 J;  3X3M A;  3CC4 A;  1A8V A;  2WKD A;  2XIW A;  2OEO A;  5EJW A;  1FGB D;  1N32 L;  2K7V A;  4DV4 Q;  4B3M L;  1U4P A;  1LTB D;  3BDC A;  4LFA Q;  5M3F G;  4HTH A;  2VUM B;  3S1Q B;  1RDP D;  1M8A A;  1IYJ B;  4A93 H;  3EBE A;  2IL8 A;  1K8A C;  1I6H H;  2ZT9 C;  3S24 A;  5D3D A;  1FJG Q;  1FNW A;  4O2D A;  3ERS X;  1X3E A;  4DK6 C;  2NVQ H;  5IYB H;  4I65 A;  4UAI A;  4IN3 A;  3G6E A;  3G71 A;  3FKI B;  2OQK A;  1A15 A;  1JOK A;  1TII D;  1F9P A;  1FR3 A;  3AU7 A;  2UUA Q;  4QCL A;  2EY1 A;  1O7I A;  2N8N A;  1K0R A;  1VQE A;  1PH1 A;  5LHY 1;  1I4Q A;  1G2T A;  3QR8 A;  3CCJ A;  1L1O C;  1E0B A;  1EWH A;  3EIV A;  2F0I A;  4FVM A;  1N32 Q;  4A3L G;  1EIH A;  3OTO L;  2F0O A;  3MVV A;  4B3M Q;  2OCE A;  1QJO A;  4RCN A;  1YI2 A;  1TWC H;  4UP9 A;  4Y7N H;  3KF8 A;  4DV7 L;  4IFD J;  2CH4 W;  1SJE D;  1HTL D;  4DK1 A;  4Q5V A;  3PO2 H;  5C0X J;  4LF9 L;  5KGU A;  2YTV A;  1NSN S;  2WKC A;  1BCP D;  3HOU G;  4U67 3;  5E7N A;  4GS3 A;  4TQU S;  4B3S L;  1PV4 A;  3FHW A;  4ZK9 B;  1UE7 A;  1HUM A;  1VQP A;  3BDO A;  2ZTE A;  4HJ8 A;  4IJH A;  5JJI A;  4QUC A;  3CQZ H;  1MKH A;  3CRL C;  1L2F A;  1VF7 A;  4F7X A;  2YTY A;  1V1Q A;  1ZKO A;  3DMU A;  3DUZ A;  3OTO Q;  2BE5 D;  2B8F A;  1SXT A;  2HCC A;  1X55 A;  2VS1 A;  4MHE A;  3I91 A;  3CCU A;  3S1R H;  1G8Z D;  4DV7 Q;  1XWE A;  3NP8 A;  2B2Y C;  3D31 A;  3NTK A;  1ZYR D;  4A3I G;  5FLX E;  4LF9 Q;  2C5C A;  2N78 A;  3T13 A;  4A75 A;  5JEA J;  2IHF A;  1AEX A;  1SYF A;  3W5O A;  5GAE C;  4XXE A;  4DV3 L;  5NUC A;  4B3S Q;  1F77 A;  1U4L A;  1EFI D;  2RCF A;  5ELN A;  4JBK A;  2R7Z B;  1EY9 A;  1SFO H;  1HJP A;  4HJA A;  2RCN A;  3I7F A;  3TP8 A;  1I50 H;  1JR0 D;  3PF4 A;  1PTO F;  3NEM A;  4DXG A;  4ALP A;  3E6Z X;  1A3U A;  4DXF A;  3OPO A;  2F0T A;  2K6A A;  4K2K A;  3O13 A;  4G4K A;  1RTN A;  4NB3 A;  1H9K A;  3KF6 A;  2AQ3 B;  2KEC A;  5C3E H;  4QB4 A;  1M1K C;  2BA1 A;  4CJ1 B;  4OO1 I;  1YEZ A;  5EAY A;  1WCM B;  3BZK A;  1TS3 A;  5IT9 L;  5IYC G;  5FLM G;  3MXP A;  2SNM A;  3TRZ A;  3I4N B;  5ELO A;  2CHB D;  4H7B A;  2G9D A;  5COY A;  2E2H H;  3K5O A;  4DV3 Q;  2IY5 B;  1R4Q B;  1WTR A;  1Y1W B;  1V1P A;  2D2C C;  2XNA C;  3HP3 A;  3J80 i;  3HOW G;  2PI2 E;  5C6A A;  1F2Z A;  4G7O C;  4CDF C;  3Q24 A;  3J80 L;  5CBE E;  2Q8R E;  1HZB A;  5E3F A;  1MJC A;  3ZJY C;  1STN A;  2Y0S B;  3M9B A;  1OO9 B;  3KJO A;  1PLF A;  2F0U A;  3SE0 A;  5BR8 L;  2EYM A;  2KCT A;  1QUQ B;  3I90 A;  1TY0 A;  3VYS A;  2BDO A;  5K5P A;  4ZCK A;  2MO1 A;  1VQ5 A;  3KFU A;  4QMG A;  1EWI A;  4RGN A;  5C4X H;  2K50 A;  3S17 H;  4HJ9 A;  1CI3 M;  1FNU A;  2ID0 A;  4IPG A;  3M3Y H;  3FDT A;  2KA7 A;  1SAP A;  3S2D B;  4DGZ A;  4K5W A;  4JV5 L;  2I07 B;  3V2T A;  4CKC A;  5KYI A;  3ERQ A;  3PF5 A;  2R7Z G;  2A6E C;  4C3I H;  4QUF A;  4CKB A;  4DUZ L;  5M5Y H;  1WD0 A;  5IP9 H;  1XPU A;  4K8I A;  3PMF A;  2L55 A;  4GLV B;  4P2C B;  5BR8 Q;  2OF1 A;  2E8G A;  3S14 B;  4MIU A;  4OO1 H;  2Q2U A;  4IO9 A;  1Z7T A;  2EJM A;  3IFD A;  4A3K G;  4L5T A;  2IT1 A;  4MTN A;  3S2H H;  3A8J E;  1GUG A;  1Z47 A;  4K5X A;  4DR2 L;  3WOE A;  3ZYY X;  1KAW A;  2YTX A;  3H15 A;  1WCM G;  4MN3 A;  3N6R A;  3M4O H;  1DD2 A;  4P72 A;  3K58 A;  3FVQ A;  3DWP A;  2EYP A;  2M2L A;  4IUP A;  4JV5 Q;  1SR3 A;  2DUD A;  1TXY A;  1EY5 A;  3SK6 A;  1F9S A;  4XIG S;  1CT1 D;  3I55 A;  4DUZ Q;  3G4S A;  4F88 A;  3U50 C;  1EQV A;  1OXV A;  1NBW A;  5JJK A;  1EYD A;  5FO8 B;  4PQX A;  2WAQ E;  1N33 L;  4JI6 Q;  2I5H A;  1JOQ A;  4X3S A;  1Q1B A;  3DM3 A;  3SGI A;  1I4P A;  2HHH L;  2AKW B;  3DWA A;  2ATW A;  1MD2 D;  3QO2 A;  1KNA A;  4DR2 Q;  2G9H D;  1SN8 A;  4JCV E;  3BU2 A;  4KLK A;  1S72 A;  4WJ3 M;  1PFM A;  3SK8 A;  2F3V A;  1VQK A;  2OTL A;  3UDF A;  4BY7 H;  1BXT A;  3HOX B;  4R4T A;  1DYQ A;  3E5S A;  2YU9 H;  5EKI A;  1ENF A;  1S5D D;  3M7G A;  2BCO A;  2FXQ A;  4OXP A;  1Y69 U;  3ULL A;  3OWE B;  1UNS A;  1MIU A;  3T53 B;  4RKB A;  4HIK A;  5C44 B;  4DV1 L;  1GVP A;  3H0G H;  1SNP A;  1IYU A;  3MXU A;  1BCP F;  3OMG A;  1O7Y A;  3K7U C;  2CW0 C;  1JE5 A;  4GNX B;  3K5N A;  4A3M B;  1YIJ A;  1N33 Q;  1EUJ A;  3R93 A;  5JPM C;  1YIT A;  2HHH Q;  3W2D A;  1QCB D;  4FO2 A;  1HNW L;  5ELB A;  5GAD C;  4FF3 A;  2JA7 H;  2RSN A;  4ZRZ A;  1TWA H;  2RDF A;  4JPB W;  2PO4 A;  5FJ8 G;  3EQL C;  3KLW A;  2WIN B;  1JCK B;  3C46 A;  1PH9 A;  5I4D A;  1CSP A;  3F2C A;  3QB3 A;  2ICE C;  4YCW A;  2F4V L;  2K75 A;  2VQF L;  4IFD I;  1I4G A;  3TSS A;  4LNQ A;  2LXJ A;  4IUR A;  3RZO B;  4GN3 B;  1QUQ A;  3I72 A;  3K0Y A;  5C0X I;  4BBR B;  4KTA A;  1S5F D;  4BBS H;  2GVA A;  2JA7 B;  1JE4 A;  4ME5 A;  2JA6 B;  3DLL A;  3VYU A;  2B2V A;  4BXX H;  4RHS A;  2B2W A;  1D6E C;  2M00 A;  5LL6 S;  2RSO A;  4YY3 L;  1HNW Q;  1EIF A;  1GHK A;  2G5D A;  1L0W A;  2BA0 A;  1X3G A;  4CJ0 B;  1NMF A;  1RIP A;  2VXW A;  4HR7 B;  1STY A;  1RJT A;  4OIK A;  3FPU B;  5K36 G;  2HIV A;  2FMC A;  4DNR B;  2F4V Q;  3TEH B;  2VQF Q;  3DWQ A;  2HDM A;  5J1Z A;  3J7A 5;  1SLJ A;  1EY0 A;  1DOL A;  5DAU A;  4DV0 L;  5CV5 A;  3K80 C;  3G7L A;  1TWH H;  4H0L C;  1WTO A;  1QVF A;  3NWT A;  4XQN A;  5CV4 A;  1DXM A;  4UP8 A;  2AWO A;  5C4H A;  4FP5 D;  3CU7 A;  2F0N A;  2D9U A;  1LV9 A;  1SMY D;  2LSS A;  4HCS A;  5C44 G;  2B63 B;  1G2S A;  2F0F A;  3S1N B;  4YY3 Q;  4DNT B;  1O7L A;  1WOC A;  3CHB D;  5M5W B;  4A3M G;  1M90 C;  5ELF A;  4RHR A;  1BNZ A;  4TRD A;  1F9R A;  1B70 B;  1Y14 B;  4DF7 A;  1A62 A;  4MNO A;  2F3I A;  4XTC S;  1G29 1;  1L1O B;  2RVL A;  3A0J A;  4KV6 A;  4A3J G;  3F1Z A;  4DAY B;  2ZXO A;  2A19 A;  3D6W A;  3HG9 A;  2YYZ A;  4DFA A;  4UPA A;  3STB C;  5CV9 A;  1A0I A;  5IP7 H;  2CWP A;  3K0X A;  4DV0 Q;  4A3B H;  1KHI A;  4J1M A;  3K6O A;  2F0G A;  3Q8D A;  3HEJ A;  1I6V C;  3A7L A;  4BBR G;  2H5X A;  2CVR A;  2B3G A;  2VZA A;  3R2I A;  3CP0 A;  3FPP A;  2EXD A;  1KLG D;  4JI4 L;  2JA6 G;  3UDX A;  5HGQ A;  4C2M H;  5IGF A;  1R9T B;  5ISR A;  1WTX A;  1IBM L;  2FIN B;  4CDD C;  3TP7 A;  1B8A A;  5C3X A;  3CCL A;  1PTO C;  1Z9F A;  2F52 A;  3S1M H;  4JOI A;  1D8L A;  3B6Y A;  2UUB L;  3TP6 A;  3RR5 A;  3GTG B;  1I4R A;  5BN4 A;  1RTO A;  2IHE A;  3PO3 G;  5H1S E;  3JAM L;  1UUP A;  1S5E D;  4YWK A;  4GNX A;  5HY6 A;  2UXB L;  4DK0 A;  1DOK A;  1X6O A;  3KLS A;  3J7Y W;  3D8G A;  3SXH A;  2MP1 A;  1GUO A;  1U5K A;  1AE3 A;  1KTK A;  2F0H A;  1U4M A;  2DJF C;  2MFI A;  2ENB A;  2RKS A;  3MFY A;  3OOC A;  1IZ6 A;  4J8Q A;  4XQQ A;  2XGT A;  3CF5 A;  1K83 H;  1HFG A;  4JI7 L;  1EU4 A;  1XYI A;  2E2D C;  2QKI C;  4YHH L;  5M5X B;  4JI4 Q;  3F2D A;  1UAP A;  4PZ7 A;  2RHQ B;  3H94 A;  4NW2 A;  3R8B A;  4QIW B;  1IBM Q;  4A3E H;  1DON A;  2WII B;  4ZKC B;  2E2I H;  2B63 G;  2UUB Q;  2IWH A;  3C3L A;  1NCV A;  1T5X D;  4YIJ A;  3GTK H;  2R92 B;  1KRT A;  1ENA A;  2PMZ B;  4P71 A;  3UE1 A;  4C1N I;  4ZYS A;  4NXN L;  1TWF B;  4BS9 A;  2PZW A;  4L5R C;  3BJU A;  4LJZ C;  1AZQ A;  5AJ3 L;  4C3J B;  4EGV A;  2UXB Q;  3UDG A;  4YWM A;  1SYC A;  3IRB A;  2OTJ A;  3PUV A;  2Q2I A;  4G7Z C;  3J81 E;  1Y8N B;  3PUY A;  2AUJ D;  4FF1 A;  4A3F B;  3S16 H;  4NMZ A;  2CFM A;  1E1T A;  1ASZ A;  4EQ5 A;  5DM7 3;  4JI7 Q;  1JOR A;  4OWT B;  4GN4 B;  3K7A H;  4UP7 A;  4YHH Q;  3J81 i;  3RN5 A;  3VDY A;  1Q8K A;  4HED A;  4R4Q A;  5KYL A;  2NN6 G;  4DU9 A;  4AQY L;  4A3L H;  1TQO A;  5BN5 A;  1CK1 A;  2QDB A;  1VCI A;  4NXN Q;  1MSG A;  1X3P A;  3JAM c;  1VDZ A;  5JVH 3;  5AJ3 Q;  1KLU D;  1CHQ D;  4O0A A;  2JJQ A;  3E0E A;  4K8J A;  4GOP B;  1XNQ L;  2NZ1 D;  4N9T A;  2K01 A;  2O2L D;  2ZTD A;  4HJ5 A;  3L7Z C;  3IAY A;  1PA6 A;  1WTP A;  1L1O A;  4ZKB B;  4JBM A;  1GUW A;  3QG1 A;  1PYS B;  3DM1 A;  3F2B A;  3QWN A;  4DAY A;  1XPO A;  1KAB A;  4AQY Q;  5CGK A;  4FDB A;  4WJW A;  1VMC A;  1QIL A;  2L11 A;  3NBH B;  1MBY A;  4QGU A;  4DV5 L;  2WB1 B;  1JJG A;  1A2U A;  1ILP A;  4DK3 C;  2JP1 A;  2RHS B;  2EOT A;  4DKA C;  2K32 A;  5L37 A;  2B2U C;  4A3I H;  2ZJR A;  1XNQ Q;  4C3J G;  3NQI A;  5T1G A;  3TS0 A;  2BH8 A;  1BDO A;  2E76 C;  4DPG A;  4TKO B;  4FNF A;  4P74 A;  1RF2 D;  1H9M A;  3KK7 A;  1PYB A;  2JA8 H;  4NDX A;  1PVO A;  3C2P A;  3NHH A;  3T56 B;  5IGC A;  2CWA A;  3VR6 A;  1KL9 A;  3ERO A;  3SEB A;  2F0P A;  4LK1 C;  4BY1 H;  4DV5 Q;  4IPD A;  3VR5 A;  1CA6 A;  5EPK A;  3VYT A;  1QNK A;  1EY8 A;  1RD9 D;  3ND8 A;  4A93 B;  2QF7 A;  2NWG A;  3CPW A;  4MZ9 A;  1BUV T;  1I6H B;  3A74 A;  4APV A;  1STH A;  3GTP H;  1HA6 A;  1XTD A;  3BG3 A;  4YCV A;  2F0S A;  2RBM A;  1VQF A;  4FXK C;  2E75 C;  2NVQ B;  1O78 A;  1NY4 A;  1BQQ T;  3S9W A;  3NE5 B;  2EYJ A;  1XXG A;  4KJN A;  3JC6 6;  3E0J A;  2PCF B;  2V1C C;  3ICE A;  1VF5 C;  5CV7 A;  2IX0 A;  2UXD L;  3MC0 B;  2NTT A;  1RL2 A;  2BE5 C;  1U4R A;  1NE3 A;  2AQ1 B;  1ILQ A;  3BZC A;  2NBF A;  3NUC A;  2NVY H;  3GD7 A;  4B08 A;  4DR1 L;  2E2J H;  2B39 A;  1Y1V H;  3A5U A;  4A3D H;  4A3G G;  1TWC B;  1PYW D;  4Y7N B;  5M3M H;  2CCZ A;  2JA5 G;  3G6J B;  3PO2 B;  3KBG A;  2OXP A;  2WB1 G;  1XX8 A;  4MTK A;  1UE6 A;  1WD1 A;  3J81 j;  3EJI A;  1Q8I A;  2NUC A;  1EOV A;  4V19 0;  4UY8 C;  1Y8P B;  1SRO A;  1EY7 A;  3K5M A;  4H02 A;  5EQ0 A;  4JI1 L;  3TS2 A;  5D3I B;  1QZH A;  3C1F A;  3GTJ H;  2UXD Q;  1PZJ D;  2VUM G;  3CQZ B;  3RLF A;  3R2T A;  4FXG C;  4RKL A;  5C4Z A;  4HJ7 A;  1D1K A;  4DR1 Q;  1VQ6 A;  1OXU A;  1SNM A;  5IE8 A;  1B2T A;  2KCM A;  1I5F A;  2EE1 A;  3OSO A;  4GOP A;  2PW7 A;  3LX0 A;  2B2T A;  5FLX L;  3S1R B;  2R6G A;  4A3K H;  3J7A F;  3D4R A;  3FKI G;  1TS2 A;  2CH4 A;  1V9P A;  2EY2 A;  2VB3 X;  2F4I A;  2LY7 A;  3OYY A;  2HUG A;  5BN3 A;  1T5E A;  1WI5 A;  2A6H D;  2MJ8 A;  5C3W A;  4A93 G;  4KK7 A;  3TME A;  4PZ6 A;  1DCZ A;  1HZ9 A;  1SFO B;  1BR9 A;  5JOB A;  1WVL A;  1JIC A;  4PMW A;  4JI1 Q;  3U9S A;  5G3L D;  2KHS A;  1E1O A;  3IL8 A;  4K6D A;  1Y8O B;  5D65 A;  1PRT B;  5IYB G;  1NMG A;  4CDE C;  4AYB B;  3NBH A;  1YJ9 A;  1I50 B;  4IQZ A;  3TP5 A;  3A8I E;  5EPJ A;  1CKN B;  5HGT A;  4DUY L;  4CKE A;  4K5V A;  2UUC L;  1D5Z C;  4JI0 L;  1CTM A;  4K0K L;  4LAA A;  3VR2 A;  1OXS C;  2QGQ A;  4OGQ C;  5C3E B;  4DR4 L;  2SOB A;  3KBX A;  1WTV A;  1X9N A;  4JYA L;  5C4J H;  4XT3 B;  2VB2 X;  2E5L L;  2F03 A;  2R93 H;  1G51 A;  4IZ8 A;  2R61 A;  5I9O A;  4RWS C;  4KY7 A;  3BYY B;  1Q12 A;  1I94 L;  4H44 C;  4RG1 A;  2O5J C;  3BZD B;  2E2H B;  1KC8 C;  1HPC A;  3W1B A;  1ESR A;  2H1E A;  4IUU A;  3PO2 G;  1IBK L;  4B9X A;  5J22 A;  4R8I A;  4P75 A;  1Q7Y C;  5IIF A;  5FK9 C;  1UE1 A;  1XJV A;  1E24 A;  2JE6 I;  2TSS A;  4KHP L;  4GN5 A;  2MHV A;  2PQE A;  1XNR L;  4IOC A;  1G91 A;  1D5M C;  1JWU D;  3AFQ A;  1GHJ A;  1HTP A;  3RMH A;  4DUY Q;  1C9O A;  2UUC Q;  1PTO H;  1Q1E A;  1ENC A;  4K0K Q;  2K4K A;  1IKM A;  2FFK B;  5FLX c;  2I46 A;  4DR4 Q;  4JYA Q;  1HH2 P;  4IJL A;  2AUK A;  2E5L Q;  3HKZ B;  2PZT A;  1GOZ A;  1PDQ A;  1EEF D;  4C56 C;  1I94 Q;  1S5C D;  1LT3 D;  3SHL A;  5A35 A;  5C4X B;  2K52 A;  3S17 B;  4I7Z C;  2HD3 A;  1B3A A;  3BDL A;  3VYR A;  1A2T A;  3A55 A;  5FJ8 H;  1LLR D;  3P7J A;  3M3Y B;  1EZ6 A;  5EGT A;  1BKB A;  4JI3 L;  1IBK Q;  4A3C G;  5IT9 c;  3D0F A;  1ONL A;  1HA5 A;  1NR2 A;  1LTS D;  5LMN W;  1VQG A;  4EQP A;  4C3I B;  5I9P A;  4KHP Q;  1XNR Q;  1ASY A;  3M7N A;  5M5Y B;  3I4N G;  2Z6K A;  3I4O A;  3GDE A;  2UXC L;  4XYO A;  4GKJ L;  1K8M A;  4PNY A;  1S5B D;  4G7H C;  3J80 c;  3RZD H;  1SNQ A;  1Y1W G;  1LTL A;  3OIQ A;  1UEA B;  1VQN A;  3S2H B;  1OTC A;  5C3E G;  1TS4 A;  2K5Q A;  5C5L A;  1VQL A;  4GZY C;  5TSS A;  1PH6 A;  4PZ8 A;  1VQD A;  2XRS D;  3NTI A;  3L3O C;  1ML0 D;  2Y0S G;  3E9H A;  4JI3 Q;  3M4O B;  1I4X A;  3QIA A;  4R1J A;  1Q90 A;  1CUK A;  2K14 A;  2PMZ E;  2QCP X;  5M9O A;  1AFP A;  1C4Q A;  3LWU A;  1Q3L A;  1X65 A;  3Q6S A;  2A5H A;  3KLR A;  4NPS A;  3I4M H;  4ID6 A;  3K81 C;  1A6X A;  2A68 D;  4RGM A;  1BBX C;  4GKJ Q;  3EFX D;  4HID A;  4UHV A;  2A74 C;  2L12 A;  3NWS A;  1A3V A;  3CKI B;  3A5Z B;  5IYD G;  2ZM6 L;  4C3H H;  3FMC A;  3P20 A;  2F0J A;  1SYE A;  3I3C A;  4HSV A;  4OX9 L;  4X3U A;  1KDC A;  2H4O A;  1CKM A;  2QA4 A;  2ZXP A;  1CKN A;  4OEM B;  3GTQ H;  1HNX L;  3CCQ A;  3URY A;  3GP7 A;  5C4X G;  1LTR D;  1IL2 A;  2I5L X;  1E2Z A;  1BBU A;  4BY7 B;  1K28 A;  3CCM A;  4LF4 L;  4BA2 I;  2QIL A;  1H95 A;  4GLA C;  4A3J H;  2YU9 B;  1O80 A;  2HQE A;  2A69 D;  2NVT H;  1K3R A;  1Q46 A;  3GQB A;  1H9S B;  4K2L A;  4DN4 M;  1EQT A;  1ET6 A;  1IBL L;  3PIO A;  3GTM H;  3H0G B;  1JB7 A;  4C3I G;  4HCE A;  4KN7 C;  2J0T D;  1Q81 C;  4EVO A;  1IW7 D;  5IP9 G;  3HFZ B;  2ZM6 Q;  5I6W A;  1VQ9 A;  4DV1 Q;  4OX9 Q;  1STB A;  1TWA B;  1GUS A;  2NN6 I;  1HNX Q;  2IX1 A;  4F87 A;  1EYG A;  2KJX A;  3GTL H;  4OWX B;  2N55 A;  1UWV A;  2WB1 E;  1VQ7 A;  4LF4 Q;  1Q82 C;  3WOF A;  3PO3 H;  4R4C A;  2A8V A;  2PNH A;  1CHP D;  2F0M A;  1MJE A;  2PQA B;  3K59 A;  4RH6 A;  1PMR A;  1CZG A;  3KOJ A;  4RFB A;  4F8M A;  1QVG A;  1IBL Q;  1KRS A;  4BBS B;  1A63 A;  2SNS A;  2JEA I;  5JJL A;  3MA2 B;  2WAC A;  3Q22 A;  3D6C A;  1SMY C;  2ZJP A;  3S15 H;  3HOY H;  1LTG D;  3A7A B;  2EYO A;  4N8F A;  1N36 L;  1EOT A;  2NZH A;  3QOL A;  3U58 A;  3PIP A;  2NVX H;  5G3L F;  3HOX G;  3H6M A;  1O7Z A;  3HOV H;  2BH2 A;  1YVC A;  3HOZ H;  3T1Y L;  1D5X C;  5A2Q E;  3E9I A;  3CCS A;  1QZG A;  1HQM C;  1S4Z A;  2EQS A;  2HDL A;  5GAG C;  2LS0 1;  1YNN D;  3AMU A;  2PNR C;  1P16 A;  5LL6 X;  2XTI A;  5E1F A;  1YNJ D;  3PSI A;  2N88 A;  3V96 A;  3A56 A;  2EVB A;  4BY7 G;  1TWH B;  2EIF A;  5LMU L;  4IFD H;  1PRT D;  2VL6 A;  1WTH A;  2LMC B;  2B29 A;  1PHJ A;  3HOZ B;  5C0X H;  4EQN A;  3OIP A;  3H91 A;  1N36 Q;  1F2M A;  4S3S A;  1VQH A;  3H0G G;  4JBW A;  5IOD A;  1W6J A;  3OMC A;  4POG A;  2VNU D;  4CHT B;  1VQM A;  2F0Q A;  2NN6 H;  2JK8 A;  1SYD A;  3TDQ A;  3T1Y Q;  1VQ4 A;  1PFS A;  1SNO A;  2B2W C;  2R7D A;  3KLS X;  5E4X A;  1SJH D;  1JQY D;  2JA7 G;  3CC2 A;  3ONA B;  4X64 L;  1SYB A;  3V05 A;  5JAV A;  3CRK C;  2K5V A;  2EDG A;  2K1B A;  1B1Z A;  4M1U B;  2EYL A;  2Q8I B;  5GAH C;  5LMU Q;  4A3B B;  1MGS A;  2PZU A;  2F0D A;  4KI0 A;  3AEV A;  1HRJ A;  4PV1 C;  1PZI D;  4JC0 A;  4XQJ A;  5JEA H;  4BBS G;  3E3X A;  5KNB A;  2L1B A;  4C2M B;  4BXX G;  1VQI A;  1VQA A;  5AFW A;  1IYV A;  1AH9 A;  1SE2 A;  3DHQ A;  3S1M B;  3I73 A;  1H9S A;  1TWG H;  5I6Y A;  2KHI A;  5KEE A;  3U4V A;  4L63 B;  1LAB A;  1STE A;  2JN4 A;  5D14 A;  4X64 Q;  5IGD A;  3F8T A;  1BOS A;  1H9J A;  2ZTC A;  2JEB I;  1B9N A;  3P75 A;  3TQY A;  4EX5 A;  1K8G A;  4CGY B;  1GXD C;  5M3F H;  3MEF A;  1NTG A;  2KVM A;  3NXW A;  4Q0F A;  3DEO A;  1K83 B;  2D5D A;  1YBY A;  3MHB A;  1IL8 A;  1S3O A;  5LMN L;  4UDU C;  1CM9 A;  3CAM A;  4KHV A;  4A3E B;  1FD7 D;  3VR3 A;  2FMM A;  4FF4 A;  2NTS A;  2E2I B;  1IHZ A;  2PQA A;  4FF2 A;  5J39 A;  2VQE L;  4RA8 A;  1SEB D;  4R4O A;  3RNU A;  1I3Q H;  1STA A;  2QW7 A;  1JJ2 A;  3GTK B;  2PW5 A;  3G48 A;  1SDF A;  1JB3 A;  4LUZ A;  2B2U A;  2SEB D;  3BVM A;  3GTO H;  5GRO A;  2ASB A;  2L4N A;  4L8J A;  4PMB A;  3J81 L;  1HZA A;  2EY6 A;  2Y0S E;  3EA6 A;  1SRU A;  1YHB A;  2Z4I A;  4JOI C;  3ULJ A;  2MGS A;  3TZU A;  1HUN A;  4KN4 C;  2GN5 A;  3S16 B;  3M4Y A;  4X6A H;  2R3Z A;  1PH5 A;  3F2U A;  4KKT A;  4GNX C;  4A3B G;  3K7A B;  4L5S A;  5LMN Q;  5IY0 A;  3HOU H;  2XRQ D;  4FYD A;  3SK5 A;  1F2Y A;  3M4Q A;  4HN7 A;  5EBC A;  2JXM B;  2Z9H A;  1ZXT A;  4ODG A;  3I8Z A;  2VQE Q;  1ROD A;  1H9R A;  2A73 B;  2XN9 C;  5HUR A;  1AZP A;  1RHP A;  2MQH A;  4HSP A;  1U9R A;  1JJC B;  2K28 A;  4R8N A;  2C9O A;  5JPN C;  4KD3 A;  3TRE A;  2EPB A;  4C1N K;  2AHO B;  4WRD A;  1KDA A;  1STG A;  4WOR A;  1KD1 C;  4FXD A;  3KUP A;  4NKL A;  2MNA A;  1J5E L;  4X3K A;  3C1E A;  1GUN A;  3WDN A;  4LF6 L;  1V8Q A;  2F0V A;  2R92 G;  4JW0 A;  3GO5 A;  3I2Z A;  2K33 A;  4LUO A;  1DGS A;  4HIO A;  1ICF B;  5J3B A;  4BA1 I;  2VUM H;  3T51 B;  3S1Q H;  3RD4 A;  1HZC A;  3MEH A;  3NSW A;  1EWC A;  2GVB A;  4G57 A;  3BS1 A;  4LFB L;  3DEP A;  3NK9 A;  1HQR D;  3NTH A;  2UU9 L;  3AYH B;  4A3E G;  1BO0 A;  1PH3 A;  4A3F G;  2JQO A;  2D0P A;  5ELE A;  1V1P B;  2ZJQ A;  1QOH A;  4IUN A;  3HRZ C; 
#chains in the Genus database with same CATH homology
 4ULL A;  2K04 A;  4A3I B;  3SR1 A;  4RCO A;  2B8G A;  1FNV A;  2B2Y A;  4TSS A;  1BF4 A;  3MFG A;  5CMD A;  1BCP C;  5FKA C;  1D2B A;  2Z8L A;  4KD4 A;  2IX3 A;  2JA8 B;  4ZQ3 A;  1AW7 A;  4K6L A;  1EYA A;  4DAV A;  1LAC A;  4ZUJ A;  4NP5 A;  2IW3 A;  1VMP A;  4PMC A;  1J8I A;  4BY1 B;  2M9V A;  1E2W A;  1PRT F;  1EY4 A;  2MUY A;  2WV6 D;  4RAU C;  2X69 A;  3GTP B;  5ELD A;  1LT4 D;  1ZYR C;  2L0C A;  5I2X A;  2TMP A;  2KQ3 A;  3HOW B;  5C5M A;  1R4P B;  1GJX A;  3T4A C;  5FO9 B;  2NVY B;  1CQV A;  4WFN 3;  1L0X B;  4KY6 A;  1JWS D;  3NBI A;  5E4W C;  4DAP A;  2E2J B;  1DM0 B;  2F1M A;  3Q23 A;  1Y1V B;  4A3D B;  2X6L A;  1DJR D;  1B50 A;  1EEI D;  4BWG B;  4CJ2 C;  5CR3 A;  3D3R A;  5M3M B;  2A6H C;  3SDZ A;  3Q0A A;  1OXX K;  1AN8 A;  4B9W A;  5T1I A;  3PUX A;  1HFN A;  2KCN A;  5F2D A;  3GTJ B;  5EKK A;  1IKL A;  1ESF A;  1JOO A;  2L9H A;  1EL0 A;  2E74 C;  4JK1 C;  3J7A V;  3LWE A;  1EY6 A;  3UI2 A;  5IT9 E;  1EU3 A;  1TS5 A;  5DEH A;  4A3K B;  2ICI A;  3OW7 A;  2EZV A;  2F3W A;  2L5T A;  4HAE A;  2K5W A;  5KNC A;  1XTC D;  4IUT A;  5KND A;  3NQT A;  1CZW A;  3HGB A;  2F0K A;  3J80 E;  2K5D A;  1L0Y B;  2KEE A;  4H13 C;  5EPL A;  3A54 A;  1LT5 D;  2PPB C;  1PFB A;  4KMU C;  3HZX A;  1HHV A;  4IUV A;  5C4J B;  2GA4 B;  2R93 B;  3MAQ A;  1EZ8 A;  5JVG 3;  4E6I A;  2RA4 A;  2RDG A;  3IFT A;  3MWY W;  2EJF C;  2AWN A;  1PZK D;  2BOS A;  2HCI A;  2B2T C;  5IGG A;  1II3 A;  5IGB A;  1ET9 A;  3K57 A;  2LFN A;  1CQF A;  4HMI A;  1HXY D;  1LO5 D;  3T16 A;  1SE3 A;  2PYK A;  4V0B A;  1PTO B;  3PUZ A;  1CFM A;  1KNE A;  2XWJ B;  2Z4H A;  1LTA D;  2CQA A;  5I2Y A;  4J6H A;  3MZ5 A;  2A6E D;  4QF4 A;  5KRU A;  4R9W A;  2A68 C;  2NYZ D;  2ZXR A;  3QOJ A;  1TKW B;  3P1H A;  1X32 A;  5K36 H;  2X6G A;  1W6K A;  2FHT A;  1B53 A;  3RZD B;  1TR5 A;  3EVQ A;  3PIO 3;  1TU2 B;  1NUC A;  3FEW X;  1EYC A;  2BDN A;  3PV0 A;  1TT2 A;  2A69 C;  2EYF A;  3VA7 A;  1X3Q A;  2K03 A;  2DNE A;  3AB9 A;  3BVG A;  4EQO A;  2F0E A;  4M8A A;  3HS0 C;  1EIG A;  4OHJ A;  1QNU A;  3BVZ A;  1WTQ A;  1IW7 C;  3I4M B;  4HMJ A;  3R3O A;  2EJG C;  3L9A X;  2J7Z A;  4C3H B;  2DN8 A;  2RDH A;  1SND A;  3PIP 3;  3GTQ B;  2XWB B;  1LTT D;  3I70 A;  4OO1 G;  1C48 A;  1F9Q A;  1KDB A;  3X3N A;  4A3J B;  1RCV D;  5IOC A;  2NVT B;  5CV6 A;  2AQ2 B;  2XVS A;  1M4V A;  2CW0 D;  4LMQ D;  3GTM B;  3TN2 A;  1WTW A;  5COR A;  3U9O A;  3SK4 A;  1ZEQ X;  1FYC A;  2IPK D;  2F0W A;  4ILW A;  5FOB B;  5DM6 3;  2DNC A;  2D62 A;  3OWF A;  4U68 A;  1YNN C;  1RKN A;  1E2V A;  1YNJ C;  2K05 A;  4KKU A;  5CC4 A;  3GTL B;  4RGT A;  5EBD A;  5EKL A;  3PO3 B;  2RQX A;  3H09 A;  1PRT C;  3A8K E;  4RGO S;  5CV8 A;  1MI2 A;  1SBB B;  3GV6 A;  3D4W A;  1SNC A;  2KOL A;  4ZLT F;  3S15 B;  3HOY B;  1SSO A;  4OIJ A;  1D1I A;  1B44 D;  1BCP B;  2NVX B;  1MSH A;  4ZAI A;  1JWM D;  5A2Q L;  3HOV B;  4ABN A;  1LTI D;  2MPM A;  5ELC A;  1ICW A;  4C3H G;  5KIX A;  3LNN A;  3RUZ A;  3OHX C;  2EYH A;  2B2V C;  1QWY A;  3NPP A;  3QJY A;  2Z1C A;  4DA2 A;  1NR4 A;  3VA5 A;  3W3A A;  4IUQ A;  5IGE A;  3M85 A;  4X3T A;  2KUM A;  1F2L A;  2LKV A;  1PXU A;  3ND9 A;  1HCZ A;  3JAM E;  2NB0 A;  4Z9C B;  2KCC A;  1I4H A;  3H3V C;  3MXG A;  1A3T A;  2JSO A;  1B9M A;  2XSC A;  1JC7 A;  1TVX A;  5DNF A;  4ZUI A;  5CBA E;  3N52 A;  2O5I C;  2OT2 A;  1PTO D;  2FJ2 A;  3GV3 A;  3DXJ C;  2EXZ A;  3ITP A;  2O4X A;  1TY2 A;  2KED A;  3D4D A;  1TWG B;  2WAQ B;  1G6Z A;  1AP0 A;  1PFN A;  2EY5 A;  2F0L A;  3K5L A;  5CYU A;  3MXN A;  4OL7 A;  5M3F B;  2V4D A;  4O42 A;  3BYT B;  1NAP A;  1KAA A;  2IJ0 A;  3SVM A;  3FRP B;  4IFD G;  4KJO A;  5FO7 B;  4XDX A;  1GUT A;  1LT6 D;  5C0X G;  4CBV A;  1QG7 A;  1QB5 D;  1DOM A;  1CA5 A;  2Q8T A;  2SDF A;  5JJZ A;  1I3Q B;  3PUW A;  1B4O A;  4KHZ A;  4K14 A;  4O1N A;  2DY7 A;  3GTO B;  4KKS A;  2JYO A;  3IKJ A;  4IAL A;  1QE6 A;  2DY8 A;  2QEJ C;  3MTS A;  1C8C A;  1DZ1 A;  1Z6H A;  2J4X A;  1V43 A;  3HOU B;  1SE4 A;  1OXT A;  5JEA G;  4XT1 B;  4N9P A;  3TZD A;  3I4L A;  4XYQ A;  4A3G B;  3TBI B;  1SYG A;  4KY5 A;  1J9O A;  2JA5 B;  1V1O A;  1K8O A;  4L6T B;  3VR4 A;  2WP8 J;  3X3M A;  2WKD A;  2XIW A;  2OEO A;  5EJW A;  1FGB D;  2K7V A;  1U4P A;  1LTB D;  3BDC A;  4HTH A;  2VUM B;  3S1Q B;  1RDP D;  1M8A A;  2IL8 A;  2ZT9 C;  5D3D A;  1FNW A;  4I65 A;  4UAI A;  4IN3 A;  3FKI B;  1TII D;  1A15 A;  1JOK A;  1F9P A;  1FR3 A;  3AU7 A;  4QCL A;  2EY1 A;  5LHY 1;  1I4Q A;  1G2T A;  1E0B A;  1EWH A;  2F0I A;  4FVM A;  1EIH A;  2F0O A;  3MVV A;  1QJO A;  4RCN A;  3KF8 A;  4IFD J;  1SJE D;  1HTL D;  4DK1 A;  4Q5V A;  5C0X J;  5KGU A;  1NSN S;  2WKC A;  1BCP D;  4U67 3;  4TQU S;  4ZK9 B;  1HUM A;  3BDO A;  4QUC A;  3CRL C;  1VF7 A;  4F7X A;  1ZKO A;  3DMU A;  3DUZ A;  2BE5 D;  2B8F A;  1SXT A;  2HCC A;  4MHE A;  3I91 A;  1G8Z D;  1XWE A;  3NP8 A;  2B2Y C;  3D31 A;  3NTK A;  1ZYR D;  5FLX E;  2C5C A;  3T13 A;  5JEA J;  1AEX A;  1SYF A;  4XXE A;  5NUC A;  1F77 A;  1U4L A;  1EFI D;  2R7Z B;  1EY9 A;  3TP8 A;  1JR0 D;  1PTO F;  4DXG A;  3E6Z X;  1A3U A;  4DXF A;  3OPO A;  2F0T A;  2K6A A;  4K2K A;  3O13 A;  1RTN A;  4G4K A;  1H9K A;  2AQ3 B;  2KEC A;  4QB4 A;  2BA1 A;  4CJ1 B;  4OO1 I;  1WCM B;  1TS3 A;  5IT9 L;  3MXP A;  2SNM A;  3I4N B;  2CHB D;  4H7B A;  2G9D A;  5COY A;  3K5O A;  1R4Q B;  1WTR A;  1Y1W B;  1V1P A;  2D2C C;  2XNA C;  3HP3 A;  5C6A A;  1F2Z A;  4G7O C;  3Q24 A;  3J80 L;  5CBE E;  2Q8R E;  5E3F A;  1STN A;  2Y0S B;  1OO9 B;  1PLF A;  2F0U A;  3SE0 A;  2EYM A;  3I90 A;  1TY0 A;  3VYS A;  2BDO A;  5K5P A;  4QMG A;  4RGN A;  1CI3 M;  1FNU A;  2ID0 A;  3FDT A;  2KA7 A;  1SAP A;  3S2D B;  4DGZ A;  4K5W A;  2I07 B;  3V2T A;  4CKC A;  5KYI A;  3ERQ A;  2A6E C;  4QUF A;  4CKB A;  1WD0 A;  4K8I A;  3PMF A;  2L55 A;  4P2C B;  2OF1 A;  3S14 B;  4OO1 H;  4MIU A;  1Z7T A;  2EJM A;  3IFD A;  2IT1 A;  3A8J E;  1GUG A;  1Z47 A;  4K5X A;  3WOE A;  3ZYY X;  4MN3 A;  3N6R A;  1DD2 A;  3K58 A;  3FVQ A;  3DWP A;  2EYP A;  2M2L A;  4IUP A;  1EY5 A;  3SK6 A;  1F9S A;  4XIG S;  1CT1 D;  4F88 A;  1EQV A;  1OXV A;  1EYD A;  5FO8 B;  4PQX A;  1JOQ A;  4X3S A;  1Q1B A;  1I4P A;  3DWA A;  1MD2 D;  3QO2 A;  1KNA A;  2G9H D;  1PFM A;  3SK8 A;  2F3V A;  1BXT A;  3HOX B;  1DYQ A;  3E5S A;  5EKI A;  1ENF A;  1S5D D;  3M7G A;  2BCO A;  1Y69 U;  3OWE B;  1UNS A;  3T53 B;  4RKB A;  5C44 B;  1SNP A;  1IYU A;  3MXU A;  1BCP F;  3OMG A;  1O7Y A;  2CW0 C;  3K5N A;  4A3M B;  3R93 A;  5JPM C;  3W2D A;  1QCB D;  4FO2 A;  5ELB A;  4FF3 A;  2RSN A;  4ZRZ A;  2RDF A;  2PO4 A;  3EQL C;  2WIN B;  1JCK B;  3C46 A;  5I4D A;  3QB3 A;  2ICE C;  4IFD I;  1I4G A;  3TSS A;  3RZO B;  4IUR A;  3I72 A;  3K0Y A;  5C0X I;  4BBR B;  4KTA A;  1S5F D;  2JA7 B;  1JE4 A;  4ME5 A;  2JA6 B;  3VYU A;  2B2V A;  4RHS A;  2B2W A;  1D6E C;  2M00 A;  5LL6 S;  2RSO A;  1GHK A;  2BA0 A;  4CJ0 B;  2VXW A;  4HR7 B;  1STY A;  1RJT A;  4OIK A;  3FPU B;  5K36 G;  2FMC A;  4DNR B;  3DWQ A;  2HDM A;  5J1Z A;  1EY0 A;  1DOL A;  5DAU A;  5CV5 A;  3G7L A;  4H0L C;  1WTO A;  3NWT A;  4XQN A;  5CV4 A;  1DXM A;  2AWO A;  5C4H A;  4FP5 D;  3CU7 A;  2F0N A;  2D9U A;  1LV9 A;  1SMY D;  3S1N B;  4HCS A;  2B63 B;  1G2S A;  2F0F A;  4DNT B;  1O7L A;  5M5W B;  3CHB D;  5ELF A;  4RHR A;  1BNZ A;  4TRD A;  1F9R A;  4DF7 A;  4XTC S;  1G29 1;  2RVL A;  4KV6 A;  2ZXO A;  3D6W A;  3HG9 A;  2YYZ A;  4DFA A;  5CV9 A;  4J1M A;  3K6O A;  2F0G A;  3HEJ A;  1I6V C;  3A7L A;  2CVR A;  3R2I A;  3FPP A;  1KLG D;  5IGF A;  1R9T B;  5ISR A;  1WTX A;  2FIN B;  3TP7 A;  5C3X A;  1PTO C;  3TP6 A;  3GTG B;  1I4R A;  5BN4 A;  1RTO A;  3JAM L;  1UUP A;  1S5E D;  4DK0 A;  1DOK A;  3KLS A;  3J7Y W;  3D8G A;  3SXH A;  2MP1 A;  1GUO A;  1KTK A;  2F0H A;  1U4M A;  2ENB A;  2RKS A;  3MFY A;  3OOC A;  4J8Q A;  4XQQ A;  1HFG A;  1EU4 A;  1XYI A;  2E2D C;  2QKI C;  5M5X B;  1UAP A;  3R8B A;  4NW2 A;  3H94 A;  4QIW B;  1DON A;  2WII B;  4ZKC B;  2IWH A;  3C3L A;  1NCV A;  1T5X D;  4YIJ A;  2R92 B;  1ENA A;  2PMZ B;  4C1N I;  4ZYS A;  1TWF B;  4BS9 A;  2PZW A;  4LJZ C;  1AZQ A;  4C3J B;  4EGV A;  1SYC A;  3PUV A;  4G7Z C;  3J81 E;  1Y8N B;  3PUY A;  2AUJ D;  4FF1 A;  4A3F B;  4NMZ A;  5DM7 3;  1JOR A;  4HED A;  5KYL A;  2NN6 G;  4DU9 A;  1TQO A;  5BN5 A;  1CK1 A;  2QDB A;  1VCI A;  1MSG A;  1X3P A;  5JVH 3;  1VDZ A;  1KLU D;  1CHQ D;  4K8J A;  2NZ1 D;  4N9T A;  2K01 A;  2O2L D;  3L7Z C;  3IAY A;  1WTP A;  4ZKB B;  1GUW A;  3QG1 A;  3DM1 A;  3QWN A;  4DAY A;  1KAB A;  5CGK A;  4WJW A;  1VMC A;  1QIL A;  2L11 A;  1MBY A;  2WB1 B;  1A2U A;  1ILP A;  2JP1 A;  2EOT A;  2K32 A;  2B2U C;  4C3J G;  3NQI A;  5T1G A;  1BDO A;  2E76 C;  4TKO B;  4FNF A;  1RF2 D;  1H9M A;  3KK7 A;  4NDX A;  3C2P A;  3NHH A;  3T56 B;  5IGC A;  3VR6 A;  3ERO A;  3SEB A;  2F0P A;  4LK1 C;  1CA6 A;  3VR5 A;  5EPK A;  3VYT A;  1QNK A;  1EY8 A;  1RD9 D;  3ND8 A;  4A93 B;  2QF7 A;  2NWG A;  1BUV T;  1I6H B;  1STH A;  1HA6 A;  3BG3 A;  2F0S A;  2RBM A;  4FXK C;  2E75 C;  2NVQ B;  1O78 A;  1BQQ T;  3S9W A;  3NE5 B;  2EYJ A;  1XXG A;  4KJN A;  3E0J A;  2PCF B;  1VF5 C;  5CV7 A;  2IX0 A;  3MC0 B;  2NTT A;  2BE5 C;  1U4R A;  2AQ1 B;  1ILQ A;  2NBF A;  3NUC A;  3GD7 A;  4B08 A;  2B39 A;  1TWC B;  1PYW D;  4Y7N B;  3G6J B;  3PO2 B;  3KBG A;  2OXP A;  1XX8 A;  1WD1 A;  3EJI A;  1Q8I A;  2NUC A;  4V19 0;  1Y8P B;  1EY7 A;  3K5M A;  5EQ0 A;  5D3I B;  3C1F A;  1PZJ D;  3CQZ B;  3RLF A;  3R2T A;  4FXG C;  4RKL A;  5C4Z A;  1D1K A;  1OXU A;  1SNM A;  1B2T A;  2EE1 A;  3OSO A;  2PW7 A;  3LX0 A;  2B2T A;  5FLX L;  3S1R B;  2R6G A;  3J7A F;  3D4R A;  1TS2 A;  2EY2 A;  2VB3 X;  2F4I A;  2LY7 A;  2HUG A;  5BN3 A;  1T5E A;  2A6H D;  2MJ8 A;  5C3W A;  4KK7 A;  3TME A;  1DCZ A;  1SFO B;  1BR9 A;  5JOB A;  1WVL A;  1JIC A;  4PMW A;  3U9S A;  5G3L D;  2KHS A;  3IL8 A;  4K6D A;  1Y8O B;  5D65 A;  1PRT B;  4AYB B;  3NBH A;  1I50 B;  4IQZ A;  3TP5 A;  3A8I E;  5EPJ A;  5HGT A;  4CKE A;  4K5V A;  1D5Z C;  1CTM A;  4LAA A;  3VR2 A;  1OXS C;  4OGQ C;  5C3E B;  2SOB A;  3KBX A;  1WTV A;  4XT3 B;  2VB2 X;  2F03 A;  4IZ8 A;  2R61 A;  5I9O A;  4RWS C;  4KY7 A;  3BYY B;  1Q12 A;  4H44 C;  2O5J C;  3BZD B;  2E2H B;  1HPC A;  1ESR A;  2H1E A;  4IUU A;  4B9X A;  5J22 A;  4R8I A;  5IIF A;  5FK9 C;  2JE6 I;  2TSS A;  2MHV A;  2PQE A;  1G91 A;  1D5M C;  1JWU D;  1GHJ A;  1HTP A;  3RMH A;  1PTO H;  1Q1E A;  1ENC A;  1IKM A;  2FFK B;  2I46 A;  2AUK A;  3HKZ B;  2PZT A;  1GOZ A;  1PDQ A;  1EEF D;  4C56 C;  1S5C D;  1LT3 D;  3SHL A;  5A35 A;  5C4X B;  3S17 B;  4I7Z C;  1B3A A;  3BDL A;  3VYR A;  1A2T A;  3A55 A;  1LLR D;  3P7J A;  3M3Y B;  1EZ6 A;  5EGT A;  1ONL A;  1HA5 A;  1NR2 A;  1LTS D;  4EQP A;  4C3I B;  5I9P A;  3M7N A;  5M5Y B;  4XYO A;  1K8M A;  4PNY A;  1S5B D;  4G7H C;  1SNQ A;  3OIQ A;  1UEA B;  3S2H B;  1TS4 A;  2K5Q A;  5C5L A;  4GZY C;  5TSS A;  2XRS D;  3NTI A;  3L3O C;  1ML0 D;  3M4O B;  1I4X A;  3QIA A;  1Q90 A;  2QCP X;  5M9O A;  1AFP A;  1C4Q A;  3LWU A;  1Q3L A;  3Q6S A;  2A5H A;  3KLR A;  4ID6 A;  1A6X A;  2A68 D;  4RGM A;  1BBX C;  3EFX D;  2A74 C;  2L12 A;  3NWS A;  1A3V A;  3CKI B;  3FMC A;  3P20 A;  2F0J A;  1SYE A;  3I3C A;  4HSV A;  4X3U A;  1KDC A;  2H4O A;  2ZXP A;  3URY A;  3GP7 A;  1LTR D;  1E2Z A;  4BY7 B;  4BA2 I;  2QIL A;  2YU9 B;  1O80 A;  2HQE A;  2A69 D;  3GQB A;  1H9S B;  4K2L A;  4DN4 M;  1EQT A;  1ET6 A;  3H0G B;  4C3I G;  4HCE A;  4KN7 C;  2J0T D;  4EVO A;  1IW7 D;  5I6W A;  1STB A;  1TWA B;  1GUS A;  2NN6 I;  2IX1 A;  4F87 A;  2KJX A;  2N55 A;  3WOF A;  1CHP D;  2F0M A;  3K59 A;  4RH6 A;  1PMR A;  1CZG A;  4RFB A;  4F8M A;  4BBS B;  2SNS A;  2JEA I;  3MA2 B;  2WAC A;  3Q22 A;  3D6C A;  1SMY C;  1LTG D;  3A7A B;  2EYO A;  1EOT A;  3QOL A;  5G3L F;  3H6M A;  1O7Z A;  1D5X C;  5A2Q E;  1HQM C;  1S4Z A;  2HDL A;  2LS0 1;  1YNN D;  3AMU A;  2PNR C;  5LL6 X;  5E1F A;  1YNJ D;  2N88 A;  3V96 A;  3A56 A;  2EVB A;  1TWH B;  4IFD H;  1PRT D;  2LMC B;  3HOZ B;  5C0X H;  4EQN A;  3OIP A;  3H91 A;  1F2M A;  4S3S A;  4JBW A;  5IOD A;  1W6J A;  3OMC A;  2VNU D;  4CHT B;  2F0Q A;  2NN6 H;  1SYD A;  3TDQ A;  1SNO A;  2B2W C;  3KLS X;  5E4X A;  1SJH D;  1JQY D;  3ONA B;  1SYB A;  3V05 A;  5JAV A;  3CRK C;  2EDG A;  2K1B A;  1B1Z A;  4M1U B;  2EYL A;  2Q8I B;  4A3B B;  1MGS A;  2PZU A;  2F0D A;  4KI0 A;  1HRJ A;  4PV1 C;  1PZI D;  4XQJ A;  5JEA H;  5KNB A;  2L1B A;  4C2M B;  5AFW A;  1IYV A;  1SE2 A;  3DHQ A;  3S1M B;  3I73 A;  1H9S A;  5I6Y A;  5KEE A;  4L63 B;  1LAB A;  1STE A;  5D14 A;  5IGD A;  1BOS A;  1H9J A;  2JEB I;  1B9N A;  3P75 A;  4CGY B;  1GXD C;  2KVM A;  3NXW A;  4Q0F A;  3DEO A;  1K83 B;  2D5D A;  3MHB A;  1IL8 A;  4UDU C;  1CM9 A;  4KHV A;  4A3E B;  1FD7 D;  3VR3 A;  2FMM A;  4FF4 A;  2NTS A;  2E2I B;  1IHZ A;  4FF2 A;  5J39 A;  4RA8 A;  1SEB D;  1STA A;  3GTK B;  2PW5 A;  1SDF A;  1JB3 A;  2B2U A;  2SEB D;  3BVM A;  2L4N A;  4L8J A;  4PMB A;  3J81 L;  2EY6 A;  3EA6 A;  2Z4I A;  2MGS A;  3TZU A;  1HUN A;  4KN4 C;  3S16 B;  3M4Y A;  2R3Z A;  3F2U A;  4KKT A;  3K7A B;  2XRQ D;  4FYD A;  3SK5 A;  1F2Y A;  4HN7 A;  5EBC A;  2JXM B;  1ZXT A;  4ODG A;  3I8Z A;  1ROD A;  5HUR A;  1H9R A;  2A73 B;  2XN9 C;  1AZP A;  1RHP A;  4HSP A;  1U9R A;  2K28 A;  4R8N A;  2C9O A;  5JPN C;  4KD3 A;  2EPB A;  4C1N K;  4WRD A;  1KDA A;  1STG A;  4WOR A;  4FXD A;  3KUP A;  4NKL A;  4X3K A;  3C1E A;  1GUN A;  3WDN A;  1V8Q A;  2F0V A;  3GO5 A;  2K33 A;  4BA1 I;  3T51 B;  3RD4 A;  3MEH A;  3NSW A;  1EWC A;  4G57 A;  3BS1 A;  3DEP A;  3NK9 A;  1HQR D;  3NTH A;  1BO0 A;  5ELE A;  1V1P B;  1QOH A;  4IUN A;  3HRZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...