4X3SA

Crystal structure of chromobox homology 7 (cbx7) with setdb1-1170me3 peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
MGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Chromobox protein homolog 7
publication title Small-Molecule Modulators of Methyl-Lysine Binding for the CBX7 Chromodomain.
pubmed doi rcsb
source organism Mus musculus
total genus 12
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4x3sA00
2DY8A 2KVMA 2KEDA 4QUCA 4IUTA 1RJTA 1Q3LA 2HUGA 2KOLA 1B53A 1G2TA 2B2VA 4IUVA 1BF4A 2L4NA 1HFNA 4MN3A 1X32A 2B2YA 2K01A 1ICWA 1X3QA 1QNKA 4XT3B 1PDQA 3LWEA 1BBXC 1NCVA 4U68A 1VMPA 4CJ1B 1PFNA 2K05A 2KUMA 2SDFA 3GV6A 2EOTA 2MP1A 2RSOA 3N52A 1QE6A 2L11A 1SSOA 2DY7A 4OIJA 5AFWA 5EPLA 3MWYW 5JJZA 2L1BA 2XIWA 2JYOA 5EPKA 4CJ2C 3UI2A 1JE4A 2Q8RE 3HP3A 2K1BA 3TN2A 1IKMA 2CVRA 3IFDA 1ILQA 1M8AA 4IUQA 1SAPA 3I90A 3R93A 5CBAE 1IKLA 1WTXA 1DONA 5EPJA 1O7YA 1U4RA 1CA6A 2NYZD 2EE1A 1XYIA 1WTQA 1HA6A 4LMQD 4RA8A 2MGSA 3DEOA 1HFGA 5E4XA 1B2TA 4RAUC 1WTOA 4R9WA 1DOKA 2BDNA 4ZK9B 2IL8A 2NWGA 2RVLA 1GUWA 1E0BA 1NR4A 5T1GA 4CJ0B 2B2TC 2KECA 1X3PA 4HSVA 4RWSC 1PLFA 1F9RA 1F9PA 2X69A 2HDMA 1XX8A 3P7JA 3QO2A 2K04A 1HUNA 4DN4M 3I3CA 3I91A 1RTNA 2K28A 5DNFA 1WVLA 1AZPA 1KNEA 1IL8A 4MHEA 3Q6SA 3D6WA 4HAEA 4UAIA 1DZ1A 1O7ZA 1HUMA 3FPUB 5EJWA 4HCSA 2B2TA 1B50A 1G91A 4ZAIA 4QUFA 2JP1A 2HCCA 1HRJA 1AP0A 2L9HA 1G2SA 5D14A 2FMMA 2VXWA 3F2UA 2B2WC 1LV9A 2X6GA 3KBXA 1RHPA 1U4PA 3GV3A 2H1EA 3MTSA 4X3SA 5D65A 1ILPA 5EKIA 1B4OA 2FHTA 2RSNA 3H91A 5T1IA 5COYA 1VMCA 2B2UC 1RTOA 1EIGA 1WTWA 1WTPA 1RODA 1HHVA 2FJ2A 2FINB 2N88A 1ML0D 2HDLA 4X3KA 1QG7A 5E4WC 1PFMA 4HEDA 4X3UA 2X6LA 2B2YC 1F9SA 1MI2A 2L12A 4X3TA 1WTVA 1O80A 1DOMA 3ONAB 2HCIA 1C8CA 3IL8A 1BNZA 2B2WA 4ZKBB 4ZLTF 1WD1A 1JICA 3I8ZA 2K03A 4IUPA 1BO0A 2D9UA 1CM9A 1B3AA 2B2UA 1NAPA 1PFBA 2R3ZA 1ZXTA 1J9OA 2MJ8A 2NZ1D 1WTRA 1DOLA 3TZDA 4OIKA 1MGSA 2J7ZA 4XT1B 4ZKCB 1G6ZA 3DEPA 3SVMA 1S4ZA 2RA4A 2MPMA 4R8IA 1KNAA 1U4MA 1NR2A 2M2LA 3G7LA 5CMDA 1EL0A 4XDXA 1TVXA 5CORA 1F2LA 1MSGA 1AZQA 2FFKB 1EOTA 1WD0A 1J8IA 1MSHA 2B2VC 1ESRA 1SDFA 3DM1A 2KEEA 4IUUA 3FDTA 2EPBA 1U4LA 1A15A 1EIHA 2N55A 4NW2A 5EQ0A 3KUPA 5CBEE 2Q8TA 1EQTA 4IURA 1F9QA 1CA5A 4O42A
chains in the Genus database with same CATH superfamily
4FP5D 2UU9L 4BXXG 1YJWA 3J80L 2EY5A 1SYBA 1BBXC 1I4PA 5C4JH 4CDEC 5AFWA 2DY7A 4GOPC 2F4VQ 2IJ0A 3MWYW 3OYYA 2NVYH 4PQXA 4CJ2C 1SFOH 4AYBB 1XWEA 2VY3A 2D62A 1WYDA 4DR6L 3HOWG 1L0XB 4CKCA 2EYFA 2E2HB 1PMRA 4LF8Q 3HOZH 2NYZD 1KTKA 1LYLA 2XGTA 4AIMA 2OQKA 4PZ6A 5M3MH 1HA6A 3KJOA 3PUXA 4KHVA 5C44H 4DV6Q 1PZJD 1ZYRC 4A76A 5E3FA 5M5XH 3A7LA 1Y1WG 4ZK9B 2NN6I 3OMCA 3I4MG 5D3IB 1V1OA 2PO4A 2N8NA 1O7IA 5J3BA 2VW9A 2UUCQ 2A6ED 5ELEA 4AYBE 4L5QA 2F0EA 2C9OA 4UY8C 5DNFA 1AZPA 4UP7A 1ESFA 1CHPD 4JBWA 3FHWA 3S1MB 1B50A 3LNNA 2JP1A 1Y14B 1S5ED 2RCNA 1ET6A 4LFCL 4IN3A 3VA5A 3JAML 5G3LD 2E2JB 3MTSA 4X3SA 4IO9A 5C0XI 3H15A 1JWUD 2FHTA 1RD9D 4DFAA 4DXGA 3J7AF 1I94L 2FJ2A 3V2TA 2F0DA 2HDLA 2I5MX 4IALA 1GUTA 4X3UA 3TP5A 2OEOA 3MC0B 2WKDA 1VQAA 3TBIB 2NVTB 3BDOA 3SR1A 3J80i 5DM73 1HR0W 3HOUH 4L63B 3W2DA 4ULLA 1RCVD 1PTOD 5AJ3Q 3DEPA 2WINB 1VQCA 2LFNA 5CR3A 3HOYB 1VF5C 2E75C 1F2LA 3FMCA 5ELNA 5FO9B 1UE7A 3KF6A 2RDHA 1HZBA 2ZJRA 4B9WA 4R4QA 1J6QA 2IHEA 1HNZQ 2KVMA 1SYDA 4X66Q 4JI2L 3V05A 4JI6Q 2G9HD 5JEAJ 3PMFA 2JEBI 3LWEA 3TREA 3J80c 2SDFA 4DUYL 4JI1L 2NVQH 5EPLA 2DN8A 2MQHA 1HA5A 2XIWA 3G71A 2E2DC 4OELB 3T1YL 1SAPA 4OWXB 3R93A 1QVFA 3JAMi 2Y0SG 1WTXA 2UUAQ 3QIAA 4GKKL 4A3EG 1HPCA 2HHHQ 5E4XA 1B2TA 3FPPA 1S3OA 1AW7A 1D6EC 1IHZA 1VCIA 1X3PA 4BXXH 2VUMG 3PUZA 1HUNA 1XMOQ 1JOOA 2XRSD 4BA2I 2OQ0A 4DU9A 3K80C 2SNSA 1PH5A 1FD7D 3NTHA 1K28A 1CK1A 2CHBD 1AH9A 4I7ZC 1Y1VG 3A54A 3GTQB 1A8VA 3J7AV 4GKJQ 2KJXA 2F0TA 3V96A 3HOWH 1G2SA 2K75A 3KBXA 4ZYSA 4H7BA 3KDFB 5C4HA 1YNXA 2PMZB 1EIFA 3H91A 2B2UC 4KN4C 2JN4A 4ID6A 1Y1WH 4QY7A 1N36Q 1HZCA 1QCBD 1TIID 2B2YC 3VR2A 5C4XB 3CCMA 1STNA 2UXCL 1L1OC 2QA4A 1ZXTA 3NWTA 2EYHA 3PV0A 5CV9A 3NPPA 5KGUA 2J7ZA 1OXTA 1RF2D 2WKCA 4JI0L 2JE6I 1K83H 2ZXRA 5FLXc 1BUVT 4G57A 5LMNW 2KHSA 1PYSB 1MSGA 3Q24A 1EOTA 3W3AA 4DV4L 1X65A 3CCSA 1PH9A 3D3RA 5JPNC 4XIGS 1SNDA 5GAEC 1UE1A 3BVMA 1IYVA 1SE4A 1EQTA 1Y8OB 1KXLA 4DR2L 1X3FA 4Q5VA 4C3JG 1EZ8A 3FKIG 3C46A 1K9MC 4P73A 5C4JB 2R92G 1VQLA 1E1OA 2ZTEA 4K6LA 2NVYB 1SFOB 3N52A 1E1TA 2BA1A 2L1BA 5EPKA 3RZOH 5M5YH 3HP3A 1PV4A 3GTOH 3HOZB 4J1MA 4RHRA 4H13C 1M8AA 4DR7L 4QQBX 5M3MB 5ELOA 2Z6KA 5C44B 1L2FA 3PO3G 5M5XB 1TWHH 1AN8A 4OX9Q 4QF4A 3MXNA 1HR0Q 5IODA 4HMJA 4OWTB 1S5DD 3C3LA 1E0BA 5CC4A 2Z4HA 3I7FA 3P7JA 3L7ZC 1JC7A 1Q12A 2I5LX 1MKHA 4DN4M 5HGQA 1I4QA 1PFSA 3URYA 2JXMB 1O7ZA 1HUMA 5EJWA 4HCSA 3OTOQ 3BZDB 4C3HB 3Q0AA 1WI5A 1JJ2A 2HCCA 1IBMQ 1HZAA 4LF5L 1VQFA 3TS2A 1G8ZD 2A5HA 3W1BA 1ONLA 4ABNA 1PVOA 1OXVA 4A3EH 3PQIA 3A7AB 2AQ1B 5T1IA 3PUVA 2DNEA 1F2YA 3UDIA 2CQAA 4N8X1 2PCFB 5C3EG 4P71A 5IT9c 2JQOA 2R6GA 1S5BD 2VUMH 3HOUB 3ONAB 2BCOA 5IGFA 3PO2G 3PSIA 1OXUA 4YWKA 1CKMA 1OXSC 2EQSA 1Y1VH 1DOLA 3H3VH 4PMWA 4C1NI 4GLXA 1EL0A 1VQGA 4B3TL 3A8IE 3A5ZB 4XDXA 2GVAA 3SE0A 4DNTB 2D2CC 1G6PA 1JJCB 3D4RA 5ELBA 1C9OA 2EZVA 4A3MG 1D1KA 4K2LA 3RNUA 4O2DA 4AH6A 4B9XA 5BR8L 3EBEA 4UHVA 2KEDA 1XNRQ 2TMPA 2A69C 2KOLA 4JOIC 3OMGA 5F2DA 3CF5A 2B39A 2NVQB 1PH3A 4OXPA 3U4ZA 2G5DA 2CW0D 1FVIA 2HQLA 4R1JA 1BCPB 1VQ4A 1Q86C 2SNMA 3UI2A 3QOLA 2SEBD 3AU7A 3ICEA 4BBSG 2K14A 1GXDC 4ZQ3A 4X65L 1PH8A 2A68D 2UUBQ 1VQ7A 3G6JB 4R9WA 5CGKA 4GOPA 2K5VA 1VS0A 2AQ3B 1VQBA 1EYCA 4FF3A 3DMUA 3F1ZA 4C2MB 1A6XA 2I0QA 4UP8A 1STBA 1QVGA 1FNWA 5LMNQ 3FKIH 1PYWD 3A8JE 2R92H 1XNQQ 2ZXOA 1SMXA 4A3CG 3D6WA 2HD3A 1D2BA 1SNCA 2OTLA 3AFQA 1A2UA 2I5HA 3F2DA 3PF4A 4DR4L 2BE5D 2A6EC 2A73B 4YCVA 3NQIA 2QEJC 2VXWA 4YHHQ 3GV3A 2H1EA 4FF4A 4A3DG 5EKIA 1H9MA 1TS5A 3MXPA 4PZ7A 5IIFA 3UDGA 3MZ5A 3K57A 2Z8LA 4JCVE 1TS3A 1PH2A 1TWFH 3R2TA 4KKUA 4X3TA 3VR4A 4B3MQ 1YBYA 4A93G 1LTRD 2UXBL 1BNZA 3D8GA 3BJUA 4ZKBB 3M7NA 2HIXA 1JICA 1BBUA 1F2ZA 2VQEQ 1K83B 3DM3A 4QB4A 1XJVA 1YNJD 1SNPA 4DR3Q 5ELDA 5JAVA 4LFBQ 4A3IB 1EQQA 2O5JC 4IFDG 3EVQA 2LXJA 3AYHB 1Q8KA 1S5CD 1PTOC 3S2HH 1OTCA 1LUZA 2F4IA 1V43A 5CBEE 3E5SA 5COYA 1B8AA 2DY8A 2L55A 1V8QA 2ENBA 1YVCA 3PO2H 3KBGA 1NBWA 3BS1A 4KKTA 3CCEA 1HFNA 4B3SQ 2WAQB 5C0XJ 1BCPD 1X3QA 1LT3D 3RZOB 2ZM6Q 4JI5L 2MP1A 2JA9A 2L11A 1LTGD 3WOEA 2B63G 2JYOA 4PV1C 3TN2A 1ILQA 1WCMG 4JBJA 4KY6A 4RGMA 1O7YA 2FMCA 4A3MH 1LTTD 2F0WA 4WJWA 1TT2A 4ZRZA 4HIDA 1NMFA 2EYMA 2E5LL 2F4VL 4A3JG 2WAQE 3RD4A 1DXMA 3PGZA 5KYLA 1LT4D 1QJOA 4RFBA 1XTDA 2K50A 2PNHA 4LF8L 2KHJA 1N34Q 3RLFA 1CT1D 3KF6B 4EQOA 3U9OA 2RHSB 4WRDA 4UAIA 4JBKA 3SGIA 1BVSA 1SN8A 2Y0SB 4N9PA 1K8OA 1G91A 1TR5A 1JWSD 4A3EB 2VQFQ 2UUCL 3BZCA 2JA6B 4BBSH 3HOXG 4LF6Q 3MFYA 3ERSX 1LT6D 2QKIC 4OO1G 4K5XA 4TSSA 1SYEA 4V0BA 4ZUIA 3X3MA 4K2KA 4JI7Q 3OW7A 2LMCB 1KDCA 2Y0SE 3CCJA 5M9OA 1GM5A 5FJ8G 4EGVA 2JA5B 3I8ZA 1BXTA 4IUPA 4A3CH 2B2UA 1NAPA 1PFBA 3Q23A 2MO1A 2JA8H 3H3VI 1X3GA 3QR8A 4XT1B 3CQZH 3A56A 1AEXA 3I4NH 2BH2A 4DAMA 3U50C 3LX0A 2NBFA 1EUJA 5M3FB 4LW1A 2FFKB 4PNYA 4A3DH 3TP6A 4LUVA 2YU9H 4KI0A 4OGQC 5AJ3L 3I4LA 3KUPA 1EU3A 4PZ8A 5I6WA 3KYHC 4NXNQ 1LACA 5JEAG 5GADC 2QCPX 1BKBA 4IUVA 3C1FA 2D5DA 4S3SA 1PZKD 1Z47A 1I4GA 2JSOA 4APVA 3HFZB 1M4VA 4XT3B 1PDQA 5BN4A 1MD2D 5IGCA 3FEWX 4KJNA 4IPDA 1K3BC 1HNZL 3ITPA 3OW2A 2A69D 1A2TA 1EFID 4X66L 1ASYA 3MAQA 3SK8A 3CMAA 1VQOA 2EYOA 2EE1A 1CTMA 4J6HA 1AE2A 1UWVA 2LS01 3E9HA 3I56A 2YTVA 3HGBA 2MGSA 3NBIA 5CYUA 1GKHA 1KQSA 4X64Q 4PG3A 1XPUA 3FKIB 1LTSD 1YZ6A 5LMUL 1EY6A 2HDMA 1XX8A 3QO2A 3NUCA 1B44D 2MUYA 4HMIA 5ELCA 3L0OA 2ATWA 1STEA 3D4DA 3BYTB 3P75A 3CRLC 1RTNA 3OSOA 2HHHL 3MEHA 1QWYA 1FJGQ 3ND9A 4JC0A 2F0FA 1WCMH 1XMOL 4RCOA 2C35B 1SRUA 3VYSA 3ND8A 3T51B 2IW3A 3EIVA 4MHEA 4A3JH 1EIGA 1HHVA 4EQPA 1MJEA 4GKJL 2UXDQ 2AQ2B 1DM0B 4EQ5A 4BY1G 2Q8IB 2PW7A 2Z6BA 3IAYA 2SOBA 3RUZA 3GTJH 1NE3A 1KL9A 3SK5A 2M9VA 3CP0A 1LTID 4MTKA 3S16H 4A3LG 3MXNB 1V9PA 1BBWA 1N36L 3GTKB 5CV6A 5A2QE 4DV1L 1U4MA 1QUQA 3GTPH 3K6OA 4FXKC 4C3IG 2O2LD 4ZUJA 4TKOB 2PZWA 3S15H 3HOXH 3S2HB 1PA6A 1SDFA 4RGNA 4OO1H 3K8AA 4BBRG 2N55A 4DR5Q 2OF1A 1X54A 2Q2HA 4KHPQ 4HTHA 2PZTA 3RR5A 3G48A 3PO2B 4KD4A 2X6LA 4K8JA 1SROA 2EY1A 4GN3B 3RZDH 4JYAQ 4IUTA 2K6AA 5FLXL 3BVGA 1G2TA 3EFXD 1STYA 2AKWB 1IBKQ 3TMEA 2DJGC 3PUWA 4MZ9A 3A0JA 1SR3A 4JI3L 1HQRD 1AE3A 2KQ3A 1RKNA 1WOCA 1I6VC 2YTXA 5DM63 2QW7A 4A3MB 4IUQA 1YIJA 4HCEA 4JK1C 1I4RA 4HR7B 3KJPA 3DLLA 3T4AC 1A63A 3I70A 2CW0C 1L0YB 4DV5Q 1KAAA 4P2CB 5IP9H 2LY7A 1JORA 1TY2A 1D5ZC 2B2TC 4HSVA 1RL2A 1YHBA 4M8AA 2EIFA 5ISRA 2A68C 4OX9L 2NZOA 2GVBA 1HR0L 2K28A 1Q7YC 1EYAA 1D7QA 1P8LA 1JE5A 1JMCA 4A3BG 4BBSB 3SK6A 4ILWA 4ZAIA 1I3QB 5J22A 5IE8A 1E7ZA 1B9NA 4DAYA 2FMMA 1RHPA 5D65A 4A3GG 1SBBB 3M3YH 1N32L 4DR1Q 1RTOA 4QJFA 2DJFC 1I50H 1LLRD 3OTOL 5KRUA 5CV7A 2B3GA 2XTIA 2BE5C 2MHVA 4IPGA 3NE5B 2OWOA 1VQMA 1CQVA 4BY7G 3ERQA 1GUGA 2JA8B 1A3UA 3S9WA 1U9RA 3CQZB 1NY4A 3MXGA 1CM9A 3I4NB 4YWLA 1CFMA 1N33Q 4IUNA 1MGSA 3S14H 4NPSA 3H0GB 4GOPB 2IWHA 4A3DB 5CORA 1LO5D 1GVPA 4RKLA 2A6HD 2EDGA 5IT9L 3RLOA 3S24A 2YU9B 4JI4Q 1PH6A 1FGBD 3I4MH 3HKZG 2KCCA 3KLSX 5EKKA 4DKAC 1YNJC 4JI5Q 2ASBA 2E2IH 2LSSA 4GN4B 1Z6HA 1JQYD 5FOBB 1PH4A 3K0XA 1IXRA 1N9WA 2YV5A 4N8FA 2N78A 1B53A 1HCZA 2K5HA 2NTTA 3DWAA 1KDBA 3J81E 4A3LH 4CJ1B 1VMPA 4KTAA 1O7LA 3PCOB 3M4QA 2F0LA 5KNCA 1YITA 2GN5A 3GTGH 4OL7A 1KIXA 3AFPA 1XNRL 4C3IH 2HQEA 1A62A 2VB2X 3TZUA 3BU2A 1ICFB 1NJIC 1CZWA 2E76C 3KOJA 1I94Q 1BCPC 4A75A 1CA6A 4YY3Q 3J7A5 2PPBC 4BBRH 1SMYD 4UDUC 5IP7G 4LMQD 2DGYA 5IWAQ 1VQPA 4K6DA 1HFGA 3SDZA 1WTOA 1D5MC 4JI8Q 2BDNA 4O1NA 1SYFA 2IX0A 2BA0A 5C5LA 2ZJQA 1EQRA 1IW7D 1STAA 2K5QA 5JJLA 5L37A 2K5DA 3M85A 2F0UA 4A3KG 2LXKA 2UUBL 3I91A 3K5OA 3Q8DA 4YCWA 3Q6SA 1XPOA 3K81C 1WCMB 2F0HA 4LF4Q 2JA7G 2IY5B 1HNWQ 1TS4A 1R9TH 5LMNL 1M1KC 4LF9Q 2RHQB 5D14A 1XNQL 1Q1EA 4A3JB 1ILPA 1ENFA 5DLQE 3BG3A 2MNAA 2F52A 1ASZA 2Q2UA 3U4VA 2L0CA 2EJMA 4XYOA 3GTJB 4HSPA 4YHHL 3IL8A 3D0FA 4GNXC 1FL0A 5J39A 2RCFA 1XTCD 3RMHA 4WJ3M 1WTRA 3CC7A 3GTPB 4A3BH 1I6HH 2J0TD 4B3ML 1K8MA 4NXML 3HOXB 1EWIA 3F8TA 3H09A 2I07B 1LABA 2PQAA 2VQEL 4A3GH 4OO1I 2KEEA 2CFMA 1STGA 1H9SA 1A15A 4NW2A 1HJPA 4RGOS 4LFBL 3RZDB 2QDBA 3TP7A 3J80E 3I55A 1CA5A 3O13A 5C0XG 4BY7H 1RJTA 4QGUA 3I4OA 1GUNA 1BF4A 1H95A 1QNKA 3CU7A 4LJZC 1NCVA 2KUMA 3GDEA 4GZYC 1BQQT 3NP8A 5JJZA 3IKJA 2WB1G 1HH2P 4H44C 1EOVA 4OWWB 5CBAE 4B3SL 4M1UB 3BYYB 2K52A 3A74A 4KN7C 3DWQA 2JJQA 2ZM6L 1WTQA 1J5EQ 4HJ8A 1TKWB 3EQLC 2BOSA 3NEMA 1HXYD 2UXCQ 3NTKA 4A4IA 1F9PA 3S1QH 5FKAC 5IGDA 3VR5A 4KLKA 1CKNA 1IL8A 2KENA 1DZ1A 3L2PA 3JAME 5K5PA 1Z9FA 5JVG3 2JEAI 1N34L 1WFQA 3M3YB 2F0VA 4IZ8A 2HT1A 2AUJD 1LV9A 1D5XC 1I50B 3NXWA 5IP7H 3BDCA 1I5FA 1VMCA 1PH1A 4C3JH 1JCKB 4FNFA 3DUZA 4K0KL 1QG7A 3E0EA 1PTOH 4R4CA 2VQFL 1QNUA 1SE2A 1WTHA 3F2CA 3K5LA 2IT1A 4UP9A 4A3KH 2PQEA 1C8CA 4LF6L 5BN3A 1YEZA 5FK9C 1SLJA 3HOWB 1MIUA 2R3ZA 1Y8PB 2NZ1D 3CHBD 4NDXA 4DUZL 5M5WH 3CCVA 1Q90A 4IPCA 2JA7H 4DR7Q 3P1HA 3H3VC 4JI7L 2MPMA 3PO3H 1KABA 1KNAA 1Y1WB 4DV7Q 3I4MB 2R7ZG 1M90C 4DA2A 5E1FA 1MSHA 1GHJA 2B2VC 3FDTA 4G4KA 2L5TA 1Q81C 5I2XA 1HTLD 2RKSA 1Q82C 1KLUD 4ME5A 4X62Q 1W6JA 3PF5A 3E3XA 1EY9A 2I46A 1VQKA 1MHWC 1GUOA 2E2HH 3KLSA 3CCQA 4DV0L 2F0GA 3MVVA 2N49A 4DK1A 4QCLA 4KD3A 4C3IB 2EOTA 1VQNA 5H1SE 5JOBA 3M4YA 4KY7A 4NXNL 2QGQA 5IGEA 3VR3A 2Q8RE 3U9SA 1IKMA 5C4XG 4CKEA 3CCUA 1LT5D 4BBRB 5KNDA 3I90A 1IKLA 1IYJB 5C3XA 5C3EH 2KCMA 4IOAA 5GAGC 3WDNA 3S1MH 3H6MA 3CD6A 2KA7A 1Z7TA 5CV4A 2NWGA 3ULLA 3IRBA 1JOKA 1LTLA 4FXGC 1QUQB 4RWSC 2IX1A 1PLFA 1W2BA 1F9RA 2X69A 3GTOB 3W5OA 5M5YB 3NQTA 1KNEA 4X64L 4B3TQ 3EJIA 1R9TB 4B3RQ 4L8JA 2AMCB 1TWHB 3K58A 1A3VA 2B2TA 1LM0A 3F2UA 2N3SA 2NUCA 2EYJA 1B4OA 2H5XA 1FJGL 4N9TA 4X3KA 2ICIA 2A19A 1TY0A 3G6EA 1MBYA 2KCTA 1F9SA 1K0SA 5M3MG 4DV6L 2R93G 2IHFA 2QILA 1EWCA 3VDYA 2BH8A 4NB3A 1GHKA 4A3BB 1I6HB 3OPOA 4LWCA 2K33A 3M9BA 4LUZA 2MJ8A 2UXDL 3TZDA 4OIKA 4DV2Q 1EIYB 2V1CC 1EY8A 4ZKCB 2Z6KC 1S4ZA 4I65A 1NR2A 3G7LA 3CCRA 1CQFA 1FNVA 2K5NA 4A3GB 3TEHB 1YJNA 2VUMB 3J81L 3DM1A 3HG9A 1PHJA 1TWAH 1ZEQX 4ODGA 4JBMA 4MNOA 4I7AA 1NNXA 4C3HG 2F3IA 4XQNA 5FLMG 1KRTA 2Q8TA 1Y1VB 2A6HC 4F87A 3J7YW 4HIOA 2EVBA 4MIUA 3OIPA 2NZHA 1Q3LA 5KYIA 1IBLQ 4DAYB 4DAPA 2WP8J 3D6CA 4YCUA 4CDDC 3C1EA 4DR5L 2B2YA 4ME3A 1B1ZA 5EBDA 4EX5A 4KHPL 4U68A 1X3EA 3T56B 2K05A 4DR4Q 2RSOA 2XSCA 1NTGA 4BS9A 1VQDA 4EVOA 4JYAL 3HOVG 2DUDA 1L1OA 2R7ZH 2K1BA 3HKZB 1IBKL 2WACA 1DONA 2LKVA 3HRZC 3MA2B 1EU4A 1XYIA 4A93H 3Q22A 4MTNA 3R8BA 3AEVA 3S1QB 2OTJA 5T1GA 3SEBA 1T5XD 3C2PA 3SXHA 3MHBA 1SMYC 3HKZE 2J4XA 1C4QA 3QWNA 2K5WA 1RIPA 4XQJA 1Y69U 4IFDH 1IL2A 3UE0A 4PMCA 3S2DH 4JI6L 1IW7C 3LGJA 4QL5A 2WFWA 2CCZA 1HNXQ 1P16A 1LTAD 1GJXA 3T53B 4TVAB 1Q46A 2EJGC 3NBHA 4C3JB 3J81i 5I6YA 1XXGA 3EN2A 2O4XA 1CI3M 4R8NA 3S1RH 2UUAL 2R92B 1AFPA 1Q1BA 3VA7A 4A3KB 1EFWA 4BWGB 2L12A 2F3VA 1O80A 1EY7A 4DK3C 1ENAA 3QG1A 4DR1L 2ZTCA 3D31A 5M5WB 2B63H 3TS0A 2D9UA 4DV3Q 2JA7B 1B9MA 4XYQA 2E74C 4GN5A 3PO3B 2M00A 5HY6A 1JOQA 5EBCA 2RA4A 2F0NA 5CV5A 4LFAQ 1PH7A 1TQOA 3QJYA 1YNND 1D8LA 4HJAA 4GNXA 1EY0A 2E5LQ 1TWFB 2CWAA 4POGA 2NVXH 1VF7A 4FF1A 1N33L 4FXDA 5EGTA 5DEHA 5IY0A 1UE6A 4XTCS 1A3TA 3BVZA 3J81c 3MXUA 4Q0FA 1WJJA 1C48A 1GD7A 4G7OC 5JJIA 2K7VA 4KK7A 4JI4L 2R93H 1RDPD 2AWNA 2XNAC 3DWPA 3F2BA 2MFIA 5FO7B 4RCNA 4JV5Q 3HZXA 3M4OH 4CGYB 3GV6A 1D1IA 1PRTF 5DAUA 4CHTB 4B08A 2ZT9C 1NMGA 5C3EB 1JE4A 4JW0A 2Z0SA 5K36G 2XVSA 4KHZA 1VQ9A 4RMFA 3QB3A 3CAMA 1ENCA 3NENA 4LF7Q 1U4RA 3KF8A 5C4ZA 2QF7A 3GTLH 1Q8IA 4XQQA 1DYQA 3DEOA 2AUKA 4C3HH 5FLMH 4OHJA 2BDOA 2EYLA 3GO5A 5FJ8H 2AHOB 1JB7A 4LNQA 2RVLA 4A3IG 1GUWA 4IJHA 1YI2A 1NUCA 3UDFA 1BOSA 1EZ6A 3K5MA 1VQHA 3CKIB 4YY3L 5IWAL 2PQAB 3ZJYC 3MFGA 4JI8L 2WB1B 3WOFA 1H9SB 3T1HQ 4KJOA 3B6YA 4P75A 1IZ6A 4DNIA 4JOIA 3HOVH 4NKLA 2B8GA 2F0KA 5IGBA 2CWPA 2WAQG 3A8KE 1YJ9A 2FXQA 2X6GA 1U4PA 2F0MA 1G6ZA 5NUCA 4LF4L 5JEAH 1RODA 1HNWL 2Z1CA 3R2IA 1IYUA 1PRTB 2VZAA 3CXCA 2WB1E 4LF9L 1B7YB 1VQ5A 1HTPA 2IPKD 3GTMH 1VQJA 3KFUA 3G4SA 4UPAA 1SE3A 3FVQA 5ELFA 4R8IA 1TS2A 2M2LA 3T16A 4J15A 4TQUS 4AQYQ 3TP8A 1XMQQ 2D0PA 2F0PA 1TWAB 3STBD 1WD0A 2UU9Q 1STHA 1BDOA 3DXJC 2Q2IA 1EY4A 1IBML 2EPBA 1JB3A 3L3OC 3RLNA 1CKNB 5C3WA 5LMUQ 4A3FG 1E2ZA 2K4KA 2ALYB 3J7ZC 3PIO3 2JA6G 3AMUA 3HKSA 4OONA 2HUGA 2MO0A 2B2VA 3NTIA 2CKZB 2L4NA 5GQOA 4V190 4DR6Q 2F0QA 3I72A 5J1ZA 3SHLA 3CRKC 2R7ZB 5LL6S 3OHXC 3L9AX 5C6AA 4C2MH 1SSOA 1PZID 3BDLA 2RQXA 1JWMD 4Y52H 4G7HC 1O78A 2JA5G 2TSSA 4A93B 4BY1H 1K0RA 1W3SA 2PI2A 2XWBB 5LHY1 5I4DA 2ES2A 1PXUA 2IL8A 4POFA 1HQMC 1NR4A 5M3FG 3JAMc 1CHQD 1OO9B 3CPWA 2OXPA 4ALPA 1TWGH 3K59A 1GOZA 1FNUA 5GAHC 1J5EL 1SJHD 2VNUD 4LFCQ 4K14A 3S2DB 4DK0A 4IFDI 5A35A 4Y7NH 1V1PA 4DV1Q 1F77A 2F1MA 5IYCG 1II3A 2RDFA 1PYBA 4F8MA 5K36H 3CMEA 2L15A 2PMZE 1SE8A 2B2WC 3QOJA 4LUOA 3S1RB 2A8VA 1PRTD 1QOHA 1WTWA 3S1NH 2D0OA 4HJ7A 3KLRA 4DGZA 1CSPA 2N88A 2DNCA 4A3IH 4DXFA 1PFMA 5I9OA 2B63B 1KLGD 2CH4A 3BZKA 4JI3Q 4PMBA 1EEID 3A55A 3A5UA 2K03A 4KKSA 4FDBA 3M4PA 4RKBA 1EQVA 1FGUA 3OWEB 4H0LC 3DHQA 5KNBA 3FP9A 3RN2A 4KY5A 5EAYA 4O0AA 2KCNA 2NVXB 1G291 4OEMB 1ESRA 5FO8B 4IUUA 4AYBG 1CSQA 3P20A 4KMUC 4JI2Q 4YIJA 2ZTDA 2B29A 5JVH3 5IYBG 4DV7L 2R93B 1T5EA 4IPHA 3S16B 2B8FA 1SEBD 4JI1Q 4DUYQ 1U5KA 2KHIA 1U0LA 2NN6G 4QUCA 3PIP3 2F03A 2OCEA 3M4OB 3T1YQ 2QDLA 1B70B 3PIOA 2K01A 3S15B 4X62L 3GD7A 4GKKQ 2K32A 4R4IA 1PFNA 3W1GA 5BN5A 4OIJA 1ZYRD 3AB9A 4P74A 1V1QA 3ER0A 3ULJA 1N32Q 1B3QA 1X55A 3GTLB 5LL6X 2Z9HA 3ZYYX 4DR3L 1W6KA 4JG2A 1E2VA 2R7DA 4IJLA 1R4QB 2XN9C 4RH6A 4P72A 4R4TA 4CBVA 1NSNS 4A3FH 2JA6H 5TSSA 4EQNA 2F0SA 4RG1A 4IOCA 4FYDA 1VQEA 1BCPF 1K3RA 3VYUA 2ZJPA 4DK6C 1WVLA 3HOVB 4CKBA 1DD2A 3CC2A 1EY5A 3FPUB 3K7AH 4QUFA 1TWCH 3J81j 2JA5H 3EA6A 3N6RA 3S17H 4F7XA 5D3DA 3HOYG 3VR6A 3T13A 4C56C 2CH4W 3FRPB 3TDQA 4B3RL 4GLAC 1ET9A 3GP7A 3CC4A 3NSWA 2FINB 2WIIB 1ML0D 4QMGA 5M3FH 3RN5A 1MI2A 2VB3X 1HZ9A 3GTMB 1L1OB 4JI0Q 5IGGA 1JR0D 4FO2A 1EEFD 1S40A 4CDFC 1WD1A 5EKLA 4DV4Q 2QEXA 5IYCH 1S72A 4JVZA 2PZUA 1Y8NB 3EROA 3SVMA 1E22A 1H9JA 3OIQA 4CDCC 3KK7A 2RF4A 3E6ZX 1GO3E 4DR2Q 1FR3A 2ICEC 4R4OA 2EJFC 5A2QL 3MEFA 1G51A 3CW2C 3LWUA 3E9IA 4DV2L 1MJCA 1U4LA 1S5FD 3UE1A 1E24A 4HJ5A 1X6OA 2F0IA 5FLXE 2EY2A 1OXXK 1X9NA 1YNNC 1F9QA 3S14B 2P5ZX 3NWSA 1E3PA 2Q2TA 2RBMA 3KDFA 3NBHB 3R3OA 1CUKA 1JJGA 4KV6A 3PIPA 1T9HA 1QE6A 1SXTA 2OT2A 4BA1I 2F0JA 3CCLA 3UDXA 3TRZA 2E2IB 2JA8G 1IBLL 2EXZA 4BY1B 4DF7A 1KC8C 4L5RC 2O5IC 3WWVA 3I4NG 5I2YA 4L5TA 3KLWA 3H0GG 1CZGA 3CPFA 2C5CA 4H02A 5IYBH 4JPBW 1TWGB 3VYRA 1DOKA 4Z9CB 5KEEA 4WFN3 3OOCA 3M7GA 1BR9A 2NN6H 4K5WA 3GTGB 1QZHA 3NELA 2A74C 4Y7NB 1YHAA 4GNXB 2GA4B 3I3CA 4LF5Q 5E7NA 4HIMA 1X56A 4NXMQ 3E0JA 1VDZA 1DGSA 2EXDA 4QIWB 2G9DA 3H94A 1UEAB 1VQIA 3JC66 3K5NA 4RHSA 1HRJA 4C1NK 2L9HA 4GS3A 1EYDA 3HS0C 2CQOA 3S1NB 2AWOA 2PNRC 1FYCA 2XRQD 1SYCA 1KAWA 5IYDG 1WTPA 3GTKH 5JPMC 5C0XH 2E2JH 1KHIA 1UE5A 2VS1A 4L6TB 1C0AA 5E4WC 1HNXL 4HEDA 4WORA 2PYKA 1WTVA 1ZKOA 2E8GA 4QIWE 1DOMA 2HCIA 1GUSA 4HN7A 1I4HA 1CKOA 1L0WA 1BO0A 3OWFA 3KF8B 2NVTH 5IT9E 4ZCKA 2NTSA 4E6IA 4U673 1K8AC 4GLVB 1QILA 4YWMA 5BR8Q 1TVXA 1KRSA 1QB5D 4K5VA 3AQQA 3HOYH 4DV3L 1J8IA 3PUYA 3HOZG 2JK8A 1UUPA 5C44G 4LFAL 5GROA 2ID0A 2YTYA 4IURA 1H9KA 1C7YA 4O42A 3STBC 3I73A 4NMZA 1SNMA 4MN3A 1JT8A 1X32A 4DPGA 1ICWA 4X65Q 1H9RA 5G3LF 2VL6A 1DCZA 1LTBD 1TU2B 5JJKA 1DJRD 3D4WA 3IFTA 1QVCA 2V4DA 2CVRA 3IFDA 2KBNA 1K73C 1KDAA 2PW5A 2F0OA 5EPJA 1XPRA 4JV5L 3NK9A 4BY7B 4K0KQ 4A3FB 1VQ8A 2R61A 2ZXPA 4NP5A 4RA8A 3TQYA 4RAUC 4K8IA 1I3QH 1SNQA 5CV8A 2H4OA 4J8QA 1SJED 3TSSA 4DNRB 4CJ0B 4FF2A 2NB0A 2KECA 1PTOF 3X3NA 1EYGA 1K8GA 4LF7L 1SYGA 2K04A 4DUZQ 1UEBA 3ULPA 4TRDA 1N8RC 3HOUG 4FVMA 3HEJA 1SNOA 3K7AB 4HAEA 1KD1C 1TWCB 5I9PA 1VQ6A 4DAVA 3S17B 2YYZA 2Z4IA 1TXYA 3K0YA 4G7ZC 2EYPA 4XXEA 4WJ4A 1AP0A 3GTQH 3VYTA 4IQZA 2IX3A 2UXBQ 4RGTA 2R7FA 1YHQA 3H0GH 3T1HL 2RSNA 4HJ9A 2RDGA 4DV0Q 2A1AA 1A0IA 1R4PB 1E2WA 4L5SA 4DV5L 2F3WA 2B2WA 1PRTC 5IP9G 5KIXA 4ZLTF 1B3AA 4F88A 3NHHA 3GQBA 1J9OA 5C4XH 5HGTA 1UAPA 4LAAA 1QZGA 5HURA 2WV6D 5CMDA 2XWJB 1UNSA 1F2MA 1AZQA 1PTOB 4HIKA 2HIVA 1EWHA 5C5MA 4X6AH 5IYDH 3I2ZA 4IFDJ 1EIHA 1V1PB 5IOCA 5EQ0A 3K7UC 3U58A 4LK1C 3SK4A 4AQYL 2EY6A 2PI2E 1XMQL 1I4XA
chains in the Genus database with same CATH topology
4FP5D 3J80L 2EY5A 1SYBA 1BBXC 1I4PA 5AFWA 2DY7A 2IJ0A 3MWYW 4PQXA 4CJ2C 4AYBB 1XWEA 2D62A 1L0XB 4CKCA 2EYFA 2E2HB 1PMRA 2NYZD 1KTKA 1HA6A 3PUXA 4KHVA 1PZJD 1ZYRC 5E3FA 3A7LA 4ZK9B 2NN6I 3OMCA 5D3IB 1V1OA 2PO4A 2A6ED 5ELEA 2F0EA 2C9OA 5DNFA 1AZPA 1ESFA 1CHPD 4JBWA 3S1MB 1B50A 3LNNA 2JP1A 1S5ED 1ET6A 3VA5A 4IN3A 3JAML 5G3LD 2E2JB 3MTSA 4X3SA 5C0XI 1JWUD 2FHTA 1RD9D 4DFAA 4DXGA 3J7AF 2FJ2A 3V2TA 2F0DA 2HDLA 4IALA 1GUTA 4X3UA 3TP5A 2OEOA 3MC0B 2WKDA 3TBIB 2NVTB 3BDOA 3SR1A 5DM73 4L63B 3W2DA 4ULLA 1RCVD 1PTOD 3DEPA 2WINB 2LFNA 5CR3A 3HOYB 1VF5C 2E75C 1F2LA 3FMCA 5FO9B 2RDHA 4B9WA 2KVMA 1SYDA 3V05A 2G9HD 5JEAJ 3PMFA 2JEBI 3LWEA 2SDFA 5EPLA 2DN8A 1HA5A 2XIWA 2E2DC 1SAPA 3R93A 1WTXA 3QIAA 1HPCA 5E4XA 1B2TA 3FPPA 1AW7A 1D6EC 1IHZA 1VCIA 1X3PA 3PUZA 1HUNA 1JOOA 2XRSD 4BA2I 4DU9A 2SNSA 1FD7D 3NTHA 1CK1A 2CHBD 4I7ZC 3A54A 3GTQB 3J7AV 2KJXA 2F0TA 3V96A 1G2SA 3KBXA 4ZYSA 4H7BA 5C4HA 2PMZB 3H91A 2B2UC 4KN4C 4ID6A 1QCBD 1TIID 2B2YC 3VR2A 5C4XB 1STNA 1ZXTA 3NWTA 2EYHA 3PV0A 5CV9A 3NPPA 5KGUA 2J7ZA 1OXTA 1RF2D 2WKCA 2JE6I 2ZXRA 1BUVT 4G57A 2KHSA 1MSGA 3Q24A 1EOTA 3W3AA 3D3RA 5JPNC 4XIGS 1SNDA 3BVMA 1IYVA 1SE4A 1EQTA 1Y8OB 4Q5VA 4C3JG 1EZ8A 3C46A 5C4JB 4K6LA 2NVYB 1SFOB 3N52A 2BA1A 2L1BA 5EPKA 3HP3A 3HOZB 4J1MA 4RHRA 4H13C 1M8AA 5M3MB 5C44B 5M5XB 1AN8A 4QF4A 3MXNA 5IODA 4HMJA 1S5DD 3C3LA 1E0BA 5CC4A 2Z4HA 3L7ZC 3P7JA 1JC7A 1Q12A 4DN4M 1I4QA 3URYA 2JXMB 1O7ZA 1HUMA 5EJWA 4HCSA 3BZDB 4C3HB 3Q0AA 2HCCA 1G8ZD 2A5HA 4ABNA 1ONLA 1OXVA 3A7AB 2AQ1B 5T1IA 3PUVA 2DNEA 1F2YA 2CQAA 2PCFB 2R6GA 1S5BD 3HOUB 3ONAB 2BCOA 5IGFA 1OXUA 1OXSC 1DOLA 4PMWA 4C1NI 1EL0A 4XDXA 3A8IE 3SE0A 4DNTB 2D2CC 3D4RA 5ELBA 2EZVA 1D1KA 4K2LA 4B9XA 2KEDA 2TMPA 2A69C 2KOLA 3OMGA 5F2DA 2B39A 2NVQB 2CW0D 1BCPB 2SNMA 3UI2A 3QOLA 2SEBD 3AU7A 1GXDC 4ZQ3A 2A68D 5CGKA 3G6JB 4R9WA 2AQ3B 1EYCA 4FF3A 3DMUA 4C2MB 1A6XA 1STBA 1FNWA 1PYWD 3A8JE 2ZXOA 3D6WA 1D2BA 1SNCA 1A2UA 2BE5D 2A6EC 2A73B 3NQIA 2QEJC 2VXWA 3GV3A 2H1EA 4FF4A 5EKIA 1H9MA 1TS5A 3MXPA 5IIFA 3MZ5A 3K57A 2Z8LA 1TS3A 4KKUA 3R2TA 4X3TA 3VR4A 1LTRD 1BNZA 3D8GA 4ZKBB 3M7NA 1JICA 1F2ZA 1K83B 4QB4A 1YNJD 1SNPA 5ELDA 5JAVA 4A3IB 2O5JC 4IFDG 3EVQA 1S5CD 1PTOC 2F4IA 1V43A 5CBEE 3E5SA 5COYA 2DY8A 2L55A 1V8QA 2ENBA 3KBGA 3BS1A 4KKTA 1HFNA 2WAQB 5C0XJ 1BCPD 1X3QA 1LT3D 3RZOB 2MP1A 2L11A 1LTGD 3WOEA 2JYOA 4PV1C 3TN2A 1ILQA 4KY6A 4RGMA 1O7YA 2FMCA 1LTTD 2F0WA 4WJWA 1TT2A 4ZRZA 2EYMA 3RD4A 1DXMA 5KYLA 1LT4D 1QJOA 4RFBA 3RLFA 1CT1D 4EQOA 3U9OA 4WRDA 4UAIA 2Y0SB 4N9PA 1K8OA 1G91A 1TR5A 1JWSD 4A3EB 2JA6B 3MFYA 1LT6D 2QKIC 4OO1G 4K5XA 4TSSA 1SYEA 4V0BA 4ZUIA 3X3MA 4K2KA 3OW7A 2LMCB 1KDCA 5M9OA 4EGVA 2JA5B 3I8ZA 1BXTA 4IUPA 2B2UA 1NAPA 1PFBA 3Q23A 4XT1B 3A56A 1AEXA 3LX0A 2NBFA 5M3FB 2FFKB 4PNYA 3TP6A 4KI0A 4OGQC 3I4LA 3KUPA 1EU3A 5I6WA 1LACA 5JEAG 2QCPX 4IUVA 3C1FA 2D5DA 4S3SA 1PZKD 1Z47A 1I4GA 2JSOA 1M4VA 5IGCA 1PDQA 5BN4A 1MD2D 4XT3B 3FEWX 4KJNA 3ITPA 2A69D 1A2TA 1EFID 3MAQA 3SK8A 2EYOA 2EE1A 1CTMA 4J6HA 2LS01 3HGBA 2MGSA 3NBIA 5CYUA 3FKIB 1LTSD 1EY6A 2HDMA 1XX8A 3NUCA 1B44D 5ELCA 2MUYA 3QO2A 4HMIA 1STEA 3D4DA 3BYTB 3P75A 3CRLC 1RTNA 3OSOA 3MEHA 1QWYA 3ND9A 2F0FA 4RCOA 3VYSA 3ND8A 3T51B 2IW3A 4MHEA 1EIGA 1HHVA 4EQPA 2AQ2B 1DM0B 2Q8IB 2PW7A 3IAYA 2SOBA 3RUZA 3SK5A 2M9VA 1LTID 3GTKB 5CV6A 5A2QE 1U4MA 3K6OA 4FXKC 4C3IG 2O2LD 4ZUJA 4TKOB 2PZWA 3S2HB 1SDFA 4RGNA 4OO1H 2N55A 2OF1A 4HTHA 2PZTA 3PO2B 4KD4A 2X6LA 4K8JA 2EY1A 4IUTA 2K6AA 5FLXL 3BVGA 1G2TA 3EFXD 1STYA 3TMEA 3PUWA 1HQRD 2KQ3A 1RKNA 1I6VC 5DM63 4A3MB 4IUQA 4HCEA 4JK1C 1I4RA 4HR7B 3T4AC 3I70A 2CW0C 1L0YB 1KAAA 4P2CB 2LY7A 1JORA 1TY2A 1D5ZC 2B2TC 4HSVA 4M8AA 5ISRA 2A68C 2K28A 1EYAA 4BBSB 3SK6A 4ILWA 4ZAIA 1I3QB 5J22A 1B9NA 4DAYA 2FMMA 1RHPA 5D65A 1SBBB 1RTOA 1LLRD 5KRUA 5CV7A 2BE5C 2MHVA 3NE5B 1CQVA 3ERQA 1GUGA 2JA8B 1A3UA 3S9WA 1U9RA 3CQZB 3MXGA 1CM9A 3I4NB 1CFMA 4IUNA 1MGSA 3H0GB 2IWHA 4A3DB 5CORA 1LO5D 4RKLA 2A6HD 2EDGA 5IT9L 2YU9B 1FGBD 2KCCA 3KLSX 5EKKA 1YNJC 1Z6HA 1JQYD 5FOBB 1B53A 1HCZA 2NTTA 3DWAA 1KDBA 3J81E 4CJ1B 1VMPA 4KTAA 1O7LA 5KNCA 2F0LA 4OL7A 2HQEA 2VB2X 3TZUA 1CZWA 2E76C 1BCPC 1CA6A 2PPBC 1SMYD 4UDUC 4LMQD 4K6DA 1HFGA 3SDZA 1WTOA 1D5MC 2BDNA 4O1NA 1SYFA 2IX0A 2BA0A 5C5LA 1IW7D 1STAA 2K5QA 2K5DA 3M85A 2F0UA 3I91A 3K5OA 3Q6SA 1WCMB 2F0HA 1TS4A 5D14A 1Q1EA 4A3JB 1ILPA 1ENFA 3BG3A 2L0CA 2EJMA 4XYOA 3GTJB 4HSPA 3IL8A 5J39A 1XTCD 3RMHA 1WTRA 3GTPB 2J0TD 1K8MA 3HOXB 3H09A 2I07B 1LABA 4OO1I 2KEEA 1STGA 1H9SA 1A15A 4NW2A 4RGOS 3RZDB 2QDBA 3TP7A 3J80E 1CA5A 3O13A 5C0XG 1RJTA 1GUNA 1BF4A 1QNKA 3CU7A 4LJZC 1NCVA 2KUMA 4GZYC 1BQQT 3NP8A 5JJZA 3IKJA 4H44C 5CBAE 4M1UB 3BYYB 4KN7C 3DWQA 1WTQA 1TKWB 3EQLC 2BOSA 1HXYD 3NTKA 1F9PA 5FKAC 5IGDA 3VR5A 1IL8A 1DZ1A 3JAME 5K5PA 5JVG3 2JEAI 3M3YB 2F0VA 4IZ8A 2AUJD 1LV9A 1D5XC 1I50B 3NXWA 3BDCA 1VMCA 1JCKB 4FNFA 3DUZA 1QG7A 1PTOH 1QNUA 1SE2A 3K5LA 2IT1A 1C8CA 2PQEA 5BN3A 5FK9C 3HOWB 2R3ZA 1Y8PB 2NZ1D 3CHBD 4NDXA 1Q90A 3P1HA 3H3VC 2MPMA 1KABA 1KNAA 1Y1WB 3I4MB 4DA2A 5E1FA 1MSHA 1GHJA 2B2VC 3FDTA 4G4KA 2L5TA 5I2XA 1HTLD 2RKSA 1KLUD 4ME5A 1W6JA 1EY9A 2I46A 1GUOA 3KLSA 2F0GA 3MVVA 4DK1A 4QCLA 4KD3A 4C3IB 2EOTA 5JOBA 3M4YA 4KY7A 5IGEA 3VR3A 2Q8RE 3U9SA 1IKMA 4CKEA 1LT5D 4BBRB 5KNDA 3I90A 1IKLA 5C3XA 3WDNA 3H6MA 2KA7A 1Z7TA 5CV4A 2NWGA 1JOKA 4FXGC 4RWSC 2IX1A 1PLFA 1F9RA 2X69A 3GTOB 5M5YB 3NQTA 1KNEA 3EJIA 1R9TB 4L8JA 1TWHB 3K58A 1A3VA 2B2TA 3F2UA 2NUCA 2EYJA 1B4OA 4N9TA 4X3KA 2ICIA 1TY0A 1MBYA 1F9SA 2QILA 1EWCA 1GHKA 4A3BB 1I6HB 3OPOA 2K33A 2MJ8A 3TZDA 4OIKA 1EY8A 4ZKCB 1S4ZA 4I65A 1NR2A 3G7LA 1CQFA 1FNVA 4A3GB 2VUMB 3J81L 3DM1A 3HG9A 1ZEQX 4ODGA 4C3HG 4XQNA 2Q8TA 1Y1VB 2A6HC 4F87A 3J7YW 2EVBA 4MIUA 3OIPA 1Q3LA 5KYIA 4DAPA 2WP8J 3D6CA 3C1EA 2B2YA 1B1ZA 5EBDA 4U68A 3T56B 2K05A 2RSOA 2XSCA 4BS9A 4EVOA 2K1BA 3HKZB 2WACA 1DONA 2LKVA 3HRZC 3MA2B 1EU4A 1XYIA 3Q22A 3R8BA 3S1QB 5T1GA 3SEBA 1T5XD 3C2PA 3SXHA 3MHBA 1SMYC 2J4XA 1C4QA 3QWNA 2K5WA 4XQJA 1Y69U 4IFDH 4PMCA 1IW7C 1LTAD 1GJXA 3T53B 2EJGC 3NBHA 4C3JB 5I6YA 1XXGA 2O4XA 1CI3M 4R8NA 2R92B 1AFPA 1Q1BA 3VA7A 4A3KB 4BWGB 2L12A 2F3VA 1O80A 1EY7A 1ENAA 3QG1A 3D31A 5M5WB 2D9UA 2JA7B 1B9MA 4XYQA 2E74C 3PO3B 2M00A 1JOQA 5EBCA 2RA4A 2F0NA 5CV5A 1TQOA 3QJYA 1YNND 1EY0A 1TWFB 1VF7A 4FF1A 4FXDA 5EGTA 5DEHA 4XTCS 1A3TA 3BVZA 3MXUA 4Q0FA 1C48A 4G7OC 2K7VA 4KK7A 1RDPD 2AWNA 2XNAC 3DWPA 5FO7B 4RCNA 3HZXA 4CGYB 3GV6A 1D1IA 1PRTF 5DAUA 4CHTB 4B08A 2ZT9C 5C3EB 1JE4A 5K36G 2XVSA 4KHZA 3QB3A 1ENCA 1U4RA 3KF8A 5C4ZA 2QF7A 1Q8IA 4XQQA 1DYQA 3DEOA 2AUKA 4OHJA 2BDOA 2EYLA 3GO5A 2RVLA 1GUWA 1NUCA 1BOSA 1EZ6A 3K5MA 3CKIB 3MFGA 2WB1B 3WOFA 1H9SB 4KJOA 4NKLA 2B8GA 2F0KA 5IGBA 3A8KE 2X6GA 1U4PA 2F0MA 1G6ZA 5NUCA 5JEAH 1RODA 2Z1CA 3R2IA 1IYUA 1PRTB 1HTPA 2IPKD 1SE3A 3FVQA 5ELFA 4R8IA 1TS2A 2M2LA 3T16A 4TQUS 3TP8A 2F0PA 1TWAB 1WD0A 1STHA 1BDOA 3DXJC 1EY4A 2EPBA 1JB3A 3L3OC 5C3WA 1E2ZA 3PIO3 3AMUA 2HUGA 2B2VA 3NTIA 2L4NA 4V190 2F0QA 3I72A 5J1ZA 3SHLA 3CRKC 2R7ZB 5LL6S 3OHXC 3L9AX 5C6AA 1SSOA 1PZID 3BDLA 2RQXA 1JWMD 4G7HC 1O78A 2TSSA 4A93B 2XWBB 5LHY1 5I4DA 1PXUA 2IL8A 1HQMC 1NR4A 1CHQD 1OO9B 2OXPA 3K59A 1GOZA 1FNUA 1SJHD 2VNUD 4K14A 3S2DB 4DK0A 4IFDI 5A35A 1V1PA 1F77A 2F1MA 1II3A 2RDFA 4F8MA 5K36H 2B2WC 3QOJA 3S1RB 1PRTD 1QOHA 1WTWA 3KLRA 4DGZA 2N88A 2DNCA 4DXFA 1PFMA 5I9OA 2B63B 1KLGD 4PMBA 1EEID 3A55A 2K03A 4KKSA 4RKBA 1EQVA 3OWEB 4H0LC 3DHQA 5KNBA 4KY5A 2NVXB 2KCNA 1G291 1ESRA 5FO8B 4IUUA 3P20A 4KMUC 4YIJA 5JVH3 2R93B 1T5EA 3S16B 2B8FA 1SEBD 2NN6G 4QUCA 3PIP3 2F03A 3M4OB 2K01A 3S15B 3GD7A 2K32A 1PFNA 5BN5A 4OIJA 1ZYRD 3AB9A 3GTLB 5LL6X 3ZYYX 1W6KA 1E2VA 1R4QB 2XN9C 4RH6A 4CBVA 1NSNS 5TSSA 4EQNA 2F0SA 4FYDA 1BCPF 3VYUA 1WVLA 3HOVB 4CKBA 1DD2A 1EY5A 3FPUB 4QUFA 3EA6A 3N6RA 4F7XA 5D3DA 3VR6A 3T13A 4C56C 3TDQA 3FRPB 1ET9A 3GP7A 3NSWA 2FINB 2WIIB 1ML0D 4QMGA 1MI2A 2VB3X 3GTMB 5IGGA 1JR0D 4FO2A 1EEFD 1WD1A 5EKLA 2PZUA 1Y8NB 3EROA 3SVMA 1H9JA 3OIQA 3KK7A 3E6ZX 1FR3A 2ICEC 2EJFC 5A2QL 3LWUA 1U4LA 1S5FD 2F0IA 5FLXE 2EY2A 1OXXK 1YNNC 1F9QA 3S14B 3NWSA 2RBMA 3R3OA 4KV6A 1QE6A 1SXTA 2OT2A 4BA1I 2F0JA 2E2IB 2EXZA 4BY1B 4DF7A 2O5IC 5I2YA 1CZGA 2C5CA 1TWGB 3VYRA 1DOKA 4Z9CB 5KEEA 4WFN3 3OOCA 3M7GA 1BR9A 2NN6H 4K5WA 3GTGB 2A74C 4Y7NB 2GA4B 3I3CA 3E0JA 1VDZA 4QIWB 2G9DA 3H94A 1UEAB 3K5NA 4RHSA 1HRJA 4C1NK 2L9HA 1EYDA 3HS0C 3S1NB 2AWOA 2PNRC 1FYCA 2XRQD 1SYCA 1WTPA 5JPMC 5C0XH 4L6TB 5E4WC 4HEDA 4WORA 2PYKA 1WTVA 1ZKOA 1DOMA 2HCIA 1GUSA 4HN7A 1I4HA 1BO0A 3OWFA 5IT9E 2NTSA 4E6IA 4U673 1QILA 1TVXA 1QB5D 4K5VA 1J8IA 3PUYA 1UUPA 2ID0A 4IURA 1H9KA 4O42A 3I73A 4NMZA 1SNMA 4MN3A 1X32A 1ICWA 1H9RA 5G3LF 1DCZA 1LTBD 1TU2B 1DJRD 3D4WA 3IFTA 2V4DA 2CVRA 3IFDA 1KDAA 2PW5A 2F0OA 5EPJA 3NK9A 4BY7B 4A3FB 2R61A 2ZXPA 4NP5A 4RA8A 4RAUC 4K8IA 1SNQA 5CV8A 2H4OA 4DNRB 1SJED 4J8QA 3TSSA 4CJ0B 4FF2A 2NB0A 2KECA 1PTOF 3X3NA 1SYGA 2K04A 4TRDA 4FVMA 3HEJA 1SNOA 3K7AB 4HAEA 1TWCB 5I9PA 4DAVA 3S17B 2YYZA 2Z4IA 3K0YA 4G7ZC 2EYPA 4XXEA 1AP0A 3VYTA 4IQZA 2IX3A 4RGTA 2RSNA 2RDGA 1R4PB 1E2WA 2F3WA 2B2WA 1PRTC 5KIXA 4ZLTF 1B3AA 4F88A 3NHHA 3GQBA 1J9OA 5HGTA 1UAPA 4LAAA 5HURA 2WV6D 5CMDA 2XWJB 1UNSA 1F2MA 1AZQA 1PTOB 1EWHA 5C5MA 4IFDJ 1EIHA 1V1PB 5IOCA 5EQ0A 4LK1C 3SK4A 2EY6A 1I4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DY8 A;  2KVM A;  2KED A;  4QUC A;  4IUT A;  1RJT A;  1Q3L A;  2HUG A;  2KOL A;  1B53 A;  1G2T A;  2B2V A;  4IUV A;  1BF4 A;  2L4N A;  1HFN A;  4MN3 A;  1X32 A;  2B2Y A;  2K01 A;  1ICW A;  1X3Q A;  1QNK A;  4XT3 B;  1PDQ A;  3LWE A;  1BBX C;  1NCV A;  4U68 A;  1VMP A;  4CJ1 B;  1PFN A;  2K05 A;  2KUM A;  2SDF A;  3GV6 A;  2EOT A;  2MP1 A;  2RSO A;  3N52 A;  1QE6 A;  2L11 A;  1SSO A;  2DY7 A;  4OIJ A;  5AFW A;  5EPL A;  3MWY W;  5JJZ A;  2L1B A;  2XIW A;  2JYO A;  5EPK A;  4CJ2 C;  3UI2 A;  1JE4 A;  2Q8R E;  3HP3 A;  2K1B A;  3TN2 A;  1IKM A;  2CVR A;  3IFD A;  1ILQ A;  1M8A A;  4IUQ A;  1SAP A;  3I90 A;  3R93 A;  5CBA E;  1IKL A;  1WTX A;  1DON A;  5EPJ A;  1O7Y A;  1U4R A;  1CA6 A;  2NYZ D;  2EE1 A;  1XYI A;  1WTQ A;  1HA6 A;  4LMQ D;  4RA8 A;  2MGS A;  3DEO A;  1HFG A;  5E4X A;  1B2T A;  4RAU C;  1WTO A;  4R9W A;  1DOK A;  2BDN A;  4ZK9 B;  2IL8 A;  2NWG A;  2RVL A;  1GUW A;  1E0B A;  1NR4 A;  5T1G A;  4CJ0 B;  2B2T C;  2KEC A;  1X3P A;  4HSV A;  4RWS C;  1PLF A;  1F9R A;  1F9P A;  2X69 A;  2HDM A;  1XX8 A;  3P7J A;  3QO2 A;  2K04 A;  1HUN A;  4DN4 M;  3I3C A;  3I91 A;  1RTN A;  2K28 A;  5DNF A;  1WVL A;  1AZP A;  1KNE A;  1IL8 A;  4MHE A;  3Q6S A;  3D6W A;  4HAE A;  4UAI A;  1DZ1 A;  1O7Z A;  1HUM A;  3FPU B;  5EJW A;  4HCS A;  2B2T A;  1B50 A;  1G91 A;  4ZAI A;  4QUF A;  2JP1 A;  2HCC A;  1HRJ A;  1AP0 A;  2L9H A;  1G2S A;  5D14 A;  2FMM A;  2VXW A;  3F2U A;  2B2W C;  1LV9 A;  2X6G A;  3KBX A;  1RHP A;  1U4P A;  3GV3 A;  2H1E A;  3MTS A;  4X3S A;  5D65 A;  1ILP A;  5EKI A;  1B4O A;  2FHT A;  2RSN A;  3H91 A;  5T1I A;  5COY A;  1VMC A;  2B2U C;  1RTO A;  1EIG A;  1WTW A;  1WTP A;  1ROD A;  1HHV A;  2FJ2 A;  2FIN B;  2N88 A;  1ML0 D;  2HDL A;  4X3K A;  1QG7 A;  5E4W C;  1PFM A;  4HED A;  4X3U A;  2X6L A;  2B2Y C;  1F9S A;  1MI2 A;  2L12 A;  4X3T A;  1WTV A;  1O80 A;  1DOM A;  3ONA B;  2HCI A;  1C8C A;  3IL8 A;  1BNZ A;  2B2W A;  4ZKB B;  4ZLT F;  1WD1 A;  1JIC A;  3I8Z A;  2K03 A;  4IUP A;  1BO0 A;  2D9U A;  1CM9 A;  1B3A A;  2B2U A;  1NAP A;  1PFB A;  2R3Z A;  1ZXT A;  1J9O A;  2MJ8 A;  2NZ1 D;  1WTR A;  1DOL A;  3TZD A;  4OIK A;  1MGS A;  2J7Z A;  4XT1 B;  4ZKC B;  1G6Z A;  3DEP A;  3SVM A;  1S4Z A;  2RA4 A;  2MPM A;  4R8I A;  1KNA A;  1U4M A;  1NR2 A;  2M2L A;  3G7L A;  5CMD A;  1EL0 A;  4XDX A;  1TVX A;  5COR A;  1F2L A;  1MSG A;  1AZQ A;  2FFK B;  1EOT A;  1WD0 A;  1J8I A;  1MSH A;  2B2V C;  1ESR A;  1SDF A;  3DM1 A;  2KEE A;  4IUU A;  3FDT A;  2EPB A;  1U4L A;  1A15 A;  1EIH A;  2N55 A;  4NW2 A;  5EQ0 A;  3KUP A;  5CBE E;  2Q8T A;  1EQT A;  4IUR A;  1F9Q A;  1CA5 A;  4O42 A; 
#chains in the Genus database with same CATH topology
 4FP5 D;  2UU9 L;  4BXX G;  1YJW A;  3J80 L;  2EY5 A;  1SYB A;  1BBX C;  1I4P A;  5C4J H;  4CDE C;  5AFW A;  2DY7 A;  4GOP C;  2F4V Q;  2IJ0 A;  3MWY W;  3OYY A;  2NVY H;  4PQX A;  4CJ2 C;  1SFO H;  4AYB B;  1XWE A;  2VY3 A;  2D62 A;  1WYD A;  4DR6 L;  3HOW G;  1L0X B;  4CKC A;  2EYF A;  2E2H B;  1PMR A;  4LF8 Q;  3HOZ H;  2NYZ D;  1KTK A;  1LYL A;  2XGT A;  4AIM A;  2OQK A;  4PZ6 A;  5M3M H;  1HA6 A;  3KJO A;  3PUX A;  4KHV A;  5C44 H;  4DV6 Q;  1PZJ D;  1ZYR C;  4A76 A;  5E3F A;  5M5X H;  3A7L A;  1Y1W G;  4ZK9 B;  2NN6 I;  3OMC A;  3I4M G;  5D3I B;  1V1O A;  2PO4 A;  2N8N A;  1O7I A;  5J3B A;  2VW9 A;  2UUC Q;  2A6E D;  5ELE A;  4AYB E;  4L5Q A;  2F0E A;  2C9O A;  4UY8 C;  5DNF A;  1AZP A;  4UP7 A;  1ESF A;  1CHP D;  4JBW A;  3FHW A;  3S1M B;  1B50 A;  3LNN A;  2JP1 A;  1Y14 B;  1S5E D;  2RCN A;  1ET6 A;  4LFC L;  4IN3 A;  3VA5 A;  3JAM L;  5G3L D;  2E2J B;  3MTS A;  4X3S A;  4IO9 A;  5C0X I;  3H15 A;  1JWU D;  2FHT A;  1RD9 D;  4DFA A;  4DXG A;  3J7A F;  1I94 L;  2FJ2 A;  3V2T A;  2F0D A;  2HDL A;  2I5M X;  4IAL A;  1GUT A;  4X3U A;  3TP5 A;  2OEO A;  3MC0 B;  2WKD A;  1VQA A;  3TBI B;  2NVT B;  3BDO A;  3SR1 A;  3J80 i;  5DM7 3;  1HR0 W;  3HOU H;  4L63 B;  3W2D A;  4ULL A;  1RCV D;  1PTO D;  5AJ3 Q;  3DEP A;  2WIN B;  1VQC A;  2LFN A;  5CR3 A;  3HOY B;  1VF5 C;  2E75 C;  1F2L A;  3FMC A;  5ELN A;  5FO9 B;  1UE7 A;  3KF6 A;  2RDH A;  1HZB A;  2ZJR A;  4B9W A;  4R4Q A;  1J6Q A;  2IHE A;  1HNZ Q;  2KVM A;  1SYD A;  4X66 Q;  4JI2 L;  3V05 A;  4JI6 Q;  2G9H D;  5JEA J;  3PMF A;  2JEB I;  3LWE A;  3TRE A;  3J80 c;  2SDF A;  4DUY L;  4JI1 L;  2NVQ H;  5EPL A;  2DN8 A;  2MQH A;  1HA5 A;  2XIW A;  3G71 A;  2E2D C;  4OEL B;  3T1Y L;  1SAP A;  4OWX B;  3R93 A;  1QVF A;  3JAM i;  2Y0S G;  1WTX A;  2UUA Q;  3QIA A;  4GKK L;  4A3E G;  1HPC A;  2HHH Q;  5E4X A;  1B2T A;  3FPP A;  1S3O A;  1AW7 A;  1D6E C;  1IHZ A;  1VCI A;  1X3P A;  4BXX H;  2VUM G;  3PUZ A;  1HUN A;  1XMO Q;  1JOO A;  2XRS D;  4BA2 I;  2OQ0 A;  4DU9 A;  3K80 C;  2SNS A;  1PH5 A;  1FD7 D;  3NTH A;  1K28 A;  1CK1 A;  2CHB D;  1AH9 A;  4I7Z C;  1Y1V G;  3A54 A;  3GTQ B;  1A8V A;  3J7A V;  4GKJ Q;  2KJX A;  2F0T A;  3V96 A;  3HOW H;  1G2S A;  2K75 A;  3KBX A;  4ZYS A;  4H7B A;  3KDF B;  5C4H A;  1YNX A;  2PMZ B;  1EIF A;  3H91 A;  2B2U C;  4KN4 C;  2JN4 A;  4ID6 A;  1Y1W H;  4QY7 A;  1N36 Q;  1HZC A;  1QCB D;  1TII D;  2B2Y C;  3VR2 A;  5C4X B;  3CCM A;  1STN A;  2UXC L;  1L1O C;  2QA4 A;  1ZXT A;  3NWT A;  2EYH A;  3PV0 A;  5CV9 A;  3NPP A;  5KGU A;  2J7Z A;  1OXT A;  1RF2 D;  2WKC A;  4JI0 L;  2JE6 I;  1K83 H;  2ZXR A;  5FLX c;  1BUV T;  4G57 A;  5LMN W;  2KHS A;  1PYS B;  1MSG A;  3Q24 A;  1EOT A;  3W3A A;  4DV4 L;  1X65 A;  3CCS A;  1PH9 A;  3D3R A;  5JPN C;  4XIG S;  1SND A;  5GAE C;  1UE1 A;  3BVM A;  1IYV A;  1SE4 A;  1EQT A;  1Y8O B;  1KXL A;  4DR2 L;  1X3F A;  4Q5V A;  4C3J G;  1EZ8 A;  3FKI G;  3C46 A;  1K9M C;  4P73 A;  5C4J B;  2R92 G;  1VQL A;  1E1O A;  2ZTE A;  4K6L A;  2NVY B;  1SFO B;  3N52 A;  1E1T A;  2BA1 A;  2L1B A;  5EPK A;  3RZO H;  5M5Y H;  3HP3 A;  1PV4 A;  3GTO H;  3HOZ B;  4J1M A;  4RHR A;  4H13 C;  1M8A A;  4DR7 L;  4QQB X;  5M3M B;  5ELO A;  2Z6K A;  5C44 B;  1L2F A;  3PO3 G;  5M5X B;  1TWH H;  1AN8 A;  4OX9 Q;  4QF4 A;  3MXN A;  1HR0 Q;  5IOD A;  4HMJ A;  4OWT B;  1S5D D;  3C3L A;  1E0B A;  5CC4 A;  2Z4H A;  3I7F A;  3P7J A;  3L7Z C;  1JC7 A;  1Q12 A;  2I5L X;  1MKH A;  4DN4 M;  5HGQ A;  1I4Q A;  1PFS A;  3URY A;  2JXM B;  1O7Z A;  1HUM A;  5EJW A;  4HCS A;  3OTO Q;  3BZD B;  4C3H B;  3Q0A A;  1WI5 A;  1JJ2 A;  2HCC A;  1IBM Q;  1HZA A;  4LF5 L;  1VQF A;  3TS2 A;  1G8Z D;  2A5H A;  3W1B A;  1ONL A;  4ABN A;  1PVO A;  1OXV A;  4A3E H;  3PQI A;  3A7A B;  2AQ1 B;  5T1I A;  3PUV A;  2DNE A;  1F2Y A;  3UDI A;  2CQA A;  4N8X 1;  2PCF B;  5C3E G;  4P71 A;  5IT9 c;  2JQO A;  2R6G A;  1S5B D;  2VUM H;  3HOU B;  3ONA B;  2BCO A;  5IGF A;  3PO2 G;  3PSI A;  1OXU A;  4YWK A;  1CKM A;  1OXS C;  2EQS A;  1Y1V H;  1DOL A;  3H3V H;  4PMW A;  4C1N I;  4GLX A;  1EL0 A;  1VQG A;  4B3T L;  3A8I E;  3A5Z B;  4XDX A;  2GVA A;  3SE0 A;  4DNT B;  2D2C C;  1G6P A;  1JJC B;  3D4R A;  5ELB A;  1C9O A;  2EZV A;  4A3M G;  1D1K A;  4K2L A;  3RNU A;  4O2D A;  4AH6 A;  4B9X A;  5BR8 L;  3EBE A;  4UHV A;  2KED A;  1XNR Q;  2TMP A;  2A69 C;  2KOL A;  4JOI C;  3OMG A;  5F2D A;  3CF5 A;  2B39 A;  2NVQ B;  1PH3 A;  4OXP A;  3U4Z A;  2G5D A;  2CW0 D;  1FVI A;  2HQL A;  4R1J A;  1BCP B;  1VQ4 A;  1Q86 C;  2SNM A;  3UI2 A;  3QOL A;  2SEB D;  3AU7 A;  3ICE A;  4BBS G;  2K14 A;  1GXD C;  4ZQ3 A;  4X65 L;  1PH8 A;  2A68 D;  2UUB Q;  1VQ7 A;  3G6J B;  4R9W A;  5CGK A;  4GOP A;  2K5V A;  1VS0 A;  2AQ3 B;  1VQB A;  1EYC A;  4FF3 A;  3DMU A;  3F1Z A;  4C2M B;  1A6X A;  2I0Q A;  4UP8 A;  1STB A;  1QVG A;  1FNW A;  5LMN Q;  3FKI H;  1PYW D;  3A8J E;  2R92 H;  1XNQ Q;  2ZXO A;  1SMX A;  4A3C G;  3D6W A;  2HD3 A;  1D2B A;  1SNC A;  2OTL A;  3AFQ A;  1A2U A;  2I5H A;  3F2D A;  3PF4 A;  4DR4 L;  2BE5 D;  2A6E C;  2A73 B;  4YCV A;  3NQI A;  2QEJ C;  2VXW A;  4YHH Q;  3GV3 A;  2H1E A;  4FF4 A;  4A3D G;  5EKI A;  1H9M A;  1TS5 A;  3MXP A;  4PZ7 A;  5IIF A;  3UDG A;  3MZ5 A;  3K57 A;  2Z8L A;  4JCV E;  1TS3 A;  1PH2 A;  1TWF H;  3R2T A;  4KKU A;  4X3T A;  3VR4 A;  4B3M Q;  1YBY A;  4A93 G;  1LTR D;  2UXB L;  1BNZ A;  3D8G A;  3BJU A;  4ZKB B;  3M7N A;  2HIX A;  1JIC A;  1BBU A;  1F2Z A;  2VQE Q;  1K83 B;  3DM3 A;  4QB4 A;  1XJV A;  1YNJ D;  1SNP A;  4DR3 Q;  5ELD A;  5JAV A;  4LFB Q;  4A3I B;  1EQQ A;  2O5J C;  4IFD G;  3EVQ A;  2LXJ A;  3AYH B;  1Q8K A;  1S5C D;  1PTO C;  3S2H H;  1OTC A;  1LUZ A;  2F4I A;  1V43 A;  5CBE E;  3E5S A;  5COY A;  1B8A A;  2DY8 A;  2L55 A;  1V8Q A;  2ENB A;  1YVC A;  3PO2 H;  3KBG A;  1NBW A;  3BS1 A;  4KKT A;  3CCE A;  1HFN A;  4B3S Q;  2WAQ B;  5C0X J;  1BCP D;  1X3Q A;  1LT3 D;  3RZO B;  2ZM6 Q;  4JI5 L;  2MP1 A;  2JA9 A;  2L11 A;  1LTG D;  3WOE A;  2B63 G;  2JYO A;  4PV1 C;  3TN2 A;  1ILQ A;  1WCM G;  4JBJ A;  4KY6 A;  4RGM A;  1O7Y A;  2FMC A;  4A3M H;  1LTT D;  2F0W A;  4WJW A;  1TT2 A;  4ZRZ A;  4HID A;  1NMF A;  2EYM A;  2E5L L;  2F4V L;  4A3J G;  2WAQ E;  3RD4 A;  1DXM A;  3PGZ A;  5KYL A;  1LT4 D;  1QJO A;  4RFB A;  1XTD A;  2K50 A;  2PNH A;  4LF8 L;  2KHJ A;  1N34 Q;  3RLF A;  1CT1 D;  3KF6 B;  4EQO A;  3U9O A;  2RHS B;  4WRD A;  4UAI A;  4JBK A;  3SGI A;  1BVS A;  1SN8 A;  2Y0S B;  4N9P A;  1K8O A;  1G91 A;  1TR5 A;  1JWS D;  4A3E B;  2VQF Q;  2UUC L;  3BZC A;  2JA6 B;  4BBS H;  3HOX G;  4LF6 Q;  3MFY A;  3ERS X;  1LT6 D;  2QKI C;  4OO1 G;  4K5X A;  4TSS A;  1SYE A;  4V0B A;  4ZUI A;  3X3M A;  4K2K A;  4JI7 Q;  3OW7 A;  2LMC B;  1KDC A;  2Y0S E;  3CCJ A;  5M9O A;  1GM5 A;  5FJ8 G;  4EGV A;  2JA5 B;  3I8Z A;  1BXT A;  4IUP A;  4A3C H;  2B2U A;  1NAP A;  1PFB A;  3Q23 A;  2MO1 A;  2JA8 H;  3H3V I;  1X3G A;  3QR8 A;  4XT1 B;  3CQZ H;  3A56 A;  1AEX A;  3I4N H;  2BH2 A;  4DAM A;  3U50 C;  3LX0 A;  2NBF A;  1EUJ A;  5M3F B;  4LW1 A;  2FFK B;  4PNY A;  4A3D H;  3TP6 A;  4LUV A;  2YU9 H;  4KI0 A;  4OGQ C;  5AJ3 L;  3I4L A;  3KUP A;  1EU3 A;  4PZ8 A;  5I6W A;  3KYH C;  4NXN Q;  1LAC A;  5JEA G;  5GAD C;  2QCP X;  1BKB A;  4IUV A;  3C1F A;  2D5D A;  4S3S A;  1PZK D;  1Z47 A;  1I4G A;  2JSO A;  4APV A;  3HFZ B;  1M4V A;  4XT3 B;  1PDQ A;  5BN4 A;  1MD2 D;  5IGC A;  3FEW X;  4KJN A;  4IPD A;  1K3B C;  1HNZ L;  3ITP A;  3OW2 A;  2A69 D;  1A2T A;  1EFI D;  4X66 L;  1ASY A;  3MAQ A;  3SK8 A;  3CMA A;  1VQO A;  2EYO A;  2EE1 A;  1CTM A;  4J6H A;  1AE2 A;  1UWV A;  2LS0 1;  3E9H A;  3I56 A;  2YTV A;  3HGB A;  2MGS A;  3NBI A;  5CYU A;  1GKH A;  1KQS A;  4X64 Q;  4PG3 A;  1XPU A;  3FKI B;  1LTS D;  1YZ6 A;  5LMU L;  1EY6 A;  2HDM A;  1XX8 A;  3QO2 A;  3NUC A;  1B44 D;  2MUY A;  4HMI A;  5ELC A;  3L0O A;  2ATW A;  1STE A;  3D4D A;  3BYT B;  3P75 A;  3CRL C;  1RTN A;  3OSO A;  2HHH L;  3MEH A;  1QWY A;  1FJG Q;  3ND9 A;  4JC0 A;  2F0F A;  1WCM H;  1XMO L;  4RCO A;  2C35 B;  1SRU A;  3VYS A;  3ND8 A;  3T51 B;  2IW3 A;  3EIV A;  4MHE A;  4A3J H;  1EIG A;  1HHV A;  4EQP A;  1MJE A;  4GKJ L;  2UXD Q;  2AQ2 B;  1DM0 B;  4EQ5 A;  4BY1 G;  2Q8I B;  2PW7 A;  2Z6B A;  3IAY A;  2SOB A;  3RUZ A;  3GTJ H;  1NE3 A;  1KL9 A;  3SK5 A;  2M9V A;  3CP0 A;  1LTI D;  4MTK A;  3S16 H;  4A3L G;  3MXN B;  1V9P A;  1BBW A;  1N36 L;  3GTK B;  5CV6 A;  5A2Q E;  4DV1 L;  1U4M A;  1QUQ A;  3GTP H;  3K6O A;  4FXK C;  4C3I G;  2O2L D;  4ZUJ A;  4TKO B;  2PZW A;  3S15 H;  3HOX H;  3S2H B;  1PA6 A;  1SDF A;  4RGN A;  4OO1 H;  3K8A A;  4BBR G;  2N55 A;  4DR5 Q;  2OF1 A;  1X54 A;  2Q2H A;  4KHP Q;  4HTH A;  2PZT A;  3RR5 A;  3G48 A;  3PO2 B;  4KD4 A;  2X6L A;  4K8J A;  1SRO A;  2EY1 A;  4GN3 B;  3RZD H;  4JYA Q;  4IUT A;  2K6A A;  5FLX L;  3BVG A;  1G2T A;  3EFX D;  1STY A;  2AKW B;  1IBK Q;  3TME A;  2DJG C;  3PUW A;  4MZ9 A;  3A0J A;  1SR3 A;  4JI3 L;  1HQR D;  1AE3 A;  2KQ3 A;  1RKN A;  1WOC A;  1I6V C;  2YTX A;  5DM6 3;  2QW7 A;  4A3M B;  4IUQ A;  1YIJ A;  4HCE A;  4JK1 C;  1I4R A;  4HR7 B;  3KJP A;  3DLL A;  3T4A C;  1A63 A;  3I70 A;  2CW0 C;  1L0Y B;  4DV5 Q;  1KAA A;  4P2C B;  5IP9 H;  2LY7 A;  1JOR A;  1TY2 A;  1D5Z C;  2B2T C;  4HSV A;  1RL2 A;  1YHB A;  4M8A A;  2EIF A;  5ISR A;  2A68 C;  4OX9 L;  2NZO A;  2GVB A;  1HR0 L;  2K28 A;  1Q7Y C;  1EYA A;  1D7Q A;  1P8L A;  1JE5 A;  1JMC A;  4A3B G;  4BBS B;  3SK6 A;  4ILW A;  4ZAI A;  1I3Q B;  5J22 A;  5IE8 A;  1E7Z A;  1B9N A;  4DAY A;  2FMM A;  1RHP A;  5D65 A;  4A3G G;  1SBB B;  3M3Y H;  1N32 L;  4DR1 Q;  1RTO A;  4QJF A;  2DJF C;  1I50 H;  1LLR D;  3OTO L;  5KRU A;  5CV7 A;  2B3G A;  2XTI A;  2BE5 C;  2MHV A;  4IPG A;  3NE5 B;  2OWO A;  1VQM A;  1CQV A;  4BY7 G;  3ERQ A;  1GUG A;  2JA8 B;  1A3U A;  3S9W A;  1U9R A;  3CQZ B;  1NY4 A;  3MXG A;  1CM9 A;  3I4N B;  4YWL A;  1CFM A;  1N33 Q;  4IUN A;  1MGS A;  3S14 H;  4NPS A;  3H0G B;  4GOP B;  2IWH A;  4A3D B;  5COR A;  1LO5 D;  1GVP A;  4RKL A;  2A6H D;  2EDG A;  5IT9 L;  3RLO A;  3S24 A;  2YU9 B;  4JI4 Q;  1PH6 A;  1FGB D;  3I4M H;  3HKZ G;  2KCC A;  3KLS X;  5EKK A;  4DKA C;  1YNJ C;  4JI5 Q;  2ASB A;  2E2I H;  2LSS A;  4GN4 B;  1Z6H A;  1JQY D;  5FOB B;  1PH4 A;  3K0X A;  1IXR A;  1N9W A;  2YV5 A;  4N8F A;  2N78 A;  1B53 A;  1HCZ A;  2K5H A;  2NTT A;  3DWA A;  1KDB A;  3J81 E;  4A3L H;  4CJ1 B;  1VMP A;  4KTA A;  1O7L A;  3PCO B;  3M4Q A;  2F0L A;  5KNC A;  1YIT A;  2GN5 A;  3GTG H;  4OL7 A;  1KIX A;  3AFP A;  1XNR L;  4C3I H;  2HQE A;  1A62 A;  2VB2 X;  3TZU A;  3BU2 A;  1ICF B;  1NJI C;  1CZW A;  2E76 C;  3KOJ A;  1I94 Q;  1BCP C;  4A75 A;  1CA6 A;  4YY3 Q;  3J7A 5;  2PPB C;  4BBR H;  1SMY D;  4UDU C;  5IP7 G;  4LMQ D;  2DGY A;  5IWA Q;  1VQP A;  4K6D A;  1HFG A;  3SDZ A;  1WTO A;  1D5M C;  4JI8 Q;  2BDN A;  4O1N A;  1SYF A;  2IX0 A;  2BA0 A;  5C5L A;  2ZJQ A;  1EQR A;  1IW7 D;  1STA A;  2K5Q A;  5JJL A;  5L37 A;  2K5D A;  3M85 A;  2F0U A;  4A3K G;  2LXK A;  2UUB L;  3I91 A;  3K5O A;  3Q8D A;  4YCW A;  3Q6S A;  1XPO A;  3K81 C;  1WCM B;  2F0H A;  4LF4 Q;  2JA7 G;  2IY5 B;  1HNW Q;  1TS4 A;  1R9T H;  5LMN L;  1M1K C;  4LF9 Q;  2RHQ B;  5D14 A;  1XNQ L;  1Q1E A;  4A3J B;  1ILP A;  1ENF A;  5DLQ E;  3BG3 A;  2MNA A;  2F52 A;  1ASZ A;  2Q2U A;  3U4V A;  2L0C A;  2EJM A;  4XYO A;  3GTJ B;  4HSP A;  4YHH L;  3IL8 A;  3D0F A;  4GNX C;  1FL0 A;  5J39 A;  2RCF A;  1XTC D;  3RMH A;  4WJ3 M;  1WTR A;  3CC7 A;  3GTP B;  4A3B H;  1I6H H;  2J0T D;  4B3M L;  1K8M A;  4NXM L;  3HOX B;  1EWI A;  3F8T A;  3H09 A;  2I07 B;  1LAB A;  2PQA A;  2VQE L;  4A3G H;  4OO1 I;  2KEE A;  2CFM A;  1STG A;  1H9S A;  1A15 A;  4NW2 A;  1HJP A;  4RGO S;  4LFB L;  3RZD B;  2QDB A;  3TP7 A;  3J80 E;  3I55 A;  1CA5 A;  3O13 A;  5C0X G;  4BY7 H;  1RJT A;  4QGU A;  3I4O A;  1GUN A;  1BF4 A;  1H95 A;  1QNK A;  3CU7 A;  4LJZ C;  1NCV A;  2KUM A;  3GDE A;  4GZY C;  1BQQ T;  3NP8 A;  5JJZ A;  3IKJ A;  2WB1 G;  1HH2 P;  4H44 C;  1EOV A;  4OWW B;  5CBA E;  4B3S L;  4M1U B;  3BYY B;  2K52 A;  3A74 A;  4KN7 C;  3DWQ A;  2JJQ A;  2ZM6 L;  1WTQ A;  1J5E Q;  4HJ8 A;  1TKW B;  3EQL C;  2BOS A;  3NEM A;  1HXY D;  2UXC Q;  3NTK A;  4A4I A;  1F9P A;  3S1Q H;  5FKA C;  5IGD A;  3VR5 A;  4KLK A;  1CKN A;  1IL8 A;  2KEN A;  1DZ1 A;  3L2P A;  3JAM E;  5K5P A;  1Z9F A;  5JVG 3;  2JEA I;  1N34 L;  1WFQ A;  3M3Y B;  2F0V A;  4IZ8 A;  2HT1 A;  2AUJ D;  1LV9 A;  1D5X C;  1I50 B;  3NXW A;  5IP7 H;  3BDC A;  1I5F A;  1VMC A;  1PH1 A;  4C3J H;  1JCK B;  4FNF A;  3DUZ A;  4K0K L;  1QG7 A;  3E0E A;  1PTO H;  4R4C A;  2VQF L;  1QNU A;  1SE2 A;  1WTH A;  3F2C A;  3K5L A;  2IT1 A;  4UP9 A;  4A3K H;  2PQE A;  1C8C A;  4LF6 L;  5BN3 A;  1YEZ A;  5FK9 C;  1SLJ A;  3HOW B;  1MIU A;  2R3Z A;  1Y8P B;  2NZ1 D;  3CHB D;  4NDX A;  4DUZ L;  5M5W H;  3CCV A;  1Q90 A;  4IPC A;  2JA7 H;  4DR7 Q;  3P1H A;  3H3V C;  4JI7 L;  2MPM A;  3PO3 H;  1KAB A;  1KNA A;  1Y1W B;  4DV7 Q;  3I4M B;  2R7Z G;  1M90 C;  4DA2 A;  5E1F A;  1MSH A;  1GHJ A;  2B2V C;  3FDT A;  4G4K A;  2L5T A;  1Q81 C;  5I2X A;  1HTL D;  2RKS A;  1Q82 C;  1KLU D;  4ME5 A;  4X62 Q;  1W6J A;  3PF5 A;  3E3X A;  1EY9 A;  2I46 A;  1VQK A;  1MHW C;  1GUO A;  2E2H H;  3KLS A;  3CCQ A;  4DV0 L;  2F0G A;  3MVV A;  2N49 A;  4DK1 A;  4QCL A;  4KD3 A;  4C3I B;  2EOT A;  1VQN A;  5H1S E;  5JOB A;  3M4Y A;  4KY7 A;  4NXN L;  2QGQ A;  5IGE A;  3VR3 A;  2Q8R E;  3U9S A;  1IKM A;  5C4X G;  4CKE A;  3CCU A;  1LT5 D;  4BBR B;  5KND A;  3I90 A;  1IKL A;  1IYJ B;  5C3X A;  5C3E H;  2KCM A;  4IOA A;  5GAG C;  3WDN A;  3S1M H;  3H6M A;  3CD6 A;  2KA7 A;  1Z7T A;  5CV4 A;  2NWG A;  3ULL A;  3IRB A;  1JOK A;  1LTL A;  4FXG C;  1QUQ B;  4RWS C;  2IX1 A;  1PLF A;  1W2B A;  1F9R A;  2X69 A;  3GTO B;  3W5O A;  5M5Y B;  3NQT A;  1KNE A;  4X64 L;  4B3T Q;  3EJI A;  1R9T B;  4B3R Q;  4L8J A;  2AMC B;  1TWH B;  3K58 A;  1A3V A;  2B2T A;  1LM0 A;  3F2U A;  2N3S A;  2NUC A;  2EYJ A;  1B4O A;  2H5X A;  1FJG L;  4N9T A;  4X3K A;  2ICI A;  2A19 A;  1TY0 A;  3G6E A;  1MBY A;  2KCT A;  1F9S A;  1K0S A;  5M3M G;  4DV6 L;  2R93 G;  2IHF A;  2QIL A;  1EWC A;  3VDY A;  2BH8 A;  4NB3 A;  1GHK A;  4A3B B;  1I6H B;  3OPO A;  4LWC A;  2K33 A;  3M9B A;  4LUZ A;  2MJ8 A;  2UXD L;  3TZD A;  4OIK A;  4DV2 Q;  1EIY B;  2V1C C;  1EY8 A;  4ZKC B;  2Z6K C;  1S4Z A;  4I65 A;  1NR2 A;  3G7L A;  3CCR A;  1CQF A;  1FNV A;  2K5N A;  4A3G B;  3TEH B;  1YJN A;  2VUM B;  3J81 L;  3DM1 A;  3HG9 A;  1PHJ A;  1TWA H;  1ZEQ X;  4ODG A;  4JBM A;  4MNO A;  4I7A A;  1NNX A;  4C3H G;  2F3I A;  4XQN A;  5FLM G;  1KRT A;  2Q8T A;  1Y1V B;  2A6H C;  4F87 A;  3J7Y W;  4HIO A;  2EVB A;  4MIU A;  3OIP A;  2NZH A;  1Q3L A;  5KYI A;  1IBL Q;  4DAY B;  4DAP A;  2WP8 J;  3D6C A;  4YCU A;  4CDD C;  3C1E A;  4DR5 L;  2B2Y A;  4ME3 A;  1B1Z A;  5EBD A;  4EX5 A;  4KHP L;  4U68 A;  1X3E A;  3T56 B;  2K05 A;  4DR4 Q;  2RSO A;  2XSC A;  1NTG A;  4BS9 A;  1VQD A;  4EVO A;  4JYA L;  3HOV G;  2DUD A;  1L1O A;  2R7Z H;  2K1B A;  3HKZ B;  1IBK L;  2WAC A;  1DON A;  2LKV A;  3HRZ C;  3MA2 B;  1EU4 A;  1XYI A;  4A93 H;  3Q22 A;  4MTN A;  3R8B A;  3AEV A;  3S1Q B;  2OTJ A;  5T1G A;  3SEB A;  1T5X D;  3C2P A;  3SXH A;  3MHB A;  1SMY C;  3HKZ E;  2J4X A;  1C4Q A;  3QWN A;  2K5W A;  1RIP A;  4XQJ A;  1Y69 U;  4IFD H;  1IL2 A;  3UE0 A;  4PMC A;  3S2D H;  4JI6 L;  1IW7 C;  3LGJ A;  4QL5 A;  2WFW A;  2CCZ A;  1HNX Q;  1P16 A;  1LTA D;  1GJX A;  3T53 B;  4TVA B;  1Q46 A;  2EJG C;  3NBH A;  4C3J B;  3J81 i;  5I6Y A;  1XXG A;  3EN2 A;  2O4X A;  1CI3 M;  4R8N A;  3S1R H;  2UUA L;  2R92 B;  1AFP A;  1Q1B A;  3VA7 A;  4A3K B;  1EFW A;  4BWG B;  2L12 A;  2F3V A;  1O80 A;  1EY7 A;  4DK3 C;  1ENA A;  3QG1 A;  4DR1 L;  2ZTC A;  3D31 A;  5M5W B;  2B63 H;  3TS0 A;  2D9U A;  4DV3 Q;  2JA7 B;  1B9M A;  4XYQ A;  2E74 C;  4GN5 A;  3PO3 B;  2M00 A;  5HY6 A;  1JOQ A;  5EBC A;  2RA4 A;  2F0N A;  5CV5 A;  4LFA Q;  1PH7 A;  1TQO A;  3QJY A;  1YNN D;  1D8L A;  4HJA A;  4GNX A;  1EY0 A;  2E5L Q;  1TWF B;  2CWA A;  4POG A;  2NVX H;  1VF7 A;  4FF1 A;  1N33 L;  4FXD A;  5EGT A;  5DEH A;  5IY0 A;  1UE6 A;  4XTC S;  1A3T A;  3BVZ A;  3J81 c;  3MXU A;  4Q0F A;  1WJJ A;  1C48 A;  1GD7 A;  4G7O C;  5JJI A;  2K7V A;  4KK7 A;  4JI4 L;  2R93 H;  1RDP D;  2AWN A;  2XNA C;  3DWP A;  3F2B A;  2MFI A;  5FO7 B;  4RCN A;  4JV5 Q;  3HZX A;  3M4O H;  4CGY B;  3GV6 A;  1D1I A;  1PRT F;  5DAU A;  4CHT B;  4B08 A;  2ZT9 C;  1NMG A;  5C3E B;  1JE4 A;  4JW0 A;  2Z0S A;  5K36 G;  2XVS A;  4KHZ A;  1VQ9 A;  4RMF A;  3QB3 A;  3CAM A;  1ENC A;  3NEN A;  4LF7 Q;  1U4R A;  3KF8 A;  5C4Z A;  2QF7 A;  3GTL H;  1Q8I A;  4XQQ A;  1DYQ A;  3DEO A;  2AUK A;  4C3H H;  5FLM H;  4OHJ A;  2BDO A;  2EYL A;  3GO5 A;  5FJ8 H;  2AHO B;  1JB7 A;  4LNQ A;  2RVL A;  4A3I G;  1GUW A;  4IJH A;  1YI2 A;  1NUC A;  3UDF A;  1BOS A;  1EZ6 A;  3K5M A;  1VQH A;  3CKI B;  4YY3 L;  5IWA L;  2PQA B;  3ZJY C;  3MFG A;  4JI8 L;  2WB1 B;  3WOF A;  1H9S B;  3T1H Q;  4KJO A;  3B6Y A;  4P75 A;  1IZ6 A;  4DNI A;  4JOI A;  3HOV H;  4NKL A;  2B8G A;  2F0K A;  5IGB A;  2CWP A;  2WAQ G;  3A8K E;  1YJ9 A;  2FXQ A;  2X6G A;  1U4P A;  2F0M A;  1G6Z A;  5NUC A;  4LF4 L;  5JEA H;  1ROD A;  1HNW L;  2Z1C A;  3R2I A;  1IYU A;  1PRT B;  2VZA A;  3CXC A;  2WB1 E;  4LF9 L;  1B7Y B;  1VQ5 A;  1HTP A;  2IPK D;  3GTM H;  1VQJ A;  3KFU A;  3G4S A;  4UPA A;  1SE3 A;  3FVQ A;  5ELF A;  4R8I A;  1TS2 A;  2M2L A;  3T16 A;  4J15 A;  4TQU S;  4AQY Q;  3TP8 A;  1XMQ Q;  2D0P A;  2F0P A;  1TWA B;  3STB D;  1WD0 A;  2UU9 Q;  1STH A;  1BDO A;  3DXJ C;  2Q2I A;  1EY4 A;  1IBM L;  2EPB A;  1JB3 A;  3L3O C;  3RLN A;  1CKN B;  5C3W A;  5LMU Q;  4A3F G;  1E2Z A;  2K4K A;  2ALY B;  3J7Z C;  3PIO 3;  2JA6 G;  3AMU A;  3HKS A;  4OON A;  2HUG A;  2MO0 A;  2B2V A;  3NTI A;  2CKZ B;  2L4N A;  5GQO A;  4V19 0;  4DR6 Q;  2F0Q A;  3I72 A;  5J1Z A;  3SHL A;  3CRK C;  2R7Z B;  5LL6 S;  3OHX C;  3L9A X;  5C6A A;  4C2M H;  1SSO A;  1PZI D;  3BDL A;  2RQX A;  1JWM D;  4Y52 H;  4G7H C;  1O78 A;  2JA5 G;  2TSS A;  4A93 B;  4BY1 H;  1K0R A;  1W3S A;  2PI2 A;  2XWB B;  5LHY 1;  5I4D A;  2ES2 A;  1PXU A;  2IL8 A;  4POF A;  1HQM C;  1NR4 A;  5M3F G;  3JAM c;  1CHQ D;  1OO9 B;  3CPW A;  2OXP A;  4ALP A;  1TWG H;  3K59 A;  1GOZ A;  1FNU A;  5GAH C;  1J5E L;  1SJH D;  2VNU D;  4LFC Q;  4K14 A;  3S2D B;  4DK0 A;  4IFD I;  5A35 A;  4Y7N H;  1V1P A;  4DV1 Q;  1F77 A;  2F1M A;  5IYC G;  1II3 A;  2RDF A;  1PYB A;  4F8M A;  5K36 H;  3CME A;  2L15 A;  2PMZ E;  1SE8 A;  2B2W C;  3QOJ A;  4LUO A;  3S1R B;  2A8V A;  1PRT D;  1QOH A;  1WTW A;  3S1N H;  2D0O A;  4HJ7 A;  3KLR A;  4DGZ A;  1CSP A;  2N88 A;  2DNC A;  4A3I H;  4DXF A;  1PFM A;  5I9O A;  2B63 B;  1KLG D;  2CH4 A;  3BZK A;  4JI3 Q;  4PMB A;  1EEI D;  3A55 A;  3A5U A;  2K03 A;  4KKS A;  4FDB A;  3M4P A;  4RKB A;  1EQV A;  1FGU A;  3OWE B;  4H0L C;  3DHQ A;  5KNB A;  3FP9 A;  3RN2 A;  4KY5 A;  5EAY A;  4O0A A;  2KCN A;  2NVX B;  1G29 1;  4OEM B;  1ESR A;  5FO8 B;  4IUU A;  4AYB G;  1CSQ A;  3P20 A;  4KMU C;  4JI2 Q;  4YIJ A;  2ZTD A;  2B29 A;  5JVH 3;  5IYB G;  4DV7 L;  2R93 B;  1T5E A;  4IPH A;  3S16 B;  2B8F A;  1SEB D;  4JI1 Q;  4DUY Q;  1U5K A;  2KHI A;  1U0L A;  2NN6 G;  4QUC A;  3PIP 3;  2F03 A;  2OCE A;  3M4O B;  3T1Y Q;  2QDL A;  1B70 B;  3PIO A;  2K01 A;  3S15 B;  4X62 L;  3GD7 A;  4GKK Q;  2K32 A;  4R4I A;  1PFN A;  3W1G A;  5BN5 A;  4OIJ A;  1ZYR D;  3AB9 A;  4P74 A;  1V1Q A;  3ER0 A;  3ULJ A;  1N32 Q;  1B3Q A;  1X55 A;  3GTL B;  5LL6 X;  2Z9H A;  3ZYY X;  4DR3 L;  1W6K A;  4JG2 A;  1E2V A;  2R7D A;  4IJL A;  1R4Q B;  2XN9 C;  4RH6 A;  4P72 A;  4R4T A;  4CBV A;  1NSN S;  4A3F H;  2JA6 H;  5TSS A;  4EQN A;  2F0S A;  4RG1 A;  4IOC A;  4FYD A;  1VQE A;  1BCP F;  1K3R A;  3VYU A;  2ZJP A;  4DK6 C;  1WVL A;  3HOV B;  4CKB A;  1DD2 A;  3CC2 A;  1EY5 A;  3FPU B;  3K7A H;  4QUF A;  1TWC H;  3J81 j;  2JA5 H;  3EA6 A;  3N6R A;  3S17 H;  4F7X A;  5D3D A;  3HOY G;  3VR6 A;  3T13 A;  4C56 C;  2CH4 W;  3FRP B;  3TDQ A;  4B3R L;  4GLA C;  1ET9 A;  3GP7 A;  3CC4 A;  3NSW A;  2FIN B;  2WII B;  1ML0 D;  4QMG A;  5M3F H;  3RN5 A;  1MI2 A;  2VB3 X;  1HZ9 A;  3GTM B;  1L1O B;  4JI0 Q;  5IGG A;  1JR0 D;  4FO2 A;  1EEF D;  1S40 A;  4CDF C;  1WD1 A;  5EKL A;  4DV4 Q;  2QEX A;  5IYC H;  1S72 A;  4JVZ A;  2PZU A;  1Y8N B;  3ERO A;  3SVM A;  1E22 A;  1H9J A;  3OIQ A;  4CDC C;  3KK7 A;  2RF4 A;  3E6Z X;  1GO3 E;  4DR2 Q;  1FR3 A;  2ICE C;  4R4O A;  2EJF C;  5A2Q L;  3MEF A;  1G51 A;  3CW2 C;  3LWU A;  3E9I A;  4DV2 L;  1MJC A;  1U4L A;  1S5F D;  3UE1 A;  1E24 A;  4HJ5 A;  1X6O A;  2F0I A;  5FLX E;  2EY2 A;  1OXX K;  1X9N A;  1YNN C;  1F9Q A;  3S14 B;  2P5Z X;  3NWS A;  1E3P A;  2Q2T A;  2RBM A;  3KDF A;  3NBH B;  3R3O A;  1CUK A;  1JJG A;  4KV6 A;  3PIP A;  1T9H A;  1QE6 A;  1SXT A;  2OT2 A;  4BA1 I;  2F0J A;  3CCL A;  3UDX A;  3TRZ A;  2E2I B;  2JA8 G;  1IBL L;  2EXZ A;  4BY1 B;  4DF7 A;  1KC8 C;  4L5R C;  2O5I C;  3WWV A;  3I4N G;  5I2Y A;  4L5T A;  3KLW A;  3H0G G;  1CZG A;  3CPF A;  2C5C A;  4H02 A;  5IYB H;  4JPB W;  1TWG B;  3VYR A;  1DOK A;  4Z9C B;  5KEE A;  4WFN 3;  3OOC A;  3M7G A;  1BR9 A;  2NN6 H;  4K5W A;  3GTG B;  1QZH A;  3NEL A;  2A74 C;  4Y7N B;  1YHA A;  4GNX B;  2GA4 B;  3I3C A;  4LF5 Q;  5E7N A;  4HIM A;  1X56 A;  4NXM Q;  3E0J A;  1VDZ A;  1DGS A;  2EXD A;  4QIW B;  2G9D A;  3H94 A;  1UEA B;  1VQI A;  3JC6 6;  3K5N A;  4RHS A;  1HRJ A;  4C1N K;  2L9H A;  4GS3 A;  1EYD A;  3HS0 C;  2CQO A;  3S1N B;  2AWO A;  2PNR C;  1FYC A;  2XRQ D;  1SYC A;  1KAW A;  5IYD G;  1WTP A;  3GTK H;  5JPM C;  5C0X H;  2E2J H;  1KHI A;  1UE5 A;  2VS1 A;  4L6T B;  1C0A A;  5E4W C;  1HNX L;  4HED A;  4WOR A;  2PYK A;  1WTV A;  1ZKO A;  2E8G A;  4QIW E;  1DOM A;  2HCI A;  1GUS A;  4HN7 A;  1I4H A;  1CKO A;  1L0W A;  1BO0 A;  3OWF A;  3KF8 B;  2NVT H;  5IT9 E;  4ZCK A;  2NTS A;  4E6I A;  4U67 3;  1K8A C;  4GLV B;  1QIL A;  4YWM A;  5BR8 Q;  1TVX A;  1KRS A;  1QB5 D;  4K5V A;  3AQQ A;  3HOY H;  4DV3 L;  1J8I A;  3PUY A;  3HOZ G;  2JK8 A;  1UUP A;  5C44 G;  4LFA L;  5GRO A;  2ID0 A;  2YTY A;  4IUR A;  1H9K A;  1C7Y A;  4O42 A;  3STB C;  3I73 A;  4NMZ A;  1SNM A;  4MN3 A;  1JT8 A;  1X32 A;  4DPG A;  1ICW A;  4X65 Q;  1H9R A;  5G3L F;  2VL6 A;  1DCZ A;  1LTB D;  1TU2 B;  5JJK A;  1DJR D;  3D4W A;  3IFT A;  1QVC A;  2V4D A;  2CVR A;  3IFD A;  2KBN A;  1K73 C;  1KDA A;  2PW5 A;  2F0O A;  5EPJ A;  1XPR A;  4JV5 L;  3NK9 A;  4BY7 B;  4K0K Q;  4A3F B;  1VQ8 A;  2R61 A;  2ZXP A;  4NP5 A;  4RA8 A;  3TQY A;  4RAU C;  4K8I A;  1I3Q H;  1SNQ A;  5CV8 A;  2H4O A;  4J8Q A;  1SJE D;  3TSS A;  4DNR B;  4CJ0 B;  4FF2 A;  2NB0 A;  2KEC A;  1PTO F;  3X3N A;  1EYG A;  1K8G A;  4LF7 L;  1SYG A;  2K04 A;  4DUZ Q;  1UEB A;  3ULP A;  4TRD A;  1N8R C;  3HOU G;  4FVM A;  3HEJ A;  1SNO A;  3K7A B;  4HAE A;  1KD1 C;  1TWC B;  5I9P A;  1VQ6 A;  4DAV A;  3S17 B;  2YYZ A;  2Z4I A;  1TXY A;  3K0Y A;  4G7Z C;  2EYP A;  4XXE A;  4WJ4 A;  1AP0 A;  3GTQ H;  3VYT A;  4IQZ A;  2IX3 A;  2UXB Q;  4RGT A;  2R7F A;  1YHQ A;  3H0G H;  3T1H L;  2RSN A;  4HJ9 A;  2RDG A;  4DV0 Q;  2A1A A;  1A0I A;  1R4P B;  1E2W A;  4L5S A;  4DV5 L;  2F3W A;  2B2W A;  1PRT C;  5IP9 G;  5KIX A;  4ZLT F;  1B3A A;  4F88 A;  3NHH A;  3GQB A;  1J9O A;  5C4X H;  5HGT A;  1UAP A;  4LAA A;  1QZG A;  5HUR A;  2WV6 D;  5CMD A;  2XWJ B;  1UNS A;  1F2M A;  1AZQ A;  1PTO B;  4HIK A;  2HIV A;  1EWH A;  5C5M A;  4X6A H;  5IYD H;  3I2Z A;  4IFD J;  1EIH A;  1V1P B;  5IOC A;  5EQ0 A;  3K7U C;  3U58 A;  4LK1 C;  3SK4 A;  4AQY L;  2EY6 A;  2PI2 E;  1XMQ L;  1I4X A; 
#chains in the Genus database with same CATH homology
 4FP5 D;  3J80 L;  2EY5 A;  1SYB A;  1BBX C;  1I4P A;  5AFW A;  2DY7 A;  2IJ0 A;  3MWY W;  4PQX A;  4CJ2 C;  4AYB B;  1XWE A;  2D62 A;  1L0X B;  4CKC A;  2EYF A;  2E2H B;  1PMR A;  2NYZ D;  1KTK A;  1HA6 A;  3PUX A;  4KHV A;  1PZJ D;  1ZYR C;  5E3F A;  3A7L A;  4ZK9 B;  2NN6 I;  3OMC A;  5D3I B;  1V1O A;  2PO4 A;  2A6E D;  5ELE A;  2F0E A;  2C9O A;  5DNF A;  1AZP A;  1ESF A;  1CHP D;  4JBW A;  3S1M B;  1B50 A;  3LNN A;  2JP1 A;  1S5E D;  1ET6 A;  3VA5 A;  4IN3 A;  3JAM L;  5G3L D;  2E2J B;  3MTS A;  4X3S A;  5C0X I;  1JWU D;  2FHT A;  1RD9 D;  4DFA A;  4DXG A;  3J7A F;  2FJ2 A;  3V2T A;  2F0D A;  2HDL A;  4IAL A;  1GUT A;  4X3U A;  3TP5 A;  2OEO A;  3MC0 B;  2WKD A;  3TBI B;  2NVT B;  3BDO A;  3SR1 A;  5DM7 3;  4L63 B;  3W2D A;  4ULL A;  1RCV D;  1PTO D;  3DEP A;  2WIN B;  2LFN A;  5CR3 A;  3HOY B;  1VF5 C;  2E75 C;  1F2L A;  3FMC A;  5FO9 B;  2RDH A;  4B9W A;  2KVM A;  1SYD A;  3V05 A;  2G9H D;  5JEA J;  3PMF A;  2JEB I;  3LWE A;  2SDF A;  5EPL A;  2DN8 A;  1HA5 A;  2XIW A;  2E2D C;  1SAP A;  3R93 A;  1WTX A;  3QIA A;  1HPC A;  5E4X A;  1B2T A;  3FPP A;  1AW7 A;  1D6E C;  1IHZ A;  1VCI A;  1X3P A;  3PUZ A;  1HUN A;  1JOO A;  2XRS D;  4BA2 I;  4DU9 A;  2SNS A;  1FD7 D;  3NTH A;  1CK1 A;  2CHB D;  4I7Z C;  3A54 A;  3GTQ B;  3J7A V;  2KJX A;  2F0T A;  3V96 A;  1G2S A;  3KBX A;  4ZYS A;  4H7B A;  5C4H A;  2PMZ B;  3H91 A;  2B2U C;  4KN4 C;  4ID6 A;  1QCB D;  1TII D;  2B2Y C;  3VR2 A;  5C4X B;  1STN A;  1ZXT A;  3NWT A;  2EYH A;  3PV0 A;  5CV9 A;  3NPP A;  5KGU A;  2J7Z A;  1OXT A;  1RF2 D;  2WKC A;  2JE6 I;  2ZXR A;  1BUV T;  4G57 A;  2KHS A;  1MSG A;  3Q24 A;  1EOT A;  3W3A A;  3D3R A;  5JPN C;  4XIG S;  1SND A;  3BVM A;  1IYV A;  1SE4 A;  1EQT A;  1Y8O B;  4Q5V A;  4C3J G;  1EZ8 A;  3C46 A;  5C4J B;  4K6L A;  2NVY B;  1SFO B;  3N52 A;  2BA1 A;  2L1B A;  5EPK A;  3HP3 A;  3HOZ B;  4J1M A;  4RHR A;  4H13 C;  1M8A A;  5M3M B;  5C44 B;  5M5X B;  1AN8 A;  4QF4 A;  3MXN A;  5IOD A;  4HMJ A;  1S5D D;  3C3L A;  1E0B A;  5CC4 A;  2Z4H A;  3L7Z C;  3P7J A;  1JC7 A;  1Q12 A;  4DN4 M;  1I4Q A;  3URY A;  2JXM B;  1O7Z A;  1HUM A;  5EJW A;  4HCS A;  3BZD B;  4C3H B;  3Q0A A;  2HCC A;  1G8Z D;  2A5H A;  4ABN A;  1ONL A;  1OXV A;  3A7A B;  2AQ1 B;  5T1I A;  3PUV A;  2DNE A;  1F2Y A;  2CQA A;  2PCF B;  2R6G A;  1S5B D;  3HOU B;  3ONA B;  2BCO A;  5IGF A;  1OXU A;  1OXS C;  1DOL A;  4PMW A;  4C1N I;  1EL0 A;  4XDX A;  3A8I E;  3SE0 A;  4DNT B;  2D2C C;  3D4R A;  5ELB A;  2EZV A;  1D1K A;  4K2L A;  4B9X A;  2KED A;  2TMP A;  2A69 C;  2KOL A;  3OMG A;  5F2D A;  2B39 A;  2NVQ B;  2CW0 D;  1BCP B;  2SNM A;  3UI2 A;  3QOL A;  2SEB D;  3AU7 A;  1GXD C;  4ZQ3 A;  2A68 D;  5CGK A;  3G6J B;  4R9W A;  2AQ3 B;  1EYC A;  4FF3 A;  3DMU A;  4C2M B;  1A6X A;  1STB A;  1FNW A;  1PYW D;  3A8J E;  2ZXO A;  3D6W A;  1D2B A;  1SNC A;  1A2U A;  2BE5 D;  2A6E C;  2A73 B;  3NQI A;  2QEJ C;  2VXW A;  3GV3 A;  2H1E A;  4FF4 A;  5EKI A;  1H9M A;  1TS5 A;  3MXP A;  5IIF A;  3MZ5 A;  3K57 A;  2Z8L A;  1TS3 A;  4KKU A;  3R2T A;  4X3T A;  3VR4 A;  1LTR D;  1BNZ A;  3D8G A;  4ZKB B;  3M7N A;  1JIC A;  1F2Z A;  1K83 B;  4QB4 A;  1YNJ D;  1SNP A;  5ELD A;  5JAV A;  4A3I B;  2O5J C;  4IFD G;  3EVQ A;  1S5C D;  1PTO C;  2F4I A;  1V43 A;  5CBE E;  3E5S A;  5COY A;  2DY8 A;  2L55 A;  1V8Q A;  2ENB A;  3KBG A;  3BS1 A;  4KKT A;  1HFN A;  2WAQ B;  5C0X J;  1BCP D;  1X3Q A;  1LT3 D;  3RZO B;  2MP1 A;  2L11 A;  1LTG D;  3WOE A;  2JYO A;  4PV1 C;  3TN2 A;  1ILQ A;  4KY6 A;  4RGM A;  1O7Y A;  2FMC A;  1LTT D;  2F0W A;  4WJW A;  1TT2 A;  4ZRZ A;  2EYM A;  3RD4 A;  1DXM A;  5KYL A;  1LT4 D;  1QJO A;  4RFB A;  3RLF A;  1CT1 D;  4EQO A;  3U9O A;  4WRD A;  4UAI A;  2Y0S B;  4N9P A;  1K8O A;  1G91 A;  1TR5 A;  1JWS D;  4A3E B;  2JA6 B;  3MFY A;  1LT6 D;  2QKI C;  4OO1 G;  4K5X A;  4TSS A;  1SYE A;  4V0B A;  4ZUI A;  3X3M A;  4K2K A;  3OW7 A;  2LMC B;  1KDC A;  5M9O A;  4EGV A;  2JA5 B;  3I8Z A;  1BXT A;  4IUP A;  2B2U A;  1NAP A;  1PFB A;  3Q23 A;  4XT1 B;  3A56 A;  1AEX A;  3LX0 A;  2NBF A;  5M3F B;  2FFK B;  4PNY A;  3TP6 A;  4KI0 A;  4OGQ C;  3I4L A;  3KUP A;  1EU3 A;  5I6W A;  1LAC A;  5JEA G;  2QCP X;  4IUV A;  3C1F A;  2D5D A;  4S3S A;  1PZK D;  1Z47 A;  1I4G A;  2JSO A;  1M4V A;  5IGC A;  1PDQ A;  5BN4 A;  1MD2 D;  4XT3 B;  3FEW X;  4KJN A;  3ITP A;  2A69 D;  1A2T A;  1EFI D;  3MAQ A;  3SK8 A;  2EYO A;  2EE1 A;  1CTM A;  4J6H A;  2LS0 1;  3HGB A;  2MGS A;  3NBI A;  5CYU A;  3FKI B;  1LTS D;  1EY6 A;  2HDM A;  1XX8 A;  3NUC A;  1B44 D;  5ELC A;  2MUY A;  3QO2 A;  4HMI A;  1STE A;  3D4D A;  3BYT B;  3P75 A;  3CRL C;  1RTN A;  3OSO A;  3MEH A;  1QWY A;  3ND9 A;  2F0F A;  4RCO A;  3VYS A;  3ND8 A;  3T51 B;  2IW3 A;  4MHE A;  1EIG A;  1HHV A;  4EQP A;  2AQ2 B;  1DM0 B;  2Q8I B;  2PW7 A;  3IAY A;  2SOB A;  3RUZ A;  3SK5 A;  2M9V A;  1LTI D;  3GTK B;  5CV6 A;  5A2Q E;  1U4M A;  3K6O A;  4FXK C;  4C3I G;  2O2L D;  4ZUJ A;  4TKO B;  2PZW A;  3S2H B;  1SDF A;  4RGN A;  4OO1 H;  2N55 A;  2OF1 A;  4HTH A;  2PZT A;  3PO2 B;  4KD4 A;  2X6L A;  4K8J A;  2EY1 A;  4IUT A;  2K6A A;  5FLX L;  3BVG A;  1G2T A;  3EFX D;  1STY A;  3TME A;  3PUW A;  1HQR D;  2KQ3 A;  1RKN A;  1I6V C;  5DM6 3;  4A3M B;  4IUQ A;  4HCE A;  4JK1 C;  1I4R A;  4HR7 B;  3T4A C;  3I70 A;  2CW0 C;  1L0Y B;  1KAA A;  4P2C B;  2LY7 A;  1JOR A;  1TY2 A;  1D5Z C;  2B2T C;  4HSV A;  4M8A A;  5ISR A;  2A68 C;  2K28 A;  1EYA A;  4BBS B;  3SK6 A;  4ILW A;  4ZAI A;  1I3Q B;  5J22 A;  1B9N A;  4DAY A;  2FMM A;  1RHP A;  5D65 A;  1SBB B;  1RTO A;  1LLR D;  5KRU A;  5CV7 A;  2BE5 C;  2MHV A;  3NE5 B;  1CQV A;  3ERQ A;  1GUG A;  2JA8 B;  1A3U A;  3S9W A;  1U9R A;  3CQZ B;  3MXG A;  1CM9 A;  3I4N B;  1CFM A;  4IUN A;  1MGS A;  3H0G B;  2IWH A;  4A3D B;  5COR A;  1LO5 D;  4RKL A;  2A6H D;  2EDG A;  5IT9 L;  2YU9 B;  1FGB D;  2KCC A;  3KLS X;  5EKK A;  1YNJ C;  1Z6H A;  1JQY D;  5FOB B;  1B53 A;  1HCZ A;  2NTT A;  3DWA A;  1KDB A;  3J81 E;  4CJ1 B;  1VMP A;  4KTA A;  1O7L A;  5KNC A;  2F0L A;  4OL7 A;  2HQE A;  2VB2 X;  3TZU A;  1CZW A;  2E76 C;  1BCP C;  1CA6 A;  2PPB C;  1SMY D;  4UDU C;  4LMQ D;  4K6D A;  1HFG A;  3SDZ A;  1WTO A;  1D5M C;  2BDN A;  4O1N A;  1SYF A;  2IX0 A;  2BA0 A;  5C5L A;  1IW7 D;  1STA A;  2K5Q A;  2K5D A;  3M85 A;  2F0U A;  3I91 A;  3K5O A;  3Q6S A;  1WCM B;  2F0H A;  1TS4 A;  5D14 A;  1Q1E A;  4A3J B;  1ILP A;  1ENF A;  3BG3 A;  2L0C A;  2EJM A;  4XYO A;  3GTJ B;  4HSP A;  3IL8 A;  5J39 A;  1XTC D;  3RMH A;  1WTR A;  3GTP B;  2J0T D;  1K8M A;  3HOX B;  3H09 A;  2I07 B;  1LAB A;  4OO1 I;  2KEE A;  1STG A;  1H9S A;  1A15 A;  4NW2 A;  4RGO S;  3RZD B;  2QDB A;  3TP7 A;  3J80 E;  1CA5 A;  3O13 A;  5C0X G;  1RJT A;  1GUN A;  1BF4 A;  1QNK A;  3CU7 A;  4LJZ C;  1NCV A;  2KUM A;  4GZY C;  1BQQ T;  3NP8 A;  5JJZ A;  3IKJ A;  4H44 C;  5CBA E;  4M1U B;  3BYY B;  4KN7 C;  3DWQ A;  1WTQ A;  1TKW B;  3EQL C;  2BOS A;  1HXY D;  3NTK A;  1F9P A;  5FKA C;  5IGD A;  3VR5 A;  1IL8 A;  1DZ1 A;  3JAM E;  5K5P A;  5JVG 3;  2JEA I;  3M3Y B;  2F0V A;  4IZ8 A;  2AUJ D;  1LV9 A;  1D5X C;  1I50 B;  3NXW A;  3BDC A;  1VMC A;  1JCK B;  4FNF A;  3DUZ A;  1QG7 A;  1PTO H;  1QNU A;  1SE2 A;  3K5L A;  2IT1 A;  1C8C A;  2PQE A;  5BN3 A;  5FK9 C;  3HOW B;  2R3Z A;  1Y8P B;  2NZ1 D;  3CHB D;  4NDX A;  1Q90 A;  3P1H A;  3H3V C;  2MPM A;  1KAB A;  1KNA A;  1Y1W B;  3I4M B;  4DA2 A;  5E1F A;  1MSH A;  1GHJ A;  2B2V C;  3FDT A;  4G4K A;  2L5T A;  5I2X A;  1HTL D;  2RKS A;  1KLU D;  4ME5 A;  1W6J A;  1EY9 A;  2I46 A;  1GUO A;  3KLS A;  2F0G A;  3MVV A;  4DK1 A;  4QCL A;  4KD3 A;  4C3I B;  2EOT A;  5JOB A;  3M4Y A;  4KY7 A;  5IGE A;  3VR3 A;  2Q8R E;  3U9S A;  1IKM A;  4CKE A;  1LT5 D;  4BBR B;  5KND A;  3I90 A;  1IKL A;  5C3X A;  3WDN A;  3H6M A;  2KA7 A;  1Z7T A;  5CV4 A;  2NWG A;  1JOK A;  4FXG C;  4RWS C;  2IX1 A;  1PLF A;  1F9R A;  2X69 A;  3GTO B;  5M5Y B;  3NQT A;  1KNE A;  3EJI A;  1R9T B;  4L8J A;  1TWH B;  3K58 A;  1A3V A;  2B2T A;  3F2U A;  2NUC A;  2EYJ A;  1B4O A;  4N9T A;  4X3K A;  2ICI A;  1TY0 A;  1MBY A;  1F9S A;  2QIL A;  1EWC A;  1GHK A;  4A3B B;  1I6H B;  3OPO A;  2K33 A;  2MJ8 A;  3TZD A;  4OIK A;  1EY8 A;  4ZKC B;  1S4Z A;  4I65 A;  1NR2 A;  3G7L A;  1CQF A;  1FNV A;  4A3G B;  2VUM B;  3J81 L;  3DM1 A;  3HG9 A;  1ZEQ X;  4ODG A;  4C3H G;  4XQN A;  2Q8T A;  1Y1V B;  2A6H C;  4F87 A;  3J7Y W;  2EVB A;  4MIU A;  3OIP A;  1Q3L A;  5KYI A;  4DAP A;  2WP8 J;  3D6C A;  3C1E A;  2B2Y A;  1B1Z A;  5EBD A;  4U68 A;  3T56 B;  2K05 A;  2RSO A;  2XSC A;  4BS9 A;  4EVO A;  2K1B A;  3HKZ B;  2WAC A;  1DON A;  2LKV A;  3HRZ C;  3MA2 B;  1EU4 A;  1XYI A;  3Q22 A;  3R8B A;  3S1Q B;  5T1G A;  3SEB A;  1T5X D;  3C2P A;  3SXH A;  3MHB A;  1SMY C;  2J4X A;  1C4Q A;  3QWN A;  2K5W A;  4XQJ A;  1Y69 U;  4IFD H;  4PMC A;  1IW7 C;  1LTA D;  1GJX A;  3T53 B;  2EJG C;  3NBH A;  4C3J B;  5I6Y A;  1XXG A;  2O4X A;  1CI3 M;  4R8N A;  2R92 B;  1AFP A;  1Q1B A;  3VA7 A;  4A3K B;  4BWG B;  2L12 A;  2F3V A;  1O80 A;  1EY7 A;  1ENA A;  3QG1 A;  3D31 A;  5M5W B;  2D9U A;  2JA7 B;  1B9M A;  4XYQ A;  2E74 C;  3PO3 B;  2M00 A;  1JOQ A;  5EBC A;  2RA4 A;  2F0N A;  5CV5 A;  1TQO A;  3QJY A;  1YNN D;  1EY0 A;  1TWF B;  1VF7 A;  4FF1 A;  4FXD A;  5EGT A;  5DEH A;  4XTC S;  1A3T A;  3BVZ A;  3MXU A;  4Q0F A;  1C48 A;  4G7O C;  2K7V A;  4KK7 A;  1RDP D;  2AWN A;  2XNA C;  3DWP A;  5FO7 B;  4RCN A;  3HZX A;  4CGY B;  3GV6 A;  1D1I A;  1PRT F;  5DAU A;  4CHT B;  4B08 A;  2ZT9 C;  5C3E B;  1JE4 A;  5K36 G;  2XVS A;  4KHZ A;  3QB3 A;  1ENC A;  1U4R A;  3KF8 A;  5C4Z A;  2QF7 A;  1Q8I A;  4XQQ A;  1DYQ A;  3DEO A;  2AUK A;  4OHJ A;  2BDO A;  2EYL A;  3GO5 A;  2RVL A;  1GUW A;  1NUC A;  1BOS A;  1EZ6 A;  3K5M A;  3CKI B;  3MFG A;  2WB1 B;  3WOF A;  1H9S B;  4KJO A;  4NKL A;  2B8G A;  2F0K A;  5IGB A;  3A8K E;  2X6G A;  1U4P A;  2F0M A;  1G6Z A;  5NUC A;  5JEA H;  1ROD A;  2Z1C A;  3R2I A;  1IYU A;  1PRT B;  1HTP A;  2IPK D;  1SE3 A;  3FVQ A;  5ELF A;  4R8I A;  1TS2 A;  2M2L A;  3T16 A;  4TQU S;  3TP8 A;  2F0P A;  1TWA B;  1WD0 A;  1STH A;  1BDO A;  3DXJ C;  1EY4 A;  2EPB A;  1JB3 A;  3L3O C;  5C3W A;  1E2Z A;  3PIO 3;  3AMU A;  2HUG A;  2B2V A;  3NTI A;  2L4N A;  4V19 0;  2F0Q A;  3I72 A;  5J1Z A;  3SHL A;  3CRK C;  2R7Z B;  5LL6 S;  3OHX C;  3L9A X;  5C6A A;  1SSO A;  1PZI D;  3BDL A;  2RQX A;  1JWM D;  4G7H C;  1O78 A;  2TSS A;  4A93 B;  2XWB B;  5LHY 1;  5I4D A;  1PXU A;  2IL8 A;  1HQM C;  1NR4 A;  1CHQ D;  1OO9 B;  2OXP A;  3K59 A;  1GOZ A;  1FNU A;  1SJH D;  2VNU D;  4K14 A;  3S2D B;  4DK0 A;  4IFD I;  5A35 A;  1V1P A;  1F77 A;  2F1M A;  1II3 A;  2RDF A;  4F8M A;  5K36 H;  2B2W C;  3QOJ A;  3S1R B;  1PRT D;  1QOH A;  1WTW A;  3KLR A;  4DGZ A;  2N88 A;  2DNC A;  4DXF A;  1PFM A;  5I9O A;  2B63 B;  1KLG D;  4PMB A;  1EEI D;  3A55 A;  2K03 A;  4KKS A;  4RKB A;  1EQV A;  3OWE B;  4H0L C;  3DHQ A;  5KNB A;  4KY5 A;  2NVX B;  2KCN A;  1G29 1;  1ESR A;  5FO8 B;  4IUU A;  3P20 A;  4KMU C;  4YIJ A;  5JVH 3;  2R93 B;  1T5E A;  3S16 B;  2B8F A;  1SEB D;  2NN6 G;  4QUC A;  3PIP 3;  2F03 A;  3M4O B;  2K01 A;  3S15 B;  3GD7 A;  2K32 A;  1PFN A;  5BN5 A;  4OIJ A;  1ZYR D;  3AB9 A;  3GTL B;  5LL6 X;  3ZYY X;  1W6K A;  1E2V A;  1R4Q B;  2XN9 C;  4RH6 A;  4CBV A;  1NSN S;  5TSS A;  4EQN A;  2F0S A;  4FYD A;  1BCP F;  3VYU A;  1WVL A;  3HOV B;  4CKB A;  1DD2 A;  1EY5 A;  3FPU B;  4QUF A;  3EA6 A;  3N6R A;  4F7X A;  5D3D A;  3VR6 A;  3T13 A;  4C56 C;  3TDQ A;  3FRP B;  1ET9 A;  3GP7 A;  3NSW A;  2FIN B;  2WII B;  1ML0 D;  4QMG A;  1MI2 A;  2VB3 X;  3GTM B;  5IGG A;  1JR0 D;  4FO2 A;  1EEF D;  1WD1 A;  5EKL A;  2PZU A;  1Y8N B;  3ERO A;  3SVM A;  1H9J A;  3OIQ A;  3KK7 A;  3E6Z X;  1FR3 A;  2ICE C;  2EJF C;  5A2Q L;  3LWU A;  1U4L A;  1S5F D;  2F0I A;  5FLX E;  2EY2 A;  1OXX K;  1YNN C;  1F9Q A;  3S14 B;  3NWS A;  2RBM A;  3R3O A;  4KV6 A;  1QE6 A;  1SXT A;  2OT2 A;  4BA1 I;  2F0J A;  2E2I B;  2EXZ A;  4BY1 B;  4DF7 A;  2O5I C;  5I2Y A;  1CZG A;  2C5C A;  1TWG B;  3VYR A;  1DOK A;  4Z9C B;  5KEE A;  4WFN 3;  3OOC A;  3M7G A;  1BR9 A;  2NN6 H;  4K5W A;  3GTG B;  2A74 C;  4Y7N B;  2GA4 B;  3I3C A;  3E0J A;  1VDZ A;  4QIW B;  2G9D A;  3H94 A;  1UEA B;  3K5N A;  4RHS A;  1HRJ A;  4C1N K;  2L9H A;  1EYD A;  3HS0 C;  3S1N B;  2AWO A;  2PNR C;  1FYC A;  2XRQ D;  1SYC A;  1WTP A;  5JPM C;  5C0X H;  4L6T B;  5E4W C;  4HED A;  4WOR A;  2PYK A;  1WTV A;  1ZKO A;  1DOM A;  2HCI A;  1GUS A;  4HN7 A;  1I4H A;  1BO0 A;  3OWF A;  5IT9 E;  2NTS A;  4E6I A;  4U67 3;  1QIL A;  1TVX A;  1QB5 D;  4K5V A;  1J8I A;  3PUY A;  1UUP A;  2ID0 A;  4IUR A;  1H9K A;  4O42 A;  3I73 A;  4NMZ A;  1SNM A;  4MN3 A;  1X32 A;  1ICW A;  1H9R A;  5G3L F;  1DCZ A;  1LTB D;  1TU2 B;  1DJR D;  3D4W A;  3IFT A;  2V4D A;  2CVR A;  3IFD A;  1KDA A;  2PW5 A;  2F0O A;  5EPJ A;  3NK9 A;  4BY7 B;  4A3F B;  2R61 A;  2ZXP A;  4NP5 A;  4RA8 A;  4RAU C;  4K8I A;  1SNQ A;  5CV8 A;  2H4O A;  4DNR B;  1SJE D;  4J8Q A;  3TSS A;  4CJ0 B;  4FF2 A;  2NB0 A;  2KEC A;  1PTO F;  3X3N A;  1SYG A;  2K04 A;  4TRD A;  4FVM A;  3HEJ A;  1SNO A;  3K7A B;  4HAE A;  1TWC B;  5I9P A;  4DAV A;  3S17 B;  2YYZ A;  2Z4I A;  3K0Y A;  4G7Z C;  2EYP A;  4XXE A;  1AP0 A;  3VYT A;  4IQZ A;  2IX3 A;  4RGT A;  2RSN A;  2RDG A;  1R4P B;  1E2W A;  2F3W A;  2B2W A;  1PRT C;  5KIX A;  4ZLT F;  1B3A A;  4F88 A;  3NHH A;  3GQB A;  1J9O A;  5HGT A;  1UAP A;  4LAA A;  5HUR A;  2WV6 D;  5CMD A;  2XWJ B;  1UNS A;  1F2M A;  1AZQ A;  1PTO B;  1EWH A;  5C5M A;  4IFD J;  1EIH A;  1V1P B;  5IOC A;  5EQ0 A;  4LK1 C;  3SK4 A;  2EY6 A;  1I4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...