4X3SA

Crystal structure of chromobox homology 7 (cbx7) with setdb1-1170me3 peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
MGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 7
publication title Small-Molecule Modulators of Methyl-Lysine Binding for the CBX7 Chromodomain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 12
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4x3sA00
2B2VA 4HCSA 1IKMA 4CJ0B 4ZLTF 2JYOA 3TN2A 1DONA 1SAPA 1F9RA 3P7JA 5CMDA 1LV9A 2B2WA 2K28A 4HSVA 4MN3A 4ZKCB 2NWGA 1BNZA 4HEDA 1O80A 5DNFA 1JICA 1PFNA 4MHEA 1M8AA 1F2LA 2MPMA 3KBXA 5EPLA 1U4PA 4RAUC 4XDXA 1Q3LA 2IL8A 2FFKB 2Q8TA 4XT1B 1BBXC 1HRJA 1HFGA 3H91A 5EJWA 1CM9A 1NCVA 4R9WA 2B2TC 4NW2A 1HUMA 4OIKA 5T1IA 3Q6SA 1RTOA 3IL8A 4IURA 1IL8A 4QUFA 1A15A 4RWSC 1WTRA 2XIWA 4IUVA 3D6WA 1F9SA 1MSHA 4CJ2C 2RVLA 1DOMA 1U4MA 5CORA 2L4NA 2R3ZA 1JE4A 2KEEA 2RSOA 2EOTA 1XX8A 2HCCA 1QNKA 3MWYW 5EPKA 1S4ZA 3FPUB 2SDFA 2K1BA 5AFWA 3R93A 1B50A 1DOLA 4XT3B 2FHTA 2FJ2A 1B4OA 2KECA 2X6LA 4X3SA 4IUUA 1U4RA 2KOLA 3MTSA 1RJTA 1HUNA 2K04A 1F9PA 2KEDA 2D9UA 4LMQD 3SVMA 1WTOA 1VMPA 2K03A 3I3CA 4R8IA 5D65A 1ZXTA 3N52A 1B53A 4X3KA 5EQ0A 3FDTA 1VMCA 1X32A 5JJZA 1NR4A 1PFMA 2KVMA 2RSNA 2JP1A 1CA5A 1AP0A 2MJ8A 3I8ZA 5T1GA 2NYZD 2L1BA 1IKLA 1TVXA 1EOTA 3I91A 2Q8RE 1WD0A 3DEPA 2L9HA 3ONAB 2CVRA 1ICWA 1X3PA 1DOKA 4RA8A 1WTVA 5CBAE 2K05A 1ESRA 1PFBA 4IUTA 1RTNA 2HCIA 2BDNA 2VXWA 4X3UA 1BF4A 1WVLA 1RODA 2B2TA 1KNAA 2B2VC 1NR2A 1B3AA 1EIGA 2J7ZA 1MSGA 2MGSA 5EPJA 1SDFA 1AZPA 5CBEE 1ILQA 3DEOA 2EPBA 1C8CA 1J8IA 3LWEA 3HP3A 2B2WC 4DN4M 5D14A 1PLFA 1WTQA 1ILPA 2MP1A 3DM1A 1O7YA 1QE6A 2L11A 3IFDA 2X69A 4IUQA 1EQTA 4X3TA 1EIHA 2DY7A 4CJ1B 4O42A 5EKIA 1HFNA 3GV3A 3GV6A 3UI2A 4QUCA 4HAEA 3F2UA 4ZKBB 1AZQA 2B2YC 5E4XA 2DY8A 2N55A 5E4WC 1MGSA 1WTXA 1G6ZA 1GUWA 5COYA 1J9OA 1DZ1A 4UAIA 1SSOA 1G2SA 1MI2A 1G91A 4ZK9B 4U68A 2RA4A 1WTWA 1WTPA 2B2UC 3I90A 1ML0D 2FINB 2X6GA 4ZAIA 3KUPA 1QG7A 1EL0A 1U4LA 3QO2A 2M2LA 1XYIA 1NAPA 4OIJA 1CA6A 1B2TA 2HUGA 2K01A 2HDLA 2B2YA 2HDMA 2EE1A 2L12A 4IUPA 2H1EA 2NZ1D 3G7LA 1KNEA 2FMMA 1WD1A 1O7ZA 1HA6A 1E0BA 1G2TA 2KUMA 2N88A 1HHVA 2B2UA 1BO0A 1RHPA 3TZDA 1F9QA 1PDQA 1X3QA
chains in the Genus database with same CATH superfamily
1IKMA 4BWGB 1KTKA 1TY2A 3AFPA 2Y0SG 2EJMA 4ODGA 3P7JA 1SE3A 3MHBA 1R9TH 3GTKB 1YNJD 3HOVB 4DR1Q 1O80A 1QVGA 1HZBA 3K0XA 4A3EB 3E9HA 1YJWA 5C3EB 1PH8A 4LAAA 5IYBG 1Q90A 3X3NA 2Q2TA 2YTVA 4KY7A 5EBCA 1PRTF 4FVMA 1RTOA 3J7AV 3IL8A 3SK8A 2UU9Q 1LUZA 2F3IA 2XIWA 1DXMA 5IT9E 1QUQB 5CORA 1STHA 4A93H 5M5YB 1EWIA 2SDFA 2V4DA 1B8AA 2WKCA 2PMZE 1D5MC 3E0JA 5IWAL 4TSSA 5FLMG 1F9PA 2JA6B 4RMFA 1YVCA 1ZXTA 4QMGA 4L5RC 1X32A 3HOVG 1YNND 3RNUA 1YZ6A 1I4XA 4A3EG 1V1OA 5C3EG 2H5XA 1PTOF 2EYMA 4KI0A 3TP8A 1OTCA 4C2MH 2L9HA 3K7AH 1EY9A 4UP7A 5I9OA 2LY7A 4KY6A 4LF5L 4GOPA 2E2HB 1MSGA 5EKKA 1TWFB 4G4KA 4JI2Q 5KYIA 4LF4Q 1WCMB 2CQAA 3NWTA 1PLFA 5ELNA 2NN6G 3IFDA 4JBWA 5M5XH 2Z1CA 3S1RB 2DY7A 4PZ6A 4CJ1B 3K0YA 2WKDA 3E9IA 4BY1H 1S72A 1H9JA 3CCLA 4DFAA 2JA6G 1EQQA 2QILA 3MAQA 4Q0FA 4M1UB 4KKUA 5G3LF 5D3IB 3HOYH 2F0GA 1FVIA 1Y1VH 3PV0A 2HUGA 3VDYA 1XNRQ 2R93H 2QDBA 4J6HA 1VQEA 2B2YA 2HDMA 1XPRA 3EROA 3HOWB 1SMXA 1V1QA 1KNEA 3EJIA 5IGCA 5KYLA 1WD1A 1CUKA 1EEFD 2N88A 3PIOA 1KRTA 3T4AC 1X3GA 2JYOA 5ELDA 1ONLA 1WCMG 2Z4IA 1I6HB 4UP9A 3ULJA 1GUTA 2UUBQ 4KY5A 2JJQA 3K5LA 1VQIA 2CWAA 2K75A 3ULLA 4DR3Q 3E5SA 3CCSA 2JXMB 3A7LA 2FFKB 1XNQL 4JYAQ 2BDOA 3I2ZA 5GAHC 4K5XA 2WB1B 4HJ7A 4A3JB 1IL8A 4HJ8A 5EKLA 4A3FH 1OXTA 1BCPD 2ZXOA 2I5LX 2RVLA 4ILWA 4PQXA 3SEBA 4JI5Q 1DOMA 4DNRB 1U4MA 3HOWG 2NVTH 1SJED 1HA5A 4A3LG 1GHJA 5LMNW 1XX8A 5IYDG 2G9DA 4EQOA 4DR1L 4JI1Q 3OIPA 1DOLA 1BUVT 1KAWA 2F0IA 1K8GA 3F2DA 3D4DA 5K5PA 5FLXL 4KHPQ 4FNFA 4CDEC 1QVCA 1STGA 3E0EA 5JJZA 2UU9L 2KVMA 4IPDA 2JP1A 2MJ8A 3GTGB 1E3PA 2F0DA 1EQRA 1EWCA 3DHQA 2B3GA 3DLLA 1GUOA 5KNBA 1HHVA 1HR0W 2WB1G 4C3HG 4A3JG 3RZOH 5IGDA 4V0BA 1SE2A 1C8CA 5GROA 3LWEA 4ZUJA 2F0LA 4MIUA 1E2WA 1C9OA 4DA2A 1PH1A 4NPSA 4WFN3 3I4LA 1VQJA 1O7IA 2DY8A 2MFIA 3CMAA 2N55A 5E4WC 4DXFA 1SE8A 3BYYB 2YTYA 2PYKA 3I70A 1KL9A 5E7NA 3KLSA 2B2UC 1KLUD 4L5TA 1XMQQ 1QG7A 4CKEA 1ZKOA 4JI2L 2SNSA 4LF4L 1O7LA 4CKBA 1EY7A 3A54A 1D1IA 1GXDC 3PCOB 3H3VH 1HTPA 2RDHA 5C5LA 2NB0A 4IPGA 3GO5A 4OWTB 2PI2A 1BR9A 3NQIA 1GVPA 4CJ0B 4ZLTF 5GADC 1F9RA 4H44C 4PZ7A 4JK1C 5BN4A 2K28A 1C48A 4DV4Q 4RHRA 3A7AB 3A74A 4JG2A 2J0TD 1XNRL 1NNXA 5EPLA 5L37A 1NMGA 3J7AF 3GTQH 3BJUA 4KJNA 1FNUA 1HJPA 3DWAA 1AH9A 1EWHA 4N9PA 4FF3A 3BDLA 1Q81C 4QUFA 3QR8A 3EFXD 1Y8OB 2F0PA 1U9RA 4TVAB 3RLFA 2UUBL 3OIQA 4LF6Q 1QWYA 5CV8A 4FF2A 1FNVA 1IYUA 1VQAA 4DR3L 1NBWA 1VQ5A 4WJ3M 1HPCA 4GN4B 2A6EC 1A3UA 1EZ8A 5CV4A 2R92B 2PMZB 2FJ2A 4J15A 1MHWC 1A62A 1W6JA 5M5WB 4FXGC 4JYAL 3SVMA 3HKSA 1IL2A 1XJVA 5H1SE 5JEAJ 3VYSA 1WFQA 5BN3A 2B63B 2UXCQ 2R61A 4JI5L 2XRQD 3HG9A 1R4QB 4DV5Q 1PH9A 2PZUA 2XGTA 3T51B 4XYQA 1VF7A 1WI5A 2PZWA 3QG1A 4QIWE 4JI1L 4A3CG 1NR2A 2K14A 1VQNA 4K6DA 2VB2X 4KHPL 3WOEA 4K0KQ 3BVMA 2HHHQ 3M7GA 2YU9H 4P2CB 3UE0A 4O42A 2K5DA 3CCJA 1CZGA 2R92G 1STAA 4HIKA 4O1NA 1C7YA 5KGUA 5COYA 2Z9HA 4C3IB 1KAAA 1T5XD 2R7FA 2RA4A 3J81i 3I90A 4ZAIA 2FINB 3S16B 5M3FH 3K7UC 3QO2A 4ME3A 2B63G 1NAPA 2JA5B 2MHVA 1B2TA 3E6ZX 4Y7NH 5C4JB 2ZJPA 3ITPA 3K57A 3SE0A 1XMOQ 1SRUA 1EYCA 3EVQA 2OEOA 1IBKQ 5CYUA 3K6OA 1L1OC 1HTLD 2IJ0A 4NXMQ 1VQPA 2A69C 2F0WA 1TWAB 5CMDA 1PFSA 1TWGB 2E2IB 1XMQL 1JC7A 4HEDA 5IOCA 1M4VA 1GKHA 3MZ5A 1RD9D 3R2TA 2QF7A 5JVG3 1TQOA 2IL8A 4K6LA 1G291 1HRJA 2N78A 4ZQ3A 4C3IG 4F8MA 4JI7Q 4KD3A 2EQSA 4IUNA 2IY5B 1WTRA 4X66Q 5KRUA 5C4XB 1F9SA 4PMCA 2JA5G 3GTMH 4CBVA 4DR7Q 4F87A 4QF4A 3HZXA 4DV4L 1ENFA 2ZJRA 4CHTB 3EA6A 5IT9L 4CDCC 3CCEA 3HS0C 3TEHB 2EYJA 2KECA 4X3SA 1DYQA 3OTOQ 2KOLA 4KN4C 4KV6A 4OO1H 3OSOA 2DUDA 4OEMB 2DGYA 5T1GA 1JORA 5LMUQ 4A3KB 1CK1A 4LF6L 1Z9FA 1N32Q 1X3PA 3ERQA 2FXQA 2YV5A 4QGUA 1PTOH 1SMYC 2F0MA 4HIDA 1J5EQ 3VR3A 4KKTA 1VQFA 3L0OA 1EU3A 5C3WA 1H9MA 4HR7B 1QVFA 3I55A 5IYBH 3MEFA 4NXNQ 1CI3M 2OTJA 4BBRH 5CC4A 1QE6A 2N49A 1EUJA 1UEBA 4GKJQ 3ER0A 4YIJA 2UXCL 1A3TA 2EY6A 3SGIA 4DV5L 4L63B 2E74C 4PZ8A 1G6ZA 1I3QH 1I50H 2A69D 4UAIA 1G2SA 1MI2A 5C5MA 1VS0A 1EFID 1PMRA 5ELEA 4K0KL 5FLMH 1CFMA 4A3KG 2HHHL 2FMMA 3T13A 3OMGA 3HOVH 2BE5C 4TRDA 4UPAA 3Q23A 3HOZH 3UDGA 5FO8B 2K6AA 1X3QA 1GUSA 2LSSA 1HNWQ 3LNNA 2NVYB 1UNSA 3BYTB 1LV9A 2ID0A 2Z8LA 4ULLA 3F2CA 3DM3A 4R4TA 1O78A 2VW9A 1X55A 1M8AA 3NQTA 1XMOL 1Q3LA 1IBKL 3FHWA 3M3YH 2NBFA 2IPKD 3CRKC 1UE6A 4E6IA 3S1NH 2IX3A 4NXML 5IY0A 2F4VQ 5FKAC 3S9WA 1JE4A 2EOTA 1L1OB 1K3RA 2A68D 5J1ZA 4XT3B 3TQYA 1PHJA 3L2PA 2PNHA 3A0JA 1K8AC 4JI7L 1WTOA 3RMHA 2K03A 5ELFA 1D6EC 1W2BA 4X66L 1GUNA 4Z9CB 1OXVA 4DR7L 3RN2A 3W2DA 1JMCA 1WCMH 2O2LD 4DAVA 1H9SB 1YBYA 2DNEA 5CR3A 2GN5A 4AH6A 5AJ3L 4JI4Q 3KF8B 3S1RH 3S1QB 3M4YA 1YNJC 4QIWB 1SFOB 3TREA 4YWKA 4OHJA 3OTOL 3AMUA 4LUZA 5F2DA 3I73A 5IIFA 1D1KA 2MP1A 1LACA 1O7YA 1NMFA 3RLOA 3MVVA 3U9SA 3GV3A 4BXXH 3C1FA 3R3OA 5C0XJ 5LMUL 4H0LC 1YIJA 1TWHB 3HOWH 1MGSA 2F1MA 4A3DH 4MTNA 1AEXA 1J5EL 4C3JB 2E5LQ 3PUZA 4EX5A 3Q0AA 2ALYB 1U4LA 3VA7A 1OO9B 4NXNL 1AE2A 3UE1A 5I6WA 4RGMA 3I4NH 2EE1A 1SYCA 5G3LD 1II3A 5JEAH 4GKJL 1EEID 3CC7A 2K33A 4DNTB 2NVXB 1G2TA 1CTMA 1YNNC 3DUZA 2VY3A 2HIXA 4IALA 1KD1C 4LW1A 2D0PA 4R8NA 1STEA 4C3HH 3HEJA 2JA7B 4A3GH 4HIMA 2L15A 2V1CC 1STNA 1F2LA 4XTCS 3S1MB 2ZTDA 2L5TA 4JI8Q 3CXCA 4C3JG 1BQQT 2E2JH 3V2TA 3J81c 4IURA 5C3XA 2HQLA 4DV0Q 1F2ZA 1G51A 4RHSA 1HNWL 5GAEC 1LLRD 2BA0A 1NE3A 4H7BA 4MNOA 1ET9A 4DKAC 1VQLA 1GD7A 4R4CA 1PH4A 1ENAA 1SNQA 2JQOA 1A6XA 1B9MA 3NBHB 3MTSA 2K04A 1V43A 1K83H 1SNDA 2WIIB 4P75A 4X3KA 2JA7G 3CKIB 4JC0A 5C44B 5I6YA 4DAYB 3PO2B 1V1PB 4ALPA 2F4VL 5IGGA 2BH8A 1S40A 4XQJA 4P74A 1TT2A 4ZYSA 1KQSA 3C2PA 2KCCA 3PO3B 2PQAA 1SYBA 3P20A 3R2IA 4YCWA 3AQQA 1PYSB 1TXYA 3QIAA 4HMJA 1LO5D 2K5VA 2QKIC 3I56A 1CHQD 2XWBB 3FMCA 4RCNA 1SEBD 2VUMB 3S14B 2K5NA 1FL0A 1S5CD 4YWLA 1I4QA 4RCOA 3CMEA 5HY6A 1TWCB 1XWEA 1BCPC 3UI2A 4JI4L 1IZ6A 1HCZA 2EJGC 1HNXL 1F77A 1SSOA 1PV4A 1AN8A 2PW5A 1WTWA 1WTPA 4X65Q 3A8IE 2M2LA 3ERSX 3J7ZC 2FMCA 5C44G 2OQ0A 1EU4A 4GN3B 3PO2G 2EYHA 2L12A 2EXZA 3U50C 3KDFA 1HA6A 1FNWA 3I7FA 3PO3G 2M00A 4FP5D 3SR1A 2Z6KA 4R1JA 4KJOA 2E5LL 2VUMG 4A3CH 1Z6HA 3J80c 2VQFQ 3A5UA 1PFNA 5BR8Q 4JBKA 4PMBA 4H13C 5KNDA 1EY0A 2WAQE 4DR2Q 5IP9H 2F3WA 1AW7A 5T1IA 2OWOA 5EAYA 1A15A 3PUYA 1T9HA 2R92H 3ND8A 2K5QA 1LT6D 4LFAQ 4A3BB 3C3LA 3DXJC 4I7AA 2EZVA 2B63H 2O5IC 1U5KA 3VA5A 4ID6A 2ZJQA 1VQMA 1SLJA 1GO3E 3M4OH 3K59A 4JI8L 4R4QA 4DV7Q 1A2TA 3KF6A 4OELB 4Y52H 4G7ZC 4GOPC 2NVQH 4DV0L 1NSNS 2GA4B 4F88A 1Y1WB 1L2FA 2CHBD 4A3IB 1D2BA 1N34Q 1OXXK 5CBAE 2EYLA 5FJ8H 2VXWA 2BCOA 1VQKA 4A3MH 3CAMA 1G8ZD 2Z6KC 4LF9Q 2QEJC 2K50A 2EDGA 1PZJD 4C3IH 4BY7H 3CC4A 4A3BG 1UWVA 2X69A 4CKCA 1ENCA 1JOKA 2BOSA 5EKIA 3GTLB 2ASBA 2B2YC 3S17H 4EGVA 2WACA 4B3ML 1VQDA 4QY7A 4JV5Q 3GQBA 1B3QA 4FDBA 1XTDA 1E1OA 1A63A 5ELOA 3MXNB 1EOVA 4GN5A 4OIJA 5D3DA 3CF5A 4RGNA 4A3IG 3A55A 2F0TA 1TWGH 1R9TB 1VQBA 1EY4A 1W6KA 4GNXA 4DV3Q 4OX9Q 3O13A 1CQVA 3I72A 1KABA 1V9PA 1ZEQX 2YYZA 2H4OA 3MXGA 4QCLA 3KFUA 1SAPA 3OWEB 5JPMC 1VQ8A 3A56A 2RF4A 3FEWX 1J6QA 1EY6A 4X65L 2L0CA 2B2WA 2LMCB 2IX0A 2NWGA 1BCPB 2A1AA 5LMNQ 2WINB 2D5DA 3BDCA 4PMWA 2PI2E 2XN9C 3JAME 3GTJH 4A93B 3QOLA 1N33Q 5ELBA 1YHBA 2JA8B 4RWSC 5C0XH 3PUXA 3S2DH 2PW7A 2JSOA 2QGQA 1EYGA 1TY0A 5CV9A 4LFCQ 4QL5A 2PNRC 2VQFL 3GTOH 1IYJB 5BR8L 3IKJA 1E2VA 1LABA 5IYCG 3D0FA 4A3KH 4G7HC 2ZM6Q 4DR2L 3K7AB 1QJOA 1UAPA 1ASYA 4FO2A 1B53A 1HZ9A 2RSNA 3T53B 2RKSA 2DNCA 3NENA 4N9TA 4EVOA 2OF1A 2HQEA 4LFAL 2E75C 2PQAB 4L5QA 4GNXC 1DOKA 3PGZA 4DK6C 4C1NI 2OXPA 3BG3A 3G71A 2EVBA 4FXKC 4A75A 5M5XB 4A93G 1J8IA 3IAYA 1GUGA 1BBUA 2JA8G 1SDFA 4BY1B 3W3AA 4DV7L 3STBD 1FGUA 1Y8PB 4OGQC 4B9WA 4POFA 5IE8A 2B2WC 2F03A 1EFWA 1ILPA 2KBNA 3S15B 3HOYB 1KLGD 1JB3A 3FPPA 1GHKA 1Y1VB 2EY5A 1M1KC 5C4ZA 1N34L 1YJ9A 1RKNA 4GOPB 3D6CA 2JE6I 1LM0A 3NSWA 4DK3C 2OTLA 1GJXA 2IX1A 4LF9L 2QW7A 3D31A 2I0QA 3AB9A 1KHIA 3KK7A 4IUPA 1WOCA 2R7ZH 1A8VA 1AE3A 4HSPA 4YHHQ 2A6HC 3HKZE 4KTAA 4B3TQ 1CKOA 1RHPA 4K14A 1PDQA 5A35A 1BDOA 1JJ2A 4HCSA 4BY1G 2GVBA 4AQYQ 4JV5L 1LTTD 2UXBQ 2GVAA 5LL6S 1IXRA 5FLXc 2EYPA 4ZKCB 2K52A 1TU2B 2E76C 1JICA 4A3FB 3HOYG 3HGBA 2MPMA 1Y1VG 2AQ2B 5JVH3 4CGYB 2WAQB 5GQOA 4XT1B 1E22A 1NCVA 2O5JC 4R9WA 4A4IA 1JE5A 4DV3L 5M3MB 1MD2D 4OX9L 3GD7A 5K36G 1TKWB 3MEHA 4DF7A 3D6WA 3OW2A 2L4NA 2EY2A 3RN5A 3K80C 4BA1I 1A0IA 3FPUB 1WYDA 5LMNL 5NUCA 4LUOA 4X6AH 3OPOA 2KENA 4OXPA 1XPUA 1U4RA 4S3SA 3QOJA 4KN7C 4XIGS 4DV2Q 5J3BA 3OW7A 4IZ8A 3HOUB 3S1QH 3I3CA 1N8RC 1N33L 1Q8KA 2ICIA 1NR4A 3S2HH 1K0SA 1D5ZC 1S3OA 2F0FA 1L0XB 3RZOB 1AP0A 1I4GA 5A2QE 3EIVA 1LT3D 4LFCL 3W1BA 3TSSA 2WAQG 3HOXH 3SXHA 3VR6A 5AJ3Q 4IUTA 2NZOA 3F2BA 2HCIA 2D62A 1BF4A 5M3MG 1E24A 3F8TA 3CW2C 4B3RQ 1EIGA 3E3XA 5EPJA 1AZPA 2ZM6L 5E1FA 4DN4M 5JJKA 4GLXA 1HFNA 1D8LA 2A6HD 2I5MX 3BZKA 4IPCA 2QCPX 2F0QA 4DXGA 2E2DC 1HZAA 3H0GH 1JWUD 4LWCA 4ZUIA 1PRTC 1S5BD 4RGOS 2LFNA 4IN3A 3CPFA 2J4XA 2MO0A 1K9MC 5I4DA 4LJZC 4O2DA 3HOUG 2IHEA 1JOQA 2A68C 3CQZH 4CDDC 3TP6A 3GTPH 5C4XG 4GNXB 4DV6Q 4H02A 2C9OA 1IBLQ 1VQOA 4YCVA 3MFYA 2JA7H 5IGBA 2L55A 5FK9C 1X54A 3D8GA 3GTQB 3NWSA 1QUQA 2XRSD 2ZXPA 2KA7A 3FP9A 5DNFA 2AHOB 3SK4A 4KD4A 2NTSA 2UXDL 1XXGA 1QB5D 4RAUC 4YHHL 1BBXC 2I46A 4B3TL 1OXUA 3GTKH 4HJAA 3BVZA 1PH7A 4DR4L 4A3EH 5C3EH 1CQFA 4AQYL 3JAMi 2CFMA 2RDGA 2UXBL 1PYBA 4QB4A 1SNPA 2R3ZA 3ZJYC 4HN7A 1S5DD 3K8AA 5I9PA 1RCVD 4YWMA 1TS4A 1LTGD 3R93A 5IODA 1B4OA 1E7ZA 2D9UA 2NN6H 2N3SA 1W3SA 5M5YH 2TSSA 4G7OC 1OXSC 3L7ZC 1C0AA 1PFMA 4DR6Q 1EY5A 2XTIA 3NTKA 1PRTD 1EOTA 2VNUD 4X62Q 1Y14B 1DJRD 3CRLC 1WD0A 2JA6H 2YU9B 4FXDA 5CV6A 2QEXA 4HJ5A 2BDNA 4RH6A 4ZRZA 1V8QA 2E8GA 4LUVA 5DM63 1ESFA 4WRDA 4CDFC 5CBEE 2C35B 4TQUS 1PYWD 2ENBA 3VR5A 4DV2L 1Q1EA 3TZUA 3PSIA 2PPBC 2F52A 3V96A 4RG1A 4X64L 1I4PA 3MXUA 2E2HH 3AYHB 4HAEA 1PXUA 4IJHA 1SJHD 1TWFH 5E4XA 4Y7NB 2BH2A 1PA6A 2K5HA 3KBGA 3NTHA 4K5VA 1EYDA 2PZTA 5CGKA 1QZGA 2KJXA 5C6AA 1I4HA 1EIYB 1HNXQ 4B3RL 4XYOA 3A5ZB 1QOHA 3FRPB 3CCMA 1HZCA 1PTOD 1XYIA 1CA6A 2AQ3B 4DU9A 2HDLA 4DUZQ 2YTXA 3M4PA 2R7DA 3C1EA 3HKZB 1EIFA 3L9AX 1VQHA 5IT9c 3P1HA 3KJPA 3TP7A 1LTAD 2TMPA 4A3LH 2F0SA 1MKHA 5IYDH 4HIOA 1Z7TA 2SOBA 3WWVA 3CPWA 4HSVA 3OMCA 1JJGA 3AFQA 4BS9A 1QZHA 1YNXA 1U0LA 4MHEA 5HGQA 3GTMB 1JWMD 3GP7A 3CCUA 4DV6L 1I6HH 5GAGC 4P71A 1IBLL 2A73B 4WJ4A 1HUMA 3UDIA 1VQGA 2LKVA 5KEEA 4OWWB 4LFBQ 1Z47A 5JAVA 4B08A 1Q7YC 3TS0A 3RD4A 2PCFB 3PIP3 2XSCA 3JAML 5CV7A 4R4IA 2P5ZX 4IPHA 3EBEA 3N6RA 1YJNA 3HKZG 2NUCA 1S4ZA 3BS1A 4A3JH 2RHSB 5AFWA 4C56C 3D4RA 3U9OA 3W5OA 1JWSD 4M8AA 1HUNA 2KEDA 1I4RA 4EQPA 3PQIA 1VMPA 2I07B 2IW3A 1G6PA 5IP7G 1LTID 3I8ZA 4RKBA 4TKOB 4BBRB 4AYBE 3DWQA 3ND9A 2C5CA 2Z6BA 5IGFA 4X3UA 3KLRA 2MGSA 4YCUA 2ES2A 3GTGH 3KJOA 5DM73 1KIXA 2XNAC 1I3QB 4XQQA 1I50B 4DV1Q 3D4WA 5D14A 1WTQA 1KDCA 4DR6L 1IBMQ 4P72A 4IFDI 4OO1G 1YHQA 2EYFA 1Q1BA 2B29A 3F2UA 2AMCB 4X62L 4KKSA 2LS01 1J9OA 4B3MQ 3QWNA 2OQKA 3CCVA 1PH2A 1G91A 1NUCA 1ML0D 2EYOA 3HRZC 3UDXA 3A8JE 3EQLC 3LGJA 5IYCH 1BOSA 4RGTA 4DUYQ 3HOZB 2JEBI 2O4XA 2VZAA 4MTKA 1T5EA 3SK6A 4BBRG 3CC2A 1RIPA 3IFTA 4BBSB 3NHHA 3VYRA 1E0BA 2KUMA 4DAMA 1MJEA 2F0VA 4U673 1DONA 3NUCA 3BZDB 1B9NA 1FYCA 3J7A5 2ZTCA 2F0UA 4GKKQ 4MN3A 3U4ZA 3M3YB 2JA8H 1CT1D 3K81C 3TMEA 1QILA 3S1NB 3K5OA 4DUZL 3OHXC 5TSSA 2Q8TA 2F3VA 3CHBD 3M4QA 4OIKA 1BBWA 2RQXA 1JR0D 3NELA 3RUZA 4JI0Q 3M7NA 5JOBA 3HOZG 1H95A 1F2MA 3MC0B 5BN5A 4DPGA 5I2XA 1QNKA 4BBSG 3TRZA 1GM5A 1VQ6A 4HJ9A 1B50A 1IYVA 5E3FA 4EQNA 2AWOA 4FF4A 1Q82C 2CH4W 2RDFA 4WJWA 5KNCA 4LFBL 1JOOA 1A2UA 3J81E 4NMZA 3SK5A 5M5WH 3PF4A 2UUAQ 1X3FA 2MUYA 2K05A 3CCQA 3S15H 5A2QL 2D2CC 1RODA 1B3AA 1M90C 3BDOA 1UE1A 1RDPD 3JAMc 2DJFC 4A3DB 2PQEA 3DM1A 3I4MB 1ET6A 3GDEA 5K36H 2VB3X 5ELCA 1EQTA 2KHSA 3T1HL 3RZDB 4UY8C 4JCVE 3G4SA 1UE7A 2F0NA 4JBJA 2F0OA 1WTXA 3I4NB 2JK8A 3OWFA 1CSPA 1CKNA 4L8JA 1DZ1A 4LF7Q 2IT1A 4ZK9B 1EL0A 2SNMA 2AUKA 2SEBD 4HTHA 4RKLA 4DR5Q 5CV5A 2K01A 3KLWA 4DV1L 1DM0B 5LHY1 1SYGA 4C3HB 3NPPA 1IBML 2PO4A 4J8QA 4NP5A 4UP8A 3CCRA 4A3GB 3S16H 2B2UA 1WJJA 4BXXG 4U68A 3K5MA 1I94Q 1Q46A 2JA5H 3CD6A 5C4JH 2ZXRA 3NBIA 2KQ3A 1VCIA 1STYA 4A3DG 3H94A 3P75A 5M3MH 3I4MG 1HXYD 3Q24A 1BNZA 1LTRD 2E2JB 4DUYL 3FKIB 4PG3A 3STBC 4JBMA 1Y1WG 3I4NG 1UEAB 4IFDG 1HFGA 1TWAH 3H91A 1SYEA 5JEAG 2E2IH 2RCFA 1TS2A 2OT2A 3A8KE 4IUVA 2Q8IB 1HQMC 2Z0SA 3NEMA 3HOUH 4GKKL 1K83B 2F0EA 4P73A 2VL6A 2XWJB 4A3GG 2QDLA 3J80E 5C4XH 3W1GA 2X6LA 2WP8J 1UUPA 2B39A 4KMUC 4UHVA 4I65A 4LMQD 3J81j 2CQOA 3N52A 5EQ0A 3M85A 4JI0L 2JA9A 3FKIG 1YEZA 3OOCA 1IKLA 1FGBD 2AKWB 2Q8RE 4AYBB 4N8FA 1RTNA 1SYDA 4HMIA 3RR5A 1WVLA 3ZYYX 1TS3A 4O0AA 2Q2IA 1HR0Q 3UDFA 1UE5A 1EYAA 3QB3A 4C2MB 4PNYA 3URYA 3H3VC 1P16A 1NTGA 3PF5A 2EY1A 1VF5C 1BVSA 2B8GA 1R4PB 3M9BA 3NTIA 3IRBA 2F0JA 2UUAL 4QJFA 1LTSD 1AFPA 4B3SQ 1LTLA 3PIPA 5KIXA 1X56A 3MFGA 4K8IA 2RCNA 3RLNA 2H1EA 2RBMA 4B9XA 4AYBG 2Z4HA 3DMUA 4LK1C 1SNOA 5LL6X 1SROA 1KDBA 4FYDA 4JI6Q 2MQHA 1BO0A 1SN8A 5J22A 1I6VC 3H3VI 1N36Q 1ZYRC 3TN2A 2R93B 4IO9A 5C0XI 4LF7L 2OCEA 1FR3A 2HD3A 3B6YA 3J7YW 1SE4A 2N8NA 4DGZA 4DR5L 2UUCQ 1L1OA 4NB3A 3KBXA 1U4PA 3KDFB 4IFDJ 2UXDQ 1Q12A 3PMFA 1BCPF 1Y69U 2NVYH 2ZTEA 5EJWA 4NKLA 4NW2A 1GOZA 1I94L 3H09A 1VQ7A 2K5WA 3M4OB 2QA4A 4LF8Q 4DR4Q 3NP8A 3T16A 1QNUA 2KEEA 5HURA 3VR4A 1H9SA 3MWYW 2AWNA 1JT8A 3KF8A 2K1BA 2NVQB 4JOIA 1TS5A 4YY3Q 4ABNA 4IUUA 4DK1A 3H15A 1RJTA 1D5XC 2R93G 4GLVB 2NVTB 5IP9G 1VQ4A 2HIVA 5ISRA 4APVA 1X6OA 4A3MB 1N9WA 2F0KA 2WFWA 3Q8DA 2NYZD 1FD7D 4A76A 4BY7B 4OONA 1I5FA 1ICWA 2B8FA 1HQRD 4Q5VA 2DN8A 1YI2A 2KHIA 5EBDA 2B2TA 2K32A 1IW7C 1KNAA 3X3MA 4L6TB 3C46A 1CZWA 2LXJA 3KF6B 3TP5A 3ICEA 3S17B 2Y0SE 3AU7A 3I4OA 1MJCA 1K8OA 2KCMA 3U58A 3VYUA 5FOBB 4IUQA 4X3TA 1EIHA 1DCZA 1SFOH 4X64Q 1CKNB 4PV1C 2G9HD 4FF1A 4A3FG 3S24A 5J39A 1ZYRD 1GUWA 1SBBB 3MXPA 3TBIB 1DD2A 1FJGQ 1MBYA 5FJ8G 4MZ9A 2A6ED 4A3MG 4K2KA 1HH2P 1H9RA 1HR0L 1TWHH 3T1YQ 2CCZA 4BY7G 1VQCA 2I5HA 3G7LA 1JB7A 4C3JH 1ICFB 2A5HA 5IP7H 4JOIC 3TDQA 3TZDA 1SXTA 3FVQA 2IWHA 3BVGA 1LYLA 2KCNA 3KLSX 4OWXB 5JJIA 2WV6D 1D7QA 4B3SL 4JI3Q 3GTJB 2VQEQ 2NVXH 3PUWA 1A3VA 1JJCB 1E1TA 3LX0A 5JPNC 3S2DB 1HNZQ 3WOFA 4I7ZC 3DWPA 1TIID 1XTCD 1CM9A 3NBHA 5IGEA 2B2TC 1ASZA 4JI6L 4ZCKA 2MO1A 3GTOB 3HFZB 1B70B 2A19A 2ICEC 1NJIC 3BZCA 1N36L 3VYTA 1MSHA 3S1MH 3ULPA 4J1MA 1XPOA 1B44D 2VS1A 1E2ZA 3BU2A 4DAYA 1S5FD 2RSOA 1V1PA 2HCCA 3QJYA 5FLXE 2UUCL 1K28A 5HGTA 4G57A 1IW7D 1TR5A 1PTOC 2FHTA 4GZYC 3PIO3 2IHFA 5DLQE 3PUVA 5DAUA 3J80i 2RHQB 1PH3A 1KDAA 1LTBD 5D65A 1IHZA 2F4IA 1VMCA 3D3RA 1YITA 1CA5A 5JJLA 4LF8L 4F7XA 5C0XG 1X65A 1NY4A 2Q2HA 1RL2A 1Q8IA 1PH5A 4OO1I 3I91A 2BA1A 1JCKB 2Q2UA 3J81L 4IJLA 1WTVA 4BA2I 4IOAA 1PFBA 3NK9A 3F1ZA 2G5DA 1MIUA 2CW0C 3NXWA 2J7ZA 5EGTA 1RF2D 4GLAC 2XVSA 2R6GA 4YY3L 2A74C 3KOJA 5C44H 4EQ5A 3H6MA 3PO2H 1ILQA 2EPBA 3HP3A 2K7VA 4IQZA 2F0HA 2L11A 3PO3H 1SR3A 2LXKA 1X9NA 4QUCA 2KCTA 2HT1A 4JPBW 4KHZA 5C4HA 1B7YB 3CU7A 2VUMH 2R7ZB 4AIMA 3S14H 4DAPA 4BBSH 4POGA 4R4OA 3JC66 5FO7B 4IOCA 2X6GA 1SNCA 1BKBA 2ZT9C 2EJFC 1TWCH 1EZ6A 4K2LA 1BXTA 1O7ZA 1LT5D 1B1ZA 1Y8NB 1QCBD 4WORA 5M3FB 1VQ9A 4KLKA 2B2VA 4JW0A 1C4QA 3U4VA 4NDXA 1LT4D 1KXLA 2D0OA 1SMYD 2EXDA 1FJGL 4KHVA 4XXEA 4C1NK 3NE5B 1PH6A 1CSQA 3T1YL 4XDXA 4GS3A 5IWAQ 1K73C 1EY8A 2M9VA 3V05A 3VR2A 2R7ZG 1K0RA 1PVOA 1K3BC 2WB1E 3Q6SA 4DK0A 3L3OC 2KHJA 2NN6I 3TS2A 1KRSA 4CJ2C 4RFBA 4LNQA 1SNMA 4JI3L 3G6JB 4N8X1 1P8LA 2VQEL 5I2YA 3WDNA 1SYFA 5DEHA 2JEAI 5EPKA 4HCEA 3T56B 3S2HB 2CW0D 4K5WA 4LF5Q 1HNZL 5M3FG 1PRTB 1F2YA 2ATWA 1L0YB 4ME5A 3G6EA 4K8JA 3HOXB 1JQYD 2CH4A 2MNAA 3J80L 4A3BH 4R8IA 1H9KA 1Q86C 2BE5D 1WTHA 1X3EA 2CKZB 3FDTA 3AEVA 3MA2B 1N32L 4OL7A 2L1BA 3EN2A 1TVXA 1L0WA 3SHLA 3DEPA 3ONAB 2CVRA 3I4MH 4RA8A 5M9OA 1ESRA 4UDUC 1STBA 1YHAA 3RZDH 2NZHA 1PZID 2B2VC 3OYYA 1S5ED 3H0GB 1K8MA 3R8BA 1Y1WH 2A8VA 3DEOA 2Y0SB 4A3IH 4V190 4IFDH 1PZKD 3MXNA 2K4KA 4L5SA 3K5NA 2EIFA 1CHPD 1DGSA 2AQ1B 4KK7A 1PTOB 3KYHC 3GV6A 3T1HQ 3CQZB 4ZKBB 3GTPB 1AZQA 1KC8C 2DJGC 4DNIA 3HOXG 1EQVA 3SDZA 1VDZA 3CP0A 3KUPA 3GTLH 1CKMA 4XQNA 3Q22A 5FO9B 3G48A 4JVZA 2AUJD 3K58A 2JN4A 2NZ1D 3LWUA 1XNQQ 3FKIH 2NTTA 4QQBX 1F9QA 3H0GG 2CWPA
chains in the Genus database with same CATH topology
1IKMA 4BWGB 1KTKA 1TY2A 2EJMA 4ODGA 3P7JA 1SE3A 3MHBA 3GTKB 1YNJD 3HOVB 1O80A 4A3EB 5C3EB 4LAAA 1Q90A 3X3NA 4KY7A 5EBCA 1PRTF 4FVMA 1RTOA 3J7AV 3IL8A 3SK8A 2XIWA 1DXMA 5IT9E 5CORA 1STHA 5M5YB 2SDFA 2V4DA 2WKCA 1D5MC 3E0JA 4TSSA 1F9PA 2JA6B 1ZXTA 4QMGA 1X32A 1YNND 1I4XA 1V1OA 1PTOF 2EYMA 4KI0A 3TP8A 2L9HA 1EY9A 5I9OA 2LY7A 4KY6A 2E2HB 1MSGA 5EKKA 1TWFB 4G4KA 5KYIA 1WCMB 2CQAA 3NWTA 1PLFA 2NN6G 3IFDA 4JBWA 2Z1CA 3S1RB 2DY7A 4CJ1B 3K0YA 2WKDA 1H9JA 4DFAA 2QILA 3MAQA 4Q0FA 4M1UB 4KKUA 5G3LF 5D3IB 2F0GA 3PV0A 2HUGA 2QDBA 4J6HA 2B2YA 2HDMA 3HOWB 3EROA 1KNEA 3EJIA 5IGCA 5KYLA 1WD1A 1EEFD 2N88A 3T4AC 2JYOA 5ELDA 1ONLA 2Z4IA 1I6HB 1GUTA 4KY5A 3K5LA 3E5SA 2JXMB 3A7LA 2FFKB 2BDOA 4K5XA 2WB1B 4A3JB 1IL8A 5EKLA 1OXTA 1BCPD 2ZXOA 4PQXA 2RVLA 4ILWA 3SEBA 1DOMA 4DNRB 1U4MA 1SJED 1HA5A 1GHJA 1XX8A 2G9DA 4EQOA 3OIPA 1DOLA 1BUVT 2F0IA 3D4DA 5K5PA 5FLXL 4FNFA 1STGA 5JJZA 2KVMA 2JP1A 2MJ8A 3GTGB 2F0DA 1EWCA 3DHQA 1GUOA 5KNBA 1HHVA 4C3HG 5IGDA 4V0BA 1SE2A 1C8CA 3LWEA 4ZUJA 2F0LA 4MIUA 1E2WA 4DA2A 4WFN3 3I4LA 2DY8A 2N55A 5E4WC 4DXFA 3BYYB 2PYKA 3I70A 3KLSA 2B2UC 1KLUD 1QG7A 4CKEA 1ZKOA 2SNSA 1O7LA 4CKBA 1EY7A 3A54A 1D1IA 1GXDC 1HTPA 2RDHA 5C5LA 2NB0A 3GO5A 1BR9A 3NQIA 4CJ0B 4ZLTF 1F9RA 4H44C 4JK1C 5BN4A 2K28A 1C48A 4RHRA 3A7AB 2J0TD 5EPLA 3J7AF 4KJNA 1FNUA 3DWAA 1EWHA 4N9PA 4FF3A 3BDLA 4QUFA 3EFXD 1Y8OB 2F0PA 1U9RA 3RLFA 3OIQA 1QWYA 5CV8A 4FF2A 1FNVA 1IYUA 1HPCA 2A6EC 1A3UA 1EZ8A 5CV4A 2R92B 2PMZB 2FJ2A 1W6JA 5M5WB 4FXGC 3SVMA 5JEAJ 3VYSA 5BN3A 2B63B 2R61A 2XRQD 3HG9A 1R4QB 2PZUA 3T51B 4XYQA 1VF7A 2PZWA 3QG1A 1NR2A 4K6DA 2VB2X 3WOEA 3BVMA 3M7GA 4P2CB 4O42A 2K5DA 1CZGA 1STAA 4O1NA 5KGUA 5COYA 4C3IB 1KAAA 1T5XD 2RA4A 3I90A 4ZAIA 2FINB 3S16B 3QO2A 1NAPA 2JA5B 2MHVA 1B2TA 3E6ZX 5C4JB 3ITPA 3K57A 3SE0A 1EYCA 3EVQA 2OEOA 5CYUA 3K6OA 1HTLD 2IJ0A 2A69C 2F0WA 1TWAB 5CMDA 1TWGB 2E2IB 1JC7A 4HEDA 5IOCA 1M4VA 3MZ5A 1RD9D 3R2TA 2QF7A 5JVG3 1TQOA 2IL8A 4K6LA 1G291 1HRJA 4ZQ3A 4C3IG 4F8MA 4KD3A 4IUNA 1WTRA 5KRUA 5C4XB 1F9SA 4PMCA 4CBVA 4F87A 4QF4A 3HZXA 1ENFA 4CHTB 3EA6A 5IT9L 3HS0C 2EYJA 2KECA 4X3SA 1DYQA 2KOLA 4KN4C 4KV6A 4OO1H 3OSOA 5T1GA 1JORA 4A3KB 1CK1A 1X3PA 3ERQA 1PTOH 1SMYC 2F0MA 3VR3A 4KKTA 1EU3A 5C3WA 1H9MA 4HR7B 1CI3M 5CC4A 1QE6A 4YIJA 1A3TA 2EY6A 4L63B 2E74C 1G6ZA 2A69D 4UAIA 1G2SA 1MI2A 5C5MA 1EFID 1PMRA 5ELEA 1CFMA 2FMMA 3T13A 3OMGA 2BE5C 4TRDA 3Q23A 5FO8B 2K6AA 1X3QA 1GUSA 3LNNA 2NVYB 1UNSA 3BYTB 1LV9A 2ID0A 2Z8LA 4ULLA 1O78A 1M8AA 3NQTA 1Q3LA 2NBFA 2IPKD 3CRKC 4E6IA 2IX3A 5FKAC 3S9WA 1JE4A 2EOTA 2A68D 5J1ZA 4XT3B 1WTOA 3RMHA 2K03A 5ELFA 1D6EC 1GUNA 4Z9CB 1OXVA 3W2DA 2O2LD 4DAVA 1H9SB 2DNEA 5CR3A 3S1QB 3M4YA 1YNJC 4QIWB 1SFOB 4OHJA 3AMUA 5F2DA 3I73A 5IIFA 1D1KA 2MP1A 1LACA 1O7YA 3MVVA 3U9SA 3GV3A 3C1FA 3R3OA 5C0XJ 4H0LC 1TWHB 1MGSA 2F1MA 1AEXA 4C3JB 3PUZA 3Q0AA 1U4LA 3VA7A 1OO9B 5I6WA 4RGMA 2EE1A 1SYCA 5G3LD 1II3A 5JEAH 1EEID 2NVXB 2K33A 4DNTB 1G2TA 1CTMA 1YNNC 3DUZA 4IALA 4R8NA 1STEA 3HEJA 2JA7B 1STNA 1F2LA 4XTCS 3S1MB 2L5TA 4C3JG 1BQQT 3V2TA 4IURA 5C3XA 1F2ZA 4RHSA 1LLRD 2BA0A 4H7BA 1ET9A 1ENAA 1SNQA 1A6XA 1B9MA 3MTSA 2K04A 1V43A 1SNDA 2WIIB 4X3KA 3CKIB 5C44B 5I6YA 3PO2B 1V1PB 5IGGA 4XQJA 1TT2A 4ZYSA 3C2PA 2KCCA 3PO3B 1SYBA 3P20A 3R2IA 3QIAA 4HMJA 1LO5D 2QKIC 1CHQD 2XWBB 3FMCA 4RCNA 1SEBD 2VUMB 3S14B 1S5CD 1I4QA 4RCOA 1TWCB 1XWEA 1BCPC 3UI2A 1HCZA 2EJGC 1F77A 1SSOA 1AN8A 2PW5A 1WTWA 1WTPA 3A8IE 2M2LA 2FMCA 1EU4A 2EYHA 2L12A 2EXZA 1HA6A 1FNWA 2M00A 4FP5D 3SR1A 4KJOA 1Z6HA 1PFNA 4PMBA 4H13C 5KNDA 1EY0A 2F3WA 1AW7A 5T1IA 1A15A 3PUYA 3ND8A 2K5QA 1LT6D 4A3BB 3C3LA 3DXJC 2EZVA 2O5IC 3VA5A 4ID6A 3K59A 1A2TA 4G7ZC 1NSNS 2GA4B 4F88A 1Y1WB 4A3IB 2CHBD 1D2BA 1OXXK 5CBAE 2EYLA 2VXWA 2BCOA 1G8ZD 2QEJC 2EDGA 1PZJD 2X69A 4CKCA 1ENCA 1JOKA 2BOSA 5EKIA 3GTLB 2B2YC 4EGVA 2WACA 3GQBA 4OIJA 5D3DA 4RGNA 3A55A 2F0TA 1R9TB 1EY4A 1W6KA 3O13A 1CQVA 3I72A 1KABA 1ZEQX 2YYZA 2H4OA 3MXGA 4QCLA 1SAPA 3OWEB 5JPMC 3A56A 3FEWX 1EY6A 2L0CA 2B2WA 2LMCB 2IX0A 2NWGA 1BCPB 2WINB 2D5DA 3BDCA 4PMWA 2XN9C 3JAME 4A93B 3QOLA 5ELBA 2JA8B 4RWSC 5C0XH 3PUXA 2PW7A 2JSOA 1TY0A 5CV9A 2PNRC 3IKJA 1E2VA 1LABA 4G7HC 3K7AB 1QJOA 1UAPA 4FO2A 1B53A 2RSNA 3T53B 2RKSA 2DNCA 4N9TA 4EVOA 2OF1A 2HQEA 2E75C 1DOKA 4C1NI 2OXPA 3BG3A 5M5XB 2EVBA 4FXKC 1J8IA 3IAYA 1GUGA 1SDFA 4BY1B 3W3AA 1Y8PB 4OGQC 4B9WA 2B2WC 2F03A 1ILPA 3S15B 3HOYB 1KLGD 1JB3A 3FPPA 1GHKA 1Y1VB 2EY5A 5C4ZA 1RKNA 3D6CA 2JE6I 3NSWA 1GJXA 2IX1A 3D31A 3AB9A 3KK7A 4IUPA 4HSPA 2A6HC 4KTAA 1RHPA 4K14A 1PDQA 5A35A 1BDOA 4HCSA 1LTTD 5LL6S 2EYPA 4ZKCB 1TU2B 2E76C 1JICA 4A3FB 3HGBA 2MPMA 2AQ2B 5JVH3 4CGYB 2WAQB 4XT1B 1NCVA 2O5JC 4R9WA 5M3MB 1MD2D 3GD7A 5K36G 1TKWB 3MEHA 4DF7A 3D6WA 2L4NA 2EY2A 4BA1I 3FPUB 5NUCA 3OPOA 1U4RA 4S3SA 3QOJA 4KN7C 4XIGS 3HOUB 3OW7A 4IZ8A 3I3CA 2ICIA 1NR4A 1D5ZC 2F0FA 3RZOB 1L0XB 1AP0A 1I4GA 5A2QE 1LT3D 3TSSA 3SXHA 3VR6A 4IUTA 2HCIA 2D62A 1BF4A 1EIGA 5EPJA 1AZPA 5E1FA 4DN4M 1HFNA 2A6HD 2QCPX 2F0QA 4DXGA 2E2DC 1JWUD 4ZUIA 1PRTC 1S5BD 4RGOS 2LFNA 4IN3A 2J4XA 5I4DA 4LJZC 1JOQA 2A68C 3TP6A 2C9OA 3MFYA 5IGBA 2L55A 5FK9C 3D8GA 3GTQB 3NWSA 2XRSD 2ZXPA 2KA7A 5DNFA 3SK4A 4KD4A 2NTSA 1XXGA 1QB5D 4RAUC 1BBXC 2I46A 1OXUA 3BVZA 1CQFA 2RDGA 4QB4A 1SNPA 2R3ZA 4HN7A 1S5DD 5I9PA 1RCVD 1TS4A 1LTGD 3R93A 5IODA 1B4OA 2D9UA 2NN6H 2TSSA 4G7OC 1OXSC 3L7ZC 1PFMA 1EY5A 3NTKA 1PRTD 1EOTA 2VNUD 1DJRD 3CRLC 1WD0A 2YU9B 4FXDA 5CV6A 2BDNA 4RH6A 4ZRZA 1V8QA 5DM63 1ESFA 4WRDA 5CBEE 4TQUS 1PYWD 2ENBA 3VR5A 1Q1EA 3TZUA 2PPBC 3V96A 1I4PA 3MXUA 4HAEA 1PXUA 1SJHD 5E4XA 4Y7NB 3KBGA 3NTHA 4K5VA 1EYDA 2PZTA 5CGKA 2KJXA 5C6AA 1I4HA 4XYOA 3FRPB 1QOHA 1PTOD 1XYIA 1CA6A 2AQ3B 4DU9A 2HDLA 3C1EA 3HKZB 3L9AX 3P1HA 3TP7A 1LTAD 2TMPA 2F0SA 1Z7TA 2SOBA 4HSVA 3OMCA 4BS9A 4MHEA 3GTMB 1JWMD 3GP7A 2A73B 1HUMA 2LKVA 5KEEA 1Z47A 5JAVA 4B08A 3RD4A 2PCFB 3PIP3 2XSCA 3JAML 5CV7A 3N6RA 2NUCA 1S4ZA 3BS1A 5AFWA 4C56C 3D4RA 3U9OA 1JWSD 4M8AA 1HUNA 2KEDA 1I4RA 4EQPA 1VMPA 2I07B 2IW3A 1LTID 3I8ZA 4RKBA 4TKOB 4BBRB 3DWQA 3ND9A 2C5CA 5IGFA 4X3UA 3KLRA 2MGSA 5DM73 2XNAC 1I3QB 4XQQA 1I50B 3D4WA 5D14A 1WTQA 1KDCA 4IFDI 4OO1G 2EYFA 1Q1BA 3F2UA 4KKSA 2LS01 1J9OA 3QWNA 1G91A 1NUCA 1ML0D 2EYOA 3HRZC 3A8JE 3EQLC 1BOSA 4RGTA 3HOZB 2JEBI 2O4XA 1T5EA 3SK6A 3IFTA 4BBSB 3NHHA 3VYRA 1E0BA 2KUMA 2F0VA 4U673 1DONA 3NUCA 3BZDB 1B9NA 1FYCA 2F0UA 4MN3A 3M3YB 1CT1D 3TMEA 1QILA 3S1NB 3K5OA 3OHXC 5TSSA 2Q8TA 2F3VA 3CHBD 4OIKA 2RQXA 1JR0D 3RUZA 3M7NA 5JOBA 1F2MA 3MC0B 5BN5A 5I2XA 1QNKA 1B50A 1IYVA 5E3FA 4EQNA 2AWOA 4FF4A 2RDFA 4WJWA 5KNCA 1JOOA 1A2UA 3J81E 4NMZA 3SK5A 2MUYA 2K05A 5A2QL 2D2CC 1RODA 1B3AA 3BDOA 1RDPD 4A3DB 2PQEA 3DM1A 3I4MB 1ET6A 5K36H 2VB3X 5ELCA 1EQTA 2KHSA 3RZDB 2F0NA 2F0OA 1WTXA 3I4NB 3OWFA 4L8JA 1DZ1A 2IT1A 4ZK9B 1EL0A 2SNMA 2AUKA 2SEBD 4HTHA 4RKLA 5CV5A 2K01A 1DM0B 5LHY1 1SYGA 4C3HB 3NPPA 2PO4A 4J8QA 4NP5A 4A3GB 2B2UA 4U68A 3K5MA 2ZXRA 3NBIA 2KQ3A 1VCIA 1STYA 3H94A 3P75A 1HXYD 3Q24A 1BNZA 1LTRD 2E2JB 3FKIB 1UEAB 4IFDG 1HFGA 3H91A 1SYEA 5JEAG 1TS2A 2OT2A 3A8KE 4IUVA 2Q8IB 1HQMC 1K83B 2F0EA 2XWJB 3J80E 2X6LA 2WP8J 1UUPA 2B39A 4KMUC 4I65A 4LMQD 3N52A 5EQ0A 3M85A 3OOCA 1IKLA 1FGBD 2Q8RE 4AYBB 1RTNA 1SYDA 4HMIA 1WVLA 3ZYYX 1TS3A 1EYAA 3QB3A 4C2MB 4PNYA 3URYA 3H3VC 2EY1A 1VF5C 2B8GA 1R4PB 3NTIA 2F0JA 1LTSD 1AFPA 5KIXA 3MFGA 4K8IA 2H1EA 2RBMA 4B9XA 2Z4HA 3DMUA 4LK1C 1SNOA 5LL6X 1KDBA 4FYDA 1BO0A 5J22A 1I6VC 1ZYRC 3TN2A 2R93B 5C0XI 1FR3A 3J7YW 1SE4A 4DGZA 3KBXA 1U4PA 4IFDJ 1Q12A 3PMFA 1BCPF 1Y69U 5EJWA 4NKLA 4NW2A 1GOZA 3H09A 2K5WA 3M4OB 3NP8A 3T16A 1QNUA 2KEEA 5HURA 3VR4A 1H9SA 3MWYW 2AWNA 3KF8A 2K1BA 2NVQB 1TS5A 4ABNA 4IUUA 4DK1A 1RJTA 1D5XC 2NVTB 5ISRA 4A3MB 2F0KA 2NYZD 1FD7D 4BY7B 1ICWA 2B8FA 1HQRD 4Q5VA 2DN8A 5EBDA 2B2TA 2K32A 1IW7C 1KNAA 3X3MA 4L6TB 3C46A 1CZWA 3TP5A 3S17B 3AU7A 1K8OA 3VYUA 5FOBB 4IUQA 4X3TA 1EIHA 1DCZA 4PV1C 2G9HD 4FF1A 5J39A 1ZYRD 1GUWA 1SBBB 3MXPA 3TBIB 1DD2A 1MBYA 2A6ED 4K2KA 1H9RA 3G7LA 2A5HA 3TDQA 3TZDA 1SXTA 3FVQA 2IWHA 3BVGA 2KCNA 3KLSX 2WV6D 3GTJB 3PUWA 1A3VA 3LX0A 5JPNC 3S2DB 3WOFA 4I7ZC 3DWPA 1TIID 1XTCD 1CM9A 3NBHA 5IGEA 2B2TC 3GTOB 2ICEC 3VYTA 1MSHA 4J1MA 1B44D 1E2ZA 4DAYA 1S5FD 2RSOA 1V1PA 2HCCA 3QJYA 5FLXE 5HGTA 4G57A 1IW7D 1TR5A 1PTOC 2FHTA 4GZYC 3PIO3 3PUVA 5DAUA 1KDAA 1LTBD 5D65A 1IHZA 2F4IA 1VMCA 3D3RA 1CA5A 4F7XA 5C0XG 1Q8IA 4OO1I 3I91A 2BA1A 1JCKB 3J81L 1WTVA 4BA2I 1PFBA 3NK9A 2CW0C 3NXWA 2J7ZA 5EGTA 1RF2D 2XVSA 2R6GA 2A74C 3H6MA 1ILQA 2EPBA 3HP3A 2K7VA 4IQZA 2F0HA 2L11A 4QUCA 4KHZA 5C4HA 3CU7A 2R7ZB 4DAPA 5FO7B 2X6GA 1SNCA 2ZT9C 2EJFC 1EZ6A 4K2LA 1BXTA 1O7ZA 1LT5D 1B1ZA 1Y8NB 1QCBD 4WORA 5M3FB 2B2VA 1C4QA 4NDXA 1LT4D 1SMYD 4KHVA 4XXEA 4C1NK 3NE5B 4XDXA 1EY8A 2M9VA 3V05A 3VR2A 3Q6SA 4DK0A 3L3OC 2NN6I 4CJ2C 4RFBA 1SNMA 3G6JB 5I2YA 3WDNA 1SYFA 5DEHA 2JEAI 5EPKA 4HCEA 3T56B 3S2HB 2CW0D 4K5WA 1PRTB 1F2YA 1L0YB 4ME5A 4K8JA 3HOXB 1JQYD 3J80L 4R8IA 1H9KA 2BE5D 3FDTA 3MA2B 4OL7A 2L1BA 1TVXA 3SHLA 3DEPA 3ONAB 2CVRA 4RA8A 5M9OA 1ESRA 4UDUC 1STBA 1PZID 2B2VC 1S5ED 3H0GB 1K8MA 3R8BA 3DEOA 2Y0SB 4V190 4IFDH 1PZKD 3MXNA 3K5NA 1CHPD 2AQ1B 4KK7A 1PTOB 3GV6A 3CQZB 4ZKBB 3GTPB 1AZQA 1EQVA 3SDZA 1VDZA 3KUPA 4XQNA 3Q22A 5FO9B 2AUJD 3K58A 2NZ1D 3LWUA 2NTTA 1F9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2V A;  4HCS A;  1IKM A;  4CJ0 B;  4ZLT F;  2JYO A;  3TN2 A;  1DON A;  1SAP A;  1F9R A;  3P7J A;  5CMD A;  1LV9 A;  2B2W A;  2K28 A;  4HSV A;  4MN3 A;  4ZKC B;  2NWG A;  1BNZ A;  4HED A;  1O80 A;  5DNF A;  1JIC A;  1PFN A;  4MHE A;  1M8A A;  1F2L A;  2MPM A;  3KBX A;  5EPL A;  1U4P A;  4RAU C;  4XDX A;  1Q3L A;  2IL8 A;  2FFK B;  2Q8T A;  4XT1 B;  1BBX C;  1HRJ A;  1HFG A;  3H91 A;  5EJW A;  1CM9 A;  1NCV A;  4R9W A;  2B2T C;  4NW2 A;  1HUM A;  4OIK A;  5T1I A;  3Q6S A;  1RTO A;  3IL8 A;  4IUR A;  1IL8 A;  4QUF A;  1A15 A;  4RWS C;  1WTR A;  2XIW A;  4IUV A;  3D6W A;  1F9S A;  1MSH A;  4CJ2 C;  2RVL A;  1DOM A;  1U4M A;  5COR A;  2L4N A;  2R3Z A;  1JE4 A;  2KEE A;  2RSO A;  2EOT A;  1XX8 A;  2HCC A;  1QNK A;  3MWY W;  5EPK A;  1S4Z A;  3FPU B;  2SDF A;  2K1B A;  5AFW A;  3R93 A;  1B50 A;  1DOL A;  4XT3 B;  2FHT A;  2FJ2 A;  1B4O A;  2KEC A;  2X6L A;  4X3S A;  4IUU A;  1U4R A;  2KOL A;  3MTS A;  1RJT A;  1HUN A;  2K04 A;  1F9P A;  2KED A;  2D9U A;  4LMQ D;  3SVM A;  1WTO A;  1VMP A;  2K03 A;  3I3C A;  4R8I A;  5D65 A;  1ZXT A;  3N52 A;  1B53 A;  4X3K A;  5EQ0 A;  3FDT A;  1VMC A;  1X32 A;  5JJZ A;  1NR4 A;  1PFM A;  2KVM A;  2RSN A;  2JP1 A;  1CA5 A;  1AP0 A;  2MJ8 A;  3I8Z A;  5T1G A;  2NYZ D;  2L1B A;  1IKL A;  1TVX A;  1EOT A;  3I91 A;  2Q8R E;  1WD0 A;  3DEP A;  2L9H A;  3ONA B;  2CVR A;  1ICW A;  1X3P A;  1DOK A;  4RA8 A;  1WTV A;  5CBA E;  2K05 A;  1ESR A;  1PFB A;  4IUT A;  1RTN A;  2HCI A;  2BDN A;  2VXW A;  4X3U A;  1BF4 A;  1WVL A;  1ROD A;  2B2T A;  1KNA A;  2B2V C;  1NR2 A;  1B3A A;  1EIG A;  2J7Z A;  1MSG A;  2MGS A;  5EPJ A;  1SDF A;  1AZP A;  5CBE E;  1ILQ A;  3DEO A;  2EPB A;  1C8C A;  1J8I A;  3LWE A;  3HP3 A;  2B2W C;  4DN4 M;  5D14 A;  1PLF A;  1WTQ A;  1ILP A;  2MP1 A;  3DM1 A;  1O7Y A;  1QE6 A;  2L11 A;  3IFD A;  2X69 A;  4IUQ A;  1EQT A;  4X3T A;  1EIH A;  2DY7 A;  4CJ1 B;  4O42 A;  5EKI A;  1HFN A;  3GV3 A;  3GV6 A;  3UI2 A;  4QUC A;  4HAE A;  3F2U A;  4ZKB B;  1AZQ A;  2B2Y C;  5E4X A;  2DY8 A;  2N55 A;  5E4W C;  1MGS A;  1WTX A;  1G6Z A;  1GUW A;  5COY A;  1J9O A;  1DZ1 A;  4UAI A;  1SSO A;  1G2S A;  1MI2 A;  1G91 A;  4ZK9 B;  4U68 A;  2RA4 A;  1WTW A;  1WTP A;  2B2U C;  3I90 A;  1ML0 D;  2FIN B;  2X6G A;  4ZAI A;  3KUP A;  1QG7 A;  1EL0 A;  1U4L A;  3QO2 A;  2M2L A;  1XYI A;  1NAP A;  4OIJ A;  1CA6 A;  1B2T A;  2HUG A;  2K01 A;  2HDL A;  2B2Y A;  2HDM A;  2EE1 A;  2L12 A;  4IUP A;  2H1E A;  2NZ1 D;  3G7L A;  1KNE A;  2FMM A;  1WD1 A;  1O7Z A;  1HA6 A;  1E0B A;  1G2T A;  2KUM A;  2N88 A;  1HHV A;  2B2U A;  1BO0 A;  1RHP A;  3TZD A;  1F9Q A;  1PDQ A;  1X3Q A; 
#chains in the Genus database with same CATH topology
 1IKM A;  4BWG B;  1KTK A;  1TY2 A;  3AFP A;  2Y0S G;  2EJM A;  4ODG A;  3P7J A;  1SE3 A;  3MHB A;  1R9T H;  3GTK B;  1YNJ D;  3HOV B;  4DR1 Q;  1O80 A;  1QVG A;  1HZB A;  3K0X A;  4A3E B;  3E9H A;  1YJW A;  5C3E B;  1PH8 A;  4LAA A;  5IYB G;  1Q90 A;  3X3N A;  2Q2T A;  2YTV A;  4KY7 A;  5EBC A;  1PRT F;  4FVM A;  1RTO A;  3J7A V;  3IL8 A;  3SK8 A;  2UU9 Q;  1LUZ A;  2F3I A;  2XIW A;  1DXM A;  5IT9 E;  1QUQ B;  5COR A;  1STH A;  4A93 H;  5M5Y B;  1EWI A;  2SDF A;  2V4D A;  1B8A A;  2WKC A;  2PMZ E;  1D5M C;  3E0J A;  5IWA L;  4TSS A;  5FLM G;  1F9P A;  2JA6 B;  4RMF A;  1YVC A;  1ZXT A;  4QMG A;  4L5R C;  1X32 A;  3HOV G;  1YNN D;  3RNU A;  1YZ6 A;  1I4X A;  4A3E G;  1V1O A;  5C3E G;  2H5X A;  1PTO F;  2EYM A;  4KI0 A;  3TP8 A;  1OTC A;  4C2M H;  2L9H A;  3K7A H;  1EY9 A;  4UP7 A;  5I9O A;  2LY7 A;  4KY6 A;  4LF5 L;  4GOP A;  2E2H B;  1MSG A;  5EKK A;  1TWF B;  4G4K A;  4JI2 Q;  5KYI A;  4LF4 Q;  1WCM B;  2CQA A;  3NWT A;  1PLF A;  5ELN A;  2NN6 G;  3IFD A;  4JBW A;  5M5X H;  2Z1C A;  3S1R B;  2DY7 A;  4PZ6 A;  4CJ1 B;  3K0Y A;  2WKD A;  3E9I A;  4BY1 H;  1S72 A;  1H9J A;  3CCL A;  4DFA A;  2JA6 G;  1EQQ A;  2QIL A;  3MAQ A;  4Q0F A;  4M1U B;  4KKU A;  5G3L F;  5D3I B;  3HOY H;  2F0G A;  1FVI A;  1Y1V H;  3PV0 A;  2HUG A;  3VDY A;  1XNR Q;  2R93 H;  2QDB A;  4J6H A;  1VQE A;  2B2Y A;  2HDM A;  1XPR A;  3ERO A;  3HOW B;  1SMX A;  1V1Q A;  1KNE A;  3EJI A;  5IGC A;  5KYL A;  1WD1 A;  1CUK A;  1EEF D;  2N88 A;  3PIO A;  1KRT A;  3T4A C;  1X3G A;  2JYO A;  5ELD A;  1ONL A;  1WCM G;  2Z4I A;  1I6H B;  4UP9 A;  3ULJ A;  1GUT A;  2UUB Q;  4KY5 A;  2JJQ A;  3K5L A;  1VQI A;  2CWA A;  2K75 A;  3ULL A;  4DR3 Q;  3E5S A;  3CCS A;  2JXM B;  3A7L A;  2FFK B;  1XNQ L;  4JYA Q;  2BDO A;  3I2Z A;  5GAH C;  4K5X A;  2WB1 B;  4HJ7 A;  4A3J B;  1IL8 A;  4HJ8 A;  5EKL A;  4A3F H;  1OXT A;  1BCP D;  2ZXO A;  2I5L X;  2RVL A;  4ILW A;  4PQX A;  3SEB A;  4JI5 Q;  1DOM A;  4DNR B;  1U4M A;  3HOW G;  2NVT H;  1SJE D;  1HA5 A;  4A3L G;  1GHJ A;  5LMN W;  1XX8 A;  5IYD G;  2G9D A;  4EQO A;  4DR1 L;  4JI1 Q;  3OIP A;  1DOL A;  1BUV T;  1KAW A;  2F0I A;  1K8G A;  3F2D A;  3D4D A;  5K5P A;  5FLX L;  4KHP Q;  4FNF A;  4CDE C;  1QVC A;  1STG A;  3E0E A;  5JJZ A;  2UU9 L;  2KVM A;  4IPD A;  2JP1 A;  2MJ8 A;  3GTG B;  1E3P A;  2F0D A;  1EQR A;  1EWC A;  3DHQ A;  2B3G A;  3DLL A;  1GUO A;  5KNB A;  1HHV A;  1HR0 W;  2WB1 G;  4C3H G;  4A3J G;  3RZO H;  5IGD A;  4V0B A;  1SE2 A;  1C8C A;  5GRO A;  3LWE A;  4ZUJ A;  2F0L A;  4MIU A;  1E2W A;  1C9O A;  4DA2 A;  1PH1 A;  4NPS A;  4WFN 3;  3I4L A;  1VQJ A;  1O7I A;  2DY8 A;  2MFI A;  3CMA A;  2N55 A;  5E4W C;  4DXF A;  1SE8 A;  3BYY B;  2YTY A;  2PYK A;  3I70 A;  1KL9 A;  5E7N A;  3KLS A;  2B2U C;  1KLU D;  4L5T A;  1XMQ Q;  1QG7 A;  4CKE A;  1ZKO A;  4JI2 L;  2SNS A;  4LF4 L;  1O7L A;  4CKB A;  1EY7 A;  3A54 A;  1D1I A;  1GXD C;  3PCO B;  3H3V H;  1HTP A;  2RDH A;  5C5L A;  2NB0 A;  4IPG A;  3GO5 A;  4OWT B;  2PI2 A;  1BR9 A;  3NQI A;  1GVP A;  4CJ0 B;  4ZLT F;  5GAD C;  1F9R A;  4H44 C;  4PZ7 A;  4JK1 C;  5BN4 A;  2K28 A;  1C48 A;  4DV4 Q;  4RHR A;  3A7A B;  3A74 A;  4JG2 A;  2J0T D;  1XNR L;  1NNX A;  5EPL A;  5L37 A;  1NMG A;  3J7A F;  3GTQ H;  3BJU A;  4KJN A;  1FNU A;  1HJP A;  3DWA A;  1AH9 A;  1EWH A;  4N9P A;  4FF3 A;  3BDL A;  1Q81 C;  4QUF A;  3QR8 A;  3EFX D;  1Y8O B;  2F0P A;  1U9R A;  4TVA B;  3RLF A;  2UUB L;  3OIQ A;  4LF6 Q;  1QWY A;  5CV8 A;  4FF2 A;  1FNV A;  1IYU A;  1VQA A;  4DR3 L;  1NBW A;  1VQ5 A;  4WJ3 M;  1HPC A;  4GN4 B;  2A6E C;  1A3U A;  1EZ8 A;  5CV4 A;  2R92 B;  2PMZ B;  2FJ2 A;  4J15 A;  1MHW C;  1A62 A;  1W6J A;  5M5W B;  4FXG C;  4JYA L;  3SVM A;  3HKS A;  1IL2 A;  1XJV A;  5H1S E;  5JEA J;  3VYS A;  1WFQ A;  5BN3 A;  2B63 B;  2UXC Q;  2R61 A;  4JI5 L;  2XRQ D;  3HG9 A;  1R4Q B;  4DV5 Q;  1PH9 A;  2PZU A;  2XGT A;  3T51 B;  4XYQ A;  1VF7 A;  1WI5 A;  2PZW A;  3QG1 A;  4QIW E;  4JI1 L;  4A3C G;  1NR2 A;  2K14 A;  1VQN A;  4K6D A;  2VB2 X;  4KHP L;  3WOE A;  4K0K Q;  3BVM A;  2HHH Q;  3M7G A;  2YU9 H;  4P2C B;  3UE0 A;  4O42 A;  2K5D A;  3CCJ A;  1CZG A;  2R92 G;  1STA A;  4HIK A;  4O1N A;  1C7Y A;  5KGU A;  5COY A;  2Z9H A;  4C3I B;  1KAA A;  1T5X D;  2R7F A;  2RA4 A;  3J81 i;  3I90 A;  4ZAI A;  2FIN B;  3S16 B;  5M3F H;  3K7U C;  3QO2 A;  4ME3 A;  2B63 G;  1NAP A;  2JA5 B;  2MHV A;  1B2T A;  3E6Z X;  4Y7N H;  5C4J B;  2ZJP A;  3ITP A;  3K57 A;  3SE0 A;  1XMO Q;  1SRU A;  1EYC A;  3EVQ A;  2OEO A;  1IBK Q;  5CYU A;  3K6O A;  1L1O C;  1HTL D;  2IJ0 A;  4NXM Q;  1VQP A;  2A69 C;  2F0W A;  1TWA B;  5CMD A;  1PFS A;  1TWG B;  2E2I B;  1XMQ L;  1JC7 A;  4HED A;  5IOC A;  1M4V A;  1GKH A;  3MZ5 A;  1RD9 D;  3R2T A;  2QF7 A;  5JVG 3;  1TQO A;  2IL8 A;  4K6L A;  1G29 1;  1HRJ A;  2N78 A;  4ZQ3 A;  4C3I G;  4F8M A;  4JI7 Q;  4KD3 A;  2EQS A;  4IUN A;  2IY5 B;  1WTR A;  4X66 Q;  5KRU A;  5C4X B;  1F9S A;  4PMC A;  2JA5 G;  3GTM H;  4CBV A;  4DR7 Q;  4F87 A;  4QF4 A;  3HZX A;  4DV4 L;  1ENF A;  2ZJR A;  4CHT B;  3EA6 A;  5IT9 L;  4CDC C;  3CCE A;  3HS0 C;  3TEH B;  2EYJ A;  2KEC A;  4X3S A;  1DYQ A;  3OTO Q;  2KOL A;  4KN4 C;  4KV6 A;  4OO1 H;  3OSO A;  2DUD A;  4OEM B;  2DGY A;  5T1G A;  1JOR A;  5LMU Q;  4A3K B;  1CK1 A;  4LF6 L;  1Z9F A;  1N32 Q;  1X3P A;  3ERQ A;  2FXQ A;  2YV5 A;  4QGU A;  1PTO H;  1SMY C;  2F0M A;  4HID A;  1J5E Q;  3VR3 A;  4KKT A;  1VQF A;  3L0O A;  1EU3 A;  5C3W A;  1H9M A;  4HR7 B;  1QVF A;  3I55 A;  5IYB H;  3MEF A;  4NXN Q;  1CI3 M;  2OTJ A;  4BBR H;  5CC4 A;  1QE6 A;  2N49 A;  1EUJ A;  1UEB A;  4GKJ Q;  3ER0 A;  4YIJ A;  2UXC L;  1A3T A;  2EY6 A;  3SGI A;  4DV5 L;  4L63 B;  2E74 C;  4PZ8 A;  1G6Z A;  1I3Q H;  1I50 H;  2A69 D;  4UAI A;  1G2S A;  1MI2 A;  5C5M A;  1VS0 A;  1EFI D;  1PMR A;  5ELE A;  4K0K L;  5FLM H;  1CFM A;  4A3K G;  2HHH L;  2FMM A;  3T13 A;  3OMG A;  3HOV H;  2BE5 C;  4TRD A;  4UPA A;  3Q23 A;  3HOZ H;  3UDG A;  5FO8 B;  2K6A A;  1X3Q A;  1GUS A;  2LSS A;  1HNW Q;  3LNN A;  2NVY B;  1UNS A;  3BYT B;  1LV9 A;  2ID0 A;  2Z8L A;  4ULL A;  3F2C A;  3DM3 A;  4R4T A;  1O78 A;  2VW9 A;  1X55 A;  1M8A A;  3NQT A;  1XMO L;  1Q3L A;  1IBK L;  3FHW A;  3M3Y H;  2NBF A;  2IPK D;  3CRK C;  1UE6 A;  4E6I A;  3S1N H;  2IX3 A;  4NXM L;  5IY0 A;  2F4V Q;  5FKA C;  3S9W A;  1JE4 A;  2EOT A;  1L1O B;  1K3R A;  2A68 D;  5J1Z A;  4XT3 B;  3TQY A;  1PHJ A;  3L2P A;  2PNH A;  3A0J A;  1K8A C;  4JI7 L;  1WTO A;  3RMH A;  2K03 A;  5ELF A;  1D6E C;  1W2B A;  4X66 L;  1GUN A;  4Z9C B;  1OXV A;  4DR7 L;  3RN2 A;  3W2D A;  1JMC A;  1WCM H;  2O2L D;  4DAV A;  1H9S B;  1YBY A;  2DNE A;  5CR3 A;  2GN5 A;  4AH6 A;  5AJ3 L;  4JI4 Q;  3KF8 B;  3S1R H;  3S1Q B;  3M4Y A;  1YNJ C;  4QIW B;  1SFO B;  3TRE A;  4YWK A;  4OHJ A;  3OTO L;  3AMU A;  4LUZ A;  5F2D A;  3I73 A;  5IIF A;  1D1K A;  2MP1 A;  1LAC A;  1O7Y A;  1NMF A;  3RLO A;  3MVV A;  3U9S A;  3GV3 A;  4BXX H;  3C1F A;  3R3O A;  5C0X J;  5LMU L;  4H0L C;  1YIJ A;  1TWH B;  3HOW H;  1MGS A;  2F1M A;  4A3D H;  4MTN A;  1AEX A;  1J5E L;  4C3J B;  2E5L Q;  3PUZ A;  4EX5 A;  3Q0A A;  2ALY B;  1U4L A;  3VA7 A;  1OO9 B;  4NXN L;  1AE2 A;  3UE1 A;  5I6W A;  4RGM A;  3I4N H;  2EE1 A;  1SYC A;  5G3L D;  1II3 A;  5JEA H;  4GKJ L;  1EEI D;  3CC7 A;  2K33 A;  4DNT B;  2NVX B;  1G2T A;  1CTM A;  1YNN C;  3DUZ A;  2VY3 A;  2HIX A;  4IAL A;  1KD1 C;  4LW1 A;  2D0P A;  4R8N A;  1STE A;  4C3H H;  3HEJ A;  2JA7 B;  4A3G H;  4HIM A;  2L15 A;  2V1C C;  1STN A;  1F2L A;  4XTC S;  3S1M B;  2ZTD A;  2L5T A;  4JI8 Q;  3CXC A;  4C3J G;  1BQQ T;  2E2J H;  3V2T A;  3J81 c;  4IUR A;  5C3X A;  2HQL A;  4DV0 Q;  1F2Z A;  1G51 A;  4RHS A;  1HNW L;  5GAE C;  1LLR D;  2BA0 A;  1NE3 A;  4H7B A;  4MNO A;  1ET9 A;  4DKA C;  1VQL A;  1GD7 A;  4R4C A;  1PH4 A;  1ENA A;  1SNQ A;  2JQO A;  1A6X A;  1B9M A;  3NBH B;  3MTS A;  2K04 A;  1V43 A;  1K83 H;  1SND A;  2WII B;  4P75 A;  4X3K A;  2JA7 G;  3CKI B;  4JC0 A;  5C44 B;  5I6Y A;  4DAY B;  3PO2 B;  1V1P B;  4ALP A;  2F4V L;  5IGG A;  2BH8 A;  1S40 A;  4XQJ A;  4P74 A;  1TT2 A;  4ZYS A;  1KQS A;  3C2P A;  2KCC A;  3PO3 B;  2PQA A;  1SYB A;  3P20 A;  3R2I A;  4YCW A;  3AQQ A;  1PYS B;  1TXY A;  3QIA A;  4HMJ A;  1LO5 D;  2K5V A;  2QKI C;  3I56 A;  1CHQ D;  2XWB B;  3FMC A;  4RCN A;  1SEB D;  2VUM B;  3S14 B;  2K5N A;  1FL0 A;  1S5C D;  4YWL A;  1I4Q A;  4RCO A;  3CME A;  5HY6 A;  1TWC B;  1XWE A;  1BCP C;  3UI2 A;  4JI4 L;  1IZ6 A;  1HCZ A;  2EJG C;  1HNX L;  1F77 A;  1SSO A;  1PV4 A;  1AN8 A;  2PW5 A;  1WTW A;  1WTP A;  4X65 Q;  3A8I E;  2M2L A;  3ERS X;  3J7Z C;  2FMC A;  5C44 G;  2OQ0 A;  1EU4 A;  4GN3 B;  3PO2 G;  2EYH A;  2L12 A;  2EXZ A;  3U50 C;  3KDF A;  1HA6 A;  1FNW A;  3I7F A;  3PO3 G;  2M00 A;  4FP5 D;  3SR1 A;  2Z6K A;  4R1J A;  4KJO A;  2E5L L;  2VUM G;  4A3C H;  1Z6H A;  3J80 c;  2VQF Q;  3A5U A;  1PFN A;  5BR8 Q;  4JBK A;  4PMB A;  4H13 C;  5KND A;  1EY0 A;  2WAQ E;  4DR2 Q;  5IP9 H;  2F3W A;  1AW7 A;  5T1I A;  2OWO A;  5EAY A;  1A15 A;  3PUY A;  1T9H A;  2R92 H;  3ND8 A;  2K5Q A;  1LT6 D;  4LFA Q;  4A3B B;  3C3L A;  3DXJ C;  4I7A A;  2EZV A;  2B63 H;  2O5I C;  1U5K A;  3VA5 A;  4ID6 A;  2ZJQ A;  1VQM A;  1SLJ A;  1GO3 E;  3M4O H;  3K59 A;  4JI8 L;  4R4Q A;  4DV7 Q;  1A2T A;  3KF6 A;  4OEL B;  4Y52 H;  4G7Z C;  4GOP C;  2NVQ H;  4DV0 L;  1NSN S;  2GA4 B;  4F88 A;  1Y1W B;  1L2F A;  2CHB D;  4A3I B;  1D2B A;  1N34 Q;  1OXX K;  5CBA E;  2EYL A;  5FJ8 H;  2VXW A;  2BCO A;  1VQK A;  4A3M H;  3CAM A;  1G8Z D;  2Z6K C;  4LF9 Q;  2QEJ C;  2K50 A;  2EDG A;  1PZJ D;  4C3I H;  4BY7 H;  3CC4 A;  4A3B G;  1UWV A;  2X69 A;  4CKC A;  1ENC A;  1JOK A;  2BOS A;  5EKI A;  3GTL B;  2ASB A;  2B2Y C;  3S17 H;  4EGV A;  2WAC A;  4B3M L;  1VQD A;  4QY7 A;  4JV5 Q;  3GQB A;  1B3Q A;  4FDB A;  1XTD A;  1E1O A;  1A63 A;  5ELO A;  3MXN B;  1EOV A;  4GN5 A;  4OIJ A;  5D3D A;  3CF5 A;  4RGN A;  4A3I G;  3A55 A;  2F0T A;  1TWG H;  1R9T B;  1VQB A;  1EY4 A;  1W6K A;  4GNX A;  4DV3 Q;  4OX9 Q;  3O13 A;  1CQV A;  3I72 A;  1KAB A;  1V9P A;  1ZEQ X;  2YYZ A;  2H4O A;  3MXG A;  4QCL A;  3KFU A;  1SAP A;  3OWE B;  5JPM C;  1VQ8 A;  3A56 A;  2RF4 A;  3FEW X;  1J6Q A;  1EY6 A;  4X65 L;  2L0C A;  2B2W A;  2LMC B;  2IX0 A;  2NWG A;  1BCP B;  2A1A A;  5LMN Q;  2WIN B;  2D5D A;  3BDC A;  4PMW A;  2PI2 E;  2XN9 C;  3JAM E;  3GTJ H;  4A93 B;  3QOL A;  1N33 Q;  5ELB A;  1YHB A;  2JA8 B;  4RWS C;  5C0X H;  3PUX A;  3S2D H;  2PW7 A;  2JSO A;  2QGQ A;  1EYG A;  1TY0 A;  5CV9 A;  4LFC Q;  4QL5 A;  2PNR C;  2VQF L;  3GTO H;  1IYJ B;  5BR8 L;  3IKJ A;  1E2V A;  1LAB A;  5IYC G;  3D0F A;  4A3K H;  4G7H C;  2ZM6 Q;  4DR2 L;  3K7A B;  1QJO A;  1UAP A;  1ASY A;  4FO2 A;  1B53 A;  1HZ9 A;  2RSN A;  3T53 B;  2RKS A;  2DNC A;  3NEN A;  4N9T A;  4EVO A;  2OF1 A;  2HQE A;  4LFA L;  2E75 C;  2PQA B;  4L5Q A;  4GNX C;  1DOK A;  3PGZ A;  4DK6 C;  4C1N I;  2OXP A;  3BG3 A;  3G71 A;  2EVB A;  4FXK C;  4A75 A;  5M5X B;  4A93 G;  1J8I A;  3IAY A;  1GUG A;  1BBU A;  2JA8 G;  1SDF A;  4BY1 B;  3W3A A;  4DV7 L;  3STB D;  1FGU A;  1Y8P B;  4OGQ C;  4B9W A;  4POF A;  5IE8 A;  2B2W C;  2F03 A;  1EFW A;  1ILP A;  2KBN A;  3S15 B;  3HOY B;  1KLG D;  1JB3 A;  3FPP A;  1GHK A;  1Y1V B;  2EY5 A;  1M1K C;  5C4Z A;  1N34 L;  1YJ9 A;  1RKN A;  4GOP B;  3D6C A;  2JE6 I;  1LM0 A;  3NSW A;  4DK3 C;  2OTL A;  1GJX A;  2IX1 A;  4LF9 L;  2QW7 A;  3D31 A;  2I0Q A;  3AB9 A;  1KHI A;  3KK7 A;  4IUP A;  1WOC A;  2R7Z H;  1A8V A;  1AE3 A;  4HSP A;  4YHH Q;  2A6H C;  3HKZ E;  4KTA A;  4B3T Q;  1CKO A;  1RHP A;  4K14 A;  1PDQ A;  5A35 A;  1BDO A;  1JJ2 A;  4HCS A;  4BY1 G;  2GVB A;  4AQY Q;  4JV5 L;  1LTT D;  2UXB Q;  2GVA A;  5LL6 S;  1IXR A;  5FLX c;  2EYP A;  4ZKC B;  2K52 A;  1TU2 B;  2E76 C;  1JIC A;  4A3F B;  3HOY G;  3HGB A;  2MPM A;  1Y1V G;  2AQ2 B;  5JVH 3;  4CGY B;  2WAQ B;  5GQO A;  4XT1 B;  1E22 A;  1NCV A;  2O5J C;  4R9W A;  4A4I A;  1JE5 A;  4DV3 L;  5M3M B;  1MD2 D;  4OX9 L;  3GD7 A;  5K36 G;  1TKW B;  3MEH A;  4DF7 A;  3D6W A;  3OW2 A;  2L4N A;  2EY2 A;  3RN5 A;  3K80 C;  4BA1 I;  1A0I A;  3FPU B;  1WYD A;  5LMN L;  5NUC A;  4LUO A;  4X6A H;  3OPO A;  2KEN A;  4OXP A;  1XPU A;  1U4R A;  4S3S A;  3QOJ A;  4KN7 C;  4XIG S;  4DV2 Q;  5J3B A;  3OW7 A;  4IZ8 A;  3HOU B;  3S1Q H;  3I3C A;  1N8R C;  1N33 L;  1Q8K A;  2ICI A;  1NR4 A;  3S2H H;  1K0S A;  1D5Z C;  1S3O A;  2F0F A;  1L0X B;  3RZO B;  1AP0 A;  1I4G A;  5A2Q E;  3EIV A;  1LT3 D;  4LFC L;  3W1B A;  3TSS A;  2WAQ G;  3HOX H;  3SXH A;  3VR6 A;  5AJ3 Q;  4IUT A;  2NZO A;  3F2B A;  2HCI A;  2D62 A;  1BF4 A;  5M3M G;  1E24 A;  3F8T A;  3CW2 C;  4B3R Q;  1EIG A;  3E3X A;  5EPJ A;  1AZP A;  2ZM6 L;  5E1F A;  4DN4 M;  5JJK A;  4GLX A;  1HFN A;  1D8L A;  2A6H D;  2I5M X;  3BZK A;  4IPC A;  2QCP X;  2F0Q A;  4DXG A;  2E2D C;  1HZA A;  3H0G H;  1JWU D;  4LWC A;  4ZUI A;  1PRT C;  1S5B D;  4RGO S;  2LFN A;  4IN3 A;  3CPF A;  2J4X A;  2MO0 A;  1K9M C;  5I4D A;  4LJZ C;  4O2D A;  3HOU G;  2IHE A;  1JOQ A;  2A68 C;  3CQZ H;  4CDD C;  3TP6 A;  3GTP H;  5C4X G;  4GNX B;  4DV6 Q;  4H02 A;  2C9O A;  1IBL Q;  1VQO A;  4YCV A;  3MFY A;  2JA7 H;  5IGB A;  2L55 A;  5FK9 C;  1X54 A;  3D8G A;  3GTQ B;  3NWS A;  1QUQ A;  2XRS D;  2ZXP A;  2KA7 A;  3FP9 A;  5DNF A;  2AHO B;  3SK4 A;  4KD4 A;  2NTS A;  2UXD L;  1XXG A;  1QB5 D;  4RAU C;  4YHH L;  1BBX C;  2I46 A;  4B3T L;  1OXU A;  3GTK H;  4HJA A;  3BVZ A;  1PH7 A;  4DR4 L;  4A3E H;  5C3E H;  1CQF A;  4AQY L;  3JAM i;  2CFM A;  2RDG A;  2UXB L;  1PYB A;  4QB4 A;  1SNP A;  2R3Z A;  3ZJY C;  4HN7 A;  1S5D D;  3K8A A;  5I9P A;  1RCV D;  4YWM A;  1TS4 A;  1LTG D;  3R93 A;  5IOD A;  1B4O A;  1E7Z A;  2D9U A;  2NN6 H;  2N3S A;  1W3S A;  5M5Y H;  2TSS A;  4G7O C;  1OXS C;  3L7Z C;  1C0A A;  1PFM A;  4DR6 Q;  1EY5 A;  2XTI A;  3NTK A;  1PRT D;  1EOT A;  2VNU D;  4X62 Q;  1Y14 B;  1DJR D;  3CRL C;  1WD0 A;  2JA6 H;  2YU9 B;  4FXD A;  5CV6 A;  2QEX A;  4HJ5 A;  2BDN A;  4RH6 A;  4ZRZ A;  1V8Q A;  2E8G A;  4LUV A;  5DM6 3;  1ESF A;  4WRD A;  4CDF C;  5CBE E;  2C35 B;  4TQU S;  1PYW D;  2ENB A;  3VR5 A;  4DV2 L;  1Q1E A;  3TZU A;  3PSI A;  2PPB C;  2F52 A;  3V96 A;  4RG1 A;  4X64 L;  1I4P A;  3MXU A;  2E2H H;  3AYH B;  4HAE A;  1PXU A;  4IJH A;  1SJH D;  1TWF H;  5E4X A;  4Y7N B;  2BH2 A;  1PA6 A;  2K5H A;  3KBG A;  3NTH A;  4K5V A;  1EYD A;  2PZT A;  5CGK A;  1QZG A;  2KJX A;  5C6A A;  1I4H A;  1EIY B;  1HNX Q;  4B3R L;  4XYO A;  3A5Z B;  1QOH A;  3FRP B;  3CCM A;  1HZC A;  1PTO D;  1XYI A;  1CA6 A;  2AQ3 B;  4DU9 A;  2HDL A;  4DUZ Q;  2YTX A;  3M4P A;  2R7D A;  3C1E A;  3HKZ B;  1EIF A;  3L9A X;  1VQH A;  5IT9 c;  3P1H A;  3KJP A;  3TP7 A;  1LTA D;  2TMP A;  4A3L H;  2F0S A;  1MKH A;  5IYD H;  4HIO A;  1Z7T A;  2SOB A;  3WWV A;  3CPW A;  4HSV A;  3OMC A;  1JJG A;  3AFQ A;  4BS9 A;  1QZH A;  1YNX A;  1U0L A;  4MHE A;  5HGQ A;  3GTM B;  1JWM D;  3GP7 A;  3CCU A;  4DV6 L;  1I6H H;  5GAG C;  4P71 A;  1IBL L;  2A73 B;  4WJ4 A;  1HUM A;  3UDI A;  1VQG A;  2LKV A;  5KEE A;  4OWW B;  4LFB Q;  1Z47 A;  5JAV A;  4B08 A;  1Q7Y C;  3TS0 A;  3RD4 A;  2PCF B;  3PIP 3;  2XSC A;  3JAM L;  5CV7 A;  4R4I A;  2P5Z X;  4IPH A;  3EBE A;  3N6R A;  1YJN A;  3HKZ G;  2NUC A;  1S4Z A;  3BS1 A;  4A3J H;  2RHS B;  5AFW A;  4C56 C;  3D4R A;  3U9O A;  3W5O A;  1JWS D;  4M8A A;  1HUN A;  2KED A;  1I4R A;  4EQP A;  3PQI A;  1VMP A;  2I07 B;  2IW3 A;  1G6P A;  5IP7 G;  1LTI D;  3I8Z A;  4RKB A;  4TKO B;  4BBR B;  4AYB E;  3DWQ A;  3ND9 A;  2C5C A;  2Z6B A;  5IGF A;  4X3U A;  3KLR A;  2MGS A;  4YCU A;  2ES2 A;  3GTG H;  3KJO A;  5DM7 3;  1KIX A;  2XNA C;  1I3Q B;  4XQQ A;  1I50 B;  4DV1 Q;  3D4W A;  5D14 A;  1WTQ A;  1KDC A;  4DR6 L;  1IBM Q;  4P72 A;  4IFD I;  4OO1 G;  1YHQ A;  2EYF A;  1Q1B A;  2B29 A;  3F2U A;  2AMC B;  4X62 L;  4KKS A;  2LS0 1;  1J9O A;  4B3M Q;  3QWN A;  2OQK A;  3CCV A;  1PH2 A;  1G91 A;  1NUC A;  1ML0 D;  2EYO A;  3HRZ C;  3UDX A;  3A8J E;  3EQL C;  3LGJ A;  5IYC H;  1BOS A;  4RGT A;  4DUY Q;  3HOZ B;  2JEB I;  2O4X A;  2VZA A;  4MTK A;  1T5E A;  3SK6 A;  4BBR G;  3CC2 A;  1RIP A;  3IFT A;  4BBS B;  3NHH A;  3VYR A;  1E0B A;  2KUM A;  4DAM A;  1MJE A;  2F0V A;  4U67 3;  1DON A;  3NUC A;  3BZD B;  1B9N A;  1FYC A;  3J7A 5;  2ZTC A;  2F0U A;  4GKK Q;  4MN3 A;  3U4Z A;  3M3Y B;  2JA8 H;  1CT1 D;  3K81 C;  3TME A;  1QIL A;  3S1N B;  3K5O A;  4DUZ L;  3OHX C;  5TSS A;  2Q8T A;  2F3V A;  3CHB D;  3M4Q A;  4OIK A;  1BBW A;  2RQX A;  1JR0 D;  3NEL A;  3RUZ A;  4JI0 Q;  3M7N A;  5JOB A;  3HOZ G;  1H95 A;  1F2M A;  3MC0 B;  5BN5 A;  4DPG A;  5I2X A;  1QNK A;  4BBS G;  3TRZ A;  1GM5 A;  1VQ6 A;  4HJ9 A;  1B50 A;  1IYV A;  5E3F A;  4EQN A;  2AWO A;  4FF4 A;  1Q82 C;  2CH4 W;  2RDF A;  4WJW A;  5KNC A;  4LFB L;  1JOO A;  1A2U A;  3J81 E;  4NMZ A;  3SK5 A;  5M5W H;  3PF4 A;  2UUA Q;  1X3F A;  2MUY A;  2K05 A;  3CCQ A;  3S15 H;  5A2Q L;  2D2C C;  1ROD A;  1B3A A;  1M90 C;  3BDO A;  1UE1 A;  1RDP D;  3JAM c;  2DJF C;  4A3D B;  2PQE A;  3DM1 A;  3I4M B;  1ET6 A;  3GDE A;  5K36 H;  2VB3 X;  5ELC A;  1EQT A;  2KHS A;  3T1H L;  3RZD B;  4UY8 C;  4JCV E;  3G4S A;  1UE7 A;  2F0N A;  4JBJ A;  2F0O A;  1WTX A;  3I4N B;  2JK8 A;  3OWF A;  1CSP A;  1CKN A;  4L8J A;  1DZ1 A;  4LF7 Q;  2IT1 A;  4ZK9 B;  1EL0 A;  2SNM A;  2AUK A;  2SEB D;  4HTH A;  4RKL A;  4DR5 Q;  5CV5 A;  2K01 A;  3KLW A;  4DV1 L;  1DM0 B;  5LHY 1;  1SYG A;  4C3H B;  3NPP A;  1IBM L;  2PO4 A;  4J8Q A;  4NP5 A;  4UP8 A;  3CCR A;  4A3G B;  3S16 H;  2B2U A;  1WJJ A;  4BXX G;  4U68 A;  3K5M A;  1I94 Q;  1Q46 A;  2JA5 H;  3CD6 A;  5C4J H;  2ZXR A;  3NBI A;  2KQ3 A;  1VCI A;  1STY A;  4A3D G;  3H94 A;  3P75 A;  5M3M H;  3I4M G;  1HXY D;  3Q24 A;  1BNZ A;  1LTR D;  2E2J B;  4DUY L;  3FKI B;  4PG3 A;  3STB C;  4JBM A;  1Y1W G;  3I4N G;  1UEA B;  4IFD G;  1HFG A;  1TWA H;  3H91 A;  1SYE A;  5JEA G;  2E2I H;  2RCF A;  1TS2 A;  2OT2 A;  3A8K E;  4IUV A;  2Q8I B;  1HQM C;  2Z0S A;  3NEM A;  3HOU H;  4GKK L;  1K83 B;  2F0E A;  4P73 A;  2VL6 A;  2XWJ B;  4A3G G;  2QDL A;  3J80 E;  5C4X H;  3W1G A;  2X6L A;  2WP8 J;  1UUP A;  2B39 A;  4KMU C;  4UHV A;  4I65 A;  4LMQ D;  3J81 j;  2CQO A;  3N52 A;  5EQ0 A;  3M85 A;  4JI0 L;  2JA9 A;  3FKI G;  1YEZ A;  3OOC A;  1IKL A;  1FGB D;  2AKW B;  2Q8R E;  4AYB B;  4N8F A;  1RTN A;  1SYD A;  4HMI A;  3RR5 A;  1WVL A;  3ZYY X;  1TS3 A;  4O0A A;  2Q2I A;  1HR0 Q;  3UDF A;  1UE5 A;  1EYA A;  3QB3 A;  4C2M B;  4PNY A;  3URY A;  3H3V C;  1P16 A;  1NTG A;  3PF5 A;  2EY1 A;  1VF5 C;  1BVS A;  2B8G A;  1R4P B;  3M9B A;  3NTI A;  3IRB A;  2F0J A;  2UUA L;  4QJF A;  1LTS D;  1AFP A;  4B3S Q;  1LTL A;  3PIP A;  5KIX A;  1X56 A;  3MFG A;  4K8I A;  2RCN A;  3RLN A;  2H1E A;  2RBM A;  4B9X A;  4AYB G;  2Z4H A;  3DMU A;  4LK1 C;  1SNO A;  5LL6 X;  1SRO A;  1KDB A;  4FYD A;  4JI6 Q;  2MQH A;  1BO0 A;  1SN8 A;  5J22 A;  1I6V C;  3H3V I;  1N36 Q;  1ZYR C;  3TN2 A;  2R93 B;  4IO9 A;  5C0X I;  4LF7 L;  2OCE A;  1FR3 A;  2HD3 A;  3B6Y A;  3J7Y W;  1SE4 A;  2N8N A;  4DGZ A;  4DR5 L;  2UUC Q;  1L1O A;  4NB3 A;  3KBX A;  1U4P A;  3KDF B;  4IFD J;  2UXD Q;  1Q12 A;  3PMF A;  1BCP F;  1Y69 U;  2NVY H;  2ZTE A;  5EJW A;  4NKL A;  4NW2 A;  1GOZ A;  1I94 L;  3H09 A;  1VQ7 A;  2K5W A;  3M4O B;  2QA4 A;  4LF8 Q;  4DR4 Q;  3NP8 A;  3T16 A;  1QNU A;  2KEE A;  5HUR A;  3VR4 A;  1H9S A;  3MWY W;  2AWN A;  1JT8 A;  3KF8 A;  2K1B A;  2NVQ B;  4JOI A;  1TS5 A;  4YY3 Q;  4ABN A;  4IUU A;  4DK1 A;  3H15 A;  1RJT A;  1D5X C;  2R93 G;  4GLV B;  2NVT B;  5IP9 G;  1VQ4 A;  2HIV A;  5ISR A;  4APV A;  1X6O A;  4A3M B;  1N9W A;  2F0K A;  2WFW A;  3Q8D A;  2NYZ D;  1FD7 D;  4A76 A;  4BY7 B;  4OON A;  1I5F A;  1ICW A;  2B8F A;  1HQR D;  4Q5V A;  2DN8 A;  1YI2 A;  2KHI A;  5EBD A;  2B2T A;  2K32 A;  1IW7 C;  1KNA A;  3X3M A;  4L6T B;  3C46 A;  1CZW A;  2LXJ A;  3KF6 B;  3TP5 A;  3ICE A;  3S17 B;  2Y0S E;  3AU7 A;  3I4O A;  1MJC A;  1K8O A;  2KCM A;  3U58 A;  3VYU A;  5FOB B;  4IUQ A;  4X3T A;  1EIH A;  1DCZ A;  1SFO H;  4X64 Q;  1CKN B;  4PV1 C;  2G9H D;  4FF1 A;  4A3F G;  3S24 A;  5J39 A;  1ZYR D;  1GUW A;  1SBB B;  3MXP A;  3TBI B;  1DD2 A;  1FJG Q;  1MBY A;  5FJ8 G;  4MZ9 A;  2A6E D;  4A3M G;  4K2K A;  1HH2 P;  1H9R A;  1HR0 L;  1TWH H;  3T1Y Q;  2CCZ A;  4BY7 G;  1VQC A;  2I5H A;  3G7L A;  1JB7 A;  4C3J H;  1ICF B;  2A5H A;  5IP7 H;  4JOI C;  3TDQ A;  3TZD A;  1SXT A;  3FVQ A;  2IWH A;  3BVG A;  1LYL A;  2KCN A;  3KLS X;  4OWX B;  5JJI A;  2WV6 D;  1D7Q A;  4B3S L;  4JI3 Q;  3GTJ B;  2VQE Q;  2NVX H;  3PUW A;  1A3V A;  1JJC B;  1E1T A;  3LX0 A;  5JPN C;  3S2D B;  1HNZ Q;  3WOF A;  4I7Z C;  3DWP A;  1TII D;  1XTC D;  1CM9 A;  3NBH A;  5IGE A;  2B2T C;  1ASZ A;  4JI6 L;  4ZCK A;  2MO1 A;  3GTO B;  3HFZ B;  1B70 B;  2A19 A;  2ICE C;  1NJI C;  3BZC A;  1N36 L;  3VYT A;  1MSH A;  3S1M H;  3ULP A;  4J1M A;  1XPO A;  1B44 D;  2VS1 A;  1E2Z A;  3BU2 A;  4DAY A;  1S5F D;  2RSO A;  1V1P A;  2HCC A;  3QJY A;  5FLX E;  2UUC L;  1K28 A;  5HGT A;  4G57 A;  1IW7 D;  1TR5 A;  1PTO C;  2FHT A;  4GZY C;  3PIO 3;  2IHF A;  5DLQ E;  3PUV A;  5DAU A;  3J80 i;  2RHQ B;  1PH3 A;  1KDA A;  1LTB D;  5D65 A;  1IHZ A;  2F4I A;  1VMC A;  3D3R A;  1YIT A;  1CA5 A;  5JJL A;  4LF8 L;  4F7X A;  5C0X G;  1X65 A;  1NY4 A;  2Q2H A;  1RL2 A;  1Q8I A;  1PH5 A;  4OO1 I;  3I91 A;  2BA1 A;  1JCK B;  2Q2U A;  3J81 L;  4IJL A;  1WTV A;  4BA2 I;  4IOA A;  1PFB A;  3NK9 A;  3F1Z A;  2G5D A;  1MIU A;  2CW0 C;  3NXW A;  2J7Z A;  5EGT A;  1RF2 D;  4GLA C;  2XVS A;  2R6G A;  4YY3 L;  2A74 C;  3KOJ A;  5C44 H;  4EQ5 A;  3H6M A;  3PO2 H;  1ILQ A;  2EPB A;  3HP3 A;  2K7V A;  4IQZ A;  2F0H A;  2L11 A;  3PO3 H;  1SR3 A;  2LXK A;  1X9N A;  4QUC A;  2KCT A;  2HT1 A;  4JPB W;  4KHZ A;  5C4H A;  1B7Y B;  3CU7 A;  2VUM H;  2R7Z B;  4AIM A;  3S14 H;  4DAP A;  4BBS H;  4POG A;  4R4O A;  3JC6 6;  5FO7 B;  4IOC A;  2X6G A;  1SNC A;  1BKB A;  2ZT9 C;  2EJF C;  1TWC H;  1EZ6 A;  4K2L A;  1BXT A;  1O7Z A;  1LT5 D;  1B1Z A;  1Y8N B;  1QCB D;  4WOR A;  5M3F B;  1VQ9 A;  4KLK A;  2B2V A;  4JW0 A;  1C4Q A;  3U4V A;  4NDX A;  1LT4 D;  1KXL A;  2D0O A;  1SMY D;  2EXD A;  1FJG L;  4KHV A;  4XXE A;  4C1N K;  3NE5 B;  1PH6 A;  1CSQ A;  3T1Y L;  4XDX A;  4GS3 A;  5IWA Q;  1K73 C;  1EY8 A;  2M9V A;  3V05 A;  3VR2 A;  2R7Z G;  1K0R A;  1PVO A;  1K3B C;  2WB1 E;  3Q6S A;  4DK0 A;  3L3O C;  2KHJ A;  2NN6 I;  3TS2 A;  1KRS A;  4CJ2 C;  4RFB A;  4LNQ A;  1SNM A;  4JI3 L;  3G6J B;  4N8X 1;  1P8L A;  2VQE L;  5I2Y A;  3WDN A;  1SYF A;  5DEH A;  2JEA I;  5EPK A;  4HCE A;  3T56 B;  3S2H B;  2CW0 D;  4K5W A;  4LF5 Q;  1HNZ L;  5M3F G;  1PRT B;  1F2Y A;  2ATW A;  1L0Y B;  4ME5 A;  3G6E A;  4K8J A;  3HOX B;  1JQY D;  2CH4 A;  2MNA A;  3J80 L;  4A3B H;  4R8I A;  1H9K A;  1Q86 C;  2BE5 D;  1WTH A;  1X3E A;  2CKZ B;  3FDT A;  3AEV A;  3MA2 B;  1N32 L;  4OL7 A;  2L1B A;  3EN2 A;  1TVX A;  1L0W A;  3SHL A;  3DEP A;  3ONA B;  2CVR A;  3I4M H;  4RA8 A;  5M9O A;  1ESR A;  4UDU C;  1STB A;  1YHA A;  3RZD H;  2NZH A;  1PZI D;  2B2V C;  3OYY A;  1S5E D;  3H0G B;  1K8M A;  3R8B A;  1Y1W H;  2A8V A;  3DEO A;  2Y0S B;  4A3I H;  4V19 0;  4IFD H;  1PZK D;  3MXN A;  2K4K A;  4L5S A;  3K5N A;  2EIF A;  1CHP D;  1DGS A;  2AQ1 B;  4KK7 A;  1PTO B;  3KYH C;  3GV6 A;  3T1H Q;  3CQZ B;  4ZKB B;  3GTP B;  1AZQ A;  1KC8 C;  2DJG C;  4DNI A;  3HOX G;  1EQV A;  3SDZ A;  1VDZ A;  3CP0 A;  3KUP A;  3GTL H;  1CKM A;  4XQN A;  3Q22 A;  5FO9 B;  3G48 A;  4JVZ A;  2AUJ D;  3K58 A;  2JN4 A;  2NZ1 D;  3LWU A;  1XNQ Q;  3FKI H;  2NTT A;  4QQB X;  1F9Q A;  3H0G G;  2CWP A; 
#chains in the Genus database with same CATH homology
 1IKM A;  4BWG B;  1KTK A;  1TY2 A;  2EJM A;  4ODG A;  3P7J A;  1SE3 A;  3MHB A;  3GTK B;  1YNJ D;  3HOV B;  1O80 A;  4A3E B;  5C3E B;  4LAA A;  1Q90 A;  3X3N A;  4KY7 A;  5EBC A;  1PRT F;  4FVM A;  1RTO A;  3J7A V;  3IL8 A;  3SK8 A;  2XIW A;  1DXM A;  5IT9 E;  5COR A;  1STH A;  5M5Y B;  2SDF A;  2V4D A;  2WKC A;  1D5M C;  3E0J A;  4TSS A;  1F9P A;  2JA6 B;  1ZXT A;  4QMG A;  1X32 A;  1YNN D;  1I4X A;  1V1O A;  1PTO F;  2EYM A;  4KI0 A;  3TP8 A;  2L9H A;  1EY9 A;  5I9O A;  2LY7 A;  4KY6 A;  2E2H B;  1MSG A;  5EKK A;  1TWF B;  4G4K A;  5KYI A;  1WCM B;  2CQA A;  3NWT A;  1PLF A;  2NN6 G;  3IFD A;  4JBW A;  2Z1C A;  3S1R B;  2DY7 A;  4CJ1 B;  3K0Y A;  2WKD A;  1H9J A;  4DFA A;  2QIL A;  3MAQ A;  4Q0F A;  4M1U B;  4KKU A;  5G3L F;  5D3I B;  2F0G A;  3PV0 A;  2HUG A;  2QDB A;  4J6H A;  2B2Y A;  2HDM A;  3HOW B;  3ERO A;  1KNE A;  3EJI A;  5IGC A;  5KYL A;  1WD1 A;  1EEF D;  2N88 A;  3T4A C;  2JYO A;  5ELD A;  1ONL A;  2Z4I A;  1I6H B;  1GUT A;  4KY5 A;  3K5L A;  3E5S A;  2JXM B;  3A7L A;  2FFK B;  2BDO A;  4K5X A;  2WB1 B;  4A3J B;  1IL8 A;  5EKL A;  1OXT A;  1BCP D;  2ZXO A;  4PQX A;  2RVL A;  4ILW A;  3SEB A;  1DOM A;  4DNR B;  1U4M A;  1SJE D;  1HA5 A;  1GHJ A;  1XX8 A;  2G9D A;  4EQO A;  3OIP A;  1DOL A;  1BUV T;  2F0I A;  3D4D A;  5K5P A;  5FLX L;  4FNF A;  1STG A;  5JJZ A;  2KVM A;  2JP1 A;  2MJ8 A;  3GTG B;  2F0D A;  1EWC A;  3DHQ A;  1GUO A;  5KNB A;  1HHV A;  4C3H G;  5IGD A;  4V0B A;  1SE2 A;  1C8C A;  3LWE A;  4ZUJ A;  2F0L A;  4MIU A;  1E2W A;  4DA2 A;  4WFN 3;  3I4L A;  2DY8 A;  2N55 A;  5E4W C;  4DXF A;  3BYY B;  2PYK A;  3I70 A;  3KLS A;  2B2U C;  1KLU D;  1QG7 A;  4CKE A;  1ZKO A;  2SNS A;  1O7L A;  4CKB A;  1EY7 A;  3A54 A;  1D1I A;  1GXD C;  1HTP A;  2RDH A;  5C5L A;  2NB0 A;  3GO5 A;  1BR9 A;  3NQI A;  4CJ0 B;  4ZLT F;  1F9R A;  4H44 C;  4JK1 C;  5BN4 A;  2K28 A;  1C48 A;  4RHR A;  3A7A B;  2J0T D;  5EPL A;  3J7A F;  4KJN A;  1FNU A;  3DWA A;  1EWH A;  4N9P A;  4FF3 A;  3BDL A;  4QUF A;  3EFX D;  1Y8O B;  2F0P A;  1U9R A;  3RLF A;  3OIQ A;  1QWY A;  5CV8 A;  4FF2 A;  1FNV A;  1IYU A;  1HPC A;  2A6E C;  1A3U A;  1EZ8 A;  5CV4 A;  2R92 B;  2PMZ B;  2FJ2 A;  1W6J A;  5M5W B;  4FXG C;  3SVM A;  5JEA J;  3VYS A;  5BN3 A;  2B63 B;  2R61 A;  2XRQ D;  3HG9 A;  1R4Q B;  2PZU A;  3T51 B;  4XYQ A;  1VF7 A;  2PZW A;  3QG1 A;  1NR2 A;  4K6D A;  2VB2 X;  3WOE A;  3BVM A;  3M7G A;  4P2C B;  4O42 A;  2K5D A;  1CZG A;  1STA A;  4O1N A;  5KGU A;  5COY A;  4C3I B;  1KAA A;  1T5X D;  2RA4 A;  3I90 A;  4ZAI A;  2FIN B;  3S16 B;  3QO2 A;  1NAP A;  2JA5 B;  2MHV A;  1B2T A;  3E6Z X;  5C4J B;  3ITP A;  3K57 A;  3SE0 A;  1EYC A;  3EVQ A;  2OEO A;  5CYU A;  3K6O A;  1HTL D;  2IJ0 A;  2A69 C;  2F0W A;  1TWA B;  5CMD A;  1TWG B;  2E2I B;  1JC7 A;  4HED A;  5IOC A;  1M4V A;  3MZ5 A;  1RD9 D;  3R2T A;  2QF7 A;  5JVG 3;  1TQO A;  2IL8 A;  4K6L A;  1G29 1;  1HRJ A;  4ZQ3 A;  4C3I G;  4F8M A;  4KD3 A;  4IUN A;  1WTR A;  5KRU A;  5C4X B;  1F9S A;  4PMC A;  4CBV A;  4F87 A;  4QF4 A;  3HZX A;  1ENF A;  4CHT B;  3EA6 A;  5IT9 L;  3HS0 C;  2EYJ A;  2KEC A;  4X3S A;  1DYQ A;  2KOL A;  4KN4 C;  4KV6 A;  4OO1 H;  3OSO A;  5T1G A;  1JOR A;  4A3K B;  1CK1 A;  1X3P A;  3ERQ A;  1PTO H;  1SMY C;  2F0M A;  3VR3 A;  4KKT A;  1EU3 A;  5C3W A;  1H9M A;  4HR7 B;  1CI3 M;  5CC4 A;  1QE6 A;  4YIJ A;  1A3T A;  2EY6 A;  4L63 B;  2E74 C;  1G6Z A;  2A69 D;  4UAI A;  1G2S A;  1MI2 A;  5C5M A;  1EFI D;  1PMR A;  5ELE A;  1CFM A;  2FMM A;  3T13 A;  3OMG A;  2BE5 C;  4TRD A;  3Q23 A;  5FO8 B;  2K6A A;  1X3Q A;  1GUS A;  3LNN A;  2NVY B;  1UNS A;  3BYT B;  1LV9 A;  2ID0 A;  2Z8L A;  4ULL A;  1O78 A;  1M8A A;  3NQT A;  1Q3L A;  2NBF A;  2IPK D;  3CRK C;  4E6I A;  2IX3 A;  5FKA C;  3S9W A;  1JE4 A;  2EOT A;  2A68 D;  5J1Z A;  4XT3 B;  1WTO A;  3RMH A;  2K03 A;  5ELF A;  1D6E C;  1GUN A;  4Z9C B;  1OXV A;  3W2D A;  2O2L D;  4DAV A;  1H9S B;  2DNE A;  5CR3 A;  3S1Q B;  3M4Y A;  1YNJ C;  4QIW B;  1SFO B;  4OHJ A;  3AMU A;  5F2D A;  3I73 A;  5IIF A;  1D1K A;  2MP1 A;  1LAC A;  1O7Y A;  3MVV A;  3U9S A;  3GV3 A;  3C1F A;  3R3O A;  5C0X J;  4H0L C;  1TWH B;  1MGS A;  2F1M A;  1AEX A;  4C3J B;  3PUZ A;  3Q0A A;  1U4L A;  3VA7 A;  1OO9 B;  5I6W A;  4RGM A;  2EE1 A;  1SYC A;  5G3L D;  1II3 A;  5JEA H;  1EEI D;  2NVX B;  2K33 A;  4DNT B;  1G2T A;  1CTM A;  1YNN C;  3DUZ A;  4IAL A;  4R8N A;  1STE A;  3HEJ A;  2JA7 B;  1STN A;  1F2L A;  4XTC S;  3S1M B;  2L5T A;  4C3J G;  1BQQ T;  3V2T A;  4IUR A;  5C3X A;  1F2Z A;  4RHS A;  1LLR D;  2BA0 A;  4H7B A;  1ET9 A;  1ENA A;  1SNQ A;  1A6X A;  1B9M A;  3MTS A;  2K04 A;  1V43 A;  1SND A;  2WII B;  4X3K A;  3CKI B;  5C44 B;  5I6Y A;  3PO2 B;  1V1P B;  5IGG A;  4XQJ A;  1TT2 A;  4ZYS A;  3C2P A;  2KCC A;  3PO3 B;  1SYB A;  3P20 A;  3R2I A;  3QIA A;  4HMJ A;  1LO5 D;  2QKI C;  1CHQ D;  2XWB B;  3FMC A;  4RCN A;  1SEB D;  2VUM B;  3S14 B;  1S5C D;  1I4Q A;  4RCO A;  1TWC B;  1XWE A;  1BCP C;  3UI2 A;  1HCZ A;  2EJG C;  1F77 A;  1SSO A;  1AN8 A;  2PW5 A;  1WTW A;  1WTP A;  3A8I E;  2M2L A;  2FMC A;  1EU4 A;  2EYH A;  2L12 A;  2EXZ A;  1HA6 A;  1FNW A;  2M00 A;  4FP5 D;  3SR1 A;  4KJO A;  1Z6H A;  1PFN A;  4PMB A;  4H13 C;  5KND A;  1EY0 A;  2F3W A;  1AW7 A;  5T1I A;  1A15 A;  3PUY A;  3ND8 A;  2K5Q A;  1LT6 D;  4A3B B;  3C3L A;  3DXJ C;  2EZV A;  2O5I C;  3VA5 A;  4ID6 A;  3K59 A;  1A2T A;  4G7Z C;  1NSN S;  2GA4 B;  4F88 A;  1Y1W B;  4A3I B;  2CHB D;  1D2B A;  1OXX K;  5CBA E;  2EYL A;  2VXW A;  2BCO A;  1G8Z D;  2QEJ C;  2EDG A;  1PZJ D;  2X69 A;  4CKC A;  1ENC A;  1JOK A;  2BOS A;  5EKI A;  3GTL B;  2B2Y C;  4EGV A;  2WAC A;  3GQB A;  4OIJ A;  5D3D A;  4RGN A;  3A55 A;  2F0T A;  1R9T B;  1EY4 A;  1W6K A;  3O13 A;  1CQV A;  3I72 A;  1KAB A;  1ZEQ X;  2YYZ A;  2H4O A;  3MXG A;  4QCL A;  1SAP A;  3OWE B;  5JPM C;  3A56 A;  3FEW X;  1EY6 A;  2L0C A;  2B2W A;  2LMC B;  2IX0 A;  2NWG A;  1BCP B;  2WIN B;  2D5D A;  3BDC A;  4PMW A;  2XN9 C;  3JAM E;  4A93 B;  3QOL A;  5ELB A;  2JA8 B;  4RWS C;  5C0X H;  3PUX A;  2PW7 A;  2JSO A;  1TY0 A;  5CV9 A;  2PNR C;  3IKJ A;  1E2V A;  1LAB A;  4G7H C;  3K7A B;  1QJO A;  1UAP A;  4FO2 A;  1B53 A;  2RSN A;  3T53 B;  2RKS A;  2DNC A;  4N9T A;  4EVO A;  2OF1 A;  2HQE A;  2E75 C;  1DOK A;  4C1N I;  2OXP A;  3BG3 A;  5M5X B;  2EVB A;  4FXK C;  1J8I A;  3IAY A;  1GUG A;  1SDF A;  4BY1 B;  3W3A A;  1Y8P B;  4OGQ C;  4B9W A;  2B2W C;  2F03 A;  1ILP A;  3S15 B;  3HOY B;  1KLG D;  1JB3 A;  3FPP A;  1GHK A;  1Y1V B;  2EY5 A;  5C4Z A;  1RKN A;  3D6C A;  2JE6 I;  3NSW A;  1GJX A;  2IX1 A;  3D31 A;  3AB9 A;  3KK7 A;  4IUP A;  4HSP A;  2A6H C;  4KTA A;  1RHP A;  4K14 A;  1PDQ A;  5A35 A;  1BDO A;  4HCS A;  1LTT D;  5LL6 S;  2EYP A;  4ZKC B;  1TU2 B;  2E76 C;  1JIC A;  4A3F B;  3HGB A;  2MPM A;  2AQ2 B;  5JVH 3;  4CGY B;  2WAQ B;  4XT1 B;  1NCV A;  2O5J C;  4R9W A;  5M3M B;  1MD2 D;  3GD7 A;  5K36 G;  1TKW B;  3MEH A;  4DF7 A;  3D6W A;  2L4N A;  2EY2 A;  4BA1 I;  3FPU B;  5NUC A;  3OPO A;  1U4R A;  4S3S A;  3QOJ A;  4KN7 C;  4XIG S;  3HOU B;  3OW7 A;  4IZ8 A;  3I3C A;  2ICI A;  1NR4 A;  1D5Z C;  2F0F A;  3RZO B;  1L0X B;  1AP0 A;  1I4G A;  5A2Q E;  1LT3 D;  3TSS A;  3SXH A;  3VR6 A;  4IUT A;  2HCI A;  2D62 A;  1BF4 A;  1EIG A;  5EPJ A;  1AZP A;  5E1F A;  4DN4 M;  1HFN A;  2A6H D;  2QCP X;  2F0Q A;  4DXG A;  2E2D C;  1JWU D;  4ZUI A;  1PRT C;  1S5B D;  4RGO S;  2LFN A;  4IN3 A;  2J4X A;  5I4D A;  4LJZ C;  1JOQ A;  2A68 C;  3TP6 A;  2C9O A;  3MFY A;  5IGB A;  2L55 A;  5FK9 C;  3D8G A;  3GTQ B;  3NWS A;  2XRS D;  2ZXP A;  2KA7 A;  5DNF A;  3SK4 A;  4KD4 A;  2NTS A;  1XXG A;  1QB5 D;  4RAU C;  1BBX C;  2I46 A;  1OXU A;  3BVZ A;  1CQF A;  2RDG A;  4QB4 A;  1SNP A;  2R3Z A;  4HN7 A;  1S5D D;  5I9P A;  1RCV D;  1TS4 A;  1LTG D;  3R93 A;  5IOD A;  1B4O A;  2D9U A;  2NN6 H;  2TSS A;  4G7O C;  1OXS C;  3L7Z C;  1PFM A;  1EY5 A;  3NTK A;  1PRT D;  1EOT A;  2VNU D;  1DJR D;  3CRL C;  1WD0 A;  2YU9 B;  4FXD A;  5CV6 A;  2BDN A;  4RH6 A;  4ZRZ A;  1V8Q A;  5DM6 3;  1ESF A;  4WRD A;  5CBE E;  4TQU S;  1PYW D;  2ENB A;  3VR5 A;  1Q1E A;  3TZU A;  2PPB C;  3V96 A;  1I4P A;  3MXU A;  4HAE A;  1PXU A;  1SJH D;  5E4X A;  4Y7N B;  3KBG A;  3NTH A;  4K5V A;  1EYD A;  2PZT A;  5CGK A;  2KJX A;  5C6A A;  1I4H A;  4XYO A;  3FRP B;  1QOH A;  1PTO D;  1XYI A;  1CA6 A;  2AQ3 B;  4DU9 A;  2HDL A;  3C1E A;  3HKZ B;  3L9A X;  3P1H A;  3TP7 A;  1LTA D;  2TMP A;  2F0S A;  1Z7T A;  2SOB A;  4HSV A;  3OMC A;  4BS9 A;  4MHE A;  3GTM B;  1JWM D;  3GP7 A;  2A73 B;  1HUM A;  2LKV A;  5KEE A;  1Z47 A;  5JAV A;  4B08 A;  3RD4 A;  2PCF B;  3PIP 3;  2XSC A;  3JAM L;  5CV7 A;  3N6R A;  2NUC A;  1S4Z A;  3BS1 A;  5AFW A;  4C56 C;  3D4R A;  3U9O A;  1JWS D;  4M8A A;  1HUN A;  2KED A;  1I4R A;  4EQP A;  1VMP A;  2I07 B;  2IW3 A;  1LTI D;  3I8Z A;  4RKB A;  4TKO B;  4BBR B;  3DWQ A;  3ND9 A;  2C5C A;  5IGF A;  4X3U A;  3KLR A;  2MGS A;  5DM7 3;  2XNA C;  1I3Q B;  4XQQ A;  1I50 B;  3D4W A;  5D14 A;  1WTQ A;  1KDC A;  4IFD I;  4OO1 G;  2EYF A;  1Q1B A;  3F2U A;  4KKS A;  2LS0 1;  1J9O A;  3QWN A;  1G91 A;  1NUC A;  1ML0 D;  2EYO A;  3HRZ C;  3A8J E;  3EQL C;  1BOS A;  4RGT A;  3HOZ B;  2JEB I;  2O4X A;  1T5E A;  3SK6 A;  3IFT A;  4BBS B;  3NHH A;  3VYR A;  1E0B A;  2KUM A;  2F0V A;  4U67 3;  1DON A;  3NUC A;  3BZD B;  1B9N A;  1FYC A;  2F0U A;  4MN3 A;  3M3Y B;  1CT1 D;  3TME A;  1QIL A;  3S1N B;  3K5O A;  3OHX C;  5TSS A;  2Q8T A;  2F3V A;  3CHB D;  4OIK A;  2RQX A;  1JR0 D;  3RUZ A;  3M7N A;  5JOB A;  1F2M A;  3MC0 B;  5BN5 A;  5I2X A;  1QNK A;  1B50 A;  1IYV A;  5E3F A;  4EQN A;  2AWO A;  4FF4 A;  2RDF A;  4WJW A;  5KNC A;  1JOO A;  1A2U A;  3J81 E;  4NMZ A;  3SK5 A;  2MUY A;  2K05 A;  5A2Q L;  2D2C C;  1ROD A;  1B3A A;  3BDO A;  1RDP D;  4A3D B;  2PQE A;  3DM1 A;  3I4M B;  1ET6 A;  5K36 H;  2VB3 X;  5ELC A;  1EQT A;  2KHS A;  3RZD B;  2F0N A;  2F0O A;  1WTX A;  3I4N B;  3OWF A;  4L8J A;  1DZ1 A;  2IT1 A;  4ZK9 B;  1EL0 A;  2SNM A;  2AUK A;  2SEB D;  4HTH A;  4RKL A;  5CV5 A;  2K01 A;  1DM0 B;  5LHY 1;  1SYG A;  4C3H B;  3NPP A;  2PO4 A;  4J8Q A;  4NP5 A;  4A3G B;  2B2U A;  4U68 A;  3K5M A;  2ZXR A;  3NBI A;  2KQ3 A;  1VCI A;  1STY A;  3H94 A;  3P75 A;  1HXY D;  3Q24 A;  1BNZ A;  1LTR D;  2E2J B;  3FKI B;  1UEA B;  4IFD G;  1HFG A;  3H91 A;  1SYE A;  5JEA G;  1TS2 A;  2OT2 A;  3A8K E;  4IUV A;  2Q8I B;  1HQM C;  1K83 B;  2F0E A;  2XWJ B;  3J80 E;  2X6L A;  2WP8 J;  1UUP A;  2B39 A;  4KMU C;  4I65 A;  4LMQ D;  3N52 A;  5EQ0 A;  3M85 A;  3OOC A;  1IKL A;  1FGB D;  2Q8R E;  4AYB B;  1RTN A;  1SYD A;  4HMI A;  1WVL A;  3ZYY X;  1TS3 A;  1EYA A;  3QB3 A;  4C2M B;  4PNY A;  3URY A;  3H3V C;  2EY1 A;  1VF5 C;  2B8G A;  1R4P B;  3NTI A;  2F0J A;  1LTS D;  1AFP A;  5KIX A;  3MFG A;  4K8I A;  2H1E A;  2RBM A;  4B9X A;  2Z4H A;  3DMU A;  4LK1 C;  1SNO A;  5LL6 X;  1KDB A;  4FYD A;  1BO0 A;  5J22 A;  1I6V C;  1ZYR C;  3TN2 A;  2R93 B;  5C0X I;  1FR3 A;  3J7Y W;  1SE4 A;  4DGZ A;  3KBX A;  1U4P A;  4IFD J;  1Q12 A;  3PMF A;  1BCP F;  1Y69 U;  5EJW A;  4NKL A;  4NW2 A;  1GOZ A;  3H09 A;  2K5W A;  3M4O B;  3NP8 A;  3T16 A;  1QNU A;  2KEE A;  5HUR A;  3VR4 A;  1H9S A;  3MWY W;  2AWN A;  3KF8 A;  2K1B A;  2NVQ B;  1TS5 A;  4ABN A;  4IUU A;  4DK1 A;  1RJT A;  1D5X C;  2NVT B;  5ISR A;  4A3M B;  2F0K A;  2NYZ D;  1FD7 D;  4BY7 B;  1ICW A;  2B8F A;  1HQR D;  4Q5V A;  2DN8 A;  5EBD A;  2B2T A;  2K32 A;  1IW7 C;  1KNA A;  3X3M A;  4L6T B;  3C46 A;  1CZW A;  3TP5 A;  3S17 B;  3AU7 A;  1K8O A;  3VYU A;  5FOB B;  4IUQ A;  4X3T A;  1EIH A;  1DCZ A;  4PV1 C;  2G9H D;  4FF1 A;  5J39 A;  1ZYR D;  1GUW A;  1SBB B;  3MXP A;  3TBI B;  1DD2 A;  1MBY A;  2A6E D;  4K2K A;  1H9R A;  3G7L A;  2A5H A;  3TDQ A;  3TZD A;  1SXT A;  3FVQ A;  2IWH A;  3BVG A;  2KCN A;  3KLS X;  2WV6 D;  3GTJ B;  3PUW A;  1A3V A;  3LX0 A;  5JPN C;  3S2D B;  3WOF A;  4I7Z C;  3DWP A;  1TII D;  1XTC D;  1CM9 A;  3NBH A;  5IGE A;  2B2T C;  3GTO B;  2ICE C;  3VYT A;  1MSH A;  4J1M A;  1B44 D;  1E2Z A;  4DAY A;  1S5F D;  2RSO A;  1V1P A;  2HCC A;  3QJY A;  5FLX E;  5HGT A;  4G57 A;  1IW7 D;  1TR5 A;  1PTO C;  2FHT A;  4GZY C;  3PIO 3;  3PUV A;  5DAU A;  1KDA A;  1LTB D;  5D65 A;  1IHZ A;  2F4I A;  1VMC A;  3D3R A;  1CA5 A;  4F7X A;  5C0X G;  1Q8I A;  4OO1 I;  3I91 A;  2BA1 A;  1JCK B;  3J81 L;  1WTV A;  4BA2 I;  1PFB A;  3NK9 A;  2CW0 C;  3NXW A;  2J7Z A;  5EGT A;  1RF2 D;  2XVS A;  2R6G A;  2A74 C;  3H6M A;  1ILQ A;  2EPB A;  3HP3 A;  2K7V A;  4IQZ A;  2F0H A;  2L11 A;  4QUC A;  4KHZ A;  5C4H A;  3CU7 A;  2R7Z B;  4DAP A;  5FO7 B;  2X6G A;  1SNC A;  2ZT9 C;  2EJF C;  1EZ6 A;  4K2L A;  1BXT A;  1O7Z A;  1LT5 D;  1B1Z A;  1Y8N B;  1QCB D;  4WOR A;  5M3F B;  2B2V A;  1C4Q A;  4NDX A;  1LT4 D;  1SMY D;  4KHV A;  4XXE A;  4C1N K;  3NE5 B;  4XDX A;  1EY8 A;  2M9V A;  3V05 A;  3VR2 A;  3Q6S A;  4DK0 A;  3L3O C;  2NN6 I;  4CJ2 C;  4RFB A;  1SNM A;  3G6J B;  5I2Y A;  3WDN A;  1SYF A;  5DEH A;  2JEA I;  5EPK A;  4HCE A;  3T56 B;  3S2H B;  2CW0 D;  4K5W A;  1PRT B;  1F2Y A;  1L0Y B;  4ME5 A;  4K8J A;  3HOX B;  1JQY D;  3J80 L;  4R8I A;  1H9K A;  2BE5 D;  3FDT A;  3MA2 B;  4OL7 A;  2L1B A;  1TVX A;  3SHL A;  3DEP A;  3ONA B;  2CVR A;  4RA8 A;  5M9O A;  1ESR A;  4UDU C;  1STB A;  1PZI D;  2B2V C;  1S5E D;  3H0G B;  1K8M A;  3R8B A;  3DEO A;  2Y0S B;  4V19 0;  4IFD H;  1PZK D;  3MXN A;  3K5N A;  1CHP D;  2AQ1 B;  4KK7 A;  1PTO B;  3GV6 A;  3CQZ B;  4ZKB B;  3GTP B;  1AZQ A;  1EQV A;  3SDZ A;  1VDZ A;  3KUP A;  4XQN A;  3Q22 A;  5FO9 B;  2AUJ D;  3K58 A;  2NZ1 D;  3LWU A;  2NTT A;  1F9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...