4X3SA

Crystal structure of chromobox homology 7 (cbx7) with setdb1-1170me3 peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
b'MGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 7
publication title Small-Molecule Modulators of Methyl-Lysine Binding for the CBX7 Chromodomain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 12
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4x3sA00
2HDLA 1ICWA 3G7LA 1BO0A 2M2LA 4NW2A 4CJ0B 1EOTA 1F2LA 1VMPA 5EQ0A 1HUMA 2N55A 1S4ZA 2FMMA 4IUVA 2IL8A 3FPUB 3QO2A 4IUUA 1WTOA 1DONA 1PFMA 1RJTA 4IUQA 3R93A 1B50A 1E0BA 3GV3A 4XDXA 5E4XA 1O7YA 4RA8A 2L1BA 1TVXA 5D65A 3IL8A 3UI2A 1HA6A 4U68A 1QG7A 1ILPA 1G91A 1O7ZA 1B53A 4HEDA 4R8IA 3H91A 1BBXC 2JYOA 1RODA 1QNKA 4X3UA 1WTQA 1U4RA 2X6GA 1PFNA 4QUCA 1AZQA 4R9WA 3MTSA 4OIJA 1IKMA 1U4PA 2N88A 2VXWA 2HCCA 1MSHA 1XYIA 4XT3B 3IFDA 1O80A 2L4NA 3KUPA 1DOKA 1EIHA 4CJ2C 1BNZA 1F9PA 3FDTA 1WTRA 3ONAB 1PFBA 1QE6A 1WTXA 1BF4A 1EL0A 4RWSC 4DN4M 1F9SA 2HDMA 2BDNA 1XX8A 2K03A 2K04A 2MGSA 5CMDA 4ZK9B 1IL8A 1B4OA 3P7JA 2B2UA 4MHEA 5EPLA 1NAPA 4IURA 2K1BA 2B2TA 1SDFA 2D9UA 2FJ2A 3TN2A 2B2VA 1RTNA 4X3SA 1CA5A 1G6ZA 1IKLA 2KEEA 1NR2A 2X69A 1M8AA 5CBAE 1JICA 2MJ8A 1AZPA 1U4MA 1EQTA 5JJZA 4X3KA 1EIGA 1LV9A 2XIWA 1X3PA 3I3CA 1KNEA 2B2YA 3I90A 1X32A 1SSOA 3N52A 5T1GA 1DOLA 2RVLA 5AFWA 5EJWA 2B2WA 1AP0A 1Q3LA 2K01A 2KEDA 2K05A 3DEPA 3SVMA 1GUWA 1CA6A 1HHVA 4ZKCB 1PDQA 1ILQA 2EOTA 2KOLA 2L12A 1HRJA 4HCSA 1CM9A 4HSVA 4O42A 3I91A 1MGSA 1NR4A 1B2TA 1MSGA 1X3QA 2NYZD 4XT1B 2MPMA 2EE1A 2KUMA 2K28A 2RSNA 1F9RA 1DZ1A 5EPKA 2CVRA 2HCIA 4OIKA 5EPJA 4ZLTF 5E4WC 1ML0D 1G2SA 1G2TA 1WTWA 1SAPA 4HAEA 1J9OA 1JE4A 2J7ZA 3GV6A 3KBXA 4MN3A 4CJ1B 1C8CA 1F9QA 2FINB 1HUNA 2FFKB 5D14A 1RHPA 3TZDA 1DOMA 1U4LA 2NZ1D 3MWYW 4LMQD 4RAUC 1ESRA 5DNFA 1VMCA 2L11A 1WVLA 4X3TA 2R3ZA 2B2UC 1WTPA 1NCVA 5T1IA 2B2TC 2DY7A 2H1EA 2B2VC 4IUPA 3DM1A 2HUGA 3HP3A 2Q8RE 1WTVA 5COYA 1RTOA 1J8IA 1KNAA 2X6LA 1A15A 3Q6SA 4UAIA 1HFNA 2KECA 1ZXTA 2B2YC 4ZAIA 1WD1A 4ZKBB 2L9HA 1PLFA 2RA4A 2SDFA 3LWEA 3F2UA 5CORA 2B2WC 2DY8A 2JP1A 1HFGA 2Q8TA 1WD0A 5EKIA 1B3AA 2KVMA 5CBEE 3DEOA 3D6WA 4QUFA 2FHTA 4IUTA 2MP1A 1MI2A 2NWGA 3I8ZA 2EPBA 2RSOA
chains in the Genus database with same CATH superfamily
2B3GA 3UDGA 3MFGA 5EAYA 3GTGH 4DR2L 4J15A 1ET6A 3HOXH 1XTCD 1Y1VB 3JAME 3X3MA 5A2QE 3SGIA 4AYBE 2Y0SG 1TVXA 3IL8A 1YHAA 1CZWA 1HA6A 3M4YA 3T1HL 1B53A 3DHQA 3D31A 2AQ1B 3I2ZA 5M9OA 4GKKL 4FDBA 4N8X1 2F03A 2JYOA 2CHBD 5IT9E 4A3MG 3H0GH 1JT8A 2F0SA 3MTSA 3KJPA 4MIUA 2HQLA 2VXWA 1T9HA 2GVAA 5J3BA 4A76A 5A2QL 2PNHA 1K3BC 2PZWA 3I56A 1PFBA 4RWSC 4KK7A 2NVXB 1XX8A 1EUJA 5I9PA 4GN5A 3RLOA 2UUCL 2KHSA 5IT9L 2C5CA 1GUSA 4MHEA 1O78A 4A3KB 3TDQA 4UDUC 4GOPC 4RHSA 1I94Q 1ASYA 3P1HA 3F2CA 4LAAA 1X3PA 1JB7A 3J81j 2RVLA 5AFWA 4BS9A 1CSQA 1Q3LA 3GTLB 5JJIA 1VQIA 5ISRA 3C1EA 3S9WA 4LUVA 2H5XA 4UP8A 3KJOA 1TWFH 3H94A 3CC7A 1PH8A 4DNTB 4A3DH 1FNWA 2ZT9C 1WTWA 1N9WA 4KD4A 2RBMA 1Q90A 1J9OA 3E9HA 1LTSD 1C8CA 3R2IA 3VR2A 1QUQA 4FXGC 1SNDA 2FFKB 3AEVA 1RHPA 1ET9A 3MWYW 4A3IB 3CRLC 2V1CC 4LF9L 2N3SA 2WINB 4X3TA 3PO2G 4JI5Q 1HNWQ 2UXBQ 1PH5A 1Q1BA 2HQEA 2RHQB 2CQAA 1SXTA 1A15A 4RGOS 5C44H 1IBKQ 4FF3A 4LF8Q 3BDCA 3G6EA 1HNXQ 1MKHA 1LABA 1DXMA 2EY1A 3MEFA 4APVA 1E2ZA 5CBEE 2F0EA 1IYVA 1VQBA 2E74C 5NUCA 1GJXA 2RSOA 3J7A5 2RCFA 2CFMA 1BO0A 1PYBA 3PO3H 3GTQH 4DV6Q 1R9TH 2F0IA 4RMFA 3S15B 4BBSB 5EQ0A 4IUVA 1GUTA 4IFDJ 4B9WA 3BS1A 2NVTB 1H9RA 3TP8A 5IYCH 1HTPA 2XVSA 4U68A 1B44D 2SOBA 1S40A 1O7LA 4RFBA 3TQYA 2L55A 4P72A 3KFUA 3TREA 1RODA 3NWTA 3MHBA 4P71A 4X66Q 4IUNA 3FRPB 5I2XA 4KN7C 2L4NA 1DOKA 2AUJD 3J80E 5ELEA 4A3CG 1GXDC 2F0PA 4DN4M 4KHPQ 1N33Q 2K03A 1YNXA 3QWNA 3TBIB 1P8LA 2QA4A 5EPLA 1E2VA 1K28A 2VS1A 1PTOF 2PI2E 1PZID 1VF5C 3OMGA 5JOBA 3J7AV 3S2DH 3PF4A 5M3FH 1KIXA 3GTGB 2MJ8A 3HOXB 3J80L 1PRTD 3I3CA 3EN2A 5KYIA 1RDPD 3CPWA 4GZYC 1BBWA 1TWCH 3WDNA 3QB3A 1E7ZA 1SN8A 4WRDA 3AQQA 2NN6G 5GROA 3K6OA 1PDQA 3X3NA 3TS2A 1AN8A 1KRTA 3H0GB 3I4LA 3DWPA 4EVOA 5AJ3L 4PG3A 5E4WC 4J1MA 3M4OH 2JA8H 3QJYA 5C4XH 4ZCKA 5KIXA 1F9QA 5C0XJ 4A93G 1N32L 4RG1A 3TZDA 4K5WA 1ESRA 3CD6A 4DV2L 1SRUA 1JE5A 1EY8A 1Z9FA 2B2UC 2BA1A 4JOIA 2E2HH 2R7DA 4DU9A 4AQYL 1CI3M 2A19A 3L3OC 2LXKA 3TZUA 5CYUA 5C3WA 1OO9B 3MZ5A 1VQHA 4L5RC 4ZAIA 3U50C 1XMOQ 1WOCA 2D62A 4PZ8A 3TRZA 4RGTA 1E2WA 3QOJA 5EKIA 1BDOA 1MI2A 1OXSC 2KA7A 4YWMA 4DR2Q 1DJRD 1TWFB 3TEHB 4GN4B 4IJHA 1FL0A 4A3DB 5IP9H 3V96A 2CCZA 5LL6X 2N8NA 3T1HQ 4KD3A 4GKKQ 1PH2A 1ONLA 5D3IB 1H9KA 1O7ZA 2KCNA 3TS0A 4A3LG 1L2FA 1K3RA 5KYLA 3NHHA 1X3EA 1FR3A 1X6OA 3F8TA 1VDZA 4WORA 4KKTA 1OXTA 1NMGA 4TSSA 2R93G 5KNDA 5C44B 4R1JA 4A3BG 4BBRH 1HCZA 4O0AA 2UUCQ 1PH9A 1DD2A 1EWIA 2MGSA 1R4QB 4B3RL 2XNAC 3CHBD 5EKLA 4ABNA 2ZJPA 2R7ZH 2F0DA 4KJNA 2B2TA 4DAMA 2IPKD 5FLMH 1NMFA 4K8JA 4HJ9A 3PO3B 3GTQB 4QB4A 3SR1A 2Q2HA 3OW7A 5CBAE 1R9TB 2OTJA 5H1SE 1EQTA 1ENCA 1AE2A 2D2CC 4K0KQ 2BCOA 1OXVA 5KEEA 3DMUA 3NK9A 2MHVA 1SE8A 1GUOA 2JXMB 3GTMH 1VQJA 1F77A 3NTHA 2DNEA 3CCMA 3M9BA 4A3MH 4CDEC 3S17H 2WIIB 1SAPA 3K57A 1HA5A 1VQDA 1KLGD 2WFWA 3GV6A 4CJ1B 2F1MA 2ZM6L 4JPBW 4LUOA 4LF9Q 4YCVA 1TXYA 1KLUD 3G4SA 5IIFA 4PMBA 4POFA 3EIVA 3I72A 3RD4A 1K73C 3S2DB 1STNA 3BJUA 4KKSA 5M3FB 2B39A 2ZJRA 4BA1I 2E2JH 4YHHL 4LFBL 2TMPA 2K32A 5G3LF 2JP1A 4ID6A 5ELCA 1TWCB 1KDBA 5I2YA 4LF4L 1C48A 1PVOA 3B6YA 4A3FG 3TSSA 4FF4A 4N8FA 1TU2B 4P74A 4OGQC 3FPUB 1YJ9A 4PZ6A 3FEWX 1DONA 3M4OB 2JA8B 5JJLA 4LK1C 5C4XB 4XYOA 4P2CB 2O2LD 2OT2A 4PZ7A 4GS3A 4HEDA 5E7NA 1CT1D 3MXGA 5ELBA 1PXUA 3RMHA 1VQFA 1S3OA 5GAGC 3PO2H 3KOJA 1I5FA 4N9PA 3RZOH 1Z6HA 1BCPC 4XQJA 3NSWA 1XNQL 2E2IB 4CDDC 5CMDA 1NNXA 1QB5D 5DM63 2IHEA 1A2TA 3SHLA 1YNNC 2QCPX 1UWVA 4IURA 3MXUA 1N8RC 1SYBA 2A5HA 1E1OA 1NE3A 4Y7NH 3CPFA 1X65A 1Y8PB 3IAYA 4DK1A 5JJZA 2NBFA 2EJFC 2XIWA 4X62L 1AEXA 5HGTA 2K52A 1YVCA 4DAVA 1AE3A 2YV5A 5EJWA 2CW0D 3JC66 5LHY1 1AP0A 1KXLA 1EY6A 3W1GA 3ZYYX 1I6VC 4C3IG 3A8JE 2KOLA 4A3GH 5AJ3Q 2K50A 2Z6KA 4I7ZC 5BR8L 3HOWB 3QG1A 2UU9L 2PZUA 1BUVT 3QIAA 2EXZA 1SNCA 1N32Q 1YJWA 3CCVA 1Q82C 5ELOA 2CH4W 4XIGS 4DV2Q 1ZYRC 3KLSX 5D14A 3HFZB 4BBRB 5IOCA 2ZJQA 2R92G 4AQYQ 1D1KA 1SJHD 3I4OA 3NXWA 4MTKA 1GOZA 1PV4A 3JAMi 2H1EA 3T4AC 2R7ZB 3K0XA 3E9IA 1KHIA 3K80C 2VQEL 1WTVA 1AH9A 3ERQA 4KHZA 2ASBA 1VQAA 2F0WA 2F4VL 1M90C 2RDGA 4MTNA 2Q8TA 5FJ8H 3FKIG 5CV9A 4IFDG 5EKKA 1BKBA 3CCUA 1CSPA 1PZJD 3EA6A 2Y0SB 4K2KA 2PCFB 2LS01 1HZCA 1JMCA 3GTMB 4QL5A 3BVMA 1VMPA 2NN6H 2F3WA 4A3MB 3S17B 1LT5D 3I4NG 2K5HA 4OHJA 3SK6A 1JJGA 1Y14B 2K5VA 2NTSA 3HOUH 2E75C 5F2DA 2JA7G 3L2PA 5GAHC 3NENA 5M5YH 3IFDA 1SFOH 3NWSA 1HQMC 4FVMA 4K6DA 4NXNL 3MC0B 2YTVA 2E2JB 3BZDB 2NUCA 1UE6A 1IL8A 1M1KC 2OF1A 4DAPA 5C3XA 5D3DA 3CQZH 5EBCA 1CA5A 4R4IA 3TP7A 1U4MA 5I9OA 1EY7A 4ZQ3A 3BVGA 3ULJA 1D5ZC 3I90A 3PMFA 2G9HD 3P75A 4EQNA 5J22A 1JWSD 3O13A 1GUWA 3T13A 2AQ3B 1ILQA 1JORA 3I91A 1NR4A 2WV6D 4IPGA 1VQPA 1FJGL 4A3LH 1CK1A 4JI8L 3S14H 3PO2B 2ZM6Q 1QVGA 1ENAA 3OWEB 3I4MG 2O5JC 2LMCB 3RZOB 2ICIA 4RGMA 4A3JG 1HJPA 4JI0L 2NZHA 2R93H 2Y0SE 2XWBB 1PH1A 2HHHL 1A3TA 4H7BA 3VA7A 1WVLA 3UE0A 4A3BH 5M3MG 1L0WA 2H4OA 3CC2A 3DM1A 2IWHA 3EFXD 4X64L 1YHQA 1T5XD 2X6LA 4Y7NB 3RZDH 1PRTB 3HOYG 4LFBQ 5M5XH 4YHHQ 5IY0A 1WD1A 1GM5A 1DGSA 1JCKB 4ODGA 4A4IA 5CORA 3CF5A 1PTOC 4ULLA 2A74C 1II3A 4A3EG 4LF4Q 2JA6G 2NB0A 1CKMA 2NWGA 1PFSA 4LF6Q 3G7LA 2WB1G 4A3GB 1JC7A 4CBVA 1CHQD 3OYYA 2QEXA 1V1PA 3HS0C 1PHJA 1EFWA 4L5QA 1A3UA 2IT1A 3J7ZC 3W3AA 1WTOA 3RN2A 1B50A 1F2MA 2I5HA 2L1BA 1EIYB 3GTKB 3M4PA 4X6AH 4OL7A 1QJOA 1EZ6A 3H91A 4DV0L 1K83H 1EYCA 4V190 2X6GA 5LMNL 2LKVA 4DFAA 2N88A 1S5FD 3A56A 4TKOB 4KY6A 1XNQQ 2F3IA 3V2TA 2LY7A 2IW3A 3F2DA 2I5MX 3DWAA 1I4PA 1NY4A 3ICEA 1MHWC 4LFAL 1SR3A 1GUNA 5IE8A 2Z8LA 1N34L 2A8VA 2K33A 1XXGA 3PF5A 2KEEA 1B7YB 4X62Q 3J81c 1JICA 1HPCA 2K14A 4ME5A 1WYDA 1Y69U 1QOHA 4A3FH 1X32A 1K8AC 3PIP3 1LO5D 2EIFA 3NUCA 2FXQA 4NXMQ 1LM0A 5C4JH 4RCNA 3D4DA 4HJ7A 1TS2A 5BR8Q 3HOUB 4JI1Q 1CM9A 4O42A 1K8GA 2F0KA 4XT1B 3EJIA 1SLJA 2CVRA 2HCIA 3KBGA 4KN4C 4UP9A 5M5YB 4BY1G 2NVQH 1SFOB 4HAEA 3NPPA 3NBHB 5JEAG 4LFCL 2MO0A 1HUNA 3H15A 1L0YB 1JQYD 4FF2A 5LMNW 2F0UA 1TIID 4O1NA 5JAVA 3A7LA 2RKSA 4O2DA 4H0LC 3BZKA 2VQEQ 1HZAA 2B2VC 1GHJA 2ZTEA 4HIMA 3CKIB 3CQZB 1STGA 1KNAA 4A75A 2F4VQ 4UAIA 1TY0A 3K5NA 1ZXTA 4C3HG 1LTGD 1V1QA 1PLFA 2L5TA 4Q5VA 4GKJL 1LT3D 3GTOH 3LGJA 1HFGA 2VB2X 5KNBA 2UUAL 4HMJA 4JBJA 1A62A 5TSSA 4IPDA 1I6HH 1YJNA 4E6IA 1FYCA 2M2LA 1EY9A 5FLXc 1F2YA 3CCJA 4C3IH 2E5LL 3S1QH 2SNSA 3A54A 4HJAA 3S14B 4HJ8A 1JOOA 1UNSA 3CCEA 1MBYA 1FD7D 1ENFA 3HGBA 2R93B 4R8IA 1IHZA 1LTRD 4A3BB 2AQ2B 1WTQA 4QUCA 3R2TA 2CWPA 2R92H 2EYOA 2KCCA 2HCCA 3AFQA 4NXNQ 1CQFA 1CQVA 1EFID 2EYHA 5ELNA 2AWOA 1S72A 3RZDB 5M5XB 3SXHA 3ONAB 4C1NK 2B63G 2BDNA 1XWEA 4DR1L 1Q81C 2QW7A 2G5DA 2LXJA 1SDFA 1VQ8A 1IBML 1LT4D 4IFDH 1X3GA 1NR2A 2CQOA 3AU7A 2HD3A 1KNEA 1V8QA 4CDCC 1KABA 3C46A 2B2WA 3DEPA 1SYFA 2PI2A 4NP5A 3RLNA 4DAYB 3I4NH 1YZ6A 1KDAA 2L12A 1K83B 4L5TA 4JI8Q 1HNZL 3K81C 3V05A 5IYBG 4JYAL 3RLFA 1DZ1A 4OELB 1NBWA 4JI0Q 3PUWA 4DR6L 3NTIA 1JE4A 1E3PA 4OO1G 1TY2A 2C9OA 3JAMc 4B3SQ 2DUDA 4BXXG 4WJ4A 3OIPA 1TWAH 4UP7A 2I0QA 5G3LD 4X64Q 4QQBX 1IL2A 2KBNA 4L63B 1J8IA 4DUYL 2AMCB 5IT9c 3DWQA 4FXKC 4A3FB 1TT2A 3H09A 1JWMD 3ZJYC 2WP8J 1WD0A 2QKIC 1A63A 1EQQA 3D6WA 4DKAC 3H3VH 4WJWA 4QUFA 4IUTA 5FO9B 5C4JB 2VUMG 3I8ZA 2A73B 1UEBA 4X65L 1EYAA 4NW2A 4K6LA 1PH6A 3FMCA 3VR3A 4DF7A 5C0XH 1S4ZA 2FMMA 4NDXA 1NTGA 1CKNB 4IUUA 1QZHA 2NVQB 2Q2UA 5ELFA 2A6EC 1Q46A 4RCOA 4DV0Q 2ES2A 4KHVA 3I4MH 4A3JH 3I55A 1RD9D 3ND8A 5CC4A 2BE5C 3QOLA 4IQZA 4OIJA 3W2DA 1GHKA 5M3MH 4GLAC 4HIOA 2QDLA 1K8MA 1PH3A 1BQQT 1AW7A 2EY5A 2A6HC 4DV7L 4LFAQ 3HOYH 3GTOB 3TMEA 3E5SA 1U9RA 4ZK9B 1N34Q 2LSSA 4R4CA 3M85A 4A3EH 1I6HB 2JA6H 4DR7L 3D4WA 2YYZA 1HXYD 1NSNS 2NTTA 1TQOA 3PSIA 4HSPA 3UE1A 4JBWA 3S1QB 1SBBB 2B2YA 1B3QA 2RF4A 3N52A 3S1MH 1LLRD 3RR5A 2BE5D 2K05A 3E6ZX 3G6JB 1VQLA 3AB9A 3VA5A 5IWAL 1L1OB 2MPMA 3WOEA 5IYDG 2R92B 1B9NA 3F1ZA 2A6HD 4LFCQ 3CAMA 2VQFL 3OWFA 2EJMA 3Q0AA 3J7YW 1STEA 1G51A 4RKBA 4NKLA 1Q8IA 2IX1A 3J81i 4JI7L 5GQOA 4LF5L 1IYUA 1I4RA 1NCVA 2A1AA 3N6RA 1S5CD 2HUGA 1PZKD 2A69C 5K36G 4KI0A 4PNYA 5LMUL 4GKJQ 1K8OA 3SDZA 1U5KA 2KENA 3CU7A 2KCTA 2UUAQ 4K14A 1JR0D 4PQXA 5I6YA 3LX0A 1FVIA 1KRSA 1LTBD 2B8FA 5IP7G 3GP7A 1TKWB 2F0TA 2HDLA 3I4NB 3T1YL 3ND9A 3PUYA 2E5LQ 1STBA 1C7YA 1HH2P 5KNCA 1HUMA 2YTYA 5J39A 4KLKA 4OX9L 2N78A 3M7NA 2Z1CA 1IW7C 4UHVA 4IUQA 3R93A 4F88A 5E4XA 4GNXB 5JEAJ 5IODA 2MQHA 4Y52H 2CH4A 4BY1H 5C6AA 4JOIC 2XGTA 2GN5A 4KJOA 4JG2A 5JEAH 1TWAB 1AZQA 4H13C 3K5LA 3PCOB 1Y1WG 1L1OA 3NEMA 5FO7B 1LTLA 3DM3A 3L0OA 5KGUA 5L37A 3K7AH 1L0XB 1F9PA 3PUXA 1WTHA 4DR1Q 4QF4A 1F9SA 4C3HH 1B4OA 2NN6I 3VYTA 1IBMQ 4LNQA 2PW7A 2LFNA 4YIJA 1IW7D 3HEJA 1DCZA 4K2LA 3ULLA 4JV5L 3I70A 2E2HB 1A6XA 1YBYA 4EQ5A 3BYTB 2K75A 2JE6I 2D0PA 1SEBD 4JI4L 4P73A 1BXTA 1VQEA 1B9MA 3I4MB 1BR9A 1CZGA 3UDIA 1CA6A 4A3JB 1HNZQ 1V1OA 4FF1A 4JYAQ 2EVBA 3ULPA 3SK5A 2K5NA 4HSVA 5BN4A 3L7ZC 2JA5G 2K28A 5CV4A 5M3MB 3QR8A 3BVZA 2J7ZA 3C3LA 2F0LA 4R8NA 4QCLA 3IRBA 2FINB 3MEHA 4GNXA 3WWVA 1QILA 1H9JA 4MNOA 1DOMA 4RKLA 2OWOA 5HGQA 2GA4B 5JVG3 4B3TL 5EBDA 2B2TC 4IUPA 3HP3A 4A3EB 1MJCA 2JA6B 5COYA 1RTOA 3OSOA 3S1RH 1DYQA 3HKSA 1SMYC 1BCPD 2KQ3A 2SDFA 2WB1B 3MAQA 5E3FA 1P16A 1RCVD 2EY2A 2OQ0A 3S1MB 4QJFA 5C3EG 4Z9CB 2EPBA 4DV3L 1YNND 4RH6A 1VQOA 4HCEA 1I4XA 1S5DD 3CRKC 4DV1L 3PIPA 4A3CH 5C4HA 1D5XC 1VQMA 2IL8A 2J4XA 3D4RA 2PPBC 5IYBH 1ASZA 5D65A 4CHTB 4OO1H 1X56A 2KHIA 3OTOL 1ZKOA 3ITPA 3PGZA 2XWJB 3T53B 4BXXH 1QVCA 1XPUA 3OIQA 4FP5D 1C9OA 1TWGH 2JN4A 1PH4A 1CUKA 1BNZA 3HOZG 3FDTA 3E0JA 2M00A 1ZYRD 5ELDA 2K04A 2JQOA 1EQVA 1YITA 3HKZG 2E76C 2PQAB 2ZTDA 4LJZC 4DR7Q 1BBUA 4JC0A 3K0YA 2D9UA 4RHRA 4GOPB 2VUMH 4FXDA 2SEBD 3A55A 2YU9H 4G7ZC 1AZPA 4A93H 1Y8OB 2K7VA 2R6GA 3UDFA 1SSOA 3FVQA 3SK4A 2QGQA 1FGBD 2KEDA 3VR4A 5IWAQ 4BY1B 2E2DC 5DLQE 2BDOA 4B3RQ 4EQPA 1QVFA 3Q24A 4QY7A 3D6CA 3PQIA 1JOQA 4ILWA 3CCSA 1IBKL 4TVAB 3E3XA 4V0BA 2EYPA 2WB1E 4DNIA 5DEHA 3MXNB 4DV5L 1FNVA 3K7AB 1AFPA 4L5SA 2EXDA 1A0IA 4JI7Q 4LF5Q 1KC8C 1IBLL 5M5WH 3PIOA 1VQCA 2L11A 3HRZC 4C3HB 2L0CA 2Q2TA 2JJQA 2ZXOA 2PO4A 5IGCA 1YNJC 2Q8RE 5LMUQ 1SE4A 2PZTA 3Q6SA 3U4VA 1EEFD 5JPMC 2L9HA 1CKOA 4QIWE 4S3SA 3KF8B 4CGYB 2BOSA 2FHTA 4IN3A 2R61A 1X55A 2PQAA 1N36L 2Z6KC 4OX9Q 1F2LA 4XYQA 5C4ZA 4GOPA 2F3VA 4BY7G 3KLSA 5IYDH 3U9OA 2K5WA 1PYWD 3KLRA 1SE2A 3ER0A 2ICEC 1UEAB 2EDGA 2VZAA 2VW9A 1QNKA 1UUPA 4P75A 1CFMA 4LF7L 3S24A 1XYIA 4HIKA 1MJEA 3SEBA 3MVVA 3S1RB 4H44C 1I4QA 1I3QH 3J80i 5J1ZA 5A35A 3MXNA 1VQNA 3BU2A 5K36H 3STBC 4UPAA 2DNCA 1G291 1B70B 1KDCA 1G6PA 2VNUD 1ICFB 4I65A 4JV5Q 5IP7H 2K6AA 2X69A 4DK6C 1D1IA 2VB3X 3HOWG 4X3KA 1EIGA 1LTAD 4KY7A 2K5QA 4JI4Q 1RL2A 3WOFA 1PH7A 1PTOD 2G9DA 4PV1C 3KF8A 1K9MC 3BDLA 1H9MA 3W1BA 1EU4A 4C3JG 2F0OA 3PUZA 1TWHH 3AYHB 3CMEA 2NYZD 3A74A 1PMRA 4ZLTF 1SMXA 4OIKA 1ML0D 2R7ZG 2C35B 2AHOB 3CMAA 1TWGB 2ZXRA 1Y1WH 3F2BA 1IZ6A 1WFQA 2NZ1D 1U0LA 4RAUC 4J6HA 4AH6A 1SJED 4B3TQ 2WAQG 4IFDI 1M4VA 2DY7A 1LYLA 1QUQB 2VUMB 1VQ7A 2YU9B 2J0TD 3HOVG 4A93B 2UU9Q 3VYRA 2AUKA 2IJ0A 1GO3E 2F4IA 5CV7A 4DV3Q 1EYDA 5DM73 5FK9C 1CHPD 3JAML 4AIMA 4DV1Q 1HTLD 2AKWB 4CJ0B 2PNRC 4WFN3 4JI3L 2RCNA 3S16H 2JA5H 4RA8A 3I7FA 3A8IE 3OTOQ 1D7QA 4DV4L 1G8ZD 5M5WB 3KF6B 3KK7A 1PA6A 1U4RA 1VQ4A 1PFNA 1NUCA 5IGEA 5JVH3 3S2HH 1IKMA 1STAA 1EY4A 1KAAA 1VQGA 2UUBL 3Q23A 5CV8A 1X54A 4K0KL 1Q12A 3H3VI 5EGTA 4FO2A 1WTXA 1BF4A 4M8AA 2EYLA 3RUZA 4H02A 1EIFA 2JA9A 2B2UA 5C0XI 3CXCA 5C3EH 1XPOA 3LNNA 4KTAA 1Q8KA 1YEZA 5K5PA 1HR0L 4LW1A 1EOVA 4AYBG 3PIO3 1STYA 1MD2D 4DXFA 1W2BA 2MO1A 4GLXA 5I4DA 2OTLA 1VQ6A 1QNUA 3NBHA 2EOTA 3K5OA 4DNRB 4ZKCB 1B8AA 2KCMA 3BZCA 1Q86C 1SE3A 4HN7A 1MSGA 1X3QA 1Y8NB 2Z9HA 4DV5Q 2KUMA 1F9RA 1SROA 5EPKA 5EPJA 1UE1A 2PYKA 2V4DA 1XMQL 1G2SA 2DJGC 2HIVA 3M4QA 3FKIH 1IBLQ 3KBXA 1I3QB 4IOCA 1QZGA 1D8LA 4OWWB 3U9SA 1WCMG 2F0HA 3TP5A 1U4LA 3KDFB 4LMQD 2DN8A 4YY3L 3HOZH 3CCQA 2MUYA 4UY8C 4KY5A 2ENBA 5IGDA 2EZVA 3KF6A 4DR5L 3A0JA 1H95A 1ESFA 2UXCL 2TSSA 3C2PA 3IFTA 3CW2C 4A3GG 1FJGQ 1PRTC 3C1FA 4XQQA 1V9PA 1TS3A 2EY6A 3LWEA 3SK8A 1B1ZA 2GVBA 4DUZL 1H9SB 1I4GA 2DY8A 1RF2D 3I73A 3M7GA 2F0GA 2KVMA 3NTKA 2JA7H 3CCLA 1N36Q 2HHHQ 4PMWA 1HR0W 1EL0A 1SNPA 2IX3A 5I6WA 3S1NH 1TWHB 1SYGA 1K0SA 3NQIA 4TRDA 3W5OA 1E0BA 4RGNA 3UI2A 1O7IA 4JBMA 1Y1WB 4F87A 4G7HC 2B8GA 4DK0A 1Y1VG 2PMZB 3A5UA 1BBXC 4JI2L 4LUZA 2WACA 5DAUA 4LF7Q 5FJ8G 1U4PA 3BDOA 3LWUA 4NPSA 4XT3B 2Z4IA 1CTMA 1HZBA 1O80A 2UXDL 4PMCA 5JJKA 4OXPA 1BCPB 3EVQA 1VQ9A 2B29A 5IGBA 4OWXB 1XJVA 1I50H 2I5LX 1VQKA 4JCVE 1VF7A 1KL9A 4DGZA 1OXUA 3KDFA 3NQTA 1UE7A 3TN2A 3T16A 5LMNQ 1IKLA 3HOUG 4C2MH 1M8AA 1VS0A 1S5ED 4DAYA 2F0NA 1SYDA 1PTOH 3S16B 2JA5B 1DOLA 4A3KG 5BN3A 1H9SA 3K5MA 4BY7H 1LTID 1HHVA 3OPOA 4HCSA 5IGFA 1QWYA 3EQLC 4DPGA 1GVPA 1SYCA 3S2HB 4G4KA 2E2IH 3NBIA 4J8QA 3MA2B 2RDHA 4DR4L 1EYGA 2MFIA 2QDBA 2A6ED 1ZEQX 5IGGA 4EX5A 4C3IB 3SE0A 4ZRZA 2NZOA 3K7UC 5DNFA 3GTPH 3A5ZB 1A3VA 1WJJA 2OXPA 4GN3B 3VYSA 5CV6A 4DR3L 2HIXA 1BVSA 2O4XA 4TQUS 4K5XA 1JJCB 5C3EB 4B3ML 4CDFC 4A3IG 3TP6A 1HFNA 2EYMA 1GKHA 2PMZE 3GQBA 2B2WC 2PQEA 1S5BD 4KKUA 1B3AA 3HOWH 3DEOA 4XTCS 3R8BA 1CKNA 4G57A 1JJ2A 3CCRA 4HTHA 2KHJA 1EZ8A 2OEOA 1EOTA 3K58A 4JI3Q 3NELA 4ALPA 1JWUD 4C3JH 4CKBA 4DK3C 4JI6L 4B9XA 4XDXA 4DV4Q 2D0OA 3FKIB 3URYA 1J5EL 1OTCA 4BBSG 2XRQD 4OONA 3VDYA 4JK1C 2PW5A 1BOSA 3HOZB 1DM0B 1UE5A 2UUBQ 1MSHA 5E1FA 3J80c 1EY0A 5FOBB 3HKZB 3J7AF 2SNMA 1EIHA 4CJ2C 2P5ZX 2EYFA 2BH2A 1SNOA 1R4PB 2HDMA 2NVYH 2AWNA 4EQOA 3HOVH 2D5DA 2JA7B 5GAEC 4I7AA 2ATWA 3GTJH 1YIJA 1Q1EA 3P7JA 4YCWA 2Q8IB 3OHXC 3FPPA 4F8MA 4YCUA 1HR0Q 4B08A 1EQRA 1RTNA 2WKCA 2OCEA 1SNQA 5HY6A 4QMGA 3S1NB 2A69D 2K5DA 1V43A 2XRSD 5LL6S 2Z6BA 1LV9A 4KV6A 4OO1I 2JEBI 4DXGA 1YHBA 3HOXG 2F0VA 1EEID 3NE5B 1HRJA 4EGVA 2JEAI 1MGSA 4IOAA 1PRTF 4YWLA 1XMQQ 3Q22A 1XNRL 4L8JA 2Z0SA 2JK8A 4K5VA 3OW2A 2IX0A 2IY5B 4YY3Q 1GD7A 3H0GG 3BG3A 4ZYSA 5HURA 1I50B 2XTIA 3BYYB 2A68C 1VMCA 4DR5Q 4POGA 3A8KE 4LF6L 4BA2I 4L6TB 1EU3A 4FYDA 1E1TA 2UXCQ 1Z7TA 4C56C 3EBEA 3A7AB 1LUZA 1RIPA 2WKDA 1XPRA 2XSCA 2RQXA 5CGKA 4JW0A 1EWCA 1IXRA 1W6KA 4C2MB 3VR6A 2B2YC 4DUZQ 2ZXPA 4ZKBB 4CKCA 2DGYA 3MFYA 4DR6Q 4KMUC 1PTOB 4QGUA 2CW0C 2EYJA 2EQSA 1TS4A 4XQNA 2RHSB 2Q2IA 4BY7B 4ZUJA 3H6MA 3HKZE 4YWKA 4OEMB 2QILA 3G71A 3HOYB 4IO9A 2BH8A 2N55A 4MZ9A 2B63H 3FP9A 5C5LA 4DUYQ 1STHA 1OXXK 1RJTA 1WI5A 1TR5A 2A68D 3GV3A 2I07B 3UDXA 4NB3A 4K8IA 4LWCA 1QG7A 4JI2Q 4XXEA 4HJ5A 1ILPA 1G91A 4A3DG 3GTPB 3GO5A 3OOCA 4Q0FA 1TS5A 4X3UA 3OMCA 1WCMH 4M1UB 2UXDQ 1EWHA 4X65Q 4IALA 1W6JA 4F7XA 1J6QA 1KTKA 3ERSX 3KUPA 5GADC 3U4ZA 3G48A 3Q8DA 4IPCA 1WTRA 1QE6A 4NMZA 3E0EA 4OWTB 4NXML 3VR5A 1K0RA 1A8VA 1Z47A 3D8GA 1Q7YC 4JVZA 1LACA 3PV0A 4JI1L 1GUGA 5C44G 1NAPA 3KYHC 4X3SA 4QIWB 3GTKH 4ZUIA 1SYEA 5FO8B 1E22A 2ZTCA 5FKAC 2Z4HA 4C3JB 1SMYD 1JOKA 1I94L 3M3YH 5CV5A 3HZXA 4HR7B 4N9TA 4DV7Q 3K59A 3PO3G 3U58A 1KD1C 2F0JA 3SVMA 2XN9C 1L1OC 1B2TA 3EROA 2L15A 1Y1VH 2EE1A 2RSNA 4DR4Q 5IYCG 2WAQB 1G2TA 2YTXA 5CR3A 1XTDA 2CWAA 1SNMA 1VCIA 2E8GA 1JB3A 4ME3A 4FNFA 4DR3Q 2NVYB 2QEJC 3J81E 3HOVB 2R3ZA 1WTPA 5T1IA 2I46A 1D2BA 3GTJB 3T51B 4IPHA 4B3MQ 4JI5L 5KRUA 1HNWL 1HZ9A 2UXBL 2ID0A 3RNUA 1F2ZA 3NP8A 2F0QA 2VY3A 2KECA 2EJGC 1W3SA 3HG9A 1X9NA 2RA4A 4LF8L 3AMUA 2VQFQ 1HNXL 2NVXH 4R4OA 3IKJA 3J81L 2MP1A 4U673 5M3FG 4A3KH 1ICWA 1NJIC 3KLWA 4HIDA 1KAWA 2O5IC 2N49A 4JI6Q 4DV6L 2ALYB 3QO2A 4WJ3M 1PFMA 1J5EQ 1O7YA 4GNXC 1HQRD 1T5EA 2QF7A 3GTLH 1D6EC 2KJXA 1V1PB 3DXJC 2BA0A 2IHFA 2JA8G 4R9WA 5C4XG 3RN5A 2RDFA 3DUZA 3T1YQ 4X66L 1LT6D 4IJLA 3VYUA 4BWGB 5C0XG 4A3IH 3CP0A 2DJFC 2OQKA 5FLXE 4AYBB 4G7OC 4KHPL 1N33L 3H3VC 5JPNC 2WAQE 1A2UA 2K1BA 1C0AA 1YNJD 2FJ2A 4DA2A 2B2VA 1G6ZA 4R4TA 2VL6A 2MNAA 3D0FA 1EY5A 2K4KA 3D3RA 2R7FA 1UAPA 4R4QA 2B63B 1LTTD 1X3FA 2M9VA 3R3OA 4JBKA 4B3SL 5T1GA 1I4HA 5FLXL 1VQ5A 3MXPA 2K01A 1FNUA 5BN5A 1QCBD 1PYSB 3CC4A 5IP9G 3P20A 2F0MA 3FHWA 4HMIA 3T56B 1XNRQ 2HT1A 1IYJB 4BBSH 3S15H 2CKZB 1WCMB 1E24A 3K8AA 3DLLA 4GLVB 4CKEA 1MIUA 2NVTH 4MN3A 5C5MA 2FMCA 1RKNA 2F0FA 4IZ8A 1BCPF 1FGUA 2F52A 4C1NI 3PUVA 3AFPA 4BBRG 1C4QA 2JSOA 1KQSA 3L9AX 3M3YB 3F2UA 1D5MC 1XMOL 5FLMG 3GDEA 1YI2A 3STBD 3GD7A
chains in the Genus database with same CATH topology
3MFGA 1ET6A 1XTCD 1Y1VB 3JAME 3X3MA 5A2QE 1TVXA 3IL8A 1CZWA 1HA6A 3M4YA 1B53A 3DHQA 3D31A 2AQ1B 5M9OA 2F03A 2JYOA 2CHBD 5IT9E 2F0SA 3MTSA 4MIUA 2VXWA 5A2QL 2PZWA 1PFBA 4RWSC 4KK7A 2NVXB 1XX8A 5I9PA 2KHSA 5IT9L 2C5CA 1GUSA 4MHEA 1O78A 4A3KB 3TDQA 4UDUC 4RHSA 3P1HA 4LAAA 1X3PA 2RVLA 5AFWA 4BS9A 1Q3LA 3GTLB 5ISRA 3C1EA 3S9WA 3H94A 4DNTB 1FNWA 2ZT9C 1WTWA 4KD4A 2RBMA 1Q90A 1J9OA 1LTSD 1C8CA 3R2IA 3VR2A 1SNDA 4FXGC 2FFKB 1RHPA 1ET9A 3MWYW 4A3IB 3CRLC 4X3TA 2WINB 1Q1BA 2HQEA 2CQAA 1SXTA 1A15A 4RGOS 4FF3A 3BDCA 1LABA 1DXMA 2EY1A 1E2ZA 5CBEE 2F0EA 1IYVA 2E74C 5NUCA 1GJXA 2RSOA 1BO0A 4BBSB 2F0IA 3S15B 5EQ0A 4IUVA 1GUTA 4IFDJ 4B9WA 3BS1A 2NVTB 1H9RA 3TP8A 1HTPA 2XVSA 4U68A 1B44D 2SOBA 1O7LA 4RFBA 2L55A 1RODA 3NWTA 3MHBA 4IUNA 3FRPB 5I2XA 4KN7C 2L4NA 1DOKA 2AUJD 3J80E 5ELEA 1GXDC 2F0PA 4DN4M 2K03A 3QWNA 3TBIB 5EPLA 1E2VA 1PTOF 1PZID 1VF5C 3OMGA 5JOBA 3J7AV 3GTGB 2MJ8A 3HOXB 3J80L 1PRTD 3I3CA 5KYIA 1RDPD 4GZYC 3WDNA 3QB3A 4WRDA 2NN6G 3K6OA 1PDQA 3X3NA 1AN8A 3H0GB 3I4LA 4EVOA 3DWPA 5E4WC 4J1MA 3QJYA 5KIXA 1F9QA 5C0XJ 3TZDA 4K5WA 1ESRA 1EY8A 2BA1A 2B2UC 4DU9A 1CI3M 3L3OC 3TZUA 5CYUA 5C3WA 1OO9B 3MZ5A 4ZAIA 2D62A 4RGTA 1E2WA 3QOJA 5EKIA 1BDOA 1MI2A 1OXSC 2KA7A 1DJRD 1TWFB 4A3DB 3V96A 5LL6X 4KD3A 1ONLA 5D3IB 1H9KA 1O7ZA 2KCNA 5KYLA 3NHHA 1FR3A 1VDZA 4WORA 4KKTA 1OXTA 4TSSA 5KNDA 5C44B 1HCZA 1DD2A 2MGSA 1R4QB 2XNAC 3CHBD 5EKLA 4ABNA 2F0DA 4KJNA 2B2TA 2IPKD 4K8JA 3PO3B 3GTQB 4QB4A 3SR1A 5CBAE 3OW7A 1R9TB 1EQTA 1ENCA 2D2CC 2BCOA 1OXVA 5KEEA 3DMUA 3NK9A 2MHVA 1GUOA 2JXMB 1F77A 3NTHA 2DNEA 2WIIB 1SAPA 3K57A 1HA5A 1KLGD 3GV6A 4CJ1B 2F1MA 1KLUD 5IIFA 4PMBA 3I72A 3RD4A 3S2DB 1STNA 4KKSA 5M3FB 2B39A 4BA1I 2TMPA 2K32A 5G3LF 2JP1A 4ID6A 5ELCA 1TWCB 1KDBA 5I2YA 1C48A 3TSSA 4FF4A 1TU2B 4OGQC 3FPUB 3FEWX 1DONA 3M4OB 2JA8B 4LK1C 5C4XB 4XYOA 4P2CB 2O2LD 2OT2A 4HEDA 1CT1D 3MXGA 5ELBA 1PXUA 3RMHA 4N9PA 1Z6HA 1BCPC 4XQJA 3NSWA 2E2IB 5CMDA 1QB5D 5DM63 1A2TA 3SHLA 1YNNC 2QCPX 4IURA 3MXUA 1SYBA 2A5HA 1Y8PB 3IAYA 5JJZA 4DK1A 2NBFA 2EJFC 2XIWA 1AEXA 5HGTA 4DAVA 5EJWA 2CW0D 5LHY1 1AP0A 1EY6A 3ZYYX 4C3IG 1I6VC 3A8JE 2KOLA 4I7ZC 3HOWB 3QG1A 2PZUA 1BUVT 3QIAA 2EXZA 1SNCA 4XIGS 1ZYRC 3KLSX 5D14A 4BBRB 5IOCA 1D1KA 1SJHD 3NXWA 1GOZA 2H1EA 3T4AC 2R7ZB 1WTVA 3ERQA 4KHZA 2F0WA 2RDGA 2Q8TA 5CV9A 4IFDG 5EKKA 1PZJD 3EA6A 2Y0SB 4K2KA 2PCFB 2LS01 3GTMB 3BVMA 1VMPA 2NN6H 2F3WA 4A3MB 3S17B 1LT5D 4OHJA 3SK6A 2NTSA 2E75C 5F2DA 3IFDA 3NWSA 1HQMC 4FVMA 4K6DA 3MC0B 2E2JB 3BZDB 2NUCA 1IL8A 2OF1A 4DAPA 5C3XA 5D3DA 5EBCA 1CA5A 3TP7A 1U4MA 5I9OA 1EY7A 4ZQ3A 3BVGA 1D5ZC 3I90A 3PMFA 2G9HD 3P75A 4EQNA 5J22A 1JWSD 3O13A 1GUWA 3T13A 2AQ3B 1ILQA 1JORA 3I91A 1NR4A 2WV6D 1CK1A 3PO2B 2O5JC 1ENAA 3OWEB 2LMCB 3RZOB 2ICIA 4RGMA 2XWBB 1A3TA 4H7BA 3VA7A 1WVLA 2H4OA 3DM1A 2IWHA 3EFXD 1T5XD 2X6LA 4Y7NB 1PRTB 1WD1A 1JCKB 4ODGA 5CORA 4ULLA 1PTOC 2A74C 1II3A 2NB0A 2NWGA 3G7LA 4A3GB 1JC7A 4CBVA 1CHQD 1V1PA 3HS0C 1A3UA 2IT1A 3W3AA 1WTOA 1B50A 1F2MA 2L1BA 3GTKB 4OL7A 1QJOA 1EZ6A 3H91A 1EYCA 4V190 2X6GA 2LKVA 4DFAA 2N88A 1S5FD 3A56A 4TKOB 4KY6A 3V2TA 2LY7A 2IW3A 3DWAA 1I4PA 1GUNA 2Z8LA 2K33A 1XXGA 2KEEA 1JICA 1HPCA 4ME5A 1Y69U 1QOHA 1X32A 3PIP3 1LO5D 3NUCA 4RCNA 3D4DA 1TS2A 3HOUB 1CM9A 4O42A 2F0KA 4XT1B 3EJIA 2CVRA 2HCIA 3KBGA 4KN4C 5M5YB 1SFOB 4HAEA 3NPPA 5JEAG 1HUNA 1L0YB 1JQYD 4FF2A 2F0UA 1TIID 4O1NA 5JAVA 3A7LA 2RKSA 4H0LC 2B2VC 1GHJA 3CKIB 3CQZB 1STGA 1KNAA 4UAIA 1TY0A 3K5NA 1ZXTA 4C3HG 1LTGD 1PLFA 2L5TA 4Q5VA 1LT3D 1HFGA 2VB2X 5KNBA 4HMJA 5TSSA 4E6IA 1FYCA 2M2LA 1EY9A 1F2YA 2SNSA 3A54A 3S14B 1JOOA 1UNSA 1MBYA 1FD7D 1ENFA 3HGBA 2R93B 4R8IA 1IHZA 1LTRD 4A3BB 2AQ2B 1WTQA 4QUCA 3R2TA 2EYOA 2KCCA 2HCCA 1CQFA 1CQVA 1EFID 2EYHA 2AWOA 3RZDB 5M5XB 3SXHA 3ONAB 4C1NK 2BDNA 1XWEA 1SDFA 1LT4D 4IFDH 1NR2A 3AU7A 1KNEA 1V8QA 1KABA 3C46A 2B2WA 3DEPA 1SYFA 4NP5A 1KDAA 2L12A 1K83B 3V05A 3RLFA 1DZ1A 3PUWA 3NTIA 1JE4A 4OO1G 1TY2A 2C9OA 3OIPA 5G3LD 4L63B 1J8IA 3DWQA 4FXKC 4A3FB 1TT2A 3H09A 1JWMD 2WP8J 1WD0A 2QKIC 3D6WA 4WJWA 4QUFA 4IUTA 5FO9B 5C4JB 3I8ZA 2A73B 1EYAA 4NW2A 4K6LA 3FMCA 3VR3A 4DF7A 5C0XH 1S4ZA 2FMMA 4NDXA 4IUUA 2NVQB 5ELFA 2A6EC 4RCOA 4KHVA 1RD9D 3ND8A 5CC4A 2BE5C 3QOLA 4IQZA 4OIJA 3W2DA 1GHKA 1K8MA 1BQQT 1AW7A 2EY5A 2A6HC 3GTOB 3TMEA 3E5SA 1U9RA 4ZK9B 3M85A 1I6HB 3D4WA 2YYZA 1HXYD 1NSNS 2NTTA 1TQOA 4HSPA 4JBWA 3S1QB 1SBBB 2B2YA 3N52A 1LLRD 2BE5D 2K05A 3E6ZX 3G6JB 3AB9A 3VA5A 2MPMA 3WOEA 2R92B 1B9NA 2A6HD 3OWFA 2EJMA 3Q0AA 3J7YW 1STEA 4RKBA 4NKLA 1Q8IA 2IX1A 1IYUA 1I4RA 1NCVA 3N6RA 1S5CD 2HUGA 1PZKD 2A69C 5K36G 4KI0A 4PNYA 1K8OA 3SDZA 3CU7A 4K14A 1JR0D 5I6YA 4PQXA 3LX0A 1LTBD 2B8FA 3GP7A 1TKWB 2F0TA 2HDLA 3I4NB 3ND9A 3PUYA 1STBA 5KNCA 1HUMA 5J39A 3M7NA 2Z1CA 1IW7C 4IUQA 3R93A 4F88A 5E4XA 5JEAJ 5IODA 5C6AA 4KJOA 5JEAH 1TWAB 1AZQA 4H13C 3K5LA 5FO7B 5KGUA 1L0XB 1F9PA 3PUXA 4QF4A 1F9SA 1B4OA 2NN6I 3VYTA 2PW7A 2LFNA 4YIJA 1IW7D 3HEJA 1DCZA 4K2LA 3I70A 2E2HB 1A6XA 3BYTB 2JE6I 1SEBD 1BXTA 1B9MA 3I4MB 1BR9A 1CZGA 1CA6A 4A3JB 1V1OA 4FF1A 2EVBA 3SK5A 5BN4A 4HSVA 3L7ZC 2K28A 5CV4A 5M3MB 3BVZA 2J7ZA 3C3LA 2F0LA 4R8NA 4QCLA 3MEHA 2FINB 1QILA 1H9JA 1DOMA 4RKLA 5JVG3 2GA4B 5EBDA 2B2TC 4IUPA 3HP3A 4A3EB 2JA6B 5COYA 1RTOA 3OSOA 1DYQA 1SMYC 1BCPD 2KQ3A 2SDFA 2WB1B 3MAQA 5E3FA 1RCVD 2EY2A 3S1MB 4Z9CB 2EPBA 1YNND 4RH6A 4HCEA 1I4XA 1S5DD 3CRKC 5C4HA 1D5XC 2IL8A 2J4XA 3D4RA 2PPBC 5D65A 4CHTB 4OO1H 1ZKOA 3ITPA 2XWJB 3T53B 3OIQA 4FP5D 1BNZA 3FDTA 3E0JA 2M00A 1ZYRD 5ELDA 2K04A 1EQVA 2E76C 4LJZC 3K0YA 2D9UA 4RHRA 4FXDA 2SEBD 3A55A 4G7ZC 1AZPA 1Y8OB 2K7VA 2R6GA 1SSOA 3FVQA 3SK4A 1FGBD 2KEDA 3VR4A 4BY1B 2E2DC 2BDOA 4EQPA 3Q24A 3D6CA 1JOQA 4ILWA 4V0BA 2EYPA 5DEHA 1FNVA 3K7AB 1AFPA 2L11A 3HRZC 4C3HB 2L0CA 2ZXOA 2PO4A 5IGCA 1YNJC 2Q8RE 1SE4A 2PZTA 3Q6SA 1EEFD 5JPMC 2L9HA 4S3SA 4CGYB 2BOSA 2FHTA 4IN3A 2R61A 1F2LA 4XYQA 5C4ZA 2F3VA 3KLSA 3U9OA 2K5WA 1PYWD 3KLRA 1SE2A 2ICEC 1UEAB 2EDGA 1QNKA 1UUPA 1CFMA 1XYIA 3SEBA 3MVVA 3S1RB 4H44C 1I4QA 5J1ZA 5A35A 3MXNA 5K36H 2DNCA 1G291 1KDCA 2VNUD 4I65A 2K6AA 2X69A 1D1IA 2VB3X 4X3KA 1EIGA 1LTAD 4KY7A 2K5QA 3WOFA 1PTOD 2G9DA 4PV1C 3KF8A 3BDLA 1H9MA 1EU4A 4C3JG 2F0OA 3PUZA 2NYZD 1PMRA 4ZLTF 4OIKA 1ML0D 1TWGB 2ZXRA 2NZ1D 4RAUC 4J6HA 1SJED 4IFDI 1M4VA 2DY7A 2VUMB 2YU9B 2J0TD 4A93B 3VYRA 2AUKA 2IJ0A 2F4IA 5CV7A 1EYDA 5DM73 5FK9C 1CHPD 3JAML 1HTLD 4CJ0B 2PNRC 4WFN3 4RA8A 3A8IE 1G8ZD 5M5WB 3KK7A 1U4RA 1PFNA 1NUCA 5IGEA 5JVH3 1IKMA 1STAA 1EY4A 1KAAA 3Q23A 5CV8A 1Q12A 5EGTA 4FO2A 1WTXA 1BF4A 4M8AA 2EYLA 3RUZA 2B2UA 5C0XI 3LNNA 4KTAA 5K5PA 3PIO3 1STYA 1MD2D 4DXFA 5I4DA 1QNUA 4ZKCB 2EOTA 3K5OA 3NBHA 4DNRB 1SE3A 4HN7A 1MSGA 1X3QA 1Y8NB 2KUMA 1F9RA 5EPKA 5EPJA 2V4DA 2PYKA 1G2SA 3KBXA 1I3QB 3U9SA 2F0HA 3TP5A 1U4LA 4LMQD 2DN8A 2MUYA 4KY5A 2ENBA 5IGDA 2EZVA 1ESFA 2TSSA 3C2PA 3IFTA 1PRTC 3C1FA 4XQQA 1TS3A 2EY6A 3LWEA 3SK8A 1B1ZA 1H9SB 1I4GA 2DY8A 1RF2D 3I73A 3M7GA 2F0GA 2KVMA 3NTKA 4PMWA 1EL0A 1SNPA 2IX3A 5I6WA 1TWHB 1SYGA 3NQIA 4TRDA 1E0BA 4RGNA 3UI2A 1Y1WB 4F87A 4G7HC 2B8GA 4DK0A 2PMZB 1BBXC 2WACA 5DAUA 1U4PA 3BDOA 3LWUA 4XT3B 2Z4IA 1CTMA 1O80A 4PMCA 1BCPB 3EVQA 5IGBA 1VF7A 4DGZA 1OXUA 3NQTA 3TN2A 3T16A 1IKLA 1M8AA 1S5ED 4DAYA 2F0NA 1SYDA 1PTOH 3S16B 2JA5B 1DOLA 5BN3A 1H9SA 3K5MA 1LTID 1HHVA 3OPOA 4HCSA 5IGFA 1QWYA 3EQLC 1SYCA 3S2HB 4G4KA 3NBIA 4J8QA 3MA2B 2RDHA 2QDBA 2A6ED 1ZEQX 5IGGA 4C3IB 3SE0A 4ZRZA 5DNFA 1A3VA 2OXPA 3VYSA 5CV6A 2O4XA 4TQUS 4K5XA 5C3EB 3TP6A 1HFNA 2EYMA 3GQBA 2B2WC 2PQEA 1S5BD 4KKUA 1B3AA 3DEOA 4XTCS 3R8BA 4G57A 4HTHA 1EZ8A 2OEOA 1EOTA 3K58A 1JWUD 4CKBA 4B9XA 4XDXA 3FKIB 3URYA 2XRQD 4JK1C 2PW5A 1BOSA 3HOZB 1DM0B 1MSHA 5E1FA 1EY0A 5FOBB 3HKZB 3J7AF 2SNMA 1EIHA 4CJ2C 2EYFA 1SNOA 1R4PB 2HDMA 2AWNA 4EQOA 2D5DA 2JA7B 1Q1EA 3P7JA 2Q8IB 3OHXC 3FPPA 4F8MA 4B08A 1RTNA 2WKCA 1SNQA 4QMGA 3S1NB 2A69D 2K5DA 1V43A 2XRSD 5LL6S 1LV9A 4KV6A 4OO1I 2JEBI 4DXGA 2F0VA 1EEID 3NE5B 1HRJA 4EGVA 2JEAI 1MGSA 1PRTF 3Q22A 4L8JA 4K5VA 2IX0A 3BG3A 4ZYSA 5HURA 1I50B 3BYYB 2A68C 1VMCA 3A8KE 4BA2I 4L6TB 1EU3A 4FYDA 1Z7TA 4C56C 3A7AB 2WKDA 2XSCA 2RQXA 5CGKA 1EWCA 1W6KA 4C2MB 3VR6A 2B2YC 2ZXPA 4ZKBB 4CKCA 3MFYA 4KMUC 1PTOB 2CW0C 2EYJA 1TS4A 4XQNA 4BY7B 4ZUJA 3H6MA 2QILA 3HOYB 2N55A 5C5LA 1STHA 1OXXK 1RJTA 1TR5A 2A68D 3GV3A 2I07B 4K8IA 1QG7A 4XXEA 1ILPA 1G91A 3GTPB 3GO5A 3OOCA 4Q0FA 1TS5A 4X3UA 3OMCA 4M1UB 1EWHA 4IALA 1W6JA 4F7XA 1KTKA 3KUPA 1WTRA 1QE6A 4NMZA 3VR5A 1Z47A 3D8GA 1LACA 3PV0A 1GUGA 1NAPA 4X3SA 4QIWB 4ZUIA 1SYEA 5FO8B 5FKAC 2Z4HA 4C3JB 1SMYD 1JOKA 5CV5A 3HZXA 4HR7B 4N9TA 3K59A 2F0JA 3SVMA 2XN9C 1B2TA 3EROA 2RSNA 2EE1A 2WAQB 1G2TA 5CR3A 1SNMA 1VCIA 1JB3A 4FNFA 2NVYB 2QEJC 3J81E 3HOVB 2R3ZA 1WTPA 5T1IA 2I46A 1D2BA 3GTJB 3T51B 5KRUA 2ID0A 1F2ZA 3NP8A 2F0QA 2KECA 2EJGC 3HG9A 2RA4A 3AMUA 3IKJA 3J81L 2MP1A 4U673 1ICWA 2O5IC 3QO2A 1PFMA 1O7YA 1HQRD 1T5EA 2QF7A 1D6EC 2KJXA 1V1PB 3DXJC 2BA0A 4R9WA 2RDFA 3DUZA 1LT6D 3VYUA 4BWGB 5C0XG 5FLXE 4AYBB 4G7OC 3H3VC 5JPNC 1A2UA 2K1BA 1YNJD 2FJ2A 4DA2A 2B2VA 1G6ZA 1EY5A 3D3RA 1UAPA 2B63B 1LTTD 2M9VA 3R3OA 5T1GA 1I4HA 5FLXL 3MXPA 2K01A 1FNUA 5BN5A 1QCBD 3P20A 2F0MA 4HMIA 3T56B 1WCMB 4CKEA 4MN3A 5C5MA 2FMCA 1RKNA 2F0FA 4IZ8A 1BCPF 4C1NI 3PUVA 1C4QA 2JSOA 3L9AX 3M3YB 3F2UA 1D5MC 3GD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDL A;  1ICW A;  3G7L A;  1BO0 A;  2M2L A;  4NW2 A;  4CJ0 B;  1EOT A;  1F2L A;  1VMP A;  5EQ0 A;  1HUM A;  2N55 A;  1S4Z A;  2FMM A;  4IUV A;  2IL8 A;  3FPU B;  3QO2 A;  4IUU A;  1WTO A;  1DON A;  1PFM A;  1RJT A;  4IUQ A;  3R93 A;  1B50 A;  1E0B A;  3GV3 A;  4XDX A;  5E4X A;  1O7Y A;  4RA8 A;  2L1B A;  1TVX A;  5D65 A;  3IL8 A;  3UI2 A;  1HA6 A;  4U68 A;  1QG7 A;  1ILP A;  1G91 A;  1O7Z A;  1B53 A;  4HED A;  4R8I A;  3H91 A;  1BBX C;  2JYO A;  1ROD A;  1QNK A;  4X3U A;  1WTQ A;  1U4R A;  2X6G A;  1PFN A;  4QUC A;  1AZQ A;  4R9W A;  3MTS A;  4OIJ A;  1IKM A;  1U4P A;  2N88 A;  2VXW A;  2HCC A;  1MSH A;  1XYI A;  4XT3 B;  3IFD A;  1O80 A;  2L4N A;  3KUP A;  1DOK A;  1EIH A;  4CJ2 C;  1BNZ A;  1F9P A;  3FDT A;  1WTR A;  3ONA B;  1PFB A;  1QE6 A;  1WTX A;  1BF4 A;  1EL0 A;  4RWS C;  4DN4 M;  1F9S A;  2HDM A;  2BDN A;  1XX8 A;  2K03 A;  2K04 A;  2MGS A;  5CMD A;  4ZK9 B;  1IL8 A;  1B4O A;  3P7J A;  2B2U A;  4MHE A;  5EPL A;  1NAP A;  4IUR A;  2K1B A;  2B2T A;  1SDF A;  2D9U A;  2FJ2 A;  3TN2 A;  2B2V A;  1RTN A;  4X3S A;  1CA5 A;  1G6Z A;  1IKL A;  2KEE A;  1NR2 A;  2X69 A;  1M8A A;  5CBA E;  1JIC A;  2MJ8 A;  1AZP A;  1U4M A;  1EQT A;  5JJZ A;  4X3K A;  1EIG A;  1LV9 A;  2XIW A;  1X3P A;  3I3C A;  1KNE A;  2B2Y A;  3I90 A;  1X32 A;  1SSO A;  3N52 A;  5T1G A;  1DOL A;  2RVL A;  5AFW A;  5EJW A;  2B2W A;  1AP0 A;  1Q3L A;  2K01 A;  2KED A;  2K05 A;  3DEP A;  3SVM A;  1GUW A;  1CA6 A;  1HHV A;  4ZKC B;  1PDQ A;  1ILQ A;  2EOT A;  2KOL A;  2L12 A;  1HRJ A;  4HCS A;  1CM9 A;  4HSV A;  4O42 A;  3I91 A;  1MGS A;  1NR4 A;  1B2T A;  1MSG A;  1X3Q A;  2NYZ D;  4XT1 B;  2MPM A;  2EE1 A;  2KUM A;  2K28 A;  2RSN A;  1F9R A;  1DZ1 A;  5EPK A;  2CVR A;  2HCI A;  4OIK A;  5EPJ A;  4ZLT F;  5E4W C;  1ML0 D;  1G2S A;  1G2T A;  1WTW A;  1SAP A;  4HAE A;  1J9O A;  1JE4 A;  2J7Z A;  3GV6 A;  3KBX A;  4MN3 A;  4CJ1 B;  1C8C A;  1F9Q A;  2FIN B;  1HUN A;  2FFK B;  5D14 A;  1RHP A;  3TZD A;  1DOM A;  1U4L A;  2NZ1 D;  3MWY W;  4LMQ D;  4RAU C;  1ESR A;  5DNF A;  1VMC A;  2L11 A;  1WVL A;  4X3T A;  2R3Z A;  2B2U C;  1WTP A;  1NCV A;  5T1I A;  2B2T C;  2DY7 A;  2H1E A;  2B2V C;  4IUP A;  3DM1 A;  2HUG A;  3HP3 A;  2Q8R E;  1WTV A;  5COY A;  1RTO A;  1J8I A;  1KNA A;  2X6L A;  1A15 A;  3Q6S A;  4UAI A;  1HFN A;  2KEC A;  1ZXT A;  2B2Y C;  4ZAI A;  1WD1 A;  4ZKB B;  2L9H A;  1PLF A;  2RA4 A;  2SDF A;  3LWE A;  3F2U A;  5COR A;  2B2W C;  2DY8 A;  2JP1 A;  1HFG A;  2Q8T A;  1WD0 A;  5EKI A;  1B3A A;  2KVM A;  5CBE E;  3DEO A;  3D6W A;  4QUF A;  2FHT A;  4IUT A;  2MP1 A;  1MI2 A;  2NWG A;  3I8Z A;  2EPB A;  2RSO A; 
#chains in the Genus database with same CATH topology
 2B3G A;  3UDG A;  3MFG A;  5EAY A;  3GTG H;  4DR2 L;  4J15 A;  1ET6 A;  3HOX H;  1XTC D;  1Y1V B;  3JAM E;  3X3M A;  5A2Q E;  3SGI A;  4AYB E;  2Y0S G;  1TVX A;  3IL8 A;  1YHA A;  1CZW A;  1HA6 A;  3M4Y A;  3T1H L;  1B53 A;  3DHQ A;  3D31 A;  2AQ1 B;  3I2Z A;  5M9O A;  4GKK L;  4FDB A;  4N8X 1;  2F03 A;  2JYO A;  2CHB D;  5IT9 E;  4A3M G;  3H0G H;  1JT8 A;  2F0S A;  3MTS A;  3KJP A;  4MIU A;  2HQL A;  2VXW A;  1T9H A;  2GVA A;  5J3B A;  4A76 A;  5A2Q L;  2PNH A;  1K3B C;  2PZW A;  3I56 A;  1PFB A;  4RWS C;  4KK7 A;  2NVX B;  1XX8 A;  1EUJ A;  5I9P A;  4GN5 A;  3RLO A;  2UUC L;  2KHS A;  5IT9 L;  2C5C A;  1GUS A;  4MHE A;  1O78 A;  4A3K B;  3TDQ A;  4UDU C;  4GOP C;  4RHS A;  1I94 Q;  1ASY A;  3P1H A;  3F2C A;  4LAA A;  1X3P A;  1JB7 A;  3J81 j;  2RVL A;  5AFW A;  4BS9 A;  1CSQ A;  1Q3L A;  3GTL B;  5JJI A;  1VQI A;  5ISR A;  3C1E A;  3S9W A;  4LUV A;  2H5X A;  4UP8 A;  3KJO A;  1TWF H;  3H94 A;  3CC7 A;  1PH8 A;  4DNT B;  4A3D H;  1FNW A;  2ZT9 C;  1WTW A;  1N9W A;  4KD4 A;  2RBM A;  1Q90 A;  1J9O A;  3E9H A;  1LTS D;  1C8C A;  3R2I A;  3VR2 A;  1QUQ A;  4FXG C;  1SND A;  2FFK B;  3AEV A;  1RHP A;  1ET9 A;  3MWY W;  4A3I B;  3CRL C;  2V1C C;  4LF9 L;  2N3S A;  2WIN B;  4X3T A;  3PO2 G;  4JI5 Q;  1HNW Q;  2UXB Q;  1PH5 A;  1Q1B A;  2HQE A;  2RHQ B;  2CQA A;  1SXT A;  1A15 A;  4RGO S;  5C44 H;  1IBK Q;  4FF3 A;  4LF8 Q;  3BDC A;  3G6E A;  1HNX Q;  1MKH A;  1LAB A;  1DXM A;  2EY1 A;  3MEF A;  4APV A;  1E2Z A;  5CBE E;  2F0E A;  1IYV A;  1VQB A;  2E74 C;  5NUC A;  1GJX A;  2RSO A;  3J7A 5;  2RCF A;  2CFM A;  1BO0 A;  1PYB A;  3PO3 H;  3GTQ H;  4DV6 Q;  1R9T H;  2F0I A;  4RMF A;  3S15 B;  4BBS B;  5EQ0 A;  4IUV A;  1GUT A;  4IFD J;  4B9W A;  3BS1 A;  2NVT B;  1H9R A;  3TP8 A;  5IYC H;  1HTP A;  2XVS A;  4U68 A;  1B44 D;  2SOB A;  1S40 A;  1O7L A;  4RFB A;  3TQY A;  2L55 A;  4P72 A;  3KFU A;  3TRE A;  1ROD A;  3NWT A;  3MHB A;  4P71 A;  4X66 Q;  4IUN A;  3FRP B;  5I2X A;  4KN7 C;  2L4N A;  1DOK A;  2AUJ D;  3J80 E;  5ELE A;  4A3C G;  1GXD C;  2F0P A;  4DN4 M;  4KHP Q;  1N33 Q;  2K03 A;  1YNX A;  3QWN A;  3TBI B;  1P8L A;  2QA4 A;  5EPL A;  1E2V A;  1K28 A;  2VS1 A;  1PTO F;  2PI2 E;  1PZI D;  1VF5 C;  3OMG A;  5JOB A;  3J7A V;  3S2D H;  3PF4 A;  5M3F H;  1KIX A;  3GTG B;  2MJ8 A;  3HOX B;  3J80 L;  1PRT D;  3I3C A;  3EN2 A;  5KYI A;  1RDP D;  3CPW A;  4GZY C;  1BBW A;  1TWC H;  3WDN A;  3QB3 A;  1E7Z A;  1SN8 A;  4WRD A;  3AQQ A;  2NN6 G;  5GRO A;  3K6O A;  1PDQ A;  3X3N A;  3TS2 A;  1AN8 A;  1KRT A;  3H0G B;  3I4L A;  3DWP A;  4EVO A;  5AJ3 L;  4PG3 A;  5E4W C;  4J1M A;  3M4O H;  2JA8 H;  3QJY A;  5C4X H;  4ZCK A;  5KIX A;  1F9Q A;  5C0X J;  4A93 G;  1N32 L;  4RG1 A;  3TZD A;  4K5W A;  1ESR A;  3CD6 A;  4DV2 L;  1SRU A;  1JE5 A;  1EY8 A;  1Z9F A;  2B2U C;  2BA1 A;  4JOI A;  2E2H H;  2R7D A;  4DU9 A;  4AQY L;  1CI3 M;  2A19 A;  3L3O C;  2LXK A;  3TZU A;  5CYU A;  5C3W A;  1OO9 B;  3MZ5 A;  1VQH A;  4L5R C;  4ZAI A;  3U50 C;  1XMO Q;  1WOC A;  2D62 A;  4PZ8 A;  3TRZ A;  4RGT A;  1E2W A;  3QOJ A;  5EKI A;  1BDO A;  1MI2 A;  1OXS C;  2KA7 A;  4YWM A;  4DR2 Q;  1DJR D;  1TWF B;  3TEH B;  4GN4 B;  4IJH A;  1FL0 A;  4A3D B;  5IP9 H;  3V96 A;  2CCZ A;  5LL6 X;  2N8N A;  3T1H Q;  4KD3 A;  4GKK Q;  1PH2 A;  1ONL A;  5D3I B;  1H9K A;  1O7Z A;  2KCN A;  3TS0 A;  4A3L G;  1L2F A;  1K3R A;  5KYL A;  3NHH A;  1X3E A;  1FR3 A;  1X6O A;  3F8T A;  1VDZ A;  4WOR A;  4KKT A;  1OXT A;  1NMG A;  4TSS A;  2R93 G;  5KND A;  5C44 B;  4R1J A;  4A3B G;  4BBR H;  1HCZ A;  4O0A A;  2UUC Q;  1PH9 A;  1DD2 A;  1EWI A;  2MGS A;  1R4Q B;  4B3R L;  2XNA C;  3CHB D;  5EKL A;  4ABN A;  2ZJP A;  2R7Z H;  2F0D A;  4KJN A;  2B2T A;  4DAM A;  2IPK D;  5FLM H;  1NMF A;  4K8J A;  4HJ9 A;  3PO3 B;  3GTQ B;  4QB4 A;  3SR1 A;  2Q2H A;  3OW7 A;  5CBA E;  1R9T B;  2OTJ A;  5H1S E;  1EQT A;  1ENC A;  1AE2 A;  2D2C C;  4K0K Q;  2BCO A;  1OXV A;  5KEE A;  3DMU A;  3NK9 A;  2MHV A;  1SE8 A;  1GUO A;  2JXM B;  3GTM H;  1VQJ A;  1F77 A;  3NTH A;  2DNE A;  3CCM A;  3M9B A;  4A3M H;  4CDE C;  3S17 H;  2WII B;  1SAP A;  3K57 A;  1HA5 A;  1VQD A;  1KLG D;  2WFW A;  3GV6 A;  4CJ1 B;  2F1M A;  2ZM6 L;  4JPB W;  4LUO A;  4LF9 Q;  4YCV A;  1TXY A;  1KLU D;  3G4S A;  5IIF A;  4PMB A;  4POF A;  3EIV A;  3I72 A;  3RD4 A;  1K73 C;  3S2D B;  1STN A;  3BJU A;  4KKS A;  5M3F B;  2B39 A;  2ZJR A;  4BA1 I;  2E2J H;  4YHH L;  4LFB L;  2TMP A;  2K32 A;  5G3L F;  2JP1 A;  4ID6 A;  5ELC A;  1TWC B;  1KDB A;  5I2Y A;  4LF4 L;  1C48 A;  1PVO A;  3B6Y A;  4A3F G;  3TSS A;  4FF4 A;  4N8F A;  1TU2 B;  4P74 A;  4OGQ C;  3FPU B;  1YJ9 A;  4PZ6 A;  3FEW X;  1DON A;  3M4O B;  2JA8 B;  5JJL A;  4LK1 C;  5C4X B;  4XYO A;  4P2C B;  2O2L D;  2OT2 A;  4PZ7 A;  4GS3 A;  4HED A;  5E7N A;  1CT1 D;  3MXG A;  5ELB A;  1PXU A;  3RMH A;  1VQF A;  1S3O A;  5GAG C;  3PO2 H;  3KOJ A;  1I5F A;  4N9P A;  3RZO H;  1Z6H A;  1BCP C;  4XQJ A;  3NSW A;  1XNQ L;  2E2I B;  4CDD C;  5CMD A;  1NNX A;  1QB5 D;  5DM6 3;  2IHE A;  1A2T A;  3SHL A;  1YNN C;  2QCP X;  1UWV A;  4IUR A;  3MXU A;  1N8R C;  1SYB A;  2A5H A;  1E1O A;  1NE3 A;  4Y7N H;  3CPF A;  1X65 A;  1Y8P B;  3IAY A;  4DK1 A;  5JJZ A;  2NBF A;  2EJF C;  2XIW A;  4X62 L;  1AEX A;  5HGT A;  2K52 A;  1YVC A;  4DAV A;  1AE3 A;  2YV5 A;  5EJW A;  2CW0 D;  3JC6 6;  5LHY 1;  1AP0 A;  1KXL A;  1EY6 A;  3W1G A;  3ZYY X;  1I6V C;  4C3I G;  3A8J E;  2KOL A;  4A3G H;  5AJ3 Q;  2K50 A;  2Z6K A;  4I7Z C;  5BR8 L;  3HOW B;  3QG1 A;  2UU9 L;  2PZU A;  1BUV T;  3QIA A;  2EXZ A;  1SNC A;  1N32 Q;  1YJW A;  3CCV A;  1Q82 C;  5ELO A;  2CH4 W;  4XIG S;  4DV2 Q;  1ZYR C;  3KLS X;  5D14 A;  3HFZ B;  4BBR B;  5IOC A;  2ZJQ A;  2R92 G;  4AQY Q;  1D1K A;  1SJH D;  3I4O A;  3NXW A;  4MTK A;  1GOZ A;  1PV4 A;  3JAM i;  2H1E A;  3T4A C;  2R7Z B;  3K0X A;  3E9I A;  1KHI A;  3K80 C;  2VQE L;  1WTV A;  1AH9 A;  3ERQ A;  4KHZ A;  2ASB A;  1VQA A;  2F0W A;  2F4V L;  1M90 C;  2RDG A;  4MTN A;  2Q8T A;  5FJ8 H;  3FKI G;  5CV9 A;  4IFD G;  5EKK A;  1BKB A;  3CCU A;  1CSP A;  1PZJ D;  3EA6 A;  2Y0S B;  4K2K A;  2PCF B;  2LS0 1;  1HZC A;  1JMC A;  3GTM B;  4QL5 A;  3BVM A;  1VMP A;  2NN6 H;  2F3W A;  4A3M B;  3S17 B;  1LT5 D;  3I4N G;  2K5H A;  4OHJ A;  3SK6 A;  1JJG A;  1Y14 B;  2K5V A;  2NTS A;  3HOU H;  2E75 C;  5F2D A;  2JA7 G;  3L2P A;  5GAH C;  3NEN A;  5M5Y H;  3IFD A;  1SFO H;  3NWS A;  1HQM C;  4FVM A;  4K6D A;  4NXN L;  3MC0 B;  2YTV A;  2E2J B;  3BZD B;  2NUC A;  1UE6 A;  1IL8 A;  1M1K C;  2OF1 A;  4DAP A;  5C3X A;  5D3D A;  3CQZ H;  5EBC A;  1CA5 A;  4R4I A;  3TP7 A;  1U4M A;  5I9O A;  1EY7 A;  4ZQ3 A;  3BVG A;  3ULJ A;  1D5Z C;  3I90 A;  3PMF A;  2G9H D;  3P75 A;  4EQN A;  5J22 A;  1JWS D;  3O13 A;  1GUW A;  3T13 A;  2AQ3 B;  1ILQ A;  1JOR A;  3I91 A;  1NR4 A;  2WV6 D;  4IPG A;  1VQP A;  1FJG L;  4A3L H;  1CK1 A;  4JI8 L;  3S14 H;  3PO2 B;  2ZM6 Q;  1QVG A;  1ENA A;  3OWE B;  3I4M G;  2O5J C;  2LMC B;  3RZO B;  2ICI A;  4RGM A;  4A3J G;  1HJP A;  4JI0 L;  2NZH A;  2R93 H;  2Y0S E;  2XWB B;  1PH1 A;  2HHH L;  1A3T A;  4H7B A;  3VA7 A;  1WVL A;  3UE0 A;  4A3B H;  5M3M G;  1L0W A;  2H4O A;  3CC2 A;  3DM1 A;  2IWH A;  3EFX D;  4X64 L;  1YHQ A;  1T5X D;  2X6L A;  4Y7N B;  3RZD H;  1PRT B;  3HOY G;  4LFB Q;  5M5X H;  4YHH Q;  5IY0 A;  1WD1 A;  1GM5 A;  1DGS A;  1JCK B;  4ODG A;  4A4I A;  5COR A;  3CF5 A;  1PTO C;  4ULL A;  2A74 C;  1II3 A;  4A3E G;  4LF4 Q;  2JA6 G;  2NB0 A;  1CKM A;  2NWG A;  1PFS A;  4LF6 Q;  3G7L A;  2WB1 G;  4A3G B;  1JC7 A;  4CBV A;  1CHQ D;  3OYY A;  2QEX A;  1V1P A;  3HS0 C;  1PHJ A;  1EFW A;  4L5Q A;  1A3U A;  2IT1 A;  3J7Z C;  3W3A A;  1WTO A;  3RN2 A;  1B50 A;  1F2M A;  2I5H A;  2L1B A;  1EIY B;  3GTK B;  3M4P A;  4X6A H;  4OL7 A;  1QJO A;  1EZ6 A;  3H91 A;  4DV0 L;  1K83 H;  1EYC A;  4V19 0;  2X6G A;  5LMN L;  2LKV A;  4DFA A;  2N88 A;  1S5F D;  3A56 A;  4TKO B;  4KY6 A;  1XNQ Q;  2F3I A;  3V2T A;  2LY7 A;  2IW3 A;  3F2D A;  2I5M X;  3DWA A;  1I4P A;  1NY4 A;  3ICE A;  1MHW C;  4LFA L;  1SR3 A;  1GUN A;  5IE8 A;  2Z8L A;  1N34 L;  2A8V A;  2K33 A;  1XXG A;  3PF5 A;  2KEE A;  1B7Y B;  4X62 Q;  3J81 c;  1JIC A;  1HPC A;  2K14 A;  4ME5 A;  1WYD A;  1Y69 U;  1QOH A;  4A3F H;  1X32 A;  1K8A C;  3PIP 3;  1LO5 D;  2EIF A;  3NUC A;  2FXQ A;  4NXM Q;  1LM0 A;  5C4J H;  4RCN A;  3D4D A;  4HJ7 A;  1TS2 A;  5BR8 Q;  3HOU B;  4JI1 Q;  1CM9 A;  4O42 A;  1K8G A;  2F0K A;  4XT1 B;  3EJI A;  1SLJ A;  2CVR A;  2HCI A;  3KBG A;  4KN4 C;  4UP9 A;  5M5Y B;  4BY1 G;  2NVQ H;  1SFO B;  4HAE A;  3NPP A;  3NBH B;  5JEA G;  4LFC L;  2MO0 A;  1HUN A;  3H15 A;  1L0Y B;  1JQY D;  4FF2 A;  5LMN W;  2F0U A;  1TII D;  4O1N A;  5JAV A;  3A7L A;  2RKS A;  4O2D A;  4H0L C;  3BZK A;  2VQE Q;  1HZA A;  2B2V C;  1GHJ A;  2ZTE A;  4HIM A;  3CKI B;  3CQZ B;  1STG A;  1KNA A;  4A75 A;  2F4V Q;  4UAI A;  1TY0 A;  3K5N A;  1ZXT A;  4C3H G;  1LTG D;  1V1Q A;  1PLF A;  2L5T A;  4Q5V A;  4GKJ L;  1LT3 D;  3GTO H;  3LGJ A;  1HFG A;  2VB2 X;  5KNB A;  2UUA L;  4HMJ A;  4JBJ A;  1A62 A;  5TSS A;  4IPD A;  1I6H H;  1YJN A;  4E6I A;  1FYC A;  2M2L A;  1EY9 A;  5FLX c;  1F2Y A;  3CCJ A;  4C3I H;  2E5L L;  3S1Q H;  2SNS A;  3A54 A;  4HJA A;  3S14 B;  4HJ8 A;  1JOO A;  1UNS A;  3CCE A;  1MBY A;  1FD7 D;  1ENF A;  3HGB A;  2R93 B;  4R8I A;  1IHZ A;  1LTR D;  4A3B B;  2AQ2 B;  1WTQ A;  4QUC A;  3R2T A;  2CWP A;  2R92 H;  2EYO A;  2KCC A;  2HCC A;  3AFQ A;  4NXN Q;  1CQF A;  1CQV A;  1EFI D;  2EYH A;  5ELN A;  2AWO A;  1S72 A;  3RZD B;  5M5X B;  3SXH A;  3ONA B;  4C1N K;  2B63 G;  2BDN A;  1XWE A;  4DR1 L;  1Q81 C;  2QW7 A;  2G5D A;  2LXJ A;  1SDF A;  1VQ8 A;  1IBM L;  1LT4 D;  4IFD H;  1X3G A;  1NR2 A;  2CQO A;  3AU7 A;  2HD3 A;  1KNE A;  1V8Q A;  4CDC C;  1KAB A;  3C46 A;  2B2W A;  3DEP A;  1SYF A;  2PI2 A;  4NP5 A;  3RLN A;  4DAY B;  3I4N H;  1YZ6 A;  1KDA A;  2L12 A;  1K83 B;  4L5T A;  4JI8 Q;  1HNZ L;  3K81 C;  3V05 A;  5IYB G;  4JYA L;  3RLF A;  1DZ1 A;  4OEL B;  1NBW A;  4JI0 Q;  3PUW A;  4DR6 L;  3NTI A;  1JE4 A;  1E3P A;  4OO1 G;  1TY2 A;  2C9O A;  3JAM c;  4B3S Q;  2DUD A;  4BXX G;  4WJ4 A;  3OIP A;  1TWA H;  4UP7 A;  2I0Q A;  5G3L D;  4X64 Q;  4QQB X;  1IL2 A;  2KBN A;  4L63 B;  1J8I A;  4DUY L;  2AMC B;  5IT9 c;  3DWQ A;  4FXK C;  4A3F B;  1TT2 A;  3H09 A;  1JWM D;  3ZJY C;  2WP8 J;  1WD0 A;  2QKI C;  1A63 A;  1EQQ A;  3D6W A;  4DKA C;  3H3V H;  4WJW A;  4QUF A;  4IUT A;  5FO9 B;  5C4J B;  2VUM G;  3I8Z A;  2A73 B;  1UEB A;  4X65 L;  1EYA A;  4NW2 A;  4K6L A;  1PH6 A;  3FMC A;  3VR3 A;  4DF7 A;  5C0X H;  1S4Z A;  2FMM A;  4NDX A;  1NTG A;  1CKN B;  4IUU A;  1QZH A;  2NVQ B;  2Q2U A;  5ELF A;  2A6E C;  1Q46 A;  4RCO A;  4DV0 Q;  2ES2 A;  4KHV A;  3I4M H;  4A3J H;  3I55 A;  1RD9 D;  3ND8 A;  5CC4 A;  2BE5 C;  3QOL A;  4IQZ A;  4OIJ A;  3W2D A;  1GHK A;  5M3M H;  4GLA C;  4HIO A;  2QDL A;  1K8M A;  1PH3 A;  1BQQ T;  1AW7 A;  2EY5 A;  2A6H C;  4DV7 L;  4LFA Q;  3HOY H;  3GTO B;  3TME A;  3E5S A;  1U9R A;  4ZK9 B;  1N34 Q;  2LSS A;  4R4C A;  3M85 A;  4A3E H;  1I6H B;  2JA6 H;  4DR7 L;  3D4W A;  2YYZ A;  1HXY D;  1NSN S;  2NTT A;  1TQO A;  3PSI A;  4HSP A;  3UE1 A;  4JBW A;  3S1Q B;  1SBB B;  2B2Y A;  1B3Q A;  2RF4 A;  3N52 A;  3S1M H;  1LLR D;  3RR5 A;  2BE5 D;  2K05 A;  3E6Z X;  3G6J B;  1VQL A;  3AB9 A;  3VA5 A;  5IWA L;  1L1O B;  2MPM A;  3WOE A;  5IYD G;  2R92 B;  1B9N A;  3F1Z A;  2A6H D;  4LFC Q;  3CAM A;  2VQF L;  3OWF A;  2EJM A;  3Q0A A;  3J7Y W;  1STE A;  1G51 A;  4RKB A;  4NKL A;  1Q8I A;  2IX1 A;  3J81 i;  4JI7 L;  5GQO A;  4LF5 L;  1IYU A;  1I4R A;  1NCV A;  2A1A A;  3N6R A;  1S5C D;  2HUG A;  1PZK D;  2A69 C;  5K36 G;  4KI0 A;  4PNY A;  5LMU L;  4GKJ Q;  1K8O A;  3SDZ A;  1U5K A;  2KEN A;  3CU7 A;  2KCT A;  2UUA Q;  4K14 A;  1JR0 D;  4PQX A;  5I6Y A;  3LX0 A;  1FVI A;  1KRS A;  1LTB D;  2B8F A;  5IP7 G;  3GP7 A;  1TKW B;  2F0T A;  2HDL A;  3I4N B;  3T1Y L;  3ND9 A;  3PUY A;  2E5L Q;  1STB A;  1C7Y A;  1HH2 P;  5KNC A;  1HUM A;  2YTY A;  5J39 A;  4KLK A;  4OX9 L;  2N78 A;  3M7N A;  2Z1C A;  1IW7 C;  4UHV A;  4IUQ A;  3R93 A;  4F88 A;  5E4X A;  4GNX B;  5JEA J;  5IOD A;  2MQH A;  4Y52 H;  2CH4 A;  4BY1 H;  5C6A A;  4JOI C;  2XGT A;  2GN5 A;  4KJO A;  4JG2 A;  5JEA H;  1TWA B;  1AZQ A;  4H13 C;  3K5L A;  3PCO B;  1Y1W G;  1L1O A;  3NEM A;  5FO7 B;  1LTL A;  3DM3 A;  3L0O A;  5KGU A;  5L37 A;  3K7A H;  1L0X B;  1F9P A;  3PUX A;  1WTH A;  4DR1 Q;  4QF4 A;  1F9S A;  4C3H H;  1B4O A;  2NN6 I;  3VYT A;  1IBM Q;  4LNQ A;  2PW7 A;  2LFN A;  4YIJ A;  1IW7 D;  3HEJ A;  1DCZ A;  4K2L A;  3ULL A;  4JV5 L;  3I70 A;  2E2H B;  1A6X A;  1YBY A;  4EQ5 A;  3BYT B;  2K75 A;  2JE6 I;  2D0P A;  1SEB D;  4JI4 L;  4P73 A;  1BXT A;  1VQE A;  1B9M A;  3I4M B;  1BR9 A;  1CZG A;  3UDI A;  1CA6 A;  4A3J B;  1HNZ Q;  1V1O A;  4FF1 A;  4JYA Q;  2EVB A;  3ULP A;  3SK5 A;  2K5N A;  4HSV A;  5BN4 A;  3L7Z C;  2JA5 G;  2K28 A;  5CV4 A;  5M3M B;  3QR8 A;  3BVZ A;  2J7Z A;  3C3L A;  2F0L A;  4R8N A;  4QCL A;  3IRB A;  2FIN B;  3MEH A;  4GNX A;  3WWV A;  1QIL A;  1H9J A;  4MNO A;  1DOM A;  4RKL A;  2OWO A;  5HGQ A;  2GA4 B;  5JVG 3;  4B3T L;  5EBD A;  2B2T C;  4IUP A;  3HP3 A;  4A3E B;  1MJC A;  2JA6 B;  5COY A;  1RTO A;  3OSO A;  3S1R H;  1DYQ A;  3HKS A;  1SMY C;  1BCP D;  2KQ3 A;  2SDF A;  2WB1 B;  3MAQ A;  5E3F A;  1P16 A;  1RCV D;  2EY2 A;  2OQ0 A;  3S1M B;  4QJF A;  5C3E G;  4Z9C B;  2EPB A;  4DV3 L;  1YNN D;  4RH6 A;  1VQO A;  4HCE A;  1I4X A;  1S5D D;  3CRK C;  4DV1 L;  3PIP A;  4A3C H;  5C4H A;  1D5X C;  1VQM A;  2IL8 A;  2J4X A;  3D4R A;  2PPB C;  5IYB H;  1ASZ A;  5D65 A;  4CHT B;  4OO1 H;  1X56 A;  2KHI A;  3OTO L;  1ZKO A;  3ITP A;  3PGZ A;  2XWJ B;  3T53 B;  4BXX H;  1QVC A;  1XPU A;  3OIQ A;  4FP5 D;  1C9O A;  1TWG H;  2JN4 A;  1PH4 A;  1CUK A;  1BNZ A;  3HOZ G;  3FDT A;  3E0J A;  2M00 A;  1ZYR D;  5ELD A;  2K04 A;  2JQO A;  1EQV A;  1YIT A;  3HKZ G;  2E76 C;  2PQA B;  2ZTD A;  4LJZ C;  4DR7 Q;  1BBU A;  4JC0 A;  3K0Y A;  2D9U A;  4RHR A;  4GOP B;  2VUM H;  4FXD A;  2SEB D;  3A55 A;  2YU9 H;  4G7Z C;  1AZP A;  4A93 H;  1Y8O B;  2K7V A;  2R6G A;  3UDF A;  1SSO A;  3FVQ A;  3SK4 A;  2QGQ A;  1FGB D;  2KED A;  3VR4 A;  5IWA Q;  4BY1 B;  2E2D C;  5DLQ E;  2BDO A;  4B3R Q;  4EQP A;  1QVF A;  3Q24 A;  4QY7 A;  3D6C A;  3PQI A;  1JOQ A;  4ILW A;  3CCS A;  1IBK L;  4TVA B;  3E3X A;  4V0B A;  2EYP A;  2WB1 E;  4DNI A;  5DEH A;  3MXN B;  4DV5 L;  1FNV A;  3K7A B;  1AFP A;  4L5S A;  2EXD A;  1A0I A;  4JI7 Q;  4LF5 Q;  1KC8 C;  1IBL L;  5M5W H;  3PIO A;  1VQC A;  2L11 A;  3HRZ C;  4C3H B;  2L0C A;  2Q2T A;  2JJQ A;  2ZXO A;  2PO4 A;  5IGC A;  1YNJ C;  2Q8R E;  5LMU Q;  1SE4 A;  2PZT A;  3Q6S A;  3U4V A;  1EEF D;  5JPM C;  2L9H A;  1CKO A;  4QIW E;  4S3S A;  3KF8 B;  4CGY B;  2BOS A;  2FHT A;  4IN3 A;  2R61 A;  1X55 A;  2PQA A;  1N36 L;  2Z6K C;  4OX9 Q;  1F2L A;  4XYQ A;  5C4Z A;  4GOP A;  2F3V A;  4BY7 G;  3KLS A;  5IYD H;  3U9O A;  2K5W A;  1PYW D;  3KLR A;  1SE2 A;  3ER0 A;  2ICE C;  1UEA B;  2EDG A;  2VZA A;  2VW9 A;  1QNK A;  1UUP A;  4P75 A;  1CFM A;  4LF7 L;  3S24 A;  1XYI A;  4HIK A;  1MJE A;  3SEB A;  3MVV A;  3S1R B;  4H44 C;  1I4Q A;  1I3Q H;  3J80 i;  5J1Z A;  5A35 A;  3MXN A;  1VQN A;  3BU2 A;  5K36 H;  3STB C;  4UPA A;  2DNC A;  1G29 1;  1B70 B;  1KDC A;  1G6P A;  2VNU D;  1ICF B;  4I65 A;  4JV5 Q;  5IP7 H;  2K6A A;  2X69 A;  4DK6 C;  1D1I A;  2VB3 X;  3HOW G;  4X3K A;  1EIG A;  1LTA D;  4KY7 A;  2K5Q A;  4JI4 Q;  1RL2 A;  3WOF A;  1PH7 A;  1PTO D;  2G9D A;  4PV1 C;  3KF8 A;  1K9M C;  3BDL A;  1H9M A;  3W1B A;  1EU4 A;  4C3J G;  2F0O A;  3PUZ A;  1TWH H;  3AYH B;  3CME A;  2NYZ D;  3A74 A;  1PMR A;  4ZLT F;  1SMX A;  4OIK A;  1ML0 D;  2R7Z G;  2C35 B;  2AHO B;  3CMA A;  1TWG B;  2ZXR A;  1Y1W H;  3F2B A;  1IZ6 A;  1WFQ A;  2NZ1 D;  1U0L A;  4RAU C;  4J6H A;  4AH6 A;  1SJE D;  4B3T Q;  2WAQ G;  4IFD I;  1M4V A;  2DY7 A;  1LYL A;  1QUQ B;  2VUM B;  1VQ7 A;  2YU9 B;  2J0T D;  3HOV G;  4A93 B;  2UU9 Q;  3VYR A;  2AUK A;  2IJ0 A;  1GO3 E;  2F4I A;  5CV7 A;  4DV3 Q;  1EYD A;  5DM7 3;  5FK9 C;  1CHP D;  3JAM L;  4AIM A;  4DV1 Q;  1HTL D;  2AKW B;  4CJ0 B;  2PNR C;  4WFN 3;  4JI3 L;  2RCN A;  3S16 H;  2JA5 H;  4RA8 A;  3I7F A;  3A8I E;  3OTO Q;  1D7Q A;  4DV4 L;  1G8Z D;  5M5W B;  3KF6 B;  3KK7 A;  1PA6 A;  1U4R A;  1VQ4 A;  1PFN A;  1NUC A;  5IGE A;  5JVH 3;  3S2H H;  1IKM A;  1STA A;  1EY4 A;  1KAA A;  1VQG A;  2UUB L;  3Q23 A;  5CV8 A;  1X54 A;  4K0K L;  1Q12 A;  3H3V I;  5EGT A;  4FO2 A;  1WTX A;  1BF4 A;  4M8A A;  2EYL A;  3RUZ A;  4H02 A;  1EIF A;  2JA9 A;  2B2U A;  5C0X I;  3CXC A;  5C3E H;  1XPO A;  3LNN A;  4KTA A;  1Q8K A;  1YEZ A;  5K5P A;  1HR0 L;  4LW1 A;  1EOV A;  4AYB G;  3PIO 3;  1STY A;  1MD2 D;  4DXF A;  1W2B A;  2MO1 A;  4GLX A;  5I4D A;  2OTL A;  1VQ6 A;  1QNU A;  3NBH A;  2EOT A;  3K5O A;  4DNR B;  4ZKC B;  1B8A A;  2KCM A;  3BZC A;  1Q86 C;  1SE3 A;  4HN7 A;  1MSG A;  1X3Q A;  1Y8N B;  2Z9H A;  4DV5 Q;  2KUM A;  1F9R A;  1SRO A;  5EPK A;  5EPJ A;  1UE1 A;  2PYK A;  2V4D A;  1XMQ L;  1G2S A;  2DJG C;  2HIV A;  3M4Q A;  3FKI H;  1IBL Q;  3KBX A;  1I3Q B;  4IOC A;  1QZG A;  1D8L A;  4OWW B;  3U9S A;  1WCM G;  2F0H A;  3TP5 A;  1U4L A;  3KDF B;  4LMQ D;  2DN8 A;  4YY3 L;  3HOZ H;  3CCQ A;  2MUY A;  4UY8 C;  4KY5 A;  2ENB A;  5IGD A;  2EZV A;  3KF6 A;  4DR5 L;  3A0J A;  1H95 A;  1ESF A;  2UXC L;  2TSS A;  3C2P A;  3IFT A;  3CW2 C;  4A3G G;  1FJG Q;  1PRT C;  3C1F A;  4XQQ A;  1V9P A;  1TS3 A;  2EY6 A;  3LWE A;  3SK8 A;  1B1Z A;  2GVB A;  4DUZ L;  1H9S B;  1I4G A;  2DY8 A;  1RF2 D;  3I73 A;  3M7G A;  2F0G A;  2KVM A;  3NTK A;  2JA7 H;  3CCL A;  1N36 Q;  2HHH Q;  4PMW A;  1HR0 W;  1EL0 A;  1SNP A;  2IX3 A;  5I6W A;  3S1N H;  1TWH B;  1SYG A;  1K0S A;  3NQI A;  4TRD A;  3W5O A;  1E0B A;  4RGN A;  3UI2 A;  1O7I A;  4JBM A;  1Y1W B;  4F87 A;  4G7H C;  2B8G A;  4DK0 A;  1Y1V G;  2PMZ B;  3A5U A;  1BBX C;  4JI2 L;  4LUZ A;  2WAC A;  5DAU A;  4LF7 Q;  5FJ8 G;  1U4P A;  3BDO A;  3LWU A;  4NPS A;  4XT3 B;  2Z4I A;  1CTM A;  1HZB A;  1O80 A;  2UXD L;  4PMC A;  5JJK A;  4OXP A;  1BCP B;  3EVQ A;  1VQ9 A;  2B29 A;  5IGB A;  4OWX B;  1XJV A;  1I50 H;  2I5L X;  1VQK A;  4JCV E;  1VF7 A;  1KL9 A;  4DGZ A;  1OXU A;  3KDF A;  3NQT A;  1UE7 A;  3TN2 A;  3T16 A;  5LMN Q;  1IKL A;  3HOU G;  4C2M H;  1M8A A;  1VS0 A;  1S5E D;  4DAY A;  2F0N A;  1SYD A;  1PTO H;  3S16 B;  2JA5 B;  1DOL A;  4A3K G;  5BN3 A;  1H9S A;  3K5M A;  4BY7 H;  1LTI D;  1HHV A;  3OPO A;  4HCS A;  5IGF A;  1QWY A;  3EQL C;  4DPG A;  1GVP A;  1SYC A;  3S2H B;  4G4K A;  2E2I H;  3NBI A;  4J8Q A;  3MA2 B;  2RDH A;  4DR4 L;  1EYG A;  2MFI A;  2QDB A;  2A6E D;  1ZEQ X;  5IGG A;  4EX5 A;  4C3I B;  3SE0 A;  4ZRZ A;  2NZO A;  3K7U C;  5DNF A;  3GTP H;  3A5Z B;  1A3V A;  1WJJ A;  2OXP A;  4GN3 B;  3VYS A;  5CV6 A;  4DR3 L;  2HIX A;  1BVS A;  2O4X A;  4TQU S;  4K5X A;  1JJC B;  5C3E B;  4B3M L;  4CDF C;  4A3I G;  3TP6 A;  1HFN A;  2EYM A;  1GKH A;  2PMZ E;  3GQB A;  2B2W C;  2PQE A;  1S5B D;  4KKU A;  1B3A A;  3HOW H;  3DEO A;  4XTC S;  3R8B A;  1CKN A;  4G57 A;  1JJ2 A;  3CCR A;  4HTH A;  2KHJ A;  1EZ8 A;  2OEO A;  1EOT A;  3K58 A;  4JI3 Q;  3NEL A;  4ALP A;  1JWU D;  4C3J H;  4CKB A;  4DK3 C;  4JI6 L;  4B9X A;  4XDX A;  4DV4 Q;  2D0O A;  3FKI B;  3URY A;  1J5E L;  1OTC A;  4BBS G;  2XRQ D;  4OON A;  3VDY A;  4JK1 C;  2PW5 A;  1BOS A;  3HOZ B;  1DM0 B;  1UE5 A;  2UUB Q;  1MSH A;  5E1F A;  3J80 c;  1EY0 A;  5FOB B;  3HKZ B;  3J7A F;  2SNM A;  1EIH A;  4CJ2 C;  2P5Z X;  2EYF A;  2BH2 A;  1SNO A;  1R4P B;  2HDM A;  2NVY H;  2AWN A;  4EQO A;  3HOV H;  2D5D A;  2JA7 B;  5GAE C;  4I7A A;  2ATW A;  3GTJ H;  1YIJ A;  1Q1E A;  3P7J A;  4YCW A;  2Q8I B;  3OHX C;  3FPP A;  4F8M A;  4YCU A;  1HR0 Q;  4B08 A;  1EQR A;  1RTN A;  2WKC A;  2OCE A;  1SNQ A;  5HY6 A;  4QMG A;  3S1N B;  2A69 D;  2K5D A;  1V43 A;  2XRS D;  5LL6 S;  2Z6B A;  1LV9 A;  4KV6 A;  4OO1 I;  2JEB I;  4DXG A;  1YHB A;  3HOX G;  2F0V A;  1EEI D;  3NE5 B;  1HRJ A;  4EGV A;  2JEA I;  1MGS A;  4IOA A;  1PRT F;  4YWL A;  1XMQ Q;  3Q22 A;  1XNR L;  4L8J A;  2Z0S A;  2JK8 A;  4K5V A;  3OW2 A;  2IX0 A;  2IY5 B;  4YY3 Q;  1GD7 A;  3H0G G;  3BG3 A;  4ZYS A;  5HUR A;  1I50 B;  2XTI A;  3BYY B;  2A68 C;  1VMC A;  4DR5 Q;  4POG A;  3A8K E;  4LF6 L;  4BA2 I;  4L6T B;  1EU3 A;  4FYD A;  1E1T A;  2UXC Q;  1Z7T A;  4C56 C;  3EBE A;  3A7A B;  1LUZ A;  1RIP A;  2WKD A;  1XPR A;  2XSC A;  2RQX A;  5CGK A;  4JW0 A;  1EWC A;  1IXR A;  1W6K A;  4C2M B;  3VR6 A;  2B2Y C;  4DUZ Q;  2ZXP A;  4ZKB B;  4CKC A;  2DGY A;  3MFY A;  4DR6 Q;  4KMU C;  1PTO B;  4QGU A;  2CW0 C;  2EYJ A;  2EQS A;  1TS4 A;  4XQN A;  2RHS B;  2Q2I A;  4BY7 B;  4ZUJ A;  3H6M A;  3HKZ E;  4YWK A;  4OEM B;  2QIL A;  3G71 A;  3HOY B;  4IO9 A;  2BH8 A;  2N55 A;  4MZ9 A;  2B63 H;  3FP9 A;  5C5L A;  4DUY Q;  1STH A;  1OXX K;  1RJT A;  1WI5 A;  1TR5 A;  2A68 D;  3GV3 A;  2I07 B;  3UDX A;  4NB3 A;  4K8I A;  4LWC A;  1QG7 A;  4JI2 Q;  4XXE A;  4HJ5 A;  1ILP A;  1G91 A;  4A3D G;  3GTP B;  3GO5 A;  3OOC A;  4Q0F A;  1TS5 A;  4X3U A;  3OMC A;  1WCM H;  4M1U B;  2UXD Q;  1EWH A;  4X65 Q;  4IAL A;  1W6J A;  4F7X A;  1J6Q A;  1KTK A;  3ERS X;  3KUP A;  5GAD C;  3U4Z A;  3G48 A;  3Q8D A;  4IPC A;  1WTR A;  1QE6 A;  4NMZ A;  3E0E A;  4OWT B;  4NXM L;  3VR5 A;  1K0R A;  1A8V A;  1Z47 A;  3D8G A;  1Q7Y C;  4JVZ A;  1LAC A;  3PV0 A;  4JI1 L;  1GUG A;  5C44 G;  1NAP A;  3KYH C;  4X3S A;  4QIW B;  3GTK H;  4ZUI A;  1SYE A;  5FO8 B;  1E22 A;  2ZTC A;  5FKA C;  2Z4H A;  4C3J B;  1SMY D;  1JOK A;  1I94 L;  3M3Y H;  5CV5 A;  3HZX A;  4HR7 B;  4N9T A;  4DV7 Q;  3K59 A;  3PO3 G;  3U58 A;  1KD1 C;  2F0J A;  3SVM A;  2XN9 C;  1L1O C;  1B2T A;  3ERO A;  2L15 A;  1Y1V H;  2EE1 A;  2RSN A;  4DR4 Q;  5IYC G;  2WAQ B;  1G2T A;  2YTX A;  5CR3 A;  1XTD A;  2CWA A;  1SNM A;  1VCI A;  2E8G A;  1JB3 A;  4ME3 A;  4FNF A;  4DR3 Q;  2NVY B;  2QEJ C;  3J81 E;  3HOV B;  2R3Z A;  1WTP A;  5T1I A;  2I46 A;  1D2B A;  3GTJ B;  3T51 B;  4IPH A;  4B3M Q;  4JI5 L;  5KRU A;  1HNW L;  1HZ9 A;  2UXB L;  2ID0 A;  3RNU A;  1F2Z A;  3NP8 A;  2F0Q A;  2VY3 A;  2KEC A;  2EJG C;  1W3S A;  3HG9 A;  1X9N A;  2RA4 A;  4LF8 L;  3AMU A;  2VQF Q;  1HNX L;  2NVX H;  4R4O A;  3IKJ A;  3J81 L;  2MP1 A;  4U67 3;  5M3F G;  4A3K H;  1ICW A;  1NJI C;  3KLW A;  4HID A;  1KAW A;  2O5I C;  2N49 A;  4JI6 Q;  4DV6 L;  2ALY B;  3QO2 A;  4WJ3 M;  1PFM A;  1J5E Q;  1O7Y A;  4GNX C;  1HQR D;  1T5E A;  2QF7 A;  3GTL H;  1D6E C;  2KJX A;  1V1P B;  3DXJ C;  2BA0 A;  2IHF A;  2JA8 G;  4R9W A;  5C4X G;  3RN5 A;  2RDF A;  3DUZ A;  3T1Y Q;  4X66 L;  1LT6 D;  4IJL A;  3VYU A;  4BWG B;  5C0X G;  4A3I H;  3CP0 A;  2DJF C;  2OQK A;  5FLX E;  4AYB B;  4G7O C;  4KHP L;  1N33 L;  3H3V C;  5JPN C;  2WAQ E;  1A2U A;  2K1B A;  1C0A A;  1YNJ D;  2FJ2 A;  4DA2 A;  2B2V A;  1G6Z A;  4R4T A;  2VL6 A;  2MNA A;  3D0F A;  1EY5 A;  2K4K A;  3D3R A;  2R7F A;  1UAP A;  4R4Q A;  2B63 B;  1LTT D;  1X3F A;  2M9V A;  3R3O A;  4JBK A;  4B3S L;  5T1G A;  1I4H A;  5FLX L;  1VQ5 A;  3MXP A;  2K01 A;  1FNU A;  5BN5 A;  1QCB D;  1PYS B;  3CC4 A;  5IP9 G;  3P20 A;  2F0M A;  3FHW A;  4HMI A;  3T56 B;  1XNR Q;  2HT1 A;  1IYJ B;  4BBS H;  3S15 H;  2CKZ B;  1WCM B;  1E24 A;  3K8A A;  3DLL A;  4GLV B;  4CKE A;  1MIU A;  2NVT H;  4MN3 A;  5C5M A;  2FMC A;  1RKN A;  2F0F A;  4IZ8 A;  1BCP F;  1FGU A;  2F52 A;  4C1N I;  3PUV A;  3AFP A;  4BBR G;  1C4Q A;  2JSO A;  1KQS A;  3L9A X;  3M3Y B;  3F2U A;  1D5M C;  1XMO L;  5FLM G;  3GDE A;  1YI2 A;  3STB D;  3GD7 A; 
#chains in the Genus database with same CATH homology
 3MFG A;  1ET6 A;  1XTC D;  1Y1V B;  3JAM E;  3X3M A;  5A2Q E;  1TVX A;  3IL8 A;  1CZW A;  1HA6 A;  3M4Y A;  1B53 A;  3DHQ A;  3D31 A;  2AQ1 B;  5M9O A;  2F03 A;  2JYO A;  2CHB D;  5IT9 E;  2F0S A;  3MTS A;  4MIU A;  2VXW A;  5A2Q L;  2PZW A;  1PFB A;  4RWS C;  4KK7 A;  2NVX B;  1XX8 A;  5I9P A;  2KHS A;  5IT9 L;  2C5C A;  1GUS A;  4MHE A;  1O78 A;  4A3K B;  3TDQ A;  4UDU C;  4RHS A;  3P1H A;  4LAA A;  1X3P A;  2RVL A;  5AFW A;  4BS9 A;  1Q3L A;  3GTL B;  5ISR A;  3C1E A;  3S9W A;  3H94 A;  4DNT B;  1FNW A;  2ZT9 C;  1WTW A;  4KD4 A;  2RBM A;  1Q90 A;  1J9O A;  1LTS D;  1C8C A;  3R2I A;  3VR2 A;  1SND A;  4FXG C;  2FFK B;  1RHP A;  1ET9 A;  3MWY W;  4A3I B;  3CRL C;  4X3T A;  2WIN B;  1Q1B A;  2HQE A;  2CQA A;  1SXT A;  1A15 A;  4RGO S;  4FF3 A;  3BDC A;  1LAB A;  1DXM A;  2EY1 A;  1E2Z A;  5CBE E;  2F0E A;  1IYV A;  2E74 C;  5NUC A;  1GJX A;  2RSO A;  1BO0 A;  4BBS B;  2F0I A;  3S15 B;  5EQ0 A;  4IUV A;  1GUT A;  4IFD J;  4B9W A;  3BS1 A;  2NVT B;  1H9R A;  3TP8 A;  1HTP A;  2XVS A;  4U68 A;  1B44 D;  2SOB A;  1O7L A;  4RFB A;  2L55 A;  1ROD A;  3NWT A;  3MHB A;  4IUN A;  3FRP B;  5I2X A;  4KN7 C;  2L4N A;  1DOK A;  2AUJ D;  3J80 E;  5ELE A;  1GXD C;  2F0P A;  4DN4 M;  2K03 A;  3QWN A;  3TBI B;  5EPL A;  1E2V A;  1PTO F;  1PZI D;  1VF5 C;  3OMG A;  5JOB A;  3J7A V;  3GTG B;  2MJ8 A;  3HOX B;  3J80 L;  1PRT D;  3I3C A;  5KYI A;  1RDP D;  4GZY C;  3WDN A;  3QB3 A;  4WRD A;  2NN6 G;  3K6O A;  1PDQ A;  3X3N A;  1AN8 A;  3H0G B;  3I4L A;  4EVO A;  3DWP A;  5E4W C;  4J1M A;  3QJY A;  5KIX A;  1F9Q A;  5C0X J;  3TZD A;  4K5W A;  1ESR A;  1EY8 A;  2BA1 A;  2B2U C;  4DU9 A;  1CI3 M;  3L3O C;  3TZU A;  5CYU A;  5C3W A;  1OO9 B;  3MZ5 A;  4ZAI A;  2D62 A;  4RGT A;  1E2W A;  3QOJ A;  5EKI A;  1BDO A;  1MI2 A;  1OXS C;  2KA7 A;  1DJR D;  1TWF B;  4A3D B;  3V96 A;  5LL6 X;  4KD3 A;  1ONL A;  5D3I B;  1H9K A;  1O7Z A;  2KCN A;  5KYL A;  3NHH A;  1FR3 A;  1VDZ A;  4WOR A;  4KKT A;  1OXT A;  4TSS A;  5KND A;  5C44 B;  1HCZ A;  1DD2 A;  2MGS A;  1R4Q B;  2XNA C;  3CHB D;  5EKL A;  4ABN A;  2F0D A;  4KJN A;  2B2T A;  2IPK D;  4K8J A;  3PO3 B;  3GTQ B;  4QB4 A;  3SR1 A;  5CBA E;  3OW7 A;  1R9T B;  1EQT A;  1ENC A;  2D2C C;  2BCO A;  1OXV A;  5KEE A;  3DMU A;  3NK9 A;  2MHV A;  1GUO A;  2JXM B;  1F77 A;  3NTH A;  2DNE A;  2WII B;  1SAP A;  3K57 A;  1HA5 A;  1KLG D;  3GV6 A;  4CJ1 B;  2F1M A;  1KLU D;  5IIF A;  4PMB A;  3I72 A;  3RD4 A;  3S2D B;  1STN A;  4KKS A;  5M3F B;  2B39 A;  4BA1 I;  2TMP A;  2K32 A;  5G3L F;  2JP1 A;  4ID6 A;  5ELC A;  1TWC B;  1KDB A;  5I2Y A;  1C48 A;  3TSS A;  4FF4 A;  1TU2 B;  4OGQ C;  3FPU B;  3FEW X;  1DON A;  3M4O B;  2JA8 B;  4LK1 C;  5C4X B;  4XYO A;  4P2C B;  2O2L D;  2OT2 A;  4HED A;  1CT1 D;  3MXG A;  5ELB A;  1PXU A;  3RMH A;  4N9P A;  1Z6H A;  1BCP C;  4XQJ A;  3NSW A;  2E2I B;  5CMD A;  1QB5 D;  5DM6 3;  1A2T A;  3SHL A;  1YNN C;  2QCP X;  4IUR A;  3MXU A;  1SYB A;  2A5H A;  1Y8P B;  3IAY A;  5JJZ A;  4DK1 A;  2NBF A;  2EJF C;  2XIW A;  1AEX A;  5HGT A;  4DAV A;  5EJW A;  2CW0 D;  5LHY 1;  1AP0 A;  1EY6 A;  3ZYY X;  4C3I G;  1I6V C;  3A8J E;  2KOL A;  4I7Z C;  3HOW B;  3QG1 A;  2PZU A;  1BUV T;  3QIA A;  2EXZ A;  1SNC A;  4XIG S;  1ZYR C;  3KLS X;  5D14 A;  4BBR B;  5IOC A;  1D1K A;  1SJH D;  3NXW A;  1GOZ A;  2H1E A;  3T4A C;  2R7Z B;  1WTV A;  3ERQ A;  4KHZ A;  2F0W A;  2RDG A;  2Q8T A;  5CV9 A;  4IFD G;  5EKK A;  1PZJ D;  3EA6 A;  2Y0S B;  4K2K A;  2PCF B;  2LS0 1;  3GTM B;  3BVM A;  1VMP A;  2NN6 H;  2F3W A;  4A3M B;  3S17 B;  1LT5 D;  4OHJ A;  3SK6 A;  2NTS A;  2E75 C;  5F2D A;  3IFD A;  3NWS A;  1HQM C;  4FVM A;  4K6D A;  3MC0 B;  2E2J B;  3BZD B;  2NUC A;  1IL8 A;  2OF1 A;  4DAP A;  5C3X A;  5D3D A;  5EBC A;  1CA5 A;  3TP7 A;  1U4M A;  5I9O A;  1EY7 A;  4ZQ3 A;  3BVG A;  1D5Z C;  3I90 A;  3PMF A;  2G9H D;  3P75 A;  4EQN A;  5J22 A;  1JWS D;  3O13 A;  1GUW A;  3T13 A;  2AQ3 B;  1ILQ A;  1JOR A;  3I91 A;  1NR4 A;  2WV6 D;  1CK1 A;  3PO2 B;  2O5J C;  1ENA A;  3OWE B;  2LMC B;  3RZO B;  2ICI A;  4RGM A;  2XWB B;  1A3T A;  4H7B A;  3VA7 A;  1WVL A;  2H4O A;  3DM1 A;  2IWH A;  3EFX D;  1T5X D;  2X6L A;  4Y7N B;  1PRT B;  1WD1 A;  1JCK B;  4ODG A;  5COR A;  4ULL A;  1PTO C;  2A74 C;  1II3 A;  2NB0 A;  2NWG A;  3G7L A;  4A3G B;  1JC7 A;  4CBV A;  1CHQ D;  1V1P A;  3HS0 C;  1A3U A;  2IT1 A;  3W3A A;  1WTO A;  1B50 A;  1F2M A;  2L1B A;  3GTK B;  4OL7 A;  1QJO A;  1EZ6 A;  3H91 A;  1EYC A;  4V19 0;  2X6G A;  2LKV A;  4DFA A;  2N88 A;  1S5F D;  3A56 A;  4TKO B;  4KY6 A;  3V2T A;  2LY7 A;  2IW3 A;  3DWA A;  1I4P A;  1GUN A;  2Z8L A;  2K33 A;  1XXG A;  2KEE A;  1JIC A;  1HPC A;  4ME5 A;  1Y69 U;  1QOH A;  1X32 A;  3PIP 3;  1LO5 D;  3NUC A;  4RCN A;  3D4D A;  1TS2 A;  3HOU B;  1CM9 A;  4O42 A;  2F0K A;  4XT1 B;  3EJI A;  2CVR A;  2HCI A;  3KBG A;  4KN4 C;  5M5Y B;  1SFO B;  4HAE A;  3NPP A;  5JEA G;  1HUN A;  1L0Y B;  1JQY D;  4FF2 A;  2F0U A;  1TII D;  4O1N A;  5JAV A;  3A7L A;  2RKS A;  4H0L C;  2B2V C;  1GHJ A;  3CKI B;  3CQZ B;  1STG A;  1KNA A;  4UAI A;  1TY0 A;  3K5N A;  1ZXT A;  4C3H G;  1LTG D;  1PLF A;  2L5T A;  4Q5V A;  1LT3 D;  1HFG A;  2VB2 X;  5KNB A;  4HMJ A;  5TSS A;  4E6I A;  1FYC A;  2M2L A;  1EY9 A;  1F2Y A;  2SNS A;  3A54 A;  3S14 B;  1JOO A;  1UNS A;  1MBY A;  1FD7 D;  1ENF A;  3HGB A;  2R93 B;  4R8I A;  1IHZ A;  1LTR D;  4A3B B;  2AQ2 B;  1WTQ A;  4QUC A;  3R2T A;  2EYO A;  2KCC A;  2HCC A;  1CQF A;  1CQV A;  1EFI D;  2EYH A;  2AWO A;  3RZD B;  5M5X B;  3SXH A;  3ONA B;  4C1N K;  2BDN A;  1XWE A;  1SDF A;  1LT4 D;  4IFD H;  1NR2 A;  3AU7 A;  1KNE A;  1V8Q A;  1KAB A;  3C46 A;  2B2W A;  3DEP A;  1SYF A;  4NP5 A;  1KDA A;  2L12 A;  1K83 B;  3V05 A;  3RLF A;  1DZ1 A;  3PUW A;  3NTI A;  1JE4 A;  4OO1 G;  1TY2 A;  2C9O A;  3OIP A;  5G3L D;  4L63 B;  1J8I A;  3DWQ A;  4FXK C;  4A3F B;  1TT2 A;  3H09 A;  1JWM D;  2WP8 J;  1WD0 A;  2QKI C;  3D6W A;  4WJW A;  4QUF A;  4IUT A;  5FO9 B;  5C4J B;  3I8Z A;  2A73 B;  1EYA A;  4NW2 A;  4K6L A;  3FMC A;  3VR3 A;  4DF7 A;  5C0X H;  1S4Z A;  2FMM A;  4NDX A;  4IUU A;  2NVQ B;  5ELF A;  2A6E C;  4RCO A;  4KHV A;  1RD9 D;  3ND8 A;  5CC4 A;  2BE5 C;  3QOL A;  4IQZ A;  4OIJ A;  3W2D A;  1GHK A;  1K8M A;  1BQQ T;  1AW7 A;  2EY5 A;  2A6H C;  3GTO B;  3TME A;  3E5S A;  1U9R A;  4ZK9 B;  3M85 A;  1I6H B;  3D4W A;  2YYZ A;  1HXY D;  1NSN S;  2NTT A;  1TQO A;  4HSP A;  4JBW A;  3S1Q B;  1SBB B;  2B2Y A;  3N52 A;  1LLR D;  2BE5 D;  2K05 A;  3E6Z X;  3G6J B;  3AB9 A;  3VA5 A;  2MPM A;  3WOE A;  2R92 B;  1B9N A;  2A6H D;  3OWF A;  2EJM A;  3Q0A A;  3J7Y W;  1STE A;  4RKB A;  4NKL A;  1Q8I A;  2IX1 A;  1IYU A;  1I4R A;  1NCV A;  3N6R A;  1S5C D;  2HUG A;  1PZK D;  2A69 C;  5K36 G;  4KI0 A;  4PNY A;  1K8O A;  3SDZ A;  3CU7 A;  4K14 A;  1JR0 D;  5I6Y A;  4PQX A;  3LX0 A;  1LTB D;  2B8F A;  3GP7 A;  1TKW B;  2F0T A;  2HDL A;  3I4N B;  3ND9 A;  3PUY A;  1STB A;  5KNC A;  1HUM A;  5J39 A;  3M7N A;  2Z1C A;  1IW7 C;  4IUQ A;  3R93 A;  4F88 A;  5E4X A;  5JEA J;  5IOD A;  5C6A A;  4KJO A;  5JEA H;  1TWA B;  1AZQ A;  4H13 C;  3K5L A;  5FO7 B;  5KGU A;  1L0X B;  1F9P A;  3PUX A;  4QF4 A;  1F9S A;  1B4O A;  2NN6 I;  3VYT A;  2PW7 A;  2LFN A;  4YIJ A;  1IW7 D;  3HEJ A;  1DCZ A;  4K2L A;  3I70 A;  2E2H B;  1A6X A;  3BYT B;  2JE6 I;  1SEB D;  1BXT A;  1B9M A;  3I4M B;  1BR9 A;  1CZG A;  1CA6 A;  4A3J B;  1V1O A;  4FF1 A;  2EVB A;  3SK5 A;  5BN4 A;  4HSV A;  3L7Z C;  2K28 A;  5CV4 A;  5M3M B;  3BVZ A;  2J7Z A;  3C3L A;  2F0L A;  4R8N A;  4QCL A;  3MEH A;  2FIN B;  1QIL A;  1H9J A;  1DOM A;  4RKL A;  5JVG 3;  2GA4 B;  5EBD A;  2B2T C;  4IUP A;  3HP3 A;  4A3E B;  2JA6 B;  5COY A;  1RTO A;  3OSO A;  1DYQ A;  1SMY C;  1BCP D;  2KQ3 A;  2SDF A;  2WB1 B;  3MAQ A;  5E3F A;  1RCV D;  2EY2 A;  3S1M B;  4Z9C B;  2EPB A;  1YNN D;  4RH6 A;  4HCE A;  1I4X A;  1S5D D;  3CRK C;  5C4H A;  1D5X C;  2IL8 A;  2J4X A;  3D4R A;  2PPB C;  5D65 A;  4CHT B;  4OO1 H;  1ZKO A;  3ITP A;  2XWJ B;  3T53 B;  3OIQ A;  4FP5 D;  1BNZ A;  3FDT A;  3E0J A;  2M00 A;  1ZYR D;  5ELD A;  2K04 A;  1EQV A;  2E76 C;  4LJZ C;  3K0Y A;  2D9U A;  4RHR A;  4FXD A;  2SEB D;  3A55 A;  4G7Z C;  1AZP A;  1Y8O B;  2K7V A;  2R6G A;  1SSO A;  3FVQ A;  3SK4 A;  1FGB D;  2KED A;  3VR4 A;  4BY1 B;  2E2D C;  2BDO A;  4EQP A;  3Q24 A;  3D6C A;  1JOQ A;  4ILW A;  4V0B A;  2EYP A;  5DEH A;  1FNV A;  3K7A B;  1AFP A;  2L11 A;  3HRZ C;  4C3H B;  2L0C A;  2ZXO A;  2PO4 A;  5IGC A;  1YNJ C;  2Q8R E;  1SE4 A;  2PZT A;  3Q6S A;  1EEF D;  5JPM C;  2L9H A;  4S3S A;  4CGY B;  2BOS A;  2FHT A;  4IN3 A;  2R61 A;  1F2L A;  4XYQ A;  5C4Z A;  2F3V A;  3KLS A;  3U9O A;  2K5W A;  1PYW D;  3KLR A;  1SE2 A;  2ICE C;  1UEA B;  2EDG A;  1QNK A;  1UUP A;  1CFM A;  1XYI A;  3SEB A;  3MVV A;  3S1R B;  4H44 C;  1I4Q A;  5J1Z A;  5A35 A;  3MXN A;  5K36 H;  2DNC A;  1G29 1;  1KDC A;  2VNU D;  4I65 A;  2K6A A;  2X69 A;  1D1I A;  2VB3 X;  4X3K A;  1EIG A;  1LTA D;  4KY7 A;  2K5Q A;  3WOF A;  1PTO D;  2G9D A;  4PV1 C;  3KF8 A;  3BDL A;  1H9M A;  1EU4 A;  4C3J G;  2F0O A;  3PUZ A;  2NYZ D;  1PMR A;  4ZLT F;  4OIK A;  1ML0 D;  1TWG B;  2ZXR A;  2NZ1 D;  4RAU C;  4J6H A;  1SJE D;  4IFD I;  1M4V A;  2DY7 A;  2VUM B;  2YU9 B;  2J0T D;  4A93 B;  3VYR A;  2AUK A;  2IJ0 A;  2F4I A;  5CV7 A;  1EYD A;  5DM7 3;  5FK9 C;  1CHP D;  3JAM L;  1HTL D;  4CJ0 B;  2PNR C;  4WFN 3;  4RA8 A;  3A8I E;  1G8Z D;  5M5W B;  3KK7 A;  1U4R A;  1PFN A;  1NUC A;  5IGE A;  5JVH 3;  1IKM A;  1STA A;  1EY4 A;  1KAA A;  3Q23 A;  5CV8 A;  1Q12 A;  5EGT A;  4FO2 A;  1WTX A;  1BF4 A;  4M8A A;  2EYL A;  3RUZ A;  2B2U A;  5C0X I;  3LNN A;  4KTA A;  5K5P A;  3PIO 3;  1STY A;  1MD2 D;  4DXF A;  5I4D A;  1QNU A;  4ZKC B;  2EOT A;  3K5O A;  3NBH A;  4DNR B;  1SE3 A;  4HN7 A;  1MSG A;  1X3Q A;  1Y8N B;  2KUM A;  1F9R A;  5EPK A;  5EPJ A;  2V4D A;  2PYK A;  1G2S A;  3KBX A;  1I3Q B;  3U9S A;  2F0H A;  3TP5 A;  1U4L A;  4LMQ D;  2DN8 A;  2MUY A;  4KY5 A;  2ENB A;  5IGD A;  2EZV A;  1ESF A;  2TSS A;  3C2P A;  3IFT A;  1PRT C;  3C1F A;  4XQQ A;  1TS3 A;  2EY6 A;  3LWE A;  3SK8 A;  1B1Z A;  1H9S B;  1I4G A;  2DY8 A;  1RF2 D;  3I73 A;  3M7G A;  2F0G A;  2KVM A;  3NTK A;  4PMW A;  1EL0 A;  1SNP A;  2IX3 A;  5I6W A;  1TWH B;  1SYG A;  3NQI A;  4TRD A;  1E0B A;  4RGN A;  3UI2 A;  1Y1W B;  4F87 A;  4G7H C;  2B8G A;  4DK0 A;  2PMZ B;  1BBX C;  2WAC A;  5DAU A;  1U4P A;  3BDO A;  3LWU A;  4XT3 B;  2Z4I A;  1CTM A;  1O80 A;  4PMC A;  1BCP B;  3EVQ A;  5IGB A;  1VF7 A;  4DGZ A;  1OXU A;  3NQT A;  3TN2 A;  3T16 A;  1IKL A;  1M8A A;  1S5E D;  4DAY A;  2F0N A;  1SYD A;  1PTO H;  3S16 B;  2JA5 B;  1DOL A;  5BN3 A;  1H9S A;  3K5M A;  1LTI D;  1HHV A;  3OPO A;  4HCS A;  5IGF A;  1QWY A;  3EQL C;  1SYC A;  3S2H B;  4G4K A;  3NBI A;  4J8Q A;  3MA2 B;  2RDH A;  2QDB A;  2A6E D;  1ZEQ X;  5IGG A;  4C3I B;  3SE0 A;  4ZRZ A;  5DNF A;  1A3V A;  2OXP A;  3VYS A;  5CV6 A;  2O4X A;  4TQU S;  4K5X A;  5C3E B;  3TP6 A;  1HFN A;  2EYM A;  3GQB A;  2B2W C;  2PQE A;  1S5B D;  4KKU A;  1B3A A;  3DEO A;  4XTC S;  3R8B A;  4G57 A;  4HTH A;  1EZ8 A;  2OEO A;  1EOT A;  3K58 A;  1JWU D;  4CKB A;  4B9X A;  4XDX A;  3FKI B;  3URY A;  2XRQ D;  4JK1 C;  2PW5 A;  1BOS A;  3HOZ B;  1DM0 B;  1MSH A;  5E1F A;  1EY0 A;  5FOB B;  3HKZ B;  3J7A F;  2SNM A;  1EIH A;  4CJ2 C;  2EYF A;  1SNO A;  1R4P B;  2HDM A;  2AWN A;  4EQO A;  2D5D A;  2JA7 B;  1Q1E A;  3P7J A;  2Q8I B;  3OHX C;  3FPP A;  4F8M A;  4B08 A;  1RTN A;  2WKC A;  1SNQ A;  4QMG A;  3S1N B;  2A69 D;  2K5D A;  1V43 A;  2XRS D;  5LL6 S;  1LV9 A;  4KV6 A;  4OO1 I;  2JEB I;  4DXG A;  2F0V A;  1EEI D;  3NE5 B;  1HRJ A;  4EGV A;  2JEA I;  1MGS A;  1PRT F;  3Q22 A;  4L8J A;  4K5V A;  2IX0 A;  3BG3 A;  4ZYS A;  5HUR A;  1I50 B;  3BYY B;  2A68 C;  1VMC A;  3A8K E;  4BA2 I;  4L6T B;  1EU3 A;  4FYD A;  1Z7T A;  4C56 C;  3A7A B;  2WKD A;  2XSC A;  2RQX A;  5CGK A;  1EWC A;  1W6K A;  4C2M B;  3VR6 A;  2B2Y C;  2ZXP A;  4ZKB B;  4CKC A;  3MFY A;  4KMU C;  1PTO B;  2CW0 C;  2EYJ A;  1TS4 A;  4XQN A;  4BY7 B;  4ZUJ A;  3H6M A;  2QIL A;  3HOY B;  2N55 A;  5C5L A;  1STH A;  1OXX K;  1RJT A;  1TR5 A;  2A68 D;  3GV3 A;  2I07 B;  4K8I A;  1QG7 A;  4XXE A;  1ILP A;  1G91 A;  3GTP B;  3GO5 A;  3OOC A;  4Q0F A;  1TS5 A;  4X3U A;  3OMC A;  4M1U B;  1EWH A;  4IAL A;  1W6J A;  4F7X A;  1KTK A;  3KUP A;  1WTR A;  1QE6 A;  4NMZ A;  3VR5 A;  1Z47 A;  3D8G A;  1LAC A;  3PV0 A;  1GUG A;  1NAP A;  4X3S A;  4QIW B;  4ZUI A;  1SYE A;  5FO8 B;  5FKA C;  2Z4H A;  4C3J B;  1SMY D;  1JOK A;  5CV5 A;  3HZX A;  4HR7 B;  4N9T A;  3K59 A;  2F0J A;  3SVM A;  2XN9 C;  1B2T A;  3ERO A;  2RSN A;  2EE1 A;  2WAQ B;  1G2T A;  5CR3 A;  1SNM A;  1VCI A;  1JB3 A;  4FNF A;  2NVY B;  2QEJ C;  3J81 E;  3HOV B;  2R3Z A;  1WTP A;  5T1I A;  2I46 A;  1D2B A;  3GTJ B;  3T51 B;  5KRU A;  2ID0 A;  1F2Z A;  3NP8 A;  2F0Q A;  2KEC A;  2EJG C;  3HG9 A;  2RA4 A;  3AMU A;  3IKJ A;  3J81 L;  2MP1 A;  4U67 3;  1ICW A;  2O5I C;  3QO2 A;  1PFM A;  1O7Y A;  1HQR D;  1T5E A;  2QF7 A;  1D6E C;  2KJX A;  1V1P B;  3DXJ C;  2BA0 A;  4R9W A;  2RDF A;  3DUZ A;  1LT6 D;  3VYU A;  4BWG B;  5C0X G;  5FLX E;  4AYB B;  4G7O C;  3H3V C;  5JPN C;  1A2U A;  2K1B A;  1YNJ D;  2FJ2 A;  4DA2 A;  2B2V A;  1G6Z A;  1EY5 A;  3D3R A;  1UAP A;  2B63 B;  1LTT D;  2M9V A;  3R3O A;  5T1G A;  1I4H A;  5FLX L;  3MXP A;  2K01 A;  1FNU A;  5BN5 A;  1QCB D;  3P20 A;  2F0M A;  4HMI A;  3T56 B;  1WCM B;  4CKE A;  4MN3 A;  5C5M A;  2FMC A;  1RKN A;  2F0F A;  4IZ8 A;  1BCP F;  4C1N I;  3PUV A;  1C4Q A;  2JSO A;  3L9A X;  3M3Y B;  3F2U A;  1D5M C;  3GD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...