4HCSA

Structure of novel subfamily cx chemokine solved by sulfur sad
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
PGVCFKVLTTKEPKANIKRCYNLPKTNNCLKCVLFVDASNRMKCIDPNASWLAERLYRLKEKGVTCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural insight into the evolution of a new chemokine family from zebrafish.
pubmed doi rcsb
source organism Danio rerio
molecule tags Signaling protein
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hcsA00
4ZKCB 4HSVA 1AZQA 1HUNA 2X69A 4OIJA 2NYZD 1C8CA 1MI2A 2M2LA 2K03A 2KEEA 2B2YC 5COYA 4ZK9B 2K28A 2MGSA 1B50A 4ZKBB 2EE1A 1MSGA 2EOTA 2B2TA 4IUPA 3LWEA 1KNEA 1RJTA 3SVMA 2K04A 5AFWA 1U4PA 5T1IA 1CA5A 1F9PA 3DM1A 4IUUA 2L9HA 1XYIA 4ZLTF 1F9QA 1TVXA 2L11A 4R8IA 1SSOA 1CM9A 1RTOA 1HFGA 2B2WA 1PLFA 2FHTA 2JP1A 2KUMA 2JYOA 3D6WA 4CJ2C 1WTPA 2KOLA 3N52A 5EPKA 4X3SA 2B2TC 1S4ZA 5CBEE 4U68A 2J7ZA 2SDFA 1DZ1A 2EPBA 1A15A 1U4MA 4XT3B 1XX8A 3G7LA 2X6GA 3I3CA 5CBAE 3DEPA 1F2LA 2BDNA 2FMMA 2RA4A 1DOKA 1PDQA 2HCCA 1NR2A 1AZPA 4QUFA 2KECA 4X3TA 1RHPA 1EL0A 2B2UA 3TZDA 5CORA 1RODA 2FFKB 1BNZA 1U4RA 1G91A 1BO0A 2FJ2A 1ESRA 1NR4A 4QUCA 1PFMA 2N88A 2NZ1D 2MJ8A 4XT1B 5EQ0A 1WTRA 1NAPA 1B4OA 4RWSC 5DNFA 3R93A 3UI2A 1WD0A 1EQTA 1F9RA 1G2SA 4HAEA 4CJ1B 5EPJA 1B53A 4DN4M 2R3ZA 1VMPA 1JE4A 2B2YA 3FPUB 5D14A 2KEDA 1G2TA 4LMQD 1O7ZA 2N55A 2MP1A 1BF4A 1O7YA 2KVMA 1E0BA 1DOLA 3IFDA 4MHEA 4UAIA 1HHVA 2VXWA 1ML0D 1WVLA 5EPLA 1F9SA 4O42A 1EOTA 1WD1A 2K1BA 2B2UC 2Q8TA 1JICA 3GV6A 1SAPA 1M8AA 3Q6SA 4IURA 1IKMA 3P7JA 1Q3LA 1MGSA 1ICWA 3FDTA 2D9UA 4RA8A 3QO2A 1KNAA 2RSOA 1J9OA 1X3PA 5E4WC 1ZXTA 1AP0A 2B2VA 2IL8A 2B2WC 1QG7A 2H1EA 2MPMA 3KUPA 2Q8RE 1EIHA 1BBXC 3I90A 1IL8A 3MWYW 1QE6A 1WTVA 1GUWA 5CMDA 4RAUC 2CVRA 5T1GA 4R9WA 5JJZA 1NCVA 2DY7A 2HDLA 4ZAIA 1X3QA 2HDMA 4X3KA 1PFNA 1SDFA 3HP3A 1QNKA 4HEDA 4IUTA 5EJWA 4X3UA 1WTOA 3F2UA 2DY8A 2X6LA 1WTQA 1B2TA 1DOMA 1VMCA 2RSNA 1WTWA 1WTXA 4IUVA 5E4XA 1ILPA 1X32A 3TN2A 1B3AA 2HCIA 3GV3A 4MN3A 4OIKA 4XDXA 4CJ0B 1HUMA 2L1BA 3ONAB 1CA6A 3DEOA 2FINB 1ILQA 2XIWA 4NW2A 2NWGA 5D65A 1G6ZA 3H91A 1HRJA 3KBXA 1EIGA 2B2VC 1DONA 1HFNA 1LV9A 2L4NA 1HA6A 1U4LA 2L12A 3I91A 4IUQA 1J8IA 2K01A 1MSHA 2HUGA 1O80A 3IL8A 4HCSA 3I8ZA 2RVLA 5EKIA 3MTSA 1RTNA 2K05A 1IKLA 1PFBA
chains in the Genus database with same CATH superfamily
4DF7A 1K9MC 1KABA 3PQIA 4PMCA 1B44D 4ZKBB 2SEBD 2MUYA 1KNEA 1CK1A 2EY1A 4P73A 4FXGC 4QGUA 4DGZA 2O5IC 3E0EA 1OXSC 2RCFA 5T1IA 3QOLA 3FP9A 3S15H 4V0BA 4CGYB 2L11A 2K5NA 2B2WA 2KUMA 3P75A 1BCPC 2ID0A 3AU7A 3SDZA 1VQOA 1I6HB 5DM63 1JOOA 4F88A 5C6AA 1J5EQ 5CBEE 3E6ZX 1U4MA 4LUVA 3RLOA 4EVOA 4DNRB 2DNEA 2Y0SG 4R4IA 5CV7A 1JCKB 1TY2A 4H0LC 3J7AF 1MD2D 3I4NG 4C2MH 4X3TA 2WINB 3TZDA 3BVZA 4DUZL 1NUCA 1STYA 1TWHH 2VQEQ 4N9TA 3PF5A 3TS2A 2A6ED 2K5WA 3PUYA 1S5FD 2QDLA 4LNQA 1VQ4A 3GD7A 1LT6D 1BOSA 1JR0D 1S5DD 4WJWA 4UAIA 1TWFB 2PZUA 2VUMG 2DN8A 4XQJA 4DV2Q 1M8AA 4R8NA 4QB4A 1I4GA 1IKMA 2SNMA 5C4JH 3E0JA 4HMJA 2MHVA 2OXPA 3T16A 3UDFA 5KYLA 3HOWB 4C3JH 4KY7A 1SE8A 2NN6I 2M9VA 5LMNQ 2UUCL 1KQSA 4LF5L 1JQYD 4K0KL 5M5XH 1HUNA 4KTAA 4FYDA 2K5HA 4U673 1VQDA 4N8FA 4JI6L 3CQZH 1G51A 3TN2A 1S5CD 3A56A 4MZ9A 3K0YA 5I9PA 4KHZA 5DLQE 2XIWA 1W6KA 2NWGA 1EY9A 5CV6A 2F0MA 3CPWA 3IAYA 3HOUH 3BS1A 5M3MH 1GUGA 4GS3A 5LL6X 2EZVA 4DV6L 2R61A 4HJ7A 4DR3Q 2TSSA 1PH6A 3H3VC 1M4VA 3GTQB 1Y1VG 4A3LH 2A6EC 4BXXG 1X3FA 2HQEA 2NN6G 1PH3A 3AEVA 3SE0A 3MHBA 3RLFA 1QJOA 2IW3A 5C3WA 5ELCA 2EY6A 4LFCL 4ZLTF 4A3EG 1I4RA 2E2HB 3R2TA 5HGTA 1I6HH 1YITA 4LF9L 4HCEA 1QVGA 1WTPA 3C46A 2ZTCA 3V96A 4BBSG 1STNA 3DMUA 4HIMA 2EJFC 1B3QA 2ZTEA 4ME3A 4CHTB 2F3VA 1N32Q 2BDNA 5FLXc 5D3DA 1W2BA 1KDCA 2LFNA 3S1MB 1BBWA 3EA6A 1TQOA 2P5ZX 2HQLA 3QOJA 3MAQA 1ESRA 1V1QA 2PYKA 2MNAA 1LM0A 4O2DA 3CCEA 4RGTA 3RN5A 1K8GA 3OTOL 1VDZA 1HNXQ 1I4HA 4LF4Q 2OQKA 1O7ZA 2UUBL 2K50A 3BZCA 1CT1D 4Y7NB 1TWFH 2ZJPA 1YEZA 3BVMA 1JICA 1VCIA 5IYCH 2EXDA 3J7YW 2AQ3B 2RHSB 3P20A 3STBD 2D9UA 1U0LA 5IWAQ 2UUAQ 3K8AA 1ZXTA 1A6XA 3HOWH 3I7FA 1YNND 4A75A 3NQIA 2NVQB 3HKZB 1GD7A 4ZAIA 4A3JG 1STBA 4HEDA 2E2IH 5C4XB 1B2TA 1PVOA 4A3KB 4S3SA 5J1ZA 3HS0C 4HIOA 5GAEC 3GQBA 5JEAH 1EWIA 4MN3A 1SNQA 3SHLA 2A69D 3M4OH 3SEBA 3TREA 1TWGH 4GKKL 4NMZA 1BDOA 2ATWA 2A8VA 4ZKCB 3MXPA 1H95A 1LO5D 3GTQH 4JI2L 1X54A 3GTKB 3A5ZB 1ICFB 2RDFA 2JA5G 2A74C 3IFTA 1UE1A 1I3QB 1CA5A 4C3IG 2E2HH 3MA2B 4R8IA 1EYDA 5FO8B 4YWLA 1LTTD 4OHJA 5GAGC 1J5EL 4HIKA 1I50H 4EX5A 1SE4A 3STBC 4KN4C 2NB0A 2RHQB 1B1ZA 5CBAE 1ESFA 3PSIA 1YNNC 1XNRL 1HNWL 3U9OA 2A6HD 1Q46A 2KHJA 3CC4A 3S1MH 3ULLA 4RG1A 1TS4A 1LT4D 2VUMH 4YY3Q 4JYAL 2Z4HA 1ASYA 2WKDA 4Q5VA 2FJ2A 2WB1G 2VQEL 4OO1I 5G3LF 4QUCA 3PO3G 4RWSC 3CRLC 2OCEA 3ULPA 2A69C 1PFSA 1UEBA 3PMFA 4LFBQ 4QIWB 5C44G 4LMQD 3EQLC 3OWFA 1N8RC 1LABA 1DOLA 4DV2L 2VXWA 4XXEA 3ER0A 4JI7L 1SAPA 3J80E 4NXML 4WJ4A 3VR5A 4RA8A 1XMOL 4IZ8A 1I5FA 4A3BB 4I7ZC 4IJHA 1ENAA 5HGQA 2PZTA 2AUKA 4AYBG 5I6YA 1WTVA 4DR4Q 2NVQH 4JV5Q 4QIWE 5LMNL 4RAUC 4DK1A 1HPCA 3CCLA 2OTLA 4C1NI 1TXYA 1CFMA 2K5DA 4ZUIA 2SNSA 5C4XH 1ENCA 3E9IA 5EJWA 4ODGA 4IUTA 1AE3A 3H0GB 2GN5A 2JQOA 3G48A 4ME5A 1Y1VH 1X32A 4BXXH 4R1JA 1YJ9A 4G7HC 2YU9B 2ENBA 1HNZQ 1IBKL 3EIVA 1JE5A 2A6HC 1LV9A 2K75A 1Y8OB 2HIXA 4KKTA 2KBNA 3VA5A 1PYWD 2K01A 3B6YA 2EXZA 2E2DC 2AQ2B 3J80L 1R4QB 2B2YC 2B2TA 1KTKA 4IPGA 4DXFA 1AZQA 5JVH3 1PV4A 4BBSH 2WFWA 3GTKH 4KD3A 3WOFA 1VF7A 4WJ3M 4JI0Q 4JI4Q 1R9TB 3QIAA 4DV3L 3NUCA 1IYUA 1GVPA 1PH2A 3CCMA 2DGYA 2KENA 1J6QA 2YTVA 1RDPD 1XPOA 5CYUA 1TKWB 4IUUA 1I94Q 2L9HA 3NTHA 4JBJA 4DR1L 4GNXC 1PLFA 1LTLA 1VQ5A 2O2LD 5BN3A 4A3DG 5EPKA 4LAAA 4FF1A 1CQVA 4DKAC 3PO3B 2J7ZA 2RCNA 1DZ1A 2EPBA 3M4YA 1KL9A 2AKWB 4KJNA 3BDOA 3D31A 2F03A 3ZYYX 2Q2UA 2JA8B 2QCPX 3NTKA 4OELB 4QY7A 3BVGA 4DAYB 3EVQA 1RODA 3JAMi 2D2CC 2UXDQ 1G8ZD 1EWCA 2OF1A 1UNSA 1SMYD 5ELOA 3H09A 1BCPB 1GKHA 4AYBB 1YI2A 2Q2TA 2N55A 3I72A 4AQYQ 2KVMA 1HR0Q 4A3JH 2E76C 4P72A 2F0TA 3I4MB 1EQRA 1X3GA 4CDDC 1ASZA 2UUAL 5I6WA 2PNHA 4A3MB 3E9HA 3W5OA 3H15A 2Q8RE 4NPSA 1SYEA 4NB3A 5J22A 5FLMG 4AYBE 3I55A 3M3YB 4A93B 1SMXA 1D7QA 2PI2E 3MVVA 3VA7A 1WJJA 1LTRD 2E5LL 2JA9A 1JORA 1I4XA 5IODA 3H0GH 4X3UA 1SN8A 2EYOA 1TIID 3KDFB 4JCVE 1IZ6A 3ND9A 1DM0B 1E2VA 4YIJA 3J81E 1YHAA 3EJIA 1E1OA 1PH1A 3L0OA 1I4PA 4K14A 2AMCB 1FNUA 2CWAA 4IUQA 4K2KA 2JSOA 1Y8PB 5KNDA 4P74A 2OWOA 1EEFD 1E2ZA 2ZJQA 2M2LA 3AQQA 1WTHA 3CCQA 5M5WB 1B50A 1ZYRD 2K5QA 1SMYC 2IPKD 4GKJL 4PZ6A 1LTAD 3S2DB 4HMIA 3Q24A 1VQ7A 1FNWA 2XGTA 5BR8Q 2V1CC 4YCWA 3A0JA 1ZEQX 3DM3A 4GOPB 1L0XB 4H02A 3PO3H 1CKNB 3GTOH 3J81L 1PRTD 1A2UA 4NXNL 4B3SQ 1NBWA 4L6TB 5EGTA 4L8JA 2IY5B 4DR5Q 4KN7C 2VNUD 5I2YA 2N3SA 1IL2A 5AJ3Q 2R92B 1Z9FA 3MFGA 2NZOA 1XTDA 2HHHQ 3F2BA 3S15B 2N88A 1F9RA 4HAEA 2R7FA 4LFBL 5KIXA 4JI8Q 4K8IA 5E3FA 3UDGA 1JE4A 3PGZA 2JA6B 3TP5A 3QR8A 4GLXA 1CSPA 1VQAA 1K8AC 4PG3A 1HHVA 4B3TQ 1OXXK 4DK3C 3I4MH 3G71A 4DAYA 2B2UC 4LFAQ 5BN4A 1TS2A 4UP8A 4LF6Q 2RDGA 1D5ZC 1A63A 1ZYRC 2RSOA 2XVSA 2VB3X 2XSCA 5C0XI 1EWHA 4DR4L 4RCNA 4A93H 1SRUA 3M3YH 3PO2B 2AUJD 1JJCB 1A3VA 3J7ZC 1JWSD 4FF2A 3NEMA 4B9WA 1E7ZA 3NENA 2L15A 1N34Q 1T5XD 3K0XA 1GO3E 4X65Q 2R7ZG 1ILPA 2F1MA 3GV3A 4XDXA 3HZXA 1KIXA 1PRTC 3AB9A 4NW2A 5LL6S 4BBRG 3KBXA 4JBWA 4IFDG 1EU4A 1IYVA 4P71A 1RL2A 1F2MA 2E2JB 3U4VA 3IL8A 2F3IA 3LWUA 3K5LA 4IPDA 3GTMB 4A3DH 4C3JB 1STEA 4X62L 1MI2A 1V9PA 4ZK9B 4JI4L 3FKIG 4K2LA 3KDFA 2K28A 2EE1A 4X66L 3PCOB 2EOTA 1I94L 4L5QA 1SR3A 1F2ZA 5GADC 3PIP3 1XPUA 1PH4A 2A73B 1XTCD 3FMCA 2BA0A 1STHA 4C3HG 1SSOA 4KKSA 1G6PA 3DHQA 2ZT9C 1C0AA 2I46A 3CXCA 1VS0A 4FF3A 3I70A 4Q0FA 3V05A 3H3VH 5FJ8G 2F52A 5LHY1 3RN2A 2O5JC 1PZKD 5IGBA 1WOCA 4RHRA 5FO7B 2R92H 4WFN3 4DV0Q 5ELDA 4GOPA 1RCVD 1U4RA 1KDAA 4QL5A 4B08A 4LJZC 4V190 2UXDL 2NZ1D 2ICIA 1WD0A 4IQZA 1CKNA 1EQTA 3S1NH 4CJ1B 1A3TA 2JA6H 4B3RQ 4DR7Q 3VYSA 1PTOF 5FLMH 1D5MC 1XXGA 4HIDA 4DUYL 2EY5A 4AQYL 3CP0A 4UY8C 4FF4A 4HTHA 1WVLA 2K14A 5JJLA 1ZKOA 1WYDA 3Q23A 5M3FG 3Q6SA 1L1OA 1A62A 2CCZA 2L5TA 2KQ3A 3G6JB 3CF5A 2RQXA 5E4WC 1J9OA 1SNPA 2MPMA 3PO2H 5C4ZA 3LNNA 4BBRB 4ZQ3A 4A3IB 1QE6A 1FR3A 2DJFC 3RD4A 4DV4Q 3J81j 2G9DA 3NQTA 1KXLA 1VMCA 1WTWA 1B8AA 2VL6A 3KF6A 2HCIA 4CJ0B 4UP7A 5IP9G 4IPHA 1G6ZA 3H91A 2WAQG 3RNUA 3ERQA 4K5VA 2C35B 2E2JH 5IY0A 1J8IA 1F2YA 3ND8A 1MJCA 2PQAB 1VQHA 3GTMH 3TP8A 4YHHL 3BJUA 2K4KA 1GUTA 2Q2IA 5IT9E 2KEEA 1VQBA 5CC4A 2UU9Q 1MSGA 4BY7G 2E2IB 3S17B 4IFDJ 2NBFA 1EIFA 3DUZA 3T13A 1KLUD 2PNRC 4POGA 5AFWA 3OHXC 4LF7Q 2RDHA 4OXPA 3M4OB 1SNCA 5C5LA 5C0XJ 1TWGB 3V2TA 1NY4A 1RIPA 4TVAB 3D6WA 3N52A 3D4WA 2F4IA 1NMFA 3WWVA 4XT3B 1VQFA 4B3SL 4A3CG 3NBHB 3PUZA 1UE6A 2F0VA 3FPPA 4DV7Q 4RKBA 2HCCA 2NVTH 2H5XA 1EUJA 2Y0SB 2F0KA 3HKSA 2HHHL 5JPNC 2PPBC 5KNBA 5DM73 1G91A 5IT9L 2KCTA 3R3OA 2CKZB 1N9WA 4DK6C 5M3FB 3I4NB 5CV5A 1PFMA 1IBML 4GNXB 2D5DA 2R3ZA 1I50B 4RKLA 4B3TL 1O7YA 4MHEA 2Y0SE 4LFAL 1ML0D 1HZCA 4JBMA 3E3XA 2E74C 4H7BA 3DWAA 2VZAA 3VR4A 3KJPA 1JMCA 1FNVA 1AW7A 2VUMB 5IP7G 2F4VQ 3WOEA 4FXDA 4BBRH 4A3IH 1PHJA 1BBXC 3I90A 3HOVG 2FXQA 5JJZA 2HDLA 2GA4B 3CCRA 4HSPA 2PMZE 3NPPA 3I4LA 4B9XA 1TWCB 3F2UA 4DFAA 4X65L 3CMEA 1EY6A 2MO0A 3FKIH 4QMGA 2RKSA 1G2TA 2IX1A 2I5LX 3ICEA 1HTPA 1LT3D 4X64Q 2BA1A 4DV1L 4K5WA 1MSHA 2HUGA 3HOZG 2ES2A 3QJYA 2DNCA 2OT2A 2K32A 1Y1WG 5EAYA 4JPBW 1JOKA 1JWMD 4PV1C 3C1EA 1L0YB 1CQFA 2A68D 4YCVA 3S17H 1TS3A 4IUPA 5FJ8H 2OEOA 1STGA 4ILWA 1Q8IA 1Y1VB 3OYYA 1K28A 1UUPA 1EU3A 3K7AB 2CWPA 1XWEA 1IW7D 2PQAA 1IBLL 2EQSA 2F0EA 4LWCA 2E8GA 5EBCA 1B9NA 1YHBA 3T56B 4A3EB 2O4XA 2M00A 3R2IA 2XWJB 2Q8IB 5JPMC 2Q2HA 3OW2A 1SFOH 3M7NA 4BBSB 2FMMA 3SK5A 3K5NA 4IOAA 1DOKA 4F87A 1GUSA 3UE0A 4DV0L 5CORA 1D2BA 1EZ8A 5M3FH 3I4NH 1BO0A 2UXBQ 1V1PB 3W1BA 4XYOA 4HJ5A 4L5TA 1JWUD 5EPJA 1NE3A 3HOXG 3J80i 2LSSA 2B2YA 3NBHA 4C56C 3CCVA 5D3IB 1B9MA 1L0WA 4X6AH 5FKAC 2I0QA 2K5VA 3TBIB 3GTPH 4DK0A 1RF2D 3PIPA 1C9OA 1X6OA 5K36G 2A68C 1YJNA 1X3PA 2B2VA 3U58A 1Q86C 1ONLA 4GNXA 3G6EA 1V8QA 4DV4L 3SXHA 1H9MA 5E7NA 5ELEA 4FNFA 1YVCA 3OOCA 3PUXA 5C3EG 5M5YB 1IW7C 1TY0A 2DJGC 3L9AX 1TWCH 1PFNA 1SDFA 4DA2A 3CCJA 2DY8A 4CKBA 4A3GG 2EYMA 2EJMA 2RSNA 3BZKA 1YIJA 4A3JB 3U50C 3AYHB 2E75C 1Z47A 4HR7B 3DEOA 3ERSX 1K3RA 4MIUA 5GQOA 4AH6A 1DONA 1HA6A 4BY1G 4QCLA 3MZ5A 5G3LD 2JA7G 3NELA 2K05A 3CC2A 2CFMA 1YNJD 1PFBA 4OO1G 4PMWA 1N33Q 1C8CA 1Q7YC 4KY6A 1GUNA 5C3XA 5JAVA 4A3CH 1U5KA 4FP5D 1SBBB 1VQEA 4BA2I 3N6RA 3SVMA 2L0CA 1EY7A 2EJGC 3K7UC 2NN6H 1CKMA 3K7AH 2KCNA 4C1NK 3J80c 1HJPA 2VQFQ 2JA5B 3S9WA 4GZYC 2F0SA 1HFGA 1GUOA 1CI3M 1LUZA 4C3IB 4A3EH 2A5HA 4DR3L 2QF7A 5E1FA 2QGQA 1N36Q 2BH2A 4DV7L 3M4QA 5TSSA 5DAUA 1F2LA 1YNXA 4XTCS 3HFZB 1JT8A 1LTGD 1RHPA 3BDLA 4XQNA 1XMQQ 3UDIA 1YBYA 4OL7A 3CCSA 3CKIB 4FDBA 5IP7H 1MBYA 2F0UA 4DN4M 2WB1B 3HOVH 3TEHB 4K5XA 1LLRD 3QB3A 3GTOB 3PF4A 1N32L 3BDCA 1BF4A 3U9SA 3R8BA 3A5UA 4JI3Q 5JJKA 1QWYA 5C44B 4K8JA 1YNJC 2K1BA 1HZ9A 2YTYA 1PMRA 4A76A 1VQ8A 1Q3LA 2UXCQ 1V1PA 4B3MQ 2R93G 1KNAA 4L63B 2KHSA 3PUVA 4DR6Q 2WB1E 3MXNB 3M7GA 3MWYW 1SROA 1HNXL 4LF4L 1MIUA 2B63G 5M5YH 3J81i 1QCBD 1EY5A 2JXMB 2A19A 3AFQA 2HDMA 4X3KA 1WTOA 5FO9B 4M8AA 2LMCB 1DOMA 4JK1C 3GDEA 3A7LA 2R7DA 5IWAL 1UE5A 1HRJA 1WCMG 2NTTA 2WIIB 2QKIC 4DV5Q 1P16A 1TT2A 2F0QA 3CHBD 4LW1A 4H13C 2C9OA 2J4XA 4HCSA 1TR5A 1RTNA 4ABNA 4HSVA 1QNUA 1VQGA 2EYHA 5C5MA 1O78A 2EYFA 2BDOA 3EBEA 3VDYA 2EYLA 1OO9B 1FYCA 1BBUA 1U4PA 1K83B 1TWAH 3ULJA 2ALYB 4HJ9A 2JA5H 3J7A5 3D8GA 2F0OA 2MO1A 3JC66 4C3IH 1TS5A 4RCOA 1CHQD 3BYYB 2F0LA 2B2TC 1FL0A 1IHZA 1CSQA 4JOIC 4EQPA 1B7YB 4U68A 1A15A 3JAME 1XX8A 1DCZA 4A3DB 1CTMA 3C3LA 1KC8C 4YWKA 4CKEA 5CR3A 3HEJA 3RR5A 2ZXPA 4YWMA 3J81c 4GLVB 1E1TA 3WDNA 1YJWA 4CKCA 3CCUA 4TRDA 1S5ED 3GTJB 1NAPA 3PV0A 4EQOA 5J3BA 3MC0B 4JVZA 1WFQA 4JC0A 4WRDA 2MQHA 3I4OA 3F2DA 2Z6KC 4DNTB 1AFPA 4OWXB 5C44H 4K0KQ 4ZYSA 1S5BD 3RLNA 1KRSA 2SOBA 3ZJYC 2PW7A 3OPOA 4YY3L 1D1IA 4JI6Q 5F2DA 3F1ZA 1MGSA 4JG2A 2VW9A 1QZGA 3JAML 4RGNA 1AP0A 3TZUA 1F77A 1EYAA 2ZTDA 1LT5D 4BY1H 3S1NB 3RZOH 5EKKA 1OXUA 4R9WA 1BQQT 1TU2B 2QA4A 1VQLA 1CUKA 1C48A 5EBDA 4KHVA 3OSOA 4ZCKA 2JJQA 1B3AA 4OIKA 3ONAB 4Z9CB 2FINB 3HOUG 5D65A 5M3MG 3D0FA 3MXNA 4LFCQ 2XRSD 1VQ9A 1U4LA 4JV5L 1O80A 1PH5A 3MTSA 3MXUA 1N33L 5NUCA 1IKLA 2PI2A 3D6CA 1Y69U 4RFBA 2K03A 2H4OA 1EQQA 3T1YQ 3VR2A 1BCPF 1GJXA 5KEEA 1SJHD 1K3BC 1RJTA 1K83H 4XYQA 3L3OC 1HNZL 3QWNA 3DM1A 2VQFL 2I5MX 4N8X1 1XYIA 3A74A 2I5HA 4M1UB 1SNMA 4NDXA 5IYDG 2CQAA 2D0PA 2EVBA 2F0FA 3S1RH 1PXUA 4J1MA 2KCCA 1N36L 2WP8J 5GROA 1IYJB 1H9JA 2PW5A 3BU2A 3T51B 3AFPA 5C0XG 2X6GA 4JW0A 4JI0L 2D62A 3TQYA 2ZM6Q 3KJOA 4KHPQ 1NR2A 2AQ1B 1AZPA 1K8MA 2KECA 4G57A 1Q1BA 3SR1A 1XMQL 1E2WA 1H9KA 2JEAI 3A54A 3W3AA 1FGUA 4P75A 1KAAA 1AH9A 4TSSA 3GTJH 1WTRA 2GVAA 3TS0A 2CQOA 1B4OA 1LYLA 1NJIC 1SNOA 2J0TD 2F0IA 1OTCA 2Z8LA 1D1KA 1Q81C 4EQNA 1G291 5EKLA 5IYCG 2IHEA 3MFYA 5EPLA 5LMUQ 1UE7A 4MTKA 4DR2Q 2NVTB 4DAVA 3NE5B 1S3OA 4H44C 4OWWB 3K57A 1PA6A 4DR6L 3OW7A 3MEFA 2EY2A 5KNCA 1EY4A 4GKKQ 4NKLA 2XNAC 2LXKA 2Z0SA 1GUWA 2PQEA 1ENFA 2HIVA 2CHBD 1GOZA 2LXJA 3SK6A 1OXTA 3O13A 5JEAG 1HR0L 1C4QA 1VQNA 1WTQA 1EL0A 4JI2Q 2Z9HA 3W1GA 1FJGQ 1KDBA 4O1NA 4BWGB 3KBGA 4FO2A 4DV5L 2BCOA 4UDUC 2R7ZB 1EYCA 3Q8DA 3SGIA 2HD3A 3K59A 2RF4A 4RGOS 1SXTA 3ITPA 2TMPA 2PZWA 2LY7A 1PTOD 4RH6A 4LK1C 4RMFA 1K8OA 2IX3A 5K5PA 5KYIA 1Q90A 5HY6A 1XNRQ 1HNWQ 3S16H 4AIMA 4KLKA 4KD4A 3FKIB 2QEJC 2QILA 2K33A 1DYQA 4JYAQ 1TVXA 2LS01 2QW7A 3KLWA 1CHPD 1H9SB 1VQJA 2FHTA 3T53B 2KHIA 4CJ2C 3KFUA 1XNQQ 2BH8A 4P2CB 4IOCA 3GP7A 4C3HB 1K0RA 5ELBA 3X3NA 2JN4A 3P1HA 1A3UA 3DEPA 1PYSB 2ZXOA 2RA4A 3PUWA 2PO4A 3T1HQ 5BR8L 2KJXA 4JI7Q 4JBKA 4NXMQ 2CH4A 2NVXB 3J7AV 1BNZA 1XMOQ 4BA1I 3PIO3 1GXDC 5IYBG 5DEHA 2JE6I 1VMPA 1DXMA 1BXTA 1BUVT 1UEAB 5J39A 1M90C 1MKHA 4LUZA 2K52A 5I4DA 3GO5A 2HT1A 3A8JE 4DR5L 3K81C 1Z7TA 5IT9c 3OIPA 1SFOB 4O42A 5C4HA 4LF8Q 1Q12A 4UPAA 3GV6A 5AJ3L 1Y8NB 4CBVA 1SNDA 2CW0D 2AWNA 4GOPC 1FVIA 1PTOC 3CW2C 2IJ0A 1O7IA 5GAHC 1IBKQ 2EYJA 2B2WC 5IGEA 1X55A 3A55A 1EIHA 3HKZG 3LGJA 4JI8L 1IL8A 5C4XG 1CZGA 3NBIA 3KF8B 4A3KG 3K58A 5FLXE 1BR9A 1X3QA 1WTXA 3GTLB 4ID6A 5IGFA 2PMZB 3F2CA 1L1OC 3K80C 4DV3Q 4LF6L 3GTPB 1D6EC 1HUMA 1ILQA 2R7ZH 2EYPA 2MFIA 2RBMA 4ALPA 1JJGA 2L12A 4DR1Q 4IFDH 1HQMC 4GLAC 1JOQA 3S14B 5LMNW 2WAQB 5JEAJ 3I8ZA 3UDXA 2RVLA 3TRZA 4MTNA 5IYDH 1RD9D 2ASBA 4FXKC 2BOSA 2NYZD 4I65A 4JI1Q 5A2QE 3T1YL 1HTLD 1N34L 4FVMA 1K73C 1Y14B 5C0XH 2I07B 4PNYA 4POFA 5IE8A 2PCFB 3D3RA 4YCUA 3CC7A 1SLJA 3HOYG 5ISRA 1EOVA 4BY7B 3M4PA 1EIYB 5FLXL 3A8KE 1RTOA 2WAQE 3HRZC 4LUOA 4OONA 1P8LA 2CW0C 3NWTA 3NWSA 4WORA 4C3HH 1T9HA 2SDFA 4K6LA 1A8VA 3G7LA 2ZM6L 4KKUA 4KHPL 4XIGS 3FHWA 3FEWX 3H6MA 4KJOA 2NVXH 2NVYB 2BE5D 3HG9A 1I4QA 1UAPA 1DJRD 4J15A 1H9SA 5A2QL 3CPFA 1JC7A 1VQPA 2IX0A 2LKVA 4IUNA 1RKNA 2NUCA 3FPUB 3NK9A 1WI5A 1SYGA 3NP8A 4RHSA 4GN5A 2MP1A 1W6JA 3NHHA 4PMBA 4UHVA 2E5LQ 1SE3A 5LMUL 1B70B 3VR3A 2V4DA 4DR2L 1R4PB 4HJ8A 1H9RA 2N49A 3DWPA 2B8FA 1NNXA 3H94A 2Q8TA 2IWHA 5I2XA 4A3BG 1KAWA 4OWTB 1ICWA 3FDTA 1CZWA 4TQUS 1I6VC 3QO2A 3QG1A 3M85A 3BYTB 3I56A 4B3RL 4DR7L 2VY3A 3HKZE 4G7OC 1SE2A 3H0GG 1T5EA 1NCVA 2JEBI 1C7YA 4NP5A 1DD2A 1FJGL 3HOVB 1FGBD 3L2PA 1EY8A 3GTLH 2F0GA 2X6LA 1QB5D 3Q0AA 4GKJQ 4OX9Q 1Z6HA 5FK9C 1QVFA 3DWQA 3K5OA 3MEHA 5IP9H 3HOYB 4IPCA 3S14H 3I91A 3IRBA 3KF8A 5CV8A 1VQCA 4CDFC 4IJLA 5ELFA 2BE5C 5EKIA 3HGBA 1KHIA 3KOJA 1VQMA 3C1FA 2WV6D 1SYBA 3HOZB 3NTIA 4NXNQ 1Y1WB 1X56A 3VYUA 1EFID 3W2DA 4DNIA 2K04A 3TDQA 4BY7H 2K7VA 1KRTA 3KK7A 4N9PA 3FVQA 3EFXD 1ET9A 1F9QA 1CM9A 1CKOA 1XJVA 1HXYD 1XNQL 2B39A 2KOLA 4X3SA 2AWOA 2XTIA 4TKOB 3VYTA 1S4ZA 4A4IA 5IYBH 4Y7NH 2UU9L 2JA8G 3I3CA 3T1HL 2YTXA 1X9NA 4QUFA 4DXGA 2NVYH 4UP9A 4G7ZC 2F0WA 4LF7L 1PH7A 2G5DA 5L37A 3G4SA 1TWAB 1GHKA 1PRTB 3CAMA 2Z6BA 2WACA 1QOHA 1K0SA 3D4RA 1NSNS 2DUDA 1B53A 4KI0A 3SK8A 3CD6A 4A3KH 3I4MG 1L2FA 1X65A 3HOXB 4DAMA 5IGCA 4LF8L 4A3MG 4R4OA 1AN8A 1F9SA 5FOBB 1Q1EA 4MNOA 4OGQC 2ZXRA 4A93G 1LTBD 3K6OA 1A0IA 4Y52H 1EFWA 2H1EA 3KUPA 4JI5Q 2R6GA 4G4KA 3KYHC 3DXJC 3CMAA 4JOIA 3M9BA 1VQKA 3AMUA 2DY7A 2ICEC 4L5RC 4X62Q 1QUQB 1XPRA 3GTGB 4X66Q 5C3EB 1I3QH 5A35A 4EQ5A 4DAPA 1D5XC 1KLGD 2EDGA 1CA6A 4A3GB 1LTID 2F4VL 1EIGA 2B2VC 3HOYH 3H3VI 2N78A 3PIOA 2Z1CA 3A7AB 1E22A 4QJFA 4JI1L 5JVG3 4BY1B 2EIFA 3HOZH 4XQQA 2Z6KA 3E5SA 3RZOB 2JA7B 1QVCA 2B29A 1Y1WH 3EN2A 2JK8A 3S2HB 2MGSA 3SK4A 3KLSA 2IHFA 5JJIA 4A3FG 1Q8KA 2F0JA 5IOCA 3Q22A 1DGSA 1MJEA 3K5MA 1HCZA 4X64L 1D8LA 2B8GA 2ZJRA 1JB7A 1PYBA 3OIQA 1QZHA 1GHJA 1YHQA 2JP1A 2JYOA 5BN5A 4R4QA 4F8MA 2KCMA 1MHWC 4HJAA 4IALA 2F0DA 2QDBA 3D4DA 1ET6A 4DUYQ 4GN4B 3RZDB 1BKBA 1SYFA 3UE1A 4RGMA 4ULLA 2R92G 4K6DA 5CGKA 5ELNA 1QILA 4EGVA 2B2UA 1SEBD 4A3BH 2FFKB 4HN7A 1II3A 2D0OA 1EYGA 4DUZQ 2JA6G 5EQ0A 2VS1A 3TP6A 5DNFA 3R93A 3UI2A 1PH8A 4KV6A 5D14A 1EY0A 3S1RB 2NZHA 3RMHA 4DPGA 3HOXH 4QF4A 1E3PA 1EOTA 2YU9H 4IURA 3P7JA 5KGUA 2K6AA 3PO2G 2UXBL 5K36H 4PQXA 1QG7A 2L55A 1IXRA 4PZ7A 1HH2P 2QEXA 2F0PA 4ZUJA 3C2PA 2R93B 1NTGA 2F0HA 5CMDA 1EEID 1PRTF 2CH4W 2CVRA 4CDCC 5T1GA 4YHHQ 1Q82C 1AEXA 5JOBA 3S1QB 1HR0W 3IKJA 3HP3A 1R9TH 1QNKA 1S40A 2UUCQ 4LF5Q 3GTGH 2B63B 5C3EH 3JAMc 4OX9L 3FRPB 2N8NA 4OEMB 1JB3A 5E4XA 2F3WA 4A3GH 2XRQD 3I73A 5IGDA 5I9OA 3TP7A 1U9RA 1HZAA 1EZ6A 4A3FB 3NXWA 1UWVA 1PTOB 2L4NA 1JJ2A 1PH9A 2KA7A 4C3JG 1YZ6A 1NMGA 1X3EA 1WCMB 3NSWA 3T4AC 1VQ6A 3VR6A 4I7AA 3DLLA 1PZJD 4KK7A 2JA7H 1QUQA 1V43A 2X69A 3BZDB 4OIJA 4DV6Q 2Z4IA 3S2HH 5COYA 1SYDA 4R4TA 4OO1H 2JA8H 1PZID 5KRUA 3LWEA 1L1OB 1F9PA 4KMUC 3CU7A 4E6IA 2FMCA 2NTSA 4J8QA 5CV4A 1SYCA 1IBMQ 2OQ0A 4LF9Q 3OMGA 3A8IE 1HA5A 1LACA 2GVBA 1O7LA 4A3LG 3RZDH 1STAA 3U4ZA 4ZRZA 2XWBB 1HQRD 3KLSX 3S24A 5M9OA 4IFDI 1PDQA 3MXGA 2IT1A 1GM5A 4A3MH 3KF6B 1A2TA 3F8TA 3S16B 4C2MB 1E24A 2YV5A 3KLRA 4O0AA 1AE2A 2OTJA 1W3SA 4APVA 1NR4A 4XT1B 3OMCA 4BS9A 2MJ8A 4QQBX 1TWHB 1OXVA 1G2SA 5CV9A 2F0NA 3TSSA 2KEDA 3OTOQ 3EROA 2C5CA 1VQIA 5IIFA 2UUBQ 1EQVA 1E0BA 3IFDA 3VYRA 1LTSD 4L5SA 3BG3A 1WD1A 2VB2X 2AHOB 1BCPD 4IO9A 3LX0A 2WKCA 4J6HA 3TMEA 5C4JB 4A3IG 4JI5L 2IL8A 2A1AA 5H1SE 4DV1Q 2R93H 3OWEB 5HURA 2YYZA 3S1QH 4KY5A 5M5WH 3RUZA 2B63H 4JI3L 3S2DH 4PZ8A 5M5XB 2XN9C 4IN3A 1S72A 2G9HD 4IUVA 3URYA 3I2ZA 2UXCL 4GN3B 1M1KC 2L1BA 3CQZB 1V1OA 4B3ML 5IGGA 4CDEC 4A3FH 1PTOH 3HOWG 4DU9A 1HFNA 1KD1C 3X3MA 1VF5C 2B3GA 1SJED 1HZBA 4F7XA 1BVSA 3CRKC 1WCMH 4R4CA 3HOUB 3L7ZC 5M3MB 1IBLQ 1FD7D
chains in the Genus database with same CATH topology
4DF7A 1KABA 4PMCA 1B44D 4ZKBB 2SEBD 2MUYA 1KNEA 1CK1A 2EY1A 4FXGC 4DGZA 2O5IC 5T1IA 1OXSC 3QOLA 4V0BA 4CGYB 2L11A 2B2WA 2KUMA 3P75A 1BCPC 2ID0A 3AU7A 3SDZA 1I6HB 5DM63 1JOOA 4F88A 5C6AA 5CBEE 3E6ZX 1U4MA 4EVOA 4DNRB 2DNEA 5CV7A 1JCKB 1TY2A 4H0LC 3J7AF 1MD2D 4X3TA 2WINB 3TZDA 3BVZA 1NUCA 1STYA 4N9TA 2A6ED 2K5WA 3PUYA 1S5FD 3GD7A 1LT6D 1BOSA 1JR0D 1S5DD 4WJWA 4UAIA 1TWFB 2PZUA 2DN8A 4XQJA 1M8AA 4R8NA 4QB4A 1I4GA 1IKMA 2SNMA 3E0JA 4HMJA 2MHVA 2OXPA 3T16A 5KYLA 3HOWB 4KY7A 2NN6I 2M9VA 1JQYD 1HUNA 4KTAA 4FYDA 4U673 3TN2A 1S5CD 3A56A 3K0YA 5I9PA 4KHZA 2XIWA 1W6KA 2NWGA 1EY9A 5CV6A 2F0MA 3IAYA 3BS1A 1GUGA 5LL6X 2EZVA 2R61A 2TSSA 3H3VC 1M4VA 3GTQB 2A6EC 2HQEA 2NN6G 3SE0A 3MHBA 3RLFA 1QJOA 2IW3A 5C3WA 5ELCA 2EY6A 4ZLTF 1I4RA 2E2HB 3R2TA 5HGTA 4HCEA 1WTPA 3C46A 3V96A 1STNA 3DMUA 2EJFC 4CHTB 2F3VA 2BDNA 5D3DA 1KDCA 2LFNA 3S1MB 3EA6A 1TQOA 3QOJA 3MAQA 1ESRA 2PYKA 4RGTA 1VDZA 1I4HA 1O7ZA 4Y7NB 1CT1D 3BVMA 1JICA 1VCIA 3J7YW 2AQ3B 3P20A 2D9UA 1ZXTA 1A6XA 1YNND 3NQIA 2NVQB 3HKZB 4ZAIA 1STBA 4HEDA 5C4XB 1B2TA 4A3KB 4S3SA 5J1ZA 3HS0C 3GQBA 5JEAH 4MN3A 1SNQA 3SHLA 2A69D 3SEBA 4NMZA 1BDOA 4ZKCB 3MXPA 1LO5D 3GTKB 2RDFA 2A74C 3IFTA 1I3QB 1CA5A 4C3IG 3MA2B 4R8IA 1EYDA 5FO8B 1LTTD 4OHJA 1SE4A 4KN4C 2NB0A 1B1ZA 5CBAE 1ESFA 1YNNC 3U9OA 2A6HD 1TS4A 1LT4D 2Z4HA 2WKDA 4Q5VA 2FJ2A 4OO1I 5G3LF 4QUCA 4RWSC 3CRLC 2A69C 3PMFA 4QIWB 4LMQD 3EQLC 3OWFA 1LABA 1DOLA 2VXWA 4XXEA 1SAPA 3J80E 3VR5A 4RA8A 4IZ8A 4A3BB 4I7ZC 1ENAA 2PZTA 2AUKA 5I6YA 1WTVA 4RAUC 4DK1A 1HPCA 4C1NI 1CFMA 2K5DA 4ZUIA 2SNSA 1ENCA 5EJWA 4ODGA 4IUTA 3H0GB 4ME5A 1X32A 4G7HC 2YU9B 2ENBA 2A6HC 1LV9A 1Y8OB 4KKTA 3VA5A 1PYWD 2K01A 2EXZA 2E2DC 2AQ2B 3J80L 1R4QB 2B2YC 2B2TA 1KTKA 4DXFA 1AZQA 5JVH3 4KD3A 3WOFA 1VF7A 1R9TB 3QIAA 3NUCA 1IYUA 1RDPD 5CYUA 1TKWB 4IUUA 2L9HA 3NTHA 1PLFA 2O2LD 5BN3A 5EPKA 4LAAA 4FF1A 1CQVA 3PO3B 2J7ZA 1DZ1A 2EPBA 3M4YA 4KJNA 3BDOA 3D31A 2F03A 3ZYYX 2JA8B 2QCPX 3NTKA 3BVGA 3EVQA 1RODA 2D2CC 1G8ZD 1EWCA 2OF1A 1UNSA 1SMYD 3H09A 1BCPB 4AYBB 2N55A 3I72A 2KVMA 2E76C 2F0TA 3I4MB 5I6WA 4A3MB 2Q8RE 1SYEA 4A93B 5J22A 3M3YB 3MVVA 3VA7A 1LTRD 1JORA 1I4XA 5IODA 4X3UA 2EYOA 1TIID 3ND9A 1DM0B 1E2VA 4YIJA 3J81E 3EJIA 1I4PA 4K14A 1FNUA 4IUQA 4K2KA 2JSOA 1Y8PB 5KNDA 1EEFD 1E2ZA 2M2LA 5M5WB 1B50A 1ZYRD 2K5QA 1SMYC 2IPKD 1LTAD 3S2DB 4HMIA 3Q24A 1FNWA 1ZEQX 1L0XB 3J81L 1PRTD 1A2UA 4L6TB 5EGTA 4L8JA 4KN7C 2VNUD 5I2YA 2R92B 3MFGA 3S15B 2N88A 1F9RA 4HAEA 5KIXA 4K8IA 5E3FA 2JA6B 1JE4A 3TP5A 1HHVA 1OXXK 4DAYA 2B2UC 5BN4A 1TS2A 2RDGA 1D5ZC 1ZYRC 2RSOA 2XVSA 2VB3X 2XSCA 5C0XI 1EWHA 4RCNA 3PO2B 2AUJD 1A3VA 1JWSD 4FF2A 4B9WA 1T5XD 1ILPA 2F1MA 3GV3A 4XDXA 3HZXA 1PRTC 3AB9A 4NW2A 5LL6S 4IFDG 3KBXA 4JBWA 1EU4A 1IYVA 1F2MA 2E2JB 3IL8A 3LWUA 3K5LA 3GTMB 4C3JB 1STEA 1MI2A 4ZK9B 4K2LA 2K28A 2EE1A 2EOTA 3PIP3 1F2ZA 2A73B 1XTCD 3FMCA 2BA0A 1STHA 4C3HG 1SSOA 4KKSA 2ZT9C 3DHQA 2I46A 4FF3A 3I70A 4Q0FA 3V05A 5LHY1 2O5JC 1PZKD 5IGBA 4RHRA 5FO7B 4WFN3 5ELDA 1RCVD 1U4RA 1KDAA 4B08A 4LJZC 4V190 2NZ1D 2ICIA 1WD0A 4IQZA 1EQTA 4CJ1B 1A3TA 3VYSA 1PTOF 1D5MC 1XXGA 2EY5A 4FF4A 4HTHA 1WVLA 1ZKOA 3Q23A 3Q6SA 2L5TA 2KQ3A 3G6JB 2RQXA 5E4WC 1J9OA 1SNPA 2MPMA 5C4ZA 3LNNA 4BBRB 4ZQ3A 4A3IB 1QE6A 1FR3A 3RD4A 2G9DA 3NQTA 1VMCA 1WTWA 2HCIA 4CJ0B 1G6ZA 3H91A 3ERQA 4K5VA 1J8IA 1F2YA 3ND8A 3TP8A 1GUTA 5IT9E 2KEEA 5CC4A 1MSGA 2E2IB 3S17B 4IFDJ 2NBFA 3T13A 3DUZA 1KLUD 2PNRC 5AFWA 3OHXC 2RDHA 3M4OB 1SNCA 5C5LA 5C0XJ 1TWGB 3V2TA 3D6WA 3N52A 3D4WA 2F4IA 4XT3B 3PUZA 2F0VA 3FPPA 4RKBA 2HCCA 2Y0SB 2F0KA 2PPBC 5JPNC 5KNBA 5DM73 1G91A 5IT9L 3R3OA 5M3FB 3I4NB 5CV5A 1PFMA 2D5DA 2R3ZA 1I50B 4RKLA 1O7YA 4MHEA 1ML0D 2E74C 4H7BA 3DWAA 3VR4A 1FNVA 1AW7A 2VUMB 3WOEA 4FXDA 1BBXC 3I90A 5JJZA 2HDLA 2GA4B 4HSPA 3NPPA 3I4LA 4B9XA 1TWCB 3F2UA 4DFAA 1EY6A 4QMGA 2RKSA 1G2TA 2IX1A 1HTPA 1LT3D 2BA1A 4K5WA 1MSHA 2HUGA 3QJYA 2DNCA 2OT2A 2K32A 1JOKA 1JWMD 4PV1C 3C1EA 1L0YB 1CQFA 2A68D 1TS3A 4IUPA 2OEOA 1STGA 4ILWA 1Q8IA 1Y1VB 1UUPA 1EU3A 3K7AB 1XWEA 1IW7D 2F0EA 5EBCA 1B9NA 3T56B 4A3EB 2O4XA 2M00A 3R2IA 2XWJB 2Q8IB 5JPMC 3M7NA 4BBSB 2FMMA 3SK5A 3K5NA 1DOKA 4F87A 1GUSA 5CORA 1D2BA 1EZ8A 1BO0A 1V1PB 4XYOA 1JWUD 5EPJA 2B2YA 3NBHA 4C56C 5D3IB 1B9MA 5FKAC 3TBIB 4DK0A 1RF2D 5K36G 2A68C 1X3PA 2B2VA 1ONLA 1V8QA 3SXHA 1H9MA 5ELEA 4FNFA 3OOCA 3PUXA 5M5YB 1IW7C 1TY0A 3L9AX 1PFNA 1SDFA 4DA2A 2DY8A 4CKBA 2EYMA 2EJMA 2RSNA 4A3JB 2E75C 1Z47A 4HR7B 3DEOA 4MIUA 1DONA 1HA6A 4QCLA 3MZ5A 5G3LD 2K05A 1YNJD 1PFBA 4OO1G 4PMWA 1C8CA 4KY6A 1GUNA 5C3XA 5JAVA 4FP5D 1SBBB 4BA2I 3N6RA 3SVMA 2L0CA 1EY7A 2EJGC 2NN6H 2KCNA 4C1NK 2JA5B 3S9WA 4GZYC 2F0SA 1HFGA 1GUOA 1CI3M 4C3IB 2A5HA 2QF7A 5E1FA 5TSSA 5DAUA 1F2LA 4XTCS 1LTGD 1RHPA 3BDLA 4XQNA 4OL7A 3CKIB 1MBYA 2F0UA 4DN4M 2WB1B 4K5XA 1LLRD 3QB3A 3GTOB 3BDCA 1BF4A 3U9SA 3R8BA 1QWYA 5C44B 4K8JA 1YNJC 2K1BA 1PMRA 1Q3LA 1V1PA 1KNAA 4L63B 2KHSA 3PUVA 3M7GA 3MWYW 1QCBD 1EY5A 2JXMB 2HDMA 4X3KA 1WTOA 5FO9B 4M8AA 2LMCB 1DOMA 4JK1C 3A7LA 1HRJA 2NTTA 2WIIB 2QKIC 1TT2A 2F0QA 3CHBD 4H13C 2C9OA 2J4XA 4HCSA 1TR5A 1RTNA 4ABNA 4HSVA 1QNUA 2EYHA 5C5MA 1O78A 2EYFA 2BDOA 2EYLA 1OO9B 1FYCA 1U4PA 1K83B 3D8GA 2F0OA 1TS5A 4RCOA 1CHQD 3BYYB 2F0LA 2B2TC 1IHZA 4EQPA 4U68A 1A15A 3JAME 1XX8A 1DCZA 4A3DB 1CTMA 3C3LA 4CKEA 5CR3A 3HEJA 2ZXPA 3WDNA 4CKCA 4TRDA 1S5ED 3GTJB 1NAPA 3PV0A 4EQOA 3MC0B 4WRDA 4DNTB 1AFPA 4ZYSA 1S5BD 2SOBA 2PW7A 3OPOA 1D1IA 5F2DA 1MGSA 3JAML 4RGNA 1AP0A 3TZUA 1F77A 1EYAA 1LT5D 3S1NB 5EKKA 1OXUA 4R9WA 1BQQT 1TU2B 1C48A 5EBDA 4KHVA 3OSOA 1B3AA 4OIKA 3ONAB 4Z9CB 2FINB 5D65A 3MXNA 2XRSD 1U4LA 1O80A 3MTSA 3MXUA 5NUCA 1IKLA 3D6CA 1Y69U 4RFBA 2K03A 2H4OA 3VR2A 1BCPF 1GJXA 5KEEA 1SJHD 1RJTA 4XYQA 3L3OC 3QWNA 3DM1A 1XYIA 4M1UB 1SNMA 4NDXA 2CQAA 2EVBA 2F0FA 1PXUA 4J1MA 2KCCA 2WP8J 1H9JA 2PW5A 3T51B 5C0XG 2X6GA 2D62A 1NR2A 2AQ1B 1AZPA 1K8MA 2KECA 4G57A 1Q1BA 3SR1A 1E2WA 1H9KA 2JEAI 3A54A 3W3AA 1KAAA 4TSSA 1WTRA 1B4OA 1SNOA 2J0TD 2F0IA 2Z8LA 1D1KA 4EQNA 1G291 5EKLA 3MFYA 5EPLA 2NVTB 4DAVA 3NE5B 4H44C 3K57A 3OW7A 2EY2A 5KNCA 1EY4A 4NKLA 2XNAC 1GUWA 2PQEA 1ENFA 2CHBD 1GOZA 3SK6A 1OXTA 3O13A 5JEAG 1C4QA 1WTQA 1EL0A 1KDBA 4O1NA 4BWGB 3KBGA 4FO2A 2BCOA 4UDUC 2R7ZB 1EYCA 3K59A 4RGOS 1SXTA 3ITPA 2TMPA 2PZWA 2LY7A 1PTOD 4RH6A 4LK1C 1K8OA 2IX3A 5K5PA 5KYIA 1Q90A 4KD4A 2QILA 2QEJC 3FKIB 2K33A 1DYQA 1TVXA 2LS01 1CHPD 1H9SB 2FHTA 3T53B 4CJ2C 4P2CB 4C3HB 3GP7A 5ELBA 3X3NA 3P1HA 1A3UA 3DEPA 2ZXOA 2RA4A 3PUWA 2PO4A 2KJXA 2NVXB 3J7AV 1BNZA 4BA1I 3PIO3 1GXDC 5DEHA 2JE6I 1VMPA 1DXMA 1BXTA 1BUVT 1UEAB 5J39A 5I4DA 3GO5A 3A8JE 1Z7TA 3OIPA 1SFOB 4O42A 5C4HA 1Q12A 3GV6A 1Y8NB 4CBVA 1SNDA 2CW0D 2AWNA 1PTOC 2IJ0A 2EYJA 2B2WC 5IGEA 3A55A 1EIHA 1IL8A 1CZGA 3NBIA 3K58A 5FLXE 1BR9A 1X3QA 1WTXA 3GTLB 4ID6A 5IGFA 2PMZB 3GTPB 1D6EC 1HUMA 1ILQA 2EYPA 2RBMA 2L12A 4IFDH 1HQMC 1JOQA 3S14B 2WAQB 5JEAJ 3I8ZA 2RVLA 1RD9D 4FXKC 2BOSA 2NYZD 4I65A 5A2QE 1HTLD 4FVMA 5C0XH 2I07B 4PNYA 2PCFB 3D3RA 5ISRA 4BY7B 5FLXL 3A8KE 1RTOA 3HRZC 2CW0C 3NWTA 3NWSA 4WORA 2SDFA 4K6LA 3G7LA 4KKUA 4XIGS 3FEWX 3H6MA 4KJOA 2NVYB 2BE5D 3HG9A 1I4QA 1UAPA 1DJRD 1H9SA 5A2QL 1JC7A 2IX0A 2LKVA 4IUNA 1RKNA 2NUCA 3FPUB 3NK9A 1SYGA 3NP8A 4RHSA 2MP1A 1W6JA 3NHHA 4PMBA 1SE3A 3VR3A 2V4DA 1R4PB 1H9RA 2Q8TA 3DWPA 2B8FA 3H94A 5I2XA 2IWHA 1ICWA 3FDTA 1CZWA 4TQUS 1I6VC 3QO2A 3QG1A 3M85A 3BYTB 4G7OC 1SE2A 1T5EA 1NCVA 2JEBI 4NP5A 1DD2A 3HOVB 1FGBD 1EY8A 2F0GA 2X6LA 1QB5D 3Q0AA 1Z6HA 5FK9C 3DWQA 3K5OA 3MEHA 3HOYB 3I91A 3KF8A 5CV8A 5EKIA 5ELFA 2BE5C 3HGBA 3C1FA 2WV6D 1SYBA 3HOZB 3NTIA 1Y1WB 3VYUA 1EFID 3W2DA 2K04A 3TDQA 2K7VA 3KK7A 4N9PA 3FVQA 3EFXD 1ET9A 1F9QA 1CM9A 1HXYD 2B39A 2KOLA 4X3SA 2AWOA 3VYTA 4TKOB 1S4ZA 3I3CA 4QUFA 4DXGA 4G7ZC 2F0WA 1TWAB 1GHKA 1PRTB 2WACA 1QOHA 3D4RA 1NSNS 1B53A 4KI0A 3SK8A 3HOXB 5IGCA 1AN8A 1F9SA 5FOBB 1Q1EA 4OGQC 2ZXRA 1LTBD 3K6OA 2H1EA 3KUPA 2R6GA 4G4KA 3DXJC 3AMUA 2DY7A 2ICEC 3GTGB 5C3EB 5A35A 4DAPA 1D5XC 1KLGD 2EDGA 1CA6A 4A3GB 1LTID 1EIGA 2B2VC 2Z1CA 3A7AB 5JVG3 4BY1B 4XQQA 3E5SA 3RZOB 2JA7B 3S2HB 2MGSA 3SK4A 3KLSA 2F0JA 5IOCA 3Q22A 3K5MA 1HCZA 2B8GA 3OIQA 1GHJA 2JP1A 2JYOA 5BN5A 4F8MA 4IALA 2F0DA 2QDBA 3D4DA 1ET6A 3RZDB 1SYFA 4RGMA 4ULLA 4K6DA 5CGKA 1QILA 4EGVA 2B2UA 1SEBD 2FFKB 4HN7A 1II3A 5EQ0A 3TP6A 5DNFA 3R93A 3UI2A 4KV6A 5D14A 1EY0A 3S1RB 3RMHA 4QF4A 1EOTA 4IURA 3P7JA 5KGUA 2K6AA 5K36H 4PQXA 1QG7A 2L55A 2F0PA 4ZUJA 3C2PA 2R93B 2F0HA 5CMDA 1EEID 1PRTF 2CVRA 5T1GA 1AEXA 5JOBA 3S1QB 3IKJA 3HP3A 1QNKA 2B63B 3FRPB 1JB3A 5E4XA 2F3WA 2XRQD 3I73A 5IGDA 5I9OA 3TP7A 1U9RA 1EZ6A 4A3FB 3NXWA 1PTOB 2L4NA 2KA7A 4C3JG 3T4AC 1WCMB 3NSWA 3VR6A 1PZJD 4KK7A 2X69A 1V43A 4OIJA 3BZDB 2Z4IA 5COYA 1SYDA 4OO1H 1PZID 5KRUA 3LWEA 1F9PA 4KMUC 3CU7A 4E6IA 2FMCA 2NTSA 4J8QA 5CV4A 1SYCA 3OMGA 3A8IE 1HA5A 1LACA 1O7LA 1STAA 4ZRZA 2XWBB 1HQRD 3KLSX 5M9OA 4IFDI 1PDQA 3MXGA 2IT1A 1A2TA 3S16B 4C2MB 3KLRA 1NR4A 4XT1B 3OMCA 4BS9A 2MJ8A 1TWHB 1OXVA 1G2SA 5CV9A 2F0NA 3TSSA 2KEDA 3EROA 2C5CA 5IIFA 1EQVA 1E0BA 3IFDA 3VYRA 1LTSD 3BG3A 1WD1A 2VB2X 1BCPD 3LX0A 2WKCA 4J6HA 3TMEA 5C4JB 2IL8A 3OWEB 5HURA 2YYZA 4KY5A 3RUZA 5M5XB 2XN9C 4IN3A 2G9HD 4IUVA 3URYA 2L1BA 3CQZB 1V1OA 5IGGA 1PTOH 4DU9A 1HFNA 3X3MA 1VF5C 1SJED 4F7XA 3CRKC 3HOUB 3L7ZC 5M3MB 1FD7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKC B;  4HSV A;  1AZQ A;  1HUN A;  2X69 A;  4OIJ A;  2NYZ D;  1C8C A;  1MI2 A;  2M2L A;  2K03 A;  2KEE A;  2B2Y C;  5COY A;  4ZK9 B;  2K28 A;  2MGS A;  1B50 A;  4ZKB B;  2EE1 A;  1MSG A;  2EOT A;  2B2T A;  4IUP A;  3LWE A;  1KNE A;  1RJT A;  3SVM A;  2K04 A;  5AFW A;  1U4P A;  5T1I A;  1CA5 A;  1F9P A;  3DM1 A;  4IUU A;  2L9H A;  1XYI A;  4ZLT F;  1F9Q A;  1TVX A;  2L11 A;  4R8I A;  1SSO A;  1CM9 A;  1RTO A;  1HFG A;  2B2W A;  1PLF A;  2FHT A;  2JP1 A;  2KUM A;  2JYO A;  3D6W A;  4CJ2 C;  1WTP A;  2KOL A;  3N52 A;  5EPK A;  4X3S A;  2B2T C;  1S4Z A;  5CBE E;  4U68 A;  2J7Z A;  2SDF A;  1DZ1 A;  2EPB A;  1A15 A;  1U4M A;  4XT3 B;  1XX8 A;  3G7L A;  2X6G A;  3I3C A;  5CBA E;  3DEP A;  1F2L A;  2BDN A;  2FMM A;  2RA4 A;  1DOK A;  1PDQ A;  2HCC A;  1NR2 A;  1AZP A;  4QUF A;  2KEC A;  4X3T A;  1RHP A;  1EL0 A;  2B2U A;  3TZD A;  5COR A;  1ROD A;  2FFK B;  1BNZ A;  1U4R A;  1G91 A;  1BO0 A;  2FJ2 A;  1ESR A;  1NR4 A;  4QUC A;  1PFM A;  2N88 A;  2NZ1 D;  2MJ8 A;  4XT1 B;  5EQ0 A;  1WTR A;  1NAP A;  1B4O A;  4RWS C;  5DNF A;  3R93 A;  3UI2 A;  1WD0 A;  1EQT A;  1F9R A;  1G2S A;  4HAE A;  4CJ1 B;  5EPJ A;  1B53 A;  4DN4 M;  2R3Z A;  1VMP A;  1JE4 A;  2B2Y A;  3FPU B;  5D14 A;  2KED A;  1G2T A;  4LMQ D;  1O7Z A;  2N55 A;  2MP1 A;  1BF4 A;  1O7Y A;  2KVM A;  1E0B A;  1DOL A;  3IFD A;  4MHE A;  4UAI A;  1HHV A;  2VXW A;  1ML0 D;  1WVL A;  5EPL A;  1F9S A;  4O42 A;  1EOT A;  1WD1 A;  2K1B A;  2B2U C;  2Q8T A;  1JIC A;  3GV6 A;  1SAP A;  1M8A A;  3Q6S A;  4IUR A;  1IKM A;  3P7J A;  1Q3L A;  1MGS A;  1ICW A;  3FDT A;  2D9U A;  4RA8 A;  3QO2 A;  1KNA A;  2RSO A;  1J9O A;  1X3P A;  5E4W C;  1ZXT A;  1AP0 A;  2B2V A;  2IL8 A;  2B2W C;  1QG7 A;  2H1E A;  2MPM A;  3KUP A;  2Q8R E;  1EIH A;  1BBX C;  3I90 A;  1IL8 A;  3MWY W;  1QE6 A;  1WTV A;  1GUW A;  5CMD A;  4RAU C;  2CVR A;  5T1G A;  4R9W A;  5JJZ A;  1NCV A;  2DY7 A;  2HDL A;  4ZAI A;  1X3Q A;  2HDM A;  4X3K A;  1PFN A;  1SDF A;  3HP3 A;  1QNK A;  4HED A;  4IUT A;  5EJW A;  4X3U A;  1WTO A;  3F2U A;  2DY8 A;  2X6L A;  1WTQ A;  1B2T A;  1DOM A;  1VMC A;  2RSN A;  1WTW A;  1WTX A;  4IUV A;  5E4X A;  1ILP A;  1X32 A;  3TN2 A;  1B3A A;  2HCI A;  3GV3 A;  4MN3 A;  4OIK A;  4XDX A;  4CJ0 B;  1HUM A;  2L1B A;  3ONA B;  1CA6 A;  3DEO A;  2FIN B;  1ILQ A;  2XIW A;  4NW2 A;  2NWG A;  5D65 A;  1G6Z A;  3H91 A;  1HRJ A;  3KBX A;  1EIG A;  2B2V C;  1DON A;  1HFN A;  1LV9 A;  2L4N A;  1HA6 A;  1U4L A;  2L12 A;  3I91 A;  4IUQ A;  1J8I A;  2K01 A;  1MSH A;  2HUG A;  1O80 A;  3IL8 A;  4HCS A;  3I8Z A;  2RVL A;  5EKI A;  3MTS A;  1RTN A;  2K05 A;  1IKL A;  1PFB A; 
#chains in the Genus database with same CATH topology
 4DF7 A;  1K9M C;  1KAB A;  3PQI A;  4PMC A;  1B44 D;  4ZKB B;  2SEB D;  2MUY A;  1KNE A;  1CK1 A;  2EY1 A;  4P73 A;  4FXG C;  4QGU A;  4DGZ A;  2O5I C;  3E0E A;  1OXS C;  2RCF A;  5T1I A;  3QOL A;  3FP9 A;  3S15 H;  4V0B A;  4CGY B;  2L11 A;  2K5N A;  2B2W A;  2KUM A;  3P75 A;  1BCP C;  2ID0 A;  3AU7 A;  3SDZ A;  1VQO A;  1I6H B;  5DM6 3;  1JOO A;  4F88 A;  5C6A A;  1J5E Q;  5CBE E;  3E6Z X;  1U4M A;  4LUV A;  3RLO A;  4EVO A;  4DNR B;  2DNE A;  2Y0S G;  4R4I A;  5CV7 A;  1JCK B;  1TY2 A;  4H0L C;  3J7A F;  1MD2 D;  3I4N G;  4C2M H;  4X3T A;  2WIN B;  3TZD A;  3BVZ A;  4DUZ L;  1NUC A;  1STY A;  1TWH H;  2VQE Q;  4N9T A;  3PF5 A;  3TS2 A;  2A6E D;  2K5W A;  3PUY A;  1S5F D;  2QDL A;  4LNQ A;  1VQ4 A;  3GD7 A;  1LT6 D;  1BOS A;  1JR0 D;  1S5D D;  4WJW A;  4UAI A;  1TWF B;  2PZU A;  2VUM G;  2DN8 A;  4XQJ A;  4DV2 Q;  1M8A A;  4R8N A;  4QB4 A;  1I4G A;  1IKM A;  2SNM A;  5C4J H;  3E0J A;  4HMJ A;  2MHV A;  2OXP A;  3T16 A;  3UDF A;  5KYL A;  3HOW B;  4C3J H;  4KY7 A;  1SE8 A;  2NN6 I;  2M9V A;  5LMN Q;  2UUC L;  1KQS A;  4LF5 L;  1JQY D;  4K0K L;  5M5X H;  1HUN A;  4KTA A;  4FYD A;  2K5H A;  4U67 3;  1VQD A;  4N8F A;  4JI6 L;  3CQZ H;  1G51 A;  3TN2 A;  1S5C D;  3A56 A;  4MZ9 A;  3K0Y A;  5I9P A;  4KHZ A;  5DLQ E;  2XIW A;  1W6K A;  2NWG A;  1EY9 A;  5CV6 A;  2F0M A;  3CPW A;  3IAY A;  3HOU H;  3BS1 A;  5M3M H;  1GUG A;  4GS3 A;  5LL6 X;  2EZV A;  4DV6 L;  2R61 A;  4HJ7 A;  4DR3 Q;  2TSS A;  1PH6 A;  3H3V C;  1M4V A;  3GTQ B;  1Y1V G;  4A3L H;  2A6E C;  4BXX G;  1X3F A;  2HQE A;  2NN6 G;  1PH3 A;  3AEV A;  3SE0 A;  3MHB A;  3RLF A;  1QJO A;  2IW3 A;  5C3W A;  5ELC A;  2EY6 A;  4LFC L;  4ZLT F;  4A3E G;  1I4R A;  2E2H B;  3R2T A;  5HGT A;  1I6H H;  1YIT A;  4LF9 L;  4HCE A;  1QVG A;  1WTP A;  3C46 A;  2ZTC A;  3V96 A;  4BBS G;  1STN A;  3DMU A;  4HIM A;  2EJF C;  1B3Q A;  2ZTE A;  4ME3 A;  4CHT B;  2F3V A;  1N32 Q;  2BDN A;  5FLX c;  5D3D A;  1W2B A;  1KDC A;  2LFN A;  3S1M B;  1BBW A;  3EA6 A;  1TQO A;  2P5Z X;  2HQL A;  3QOJ A;  3MAQ A;  1ESR A;  1V1Q A;  2PYK A;  2MNA A;  1LM0 A;  4O2D A;  3CCE A;  4RGT A;  3RN5 A;  1K8G A;  3OTO L;  1VDZ A;  1HNX Q;  1I4H A;  4LF4 Q;  2OQK A;  1O7Z A;  2UUB L;  2K50 A;  3BZC A;  1CT1 D;  4Y7N B;  1TWF H;  2ZJP A;  1YEZ A;  3BVM A;  1JIC A;  1VCI A;  5IYC H;  2EXD A;  3J7Y W;  2AQ3 B;  2RHS B;  3P20 A;  3STB D;  2D9U A;  1U0L A;  5IWA Q;  2UUA Q;  3K8A A;  1ZXT A;  1A6X A;  3HOW H;  3I7F A;  1YNN D;  4A75 A;  3NQI A;  2NVQ B;  3HKZ B;  1GD7 A;  4ZAI A;  4A3J G;  1STB A;  4HED A;  2E2I H;  5C4X B;  1B2T A;  1PVO A;  4A3K B;  4S3S A;  5J1Z A;  3HS0 C;  4HIO A;  5GAE C;  3GQB A;  5JEA H;  1EWI A;  4MN3 A;  1SNQ A;  3SHL A;  2A69 D;  3M4O H;  3SEB A;  3TRE A;  1TWG H;  4GKK L;  4NMZ A;  1BDO A;  2ATW A;  2A8V A;  4ZKC B;  3MXP A;  1H95 A;  1LO5 D;  3GTQ H;  4JI2 L;  1X54 A;  3GTK B;  3A5Z B;  1ICF B;  2RDF A;  2JA5 G;  2A74 C;  3IFT A;  1UE1 A;  1I3Q B;  1CA5 A;  4C3I G;  2E2H H;  3MA2 B;  4R8I A;  1EYD A;  5FO8 B;  4YWL A;  1LTT D;  4OHJ A;  5GAG C;  1J5E L;  4HIK A;  1I50 H;  4EX5 A;  1SE4 A;  3STB C;  4KN4 C;  2NB0 A;  2RHQ B;  1B1Z A;  5CBA E;  1ESF A;  3PSI A;  1YNN C;  1XNR L;  1HNW L;  3U9O A;  2A6H D;  1Q46 A;  2KHJ A;  3CC4 A;  3S1M H;  3ULL A;  4RG1 A;  1TS4 A;  1LT4 D;  2VUM H;  4YY3 Q;  4JYA L;  2Z4H A;  1ASY A;  2WKD A;  4Q5V A;  2FJ2 A;  2WB1 G;  2VQE L;  4OO1 I;  5G3L F;  4QUC A;  3PO3 G;  4RWS C;  3CRL C;  2OCE A;  3ULP A;  2A69 C;  1PFS A;  1UEB A;  3PMF A;  4LFB Q;  4QIW B;  5C44 G;  4LMQ D;  3EQL C;  3OWF A;  1N8R C;  1LAB A;  1DOL A;  4DV2 L;  2VXW A;  4XXE A;  3ER0 A;  4JI7 L;  1SAP A;  3J80 E;  4NXM L;  4WJ4 A;  3VR5 A;  4RA8 A;  1XMO L;  4IZ8 A;  1I5F A;  4A3B B;  4I7Z C;  4IJH A;  1ENA A;  5HGQ A;  2PZT A;  2AUK A;  4AYB G;  5I6Y A;  1WTV A;  4DR4 Q;  2NVQ H;  4JV5 Q;  4QIW E;  5LMN L;  4RAU C;  4DK1 A;  1HPC A;  3CCL A;  2OTL A;  4C1N I;  1TXY A;  1CFM A;  2K5D A;  4ZUI A;  2SNS A;  5C4X H;  1ENC A;  3E9I A;  5EJW A;  4ODG A;  4IUT A;  1AE3 A;  3H0G B;  2GN5 A;  2JQO A;  3G48 A;  4ME5 A;  1Y1V H;  1X32 A;  4BXX H;  4R1J A;  1YJ9 A;  4G7H C;  2YU9 B;  2ENB A;  1HNZ Q;  1IBK L;  3EIV A;  1JE5 A;  2A6H C;  1LV9 A;  2K75 A;  1Y8O B;  2HIX A;  4KKT A;  2KBN A;  3VA5 A;  1PYW D;  2K01 A;  3B6Y A;  2EXZ A;  2E2D C;  2AQ2 B;  3J80 L;  1R4Q B;  2B2Y C;  2B2T A;  1KTK A;  4IPG A;  4DXF A;  1AZQ A;  5JVH 3;  1PV4 A;  4BBS H;  2WFW A;  3GTK H;  4KD3 A;  3WOF A;  1VF7 A;  4WJ3 M;  4JI0 Q;  4JI4 Q;  1R9T B;  3QIA A;  4DV3 L;  3NUC A;  1IYU A;  1GVP A;  1PH2 A;  3CCM A;  2DGY A;  2KEN A;  1J6Q A;  2YTV A;  1RDP D;  1XPO A;  5CYU A;  1TKW B;  4IUU A;  1I94 Q;  2L9H A;  3NTH A;  4JBJ A;  4DR1 L;  4GNX C;  1PLF A;  1LTL A;  1VQ5 A;  2O2L D;  5BN3 A;  4A3D G;  5EPK A;  4LAA A;  4FF1 A;  1CQV A;  4DKA C;  3PO3 B;  2J7Z A;  2RCN A;  1DZ1 A;  2EPB A;  3M4Y A;  1KL9 A;  2AKW B;  4KJN A;  3BDO A;  3D31 A;  2F03 A;  3ZYY X;  2Q2U A;  2JA8 B;  2QCP X;  3NTK A;  4OEL B;  4QY7 A;  3BVG A;  4DAY B;  3EVQ A;  1ROD A;  3JAM i;  2D2C C;  2UXD Q;  1G8Z D;  1EWC A;  2OF1 A;  1UNS A;  1SMY D;  5ELO A;  3H09 A;  1BCP B;  1GKH A;  4AYB B;  1YI2 A;  2Q2T A;  2N55 A;  3I72 A;  4AQY Q;  2KVM A;  1HR0 Q;  4A3J H;  2E76 C;  4P72 A;  2F0T A;  3I4M B;  1EQR A;  1X3G A;  4CDD C;  1ASZ A;  2UUA L;  5I6W A;  2PNH A;  4A3M B;  3E9H A;  3W5O A;  3H15 A;  2Q8R E;  4NPS A;  1SYE A;  4NB3 A;  5J22 A;  5FLM G;  4AYB E;  3I55 A;  3M3Y B;  4A93 B;  1SMX A;  1D7Q A;  2PI2 E;  3MVV A;  3VA7 A;  1WJJ A;  1LTR D;  2E5L L;  2JA9 A;  1JOR A;  1I4X A;  5IOD A;  3H0G H;  4X3U A;  1SN8 A;  2EYO A;  1TII D;  3KDF B;  4JCV E;  1IZ6 A;  3ND9 A;  1DM0 B;  1E2V A;  4YIJ A;  3J81 E;  1YHA A;  3EJI A;  1E1O A;  1PH1 A;  3L0O A;  1I4P A;  4K14 A;  2AMC B;  1FNU A;  2CWA A;  4IUQ A;  4K2K A;  2JSO A;  1Y8P B;  5KND A;  4P74 A;  2OWO A;  1EEF D;  1E2Z A;  2ZJQ A;  2M2L A;  3AQQ A;  1WTH A;  3CCQ A;  5M5W B;  1B50 A;  1ZYR D;  2K5Q A;  1SMY C;  2IPK D;  4GKJ L;  4PZ6 A;  1LTA D;  3S2D B;  4HMI A;  3Q24 A;  1VQ7 A;  1FNW A;  2XGT A;  5BR8 Q;  2V1C C;  4YCW A;  3A0J A;  1ZEQ X;  3DM3 A;  4GOP B;  1L0X B;  4H02 A;  3PO3 H;  1CKN B;  3GTO H;  3J81 L;  1PRT D;  1A2U A;  4NXN L;  4B3S Q;  1NBW A;  4L6T B;  5EGT A;  4L8J A;  2IY5 B;  4DR5 Q;  4KN7 C;  2VNU D;  5I2Y A;  2N3S A;  1IL2 A;  5AJ3 Q;  2R92 B;  1Z9F A;  3MFG A;  2NZO A;  1XTD A;  2HHH Q;  3F2B A;  3S15 B;  2N88 A;  1F9R A;  4HAE A;  2R7F A;  4LFB L;  5KIX A;  4JI8 Q;  4K8I A;  5E3F A;  3UDG A;  1JE4 A;  3PGZ A;  2JA6 B;  3TP5 A;  3QR8 A;  4GLX A;  1CSP A;  1VQA A;  1K8A C;  4PG3 A;  1HHV A;  4B3T Q;  1OXX K;  4DK3 C;  3I4M H;  3G71 A;  4DAY A;  2B2U C;  4LFA Q;  5BN4 A;  1TS2 A;  4UP8 A;  4LF6 Q;  2RDG A;  1D5Z C;  1A63 A;  1ZYR C;  2RSO A;  2XVS A;  2VB3 X;  2XSC A;  5C0X I;  1EWH A;  4DR4 L;  4RCN A;  4A93 H;  1SRU A;  3M3Y H;  3PO2 B;  2AUJ D;  1JJC B;  1A3V A;  3J7Z C;  1JWS D;  4FF2 A;  3NEM A;  4B9W A;  1E7Z A;  3NEN A;  2L15 A;  1N34 Q;  1T5X D;  3K0X A;  1GO3 E;  4X65 Q;  2R7Z G;  1ILP A;  2F1M A;  3GV3 A;  4XDX A;  3HZX A;  1KIX A;  1PRT C;  3AB9 A;  4NW2 A;  5LL6 S;  4BBR G;  3KBX A;  4JBW A;  4IFD G;  1EU4 A;  1IYV A;  4P71 A;  1RL2 A;  1F2M A;  2E2J B;  3U4V A;  3IL8 A;  2F3I A;  3LWU A;  3K5L A;  4IPD A;  3GTM B;  4A3D H;  4C3J B;  1STE A;  4X62 L;  1MI2 A;  1V9P A;  4ZK9 B;  4JI4 L;  3FKI G;  4K2L A;  3KDF A;  2K28 A;  2EE1 A;  4X66 L;  3PCO B;  2EOT A;  1I94 L;  4L5Q A;  1SR3 A;  1F2Z A;  5GAD C;  3PIP 3;  1XPU A;  1PH4 A;  2A73 B;  1XTC D;  3FMC A;  2BA0 A;  1STH A;  4C3H G;  1SSO A;  4KKS A;  1G6P A;  3DHQ A;  2ZT9 C;  1C0A A;  2I46 A;  3CXC A;  1VS0 A;  4FF3 A;  3I70 A;  4Q0F A;  3V05 A;  3H3V H;  5FJ8 G;  2F52 A;  5LHY 1;  3RN2 A;  2O5J C;  1PZK D;  5IGB A;  1WOC A;  4RHR A;  5FO7 B;  2R92 H;  4WFN 3;  4DV0 Q;  5ELD A;  4GOP A;  1RCV D;  1U4R A;  1KDA A;  4QL5 A;  4B08 A;  4LJZ C;  4V19 0;  2UXD L;  2NZ1 D;  2ICI A;  1WD0 A;  4IQZ A;  1CKN A;  1EQT A;  3S1N H;  4CJ1 B;  1A3T A;  2JA6 H;  4B3R Q;  4DR7 Q;  3VYS A;  1PTO F;  5FLM H;  1D5M C;  1XXG A;  4HID A;  4DUY L;  2EY5 A;  4AQY L;  3CP0 A;  4UY8 C;  4FF4 A;  4HTH A;  1WVL A;  2K14 A;  5JJL A;  1ZKO A;  1WYD A;  3Q23 A;  5M3F G;  3Q6S A;  1L1O A;  1A62 A;  2CCZ A;  2L5T A;  2KQ3 A;  3G6J B;  3CF5 A;  2RQX A;  5E4W C;  1J9O A;  1SNP A;  2MPM A;  3PO2 H;  5C4Z A;  3LNN A;  4BBR B;  4ZQ3 A;  4A3I B;  1QE6 A;  1FR3 A;  2DJF C;  3RD4 A;  4DV4 Q;  3J81 j;  2G9D A;  3NQT A;  1KXL A;  1VMC A;  1WTW A;  1B8A A;  2VL6 A;  3KF6 A;  2HCI A;  4CJ0 B;  4UP7 A;  5IP9 G;  4IPH A;  1G6Z A;  3H91 A;  2WAQ G;  3RNU A;  3ERQ A;  4K5V A;  2C35 B;  2E2J H;  5IY0 A;  1J8I A;  1F2Y A;  3ND8 A;  1MJC A;  2PQA B;  1VQH A;  3GTM H;  3TP8 A;  4YHH L;  3BJU A;  2K4K A;  1GUT A;  2Q2I A;  5IT9 E;  2KEE A;  1VQB A;  5CC4 A;  2UU9 Q;  1MSG A;  4BY7 G;  2E2I B;  3S17 B;  4IFD J;  2NBF A;  1EIF A;  3DUZ A;  3T13 A;  1KLU D;  2PNR C;  4POG A;  5AFW A;  3OHX C;  4LF7 Q;  2RDH A;  4OXP A;  3M4O B;  1SNC A;  5C5L A;  5C0X J;  1TWG B;  3V2T A;  1NY4 A;  1RIP A;  4TVA B;  3D6W A;  3N52 A;  3D4W A;  2F4I A;  1NMF A;  3WWV A;  4XT3 B;  1VQF A;  4B3S L;  4A3C G;  3NBH B;  3PUZ A;  1UE6 A;  2F0V A;  3FPP A;  4DV7 Q;  4RKB A;  2HCC A;  2NVT H;  2H5X A;  1EUJ A;  2Y0S B;  2F0K A;  3HKS A;  2HHH L;  5JPN C;  2PPB C;  5KNB A;  5DM7 3;  1G91 A;  5IT9 L;  2KCT A;  3R3O A;  2CKZ B;  1N9W A;  4DK6 C;  5M3F B;  3I4N B;  5CV5 A;  1PFM A;  1IBM L;  4GNX B;  2D5D A;  2R3Z A;  1I50 B;  4RKL A;  4B3T L;  1O7Y A;  4MHE A;  2Y0S E;  4LFA L;  1ML0 D;  1HZC A;  4JBM A;  3E3X A;  2E74 C;  4H7B A;  3DWA A;  2VZA A;  3VR4 A;  3KJP A;  1JMC A;  1FNV A;  1AW7 A;  2VUM B;  5IP7 G;  2F4V Q;  3WOE A;  4FXD A;  4BBR H;  4A3I H;  1PHJ A;  1BBX C;  3I90 A;  3HOV G;  2FXQ A;  5JJZ A;  2HDL A;  2GA4 B;  3CCR A;  4HSP A;  2PMZ E;  3NPP A;  3I4L A;  4B9X A;  1TWC B;  3F2U A;  4DFA A;  4X65 L;  3CME A;  1EY6 A;  2MO0 A;  3FKI H;  4QMG A;  2RKS A;  1G2T A;  2IX1 A;  2I5L X;  3ICE A;  1HTP A;  1LT3 D;  4X64 Q;  2BA1 A;  4DV1 L;  4K5W A;  1MSH A;  2HUG A;  3HOZ G;  2ES2 A;  3QJY A;  2DNC A;  2OT2 A;  2K32 A;  1Y1W G;  5EAY A;  4JPB W;  1JOK A;  1JWM D;  4PV1 C;  3C1E A;  1L0Y B;  1CQF A;  2A68 D;  4YCV A;  3S17 H;  1TS3 A;  4IUP A;  5FJ8 H;  2OEO A;  1STG A;  4ILW A;  1Q8I A;  1Y1V B;  3OYY A;  1K28 A;  1UUP A;  1EU3 A;  3K7A B;  2CWP A;  1XWE A;  1IW7 D;  2PQA A;  1IBL L;  2EQS A;  2F0E A;  4LWC A;  2E8G A;  5EBC A;  1B9N A;  1YHB A;  3T56 B;  4A3E B;  2O4X A;  2M00 A;  3R2I A;  2XWJ B;  2Q8I B;  5JPM C;  2Q2H A;  3OW2 A;  1SFO H;  3M7N A;  4BBS B;  2FMM A;  3SK5 A;  3K5N A;  4IOA A;  1DOK A;  4F87 A;  1GUS A;  3UE0 A;  4DV0 L;  5COR A;  1D2B A;  1EZ8 A;  5M3F H;  3I4N H;  1BO0 A;  2UXB Q;  1V1P B;  3W1B A;  4XYO A;  4HJ5 A;  4L5T A;  1JWU D;  5EPJ A;  1NE3 A;  3HOX G;  3J80 i;  2LSS A;  2B2Y A;  3NBH A;  4C56 C;  3CCV A;  5D3I B;  1B9M A;  1L0W A;  4X6A H;  5FKA C;  2I0Q A;  2K5V A;  3TBI B;  3GTP H;  4DK0 A;  1RF2 D;  3PIP A;  1C9O A;  1X6O A;  5K36 G;  2A68 C;  1YJN A;  1X3P A;  2B2V A;  3U58 A;  1Q86 C;  1ONL A;  4GNX A;  3G6E A;  1V8Q A;  4DV4 L;  3SXH A;  1H9M A;  5E7N A;  5ELE A;  4FNF A;  1YVC A;  3OOC A;  3PUX A;  5C3E G;  5M5Y B;  1IW7 C;  1TY0 A;  2DJG C;  3L9A X;  1TWC H;  1PFN A;  1SDF A;  4DA2 A;  3CCJ A;  2DY8 A;  4CKB A;  4A3G G;  2EYM A;  2EJM A;  2RSN A;  3BZK A;  1YIJ A;  4A3J B;  3U50 C;  3AYH B;  2E75 C;  1Z47 A;  4HR7 B;  3DEO A;  3ERS X;  1K3R A;  4MIU A;  5GQO A;  4AH6 A;  1DON A;  1HA6 A;  4BY1 G;  4QCL A;  3MZ5 A;  5G3L D;  2JA7 G;  3NEL A;  2K05 A;  3CC2 A;  2CFM A;  1YNJ D;  1PFB A;  4OO1 G;  4PMW A;  1N33 Q;  1C8C A;  1Q7Y C;  4KY6 A;  1GUN A;  5C3X A;  5JAV A;  4A3C H;  1U5K A;  4FP5 D;  1SBB B;  1VQE A;  4BA2 I;  3N6R A;  3SVM A;  2L0C A;  1EY7 A;  2EJG C;  3K7U C;  2NN6 H;  1CKM A;  3K7A H;  2KCN A;  4C1N K;  3J80 c;  1HJP A;  2VQF Q;  2JA5 B;  3S9W A;  4GZY C;  2F0S A;  1HFG A;  1GUO A;  1CI3 M;  1LUZ A;  4C3I B;  4A3E H;  2A5H A;  4DR3 L;  2QF7 A;  5E1F A;  2QGQ A;  1N36 Q;  2BH2 A;  4DV7 L;  3M4Q A;  5TSS A;  5DAU A;  1F2L A;  1YNX A;  4XTC S;  3HFZ B;  1JT8 A;  1LTG D;  1RHP A;  3BDL A;  4XQN A;  1XMQ Q;  3UDI A;  1YBY A;  4OL7 A;  3CCS A;  3CKI B;  4FDB A;  5IP7 H;  1MBY A;  2F0U A;  4DN4 M;  2WB1 B;  3HOV H;  3TEH B;  4K5X A;  1LLR D;  3QB3 A;  3GTO B;  3PF4 A;  1N32 L;  3BDC A;  1BF4 A;  3U9S A;  3R8B A;  3A5U A;  4JI3 Q;  5JJK A;  1QWY A;  5C44 B;  4K8J A;  1YNJ C;  2K1B A;  1HZ9 A;  2YTY A;  1PMR A;  4A76 A;  1VQ8 A;  1Q3L A;  2UXC Q;  1V1P A;  4B3M Q;  2R93 G;  1KNA A;  4L63 B;  2KHS A;  3PUV A;  4DR6 Q;  2WB1 E;  3MXN B;  3M7G A;  3MWY W;  1SRO A;  1HNX L;  4LF4 L;  1MIU A;  2B63 G;  5M5Y H;  3J81 i;  1QCB D;  1EY5 A;  2JXM B;  2A19 A;  3AFQ A;  2HDM A;  4X3K A;  1WTO A;  5FO9 B;  4M8A A;  2LMC B;  1DOM A;  4JK1 C;  3GDE A;  3A7L A;  2R7D A;  5IWA L;  1UE5 A;  1HRJ A;  1WCM G;  2NTT A;  2WII B;  2QKI C;  4DV5 Q;  1P16 A;  1TT2 A;  2F0Q A;  3CHB D;  4LW1 A;  4H13 C;  2C9O A;  2J4X A;  4HCS A;  1TR5 A;  1RTN A;  4ABN A;  4HSV A;  1QNU A;  1VQG A;  2EYH A;  5C5M A;  1O78 A;  2EYF A;  2BDO A;  3EBE A;  3VDY A;  2EYL A;  1OO9 B;  1FYC A;  1BBU A;  1U4P A;  1K83 B;  1TWA H;  3ULJ A;  2ALY B;  4HJ9 A;  2JA5 H;  3J7A 5;  3D8G A;  2F0O A;  2MO1 A;  3JC6 6;  4C3I H;  1TS5 A;  4RCO A;  1CHQ D;  3BYY B;  2F0L A;  2B2T C;  1FL0 A;  1IHZ A;  1CSQ A;  4JOI C;  4EQP A;  1B7Y B;  4U68 A;  1A15 A;  3JAM E;  1XX8 A;  1DCZ A;  4A3D B;  1CTM A;  3C3L A;  1KC8 C;  4YWK A;  4CKE A;  5CR3 A;  3HEJ A;  3RR5 A;  2ZXP A;  4YWM A;  3J81 c;  4GLV B;  1E1T A;  3WDN A;  1YJW A;  4CKC A;  3CCU A;  4TRD A;  1S5E D;  3GTJ B;  1NAP A;  3PV0 A;  4EQO A;  5J3B A;  3MC0 B;  4JVZ A;  1WFQ A;  4JC0 A;  4WRD A;  2MQH A;  3I4O A;  3F2D A;  2Z6K C;  4DNT B;  1AFP A;  4OWX B;  5C44 H;  4K0K Q;  4ZYS A;  1S5B D;  3RLN A;  1KRS A;  2SOB A;  3ZJY C;  2PW7 A;  3OPO A;  4YY3 L;  1D1I A;  4JI6 Q;  5F2D A;  3F1Z A;  1MGS A;  4JG2 A;  2VW9 A;  1QZG A;  3JAM L;  4RGN A;  1AP0 A;  3TZU A;  1F77 A;  1EYA A;  2ZTD A;  1LT5 D;  4BY1 H;  3S1N B;  3RZO H;  5EKK A;  1OXU A;  4R9W A;  1BQQ T;  1TU2 B;  2QA4 A;  1VQL A;  1CUK A;  1C48 A;  5EBD A;  4KHV A;  3OSO A;  4ZCK A;  2JJQ A;  1B3A A;  4OIK A;  3ONA B;  4Z9C B;  2FIN B;  3HOU G;  5D65 A;  5M3M G;  3D0F A;  3MXN A;  4LFC Q;  2XRS D;  1VQ9 A;  1U4L A;  4JV5 L;  1O80 A;  1PH5 A;  3MTS A;  3MXU A;  1N33 L;  5NUC A;  1IKL A;  2PI2 A;  3D6C A;  1Y69 U;  4RFB A;  2K03 A;  2H4O A;  1EQQ A;  3T1Y Q;  3VR2 A;  1BCP F;  1GJX A;  5KEE A;  1SJH D;  1K3B C;  1RJT A;  1K83 H;  4XYQ A;  3L3O C;  1HNZ L;  3QWN A;  3DM1 A;  2VQF L;  2I5M X;  4N8X 1;  1XYI A;  3A74 A;  2I5H A;  4M1U B;  1SNM A;  4NDX A;  5IYD G;  2CQA A;  2D0P A;  2EVB A;  2F0F A;  3S1R H;  1PXU A;  4J1M A;  2KCC A;  1N36 L;  2WP8 J;  5GRO A;  1IYJ B;  1H9J A;  2PW5 A;  3BU2 A;  3T51 B;  3AFP A;  5C0X G;  2X6G A;  4JW0 A;  4JI0 L;  2D62 A;  3TQY A;  2ZM6 Q;  3KJO A;  4KHP Q;  1NR2 A;  2AQ1 B;  1AZP A;  1K8M A;  2KEC A;  4G57 A;  1Q1B A;  3SR1 A;  1XMQ L;  1E2W A;  1H9K A;  2JEA I;  3A54 A;  3W3A A;  1FGU A;  4P75 A;  1KAA A;  1AH9 A;  4TSS A;  3GTJ H;  1WTR A;  2GVA A;  3TS0 A;  2CQO A;  1B4O A;  1LYL A;  1NJI C;  1SNO A;  2J0T D;  2F0I A;  1OTC A;  2Z8L A;  1D1K A;  1Q81 C;  4EQN A;  1G29 1;  5EKL A;  5IYC G;  2IHE A;  3MFY A;  5EPL A;  5LMU Q;  1UE7 A;  4MTK A;  4DR2 Q;  2NVT B;  4DAV A;  3NE5 B;  1S3O A;  4H44 C;  4OWW B;  3K57 A;  1PA6 A;  4DR6 L;  3OW7 A;  3MEF A;  2EY2 A;  5KNC A;  1EY4 A;  4GKK Q;  4NKL A;  2XNA C;  2LXK A;  2Z0S A;  1GUW A;  2PQE A;  1ENF A;  2HIV A;  2CHB D;  1GOZ A;  2LXJ A;  3SK6 A;  1OXT A;  3O13 A;  5JEA G;  1HR0 L;  1C4Q A;  1VQN A;  1WTQ A;  1EL0 A;  4JI2 Q;  2Z9H A;  3W1G A;  1FJG Q;  1KDB A;  4O1N A;  4BWG B;  3KBG A;  4FO2 A;  4DV5 L;  2BCO A;  4UDU C;  2R7Z B;  1EYC A;  3Q8D A;  3SGI A;  2HD3 A;  3K59 A;  2RF4 A;  4RGO S;  1SXT A;  3ITP A;  2TMP A;  2PZW A;  2LY7 A;  1PTO D;  4RH6 A;  4LK1 C;  4RMF A;  1K8O A;  2IX3 A;  5K5P A;  5KYI A;  1Q90 A;  5HY6 A;  1XNR Q;  1HNW Q;  3S16 H;  4AIM A;  4KLK A;  4KD4 A;  3FKI B;  2QEJ C;  2QIL A;  2K33 A;  1DYQ A;  4JYA Q;  1TVX A;  2LS0 1;  2QW7 A;  3KLW A;  1CHP D;  1H9S B;  1VQJ A;  2FHT A;  3T53 B;  2KHI A;  4CJ2 C;  3KFU A;  1XNQ Q;  2BH8 A;  4P2C B;  4IOC A;  3GP7 A;  4C3H B;  1K0R A;  5ELB A;  3X3N A;  2JN4 A;  3P1H A;  1A3U A;  3DEP A;  1PYS B;  2ZXO A;  2RA4 A;  3PUW A;  2PO4 A;  3T1H Q;  5BR8 L;  2KJX A;  4JI7 Q;  4JBK A;  4NXM Q;  2CH4 A;  2NVX B;  3J7A V;  1BNZ A;  1XMO Q;  4BA1 I;  3PIO 3;  1GXD C;  5IYB G;  5DEH A;  2JE6 I;  1VMP A;  1DXM A;  1BXT A;  1BUV T;  1UEA B;  5J39 A;  1M90 C;  1MKH A;  4LUZ A;  2K52 A;  5I4D A;  3GO5 A;  2HT1 A;  3A8J E;  4DR5 L;  3K81 C;  1Z7T A;  5IT9 c;  3OIP A;  1SFO B;  4O42 A;  5C4H A;  4LF8 Q;  1Q12 A;  4UPA A;  3GV6 A;  5AJ3 L;  1Y8N B;  4CBV A;  1SND A;  2CW0 D;  2AWN A;  4GOP C;  1FVI A;  1PTO C;  3CW2 C;  2IJ0 A;  1O7I A;  5GAH C;  1IBK Q;  2EYJ A;  2B2W C;  5IGE A;  1X55 A;  3A55 A;  1EIH A;  3HKZ G;  3LGJ A;  4JI8 L;  1IL8 A;  5C4X G;  1CZG A;  3NBI A;  3KF8 B;  4A3K G;  3K58 A;  5FLX E;  1BR9 A;  1X3Q A;  1WTX A;  3GTL B;  4ID6 A;  5IGF A;  2PMZ B;  3F2C A;  1L1O C;  3K80 C;  4DV3 Q;  4LF6 L;  3GTP B;  1D6E C;  1HUM A;  1ILQ A;  2R7Z H;  2EYP A;  2MFI A;  2RBM A;  4ALP A;  1JJG A;  2L12 A;  4DR1 Q;  4IFD H;  1HQM C;  4GLA C;  1JOQ A;  3S14 B;  5LMN W;  2WAQ B;  5JEA J;  3I8Z A;  3UDX A;  2RVL A;  3TRZ A;  4MTN A;  5IYD H;  1RD9 D;  2ASB A;  4FXK C;  2BOS A;  2NYZ D;  4I65 A;  4JI1 Q;  5A2Q E;  3T1Y L;  1HTL D;  1N34 L;  4FVM A;  1K73 C;  1Y14 B;  5C0X H;  2I07 B;  4PNY A;  4POF A;  5IE8 A;  2PCF B;  3D3R A;  4YCU A;  3CC7 A;  1SLJ A;  3HOY G;  5ISR A;  1EOV A;  4BY7 B;  3M4P A;  1EIY B;  5FLX L;  3A8K E;  1RTO A;  2WAQ E;  3HRZ C;  4LUO A;  4OON A;  1P8L A;  2CW0 C;  3NWT A;  3NWS A;  4WOR A;  4C3H H;  1T9H A;  2SDF A;  4K6L A;  1A8V A;  3G7L A;  2ZM6 L;  4KKU A;  4KHP L;  4XIG S;  3FHW A;  3FEW X;  3H6M A;  4KJO A;  2NVX H;  2NVY B;  2BE5 D;  3HG9 A;  1I4Q A;  1UAP A;  1DJR D;  4J15 A;  1H9S A;  5A2Q L;  3CPF A;  1JC7 A;  1VQP A;  2IX0 A;  2LKV A;  4IUN A;  1RKN A;  2NUC A;  3FPU B;  3NK9 A;  1WI5 A;  1SYG A;  3NP8 A;  4RHS A;  4GN5 A;  2MP1 A;  1W6J A;  3NHH A;  4PMB A;  4UHV A;  2E5L Q;  1SE3 A;  5LMU L;  1B70 B;  3VR3 A;  2V4D A;  4DR2 L;  1R4P B;  4HJ8 A;  1H9R A;  2N49 A;  3DWP A;  2B8F A;  1NNX A;  3H94 A;  2Q8T A;  2IWH A;  5I2X A;  4A3B G;  1KAW A;  4OWT B;  1ICW A;  3FDT A;  1CZW A;  4TQU S;  1I6V C;  3QO2 A;  3QG1 A;  3M85 A;  3BYT B;  3I56 A;  4B3R L;  4DR7 L;  2VY3 A;  3HKZ E;  4G7O C;  1SE2 A;  3H0G G;  1T5E A;  1NCV A;  2JEB I;  1C7Y A;  4NP5 A;  1DD2 A;  1FJG L;  3HOV B;  1FGB D;  3L2P A;  1EY8 A;  3GTL H;  2F0G A;  2X6L A;  1QB5 D;  3Q0A A;  4GKJ Q;  4OX9 Q;  1Z6H A;  5FK9 C;  1QVF A;  3DWQ A;  3K5O A;  3MEH A;  5IP9 H;  3HOY B;  4IPC A;  3S14 H;  3I91 A;  3IRB A;  3KF8 A;  5CV8 A;  1VQC A;  4CDF C;  4IJL A;  5ELF A;  2BE5 C;  5EKI A;  3HGB A;  1KHI A;  3KOJ A;  1VQM A;  3C1F A;  2WV6 D;  1SYB A;  3HOZ B;  3NTI A;  4NXN Q;  1Y1W B;  1X56 A;  3VYU A;  1EFI D;  3W2D A;  4DNI A;  2K04 A;  3TDQ A;  4BY7 H;  2K7V A;  1KRT A;  3KK7 A;  4N9P A;  3FVQ A;  3EFX D;  1ET9 A;  1F9Q A;  1CM9 A;  1CKO A;  1XJV A;  1HXY D;  1XNQ L;  2B39 A;  2KOL A;  4X3S A;  2AWO A;  2XTI A;  4TKO B;  3VYT A;  1S4Z A;  4A4I A;  5IYB H;  4Y7N H;  2UU9 L;  2JA8 G;  3I3C A;  3T1H L;  2YTX A;  1X9N A;  4QUF A;  4DXG A;  2NVY H;  4UP9 A;  4G7Z C;  2F0W A;  4LF7 L;  1PH7 A;  2G5D A;  5L37 A;  3G4S A;  1TWA B;  1GHK A;  1PRT B;  3CAM A;  2Z6B A;  2WAC A;  1QOH A;  1K0S A;  3D4R A;  1NSN S;  2DUD A;  1B53 A;  4KI0 A;  3SK8 A;  3CD6 A;  4A3K H;  3I4M G;  1L2F A;  1X65 A;  3HOX B;  4DAM A;  5IGC A;  4LF8 L;  4A3M G;  4R4O A;  1AN8 A;  1F9S A;  5FOB B;  1Q1E A;  4MNO A;  4OGQ C;  2ZXR A;  4A93 G;  1LTB D;  3K6O A;  1A0I A;  4Y52 H;  1EFW A;  2H1E A;  3KUP A;  4JI5 Q;  2R6G A;  4G4K A;  3KYH C;  3DXJ C;  3CMA A;  4JOI A;  3M9B A;  1VQK A;  3AMU A;  2DY7 A;  2ICE C;  4L5R C;  4X62 Q;  1QUQ B;  1XPR A;  3GTG B;  4X66 Q;  5C3E B;  1I3Q H;  5A35 A;  4EQ5 A;  4DAP A;  1D5X C;  1KLG D;  2EDG A;  1CA6 A;  4A3G B;  1LTI D;  2F4V L;  1EIG A;  2B2V C;  3HOY H;  3H3V I;  2N78 A;  3PIO A;  2Z1C A;  3A7A B;  1E22 A;  4QJF A;  4JI1 L;  5JVG 3;  4BY1 B;  2EIF A;  3HOZ H;  4XQQ A;  2Z6K A;  3E5S A;  3RZO B;  2JA7 B;  1QVC A;  2B29 A;  1Y1W H;  3EN2 A;  2JK8 A;  3S2H B;  2MGS A;  3SK4 A;  3KLS A;  2IHF A;  5JJI A;  4A3F G;  1Q8K A;  2F0J A;  5IOC A;  3Q22 A;  1DGS A;  1MJE A;  3K5M A;  1HCZ A;  4X64 L;  1D8L A;  2B8G A;  2ZJR A;  1JB7 A;  1PYB A;  3OIQ A;  1QZH A;  1GHJ A;  1YHQ A;  2JP1 A;  2JYO A;  5BN5 A;  4R4Q A;  4F8M A;  2KCM A;  1MHW C;  4HJA A;  4IAL A;  2F0D A;  2QDB A;  3D4D A;  1ET6 A;  4DUY Q;  4GN4 B;  3RZD B;  1BKB A;  1SYF A;  3UE1 A;  4RGM A;  4ULL A;  2R92 G;  4K6D A;  5CGK A;  5ELN A;  1QIL A;  4EGV A;  2B2U A;  1SEB D;  4A3B H;  2FFK B;  4HN7 A;  1II3 A;  2D0O A;  1EYG A;  4DUZ Q;  2JA6 G;  5EQ0 A;  2VS1 A;  3TP6 A;  5DNF A;  3R93 A;  3UI2 A;  1PH8 A;  4KV6 A;  5D14 A;  1EY0 A;  3S1R B;  2NZH A;  3RMH A;  4DPG A;  3HOX H;  4QF4 A;  1E3P A;  1EOT A;  2YU9 H;  4IUR A;  3P7J A;  5KGU A;  2K6A A;  3PO2 G;  2UXB L;  5K36 H;  4PQX A;  1QG7 A;  2L55 A;  1IXR A;  4PZ7 A;  1HH2 P;  2QEX A;  2F0P A;  4ZUJ A;  3C2P A;  2R93 B;  1NTG A;  2F0H A;  5CMD A;  1EEI D;  1PRT F;  2CH4 W;  2CVR A;  4CDC C;  5T1G A;  4YHH Q;  1Q82 C;  1AEX A;  5JOB A;  3S1Q B;  1HR0 W;  3IKJ A;  3HP3 A;  1R9T H;  1QNK A;  1S40 A;  2UUC Q;  4LF5 Q;  3GTG H;  2B63 B;  5C3E H;  3JAM c;  4OX9 L;  3FRP B;  2N8N A;  4OEM B;  1JB3 A;  5E4X A;  2F3W A;  4A3G H;  2XRQ D;  3I73 A;  5IGD A;  5I9O A;  3TP7 A;  1U9R A;  1HZA A;  1EZ6 A;  4A3F B;  3NXW A;  1UWV A;  1PTO B;  2L4N A;  1JJ2 A;  1PH9 A;  2KA7 A;  4C3J G;  1YZ6 A;  1NMG A;  1X3E A;  1WCM B;  3NSW A;  3T4A C;  1VQ6 A;  3VR6 A;  4I7A A;  3DLL A;  1PZJ D;  4KK7 A;  2JA7 H;  1QUQ A;  1V43 A;  2X69 A;  3BZD B;  4OIJ A;  4DV6 Q;  2Z4I A;  3S2H H;  5COY A;  1SYD A;  4R4T A;  4OO1 H;  2JA8 H;  1PZI D;  5KRU A;  3LWE A;  1L1O B;  1F9P A;  4KMU C;  3CU7 A;  4E6I A;  2FMC A;  2NTS A;  4J8Q A;  5CV4 A;  1SYC A;  1IBM Q;  2OQ0 A;  4LF9 Q;  3OMG A;  3A8I E;  1HA5 A;  1LAC A;  2GVB A;  1O7L A;  4A3L G;  3RZD H;  1STA A;  3U4Z A;  4ZRZ A;  2XWB B;  1HQR D;  3KLS X;  3S24 A;  5M9O A;  4IFD I;  1PDQ A;  3MXG A;  2IT1 A;  1GM5 A;  4A3M H;  3KF6 B;  1A2T A;  3F8T A;  3S16 B;  4C2M B;  1E24 A;  2YV5 A;  3KLR A;  4O0A A;  1AE2 A;  2OTJ A;  1W3S A;  4APV A;  1NR4 A;  4XT1 B;  3OMC A;  4BS9 A;  2MJ8 A;  4QQB X;  1TWH B;  1OXV A;  1G2S A;  5CV9 A;  2F0N A;  3TSS A;  2KED A;  3OTO Q;  3ERO A;  2C5C A;  1VQI A;  5IIF A;  2UUB Q;  1EQV A;  1E0B A;  3IFD A;  3VYR A;  1LTS D;  4L5S A;  3BG3 A;  1WD1 A;  2VB2 X;  2AHO B;  1BCP D;  4IO9 A;  3LX0 A;  2WKC A;  4J6H A;  3TME A;  5C4J B;  4A3I G;  4JI5 L;  2IL8 A;  2A1A A;  5H1S E;  4DV1 Q;  2R93 H;  3OWE B;  5HUR A;  2YYZ A;  3S1Q H;  4KY5 A;  5M5W H;  3RUZ A;  2B63 H;  4JI3 L;  3S2D H;  4PZ8 A;  5M5X B;  2XN9 C;  4IN3 A;  1S72 A;  2G9H D;  4IUV A;  3URY A;  3I2Z A;  2UXC L;  4GN3 B;  1M1K C;  2L1B A;  3CQZ B;  1V1O A;  4B3M L;  5IGG A;  4CDE C;  4A3F H;  1PTO H;  3HOW G;  4DU9 A;  1HFN A;  1KD1 C;  3X3M A;  1VF5 C;  2B3G A;  1SJE D;  1HZB A;  4F7X A;  1BVS A;  3CRK C;  1WCM H;  4R4C A;  3HOU B;  3L7Z C;  5M3M B;  1IBL Q;  1FD7 D; 
#chains in the Genus database with same CATH homology
 4DF7 A;  1KAB A;  4PMC A;  1B44 D;  4ZKB B;  2SEB D;  2MUY A;  1KNE A;  1CK1 A;  2EY1 A;  4FXG C;  4DGZ A;  2O5I C;  5T1I A;  1OXS C;  3QOL A;  4V0B A;  4CGY B;  2L11 A;  2B2W A;  2KUM A;  3P75 A;  1BCP C;  2ID0 A;  3AU7 A;  3SDZ A;  1I6H B;  5DM6 3;  1JOO A;  4F88 A;  5C6A A;  5CBE E;  3E6Z X;  1U4M A;  4EVO A;  4DNR B;  2DNE A;  5CV7 A;  1JCK B;  1TY2 A;  4H0L C;  3J7A F;  1MD2 D;  4X3T A;  2WIN B;  3TZD A;  3BVZ A;  1NUC A;  1STY A;  4N9T A;  2A6E D;  2K5W A;  3PUY A;  1S5F D;  3GD7 A;  1LT6 D;  1BOS A;  1JR0 D;  1S5D D;  4WJW A;  4UAI A;  1TWF B;  2PZU A;  2DN8 A;  4XQJ A;  1M8A A;  4R8N A;  4QB4 A;  1I4G A;  1IKM A;  2SNM A;  3E0J A;  4HMJ A;  2MHV A;  2OXP A;  3T16 A;  5KYL A;  3HOW B;  4KY7 A;  2NN6 I;  2M9V A;  1JQY D;  1HUN A;  4KTA A;  4FYD A;  4U67 3;  3TN2 A;  1S5C D;  3A56 A;  3K0Y A;  5I9P A;  4KHZ A;  2XIW A;  1W6K A;  2NWG A;  1EY9 A;  5CV6 A;  2F0M A;  3IAY A;  3BS1 A;  1GUG A;  5LL6 X;  2EZV A;  2R61 A;  2TSS A;  3H3V C;  1M4V A;  3GTQ B;  2A6E C;  2HQE A;  2NN6 G;  3SE0 A;  3MHB A;  3RLF A;  1QJO A;  2IW3 A;  5C3W A;  5ELC A;  2EY6 A;  4ZLT F;  1I4R A;  2E2H B;  3R2T A;  5HGT A;  4HCE A;  1WTP A;  3C46 A;  3V96 A;  1STN A;  3DMU A;  2EJF C;  4CHT B;  2F3V A;  2BDN A;  5D3D A;  1KDC A;  2LFN A;  3S1M B;  3EA6 A;  1TQO A;  3QOJ A;  3MAQ A;  1ESR A;  2PYK A;  4RGT A;  1VDZ A;  1I4H A;  1O7Z A;  4Y7N B;  1CT1 D;  3BVM A;  1JIC A;  1VCI A;  3J7Y W;  2AQ3 B;  3P20 A;  2D9U A;  1ZXT A;  1A6X A;  1YNN D;  3NQI A;  2NVQ B;  3HKZ B;  4ZAI A;  1STB A;  4HED A;  5C4X B;  1B2T A;  4A3K B;  4S3S A;  5J1Z A;  3HS0 C;  3GQB A;  5JEA H;  4MN3 A;  1SNQ A;  3SHL A;  2A69 D;  3SEB A;  4NMZ A;  1BDO A;  4ZKC B;  3MXP A;  1LO5 D;  3GTK B;  2RDF A;  2A74 C;  3IFT A;  1I3Q B;  1CA5 A;  4C3I G;  3MA2 B;  4R8I A;  1EYD A;  5FO8 B;  1LTT D;  4OHJ A;  1SE4 A;  4KN4 C;  2NB0 A;  1B1Z A;  5CBA E;  1ESF A;  1YNN C;  3U9O A;  2A6H D;  1TS4 A;  1LT4 D;  2Z4H A;  2WKD A;  4Q5V A;  2FJ2 A;  4OO1 I;  5G3L F;  4QUC A;  4RWS C;  3CRL C;  2A69 C;  3PMF A;  4QIW B;  4LMQ D;  3EQL C;  3OWF A;  1LAB A;  1DOL A;  2VXW A;  4XXE A;  1SAP A;  3J80 E;  3VR5 A;  4RA8 A;  4IZ8 A;  4A3B B;  4I7Z C;  1ENA A;  2PZT A;  2AUK A;  5I6Y A;  1WTV A;  4RAU C;  4DK1 A;  1HPC A;  4C1N I;  1CFM A;  2K5D A;  4ZUI A;  2SNS A;  1ENC A;  5EJW A;  4ODG A;  4IUT A;  3H0G B;  4ME5 A;  1X32 A;  4G7H C;  2YU9 B;  2ENB A;  2A6H C;  1LV9 A;  1Y8O B;  4KKT A;  3VA5 A;  1PYW D;  2K01 A;  2EXZ A;  2E2D C;  2AQ2 B;  3J80 L;  1R4Q B;  2B2Y C;  2B2T A;  1KTK A;  4DXF A;  1AZQ A;  5JVH 3;  4KD3 A;  3WOF A;  1VF7 A;  1R9T B;  3QIA A;  3NUC A;  1IYU A;  1RDP D;  5CYU A;  1TKW B;  4IUU A;  2L9H A;  3NTH A;  1PLF A;  2O2L D;  5BN3 A;  5EPK A;  4LAA A;  4FF1 A;  1CQV A;  3PO3 B;  2J7Z A;  1DZ1 A;  2EPB A;  3M4Y A;  4KJN A;  3BDO A;  3D31 A;  2F03 A;  3ZYY X;  2JA8 B;  2QCP X;  3NTK A;  3BVG A;  3EVQ A;  1ROD A;  2D2C C;  1G8Z D;  1EWC A;  2OF1 A;  1UNS A;  1SMY D;  3H09 A;  1BCP B;  4AYB B;  2N55 A;  3I72 A;  2KVM A;  2E76 C;  2F0T A;  3I4M B;  5I6W A;  4A3M B;  2Q8R E;  1SYE A;  4A93 B;  5J22 A;  3M3Y B;  3MVV A;  3VA7 A;  1LTR D;  1JOR A;  1I4X A;  5IOD A;  4X3U A;  2EYO A;  1TII D;  3ND9 A;  1DM0 B;  1E2V A;  4YIJ A;  3J81 E;  3EJI A;  1I4P A;  4K14 A;  1FNU A;  4IUQ A;  4K2K A;  2JSO A;  1Y8P B;  5KND A;  1EEF D;  1E2Z A;  2M2L A;  5M5W B;  1B50 A;  1ZYR D;  2K5Q A;  1SMY C;  2IPK D;  1LTA D;  3S2D B;  4HMI A;  3Q24 A;  1FNW A;  1ZEQ X;  1L0X B;  3J81 L;  1PRT D;  1A2U A;  4L6T B;  5EGT A;  4L8J A;  4KN7 C;  2VNU D;  5I2Y A;  2R92 B;  3MFG A;  3S15 B;  2N88 A;  1F9R A;  4HAE A;  5KIX A;  4K8I A;  5E3F A;  2JA6 B;  1JE4 A;  3TP5 A;  1HHV A;  1OXX K;  4DAY A;  2B2U C;  5BN4 A;  1TS2 A;  2RDG A;  1D5Z C;  1ZYR C;  2RSO A;  2XVS A;  2VB3 X;  2XSC A;  5C0X I;  1EWH A;  4RCN A;  3PO2 B;  2AUJ D;  1A3V A;  1JWS D;  4FF2 A;  4B9W A;  1T5X D;  1ILP A;  2F1M A;  3GV3 A;  4XDX A;  3HZX A;  1PRT C;  3AB9 A;  4NW2 A;  5LL6 S;  4IFD G;  3KBX A;  4JBW A;  1EU4 A;  1IYV A;  1F2M A;  2E2J B;  3IL8 A;  3LWU A;  3K5L A;  3GTM B;  4C3J B;  1STE A;  1MI2 A;  4ZK9 B;  4K2L A;  2K28 A;  2EE1 A;  2EOT A;  3PIP 3;  1F2Z A;  2A73 B;  1XTC D;  3FMC A;  2BA0 A;  1STH A;  4C3H G;  1SSO A;  4KKS A;  2ZT9 C;  3DHQ A;  2I46 A;  4FF3 A;  3I70 A;  4Q0F A;  3V05 A;  5LHY 1;  2O5J C;  1PZK D;  5IGB A;  4RHR A;  5FO7 B;  4WFN 3;  5ELD A;  1RCV D;  1U4R A;  1KDA A;  4B08 A;  4LJZ C;  4V19 0;  2NZ1 D;  2ICI A;  1WD0 A;  4IQZ A;  1EQT A;  4CJ1 B;  1A3T A;  3VYS A;  1PTO F;  1D5M C;  1XXG A;  2EY5 A;  4FF4 A;  4HTH A;  1WVL A;  1ZKO A;  3Q23 A;  3Q6S A;  2L5T A;  2KQ3 A;  3G6J B;  2RQX A;  5E4W C;  1J9O A;  1SNP A;  2MPM A;  5C4Z A;  3LNN A;  4BBR B;  4ZQ3 A;  4A3I B;  1QE6 A;  1FR3 A;  3RD4 A;  2G9D A;  3NQT A;  1VMC A;  1WTW A;  2HCI A;  4CJ0 B;  1G6Z A;  3H91 A;  3ERQ A;  4K5V A;  1J8I A;  1F2Y A;  3ND8 A;  3TP8 A;  1GUT A;  5IT9 E;  2KEE A;  5CC4 A;  1MSG A;  2E2I B;  3S17 B;  4IFD J;  2NBF A;  3T13 A;  3DUZ A;  1KLU D;  2PNR C;  5AFW A;  3OHX C;  2RDH A;  3M4O B;  1SNC A;  5C5L A;  5C0X J;  1TWG B;  3V2T A;  3D6W A;  3N52 A;  3D4W A;  2F4I A;  4XT3 B;  3PUZ A;  2F0V A;  3FPP A;  4RKB A;  2HCC A;  2Y0S B;  2F0K A;  2PPB C;  5JPN C;  5KNB A;  5DM7 3;  1G91 A;  5IT9 L;  3R3O A;  5M3F B;  3I4N B;  5CV5 A;  1PFM A;  2D5D A;  2R3Z A;  1I50 B;  4RKL A;  1O7Y A;  4MHE A;  1ML0 D;  2E74 C;  4H7B A;  3DWA A;  3VR4 A;  1FNV A;  1AW7 A;  2VUM B;  3WOE A;  4FXD A;  1BBX C;  3I90 A;  5JJZ A;  2HDL A;  2GA4 B;  4HSP A;  3NPP A;  3I4L A;  4B9X A;  1TWC B;  3F2U A;  4DFA A;  1EY6 A;  4QMG A;  2RKS A;  1G2T A;  2IX1 A;  1HTP A;  1LT3 D;  2BA1 A;  4K5W A;  1MSH A;  2HUG A;  3QJY A;  2DNC A;  2OT2 A;  2K32 A;  1JOK A;  1JWM D;  4PV1 C;  3C1E A;  1L0Y B;  1CQF A;  2A68 D;  1TS3 A;  4IUP A;  2OEO A;  1STG A;  4ILW A;  1Q8I A;  1Y1V B;  1UUP A;  1EU3 A;  3K7A B;  1XWE A;  1IW7 D;  2F0E A;  5EBC A;  1B9N A;  3T56 B;  4A3E B;  2O4X A;  2M00 A;  3R2I A;  2XWJ B;  2Q8I B;  5JPM C;  3M7N A;  4BBS B;  2FMM A;  3SK5 A;  3K5N A;  1DOK A;  4F87 A;  1GUS A;  5COR A;  1D2B A;  1EZ8 A;  1BO0 A;  1V1P B;  4XYO A;  1JWU D;  5EPJ A;  2B2Y A;  3NBH A;  4C56 C;  5D3I B;  1B9M A;  5FKA C;  3TBI B;  4DK0 A;  1RF2 D;  5K36 G;  2A68 C;  1X3P A;  2B2V A;  1ONL A;  1V8Q A;  3SXH A;  1H9M A;  5ELE A;  4FNF A;  3OOC A;  3PUX A;  5M5Y B;  1IW7 C;  1TY0 A;  3L9A X;  1PFN A;  1SDF A;  4DA2 A;  2DY8 A;  4CKB A;  2EYM A;  2EJM A;  2RSN A;  4A3J B;  2E75 C;  1Z47 A;  4HR7 B;  3DEO A;  4MIU A;  1DON A;  1HA6 A;  4QCL A;  3MZ5 A;  5G3L D;  2K05 A;  1YNJ D;  1PFB A;  4OO1 G;  4PMW A;  1C8C A;  4KY6 A;  1GUN A;  5C3X A;  5JAV A;  4FP5 D;  1SBB B;  4BA2 I;  3N6R A;  3SVM A;  2L0C A;  1EY7 A;  2EJG C;  2NN6 H;  2KCN A;  4C1N K;  2JA5 B;  3S9W A;  4GZY C;  2F0S A;  1HFG A;  1GUO A;  1CI3 M;  4C3I B;  2A5H A;  2QF7 A;  5E1F A;  5TSS A;  5DAU A;  1F2L A;  4XTC S;  1LTG D;  1RHP A;  3BDL A;  4XQN A;  4OL7 A;  3CKI B;  1MBY A;  2F0U A;  4DN4 M;  2WB1 B;  4K5X A;  1LLR D;  3QB3 A;  3GTO B;  3BDC A;  1BF4 A;  3U9S A;  3R8B A;  1QWY A;  5C44 B;  4K8J A;  1YNJ C;  2K1B A;  1PMR A;  1Q3L A;  1V1P A;  1KNA A;  4L63 B;  2KHS A;  3PUV A;  3M7G A;  3MWY W;  1QCB D;  1EY5 A;  2JXM B;  2HDM A;  4X3K A;  1WTO A;  5FO9 B;  4M8A A;  2LMC B;  1DOM A;  4JK1 C;  3A7L A;  1HRJ A;  2NTT A;  2WII B;  2QKI C;  1TT2 A;  2F0Q A;  3CHB D;  4H13 C;  2C9O A;  2J4X A;  4HCS A;  1TR5 A;  1RTN A;  4ABN A;  4HSV A;  1QNU A;  2EYH A;  5C5M A;  1O78 A;  2EYF A;  2BDO A;  2EYL A;  1OO9 B;  1FYC A;  1U4P A;  1K83 B;  3D8G A;  2F0O A;  1TS5 A;  4RCO A;  1CHQ D;  3BYY B;  2F0L A;  2B2T C;  1IHZ A;  4EQP A;  4U68 A;  1A15 A;  3JAM E;  1XX8 A;  1DCZ A;  4A3D B;  1CTM A;  3C3L A;  4CKE A;  5CR3 A;  3HEJ A;  2ZXP A;  3WDN A;  4CKC A;  4TRD A;  1S5E D;  3GTJ B;  1NAP A;  3PV0 A;  4EQO A;  3MC0 B;  4WRD A;  4DNT B;  1AFP A;  4ZYS A;  1S5B D;  2SOB A;  2PW7 A;  3OPO A;  1D1I A;  5F2D A;  1MGS A;  3JAM L;  4RGN A;  1AP0 A;  3TZU A;  1F77 A;  1EYA A;  1LT5 D;  3S1N B;  5EKK A;  1OXU A;  4R9W A;  1BQQ T;  1TU2 B;  1C48 A;  5EBD A;  4KHV A;  3OSO A;  1B3A A;  4OIK A;  3ONA B;  4Z9C B;  2FIN B;  5D65 A;  3MXN A;  2XRS D;  1U4L A;  1O80 A;  3MTS A;  3MXU A;  5NUC A;  1IKL A;  3D6C A;  1Y69 U;  4RFB A;  2K03 A;  2H4O A;  3VR2 A;  1BCP F;  1GJX A;  5KEE A;  1SJH D;  1RJT A;  4XYQ A;  3L3O C;  3QWN A;  3DM1 A;  1XYI A;  4M1U B;  1SNM A;  4NDX A;  2CQA A;  2EVB A;  2F0F A;  1PXU A;  4J1M A;  2KCC A;  2WP8 J;  1H9J A;  2PW5 A;  3T51 B;  5C0X G;  2X6G A;  2D62 A;  1NR2 A;  2AQ1 B;  1AZP A;  1K8M A;  2KEC A;  4G57 A;  1Q1B A;  3SR1 A;  1E2W A;  1H9K A;  2JEA I;  3A54 A;  3W3A A;  1KAA A;  4TSS A;  1WTR A;  1B4O A;  1SNO A;  2J0T D;  2F0I A;  2Z8L A;  1D1K A;  4EQN A;  1G29 1;  5EKL A;  3MFY A;  5EPL A;  2NVT B;  4DAV A;  3NE5 B;  4H44 C;  3K57 A;  3OW7 A;  2EY2 A;  5KNC A;  1EY4 A;  4NKL A;  2XNA C;  1GUW A;  2PQE A;  1ENF A;  2CHB D;  1GOZ A;  3SK6 A;  1OXT A;  3O13 A;  5JEA G;  1C4Q A;  1WTQ A;  1EL0 A;  1KDB A;  4O1N A;  4BWG B;  3KBG A;  4FO2 A;  2BCO A;  4UDU C;  2R7Z B;  1EYC A;  3K59 A;  4RGO S;  1SXT A;  3ITP A;  2TMP A;  2PZW A;  2LY7 A;  1PTO D;  4RH6 A;  4LK1 C;  1K8O A;  2IX3 A;  5K5P A;  5KYI A;  1Q90 A;  4KD4 A;  2QIL A;  2QEJ C;  3FKI B;  2K33 A;  1DYQ A;  1TVX A;  2LS0 1;  1CHP D;  1H9S B;  2FHT A;  3T53 B;  4CJ2 C;  4P2C B;  4C3H B;  3GP7 A;  5ELB A;  3X3N A;  3P1H A;  1A3U A;  3DEP A;  2ZXO A;  2RA4 A;  3PUW A;  2PO4 A;  2KJX A;  2NVX B;  3J7A V;  1BNZ A;  4BA1 I;  3PIO 3;  1GXD C;  5DEH A;  2JE6 I;  1VMP A;  1DXM A;  1BXT A;  1BUV T;  1UEA B;  5J39 A;  5I4D A;  3GO5 A;  3A8J E;  1Z7T A;  3OIP A;  1SFO B;  4O42 A;  5C4H A;  1Q12 A;  3GV6 A;  1Y8N B;  4CBV A;  1SND A;  2CW0 D;  2AWN A;  1PTO C;  2IJ0 A;  2EYJ A;  2B2W C;  5IGE A;  3A55 A;  1EIH A;  1IL8 A;  1CZG A;  3NBI A;  3K58 A;  5FLX E;  1BR9 A;  1X3Q A;  1WTX A;  3GTL B;  4ID6 A;  5IGF A;  2PMZ B;  3GTP B;  1D6E C;  1HUM A;  1ILQ A;  2EYP A;  2RBM A;  2L12 A;  4IFD H;  1HQM C;  1JOQ A;  3S14 B;  2WAQ B;  5JEA J;  3I8Z A;  2RVL A;  1RD9 D;  4FXK C;  2BOS A;  2NYZ D;  4I65 A;  5A2Q E;  1HTL D;  4FVM A;  5C0X H;  2I07 B;  4PNY A;  2PCF B;  3D3R A;  5ISR A;  4BY7 B;  5FLX L;  3A8K E;  1RTO A;  3HRZ C;  2CW0 C;  3NWT A;  3NWS A;  4WOR A;  2SDF A;  4K6L A;  3G7L A;  4KKU A;  4XIG S;  3FEW X;  3H6M A;  4KJO A;  2NVY B;  2BE5 D;  3HG9 A;  1I4Q A;  1UAP A;  1DJR D;  1H9S A;  5A2Q L;  1JC7 A;  2IX0 A;  2LKV A;  4IUN A;  1RKN A;  2NUC A;  3FPU B;  3NK9 A;  1SYG A;  3NP8 A;  4RHS A;  2MP1 A;  1W6J A;  3NHH A;  4PMB A;  1SE3 A;  3VR3 A;  2V4D A;  1R4P B;  1H9R A;  2Q8T A;  3DWP A;  2B8F A;  3H94 A;  5I2X A;  2IWH A;  1ICW A;  3FDT A;  1CZW A;  4TQU S;  1I6V C;  3QO2 A;  3QG1 A;  3M85 A;  3BYT B;  4G7O C;  1SE2 A;  1T5E A;  1NCV A;  2JEB I;  4NP5 A;  1DD2 A;  3HOV B;  1FGB D;  1EY8 A;  2F0G A;  2X6L A;  1QB5 D;  3Q0A A;  1Z6H A;  5FK9 C;  3DWQ A;  3K5O A;  3MEH A;  3HOY B;  3I91 A;  3KF8 A;  5CV8 A;  5EKI A;  5ELF A;  2BE5 C;  3HGB A;  3C1F A;  2WV6 D;  1SYB A;  3HOZ B;  3NTI A;  1Y1W B;  3VYU A;  1EFI D;  3W2D A;  2K04 A;  3TDQ A;  2K7V A;  3KK7 A;  4N9P A;  3FVQ A;  3EFX D;  1ET9 A;  1F9Q A;  1CM9 A;  1HXY D;  2B39 A;  2KOL A;  4X3S A;  2AWO A;  3VYT A;  4TKO B;  1S4Z A;  3I3C A;  4QUF A;  4DXG A;  4G7Z C;  2F0W A;  1TWA B;  1GHK A;  1PRT B;  2WAC A;  1QOH A;  3D4R A;  1NSN S;  1B53 A;  4KI0 A;  3SK8 A;  3HOX B;  5IGC A;  1AN8 A;  1F9S A;  5FOB B;  1Q1E A;  4OGQ C;  2ZXR A;  1LTB D;  3K6O A;  2H1E A;  3KUP A;  2R6G A;  4G4K A;  3DXJ C;  3AMU A;  2DY7 A;  2ICE C;  3GTG B;  5C3E B;  5A35 A;  4DAP A;  1D5X C;  1KLG D;  2EDG A;  1CA6 A;  4A3G B;  1LTI D;  1EIG A;  2B2V C;  2Z1C A;  3A7A B;  5JVG 3;  4BY1 B;  4XQQ A;  3E5S A;  3RZO B;  2JA7 B;  3S2H B;  2MGS A;  3SK4 A;  3KLS A;  2F0J A;  5IOC A;  3Q22 A;  3K5M A;  1HCZ A;  2B8G A;  3OIQ A;  1GHJ A;  2JP1 A;  2JYO A;  5BN5 A;  4F8M A;  4IAL A;  2F0D A;  2QDB A;  3D4D A;  1ET6 A;  3RZD B;  1SYF A;  4RGM A;  4ULL A;  4K6D A;  5CGK A;  1QIL A;  4EGV A;  2B2U A;  1SEB D;  2FFK B;  4HN7 A;  1II3 A;  5EQ0 A;  3TP6 A;  5DNF A;  3R93 A;  3UI2 A;  4KV6 A;  5D14 A;  1EY0 A;  3S1R B;  3RMH A;  4QF4 A;  1EOT A;  4IUR A;  3P7J A;  5KGU A;  2K6A A;  5K36 H;  4PQX A;  1QG7 A;  2L55 A;  2F0P A;  4ZUJ A;  3C2P A;  2R93 B;  2F0H A;  5CMD A;  1EEI D;  1PRT F;  2CVR A;  5T1G A;  1AEX A;  5JOB A;  3S1Q B;  3IKJ A;  3HP3 A;  1QNK A;  2B63 B;  3FRP B;  1JB3 A;  5E4X A;  2F3W A;  2XRQ D;  3I73 A;  5IGD A;  5I9O A;  3TP7 A;  1U9R A;  1EZ6 A;  4A3F B;  3NXW A;  1PTO B;  2L4N A;  2KA7 A;  4C3J G;  3T4A C;  1WCM B;  3NSW A;  3VR6 A;  1PZJ D;  4KK7 A;  2X69 A;  1V43 A;  4OIJ A;  3BZD B;  2Z4I A;  5COY A;  1SYD A;  4OO1 H;  1PZI D;  5KRU A;  3LWE A;  1F9P A;  4KMU C;  3CU7 A;  4E6I A;  2FMC A;  2NTS A;  4J8Q A;  5CV4 A;  1SYC A;  3OMG A;  3A8I E;  1HA5 A;  1LAC A;  1O7L A;  1STA A;  4ZRZ A;  2XWB B;  1HQR D;  3KLS X;  5M9O A;  4IFD I;  1PDQ A;  3MXG A;  2IT1 A;  1A2T A;  3S16 B;  4C2M B;  3KLR A;  1NR4 A;  4XT1 B;  3OMC A;  4BS9 A;  2MJ8 A;  1TWH B;  1OXV A;  1G2S A;  5CV9 A;  2F0N A;  3TSS A;  2KED A;  3ERO A;  2C5C A;  5IIF A;  1EQV A;  1E0B A;  3IFD A;  3VYR A;  1LTS D;  3BG3 A;  1WD1 A;  2VB2 X;  1BCP D;  3LX0 A;  2WKC A;  4J6H A;  3TME A;  5C4J B;  2IL8 A;  3OWE B;  5HUR A;  2YYZ A;  4KY5 A;  3RUZ A;  5M5X B;  2XN9 C;  4IN3 A;  2G9H D;  4IUV A;  3URY A;  2L1B A;  3CQZ B;  1V1O A;  5IGG A;  1PTO H;  4DU9 A;  1HFN A;  3X3M A;  1VF5 C;  1SJE D;  4F7X A;  3CRK C;  3HOU B;  3L7Z C;  5M3M B;  1FD7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...