4HCSA

Structure of novel subfamily cx chemokine solved by sulfur sad
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
PGVCFKVLTTKEPKANIKRCYNLPKTNNCLKCVLFVDASNRMKCIDPNASWLAERLYRLKEKGVTCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural insight into the evolution of a new chemokine family from zebrafish.
pubmed doi rcsb
source organism Danio rerio
molecule tags Signaling protein
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hcsA00
2Q8TA 3IFDA 1MSHA 1LV9A 1RTOA 2RA4A 4X3SA 1DOLA 1F9PA 1PLFA 1VMPA 2B2TA 2KVMA 2CVRA 1B50A 2SDFA 1AZPA 3ONAB 2HUGA 1CA5A 3FPUB 2HDMA 5D14A 1HFNA 2K04A 2B2TC 2KECA 4LMQD 5JJZA 1DONA 1E0BA 4MN3A 1S4ZA 1BBXC 2X6GA 1SDFA 1G2TA 2J7ZA 1AZQA 2RVLA 2N88A 4X3TA 1ZXTA 1G6ZA 3DEPA 3MWYW 4RWSC 5CORA 4XT1B 4CJ1B 4HSVA 3P7JA 1XX8A 1ESRA 2IL8A 3DM1A 2X69A 1B53A 2MJ8A 2KUMA 1KNAA 1C8CA 2K1BA 5EPKA 1O7YA 3KBXA 1NR4A 4HCSA 5D65A 4X3UA 3TN2A 1CA6A 1QNKA 3FDTA 4IUTA 1J8IA 1PFBA 1DOKA 1X32A 4OIKA 1PFMA 4CJ2C 1MGSA 4ZLTF 4NW2A 1RHPA 2FJ2A 2FMMA 1M8AA 2HCIA 1G2SA 2HCCA 1X3PA 2K05A 5EJWA 2M2LA 1O80A 1KNEA 1QE6A 2FFKB 4X3KA 5COYA 4DN4M 1HHVA 1IKMA 4HEDA 1IKLA 2EOTA 3N52A 3D6WA 4R9WA 2K28A 1QG7A 1G91A 1B2TA 1F9SA 5T1GA 2JYOA 5EPLA 3SVMA 1WTPA 3H91A 2K01A 4MHEA 4RA8A 1F2LA 2K03A 1HA6A 3F2UA 2B2VA 2KOLA 4IUQA 1ML0D 2NYZD 1EQTA 2HDLA 1SAPA 1NR2A 1PFNA 1ILQA 1BO0A 1RODA 2MP1A 3IL8A 1JE4A 2B2VC 1WTXA 1HUMA 1RJTA 3I90A 1WTRA 1J9OA 1EOTA 4IUVA 2D9UA 2X6LA 5EKIA 1EL0A 4IUPA 5CMDA 1B4OA 3KUPA 3R93A 5E4WC 4U68A 4IURA 1VMCA 2L4NA 1EIHA 4R8IA 1WTWA 4RAUC 1A15A 2DY8A 4XDXA 4QUCA 1HUNA 2R3ZA 2XIWA 5AFWA 5EPJA 3Q6SA 3UI2A 2RSNA 5EQ0A 1WD1A 5T1IA 1BNZA 1ILPA 1JICA 2B2UC 3I8ZA 3G7LA 1IL8A 3DEOA 4ZAIA 1NAPA 1WTQA 1F9RA 2KEDA 3GV6A 3HP3A 1GUWA 2L11A 2FHTA 1HRJA 1EIGA 2EPBA 5E4XA 2NZ1D 1Q3LA 4OIJA 2B2YC 2DY7A 3LWEA 4CJ0B 1WD0A 2RSOA 4HAEA 2KEEA 2Q8RE 4QUFA 1DOMA 2FINB 1WTVA 2L1BA 2NWGA 4O42A 1DZ1A 5CBAE 1ICWA 2VXWA 1O7ZA 3QO2A 2B2WA 2L12A 1X3QA 4IUUA 2MGSA 1U4LA 4UAIA 2JP1A 1XYIA 3I3CA 1AP0A 2B2UA 1RTNA 2EE1A 2H1EA 2N55A 4ZK9B 1BF4A 1WVLA 3TZDA 2B2WC 4ZKCB 2MPMA 3GV3A 1WTOA 4ZKBB 2L9HA 1U4PA 1PDQA 1SSOA 3I91A 4XT3B 2B2YA 1TVXA 1U4RA 2BDNA 5CBEE 1B3AA 1MSGA 3MTSA 5DNFA 1CM9A 1F9QA 1U4MA 1HFGA 1MI2A 1NCVA
chains in the Genus database with same CATH superfamily
2QDLA 4ME3A 1LTRD 1SFOB 1J5EQ 1B1ZA 2AQ3B 4DUYL 2EY5A 1PH2A 1L0WA 4G4KA 4KY7A 1NJIC 3FHWA 4BBSB 1MHWC 1HZ9A 2E2DC 1K9MC 1VQFA 4MNOA 4MN3A 2C35B 2R93H 3WWVA 1I4HA 3I4MG 2H4OA 4DU9A 3GTGB 5FLXE 1LT4D 1NR4A 4FF1A 1VQCA 1CA6A 2NN6G 1VQ7A 4A3FB 3S14B 4KMUC 4JI4Q 4OIKA 3GTOB 5IGEA 5EJWA 4DAPA 1TR5A 1O80A 1QE6A 4A3KG 2WAQE 5DM73 3RLNA 1CHQD 2NTTA 2XWJB 3KLSA 4O0AA 4DAYB 5FO7B 1A6XA 4GKKL 1UEBA 5D3IB 1Y8PB 5KYLA 1GVPA 1I4RA 1Y14B 3I4OA 2VQEQ 2I0QA 2D5DA 3PF5A 3KF6B 4B3TQ 4A93G 3L2PA 1EOVA 5JJKA 3GTMH 3JAMc 2JXMB 3I90A 3NE5B 4EQOA 3CQZH 4IUPA 4K2KA 1EUJA 2ZXOA 2RQXA 3NXWA 2ZJQA 5M9OA 2EYFA 1VQNA 2H5XA 1ENAA 3A56A 3ER0A 4G57A 3H3VI 5EQ0A 1PXUA 3CRLC 3CXCA 4X64L 1J6QA 4G7HC 3K6OA 1K73C 1Z9FA 1JR0D 4N8X1 2EPBA 5E4XA 2K5DA 2KQ3A 1KIXA 1YVCA 3L3OC 4R4IA 1WD0A 4A3IG 1PTOB 4A3EH 4JOIC 3I70A 1DOMA 2B8GA 4X66L 5FJ8G 1K8AC 2E8GA 4OL7A 2L12A 1LM0A 1IYJB 4CDCC 1TWGH 5IP9H 2B8FA 3UE0A 1RTNA 2K50A 3CMEA 1N33Q 3RLOA 4DKAC 1AN8A 1QOHA 4P75A 1AFPA 4LAAA 3L0OA 1KXLA 4LW1A 4DNIA 1YIJA 3HG9A 2UUAQ 5JPNC 1A63A 3KOJA 1BQQT 2JA5H 4AH6A 5DNFA 4GS3A 1CM9A 4NXMQ 3A5ZB 3F1ZA 4BA1I 1G8ZD 2KCTA 5FLXc 4C3JB 4DV7L 2OF1A 2EY6A 3J7YW 4BY7G 4QY7A 1A0IA 1IL2A 2WACA 4A3MB 2OTJA 5C4ZA 3J81L 5CGKA 3PIO3 4LFCQ 2VB2X 5BR8Q 3HOXB 4DV0Q 2A68C 3HKZG 3KLSX 3QOJA 3VR4A 3GTLB 1PFSA 4BXXG 5FLMG 4DV4L 3OYYA 1STEA 1V1PB 4DNTB 3FKIB 4KI0A 5E1FA 2HT1A 2F3VA 1II3A 3LGJA 3T1YQ 1J8IA 3PIOA 2D0PA 5M3MH 3K0YA 3A5UA 2SEBD 1X65A 2HCCA 3T13A 1KNEA 1IKMA 2P5ZX 3RUZA 2EYPA 1X3GA 1EYCA 2IPKD 1XMOL 3LX0A 4ZRZA 5BN4A 2WB1B 4L6TB 4CDEC 1IZ6A 5AJ3Q 2VQFQ 4KD3A 4LNQA 4JI2L 4M8AA 3DLLA 4P74A 1MD2D 4GLXA 1B4OA 1L1OC 4R1JA 5E3FA 4GLVB 3K7AB 1D8LA 2FMCA 4RH6A 3ULJA 4A3BH 2RSNA 3A7LA 3KDFA 3Q8DA 3HOYH 3HOUG 1A62A 1AE2A 1KC8C 2Q2UA 3PO2H 4DV2L 2E2JH 5LMNW 1ZKOA 5CV7A 4A3CH 4C3IG 5C0XJ 3S1RB 4LF4L 1R4PB 1NNXA 4BBSH 1XTCD 3BZDB 2H1EA 2Y0SB 1XWEA 3MXNB 4EX5A 2K5QA 3OTOL 1VQLA 2JA7H 1SSOA 1EZ8A 5NUCA 1PH8A 1PHJA 1I6HH 3GTGH 2D0OA 1F2MA 3DWAA 1STAA 1SAPA 1EY0A 1A3UA 2JSOA 5KIXA 1F9PA 4K5WA 3GTOH 2CFMA 2KHIA 1KDCA 2K04A 1VF5C 3FMCA 4IPCA 2J7ZA 2QCPX 2PNRC 3J80E 1AZQA 3U58A 1E3PA 2N8NA 3S15B 2RDFA 2OWOA 1K83B 1E1OA 3MXGA 3P7JA 1E2WA 3GTJB 4JI4L 4YY3Q 4NB3A 2F0OA 1QUQB 3VDYA 4DR4Q 5IYDG 1TT2A 3FDTA 4I7ZC 4PZ7A 3PF4A 5ELEA 4DN4M 5FLXL 3HOVG 4JW0A 4XYOA 1GUTA 4B08A 1D5MC 1NTGA 2F0GA 5H1SE 1SMYC 1XPUA 5IE8A 3E3XA 2EJGC 1OXUA 4KKUA 4K6DA 4TKOB 2XN9C 3I7FA 4GOPB 3I2ZA 2F0TA 3J81j 1PTOH 4JYAQ 1EOTA 1TS4A 1I50B 5I9PA 1X3FA 4IURA 5C3EB 1XJVA 2UU9L 1NE3A 3BU2A 2K5VA 5JEAH 4JK1C 3ICEA 1ILPA 4POFA 1BNZA 1C4QA 1WFQA 4RKBA 1BDOA 2DY7A 2MNAA 3K81C 2F0IA 1U5KA 4C3JH 5CYUA 1KD1C 2NVYB 1SNDA 3VA5A 1WTVA 1DZ1A 4V0BA 3U9OA 1M4VA 3HOZG 2PMZE 4BY1B 2A68D 1HA5A 3Q23A 2JP1A 3JAMi 4ZK9B 1WVLA 3EROA 3HOXH 3OIPA 4NXML 1TVXA 2R93G 1JB7A 1MSGA 5IGBA 1IBKQ 2RCNA 3SDZA 4CHTB 1TQOA 3UDXA 1A2UA 4DXGA 3A74A 1DOLA 1SNCA 1HNWQ 3AB9A 1VMPA 4JPBW 1ONLA 1GD7A 4PG3A 1HZBA 3T56B 3Q24A 4DV3Q 3R2TA 2JA6B 1BBXC 3NBIA 1U9RA 2OT2A 5FOBB 5CORA 1Y8NB 4LJZC 3T1YL 3IKJA 3E9HA 2K1BA 5EAYA 4HCSA 3FPPA 2IHFA 4K0KL 4DAMA 4OWTB 1RD9D 4ZLTF 4TQUS 3WOEA 4RG1A 1TWAB 3S1NH 1S3OA 4DUYQ 4EQNA 3D6WA 5J3BA 4JBKA 2VQFL 4WJ3M 1G91A 2UXBL 2ZTDA 3EJIA 5IT9c 3CC7A 1K0RA 1PTOF 1CTMA 3PCOB 2F0QA 1RJTA 2R61A 4IFDJ 2NVQH 3LWUA 3R93A 3KF8B 4U68A 2JQOA 4A3EG 2KA7A 5GQOA 4AIMA 2OEOA 4A3JH 2JEAI 3CCVA 3J7A5 4IALA 1PH4A 4OO1H 2XWBB 5IP9G 1IL8A 1WTQA 1GUWA 1F9RA 1HRJA 2LKVA 3I4NB 2NZ1D 2K14A 1N34Q 1RF2D 2BE5D 2YU9B 5L37A 1BCPB 4L5TA 1QNUA 2JA5G 1WYDA 1I6VC 1PV4A 1CKOA 2B3GA 4O2DA 3X3MA 3ULLA 3K5LA 3K0XA 4HIMA 2B2UA 5IODA 3GV3A 4OONA 1Z47A 2LS01 1LT6D 2IX0A 1B3AA 2RKSA 4JI6L 3EFXD 1F9QA 3VYSA 3GTPB 2DY8A 4KKSA 1MSHA 1RTOA 4HN7A 4CDDC 1TWHB 4PMWA 3GTQB 2DNCA 3Q22A 1B50A 2I5HA 5DM63 1SMYD 1VQMA 2KECA 5M3MG 1SDFA 1Q86C 3H0GB 3G48A 1CKNA 4CJ1B 1S5BD 1SN8A 4DR4L 2IL8A 2E2HB 4IOCA 1B53A 1VQ5A 1K28A 5IOCA 4KHVA 3J80L 1TS3A 2EQSA 5IGDA 2R7ZH 2UXDL 1HXYD 1PFBA 2RCFA 2R92B 4A3GB 1G291 4HJAA 1JJGA 3TN2A 1QVFA 5C3EH 2VZAA 4HMIA 4HCEA 2CQOA 1X55A 1S5DD 4R9WA 5TSSA 4WJWA 4MIUA 4AYBB 4MTKA 3M4OB 3T51B 1FNWA 3B6YA 5CR3A 4A3BG 4LFBQ 1I4PA 3S1MB 4QQBX 1HH2P 2QILA 2CH4W 1B3QA 3HOYG 1YNJC 5HGTA 3I72A 2AMCB 4DV4Q 1ASZA 2UUCL 3HS0C 3R8BA 3PO2G 3O13A 2EY1A 2F3WA 3P1HA 1VQKA 3U50C 1C0AA 3CCUA 3D4RA 1V43A 4DR7Q 1WOCA 3HGBA 1NY4A 3NEMA 5M5WB 4KK7A 4A3CG 4X62L 4V190 3VR5A 4FYDA 3I8ZA 1OO9B 4BBSG 2Z1CA 4J15A 1IHZA 4OHJA 4LF8Q 2ZJRA 3HEJA 2AUKA 1C7YA 5HY6A 3K5NA 3SK5A 3OWFA 1O7IA 4HAEA 1I5FA 4QUFA 3NSWA 2AHOB 5LL6S 4WORA 5EBCA 1LTLA 1GUGA 4IUUA 4ALPA 1U4LA 4QJFA 3EVQA 1E2VA 1D6EC 3ND9A 5CV8A 5IYBH 1IBKL 4ZKBB 3L7ZC 5C0XH 2JE6I 1D1IA 1U4RA 1U0LA 1HNWL 5CV9A 5KNDA 1GJXA 3GP7A 4KTAA 5AFWA 3UI2A 2K5WA 4LFAL 2XRQD 3CPFA 1TS2A 3J81c 4DV3L 3NTKA 1YI2A 2VUMB 1CZGA 1CFMA 1CUKA 3BDOA 3KJOA 1VQHA 2NB0A 1KRTA 1YJ9A 4F88A 5DAUA 2BH2A 1TWFH 2F52A 5CC4A 4UP9A 3ZYYX 3OTOQ 2KUMA 5A2QE 4L63B 3M3YB 4PNYA 2XRSD 1B9MA 1YZ6A 1D5ZC 5BN5A 2K52A 4Y7NB 2HHHQ 4RGNA 3NQTA 4R4OA 4EGVA 2M9VA 5I2XA 3MHBA 1RL2A 2M2LA 4DV1L 2FFKB 5JAVA 3RN5A 1SEBD 1BVSA 2PZTA 2AQ2B 1X3EA 2Z0SA 4XQJA 3RZOH 2K28A 2TMPA 1KQSA 3S16H 2WIIB 1EEID 1HR0W 1WTPA 1EIFA 3RN2A 3NWTA 4KLKA 3H91A 4YCUA 2A69C 2IW3A 4MHEA 1F2LA 4RA8A 5JEAG 4A76A 1B7YB 3KDFB 2QDBA 1ILQA 2YU9H 1RODA 1JE4A 2LSSA 1D1KA 1PH9A 4IUVA 5KNCA 1VQDA 2K33A 1DD2A 1PRTB 3AFQA 2Q2TA 3NWSA 4C3JG 4XYQA 4JI1L 4NP5A 1A15A 4JI7Q 4QUCA 4N9TA 5EKKA 1KLGD 4JI3Q 2PQAA 2XIWA 2CCZA 1W6JA 4G7ZC 3E6ZX 1N34L 1KDAA 3DEOA 4HJ9A 1F77A 2KEDA 3HOXG 2B2YC 4QIWE 2A6EC 2I07B 1K8OA 1HNZL 5F2DA 1WCMB 3BZKA 5I2YA 2N3SA 1ICWA 2Q2IA 1VQOA 4UAIA 2HQEA 3I3CA 5JVH3 1K3BC 2EE1A 5K36H 2BDOA 1SE4A 3D0FA 3CF5A 2UU9Q 3TQYA 3H0GH 2R6GA 4HSPA 2B63H 3IRBA 1Y1VB 3HKZE 4Y52H 4JOIA 1K8GA 4KY6A 2WB1G 2ZXRA 4UHVA 1V8QA 1QZHA 1YITA 2EXDA 4A3DB 3K58A 1GUOA 2ATWA 1SLJA 2B2TA 1GOZA 2KVMA 2R92H 1LTID 1IXRA 1LUZA 4DAVA 1LABA 2B2TC 3RD4A 4FDBA 2F0EA 3OMCA 1JMCA 1G6ZA 5C0XI 4GNXA 1MKHA 4FXGC 1ZXTA 1STNA 3M4OH 5DLQE 3KYHC 4JI0L 1YNJD 5JOBA 4GNXC 1C48A 1LTBD 3PMFA 1XMQQ 3EQLC 2OCEA 5KNBA 3S17B 1JWSD 2AWOA 3SGIA 1RHPA 3I4MB 2R7FA 1ICFB 4XQNA 5IGGA 5LMUQ 1ZYRC 4HEDA 2F0WA 4IJLA 4IN3A 3D31A 5M5WH 4MTNA 1PH3A 2PQEA 5K5PA 4LFBL 3CC2A 2F3IA 1RIPA 2ALYB 2EJMA 1E2ZA 1OXXK 2KENA 4LUZA 4ABNA 1GUNA 4A3JG 2Y0SG 5CV4A 1EIYB 5C4XH 1NR2A 5ELOA 2PO4A 4OO1G 4A3KB 4L5RC 1BCPF 4HJ5A 4K8IA 1HUMA 4DK6C 1KAWA 1XXGA 4DR7L 5CMDA 5ISRA 1AH9A 4DPGA 2K5NA 4K0KQ 4XDXA 2PCFB 1G6PA 2F0DA 3FEWX 4IFDH 4LF8L 1VQAA 4BBRH 5M5XH 2CWAA 1OXTA 1HTLD 4GKJQ 2L55A 5M3FH 2K5HA 2PYKA 2UXBQ 1CSQA 2XVSA 2J4XA 2C9OA 3AU7A 1L1OA 3I73A 1FGUA 2JA8H 3KK7A 1Q12A 5IIFA 2ZM6Q 1CQVA 1H9SA 3A8JE 2QGQA 5LMNQ 2E74C 1WJJA 1SNOA 1K8MA 4Q0FA 3HOWB 5ELCA 2WAQB 3BYYB 4C2MB 5IGCA 3S2HB 3KJPA 1DYQA 3I4LA 4DUZL 3SEBA 1MI2A 3M3YH 1LV9A 2PI2E 4X3SA 1PZKD 2BA1A 3DM3A 1PLFA 3N6RA 4PMCA 3U9SA 1EY5A 3F2DA 1SFOH 2F03A 3PUWA 3W1BA 5M5YB 2KCNA 2XTIA 2R7ZG 1Q81C 1M1KC 1V1OA 2A69D 2N88A 5C3EG 1Q8IA 2ID0A 5J1ZA 2EYHA 5IY0A 1UE7A 4BY7B 2IHEA 2HHHL 1C8CA 1HJPA 1KABA 1SE8A 3G71A 3PGZA 3TP6A 2LY7A 4IUTA 4JI6Q 1XNQL 1X32A 1SYFA 4A3FH 2ZJPA 3S14H 4YCVA 2FJ2A 1YNNC 4DAYA 2JJQA 4IUNA 4X3KA 5A2QL 1PVOA 1IKLA 2EOTA 2F0UA 3J81i 1DJRD 5C44B 3PQIA 1STHA 1CK1A 2A6ED 1CT1D 1IYUA 2JYOA 2PNHA 4DFAA 5CV6A 2E2IB 1HNXL 4ZUJA 4O1NA 2B2VA 5FO8B 3PUXA 4KJNA 3FVQA 4RCOA 2Z6KA 1FL0A 3TRZA 4CGYB 3NUCA 2B2VC 1L0XB 2NTSA 4QCLA 2SOBA 4KKTA 1I4GA 2Z6KC 4JI7L 3CCSA 1F2ZA 4P72A 4JI3L 2I5MX 2K75A 5ELDA 3TP5A 2UXDQ 2A74C 4LF9Q 4RGMA 2KJXA 4QGUA 5GROA 4OWXB 1QVGA 3H09A 2SNSA 3GV6A 4KD4A 4X65Q 1EIGA 2F0MA 1EQRA 5IYBG 5C0XG 2Q8IB 3LWEA 2DN8A 1PTOC 3NTHA 5CV5A 3VYUA 2EJFC 2HD3A 1Q82C 2NUCA 3Q0AA 2UUCQ 1X3QA 2MGSA 3HOUB 3PO3B 3ULPA 2ZTEA 4IFDI 4B3SL 4KJOA 1AE3A 1EY8A 1Y1WB 5JJLA 4EQ5A 1PDQA 4CKBA 1ET9A 5C3WA 3NBHB 1CKNB 4X62Q 3I56A 2RBMA 4C3HB 4NPSA 3MA2B 3RMHA 1ZYRD 3E0JA 3M4PA 2EYLA 2NVTB 5KEEA 2CVRA 3G4SA 2V1CC 5G3LF 4IOAA 4LMQD 4A3MH 3C3LA 3TEHB 2X6GA 4DV5Q 1S72A 4JBJA 1VQIA 4LWCA 2K32A 2FXQA 4DR1L 1Z6HA 1XMQL 1XTDA 3DEPA 3MWYW 4GLAC 3U4ZA 4XT1B 3J80c 3GTLH 3TS2A 1MBYA 2E5LL 4JI5L 3MFGA 3FKIH 4B3RQ 3T16A 5D65A 1D2BA 2XSCA 5LMUL 3T53B 2BCOA 1PRTF 1T5XD 2FMMA 4CKEA 2A1AA 2VW9A 2K05A 4LFAQ 1HHVA 2J0TD 3TSSA 3VR2A 3PIPA 2TSSA 4DA2A 3RZDB 4RHRA 1W6KA 4IPGA 2WKDA 1FVIA 2RHSB 4EVOA 3GTKB 3SVMA 2F0KA 1ASYA 2K01A 2VS1A 1HA6A 1Z7TA 4GN3B 1S5ED 3NHHA 4B9WA 1LO5D 3CCQA 3G6JB 1S5FD 1BO0A 3NQIA 3TREA 1K3RA 2OTLA 3HOVB 2IY5B 2MHVA 2QKIC 3T4AC 5JPMC 1YJWA 1EWHA 1Q7YC 4A3LH 1UE1A 1A2TA 2F0JA 1EIHA 3E0EA 2RF4A 2WINB 2I46A 4HIOA 3CKIB 3K7AH 4GKJL 2LFNA 5T1IA 4DV1Q 1HZAA 3HOWH 1NAPA 2OQKA 2L11A 5K36G 3BZCA 4OIJA 3S2HH 2A73B 3H0GG 2UXCL 1JORA 4IPHA 2ZM6L 2CWPA 2KEEA 2B63G 2GN5A 1VQPA 1KAAA 3MXNA 3MXPA 5LMNL 1IW7C 3S1RH 1AP0A 4P73A 4KHZA 2R92G 3A8KE 1AW7A 1UEAB 4IJHA 4JI1Q 4XT3B 1FYCA 2BDNA 1ESFA 1EY9A 3CCJA 4YIJA 1JOOA 1SYBA 1SJED 1NCVA 2Q8TA 5KYIA 1YNND 1FGBD 1VCIA 1MJEA 1LACA 4K2LA 4LK1C 2ENBA 4FO2A 2SDFA 1HNZQ 3ONAB 2HUGA 1CA5A 1EU3A 2R93B 1G51A 2YTYA 5C44H 1H9RA 1HQMC 4LF5Q 4RWSC 2IWHA 4LF6Q 1N36Q 3S15H 3F8TA 2AKWB 1EZ6A 1K83H 3DXJC 3P20A 5GAGC 3OSOA 4FXDA 3TP8A 3GTJH 3ERSX 1KLUD 1O78A 1QILA 1QNKA 2BA0A 5C4JB 1D5XC 2AUJD 2F1MA 5C4XG 4OGQC 4OXPA 5GAEC 5EKLA 3C46A 3CD6A 2ICIA 4KY5A 2AQ1B 4WJ4A 2PMZB 1YJNA 2M00A 1PTOD 1MIUA 5EPLA 4P71A 4FP5D 1DGSA 1Q1EA 1QJOA 4IFDG 1T5EA 2A5HA 3D8GA 3F2UA 4GOPC 1F2YA 5EBDA 4BBRG 3GTMB 4EQPA 2MP1A 3W2DA 3MC0B 4DK0A 5M3FG 2CW0C 4JI0Q 2EDGA 5JVG3 5EKIA 4HJ8A 3KUPA 4LF9L 1I50H 1BBUA 1R4QB 1SYCA 2K6AA 3OIQA 2JA8G 4R8IA 4L5SA 1DM0B 3PO3H 1HUNA 4YWMA 4X65L 3KLWA 5ELNA 3DWQA 5IYCH 1QVCA 1Y1WH 4JI8Q 4QMGA 1TS5A 2CKZB 4J6HA 4KHPL 5JJIA 3S24A 3UDFA 3NENA 4A3EB 4C3HH 4DV6L 1JJCB 1A3TA 1X56A 4NKLA 2FINB 2NVYH 2PZWA 3NP8A 1VQJA 2PI2A 4F8MA 1GXDC 1SBBB 3DHQA 3FRPB 4BY1H 2B2WA 4ZQ3A 1BKBA 3A7AB 2F0SA 1FR3A 1ENFA 1EY6A 2Z4IA 3HFZB 2B2WC 3TZUA 3A0JA 2A6HC 1GHKA 4AQYQ 3K7UC 3AMUA 3VYRA 2JA5B 5CBEE 4HR7B 1LT3D 2L5TA 4HJ7A 1HFGA 3IFDA 1T9HA 1BUVT 2B29A 3BJUA 1VS0A 4DV5L 4C1NK 5D14A 3QJYA 1HFNA 3IFTA 4PMBA 4A3FG 1SYGA 2XNAC 3RZDH 2JA6H 2YYZA 4X3TA 3PUVA 4OO1I 4B3RL 1XX8A 1EYAA 1H9MA 1E22A 1I4XA 2PZUA 1RDPD 4ZUIA 5C5MA 4XXEA 1PZID 5M3MB 4IZ8A 4DUZQ 2LXKA 4NW2A 1W3SA 1JWMD 1TWAH 3M85A 5C6AA 4BS9A 2IJ0A 2RDHA 3K59A 3A55A 3M7GA 3LNNA 4FF3A 2HQLA 5T1GA 1B70B 4RHSA 2NZOA 2K03A 5FKAC 3F2CA 2Q2HA 2F4VQ 4ID6A 1O7LA 2ZTCA 4NMZA 3D6CA 3JAME 4M1UB 2L0CA 1PA6A 3SXHA 1HR0Q 3R2IA 3ERQA 5LHY1 1IW7D 2O2LD 3J80i 1Y69U 4GN4B 4A4IA 2NVXB 2JA9A 1VQGA 2NBFA 1L1OB 5I6YA 1VMCA 2L4NA 1CI3M 3QOLA 4RAUC 1XNQQ 4UY8C 4C1NI 3VYTA 3AQQA 3OW2A 1Q90A 1H9SB 3VR3A 2MQHA 3W3AA 1JICA 1UUPA 4DK3C 3HP3A 2SNMA 2KHSA 1JJ2A 3PO2B 1I94Q 3I4NH 3M9BA 1HTPA 2E2JB 1BCPC 4RGTA 4YHHL 4JG2A 3SK4A 1HNXQ 4N8FA 1UE5A 1K0SA 3MEHA 2WB1E 1STYA 1P8LA 4F87A 1GKHA 1GO3E 3FP9A 3WOFA 1BF4A 3TZDA 4R4QA 4JBMA 2JA7B 4ODGA 2Z6BA 2B2YA 4A3MG 1I6HB 2MFIA 3GDEA 4ZCKA 3MTSA 5GADC 2F0NA 1LLRD 3K57A 1BR9A 1YEZA 2HCIA 4UP8A 3GTPH 3SK6A 5C4JH 4F7XA 3FKIG 1TWHH 3STBC 3UDGA 3GTQH 3FPUB 2KCMA 4ME5A 3URYA 4LF5L 1DONA 4HIKA 5C3XA 4OWWB 4LF6L 1GM5A 1N36L 2JN4A 2KCCA 1A8VA 4DR2L 4XTCS 3S1QB 2QW7A 2I5LX 4HSVA 2CW0D 1VQ4A 1ESRA 4R4CA 4TVAB 4B3SQ 2E2HH 1SJHD 3M7NA 3KBXA 4B3ML 1UAPA 3MAQA 1EQVA 1SNQA 1I3QB 2JK8A 2Y0SE 1VQ8A 2LMCB 3BVGA 3OMGA 3QB3A 2PPBC 4NXNQ 4A3GH 4PZ6A 2WKCA 3N52A 4A3LG 1TIID 2WV6D 1F9SA 2YV5A 3OOCA 2GVBA 5FK9C 4PQXA 1YHAA 2F0VA 3BVMA 2KOLA 3UE1A 1D7QA 1E1TA 4J1MA 4DR1Q 3S1MH 1B44D 3HOWG 1EWIA 2ZT9C 2Z8LA 2WAQG 2E5LQ 1VQ6A 4JV5Q 4JI5Q 4P2CB 5E4WC 2A6HD 4UDUC 1JT8A 4JI8L 4K5XA 4QF4A 5EPJA 1BOSA 1PYBA 1STBA 3HZXA 1Q8KA 1KDBA 1X54A 3CRKC 3TP7A 2KBNA 2DGYA 1DXMA 1SE3A 2RSOA 2Q8RE 1EFID 2L1BA 4O42A 2MO1A 3RLFA 3CC4A 4MZ9A 3MXUA 4U673 3D4DA 4AQYL 4DF7A 1PZJD 3JC66 1FNVA 1XNRQ 3WDNA 4A93B 4BA2I 1NBWA 4RMFA 4IO9A 4H02A 1NUCA 5C44G 3K5MA 1U4MA 2HIXA 3A54A 3R3OA 1N32Q 2EZVA 4RCNA 2UXCQ 2KHJA 3GQBA 1AZPA 2VUMH 4IQZA 1YNXA 3PV0A 1Y8OB 1H9KA 1G2TA 4I7AA 3J7AV 1PH5A 3H6MA 4A3IB 1CHPD 5KGUA 1VQ9A 2CH4A 2VY3A 3V96A 4DR6L 4ZYSA 2UUBL 4ILWA 2BOSA 1TY0A 4RFBA 1PH6A 4X3UA 3W1GA 2NVXH 4QL5A 1MGSA 5I4DA 4J8QA 4Y7NH 3S1NB 1V1QA 1UE6A 4X6AH 4QIWB 1KL9A 2JEBI 3EIVA 4OX9Q 2F4VL 3EA6A 1BCPD 1VDZA 3PO3G 1HR0L 4Q5VA 1GUSA 4G7OC 1FD7D 1ML0D 2NYZD 2HDLA 5IYCG 2DNEA 1KRSA 5IGFA 1Y1WG 1JB3A 2G9DA 3J7ZC 4APVA 1EYGA 2ES2A 1J9OA 2NVQB 1EL0A 2D9UA 1PRTC 4PV1C 4C3HG 2N49A 3HKZB 3AFPA 4DR5Q 3JAML 1IBML 4A3JB 2DJGC 1SE2A 1SR3A 1QZGA 1IBLL 3BS1A 4BY1G 5E7NA 1JOQA 1BBWA 2C5CA 3KF6A 1I94L 4ZAIA 2YTXA 3H15A 1VQBA 4FXKC 1J5EL 4K6LA 5KRUA 5IWAQ 4CJ0B 1EY7A 1RCVD 3G6EA 2E75C 2F4IA 3STBD 3E9IA 4I65A 1EFWA 1SYDA 1JCKB 2BE5C 4KN7C 1WCMH 2ICEC 3ND8A 3GO5A 3NELA 3QO2A 4TSSA 1N8RC 1XYIA 1BXTA 3C1EA 3H94A 2N55A 4YCWA 1P16A 2L9HA 5J22A 3S1QH 1SMXA 3VR6A 1TKWB 1HZCA 5DEHA 2JA6G 3NK9A 1NMFA 1Y1VH 4NDXA 3TMEA 2A19A 3D4WA 1L0YB 1LTSD 1I3QH 4A3DH 4KHPQ 3DWPA 2D2CC 2L15A 3S2DB 1ZEQX 4R4TA 4DV6Q 1JE5A 3DMUA 3C2PA 5JJZA 2VQEL 2EYOA 3ZJYC 3BVZA 1CSPA 4B3TL 4GZYC 5IP7H 3M4QA 1LT5D 3L9AX 4N9PA 3EBEA 1YBYA 1QWYA 1O7YA 4C3IB 1JC7A 4FNFA 2R7ZB 4NXNL 2HIVA 3TS0A 4UP7A 3S17H 1PFMA 5A35A 4CJ2C 1FJGQ 1H95A 3EN2A 3T1HQ 1M8AA 1TU2B 1G2SA 2GVAA 1L2FA 4WFN3 3RNUA 3AEVA 3I4MH 2IX3A 4K8JA 3TBIB 5BN3A 1JOKA 5EGTA 1EY4A 1H9JA 1V1PA 1QG7A 5IT9E 1B2TA 2OXPA 2O5JC 2GA4B 3PIP3 3TDQA 2NN6H 4HMJA 4KN4C 4JV5L 1EQTA 1LTAD 3BYTB 3K8AA 5HGQA 3VA7A 3CCLA 2EY2A 4A3KH 3V05A 1CQFA 2EXZA 5GAHC 4DR3Q 4LF7Q 3I4NG 1N33L 3MVVA 4ULLA 5LL6X 1EYDA 4H0LC 2UUAL 1OTCA 4L8JA 3Q6SA 3SE0A 4H44C 4POGA 4A93H 1EWCA 4H7BA 1X6OA 2IT1A 3CHBD 3X3NA 2QEXA 4JCVE 1SNMA 3SHLA 2AWNA 2YTVA 4LFCL 5D3DA 2B39A 4AYBE 1HCZA 5BR8L 4DV0L 3I55A 2ASBA 1Q46A 1XNRL 5C4HA 3CAMA 1V9PA 4LUVA 3QWNA 4HIDA 4ZKCB 1OXVA 2MPMA 1TWCB 5FO9B 1U4PA 2G5DA 3I91A 4A3IH 1N32L 3CCEA 4C2MH 1TXYA 2WP8J 5FJ8H 1I4QA 4CDFC 2PW7A 5G3LD 2RA4A 4E6IA 1R9TB 1C9OA 1S40A 4YHHQ 4DXFA 2HDMA 3F2BA 5M5YH 5AJ3L 1S4ZA 1TWFB 3C1FA 2RVLA 4A3GG 4FF4A 3CP0A 2EYJA 4BY7H 3DM1A 4YWKA 2X69A 2MJ8A 3HOZB 1PRTD 1KNAA 2Z4HA 4IPDA 1N9WA 2VB3X 4AYBG 4RKLA 1SRUA 2CQAA 4JC0A 1DOKA 3CMAA 4FF2A 4UPAA 1GHJA 2DUDA 1X3PA 3GD7A 4OX9L 3BDCA 4BXXH 1JWUD 4DNRB 5FLMH 3RZOB 3S16B 1AEXA 3UDIA 3DUZA 1PYSB 1PH1A 2QA4A 2QF7A 1QUQA 3A8IE 5HURA 1LTTD 1SYEA 3IAYA 4DR2Q 4S3SA 4BWGB 2E2IH 1QCBD 3KFUA 4GKKQ 1XPRA 4FVMA 3IL8A 3HRZC 1WTXA 4JVZA 4DR5L 1WTRA 2X6LA 4B3MQ 1B9NA 1RKNA 2K7VA 1WTWA 3D3RA 1EEFD 2MO0A 1ET6A 2R3ZA 1KHIA 5I9OA 4GOPA 2B2UC 2IX1A 5IWAL 1CZWA 2NN6I 4H13C 2PQAB 1Q3LA 4X64Q 4C56C 1NMGA 1HQRD 3U4VA 4WRDA 2D62A 4RGOS 1W2BA 1UWVA 3QR8A 2NWGA 3CQZB 2K4KA 4K5VA 4DGZA 3S2DH 2VXWA 1SNPA 1O7ZA 3P75A 2R7DA 4X66Q 3HOUH 3BDLA 3NBHA 1A3VA 1NSNS 3CW2C 2VUMG 1WTOA 2MUYA 1STGA 4YY3L 1JQYD 1SXTA 2B63B 4L5QA 3CCMA 2EIFA 3PUZA 1MJCA 1CKMA 3J81E 1FNUA 4QB4A 4C3IH 2EVBA 2V4DA 1E24A 1WTHA 4DV7Q 1KTKA 3PSIA 2NVTH 4CBVA 4XQQA 1LYLA 4GN5A 1TWGB 2QEJC 3BG3A 4R8NA 3W5OA 2F0PA 1E0BA 2DJFC 3K80C 2CHBD 2ZXPA 3NPPA 1PMRA 5J39A 2A8VA 3K5OA 3J7AF 2XGTA 2BH8A 1VQEA 2RHQB 3NTIA 1WI5A 4JYAL 1UNSA 3M4YA 2F0FA 1HPCA 3AYHB 4GNXB 5EPKA 2G9HD 1FJGL 4OELB 4OEMB 4DK1A 3T1HL 1YHQA 1S5CD 3E5SA 1B8AA 1LTGD 3PUYA 3HKSA 1WD1A 5COYA 5I6WA 3RR5A 3H3VC 3OWEB 4YWLA 3MFYA 3H3VH 3ITPA 1ENCA 4CKCA 5ELFA 2F0LA 4Z9CB 3CU7A 1XMOQ 3GTKH 2PW5A 5IYDH 5C4XB 4IUQA 2F0HA 4B9XA 2VL6A 2JA7G 1E7ZA 1PFNA 4LUOA 4DR3L 4LF7L 4HTHA 5IT9L 3HOVH 1PYWD 5JEAJ 4DR6Q 4JI2Q 2UUBQ 1YHBA 2N78A 3OPOA 3SR1A 5ELBA 1WCMG 4JBWA 3CCRA 2Z9HA 3SK8A 3OHXC 4BBRB 5M5XB 4TRDA 2LXJA 3V2TA 1TWCH 5M3FB 2VNUD 3CPWA 1X9NA 1SROA 2NZHA 3G7LA 4K14A 1OXSC 2FHTA 1QB5D 1VF7A 3KBGA 4PZ8A 2JA8B 3S9WA 3KF8A 1EQQA 1Q1BA 1IYVA 5CBAE 1Y1VG 4DV2Q 1R9TH 1TY2A 2OQ0A 4KV6A 2RDGA 5C5LA 1M90C 3KLRA 3QG1A 3MEFA 4A3DG 3OW7A 2WFWA 4LF4Q 4A3BB 2O5IC 1PH7A 2E76C 2O4XA 4XIGS 1XPOA 3MZ5A 3HOYB 1DCZA 1IBMQ 1EU4A 1IBLQ 2EYMA 3HOZH 4A75A 3QIAA 5IP7G
chains in the Genus database with same CATH topology
1LTRD 1SFOB 1B1ZA 2AQ3B 2EY5A 4G4KA 4KY7A 4BBSB 2E2DC 4MN3A 1I4HA 2H4OA 4DU9A 3GTGB 5FLXE 1LT4D 1NR4A 4FF1A 1CA6A 2NN6G 4A3FB 3S14B 4KMUC 4OIKA 3GTOB 5IGEA 5EJWA 4DAPA 1TR5A 1O80A 1QE6A 5DM73 1CHQD 2NTTA 2XWJB 3KLSA 1A6XA 5FO7B 5D3IB 5KYLA 1Y8PB 1I4RA 2D5DA 2JXMB 3I90A 3NE5B 4EQOA 4IUPA 4K2KA 2ZXOA 2RQXA 3NXWA 5M9OA 2EYFA 3A56A 1ENAA 4G57A 5EQ0A 1PXUA 3CRLC 4G7HC 3K6OA 1JR0D 2EPBA 5E4XA 2K5DA 2KQ3A 3L3OC 1WD0A 1PTOB 3I70A 1DOMA 2B8GA 4OL7A 2L12A 2B8FA 1RTNA 1AN8A 1QOHA 1AFPA 4LAAA 3HG9A 5JPNC 1BQQT 5DNFA 1CM9A 4BA1I 1G8ZD 4C3JB 2OF1A 2EY6A 3J7YW 2WACA 4A3MB 5C4ZA 3J81L 5CGKA 3PIO3 2VB2X 3HOXB 2A68C 3KLSX 3QOJA 3VR4A 3GTLB 1STEA 1V1PB 4DNTB 3FKIB 4KI0A 5E1FA 2F3VA 1II3A 1J8IA 3K0YA 2SEBD 2HCCA 3T13A 1KNEA 1IKMA 3RUZA 2EYPA 1EYCA 2IPKD 3LX0A 4ZRZA 5BN4A 2WB1B 4L6TB 4KD3A 4M8AA 1MD2D 1B4OA 5E3FA 3K7AB 2FMCA 4RH6A 2RSNA 3A7LA 1ZKOA 5CV7A 4C3IG 5C0XJ 3S1RB 1R4PB 1XTCD 3BZDB 2H1EA 2Y0SB 1XWEA 2K5QA 1SSOA 1EZ8A 5NUCA 1F2MA 3DWAA 1STAA 1SAPA 1EY0A 1A3UA 2JSOA 5KIXA 1F9PA 4K5WA 1KDCA 2K04A 1VF5C 3FMCA 2J7ZA 2QCPX 2PNRC 3J80E 1AZQA 3S15B 2RDFA 1K83B 3MXGA 3P7JA 1E2WA 3GTJB 2F0OA 1TT2A 3FDTA 4I7ZC 5ELEA 4DN4M 5FLXL 4XYOA 1GUTA 4B08A 1D5MC 2F0GA 1SMYC 2EJGC 1OXUA 4KKUA 4K6DA 4TKOB 2XN9C 2F0TA 1PTOH 1EOTA 1TS4A 1I50B 5I9PA 4IURA 5C3EB 5JEAH 4JK1C 1ILPA 1BNZA 1C4QA 4RKBA 1BDOA 2DY7A 2F0IA 5CYUA 2NVYB 1SNDA 3VA5A 1WTVA 1DZ1A 4V0BA 3U9OA 1M4VA 4BY1B 2A68D 1HA5A 3Q23A 2JP1A 4ZK9B 1WVLA 3EROA 3OIPA 1TVXA 1MSGA 5IGBA 3SDZA 4CHTB 1TQOA 1A2UA 4DXGA 1DOLA 1SNCA 3AB9A 1VMPA 1ONLA 3T56B 3Q24A 3R2TA 2JA6B 1BBXC 3NBIA 1U9RA 2OT2A 5FOBB 5CORA 1Y8NB 4LJZC 3IKJA 2K1BA 4HCSA 3FPPA 1RD9D 4ZLTF 4TQUS 3WOEA 1TWAB 4EQNA 3D6WA 1G91A 3EJIA 1PTOF 1CTMA 2F0QA 1RJTA 2R61A 4IFDJ 3LWUA 3R93A 4U68A 2KA7A 2OEOA 2JEAI 4IALA 4OO1H 2XWBB 1WTQA 1IL8A 1GUWA 1F9RA 1HRJA 2LKVA 3I4NB 2NZ1D 1RF2D 2BE5D 2YU9B 1BCPB 1QNUA 1I6VC 3X3MA 3K5LA 2B2UA 5IODA 3GV3A 1Z47A 2LS01 1LT6D 2IX0A 1B3AA 2RKSA 3EFXD 1F9QA 3VYSA 3GTPB 2DY8A 4KKSA 1MSHA 1RTOA 4HN7A 1TWHB 4PMWA 3GTQB 2DNCA 3Q22A 1B50A 5DM63 1SMYD 2KECA 1SDFA 3H0GB 4CJ1B 1S5BD 2IL8A 2E2HB 1B53A 5IOCA 4KHVA 3J80L 1TS3A 5IGDA 1HXYD 1PFBA 2R92B 4A3GB 1G291 3TN2A 4HMIA 4HCEA 1S5DD 4R9WA 5TSSA 4WJWA 4MIUA 4AYBB 3M4OB 3T51B 1FNWA 5CR3A 1I4PA 3S1MB 2QILA 1YNJC 5HGTA 3I72A 3HS0C 3R8BA 3O13A 2EY1A 2F3WA 3P1HA 3D4RA 1V43A 3HGBA 5M5WB 4KK7A 4V190 3VR5A 4FYDA 3I8ZA 1OO9B 2Z1CA 1IHZA 4OHJA 3HEJA 2AUKA 3K5NA 3SK5A 3OWFA 4HAEA 4QUFA 3NSWA 5LL6S 4WORA 5EBCA 1GUGA 4IUUA 1U4LA 3EVQA 1E2VA 1D6EC 3ND9A 5CV8A 4ZKBB 3L7ZC 5C0XH 2JE6I 1D1IA 1U4RA 5CV9A 5KNDA 1GJXA 3GP7A 4KTAA 5AFWA 3UI2A 2K5WA 2XRQD 1TS2A 3NTKA 2VUMB 1CZGA 1CFMA 3BDOA 2NB0A 4F88A 5DAUA 5CC4A 3ZYYX 2KUMA 5A2QE 4L63B 3M3YB 4PNYA 2XRSD 1B9MA 1D5ZC 5BN5A 4Y7NB 4RGNA 3NQTA 4EGVA 2M9VA 5I2XA 3MHBA 2M2LA 2FFKB 5JAVA 1SEBD 2PZTA 2AQ2B 4XQJA 2K28A 2TMPA 2WIIB 1EEID 1WTPA 3NWTA 3H91A 2A69C 2IW3A 4MHEA 1F2LA 4RA8A 5JEAG 2QDBA 1ILQA 1RODA 1JE4A 1D1KA 4IUVA 5KNCA 2K33A 1DD2A 1PRTB 3NWSA 4C3JG 4XYQA 4NP5A 1A15A 4QUCA 4N9TA 5EKKA 1KLGD 2XIWA 1W6JA 4G7ZC 3E6ZX 1KDAA 3DEOA 1F77A 2KEDA 2B2YC 2A6EC 2I07B 1K8OA 5F2DA 1WCMB 5I2YA 1ICWA 4UAIA 2HQEA 3I3CA 5JVH3 2EE1A 5K36H 2BDOA 1SE4A 2R6GA 4HSPA 1Y1VB 4KY6A 2ZXRA 1V8QA 4A3DB 3K58A 1GUOA 2B2TA 1GOZA 2KVMA 1LTID 4DAVA 1LABA 2B2TC 3RD4A 2F0EA 3OMCA 5C0XI 4FXGC 1ZXTA 1STNA 1YNJD 5JOBA 1C48A 1LTBD 3PMFA 3EQLC 5KNBA 3S17B 1JWSD 2AWOA 1RHPA 3I4MB 4XQNA 5IGGA 1ZYRC 4HEDA 2F0WA 4IN3A 3D31A 2PQEA 5K5PA 2EJMA 1E2ZA 1OXXK 4ABNA 1GUNA 5CV4A 1NR2A 2PO4A 4OO1G 4A3KB 1BCPF 4K8IA 1HUMA 1XXGA 5CMDA 5ISRA 4XDXA 2PCFB 2F0DA 3FEWX 4IFDH 1OXTA 1HTLD 2L55A 2PYKA 2XVSA 2J4XA 2C9OA 3AU7A 3I73A 3KK7A 1Q12A 5IIFA 1CQVA 1H9SA 3A8JE 2E74C 1SNOA 1K8MA 4Q0FA 3HOWB 5ELCA 2WAQB 3BYYB 4C2MB 5IGCA 3S2HB 1DYQA 3I4LA 3SEBA 1MI2A 1LV9A 4X3SA 1PZKD 2BA1A 1PLFA 3N6RA 4PMCA 3U9SA 1EY5A 2F03A 3PUWA 5M5YB 2KCNA 1V1OA 2A69D 2N88A 1Q8IA 2ID0A 5J1ZA 2EYHA 4BY7B 1C8CA 1KABA 3TP6A 2LY7A 4IUTA 1X32A 1SYFA 2FJ2A 1YNNC 4DAYA 4IUNA 4X3KA 5A2QL 1IKLA 2EOTA 2F0UA 1DJRD 5C44B 1STHA 1CK1A 2A6ED 1CT1D 1IYUA 2JYOA 4DFAA 5CV6A 2E2IB 4ZUJA 4O1NA 2B2VA 5FO8B 3PUXA 4KJNA 3FVQA 4RCOA 4CGYB 3NUCA 2B2VC 1L0XB 2NTSA 4QCLA 2SOBA 4KKTA 1I4GA 1F2ZA 5ELDA 3TP5A 2A74C 4RGMA 2KJXA 3H09A 2SNSA 3GV6A 4KD4A 1EIGA 2F0MA 5C0XG 2Q8IB 3LWEA 2DN8A 1PTOC 3NTHA 5CV5A 3VYUA 2EJFC 2NUCA 3Q0AA 1X3QA 2MGSA 3HOUB 3PO3B 4IFDI 4KJOA 1EY8A 1Y1WB 1PDQA 4CKBA 1ET9A 5C3WA 2RBMA 4C3HB 3MA2B 3RMHA 1ZYRD 3E0JA 2EYLA 2NVTB 5KEEA 2CVRA 5G3LF 4LMQD 3C3LA 2X6GA 2K32A 1Z6HA 1G6ZA 3DEPA 3MWYW 4XT1B 1MBYA 3MFGA 3T16A 5D65A 1D2BA 2XSCA 3T53B 2BCOA 1PRTF 1T5XD 2FMMA 4CKEA 2K05A 1HHVA 2J0TD 3TSSA 3VR2A 2TSSA 4DA2A 3RZDB 4RHRA 1W6KA 2WKDA 4EVOA 3GTKB 3SVMA 2F0KA 2K01A 1HA6A 1Z7TA 3NHHA 1S5ED 4B9WA 1LO5D 3G6JB 1S5FD 1BO0A 3NQIA 3HOVB 2MHVA 2QKIC 3T4AC 5JPMC 1EWHA 2F0JA 1A2TA 1EIHA 2WINB 2I46A 3CKIB 2LFNA 5T1IA 1NAPA 2L11A 5K36G 4OIJA 2A73B 1JORA 2KEEA 1KAAA 3MXNA 3MXPA 1IW7C 1AP0A 4KHZA 3A8KE 1AW7A 1UEAB 4XT3B 1FYCA 2BDNA 1ESFA 1EY9A 4YIJA 1JOOA 1SYBA 1SJED 1NCVA 2Q8TA 5KYIA 1YNND 1FGBD 1VCIA 1LACA 4K2LA 4LK1C 2ENBA 4FO2A 2SDFA 3ONAB 2HUGA 1CA5A 1EU3A 2R93B 1H9RA 1HQMC 4RWSC 2IWHA 1EZ6A 3P20A 3DXJC 3OSOA 4FXDA 3TP8A 1KLUD 1O78A 1QILA 1QNKA 2BA0A 5C4JB 1D5XC 2AUJD 2F1MA 4OGQC 5EKLA 3C46A 2ICIA 4KY5A 2AQ1B 2PMZB 2M00A 1PTOD 5EPLA 4FP5D 1Q1EA 1QJOA 4IFDG 1T5EA 2A5HA 3D8GA 3F2UA 1F2YA 5EBDA 3GTMB 4EQPA 2MP1A 3W2DA 3MC0B 4DK0A 2CW0C 2EDGA 5JVG3 5EKIA 3KUPA 1R4QB 2K6AA 1SYCA 3OIQA 4R8IA 1DM0B 1HUNA 3DWQA 4QMGA 1TS5A 4J6HA 4A3EB 1A3TA 4NKLA 2FINB 2PZWA 3NP8A 4F8MA 1GXDC 1SBBB 3DHQA 3FRPB 2B2WA 4ZQ3A 3A7AB 2F0SA 1FR3A 1ENFA 1EY6A 2Z4IA 2B2WC 3TZUA 2A6HC 1GHKA 3AMUA 3VYRA 2JA5B 5CBEE 4HR7B 1LT3D 2L5TA 1HFGA 3IFDA 1BUVT 4C1NK 5D14A 3QJYA 1HFNA 3IFTA 4PMBA 1SYGA 2XNAC 2YYZA 4X3TA 3PUVA 4OO1I 1XX8A 1EYAA 1H9MA 1I4XA 2PZUA 1RDPD 4ZUIA 5C5MA 4XXEA 1PZID 5M3MB 4IZ8A 4NW2A 1JWMD 3M85A 5C6AA 4BS9A 2IJ0A 2RDHA 3K59A 3A55A 3M7GA 3LNNA 4FF3A 5T1GA 4RHSA 2K03A 5FKAC 4ID6A 1O7LA 4NMZA 3D6CA 3JAME 4M1UB 2L0CA 3SXHA 3R2IA 3ERQA 5LHY1 1IW7D 2O2LD 1Y69U 2NVXB 2NBFA 5I6YA 1VMCA 2L4NA 1CI3M 3QOLA 4RAUC 4C1NI 3VYTA 1Q90A 1H9SB 3VR3A 3W3AA 1JICA 1UUPA 3HP3A 2SNMA 2KHSA 3PO2B 1HTPA 2E2JB 1BCPC 4RGTA 3SK4A 3MEHA 1STYA 4F87A 3WOFA 1BF4A 3TZDA 2JA7B 4ODGA 2B2YA 1I6HB 3MTSA 2F0NA 1LLRD 3K57A 1BR9A 2HCIA 3SK6A 4F7XA 3FPUB 4ME5A 3URYA 1DONA 5C3XA 2KCCA 4XTCS 3S1QB 4HSVA 2CW0D 1ESRA 1SJHD 3M7NA 3KBXA 1UAPA 3MAQA 1EQVA 1SNQA 1I3QB 2LMCB 3BVGA 3OMGA 3QB3A 2PPBC 2WKCA 3N52A 1TIID 2WV6D 1F9SA 3OOCA 5FK9C 4PQXA 2F0VA 3BVMA 2KOLA 4J1MA 1B44D 2ZT9C 2Z8LA 4P2CB 5E4WC 2A6HD 4UDUC 4K5XA 4QF4A 5EPJA 1BOSA 1STBA 3HZXA 1KDBA 3CRKC 3TP7A 1DXMA 1SE3A 2RSOA 2Q8RE 1EFID 2L1BA 4O42A 3RLFA 3MXUA 4U673 3D4DA 4DF7A 1PZJD 1FNVA 3WDNA 4A93B 4BA2I 1NUCA 3K5MA 1U4MA 3A54A 3R3OA 2EZVA 4RCNA 3GQBA 1AZPA 4IQZA 3PV0A 1Y8OB 1H9KA 1G2TA 3J7AV 3H6MA 4A3IB 1CHPD 5KGUA 3V96A 4ZYSA 4ILWA 2BOSA 1TY0A 4RFBA 4X3UA 1MGSA 5I4DA 4J8QA 3S1NB 4QIWB 2JEBI 3EA6A 1BCPD 1VDZA 4Q5VA 1GUSA 4G7OC 1FD7D 1ML0D 2NYZD 2HDLA 2DNEA 5IGFA 1JB3A 2G9DA 2NVQB 1J9OA 1EL0A 2D9UA 1PRTC 4PV1C 4C3HG 3HKZB 3JAML 4A3JB 1SE2A 3BS1A 1JOQA 2C5CA 4ZAIA 4FXKC 4K6LA 5KRUA 4CJ0B 1EY7A 1RCVD 2E75C 2F4IA 4I65A 1SYDA 1JCKB 2BE5C 4KN7C 2ICEC 3ND8A 3GO5A 3QO2A 4TSSA 1XYIA 1BXTA 3C1EA 3H94A 2N55A 2L9HA 5J22A 3VR6A 1TKWB 5DEHA 3NK9A 4NDXA 3TMEA 3D4WA 1L0YB 1LTSD 3DWPA 2D2CC 3S2DB 1ZEQX 3DMUA 3C2PA 5JJZA 2EYOA 3BVZA 4GZYC 1LT5D 3L9AX 4N9PA 1QWYA 1O7YA 4C3IB 1JC7A 4FNFA 2R7ZB 1PFMA 5A35A 4CJ2C 1M8AA 1TU2B 1G2SA 4WFN3 2IX3A 4K8JA 3TBIB 5BN3A 1JOKA 5EGTA 1EY4A 1H9JA 1V1PA 1QG7A 5IT9E 1B2TA 2OXPA 2O5JC 2GA4B 3PIP3 3TDQA 2NN6H 4HMJA 4KN4C 1EQTA 1LTAD 3BYTB 3VA7A 2EY2A 3V05A 1CQFA 2EXZA 3MVVA 4ULLA 5LL6X 1EYDA 4H0LC 4L8JA 3Q6SA 3SE0A 4H44C 1EWCA 4H7BA 2IT1A 3CHBD 3X3NA 1SNMA 3SHLA 2AWNA 5D3DA 2B39A 1HCZA 5C4HA 3QWNA 4ZKCB 1OXVA 2MPMA 1TWCB 5FO9B 1U4PA 3I91A 2WP8J 1I4QA 2PW7A 5G3LD 2RA4A 4E6IA 1R9TB 4DXFA 2HDMA 1S4ZA 1TWFB 3C1FA 2RVLA 4FF4A 2EYJA 3DM1A 2X69A 2MJ8A 3HOZB 1PRTD 1KNAA 2Z4HA 2VB3X 4RKLA 2CQAA 1DOKA 4FF2A 1GHJA 3GD7A 1X3PA 3BDCA 1JWUD 4DNRB 3RZOB 3S16B 1AEXA 3DUZA 2QF7A 3A8IE 5HURA 1LTTD 1SYEA 3IAYA 4BWGB 4S3SA 1QCBD 4FVMA 3IL8A 3HRZC 1WTXA 1WTRA 2X6LA 1B9NA 1RKNA 2K7VA 1WTWA 3D3RA 1EEFD 1ET6A 2R3ZA 5I9OA 2IX1A 2B2UC 1CZWA 2NN6I 4H13C 1Q3LA 4C56C 1HQRD 4WRDA 2D62A 4RGOS 2NWGA 3CQZB 4K5VA 4DGZA 2VXWA 1SNPA 1O7ZA 3P75A 3BDLA 3NBHA 1A3VA 1NSNS 1WTOA 2MUYA 1STGA 1JQYD 1SXTA 2B63B 3PUZA 3J81E 1FNUA 4QB4A 2EVBA 2V4DA 1KTKA 4CBVA 4XQQA 1TWGB 2QEJC 3BG3A 4R8NA 2F0PA 1E0BA 2CHBD 2ZXPA 3NPPA 1PMRA 5J39A 3J7AF 3K5OA 3NTIA 1UNSA 3M4YA 2F0FA 1HPCA 5EPKA 2G9HD 4DK1A 1S5CD 3E5SA 1LTGD 3PUYA 1WD1A 5COYA 5I6WA 3H3VC 3OWEB 3MFYA 3ITPA 1ENCA 4CKCA 5ELFA 2F0LA 4Z9CB 3CU7A 2PW5A 5C4XB 4IUQA 2F0HA 4B9XA 1PFNA 4HTHA 5IT9L 1PYWD 5JEAJ 3OPOA 3SR1A 5ELBA 4JBWA 3SK8A 3OHXC 4BBRB 5M5XB 4TRDA 3V2TA 5M3FB 2VNUD 3G7LA 4K14A 1OXSC 2FHTA 1QB5D 1VF7A 3KBGA 2JA8B 3S9WA 3KF8A 1Q1BA 1IYVA 5CBAE 1TY2A 4KV6A 5C5LA 2RDGA 3KLRA 3QG1A 3OW7A 4A3BB 2O5IC 2E76C 2O4XA 4XIGS 3MZ5A 3HOYB 1DCZA 1EU4A 2EYMA 3QIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8T A;  3IFD A;  1MSH A;  1LV9 A;  1RTO A;  2RA4 A;  4X3S A;  1DOL A;  1F9P A;  1PLF A;  1VMP A;  2B2T A;  2KVM A;  2CVR A;  1B50 A;  2SDF A;  1AZP A;  3ONA B;  2HUG A;  1CA5 A;  3FPU B;  2HDM A;  5D14 A;  1HFN A;  2K04 A;  2B2T C;  2KEC A;  4LMQ D;  5JJZ A;  1DON A;  1E0B A;  4MN3 A;  1S4Z A;  1BBX C;  2X6G A;  1SDF A;  1G2T A;  2J7Z A;  1AZQ A;  2RVL A;  2N88 A;  4X3T A;  1ZXT A;  1G6Z A;  3DEP A;  3MWY W;  4RWS C;  5COR A;  4XT1 B;  4CJ1 B;  4HSV A;  3P7J A;  1XX8 A;  1ESR A;  2IL8 A;  3DM1 A;  2X69 A;  1B53 A;  2MJ8 A;  2KUM A;  1KNA A;  1C8C A;  2K1B A;  5EPK A;  1O7Y A;  3KBX A;  1NR4 A;  4HCS A;  5D65 A;  4X3U A;  3TN2 A;  1CA6 A;  1QNK A;  3FDT A;  4IUT A;  1J8I A;  1PFB A;  1DOK A;  1X32 A;  4OIK A;  1PFM A;  4CJ2 C;  1MGS A;  4ZLT F;  4NW2 A;  1RHP A;  2FJ2 A;  2FMM A;  1M8A A;  2HCI A;  1G2S A;  2HCC A;  1X3P A;  2K05 A;  5EJW A;  2M2L A;  1O80 A;  1KNE A;  1QE6 A;  2FFK B;  4X3K A;  5COY A;  4DN4 M;  1HHV A;  1IKM A;  4HED A;  1IKL A;  2EOT A;  3N52 A;  3D6W A;  4R9W A;  2K28 A;  1QG7 A;  1G91 A;  1B2T A;  1F9S A;  5T1G A;  2JYO A;  5EPL A;  3SVM A;  1WTP A;  3H91 A;  2K01 A;  4MHE A;  4RA8 A;  1F2L A;  2K03 A;  1HA6 A;  3F2U A;  2B2V A;  2KOL A;  4IUQ A;  1ML0 D;  2NYZ D;  1EQT A;  2HDL A;  1SAP A;  1NR2 A;  1PFN A;  1ILQ A;  1BO0 A;  1ROD A;  2MP1 A;  3IL8 A;  1JE4 A;  2B2V C;  1WTX A;  1HUM A;  1RJT A;  3I90 A;  1WTR A;  1J9O A;  1EOT A;  4IUV A;  2D9U A;  2X6L A;  5EKI A;  1EL0 A;  4IUP A;  5CMD A;  1B4O A;  3KUP A;  3R93 A;  5E4W C;  4U68 A;  4IUR A;  1VMC A;  2L4N A;  1EIH A;  4R8I A;  1WTW A;  4RAU C;  1A15 A;  2DY8 A;  4XDX A;  4QUC A;  1HUN A;  2R3Z A;  2XIW A;  5AFW A;  5EPJ A;  3Q6S A;  3UI2 A;  2RSN A;  5EQ0 A;  1WD1 A;  5T1I A;  1BNZ A;  1ILP A;  1JIC A;  2B2U C;  3I8Z A;  3G7L A;  1IL8 A;  3DEO A;  4ZAI A;  1NAP A;  1WTQ A;  1F9R A;  2KED A;  3GV6 A;  3HP3 A;  1GUW A;  2L11 A;  2FHT A;  1HRJ A;  1EIG A;  2EPB A;  5E4X A;  2NZ1 D;  1Q3L A;  4OIJ A;  2B2Y C;  2DY7 A;  3LWE A;  4CJ0 B;  1WD0 A;  2RSO A;  4HAE A;  2KEE A;  2Q8R E;  4QUF A;  1DOM A;  2FIN B;  1WTV A;  2L1B A;  2NWG A;  4O42 A;  1DZ1 A;  5CBA E;  1ICW A;  2VXW A;  1O7Z A;  3QO2 A;  2B2W A;  2L12 A;  1X3Q A;  4IUU A;  2MGS A;  1U4L A;  4UAI A;  2JP1 A;  1XYI A;  3I3C A;  1AP0 A;  2B2U A;  1RTN A;  2EE1 A;  2H1E A;  2N55 A;  4ZK9 B;  1BF4 A;  1WVL A;  3TZD A;  2B2W C;  4ZKC B;  2MPM A;  3GV3 A;  1WTO A;  4ZKB B;  2L9H A;  1U4P A;  1PDQ A;  1SSO A;  3I91 A;  4XT3 B;  2B2Y A;  1TVX A;  1U4R A;  2BDN A;  5CBE E;  1B3A A;  1MSG A;  3MTS A;  5DNF A;  1CM9 A;  1F9Q A;  1U4M A;  1HFG A;  1MI2 A;  1NCV A; 
#chains in the Genus database with same CATH topology
 2QDL A;  4ME3 A;  1LTR D;  1SFO B;  1J5E Q;  1B1Z A;  2AQ3 B;  4DUY L;  2EY5 A;  1PH2 A;  1L0W A;  4G4K A;  4KY7 A;  1NJI C;  3FHW A;  4BBS B;  1MHW C;  1HZ9 A;  2E2D C;  1K9M C;  1VQF A;  4MNO A;  4MN3 A;  2C35 B;  2R93 H;  3WWV A;  1I4H A;  3I4M G;  2H4O A;  4DU9 A;  3GTG B;  5FLX E;  1LT4 D;  1NR4 A;  4FF1 A;  1VQC A;  1CA6 A;  2NN6 G;  1VQ7 A;  4A3F B;  3S14 B;  4KMU C;  4JI4 Q;  4OIK A;  3GTO B;  5IGE A;  5EJW A;  4DAP A;  1TR5 A;  1O80 A;  1QE6 A;  4A3K G;  2WAQ E;  5DM7 3;  3RLN A;  1CHQ D;  2NTT A;  2XWJ B;  3KLS A;  4O0A A;  4DAY B;  5FO7 B;  1A6X A;  4GKK L;  1UEB A;  5D3I B;  1Y8P B;  5KYL A;  1GVP A;  1I4R A;  1Y14 B;  3I4O A;  2VQE Q;  2I0Q A;  2D5D A;  3PF5 A;  3KF6 B;  4B3T Q;  4A93 G;  3L2P A;  1EOV A;  5JJK A;  3GTM H;  3JAM c;  2JXM B;  3I90 A;  3NE5 B;  4EQO A;  3CQZ H;  4IUP A;  4K2K A;  1EUJ A;  2ZXO A;  2RQX A;  3NXW A;  2ZJQ A;  5M9O A;  2EYF A;  1VQN A;  2H5X A;  1ENA A;  3A56 A;  3ER0 A;  4G57 A;  3H3V I;  5EQ0 A;  1PXU A;  3CRL C;  3CXC A;  4X64 L;  1J6Q A;  4G7H C;  3K6O A;  1K73 C;  1Z9F A;  1JR0 D;  4N8X 1;  2EPB A;  5E4X A;  2K5D A;  2KQ3 A;  1KIX A;  1YVC A;  3L3O C;  4R4I A;  1WD0 A;  4A3I G;  1PTO B;  4A3E H;  4JOI C;  3I70 A;  1DOM A;  2B8G A;  4X66 L;  5FJ8 G;  1K8A C;  2E8G A;  4OL7 A;  2L12 A;  1LM0 A;  1IYJ B;  4CDC C;  1TWG H;  5IP9 H;  2B8F A;  3UE0 A;  1RTN A;  2K50 A;  3CME A;  1N33 Q;  3RLO A;  4DKA C;  1AN8 A;  1QOH A;  4P75 A;  1AFP A;  4LAA A;  3L0O A;  1KXL A;  4LW1 A;  4DNI A;  1YIJ A;  3HG9 A;  2UUA Q;  5JPN C;  1A63 A;  3KOJ A;  1BQQ T;  2JA5 H;  4AH6 A;  5DNF A;  4GS3 A;  1CM9 A;  4NXM Q;  3A5Z B;  3F1Z A;  4BA1 I;  1G8Z D;  2KCT A;  5FLX c;  4C3J B;  4DV7 L;  2OF1 A;  2EY6 A;  3J7Y W;  4BY7 G;  4QY7 A;  1A0I A;  1IL2 A;  2WAC A;  4A3M B;  2OTJ A;  5C4Z A;  3J81 L;  5CGK A;  3PIO 3;  4LFC Q;  2VB2 X;  5BR8 Q;  3HOX B;  4DV0 Q;  2A68 C;  3HKZ G;  3KLS X;  3QOJ A;  3VR4 A;  3GTL B;  1PFS A;  4BXX G;  5FLM G;  4DV4 L;  3OYY A;  1STE A;  1V1P B;  4DNT B;  3FKI B;  4KI0 A;  5E1F A;  2HT1 A;  2F3V A;  1II3 A;  3LGJ A;  3T1Y Q;  1J8I A;  3PIO A;  2D0P A;  5M3M H;  3K0Y A;  3A5U A;  2SEB D;  1X65 A;  2HCC A;  3T13 A;  1KNE A;  1IKM A;  2P5Z X;  3RUZ A;  2EYP A;  1X3G A;  1EYC A;  2IPK D;  1XMO L;  3LX0 A;  4ZRZ A;  5BN4 A;  2WB1 B;  4L6T B;  4CDE C;  1IZ6 A;  5AJ3 Q;  2VQF Q;  4KD3 A;  4LNQ A;  4JI2 L;  4M8A A;  3DLL A;  4P74 A;  1MD2 D;  4GLX A;  1B4O A;  1L1O C;  4R1J A;  5E3F A;  4GLV B;  3K7A B;  1D8L A;  2FMC A;  4RH6 A;  3ULJ A;  4A3B H;  2RSN A;  3A7L A;  3KDF A;  3Q8D A;  3HOY H;  3HOU G;  1A62 A;  1AE2 A;  1KC8 C;  2Q2U A;  3PO2 H;  4DV2 L;  2E2J H;  5LMN W;  1ZKO A;  5CV7 A;  4A3C H;  4C3I G;  5C0X J;  3S1R B;  4LF4 L;  1R4P B;  1NNX A;  4BBS H;  1XTC D;  3BZD B;  2H1E A;  2Y0S B;  1XWE A;  3MXN B;  4EX5 A;  2K5Q A;  3OTO L;  1VQL A;  2JA7 H;  1SSO A;  1EZ8 A;  5NUC A;  1PH8 A;  1PHJ A;  1I6H H;  3GTG H;  2D0O A;  1F2M A;  3DWA A;  1STA A;  1SAP A;  1EY0 A;  1A3U A;  2JSO A;  5KIX A;  1F9P A;  4K5W A;  3GTO H;  2CFM A;  2KHI A;  1KDC A;  2K04 A;  1VF5 C;  3FMC A;  4IPC A;  2J7Z A;  2QCP X;  2PNR C;  3J80 E;  1AZQ A;  3U58 A;  1E3P A;  2N8N A;  3S15 B;  2RDF A;  2OWO A;  1K83 B;  1E1O A;  3MXG A;  3P7J A;  1E2W A;  3GTJ B;  4JI4 L;  4YY3 Q;  4NB3 A;  2F0O A;  1QUQ B;  3VDY A;  4DR4 Q;  5IYD G;  1TT2 A;  3FDT A;  4I7Z C;  4PZ7 A;  3PF4 A;  5ELE A;  4DN4 M;  5FLX L;  3HOV G;  4JW0 A;  4XYO A;  1GUT A;  4B08 A;  1D5M C;  1NTG A;  2F0G A;  5H1S E;  1SMY C;  1XPU A;  5IE8 A;  3E3X A;  2EJG C;  1OXU A;  4KKU A;  4K6D A;  4TKO B;  2XN9 C;  3I7F A;  4GOP B;  3I2Z A;  2F0T A;  3J81 j;  1PTO H;  4JYA Q;  1EOT A;  1TS4 A;  1I50 B;  5I9P A;  1X3F A;  4IUR A;  5C3E B;  1XJV A;  2UU9 L;  1NE3 A;  3BU2 A;  2K5V A;  5JEA H;  4JK1 C;  3ICE A;  1ILP A;  4POF A;  1BNZ A;  1C4Q A;  1WFQ A;  4RKB A;  1BDO A;  2DY7 A;  2MNA A;  3K81 C;  2F0I A;  1U5K A;  4C3J H;  5CYU A;  1KD1 C;  2NVY B;  1SND A;  3VA5 A;  1WTV A;  1DZ1 A;  4V0B A;  3U9O A;  1M4V A;  3HOZ G;  2PMZ E;  4BY1 B;  2A68 D;  1HA5 A;  3Q23 A;  2JP1 A;  3JAM i;  4ZK9 B;  1WVL A;  3ERO A;  3HOX H;  3OIP A;  4NXM L;  1TVX A;  2R93 G;  1JB7 A;  1MSG A;  5IGB A;  1IBK Q;  2RCN A;  3SDZ A;  4CHT B;  1TQO A;  3UDX A;  1A2U A;  4DXG A;  3A74 A;  1DOL A;  1SNC A;  1HNW Q;  3AB9 A;  1VMP A;  4JPB W;  1ONL A;  1GD7 A;  4PG3 A;  1HZB A;  3T56 B;  3Q24 A;  4DV3 Q;  3R2T A;  2JA6 B;  1BBX C;  3NBI A;  1U9R A;  2OT2 A;  5FOB B;  5COR A;  1Y8N B;  4LJZ C;  3T1Y L;  3IKJ A;  3E9H A;  2K1B A;  5EAY A;  4HCS A;  3FPP A;  2IHF A;  4K0K L;  4DAM A;  4OWT B;  1RD9 D;  4ZLT F;  4TQU S;  3WOE A;  4RG1 A;  1TWA B;  3S1N H;  1S3O A;  4DUY Q;  4EQN A;  3D6W A;  5J3B A;  4JBK A;  2VQF L;  4WJ3 M;  1G91 A;  2UXB L;  2ZTD A;  3EJI A;  5IT9 c;  3CC7 A;  1K0R A;  1PTO F;  1CTM A;  3PCO B;  2F0Q A;  1RJT A;  2R61 A;  4IFD J;  2NVQ H;  3LWU A;  3R93 A;  3KF8 B;  4U68 A;  2JQO A;  4A3E G;  2KA7 A;  5GQO A;  4AIM A;  2OEO A;  4A3J H;  2JEA I;  3CCV A;  3J7A 5;  4IAL A;  1PH4 A;  4OO1 H;  2XWB B;  5IP9 G;  1IL8 A;  1WTQ A;  1GUW A;  1F9R A;  1HRJ A;  2LKV A;  3I4N B;  2NZ1 D;  2K14 A;  1N34 Q;  1RF2 D;  2BE5 D;  2YU9 B;  5L37 A;  1BCP B;  4L5T A;  1QNU A;  2JA5 G;  1WYD A;  1I6V C;  1PV4 A;  1CKO A;  2B3G A;  4O2D A;  3X3M A;  3ULL A;  3K5L A;  3K0X A;  4HIM A;  2B2U A;  5IOD A;  3GV3 A;  4OON A;  1Z47 A;  2LS0 1;  1LT6 D;  2IX0 A;  1B3A A;  2RKS A;  4JI6 L;  3EFX D;  1F9Q A;  3VYS A;  3GTP B;  2DY8 A;  4KKS A;  1MSH A;  1RTO A;  4HN7 A;  4CDD C;  1TWH B;  4PMW A;  3GTQ B;  2DNC A;  3Q22 A;  1B50 A;  2I5H A;  5DM6 3;  1SMY D;  1VQM A;  2KEC A;  5M3M G;  1SDF A;  1Q86 C;  3H0G B;  3G48 A;  1CKN A;  4CJ1 B;  1S5B D;  1SN8 A;  4DR4 L;  2IL8 A;  2E2H B;  4IOC A;  1B53 A;  1VQ5 A;  1K28 A;  5IOC A;  4KHV A;  3J80 L;  1TS3 A;  2EQS A;  5IGD A;  2R7Z H;  2UXD L;  1HXY D;  1PFB A;  2RCF A;  2R92 B;  4A3G B;  1G29 1;  4HJA A;  1JJG A;  3TN2 A;  1QVF A;  5C3E H;  2VZA A;  4HMI A;  4HCE A;  2CQO A;  1X55 A;  1S5D D;  4R9W A;  5TSS A;  4WJW A;  4MIU A;  4AYB B;  4MTK A;  3M4O B;  3T51 B;  1FNW A;  3B6Y A;  5CR3 A;  4A3B G;  4LFB Q;  1I4P A;  3S1M B;  4QQB X;  1HH2 P;  2QIL A;  2CH4 W;  1B3Q A;  3HOY G;  1YNJ C;  5HGT A;  3I72 A;  2AMC B;  4DV4 Q;  1ASZ A;  2UUC L;  3HS0 C;  3R8B A;  3PO2 G;  3O13 A;  2EY1 A;  2F3W A;  3P1H A;  1VQK A;  3U50 C;  1C0A A;  3CCU A;  3D4R A;  1V43 A;  4DR7 Q;  1WOC A;  3HGB A;  1NY4 A;  3NEM A;  5M5W B;  4KK7 A;  4A3C G;  4X62 L;  4V19 0;  3VR5 A;  4FYD A;  3I8Z A;  1OO9 B;  4BBS G;  2Z1C A;  4J15 A;  1IHZ A;  4OHJ A;  4LF8 Q;  2ZJR A;  3HEJ A;  2AUK A;  1C7Y A;  5HY6 A;  3K5N A;  3SK5 A;  3OWF A;  1O7I A;  4HAE A;  1I5F A;  4QUF A;  3NSW A;  2AHO B;  5LL6 S;  4WOR A;  5EBC A;  1LTL A;  1GUG A;  4IUU A;  4ALP A;  1U4L A;  4QJF A;  3EVQ A;  1E2V A;  1D6E C;  3ND9 A;  5CV8 A;  5IYB H;  1IBK L;  4ZKB B;  3L7Z C;  5C0X H;  2JE6 I;  1D1I A;  1U4R A;  1U0L A;  1HNW L;  5CV9 A;  5KND A;  1GJX A;  3GP7 A;  4KTA A;  5AFW A;  3UI2 A;  2K5W A;  4LFA L;  2XRQ D;  3CPF A;  1TS2 A;  3J81 c;  4DV3 L;  3NTK A;  1YI2 A;  2VUM B;  1CZG A;  1CFM A;  1CUK A;  3BDO A;  3KJO A;  1VQH A;  2NB0 A;  1KRT A;  1YJ9 A;  4F88 A;  5DAU A;  2BH2 A;  1TWF H;  2F52 A;  5CC4 A;  4UP9 A;  3ZYY X;  3OTO Q;  2KUM A;  5A2Q E;  4L63 B;  3M3Y B;  4PNY A;  2XRS D;  1B9M A;  1YZ6 A;  1D5Z C;  5BN5 A;  2K52 A;  4Y7N B;  2HHH Q;  4RGN A;  3NQT A;  4R4O A;  4EGV A;  2M9V A;  5I2X A;  3MHB A;  1RL2 A;  2M2L A;  4DV1 L;  2FFK B;  5JAV A;  3RN5 A;  1SEB D;  1BVS A;  2PZT A;  2AQ2 B;  1X3E A;  2Z0S A;  4XQJ A;  3RZO H;  2K28 A;  2TMP A;  1KQS A;  3S16 H;  2WII B;  1EEI D;  1HR0 W;  1WTP A;  1EIF A;  3RN2 A;  3NWT A;  4KLK A;  3H91 A;  4YCU A;  2A69 C;  2IW3 A;  4MHE A;  1F2L A;  4RA8 A;  5JEA G;  4A76 A;  1B7Y B;  3KDF B;  2QDB A;  1ILQ A;  2YU9 H;  1ROD A;  1JE4 A;  2LSS A;  1D1K A;  1PH9 A;  4IUV A;  5KNC A;  1VQD A;  2K33 A;  1DD2 A;  1PRT B;  3AFQ A;  2Q2T A;  3NWS A;  4C3J G;  4XYQ A;  4JI1 L;  4NP5 A;  1A15 A;  4JI7 Q;  4QUC A;  4N9T A;  5EKK A;  1KLG D;  4JI3 Q;  2PQA A;  2XIW A;  2CCZ A;  1W6J A;  4G7Z C;  3E6Z X;  1N34 L;  1KDA A;  3DEO A;  4HJ9 A;  1F77 A;  2KED A;  3HOX G;  2B2Y C;  4QIW E;  2A6E C;  2I07 B;  1K8O A;  1HNZ L;  5F2D A;  1WCM B;  3BZK A;  5I2Y A;  2N3S A;  1ICW A;  2Q2I A;  1VQO A;  4UAI A;  2HQE A;  3I3C A;  5JVH 3;  1K3B C;  2EE1 A;  5K36 H;  2BDO A;  1SE4 A;  3D0F A;  3CF5 A;  2UU9 Q;  3TQY A;  3H0G H;  2R6G A;  4HSP A;  2B63 H;  3IRB A;  1Y1V B;  3HKZ E;  4Y52 H;  4JOI A;  1K8G A;  4KY6 A;  2WB1 G;  2ZXR A;  4UHV A;  1V8Q A;  1QZH A;  1YIT A;  2EXD A;  4A3D B;  3K58 A;  1GUO A;  2ATW A;  1SLJ A;  2B2T A;  1GOZ A;  2KVM A;  2R92 H;  1LTI D;  1IXR A;  1LUZ A;  4DAV A;  1LAB A;  2B2T C;  3RD4 A;  4FDB A;  2F0E A;  3OMC A;  1JMC A;  1G6Z A;  5C0X I;  4GNX A;  1MKH A;  4FXG C;  1ZXT A;  1STN A;  3M4O H;  5DLQ E;  3KYH C;  4JI0 L;  1YNJ D;  5JOB A;  4GNX C;  1C48 A;  1LTB D;  3PMF A;  1XMQ Q;  3EQL C;  2OCE A;  5KNB A;  3S17 B;  1JWS D;  2AWO A;  3SGI A;  1RHP A;  3I4M B;  2R7F A;  1ICF B;  4XQN A;  5IGG A;  5LMU Q;  1ZYR C;  4HED A;  2F0W A;  4IJL A;  4IN3 A;  3D31 A;  5M5W H;  4MTN A;  1PH3 A;  2PQE A;  5K5P A;  4LFB L;  3CC2 A;  2F3I A;  1RIP A;  2ALY B;  2EJM A;  1E2Z A;  1OXX K;  2KEN A;  4LUZ A;  4ABN A;  1GUN A;  4A3J G;  2Y0S G;  5CV4 A;  1EIY B;  5C4X H;  1NR2 A;  5ELO A;  2PO4 A;  4OO1 G;  4A3K B;  4L5R C;  1BCP F;  4HJ5 A;  4K8I A;  1HUM A;  4DK6 C;  1KAW A;  1XXG A;  4DR7 L;  5CMD A;  5ISR A;  1AH9 A;  4DPG A;  2K5N A;  4K0K Q;  4XDX A;  2PCF B;  1G6P A;  2F0D A;  3FEW X;  4IFD H;  4LF8 L;  1VQA A;  4BBR H;  5M5X H;  2CWA A;  1OXT A;  1HTL D;  4GKJ Q;  2L55 A;  5M3F H;  2K5H A;  2PYK A;  2UXB Q;  1CSQ A;  2XVS A;  2J4X A;  2C9O A;  3AU7 A;  1L1O A;  3I73 A;  1FGU A;  2JA8 H;  3KK7 A;  1Q12 A;  5IIF A;  2ZM6 Q;  1CQV A;  1H9S A;  3A8J E;  2QGQ A;  5LMN Q;  2E74 C;  1WJJ A;  1SNO A;  1K8M A;  4Q0F A;  3HOW B;  5ELC A;  2WAQ B;  3BYY B;  4C2M B;  5IGC A;  3S2H B;  3KJP A;  1DYQ A;  3I4L A;  4DUZ L;  3SEB A;  1MI2 A;  3M3Y H;  1LV9 A;  2PI2 E;  4X3S A;  1PZK D;  2BA1 A;  3DM3 A;  1PLF A;  3N6R A;  4PMC A;  3U9S A;  1EY5 A;  3F2D A;  1SFO H;  2F03 A;  3PUW A;  3W1B A;  5M5Y B;  2KCN A;  2XTI A;  2R7Z G;  1Q81 C;  1M1K C;  1V1O A;  2A69 D;  2N88 A;  5C3E G;  1Q8I A;  2ID0 A;  5J1Z A;  2EYH A;  5IY0 A;  1UE7 A;  4BY7 B;  2IHE A;  2HHH L;  1C8C A;  1HJP A;  1KAB A;  1SE8 A;  3G71 A;  3PGZ A;  3TP6 A;  2LY7 A;  4IUT A;  4JI6 Q;  1XNQ L;  1X32 A;  1SYF A;  4A3F H;  2ZJP A;  3S14 H;  4YCV A;  2FJ2 A;  1YNN C;  4DAY A;  2JJQ A;  4IUN A;  4X3K A;  5A2Q L;  1PVO A;  1IKL A;  2EOT A;  2F0U A;  3J81 i;  1DJR D;  5C44 B;  3PQI A;  1STH A;  1CK1 A;  2A6E D;  1CT1 D;  1IYU A;  2JYO A;  2PNH A;  4DFA A;  5CV6 A;  2E2I B;  1HNX L;  4ZUJ A;  4O1N A;  2B2V A;  5FO8 B;  3PUX A;  4KJN A;  3FVQ A;  4RCO A;  2Z6K A;  1FL0 A;  3TRZ A;  4CGY B;  3NUC A;  2B2V C;  1L0X B;  2NTS A;  4QCL A;  2SOB A;  4KKT A;  1I4G A;  2Z6K C;  4JI7 L;  3CCS A;  1F2Z A;  4P72 A;  4JI3 L;  2I5M X;  2K75 A;  5ELD A;  3TP5 A;  2UXD Q;  2A74 C;  4LF9 Q;  4RGM A;  2KJX A;  4QGU A;  5GRO A;  4OWX B;  1QVG A;  3H09 A;  2SNS A;  3GV6 A;  4KD4 A;  4X65 Q;  1EIG A;  2F0M A;  1EQR A;  5IYB G;  5C0X G;  2Q8I B;  3LWE A;  2DN8 A;  1PTO C;  3NTH A;  5CV5 A;  3VYU A;  2EJF C;  2HD3 A;  1Q82 C;  2NUC A;  3Q0A A;  2UUC Q;  1X3Q A;  2MGS A;  3HOU B;  3PO3 B;  3ULP A;  2ZTE A;  4IFD I;  4B3S L;  4KJO A;  1AE3 A;  1EY8 A;  1Y1W B;  5JJL A;  4EQ5 A;  1PDQ A;  4CKB A;  1ET9 A;  5C3W A;  3NBH B;  1CKN B;  4X62 Q;  3I56 A;  2RBM A;  4C3H B;  4NPS A;  3MA2 B;  3RMH A;  1ZYR D;  3E0J A;  3M4P A;  2EYL A;  2NVT B;  5KEE A;  2CVR A;  3G4S A;  2V1C C;  5G3L F;  4IOA A;  4LMQ D;  4A3M H;  3C3L A;  3TEH B;  2X6G A;  4DV5 Q;  1S72 A;  4JBJ A;  1VQI A;  4LWC A;  2K32 A;  2FXQ A;  4DR1 L;  1Z6H A;  1XMQ L;  1XTD A;  3DEP A;  3MWY W;  4GLA C;  3U4Z A;  4XT1 B;  3J80 c;  3GTL H;  3TS2 A;  1MBY A;  2E5L L;  4JI5 L;  3MFG A;  3FKI H;  4B3R Q;  3T16 A;  5D65 A;  1D2B A;  2XSC A;  5LMU L;  3T53 B;  2BCO A;  1PRT F;  1T5X D;  2FMM A;  4CKE A;  2A1A A;  2VW9 A;  2K05 A;  4LFA Q;  1HHV A;  2J0T D;  3TSS A;  3VR2 A;  3PIP A;  2TSS A;  4DA2 A;  3RZD B;  4RHR A;  1W6K A;  4IPG A;  2WKD A;  1FVI A;  2RHS B;  4EVO A;  3GTK B;  3SVM A;  2F0K A;  1ASY A;  2K01 A;  2VS1 A;  1HA6 A;  1Z7T A;  4GN3 B;  1S5E D;  3NHH A;  4B9W A;  1LO5 D;  3CCQ A;  3G6J B;  1S5F D;  1BO0 A;  3NQI A;  3TRE A;  1K3R A;  2OTL A;  3HOV B;  2IY5 B;  2MHV A;  2QKI C;  3T4A C;  5JPM C;  1YJW A;  1EWH A;  1Q7Y C;  4A3L H;  1UE1 A;  1A2T A;  2F0J A;  1EIH A;  3E0E A;  2RF4 A;  2WIN B;  2I46 A;  4HIO A;  3CKI B;  3K7A H;  4GKJ L;  2LFN A;  5T1I A;  4DV1 Q;  1HZA A;  3HOW H;  1NAP A;  2OQK A;  2L11 A;  5K36 G;  3BZC A;  4OIJ A;  3S2H H;  2A73 B;  3H0G G;  2UXC L;  1JOR A;  4IPH A;  2ZM6 L;  2CWP A;  2KEE A;  2B63 G;  2GN5 A;  1VQP A;  1KAA A;  3MXN A;  3MXP A;  5LMN L;  1IW7 C;  3S1R H;  1AP0 A;  4P73 A;  4KHZ A;  2R92 G;  3A8K E;  1AW7 A;  1UEA B;  4IJH A;  4JI1 Q;  4XT3 B;  1FYC A;  2BDN A;  1ESF A;  1EY9 A;  3CCJ A;  4YIJ A;  1JOO A;  1SYB A;  1SJE D;  1NCV A;  2Q8T A;  5KYI A;  1YNN D;  1FGB D;  1VCI A;  1MJE A;  1LAC A;  4K2L A;  4LK1 C;  2ENB A;  4FO2 A;  2SDF A;  1HNZ Q;  3ONA B;  2HUG A;  1CA5 A;  1EU3 A;  2R93 B;  1G51 A;  2YTY A;  5C44 H;  1H9R A;  1HQM C;  4LF5 Q;  4RWS C;  2IWH A;  4LF6 Q;  1N36 Q;  3S15 H;  3F8T A;  2AKW B;  1EZ6 A;  1K83 H;  3DXJ C;  3P20 A;  5GAG C;  3OSO A;  4FXD A;  3TP8 A;  3GTJ H;  3ERS X;  1KLU D;  1O78 A;  1QIL A;  1QNK A;  2BA0 A;  5C4J B;  1D5X C;  2AUJ D;  2F1M A;  5C4X G;  4OGQ C;  4OXP A;  5GAE C;  5EKL A;  3C46 A;  3CD6 A;  2ICI A;  4KY5 A;  2AQ1 B;  4WJ4 A;  2PMZ B;  1YJN A;  2M00 A;  1PTO D;  1MIU A;  5EPL A;  4P71 A;  4FP5 D;  1DGS A;  1Q1E A;  1QJO A;  4IFD G;  1T5E A;  2A5H A;  3D8G A;  3F2U A;  4GOP C;  1F2Y A;  5EBD A;  4BBR G;  3GTM B;  4EQP A;  2MP1 A;  3W2D A;  3MC0 B;  4DK0 A;  5M3F G;  2CW0 C;  4JI0 Q;  2EDG A;  5JVG 3;  5EKI A;  4HJ8 A;  3KUP A;  4LF9 L;  1I50 H;  1BBU A;  1R4Q B;  1SYC A;  2K6A A;  3OIQ A;  2JA8 G;  4R8I A;  4L5S A;  1DM0 B;  3PO3 H;  1HUN A;  4YWM A;  4X65 L;  3KLW A;  5ELN A;  3DWQ A;  5IYC H;  1QVC A;  1Y1W H;  4JI8 Q;  4QMG A;  1TS5 A;  2CKZ B;  4J6H A;  4KHP L;  5JJI A;  3S24 A;  3UDF A;  3NEN A;  4A3E B;  4C3H H;  4DV6 L;  1JJC B;  1A3T A;  1X56 A;  4NKL A;  2FIN B;  2NVY H;  2PZW A;  3NP8 A;  1VQJ A;  2PI2 A;  4F8M A;  1GXD C;  1SBB B;  3DHQ A;  3FRP B;  4BY1 H;  2B2W A;  4ZQ3 A;  1BKB A;  3A7A B;  2F0S A;  1FR3 A;  1ENF A;  1EY6 A;  2Z4I A;  3HFZ B;  2B2W C;  3TZU A;  3A0J A;  2A6H C;  1GHK A;  4AQY Q;  3K7U C;  3AMU A;  3VYR A;  2JA5 B;  5CBE E;  4HR7 B;  1LT3 D;  2L5T A;  4HJ7 A;  1HFG A;  3IFD A;  1T9H A;  1BUV T;  2B29 A;  3BJU A;  1VS0 A;  4DV5 L;  4C1N K;  5D14 A;  3QJY A;  1HFN A;  3IFT A;  4PMB A;  4A3F G;  1SYG A;  2XNA C;  3RZD H;  2JA6 H;  2YYZ A;  4X3T A;  3PUV A;  4OO1 I;  4B3R L;  1XX8 A;  1EYA A;  1H9M A;  1E22 A;  1I4X A;  2PZU A;  1RDP D;  4ZUI A;  5C5M A;  4XXE A;  1PZI D;  5M3M B;  4IZ8 A;  4DUZ Q;  2LXK A;  4NW2 A;  1W3S A;  1JWM D;  1TWA H;  3M85 A;  5C6A A;  4BS9 A;  2IJ0 A;  2RDH A;  3K59 A;  3A55 A;  3M7G A;  3LNN A;  4FF3 A;  2HQL A;  5T1G A;  1B70 B;  4RHS A;  2NZO A;  2K03 A;  5FKA C;  3F2C A;  2Q2H A;  2F4V Q;  4ID6 A;  1O7L A;  2ZTC A;  4NMZ A;  3D6C A;  3JAM E;  4M1U B;  2L0C A;  1PA6 A;  3SXH A;  1HR0 Q;  3R2I A;  3ERQ A;  5LHY 1;  1IW7 D;  2O2L D;  3J80 i;  1Y69 U;  4GN4 B;  4A4I A;  2NVX B;  2JA9 A;  1VQG A;  2NBF A;  1L1O B;  5I6Y A;  1VMC A;  2L4N A;  1CI3 M;  3QOL A;  4RAU C;  1XNQ Q;  4UY8 C;  4C1N I;  3VYT A;  3AQQ A;  3OW2 A;  1Q90 A;  1H9S B;  3VR3 A;  2MQH A;  3W3A A;  1JIC A;  1UUP A;  4DK3 C;  3HP3 A;  2SNM A;  2KHS A;  1JJ2 A;  3PO2 B;  1I94 Q;  3I4N H;  3M9B A;  1HTP A;  2E2J B;  1BCP C;  4RGT A;  4YHH L;  4JG2 A;  3SK4 A;  1HNX Q;  4N8F A;  1UE5 A;  1K0S A;  3MEH A;  2WB1 E;  1STY A;  1P8L A;  4F87 A;  1GKH A;  1GO3 E;  3FP9 A;  3WOF A;  1BF4 A;  3TZD A;  4R4Q A;  4JBM A;  2JA7 B;  4ODG A;  2Z6B A;  2B2Y A;  4A3M G;  1I6H B;  2MFI A;  3GDE A;  4ZCK A;  3MTS A;  5GAD C;  2F0N A;  1LLR D;  3K57 A;  1BR9 A;  1YEZ A;  2HCI A;  4UP8 A;  3GTP H;  3SK6 A;  5C4J H;  4F7X A;  3FKI G;  1TWH H;  3STB C;  3UDG A;  3GTQ H;  3FPU B;  2KCM A;  4ME5 A;  3URY A;  4LF5 L;  1DON A;  4HIK A;  5C3X A;  4OWW B;  4LF6 L;  1GM5 A;  1N36 L;  2JN4 A;  2KCC A;  1A8V A;  4DR2 L;  4XTC S;  3S1Q B;  2QW7 A;  2I5L X;  4HSV A;  2CW0 D;  1VQ4 A;  1ESR A;  4R4C A;  4TVA B;  4B3S Q;  2E2H H;  1SJH D;  3M7N A;  3KBX A;  4B3M L;  1UAP A;  3MAQ A;  1EQV A;  1SNQ A;  1I3Q B;  2JK8 A;  2Y0S E;  1VQ8 A;  2LMC B;  3BVG A;  3OMG A;  3QB3 A;  2PPB C;  4NXN Q;  4A3G H;  4PZ6 A;  2WKC A;  3N52 A;  4A3L G;  1TII D;  2WV6 D;  1F9S A;  2YV5 A;  3OOC A;  2GVB A;  5FK9 C;  4PQX A;  1YHA A;  2F0V A;  3BVM A;  2KOL A;  3UE1 A;  1D7Q A;  1E1T A;  4J1M A;  4DR1 Q;  3S1M H;  1B44 D;  3HOW G;  1EWI A;  2ZT9 C;  2Z8L A;  2WAQ G;  2E5L Q;  1VQ6 A;  4JV5 Q;  4JI5 Q;  4P2C B;  5E4W C;  2A6H D;  4UDU C;  1JT8 A;  4JI8 L;  4K5X A;  4QF4 A;  5EPJ A;  1BOS A;  1PYB A;  1STB A;  3HZX A;  1Q8K A;  1KDB A;  1X54 A;  3CRK C;  3TP7 A;  2KBN A;  2DGY A;  1DXM A;  1SE3 A;  2RSO A;  2Q8R E;  1EFI D;  2L1B A;  4O42 A;  2MO1 A;  3RLF A;  3CC4 A;  4MZ9 A;  3MXU A;  4U67 3;  3D4D A;  4AQY L;  4DF7 A;  1PZJ D;  3JC6 6;  1FNV A;  1XNR Q;  3WDN A;  4A93 B;  4BA2 I;  1NBW A;  4RMF A;  4IO9 A;  4H02 A;  1NUC A;  5C44 G;  3K5M A;  1U4M A;  2HIX A;  3A54 A;  3R3O A;  1N32 Q;  2EZV A;  4RCN A;  2UXC Q;  2KHJ A;  3GQB A;  1AZP A;  2VUM H;  4IQZ A;  1YNX A;  3PV0 A;  1Y8O B;  1H9K A;  1G2T A;  4I7A A;  3J7A V;  1PH5 A;  3H6M A;  4A3I B;  1CHP D;  5KGU A;  1VQ9 A;  2CH4 A;  2VY3 A;  3V96 A;  4DR6 L;  4ZYS A;  2UUB L;  4ILW A;  2BOS A;  1TY0 A;  4RFB A;  1PH6 A;  4X3U A;  3W1G A;  2NVX H;  4QL5 A;  1MGS A;  5I4D A;  4J8Q A;  4Y7N H;  3S1N B;  1V1Q A;  1UE6 A;  4X6A H;  4QIW B;  1KL9 A;  2JEB I;  3EIV A;  4OX9 Q;  2F4V L;  3EA6 A;  1BCP D;  1VDZ A;  3PO3 G;  1HR0 L;  4Q5V A;  1GUS A;  4G7O C;  1FD7 D;  1ML0 D;  2NYZ D;  2HDL A;  5IYC G;  2DNE A;  1KRS A;  5IGF A;  1Y1W G;  1JB3 A;  2G9D A;  3J7Z C;  4APV A;  1EYG A;  2ES2 A;  1J9O A;  2NVQ B;  1EL0 A;  2D9U A;  1PRT C;  4PV1 C;  4C3H G;  2N49 A;  3HKZ B;  3AFP A;  4DR5 Q;  3JAM L;  1IBM L;  4A3J B;  2DJG C;  1SE2 A;  1SR3 A;  1QZG A;  1IBL L;  3BS1 A;  4BY1 G;  5E7N A;  1JOQ A;  1BBW A;  2C5C A;  3KF6 A;  1I94 L;  4ZAI A;  2YTX A;  3H15 A;  1VQB A;  4FXK C;  1J5E L;  4K6L A;  5KRU A;  5IWA Q;  4CJ0 B;  1EY7 A;  1RCV D;  3G6E A;  2E75 C;  2F4I A;  3STB D;  3E9I A;  4I65 A;  1EFW A;  1SYD A;  1JCK B;  2BE5 C;  4KN7 C;  1WCM H;  2ICE C;  3ND8 A;  3GO5 A;  3NEL A;  3QO2 A;  4TSS A;  1N8R C;  1XYI A;  1BXT A;  3C1E A;  3H94 A;  2N55 A;  4YCW A;  1P16 A;  2L9H A;  5J22 A;  3S1Q H;  1SMX A;  3VR6 A;  1TKW B;  1HZC A;  5DEH A;  2JA6 G;  3NK9 A;  1NMF A;  1Y1V H;  4NDX A;  3TME A;  2A19 A;  3D4W A;  1L0Y B;  1LTS D;  1I3Q H;  4A3D H;  4KHP Q;  3DWP A;  2D2C C;  2L15 A;  3S2D B;  1ZEQ X;  4R4T A;  4DV6 Q;  1JE5 A;  3DMU A;  3C2P A;  5JJZ A;  2VQE L;  2EYO A;  3ZJY C;  3BVZ A;  1CSP A;  4B3T L;  4GZY C;  5IP7 H;  3M4Q A;  1LT5 D;  3L9A X;  4N9P A;  3EBE A;  1YBY A;  1QWY A;  1O7Y A;  4C3I B;  1JC7 A;  4FNF A;  2R7Z B;  4NXN L;  2HIV A;  3TS0 A;  4UP7 A;  3S17 H;  1PFM A;  5A35 A;  4CJ2 C;  1FJG Q;  1H95 A;  3EN2 A;  3T1H Q;  1M8A A;  1TU2 B;  1G2S A;  2GVA A;  1L2F A;  4WFN 3;  3RNU A;  3AEV A;  3I4M H;  2IX3 A;  4K8J A;  3TBI B;  5BN3 A;  1JOK A;  5EGT A;  1EY4 A;  1H9J A;  1V1P A;  1QG7 A;  5IT9 E;  1B2T A;  2OXP A;  2O5J C;  2GA4 B;  3PIP 3;  3TDQ A;  2NN6 H;  4HMJ A;  4KN4 C;  4JV5 L;  1EQT A;  1LTA D;  3BYT B;  3K8A A;  5HGQ A;  3VA7 A;  3CCL A;  2EY2 A;  4A3K H;  3V05 A;  1CQF A;  2EXZ A;  5GAH C;  4DR3 Q;  4LF7 Q;  3I4N G;  1N33 L;  3MVV A;  4ULL A;  5LL6 X;  1EYD A;  4H0L C;  2UUA L;  1OTC A;  4L8J A;  3Q6S A;  3SE0 A;  4H44 C;  4POG A;  4A93 H;  1EWC A;  4H7B A;  1X6O A;  2IT1 A;  3CHB D;  3X3N A;  2QEX A;  4JCV E;  1SNM A;  3SHL A;  2AWN A;  2YTV A;  4LFC L;  5D3D A;  2B39 A;  4AYB E;  1HCZ A;  5BR8 L;  4DV0 L;  3I55 A;  2ASB A;  1Q46 A;  1XNR L;  5C4H A;  3CAM A;  1V9P A;  4LUV A;  3QWN A;  4HID A;  4ZKC B;  1OXV A;  2MPM A;  1TWC B;  5FO9 B;  1U4P A;  2G5D A;  3I91 A;  4A3I H;  1N32 L;  3CCE A;  4C2M H;  1TXY A;  2WP8 J;  5FJ8 H;  1I4Q A;  4CDF C;  2PW7 A;  5G3L D;  2RA4 A;  4E6I A;  1R9T B;  1C9O A;  1S40 A;  4YHH Q;  4DXF A;  2HDM A;  3F2B A;  5M5Y H;  5AJ3 L;  1S4Z A;  1TWF B;  3C1F A;  2RVL A;  4A3G G;  4FF4 A;  3CP0 A;  2EYJ A;  4BY7 H;  3DM1 A;  4YWK A;  2X69 A;  2MJ8 A;  3HOZ B;  1PRT D;  1KNA A;  2Z4H A;  4IPD A;  1N9W A;  2VB3 X;  4AYB G;  4RKL A;  1SRU A;  2CQA A;  4JC0 A;  1DOK A;  3CMA A;  4FF2 A;  4UPA A;  1GHJ A;  2DUD A;  1X3P A;  3GD7 A;  4OX9 L;  3BDC A;  4BXX H;  1JWU D;  4DNR B;  5FLM H;  3RZO B;  3S16 B;  1AEX A;  3UDI A;  3DUZ A;  1PYS B;  1PH1 A;  2QA4 A;  2QF7 A;  1QUQ A;  3A8I E;  5HUR A;  1LTT D;  1SYE A;  3IAY A;  4DR2 Q;  4S3S A;  4BWG B;  2E2I H;  1QCB D;  3KFU A;  4GKK Q;  1XPR A;  4FVM A;  3IL8 A;  3HRZ C;  1WTX A;  4JVZ A;  4DR5 L;  1WTR A;  2X6L A;  4B3M Q;  1B9N A;  1RKN A;  2K7V A;  1WTW A;  3D3R A;  1EEF D;  2MO0 A;  1ET6 A;  2R3Z A;  1KHI A;  5I9O A;  4GOP A;  2B2U C;  2IX1 A;  5IWA L;  1CZW A;  2NN6 I;  4H13 C;  2PQA B;  1Q3L A;  4X64 Q;  4C56 C;  1NMG A;  1HQR D;  3U4V A;  4WRD A;  2D62 A;  4RGO S;  1W2B A;  1UWV A;  3QR8 A;  2NWG A;  3CQZ B;  2K4K A;  4K5V A;  4DGZ A;  3S2D H;  2VXW A;  1SNP A;  1O7Z A;  3P75 A;  2R7D A;  4X66 Q;  3HOU H;  3BDL A;  3NBH A;  1A3V A;  1NSN S;  3CW2 C;  2VUM G;  1WTO A;  2MUY A;  1STG A;  4YY3 L;  1JQY D;  1SXT A;  2B63 B;  4L5Q A;  3CCM A;  2EIF A;  3PUZ A;  1MJC A;  1CKM A;  3J81 E;  1FNU A;  4QB4 A;  4C3I H;  2EVB A;  2V4D A;  1E24 A;  1WTH A;  4DV7 Q;  1KTK A;  3PSI A;  2NVT H;  4CBV A;  4XQQ A;  1LYL A;  4GN5 A;  1TWG B;  2QEJ C;  3BG3 A;  4R8N A;  3W5O A;  2F0P A;  1E0B A;  2DJF C;  3K80 C;  2CHB D;  2ZXP A;  3NPP A;  1PMR A;  5J39 A;  2A8V A;  3K5O A;  3J7A F;  2XGT A;  2BH8 A;  1VQE A;  2RHQ B;  3NTI A;  1WI5 A;  4JYA L;  1UNS A;  3M4Y A;  2F0F A;  1HPC A;  3AYH B;  4GNX B;  5EPK A;  2G9H D;  1FJG L;  4OEL B;  4OEM B;  4DK1 A;  3T1H L;  1YHQ A;  1S5C D;  3E5S A;  1B8A A;  1LTG D;  3PUY A;  3HKS A;  1WD1 A;  5COY A;  5I6W A;  3RR5 A;  3H3V C;  3OWE B;  4YWL A;  3MFY A;  3H3V H;  3ITP A;  1ENC A;  4CKC A;  5ELF A;  2F0L A;  4Z9C B;  3CU7 A;  1XMO Q;  3GTK H;  2PW5 A;  5IYD H;  5C4X B;  4IUQ A;  2F0H A;  4B9X A;  2VL6 A;  2JA7 G;  1E7Z A;  1PFN A;  4LUO A;  4DR3 L;  4LF7 L;  4HTH A;  5IT9 L;  3HOV H;  1PYW D;  5JEA J;  4DR6 Q;  4JI2 Q;  2UUB Q;  1YHB A;  2N78 A;  3OPO A;  3SR1 A;  5ELB A;  1WCM G;  4JBW A;  3CCR A;  2Z9H A;  3SK8 A;  3OHX C;  4BBR B;  5M5X B;  4TRD A;  2LXJ A;  3V2T A;  1TWC H;  5M3F B;  2VNU D;  3CPW A;  1X9N A;  1SRO A;  2NZH A;  3G7L A;  4K14 A;  1OXS C;  2FHT A;  1QB5 D;  1VF7 A;  3KBG A;  4PZ8 A;  2JA8 B;  3S9W A;  3KF8 A;  1EQQ A;  1Q1B A;  1IYV A;  5CBA E;  1Y1V G;  4DV2 Q;  1R9T H;  1TY2 A;  2OQ0 A;  4KV6 A;  2RDG A;  5C5L A;  1M90 C;  3KLR A;  3QG1 A;  3MEF A;  4A3D G;  3OW7 A;  2WFW A;  4LF4 Q;  4A3B B;  2O5I C;  1PH7 A;  2E76 C;  2O4X A;  4XIG S;  1XPO A;  3MZ5 A;  3HOY B;  1DCZ A;  1IBM Q;  1EU4 A;  1IBL Q;  2EYM A;  3HOZ H;  4A75 A;  3QIA A;  5IP7 G; 
#chains in the Genus database with same CATH homology
 1LTR D;  1SFO B;  1B1Z A;  2AQ3 B;  2EY5 A;  4G4K A;  4KY7 A;  4BBS B;  2E2D C;  4MN3 A;  1I4H A;  2H4O A;  4DU9 A;  3GTG B;  5FLX E;  1LT4 D;  1NR4 A;  4FF1 A;  1CA6 A;  2NN6 G;  4A3F B;  3S14 B;  4KMU C;  4OIK A;  3GTO B;  5IGE A;  5EJW A;  4DAP A;  1TR5 A;  1O80 A;  1QE6 A;  5DM7 3;  1CHQ D;  2NTT A;  2XWJ B;  3KLS A;  1A6X A;  5FO7 B;  5D3I B;  5KYL A;  1Y8P B;  1I4R A;  2D5D A;  2JXM B;  3I90 A;  3NE5 B;  4EQO A;  4IUP A;  4K2K A;  2ZXO A;  2RQX A;  3NXW A;  5M9O A;  2EYF A;  3A56 A;  1ENA A;  4G57 A;  5EQ0 A;  1PXU A;  3CRL C;  4G7H C;  3K6O A;  1JR0 D;  2EPB A;  5E4X A;  2K5D A;  2KQ3 A;  3L3O C;  1WD0 A;  1PTO B;  3I70 A;  1DOM A;  2B8G A;  4OL7 A;  2L12 A;  2B8F A;  1RTN A;  1AN8 A;  1QOH A;  1AFP A;  4LAA A;  3HG9 A;  5JPN C;  1BQQ T;  5DNF A;  1CM9 A;  4BA1 I;  1G8Z D;  4C3J B;  2OF1 A;  2EY6 A;  3J7Y W;  2WAC A;  4A3M B;  5C4Z A;  3J81 L;  5CGK A;  3PIO 3;  2VB2 X;  3HOX B;  2A68 C;  3KLS X;  3QOJ A;  3VR4 A;  3GTL B;  1STE A;  1V1P B;  4DNT B;  3FKI B;  4KI0 A;  5E1F A;  2F3V A;  1II3 A;  1J8I A;  3K0Y A;  2SEB D;  2HCC A;  3T13 A;  1KNE A;  1IKM A;  3RUZ A;  2EYP A;  1EYC A;  2IPK D;  3LX0 A;  4ZRZ A;  5BN4 A;  2WB1 B;  4L6T B;  4KD3 A;  4M8A A;  1MD2 D;  1B4O A;  5E3F A;  3K7A B;  2FMC A;  4RH6 A;  2RSN A;  3A7L A;  1ZKO A;  5CV7 A;  4C3I G;  5C0X J;  3S1R B;  1R4P B;  1XTC D;  3BZD B;  2H1E A;  2Y0S B;  1XWE A;  2K5Q A;  1SSO A;  1EZ8 A;  5NUC A;  1F2M A;  3DWA A;  1STA A;  1SAP A;  1EY0 A;  1A3U A;  2JSO A;  5KIX A;  1F9P A;  4K5W A;  1KDC A;  2K04 A;  1VF5 C;  3FMC A;  2J7Z A;  2QCP X;  2PNR C;  3J80 E;  1AZQ A;  3S15 B;  2RDF A;  1K83 B;  3MXG A;  3P7J A;  1E2W A;  3GTJ B;  2F0O A;  1TT2 A;  3FDT A;  4I7Z C;  5ELE A;  4DN4 M;  5FLX L;  4XYO A;  1GUT A;  4B08 A;  1D5M C;  2F0G A;  1SMY C;  2EJG C;  1OXU A;  4KKU A;  4K6D A;  4TKO B;  2XN9 C;  2F0T A;  1PTO H;  1EOT A;  1TS4 A;  1I50 B;  5I9P A;  4IUR A;  5C3E B;  5JEA H;  4JK1 C;  1ILP A;  1BNZ A;  1C4Q A;  4RKB A;  1BDO A;  2DY7 A;  2F0I A;  5CYU A;  2NVY B;  1SND A;  3VA5 A;  1WTV A;  1DZ1 A;  4V0B A;  3U9O A;  1M4V A;  4BY1 B;  2A68 D;  1HA5 A;  3Q23 A;  2JP1 A;  4ZK9 B;  1WVL A;  3ERO A;  3OIP A;  1TVX A;  1MSG A;  5IGB A;  3SDZ A;  4CHT B;  1TQO A;  1A2U A;  4DXG A;  1DOL A;  1SNC A;  3AB9 A;  1VMP A;  1ONL A;  3T56 B;  3Q24 A;  3R2T A;  2JA6 B;  1BBX C;  3NBI A;  1U9R A;  2OT2 A;  5FOB B;  5COR A;  1Y8N B;  4LJZ C;  3IKJ A;  2K1B A;  4HCS A;  3FPP A;  1RD9 D;  4ZLT F;  4TQU S;  3WOE A;  1TWA B;  4EQN A;  3D6W A;  1G91 A;  3EJI A;  1PTO F;  1CTM A;  2F0Q A;  1RJT A;  2R61 A;  4IFD J;  3LWU A;  3R93 A;  4U68 A;  2KA7 A;  2OEO A;  2JEA I;  4IAL A;  4OO1 H;  2XWB B;  1WTQ A;  1IL8 A;  1GUW A;  1F9R A;  1HRJ A;  2LKV A;  3I4N B;  2NZ1 D;  1RF2 D;  2BE5 D;  2YU9 B;  1BCP B;  1QNU A;  1I6V C;  3X3M A;  3K5L A;  2B2U A;  5IOD A;  3GV3 A;  1Z47 A;  2LS0 1;  1LT6 D;  2IX0 A;  1B3A A;  2RKS A;  3EFX D;  1F9Q A;  3VYS A;  3GTP B;  2DY8 A;  4KKS A;  1MSH A;  1RTO A;  4HN7 A;  1TWH B;  4PMW A;  3GTQ B;  2DNC A;  3Q22 A;  1B50 A;  5DM6 3;  1SMY D;  2KEC A;  1SDF A;  3H0G B;  4CJ1 B;  1S5B D;  2IL8 A;  2E2H B;  1B53 A;  5IOC A;  4KHV A;  3J80 L;  1TS3 A;  5IGD A;  1HXY D;  1PFB A;  2R92 B;  4A3G B;  1G29 1;  3TN2 A;  4HMI A;  4HCE A;  1S5D D;  4R9W A;  5TSS A;  4WJW A;  4MIU A;  4AYB B;  3M4O B;  3T51 B;  1FNW A;  5CR3 A;  1I4P A;  3S1M B;  2QIL A;  1YNJ C;  5HGT A;  3I72 A;  3HS0 C;  3R8B A;  3O13 A;  2EY1 A;  2F3W A;  3P1H A;  3D4R A;  1V43 A;  3HGB A;  5M5W B;  4KK7 A;  4V19 0;  3VR5 A;  4FYD A;  3I8Z A;  1OO9 B;  2Z1C A;  1IHZ A;  4OHJ A;  3HEJ A;  2AUK A;  3K5N A;  3SK5 A;  3OWF A;  4HAE A;  4QUF A;  3NSW A;  5LL6 S;  4WOR A;  5EBC A;  1GUG A;  4IUU A;  1U4L A;  3EVQ A;  1E2V A;  1D6E C;  3ND9 A;  5CV8 A;  4ZKB B;  3L7Z C;  5C0X H;  2JE6 I;  1D1I A;  1U4R A;  5CV9 A;  5KND A;  1GJX A;  3GP7 A;  4KTA A;  5AFW A;  3UI2 A;  2K5W A;  2XRQ D;  1TS2 A;  3NTK A;  2VUM B;  1CZG A;  1CFM A;  3BDO A;  2NB0 A;  4F88 A;  5DAU A;  5CC4 A;  3ZYY X;  2KUM A;  5A2Q E;  4L63 B;  3M3Y B;  4PNY A;  2XRS D;  1B9M A;  1D5Z C;  5BN5 A;  4Y7N B;  4RGN A;  3NQT A;  4EGV A;  2M9V A;  5I2X A;  3MHB A;  2M2L A;  2FFK B;  5JAV A;  1SEB D;  2PZT A;  2AQ2 B;  4XQJ A;  2K28 A;  2TMP A;  2WII B;  1EEI D;  1WTP A;  3NWT A;  3H91 A;  2A69 C;  2IW3 A;  4MHE A;  1F2L A;  4RA8 A;  5JEA G;  2QDB A;  1ILQ A;  1ROD A;  1JE4 A;  1D1K A;  4IUV A;  5KNC A;  2K33 A;  1DD2 A;  1PRT B;  3NWS A;  4C3J G;  4XYQ A;  4NP5 A;  1A15 A;  4QUC A;  4N9T A;  5EKK A;  1KLG D;  2XIW A;  1W6J A;  4G7Z C;  3E6Z X;  1KDA A;  3DEO A;  1F77 A;  2KED A;  2B2Y C;  2A6E C;  2I07 B;  1K8O A;  5F2D A;  1WCM B;  5I2Y A;  1ICW A;  4UAI A;  2HQE A;  3I3C A;  5JVH 3;  2EE1 A;  5K36 H;  2BDO A;  1SE4 A;  2R6G A;  4HSP A;  1Y1V B;  4KY6 A;  2ZXR A;  1V8Q A;  4A3D B;  3K58 A;  1GUO A;  2B2T A;  1GOZ A;  2KVM A;  1LTI D;  4DAV A;  1LAB A;  2B2T C;  3RD4 A;  2F0E A;  3OMC A;  5C0X I;  4FXG C;  1ZXT A;  1STN A;  1YNJ D;  5JOB A;  1C48 A;  1LTB D;  3PMF A;  3EQL C;  5KNB A;  3S17 B;  1JWS D;  2AWO A;  1RHP A;  3I4M B;  4XQN A;  5IGG A;  1ZYR C;  4HED A;  2F0W A;  4IN3 A;  3D31 A;  2PQE A;  5K5P A;  2EJM A;  1E2Z A;  1OXX K;  4ABN A;  1GUN A;  5CV4 A;  1NR2 A;  2PO4 A;  4OO1 G;  4A3K B;  1BCP F;  4K8I A;  1HUM A;  1XXG A;  5CMD A;  5ISR A;  4XDX A;  2PCF B;  2F0D A;  3FEW X;  4IFD H;  1OXT A;  1HTL D;  2L55 A;  2PYK A;  2XVS A;  2J4X A;  2C9O A;  3AU7 A;  3I73 A;  3KK7 A;  1Q12 A;  5IIF A;  1CQV A;  1H9S A;  3A8J E;  2E74 C;  1SNO A;  1K8M A;  4Q0F A;  3HOW B;  5ELC A;  2WAQ B;  3BYY B;  4C2M B;  5IGC A;  3S2H B;  1DYQ A;  3I4L A;  3SEB A;  1MI2 A;  1LV9 A;  4X3S A;  1PZK D;  2BA1 A;  1PLF A;  3N6R A;  4PMC A;  3U9S A;  1EY5 A;  2F03 A;  3PUW A;  5M5Y B;  2KCN A;  1V1O A;  2A69 D;  2N88 A;  1Q8I A;  2ID0 A;  5J1Z A;  2EYH A;  4BY7 B;  1C8C A;  1KAB A;  3TP6 A;  2LY7 A;  4IUT A;  1X32 A;  1SYF A;  2FJ2 A;  1YNN C;  4DAY A;  4IUN A;  4X3K A;  5A2Q L;  1IKL A;  2EOT A;  2F0U A;  1DJR D;  5C44 B;  1STH A;  1CK1 A;  2A6E D;  1CT1 D;  1IYU A;  2JYO A;  4DFA A;  5CV6 A;  2E2I B;  4ZUJ A;  4O1N A;  2B2V A;  5FO8 B;  3PUX A;  4KJN A;  3FVQ A;  4RCO A;  4CGY B;  3NUC A;  2B2V C;  1L0X B;  2NTS A;  4QCL A;  2SOB A;  4KKT A;  1I4G A;  1F2Z A;  5ELD A;  3TP5 A;  2A74 C;  4RGM A;  2KJX A;  3H09 A;  2SNS A;  3GV6 A;  4KD4 A;  1EIG A;  2F0M A;  5C0X G;  2Q8I B;  3LWE A;  2DN8 A;  1PTO C;  3NTH A;  5CV5 A;  3VYU A;  2EJF C;  2NUC A;  3Q0A A;  1X3Q A;  2MGS A;  3HOU B;  3PO3 B;  4IFD I;  4KJO A;  1EY8 A;  1Y1W B;  1PDQ A;  4CKB A;  1ET9 A;  5C3W A;  2RBM A;  4C3H B;  3MA2 B;  3RMH A;  1ZYR D;  3E0J A;  2EYL A;  2NVT B;  5KEE A;  2CVR A;  5G3L F;  4LMQ D;  3C3L A;  2X6G A;  2K32 A;  1Z6H A;  1G6Z A;  3DEP A;  3MWY W;  4XT1 B;  1MBY A;  3MFG A;  3T16 A;  5D65 A;  1D2B A;  2XSC A;  3T53 B;  2BCO A;  1PRT F;  1T5X D;  2FMM A;  4CKE A;  2K05 A;  1HHV A;  2J0T D;  3TSS A;  3VR2 A;  2TSS A;  4DA2 A;  3RZD B;  4RHR A;  1W6K A;  2WKD A;  4EVO A;  3GTK B;  3SVM A;  2F0K A;  2K01 A;  1HA6 A;  1Z7T A;  3NHH A;  1S5E D;  4B9W A;  1LO5 D;  3G6J B;  1S5F D;  1BO0 A;  3NQI A;  3HOV B;  2MHV A;  2QKI C;  3T4A C;  5JPM C;  1EWH A;  2F0J A;  1A2T A;  1EIH A;  2WIN B;  2I46 A;  3CKI B;  2LFN A;  5T1I A;  1NAP A;  2L11 A;  5K36 G;  4OIJ A;  2A73 B;  1JOR A;  2KEE A;  1KAA A;  3MXN A;  3MXP A;  1IW7 C;  1AP0 A;  4KHZ A;  3A8K E;  1AW7 A;  1UEA B;  4XT3 B;  1FYC A;  2BDN A;  1ESF A;  1EY9 A;  4YIJ A;  1JOO A;  1SYB A;  1SJE D;  1NCV A;  2Q8T A;  5KYI A;  1YNN D;  1FGB D;  1VCI A;  1LAC A;  4K2L A;  4LK1 C;  2ENB A;  4FO2 A;  2SDF A;  3ONA B;  2HUG A;  1CA5 A;  1EU3 A;  2R93 B;  1H9R A;  1HQM C;  4RWS C;  2IWH A;  1EZ6 A;  3P20 A;  3DXJ C;  3OSO A;  4FXD A;  3TP8 A;  1KLU D;  1O78 A;  1QIL A;  1QNK A;  2BA0 A;  5C4J B;  1D5X C;  2AUJ D;  2F1M A;  4OGQ C;  5EKL A;  3C46 A;  2ICI A;  4KY5 A;  2AQ1 B;  2PMZ B;  2M00 A;  1PTO D;  5EPL A;  4FP5 D;  1Q1E A;  1QJO A;  4IFD G;  1T5E A;  2A5H A;  3D8G A;  3F2U A;  1F2Y A;  5EBD A;  3GTM B;  4EQP A;  2MP1 A;  3W2D A;  3MC0 B;  4DK0 A;  2CW0 C;  2EDG A;  5JVG 3;  5EKI A;  3KUP A;  1R4Q B;  2K6A A;  1SYC A;  3OIQ A;  4R8I A;  1DM0 B;  1HUN A;  3DWQ A;  4QMG A;  1TS5 A;  4J6H A;  4A3E B;  1A3T A;  4NKL A;  2FIN B;  2PZW A;  3NP8 A;  4F8M A;  1GXD C;  1SBB B;  3DHQ A;  3FRP B;  2B2W A;  4ZQ3 A;  3A7A B;  2F0S A;  1FR3 A;  1ENF A;  1EY6 A;  2Z4I A;  2B2W C;  3TZU A;  2A6H C;  1GHK A;  3AMU A;  3VYR A;  2JA5 B;  5CBE E;  4HR7 B;  1LT3 D;  2L5T A;  1HFG A;  3IFD A;  1BUV T;  4C1N K;  5D14 A;  3QJY A;  1HFN A;  3IFT A;  4PMB A;  1SYG A;  2XNA C;  2YYZ A;  4X3T A;  3PUV A;  4OO1 I;  1XX8 A;  1EYA A;  1H9M A;  1I4X A;  2PZU A;  1RDP D;  4ZUI A;  5C5M A;  4XXE A;  1PZI D;  5M3M B;  4IZ8 A;  4NW2 A;  1JWM D;  3M85 A;  5C6A A;  4BS9 A;  2IJ0 A;  2RDH A;  3K59 A;  3A55 A;  3M7G A;  3LNN A;  4FF3 A;  5T1G A;  4RHS A;  2K03 A;  5FKA C;  4ID6 A;  1O7L A;  4NMZ A;  3D6C A;  3JAM E;  4M1U B;  2L0C A;  3SXH A;  3R2I A;  3ERQ A;  5LHY 1;  1IW7 D;  2O2L D;  1Y69 U;  2NVX B;  2NBF A;  5I6Y A;  1VMC A;  2L4N A;  1CI3 M;  3QOL A;  4RAU C;  4C1N I;  3VYT A;  1Q90 A;  1H9S B;  3VR3 A;  3W3A A;  1JIC A;  1UUP A;  3HP3 A;  2SNM A;  2KHS A;  3PO2 B;  1HTP A;  2E2J B;  1BCP C;  4RGT A;  3SK4 A;  3MEH A;  1STY A;  4F87 A;  3WOF A;  1BF4 A;  3TZD A;  2JA7 B;  4ODG A;  2B2Y A;  1I6H B;  3MTS A;  2F0N A;  1LLR D;  3K57 A;  1BR9 A;  2HCI A;  3SK6 A;  4F7X A;  3FPU B;  4ME5 A;  3URY A;  1DON A;  5C3X A;  2KCC A;  4XTC S;  3S1Q B;  4HSV A;  2CW0 D;  1ESR A;  1SJH D;  3M7N A;  3KBX A;  1UAP A;  3MAQ A;  1EQV A;  1SNQ A;  1I3Q B;  2LMC B;  3BVG A;  3OMG A;  3QB3 A;  2PPB C;  2WKC A;  3N52 A;  1TII D;  2WV6 D;  1F9S A;  3OOC A;  5FK9 C;  4PQX A;  2F0V A;  3BVM A;  2KOL A;  4J1M A;  1B44 D;  2ZT9 C;  2Z8L A;  4P2C B;  5E4W C;  2A6H D;  4UDU C;  4K5X A;  4QF4 A;  5EPJ A;  1BOS A;  1STB A;  3HZX A;  1KDB A;  3CRK C;  3TP7 A;  1DXM A;  1SE3 A;  2RSO A;  2Q8R E;  1EFI D;  2L1B A;  4O42 A;  3RLF A;  3MXU A;  4U67 3;  3D4D A;  4DF7 A;  1PZJ D;  1FNV A;  3WDN A;  4A93 B;  4BA2 I;  1NUC A;  3K5M A;  1U4M A;  3A54 A;  3R3O A;  2EZV A;  4RCN A;  3GQB A;  1AZP A;  4IQZ A;  3PV0 A;  1Y8O B;  1H9K A;  1G2T A;  3J7A V;  3H6M A;  4A3I B;  1CHP D;  5KGU A;  3V96 A;  4ZYS A;  4ILW A;  2BOS A;  1TY0 A;  4RFB A;  4X3U A;  1MGS A;  5I4D A;  4J8Q A;  3S1N B;  4QIW B;  2JEB I;  3EA6 A;  1BCP D;  1VDZ A;  4Q5V A;  1GUS A;  4G7O C;  1FD7 D;  1ML0 D;  2NYZ D;  2HDL A;  2DNE A;  5IGF A;  1JB3 A;  2G9D A;  2NVQ B;  1J9O A;  1EL0 A;  2D9U A;  1PRT C;  4PV1 C;  4C3H G;  3HKZ B;  3JAM L;  4A3J B;  1SE2 A;  3BS1 A;  1JOQ A;  2C5C A;  4ZAI A;  4FXK C;  4K6L A;  5KRU A;  4CJ0 B;  1EY7 A;  1RCV D;  2E75 C;  2F4I A;  4I65 A;  1SYD A;  1JCK B;  2BE5 C;  4KN7 C;  2ICE C;  3ND8 A;  3GO5 A;  3QO2 A;  4TSS A;  1XYI A;  1BXT A;  3C1E A;  3H94 A;  2N55 A;  2L9H A;  5J22 A;  3VR6 A;  1TKW B;  5DEH A;  3NK9 A;  4NDX A;  3TME A;  3D4W A;  1L0Y B;  1LTS D;  3DWP A;  2D2C C;  3S2D B;  1ZEQ X;  3DMU A;  3C2P A;  5JJZ A;  2EYO A;  3BVZ A;  4GZY C;  1LT5 D;  3L9A X;  4N9P A;  1QWY A;  1O7Y A;  4C3I B;  1JC7 A;  4FNF A;  2R7Z B;  1PFM A;  5A35 A;  4CJ2 C;  1M8A A;  1TU2 B;  1G2S A;  4WFN 3;  2IX3 A;  4K8J A;  3TBI B;  5BN3 A;  1JOK A;  5EGT A;  1EY4 A;  1H9J A;  1V1P A;  1QG7 A;  5IT9 E;  1B2T A;  2OXP A;  2O5J C;  2GA4 B;  3PIP 3;  3TDQ A;  2NN6 H;  4HMJ A;  4KN4 C;  1EQT A;  1LTA D;  3BYT B;  3VA7 A;  2EY2 A;  3V05 A;  1CQF A;  2EXZ A;  3MVV A;  4ULL A;  5LL6 X;  1EYD A;  4H0L C;  4L8J A;  3Q6S A;  3SE0 A;  4H44 C;  1EWC A;  4H7B A;  2IT1 A;  3CHB D;  3X3N A;  1SNM A;  3SHL A;  2AWN A;  5D3D A;  2B39 A;  1HCZ A;  5C4H A;  3QWN A;  4ZKC B;  1OXV A;  2MPM A;  1TWC B;  5FO9 B;  1U4P A;  3I91 A;  2WP8 J;  1I4Q A;  2PW7 A;  5G3L D;  2RA4 A;  4E6I A;  1R9T B;  4DXF A;  2HDM A;  1S4Z A;  1TWF B;  3C1F A;  2RVL A;  4FF4 A;  2EYJ A;  3DM1 A;  2X69 A;  2MJ8 A;  3HOZ B;  1PRT D;  1KNA A;  2Z4H A;  2VB3 X;  4RKL A;  2CQA A;  1DOK A;  4FF2 A;  1GHJ A;  3GD7 A;  1X3P A;  3BDC A;  1JWU D;  4DNR B;  3RZO B;  3S16 B;  1AEX A;  3DUZ A;  2QF7 A;  3A8I E;  5HUR A;  1LTT D;  1SYE A;  3IAY A;  4BWG B;  4S3S A;  1QCB D;  4FVM A;  3IL8 A;  3HRZ C;  1WTX A;  1WTR A;  2X6L A;  1B9N A;  1RKN A;  2K7V A;  1WTW A;  3D3R A;  1EEF D;  1ET6 A;  2R3Z A;  5I9O A;  2IX1 A;  2B2U C;  1CZW A;  2NN6 I;  4H13 C;  1Q3L A;  4C56 C;  1HQR D;  4WRD A;  2D62 A;  4RGO S;  2NWG A;  3CQZ B;  4K5V A;  4DGZ A;  2VXW A;  1SNP A;  1O7Z A;  3P75 A;  3BDL A;  3NBH A;  1A3V A;  1NSN S;  1WTO A;  2MUY A;  1STG A;  1JQY D;  1SXT A;  2B63 B;  3PUZ A;  3J81 E;  1FNU A;  4QB4 A;  2EVB A;  2V4D A;  1KTK A;  4CBV A;  4XQQ A;  1TWG B;  2QEJ C;  3BG3 A;  4R8N A;  2F0P A;  1E0B A;  2CHB D;  2ZXP A;  3NPP A;  1PMR A;  5J39 A;  3J7A F;  3K5O A;  3NTI A;  1UNS A;  3M4Y A;  2F0F A;  1HPC A;  5EPK A;  2G9H D;  4DK1 A;  1S5C D;  3E5S A;  1LTG D;  3PUY A;  1WD1 A;  5COY A;  5I6W A;  3H3V C;  3OWE B;  3MFY A;  3ITP A;  1ENC A;  4CKC A;  5ELF A;  2F0L A;  4Z9C B;  3CU7 A;  2PW5 A;  5C4X B;  4IUQ A;  2F0H A;  4B9X A;  1PFN A;  4HTH A;  5IT9 L;  1PYW D;  5JEA J;  3OPO A;  3SR1 A;  5ELB A;  4JBW A;  3SK8 A;  3OHX C;  4BBR B;  5M5X B;  4TRD A;  3V2T A;  5M3F B;  2VNU D;  3G7L A;  4K14 A;  1OXS C;  2FHT A;  1QB5 D;  1VF7 A;  3KBG A;  2JA8 B;  3S9W A;  3KF8 A;  1Q1B A;  1IYV A;  5CBA E;  1TY2 A;  4KV6 A;  5C5L A;  2RDG A;  3KLR A;  3QG1 A;  3OW7 A;  4A3B B;  2O5I C;  2E76 C;  2O4X A;  4XIG S;  3MZ5 A;  3HOY B;  1DCZ A;  1EU4 A;  2EYM A;  3QIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...