4HCSA

Structure of novel subfamily cx chemokine solved by sulfur sad
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
PGVCFKVLTTKEPKANIKRCYNLPKTNNCLKCVLFVDASNRMKCIDPNASWLAERLYRLKEKGVTCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the evolution of a new chemokine family from zebrafish.
pubmed doi rcsb
source organism Danio rerio
molecule tags Signaling protein
molecule keywords Uncharacterized protein
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hcsA00
2B2YC 1EIGA 2X6GA 3DEPA 4UAIA 1DZ1A 1RTNA 4QUCA 1HFNA 3DM1A 1ZXTA 1F9QA 1MSHA 1JICA 3GV6A 3I3CA 1Q3LA 1HFGA 3I8ZA 4DN4M 4QUFA 1NR4A 2Q8RE 1G6ZA 3UI2A 2XIWA 1GUWA 1QNKA 1B4OA 1RJTA 2D9UA 2RSNA 3D6WA 1J9OA 2B2WC 1IKMA 4ZAIA 4OIKA 2KEDA 1WD1A 1ILPA 2NYZD 3KUPA 1X3QA 3FDTA 2N88A 1NR2A 1SDFA 2DY8A 2HCCA 2K04A 4IURA 1KNAA 1AZQA 5DNFA 4IUQA 4CJ2C 1J8IA 1F2LA 2MJ8A 4X3TA 2L1BA 1LV9A 1HRJA 2FINB 5CMDA 2EE1A 1O7YA 1PFMA 1B50A 1MGSA 1B53A 5EPKA 1PLFA 4ZKCB 1BF4A 1CA5A 1SSOA 1DOKA 1WTPA 1CM9A 2B2UA 1A15A 2K05A 3IFDA 2J7ZA 4IUTA 2FHTA 5EJWA 1RHPA 3TN2A 1DONA 1G2SA 2B2VC 4RA8A 4CJ0B 1WTQA 1WTOA 2MP1A 1RODA 1BBXC 4XT3B 2HDMA 4ZLTF 2L4NA 1VMCA 2HUGA 1HUNA 4ZKBB 1G2TA 1E0BA 1ILQA 3H91A 2B2WA 1VMPA 3I91A 2B2TC 3P7JA 5E4WC 5CBAE 2JP1A 2NWGA 4XDXA 1CA6A 1XYIA 1QE6A 2KECA 1G91A 2KOLA 1ML0D 5CBEE 1EOTA 2NZ1D 2B2TA 4IUPA 1S4ZA 5CORA 2KUMA 1WD0A 4RWSC 1RTOA 1JE4A 1DOLA 4OIJA 5D65A 1NCVA 2KEEA 3FPUB 2X69A 2K01A 1F9SA 1TVXA 4HSVA 5EKIA 2Q8TA 4CJ1B 3MWYW 1PFBA 4R9WA 1U4LA 1EIHA 4HEDA 4LMQD 1X32A 4RAUC 2L11A 3GV3A 1ICWA 2BDNA 2L12A 1U4PA 4U68A 5T1GA 2M2LA 3SVMA 3TZDA 2RA4A 4R8IA 3LWEA 2K28A 2K1BA 2L9HA 1EQTA 1NAPA 2EOTA 2KVMA 4IUUA 5E4XA 1ESRA 5EPJA 1WTVA 1U4RA 2N55A 5EQ0A 2CVRA 2VXWA 3DEOA 3Q6SA 1EL0A 5T1IA 2RSOA 4X3UA 3I90A 1PFNA 5EPLA 1U4MA 3R93A 1WTWA 1PDQA 2RVLA 3F2UA 1KNEA 3N52A 4IUVA 1F9RA 2K03A 1IL8A 2R3ZA 1X3PA 1AP0A 1DOMA 1AZPA 5COYA 5JJZA 4X3KA 2B2VA 2HDLA 4HAEA 2H1EA 4MN3A 2MGSA 3MTSA 1MI2A 1QG7A 3QO2A 4NW2A 1F9PA 2IL8A 1HUMA 1SAPA 2HCIA 2B2YA 2MPMA 1MSGA 4XT1B 1BO0A 2SDFA 1HA6A 5D14A 1B2TA 2FMMA 4X3SA 1IKLA 1O80A 2EPBA 2FJ2A 4ZK9B 4MHEA 3IL8A 1WTRA 1HHVA 1B3AA 2DY7A 2JYOA 2X6LA 5AFWA 3G7LA 4O42A 3ONAB 1WVLA 1M8AA 2FFKB 3HP3A 4HCSA 1BNZA 1XX8A 3KBXA 1C8CA 1O7ZA 1WTXA 2B2UC
chains in the Genus database with same CATH superfamily
4DR5L 4UAIA 5IT9L 2UUBL 1Z7TA 3RR5A 1STAA 2CH4W 2LXJA 1UNSA 3TRZA 3KK7A 2O2LD 1Q82C 4DV4Q 1FR3A 1JQYD 4NXML 5FJ8G 4JI0L 1PMRA 1MJEA 2R7FA 1LUZA 4A3LH 3G48A 3D6CA 1STBA 4YHHQ 2ZXRA 3F2CA 1FNUA 2FHTA 4FNFA 1LTGD 3T1HL 2A6EC 1BBXC 3Q23A 2A6HC 1E1TA 3AQQA 4QMGA 1CQFA 2CFMA 1WCMG 2B2WA 1VMPA 3F2BA 2JP1A 2NWGA 4FF2A 3SK8A 1PYSB 4DV7L 2A73B 4DAYA 1KABA 3HGBA 2IJ0A 2LSSA 2EJMA 5FKAC 2I07B 1JJGA 2YU9B 1EWHA 2AUJD 1ET9A 3K80C 4JBJA 4OONA 1X3FA 4RCNA 4JV5L 1CKNB 2IW3A 5CV7A 3S2DH 1ICWA 4G4KA 3TREA 4DAMA 3KBGA 5JVG3 4XYQA 4DR2L 1ICFB 5JAVA 3BS1A 1HQRD 3RZOB 1GJXA 1RL2A 4PZ6A 3NXWA 5KRUA 4BA1I 4R4QA 4P71A 2JA9A 1TIID 3PGZA 1C7YA 2R92H 3RN5A 3STBD 1YNXA 5GQOA 1FGUA 1LTAD 5IIFA 2CWPA 4NW2A 2IL8A 1E2VA 4K5WA 3GTKH 1HZBA 1VQ4A 1V1PB 3M7GA 3PIPA 3A7AB 3H94A 3MXPA 1QVCA 2R61A 2R92B 2X6LA 5K36H 1UE1A 5ELDA 1QNUA 3TMEA 2NVXB 1KDBA 5CORA 5M3MB 2OQ0A 3ULPA 4JC0A 3KJPA 1K3RA 3HKSA 1RKNA 1SNCA 1PZJD 4DV0Q 2I46A 4XQJA 4JYAQ 5M5YB 1SMXA 1TWHB 1PH1A 1XPOA 1HRJA 1MKHA 3NBHA 3OSOA 4A93H 3NSWA 4QF4A 2K05A 3H0GH 4IN3A 5FK9C 5BN4A 1P8LA 2E2DC 1XMOQ 3L0OA 2F0HA 4XIGS 2YTXA 4KJNA 2N8NA 1A6XA 4B9WA 4ZQ3A 4KHZA 2RHQB 2Y0SB 2B2TC 4NP5A 3VYSA 2QGQA 3LGJA 2WB1G 4A3MB 1ML0D 5ELFA 3HOZB 4NMZA 2JEAI 3NK9A 4HR7B 1HCZA 4BBSH 1MHWC 1SE4A 4K2KA 4MTNA 1HQMC 2Q8TA 1GXDC 1D2BA 4C2MH 4GN4B 2NN6G 1EIHA 2F0IA 4U68A 1U4PA 1HNZL 2M2LA 5BR8L 1MBYA 5BN5A 4DV7Q 1KHIA 3PUVA 2BA1A 2EOTA 1EWIA 4AQYQ 1EZ6A 1HR0W 3CCSA 4IFDJ 3CCRA 5HGTA 4Z9CB 1X9NA 1D5XC 1SJED 1EFID 2PZTA 4IUVA 1TWAB 1B70B 1NY4A 3D0FA 4A3CG 5COYA 1TU2B 2B2VA 3PUWA 4FYDA 1VQ8A 4KD4A 5J3BA 1D1KA 4X6AH 4XTCS 3TP7A 3RLOA 4PMWA 2XVSA 3CRKC 1V43A 2SDFA 3NTKA 1HA6A 5C3EG 5IT9E 3EFXD 1YEZA 4HCEA 4YWKA 4OXPA 1QUQA 5C6AA 1QOHA 1BR9A 1XMOL 4KI0A 4RHSA 3S24A 3IKJA 4RH6A 1PTOC 2EDGA 3CW2C 2XGTA 4DN4M 5KEEA 3OIPA 1GUWA 2K32A 1G6PA 3OYYA 2M9VA 4DV5L 2B2WC 4ZRZA 2JA7H 4NDXA 1IBLQ 2IHEA 4FF1A 1FJGL 4HMIA 2K5QA 5C4ZA 2K04A 4M8AA 1A3VA 3P1HA 4CJ2C 5JEAG 4JYAL 1IZ6A 1VQNA 2B39A 5C0XI 2ZTEA 4KV6A 4JBKA 1SYDA 1BCPD 1JWUD 1JWSD 2D5DA 2EVBA 2O5JC 4YY3L 1BOSA 1EEFD 3CC4A 1HNXL 3K59A 4ALPA 1TWGB 4DNTB 4OX9Q 2TMPA 2IX1A 1ZYRD 1JOKA 1GM5A 1PH5A 4N9PA 1RODA 4LFAL 4XT3B 4DAPA 1N34Q 2A19A 1EY0A 1O78A 4JG2A 4A3GG 2NN6I 1BQQT 4AQYL 1B9MA 1YBYA 1E24A 1I4RA 1XPRA 3M9BA 1SYGA 5E3FA 4B3SQ 1HZCA 3WWVA 1G91A 1NTGA 2RDGA 4B3RL 3M4YA 4POFA 3FVQA 4A3EH 2NZ1D 4JBMA 3MXGA 4DV2L 3U4ZA 3HOWH 4WJWA 1Q8KA 1Q1EA 1DOLA 4H7BA 5EKIA 3I4MH 1GUGA 2R6GA 4DR3L 1R4QB 4ZCKA 4R9WA 1U4LA 1X32A 3FEWX 3MVVA 4RAUC 5CV4A 2UXDL 5M3MH 4DV6Q 1E1OA 4LAAA 4OO1I 3SE0A 4IUUA 3KDFA 1EEID 1VQOA 1Y8OB 5T1IA 4LJZC 5G3LF 1FGBD 4OWTB 3X3NA 5EKLA 2Z8LA 4RGMA 5EPLA 4DNIA 5ELNA 1PDQA 1STHA 2BDOA 3BVGA 4CKBA 2A68C 3N52A 2PZWA 5I2YA 2E2JB 1Q7YC 3S1QB 1A8VA 1AZPA 1IBMQ 1G8ZD 2UXCQ 1YZ6A 5C44H 1GHKA 1TXYA 4A3DB 4BY1B 1ONLA 1B1ZA 3F8TA 3I4NG 4QJFA 2K4KA 1IW7D 1VQHA 1II3A 2EPBA 2NBFA 3RZOH 1ENFA 4KTAA 3CC7A 1JB3A 1PRTD 2AQ3B 4V190 4A93B 2GVBA 3D4DA 1RDPD 3W1BA 3C2PA 4I65A 3T1HQ 1B8AA 5M5YH 3GTPH 1RF2D 2XIWA 2AQ1B 3TP8A 1VCIA 2JA7G 3U9OA 2NVQB 4DA2A 2K5DA 3GTJB 5M3FG 4JOIC 3PO3B 4X3TA 1LV9A 1C0AA 2F0FA 2NZHA 3H0GG 3VR2A 2ICIA 3T53B 4A3BH 2CQAA 1YJNA 1V1PA 4CDDC 1PTOH 4OELB 1BF4A 2XTIA 3HOXG 4TQUS 2HQLA 2RDFA 1STGA 3MZ5A 3MXUA 4GZYC 5IGEA 2A69D 3N6RA 2F0LA 1J5EQ 3AYHB 3HOVG 3D8GA 3PIP3 3T1YL 2CKZB 4R4TA 1L1OA 5EBCA 1E7ZA 5E4WC 4FVMA 1GHJA 4KKSA 4QIWE 3CCQA 3ERSX 1JB7A 5ISRA 2ZJQA 4WRDA 1H9MA 3RMHA 4LFCQ 2K5VA 3K5NA 4WJ3M 4LF4L 2Z1CA 3SXHA 2K33A 3UE0A 2EYFA 4DR4L 1L0XB 2YTYA 2XN9C 3BVZA 3GDEA 5C3EB 3I4NH 3NBHB 1IBKQ 4OEMB 3G4SA 2VQEL 3GTLB 2ZTDA 2Z6BA 4GNXA 4DV1L 4R8IA 4H44C 1EY4A 1EWCA 3MXNB 4X62L 2RSOA 4NXNL 5IGFA 3AU7A 3OPOA 4O0AA 5IGDA 1EY9A 5C3EH 3I4NB 2QILA 2PI2A 5C5LA 1EUJA 3VYRA 5A35A 3DWQA 4G7OC 4AYBB 4EQ5A 1PH7A 3I56A 4A3CH 1SMYC 1B2TA 1D5MC 2ALYB 5C0XH 4XXEA 4C3HB 1VQ5A 2F4VQ 4H13C 1PH2A 1VDZA 2CW0C 1C8CA 1Y8PB 3KF8A 5FLXL 5K5PA 1YNND 4ZUIA 1Y8NB 3I8ZA 2Q8RE 3PF5A 1Y1VB 4DU9A 3TSSA 3EROA 1JC7A 1STEA 1KL9A 3HS0C 4OIKA 5HURA 2EIFA 2NVQH 1XNRQ 4M1UB 3L9AX 1D6EC 2MJ8A 1BDOA 1T5EA 4LFBQ 2NVTB 3H6MA 5EPKA 1T5XD 2UU9Q 4A3LG 1YJ9A 4Q0FA 1L0WA 3CQZB 4WFN3 5KNDA 3VDYA 2EY6A 3TDQA 5JEAH 5K36G 1HH2P 1HPCA 1K0RA 3F1ZA 2EXDA 1WTOA 1A2UA 3W2DA 1YNJC 4K6DA 3EQLC 1D8LA 1TWCH 4OWWB 1WI5A 2R92G 2K6AA 5I4DA 1HNZQ 4LW1A 5ELBA 4KHPL 3HRZC 1HR0L 1LACA 3CPWA 1DCZA 3BDOA 1CQVA 5AJ3L 1I4QA 2KEEA 3JAME 2K01A 4CJ1B 4JW0A 2JXMB 3BDLA 4HJ7A 2GA4B 3KFUA 1ESFA 2A1AA 3MHBA 1PYBA 3SVMA 5T1GA 3KF6A 1PV4A 3F2DA 1OXTA 1AEXA 1I50B 3CCVA 1L1OB 2NTTA 4KY5A 1FD7D 2DUDA 2PQEA 1A3TA 4DV6L 5C3XA 5IGCA 4OO1G 2I0QA 1KXLA 2M00A 4YWLA 3DMUA 3LNNA 1LYLA 3EJIA 4X3UA 5H1SE 3Q22A 1Y69U 1YHQA 1TWFH 3P75A 1YVCA 4IFDH 3T16A 2D2CC 3S14B 2EJGC 5EAYA 3KLSA 4MN3A 3QO2A 2F0KA 1MSGA 2LKVA 4GNXC 1TY0A 5LL6S 3UDIA 1CFMA 2WB1B 4A75A 1WTRA 2DY7A 1BCPB 3L3OC 3CCEA 2OXPA 2ASBA 3DXJC 4PMBA 1STYA 3QG1A 1BNZA 3G6JB 4L8JA 2B2YC 4FDBA 3HOVB 4KN7C 1RTNA 4DKAC 3HOYB 4UP7A 3I4OA 1RD9D 3S1NB 1T9HA 2L0CA 2D9UA 4BY1H 1Z9FA 2EYHA 4JI0Q 2B63B 2RKSA 4KY6A 4DR7L 1VQ9A 4DV3L 2N3SA 4A4IA 1Y1WB 4A3IB 3S1QH 1KNAA 1I50H 4IUQA 1W3SA 3E0JA 1FJGQ 2FINB 1WTPA 5LMUL 2MO0A 4LWCA 1N32Q 4CKEA 4LF8L 2F52A 3KF8B 5C4XH 4EQNA 3PUXA 5NUCA 4HTHA 4YCUA 2C9OA 1DM0B 4OWXB 4QL5A 4ME3A 4LF6Q 3FKIB 1XJVA 4FP5D 4APVA 3KOJA 1QE6A 3A55A 3I73A 1EY5A 2KOLA 4KKTA 4JI6L 5JJIA 3KLSX 1KAAA 4O2DA 4IUPA 1CKNA 4AYBG 3M4OB 2JA8B 5M3MG 2IT1A 2BH2A 1HA5A 3MWYW 1S40A 4AH6A 1AW7A 2F3IA 3TEHB 1HR0Q 2NTSA 2NVTH 3J7YW 4K8IA 1Q12A 2QF7A 5C5MA 4HJAA 2PQAA 2D0PA 4DV1Q 1AFPA 3CP0A 4BBRG 1K83H 2L15A 1N34L 1L1OC 2AQ2B 4MTKA 1UWVA 5M3FH 4RKLA 3F2UA 1E3PA 4YIJA 2JQOA 2NUCA 4IQZA 3S15H 2JA7B 3SHLA 3FHWA 2OTLA 2Z9HA 1HUMA 1C9OA 3CU7A 5IP7H 3PO3G 4ILWA 3E6ZX 4X65Q 2EYLA 1Y14B 3S1NH 2RF4A 5KNCA 4GNXB 3CPFA 3CCLA 4CDCC 2KENA 3K0YA 4YCWA 2AUKA 4R1JA 2EYOA 4RKBA 1K73C 5FOBB 1I5FA 4NKLA 1ZXTA 1OXVA 1G6ZA 2GN5A 1B4OA 3J80i 2DN8A 1TS2A 4G7ZC 3KUPA 3QJYA 1X3QA 3NQIA 3CQZH 4C1NK 1QJOA 1TWAH 5DNFA 1SEBD 1SXTA 1HZAA 4RGNA 1TWHH 3VYUA 5CMDA 2E2IB 2NZOA 4E6IA 3GTLH 1B50A 3QOLA 1XWEA 1TQOA 3S1RB 3A8KE 4YWMA 1CA5A 2JA6B 2H4OA 2NVXH 1SRUA 1IYJB 2ZJPA 3RLFA 1LLRD 1YNJD 3ND8A 2WKCA 2HHHQ 4LUZA 1H9KA 2HDMA 4ZLTF 1K28A 2HUGA 4PZ7A 1GVPA 3I4MG 1I4PA 1E0BA 3S2HH 3GTKB 2N49A 1S5ED 4K8JA 4XDXA 1SYEA 5JPNC 1ENCA 3P20A 4C3HH 3HZXA 1NE3A 4YCVA 4K6LA 1V1QA 2VQFL 1PXUA 3QB3A 4DXFA 1I4XA 1E22A 1VQ6A 1CKMA 4S3SA 5M5XH 3MFGA 1Q90A 2ZTCA 4EGVA 1QZHA 3Q0AA 1L0YB 3TZDA 2K28A 3MC0B 3NBIA 4RFBA 3H0GB 2BCOA 1NAPA 1CHQD 5BN3A 3TBIB 5GROA 2UXDQ 1ASZA 2JA5H 1EL0A 1BKBA 4H02A 3HOXB 2K75A 2JA5B 1A0IA 1U4MA 1JOQA 2KBNA 3ULLA 1L2FA 1I3QB 3NHHA 1N32L 1Q1BA 3LX0A 3CAMA 5LMUQ 4POGA 4X3KA 4JI1L 3HKZB 1KDCA 3J81L 2VQFQ 1HXYD 4FXDA 2B8GA 3HOUG 3JC66 3S1MH 1VF5C 1Q8IA 4A3KG 4GLAC 2SEBD 3BZCA 4A3GB 1KRSA 2ZXPA 5D14A 4IALA 5KYIA 3H3VC 3BJUA 4GKKL 5L37A 5HGQA 1B3AA 3PQIA 4XQQA 4DV3Q 4MIUA 2K14A 5ELOA 3ONAB 5FO9B 1QCBD 1EFWA 3SGIA 1CTMA 3KBXA 2HHHL 1V8QA 4GS3A 5FO8B 4LK1C 1QILA 3KLWA 1HFGA 1ET6A 3WDNA 4DF7A 2PYKA 2JK8A 3NTIA 1VQEA 3M85A 1IYUA 4FXGC 4ZAIA 3X3MA 1FVIA 4LF5Q 4BA2I 2ENBA 4K14A 5JPMC 5CYUA 2E2HH 4B3TQ 3OW2A 1M90C 4HIDA 1XNRL 2A6ED 3OOCA 3NELA 1LM0A 2B3GA 1N33Q 2B2UA 3I4MB 1VQLA 2I5HA 2EYMA 1LTBD 3BZDB 4AYBE 2OF1A 3H91A 2YU9H 1NUCA 2WAQE 5IYCG 1XYIA 5JVH3 3TZUA 3DM3A 1YHBA 1LTLA 3DHQA 1C4QA 2IY5B 2F0PA 2HD3A 4OHJA 2PNHA 1SBBB 4TKOB 5IYCH 4K0KQ 2JSOA 4OIJA 1NCVA 5CC4A 2B29A 1M1KC 3G71A 1DJRD 3VR4A 5C44B 1TY2A 3A0JA 1FNWA 2A8VA 1O7LA 1K9MC 2EY5A 1S5CD 5IY0A 4KLKA 2QEXA 2RA4A 3GTOH 3T13A 3S2HB 4J8QA 2C5CA 4C3IG 5E4XA 4IFDG 4BXXG 1UE5A 1DXMA 4DPGA 3K58A 4OL7A 3HOUB 4L5SA 1A2TA 1CKOA 1H9RA 1BXTA 1VF7A 3NUCA 2EXZA 4A3MG 3URYA 3PO3H 3EN2A 4LF7Q 2E2IH 1QWYA 1XNQQ 2Q8IB 4R4IA 4DNRB 1MI2A 3I70A 4LF9Q 2VZAA 3SDZA 4RHRA 4GN3B 3M4OH 4DAYB 1IKLA 3GTPB 1GUOA 1CHPD 1PH9A 3K0XA 3J7A5 4HCSA 1AH9A 1R9TH 1O7ZA 1WTXA 2B2UC 3DEPA 2VB3X 1ASYA 1Z6HA 3FKIH 4DUZQ 1XPUA 1SYCA 4JI2Q 1NNXA 1PHJA 4BS9A 2KA7A 2Z6KC 5IE8A 5J22A 3UDXA 3FPPA 1SMYD 3B6YA 3FKIG 3ITPA 4CBVA 2VUMB 2LS01 2HCCA 5EKKA 2R93H 1CZGA 1WYDA 4GLVB 1JMCA 4LF9L 1JJ2A 1KIXA 1MD2D 2CCZA 2R7ZH 1DOKA 1OXUA 4WJ4A 4KJOA 5I6YA 5EJWA 1G2SA 4RA8A 2LY7A 4CJ0B 1I4HA 2J4XA 2K5HA 1BVSA 2B63H 5G3LD 4A3BB 1VMCA 2A68D 4X62Q 2F0EA 4IO9A 2XRQD 4Y52H 3S17H 2OQKA 1HNWL 1S5FD 2OEOA 5CGKA 4IOAA 1PYWD 4NPSA 2F0GA 3HKZG 2VQEQ 3UDGA 4IFDI 4QQBX 4C3IH 4DR6Q 1IBKL 2EYPA 2SNSA 2ES2A 2EY1A 3CD6A 3Q8DA 3GTGH 4FXKC 2FMCA 3FPUB 4HSVA 1BBWA 3SK6A 3C1EA 4EVOA 2BE5C 3GV3A 1Y1WG 2F3WA 4IPDA 1N36L 4DR2Q 2HIXA 3IFTA 3D3RA 3S16B 2R7ZG 1ZEQX 3OTOQ 3WOFA 1SN8A 2WKDA 2UUAL 2CVRA 2P5ZX 2PO4A 4A3DH 2JE6I 3MEHA 4EQOA 3ICEA 4HN7A 2PCFB 4DK0A 1W2BA 4LF8Q 3TP6A 4A3KH 2AMCB 4A3JH 2KQ3A 1YHAA 4PG3A 4I7ZC 4C2MB 4KHPQ 1V1OA 4K5VA 2YYZA 2ZM6Q 1KRTA 4ME5A 1WTHA 3PSIA 5FLXE 5AFWA 2PW5A 2MQHA 1H9JA 3HP3A 4N9TA 4C56C 4OO1H 1HFNA 3GV6A 3RN2A 2L5TA 3NQTA 5LMNQ 4A3EB 1IKMA 4DK3C 4A3FG 3HOVH 3FDTA 1X54A 2N88A 5IGBA 1NR2A 4GKKQ 3K5MA 4P73A 2ZM6L 4DV4L 3OW7A 1QVGA 1B7YB 4UPAA 2VNUD 5IP9H 1GOZA 3CMAA 1DD2A 3S14H 1MIUA 2F0OA 1LT4D 4C3HG 4JI1Q 4JI2L 1H9SA 3IFDA 3AMUA 5ELCA 1WCMB 1BUVT 3ND9A 4AIMA 4LUVA 4Y7NB 3RNUA 3MAQA 1JORA 1HUNA 1EY6A 1N8RC 4P72A 1VS0A 2UUCQ 2KHJA 5KGUA 1CA6A 4JI7L 2PNRC 3CHBD 3L7ZC 3H09A 4GN5A 3E9IA 2R7DA 2ZJRA 2ID0A 2C35B 1F2YA 3GD7A 4L5RC 1JE4A 1KLUD 4P2CB 2Q2TA 4FF3A 1TVXA 4ZYSA 1X6OA 4NXNQ 3HOYG 1VQDA 1A62A 3OWEB 3PCOB 2L12A 3D4WA 4FF4A 3I4LA 1MJCA 3K5LA 2JEBI 2EYJA 1LT3D 1LTSD 1EQTA 5D3IB 1VQCA 2E74C 3K6OA 2VXWA 3DEOA 2RCNA 2ZT9C 3OHXC 3HG9A 2VY3A 4LFAQ 3R93A 4KKUA 4J15A 4DR4Q 3J81j 5IP7G 3R2TA 4XQNA 3NWSA 4Q5VA 3WOEA 2QEJC 4JI6Q 1UEBA 1KTKA 2HCIA 1VQPA 2EJFC 4KY7A 2QCPX 1EYGA 1O80A 4ZK9B 4LF6L 1Y1VH 2K52A 2WV6D 3TQYA 4JCVE 2RCFA 1GUSA 1PTOD 4UP9A 3HOWG 3NWTA 4LNQA 4A3BG 2Q2UA 4JI4Q 4QUCA 3ULJA 1IXRA 1JICA 4J1MA 3STBC 3OMGA 2IX3A 3M3YB 1D5ZC 4QUFA 4DR5Q 1LTRD 4N8X1 4X66L 2DNCA 1J9OA 2A5HA 2UXBL 3NE5B 5HY6A 2I5MX 4IPGA 2BA0A 3HEJA 3KDFB 2WFWA 1AZQA 3M3YH 1QVFA 2AKWB 3M4PA 1CI3M 2JA5G 5A2QE 5C0XJ 1LTTD 2KHIA 2YTVA 4QGUA 4JI3L 5IOCA 4LF7L 1SSOA 2F0TA 1Q81C 2XNAC 3E3XA 3GTJH 4G57A 1FYCA 3S1MB 2PZUA 1ZYRC 4IPHA 3NENA 1I4GA 2EZVA 5DLQE 1AN8A 1AE3A 1X65A 2VW9A 4BBRH 4A3IG 2HQEA 3DUZA 3HOXH 1FNVA 2F0UA 2IHFA 1IBML 1WD0A 4F7XA 1RTOA 3PIO3 1WFQA 5D65A 1VQFA 1PH4A 3MEFA 1NJIC 4K0KL 3CC2A 4HEDA 5IWAQ 4RG1A 3DWAA 2E2HB 2KCCA 2ZXOA 3LWEA 2K1BA 3CXCA 1TKWB 3GTQB 2H5XA 3AEVA 4UP8A 4R4CA 2YV5A 4HIOA 5IYDG 4A3EG 2CW0D 1KNEA 2K03A 1IL8A 1X3PA 2JA6G 2XWJB 1HTPA 3PIOA 4ZUJA 3RD4A 1JT8A 1JJCB 3PO2G 4BY7H 3BU2A 1K83B 4Y7NH 4A3GH 2B2YA 4WORA 3BDCA 1HNWQ 3MA2B 1XTCD 2NN6H 4QB4A 4PV1C 1VQKA 2FMMA 2HIVA 1JOOA 4DUYQ 1IW7C 1KAWA 4C1NI 2FFKB 5LMNL 2R3ZA 4HIMA 5C0XG 1CT1D 1E2ZA 1JR0D 2MUYA 1SYBA 3I3CA 1V9PA 4KD3A 2JA8H 1PH3A 4L63B 3UI2A 2UU9L 1RJTA 1K8OA 1PA6A 4JBWA 2FXQA 1PVOA 5C4HA 1WD1A 1KLGD 1NSNS 5A2QL 2DY8A 2RHSB 3PV0A 2ATWA 1LABA 4HJ8A 1TWGH 4IURA 2L55A 1N9WA 4PMCA 3JAMi 5LMNW 2EE1A 1O7YA 1MGSA 3RZDB 4GLXA 3RLNA 1KDAA 5CV6A 3VR3A 1TS3A 5IP9G 2Z4IA 3DWPA 2SNMA 1S3OA 2L4NA 3T56B 3VR5A 3VA5A 1XTDA 3K81C 1G2TA 2R7ZB 3I91A 4L6TB 1Z47A 4A3KB 1VQMA 4JI8L 2WB1E 2F0WA 3I55A 2G5DA 4CHTB 3BYTB 5GAHC 1GO3E 1VQGA 3M4QA 2IWHA 3PF4A 1SE2A 2VUMH 4PNYA 4RWSC 5GAGC 4X64L 4B3ML 1PFBA 4CDEC 1G291 5I2XA 1VQAA 3CMEA 1H9SB 1TS4A 4MNOA 3FMCA 1SR3A 1TR5A 2BE5D 2CHBD 5BR8Q 1U4RA 2AHOB 3C3LA 3GP7A 5EQ0A 1SNPA 3AFQA 2KJXA 4IUNA 4BBSG 1LTID 2RVLA 1OXXK 1DYQA 4X64Q 4OX9L 1IL2A 3W3AA 3K7AB 3U50C 3EVQA 2K5WA 2F0VA 2CQOA 2F0SA 3OWFA 2MGSA 4JK1C 1QG7A 4ODGA 4LFBL 2JA8G 2MPMA 2WACA 3ERQA 1BO0A 4LUOA 4O1NA 2AWOA 2A6HD 3OMCA 2UUCL 3S15B 4F8MA 4RGOS 1K8MA 3A5UA 3GTOB 4PZ8A 1DZ1A 2X6GA 2UUBQ 4DUZL 4A3IH 3DM1A 1MSHA 2OWOA 2R93B 4JI5L 3ER0A 3KF6B 1SNDA 3D6WA 1E2WA 2SOBA 1ZKOA 3HOYH 3FP9A 5J39A 1YI2A 5LL6X 5IYDH 1PRTC 5I6WA 3TS0A 3J81i 4DR7Q 1GD7A 1PH8A 2O4XA 1KQSA 3J7AV 3GQBA 1R9TB 1EU3A 1R4PB 3MXNA 3S9WA 2G9HD 3V2TA 5I9PA 2J7ZA 5TSSA 2V4DA 1PH6A 3IRBA 1OXSC 3D31A 2GVAA 1CSPA 3S17B 3GTMB 3E9HA 1X56A 4UDUC 5C4XB 2Y0SE 2F0DA 2NVYH 1EYDA 4KMUC 4IPCA 3U4VA 5CBEE 1QB5D 2F1MA 5FO7B 1S4ZA 4L5TA 4EX5A 2KUMA 4A3DG 2Q2IA 5KYLA 4B3MQ 1U5KA 5E1FA 1F9SA 2WAQB 3GTQH 5DAUA 3PUYA 1SFOB 1EQVA 1PTOF 1PRTB 1EQQA 1GKHA 1Y1WH 4TRDA 3ZYYX 1QZGA 2UUAQ 4BBSB 2VB2X 3KLRA 3CCMA 2L9HA 1P16A 3A54A 2E75C 4JI8Q 3H3VI 1SE3A 5EPJA 4A3MH 1N36Q 2QDLA 1SLJA 1K8GA 2A74C 3Q6SA 3R3OA 1JE5A 3I90A 1PFNA 5E7NA 1TT2A 1EIFA 1EU4A 2G9DA 4DR3Q 3A8IE 1X3GA 1SNMA 1TWCB 1BBUA 1VQIA 4MZ9A 1N33L 3TP5A 4BBRB 2HDLA 5AJ3Q 3A7LA 4DV2Q 3S2DB 3PO2H 4U673 5C44G 3MTSA 4G7HC 1JWMD 5KIXA 2F0NA 3W1GA 3J81c 4B3SL 2AWNA 1SYFA 5LHY1 2WINB 4DXGA 3VR6A 3IL8A 2JYOA 4LF5L 2N78A 4KHVA 1YIJA 2XRSD 4IOCA 3J80c 1TWFB 1XX8A 2QKIC 3V05A 1CK1A 3K7UC 5M9OA 1SROA 1HNXQ 3BZKA 5CR3A 2KCMA 4QY7A 4ABNA 5M5XB 1QUQB 4JI3Q 2O5IC 4EQPA 2RSNA 2NYZD 2F0JA 5IGGA 1U9RA 3M7NA 1SJHD 1K8AC 1J8IA 2OCEA 1O7IA 2Z6KA 3CCJA 1IBLL 2I5LX 4DV5Q 1PFMA 4HIKA 4RMFA 3LWUA 1GUTA 3NEMA 4JI5Q 4GKJL 1KC8C 4UY8C 3O13A 2PPBC 4IUTA 1RHPA 3T4AC 4TVAB 1PRTF 2Z0SA 2NVYB 3AFPA 1Q46A 2JA6H 1EIYB 1ILQA 4GOPC 5D3DA 3K57A 1I6VC 1F2MA 2VUMG 2NB0A 5JOBA 1EZ8A 2MO1A 3J80L 2HT1A 2F4IA 2KECA 2XWBB 4JPBW 5DM63 4JV5Q 4F88A 2BOSA 4JVZA 2E5LQ 3PMFA 4BXXH 3W5OA 1F2ZA 1OO9B 2X69A 3OIQA 3L2PA 2MNAA 4OGQC 4ULLA 2TSSA 3PO2B 3NTHA 1UE6A 4LMQD 3H15A 2BDNA 2F03A 4A3JG 2WP8J 2PI2E 1D1IA 5M5WB 3V96A 4L5QA 2V1CC 5EBDA 4A76A 1W6KA 1HTLD 2A69C 1A63A 4JOIA 1Y1VG 3QR8A 1FL0A 4N8FA 2VL6A 5FLMG 1NMGA 1DOMA 4CGYB 2E2JH 2OTJA 2B8FA 2LXKA 1SFOH 2EY2A 4LFCL 1AE2A 4PQXA 1SAPA 5M3FB 1S72A 4XT1B 3JAMc 4X3SA 4HJ9A 2Y0SG 1YJWA 1SNQA 1U0LA 3CCUA 1WVLA 3K5OA 3S1RH 5JEAJ 3A5ZB 2JJQA 4B9XA 2EQSA 1LT6D 5IODA 3HOZG 2D62A 1I3QH 1PZID 1BCPC 1DGSA 4KK7A 3FRPB 1F9QA 2CH4A 4BY7G 1WCMH 1QNKA 2J0TD 1K0SA 3D4RA 1CUKA 1WJJA 2F4VL 3R8BA 1RIPA 3U58A 1GUNA 1NBWA 2VS1A 2DJFC 4B3TL 3R2IA 1F2LA 3A8JE 1B9NA 2PQAB 4C3JH 1VQ7A 1BCPF 3K8AA 3MFYA 3IAYA 1B53A 1EYAA 1XNQL 2QW7A 1A15A 4RCOA 1DONA 3TN2A 3C46A 4CDFC 2B2VC 1S5DD 5JJKA 2CWAA 3U9SA 1WTQA 1A3UA 2MP1A 4J6HA 2DGYA 3J80E 4DUYL 3G6EA 4V0BA 1VQBA 4A3FB 1I94Q 3VA7A 1XMQQ 2BH8A 3E0EA 1M4VA 4A93G 4GOPB 4DFAA 1EQRA 3SK5A 2F0QA 2RQXA 5JJLA 3ZJYC 3C1FA 4HMJA 1X55A 2UXCL 1PTOB 3A74A 1I6HB 4FO2A 4QIWB 4DR1Q 1STNA 4A3JB 1EOVA 4H0LC 4LF4Q 2E5LL 3GTMH 1S5BD 2E8GA 4ID6A 5C4JB 1F77A 5EGTA 4R4OA 1Q86C 1WOCA 1H95A 2KVMA 3JAML 3A56A 1ESRA 1CZWA 1WTVA 5KNBA 2RDHA 3T1YQ 3SEBA 3SK4A 4HJ5A 2ICEC 4IJLA 5IYBG 2QDBA 1J5EL 2MFIA 3GTGB 1WTWA 4C3IB 2R93G 5CV5A 1F9RA 4DR1L 2K50A 4GKJQ 1UAPA 2H1EA 4TSSA 3EA6A 5C4JH 1TS5A 4B08A 4HSPA 3DLLA 2PMZE 3UE1A 2DJGC 2FJ2A 3EIVA 4MHEA 3PUZA 2JN4A 1HZ9A 3G7LA 3NPPA 4BY7B 2D0OA 1X3EA 1B44D 2XSCA 4DV0L 1UEAB 1EIGA 4CKCA 4NB3A 4C3JG 4A3FH 1Q3LA 4YHHL 2RBMA 3CRLC 1NR4A 4R8NA 3BYYB 1J6QA 2KHSA 5J1ZA 1PFSA 4P74A 5DEHA 3BVMA 2KEDA 4BWGB 1ILPA 1SDFA 3J81E 5DM73 2L1BA 3SR1A 4IJHA 5FLXc 1EYCA 1YITA 3I7FA 3KJOA 4KN4C 4ZKCB 1PLFA 1CM9A 2WAQG 3HOWB 5IT9c 2F0MA 3RUZA 3BG3A 3S16H 1W6JA 2WIIB 4JI4L 1G51A 1IHZA 1SE8A 2K7VA 3UDFA 3VYTA 2Z4HA 3J7ZC 1VQJA 1LT5D 4K2LA 3J7AF 2QA4A 1EY8A 4ZKBB 4DK1A 4P75A 2PW7A 1PZKD 4BY1G 3OTOL 3P7JA 2LMCB 1K3BC 1UUPA 3AB9A 5CBAE 4X65L 2PMZB 3I2ZA 1OTCA 3E5SA 2OT2A 4QCLA 5FLMH 1EOTA 5IWAL 2MHVA 2B2TA 2DNEA 4DAVA 3HKZE 1I6HH 1LO5D 1D7QA 3CF5A 2F3VA 1IYVA 1UE7A 5GADC 5F2DA 4DR6L 2K5NA 2L11A 3HOUH 4B3RQ 5C3WA 2Q2HA 2KCTA 1XMQL 1JCKB 1SNOA 3I72A 3Q24A 1I94L 3QOJA 2N55A 3HOZH 4DGZA 3CKIB 3NP8A 2KCNA 3QIAA 1EY7A 5IYBH 5GAEC 4GOPA 2IPKD 1ENAA 1NMFA 3EBEA 2IX0A 4UHVA 3RZDH 5CV8A 3QWNA 1AP0A 3K7AH 5M5WH 5JJZA 1B3QA 4YY3Q 4DK6C 1KD1C 4HAEA 2B63G 1YNNC 4I7AA 4RGTA 1CSQA 5CV9A 1C48A 1F9PA 2LFNA 4NXMQ 1XXGA 4XYOA 4JI7Q 4F87A 4IZ8A 3T51B 5C4XG 3GO5A 3KYHC 4K5XA 1HHVA 4C3JB 5I9OA 3HFZB 5ELEA 5FJ8H 2UXBQ 3H3VH 4O42A 2E76C 1M8AA 4X66Q 1HJPA 1RCVD 3TS2A
chains in the Genus database with same CATH topology
4UAIA 5IT9L 1Z7TA 1STAA 1UNSA 3KK7A 2O2LD 1FR3A 1JQYD 1PMRA 3D6CA 1STBA 2ZXRA 1FNUA 2FHTA 4FNFA 1LTGD 2A6EC 1BBXC 3Q23A 2A6HC 4QMGA 1CQFA 2B2WA 1VMPA 2JP1A 2NWGA 4FF2A 3SK8A 2A73B 4DAYA 1KABA 3HGBA 2IJ0A 2EJMA 5FKAC 2I07B 2YU9B 1EWHA 2AUJD 1ET9A 4RCNA 2IW3A 5CV7A 1ICWA 4G4KA 3KBGA 5JVG3 4XYQA 5JAVA 3BS1A 1HQRD 3RZOB 1GJXA 3NXWA 5KRUA 4BA1I 1TIID 1LTAD 5IIFA 4NW2A 2IL8A 1E2VA 4K5WA 1V1PB 3M7GA 3A7AB 3H94A 3MXPA 2R61A 2R92B 2X6LA 5K36H 5ELDA 1QNUA 3TMEA 2NVXB 1KDBA 5CORA 5M3MB 1RKNA 1SNCA 1PZJD 2I46A 4XQJA 5M5YB 1TWHB 1HRJA 3NBHA 3OSOA 3NSWA 4QF4A 2K05A 4IN3A 5FK9C 5BN4A 2E2DC 2F0HA 4XIGS 4KJNA 1A6XA 4B9WA 4ZQ3A 4KHZA 2Y0SB 2B2TC 4NP5A 3VYSA 4A3MB 1ML0D 5ELFA 3HOZB 4NMZA 2JEAI 3NK9A 4HR7B 1HCZA 1SE4A 4K2KA 1HQMC 2Q8TA 1GXDC 1D2BA 2NN6G 1EIHA 2F0IA 4U68A 1U4PA 2M2LA 1MBYA 5BN5A 3PUVA 2BA1A 2EOTA 1EZ6A 4IFDJ 5HGTA 4Z9CB 1D5XC 1SJED 1EFID 2PZTA 4IUVA 1TWAB 5COYA 1TU2B 2B2VA 3PUWA 4FYDA 4KD4A 1D1KA 4XTCS 3TP7A 4PMWA 2XVSA 3CRKC 1V43A 2SDFA 3NTKA 1HA6A 5IT9E 3EFXD 4HCEA 5C6AA 1QOHA 1BR9A 4KI0A 4RHSA 3IKJA 4RH6A 1PTOC 2EDGA 4DN4M 5KEEA 3OIPA 1GUWA 2K32A 2M9VA 2B2WC 4ZRZA 4NDXA 4FF1A 4HMIA 2K5QA 5C4ZA 2K04A 4M8AA 1A3VA 3P1HA 4CJ2C 5JEAG 2B39A 5C0XI 4KV6A 1SYDA 1BCPD 1JWUD 1JWSD 2D5DA 2EVBA 2O5JC 1BOSA 1EEFD 3K59A 1TWGB 4DNTB 2TMPA 2IX1A 1ZYRD 1JOKA 4N9PA 1RODA 4XT3B 4DAPA 1EY0A 1O78A 2NN6I 1BQQT 1B9MA 1I4RA 1SYGA 5E3FA 1G91A 2RDGA 3M4YA 3FVQA 2NZ1D 3MXGA 4WJWA 1Q1EA 1DOLA 4H7BA 5EKIA 1GUGA 2R6GA 1R4QB 4R9WA 1U4LA 1X32A 3FEWX 3MVVA 4RAUC 5CV4A 4LAAA 4OO1I 3SE0A 4IUUA 1EEID 1Y8OB 5T1IA 4LJZC 5G3LF 1FGBD 3X3NA 5EKLA 2Z8LA 4RGMA 5EPLA 1PDQA 1STHA 2BDOA 3BVGA 4CKBA 2A68C 3N52A 2PZWA 5I2YA 2E2JB 3S1QB 1AZPA 1G8ZD 1GHKA 4A3DB 4BY1B 1ONLA 1B1ZA 1IW7D 1II3A 2EPBA 2NBFA 1ENFA 4KTAA 1JB3A 1PRTD 2AQ3B 4V190 4A93B 3D4DA 1RDPD 3C2PA 4I65A 1RF2D 2XIWA 2AQ1B 3TP8A 1VCIA 3U9OA 2NVQB 4DA2A 2K5DA 3GTJB 3PO3B 4X3TA 1LV9A 2F0FA 3VR2A 2ICIA 3T53B 2CQAA 1V1PA 1PTOH 1BF4A 4TQUS 2RDFA 1STGA 3MZ5A 3MXUA 4GZYC 5IGEA 2A69D 3N6RA 2F0LA 3D8GA 3PIP3 5EBCA 5E4WC 4FVMA 1GHJA 4KKSA 5ISRA 4WRDA 1H9MA 3RMHA 3K5NA 2Z1CA 3SXHA 2K33A 2EYFA 1L0XB 2XN9C 3BVZA 5C3EB 3GTLB 4R8IA 4H44C 1EY4A 1EWCA 2RSOA 5IGFA 3AU7A 3OPOA 5IGDA 1EY9A 3I4NB 2QILA 5C5LA 3VYRA 5A35A 3DWQA 4G7OC 4AYBB 1SMYC 1B2TA 1D5MC 5C0XH 4XXEA 4C3HB 4H13C 1VDZA 2CW0C 1C8CA 1Y8PB 3KF8A 5FLXL 5K5PA 1YNND 4ZUIA 1Y8NB 3I8ZA 2Q8RE 1Y1VB 4DU9A 3TSSA 3EROA 1JC7A 1STEA 3HS0C 5HURA 4OIKA 4M1UB 3L9AX 1D6EC 2MJ8A 1BDOA 1T5EA 2NVTB 3H6MA 5EPKA 1T5XD 4Q0FA 3CQZB 4WFN3 5KNDA 2EY6A 3TDQA 5JEAH 5K36G 1HPCA 1WTOA 1A2UA 3W2DA 1YNJC 4K6DA 3EQLC 2K6AA 5I4DA 5ELBA 3HRZC 1LACA 1DCZA 3BDOA 1CQVA 1I4QA 2KEEA 3JAME 2K01A 4CJ1B 2JXMB 3BDLA 2GA4B 1ESFA 3MHBA 3SVMA 5T1GA 1OXTA 1AEXA 1I50B 2NTTA 4KY5A 1FD7D 2PQEA 1A3TA 5C3XA 5IGCA 4OO1G 2M00A 3DMUA 3LNNA 4X3UA 3EJIA 3Q22A 1Y69U 3P75A 4IFDH 3T16A 2D2CC 3S14B 2EJGC 3KLSA 4MN3A 3QO2A 2F0KA 1MSGA 2LKVA 1TY0A 5LL6S 1CFMA 2WB1B 1WTRA 2DY7A 1BCPB 3L3OC 2OXPA 3DXJC 4PMBA 1STYA 1BNZA 3QG1A 3G6JB 4L8JA 2B2YC 3HOVB 4KN7C 1RTNA 3HOYB 1RD9D 3S1NB 2L0CA 2D9UA 2EYHA 2B63B 2RKSA 4KY6A 1Y1WB 4A3IB 1KNAA 4IUQA 3E0JA 2FINB 1WTPA 4CKEA 4EQNA 3PUXA 5NUCA 4HTHA 2C9OA 1DM0B 3FKIB 4FP5D 1QE6A 3A55A 3I73A 1EY5A 2KOLA 4KKTA 3KLSX 1KAAA 4IUPA 3M4OB 2JA8B 2IT1A 1HA5A 3MWYW 1AW7A 2NTSA 3J7YW 4K8IA 1Q12A 2QF7A 5C5MA 1AFPA 2AQ2B 4RKLA 3F2UA 4YIJA 2NUCA 4IQZA 2JA7B 3SHLA 3CU7A 1HUMA 4ILWA 3E6ZX 2EYLA 5KNCA 3K0YA 2AUKA 2EYOA 4RKBA 5FOBB 4NKLA 1ZXTA 1OXVA 1G6ZA 1B4OA 2DN8A 1TS2A 4G7ZC 3KUPA 3QJYA 1X3QA 3NQIA 4C1NK 1QJOA 5DNFA 1SEBD 1SXTA 4RGNA 3VYUA 5CMDA 2E2IB 4E6IA 1B50A 3QOLA 1XWEA 1TQOA 3S1RB 1CA5A 3A8KE 2JA6B 2H4OA 3RLFA 1LLRD 1YNJD 3ND8A 2WKCA 1H9KA 2HDMA 4ZLTF 2HUGA 1I4PA 1E0BA 3GTKB 1S5ED 4K8JA 4XDXA 1SYEA 5JPNC 1ENCA 3P20A 3HZXA 4K6LA 1PXUA 3QB3A 4DXFA 1I4XA 4S3SA 3MFGA 1Q90A 4EGVA 3Q0AA 1L0YB 3TZDA 2K28A 3MC0B 3NBIA 4RFBA 3H0GB 2BCOA 1NAPA 1CHQD 5BN3A 3TBIB 1EL0A 3HOXB 2JA5B 1U4MA 1JOQA 3NHHA 1I3QB 1Q1BA 3LX0A 4X3KA 3HKZB 1KDCA 3J81L 1HXYD 4FXDA 2B8GA 1VF5C 1Q8IA 2SEBD 4A3GB 2ZXPA 5D14A 4IALA 5KYIA 3H3VC 1B3AA 4XQQA 4MIUA 3ONAB 5FO9B 1QCBD 1CTMA 3KBXA 1V8QA 5FO8B 4LK1C 1QILA 1HFGA 4DF7A 3WDNA 1ET6A 2PYKA 3NTIA 3M85A 1IYUA 4FXGC 4ZAIA 3X3MA 4BA2I 2ENBA 4K14A 5JPMC 5CYUA 2A6ED 3OOCA 2B2UA 3I4MB 2EYMA 1LTBD 3BZDB 2OF1A 3H91A 1NUCA 1XYIA 5JVH3 3TZUA 3DHQA 1C4QA 2F0PA 4OHJA 1SBBB 4TKOB 2JSOA 4OIJA 1NCVA 5CC4A 1DJRD 3VR4A 5C44B 1TY2A 1FNWA 1O7LA 2EY5A 1S5CD 2RA4A 3T13A 3S2HB 4J8QA 2C5CA 4C3IG 5E4XA 4IFDG 1DXMA 3K58A 4OL7A 3HOUB 1A2TA 1H9RA 1BXTA 1VF7A 3NUCA 2EXZA 3URYA 1QWYA 2Q8IB 4DNRB 1MI2A 3I70A 3SDZA 4RHRA 1IKLA 3GTPB 1GUOA 1CHPD 4HCSA 1O7ZA 1WTXA 2B2UC 3DEPA 2VB3X 1Z6HA 1SYCA 4BS9A 2KA7A 5J22A 3FPPA 1SMYD 3ITPA 4CBVA 2VUMB 2LS01 2HCCA 5EKKA 1CZGA 1MD2D 1DOKA 1OXUA 4KJOA 5I6YA 5EJWA 1G2SA 4RA8A 2LY7A 4CJ0B 1I4HA 2J4XA 5G3LD 4A3BB 1VMCA 2A68D 2F0EA 2XRQD 1S5FD 2OEOA 5CGKA 1PYWD 2F0GA 4IFDI 2EYPA 2SNSA 2EY1A 4FXKC 2FMCA 3FPUB 4HSVA 3SK6A 3C1EA 4EVOA 2BE5C 3GV3A 2F3WA 3IFTA 3D3RA 3S16B 1ZEQX 3WOFA 2WKDA 2CVRA 2PO4A 2JE6I 3MEHA 4EQOA 4HN7A 2PCFB 4DK0A 3TP6A 2KQ3A 4I7ZC 4C2MB 1V1OA 4K5VA 2YYZA 4ME5A 5FLXE 5AFWA 2PW5A 1H9JA 3HP3A 4N9TA 4C56C 4OO1H 1HFNA 3GV6A 2L5TA 3NQTA 4A3EB 1IKMA 3FDTA 2N88A 5IGBA 1NR2A 3K5MA 3OW7A 2VNUD 1GOZA 1DD2A 2F0OA 1LT4D 4C3HG 1H9SA 3IFDA 3AMUA 5ELCA 1WCMB 1BUVT 3ND9A 4Y7NB 3MAQA 1JORA 1HUNA 1EY6A 5KGUA 1CA6A 2PNRC 3CHBD 3L7ZC 3H09A 2ID0A 1F2YA 3GD7A 1JE4A 1KLUD 4P2CB 4FF3A 1TVXA 4ZYSA 3OWEB 2L12A 3D4WA 4FF4A 3I4LA 3K5LA 2JEBI 2EYJA 1LT3D 1LTSD 1EQTA 5D3IB 2E74C 3K6OA 2VXWA 3DEOA 2ZT9C 3OHXC 3HG9A 3R93A 4KKUA 3R2TA 4XQNA 3NWSA 4Q5VA 3WOEA 2QEJC 1KTKA 2HCIA 2EJFC 4KY7A 2QCPX 1O80A 4ZK9B 2WV6D 1GUSA 1PTOD 3NWTA 4QUCA 1JICA 4J1MA 3OMGA 2IX3A 3M3YB 1D5ZC 4QUFA 1LTRD 2DNCA 1J9OA 2A5HA 3NE5B 2BA0A 3HEJA 1AZQA 1CI3M 5A2QE 5C0XJ 1LTTD 5IOCA 1SSOA 2F0TA 2XNAC 4G57A 1FYCA 3S1MB 2PZUA 1ZYRC 1I4GA 2EZVA 1AN8A 2HQEA 3DUZA 1FNVA 2F0UA 1WD0A 4F7XA 1RTOA 3PIO3 5D65A 4HEDA 3DWAA 2E2HB 2KCCA 2ZXOA 3LWEA 2K1BA 1TKWB 3GTQB 2CW0D 1KNEA 2K03A 1IL8A 1X3PA 2XWJB 1HTPA 4ZUJA 3RD4A 1K83B 2B2YA 4WORA 3BDCA 3MA2B 1XTCD 2NN6H 4QB4A 4PV1C 2FMMA 1JOOA 1IW7C 4C1NI 2FFKB 2R3ZA 5C0XG 1CT1D 1E2ZA 1JR0D 2MUYA 1SYBA 3I3CA 4KD3A 4L63B 3UI2A 1RJTA 1K8OA 4JBWA 5C4HA 1WD1A 1KLGD 5A2QL 1NSNS 2DY8A 3PV0A 1LABA 4IURA 2L55A 4PMCA 2EE1A 1O7YA 1MGSA 3RZDB 1KDAA 5CV6A 3VR3A 1TS3A 2Z4IA 3DWPA 2SNMA 2L4NA 3T56B 3VR5A 3VA5A 1G2TA 2R7ZB 3I91A 1Z47A 4L6TB 4A3KB 2F0WA 4CHTB 3BYTB 2IWHA 1SE2A 4PNYA 4RWSC 1PFBA 1G291 5I2XA 1H9SB 1TS4A 3FMCA 1TR5A 2BE5D 2CHBD 1U4RA 3C3LA 3GP7A 5EQ0A 1SNPA 2KJXA 4IUNA 1LTID 2RVLA 1OXXK 1DYQA 3W3AA 3K7AB 3EVQA 2K5WA 2F0VA 2F0SA 3OWFA 2MGSA 4JK1C 1QG7A 4ODGA 2MPMA 2WACA 3ERQA 1BO0A 4O1NA 2AWOA 2A6HD 3OMCA 3S15B 4F8MA 4RGOS 1K8MA 3GTOB 1DZ1A 2X6GA 3DM1A 1MSHA 2R93B 1SNDA 3D6WA 1E2WA 2SOBA 1ZKOA 5J39A 5LL6X 1PRTC 5I6WA 2O4XA 3J7AV 3GQBA 1R9TB 1EU3A 1R4PB 3MXNA 3S9WA 2G9HD 3V2TA 5I9PA 2J7ZA 5TSSA 2V4DA 1OXSC 3D31A 3S17B 3GTMB 4UDUC 5C4XB 2F0DA 1EYDA 4KMUC 5CBEE 1QB5D 2F1MA 5FO7B 1S4ZA 2KUMA 5KYLA 5E1FA 1F9SA 2WAQB 5DAUA 3PUYA 1SFOB 1EQVA 1PTOF 1PRTB 4TRDA 3ZYYX 4BBSB 2VB2X 3KLRA 2L9HA 3A54A 2E75C 1SE3A 5EPJA 2A74C 3Q6SA 3R3OA 3I90A 1PFNA 1TT2A 1EU4A 2G9DA 3A8IE 1SNMA 1TWCB 3TP5A 4BBRB 2HDLA 3A7LA 3S2DB 4U673 4G7HC 3MTSA 1JWMD 5KIXA 2F0NA 2AWNA 1SYFA 5LHY1 2WINB 4DXGA 3VR6A 3IL8A 2JYOA 4KHVA 2XRSD 1TWFB 1XX8A 2QKIC 3V05A 1CK1A 5M9OA 5CR3A 5M5XB 4ABNA 2O5IC 4EQPA 2RSNA 2NYZD 2F0JA 5IGGA 1U9RA 3M7NA 1SJHD 1J8IA 1PFMA 3LWUA 1GUTA 3O13A 2PPBC 4IUTA 1RHPA 3T4AC 1PRTF 2NVYB 1ILQA 5D3DA 3K57A 1I6VC 1F2MA 2NB0A 5JOBA 1EZ8A 3J80L 2F4IA 2KECA 2XWBB 5DM63 4F88A 2BOSA 3PMFA 1F2ZA 1OO9B 2X69A 3OIQA 4OGQC 4ULLA 2TSSA 3PO2B 3NTHA 4LMQD 2BDNA 2F03A 2WP8J 1D1IA 5M5WB 3V96A 5EBDA 1W6KA 1HTLD 2A69C 1DOMA 4CGYB 2B8FA 2EY2A 4PQXA 1SAPA 5M3FB 4XT1B 4X3SA 1SNQA 1WVLA 3K5OA 5JEAJ 4B9XA 1LT6D 5IODA 2D62A 1PZID 1BCPC 4KK7A 3FRPB 1F9QA 1QNKA 2J0TD 3D4RA 3R8BA 1GUNA 3R2IA 1F2LA 3A8JE 1B9NA 1BCPF 3MFYA 3IAYA 1B53A 1EYAA 1A15A 4RCOA 1DONA 3TN2A 3C46A 2B2VC 1S5DD 3U9SA 1WTQA 1A3UA 2MP1A 4J6HA 3J80E 4V0BA 4A3FB 3VA7A 1M4VA 4DFAA 3SK5A 2F0QA 2RQXA 3C1FA 4HMJA 1PTOB 1I6HB 4FO2A 4QIWB 1STNA 4A3JB 4H0LC 1S5BD 4ID6A 5C4JB 1F77A 5EGTA 3JAML 2KVMA 3A56A 1ESRA 1CZWA 1WTVA 5KNBA 2RDHA 3SEBA 3SK4A 2ICEC 2QDBA 3GTGB 1WTWA 4C3IB 5CV5A 1F9RA 1UAPA 2H1EA 4TSSA 3EA6A 1TS5A 4B08A 4HSPA 2FJ2A 4MHEA 3PUZA 3G7LA 3NPPA 4BY7B 1B44D 2XSCA 1UEAB 1EIGA 4CKCA 4C3JG 1Q3LA 2RBMA 3CRLC 1NR4A 4R8NA 3BYYB 2KHSA 5J1ZA 5DEHA 3BVMA 2KEDA 4BWGB 1ILPA 1SDFA 3J81E 5DM73 2L1BA 3SR1A 1EYCA 4KN4C 4ZKCB 1PLFA 3HOWB 1CM9A 2F0MA 3RUZA 3BG3A 1W6JA 2WIIB 1IHZA 2K7VA 3VYTA 2Z4HA 1LT5D 4K2LA 3J7AF 1EY8A 4ZKBB 4DK1A 2PW7A 1PZKD 3P7JA 2LMCB 1UUPA 3AB9A 5CBAE 2PMZB 3E5SA 2OT2A 4QCLA 1EOTA 2MHVA 2B2TA 2DNEA 4DAVA 1LO5D 2F3VA 1IYVA 5F2DA 2L11A 5C3WA 1JCKB 1SNOA 3I72A 3Q24A 3QOJA 2N55A 4DGZA 3CKIB 3NP8A 2KCNA 3QIAA 1EY7A 2IPKD 1ENAA 2IX0A 5CV8A 3QWNA 1AP0A 5JJZA 4HAEA 1YNNC 4RGTA 5CV9A 1C48A 1F9PA 2LFNA 1XXGA 4XYOA 4F87A 4IZ8A 3T51B 3GO5A 1HHVA 4K5XA 4C3JB 5I9OA 5ELEA 4O42A 2E76C 1M8AA 1RCVD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2Y C;  1EIG A;  2X6G A;  3DEP A;  4UAI A;  1DZ1 A;  1RTN A;  4QUC A;  1HFN A;  3DM1 A;  1ZXT A;  1F9Q A;  1MSH A;  1JIC A;  3GV6 A;  3I3C A;  1Q3L A;  1HFG A;  3I8Z A;  4DN4 M;  4QUF A;  1NR4 A;  2Q8R E;  1G6Z A;  3UI2 A;  2XIW A;  1GUW A;  1QNK A;  1B4O A;  1RJT A;  2D9U A;  2RSN A;  3D6W A;  1J9O A;  2B2W C;  1IKM A;  4ZAI A;  4OIK A;  2KED A;  1WD1 A;  1ILP A;  2NYZ D;  3KUP A;  1X3Q A;  3FDT A;  2N88 A;  1NR2 A;  1SDF A;  2DY8 A;  2HCC A;  2K04 A;  4IUR A;  1KNA A;  1AZQ A;  5DNF A;  4IUQ A;  4CJ2 C;  1J8I A;  1F2L A;  2MJ8 A;  4X3T A;  2L1B A;  1LV9 A;  1HRJ A;  2FIN B;  5CMD A;  2EE1 A;  1O7Y A;  1PFM A;  1B50 A;  1MGS A;  1B53 A;  5EPK A;  1PLF A;  4ZKC B;  1BF4 A;  1CA5 A;  1SSO A;  1DOK A;  1WTP A;  1CM9 A;  2B2U A;  1A15 A;  2K05 A;  3IFD A;  2J7Z A;  4IUT A;  2FHT A;  5EJW A;  1RHP A;  3TN2 A;  1DON A;  1G2S A;  2B2V C;  4RA8 A;  4CJ0 B;  1WTQ A;  1WTO A;  2MP1 A;  1ROD A;  1BBX C;  4XT3 B;  2HDM A;  4ZLT F;  2L4N A;  1VMC A;  2HUG A;  1HUN A;  4ZKB B;  1G2T A;  1E0B A;  1ILQ A;  3H91 A;  2B2W A;  1VMP A;  3I91 A;  2B2T C;  3P7J A;  5E4W C;  5CBA E;  2JP1 A;  2NWG A;  4XDX A;  1CA6 A;  1XYI A;  1QE6 A;  2KEC A;  1G91 A;  2KOL A;  1ML0 D;  5CBE E;  1EOT A;  2NZ1 D;  2B2T A;  4IUP A;  1S4Z A;  5COR A;  2KUM A;  1WD0 A;  4RWS C;  1RTO A;  1JE4 A;  1DOL A;  4OIJ A;  5D65 A;  1NCV A;  2KEE A;  3FPU B;  2X69 A;  2K01 A;  1F9S A;  1TVX A;  4HSV A;  5EKI A;  2Q8T A;  4CJ1 B;  3MWY W;  1PFB A;  4R9W A;  1U4L A;  1EIH A;  4HED A;  4LMQ D;  1X32 A;  4RAU C;  2L11 A;  3GV3 A;  1ICW A;  2BDN A;  2L12 A;  1U4P A;  4U68 A;  5T1G A;  2M2L A;  3SVM A;  3TZD A;  2RA4 A;  4R8I A;  3LWE A;  2K28 A;  2K1B A;  2L9H A;  1EQT A;  1NAP A;  2EOT A;  2KVM A;  4IUU A;  5E4X A;  1ESR A;  5EPJ A;  1WTV A;  1U4R A;  2N55 A;  5EQ0 A;  2CVR A;  2VXW A;  3DEO A;  3Q6S A;  1EL0 A;  5T1I A;  2RSO A;  4X3U A;  3I90 A;  1PFN A;  5EPL A;  1U4M A;  3R93 A;  1WTW A;  1PDQ A;  2RVL A;  3F2U A;  1KNE A;  3N52 A;  4IUV A;  1F9R A;  2K03 A;  1IL8 A;  2R3Z A;  1X3P A;  1AP0 A;  1DOM A;  1AZP A;  5COY A;  5JJZ A;  4X3K A;  2B2V A;  2HDL A;  4HAE A;  2H1E A;  4MN3 A;  2MGS A;  3MTS A;  1MI2 A;  1QG7 A;  3QO2 A;  4NW2 A;  1F9P A;  2IL8 A;  1HUM A;  1SAP A;  2HCI A;  2B2Y A;  2MPM A;  1MSG A;  4XT1 B;  1BO0 A;  2SDF A;  1HA6 A;  5D14 A;  1B2T A;  2FMM A;  4X3S A;  1IKL A;  1O80 A;  2EPB A;  2FJ2 A;  4ZK9 B;  4MHE A;  3IL8 A;  1WTR A;  1HHV A;  1B3A A;  2DY7 A;  2JYO A;  2X6L A;  5AFW A;  3G7L A;  4O42 A;  3ONA B;  1WVL A;  1M8A A;  2FFK B;  3HP3 A;  4HCS A;  1BNZ A;  1XX8 A;  3KBX A;  1C8C A;  1O7Z A;  1WTX A;  2B2U C; 
#chains in the Genus database with same CATH topology
 4DR5 L;  4UAI A;  5IT9 L;  2UUB L;  1Z7T A;  3RR5 A;  1STA A;  2CH4 W;  2LXJ A;  1UNS A;  3TRZ A;  3KK7 A;  2O2L D;  1Q82 C;  4DV4 Q;  1FR3 A;  1JQY D;  4NXM L;  5FJ8 G;  4JI0 L;  1PMR A;  1MJE A;  2R7F A;  1LUZ A;  4A3L H;  3G48 A;  3D6C A;  1STB A;  4YHH Q;  2ZXR A;  3F2C A;  1FNU A;  2FHT A;  4FNF A;  1LTG D;  3T1H L;  2A6E C;  1BBX C;  3Q23 A;  2A6H C;  1E1T A;  3AQQ A;  4QMG A;  1CQF A;  2CFM A;  1WCM G;  2B2W A;  1VMP A;  3F2B A;  2JP1 A;  2NWG A;  4FF2 A;  3SK8 A;  1PYS B;  4DV7 L;  2A73 B;  4DAY A;  1KAB A;  3HGB A;  2IJ0 A;  2LSS A;  2EJM A;  5FKA C;  2I07 B;  1JJG A;  2YU9 B;  1EWH A;  2AUJ D;  1ET9 A;  3K80 C;  4JBJ A;  4OON A;  1X3F A;  4RCN A;  4JV5 L;  1CKN B;  2IW3 A;  5CV7 A;  3S2D H;  1ICW A;  4G4K A;  3TRE A;  4DAM A;  3KBG A;  5JVG 3;  4XYQ A;  4DR2 L;  1ICF B;  5JAV A;  3BS1 A;  1HQR D;  3RZO B;  1GJX A;  1RL2 A;  4PZ6 A;  3NXW A;  5KRU A;  4BA1 I;  4R4Q A;  4P71 A;  2JA9 A;  1TII D;  3PGZ A;  1C7Y A;  2R92 H;  3RN5 A;  3STB D;  1YNX A;  5GQO A;  1FGU A;  1LTA D;  5IIF A;  2CWP A;  4NW2 A;  2IL8 A;  1E2V A;  4K5W A;  3GTK H;  1HZB A;  1VQ4 A;  1V1P B;  3M7G A;  3PIP A;  3A7A B;  3H94 A;  3MXP A;  1QVC A;  2R61 A;  2R92 B;  2X6L A;  5K36 H;  1UE1 A;  5ELD A;  1QNU A;  3TME A;  2NVX B;  1KDB A;  5COR A;  5M3M B;  2OQ0 A;  3ULP A;  4JC0 A;  3KJP A;  1K3R A;  3HKS A;  1RKN A;  1SNC A;  1PZJ D;  4DV0 Q;  2I46 A;  4XQJ A;  4JYA Q;  5M5Y B;  1SMX A;  1TWH B;  1PH1 A;  1XPO A;  1HRJ A;  1MKH A;  3NBH A;  3OSO A;  4A93 H;  3NSW A;  4QF4 A;  2K05 A;  3H0G H;  4IN3 A;  5FK9 C;  5BN4 A;  1P8L A;  2E2D C;  1XMO Q;  3L0O A;  2F0H A;  4XIG S;  2YTX A;  4KJN A;  2N8N A;  1A6X A;  4B9W A;  4ZQ3 A;  4KHZ A;  2RHQ B;  2Y0S B;  2B2T C;  4NP5 A;  3VYS A;  2QGQ A;  3LGJ A;  2WB1 G;  4A3M B;  1ML0 D;  5ELF A;  3HOZ B;  4NMZ A;  2JEA I;  3NK9 A;  4HR7 B;  1HCZ A;  4BBS H;  1MHW C;  1SE4 A;  4K2K A;  4MTN A;  1HQM C;  2Q8T A;  1GXD C;  1D2B A;  4C2M H;  4GN4 B;  2NN6 G;  1EIH A;  2F0I A;  4U68 A;  1U4P A;  1HNZ L;  2M2L A;  5BR8 L;  1MBY A;  5BN5 A;  4DV7 Q;  1KHI A;  3PUV A;  2BA1 A;  2EOT A;  1EWI A;  4AQY Q;  1EZ6 A;  1HR0 W;  3CCS A;  4IFD J;  3CCR A;  5HGT A;  4Z9C B;  1X9N A;  1D5X C;  1SJE D;  1EFI D;  2PZT A;  4IUV A;  1TWA B;  1B70 B;  1NY4 A;  3D0F A;  4A3C G;  5COY A;  1TU2 B;  2B2V A;  3PUW A;  4FYD A;  1VQ8 A;  4KD4 A;  5J3B A;  1D1K A;  4X6A H;  4XTC S;  3TP7 A;  3RLO A;  4PMW A;  2XVS A;  3CRK C;  1V43 A;  2SDF A;  3NTK A;  1HA6 A;  5C3E G;  5IT9 E;  3EFX D;  1YEZ A;  4HCE A;  4YWK A;  4OXP A;  1QUQ A;  5C6A A;  1QOH A;  1BR9 A;  1XMO L;  4KI0 A;  4RHS A;  3S24 A;  3IKJ A;  4RH6 A;  1PTO C;  2EDG A;  3CW2 C;  2XGT A;  4DN4 M;  5KEE A;  3OIP A;  1GUW A;  2K32 A;  1G6P A;  3OYY A;  2M9V A;  4DV5 L;  2B2W C;  4ZRZ A;  2JA7 H;  4NDX A;  1IBL Q;  2IHE A;  4FF1 A;  1FJG L;  4HMI A;  2K5Q A;  5C4Z A;  2K04 A;  4M8A A;  1A3V A;  3P1H A;  4CJ2 C;  5JEA G;  4JYA L;  1IZ6 A;  1VQN A;  2B39 A;  5C0X I;  2ZTE A;  4KV6 A;  4JBK A;  1SYD A;  1BCP D;  1JWU D;  1JWS D;  2D5D A;  2EVB A;  2O5J C;  4YY3 L;  1BOS A;  1EEF D;  3CC4 A;  1HNX L;  3K59 A;  4ALP A;  1TWG B;  4DNT B;  4OX9 Q;  2TMP A;  2IX1 A;  1ZYR D;  1JOK A;  1GM5 A;  1PH5 A;  4N9P A;  1ROD A;  4LFA L;  4XT3 B;  4DAP A;  1N34 Q;  2A19 A;  1EY0 A;  1O78 A;  4JG2 A;  4A3G G;  2NN6 I;  1BQQ T;  4AQY L;  1B9M A;  1YBY A;  1E24 A;  1I4R A;  1XPR A;  3M9B A;  1SYG A;  5E3F A;  4B3S Q;  1HZC A;  3WWV A;  1G91 A;  1NTG A;  2RDG A;  4B3R L;  3M4Y A;  4POF A;  3FVQ A;  4A3E H;  2NZ1 D;  4JBM A;  3MXG A;  4DV2 L;  3U4Z A;  3HOW H;  4WJW A;  1Q8K A;  1Q1E A;  1DOL A;  4H7B A;  5EKI A;  3I4M H;  1GUG A;  2R6G A;  4DR3 L;  1R4Q B;  4ZCK A;  4R9W A;  1U4L A;  1X32 A;  3FEW X;  3MVV A;  4RAU C;  5CV4 A;  2UXD L;  5M3M H;  4DV6 Q;  1E1O A;  4LAA A;  4OO1 I;  3SE0 A;  4IUU A;  3KDF A;  1EEI D;  1VQO A;  1Y8O B;  5T1I A;  4LJZ C;  5G3L F;  1FGB D;  4OWT B;  3X3N A;  5EKL A;  2Z8L A;  4RGM A;  5EPL A;  4DNI A;  5ELN A;  1PDQ A;  1STH A;  2BDO A;  3BVG A;  4CKB A;  2A68 C;  3N52 A;  2PZW A;  5I2Y A;  2E2J B;  1Q7Y C;  3S1Q B;  1A8V A;  1AZP A;  1IBM Q;  1G8Z D;  2UXC Q;  1YZ6 A;  5C44 H;  1GHK A;  1TXY A;  4A3D B;  4BY1 B;  1ONL A;  1B1Z A;  3F8T A;  3I4N G;  4QJF A;  2K4K A;  1IW7 D;  1VQH A;  1II3 A;  2EPB A;  2NBF A;  3RZO H;  1ENF A;  4KTA A;  3CC7 A;  1JB3 A;  1PRT D;  2AQ3 B;  4V19 0;  4A93 B;  2GVB A;  3D4D A;  1RDP D;  3W1B A;  3C2P A;  4I65 A;  3T1H Q;  1B8A A;  5M5Y H;  3GTP H;  1RF2 D;  2XIW A;  2AQ1 B;  3TP8 A;  1VCI A;  2JA7 G;  3U9O A;  2NVQ B;  4DA2 A;  2K5D A;  3GTJ B;  5M3F G;  4JOI C;  3PO3 B;  4X3T A;  1LV9 A;  1C0A A;  2F0F A;  2NZH A;  3H0G G;  3VR2 A;  2ICI A;  3T53 B;  4A3B H;  2CQA A;  1YJN A;  1V1P A;  4CDD C;  1PTO H;  4OEL B;  1BF4 A;  2XTI A;  3HOX G;  4TQU S;  2HQL A;  2RDF A;  1STG A;  3MZ5 A;  3MXU A;  4GZY C;  5IGE A;  2A69 D;  3N6R A;  2F0L A;  1J5E Q;  3AYH B;  3HOV G;  3D8G A;  3PIP 3;  3T1Y L;  2CKZ B;  4R4T A;  1L1O A;  5EBC A;  1E7Z A;  5E4W C;  4FVM A;  1GHJ A;  4KKS A;  4QIW E;  3CCQ A;  3ERS X;  1JB7 A;  5ISR A;  2ZJQ A;  4WRD A;  1H9M A;  3RMH A;  4LFC Q;  2K5V A;  3K5N A;  4WJ3 M;  4LF4 L;  2Z1C A;  3SXH A;  2K33 A;  3UE0 A;  2EYF A;  4DR4 L;  1L0X B;  2YTY A;  2XN9 C;  3BVZ A;  3GDE A;  5C3E B;  3I4N H;  3NBH B;  1IBK Q;  4OEM B;  3G4S A;  2VQE L;  3GTL B;  2ZTD A;  2Z6B A;  4GNX A;  4DV1 L;  4R8I A;  4H44 C;  1EY4 A;  1EWC A;  3MXN B;  4X62 L;  2RSO A;  4NXN L;  5IGF A;  3AU7 A;  3OPO A;  4O0A A;  5IGD A;  1EY9 A;  5C3E H;  3I4N B;  2QIL A;  2PI2 A;  5C5L A;  1EUJ A;  3VYR A;  5A35 A;  3DWQ A;  4G7O C;  4AYB B;  4EQ5 A;  1PH7 A;  3I56 A;  4A3C H;  1SMY C;  1B2T A;  1D5M C;  2ALY B;  5C0X H;  4XXE A;  4C3H B;  1VQ5 A;  2F4V Q;  4H13 C;  1PH2 A;  1VDZ A;  2CW0 C;  1C8C A;  1Y8P B;  3KF8 A;  5FLX L;  5K5P A;  1YNN D;  4ZUI A;  1Y8N B;  3I8Z A;  2Q8R E;  3PF5 A;  1Y1V B;  4DU9 A;  3TSS A;  3ERO A;  1JC7 A;  1STE A;  1KL9 A;  3HS0 C;  4OIK A;  5HUR A;  2EIF A;  2NVQ H;  1XNR Q;  4M1U B;  3L9A X;  1D6E C;  2MJ8 A;  1BDO A;  1T5E A;  4LFB Q;  2NVT B;  3H6M A;  5EPK A;  1T5X D;  2UU9 Q;  4A3L G;  1YJ9 A;  4Q0F A;  1L0W A;  3CQZ B;  4WFN 3;  5KND A;  3VDY A;  2EY6 A;  3TDQ A;  5JEA H;  5K36 G;  1HH2 P;  1HPC A;  1K0R A;  3F1Z A;  2EXD A;  1WTO A;  1A2U A;  3W2D A;  1YNJ C;  4K6D A;  3EQL C;  1D8L A;  1TWC H;  4OWW B;  1WI5 A;  2R92 G;  2K6A A;  5I4D A;  1HNZ Q;  4LW1 A;  5ELB A;  4KHP L;  3HRZ C;  1HR0 L;  1LAC A;  3CPW A;  1DCZ A;  3BDO A;  1CQV A;  5AJ3 L;  1I4Q A;  2KEE A;  3JAM E;  2K01 A;  4CJ1 B;  4JW0 A;  2JXM B;  3BDL A;  4HJ7 A;  2GA4 B;  3KFU A;  1ESF A;  2A1A A;  3MHB A;  1PYB A;  3SVM A;  5T1G A;  3KF6 A;  1PV4 A;  3F2D A;  1OXT A;  1AEX A;  1I50 B;  3CCV A;  1L1O B;  2NTT A;  4KY5 A;  1FD7 D;  2DUD A;  2PQE A;  1A3T A;  4DV6 L;  5C3X A;  5IGC A;  4OO1 G;  2I0Q A;  1KXL A;  2M00 A;  4YWL A;  3DMU A;  3LNN A;  1LYL A;  3EJI A;  4X3U A;  5H1S E;  3Q22 A;  1Y69 U;  1YHQ A;  1TWF H;  3P75 A;  1YVC A;  4IFD H;  3T16 A;  2D2C C;  3S14 B;  2EJG C;  5EAY A;  3KLS A;  4MN3 A;  3QO2 A;  2F0K A;  1MSG A;  2LKV A;  4GNX C;  1TY0 A;  5LL6 S;  3UDI A;  1CFM A;  2WB1 B;  4A75 A;  1WTR A;  2DY7 A;  1BCP B;  3L3O C;  3CCE A;  2OXP A;  2ASB A;  3DXJ C;  4PMB A;  1STY A;  3QG1 A;  1BNZ A;  3G6J B;  4L8J A;  2B2Y C;  4FDB A;  3HOV B;  4KN7 C;  1RTN A;  4DKA C;  3HOY B;  4UP7 A;  3I4O A;  1RD9 D;  3S1N B;  1T9H A;  2L0C A;  2D9U A;  4BY1 H;  1Z9F A;  2EYH A;  4JI0 Q;  2B63 B;  2RKS A;  4KY6 A;  4DR7 L;  1VQ9 A;  4DV3 L;  2N3S A;  4A4I A;  1Y1W B;  4A3I B;  3S1Q H;  1KNA A;  1I50 H;  4IUQ A;  1W3S A;  3E0J A;  1FJG Q;  2FIN B;  1WTP A;  5LMU L;  2MO0 A;  4LWC A;  1N32 Q;  4CKE A;  4LF8 L;  2F52 A;  3KF8 B;  5C4X H;  4EQN A;  3PUX A;  5NUC A;  4HTH A;  4YCU A;  2C9O A;  1DM0 B;  4OWX B;  4QL5 A;  4ME3 A;  4LF6 Q;  3FKI B;  1XJV A;  4FP5 D;  4APV A;  3KOJ A;  1QE6 A;  3A55 A;  3I73 A;  1EY5 A;  2KOL A;  4KKT A;  4JI6 L;  5JJI A;  3KLS X;  1KAA A;  4O2D A;  4IUP A;  1CKN A;  4AYB G;  3M4O B;  2JA8 B;  5M3M G;  2IT1 A;  2BH2 A;  1HA5 A;  3MWY W;  1S40 A;  4AH6 A;  1AW7 A;  2F3I A;  3TEH B;  1HR0 Q;  2NTS A;  2NVT H;  3J7Y W;  4K8I A;  1Q12 A;  2QF7 A;  5C5M A;  4HJA A;  2PQA A;  2D0P A;  4DV1 Q;  1AFP A;  3CP0 A;  4BBR G;  1K83 H;  2L15 A;  1N34 L;  1L1O C;  2AQ2 B;  4MTK A;  1UWV A;  5M3F H;  4RKL A;  3F2U A;  1E3P A;  4YIJ A;  2JQO A;  2NUC A;  4IQZ A;  3S15 H;  2JA7 B;  3SHL A;  3FHW A;  2OTL A;  2Z9H A;  1HUM A;  1C9O A;  3CU7 A;  5IP7 H;  3PO3 G;  4ILW A;  3E6Z X;  4X65 Q;  2EYL A;  1Y14 B;  3S1N H;  2RF4 A;  5KNC A;  4GNX B;  3CPF A;  3CCL A;  4CDC C;  2KEN A;  3K0Y A;  4YCW A;  2AUK A;  4R1J A;  2EYO A;  4RKB A;  1K73 C;  5FOB B;  1I5F A;  4NKL A;  1ZXT A;  1OXV A;  1G6Z A;  2GN5 A;  1B4O A;  3J80 i;  2DN8 A;  1TS2 A;  4G7Z C;  3KUP A;  3QJY A;  1X3Q A;  3NQI A;  3CQZ H;  4C1N K;  1QJO A;  1TWA H;  5DNF A;  1SEB D;  1SXT A;  1HZA A;  4RGN A;  1TWH H;  3VYU A;  5CMD A;  2E2I B;  2NZO A;  4E6I A;  3GTL H;  1B50 A;  3QOL A;  1XWE A;  1TQO A;  3S1R B;  3A8K E;  4YWM A;  1CA5 A;  2JA6 B;  2H4O A;  2NVX H;  1SRU A;  1IYJ B;  2ZJP A;  3RLF A;  1LLR D;  1YNJ D;  3ND8 A;  2WKC A;  2HHH Q;  4LUZ A;  1H9K A;  2HDM A;  4ZLT F;  1K28 A;  2HUG A;  4PZ7 A;  1GVP A;  3I4M G;  1I4P A;  1E0B A;  3S2H H;  3GTK B;  2N49 A;  1S5E D;  4K8J A;  4XDX A;  1SYE A;  5JPN C;  1ENC A;  3P20 A;  4C3H H;  3HZX A;  1NE3 A;  4YCV A;  4K6L A;  1V1Q A;  2VQF L;  1PXU A;  3QB3 A;  4DXF A;  1I4X A;  1E22 A;  1VQ6 A;  1CKM A;  4S3S A;  5M5X H;  3MFG A;  1Q90 A;  2ZTC A;  4EGV A;  1QZH A;  3Q0A A;  1L0Y B;  3TZD A;  2K28 A;  3MC0 B;  3NBI A;  4RFB A;  3H0G B;  2BCO A;  1NAP A;  1CHQ D;  5BN3 A;  3TBI B;  5GRO A;  2UXD Q;  1ASZ A;  2JA5 H;  1EL0 A;  1BKB A;  4H02 A;  3HOX B;  2K75 A;  2JA5 B;  1A0I A;  1U4M A;  1JOQ A;  2KBN A;  3ULL A;  1L2F A;  1I3Q B;  3NHH A;  1N32 L;  1Q1B A;  3LX0 A;  3CAM A;  5LMU Q;  4POG A;  4X3K A;  4JI1 L;  3HKZ B;  1KDC A;  3J81 L;  2VQF Q;  1HXY D;  4FXD A;  2B8G A;  3HOU G;  3JC6 6;  3S1M H;  1VF5 C;  1Q8I A;  4A3K G;  4GLA C;  2SEB D;  3BZC A;  4A3G B;  1KRS A;  2ZXP A;  5D14 A;  4IAL A;  5KYI A;  3H3V C;  3BJU A;  4GKK L;  5L37 A;  5HGQ A;  1B3A A;  3PQI A;  4XQQ A;  4DV3 Q;  4MIU A;  2K14 A;  5ELO A;  3ONA B;  5FO9 B;  1QCB D;  1EFW A;  3SGI A;  1CTM A;  3KBX A;  2HHH L;  1V8Q A;  4GS3 A;  5FO8 B;  4LK1 C;  1QIL A;  3KLW A;  1HFG A;  1ET6 A;  3WDN A;  4DF7 A;  2PYK A;  2JK8 A;  3NTI A;  1VQE A;  3M85 A;  1IYU A;  4FXG C;  4ZAI A;  3X3M A;  1FVI A;  4LF5 Q;  4BA2 I;  2ENB A;  4K14 A;  5JPM C;  5CYU A;  2E2H H;  4B3T Q;  3OW2 A;  1M90 C;  4HID A;  1XNR L;  2A6E D;  3OOC A;  3NEL A;  1LM0 A;  2B3G A;  1N33 Q;  2B2U A;  3I4M B;  1VQL A;  2I5H A;  2EYM A;  1LTB D;  3BZD B;  4AYB E;  2OF1 A;  3H91 A;  2YU9 H;  1NUC A;  2WAQ E;  5IYC G;  1XYI A;  5JVH 3;  3TZU A;  3DM3 A;  1YHB A;  1LTL A;  3DHQ A;  1C4Q A;  2IY5 B;  2F0P A;  2HD3 A;  4OHJ A;  2PNH A;  1SBB B;  4TKO B;  5IYC H;  4K0K Q;  2JSO A;  4OIJ A;  1NCV A;  5CC4 A;  2B29 A;  1M1K C;  3G71 A;  1DJR D;  3VR4 A;  5C44 B;  1TY2 A;  3A0J A;  1FNW A;  2A8V A;  1O7L A;  1K9M C;  2EY5 A;  1S5C D;  5IY0 A;  4KLK A;  2QEX A;  2RA4 A;  3GTO H;  3T13 A;  3S2H B;  4J8Q A;  2C5C A;  4C3I G;  5E4X A;  4IFD G;  4BXX G;  1UE5 A;  1DXM A;  4DPG A;  3K58 A;  4OL7 A;  3HOU B;  4L5S A;  1A2T A;  1CKO A;  1H9R A;  1BXT A;  1VF7 A;  3NUC A;  2EXZ A;  4A3M G;  3URY A;  3PO3 H;  3EN2 A;  4LF7 Q;  2E2I H;  1QWY A;  1XNQ Q;  2Q8I B;  4R4I A;  4DNR B;  1MI2 A;  3I70 A;  4LF9 Q;  2VZA A;  3SDZ A;  4RHR A;  4GN3 B;  3M4O H;  4DAY B;  1IKL A;  3GTP B;  1GUO A;  1CHP D;  1PH9 A;  3K0X A;  3J7A 5;  4HCS A;  1AH9 A;  1R9T H;  1O7Z A;  1WTX A;  2B2U C;  3DEP A;  2VB3 X;  1ASY A;  1Z6H A;  3FKI H;  4DUZ Q;  1XPU A;  1SYC A;  4JI2 Q;  1NNX A;  1PHJ A;  4BS9 A;  2KA7 A;  2Z6K C;  5IE8 A;  5J22 A;  3UDX A;  3FPP A;  1SMY D;  3B6Y A;  3FKI G;  3ITP A;  4CBV A;  2VUM B;  2LS0 1;  2HCC A;  5EKK A;  2R93 H;  1CZG A;  1WYD A;  4GLV B;  1JMC A;  4LF9 L;  1JJ2 A;  1KIX A;  1MD2 D;  2CCZ A;  2R7Z H;  1DOK A;  1OXU A;  4WJ4 A;  4KJO A;  5I6Y A;  5EJW A;  1G2S A;  4RA8 A;  2LY7 A;  4CJ0 B;  1I4H A;  2J4X A;  2K5H A;  1BVS A;  2B63 H;  5G3L D;  4A3B B;  1VMC A;  2A68 D;  4X62 Q;  2F0E A;  4IO9 A;  2XRQ D;  4Y52 H;  3S17 H;  2OQK A;  1HNW L;  1S5F D;  2OEO A;  5CGK A;  4IOA A;  1PYW D;  4NPS A;  2F0G A;  3HKZ G;  2VQE Q;  3UDG A;  4IFD I;  4QQB X;  4C3I H;  4DR6 Q;  1IBK L;  2EYP A;  2SNS A;  2ES2 A;  2EY1 A;  3CD6 A;  3Q8D A;  3GTG H;  4FXK C;  2FMC A;  3FPU B;  4HSV A;  1BBW A;  3SK6 A;  3C1E A;  4EVO A;  2BE5 C;  3GV3 A;  1Y1W G;  2F3W A;  4IPD A;  1N36 L;  4DR2 Q;  2HIX A;  3IFT A;  3D3R A;  3S16 B;  2R7Z G;  1ZEQ X;  3OTO Q;  3WOF A;  1SN8 A;  2WKD A;  2UUA L;  2CVR A;  2P5Z X;  2PO4 A;  4A3D H;  2JE6 I;  3MEH A;  4EQO A;  3ICE A;  4HN7 A;  2PCF B;  4DK0 A;  1W2B A;  4LF8 Q;  3TP6 A;  4A3K H;  2AMC B;  4A3J H;  2KQ3 A;  1YHA A;  4PG3 A;  4I7Z C;  4C2M B;  4KHP Q;  1V1O A;  4K5V A;  2YYZ A;  2ZM6 Q;  1KRT A;  4ME5 A;  1WTH A;  3PSI A;  5FLX E;  5AFW A;  2PW5 A;  2MQH A;  1H9J A;  3HP3 A;  4N9T A;  4C56 C;  4OO1 H;  1HFN A;  3GV6 A;  3RN2 A;  2L5T A;  3NQT A;  5LMN Q;  4A3E B;  1IKM A;  4DK3 C;  4A3F G;  3HOV H;  3FDT A;  1X54 A;  2N88 A;  5IGB A;  1NR2 A;  4GKK Q;  3K5M A;  4P73 A;  2ZM6 L;  4DV4 L;  3OW7 A;  1QVG A;  1B7Y B;  4UPA A;  2VNU D;  5IP9 H;  1GOZ A;  3CMA A;  1DD2 A;  3S14 H;  1MIU A;  2F0O A;  1LT4 D;  4C3H G;  4JI1 Q;  4JI2 L;  1H9S A;  3IFD A;  3AMU A;  5ELC A;  1WCM B;  1BUV T;  3ND9 A;  4AIM A;  4LUV A;  4Y7N B;  3RNU A;  3MAQ A;  1JOR A;  1HUN A;  1EY6 A;  1N8R C;  4P72 A;  1VS0 A;  2UUC Q;  2KHJ A;  5KGU A;  1CA6 A;  4JI7 L;  2PNR C;  3CHB D;  3L7Z C;  3H09 A;  4GN5 A;  3E9I A;  2R7D A;  2ZJR A;  2ID0 A;  2C35 B;  1F2Y A;  3GD7 A;  4L5R C;  1JE4 A;  1KLU D;  4P2C B;  2Q2T A;  4FF3 A;  1TVX A;  4ZYS A;  1X6O A;  4NXN Q;  3HOY G;  1VQD A;  1A62 A;  3OWE B;  3PCO B;  2L12 A;  3D4W A;  4FF4 A;  3I4L A;  1MJC A;  3K5L A;  2JEB I;  2EYJ A;  1LT3 D;  1LTS D;  1EQT A;  5D3I B;  1VQC A;  2E74 C;  3K6O A;  2VXW A;  3DEO A;  2RCN A;  2ZT9 C;  3OHX C;  3HG9 A;  2VY3 A;  4LFA Q;  3R93 A;  4KKU A;  4J15 A;  4DR4 Q;  3J81 j;  5IP7 G;  3R2T A;  4XQN A;  3NWS A;  4Q5V A;  3WOE A;  2QEJ C;  4JI6 Q;  1UEB A;  1KTK A;  2HCI A;  1VQP A;  2EJF C;  4KY7 A;  2QCP X;  1EYG A;  1O80 A;  4ZK9 B;  4LF6 L;  1Y1V H;  2K52 A;  2WV6 D;  3TQY A;  4JCV E;  2RCF A;  1GUS A;  1PTO D;  4UP9 A;  3HOW G;  3NWT A;  4LNQ A;  4A3B G;  2Q2U A;  4JI4 Q;  4QUC A;  3ULJ A;  1IXR A;  1JIC A;  4J1M A;  3STB C;  3OMG A;  2IX3 A;  3M3Y B;  1D5Z C;  4QUF A;  4DR5 Q;  1LTR D;  4N8X 1;  4X66 L;  2DNC A;  1J9O A;  2A5H A;  2UXB L;  3NE5 B;  5HY6 A;  2I5M X;  4IPG A;  2BA0 A;  3HEJ A;  3KDF B;  2WFW A;  1AZQ A;  3M3Y H;  1QVF A;  2AKW B;  3M4P A;  1CI3 M;  2JA5 G;  5A2Q E;  5C0X J;  1LTT D;  2KHI A;  2YTV A;  4QGU A;  4JI3 L;  5IOC A;  4LF7 L;  1SSO A;  2F0T A;  1Q81 C;  2XNA C;  3E3X A;  3GTJ H;  4G57 A;  1FYC A;  3S1M B;  2PZU A;  1ZYR C;  4IPH A;  3NEN A;  1I4G A;  2EZV A;  5DLQ E;  1AN8 A;  1AE3 A;  1X65 A;  2VW9 A;  4BBR H;  4A3I G;  2HQE A;  3DUZ A;  3HOX H;  1FNV A;  2F0U A;  2IHF A;  1IBM L;  1WD0 A;  4F7X A;  1RTO A;  3PIO 3;  1WFQ A;  5D65 A;  1VQF A;  1PH4 A;  3MEF A;  1NJI C;  4K0K L;  3CC2 A;  4HED A;  5IWA Q;  4RG1 A;  3DWA A;  2E2H B;  2KCC A;  2ZXO A;  3LWE A;  2K1B A;  3CXC A;  1TKW B;  3GTQ B;  2H5X A;  3AEV A;  4UP8 A;  4R4C A;  2YV5 A;  4HIO A;  5IYD G;  4A3E G;  2CW0 D;  1KNE A;  2K03 A;  1IL8 A;  1X3P A;  2JA6 G;  2XWJ B;  1HTP A;  3PIO A;  4ZUJ A;  3RD4 A;  1JT8 A;  1JJC B;  3PO2 G;  4BY7 H;  3BU2 A;  1K83 B;  4Y7N H;  4A3G H;  2B2Y A;  4WOR A;  3BDC A;  1HNW Q;  3MA2 B;  1XTC D;  2NN6 H;  4QB4 A;  4PV1 C;  1VQK A;  2FMM A;  2HIV A;  1JOO A;  4DUY Q;  1IW7 C;  1KAW A;  4C1N I;  2FFK B;  5LMN L;  2R3Z A;  4HIM A;  5C0X G;  1CT1 D;  1E2Z A;  1JR0 D;  2MUY A;  1SYB A;  3I3C A;  1V9P A;  4KD3 A;  2JA8 H;  1PH3 A;  4L63 B;  3UI2 A;  2UU9 L;  1RJT A;  1K8O A;  1PA6 A;  4JBW A;  2FXQ A;  1PVO A;  5C4H A;  1WD1 A;  1KLG D;  1NSN S;  5A2Q L;  2DY8 A;  2RHS B;  3PV0 A;  2ATW A;  1LAB A;  4HJ8 A;  1TWG H;  4IUR A;  2L55 A;  1N9W A;  4PMC A;  3JAM i;  5LMN W;  2EE1 A;  1O7Y A;  1MGS A;  3RZD B;  4GLX A;  3RLN A;  1KDA A;  5CV6 A;  3VR3 A;  1TS3 A;  5IP9 G;  2Z4I A;  3DWP A;  2SNM A;  1S3O A;  2L4N A;  3T56 B;  3VR5 A;  3VA5 A;  1XTD A;  3K81 C;  1G2T A;  2R7Z B;  3I91 A;  4L6T B;  1Z47 A;  4A3K B;  1VQM A;  4JI8 L;  2WB1 E;  2F0W A;  3I55 A;  2G5D A;  4CHT B;  3BYT B;  5GAH C;  1GO3 E;  1VQG A;  3M4Q A;  2IWH A;  3PF4 A;  1SE2 A;  2VUM H;  4PNY A;  4RWS C;  5GAG C;  4X64 L;  4B3M L;  1PFB A;  4CDE C;  1G29 1;  5I2X A;  1VQA A;  3CME A;  1H9S B;  1TS4 A;  4MNO A;  3FMC A;  1SR3 A;  1TR5 A;  2BE5 D;  2CHB D;  5BR8 Q;  1U4R A;  2AHO B;  3C3L A;  3GP7 A;  5EQ0 A;  1SNP A;  3AFQ A;  2KJX A;  4IUN A;  4BBS G;  1LTI D;  2RVL A;  1OXX K;  1DYQ A;  4X64 Q;  4OX9 L;  1IL2 A;  3W3A A;  3K7A B;  3U50 C;  3EVQ A;  2K5W A;  2F0V A;  2CQO A;  2F0S A;  3OWF A;  2MGS A;  4JK1 C;  1QG7 A;  4ODG A;  4LFB L;  2JA8 G;  2MPM A;  2WAC A;  3ERQ A;  1BO0 A;  4LUO A;  4O1N A;  2AWO A;  2A6H D;  3OMC A;  2UUC L;  3S15 B;  4F8M A;  4RGO S;  1K8M A;  3A5U A;  3GTO B;  4PZ8 A;  1DZ1 A;  2X6G A;  2UUB Q;  4DUZ L;  4A3I H;  3DM1 A;  1MSH A;  2OWO A;  2R93 B;  4JI5 L;  3ER0 A;  3KF6 B;  1SND A;  3D6W A;  1E2W A;  2SOB A;  1ZKO A;  3HOY H;  3FP9 A;  5J39 A;  1YI2 A;  5LL6 X;  5IYD H;  1PRT C;  5I6W A;  3TS0 A;  3J81 i;  4DR7 Q;  1GD7 A;  1PH8 A;  2O4X A;  1KQS A;  3J7A V;  3GQB A;  1R9T B;  1EU3 A;  1R4P B;  3MXN A;  3S9W A;  2G9H D;  3V2T A;  5I9P A;  2J7Z A;  5TSS A;  2V4D A;  1PH6 A;  3IRB A;  1OXS C;  3D31 A;  2GVA A;  1CSP A;  3S17 B;  3GTM B;  3E9H A;  1X56 A;  4UDU C;  5C4X B;  2Y0S E;  2F0D A;  2NVY H;  1EYD A;  4KMU C;  4IPC A;  3U4V A;  5CBE E;  1QB5 D;  2F1M A;  5FO7 B;  1S4Z A;  4L5T A;  4EX5 A;  2KUM A;  4A3D G;  2Q2I A;  5KYL A;  4B3M Q;  1U5K A;  5E1F A;  1F9S A;  2WAQ B;  3GTQ H;  5DAU A;  3PUY A;  1SFO B;  1EQV A;  1PTO F;  1PRT B;  1EQQ A;  1GKH A;  1Y1W H;  4TRD A;  3ZYY X;  1QZG A;  2UUA Q;  4BBS B;  2VB2 X;  3KLR A;  3CCM A;  2L9H A;  1P16 A;  3A54 A;  2E75 C;  4JI8 Q;  3H3V I;  1SE3 A;  5EPJ A;  4A3M H;  1N36 Q;  2QDL A;  1SLJ A;  1K8G A;  2A74 C;  3Q6S A;  3R3O A;  1JE5 A;  3I90 A;  1PFN A;  5E7N A;  1TT2 A;  1EIF A;  1EU4 A;  2G9D A;  4DR3 Q;  3A8I E;  1X3G A;  1SNM A;  1TWC B;  1BBU A;  1VQI A;  4MZ9 A;  1N33 L;  3TP5 A;  4BBR B;  2HDL A;  5AJ3 Q;  3A7L A;  4DV2 Q;  3S2D B;  3PO2 H;  4U67 3;  5C44 G;  3MTS A;  4G7H C;  1JWM D;  5KIX A;  2F0N A;  3W1G A;  3J81 c;  4B3S L;  2AWN A;  1SYF A;  5LHY 1;  2WIN B;  4DXG A;  3VR6 A;  3IL8 A;  2JYO A;  4LF5 L;  2N78 A;  4KHV A;  1YIJ A;  2XRS D;  4IOC A;  3J80 c;  1TWF B;  1XX8 A;  2QKI C;  3V05 A;  1CK1 A;  3K7U C;  5M9O A;  1SRO A;  1HNX Q;  3BZK A;  5CR3 A;  2KCM A;  4QY7 A;  4ABN A;  5M5X B;  1QUQ B;  4JI3 Q;  2O5I C;  4EQP A;  2RSN A;  2NYZ D;  2F0J A;  5IGG A;  1U9R A;  3M7N A;  1SJH D;  1K8A C;  1J8I A;  2OCE A;  1O7I A;  2Z6K A;  3CCJ A;  1IBL L;  2I5L X;  4DV5 Q;  1PFM A;  4HIK A;  4RMF A;  3LWU A;  1GUT A;  3NEM A;  4JI5 Q;  4GKJ L;  1KC8 C;  4UY8 C;  3O13 A;  2PPB C;  4IUT A;  1RHP A;  3T4A C;  4TVA B;  1PRT F;  2Z0S A;  2NVY B;  3AFP A;  1Q46 A;  2JA6 H;  1EIY B;  1ILQ A;  4GOP C;  5D3D A;  3K57 A;  1I6V C;  1F2M A;  2VUM G;  2NB0 A;  5JOB A;  1EZ8 A;  2MO1 A;  3J80 L;  2HT1 A;  2F4I A;  2KEC A;  2XWB B;  4JPB W;  5DM6 3;  4JV5 Q;  4F88 A;  2BOS A;  4JVZ A;  2E5L Q;  3PMF A;  4BXX H;  3W5O A;  1F2Z A;  1OO9 B;  2X69 A;  3OIQ A;  3L2P A;  2MNA A;  4OGQ C;  4ULL A;  2TSS A;  3PO2 B;  3NTH A;  1UE6 A;  4LMQ D;  3H15 A;  2BDN A;  2F03 A;  4A3J G;  2WP8 J;  2PI2 E;  1D1I A;  5M5W B;  3V96 A;  4L5Q A;  2V1C C;  5EBD A;  4A76 A;  1W6K A;  1HTL D;  2A69 C;  1A63 A;  4JOI A;  1Y1V G;  3QR8 A;  1FL0 A;  4N8F A;  2VL6 A;  5FLM G;  1NMG A;  1DOM A;  4CGY B;  2E2J H;  2OTJ A;  2B8F A;  2LXK A;  1SFO H;  2EY2 A;  4LFC L;  1AE2 A;  4PQX A;  1SAP A;  5M3F B;  1S72 A;  4XT1 B;  3JAM c;  4X3S A;  4HJ9 A;  2Y0S G;  1YJW A;  1SNQ A;  1U0L A;  3CCU A;  1WVL A;  3K5O A;  3S1R H;  5JEA J;  3A5Z B;  2JJQ A;  4B9X A;  2EQS A;  1LT6 D;  5IOD A;  3HOZ G;  2D62 A;  1I3Q H;  1PZI D;  1BCP C;  1DGS A;  4KK7 A;  3FRP B;  1F9Q A;  2CH4 A;  4BY7 G;  1WCM H;  1QNK A;  2J0T D;  1K0S A;  3D4R A;  1CUK A;  1WJJ A;  2F4V L;  3R8B A;  1RIP A;  3U58 A;  1GUN A;  1NBW A;  2VS1 A;  2DJF C;  4B3T L;  3R2I A;  1F2L A;  3A8J E;  1B9N A;  2PQA B;  4C3J H;  1VQ7 A;  1BCP F;  3K8A A;  3MFY A;  3IAY A;  1B53 A;  1EYA A;  1XNQ L;  2QW7 A;  1A15 A;  4RCO A;  1DON A;  3TN2 A;  3C46 A;  4CDF C;  2B2V C;  1S5D D;  5JJK A;  2CWA A;  3U9S A;  1WTQ A;  1A3U A;  2MP1 A;  4J6H A;  2DGY A;  3J80 E;  4DUY L;  3G6E A;  4V0B A;  1VQB A;  4A3F B;  1I94 Q;  3VA7 A;  1XMQ Q;  2BH8 A;  3E0E A;  1M4V A;  4A93 G;  4GOP B;  4DFA A;  1EQR A;  3SK5 A;  2F0Q A;  2RQX A;  5JJL A;  3ZJY C;  3C1F A;  4HMJ A;  1X55 A;  2UXC L;  1PTO B;  3A74 A;  1I6H B;  4FO2 A;  4QIW B;  4DR1 Q;  1STN A;  4A3J B;  1EOV A;  4H0L C;  4LF4 Q;  2E5L L;  3GTM H;  1S5B D;  2E8G A;  4ID6 A;  5C4J B;  1F77 A;  5EGT A;  4R4O A;  1Q86 C;  1WOC A;  1H95 A;  2KVM A;  3JAM L;  3A56 A;  1ESR A;  1CZW A;  1WTV A;  5KNB A;  2RDH A;  3T1Y Q;  3SEB A;  3SK4 A;  4HJ5 A;  2ICE C;  4IJL A;  5IYB G;  2QDB A;  1J5E L;  2MFI A;  3GTG B;  1WTW A;  4C3I B;  2R93 G;  5CV5 A;  1F9R A;  4DR1 L;  2K50 A;  4GKJ Q;  1UAP A;  2H1E A;  4TSS A;  3EA6 A;  5C4J H;  1TS5 A;  4B08 A;  4HSP A;  3DLL A;  2PMZ E;  3UE1 A;  2DJG C;  2FJ2 A;  3EIV A;  4MHE A;  3PUZ A;  2JN4 A;  1HZ9 A;  3G7L A;  3NPP A;  4BY7 B;  2D0O A;  1X3E A;  1B44 D;  2XSC A;  4DV0 L;  1UEA B;  1EIG A;  4CKC A;  4NB3 A;  4C3J G;  4A3F H;  1Q3L A;  4YHH L;  2RBM A;  3CRL C;  1NR4 A;  4R8N A;  3BYY B;  1J6Q A;  2KHS A;  5J1Z A;  1PFS A;  4P74 A;  5DEH A;  3BVM A;  2KED A;  4BWG B;  1ILP A;  1SDF A;  3J81 E;  5DM7 3;  2L1B A;  3SR1 A;  4IJH A;  5FLX c;  1EYC A;  1YIT A;  3I7F A;  3KJO A;  4KN4 C;  4ZKC B;  1PLF A;  1CM9 A;  2WAQ G;  3HOW B;  5IT9 c;  2F0M A;  3RUZ A;  3BG3 A;  3S16 H;  1W6J A;  2WII B;  4JI4 L;  1G51 A;  1IHZ A;  1SE8 A;  2K7V A;  3UDF A;  3VYT A;  2Z4H A;  3J7Z C;  1VQJ A;  1LT5 D;  4K2L A;  3J7A F;  2QA4 A;  1EY8 A;  4ZKB B;  4DK1 A;  4P75 A;  2PW7 A;  1PZK D;  4BY1 G;  3OTO L;  3P7J A;  2LMC B;  1K3B C;  1UUP A;  3AB9 A;  5CBA E;  4X65 L;  2PMZ B;  3I2Z A;  1OTC A;  3E5S A;  2OT2 A;  4QCL A;  5FLM H;  1EOT A;  5IWA L;  2MHV A;  2B2T A;  2DNE A;  4DAV A;  3HKZ E;  1I6H H;  1LO5 D;  1D7Q A;  3CF5 A;  2F3V A;  1IYV A;  1UE7 A;  5GAD C;  5F2D A;  4DR6 L;  2K5N A;  2L11 A;  3HOU H;  4B3R Q;  5C3W A;  2Q2H A;  2KCT A;  1XMQ L;  1JCK B;  1SNO A;  3I72 A;  3Q24 A;  1I94 L;  3QOJ A;  2N55 A;  3HOZ H;  4DGZ A;  3CKI B;  3NP8 A;  2KCN A;  3QIA A;  1EY7 A;  5IYB H;  5GAE C;  4GOP A;  2IPK D;  1ENA A;  1NMF A;  3EBE A;  2IX0 A;  4UHV A;  3RZD H;  5CV8 A;  3QWN A;  1AP0 A;  3K7A H;  5M5W H;  5JJZ A;  1B3Q A;  4YY3 Q;  4DK6 C;  1KD1 C;  4HAE A;  2B63 G;  1YNN C;  4I7A A;  4RGT A;  1CSQ A;  5CV9 A;  1C48 A;  1F9P A;  2LFN A;  4NXM Q;  1XXG A;  4XYO A;  4JI7 Q;  4F87 A;  4IZ8 A;  3T51 B;  5C4X G;  3GO5 A;  3KYH C;  4K5X A;  1HHV A;  4C3J B;  5I9O A;  3HFZ B;  5ELE A;  5FJ8 H;  2UXB Q;  3H3V H;  4O42 A;  2E76 C;  1M8A A;  4X66 Q;  1HJP A;  1RCV D;  3TS2 A; 
#chains in the Genus database with same CATH homology
 4UAI A;  5IT9 L;  1Z7T A;  1STA A;  1UNS A;  3KK7 A;  2O2L D;  1FR3 A;  1JQY D;  1PMR A;  3D6C A;  1STB A;  2ZXR A;  1FNU A;  2FHT A;  4FNF A;  1LTG D;  2A6E C;  1BBX C;  3Q23 A;  2A6H C;  4QMG A;  1CQF A;  2B2W A;  1VMP A;  2JP1 A;  2NWG A;  4FF2 A;  3SK8 A;  2A73 B;  4DAY A;  1KAB A;  3HGB A;  2IJ0 A;  2EJM A;  5FKA C;  2I07 B;  2YU9 B;  1EWH A;  2AUJ D;  1ET9 A;  4RCN A;  2IW3 A;  5CV7 A;  1ICW A;  4G4K A;  3KBG A;  5JVG 3;  4XYQ A;  5JAV A;  3BS1 A;  1HQR D;  3RZO B;  1GJX A;  3NXW A;  5KRU A;  4BA1 I;  1TII D;  1LTA D;  5IIF A;  4NW2 A;  2IL8 A;  1E2V A;  4K5W A;  1V1P B;  3M7G A;  3A7A B;  3H94 A;  3MXP A;  2R61 A;  2R92 B;  2X6L A;  5K36 H;  5ELD A;  1QNU A;  3TME A;  2NVX B;  1KDB A;  5COR A;  5M3M B;  1RKN A;  1SNC A;  1PZJ D;  2I46 A;  4XQJ A;  5M5Y B;  1TWH B;  1HRJ A;  3NBH A;  3OSO A;  3NSW A;  4QF4 A;  2K05 A;  4IN3 A;  5FK9 C;  5BN4 A;  2E2D C;  2F0H A;  4XIG S;  4KJN A;  1A6X A;  4B9W A;  4ZQ3 A;  4KHZ A;  2Y0S B;  2B2T C;  4NP5 A;  3VYS A;  4A3M B;  1ML0 D;  5ELF A;  3HOZ B;  4NMZ A;  2JEA I;  3NK9 A;  4HR7 B;  1HCZ A;  1SE4 A;  4K2K A;  1HQM C;  2Q8T A;  1GXD C;  1D2B A;  2NN6 G;  1EIH A;  2F0I A;  4U68 A;  1U4P A;  2M2L A;  1MBY A;  5BN5 A;  3PUV A;  2BA1 A;  2EOT A;  1EZ6 A;  4IFD J;  5HGT A;  4Z9C B;  1D5X C;  1SJE D;  1EFI D;  2PZT A;  4IUV A;  1TWA B;  5COY A;  1TU2 B;  2B2V A;  3PUW A;  4FYD A;  4KD4 A;  1D1K A;  4XTC S;  3TP7 A;  4PMW A;  2XVS A;  3CRK C;  1V43 A;  2SDF A;  3NTK A;  1HA6 A;  5IT9 E;  3EFX D;  4HCE A;  5C6A A;  1QOH A;  1BR9 A;  4KI0 A;  4RHS A;  3IKJ A;  4RH6 A;  1PTO C;  2EDG A;  4DN4 M;  5KEE A;  3OIP A;  1GUW A;  2K32 A;  2M9V A;  2B2W C;  4ZRZ A;  4NDX A;  4FF1 A;  4HMI A;  2K5Q A;  5C4Z A;  2K04 A;  4M8A A;  1A3V A;  3P1H A;  4CJ2 C;  5JEA G;  2B39 A;  5C0X I;  4KV6 A;  1SYD A;  1BCP D;  1JWU D;  1JWS D;  2D5D A;  2EVB A;  2O5J C;  1BOS A;  1EEF D;  3K59 A;  1TWG B;  4DNT B;  2TMP A;  2IX1 A;  1ZYR D;  1JOK A;  4N9P A;  1ROD A;  4XT3 B;  4DAP A;  1EY0 A;  1O78 A;  2NN6 I;  1BQQ T;  1B9M A;  1I4R A;  1SYG A;  5E3F A;  1G91 A;  2RDG A;  3M4Y A;  3FVQ A;  2NZ1 D;  3MXG A;  4WJW A;  1Q1E A;  1DOL A;  4H7B A;  5EKI A;  1GUG A;  2R6G A;  1R4Q B;  4R9W A;  1U4L A;  1X32 A;  3FEW X;  3MVV A;  4RAU C;  5CV4 A;  4LAA A;  4OO1 I;  3SE0 A;  4IUU A;  1EEI D;  1Y8O B;  5T1I A;  4LJZ C;  5G3L F;  1FGB D;  3X3N A;  5EKL A;  2Z8L A;  4RGM A;  5EPL A;  1PDQ A;  1STH A;  2BDO A;  3BVG A;  4CKB A;  2A68 C;  3N52 A;  2PZW A;  5I2Y A;  2E2J B;  3S1Q B;  1AZP A;  1G8Z D;  1GHK A;  4A3D B;  4BY1 B;  1ONL A;  1B1Z A;  1IW7 D;  1II3 A;  2EPB A;  2NBF A;  1ENF A;  4KTA A;  1JB3 A;  1PRT D;  2AQ3 B;  4V19 0;  4A93 B;  3D4D A;  1RDP D;  3C2P A;  4I65 A;  1RF2 D;  2XIW A;  2AQ1 B;  3TP8 A;  1VCI A;  3U9O A;  2NVQ B;  4DA2 A;  2K5D A;  3GTJ B;  3PO3 B;  4X3T A;  1LV9 A;  2F0F A;  3VR2 A;  2ICI A;  3T53 B;  2CQA A;  1V1P A;  1PTO H;  1BF4 A;  4TQU S;  2RDF A;  1STG A;  3MZ5 A;  3MXU A;  4GZY C;  5IGE A;  2A69 D;  3N6R A;  2F0L A;  3D8G A;  3PIP 3;  5EBC A;  5E4W C;  4FVM A;  1GHJ A;  4KKS A;  5ISR A;  4WRD A;  1H9M A;  3RMH A;  3K5N A;  2Z1C A;  3SXH A;  2K33 A;  2EYF A;  1L0X B;  2XN9 C;  3BVZ A;  5C3E B;  3GTL B;  4R8I A;  4H44 C;  1EY4 A;  1EWC A;  2RSO A;  5IGF A;  3AU7 A;  3OPO A;  5IGD A;  1EY9 A;  3I4N B;  2QIL A;  5C5L A;  3VYR A;  5A35 A;  3DWQ A;  4G7O C;  4AYB B;  1SMY C;  1B2T A;  1D5M C;  5C0X H;  4XXE A;  4C3H B;  4H13 C;  1VDZ A;  2CW0 C;  1C8C A;  1Y8P B;  3KF8 A;  5FLX L;  5K5P A;  1YNN D;  4ZUI A;  1Y8N B;  3I8Z A;  2Q8R E;  1Y1V B;  4DU9 A;  3TSS A;  3ERO A;  1JC7 A;  1STE A;  3HS0 C;  5HUR A;  4OIK A;  4M1U B;  3L9A X;  1D6E C;  2MJ8 A;  1BDO A;  1T5E A;  2NVT B;  3H6M A;  5EPK A;  1T5X D;  4Q0F A;  3CQZ B;  4WFN 3;  5KND A;  2EY6 A;  3TDQ A;  5JEA H;  5K36 G;  1HPC A;  1WTO A;  1A2U A;  3W2D A;  1YNJ C;  4K6D A;  3EQL C;  2K6A A;  5I4D A;  5ELB A;  3HRZ C;  1LAC A;  1DCZ A;  3BDO A;  1CQV A;  1I4Q A;  2KEE A;  3JAM E;  2K01 A;  4CJ1 B;  2JXM B;  3BDL A;  2GA4 B;  1ESF A;  3MHB A;  3SVM A;  5T1G A;  1OXT A;  1AEX A;  1I50 B;  2NTT A;  4KY5 A;  1FD7 D;  2PQE A;  1A3T A;  5C3X A;  5IGC A;  4OO1 G;  2M00 A;  3DMU A;  3LNN A;  4X3U A;  3EJI A;  3Q22 A;  1Y69 U;  3P75 A;  4IFD H;  3T16 A;  2D2C C;  3S14 B;  2EJG C;  3KLS A;  4MN3 A;  3QO2 A;  2F0K A;  1MSG A;  2LKV A;  1TY0 A;  5LL6 S;  1CFM A;  2WB1 B;  1WTR A;  2DY7 A;  1BCP B;  3L3O C;  2OXP A;  3DXJ C;  4PMB A;  1STY A;  1BNZ A;  3QG1 A;  3G6J B;  4L8J A;  2B2Y C;  3HOV B;  4KN7 C;  1RTN A;  3HOY B;  1RD9 D;  3S1N B;  2L0C A;  2D9U A;  2EYH A;  2B63 B;  2RKS A;  4KY6 A;  1Y1W B;  4A3I B;  1KNA A;  4IUQ A;  3E0J A;  2FIN B;  1WTP A;  4CKE A;  4EQN A;  3PUX A;  5NUC A;  4HTH A;  2C9O A;  1DM0 B;  3FKI B;  4FP5 D;  1QE6 A;  3A55 A;  3I73 A;  1EY5 A;  2KOL A;  4KKT A;  3KLS X;  1KAA A;  4IUP A;  3M4O B;  2JA8 B;  2IT1 A;  1HA5 A;  3MWY W;  1AW7 A;  2NTS A;  3J7Y W;  4K8I A;  1Q12 A;  2QF7 A;  5C5M A;  1AFP A;  2AQ2 B;  4RKL A;  3F2U A;  4YIJ A;  2NUC A;  4IQZ A;  2JA7 B;  3SHL A;  3CU7 A;  1HUM A;  4ILW A;  3E6Z X;  2EYL A;  5KNC A;  3K0Y A;  2AUK A;  2EYO A;  4RKB A;  5FOB B;  4NKL A;  1ZXT A;  1OXV A;  1G6Z A;  1B4O A;  2DN8 A;  1TS2 A;  4G7Z C;  3KUP A;  3QJY A;  1X3Q A;  3NQI A;  4C1N K;  1QJO A;  5DNF A;  1SEB D;  1SXT A;  4RGN A;  3VYU A;  5CMD A;  2E2I B;  4E6I A;  1B50 A;  3QOL A;  1XWE A;  1TQO A;  3S1R B;  1CA5 A;  3A8K E;  2JA6 B;  2H4O A;  3RLF A;  1LLR D;  1YNJ D;  3ND8 A;  2WKC A;  1H9K A;  2HDM A;  4ZLT F;  2HUG A;  1I4P A;  1E0B A;  3GTK B;  1S5E D;  4K8J A;  4XDX A;  1SYE A;  5JPN C;  1ENC A;  3P20 A;  3HZX A;  4K6L A;  1PXU A;  3QB3 A;  4DXF A;  1I4X A;  4S3S A;  3MFG A;  1Q90 A;  4EGV A;  3Q0A A;  1L0Y B;  3TZD A;  2K28 A;  3MC0 B;  3NBI A;  4RFB A;  3H0G B;  2BCO A;  1NAP A;  1CHQ D;  5BN3 A;  3TBI B;  1EL0 A;  3HOX B;  2JA5 B;  1U4M A;  1JOQ A;  3NHH A;  1I3Q B;  1Q1B A;  3LX0 A;  4X3K A;  3HKZ B;  1KDC A;  3J81 L;  1HXY D;  4FXD A;  2B8G A;  1VF5 C;  1Q8I A;  2SEB D;  4A3G B;  2ZXP A;  5D14 A;  4IAL A;  5KYI A;  3H3V C;  1B3A A;  4XQQ A;  4MIU A;  3ONA B;  5FO9 B;  1QCB D;  1CTM A;  3KBX A;  1V8Q A;  5FO8 B;  4LK1 C;  1QIL A;  1HFG A;  4DF7 A;  3WDN A;  1ET6 A;  2PYK A;  3NTI A;  3M85 A;  1IYU A;  4FXG C;  4ZAI A;  3X3M A;  4BA2 I;  2ENB A;  4K14 A;  5JPM C;  5CYU A;  2A6E D;  3OOC A;  2B2U A;  3I4M B;  2EYM A;  1LTB D;  3BZD B;  2OF1 A;  3H91 A;  1NUC A;  1XYI A;  5JVH 3;  3TZU A;  3DHQ A;  1C4Q A;  2F0P A;  4OHJ A;  1SBB B;  4TKO B;  2JSO A;  4OIJ A;  1NCV A;  5CC4 A;  1DJR D;  3VR4 A;  5C44 B;  1TY2 A;  1FNW A;  1O7L A;  2EY5 A;  1S5C D;  2RA4 A;  3T13 A;  3S2H B;  4J8Q A;  2C5C A;  4C3I G;  5E4X A;  4IFD G;  1DXM A;  3K58 A;  4OL7 A;  3HOU B;  1A2T A;  1H9R A;  1BXT A;  1VF7 A;  3NUC A;  2EXZ A;  3URY A;  1QWY A;  2Q8I B;  4DNR B;  1MI2 A;  3I70 A;  3SDZ A;  4RHR A;  1IKL A;  3GTP B;  1GUO A;  1CHP D;  4HCS A;  1O7Z A;  1WTX A;  2B2U C;  3DEP A;  2VB3 X;  1Z6H A;  1SYC A;  4BS9 A;  2KA7 A;  5J22 A;  3FPP A;  1SMY D;  3ITP A;  4CBV A;  2VUM B;  2LS0 1;  2HCC A;  5EKK A;  1CZG A;  1MD2 D;  1DOK A;  1OXU A;  4KJO A;  5I6Y A;  5EJW A;  1G2S A;  4RA8 A;  2LY7 A;  4CJ0 B;  1I4H A;  2J4X A;  5G3L D;  4A3B B;  1VMC A;  2A68 D;  2F0E A;  2XRQ D;  1S5F D;  2OEO A;  5CGK A;  1PYW D;  2F0G A;  4IFD I;  2EYP A;  2SNS A;  2EY1 A;  4FXK C;  2FMC A;  3FPU B;  4HSV A;  3SK6 A;  3C1E A;  4EVO A;  2BE5 C;  3GV3 A;  2F3W A;  3IFT A;  3D3R A;  3S16 B;  1ZEQ X;  3WOF A;  2WKD A;  2CVR A;  2PO4 A;  2JE6 I;  3MEH A;  4EQO A;  4HN7 A;  2PCF B;  4DK0 A;  3TP6 A;  2KQ3 A;  4I7Z C;  4C2M B;  1V1O A;  4K5V A;  2YYZ A;  4ME5 A;  5FLX E;  5AFW A;  2PW5 A;  1H9J A;  3HP3 A;  4N9T A;  4C56 C;  4OO1 H;  1HFN A;  3GV6 A;  2L5T A;  3NQT A;  4A3E B;  1IKM A;  3FDT A;  2N88 A;  5IGB A;  1NR2 A;  3K5M A;  3OW7 A;  2VNU D;  1GOZ A;  1DD2 A;  2F0O A;  1LT4 D;  4C3H G;  1H9S A;  3IFD A;  3AMU A;  5ELC A;  1WCM B;  1BUV T;  3ND9 A;  4Y7N B;  3MAQ A;  1JOR A;  1HUN A;  1EY6 A;  5KGU A;  1CA6 A;  2PNR C;  3CHB D;  3L7Z C;  3H09 A;  2ID0 A;  1F2Y A;  3GD7 A;  1JE4 A;  1KLU D;  4P2C B;  4FF3 A;  1TVX A;  4ZYS A;  3OWE B;  2L12 A;  3D4W A;  4FF4 A;  3I4L A;  3K5L A;  2JEB I;  2EYJ A;  1LT3 D;  1LTS D;  1EQT A;  5D3I B;  2E74 C;  3K6O A;  2VXW A;  3DEO A;  2ZT9 C;  3OHX C;  3HG9 A;  3R93 A;  4KKU A;  3R2T A;  4XQN A;  3NWS A;  4Q5V A;  3WOE A;  2QEJ C;  1KTK A;  2HCI A;  2EJF C;  4KY7 A;  2QCP X;  1O80 A;  4ZK9 B;  2WV6 D;  1GUS A;  1PTO D;  3NWT A;  4QUC A;  1JIC A;  4J1M A;  3OMG A;  2IX3 A;  3M3Y B;  1D5Z C;  4QUF A;  1LTR D;  2DNC A;  1J9O A;  2A5H A;  3NE5 B;  2BA0 A;  3HEJ A;  1AZQ A;  1CI3 M;  5A2Q E;  5C0X J;  1LTT D;  5IOC A;  1SSO A;  2F0T A;  2XNA C;  4G57 A;  1FYC A;  3S1M B;  2PZU A;  1ZYR C;  1I4G A;  2EZV A;  1AN8 A;  2HQE A;  3DUZ A;  1FNV A;  2F0U A;  1WD0 A;  4F7X A;  1RTO A;  3PIO 3;  5D65 A;  4HED A;  3DWA A;  2E2H B;  2KCC A;  2ZXO A;  3LWE A;  2K1B A;  1TKW B;  3GTQ B;  2CW0 D;  1KNE A;  2K03 A;  1IL8 A;  1X3P A;  2XWJ B;  1HTP A;  4ZUJ A;  3RD4 A;  1K83 B;  2B2Y A;  4WOR A;  3BDC A;  3MA2 B;  1XTC D;  2NN6 H;  4QB4 A;  4PV1 C;  2FMM A;  1JOO A;  1IW7 C;  4C1N I;  2FFK B;  2R3Z A;  5C0X G;  1CT1 D;  1E2Z A;  1JR0 D;  2MUY A;  1SYB A;  3I3C A;  4KD3 A;  4L63 B;  3UI2 A;  1RJT A;  1K8O A;  4JBW A;  5C4H A;  1WD1 A;  1KLG D;  5A2Q L;  1NSN S;  2DY8 A;  3PV0 A;  1LAB A;  4IUR A;  2L55 A;  4PMC A;  2EE1 A;  1O7Y A;  1MGS A;  3RZD B;  1KDA A;  5CV6 A;  3VR3 A;  1TS3 A;  2Z4I A;  3DWP A;  2SNM A;  2L4N A;  3T56 B;  3VR5 A;  3VA5 A;  1G2T A;  2R7Z B;  3I91 A;  1Z47 A;  4L6T B;  4A3K B;  2F0W A;  4CHT B;  3BYT B;  2IWH A;  1SE2 A;  4PNY A;  4RWS C;  1PFB A;  1G29 1;  5I2X A;  1H9S B;  1TS4 A;  3FMC A;  1TR5 A;  2BE5 D;  2CHB D;  1U4R A;  3C3L A;  3GP7 A;  5EQ0 A;  1SNP A;  2KJX A;  4IUN A;  1LTI D;  2RVL A;  1OXX K;  1DYQ A;  3W3A A;  3K7A B;  3EVQ A;  2K5W A;  2F0V A;  2F0S A;  3OWF A;  2MGS A;  4JK1 C;  1QG7 A;  4ODG A;  2MPM A;  2WAC A;  3ERQ A;  1BO0 A;  4O1N A;  2AWO A;  2A6H D;  3OMC A;  3S15 B;  4F8M A;  4RGO S;  1K8M A;  3GTO B;  1DZ1 A;  2X6G A;  3DM1 A;  1MSH A;  2R93 B;  1SND A;  3D6W A;  1E2W A;  2SOB A;  1ZKO A;  5J39 A;  5LL6 X;  1PRT C;  5I6W A;  2O4X A;  3J7A V;  3GQB A;  1R9T B;  1EU3 A;  1R4P B;  3MXN A;  3S9W A;  2G9H D;  3V2T A;  5I9P A;  2J7Z A;  5TSS A;  2V4D A;  1OXS C;  3D31 A;  3S17 B;  3GTM B;  4UDU C;  5C4X B;  2F0D A;  1EYD A;  4KMU C;  5CBE E;  1QB5 D;  2F1M A;  5FO7 B;  1S4Z A;  2KUM A;  5KYL A;  5E1F A;  1F9S A;  2WAQ B;  5DAU A;  3PUY A;  1SFO B;  1EQV A;  1PTO F;  1PRT B;  4TRD A;  3ZYY X;  4BBS B;  2VB2 X;  3KLR A;  2L9H A;  3A54 A;  2E75 C;  1SE3 A;  5EPJ A;  2A74 C;  3Q6S A;  3R3O A;  3I90 A;  1PFN A;  1TT2 A;  1EU4 A;  2G9D A;  3A8I E;  1SNM A;  1TWC B;  3TP5 A;  4BBR B;  2HDL A;  3A7L A;  3S2D B;  4U67 3;  4G7H C;  3MTS A;  1JWM D;  5KIX A;  2F0N A;  2AWN A;  1SYF A;  5LHY 1;  2WIN B;  4DXG A;  3VR6 A;  3IL8 A;  2JYO A;  4KHV A;  2XRS D;  1TWF B;  1XX8 A;  2QKI C;  3V05 A;  1CK1 A;  5M9O A;  5CR3 A;  5M5X B;  4ABN A;  2O5I C;  4EQP A;  2RSN A;  2NYZ D;  2F0J A;  5IGG A;  1U9R A;  3M7N A;  1SJH D;  1J8I A;  1PFM A;  3LWU A;  1GUT A;  3O13 A;  2PPB C;  4IUT A;  1RHP A;  3T4A C;  1PRT F;  2NVY B;  1ILQ A;  5D3D A;  3K57 A;  1I6V C;  1F2M A;  2NB0 A;  5JOB A;  1EZ8 A;  3J80 L;  2F4I A;  2KEC A;  2XWB B;  5DM6 3;  4F88 A;  2BOS A;  3PMF A;  1F2Z A;  1OO9 B;  2X69 A;  3OIQ A;  4OGQ C;  4ULL A;  2TSS A;  3PO2 B;  3NTH A;  4LMQ D;  2BDN A;  2F03 A;  2WP8 J;  1D1I A;  5M5W B;  3V96 A;  5EBD A;  1W6K A;  1HTL D;  2A69 C;  1DOM A;  4CGY B;  2B8F A;  2EY2 A;  4PQX A;  1SAP A;  5M3F B;  4XT1 B;  4X3S A;  1SNQ A;  1WVL A;  3K5O A;  5JEA J;  4B9X A;  1LT6 D;  5IOD A;  2D62 A;  1PZI D;  1BCP C;  4KK7 A;  3FRP B;  1F9Q A;  1QNK A;  2J0T D;  3D4R A;  3R8B A;  1GUN A;  3R2I A;  1F2L A;  3A8J E;  1B9N A;  1BCP F;  3MFY A;  3IAY A;  1B53 A;  1EYA A;  1A15 A;  4RCO A;  1DON A;  3TN2 A;  3C46 A;  2B2V C;  1S5D D;  3U9S A;  1WTQ A;  1A3U A;  2MP1 A;  4J6H A;  3J80 E;  4V0B A;  4A3F B;  3VA7 A;  1M4V A;  4DFA A;  3SK5 A;  2F0Q A;  2RQX A;  3C1F A;  4HMJ A;  1PTO B;  1I6H B;  4FO2 A;  4QIW B;  1STN A;  4A3J B;  4H0L C;  1S5B D;  4ID6 A;  5C4J B;  1F77 A;  5EGT A;  3JAM L;  2KVM A;  3A56 A;  1ESR A;  1CZW A;  1WTV A;  5KNB A;  2RDH A;  3SEB A;  3SK4 A;  2ICE C;  2QDB A;  3GTG B;  1WTW A;  4C3I B;  5CV5 A;  1F9R A;  1UAP A;  2H1E A;  4TSS A;  3EA6 A;  1TS5 A;  4B08 A;  4HSP A;  2FJ2 A;  4MHE A;  3PUZ A;  3G7L A;  3NPP A;  4BY7 B;  1B44 D;  2XSC A;  1UEA B;  1EIG A;  4CKC A;  4C3J G;  1Q3L A;  2RBM A;  3CRL C;  1NR4 A;  4R8N A;  3BYY B;  2KHS A;  5J1Z A;  5DEH A;  3BVM A;  2KED A;  4BWG B;  1ILP A;  1SDF A;  3J81 E;  5DM7 3;  2L1B A;  3SR1 A;  1EYC A;  4KN4 C;  4ZKC B;  1PLF A;  3HOW B;  1CM9 A;  2F0M A;  3RUZ A;  3BG3 A;  1W6J A;  2WII B;  1IHZ A;  2K7V A;  3VYT A;  2Z4H A;  1LT5 D;  4K2L A;  3J7A F;  1EY8 A;  4ZKB B;  4DK1 A;  2PW7 A;  1PZK D;  3P7J A;  2LMC B;  1UUP A;  3AB9 A;  5CBA E;  2PMZ B;  3E5S A;  2OT2 A;  4QCL A;  1EOT A;  2MHV A;  2B2T A;  2DNE A;  4DAV A;  1LO5 D;  2F3V A;  1IYV A;  5F2D A;  2L11 A;  5C3W A;  1JCK B;  1SNO A;  3I72 A;  3Q24 A;  3QOJ A;  2N55 A;  4DGZ A;  3CKI B;  3NP8 A;  2KCN A;  3QIA A;  1EY7 A;  2IPK D;  1ENA A;  2IX0 A;  5CV8 A;  3QWN A;  1AP0 A;  5JJZ A;  4HAE A;  1YNN C;  4RGT A;  5CV9 A;  1C48 A;  1F9P A;  2LFN A;  1XXG A;  4XYO A;  4F87 A;  4IZ8 A;  3T51 B;  3GO5 A;  1HHV A;  4K5X A;  4C3J B;  5I9O A;  5ELE A;  4O42 A;  2E76 C;  1M8A A;  1RCV D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...