4HCSA

Structure of novel subfamily cx chemokine solved by sulfur sad
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
PGVCFKVLTTKEPKANIKRCYNLPKTNNCLKCVLFVDASNRMKCIDPNASWLAERLYRLKEKGVTCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Uncharacterized protein
publication title Structural insight into the evolution of a new chemokine family from zebrafish.
pubmed doi rcsb
source organism Danio rerio
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hcsA00
1RJTA 5AFWA 2X6LA 5DNFA 2FMMA 3R93A 1ILQA 2HDLA 1GUWA 1ESRA 1A15A 5EPJA 1E0BA 4ZK9B 1IKMA 4IUUA 4RWSC 1IL8A 1WTWA 3ONAB 5CBAE 3I8ZA 1JICA 1X3PA 1LV9A 1NR4A 2XIWA 1RODA 2B2VC 1QNKA 4IUVA 1VMPA 1B50A 1NR2A 1PFNA 2J7ZA 4ZAIA 2NZ1D 3TN2A 1CA5A 1AP0A 4U68A 1EL0A 2B2WA 2VXWA 2N88A 2K04A 3KBXA 2KECA 5EQ0A 2B2UA 2FINB 2SDFA 4MN3A 1QE6A 2KUMA 3IFDA 4RAUC 4XDXA 2KEEA 1KNEA 4UAIA 2FJ2A 1WTRA 1QG7A 2L4NA 3I91A 3N52A 5COYA 3QO2A 2EPBA 4LMQD 1WTOA 1BF4A 1HHVA 3GV6A 2JYOA 4DN4M 1BNZA 3F2UA 4ZKBB 1ILPA 2MJ8A 2R3ZA 3DEOA 2K1BA 1XYIA 2NWGA 5E4WC 4MHEA 4OIJA 1AZPA 1J8IA 3MWYW 2NYZD 1F9SA 1G6ZA 2B2VA 1SSOA 1VMCA 4RA8A 1EIHA 1PLFA 2MP1A 2FHTA 1NCVA 3Q6SA 1F2LA 1MSGA 1O7ZA 2B2YC 1X3QA 4X3UA 5D14A 1B4OA 4R9WA 1MGSA 2IL8A 3G7LA 1JE4A 3KUPA 1MI2A 2KVMA 4HEDA 3UI2A 2K01A 2BDNA 1S4ZA 2RSOA 1WVLA 1WTVA 1F9RA 2KOLA 3MTSA 2EE1A 2RVLA 4QUCA 1U4LA 5EPKA 1PFMA 3IL8A 2B2TC 2X69A 1DZ1A 4HSVA 1Q3LA 1WD0A 1J9OA 1G2SA 5EKIA 3GV3A 3SVMA 1WD1A 3FDTA 1WTXA 4XT3B 1IKLA 4HAEA 5CMDA 3H91A 2FFKB 1SDFA 2N55A 1WTPA 1NAPA 1XX8A 2H1EA 2L12A 2HCCA 4X3TA 4XT1B 4ZLTF 2HUGA 5T1GA 3DEPA 4CJ1B 1HFGA 4NW2A 1U4MA 1DOMA 1ICWA 5CORA 2B2YA 3DM1A 1DONA 1B2TA 1HUNA 1MSHA 5CBEE 1CA6A 1F9QA 2Q8TA 4R8IA 1SAPA 2B2TA 1U4RA 4HCSA 1HA6A 5EPLA 3FPUB 5EJWA 1BBXC 1HFNA 2RA4A 2D9UA 2DY8A 2X6GA 3I3CA 4IUTA 4IUQA 1HUMA 2L9HA 2L1BA 2DY7A 2KEDA 2L11A 3I90A 2MPMA 3P7JA 2EOTA 1RTNA 4IUPA 5E4XA 2HCIA 3D6WA 1G2TA 1O7YA 1M8AA 2MGSA 4IURA 5D65A 4QUFA 1CM9A 1DOKA 1DOLA 1EQTA 2CVRA 2K03A 4CJ0B 4OIKA 1WTQA 1B53A 1RHPA 1C8CA 4X3SA 1ZXTA 1EIGA 4CJ2C 3HP3A 1HRJA 3LWEA 1ML0D 1KNAA 1RTOA 5JJZA 4X3KA 3TZDA 4ZKCB 4O42A 2K28A 1G91A 1PDQA 1O80A 1X32A 2K05A 2B2WC 1EOTA 1U4PA 1F9PA 2HDMA 2RSNA 5T1IA 1AZQA 2JP1A 1B3AA 1PFBA 2M2LA 1BO0A 2Q8RE 2B2UC 1TVXA
chains in the Genus database with same CATH superfamily
1IBMQ 2IX3A 4QCLA 5JVG3 1XPOA 5A2QL 5K36G 2K52A 1B3QA 4CDFC 4DV7Q 2A6ED 1OTCA 4A3LH 1EFID 1EY9A 1LUZA 2I5MX 3TMEA 1PRTB 4EX5A 4HMJA 4K5XA 3VR2A 1PFNA 3CW2C 2EY2A 3TDQA 3PSIA 3KK7A 3RN2A 3VYTA 4XDXA 3NBHB 2KCCA 2K32A 2PQAA 5C4HA 1SNDA 2E8GA 5IP7G 2A19A 3BYYB 1BNZA 1CK1A 1A3VA 1U0LA 2K1BA 4L8JA 5E4WC 1D1IA 1GOZA 2EXDA 1H95A 4UP7A 2PZWA 1E3PA 2Z9HA 2F0TA 2EYHA 1MSGA 4ZK9B 3GTJB 2ZXPA 3A54A 3OHXC 2KVMA 1Q12A 2R7ZG 4C3JG 3GTQB 5KRUA 4Q5VA 3SVMA 3OYYA 3A8KE 5CMDA 2YTXA 1PH3A 1LTSD 3H91A 4S3SA 5JPMC 3QOJA 1J5EL 5C5MA 2ZJQA 4YCVA 4X3TA 2IHEA 1TKWB 1K28A 1HNWL 5C44H 1K83B 1XWEA 1DONA 2EYJA 1HNWQ 2KHSA 4DV6L 4P75A 4A3IB 4FP5D 1GJXA 2MQHA 4J1MA 5GADC 3CCUA 4DV6Q 1JJGA 5EPLA 4M1UB 3R8BA 1SMYD 3MXGA 2UUAL 1BBUA 1BQQT 4LFAL 1KLUD 1X6OA 1JQYD 4DNRB 4GNXB 1TU2B 2JA8B 4OIKA 4LFAQ 2NVXB 1JOQA 3J7ZC 4HJ7A 1EIGA 4CJ2C 2CH4A 1VF5C 1H9KA 2R92G 3T51B 4H02A 1EYGA 5FLXE 5C4XB 4PMCA 5IGCA 4DFAA 3BZCA 1JT8A 1TR5A 2V4DA 4ZYSA 3EIVA 2LKVA 1IKMA 5CC4A 2XRQD 2IY5B 2XIWA 3S2HB 3I72A 4BXXG 1YIJA 3VA5A 2F0JA 3KF6B 4FYDA 3I4NH 2KECA 3BYTB 2NVYB 3M4OB 4A3EB 4RAUC 1CQVA 3N6RA 1KNEA 1C0AA 2EYMA 1Q82C 1TXYA 2QGQA 3S1RH 4PV1C 3NTIA 3GV6A 2JYOA 2KQ3A 2R3ZA 2SNMA 1STYA 3F8TA 2NWGA 3W3AA 2LS01 2HD3A 3EROA 4OONA 4CDEC 2EY1A 3RLNA 3DWPA 3FEWX 3TP5A 2IT1A 4NDXA 1UE5A 3I4MH 3OIPA 4C1NI 1XJVA 3HOWG 1GUOA 1IL2A 4PNYA 4KJOA 4G4KA 3GD7A 5A2QE 4DR2L 5E1FA 4ZQ3A 2YTVA 1EYCA 4DR2Q 3A0JA 1XMOL 1PH4A 2B3GA 3STBC 2E74C 4XYQA 1EY0A 2SEBD 5GQOA 5EAYA 4K2KA 1XMOQ 5C3EG 1SYFA 3DMUA 4GKKL 2B2YA 4PQXA 1SMYC 1K0RA 1B2TA 3QB3A 5DEHA 1I50B 1JWUD 4GKKQ 4APVA 2F0UA 3VR5A 3HOXB 3PQIA 3KOJA 4TVAB 3T4AC 1B9MA 1I5FA 1QJOA 2K5DA 1L0XB 3FKIG 1M1KC 1KDAA 3P7JA 4YCWA 3CC4A 5C4JH 1G2TA 3MC0B 1T5XD 1M8AA 3MVVA 3HOYG 3J7YW 3K7AH 2VZAA 4QMGA 5JEAJ 2NVQH 1P16A 2B2WC 1PH1A 1EWIA 5M5WH 4IFDI 2Q8RE 4BBSH 1TIID 5AFWA 2X6LA 3W1BA 4KHVA 4KV6A 1PA6A 2F3IA 3R93A 5IYBG 1G8ZD 4BS9A 1B7YB 3H3VC 1WJJA 2XGTA 4CKBA 3Q8DA 1Z6HA 1H9JA 3DXJC 4JBKA 1STAA 1PRTC 3CQZH 3LWUA 3EA6A 1X3GA 3HOVG 1Y1WB 4JI3L 4GLVB 4JC0A 4U68A 3S2DH 4YWLA 2RHSB 3NK9A 4CBVA 1YI2A 4JI3Q 4A3FG 1EZ8A 3HOZH 4A4IA 5DM63 5IWAL 1VQJA 1LTBD 4OO1I 4DR1L 3QO2A 2F0WA 3TS0A 1HHVA 5L37A 1JCKB 2B63B 4KY7A 1KABA 5IWAQ 4TRDA 2M9VA 4DR1Q 3J81j 5I9OA 3H0GG 4JI0L 3RZOH 1SSOA 4OXPA 1Y8PB 5FK9C 1TS5A 4X3UA 1X3FA 1B4OA 4JI0Q 1B9NA 4NB3A 4R4QA 5J22A 1XNRL 2KOLA 4DNIA 1LT3D 5C44B 1PH7A 3S1NH 4AYBB 3MEHA 1PTOD 2VB2X 3ZJYC 3VDYA 1XNRQ 1D7QA 1WTXA 3A55A 2D5DA 3J80c 4K5VA 3A56A 1VQBA 1Y1VH 2R6GA 2RCNA 1XX8A 2L12A 5CV6A 4NKLA 2QCPX 1QVFA 4B9WA 4DAMA 4A3BG 2F0MA 2D2CC 1NSNS 1B44D 3BZDB 1K3BC 4F88A 4AQYL 3NPPA 2F3WA 4OGQC 4BY1G 2OXPA 1SAPA 5G3LF 1VQGA 3DWAA 4AQYQ 1OXTA 2X6GA 3I3CA 1I6HH 3QR8A 2D0PA 2BCOA 1KAAA 1UE7A 5IYCH 2N78A 4IPGA 1STEA 5HURA 4CJ0B 2K03A 1WTQA 1VQHA 4X3SA 5J1ZA 4G7HC 3GTOH 2VQFL 1Q90A 1X32A 1Z7TA 2ID0A 4HIKA 5H1SE 4IUNA 2LY7A 2M2LA 2VQFQ 2KJXA 3T1YQ 1XNQL 1GUGA 1BCPF 2XNAC 4GOPC 1YHBA 5JVH3 2HDLA 1XNQQ 5M5YH 1A63A 2MUYA 1M90C 1D8LA 3PO3B 1UE6A 4RKBA 2PW7A 4H7BA 3TREA 5CBAE 2XWBB 4K6LA 1T9HA 1WCMH 2B2VC 4AYBE 2E75C 2GVAA 3HGBA 4A3GG 4N9PA 4FDBA 3M4YA 2WB1E 3AYHB 1K8GA 2PI2A 4LF8Q 3NBHA 3A8JE 1HR0L 1KTKA 4BBRG 3W1GA 1QE6A 1B1ZA 5KGUA 2KEEA 1HR0Q 3L0OA 1VQMA 2Y0SB 1ONLA 1PZID 2BA0A 3I4MB 1RKNA 3DEOA 2F4IA 2VUMB 4A3JB 1KDCA 2NYZD 4C2MH 2A69C 3X3NA 2QDLA 4DXFA 3C1EA 3ND9A 2PPBC 1II3A 1RF2D 5C4XG 2MHVA 3WDNA 1AEXA 1GD7A 1F9RA 5IODA 2AWOA 4YWMA 4DV3L 1EOVA 4XQJA 3A7AB 3PF5A 3H3VH 2DJGC 4HSVA 1G2SA 1Q8KA 1O78A 4N9TA 4KJNA 4NMZA 3M9BA 4DV3Q 2PNRC 4X65L 2XWJB 3FRPB 2QF7A 1S5ED 1NTGA 4X65Q 4JI1L 1PVOA 1N9WA 1MJEA 1WI5A 2R93G 4JI1Q 1VQIA 1TWGB 4A3EG 4J6HA 1HH2P 2KENA 4KD4A 4EGVA 3HOUH 2KHIA 1JOKA 5BN3A 1EY7A 2ZT9C 1TQOA 3K7AB 3A5ZB 4HTHA 4DV2L 3FPUB 5IP9H 1BBXC 2DJFC 4R1JA 4DV2Q 1RTNA 4GNXA 1K73C 4JPBW 3Q22A 1H9SB 3UDGA 1VQCA 3OPOA 3M4PA 4XQQA 2JJQA 3HP3A 1RCVD 2Y0SE 4IJHA 4ZKCB 1MBYA 3CHBD 3SE0A 3K80C 1F9PA 1ET9A 3IAYA 2NBFA 1V43A 3TEHB 3VA7A 1TVXA 5ELBA 4BY7H 2I5HA 3CPWA 3SK6A 3S2DB 1A15A 1VQ9A 1VQ6A 3D6CA 1CHPD 1K8AC 3K81C 1XPRA 3HOZB 1GHKA 1IW7D 1JICA 2RQXA 2PMZB 3D4WA 3KF6A 3CMAA 4X62L 1GM5A 4DV4L 4IUVA 2KCNA 1K9MC 1C7YA 1AP0A 4X62Q 4UP9A 5FLMH 5EQ0A 1TY2A 5M3MB 2B2UA 4DR7L 1SLJA 5GAEC 1X56A 1V1QA 3RLFA 1HZCA 1QG7A 4DR7Q 3S15H 1NE3A 3F2UA 3MXNB 3EFXD 1G51A 3JAML 4OIJA 5BR8L 4RGMA 3S1NB 1HCZA 2F0OA 1EY8A 5LL6S 4TQUS 3T56B 3OW2A 2EXZA 1JJ2A 3WWVA 5BR8Q 4DPGA 2ZM6L 4F7XA 5IE8A 1FGUA 2GA4B 3OW7A 1WTVA 4JK1C 4RGTA 5KIXA 2ZM6Q 4YHHQ 2H4OA 1PYBA 2E2JB 2BH8A 3CC7A 2MO0A 3K5OA 4XT3B 1LT5D 4L5QA 4NP5A 4QY7A 5J3BA 1Y1WG 5EGTA 5JEAG 1AE2A 2D0OA 2Q8IB 2RDFA 4ZLTF 1HFGA 1I6HB 4HJ5A 5CYUA 3W5OA 1Q46A 3EJIA 4KLKA 3RR5A 4DUYL 1BR9A 1GUSA 1HZAA 2B63G 2PMZE 2N49A 4DUYQ 1D5XC 1S5FD 4XTCS 1X55A 4JI8L 5M5XH 1SNPA 4IUTA 1VQOA 1A6XA 4AH6A 1FR3A 1EYAA 1E2ZA 2RDHA 2YU9H 4A3KH 1PTOH 3J80E 2EZVA 1PV4A 3G71A 2JA6H 2A8VA 3MFGA 1STGA 5C0XH 4H13C 1BVSA 1ZEQX 2K28A 4R4IA 4AYBG 1TWFB 4IFDG 2I0QA 2J4XA 5IT9E 1WCMB 1I3QB 1TWHH 2RHQB 3RZDB 5BN4A 5KEEA 3FVQA 1A2UA 3QWNA 3BDOA 3K0YA 4MNOA 1TWCB 4C3IB 1WTWA 1CQFA 2EY5A 5ELEA 4DXGA 3SXHA 2EVBA 2BE5D 1OXXK 3KJOA 4B3TL 3M3YH 4ZAIA 2J7ZA 1CI3M 2NUCA 3AFQA 3GDEA 3ULLA 4B3TQ 4C2MB 4JBWA 1WYDA 4RG1A 3JAMi 3PO2H 4OO1G 3I7FA 3T1HL 4ZKBB 2CH4W 3PIOA 3C1FA 4MHEA 1Q7YC 2AMCB 4A93B 3DLLA 4QJFA 1X54A 1S40A 1VQLA 1ZYRD 1CKNB 1V8QA 1W6KA 4R9WA 1K0SA 4OELB 1NBWA 1T5EA 2WIIB 2RVLA 1V1OA 3IL8A 2WKDA 1F2ZA 3LX0A 4POGA 3PO3G 2NN6H 1NY4A 1K8MA 3HOUB 4R8NA 3ULJA 4A75A 5I9PA 5M3FH 2QW7A 3VR3A 5E3FA 3RN5A 1F2MA 2YV5A 1SDFA 1EY4A 1SNOA 5C5LA 3GTPH 5FJ8G 1ASYA 2MNAA 3DEPA 4YCUA 2NVTH 2CCZA 3NXWA 4A3DB 1V1PB 2K14A 1MSHA 3T53B 3KBGA 4JBMA 3E3XA 4ODGA 2QEJC 3HFZB 1VQKA 3VYRA 1RD9D 4HCSA 3SGIA 2UUBL 1G291 2EYFA 2Q2HA 3CPFA 2RA4A 4V0BA 2VUMG 4A3JG 2D9UA 4OWWB 4A76A 2Z4IA 3WOEA 4KKSA 2L1BA 2UUBQ 5E4XA 4K14A 4R4CA 3JAME 4IOAA 4WJ4A 3DWQA 1EQTA 4BY7B 2YYZA 1J5EQ 4NXML 1SNQA 2OQKA 1IYVA 1STBA 2BOSA 3E6ZX 3J81E 2AQ1B 2NTTA 4C3HB 1LTRD 4PZ6A 4Y7NH 3CKIB 5JJZA 2JA5H 2CHBD 4NXMQ 3EQLC 4PZ8A 1PH8A 1K3RA 3S17B 3T13A 3D31A 4DV0L 4IOCA 1GUTA 2CW0C 3UE1A 3S16H 1MJCA 1QILA 4DV0Q 1LO5D 2F0DA 4FF3A 1ESRA 1N34L 2KA7A 2DUDA 2E76C 2IPKD 3NQTA 3KLWA 4IUUA 2UUAQ 1N34Q 5FO8B 3ONAB 1NUCA 5KNDA 1SRUA 1QNKA 3JC66 5LMNW 1CA5A 1IZ6A 2G9DA 1CSPA 2Z8LA 1PH6A 1HR0W 2EJFC 4PG3A 3UDFA 1YJWA 4KK7A 2A6EC 2K5WA 3DM3A 1FNVA 1R4QB 3ZYYX 4GOPB 2MJ8A 1TWAH 5CV5A 2EY6A 1PH9A 3PCOB 1VMCA 3GTGH 3MZ5A 4G7OC 3GTLH 2BH2A 3F2BA 1SROA 4OO1H 3F2DA 1HZ9A 4QUCA 3K6OA 1J6QA 2JA7G 3QIAA 5C0XJ 5K36H 3V2TA 3I4OA 2OT2A 5EKIA 1EQQA 1X65A 4MIUA 1SJHD 1WTPA 4OWTB 1D5ZC 4KTAA 4NXNL 1ZKOA 1DYQA 1U4MA 1YBYA 5M3MG 3DM1A 3H6MA 4NXNQ 1EIFA 4A3MG 5NUCA 3K5LA 2IW3A 1E2WA 1HNXL 1CA6A 1F9QA 2L0CA 4FVMA 1OXVA 3TZUA 3A5UA 2K5NA 3UDXA 5IP7H 1HNXQ 3J7AV 3L3OC 2DNCA 1EYDA 1H9SA 2DY7A 3I90A 5IGFA 1XTCD 4IJLA 4P2CB 3AEVA 1S3OA 4CDDC 2CVRA 1KL9A 2F0GA 3G4SA 1RL2A 1VQNA 2JK8A 4K8IA 1K8OA 1NNXA 1KNAA 1RTOA 4O1NA 1H9RA 1S5CD 1SE2A 3SK5A 4C3JH 1NMFA 3S9WA 1O80A 3NWSA 4QB4A 1BXTA 1VQ8A 2R7ZH 3I55A 1G91A 1UE1A 2RSNA 1Q86C 2F0KA 3E9HA 1RJTA 3K5NA 2E2DC 2FMMA 5CV4A 2ZJPA 3I73A 5IGEA 4WFN3 1W3SA 3E0JA 4TSSA 5G3LD 4RWSC 3OWEB 2Q2UA 1IL8A 1PH2A 2K4KA 2HIXA 2F0PA 1PYSB 1X9NA 4CGYB 1BBWA 1P8LA 4R4TA 3AMUA 3C2PA 2NZOA 3SHLA 5EKLA 1QB5D 3GP7A 1IXRA 3KLSX 4UAIA 2ZTDA 3MXNA 3N52A 1I4QA 3I91A 1SJED 4DKAC 2PCFB 5J39A 1L0YB 2GVBA 2J0TD 5I2YA 3MA2B 1BCPD 4H44C 4YIJA 5M3FB 4DU9A 1W2BA 3CCQA 3S14H 3G6EA 2R92H 3BDLA 2XTIA 3K7UC 2IL8A 1Z47A 1JE4A 4UP8A 1VQ5A 4HEDA 4HCEA 1WVLA 3KFUA 1IHZA 3CC2A 2LSSA 3OMCA 5C3WA 1SNMA 1FNWA 4MTKA 2NVTB 2EE1A 4HR7B 4KY6A 2B2TC 1PMRA 3CCMA 2F4VL 1E7ZA 4LFCL 4A3CG 3D0FA 4C3IG 3E0EA 3Q0AA 4MZ9A 4JV5L 4XQNA 1KQSA 2Z0SA 1TY0A 2F4VQ 2K5VA 3IRBA 2N55A 2A73B 2LMCB 4JV5Q 1IYUA 4UY8C 1PRTF 1B8AA 4BXXH 4NW2A 2A1AA 2EYPA 2QILA 1CTMA 4ULLA 3S1MH 2Z6KC 2N3SA 1AE3A 4R8IA 1S72A 3GTMH 4DV5L 5K5PA 3C3LA 1I94L 2K5QA 4DV5Q 2CFMA 1DCZA 4A93G 1BOSA 3K57A 1I94Q 2WB1B 4XYOA 4QUFA 2L55A 3S16B 4GN5A 4KD3A 3TQYA 2F0FA 3NEMA 2ICIA 4O2DA 1YHQA 3NWTA 1PFSA 1KXLA 3CCEA 3HOWH 2JP1A 3EVQA 2FXQA 4WRDA 5IY0A 2CWPA 4IALA 2F1MA 2HQEA 2JSOA 4L5SA 3PF4A 5BN5A 4A3DG 5I6WA 5C3EH 3NELA 4Z9CB 3TSSA 3FMCA 2R7FA 5C3XA 4EQPA 3NHHA 2CWAA 4DK3C 1R9TH 2IX1A 1LT6D 2B2WA 2K04A 1GXDC 2SDFA 4IQZA 4H0LC 3IFDA 3FKIH 1BCPC 4DR5L 4E6IA 1ET6A 4RGNA 3I4NB 1JR0D 2VQEL 1D2BA 3HOYH 3A74A 4DR5Q 4HIOA 4RCOA 4C3HG 1XYIA 1KLGD 1TS4A 2VQEQ 3U9OA 1CKNA 1GKHA 4A3IG 2JXMB 4LW1A 2MP1A 3S1RB 1O7ZA 1X3QA 4IO9A 1QOHA 2TSSA 4XXEA 1A3UA 2V1CC 2RDGA 1WTOA 4V190 2BDNA 3E9IA 1JC7A 3U4ZA 3MTSA 1IBLL 1FJGL 5IYBH 1IBLQ 1SN8A 1FJGQ 3MAQA 2JA8G 1GO3E 4DK0A 4DR6L 1TS3A 3VR6A 3HOVH 4C1NK 1V1PA 2M00A 3J80L 4DR6Q 4K5WA 2WKCA 2R61A 3ITPA 1Y8OB 1PTOC 4NPSA 4A3FH 3VYSA 5IGGA 4JOIC 1ESFA 5IT9L 2OF1A 2PZTA 4ALPA 3ULPA 2E2HH 4JI6L 4IUQA 4G57A 4C3JB 4PMWA 2C9OA 4LF7L 2OWOA 3H0GH 4JI6Q 2AQ2B 4IPDA 1KIXA 3KF8B 2IHFA 4JCVE 4LF7Q 3NE5B 4DGZA 1ZXTA 2OTJA 3MXUA 4OHJA 3EN2A 2PZUA 4FNFA 4I65A 4O0AA 5C4JB 3M85A 4RHSA 1B3AA 5IYDG 1A62A 3RUZA 1VQ7A 1QZGA 4FO2A 1Z9FA 1L1OC 1Q1EA 2XVSA 4DV1L 4JI7L 1SYBA 4FXGC 2NVQB 4B3ML 3Q24A 3CCSA 4DV1Q 4ME3A 3RMHA 5M5WB 4A3BH 3R2IA 4RMFA 4B3MQ 4KY5A 4BBSB 4RCNA 4BA2I 3SR1A 1MIUA 2E5LL 2OCEA 2R7DA 4BY1H 1M4VA 1VQPA 3KBXA 3R2TA 3PIO3 3CQZB 1LTGD 2E5LQ 3PIPA 4GKJL 1SE8A 4GOPA 3NP8A 3TP7A 3S14B 2R92B 3UE0A 1S5BD 2G5DA 2OEOA 4F8MA 1YJNA 4GKJQ 1BF4A 1C48A 4I7ZC 3H15A 1JB7A 2NZHA 1SBBB 4LF4L 3GTQH 2B2VA 1EIYB 2P5ZX 1NCVA 3HOXG 4LF4Q 1FD7D 4GN3B 1XXGA 5FLXc 2K01A 2RSOA 4DV4Q 4DR3L 2JQOA 3FPPA 1U4LA 3RZOB 1OXSC 1UEBA 3MFYA 3V05A 3PUXA 4DR3Q 4KI0A 3J80i 4AIMA 1K83H 1YNJD 5LHY1 4HMIA 3GTMB 3PUYA 1LTTD 4A3GH 3BDCA 3CXCA 4A3LG 1ICWA 1UWVA 2O5JC 3J81L 2L5TA 4ZUJA 1Y1VB 4BBRH 4JI5L 3F2CA 1E1TA 2VB3X 5HGQA 1D1KA 4ZCKA 1SR3A 2AKWB 4JI5Q 4YY3L 2NVXH 2A74C 2F0VA 4HJ9A 3HOWB 3FHWA 2MPMA 3CCLA 4YY3Q 3C46A 1YNND 3B6YA 1CM9A 1I4RA 2A6HD 1Y14B 3I2ZA 1C8CA 5C4XH 3HEJA 2WAQB 5KYLA 4LF6L 1EQRA 5C3EB 1KRSA 2K05A 1EOTA 2KCTA 4QGUA 4MN3A 4LF6Q 3S2HH 3H09A 4M8AA 1ILQA 1FYCA 3S24A 3GTOB 3H3VI 5KNCA 2SNSA 4JI8Q 2WINB 5IIFA 2R93H 3L2PA 4A3EH 1PXUA 1LV9A 2ASBA 1NR2A 5FOBB 5M5YB 4JVZA 2F0LA 5C44G 3NQIA 5HGTA 2FINB 4OX9L 3G48A 3G6JB 1EZ6A 1EFWA 1IW7C 2WB1G 3CRLC 4OX9Q 1B70B 3I56A 4QF4A 2L4NA 2ZXOA 1DJRD 4RH6A 4J15A 1HJPA 3AFPA 3A7LA 1AZPA 1J8IA 2F0HA 4DK6C 1VF7A 3Q6SA 2JEBI 3FP9A 1YNJC 2B39A 3RLOA 1SFOH 2F0QA 1CFMA 2ES2A 4WJ3M 5I2XA 4CKEA 1DZ1A 3NTKA 3KDFB 3O13A 3GQBA 4IN3A 4A3FB 2WAQE 2KCMA 1I50H 2CQOA 3HKZB 3J81i 1NAPA 3HOXH 5ELOA 1EEFD 2ALYB 5IGDA 1YVCA 2AQ3B 2KHJA 3T1HQ 4B08A 3S1QH 1HUNA 3QJYA 5ELNA 4B9XA 4KN7C 5ELFA 3J7AF 4CHTB 3I4NG 3EBEA 4LUZA 4YWKA 2A6HC 3HS0C 2QKIC 4DV7L 3P1HA 2L9HA 3HZXA 1ENCA 1FL0A 2RCFA 5DAUA 4FF1A 2XRSD 1WOCA 2MGSA 1JWSD 1DOKA 4FXDA 5EBDA 1NJIC 1CSQA 4RGOS 2C35B 4ZUIA 2HQLA 1ML0D 2IJ0A 4A3BB 4X3KA 1DD2A 3ERQA 1U4PA 3TBIB 5T1IA 1E22A 5CR3A 1A3TA 3SDZA 2ICEC 4EQNA 2Y0SG 3I4MG 1KHIA 4KKTA 4EQ5A 3TP8A 4BY1B 3F1ZA 5JEAH 1Y1WH 1SNCA 2PW5A 3NSWA 2K6AA 1KRTA 1ENAA 1B50A 1CUKA 3SEBA 2NZ1D 1EQVA 3HKZE 2B63H 2N88A 1YNXA 4N8X1 2DN8A 1VCIA 2EYLA 1CT1D 3SK4A 2FJ2A 4K0KL 1I4GA 3VR4A 4L6TB 4LMQD 2BE5C 4DN4M 1ILPA 1BDOA 4LJZC 4K0KQ 2UXDL 1FGBD 5GROA 2YTYA 1LTLA 1C4QA 1VDZA 1WFQA 4UDUC 2UXDQ 3S15B 1F2LA 2LFNA 2B2YC 5TSSA 4FF2A 1AN8A 4IFDH 3STBD 3HG9A 3UI2A 3BZKA 1SYGA 4A3GB 5C0XI 4F87A 1E1OA 4DAYB 1WTRA 1IYJB 1JMCA 4DA2A 4BBSG 3GV3A 3TS2A 1BCPB 5IGBA 4BBRB 1ZYRC 4HAEA 1ASZA 1EU4A 2SOBA 1G6PA 2PI2E 3K58A 4HJ8A 4CJ1B 1JE5A 5CORA 2G9HD 2HIVA 1VQFA 2WV6D 3BVMA 2AWNA 5CBEE 4DUZL 4KHZA 2Q8TA 3BJUA 4DUZQ 3VYUA 3Q23A 1F2YA 1Y69U 4JI4L 3HOZG 3ICEA 3KF8A 3D4DA 3CP0A 1GUNA 4IUPA 4JI4Q 4GZYC 1AFPA 1CZGA 3CD6A 3WOFA 4ILWA 5D65A 3P20A 1DOLA 3E5SA 1N36L 1N8RC 3UDIA 5M5XB 1Q81C 5EBCA 1N36Q 1PZKD 4LF9L 4PZ7A 2L15A 2ZJRA 1F77A 2YU9B 1QCBD 4A3KB 3RD4A 2Z6BA 1PTOB 4Y52H 1PRTD 3PO3H 1D5MC 1GHJA 1AZQA 3OWFA 4LF9Q 2R93B 2JA6B 4RHRA 1QUQB 1NMGA 5I4DA 1BUVT 4KN4C 5F2DA 2NN6I 4IPCA 5FJ8H 5EPJA 1E0BA 2AUJD 4LF5L 1TWHB 1Y1VG 4RKLA 1FNUA 1JJCB 4LF5Q 4BWGB 5AJ3L 3TN2A 3LNNA 3U58A 1LTAD 1EL0A 3CCVA 4EVOA 1MD2D 3L9AX 4L5RC 4HSPA 5AJ3Q 2VUMH 5M9OA 4A3JH 1VQEA 2JEAI 1L1OB 3M3YB 4DK1A 2VL6A 4JI2L 2EPBA 1SFOB 1S5DD 2EQSA 4QIWB 2HHHL 1C9OA 4JI2Q 4HIMA 1I4XA 2WAQG 5IYCG 3PO2B 2HHHQ 3MXPA 1RDPD 2K75A 4RA8A 5D3IB 3KLSA 2RF4A 1LACA 2QA4A 3G7LA 3KUPA 5JOBA 1S4ZA 2UUCL 2PNHA 1MHWC 5EPKA 3KYHC 2UXBL 3S1QB 1WD0A 2UUCQ 1J9OA 3ND8A 1TWGH 4U673 2UXBQ 1CKOA 1UEAB 3DHQA 5LMUL 2I46A 4OEMB 3TRZA 4JW0A 1EY6A 4XT1B 5LMUQ 2Z4HA 1WCMG 5LL6X 1XMQL 1SMXA 3GTPB 1D6EC 4DAVA 1A2TA 4LAAA 1XMQQ 5EJWA 3U9SA 2WACA 1N33L 2QEXA 1HFNA 5JJKA 2LXKA 5CGKA 1DXMA 3PV0A 3I70A 1N33Q 1UNSA 2RBMA 4LFCQ 1LLRD 3ERSX 3I4LA 4IURA 4LWCA 4QQBX 4QL5A 1B53A 4RFBA 2UXCL 3CU7A 2FMCA 1PZJD 4QIWE 2F0IA 2UXCQ 2JA7H 3HKSA 2DNEA 2HDMA 2HCIA 2E2IH 3HKZG 1WTHA 4IFDJ 3PGZA 4K8JA 2AHOB 4Y7NB 2JA5B 2F0SA 1GUWA 5EKKA 3KJPA 1STHA 1SYDA 5M3MH 3PIP3 1YEZA 3PUZA 2H5XA 1X3PA 3OSOA 1NR4A 4A3MH 2F3VA 5KYIA 1R4PB 4HN7A 2D62A 1XPUA 3HOUG 1JORA 2A69D 1YITA 2KUMA 3PMFA 3H94A 4UHVA 1DM0B 5IP9G 4JBJA 1HRJA 5CV9A 3SK8A 3HRZC 1KAWA 2PQAB 2O4XA 2WP8J 2DGYA 1OO9B 2EJGC 1FVIA 2N8NA 5CV7A 4LUOA 2ATWA 1F9SA 2K7VA 2E2JH 4DF7A 1PLFA 2FHTA 1SE4A 5D14A 5IT9c 1O7IA 2I07B 4P74A 1TWAB 1MI2A 1CZWA 2B29A 3KDFA 3D8GA 3W2DA 2JA9A 1YZ6A 3MEFA 3GTGB 3FDTA 2LXJA 4BY7G 3GTLB 2B8GA 1SEBD 2JE6I 1STNA 4I7AA 4N8FA 5I6YA 3BU2A 4GNXC 4TKOB 3ER0A 1YJ9A 1SE3A 2K33A 4GN4B 3NTHA 2VS1A 3BVZA 1KD1C 3T1YL 2KBNA 4XIGS 1E2VA 4KHPL 4CKCA 3LGJA 4K2LA 4P72A 2B2TA 4PMBA 4DAPA 5FLMG 1HA6A 2I5LX 1UUPA 5DM73 1TS2A 4KHPQ 4FF4A 4X6AH 2MO1A 2L11A 2KEDA 5FKAC 3M7NA 3BS1A 4IZ8A 3D6WA 1TWFH 1N32L 3GTKH 1HTLD 4KKUA 3QOLA 1HA5A 3CMEA 4ZRZA 1I3QH 5JAVA 1EWCA 1N32Q 4LF8L 1RIPA 2F03A 5LMNL 2TMPA 3RZDH 2Z6KA 1HZBA 5LMNQ 1VQ4A 4A3CH 2XSCA 1PFBA 1TWCH 1BO0A 3K0XA 4C3IH 2B2UC 4JG2A 3R3OA 1QWYA 5DNFA 3KLRA 1HNZL 2R7ZB 5C4ZA 4J8QA 1HNZQ 4Q0FA 2GN5A 3GO5A 1L2FA 2AUKA 4EQOA 2RKSA 3I8ZA 4WJWA 4LUVA 2VY3A 5FO9B 1PTOF 2F0NA 1EU3A 2A5HA 2PYKA 3PUVA 3T16A 2VXWA 3K5MA 2F0EA 4GLAC 4P71A 3QG1A 3D4RA 4A93H 4DR4L 4MTNA 3JAMc 5COYA 3U4VA 2NTSA 1V9PA 4UPAA 4DR4Q 4JI7Q 3J81c 1ENFA 2OQ0A 4A3KG 1IBKL 3URYA 3CAMA 5DLQE 2JA6G 3OTOL 2CKZB 1IBKQ 1MGSA 4DAYA 1AW7A 4B3RL 1YHAA 1EY5A 3AQQA 3PUWA 5C0XG 5A35A 3OTOQ 1TT2A 4B3RQ 1CKMA 1Q3LA 1U9RA 4A3DH 1IKLA 1CHQD 1KDBA 2JN4A 2EDGA 4IPHA 3M4QA 2FFKB 2PQEA 5ISRA 3GTJH 4L63B 2HUGA 1BKBA 5IOCA 1QVCA 4BA1I 4OL7A 2BA1A 4LNQA 1EUJA 1U4RA 3CF5A 2Q2TA 4WORA 3OMGA 1JWMD 1LYLA 2O2LD 1HUMA 3S1MB 3PO2G 3M7GA 4C3HH 3RNUA 2A68D 2JA7B 1PHJA 5GAGC 3OIQA 5FO7B 1I4HA 1O7YA 2IWHA 1ICFB 4A3IH 3S17H 2E2IB 4LFBL 1EWHA 2O5IC 1Q8IA 3LWEA 4LFBQ 2UU9L 1PH5A 4O42A 1QVGA 1PDQA 1QUQA 1HQMC 4JOIA 2QDBA 1A8VA 1GVPA 1QNUA 1XTDA 1X3EA 2UU9Q 1I6VC 4A3MB 3U50C 2JA8H 2C5CA 1LT4D 4ME5A 1PYWD 2NN6G 2EIFA 4C56C 4GS3A 3D3RA 3CCRA 5M3FG 1I4PA 1U5KA 4R4OA 1RODA 5JJLA 3TP6A 4X66L 2WFWA 1VMPA 4G7ZC 3AU7A 4FXKC 4JYAL 2PO4A 1MKHA 2ZXRA 4GLXA 4X66Q 5C6AA 2XN9C 3NENA 1HPCA 1LTID 4JYAQ 1JB3A 1L1OA 2Q2IA 1W6JA 2B8FA 3MHBA 3P75A 2VW9A 3AB9A 2Z1CA 3DUZA 5CV8A 3CRKC 5JPNC 4K6DA 1R9TB 3IFTA 1SYEA 1AH9A 3FKIB 3MWYW 2VNUD 1G6ZA 2NVYH 3M4OH 1EIHA 4ABNA 4LK1C 3NBIA 3HOYB 1LABA 1VQDA 5IYDH 4L5TA 4DNTB 2JA5G 5HY6A 5JJIA 1LM0A 2F52A 1PFMA 5D3DA 2X69A 4HJAA 5FLXL 1QZHA 1WD1A 3CCJA 3K59A 1E24A 4YHHL 5GAHC 3IKJA 3K8AA 1Q1BA 2NB0A 2EYOA 1SYCA 2H1EA 3BVGA 1HQRD 1A0IA 1SXTA 2HCCA 2ZTEA 2ZTCA 1OXUA 4P73A 5ELDA 5E7NA 5T1GA 4CDCC 1L0WA 1DGSA 1DOMA 1VS0A 2IX0A 1HXYD 4X64L 1HTPA 3L7ZC 4KMUC 4OWXB 2A68C 3GTKB 4POFA 2K5HA 2EJMA 4X64Q 3HOVB 1VQAA 1UAPA 2ENBA 1H9MA 4ID6A 4HIDA 3A8IE 2CQAA 2DY8A 1KC8C 5KNBA 1JOOA 2EOTA 2BDOA 2HT1A 1EEID 3X3MA 1Y8NB 2CW0D 2MFIA 3NUCA 4B3SL 1O7LA 1RHPA 3OOCA 2E2HB 3V96A 5ELCA 4B3SQ 3J7A5 3TZDA 2OTLA 3H0GB 2K50A 1IBML 3BG3A 1YNNC
chains in the Genus database with same CATH topology
2IX3A 4QCLA 5JVG3 5A2QL 5K36G 2A6ED 1EFID 1EY9A 3TMEA 1PRTB 4HMJA 4K5XA 3VR2A 1PFNA 2EY2A 3TDQA 3KK7A 3VYTA 4XDXA 2KCCA 2K32A 5C4HA 1SNDA 3BYYB 1BNZA 1CK1A 1A3VA 2K1BA 4L8JA 5E4WC 1D1IA 1GOZA 2PZWA 2F0TA 2EYHA 1MSGA 4ZK9B 3GTJB 2ZXPA 3A54A 3OHXC 2KVMA 1Q12A 4C3JG 3GTQB 5KRUA 4Q5VA 3SVMA 3A8KE 5CMDA 1LTSD 3H91A 4S3SA 5JPMC 3QOJA 5C5MA 4X3TA 1TKWB 1K83B 1XWEA 1DONA 2EYJA 2KHSA 4A3IB 4FP5D 1GJXA 4J1MA 5EPLA 4M1UB 3R8BA 1SMYD 3MXGA 1BQQT 1KLUD 1JQYD 4DNRB 2JA8B 1TU2B 4OIKA 2NVXB 1JOQA 1EIGA 4CJ2C 1VF5C 1H9KA 3T51B 5FLXE 5C4XB 4PMCA 5IGCA 4DFAA 1TR5A 2V4DA 4ZYSA 2LKVA 1IKMA 5CC4A 2XRQD 2XIWA 3S2HB 3I72A 3VA5A 2F0JA 4FYDA 2KECA 3BYTB 2NVYB 3M4OB 4A3EB 4RAUC 1CQVA 3N6RA 1KNEA 2EYMA 4PV1C 3NTIA 3GV6A 2JYOA 2KQ3A 2R3ZA 2SNMA 1STYA 2NWGA 3W3AA 2LS01 3EROA 2EY1A 3DWPA 3FEWX 3TP5A 2IT1A 4NDXA 3OIPA 4C1NI 1GUOA 4PNYA 4KJOA 4G4KA 3GD7A 5A2QE 5E1FA 4ZQ3A 1EYCA 2E74C 4XYQA 1EY0A 2SEBD 4K2KA 1SYFA 3DMUA 2B2YA 4PQXA 1SMYC 1B2TA 3QB3A 5DEHA 1I50B 1JWUD 2F0UA 3VR5A 3HOXB 3T4AC 1B9MA 1QJOA 2K5DA 1L0XB 1KDAA 3P7JA 1G2TA 3MC0B 1T5XD 1M8AA 3MVVA 3J7YW 4QMGA 5JEAJ 2B2WC 4IFDI 2Q8RE 1TIID 5AFWA 2X6LA 4KHVA 4KV6A 3R93A 1G8ZD 4BS9A 3H3VC 4CKBA 1Z6HA 1H9JA 3DXJC 1STAA 1PRTC 3LWUA 3EA6A 1Y1WB 4U68A 3NK9A 4CBVA 1EZ8A 5DM63 1LTBD 4OO1I 3QO2A 2F0WA 1HHVA 1JCKB 2B63B 4KY7A 1KABA 4TRDA 2M9VA 5I9OA 1SSOA 1Y8PB 5FK9C 1TS5A 4X3UA 1B4OA 1B9NA 5J22A 2KOLA 1LT3D 5C44B 4AYBB 3MEHA 1PTOD 2VB2X 1WTXA 3A55A 2D5DA 4K5VA 3A56A 2R6GA 1XX8A 2L12A 5CV6A 4NKLA 2QCPX 4B9WA 2F0MA 2D2CC 1NSNS 1B44D 3BZDB 4F88A 3NPPA 2F3WA 4OGQC 2OXPA 1SAPA 5G3LF 3DWAA 1OXTA 2X6GA 3I3CA 2BCOA 1KAAA 1STEA 5HURA 4CJ0B 2K03A 1WTQA 4X3SA 5J1ZA 4G7HC 1Q90A 1X32A 1Z7TA 2ID0A 4IUNA 2LY7A 2M2LA 2KJXA 1GUGA 1BCPF 2XNAC 5JVH3 2HDLA 2MUYA 3PO3B 4RKBA 2PW7A 4H7BA 5CBAE 2XWBB 4K6LA 2B2VC 2E75C 3HGBA 4N9PA 3M4YA 3NBHA 3A8JE 1KTKA 1QE6A 1B1ZA 5KGUA 2KEEA 2Y0SB 1ONLA 1PZID 2BA0A 3I4MB 1RKNA 3DEOA 2F4IA 2VUMB 4A3JB 1KDCA 2NYZD 2A69C 3X3NA 4DXFA 3C1EA 3ND9A 2PPBC 1II3A 1RF2D 2MHVA 3WDNA 1AEXA 1F9RA 5IODA 2AWOA 4XQJA 3A7AB 4HSVA 1G2SA 1O78A 4N9TA 4KJNA 4NMZA 2PNRC 2XWJB 3FRPB 2QF7A 1S5ED 1TWGB 4J6HA 4KD4A 4EGVA 1JOKA 5BN3A 1EY7A 2ZT9C 1TQOA 3K7AB 4HTHA 3FPUB 1BBXC 1RTNA 3Q22A 1H9SB 3OPOA 4XQQA 3HP3A 1RCVD 4ZKCB 1MBYA 3CHBD 3SE0A 1F9PA 1ET9A 3IAYA 2NBFA 1V43A 3VA7A 1TVXA 5ELBA 3SK6A 3S2DB 1A15A 3D6CA 1CHPD 3HOZB 1GHKA 1IW7D 1JICA 2RQXA 2PMZB 3D4WA 4IUVA 2KCNA 1AP0A 5EQ0A 1TY2A 5M3MB 2B2UA 3RLFA 1QG7A 3F2UA 3EFXD 3JAML 4OIJA 4RGMA 3S1NB 1HCZA 2F0OA 1EY8A 5LL6S 4TQUS 3T56B 2EXZA 4F7XA 2GA4B 3OW7A 1WTVA 4JK1C 4RGTA 5KIXA 2H4OA 2E2JB 3K5OA 4XT3B 1LT5D 4NP5A 5EGTA 5JEAG 2Q8IB 2RDFA 4ZLTF 1HFGA 1I6HB 5CYUA 3EJIA 1BR9A 1GUSA 1D5XC 1S5FD 4XTCS 1SNPA 4IUTA 1A6XA 1FR3A 1EYAA 1E2ZA 2RDHA 1PTOH 3J80E 2EZVA 3MFGA 1STGA 5C0XH 4H13C 1ZEQX 2K28A 1TWFB 4IFDG 2J4XA 5IT9E 1WCMB 1I3QB 3RZDB 5BN4A 5KEEA 3FVQA 1A2UA 3QWNA 3BDOA 3K0YA 1TWCB 4C3IB 1WTWA 1CQFA 2EY5A 5ELEA 4DXGA 3SXHA 2EVBA 2BE5D 1OXXK 4ZAIA 2J7ZA 1CI3M 2NUCA 4C2MB 4JBWA 4OO1G 4ZKBB 3C1FA 4MHEA 4A93B 1ZYRD 1V8QA 1W6KA 4R9WA 1T5EA 2WIIB 2RVLA 1V1OA 3IL8A 2WKDA 1F2ZA 3LX0A 2NN6H 1K8MA 3HOUB 4R8NA 5I9PA 3VR3A 5E3FA 1F2MA 1SDFA 1EY4A 1SNOA 5C5LA 3DEPA 3NXWA 4A3DB 1V1PB 1MSHA 3T53B 3KBGA 4ODGA 2QEJC 3VYRA 1RD9D 4HCSA 1G291 2EYFA 4V0BA 2RA4A 2D9UA 2Z4IA 3WOEA 4KKSA 2L1BA 5E4XA 4K14A 3JAME 3DWQA 1EQTA 4BY7B 2YYZA 1IYVA 1SNQA 1STBA 2BOSA 3E6ZX 3J81E 2AQ1B 2NTTA 4C3HB 1LTRD 3CKIB 5JJZA 2CHBD 3EQLC 3S17B 3T13A 3D31A 1GUTA 2CW0C 1QILA 4FF3A 1LO5D 2F0DA 1ESRA 2KA7A 2E76C 2IPKD 3NQTA 4IUUA 5FO8B 3ONAB 1NUCA 5KNDA 1QNKA 1CA5A 2G9DA 2Z8LA 2EJFC 4KK7A 2A6EC 2K5WA 1FNVA 1R4QB 3ZYYX 2MJ8A 5CV5A 2EY6A 1VMCA 3MZ5A 4G7OC 4OO1H 4QUCA 3K6OA 3QIAA 5C0XJ 5K36H 3V2TA 2OT2A 5EKIA 4MIUA 1SJHD 1WTPA 1D5ZC 4KTAA 1ZKOA 1DYQA 1U4MA 3DM1A 3H6MA 5NUCA 3K5LA 2IW3A 1E2WA 1CA6A 1F9QA 2L0CA 4FVMA 1OXVA 3TZUA 3J7AV 3L3OC 2DNCA 1EYDA 1H9SA 2DY7A 3I90A 5IGFA 1XTCD 4P2CB 2CVRA 2F0GA 4K8IA 1K8OA 1KNAA 1RTOA 4O1NA 1H9RA 1S5CD 1SE2A 3SK5A 3S9WA 1G91A 1O80A 3NWSA 4QB4A 1BXTA 2RSNA 2F0KA 1RJTA 3K5NA 2E2DC 2FMMA 5CV4A 3I73A 5IGEA 4WFN3 3E0JA 4TSSA 5G3LD 4RWSC 3OWEB 1IL8A 2F0PA 4CGYB 3AMUA 3C2PA 3SHLA 5EKLA 1QB5D 3GP7A 3KLSX 4UAIA 3MXNA 1I4QA 3I91A 1SJED 3N52A 2PCFB 5J39A 1L0YB 2J0TD 5I2YA 3MA2B 1BCPD 4H44C 4YIJA 5M3FB 4DU9A 3BDLA 2IL8A 1Z47A 1JE4A 4HEDA 4HCEA 1WVLA 1IHZA 3OMCA 5C3WA 1SNMA 1FNWA 2NVTB 2EE1A 4HR7B 4KY6A 2B2TC 1PMRA 4C3IG 3Q0AA 4XQNA 1TY0A 2N55A 2A73B 2LMCB 1IYUA 1PRTF 4NW2A 2EYPA 2QILA 1CTMA 4ULLA 4R8IA 5K5PA 3C3LA 2K5QA 1DCZA 1BOSA 3K57A 2WB1B 4XYOA 4QUFA 2L55A 3S16B 4KD3A 2F0FA 2ICIA 3NWTA 2JP1A 3EVQA 4WRDA 4IALA 2F1MA 2HQEA 2JSOA 5BN5A 5I6WA 4Z9CB 3TSSA 3FMCA 5C3XA 4EQPA 3NHHA 2IX1A 1LT6D 2B2WA 2K04A 1GXDC 2SDFA 4IQZA 4H0LC 3IFDA 1BCPC 4E6IA 1ET6A 4RGNA 3I4NB 1JR0D 1D2BA 4RCOA 4C3HG 1XYIA 1KLGD 1TS4A 3U9OA 2JXMB 2MP1A 3S1RB 1O7ZA 1X3QA 1QOHA 4XXEA 2TSSA 1A3UA 2RDGA 1WTOA 4V190 2BDNA 1JC7A 3MTSA 3MAQA 4DK0A 1TS3A 3VR6A 4C1NK 1V1PA 2M00A 3J80L 4K5WA 2WKCA 2R61A 3ITPA 1Y8OB 1PTOC 3VYSA 5IGGA 1ESFA 5IT9L 2OF1A 2PZTA 4IUQA 4G57A 4C3JB 4PMWA 2C9OA 2AQ2B 3NE5B 4DGZA 1ZXTA 3MXUA 4OHJA 2PZUA 4FNFA 4I65A 5C4JB 3M85A 4RHSA 1B3AA 3RUZA 4FO2A 1Q1EA 2XVSA 1SYBA 4FXGC 2NVQB 3Q24A 3RMHA 5M5WB 3R2IA 4KY5A 4BBSB 4RCNA 4BA2I 3SR1A 1M4VA 3KBXA 3R2TA 3PIO3 3CQZB 1LTGD 3NP8A 3TP7A 3S14B 2R92B 1S5BD 2OEOA 4F8MA 1BF4A 1C48A 4I7ZC 1SBBB 2B2VA 1NCVA 1FD7D 1XXGA 2K01A 2RSOA 3FPPA 1U4LA 3RZOB 1OXSC 3MFYA 3V05A 3PUXA 4KI0A 1YNJD 5LHY1 4HMIA 3GTMB 3PUYA 1LTTD 3BDCA 1ICWA 2O5JC 3J81L 2L5TA 4ZUJA 1Y1VB 2VB3X 1D1KA 2A74C 2F0VA 3HOWB 2MPMA 3C46A 1YNND 1CM9A 1I4RA 2A6HD 1C8CA 3HEJA 2WAQB 5KYLA 5C3EB 2K05A 1EOTA 4MN3A 3H09A 4M8AA 1ILQA 1FYCA 3GTOB 5KNCA 2SNSA 2WINB 5IIFA 1PXUA 1LV9A 1NR2A 5FOBB 5M5YB 2F0LA 3NQIA 5HGTA 2FINB 3G6JB 1EZ6A 1IW7C 3CRLC 4QF4A 2L4NA 2ZXOA 1DJRD 4RH6A 3A7LA 1AZPA 1J8IA 2F0HA 1VF7A 3Q6SA 2JEBI 1YNJC 2B39A 2F0QA 1CFMA 5I2XA 4CKEA 1DZ1A 3NTKA 3O13A 3GQBA 4IN3A 4A3FB 3HKZB 1NAPA 1EEFD 5IGDA 2AQ3B 4B08A 1HUNA 3QJYA 4B9XA 4KN7C 5ELFA 3J7AF 4CHTB 2A6HC 3HS0C 2QKIC 3P1HA 2L9HA 3HZXA 1ENCA 5DAUA 4FF1A 2XRSD 2MGSA 1JWSD 1DOKA 4FXDA 5EBDA 4RGOS 4ZUIA 1ML0D 2IJ0A 4A3BB 4X3KA 1DD2A 3ERQA 1U4PA 3TBIB 5T1IA 5CR3A 1A3TA 3SDZA 2ICEC 4EQNA 4KKTA 3TP8A 4BY1B 5JEAH 1SNCA 2PW5A 3NSWA 2K6AA 1ENAA 1B50A 3SEBA 2NZ1D 1EQVA 2N88A 2DN8A 1VCIA 2EYLA 1CT1D 3SK4A 2FJ2A 1I4GA 3VR4A 4L6TB 4LMQD 2BE5C 4DN4M 1ILPA 1BDOA 4LJZC 1FGBD 1C4QA 1VDZA 4UDUC 3S15B 1F2LA 2LFNA 2B2YC 5TSSA 4FF2A 1AN8A 4IFDH 3HG9A 3UI2A 1SYGA 4A3GB 5C0XI 4F87A 1WTRA 4DA2A 3GV3A 1BCPB 5IGBA 4BBRB 1ZYRC 4HAEA 1EU4A 2SOBA 3K58A 4CJ1B 5CORA 2G9HD 2WV6D 3BVMA 2AWNA 5CBEE 4KHZA 2Q8TA 3VYUA 3Q23A 1F2YA 1Y69U 3KF8A 3D4DA 1GUNA 4IUPA 4GZYC 1AFPA 1CZGA 3WOFA 4ILWA 5D65A 3P20A 1DOLA 3E5SA 5M5XB 5EBCA 1PZKD 1F77A 2YU9B 1QCBD 4A3KB 3RD4A 1PTOB 1PRTD 1D5MC 1GHJA 1AZQA 3OWFA 2R93B 2JA6B 4RHRA 5I4DA 1BUVT 4KN4C 5F2DA 2NN6I 5EPJA 1E0BA 2AUJD 1TWHB 4RKLA 1FNUA 4BWGB 3TN2A 3LNNA 1LTAD 1EL0A 4EVOA 1MD2D 3L9AX 4HSPA 5M9OA 2JEAI 3M3YB 4DK1A 2EPBA 1SFOB 1S5DD 4QIWB 1I4XA 3PO2B 3MXPA 1RDPD 4RA8A 5D3IB 3KLSA 1LACA 3G7LA 3KUPA 5JOBA 1S4ZA 5EPKA 3S1QB 1WD0A 1J9OA 3ND8A 4U673 1UEAB 3DHQA 2I46A 1EY6A 4XT1B 2Z4HA 5LL6X 3GTPB 1D6EC 4DAVA 1A2TA 4LAAA 5EJWA 3U9SA 2WACA 1HFNA 5CGKA 1DXMA 3PV0A 3I70A 1UNSA 2RBMA 1LLRD 3I4LA 4IURA 1B53A 4RFBA 3CU7A 2FMCA 1PZJD 2F0IA 2DNEA 2HDMA 2HCIA 4IFDJ 4K8JA 4Y7NB 2JA5B 2F0SA 1GUWA 5EKKA 1STHA 1SYDA 3PIP3 3PUZA 1X3PA 3OSOA 1NR4A 2F3VA 5KYIA 1R4PB 4HN7A 2D62A 1JORA 2A69D 2KUMA 3PMFA 3H94A 1DM0B 1HRJA 5CV9A 3SK8A 3HRZC 2O4XA 2WP8J 1OO9B 2EJGC 5CV7A 1F9SA 2K7VA 4DF7A 1PLFA 2FHTA 1SE4A 5D14A 2I07B 1TWAB 1MI2A 1CZWA 3D8GA 3W2DA 3GTGB 3FDTA 3GTLB 2B8GA 1SEBD 2JE6I 1STNA 5I6YA 4TKOB 1SE3A 2K33A 3NTHA 3BVZA 4XIGS 1E2VA 4CKCA 4K2LA 2B2TA 4PMBA 4DAPA 1HA6A 1UUPA 5DM73 1TS2A 4FF4A 2L11A 2KEDA 5FKAC 3M7NA 3BS1A 4IZ8A 3D6WA 1HTLD 4KKUA 3QOLA 1HA5A 4ZRZA 5JAVA 1EWCA 2F03A 2TMPA 2XSCA 1PFBA 1BO0A 2B2UC 3R3OA 1QWYA 5DNFA 3KLRA 2R7ZB 5C4ZA 4J8QA 4Q0FA 3GO5A 2AUKA 4EQOA 2RKSA 3I8ZA 4WJWA 5FO9B 1PTOF 2F0NA 1EU3A 2A5HA 2PYKA 3PUVA 3T16A 2VXWA 3K5MA 2F0EA 3QG1A 3D4RA 5COYA 2NTSA 1ENFA 3URYA 1MGSA 4DAYA 1AW7A 1EY5A 3PUWA 5C0XG 5A35A 1TT2A 1Q3LA 1U9RA 1IKLA 1CHQD 1KDBA 2EDGA 2FFKB 2PQEA 5ISRA 4L63B 2HUGA 5IOCA 4BA1I 4OL7A 2BA1A 1U4RA 4WORA 3OMGA 1JWMD 2O2LD 1HUMA 3S1MB 3M7GA 2A68D 2JA7B 3OIQA 5FO7B 1I4HA 1O7YA 2IWHA 2E2IB 1EWHA 2O5IC 1Q8IA 3LWEA 4O42A 1PDQA 1HQMC 2QDBA 1QNUA 1I6VC 4A3MB 2C5CA 1LT4D 4ME5A 1PYWD 2NN6G 4C56C 3D3RA 1I4PA 1RODA 3TP6A 1VMPA 4G7ZC 3AU7A 4FXKC 2PO4A 2ZXRA 5C6AA 2XN9C 1HPCA 1LTID 1JB3A 1W6JA 2B8FA 3MHBA 3P75A 3AB9A 2Z1CA 3DUZA 5CV8A 3CRKC 5JPNC 4K6DA 1R9TB 3IFTA 1SYEA 3FKIB 3MWYW 2VNUD 1G6ZA 1EIHA 4ABNA 4LK1C 3NBIA 3HOYB 1LABA 4DNTB 1PFMA 5D3DA 2X69A 5FLXL 1WD1A 3K59A 3IKJA 1Q1BA 2NB0A 2EYOA 1SYCA 2H1EA 1HQRD 3BVGA 2HCCA 1SXTA 5ELDA 1OXUA 5T1GA 1DOMA 2IX0A 1HXYD 1HTPA 3L7ZC 4KMUC 2A68C 3GTKB 2EJMA 3HOVB 1UAPA 2ENBA 1H9MA 4ID6A 3A8IE 2CQAA 2DY8A 5KNBA 1JOOA 2EOTA 2BDOA 1EEID 3X3MA 1Y8NB 2CW0D 3NUCA 1O7LA 1RHPA 3OOCA 2E2HB 3V96A 5ELCA 3TZDA 3H0GB 3BG3A 1YNNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RJT A;  5AFW A;  2X6L A;  5DNF A;  2FMM A;  3R93 A;  1ILQ A;  2HDL A;  1GUW A;  1ESR A;  1A15 A;  5EPJ A;  1E0B A;  4ZK9 B;  1IKM A;  4IUU A;  4RWS C;  1IL8 A;  1WTW A;  3ONA B;  5CBA E;  3I8Z A;  1JIC A;  1X3P A;  1LV9 A;  1NR4 A;  2XIW A;  1ROD A;  2B2V C;  1QNK A;  4IUV A;  1VMP A;  1B50 A;  1NR2 A;  1PFN A;  2J7Z A;  4ZAI A;  2NZ1 D;  3TN2 A;  1CA5 A;  1AP0 A;  4U68 A;  1EL0 A;  2B2W A;  2VXW A;  2N88 A;  2K04 A;  3KBX A;  2KEC A;  5EQ0 A;  2B2U A;  2FIN B;  2SDF A;  4MN3 A;  1QE6 A;  2KUM A;  3IFD A;  4RAU C;  4XDX A;  2KEE A;  1KNE A;  4UAI A;  2FJ2 A;  1WTR A;  1QG7 A;  2L4N A;  3I91 A;  3N52 A;  5COY A;  3QO2 A;  2EPB A;  4LMQ D;  1WTO A;  1BF4 A;  1HHV A;  3GV6 A;  2JYO A;  4DN4 M;  1BNZ A;  3F2U A;  4ZKB B;  1ILP A;  2MJ8 A;  2R3Z A;  3DEO A;  2K1B A;  1XYI A;  2NWG A;  5E4W C;  4MHE A;  4OIJ A;  1AZP A;  1J8I A;  3MWY W;  2NYZ D;  1F9S A;  1G6Z A;  2B2V A;  1SSO A;  1VMC A;  4RA8 A;  1EIH A;  1PLF A;  2MP1 A;  2FHT A;  1NCV A;  3Q6S A;  1F2L A;  1MSG A;  1O7Z A;  2B2Y C;  1X3Q A;  4X3U A;  5D14 A;  1B4O A;  4R9W A;  1MGS A;  2IL8 A;  3G7L A;  1JE4 A;  3KUP A;  1MI2 A;  2KVM A;  4HED A;  3UI2 A;  2K01 A;  2BDN A;  1S4Z A;  2RSO A;  1WVL A;  1WTV A;  1F9R A;  2KOL A;  3MTS A;  2EE1 A;  2RVL A;  4QUC A;  1U4L A;  5EPK A;  1PFM A;  3IL8 A;  2B2T C;  2X69 A;  1DZ1 A;  4HSV A;  1Q3L A;  1WD0 A;  1J9O A;  1G2S A;  5EKI A;  3GV3 A;  3SVM A;  1WD1 A;  3FDT A;  1WTX A;  4XT3 B;  1IKL A;  4HAE A;  5CMD A;  3H91 A;  2FFK B;  1SDF A;  2N55 A;  1WTP A;  1NAP A;  1XX8 A;  2H1E A;  2L12 A;  2HCC A;  4X3T A;  4XT1 B;  4ZLT F;  2HUG A;  5T1G A;  3DEP A;  4CJ1 B;  1HFG A;  4NW2 A;  1U4M A;  1DOM A;  1ICW A;  5COR A;  2B2Y A;  3DM1 A;  1DON A;  1B2T A;  1HUN A;  1MSH A;  5CBE E;  1CA6 A;  1F9Q A;  2Q8T A;  4R8I A;  1SAP A;  2B2T A;  1U4R A;  4HCS A;  1HA6 A;  5EPL A;  3FPU B;  5EJW A;  1BBX C;  1HFN A;  2RA4 A;  2D9U A;  2DY8 A;  2X6G A;  3I3C A;  4IUT A;  4IUQ A;  1HUM A;  2L9H A;  2L1B A;  2DY7 A;  2KED A;  2L11 A;  3I90 A;  2MPM A;  3P7J A;  2EOT A;  1RTN A;  4IUP A;  5E4X A;  2HCI A;  3D6W A;  1G2T A;  1O7Y A;  1M8A A;  2MGS A;  4IUR A;  5D65 A;  4QUF A;  1CM9 A;  1DOK A;  1DOL A;  1EQT A;  2CVR A;  2K03 A;  4CJ0 B;  4OIK A;  1WTQ A;  1B53 A;  1RHP A;  1C8C A;  4X3S A;  1ZXT A;  1EIG A;  4CJ2 C;  3HP3 A;  1HRJ A;  3LWE A;  1ML0 D;  1KNA A;  1RTO A;  5JJZ A;  4X3K A;  3TZD A;  4ZKC B;  4O42 A;  2K28 A;  1G91 A;  1PDQ A;  1O80 A;  1X32 A;  2K05 A;  2B2W C;  1EOT A;  1U4P A;  1F9P A;  2HDM A;  2RSN A;  5T1I A;  1AZQ A;  2JP1 A;  1B3A A;  1PFB A;  2M2L A;  1BO0 A;  2Q8R E;  2B2U C;  1TVX A; 
#chains in the Genus database with same CATH topology
 1IBM Q;  2IX3 A;  4QCL A;  5JVG 3;  1XPO A;  5A2Q L;  5K36 G;  2K52 A;  1B3Q A;  4CDF C;  4DV7 Q;  2A6E D;  1OTC A;  4A3L H;  1EFI D;  1EY9 A;  1LUZ A;  2I5M X;  3TME A;  1PRT B;  4EX5 A;  4HMJ A;  4K5X A;  3VR2 A;  1PFN A;  3CW2 C;  2EY2 A;  3TDQ A;  3PSI A;  3KK7 A;  3RN2 A;  3VYT A;  4XDX A;  3NBH B;  2KCC A;  2K32 A;  2PQA A;  5C4H A;  1SND A;  2E8G A;  5IP7 G;  2A19 A;  3BYY B;  1BNZ A;  1CK1 A;  1A3V A;  1U0L A;  2K1B A;  4L8J A;  5E4W C;  1D1I A;  1GOZ A;  2EXD A;  1H95 A;  4UP7 A;  2PZW A;  1E3P A;  2Z9H A;  2F0T A;  2EYH A;  1MSG A;  4ZK9 B;  3GTJ B;  2ZXP A;  3A54 A;  3OHX C;  2KVM A;  1Q12 A;  2R7Z G;  4C3J G;  3GTQ B;  5KRU A;  4Q5V A;  3SVM A;  3OYY A;  3A8K E;  5CMD A;  2YTX A;  1PH3 A;  1LTS D;  3H91 A;  4S3S A;  5JPM C;  3QOJ A;  1J5E L;  5C5M A;  2ZJQ A;  4YCV A;  4X3T A;  2IHE A;  1TKW B;  1K28 A;  1HNW L;  5C44 H;  1K83 B;  1XWE A;  1DON A;  2EYJ A;  1HNW Q;  2KHS A;  4DV6 L;  4P75 A;  4A3I B;  4FP5 D;  1GJX A;  2MQH A;  4J1M A;  5GAD C;  3CCU A;  4DV6 Q;  1JJG A;  5EPL A;  4M1U B;  3R8B A;  1SMY D;  3MXG A;  2UUA L;  1BBU A;  1BQQ T;  4LFA L;  1KLU D;  1X6O A;  1JQY D;  4DNR B;  4GNX B;  1TU2 B;  2JA8 B;  4OIK A;  4LFA Q;  2NVX B;  1JOQ A;  3J7Z C;  4HJ7 A;  1EIG A;  4CJ2 C;  2CH4 A;  1VF5 C;  1H9K A;  2R92 G;  3T51 B;  4H02 A;  1EYG A;  5FLX E;  5C4X B;  4PMC A;  5IGC A;  4DFA A;  3BZC A;  1JT8 A;  1TR5 A;  2V4D A;  4ZYS A;  3EIV A;  2LKV A;  1IKM A;  5CC4 A;  2XRQ D;  2IY5 B;  2XIW A;  3S2H B;  3I72 A;  4BXX G;  1YIJ A;  3VA5 A;  2F0J A;  3KF6 B;  4FYD A;  3I4N H;  2KEC A;  3BYT B;  2NVY B;  3M4O B;  4A3E B;  4RAU C;  1CQV A;  3N6R A;  1KNE A;  1C0A A;  2EYM A;  1Q82 C;  1TXY A;  2QGQ A;  3S1R H;  4PV1 C;  3NTI A;  3GV6 A;  2JYO A;  2KQ3 A;  2R3Z A;  2SNM A;  1STY A;  3F8T A;  2NWG A;  3W3A A;  2LS0 1;  2HD3 A;  3ERO A;  4OON A;  4CDE C;  2EY1 A;  3RLN A;  3DWP A;  3FEW X;  3TP5 A;  2IT1 A;  4NDX A;  1UE5 A;  3I4M H;  3OIP A;  4C1N I;  1XJV A;  3HOW G;  1GUO A;  1IL2 A;  4PNY A;  4KJO A;  4G4K A;  3GD7 A;  5A2Q E;  4DR2 L;  5E1F A;  4ZQ3 A;  2YTV A;  1EYC A;  4DR2 Q;  3A0J A;  1XMO L;  1PH4 A;  2B3G A;  3STB C;  2E74 C;  4XYQ A;  1EY0 A;  2SEB D;  5GQO A;  5EAY A;  4K2K A;  1XMO Q;  5C3E G;  1SYF A;  3DMU A;  4GKK L;  2B2Y A;  4PQX A;  1SMY C;  1K0R A;  1B2T A;  3QB3 A;  5DEH A;  1I50 B;  1JWU D;  4GKK Q;  4APV A;  2F0U A;  3VR5 A;  3HOX B;  3PQI A;  3KOJ A;  4TVA B;  3T4A C;  1B9M A;  1I5F A;  1QJO A;  2K5D A;  1L0X B;  3FKI G;  1M1K C;  1KDA A;  3P7J A;  4YCW A;  3CC4 A;  5C4J H;  1G2T A;  3MC0 B;  1T5X D;  1M8A A;  3MVV A;  3HOY G;  3J7Y W;  3K7A H;  2VZA A;  4QMG A;  5JEA J;  2NVQ H;  1P16 A;  2B2W C;  1PH1 A;  1EWI A;  5M5W H;  4IFD I;  2Q8R E;  4BBS H;  1TII D;  5AFW A;  2X6L A;  3W1B A;  4KHV A;  4KV6 A;  1PA6 A;  2F3I A;  3R93 A;  5IYB G;  1G8Z D;  4BS9 A;  1B7Y B;  3H3V C;  1WJJ A;  2XGT A;  4CKB A;  3Q8D A;  1Z6H A;  1H9J A;  3DXJ C;  4JBK A;  1STA A;  1PRT C;  3CQZ H;  3LWU A;  3EA6 A;  1X3G A;  3HOV G;  1Y1W B;  4JI3 L;  4GLV B;  4JC0 A;  4U68 A;  3S2D H;  4YWL A;  2RHS B;  3NK9 A;  4CBV A;  1YI2 A;  4JI3 Q;  4A3F G;  1EZ8 A;  3HOZ H;  4A4I A;  5DM6 3;  5IWA L;  1VQJ A;  1LTB D;  4OO1 I;  4DR1 L;  3QO2 A;  2F0W A;  3TS0 A;  1HHV A;  5L37 A;  1JCK B;  2B63 B;  4KY7 A;  1KAB A;  5IWA Q;  4TRD A;  2M9V A;  4DR1 Q;  3J81 j;  5I9O A;  3H0G G;  4JI0 L;  3RZO H;  1SSO A;  4OXP A;  1Y8P B;  5FK9 C;  1TS5 A;  4X3U A;  1X3F A;  1B4O A;  4JI0 Q;  1B9N A;  4NB3 A;  4R4Q A;  5J22 A;  1XNR L;  2KOL A;  4DNI A;  1LT3 D;  5C44 B;  1PH7 A;  3S1N H;  4AYB B;  3MEH A;  1PTO D;  2VB2 X;  3ZJY C;  3VDY A;  1XNR Q;  1D7Q A;  1WTX A;  3A55 A;  2D5D A;  3J80 c;  4K5V A;  3A56 A;  1VQB A;  1Y1V H;  2R6G A;  2RCN A;  1XX8 A;  2L12 A;  5CV6 A;  4NKL A;  2QCP X;  1QVF A;  4B9W A;  4DAM A;  4A3B G;  2F0M A;  2D2C C;  1NSN S;  1B44 D;  3BZD B;  1K3B C;  4F88 A;  4AQY L;  3NPP A;  2F3W A;  4OGQ C;  4BY1 G;  2OXP A;  1SAP A;  5G3L F;  1VQG A;  3DWA A;  4AQY Q;  1OXT A;  2X6G A;  3I3C A;  1I6H H;  3QR8 A;  2D0P A;  2BCO A;  1KAA A;  1UE7 A;  5IYC H;  2N78 A;  4IPG A;  1STE A;  5HUR A;  4CJ0 B;  2K03 A;  1WTQ A;  1VQH A;  4X3S A;  5J1Z A;  4G7H C;  3GTO H;  2VQF L;  1Q90 A;  1X32 A;  1Z7T A;  2ID0 A;  4HIK A;  5H1S E;  4IUN A;  2LY7 A;  2M2L A;  2VQF Q;  2KJX A;  3T1Y Q;  1XNQ L;  1GUG A;  1BCP F;  2XNA C;  4GOP C;  1YHB A;  5JVH 3;  2HDL A;  1XNQ Q;  5M5Y H;  1A63 A;  2MUY A;  1M90 C;  1D8L A;  3PO3 B;  1UE6 A;  4RKB A;  2PW7 A;  4H7B A;  3TRE A;  5CBA E;  2XWB B;  4K6L A;  1T9H A;  1WCM H;  2B2V C;  4AYB E;  2E75 C;  2GVA A;  3HGB A;  4A3G G;  4N9P A;  4FDB A;  3M4Y A;  2WB1 E;  3AYH B;  1K8G A;  2PI2 A;  4LF8 Q;  3NBH A;  3A8J E;  1HR0 L;  1KTK A;  4BBR G;  3W1G A;  1QE6 A;  1B1Z A;  5KGU A;  2KEE A;  1HR0 Q;  3L0O A;  1VQM A;  2Y0S B;  1ONL A;  1PZI D;  2BA0 A;  3I4M B;  1RKN A;  3DEO A;  2F4I A;  2VUM B;  4A3J B;  1KDC A;  2NYZ D;  4C2M H;  2A69 C;  3X3N A;  2QDL A;  4DXF A;  3C1E A;  3ND9 A;  2PPB C;  1II3 A;  1RF2 D;  5C4X G;  2MHV A;  3WDN A;  1AEX A;  1GD7 A;  1F9R A;  5IOD A;  2AWO A;  4YWM A;  4DV3 L;  1EOV A;  4XQJ A;  3A7A B;  3PF5 A;  3H3V H;  2DJG C;  4HSV A;  1G2S A;  1Q8K A;  1O78 A;  4N9T A;  4KJN A;  4NMZ A;  3M9B A;  4DV3 Q;  2PNR C;  4X65 L;  2XWJ B;  3FRP B;  2QF7 A;  1S5E D;  1NTG A;  4X65 Q;  4JI1 L;  1PVO A;  1N9W A;  1MJE A;  1WI5 A;  2R93 G;  4JI1 Q;  1VQI A;  1TWG B;  4A3E G;  4J6H A;  1HH2 P;  2KEN A;  4KD4 A;  4EGV A;  3HOU H;  2KHI A;  1JOK A;  5BN3 A;  1EY7 A;  2ZT9 C;  1TQO A;  3K7A B;  3A5Z B;  4HTH A;  4DV2 L;  3FPU B;  5IP9 H;  1BBX C;  2DJF C;  4R1J A;  4DV2 Q;  1RTN A;  4GNX A;  1K73 C;  4JPB W;  3Q22 A;  1H9S B;  3UDG A;  1VQC A;  3OPO A;  3M4P A;  4XQQ A;  2JJQ A;  3HP3 A;  1RCV D;  2Y0S E;  4IJH A;  4ZKC B;  1MBY A;  3CHB D;  3SE0 A;  3K80 C;  1F9P A;  1ET9 A;  3IAY A;  2NBF A;  1V43 A;  3TEH B;  3VA7 A;  1TVX A;  5ELB A;  4BY7 H;  2I5H A;  3CPW A;  3SK6 A;  3S2D B;  1A15 A;  1VQ9 A;  1VQ6 A;  3D6C A;  1CHP D;  1K8A C;  3K81 C;  1XPR A;  3HOZ B;  1GHK A;  1IW7 D;  1JIC A;  2RQX A;  2PMZ B;  3D4W A;  3KF6 A;  3CMA A;  4X62 L;  1GM5 A;  4DV4 L;  4IUV A;  2KCN A;  1K9M C;  1C7Y A;  1AP0 A;  4X62 Q;  4UP9 A;  5FLM H;  5EQ0 A;  1TY2 A;  5M3M B;  2B2U A;  4DR7 L;  1SLJ A;  5GAE C;  1X56 A;  1V1Q A;  3RLF A;  1HZC A;  1QG7 A;  4DR7 Q;  3S15 H;  1NE3 A;  3F2U A;  3MXN B;  3EFX D;  1G51 A;  3JAM L;  4OIJ A;  5BR8 L;  4RGM A;  3S1N B;  1HCZ A;  2F0O A;  1EY8 A;  5LL6 S;  4TQU S;  3T56 B;  3OW2 A;  2EXZ A;  1JJ2 A;  3WWV A;  5BR8 Q;  4DPG A;  2ZM6 L;  4F7X A;  5IE8 A;  1FGU A;  2GA4 B;  3OW7 A;  1WTV A;  4JK1 C;  4RGT A;  5KIX A;  2ZM6 Q;  4YHH Q;  2H4O A;  1PYB A;  2E2J B;  2BH8 A;  3CC7 A;  2MO0 A;  3K5O A;  4XT3 B;  1LT5 D;  4L5Q A;  4NP5 A;  4QY7 A;  5J3B A;  1Y1W G;  5EGT A;  5JEA G;  1AE2 A;  2D0O A;  2Q8I B;  2RDF A;  4ZLT F;  1HFG A;  1I6H B;  4HJ5 A;  5CYU A;  3W5O A;  1Q46 A;  3EJI A;  4KLK A;  3RR5 A;  4DUY L;  1BR9 A;  1GUS A;  1HZA A;  2B63 G;  2PMZ E;  2N49 A;  4DUY Q;  1D5X C;  1S5F D;  4XTC S;  1X55 A;  4JI8 L;  5M5X H;  1SNP A;  4IUT A;  1VQO A;  1A6X A;  4AH6 A;  1FR3 A;  1EYA A;  1E2Z A;  2RDH A;  2YU9 H;  4A3K H;  1PTO H;  3J80 E;  2EZV A;  1PV4 A;  3G71 A;  2JA6 H;  2A8V A;  3MFG A;  1STG A;  5C0X H;  4H13 C;  1BVS A;  1ZEQ X;  2K28 A;  4R4I A;  4AYB G;  1TWF B;  4IFD G;  2I0Q A;  2J4X A;  5IT9 E;  1WCM B;  1I3Q B;  1TWH H;  2RHQ B;  3RZD B;  5BN4 A;  5KEE A;  3FVQ A;  1A2U A;  3QWN A;  3BDO A;  3K0Y A;  4MNO A;  1TWC B;  4C3I B;  1WTW A;  1CQF A;  2EY5 A;  5ELE A;  4DXG A;  3SXH A;  2EVB A;  2BE5 D;  1OXX K;  3KJO A;  4B3T L;  3M3Y H;  4ZAI A;  2J7Z A;  1CI3 M;  2NUC A;  3AFQ A;  3GDE A;  3ULL A;  4B3T Q;  4C2M B;  4JBW A;  1WYD A;  4RG1 A;  3JAM i;  3PO2 H;  4OO1 G;  3I7F A;  3T1H L;  4ZKB B;  2CH4 W;  3PIO A;  3C1F A;  4MHE A;  1Q7Y C;  2AMC B;  4A93 B;  3DLL A;  4QJF A;  1X54 A;  1S40 A;  1VQL A;  1ZYR D;  1CKN B;  1V8Q A;  1W6K A;  4R9W A;  1K0S A;  4OEL B;  1NBW A;  1T5E A;  2WII B;  2RVL A;  1V1O A;  3IL8 A;  2WKD A;  1F2Z A;  3LX0 A;  4POG A;  3PO3 G;  2NN6 H;  1NY4 A;  1K8M A;  3HOU B;  4R8N A;  3ULJ A;  4A75 A;  5I9P A;  5M3F H;  2QW7 A;  3VR3 A;  5E3F A;  3RN5 A;  1F2M A;  2YV5 A;  1SDF A;  1EY4 A;  1SNO A;  5C5L A;  3GTP H;  5FJ8 G;  1ASY A;  2MNA A;  3DEP A;  4YCU A;  2NVT H;  2CCZ A;  3NXW A;  4A3D B;  1V1P B;  2K14 A;  1MSH A;  3T53 B;  3KBG A;  4JBM A;  3E3X A;  4ODG A;  2QEJ C;  3HFZ B;  1VQK A;  3VYR A;  1RD9 D;  4HCS A;  3SGI A;  2UUB L;  1G29 1;  2EYF A;  2Q2H A;  3CPF A;  2RA4 A;  4V0B A;  2VUM G;  4A3J G;  2D9U A;  4OWW B;  4A76 A;  2Z4I A;  3WOE A;  4KKS A;  2L1B A;  2UUB Q;  5E4X A;  4K14 A;  4R4C A;  3JAM E;  4IOA A;  4WJ4 A;  3DWQ A;  1EQT A;  4BY7 B;  2YYZ A;  1J5E Q;  4NXM L;  1SNQ A;  2OQK A;  1IYV A;  1STB A;  2BOS A;  3E6Z X;  3J81 E;  2AQ1 B;  2NTT A;  4C3H B;  1LTR D;  4PZ6 A;  4Y7N H;  3CKI B;  5JJZ A;  2JA5 H;  2CHB D;  4NXM Q;  3EQL C;  4PZ8 A;  1PH8 A;  1K3R A;  3S17 B;  3T13 A;  3D31 A;  4DV0 L;  4IOC A;  1GUT A;  2CW0 C;  3UE1 A;  3S16 H;  1MJC A;  1QIL A;  4DV0 Q;  1LO5 D;  2F0D A;  4FF3 A;  1ESR A;  1N34 L;  2KA7 A;  2DUD A;  2E76 C;  2IPK D;  3NQT A;  3KLW A;  4IUU A;  2UUA Q;  1N34 Q;  5FO8 B;  3ONA B;  1NUC A;  5KND A;  1SRU A;  1QNK A;  3JC6 6;  5LMN W;  1CA5 A;  1IZ6 A;  2G9D A;  1CSP A;  2Z8L A;  1PH6 A;  1HR0 W;  2EJF C;  4PG3 A;  3UDF A;  1YJW A;  4KK7 A;  2A6E C;  2K5W A;  3DM3 A;  1FNV A;  1R4Q B;  3ZYY X;  4GOP B;  2MJ8 A;  1TWA H;  5CV5 A;  2EY6 A;  1PH9 A;  3PCO B;  1VMC A;  3GTG H;  3MZ5 A;  4G7O C;  3GTL H;  2BH2 A;  3F2B A;  1SRO A;  4OO1 H;  3F2D A;  1HZ9 A;  4QUC A;  3K6O A;  1J6Q A;  2JA7 G;  3QIA A;  5C0X J;  5K36 H;  3V2T A;  3I4O A;  2OT2 A;  5EKI A;  1EQQ A;  1X65 A;  4MIU A;  1SJH D;  1WTP A;  4OWT B;  1D5Z C;  4KTA A;  4NXN L;  1ZKO A;  1DYQ A;  1U4M A;  1YBY A;  5M3M G;  3DM1 A;  3H6M A;  4NXN Q;  1EIF A;  4A3M G;  5NUC A;  3K5L A;  2IW3 A;  1E2W A;  1HNX L;  1CA6 A;  1F9Q A;  2L0C A;  4FVM A;  1OXV A;  3TZU A;  3A5U A;  2K5N A;  3UDX A;  5IP7 H;  1HNX Q;  3J7A V;  3L3O C;  2DNC A;  1EYD A;  1H9S A;  2DY7 A;  3I90 A;  5IGF A;  1XTC D;  4IJL A;  4P2C B;  3AEV A;  1S3O A;  4CDD C;  2CVR A;  1KL9 A;  2F0G A;  3G4S A;  1RL2 A;  1VQN A;  2JK8 A;  4K8I A;  1K8O A;  1NNX A;  1KNA A;  1RTO A;  4O1N A;  1H9R A;  1S5C D;  1SE2 A;  3SK5 A;  4C3J H;  1NMF A;  3S9W A;  1O80 A;  3NWS A;  4QB4 A;  1BXT A;  1VQ8 A;  2R7Z H;  3I55 A;  1G91 A;  1UE1 A;  2RSN A;  1Q86 C;  2F0K A;  3E9H A;  1RJT A;  3K5N A;  2E2D C;  2FMM A;  5CV4 A;  2ZJP A;  3I73 A;  5IGE A;  4WFN 3;  1W3S A;  3E0J A;  4TSS A;  5G3L D;  4RWS C;  3OWE B;  2Q2U A;  1IL8 A;  1PH2 A;  2K4K A;  2HIX A;  2F0P A;  1PYS B;  1X9N A;  4CGY B;  1BBW A;  1P8L A;  4R4T A;  3AMU A;  3C2P A;  2NZO A;  3SHL A;  5EKL A;  1QB5 D;  3GP7 A;  1IXR A;  3KLS X;  4UAI A;  2ZTD A;  3MXN A;  3N52 A;  1I4Q A;  3I91 A;  1SJE D;  4DKA C;  2PCF B;  5J39 A;  1L0Y B;  2GVB A;  2J0T D;  5I2Y A;  3MA2 B;  1BCP D;  4H44 C;  4YIJ A;  5M3F B;  4DU9 A;  1W2B A;  3CCQ A;  3S14 H;  3G6E A;  2R92 H;  3BDL A;  2XTI A;  3K7U C;  2IL8 A;  1Z47 A;  1JE4 A;  4UP8 A;  1VQ5 A;  4HED A;  4HCE A;  1WVL A;  3KFU A;  1IHZ A;  3CC2 A;  2LSS A;  3OMC A;  5C3W A;  1SNM A;  1FNW A;  4MTK A;  2NVT B;  2EE1 A;  4HR7 B;  4KY6 A;  2B2T C;  1PMR A;  3CCM A;  2F4V L;  1E7Z A;  4LFC L;  4A3C G;  3D0F A;  4C3I G;  3E0E A;  3Q0A A;  4MZ9 A;  4JV5 L;  4XQN A;  1KQS A;  2Z0S A;  1TY0 A;  2F4V Q;  2K5V A;  3IRB A;  2N55 A;  2A73 B;  2LMC B;  4JV5 Q;  1IYU A;  4UY8 C;  1PRT F;  1B8A A;  4BXX H;  4NW2 A;  2A1A A;  2EYP A;  2QIL A;  1CTM A;  4ULL A;  3S1M H;  2Z6K C;  2N3S A;  1AE3 A;  4R8I A;  1S72 A;  3GTM H;  4DV5 L;  5K5P A;  3C3L A;  1I94 L;  2K5Q A;  4DV5 Q;  2CFM A;  1DCZ A;  4A93 G;  1BOS A;  3K57 A;  1I94 Q;  2WB1 B;  4XYO A;  4QUF A;  2L55 A;  3S16 B;  4GN5 A;  4KD3 A;  3TQY A;  2F0F A;  3NEM A;  2ICI A;  4O2D A;  1YHQ A;  3NWT A;  1PFS A;  1KXL A;  3CCE A;  3HOW H;  2JP1 A;  3EVQ A;  2FXQ A;  4WRD A;  5IY0 A;  2CWP A;  4IAL A;  2F1M A;  2HQE A;  2JSO A;  4L5S A;  3PF4 A;  5BN5 A;  4A3D G;  5I6W A;  5C3E H;  3NEL A;  4Z9C B;  3TSS A;  3FMC A;  2R7F A;  5C3X A;  4EQP A;  3NHH A;  2CWA A;  4DK3 C;  1R9T H;  2IX1 A;  1LT6 D;  2B2W A;  2K04 A;  1GXD C;  2SDF A;  4IQZ A;  4H0L C;  3IFD A;  3FKI H;  1BCP C;  4DR5 L;  4E6I A;  1ET6 A;  4RGN A;  3I4N B;  1JR0 D;  2VQE L;  1D2B A;  3HOY H;  3A74 A;  4DR5 Q;  4HIO A;  4RCO A;  4C3H G;  1XYI A;  1KLG D;  1TS4 A;  2VQE Q;  3U9O A;  1CKN A;  1GKH A;  4A3I G;  2JXM B;  4LW1 A;  2MP1 A;  3S1R B;  1O7Z A;  1X3Q A;  4IO9 A;  1QOH A;  2TSS A;  4XXE A;  1A3U A;  2V1C C;  2RDG A;  1WTO A;  4V19 0;  2BDN A;  3E9I A;  1JC7 A;  3U4Z A;  3MTS A;  1IBL L;  1FJG L;  5IYB H;  1IBL Q;  1SN8 A;  1FJG Q;  3MAQ A;  2JA8 G;  1GO3 E;  4DK0 A;  4DR6 L;  1TS3 A;  3VR6 A;  3HOV H;  4C1N K;  1V1P A;  2M00 A;  3J80 L;  4DR6 Q;  4K5W A;  2WKC A;  2R61 A;  3ITP A;  1Y8O B;  1PTO C;  4NPS A;  4A3F H;  3VYS A;  5IGG A;  4JOI C;  1ESF A;  5IT9 L;  2OF1 A;  2PZT A;  4ALP A;  3ULP A;  2E2H H;  4JI6 L;  4IUQ A;  4G57 A;  4C3J B;  4PMW A;  2C9O A;  4LF7 L;  2OWO A;  3H0G H;  4JI6 Q;  2AQ2 B;  4IPD A;  1KIX A;  3KF8 B;  2IHF A;  4JCV E;  4LF7 Q;  3NE5 B;  4DGZ A;  1ZXT A;  2OTJ A;  3MXU A;  4OHJ A;  3EN2 A;  2PZU A;  4FNF A;  4I65 A;  4O0A A;  5C4J B;  3M85 A;  4RHS A;  1B3A A;  5IYD G;  1A62 A;  3RUZ A;  1VQ7 A;  1QZG A;  4FO2 A;  1Z9F A;  1L1O C;  1Q1E A;  2XVS A;  4DV1 L;  4JI7 L;  1SYB A;  4FXG C;  2NVQ B;  4B3M L;  3Q24 A;  3CCS A;  4DV1 Q;  4ME3 A;  3RMH A;  5M5W B;  4A3B H;  3R2I A;  4RMF A;  4B3M Q;  4KY5 A;  4BBS B;  4RCN A;  4BA2 I;  3SR1 A;  1MIU A;  2E5L L;  2OCE A;  2R7D A;  4BY1 H;  1M4V A;  1VQP A;  3KBX A;  3R2T A;  3PIO 3;  3CQZ B;  1LTG D;  2E5L Q;  3PIP A;  4GKJ L;  1SE8 A;  4GOP A;  3NP8 A;  3TP7 A;  3S14 B;  2R92 B;  3UE0 A;  1S5B D;  2G5D A;  2OEO A;  4F8M A;  1YJN A;  4GKJ Q;  1BF4 A;  1C48 A;  4I7Z C;  3H15 A;  1JB7 A;  2NZH A;  1SBB B;  4LF4 L;  3GTQ H;  2B2V A;  1EIY B;  2P5Z X;  1NCV A;  3HOX G;  4LF4 Q;  1FD7 D;  4GN3 B;  1XXG A;  5FLX c;  2K01 A;  2RSO A;  4DV4 Q;  4DR3 L;  2JQO A;  3FPP A;  1U4L A;  3RZO B;  1OXS C;  1UEB A;  3MFY A;  3V05 A;  3PUX A;  4DR3 Q;  4KI0 A;  3J80 i;  4AIM A;  1K83 H;  1YNJ D;  5LHY 1;  4HMI A;  3GTM B;  3PUY A;  1LTT D;  4A3G H;  3BDC A;  3CXC A;  4A3L G;  1ICW A;  1UWV A;  2O5J C;  3J81 L;  2L5T A;  4ZUJ A;  1Y1V B;  4BBR H;  4JI5 L;  3F2C A;  1E1T A;  2VB3 X;  5HGQ A;  1D1K A;  4ZCK A;  1SR3 A;  2AKW B;  4JI5 Q;  4YY3 L;  2NVX H;  2A74 C;  2F0V A;  4HJ9 A;  3HOW B;  3FHW A;  2MPM A;  3CCL A;  4YY3 Q;  3C46 A;  1YNN D;  3B6Y A;  1CM9 A;  1I4R A;  2A6H D;  1Y14 B;  3I2Z A;  1C8C A;  5C4X H;  3HEJ A;  2WAQ B;  5KYL A;  4LF6 L;  1EQR A;  5C3E B;  1KRS A;  2K05 A;  1EOT A;  2KCT A;  4QGU A;  4MN3 A;  4LF6 Q;  3S2H H;  3H09 A;  4M8A A;  1ILQ A;  1FYC A;  3S24 A;  3GTO B;  3H3V I;  5KNC A;  2SNS A;  4JI8 Q;  2WIN B;  5IIF A;  2R93 H;  3L2P A;  4A3E H;  1PXU A;  1LV9 A;  2ASB A;  1NR2 A;  5FOB B;  5M5Y B;  4JVZ A;  2F0L A;  5C44 G;  3NQI A;  5HGT A;  2FIN B;  4OX9 L;  3G48 A;  3G6J B;  1EZ6 A;  1EFW A;  1IW7 C;  2WB1 G;  3CRL C;  4OX9 Q;  1B70 B;  3I56 A;  4QF4 A;  2L4N A;  2ZXO A;  1DJR D;  4RH6 A;  4J15 A;  1HJP A;  3AFP A;  3A7L A;  1AZP A;  1J8I A;  2F0H A;  4DK6 C;  1VF7 A;  3Q6S A;  2JEB I;  3FP9 A;  1YNJ C;  2B39 A;  3RLO A;  1SFO H;  2F0Q A;  1CFM A;  2ES2 A;  4WJ3 M;  5I2X A;  4CKE A;  1DZ1 A;  3NTK A;  3KDF B;  3O13 A;  3GQB A;  4IN3 A;  4A3F B;  2WAQ E;  2KCM A;  1I50 H;  2CQO A;  3HKZ B;  3J81 i;  1NAP A;  3HOX H;  5ELO A;  1EEF D;  2ALY B;  5IGD A;  1YVC A;  2AQ3 B;  2KHJ A;  3T1H Q;  4B08 A;  3S1Q H;  1HUN A;  3QJY A;  5ELN A;  4B9X A;  4KN7 C;  5ELF A;  3J7A F;  4CHT B;  3I4N G;  3EBE A;  4LUZ A;  4YWK A;  2A6H C;  3HS0 C;  2QKI C;  4DV7 L;  3P1H A;  2L9H A;  3HZX A;  1ENC A;  1FL0 A;  2RCF A;  5DAU A;  4FF1 A;  2XRS D;  1WOC A;  2MGS A;  1JWS D;  1DOK A;  4FXD A;  5EBD A;  1NJI C;  1CSQ A;  4RGO S;  2C35 B;  4ZUI A;  2HQL A;  1ML0 D;  2IJ0 A;  4A3B B;  4X3K A;  1DD2 A;  3ERQ A;  1U4P A;  3TBI B;  5T1I A;  1E22 A;  5CR3 A;  1A3T A;  3SDZ A;  2ICE C;  4EQN A;  2Y0S G;  3I4M G;  1KHI A;  4KKT A;  4EQ5 A;  3TP8 A;  4BY1 B;  3F1Z A;  5JEA H;  1Y1W H;  1SNC A;  2PW5 A;  3NSW A;  2K6A A;  1KRT A;  1ENA A;  1B50 A;  1CUK A;  3SEB A;  2NZ1 D;  1EQV A;  3HKZ E;  2B63 H;  2N88 A;  1YNX A;  4N8X 1;  2DN8 A;  1VCI A;  2EYL A;  1CT1 D;  3SK4 A;  2FJ2 A;  4K0K L;  1I4G A;  3VR4 A;  4L6T B;  4LMQ D;  2BE5 C;  4DN4 M;  1ILP A;  1BDO A;  4LJZ C;  4K0K Q;  2UXD L;  1FGB D;  5GRO A;  2YTY A;  1LTL A;  1C4Q A;  1VDZ A;  1WFQ A;  4UDU C;  2UXD Q;  3S15 B;  1F2L A;  2LFN A;  2B2Y C;  5TSS A;  4FF2 A;  1AN8 A;  4IFD H;  3STB D;  3HG9 A;  3UI2 A;  3BZK A;  1SYG A;  4A3G B;  5C0X I;  4F87 A;  1E1O A;  4DAY B;  1WTR A;  1IYJ B;  1JMC A;  4DA2 A;  4BBS G;  3GV3 A;  3TS2 A;  1BCP B;  5IGB A;  4BBR B;  1ZYR C;  4HAE A;  1ASZ A;  1EU4 A;  2SOB A;  1G6P A;  2PI2 E;  3K58 A;  4HJ8 A;  4CJ1 B;  1JE5 A;  5COR A;  2G9H D;  2HIV A;  1VQF A;  2WV6 D;  3BVM A;  2AWN A;  5CBE E;  4DUZ L;  4KHZ A;  2Q8T A;  3BJU A;  4DUZ Q;  3VYU A;  3Q23 A;  1F2Y A;  1Y69 U;  4JI4 L;  3HOZ G;  3ICE A;  3KF8 A;  3D4D A;  3CP0 A;  1GUN A;  4IUP A;  4JI4 Q;  4GZY C;  1AFP A;  1CZG A;  3CD6 A;  3WOF A;  4ILW A;  5D65 A;  3P20 A;  1DOL A;  3E5S A;  1N36 L;  1N8R C;  3UDI A;  5M5X B;  1Q81 C;  5EBC A;  1N36 Q;  1PZK D;  4LF9 L;  4PZ7 A;  2L15 A;  2ZJR A;  1F77 A;  2YU9 B;  1QCB D;  4A3K B;  3RD4 A;  2Z6B A;  1PTO B;  4Y52 H;  1PRT D;  3PO3 H;  1D5M C;  1GHJ A;  1AZQ A;  3OWF A;  4LF9 Q;  2R93 B;  2JA6 B;  4RHR A;  1QUQ B;  1NMG A;  5I4D A;  1BUV T;  4KN4 C;  5F2D A;  2NN6 I;  4IPC A;  5FJ8 H;  5EPJ A;  1E0B A;  2AUJ D;  4LF5 L;  1TWH B;  1Y1V G;  4RKL A;  1FNU A;  1JJC B;  4LF5 Q;  4BWG B;  5AJ3 L;  3TN2 A;  3LNN A;  3U58 A;  1LTA D;  1EL0 A;  3CCV A;  4EVO A;  1MD2 D;  3L9A X;  4L5R C;  4HSP A;  5AJ3 Q;  2VUM H;  5M9O A;  4A3J H;  1VQE A;  2JEA I;  1L1O B;  3M3Y B;  4DK1 A;  2VL6 A;  4JI2 L;  2EPB A;  1SFO B;  1S5D D;  2EQS A;  4QIW B;  2HHH L;  1C9O A;  4JI2 Q;  4HIM A;  1I4X A;  2WAQ G;  5IYC G;  3PO2 B;  2HHH Q;  3MXP A;  1RDP D;  2K75 A;  4RA8 A;  5D3I B;  3KLS A;  2RF4 A;  1LAC A;  2QA4 A;  3G7L A;  3KUP A;  5JOB A;  1S4Z A;  2UUC L;  2PNH A;  1MHW C;  5EPK A;  3KYH C;  2UXB L;  3S1Q B;  1WD0 A;  2UUC Q;  1J9O A;  3ND8 A;  1TWG H;  4U67 3;  2UXB Q;  1CKO A;  1UEA B;  3DHQ A;  5LMU L;  2I46 A;  4OEM B;  3TRZ A;  4JW0 A;  1EY6 A;  4XT1 B;  5LMU Q;  2Z4H A;  1WCM G;  5LL6 X;  1XMQ L;  1SMX A;  3GTP B;  1D6E C;  4DAV A;  1A2T A;  4LAA A;  1XMQ Q;  5EJW A;  3U9S A;  2WAC A;  1N33 L;  2QEX A;  1HFN A;  5JJK A;  2LXK A;  5CGK A;  1DXM A;  3PV0 A;  3I70 A;  1N33 Q;  1UNS A;  2RBM A;  4LFC Q;  1LLR D;  3ERS X;  3I4L A;  4IUR A;  4LWC A;  4QQB X;  4QL5 A;  1B53 A;  4RFB A;  2UXC L;  3CU7 A;  2FMC A;  1PZJ D;  4QIW E;  2F0I A;  2UXC Q;  2JA7 H;  3HKS A;  2DNE A;  2HDM A;  2HCI A;  2E2I H;  3HKZ G;  1WTH A;  4IFD J;  3PGZ A;  4K8J A;  2AHO B;  4Y7N B;  2JA5 B;  2F0S A;  1GUW A;  5EKK A;  3KJP A;  1STH A;  1SYD A;  5M3M H;  3PIP 3;  1YEZ A;  3PUZ A;  2H5X A;  1X3P A;  3OSO A;  1NR4 A;  4A3M H;  2F3V A;  5KYI A;  1R4P B;  4HN7 A;  2D62 A;  1XPU A;  3HOU G;  1JOR A;  2A69 D;  1YIT A;  2KUM A;  3PMF A;  3H94 A;  4UHV A;  1DM0 B;  5IP9 G;  4JBJ A;  1HRJ A;  5CV9 A;  3SK8 A;  3HRZ C;  1KAW A;  2PQA B;  2O4X A;  2WP8 J;  2DGY A;  1OO9 B;  2EJG C;  1FVI A;  2N8N A;  5CV7 A;  4LUO A;  2ATW A;  1F9S A;  2K7V A;  2E2J H;  4DF7 A;  1PLF A;  2FHT A;  1SE4 A;  5D14 A;  5IT9 c;  1O7I A;  2I07 B;  4P74 A;  1TWA B;  1MI2 A;  1CZW A;  2B29 A;  3KDF A;  3D8G A;  3W2D A;  2JA9 A;  1YZ6 A;  3MEF A;  3GTG B;  3FDT A;  2LXJ A;  4BY7 G;  3GTL B;  2B8G A;  1SEB D;  2JE6 I;  1STN A;  4I7A A;  4N8F A;  5I6Y A;  3BU2 A;  4GNX C;  4TKO B;  3ER0 A;  1YJ9 A;  1SE3 A;  2K33 A;  4GN4 B;  3NTH A;  2VS1 A;  3BVZ A;  1KD1 C;  3T1Y L;  2KBN A;  4XIG S;  1E2V A;  4KHP L;  4CKC A;  3LGJ A;  4K2L A;  4P72 A;  2B2T A;  4PMB A;  4DAP A;  5FLM G;  1HA6 A;  2I5L X;  1UUP A;  5DM7 3;  1TS2 A;  4KHP Q;  4FF4 A;  4X6A H;  2MO1 A;  2L11 A;  2KED A;  5FKA C;  3M7N A;  3BS1 A;  4IZ8 A;  3D6W A;  1TWF H;  1N32 L;  3GTK H;  1HTL D;  4KKU A;  3QOL A;  1HA5 A;  3CME A;  4ZRZ A;  1I3Q H;  5JAV A;  1EWC A;  1N32 Q;  4LF8 L;  1RIP A;  2F03 A;  5LMN L;  2TMP A;  3RZD H;  2Z6K A;  1HZB A;  5LMN Q;  1VQ4 A;  4A3C H;  2XSC A;  1PFB A;  1TWC H;  1BO0 A;  3K0X A;  4C3I H;  2B2U C;  4JG2 A;  3R3O A;  1QWY A;  5DNF A;  3KLR A;  1HNZ L;  2R7Z B;  5C4Z A;  4J8Q A;  1HNZ Q;  4Q0F A;  2GN5 A;  3GO5 A;  1L2F A;  2AUK A;  4EQO A;  2RKS A;  3I8Z A;  4WJW A;  4LUV A;  2VY3 A;  5FO9 B;  1PTO F;  2F0N A;  1EU3 A;  2A5H A;  2PYK A;  3PUV A;  3T16 A;  2VXW A;  3K5M A;  2F0E A;  4GLA C;  4P71 A;  3QG1 A;  3D4R A;  4A93 H;  4DR4 L;  4MTN A;  3JAM c;  5COY A;  3U4V A;  2NTS A;  1V9P A;  4UPA A;  4DR4 Q;  4JI7 Q;  3J81 c;  1ENF A;  2OQ0 A;  4A3K G;  1IBK L;  3URY A;  3CAM A;  5DLQ E;  2JA6 G;  3OTO L;  2CKZ B;  1IBK Q;  1MGS A;  4DAY A;  1AW7 A;  4B3R L;  1YHA A;  1EY5 A;  3AQQ A;  3PUW A;  5C0X G;  5A35 A;  3OTO Q;  1TT2 A;  4B3R Q;  1CKM A;  1Q3L A;  1U9R A;  4A3D H;  1IKL A;  1CHQ D;  1KDB A;  2JN4 A;  2EDG A;  4IPH A;  3M4Q A;  2FFK B;  2PQE A;  5ISR A;  3GTJ H;  4L63 B;  2HUG A;  1BKB A;  5IOC A;  1QVC A;  4BA1 I;  4OL7 A;  2BA1 A;  4LNQ A;  1EUJ A;  1U4R A;  3CF5 A;  2Q2T A;  4WOR A;  3OMG A;  1JWM D;  1LYL A;  2O2L D;  1HUM A;  3S1M B;  3PO2 G;  3M7G A;  4C3H H;  3RNU A;  2A68 D;  2JA7 B;  1PHJ A;  5GAG C;  3OIQ A;  5FO7 B;  1I4H A;  1O7Y A;  2IWH A;  1ICF B;  4A3I H;  3S17 H;  2E2I B;  4LFB L;  1EWH A;  2O5I C;  1Q8I A;  3LWE A;  4LFB Q;  2UU9 L;  1PH5 A;  4O42 A;  1QVG A;  1PDQ A;  1QUQ A;  1HQM C;  4JOI A;  2QDB A;  1A8V A;  1GVP A;  1QNU A;  1XTD A;  1X3E A;  2UU9 Q;  1I6V C;  4A3M B;  3U50 C;  2JA8 H;  2C5C A;  1LT4 D;  4ME5 A;  1PYW D;  2NN6 G;  2EIF A;  4C56 C;  4GS3 A;  3D3R A;  3CCR A;  5M3F G;  1I4P A;  1U5K A;  4R4O A;  1ROD A;  5JJL A;  3TP6 A;  4X66 L;  2WFW A;  1VMP A;  4G7Z C;  3AU7 A;  4FXK C;  4JYA L;  2PO4 A;  1MKH A;  2ZXR A;  4GLX A;  4X66 Q;  5C6A A;  2XN9 C;  3NEN A;  1HPC A;  1LTI D;  4JYA Q;  1JB3 A;  1L1O A;  2Q2I A;  1W6J A;  2B8F A;  3MHB A;  3P75 A;  2VW9 A;  3AB9 A;  2Z1C A;  3DUZ A;  5CV8 A;  3CRK C;  5JPN C;  4K6D A;  1R9T B;  3IFT A;  1SYE A;  1AH9 A;  3FKI B;  3MWY W;  2VNU D;  1G6Z A;  2NVY H;  3M4O H;  1EIH A;  4ABN A;  4LK1 C;  3NBI A;  3HOY B;  1LAB A;  1VQD A;  5IYD H;  4L5T A;  4DNT B;  2JA5 G;  5HY6 A;  5JJI A;  1LM0 A;  2F52 A;  1PFM A;  5D3D A;  2X69 A;  4HJA A;  5FLX L;  1QZH A;  1WD1 A;  3CCJ A;  3K59 A;  1E24 A;  4YHH L;  5GAH C;  3IKJ A;  3K8A A;  1Q1B A;  2NB0 A;  2EYO A;  1SYC A;  2H1E A;  3BVG A;  1HQR D;  1A0I A;  1SXT A;  2HCC A;  2ZTE A;  2ZTC A;  1OXU A;  4P73 A;  5ELD A;  5E7N A;  5T1G A;  4CDC C;  1L0W A;  1DGS A;  1DOM A;  1VS0 A;  2IX0 A;  1HXY D;  4X64 L;  1HTP A;  3L7Z C;  4KMU C;  4OWX B;  2A68 C;  3GTK B;  4POF A;  2K5H A;  2EJM A;  4X64 Q;  3HOV B;  1VQA A;  1UAP A;  2ENB A;  1H9M A;  4ID6 A;  4HID A;  3A8I E;  2CQA A;  2DY8 A;  1KC8 C;  5KNB A;  1JOO A;  2EOT A;  2BDO A;  2HT1 A;  1EEI D;  3X3M A;  1Y8N B;  2CW0 D;  2MFI A;  3NUC A;  4B3S L;  1O7L A;  1RHP A;  3OOC A;  2E2H B;  3V96 A;  5ELC A;  4B3S Q;  3J7A 5;  3TZD A;  2OTL A;  3H0G B;  2K50 A;  1IBM L;  3BG3 A;  1YNN C; 
#chains in the Genus database with same CATH homology
 2IX3 A;  4QCL A;  5JVG 3;  5A2Q L;  5K36 G;  2A6E D;  1EFI D;  1EY9 A;  3TME A;  1PRT B;  4HMJ A;  4K5X A;  3VR2 A;  1PFN A;  2EY2 A;  3TDQ A;  3KK7 A;  3VYT A;  4XDX A;  2KCC A;  2K32 A;  5C4H A;  1SND A;  3BYY B;  1BNZ A;  1CK1 A;  1A3V A;  2K1B A;  4L8J A;  5E4W C;  1D1I A;  1GOZ A;  2PZW A;  2F0T A;  2EYH A;  1MSG A;  4ZK9 B;  3GTJ B;  2ZXP A;  3A54 A;  3OHX C;  2KVM A;  1Q12 A;  4C3J G;  3GTQ B;  5KRU A;  4Q5V A;  3SVM A;  3A8K E;  5CMD A;  1LTS D;  3H91 A;  4S3S A;  5JPM C;  3QOJ A;  5C5M A;  4X3T A;  1TKW B;  1K83 B;  1XWE A;  1DON A;  2EYJ A;  2KHS A;  4A3I B;  4FP5 D;  1GJX A;  4J1M A;  5EPL A;  4M1U B;  3R8B A;  1SMY D;  3MXG A;  1BQQ T;  1KLU D;  1JQY D;  4DNR B;  2JA8 B;  1TU2 B;  4OIK A;  2NVX B;  1JOQ A;  1EIG A;  4CJ2 C;  1VF5 C;  1H9K A;  3T51 B;  5FLX E;  5C4X B;  4PMC A;  5IGC A;  4DFA A;  1TR5 A;  2V4D A;  4ZYS A;  2LKV A;  1IKM A;  5CC4 A;  2XRQ D;  2XIW A;  3S2H B;  3I72 A;  3VA5 A;  2F0J A;  4FYD A;  2KEC A;  3BYT B;  2NVY B;  3M4O B;  4A3E B;  4RAU C;  1CQV A;  3N6R A;  1KNE A;  2EYM A;  4PV1 C;  3NTI A;  3GV6 A;  2JYO A;  2KQ3 A;  2R3Z A;  2SNM A;  1STY A;  2NWG A;  3W3A A;  2LS0 1;  3ERO A;  2EY1 A;  3DWP A;  3FEW X;  3TP5 A;  2IT1 A;  4NDX A;  3OIP A;  4C1N I;  1GUO A;  4PNY A;  4KJO A;  4G4K A;  3GD7 A;  5A2Q E;  5E1F A;  4ZQ3 A;  1EYC A;  2E74 C;  4XYQ A;  1EY0 A;  2SEB D;  4K2K A;  1SYF A;  3DMU A;  2B2Y A;  4PQX A;  1SMY C;  1B2T A;  3QB3 A;  5DEH A;  1I50 B;  1JWU D;  2F0U A;  3VR5 A;  3HOX B;  3T4A C;  1B9M A;  1QJO A;  2K5D A;  1L0X B;  1KDA A;  3P7J A;  1G2T A;  3MC0 B;  1T5X D;  1M8A A;  3MVV A;  3J7Y W;  4QMG A;  5JEA J;  2B2W C;  4IFD I;  2Q8R E;  1TII D;  5AFW A;  2X6L A;  4KHV A;  4KV6 A;  3R93 A;  1G8Z D;  4BS9 A;  3H3V C;  4CKB A;  1Z6H A;  1H9J A;  3DXJ C;  1STA A;  1PRT C;  3LWU A;  3EA6 A;  1Y1W B;  4U68 A;  3NK9 A;  4CBV A;  1EZ8 A;  5DM6 3;  1LTB D;  4OO1 I;  3QO2 A;  2F0W A;  1HHV A;  1JCK B;  2B63 B;  4KY7 A;  1KAB A;  4TRD A;  2M9V A;  5I9O A;  1SSO A;  1Y8P B;  5FK9 C;  1TS5 A;  4X3U A;  1B4O A;  1B9N A;  5J22 A;  2KOL A;  1LT3 D;  5C44 B;  4AYB B;  3MEH A;  1PTO D;  2VB2 X;  1WTX A;  3A55 A;  2D5D A;  4K5V A;  3A56 A;  2R6G A;  1XX8 A;  2L12 A;  5CV6 A;  4NKL A;  2QCP X;  4B9W A;  2F0M A;  2D2C C;  1NSN S;  1B44 D;  3BZD B;  4F88 A;  3NPP A;  2F3W A;  4OGQ C;  2OXP A;  1SAP A;  5G3L F;  3DWA A;  1OXT A;  2X6G A;  3I3C A;  2BCO A;  1KAA A;  1STE A;  5HUR A;  4CJ0 B;  2K03 A;  1WTQ A;  4X3S A;  5J1Z A;  4G7H C;  1Q90 A;  1X32 A;  1Z7T A;  2ID0 A;  4IUN A;  2LY7 A;  2M2L A;  2KJX A;  1GUG A;  1BCP F;  2XNA C;  5JVH 3;  2HDL A;  2MUY A;  3PO3 B;  4RKB A;  2PW7 A;  4H7B A;  5CBA E;  2XWB B;  4K6L A;  2B2V C;  2E75 C;  3HGB A;  4N9P A;  3M4Y A;  3NBH A;  3A8J E;  1KTK A;  1QE6 A;  1B1Z A;  5KGU A;  2KEE A;  2Y0S B;  1ONL A;  1PZI D;  2BA0 A;  3I4M B;  1RKN A;  3DEO A;  2F4I A;  2VUM B;  4A3J B;  1KDC A;  2NYZ D;  2A69 C;  3X3N A;  4DXF A;  3C1E A;  3ND9 A;  2PPB C;  1II3 A;  1RF2 D;  2MHV A;  3WDN A;  1AEX A;  1F9R A;  5IOD A;  2AWO A;  4XQJ A;  3A7A B;  4HSV A;  1G2S A;  1O78 A;  4N9T A;  4KJN A;  4NMZ A;  2PNR C;  2XWJ B;  3FRP B;  2QF7 A;  1S5E D;  1TWG B;  4J6H A;  4KD4 A;  4EGV A;  1JOK A;  5BN3 A;  1EY7 A;  2ZT9 C;  1TQO A;  3K7A B;  4HTH A;  3FPU B;  1BBX C;  1RTN A;  3Q22 A;  1H9S B;  3OPO A;  4XQQ A;  3HP3 A;  1RCV D;  4ZKC B;  1MBY A;  3CHB D;  3SE0 A;  1F9P A;  1ET9 A;  3IAY A;  2NBF A;  1V43 A;  3VA7 A;  1TVX A;  5ELB A;  3SK6 A;  3S2D B;  1A15 A;  3D6C A;  1CHP D;  3HOZ B;  1GHK A;  1IW7 D;  1JIC A;  2RQX A;  2PMZ B;  3D4W A;  4IUV A;  2KCN A;  1AP0 A;  5EQ0 A;  1TY2 A;  5M3M B;  2B2U A;  3RLF A;  1QG7 A;  3F2U A;  3EFX D;  3JAM L;  4OIJ A;  4RGM A;  3S1N B;  1HCZ A;  2F0O A;  1EY8 A;  5LL6 S;  4TQU S;  3T56 B;  2EXZ A;  4F7X A;  2GA4 B;  3OW7 A;  1WTV A;  4JK1 C;  4RGT A;  5KIX A;  2H4O A;  2E2J B;  3K5O A;  4XT3 B;  1LT5 D;  4NP5 A;  5EGT A;  5JEA G;  2Q8I B;  2RDF A;  4ZLT F;  1HFG A;  1I6H B;  5CYU A;  3EJI A;  1BR9 A;  1GUS A;  1D5X C;  1S5F D;  4XTC S;  1SNP A;  4IUT A;  1A6X A;  1FR3 A;  1EYA A;  1E2Z A;  2RDH A;  1PTO H;  3J80 E;  2EZV A;  3MFG A;  1STG A;  5C0X H;  4H13 C;  1ZEQ X;  2K28 A;  1TWF B;  4IFD G;  2J4X A;  5IT9 E;  1WCM B;  1I3Q B;  3RZD B;  5BN4 A;  5KEE A;  3FVQ A;  1A2U A;  3QWN A;  3BDO A;  3K0Y A;  1TWC B;  4C3I B;  1WTW A;  1CQF A;  2EY5 A;  5ELE A;  4DXG A;  3SXH A;  2EVB A;  2BE5 D;  1OXX K;  4ZAI A;  2J7Z A;  1CI3 M;  2NUC A;  4C2M B;  4JBW A;  4OO1 G;  4ZKB B;  3C1F A;  4MHE A;  4A93 B;  1ZYR D;  1V8Q A;  1W6K A;  4R9W A;  1T5E A;  2WII B;  2RVL A;  1V1O A;  3IL8 A;  2WKD A;  1F2Z A;  3LX0 A;  2NN6 H;  1K8M A;  3HOU B;  4R8N A;  5I9P A;  3VR3 A;  5E3F A;  1F2M A;  1SDF A;  1EY4 A;  1SNO A;  5C5L A;  3DEP A;  3NXW A;  4A3D B;  1V1P B;  1MSH A;  3T53 B;  3KBG A;  4ODG A;  2QEJ C;  3VYR A;  1RD9 D;  4HCS A;  1G29 1;  2EYF A;  4V0B A;  2RA4 A;  2D9U A;  2Z4I A;  3WOE A;  4KKS A;  2L1B A;  5E4X A;  4K14 A;  3JAM E;  3DWQ A;  1EQT A;  4BY7 B;  2YYZ A;  1IYV A;  1SNQ A;  1STB A;  2BOS A;  3E6Z X;  3J81 E;  2AQ1 B;  2NTT A;  4C3H B;  1LTR D;  3CKI B;  5JJZ A;  2CHB D;  3EQL C;  3S17 B;  3T13 A;  3D31 A;  1GUT A;  2CW0 C;  1QIL A;  4FF3 A;  1LO5 D;  2F0D A;  1ESR A;  2KA7 A;  2E76 C;  2IPK D;  3NQT A;  4IUU A;  5FO8 B;  3ONA B;  1NUC A;  5KND A;  1QNK A;  1CA5 A;  2G9D A;  2Z8L A;  2EJF C;  4KK7 A;  2A6E C;  2K5W A;  1FNV A;  1R4Q B;  3ZYY X;  2MJ8 A;  5CV5 A;  2EY6 A;  1VMC A;  3MZ5 A;  4G7O C;  4OO1 H;  4QUC A;  3K6O A;  3QIA A;  5C0X J;  5K36 H;  3V2T A;  2OT2 A;  5EKI A;  4MIU A;  1SJH D;  1WTP A;  1D5Z C;  4KTA A;  1ZKO A;  1DYQ A;  1U4M A;  3DM1 A;  3H6M A;  5NUC A;  3K5L A;  2IW3 A;  1E2W A;  1CA6 A;  1F9Q A;  2L0C A;  4FVM A;  1OXV A;  3TZU A;  3J7A V;  3L3O C;  2DNC A;  1EYD A;  1H9S A;  2DY7 A;  3I90 A;  5IGF A;  1XTC D;  4P2C B;  2CVR A;  2F0G A;  4K8I A;  1K8O A;  1KNA A;  1RTO A;  4O1N A;  1H9R A;  1S5C D;  1SE2 A;  3SK5 A;  3S9W A;  1G91 A;  1O80 A;  3NWS A;  4QB4 A;  1BXT A;  2RSN A;  2F0K A;  1RJT A;  3K5N A;  2E2D C;  2FMM A;  5CV4 A;  3I73 A;  5IGE A;  4WFN 3;  3E0J A;  4TSS A;  5G3L D;  4RWS C;  3OWE B;  1IL8 A;  2F0P A;  4CGY B;  3AMU A;  3C2P A;  3SHL A;  5EKL A;  1QB5 D;  3GP7 A;  3KLS X;  4UAI A;  3MXN A;  1I4Q A;  3I91 A;  1SJE D;  3N52 A;  2PCF B;  5J39 A;  1L0Y B;  2J0T D;  5I2Y A;  3MA2 B;  1BCP D;  4H44 C;  4YIJ A;  5M3F B;  4DU9 A;  3BDL A;  2IL8 A;  1Z47 A;  1JE4 A;  4HED A;  4HCE A;  1WVL A;  1IHZ A;  3OMC A;  5C3W A;  1SNM A;  1FNW A;  2NVT B;  2EE1 A;  4HR7 B;  4KY6 A;  2B2T C;  1PMR A;  4C3I G;  3Q0A A;  4XQN A;  1TY0 A;  2N55 A;  2A73 B;  2LMC B;  1IYU A;  1PRT F;  4NW2 A;  2EYP A;  2QIL A;  1CTM A;  4ULL A;  4R8I A;  5K5P A;  3C3L A;  2K5Q A;  1DCZ A;  1BOS A;  3K57 A;  2WB1 B;  4XYO A;  4QUF A;  2L55 A;  3S16 B;  4KD3 A;  2F0F A;  2ICI A;  3NWT A;  2JP1 A;  3EVQ A;  4WRD A;  4IAL A;  2F1M A;  2HQE A;  2JSO A;  5BN5 A;  5I6W A;  4Z9C B;  3TSS A;  3FMC A;  5C3X A;  4EQP A;  3NHH A;  2IX1 A;  1LT6 D;  2B2W A;  2K04 A;  1GXD C;  2SDF A;  4IQZ A;  4H0L C;  3IFD A;  1BCP C;  4E6I A;  1ET6 A;  4RGN A;  3I4N B;  1JR0 D;  1D2B A;  4RCO A;  4C3H G;  1XYI A;  1KLG D;  1TS4 A;  3U9O A;  2JXM B;  2MP1 A;  3S1R B;  1O7Z A;  1X3Q A;  1QOH A;  4XXE A;  2TSS A;  1A3U A;  2RDG A;  1WTO A;  4V19 0;  2BDN A;  1JC7 A;  3MTS A;  3MAQ A;  4DK0 A;  1TS3 A;  3VR6 A;  4C1N K;  1V1P A;  2M00 A;  3J80 L;  4K5W A;  2WKC A;  2R61 A;  3ITP A;  1Y8O B;  1PTO C;  3VYS A;  5IGG A;  1ESF A;  5IT9 L;  2OF1 A;  2PZT A;  4IUQ A;  4G57 A;  4C3J B;  4PMW A;  2C9O A;  2AQ2 B;  3NE5 B;  4DGZ A;  1ZXT A;  3MXU A;  4OHJ A;  2PZU A;  4FNF A;  4I65 A;  5C4J B;  3M85 A;  4RHS A;  1B3A A;  3RUZ A;  4FO2 A;  1Q1E A;  2XVS A;  1SYB A;  4FXG C;  2NVQ B;  3Q24 A;  3RMH A;  5M5W B;  3R2I A;  4KY5 A;  4BBS B;  4RCN A;  4BA2 I;  3SR1 A;  1M4V A;  3KBX A;  3R2T A;  3PIO 3;  3CQZ B;  1LTG D;  3NP8 A;  3TP7 A;  3S14 B;  2R92 B;  1S5B D;  2OEO A;  4F8M A;  1BF4 A;  1C48 A;  4I7Z C;  1SBB B;  2B2V A;  1NCV A;  1FD7 D;  1XXG A;  2K01 A;  2RSO A;  3FPP A;  1U4L A;  3RZO B;  1OXS C;  3MFY A;  3V05 A;  3PUX A;  4KI0 A;  1YNJ D;  5LHY 1;  4HMI A;  3GTM B;  3PUY A;  1LTT D;  3BDC A;  1ICW A;  2O5J C;  3J81 L;  2L5T A;  4ZUJ A;  1Y1V B;  2VB3 X;  1D1K A;  2A74 C;  2F0V A;  3HOW B;  2MPM A;  3C46 A;  1YNN D;  1CM9 A;  1I4R A;  2A6H D;  1C8C A;  3HEJ A;  2WAQ B;  5KYL A;  5C3E B;  2K05 A;  1EOT A;  4MN3 A;  3H09 A;  4M8A A;  1ILQ A;  1FYC A;  3GTO B;  5KNC A;  2SNS A;  2WIN B;  5IIF A;  1PXU A;  1LV9 A;  1NR2 A;  5FOB B;  5M5Y B;  2F0L A;  3NQI A;  5HGT A;  2FIN B;  3G6J B;  1EZ6 A;  1IW7 C;  3CRL C;  4QF4 A;  2L4N A;  2ZXO A;  1DJR D;  4RH6 A;  3A7L A;  1AZP A;  1J8I A;  2F0H A;  1VF7 A;  3Q6S A;  2JEB I;  1YNJ C;  2B39 A;  2F0Q A;  1CFM A;  5I2X A;  4CKE A;  1DZ1 A;  3NTK A;  3O13 A;  3GQB A;  4IN3 A;  4A3F B;  3HKZ B;  1NAP A;  1EEF D;  5IGD A;  2AQ3 B;  4B08 A;  1HUN A;  3QJY A;  4B9X A;  4KN7 C;  5ELF A;  3J7A F;  4CHT B;  2A6H C;  3HS0 C;  2QKI C;  3P1H A;  2L9H A;  3HZX A;  1ENC A;  5DAU A;  4FF1 A;  2XRS D;  2MGS A;  1JWS D;  1DOK A;  4FXD A;  5EBD A;  4RGO S;  4ZUI A;  1ML0 D;  2IJ0 A;  4A3B B;  4X3K A;  1DD2 A;  3ERQ A;  1U4P A;  3TBI B;  5T1I A;  5CR3 A;  1A3T A;  3SDZ A;  2ICE C;  4EQN A;  4KKT A;  3TP8 A;  4BY1 B;  5JEA H;  1SNC A;  2PW5 A;  3NSW A;  2K6A A;  1ENA A;  1B50 A;  3SEB A;  2NZ1 D;  1EQV A;  2N88 A;  2DN8 A;  1VCI A;  2EYL A;  1CT1 D;  3SK4 A;  2FJ2 A;  1I4G A;  3VR4 A;  4L6T B;  4LMQ D;  2BE5 C;  4DN4 M;  1ILP A;  1BDO A;  4LJZ C;  1FGB D;  1C4Q A;  1VDZ A;  4UDU C;  3S15 B;  1F2L A;  2LFN A;  2B2Y C;  5TSS A;  4FF2 A;  1AN8 A;  4IFD H;  3HG9 A;  3UI2 A;  1SYG A;  4A3G B;  5C0X I;  4F87 A;  1WTR A;  4DA2 A;  3GV3 A;  1BCP B;  5IGB A;  4BBR B;  1ZYR C;  4HAE A;  1EU4 A;  2SOB A;  3K58 A;  4CJ1 B;  5COR A;  2G9H D;  2WV6 D;  3BVM A;  2AWN A;  5CBE E;  4KHZ A;  2Q8T A;  3VYU A;  3Q23 A;  1F2Y A;  1Y69 U;  3KF8 A;  3D4D A;  1GUN A;  4IUP A;  4GZY C;  1AFP A;  1CZG A;  3WOF A;  4ILW A;  5D65 A;  3P20 A;  1DOL A;  3E5S A;  5M5X B;  5EBC A;  1PZK D;  1F77 A;  2YU9 B;  1QCB D;  4A3K B;  3RD4 A;  1PTO B;  1PRT D;  1D5M C;  1GHJ A;  1AZQ A;  3OWF A;  2R93 B;  2JA6 B;  4RHR A;  5I4D A;  1BUV T;  4KN4 C;  5F2D A;  2NN6 I;  5EPJ A;  1E0B A;  2AUJ D;  1TWH B;  4RKL A;  1FNU A;  4BWG B;  3TN2 A;  3LNN A;  1LTA D;  1EL0 A;  4EVO A;  1MD2 D;  3L9A X;  4HSP A;  5M9O A;  2JEA I;  3M3Y B;  4DK1 A;  2EPB A;  1SFO B;  1S5D D;  4QIW B;  1I4X A;  3PO2 B;  3MXP A;  1RDP D;  4RA8 A;  5D3I B;  3KLS A;  1LAC A;  3G7L A;  3KUP A;  5JOB A;  1S4Z A;  5EPK A;  3S1Q B;  1WD0 A;  1J9O A;  3ND8 A;  4U67 3;  1UEA B;  3DHQ A;  2I46 A;  1EY6 A;  4XT1 B;  2Z4H A;  5LL6 X;  3GTP B;  1D6E C;  4DAV A;  1A2T A;  4LAA A;  5EJW A;  3U9S A;  2WAC A;  1HFN A;  5CGK A;  1DXM A;  3PV0 A;  3I70 A;  1UNS A;  2RBM A;  1LLR D;  3I4L A;  4IUR A;  1B53 A;  4RFB A;  3CU7 A;  2FMC A;  1PZJ D;  2F0I A;  2DNE A;  2HDM A;  2HCI A;  4IFD J;  4K8J A;  4Y7N B;  2JA5 B;  2F0S A;  1GUW A;  5EKK A;  1STH A;  1SYD A;  3PIP 3;  3PUZ A;  1X3P A;  3OSO A;  1NR4 A;  2F3V A;  5KYI A;  1R4P B;  4HN7 A;  2D62 A;  1JOR A;  2A69 D;  2KUM A;  3PMF A;  3H94 A;  1DM0 B;  1HRJ A;  5CV9 A;  3SK8 A;  3HRZ C;  2O4X A;  2WP8 J;  1OO9 B;  2EJG C;  5CV7 A;  1F9S A;  2K7V A;  4DF7 A;  1PLF A;  2FHT A;  1SE4 A;  5D14 A;  2I07 B;  1TWA B;  1MI2 A;  1CZW A;  3D8G A;  3W2D A;  3GTG B;  3FDT A;  3GTL B;  2B8G A;  1SEB D;  2JE6 I;  1STN A;  5I6Y A;  4TKO B;  1SE3 A;  2K33 A;  3NTH A;  3BVZ A;  4XIG S;  1E2V A;  4CKC A;  4K2L A;  2B2T A;  4PMB A;  4DAP A;  1HA6 A;  1UUP A;  5DM7 3;  1TS2 A;  4FF4 A;  2L11 A;  2KED A;  5FKA C;  3M7N A;  3BS1 A;  4IZ8 A;  3D6W A;  1HTL D;  4KKU A;  3QOL A;  1HA5 A;  4ZRZ A;  5JAV A;  1EWC A;  2F03 A;  2TMP A;  2XSC A;  1PFB A;  1BO0 A;  2B2U C;  3R3O A;  1QWY A;  5DNF A;  3KLR A;  2R7Z B;  5C4Z A;  4J8Q A;  4Q0F A;  3GO5 A;  2AUK A;  4EQO A;  2RKS A;  3I8Z A;  4WJW A;  5FO9 B;  1PTO F;  2F0N A;  1EU3 A;  2A5H A;  2PYK A;  3PUV A;  3T16 A;  2VXW A;  3K5M A;  2F0E A;  3QG1 A;  3D4R A;  5COY A;  2NTS A;  1ENF A;  3URY A;  1MGS A;  4DAY A;  1AW7 A;  1EY5 A;  3PUW A;  5C0X G;  5A35 A;  1TT2 A;  1Q3L A;  1U9R A;  1IKL A;  1CHQ D;  1KDB A;  2EDG A;  2FFK B;  2PQE A;  5ISR A;  4L63 B;  2HUG A;  5IOC A;  4BA1 I;  4OL7 A;  2BA1 A;  1U4R A;  4WOR A;  3OMG A;  1JWM D;  2O2L D;  1HUM A;  3S1M B;  3M7G A;  2A68 D;  2JA7 B;  3OIQ A;  5FO7 B;  1I4H A;  1O7Y A;  2IWH A;  2E2I B;  1EWH A;  2O5I C;  1Q8I A;  3LWE A;  4O42 A;  1PDQ A;  1HQM C;  2QDB A;  1QNU A;  1I6V C;  4A3M B;  2C5C A;  1LT4 D;  4ME5 A;  1PYW D;  2NN6 G;  4C56 C;  3D3R A;  1I4P A;  1ROD A;  3TP6 A;  1VMP A;  4G7Z C;  3AU7 A;  4FXK C;  2PO4 A;  2ZXR A;  5C6A A;  2XN9 C;  1HPC A;  1LTI D;  1JB3 A;  1W6J A;  2B8F A;  3MHB A;  3P75 A;  3AB9 A;  2Z1C A;  3DUZ A;  5CV8 A;  3CRK C;  5JPN C;  4K6D A;  1R9T B;  3IFT A;  1SYE A;  3FKI B;  3MWY W;  2VNU D;  1G6Z A;  1EIH A;  4ABN A;  4LK1 C;  3NBI A;  3HOY B;  1LAB A;  4DNT B;  1PFM A;  5D3D A;  2X69 A;  5FLX L;  1WD1 A;  3K59 A;  3IKJ A;  1Q1B A;  2NB0 A;  2EYO A;  1SYC A;  2H1E A;  1HQR D;  3BVG A;  2HCC A;  1SXT A;  5ELD A;  1OXU A;  5T1G A;  1DOM A;  2IX0 A;  1HXY D;  1HTP A;  3L7Z C;  4KMU C;  2A68 C;  3GTK B;  2EJM A;  3HOV B;  1UAP A;  2ENB A;  1H9M A;  4ID6 A;  3A8I E;  2CQA A;  2DY8 A;  5KNB A;  1JOO A;  2EOT A;  2BDO A;  1EEI D;  3X3M A;  1Y8N B;  2CW0 D;  3NUC A;  1O7L A;  1RHP A;  3OOC A;  2E2H B;  3V96 A;  5ELC A;  3TZD A;  3H0G B;  3BG3 A;  1YNN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...