4HCSA

Structure of novel subfamily cx chemokine solved by sulfur sad
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
PGVCFKVLTTKEPKANIKRCYNLPKTNNCLKCVLFVDASNRMKCIDPNASWLAERLYRLKEKGVTCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the evolution of a new chemokine family from zebrafish.
pubmed doi rcsb
source organism Danio rerio
molecule tags Signaling protein
molecule keywords Uncharacterized protein
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hcsA00
2K01A 1RTOA 2B2YA 2KVMA 1WD0A 1HFNA 1DOLA 4ZLTF 2KOLA 3IFDA 3KUPA 2MGSA 1NCVA 2KEDA 4IUUA 5E4XA 1JE4A 1WVLA 1WTRA 2L4NA 1U4LA 4ZK9B 1VMCA 1ZXTA 5EPLA 1NAPA 2JYOA 2XIWA 1RJTA 2HDLA 2H1EA 1F9PA 1O7YA 2DY8A 2MJ8A 2BDNA 4QUFA 1IKLA 1A15A 2HDMA 3I8ZA 5CBAE 1U4RA 4HSVA 3N52A 3MWYW 5CBEE 4IUVA 1G2SA 4RAUC 3F2UA 1HUMA 1X3QA 1Q3LA 4IUQA 1U4PA 1M8AA 1LV9A 4XDXA 4CJ2C 1WTQA 3HP3A 1EOTA 2IL8A 1F9QA 5AFWA 2KUMA 3DEOA 4DN4M 4ZAIA 1B50A 1PFBA 2B2VC 4XT3B 4ZKCB 1SSOA 3R93A 1C8CA 2B2TA 2Q8RE 4QUCA 1BO0A 2RSNA 2X6LA 3H91A 3I90A 1RHPA 1CA6A 1ILPA 4X3SA 4X3TA 2K28A 2HCIA 2KECA 5EPKA 1B4OA 3GV6A 2FINB 5EKIA 4IUTA 4CJ0B 4OIKA 1DOKA 2NWGA 3I91A 5DNFA 1MSGA 2K05A 1G6ZA 1HHVA 2R3ZA 4RA8A 1EIGA 1X32A 1E0BA 1JICA 2KEEA 1G2TA 2MP1A 1PFNA 2B2YC 2NZ1D 2HCCA 1NR4A 2N88A 5EQ0A 1F9RA 5COYA 1SDFA 1QNKA 2B2UA 3KBXA 3TZDA 1WTPA 2L1BA 4HEDA 1TVXA 2RA4A 1EQTA 2FJ2A 3P7JA 4X3KA 2Q8TA 3SVMA 1B53A 2L11A 2K04A 3ONAB 2FMMA 2NYZD 3Q6SA 1B2TA 1EL0A 1RODA 1DONA 4IURA 1SAPA 1WTXA 1CA5A 1ML0D 4IUPA 1MI2A 2RSOA 3I3CA 2M2LA 5D65A 3TN2A 2SDFA 1B3AA 2D9UA 2B2UC 1MSHA 2EE1A 2X69A 5EPJA 1PFMA 2B2WC 1F2LA 1ILQA 1NR2A 2FFKB 1U4MA 5D14A 3LWEA 1WD1A 1O7ZA 1CM9A 5T1IA 4CJ1B 1BNZA 1BBXC 2L12A 4O42A 2RVLA 1VMPA 3IL8A 4HAEA 2K1BA 1ESRA 4X3UA 2X6GA 1F9SA 2MPMA 1IKMA 3FPUB 4LMQD 4R8IA 1RTNA 4MN3A 4R9WA 1HUNA 1KNEA 5T1GA 5E4WC 5CORA 3D6WA 1S4ZA 1IL8A 2B2VA 3MTSA 4OIJA 1AP0A 3DM1A 1HFGA 4NW2A 2B2TC 2EPBA 4U68A 1ICWA 1QE6A 1PLFA 2L9HA 1KNAA 2VXWA 3QO2A 1EIHA 2CVRA 4HCSA 5CMDA 1WTOA 2JP1A 4UAIA 1MGSA 1J9OA 3G7LA 1XX8A 2J7ZA 1AZQA 1G91A 2N55A 1O80A 1PDQA 5EJWA 1BF4A 3GV3A 2FHTA 2HUGA 1DOMA 3UI2A 1AZPA 1J8IA 1HA6A 2B2WA 2DY7A 1GUWA 1QG7A 1XYIA 1DZ1A 1X3PA 2K03A 3DEPA 3FDTA 2EOTA 4XT1B 4RWSC 5JJZA 1WTWA 4ZKBB 1HRJA 4MHEA 1WTVA
chains in the Genus database with same CATH superfamily
2DUDA 3UE0A 3U50C 1YIJA 1E2WA 4MZ9A 1PH1A 1GXDC 4LW1A 2EYPA 5M5XH 4JV5Q 1XNRQ 4GKJL 3CC7A 3LNNA 1FJGQ 3N6RA 4L5SA 3NTIA 5LMNW 2HDMA 2O5JC 3MWYW 4OGQC 1N9WA 1HUMA 2IW3A 3TRZA 1F77A 2RDHA 1HZAA 3TREA 1SNOA 4HJAA 3RN2A 3I4MH 2E2DC 5KYLA 4A3KG 2CW0D 4UP7A 4L8JA 2M00A 3GTKH 1I94Q 3FHWA 5CV5A 1IW7D 3JAME 4JI7L 1RHPA 4RGMA 1C0AA 3ZYYX 5EGTA 2KQ3A 2JA8B 1H9MA 2EXDA 3GV6A 3I91A 4RHSA 4Y7NH 1ET6A 4Q0FA 1RD9D 4KKTA 4BXXH 2UXCQ 2NZ1D 3ITPA 2K6AA 2K5QA 5I6YA 4FYDA 4DR6Q 5CV7A 4GN3B 3E6ZX 4JCVE 3ONAB 1JB3A 2F0MA 2ZJPA 1Q8IA 1QOHA 1IXRA 5CGKA 3VR3A 4X64L 1XWEA 5DM73 2M2LA 3KLRA 3F2DA 1GHJA 1PH7A 4KHVA 3S1RH 4A3MH 1ILQA 2F0NA 3T16A 1UUPA 5JVH3 4P72A 5FLMG 2PI2E 3VYSA 1EZ8A 2F0OA 4TQUS 5HGTA 3RZDB 5JEAG 2P5ZX 1V1QA 2JXMB 3MEFA 2K5VA 4K5XA 3HOZH 1S4ZA 2B2VA 2JQOA 4OIJA 1AP0A 1SN8A 1D5MC 2KHJA 4R4QA 5GADC 5IP7H 4XYQA 1D2BA 4HJ9A 2SNSA 1D7QA 2K7VA 3HOWH 3NE5B 3S24A 1VQ8A 5C3XA 4AQYL 1DZ1A 2QCPX 2OTJA 1X3FA 1EUJA 5FO9B 4I65A 1B1ZA 4MIUA 2E8GA 3VA5A 4B3RQ 3S14H 3P75A 4B3MQ 2IHEA 3OIPA 2A69C 1YEZA 4IUUA 1XMOL 5C44B 3T1HQ 1W6JA 1D1IA 1YNJC 4CDFC 3A74A 5G3LF 1VQKA 2ALYB 4KKUA 2Z1CA 5M5XB 4OO1H 3T13A 2ASBA 2DY8A 2E2HH 3I4OA 5IOCA 1PH9A 3AFQA 2D2CC 3L0OA 1D6EC 4IOAA 1JJGA 1PYWD 2A68D 4A3LG 5C4HA 5CR3A 4DR1L 1BUVT 5KNDA 3HP3A 5AFWA 1LT4D 1PFSA 1CTMA 3AMUA 5C4XG 2KCCA 1FVIA 2DNCA 4C2MH 2X6LA 3I90A 4L5RC 1JWMD 2NVXB 4A3CH 1BKBA 3NENA 4X65L 4R8NA 1JR0D 4OL7A 2KECA 4LNQA 3KF8A 3CC2A 1QUQB 2TSSA 1MSGA 4DR5Q 3HOUG 4N9TA 4UP9A 2WKDA 1PFNA 2B2YC 2BOSA 4DK3C 3NWTA 1NY4A 4DV0L 1Y8NB 1HPCA 1IYJB 1Q46A 3D3RA 2UXDQ 2F1MA 3NP8A 3TQYA 4JI2Q 2Z9HA 1LT5D 1PRTF 4LFCQ 4K2LA 4O42A 3S1RB 2HQEA 3BYTB 1Y1VG 1JOOA 1F9SA 3KF6A 3KDFB 4YIJA 5DLQE 5D3DA 1HUNA 3CHBD 2F0QA 1SNQA 2ZM6L 3MVVA 2Q8IB 2GVBA 1E1TA 2N78A 4ZYSA 4A3FH 1VQBA 2PQAA 2EJMA 4NXNQ 5NUCA 2JE6I 3GV3A 4KHPL 5I9PA 4A93H 2VZAA 1ZKOA 4C3IH 3HKZG 3T56B 4DV3L 4PMWA 1AN8A 1JWUD 4A3LH 3M3YH 2QDBA 4WJ3M 2KVMA 4A4IA 1JWSD 1SMYC 1Z6HA 1YHAA 4A3IG 2F0IA 2HIVA 4A3KH 2XN9C 1BBWA 4GNXC 1SNMA 1KRSA 3D6CA 4GKKL 3N52A 1A3TA 1B9NA 4M1UB 4RAUC 2K33A 3BYYB 1EEID 4XDXA 4TKOB 4XQJA 2VY3A 3DEOA 4ZAIA 2IPKD 1RKNA 4LUVA 3WDNA 1C8CA 2B2TA 2C35B 4C3JH 2B8GA 1HNZL 4BBSB 2C9OA 1AH9A 4GOPB 3UE1A 1LUZA 3FEWX 4X3TA 3BZCA 4ALPA 1FR3A 4O1NA 1N34Q 2I46A 4ODGA 3QG1A 1AE2A 3FRPB 3SGIA 1NBWA 3TSSA 5JAVA 5E1FA 1SYFA 2N49A 3HFZB 1WTPA 5M3MB 3I4NB 1QZHA 1W6KA 2NVYH 4PMCA 1ASYA 1Z9FA 5EBCA 2X69A 1KAAA 5A35A 1BQQT 1LTGD 5FLXL 5T1IA 1STBA 1SBBB 4LJZC 3CAMA 4A3JH 4JV5L 4OO1I 1E22A 1Y69U 3HS0C 3GTJB 4V190 1R4PB 4ABNA 2K52A 3J7A5 4H44C 1R9TH 1N36Q 2A1AA 3GTGH 1IBKL 3PQIA 3TS2A 1OXVA 1SMXA 1BCPC 1TWAB 1HFGA 2NVQH 2RDFA 4K6DA 4K5WA 1FGBD 1PLFA 5DM63 1KNAA 1SRUA 4IPCA 1WTOA 3A5UA 1J9OA 1EFID 3OOCA 2CQOA 2SOBA 4EVOA 4BBRG 2JA8H 4A3GB 5LMNL 1GKHA 5IWAL 3J81i 5M3FB 1KAWA 4K5VA 1I6HB 3I4LA 2WFWA 4DR7Q 2B63H 2R6GA 1D5ZC 2JA9A 4IN3A 4LWCA 2R93B 1CHPD 2YTYA 4DR5L 1TWHB 2CHBD 5KEEA 4DV6L 2CCZA 5C3WA 3IAYA 2JA7B 1GUNA 1BXTA 2AQ3B 2PZUA 1STHA 1E24A 5IE8A 1FNWA 2BE5D 2O2LD 1U4RA 2BE5C 4HJ5A 4IUVA 4PNYA 1Q3LA 4XXEA 3T53B 1A2TA 1EOTA 3NELA 2OEOA 1QWYA 3OTOQ 2NN6I 2RKSA 4RGNA 1WTHA 4DV3Q 2F4VQ 3SE0A 4DV2L 1LTLA 4O0AA 2E76C 3C3LA 3OMCA 3VYTA 3BDCA 5EKLA 2Z6KA 4UHVA 4DK6C 2K05A 3DHQA 2LXJA 1EU4A 4LFAQ 4B9XA 2F0UA 4OELB 4EQOA 4QQBX 2Y0SB 4L5QA 1J5EL 3OW7A 1X6OA 4ME5A 1TVXA 1X54A 3AQQA 4YCUA 3M85A 4ME3A 4RKLA 2NYZD 4DV4L 1CQFA 1L1OB 2Z8LA 3FPPA 1EZ6A 4HSPA 3HOXG 4FP5D 1I4QA 3KOJA 1I3QH 1QJOA 1OO9B 2K5DA 4N8X1 4A3FG 1V1PB 4DU9A 1B8AA 1WD1A 1EYDA 4LF7Q 2MO0A 3X3MA 2F0LA 4X3UA 1Q86C 2K75A 3HOVB 3Q22A 5IYBH 2Q2UA 4H0LC 1FYCA 2OXPA 1QZGA 1R9TB 4LF8Q 1ICWA 2NB0A 4DV7Q 2QDLA 3CF5A 1EIHA 5IYDG 3SEBA 1JT8A 1G6PA 4IPGA 1X3PA 3DEPA 3V05A 1TWFH 3ULPA 2L15A 1EQQA 3PIP3 3SK4A 5IWAQ 2EIFA 1WD0A 5JJLA 1CKMA 2E75C 2RHSB 2GVAA 3IKJA 1EQVA 3DWQA 4G4KA 4AH6A 1LTTD 3LWUA 1EY8A 3I56A 3S2HB 2HHHQ 4EQ5A 5GQOA 1NTGA 4XTCS 2EY6A 3HEJA 3MZ5A 4BBRH 1PV4A 4FF4A 4FO2A 1AFPA 3GD7A 3T1YL 2CH4A 4GKKQ 3Q24A 4HSVA 5GROA 3FKIH 3F2UA 3C1FA 5KNBA 3OMGA 3HOYG 1D8LA 1EYCA 2AUKA 4OWTB 4HJ7A 4DR4Q 2XRQD 1QVCA 4EQPA 1UE1A 1V1OA 1SMYD 1ESFA 3CPFA 2R92H 5FLMH 3W2DA 5IODA 3PUZA 3A56A 3I7FA 3S2DH 5DAUA 2MFIA 1S5ED 4OHJA 1ILPA 2UUAL 1Y8PB 4U673 3IFTA 4JI3Q 3MXGA 4JBWA 3EVQA 4B3SQ 4LUZA 3WOEA 3PO3H 2F3IA 1NJIC 1SYDA 4RA8A 3K5NA 1DXMA 4IJHA 2EQSA 2Q2TA 5M5WH 5COYA 3OW2A 3E0JA 4A3BB 1S5BD 4HEDA 3M3YB 4CKCA 1X3EA 3ICEA 2F0VA 1SYBA 3KFUA 4DV1L 5C6AA 3CC4A 3QOLA 1OXUA 3PIOA 4BBSG 5CC4A 5M5YB 3S17B 1A8VA 3W5OA 2BH8A 1KTKA 3EQLC 1ESRA 2F4VL 1XTCD 2X6GA 5F2DA 4L63B 2CFMA 1IKMA 4HIMA 2DNEA 5T1GA 3GQBA 1IL8A 4A3DG 3OIQA 4K8IA 1QE6A 4YHHQ 2ZXRA 3ULJA 2EVBA 5C5MA 4C3HH 1HNXL 1HR0L 4P73A 4GNXB 4OXPA 1O80A 2KCNA 4RKBA 1KD1C 3EROA 4QJFA 4HTHA 4G7HC 5LMNQ 5LHY1 1G8ZD 5JJZA 4CBVA 4DV5Q 2LXKA 5HGQA 4JW0A 1HZBA 1C9OA 1CSPA 2JEAI 1C48A 4GOPC 4YWMA 3NBHB 1I4XA 4H02A 4KJOA 2JJQA 3PCOB 3TBIB 3VR6A 3HOWB 2JK8A 4UP8A 1IHZA 1TQOA 1WJJA 4BY1H 4A3EB 2RHQB 4KTAA 3TP5A 1PH8A 5CBEE 4YWLA 2E2IH 2R7ZB 3DUZA 2LS01 2CWPA 5TSSA 4CJ2C 1EY9A 3VDYA 3CKIB 2UUCQ 5C3EG 3AFPA 3RUZA 2Q8RE 1V1PA 1GVPA 3DLLA 4DUZQ 3U9OA 1PA6A 1M1KC 2KHSA 2ZTEA 2E2HB 2YTVA 3ER0A 3G4SA 1YNNC 3J7YW 4CDCC 2ICEC 1VQ7A 3GTPH 1K0RA 2BA1A 2XSCA 5M9OA 4GLXA 1UWVA 3U4ZA 1BCPF 3RD4A 2R92B 2NN6G 2ZXPA 4LUOA 1HZ9A 3U9SA 2A8VA 4C2MB 2J4XA 2GA4B 3HOXB 3QWNA 1GM5A 5D65A 3U4VA 3CXCA 2B2UC 1MSHA 3PO3G 3W3AA 1PMRA 1H9RA 3LWEA 1CM9A 4B3TL 3MFGA 4MNOA 4WFN3 5IYDH 1VQEA 4LF4Q 1XPOA 3FPUB 4IOCA 4AYBE 2R93H 1MHWC 2EYJA 3MTSA 5ELOA 4CHTB 4K0KQ 2PO4A 4HR7B 3EIVA 3G71A 2VUMH 1EY5A 4DAVA 2NVTH 3A55A 3BVGA 2XWJB 1AZPA 1CQVA 1LTSD 1C4QA 3GTOH 4DV2Q 2QF7A 1PTOF 1EIYB 1WTWA 1ASZA 4LK1C 1CSQA 2V1CC 2NTSA 5C0XJ 3E9HA 2WINB 2AWNA 4FVMA 1ZYRC 1DCZA 1TWCH 1EU3A 1VQDA 4KY5A 1VQCA 5C3EB 1JORA 1U4LA 2KA7A 3S1NB 3PF5A 2BA0A 1W3SA 2K5HA 4C1NI 1SJHD 4UY8C 1LABA 2NN6H 1H9KA 3D0FA 3I55A 5I6WA 4JI6Q 1K83B 3I8ZA 5CBAE 4A93B 1Z47A 2A74C 2K5NA 1L2FA 3GTLH 4RHRA 2AHOB 4RH6A 2Z6BA 2E74C 2GN5A 3GTGB 1TS3A 2QILA 4LF5Q 2MHVA 2Z6KC 2EYMA 1PFBA 4DR2Q 1BR9A 4DAMA 4ZRZA 1K3BC 5D3IB 3TMEA 1E3PA 4MTNA 1CA6A 4Q5VA 2Y0SE 4F87A 5C4ZA 4B3SL 4JI3L 1PTOD 1DOKA 4EX5A 4RFBA 1OXXK 1JJCB 1E7ZA 5GAGC 2B63B 4FDBA 4UPAA 2OQ0A 1A62A 1Y1VB 4BWGB 5EQ0A 2NBFA 1IZ6A 2KHIA 2CW0C 3KBXA 4JI1Q 1BCPD 3P7JA 4DUYQ 3K6OA 1B53A 2L11A 4HIDA 3J81j 1RODA 4IJLA 2B63G 1MI2A 3QB3A 2E5LQ 3CCQA 2WAQE 1G2TA 2PQAB 1MJCA 2ZJQA 5KGUA 1K8MA 2UUBQ 1KDBA 4HAEA 1CKNA 1KABA 3B6YA 3F8TA 4POFA 4A3CG 3BJUA 3CCUA 2OTLA 2JEBI 3I70A 1QCBD 1GO3E 3PO2H 1NE3A 2LFNA 3KF6B 2NVYB 3DM1A 3H15A 4C3HB 2EPBA 4F8MA 2SEBD 1P8LA 1TY2A 5KYIA 1HNXQ 1HR0Q 3PF4A 3SHLA 2TMPA 1YI2A 2R7ZG 4P2CB 2AKWB 1K9MC 1VDZA 3O13A 4J1MA 2R93G 2NVTB 4DV5L 1EY6A 4XT1B 4IZ8A 4NKLA 2HQLA 2JA6G 4KJNA 1WOCA 3IFDA 3RLFA 4WJ4A 5CV4A 1XNQQ 4FF3A 4OWWB 4IPHA 3NSWA 1YJWA 4GZYC 5KIXA 1AW7A 4JI0Q 1DM0B 1WCMB 1B7YB 2NVXH 5IP9G 1CZGA 4A3GH 1EEFD 4AIMA 1LACA 5BN4A 2ZT9C 4JOIA 3NQTA 1WTQA 2IL8A 1BBUA 3URYA 4RCNA 2KBNA 4NMZA 1Q81C 1RDPD 2RBMA 2D62A 3KJPA 3F2CA 1N33Q 1B3QA 1GD7A 5I4DA 4MTKA 1YNXA 3K59A 4HIKA 2UXBQ 3MC0B 4P74A 2K28A 1PRTB 1X9NA 5M5YH 1I6VC 4OIKA 1SR3A 1KRTA 4KKSA 4HN7A 3BVMA 1X32A 4KK7A 4C3IB 2KEEA 2RQXA 2YU9H 2F03A 2ZTDA 1L0XB 2R7FA 1VQ5A 3OTOL 3I4MG 5BR8L 5ELBA 4BY7B 1M90C 1GUGA 1TXYA 4DR3Q 4BY1G 3KDFA 2EJFC 1KLUD 4G7OC 3MXNA 1LTBD 1CK1A 2L0CA 1N34L 1X65A 1G6ZA 3TN2A 3KK7A 4LF9Q 2SDFA 2VUMG 4BA2I 3K5OA 3D4DA 4LF6L 1TS2A 1HQMC 2PZWA 4XYOA 3RLNA 1V43A 2K1BA 2WV6D 3CCRA 2E2JH 2F0PA 2F0GA 1K73C 1R4QB 3BG3A 4K2KA 2VS1A 3M4OB 3E0EA 1XMQL 3PUYA 2OWOA 5JOBA 3J80L 1NMGA 3G7LA 1XTDA 1IYVA 3PIO3 1AZQA 5LL6X 1J8IA 2AMCB 5IP9H 4QCLA 4HIOA 5C4JH 1XNRL 3HZXA 5K5PA 1I6HH 1WCMG 2D0OA 5JPMC 3U58A 1OXTA 1YJ9A 4CKBA 1PH5A 1DJRD 2OQKA 4PZ8A 1QB5D 1HFNA 2E5LL 2RCNA 2JN4A 4BBSH 3HOZB 2PQEA 4TRDA 4POGA 3VYRA 3JAMi 3MHBA 2F0TA 2XIWA 3E3XA 1FNVA 4C3JG 3VR5A 1IKLA 2KENA 1VQFA 4IQZA 4A3DH 1RIPA 2CQAA 1U4PA 3NQIA 1YNND 1VQNA 4QIWB 1STYA 3H0GB 2OT2A 3A0JA 3M4QA 4NPSA 3RR5A 3GTMB 1GHKA 2UXCL 3NUCA 3T1YQ 3H91A 3DWPA 3UDXA 5I9OA 4GS3A 1IW7C 4O2DA 1O78A 1B4OA 4P75A 5C5LA 4CJ0B 2NZHA 5IYCH 4B9WA 4DGZA 1ENAA 1E2VA 4EGVA 1TKWB 1M4VA 2RCFA 2H4OA 4IALA 3SK5A 3BZKA 3L7ZC 2VW9A 1X3GA 3CPWA 1YZ6A 3J81c 3TZDA 3K0XA 1UAPA 4DXFA 1EQTA 3V2TA 3PO2G 4R4CA 1K8AC 1DONA 2F0DA 4CDDC 2XNAC 1ZEQX 1TY0A 2RSOA 4J6HA 4QIWE 5LMUL 1GUOA 2R7ZH 5C0XH 4DV7L 1JOKA 1XNQL 1HQRD 1PYBA 5D14A 3WWVA 3PMFA 4ULLA 5CV8A 4A75A 1BBXC 2PNRC 2UUBL 3MXNB 3CCEA 1GJXA 2MPMA 3PO2B 4KN4C 3Q23A 4MN3A 3MFYA 2JA6H 2EYLA 4BY7H 1EWIA 5E4WC 1I4RA 4NW2A 1L1OC 3TZUA 4LF8L 1HTPA 4PG3A 4NB3A 2PI2A 3GP7A 2ES2A 1XX8A 4C56C 1Q90A 1TWFB 1IBMQ 1MIUA 3MAQA 4CKEA 1RL2A 3NEMA 2WKCA 1WTVA 1B44D 4WJWA 5M3FG 5K36H 2MGSA 5ELFA 1JE4A 2XGTA 1XJVA 1ZXTA 5EPLA 2F0HA 3R2TA 4YCVA 4FXDA 1PXUA 1S5CD 5KRUA 4L6TB 1T9HA 1A0IA 1J5EQ 4JI8L 4CGYB 2CKZB 4Y7NB 2DJGC 4DV4Q 3STBD 4RGTA 5IYCG 3OWEB 4IFDJ 3SDZA 1HNWL 5FK9C 1M8AA 2F0KA 2EXZA 4HMIA 1SLJA 2F52A 3S1QH 3X3NA 3S2DB 1NMFA 1BCPB 3TP8A 2K50A 4ZUIA 1HR0W 3K0YA 1Z7TA 3EBEA 4F7XA 1STNA 2HCIA 2FINB 4I7ZC 1LTAD 3Q0AA 5DNFA 2KJXA 1XMQQ 3L2PA 1I50B 3BS1A 3A8KE 3M7GA 1VF7A 3HOVH 2UUCL 1LYLA 1TWCB 2FXQA 5C3EH 4JG2A 3I4NG 4OONA 2Z4IA 3L3OC 2UUAQ 3BDOA 4KD3A 1VQ6A 2LMCB 2Y0SG 1HH2P 1FGUA 2Q8TA 3ERSX 4DNRB 1EOVA 2B8FA 2F0WA 1EFWA 3CQZB 2D9UA 2EE1A 1PYSB 4GNXA 1XXGA 3S2HH 3UDIA 2QA4A 2LY7A 4QMGA 3H0GG 3EJIA 1L1OA 3NWSA 2JA5H 3MXUA 1VQ4A 3VA7A 1QILA 3S14B 3GO5A 3HRZC 4R8IA 4C3IG 4GN4B 2WACA 4DFAA 2PMZB 1CFMA 3QOJA 2A6HC 3S1MB 2L9HA 2VXWA 4LFCL 1KC8C 4JI2L 3A7LA 1CZWA 1PDQA 5EJWA 5HURA 2FHTA 4PQXA 3A54A 4DAYA 2DY7A 3FKIB 5ELNA 2I07B 2PYKA 1Y1VH 4JOIC 1XPRA 2B39A 4GOPA 3TEHB 2B2YA 1EWCA 1T5XD 4DR1Q 1LT6D 1A63A 2RDGA 4DK0A 2VL6A 1NCVA 3FKIG 3VR2A 4QGUA 3H6MA 2BH2A 1VMCA 3K7AH 1JQYD 2SNMA 1Q1EA 1S5FD 4A3DB 1H95A 1A15A 1CT1D 1K0SA 4KHZA 5IT9L 3HOUH 4R4OA 4DA2A 2WAQB 1YNJD 2F3VA 2LKVA 1B50A 3S1MH 4PV1C 4XT3B 1SSOA 3PV0A 4GN5A 1TWHH 4JI8Q 1XPUA 4J15A 1STEA 2EZVA 3TS0A 1PH6A 1VQAA 4DUZL 3G6JB 3LGJA 1IBLL 3SK8A 4E6IA 3HKZB 1I5FA 1ZYRD 5EPKA 3PGZA 3CRKC 3MXPA 1SFOB 1HXYD 1ENFA 4G57A 3ZJYC 3RNUA 1A3UA 2D0PA 5AJ3Q 2R3ZA 1HZCA 1O7LA 2AWOA 4N8FA 3WOFA 2MP1A 3AB9A 4JVZA 4A76A 1PRTC 4HMJA 1PZID 3C46A 4JPBW 4OX9Q 2KCMA 1N32Q 3JC66 2L1BA 5E3FA 4A3BG 1ONLA 2WB1E 3RLOA 1EL0A 1B9MA 1K3RA 5LMUQ 1CA5A 1IBKQ 3GTQB 3OWFA 5EPJA 1SYCA 1VQIA 2B2WC 1YBYA 2NUCA 4DK1A 1O7ZA 1BNZA 3KYHC 3PIPA 1VCIA 1WI5A 3KLSA 4DUYL 1PTOH 4JI1L 3S15H 2PCFB 2JA5B 4R9WA 3HOYB 2EYOA 2OF1A 3D6WA 1W2BA 4HCEA 2IT1A 2B2TC 4U68A 2JSOA 3NBIA 2CH4W 1LM0A 1UNSA 3R8BA 3I2ZA 4A3IH 1G91A 4Z9CB 3CCMA 1I3QB 1TS4A 2EJGC 1GUWA 1HA6A 1N36L 4A3EH 3NHHA 2EOTA 1A3VA 4RWSC 3M4YA 1GUSA 2O5IC 1MJEA 1RTOA 4P71A 3NTKA 4PMBA 5IYBG 1S3OA 4ID6A 3STBC 5C44G 1DOLA 1YHQA 4YCWA 3S1NH 4N9PA 1BVSA 4C3JB 1Q8KA 3ULLA 1AE3A 5A2QL 1FJGL 2QGQA 1L0YB 4JI4Q 2H1EA 4WRDA 5FO7B 1JOQA 4QUFA 1KDAA 4QF4A 1ICFB 5C0XI 4DR7L 3D8GA 5ELCA 3S1QB 1U9RA 4H7BA 3I73A 5K36G 1F2YA 4C3HG 1JCKB 2F4IA 3MA2B 2RSNA 1WFQA 2DJFC 3J7AF 2ICIA 4LF4L 1UEBA 4TVAB 5GAHC 1S72A 3HOXH 1PH3A 4RGOS 4FNFA 1VQHA 3SK6A 4BBRB 2I5LX 4LFBL 2F3WA 4A3JB 5IP7G 3T1HL 2VB2X 3VYUA 1E0BA 3M4PA 3BVZA 4S3SA 4K8JA 4JK1C 4DAPA 5CYUA 1F9RA 1SDFA 1OXSC 2B2UA 2L5TA 3HKSA 1SEBD 4A3JG 2RA4A 2NVQB 2J0TD 1VQGA 3SVMA 2K04A 2NZOA 5GAEC 1Q12A 4FF1A 4YY3Q 3I3CA 4X62Q 3EA6A 1F2LA 3PO3B 3GTOB 4OX9L 2L12A 2QW7A 4DR3L 5JJIA 3K5LA 2VNUD 4L5TA 1SNCA 4IPDA 4ZCKA 4QL5A 3S16B 1D1KA 4A3BH 4C1NK 4I7AA 1FL0A 1TR5A 5FLXE 4TSSA 1TWGB 3BDLA 2JA7H 1NSNS 2K5WA 3T51B 1TT2A 2N8NA 4ZUJA 5BN3A 3CMEA 3D31A 4GLAC 5I2XA 4DV6Q 2BDOA 4JBKA 4LF6Q 4NXMQ 3CD6A 2A19A 2HUGA 1DOMA 4FF2A 2B2WA 1UEAB 3NXWA 4ZQ3A 2I5MX 4IFDI 3EFXD 1I4PA 3KBGA 4A3GG 5EKKA 2KEDA 3S9WA 3OYYA 1VQOA 3PUXA 2EY5A 1J6QA 1WYDA 2ID0A 4J8QA 1CUKA 2IX0A 3J80E 4JI0L 3KF8B 4V0BA 1SROA 2WB1G 1RF2D 3UDGA 3JAMc 1I94L 2AUJD 4PZ6A 4CDEC 5JVG3 2EDGA 2B2VC 1BOSA 4ZKCB 4NXNL 5IGEA 3HG9A 5L37A 3CMAA 3TP6A 2IX1A 2VB3X 1CKOA 1BO0A 3OHXC 3G6EA 3J80i 3FMCA 1IYUA 5FKAC 1Q7YC 5DEHA 4X3SA 2A69D 4DR4L 2E2IB 4LFBQ 4BA1I 2EY2A 1STAA 3DM3A 3A7AB 4NP5A 5FOBB 5M3MG 3H0GH 1B2TA 4DNTB 5FO8B 5IT9E 1LTID 5FJ8G 3P20A 1EY4A 3CP0A 2CWAA 4IUNA 1B3AA 1Y1WH 4KLKA 3K57A 4KI0A 3S15B 3RZDH 1QNUA 2RVLA 3TDQA 4DNIA 1H9SB 4JI4L 4KHPQ 4R4TA 1DYQA 1RTNA 4AQYQ 5C44H 3SR1A 2PNHA 4JBMA 3F1ZA 3H3VC 1H9SA 2UU9Q 3NTHA 1PZKD 1XMOQ 2K32A 3QO2A 4HCSA 5IGFA 2JP1A 5JEAJ 1MGSA 1N8RC 1QUQA 5C4JB 2J7ZA 1SYGA 5CV9A 3UI2A 4NXML 4FXGC 4OEMB 2YYZA 1K28A 2K03A 3W1GA 4AYBG 3FVQA 1KIXA 2UXBL 2YTXA 2VQEL 2H5XA 4MHEA 3K7UC 2K01A 3CCVA 2JA6B 3H3VI 4K0KL 4YHHL 1LLRD 4WORA 4YY3L 2KOLA 1MBYA 2ATWA 3A8IE 1SE8A 5FLXc 4BXXG 3KJOA 3RMHA 4QY7A 1NAPA 2PMZE 1VS0A 4AYBB 5JJKA 5BR8Q 1K8GA 4A93G 2QEXA 1F9PA 1O7YA 2MO1A 1MD2D 4M8AA 3H09A 5IIFA 3T4AC 3QIAA 5A2QE 3GTJH 3R2IA 3KLSX 3OSOA 3QR8A 3L9AX 1Y14B 5M3FH 2YU9B 4JI5Q 3HGBA 1AEXA 2A6ED 2KUMA 1TWAH 4XIGS 5CV6A 2RF4A 3CRLC 1HNZQ 2HIXA 5J1ZA 1GUTA 1UE5A 2XTIA 3NPPA 2QKIC 2D5DA 3ND8A 4DAYB 2R7DA 4IUTA 1X56A 2NWGA 2Z0SA 2WIIB 3RZOH 4IFDH 1JICA 4DXGA 1SYEA 3D4WA 2O4XA 1NUCA 2N88A 1SE3A 2IJ0A 3MEHA 1Q82C 1SJED 3J7AV 4BY7G 4NDXA 5IGCA 3I4MB 2FJ2A 1S40A 1UE7A 5IY0A 3AYHB 3W1BA 1SXTA 1F2ZA 4HJ8A 3TP7A 4X62L 4A3FB 5IT9c 1NR2A 1VQJA 1H9JA 3NBHA 4CJ1B 5J3BA 2Q2HA 3UDFA 1VMPA 3S16H 1JE5A 1IBML 1QVGA 1VQ9A 4LMQD 4X6AH 2EY1A 2N3SA 3E5SA 1TWGH 1PTOC 4K14A 1OTCA 3ERQA 1SE2A 4BS9A 1CHQD 4X66L 2WB1B 3GTMH 2A5HA 2QEJC 1PHJA 1EYAA 4B3TQ 5C0XG 1SFOH 4UAIA 3OPOA 4OO1G 1A6XA 4IO9A 3DWAA 4A3KB 1LO5D 1QG7A 3I72A 1EWHA 2K4KA 1A2UA 2VQFQ 4JYAL 4ZKBB 1HRJA 1TIID 1G51A 1VF5C 4RG1A 4GLVB 1GOZA 5JPNC 3HKZE 2PZTA 3KUPA 1CKNB 5KNCA 4LF5L 2A6HD 1X55A 3BU2A 4UDUC 3GTQH 4GKJQ 2IHFA 1KLGD 3HOWG 2JYOA 3K58A 2EYFA 3K7AB 1KQSA 5G3LD 5IGDA 1PH2A 5EBDA 4H13C 3J7ZC 1D5XC 1G2SA 4KMUC 3CCJA 1X3QA 4IUQA 2G9HD 1PRTD 2DN8A 2K14A 1LV9A 4IFDG 3DMUA 2MUYA 3P1HA 2PW7A 1IL2A 2JA7G 1F9QA 4LAAA 1PZJD 1TS5A 3A8JE 1EY0A 1KHIA 5J39A 3J80c 3LX0A 3I4NH 1JC7A 3A5ZB 5M3MH 5ELDA 4QUCA 3HOVG 4R1JA 4KY7A 1FD7D 4F88A 3D4RA 1WCMH 4JI6L 1FNUA 1U0LA 1C7YA 1PH4A 3C1EA 1E2ZA 1KDCA 5ELEA 3PUVA 3G48A 2UU9L 1F2MA 1HHVA 2A6EC 5C4XH 5IGGA 2I0QA 3RZOB 1ENCA 3R3OA 4DR2L 1NR4A 2PPBC 2MNAA 1QNKA 2NTTA 3QJYA 2Q2IA 4KD4A 2R92G 4KN7C 4X3KA 2JA5G 1HTLD 2FMMA 3Q6SA 4OWXB 2VUMB 3AU7A 4IURA 1SAPA 1ML0D 2HT1A 3Q8DA 1Q1BA 3F2BA 1SNPA 1PFMA 2G5DA 4LFAL 1U4MA 2KCTA 4DF7A 2JA8G 1YHBA 1JJ2A 1DD2A 1YJNA 1HJPA 1JMCA 2WAQG 2XVSA 2AQ2B 4DKAC 4RCOA 4JI7Q 1G291 1V8QA 1KNEA 1T5EA 2C5CA 3IRBA 4DPGA 5IGBA 4R4IA 2F0JA 1HNWQ 2M9VA 2Z4HA 2B3GA 3H3VH 3PUWA 1O7IA 1II3A 5CMDA 1STGA 2B29A 2PW5A 3V96A 4EQNA 2N55A 1BF4A 4XQQA 1HA5A 3DXJC 1K83H 1XYIA 1VQPA 2VQEQ 3FDTA 2IWHA 1SE4A 5M5WB 2WP8J 2I5HA 4JYAQ 3GTLB 5JEAH 3HOYH 1I50H 4X64Q 2ZJRA 2HD3A 3CW2C 2E2JB 3HOZG 1PTOB 4JBJA 4ZLTF 2F0FA 4JC0A 4B3ML 2AQ1B 1Y1WG 4Y52H 1UE6A 1WVLA 1WTRA 5E4XA 2L4NA 3K81C 3KLWA 4ZK9B 4YWKA 3CCSA 2DGYA 1L0WA 3M4OH 1LTRD 1RJTA 2HDLA 1RCVD 2F0SA 3CCLA 3S17H 1VQMA 4A3EG 2MJ8A 2BDNA 3CU7A 5EAYA 1PVOA 1IBLQ 3BZDB 1V9PA 3CQZH 2XWBB 1Y1WB 4K6LA 2V4DA 2ZM6Q 2IX3A 2ZXOA 1K8OA 1EIFA 4ILWA 3PSIA 4JI5L 1KXLA 4DN4M 3J81E 1SNDA 1DGSA 1JB7A 4RMFA 1EY7A 3R93A 2MQHA 2FMCA 3M9BA 1N32L 3H94A 1VQLA 1NNXA 3K80C 5HY6A 3J81L 5FJ8H 2F0EA 4KY6A 3M7NA 3GDEA 4PZ7A 2XRSD 5EKIA 4X65Q 2A68C 1BDOA 3C2PA 4X66Q 4BY1B 3VR4A 2OCEA 2LSSA 1CI3M 4A3MG 5E7NA 1EIGA 2G9DA 1N33L 4LF9L 1YVCA 2R61A 4XQNA 2HCCA 4DR6L 3K5MA 3NK9A 1B70B 1LT3D 5I2YA 3AEVA 1U5KA 4LF7L 5J22A 1TU2B 1E1OA 4DV0Q 1YITA 5H1SE 1HCZA 3ND9A 4DV1Q 3SXHA 2EYHA 5AJ3L 1WTXA 4FXKC 4IUPA 1P16A 2YV5A 5LL6S 4A3MB 4QB4A 2UXDL 3EN2A 4APVA 2ZTCA 2FFKB 5C4XB 3RN5A 1QVFA 4KV6A 2IY5B 3IL8A 3GTPB 3E9IA 2ENBA 3HOUB 1EYGA 1I4HA 5CORA 2L55A 1Y8OB 1I4GA 2BCOA 1S5DD 1EQRA 1MKHA 4A3IB 1ET9A 2CVRA 3K8AA 3GTKB 1KL9A 4B08A 2HHHL 5ISRA 2A73B 5BN5A 2VQFL 4G7ZC 3JAML 3FP9A 4B3RL
chains in the Genus database with same CATH topology
1E2WA 1GXDC 2EYPA 3LNNA 3N6RA 3NTIA 2HDMA 2O5JC 3MWYW 4OGQC 1HUMA 2IW3A 1F77A 2RDHA 1SNOA 2E2DC 5KYLA 2CW0D 4L8JA 2M00A 5CV5A 3JAME 1IW7D 1RHPA 4RGMA 3ZYYX 5EGTA 2KQ3A 2JA8B 1H9MA 3GV6A 3I91A 4RHSA 1ET6A 4Q0FA 1RD9D 4KKTA 2NZ1D 3ITPA 2K6AA 2K5QA 5I6YA 4FYDA 5CV7A 3E6ZX 3ONAB 1JB3A 2F0MA 1Q8IA 1QOHA 5CGKA 3VR3A 1XWEA 5DM73 2M2LA 3KLRA 1GHJA 4KHVA 1ILQA 2F0NA 3T16A 1UUPA 5JVH3 3VYSA 1EZ8A 2F0OA 4TQUS 5HGTA 3RZDB 5JEAG 2JXMB 4K5XA 1S4ZA 2B2VA 4OIJA 1AP0A 1D5MC 4XYQA 1D2BA 2SNSA 2K7VA 3NE5B 5C3XA 1DZ1A 2QCPX 5FO9B 4I65A 1B1ZA 4MIUA 3VA5A 3P75A 3OIPA 2A69C 4IUUA 5C44B 1W6JA 1D1IA 1YNJC 5G3LF 4KKUA 2Z1CA 5M5XB 4OO1H 3T13A 2DY8A 5IOCA 2D2CC 1D6EC 1PYWD 2A68D 5C4HA 5CR3A 1BUVT 5KNDA 3HP3A 5AFWA 1LT4D 1CTMA 3AMUA 2KCCA 2DNCA 2X6LA 3I90A 1JWMD 2NVXB 4R8NA 1JR0D 4OL7A 2KECA 3KF8A 2TSSA 1MSGA 4N9TA 2WKDA 1PFNA 2B2YC 2BOSA 3NWTA 1Y8NB 1HPCA 3D3RA 2F1MA 3NP8A 1LT5D 1PRTF 4K2LA 4O42A 3S1RB 2HQEA 3BYTB 1JOOA 1F9SA 4YIJA 5D3DA 1HUNA 3CHBD 2F0QA 1SNQA 3MVVA 2Q8IB 4ZYSA 2EJMA 5NUCA 2JE6I 3GV3A 5I9PA 1ZKOA 3T56B 4PMWA 1AN8A 1JWUD 2QDBA 2KVMA 1JWSD 1SMYC 1Z6HA 2F0IA 2XN9C 1SNMA 3D6CA 3N52A 1A3TA 1B9NA 4M1UB 4RAUC 2K33A 3BYYB 1EEID 4XDXA 4TKOB 4XQJA 3DEOA 4ZAIA 2IPKD 1RKNA 3WDNA 1C8CA 2B2TA 2B8GA 4BBSB 2C9OA 3FEWX 4X3TA 1FR3A 4O1NA 2I46A 4ODGA 3QG1A 3FRPB 3TSSA 5JAVA 5E1FA 1SYFA 1WTPA 5M3MB 3I4NB 1W6KA 4PMCA 5EBCA 2X69A 1KAAA 5A35A 1BQQT 1LTGD 5FLXL 5T1IA 1STBA 1SBBB 4LJZC 4OO1I 1Y69U 3HS0C 3GTJB 4V190 1R4PB 4ABNA 4H44C 1OXVA 1BCPC 1TWAB 1HFGA 2RDFA 4K6DA 4K5WA 1FGBD 1PLFA 5DM63 1KNAA 1WTOA 1J9OA 1EFID 3OOCA 2SOBA 4EVOA 4A3GB 5M3FB 4K5VA 1I6HB 3I4LA 2R6GA 1D5ZC 4IN3A 2R93B 1CHPD 1TWHB 2CHBD 5KEEA 2JA7B 5C3WA 3IAYA 1GUNA 1BXTA 2AQ3B 2PZUA 1STHA 1FNWA 2BE5D 2O2LD 1U4RA 2BE5C 4IUVA 4PNYA 1Q3LA 4XXEA 3T53B 1A2TA 1EOTA 2OEOA 1QWYA 2NN6I 2RKSA 4RGNA 3SE0A 2E76C 3C3LA 3OMCA 3VYTA 3BDCA 5EKLA 2K05A 3DHQA 1EU4A 4B9XA 2F0UA 4EQOA 2Y0SB 3OW7A 4ME5A 1TVXA 3M85A 4RKLA 2NYZD 1CQFA 2Z8LA 3FPPA 1EZ6A 4HSPA 4FP5D 1I4QA 1QJOA 1OO9B 2K5DA 1V1PB 4DU9A 1WD1A 1EYDA 3X3MA 2F0LA 4X3UA 3HOVB 3Q22A 4H0LC 1FYCA 2OXPA 1R9TB 1ICWA 2NB0A 1EIHA 3SEBA 1X3PA 3DEPA 3V05A 3PIP3 3SK4A 1WD0A 2E75C 3IKJA 1EQVA 3DWQA 4G4KA 1LTTD 3LWUA 1EY8A 3S2HB 4XTCS 2EY6A 3HEJA 3MZ5A 4FF4A 4FO2A 1AFPA 3GD7A 3Q24A 4HSVA 3F2UA 3C1FA 5KNBA 3OMGA 1EYCA 2AUKA 2XRQD 4EQPA 1V1OA 1SMYD 1ESFA 3W2DA 5IODA 3PUZA 3A56A 5DAUA 1S5ED 4OHJA 1ILPA 1Y8PB 4U673 3IFTA 3MXGA 4JBWA 3EVQA 3WOEA 1SYDA 4RA8A 3K5NA 1DXMA 5COYA 3E0JA 4A3BB 1S5BD 4HEDA 3M3YB 4CKCA 2F0VA 1SYBA 5C6AA 3QOLA 1OXUA 5CC4A 5M5YB 3S17B 1KTKA 3EQLC 1ESRA 1XTCD 2X6GA 5F2DA 4L63B 1IKMA 2DNEA 5T1GA 3GQBA 1IL8A 3OIQA 4K8IA 1QE6A 2ZXRA 2EVBA 5C5MA 1O80A 2KCNA 4RKBA 3EROA 4HTHA 4G7HC 5LHY1 1G8ZD 5JJZA 4CBVA 2JEAI 1C48A 1I4XA 4KJOA 3TBIB 3VR6A 3HOWB 1IHZA 1TQOA 4A3EB 4KTAA 3TP5A 5CBEE 2R7ZB 3DUZA 2LS01 5TSSA 4CJ2C 1EY9A 3CKIB 3RUZA 2Q8RE 1V1PA 3U9OA 2KHSA 2E2HB 1YNNC 3J7YW 2ICEC 2BA1A 2XSCA 5M9OA 1BCPF 3RD4A 2R92B 2NN6G 2ZXPA 3U9SA 4C2MB 2J4XA 2GA4B 3HOXB 3QWNA 5D65A 2B2UC 1MSHA 3W3AA 1PMRA 1H9RA 3LWEA 1CM9A 3MFGA 4WFN3 3FPUB 2EYJA 3MTSA 4CHTB 2PO4A 4HR7B 1EY5A 4DAVA 3A55A 3BVGA 2XWJB 1AZPA 1CQVA 1LTSD 1C4QA 2QF7A 1PTOF 1WTWA 4LK1C 2NTSA 5C0XJ 2WINB 2AWNA 4FVMA 1ZYRC 1DCZA 4KY5A 1EU3A 5C3EB 1JORA 1U4LA 2KA7A 3S1NB 2BA0A 4C1NI 1SJHD 1LABA 2NN6H 1H9KA 5I6WA 1K83B 3I8ZA 5CBAE 4A93B 1Z47A 2A74C 4RHRA 4RH6A 3GTGB 2E74C 1TS3A 2QILA 2MHVA 2EYMA 1PFBA 1BR9A 4ZRZA 5D3IB 3TMEA 1CA6A 4Q5VA 4F87A 5C4ZA 1PTOD 1DOKA 4RFBA 1OXXK 2B63B 1Y1VB 4BWGB 5EQ0A 2NBFA 2CW0C 3KBXA 1BCPD 3P7JA 3K6OA 1B53A 2L11A 1RODA 1MI2A 3QB3A 1G2TA 5KGUA 1K8MA 1KDBA 4HAEA 1KABA 2JEBI 3I70A 1QCBD 2LFNA 2NVYB 3DM1A 4C3HB 2EPBA 4F8MA 2SEBD 1TY2A 5KYIA 3SHLA 2TMPA 4P2CB 1VDZA 3O13A 4J1MA 2NVTB 1EY6A 4XT1B 4IZ8A 4NKLA 4KJNA 3IFDA 3RLFA 5CV4A 4FF3A 3NSWA 4GZYC 5KIXA 1AW7A 1DM0B 1WCMB 1CZGA 1EEFD 1LACA 5BN4A 2ZT9C 3NQTA 1WTQA 2IL8A 3URYA 4RCNA 4NMZA 1RDPD 2RBMA 2D62A 5I4DA 3K59A 3MC0B 2K28A 1PRTB 1I6VC 4OIKA 4KKSA 4HN7A 3BVMA 1X32A 4KK7A 4C3IB 2KEEA 2RQXA 2F03A 1L0XB 5ELBA 4BY7B 1GUGA 2EJFC 1KLUD 4G7OC 3MXNA 1LTBD 1CK1A 2L0CA 1G6ZA 3TN2A 3KK7A 4BA2I 2SDFA 3K5OA 3D4DA 1TS2A 1HQMC 2PZWA 4XYOA 1V43A 2K1BA 2WV6D 2F0PA 2F0GA 1R4QB 3BG3A 4K2KA 3M4OB 3PUYA 5JOBA 3J80L 3G7LA 1IYVA 3PIO3 1AZQA 5LL6X 1J8IA 4QCLA 3HZXA 5K5PA 5JPMC 1OXTA 4CKBA 1DJRD 1QB5D 1HFNA 3HOZB 2PQEA 4TRDA 3VYRA 3MHBA 2F0TA 2XIWA 1FNVA 4C3JG 3VR5A 1IKLA 4IQZA 2CQAA 1U4PA 3NQIA 1YNND 4QIWB 1STYA 3H0GB 2OT2A 3GTMB 1GHKA 3NUCA 3H91A 3DWPA 5I9OA 1IW7C 1O78A 1B4OA 5C5LA 4CJ0B 4B9WA 4DGZA 1ENAA 1E2VA 4EGVA 1TKWB 1M4VA 2H4OA 4IALA 3SK5A 3L7ZC 3TZDA 1UAPA 4DXFA 1EQTA 3V2TA 1DONA 2F0DA 2XNAC 1ZEQX 1TY0A 2RSOA 4J6HA 1GUOA 5C0XH 1JOKA 1HQRD 5D14A 3PMFA 4ULLA 5CV8A 1BBXC 2PNRC 1GJXA 2MPMA 3PO2B 4KN4C 3Q23A 4MN3A 3MFYA 2EYLA 5E4WC 1I4RA 4NW2A 3TZUA 1HTPA 3GP7A 1XX8A 4C56C 1Q90A 1TWFB 3MAQA 4CKEA 2WKCA 1WTVA 1B44D 4WJWA 5K36H 2MGSA 5ELFA 1JE4A 1ZXTA 5EPLA 2F0HA 3R2TA 4FXDA 1PXUA 1S5CD 5KRUA 4L6TB 4CGYB 4Y7NB 4RGTA 3OWEB 4IFDJ 3SDZA 5FK9C 1M8AA 2F0KA 2EXZA 4HMIA 3X3NA 3S2DB 1BCPB 3TP8A 4ZUIA 3K0YA 1Z7TA 4F7XA 1STNA 2HCIA 2FINB 4I7ZC 1LTAD 3Q0AA 5DNFA 2KJXA 1I50B 3BS1A 3A8KE 3M7GA 1VF7A 1TWCB 2Z4IA 3L3OC 3BDOA 4KD3A 2LMCB 2Q8TA 4DNRB 2B8FA 2F0WA 3CQZB 2D9UA 2EE1A 1XXGA 2LY7A 4QMGA 3EJIA 3NWSA 3MXUA 3VA7A 1QILA 3S14B 3GO5A 3HRZC 4R8IA 4C3IG 2WACA 4DFAA 2PMZB 1CFMA 3QOJA 2A6HC 3S1MB 2L9HA 2VXWA 3A7LA 5EJWA 1CZWA 1PDQA 5HURA 2FHTA 4PQXA 4DAYA 3A54A 2DY7A 3FKIB 2I07B 2PYKA 2B39A 2B2YA 1EWCA 1T5XD 1LT6D 2RDGA 4DK0A 1NCVA 3VR2A 3H6MA 1VMCA 1JQYD 2SNMA 1Q1EA 1S5FD 4A3DB 1A15A 1CT1D 4KHZA 5IT9L 4DA2A 2WAQB 1YNJD 2F3VA 2LKVA 1B50A 4PV1C 4XT3B 1SSOA 3PV0A 1STEA 2EZVA 3G6JB 3SK8A 4E6IA 3HKZB 1ZYRD 5EPKA 3CRKC 3MXPA 1SFOB 1HXYD 1ENFA 4G57A 1A3UA 2R3ZA 1O7LA 2AWOA 3WOFA 2MP1A 3AB9A 1PRTC 4HMJA 1PZID 3C46A 2L1BA 5E3FA 1ONLA 1EL0A 1B9MA 1CA5A 3GTQB 3OWFA 5EPJA 1SYCA 2B2WC 2NUCA 4DK1A 1O7ZA 1BNZA 1VCIA 3KLSA 1PTOH 2PCFB 2JA5B 4R9WA 3HOYB 2EYOA 2OF1A 3D6WA 4HCEA 2IT1A 2B2TC 4U68A 2JSOA 3NBIA 1UNSA 3R8BA 1G91A 4Z9CB 1I3QB 1TS4A 2EJGC 1GUWA 1HA6A 3NHHA 2EOTA 1A3VA 4RWSC 3M4YA 1GUSA 2O5IC 1RTOA 3NTKA 4PMBA 4ID6A 1DOLA 4N9PA 4C3JB 5A2QL 1L0YB 2H1EA 4WRDA 5FO7B 1JOQA 4QUFA 1KDAA 4QF4A 5C0XI 3D8GA 5ELCA 3S1QB 1U9RA 4H7BA 3I73A 5K36G 1F2YA 4C3HG 1JCKB 2F4IA 3MA2B 2RSNA 3J7AF 2ICIA 4RGOS 4FNFA 3SK6A 4BBRB 2F3WA 4A3JB 3VYUA 2VB2X 1E0BA 3BVZA 4S3SA 4K8JA 4JK1C 4DAPA 5CYUA 1F9RA 1SDFA 1OXSC 2B2UA 2L5TA 1SEBD 2RA4A 2NVQB 2J0TD 3SVMA 2K04A 1Q12A 4FF1A 3I3CA 3EA6A 1F2LA 3PO3B 3GTOB 2L12A 3K5LA 2VNUD 1SNCA 3S16B 1D1KA 4C1NK 1TR5A 5FLXE 4TSSA 1TWGB 3BDLA 1NSNS 2K5WA 3T51B 1TT2A 4ZUJA 5BN3A 3D31A 5I2XA 2BDOA 2HUGA 1DOMA 4FF2A 2B2WA 1UEAB 3NXWA 4ZQ3A 4IFDI 3EFXD 1I4PA 3KBGA 5EKKA 2KEDA 3S9WA 3PUXA 2EY5A 2ID0A 4J8QA 2IX0A 3J80E 4V0BA 1RF2D 2AUJD 5JVG3 2EDGA 2B2VC 1BOSA 4ZKCB 5IGEA 3HG9A 2IX1A 3TP6A 2VB3X 1BO0A 3OHXC 3FMCA 1IYUA 5FKAC 5DEHA 4X3SA 2A69D 2E2IB 4BA1I 2EY2A 1STAA 3A7AB 4NP5A 5FOBB 1B2TA 4DNTB 5FO8B 5IT9E 1LTID 3P20A 1EY4A 4IUNA 1B3AA 3K57A 4KI0A 3S15B 1QNUA 2RVLA 3TDQA 1H9SB 1DYQA 1RTNA 3SR1A 3H3VC 1H9SA 3NTHA 1PZKD 2K32A 3QO2A 4HCSA 5IGFA 2JP1A 5JEAJ 1MGSA 5C4JB 2J7ZA 1SYGA 5CV9A 3UI2A 4FXGC 2YYZA 2K03A 3FVQA 4MHEA 2K01A 2JA6B 1LLRD 4WORA 2KOLA 1MBYA 3A8IE 3RMHA 1NAPA 4AYBB 1F9PA 1O7YA 4M8AA 1MD2D 3H09A 5IIFA 3T4AC 3QIAA 5A2QE 3R2IA 3KLSX 3OSOA 3L9AX 2YU9B 3HGBA 1AEXA 2A6ED 2KUMA 4XIGS 5CV6A 3CRLC 5J1ZA 1GUTA 3NPPA 2QKIC 2D5DA 3ND8A 4IUTA 2NWGA 2WIIB 4IFDH 1JICA 4DXGA 1SYEA 3D4WA 2O4XA 1NUCA 2N88A 1SE3A 2IJ0A 3MEHA 1SJED 3J7AV 4NDXA 5IGCA 3I4MB 2FJ2A 1SXTA 1F2ZA 3TP7A 4A3FB 1NR2A 3NBHA 1H9JA 4CJ1B 1VMPA 4LMQD 2EY1A 3E5SA 1PTOC 4K14A 3ERQA 1SE2A 4BS9A 1CHQD 2WB1B 2A5HA 2QEJC 1EYAA 5C0XG 4UAIA 3OPOA 4OO1G 1A6XA 3DWAA 4A3KB 1LO5D 1QG7A 3I72A 1EWHA 1A2UA 4ZKBB 1HRJA 1TIID 1VF5C 1GOZA 5JPNC 2PZTA 3KUPA 5KNCA 2A6HD 4UDUC 1KLGD 2JYOA 3K58A 2EYFA 3K7AB 5G3LD 5IGDA 5EBDA 4H13C 1D5XC 1G2SA 4KMUC 1X3QA 4IUQA 2G9HD 1PRTD 2DN8A 4IFDG 1LV9A 3DMUA 2MUYA 3P1HA 2PW7A 1F9QA 4LAAA 1PZJD 1TS5A 3A8JE 1EY0A 5J39A 3LX0A 1JC7A 5ELDA 4QUCA 4KY7A 1FD7D 4F88A 3D4RA 1FNUA 3C1EA 1E2ZA 1KDCA 5ELEA 3PUVA 1F2MA 1HHVA 2A6EC 5IGGA 3RZOB 1ENCA 3R3OA 1NR4A 2PPBC 1QNKA 2NTTA 3QJYA 4KD4A 4KN7C 4X3KA 1HTLD 2FMMA 3Q6SA 2VUMB 3AU7A 4IURA 1SAPA 1ML0D 1Q1BA 1SNPA 1PFMA 1U4MA 4DF7A 1DD2A 2XVSA 2AQ2B 4RCOA 1G291 1V8QA 1KNEA 1T5EA 2C5CA 5IGBA 2F0JA 2M9VA 2Z4HA 3PUWA 1II3A 5CMDA 1STGA 2PW5A 3V96A 4EQNA 2N55A 1BF4A 4XQQA 1HA5A 3DXJC 1XYIA 3FDTA 2IWHA 1SE4A 5M5WB 2WP8J 3GTLB 5JEAH 2E2JB 1PTOB 4ZLTF 2F0FA 2AQ1B 1WVLA 1WTRA 5E4XA 2L4NA 4ZK9B 1LTRD 1RJTA 2HDLA 1RCVD 2F0SA 2MJ8A 2BDNA 3CU7A 3BZDB 2XWBB 1Y1WB 4K6LA 2V4DA 2IX3A 2ZXOA 1K8OA 4ILWA 4DN4M 3J81E 1SNDA 1EY7A 3R93A 2FMCA 3H94A 3J81L 2F0EA 4KY6A 3M7NA 2XRSD 5EKIA 2A68C 1BDOA 3C2PA 4BY1B 3VR4A 1CI3M 1EIGA 2G9DA 2R61A 4XQNA 2HCCA 3K5MA 3NK9A 1LT3D 5I2YA 5J22A 1TU2B 1HCZA 3ND9A 3SXHA 2EYHA 1WTXA 4FXKC 4IUPA 5LL6S 4A3MB 4QB4A 2FFKB 5C4XB 4KV6A 3IL8A 3GTPB 2ENBA 3HOUB 1I4HA 5CORA 2L55A 1Y8OB 1I4GA 2BCOA 1S5DD 4A3IB 1ET9A 2CVRA 3GTKB 4B08A 5ISRA 2A73B 5BN5A 4G7ZC 3JAML
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K01 A;  1RTO A;  2B2Y A;  2KVM A;  1WD0 A;  1HFN A;  1DOL A;  4ZLT F;  2KOL A;  3IFD A;  3KUP A;  2MGS A;  1NCV A;  2KED A;  4IUU A;  5E4X A;  1JE4 A;  1WVL A;  1WTR A;  2L4N A;  1U4L A;  4ZK9 B;  1VMC A;  1ZXT A;  5EPL A;  1NAP A;  2JYO A;  2XIW A;  1RJT A;  2HDL A;  2H1E A;  1F9P A;  1O7Y A;  2DY8 A;  2MJ8 A;  2BDN A;  4QUF A;  1IKL A;  1A15 A;  2HDM A;  3I8Z A;  5CBA E;  1U4R A;  4HSV A;  3N52 A;  3MWY W;  5CBE E;  4IUV A;  1G2S A;  4RAU C;  3F2U A;  1HUM A;  1X3Q A;  1Q3L A;  4IUQ A;  1U4P A;  1M8A A;  1LV9 A;  4XDX A;  4CJ2 C;  1WTQ A;  3HP3 A;  1EOT A;  2IL8 A;  1F9Q A;  5AFW A;  2KUM A;  3DEO A;  4DN4 M;  4ZAI A;  1B50 A;  1PFB A;  2B2V C;  4XT3 B;  4ZKC B;  1SSO A;  3R93 A;  1C8C A;  2B2T A;  2Q8R E;  4QUC A;  1BO0 A;  2RSN A;  2X6L A;  3H91 A;  3I90 A;  1RHP A;  1CA6 A;  1ILP A;  4X3S A;  4X3T A;  2K28 A;  2HCI A;  2KEC A;  5EPK A;  1B4O A;  3GV6 A;  2FIN B;  5EKI A;  4IUT A;  4CJ0 B;  4OIK A;  1DOK A;  2NWG A;  3I91 A;  5DNF A;  1MSG A;  2K05 A;  1G6Z A;  1HHV A;  2R3Z A;  4RA8 A;  1EIG A;  1X32 A;  1E0B A;  1JIC A;  2KEE A;  1G2T A;  2MP1 A;  1PFN A;  2B2Y C;  2NZ1 D;  2HCC A;  1NR4 A;  2N88 A;  5EQ0 A;  1F9R A;  5COY A;  1SDF A;  1QNK A;  2B2U A;  3KBX A;  3TZD A;  1WTP A;  2L1B A;  4HED A;  1TVX A;  2RA4 A;  1EQT A;  2FJ2 A;  3P7J A;  4X3K A;  2Q8T A;  3SVM A;  1B53 A;  2L11 A;  2K04 A;  3ONA B;  2FMM A;  2NYZ D;  3Q6S A;  1B2T A;  1EL0 A;  1ROD A;  1DON A;  4IUR A;  1SAP A;  1WTX A;  1CA5 A;  1ML0 D;  4IUP A;  1MI2 A;  2RSO A;  3I3C A;  2M2L A;  5D65 A;  3TN2 A;  2SDF A;  1B3A A;  2D9U A;  2B2U C;  1MSH A;  2EE1 A;  2X69 A;  5EPJ A;  1PFM A;  2B2W C;  1F2L A;  1ILQ A;  1NR2 A;  2FFK B;  1U4M A;  5D14 A;  3LWE A;  1WD1 A;  1O7Z A;  1CM9 A;  5T1I A;  4CJ1 B;  1BNZ A;  1BBX C;  2L12 A;  4O42 A;  2RVL A;  1VMP A;  3IL8 A;  4HAE A;  2K1B A;  1ESR A;  4X3U A;  2X6G A;  1F9S A;  2MPM A;  1IKM A;  3FPU B;  4LMQ D;  4R8I A;  1RTN A;  4MN3 A;  4R9W A;  1HUN A;  1KNE A;  5T1G A;  5E4W C;  5COR A;  3D6W A;  1S4Z A;  1IL8 A;  2B2V A;  3MTS A;  4OIJ A;  1AP0 A;  3DM1 A;  1HFG A;  4NW2 A;  2B2T C;  2EPB A;  4U68 A;  1ICW A;  1QE6 A;  1PLF A;  2L9H A;  1KNA A;  2VXW A;  3QO2 A;  1EIH A;  2CVR A;  4HCS A;  5CMD A;  1WTO A;  2JP1 A;  4UAI A;  1MGS A;  1J9O A;  3G7L A;  1XX8 A;  2J7Z A;  1AZQ A;  1G91 A;  2N55 A;  1O80 A;  1PDQ A;  5EJW A;  1BF4 A;  3GV3 A;  2FHT A;  2HUG A;  1DOM A;  3UI2 A;  1AZP A;  1J8I A;  1HA6 A;  2B2W A;  2DY7 A;  1GUW A;  1QG7 A;  1XYI A;  1DZ1 A;  1X3P A;  2K03 A;  3DEP A;  3FDT A;  2EOT A;  4XT1 B;  4RWS C;  5JJZ A;  1WTW A;  4ZKB B;  1HRJ A;  4MHE A;  1WTV A; 
#chains in the Genus database with same CATH topology
 2DUD A;  3UE0 A;  3U50 C;  1YIJ A;  1E2W A;  4MZ9 A;  1PH1 A;  1GXD C;  4LW1 A;  2EYP A;  5M5X H;  4JV5 Q;  1XNR Q;  4GKJ L;  3CC7 A;  3LNN A;  1FJG Q;  3N6R A;  4L5S A;  3NTI A;  5LMN W;  2HDM A;  2O5J C;  3MWY W;  4OGQ C;  1N9W A;  1HUM A;  2IW3 A;  3TRZ A;  1F77 A;  2RDH A;  1HZA A;  3TRE A;  1SNO A;  4HJA A;  3RN2 A;  3I4M H;  2E2D C;  5KYL A;  4A3K G;  2CW0 D;  4UP7 A;  4L8J A;  2M00 A;  3GTK H;  1I94 Q;  3FHW A;  5CV5 A;  1IW7 D;  3JAM E;  4JI7 L;  1RHP A;  4RGM A;  1C0A A;  3ZYY X;  5EGT A;  2KQ3 A;  2JA8 B;  1H9M A;  2EXD A;  3GV6 A;  3I91 A;  4RHS A;  4Y7N H;  1ET6 A;  4Q0F A;  1RD9 D;  4KKT A;  4BXX H;  2UXC Q;  2NZ1 D;  3ITP A;  2K6A A;  2K5Q A;  5I6Y A;  4FYD A;  4DR6 Q;  5CV7 A;  4GN3 B;  3E6Z X;  4JCV E;  3ONA B;  1JB3 A;  2F0M A;  2ZJP A;  1Q8I A;  1QOH A;  1IXR A;  5CGK A;  3VR3 A;  4X64 L;  1XWE A;  5DM7 3;  2M2L A;  3KLR A;  3F2D A;  1GHJ A;  1PH7 A;  4KHV A;  3S1R H;  4A3M H;  1ILQ A;  2F0N A;  3T16 A;  1UUP A;  5JVH 3;  4P72 A;  5FLM G;  2PI2 E;  3VYS A;  1EZ8 A;  2F0O A;  4TQU S;  5HGT A;  3RZD B;  5JEA G;  2P5Z X;  1V1Q A;  2JXM B;  3MEF A;  2K5V A;  4K5X A;  3HOZ H;  1S4Z A;  2B2V A;  2JQO A;  4OIJ A;  1AP0 A;  1SN8 A;  1D5M C;  2KHJ A;  4R4Q A;  5GAD C;  5IP7 H;  4XYQ A;  1D2B A;  4HJ9 A;  2SNS A;  1D7Q A;  2K7V A;  3HOW H;  3NE5 B;  3S24 A;  1VQ8 A;  5C3X A;  4AQY L;  1DZ1 A;  2QCP X;  2OTJ A;  1X3F A;  1EUJ A;  5FO9 B;  4I65 A;  1B1Z A;  4MIU A;  2E8G A;  3VA5 A;  4B3R Q;  3S14 H;  3P75 A;  4B3M Q;  2IHE A;  3OIP A;  2A69 C;  1YEZ A;  4IUU A;  1XMO L;  5C44 B;  3T1H Q;  1W6J A;  1D1I A;  1YNJ C;  4CDF C;  3A74 A;  5G3L F;  1VQK A;  2ALY B;  4KKU A;  2Z1C A;  5M5X B;  4OO1 H;  3T13 A;  2ASB A;  2DY8 A;  2E2H H;  3I4O A;  5IOC A;  1PH9 A;  3AFQ A;  2D2C C;  3L0O A;  1D6E C;  4IOA A;  1JJG A;  1PYW D;  2A68 D;  4A3L G;  5C4H A;  5CR3 A;  4DR1 L;  1BUV T;  5KND A;  3HP3 A;  5AFW A;  1LT4 D;  1PFS A;  1CTM A;  3AMU A;  5C4X G;  2KCC A;  1FVI A;  2DNC A;  4C2M H;  2X6L A;  3I90 A;  4L5R C;  1JWM D;  2NVX B;  4A3C H;  1BKB A;  3NEN A;  4X65 L;  4R8N A;  1JR0 D;  4OL7 A;  2KEC A;  4LNQ A;  3KF8 A;  3CC2 A;  1QUQ B;  2TSS A;  1MSG A;  4DR5 Q;  3HOU G;  4N9T A;  4UP9 A;  2WKD A;  1PFN A;  2B2Y C;  2BOS A;  4DK3 C;  3NWT A;  1NY4 A;  4DV0 L;  1Y8N B;  1HPC A;  1IYJ B;  1Q46 A;  3D3R A;  2UXD Q;  2F1M A;  3NP8 A;  3TQY A;  4JI2 Q;  2Z9H A;  1LT5 D;  1PRT F;  4LFC Q;  4K2L A;  4O42 A;  3S1R B;  2HQE A;  3BYT B;  1Y1V G;  1JOO A;  1F9S A;  3KF6 A;  3KDF B;  4YIJ A;  5DLQ E;  5D3D A;  1HUN A;  3CHB D;  2F0Q A;  1SNQ A;  2ZM6 L;  3MVV A;  2Q8I B;  2GVB A;  1E1T A;  2N78 A;  4ZYS A;  4A3F H;  1VQB A;  2PQA A;  2EJM A;  4NXN Q;  5NUC A;  2JE6 I;  3GV3 A;  4KHP L;  5I9P A;  4A93 H;  2VZA A;  1ZKO A;  4C3I H;  3HKZ G;  3T56 B;  4DV3 L;  4PMW A;  1AN8 A;  1JWU D;  4A3L H;  3M3Y H;  2QDB A;  4WJ3 M;  2KVM A;  4A4I A;  1JWS D;  1SMY C;  1Z6H A;  1YHA A;  4A3I G;  2F0I A;  2HIV A;  4A3K H;  2XN9 C;  1BBW A;  4GNX C;  1SNM A;  1KRS A;  3D6C A;  4GKK L;  3N52 A;  1A3T A;  1B9N A;  4M1U B;  4RAU C;  2K33 A;  3BYY B;  1EEI D;  4XDX A;  4TKO B;  4XQJ A;  2VY3 A;  3DEO A;  4ZAI A;  2IPK D;  1RKN A;  4LUV A;  3WDN A;  1C8C A;  2B2T A;  2C35 B;  4C3J H;  2B8G A;  1HNZ L;  4BBS B;  2C9O A;  1AH9 A;  4GOP B;  3UE1 A;  1LUZ A;  3FEW X;  4X3T A;  3BZC A;  4ALP A;  1FR3 A;  4O1N A;  1N34 Q;  2I46 A;  4ODG A;  3QG1 A;  1AE2 A;  3FRP B;  3SGI A;  1NBW A;  3TSS A;  5JAV A;  5E1F A;  1SYF A;  2N49 A;  3HFZ B;  1WTP A;  5M3M B;  3I4N B;  1QZH A;  1W6K A;  2NVY H;  4PMC A;  1ASY A;  1Z9F A;  5EBC A;  2X69 A;  1KAA A;  5A35 A;  1BQQ T;  1LTG D;  5FLX L;  5T1I A;  1STB A;  1SBB B;  4LJZ C;  3CAM A;  4A3J H;  4JV5 L;  4OO1 I;  1E22 A;  1Y69 U;  3HS0 C;  3GTJ B;  4V19 0;  1R4P B;  4ABN A;  2K52 A;  3J7A 5;  4H44 C;  1R9T H;  1N36 Q;  2A1A A;  3GTG H;  1IBK L;  3PQI A;  3TS2 A;  1OXV A;  1SMX A;  1BCP C;  1TWA B;  1HFG A;  2NVQ H;  2RDF A;  4K6D A;  4K5W A;  1FGB D;  1PLF A;  5DM6 3;  1KNA A;  1SRU A;  4IPC A;  1WTO A;  3A5U A;  1J9O A;  1EFI D;  3OOC A;  2CQO A;  2SOB A;  4EVO A;  4BBR G;  2JA8 H;  4A3G B;  5LMN L;  1GKH A;  5IWA L;  3J81 i;  5M3F B;  1KAW A;  4K5V A;  1I6H B;  3I4L A;  2WFW A;  4DR7 Q;  2B63 H;  2R6G A;  1D5Z C;  2JA9 A;  4IN3 A;  4LWC A;  2R93 B;  1CHP D;  2YTY A;  4DR5 L;  1TWH B;  2CHB D;  5KEE A;  4DV6 L;  2CCZ A;  5C3W A;  3IAY A;  2JA7 B;  1GUN A;  1BXT A;  2AQ3 B;  2PZU A;  1STH A;  1E24 A;  5IE8 A;  1FNW A;  2BE5 D;  2O2L D;  1U4R A;  2BE5 C;  4HJ5 A;  4IUV A;  4PNY A;  1Q3L A;  4XXE A;  3T53 B;  1A2T A;  1EOT A;  3NEL A;  2OEO A;  1QWY A;  3OTO Q;  2NN6 I;  2RKS A;  4RGN A;  1WTH A;  4DV3 Q;  2F4V Q;  3SE0 A;  4DV2 L;  1LTL A;  4O0A A;  2E76 C;  3C3L A;  3OMC A;  3VYT A;  3BDC A;  5EKL A;  2Z6K A;  4UHV A;  4DK6 C;  2K05 A;  3DHQ A;  2LXJ A;  1EU4 A;  4LFA Q;  4B9X A;  2F0U A;  4OEL B;  4EQO A;  4QQB X;  2Y0S B;  4L5Q A;  1J5E L;  3OW7 A;  1X6O A;  4ME5 A;  1TVX A;  1X54 A;  3AQQ A;  4YCU A;  3M85 A;  4ME3 A;  4RKL A;  2NYZ D;  4DV4 L;  1CQF A;  1L1O B;  2Z8L A;  3FPP A;  1EZ6 A;  4HSP A;  3HOX G;  4FP5 D;  1I4Q A;  3KOJ A;  1I3Q H;  1QJO A;  1OO9 B;  2K5D A;  4N8X 1;  4A3F G;  1V1P B;  4DU9 A;  1B8A A;  1WD1 A;  1EYD A;  4LF7 Q;  2MO0 A;  3X3M A;  2F0L A;  4X3U A;  1Q86 C;  2K75 A;  3HOV B;  3Q22 A;  5IYB H;  2Q2U A;  4H0L C;  1FYC A;  2OXP A;  1QZG A;  1R9T B;  4LF8 Q;  1ICW A;  2NB0 A;  4DV7 Q;  2QDL A;  3CF5 A;  1EIH A;  5IYD G;  3SEB A;  1JT8 A;  1G6P A;  4IPG A;  1X3P A;  3DEP A;  3V05 A;  1TWF H;  3ULP A;  2L15 A;  1EQQ A;  3PIP 3;  3SK4 A;  5IWA Q;  2EIF A;  1WD0 A;  5JJL A;  1CKM A;  2E75 C;  2RHS B;  2GVA A;  3IKJ A;  1EQV A;  3DWQ A;  4G4K A;  4AH6 A;  1LTT D;  3LWU A;  1EY8 A;  3I56 A;  3S2H B;  2HHH Q;  4EQ5 A;  5GQO A;  1NTG A;  4XTC S;  2EY6 A;  3HEJ A;  3MZ5 A;  4BBR H;  1PV4 A;  4FF4 A;  4FO2 A;  1AFP A;  3GD7 A;  3T1Y L;  2CH4 A;  4GKK Q;  3Q24 A;  4HSV A;  5GRO A;  3FKI H;  3F2U A;  3C1F A;  5KNB A;  3OMG A;  3HOY G;  1D8L A;  1EYC A;  2AUK A;  4OWT B;  4HJ7 A;  4DR4 Q;  2XRQ D;  1QVC A;  4EQP A;  1UE1 A;  1V1O A;  1SMY D;  1ESF A;  3CPF A;  2R92 H;  5FLM H;  3W2D A;  5IOD A;  3PUZ A;  3A56 A;  3I7F A;  3S2D H;  5DAU A;  2MFI A;  1S5E D;  4OHJ A;  1ILP A;  2UUA L;  1Y8P B;  4U67 3;  3IFT A;  4JI3 Q;  3MXG A;  4JBW A;  3EVQ A;  4B3S Q;  4LUZ A;  3WOE A;  3PO3 H;  2F3I A;  1NJI C;  1SYD A;  4RA8 A;  3K5N A;  1DXM A;  4IJH A;  2EQS A;  2Q2T A;  5M5W H;  5COY A;  3OW2 A;  3E0J A;  4A3B B;  1S5B D;  4HED A;  3M3Y B;  4CKC A;  1X3E A;  3ICE A;  2F0V A;  1SYB A;  3KFU A;  4DV1 L;  5C6A A;  3CC4 A;  3QOL A;  1OXU A;  3PIO A;  4BBS G;  5CC4 A;  5M5Y B;  3S17 B;  1A8V A;  3W5O A;  2BH8 A;  1KTK A;  3EQL C;  1ESR A;  2F4V L;  1XTC D;  2X6G A;  5F2D A;  4L63 B;  2CFM A;  1IKM A;  4HIM A;  2DNE A;  5T1G A;  3GQB A;  1IL8 A;  4A3D G;  3OIQ A;  4K8I A;  1QE6 A;  4YHH Q;  2ZXR A;  3ULJ A;  2EVB A;  5C5M A;  4C3H H;  1HNX L;  1HR0 L;  4P73 A;  4GNX B;  4OXP A;  1O80 A;  2KCN A;  4RKB A;  1KD1 C;  3ERO A;  4QJF A;  4HTH A;  4G7H C;  5LMN Q;  5LHY 1;  1G8Z D;  5JJZ A;  4CBV A;  4DV5 Q;  2LXK A;  5HGQ A;  4JW0 A;  1HZB A;  1C9O A;  1CSP A;  2JEA I;  1C48 A;  4GOP C;  4YWM A;  3NBH B;  1I4X A;  4H02 A;  4KJO A;  2JJQ A;  3PCO B;  3TBI B;  3VR6 A;  3HOW B;  2JK8 A;  4UP8 A;  1IHZ A;  1TQO A;  1WJJ A;  4BY1 H;  4A3E B;  2RHQ B;  4KTA A;  3TP5 A;  1PH8 A;  5CBE E;  4YWL A;  2E2I H;  2R7Z B;  3DUZ A;  2LS0 1;  2CWP A;  5TSS A;  4CJ2 C;  1EY9 A;  3VDY A;  3CKI B;  2UUC Q;  5C3E G;  3AFP A;  3RUZ A;  2Q8R E;  1V1P A;  1GVP A;  3DLL A;  4DUZ Q;  3U9O A;  1PA6 A;  1M1K C;  2KHS A;  2ZTE A;  2E2H B;  2YTV A;  3ER0 A;  3G4S A;  1YNN C;  3J7Y W;  4CDC C;  2ICE C;  1VQ7 A;  3GTP H;  1K0R A;  2BA1 A;  2XSC A;  5M9O A;  4GLX A;  1UWV A;  3U4Z A;  1BCP F;  3RD4 A;  2R92 B;  2NN6 G;  2ZXP A;  4LUO A;  1HZ9 A;  3U9S A;  2A8V A;  4C2M B;  2J4X A;  2GA4 B;  3HOX B;  3QWN A;  1GM5 A;  5D65 A;  3U4V A;  3CXC A;  2B2U C;  1MSH A;  3PO3 G;  3W3A A;  1PMR A;  1H9R A;  3LWE A;  1CM9 A;  4B3T L;  3MFG A;  4MNO A;  4WFN 3;  5IYD H;  1VQE A;  4LF4 Q;  1XPO A;  3FPU B;  4IOC A;  4AYB E;  2R93 H;  1MHW C;  2EYJ A;  3MTS A;  5ELO A;  4CHT B;  4K0K Q;  2PO4 A;  4HR7 B;  3EIV A;  3G71 A;  2VUM H;  1EY5 A;  4DAV A;  2NVT H;  3A55 A;  3BVG A;  2XWJ B;  1AZP A;  1CQV A;  1LTS D;  1C4Q A;  3GTO H;  4DV2 Q;  2QF7 A;  1PTO F;  1EIY B;  1WTW A;  1ASZ A;  4LK1 C;  1CSQ A;  2V1C C;  2NTS A;  5C0X J;  3E9H A;  2WIN B;  2AWN A;  4FVM A;  1ZYR C;  1DCZ A;  1TWC H;  1EU3 A;  1VQD A;  4KY5 A;  1VQC A;  5C3E B;  1JOR A;  1U4L A;  2KA7 A;  3S1N B;  3PF5 A;  2BA0 A;  1W3S A;  2K5H A;  4C1N I;  1SJH D;  4UY8 C;  1LAB A;  2NN6 H;  1H9K A;  3D0F A;  3I55 A;  5I6W A;  4JI6 Q;  1K83 B;  3I8Z A;  5CBA E;  4A93 B;  1Z47 A;  2A74 C;  2K5N A;  1L2F A;  3GTL H;  4RHR A;  2AHO B;  4RH6 A;  2Z6B A;  2E74 C;  2GN5 A;  3GTG B;  1TS3 A;  2QIL A;  4LF5 Q;  2MHV A;  2Z6K C;  2EYM A;  1PFB A;  4DR2 Q;  1BR9 A;  4DAM A;  4ZRZ A;  1K3B C;  5D3I B;  3TME A;  1E3P A;  4MTN A;  1CA6 A;  4Q5V A;  2Y0S E;  4F87 A;  5C4Z A;  4B3S L;  4JI3 L;  1PTO D;  1DOK A;  4EX5 A;  4RFB A;  1OXX K;  1JJC B;  1E7Z A;  5GAG C;  2B63 B;  4FDB A;  4UPA A;  2OQ0 A;  1A62 A;  1Y1V B;  4BWG B;  5EQ0 A;  2NBF A;  1IZ6 A;  2KHI A;  2CW0 C;  3KBX A;  4JI1 Q;  1BCP D;  3P7J A;  4DUY Q;  3K6O A;  1B53 A;  2L11 A;  4HID A;  3J81 j;  1ROD A;  4IJL A;  2B63 G;  1MI2 A;  3QB3 A;  2E5L Q;  3CCQ A;  2WAQ E;  1G2T A;  2PQA B;  1MJC A;  2ZJQ A;  5KGU A;  1K8M A;  2UUB Q;  1KDB A;  4HAE A;  1CKN A;  1KAB A;  3B6Y A;  3F8T A;  4POF A;  4A3C G;  3BJU A;  3CCU A;  2OTL A;  2JEB I;  3I70 A;  1QCB D;  1GO3 E;  3PO2 H;  1NE3 A;  2LFN A;  3KF6 B;  2NVY B;  3DM1 A;  3H15 A;  4C3H B;  2EPB A;  4F8M A;  2SEB D;  1P8L A;  1TY2 A;  5KYI A;  1HNX Q;  1HR0 Q;  3PF4 A;  3SHL A;  2TMP A;  1YI2 A;  2R7Z G;  4P2C B;  2AKW B;  1K9M C;  1VDZ A;  3O13 A;  4J1M A;  2R93 G;  2NVT B;  4DV5 L;  1EY6 A;  4XT1 B;  4IZ8 A;  4NKL A;  2HQL A;  2JA6 G;  4KJN A;  1WOC A;  3IFD A;  3RLF A;  4WJ4 A;  5CV4 A;  1XNQ Q;  4FF3 A;  4OWW B;  4IPH A;  3NSW A;  1YJW A;  4GZY C;  5KIX A;  1AW7 A;  4JI0 Q;  1DM0 B;  1WCM B;  1B7Y B;  2NVX H;  5IP9 G;  1CZG A;  4A3G H;  1EEF D;  4AIM A;  1LAC A;  5BN4 A;  2ZT9 C;  4JOI A;  3NQT A;  1WTQ A;  2IL8 A;  1BBU A;  3URY A;  4RCN A;  2KBN A;  4NMZ A;  1Q81 C;  1RDP D;  2RBM A;  2D62 A;  3KJP A;  3F2C A;  1N33 Q;  1B3Q A;  1GD7 A;  5I4D A;  4MTK A;  1YNX A;  3K59 A;  4HIK A;  2UXB Q;  3MC0 B;  4P74 A;  2K28 A;  1PRT B;  1X9N A;  5M5Y H;  1I6V C;  4OIK A;  1SR3 A;  1KRT A;  4KKS A;  4HN7 A;  3BVM A;  1X32 A;  4KK7 A;  4C3I B;  2KEE A;  2RQX A;  2YU9 H;  2F03 A;  2ZTD A;  1L0X B;  2R7F A;  1VQ5 A;  3OTO L;  3I4M G;  5BR8 L;  5ELB A;  4BY7 B;  1M90 C;  1GUG A;  1TXY A;  4DR3 Q;  4BY1 G;  3KDF A;  2EJF C;  1KLU D;  4G7O C;  3MXN A;  1LTB D;  1CK1 A;  2L0C A;  1N34 L;  1X65 A;  1G6Z A;  3TN2 A;  3KK7 A;  4LF9 Q;  2SDF A;  2VUM G;  4BA2 I;  3K5O A;  3D4D A;  4LF6 L;  1TS2 A;  1HQM C;  2PZW A;  4XYO A;  3RLN A;  1V43 A;  2K1B A;  2WV6 D;  3CCR A;  2E2J H;  2F0P A;  2F0G A;  1K73 C;  1R4Q B;  3BG3 A;  4K2K A;  2VS1 A;  3M4O B;  3E0E A;  1XMQ L;  3PUY A;  2OWO A;  5JOB A;  3J80 L;  1NMG A;  3G7L A;  1XTD A;  1IYV A;  3PIO 3;  1AZQ A;  5LL6 X;  1J8I A;  2AMC B;  5IP9 H;  4QCL A;  4HIO A;  5C4J H;  1XNR L;  3HZX A;  5K5P A;  1I6H H;  1WCM G;  2D0O A;  5JPM C;  3U58 A;  1OXT A;  1YJ9 A;  4CKB A;  1PH5 A;  1DJR D;  2OQK A;  4PZ8 A;  1QB5 D;  1HFN A;  2E5L L;  2RCN A;  2JN4 A;  4BBS H;  3HOZ B;  2PQE A;  4TRD A;  4POG A;  3VYR A;  3JAM i;  3MHB A;  2F0T A;  2XIW A;  3E3X A;  1FNV A;  4C3J G;  3VR5 A;  1IKL A;  2KEN A;  1VQF A;  4IQZ A;  4A3D H;  1RIP A;  2CQA A;  1U4P A;  3NQI A;  1YNN D;  1VQN A;  4QIW B;  1STY A;  3H0G B;  2OT2 A;  3A0J A;  3M4Q A;  4NPS A;  3RR5 A;  3GTM B;  1GHK A;  2UXC L;  3NUC A;  3T1Y Q;  3H91 A;  3DWP A;  3UDX A;  5I9O A;  4GS3 A;  1IW7 C;  4O2D A;  1O78 A;  1B4O A;  4P75 A;  5C5L A;  4CJ0 B;  2NZH A;  5IYC H;  4B9W A;  4DGZ A;  1ENA A;  1E2V A;  4EGV A;  1TKW B;  1M4V A;  2RCF A;  2H4O A;  4IAL A;  3SK5 A;  3BZK A;  3L7Z C;  2VW9 A;  1X3G A;  3CPW A;  1YZ6 A;  3J81 c;  3TZD A;  3K0X A;  1UAP A;  4DXF A;  1EQT A;  3V2T A;  3PO2 G;  4R4C A;  1K8A C;  1DON A;  2F0D A;  4CDD C;  2XNA C;  1ZEQ X;  1TY0 A;  2RSO A;  4J6H A;  4QIW E;  5LMU L;  1GUO A;  2R7Z H;  5C0X H;  4DV7 L;  1JOK A;  1XNQ L;  1HQR D;  1PYB A;  5D14 A;  3WWV A;  3PMF A;  4ULL A;  5CV8 A;  4A75 A;  1BBX C;  2PNR C;  2UUB L;  3MXN B;  3CCE A;  1GJX A;  2MPM A;  3PO2 B;  4KN4 C;  3Q23 A;  4MN3 A;  3MFY A;  2JA6 H;  2EYL A;  4BY7 H;  1EWI A;  5E4W C;  1I4R A;  4NW2 A;  1L1O C;  3TZU A;  4LF8 L;  1HTP A;  4PG3 A;  4NB3 A;  2PI2 A;  3GP7 A;  2ES2 A;  1XX8 A;  4C56 C;  1Q90 A;  1TWF B;  1IBM Q;  1MIU A;  3MAQ A;  4CKE A;  1RL2 A;  3NEM A;  2WKC A;  1WTV A;  1B44 D;  4WJW A;  5M3F G;  5K36 H;  2MGS A;  5ELF A;  1JE4 A;  2XGT A;  1XJV A;  1ZXT A;  5EPL A;  2F0H A;  3R2T A;  4YCV A;  4FXD A;  1PXU A;  1S5C D;  5KRU A;  4L6T B;  1T9H A;  1A0I A;  1J5E Q;  4JI8 L;  4CGY B;  2CKZ B;  4Y7N B;  2DJG C;  4DV4 Q;  3STB D;  4RGT A;  5IYC G;  3OWE B;  4IFD J;  3SDZ A;  1HNW L;  5FK9 C;  1M8A A;  2F0K A;  2EXZ A;  4HMI A;  1SLJ A;  2F52 A;  3S1Q H;  3X3N A;  3S2D B;  1NMF A;  1BCP B;  3TP8 A;  2K50 A;  4ZUI A;  1HR0 W;  3K0Y A;  1Z7T A;  3EBE A;  4F7X A;  1STN A;  2HCI A;  2FIN B;  4I7Z C;  1LTA D;  3Q0A A;  5DNF A;  2KJX A;  1XMQ Q;  3L2P A;  1I50 B;  3BS1 A;  3A8K E;  3M7G A;  1VF7 A;  3HOV H;  2UUC L;  1LYL A;  1TWC B;  2FXQ A;  5C3E H;  4JG2 A;  3I4N G;  4OON A;  2Z4I A;  3L3O C;  2UUA Q;  3BDO A;  4KD3 A;  1VQ6 A;  2LMC B;  2Y0S G;  1HH2 P;  1FGU A;  2Q8T A;  3ERS X;  4DNR B;  1EOV A;  2B8F A;  2F0W A;  1EFW A;  3CQZ B;  2D9U A;  2EE1 A;  1PYS B;  4GNX A;  1XXG A;  3S2H H;  3UDI A;  2QA4 A;  2LY7 A;  4QMG A;  3H0G G;  3EJI A;  1L1O A;  3NWS A;  2JA5 H;  3MXU A;  1VQ4 A;  3VA7 A;  1QIL A;  3S14 B;  3GO5 A;  3HRZ C;  4R8I A;  4C3I G;  4GN4 B;  2WAC A;  4DFA A;  2PMZ B;  1CFM A;  3QOJ A;  2A6H C;  3S1M B;  2L9H A;  2VXW A;  4LFC L;  1KC8 C;  4JI2 L;  3A7L A;  1CZW A;  1PDQ A;  5EJW A;  5HUR A;  2FHT A;  4PQX A;  3A54 A;  4DAY A;  2DY7 A;  3FKI B;  5ELN A;  2I07 B;  2PYK A;  1Y1V H;  4JOI C;  1XPR A;  2B39 A;  4GOP A;  3TEH B;  2B2Y A;  1EWC A;  1T5X D;  4DR1 Q;  1LT6 D;  1A63 A;  2RDG A;  4DK0 A;  2VL6 A;  1NCV A;  3FKI G;  3VR2 A;  4QGU A;  3H6M A;  2BH2 A;  1VMC A;  3K7A H;  1JQY D;  2SNM A;  1Q1E A;  1S5F D;  4A3D B;  1H95 A;  1A15 A;  1CT1 D;  1K0S A;  4KHZ A;  5IT9 L;  3HOU H;  4R4O A;  4DA2 A;  2WAQ B;  1YNJ D;  2F3V A;  2LKV A;  1B50 A;  3S1M H;  4PV1 C;  4XT3 B;  1SSO A;  3PV0 A;  4GN5 A;  1TWH H;  4JI8 Q;  1XPU A;  4J15 A;  1STE A;  2EZV A;  3TS0 A;  1PH6 A;  1VQA A;  4DUZ L;  3G6J B;  3LGJ A;  1IBL L;  3SK8 A;  4E6I A;  3HKZ B;  1I5F A;  1ZYR D;  5EPK A;  3PGZ A;  3CRK C;  3MXP A;  1SFO B;  1HXY D;  1ENF A;  4G57 A;  3ZJY C;  3RNU A;  1A3U A;  2D0P A;  5AJ3 Q;  2R3Z A;  1HZC A;  1O7L A;  2AWO A;  4N8F A;  3WOF A;  2MP1 A;  3AB9 A;  4JVZ A;  4A76 A;  1PRT C;  4HMJ A;  1PZI D;  3C46 A;  4JPB W;  4OX9 Q;  2KCM A;  1N32 Q;  3JC6 6;  2L1B A;  5E3F A;  4A3B G;  1ONL A;  2WB1 E;  3RLO A;  1EL0 A;  1B9M A;  1K3R A;  5LMU Q;  1CA5 A;  1IBK Q;  3GTQ B;  3OWF A;  5EPJ A;  1SYC A;  1VQI A;  2B2W C;  1YBY A;  2NUC A;  4DK1 A;  1O7Z A;  1BNZ A;  3KYH C;  3PIP A;  1VCI A;  1WI5 A;  3KLS A;  4DUY L;  1PTO H;  4JI1 L;  3S15 H;  2PCF B;  2JA5 B;  4R9W A;  3HOY B;  2EYO A;  2OF1 A;  3D6W A;  1W2B A;  4HCE A;  2IT1 A;  2B2T C;  4U68 A;  2JSO A;  3NBI A;  2CH4 W;  1LM0 A;  1UNS A;  3R8B A;  3I2Z A;  4A3I H;  1G91 A;  4Z9C B;  3CCM A;  1I3Q B;  1TS4 A;  2EJG C;  1GUW A;  1HA6 A;  1N36 L;  4A3E H;  3NHH A;  2EOT A;  1A3V A;  4RWS C;  3M4Y A;  1GUS A;  2O5I C;  1MJE A;  1RTO A;  4P71 A;  3NTK A;  4PMB A;  5IYB G;  1S3O A;  4ID6 A;  3STB C;  5C44 G;  1DOL A;  1YHQ A;  4YCW A;  3S1N H;  4N9P A;  1BVS A;  4C3J B;  1Q8K A;  3ULL A;  1AE3 A;  5A2Q L;  1FJG L;  2QGQ A;  1L0Y B;  4JI4 Q;  2H1E A;  4WRD A;  5FO7 B;  1JOQ A;  4QUF A;  1KDA A;  4QF4 A;  1ICF B;  5C0X I;  4DR7 L;  3D8G A;  5ELC A;  3S1Q B;  1U9R A;  4H7B A;  3I73 A;  5K36 G;  1F2Y A;  4C3H G;  1JCK B;  2F4I A;  3MA2 B;  2RSN A;  1WFQ A;  2DJF C;  3J7A F;  2ICI A;  4LF4 L;  1UEB A;  4TVA B;  5GAH C;  1S72 A;  3HOX H;  1PH3 A;  4RGO S;  4FNF A;  1VQH A;  3SK6 A;  4BBR B;  2I5L X;  4LFB L;  2F3W A;  4A3J B;  5IP7 G;  3T1H L;  2VB2 X;  3VYU A;  1E0B A;  3M4P A;  3BVZ A;  4S3S A;  4K8J A;  4JK1 C;  4DAP A;  5CYU A;  1F9R A;  1SDF A;  1OXS C;  2B2U A;  2L5T A;  3HKS A;  1SEB D;  4A3J G;  2RA4 A;  2NVQ B;  2J0T D;  1VQG A;  3SVM A;  2K04 A;  2NZO A;  5GAE C;  1Q12 A;  4FF1 A;  4YY3 Q;  3I3C A;  4X62 Q;  3EA6 A;  1F2L A;  3PO3 B;  3GTO B;  4OX9 L;  2L12 A;  2QW7 A;  4DR3 L;  5JJI A;  3K5L A;  2VNU D;  4L5T A;  1SNC A;  4IPD A;  4ZCK A;  4QL5 A;  3S16 B;  1D1K A;  4A3B H;  4C1N K;  4I7A A;  1FL0 A;  1TR5 A;  5FLX E;  4TSS A;  1TWG B;  3BDL A;  2JA7 H;  1NSN S;  2K5W A;  3T51 B;  1TT2 A;  2N8N A;  4ZUJ A;  5BN3 A;  3CME A;  3D31 A;  4GLA C;  5I2X A;  4DV6 Q;  2BDO A;  4JBK A;  4LF6 Q;  4NXM Q;  3CD6 A;  2A19 A;  2HUG A;  1DOM A;  4FF2 A;  2B2W A;  1UEA B;  3NXW A;  4ZQ3 A;  2I5M X;  4IFD I;  3EFX D;  1I4P A;  3KBG A;  4A3G G;  5EKK A;  2KED A;  3S9W A;  3OYY A;  1VQO A;  3PUX A;  2EY5 A;  1J6Q A;  1WYD A;  2ID0 A;  4J8Q A;  1CUK A;  2IX0 A;  3J80 E;  4JI0 L;  3KF8 B;  4V0B A;  1SRO A;  2WB1 G;  1RF2 D;  3UDG A;  3JAM c;  1I94 L;  2AUJ D;  4PZ6 A;  4CDE C;  5JVG 3;  2EDG A;  2B2V C;  1BOS A;  4ZKC B;  4NXN L;  5IGE A;  3HG9 A;  5L37 A;  3CMA A;  3TP6 A;  2IX1 A;  2VB3 X;  1CKO A;  1BO0 A;  3OHX C;  3G6E A;  3J80 i;  3FMC A;  1IYU A;  5FKA C;  1Q7Y C;  5DEH A;  4X3S A;  2A69 D;  4DR4 L;  2E2I B;  4LFB Q;  4BA1 I;  2EY2 A;  1STA A;  3DM3 A;  3A7A B;  4NP5 A;  5FOB B;  5M3M G;  3H0G H;  1B2T A;  4DNT B;  5FO8 B;  5IT9 E;  1LTI D;  5FJ8 G;  3P20 A;  1EY4 A;  3CP0 A;  2CWA A;  4IUN A;  1B3A A;  1Y1W H;  4KLK A;  3K57 A;  4KI0 A;  3S15 B;  3RZD H;  1QNU A;  2RVL A;  3TDQ A;  4DNI A;  1H9S B;  4JI4 L;  4KHP Q;  4R4T A;  1DYQ A;  1RTN A;  4AQY Q;  5C44 H;  3SR1 A;  2PNH A;  4JBM A;  3F1Z A;  3H3V C;  1H9S A;  2UU9 Q;  3NTH A;  1PZK D;  1XMO Q;  2K32 A;  3QO2 A;  4HCS A;  5IGF A;  2JP1 A;  5JEA J;  1MGS A;  1N8R C;  1QUQ A;  5C4J B;  2J7Z A;  1SYG A;  5CV9 A;  3UI2 A;  4NXM L;  4FXG C;  4OEM B;  2YYZ A;  1K28 A;  2K03 A;  3W1G A;  4AYB G;  3FVQ A;  1KIX A;  2UXB L;  2YTX A;  2VQE L;  2H5X A;  4MHE A;  3K7U C;  2K01 A;  3CCV A;  2JA6 B;  3H3V I;  4K0K L;  4YHH L;  1LLR D;  4WOR A;  4YY3 L;  2KOL A;  1MBY A;  2ATW A;  3A8I E;  1SE8 A;  5FLX c;  4BXX G;  3KJO A;  3RMH A;  4QY7 A;  1NAP A;  2PMZ E;  1VS0 A;  4AYB B;  5JJK A;  5BR8 Q;  1K8G A;  4A93 G;  2QEX A;  1F9P A;  1O7Y A;  2MO1 A;  1MD2 D;  4M8A A;  3H09 A;  5IIF A;  3T4A C;  3QIA A;  5A2Q E;  3GTJ H;  3R2I A;  3KLS X;  3OSO A;  3QR8 A;  3L9A X;  1Y14 B;  5M3F H;  2YU9 B;  4JI5 Q;  3HGB A;  1AEX A;  2A6E D;  2KUM A;  1TWA H;  4XIG S;  5CV6 A;  2RF4 A;  3CRL C;  1HNZ Q;  2HIX A;  5J1Z A;  1GUT A;  1UE5 A;  2XTI A;  3NPP A;  2QKI C;  2D5D A;  3ND8 A;  4DAY B;  2R7D A;  4IUT A;  1X56 A;  2NWG A;  2Z0S A;  2WII B;  3RZO H;  4IFD H;  1JIC A;  4DXG A;  1SYE A;  3D4W A;  2O4X A;  1NUC A;  2N88 A;  1SE3 A;  2IJ0 A;  3MEH A;  1Q82 C;  1SJE D;  3J7A V;  4BY7 G;  4NDX A;  5IGC A;  3I4M B;  2FJ2 A;  1S40 A;  1UE7 A;  5IY0 A;  3AYH B;  3W1B A;  1SXT A;  1F2Z A;  4HJ8 A;  3TP7 A;  4X62 L;  4A3F B;  5IT9 c;  1NR2 A;  1VQJ A;  1H9J A;  3NBH A;  4CJ1 B;  5J3B A;  2Q2H A;  3UDF A;  1VMP A;  3S16 H;  1JE5 A;  1IBM L;  1QVG A;  1VQ9 A;  4LMQ D;  4X6A H;  2EY1 A;  2N3S A;  3E5S A;  1TWG H;  1PTO C;  4K14 A;  1OTC A;  3ERQ A;  1SE2 A;  4BS9 A;  1CHQ D;  4X66 L;  2WB1 B;  3GTM H;  2A5H A;  2QEJ C;  1PHJ A;  1EYA A;  4B3T Q;  5C0X G;  1SFO H;  4UAI A;  3OPO A;  4OO1 G;  1A6X A;  4IO9 A;  3DWA A;  4A3K B;  1LO5 D;  1QG7 A;  3I72 A;  1EWH A;  2K4K A;  1A2U A;  2VQF Q;  4JYA L;  4ZKB B;  1HRJ A;  1TII D;  1G51 A;  1VF5 C;  4RG1 A;  4GLV B;  1GOZ A;  5JPN C;  3HKZ E;  2PZT A;  3KUP A;  1CKN B;  5KNC A;  4LF5 L;  2A6H D;  1X55 A;  3BU2 A;  4UDU C;  3GTQ H;  4GKJ Q;  2IHF A;  1KLG D;  3HOW G;  2JYO A;  3K58 A;  2EYF A;  3K7A B;  1KQS A;  5G3L D;  5IGD A;  1PH2 A;  5EBD A;  4H13 C;  3J7Z C;  1D5X C;  1G2S A;  4KMU C;  3CCJ A;  1X3Q A;  4IUQ A;  2G9H D;  1PRT D;  2DN8 A;  2K14 A;  1LV9 A;  4IFD G;  3DMU A;  2MUY A;  3P1H A;  2PW7 A;  1IL2 A;  2JA7 G;  1F9Q A;  4LAA A;  1PZJ D;  1TS5 A;  3A8J E;  1EY0 A;  1KHI A;  5J39 A;  3J80 c;  3LX0 A;  3I4N H;  1JC7 A;  3A5Z B;  5M3M H;  5ELD A;  4QUC A;  3HOV G;  4R1J A;  4KY7 A;  1FD7 D;  4F88 A;  3D4R A;  1WCM H;  4JI6 L;  1FNU A;  1U0L A;  1C7Y A;  1PH4 A;  3C1E A;  1E2Z A;  1KDC A;  5ELE A;  3PUV A;  3G48 A;  2UU9 L;  1F2M A;  1HHV A;  2A6E C;  5C4X H;  5IGG A;  2I0Q A;  3RZO B;  1ENC A;  3R3O A;  4DR2 L;  1NR4 A;  2PPB C;  2MNA A;  1QNK A;  2NTT A;  3QJY A;  2Q2I A;  4KD4 A;  2R92 G;  4KN7 C;  4X3K A;  2JA5 G;  1HTL D;  2FMM A;  3Q6S A;  4OWX B;  2VUM B;  3AU7 A;  4IUR A;  1SAP A;  1ML0 D;  2HT1 A;  3Q8D A;  1Q1B A;  3F2B A;  1SNP A;  1PFM A;  2G5D A;  4LFA L;  1U4M A;  2KCT A;  4DF7 A;  2JA8 G;  1YHB A;  1JJ2 A;  1DD2 A;  1YJN A;  1HJP A;  1JMC A;  2WAQ G;  2XVS A;  2AQ2 B;  4DKA C;  4RCO A;  4JI7 Q;  1G29 1;  1V8Q A;  1KNE A;  1T5E A;  2C5C A;  3IRB A;  4DPG A;  5IGB A;  4R4I A;  2F0J A;  1HNW Q;  2M9V A;  2Z4H A;  2B3G A;  3H3V H;  3PUW A;  1O7I A;  1II3 A;  5CMD A;  1STG A;  2B29 A;  2PW5 A;  3V96 A;  4EQN A;  2N55 A;  1BF4 A;  4XQQ A;  1HA5 A;  3DXJ C;  1K83 H;  1XYI A;  1VQP A;  2VQE Q;  3FDT A;  2IWH A;  1SE4 A;  5M5W B;  2WP8 J;  2I5H A;  4JYA Q;  3GTL B;  5JEA H;  3HOY H;  1I50 H;  4X64 Q;  2ZJR A;  2HD3 A;  3CW2 C;  2E2J B;  3HOZ G;  1PTO B;  4JBJ A;  4ZLT F;  2F0F A;  4JC0 A;  4B3M L;  2AQ1 B;  1Y1W G;  4Y52 H;  1UE6 A;  1WVL A;  1WTR A;  5E4X A;  2L4N A;  3K81 C;  3KLW A;  4ZK9 B;  4YWK A;  3CCS A;  2DGY A;  1L0W A;  3M4O H;  1LTR D;  1RJT A;  2HDL A;  1RCV D;  2F0S A;  3CCL A;  3S17 H;  1VQM A;  4A3E G;  2MJ8 A;  2BDN A;  3CU7 A;  5EAY A;  1PVO A;  1IBL Q;  3BZD B;  1V9P A;  3CQZ H;  2XWB B;  1Y1W B;  4K6L A;  2V4D A;  2ZM6 Q;  2IX3 A;  2ZXO A;  1K8O A;  1EIF A;  4ILW A;  3PSI A;  4JI5 L;  1KXL A;  4DN4 M;  3J81 E;  1SND A;  1DGS A;  1JB7 A;  4RMF A;  1EY7 A;  3R93 A;  2MQH A;  2FMC A;  3M9B A;  1N32 L;  3H94 A;  1VQL A;  1NNX A;  3K80 C;  5HY6 A;  3J81 L;  5FJ8 H;  2F0E A;  4KY6 A;  3M7N A;  3GDE A;  4PZ7 A;  2XRS D;  5EKI A;  4X65 Q;  2A68 C;  1BDO A;  3C2P A;  4X66 Q;  4BY1 B;  3VR4 A;  2OCE A;  2LSS A;  1CI3 M;  4A3M G;  5E7N A;  1EIG A;  2G9D A;  1N33 L;  4LF9 L;  1YVC A;  2R61 A;  4XQN A;  2HCC A;  4DR6 L;  3K5M A;  3NK9 A;  1B70 B;  1LT3 D;  5I2Y A;  3AEV A;  1U5K A;  4LF7 L;  5J22 A;  1TU2 B;  1E1O A;  4DV0 Q;  1YIT A;  5H1S E;  1HCZ A;  3ND9 A;  4DV1 Q;  3SXH A;  2EYH A;  5AJ3 L;  1WTX A;  4FXK C;  4IUP A;  1P16 A;  2YV5 A;  5LL6 S;  4A3M B;  4QB4 A;  2UXD L;  3EN2 A;  4APV A;  2ZTC A;  2FFK B;  5C4X B;  3RN5 A;  1QVF A;  4KV6 A;  2IY5 B;  3IL8 A;  3GTP B;  3E9I A;  2ENB A;  3HOU B;  1EYG A;  1I4H A;  5COR A;  2L55 A;  1Y8O B;  1I4G A;  2BCO A;  1S5D D;  1EQR A;  1MKH A;  4A3I B;  1ET9 A;  2CVR A;  3K8A A;  3GTK B;  1KL9 A;  4B08 A;  2HHH L;  5ISR A;  2A73 B;  5BN5 A;  2VQF L;  4G7Z C;  3JAM L;  3FP9 A;  4B3R L; 
#chains in the Genus database with same CATH homology
 1E2W A;  1GXD C;  2EYP A;  3LNN A;  3N6R A;  3NTI A;  2HDM A;  2O5J C;  3MWY W;  4OGQ C;  1HUM A;  2IW3 A;  1F77 A;  2RDH A;  1SNO A;  2E2D C;  5KYL A;  2CW0 D;  4L8J A;  2M00 A;  5CV5 A;  3JAM E;  1IW7 D;  1RHP A;  4RGM A;  3ZYY X;  5EGT A;  2KQ3 A;  2JA8 B;  1H9M A;  3GV6 A;  3I91 A;  4RHS A;  1ET6 A;  4Q0F A;  1RD9 D;  4KKT A;  2NZ1 D;  3ITP A;  2K6A A;  2K5Q A;  5I6Y A;  4FYD A;  5CV7 A;  3E6Z X;  3ONA B;  1JB3 A;  2F0M A;  1Q8I A;  1QOH A;  5CGK A;  3VR3 A;  1XWE A;  5DM7 3;  2M2L A;  3KLR A;  1GHJ A;  4KHV A;  1ILQ A;  2F0N A;  3T16 A;  1UUP A;  5JVH 3;  3VYS A;  1EZ8 A;  2F0O A;  4TQU S;  5HGT A;  3RZD B;  5JEA G;  2JXM B;  4K5X A;  1S4Z A;  2B2V A;  4OIJ A;  1AP0 A;  1D5M C;  4XYQ A;  1D2B A;  2SNS A;  2K7V A;  3NE5 B;  5C3X A;  1DZ1 A;  2QCP X;  5FO9 B;  4I65 A;  1B1Z A;  4MIU A;  3VA5 A;  3P75 A;  3OIP A;  2A69 C;  4IUU A;  5C44 B;  1W6J A;  1D1I A;  1YNJ C;  5G3L F;  4KKU A;  2Z1C A;  5M5X B;  4OO1 H;  3T13 A;  2DY8 A;  5IOC A;  2D2C C;  1D6E C;  1PYW D;  2A68 D;  5C4H A;  5CR3 A;  1BUV T;  5KND A;  3HP3 A;  5AFW A;  1LT4 D;  1CTM A;  3AMU A;  2KCC A;  2DNC A;  2X6L A;  3I90 A;  1JWM D;  2NVX B;  4R8N A;  1JR0 D;  4OL7 A;  2KEC A;  3KF8 A;  2TSS A;  1MSG A;  4N9T A;  2WKD A;  1PFN A;  2B2Y C;  2BOS A;  3NWT A;  1Y8N B;  1HPC A;  3D3R A;  2F1M A;  3NP8 A;  1LT5 D;  1PRT F;  4K2L A;  4O42 A;  3S1R B;  2HQE A;  3BYT B;  1JOO A;  1F9S A;  4YIJ A;  5D3D A;  1HUN A;  3CHB D;  2F0Q A;  1SNQ A;  3MVV A;  2Q8I B;  4ZYS A;  2EJM A;  5NUC A;  2JE6 I;  3GV3 A;  5I9P A;  1ZKO A;  3T56 B;  4PMW A;  1AN8 A;  1JWU D;  2QDB A;  2KVM A;  1JWS D;  1SMY C;  1Z6H A;  2F0I A;  2XN9 C;  1SNM A;  3D6C A;  3N52 A;  1A3T A;  1B9N A;  4M1U B;  4RAU C;  2K33 A;  3BYY B;  1EEI D;  4XDX A;  4TKO B;  4XQJ A;  3DEO A;  4ZAI A;  2IPK D;  1RKN A;  3WDN A;  1C8C A;  2B2T A;  2B8G A;  4BBS B;  2C9O A;  3FEW X;  4X3T A;  1FR3 A;  4O1N A;  2I46 A;  4ODG A;  3QG1 A;  3FRP B;  3TSS A;  5JAV A;  5E1F A;  1SYF A;  1WTP A;  5M3M B;  3I4N B;  1W6K A;  4PMC A;  5EBC A;  2X69 A;  1KAA A;  5A35 A;  1BQQ T;  1LTG D;  5FLX L;  5T1I A;  1STB A;  1SBB B;  4LJZ C;  4OO1 I;  1Y69 U;  3HS0 C;  3GTJ B;  4V19 0;  1R4P B;  4ABN A;  4H44 C;  1OXV A;  1BCP C;  1TWA B;  1HFG A;  2RDF A;  4K6D A;  4K5W A;  1FGB D;  1PLF A;  5DM6 3;  1KNA A;  1WTO A;  1J9O A;  1EFI D;  3OOC A;  2SOB A;  4EVO A;  4A3G B;  5M3F B;  4K5V A;  1I6H B;  3I4L A;  2R6G A;  1D5Z C;  4IN3 A;  2R93 B;  1CHP D;  1TWH B;  2CHB D;  5KEE A;  2JA7 B;  5C3W A;  3IAY A;  1GUN A;  1BXT A;  2AQ3 B;  2PZU A;  1STH A;  1FNW A;  2BE5 D;  2O2L D;  1U4R A;  2BE5 C;  4IUV A;  4PNY A;  1Q3L A;  4XXE A;  3T53 B;  1A2T A;  1EOT A;  2OEO A;  1QWY A;  2NN6 I;  2RKS A;  4RGN A;  3SE0 A;  2E76 C;  3C3L A;  3OMC A;  3VYT A;  3BDC A;  5EKL A;  2K05 A;  3DHQ A;  1EU4 A;  4B9X A;  2F0U A;  4EQO A;  2Y0S B;  3OW7 A;  4ME5 A;  1TVX A;  3M85 A;  4RKL A;  2NYZ D;  1CQF A;  2Z8L A;  3FPP A;  1EZ6 A;  4HSP A;  4FP5 D;  1I4Q A;  1QJO A;  1OO9 B;  2K5D A;  1V1P B;  4DU9 A;  1WD1 A;  1EYD A;  3X3M A;  2F0L A;  4X3U A;  3HOV B;  3Q22 A;  4H0L C;  1FYC A;  2OXP A;  1R9T B;  1ICW A;  2NB0 A;  1EIH A;  3SEB A;  1X3P A;  3DEP A;  3V05 A;  3PIP 3;  3SK4 A;  1WD0 A;  2E75 C;  3IKJ A;  1EQV A;  3DWQ A;  4G4K A;  1LTT D;  3LWU A;  1EY8 A;  3S2H B;  4XTC S;  2EY6 A;  3HEJ A;  3MZ5 A;  4FF4 A;  4FO2 A;  1AFP A;  3GD7 A;  3Q24 A;  4HSV A;  3F2U A;  3C1F A;  5KNB A;  3OMG A;  1EYC A;  2AUK A;  2XRQ D;  4EQP A;  1V1O A;  1SMY D;  1ESF A;  3W2D A;  5IOD A;  3PUZ A;  3A56 A;  5DAU A;  1S5E D;  4OHJ A;  1ILP A;  1Y8P B;  4U67 3;  3IFT A;  3MXG A;  4JBW A;  3EVQ A;  3WOE A;  1SYD A;  4RA8 A;  3K5N A;  1DXM A;  5COY A;  3E0J A;  4A3B B;  1S5B D;  4HED A;  3M3Y B;  4CKC A;  2F0V A;  1SYB A;  5C6A A;  3QOL A;  1OXU A;  5CC4 A;  5M5Y B;  3S17 B;  1KTK A;  3EQL C;  1ESR A;  1XTC D;  2X6G A;  5F2D A;  4L63 B;  1IKM A;  2DNE A;  5T1G A;  3GQB A;  1IL8 A;  3OIQ A;  4K8I A;  1QE6 A;  2ZXR A;  2EVB A;  5C5M A;  1O80 A;  2KCN A;  4RKB A;  3ERO A;  4HTH A;  4G7H C;  5LHY 1;  1G8Z D;  5JJZ A;  4CBV A;  2JEA I;  1C48 A;  1I4X A;  4KJO A;  3TBI B;  3VR6 A;  3HOW B;  1IHZ A;  1TQO A;  4A3E B;  4KTA A;  3TP5 A;  5CBE E;  2R7Z B;  3DUZ A;  2LS0 1;  5TSS A;  4CJ2 C;  1EY9 A;  3CKI B;  3RUZ A;  2Q8R E;  1V1P A;  3U9O A;  2KHS A;  2E2H B;  1YNN C;  3J7Y W;  2ICE C;  2BA1 A;  2XSC A;  5M9O A;  1BCP F;  3RD4 A;  2R92 B;  2NN6 G;  2ZXP A;  3U9S A;  4C2M B;  2J4X A;  2GA4 B;  3HOX B;  3QWN A;  5D65 A;  2B2U C;  1MSH A;  3W3A A;  1PMR A;  1H9R A;  3LWE A;  1CM9 A;  3MFG A;  4WFN 3;  3FPU B;  2EYJ A;  3MTS A;  4CHT B;  2PO4 A;  4HR7 B;  1EY5 A;  4DAV A;  3A55 A;  3BVG A;  2XWJ B;  1AZP A;  1CQV A;  1LTS D;  1C4Q A;  2QF7 A;  1PTO F;  1WTW A;  4LK1 C;  2NTS A;  5C0X J;  2WIN B;  2AWN A;  4FVM A;  1ZYR C;  1DCZ A;  4KY5 A;  1EU3 A;  5C3E B;  1JOR A;  1U4L A;  2KA7 A;  3S1N B;  2BA0 A;  4C1N I;  1SJH D;  1LAB A;  2NN6 H;  1H9K A;  5I6W A;  1K83 B;  3I8Z A;  5CBA E;  4A93 B;  1Z47 A;  2A74 C;  4RHR A;  4RH6 A;  3GTG B;  2E74 C;  1TS3 A;  2QIL A;  2MHV A;  2EYM A;  1PFB A;  1BR9 A;  4ZRZ A;  5D3I B;  3TME A;  1CA6 A;  4Q5V A;  4F87 A;  5C4Z A;  1PTO D;  1DOK A;  4RFB A;  1OXX K;  2B63 B;  1Y1V B;  4BWG B;  5EQ0 A;  2NBF A;  2CW0 C;  3KBX A;  1BCP D;  3P7J A;  3K6O A;  1B53 A;  2L11 A;  1ROD A;  1MI2 A;  3QB3 A;  1G2T A;  5KGU A;  1K8M A;  1KDB A;  4HAE A;  1KAB A;  2JEB I;  3I70 A;  1QCB D;  2LFN A;  2NVY B;  3DM1 A;  4C3H B;  2EPB A;  4F8M A;  2SEB D;  1TY2 A;  5KYI A;  3SHL A;  2TMP A;  4P2C B;  1VDZ A;  3O13 A;  4J1M A;  2NVT B;  1EY6 A;  4XT1 B;  4IZ8 A;  4NKL A;  4KJN A;  3IFD A;  3RLF A;  5CV4 A;  4FF3 A;  3NSW A;  4GZY C;  5KIX A;  1AW7 A;  1DM0 B;  1WCM B;  1CZG A;  1EEF D;  1LAC A;  5BN4 A;  2ZT9 C;  3NQT A;  1WTQ A;  2IL8 A;  3URY A;  4RCN A;  4NMZ A;  1RDP D;  2RBM A;  2D62 A;  5I4D A;  3K59 A;  3MC0 B;  2K28 A;  1PRT B;  1I6V C;  4OIK A;  4KKS A;  4HN7 A;  3BVM A;  1X32 A;  4KK7 A;  4C3I B;  2KEE A;  2RQX A;  2F03 A;  1L0X B;  5ELB A;  4BY7 B;  1GUG A;  2EJF C;  1KLU D;  4G7O C;  3MXN A;  1LTB D;  1CK1 A;  2L0C A;  1G6Z A;  3TN2 A;  3KK7 A;  4BA2 I;  2SDF A;  3K5O A;  3D4D A;  1TS2 A;  1HQM C;  2PZW A;  4XYO A;  1V43 A;  2K1B A;  2WV6 D;  2F0P A;  2F0G A;  1R4Q B;  3BG3 A;  4K2K A;  3M4O B;  3PUY A;  5JOB A;  3J80 L;  3G7L A;  1IYV A;  3PIO 3;  1AZQ A;  5LL6 X;  1J8I A;  4QCL A;  3HZX A;  5K5P A;  5JPM C;  1OXT A;  4CKB A;  1DJR D;  1QB5 D;  1HFN A;  3HOZ B;  2PQE A;  4TRD A;  3VYR A;  3MHB A;  2F0T A;  2XIW A;  1FNV A;  4C3J G;  3VR5 A;  1IKL A;  4IQZ A;  2CQA A;  1U4P A;  3NQI A;  1YNN D;  4QIW B;  1STY A;  3H0G B;  2OT2 A;  3GTM B;  1GHK A;  3NUC A;  3H91 A;  3DWP A;  5I9O A;  1IW7 C;  1O78 A;  1B4O A;  5C5L A;  4CJ0 B;  4B9W A;  4DGZ A;  1ENA A;  1E2V A;  4EGV A;  1TKW B;  1M4V A;  2H4O A;  4IAL A;  3SK5 A;  3L7Z C;  3TZD A;  1UAP A;  4DXF A;  1EQT A;  3V2T A;  1DON A;  2F0D A;  2XNA C;  1ZEQ X;  1TY0 A;  2RSO A;  4J6H A;  1GUO A;  5C0X H;  1JOK A;  1HQR D;  5D14 A;  3PMF A;  4ULL A;  5CV8 A;  1BBX C;  2PNR C;  1GJX A;  2MPM A;  3PO2 B;  4KN4 C;  3Q23 A;  4MN3 A;  3MFY A;  2EYL A;  5E4W C;  1I4R A;  4NW2 A;  3TZU A;  1HTP A;  3GP7 A;  1XX8 A;  4C56 C;  1Q90 A;  1TWF B;  3MAQ A;  4CKE A;  2WKC A;  1WTV A;  1B44 D;  4WJW A;  5K36 H;  2MGS A;  5ELF A;  1JE4 A;  1ZXT A;  5EPL A;  2F0H A;  3R2T A;  4FXD A;  1PXU A;  1S5C D;  5KRU A;  4L6T B;  4CGY B;  4Y7N B;  4RGT A;  3OWE B;  4IFD J;  3SDZ A;  5FK9 C;  1M8A A;  2F0K A;  2EXZ A;  4HMI A;  3X3N A;  3S2D B;  1BCP B;  3TP8 A;  4ZUI A;  3K0Y A;  1Z7T A;  4F7X A;  1STN A;  2HCI A;  2FIN B;  4I7Z C;  1LTA D;  3Q0A A;  5DNF A;  2KJX A;  1I50 B;  3BS1 A;  3A8K E;  3M7G A;  1VF7 A;  1TWC B;  2Z4I A;  3L3O C;  3BDO A;  4KD3 A;  2LMC B;  2Q8T A;  4DNR B;  2B8F A;  2F0W A;  3CQZ B;  2D9U A;  2EE1 A;  1XXG A;  2LY7 A;  4QMG A;  3EJI A;  3NWS A;  3MXU A;  3VA7 A;  1QIL A;  3S14 B;  3GO5 A;  3HRZ C;  4R8I A;  4C3I G;  2WAC A;  4DFA A;  2PMZ B;  1CFM A;  3QOJ A;  2A6H C;  3S1M B;  2L9H A;  2VXW A;  3A7L A;  5EJW A;  1CZW A;  1PDQ A;  5HUR A;  2FHT A;  4PQX A;  4DAY A;  3A54 A;  2DY7 A;  3FKI B;  2I07 B;  2PYK A;  2B39 A;  2B2Y A;  1EWC A;  1T5X D;  1LT6 D;  2RDG A;  4DK0 A;  1NCV A;  3VR2 A;  3H6M A;  1VMC A;  1JQY D;  2SNM A;  1Q1E A;  1S5F D;  4A3D B;  1A15 A;  1CT1 D;  4KHZ A;  5IT9 L;  4DA2 A;  2WAQ B;  1YNJ D;  2F3V A;  2LKV A;  1B50 A;  4PV1 C;  4XT3 B;  1SSO A;  3PV0 A;  1STE A;  2EZV A;  3G6J B;  3SK8 A;  4E6I A;  3HKZ B;  1ZYR D;  5EPK A;  3CRK C;  3MXP A;  1SFO B;  1HXY D;  1ENF A;  4G57 A;  1A3U A;  2R3Z A;  1O7L A;  2AWO A;  3WOF A;  2MP1 A;  3AB9 A;  1PRT C;  4HMJ A;  1PZI D;  3C46 A;  2L1B A;  5E3F A;  1ONL A;  1EL0 A;  1B9M A;  1CA5 A;  3GTQ B;  3OWF A;  5EPJ A;  1SYC A;  2B2W C;  2NUC A;  4DK1 A;  1O7Z A;  1BNZ A;  1VCI A;  3KLS A;  1PTO H;  2PCF B;  2JA5 B;  4R9W A;  3HOY B;  2EYO A;  2OF1 A;  3D6W A;  4HCE A;  2IT1 A;  2B2T C;  4U68 A;  2JSO A;  3NBI A;  1UNS A;  3R8B A;  1G91 A;  4Z9C B;  1I3Q B;  1TS4 A;  2EJG C;  1GUW A;  1HA6 A;  3NHH A;  2EOT A;  1A3V A;  4RWS C;  3M4Y A;  1GUS A;  2O5I C;  1RTO A;  3NTK A;  4PMB A;  4ID6 A;  1DOL A;  4N9P A;  4C3J B;  5A2Q L;  1L0Y B;  2H1E A;  4WRD A;  5FO7 B;  1JOQ A;  4QUF A;  1KDA A;  4QF4 A;  5C0X I;  3D8G A;  5ELC A;  3S1Q B;  1U9R A;  4H7B A;  3I73 A;  5K36 G;  1F2Y A;  4C3H G;  1JCK B;  2F4I A;  3MA2 B;  2RSN A;  3J7A F;  2ICI A;  4RGO S;  4FNF A;  3SK6 A;  4BBR B;  2F3W A;  4A3J B;  3VYU A;  2VB2 X;  1E0B A;  3BVZ A;  4S3S A;  4K8J A;  4JK1 C;  4DAP A;  5CYU A;  1F9R A;  1SDF A;  1OXS C;  2B2U A;  2L5T A;  1SEB D;  2RA4 A;  2NVQ B;  2J0T D;  3SVM A;  2K04 A;  1Q12 A;  4FF1 A;  3I3C A;  3EA6 A;  1F2L A;  3PO3 B;  3GTO B;  2L12 A;  3K5L A;  2VNU D;  1SNC A;  3S16 B;  1D1K A;  4C1N K;  1TR5 A;  5FLX E;  4TSS A;  1TWG B;  3BDL A;  1NSN S;  2K5W A;  3T51 B;  1TT2 A;  4ZUJ A;  5BN3 A;  3D31 A;  5I2X A;  2BDO A;  2HUG A;  1DOM A;  4FF2 A;  2B2W A;  1UEA B;  3NXW A;  4ZQ3 A;  4IFD I;  3EFX D;  1I4P A;  3KBG A;  5EKK A;  2KED A;  3S9W A;  3PUX A;  2EY5 A;  2ID0 A;  4J8Q A;  2IX0 A;  3J80 E;  4V0B A;  1RF2 D;  2AUJ D;  5JVG 3;  2EDG A;  2B2V C;  1BOS A;  4ZKC B;  5IGE A;  3HG9 A;  2IX1 A;  3TP6 A;  2VB3 X;  1BO0 A;  3OHX C;  3FMC A;  1IYU A;  5FKA C;  5DEH A;  4X3S A;  2A69 D;  2E2I B;  4BA1 I;  2EY2 A;  1STA A;  3A7A B;  4NP5 A;  5FOB B;  1B2T A;  4DNT B;  5FO8 B;  5IT9 E;  1LTI D;  3P20 A;  1EY4 A;  4IUN A;  1B3A A;  3K57 A;  4KI0 A;  3S15 B;  1QNU A;  2RVL A;  3TDQ A;  1H9S B;  1DYQ A;  1RTN A;  3SR1 A;  3H3V C;  1H9S A;  3NTH A;  1PZK D;  2K32 A;  3QO2 A;  4HCS A;  5IGF A;  2JP1 A;  5JEA J;  1MGS A;  5C4J B;  2J7Z A;  1SYG A;  5CV9 A;  3UI2 A;  4FXG C;  2YYZ A;  2K03 A;  3FVQ A;  4MHE A;  2K01 A;  2JA6 B;  1LLR D;  4WOR A;  2KOL A;  1MBY A;  3A8I E;  3RMH A;  1NAP A;  4AYB B;  1F9P A;  1O7Y A;  4M8A A;  1MD2 D;  3H09 A;  5IIF A;  3T4A C;  3QIA A;  5A2Q E;  3R2I A;  3KLS X;  3OSO A;  3L9A X;  2YU9 B;  3HGB A;  1AEX A;  2A6E D;  2KUM A;  4XIG S;  5CV6 A;  3CRL C;  5J1Z A;  1GUT A;  3NPP A;  2QKI C;  2D5D A;  3ND8 A;  4IUT A;  2NWG A;  2WII B;  4IFD H;  1JIC A;  4DXG A;  1SYE A;  3D4W A;  2O4X A;  1NUC A;  2N88 A;  1SE3 A;  2IJ0 A;  3MEH A;  1SJE D;  3J7A V;  4NDX A;  5IGC A;  3I4M B;  2FJ2 A;  1SXT A;  1F2Z A;  3TP7 A;  4A3F B;  1NR2 A;  3NBH A;  1H9J A;  4CJ1 B;  1VMP A;  4LMQ D;  2EY1 A;  3E5S A;  1PTO C;  4K14 A;  3ERQ A;  1SE2 A;  4BS9 A;  1CHQ D;  2WB1 B;  2A5H A;  2QEJ C;  1EYA A;  5C0X G;  4UAI A;  3OPO A;  4OO1 G;  1A6X A;  3DWA A;  4A3K B;  1LO5 D;  1QG7 A;  3I72 A;  1EWH A;  1A2U A;  4ZKB B;  1HRJ A;  1TII D;  1VF5 C;  1GOZ A;  5JPN C;  2PZT A;  3KUP A;  5KNC A;  2A6H D;  4UDU C;  1KLG D;  2JYO A;  3K58 A;  2EYF A;  3K7A B;  5G3L D;  5IGD A;  5EBD A;  4H13 C;  1D5X C;  1G2S A;  4KMU C;  1X3Q A;  4IUQ A;  2G9H D;  1PRT D;  2DN8 A;  4IFD G;  1LV9 A;  3DMU A;  2MUY A;  3P1H A;  2PW7 A;  1F9Q A;  4LAA A;  1PZJ D;  1TS5 A;  3A8J E;  1EY0 A;  5J39 A;  3LX0 A;  1JC7 A;  5ELD A;  4QUC A;  4KY7 A;  1FD7 D;  4F88 A;  3D4R A;  1FNU A;  3C1E A;  1E2Z A;  1KDC A;  5ELE A;  3PUV A;  1F2M A;  1HHV A;  2A6E C;  5IGG A;  3RZO B;  1ENC A;  3R3O A;  1NR4 A;  2PPB C;  1QNK A;  2NTT A;  3QJY A;  4KD4 A;  4KN7 C;  4X3K A;  1HTL D;  2FMM A;  3Q6S A;  2VUM B;  3AU7 A;  4IUR A;  1SAP A;  1ML0 D;  1Q1B A;  1SNP A;  1PFM A;  1U4M A;  4DF7 A;  1DD2 A;  2XVS A;  2AQ2 B;  4RCO A;  1G29 1;  1V8Q A;  1KNE A;  1T5E A;  2C5C A;  5IGB A;  2F0J A;  2M9V A;  2Z4H A;  3PUW A;  1II3 A;  5CMD A;  1STG A;  2PW5 A;  3V96 A;  4EQN A;  2N55 A;  1BF4 A;  4XQQ A;  1HA5 A;  3DXJ C;  1XYI A;  3FDT A;  2IWH A;  1SE4 A;  5M5W B;  2WP8 J;  3GTL B;  5JEA H;  2E2J B;  1PTO B;  4ZLT F;  2F0F A;  2AQ1 B;  1WVL A;  1WTR A;  5E4X A;  2L4N A;  4ZK9 B;  1LTR D;  1RJT A;  2HDL A;  1RCV D;  2F0S A;  2MJ8 A;  2BDN A;  3CU7 A;  3BZD B;  2XWB B;  1Y1W B;  4K6L A;  2V4D A;  2IX3 A;  2ZXO A;  1K8O A;  4ILW A;  4DN4 M;  3J81 E;  1SND A;  1EY7 A;  3R93 A;  2FMC A;  3H94 A;  3J81 L;  2F0E A;  4KY6 A;  3M7N A;  2XRS D;  5EKI A;  2A68 C;  1BDO A;  3C2P A;  4BY1 B;  3VR4 A;  1CI3 M;  1EIG A;  2G9D A;  2R61 A;  4XQN A;  2HCC A;  3K5M A;  3NK9 A;  1LT3 D;  5I2Y A;  5J22 A;  1TU2 B;  1HCZ A;  3ND9 A;  3SXH A;  2EYH A;  1WTX A;  4FXK C;  4IUP A;  5LL6 S;  4A3M B;  4QB4 A;  2FFK B;  5C4X B;  4KV6 A;  3IL8 A;  3GTP B;  2ENB A;  3HOU B;  1I4H A;  5COR A;  2L55 A;  1Y8O B;  1I4G A;  2BCO A;  1S5D D;  4A3I B;  1ET9 A;  2CVR A;  3GTK B;  4B08 A;  5ISR A;  2A73 B;  5BN5 A;  4G7Z C;  3JAM L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...