5KRUA

Crystal structure of staphylococcal nuclease variant delta+phs t62e/v66k at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
132
structure length
132
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFEKKMKENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62E/V66K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 132
sequence length 132
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5kruA00
5IGCA 2LKVA 5M9OA 2WACA 1JOQA 1AEXA 1NUCA 1A2TA 4HTHA 2F0MA 5KYLA 2PQEA 4ID6A 1EY4A 5CR3A 1F2MA 1EY9A 3EVQA 1A3VA 3NK9A 1JOOA 5CC4A 2PW5A 3BDLA 3D6CA 3PMFA 4IUNA 5CGKA 3MVVA 4K5WA 4KHVA 1JORA 4F8MA 3TMEA 5IIFA 2HQEA 4K2KA 2EYMA 2QDBA 2RDFA 2RKSA 5JAVA 3HEJA 4N9PA 4KJOA 5KIXA 5CV7A 5DEHA 5F2DA 2F0EA 2SOBA 4K5XA 3ERQA 4QF4A 2EY6A 5DAUA 5CV5A 3QOLA 3HZXA 1F2ZA 2F0PA 4OL7A 4J6HA 4RKBA 4TRDA 4RKLA 5ISRA 3TP7A 5KEEA 3E5SA 2F0QA 2PZWA 3SK8A 3TP8A 1SYCA 1STHA 2RBMA 3OMCA 4HMIA 4WORA 1SNQA 5C5MA 2NUCA 1A3UA 1SYGA 4KD3A 5JOBA 3MEHA 3D4WA 3NP8A 3EJIA 5EKLA 3T16A 2OXPA 1EZ8A 1EZ6A 3SK6A 1F2YA 3R3OA 1IHZA 5KGUA 1STAA 5CV8A 5C6AA 2F0DA 5IOCA 4KJNA 1SYBA 5EKKA 5C4HA 2EYPA 4E6IA 3BDCA 3C1FA 3QB3A 4I65A 2OEOA 3D4DA 5EGTA 4NP5A 3EROA 3ITPA 1SYDA 5CV4A 2OF1A 1A2UA 2KHSA 3MZ5A 5C5LA 4B9XA 5IODA 5KYIA 5J39A 2F0JA 2F0IA 4B9WA 5C3XA 1II3A 3SR1A 2SNSA 3OSOA 5C4ZA 3TP5A 4K5VA 1EYAA 4NKLA 5IGFA 1ENCA 1EYCA 3SK4A 3U9OA 1EY5A 2SNMA 1SNCA 4KY7A 5IGDA 1EY0A 1RKNA 2PZUA 1SNDA 2M00A 3SK5A 4EQNA 5I9PA 3RUZA 1KAAA 5NUCA 4K14A 2EY1A 2PW7A 4WRDA 5E1FA 4KV6A 1A3TA 5I6YA 3OMGA 4K8IA 5HGTA 3P1HA 2ENBA 4H7BA 4ODGA 2EYHA 2F0LA 4QMGA 4EQPA 1EYDA 1EY6A 1SYFA 1NSNS 3C1EA 1U9RA 1ENAA 4DGZA 4EQOA 3OWFA 4DF7A 1EQVA 4KY5A 3T13A 1TR5A 5C3WA 2EY2A 2F0HA 2EYFA 4NDXA 3H6MA 2F0VA 4KY6A 2KQ3A 4DU9A 2F0TA 1STNA 3DMUA 1EY7A 2EYLA 4IALA 4IZ8A 4PNYA 1KABA 1TT2A 5K5PA 4PMCA 3QOJA 4MIUA 3DHQA 1KDCA 4HMJA 4J1MA 1TQOA 4ZQ3A 4K6DA 4NMZA 4YIJA 3VA5A 4DFAA 5E3FA 4S3SA 1SNPA 4G57A 2F0FA 3MHBA 3MXPA 5IGBA 2O4XA 3D8GA 4ME5A 3SXHA 4EVOA 3S9WA 4KD4A 5CV9A 5J1ZA 2F0OA 3LX0A 4F7XA 2F0NA 2F0KA 1SNMA 5HURA 2F0WA 4N9TA 5IGGA 2PYKA 1STGA 2F0SA 2PZTA 3NQTA 3NXWA 1EY8A 3SHLA 5I6WA 2F0UA 3TP6A 2EYJA 1SYEA 2EXZA 2F0GA 2F3VA 4ZUIA 2EY5A 3P75A 4KTAA 4K2LA 5CV6A 1STBA 1JOKA 3NHHA 4K8JA 4ZUJA 5I9OA 2F3WA 5IGEA 1STYA 1SNOA 2EYOA 1KDBA 4LAAA 3NUCA 4R8NA 3V2TA 5KRUA 5J22A 4PMBA 1KDAA 4QB4A
chains in the Genus database with same CATH superfamily
1P16A 4HSPA 1NUCA 2CW0C 3AMUA 4JI0Q 2IT1A 5CR3A 3S1RB 1IBLQ 3UDIA 1A3VA 2I5LX 5IYCG 2B2UA 3PMFA 5EBCA 4K5WA 4N8X1 5GROA 1LTID 5M5YH 3I4NG 1L0YB 1HR0W 4RWSC 2RDFA 4JG2A 1HNXQ 4X65L 1PHJA 3GTMB 1XPUA 1HZCA 4K0KQ 2M2LA 1QVGA 4JCVE 5FO8B 2EE1A 1E24A 2JP1A 1PLFA 4IPDA 4QIWE 1A3UA 1NNXA 5FLMG 1EZ6A 2I5HA 4XT1B 3PF4A 2JA6G 5JVG3 3MXNB 2EYPA 4KKTA 3HOVG 3I73A 4CDCC 2B2TC 1LTRD 1Y1VG 2JN4A 3ND8A 2ZXOA 4ZLTF 4JBKA 1KLGD 1EYGA 2RA4A 2SNSA 2VQEL 1E2WA 2IPKD 2DY8A 1YEZA 5IGFA 2Q2IA 1SDFA 3J80i 4DA2A 2WFWA 1F9PA 1I3QB 1XPRA 4C3HG 3CMAA 4L5SA 1QVCA 3U58A 3S2DH 1JJGA 1EQQA 4P75A 2B39A 1NSNS 1KNEA 1IZ6A 4EX5A 2PCFB 4KY5A 3JAMi 1Y1WG 3GTOH 2EYFA 4FXKC 3OTOQ 5M5WB 4R4QA 1VQ6A 5IYDH 4DNRB 5C0XG 4A3MB 4IALA 3U50C 3MTSA 4IPGA 3PSIA 1OXXK 4JC0A 3Q22A 3KDFA 2RDHA 4DV5L 5BR8L 2MO0A 1NE3A 1W6JA 4YY3L 3S1MB 1PYWD 4A75A 2VB2X 4RFBA 3U4VA 1EY8A 4DV0L 4HSVA 3TS2A 2E8GA 3RNUA 3E9HA 4OX9Q 3D4RA 2QEJC 3EN2A 5J3BA 4PMBA 2JEBI 3WOFA 2ZM6Q 4RHSA 1PH5A 4IUQA 5JPNC 3CC7A 2LFNA 4A3DB 5EAYA 1EWIA 1B53A 4J15A 1UE5A 2IX0A 4JI2L 4DV7L 1W2BA 4IO9A 4GOPB 3ONAB 3CC2A 2HQEA 5JAVA 5M3MH 1IBMQ 1LACA 4N9PA 4Q0FA 1VMCA 3GTKB 3QOLA 1WD1A 3PCOB 2N88A 3W5OA 1X56A 1X3PA 4NXML 3CHBD 3A5ZB 3S14B 2CFMA 1STHA 1XMQL 3HOUB 1WTPA 3K5NA 1SAPA 3GTGB 4GLXA 3J81i 2N3SA 2XRSD 1KC8C 2HDLA 1V1OA 1XX8A 1VQAA 1A0IA 1KLUD 2D0PA 4KHPQ 4BXXH 4C2MH 5CMDA 3S15H 3KJPA 2Z6BA 2JE6I 1SE3A 2KEDA 1VQHA 4C3JG 1CTMA 1SJHD 3M9BA 1DOLA 4YWMA 1QZGA 2H1EA 3BZKA 4DR6L 1SNDA 3VYUA 3BYTB 2B2WA 3NBIA 2K05A 1R4PB 4K14A 1H95A 2KOLA 3M4PA 2X69A 2KJXA 1HA5A 3PUYA 4L5QA 1WTHA 2MFIA 4RCOA 3SEBA 1SYFA 1IBKL 3N52A 4DUYL 3ULJA 2I0QA 4DV2L 2KQ3A 3HOYB 3JC66 3L7ZC 1CA6A 2Q8RE 4LF4Q 1I6HH 3FKIH 4MIUA 3RLFA 2NVTH 3J81E 1V9PA 3W1GA 5JJKA 4X66Q 4ME3A 1K83H 1T5XD 4QL5A 1N9WA 3HRZC 1CI3M 2Q8IB 1L1OA 4OXPA 3CW2C 5M5YB 4BY7G 4KHZA 2G5DA 2DNCA 4PG3A 2OTJA 1P8LA 2ID0A 2CH4A 1DZ1A 1AE2A 2EPBA 2KEEA 2X6LA 3A5UA 2WV6D 1TKWB 2BOSA 1H9SA 2L0CA 4P71A 2P5ZX 1XMOQ 1O7ZA 5C44B 2PNHA 3PUVA 4B3TL 1IYVA 1H9KA 5IYBH 1FL0A 1KIXA 1IYUA 2OQ0A 3D6CA 3PGZA 4IPCA 4JI1L 1VQFA 1PYSB 3RN2A 2L1BA 4Y7NB 1S5DD 2EYMA 4XIGS 4YWKA 4BBRB 3PIO3 4DR7Q 5F2DA 2SOBA 3FDTA 2A68D 4RGTA 5DAUA 1XNRL 4LFBL 1F2ZA 3VR4A 3DWPA 2WINB 3DWQA 2Q2TA 4LF6L 1QUQA 5ELBA 5LMUQ 2OQKA 4BA2I 5C5MA 2LMCB 4P2CB 3HOWB 1QCBD 3TZUA 3S2DB 2R7ZG 1JCKB 1SRUA 4JOIA 1Q81C 2KCNA 3T1HL 1U4PA 3HS0C 1WTXA 2WAQG 1DCZA 3CCRA 1DOMA 2I07B 2OEOA 3Q23A 3GTOB 2CKZB 4RAUC 5C4XH 5IODA 4JI0L 3L0OA 1U5KA 2F0IA 2FINB 1S40A 1VCIA 1D6EC 1I4PA 1PZID 1ENCA 4EQ5A 1PMRA 4CKCA 4O1NA 3D0FA 4EQNA 4A76A 2ZJQA 4AYBB 4YWLA 3VYSA 1UEAB 4K8IA 4A3GB 1HUMA 3PIPA 4A3JH 2NZHA 3NWSA 1T5EA 2UXDQ 1TR5A 2D5DA 2K1BA 4DU9A 2F0TA 1EY7A 4A3CH 2MNAA 4PMCA 3ND9A 3VA5A 4DNIA 4YIJA 2IX3A 3TS0A 4DR4Q 1VQNA 1CHPD 1DGSA 3DEOA 1WOCA 1YJ9A 5M3MB 1TS4A 2PYKA 2A1AA 2K52A 1J5EQ 3J7YW 1PH8A 4QJFA 1GOZA 4HJ9A 5IY0A 4KTAA 1SFOB 1I50B 3H94A 5I9OA 4JYAQ 4DAYA 1W3SA 4B08A 4LF8Q 1C9OA 3CCJA 1TY2A 3OTOL 2XNAC 1AE3A 4BY1H 1ZXTA 3TDQA 4YCUA 2KCCA 4DV6L 3CAMA 3I4MG 4XYQA 2FMCA 4X62L 3S15B 3OIPA 3CP0A 3MEFA 2A6HD 4QF4A 3EFXD 1D1KA 1QNUA 3HOXH 5BN4A 3KYHC 2WB1B 4IFDI 1VQ8A 1LTBD 3E5SA 4H44C 5K36G 3W1BA 3AU7A 3NP8A 2DGYA 3D4WA 4BBSH 2RHSB 1O7IA 4KK7A 4MTNA 3SK6A 1HFNA 4IN3A 3MWYW 5L37A 3LWUA 2VQEQ 3U4ZA 4A3BG 2ZM6L 3EROA 1JMCA 3MZ5A 4JW0A 3CMEA 4C56C 3F2CA 2GVAA 4RGOS 2F52A 1JB3A 1DM0B 3KF8A 4FF2A 3AQQA 1M8AA 4R8IA 3R2TA 1K83B 1IBML 2B8FA 3SK5A 2K28A 5I9PA 2F03A 3RUZA 4ULLA 1VQKA 5E1FA 2B63G 4KV6A 4FVMA 4H7BA 4CJ2C 2JJQA 2F1MA 1SROA 2QGQA 1EWCA 1MJCA 1MGSA 1TWGB 1ONLA 2UU9Q 4B3MQ 3FEWX 2R7FA 1LTTD 4L5TA 4YY3Q 2BH8A 2AKWB 4KHPL 4DR2L 5D3DA 1PDQA 4QIWB 2C9OA 2Y0SE 3CCLA 5IGBA 1KL9A 2O4XA 4KI0A 4CBVA 2VUMG 3HKZE 2Q2UA 1U4MA 2JA7H 5EPJA 1E22A 2QKIC 4TKOB 1BUVT 2FJ2A 3NXWA 5E4WC 1A6XA 2B2VA 1PH2A 2OCEA 2JA8H 1YBYA 2F0GA 5EKIA 4TVAB 2R93G 2MO1A 4K2LA 4YHHL 4K8JA 2A6ED 1L2FA 2K7VA 4JI2Q 4CDEC 1QNKA 3V2TA 1VQLA 2UUAQ 1HA6A 4HTHA 1Q7YC 5IP7G 4JBJA 4IUNA 1I3QH 1PRTF 4GS3A 4LF4L 1K0RA 5C4XB 4FXDA 1ET9A 3HEJA 1XMQQ 5DEHA 1V1PA 2EY6A 3D6WA 1ML0D 4A3EG 2PPBC 2A6HC 4CHTB 4LJZC 5ISRA 5FLXE 4QQBX 1G8ZD 1EU4A 4A3MH 1EIYB 2VXWA 1BCPF 3EJIA 1BF4A 2KENA 1ASYA 2Z0SA 2XSCA 3GV3A 4A3JB 3S17H 5EKKA 2OT2A 1XMOL 1Q3LA 1ZYRD 3STBC 3S1MH 4DR6Q 1PRTD 5IYBG 1X3FA 1B1ZA 2Z4HA 4YCWA 1TVXA 1HZ9A 4C3IG 1RD9D 2YTYA 4NPSA 3SVMA 4PMWA 1PH1A 3IRBA 4IFDH 4JI4Q 1PTOF 5FLXL 1IBKQ 4QGUA 3QJYA 4DUYQ 3CCEA 3K5OA 4DV2Q 2E2HB 4A93H 4A3DH 1KNAA 1PVOA 1SE2A 5LMUL 4DXGA 4QMGA 3GTLH 2FMMA 3PUZA 3M3YH 1O7YA 3OWFA 3OHXC 3I55A 1RCVD 1UE1A 4R9WA 3T51B 3GDEA 1O80A 4K6LA 3E6ZX 3GTKH 3QOJA 4M8AA 4Y52H 4NXNL 5E3FA 3S14H 4BY1B 1JJCB 1GUGA 3HOUH 2R92B 2XWJB 3HKSA 5J1ZA 1PTOD 1SMYD 2B2TA 3LX0A 2K01A 5HGQA 2A74C 2E2IB 5IGGA 1OXTA 4JI5L 3UDFA 4KN4C 1EEID 3LGJA 4LUVA 3D3RA 1R9TB 2DJGC 3BVMA 3P75A 4JI8L 4OO1I 3I90A 1CKNA 2K03A 1EIFA 3M85A 2ZTCA 2A6EC 3DM3A 1X9NA 2WP8J 4BBSB 4JI1Q 2UXDL 3A0JA 3DEPA 2WACA 4M1UB 3SDZA 3J7A5 1KRSA 2OTLA 1B70B 1I6VC 4L6TB 3HP3A 5DM63 3DLLA 4A3CG 1JOOA 3PO3B 1I94L 2QEXA 4F8MA 1CQFA 1VQOA 1HCZA 1LT6D 4DR4L 4KKUA 3H0GB 3TREA 3HOVB 3I72A 3HG9A 3H15A 3TBIB 2F0QA 3T1HQ 4U673 3J7ZC 4POGA 2A69C 1D5ZC 2RSNA 5JOBA 3EIVA 1EFWA 2JA5H 1EZ8A 2AUJD 2DY7A 1CKOA 1D5XC 1A63A 1EL0A 1V8QA 4DAPA 1X3QA 1M90C 4JYAL 1ESRA 3GV6A 4WFN3 4E6IA 1SLJA 4LF8L 4YCVA 4A3LG 1FVIA 5I2XA 1K0SA 1YHBA 4TQUS 1D8LA 3HOZB 2EZVA 3GO5A 3L9AX 1JC7A 1EY5A 4KY7A 1EY0A 4GLAC 4A3IG 3M7NA 2JA7B 4GNXB 3H09A 3HOXG 5C44H 2BA1A 3C46A 4WRDA 4WJWA 2K5HA 1MBYA 2VB3X 1N8RC 4OWTB 3C3LA 1XNQL 2JA8B 2B3GA 4GN4B 1K3BC 2D2CC 5IP9G 1JWMD 5LMNL 2EY2A 4NDXA 2L55A 4Y7NH 1HJPA 2SEBD 3F8TA 2C5CA 4BBRH 4IZ8A 3GQBA 3J80c 1U4RA 2L11A 4HMJA 1KDCA 1O78A 4XXEA 2WIIB 4LNQA 1BKBA 4L8JA 4A4IA 4CDFC 1BNZA 3C2PA 4FF4A 1SNPA 4QUFA 3RLOA 4A3FG 1KD1C 1GXDC 4O42A 1NTGA 3HOWH 2E75C 1D5MC 1PTOC 1IL8A 4LW1A 2D62A 3JAMc 2K5DA 1SYEA 4O0AA 1V43A 1LUZA 2E76C 3PUXA 5CV6A 1YNNC 1JOKA 1Q82C 1S3OA 2NVQB 5C0XJ 4DV6Q 4X62Q 4IUVA 5IGCA 5IE8A 1GUOA 5M9OA 2UU9L 2PQAA 4B3ML 4HIDA 1B9MA 5KYLA 2PQEA 3FVQA 1EY4A 1VQPA 3S17B 4LWCA 3M4QA 3I91A 3NK9A 4KHVA 3H91A 2PNRC 1VQDA 4A3GH 1I5FA 2LXKA 2KHJA 1UE7A 1EQRA 1JR0D 4U68A 3MFYA 3UI2A 5GAHC 3Q6SA 2KUMA 4FXGC 2V4DA 2A5HA 1IW7D 4OO1H 3TN2A 1X55A 1QOHA 4C3JB 3I2ZA 3EQLC 1SYGA 3MEHA 4DK3C 4A93B 2N78A 4HIMA 4DK0A 5CV8A 3GTLB 3CCMA 4XQNA 4CKBA 3M3YB 2EJMA 2PO4A 3BDCA 2UUAL 2B2UC 3C1FA 4I65A 3FPUB 1RTOA 2VL6A 2OF1A 2KHSA 4JVZA 1HZBA 2LXJA 1TS3A 3A56A 1HTPA 1EUJA 4DK6C 1SFOH 1I50H 1JB7A 1TWFH 3J81c 1RKNA 1BO0A 2Z4IA 4IURA 4DN4M 4RMFA 5DM73 3KK7A 4X64L 3KF6A 2X6GA 4DR2Q 2MJ8A 3TSSA 1F2LA 2EQSA 3F2UA 3BU2A 4O2DA 2DJFC 5A35A 4A3KG 3IAYA 4P73A 2EJGC 5E7NA 5HY6A 1RIPA 4I7ZC 3MXPA 2CQOA 1IXRA 4P74A 5C3EH 2YTXA 2JQOA 5KNBA 1YI2A 4YHHQ 4XTCS 4AQYL 4JI4L 1PH7A 2EXZA 2EY5A 3K5LA 1CHQD 2NN6H 1Q8KA 4A3DG 2KCTA 1PTOH 4IQZA 2JK8A 2L9HA 2JA5B 1Q1EA 4JI6L 2DN8A 2O2LD 2PI2A 1ASZA 1EY9A 1PV4A 5A2QL 2QA4A 1NY4A 4UHVA 1S4ZA 2MGSA 2RKSA 1X65A 1G2SA 3CD6A 3X3MA 3T1YQ 4H0LC 4K5XA 4L5RC 2F0PA 3OWEB 4TSSA 1TWGH 4RKLA 3RZDH 4DR3L 3MXNA 1LT3D 2VS1A 1X3EA 4KD3A 2B8GA 2Y0SB 3KF8B 1PH4A 1VDZA 3HKZB 3PO2H 1GKHA 4KN7C 2LY7A 1FGUA 1TXYA 1YNJD 2A19A 2H5XA 4ZKCB 5FJ8G 1Z6HA 4RA8A 5J39A 5CYUA 3KBGA 2FXQA 1F77A 1LLRD 5C4ZA 3PQIA 1XXGA 5LHY1 2ICEC 5ELNA 4G7OC 2SNMA 3RD4A 3L2PA 2BDOA 3A8IE 4B3RL 2ZTEA 2EY1A 4MZ9A 4PZ8A 4IOCA 1VQ9A 5EPKA 2H4OA 2C35B 1WCMH 2F0LA 3HOYG 3I4OA 1HR0L 1TY0A 4DF7A 2BCOA 1EQVA 3A74A 4NXNQ 4ILWA 2DUDA 3OW2A 2TMPA 3NTKA 5T1IA 5JJZA 3CCQA 1NBWA 2XGTA 1B9NA 4J1MA 3EA6A 1PH6A 2AUKA 1Y8OB 2AQ2B 3NELA 1TIID 2QDLA 4JI5Q 3A54A 3K58A 2B2WC 2NZOA 1HQRD 5GAGC 4JI8Q 4DK1A 3K0YA 1YHQA 4ALPA 1I4RA 3NQTA 1XWEA 2F3VA 5D65A 4HCEA 5C44G 3VDYA 1LTLA 3ZJYC 4JI7L 3I4MB 3A7LA 4DR5L 5T1GA 4C1NK 3OPOA 1K3RA 1KDBA 4KMUC 4DAMA 1H9RA 4GNXC 1PH9A 4GOPA 1I94Q 1JICA 3KBXA 1O7LA 2CWPA 1PFMA 4DKAC 1CZGA 5EQ0A 1F2MA 3IFTA 3MVVA 3A8KE 1L1OC 2IX1A 2E2HH 3NTHA 3I56A 1XJVA 3WDNA 3ERQA 3P7JA 3HOWG 3MXUA 5IT9c 3G6EA 1TWFB 1LYLA 1PRTB 1HNZL 4JI3Q 4JPBW 5IYDG 1XPOA 1J6QA 4GN3B 1E2VA 5C4JH 2N55A 1MHWC 2XIWA 2UUCQ 2R92H 1FD7D 2KA7A 5EGTA 1GM5A 3ITPA 1E3PA 2GVBA 2E2IH 4LF5L 2ZXRA 4B9WA 2O5IC 4AYBG 5IYCH 4DAVA 1R9TH 3TP5A 2A68C 1NMFA 1K8AC 3U9OA 3RMHA 3I4NH 4A3GG 3Q8DA 1XNQQ 1DD2A 5H1SE 4QY7A 5C3EB 1TWAH 2KECA 3KJOA 2HIVA 5LMNQ 5M5XB 1A3TA 2EIFA 1BQQT 3QR8A 4RGMA 3Q0AA 1EOVA 4JOIC 2Z9HA 4KKSA 1EY6A 1I4QA 1VF5C 3QG1A 3PO3H 2JSOA 4R4CA 2KHIA 3NBHB 2F0HA 1PTOB 5FLMH 1XTCD 1HRJA 2O5JC 2D9UA 1FGBD 2RCNA 1I4HA 1QJOA 1WJJA 3H0GH 1SMXA 3HOVH 3MAQA 3MC0B 4IUPA 2BDNA 4ZQ3A 5M3MG 1Y1VH 1H9MA 1ZEQX 4UAIA 2CVRA 2B2YC 1LV9A 2IHEA 1C8CA 4IUUA 2PMZE 2F0WA 3KLWA 1D1IA 2F0SA 2IWHA 3SHLA 4PZ7A 3PUWA 1MSHA 5ELEA 4DR1Q 3NENA 4HEDA 4ZUIA 3AYHB 1JE4A 1GO3E 4C3HH 2WAQE 3RZDB 2BH2A 3SGIA 1E2ZA 2EVBA 4XQJA 1SNOA 5J22A 3CCUA 5FOBB 3T16A 4BXXG 3UE0A 3HOZH 2EJFC 2IHFA 4L63B 1AH9A 3CCVA 4OEMB 1JOQA 1Y1WH 1Y8PB 3PO2B 4LFCL 2ATWA 2BE5D 2PW5A 2YYZA 1JORA 2WB1G 2K75A 1XTDA 1NCVA 4KJOA 1PFSA 2F0EA 1QB5D 2KBNA 5CV5A 2RCFA 1WTWA 1KTKA 4TRDA 5IT9L 1SYCA 4HAEA 1AFPA 3AB9A 3RR5A 5KGUA 1WCMB 1Z47A 1GVPA 5C4HA 4MHEA 1RF2D 3BYYB 3FKIG 4H13C 4HIKA 4HJAA 4LUZA 5AJ3L 3M4OB 1X3GA 5CV4A 4RH6A 1Q8IA 1LT5D 2J0TD 3OSOA 3DM1A 5M3FB 2VNUD 3P20A 2NVQH 1CT1D 5ELCA 1Q12A 4X64Q 2FHTA 3T1YL 3J7AF 2VY3A 3S16B 4CKEA 1LTAD 3I4LA 4Q5VA 2ENBA 1TWCB 1YITA 2TSSA 1EYDA 1BR9A 1N36L 2UUBQ 1PZJD 1FR3A 4B3SL 1CSQA 4OWWB 4LF9L 2EYLA 3PIOA 1R4QB 1J8IA 1KABA 1S5CD 4R4OA 2CW0D 1SE8A 3MFGA 4AQYQ 1M1KC 5FO7B 1KHIA 4EVOA 4DV3Q 4C3JH 1VQ5A 1F9SA 1MSGA 5CV9A 2F0NA 1E7ZA 1BCPD 3KDFB 4N9TA 1A8VA 4OHJA 3UDGA 2VW9A 4X6AH 2F0UA 1J9OA 1X54A 4JI6Q 5ELDA 1KAWA 1OO9B 5KRUA 2UXCL 1QWYA 3NUCA 5KNCA 1K8OA 2F4IA 2LKVA 5EPLA 2A8VA 2NBFA 5C4XG 4HN7A 1DXMA 4UPAA 5C4JB 3BJUA 5CC4A 3MXGA 1IL2A 4CJ0B 1ICFB 2NWGA 5IIFA 4DR3Q 2QDBA 2NVYB 1CK1A 4N8FA 1WI5A 4PZ6A 2B2VC 3HZXA 2KCMA 3BVZA 3F2DA 3I4NB 2AQ1B 3I8ZA 4A3JG 5CORA 1BOSA 1L0WA 4FF1A 1KQSA 1TWAB 2K5NA 2NUCA 4V0BA 1K28A 1F2YA 3R3OA 1G91A 5IWAQ 3E0JA 3KLSX 3CC4A 1CSPA 2IY5B 2E2JH 3DWAA 1B44D 2K5QA 2JA6B 5ELOA 1EIGA 4FF3A 4B3RQ 3KOJA 2IL8A 4WJ3M 1Y1VB 1SNCA 1NR4A 1TU2B 2XTIA 1MKHA 5EJWA 4X3UA 4JK1C 1WTVA 1HR0Q 5D3IB 2WKCA 1N32Q 1HQMC 1UAPA 1VMPA 3BZDB 2FFKB 4IJHA 1HTLD 3RZOH 1SR3A 4JI3L 1CA5A 3HGBA 1RHPA 4C3HB 1AW7A 1VQEA 3BG3A 1ZYRC 1UWVA 4OONA 2R7ZH 1N33L 3NPPA 2HHHL 1PRTC 4BY1G 3DMUA 4F87A 1VQGA 4PNYA 2UUCL 3RN5A 4BWGB 1EFID 4CJ1B 1BBWA 1TQOA 1Y1WB 1G2TA 1CUKA 4IUTA 4G57A 5JVH3 2F0FA 3MHBA 1Q1BA 4JI7Q 5GQOA 4DR5Q 3QO2A 2Z6KC 1BCPC 1YHAA 1EEFD 2K5WA 3UE1A 2YU9H 2EYJA 2NN6I 1GUWA 2DNEA 1L1OB 4BBSG 1GJXA 1VQ4A 1S72A 3CKIB 1ET6A 2K33A 2EYOA 1QE6A 3PO3G 3A8JE 1KDAA 3BZCA 2CH4W 1VS0A 2HQLA 3OOCA 1RL2A 3PIP3 1WTOA 3MA2B 1H9SB 4JBMA 1A15A 3BDLA 5CGKA 3H0GG 1X32A 4DUZL 1PA6A 1SMYC 2K32A 3VYTA 1HNZQ 1FNVA 1IYJB 1X6OA 3AFPA 5JJIA 3S2HH 1G6ZA 3V05A 2ZTDA 1HXYD 4LUOA 2PZWA 4DR1L 4UY8C 2EOTA 2RQXA 3NSWA 2OXPA 4LF5Q 2NVXH 2L15A 1BDOA 1QUQB 4G7HC 1PZKD 3G7LA 4KJNA 1VQJA 3K0XA 3KFUA 3HOZG 3S1QB 1JWUD 3K7AB 2D0OA 3OIQA 2A73B 1A2UA 4B9XA 1YZ6A 3BDOA 5C3XA 4FP5D 3SR1A 2JA7G 4DNTB 1S5BD 4K5VA 2E74C 3IFDA 3I4MH 4NKLA 1NMGA 1CKMA 2JA9A 1QZHA 2JA8G 1KAAA 1UE6A 3X3NA 4A3KB 1IKLA 5HGTA 1BXTA 1HH2P 3K57A 1ICWA 5K36H 2EYHA 1JT8A 4X3KA 3A55A 1B8AA 1QVFA 1SN8A 2F0VA 1STNA 3J80E 1Y8NB 3G6JB 4DPGA 4A3BH 1RODA 2SDFA 4ABNA 4JV5Q 3O13A 4OELB 1YJNA 1QG7A 4AH6A 5BN3A 4RHRA 4EGVA 3JAME 4A3MG 2CCZA 2AMCB 2I5MX 2RSOA 4HJ7A 1N34Q 1EU3A 1E0BA 3LWEA 3S24A 1NJIC 4BY7B 2ZJPA 2B63H 2L4NA 2F3WA 4BS9A 1GHKA 3GTJH 4LFCQ 2UUBL 3J80L 3K81C 5I2YA 5JEAH 1I4GA 4IOAA 5A2QE 1A2TA 2F0MA 4ID6A 5CBAE 2E5LL 4R4IA 3TEHB 5DLQE 3I7FA 2E2JB 4DAYB 5M5XH 2V1CC 5G3LF 4IFDG 5KIXA 4IFDJ 4DV3L 4DV4L 3JAML 4GKJL 3BS1A 2VUMH 3FP9A 1LABA 4MN3A 4RKBA 4R1JA 3R8BA 4IJLA 4AIMA 4LFAL 4A93G 3TP7A 1D7QA 5KEEA 5GAEC 1ENFA 2J7ZA 3PV0A 5LL6S 4WORA 2Z1CA 3T53B 2I46A 3D31A 2YV5A 3G4SA 2ZXPA 5AJ3Q 2R93H 2QILA 2HCCA 3RZOB 4WJ4A 4LMQD 2F3IA 1WYDA 1LTGD 2K4KA 2PMZB 3E0EA 4MNOA 1HFGA 3CRLC 3S1NB 2R7ZB 3VR3A 2UXBQ 1SJED 3VYRA 5C5LA 3W2DA 5KYIA 2IW3A 1JJ2A 5IP7H 3HOUG 1TWHH 2HDMA 4GNXA 5G3LD 5FK9C 2WAQB 1CFMA 3DUZA 1VQ7A 3GTQH 4GZYC 2ES2A 1DOKA 1NR2A 3KLSA 2PZUA 2M00A 1IW7C 1N36Q 3LNNA 4A3EH 4B3SQ 2ALYB 3L3OC 4LF9Q 3CU7A 1YJWA 1F9QA 2YU9B 4UP9A 4EQPA 2PI2E 1EOTA 1U9RA 4ZAIA 1AP0A 1CQVA 2LSSA 4HJ5A 3R93A 5IWAL 3OW7A 4ZYSA 3NE5B 2F4VQ 2AQ3B 3AFQA 2KVMA 1HZAA 4K6DA 4DFAA 3J81L 3D8GA 2G9HD 3OYYA 5BN5A 4C3IH 2B29A 4QCLA 2NTSA 3S2HB 1HNWL 2MUYA 1K8GA 1GUTA 1S5ED 2UXCQ 1HHVA 4JBWA 1PH3A 2JA5G 2N49A 2XWBB 1N32L 2MPMA 1C48A 3M4OH 4NB3A 4Z9CB 3RLNA 3FRPB 4GKKQ 2Q8TA 5IGEA 2K04A 3M4YA 1ESFA 3FPPA 2NVXB 1SBBB 4LK1C 5C0XI 5M3FH 3H3VI 3HFZB 2AHOB 3EVQA 2L12A 3S16H 1FYCA 3TMEA 4FO2A 2VQFQ 1TWCH 2RDGA 1JWSD 2RF4A 2E2DC 1IBLL 3T4AC 2RVLA 4OL7A 2Y0SG 3K59A 4HCSA 1K73C 3H3VC 3NEMA 3HKZG 3CF5A 1HNXL 1K9MC 2B2YA 3TRZA 1SNQA 5CBEE 1PXUA 3CPFA 1V1PB 4MTKA 4K0KL 3CRKC 4I7AA 1L0XB 1FJGQ 1IHZA 4BBRG 1STAA 5C6AA 3CPWA 2K50A 5IOCA 3CCSA 1G51A 3F2BA 3D4DA 5TSSA 2ICIA 3K80C 3GTPH 4RCNA 1OTCA 3B6YA 5ELFA 4A3BB 4X3TA 1EYAA 3VR2A 4IPHA 1JQYD 3U9SA 3SK4A 4LF7Q 3J7AV 5IGDA 2R3ZA 2AWOA 4OIJA 1TS5A 1STEA 3KLRA 3G71A 4X3SA 1C7YA 2WKDA 1BBXC 2OWOA 1N33Q 4J8QA 2MP1A 3P1HA 2HHHQ 2QF7A 4DV1Q 2Q2HA 3CXCA 3C1EA 4EQOA 3T56B 2NB0A 5C3WA 2B63B 3A7AB 1ZKOA 1YNJC 2NYZD 2NVYH 1MJEA 1BCPB 3GTJB 4UDUC 1AZQA 1BVSA 1G291 1B3QA 1B2TA 1VQCA 4FNFA 1B3AA 3VA7A 3DHQA 3R2IA 4R4TA 5FKAC 1EIHA 3TQYA 4A3LH 3NWTA 2XN9C 4S3SA 2CHBD 4X65Q 3S9WA 3SXHA 4GLVB 3TZDA 2JYOA 1PFBA 2F0OA 1MIUA 3GD7A 3I3CA 1M4VA 1SNMA 2HUGA 4DXFA 1DJRD 4C2MB 5HURA 4OO1G 2MQHA 1DONA 2M9VA 1XYIA 3TP6A 3K7UC 4A3IH 2VUMB 3G48A 1V1QA 3ULLA 4UP8A 1H9JA 1RTNA 1STBA 2IJ0A 4ZUJA 2JA6H 1Y14B 1STYA 1W6KA 3V96A 3E9IA 2NZ1D 4OX9L 4DUZQ 1LO5D 5D14A 2R93B 5IP9H 4PQXA 1C0AA 1CKNB 3VR5A 2CQAA 2N8NA 3URYA 3STBD 1GD7A 4K2KA 4JV5L 1GUNA 2R7DA 3CQZH 1TWHB 5LMNW 5CV7A 4G7ZC 5K5PA 3SK8A 3TP8A 4A3FH 1Z9FA 3M7GA 5IT9E 1I6HB 3FKIB 3GTQB 3K5MA 1CM9A 1MD2D 4J6HA 2NVTB 2GN5A 3J81j 1Q90A 1KRTA 3AEVA 1GUSA 3NQIA 5FLXc 1UUPA 4HMIA 3OMCA 4A3EB 5FO9B 5EKLA 1N34L 4GOPC 2QW7A 4NW2A 1B4OA 4APVA 2YTVA 1FNUA 1RDPD 4XYOA 5GADC 2F0DA 5C0XH 1LT4D 3H3VH 1LTSD 1SYBA 1SXTA 2HIXA 3Q24A 1OXUA 3S1RH 2XVSA 1T9HA 2G9DA 5JJLA 3QB3A 3IKJA 5JEAG 1SYDA 4DV5Q 3NTIA 1GHJA 1Z7TA 5BR8Q 1WTQA 3ER0A 3VR6A 1F9RA 5JEAJ 2K6AA 4ZK9B 3ERSX 5C3EG 3GTMH 2LS01 3F1ZA 3W3AA 3ICEA 2JXMB 1VQBA 3ZYYX 4DV0Q 4BA1I 3QWNA 4CDDC 4FYDA 4C3IB 4ZRZA 1SE4A 2PW7A 1S5FD 2NN6G 5I6YA 1BBUA 4GN5A 3OMGA 1EWHA 1PYBA 2EXDA 4UP7A 1WFQA 4ODGA 2NTTA 2ZT9C 4DGZA 5E4XA 3T13A 1YVCA 3QIAA 1Q86C 1SSOA 1D2BA 4XDXA 4DV7Q 1TT2A 2J4XA 4F88A 2K5VA 4NMZA 1WVLA 3N6RA 2UXBL 4ME5A 2R6GA 1VQIA 4F7XA 5DNFA 2R61A 4XQQA 4NXMQ 4X66L 1STGA 4OIKA 5LL6X 3EBEA 1IKMA 2QCPX 3S1QH 3K7AH 1CZWA 1HUNA 5M5WH 4ZCKA 3PO2G 2E5LQ 2A69D 1DYQA 4C1NI 3PF5A 2Z8LA 1NAPA 1K8MA 4AYBE 1AEXA 1WD0A 1JE5A 3FHWA 4ZKBB 4DV4Q 4GKJQ 4G4KA 2F4VL 1OXSC 1Q46A 4HJ8A 4HIOA 4LFAQ 4OGQC 4A3KH 5AFWA 1AN8A 2PQAB 1YIJA 3GTPB 1ILPA 3ULPA 4PV1C 1U0LA 3KUPA 4QUCA 2ASBA 2L5TA 1RJTA 4P72A 1WCMG 1SEBD 2RBMA 2RHQB 4DR7L 3WWVA 1UEBA 3E3XA 4KLKA 3SE0A 1EQTA 1PFNA 3UDXA 3K6OA 4H02A 2MHVA 1FNWA 2Z6KA 4POFA 3BVGA 4GKKL 2K14A 3I70A 1AZPA 1LM0A 4XT3B 4HR7B 2AWNA 1E1TA 2BE5C 4NP5A 1QILA 5EBDA 2ZJRA 5M3FG 1G6PA 2GA4B 2F0JA 2XRQD 1II3A 4FDBA 1OXVA 4BY7H 1UNSA 1EYCA 5JPMC 2VQFL 5COYA 5NUCA 3GTGH 3NBHA 5KNDA 1B50A 3DXJC 1I4XA 4A3IB 1U4LA 1ENAA 4CGYB 3HOXB 1HPCA 1YNND 4B3TQ 2HCIA 3H6MA 4KY6A 1FJGL 2WB1E 3IL8A 4RGNA 2JEAI 2HD3A 3KF6B 3FMCA 1C4QA 5I4DA 1ILQA 1HNWQ 5FJ8H 4RG1A 4LFBQ 1XNRQ 4KD4A 3K8AA 4LF6Q 2F0KA 1Y69U 1VQMA 2CWAA 1VF7A 4LF7L 3CQZB 1MI2A 2PZTA 2VZAA 5I6WA 4V190 1A62A 1TS2A 3WOEA 4A3FB 3GP7A 1YNXA 1KXLA 1B7YB 4OWXB 3S1NH 3NHHA 4DV1L 1WTRA 2HT1A 3HOYH 2EDGA 4LAAA 1E1OA 4R8NA 2R92G 1J5EL 2BA0A 4QB4A
chains in the Genus database with same CATH topology
4HSPA 1NUCA 2CW0C 3AMUA 2IT1A 5CR3A 3S1RB 1A3VA 2B2UA 3PMFA 5EBCA 4K5WA 1LTID 1L0YB 4RWSC 2RDFA 3GTMB 2M2LA 5FO8B 2EE1A 2JP1A 1PLFA 1A3UA 1EZ6A 4XT1B 5JVG3 2EYPA 4KKTA 3I73A 2B2TC 1LTRD 3ND8A 2ZXOA 4ZLTF 1KLGD 2RA4A 2SNSA 1E2WA 2IPKD 2DY8A 5IGFA 1SDFA 4DA2A 1F9PA 1I3QB 4C3HG 2B39A 1NSNS 1KNEA 2PCFB 4KY5A 2EYFA 4FXKC 5M5WB 4DNRB 5C0XG 4A3MB 4IALA 3MTSA 1OXXK 3Q22A 2RDHA 1W6JA 3S1MB 1PYWD 2VB2X 4RFBA 1EY8A 4HSVA 3D4RA 2QEJC 4PMBA 2JEBI 3WOFA 4RHSA 4IUQA 5JPNC 2LFNA 4A3DB 1B53A 2IX0A 3ONAB 2HQEA 5JAVA 1LACA 4N9PA 4Q0FA 1VMCA 3GTKB 3QOLA 1WD1A 2N88A 1X3PA 3CHBD 3S14B 1STHA 3HOUB 1WTPA 3K5NA 1SAPA 3GTGB 2XRSD 2HDLA 1V1OA 1XX8A 1KLUD 5CMDA 2JE6I 1SE3A 2KEDA 4C3JG 1CTMA 1SJHD 1DOLA 2H1EA 1SNDA 3VYUA 3BYTB 2B2WA 3NBIA 2K05A 1R4PB 4K14A 2KOLA 2X69A 2KJXA 1HA5A 3PUYA 4RCOA 3SEBA 1SYFA 3N52A 2KQ3A 3HOYB 3L7ZC 1CA6A 2Q8RE 4MIUA 3RLFA 3J81E 1T5XD 3HRZC 1CI3M 2Q8IB 5M5YB 4KHZA 2DNCA 2ID0A 1DZ1A 2EPBA 2KEEA 2X6LA 2WV6D 1TKWB 2BOSA 1H9SA 2L0CA 1O7ZA 5C44B 3PUVA 1IYVA 1H9KA 1IYUA 3D6CA 2L1BA 4Y7NB 1S5DD 2EYMA 4XIGS 4BBRB 3PIO3 5F2DA 2SOBA 3FDTA 2A68D 4RGTA 5DAUA 1F2ZA 3VR4A 3DWPA 2WINB 3DWQA 5ELBA 4BA2I 5C5MA 2LMCB 4P2CB 3HOWB 1QCBD 3TZUA 3S2DB 1JCKB 2KCNA 1U4PA 3HS0C 1WTXA 1DCZA 1DOMA 2I07B 2OEOA 3Q23A 3GTOB 4RAUC 5IODA 2F0IA 2FINB 1VCIA 1D6EC 1I4PA 1PZID 1ENCA 1PMRA 4CKCA 4O1NA 4EQNA 4AYBB 3VYSA 1UEAB 4K8IA 4A3GB 1HUMA 3NWSA 1T5EA 1TR5A 2D5DA 2K1BA 4DU9A 2F0TA 1EY7A 4PMCA 3ND9A 3VA5A 4YIJA 2IX3A 1CHPD 3DEOA 5M3MB 1TS4A 2PYKA 3J7YW 1GOZA 1SFOB 4KTAA 1I50B 3H94A 5I9OA 4DAYA 4B08A 1TY2A 2XNAC 1ZXTA 3TDQA 2KCCA 4XYQA 2FMCA 3S15B 3OIPA 2A6HD 4QF4A 3EFXD 1D1KA 1QNUA 5BN4A 2WB1B 4IFDI 1LTBD 3E5SA 4H44C 5K36G 3AU7A 3D4WA 3NP8A 4KK7A 3SK6A 1HFNA 4IN3A 3MWYW 3LWUA 3EROA 3MZ5A 4C56C 4RGOS 1JB3A 1DM0B 3KF8A 4FF2A 1M8AA 4R8IA 3R2TA 1K83B 2B8FA 3SK5A 2K28A 5I9PA 2F03A 3RUZA 4ULLA 5E1FA 4KV6A 4FVMA 4H7BA 4CJ2C 2F1MA 1EWCA 1MGSA 1TWGB 1ONLA 3FEWX 1LTTD 5D3DA 1PDQA 4QIWB 2C9OA 5IGBA 2O4XA 4KI0A 4CBVA 1U4MA 5EPJA 2QKIC 4TKOB 1BUVT 2FJ2A 3NXWA 5E4WC 1A6XA 2B2VA 2F0GA 5EKIA 4K2LA 4K8JA 2A6ED 2K7VA 1QNKA 3V2TA 1HA6A 4HTHA 4IUNA 1PRTF 5C4XB 4FXDA 1ET9A 3HEJA 5DEHA 1V1PA 2EY6A 3D6WA 1ML0D 2PPBC 2A6HC 4CHTB 4LJZC 5ISRA 5FLXE 1G8ZD 1EU4A 2VXWA 1BCPF 3EJIA 1BF4A 2XSCA 3GV3A 4A3JB 5EKKA 2OT2A 1Q3LA 1ZYRD 1PRTD 1B1ZA 2Z4HA 1TVXA 4C3IG 1RD9D 3SVMA 4PMWA 4IFDH 1PTOF 5FLXL 3QJYA 3K5OA 2E2HB 1KNAA 1SE2A 4DXGA 4QMGA 2FMMA 3PUZA 1O7YA 3OWFA 3OHXC 1RCVD 4R9WA 3T51B 1O80A 4K6LA 3E6ZX 3QOJA 4M8AA 5E3FA 4BY1B 1GUGA 2R92B 2XWJB 5J1ZA 1PTOD 1SMYD 2B2TA 3LX0A 2K01A 2A74C 2E2IB 5IGGA 1OXTA 4KN4C 1EEID 3D3RA 1R9TB 3BVMA 3P75A 4OO1I 3I90A 2K03A 3M85A 2A6EC 2WP8J 4BBSB 3DEPA 2WACA 4M1UB 3SDZA 1I6VC 4L6TB 3HP3A 5DM63 1JOOA 3PO3B 4F8MA 1CQFA 1HCZA 1LT6D 4KKUA 3H0GB 3HOVB 3I72A 3HG9A 3TBIB 2F0QA 4U673 2A69C 1D5ZC 2RSNA 5JOBA 1EZ8A 2AUJD 2DY7A 1D5XC 1EL0A 1V8QA 4DAPA 1X3QA 1ESRA 3GV6A 4WFN3 4E6IA 5I2XA 4TQUS 3HOZB 2EZVA 3GO5A 3L9AX 1JC7A 1EY5A 4KY7A 1EY0A 3M7NA 2JA7B 3H09A 2BA1A 3C46A 4WRDA 4WJWA 1MBYA 2VB3X 3C3LA 2JA8B 2D2CC 1JWMD 2EY2A 4NDXA 2L55A 2SEBD 2C5CA 4IZ8A 3GQBA 1U4RA 2L11A 4HMJA 1KDCA 1O78A 4XXEA 2WIIB 4L8JA 3C2PA 1BNZA 4FF4A 1SNPA 4QUFA 1GXDC 4O42A 2E75C 1D5MC 1PTOC 1IL8A 2D62A 2K5DA 1SYEA 1V43A 2E76C 3PUXA 5CV6A 1YNNC 1JOKA 2NVQB 5C0XJ 4IUVA 5IGCA 1GUOA 5M9OA 1B9MA 5KYLA 2PQEA 3FVQA 1EY4A 3S17B 3NK9A 3I91A 4KHVA 3H91A 2PNRC 1JR0D 4U68A 3MFYA 3UI2A 3Q6SA 2KUMA 4FXGC 2V4DA 2A5HA 1IW7D 4OO1H 3TN2A 1QOHA 4C3JB 3EQLC 1SYGA 3MEHA 4A93B 4DK0A 5CV8A 3GTLB 4XQNA 4CKBA 3M3YB 2EJMA 2PO4A 3BDCA 2B2UC 3C1FA 4I65A 3FPUB 1RTOA 2OF1A 2KHSA 1TS3A 3A56A 1HTPA 1RKNA 1BO0A 2Z4IA 4IURA 4DN4M 5DM73 3KK7A 2X6GA 2MJ8A 3TSSA 1F2LA 3F2UA 5A35A 3IAYA 2EJGC 4I7ZC 3MXPA 5KNBA 4XTCS 2EXZA 2EY5A 3K5LA 1CHQD 2NN6H 1PTOH 4IQZA 2L9HA 2JA5B 1Q1EA 2DN8A 2O2LD 1EY9A 5A2QL 1S4ZA 2MGSA 2RKSA 1G2SA 3X3MA 4H0LC 4K5XA 2F0PA 3OWEB 4TSSA 4RKLA 3MXNA 1LT3D 4KD3A 2B8GA 2Y0SB 1VDZA 3HKZB 4KN7C 2LY7A 1YNJD 4ZKCB 1Z6HA 4RA8A 5J39A 5CYUA 3KBGA 1F77A 1LLRD 5C4ZA 1XXGA 5LHY1 2ICEC 4G7OC 2SNMA 3RD4A 2BDOA 3A8IE 2EY1A 5EPKA 2H4OA 2F0LA 1TY0A 4DF7A 2BCOA 1EQVA 4ILWA 2TMPA 3NTKA 5T1IA 5JJZA 1B9NA 4J1MA 3EA6A 2AUKA 1Y8OB 2AQ2B 1TIID 3A54A 3K58A 2B2WC 1HQRD 4DK1A 3K0YA 1I4RA 3NQTA 1XWEA 2F3VA 5D65A 4HCEA 3I4MB 3A7LA 5T1GA 4C1NK 3OPOA 1KDBA 4KMUC 1H9RA 1JICA 3KBXA 1O7LA 1PFMA 1CZGA 5EQ0A 1F2MA 3IFTA 3MVVA 3A8KE 2IX1A 3NTHA 3WDNA 3ERQA 3P7JA 3MXUA 1TWFB 1PRTB 1E2VA 2N55A 2XIWA 1FD7D 2KA7A 5EGTA 3ITPA 2ZXRA 4B9WA 2O5IC 4DAVA 3TP5A 2A68C 3U9OA 3RMHA 1DD2A 5C3EB 2KECA 5M5XB 1A3TA 1BQQT 4RGMA 3Q0AA 4KKSA 1EY6A 1I4QA 1VF5C 3QG1A 2JSOA 2F0HA 1PTOB 1XTCD 1HRJA 2O5JC 2D9UA 1FGBD 1I4HA 1QJOA 3MAQA 3MC0B 4IUPA 2BDNA 4ZQ3A 1H9MA 1ZEQX 4UAIA 2CVRA 2B2YC 1LV9A 1C8CA 4IUUA 2F0WA 1D1IA 2F0SA 2IWHA 3SHLA 3PUWA 1MSHA 5ELEA 4HEDA 4ZUIA 1JE4A 3RZDB 1E2ZA 2EVBA 4XQJA 1SNOA 5J22A 5FOBB 3T16A 2EJFC 4L63B 1JOQA 1Y8PB 3PO2B 2BE5D 2PW5A 2YYZA 1JORA 1NCVA 4KJOA 2F0EA 1QB5D 5CV5A 1WTWA 1KTKA 4TRDA 5IT9L 1SYCA 4HAEA 1AFPA 3AB9A 5KGUA 1WCMB 1Z47A 5C4HA 4MHEA 1RF2D 3BYYB 4H13C 3M4OB 5CV4A 4RH6A 1Q8IA 1LT5D 2J0TD 3OSOA 3DM1A 5M3FB 2VNUD 3P20A 1CT1D 5ELCA 1Q12A 2FHTA 3J7AF 3S16B 4CKEA 1LTAD 3I4LA 4Q5VA 2ENBA 1TWCB 2TSSA 1EYDA 1BR9A 1PZJD 1FR3A 2EYLA 1R4QB 1J8IA 1KABA 1S5CD 2CW0D 3MFGA 5FO7B 4EVOA 1F9SA 1MSGA 5CV9A 2F0NA 1BCPD 4N9TA 4OHJA 2F0UA 1J9OA 5ELDA 1OO9B 5KRUA 1K8OA 1QWYA 3NUCA 5KNCA 2F4IA 2LKVA 5EPLA 2NBFA 4HN7A 1DXMA 5C4JB 5CC4A 3MXGA 4CJ0B 2NWGA 5IIFA 2QDBA 2NVYB 1CK1A 2B2VC 3HZXA 3BVZA 3I4NB 2AQ1B 3I8ZA 5CORA 1BOSA 4FF1A 1TWAB 2NUCA 4V0BA 1F2YA 3R3OA 1G91A 3E0JA 3KLSX 3DWAA 1B44D 2K5QA 2JA6B 1EIGA 4FF3A 2IL8A 1Y1VB 1SNCA 1NR4A 1TU2B 5EJWA 4X3UA 4JK1C 1WTVA 5D3IB 2WKCA 1HQMC 1UAPA 1VMPA 3BZDB 2FFKB 1HTLD 1CA5A 3HGBA 1RHPA 4C3HB 1AW7A 3BG3A 1ZYRC 3NPPA 1PRTC 4F87A 3DMUA 4PNYA 4BWGB 1EFID 4CJ1B 1Y1WB 1TQOA 1G2TA 4IUTA 4G57A 5JVH3 2F0FA 3MHBA 1Q1BA 3QO2A 1BCPC 1EEFD 2K5WA 2EYJA 2NN6I 1GUWA 2DNEA 1GJXA 3CKIB 1ET6A 2K33A 2EYOA 1QE6A 3A8JE 1KDAA 3OOCA 3PIP3 1WTOA 3MA2B 1H9SB 1A15A 3BDLA 5CGKA 1X32A 1SMYC 2K32A 3VYTA 1FNVA 1G6ZA 3V05A 1HXYD 2PZWA 2EOTA 2RQXA 3NSWA 2OXPA 1BDOA 4G7HC 1PZKD 3G7LA 4KJNA 3S1QB 1JWUD 3K7AB 3OIQA 2A73B 1A2UA 4B9XA 3BDOA 5C3XA 4FP5D 3SR1A 4DNTB 1S5BD 4K5VA 2E74C 3IFDA 4NKLA 1KAAA 3X3NA 4A3KB 1IKLA 5HGTA 1BXTA 3K57A 1ICWA 5K36H 2EYHA 4X3KA 3A55A 2F0VA 1STNA 3J80E 1Y8NB 3G6JB 1RODA 2SDFA 4ABNA 3O13A 1QG7A 5BN3A 4RHRA 4EGVA 3JAME 2RSOA 1EU3A 1E0BA 3LWEA 4BY7B 2L4NA 2F3WA 4BS9A 1GHKA 3J80L 5I2YA 5JEAH 1I4GA 5A2QE 1A2TA 2F0MA 4ID6A 5CBAE 2E2JB 5G3LF 4IFDG 5KIXA 4IFDJ 3JAML 3BS1A 4RKBA 1LABA 4MN3A 3R8BA 3TP7A 5KEEA 1ENFA 2J7ZA 3PV0A 5LL6S 4WORA 2Z1CA 3T53B 2I46A 3D31A 2ZXPA 2QILA 2HCCA 3RZOB 4LMQD 1LTGD 2PMZB 1HFGA 3CRLC 3S1NB 2R7ZB 3VR3A 1SJED 3VYRA 5C5LA 3W2DA 5KYIA 2IW3A 2HDMA 5G3LD 5FK9C 2WAQB 1CFMA 3DUZA 4GZYC 1DOKA 1NR2A 3KLSA 2PZUA 2M00A 1IW7C 3LNNA 3L3OC 3CU7A 1F9QA 2YU9B 4EQPA 4ZAIA 1EOTA 1U9RA 1AP0A 1CQVA 3R93A 3OW7A 4ZYSA 3NE5B 2AQ3B 2KVMA 4K6DA 4DFAA 3J81L 3D8GA 2G9HD 5BN5A 4QCLA 2NTSA 3S2HB 2MUYA 1GUTA 1S5ED 1HHVA 4JBWA 2XWBB 2MPMA 1C48A 4Z9CB 3FRPB 2Q8TA 5IGEA 2K04A 3M4YA 1ESFA 3FPPA 2NVXB 1SBBB 4LK1C 5C0XI 3EVQA 2L12A 1FYCA 3TMEA 4FO2A 2RDGA 1JWSD 2E2DC 3T4AC 2RVLA 4OL7A 3K59A 4HCSA 3H3VC 2B2YA 1SNQA 5CBEE 1PXUA 1V1PB 3CRKC 1L0XB 1IHZA 1STAA 5C6AA 5IOCA 3D4DA 5TSSA 2ICIA 4RCNA 5ELFA 4A3BB 4X3TA 1EYAA 3VR2A 1JQYD 3U9SA 3SK4A 3J7AV 5IGDA 2R3ZA 2AWOA 4OIJA 1TS5A 1STEA 3KLRA 4X3SA 2WKDA 1BBXC 4J8QA 2MP1A 3P1HA 2QF7A 3C1EA 4EQOA 3T56B 2NB0A 5C3WA 2B63B 3A7AB 1ZKOA 1YNJC 2NYZD 3GTJB 1BCPB 4UDUC 1AZQA 1G291 1B2TA 4FNFA 1B3AA 3VA7A 3DHQA 3R2IA 5FKAC 1EIHA 3NWTA 2XN9C 4S3SA 2CHBD 3S9WA 3SXHA 3TZDA 2JYOA 1PFBA 2F0OA 3I3CA 3GD7A 1M4VA 1SNMA 2HUGA 4DXFA 1DJRD 4C2MB 5HURA 4OO1G 1DONA 2M9VA 1XYIA 3TP6A 2VUMB 1H9JA 1RTNA 1STBA 2IJ0A 4ZUJA 1STYA 1W6KA 3V96A 2NZ1D 1LO5D 5D14A 2R93B 4PQXA 3VR5A 2CQAA 3URYA 4K2KA 1GUNA 1TWHB 5CV7A 4G7ZC 5K5PA 3SK8A 3TP8A 3M7GA 5IT9E 1I6HB 3FKIB 3GTQB 3K5MA 1CM9A 1MD2D 4J6HA 2NVTB 1Q90A 1GUSA 3NQIA 1UUPA 4HMIA 3OMCA 4A3EB 5FO9B 5EKLA 4NW2A 1B4OA 1FNUA 1RDPD 4XYOA 5C0XH 2F0DA 1LT4D 1LTSD 1SYBA 1SXTA 3Q24A 1OXUA 2XVSA 2G9DA 3QB3A 3IKJA 5JEAG 1SYDA 1GHJA 1Z7TA 3NTIA 1WTQA 3VR6A 1F9RA 5JEAJ 2K6AA 4ZK9B 2LS01 3W3AA 2JXMB 3ZYYX 4BA1I 3QWNA 4FYDA 4C3IB 4ZRZA 1SE4A 2PW7A 1S5FD 2NN6G 5I6YA 3OMGA 1EWHA 4ODGA 2NTTA 2ZT9C 4DGZA 5E4XA 3T13A 3QIAA 1SSOA 1D2BA 4XDXA 1TT2A 2J4XA 4F88A 4NMZA 1WVLA 3N6RA 4ME5A 2R6GA 4F7XA 5DNFA 2R61A 4XQQA 1STGA 4OIKA 5LL6X 1IKMA 2QCPX 1CZWA 1HUNA 2A69D 1DYQA 4C1NI 2Z8LA 1NAPA 1K8MA 1AEXA 1WD0A 4ZKBB 4G4KA 1OXSC 4OGQC 5AFWA 1AN8A 3GTPB 1ILPA 4PV1C 3KUPA 4QUCA 2L5TA 1RJTA 1SEBD 2RBMA 3SE0A 1EQTA 1PFNA 3K6OA 2MHVA 1FNWA 3BVGA 3I70A 1AZPA 4XT3B 4HR7B 2AWNA 2BE5C 4NP5A 1QILA 5EBDA 2GA4B 2F0JA 2XRQD 1II3A 1OXVA 1UNSA 1EYCA 5JPMC 5COYA 5NUCA 3NBHA 5KNDA 1B50A 3DXJC 1I4XA 4A3IB 1U4LA 1ENAA 4CGYB 3HOXB 1HPCA 1YNND 2HCIA 3H6MA 4KY6A 3IL8A 4RGNA 2JEAI 3FMCA 1C4QA 5I4DA 1ILQA 4KD4A 2F0KA 1Y69U 1VF7A 3CQZB 1MI2A 2PZTA 5I6WA 4V190 1TS2A 3WOEA 4A3FB 3GP7A 3NHHA 1WTRA 2EDGA 4LAAA 4R8NA 2BA0A 4QB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGC A;  2LKV A;  5M9O A;  2WAC A;  1JOQ A;  1AEX A;  1NUC A;  1A2T A;  4HTH A;  2F0M A;  5KYL A;  2PQE A;  4ID6 A;  1EY4 A;  5CR3 A;  1F2M A;  1EY9 A;  3EVQ A;  1A3V A;  3NK9 A;  1JOO A;  5CC4 A;  2PW5 A;  3BDL A;  3D6C A;  3PMF A;  4IUN A;  5CGK A;  3MVV A;  4K5W A;  4KHV A;  1JOR A;  4F8M A;  3TME A;  5IIF A;  2HQE A;  4K2K A;  2EYM A;  2QDB A;  2RDF A;  2RKS A;  5JAV A;  3HEJ A;  4N9P A;  4KJO A;  5KIX A;  5CV7 A;  5DEH A;  5F2D A;  2F0E A;  2SOB A;  4K5X A;  3ERQ A;  4QF4 A;  2EY6 A;  5DAU A;  5CV5 A;  3QOL A;  3HZX A;  1F2Z A;  2F0P A;  4OL7 A;  4J6H A;  4RKB A;  4TRD A;  4RKL A;  5ISR A;  3TP7 A;  5KEE A;  3E5S A;  2F0Q A;  2PZW A;  3SK8 A;  3TP8 A;  1SYC A;  1STH A;  2RBM A;  3OMC A;  4HMI A;  4WOR A;  1SNQ A;  5C5M A;  2NUC A;  1A3U A;  1SYG A;  4KD3 A;  5JOB A;  3MEH A;  3D4W A;  3NP8 A;  3EJI A;  5EKL A;  3T16 A;  2OXP A;  1EZ8 A;  1EZ6 A;  3SK6 A;  1F2Y A;  3R3O A;  1IHZ A;  5KGU A;  1STA A;  5CV8 A;  5C6A A;  2F0D A;  5IOC A;  4KJN A;  1SYB A;  5EKK A;  5C4H A;  2EYP A;  4E6I A;  3BDC A;  3C1F A;  3QB3 A;  4I65 A;  2OEO A;  3D4D A;  5EGT A;  4NP5 A;  3ERO A;  3ITP A;  1SYD A;  5CV4 A;  2OF1 A;  1A2U A;  2KHS A;  3MZ5 A;  5C5L A;  4B9X A;  5IOD A;  5KYI A;  5J39 A;  2F0J A;  2F0I A;  4B9W A;  5C3X A;  1II3 A;  3SR1 A;  2SNS A;  3OSO A;  5C4Z A;  3TP5 A;  4K5V A;  1EYA A;  4NKL A;  5IGF A;  1ENC A;  1EYC A;  3SK4 A;  3U9O A;  1EY5 A;  2SNM A;  1SNC A;  4KY7 A;  5IGD A;  1EY0 A;  1RKN A;  2PZU A;  1SND A;  2M00 A;  3SK5 A;  4EQN A;  5I9P A;  3RUZ A;  1KAA A;  5NUC A;  4K14 A;  2EY1 A;  2PW7 A;  4WRD A;  5E1F A;  4KV6 A;  1A3T A;  5I6Y A;  3OMG A;  4K8I A;  5HGT A;  3P1H A;  2ENB A;  4H7B A;  4ODG A;  2EYH A;  2F0L A;  4QMG A;  4EQP A;  1EYD A;  1EY6 A;  1SYF A;  1NSN S;  3C1E A;  1U9R A;  1ENA A;  4DGZ A;  4EQO A;  3OWF A;  4DF7 A;  1EQV A;  4KY5 A;  3T13 A;  1TR5 A;  5C3W A;  2EY2 A;  2F0H A;  2EYF A;  4NDX A;  3H6M A;  2F0V A;  4KY6 A;  2KQ3 A;  4DU9 A;  2F0T A;  1STN A;  3DMU A;  1EY7 A;  2EYL A;  4IAL A;  4IZ8 A;  4PNY A;  1KAB A;  1TT2 A;  5K5P A;  4PMC A;  3QOJ A;  4MIU A;  3DHQ A;  1KDC A;  4HMJ A;  4J1M A;  1TQO A;  4ZQ3 A;  4K6D A;  4NMZ A;  4YIJ A;  3VA5 A;  4DFA A;  5E3F A;  4S3S A;  1SNP A;  4G57 A;  2F0F A;  3MHB A;  3MXP A;  5IGB A;  2O4X A;  3D8G A;  4ME5 A;  3SXH A;  4EVO A;  3S9W A;  4KD4 A;  5CV9 A;  5J1Z A;  2F0O A;  3LX0 A;  4F7X A;  2F0N A;  2F0K A;  1SNM A;  5HUR A;  2F0W A;  4N9T A;  5IGG A;  2PYK A;  1STG A;  2F0S A;  2PZT A;  3NQT A;  3NXW A;  1EY8 A;  3SHL A;  5I6W A;  2F0U A;  3TP6 A;  2EYJ A;  1SYE A;  2EXZ A;  2F0G A;  2F3V A;  4ZUI A;  2EY5 A;  3P75 A;  4KTA A;  4K2L A;  5CV6 A;  1STB A;  1JOK A;  3NHH A;  4K8J A;  4ZUJ A;  5I9O A;  2F3W A;  5IGE A;  1STY A;  1SNO A;  2EYO A;  1KDB A;  4LAA A;  3NUC A;  4R8N A;  3V2T A;  5KRU A;  5J22 A;  4PMB A;  1KDA A;  4QB4 A; 
#chains in the Genus database with same CATH topology
 1P16 A;  4HSP A;  1NUC A;  2CW0 C;  3AMU A;  4JI0 Q;  2IT1 A;  5CR3 A;  3S1R B;  1IBL Q;  3UDI A;  1A3V A;  2I5L X;  5IYC G;  2B2U A;  3PMF A;  5EBC A;  4K5W A;  4N8X 1;  5GRO A;  1LTI D;  5M5Y H;  3I4N G;  1L0Y B;  1HR0 W;  4RWS C;  2RDF A;  4JG2 A;  1HNX Q;  4X65 L;  1PHJ A;  3GTM B;  1XPU A;  1HZC A;  4K0K Q;  2M2L A;  1QVG A;  4JCV E;  5FO8 B;  2EE1 A;  1E24 A;  2JP1 A;  1PLF A;  4IPD A;  4QIW E;  1A3U A;  1NNX A;  5FLM G;  1EZ6 A;  2I5H A;  4XT1 B;  3PF4 A;  2JA6 G;  5JVG 3;  3MXN B;  2EYP A;  4KKT A;  3HOV G;  3I73 A;  4CDC C;  2B2T C;  1LTR D;  1Y1V G;  2JN4 A;  3ND8 A;  2ZXO A;  4ZLT F;  4JBK A;  1KLG D;  1EYG A;  2RA4 A;  2SNS A;  2VQE L;  1E2W A;  2IPK D;  2DY8 A;  1YEZ A;  5IGF A;  2Q2I A;  1SDF A;  3J80 i;  4DA2 A;  2WFW A;  1F9P A;  1I3Q B;  1XPR A;  4C3H G;  3CMA A;  4L5S A;  1QVC A;  3U58 A;  3S2D H;  1JJG A;  1EQQ A;  4P75 A;  2B39 A;  1NSN S;  1KNE A;  1IZ6 A;  4EX5 A;  2PCF B;  4KY5 A;  3JAM i;  1Y1W G;  3GTO H;  2EYF A;  4FXK C;  3OTO Q;  5M5W B;  4R4Q A;  1VQ6 A;  5IYD H;  4DNR B;  5C0X G;  4A3M B;  4IAL A;  3U50 C;  3MTS A;  4IPG A;  3PSI A;  1OXX K;  4JC0 A;  3Q22 A;  3KDF A;  2RDH A;  4DV5 L;  5BR8 L;  2MO0 A;  1NE3 A;  1W6J A;  4YY3 L;  3S1M B;  1PYW D;  4A75 A;  2VB2 X;  4RFB A;  3U4V A;  1EY8 A;  4DV0 L;  4HSV A;  3TS2 A;  2E8G A;  3RNU A;  3E9H A;  4OX9 Q;  3D4R A;  2QEJ C;  3EN2 A;  5J3B A;  4PMB A;  2JEB I;  3WOF A;  2ZM6 Q;  4RHS A;  1PH5 A;  4IUQ A;  5JPN C;  3CC7 A;  2LFN A;  4A3D B;  5EAY A;  1EWI A;  1B53 A;  4J15 A;  1UE5 A;  2IX0 A;  4JI2 L;  4DV7 L;  1W2B A;  4IO9 A;  4GOP B;  3ONA B;  3CC2 A;  2HQE A;  5JAV A;  5M3M H;  1IBM Q;  1LAC A;  4N9P A;  4Q0F A;  1VMC A;  3GTK B;  3QOL A;  1WD1 A;  3PCO B;  2N88 A;  3W5O A;  1X56 A;  1X3P A;  4NXM L;  3CHB D;  3A5Z B;  3S14 B;  2CFM A;  1STH A;  1XMQ L;  3HOU B;  1WTP A;  3K5N A;  1SAP A;  3GTG B;  4GLX A;  3J81 i;  2N3S A;  2XRS D;  1KC8 C;  2HDL A;  1V1O A;  1XX8 A;  1VQA A;  1A0I A;  1KLU D;  2D0P A;  4KHP Q;  4BXX H;  4C2M H;  5CMD A;  3S15 H;  3KJP A;  2Z6B A;  2JE6 I;  1SE3 A;  2KED A;  1VQH A;  4C3J G;  1CTM A;  1SJH D;  3M9B A;  1DOL A;  4YWM A;  1QZG A;  2H1E A;  3BZK A;  4DR6 L;  1SND A;  3VYU A;  3BYT B;  2B2W A;  3NBI A;  2K05 A;  1R4P B;  4K14 A;  1H95 A;  2KOL A;  3M4P A;  2X69 A;  2KJX A;  1HA5 A;  3PUY A;  4L5Q A;  1WTH A;  2MFI A;  4RCO A;  3SEB A;  1SYF A;  1IBK L;  3N52 A;  4DUY L;  3ULJ A;  2I0Q A;  4DV2 L;  2KQ3 A;  3HOY B;  3JC6 6;  3L7Z C;  1CA6 A;  2Q8R E;  4LF4 Q;  1I6H H;  3FKI H;  4MIU A;  3RLF A;  2NVT H;  3J81 E;  1V9P A;  3W1G A;  5JJK A;  4X66 Q;  4ME3 A;  1K83 H;  1T5X D;  4QL5 A;  1N9W A;  3HRZ C;  1CI3 M;  2Q8I B;  1L1O A;  4OXP A;  3CW2 C;  5M5Y B;  4BY7 G;  4KHZ A;  2G5D A;  2DNC A;  4PG3 A;  2OTJ A;  1P8L A;  2ID0 A;  2CH4 A;  1DZ1 A;  1AE2 A;  2EPB A;  2KEE A;  2X6L A;  3A5U A;  2WV6 D;  1TKW B;  2BOS A;  1H9S A;  2L0C A;  4P71 A;  2P5Z X;  1XMO Q;  1O7Z A;  5C44 B;  2PNH A;  3PUV A;  4B3T L;  1IYV A;  1H9K A;  5IYB H;  1FL0 A;  1KIX A;  1IYU A;  2OQ0 A;  3D6C A;  3PGZ A;  4IPC A;  4JI1 L;  1VQF A;  1PYS B;  3RN2 A;  2L1B A;  4Y7N B;  1S5D D;  2EYM A;  4XIG S;  4YWK A;  4BBR B;  3PIO 3;  4DR7 Q;  5F2D A;  2SOB A;  3FDT A;  2A68 D;  4RGT A;  5DAU A;  1XNR L;  4LFB L;  1F2Z A;  3VR4 A;  3DWP A;  2WIN B;  3DWQ A;  2Q2T A;  4LF6 L;  1QUQ A;  5ELB A;  5LMU Q;  2OQK A;  4BA2 I;  5C5M A;  2LMC B;  4P2C B;  3HOW B;  1QCB D;  3TZU A;  3S2D B;  2R7Z G;  1JCK B;  1SRU A;  4JOI A;  1Q81 C;  2KCN A;  3T1H L;  1U4P A;  3HS0 C;  1WTX A;  2WAQ G;  1DCZ A;  3CCR A;  1DOM A;  2I07 B;  2OEO A;  3Q23 A;  3GTO B;  2CKZ B;  4RAU C;  5C4X H;  5IOD A;  4JI0 L;  3L0O A;  1U5K A;  2F0I A;  2FIN B;  1S40 A;  1VCI A;  1D6E C;  1I4P A;  1PZI D;  1ENC A;  4EQ5 A;  1PMR A;  4CKC A;  4O1N A;  3D0F A;  4EQN A;  4A76 A;  2ZJQ A;  4AYB B;  4YWL A;  3VYS A;  1UEA B;  4K8I A;  4A3G B;  1HUM A;  3PIP A;  4A3J H;  2NZH A;  3NWS A;  1T5E A;  2UXD Q;  1TR5 A;  2D5D A;  2K1B A;  4DU9 A;  2F0T A;  1EY7 A;  4A3C H;  2MNA A;  4PMC A;  3ND9 A;  3VA5 A;  4DNI A;  4YIJ A;  2IX3 A;  3TS0 A;  4DR4 Q;  1VQN A;  1CHP D;  1DGS A;  3DEO A;  1WOC A;  1YJ9 A;  5M3M B;  1TS4 A;  2PYK A;  2A1A A;  2K52 A;  1J5E Q;  3J7Y W;  1PH8 A;  4QJF A;  1GOZ A;  4HJ9 A;  5IY0 A;  4KTA A;  1SFO B;  1I50 B;  3H94 A;  5I9O A;  4JYA Q;  4DAY A;  1W3S A;  4B08 A;  4LF8 Q;  1C9O A;  3CCJ A;  1TY2 A;  3OTO L;  2XNA C;  1AE3 A;  4BY1 H;  1ZXT A;  3TDQ A;  4YCU A;  2KCC A;  4DV6 L;  3CAM A;  3I4M G;  4XYQ A;  2FMC A;  4X62 L;  3S15 B;  3OIP A;  3CP0 A;  3MEF A;  2A6H D;  4QF4 A;  3EFX D;  1D1K A;  1QNU A;  3HOX H;  5BN4 A;  3KYH C;  2WB1 B;  4IFD I;  1VQ8 A;  1LTB D;  3E5S A;  4H44 C;  5K36 G;  3W1B A;  3AU7 A;  3NP8 A;  2DGY A;  3D4W A;  4BBS H;  2RHS B;  1O7I A;  4KK7 A;  4MTN A;  3SK6 A;  1HFN A;  4IN3 A;  3MWY W;  5L37 A;  3LWU A;  2VQE Q;  3U4Z A;  4A3B G;  2ZM6 L;  3ERO A;  1JMC A;  3MZ5 A;  4JW0 A;  3CME A;  4C56 C;  3F2C A;  2GVA A;  4RGO S;  2F52 A;  1JB3 A;  1DM0 B;  3KF8 A;  4FF2 A;  3AQQ A;  1M8A A;  4R8I A;  3R2T A;  1K83 B;  1IBM L;  2B8F A;  3SK5 A;  2K28 A;  5I9P A;  2F03 A;  3RUZ A;  4ULL A;  1VQK A;  5E1F A;  2B63 G;  4KV6 A;  4FVM A;  4H7B A;  4CJ2 C;  2JJQ A;  2F1M A;  1SRO A;  2QGQ A;  1EWC A;  1MJC A;  1MGS A;  1TWG B;  1ONL A;  2UU9 Q;  4B3M Q;  3FEW X;  2R7F A;  1LTT D;  4L5T A;  4YY3 Q;  2BH8 A;  2AKW B;  4KHP L;  4DR2 L;  5D3D A;  1PDQ A;  4QIW B;  2C9O A;  2Y0S E;  3CCL A;  5IGB A;  1KL9 A;  2O4X A;  4KI0 A;  4CBV A;  2VUM G;  3HKZ E;  2Q2U A;  1U4M A;  2JA7 H;  5EPJ A;  1E22 A;  2QKI C;  4TKO B;  1BUV T;  2FJ2 A;  3NXW A;  5E4W C;  1A6X A;  2B2V A;  1PH2 A;  2OCE A;  2JA8 H;  1YBY A;  2F0G A;  5EKI A;  4TVA B;  2R93 G;  2MO1 A;  4K2L A;  4YHH L;  4K8J A;  2A6E D;  1L2F A;  2K7V A;  4JI2 Q;  4CDE C;  1QNK A;  3V2T A;  1VQL A;  2UUA Q;  1HA6 A;  4HTH A;  1Q7Y C;  5IP7 G;  4JBJ A;  4IUN A;  1I3Q H;  1PRT F;  4GS3 A;  4LF4 L;  1K0R A;  5C4X B;  4FXD A;  1ET9 A;  3HEJ A;  1XMQ Q;  5DEH A;  1V1P A;  2EY6 A;  3D6W A;  1ML0 D;  4A3E G;  2PPB C;  2A6H C;  4CHT B;  4LJZ C;  5ISR A;  5FLX E;  4QQB X;  1G8Z D;  1EU4 A;  4A3M H;  1EIY B;  2VXW A;  1BCP F;  3EJI A;  1BF4 A;  2KEN A;  1ASY A;  2Z0S A;  2XSC A;  3GV3 A;  4A3J B;  3S17 H;  5EKK A;  2OT2 A;  1XMO L;  1Q3L A;  1ZYR D;  3STB C;  3S1M H;  4DR6 Q;  1PRT D;  5IYB G;  1X3F A;  1B1Z A;  2Z4H A;  4YCW A;  1TVX A;  1HZ9 A;  4C3I G;  1RD9 D;  2YTY A;  4NPS A;  3SVM A;  4PMW A;  1PH1 A;  3IRB A;  4IFD H;  4JI4 Q;  1PTO F;  5FLX L;  1IBK Q;  4QGU A;  3QJY A;  4DUY Q;  3CCE A;  3K5O A;  4DV2 Q;  2E2H B;  4A93 H;  4A3D H;  1KNA A;  1PVO A;  1SE2 A;  5LMU L;  4DXG A;  4QMG A;  3GTL H;  2FMM A;  3PUZ A;  3M3Y H;  1O7Y A;  3OWF A;  3OHX C;  3I55 A;  1RCV D;  1UE1 A;  4R9W A;  3T51 B;  3GDE A;  1O80 A;  4K6L A;  3E6Z X;  3GTK H;  3QOJ A;  4M8A A;  4Y52 H;  4NXN L;  5E3F A;  3S14 H;  4BY1 B;  1JJC B;  1GUG A;  3HOU H;  2R92 B;  2XWJ B;  3HKS A;  5J1Z A;  1PTO D;  1SMY D;  2B2T A;  3LX0 A;  2K01 A;  5HGQ A;  2A74 C;  2E2I B;  5IGG A;  1OXT A;  4JI5 L;  3UDF A;  4KN4 C;  1EEI D;  3LGJ A;  4LUV A;  3D3R A;  1R9T B;  2DJG C;  3BVM A;  3P75 A;  4JI8 L;  4OO1 I;  3I90 A;  1CKN A;  2K03 A;  1EIF A;  3M85 A;  2ZTC A;  2A6E C;  3DM3 A;  1X9N A;  2WP8 J;  4BBS B;  4JI1 Q;  2UXD L;  3A0J A;  3DEP A;  2WAC A;  4M1U B;  3SDZ A;  3J7A 5;  1KRS A;  2OTL A;  1B70 B;  1I6V C;  4L6T B;  3HP3 A;  5DM6 3;  3DLL A;  4A3C G;  1JOO A;  3PO3 B;  1I94 L;  2QEX A;  4F8M A;  1CQF A;  1VQO A;  1HCZ A;  1LT6 D;  4DR4 L;  4KKU A;  3H0G B;  3TRE A;  3HOV B;  3I72 A;  3HG9 A;  3H15 A;  3TBI B;  2F0Q A;  3T1H Q;  4U67 3;  3J7Z C;  4POG A;  2A69 C;  1D5Z C;  2RSN A;  5JOB A;  3EIV A;  1EFW A;  2JA5 H;  1EZ8 A;  2AUJ D;  2DY7 A;  1CKO A;  1D5X C;  1A63 A;  1EL0 A;  1V8Q A;  4DAP A;  1X3Q A;  1M90 C;  4JYA L;  1ESR A;  3GV6 A;  4WFN 3;  4E6I A;  1SLJ A;  4LF8 L;  4YCV A;  4A3L G;  1FVI A;  5I2X A;  1K0S A;  1YHB A;  4TQU S;  1D8L A;  3HOZ B;  2EZV A;  3GO5 A;  3L9A X;  1JC7 A;  1EY5 A;  4KY7 A;  1EY0 A;  4GLA C;  4A3I G;  3M7N A;  2JA7 B;  4GNX B;  3H09 A;  3HOX G;  5C44 H;  2BA1 A;  3C46 A;  4WRD A;  4WJW A;  2K5H A;  1MBY A;  2VB3 X;  1N8R C;  4OWT B;  3C3L A;  1XNQ L;  2JA8 B;  2B3G A;  4GN4 B;  1K3B C;  2D2C C;  5IP9 G;  1JWM D;  5LMN L;  2EY2 A;  4NDX A;  2L55 A;  4Y7N H;  1HJP A;  2SEB D;  3F8T A;  2C5C A;  4BBR H;  4IZ8 A;  3GQB A;  3J80 c;  1U4R A;  2L11 A;  4HMJ A;  1KDC A;  1O78 A;  4XXE A;  2WII B;  4LNQ A;  1BKB A;  4L8J A;  4A4I A;  4CDF C;  1BNZ A;  3C2P A;  4FF4 A;  1SNP A;  4QUF A;  3RLO A;  4A3F G;  1KD1 C;  1GXD C;  4O42 A;  1NTG A;  3HOW H;  2E75 C;  1D5M C;  1PTO C;  1IL8 A;  4LW1 A;  2D62 A;  3JAM c;  2K5D A;  1SYE A;  4O0A A;  1V43 A;  1LUZ A;  2E76 C;  3PUX A;  5CV6 A;  1YNN C;  1JOK A;  1Q82 C;  1S3O A;  2NVQ B;  5C0X J;  4DV6 Q;  4X62 Q;  4IUV A;  5IGC A;  5IE8 A;  1GUO A;  5M9O A;  2UU9 L;  2PQA A;  4B3M L;  4HID A;  1B9M A;  5KYL A;  2PQE A;  3FVQ A;  1EY4 A;  1VQP A;  3S17 B;  4LWC A;  3M4Q A;  3I91 A;  3NK9 A;  4KHV A;  3H91 A;  2PNR C;  1VQD A;  4A3G H;  1I5F A;  2LXK A;  2KHJ A;  1UE7 A;  1EQR A;  1JR0 D;  4U68 A;  3MFY A;  3UI2 A;  5GAH C;  3Q6S A;  2KUM A;  4FXG C;  2V4D A;  2A5H A;  1IW7 D;  4OO1 H;  3TN2 A;  1X55 A;  1QOH A;  4C3J B;  3I2Z A;  3EQL C;  1SYG A;  3MEH A;  4DK3 C;  4A93 B;  2N78 A;  4HIM A;  4DK0 A;  5CV8 A;  3GTL B;  3CCM A;  4XQN A;  4CKB A;  3M3Y B;  2EJM A;  2PO4 A;  3BDC A;  2UUA L;  2B2U C;  3C1F A;  4I65 A;  3FPU B;  1RTO A;  2VL6 A;  2OF1 A;  2KHS A;  4JVZ A;  1HZB A;  2LXJ A;  1TS3 A;  3A56 A;  1HTP A;  1EUJ A;  4DK6 C;  1SFO H;  1I50 H;  1JB7 A;  1TWF H;  3J81 c;  1RKN A;  1BO0 A;  2Z4I A;  4IUR A;  4DN4 M;  4RMF A;  5DM7 3;  3KK7 A;  4X64 L;  3KF6 A;  2X6G A;  4DR2 Q;  2MJ8 A;  3TSS A;  1F2L A;  2EQS A;  3F2U A;  3BU2 A;  4O2D A;  2DJF C;  5A35 A;  4A3K G;  3IAY A;  4P73 A;  2EJG C;  5E7N A;  5HY6 A;  1RIP A;  4I7Z C;  3MXP A;  2CQO A;  1IXR A;  4P74 A;  5C3E H;  2YTX A;  2JQO A;  5KNB A;  1YI2 A;  4YHH Q;  4XTC S;  4AQY L;  4JI4 L;  1PH7 A;  2EXZ A;  2EY5 A;  3K5L A;  1CHQ D;  2NN6 H;  1Q8K A;  4A3D G;  2KCT A;  1PTO H;  4IQZ A;  2JK8 A;  2L9H A;  2JA5 B;  1Q1E A;  4JI6 L;  2DN8 A;  2O2L D;  2PI2 A;  1ASZ A;  1EY9 A;  1PV4 A;  5A2Q L;  2QA4 A;  1NY4 A;  4UHV A;  1S4Z A;  2MGS A;  2RKS A;  1X65 A;  1G2S A;  3CD6 A;  3X3M A;  3T1Y Q;  4H0L C;  4K5X A;  4L5R C;  2F0P A;  3OWE B;  4TSS A;  1TWG H;  4RKL A;  3RZD H;  4DR3 L;  3MXN A;  1LT3 D;  2VS1 A;  1X3E A;  4KD3 A;  2B8G A;  2Y0S B;  3KF8 B;  1PH4 A;  1VDZ A;  3HKZ B;  3PO2 H;  1GKH A;  4KN7 C;  2LY7 A;  1FGU A;  1TXY A;  1YNJ D;  2A19 A;  2H5X A;  4ZKC B;  5FJ8 G;  1Z6H A;  4RA8 A;  5J39 A;  5CYU A;  3KBG A;  2FXQ A;  1F77 A;  1LLR D;  5C4Z A;  3PQI A;  1XXG A;  5LHY 1;  2ICE C;  5ELN A;  4G7O C;  2SNM A;  3RD4 A;  3L2P A;  2BDO A;  3A8I E;  4B3R L;  2ZTE A;  2EY1 A;  4MZ9 A;  4PZ8 A;  4IOC A;  1VQ9 A;  5EPK A;  2H4O A;  2C35 B;  1WCM H;  2F0L A;  3HOY G;  3I4O A;  1HR0 L;  1TY0 A;  4DF7 A;  2BCO A;  1EQV A;  3A74 A;  4NXN Q;  4ILW A;  2DUD A;  3OW2 A;  2TMP A;  3NTK A;  5T1I A;  5JJZ A;  3CCQ A;  1NBW A;  2XGT A;  1B9N A;  4J1M A;  3EA6 A;  1PH6 A;  2AUK A;  1Y8O B;  2AQ2 B;  3NEL A;  1TII D;  2QDL A;  4JI5 Q;  3A54 A;  3K58 A;  2B2W C;  2NZO A;  1HQR D;  5GAG C;  4JI8 Q;  4DK1 A;  3K0Y A;  1YHQ A;  4ALP A;  1I4R A;  3NQT A;  1XWE A;  2F3V A;  5D65 A;  4HCE A;  5C44 G;  3VDY A;  1LTL A;  3ZJY C;  4JI7 L;  3I4M B;  3A7L A;  4DR5 L;  5T1G A;  4C1N K;  3OPO A;  1K3R A;  1KDB A;  4KMU C;  4DAM A;  1H9R A;  4GNX C;  1PH9 A;  4GOP A;  1I94 Q;  1JIC A;  3KBX A;  1O7L A;  2CWP A;  1PFM A;  4DKA C;  1CZG A;  5EQ0 A;  1F2M A;  3IFT A;  3MVV A;  3A8K E;  1L1O C;  2IX1 A;  2E2H H;  3NTH A;  3I56 A;  1XJV A;  3WDN A;  3ERQ A;  3P7J A;  3HOW G;  3MXU A;  5IT9 c;  3G6E A;  1TWF B;  1LYL A;  1PRT B;  1HNZ L;  4JI3 Q;  4JPB W;  5IYD G;  1XPO A;  1J6Q A;  4GN3 B;  1E2V A;  5C4J H;  2N55 A;  1MHW C;  2XIW A;  2UUC Q;  2R92 H;  1FD7 D;  2KA7 A;  5EGT A;  1GM5 A;  3ITP A;  1E3P A;  2GVB A;  2E2I H;  4LF5 L;  2ZXR A;  4B9W A;  2O5I C;  4AYB G;  5IYC H;  4DAV A;  1R9T H;  3TP5 A;  2A68 C;  1NMF A;  1K8A C;  3U9O A;  3RMH A;  3I4N H;  4A3G G;  3Q8D A;  1XNQ Q;  1DD2 A;  5H1S E;  4QY7 A;  5C3E B;  1TWA H;  2KEC A;  3KJO A;  2HIV A;  5LMN Q;  5M5X B;  1A3T A;  2EIF A;  1BQQ T;  3QR8 A;  4RGM A;  3Q0A A;  1EOV A;  4JOI C;  2Z9H A;  4KKS A;  1EY6 A;  1I4Q A;  1VF5 C;  3QG1 A;  3PO3 H;  2JSO A;  4R4C A;  2KHI A;  3NBH B;  2F0H A;  1PTO B;  5FLM H;  1XTC D;  1HRJ A;  2O5J C;  2D9U A;  1FGB D;  2RCN A;  1I4H A;  1QJO A;  1WJJ A;  3H0G H;  1SMX A;  3HOV H;  3MAQ A;  3MC0 B;  4IUP A;  2BDN A;  4ZQ3 A;  5M3M G;  1Y1V H;  1H9M A;  1ZEQ X;  4UAI A;  2CVR A;  2B2Y C;  1LV9 A;  2IHE A;  1C8C A;  4IUU A;  2PMZ E;  2F0W A;  3KLW A;  1D1I A;  2F0S A;  2IWH A;  3SHL A;  4PZ7 A;  3PUW A;  1MSH A;  5ELE A;  4DR1 Q;  3NEN A;  4HED A;  4ZUI A;  3AYH B;  1JE4 A;  1GO3 E;  4C3H H;  2WAQ E;  3RZD B;  2BH2 A;  3SGI A;  1E2Z A;  2EVB A;  4XQJ A;  1SNO A;  5J22 A;  3CCU A;  5FOB B;  3T16 A;  4BXX G;  3UE0 A;  3HOZ H;  2EJF C;  2IHF A;  4L63 B;  1AH9 A;  3CCV A;  4OEM B;  1JOQ A;  1Y1W H;  1Y8P B;  3PO2 B;  4LFC L;  2ATW A;  2BE5 D;  2PW5 A;  2YYZ A;  1JOR A;  2WB1 G;  2K75 A;  1XTD A;  1NCV A;  4KJO A;  1PFS A;  2F0E A;  1QB5 D;  2KBN A;  5CV5 A;  2RCF A;  1WTW A;  1KTK A;  4TRD A;  5IT9 L;  1SYC A;  4HAE A;  1AFP A;  3AB9 A;  3RR5 A;  5KGU A;  1WCM B;  1Z47 A;  1GVP A;  5C4H A;  4MHE A;  1RF2 D;  3BYY B;  3FKI G;  4H13 C;  4HIK A;  4HJA A;  4LUZ A;  5AJ3 L;  3M4O B;  1X3G A;  5CV4 A;  4RH6 A;  1Q8I A;  1LT5 D;  2J0T D;  3OSO A;  3DM1 A;  5M3F B;  2VNU D;  3P20 A;  2NVQ H;  1CT1 D;  5ELC A;  1Q12 A;  4X64 Q;  2FHT A;  3T1Y L;  3J7A F;  2VY3 A;  3S16 B;  4CKE A;  1LTA D;  3I4L A;  4Q5V A;  2ENB A;  1TWC B;  1YIT A;  2TSS A;  1EYD A;  1BR9 A;  1N36 L;  2UUB Q;  1PZJ D;  1FR3 A;  4B3S L;  1CSQ A;  4OWW B;  4LF9 L;  2EYL A;  3PIO A;  1R4Q B;  1J8I A;  1KAB A;  1S5C D;  4R4O A;  2CW0 D;  1SE8 A;  3MFG A;  4AQY Q;  1M1K C;  5FO7 B;  1KHI A;  4EVO A;  4DV3 Q;  4C3J H;  1VQ5 A;  1F9S A;  1MSG A;  5CV9 A;  2F0N A;  1E7Z A;  1BCP D;  3KDF B;  4N9T A;  1A8V A;  4OHJ A;  3UDG A;  2VW9 A;  4X6A H;  2F0U A;  1J9O A;  1X54 A;  4JI6 Q;  5ELD A;  1KAW A;  1OO9 B;  5KRU A;  2UXC L;  1QWY A;  3NUC A;  5KNC A;  1K8O A;  2F4I A;  2LKV A;  5EPL A;  2A8V A;  2NBF A;  5C4X G;  4HN7 A;  1DXM A;  4UPA A;  5C4J B;  3BJU A;  5CC4 A;  3MXG A;  1IL2 A;  4CJ0 B;  1ICF B;  2NWG A;  5IIF A;  4DR3 Q;  2QDB A;  2NVY B;  1CK1 A;  4N8F A;  1WI5 A;  4PZ6 A;  2B2V C;  3HZX A;  2KCM A;  3BVZ A;  3F2D A;  3I4N B;  2AQ1 B;  3I8Z A;  4A3J G;  5COR A;  1BOS A;  1L0W A;  4FF1 A;  1KQS A;  1TWA B;  2K5N A;  2NUC A;  4V0B A;  1K28 A;  1F2Y A;  3R3O A;  1G91 A;  5IWA Q;  3E0J A;  3KLS X;  3CC4 A;  1CSP A;  2IY5 B;  2E2J H;  3DWA A;  1B44 D;  2K5Q A;  2JA6 B;  5ELO A;  1EIG A;  4FF3 A;  4B3R Q;  3KOJ A;  2IL8 A;  4WJ3 M;  1Y1V B;  1SNC A;  1NR4 A;  1TU2 B;  2XTI A;  1MKH A;  5EJW A;  4X3U A;  4JK1 C;  1WTV A;  1HR0 Q;  5D3I B;  2WKC A;  1N32 Q;  1HQM C;  1UAP A;  1VMP A;  3BZD B;  2FFK B;  4IJH A;  1HTL D;  3RZO H;  1SR3 A;  4JI3 L;  1CA5 A;  3HGB A;  1RHP A;  4C3H B;  1AW7 A;  1VQE A;  3BG3 A;  1ZYR C;  1UWV A;  4OON A;  2R7Z H;  1N33 L;  3NPP A;  2HHH L;  1PRT C;  4BY1 G;  3DMU A;  4F87 A;  1VQG A;  4PNY A;  2UUC L;  3RN5 A;  4BWG B;  1EFI D;  4CJ1 B;  1BBW A;  1TQO A;  1Y1W B;  1G2T A;  1CUK A;  4IUT A;  4G57 A;  5JVH 3;  2F0F A;  3MHB A;  1Q1B A;  4JI7 Q;  5GQO A;  4DR5 Q;  3QO2 A;  2Z6K C;  1BCP C;  1YHA A;  1EEF D;  2K5W A;  3UE1 A;  2YU9 H;  2EYJ A;  2NN6 I;  1GUW A;  2DNE A;  1L1O B;  4BBS G;  1GJX A;  1VQ4 A;  1S72 A;  3CKI B;  1ET6 A;  2K33 A;  2EYO A;  1QE6 A;  3PO3 G;  3A8J E;  1KDA A;  3BZC A;  2CH4 W;  1VS0 A;  2HQL A;  3OOC A;  1RL2 A;  3PIP 3;  1WTO A;  3MA2 B;  1H9S B;  4JBM A;  1A15 A;  3BDL A;  5CGK A;  3H0G G;  1X32 A;  4DUZ L;  1PA6 A;  1SMY C;  2K32 A;  3VYT A;  1HNZ Q;  1FNV A;  1IYJ B;  1X6O A;  3AFP A;  5JJI A;  3S2H H;  1G6Z A;  3V05 A;  2ZTD A;  1HXY D;  4LUO A;  2PZW A;  4DR1 L;  4UY8 C;  2EOT A;  2RQX A;  3NSW A;  2OXP A;  4LF5 Q;  2NVX H;  2L15 A;  1BDO A;  1QUQ B;  4G7H C;  1PZK D;  3G7L A;  4KJN A;  1VQJ A;  3K0X A;  3KFU A;  3HOZ G;  3S1Q B;  1JWU D;  3K7A B;  2D0O A;  3OIQ A;  2A73 B;  1A2U A;  4B9X A;  1YZ6 A;  3BDO A;  5C3X A;  4FP5 D;  3SR1 A;  2JA7 G;  4DNT B;  1S5B D;  4K5V A;  2E74 C;  3IFD A;  3I4M H;  4NKL A;  1NMG A;  1CKM A;  2JA9 A;  1QZH A;  2JA8 G;  1KAA A;  1UE6 A;  3X3N A;  4A3K B;  1IKL A;  5HGT A;  1BXT A;  1HH2 P;  3K57 A;  1ICW A;  5K36 H;  2EYH A;  1JT8 A;  4X3K A;  3A55 A;  1B8A A;  1QVF A;  1SN8 A;  2F0V A;  1STN A;  3J80 E;  1Y8N B;  3G6J B;  4DPG A;  4A3B H;  1ROD A;  2SDF A;  4ABN A;  4JV5 Q;  3O13 A;  4OEL B;  1YJN A;  1QG7 A;  4AH6 A;  5BN3 A;  4RHR A;  4EGV A;  3JAM E;  4A3M G;  2CCZ A;  2AMC B;  2I5M X;  2RSO A;  4HJ7 A;  1N34 Q;  1EU3 A;  1E0B A;  3LWE A;  3S24 A;  1NJI C;  4BY7 B;  2ZJP A;  2B63 H;  2L4N A;  2F3W A;  4BS9 A;  1GHK A;  3GTJ H;  4LFC Q;  2UUB L;  3J80 L;  3K81 C;  5I2Y A;  5JEA H;  1I4G A;  4IOA A;  5A2Q E;  1A2T A;  2F0M A;  4ID6 A;  5CBA E;  2E5L L;  4R4I A;  3TEH B;  5DLQ E;  3I7F A;  2E2J B;  4DAY B;  5M5X H;  2V1C C;  5G3L F;  4IFD G;  5KIX A;  4IFD J;  4DV3 L;  4DV4 L;  3JAM L;  4GKJ L;  3BS1 A;  2VUM H;  3FP9 A;  1LAB A;  4MN3 A;  4RKB A;  4R1J A;  3R8B A;  4IJL A;  4AIM A;  4LFA L;  4A93 G;  3TP7 A;  1D7Q A;  5KEE A;  5GAE C;  1ENF A;  2J7Z A;  3PV0 A;  5LL6 S;  4WOR A;  2Z1C A;  3T53 B;  2I46 A;  3D31 A;  2YV5 A;  3G4S A;  2ZXP A;  5AJ3 Q;  2R93 H;  2QIL A;  2HCC A;  3RZO B;  4WJ4 A;  4LMQ D;  2F3I A;  1WYD A;  1LTG D;  2K4K A;  2PMZ B;  3E0E A;  4MNO A;  1HFG A;  3CRL C;  3S1N B;  2R7Z B;  3VR3 A;  2UXB Q;  1SJE D;  3VYR A;  5C5L A;  3W2D A;  5KYI A;  2IW3 A;  1JJ2 A;  5IP7 H;  3HOU G;  1TWH H;  2HDM A;  4GNX A;  5G3L D;  5FK9 C;  2WAQ B;  1CFM A;  3DUZ A;  1VQ7 A;  3GTQ H;  4GZY C;  2ES2 A;  1DOK A;  1NR2 A;  3KLS A;  2PZU A;  2M00 A;  1IW7 C;  1N36 Q;  3LNN A;  4A3E H;  4B3S Q;  2ALY B;  3L3O C;  4LF9 Q;  3CU7 A;  1YJW A;  1F9Q A;  2YU9 B;  4UP9 A;  4EQP A;  2PI2 E;  1EOT A;  1U9R A;  4ZAI A;  1AP0 A;  1CQV A;  2LSS A;  4HJ5 A;  3R93 A;  5IWA L;  3OW7 A;  4ZYS A;  3NE5 B;  2F4V Q;  2AQ3 B;  3AFQ A;  2KVM A;  1HZA A;  4K6D A;  4DFA A;  3J81 L;  3D8G A;  2G9H D;  3OYY A;  5BN5 A;  4C3I H;  2B29 A;  4QCL A;  2NTS A;  3S2H B;  1HNW L;  2MUY A;  1K8G A;  1GUT A;  1S5E D;  2UXC Q;  1HHV A;  4JBW A;  1PH3 A;  2JA5 G;  2N49 A;  2XWB B;  1N32 L;  2MPM A;  1C48 A;  3M4O H;  4NB3 A;  4Z9C B;  3RLN A;  3FRP B;  4GKK Q;  2Q8T A;  5IGE A;  2K04 A;  3M4Y A;  1ESF A;  3FPP A;  2NVX B;  1SBB B;  4LK1 C;  5C0X I;  5M3F H;  3H3V I;  3HFZ B;  2AHO B;  3EVQ A;  2L12 A;  3S16 H;  1FYC A;  3TME A;  4FO2 A;  2VQF Q;  1TWC H;  2RDG A;  1JWS D;  2RF4 A;  2E2D C;  1IBL L;  3T4A C;  2RVL A;  4OL7 A;  2Y0S G;  3K59 A;  4HCS A;  1K73 C;  3H3V C;  3NEM A;  3HKZ G;  3CF5 A;  1HNX L;  1K9M C;  2B2Y A;  3TRZ A;  1SNQ A;  5CBE E;  1PXU A;  3CPF A;  1V1P B;  4MTK A;  4K0K L;  3CRK C;  4I7A A;  1L0X B;  1FJG Q;  1IHZ A;  4BBR G;  1STA A;  5C6A A;  3CPW A;  2K50 A;  5IOC A;  3CCS A;  1G51 A;  3F2B A;  3D4D A;  5TSS A;  2ICI A;  3K80 C;  3GTP H;  4RCN A;  1OTC A;  3B6Y A;  5ELF A;  4A3B B;  4X3T A;  1EYA A;  3VR2 A;  4IPH A;  1JQY D;  3U9S A;  3SK4 A;  4LF7 Q;  3J7A V;  5IGD A;  2R3Z A;  2AWO A;  4OIJ A;  1TS5 A;  1STE A;  3KLR A;  3G71 A;  4X3S A;  1C7Y A;  2WKD A;  1BBX C;  2OWO A;  1N33 Q;  4J8Q A;  2MP1 A;  3P1H A;  2HHH Q;  2QF7 A;  4DV1 Q;  2Q2H A;  3CXC A;  3C1E A;  4EQO A;  3T56 B;  2NB0 A;  5C3W A;  2B63 B;  3A7A B;  1ZKO A;  1YNJ C;  2NYZ D;  2NVY H;  1MJE A;  1BCP B;  3GTJ B;  4UDU C;  1AZQ A;  1BVS A;  1G29 1;  1B3Q A;  1B2T A;  1VQC A;  4FNF A;  1B3A A;  3VA7 A;  3DHQ A;  3R2I A;  4R4T A;  5FKA C;  1EIH A;  3TQY A;  4A3L H;  3NWT A;  2XN9 C;  4S3S A;  2CHB D;  4X65 Q;  3S9W A;  3SXH A;  4GLV B;  3TZD A;  2JYO A;  1PFB A;  2F0O A;  1MIU A;  3GD7 A;  3I3C A;  1M4V A;  1SNM A;  2HUG A;  4DXF A;  1DJR D;  4C2M B;  5HUR A;  4OO1 G;  2MQH A;  1DON A;  2M9V A;  1XYI A;  3TP6 A;  3K7U C;  4A3I H;  2VUM B;  3G48 A;  1V1Q A;  3ULL A;  4UP8 A;  1H9J A;  1RTN A;  1STB A;  2IJ0 A;  4ZUJ A;  2JA6 H;  1Y14 B;  1STY A;  1W6K A;  3V96 A;  3E9I A;  2NZ1 D;  4OX9 L;  4DUZ Q;  1LO5 D;  5D14 A;  2R93 B;  5IP9 H;  4PQX A;  1C0A A;  1CKN B;  3VR5 A;  2CQA A;  2N8N A;  3URY A;  3STB D;  1GD7 A;  4K2K A;  4JV5 L;  1GUN A;  2R7D A;  3CQZ H;  1TWH B;  5LMN W;  5CV7 A;  4G7Z C;  5K5P A;  3SK8 A;  3TP8 A;  4A3F H;  1Z9F A;  3M7G A;  5IT9 E;  1I6H B;  3FKI B;  3GTQ B;  3K5M A;  1CM9 A;  1MD2 D;  4J6H A;  2NVT B;  2GN5 A;  3J81 j;  1Q90 A;  1KRT A;  3AEV A;  1GUS A;  3NQI A;  5FLX c;  1UUP A;  4HMI A;  3OMC A;  4A3E B;  5FO9 B;  5EKL A;  1N34 L;  4GOP C;  2QW7 A;  4NW2 A;  1B4O A;  4APV A;  2YTV A;  1FNU A;  1RDP D;  4XYO A;  5GAD C;  2F0D A;  5C0X H;  1LT4 D;  3H3V H;  1LTS D;  1SYB A;  1SXT A;  2HIX A;  3Q24 A;  1OXU A;  3S1R H;  2XVS A;  1T9H A;  2G9D A;  5JJL A;  3QB3 A;  3IKJ A;  5JEA G;  1SYD A;  4DV5 Q;  3NTI A;  1GHJ A;  1Z7T A;  5BR8 Q;  1WTQ A;  3ER0 A;  3VR6 A;  1F9R A;  5JEA J;  2K6A A;  4ZK9 B;  3ERS X;  5C3E G;  3GTM H;  2LS0 1;  3F1Z A;  3W3A A;  3ICE A;  2JXM B;  1VQB A;  3ZYY X;  4DV0 Q;  4BA1 I;  3QWN A;  4CDD C;  4FYD A;  4C3I B;  4ZRZ A;  1SE4 A;  2PW7 A;  1S5F D;  2NN6 G;  5I6Y A;  1BBU A;  4GN5 A;  3OMG A;  1EWH A;  1PYB A;  2EXD A;  4UP7 A;  1WFQ A;  4ODG A;  2NTT A;  2ZT9 C;  4DGZ A;  5E4X A;  3T13 A;  1YVC A;  3QIA A;  1Q86 C;  1SSO A;  1D2B A;  4XDX A;  4DV7 Q;  1TT2 A;  2J4X A;  4F88 A;  2K5V A;  4NMZ A;  1WVL A;  3N6R A;  2UXB L;  4ME5 A;  2R6G A;  1VQI A;  4F7X A;  5DNF A;  2R61 A;  4XQQ A;  4NXM Q;  4X66 L;  1STG A;  4OIK A;  5LL6 X;  3EBE A;  1IKM A;  2QCP X;  3S1Q H;  3K7A H;  1CZW A;  1HUN A;  5M5W H;  4ZCK A;  3PO2 G;  2E5L Q;  2A69 D;  1DYQ A;  4C1N I;  3PF5 A;  2Z8L A;  1NAP A;  1K8M A;  4AYB E;  1AEX A;  1WD0 A;  1JE5 A;  3FHW A;  4ZKB B;  4DV4 Q;  4GKJ Q;  4G4K A;  2F4V L;  1OXS C;  1Q46 A;  4HJ8 A;  4HIO A;  4LFA Q;  4OGQ C;  4A3K H;  5AFW A;  1AN8 A;  2PQA B;  1YIJ A;  3GTP B;  1ILP A;  3ULP A;  4PV1 C;  1U0L A;  3KUP A;  4QUC A;  2ASB A;  2L5T A;  1RJT A;  4P72 A;  1WCM G;  1SEB D;  2RBM A;  2RHQ B;  4DR7 L;  3WWV A;  1UEB A;  3E3X A;  4KLK A;  3SE0 A;  1EQT A;  1PFN A;  3UDX A;  3K6O A;  4H02 A;  2MHV A;  1FNW A;  2Z6K A;  4POF A;  3BVG A;  4GKK L;  2K14 A;  3I70 A;  1AZP A;  1LM0 A;  4XT3 B;  4HR7 B;  2AWN A;  1E1T A;  2BE5 C;  4NP5 A;  1QIL A;  5EBD A;  2ZJR A;  5M3F G;  1G6P A;  2GA4 B;  2F0J A;  2XRQ D;  1II3 A;  4FDB A;  1OXV A;  4BY7 H;  1UNS A;  1EYC A;  5JPM C;  2VQF L;  5COY A;  5NUC A;  3GTG H;  3NBH A;  5KND A;  1B50 A;  3DXJ C;  1I4X A;  4A3I B;  1U4L A;  1ENA A;  4CGY B;  3HOX B;  1HPC A;  1YNN D;  4B3T Q;  2HCI A;  3H6M A;  4KY6 A;  1FJG L;  2WB1 E;  3IL8 A;  4RGN A;  2JEA I;  2HD3 A;  3KF6 B;  3FMC A;  1C4Q A;  5I4D A;  1ILQ A;  1HNW Q;  5FJ8 H;  4RG1 A;  4LFB Q;  1XNR Q;  4KD4 A;  3K8A A;  4LF6 Q;  2F0K A;  1Y69 U;  1VQM A;  2CWA A;  1VF7 A;  4LF7 L;  3CQZ B;  1MI2 A;  2PZT A;  2VZA A;  5I6W A;  4V19 0;  1A62 A;  1TS2 A;  3WOE A;  4A3F B;  3GP7 A;  1YNX A;  1KXL A;  1B7Y B;  4OWX B;  3S1N H;  3NHH A;  4DV1 L;  1WTR A;  2HT1 A;  3HOY H;  2EDG A;  4LAA A;  1E1O A;  4R8N A;  2R92 G;  1J5E L;  2BA0 A;  4QB4 A; 
#chains in the Genus database with same CATH homology
 4HSP A;  1NUC A;  2CW0 C;  3AMU A;  2IT1 A;  5CR3 A;  3S1R B;  1A3V A;  2B2U A;  3PMF A;  5EBC A;  4K5W A;  1LTI D;  1L0Y B;  4RWS C;  2RDF A;  3GTM B;  2M2L A;  5FO8 B;  2EE1 A;  2JP1 A;  1PLF A;  1A3U A;  1EZ6 A;  4XT1 B;  5JVG 3;  2EYP A;  4KKT A;  3I73 A;  2B2T C;  1LTR D;  3ND8 A;  2ZXO A;  4ZLT F;  1KLG D;  2RA4 A;  2SNS A;  1E2W A;  2IPK D;  2DY8 A;  5IGF A;  1SDF A;  4DA2 A;  1F9P A;  1I3Q B;  4C3H G;  2B39 A;  1NSN S;  1KNE A;  2PCF B;  4KY5 A;  2EYF A;  4FXK C;  5M5W B;  4DNR B;  5C0X G;  4A3M B;  4IAL A;  3MTS A;  1OXX K;  3Q22 A;  2RDH A;  1W6J A;  3S1M B;  1PYW D;  2VB2 X;  4RFB A;  1EY8 A;  4HSV A;  3D4R A;  2QEJ C;  4PMB A;  2JEB I;  3WOF A;  4RHS A;  4IUQ A;  5JPN C;  2LFN A;  4A3D B;  1B53 A;  2IX0 A;  3ONA B;  2HQE A;  5JAV A;  1LAC A;  4N9P A;  4Q0F A;  1VMC A;  3GTK B;  3QOL A;  1WD1 A;  2N88 A;  1X3P A;  3CHB D;  3S14 B;  1STH A;  3HOU B;  1WTP A;  3K5N A;  1SAP A;  3GTG B;  2XRS D;  2HDL A;  1V1O A;  1XX8 A;  1KLU D;  5CMD A;  2JE6 I;  1SE3 A;  2KED A;  4C3J G;  1CTM A;  1SJH D;  1DOL A;  2H1E A;  1SND A;  3VYU A;  3BYT B;  2B2W A;  3NBI A;  2K05 A;  1R4P B;  4K14 A;  2KOL A;  2X69 A;  2KJX A;  1HA5 A;  3PUY A;  4RCO A;  3SEB A;  1SYF A;  3N52 A;  2KQ3 A;  3HOY B;  3L7Z C;  1CA6 A;  2Q8R E;  4MIU A;  3RLF A;  3J81 E;  1T5X D;  3HRZ C;  1CI3 M;  2Q8I B;  5M5Y B;  4KHZ A;  2DNC A;  2ID0 A;  1DZ1 A;  2EPB A;  2KEE A;  2X6L A;  2WV6 D;  1TKW B;  2BOS A;  1H9S A;  2L0C A;  1O7Z A;  5C44 B;  3PUV A;  1IYV A;  1H9K A;  1IYU A;  3D6C A;  2L1B A;  4Y7N B;  1S5D D;  2EYM A;  4XIG S;  4BBR B;  3PIO 3;  5F2D A;  2SOB A;  3FDT A;  2A68 D;  4RGT A;  5DAU A;  1F2Z A;  3VR4 A;  3DWP A;  2WIN B;  3DWQ A;  5ELB A;  4BA2 I;  5C5M A;  2LMC B;  4P2C B;  3HOW B;  1QCB D;  3TZU A;  3S2D B;  1JCK B;  2KCN A;  1U4P A;  3HS0 C;  1WTX A;  1DCZ A;  1DOM A;  2I07 B;  2OEO A;  3Q23 A;  3GTO B;  4RAU C;  5IOD A;  2F0I A;  2FIN B;  1VCI A;  1D6E C;  1I4P A;  1PZI D;  1ENC A;  1PMR A;  4CKC A;  4O1N A;  4EQN A;  4AYB B;  3VYS A;  1UEA B;  4K8I A;  4A3G B;  1HUM A;  3NWS A;  1T5E A;  1TR5 A;  2D5D A;  2K1B A;  4DU9 A;  2F0T A;  1EY7 A;  4PMC A;  3ND9 A;  3VA5 A;  4YIJ A;  2IX3 A;  1CHP D;  3DEO A;  5M3M B;  1TS4 A;  2PYK A;  3J7Y W;  1GOZ A;  1SFO B;  4KTA A;  1I50 B;  3H94 A;  5I9O A;  4DAY A;  4B08 A;  1TY2 A;  2XNA C;  1ZXT A;  3TDQ A;  2KCC A;  4XYQ A;  2FMC A;  3S15 B;  3OIP A;  2A6H D;  4QF4 A;  3EFX D;  1D1K A;  1QNU A;  5BN4 A;  2WB1 B;  4IFD I;  1LTB D;  3E5S A;  4H44 C;  5K36 G;  3AU7 A;  3D4W A;  3NP8 A;  4KK7 A;  3SK6 A;  1HFN A;  4IN3 A;  3MWY W;  3LWU A;  3ERO A;  3MZ5 A;  4C56 C;  4RGO S;  1JB3 A;  1DM0 B;  3KF8 A;  4FF2 A;  1M8A A;  4R8I A;  3R2T A;  1K83 B;  2B8F A;  3SK5 A;  2K28 A;  5I9P A;  2F03 A;  3RUZ A;  4ULL A;  5E1F A;  4KV6 A;  4FVM A;  4H7B A;  4CJ2 C;  2F1M A;  1EWC A;  1MGS A;  1TWG B;  1ONL A;  3FEW X;  1LTT D;  5D3D A;  1PDQ A;  4QIW B;  2C9O A;  5IGB A;  2O4X A;  4KI0 A;  4CBV A;  1U4M A;  5EPJ A;  2QKI C;  4TKO B;  1BUV T;  2FJ2 A;  3NXW A;  5E4W C;  1A6X A;  2B2V A;  2F0G A;  5EKI A;  4K2L A;  4K8J A;  2A6E D;  2K7V A;  1QNK A;  3V2T A;  1HA6 A;  4HTH A;  4IUN A;  1PRT F;  5C4X B;  4FXD A;  1ET9 A;  3HEJ A;  5DEH A;  1V1P A;  2EY6 A;  3D6W A;  1ML0 D;  2PPB C;  2A6H C;  4CHT B;  4LJZ C;  5ISR A;  5FLX E;  1G8Z D;  1EU4 A;  2VXW A;  1BCP F;  3EJI A;  1BF4 A;  2XSC A;  3GV3 A;  4A3J B;  5EKK A;  2OT2 A;  1Q3L A;  1ZYR D;  1PRT D;  1B1Z A;  2Z4H A;  1TVX A;  4C3I G;  1RD9 D;  3SVM A;  4PMW A;  4IFD H;  1PTO F;  5FLX L;  3QJY A;  3K5O A;  2E2H B;  1KNA A;  1SE2 A;  4DXG A;  4QMG A;  2FMM A;  3PUZ A;  1O7Y A;  3OWF A;  3OHX C;  1RCV D;  4R9W A;  3T51 B;  1O80 A;  4K6L A;  3E6Z X;  3QOJ A;  4M8A A;  5E3F A;  4BY1 B;  1GUG A;  2R92 B;  2XWJ B;  5J1Z A;  1PTO D;  1SMY D;  2B2T A;  3LX0 A;  2K01 A;  2A74 C;  2E2I B;  5IGG A;  1OXT A;  4KN4 C;  1EEI D;  3D3R A;  1R9T B;  3BVM A;  3P75 A;  4OO1 I;  3I90 A;  2K03 A;  3M85 A;  2A6E C;  2WP8 J;  4BBS B;  3DEP A;  2WAC A;  4M1U B;  3SDZ A;  1I6V C;  4L6T B;  3HP3 A;  5DM6 3;  1JOO A;  3PO3 B;  4F8M A;  1CQF A;  1HCZ A;  1LT6 D;  4KKU A;  3H0G B;  3HOV B;  3I72 A;  3HG9 A;  3TBI B;  2F0Q A;  4U67 3;  2A69 C;  1D5Z C;  2RSN A;  5JOB A;  1EZ8 A;  2AUJ D;  2DY7 A;  1D5X C;  1EL0 A;  1V8Q A;  4DAP A;  1X3Q A;  1ESR A;  3GV6 A;  4WFN 3;  4E6I A;  5I2X A;  4TQU S;  3HOZ B;  2EZV A;  3GO5 A;  3L9A X;  1JC7 A;  1EY5 A;  4KY7 A;  1EY0 A;  3M7N A;  2JA7 B;  3H09 A;  2BA1 A;  3C46 A;  4WRD A;  4WJW A;  1MBY A;  2VB3 X;  3C3L A;  2JA8 B;  2D2C C;  1JWM D;  2EY2 A;  4NDX A;  2L55 A;  2SEB D;  2C5C A;  4IZ8 A;  3GQB A;  1U4R A;  2L11 A;  4HMJ A;  1KDC A;  1O78 A;  4XXE A;  2WII B;  4L8J A;  3C2P A;  1BNZ A;  4FF4 A;  1SNP A;  4QUF A;  1GXD C;  4O42 A;  2E75 C;  1D5M C;  1PTO C;  1IL8 A;  2D62 A;  2K5D A;  1SYE A;  1V43 A;  2E76 C;  3PUX A;  5CV6 A;  1YNN C;  1JOK A;  2NVQ B;  5C0X J;  4IUV A;  5IGC A;  1GUO A;  5M9O A;  1B9M A;  5KYL A;  2PQE A;  3FVQ A;  1EY4 A;  3S17 B;  3NK9 A;  3I91 A;  4KHV A;  3H91 A;  2PNR C;  1JR0 D;  4U68 A;  3MFY A;  3UI2 A;  3Q6S A;  2KUM A;  4FXG C;  2V4D A;  2A5H A;  1IW7 D;  4OO1 H;  3TN2 A;  1QOH A;  4C3J B;  3EQL C;  1SYG A;  3MEH A;  4A93 B;  4DK0 A;  5CV8 A;  3GTL B;  4XQN A;  4CKB A;  3M3Y B;  2EJM A;  2PO4 A;  3BDC A;  2B2U C;  3C1F A;  4I65 A;  3FPU B;  1RTO A;  2OF1 A;  2KHS A;  1TS3 A;  3A56 A;  1HTP A;  1RKN A;  1BO0 A;  2Z4I A;  4IUR A;  4DN4 M;  5DM7 3;  3KK7 A;  2X6G A;  2MJ8 A;  3TSS A;  1F2L A;  3F2U A;  5A35 A;  3IAY A;  2EJG C;  4I7Z C;  3MXP A;  5KNB A;  4XTC S;  2EXZ A;  2EY5 A;  3K5L A;  1CHQ D;  2NN6 H;  1PTO H;  4IQZ A;  2L9H A;  2JA5 B;  1Q1E A;  2DN8 A;  2O2L D;  1EY9 A;  5A2Q L;  1S4Z A;  2MGS A;  2RKS A;  1G2S A;  3X3M A;  4H0L C;  4K5X A;  2F0P A;  3OWE B;  4TSS A;  4RKL A;  3MXN A;  1LT3 D;  4KD3 A;  2B8G A;  2Y0S B;  1VDZ A;  3HKZ B;  4KN7 C;  2LY7 A;  1YNJ D;  4ZKC B;  1Z6H A;  4RA8 A;  5J39 A;  5CYU A;  3KBG A;  1F77 A;  1LLR D;  5C4Z A;  1XXG A;  5LHY 1;  2ICE C;  4G7O C;  2SNM A;  3RD4 A;  2BDO A;  3A8I E;  2EY1 A;  5EPK A;  2H4O A;  2F0L A;  1TY0 A;  4DF7 A;  2BCO A;  1EQV A;  4ILW A;  2TMP A;  3NTK A;  5T1I A;  5JJZ A;  1B9N A;  4J1M A;  3EA6 A;  2AUK A;  1Y8O B;  2AQ2 B;  1TII D;  3A54 A;  3K58 A;  2B2W C;  1HQR D;  4DK1 A;  3K0Y A;  1I4R A;  3NQT A;  1XWE A;  2F3V A;  5D65 A;  4HCE A;  3I4M B;  3A7L A;  5T1G A;  4C1N K;  3OPO A;  1KDB A;  4KMU C;  1H9R A;  1JIC A;  3KBX A;  1O7L A;  1PFM A;  1CZG A;  5EQ0 A;  1F2M A;  3IFT A;  3MVV A;  3A8K E;  2IX1 A;  3NTH A;  3WDN A;  3ERQ A;  3P7J A;  3MXU A;  1TWF B;  1PRT B;  1E2V A;  2N55 A;  2XIW A;  1FD7 D;  2KA7 A;  5EGT A;  3ITP A;  2ZXR A;  4B9W A;  2O5I C;  4DAV A;  3TP5 A;  2A68 C;  3U9O A;  3RMH A;  1DD2 A;  5C3E B;  2KEC A;  5M5X B;  1A3T A;  1BQQ T;  4RGM A;  3Q0A A;  4KKS A;  1EY6 A;  1I4Q A;  1VF5 C;  3QG1 A;  2JSO A;  2F0H A;  1PTO B;  1XTC D;  1HRJ A;  2O5J C;  2D9U A;  1FGB D;  1I4H A;  1QJO A;  3MAQ A;  3MC0 B;  4IUP A;  2BDN A;  4ZQ3 A;  1H9M A;  1ZEQ X;  4UAI A;  2CVR A;  2B2Y C;  1LV9 A;  1C8C A;  4IUU A;  2F0W A;  1D1I A;  2F0S A;  2IWH A;  3SHL A;  3PUW A;  1MSH A;  5ELE A;  4HED A;  4ZUI A;  1JE4 A;  3RZD B;  1E2Z A;  2EVB A;  4XQJ A;  1SNO A;  5J22 A;  5FOB B;  3T16 A;  2EJF C;  4L63 B;  1JOQ A;  1Y8P B;  3PO2 B;  2BE5 D;  2PW5 A;  2YYZ A;  1JOR A;  1NCV A;  4KJO A;  2F0E A;  1QB5 D;  5CV5 A;  1WTW A;  1KTK A;  4TRD A;  5IT9 L;  1SYC A;  4HAE A;  1AFP A;  3AB9 A;  5KGU A;  1WCM B;  1Z47 A;  5C4H A;  4MHE A;  1RF2 D;  3BYY B;  4H13 C;  3M4O B;  5CV4 A;  4RH6 A;  1Q8I A;  1LT5 D;  2J0T D;  3OSO A;  3DM1 A;  5M3F B;  2VNU D;  3P20 A;  1CT1 D;  5ELC A;  1Q12 A;  2FHT A;  3J7A F;  3S16 B;  4CKE A;  1LTA D;  3I4L A;  4Q5V A;  2ENB A;  1TWC B;  2TSS A;  1EYD A;  1BR9 A;  1PZJ D;  1FR3 A;  2EYL A;  1R4Q B;  1J8I A;  1KAB A;  1S5C D;  2CW0 D;  3MFG A;  5FO7 B;  4EVO A;  1F9S A;  1MSG A;  5CV9 A;  2F0N A;  1BCP D;  4N9T A;  4OHJ A;  2F0U A;  1J9O A;  5ELD A;  1OO9 B;  5KRU A;  1K8O A;  1QWY A;  3NUC A;  5KNC A;  2F4I A;  2LKV A;  5EPL A;  2NBF A;  4HN7 A;  1DXM A;  5C4J B;  5CC4 A;  3MXG A;  4CJ0 B;  2NWG A;  5IIF A;  2QDB A;  2NVY B;  1CK1 A;  2B2V C;  3HZX A;  3BVZ A;  3I4N B;  2AQ1 B;  3I8Z A;  5COR A;  1BOS A;  4FF1 A;  1TWA B;  2NUC A;  4V0B A;  1F2Y A;  3R3O A;  1G91 A;  3E0J A;  3KLS X;  3DWA A;  1B44 D;  2K5Q A;  2JA6 B;  1EIG A;  4FF3 A;  2IL8 A;  1Y1V B;  1SNC A;  1NR4 A;  1TU2 B;  5EJW A;  4X3U A;  4JK1 C;  1WTV A;  5D3I B;  2WKC A;  1HQM C;  1UAP A;  1VMP A;  3BZD B;  2FFK B;  1HTL D;  1CA5 A;  3HGB A;  1RHP A;  4C3H B;  1AW7 A;  3BG3 A;  1ZYR C;  3NPP A;  1PRT C;  4F87 A;  3DMU A;  4PNY A;  4BWG B;  1EFI D;  4CJ1 B;  1Y1W B;  1TQO A;  1G2T A;  4IUT A;  4G57 A;  5JVH 3;  2F0F A;  3MHB A;  1Q1B A;  3QO2 A;  1BCP C;  1EEF D;  2K5W A;  2EYJ A;  2NN6 I;  1GUW A;  2DNE A;  1GJX A;  3CKI B;  1ET6 A;  2K33 A;  2EYO A;  1QE6 A;  3A8J E;  1KDA A;  3OOC A;  3PIP 3;  1WTO A;  3MA2 B;  1H9S B;  1A15 A;  3BDL A;  5CGK A;  1X32 A;  1SMY C;  2K32 A;  3VYT A;  1FNV A;  1G6Z A;  3V05 A;  1HXY D;  2PZW A;  2EOT A;  2RQX A;  3NSW A;  2OXP A;  1BDO A;  4G7H C;  1PZK D;  3G7L A;  4KJN A;  3S1Q B;  1JWU D;  3K7A B;  3OIQ A;  2A73 B;  1A2U A;  4B9X A;  3BDO A;  5C3X A;  4FP5 D;  3SR1 A;  4DNT B;  1S5B D;  4K5V A;  2E74 C;  3IFD A;  4NKL A;  1KAA A;  3X3N A;  4A3K B;  1IKL A;  5HGT A;  1BXT A;  3K57 A;  1ICW A;  5K36 H;  2EYH A;  4X3K A;  3A55 A;  2F0V A;  1STN A;  3J80 E;  1Y8N B;  3G6J B;  1ROD A;  2SDF A;  4ABN A;  3O13 A;  1QG7 A;  5BN3 A;  4RHR A;  4EGV A;  3JAM E;  2RSO A;  1EU3 A;  1E0B A;  3LWE A;  4BY7 B;  2L4N A;  2F3W A;  4BS9 A;  1GHK A;  3J80 L;  5I2Y A;  5JEA H;  1I4G A;  5A2Q E;  1A2T A;  2F0M A;  4ID6 A;  5CBA E;  2E2J B;  5G3L F;  4IFD G;  5KIX A;  4IFD J;  3JAM L;  3BS1 A;  4RKB A;  1LAB A;  4MN3 A;  3R8B A;  3TP7 A;  5KEE A;  1ENF A;  2J7Z A;  3PV0 A;  5LL6 S;  4WOR A;  2Z1C A;  3T53 B;  2I46 A;  3D31 A;  2ZXP A;  2QIL A;  2HCC A;  3RZO B;  4LMQ D;  1LTG D;  2PMZ B;  1HFG A;  3CRL C;  3S1N B;  2R7Z B;  3VR3 A;  1SJE D;  3VYR A;  5C5L A;  3W2D A;  5KYI A;  2IW3 A;  2HDM A;  5G3L D;  5FK9 C;  2WAQ B;  1CFM A;  3DUZ A;  4GZY C;  1DOK A;  1NR2 A;  3KLS A;  2PZU A;  2M00 A;  1IW7 C;  3LNN A;  3L3O C;  3CU7 A;  1F9Q A;  2YU9 B;  4EQP A;  4ZAI A;  1EOT A;  1U9R A;  1AP0 A;  1CQV A;  3R93 A;  3OW7 A;  4ZYS A;  3NE5 B;  2AQ3 B;  2KVM A;  4K6D A;  4DFA A;  3J81 L;  3D8G A;  2G9H D;  5BN5 A;  4QCL A;  2NTS A;  3S2H B;  2MUY A;  1GUT A;  1S5E D;  1HHV A;  4JBW A;  2XWB B;  2MPM A;  1C48 A;  4Z9C B;  3FRP B;  2Q8T A;  5IGE A;  2K04 A;  3M4Y A;  1ESF A;  3FPP A;  2NVX B;  1SBB B;  4LK1 C;  5C0X I;  3EVQ A;  2L12 A;  1FYC A;  3TME A;  4FO2 A;  2RDG A;  1JWS D;  2E2D C;  3T4A C;  2RVL A;  4OL7 A;  3K59 A;  4HCS A;  3H3V C;  2B2Y A;  1SNQ A;  5CBE E;  1PXU A;  1V1P B;  3CRK C;  1L0X B;  1IHZ A;  1STA A;  5C6A A;  5IOC A;  3D4D A;  5TSS A;  2ICI A;  4RCN A;  5ELF A;  4A3B B;  4X3T A;  1EYA A;  3VR2 A;  1JQY D;  3U9S A;  3SK4 A;  3J7A V;  5IGD A;  2R3Z A;  2AWO A;  4OIJ A;  1TS5 A;  1STE A;  3KLR A;  4X3S A;  2WKD A;  1BBX C;  4J8Q A;  2MP1 A;  3P1H A;  2QF7 A;  3C1E A;  4EQO A;  3T56 B;  2NB0 A;  5C3W A;  2B63 B;  3A7A B;  1ZKO A;  1YNJ C;  2NYZ D;  3GTJ B;  1BCP B;  4UDU C;  1AZQ A;  1G29 1;  1B2T A;  4FNF A;  1B3A A;  3VA7 A;  3DHQ A;  3R2I A;  5FKA C;  1EIH A;  3NWT A;  2XN9 C;  4S3S A;  2CHB D;  3S9W A;  3SXH A;  3TZD A;  2JYO A;  1PFB A;  2F0O A;  3I3C A;  3GD7 A;  1M4V A;  1SNM A;  2HUG A;  4DXF A;  1DJR D;  4C2M B;  5HUR A;  4OO1 G;  1DON A;  2M9V A;  1XYI A;  3TP6 A;  2VUM B;  1H9J A;  1RTN A;  1STB A;  2IJ0 A;  4ZUJ A;  1STY A;  1W6K A;  3V96 A;  2NZ1 D;  1LO5 D;  5D14 A;  2R93 B;  4PQX A;  3VR5 A;  2CQA A;  3URY A;  4K2K A;  1GUN A;  1TWH B;  5CV7 A;  4G7Z C;  5K5P A;  3SK8 A;  3TP8 A;  3M7G A;  5IT9 E;  1I6H B;  3FKI B;  3GTQ B;  3K5M A;  1CM9 A;  1MD2 D;  4J6H A;  2NVT B;  1Q90 A;  1GUS A;  3NQI A;  1UUP A;  4HMI A;  3OMC A;  4A3E B;  5FO9 B;  5EKL A;  4NW2 A;  1B4O A;  1FNU A;  1RDP D;  4XYO A;  5C0X H;  2F0D A;  1LT4 D;  1LTS D;  1SYB A;  1SXT A;  3Q24 A;  1OXU A;  2XVS A;  2G9D A;  3QB3 A;  3IKJ A;  5JEA G;  1SYD A;  1GHJ A;  1Z7T A;  3NTI A;  1WTQ A;  3VR6 A;  1F9R A;  5JEA J;  2K6A A;  4ZK9 B;  2LS0 1;  3W3A A;  2JXM B;  3ZYY X;  4BA1 I;  3QWN A;  4FYD A;  4C3I B;  4ZRZ A;  1SE4 A;  2PW7 A;  1S5F D;  2NN6 G;  5I6Y A;  3OMG A;  1EWH A;  4ODG A;  2NTT A;  2ZT9 C;  4DGZ A;  5E4X A;  3T13 A;  3QIA A;  1SSO A;  1D2B A;  4XDX A;  1TT2 A;  2J4X A;  4F88 A;  4NMZ A;  1WVL A;  3N6R A;  4ME5 A;  2R6G A;  4F7X A;  5DNF A;  2R61 A;  4XQQ A;  1STG A;  4OIK A;  5LL6 X;  1IKM A;  2QCP X;  1CZW A;  1HUN A;  2A69 D;  1DYQ A;  4C1N I;  2Z8L A;  1NAP A;  1K8M A;  1AEX A;  1WD0 A;  4ZKB B;  4G4K A;  1OXS C;  4OGQ C;  5AFW A;  1AN8 A;  3GTP B;  1ILP A;  4PV1 C;  3KUP A;  4QUC A;  2L5T A;  1RJT A;  1SEB D;  2RBM A;  3SE0 A;  1EQT A;  1PFN A;  3K6O A;  2MHV A;  1FNW A;  3BVG A;  3I70 A;  1AZP A;  4XT3 B;  4HR7 B;  2AWN A;  2BE5 C;  4NP5 A;  1QIL A;  5EBD A;  2GA4 B;  2F0J A;  2XRQ D;  1II3 A;  1OXV A;  1UNS A;  1EYC A;  5JPM C;  5COY A;  5NUC A;  3NBH A;  5KND A;  1B50 A;  3DXJ C;  1I4X A;  4A3I B;  1U4L A;  1ENA A;  4CGY B;  3HOX B;  1HPC A;  1YNN D;  2HCI A;  3H6M A;  4KY6 A;  3IL8 A;  4RGN A;  2JEA I;  3FMC A;  1C4Q A;  5I4D A;  1ILQ A;  4KD4 A;  2F0K A;  1Y69 U;  1VF7 A;  3CQZ B;  1MI2 A;  2PZT A;  5I6W A;  4V19 0;  1TS2 A;  3WOE A;  4A3F B;  3GP7 A;  3NHH A;  1WTR A;  2EDG A;  4LAA A;  4R8N A;  2BA0 A;  4QB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...