5KRUA

Crystal structure of staphylococcal nuclease variant delta+phs t62e/v66k at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
132
structure length
132
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFEKKMKENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62E/V66K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 132
sequence length 132
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5kruA00
1SYEA 4K6DA 3MEHA 2EY1A 5C5LA 2RBMA 1SYFA 2KHSA 3QOLA 4J6HA 5JOBA 4R8NA 5IGBA 3EJIA 2F0KA 2F0TA 2EYJA 5J39A 1SNPA 5KGUA 2F3VA 3DMUA 5C4ZA 3LX0A 2F0VA 2SNSA 5J1ZA 3H6MA 4K8IA 1JOKA 1A2TA 3NP8A 4K5WA 1TR5A 3R3OA 1TQOA 2F0PA 3U9OA 4QB4A 2RKSA 3OMGA 4DFAA 1F2ZA 1IHZA 4EQPA 3SK8A 3OSOA 3P1HA 4ME5A 5EKKA 2EYHA 5IGDA 1EY4A 1EYCA 3MZ5A 5KIXA 1EY6A 5IGFA 2EYFA 2F0EA 2OF1A 4HTHA 4KTAA 4N9TA 4NDXA 4RKBA 4F7XA 2EYLA 1A3VA 3D4WA 4PMCA 4S3SA 4ZUJA 2RDFA 1U9RA 5ISRA 3OMCA 2EYOA 4HMJA 4ODGA 2F0WA 3SK4A 1SYBA 4IALA 4NKLA 4ID6A 4QMGA 2O4XA 3C1EA 4KD3A 5EKLA 1STAA 3OWFA 1STBA 3E5SA 4YIJA 5DEHA 3SR1A 2F0GA 2F0DA 5KRUA 2EY6A 4KY7A 2F0LA 4F8MA 4ZQ3A 4RKLA 3DHQA 5C5MA 2KQ3A 1EYAA 3D8GA 5C6AA 1ENCA 4K8JA 5JAVA 1SYDA 4OL7A 4KV6A 1EY0A 5F2DA 4N9PA 4KJNA 4DU9A 4IUNA 3SHLA 3SK5A 5I6WA 5IOCA 1KDCA 5E3FA 1EZ8A 3MVVA 2F0JA 1RKNA 4K2KA 1EYDA 2F0NA 4DF7A 5C4HA 5C3XA 1ENAA 5C3WA 5IGGA 1STNA 2F0UA 4EQOA 5CV6A 5CR3A 3TP7A 2QDBA 3V2TA 4EQNA 5I6YA 2PZTA 1EY5A 2F0QA 1SNCA 3NUCA 4IZ8A 2OEOA 4K14A 1SNMA 4K5VA 1JORA 1TT2A 5NUCA 1II3A 2EYPA 3TP6A 1NUCA 1KABA 4WRDA 3HEJA 5CV4A 4EVOA 3BDLA 5KEEA 4I65A 5I9OA 1STYA 5HGTA 2LKVA 2PQEA 2NUCA 3MXPA 3MHBA 2F3WA 5CC4A 3S9WA 5I9PA 3QB3A 2F0FA 4KHVA 4KY5A 2PW5A 5KYIA 4KD4A 3NQTA 4B9WA 1KDBA 3BDCA 3RUZA 5IODA 5CV9A 2F0IA 2EY2A 3HZXA 3ITPA 3TP5A 3TP8A 5J22A 1SNQA 2SNMA 1AEXA 3TMEA 4DGZA 5KYLA 1A2UA 1A3UA 2ENBA 2HQEA 1EY8A 2PW7A 3NXWA 3T16A 4WORA 4PNYA 1JOOA 1F2YA 5CV8A 3EVQA 1SYCA 2PZUA 1NSNS 1EY7A 5HURA 1JOQA 2PZWA 1SNDA 3NHHA 2PYKA 4KY6A 4QF4A 5EGTA 5CV5A 3SK6A 3T13A 2EXZA 2F0MA 4NP5A 4KJOA 3VA5A 1EZ6A 2WACA 3D6CA 4E6IA 1EQVA 2EYMA 2M00A 4J1MA 4K2LA 1F2MA 1SNOA 5CV7A 5E1FA 5CGKA 3EROA 1EY9A 4HMIA 5IIFA 4NMZA 2EY5A 2SOBA 1STHA 3D4DA 3QOJA 5DAUA 2OXPA 1SYGA 1A3TA 2F0SA 1STGA 4H7BA 4K5XA 3ERQA 2F0HA 3PMFA 4LAAA 4MIUA 2F0OA 4PMBA 5M9OA 1KAAA 3NK9A 5K5PA 3P75A 3C1FA 3SXHA 5IGCA 1KDAA 4B9XA 4G57A 4ZUIA 5IGEA 4TRDA
chains in the Genus database with same CATH superfamily
4ME3A 3NTKA 3MC0B 1Y1WH 1SRUA 4KKTA 4LFBQ 1F9PA 4CKBA 1WTHA 2V4DA 1MBYA 1PZJD 1UEBA 3L9AX 3DWPA 4WFN3 4A4IA 4A93B 2E8GA 2F0EA 1GKHA 3SE0A 3HOXH 4C3JG 2R7FA 3D4WA 2XIWA 3PIOA 2ZXPA 4L8JA 1FR3A 4IOCA 4ULLA 2UXBQ 1SYBA 1K83B 1HFGA 3CCUA 1K0RA 1E2WA 3HOZH 1B7YB 5FLXE 3H15A 3HOWG 3DHQA 1C0AA 2IW3A 2BA0A 3R93A 1CZGA 1EY0A 1UE7A 2L12A 4L5QA 5C4JH 2DY8A 3K6OA 2EZVA 1CKOA 4H02A 3RR5A 5M3FG 3K81C 4OO1H 4EQOA 2YTXA 2J4XA 4JI4L 4JBMA 4CDCC 1N33L 1AE2A 1T5XD 1YHAA 4F87A 3I91A 1M1KC 1TWGB 1W6JA 2VQFQ 4KHVA 5KYIA 4BA1I 4X62L 1G6PA 1BOSA 1W6KA 2K5WA 2ENBA 4X3UA 1QZHA 1K28A 3SGIA 1EY7A 3AB9A 5LL6X 3RN2A 3I3CA 1PDQA 1EFID 5EGTA 4DV7L 3Q0AA 2I07B 3K57A 3D6CA 4HN7A 2E76C 1F2MA 4DR5L 3WWVA 3QWNA 3CC4A 1G91A 2WV6D 3FKIG 4LAAA 2KBNA 5IP7H 4KHZA 4R4QA 2Z6BA 2VS1A 1P16A 3T4AC 4OIJA 2AUJD 4A3KG 1Z7TA 1YZ6A 1LUZA 2NVQH 4A76A 2B2WA 2AQ2B 4B08A 4JI8Q 1SNPA 2KCCA 1SSOA 1JICA 1DYQA 5C4ZA 1WJJA 3NWTA 3A5UA 4KHPL 4C1NK 3G7LA 2RKSA 5G3LD 2VUMH 4KK7A 5HGQA 1G2TA 4FF2A 4JOIA 3J81L 5DM73 2K1BA 1VQPA 2E2HH 2R7ZB 4X65L 1BXTA 4ZUJA 2RDFA 4HEDA 3OMCA 1XJVA 3I4MG 3PO2G 4U673 1HRJA 1L0WA 4OXPA 1VQIA 4HCSA 3W2DA 1XPUA 4YIJA 2MUYA 2F0DA 4V190 1R9TB 4A3EG 3VYUA 4RH6A 5C3EG 4GKJL 5C5MA 4O1NA 3AQQA 1RF2D 2JYOA 3CCJA 4OL7A 1YJWA 2TSSA 1LTLA 1OXXK 2K50A 1OO9B 3FDTA 2ZM6Q 4L5TA 4XDXA 1I3QB 3VR3A 5AJ3L 3RZDB 2KOLA 4A3IG 3HOVG 2LSSA 4LNQA 1A63A 3GTLH 4JI5L 3EFXD 5HY6A 4A3BB 1STYA 5JPMC 1DONA 3KF8A 3PUZA 5CC4A 2QA4A 1X3PA 2PW5A 3GTPB 1UE1A 2EXDA 1HZ9A 5A2QL 3H0GB 2G5DA 4L5RC 3M3YB 3MXNB 4C2MB 4HJ8A 4DR7Q 5T1GA 3M4OB 4DPGA 2ICIA 3UDXA 2WIIB 4KJOA 1EZ6A 3EBEA 2JA5G 1BCPF 1EQVA 3KF8B 3I4OA 2R92G 3RD4A 5LMUQ 3D4DA 4ZKBB 2YU9H 3NE5B 4F88A 2K75A 3G48A 1KDAA 3A8KE 4L5SA 2TMPA 5IGEA 2KHSA 5JOBA 2KCMA 1PH2A 4DV3L 2UUAQ 3SEBA 4YY3Q 4LF6Q 5KGUA 1DOMA 4RCNA 1RCVD 3BJUA 5LHY1 5GQOA 1SFOB 1KQSA 2NVYB 3HOWB 1AZPA 3RZOH 1PH5A 3P1HA 3I4LA 1JE5A 2LMCB 5IGDA 4NXML 1VQKA 4RAUC 1IW7D 3CCSA 5EQ0A 1B8AA 4F7XA 3T1HQ 5IT9c 3J7ZC 1SJED 1Q82C 2NN6H 4BBSG 1TY2A 4ODGA 3SK4A 1N36L 1XXGA 2A19A 3JC66 4B3SQ 3OW2A 5C4JB 2L55A 1TXYA 5FLMG 3D8GA 3TZDA 1FGBD 2OQ0A 1KAWA 4FO2A 3SHLA 1F2LA 2NVTH 4X66L 3NSWA 3D4RA 5I6WA 3MVVA 1EYDA 2F0NA 1ENAA 5GROA 4KKUA 3K5OA 5JEAG 4K6LA 4C3HH 1QVGA 5I6YA 5A2QE 1J5EL 1FNWA 1TKWB 2EYPA 4XQNA 5C44G 1PH6A 3K80C 3A55A 3G6JB 3S24A 4DA2A 1FNVA 3HS0C 1S5BD 2MFIA 3S9WA 1PH3A 3TEHB 1LTTD 3GTGH 4KD4A 2XVSA 2A6EC 1XX8A 1X3GA 2CWPA 3F2BA 4A3KB 5ELEA 4DR6L 4BY7H 4C3IH 4DAMA 2R61A 1RJTA 1I94L 1SYCA 2XRQD 4JK1C 1G291 5EAYA 1G51A 1PV4A 4OWWB 5C0XJ 1K3BC 1FJGL 3OIQA 1GUNA 4JI6L 2E5LQ 1EUJA 5ELDA 1X65A 1Y69U 1NNXA 5ELCA 4ZCKA 1STHA 2Z8LA 4RGTA 2XGTA 4MIUA 1OXUA 1XNRL 4LF9L 5DNFA 4DV4Q 4B9XA 4FF4A 1QVCA 1Y14B 1QZGA 1KNEA 2A69C 1DM0B 2XRSD 5BN3A 3DMUA 2VUMB 4ZLTF 2K52A 3H6MA 2DGYA 1BBUA 2Y0SG 2VQEQ 1AFPA 2WAQG 4G7ZC 1HUMA 1VQGA 5C3EB 2VB3X 1C48A 1I4RA 4ME5A 1D5ZC 5IT9E 3CF5A 3S16H 2EE1A 4K0KQ 4XYQA 1Q8IA 1ET6A 1U9RA 3NELA 2EYOA 3C46A 1Z47A 1EWIA 1QILA 2K6AA 5K36G 4A3IB 3HOVB 3MWYW 4XQQA 5DEHA 2A5HA 4A3GG 2BA1A 3KF6B 3GTJH 4FNFA 2JA7B 4GNXB 3OPOA 1ZYRD 1BBXC 1SYDA 1Q1EA 2BOSA 1ML0D 4UP7A 3UE1A 3F2CA 1Q86C 2XTIA 1Q81C 2KUMA 1QNUA 3MTSA 3S1RB 5IOCA 4XT3B 4K2KA 1E24A 1STNA 5CV6A 2X69A 3P7JA 1N34Q 3V2TA 3RLNA 4DV1L 1EY5A 1LT6D 4TQUS 1SNCA 4GLAC 3TDQA 3E0JA 3A56A 1EEFD 3AFQA 3GTQH 1D5XC 5KEEA 1PFSA 2RHQB 1TY0A 3UDIA 5HGTA 4B3ML 2A68D 3AU7A 2F3WA 3HKZG 3VA7A 1DD2A 3FMCA 4KY5A 3CCRA 2UXCQ 4X3TA 2N49A 4DGZA 4LUZA 4Y7NB 3NXWA 3JAMi 2ZTCA 3I7FA 2K4KA 1BCPC 1D5MC 4A3DH 1TS3A 2ZXRA 5BN4A 1FL0A 5E1FA 1CA6A 2RHSB 4DUZL 3EROA 3OTOL 1EQRA 1VQ5A 2KEEA 2C35B 1K9MC 4X64L 4GLVB 1K8GA 2Z6KC 4AQYQ 4Y52H 5C4XH 2B39A 3P75A 1CT1D 4DV5L 5M5XB 2IHFA 3W3AA 4TRDA 2PNRC 1JB7A 4K6DA 3MEHA 1YNJD 2I5HA 1LABA 2F0KA 1LV9A 3IAYA 1EFWA 1UE5A 2RCNA 2RDHA 3LX0A 1J8IA 2HHHL 1I4PA 3KUPA 1J9OA 2UUBL 3MZ5A 4ILWA 3JAMc 1EY6A 1X55A 1LT4D 1UE6A 5FK9C 3K5MA 2UU9L 1PH7A 1AP0A 2A6HD 4RCOA 3G4SA 4JI4Q 3S2DB 5EKIA 3ERSX 4CGYB 1N33Q 1H95A 5EKLA 1BR9A 1STAA 2K5NA 1VQLA 1LO5D 1VQBA 3NTIA 4DR2L 1KC8C 3Q22A 5C44B 4ZQ3A 2JQOA 4R1JA 2NN6I 1WTRA 1VCIA 4X62Q 4OX9Q 4DU9A 1UWVA 4DR3Q 1K8MA 1CQVA 2VZAA 3A7AB 2AQ1B 1E7ZA 1PH1A 2CQOA 3NUCA 3J7A5 5JEAJ 1QG7A 3S1QB 1F9RA 2MNAA 2B8GA 4DR5Q 2O2LD 5FJ8G 3M85A 1QOHA 4LFCL 1RTNA 3GTMB 4N8X1 4BY1B 1SMXA 1VQCA 1XMQL 4LFAL 1TIID 3HZXA 3MFGA 1SEBD 3T16A 3X3NA 1TWCB 4WORA 4JG2A 1PTOH 4CDDC 2CQAA 2RA4A 3CCQA 3R2IA 4P74A 1DJRD 1U4RA 3U9SA 1HZAA 3KBXA 4O2DA 3T13A 1GUWA 4KHPQ 2IPKD 1I6HH 2EYMA 4K2LA 4MN3A 4A3JB 5CGKA 1B2TA 3J80i 2JEBI 4NMZA 2Y0SB 4DXGA 4CJ1B 2WAQB 5IWAL 1IYUA 4IUQA 3OIPA 2PNHA 3M4QA 4X65Q 4LF7L 4G4KA 2F4VQ 5JJIA 1JQYD 1EEID 2C5CA 4FDBA 2F3VA 2FMCA 2OT2A 3HGBA 4GKJQ 5E4WC 4A3GB 5IYBG 3VR5A 1F9SA 2Z6KA 3GO5A 5GADC 3JAME 1S5DD 1Q12A 5EPLA 1RL2A 5EKKA 2J0TD 3H0GG 5KIXA 5M5YB 1ET9A 1KD1C 1NR4A 2OWOA 2E2IB 5AJ3Q 2B8FA 3BYTB 5FO8B 2K01A 3C2PA 5EPKA 1L2FA 2SDFA 2YTVA 5J3BA 4LF8L 3GTJB 4NKLA 1NY4A 5JJLA 3R8BA 2JA8H 3S14H 3J80c 3I70A 1CK1A 4JI5Q 1OXTA 2ZT9C 3M7NA 4JYAL 4KY7A 1XMOL 3T1YQ 4R9WA 1QB5D 4RG1A 4RFBA 3KJOA 1MHWC 3HKZB 4BS9A 4PZ8A 3GQBA 3J80L 3PIPA 3CU7A 4JI2L 4RGOS 1ZEQX 4DNTB 2K14A 4FYDA 1IBKL 3G71A 4MNOA 1SE3A 4OWXB 4C3JH 2E75C 3PUYA 1EWHA 2MQHA 2QEXA 2HQLA 1TT2A 5NUCA 2HT1A 1KABA 3CQZB 2NTSA 3IFDA 3HOUH 4V0BA 3HOXG 4LW1A 1HTPA 3A0JA 2KECA 3NQTA 1KDBA 2B3GA 3ONAB 1VS0A 4YHHQ 4RMFA 4YCWA 4LUOA 1VQHA 4YWLA 1A3UA 1ENFA 4IUPA 2UUCL 2MP1A 1DXMA 2DN8A 1V8QA 4DV3Q 4UP8A 1MIUA 1B44D 3MXGA 2Q8IB 1E1TA 3HOZG 1BBWA 1C9OA 1LTRD 4GN4B 4HJAA 3V96A 1KRTA 2CH4W 5M3FH 1YNND 2AMCB 2K5VA 1CZWA 1WVLA 2Y0SE 2WAQE 3VA5A 3NPPA 5CV7A 4RHRA 1QWYA 1JE4A 4FXDA 5C4XB 2EY5A 3CP0A 5DAUA 3QG1A 5M3MH 2F0HA 2PI2A 4OO1G 4U68A 3KK7A 3BVZA 1X6OA 5EBDA 1PFMA 3ULPA 4JV5L 4P72A 4OEMB 1N36Q 2EIFA 5C0XG 1GM5A 3I73A 1X3EA 4XYOA 5TSSA 3V05A 3I72A 3UDGA 1D1KA 4HSVA 4K8IA 3J7YW 2G9DA 3W1GA 2UXDL 1A2TA 2FFKB 1TR5A 2A74C 2MHVA 2K7VA 2OTLA 4DUYL 2OCEA 1IKLA 4BA2I 3CAMA 1O80A 4BBRB 4X66Q 1D7QA 1PA6A 1KTKA 3FKIH 4DAYB 3W5OA 1YHBA 4S3SA 3HKSA 3BDOA 5ISRA 2L5TA 3FP9A 4AYBB 1QCBD 1J5EQ 3J80E 4IALA 1KIXA 4JPBW 2O4XA 3C1EA 3PV0A 4L63B 2JJQA 2YYZA 1U5KA 3J7AF 2F0GA 5KRUA 1IW7C 1O7ZA 1SAPA 3HKZE 2K5DA 1S5ED 4ZAIA 5IP7G 2HCIA 3L2PA 5JJKA 4XIGS 4QUFA 3DUZA 5JAVA 4IOAA 1TWHB 1T5EA 4KJNA 1LLRD 2AWNA 3CC2A 4KN7C 1HA6A 1I94Q 3TP7A 4EX5A 3UDFA 1K0SA 3O13A 2J7ZA 2HIXA 4A3FH 2VUMG 4DR4L 3I4MH 3PO2H 4RHSA 1HNZL 4CKEA 2A73B 2Z1CA 3RLOA 3VR4A 5CMDA 1XNRQ 4A3EH 1PH9A 1HNWL 4LF9Q 2XSCA 4DAPA 1YI2A 2R93H 2CKZB 5KYLA 1CM9A 3STBD 1E2VA 2I46A 2PW7A 3RMHA 2JXMB 2N3SA 2N55A 3D0FA 4ZK9B 3A8JE 3NENA 4H13C 4QQBX 2JP1A 5ELOA 3MXNA 1SNDA 1U4LA 3A7LA 2CW0D 5JPNC 1N32L 2MO1A 1SDFA 2XN9C 4NP5A 5CORA 2JA6H 2DUDA 1GUTA 4J1MA 2JA7G 1KLGD 1L0YB 3CPFA 1GJXA 3M4YA 5IIFA 3ND9A 1HZBA 1SYGA 4A3LH 4TVAB 1Q90A 4PMBA 1KAAA 2WKDA 2B63B 3HOYH 3C3LA 1CSQA 5IGCA 1ONLA 1MI2A 1SYEA 1GVPA 2EYJA 4LFBL 2PI2E 1WCMH 1WOCA 1JWMD 4JI0Q 1X54A 3BVGA 1HR0L 1F2ZA 2FHTA 1V43A 2VW9A 2JA5H 2IL8A 4DV2Q 5D14A 1SE2A 4RKBA 2Q2UA 1ZXTA 4NDXA 3BS1A 4GNXC 1A3VA 1SROA 1Y1WB 4DV1Q 1FGUA 3BVMA 1QE6A 1PH4A 3BU2A 2XNAC 2DJFC 3CPWA 3TZUA 1W2BA 3PO3H 4HR7B 1EYAA 4C1NI 3HOXB 5ELNA 3S1NH 1DOLA 1Y1VH 2JSOA 1PFBA 1KLUD 1EIHA 2O5IC 2VY3A 3MEFA 3BG3A 3TQYA 1JJ2A 1ZYRC 3HOZB 1LTGD 3HOUB 4BBSH 1B9MA 4DUZQ 2EVBA 1WFQA 5AFWA 4H0LC 3OTOQ 5IT9L 5LMNL 2B29A 1LTAD 3OW7A 3KOJA 3I2ZA 1PRTD 4B9WA 1IL2A 4DV5Q 1SLJA 5FLMH 1AZQA 3CCLA 1JWSD 2QDLA 2L11A 1F2YA 1G8ZD 5CV8A 3F8TA 1QVFA 2A68C 1HNXL 2QGQA 1O7IA 3BYYB 5L37A 5E4XA 4JI3Q 5D65A 2SEBD 2N88A 2ZTEA 5M3MB 2WACA 3QJYA 1X32A 1AW7A 1D1IA 5M5WH 1JR0D 1T9HA 2UUBQ 4RGNA 4K5XA 4JI1Q 4NB3A 1BF4A 3S17H 2UU9Q 2LS01 1P8LA 1TS5A 1O78A 5C5LA 3K7AH 4BXXH 3EJIA 1Y8NB 3QIAA 1HR0W 1NBWA 1SXTA 4PZ6A 1EYGA 4NXNQ 4K5WA 4CDEC 2Q2IA 1I5FA 3WOFA 4H44C 4UPAA 4C3IG 4BY1G 4R4TA 3S15H 1YNJC 1TWFH 1EY4A 4POFA 2KEDA 2NVQB 3CRKC 2MJ8A 4MTNA 3GV3A 1UNSA 1XYIA 2M9VA 1A6XA 4POGA 3S2HH 5CYUA 4DNIA 3OWFA 1STBA 3SR1A 1U4PA 2NZHA 4A3JG 3I4NH 1IBMQ 4TKOB 4LFCQ 1GD7A 3KF6A 4RKLA 1XNQQ 1HUNA 2A6HC 1ASYA 1NAPA 3EA6A 4LFAQ 1FNUA 4GNXA 1XMQQ 4N9PA 1PYSB 2E2HB 1L1OB 4IUTA 1ILPA 1NJIC 4MHEA 3E9IA 3SK5A 4IFDH 1EZ8A 4A3FB 1E3PA 5IGGA 1GUSA 5IP9G 3CMAA 2ZJRA 1TWAH 1E1OA 2R3ZA 1TVXA 4K14A 1O7YA 4JBJA 3W1BA 5IE8A 1TS2A 3K0XA 1PTOF 5E7NA 5CV4A 4EVOA 2KCNA 2CCZA 1CSPA 3MXPA 3MHBA 3K59A 1ICWA 1UAPA 4G7OC 3VYSA 3PIO3 1GUGA 3BDCA 4QL5A 2NVXH 4MZ9A 1Q46A 1SN8A 5FO7B 3TP8A 1SNQA 2EQSA 2NZ1D 4DV6L 1VQOA 3HRZC 3LGJA 3GTOH 1EY8A 1S4ZA 3VDYA 4QUCA 3H3VH 1UUPA 1E22A 1NCVA 3KBGA 3GTLB 1U0LA 5HURA 2LXJA 1KRSA 1RODA 2RVLA 1AE3A 3PF4A 2PYKA 3BZKA 2ID0A 1PZID 2CFMA 1SMYD 2KA7A 2ASBA 2JA9A 3QOJA 2H4OA 5LMUL 1H9JA 1M90C 3PMFA 1LM0A 5FOBB 2KCTA 4C56C 4A93H 4IURA 3FRPB 1PFNA 3E6ZX 3TS2A 2E2DC 1HCZA 1I4GA 3OHXC 5IGBA 3A54A 1WCMB 2A1AA 2F0TA 4AH6A 1XPRA 1CKMA 4LF6L 2BE5D 1QNKA 5CBEE 1K83H 1XMOQ 1SE8A 3DM1A 2VXWA 4A3CH 1V1QA 5ELBA 1RD9D 3NP8A 5IYCH 3KJPA 2YU9B 1VMPA 1YHQA 3I56A 4GOPC 4NPSA 5KNBA 4GZYC 4HTHA 4KKSA 4KTAA 4OHJA 1YITA 4A3DG 5JJZA 1LT3D 5ELFA 3F2DA 3PO3B 4P2CB 1NTGA 1NE3A 4R8IA 1X9NA 3J7AV 4EGVA 4JBKA 4LMQD 2EY6A 3RZOB 5C4XG 3NBHA 2RQXA 4L6TB 1LTBD 1E2ZA 1VDZA 2NWGA 4UAIA 1TWGH 1LT5D 2Q8TA 2K28A 1YNXA 2IWHA 1YIJA 3T56B 4PMWA 1VQFA 2R6GA 2UUCQ 1IXRA 2F0JA 4IUUA 1CKNA 1G2SA 2PZTA 1PMRA 2ZTDA 3IFTA 4DK3C 3JAML 1OTCA 1L0XB 4JVZA 3LNNA 1NUCA 5D3DA 3NBHB 1BNZA 1IBLL 3QR8A 1ILQA 2FXQA 4RWSC 2NVTB 2DNEA 4BBRG 4B3TL 1JC7A 5IODA 2BH2A 2GN5A 4DK1A 3IKJA 3F1ZA 4LWCA 4JV5Q 1HXYD 4C3HB 3NQIA 1SBBB 2K32A 2L9HA 4RA8A 4IJLA 4ZRZA 4AYBG 1CKNB 2ZJQA 1I4QA 4PZ7A 1OXVA 4AIMA 4FXGC 1W3SA 4IPHA 4DV7Q 2UXDQ 4BWGB 1EIFA 4ALPA 4UY8C 1MSHA 2DNCA 3GTGB 4DUYQ 3MFYA 1IL8A 1PRTF 2L0CA 1C7YA 2QILA 3AMUA 1CA5A 1STGA 5FJ8H 2GVAA 4WJ3M 4BY7B 4C3IB 1YNNC 4DV4L 2ALYB 3GTKH 4J6HA 1SYFA 4DV0L 1B50A 4XTCS 1WTPA 4R8NA 2R7ZH 4R4IA 1V1PB 4MTKA 3Q8DA 3GDEA 2YTYA 3CD6A 4KN4C 2SNSA 4FP5D 3S15B 1HJPA 3R3OA 3WDNA 3U9OA 2RF4A 5FLXc 4A3MH 1K73C 1IHZA 4X3KA 1R9TH 1IYJB 4O42A 2D9UA 4IQZA 1D6EC 3NEMA 2EYFA 2OF1A 3S2HB 1R4QB 5IYDH 4HCEA 2Z4HA 2F0WA 4JI7L 1I3QH 3I4NB 4Q5VA 4X3SA 1TU2B 2K03A 4ZYSA 2GVBA 3MA2B 4GOPA 2I5MX 2ZJPA 2KQ3A 1BUVT 3CCVA 4GLXA 3DWQA 2QF7A 4A3BH 4LF4L 3AFPA 4HIOA 2B63G 5IYBH 1PH8A 2RSOA 1C8CA 3S16B 1PLFA 2NB0A 3FPPA 4DKAC 2OQKA 5E3FA 5EJWA 3GTPH 1GHKA 3ND8A 3CMEA 3H0GH 3URYA 1GUOA 1B1ZA 1SR3A 2QEJC 1Q3LA 1N32Q 4OGQC 3M3YH 1SNMA 4GOPB 4C2MH 3DXJC 3M4OH 4IFDI 2K5HA 1YJ9A 1B70B 1C4QA 4GKKL 1KHIA 2NUCA 2EDGA 2N78A 5I9PA 3GTOB 3TREA 3L0OA 2VNUD 3KLSX 5DLQE 3ITPA 3PSIA 4Z9CB 2UXCL 2VB2X 3H94A 4PG3A 2JA8G 1Y1WG 1JT8A 2MPMA 4HSPA 4HJ9A 5BR8L 2D0OA 2WINB 1MSGA 4HIDA 4DK6C 3GTQB 2Z9HA 5LL6S 2FMMA 1S5FD 4QF4A 3LWUA 1ASZA 5JVG3 3DM3A 4ABNA 1HR0Q 1Z9FA 3EN2A 3STBC 4HMIA 3H3VI 1SFOH 2SOBA 3U50C 3OOCA 2WFWA 5M9OA 1YBYA 2NVYH 3HOWH 4AQYL 3SXHA 1DCZA 2CW0C 4X6AH 2EPBA 1F77A 3RLFA 1I6VC 2BCOA 3J81j 1BVSA 1A8VA 2F1MA 3BZDB 3KYHC 4I7AA 3CXCA 4A3DB 2PMZB 2Q2HA 3HOUG 1WTOA 1EOTA 1WTVA 1BDOA 4APVA 2MGSA 1VQAA 1RTOA 2GA4B 4EQ5A 1CHQD 3KDFA 4EQPA 5BN5A 2BH8A 1X56A 2HD3A 3PUVA 1SE4A 1HZCA 1PYWD 4NXMQ 4B3RL 1KXLA 3PUWA 4JC0A 1MD2D 3D6WA 3GD7A 1WI5A 4DAYA 2K04A 4A75A 5I2XA 1CI3M 4HMJA 1RHPA 3T53B 2KENA 1V9PA 4ID6A 3D31A 2O5JC 3E5SA 5M3MG 1X3FA 5C0XH 5LMNQ 3KDFB 3ICEA 3J81i 2K5QA 2RSNA 4KMUC 1ENCA 4K8JA 1K8AC 3ZYYX 2OTJA 4GN3B 5EPJA 5GAHC 4OX9L 1HQRD 2K05A 4YWMA 4DR3L 4LF5L 1OXSC 3B6YA 5KNDA 5C3XA 1HNXQ 4A3KH 3QO2A 1GO3E 4FF1A 1CFMA 2HDMA 3GV6A 3U58A 3A74A 4RGMA 3BDLA 2X6GA 2H1EA 5I9OA 2PQEA 2ZXOA 3VR2A 1PTOD 4P73A 3HFZB 4IN3A 1V1OA 2R7DA 1Q7YC 2WB1G 1MGSA 1H9KA 5CV9A 1CUKA 2IHEA 3PGZA 4DR6Q 3KLSA 1A2UA 1EQTA 1VF7A 5FO9B 3K7UC 4FF3A 4QCLA 1QJOA 3HG9A 3NWSA 3VYTA 3J81c 1PRTC 1HHVA 1M4VA 2PZWA 1FJGQ 5FKAC 4JI6Q 4E6IA 2HDLA 4GS3A 4IJHA 1EY9A 1EL0A 2D5DA 3WOEA 5C6AA 3TRZA 1HQMC 3ERQA 1GXDC 4ZKCB 3GTKB 1PTOB 5C3EH 1DOKA 2IT1A 3C1FA 1UEAB 2PMZE 1VQ6A 1EWCA 4A3FG 1SJHD 4LJZC 3VR6A 4JCVE 2F4VL 4IPGA 2C9OA 1MJEA 2B2YC 1I6HB 5J39A 3M9BA 2KHIA 4M8AA 4A3MB 2M2LA 3R2TA 4PQXA 3DLLA 3IL8A 1JOKA 1PYBA 4A3IH 3HOVH 2R93G 3F2UA 1I50H 2F0PA 1WYDA 1FVIA 3AYHB 2EYHA 1RDPD 2JA7H 2EJMA 1VQNA 1VQ7A 4DR1L 2P5ZX 2F03A 1WD0A 2JA6G 3S1RH 5JVH3 4DN4M 1VQMA 1NR2A 2L4NA 1L1OC 2CVRA 2QKIC 4A3LG 1MJCA 2HUGA 3FVQA 2F0LA 3HOYG 3T1YL 3VYRA 1VQJA 4DV6Q 1VQ8A 2R92H 4AYBE 1S72A 1KDCA 3T51B 2RCFA 1BO0A 2JA8B 3S14B 2JE6I 5CR3A 2V1CC 3X3MA 3DEPA 1WCMG 4EQNA 3H91A 2F0QA 4Y7NH 2UXBL 1B9NA 4K5VA 3NBIA 3TP6A 4UDUC 2Q8RE 4B3MQ 1KL9A 2B2VC 3I55A 1EU3A 2JEAI 2F0FA 2AHOB 3U4VA 1LACA 1A0IA 1NMFA 4LUVA 4DAVA 5J22A 3ER0A 4YHHL 2NBFA 4C3JB 3CRLC 4PNYA 5M5XH 3J81E 3PO3G 4HAEA 1HTLD 2F3IA 3PCOB 2E74C 1G6ZA 2AUKA 4KY6A 3CW2C 1N8RC 1K8OA 1ESFA 3CCEA 4DNRB 1LYLA 3KLRA 1SNOA 3NTHA 1Y1VG 3CHBD 2VL6A 3IRBA 2VQFL 4X64Q 4OELB 3PF5A 4I7ZC 1JJGA 1VF5C 2NN6G 2E2JH 4FVMA 4YCUA 4ZUIA 3RN5A 1R4PB 1SMYC 5M3FB 2EY1A 1KNAA 1H9MA 3QOLA 2CWAA 1ICFB 1IYVA 1I4HA 4CJ0B 3S2DH 1JWUD 3KLWA 1E0BA 2F0VA 3PUXA 5JEAH 2HHHQ 3A8IE 2LXKA 4IPDA 4CHTB 1K3RA 2PO4A 4FXKC 3OSOA 5C44H 3EQLC 1J6QA 1YEZA 2G9HD 5IGFA 4C3HG 2I5LX 4KI0A 2I0QA 2BE5C 2B2YA 1PRTB 4OIKA 4PMCA 3ZJYC 1PVOA 2EJFC 3N52A 2EJGC 3TSSA 1CTMA 1WTQA 4KD3A 4LK1C 3TN2A 4JI8L 2PCFB 4DR2Q 2Z0SA 3PQIA 1IBLQ 2F4IA 4F8MA 4OO1I 1S5CD 4YCVA 3S1QH 1VQEA 4B3TQ 1JJCB 3FKIB 4XT1B 5F2DA 2B2TC 1QUQA 4BY7G 1TS4A 4IUNA 4HIKA 3EIVA 2WB1B 4PV1C 4CJ2C 4BXXG 3GTMH 2MO0A 1L1OA 5C0XI 1RKNA 4BY1H 4DF7A 5I2YA 5C3WA 3U4ZA 4R4CA 3P20A 1TWCH 1HH2P 4HIMA 1JORA 3K0YA 1Z6HA 3BZCA 1JB3A 4WJWA 3HEJA 1Q8KA 2LY7A 1Q1BA 3G6EA 3UE0A 2WP8J 3DWAA 3TBIB 1QUQB 3FHWA 4A3JH 2EY2A 2ES2A 1FD7D 2D62A 2SNMA 3TMEA 2N8NA 2HCCA 4M1UB 1VQ9A 2ZM6L 5A35A 4DV0Q 2Z4IA 4QGUA 4NW2A 3I4NG 2PZUA 3I4MB 3PO2B 1Y8OB 1NSNS 5LMNW 2B2VA 2IJ0A 4GN5A 3S1MH 3CCMA 4IO9A 5CV5A 2EXZA 5IP9H 5H1SE 3UI2A 3PIP3 4A3EB 4OWTB 5K36H 2R93B 4IFDG 5IWAQ 2OXPA 1A3TA 4DXFA 4A3GH 1MKHA 1O7LA 2AQ3B 4OONA 4LF7Q 4G57A 1F9QA 3Q23A 4DK0A 3D3RA 5M5YH 4JI7Q 2D2CC 2RBMA 2E2IH 2JA6B 2FJ2A 1DGSA 1CHPD 2EOTA 3OWEB 1I50B 4DR7L 2B2UC 5G3LF 3A5ZB 3M7GA 4XXEA 4QB4A 2PPBC 4JI0L 1VQ4A 3HOYB 4LF4Q 4QJFA 3SK8A 1B3QA 3Q24A 1EYCA 1IZ6A 2DJGC 4DV2L 2XWJB 4QIWB 2XWBB 3SVMA 1WTWA 2IY5B 2AWOA 4LF8Q 2KHJA 3E3XA 1WTXA 4O0AA 2WKCA 2UUAL 1H9RA 4YY3L 3CC7A 1PZKD 1XTDA 2ICEC 4GKKQ 4QY7A 4JYAQ 1S40A 2JA5B 3SDZA 1B3AA 4J15A 1XWEA 2ATWA 4P75A 2WB1E 2R92B 4A93G 3CQZH 1D2BA 2KVMA 3LWEA 4JI2Q 2H5XA 2D0PA 2FINB 1IBKQ 1EQQA 1YVCA 4JOIC 5BR8Q 5C4HA 3I90A 2F0UA 3T1HL 4A3CG 1ESRA 2QDBA 2KJXA 3H3VC 5IYCG 2A6ED 2OEOA 1XPOA 1II3A 2AKWB 2X6LA 4B3SL 2B2TA 2IX3A 1HA5A 3TS0A 5GAEC 3S1NB 2CHBD 2L1BA 1Y1VB 3QB3A 1I4XA 3N6RA 1VQDA 2F0IA 1N9WA 1EOVA 2RDGA 3TP5A 4TSSA 5T1IA 1JOOA 2F52A 1VMCA 4KLKA 4BBSB 4IPCA 2JN4A 3MAQA 5I4DA 1HPCA 4HJ5A 1JOQA 3HP3A 4YWKA 4JI3L 1PXUA 3NHHA 3MXUA 2F0MA 2NYZD 5CBAE 2A69D 4J8QA 2E2JB 3AEVA 1AN8A 1S3OA 2NZOA 4B3RQ 2F0SA 4WJ4A 4JI1L 5GAGC 2Q2TA 5K5PA 4XQJA 2A8VA 4BBRH 3Q6SA 1EU4A 3RNUA 2DY7A 4UHVA 1HFNA 2IX0A 2K33A 1GOZA 4HJ7A 1V1PA 3ULLA 5J1ZA 5M5WB 5D3IB 4NXNL 4R4OA 2E5LL 1TQOA 5EBCA 3OMGA 4DFAA 4QIWE 2PQAA 3S17B 1YJNA 2HIVA 1NMGA 3K5NA 5IY0A 1B53A 1Y8PB 4LF5Q 1IKMA 4CKCA 1DZ1A 2L15A 3K7AB 4N9TA 1TWHH 2EYLA 2NTTA 3M4PA 2BDNA 2IX1A 2B2UA 3K8AA 4JW0A 1ZKOA 2BDOA 4QMGA 4UP9A 3K58A 1XTCD 2CH4A 4IUVA 1U4MA 1IBML 1TWFB 1H9SA 2PQAB 2JK8A 1XNQL 2VQEL 1BKBA 4KV6A 3OYYA 1X3QA 2R7ZG 1AH9A 3FEWX 1JCKB 5DM63 1A15A 5FLXL 1PHJA 4K0KL 3E0EA 1FYCA 1LTSD 4IZ8A 5COYA 4A3MG 4DR4Q 3RZDH 3GP7A 1HNZQ 4WRDA 4I65A 1H9SB 2LKVA 3I8ZA 4N8FA 1BCPD 4Q0FA 3CKIB 5IYDG 1HNWQ 1B4OA 1CQFA 3RUZA 3ULJA 1A62A 3E9HA 3L7ZC 1AEXA 1EIGA 2LFNA 1TWAB 2HQEA 1LTID 1RIPA 2B63H 1D8LA 1STEA 3S1MB 1GHJA 3EVQA 1N34L 1PTOC 4P71A 4CDFC 4CBVA 1JMCA 3SK6A 4A3BG 1M8AA 2B2WC 2M00A 2QCPX 5KNCA 2NVXB 2YV5A 3KFUA 3H09A 4H7BA 1BQQT 4JBWA 2F0OA 3L3OC 4DR1Q 3NK9A 1BCPB 4G7HC 1EIYB 4IFDJ 2QW7A 3K5LA 1WD1A 3FPUB 3DEOA
chains in the Genus database with same CATH topology
3NTKA 3MC0B 4KKTA 1F9PA 4CKBA 2V4DA 1MBYA 1PZJD 3L9AX 3DWPA 4WFN3 4A93B 2F0EA 3SE0A 4C3JG 3D4WA 2XIWA 2ZXPA 4L8JA 1FR3A 4ULLA 1SYBA 1K83B 1HFGA 1E2WA 5FLXE 3DHQA 2IW3A 2BA0A 3R93A 1CZGA 1EY0A 2L12A 2DY8A 3K6OA 2EZVA 4OO1H 4EQOA 2J4XA 1T5XD 4F87A 3I91A 1TWGB 1W6JA 4KHVA 5KYIA 4BA1I 1BOSA 1W6KA 2K5WA 2ENBA 4X3UA 1EY7A 3AB9A 5LL6X 3I3CA 1PDQA 1EFID 5EGTA 3Q0AA 2I07B 3K57A 3D6CA 4HN7A 2E76C 1F2MA 3QWNA 1G91A 2WV6D 4LAAA 4KHZA 3T4AC 4OIJA 2AUJD 1Z7TA 2B2WA 2AQ2B 4B08A 1SNPA 2KCCA 1SSOA 1JICA 1DYQA 5C4ZA 3NWTA 4C1NK 3G7LA 2RKSA 5G3LD 4KK7A 1G2TA 4FF2A 3J81L 5DM73 2K1BA 2R7ZB 1BXTA 4ZUJA 2RDFA 4HEDA 3OMCA 4U673 1HRJA 4HCSA 3W2DA 4YIJA 2MUYA 2F0DA 4V190 1R9TB 3VYUA 4RH6A 5C5MA 4O1NA 1RF2D 2JYOA 4OL7A 2TSSA 1OXXK 1OO9B 3FDTA 4XDXA 1I3QB 3VR3A 3RZDB 2KOLA 3EFXD 4A3BB 1STYA 5JPMC 1DONA 3KF8A 3PUZA 5CC4A 1X3PA 2PW5A 3GTPB 5A2QL 3H0GB 3M3YB 4C2MB 5T1GA 3M4OB 2ICIA 2WIIB 4KJOA 1EZ6A 1BCPF 1EQVA 3RD4A 3D4DA 4ZKBB 3NE5B 4F88A 1KDAA 3A8KE 2TMPA 5IGEA 2KHSA 5JOBA 3SEBA 5KGUA 1DOMA 4RCNA 1RCVD 5LHY1 1SFOB 2NVYB 3HOWB 1AZPA 3P1HA 3I4LA 2LMCB 5IGDA 4RAUC 1IW7D 5EQ0A 4F7XA 1SJED 2NN6H 1TY2A 4ODGA 3SK4A 1XXGA 5C4JB 2L55A 3D8GA 3TZDA 1FGBD 4FO2A 3SHLA 1F2LA 3NSWA 3D4RA 5I6WA 3MVVA 1EYDA 2F0NA 1ENAA 4KKUA 3K5OA 5JEAG 4K6LA 5I6YA 5A2QE 1FNWA 1TKWB 2EYPA 4XQNA 3A55A 3G6JB 4DA2A 1FNVA 3HS0C 1S5BD 3S9WA 1LTTD 4KD4A 2XVSA 2A6EC 1XX8A 4A3KB 5ELEA 2R61A 1RJTA 1SYCA 2XRQD 4JK1C 1G291 5C0XJ 3OIQA 1GUNA 5ELDA 1Y69U 5ELCA 1STHA 2Z8LA 4RGTA 4MIUA 1OXUA 5DNFA 4FF4A 4B9XA 1KNEA 2A69C 1DM0B 2XRSD 5BN3A 3DMUA 2VUMB 4ZLTF 3H6MA 1AFPA 4G7ZC 1HUMA 5C3EB 2VB3X 1C48A 1I4RA 4ME5A 1D5ZC 5IT9E 2EE1A 4XYQA 1Q8IA 1ET6A 1U9RA 2EYOA 3C46A 1Z47A 2K6AA 1QILA 5K36G 4A3IB 3HOVB 3MWYW 4XQQA 5DEHA 2A5HA 2BA1A 4FNFA 2JA7B 3OPOA 1ZYRD 1BBXC 1SYDA 1Q1EA 2BOSA 1ML0D 2KUMA 1QNUA 3MTSA 3S1RB 5IOCA 4XT3B 4K2KA 1STNA 5CV6A 2X69A 3P7JA 3V2TA 1EY5A 4TQUS 1LT6D 1SNCA 3TDQA 3E0JA 3A56A 1EEFD 5KEEA 1D5XC 1TY0A 5HGTA 2A68D 3AU7A 2F3WA 3VA7A 1DD2A 3FMCA 4KY5A 4X3TA 4DGZA 4Y7NB 3NXWA 1BCPC 1D5MC 1TS3A 2ZXRA 5BN4A 5E1FA 1CA6A 3EROA 2KEEA 2B39A 1CT1D 3P75A 5M5XB 3W3AA 4TRDA 2PNRC 4K6DA 3MEHA 1YNJD 1LABA 2F0KA 1LV9A 3IAYA 2RDHA 3LX0A 1J8IA 1I4PA 3KUPA 1J9OA 3MZ5A 4ILWA 1EY6A 1LT4D 5FK9C 3K5MA 1AP0A 2A6HD 4RCOA 3S2DB 5EKIA 4CGYB 5EKLA 1BR9A 1STAA 1LO5D 3NTIA 3Q22A 5C44B 4ZQ3A 2NN6I 1WTRA 1VCIA 4DU9A 1K8MA 1CQVA 3A7AB 2AQ1B 3NUCA 5JEAJ 1QG7A 3S1QB 1F9RA 2B8GA 2O2LD 3M85A 1QOHA 1RTNA 3GTMB 4BY1B 1TIID 3HZXA 3MFGA 1SEBD 3T16A 3X3NA 1TWCB 4WORA 1PTOH 2CQAA 2RA4A 3R2IA 1DJRD 1U4RA 3U9SA 3KBXA 3T13A 1GUWA 2IPKD 2EYMA 4K2LA 4MN3A 4A3JB 5CGKA 1B2TA 2JEBI 4NMZA 2Y0SB 4DXGA 4CJ1B 2WAQB 1IYUA 4IUQA 3OIPA 4G4KA 1JQYD 1EEID 2C5CA 2F3VA 2FMCA 2OT2A 3HGBA 5E4WC 4A3GB 3VR5A 1F9SA 3GO5A 3JAME 1S5DD 1Q12A 5EPLA 5EKKA 2J0TD 5KIXA 5M5YB 1ET9A 1NR4A 2E2IB 2B8FA 3BYTB 5FO8B 2K01A 3C2PA 5EPKA 2SDFA 3GTJB 4NKLA 3R8BA 3I70A 1CK1A 1OXTA 2ZT9C 3M7NA 4KY7A 4R9WA 1QB5D 4RFBA 3HKZB 4BS9A 3GQBA 3J80L 3CU7A 4RGOS 1ZEQX 4DNTB 4FYDA 1SE3A 2E75C 3PUYA 1EWHA 1TT2A 5NUCA 1KABA 3CQZB 2NTSA 3IFDA 4V0BA 1HTPA 2KECA 3NQTA 1KDBA 3ONAB 1A3UA 1ENFA 4IUPA 2MP1A 1DXMA 2DN8A 1V8QA 1B44D 3MXGA 2Q8IB 1LTRD 3V96A 1YNND 1CZWA 1WVLA 3VA5A 3NPPA 5CV7A 4RHRA 1QWYA 1JE4A 4FXDA 5C4XB 2EY5A 5DAUA 3QG1A 2F0HA 4OO1G 4U68A 3KK7A 3BVZA 5EBDA 1PFMA 5C0XG 3I73A 3V05A 4XYOA 5TSSA 3I72A 1D1KA 4HSVA 4K8IA 3J7YW 2G9DA 1A2TA 2FFKB 1TR5A 2A74C 2MHVA 2K7VA 1IKLA 4BA2I 1O80A 4BBRB 1KTKA 4S3SA 3BDOA 5ISRA 2L5TA 4AYBB 1QCBD 3J80E 4IALA 2O4XA 3C1EA 3PV0A 4L63B 2YYZA 3J7AF 2F0GA 5KRUA 1IW7C 1O7ZA 1SAPA 2K5DA 1S5ED 4ZAIA 2HCIA 4XIGS 4QUFA 3DUZA 5JAVA 1TWHB 1T5EA 4KJNA 1LLRD 2AWNA 4KN7C 1HA6A 3TP7A 3O13A 2J7ZA 4RHSA 4CKEA 2A73B 2Z1CA 3VR4A 5CMDA 2XSCA 4DAPA 5KYLA 1CM9A 1E2VA 2I46A 2PW7A 3RMHA 2JXMB 2N55A 4ZK9B 3A8JE 4H13C 2JP1A 3MXNA 1SNDA 5JPNC 1U4LA 2CW0D 3A7LA 2XN9C 1SDFA 5CORA 4NP5A 1GUTA 4J1MA 1KLGD 1L0YB 1GJXA 3M4YA 5IIFA 3ND9A 1SYGA 1Q90A 4PMBA 1KAAA 2WKDA 2B63B 3C3LA 5IGCA 1ONLA 1MI2A 1SYEA 2EYJA 1JWMD 3BVGA 1F2ZA 2FHTA 1V43A 2IL8A 5D14A 1SE2A 4RKBA 1ZXTA 4NDXA 3BS1A 1A3VA 1Y1WB 3BVMA 1QE6A 2XNAC 3TZUA 4HR7B 1EYAA 4C1NI 3HOXB 1DOLA 2JSOA 1PFBA 1KLUD 1EIHA 2O5IC 3BG3A 1ZYRC 3HOZB 1LTGD 3HOUB 1B9MA 2EVBA 5AFWA 4H0LC 5IT9L 1LTAD 3OW7A 1PRTD 4B9WA 1AZQA 1JWSD 2L11A 1F2YA 1G8ZD 5CV8A 2A68C 3BYYB 5E4XA 5D65A 2SEBD 2N88A 5M3MB 2WACA 3QJYA 1X32A 1AW7A 1D1IA 1JR0D 4RGNA 4K5XA 1BF4A 2LS01 1TS5A 1O78A 5C5LA 3EJIA 1Y8NB 3QIAA 1SXTA 4K5WA 3WOFA 4H44C 4C3IG 1YNJC 1EY4A 2KEDA 2NVQB 3CRKC 2MJ8A 3GV3A 1UNSA 1XYIA 2M9VA 1A6XA 5CYUA 3OWFA 1STBA 3SR1A 1U4PA 4TKOB 4RKLA 1HUNA 2A6HC 1NAPA 3EA6A 1FNUA 4N9PA 2E2HB 4IUTA 1ILPA 4MHEA 3SK5A 4IFDH 1EZ8A 4A3FB 5IGGA 1GUSA 2R3ZA 1TVXA 4K14A 1O7YA 1TS2A 1PTOF 5CV4A 4EVOA 2KCNA 3MXPA 3MHBA 3K59A 1ICWA 1UAPA 4G7OC 3VYSA 3PIO3 1GUGA 3BDCA 5FO7B 3TP8A 1SNQA 2NZ1D 3HRZC 1EY8A 1S4ZA 4QUCA 1UUPA 1NCVA 3KBGA 3GTLB 5HURA 1RODA 2RVLA 2PYKA 2ID0A 1PZID 1SMYD 2KA7A 3QOJA 2H4OA 1H9JA 3PMFA 5FOBB 4C56C 4IURA 3FRPB 1PFNA 3E6ZX 2E2DC 1HCZA 1I4GA 3OHXC 5IGBA 3A54A 1WCMB 2F0TA 2BE5D 1QNKA 5CBEE 3DM1A 2VXWA 5ELBA 1RD9D 3NP8A 2YU9B 1VMPA 5KNBA 4GZYC 4HTHA 4KKSA 4KTAA 4OHJA 5JJZA 1LT3D 5ELFA 3PO3B 4P2CB 4R8IA 3J7AV 4EGVA 4LMQD 2EY6A 3RZOB 3NBHA 2RQXA 4L6TB 1LTBD 1E2ZA 1VDZA 2NWGA 4UAIA 1LT5D 2Q8TA 2K28A 2IWHA 3T56B 4PMWA 2R6GA 2F0JA 4IUUA 1G2SA 2PZTA 1PMRA 3IFTA 3JAML 1L0XB 3LNNA 1NUCA 5D3DA 1BNZA 1ILQA 4RWSC 2NVTB 2DNEA 1JC7A 5IODA 4DK1A 3IKJA 1HXYD 4C3HB 3NQIA 1SBBB 2K32A 2L9HA 4RA8A 4ZRZA 1I4QA 1OXVA 4FXGC 4BWGB 1MSHA 2DNCA 3GTGB 3MFYA 1IL8A 1PRTF 2L0CA 2QILA 3AMUA 1CA5A 1STGA 4BY7B 4C3IB 1YNNC 4J6HA 1SYFA 1B50A 4XTCS 1WTPA 4R8NA 1V1PB 4KN4C 2SNSA 4FP5D 3S15B 3R3OA 3WDNA 3U9OA 1IHZA 4X3KA 4O42A 2D9UA 4IQZA 1D6EC 2EYFA 2OF1A 3S2HB 1R4QB 4HCEA 2Z4HA 2F0WA 3I4NB 4Q5VA 4X3SA 1TU2B 2K03A 4ZYSA 3MA2B 2KQ3A 1BUVT 3DWQA 2QF7A 3S16B 1C8CA 2RSOA 1PLFA 2NB0A 3FPPA 5E3FA 5EJWA 1GHKA 3ND8A 3URYA 1GUOA 1B1ZA 2QEJC 1Q3LA 4OGQC 1SNMA 3DXJC 4IFDI 1C4QA 2NUCA 2EDGA 5I9PA 3GTOB 2VNUD 3KLSX 3ITPA 4Z9CB 2VB2X 3H94A 2MPMA 4HSPA 2WINB 1MSGA 3GTQB 5LL6S 2FMMA 1S5FD 4QF4A 3LWUA 5JVG3 4ABNA 4HMIA 2SOBA 3OOCA 5M9OA 3SXHA 1DCZA 2CW0C 2EPBA 1F77A 3RLFA 1I6VC 2BCOA 2F1MA 4A3DB 3BZDB 2PMZB 1WTOA 1EOTA 1WTVA 1BDOA 2MGSA 1RTOA 2GA4B 1CHQD 4EQPA 5BN5A 3PUVA 1SE4A 1PYWD 3PUWA 1MD2D 3D6WA 3GD7A 4DAYA 2K04A 5I2XA 1CI3M 4HMJA 1RHPA 3T53B 4ID6A 3D31A 2O5JC 3E5SA 5C0XH 2K5QA 2RSNA 4KMUC 1ENCA 4K8JA 3ZYYX 5EPJA 1HQRD 2K05A 1OXSC 5KNDA 5C3XA 3QO2A 4FF1A 1CFMA 2HDMA 3GV6A 4RGMA 3BDLA 2X6GA 5I9OA 2H1EA 2PQEA 2ZXOA 3VR2A 1PTOD 4IN3A 1V1OA 1MGSA 1H9KA 5CV9A 3KLSA 1A2UA 1EQTA 1VF7A 5FO9B 4FF3A 4QCLA 1QJOA 3HG9A 3NWSA 3VYTA 1HHVA 1PRTC 1M4VA 2PZWA 5FKAC 4E6IA 2HDLA 1EY9A 1EL0A 2D5DA 3WOEA 5C6AA 1HQMC 3ERQA 1GXDC 4ZKCB 3GTKB 1PTOB 1DOKA 2IT1A 3C1FA 1UEAB 1EWCA 1SJHD 4LJZC 3VR6A 2C9OA 2B2YC 1I6HB 5J39A 4M8AA 4A3MB 2M2LA 3R2TA 4PQXA 3IL8A 1JOKA 3F2UA 2F0PA 2EYHA 1RDPD 2EJMA 2F03A 1WD0A 5JVH3 4DN4M 1NR2A 2L4NA 2CVRA 2QKIC 2HUGA 3FVQA 2F0LA 3VYRA 1KDCA 3T51B 1BO0A 2JA8B 3S14B 2JE6I 5CR3A 3X3MA 4EQNA 3DEPA 3H91A 2F0QA 1B9NA 4K5VA 3NBIA 3TP6A 4UDUC 2Q8RE 2B2VC 1EU3A 2JEAI 2F0FA 1LACA 4DAVA 5J22A 2NBFA 4C3JB 3CRLC 4PNYA 3J81E 4HAEA 1HTLD 2E74C 1G6ZA 2AUKA 4KY6A 1K8OA 1ESFA 4DNRB 3KLRA 1SNOA 3NTHA 3CHBD 4I7ZC 1VF5C 2NN6G 4FVMA 4ZUIA 1R4PB 1SMYC 5M3FB 2EY1A 1KNAA 1H9MA 3QOLA 1IYVA 1I4HA 4CJ0B 1JWUD 1E0BA 2F0VA 3PUXA 5JEAH 3A8IE 4CHTB 2PO4A 4FXKC 3OSOA 3EQLC 2G9HD 5IGFA 4C3HG 4KI0A 2BE5C 2B2YA 1PRTB 4OIKA 4PMCA 2EJFC 3N52A 2EJGC 3TSSA 1CTMA 1WTQA 4KD3A 4LK1C 3TN2A 2PCFB 2F4IA 4F8MA 4OO1I 1S5CD 3FKIB 4XT1B 5F2DA 2B2TC 1TS4A 4IUNA 2WB1B 4PV1C 4CJ2C 5C0XI 1RKNA 4DF7A 5I2YA 5C3WA 3P20A 1JORA 3K0YA 1Z6HA 4WJWA 1JB3A 3HEJA 2LY7A 1Q1BA 2WP8J 3DWAA 3TBIB 2EY2A 1FD7D 2D62A 2SNMA 3TMEA 4M1UB 2HCCA 5A35A 2Z4IA 4NW2A 2PZUA 3I4MB 3PO2B 1Y8OB 1NSNS 2B2VA 2IJ0A 5CV5A 2EXZA 3UI2A 3PIP3 4A3EB 5K36H 2R93B 4IFDG 2OXPA 1A3TA 4DXFA 1O7LA 2AQ3B 4G57A 1F9QA 3Q23A 4DK0A 3D3RA 2D2CC 2RBMA 2JA6B 2FJ2A 1CHPD 2EOTA 3OWEB 1I50B 2B2UC 5G3LF 3M7GA 4XXEA 4QB4A 2PPBC 3HOYB 3SK8A 3Q24A 1EYCA 2XWJB 4QIWB 2XWBB 3SVMA 1WTWA 2AWOA 1WTXA 2WKCA 1H9RA 1PZKD 2ICEC 2JA5B 3SDZA 1B3AA 1XWEA 2R92B 1D2BA 2KVMA 3LWEA 2FINB 5C4HA 3I90A 2F0UA 1ESRA 2QDBA 2KJXA 3H3VC 2A6ED 2OEOA 1II3A 2X6LA 2B2TA 2IX3A 1HA5A 3S1NB 2CHBD 2L1BA 1Y1VB 3QB3A 1I4XA 3N6RA 2F0IA 2RDGA 3TP5A 4TSSA 5T1IA 1JOOA 1VMCA 4BBSB 3MAQA 5I4DA 1HPCA 1JOQA 3HP3A 1PXUA 3NHHA 3MXUA 2F0MA 2NYZD 5CBAE 2A69D 4J8QA 2E2JB 1AN8A 2F0SA 5K5PA 4XQJA 3Q6SA 1EU4A 2DY7A 1HFNA 2IX0A 2K33A 1GOZA 1V1PA 5J1ZA 5M5WB 5D3IB 1TQOA 5EBCA 3OMGA 4DFAA 3S17B 3K5NA 1B53A 1Y8PB 1IKMA 4CKCA 1DZ1A 3K7AB 4N9TA 2EYLA 2NTTA 2BDNA 2IX1A 2B2UA 1ZKOA 2BDOA 4QMGA 3K58A 1XTCD 4IUVA 1U4MA 1TWFB 1H9SA 4KV6A 1X3QA 3FEWX 1JCKB 5DM63 1A15A 5FLXL 1FYCA 1LTSD 4IZ8A 5COYA 3GP7A 4WRDA 4I65A 1H9SB 2LKVA 3I8ZA 1BCPD 4Q0FA 3CKIB 1B4OA 1CQFA 3RUZA 3L7ZC 1AEXA 1EIGA 2LFNA 1TWAB 2HQEA 1LTID 3S1MB 1STEA 1GHJA 3EVQA 1PTOC 4CBVA 3SK6A 1M8AA 2B2WC 2M00A 2QCPX 5KNCA 2NVXB 3H09A 4H7BA 1BQQT 4JBWA 2F0OA 3L3OC 1BCPB 3NK9A 4G7HC 4IFDJ 3K5LA 1WD1A 3FPUB 3DEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYE A;  4K6D A;  3MEH A;  2EY1 A;  5C5L A;  2RBM A;  1SYF A;  2KHS A;  3QOL A;  4J6H A;  5JOB A;  4R8N A;  5IGB A;  3EJI A;  2F0K A;  2F0T A;  2EYJ A;  5J39 A;  1SNP A;  5KGU A;  2F3V A;  3DMU A;  5C4Z A;  3LX0 A;  2F0V A;  2SNS A;  5J1Z A;  3H6M A;  4K8I A;  1JOK A;  1A2T A;  3NP8 A;  4K5W A;  1TR5 A;  3R3O A;  1TQO A;  2F0P A;  3U9O A;  4QB4 A;  2RKS A;  3OMG A;  4DFA A;  1F2Z A;  1IHZ A;  4EQP A;  3SK8 A;  3OSO A;  3P1H A;  4ME5 A;  5EKK A;  2EYH A;  5IGD A;  1EY4 A;  1EYC A;  3MZ5 A;  5KIX A;  1EY6 A;  5IGF A;  2EYF A;  2F0E A;  2OF1 A;  4HTH A;  4KTA A;  4N9T A;  4NDX A;  4RKB A;  4F7X A;  2EYL A;  1A3V A;  3D4W A;  4PMC A;  4S3S A;  4ZUJ A;  2RDF A;  1U9R A;  5ISR A;  3OMC A;  2EYO A;  4HMJ A;  4ODG A;  2F0W A;  3SK4 A;  1SYB A;  4IAL A;  4NKL A;  4ID6 A;  4QMG A;  2O4X A;  3C1E A;  4KD3 A;  5EKL A;  1STA A;  3OWF A;  1STB A;  3E5S A;  4YIJ A;  5DEH A;  3SR1 A;  2F0G A;  2F0D A;  5KRU A;  2EY6 A;  4KY7 A;  2F0L A;  4F8M A;  4ZQ3 A;  4RKL A;  3DHQ A;  5C5M A;  2KQ3 A;  1EYA A;  3D8G A;  5C6A A;  1ENC A;  4K8J A;  5JAV A;  1SYD A;  4OL7 A;  4KV6 A;  1EY0 A;  5F2D A;  4N9P A;  4KJN A;  4DU9 A;  4IUN A;  3SHL A;  3SK5 A;  5I6W A;  5IOC A;  1KDC A;  5E3F A;  1EZ8 A;  3MVV A;  2F0J A;  1RKN A;  4K2K A;  1EYD A;  2F0N A;  4DF7 A;  5C4H A;  5C3X A;  1ENA A;  5C3W A;  5IGG A;  1STN A;  2F0U A;  4EQO A;  5CV6 A;  5CR3 A;  3TP7 A;  2QDB A;  3V2T A;  4EQN A;  5I6Y A;  2PZT A;  1EY5 A;  2F0Q A;  1SNC A;  3NUC A;  4IZ8 A;  2OEO A;  4K14 A;  1SNM A;  4K5V A;  1JOR A;  1TT2 A;  5NUC A;  1II3 A;  2EYP A;  3TP6 A;  1NUC A;  1KAB A;  4WRD A;  3HEJ A;  5CV4 A;  4EVO A;  3BDL A;  5KEE A;  4I65 A;  5I9O A;  1STY A;  5HGT A;  2LKV A;  2PQE A;  2NUC A;  3MXP A;  3MHB A;  2F3W A;  5CC4 A;  3S9W A;  5I9P A;  3QB3 A;  2F0F A;  4KHV A;  4KY5 A;  2PW5 A;  5KYI A;  4KD4 A;  3NQT A;  4B9W A;  1KDB A;  3BDC A;  3RUZ A;  5IOD A;  5CV9 A;  2F0I A;  2EY2 A;  3HZX A;  3ITP A;  3TP5 A;  3TP8 A;  5J22 A;  1SNQ A;  2SNM A;  1AEX A;  3TME A;  4DGZ A;  5KYL A;  1A2U A;  1A3U A;  2ENB A;  2HQE A;  1EY8 A;  2PW7 A;  3NXW A;  3T16 A;  4WOR A;  4PNY A;  1JOO A;  1F2Y A;  5CV8 A;  3EVQ A;  1SYC A;  2PZU A;  1NSN S;  1EY7 A;  5HUR A;  1JOQ A;  2PZW A;  1SND A;  3NHH A;  2PYK A;  4KY6 A;  4QF4 A;  5EGT A;  5CV5 A;  3SK6 A;  3T13 A;  2EXZ A;  2F0M A;  4NP5 A;  4KJO A;  3VA5 A;  1EZ6 A;  2WAC A;  3D6C A;  4E6I A;  1EQV A;  2EYM A;  2M00 A;  4J1M A;  4K2L A;  1F2M A;  1SNO A;  5CV7 A;  5E1F A;  5CGK A;  3ERO A;  1EY9 A;  4HMI A;  5IIF A;  4NMZ A;  2EY5 A;  2SOB A;  1STH A;  3D4D A;  3QOJ A;  5DAU A;  2OXP A;  1SYG A;  1A3T A;  2F0S A;  1STG A;  4H7B A;  4K5X A;  3ERQ A;  2F0H A;  3PMF A;  4LAA A;  4MIU A;  2F0O A;  4PMB A;  5M9O A;  1KAA A;  3NK9 A;  5K5P A;  3P75 A;  3C1F A;  3SXH A;  5IGC A;  1KDA A;  4B9X A;  4G57 A;  4ZUI A;  5IGE A;  4TRD A; 
#chains in the Genus database with same CATH topology
 4ME3 A;  3NTK A;  3MC0 B;  1Y1W H;  1SRU A;  4KKT A;  4LFB Q;  1F9P A;  4CKB A;  1WTH A;  2V4D A;  1MBY A;  1PZJ D;  1UEB A;  3L9A X;  3DWP A;  4WFN 3;  4A4I A;  4A93 B;  2E8G A;  2F0E A;  1GKH A;  3SE0 A;  3HOX H;  4C3J G;  2R7F A;  3D4W A;  2XIW A;  3PIO A;  2ZXP A;  4L8J A;  1FR3 A;  4IOC A;  4ULL A;  2UXB Q;  1SYB A;  1K83 B;  1HFG A;  3CCU A;  1K0R A;  1E2W A;  3HOZ H;  1B7Y B;  5FLX E;  3H15 A;  3HOW G;  3DHQ A;  1C0A A;  2IW3 A;  2BA0 A;  3R93 A;  1CZG A;  1EY0 A;  1UE7 A;  2L12 A;  4L5Q A;  5C4J H;  2DY8 A;  3K6O A;  2EZV A;  1CKO A;  4H02 A;  3RR5 A;  5M3F G;  3K81 C;  4OO1 H;  4EQO A;  2YTX A;  2J4X A;  4JI4 L;  4JBM A;  4CDC C;  1N33 L;  1AE2 A;  1T5X D;  1YHA A;  4F87 A;  3I91 A;  1M1K C;  1TWG B;  1W6J A;  2VQF Q;  4KHV A;  5KYI A;  4BA1 I;  4X62 L;  1G6P A;  1BOS A;  1W6K A;  2K5W A;  2ENB A;  4X3U A;  1QZH A;  1K28 A;  3SGI A;  1EY7 A;  3AB9 A;  5LL6 X;  3RN2 A;  3I3C A;  1PDQ A;  1EFI D;  5EGT A;  4DV7 L;  3Q0A A;  2I07 B;  3K57 A;  3D6C A;  4HN7 A;  2E76 C;  1F2M A;  4DR5 L;  3WWV A;  3QWN A;  3CC4 A;  1G91 A;  2WV6 D;  3FKI G;  4LAA A;  2KBN A;  5IP7 H;  4KHZ A;  4R4Q A;  2Z6B A;  2VS1 A;  1P16 A;  3T4A C;  4OIJ A;  2AUJ D;  4A3K G;  1Z7T A;  1YZ6 A;  1LUZ A;  2NVQ H;  4A76 A;  2B2W A;  2AQ2 B;  4B08 A;  4JI8 Q;  1SNP A;  2KCC A;  1SSO A;  1JIC A;  1DYQ A;  5C4Z A;  1WJJ A;  3NWT A;  3A5U A;  4KHP L;  4C1N K;  3G7L A;  2RKS A;  5G3L D;  2VUM H;  4KK7 A;  5HGQ A;  1G2T A;  4FF2 A;  4JOI A;  3J81 L;  5DM7 3;  2K1B A;  1VQP A;  2E2H H;  2R7Z B;  4X65 L;  1BXT A;  4ZUJ A;  2RDF A;  4HED A;  3OMC A;  1XJV A;  3I4M G;  3PO2 G;  4U67 3;  1HRJ A;  1L0W A;  4OXP A;  1VQI A;  4HCS A;  3W2D A;  1XPU A;  4YIJ A;  2MUY A;  2F0D A;  4V19 0;  1R9T B;  4A3E G;  3VYU A;  4RH6 A;  5C3E G;  4GKJ L;  5C5M A;  4O1N A;  3AQQ A;  1RF2 D;  2JYO A;  3CCJ A;  4OL7 A;  1YJW A;  2TSS A;  1LTL A;  1OXX K;  2K50 A;  1OO9 B;  3FDT A;  2ZM6 Q;  4L5T A;  4XDX A;  1I3Q B;  3VR3 A;  5AJ3 L;  3RZD B;  2KOL A;  4A3I G;  3HOV G;  2LSS A;  4LNQ A;  1A63 A;  3GTL H;  4JI5 L;  3EFX D;  5HY6 A;  4A3B B;  1STY A;  5JPM C;  1DON A;  3KF8 A;  3PUZ A;  5CC4 A;  2QA4 A;  1X3P A;  2PW5 A;  3GTP B;  1UE1 A;  2EXD A;  1HZ9 A;  5A2Q L;  3H0G B;  2G5D A;  4L5R C;  3M3Y B;  3MXN B;  4C2M B;  4HJ8 A;  4DR7 Q;  5T1G A;  3M4O B;  4DPG A;  2ICI A;  3UDX A;  2WII B;  4KJO A;  1EZ6 A;  3EBE A;  2JA5 G;  1BCP F;  1EQV A;  3KF8 B;  3I4O A;  2R92 G;  3RD4 A;  5LMU Q;  3D4D A;  4ZKB B;  2YU9 H;  3NE5 B;  4F88 A;  2K75 A;  3G48 A;  1KDA A;  3A8K E;  4L5S A;  2TMP A;  5IGE A;  2KHS A;  5JOB A;  2KCM A;  1PH2 A;  4DV3 L;  2UUA Q;  3SEB A;  4YY3 Q;  4LF6 Q;  5KGU A;  1DOM A;  4RCN A;  1RCV D;  3BJU A;  5LHY 1;  5GQO A;  1SFO B;  1KQS A;  2NVY B;  3HOW B;  1AZP A;  3RZO H;  1PH5 A;  3P1H A;  3I4L A;  1JE5 A;  2LMC B;  5IGD A;  4NXM L;  1VQK A;  4RAU C;  1IW7 D;  3CCS A;  5EQ0 A;  1B8A A;  4F7X A;  3T1H Q;  5IT9 c;  3J7Z C;  1SJE D;  1Q82 C;  2NN6 H;  4BBS G;  1TY2 A;  4ODG A;  3SK4 A;  1N36 L;  1XXG A;  2A19 A;  3JC6 6;  4B3S Q;  3OW2 A;  5C4J B;  2L55 A;  1TXY A;  5FLM G;  3D8G A;  3TZD A;  1FGB D;  2OQ0 A;  1KAW A;  4FO2 A;  3SHL A;  1F2L A;  2NVT H;  4X66 L;  3NSW A;  3D4R A;  5I6W A;  3MVV A;  1EYD A;  2F0N A;  1ENA A;  5GRO A;  4KKU A;  3K5O A;  5JEA G;  4K6L A;  4C3H H;  1QVG A;  5I6Y A;  5A2Q E;  1J5E L;  1FNW A;  1TKW B;  2EYP A;  4XQN A;  5C44 G;  1PH6 A;  3K80 C;  3A55 A;  3G6J B;  3S24 A;  4DA2 A;  1FNV A;  3HS0 C;  1S5B D;  2MFI A;  3S9W A;  1PH3 A;  3TEH B;  1LTT D;  3GTG H;  4KD4 A;  2XVS A;  2A6E C;  1XX8 A;  1X3G A;  2CWP A;  3F2B A;  4A3K B;  5ELE A;  4DR6 L;  4BY7 H;  4C3I H;  4DAM A;  2R61 A;  1RJT A;  1I94 L;  1SYC A;  2XRQ D;  4JK1 C;  1G29 1;  5EAY A;  1G51 A;  1PV4 A;  4OWW B;  5C0X J;  1K3B C;  1FJG L;  3OIQ A;  1GUN A;  4JI6 L;  2E5L Q;  1EUJ A;  5ELD A;  1X65 A;  1Y69 U;  1NNX A;  5ELC A;  4ZCK A;  1STH A;  2Z8L A;  4RGT A;  2XGT A;  4MIU A;  1OXU A;  1XNR L;  4LF9 L;  5DNF A;  4DV4 Q;  4B9X A;  4FF4 A;  1QVC A;  1Y14 B;  1QZG A;  1KNE A;  2A69 C;  1DM0 B;  2XRS D;  5BN3 A;  3DMU A;  2VUM B;  4ZLT F;  2K52 A;  3H6M A;  2DGY A;  1BBU A;  2Y0S G;  2VQE Q;  1AFP A;  2WAQ G;  4G7Z C;  1HUM A;  1VQG A;  5C3E B;  2VB3 X;  1C48 A;  1I4R A;  4ME5 A;  1D5Z C;  5IT9 E;  3CF5 A;  3S16 H;  2EE1 A;  4K0K Q;  4XYQ A;  1Q8I A;  1ET6 A;  1U9R A;  3NEL A;  2EYO A;  3C46 A;  1Z47 A;  1EWI A;  1QIL A;  2K6A A;  5K36 G;  4A3I B;  3HOV B;  3MWY W;  4XQQ A;  5DEH A;  2A5H A;  4A3G G;  2BA1 A;  3KF6 B;  3GTJ H;  4FNF A;  2JA7 B;  4GNX B;  3OPO A;  1ZYR D;  1BBX C;  1SYD A;  1Q1E A;  2BOS A;  1ML0 D;  4UP7 A;  3UE1 A;  3F2C A;  1Q86 C;  2XTI A;  1Q81 C;  2KUM A;  1QNU A;  3MTS A;  3S1R B;  5IOC A;  4XT3 B;  4K2K A;  1E24 A;  1STN A;  5CV6 A;  2X69 A;  3P7J A;  1N34 Q;  3V2T A;  3RLN A;  4DV1 L;  1EY5 A;  1LT6 D;  4TQU S;  1SNC A;  4GLA C;  3TDQ A;  3E0J A;  3A56 A;  1EEF D;  3AFQ A;  3GTQ H;  1D5X C;  5KEE A;  1PFS A;  2RHQ B;  1TY0 A;  3UDI A;  5HGT A;  4B3M L;  2A68 D;  3AU7 A;  2F3W A;  3HKZ G;  3VA7 A;  1DD2 A;  3FMC A;  4KY5 A;  3CCR A;  2UXC Q;  4X3T A;  2N49 A;  4DGZ A;  4LUZ A;  4Y7N B;  3NXW A;  3JAM i;  2ZTC A;  3I7F A;  2K4K A;  1BCP C;  1D5M C;  4A3D H;  1TS3 A;  2ZXR A;  5BN4 A;  1FL0 A;  5E1F A;  1CA6 A;  2RHS B;  4DUZ L;  3ERO A;  3OTO L;  1EQR A;  1VQ5 A;  2KEE A;  2C35 B;  1K9M C;  4X64 L;  4GLV B;  1K8G A;  2Z6K C;  4AQY Q;  4Y52 H;  5C4X H;  2B39 A;  3P75 A;  1CT1 D;  4DV5 L;  5M5X B;  2IHF A;  3W3A A;  4TRD A;  2PNR C;  1JB7 A;  4K6D A;  3MEH A;  1YNJ D;  2I5H A;  1LAB A;  2F0K A;  1LV9 A;  3IAY A;  1EFW A;  1UE5 A;  2RCN A;  2RDH A;  3LX0 A;  1J8I A;  2HHH L;  1I4P A;  3KUP A;  1J9O A;  2UUB L;  3MZ5 A;  4ILW A;  3JAM c;  1EY6 A;  1X55 A;  1LT4 D;  1UE6 A;  5FK9 C;  3K5M A;  2UU9 L;  1PH7 A;  1AP0 A;  2A6H D;  4RCO A;  3G4S A;  4JI4 Q;  3S2D B;  5EKI A;  3ERS X;  4CGY B;  1N33 Q;  1H95 A;  5EKL A;  1BR9 A;  1STA A;  2K5N A;  1VQL A;  1LO5 D;  1VQB A;  3NTI A;  4DR2 L;  1KC8 C;  3Q22 A;  5C44 B;  4ZQ3 A;  2JQO A;  4R1J A;  2NN6 I;  1WTR A;  1VCI A;  4X62 Q;  4OX9 Q;  4DU9 A;  1UWV A;  4DR3 Q;  1K8M A;  1CQV A;  2VZA A;  3A7A B;  2AQ1 B;  1E7Z A;  1PH1 A;  2CQO A;  3NUC A;  3J7A 5;  5JEA J;  1QG7 A;  3S1Q B;  1F9R A;  2MNA A;  2B8G A;  4DR5 Q;  2O2L D;  5FJ8 G;  3M85 A;  1QOH A;  4LFC L;  1RTN A;  3GTM B;  4N8X 1;  4BY1 B;  1SMX A;  1VQC A;  1XMQ L;  4LFA L;  1TII D;  3HZX A;  3MFG A;  1SEB D;  3T16 A;  3X3N A;  1TWC B;  4WOR A;  4JG2 A;  1PTO H;  4CDD C;  2CQA A;  2RA4 A;  3CCQ A;  3R2I A;  4P74 A;  1DJR D;  1U4R A;  3U9S A;  1HZA A;  3KBX A;  4O2D A;  3T13 A;  1GUW A;  4KHP Q;  2IPK D;  1I6H H;  2EYM A;  4K2L A;  4MN3 A;  4A3J B;  5CGK A;  1B2T A;  3J80 i;  2JEB I;  4NMZ A;  2Y0S B;  4DXG A;  4CJ1 B;  2WAQ B;  5IWA L;  1IYU A;  4IUQ A;  3OIP A;  2PNH A;  3M4Q A;  4X65 Q;  4LF7 L;  4G4K A;  2F4V Q;  5JJI A;  1JQY D;  1EEI D;  2C5C A;  4FDB A;  2F3V A;  2FMC A;  2OT2 A;  3HGB A;  4GKJ Q;  5E4W C;  4A3G B;  5IYB G;  3VR5 A;  1F9S A;  2Z6K A;  3GO5 A;  5GAD C;  3JAM E;  1S5D D;  1Q12 A;  5EPL A;  1RL2 A;  5EKK A;  2J0T D;  3H0G G;  5KIX A;  5M5Y B;  1ET9 A;  1KD1 C;  1NR4 A;  2OWO A;  2E2I B;  5AJ3 Q;  2B8F A;  3BYT B;  5FO8 B;  2K01 A;  3C2P A;  5EPK A;  1L2F A;  2SDF A;  2YTV A;  5J3B A;  4LF8 L;  3GTJ B;  4NKL A;  1NY4 A;  5JJL A;  3R8B A;  2JA8 H;  3S14 H;  3J80 c;  3I70 A;  1CK1 A;  4JI5 Q;  1OXT A;  2ZT9 C;  3M7N A;  4JYA L;  4KY7 A;  1XMO L;  3T1Y Q;  4R9W A;  1QB5 D;  4RG1 A;  4RFB A;  3KJO A;  1MHW C;  3HKZ B;  4BS9 A;  4PZ8 A;  3GQB A;  3J80 L;  3PIP A;  3CU7 A;  4JI2 L;  4RGO S;  1ZEQ X;  4DNT B;  2K14 A;  4FYD A;  1IBK L;  3G71 A;  4MNO A;  1SE3 A;  4OWX B;  4C3J H;  2E75 C;  3PUY A;  1EWH A;  2MQH A;  2QEX A;  2HQL A;  1TT2 A;  5NUC A;  2HT1 A;  1KAB A;  3CQZ B;  2NTS A;  3IFD A;  3HOU H;  4V0B A;  3HOX G;  4LW1 A;  1HTP A;  3A0J A;  2KEC A;  3NQT A;  1KDB A;  2B3G A;  3ONA B;  1VS0 A;  4YHH Q;  4RMF A;  4YCW A;  4LUO A;  1VQH A;  4YWL A;  1A3U A;  1ENF A;  4IUP A;  2UUC L;  2MP1 A;  1DXM A;  2DN8 A;  1V8Q A;  4DV3 Q;  4UP8 A;  1MIU A;  1B44 D;  3MXG A;  2Q8I B;  1E1T A;  3HOZ G;  1BBW A;  1C9O A;  1LTR D;  4GN4 B;  4HJA A;  3V96 A;  1KRT A;  2CH4 W;  5M3F H;  1YNN D;  2AMC B;  2K5V A;  1CZW A;  1WVL A;  2Y0S E;  2WAQ E;  3VA5 A;  3NPP A;  5CV7 A;  4RHR A;  1QWY A;  1JE4 A;  4FXD A;  5C4X B;  2EY5 A;  3CP0 A;  5DAU A;  3QG1 A;  5M3M H;  2F0H A;  2PI2 A;  4OO1 G;  4U68 A;  3KK7 A;  3BVZ A;  1X6O A;  5EBD A;  1PFM A;  3ULP A;  4JV5 L;  4P72 A;  4OEM B;  1N36 Q;  2EIF A;  5C0X G;  1GM5 A;  3I73 A;  1X3E A;  4XYO A;  5TSS A;  3V05 A;  3I72 A;  3UDG A;  1D1K A;  4HSV A;  4K8I A;  3J7Y W;  2G9D A;  3W1G A;  2UXD L;  1A2T A;  2FFK B;  1TR5 A;  2A74 C;  2MHV A;  2K7V A;  2OTL A;  4DUY L;  2OCE A;  1IKL A;  4BA2 I;  3CAM A;  1O80 A;  4BBR B;  4X66 Q;  1D7Q A;  1PA6 A;  1KTK A;  3FKI H;  4DAY B;  3W5O A;  1YHB A;  4S3S A;  3HKS A;  3BDO A;  5ISR A;  2L5T A;  3FP9 A;  4AYB B;  1QCB D;  1J5E Q;  3J80 E;  4IAL A;  1KIX A;  4JPB W;  2O4X A;  3C1E A;  3PV0 A;  4L63 B;  2JJQ A;  2YYZ A;  1U5K A;  3J7A F;  2F0G A;  5KRU A;  1IW7 C;  1O7Z A;  1SAP A;  3HKZ E;  2K5D A;  1S5E D;  4ZAI A;  5IP7 G;  2HCI A;  3L2P A;  5JJK A;  4XIG S;  4QUF A;  3DUZ A;  5JAV A;  4IOA A;  1TWH B;  1T5E A;  4KJN A;  1LLR D;  2AWN A;  3CC2 A;  4KN7 C;  1HA6 A;  1I94 Q;  3TP7 A;  4EX5 A;  3UDF A;  1K0S A;  3O13 A;  2J7Z A;  2HIX A;  4A3F H;  2VUM G;  4DR4 L;  3I4M H;  3PO2 H;  4RHS A;  1HNZ L;  4CKE A;  2A73 B;  2Z1C A;  3RLO A;  3VR4 A;  5CMD A;  1XNR Q;  4A3E H;  1PH9 A;  1HNW L;  4LF9 Q;  2XSC A;  4DAP A;  1YI2 A;  2R93 H;  2CKZ B;  5KYL A;  1CM9 A;  3STB D;  1E2V A;  2I46 A;  2PW7 A;  3RMH A;  2JXM B;  2N3S A;  2N55 A;  3D0F A;  4ZK9 B;  3A8J E;  3NEN A;  4H13 C;  4QQB X;  2JP1 A;  5ELO A;  3MXN A;  1SND A;  1U4L A;  3A7L A;  2CW0 D;  5JPN C;  1N32 L;  2MO1 A;  1SDF A;  2XN9 C;  4NP5 A;  5COR A;  2JA6 H;  2DUD A;  1GUT A;  4J1M A;  2JA7 G;  1KLG D;  1L0Y B;  3CPF A;  1GJX A;  3M4Y A;  5IIF A;  3ND9 A;  1HZB A;  1SYG A;  4A3L H;  4TVA B;  1Q90 A;  4PMB A;  1KAA A;  2WKD A;  2B63 B;  3HOY H;  3C3L A;  1CSQ A;  5IGC A;  1ONL A;  1MI2 A;  1SYE A;  1GVP A;  2EYJ A;  4LFB L;  2PI2 E;  1WCM H;  1WOC A;  1JWM D;  4JI0 Q;  1X54 A;  3BVG A;  1HR0 L;  1F2Z A;  2FHT A;  1V43 A;  2VW9 A;  2JA5 H;  2IL8 A;  4DV2 Q;  5D14 A;  1SE2 A;  4RKB A;  2Q2U A;  1ZXT A;  4NDX A;  3BS1 A;  4GNX C;  1A3V A;  1SRO A;  1Y1W B;  4DV1 Q;  1FGU A;  3BVM A;  1QE6 A;  1PH4 A;  3BU2 A;  2XNA C;  2DJF C;  3CPW A;  3TZU A;  1W2B A;  3PO3 H;  4HR7 B;  1EYA A;  4C1N I;  3HOX B;  5ELN A;  3S1N H;  1DOL A;  1Y1V H;  2JSO A;  1PFB A;  1KLU D;  1EIH A;  2O5I C;  2VY3 A;  3MEF A;  3BG3 A;  3TQY A;  1JJ2 A;  1ZYR C;  3HOZ B;  1LTG D;  3HOU B;  4BBS H;  1B9M A;  4DUZ Q;  2EVB A;  1WFQ A;  5AFW A;  4H0L C;  3OTO Q;  5IT9 L;  5LMN L;  2B29 A;  1LTA D;  3OW7 A;  3KOJ A;  3I2Z A;  1PRT D;  4B9W A;  1IL2 A;  4DV5 Q;  1SLJ A;  5FLM H;  1AZQ A;  3CCL A;  1JWS D;  2QDL A;  2L11 A;  1F2Y A;  1G8Z D;  5CV8 A;  3F8T A;  1QVF A;  2A68 C;  1HNX L;  2QGQ A;  1O7I A;  3BYY B;  5L37 A;  5E4X A;  4JI3 Q;  5D65 A;  2SEB D;  2N88 A;  2ZTE A;  5M3M B;  2WAC A;  3QJY A;  1X32 A;  1AW7 A;  1D1I A;  5M5W H;  1JR0 D;  1T9H A;  2UUB Q;  4RGN A;  4K5X A;  4JI1 Q;  4NB3 A;  1BF4 A;  3S17 H;  2UU9 Q;  2LS0 1;  1P8L A;  1TS5 A;  1O78 A;  5C5L A;  3K7A H;  4BXX H;  3EJI A;  1Y8N B;  3QIA A;  1HR0 W;  1NBW A;  1SXT A;  4PZ6 A;  1EYG A;  4NXN Q;  4K5W A;  4CDE C;  2Q2I A;  1I5F A;  3WOF A;  4H44 C;  4UPA A;  4C3I G;  4BY1 G;  4R4T A;  3S15 H;  1YNJ C;  1TWF H;  1EY4 A;  4POF A;  2KED A;  2NVQ B;  3CRK C;  2MJ8 A;  4MTN A;  3GV3 A;  1UNS A;  1XYI A;  2M9V A;  1A6X A;  4POG A;  3S2H H;  5CYU A;  4DNI A;  3OWF A;  1STB A;  3SR1 A;  1U4P A;  2NZH A;  4A3J G;  3I4N H;  1IBM Q;  4TKO B;  4LFC Q;  1GD7 A;  3KF6 A;  4RKL A;  1XNQ Q;  1HUN A;  2A6H C;  1ASY A;  1NAP A;  3EA6 A;  4LFA Q;  1FNU A;  4GNX A;  1XMQ Q;  4N9P A;  1PYS B;  2E2H B;  1L1O B;  4IUT A;  1ILP A;  1NJI C;  4MHE A;  3E9I A;  3SK5 A;  4IFD H;  1EZ8 A;  4A3F B;  1E3P A;  5IGG A;  1GUS A;  5IP9 G;  3CMA A;  2ZJR A;  1TWA H;  1E1O A;  2R3Z A;  1TVX A;  4K14 A;  1O7Y A;  4JBJ A;  3W1B A;  5IE8 A;  1TS2 A;  3K0X A;  1PTO F;  5E7N A;  5CV4 A;  4EVO A;  2KCN A;  2CCZ A;  1CSP A;  3MXP A;  3MHB A;  3K59 A;  1ICW A;  1UAP A;  4G7O C;  3VYS A;  3PIO 3;  1GUG A;  3BDC A;  4QL5 A;  2NVX H;  4MZ9 A;  1Q46 A;  1SN8 A;  5FO7 B;  3TP8 A;  1SNQ A;  2EQS A;  2NZ1 D;  4DV6 L;  1VQO A;  3HRZ C;  3LGJ A;  3GTO H;  1EY8 A;  1S4Z A;  3VDY A;  4QUC A;  3H3V H;  1UUP A;  1E22 A;  1NCV A;  3KBG A;  3GTL B;  1U0L A;  5HUR A;  2LXJ A;  1KRS A;  1ROD A;  2RVL A;  1AE3 A;  3PF4 A;  2PYK A;  3BZK A;  2ID0 A;  1PZI D;  2CFM A;  1SMY D;  2KA7 A;  2ASB A;  2JA9 A;  3QOJ A;  2H4O A;  5LMU L;  1H9J A;  1M90 C;  3PMF A;  1LM0 A;  5FOB B;  2KCT A;  4C56 C;  4A93 H;  4IUR A;  3FRP B;  1PFN A;  3E6Z X;  3TS2 A;  2E2D C;  1HCZ A;  1I4G A;  3OHX C;  5IGB A;  3A54 A;  1WCM B;  2A1A A;  2F0T A;  4AH6 A;  1XPR A;  1CKM A;  4LF6 L;  2BE5 D;  1QNK A;  5CBE E;  1K83 H;  1XMO Q;  1SE8 A;  3DM1 A;  2VXW A;  4A3C H;  1V1Q A;  5ELB A;  1RD9 D;  3NP8 A;  5IYC H;  3KJP A;  2YU9 B;  1VMP A;  1YHQ A;  3I56 A;  4GOP C;  4NPS A;  5KNB A;  4GZY C;  4HTH A;  4KKS A;  4KTA A;  4OHJ A;  1YIT A;  4A3D G;  5JJZ A;  1LT3 D;  5ELF A;  3F2D A;  3PO3 B;  4P2C B;  1NTG A;  1NE3 A;  4R8I A;  1X9N A;  3J7A V;  4EGV A;  4JBK A;  4LMQ D;  2EY6 A;  3RZO B;  5C4X G;  3NBH A;  2RQX A;  4L6T B;  1LTB D;  1E2Z A;  1VDZ A;  2NWG A;  4UAI A;  1TWG H;  1LT5 D;  2Q8T A;  2K28 A;  1YNX A;  2IWH A;  1YIJ A;  3T56 B;  4PMW A;  1VQF A;  2R6G A;  2UUC Q;  1IXR A;  2F0J A;  4IUU A;  1CKN A;  1G2S A;  2PZT A;  1PMR A;  2ZTD A;  3IFT A;  4DK3 C;  3JAM L;  1OTC A;  1L0X B;  4JVZ A;  3LNN A;  1NUC A;  5D3D A;  3NBH B;  1BNZ A;  1IBL L;  3QR8 A;  1ILQ A;  2FXQ A;  4RWS C;  2NVT B;  2DNE A;  4BBR G;  4B3T L;  1JC7 A;  5IOD A;  2BH2 A;  2GN5 A;  4DK1 A;  3IKJ A;  3F1Z A;  4LWC A;  4JV5 Q;  1HXY D;  4C3H B;  3NQI A;  1SBB B;  2K32 A;  2L9H A;  4RA8 A;  4IJL A;  4ZRZ A;  4AYB G;  1CKN B;  2ZJQ A;  1I4Q A;  4PZ7 A;  1OXV A;  4AIM A;  4FXG C;  1W3S A;  4IPH A;  4DV7 Q;  2UXD Q;  4BWG B;  1EIF A;  4ALP A;  4UY8 C;  1MSH A;  2DNC A;  3GTG B;  4DUY Q;  3MFY A;  1IL8 A;  1PRT F;  2L0C A;  1C7Y A;  2QIL A;  3AMU A;  1CA5 A;  1STG A;  5FJ8 H;  2GVA A;  4WJ3 M;  4BY7 B;  4C3I B;  1YNN C;  4DV4 L;  2ALY B;  3GTK H;  4J6H A;  1SYF A;  4DV0 L;  1B50 A;  4XTC S;  1WTP A;  4R8N A;  2R7Z H;  4R4I A;  1V1P B;  4MTK A;  3Q8D A;  3GDE A;  2YTY A;  3CD6 A;  4KN4 C;  2SNS A;  4FP5 D;  3S15 B;  1HJP A;  3R3O A;  3WDN A;  3U9O A;  2RF4 A;  5FLX c;  4A3M H;  1K73 C;  1IHZ A;  4X3K A;  1R9T H;  1IYJ B;  4O42 A;  2D9U A;  4IQZ A;  1D6E C;  3NEM A;  2EYF A;  2OF1 A;  3S2H B;  1R4Q B;  5IYD H;  4HCE A;  2Z4H A;  2F0W A;  4JI7 L;  1I3Q H;  3I4N B;  4Q5V A;  4X3S A;  1TU2 B;  2K03 A;  4ZYS A;  2GVB A;  3MA2 B;  4GOP A;  2I5M X;  2ZJP A;  2KQ3 A;  1BUV T;  3CCV A;  4GLX A;  3DWQ A;  2QF7 A;  4A3B H;  4LF4 L;  3AFP A;  4HIO A;  2B63 G;  5IYB H;  1PH8 A;  2RSO A;  1C8C A;  3S16 B;  1PLF A;  2NB0 A;  3FPP A;  4DKA C;  2OQK A;  5E3F A;  5EJW A;  3GTP H;  1GHK A;  3ND8 A;  3CME A;  3H0G H;  3URY A;  1GUO A;  1B1Z A;  1SR3 A;  2QEJ C;  1Q3L A;  1N32 Q;  4OGQ C;  3M3Y H;  1SNM A;  4GOP B;  4C2M H;  3DXJ C;  3M4O H;  4IFD I;  2K5H A;  1YJ9 A;  1B70 B;  1C4Q A;  4GKK L;  1KHI A;  2NUC A;  2EDG A;  2N78 A;  5I9P A;  3GTO B;  3TRE A;  3L0O A;  2VNU D;  3KLS X;  5DLQ E;  3ITP A;  3PSI A;  4Z9C B;  2UXC L;  2VB2 X;  3H94 A;  4PG3 A;  2JA8 G;  1Y1W G;  1JT8 A;  2MPM A;  4HSP A;  4HJ9 A;  5BR8 L;  2D0O A;  2WIN B;  1MSG A;  4HID A;  4DK6 C;  3GTQ B;  2Z9H A;  5LL6 S;  2FMM A;  1S5F D;  4QF4 A;  3LWU A;  1ASZ A;  5JVG 3;  3DM3 A;  4ABN A;  1HR0 Q;  1Z9F A;  3EN2 A;  3STB C;  4HMI A;  3H3V I;  1SFO H;  2SOB A;  3U50 C;  3OOC A;  2WFW A;  5M9O A;  1YBY A;  2NVY H;  3HOW H;  4AQY L;  3SXH A;  1DCZ A;  2CW0 C;  4X6A H;  2EPB A;  1F77 A;  3RLF A;  1I6V C;  2BCO A;  3J81 j;  1BVS A;  1A8V A;  2F1M A;  3BZD B;  3KYH C;  4I7A A;  3CXC A;  4A3D B;  2PMZ B;  2Q2H A;  3HOU G;  1WTO A;  1EOT A;  1WTV A;  1BDO A;  4APV A;  2MGS A;  1VQA A;  1RTO A;  2GA4 B;  4EQ5 A;  1CHQ D;  3KDF A;  4EQP A;  5BN5 A;  2BH8 A;  1X56 A;  2HD3 A;  3PUV A;  1SE4 A;  1HZC A;  1PYW D;  4NXM Q;  4B3R L;  1KXL A;  3PUW A;  4JC0 A;  1MD2 D;  3D6W A;  3GD7 A;  1WI5 A;  4DAY A;  2K04 A;  4A75 A;  5I2X A;  1CI3 M;  4HMJ A;  1RHP A;  3T53 B;  2KEN A;  1V9P A;  4ID6 A;  3D31 A;  2O5J C;  3E5S A;  5M3M G;  1X3F A;  5C0X H;  5LMN Q;  3KDF B;  3ICE A;  3J81 i;  2K5Q A;  2RSN A;  4KMU C;  1ENC A;  4K8J A;  1K8A C;  3ZYY X;  2OTJ A;  4GN3 B;  5EPJ A;  5GAH C;  4OX9 L;  1HQR D;  2K05 A;  4YWM A;  4DR3 L;  4LF5 L;  1OXS C;  3B6Y A;  5KND A;  5C3X A;  1HNX Q;  4A3K H;  3QO2 A;  1GO3 E;  4FF1 A;  1CFM A;  2HDM A;  3GV6 A;  3U58 A;  3A74 A;  4RGM A;  3BDL A;  2X6G A;  2H1E A;  5I9O A;  2PQE A;  2ZXO A;  3VR2 A;  1PTO D;  4P73 A;  3HFZ B;  4IN3 A;  1V1O A;  2R7D A;  1Q7Y C;  2WB1 G;  1MGS A;  1H9K A;  5CV9 A;  1CUK A;  2IHE A;  3PGZ A;  4DR6 Q;  3KLS A;  1A2U A;  1EQT A;  1VF7 A;  5FO9 B;  3K7U C;  4FF3 A;  4QCL A;  1QJO A;  3HG9 A;  3NWS A;  3VYT A;  3J81 c;  1PRT C;  1HHV A;  1M4V A;  2PZW A;  1FJG Q;  5FKA C;  4JI6 Q;  4E6I A;  2HDL A;  4GS3 A;  4IJH A;  1EY9 A;  1EL0 A;  2D5D A;  3WOE A;  5C6A A;  3TRZ A;  1HQM C;  3ERQ A;  1GXD C;  4ZKC B;  3GTK B;  1PTO B;  5C3E H;  1DOK A;  2IT1 A;  3C1F A;  1UEA B;  2PMZ E;  1VQ6 A;  1EWC A;  4A3F G;  1SJH D;  4LJZ C;  3VR6 A;  4JCV E;  2F4V L;  4IPG A;  2C9O A;  1MJE A;  2B2Y C;  1I6H B;  5J39 A;  3M9B A;  2KHI A;  4M8A A;  4A3M B;  2M2L A;  3R2T A;  4PQX A;  3DLL A;  3IL8 A;  1JOK A;  1PYB A;  4A3I H;  3HOV H;  2R93 G;  3F2U A;  1I50 H;  2F0P A;  1WYD A;  1FVI A;  3AYH B;  2EYH A;  1RDP D;  2JA7 H;  2EJM A;  1VQN A;  1VQ7 A;  4DR1 L;  2P5Z X;  2F03 A;  1WD0 A;  2JA6 G;  3S1R H;  5JVH 3;  4DN4 M;  1VQM A;  1NR2 A;  2L4N A;  1L1O C;  2CVR A;  2QKI C;  4A3L G;  1MJC A;  2HUG A;  3FVQ A;  2F0L A;  3HOY G;  3T1Y L;  3VYR A;  1VQJ A;  4DV6 Q;  1VQ8 A;  2R92 H;  4AYB E;  1S72 A;  1KDC A;  3T51 B;  2RCF A;  1BO0 A;  2JA8 B;  3S14 B;  2JE6 I;  5CR3 A;  2V1C C;  3X3M A;  3DEP A;  1WCM G;  4EQN A;  3H91 A;  2F0Q A;  4Y7N H;  2UXB L;  1B9N A;  4K5V A;  3NBI A;  3TP6 A;  4UDU C;  2Q8R E;  4B3M Q;  1KL9 A;  2B2V C;  3I55 A;  1EU3 A;  2JEA I;  2F0F A;  2AHO B;  3U4V A;  1LAC A;  1A0I A;  1NMF A;  4LUV A;  4DAV A;  5J22 A;  3ER0 A;  4YHH L;  2NBF A;  4C3J B;  3CRL C;  4PNY A;  5M5X H;  3J81 E;  3PO3 G;  4HAE A;  1HTL D;  2F3I A;  3PCO B;  2E74 C;  1G6Z A;  2AUK A;  4KY6 A;  3CW2 C;  1N8R C;  1K8O A;  1ESF A;  3CCE A;  4DNR B;  1LYL A;  3KLR A;  1SNO A;  3NTH A;  1Y1V G;  3CHB D;  2VL6 A;  3IRB A;  2VQF L;  4X64 Q;  4OEL B;  3PF5 A;  4I7Z C;  1JJG A;  1VF5 C;  2NN6 G;  2E2J H;  4FVM A;  4YCU A;  4ZUI A;  3RN5 A;  1R4P B;  1SMY C;  5M3F B;  2EY1 A;  1KNA A;  1H9M A;  3QOL A;  2CWA A;  1ICF B;  1IYV A;  1I4H A;  4CJ0 B;  3S2D H;  1JWU D;  3KLW A;  1E0B A;  2F0V A;  3PUX A;  5JEA H;  2HHH Q;  3A8I E;  2LXK A;  4IPD A;  4CHT B;  1K3R A;  2PO4 A;  4FXK C;  3OSO A;  5C44 H;  3EQL C;  1J6Q A;  1YEZ A;  2G9H D;  5IGF A;  4C3H G;  2I5L X;  4KI0 A;  2I0Q A;  2BE5 C;  2B2Y A;  1PRT B;  4OIK A;  4PMC A;  3ZJY C;  1PVO A;  2EJF C;  3N52 A;  2EJG C;  3TSS A;  1CTM A;  1WTQ A;  4KD3 A;  4LK1 C;  3TN2 A;  4JI8 L;  2PCF B;  4DR2 Q;  2Z0S A;  3PQI A;  1IBL Q;  2F4I A;  4F8M A;  4OO1 I;  1S5C D;  4YCV A;  3S1Q H;  1VQE A;  4B3T Q;  1JJC B;  3FKI B;  4XT1 B;  5F2D A;  2B2T C;  1QUQ A;  4BY7 G;  1TS4 A;  4IUN A;  4HIK A;  3EIV A;  2WB1 B;  4PV1 C;  4CJ2 C;  4BXX G;  3GTM H;  2MO0 A;  1L1O A;  5C0X I;  1RKN A;  4BY1 H;  4DF7 A;  5I2Y A;  5C3W A;  3U4Z A;  4R4C A;  3P20 A;  1TWC H;  1HH2 P;  4HIM A;  1JOR A;  3K0Y A;  1Z6H A;  3BZC A;  1JB3 A;  4WJW A;  3HEJ A;  1Q8K A;  2LY7 A;  1Q1B A;  3G6E A;  3UE0 A;  2WP8 J;  3DWA A;  3TBI B;  1QUQ B;  3FHW A;  4A3J H;  2EY2 A;  2ES2 A;  1FD7 D;  2D62 A;  2SNM A;  3TME A;  2N8N A;  2HCC A;  4M1U B;  1VQ9 A;  2ZM6 L;  5A35 A;  4DV0 Q;  2Z4I A;  4QGU A;  4NW2 A;  3I4N G;  2PZU A;  3I4M B;  3PO2 B;  1Y8O B;  1NSN S;  5LMN W;  2B2V A;  2IJ0 A;  4GN5 A;  3S1M H;  3CCM A;  4IO9 A;  5CV5 A;  2EXZ A;  5IP9 H;  5H1S E;  3UI2 A;  3PIP 3;  4A3E B;  4OWT B;  5K36 H;  2R93 B;  4IFD G;  5IWA Q;  2OXP A;  1A3T A;  4DXF A;  4A3G H;  1MKH A;  1O7L A;  2AQ3 B;  4OON A;  4LF7 Q;  4G57 A;  1F9Q A;  3Q23 A;  4DK0 A;  3D3R A;  5M5Y H;  4JI7 Q;  2D2C C;  2RBM A;  2E2I H;  2JA6 B;  2FJ2 A;  1DGS A;  1CHP D;  2EOT A;  3OWE B;  1I50 B;  4DR7 L;  2B2U C;  5G3L F;  3A5Z B;  3M7G A;  4XXE A;  4QB4 A;  2PPB C;  4JI0 L;  1VQ4 A;  3HOY B;  4LF4 Q;  4QJF A;  3SK8 A;  1B3Q A;  3Q24 A;  1EYC A;  1IZ6 A;  2DJG C;  4DV2 L;  2XWJ B;  4QIW B;  2XWB B;  3SVM A;  1WTW A;  2IY5 B;  2AWO A;  4LF8 Q;  2KHJ A;  3E3X A;  1WTX A;  4O0A A;  2WKC A;  2UUA L;  1H9R A;  4YY3 L;  3CC7 A;  1PZK D;  1XTD A;  2ICE C;  4GKK Q;  4QY7 A;  4JYA Q;  1S40 A;  2JA5 B;  3SDZ A;  1B3A A;  4J15 A;  1XWE A;  2ATW A;  4P75 A;  2WB1 E;  2R92 B;  4A93 G;  3CQZ H;  1D2B A;  2KVM A;  3LWE A;  4JI2 Q;  2H5X A;  2D0P A;  2FIN B;  1IBK Q;  1EQQ A;  1YVC A;  4JOI C;  5BR8 Q;  5C4H A;  3I90 A;  2F0U A;  3T1H L;  4A3C G;  1ESR A;  2QDB A;  2KJX A;  3H3V C;  5IYC G;  2A6E D;  2OEO A;  1XPO A;  1II3 A;  2AKW B;  2X6L A;  4B3S L;  2B2T A;  2IX3 A;  1HA5 A;  3TS0 A;  5GAE C;  3S1N B;  2CHB D;  2L1B A;  1Y1V B;  3QB3 A;  1I4X A;  3N6R A;  1VQD A;  2F0I A;  1N9W A;  1EOV A;  2RDG A;  3TP5 A;  4TSS A;  5T1I A;  1JOO A;  2F52 A;  1VMC A;  4KLK A;  4BBS B;  4IPC A;  2JN4 A;  3MAQ A;  5I4D A;  1HPC A;  4HJ5 A;  1JOQ A;  3HP3 A;  4YWK A;  4JI3 L;  1PXU A;  3NHH A;  3MXU A;  2F0M A;  2NYZ D;  5CBA E;  2A69 D;  4J8Q A;  2E2J B;  3AEV A;  1AN8 A;  1S3O A;  2NZO A;  4B3R Q;  2F0S A;  4WJ4 A;  4JI1 L;  5GAG C;  2Q2T A;  5K5P A;  4XQJ A;  2A8V A;  4BBR H;  3Q6S A;  1EU4 A;  3RNU A;  2DY7 A;  4UHV A;  1HFN A;  2IX0 A;  2K33 A;  1GOZ A;  4HJ7 A;  1V1P A;  3ULL A;  5J1Z A;  5M5W B;  5D3I B;  4NXN L;  4R4O A;  2E5L L;  1TQO A;  5EBC A;  3OMG A;  4DFA A;  4QIW E;  2PQA A;  3S17 B;  1YJN A;  2HIV A;  1NMG A;  3K5N A;  5IY0 A;  1B53 A;  1Y8P B;  4LF5 Q;  1IKM A;  4CKC A;  1DZ1 A;  2L15 A;  3K7A B;  4N9T A;  1TWH H;  2EYL A;  2NTT A;  3M4P A;  2BDN A;  2IX1 A;  2B2U A;  3K8A A;  4JW0 A;  1ZKO A;  2BDO A;  4QMG A;  4UP9 A;  3K58 A;  1XTC D;  2CH4 A;  4IUV A;  1U4M A;  1IBM L;  1TWF B;  1H9S A;  2PQA B;  2JK8 A;  1XNQ L;  2VQE L;  1BKB A;  4KV6 A;  3OYY A;  1X3Q A;  2R7Z G;  1AH9 A;  3FEW X;  1JCK B;  5DM6 3;  1A15 A;  5FLX L;  1PHJ A;  4K0K L;  3E0E A;  1FYC A;  1LTS D;  4IZ8 A;  5COY A;  4A3M G;  4DR4 Q;  3RZD H;  3GP7 A;  1HNZ Q;  4WRD A;  4I65 A;  1H9S B;  2LKV A;  3I8Z A;  4N8F A;  1BCP D;  4Q0F A;  3CKI B;  5IYD G;  1HNW Q;  1B4O A;  1CQF A;  3RUZ A;  3ULJ A;  1A62 A;  3E9H A;  3L7Z C;  1AEX A;  1EIG A;  2LFN A;  1TWA B;  2HQE A;  1LTI D;  1RIP A;  2B63 H;  1D8L A;  1STE A;  3S1M B;  1GHJ A;  3EVQ A;  1N34 L;  1PTO C;  4P71 A;  4CDF C;  4CBV A;  1JMC A;  3SK6 A;  4A3B G;  1M8A A;  2B2W C;  2M00 A;  2QCP X;  5KNC A;  2NVX B;  2YV5 A;  3KFU A;  3H09 A;  4H7B A;  1BQQ T;  4JBW A;  2F0O A;  3L3O C;  4DR1 Q;  3NK9 A;  1BCP B;  4G7H C;  1EIY B;  4IFD J;  2QW7 A;  3K5L A;  1WD1 A;  3FPU B;  3DEO A; 
#chains in the Genus database with same CATH homology
 3NTK A;  3MC0 B;  4KKT A;  1F9P A;  4CKB A;  2V4D A;  1MBY A;  1PZJ D;  3L9A X;  3DWP A;  4WFN 3;  4A93 B;  2F0E A;  3SE0 A;  4C3J G;  3D4W A;  2XIW A;  2ZXP A;  4L8J A;  1FR3 A;  4ULL A;  1SYB A;  1K83 B;  1HFG A;  1E2W A;  5FLX E;  3DHQ A;  2IW3 A;  2BA0 A;  3R93 A;  1CZG A;  1EY0 A;  2L12 A;  2DY8 A;  3K6O A;  2EZV A;  4OO1 H;  4EQO A;  2J4X A;  1T5X D;  4F87 A;  3I91 A;  1TWG B;  1W6J A;  4KHV A;  5KYI A;  4BA1 I;  1BOS A;  1W6K A;  2K5W A;  2ENB A;  4X3U A;  1EY7 A;  3AB9 A;  5LL6 X;  3I3C A;  1PDQ A;  1EFI D;  5EGT A;  3Q0A A;  2I07 B;  3K57 A;  3D6C A;  4HN7 A;  2E76 C;  1F2M A;  3QWN A;  1G91 A;  2WV6 D;  4LAA A;  4KHZ A;  3T4A C;  4OIJ A;  2AUJ D;  1Z7T A;  2B2W A;  2AQ2 B;  4B08 A;  1SNP A;  2KCC A;  1SSO A;  1JIC A;  1DYQ A;  5C4Z A;  3NWT A;  4C1N K;  3G7L A;  2RKS A;  5G3L D;  4KK7 A;  1G2T A;  4FF2 A;  3J81 L;  5DM7 3;  2K1B A;  2R7Z B;  1BXT A;  4ZUJ A;  2RDF A;  4HED A;  3OMC A;  4U67 3;  1HRJ A;  4HCS A;  3W2D A;  4YIJ A;  2MUY A;  2F0D A;  4V19 0;  1R9T B;  3VYU A;  4RH6 A;  5C5M A;  4O1N A;  1RF2 D;  2JYO A;  4OL7 A;  2TSS A;  1OXX K;  1OO9 B;  3FDT A;  4XDX A;  1I3Q B;  3VR3 A;  3RZD B;  2KOL A;  3EFX D;  4A3B B;  1STY A;  5JPM C;  1DON A;  3KF8 A;  3PUZ A;  5CC4 A;  1X3P A;  2PW5 A;  3GTP B;  5A2Q L;  3H0G B;  3M3Y B;  4C2M B;  5T1G A;  3M4O B;  2ICI A;  2WII B;  4KJO A;  1EZ6 A;  1BCP F;  1EQV A;  3RD4 A;  3D4D A;  4ZKB B;  3NE5 B;  4F88 A;  1KDA A;  3A8K E;  2TMP A;  5IGE A;  2KHS A;  5JOB A;  3SEB A;  5KGU A;  1DOM A;  4RCN A;  1RCV D;  5LHY 1;  1SFO B;  2NVY B;  3HOW B;  1AZP A;  3P1H A;  3I4L A;  2LMC B;  5IGD A;  4RAU C;  1IW7 D;  5EQ0 A;  4F7X A;  1SJE D;  2NN6 H;  1TY2 A;  4ODG A;  3SK4 A;  1XXG A;  5C4J B;  2L55 A;  3D8G A;  3TZD A;  1FGB D;  4FO2 A;  3SHL A;  1F2L A;  3NSW A;  3D4R A;  5I6W A;  3MVV A;  1EYD A;  2F0N A;  1ENA A;  4KKU A;  3K5O A;  5JEA G;  4K6L A;  5I6Y A;  5A2Q E;  1FNW A;  1TKW B;  2EYP A;  4XQN A;  3A55 A;  3G6J B;  4DA2 A;  1FNV A;  3HS0 C;  1S5B D;  3S9W A;  1LTT D;  4KD4 A;  2XVS A;  2A6E C;  1XX8 A;  4A3K B;  5ELE A;  2R61 A;  1RJT A;  1SYC A;  2XRQ D;  4JK1 C;  1G29 1;  5C0X J;  3OIQ A;  1GUN A;  5ELD A;  1Y69 U;  5ELC A;  1STH A;  2Z8L A;  4RGT A;  4MIU A;  1OXU A;  5DNF A;  4FF4 A;  4B9X A;  1KNE A;  2A69 C;  1DM0 B;  2XRS D;  5BN3 A;  3DMU A;  2VUM B;  4ZLT F;  3H6M A;  1AFP A;  4G7Z C;  1HUM A;  5C3E B;  2VB3 X;  1C48 A;  1I4R A;  4ME5 A;  1D5Z C;  5IT9 E;  2EE1 A;  4XYQ A;  1Q8I A;  1ET6 A;  1U9R A;  2EYO A;  3C46 A;  1Z47 A;  2K6A A;  1QIL A;  5K36 G;  4A3I B;  3HOV B;  3MWY W;  4XQQ A;  5DEH A;  2A5H A;  2BA1 A;  4FNF A;  2JA7 B;  3OPO A;  1ZYR D;  1BBX C;  1SYD A;  1Q1E A;  2BOS A;  1ML0 D;  2KUM A;  1QNU A;  3MTS A;  3S1R B;  5IOC A;  4XT3 B;  4K2K A;  1STN A;  5CV6 A;  2X69 A;  3P7J A;  3V2T A;  1EY5 A;  4TQU S;  1LT6 D;  1SNC A;  3TDQ A;  3E0J A;  3A56 A;  1EEF D;  5KEE A;  1D5X C;  1TY0 A;  5HGT A;  2A68 D;  3AU7 A;  2F3W A;  3VA7 A;  1DD2 A;  3FMC A;  4KY5 A;  4X3T A;  4DGZ A;  4Y7N B;  3NXW A;  1BCP C;  1D5M C;  1TS3 A;  2ZXR A;  5BN4 A;  5E1F A;  1CA6 A;  3ERO A;  2KEE A;  2B39 A;  1CT1 D;  3P75 A;  5M5X B;  3W3A A;  4TRD A;  2PNR C;  4K6D A;  3MEH A;  1YNJ D;  1LAB A;  2F0K A;  1LV9 A;  3IAY A;  2RDH A;  3LX0 A;  1J8I A;  1I4P A;  3KUP A;  1J9O A;  3MZ5 A;  4ILW A;  1EY6 A;  1LT4 D;  5FK9 C;  3K5M A;  1AP0 A;  2A6H D;  4RCO A;  3S2D B;  5EKI A;  4CGY B;  5EKL A;  1BR9 A;  1STA A;  1LO5 D;  3NTI A;  3Q22 A;  5C44 B;  4ZQ3 A;  2NN6 I;  1WTR A;  1VCI A;  4DU9 A;  1K8M A;  1CQV A;  3A7A B;  2AQ1 B;  3NUC A;  5JEA J;  1QG7 A;  3S1Q B;  1F9R A;  2B8G A;  2O2L D;  3M85 A;  1QOH A;  1RTN A;  3GTM B;  4BY1 B;  1TII D;  3HZX A;  3MFG A;  1SEB D;  3T16 A;  3X3N A;  1TWC B;  4WOR A;  1PTO H;  2CQA A;  2RA4 A;  3R2I A;  1DJR D;  1U4R A;  3U9S A;  3KBX A;  3T13 A;  1GUW A;  2IPK D;  2EYM A;  4K2L A;  4MN3 A;  4A3J B;  5CGK A;  1B2T A;  2JEB I;  4NMZ A;  2Y0S B;  4DXG A;  4CJ1 B;  2WAQ B;  1IYU A;  4IUQ A;  3OIP A;  4G4K A;  1JQY D;  1EEI D;  2C5C A;  2F3V A;  2FMC A;  2OT2 A;  3HGB A;  5E4W C;  4A3G B;  3VR5 A;  1F9S A;  3GO5 A;  3JAM E;  1S5D D;  1Q12 A;  5EPL A;  5EKK A;  2J0T D;  5KIX A;  5M5Y B;  1ET9 A;  1NR4 A;  2E2I B;  2B8F A;  3BYT B;  5FO8 B;  2K01 A;  3C2P A;  5EPK A;  2SDF A;  3GTJ B;  4NKL A;  3R8B A;  3I70 A;  1CK1 A;  1OXT A;  2ZT9 C;  3M7N A;  4KY7 A;  4R9W A;  1QB5 D;  4RFB A;  3HKZ B;  4BS9 A;  3GQB A;  3J80 L;  3CU7 A;  4RGO S;  1ZEQ X;  4DNT B;  4FYD A;  1SE3 A;  2E75 C;  3PUY A;  1EWH A;  1TT2 A;  5NUC A;  1KAB A;  3CQZ B;  2NTS A;  3IFD A;  4V0B A;  1HTP A;  2KEC A;  3NQT A;  1KDB A;  3ONA B;  1A3U A;  1ENF A;  4IUP A;  2MP1 A;  1DXM A;  2DN8 A;  1V8Q A;  1B44 D;  3MXG A;  2Q8I B;  1LTR D;  3V96 A;  1YNN D;  1CZW A;  1WVL A;  3VA5 A;  3NPP A;  5CV7 A;  4RHR A;  1QWY A;  1JE4 A;  4FXD A;  5C4X B;  2EY5 A;  5DAU A;  3QG1 A;  2F0H A;  4OO1 G;  4U68 A;  3KK7 A;  3BVZ A;  5EBD A;  1PFM A;  5C0X G;  3I73 A;  3V05 A;  4XYO A;  5TSS A;  3I72 A;  1D1K A;  4HSV A;  4K8I A;  3J7Y W;  2G9D A;  1A2T A;  2FFK B;  1TR5 A;  2A74 C;  2MHV A;  2K7V A;  1IKL A;  4BA2 I;  1O80 A;  4BBR B;  1KTK A;  4S3S A;  3BDO A;  5ISR A;  2L5T A;  4AYB B;  1QCB D;  3J80 E;  4IAL A;  2O4X A;  3C1E A;  3PV0 A;  4L63 B;  2YYZ A;  3J7A F;  2F0G A;  5KRU A;  1IW7 C;  1O7Z A;  1SAP A;  2K5D A;  1S5E D;  4ZAI A;  2HCI A;  4XIG S;  4QUF A;  3DUZ A;  5JAV A;  1TWH B;  1T5E A;  4KJN A;  1LLR D;  2AWN A;  4KN7 C;  1HA6 A;  3TP7 A;  3O13 A;  2J7Z A;  4RHS A;  4CKE A;  2A73 B;  2Z1C A;  3VR4 A;  5CMD A;  2XSC A;  4DAP A;  5KYL A;  1CM9 A;  1E2V A;  2I46 A;  2PW7 A;  3RMH A;  2JXM B;  2N55 A;  4ZK9 B;  3A8J E;  4H13 C;  2JP1 A;  3MXN A;  1SND A;  5JPN C;  1U4L A;  2CW0 D;  3A7L A;  2XN9 C;  1SDF A;  5COR A;  4NP5 A;  1GUT A;  4J1M A;  1KLG D;  1L0Y B;  1GJX A;  3M4Y A;  5IIF A;  3ND9 A;  1SYG A;  1Q90 A;  4PMB A;  1KAA A;  2WKD A;  2B63 B;  3C3L A;  5IGC A;  1ONL A;  1MI2 A;  1SYE A;  2EYJ A;  1JWM D;  3BVG A;  1F2Z A;  2FHT A;  1V43 A;  2IL8 A;  5D14 A;  1SE2 A;  4RKB A;  1ZXT A;  4NDX A;  3BS1 A;  1A3V A;  1Y1W B;  3BVM A;  1QE6 A;  2XNA C;  3TZU A;  4HR7 B;  1EYA A;  4C1N I;  3HOX B;  1DOL A;  2JSO A;  1PFB A;  1KLU D;  1EIH A;  2O5I C;  3BG3 A;  1ZYR C;  3HOZ B;  1LTG D;  3HOU B;  1B9M A;  2EVB A;  5AFW A;  4H0L C;  5IT9 L;  1LTA D;  3OW7 A;  1PRT D;  4B9W A;  1AZQ A;  1JWS D;  2L11 A;  1F2Y A;  1G8Z D;  5CV8 A;  2A68 C;  3BYY B;  5E4X A;  5D65 A;  2SEB D;  2N88 A;  5M3M B;  2WAC A;  3QJY A;  1X32 A;  1AW7 A;  1D1I A;  1JR0 D;  4RGN A;  4K5X A;  1BF4 A;  2LS0 1;  1TS5 A;  1O78 A;  5C5L A;  3EJI A;  1Y8N B;  3QIA A;  1SXT A;  4K5W A;  3WOF A;  4H44 C;  4C3I G;  1YNJ C;  1EY4 A;  2KED A;  2NVQ B;  3CRK C;  2MJ8 A;  3GV3 A;  1UNS A;  1XYI A;  2M9V A;  1A6X A;  5CYU A;  3OWF A;  1STB A;  3SR1 A;  1U4P A;  4TKO B;  4RKL A;  1HUN A;  2A6H C;  1NAP A;  3EA6 A;  1FNU A;  4N9P A;  2E2H B;  4IUT A;  1ILP A;  4MHE A;  3SK5 A;  4IFD H;  1EZ8 A;  4A3F B;  5IGG A;  1GUS A;  2R3Z A;  1TVX A;  4K14 A;  1O7Y A;  1TS2 A;  1PTO F;  5CV4 A;  4EVO A;  2KCN A;  3MXP A;  3MHB A;  3K59 A;  1ICW A;  1UAP A;  4G7O C;  3VYS A;  3PIO 3;  1GUG A;  3BDC A;  5FO7 B;  3TP8 A;  1SNQ A;  2NZ1 D;  3HRZ C;  1EY8 A;  1S4Z A;  4QUC A;  1UUP A;  1NCV A;  3KBG A;  3GTL B;  5HUR A;  1ROD A;  2RVL A;  2PYK A;  2ID0 A;  1PZI D;  1SMY D;  2KA7 A;  3QOJ A;  2H4O A;  1H9J A;  3PMF A;  5FOB B;  4C56 C;  4IUR A;  3FRP B;  1PFN A;  3E6Z X;  2E2D C;  1HCZ A;  1I4G A;  3OHX C;  5IGB A;  3A54 A;  1WCM B;  2F0T A;  2BE5 D;  1QNK A;  5CBE E;  3DM1 A;  2VXW A;  5ELB A;  1RD9 D;  3NP8 A;  2YU9 B;  1VMP A;  5KNB A;  4GZY C;  4HTH A;  4KKS A;  4KTA A;  4OHJ A;  5JJZ A;  1LT3 D;  5ELF A;  3PO3 B;  4P2C B;  4R8I A;  3J7A V;  4EGV A;  4LMQ D;  2EY6 A;  3RZO B;  3NBH A;  2RQX A;  4L6T B;  1LTB D;  1E2Z A;  1VDZ A;  2NWG A;  4UAI A;  1LT5 D;  2Q8T A;  2K28 A;  2IWH A;  3T56 B;  4PMW A;  2R6G A;  2F0J A;  4IUU A;  1G2S A;  2PZT A;  1PMR A;  3IFT A;  3JAM L;  1L0X B;  3LNN A;  1NUC A;  5D3D A;  1BNZ A;  1ILQ A;  4RWS C;  2NVT B;  2DNE A;  1JC7 A;  5IOD A;  4DK1 A;  3IKJ A;  1HXY D;  4C3H B;  3NQI A;  1SBB B;  2K32 A;  2L9H A;  4RA8 A;  4ZRZ A;  1I4Q A;  1OXV A;  4FXG C;  4BWG B;  1MSH A;  2DNC A;  3GTG B;  3MFY A;  1IL8 A;  1PRT F;  2L0C A;  2QIL A;  3AMU A;  1CA5 A;  1STG A;  4BY7 B;  4C3I B;  1YNN C;  4J6H A;  1SYF A;  1B50 A;  4XTC S;  1WTP A;  4R8N A;  1V1P B;  4KN4 C;  2SNS A;  4FP5 D;  3S15 B;  3R3O A;  3WDN A;  3U9O A;  1IHZ A;  4X3K A;  4O42 A;  2D9U A;  4IQZ A;  1D6E C;  2EYF A;  2OF1 A;  3S2H B;  1R4Q B;  4HCE A;  2Z4H A;  2F0W A;  3I4N B;  4Q5V A;  4X3S A;  1TU2 B;  2K03 A;  4ZYS A;  3MA2 B;  2KQ3 A;  1BUV T;  3DWQ A;  2QF7 A;  3S16 B;  1C8C A;  2RSO A;  1PLF A;  2NB0 A;  3FPP A;  5E3F A;  5EJW A;  1GHK A;  3ND8 A;  3URY A;  1GUO A;  1B1Z A;  2QEJ C;  1Q3L A;  4OGQ C;  1SNM A;  3DXJ C;  4IFD I;  1C4Q A;  2NUC A;  2EDG A;  5I9P A;  3GTO B;  2VNU D;  3KLS X;  3ITP A;  4Z9C B;  2VB2 X;  3H94 A;  2MPM A;  4HSP A;  2WIN B;  1MSG A;  3GTQ B;  5LL6 S;  2FMM A;  1S5F D;  4QF4 A;  3LWU A;  5JVG 3;  4ABN A;  4HMI A;  2SOB A;  3OOC A;  5M9O A;  3SXH A;  1DCZ A;  2CW0 C;  2EPB A;  1F77 A;  3RLF A;  1I6V C;  2BCO A;  2F1M A;  4A3D B;  3BZD B;  2PMZ B;  1WTO A;  1EOT A;  1WTV A;  1BDO A;  2MGS A;  1RTO A;  2GA4 B;  1CHQ D;  4EQP A;  5BN5 A;  3PUV A;  1SE4 A;  1PYW D;  3PUW A;  1MD2 D;  3D6W A;  3GD7 A;  4DAY A;  2K04 A;  5I2X A;  1CI3 M;  4HMJ A;  1RHP A;  3T53 B;  4ID6 A;  3D31 A;  2O5J C;  3E5S A;  5C0X H;  2K5Q A;  2RSN A;  4KMU C;  1ENC A;  4K8J A;  3ZYY X;  5EPJ A;  1HQR D;  2K05 A;  1OXS C;  5KND A;  5C3X A;  3QO2 A;  4FF1 A;  1CFM A;  2HDM A;  3GV6 A;  4RGM A;  3BDL A;  2X6G A;  5I9O A;  2H1E A;  2PQE A;  2ZXO A;  3VR2 A;  1PTO D;  4IN3 A;  1V1O A;  1MGS A;  1H9K A;  5CV9 A;  3KLS A;  1A2U A;  1EQT A;  1VF7 A;  5FO9 B;  4FF3 A;  4QCL A;  1QJO A;  3HG9 A;  3NWS A;  3VYT A;  1HHV A;  1PRT C;  1M4V A;  2PZW A;  5FKA C;  4E6I A;  2HDL A;  1EY9 A;  1EL0 A;  2D5D A;  3WOE A;  5C6A A;  1HQM C;  3ERQ A;  1GXD C;  4ZKC B;  3GTK B;  1PTO B;  1DOK A;  2IT1 A;  3C1F A;  1UEA B;  1EWC A;  1SJH D;  4LJZ C;  3VR6 A;  2C9O A;  2B2Y C;  1I6H B;  5J39 A;  4M8A A;  4A3M B;  2M2L A;  3R2T A;  4PQX A;  3IL8 A;  1JOK A;  3F2U A;  2F0P A;  2EYH A;  1RDP D;  2EJM A;  2F03 A;  1WD0 A;  5JVH 3;  4DN4 M;  1NR2 A;  2L4N A;  2CVR A;  2QKI C;  2HUG A;  3FVQ A;  2F0L A;  3VYR A;  1KDC A;  3T51 B;  1BO0 A;  2JA8 B;  3S14 B;  2JE6 I;  5CR3 A;  3X3M A;  4EQN A;  3DEP A;  3H91 A;  2F0Q A;  1B9N A;  4K5V A;  3NBI A;  3TP6 A;  4UDU C;  2Q8R E;  2B2V C;  1EU3 A;  2JEA I;  2F0F A;  1LAC A;  4DAV A;  5J22 A;  2NBF A;  4C3J B;  3CRL C;  4PNY A;  3J81 E;  4HAE A;  1HTL D;  2E74 C;  1G6Z A;  2AUK A;  4KY6 A;  1K8O A;  1ESF A;  4DNR B;  3KLR A;  1SNO A;  3NTH A;  3CHB D;  4I7Z C;  1VF5 C;  2NN6 G;  4FVM A;  4ZUI A;  1R4P B;  1SMY C;  5M3F B;  2EY1 A;  1KNA A;  1H9M A;  3QOL A;  1IYV A;  1I4H A;  4CJ0 B;  1JWU D;  1E0B A;  2F0V A;  3PUX A;  5JEA H;  3A8I E;  4CHT B;  2PO4 A;  4FXK C;  3OSO A;  3EQL C;  2G9H D;  5IGF A;  4C3H G;  4KI0 A;  2BE5 C;  2B2Y A;  1PRT B;  4OIK A;  4PMC A;  2EJF C;  3N52 A;  2EJG C;  3TSS A;  1CTM A;  1WTQ A;  4KD3 A;  4LK1 C;  3TN2 A;  2PCF B;  2F4I A;  4F8M A;  4OO1 I;  1S5C D;  3FKI B;  4XT1 B;  5F2D A;  2B2T C;  1TS4 A;  4IUN A;  2WB1 B;  4PV1 C;  4CJ2 C;  5C0X I;  1RKN A;  4DF7 A;  5I2Y A;  5C3W A;  3P20 A;  1JOR A;  3K0Y A;  1Z6H A;  4WJW A;  1JB3 A;  3HEJ A;  2LY7 A;  1Q1B A;  2WP8 J;  3DWA A;  3TBI B;  2EY2 A;  1FD7 D;  2D62 A;  2SNM A;  3TME A;  4M1U B;  2HCC A;  5A35 A;  2Z4I A;  4NW2 A;  2PZU A;  3I4M B;  3PO2 B;  1Y8O B;  1NSN S;  2B2V A;  2IJ0 A;  5CV5 A;  2EXZ A;  3UI2 A;  3PIP 3;  4A3E B;  5K36 H;  2R93 B;  4IFD G;  2OXP A;  1A3T A;  4DXF A;  1O7L A;  2AQ3 B;  4G57 A;  1F9Q A;  3Q23 A;  4DK0 A;  3D3R A;  2D2C C;  2RBM A;  2JA6 B;  2FJ2 A;  1CHP D;  2EOT A;  3OWE B;  1I50 B;  2B2U C;  5G3L F;  3M7G A;  4XXE A;  4QB4 A;  2PPB C;  3HOY B;  3SK8 A;  3Q24 A;  1EYC A;  2XWJ B;  4QIW B;  2XWB B;  3SVM A;  1WTW A;  2AWO A;  1WTX A;  2WKC A;  1H9R A;  1PZK D;  2ICE C;  2JA5 B;  3SDZ A;  1B3A A;  1XWE A;  2R92 B;  1D2B A;  2KVM A;  3LWE A;  2FIN B;  5C4H A;  3I90 A;  2F0U A;  1ESR A;  2QDB A;  2KJX A;  3H3V C;  2A6E D;  2OEO A;  1II3 A;  2X6L A;  2B2T A;  2IX3 A;  1HA5 A;  3S1N B;  2CHB D;  2L1B A;  1Y1V B;  3QB3 A;  1I4X A;  3N6R A;  2F0I A;  2RDG A;  3TP5 A;  4TSS A;  5T1I A;  1JOO A;  1VMC A;  4BBS B;  3MAQ A;  5I4D A;  1HPC A;  1JOQ A;  3HP3 A;  1PXU A;  3NHH A;  3MXU A;  2F0M A;  2NYZ D;  5CBA E;  2A69 D;  4J8Q A;  2E2J B;  1AN8 A;  2F0S A;  5K5P A;  4XQJ A;  3Q6S A;  1EU4 A;  2DY7 A;  1HFN A;  2IX0 A;  2K33 A;  1GOZ A;  1V1P A;  5J1Z A;  5M5W B;  5D3I B;  1TQO A;  5EBC A;  3OMG A;  4DFA A;  3S17 B;  3K5N A;  1B53 A;  1Y8P B;  1IKM A;  4CKC A;  1DZ1 A;  3K7A B;  4N9T A;  2EYL A;  2NTT A;  2BDN A;  2IX1 A;  2B2U A;  1ZKO A;  2BDO A;  4QMG A;  3K58 A;  1XTC D;  4IUV A;  1U4M A;  1TWF B;  1H9S A;  4KV6 A;  1X3Q A;  3FEW X;  1JCK B;  5DM6 3;  1A15 A;  5FLX L;  1FYC A;  1LTS D;  4IZ8 A;  5COY A;  3GP7 A;  4WRD A;  4I65 A;  1H9S B;  2LKV A;  3I8Z A;  1BCP D;  4Q0F A;  3CKI B;  1B4O A;  1CQF A;  3RUZ A;  3L7Z C;  1AEX A;  1EIG A;  2LFN A;  1TWA B;  2HQE A;  1LTI D;  3S1M B;  1STE A;  1GHJ A;  3EVQ A;  1PTO C;  4CBV A;  3SK6 A;  1M8A A;  2B2W C;  2M00 A;  2QCP X;  5KNC A;  2NVX B;  3H09 A;  4H7B A;  1BQQ T;  4JBW A;  2F0O A;  3L3O C;  1BCP B;  3NK9 A;  4G7H C;  4IFD J;  3K5L A;  1WD1 A;  3FPU B;  3DEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...