5KRUA

Crystal structure of staphylococcal nuclease variant delta+phs t62e/v66k at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
132
structure length
132
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFEKKMKENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62E/V66K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 37
structure length 132
sequence length 132
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5kruA00
4WRDA 5ISRA 2F0PA 4EQOA 1EZ6A 1F2YA 1SNPA 4I65A 3D8GA 4K8JA 4KJNA 3NXWA 3TP7A 2EYFA 2KHSA 4KY6A 5EKKA 3PMFA 3EROA 1U9RA 1A3UA 3P75A 4KJOA 4PMBA 1EZ8A 3MXPA 3ERQA 5IGGA 1TR5A 4NDXA 4KHVA 3TP8A 2EYJA 1II3A 5JOBA 5CR3A 3OWFA 5KYIA 4N9PA 3C1EA 4EQPA 4LAAA 3QOJA 4KTAA 4DU9A 4ZQ3A 1IHZA 3SR1A 5CGKA 1JORA 5C4ZA 3SK8A 5KEEA 3MVVA 1EYDA 1STYA 4R8NA 5I9OA 3C1FA 2F0EA 4IALA 4G57A 5F2DA 4E6IA 3NP8A 2PZTA 1RKNA 3U9OA 2LKVA 5IODA 4K8IA 1KDAA 2EY5A 3T16A 1SYFA 1F2MA 3NHHA 4F7XA 4K5VA 4KD4A 2OXPA 5IGFA 2F0DA 1KABA 1SYBA 3P1HA 3BDCA 1SYCA 5I9PA 2PW5A 4NMZA 2F0NA 3T13A 1STHA 5C3XA 4HMJA 1EY6A 2RBMA 1KDBA 1EQVA 1SNQA 1SNOA 2NUCA 1A3VA 3NQTA 5J1ZA 3TP6A 3TP5A 4HMIA 4J6HA 2F0MA 3OMGA 4S3SA 1SNMA 2OEOA 1KDCA 5CV6A 1A3TA 4YIJA 3SK6A 5IGBA 1ENAA 1A2UA 3MZ5A 3HZXA 1NUCA 2EYPA 5EGTA 1EY0A 5J39A 4RKBA 1EY4A 1SYGA 4ID6A 1STAA 5CV9A 5CV7A 2F0TA 2KQ3A 5M9OA 4NKLA 1TT2A 3D4DA 3NUCA 1STBA 3QB3A 4IZ8A 1A2TA 4KY7A 5IGCA 3MEHA 1NSNS 1SYDA 2EXZA 4EVOA 2M00A 4KY5A 2WACA 5HURA 4MIUA 3RUZA 2SOBA 3NK9A 4QB4A 4B9WA 4RKLA 3R3OA 5DAUA 3V2TA 5KGUA 2F3VA 4K5WA 5CV8A 2HQEA 2F0QA 2EYHA 5CV4A 5C5MA 5NUCA 3H6MA 4K2LA 5EKLA 4HTHA 4H7BA 4N9TA 2F0OA 5C3WA 2PZUA 2QDBA 3EJIA 2F0SA 2F0WA 5C5LA 5C6AA 5IIFA 4QMGA 1KAAA 2RDFA 3SHLA 5CV5A 3D4WA 5HGTA 5IGDA 1ENCA 5IOCA 2EY1A 2F3WA 2PZWA 3DHQA 4ZUJA 4J1MA 4K5XA 5KYLA 3VA5A 4ODGA 1SNCA 2ENBA 2F0KA 2EYOA 5CC4A 2RKSA 5I6WA 2PYKA 1EY9A 3EVQA 3ITPA 4ME5A 1JOKA 4ZUIA 5JAVA 3SXHA 1F2ZA 1EY8A 2EY2A 2SNSA 3D6CA 3OSOA 4TRDA 1TQOA 2F0JA 2F0GA 1AEXA 4KD3A 4K6DA 4WORA 4DGZA 5KIXA 4K14A 4NP5A 2OF1A 2F0FA 2SNMA 3SK5A 3S9WA 2F0UA 4OL7A 4PMCA 5IGEA 1JOQA 4EQNA 1EY7A 4KV6A 5C4HA 5K5PA 3LX0A 3OMCA 1EYAA 3MHBA 1EY5A 3DMUA 2EYMA 4QF4A 4K2KA 4B9XA 4DFAA 5DEHA 3BDLA 1EYCA 2EYLA 2F0LA 4PNYA 3SK4A 3HEJA 2F0IA 5KRUA 3TMEA 4F8MA 1STNA 5J22A 3QOLA 2F0HA 1STGA 2PQEA 2PW7A 4IUNA 5E1FA 4DF7A 5I6YA 2F0VA 1JOOA 2EY6A 3E5SA 1SNDA 1SYEA 2O4XA 5E3FA
chains in the Genus database with same CATH superfamily
1EOVA 5IP9G 1JWSD 3NXWA 2I46A 3GTKB 2IJ0A 1PH8A 1BCPC 4DAYB 4JC0A 1WTOA 2HHHL 1AW7A 4X3TA 2JA7H 1PTOH 1AN8A 1II3A 3KBXA 4F87A 1CQVA 2Z0SA 1TS5A 3GTMB 3CAMA 2NTSA 1JMCA 1T5XD 1D5XC 5CGKA 1PH7A 3K0YA 1ZKOA 1D5MC 3MVVA 2BDOA 4KN4C 4DK1A 3H3VI 1TKWB 1X3GA 5IYBH 5EJWA 2PZTA 1X55A 4R4QA 3T16A 4KKUA 4LF8L 4LFBL 2JA5H 3AB9A 1R4QB 2UXCL 2CVRA 3BDCA 3GTPB 5I9PA 2JA7G 2N3SA 4GLXA 2CH4W 2OTJA 2NUCA 1OXTA 2F0MA 4S3SA 1QG7A 4ZKBB 5IYBG 1YHAA 5M5XB 1XNRL 3KF6B 1PVOA 1DOMA 4DR5L 5EGTA 2FXQA 1DXMA 2A69C 2UXDQ 1TWCB 4DV0L 3L2PA 5C4XH 3NUCA 4C56C 4TSSA 1A2TA 3MEHA 2R3ZA 4ZK9B 3DUZA 1SN8A 4X65L 5JVH3 5KGUA 1H9RA 1BBUA 4PG3A 2EYHA 2JA9A 3I91A 2K03A 3WOEA 2KBNA 4GLVB 2UUAQ 2BH2A 4JBMA 2Q8RE 2WKCA 4C3IH 4JI6L 4QMGA 2XVSA 1KAWA 4A3BG 2K75A 1XTCD 2F3WA 1AZPA 3EFXD 5IT9c 1CSQA 1KLUD 1B7YB 3DEPA 5JVG3 5C4XG 1IBLL 2PYKA 3VR2A 4ME5A 1ET9A 3M3YB 1EL0A 2KVMA 2KUMA 2ATWA 3D6CA 3K7AH 3OSOA 3A8IE 2N88A 1CHPD 4DV2Q 2LY7A 4HCEA 2K5NA 4K14A 2CKZB 4C2MH 4JI1L 5KNCA 4POGA 1EY7A 1D2BA 1EYAA 3MHBA 4LMQD 4C3IG 1B3QA 1HR0L 4YWMA 2F0IA 1GM5A 5KRUA 3HOYH 1P8LA 3NQIA 1UAPA 3NENA 5ISRA 1VQIA 3D8GA 1Y8PB 2NZOA 1NCVA 4LJZC 5EKKA 4PZ8A 4JYAQ 4PMBA 3B6YA 2X69A 1T5EA 1BUVT 4RFBA 2EYJA 4X66Q 3OPOA 4EQPA 5M3FB 1WTQA 1HNWL 5D3DA 4JG2A 5C4ZA 2IW3A 3HOYG 2R6GA 1EYDA 4IPDA 4RG1A 2V1CC 2A6HC 3E9IA 2E5LQ 4L5QA 1FNVA 5LMNL 5A2QL 3H91A 2B2TC 1LTTD 1WCMH 3CKIB 3TREA 4DK0A 3T13A 3VYSA 1X9NA 3BVMA 1CZWA 2LMCB 1E2ZA 5BN5A 1D5ZC 2YTVA 2VQEQ 3M7NA 1S40A 1I94Q 2A6EC 1VQ9A 4CHTB 4BS9A 4DV5L 4EQ5A 1ENAA 2B2TA 4L5TA 1WTRA 3U4ZA 1TWGH 2KJXA 3HZXA 1PYBA 4DUZQ 2M2LA 1ASZA 1TWFH 3QJYA 3AYHB 3CC4A 4DPGA 1WCMG 5M9OA 5I2YA 2YYZA 4GKKQ 3CD6A 1QB5D 3F1ZA 1PYSB 2CWAA 5M5WH 4QB4A 4DUYQ 2G5DA 1WFQA 1CHQD 1MSHA 1SJHD 2HHHQ 1HTPA 1S5ED 1Q46A 2P5ZX 4LWCA 3HRZC 2PQAB 1WVLA 2PZWA 4XT1B 1YJWA 3I4LA 3J81E 3AQQA 1EY8A 2F0GA 4C3JH 3HOWB 1VMCA 4IUTA 4LFBQ 4OX9L 3S9WA 1VQBA 1NJIC 4QF4A 3RNUA 2HCCA 4ME3A 2B63H 1G6ZA 3D6WA 3TMEA 1STGA 4QIWE 2A5HA 2Z6KC 1QUQB 4XQJA 3TS0A 1SYEA 3K7UC 1LT4D 4C3JG 2D9UA 4LF4L 1L2FA 1C9OA 4DV0Q 2R7DA 4ALPA 1J5EL 1S72A 2LSSA 4BBSB 3S1QH 3ERQA 5JJIA 4X65Q 4FO2A 1LV9A 1SR3A 3HFZB 2B63G 1ENFA 3S16H 1V1PB 2KECA 4DU9A 1Q1BA 2Z6KA 3SR1A 1D6EC 1X3FA 3MFYA 5KEEA 2CQOA 1FVIA 1FL0A 3NP8A 1WTWA 5EPLA 1HUMA 1MIUA 4ZLTF 5IYCH 1B44D 5EAYA 1EU4A 1VS0A 3PCOB 1IKMA 1DYQA 1CTMA 3RN5A 4DNTB 1NNXA 5T1GA 1CA5A 1EQVA 4XT3B 1A3VA 4JI4L 1DOLA 1GJXA 1RHPA 3GTJB 3ND9A 2E2HB 2L11A 4JI1Q 3NBIA 1IBML 1ZYRD 4A76A 4JI5L 2H4OA 1YEZA 4IPHA 5IGBA 3DXJC 5C44H 1X3QA 1HR0Q 3E9HA 3MFGA 1NBWA 2D5DA 1XMOL 4CJ0B 2PI2E 5IYCG 2X6LA 4CGYB 5C0XJ 2AKWB 3LWEA 1Z9FA 4NKLA 2LFNA 2MP1A 3P7JA 4TKOB 4C1NI 2JA7B 1PTOB 3RUZA 3M4PA 2UXBL 2DY7A 2EOTA 4B9WA 2CHBD 1PZID 2MQHA 1CT1D 1UEAB 1VQ5A 2J4XA 3D31A 2RQXA 2XWJB 4C3HH 4N9TA 1PH1A 4GOPC 5C44G 4DNIA 2B2UC 1MKHA 3Q6SA 1HNWQ 2BE5C 5LL6S 4JPBW 2VB2X 1HFNA 3S2HH 1TS4A 5LMNQ 4A3EH 4WORA 2QEJC 1W3SA 3RLOA 4GOPA 3Q0AA 3I2ZA 2B2YC 4C3HG 4KV6A 4R1JA 3NTIA 3OMCA 1PRTC 1WJJA 4Z9CB 1RDPD 1W6JA 1IYVA 2PCFB 1K3BC 1NAPA 1YZ6A 5DEHA 4WJWA 4P73A 4A3BB 1HHVA 4G4KA 1I5FA 3DEOA 3NBHA 5C4XB 2TMPA 3ULJA 4ZKCB 3CXCA 4MTNA 4DV5Q 1TIID 1HZCA 1VQOA 4A3EG 3KJPA 4OONA 1EZ6A 4EQOA 1EQRA 1YHBA 2EYFA 4DV4L 2JQOA 3CCUA 4HIOA 5LL6X 4H13C 1T9HA 2G9HD 4C3IB 1HTLD 2B2WA 1V43A 5GQOA 4IUVA 3EN2A 2VXWA 2ZTDA 2NVXH 1HNZL 2IT1A 1HFGA 5ELDA 2KOLA 3T1HQ 3VR3A 5IYDH 3K7AB 2KHJA 3G71A 2MJ8A 4GNXC 2JK8A 2VW9A 1L0XB 4C2MB 1SDFA 4FDBA 1QZHA 2A68C 2RSNA 3TP5A 4RA8A 4OIJA 3CCMA 3HOYB 1QZGA 1VQMA 5JJZA 3ONAB 4OEMB 3J80c 2E75C 1A2UA 5IYDG 3K81C 1EY4A 2YTXA 4AQYL 1JE5A 1PTOD 1BVSA 1ONLA 3GTLH 1TT2A 4KY7A 4IZ8A 4NW2A 1EIHA 3HOZH 4QCLA 1BQQT 3NTHA 3R3OA 3UI2A 4LF4Q 2OQKA 1J5EQ 1U5KA 1RD9D 3PUVA 5D14A 2N78A 3OHXC 2PZUA 3EJIA 3HKSA 5C5LA 4Y52H 3STBD 1C4QA 1I4XA 1N34L 2B2VC 1UE7A 1WCMB 1ML0D 4QQBX 1JCKB 4P2CB 3HOZG 1Y8NB 2VUMH 4IOAA 4RGOS 2F0JA 1I6VC 3H0GG 1EIFA 1VQKA 2OF1A 4R9WA 2JXMB 1CA6A 3RR5A 1LTAD 1Q81C 1EWIA 3SE0A 1SAPA 4PZ6A 2B2VA 3JAMc 3SK4A 3PO2G 1TWFB 3T53B 4F8MA 1IBMQ 2PQEA 5C0XI 1KIXA 2E2DC 1QCBD 4L63B 1HZ9A 4JI5Q 3WOFA 1C48A 3TZUA 1GUWA 1SEBD 1XMOQ 4A3JH 2VUMG 3KUPA 4X6AH 2NN6H 2ZJRA 2K5VA 5E4XA 5ELNA 1F77A 3KLRA 1EZ8A 2UXBQ 5FO8B 1DONA 1CKMA 3D4RA 3GTQB 1CKNA 1V9PA 2F4VL 3QOJA 2WFWA 3CRKC 3HOXH 2JSOA 2O5IC 2HQLA 1OTCA 4R4IA 4IALA 4A4IA 3M85A 5FJ8H 1KLGD 4A3JG 1N36Q 4C3JB 2NN6G 1OXVA 4FXDA 4B08A 2F0NA 1V1OA 1K0SA 3LNNA 1V8QA 4UDUC 1CI3M 2B63B 1JJGA 1PFNA 2GVAA 3GV6A 3HOXG 1JB7A 2AMCB 2HDMA 4IFDH 3H94A 3GD7A 1KNEA 3TEHB 1O7YA 3W1BA 2KEEA 5FJ8G 3CCEA 3W5OA 1LTLA 4QIWB 4DV2L 2QA4A 3QB3A 2XTIA 2J7ZA 3S1QB 3S17H 2WACA 3CRLC 4QUCA 3S16B 3S2DB 1HUNA 2HQEA 4IFDG 1GUTA 1KC8C 4OWTB 1LTBD 3T56B 4HIKA 4IJLA 3G48A 1HNZQ 1W2BA 4K5XA 1VQEA 3VA5A 2F0KA 3AEVA 5JEAH 3K58A 1JOKA 1Y14B 2HDLA 2Z8LA 2UUCL 2XN9C 4GN3B 2O5JC 4WJ3M 5FLXc 3CQZH 4A3DH 2BOSA 4CDFC 1DZ1A 4K6LA 5C44B 4KHPL 2VNUD 3DMUA 4A3FH 2CW0D 1LO5D 2B8FA 3K0XA 5I4DA 2HCIA 3HS0C 1N8RC 3J7A5 2EY6A 5JEAG 3E5SA 4JI7L 1PFBA 1SFOH 1BXTA 3TS2A 4AQYQ 3TP7A 3C2PA 2KHSA 4KY6A 4CDCC 1D7QA 3PMFA 3CCLA 4A3DG 2RCFA 1OXXK 3P75A 4C3HB 2IX1A 1N9WA 1RJTA 4UPAA 4A3FG 1B9MA 3QWNA 4TVAB 4LAAA 4ZQ3A 4FF2A 2V4DA 2ZXOA 3NE5B 3L0OA 5CMDA 3RLFA 3U58A 1H9JA 2KEDA 2RDHA 2LKVA 3S2HB 4A3EB 1N34Q 4H0LC 5T1IA 4EX5A 1ESFA 1H9SB 1I3QH 2L5TA 1RCVD 1G51A 2F0DA 3J81c 4DUYL 1SYBA 1DOKA 1SNQA 1MBYA 4OO1H 2F52A 1BOSA 4L5RC 2VS1A 2ZTEA 5M5YH 3U9SA 3S1NH 2JA6H 5EPKA 3RN2A 3PGZA 2A6ED 1BCPF 1QVFA 4X64L 1X56A 3S14H 5AJ3Q 1HR0W 4LW1A 2Z9HA 2KQ3A 3OTOQ 1FGBD 1YJ9A 1VQLA 3K5NA 2I5HA 4OO1G 4TQUS 1GUNA 3MXNB 5DAUA 3I3CA 3H3VC 5ELEA 1SSOA 3JAME 4PQXA 2F0OA 2NBFA 5C3WA 1KAAA 2F4VQ 1M90C 4GOPB 1JC7A 5KNDA 4N8FA 4APVA 1WD0A 5I6WA 4LF7Q 2JA5G 1HH2P 3U50C 1VQAA 5C3EH 1E0BA 2RHSB 1GUOA 1TXYA 5LMNW 3NBHB 2F0FA 2EPBA 1SMYD 2Y0SE 4LUVA 4EGVA 1G6PA 2TSSA 3SVMA 2CQAA 1YI2A 1G2SA 2EYMA 2MO1A 2C9OA 4DF7A 1IBKL 3I70A 3GTLB 3CW2C 4GLAC 3FKIH 2N8NA 1SNDA 3HOZB 4WRDA 5C3EG 4HJ7A 4Q0FA 2AQ2B 5FOBB 1EWCA 3H0GB 3RZDH 2UU9L 4LF9Q 1N33L 3BVZA 5BN3A 1A3UA 3Q22A 1C8CA 3E0EA 3FPUB 3PUZA 3PO2B 3PIOA 1D1IA 1HA5A 2Y0SG 3PIO3 4QL5A 3FKIG 2G9DA 3KFUA 3H3VH 4XYOA 3I7FA 3M9BA 2CWPA 2VUMB 4V190 2BH8A 3HKZE 2KA7A 4B3RL 3BVGA 1DD2A 2E8GA 2LS01 2Z4IA 3I72A 2UUCQ 3MAQA 3LGJA 2OEOA 5CORA 2J0TD 3CCJA 4HJ9A 4KHPQ 1GD7A 2BCOA 4CKBA 2WAQE 4CBVA 5HGQA 1EIYB 1M1KC 4XDXA 4JI7Q 1VQ4A 4DXGA 2EXZA 4YCVA 5TSSA 4K0KL 4ZCKA 5FLXE 1CSPA 2L4NA 1S5FD 1B53A 4CJ2C 3HKZG 1K8AC 1KRTA 4QGUA 4MHEA 3MXGA 3I4NH 2XRQD 1GHJA 4V0BA 1MJCA 3DLLA 1VMPA 4UHVA 1Q82C 1SXTA 2QILA 1M8AA 3ULLA 1UE6A 5KYLA 2YV5A 2RKSA 2JEAI 2I5MX 2WAQG 3ZYYX 2SNSA 3K5OA 1I50H 1AEXA 2EJFC 4DGZA 2OWOA 3FHWA 3I4NG 5D65A 3SK5A 3N52A 4OL7A 4O42A 1VQHA 3SGIA 1FJGL 4ULLA 3HEJA 3T1HL 2K6AA 1F9PA 1STNA 2E2IH 1SE3A 3KLSA 4X3UA 3S17B 4F88A 1MJEA 1CKNB 5E3FA 4X64Q 4K8JA 4CKCA 1HNXQ 3QR8A 4P71A 3CC2A 1EYGA 4NDXA 5IE8A 4KHVA 1Q90A 1WTXA 2A19A 1F9QA 3S24A 2HIVA 3K59A 2HUGA 2DN8A 3GTOH 3PV0A 1VDZA 2R93H 2ZXPA 3A5ZB 3CCSA 5E7NA 1SLJA 1CZGA 4F7XA 4A3CH 1JJ2A 2FINB 2NZHA 1QVCA 4KK7A 5ELCA 3CQZB 4A3DB 3GDEA 1SYCA 2KCNA 1GVPA 4A3FB 5FK9C 3GTGB 3VR4A 2KCTA 3NQTA 3BYTB 5IY0A 3OMGA 3OYYA 2DGYA 3KBGA 4M8AA 1A3TA 2F1MA 2R93G 1SFOB 1IYJB 1PH4A 1V1QA 3KDFA 4KMUC 3CP0A 4RKBA 1RF2D 1NTGA 1STAA 1IBKQ 2R7ZH 5FO7B 4L6TB 3F2DA 4GN5A 1XWEA 2Q2HA 3NK9A 3EIVA 4IO9A 2K32A 2MUYA 2UU9Q 1N33Q 4JOIC 4XIGS 4KN7C 3W1GA 2R7FA 1TS3A 2F0SA 5CYUA 5C6AA 3NEMA 3NELA 5H1SE 2EDGA 5DLQE 1W6KA 1ASYA 1I3QB 1AP0A 1E3PA 2EZVA 4JI3L 2ZM6Q 2Q8IB 4JOIA 3K80C 4WJ4A 3UE1A 1IKLA 4O0AA 1Y1VH 3HOVH 4A3LH 4K6DA 1QJOA 1GXDC 1LTRD 4B3RQ 5M5YB 3K57A 3S1NB 3AU7A 1FD7D 4J15A 1J8IA 4UP9A 1DCZA 3S14B 4DAYA 2NVQH 3QOLA 2KCCA 4RH6A 1N36L 2JA5B 4NB3A 1J9OA 5JEAJ 3M4YA 2O4XA 2E76C 2KCMA 1Y1VG 4A3LG 2IX3A 4LFCQ 2VQFL 4K0KQ 2B2UA 3HGBA 1JR0D 3VYUA 1NE3A 2XSCA 1IW7D 1ZEQX 3E3XA 1MD2D 1BBWA 1YNNC 5A2QE 1JORA 3SK8A 1WYDA 4R8NA 4DV3L 2Z4HA 1B4OA 1ESRA 3NPPA 1TWHH 3IL8A 1VCIA 1PFMA 4IUUA 5IWAQ 5C3EB 2EY5A 4A3IH 1PRTF 2O2LD 4XQQA 1XMQL 2B2YA 2ZT9C 1CKOA 2VB3X 1STEA 2PNHA 2RBMA 3OW2A 3GTKH 4HN7A 1KDBA 3R8BA 4DV7L 1PHJA 1S3OA 3TP6A 1BCPB 4J6HA 2DJGC 2Y0SB 1LYLA 1WTVA 2QDLA 4OHJA 1FJGQ 3A54A 2L0CA 3Q8DA 3FKIB 2WKDA 5C4JH 3Q23A 1BR9A 4A3IG 1EY0A 5J39A 2IHEA 1A0IA 3TSSA 4B3TL 3RZDB 3S15H 3A7LA 1E7ZA 1SYDA 3A5UA 4MIUA 2AQ3B 1PV4A 3TZDA 1D1KA 4K5WA 1VF5C 4DR2Q 2F3IA 4HR7B 3A0JA 1WTPA 2FFKB 3L9AX 2EQSA 4GNXA 1HPCA 4IN3A 1RODA 1YJNA 3VR5A 4KKSA 1CUKA 2NN6I 2K5QA 5FO9B 1PA6A 1RTNA 1F2ZA 1H9MA 1LLRD 1TQOA 1B9NA 3IFDA 3HKZB 1Z47A 2A73B 5KIXA 1VQCA 1VQJA 3CPFA 3BYYB 1P16A 4CDEC 1Q12A 5K5PA 3EA6A 4RGMA 4DFAA 4O1NA 2EYLA 1ICFB 4ZYSA 1A62A 2C35B 2PW7A 4JV5L 3J80L 2D62A 4LUZA 2WAQB 1K8GA 1LT3D 2F0PA 3VDYA 4I65A 1SNPA 1HQRD 5BN4A 1CQFA 3I4NB 2NB0A 1A8VA 4JBWA 5IGGA 1E1OA 3OWFA 2ZJPA 4XQNA 1ZYRC 1ET6A 1LM0A 3R2IA 2JYOA 4O2DA 1O7ZA 1TVXA 1TWGB 3CF5A 1O7IA 4MNOA 3J7AV 1IZ6A 1STYA 4FF3A 5AJ3L 3I4MH 2DNCA 3JC66 3S1MH 1LACA 3U9OA 1RKNA 1Q86C 5IODA 4K8IA 5GROA 1I50B 5DM73 3OTOL 4POFA 4K5VA 3OIQA 5M5WB 1RTOA 4JI3Q 3TBIB 3E6ZX 1YIJA 3DM1A 1BCPD 4HSPA 3I4OA 1IL8A 2JEBI 2E2IB 1QOHA 1TY0A 2LXKA 1Q8IA 3I4MG 3F2UA 4GZYC 2AQ1B 2EJMA 1ZXTA 2I0QA 4AYBG 3CMAA 4LF7L 4DR4L 3R93A 2VY3A 5CV7A 5A35A 2XGTA 5IGCA 4UP8A 2Z6BA 4KY5A 3MEFA 3KJOA 1EUJA 4FXKC 4U673 4OWXB 1KQSA 2EVBA 2RSOA 2VQFQ 5EBCA 4ZAIA 3GTOB 1Q8KA 2R93B 1VQDA 3KF8A 2WB1E 2Q2TA 4B3ML 5CV5A 4IQZA 2JP1A 3D4WA 5FKAC 3RD4A 1XYIA 1GKHA 1ENCA 1AE3A 1PH9A 2CFMA 4KI0A 3DHQA 1BBXC 5EPJA 1L0YB 4DV3Q 4JK1C 2A69D 3ITPA 4LF9L 1VQ6A 4OELB 1F9SA 5M3MH 1GUGA 2VL6A 1XMQQ 2Q8TA 4MTKA 2A74C 2OT2A 3G6JB 1QUQA 4PMCA 5ELOA 2KENA 4EQNA 4BA1I 3LX0A 3VYRA 1B1ZA 1QNKA 1PZJD 3OWEB 4DV7Q 1S5BD 4PNYA 3M4OH 1B8AA 3J80i 1R9TH 2I5LX 2F0VA 2WB1G 1UE5A 2WV6D 4HIMA 1AZQA 4KD4A 1R4PB 3SEBA 5M3MG 4B3TQ 3QIAA 4QUFA 4OO1I 3W3AA 4HJAA 3I55A 3NWSA 2L1BA 1IXRA 4HJ8A 1EQTA 1K8MA 3L3OC 4RGTA 1D8LA 1QE6A 4G7OC 1PLFA 4OGQC 3ICEA 2R61A 2IY5B 3V96A 4DN4M 4FYDA 2FHTA 1XPOA 1Z6HA 1N32L 4G57A 1PTOC 2B8GA 5GAGC 1PXUA 1Y1VB 2AUKA 4A3MH 2H1EA 1SJED 3CCRA 2PW5A 2RCNA 1WD1A 1KRSA 2OQ0A 4BBSH 3GQBA 2NVQB 1OO9B 1E22A 1O80A 3WWVA 1KNAA 3A7AB 2LXJA 2QCPX 3G6EA 1NMFA 2MNAA 2EYPA 1SE4A 1QILA 4R4OA 1HA6A 4A3MG 1PH5A 2A6HD 1SYGA 2ZTCA 4JV5Q 2DNEA 2GA4B 4DR6Q 2R92H 2M00A 4DKAC 3BU2A 3F2BA 2ALYB 3O13A 1Y1WH 4A3GH 5AFWA 5CV4A 5NUCA 4X3SA 1FR3A 1AH9A 1L1OC 4HJ5A 1HZAA 4HTHA 2EIFA 1BNZA 2ES2A 3PUXA 5IIFA 3Q24A 1M4VA 3OIPA 3GTJH 1TWHB 1JB3A 4ILWA 3U4VA 4ODGA 2A8VA 1YNJC 1HNXL 2R92G 3CCQA 4DNRB 1L1OA 2FMCA 3IKJA 2ID0A 3UDGA 3CCVA 1Y1WG 4A3GG 3J81L 4HIDA 4R4TA 2IWHA 3G7LA 4CKEA 1XNQL 2NVXB 2JA6G 4DK3C 5CBEE 2QW7A 3K5LA 1S4ZA 4B9XA 5C4JB 3NSWA 2L55A 2JN4A 4DV6L 3T1YL 4IPGA 2Z1CA 3BZDB 1XXGA 4YCWA 5ELFA 5GAEC 3S15B 1XX8A 3FRPB 2HIXA 2XRSD 4OIKA 1BKBA 2JE6I 4DR4Q 4LF6Q 4DV1Q 3DWQA 4N8X1 3MXPA 1TR5A 5JOBA 4X62L 5GADC 1PH3A 4A93H 3S1RH 4JI0L 3PO3H 3I90A 3BZKA 1PRTB 2NZ1D 4A3BH 4B3MQ 2Q2UA 5IP7H 2RVLA 4HSVA 2MO0A 4GN4B 4BWGB 3GV3A 1KDAA 3PSIA 5JPMC 3VYTA 3ULPA 2DUDA 1RL2A 3P20A 4DR3L 2MPMA 1SNOA 4A93G 1E2WA 1E24A 5I2XA 1Y8OB 3PO3G 4YY3L 4YHHL 3H15A 4JBKA 1SNMA 2L12A 2K5WA 1LABA 5IP7G 2CCZA 3MZ5A 1JICA 3KK7A 1FNUA 2ZM6L 4GS3A 5IT9L 1IYUA 1NSNS 1Z7TA 4EVOA 3ER0A 5HURA 1KD1C 3KOJA 2MFIA 1F2LA 4RKLA 4DAPA 4GNXB 3V2TA 3DWAA 3C46A 4J8QA 3RMHA 3H6MA 2SDFA 1UEBA 2CW0C 2Q2IA 3I4MB 4BY7H 3S1MB 3SHLA 4LF5L 4IURA 2IHFA 5HGTA 2NVTH 4AYBB 5IGDA 5IOCA 4A3JB 5CC4A 4BXXH 1HCZA 1N32Q 5LMUL 3CMEA 3A74A 2EY2A 1VQNA 4LFCL 1WI5A 3J81i 1DJRD 4BBRH 3BS1A 2KHIA 1ICWA 5G3LF 4DR7L 5HY6A 3HOXB 1G8ZD 3DM3A 1K9MC 4BY7G 1XPUA 1Q1EA 4KKTA 4UP7A 1LTSD 5J22A 1K3RA 4IOCA 2QGQA 1I4RA 3MC0B 5IWAL 2K14A 4BXXG 1JOOA 2BE5D 3RZOH 4JI2Q 3URYA 1UE1A 2PO4A 1K28A 4BBRG 5EQ0A 3GP7A 3PUYA 3FDTA 2WP8J 4Y7NH 5JJKA 1K0RA 1WOCA 4DXFA 2E74C 2PPBC 5KYIA 1NMGA 4FXGC 1FYCA 1PRTD 1YNND 2K5HA 3UDIA 2PMZB 2WB1B 4BA2I 1OXSC 3PUWA 1K8OA 1UNSA 2JA8H 2X6GA 5M3MB 3J81j 2OXPA 3J7AF 1HZBA 4PV1C 2SEBD 2AHOB 2B39A 3ZJYC 1MSGA 1STHA 5C3XA 1CFMA 4DR2L 2EXDA 4DR1L 2QEXA 3M4OB 1BF4A 5GAHC 2H5XA 1TY2A 1R9TB 1XNQQ 3GTQH 1KXLA 2FMMA 2D2CC 1NUCA 4P75A 4DV6Q 2JA8G 3T1YQ 1SE8A 1YBYA 4IUPA 2F0TA 3UDFA 3D3RA 3D4DA 3RLNA 1MI2A 3KF8B 3J7ZC 4LF8Q 2SOBA 1SRUA 2UXCQ 1SMYC 1I6HH 4A3KH 5C5MA 1NY4A 2GN5A 1GUSA 3F8TA 3OOCA 2A68D 4IPCA 2K52A 5EKLA 1TS2A 2BA1A 5FLMH 5K36H 4X62Q 1X54A 2QF7A 1AE2A 1PZKD 2D0OA 2IL8A 1PYWD 3VR6A 4JI0Q 4LFAL 4A3MB 1XNRQ 2E2JH 4DAVA 2XIWA 4DR5Q 1EFWA 2K33A 3BDOA 2UUBL 4A3CG 3K8AA 4ZUIA 5JAVA 3IRBA 3SXHA 1XJVA 4KD3A 1LUZA 4PZ7A 4P74A 3FP9A 3H09A 4A3KG 2K7VA 4AIMA 2PI2A 3S2DH 4DR3Q 3A56A 5FLMG 1SROA 2K4KA 5K36G 1O78A 4IFDJ 4LUOA 3BDLA 2F0LA 1X32A 4AH6A 1Y69U 1C7YA 4FF4A 4YY3Q 2JJQA 4YHHQ 4I7ZC 1SBBB 4JI6Q 1A6XA 5E1FA 1EEID 3FPPA 1TWAH 1LTGD 4FF1A 2R7ZG 2R92B 4M1UB 1IBLQ 2I07B 2PNRC 3L7ZC 4DK6C 1Y1WB 4A3GB 2A1AA 1JWUD 2CH4A 3EROA 1X3EA 1U9RA 2K1BA 2NYZD 4RGNA 4RHRA 1PFSA 1E1TA 2JA6B 4H44C 4JI8L 3TP8A 3A8JE 5CR3A 1H9SA 5JPNC 3C1EA 1VQGA 1OXUA 3A8KE 4YCUA 5IT9E 2L15A 3BJUA 1UWVA 5I9OA 3C1FA 4NPSA 4BY1H 1CM9A 4LF5Q 3DWPA 1JWMD 1G2TA 2AWNA 4I7AA 1F2MA 1PDQA 1X3PA 5IGFA 1NR4A 3HOVG 1Q7YC 1KABA 3TRZA 1QWYA 5LMUQ 4L5SA 3AMUA 3CC7A 3T51B 1VF7A 3X3NA 1EQQA 1KTKA 2YU9H 4HMIA 1MHWC 1RIPA 2IX0A 2HD3A 4DR7Q 1JQYD 2RA4A 3E0JA 5BR8L 3HOUH 5ELBA 4BY1G 5CBAE 1VQ7A 3MXNA 1TU2B 1U4PA 2NVYH 3A55A 2K05A 3SDZA 1JE4A 1K83H 1H95A 1STBA 2OCEA 3W2DA 4JCVE 4GKJL 5COYA 4NXNL 3KF6A 4A93B 3ND8A 3S1RB 3PO3B 4NXML 4ZRZA 1JJCB 1HJPA 2MHVA 4H7BA 3HOUG 2VZAA 4IUQA 1L1OB 2K50A 4WFN3 3GTMH 2B2WC 4CJ1B 3LWUA 1AFPA 2EY1A 4XYQA 1EEFD 4JVZA 3IAYA 1SNCA 2EYOA 3AFPA 4JBJA 1EU3A 3EQLC 4B3SL 4H02A 4KHZA 2AUJD 1CK1A 4RCNA 4XXEA 2F0UA 2XWBB 4CDDC 3GTPH 4Q5VA 5C4HA 3CPWA 1EY5A 4DR1Q 1X6OA 3KLSX 2EJGC 2N55A 2B29A 1XPRA 5M5XH 4QJFA 2B3GA 1I4QA 3V05A 4KJNA 4G7ZC 4UY8C 1TWCH 3F2CA 4RCOA 2ICEC 4JW0A 4OX9Q 4BY7B 1GO3E 5DNFA 4N9PA 3HP3A 2NVTB 3FMCA 4KTAA 1IHZA 3IFTA 1HQMC 2EE1A 4MN3A 1IL2A 3ERSX 3EBEA 4E6IA 3I56A 4DAMA 1MGSA 4RWSC 4LFAQ 4DR6L 1SYFA 4BBRB 2RHQB 1PMRA 1EOTA 1JT8A 4RMFA 2UUBQ 3QO2A 3MWYW 4QY7A 3M3YH 2D0PA 5LHY1 1Q3LA 3H0GH 4HMJA 4RHSA 4IFDI 1O7LA 2XNAC 5EBDA 4P72A 1LT6D 1L0WA 3UE0A 3OW7A 2F03A 1KDCA 5CV6A 4YIJA 3BZCA 3SK6A 4ABNA 4AYBE 5L37A 3PO2H 3RZOB 2ZXRA 1QNUA 1SMXA 1YITA 1EIGA 3K6OA 4IJHA 4ID6A 5CV9A 2ZJQA 4Y7NB 5E4WC 5J3BA 1KL9A 2DJFC 3AFQA 3TN2A 5CV8A 1ILQA 2M9VA 3QG1A 2BDNA 1EWHA 2WINB 4JI4Q 3J7YW 3M4QA 4JI8Q 2F0WA 2RDFA 5M3FH 2JA8B 1VQ8A 3VA7A 3TDQA 2AWOA 4J1MA 5JJLA 3JAML 1G291 4LF6L 1YNJD 4DV1L 3EVQA 1U4MA 2F4IA 4TRDA 1H9KA 4U68A 3PIPA 2PQAA 2NTTA 3PIP3 4NP5A 2MGSA 2SNMA 1PH6A 2OTLA 4FVMA 4MZ9A 4LNQA 1JOQA 1YVCA 1IW7C 3PF4A 1SE2A 5KNBA 5M3FG 2PMZE 2K28A 2UXDL 2ASBA 2IPKD 5BR8Q 2K01A 2BA0A 2ICIA 3HG9A 5I6YA 4OXPA 1F2YA 1I6HB 1VQFA 2K04A 4A3KB 4A75A 1E2VA 4HCSA 2HT1A 1LT5D 4KJOA 2UUAL 4GKJQ 2L9HA 1X65A 4NXNQ 1U4RA 1B3AA 1FGUA 5DM63 3N6RA 4NXMQ 2E2JB 5D3IB 3T4AC 1XTDA 2C5CA 1U0LA 2F0EA 5F2DA 4LK1C 1QVGA 2R7ZB 2FJ2A 3MXUA 3NWTA 5C0XH 3NHHA 2RDGA 1V1PA 1HXYD 4PMWA 3WDNA 1F9RA 2QKIC 4YWLA 1KHIA 3P1HA 4B3SQ 4OWWB 4NMZA 3NTKA 4YWKA 4DV4Q 1EY6A 3UDXA 3K5MA 3HOWH 5J1ZA 1A15A 3MA2B 1BDOA 1TWAB 2DY8A 2WIIB 3G4SA 1VQPA 1NR2A 5C0XG 2K5DA 4HEDA 4L8JA 1HRJA 1EFID 4G7HC 1K73C 3HOVB 1C0AA 4JYAL 1J6QA 3I8ZA 1FNWA 1I4PA 3FEWX 1GOZA 5EKIA 4XTCS 4X66L 1ILPA 3HOWG 1S5DD 2F3VA 4FNFA 4DA2A 2F0QA 1PTOF 3KDFB 1I4GA 1A63A 3BG3A 4K2LA 3D0FA 3GTGH 3PF5A 1B70B 2N49A 2QDBA 5FLXL 4BY1B 4X3KA 1G91A 3STBC 2E5LL 3GO5A 1GHKA 3M7GA 3CHBD 3JAMi 1PH2A 3MTSA 4HAEA 4ZUJA 3PQIA 4JI2L 5G3LD 2ENBA 3I73A 1BO0A 3KLWA 1EY9A 4KLKA 4R4CA 4RAUC 4C1NK 2RF4A 3FVQA 2GVBA 5IP9H 3TQYA 2YU9B 1DGSA 3CU7A 1DM0B 1YNXA 2YTYA 5IGEA 2VQEL 1B50A 4BBSG 1B2TA 3HOUB 1I94L 3R2TA 1LTID 3J80E 1UUPA 4K2KA 4FP5D 1YHQA 2NVYB 1EYCA 3C3LA 4DUZL 1S5CD 3X3MA 2E2HH 3KYHC 4UAIA 1K83B 2F0HA 4IUNA 4A3IB 1U4LA 2NWGA 1I4HA 4GKKL 1WTHA 4R8IA
chains in the Genus database with same CATH topology
1JWSD 3NXWA 2I46A 3GTKB 2IJ0A 1BCPC 1WTOA 1AW7A 4X3TA 1PTOH 1AN8A 1II3A 3KBXA 4F87A 1CQVA 1TS5A 3GTMB 2NTSA 1T5XD 1D5XC 5CGKA 3K0YA 1ZKOA 1D5MC 3MVVA 2BDOA 4KN4C 4DK1A 1TKWB 5EJWA 2PZTA 3T16A 4KKUA 3AB9A 1R4QB 2CVRA 3BDCA 3GTPB 5I9PA 2NUCA 1OXTA 2F0MA 4S3SA 1QG7A 4ZKBB 5M5XB 1DOMA 5EGTA 1DXMA 2A69C 1TWCB 3NUCA 4C56C 4TSSA 1A2TA 3MEHA 2R3ZA 4ZK9B 3DUZA 5JVH3 5KGUA 1H9RA 2EYHA 3I91A 2K03A 3WOEA 2Q8RE 2WKCA 4QMGA 2XVSA 1XTCD 2F3WA 1AZPA 3EFXD 1KLUD 3DEPA 5JVG3 2PYKA 3VR2A 4ME5A 1ET9A 3M3YB 1EL0A 2KVMA 2KUMA 3D6CA 3OSOA 3A8IE 2N88A 1CHPD 2LY7A 4HCEA 4K14A 5KNCA 1EY7A 1D2BA 1EYAA 3MHBA 4LMQD 4C3IG 2F0IA 5KRUA 3NQIA 1UAPA 5ISRA 3D8GA 1Y8PB 4LJZC 1NCVA 5EKKA 4PMBA 2X69A 1T5EA 1BUVT 4RFBA 2EYJA 3OPOA 4EQPA 5M3FB 1WTQA 5D3DA 5C4ZA 2IW3A 2R6GA 1EYDA 2A6HC 1FNVA 5A2QL 3H91A 2B2TC 1LTTD 3CKIB 4DK0A 3T13A 3VYSA 3BVMA 1CZWA 2LMCB 1E2ZA 5BN5A 1D5ZC 3M7NA 2A6EC 4CHTB 4BS9A 1ENAA 2B2TA 1WTRA 2KJXA 3HZXA 2M2LA 3QJYA 5M9OA 5I2YA 2YYZA 1QB5D 4QB4A 1CHQD 1MSHA 1SJHD 1HTPA 1S5ED 3HRZC 1WVLA 2PZWA 4XT1B 3I4LA 3J81E 1EY8A 2F0GA 3HOWB 1VMCA 4IUTA 3S9WA 4QF4A 2HCCA 1G6ZA 3D6WA 3TMEA 1STGA 2A5HA 4XQJA 1SYEA 1LT4D 4C3JG 2D9UA 4BBSB 3ERQA 4FO2A 1LV9A 1ENFA 1V1PB 2KECA 4DU9A 1Q1BA 3SR1A 1D6EC 3MFYA 5KEEA 3NP8A 1WTWA 5EPLA 1HUMA 4ZLTF 1B44D 1EU4A 1IKMA 1DYQA 1CTMA 4DNTB 5T1GA 1CA5A 1EQVA 4XT3B 1A3VA 1DOLA 1GJXA 1RHPA 3GTJB 3ND9A 2E2HB 2L11A 3NBIA 1ZYRD 2H4OA 5IGBA 3DXJC 1X3QA 3MFGA 2D5DA 4CJ0B 2X6LA 4CGYB 5C0XJ 3LWEA 4NKLA 2LFNA 2MP1A 3P7JA 4TKOB 4C1NI 2JA7B 1PTOB 3RUZA 2DY7A 2EOTA 4B9WA 2CHBD 1PZID 1CT1D 1UEAB 2J4XA 3D31A 2RQXA 2XWJB 4N9TA 2B2UC 3Q6SA 2BE5C 5LL6S 2VB2X 1HFNA 1TS4A 4WORA 2QEJC 3Q0AA 2B2YC 4C3HG 4KV6A 3NTIA 3OMCA 1PRTC 4Z9CB 1RDPD 1W6JA 1IYVA 2PCFB 1NAPA 5DEHA 4WJWA 4A3BB 1HHVA 4G4KA 3DEOA 3NBHA 5C4XB 2TMPA 4ZKCB 1TIID 4EQOA 1EZ6A 2EYFA 5LL6X 4H13C 2G9HD 4C3IB 1HTLD 2B2WA 1V43A 4IUVA 2VXWA 2IT1A 1HFGA 5ELDA 2KOLA 3VR3A 3K7AB 2MJ8A 1L0XB 4C2MB 1SDFA 2A68C 2RSNA 3TP5A 4RA8A 4OIJA 3HOYB 5JJZA 3ONAB 2E75C 1A2UA 1EY4A 1PTOD 1ONLA 1TT2A 4KY7A 4IZ8A 4NW2A 1EIHA 4QCLA 1BQQT 3NTHA 3R3OA 3UI2A 1RD9D 3PUVA 5D14A 3OHXC 2PZUA 3EJIA 5C5LA 1C4QA 1I4XA 2B2VC 1WCMB 1ML0D 1JCKB 4P2CB 1Y8NB 4RGOS 2F0JA 1I6VC 2OF1A 4R9WA 2JXMB 1CA6A 1LTAD 3SE0A 1SAPA 2B2VA 3SK4A 1TWFB 3T53B 4F8MA 2PQEA 5C0XI 2E2DC 1QCBD 4L63B 3WOFA 1C48A 3TZUA 1GUWA 1SEBD 3KUPA 2NN6H 5E4XA 1F77A 3KLRA 1EZ8A 5FO8B 1DONA 3D4RA 3GTQB 3QOJA 3CRKC 2JSOA 2O5IC 4IALA 3M85A 1KLGD 4C3JB 2NN6G 1OXVA 4FXDA 4B08A 2F0NA 1V1OA 3LNNA 1V8QA 4UDUC 1CI3M 2B63B 1PFNA 3GV6A 4IFDH 2HDMA 3H94A 3GD7A 1KNEA 1O7YA 2KEEA 4QIWB 3QB3A 2J7ZA 3S1QB 2WACA 3CRLC 4QUCA 3S16B 3S2DB 1HUNA 2HQEA 4IFDG 1GUTA 1LTBD 3T56B 4K5XA 3VA5A 2F0KA 5JEAH 3K58A 1JOKA 2HDLA 2Z8LA 2XN9C 2O5JC 2BOSA 1DZ1A 4K6LA 5C44B 2VNUD 3DMUA 2CW0D 1LO5D 2B8FA 5I4DA 2HCIA 3HS0C 2EY6A 5JEAG 3E5SA 1PFBA 1BXTA 3TP7A 3C2PA 2KHSA 4KY6A 3PMFA 1OXXK 3P75A 4C3HB 2IX1A 1RJTA 1B9MA 3QWNA 4LAAA 4ZQ3A 4FF2A 2V4DA 2ZXOA 3NE5B 5CMDA 3RLFA 1H9JA 2KEDA 2RDHA 2LKVA 3S2HB 4A3EB 4H0LC 5T1IA 1ESFA 1H9SB 2L5TA 1RCVD 2F0DA 1SYBA 1DOKA 1SNQA 1MBYA 4OO1H 1BOSA 3U9SA 5EPKA 2A6ED 1BCPF 2KQ3A 1FGBD 3K5NA 4OO1G 4TQUS 1GUNA 5DAUA 3I3CA 3H3VC 5ELEA 1SSOA 3JAME 4PQXA 2F0OA 2NBFA 5C3WA 1KAAA 1JC7A 5KNDA 1WD0A 5I6WA 1E0BA 1GUOA 2F0FA 2EPBA 1SMYD 4EGVA 2TSSA 3SVMA 2CQAA 1G2SA 2EYMA 2C9OA 4DF7A 3I70A 3GTLB 1SNDA 3HOZB 4WRDA 4Q0FA 2AQ2B 5FOBB 1EWCA 3H0GB 3BVZA 5BN3A 1A3UA 3Q22A 1C8CA 3FPUB 3PUZA 3PO2B 1D1IA 1HA5A 3PIO3 2G9DA 4XYOA 2VUMB 4V190 2KA7A 3BVGA 1DD2A 2LS01 2Z4IA 3I72A 3MAQA 2OEOA 5CORA 2J0TD 2BCOA 4CKBA 4CBVA 4XDXA 4DXGA 2EXZA 5TSSA 5FLXE 1S5FD 2L4NA 1B53A 4CJ2C 4MHEA 3MXGA 2XRQD 1GHJA 4V0BA 1VMPA 1SXTA 2QILA 1M8AA 5KYLA 2RKSA 2JEAI 3ZYYX 2SNSA 3K5OA 1AEXA 2EJFC 4DGZA 5D65A 3SK5A 3N52A 4OL7A 4O42A 4ULLA 3HEJA 2K6AA 1F9PA 1STNA 1SE3A 3KLSA 4X3UA 3S17B 4F88A 5E3FA 4K8JA 4CKCA 4NDXA 4KHVA 1Q90A 1WTXA 1F9QA 3K59A 2HUGA 2DN8A 3PV0A 1VDZA 2ZXPA 1CZGA 4F7XA 2FINB 4KK7A 5ELCA 3CQZB 4A3DB 1SYCA 2KCNA 4A3FB 5FK9C 3GTGB 3VR4A 3NQTA 3BYTB 3OMGA 3KBGA 4M8AA 1A3TA 2F1MA 1SFOB 4KMUC 4RKBA 1RF2D 1STAA 5FO7B 4L6TB 1XWEA 3NK9A 2K32A 2MUYA 4XIGS 4KN7C 1TS3A 2F0SA 5CYUA 5C6AA 2EDGA 1W6KA 1I3QB 1AP0A 2EZVA 2Q8IB 1IKLA 4K6DA 1QJOA 1GXDC 1LTRD 5M5YB 3K57A 3S1NB 3AU7A 1FD7D 1J8IA 1DCZA 3S14B 4DAYA 3QOLA 2KCCA 4RH6A 2JA5B 1J9OA 5JEAJ 3M4YA 2O4XA 2E76C 2IX3A 2B2UA 3HGBA 1JR0D 3VYUA 2XSCA 1IW7D 1ZEQX 1MD2D 1YNNC 5A2QE 1JORA 3SK8A 4R8NA 2Z4HA 1B4OA 1ESRA 3NPPA 3IL8A 1VCIA 1PFMA 4IUUA 5C3EB 2EY5A 1PRTF 2O2LD 4XQQA 2B2YA 2ZT9C 2VB3X 1STEA 2RBMA 4HN7A 1KDBA 3R8BA 3TP6A 1BCPB 4J6HA 2Y0SB 1WTVA 4OHJA 3A54A 2L0CA 3FKIB 2WKDA 3Q23A 1BR9A 1EY0A 5J39A 3TSSA 3RZDB 3A7LA 1SYDA 4MIUA 2AQ3B 3TZDA 1D1KA 4K5WA 1VF5C 4HR7B 1WTPA 2FFKB 3L9AX 1HPCA 4IN3A 1RODA 3VR5A 4KKSA 2NN6I 2K5QA 5FO9B 1RTNA 1F2ZA 1H9MA 1LLRD 1TQOA 1B9NA 3IFDA 3HKZB 1Z47A 2A73B 5KIXA 3BYYB 1Q12A 5K5PA 3EA6A 4RGMA 4DFAA 4O1NA 2EYLA 4ZYSA 2PW7A 3J80L 2D62A 2WAQB 1LT3D 2F0PA 4I65A 1SNPA 1HQRD 5BN4A 1CQFA 3I4NB 2NB0A 4JBWA 5IGGA 3OWFA 4XQNA 1ZYRC 1ET6A 3R2IA 2JYOA 1O7ZA 1TVXA 1TWGB 3J7AV 1STYA 4FF3A 2DNCA 1LACA 3U9OA 1RKNA 5IODA 4K8IA 1I50B 5DM73 4K5VA 3OIQA 5M5WB 1RTOA 3TBIB 3E6ZX 3DM1A 1BCPD 4HSPA 1IL8A 2JEBI 2E2IB 1QOHA 1TY0A 1Q8IA 3F2UA 4GZYC 2AQ1B 2EJMA 1ZXTA 3R93A 5CV7A 5A35A 5IGCA 4KY5A 4FXKC 4U673 2EVBA 2RSOA 5EBCA 4ZAIA 3GTOB 2R93B 3KF8A 5CV5A 4IQZA 2JP1A 3D4WA 5FKAC 3RD4A 1XYIA 1ENCA 4KI0A 3DHQA 1BBXC 5EPJA 1L0YB 4JK1C 2A69D 3ITPA 1F9SA 1GUGA 2Q8TA 2A74C 2OT2A 3G6JB 4PMCA 4EQNA 4BA1I 3LX0A 3VYRA 1B1ZA 1QNKA 1PZJD 3OWEB 1S5BD 4PNYA 2F0VA 2WV6D 1AZQA 4KD4A 1R4PB 3SEBA 3QIAA 4QUFA 4OO1I 3W3AA 3NWSA 2L1BA 1EQTA 1K8MA 3L3OC 4RGTA 4G7OC 1QE6A 1PLFA 4OGQC 2R61A 3V96A 4DN4M 4FYDA 2FHTA 1Z6HA 4G57A 1PTOC 2B8GA 1PXUA 1Y1VB 2AUKA 2H1EA 1SJED 2PW5A 1WD1A 3GQBA 2NVQB 1OO9B 1O80A 1KNAA 3A7AB 2QCPX 2EYPA 1SE4A 1QILA 1HA6A 2A6HD 1SYGA 2DNEA 2GA4B 2M00A 3O13A 5AFWA 5CV4A 5NUCA 4X3SA 1FR3A 4HTHA 1BNZA 3PUXA 5IIFA 3Q24A 1M4VA 3OIPA 1TWHB 1JB3A 4ILWA 4ODGA 1YNJC 4DNRB 2FMCA 3IKJA 2ID0A 3J81L 2IWHA 3G7LA 4CKEA 2NVXB 5CBEE 3K5LA 1S4ZA 4B9XA 5C4JB 3NSWA 2L55A 2Z1CA 3BZDB 1XXGA 5ELFA 3S15B 1XX8A 3FRPB 2XRSD 4OIKA 2JE6I 3DWQA 3MXPA 1TR5A 5JOBA 3I90A 1PRTB 2NZ1D 2RVLA 4HSVA 4BWGB 3GV3A 1KDAA 5JPMC 3VYTA 3P20A 2MPMA 1SNOA 1E2WA 5I2XA 1Y8OB 1SNMA 2L12A 2K5WA 1LABA 3MZ5A 1JICA 3KK7A 1FNUA 5IT9L 1IYUA 1NSNS 1Z7TA 4EVOA 5HURA 1F2LA 4RKLA 4DAPA 3V2TA 3DWAA 3C46A 4J8QA 3RMHA 3H6MA 2SDFA 2CW0C 3I4MB 3S1MB 3SHLA 4IURA 5HGTA 4AYBB 5IGDA 5IOCA 4A3JB 5CC4A 1HCZA 2EY2A 1DJRD 3BS1A 1ICWA 5G3LF 3HOXB 1G8ZD 1Q1EA 4KKTA 1LTSD 5J22A 1I4RA 3MC0B 1JOOA 2BE5D 3URYA 2PO4A 5EQ0A 3GP7A 3PUYA 3FDTA 2WP8J 4DXFA 2E74C 2PPBC 5KYIA 4FXGC 1FYCA 1PRTD 1YNND 2PMZB 2WB1B 4BA2I 1OXSC 3PUWA 1K8OA 1UNSA 2X6GA 5M3MB 2OXPA 3J7AF 4PV1C 2SEBD 2B39A 1MSGA 1STHA 5C3XA 1CFMA 3M4OB 1BF4A 1TY2A 1R9TB 2FMMA 2D2CC 1NUCA 4IUPA 2F0TA 3D3RA 3D4DA 1MI2A 2SOBA 1SMYC 5C5MA 1GUSA 3OOCA 2A68D 5EKLA 1TS2A 2BA1A 5K36H 2QF7A 1PZKD 2IL8A 1PYWD 3VR6A 4A3MB 4DAVA 2XIWA 2K33A 3BDOA 4ZUIA 5JAVA 3SXHA 4KD3A 3H09A 2K7VA 3A56A 5K36G 1O78A 4IFDJ 3BDLA 2F0LA 1X32A 1Y69U 4FF4A 4I7ZC 1SBBB 1A6XA 5E1FA 1EEID 3FPPA 1LTGD 4FF1A 2R92B 4M1UB 2I07B 2PNRC 3L7ZC 1Y1WB 4A3GB 1JWUD 3EROA 2NYZD 1U9RA 2K1BA 4RGNA 4RHRA 2JA6B 4H44C 3TP8A 3A8JE 5CR3A 1H9SA 5JPNC 3C1EA 1OXUA 3A8KE 5IT9E 5I9OA 3C1FA 1CM9A 3DWPA 1JWMD 1G2TA 2AWNA 1F2MA 1PDQA 1X3PA 5IGFA 1NR4A 1KABA 1QWYA 3AMUA 3T51B 1VF7A 3X3NA 1KTKA 4HMIA 2IX0A 1JQYD 2RA4A 3E0JA 5ELBA 5CBAE 3MXNA 1TU2B 1U4PA 3A55A 2K05A 3SDZA 1JE4A 1STBA 3W2DA 5COYA 4A93B 3ND8A 3S1RB 3PO3B 4ZRZA 2MHVA 4H7BA 4IUQA 4WFN3 2B2WC 4CJ1B 3LWUA 1AFPA 2EY1A 4XYQA 1EEFD 3IAYA 1SNCA 2EYOA 1EU3A 3EQLC 4KHZA 2AUJD 1CK1A 4RCNA 4XXEA 2F0UA 2XWBB 4Q5VA 5C4HA 1EY5A 3KLSX 2EJGC 2N55A 1I4QA 3V05A 4KJNA 4G7ZC 4RCOA 2ICEC 4BY7B 5DNFA 4N9PA 3HP3A 2NVTB 3FMCA 4KTAA 1IHZA 3IFTA 1HQMC 2EE1A 4MN3A 4E6IA 1MGSA 4RWSC 1SYFA 4BBRB 1PMRA 1EOTA 3QO2A 3MWYW 5LHY1 1Q3LA 4HMJA 4RHSA 4IFDI 1O7LA 2XNAC 5EBDA 1LT6D 2F03A 3OW7A 1KDCA 5CV6A 4YIJA 3SK6A 4ABNA 3RZOB 2ZXRA 1QNUA 1EIGA 3K6OA 4ID6A 5CV9A 4Y7NB 5E4WC 3TN2A 5CV8A 1ILQA 2M9VA 3QG1A 2BDNA 1EWHA 2WINB 3J7YW 2F0WA 2RDFA 2JA8B 3VA7A 3TDQA 2AWOA 4J1MA 3JAML 1G291 1YNJD 3EVQA 1U4MA 2F4IA 4TRDA 1H9KA 4U68A 2NTTA 3PIP3 4NP5A 2MGSA 2SNMA 4FVMA 1JOQA 1IW7C 1SE2A 5KNBA 2K28A 2IPKD 2K01A 2BA0A 2ICIA 3HG9A 5I6YA 1F2YA 1I6HB 2K04A 4A3KB 1E2VA 4HCSA 1LT5D 4KJOA 2L9HA 1U4RA 1B3AA 5DM63 3N6RA 2E2JB 5D3IB 3T4AC 2C5CA 2F0EA 5F2DA 4LK1C 2R7ZB 2FJ2A 3MXUA 3NWTA 5C0XH 3NHHA 2RDGA 1V1PA 1HXYD 4PMWA 3WDNA 1F9RA 2QKIC 3P1HA 4NMZA 3NTKA 1EY6A 3K5MA 5J1ZA 1A15A 3MA2B 1BDOA 1TWAB 2DY8A 2WIIB 1NR2A 5C0XG 2K5DA 4HEDA 4L8JA 1HRJA 1EFID 4G7HC 3HOVB 3I8ZA 1FNWA 1I4PA 3FEWX 1GOZA 5EKIA 4XTCS 1ILPA 1S5DD 2F3VA 4FNFA 4DA2A 2F0QA 1PTOF 1I4GA 3BG3A 4K2LA 1G91A 2QDBA 5FLXL 4BY1B 4X3KA 3GO5A 1GHKA 3M7GA 3CHBD 3MTSA 4HAEA 4ZUJA 5G3LD 2ENBA 3I73A 1BO0A 1EY9A 4RAUC 4C1NK 3FVQA 2YU9B 3CU7A 1DM0B 5IGEA 1B50A 1B2TA 3HOUB 3R2TA 1LTID 3J80E 1UUPA 4K2KA 4FP5D 2NVYB 1EYCA 3C3LA 1S5CD 3X3MA 4UAIA 1K83B 2F0HA 4IUNA 4A3IB 1U4LA 2NWGA 1I4HA 4R8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WRD A;  5ISR A;  2F0P A;  4EQO A;  1EZ6 A;  1F2Y A;  1SNP A;  4I65 A;  3D8G A;  4K8J A;  4KJN A;  3NXW A;  3TP7 A;  2EYF A;  2KHS A;  4KY6 A;  5EKK A;  3PMF A;  3ERO A;  1U9R A;  1A3U A;  3P75 A;  4KJO A;  4PMB A;  1EZ8 A;  3MXP A;  3ERQ A;  5IGG A;  1TR5 A;  4NDX A;  4KHV A;  3TP8 A;  2EYJ A;  1II3 A;  5JOB A;  5CR3 A;  3OWF A;  5KYI A;  4N9P A;  3C1E A;  4EQP A;  4LAA A;  3QOJ A;  4KTA A;  4DU9 A;  4ZQ3 A;  1IHZ A;  3SR1 A;  5CGK A;  1JOR A;  5C4Z A;  3SK8 A;  5KEE A;  3MVV A;  1EYD A;  1STY A;  4R8N A;  5I9O A;  3C1F A;  2F0E A;  4IAL A;  4G57 A;  5F2D A;  4E6I A;  3NP8 A;  2PZT A;  1RKN A;  3U9O A;  2LKV A;  5IOD A;  4K8I A;  1KDA A;  2EY5 A;  3T16 A;  1SYF A;  1F2M A;  3NHH A;  4F7X A;  4K5V A;  4KD4 A;  2OXP A;  5IGF A;  2F0D A;  1KAB A;  1SYB A;  3P1H A;  3BDC A;  1SYC A;  5I9P A;  2PW5 A;  4NMZ A;  2F0N A;  3T13 A;  1STH A;  5C3X A;  4HMJ A;  1EY6 A;  2RBM A;  1KDB A;  1EQV A;  1SNQ A;  1SNO A;  2NUC A;  1A3V A;  3NQT A;  5J1Z A;  3TP6 A;  3TP5 A;  4HMI A;  4J6H A;  2F0M A;  3OMG A;  4S3S A;  1SNM A;  2OEO A;  1KDC A;  5CV6 A;  1A3T A;  4YIJ A;  3SK6 A;  5IGB A;  1ENA A;  1A2U A;  3MZ5 A;  3HZX A;  1NUC A;  2EYP A;  5EGT A;  1EY0 A;  5J39 A;  4RKB A;  1EY4 A;  1SYG A;  4ID6 A;  1STA A;  5CV9 A;  5CV7 A;  2F0T A;  2KQ3 A;  5M9O A;  4NKL A;  1TT2 A;  3D4D A;  3NUC A;  1STB A;  3QB3 A;  4IZ8 A;  1A2T A;  4KY7 A;  5IGC A;  3MEH A;  1NSN S;  1SYD A;  2EXZ A;  4EVO A;  2M00 A;  4KY5 A;  2WAC A;  5HUR A;  4MIU A;  3RUZ A;  2SOB A;  3NK9 A;  4QB4 A;  4B9W A;  4RKL A;  3R3O A;  5DAU A;  3V2T A;  5KGU A;  2F3V A;  4K5W A;  5CV8 A;  2HQE A;  2F0Q A;  2EYH A;  5CV4 A;  5C5M A;  5NUC A;  3H6M A;  4K2L A;  5EKL A;  4HTH A;  4H7B A;  4N9T A;  2F0O A;  5C3W A;  2PZU A;  2QDB A;  3EJI A;  2F0S A;  2F0W A;  5C5L A;  5C6A A;  5IIF A;  4QMG A;  1KAA A;  2RDF A;  3SHL A;  5CV5 A;  3D4W A;  5HGT A;  5IGD A;  1ENC A;  5IOC A;  2EY1 A;  2F3W A;  2PZW A;  3DHQ A;  4ZUJ A;  4J1M A;  4K5X A;  5KYL A;  3VA5 A;  4ODG A;  1SNC A;  2ENB A;  2F0K A;  2EYO A;  5CC4 A;  2RKS A;  5I6W A;  2PYK A;  1EY9 A;  3EVQ A;  3ITP A;  4ME5 A;  1JOK A;  4ZUI A;  5JAV A;  3SXH A;  1F2Z A;  1EY8 A;  2EY2 A;  2SNS A;  3D6C A;  3OSO A;  4TRD A;  1TQO A;  2F0J A;  2F0G A;  1AEX A;  4KD3 A;  4K6D A;  4WOR A;  4DGZ A;  5KIX A;  4K14 A;  4NP5 A;  2OF1 A;  2F0F A;  2SNM A;  3SK5 A;  3S9W A;  2F0U A;  4OL7 A;  4PMC A;  5IGE A;  1JOQ A;  4EQN A;  1EY7 A;  4KV6 A;  5C4H A;  5K5P A;  3LX0 A;  3OMC A;  1EYA A;  3MHB A;  1EY5 A;  3DMU A;  2EYM A;  4QF4 A;  4K2K A;  4B9X A;  4DFA A;  5DEH A;  3BDL A;  1EYC A;  2EYL A;  2F0L A;  4PNY A;  3SK4 A;  3HEJ A;  2F0I A;  5KRU A;  3TME A;  4F8M A;  1STN A;  5J22 A;  3QOL A;  2F0H A;  1STG A;  2PQE A;  2PW7 A;  4IUN A;  5E1F A;  4DF7 A;  5I6Y A;  2F0V A;  1JOO A;  2EY6 A;  3E5S A;  1SND A;  1SYE A;  2O4X A;  5E3F A; 
#chains in the Genus database with same CATH topology
 1EOV A;  5IP9 G;  1JWS D;  3NXW A;  2I46 A;  3GTK B;  2IJ0 A;  1PH8 A;  1BCP C;  4DAY B;  4JC0 A;  1WTO A;  2HHH L;  1AW7 A;  4X3T A;  2JA7 H;  1PTO H;  1AN8 A;  1II3 A;  3KBX A;  4F87 A;  1CQV A;  2Z0S A;  1TS5 A;  3GTM B;  3CAM A;  2NTS A;  1JMC A;  1T5X D;  1D5X C;  5CGK A;  1PH7 A;  3K0Y A;  1ZKO A;  1D5M C;  3MVV A;  2BDO A;  4KN4 C;  4DK1 A;  3H3V I;  1TKW B;  1X3G A;  5IYB H;  5EJW A;  2PZT A;  1X55 A;  4R4Q A;  3T16 A;  4KKU A;  4LF8 L;  4LFB L;  2JA5 H;  3AB9 A;  1R4Q B;  2UXC L;  2CVR A;  3BDC A;  3GTP B;  5I9P A;  2JA7 G;  2N3S A;  4GLX A;  2CH4 W;  2OTJ A;  2NUC A;  1OXT A;  2F0M A;  4S3S A;  1QG7 A;  4ZKB B;  5IYB G;  1YHA A;  5M5X B;  1XNR L;  3KF6 B;  1PVO A;  1DOM A;  4DR5 L;  5EGT A;  2FXQ A;  1DXM A;  2A69 C;  2UXD Q;  1TWC B;  4DV0 L;  3L2P A;  5C4X H;  3NUC A;  4C56 C;  4TSS A;  1A2T A;  3MEH A;  2R3Z A;  4ZK9 B;  3DUZ A;  1SN8 A;  4X65 L;  5JVH 3;  5KGU A;  1H9R A;  1BBU A;  4PG3 A;  2EYH A;  2JA9 A;  3I91 A;  2K03 A;  3WOE A;  2KBN A;  4GLV B;  2UUA Q;  2BH2 A;  4JBM A;  2Q8R E;  2WKC A;  4C3I H;  4JI6 L;  4QMG A;  2XVS A;  1KAW A;  4A3B G;  2K75 A;  1XTC D;  2F3W A;  1AZP A;  3EFX D;  5IT9 c;  1CSQ A;  1KLU D;  1B7Y B;  3DEP A;  5JVG 3;  5C4X G;  1IBL L;  2PYK A;  3VR2 A;  4ME5 A;  1ET9 A;  3M3Y B;  1EL0 A;  2KVM A;  2KUM A;  2ATW A;  3D6C A;  3K7A H;  3OSO A;  3A8I E;  2N88 A;  1CHP D;  4DV2 Q;  2LY7 A;  4HCE A;  2K5N A;  4K14 A;  2CKZ B;  4C2M H;  4JI1 L;  5KNC A;  4POG A;  1EY7 A;  1D2B A;  1EYA A;  3MHB A;  4LMQ D;  4C3I G;  1B3Q A;  1HR0 L;  4YWM A;  2F0I A;  1GM5 A;  5KRU A;  3HOY H;  1P8L A;  3NQI A;  1UAP A;  3NEN A;  5ISR A;  1VQI A;  3D8G A;  1Y8P B;  2NZO A;  1NCV A;  4LJZ C;  5EKK A;  4PZ8 A;  4JYA Q;  4PMB A;  3B6Y A;  2X69 A;  1T5E A;  1BUV T;  4RFB A;  2EYJ A;  4X66 Q;  3OPO A;  4EQP A;  5M3F B;  1WTQ A;  1HNW L;  5D3D A;  4JG2 A;  5C4Z A;  2IW3 A;  3HOY G;  2R6G A;  1EYD A;  4IPD A;  4RG1 A;  2V1C C;  2A6H C;  3E9I A;  2E5L Q;  4L5Q A;  1FNV A;  5LMN L;  5A2Q L;  3H91 A;  2B2T C;  1LTT D;  1WCM H;  3CKI B;  3TRE A;  4DK0 A;  3T13 A;  3VYS A;  1X9N A;  3BVM A;  1CZW A;  2LMC B;  1E2Z A;  5BN5 A;  1D5Z C;  2YTV A;  2VQE Q;  3M7N A;  1S40 A;  1I94 Q;  2A6E C;  1VQ9 A;  4CHT B;  4BS9 A;  4DV5 L;  4EQ5 A;  1ENA A;  2B2T A;  4L5T A;  1WTR A;  3U4Z A;  1TWG H;  2KJX A;  3HZX A;  1PYB A;  4DUZ Q;  2M2L A;  1ASZ A;  1TWF H;  3QJY A;  3AYH B;  3CC4 A;  4DPG A;  1WCM G;  5M9O A;  5I2Y A;  2YYZ A;  4GKK Q;  3CD6 A;  1QB5 D;  3F1Z A;  1PYS B;  2CWA A;  5M5W H;  4QB4 A;  4DUY Q;  2G5D A;  1WFQ A;  1CHQ D;  1MSH A;  1SJH D;  2HHH Q;  1HTP A;  1S5E D;  1Q46 A;  2P5Z X;  4LWC A;  3HRZ C;  2PQA B;  1WVL A;  2PZW A;  4XT1 B;  1YJW A;  3I4L A;  3J81 E;  3AQQ A;  1EY8 A;  2F0G A;  4C3J H;  3HOW B;  1VMC A;  4IUT A;  4LFB Q;  4OX9 L;  3S9W A;  1VQB A;  1NJI C;  4QF4 A;  3RNU A;  2HCC A;  4ME3 A;  2B63 H;  1G6Z A;  3D6W A;  3TME A;  1STG A;  4QIW E;  2A5H A;  2Z6K C;  1QUQ B;  4XQJ A;  3TS0 A;  1SYE A;  3K7U C;  1LT4 D;  4C3J G;  2D9U A;  4LF4 L;  1L2F A;  1C9O A;  4DV0 Q;  2R7D A;  4ALP A;  1J5E L;  1S72 A;  2LSS A;  4BBS B;  3S1Q H;  3ERQ A;  5JJI A;  4X65 Q;  4FO2 A;  1LV9 A;  1SR3 A;  3HFZ B;  2B63 G;  1ENF A;  3S16 H;  1V1P B;  2KEC A;  4DU9 A;  1Q1B A;  2Z6K A;  3SR1 A;  1D6E C;  1X3F A;  3MFY A;  5KEE A;  2CQO A;  1FVI A;  1FL0 A;  3NP8 A;  1WTW A;  5EPL A;  1HUM A;  1MIU A;  4ZLT F;  5IYC H;  1B44 D;  5EAY A;  1EU4 A;  1VS0 A;  3PCO B;  1IKM A;  1DYQ A;  1CTM A;  3RN5 A;  4DNT B;  1NNX A;  5T1G A;  1CA5 A;  1EQV A;  4XT3 B;  1A3V A;  4JI4 L;  1DOL A;  1GJX A;  1RHP A;  3GTJ B;  3ND9 A;  2E2H B;  2L11 A;  4JI1 Q;  3NBI A;  1IBM L;  1ZYR D;  4A76 A;  4JI5 L;  2H4O A;  1YEZ A;  4IPH A;  5IGB A;  3DXJ C;  5C44 H;  1X3Q A;  1HR0 Q;  3E9H A;  3MFG A;  1NBW A;  2D5D A;  1XMO L;  4CJ0 B;  2PI2 E;  5IYC G;  2X6L A;  4CGY B;  5C0X J;  2AKW B;  3LWE A;  1Z9F A;  4NKL A;  2LFN A;  2MP1 A;  3P7J A;  4TKO B;  4C1N I;  2JA7 B;  1PTO B;  3RUZ A;  3M4P A;  2UXB L;  2DY7 A;  2EOT A;  4B9W A;  2CHB D;  1PZI D;  2MQH A;  1CT1 D;  1UEA B;  1VQ5 A;  2J4X A;  3D31 A;  2RQX A;  2XWJ B;  4C3H H;  4N9T A;  1PH1 A;  4GOP C;  5C44 G;  4DNI A;  2B2U C;  1MKH A;  3Q6S A;  1HNW Q;  2BE5 C;  5LL6 S;  4JPB W;  2VB2 X;  1HFN A;  3S2H H;  1TS4 A;  5LMN Q;  4A3E H;  4WOR A;  2QEJ C;  1W3S A;  3RLO A;  4GOP A;  3Q0A A;  3I2Z A;  2B2Y C;  4C3H G;  4KV6 A;  4R1J A;  3NTI A;  3OMC A;  1PRT C;  1WJJ A;  4Z9C B;  1RDP D;  1W6J A;  1IYV A;  2PCF B;  1K3B C;  1NAP A;  1YZ6 A;  5DEH A;  4WJW A;  4P73 A;  4A3B B;  1HHV A;  4G4K A;  1I5F A;  3DEO A;  3NBH A;  5C4X B;  2TMP A;  3ULJ A;  4ZKC B;  3CXC A;  4MTN A;  4DV5 Q;  1TII D;  1HZC A;  1VQO A;  4A3E G;  3KJP A;  4OON A;  1EZ6 A;  4EQO A;  1EQR A;  1YHB A;  2EYF A;  4DV4 L;  2JQO A;  3CCU A;  4HIO A;  5LL6 X;  4H13 C;  1T9H A;  2G9H D;  4C3I B;  1HTL D;  2B2W A;  1V43 A;  5GQO A;  4IUV A;  3EN2 A;  2VXW A;  2ZTD A;  2NVX H;  1HNZ L;  2IT1 A;  1HFG A;  5ELD A;  2KOL A;  3T1H Q;  3VR3 A;  5IYD H;  3K7A B;  2KHJ A;  3G71 A;  2MJ8 A;  4GNX C;  2JK8 A;  2VW9 A;  1L0X B;  4C2M B;  1SDF A;  4FDB A;  1QZH A;  2A68 C;  2RSN A;  3TP5 A;  4RA8 A;  4OIJ A;  3CCM A;  3HOY B;  1QZG A;  1VQM A;  5JJZ A;  3ONA B;  4OEM B;  3J80 c;  2E75 C;  1A2U A;  5IYD G;  3K81 C;  1EY4 A;  2YTX A;  4AQY L;  1JE5 A;  1PTO D;  1BVS A;  1ONL A;  3GTL H;  1TT2 A;  4KY7 A;  4IZ8 A;  4NW2 A;  1EIH A;  3HOZ H;  4QCL A;  1BQQ T;  3NTH A;  3R3O A;  3UI2 A;  4LF4 Q;  2OQK A;  1J5E Q;  1U5K A;  1RD9 D;  3PUV A;  5D14 A;  2N78 A;  3OHX C;  2PZU A;  3EJI A;  3HKS A;  5C5L A;  4Y52 H;  3STB D;  1C4Q A;  1I4X A;  1N34 L;  2B2V C;  1UE7 A;  1WCM B;  1ML0 D;  4QQB X;  1JCK B;  4P2C B;  3HOZ G;  1Y8N B;  2VUM H;  4IOA A;  4RGO S;  2F0J A;  1I6V C;  3H0G G;  1EIF A;  1VQK A;  2OF1 A;  4R9W A;  2JXM B;  1CA6 A;  3RR5 A;  1LTA D;  1Q81 C;  1EWI A;  3SE0 A;  1SAP A;  4PZ6 A;  2B2V A;  3JAM c;  3SK4 A;  3PO2 G;  1TWF B;  3T53 B;  4F8M A;  1IBM Q;  2PQE A;  5C0X I;  1KIX A;  2E2D C;  1QCB D;  4L63 B;  1HZ9 A;  4JI5 Q;  3WOF A;  1C48 A;  3TZU A;  1GUW A;  1SEB D;  1XMO Q;  4A3J H;  2VUM G;  3KUP A;  4X6A H;  2NN6 H;  2ZJR A;  2K5V A;  5E4X A;  5ELN A;  1F77 A;  3KLR A;  1EZ8 A;  2UXB Q;  5FO8 B;  1DON A;  1CKM A;  3D4R A;  3GTQ B;  1CKN A;  1V9P A;  2F4V L;  3QOJ A;  2WFW A;  3CRK C;  3HOX H;  2JSO A;  2O5I C;  2HQL A;  1OTC A;  4R4I A;  4IAL A;  4A4I A;  3M85 A;  5FJ8 H;  1KLG D;  4A3J G;  1N36 Q;  4C3J B;  2NN6 G;  1OXV A;  4FXD A;  4B08 A;  2F0N A;  1V1O A;  1K0S A;  3LNN A;  1V8Q A;  4UDU C;  1CI3 M;  2B63 B;  1JJG A;  1PFN A;  2GVA A;  3GV6 A;  3HOX G;  1JB7 A;  2AMC B;  2HDM A;  4IFD H;  3H94 A;  3GD7 A;  1KNE A;  3TEH B;  1O7Y A;  3W1B A;  2KEE A;  5FJ8 G;  3CCE A;  3W5O A;  1LTL A;  4QIW B;  4DV2 L;  2QA4 A;  3QB3 A;  2XTI A;  2J7Z A;  3S1Q B;  3S17 H;  2WAC A;  3CRL C;  4QUC A;  3S16 B;  3S2D B;  1HUN A;  2HQE A;  4IFD G;  1GUT A;  1KC8 C;  4OWT B;  1LTB D;  3T56 B;  4HIK A;  4IJL A;  3G48 A;  1HNZ Q;  1W2B A;  4K5X A;  1VQE A;  3VA5 A;  2F0K A;  3AEV A;  5JEA H;  3K58 A;  1JOK A;  1Y14 B;  2HDL A;  2Z8L A;  2UUC L;  2XN9 C;  4GN3 B;  2O5J C;  4WJ3 M;  5FLX c;  3CQZ H;  4A3D H;  2BOS A;  4CDF C;  1DZ1 A;  4K6L A;  5C44 B;  4KHP L;  2VNU D;  3DMU A;  4A3F H;  2CW0 D;  1LO5 D;  2B8F A;  3K0X A;  5I4D A;  2HCI A;  3HS0 C;  1N8R C;  3J7A 5;  2EY6 A;  5JEA G;  3E5S A;  4JI7 L;  1PFB A;  1SFO H;  1BXT A;  3TS2 A;  4AQY Q;  3TP7 A;  3C2P A;  2KHS A;  4KY6 A;  4CDC C;  1D7Q A;  3PMF A;  3CCL A;  4A3D G;  2RCF A;  1OXX K;  3P75 A;  4C3H B;  2IX1 A;  1N9W A;  1RJT A;  4UPA A;  4A3F G;  1B9M A;  3QWN A;  4TVA B;  4LAA A;  4ZQ3 A;  4FF2 A;  2V4D A;  2ZXO A;  3NE5 B;  3L0O A;  5CMD A;  3RLF A;  3U58 A;  1H9J A;  2KED A;  2RDH A;  2LKV A;  3S2H B;  4A3E B;  1N34 Q;  4H0L C;  5T1I A;  4EX5 A;  1ESF A;  1H9S B;  1I3Q H;  2L5T A;  1RCV D;  1G51 A;  2F0D A;  3J81 c;  4DUY L;  1SYB A;  1DOK A;  1SNQ A;  1MBY A;  4OO1 H;  2F52 A;  1BOS A;  4L5R C;  2VS1 A;  2ZTE A;  5M5Y H;  3U9S A;  3S1N H;  2JA6 H;  5EPK A;  3RN2 A;  3PGZ A;  2A6E D;  1BCP F;  1QVF A;  4X64 L;  1X56 A;  3S14 H;  5AJ3 Q;  1HR0 W;  4LW1 A;  2Z9H A;  2KQ3 A;  3OTO Q;  1FGB D;  1YJ9 A;  1VQL A;  3K5N A;  2I5H A;  4OO1 G;  4TQU S;  1GUN A;  3MXN B;  5DAU A;  3I3C A;  3H3V C;  5ELE A;  1SSO A;  3JAM E;  4PQX A;  2F0O A;  2NBF A;  5C3W A;  1KAA A;  2F4V Q;  1M90 C;  4GOP B;  1JC7 A;  5KND A;  4N8F A;  4APV A;  1WD0 A;  5I6W A;  4LF7 Q;  2JA5 G;  1HH2 P;  3U50 C;  1VQA A;  5C3E H;  1E0B A;  2RHS B;  1GUO A;  1TXY A;  5LMN W;  3NBH B;  2F0F A;  2EPB A;  1SMY D;  2Y0S E;  4LUV A;  4EGV A;  1G6P A;  2TSS A;  3SVM A;  2CQA A;  1YI2 A;  1G2S A;  2EYM A;  2MO1 A;  2C9O A;  4DF7 A;  1IBK L;  3I70 A;  3GTL B;  3CW2 C;  4GLA C;  3FKI H;  2N8N A;  1SND A;  3HOZ B;  4WRD A;  5C3E G;  4HJ7 A;  4Q0F A;  2AQ2 B;  5FOB B;  1EWC A;  3H0G B;  3RZD H;  2UU9 L;  4LF9 Q;  1N33 L;  3BVZ A;  5BN3 A;  1A3U A;  3Q22 A;  1C8C A;  3E0E A;  3FPU B;  3PUZ A;  3PO2 B;  3PIO A;  1D1I A;  1HA5 A;  2Y0S G;  3PIO 3;  4QL5 A;  3FKI G;  2G9D A;  3KFU A;  3H3V H;  4XYO A;  3I7F A;  3M9B A;  2CWP A;  2VUM B;  4V19 0;  2BH8 A;  3HKZ E;  2KA7 A;  4B3R L;  3BVG A;  1DD2 A;  2E8G A;  2LS0 1;  2Z4I A;  3I72 A;  2UUC Q;  3MAQ A;  3LGJ A;  2OEO A;  5COR A;  2J0T D;  3CCJ A;  4HJ9 A;  4KHP Q;  1GD7 A;  2BCO A;  4CKB A;  2WAQ E;  4CBV A;  5HGQ A;  1EIY B;  1M1K C;  4XDX A;  4JI7 Q;  1VQ4 A;  4DXG A;  2EXZ A;  4YCV A;  5TSS A;  4K0K L;  4ZCK A;  5FLX E;  1CSP A;  2L4N A;  1S5F D;  1B53 A;  4CJ2 C;  3HKZ G;  1K8A C;  1KRT A;  4QGU A;  4MHE A;  3MXG A;  3I4N H;  2XRQ D;  1GHJ A;  4V0B A;  1MJC A;  3DLL A;  1VMP A;  4UHV A;  1Q82 C;  1SXT A;  2QIL A;  1M8A A;  3ULL A;  1UE6 A;  5KYL A;  2YV5 A;  2RKS A;  2JEA I;  2I5M X;  2WAQ G;  3ZYY X;  2SNS A;  3K5O A;  1I50 H;  1AEX A;  2EJF C;  4DGZ A;  2OWO A;  3FHW A;  3I4N G;  5D65 A;  3SK5 A;  3N52 A;  4OL7 A;  4O42 A;  1VQH A;  3SGI A;  1FJG L;  4ULL A;  3HEJ A;  3T1H L;  2K6A A;  1F9P A;  1STN A;  2E2I H;  1SE3 A;  3KLS A;  4X3U A;  3S17 B;  4F88 A;  1MJE A;  1CKN B;  5E3F A;  4X64 Q;  4K8J A;  4CKC A;  1HNX Q;  3QR8 A;  4P71 A;  3CC2 A;  1EYG A;  4NDX A;  5IE8 A;  4KHV A;  1Q90 A;  1WTX A;  2A19 A;  1F9Q A;  3S24 A;  2HIV A;  3K59 A;  2HUG A;  2DN8 A;  3GTO H;  3PV0 A;  1VDZ A;  2R93 H;  2ZXP A;  3A5Z B;  3CCS A;  5E7N A;  1SLJ A;  1CZG A;  4F7X A;  4A3C H;  1JJ2 A;  2FIN B;  2NZH A;  1QVC A;  4KK7 A;  5ELC A;  3CQZ B;  4A3D B;  3GDE A;  1SYC A;  2KCN A;  1GVP A;  4A3F B;  5FK9 C;  3GTG B;  3VR4 A;  2KCT A;  3NQT A;  3BYT B;  5IY0 A;  3OMG A;  3OYY A;  2DGY A;  3KBG A;  4M8A A;  1A3T A;  2F1M A;  2R93 G;  1SFO B;  1IYJ B;  1PH4 A;  1V1Q A;  3KDF A;  4KMU C;  3CP0 A;  4RKB A;  1RF2 D;  1NTG A;  1STA A;  1IBK Q;  2R7Z H;  5FO7 B;  4L6T B;  3F2D A;  4GN5 A;  1XWE A;  2Q2H A;  3NK9 A;  3EIV A;  4IO9 A;  2K32 A;  2MUY A;  2UU9 Q;  1N33 Q;  4JOI C;  4XIG S;  4KN7 C;  3W1G A;  2R7F A;  1TS3 A;  2F0S A;  5CYU A;  5C6A A;  3NEM A;  3NEL A;  5H1S E;  2EDG A;  5DLQ E;  1W6K A;  1ASY A;  1I3Q B;  1AP0 A;  1E3P A;  2EZV A;  4JI3 L;  2ZM6 Q;  2Q8I B;  4JOI A;  3K80 C;  4WJ4 A;  3UE1 A;  1IKL A;  4O0A A;  1Y1V H;  3HOV H;  4A3L H;  4K6D A;  1QJO A;  1GXD C;  1LTR D;  4B3R Q;  5M5Y B;  3K57 A;  3S1N B;  3AU7 A;  1FD7 D;  4J15 A;  1J8I A;  4UP9 A;  1DCZ A;  3S14 B;  4DAY A;  2NVQ H;  3QOL A;  2KCC A;  4RH6 A;  1N36 L;  2JA5 B;  4NB3 A;  1J9O A;  5JEA J;  3M4Y A;  2O4X A;  2E76 C;  2KCM A;  1Y1V G;  4A3L G;  2IX3 A;  4LFC Q;  2VQF L;  4K0K Q;  2B2U A;  3HGB A;  1JR0 D;  3VYU A;  1NE3 A;  2XSC A;  1IW7 D;  1ZEQ X;  3E3X A;  1MD2 D;  1BBW A;  1YNN C;  5A2Q E;  1JOR A;  3SK8 A;  1WYD A;  4R8N A;  4DV3 L;  2Z4H A;  1B4O A;  1ESR A;  3NPP A;  1TWH H;  3IL8 A;  1VCI A;  1PFM A;  4IUU A;  5IWA Q;  5C3E B;  2EY5 A;  4A3I H;  1PRT F;  2O2L D;  4XQQ A;  1XMQ L;  2B2Y A;  2ZT9 C;  1CKO A;  2VB3 X;  1STE A;  2PNH A;  2RBM A;  3OW2 A;  3GTK H;  4HN7 A;  1KDB A;  3R8B A;  4DV7 L;  1PHJ A;  1S3O A;  3TP6 A;  1BCP B;  4J6H A;  2DJG C;  2Y0S B;  1LYL A;  1WTV A;  2QDL A;  4OHJ A;  1FJG Q;  3A54 A;  2L0C A;  3Q8D A;  3FKI B;  2WKD A;  5C4J H;  3Q23 A;  1BR9 A;  4A3I G;  1EY0 A;  5J39 A;  2IHE A;  1A0I A;  3TSS A;  4B3T L;  3RZD B;  3S15 H;  3A7L A;  1E7Z A;  1SYD A;  3A5U A;  4MIU A;  2AQ3 B;  1PV4 A;  3TZD A;  1D1K A;  4K5W A;  1VF5 C;  4DR2 Q;  2F3I A;  4HR7 B;  3A0J A;  1WTP A;  2FFK B;  3L9A X;  2EQS A;  4GNX A;  1HPC A;  4IN3 A;  1ROD A;  1YJN A;  3VR5 A;  4KKS A;  1CUK A;  2NN6 I;  2K5Q A;  5FO9 B;  1PA6 A;  1RTN A;  1F2Z A;  1H9M A;  1LLR D;  1TQO A;  1B9N A;  3IFD A;  3HKZ B;  1Z47 A;  2A73 B;  5KIX A;  1VQC A;  1VQJ A;  3CPF A;  3BYY B;  1P16 A;  4CDE C;  1Q12 A;  5K5P A;  3EA6 A;  4RGM A;  4DFA A;  4O1N A;  2EYL A;  1ICF B;  4ZYS A;  1A62 A;  2C35 B;  2PW7 A;  4JV5 L;  3J80 L;  2D62 A;  4LUZ A;  2WAQ B;  1K8G A;  1LT3 D;  2F0P A;  3VDY A;  4I65 A;  1SNP A;  1HQR D;  5BN4 A;  1CQF A;  3I4N B;  2NB0 A;  1A8V A;  4JBW A;  5IGG A;  1E1O A;  3OWF A;  2ZJP A;  4XQN A;  1ZYR C;  1ET6 A;  1LM0 A;  3R2I A;  2JYO A;  4O2D A;  1O7Z A;  1TVX A;  1TWG B;  3CF5 A;  1O7I A;  4MNO A;  3J7A V;  1IZ6 A;  1STY A;  4FF3 A;  5AJ3 L;  3I4M H;  2DNC A;  3JC6 6;  3S1M H;  1LAC A;  3U9O A;  1RKN A;  1Q86 C;  5IOD A;  4K8I A;  5GRO A;  1I50 B;  5DM7 3;  3OTO L;  4POF A;  4K5V A;  3OIQ A;  5M5W B;  1RTO A;  4JI3 Q;  3TBI B;  3E6Z X;  1YIJ A;  3DM1 A;  1BCP D;  4HSP A;  3I4O A;  1IL8 A;  2JEB I;  2E2I B;  1QOH A;  1TY0 A;  2LXK A;  1Q8I A;  3I4M G;  3F2U A;  4GZY C;  2AQ1 B;  2EJM A;  1ZXT A;  2I0Q A;  4AYB G;  3CMA A;  4LF7 L;  4DR4 L;  3R93 A;  2VY3 A;  5CV7 A;  5A35 A;  2XGT A;  5IGC A;  4UP8 A;  2Z6B A;  4KY5 A;  3MEF A;  3KJO A;  1EUJ A;  4FXK C;  4U67 3;  4OWX B;  1KQS A;  2EVB A;  2RSO A;  2VQF Q;  5EBC A;  4ZAI A;  3GTO B;  1Q8K A;  2R93 B;  1VQD A;  3KF8 A;  2WB1 E;  2Q2T A;  4B3M L;  5CV5 A;  4IQZ A;  2JP1 A;  3D4W A;  5FKA C;  3RD4 A;  1XYI A;  1GKH A;  1ENC A;  1AE3 A;  1PH9 A;  2CFM A;  4KI0 A;  3DHQ A;  1BBX C;  5EPJ A;  1L0Y B;  4DV3 Q;  4JK1 C;  2A69 D;  3ITP A;  4LF9 L;  1VQ6 A;  4OEL B;  1F9S A;  5M3M H;  1GUG A;  2VL6 A;  1XMQ Q;  2Q8T A;  4MTK A;  2A74 C;  2OT2 A;  3G6J B;  1QUQ A;  4PMC A;  5ELO A;  2KEN A;  4EQN A;  4BA1 I;  3LX0 A;  3VYR A;  1B1Z A;  1QNK A;  1PZJ D;  3OWE B;  4DV7 Q;  1S5B D;  4PNY A;  3M4O H;  1B8A A;  3J80 i;  1R9T H;  2I5L X;  2F0V A;  2WB1 G;  1UE5 A;  2WV6 D;  4HIM A;  1AZQ A;  4KD4 A;  1R4P B;  3SEB A;  5M3M G;  4B3T Q;  3QIA A;  4QUF A;  4OO1 I;  3W3A A;  4HJA A;  3I55 A;  3NWS A;  2L1B A;  1IXR A;  4HJ8 A;  1EQT A;  1K8M A;  3L3O C;  4RGT A;  1D8L A;  1QE6 A;  4G7O C;  1PLF A;  4OGQ C;  3ICE A;  2R61 A;  2IY5 B;  3V96 A;  4DN4 M;  4FYD A;  2FHT A;  1XPO A;  1Z6H A;  1N32 L;  4G57 A;  1PTO C;  2B8G A;  5GAG C;  1PXU A;  1Y1V B;  2AUK A;  4A3M H;  2H1E A;  1SJE D;  3CCR A;  2PW5 A;  2RCN A;  1WD1 A;  1KRS A;  2OQ0 A;  4BBS H;  3GQB A;  2NVQ B;  1OO9 B;  1E22 A;  1O80 A;  3WWV A;  1KNA A;  3A7A B;  2LXJ A;  2QCP X;  3G6E A;  1NMF A;  2MNA A;  2EYP A;  1SE4 A;  1QIL A;  4R4O A;  1HA6 A;  4A3M G;  1PH5 A;  2A6H D;  1SYG A;  2ZTC A;  4JV5 Q;  2DNE A;  2GA4 B;  4DR6 Q;  2R92 H;  2M00 A;  4DKA C;  3BU2 A;  3F2B A;  2ALY B;  3O13 A;  1Y1W H;  4A3G H;  5AFW A;  5CV4 A;  5NUC A;  4X3S A;  1FR3 A;  1AH9 A;  1L1O C;  4HJ5 A;  1HZA A;  4HTH A;  2EIF A;  1BNZ A;  2ES2 A;  3PUX A;  5IIF A;  3Q24 A;  1M4V A;  3OIP A;  3GTJ H;  1TWH B;  1JB3 A;  4ILW A;  3U4V A;  4ODG A;  2A8V A;  1YNJ C;  1HNX L;  2R92 G;  3CCQ A;  4DNR B;  1L1O A;  2FMC A;  3IKJ A;  2ID0 A;  3UDG A;  3CCV A;  1Y1W G;  4A3G G;  3J81 L;  4HID A;  4R4T A;  2IWH A;  3G7L A;  4CKE A;  1XNQ L;  2NVX B;  2JA6 G;  4DK3 C;  5CBE E;  2QW7 A;  3K5L A;  1S4Z A;  4B9X A;  5C4J B;  3NSW A;  2L55 A;  2JN4 A;  4DV6 L;  3T1Y L;  4IPG A;  2Z1C A;  3BZD B;  1XXG A;  4YCW A;  5ELF A;  5GAE C;  3S15 B;  1XX8 A;  3FRP B;  2HIX A;  2XRS D;  4OIK A;  1BKB A;  2JE6 I;  4DR4 Q;  4LF6 Q;  4DV1 Q;  3DWQ A;  4N8X 1;  3MXP A;  1TR5 A;  5JOB A;  4X62 L;  5GAD C;  1PH3 A;  4A93 H;  3S1R H;  4JI0 L;  3PO3 H;  3I90 A;  3BZK A;  1PRT B;  2NZ1 D;  4A3B H;  4B3M Q;  2Q2U A;  5IP7 H;  2RVL A;  4HSV A;  2MO0 A;  4GN4 B;  4BWG B;  3GV3 A;  1KDA A;  3PSI A;  5JPM C;  3VYT A;  3ULP A;  2DUD A;  1RL2 A;  3P20 A;  4DR3 L;  2MPM A;  1SNO A;  4A93 G;  1E2W A;  1E24 A;  5I2X A;  1Y8O B;  3PO3 G;  4YY3 L;  4YHH L;  3H15 A;  4JBK A;  1SNM A;  2L12 A;  2K5W A;  1LAB A;  5IP7 G;  2CCZ A;  3MZ5 A;  1JIC A;  3KK7 A;  1FNU A;  2ZM6 L;  4GS3 A;  5IT9 L;  1IYU A;  1NSN S;  1Z7T A;  4EVO A;  3ER0 A;  5HUR A;  1KD1 C;  3KOJ A;  2MFI A;  1F2L A;  4RKL A;  4DAP A;  4GNX B;  3V2T A;  3DWA A;  3C46 A;  4J8Q A;  3RMH A;  3H6M A;  2SDF A;  1UEB A;  2CW0 C;  2Q2I A;  3I4M B;  4BY7 H;  3S1M B;  3SHL A;  4LF5 L;  4IUR A;  2IHF A;  5HGT A;  2NVT H;  4AYB B;  5IGD A;  5IOC A;  4A3J B;  5CC4 A;  4BXX H;  1HCZ A;  1N32 Q;  5LMU L;  3CME A;  3A74 A;  2EY2 A;  1VQN A;  4LFC L;  1WI5 A;  3J81 i;  1DJR D;  4BBR H;  3BS1 A;  2KHI A;  1ICW A;  5G3L F;  4DR7 L;  5HY6 A;  3HOX B;  1G8Z D;  3DM3 A;  1K9M C;  4BY7 G;  1XPU A;  1Q1E A;  4KKT A;  4UP7 A;  1LTS D;  5J22 A;  1K3R A;  4IOC A;  2QGQ A;  1I4R A;  3MC0 B;  5IWA L;  2K14 A;  4BXX G;  1JOO A;  2BE5 D;  3RZO H;  4JI2 Q;  3URY A;  1UE1 A;  2PO4 A;  1K28 A;  4BBR G;  5EQ0 A;  3GP7 A;  3PUY A;  3FDT A;  2WP8 J;  4Y7N H;  5JJK A;  1K0R A;  1WOC A;  4DXF A;  2E74 C;  2PPB C;  5KYI A;  1NMG A;  4FXG C;  1FYC A;  1PRT D;  1YNN D;  2K5H A;  3UDI A;  2PMZ B;  2WB1 B;  4BA2 I;  1OXS C;  3PUW A;  1K8O A;  1UNS A;  2JA8 H;  2X6G A;  5M3M B;  3J81 j;  2OXP A;  3J7A F;  1HZB A;  4PV1 C;  2SEB D;  2AHO B;  2B39 A;  3ZJY C;  1MSG A;  1STH A;  5C3X A;  1CFM A;  4DR2 L;  2EXD A;  4DR1 L;  2QEX A;  3M4O B;  1BF4 A;  5GAH C;  2H5X A;  1TY2 A;  1R9T B;  1XNQ Q;  3GTQ H;  1KXL A;  2FMM A;  2D2C C;  1NUC A;  4P75 A;  4DV6 Q;  2JA8 G;  3T1Y Q;  1SE8 A;  1YBY A;  4IUP A;  2F0T A;  3UDF A;  3D3R A;  3D4D A;  3RLN A;  1MI2 A;  3KF8 B;  3J7Z C;  4LF8 Q;  2SOB A;  1SRU A;  2UXC Q;  1SMY C;  1I6H H;  4A3K H;  5C5M A;  1NY4 A;  2GN5 A;  1GUS A;  3F8T A;  3OOC A;  2A68 D;  4IPC A;  2K52 A;  5EKL A;  1TS2 A;  2BA1 A;  5FLM H;  5K36 H;  4X62 Q;  1X54 A;  2QF7 A;  1AE2 A;  1PZK D;  2D0O A;  2IL8 A;  1PYW D;  3VR6 A;  4JI0 Q;  4LFA L;  4A3M B;  1XNR Q;  2E2J H;  4DAV A;  2XIW A;  4DR5 Q;  1EFW A;  2K33 A;  3BDO A;  2UUB L;  4A3C G;  3K8A A;  4ZUI A;  5JAV A;  3IRB A;  3SXH A;  1XJV A;  4KD3 A;  1LUZ A;  4PZ7 A;  4P74 A;  3FP9 A;  3H09 A;  4A3K G;  2K7V A;  4AIM A;  2PI2 A;  3S2D H;  4DR3 Q;  3A56 A;  5FLM G;  1SRO A;  2K4K A;  5K36 G;  1O78 A;  4IFD J;  4LUO A;  3BDL A;  2F0L A;  1X32 A;  4AH6 A;  1Y69 U;  1C7Y A;  4FF4 A;  4YY3 Q;  2JJQ A;  4YHH Q;  4I7Z C;  1SBB B;  4JI6 Q;  1A6X A;  5E1F A;  1EEI D;  3FPP A;  1TWA H;  1LTG D;  4FF1 A;  2R7Z G;  2R92 B;  4M1U B;  1IBL Q;  2I07 B;  2PNR C;  3L7Z C;  4DK6 C;  1Y1W B;  4A3G B;  2A1A A;  1JWU D;  2CH4 A;  3ERO A;  1X3E A;  1U9R A;  2K1B A;  2NYZ D;  4RGN A;  4RHR A;  1PFS A;  1E1T A;  2JA6 B;  4H44 C;  4JI8 L;  3TP8 A;  3A8J E;  5CR3 A;  1H9S A;  5JPN C;  3C1E A;  1VQG A;  1OXU A;  3A8K E;  4YCU A;  5IT9 E;  2L15 A;  3BJU A;  1UWV A;  5I9O A;  3C1F A;  4NPS A;  4BY1 H;  1CM9 A;  4LF5 Q;  3DWP A;  1JWM D;  1G2T A;  2AWN A;  4I7A A;  1F2M A;  1PDQ A;  1X3P A;  5IGF A;  1NR4 A;  3HOV G;  1Q7Y C;  1KAB A;  3TRZ A;  1QWY A;  5LMU Q;  4L5S A;  3AMU A;  3CC7 A;  3T51 B;  1VF7 A;  3X3N A;  1EQQ A;  1KTK A;  2YU9 H;  4HMI A;  1MHW C;  1RIP A;  2IX0 A;  2HD3 A;  4DR7 Q;  1JQY D;  2RA4 A;  3E0J A;  5BR8 L;  3HOU H;  5ELB A;  4BY1 G;  5CBA E;  1VQ7 A;  3MXN A;  1TU2 B;  1U4P A;  2NVY H;  3A55 A;  2K05 A;  3SDZ A;  1JE4 A;  1K83 H;  1H95 A;  1STB A;  2OCE A;  3W2D A;  4JCV E;  4GKJ L;  5COY A;  4NXN L;  3KF6 A;  4A93 B;  3ND8 A;  3S1R B;  3PO3 B;  4NXM L;  4ZRZ A;  1JJC B;  1HJP A;  2MHV A;  4H7B A;  3HOU G;  2VZA A;  4IUQ A;  1L1O B;  2K50 A;  4WFN 3;  3GTM H;  2B2W C;  4CJ1 B;  3LWU A;  1AFP A;  2EY1 A;  4XYQ A;  1EEF D;  4JVZ A;  3IAY A;  1SNC A;  2EYO A;  3AFP A;  4JBJ A;  1EU3 A;  3EQL C;  4B3S L;  4H02 A;  4KHZ A;  2AUJ D;  1CK1 A;  4RCN A;  4XXE A;  2F0U A;  2XWB B;  4CDD C;  3GTP H;  4Q5V A;  5C4H A;  3CPW A;  1EY5 A;  4DR1 Q;  1X6O A;  3KLS X;  2EJG C;  2N55 A;  2B29 A;  1XPR A;  5M5X H;  4QJF A;  2B3G A;  1I4Q A;  3V05 A;  4KJN A;  4G7Z C;  4UY8 C;  1TWC H;  3F2C A;  4RCO A;  2ICE C;  4JW0 A;  4OX9 Q;  4BY7 B;  1GO3 E;  5DNF A;  4N9P A;  3HP3 A;  2NVT B;  3FMC A;  4KTA A;  1IHZ A;  3IFT A;  1HQM C;  2EE1 A;  4MN3 A;  1IL2 A;  3ERS X;  3EBE A;  4E6I A;  3I56 A;  4DAM A;  1MGS A;  4RWS C;  4LFA Q;  4DR6 L;  1SYF A;  4BBR B;  2RHQ B;  1PMR A;  1EOT A;  1JT8 A;  4RMF A;  2UUB Q;  3QO2 A;  3MWY W;  4QY7 A;  3M3Y H;  2D0P A;  5LHY 1;  1Q3L A;  3H0G H;  4HMJ A;  4RHS A;  4IFD I;  1O7L A;  2XNA C;  5EBD A;  4P72 A;  1LT6 D;  1L0W A;  3UE0 A;  3OW7 A;  2F03 A;  1KDC A;  5CV6 A;  4YIJ A;  3BZC A;  3SK6 A;  4ABN A;  4AYB E;  5L37 A;  3PO2 H;  3RZO B;  2ZXR A;  1QNU A;  1SMX A;  1YIT A;  1EIG A;  3K6O A;  4IJH A;  4ID6 A;  5CV9 A;  2ZJQ A;  4Y7N B;  5E4W C;  5J3B A;  1KL9 A;  2DJF C;  3AFQ A;  3TN2 A;  5CV8 A;  1ILQ A;  2M9V A;  3QG1 A;  2BDN A;  1EWH A;  2WIN B;  4JI4 Q;  3J7Y W;  3M4Q A;  4JI8 Q;  2F0W A;  2RDF A;  5M3F H;  2JA8 B;  1VQ8 A;  3VA7 A;  3TDQ A;  2AWO A;  4J1M A;  5JJL A;  3JAM L;  1G29 1;  4LF6 L;  1YNJ D;  4DV1 L;  3EVQ A;  1U4M A;  2F4I A;  4TRD A;  1H9K A;  4U68 A;  3PIP A;  2PQA A;  2NTT A;  3PIP 3;  4NP5 A;  2MGS A;  2SNM A;  1PH6 A;  2OTL A;  4FVM A;  4MZ9 A;  4LNQ A;  1JOQ A;  1YVC A;  1IW7 C;  3PF4 A;  1SE2 A;  5KNB A;  5M3F G;  2PMZ E;  2K28 A;  2UXD L;  2ASB A;  2IPK D;  5BR8 Q;  2K01 A;  2BA0 A;  2ICI A;  3HG9 A;  5I6Y A;  4OXP A;  1F2Y A;  1I6H B;  1VQF A;  2K04 A;  4A3K B;  4A75 A;  1E2V A;  4HCS A;  2HT1 A;  1LT5 D;  4KJO A;  2UUA L;  4GKJ Q;  2L9H A;  1X65 A;  4NXN Q;  1U4R A;  1B3A A;  1FGU A;  5DM6 3;  3N6R A;  4NXM Q;  2E2J B;  5D3I B;  3T4A C;  1XTD A;  2C5C A;  1U0L A;  2F0E A;  5F2D A;  4LK1 C;  1QVG A;  2R7Z B;  2FJ2 A;  3MXU A;  3NWT A;  5C0X H;  3NHH A;  2RDG A;  1V1P A;  1HXY D;  4PMW A;  3WDN A;  1F9R A;  2QKI C;  4YWL A;  1KHI A;  3P1H A;  4B3S Q;  4OWW B;  4NMZ A;  3NTK A;  4YWK A;  4DV4 Q;  1EY6 A;  3UDX A;  3K5M A;  3HOW H;  5J1Z A;  1A15 A;  3MA2 B;  1BDO A;  1TWA B;  2DY8 A;  2WII B;  3G4S A;  1VQP A;  1NR2 A;  5C0X G;  2K5D A;  4HED A;  4L8J A;  1HRJ A;  1EFI D;  4G7H C;  1K73 C;  3HOV B;  1C0A A;  4JYA L;  1J6Q A;  3I8Z A;  1FNW A;  1I4P A;  3FEW X;  1GOZ A;  5EKI A;  4XTC S;  4X66 L;  1ILP A;  3HOW G;  1S5D D;  2F3V A;  4FNF A;  4DA2 A;  2F0Q A;  1PTO F;  3KDF B;  1I4G A;  1A63 A;  3BG3 A;  4K2L A;  3D0F A;  3GTG H;  3PF5 A;  1B70 B;  2N49 A;  2QDB A;  5FLX L;  4BY1 B;  4X3K A;  1G91 A;  3STB C;  2E5L L;  3GO5 A;  1GHK A;  3M7G A;  3CHB D;  3JAM i;  1PH2 A;  3MTS A;  4HAE A;  4ZUJ A;  3PQI A;  4JI2 L;  5G3L D;  2ENB A;  3I73 A;  1BO0 A;  3KLW A;  1EY9 A;  4KLK A;  4R4C A;  4RAU C;  4C1N K;  2RF4 A;  3FVQ A;  2GVB A;  5IP9 H;  3TQY A;  2YU9 B;  1DGS A;  3CU7 A;  1DM0 B;  1YNX A;  2YTY A;  5IGE A;  2VQE L;  1B50 A;  4BBS G;  1B2T A;  3HOU B;  1I94 L;  3R2T A;  1LTI D;  3J80 E;  1UUP A;  4K2K A;  4FP5 D;  1YHQ A;  2NVY B;  1EYC A;  3C3L A;  4DUZ L;  1S5C D;  3X3M A;  2E2H H;  3KYH C;  4UAI A;  1K83 B;  2F0H A;  4IUN A;  4A3I B;  1U4L A;  2NWG A;  1I4H A;  4GKK L;  1WTH A;  4R8I A; 
#chains in the Genus database with same CATH homology
 1JWS D;  3NXW A;  2I46 A;  3GTK B;  2IJ0 A;  1BCP C;  1WTO A;  1AW7 A;  4X3T A;  1PTO H;  1AN8 A;  1II3 A;  3KBX A;  4F87 A;  1CQV A;  1TS5 A;  3GTM B;  2NTS A;  1T5X D;  1D5X C;  5CGK A;  3K0Y A;  1ZKO A;  1D5M C;  3MVV A;  2BDO A;  4KN4 C;  4DK1 A;  1TKW B;  5EJW A;  2PZT A;  3T16 A;  4KKU A;  3AB9 A;  1R4Q B;  2CVR A;  3BDC A;  3GTP B;  5I9P A;  2NUC A;  1OXT A;  2F0M A;  4S3S A;  1QG7 A;  4ZKB B;  5M5X B;  1DOM A;  5EGT A;  1DXM A;  2A69 C;  1TWC B;  3NUC A;  4C56 C;  4TSS A;  1A2T A;  3MEH A;  2R3Z A;  4ZK9 B;  3DUZ A;  5JVH 3;  5KGU A;  1H9R A;  2EYH A;  3I91 A;  2K03 A;  3WOE A;  2Q8R E;  2WKC A;  4QMG A;  2XVS A;  1XTC D;  2F3W A;  1AZP A;  3EFX D;  1KLU D;  3DEP A;  5JVG 3;  2PYK A;  3VR2 A;  4ME5 A;  1ET9 A;  3M3Y B;  1EL0 A;  2KVM A;  2KUM A;  3D6C A;  3OSO A;  3A8I E;  2N88 A;  1CHP D;  2LY7 A;  4HCE A;  4K14 A;  5KNC A;  1EY7 A;  1D2B A;  1EYA A;  3MHB A;  4LMQ D;  4C3I G;  2F0I A;  5KRU A;  3NQI A;  1UAP A;  5ISR A;  3D8G A;  1Y8P B;  4LJZ C;  1NCV A;  5EKK A;  4PMB A;  2X69 A;  1T5E A;  1BUV T;  4RFB A;  2EYJ A;  3OPO A;  4EQP A;  5M3F B;  1WTQ A;  5D3D A;  5C4Z A;  2IW3 A;  2R6G A;  1EYD A;  2A6H C;  1FNV A;  5A2Q L;  3H91 A;  2B2T C;  1LTT D;  3CKI B;  4DK0 A;  3T13 A;  3VYS A;  3BVM A;  1CZW A;  2LMC B;  1E2Z A;  5BN5 A;  1D5Z C;  3M7N A;  2A6E C;  4CHT B;  4BS9 A;  1ENA A;  2B2T A;  1WTR A;  2KJX A;  3HZX A;  2M2L A;  3QJY A;  5M9O A;  5I2Y A;  2YYZ A;  1QB5 D;  4QB4 A;  1CHQ D;  1MSH A;  1SJH D;  1HTP A;  1S5E D;  3HRZ C;  1WVL A;  2PZW A;  4XT1 B;  3I4L A;  3J81 E;  1EY8 A;  2F0G A;  3HOW B;  1VMC A;  4IUT A;  3S9W A;  4QF4 A;  2HCC A;  1G6Z A;  3D6W A;  3TME A;  1STG A;  2A5H A;  4XQJ A;  1SYE A;  1LT4 D;  4C3J G;  2D9U A;  4BBS B;  3ERQ A;  4FO2 A;  1LV9 A;  1ENF A;  1V1P B;  2KEC A;  4DU9 A;  1Q1B A;  3SR1 A;  1D6E C;  3MFY A;  5KEE A;  3NP8 A;  1WTW A;  5EPL A;  1HUM A;  4ZLT F;  1B44 D;  1EU4 A;  1IKM A;  1DYQ A;  1CTM A;  4DNT B;  5T1G A;  1CA5 A;  1EQV A;  4XT3 B;  1A3V A;  1DOL A;  1GJX A;  1RHP A;  3GTJ B;  3ND9 A;  2E2H B;  2L11 A;  3NBI A;  1ZYR D;  2H4O A;  5IGB A;  3DXJ C;  1X3Q A;  3MFG A;  2D5D A;  4CJ0 B;  2X6L A;  4CGY B;  5C0X J;  3LWE A;  4NKL A;  2LFN A;  2MP1 A;  3P7J A;  4TKO B;  4C1N I;  2JA7 B;  1PTO B;  3RUZ A;  2DY7 A;  2EOT A;  4B9W A;  2CHB D;  1PZI D;  1CT1 D;  1UEA B;  2J4X A;  3D31 A;  2RQX A;  2XWJ B;  4N9T A;  2B2U C;  3Q6S A;  2BE5 C;  5LL6 S;  2VB2 X;  1HFN A;  1TS4 A;  4WOR A;  2QEJ C;  3Q0A A;  2B2Y C;  4C3H G;  4KV6 A;  3NTI A;  3OMC A;  1PRT C;  4Z9C B;  1RDP D;  1W6J A;  1IYV A;  2PCF B;  1NAP A;  5DEH A;  4WJW A;  4A3B B;  1HHV A;  4G4K A;  3DEO A;  3NBH A;  5C4X B;  2TMP A;  4ZKC B;  1TII D;  4EQO A;  1EZ6 A;  2EYF A;  5LL6 X;  4H13 C;  2G9H D;  4C3I B;  1HTL D;  2B2W A;  1V43 A;  4IUV A;  2VXW A;  2IT1 A;  1HFG A;  5ELD A;  2KOL A;  3VR3 A;  3K7A B;  2MJ8 A;  1L0X B;  4C2M B;  1SDF A;  2A68 C;  2RSN A;  3TP5 A;  4RA8 A;  4OIJ A;  3HOY B;  5JJZ A;  3ONA B;  2E75 C;  1A2U A;  1EY4 A;  1PTO D;  1ONL A;  1TT2 A;  4KY7 A;  4IZ8 A;  4NW2 A;  1EIH A;  4QCL A;  1BQQ T;  3NTH A;  3R3O A;  3UI2 A;  1RD9 D;  3PUV A;  5D14 A;  3OHX C;  2PZU A;  3EJI A;  5C5L A;  1C4Q A;  1I4X A;  2B2V C;  1WCM B;  1ML0 D;  1JCK B;  4P2C B;  1Y8N B;  4RGO S;  2F0J A;  1I6V C;  2OF1 A;  4R9W A;  2JXM B;  1CA6 A;  1LTA D;  3SE0 A;  1SAP A;  2B2V A;  3SK4 A;  1TWF B;  3T53 B;  4F8M A;  2PQE A;  5C0X I;  2E2D C;  1QCB D;  4L63 B;  3WOF A;  1C48 A;  3TZU A;  1GUW A;  1SEB D;  3KUP A;  2NN6 H;  5E4X A;  1F77 A;  3KLR A;  1EZ8 A;  5FO8 B;  1DON A;  3D4R A;  3GTQ B;  3QOJ A;  3CRK C;  2JSO A;  2O5I C;  4IAL A;  3M85 A;  1KLG D;  4C3J B;  2NN6 G;  1OXV A;  4FXD A;  4B08 A;  2F0N A;  1V1O A;  3LNN A;  1V8Q A;  4UDU C;  1CI3 M;  2B63 B;  1PFN A;  3GV6 A;  4IFD H;  2HDM A;  3H94 A;  3GD7 A;  1KNE A;  1O7Y A;  2KEE A;  4QIW B;  3QB3 A;  2J7Z A;  3S1Q B;  2WAC A;  3CRL C;  4QUC A;  3S16 B;  3S2D B;  1HUN A;  2HQE A;  4IFD G;  1GUT A;  1LTB D;  3T56 B;  4K5X A;  3VA5 A;  2F0K A;  5JEA H;  3K58 A;  1JOK A;  2HDL A;  2Z8L A;  2XN9 C;  2O5J C;  2BOS A;  1DZ1 A;  4K6L A;  5C44 B;  2VNU D;  3DMU A;  2CW0 D;  1LO5 D;  2B8F A;  5I4D A;  2HCI A;  3HS0 C;  2EY6 A;  5JEA G;  3E5S A;  1PFB A;  1BXT A;  3TP7 A;  3C2P A;  2KHS A;  4KY6 A;  3PMF A;  1OXX K;  3P75 A;  4C3H B;  2IX1 A;  1RJT A;  1B9M A;  3QWN A;  4LAA A;  4ZQ3 A;  4FF2 A;  2V4D A;  2ZXO A;  3NE5 B;  5CMD A;  3RLF A;  1H9J A;  2KED A;  2RDH A;  2LKV A;  3S2H B;  4A3E B;  4H0L C;  5T1I A;  1ESF A;  1H9S B;  2L5T A;  1RCV D;  2F0D A;  1SYB A;  1DOK A;  1SNQ A;  1MBY A;  4OO1 H;  1BOS A;  3U9S A;  5EPK A;  2A6E D;  1BCP F;  2KQ3 A;  1FGB D;  3K5N A;  4OO1 G;  4TQU S;  1GUN A;  5DAU A;  3I3C A;  3H3V C;  5ELE A;  1SSO A;  3JAM E;  4PQX A;  2F0O A;  2NBF A;  5C3W A;  1KAA A;  1JC7 A;  5KND A;  1WD0 A;  5I6W A;  1E0B A;  1GUO A;  2F0F A;  2EPB A;  1SMY D;  4EGV A;  2TSS A;  3SVM A;  2CQA A;  1G2S A;  2EYM A;  2C9O A;  4DF7 A;  3I70 A;  3GTL B;  1SND A;  3HOZ B;  4WRD A;  4Q0F A;  2AQ2 B;  5FOB B;  1EWC A;  3H0G B;  3BVZ A;  5BN3 A;  1A3U A;  3Q22 A;  1C8C A;  3FPU B;  3PUZ A;  3PO2 B;  1D1I A;  1HA5 A;  3PIO 3;  2G9D A;  4XYO A;  2VUM B;  4V19 0;  2KA7 A;  3BVG A;  1DD2 A;  2LS0 1;  2Z4I A;  3I72 A;  3MAQ A;  2OEO A;  5COR A;  2J0T D;  2BCO A;  4CKB A;  4CBV A;  4XDX A;  4DXG A;  2EXZ A;  5TSS A;  5FLX E;  1S5F D;  2L4N A;  1B53 A;  4CJ2 C;  4MHE A;  3MXG A;  2XRQ D;  1GHJ A;  4V0B A;  1VMP A;  1SXT A;  2QIL A;  1M8A A;  5KYL A;  2RKS A;  2JEA I;  3ZYY X;  2SNS A;  3K5O A;  1AEX A;  2EJF C;  4DGZ A;  5D65 A;  3SK5 A;  3N52 A;  4OL7 A;  4O42 A;  4ULL A;  3HEJ A;  2K6A A;  1F9P A;  1STN A;  1SE3 A;  3KLS A;  4X3U A;  3S17 B;  4F88 A;  5E3F A;  4K8J A;  4CKC A;  4NDX A;  4KHV A;  1Q90 A;  1WTX A;  1F9Q A;  3K59 A;  2HUG A;  2DN8 A;  3PV0 A;  1VDZ A;  2ZXP A;  1CZG A;  4F7X A;  2FIN B;  4KK7 A;  5ELC A;  3CQZ B;  4A3D B;  1SYC A;  2KCN A;  4A3F B;  5FK9 C;  3GTG B;  3VR4 A;  3NQT A;  3BYT B;  3OMG A;  3KBG A;  4M8A A;  1A3T A;  2F1M A;  1SFO B;  4KMU C;  4RKB A;  1RF2 D;  1STA A;  5FO7 B;  4L6T B;  1XWE A;  3NK9 A;  2K32 A;  2MUY A;  4XIG S;  4KN7 C;  1TS3 A;  2F0S A;  5CYU A;  5C6A A;  2EDG A;  1W6K A;  1I3Q B;  1AP0 A;  2EZV A;  2Q8I B;  1IKL A;  4K6D A;  1QJO A;  1GXD C;  1LTR D;  5M5Y B;  3K57 A;  3S1N B;  3AU7 A;  1FD7 D;  1J8I A;  1DCZ A;  3S14 B;  4DAY A;  3QOL A;  2KCC A;  4RH6 A;  2JA5 B;  1J9O A;  5JEA J;  3M4Y A;  2O4X A;  2E76 C;  2IX3 A;  2B2U A;  3HGB A;  1JR0 D;  3VYU A;  2XSC A;  1IW7 D;  1ZEQ X;  1MD2 D;  1YNN C;  5A2Q E;  1JOR A;  3SK8 A;  4R8N A;  2Z4H A;  1B4O A;  1ESR A;  3NPP A;  3IL8 A;  1VCI A;  1PFM A;  4IUU A;  5C3E B;  2EY5 A;  1PRT F;  2O2L D;  4XQQ A;  2B2Y A;  2ZT9 C;  2VB3 X;  1STE A;  2RBM A;  4HN7 A;  1KDB A;  3R8B A;  3TP6 A;  1BCP B;  4J6H A;  2Y0S B;  1WTV A;  4OHJ A;  3A54 A;  2L0C A;  3FKI B;  2WKD A;  3Q23 A;  1BR9 A;  1EY0 A;  5J39 A;  3TSS A;  3RZD B;  3A7L A;  1SYD A;  4MIU A;  2AQ3 B;  3TZD A;  1D1K A;  4K5W A;  1VF5 C;  4HR7 B;  1WTP A;  2FFK B;  3L9A X;  1HPC A;  4IN3 A;  1ROD A;  3VR5 A;  4KKS A;  2NN6 I;  2K5Q A;  5FO9 B;  1RTN A;  1F2Z A;  1H9M A;  1LLR D;  1TQO A;  1B9N A;  3IFD A;  3HKZ B;  1Z47 A;  2A73 B;  5KIX A;  3BYY B;  1Q12 A;  5K5P A;  3EA6 A;  4RGM A;  4DFA A;  4O1N A;  2EYL A;  4ZYS A;  2PW7 A;  3J80 L;  2D62 A;  2WAQ B;  1LT3 D;  2F0P A;  4I65 A;  1SNP A;  1HQR D;  5BN4 A;  1CQF A;  3I4N B;  2NB0 A;  4JBW A;  5IGG A;  3OWF A;  4XQN A;  1ZYR C;  1ET6 A;  3R2I A;  2JYO A;  1O7Z A;  1TVX A;  1TWG B;  3J7A V;  1STY A;  4FF3 A;  2DNC A;  1LAC A;  3U9O A;  1RKN A;  5IOD A;  4K8I A;  1I50 B;  5DM7 3;  4K5V A;  3OIQ A;  5M5W B;  1RTO A;  3TBI B;  3E6Z X;  3DM1 A;  1BCP D;  4HSP A;  1IL8 A;  2JEB I;  2E2I B;  1QOH A;  1TY0 A;  1Q8I A;  3F2U A;  4GZY C;  2AQ1 B;  2EJM A;  1ZXT A;  3R93 A;  5CV7 A;  5A35 A;  5IGC A;  4KY5 A;  4FXK C;  4U67 3;  2EVB A;  2RSO A;  5EBC A;  4ZAI A;  3GTO B;  2R93 B;  3KF8 A;  5CV5 A;  4IQZ A;  2JP1 A;  3D4W A;  5FKA C;  3RD4 A;  1XYI A;  1ENC A;  4KI0 A;  3DHQ A;  1BBX C;  5EPJ A;  1L0Y B;  4JK1 C;  2A69 D;  3ITP A;  1F9S A;  1GUG A;  2Q8T A;  2A74 C;  2OT2 A;  3G6J B;  4PMC A;  4EQN A;  4BA1 I;  3LX0 A;  3VYR A;  1B1Z A;  1QNK A;  1PZJ D;  3OWE B;  1S5B D;  4PNY A;  2F0V A;  2WV6 D;  1AZQ A;  4KD4 A;  1R4P B;  3SEB A;  3QIA A;  4QUF A;  4OO1 I;  3W3A A;  3NWS A;  2L1B A;  1EQT A;  1K8M A;  3L3O C;  4RGT A;  4G7O C;  1QE6 A;  1PLF A;  4OGQ C;  2R61 A;  3V96 A;  4DN4 M;  4FYD A;  2FHT A;  1Z6H A;  4G57 A;  1PTO C;  2B8G A;  1PXU A;  1Y1V B;  2AUK A;  2H1E A;  1SJE D;  2PW5 A;  1WD1 A;  3GQB A;  2NVQ B;  1OO9 B;  1O80 A;  1KNA A;  3A7A B;  2QCP X;  2EYP A;  1SE4 A;  1QIL A;  1HA6 A;  2A6H D;  1SYG A;  2DNE A;  2GA4 B;  2M00 A;  3O13 A;  5AFW A;  5CV4 A;  5NUC A;  4X3S A;  1FR3 A;  4HTH A;  1BNZ A;  3PUX A;  5IIF A;  3Q24 A;  1M4V A;  3OIP A;  1TWH B;  1JB3 A;  4ILW A;  4ODG A;  1YNJ C;  4DNR B;  2FMC A;  3IKJ A;  2ID0 A;  3J81 L;  2IWH A;  3G7L A;  4CKE A;  2NVX B;  5CBE E;  3K5L A;  1S4Z A;  4B9X A;  5C4J B;  3NSW A;  2L55 A;  2Z1C A;  3BZD B;  1XXG A;  5ELF A;  3S15 B;  1XX8 A;  3FRP B;  2XRS D;  4OIK A;  2JE6 I;  3DWQ A;  3MXP A;  1TR5 A;  5JOB A;  3I90 A;  1PRT B;  2NZ1 D;  2RVL A;  4HSV A;  4BWG B;  3GV3 A;  1KDA A;  5JPM C;  3VYT A;  3P20 A;  2MPM A;  1SNO A;  1E2W A;  5I2X A;  1Y8O B;  1SNM A;  2L12 A;  2K5W A;  1LAB A;  3MZ5 A;  1JIC A;  3KK7 A;  1FNU A;  5IT9 L;  1IYU A;  1NSN S;  1Z7T A;  4EVO A;  5HUR A;  1F2L A;  4RKL A;  4DAP A;  3V2T A;  3DWA A;  3C46 A;  4J8Q A;  3RMH A;  3H6M A;  2SDF A;  2CW0 C;  3I4M B;  3S1M B;  3SHL A;  4IUR A;  5HGT A;  4AYB B;  5IGD A;  5IOC A;  4A3J B;  5CC4 A;  1HCZ A;  2EY2 A;  1DJR D;  3BS1 A;  1ICW A;  5G3L F;  3HOX B;  1G8Z D;  1Q1E A;  4KKT A;  1LTS D;  5J22 A;  1I4R A;  3MC0 B;  1JOO A;  2BE5 D;  3URY A;  2PO4 A;  5EQ0 A;  3GP7 A;  3PUY A;  3FDT A;  2WP8 J;  4DXF A;  2E74 C;  2PPB C;  5KYI A;  4FXG C;  1FYC A;  1PRT D;  1YNN D;  2PMZ B;  2WB1 B;  4BA2 I;  1OXS C;  3PUW A;  1K8O A;  1UNS A;  2X6G A;  5M3M B;  2OXP A;  3J7A F;  4PV1 C;  2SEB D;  2B39 A;  1MSG A;  1STH A;  5C3X A;  1CFM A;  3M4O B;  1BF4 A;  1TY2 A;  1R9T B;  2FMM A;  2D2C C;  1NUC A;  4IUP A;  2F0T A;  3D3R A;  3D4D A;  1MI2 A;  2SOB A;  1SMY C;  5C5M A;  1GUS A;  3OOC A;  2A68 D;  5EKL A;  1TS2 A;  2BA1 A;  5K36 H;  2QF7 A;  1PZK D;  2IL8 A;  1PYW D;  3VR6 A;  4A3M B;  4DAV A;  2XIW A;  2K33 A;  3BDO A;  4ZUI A;  5JAV A;  3SXH A;  4KD3 A;  3H09 A;  2K7V A;  3A56 A;  5K36 G;  1O78 A;  4IFD J;  3BDL A;  2F0L A;  1X32 A;  1Y69 U;  4FF4 A;  4I7Z C;  1SBB B;  1A6X A;  5E1F A;  1EEI D;  3FPP A;  1LTG D;  4FF1 A;  2R92 B;  4M1U B;  2I07 B;  2PNR C;  3L7Z C;  1Y1W B;  4A3G B;  1JWU D;  3ERO A;  2NYZ D;  1U9R A;  2K1B A;  4RGN A;  4RHR A;  2JA6 B;  4H44 C;  3TP8 A;  3A8J E;  5CR3 A;  1H9S A;  5JPN C;  3C1E A;  1OXU A;  3A8K E;  5IT9 E;  5I9O A;  3C1F A;  1CM9 A;  3DWP A;  1JWM D;  1G2T A;  2AWN A;  1F2M A;  1PDQ A;  1X3P A;  5IGF A;  1NR4 A;  1KAB A;  1QWY A;  3AMU A;  3T51 B;  1VF7 A;  3X3N A;  1KTK A;  4HMI A;  2IX0 A;  1JQY D;  2RA4 A;  3E0J A;  5ELB A;  5CBA E;  3MXN A;  1TU2 B;  1U4P A;  3A55 A;  2K05 A;  3SDZ A;  1JE4 A;  1STB A;  3W2D A;  5COY A;  4A93 B;  3ND8 A;  3S1R B;  3PO3 B;  4ZRZ A;  2MHV A;  4H7B A;  4IUQ A;  4WFN 3;  2B2W C;  4CJ1 B;  3LWU A;  1AFP A;  2EY1 A;  4XYQ A;  1EEF D;  3IAY A;  1SNC A;  2EYO A;  1EU3 A;  3EQL C;  4KHZ A;  2AUJ D;  1CK1 A;  4RCN A;  4XXE A;  2F0U A;  2XWB B;  4Q5V A;  5C4H A;  1EY5 A;  3KLS X;  2EJG C;  2N55 A;  1I4Q A;  3V05 A;  4KJN A;  4G7Z C;  4RCO A;  2ICE C;  4BY7 B;  5DNF A;  4N9P A;  3HP3 A;  2NVT B;  3FMC A;  4KTA A;  1IHZ A;  3IFT A;  1HQM C;  2EE1 A;  4MN3 A;  4E6I A;  1MGS A;  4RWS C;  1SYF A;  4BBR B;  1PMR A;  1EOT A;  3QO2 A;  3MWY W;  5LHY 1;  1Q3L A;  4HMJ A;  4RHS A;  4IFD I;  1O7L A;  2XNA C;  5EBD A;  1LT6 D;  2F03 A;  3OW7 A;  1KDC A;  5CV6 A;  4YIJ A;  3SK6 A;  4ABN A;  3RZO B;  2ZXR A;  1QNU A;  1EIG A;  3K6O A;  4ID6 A;  5CV9 A;  4Y7N B;  5E4W C;  3TN2 A;  5CV8 A;  1ILQ A;  2M9V A;  3QG1 A;  2BDN A;  1EWH A;  2WIN B;  3J7Y W;  2F0W A;  2RDF A;  2JA8 B;  3VA7 A;  3TDQ A;  2AWO A;  4J1M A;  3JAM L;  1G29 1;  1YNJ D;  3EVQ A;  1U4M A;  2F4I A;  4TRD A;  1H9K A;  4U68 A;  2NTT A;  3PIP 3;  4NP5 A;  2MGS A;  2SNM A;  4FVM A;  1JOQ A;  1IW7 C;  1SE2 A;  5KNB A;  2K28 A;  2IPK D;  2K01 A;  2BA0 A;  2ICI A;  3HG9 A;  5I6Y A;  1F2Y A;  1I6H B;  2K04 A;  4A3K B;  1E2V A;  4HCS A;  1LT5 D;  4KJO A;  2L9H A;  1U4R A;  1B3A A;  5DM6 3;  3N6R A;  2E2J B;  5D3I B;  3T4A C;  2C5C A;  2F0E A;  5F2D A;  4LK1 C;  2R7Z B;  2FJ2 A;  3MXU A;  3NWT A;  5C0X H;  3NHH A;  2RDG A;  1V1P A;  1HXY D;  4PMW A;  3WDN A;  1F9R A;  2QKI C;  3P1H A;  4NMZ A;  3NTK A;  1EY6 A;  3K5M A;  5J1Z A;  1A15 A;  3MA2 B;  1BDO A;  1TWA B;  2DY8 A;  2WII B;  1NR2 A;  5C0X G;  2K5D A;  4HED A;  4L8J A;  1HRJ A;  1EFI D;  4G7H C;  3HOV B;  3I8Z A;  1FNW A;  1I4P A;  3FEW X;  1GOZ A;  5EKI A;  4XTC S;  1ILP A;  1S5D D;  2F3V A;  4FNF A;  4DA2 A;  2F0Q A;  1PTO F;  1I4G A;  3BG3 A;  4K2L A;  1G91 A;  2QDB A;  5FLX L;  4BY1 B;  4X3K A;  3GO5 A;  1GHK A;  3M7G A;  3CHB D;  3MTS A;  4HAE A;  4ZUJ A;  5G3L D;  2ENB A;  3I73 A;  1BO0 A;  1EY9 A;  4RAU C;  4C1N K;  3FVQ A;  2YU9 B;  3CU7 A;  1DM0 B;  5IGE A;  1B50 A;  1B2T A;  3HOU B;  3R2T A;  1LTI D;  3J80 E;  1UUP A;  4K2K A;  4FP5 D;  2NVY B;  1EYC A;  3C3L A;  1S5C D;  3X3M A;  4UAI A;  1K83 B;  2F0H A;  4IUN A;  4A3I B;  1U4L A;  2NWG A;  1I4H A;  4R8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...