5KRUA

Crystal structure of staphylococcal nuclease variant delta+phs t62e/v66k at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
132
structure length
132
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFEKKMKENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62E/V66K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 132
sequence length 132
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5kruA00
3DMUA 3V2TA 1RKNA 5IOCA 1STBA 3T16A 4PMCA 1ENAA 4HMJA 4QB4A 2KHSA 2RDFA 5F2DA 1EY9A 2F0KA 5CV6A 5J1ZA 5JAVA 5CV9A 4ME5A 2F0TA 2RKSA 1SYFA 3MXPA 4EQPA 5IGFA 5IGBA 3S9WA 1AEXA 2F0DA 3D6CA 3NXWA 2EY5A 2EY1A 4S3SA 2PZWA 2NUCA 4ZUIA 4KJOA 5C5MA 1TQOA 2F0MA 4YIJA 2EYHA 5E1FA 4EQNA 4H7BA 3SR1A 3TMEA 2F3WA 3HZXA 4KJNA 3EVQA 2SNSA 5IGEA 1F2YA 4HMIA 4RKLA 4NP5A 3P1HA 1TT2A 1A3VA 1NSNS 4KTAA 3SK5A 4E6IA 3QB3A 3D4WA 5EGTA 2O4XA 1SNDA 3NK9A 1U9RA 3TP6A 5I9PA 2HQEA 4K6DA 5C5LA 5IGGA 1KAAA 4KV6A 4QMGA 1EZ6A 2M00A 5CC4A 2EYOA 3NP8A 1STYA 2LKVA 5IIFA 5EKKA 2F0VA 5CR3A 4K14A 5C3XA 5KYIA 1ENCA 3P75A 5KIXA 4B9XA 4F7XA 1KDAA 5I6WA 3LX0A 3U9OA 3EJIA 2SOBA 5CV7A 4KY5A 4KY6A 5KGUA 2F0PA 2EY6A 4ZQ3A 4LAAA 4N9PA 3BDLA 2F0EA 5E3FA 4WRDA 1EY4A 4ODGA 5CV4A 4MIUA 3T13A 1F2MA 1IHZA 1SNOA 2PZUA 2F0WA 4KY7A 1SNMA 4NDXA 4DFAA 4EQOA 5NUCA 5C3WA 1STNA 5C6AA 5CGKA 3MVVA 5M9OA 2F0QA 4R8NA 1A2UA 5I6YA 2F0OA 3NQTA 4TRDA 2F0LA 2KQ3A 4K8JA 4EVOA 1EQVA 1II3A 3SK6A 4F8MA 4RKBA 1EY5A 5K5PA 1JOKA 3OWFA 2WACA 3D8GA 2EYFA 4QF4A 2PW7A 3EROA 1SYEA 4PMBA 2EYLA 1KABA 1SNQA 5HGTA 3NUCA 1A3UA 1SYBA 3PMFA 4NKLA 4KHVA 4IALA 3NHHA 2EXZA 4G57A 1STHA 5J39A 5IODA 1NUCA 5CV5A 4PNYA 1KDBA 3HEJA 1EY7A 4J6HA 3ITPA 4NMZA 2F0GA 3ERQA 4HTHA 2F0NA 4WORA 5DAUA 2F0JA 1JOOA 3SXHA 4DF7A 5KRUA 4K2KA 4IUNA 3C1EA 1JORA 4DGZA 5KYLA 5IGDA 2EYPA 1JOQA 3E5SA 4IZ8A 3R3OA 4J1MA 1SNCA 4K5VA 3TP5A 2EYMA 4ID6A 3C1FA 5CV8A 5I9OA 2EY2A 1EY6A 1SYGA 1F2ZA 4K5XA 1A2TA 3H6MA 3SK8A 2RBMA 2EYJA 1KDCA 1SYCA 2PZTA 4K2LA 2F0SA 1EYCA 3SK4A 4B9WA 5C4HA 4KD4A 3MHBA 3QOJA 4K5WA 1EY0A 2OXPA 1A3TA 3BDCA 2F3VA 5JOBA 3DHQA 2F0UA 5EKLA 4I65A 3D4DA 3RUZA 3VA5A 5HURA 3OSOA 2OF1A 1STAA 4N9TA 2PYKA 1EYDA 2OEOA 5C4ZA 4ZUJA 2F0IA 3QOLA 5KEEA 2ENBA 2PQEA 3SHLA 1STGA 5J22A 3OMGA 4KD3A 5DEHA 3MEHA 4DU9A 1EY8A 2PW5A 3TP7A 2F0FA 3MZ5A 1SYDA 4K8IA 5IGCA 1SNPA 1EYAA 2QDBA 2SNMA 3OMCA 3TP8A 1TR5A 2F0HA 1EZ8A 5ISRA 4OL7A
chains in the Genus database with same CATH superfamily
1DJRD 1W6JA 2GVBA 2QDLA 3KK7A 3KLSX 2OCEA 3VDYA 4DXGA 4GKJL 4HJ5A 4K0KL 1CKMA 4IO9A 2G5DA 2A6ED 4IPGA 2AQ3B 2ZXPA 5C3EH 1JJGA 4HR7B 4L5TA 2N88A 4JK1C 4DV2L 2R92B 1SBBB 1UUPA 1A0IA 3K7AH 1YNND 1LO5D 2PCFB 3EVQA 5FO7B 1QZHA 2ASBA 2JN4A 2IW3A 2RVLA 4A4IA 2PNRC 2K5QA 3J7YW 5M3MH 3S14B 4GKKL 3FKIH 3PO3G 3L0OA 1XXGA 2EXDA 1D5ZC 1VQFA 1B70B 1I3QH 2KOLA 3PCOB 1TKWB 5C3XA 1R9TB 2UUBQ 3GTMB 1VQDA 2A6EC 2MFIA 1XMOQ 2SOBA 1ASYA 1K8GA 3K5NA 1TWGH 3BDLA 1FVIA 4A3JH 2IJ0A 3T13A 1SNOA 1HCZA 3WOFA 1YNNC 1STNA 2RSOA 2YU9H 3CCSA 4F8MA 1TS5A 3FPPA 1S5BD 4B3TL 1Q1BA 2JA8H 1GKHA 4G7HC 1SYEA 2K50A 1CUKA 2XRSD 3A8JE 1RHPA 5KNBA 1IBKL 2VQEL 2E75C 1MBYA 2UUAQ 5CV5A 5C3EB 4X3UA 4DR6Q 3SGIA 1VS0A 2R93H 2F0JA 2A8VA 2MNAA 3HOZG 5KYLA 3Q22A 4V190 1EWCA 4A3BG 3K7AB 4IZ8A 4LNQA 1SROA 1CTMA 3DWQA 2XIWA 3GO5A 1C8CA 4CDEC 4DAPA 3P20A 3SK8A 2JA9A 5A35A 3BG3A 3FKIB 1LTBD 5C0XG 1WYDA 1A8VA 4KHPL 1I3QB 2NVQH 1WTHA 3QWNA 3DM3A 4XT3B 4DR1Q 3T1HL 4KLKA 4A75A 2EE1A 2Z1CA 1BUVT 4A3JB 4DU9A 5IYCG 3I4NG 3C3LA 1SYDA 3U4VA 2MO1A 3CXCA 1PHJA 1HUMA 2LXJA 2E8GA 1PH7A 2YU9B 1V8QA 4Y7NH 4OWXB 2WB1B 1TWCH 2E2DC 2JA8B 3I70A 2PI2E 1CKNB 2ZJPA 1H9SB 4DPGA 1TU2B 2NZ1D 4HCSA 1EEID 1AP0A 4I7ZC 1KNEA 1EFID 4QUCA 3LGJA 4KJOA 1IL2A 1MSGA 4UHVA 1N32Q 4DK0A 2JYOA 2LFNA 5M5WH 2V4DA 3WDNA 1K0RA 1PDQA 4RKLA 1VQ8A 3A55A 1MD2D 2NN6G 1VDZA 1YVCA 5I9PA 4IJHA 2J0TD 3MEFA 2M00A 4F87A 4HIMA 3CCJA 3S16H 1STYA 5M5YH 2CW0D 1B9MA 4X6AH 2B2UA 1DD2A 4K14A 4JCVE 1XNRQ 1OXXK 1YHQA 4N9PA 1L2FA 4XDXA 1IYJB 1S5DD 2JA6H 3HOXH 2RDGA 4XTCS 3MVVA 5J22A 2F0QA 3RZDH 3KDFB 1NTGA 2CFMA 3D8GA 3I3CA 4GOPC 3CF5A 4FYDA 1K8OA 2DNCA 1NJIC 2GA4B 1VMCA 2EZVA 2CW0C 2ALYB 1A3UA 3RN5A 3VYSA 4FF1A 5HGQA 1U4RA 1SE4A 2FMMA 3ITPA 1F2LA 2R61A 2RQXA 4WORA 3LWEA 4DNIA 4L5RC 2A73B 2OT2A 3UDFA 2A1AA 5JJKA 3VR3A 5M5WB 2VL6A 5GAHC 3K57A 1V1OA 3R2TA 3OHXC 3PGZA 3TS2A 4BY1G 4OIKA 1M1KC 5IYBH 4OO1I 4OXPA 1YEZA 2EYJA 1KDCA 4JPBW 4JYAQ 5IWAL 1K3RA 3HFZB 2HHHL 2JA5H 2F4VQ 3OSOA 1B1ZA 4BA1I 2PYKA 2VW9A 4DR7Q 3PF4A 1TVXA 2FXQA 4UP9A 1Y69U 3L2PA 3D31A 1GUWA 2FHTA 3HOXB 1HR0Q 5ELCA 3F2DA 3RZDB 3GTLH 1PRTF 3J80E 1JICA 4ZAIA 1HHVA 1RKNA 1MI2A 3O13A 2R3ZA 4ZKCB 1VF5C 3PIP3 4DNRB 3HOVH 3A5ZB 4A3GG 5GADC 4CDDC 2B2TA 2R7DA 2SEBD 1BKBA 3L3OC 2X6LA 1I4RA 4NXNL 1VQ5A 2F0DA 1VQOA 1AH9A 2UXDQ 1WTQA 1I94L 4EQNA 3WWVA 2AWOA 1SLJA 1PH8A 2SNSA 3KBXA 2B2TC 3UDXA 2AQ1B 1A3VA 2VUMB 4LF7L 4BY7G 4O1NA 5CMDA 4C3HG 1GJXA 4C3IH 1U9RA 3HKZG 5CYUA 3G6EA 1DOMA 4NB3A 3A54A 3J7A5 4RH6A 4NXML 1PFBA 3DLLA 4H13C 2PPBC 2EDGA 4BXXH 2JA5B 4L8JA 3CQZH 4YWMA 2KA7A 1FJGQ 5E4XA 5CV7A 5KGUA 2I5HA 1CKNA 2Z0SA 4A3KB 2NVTH 2B2WC 1H9SA 1XWEA 4MNOA 1EY4A 1V1PA 1TIID 3J80c 1SNMA 2QW7A 3FMCA 5EJWA 5CGKA 2LXKA 3GTLB 1EQTA 4A3MG 2CWAA 3U9SA 2C35B 1YNXA 1I6VC 2M9VA 3K5MA 4TVAB 3RN2A 3M3YB 5D65A 2KCCA 2RCNA 4RMFA 3A5UA 4IALA 1AN8A 3MXNB 4G57A 1U4LA 3M7NA 1STHA 5I2XA 3TZDA 1X55A 1ML0D 4IUNA 3C1EA 1WTXA 3IFTA 1E1TA 3TP5A 2BDOA 4R4TA 4RGMA 3D3RA 1PH4A 1BF4A 2EPBA 1SYGA 2UXCQ 2L12A 4C3IB 3H6MA 3Q0AA 1P16A 1SYCA 1G6ZA 2F0SA 2ZTEA 3UE0A 3KDFA 3N6RA 1HA5A 4PZ8A 5HY6A 3T53B 4A3IG 3OW2A 1WJJA 3CMEA 3CKIB 3W2DA 2OF1A 3HOYG 4MN3A 4IPCA 3VR6A 1C4QA 1S5CD 2ENBA 1E0BA 1QOHA 1BCPC 1CHQD 1A6XA 2WV6D 4ZRZA 1YIJA 1L0WA 1SNPA 2JQOA 4C56C 1YHBA 3OMCA 2F0HA 3KF8A 4X64L 4TKOB 3PO2H 2WFWA 1K83H 3V2TA 2KBNA 3T16A 4IUTA 1XPUA 2EJMA 1D5MC 1YJNA 1J8IA 4GZYC 2L5TA 3BYTB 5CV6A 5EQ0A 1M4VA 2ICIA 2RCFA 4AYBE 4P73A 4M1UB 1SSOA 2JEAI 4LJZC 4RCOA 1EFWA 3BS1A 2WKDA 1JE5A 2K5WA 2K1BA 4DR4Q 3MFGA 3QB3A 5EGTA 1LLRD 1ZKOA 2K14A 3NWTA 1VMPA 1EZ6A 3HRZC 5CC4A 2IL8A 1WTRA 3S15H 1PFMA 2N49A 3OTOQ 5ELEA 3CC4A 3J81L 3E3XA 5IE8A 4F7XA 3J81E 3Q23A 1QVCA 3CPWA 4KY5A 2EY6A 3S1MH 3URYA 2KEEA 2KVMA 4KN4C 1PXUA 2VS1A 4WJWA 4JI6L 3EQLC 1L1OC 4DAVA 1QILA 1I4XA 4L5QA 4P71A 3T1YL 4A3EH 1K73C 2F0OA 1K8AC 1P8LA 4K8JA 3PO2B 1E24A 1K83B 3QG1A 1B9NA 1N34L 1CFMA 3GDEA 3K5LA 3H09A 3TBIB 4DR2Q 3VR2A 2K05A 1OXUA 3I90A 1TS3A 5LMNW 1EIFA 1NAPA 5EKLA 4HIOA 2J7ZA 4IPHA 1X3QA 3JAME 1B3AA 1STEA 4A93G 4QL5A 1MJCA 4XQQA 5C4XG 2DY8A 1MGSA 1CM9A 5IP9H 2KEDA 2XTIA 5LMUQ 1F9SA 2XWJB 1KAWA 3TRZA 4DV5Q 5D3IB 4JI5L 2V1CC 1NMFA 1PFSA 2IT1A 4DV3Q 3BDCA 5IY0A 3S15B 3RUZA 3WOEA 3KFUA 1H95A 1DYQA 3PO3H 2ZXRA 1YITA 1D1IA 3CW2C 4RHRA 2NVXH 3S1MB 1STGA 4A3CG 2ZM6L 3BVZA 3GV3A 3CP0A 3PUXA 2RSNA 2L4NA 3OPOA 1S3OA 1UEAB 4X66Q 2E2HH 1S4ZA 4PQXA 1PMRA 2ATWA 1I6HB 2FMCA 3UDIA 3CCEA 2YYZA 5I4DA 4NPSA 4EQPA 5M3FB 1PTOD 1U5KA 4FXDA 1EIGA 4JBWA 3VYTA 3JAMc 2EY5A 3K58A 1E2ZA 1SAPA 2FFKB 2PNHA 3S17H 3EN2A 3DUZA 1W6KA 2BA1A 4LFAL 2ZTCA 1HTPA 1TT2A 3R8BA 2PI2A 3HOZH 2JXMB 4A3BH 2Z4IA 5C4JH 3MA2B 2IY5B 3K6OA 5CBAE 1LYLA 1X3EA 3U58A 2LKVA 2NBFA 3J81j 2NVYH 5G3LD 4XYOA 1HNWQ 3BZDB 4C3JG 3PO3B 1NR4A 1N9WA 3F2UA 3OWEB 2NVXB 2F0EA 3BU2A 2O2LD 2WB1E 2DY7A 5FO9B 3HKSA 1BR9A 5JEAG 1L0YB 3M4OB 2E76C 3AEVA 4UPAA 4OIJA 4C2MH 4LFCQ 3I4NH 3OW7A 2E2HB 3EROA 4JI4L 1C7YA 4LF6Q 3PUZA 2N8NA 5ELFA 4XXEA 1Y8OB 1Q7YC 4RG1A 1SYBA 4NKLA 1Q1EA 5KNDA 4CKBA 3RD4A 3D4RA 3C46A 2UUCL 1HFGA 1KDBA 2D62A 4A3DG 1UE1A 2KCNA 4A3FG 1UWVA 1HZ9A 4AQYQ 3L9AX 1JOQA 2PO4A 1PRTB 2EQSA 3BZCA 4RGOS 3HOZB 2R7FA 4YHHL 2A69D 5C4JB 1IBML 1CHPD 1SFOH 3AB9A 1EY0A 2NN6H 1A3TA 2WAQE 3DHQA 4YCVA 2NVYB 4X62Q 3QIAA 2B29A 1UAPA 3TZUA 2KENA 2Z4HA 1PYWD 1RODA 2ZJQA 1XNRL 4CDFC 3DMUA 3DEOA 4C2MB 2WIIB 2KHIA 2IHEA 4QB4A 2RDFA 2A69C 5DNFA 4GNXC 3J7AV 1CZWA 2RHSB 2HCIA 1AEXA 3I4MG 1VQGA 4Y52H 4S3SA 1V1QA 4KKTA 2AQ2B 4H7BA 1FGBD 2HD3A 4UDUC 4PV1C 5FLMG 3G6JB 4LUOA 1I4GA 2LMCB 1VQNA 4BY1H 1ZYRD 2GN5A 3UE1A 1WCMG 3QR8A 1U4PA 5JJZA 4QQBX 2UXBQ 4GLAC 1KDAA 1H9RA 3MFYA 3LX0A 1B3QA 4ZYSA 2MJ8A 1G2TA 3AFQA 4DUYL 1CT1D 4MIUA 4JI3L 4NDXA 3KUPA 1VQPA 1PZKD 3HOUG 1FR3A 4BBRB 4DR7L 5IGFA 1LT4D 5K5PA 3CCLA 4JG2A 3ND9A 1WD1A 1PH5A 4HCEA 3K0XA 1FL0A 5BR8L 2IX3A 1PA6A 4HJ9A 2JJQA 1OXTA 3NPPA 4PMBA 1EOTA 2OQ0A 3DEPA 4FP5D 1ZYRC 2B8FA 2K33A 2I5LX 2VQFQ 1LT3D 1RD9D 1XX8A 5J39A 1S72A 1PTOF 3ULPA 1EY7A 1TXYA 2F0GA 3ERQA 3NEMA 4KN7C 5DAUA 2VXWA 2F3IA 2B39A 3CRKC 4DNTB 1HR0W 1SNCA 1E1OA 3FDTA 2WINB 2C5CA 4JI0Q 4TQUS 2EY2A 1EY6A 4DAMA 1PH3A 1B2TA 2E74C 3S1QH 4K2LA 3C2PA 1IBLQ 1LT6D 4BY7H 5BN5A 5FO8B 3MHBA 4DV0L 1GO3E 4C3HH 2UU9L 4DUZQ 2F0UA 1F9QA 2IPKD 2OEOA 5G3LF 3QOLA 5C44H 5T1IA 4RA8A 3OMGA 2K5NA 4O0AA 1BBXC 3GTOH 2F0FA 5GAGC 3H3VC 3Q24A 2JA7G 3SE0A 1CKOA 2Q2HA 1EU4A 4C1NI 1N33Q 1HNZL 1QG7A 3G4SA 5M3MB 1AFPA 5L37A 4A3MH 5KNCA 4ME5A 1SYFA 3S9WA 4FF2A 2PZWA 2DNEA 4B3MQ 3NBHB 1TWGB 3R2IA 4DV7Q 1M90C 1TY0A 4ILWA 5IP7G 4DR3L 4DR5Q 2BE5C 1H9MA 2Q2IA 2XNAC 3SK5A 4ZKBB 4LF5Q 1GUNA 4JI8L 1Q90A 3CRLC 3S1QB 5AJ3Q 4H44C 4BY7B 1JQYD 4C3HB 4BBSG 3BYYB 4DV4Q 1HTLD 1SXTA 1FNUA 4HEDA 5EPJA 4AYBG 1JR0D 2D0PA 2OQKA 3MAQA 2F0PA 3MTSA 1XYIA 1QUQB 5FJ8G 4A3IH 5C44B 1JWSD 1QE6A 1WTPA 3HOYH 2R93B 4R4CA 1PH9A 2DUDA 3GTOB 1JC7A 3A7LA 3NSWA 3GTPH 1VCIA 1QVFA 1JOKA 4H02A 4RFBA 1RDPD 3HOWG 3V96A 1ILPA 3GTJH 4A3MB 3V05A 1CSPA 1CI3M 3NHHA 2EXZA 2ES2A 4ZCKA 3H15A 1ESRA 4JI7L 2NVQB 3X3MA 3AYHB 4OWTB 2F1MA 3SXHA 3CC7A 2WAQB 4DV6Q 3W1BA 3A7AB 4UY8C 1KRTA 2HCCA 3TS0A 3PIO3 4ID6A 2B2UC 1N36Q 1T9HA 2FJ2A 3RZOH 2CH4A 2K5DA 1EIHA 4Y7NB 1I4QA 3PUVA 1Z7TA 4DR4L 4LF4L 1TWCB 4BA2I 4KD4A 1Y1WH 1D5XC 3KF6B 3NTHA 3Q8DA 4R4QA 2R92G 5EBCA 2ZT9C 3IL8A 1EYDA 5JPMC 3LNNA 3OTOL 4A3IB 3EBEA 4KHZA 3HOYB 4CDCC 3JC66 4LFBL 2YTVA 2HQLA 4QCLA 2NTTA 1XMQQ 4PMCA 5JPNC 1ENAA 3Q6SA 3MXGA 2F0KA 4X65L 2MQHA 3S16B 4JI2Q 3ER0A 3GTJB 5M5YB 1J5EL 3FHWA 2PMZB 3B6YA 3NXWA 3KYHC 4CJ0B 4DR2L 5E4WC 1IL8A 2EYHA 3T4AC 1CA6A 3DWPA 3SR1A 1OTCA 2H5XA 3RLFA 2CQOA 4GKJQ 1DOLA 2JA6B 4K0KQ 1AZQA 2O5JC 5C4XH 3NK9A 1D7QA 3ND8A 3KJPA 1GM5A 2WKCA 3RZOB 5FK9C 5C3EG 4N8X1 1GHJA 4DV2Q 1Q86C 2A19A 2K5VA 1WI5A 3J80i 3A56A 1WTVA 1Y1WB 1KLGD 1VQCA 1J9OA 2MP1A 4C1NK 3U9OA 1B8AA 3PIPA 3HGBA 5E3FA 1O7ZA 4GKKQ 5AFWA 2P5ZX 1X56A 4XQNA 2B63G 2R7ZG 5C6AA 3E0EA 3S2HH 1ICWA 1EQVA 4A3CH 3NBHA 1X9NA 4H0LC 2N78A 2H4OA 2JEBI 2Y0SG 4A3JG 2VB3X 3TEHB 1YHAA 1LABA 3EA6A 3HP3A 4YY3L 1NUCA 4HAEA 5E7NA 1JOOA 2JP1A 2IWHA 4YCUA 5IGDA 2EYPA 3E5SA 5BN3A 2QILA 1QZGA 1FYCA 1ET6A 2QA4A 1DONA 5C4XB 3SVMA 5I9OA 1EYCA 1C0AA 2OXPA 1MKHA 4ALPA 3HOVB 1QNKA 3BZKA 1PTOH 3IKJA 3UDGA 1RL2A 1DXMA 1G91A 4RWSC 2OTJA 1BCPD 5DEHA 2DN8A 1EY8A 1XNQL 2PW5A 4IN3A 1LTGD 1TR5A 2DJGC 3SEBA 3RMHA 4KHPQ 5JEAH 4B3SL 1YNJD 3T1HQ 4FF3A 5J1ZA 1Q46A 4GN3B 1IXRA 2XRQD 5CV9A 1AE3A 1X3FA 1YJ9A 4LF6L 1HRJA 1ESFA 3CQZB 2ICEC 5EKIA 1CQFA 4ZUIA 3K5OA 3S1NH 2NVTB 4QJFA 2RA4A 5C0XI 4KJNA 5IGEA 1F2YA 4A3DH 4NP5A 4HIDA 1YJWA 4QGUA 2HT1A 4GS3A 5LL6S 4B3RQ 3PF5A 1YNJC 4UP7A 2OTLA 5CORA 4GLVB 1YZ6A 3AU7A 2DJFC 5CR3A 1HPCA 1V9PA 2BA0A 2K32A 4IURA 4QUFA 1PTOB 5I6WA 4CBVA 1D6EC 1G2SA 4DV1L 3TQYA 4JI1L 3VR5A 2C9OA 3M4QA 4ODGA 3N52A 2LSSA 1IHZA 1ICFB 4LUVA 2M2LA 4HIKA 4IFDG 2KUMA 1K3BC 4EVOA 1X32A 4RKBA 1VF7A 3U4ZA 4PG3A 1X3PA 1LUZA 4Q0FA 5D3DA 3NUCA 3PMFA 1FNWA 1OXVA 3HOXG 4BWGB 2A5HA 1A62A 2QKIC 2NN6I 2CWPA 2I0QA 1HH2P 3I4MH 3S1NB 1TWAH 3I91A 4J1MA 2HIVA 3R3OA 5LMNL 4A3DB 4CJ1B 1VQ9A 4LW1A 1WTWA 1Y14B 3QO2A 3S1RH 4EX5A 2MGSA 1HFNA 1Q12A 1IW7C 2YTXA 4DK1A 1PFNA 5FLMH 1RF2D 4OX9Q 1KNAA 1BVSA 2MO0A 4LF8Q 1WCMH 2VUMG 3OYYA 1S5ED 3J7AF 4R4IA 2E2JH 1Q81C 1HJPA 3I8ZA 3KLWA 2VB2X 3F2CA 2E5LQ 3JAMi 2X6GA 3HOUH 3PQIA 2Z6BA 5F2DA 4P2CB 4RHSA 3G71A 1G8ZD 4A3KG 3I4OA 4Q5VA 2KJXA 3J81c 5J3BA 1BBWA 2NTSA 1JWUD 2K5HA 2AHOB 1IZ6A 1JB7A 1UEBA 4BS9A 3R93A 3TMEA 4OGQC 3MXNA 2UUBL 3HZXA 1TWAB 2XN9C 1XMOL 4OELB 4A3EB 2O4XA 3A0JA 4IOCA 2FINB 1VQEA 2EYOA 2HUGA 1DM0B 3ONAB 1I94Q 1ILQA 2F0VA 2EOTA 2F52A 1LTAD 1X6OA 1NY4A 1D1KA 1VQMA 4LF7Q 1WCMB 3KLSA 1O7YA 1BCPF 4R1JA 3PUYA 4NXMQ 2E2JB 2K75A 2UUAL 1NE3A 4DR6L 1QB5D 4QF4A 2PW7A 2JA7H 3HOUB 1DOKA 4EQ5A 2A68D 3SDZA 3U50C 1EQRA 1EWIA 3TDQA 1UE5A 4PMWA 2QEXA 5C0XH 1UE6A 5ELBA 4QY7A 3BJUA 1SN8A 3GTKH 1IKMA 1LTRD 1VQHA 4DGZA 4DR1L 3PSIA 4FO2A 4L5SA 1K28A 2XSCA 2EYMA 4KKSA 5JJLA 3C1FA 3HKZE 3I2ZA 4K5XA 1T5EA 5IYCH 1HA6A 4LF9Q 1T5XD 4DV7L 2Z6KA 3SK4A 5H1SE 2YTYA 1OXSC 2A68C 2F3VA 4ZK9B 3GTGH 4A3LG 5HURA 1K0SA 5COYA 4N9TA 1K9MC 4MHEA 3NWSA 2KECA 3FVQA 3D0FA 4DV4L 3PUWA 2AKWB 1VQAA 3S17B 5K36G 1SEBD 3CAMA 4KI0A 2F4IA 5FJ8H 2H1EA 2HDMA 1STBA 2K03A 2GVAA 4A3BB 1N32L 1Y8NB 2JA7B 2LY7A 4OEMB 1BDOA 1HNXQ 2CHBD 1PZJD 3DWAA 2K01A 3L7ZC 2EY1A 3AQQA 1SRUA 2K52A 2TMPA 3S24A 3GTQH 4MZ9A 5EPLA 1E2VA 1Z6HA 3CPFA 1X54A 3NELA 3H0GG 3I4NB 5C5LA 1KIXA 3CU7A 4RCNA 3GTGB 1ENCA 5KIXA 4OO1G 3P7JA 4G7OC 1D2BA 4IUUA 4FF4A 2R92H 1TWHH 2QGQA 1UE7A 1ZEQX 5CV4A 4EQOA 5M9OA 3NTIA 1LTLA 1H9JA 3LWUA 3ZJYC 4L6TB 2JE6I 2PMZE 1S5FD 1SNQA 1JMCA 1SFOB 1RTNA 2K7VA 4JI6Q 3GTMH 1GUSA 4KHVA 4RGTA 4IFDI 3K59A 1IYUA 3T1YQ 1RJTA 5IODA 4PNYA 4DN4M 4JYAL 2F0NA 1GOZA 2VNUD 1JCKB 2D5DA 1N34Q 1JORA 2F4VL 3IAYA 5LL6X 3GTQB 4CJ2C 4J8QA 1AW7A 1C9OA 1SJHD 2AUKA 4WJ3M 2AMCB 1O7IA 5M3FG 4J15A 3F1ZA 3E9IA 1A2TA 4GOPB 4JBKA 1SMXA 2PZTA 1HR0L 1KHIA 1QWYA 1EWHA 2RHQB 4DK3C 1DGSA 1PZID 1YBYA 1MSHA 4WJ4A 4IUQA 5IP9G 1UNSA 2BCOA 3KLRA 4A3GH 1KTKA 1TWHB 2XVSA 3A8KE 3E9HA 4GN4B 4KD3A 3MEHA 2XWBB 4JI5Q 2IHFA 3STBC 2D0OA 4O2DA 4M8AA 3FEWX 2I5MX 4OL7A 2ZXOA 2BOSA 1BNZA 4JBJA 2Q2UA 2UXDL 1NCVA 1XPOA 4RAUC 2B63H 2R7ZH 1SDFA 4HMJA 2KHSA 1EY9A 4UP8A 4BY1B 5JEAJ 4IUPA 1ONLA 2ZM6Q 1EUJA 1Q82C 2NZOA 1U0LA 2AWNA 1TQOA 4IQZA 5E1FA 4JBMA 4G4KA 1PRTD 2I46A 1FJGL 4IOAA 2BE5D 4HJ7A 4KTAA 1VQLA 2BH2A 1LM0A 3IRBA 1I4HA 1S40A 5IYDG 1KL9A 1Z9FA 4KV6A 1HUNA 3T51B 2BDNA 3P75A 2CQAA 4YWKA 4LFAQ 4KY6A 5A2QL 2L9HA 4L63B 3ZYYX 1PVOA 2L1BA 3X3NA 5A2QE 4A3GB 1QVGA 3I56A 3K8AA 2R6GA 3UI2A 1PRTC 5C3WA 1A2UA 4FNFA 4ABNA 4DKAC 1KQSA 2LS01 1EY5A 2L0CA 3H91A 2B63B 2R7ZB 1HZCA 2E2IH 2VZAA 5M5XH 4AH6A 1DZ1A 1KD1C 1R4PB 4OHJA 2IX0A 1B44D 4PZ6A 1BOSA 2UXCL 1VQJA 3HKZB 5GQOA 1H9KA 1PV4A 1Y1VG 2Y0SB 3QJYA 1IKLA 3I55A 1QJOA 2ZTDA 4JI4Q 4CKEA 1K8MA 4POFA 4IPDA 3GQBA 4B9WA 2UUCQ 1FD7D 5JOBA 3CHBD 2Q8RE 4I65A 1V1PB 1EYGA 4F88A 3K80C 4B3RL 1E3PA 4LMQD 1EEFD 4JV5Q 5EBDA 1VQIA 3F8TA 4YHHQ 1IBMQ 4CGYB 1EYAA 4XT1B 2G9DA 5JJIA 4TSSA 4IFDH 1JB3A 2E2IB 5ELNA 5M5XB 3M9BA 1B53A 3NENA 4YCWA 4WFN3 3PIOA 3MWYW 2Z9HA 3RLNA 4GOPA 1CZGA 4BBRG 4JW0A 4UAIA 1G51A 1SE2A 1BCPB 5C5MA 4KKUA 4YIJA 1WVLA 1Y8PB 1NBWA 3AMUA 1KXLA 3P1HA 2MHVA 4QIWB 4LWCA 4V0BA 3GTPB 2HQEA 4K6DA 3BDOA 1KAAA 3NP8A 2SDFA 2IX1A 3T56B 2L11A 1WFQA 3W1GA 2ZJRA 3KF8B 3VA7A 5IT9L 5CBEE 4LAAA 1SR3A 4I7AA 4IUVA 5IT9E 3CD6A 3M4YA 3CCUA 4OX9L 2CVRA 1M8AA 4LK1C 1F2MA 3ULLA 2VUMH 4LF8L 3NQTA 2F0LA 2NZHA 1OO9B 3SK6A 4A93H 1LT5D 5JVG3 3F2BA 4P75A 2XGTA 1R4QB 1O7LA 5TSSA 4P72A 5D14A 5T1GA 5LMUL 4DUYQ 2E5LL 2B2VA 4R4OA 4JI3Q 4CKCA 2Q8TA 4JOIA 1VQ7A 2A74C 4DV5L 3NTKA 4A3KH 1PH2A 4J6HA 4HTHA 4DV3L 2VY3A 4K2KA 2JSOA 5BR8Q 5C0XJ 5M3MG 5JVH3 4FXKC 3DXJC 1L1OB 3FKIG 3J80L 2B2VC 1FNVA 3E6ZX 4JOIC 1VQKA 1V43A 2EIFA 3M3YH 1Q8IA 5C4HA 4POGA 3QOJA 3VA5A 4APVA 2KCMA 1PYSB 3D4DA 3NE5B 2NYZD 1JT8A 4X66L 5IT9c 1TS2A 1TS4A 1ASZA 5DLQE 4G7ZC 3SHLA 4GLXA 3CCMA 4B3TQ 2WB1G 3TP7A 1GUOA 2QDBA 1CSQA 2JA8G 3TP8A 4DV0Q 2UU9Q 5ISRA 1QUQA 3CC2A 2DGYA 1EIYB 2B2WA 4A93B 1IBKQ 2VQEQ 3RLOA 1E2WA 1GVPA 5C44G 4FXGC 2Q8IB 1KC8C 2R93G 2B2YA 3MXPA 3KJOA 3KBGA 3CCVA 3D6CA 4LUZA 1BXTA 1PH6A 3I72A 1MHWC 1AZPA 1HNZQ 2F0MA 1D8LA 4C3JH 2F3WA 1TWFH 1HNWL 2B2YC 3S2HB 1NR2A 2HIXA 3TP6A 4MTKA 3OOCA 3H3VI 1EOVA 2JK8A 4YWLA 5IGGA 1GD7A 1SE8A 3FRPB 1F9RA 2L15A 4QMGA 3PV0A 3M85A 1PLFA 5IIFA 2WAQG 2K6AA 4GN5A 1I50H 4LFCL 4LF9L 4DR3Q 4X3SA 3K7UC 1HZBA 3M4PA 4A3LH 2CKZB 1G6PA 4ME3A 3KF6A 4JI8Q 3TREA 2PZUA 2HDLA 4KY7A 4R9WA 5FLXL 1I4PA 1PH1A 1B50A 5FLXE 2NB0A 3MC0B 5I6YA 3ULJA 2KQ3A 1B4OA 3NBIA 4AIMA 4A3FH 1W2BA 5K36H 4AQYL 1L0XB 1W3SA 2Q2TA 2B8GA 3IFDA 2PQAB 2MPMA 1E22A 2TSSA 1X65A 3TN2A 1GUTA 1HNXL 1RCVD 1F9PA 4X62L 3RR5A 4C3JB 3ICEA 1TWFB 1RTOA 1LACA 1E7ZA 1HXYD 4JI7Q 5EAYA 1KLUD 4RGNA 2MUYA 4K5WA 1IW7D 2QCPX 3H0GH 2EJFC 2NWGA 1I50B 5ELDA 3D6WA 1EQQA 1TY2A 4X3TA 5C4ZA 2JA6G 2F0IA 1O80A 2WP8J 3AFPA 2D2CC 5FLXc 4OO1H 3MZ5A 2K4KA 4K8IA 1HQMC 2SNMA 4LF4Q 3J81i 4KK7A 1Y1WG 4Z9CB 3MXUA 3G48A 4A3FB 1KRSA 1L1OA 5DM73 5GAEC 3I4LA 4HN7A 1AE2A 5JAVA 3ERSX 2F0TA 2QEJC 2RKSA 2X69A 5LHY1 3I7FA 1I5FA 1JWMD 1BBUA 2KHJA 4LFBQ 3S2DH 1LTTD 1U4MA 1RIPA 2K04A 4CHTB 5IYBG 1WTOA 2UXBL 3NQIA 2CCZA 5FKAC 4X65Q 4KMUC 3VYUA 4DAYB 1F77A 3A8IE 5ELOA 5IWAQ 1SNDA 1J5EQ 4ZLTF 1JJ2A 2HHHQ 2JA5G 1C48A 1I6HH 2AUJD 1ZXTA 1LTID 4GNXB 5M3FH 1EU3A 3KOJA 3H0GB 4B9XA 1B7YB 4HSVA 3EJIA 2ID0A 4HSPA 3JAML 4ZQ3A 1BQQT 3H94A 3TSSA 1X3GA 2I07B 1PYBA 2VQFL 1A15A 2F0WA 1G291 4DFAA 3I4MB 1GHKA 5NUCA 3W5OA 2CH4W 4HJ8A 3HOVG 1II3A 4P74A 4HJAA 3OWFA 2WACA 2EYFA 1GXDC 4DK6C 4NXNQ 3GV6A 3S1RB 4JC0A 3BVMA 2EYLA 3GP7A 5HGTA 1VQBA 4JI0L 3CMAA 1DCZA 2N55A 3S2DB 5GROA 4FDBA 1IBLL 4E6IA 4DUZL 4U68A 2G9HD 4C3IG 2EVBA 4N8FA 4OWWB 3H3VH 3M4OH 2Z8LA 3OIPA 5CV8A 1CK1A 4BXXG 5BN4A 4YY3Q 1NMGA 5IYDH 1N33L 2YV5A 4XYQA 4ZUJA 5KEEA 2PQAA 3I73A 5IGCA 1CA5A 2N3SA 3M7GA 3VYRA 3RNUA 5IOCA 1HZAA 1XTCD 4B3ML 3BVGA 5IP7H 1N8RC 1EL0A 4DR5L 2Y0SE 1ET9A 1SJED 1CQVA 1XNQQ 4IFDJ 4LF5L 1PTOC 5IGBA 1IYVA 5DM63 5AJ3L 2NUCA 3G7LA 1MJEA 4BBSH 4B3SQ 3DM1A 1JE4A 1Y1VH 2A6HD 2Z6KC 1Z47A 4HMIA 3GD7A 4R8IA 1FGUA 1NSNS 1XJVA 3D4WA 3HG9A 1LV9A 3OIQA 1WD0A 3HS0C 4A76A 1SMYD 2J4XA 3FPUB 1O78A 1HQRD 5EKKA 4O42A 3A74A 1YI2A 4JVZA 5KYIA 3HOWH 2QF7A 1XPRA 4X64Q 2OWOA 1QCBD 3PO2G 4WRDA 3GTKB 2KCTA 3VR4A 2B3GA 4B08A 2A6HC 2D9UA 4DXFA 3E0JA 1XTDA 3K0YA 4EGVA 4JV5L 4R8NA 3EFXD 4TRDA 1WOCA 3EIVA 3CCQA 5EPKA 4DV6L 1J6QA 1SMYC 4DAYA 1KABA 4IJLA 4DV1Q 4JI1Q 5FOBB 1VQ6A 1VQ4A 1N36L 4X3KA 3CCRA 1QNUA 1MIUA 1GUGA 1Q3LA 4GNXA 3HEJA 2K28A 1BO0A 4NMZA 3J7ZC 5KRUA 3K81C 4QIWE 4OONA 4DF7A 4BBSB 2L55A 4K6LA 2RDHA 5I2YA 4FVMA 4PZ7A 4BBRH 4AYBB 1Y1VB 4K5VA 2O5IC 2F03A 3S14H 1F2ZA 2RF4A 2RBMA 3FP9A 1JJCB 4U673 4MTNA 1R9TH 1LTSD 1XMQL 4XQJA 3W3AA 2EJGC 1STAA 4XIGS 5LMNQ 3HOWB 4DA2A 2PQEA 4A3EG 4JI2L 1A63A 4NW2A 1Q8KA 1ENFA 1NNXA 2BH8A 3STBD 1SE3A 1EZ8A 4ULLA
chains in the Genus database with same CATH topology
1DJRD 1W6JA 3KK7A 3KLSX 4DXGA 2A6ED 2AQ3B 2ZXPA 4HR7B 2N88A 4JK1C 2R92B 1SBBB 1UUPA 1YNND 1LO5D 2PCFB 3EVQA 5FO7B 2IW3A 2RVLA 2PNRC 2K5QA 3J7YW 3S14B 1XXGA 1D5ZC 2KOLA 1R9TB 1TKWB 5C3XA 3GTMB 2A6EC 2SOBA 3K5NA 3BDLA 2IJ0A 3T13A 1SNOA 1HCZA 3WOFA 1YNNC 1STNA 2RSOA 4F8MA 1TS5A 3FPPA 1S5BD 1Q1BA 4G7HC 1SYEA 2XRSD 3A8JE 1RHPA 5KNBA 2E75C 1MBYA 5CV5A 5C3EB 4X3UA 2F0JA 5KYLA 3Q22A 4V190 1EWCA 3K7AB 4IZ8A 1CTMA 3DWQA 2XIWA 3GO5A 1C8CA 4DAPA 3P20A 3SK8A 5A35A 3BG3A 3FKIB 1LTBD 5C0XG 1I3QB 3QWNA 4XT3B 2EE1A 2Z1CA 1BUVT 4A3JB 4DU9A 3C3LA 1SYDA 1HUMA 2YU9B 1V8QA 2WB1B 2E2DC 2JA8B 3I70A 1H9SB 1TU2B 2NZ1D 4HCSA 1EEID 1AP0A 4I7ZC 1KNEA 1EFID 4QUCA 4KJOA 1MSGA 4DK0A 2JYOA 2LFNA 2V4DA 3WDNA 1PDQA 4RKLA 3A55A 1MD2D 2NN6G 1VDZA 5I9PA 2J0TD 4F87A 2M00A 1STYA 2CW0D 1B9MA 2B2UA 1DD2A 4K14A 1OXXK 4N9PA 4XDXA 1S5DD 2RDGA 4XTCS 3MVVA 5J22A 2F0QA 3D8GA 3I3CA 4FYDA 1K8OA 2DNCA 2GA4B 1VMCA 2EZVA 2CW0C 1A3UA 3VYSA 4FF1A 1U4RA 1SE4A 2FMMA 3ITPA 1F2LA 2R61A 2RQXA 4WORA 3LWEA 2A73B 2OT2A 3VR3A 5M5WB 3K57A 1V1OA 3R2TA 3OHXC 4OIKA 4OO1I 2EYJA 1KDCA 3OSOA 1B1ZA 4BA1I 2PYKA 1TVXA 1Y69U 3D31A 1GUWA 2FHTA 3HOXB 5ELCA 3RZDB 1PRTF 3J80E 1JICA 4ZAIA 1HHVA 1RKNA 1MI2A 3O13A 2R3ZA 4ZKCB 1VF5C 3PIP3 4DNRB 2B2TA 2SEBD 3L3OC 2X6LA 1I4RA 2F0DA 1WTQA 4EQNA 2AWOA 2SNSA 3KBXA 2B2TC 2AQ1B 1A3VA 2VUMB 4O1NA 5CMDA 4C3HG 1GJXA 1U9RA 5CYUA 1DOMA 3A54A 4RH6A 1PFBA 2PPBC 4H13C 2EDGA 2JA5B 4L8JA 2KA7A 5E4XA 5CV7A 5KGUA 4A3KB 2B2WC 1H9SA 1XWEA 1EY4A 1V1PA 1TIID 1SNMA 3FMCA 5EJWA 5CGKA 3GTLB 1EQTA 3U9SA 1I6VC 2M9VA 3K5MA 3M3YB 5D65A 2KCCA 4IALA 1AN8A 4G57A 1U4LA 3M7NA 1STHA 5I2XA 3TZDA 1ML0D 4IUNA 3C1EA 1WTXA 3IFTA 3TP5A 2BDOA 4RGMA 3D3RA 1BF4A 2EPBA 1SYGA 2L12A 4C3IB 3H6MA 3Q0AA 1SYCA 1G6ZA 2F0SA 3N6RA 1HA5A 3T53B 3CKIB 3W2DA 2OF1A 4MN3A 3VR6A 1C4QA 1S5CD 2ENBA 1E0BA 1QOHA 1BCPC 1CHQD 1A6XA 2WV6D 4ZRZA 1SNPA 4C56C 3OMCA 2F0HA 3KF8A 4TKOB 3V2TA 3T16A 4IUTA 2EJMA 1D5MC 1J8IA 4GZYC 2L5TA 3BYTB 5CV6A 5EQ0A 1M4VA 2ICIA 4M1UB 1SSOA 2JEAI 4LJZC 4RCOA 3BS1A 2WKDA 2K5WA 2K1BA 3MFGA 3QB3A 5EGTA 1LLRD 1ZKOA 3NWTA 1VMPA 1EZ6A 3HRZC 5CC4A 2IL8A 1WTRA 1PFMA 5ELEA 3J81L 4F7XA 3J81E 3Q23A 4KY5A 2EY6A 3URYA 2KEEA 2KVMA 4KN4C 1PXUA 4WJWA 3EQLC 4DAVA 1QILA 1I4XA 2F0OA 4K8JA 3PO2B 1K83B 3QG1A 1B9NA 1CFMA 3K5LA 3H09A 3TBIB 3VR2A 2K05A 1OXUA 3I90A 1TS3A 1NAPA 5EKLA 2J7ZA 1X3QA 3JAME 1B3AA 1STEA 4XQQA 2DY8A 1MGSA 1CM9A 2KEDA 1F9SA 2XWJB 5D3IB 2IT1A 3BDCA 3S15B 3RUZA 3WOEA 1DYQA 2ZXRA 1D1IA 4RHRA 3S1MB 1STGA 3BVZA 3GV3A 3PUXA 2RSNA 2L4NA 3OPOA 1UEAB 1S4ZA 4PQXA 1PMRA 1I6HB 2FMCA 2YYZA 5I4DA 4EQPA 5M3FB 1PTOD 4FXDA 1EIGA 4JBWA 3VYTA 2EY5A 3K58A 1E2ZA 1SAPA 2FFKB 3DUZA 1W6KA 2BA1A 1HTPA 1TT2A 3R8BA 2JXMB 2Z4IA 3MA2B 3K6OA 5CBAE 2LKVA 2NBFA 5G3LD 4XYOA 3BZDB 4C3JG 3PO3B 1NR4A 3F2UA 3OWEB 2NVXB 2F0EA 2O2LD 2DY7A 5FO9B 5JEAG 1BR9A 1L0YB 3M4OB 2E76C 4OIJA 3OW7A 2E2HB 3EROA 3PUZA 5ELFA 4XXEA 1Y8OB 1SYBA 4NKLA 1Q1EA 5KNDA 4CKBA 3RD4A 3D4RA 3C46A 1HFGA 1KDBA 2D62A 2KCNA 3L9AX 1JOQA 2PO4A 1PRTB 4RGOS 3HOZB 2A69D 5C4JB 1CHPD 3AB9A 1EY0A 2NN6H 1A3TA 3DHQA 2NVYB 3QIAA 1UAPA 3TZUA 2Z4HA 1PYWD 1RODA 3DMUA 3DEOA 4C2MB 2WIIB 4QB4A 2RDFA 2A69C 5DNFA 3J7AV 1CZWA 2HCIA 1AEXA 4S3SA 4KKTA 2AQ2B 4H7BA 1FGBD 4UDUC 4PV1C 3G6JB 1I4GA 2LMCB 1ZYRD 1U4PA 5JJZA 1KDAA 1H9RA 3MFYA 3LX0A 4ZYSA 2MJ8A 1G2TA 1CT1D 4MIUA 4NDXA 3KUPA 1PZKD 1FR3A 4BBRB 5IGFA 1LT4D 5K5PA 3ND9A 1WD1A 4HCEA 2IX3A 1OXTA 3NPPA 4PMBA 1EOTA 3DEPA 4FP5D 1ZYRC 2B8FA 2K33A 1LT3D 1RD9D 1XX8A 5J39A 1PTOF 1EY7A 4KN7C 2F0GA 3ERQA 5DAUA 2VXWA 2B39A 3CRKC 4DNTB 1SNCA 3FDTA 2WINB 2C5CA 4TQUS 2EY2A 1EY6A 1B2TA 2E74C 4K2LA 3C2PA 1LT6D 5BN5A 5FO8B 3MHBA 2F0UA 1F9QA 2IPKD 2OEOA 5G3LF 3QOLA 5T1IA 4RA8A 3OMGA 1BBXC 2F0FA 3H3VC 3Q24A 3SE0A 1EU4A 4C1NI 1QG7A 5M3MB 1AFPA 5KNCA 4ME5A 1SYFA 3S9WA 4FF2A 2PZWA 2DNEA 1TWGB 3R2IA 1TY0A 4ILWA 2BE5C 1H9MA 2XNAC 3SK5A 4ZKBB 1GUNA 1Q90A 3CRLC 3S1QB 4H44C 4BY7B 1JQYD 4C3HB 3BYYB 1HTLD 1SXTA 1FNUA 4HEDA 5EPJA 1JR0D 3MAQA 2F0PA 3MTSA 1XYIA 5C44B 1JWSD 1QE6A 1WTPA 2R93B 3GTOB 1JC7A 3A7LA 3NSWA 1VCIA 1JOKA 4RFBA 1RDPD 3V96A 1ILPA 4A3MB 3V05A 1CI3M 3NHHA 2EXZA 2NVQB 1ESRA 3X3MA 2F1MA 3SXHA 2WAQB 3A7AB 2HCCA 3PIO3 4ID6A 2B2UC 2FJ2A 1EIHA 2K5DA 4Y7NB 1I4QA 3PUVA 1Z7TA 4BA2I 1TWCB 4KD4A 1D5XC 3NTHA 5EBCA 2ZT9C 3IL8A 1EYDA 5JPMC 3LNNA 4A3IB 4KHZA 3HOYB 4QCLA 2NTTA 4PMCA 5JPNC 1ENAA 3Q6SA 3MXGA 2F0KA 3S16B 3GTJB 5M5YB 2PMZB 3NXWA 4CJ0B 5E4WC 1IL8A 2EYHA 3T4AC 1CA6A 3DWPA 3SR1A 3RLFA 1DOLA 2JA6B 1AZQA 2O5JC 3NK9A 3ND8A 3RZOB 2WKCA 5FK9C 1GHJA 1Y1WB 3A56A 1WTVA 1KLGD 1J9OA 2MP1A 4C1NK 3U9OA 3HGBA 5E3FA 1O7ZA 5AFWA 4XQNA 5C6AA 1ICWA 1EQVA 3NBHA 4H0LC 2H4OA 2JEBI 2VB3X 1LABA 3EA6A 3HP3A 1NUCA 4HAEA 1JOOA 2JP1A 2IWHA 5IGDA 2EYPA 3E5SA 5BN3A 2QILA 1FYCA 1ET6A 1DONA 5C4XB 3SVMA 5I9OA 1EYCA 2OXPA 3HOVB 1QNKA 1PTOH 3IKJA 1DXMA 1G91A 4RWSC 1BCPD 5DEHA 2DN8A 1EY8A 2PW5A 4IN3A 1LTGD 1TR5A 3SEBA 3RMHA 5JEAH 1YNJD 4FF3A 5J1ZA 2XRQD 5CV9A 1HRJA 1ESFA 3CQZB 2ICEC 5EKIA 1CQFA 4ZUIA 3K5OA 2NVTB 2RA4A 5C0XI 4KJNA 5IGEA 1F2YA 4NP5A 5LL6S 1YNJC 5CORA 3AU7A 5CR3A 1HPCA 2BA0A 2K32A 4IURA 4QUFA 1PTOB 5I6WA 4CBVA 1D6EC 1G2SA 3VR5A 2C9OA 4ODGA 3N52A 1IHZA 2M2LA 4IFDG 2KUMA 4EVOA 1X32A 4RKBA 1VF7A 1X3PA 4Q0FA 5D3DA 3NUCA 3PMFA 1FNWA 1OXVA 4BWGB 2A5HA 2QKIC 2NN6I 3S1NB 3I91A 4J1MA 3R3OA 4A3DB 4CJ1B 1WTWA 3QO2A 2MGSA 1HFNA 1Q12A 1IW7C 4DK1A 1PFNA 1RF2D 1KNAA 1S5ED 3J7AF 3I8ZA 2VB2X 2X6GA 5F2DA 4P2CB 4RHSA 1G8ZD 4Q5VA 2KJXA 2NTSA 1JWUD 4BS9A 3R93A 3TMEA 4OGQC 3MXNA 3HZXA 1TWAB 2XN9C 4A3EB 2O4XA 2FINB 2EYOA 2HUGA 1DM0B 3ONAB 1ILQA 2F0VA 2EOTA 1LTAD 1D1KA 1WCMB 3KLSA 1O7YA 1BCPF 3PUYA 2E2JB 1QB5D 4QF4A 2PW7A 3HOUB 1DOKA 2A68D 3SDZA 3TDQA 4PMWA 5C0XH 5ELBA 1IKMA 1LTRD 4DGZA 4FO2A 2XSCA 2EYMA 4KKSA 3C1FA 4K5XA 1T5EA 1HA6A 1T5XD 3SK4A 1OXSC 2A68C 2F3VA 4ZK9B 5HURA 5COYA 4N9TA 4MHEA 3NWSA 2KECA 3FVQA 3PUWA 3S17B 5K36G 1SEBD 4KI0A 2F4IA 2H1EA 2HDMA 1STBA 2K03A 4A3BB 1Y8NB 2JA7B 2LY7A 1BDOA 2CHBD 1PZJD 3DWAA 2K01A 3L7ZC 2EY1A 2TMPA 5EPLA 1E2VA 1Z6HA 3I4NB 5C5LA 3CU7A 4RCNA 3GTGB 1ENCA 5KIXA 4OO1G 3P7JA 4G7OC 1D2BA 4IUUA 4FF4A 1ZEQX 5CV4A 4EQOA 5M9OA 3NTIA 1H9JA 3LWUA 4L6TB 2JE6I 1S5FD 1SNQA 1SFOB 1RTNA 2K7VA 1GUSA 4KHVA 4RGTA 4IFDI 3K59A 1IYUA 1RJTA 5IODA 4PNYA 4DN4M 2F0NA 1GOZA 2VNUD 1JCKB 2D5DA 1JORA 3IAYA 5LL6X 3GTQB 4CJ2C 4J8QA 1AW7A 1SJHD 2AUKA 1A2TA 2PZTA 1QWYA 1EWHA 1PZID 1MSHA 4IUQA 1UNSA 2BCOA 3KLRA 1KTKA 1TWHB 2XVSA 3A8KE 4KD3A 3MEHA 2XWBB 4M8AA 3FEWX 4OL7A 2ZXOA 2BOSA 1BNZA 1NCVA 4RAUC 1SDFA 4HMJA 2KHSA 1EY9A 4BY1B 5JEAJ 4IUPA 1ONLA 2AWNA 1TQOA 4IQZA 5E1FA 4G4KA 1PRTD 2I46A 2BE5D 4KTAA 1I4HA 4KV6A 1HUNA 3T51B 2BDNA 3P75A 2CQAA 4KY6A 5A2QL 2L9HA 4L63B 3ZYYX 2L1BA 3X3NA 5A2QE 4A3GB 2R6GA 3UI2A 1PRTC 5C3WA 1A2UA 4FNFA 4ABNA 2LS01 1EY5A 2L0CA 3H91A 2B63B 2R7ZB 1DZ1A 1R4PB 4OHJA 2IX0A 1B44D 1BOSA 3HKZB 1H9KA 2Y0SB 3QJYA 1IKLA 1QJOA 4CKEA 1K8MA 3GQBA 4B9WA 1FD7D 5JOBA 3CHBD 2Q8RE 4I65A 1V1PB 4F88A 4LMQD 1EEFD 5EBDA 4CGYB 1EYAA 4XT1B 2G9DA 4TSSA 4IFDH 1JB3A 2E2IB 5M5XB 1B53A 4WFN3 3MWYW 1CZGA 4UAIA 1SE2A 1BCPB 5C5MA 4KKUA 4YIJA 1WVLA 1Y8PB 3AMUA 3P1HA 2MHVA 4QIWB 4V0BA 3GTPB 2HQEA 4K6DA 3BDOA 1KAAA 3NP8A 2SDFA 2IX1A 3T56B 2L11A 3VA7A 5IT9L 5CBEE 4LAAA 4IUVA 5IT9E 3M4YA 2CVRA 1M8AA 4LK1C 1F2MA 3NQTA 2F0LA 1OO9B 3SK6A 1LT5D 5JVG3 1R4QB 1O7LA 5TSSA 5D14A 5T1GA 2B2VA 4CKCA 2Q8TA 2A74C 3NTKA 4J6HA 4HTHA 4K2KA 2JSOA 5C0XJ 5JVH3 4FXKC 3DXJC 3J80L 2B2VC 1FNVA 3E6ZX 1V43A 1Q8IA 5C4HA 3QOJA 3VA5A 3NE5B 3D4DA 2NYZD 1TS2A 1TS4A 4G7ZC 3SHLA 3TP7A 1GUOA 2QDBA 3TP8A 5ISRA 2B2WA 4A93B 1E2WA 4FXGC 2Q8IB 2B2YA 3MXPA 3KBGA 3D6CA 1BXTA 3I72A 1AZPA 2F0MA 2F3WA 2B2YC 3S2HB 1NR2A 3TP6A 3OOCA 5IGGA 1F9RA 3FRPB 4QMGA 3PV0A 3M85A 1PLFA 5IIFA 2K6AA 4X3SA 2PZUA 2HDLA 4KY7A 4R9WA 5FLXL 1I4PA 1B50A 5FLXE 2NB0A 3MC0B 5I6YA 2KQ3A 1B4OA 3NBIA 5K36H 1L0XB 2B8GA 3IFDA 2MPMA 2TSSA 3TN2A 1GUTA 1RCVD 1F9PA 4C3JB 1TWFB 1RTOA 1LACA 1HXYD 1KLUD 4RGNA 2MUYA 4K5WA 1IW7D 2QCPX 2EJFC 2NWGA 1I50B 5ELDA 3D6WA 1TY2A 4X3TA 5C4ZA 2F0IA 1O80A 2WP8J 2D2CC 4OO1H 3MZ5A 4K8IA 1HQMC 2SNMA 4KK7A 4Z9CB 3MXUA 4A3FB 5DM73 3I4LA 4HN7A 5JAVA 2F0TA 2QEJC 2RKSA 2X69A 5LHY1 1JWMD 1LTTD 1U4MA 2K04A 4CHTB 1WTOA 3NQIA 5FKAC 4KMUC 3VYUA 1F77A 3A8IE 1SNDA 4ZLTF 1C48A 2AUJD 1ZXTA 1LTID 1EU3A 3H0GB 4B9XA 4HSVA 3EJIA 2ID0A 4HSPA 3JAML 4ZQ3A 1BQQT 3H94A 3TSSA 2I07B 1A15A 2F0WA 1G291 4DFAA 3I4MB 1GHKA 5NUCA 1II3A 3OWFA 2WACA 2EYFA 1GXDC 3GV6A 3S1RB 3BVMA 2EYLA 3GP7A 5HGTA 1DCZA 2N55A 3S2DB 4E6IA 4U68A 2G9HD 4C3IG 2EVBA 2Z8LA 3OIPA 5CV8A 1CK1A 5BN4A 4XYQA 4ZUJA 5KEEA 3I73A 5IGCA 1CA5A 3M7GA 3VYRA 5IOCA 1XTCD 3BVGA 1EL0A 1ET9A 1SJED 1CQVA 4IFDJ 1PTOC 5IGBA 1IYVA 5DM63 2NUCA 3G7LA 3DM1A 1JE4A 2A6HD 1Z47A 4HMIA 3GD7A 4R8IA 1NSNS 3D4WA 3HG9A 1LV9A 3OIQA 1WD0A 3HS0C 1SMYD 2J4XA 3FPUB 1O78A 1HQRD 5EKKA 4O42A 5KYIA 2QF7A 1QCBD 4WRDA 3GTKB 3VR4A 4B08A 2A6HC 2D9UA 4DXFA 3E0JA 4EGVA 3K0YA 4R8NA 3EFXD 4TRDA 5EPKA 1SMYC 4DAYA 1KABA 5FOBB 4X3KA 1QNUA 1GUGA 1Q3LA 3HEJA 2K28A 1BO0A 4NMZA 5KRUA 4DF7A 4BBSB 2L55A 4K6LA 2RDHA 5I2YA 4FVMA 4AYBB 1Y1VB 4K5VA 2O5IC 2F03A 1F2ZA 2RBMA 4U673 1LTSD 4XQJA 3W3AA 2EJGC 1STAA 4XIGS 3HOWB 4DA2A 2PQEA 4NW2A 1ENFA 1SE3A 1EZ8A 4ULLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMU A;  3V2T A;  1RKN A;  5IOC A;  1STB A;  3T16 A;  4PMC A;  1ENA A;  4HMJ A;  4QB4 A;  2KHS A;  2RDF A;  5F2D A;  1EY9 A;  2F0K A;  5CV6 A;  5J1Z A;  5JAV A;  5CV9 A;  4ME5 A;  2F0T A;  2RKS A;  1SYF A;  3MXP A;  4EQP A;  5IGF A;  5IGB A;  3S9W A;  1AEX A;  2F0D A;  3D6C A;  3NXW A;  2EY5 A;  2EY1 A;  4S3S A;  2PZW A;  2NUC A;  4ZUI A;  4KJO A;  5C5M A;  1TQO A;  2F0M A;  4YIJ A;  2EYH A;  5E1F A;  4EQN A;  4H7B A;  3SR1 A;  3TME A;  2F3W A;  3HZX A;  4KJN A;  3EVQ A;  2SNS A;  5IGE A;  1F2Y A;  4HMI A;  4RKL A;  4NP5 A;  3P1H A;  1TT2 A;  1A3V A;  1NSN S;  4KTA A;  3SK5 A;  4E6I A;  3QB3 A;  3D4W A;  5EGT A;  2O4X A;  1SND A;  3NK9 A;  1U9R A;  3TP6 A;  5I9P A;  2HQE A;  4K6D A;  5C5L A;  5IGG A;  1KAA A;  4KV6 A;  4QMG A;  1EZ6 A;  2M00 A;  5CC4 A;  2EYO A;  3NP8 A;  1STY A;  2LKV A;  5IIF A;  5EKK A;  2F0V A;  5CR3 A;  4K14 A;  5C3X A;  5KYI A;  1ENC A;  3P75 A;  5KIX A;  4B9X A;  4F7X A;  1KDA A;  5I6W A;  3LX0 A;  3U9O A;  3EJI A;  2SOB A;  5CV7 A;  4KY5 A;  4KY6 A;  5KGU A;  2F0P A;  2EY6 A;  4ZQ3 A;  4LAA A;  4N9P A;  3BDL A;  2F0E A;  5E3F A;  4WRD A;  1EY4 A;  4ODG A;  5CV4 A;  4MIU A;  3T13 A;  1F2M A;  1IHZ A;  1SNO A;  2PZU A;  2F0W A;  4KY7 A;  1SNM A;  4NDX A;  4DFA A;  4EQO A;  5NUC A;  5C3W A;  1STN A;  5C6A A;  5CGK A;  3MVV A;  5M9O A;  2F0Q A;  4R8N A;  1A2U A;  5I6Y A;  2F0O A;  3NQT A;  4TRD A;  2F0L A;  2KQ3 A;  4K8J A;  4EVO A;  1EQV A;  1II3 A;  3SK6 A;  4F8M A;  4RKB A;  1EY5 A;  5K5P A;  1JOK A;  3OWF A;  2WAC A;  3D8G A;  2EYF A;  4QF4 A;  2PW7 A;  3ERO A;  1SYE A;  4PMB A;  2EYL A;  1KAB A;  1SNQ A;  5HGT A;  3NUC A;  1A3U A;  1SYB A;  3PMF A;  4NKL A;  4KHV A;  4IAL A;  3NHH A;  2EXZ A;  4G57 A;  1STH A;  5J39 A;  5IOD A;  1NUC A;  5CV5 A;  4PNY A;  1KDB A;  3HEJ A;  1EY7 A;  4J6H A;  3ITP A;  4NMZ A;  2F0G A;  3ERQ A;  4HTH A;  2F0N A;  4WOR A;  5DAU A;  2F0J A;  1JOO A;  3SXH A;  4DF7 A;  5KRU A;  4K2K A;  4IUN A;  3C1E A;  1JOR A;  4DGZ A;  5KYL A;  5IGD A;  2EYP A;  1JOQ A;  3E5S A;  4IZ8 A;  3R3O A;  4J1M A;  1SNC A;  4K5V A;  3TP5 A;  2EYM A;  4ID6 A;  3C1F A;  5CV8 A;  5I9O A;  2EY2 A;  1EY6 A;  1SYG A;  1F2Z A;  4K5X A;  1A2T A;  3H6M A;  3SK8 A;  2RBM A;  2EYJ A;  1KDC A;  1SYC A;  2PZT A;  4K2L A;  2F0S A;  1EYC A;  3SK4 A;  4B9W A;  5C4H A;  4KD4 A;  3MHB A;  3QOJ A;  4K5W A;  1EY0 A;  2OXP A;  1A3T A;  3BDC A;  2F3V A;  5JOB A;  3DHQ A;  2F0U A;  5EKL A;  4I65 A;  3D4D A;  3RUZ A;  3VA5 A;  5HUR A;  3OSO A;  2OF1 A;  1STA A;  4N9T A;  2PYK A;  1EYD A;  2OEO A;  5C4Z A;  4ZUJ A;  2F0I A;  3QOL A;  5KEE A;  2ENB A;  2PQE A;  3SHL A;  1STG A;  5J22 A;  3OMG A;  4KD3 A;  5DEH A;  3MEH A;  4DU9 A;  1EY8 A;  2PW5 A;  3TP7 A;  2F0F A;  3MZ5 A;  1SYD A;  4K8I A;  5IGC A;  1SNP A;  1EYA A;  2QDB A;  2SNM A;  3OMC A;  3TP8 A;  1TR5 A;  2F0H A;  1EZ8 A;  5ISR A;  4OL7 A; 
#chains in the Genus database with same CATH topology
 1DJR D;  1W6J A;  2GVB A;  2QDL A;  3KK7 A;  3KLS X;  2OCE A;  3VDY A;  4DXG A;  4GKJ L;  4HJ5 A;  4K0K L;  1CKM A;  4IO9 A;  2G5D A;  2A6E D;  4IPG A;  2AQ3 B;  2ZXP A;  5C3E H;  1JJG A;  4HR7 B;  4L5T A;  2N88 A;  4JK1 C;  4DV2 L;  2R92 B;  1SBB B;  1UUP A;  1A0I A;  3K7A H;  1YNN D;  1LO5 D;  2PCF B;  3EVQ A;  5FO7 B;  1QZH A;  2ASB A;  2JN4 A;  2IW3 A;  2RVL A;  4A4I A;  2PNR C;  2K5Q A;  3J7Y W;  5M3M H;  3S14 B;  4GKK L;  3FKI H;  3PO3 G;  3L0O A;  1XXG A;  2EXD A;  1D5Z C;  1VQF A;  1B70 B;  1I3Q H;  2KOL A;  3PCO B;  1TKW B;  5C3X A;  1R9T B;  2UUB Q;  3GTM B;  1VQD A;  2A6E C;  2MFI A;  1XMO Q;  2SOB A;  1ASY A;  1K8G A;  3K5N A;  1TWG H;  3BDL A;  1FVI A;  4A3J H;  2IJ0 A;  3T13 A;  1SNO A;  1HCZ A;  3WOF A;  1YNN C;  1STN A;  2RSO A;  2YU9 H;  3CCS A;  4F8M A;  1TS5 A;  3FPP A;  1S5B D;  4B3T L;  1Q1B A;  2JA8 H;  1GKH A;  4G7H C;  1SYE A;  2K50 A;  1CUK A;  2XRS D;  3A8J E;  1RHP A;  5KNB A;  1IBK L;  2VQE L;  2E75 C;  1MBY A;  2UUA Q;  5CV5 A;  5C3E B;  4X3U A;  4DR6 Q;  3SGI A;  1VS0 A;  2R93 H;  2F0J A;  2A8V A;  2MNA A;  3HOZ G;  5KYL A;  3Q22 A;  4V19 0;  1EWC A;  4A3B G;  3K7A B;  4IZ8 A;  4LNQ A;  1SRO A;  1CTM A;  3DWQ A;  2XIW A;  3GO5 A;  1C8C A;  4CDE C;  4DAP A;  3P20 A;  3SK8 A;  2JA9 A;  5A35 A;  3BG3 A;  3FKI B;  1LTB D;  5C0X G;  1WYD A;  1A8V A;  4KHP L;  1I3Q B;  2NVQ H;  1WTH A;  3QWN A;  3DM3 A;  4XT3 B;  4DR1 Q;  3T1H L;  4KLK A;  4A75 A;  2EE1 A;  2Z1C A;  1BUV T;  4A3J B;  4DU9 A;  5IYC G;  3I4N G;  3C3L A;  1SYD A;  3U4V A;  2MO1 A;  3CXC A;  1PHJ A;  1HUM A;  2LXJ A;  2E8G A;  1PH7 A;  2YU9 B;  1V8Q A;  4Y7N H;  4OWX B;  2WB1 B;  1TWC H;  2E2D C;  2JA8 B;  3I70 A;  2PI2 E;  1CKN B;  2ZJP A;  1H9S B;  4DPG A;  1TU2 B;  2NZ1 D;  4HCS A;  1EEI D;  1AP0 A;  4I7Z C;  1KNE A;  1EFI D;  4QUC A;  3LGJ A;  4KJO A;  1IL2 A;  1MSG A;  4UHV A;  1N32 Q;  4DK0 A;  2JYO A;  2LFN A;  5M5W H;  2V4D A;  3WDN A;  1K0R A;  1PDQ A;  4RKL A;  1VQ8 A;  3A55 A;  1MD2 D;  2NN6 G;  1VDZ A;  1YVC A;  5I9P A;  4IJH A;  2J0T D;  3MEF A;  2M00 A;  4F87 A;  4HIM A;  3CCJ A;  3S16 H;  1STY A;  5M5Y H;  2CW0 D;  1B9M A;  4X6A H;  2B2U A;  1DD2 A;  4K14 A;  4JCV E;  1XNR Q;  1OXX K;  1YHQ A;  4N9P A;  1L2F A;  4XDX A;  1IYJ B;  1S5D D;  2JA6 H;  3HOX H;  2RDG A;  4XTC S;  3MVV A;  5J22 A;  2F0Q A;  3RZD H;  3KDF B;  1NTG A;  2CFM A;  3D8G A;  3I3C A;  4GOP C;  3CF5 A;  4FYD A;  1K8O A;  2DNC A;  1NJI C;  2GA4 B;  1VMC A;  2EZV A;  2CW0 C;  2ALY B;  1A3U A;  3RN5 A;  3VYS A;  4FF1 A;  5HGQ A;  1U4R A;  1SE4 A;  2FMM A;  3ITP A;  1F2L A;  2R61 A;  2RQX A;  4WOR A;  3LWE A;  4DNI A;  4L5R C;  2A73 B;  2OT2 A;  3UDF A;  2A1A A;  5JJK A;  3VR3 A;  5M5W B;  2VL6 A;  5GAH C;  3K57 A;  1V1O A;  3R2T A;  3OHX C;  3PGZ A;  3TS2 A;  4BY1 G;  4OIK A;  1M1K C;  5IYB H;  4OO1 I;  4OXP A;  1YEZ A;  2EYJ A;  1KDC A;  4JPB W;  4JYA Q;  5IWA L;  1K3R A;  3HFZ B;  2HHH L;  2JA5 H;  2F4V Q;  3OSO A;  1B1Z A;  4BA1 I;  2PYK A;  2VW9 A;  4DR7 Q;  3PF4 A;  1TVX A;  2FXQ A;  4UP9 A;  1Y69 U;  3L2P A;  3D31 A;  1GUW A;  2FHT A;  3HOX B;  1HR0 Q;  5ELC A;  3F2D A;  3RZD B;  3GTL H;  1PRT F;  3J80 E;  1JIC A;  4ZAI A;  1HHV A;  1RKN A;  1MI2 A;  3O13 A;  2R3Z A;  4ZKC B;  1VF5 C;  3PIP 3;  4DNR B;  3HOV H;  3A5Z B;  4A3G G;  5GAD C;  4CDD C;  2B2T A;  2R7D A;  2SEB D;  1BKB A;  3L3O C;  2X6L A;  1I4R A;  4NXN L;  1VQ5 A;  2F0D A;  1VQO A;  1AH9 A;  2UXD Q;  1WTQ A;  1I94 L;  4EQN A;  3WWV A;  2AWO A;  1SLJ A;  1PH8 A;  2SNS A;  3KBX A;  2B2T C;  3UDX A;  2AQ1 B;  1A3V A;  2VUM B;  4LF7 L;  4BY7 G;  4O1N A;  5CMD A;  4C3H G;  1GJX A;  4C3I H;  1U9R A;  3HKZ G;  5CYU A;  3G6E A;  1DOM A;  4NB3 A;  3A54 A;  3J7A 5;  4RH6 A;  4NXM L;  1PFB A;  3DLL A;  4H13 C;  2PPB C;  2EDG A;  4BXX H;  2JA5 B;  4L8J A;  3CQZ H;  4YWM A;  2KA7 A;  1FJG Q;  5E4X A;  5CV7 A;  5KGU A;  2I5H A;  1CKN A;  2Z0S A;  4A3K B;  2NVT H;  2B2W C;  1H9S A;  1XWE A;  4MNO A;  1EY4 A;  1V1P A;  1TII D;  3J80 c;  1SNM A;  2QW7 A;  3FMC A;  5EJW A;  5CGK A;  2LXK A;  3GTL B;  1EQT A;  4A3M G;  2CWA A;  3U9S A;  2C35 B;  1YNX A;  1I6V C;  2M9V A;  3K5M A;  4TVA B;  3RN2 A;  3M3Y B;  5D65 A;  2KCC A;  2RCN A;  4RMF A;  3A5U A;  4IAL A;  1AN8 A;  3MXN B;  4G57 A;  1U4L A;  3M7N A;  1STH A;  5I2X A;  3TZD A;  1X55 A;  1ML0 D;  4IUN A;  3C1E A;  1WTX A;  3IFT A;  1E1T A;  3TP5 A;  2BDO A;  4R4T A;  4RGM A;  3D3R A;  1PH4 A;  1BF4 A;  2EPB A;  1SYG A;  2UXC Q;  2L12 A;  4C3I B;  3H6M A;  3Q0A A;  1P16 A;  1SYC A;  1G6Z A;  2F0S A;  2ZTE A;  3UE0 A;  3KDF A;  3N6R A;  1HA5 A;  4PZ8 A;  5HY6 A;  3T53 B;  4A3I G;  3OW2 A;  1WJJ A;  3CME A;  3CKI B;  3W2D A;  2OF1 A;  3HOY G;  4MN3 A;  4IPC A;  3VR6 A;  1C4Q A;  1S5C D;  2ENB A;  1E0B A;  1QOH A;  1BCP C;  1CHQ D;  1A6X A;  2WV6 D;  4ZRZ A;  1YIJ A;  1L0W A;  1SNP A;  2JQO A;  4C56 C;  1YHB A;  3OMC A;  2F0H A;  3KF8 A;  4X64 L;  4TKO B;  3PO2 H;  2WFW A;  1K83 H;  3V2T A;  2KBN A;  3T16 A;  4IUT A;  1XPU A;  2EJM A;  1D5M C;  1YJN A;  1J8I A;  4GZY C;  2L5T A;  3BYT B;  5CV6 A;  5EQ0 A;  1M4V A;  2ICI A;  2RCF A;  4AYB E;  4P73 A;  4M1U B;  1SSO A;  2JEA I;  4LJZ C;  4RCO A;  1EFW A;  3BS1 A;  2WKD A;  1JE5 A;  2K5W A;  2K1B A;  4DR4 Q;  3MFG A;  3QB3 A;  5EGT A;  1LLR D;  1ZKO A;  2K14 A;  3NWT A;  1VMP A;  1EZ6 A;  3HRZ C;  5CC4 A;  2IL8 A;  1WTR A;  3S15 H;  1PFM A;  2N49 A;  3OTO Q;  5ELE A;  3CC4 A;  3J81 L;  3E3X A;  5IE8 A;  4F7X A;  3J81 E;  3Q23 A;  1QVC A;  3CPW A;  4KY5 A;  2EY6 A;  3S1M H;  3URY A;  2KEE A;  2KVM A;  4KN4 C;  1PXU A;  2VS1 A;  4WJW A;  4JI6 L;  3EQL C;  1L1O C;  4DAV A;  1QIL A;  1I4X A;  4L5Q A;  4P71 A;  3T1Y L;  4A3E H;  1K73 C;  2F0O A;  1K8A C;  1P8L A;  4K8J A;  3PO2 B;  1E24 A;  1K83 B;  3QG1 A;  1B9N A;  1N34 L;  1CFM A;  3GDE A;  3K5L A;  3H09 A;  3TBI B;  4DR2 Q;  3VR2 A;  2K05 A;  1OXU A;  3I90 A;  1TS3 A;  5LMN W;  1EIF A;  1NAP A;  5EKL A;  4HIO A;  2J7Z A;  4IPH A;  1X3Q A;  3JAM E;  1B3A A;  1STE A;  4A93 G;  4QL5 A;  1MJC A;  4XQQ A;  5C4X G;  2DY8 A;  1MGS A;  1CM9 A;  5IP9 H;  2KED A;  2XTI A;  5LMU Q;  1F9S A;  2XWJ B;  1KAW A;  3TRZ A;  4DV5 Q;  5D3I B;  4JI5 L;  2V1C C;  1NMF A;  1PFS A;  2IT1 A;  4DV3 Q;  3BDC A;  5IY0 A;  3S15 B;  3RUZ A;  3WOE A;  3KFU A;  1H95 A;  1DYQ A;  3PO3 H;  2ZXR A;  1YIT A;  1D1I A;  3CW2 C;  4RHR A;  2NVX H;  3S1M B;  1STG A;  4A3C G;  2ZM6 L;  3BVZ A;  3GV3 A;  3CP0 A;  3PUX A;  2RSN A;  2L4N A;  3OPO A;  1S3O A;  1UEA B;  4X66 Q;  2E2H H;  1S4Z A;  4PQX A;  1PMR A;  2ATW A;  1I6H B;  2FMC A;  3UDI A;  3CCE A;  2YYZ A;  5I4D A;  4NPS A;  4EQP A;  5M3F B;  1PTO D;  1U5K A;  4FXD A;  1EIG A;  4JBW A;  3VYT A;  3JAM c;  2EY5 A;  3K58 A;  1E2Z A;  1SAP A;  2FFK B;  2PNH A;  3S17 H;  3EN2 A;  3DUZ A;  1W6K A;  2BA1 A;  4LFA L;  2ZTC A;  1HTP A;  1TT2 A;  3R8B A;  2PI2 A;  3HOZ H;  2JXM B;  4A3B H;  2Z4I A;  5C4J H;  3MA2 B;  2IY5 B;  3K6O A;  5CBA E;  1LYL A;  1X3E A;  3U58 A;  2LKV A;  2NBF A;  3J81 j;  2NVY H;  5G3L D;  4XYO A;  1HNW Q;  3BZD B;  4C3J G;  3PO3 B;  1NR4 A;  1N9W A;  3F2U A;  3OWE B;  2NVX B;  2F0E A;  3BU2 A;  2O2L D;  2WB1 E;  2DY7 A;  5FO9 B;  3HKS A;  1BR9 A;  5JEA G;  1L0Y B;  3M4O B;  2E76 C;  3AEV A;  4UPA A;  4OIJ A;  4C2M H;  4LFC Q;  3I4N H;  3OW7 A;  2E2H B;  3ERO A;  4JI4 L;  1C7Y A;  4LF6 Q;  3PUZ A;  2N8N A;  5ELF A;  4XXE A;  1Y8O B;  1Q7Y C;  4RG1 A;  1SYB A;  4NKL A;  1Q1E A;  5KND A;  4CKB A;  3RD4 A;  3D4R A;  3C46 A;  2UUC L;  1HFG A;  1KDB A;  2D62 A;  4A3D G;  1UE1 A;  2KCN A;  4A3F G;  1UWV A;  1HZ9 A;  4AQY Q;  3L9A X;  1JOQ A;  2PO4 A;  1PRT B;  2EQS A;  3BZC A;  4RGO S;  3HOZ B;  2R7F A;  4YHH L;  2A69 D;  5C4J B;  1IBM L;  1CHP D;  1SFO H;  3AB9 A;  1EY0 A;  2NN6 H;  1A3T A;  2WAQ E;  3DHQ A;  4YCV A;  2NVY B;  4X62 Q;  3QIA A;  2B29 A;  1UAP A;  3TZU A;  2KEN A;  2Z4H A;  1PYW D;  1ROD A;  2ZJQ A;  1XNR L;  4CDF C;  3DMU A;  3DEO A;  4C2M B;  2WII B;  2KHI A;  2IHE A;  4QB4 A;  2RDF A;  2A69 C;  5DNF A;  4GNX C;  3J7A V;  1CZW A;  2RHS B;  2HCI A;  1AEX A;  3I4M G;  1VQG A;  4Y52 H;  4S3S A;  1V1Q A;  4KKT A;  2AQ2 B;  4H7B A;  1FGB D;  2HD3 A;  4UDU C;  4PV1 C;  5FLM G;  3G6J B;  4LUO A;  1I4G A;  2LMC B;  1VQN A;  4BY1 H;  1ZYR D;  2GN5 A;  3UE1 A;  1WCM G;  3QR8 A;  1U4P A;  5JJZ A;  4QQB X;  2UXB Q;  4GLA C;  1KDA A;  1H9R A;  3MFY A;  3LX0 A;  1B3Q A;  4ZYS A;  2MJ8 A;  1G2T A;  3AFQ A;  4DUY L;  1CT1 D;  4MIU A;  4JI3 L;  4NDX A;  3KUP A;  1VQP A;  1PZK D;  3HOU G;  1FR3 A;  4BBR B;  4DR7 L;  5IGF A;  1LT4 D;  5K5P A;  3CCL A;  4JG2 A;  3ND9 A;  1WD1 A;  1PH5 A;  4HCE A;  3K0X A;  1FL0 A;  5BR8 L;  2IX3 A;  1PA6 A;  4HJ9 A;  2JJQ A;  1OXT A;  3NPP A;  4PMB A;  1EOT A;  2OQ0 A;  3DEP A;  4FP5 D;  1ZYR C;  2B8F A;  2K33 A;  2I5L X;  2VQF Q;  1LT3 D;  1RD9 D;  1XX8 A;  5J39 A;  1S72 A;  1PTO F;  3ULP A;  1EY7 A;  1TXY A;  2F0G A;  3ERQ A;  3NEM A;  4KN7 C;  5DAU A;  2VXW A;  2F3I A;  2B39 A;  3CRK C;  4DNT B;  1HR0 W;  1SNC A;  1E1O A;  3FDT A;  2WIN B;  2C5C A;  4JI0 Q;  4TQU S;  2EY2 A;  1EY6 A;  4DAM A;  1PH3 A;  1B2T A;  2E74 C;  3S1Q H;  4K2L A;  3C2P A;  1IBL Q;  1LT6 D;  4BY7 H;  5BN5 A;  5FO8 B;  3MHB A;  4DV0 L;  1GO3 E;  4C3H H;  2UU9 L;  4DUZ Q;  2F0U A;  1F9Q A;  2IPK D;  2OEO A;  5G3L F;  3QOL A;  5C44 H;  5T1I A;  4RA8 A;  3OMG A;  2K5N A;  4O0A A;  1BBX C;  3GTO H;  2F0F A;  5GAG C;  3H3V C;  3Q24 A;  2JA7 G;  3SE0 A;  1CKO A;  2Q2H A;  1EU4 A;  4C1N I;  1N33 Q;  1HNZ L;  1QG7 A;  3G4S A;  5M3M B;  1AFP A;  5L37 A;  4A3M H;  5KNC A;  4ME5 A;  1SYF A;  3S9W A;  4FF2 A;  2PZW A;  2DNE A;  4B3M Q;  3NBH B;  1TWG B;  3R2I A;  4DV7 Q;  1M90 C;  1TY0 A;  4ILW A;  5IP7 G;  4DR3 L;  4DR5 Q;  2BE5 C;  1H9M A;  2Q2I A;  2XNA C;  3SK5 A;  4ZKB B;  4LF5 Q;  1GUN A;  4JI8 L;  1Q90 A;  3CRL C;  3S1Q B;  5AJ3 Q;  4H44 C;  4BY7 B;  1JQY D;  4C3H B;  4BBS G;  3BYY B;  4DV4 Q;  1HTL D;  1SXT A;  1FNU A;  4HED A;  5EPJ A;  4AYB G;  1JR0 D;  2D0P A;  2OQK A;  3MAQ A;  2F0P A;  3MTS A;  1XYI A;  1QUQ B;  5FJ8 G;  4A3I H;  5C44 B;  1JWS D;  1QE6 A;  1WTP A;  3HOY H;  2R93 B;  4R4C A;  1PH9 A;  2DUD A;  3GTO B;  1JC7 A;  3A7L A;  3NSW A;  3GTP H;  1VCI A;  1QVF A;  1JOK A;  4H02 A;  4RFB A;  1RDP D;  3HOW G;  3V96 A;  1ILP A;  3GTJ H;  4A3M B;  3V05 A;  1CSP A;  1CI3 M;  3NHH A;  2EXZ A;  2ES2 A;  4ZCK A;  3H15 A;  1ESR A;  4JI7 L;  2NVQ B;  3X3M A;  3AYH B;  4OWT B;  2F1M A;  3SXH A;  3CC7 A;  2WAQ B;  4DV6 Q;  3W1B A;  3A7A B;  4UY8 C;  1KRT A;  2HCC A;  3TS0 A;  3PIO 3;  4ID6 A;  2B2U C;  1N36 Q;  1T9H A;  2FJ2 A;  3RZO H;  2CH4 A;  2K5D A;  1EIH A;  4Y7N B;  1I4Q A;  3PUV A;  1Z7T A;  4DR4 L;  4LF4 L;  1TWC B;  4BA2 I;  4KD4 A;  1Y1W H;  1D5X C;  3KF6 B;  3NTH A;  3Q8D A;  4R4Q A;  2R92 G;  5EBC A;  2ZT9 C;  3IL8 A;  1EYD A;  5JPM C;  3LNN A;  3OTO L;  4A3I B;  3EBE A;  4KHZ A;  3HOY B;  4CDC C;  3JC6 6;  4LFB L;  2YTV A;  2HQL A;  4QCL A;  2NTT A;  1XMQ Q;  4PMC A;  5JPN C;  1ENA A;  3Q6S A;  3MXG A;  2F0K A;  4X65 L;  2MQH A;  3S16 B;  4JI2 Q;  3ER0 A;  3GTJ B;  5M5Y B;  1J5E L;  3FHW A;  2PMZ B;  3B6Y A;  3NXW A;  3KYH C;  4CJ0 B;  4DR2 L;  5E4W C;  1IL8 A;  2EYH A;  3T4A C;  1CA6 A;  3DWP A;  3SR1 A;  1OTC A;  2H5X A;  3RLF A;  2CQO A;  4GKJ Q;  1DOL A;  2JA6 B;  4K0K Q;  1AZQ A;  2O5J C;  5C4X H;  3NK9 A;  1D7Q A;  3ND8 A;  3KJP A;  1GM5 A;  2WKC A;  3RZO B;  5FK9 C;  5C3E G;  4N8X 1;  1GHJ A;  4DV2 Q;  1Q86 C;  2A19 A;  2K5V A;  1WI5 A;  3J80 i;  3A56 A;  1WTV A;  1Y1W B;  1KLG D;  1VQC A;  1J9O A;  2MP1 A;  4C1N K;  3U9O A;  1B8A A;  3PIP A;  3HGB A;  5E3F A;  1O7Z A;  4GKK Q;  5AFW A;  2P5Z X;  1X56 A;  4XQN A;  2B63 G;  2R7Z G;  5C6A A;  3E0E A;  3S2H H;  1ICW A;  1EQV A;  4A3C H;  3NBH A;  1X9N A;  4H0L C;  2N78 A;  2H4O A;  2JEB I;  2Y0S G;  4A3J G;  2VB3 X;  3TEH B;  1YHA A;  1LAB A;  3EA6 A;  3HP3 A;  4YY3 L;  1NUC A;  4HAE A;  5E7N A;  1JOO A;  2JP1 A;  2IWH A;  4YCU A;  5IGD A;  2EYP A;  3E5S A;  5BN3 A;  2QIL A;  1QZG A;  1FYC A;  1ET6 A;  2QA4 A;  1DON A;  5C4X B;  3SVM A;  5I9O A;  1EYC A;  1C0A A;  2OXP A;  1MKH A;  4ALP A;  3HOV B;  1QNK A;  3BZK A;  1PTO H;  3IKJ A;  3UDG A;  1RL2 A;  1DXM A;  1G91 A;  4RWS C;  2OTJ A;  1BCP D;  5DEH A;  2DN8 A;  1EY8 A;  1XNQ L;  2PW5 A;  4IN3 A;  1LTG D;  1TR5 A;  2DJG C;  3SEB A;  3RMH A;  4KHP Q;  5JEA H;  4B3S L;  1YNJ D;  3T1H Q;  4FF3 A;  5J1Z A;  1Q46 A;  4GN3 B;  1IXR A;  2XRQ D;  5CV9 A;  1AE3 A;  1X3F A;  1YJ9 A;  4LF6 L;  1HRJ A;  1ESF A;  3CQZ B;  2ICE C;  5EKI A;  1CQF A;  4ZUI A;  3K5O A;  3S1N H;  2NVT B;  4QJF A;  2RA4 A;  5C0X I;  4KJN A;  5IGE A;  1F2Y A;  4A3D H;  4NP5 A;  4HID A;  1YJW A;  4QGU A;  2HT1 A;  4GS3 A;  5LL6 S;  4B3R Q;  3PF5 A;  1YNJ C;  4UP7 A;  2OTL A;  5COR A;  4GLV B;  1YZ6 A;  3AU7 A;  2DJF C;  5CR3 A;  1HPC A;  1V9P A;  2BA0 A;  2K32 A;  4IUR A;  4QUF A;  1PTO B;  5I6W A;  4CBV A;  1D6E C;  1G2S A;  4DV1 L;  3TQY A;  4JI1 L;  3VR5 A;  2C9O A;  3M4Q A;  4ODG A;  3N52 A;  2LSS A;  1IHZ A;  1ICF B;  4LUV A;  2M2L A;  4HIK A;  4IFD G;  2KUM A;  1K3B C;  4EVO A;  1X32 A;  4RKB A;  1VF7 A;  3U4Z A;  4PG3 A;  1X3P A;  1LUZ A;  4Q0F A;  5D3D A;  3NUC A;  3PMF A;  1FNW A;  1OXV A;  3HOX G;  4BWG B;  2A5H A;  1A62 A;  2QKI C;  2NN6 I;  2CWP A;  2I0Q A;  1HH2 P;  3I4M H;  3S1N B;  1TWA H;  3I91 A;  4J1M A;  2HIV A;  3R3O A;  5LMN L;  4A3D B;  4CJ1 B;  1VQ9 A;  4LW1 A;  1WTW A;  1Y14 B;  3QO2 A;  3S1R H;  4EX5 A;  2MGS A;  1HFN A;  1Q12 A;  1IW7 C;  2YTX A;  4DK1 A;  1PFN A;  5FLM H;  1RF2 D;  4OX9 Q;  1KNA A;  1BVS A;  2MO0 A;  4LF8 Q;  1WCM H;  2VUM G;  3OYY A;  1S5E D;  3J7A F;  4R4I A;  2E2J H;  1Q81 C;  1HJP A;  3I8Z A;  3KLW A;  2VB2 X;  3F2C A;  2E5L Q;  3JAM i;  2X6G A;  3HOU H;  3PQI A;  2Z6B A;  5F2D A;  4P2C B;  4RHS A;  3G71 A;  1G8Z D;  4A3K G;  3I4O A;  4Q5V A;  2KJX A;  3J81 c;  5J3B A;  1BBW A;  2NTS A;  1JWU D;  2K5H A;  2AHO B;  1IZ6 A;  1JB7 A;  1UEB A;  4BS9 A;  3R93 A;  3TME A;  4OGQ C;  3MXN A;  2UUB L;  3HZX A;  1TWA B;  2XN9 C;  1XMO L;  4OEL B;  4A3E B;  2O4X A;  3A0J A;  4IOC A;  2FIN B;  1VQE A;  2EYO A;  2HUG A;  1DM0 B;  3ONA B;  1I94 Q;  1ILQ A;  2F0V A;  2EOT A;  2F52 A;  1LTA D;  1X6O A;  1NY4 A;  1D1K A;  1VQM A;  4LF7 Q;  1WCM B;  3KLS A;  1O7Y A;  1BCP F;  4R1J A;  3PUY A;  4NXM Q;  2E2J B;  2K75 A;  2UUA L;  1NE3 A;  4DR6 L;  1QB5 D;  4QF4 A;  2PW7 A;  2JA7 H;  3HOU B;  1DOK A;  4EQ5 A;  2A68 D;  3SDZ A;  3U50 C;  1EQR A;  1EWI A;  3TDQ A;  1UE5 A;  4PMW A;  2QEX A;  5C0X H;  1UE6 A;  5ELB A;  4QY7 A;  3BJU A;  1SN8 A;  3GTK H;  1IKM A;  1LTR D;  1VQH A;  4DGZ A;  4DR1 L;  3PSI A;  4FO2 A;  4L5S A;  1K28 A;  2XSC A;  2EYM A;  4KKS A;  5JJL A;  3C1F A;  3HKZ E;  3I2Z A;  4K5X A;  1T5E A;  5IYC H;  1HA6 A;  4LF9 Q;  1T5X D;  4DV7 L;  2Z6K A;  3SK4 A;  5H1S E;  2YTY A;  1OXS C;  2A68 C;  2F3V A;  4ZK9 B;  3GTG H;  4A3L G;  5HUR A;  1K0S A;  5COY A;  4N9T A;  1K9M C;  4MHE A;  3NWS A;  2KEC A;  3FVQ A;  3D0F A;  4DV4 L;  3PUW A;  2AKW B;  1VQA A;  3S17 B;  5K36 G;  1SEB D;  3CAM A;  4KI0 A;  2F4I A;  5FJ8 H;  2H1E A;  2HDM A;  1STB A;  2K03 A;  2GVA A;  4A3B B;  1N32 L;  1Y8N B;  2JA7 B;  2LY7 A;  4OEM B;  1BDO A;  1HNX Q;  2CHB D;  1PZJ D;  3DWA A;  2K01 A;  3L7Z C;  2EY1 A;  3AQQ A;  1SRU A;  2K52 A;  2TMP A;  3S24 A;  3GTQ H;  4MZ9 A;  5EPL A;  1E2V A;  1Z6H A;  3CPF A;  1X54 A;  3NEL A;  3H0G G;  3I4N B;  5C5L A;  1KIX A;  3CU7 A;  4RCN A;  3GTG B;  1ENC A;  5KIX A;  4OO1 G;  3P7J A;  4G7O C;  1D2B A;  4IUU A;  4FF4 A;  2R92 H;  1TWH H;  2QGQ A;  1UE7 A;  1ZEQ X;  5CV4 A;  4EQO A;  5M9O A;  3NTI A;  1LTL A;  1H9J A;  3LWU A;  3ZJY C;  4L6T B;  2JE6 I;  2PMZ E;  1S5F D;  1SNQ A;  1JMC A;  1SFO B;  1RTN A;  2K7V A;  4JI6 Q;  3GTM H;  1GUS A;  4KHV A;  4RGT A;  4IFD I;  3K59 A;  1IYU A;  3T1Y Q;  1RJT A;  5IOD A;  4PNY A;  4DN4 M;  4JYA L;  2F0N A;  1GOZ A;  2VNU D;  1JCK B;  2D5D A;  1N34 Q;  1JOR A;  2F4V L;  3IAY A;  5LL6 X;  3GTQ B;  4CJ2 C;  4J8Q A;  1AW7 A;  1C9O A;  1SJH D;  2AUK A;  4WJ3 M;  2AMC B;  1O7I A;  5M3F G;  4J15 A;  3F1Z A;  3E9I A;  1A2T A;  4GOP B;  4JBK A;  1SMX A;  2PZT A;  1HR0 L;  1KHI A;  1QWY A;  1EWH A;  2RHQ B;  4DK3 C;  1DGS A;  1PZI D;  1YBY A;  1MSH A;  4WJ4 A;  4IUQ A;  5IP9 G;  1UNS A;  2BCO A;  3KLR A;  4A3G H;  1KTK A;  1TWH B;  2XVS A;  3A8K E;  3E9H A;  4GN4 B;  4KD3 A;  3MEH A;  2XWB B;  4JI5 Q;  2IHF A;  3STB C;  2D0O A;  4O2D A;  4M8A A;  3FEW X;  2I5M X;  4OL7 A;  2ZXO A;  2BOS A;  1BNZ A;  4JBJ A;  2Q2U A;  2UXD L;  1NCV A;  1XPO A;  4RAU C;  2B63 H;  2R7Z H;  1SDF A;  4HMJ A;  2KHS A;  1EY9 A;  4UP8 A;  4BY1 B;  5JEA J;  4IUP A;  1ONL A;  2ZM6 Q;  1EUJ A;  1Q82 C;  2NZO A;  1U0L A;  2AWN A;  1TQO A;  4IQZ A;  5E1F A;  4JBM A;  4G4K A;  1PRT D;  2I46 A;  1FJG L;  4IOA A;  2BE5 D;  4HJ7 A;  4KTA A;  1VQL A;  2BH2 A;  1LM0 A;  3IRB A;  1I4H A;  1S40 A;  5IYD G;  1KL9 A;  1Z9F A;  4KV6 A;  1HUN A;  3T51 B;  2BDN A;  3P75 A;  2CQA A;  4YWK A;  4LFA Q;  4KY6 A;  5A2Q L;  2L9H A;  4L63 B;  3ZYY X;  1PVO A;  2L1B A;  3X3N A;  5A2Q E;  4A3G B;  1QVG A;  3I56 A;  3K8A A;  2R6G A;  3UI2 A;  1PRT C;  5C3W A;  1A2U A;  4FNF A;  4ABN A;  4DKA C;  1KQS A;  2LS0 1;  1EY5 A;  2L0C A;  3H91 A;  2B63 B;  2R7Z B;  1HZC A;  2E2I H;  2VZA A;  5M5X H;  4AH6 A;  1DZ1 A;  1KD1 C;  1R4P B;  4OHJ A;  2IX0 A;  1B44 D;  4PZ6 A;  1BOS A;  2UXC L;  1VQJ A;  3HKZ B;  5GQO A;  1H9K A;  1PV4 A;  1Y1V G;  2Y0S B;  3QJY A;  1IKL A;  3I55 A;  1QJO A;  2ZTD A;  4JI4 Q;  4CKE A;  1K8M A;  4POF A;  4IPD A;  3GQB A;  4B9W A;  2UUC Q;  1FD7 D;  5JOB A;  3CHB D;  2Q8R E;  4I65 A;  1V1P B;  1EYG A;  4F88 A;  3K80 C;  4B3R L;  1E3P A;  4LMQ D;  1EEF D;  4JV5 Q;  5EBD A;  1VQI A;  3F8T A;  4YHH Q;  1IBM Q;  4CGY B;  1EYA A;  4XT1 B;  2G9D A;  5JJI A;  4TSS A;  4IFD H;  1JB3 A;  2E2I B;  5ELN A;  5M5X B;  3M9B A;  1B53 A;  3NEN A;  4YCW A;  4WFN 3;  3PIO A;  3MWY W;  2Z9H A;  3RLN A;  4GOP A;  1CZG A;  4BBR G;  4JW0 A;  4UAI A;  1G51 A;  1SE2 A;  1BCP B;  5C5M A;  4KKU A;  4YIJ A;  1WVL A;  1Y8P B;  1NBW A;  3AMU A;  1KXL A;  3P1H A;  2MHV A;  4QIW B;  4LWC A;  4V0B A;  3GTP B;  2HQE A;  4K6D A;  3BDO A;  1KAA A;  3NP8 A;  2SDF A;  2IX1 A;  3T56 B;  2L11 A;  1WFQ A;  3W1G A;  2ZJR A;  3KF8 B;  3VA7 A;  5IT9 L;  5CBE E;  4LAA A;  1SR3 A;  4I7A A;  4IUV A;  5IT9 E;  3CD6 A;  3M4Y A;  3CCU A;  4OX9 L;  2CVR A;  1M8A A;  4LK1 C;  1F2M A;  3ULL A;  2VUM H;  4LF8 L;  3NQT A;  2F0L A;  2NZH A;  1OO9 B;  3SK6 A;  4A93 H;  1LT5 D;  5JVG 3;  3F2B A;  4P75 A;  2XGT A;  1R4Q B;  1O7L A;  5TSS A;  4P72 A;  5D14 A;  5T1G A;  5LMU L;  4DUY Q;  2E5L L;  2B2V A;  4R4O A;  4JI3 Q;  4CKC A;  2Q8T A;  4JOI A;  1VQ7 A;  2A74 C;  4DV5 L;  3NTK A;  4A3K H;  1PH2 A;  4J6H A;  4HTH A;  4DV3 L;  2VY3 A;  4K2K A;  2JSO A;  5BR8 Q;  5C0X J;  5M3M G;  5JVH 3;  4FXK C;  3DXJ C;  1L1O B;  3FKI G;  3J80 L;  2B2V C;  1FNV A;  3E6Z X;  4JOI C;  1VQK A;  1V43 A;  2EIF A;  3M3Y H;  1Q8I A;  5C4H A;  4POG A;  3QOJ A;  3VA5 A;  4APV A;  2KCM A;  1PYS B;  3D4D A;  3NE5 B;  2NYZ D;  1JT8 A;  4X66 L;  5IT9 c;  1TS2 A;  1TS4 A;  1ASZ A;  5DLQ E;  4G7Z C;  3SHL A;  4GLX A;  3CCM A;  4B3T Q;  2WB1 G;  3TP7 A;  1GUO A;  2QDB A;  1CSQ A;  2JA8 G;  3TP8 A;  4DV0 Q;  2UU9 Q;  5ISR A;  1QUQ A;  3CC2 A;  2DGY A;  1EIY B;  2B2W A;  4A93 B;  1IBK Q;  2VQE Q;  3RLO A;  1E2W A;  1GVP A;  5C44 G;  4FXG C;  2Q8I B;  1KC8 C;  2R93 G;  2B2Y A;  3MXP A;  3KJO A;  3KBG A;  3CCV A;  3D6C A;  4LUZ A;  1BXT A;  1PH6 A;  3I72 A;  1MHW C;  1AZP A;  1HNZ Q;  2F0M A;  1D8L A;  4C3J H;  2F3W A;  1TWF H;  1HNW L;  2B2Y C;  3S2H B;  1NR2 A;  2HIX A;  3TP6 A;  4MTK A;  3OOC A;  3H3V I;  1EOV A;  2JK8 A;  4YWL A;  5IGG A;  1GD7 A;  1SE8 A;  3FRP B;  1F9R A;  2L15 A;  4QMG A;  3PV0 A;  3M85 A;  1PLF A;  5IIF A;  2WAQ G;  2K6A A;  4GN5 A;  1I50 H;  4LFC L;  4LF9 L;  4DR3 Q;  4X3S A;  3K7U C;  1HZB A;  3M4P A;  4A3L H;  2CKZ B;  1G6P A;  4ME3 A;  3KF6 A;  4JI8 Q;  3TRE A;  2PZU A;  2HDL A;  4KY7 A;  4R9W A;  5FLX L;  1I4P A;  1PH1 A;  1B50 A;  5FLX E;  2NB0 A;  3MC0 B;  5I6Y A;  3ULJ A;  2KQ3 A;  1B4O A;  3NBI A;  4AIM A;  4A3F H;  1W2B A;  5K36 H;  4AQY L;  1L0X B;  1W3S A;  2Q2T A;  2B8G A;  3IFD A;  2PQA B;  2MPM A;  1E22 A;  2TSS A;  1X65 A;  3TN2 A;  1GUT A;  1HNX L;  1RCV D;  1F9P A;  4X62 L;  3RR5 A;  4C3J B;  3ICE A;  1TWF B;  1RTO A;  1LAC A;  1E7Z A;  1HXY D;  4JI7 Q;  5EAY A;  1KLU D;  4RGN A;  2MUY A;  4K5W A;  1IW7 D;  2QCP X;  3H0G H;  2EJF C;  2NWG A;  1I50 B;  5ELD A;  3D6W A;  1EQQ A;  1TY2 A;  4X3T A;  5C4Z A;  2JA6 G;  2F0I A;  1O80 A;  2WP8 J;  3AFP A;  2D2C C;  5FLX c;  4OO1 H;  3MZ5 A;  2K4K A;  4K8I A;  1HQM C;  2SNM A;  4LF4 Q;  3J81 i;  4KK7 A;  1Y1W G;  4Z9C B;  3MXU A;  3G48 A;  4A3F B;  1KRS A;  1L1O A;  5DM7 3;  5GAE C;  3I4L A;  4HN7 A;  1AE2 A;  5JAV A;  3ERS X;  2F0T A;  2QEJ C;  2RKS A;  2X69 A;  5LHY 1;  3I7F A;  1I5F A;  1JWM D;  1BBU A;  2KHJ A;  4LFB Q;  3S2D H;  1LTT D;  1U4M A;  1RIP A;  2K04 A;  4CHT B;  5IYB G;  1WTO A;  2UXB L;  3NQI A;  2CCZ A;  5FKA C;  4X65 Q;  4KMU C;  3VYU A;  4DAY B;  1F77 A;  3A8I E;  5ELO A;  5IWA Q;  1SND A;  1J5E Q;  4ZLT F;  1JJ2 A;  2HHH Q;  2JA5 G;  1C48 A;  1I6H H;  2AUJ D;  1ZXT A;  1LTI D;  4GNX B;  5M3F H;  1EU3 A;  3KOJ A;  3H0G B;  4B9X A;  1B7Y B;  4HSV A;  3EJI A;  2ID0 A;  4HSP A;  3JAM L;  4ZQ3 A;  1BQQ T;  3H94 A;  3TSS A;  1X3G A;  2I07 B;  1PYB A;  2VQF L;  1A15 A;  2F0W A;  1G29 1;  4DFA A;  3I4M B;  1GHK A;  5NUC A;  3W5O A;  2CH4 W;  4HJ8 A;  3HOV G;  1II3 A;  4P74 A;  4HJA A;  3OWF A;  2WAC A;  2EYF A;  1GXD C;  4DK6 C;  4NXN Q;  3GV6 A;  3S1R B;  4JC0 A;  3BVM A;  2EYL A;  3GP7 A;  5HGT A;  1VQB A;  4JI0 L;  3CMA A;  1DCZ A;  2N55 A;  3S2D B;  5GRO A;  4FDB A;  1IBL L;  4E6I A;  4DUZ L;  4U68 A;  2G9H D;  4C3I G;  2EVB A;  4N8F A;  4OWW B;  3H3V H;  3M4O H;  2Z8L A;  3OIP A;  5CV8 A;  1CK1 A;  4BXX G;  5BN4 A;  4YY3 Q;  1NMG A;  5IYD H;  1N33 L;  2YV5 A;  4XYQ A;  4ZUJ A;  5KEE A;  2PQA A;  3I73 A;  5IGC A;  1CA5 A;  2N3S A;  3M7G A;  3VYR A;  3RNU A;  5IOC A;  1HZA A;  1XTC D;  4B3M L;  3BVG A;  5IP7 H;  1N8R C;  1EL0 A;  4DR5 L;  2Y0S E;  1ET9 A;  1SJE D;  1CQV A;  1XNQ Q;  4IFD J;  4LF5 L;  1PTO C;  5IGB A;  1IYV A;  5DM6 3;  5AJ3 L;  2NUC A;  3G7L A;  1MJE A;  4BBS H;  4B3S Q;  3DM1 A;  1JE4 A;  1Y1V H;  2A6H D;  2Z6K C;  1Z47 A;  4HMI A;  3GD7 A;  4R8I A;  1FGU A;  1NSN S;  1XJV A;  3D4W A;  3HG9 A;  1LV9 A;  3OIQ A;  1WD0 A;  3HS0 C;  4A76 A;  1SMY D;  2J4X A;  3FPU B;  1O78 A;  1HQR D;  5EKK A;  4O42 A;  3A74 A;  1YI2 A;  4JVZ A;  5KYI A;  3HOW H;  2QF7 A;  1XPR A;  4X64 Q;  2OWO A;  1QCB D;  3PO2 G;  4WRD A;  3GTK B;  2KCT A;  3VR4 A;  2B3G A;  4B08 A;  2A6H C;  2D9U A;  4DXF A;  3E0J A;  1XTD A;  3K0Y A;  4EGV A;  4JV5 L;  4R8N A;  3EFX D;  4TRD A;  1WOC A;  3EIV A;  3CCQ A;  5EPK A;  4DV6 L;  1J6Q A;  1SMY C;  4DAY A;  1KAB A;  4IJL A;  4DV1 Q;  4JI1 Q;  5FOB B;  1VQ6 A;  1VQ4 A;  1N36 L;  4X3K A;  3CCR A;  1QNU A;  1MIU A;  1GUG A;  1Q3L A;  4GNX A;  3HEJ A;  2K28 A;  1BO0 A;  4NMZ A;  3J7Z C;  5KRU A;  3K81 C;  4QIW E;  4OON A;  4DF7 A;  4BBS B;  2L55 A;  4K6L A;  2RDH A;  5I2Y A;  4FVM A;  4PZ7 A;  4BBR H;  4AYB B;  1Y1V B;  4K5V A;  2O5I C;  2F03 A;  3S14 H;  1F2Z A;  2RF4 A;  2RBM A;  3FP9 A;  1JJC B;  4U67 3;  4MTN A;  1R9T H;  1LTS D;  1XMQ L;  4XQJ A;  3W3A A;  2EJG C;  1STA A;  4XIG S;  5LMN Q;  3HOW B;  4DA2 A;  2PQE A;  4A3E G;  4JI2 L;  1A63 A;  4NW2 A;  1Q8K A;  1ENF A;  1NNX A;  2BH8 A;  3STB D;  1SE3 A;  1EZ8 A;  4ULL A; 
#chains in the Genus database with same CATH homology
 1DJR D;  1W6J A;  3KK7 A;  3KLS X;  4DXG A;  2A6E D;  2AQ3 B;  2ZXP A;  4HR7 B;  2N88 A;  4JK1 C;  2R92 B;  1SBB B;  1UUP A;  1YNN D;  1LO5 D;  2PCF B;  3EVQ A;  5FO7 B;  2IW3 A;  2RVL A;  2PNR C;  2K5Q A;  3J7Y W;  3S14 B;  1XXG A;  1D5Z C;  2KOL A;  1R9T B;  1TKW B;  5C3X A;  3GTM B;  2A6E C;  2SOB A;  3K5N A;  3BDL A;  2IJ0 A;  3T13 A;  1SNO A;  1HCZ A;  3WOF A;  1YNN C;  1STN A;  2RSO A;  4F8M A;  1TS5 A;  3FPP A;  1S5B D;  1Q1B A;  4G7H C;  1SYE A;  2XRS D;  3A8J E;  1RHP A;  5KNB A;  2E75 C;  1MBY A;  5CV5 A;  5C3E B;  4X3U A;  2F0J A;  5KYL A;  3Q22 A;  4V19 0;  1EWC A;  3K7A B;  4IZ8 A;  1CTM A;  3DWQ A;  2XIW A;  3GO5 A;  1C8C A;  4DAP A;  3P20 A;  3SK8 A;  5A35 A;  3BG3 A;  3FKI B;  1LTB D;  5C0X G;  1I3Q B;  3QWN A;  4XT3 B;  2EE1 A;  2Z1C A;  1BUV T;  4A3J B;  4DU9 A;  3C3L A;  1SYD A;  1HUM A;  2YU9 B;  1V8Q A;  2WB1 B;  2E2D C;  2JA8 B;  3I70 A;  1H9S B;  1TU2 B;  2NZ1 D;  4HCS A;  1EEI D;  1AP0 A;  4I7Z C;  1KNE A;  1EFI D;  4QUC A;  4KJO A;  1MSG A;  4DK0 A;  2JYO A;  2LFN A;  2V4D A;  3WDN A;  1PDQ A;  4RKL A;  3A55 A;  1MD2 D;  2NN6 G;  1VDZ A;  5I9P A;  2J0T D;  4F87 A;  2M00 A;  1STY A;  2CW0 D;  1B9M A;  2B2U A;  1DD2 A;  4K14 A;  1OXX K;  4N9P A;  4XDX A;  1S5D D;  2RDG A;  4XTC S;  3MVV A;  5J22 A;  2F0Q A;  3D8G A;  3I3C A;  4FYD A;  1K8O A;  2DNC A;  2GA4 B;  1VMC A;  2EZV A;  2CW0 C;  1A3U A;  3VYS A;  4FF1 A;  1U4R A;  1SE4 A;  2FMM A;  3ITP A;  1F2L A;  2R61 A;  2RQX A;  4WOR A;  3LWE A;  2A73 B;  2OT2 A;  3VR3 A;  5M5W B;  3K57 A;  1V1O A;  3R2T A;  3OHX C;  4OIK A;  4OO1 I;  2EYJ A;  1KDC A;  3OSO A;  1B1Z A;  4BA1 I;  2PYK A;  1TVX A;  1Y69 U;  3D31 A;  1GUW A;  2FHT A;  3HOX B;  5ELC A;  3RZD B;  1PRT F;  3J80 E;  1JIC A;  4ZAI A;  1HHV A;  1RKN A;  1MI2 A;  3O13 A;  2R3Z A;  4ZKC B;  1VF5 C;  3PIP 3;  4DNR B;  2B2T A;  2SEB D;  3L3O C;  2X6L A;  1I4R A;  2F0D A;  1WTQ A;  4EQN A;  2AWO A;  2SNS A;  3KBX A;  2B2T C;  2AQ1 B;  1A3V A;  2VUM B;  4O1N A;  5CMD A;  4C3H G;  1GJX A;  1U9R A;  5CYU A;  1DOM A;  3A54 A;  4RH6 A;  1PFB A;  2PPB C;  4H13 C;  2EDG A;  2JA5 B;  4L8J A;  2KA7 A;  5E4X A;  5CV7 A;  5KGU A;  4A3K B;  2B2W C;  1H9S A;  1XWE A;  1EY4 A;  1V1P A;  1TII D;  1SNM A;  3FMC A;  5EJW A;  5CGK A;  3GTL B;  1EQT A;  3U9S A;  1I6V C;  2M9V A;  3K5M A;  3M3Y B;  5D65 A;  2KCC A;  4IAL A;  1AN8 A;  4G57 A;  1U4L A;  3M7N A;  1STH A;  5I2X A;  3TZD A;  1ML0 D;  4IUN A;  3C1E A;  1WTX A;  3IFT A;  3TP5 A;  2BDO A;  4RGM A;  3D3R A;  1BF4 A;  2EPB A;  1SYG A;  2L12 A;  4C3I B;  3H6M A;  3Q0A A;  1SYC A;  1G6Z A;  2F0S A;  3N6R A;  1HA5 A;  3T53 B;  3CKI B;  3W2D A;  2OF1 A;  4MN3 A;  3VR6 A;  1C4Q A;  1S5C D;  2ENB A;  1E0B A;  1QOH A;  1BCP C;  1CHQ D;  1A6X A;  2WV6 D;  4ZRZ A;  1SNP A;  4C56 C;  3OMC A;  2F0H A;  3KF8 A;  4TKO B;  3V2T A;  3T16 A;  4IUT A;  2EJM A;  1D5M C;  1J8I A;  4GZY C;  2L5T A;  3BYT B;  5CV6 A;  5EQ0 A;  1M4V A;  2ICI A;  4M1U B;  1SSO A;  2JEA I;  4LJZ C;  4RCO A;  3BS1 A;  2WKD A;  2K5W A;  2K1B A;  3MFG A;  3QB3 A;  5EGT A;  1LLR D;  1ZKO A;  3NWT A;  1VMP A;  1EZ6 A;  3HRZ C;  5CC4 A;  2IL8 A;  1WTR A;  1PFM A;  5ELE A;  3J81 L;  4F7X A;  3J81 E;  3Q23 A;  4KY5 A;  2EY6 A;  3URY A;  2KEE A;  2KVM A;  4KN4 C;  1PXU A;  4WJW A;  3EQL C;  4DAV A;  1QIL A;  1I4X A;  2F0O A;  4K8J A;  3PO2 B;  1K83 B;  3QG1 A;  1B9N A;  1CFM A;  3K5L A;  3H09 A;  3TBI B;  3VR2 A;  2K05 A;  1OXU A;  3I90 A;  1TS3 A;  1NAP A;  5EKL A;  2J7Z A;  1X3Q A;  3JAM E;  1B3A A;  1STE A;  4XQQ A;  2DY8 A;  1MGS A;  1CM9 A;  2KED A;  1F9S A;  2XWJ B;  5D3I B;  2IT1 A;  3BDC A;  3S15 B;  3RUZ A;  3WOE A;  1DYQ A;  2ZXR A;  1D1I A;  4RHR A;  3S1M B;  1STG A;  3BVZ A;  3GV3 A;  3PUX A;  2RSN A;  2L4N A;  3OPO A;  1UEA B;  1S4Z A;  4PQX A;  1PMR A;  1I6H B;  2FMC A;  2YYZ A;  5I4D A;  4EQP A;  5M3F B;  1PTO D;  4FXD A;  1EIG A;  4JBW A;  3VYT A;  2EY5 A;  3K58 A;  1E2Z A;  1SAP A;  2FFK B;  3DUZ A;  1W6K A;  2BA1 A;  1HTP A;  1TT2 A;  3R8B A;  2JXM B;  2Z4I A;  3MA2 B;  3K6O A;  5CBA E;  2LKV A;  2NBF A;  5G3L D;  4XYO A;  3BZD B;  4C3J G;  3PO3 B;  1NR4 A;  3F2U A;  3OWE B;  2NVX B;  2F0E A;  2O2L D;  2DY7 A;  5FO9 B;  5JEA G;  1BR9 A;  1L0Y B;  3M4O B;  2E76 C;  4OIJ A;  3OW7 A;  2E2H B;  3ERO A;  3PUZ A;  5ELF A;  4XXE A;  1Y8O B;  1SYB A;  4NKL A;  1Q1E A;  5KND A;  4CKB A;  3RD4 A;  3D4R A;  3C46 A;  1HFG A;  1KDB A;  2D62 A;  2KCN A;  3L9A X;  1JOQ A;  2PO4 A;  1PRT B;  4RGO S;  3HOZ B;  2A69 D;  5C4J B;  1CHP D;  3AB9 A;  1EY0 A;  2NN6 H;  1A3T A;  3DHQ A;  2NVY B;  3QIA A;  1UAP A;  3TZU A;  2Z4H A;  1PYW D;  1ROD A;  3DMU A;  3DEO A;  4C2M B;  2WII B;  4QB4 A;  2RDF A;  2A69 C;  5DNF A;  3J7A V;  1CZW A;  2HCI A;  1AEX A;  4S3S A;  4KKT A;  2AQ2 B;  4H7B A;  1FGB D;  4UDU C;  4PV1 C;  3G6J B;  1I4G A;  2LMC B;  1ZYR D;  1U4P A;  5JJZ A;  1KDA A;  1H9R A;  3MFY A;  3LX0 A;  4ZYS A;  2MJ8 A;  1G2T A;  1CT1 D;  4MIU A;  4NDX A;  3KUP A;  1PZK D;  1FR3 A;  4BBR B;  5IGF A;  1LT4 D;  5K5P A;  3ND9 A;  1WD1 A;  4HCE A;  2IX3 A;  1OXT A;  3NPP A;  4PMB A;  1EOT A;  3DEP A;  4FP5 D;  1ZYR C;  2B8F A;  2K33 A;  1LT3 D;  1RD9 D;  1XX8 A;  5J39 A;  1PTO F;  1EY7 A;  4KN7 C;  2F0G A;  3ERQ A;  5DAU A;  2VXW A;  2B39 A;  3CRK C;  4DNT B;  1SNC A;  3FDT A;  2WIN B;  2C5C A;  4TQU S;  2EY2 A;  1EY6 A;  1B2T A;  2E74 C;  4K2L A;  3C2P A;  1LT6 D;  5BN5 A;  5FO8 B;  3MHB A;  2F0U A;  1F9Q A;  2IPK D;  2OEO A;  5G3L F;  3QOL A;  5T1I A;  4RA8 A;  3OMG A;  1BBX C;  2F0F A;  3H3V C;  3Q24 A;  3SE0 A;  1EU4 A;  4C1N I;  1QG7 A;  5M3M B;  1AFP A;  5KNC A;  4ME5 A;  1SYF A;  3S9W A;  4FF2 A;  2PZW A;  2DNE A;  1TWG B;  3R2I A;  1TY0 A;  4ILW A;  2BE5 C;  1H9M A;  2XNA C;  3SK5 A;  4ZKB B;  1GUN A;  1Q90 A;  3CRL C;  3S1Q B;  4H44 C;  4BY7 B;  1JQY D;  4C3H B;  3BYY B;  1HTL D;  1SXT A;  1FNU A;  4HED A;  5EPJ A;  1JR0 D;  3MAQ A;  2F0P A;  3MTS A;  1XYI A;  5C44 B;  1JWS D;  1QE6 A;  1WTP A;  2R93 B;  3GTO B;  1JC7 A;  3A7L A;  3NSW A;  1VCI A;  1JOK A;  4RFB A;  1RDP D;  3V96 A;  1ILP A;  4A3M B;  3V05 A;  1CI3 M;  3NHH A;  2EXZ A;  2NVQ B;  1ESR A;  3X3M A;  2F1M A;  3SXH A;  2WAQ B;  3A7A B;  2HCC A;  3PIO 3;  4ID6 A;  2B2U C;  2FJ2 A;  1EIH A;  2K5D A;  4Y7N B;  1I4Q A;  3PUV A;  1Z7T A;  4BA2 I;  1TWC B;  4KD4 A;  1D5X C;  3NTH A;  5EBC A;  2ZT9 C;  3IL8 A;  1EYD A;  5JPM C;  3LNN A;  4A3I B;  4KHZ A;  3HOY B;  4QCL A;  2NTT A;  4PMC A;  5JPN C;  1ENA A;  3Q6S A;  3MXG A;  2F0K A;  3S16 B;  3GTJ B;  5M5Y B;  2PMZ B;  3NXW A;  4CJ0 B;  5E4W C;  1IL8 A;  2EYH A;  3T4A C;  1CA6 A;  3DWP A;  3SR1 A;  3RLF A;  1DOL A;  2JA6 B;  1AZQ A;  2O5J C;  3NK9 A;  3ND8 A;  3RZO B;  2WKC A;  5FK9 C;  1GHJ A;  1Y1W B;  3A56 A;  1WTV A;  1KLG D;  1J9O A;  2MP1 A;  4C1N K;  3U9O A;  3HGB A;  5E3F A;  1O7Z A;  5AFW A;  4XQN A;  5C6A A;  1ICW A;  1EQV A;  3NBH A;  4H0L C;  2H4O A;  2JEB I;  2VB3 X;  1LAB A;  3EA6 A;  3HP3 A;  1NUC A;  4HAE A;  1JOO A;  2JP1 A;  2IWH A;  5IGD A;  2EYP A;  3E5S A;  5BN3 A;  2QIL A;  1FYC A;  1ET6 A;  1DON A;  5C4X B;  3SVM A;  5I9O A;  1EYC A;  2OXP A;  3HOV B;  1QNK A;  1PTO H;  3IKJ A;  1DXM A;  1G91 A;  4RWS C;  1BCP D;  5DEH A;  2DN8 A;  1EY8 A;  2PW5 A;  4IN3 A;  1LTG D;  1TR5 A;  3SEB A;  3RMH A;  5JEA H;  1YNJ D;  4FF3 A;  5J1Z A;  2XRQ D;  5CV9 A;  1HRJ A;  1ESF A;  3CQZ B;  2ICE C;  5EKI A;  1CQF A;  4ZUI A;  3K5O A;  2NVT B;  2RA4 A;  5C0X I;  4KJN A;  5IGE A;  1F2Y A;  4NP5 A;  5LL6 S;  1YNJ C;  5COR A;  3AU7 A;  5CR3 A;  1HPC A;  2BA0 A;  2K32 A;  4IUR A;  4QUF A;  1PTO B;  5I6W A;  4CBV A;  1D6E C;  1G2S A;  3VR5 A;  2C9O A;  4ODG A;  3N52 A;  1IHZ A;  2M2L A;  4IFD G;  2KUM A;  4EVO A;  1X32 A;  4RKB A;  1VF7 A;  1X3P A;  4Q0F A;  5D3D A;  3NUC A;  3PMF A;  1FNW A;  1OXV A;  4BWG B;  2A5H A;  2QKI C;  2NN6 I;  3S1N B;  3I91 A;  4J1M A;  3R3O A;  4A3D B;  4CJ1 B;  1WTW A;  3QO2 A;  2MGS A;  1HFN A;  1Q12 A;  1IW7 C;  4DK1 A;  1PFN A;  1RF2 D;  1KNA A;  1S5E D;  3J7A F;  3I8Z A;  2VB2 X;  2X6G A;  5F2D A;  4P2C B;  4RHS A;  1G8Z D;  4Q5V A;  2KJX A;  2NTS A;  1JWU D;  4BS9 A;  3R93 A;  3TME A;  4OGQ C;  3MXN A;  3HZX A;  1TWA B;  2XN9 C;  4A3E B;  2O4X A;  2FIN B;  2EYO A;  2HUG A;  1DM0 B;  3ONA B;  1ILQ A;  2F0V A;  2EOT A;  1LTA D;  1D1K A;  1WCM B;  3KLS A;  1O7Y A;  1BCP F;  3PUY A;  2E2J B;  1QB5 D;  4QF4 A;  2PW7 A;  3HOU B;  1DOK A;  2A68 D;  3SDZ A;  3TDQ A;  4PMW A;  5C0X H;  5ELB A;  1IKM A;  1LTR D;  4DGZ A;  4FO2 A;  2XSC A;  2EYM A;  4KKS A;  3C1F A;  4K5X A;  1T5E A;  1HA6 A;  1T5X D;  3SK4 A;  1OXS C;  2A68 C;  2F3V A;  4ZK9 B;  5HUR A;  5COY A;  4N9T A;  4MHE A;  3NWS A;  2KEC A;  3FVQ A;  3PUW A;  3S17 B;  5K36 G;  1SEB D;  4KI0 A;  2F4I A;  2H1E A;  2HDM A;  1STB A;  2K03 A;  4A3B B;  1Y8N B;  2JA7 B;  2LY7 A;  1BDO A;  2CHB D;  1PZJ D;  3DWA A;  2K01 A;  3L7Z C;  2EY1 A;  2TMP A;  5EPL A;  1E2V A;  1Z6H A;  3I4N B;  5C5L A;  3CU7 A;  4RCN A;  3GTG B;  1ENC A;  5KIX A;  4OO1 G;  3P7J A;  4G7O C;  1D2B A;  4IUU A;  4FF4 A;  1ZEQ X;  5CV4 A;  4EQO A;  5M9O A;  3NTI A;  1H9J A;  3LWU A;  4L6T B;  2JE6 I;  1S5F D;  1SNQ A;  1SFO B;  1RTN A;  2K7V A;  1GUS A;  4KHV A;  4RGT A;  4IFD I;  3K59 A;  1IYU A;  1RJT A;  5IOD A;  4PNY A;  4DN4 M;  2F0N A;  1GOZ A;  2VNU D;  1JCK B;  2D5D A;  1JOR A;  3IAY A;  5LL6 X;  3GTQ B;  4CJ2 C;  4J8Q A;  1AW7 A;  1SJH D;  2AUK A;  1A2T A;  2PZT A;  1QWY A;  1EWH A;  1PZI D;  1MSH A;  4IUQ A;  1UNS A;  2BCO A;  3KLR A;  1KTK A;  1TWH B;  2XVS A;  3A8K E;  4KD3 A;  3MEH A;  2XWB B;  4M8A A;  3FEW X;  4OL7 A;  2ZXO A;  2BOS A;  1BNZ A;  1NCV A;  4RAU C;  1SDF A;  4HMJ A;  2KHS A;  1EY9 A;  4BY1 B;  5JEA J;  4IUP A;  1ONL A;  2AWN A;  1TQO A;  4IQZ A;  5E1F A;  4G4K A;  1PRT D;  2I46 A;  2BE5 D;  4KTA A;  1I4H A;  4KV6 A;  1HUN A;  3T51 B;  2BDN A;  3P75 A;  2CQA A;  4KY6 A;  5A2Q L;  2L9H A;  4L63 B;  3ZYY X;  2L1B A;  3X3N A;  5A2Q E;  4A3G B;  2R6G A;  3UI2 A;  1PRT C;  5C3W A;  1A2U A;  4FNF A;  4ABN A;  2LS0 1;  1EY5 A;  2L0C A;  3H91 A;  2B63 B;  2R7Z B;  1DZ1 A;  1R4P B;  4OHJ A;  2IX0 A;  1B44 D;  1BOS A;  3HKZ B;  1H9K A;  2Y0S B;  3QJY A;  1IKL A;  1QJO A;  4CKE A;  1K8M A;  3GQB A;  4B9W A;  1FD7 D;  5JOB A;  3CHB D;  2Q8R E;  4I65 A;  1V1P B;  4F88 A;  4LMQ D;  1EEF D;  5EBD A;  4CGY B;  1EYA A;  4XT1 B;  2G9D A;  4TSS A;  4IFD H;  1JB3 A;  2E2I B;  5M5X B;  1B53 A;  4WFN 3;  3MWY W;  1CZG A;  4UAI A;  1SE2 A;  1BCP B;  5C5M A;  4KKU A;  4YIJ A;  1WVL A;  1Y8P B;  3AMU A;  3P1H A;  2MHV A;  4QIW B;  4V0B A;  3GTP B;  2HQE A;  4K6D A;  3BDO A;  1KAA A;  3NP8 A;  2SDF A;  2IX1 A;  3T56 B;  2L11 A;  3VA7 A;  5IT9 L;  5CBE E;  4LAA A;  4IUV A;  5IT9 E;  3M4Y A;  2CVR A;  1M8A A;  4LK1 C;  1F2M A;  3NQT A;  2F0L A;  1OO9 B;  3SK6 A;  1LT5 D;  5JVG 3;  1R4Q B;  1O7L A;  5TSS A;  5D14 A;  5T1G A;  2B2V A;  4CKC A;  2Q8T A;  2A74 C;  3NTK A;  4J6H A;  4HTH A;  4K2K A;  2JSO A;  5C0X J;  5JVH 3;  4FXK C;  3DXJ C;  3J80 L;  2B2V C;  1FNV A;  3E6Z X;  1V43 A;  1Q8I A;  5C4H A;  3QOJ A;  3VA5 A;  3NE5 B;  3D4D A;  2NYZ D;  1TS2 A;  1TS4 A;  4G7Z C;  3SHL A;  3TP7 A;  1GUO A;  2QDB A;  3TP8 A;  5ISR A;  2B2W A;  4A93 B;  1E2W A;  4FXG C;  2Q8I B;  2B2Y A;  3MXP A;  3KBG A;  3D6C A;  1BXT A;  3I72 A;  1AZP A;  2F0M A;  2F3W A;  2B2Y C;  3S2H B;  1NR2 A;  3TP6 A;  3OOC A;  5IGG A;  1F9R A;  3FRP B;  4QMG A;  3PV0 A;  3M85 A;  1PLF A;  5IIF A;  2K6A A;  4X3S A;  2PZU A;  2HDL A;  4KY7 A;  4R9W A;  5FLX L;  1I4P A;  1B50 A;  5FLX E;  2NB0 A;  3MC0 B;  5I6Y A;  2KQ3 A;  1B4O A;  3NBI A;  5K36 H;  1L0X B;  2B8G A;  3IFD A;  2MPM A;  2TSS A;  3TN2 A;  1GUT A;  1RCV D;  1F9P A;  4C3J B;  1TWF B;  1RTO A;  1LAC A;  1HXY D;  1KLU D;  4RGN A;  2MUY A;  4K5W A;  1IW7 D;  2QCP X;  2EJF C;  2NWG A;  1I50 B;  5ELD A;  3D6W A;  1TY2 A;  4X3T A;  5C4Z A;  2F0I A;  1O80 A;  2WP8 J;  2D2C C;  4OO1 H;  3MZ5 A;  4K8I A;  1HQM C;  2SNM A;  4KK7 A;  4Z9C B;  3MXU A;  4A3F B;  5DM7 3;  3I4L A;  4HN7 A;  5JAV A;  2F0T A;  2QEJ C;  2RKS A;  2X69 A;  5LHY 1;  1JWM D;  1LTT D;  1U4M A;  2K04 A;  4CHT B;  1WTO A;  3NQI A;  5FKA C;  4KMU C;  3VYU A;  1F77 A;  3A8I E;  1SND A;  4ZLT F;  1C48 A;  2AUJ D;  1ZXT A;  1LTI D;  1EU3 A;  3H0G B;  4B9X A;  4HSV A;  3EJI A;  2ID0 A;  4HSP A;  3JAM L;  4ZQ3 A;  1BQQ T;  3H94 A;  3TSS A;  2I07 B;  1A15 A;  2F0W A;  1G29 1;  4DFA A;  3I4M B;  1GHK A;  5NUC A;  1II3 A;  3OWF A;  2WAC A;  2EYF A;  1GXD C;  3GV6 A;  3S1R B;  3BVM A;  2EYL A;  3GP7 A;  5HGT A;  1DCZ A;  2N55 A;  3S2D B;  4E6I A;  4U68 A;  2G9H D;  4C3I G;  2EVB A;  2Z8L A;  3OIP A;  5CV8 A;  1CK1 A;  5BN4 A;  4XYQ A;  4ZUJ A;  5KEE A;  3I73 A;  5IGC A;  1CA5 A;  3M7G A;  3VYR A;  5IOC A;  1XTC D;  3BVG A;  1EL0 A;  1ET9 A;  1SJE D;  1CQV A;  4IFD J;  1PTO C;  5IGB A;  1IYV A;  5DM6 3;  2NUC A;  3G7L A;  3DM1 A;  1JE4 A;  2A6H D;  1Z47 A;  4HMI A;  3GD7 A;  4R8I A;  1NSN S;  3D4W A;  3HG9 A;  1LV9 A;  3OIQ A;  1WD0 A;  3HS0 C;  1SMY D;  2J4X A;  3FPU B;  1O78 A;  1HQR D;  5EKK A;  4O42 A;  5KYI A;  2QF7 A;  1QCB D;  4WRD A;  3GTK B;  3VR4 A;  4B08 A;  2A6H C;  2D9U A;  4DXF A;  3E0J A;  4EGV A;  3K0Y A;  4R8N A;  3EFX D;  4TRD A;  5EPK A;  1SMY C;  4DAY A;  1KAB A;  5FOB B;  4X3K A;  1QNU A;  1GUG A;  1Q3L A;  3HEJ A;  2K28 A;  1BO0 A;  4NMZ A;  5KRU A;  4DF7 A;  4BBS B;  2L55 A;  4K6L A;  2RDH A;  5I2Y A;  4FVM A;  4AYB B;  1Y1V B;  4K5V A;  2O5I C;  2F03 A;  1F2Z A;  2RBM A;  4U67 3;  1LTS D;  4XQJ A;  3W3A A;  2EJG C;  1STA A;  4XIG S;  3HOW B;  4DA2 A;  2PQE A;  4NW2 A;  1ENF A;  1SE3 A;  1EZ8 A;  4ULL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...