5KRUA

Crystal structure of staphylococcal nuclease variant delta+phs t62e/v66k at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
132
structure length
132
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFEKKMKENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62E/V66K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 37
structure length 132
sequence length 132
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5kruA00
3OMCA 5CV8A 5NUCA 2LKVA 2F0SA 3OSOA 2F0DA 1STBA 5JAVA 5CGKA 3NXWA 3D8GA 2HQEA 4HTHA 1EY9A 4ODGA 3V2TA 3S9WA 4EQOA 2PZWA 4KTAA 5CC4A 1A3UA 2EYFA 2M00A 5EKKA 5IODA 1SYBA 2O4XA 5IGEA 1KABA 2F0VA 5ISRA 2F3WA 3E5SA 3HZXA 4IALA 4B9WA 2WACA 2EY2A 1EYCA 1STHA 2EY5A 2EYPA 3R3OA 4ZUIA 4K2KA 1A3VA 2EYMA 4B9XA 5IGGA 3NP8A 4NKLA 1STAA 3BDCA 3DHQA 3OMGA 2F0GA 4KY6A 5K5PA 4LAAA 4EVOA 1SYEA 1NSNS 1EYDA 1II3A 2F0OA 4KJOA 4QMGA 3EVQA 2KHSA 3MXPA 4S3SA 2F0LA 2F0WA 3PMFA 3BDLA 5J22A 3MVVA 3U9OA 5C3XA 5EGTA 5F2DA 2F0FA 3H6MA 5CV6A 2PW5A 4NMZA 2OF1A 1IHZA 4K2LA 4ID6A 3T13A 5I6WA 1KAAA 5IGBA 4PMCA 4K6DA 5KYIA 1EZ8A 3SR1A 1SNCA 1KDBA 5C3WA 4OL7A 2F0PA 4KY5A 1JOOA 4QF4A 4E6IA 2F0EA 5C4ZA 2OEOA 4ME5A 3D6CA 4ZQ3A 5C5LA 4G57A 5HGTA 2F0UA 3QB3A 1F2ZA 5KGUA 1SNOA 4EQPA 4DGZA 2RKSA 1NUCA 1SNDA 1TR5A 3D4WA 3HEJA 4PNYA 2EYHA 1AEXA 2KQ3A 2F0KA 4HMIA 3EJIA 3P75A 4RKLA 3SK5A 2F0MA 2F3VA 2OXPA 3T16A 3MEHA 4N9PA 1KDCA 2QDBA 1KDAA 3EROA 3TP8A 3MZ5A 2F0NA 4NDXA 1SNMA 2EY1A 1STNA 2EYLA 3TP7A 4RKBA 4DU9A 4K5VA 5IGFA 1EQVA 3TP6A 1EYAA 4F7XA 1JORA 5EKLA 5HURA 4EQNA 3C1FA 4HMJA 3OWFA 5IGDA 2F0HA 5IOCA 2PYKA 2EYOA 4NP5A 5JOBA 5C4HA 3ERQA 4MIUA 1EY0A 3NHHA 1EY8A 3SK8A 5KEEA 1U9RA 1A3TA 4K8IA 4KHVA 2SNMA 1SYFA 2F0JA 1EY6A 1SYDA 1TQOA 3NK9A 4K5XA 1SYGA 4QB4A 3QOLA 5C6AA 5KRUA 5CV7A 1F2MA 3QOJA 2PZUA 5IIFA 5CV5A 3D4DA 4KV6A 2RBMA 3ITPA 4F8MA 5I9OA 1STGA 5J39A 5IGCA 4YIJA 4KD4A 4TRDA 4DF7A 2PZTA 5CV4A 4J1MA 1F2YA 1A2TA 1SYCA 4KD3A 2F0TA 1JOQA 1RKNA 4PMBA 4WORA 2F0IA 2SNSA 5DAUA 2F0QA 3C1EA 5C5MA 4I65A 3SK4A 1TT2A 3SXHA 3NQTA 3MHBA 2PQEA 4WRDA 1SNQA 4DFAA 3RUZA 5I9PA 2RDFA 2PW7A 3NUCA 5DEHA 5E1FA 2ENBA 3LX0A 1ENCA 1A2UA 4J6HA 4KJNA 5J1ZA 5I6YA 5KIXA 1EY4A 5KYLA 2EY6A 5CV9A 1EY5A 4IUNA 2EYJA 3DMUA 4K5WA 1EZ6A 3SHLA 1JOKA 4H7BA 4K14A 3P1HA 2SOBA 3SK6A 3TMEA 3TP5A 3VA5A 4N9TA 4R8NA 1EY7A 5E3FA 2EXZA 1STYA 4IZ8A 5CR3A 4ZUJA 5M9OA 1ENAA 1SNPA 4K8JA 2NUCA 4KY7A
chains in the Genus database with same CATH superfamily
1F77A 1ICFB 3OYYA 3E6ZX 4M1UB 1Q81C 1BBXC 1I4RA 1S5ED 4KTAA 1YVCA 3KF6B 2HD3A 5EKKA 2EYFA 2K50A 2YTXA 2KCTA 1M1KC 2MO1A 3A0JA 4GS3A 1FGBD 4K6LA 3L0OA 4JI4Q 2D62A 1WTWA 1QVFA 1LT5D 5LMNW 2K32A 1HTPA 2ZM6L 1GUSA 1PH8A 1VS0A 5KNBA 2F0OA 4B3TQ 5LMUQ 4S3SA 5FO8B 1VQKA 4FF4A 2Z6KC 4HIOA 1AW7A 1PH1A 5I6WA 3HOWB 2L0CA 4QUFA 4PZ7A 3PGZA 4GNXC 1C48A 2E2HB 1B3AA 1SNOA 4LF6L 2IY5B 3S2HB 2TMPA 4PNYA 2Z8LA 1TKWB 4O2DA 1A63A 1XTDA 2TSSA 2OTJA 4X3KA 5IP9H 1STNA 5EQ0A 1VQNA 1EEFD 2HIXA 5G3LF 2E2JH 2VY3A 1O7YA 4ZLTF 4L8JA 3RLFA 4HR7B 1BCPB 4LFBL 3HGBA 4DR6Q 3I4NH 3G71A 1CT1D 2B2TC 2B63B 2WAQG 3HKZE 5D3IB 2A6EC 2NN6G 4CDCC 1HNWL 3AFQA 2ZJQA 1VQGA 1F2MA 3J7YW 1H9KA 2EOTA 5FKAC 2CFMA 4X3TA 4DV7L 2E5LQ 1CHQD 2WAQE 3GD7A 3TRZA 3RZOB 3TQYA 5IP7H 1PZJD 2CQOA 4DR5Q 4JI0L 4O0AA 1SXTA 1QVCA 3R2TA 2VNUD 5ELNA 4IO9A 3MTSA 1YNJD 1U4RA 1M90C 1X32A 4OO1G 1HA5A 1ENAA 2DY7A 1D6EC 3IRBA 2F0SA 5CGKA 3U50C 2BH8A 4MHEA 1W3SA 4ODGA 5JJKA 5M5XH 3QO2A 2I5HA 2V1CC 5EBCA 2LS01 4GLVB 1SDFA 4IALA 1CZGA 1BBWA 1FL0A 1BF4A 2EYMA 1Z47A 1F2LA 2JK8A 2RHQB 2AQ2B 1EU4A 2LXJA 4ALPA 4KJOA 4N8FA 4CKEA 2RDGA 4DV6L 2K75A 1CHPD 1HZ9A 5DM73 4B3ML 3S2DH 3HOWH 3GTQH 5CV6A 1ZKOA 3TSSA 3K7AH 4DXGA 3Q8DA 4OL7A 4LW1A 2IL8A 1AH9A 2XWBB 1G291 3A8KE 4DR3L 1V1QA 1BQQT 4EX5A 3I4MH 4BBSG 3GTMH 3J81E 2EYHA 1MSHA 2F0KA 4OELB 1IZ6A 2A6ED 5M3MB 1TWHB 3CRKC 2A68D 3CC7A 2QDBA 2NTTA 1HHVA 2YU9H 1Z7TA 4OONA 1SFOH 3HOUH 3D31A 4N8X1 1SN8A 1HNZQ 3G6JB 2R93G 1MI2A 3TS2A 1LTBD 3U58A 2MHVA 1W6JA 1GHKA 4DV5Q 4BXXH 5LMNL 4WFN3 2C35B 2A74C 4UPAA 5M3FG 3QOLA 4LUOA 4DV4L 1YNJC 2H5XA 2IHEA 3F2UA 4LF8L 1EQTA 5A2QE 1X9NA 5CV4A 2UUCQ 1IXRA 4DR1Q 2F0QA 3E9HA 2CW0C 1XMQQ 1N36L 1E1OA 4J6HA 4G4KA 1EY4A 2GVBA 3S16B 1HFGA 3FKIH 4XDXA 2WV6D 3AB9A 4QUCA 1O7IA 3T4AC 3EFXD 3VYRA 4L5TA 1BNZA 1LTSD 2Z4IA 3MXNA 1K73C 1TWCB 4CHTB 3GTKB 2HQEA 2R3ZA 2N49A 1I3QH 4IOCA 3FEWX 5IGEA 2JN4A 1PMRA 4NXNL 3UE1A 3HOXH 3H0GB 4LF6Q 1H9RA 1WTPA 1C9OA 1OXXK 4LAAA 1VQIA 2RCFA 5C3EB 4A3CH 1TWGH 4GLXA 3HFZB 1D1IA 1QILA 4UP8A 1A8VA 4JG2A 1VQ8A 1LTID 1M8AA 3I70A 1CSQA 3I72A 1CKMA 4YCUA 2JA5B 4YHHQ 1NMFA 4RH6A 2B2VA 3EA6A 3G4SA 2YTYA 1JICA 1R4PB 1GUGA 4JI4L 4DR2Q 1LV9A 1E1TA 2Z1CA 5DLQE 4A3DG 1PVOA 2JYOA 3MEHA 1S40A 4JI7Q 4LJZC 1QZHA 4POFA 1Q1EA 4NDXA 4JI2Q 3H3VC 1I6VC 4KI0A 1IBKQ 3A8JE 1Y1WG 1V43A 4AYBG 4DUZQ 1H9JA 1X55A 1CA6A 4EQNA 5M3FB 2FFKB 1D1KA 4RG1A 4PMWA 2XGTA 1B4OA 4HN7A 1YNNC 3NE5B 4OIKA 4QJFA 3HOUG 3H09A 3SE0A 1QUQB 3CCSA 4LF5Q 4F87A 1VQHA 1JQYD 3M4QA 1KRTA 3SDZA 2PZUA 5IIFA 5I9OA 3D4DA 1YHBA 1OXSC 3IFDA 2Q2HA 4LK1C 4DF7A 4ILWA 4R8IA 1T5XD 4DAMA 2B2WA 4CJ2C 3D0FA 1SMYD 1Z6HA 3SVMA 4AQYQ 4LFCQ 3I90A 5KRUA 1SFOB 5FLXE 2F4VL 3S2HH 4RAUC 1YJ9A 2AHOB 1PTOD 5KYLA 2WB1E 5CV9A 1CZWA 3C2PA 3SHLA 4C3JG 4DR4L 4IPHA 2SOBA 1F9PA 5IWAQ 2XVSA 3DXJC 5JEAG 2Z0SA 2WAQB 4BY1B 1X3FA 4KKUA 5C4XH 1DM0B 5D3DA 4DV2Q 4KHZA 1ZEQX 4H0LC 5IYBH 1YNXA 1L2FA 2NBFA 1PH9A 1RDPD 5C4XG 4B3MQ 3W3AA 4HJ7A 3HRZC 3S1NB 5ELOA 3R3OA 4L63B 2XIWA 4JOIA 3D4RA 3FMCA 2Q8TA 2KECA 4IUVA 3S1NH 2NB0A 2VXWA 2E2DC 1MKHA 2D5DA 3UI2A 5IT9L 3DEPA 2JJQA 5C44G 4PZ6A 5F2DA 1BCPD 1Y14B 1HFNA 5IGBA 3T13A 3RN2A 4PMCA 2ICEC 4GNXB 4XTCS 2JA5G 3NQIA 1V1PB 3RR5A 4ME3A 3A54A 3CW2C 4R4TA 2Z4HA 1ZYRC 2H1EA 4EQPA 1SNDA 3STBD 5GAGC 2BCOA 4RFBA 1K8MA 3RZOH 2H4OA 2ALYB 4IJLA 1MGSA 3KLRA 4DNIA 3X3MA 1BCPF 1SE4A 2PI2A 2F1MA 3JAML 1D2BA 3G6EA 1TU2B 3NTIA 1LTRD 2PNHA 1B3QA 1L1OC 2AWNA 2NVYB 5IGDA 4TVAB 4JI8L 1B50A 4NP5A 5JOBA 2DN8A 1I5FA 5C3EG 4KK7A 1R4QB 3ERQA 5JVG3 1U5KA 3FPPA 1HJPA 1SYDA 1TQOA 4K5XA 3AEVA 3W5OA 4DR7L 2LXKA 2LY7A 1W6KA 1N36Q 4LF4Q 3IAYA 3K6OA 2N55A 1V9PA 3NTKA 1HZCA 4XQNA 4JPBW 2PPBC 2NVTB 5C5MA 2EQSA 1H9MA 4LUZA 2NYZD 5DEHA 4XT3B 2CWPA 1VQ9A 1DGSA 2WIIB 5LMNQ 1HTLD 2EY6A 4JI6Q 1Y1WH 1JOKA 4H7BA 3VA5A 3N6RA 1RCVD 3FHWA 1B70B 4H13C 2XWJB 2UU9L 1QOHA 4HEDA 1G8ZD 3VYTA 4BBSH 3S1MB 2DNCA 1YHAA 4A3IH 1RODA 2IX1A 1D8LA 1ASZA 3H91A 3NXWA 4DR7Q 4EQOA 4DV1Q 1DD2A 1A3UA 2O4XA 1K28A 2V4DA 2EY5A 4K2KA 4A3KG 3EN2A 3NP8A 5K5PA 3BDCA 5IYDG 2F0GA 1ZYRD 3BZCA 3M7NA 1OXTA 1CI3M 1K83B 3S14B 5M3MG 2F0WA 4AH6A 4BA1I 5M5YB 3OIQA 4FP5D 3I2ZA 3FDTA 4OX9L 2Q2TA 2F0EA 1Y1WB 2KA7A 2R7FA 3I4MB 1EIGA 2JA5H 1BBUA 1TWAB 5IWAL 4ABNA 2UUBL 3GTOH 3KBXA 2A6HC 2RQXA 4UAIA 5FLXL 3M4OH 2EY1A 4C2MB 2WB1B 3FKIG 4R1JA 3EBEA 1WTHA 1JJGA 3CC4A 3DWQA 4AQYL 2F0HA 3GTGH 3OPOA 2EPBA 1KNEA 1H9SB 4UHVA 1O7ZA 3SGIA 1EWHA 4KHVA 1SYFA 2JA7B 4JI0Q 2WINB 1SYGA 3NPPA 4A3MB 3GTKH 5CV7A 4RGOS 5COYA 4DV2L 1P8LA 2N3SA 4BBRB 4TRDA 2A69D 1VMCA 2QEJC 1CKOA 4XYOA 1LT4D 4DAVA 3I4NG 4NB3A 1JWUD 3WOEA 2I07B 1QCBD 4G7OC 1HR0L 5HGQA 1HH2P 2AKWB 1GHJA 3NUCA 5EPJA 1A2UA 1XPRA 4ZKCB 1GUOA 3HKZB 1EY5A 1PV4A 4EGVA 3TP5A 4P74A 3S16H 4LFCL 1TVXA 1UNSA 1ILPA 1SNPA 3UDXA 3J7AF 5C44B 4C3JH 1PH7A 2UU9Q 5BN3A 2MPMA 1PH3A 4JBKA 1YEZA 4A3JB 3FRPB 4B3RL 2ZXOA 4U68A 4X6AH 4FDBA 4C56C 1K8AC 4HTHA 5ELDA 2OT2A 3H94A 3NWSA 3ONAB 4H02A 5ISRA 2P5ZX 2RCNA 3M9BA 3AMUA 2JA7G 2EYPA 1EIFA 2B2TA 4JVZA 5CYUA 3VR4A 2K7VA 2XTIA 3VR6A 2YV5A 2E76C 5GQOA 2J4XA 2NWGA 1ICWA 1M4VA 3MXUA 1XNQQ 3A74A 3I55A 3MVVA 2R92G 5C3XA 2XRSD 2QEXA 3BDOA 4DKAC 3T56B 3W1BA 5EBDA 4HSPA 2HDMA 3T1HL 2OF1A 1PRTD 1WD0A 2PO4A 3CCRA 3RZDB 4K6DA 3SR1A 1SNCA 2MNAA 1EWCA 1RD9D 4QF4A 1LUZA 1IBMQ 1IL8A 2JA7H 3D6CA 4DV0L 4ZQ3A 2F0UA 5KGUA 2FXQA 2XSCA 4XQJA 1PH5A 1K9MC 2OWOA 4C1NK 1QNUA 1S3OA 2OXPA 1KDCA 2I46A 3GV6A 4UDUC 4Z9CB 4X62L 2J7ZA 4C3IG 5IGFA 1IW7D 1BCPC 1TS5A 3M4OB 1JORA 2L12A 1I4XA 2HCIA 4A3FB 1WVLA 5IOCA 1GUWA 1O80A 5JJZA 2HUGA 1E22A 2F52A 3GTGB 1EFID 3MEFA 2I0QA 1ET6A 2K5HA 3I4NB 1C4QA 1BUVT 2IX0A 3A8IE 3FPUB 3IL8A 5BR8Q 2HQLA 2PQAA 1JJ2A 4RMFA 1F9SA 5CV5A 4LF9L 1YIJA 2ZJPA 1VQ6A 3PUYA 2A73B 1KLGD 2JEAI 2LMCB 5E7NA 1T5EA 2KOLA 1UE6A 4ULLA 5E1FA 3QG1A 3S1QH 1TS4A 5J1ZA 5C0XG 4XIGS 1VQ4A 4POGA 5JJLA 1VQ7A 3FVQA 4A3FG 1XWEA 2G9HD 2ZTCA 4DR1L 1STYA 1GXDC 1LLRD 4IZ8A 4X66Q 3U9SA 1HUMA 4NXMQ 1PHJA 1LTGD 3GTLH 1JJCB 1KXLA 3HKZG 5GAHC 2VQEQ 1DOKA 1TXYA 2I5MX 4J8QA 3OTOQ 1TY0A 1FJGL 2PQAB 3RD4A 4DUYL 1PRTC 2O5JC 2FHTA 4LUVA 3H0GH 4P72A 2F03A 1PTOF 2B2UA 2BE5C 4BY7G 1CQFA 4X64Q 1STAA 3L7ZC 4IPCA 5IP9G 4L5RC 4EVOA 1NJIC 3R93A 4A75A 2X6LA 1UE1A 4HIDA 2HHHL 3J81j 1J9OA 2NVYH 2NVTH 1Y8PB 4GN5A 3OW2A 5EGTA 1UAPA 1N33Q 2I5LX 3DLLA 1SLJA 3ULPA 2B2VC 4U673 1I50H 3QIAA 2UUBQ 3I4LA 1JOOA 4IN3A 3HOXG 3FKIB 2ES2A 1NBWA 4ME5A 1E2WA 5C5LA 5D14A 2EXDA 2JA8G 5J3BA 1IBKL 1B44D 3DUZA 4XXEA 5AJ3L 2OQ0A 2A5HA 1KTKA 1X65A 3TP7A 1LM0A 2B2UC 2CHBD 4R9WA 2IPKD 1E24A 4A76A 4A3GG 4FXKC 2D9UA 3D3RA 2PYKA 3H3VH 1DZ1A 3CCVA 3GTJH 3HOZG 1LT6D 4LF9Q 3OHXC 1U9RA 1N34Q 4DK3C 1HNWQ 2SNMA 5E4WC 5C6AA 5BR8L 2B63H 4HCEA 1EQQA 3MXNB 3JC66 4QCLA 1AE2A 1NY4A 5M3MH 1QZGA 3HOYB 2IHFA 4YY3Q 1SJHD 2EIFA 1EYGA 5T1GA 3VR3A 2BE5D 2G5DA 5C0XI 3PF5A 3TMEA 2VQFQ 2VUMG 1HXYD 1L0XB 4DPGA 2FMMA 2KEEA 1C7YA 2DJGC 1RIPA 1CKNB 3KLSX 3PCOB 4A3GH 2F0DA 1UEBA 2GA4B 4JV5Q 2PZWA 1G2TA 3VYSA 3HOVG 1S5CD 5ELBA 4B9WA 4PV1C 1PDQA 5HY6A 1PTOB 5EKIA 3HP3A 3EVQA 4A93B 1QJOA 1TIID 1BVSA 3CQZH 1PTOH 1CSPA 1Y8OB 1Q7YC 4FXDA 1N34L 3T1YQ 1JWMD 3PSIA 3CRLC 1EZ8A 4X65Q 2VZAA 3CF5A 1GVPA 2VS1A 4WJWA 4IUQA 5JEAH 2OEOA 5JEAJ 3QB3A 1QG7A 2FJ2A 3Q23A 4X64L 3V96A 2K5VA 5EPLA 4A4IA 1UEAB 3CP0A 3T16A 4QY7A 2CVRA 4N9PA 2GVAA 3WOFA 1Q90A 1X3GA 3EROA 3TP8A 3BVMA 2L55A 4OO1H 3TP6A 1G51A 4DR3Q 1GOZA 1PZID 2AWOA 4YCWA 2EYOA 3PO3B 2C5CA 1BOSA 5KNDA 5A2QL 4MIUA 4FYDA 4OIJA 3KF8A 1N33L 1U4LA 1VQLA 3I73A 2HHHQ 2UXCQ 1K0RA 1Q46A 4J1MA 4JI1Q 3S14H 1SE3A 3KBGA 4WORA 1XYIA 2Y0SB 3QJYA 5LHY1 4A3BB 1RF2D 1B9NA 3LX0A 3C3LA 4LF7L 3DWPA 1XTCD 3LNNA 2EYJA 1FJGQ 1X3EA 2F4VQ 4K5WA 2IWHA 1KLUD 1E7ZA 3P1HA 3VR5A 4CDFC 3HOWG 4A3LG 4N9TA 5M9OA 2NUCA 4YWMA 4DN4M 3J81i 4A3FH 3CD6A 2BH2A 3CC2A 2JA8B 1STBA 3P7JA 2Z9HA 2PI2E 3NELA 1PRTF 5L37A 4EQ5A 3S1MH 3D8GA 4C3HG 3ZYYX 1CA5A 3J81L 1VQMA 2D0PA 3NENA 4GN4B 4A3JH 1NMGA 2LSSA 4NW2A 3HOXB 1V1PA 3OW7A 1VQCA 1C0AA 3K5MA 4JI5Q 2WACA 2EY2A 4CDDC 3PF4A 1A3VA 1XMOL 4JI3Q 1G91A 3OMGA 4XYQA 4KY6A 3K8AA 1I6HH 5FLMG 3PMFA 4ZRZA 1J6QA 3GTPB 1YBYA 4A3MH 1EL0A 4JI7L 1L0YB 1MJCA 4FXGC 4OWXB 3K58A 3JAME 1JB7A 5IYCH 4IFDI 2E2HH 4QQBX 1A62A 4LFBQ 5C4ZA 2Y0SE 1N32L 1S5DD 1SSOA 2RKSA 4RHRA 2VQFL 1LYLA 1E3PA 4IPDA 4TQUS 3SK5A 3P75A 2MFIA 2R7ZG 2F3VA 4JI6L 2YTVA 1R9TH 1F9RA 4A3EG 1WYDA 3J80E 2NN6H 4IUUA 1R9TB 1XPUA 3HKSA 5HURA 2R7ZH 4C3JB 5I4DA 3HOZH 4A3EB 3RMHA 5GROA 1DCZA 5G3LD 3SEBA 1FNUA 3CPWA 3LWEA 3JAMc 1QE6A 4ZYSA 2L4NA 1QWYA 4KN4C 3KJOA 1EU3A 3S17B 2PMZE 3I3CA 4F8MA 1XNQL 3A7LA 1BKBA 1Y69U 2ZTDA 2R93H 3PUWA 4JOIC 2CW0D 2L11A 1HNXL 5ELCA 3BVGA 1ILQA 4R4CA 3HOYG 3CQZB 4DFAA 1J5EQ 5I9PA 3EIVA 1SAPA 3RLOA 3G48A 3VDYA 1I4HA 1ZXTA 4O42A 3UDGA 4IUNA 1ML0D 2BDOA 1PFMA 3T51B 2KCCA 1Q12A 3E3XA 2EXZA 1SRUA 2R6GA 3U4ZA 2JA8H 1SBBB 1GO3E 4GOPC 4LNQA 3HOZB 2WKCA 1U0LA 3F2CA 1LTLA 3LGJA 3J7AV 4A3GB 2CH4W 5IODA 2OQKA 1KABA 1OTCA 1KQSA 4GKJL 1QB5D 1Q8KA 4GN3B 3F2BA 5IGGA 3BZDB 4G7ZC 4P75A 4DAPA 1NSNS 1D7QA 2LFNA 3GTPH 2Q8IB 2KHSA 5I2XA 3NBHA 1LABA 1J8IA 3L3OC 3F8TA 1IBLL 2K04A 2PW5A 3ND9A 1KAAA 2KUMA 4HIMA 4IFDH 5CBEE 1CK1A 3IKJA 2L9HA 3X3NA 3C46A 3GTMB 1XNRL 5HGTA 4NXML 2JSOA 1BO0A 4APVA 4X66L 1JE4A 4DGZA 3I91A 1TR5A 4P2CB 1I4QA 1AEXA 2KQ3A 1KRSA 4HMIA 1GUNA 2DGYA 1CTMA 2EZVA 1WTXA 3A56A 1KDAA 1IBLQ 4BY7B 3MZ5A 2F0NA 4KLKA 2K01A 1Y1VG 1QUQA 1DOMA 3PO2B 1JWSD 2EJMA 4Y52H 2ZJRA 5ELFA 1WI5A 2GN5A 2E2IB 5JVH3 4C3HB 2B2YC 4OX9Q 1DJRD 4HJAA 3P20A 4C3IH 4RCNA 4FO2A 5I2YA 4IFDG 3E0JA 4QIWB 2NVXH 1NNXA 1ENFA 5M5XB 3GDEA 4RCOA 1BDOA 4LMQD 1Q86C 1K8OA 1A2TA 1K83H 2OTLA 4H44C 3GV3A 1OO9B 1Q8IA 2F0IA 2EDGA 3FP9A 3CCQA 1TT2A 2RF4A 2PW7A 2FMCA 3PUZA 3J80i 4JI2L 1CQVA 4DV3Q 3DM1A 1Z9FA 3MA2B 5KIXA 4DR5L 1J5EL 2N78A 3S1RH 1E2ZA 1JR0D 5IY0A 2R92H 5C4XB 3MC0B 1KC8C 3M85A 3D6WA 3M4PA 4X3UA 2G9DA 1S72A 4RWSC 1IYJB 1IYUA 2UXDQ 3PO3G 4FF3A 2F0VA 5ELEA 1TY2A 3RLNA 1FGUA 4ZUIA 1KAWA 4NKLA 1OXVA 2BA0A 3J7A5 1EYDA 3A55A 3A7AB 3PV0A 5J22A 1HCZA 2BDNA 3TREA 1BR9A 3CCJA 1HUNA 1EEID 2K5WA 3CCMA 1N8RC 3J80c 5IYBG 5LMUL 1EIHA 1IL2A 3B6YA 3QWNA 1FR3A 5FO9B 3ICEA 4Q5VA 4G57A 3STBC 4DV0Q 4JI3L 5C4JB 1XMOQ 1IBML 3DM3A 3N52A 4DAYA 1BXTA 4RKLA 2F0MA 1S5FD 3CXCA 4OEMB 4OHJA 4DV3L 1SNMA 3WDNA 2A68C 2CCZA 1H9SA 4HCSA 4BY7H 4LWCA 2R61A 1AP0A 1FYCA 1PLFA 3TEHB 2ZXPA 3KF6A 2K5DA 3NBHB 1T9HA 1L0WA 4AYBE 2HT1A 2B2YA 4J15A 1WFQA 2VL6A 3J7ZC 3SK8A 5KEEA 4DV4Q 2UUAQ 5EPKA 4A3IG 2NVQH 2B39A 2EJGC 4V190 4JYAQ 3NWTA 1STGA 1X3QA 4DV5L 1WTVA 3HOYH 4PG3A 1DYQA 1STEA 1SYCA 2B3GA 3TDQA 2K52A 1NAPA 2QDLA 3W1GA 5FLMH 3K0XA 2UXCL 2N88A 1PFNA 5C4JH 1SNQA 4Q0FA 2B63G 3OWEB 1D5ZC 1YJNA 2XNAC 1VQOA 1TWFB 4BBRG 1EWIA 1GM5A 2K4KA 2MP1A 3CCUA 1TS3A 3AYHB 2UUAL 4LF7Q 2JA6H 3TZUA 5CBAE 3H0GG 5D65A 1FVIA 2VQEL 1TWFH 3RNUA 2BOSA 3CPFA 4JBMA 1KL9A 5CR3A 5FO7B 2WB1G 4K2LA 2XN9C 4F88A 3A5UA 2JXMB 2XRQD 3G7LA 1HZBA 1Q1BA 5JPNC 3VA7A 3KLWA 2JP1A 3TZDA 4FF1A 1LACA 5K36G 2DNEA 2DY8A 5DNFA 1D5XC 3KDFB 1AZPA 1EYCA 5CMDA 3S17H 2IT1A 4B9XA 4CKBA 1MD2D 1MBYA 2MO0A 4KKTA 1MHWC 3F2DA 3K81C 1WCMH 3HOVH 3KLSA 4CGYB 1I4PA 4QMGA 2F0LA 4BS9A 3PIOA 2CH4A 1TWGB 4KN7C 4LF5L 2AUJD 5KYIA 1XPOA 1VQ5A 2F0PA 4CKCA 2MJ8A 3HG9A 1QNKA 2KHJA 4KMUC 3K7UC 3ER0A 1EIYB 4CDEC 4DUZL 2KENA 1VQDA 3HEJA 1SJED 3S1QB 1S5BD 4P73A 4WJ3M 2J0TD 1YJWA 1PXUA 1LTTD 4DU9A 2KVMA 2HIVA 3BG3A 1I6HB 4DAYB 1JCKB 4PZ8A 3C1FA 4C2MH 1ASYA 3CKIB 3CU7A 3JAMi 2Q8RE 1P16A 5C4HA 1VQPA 4WJ4A 3VYUA 2UXBQ 2NVQB 1B2TA 1CFMA 1VQBA 5IT9c 2R7DA 1AZQA 1YNND 2O2LD 2Q2UA 1QVGA 1V1OA 1UWVA 2F0JA 1WJJA 3GTQB 1PFBA 1EUJA 1XMQL 1SROA 1KD1C 2UXBL 3O13A 4KD4A 2D0OA 3F1ZA 4ZAIA 1NCVA 1F2YA 3PUXA 5C3EH 2RVLA 1Y8NB 4QIWE 1UE5A 4HJ5A 5FJ8G 1B1ZA 2SNSA 2Y0SG 4GZYC 4NXNQ 4IUPA 1SMYC 3NBIA 1VDZA 3GO5A 2UXDL 1SEBD 5LL6X 2F3IA 1AFPA 3S1RB 1NR4A 5C0XJ 4IJHA 4P71A 4Y7NB 1PTOC 3WWVA 4G7HC 1HZAA 5E3FA 5FOBB 2EE1A 4UY8C 3RZDH 3KFUA 4A3DB 1D5MC 3CCEA 1N32Q 4MZ9A 4GOPA 1HNZL 3S9WA 3GTLB 1Y1VH 3K57A 1JE5A 1FNWA 1B8AA 2Z6BA 3M3YH 2FINB 1WD1A 1K0SA 3E5SA 1PRTB 2F3WA 2NN6I 3I7FA 1STHA 3HS0C 4OO1I 2WFWA 1VF7A 3CCLA 1CM9A 1SE2A 2KHIA 2Q2IA 4LF8Q 3BVZA 3ND8A 5DM63 2F0FA 3H6MA 3PO2G 4FF2A 2QF7A 1E2VA 2A69C 1KDBA 1EFWA 2ZXRA 1I94L 4E6IA 1GUTA 1RTNA 2D2CC 5M5WB 5KNCA 4A3MG 3I8ZA 1SR3A 1PH2A 4A93G 3NSWA 4BWGB 1NUCA 3D4WA 4GNXA 1FD7D 4DR4Q 4RA8A 1MJEA 1Q82C 4BY1G 4A3BH 4AIMA 2E74C 1NTGA 3NEMA 1KNAA 3K5OA 4LFAL 3OIPA 1DONA 3AQQA 2E75C 1HA6A 1PYSB 3GP7A 1O78A 3T53B 1I94Q 2L5TA 2VUMH 3M4YA 5AFWA 1EY0A 2Z6KA 1EOTA 4TSSA 4BA2I 3MAQA 2E2IH 1IKLA 2A1AA 4K8IA 2VUMB 1EY6A 3I4MG 2JEBI 1JMCA 1JB3A 4OWTB 2RDHA 2B8GA 3L2PA 4R4QA 1JOQA 4YCVA 1G6ZA 2PMZB 4UP7A 4A93H 5DAUA 4BXXG 3C1EA 1AE3A 1U4PA 2JQOA 4WRDA 2CWAA 3NTHA 4GKJQ 3AFPA 1O7LA 4FVMA 3KJPA 1YITA 3BS1A 1HQMC 4ZCKA 1I4GA 2KBNA 2ZT9C 4R4OA 4A3KB 4K0KL 4DA2A 2NTSA 3I56A 1EY7A 1I50B 4ZUJA 4DK0A 2E2JB 4I65A 4KY5A 3TS0A 1TWCH 4BBSB 1X56A 4YHHL 4X65L 2K5QA 1X3PA 2M2LA 3W2DA 2NVXB 5CC4A 2M00A 4GLAC 3K59A 3T1YL 2AUKA 2QKIC 4RGTA 4XQQA 2QW7A 1X6OA 3GTOB 2IJ0A 2L1BA 4GOPB 3HOVB 3R8BA 2K03A 3DHQA 2NZOA 4UP9A 4L5QA 5BN5A 1RJTA 1II3A 5IT9E 4OWWB 5H1SE 3MXPA 1KHIA 2R7ZB 3BDLA 2K05A 4X62Q 1IKMA 1WCMG 3K0YA 3URYA 4IFDJ 4NPSA 4NMZA 4V0BA 1SE8A 1LT3D 1HR0W 1B9MA 3J80L 3S2DB 3BJUA 4MNOA 4DR6L 4DR2L 4B3TL 3PIPA 4B3SQ 2HCCA 4JI8Q 2E8GA 5CORA 4B3SL 4KKSA 4R4IA 5E4XA 3UDFA 4C1NI 4JI5L 3MWYW 3KOJA 3EJIA 1A0IA 1RHPA 3K5NA 1L1OA 5TSSA 2CQAA 2B8FA 4KHPQ 2A6HD 2EYLA 4RKBA 2ICIA 4JK1C 5M3FH 4K5VA 1YHQA 1IYVA 1EYAA 3BYYB 4F7XA 4B3RQ 5EKLA 2ATWA 3ERSX 1YZ6A 4HMJA 2JA6G 3ULLA 4A3IB 2UUCL 4A3KH 1H95A 5IYDH 2K1BA 3S24A 5IP7G 3PIP3 1WCMB 1ESFA 3KDFA 1K3RA 1VQFA 3PO3H 1EY8A 1GD7A 1CKNA 3QR8A 3GTJB 4I7AA 1A3TA 3M3YB 1GJXA 4ZKBB 5M5WH 4QB4A 3CAMA 5C0XH 3UDIA 2CKZB 4KV6A 4DNTB 1PYBA 5IGCA 4YIJA 3PUVA 4IQZA 4YWLA 5FJ8H 3KK7A 1W2BA 2BA1A 4BBRH 4KD3A 3DWAA 1XXGA 4O1NA 3SK4A 2JE6I 1PA6A 4K0KQ 3MHBA 2PQEA 5IE8A 3CMAA 5JJIA 1WTOA 4I7ZC 1WTQA 1ENCA 1RTOA 3ZJYC 1NE3A 1Q3LA 1G2SA 3GQBA 5FLXc 3K80C 1EQRA 3DMUA 5AJ3Q 3Q22A 5T1IA 1HR0Q 2JA6B 4K14A 1DOLA 3LWUA 3SK6A 3MFGA 4R8NA 1VQAA 2SDFA 2NZHA 4IPGA 1IW7C 4KY7A 2K5NA 5CV8A 5NUCA 2LKVA 2C9OA 3S15B 1F9QA 1I3QB 2ID0A 3OSOA 4LFAQ 1PFSA 1V8QA 4HIKA 4A3DH 1EY9A 3MFYA 1A15A 3ULJA 2RSOA 2RA4A 1SYBA 2R93B 1MSGA 4C3IB 3HZXA 4A3EH 3Q6SA 1G6PA 1SYEA 1XX8A 2MGSA 4YWKA 3PO2H 5GADC 3KYHC 2MQHA 4JYAL 4MTKA 3PQIA 1OXUA 3U9OA 1UE7A 1LTAD 3RN5A 2WP8J 1EOVA 5M5YH 2ZTEA 1MIUA 1DXMA 2WKDA 3KF8B 4X3SA 3L9AX 4DK6C 5A35A 3CHBD 4HSVA 1XJVA 1X54A 1PH4A 3IFTA 1XNRQ 1N9WA 2R92B 2K33A 1AN8A 5EAYA 2DJFC 4PQXA 2X69A 3BU2A 1HQRD 3MXGA 2SEBD 2O5IC 5GAEC 4RGMA 3HOUB 3H15A 1FNVA 2OCEA 2N8NA 4L6TB 1TWHH 4B08A 3DEOA 4AYBB 1VCIA 4DNRB 4IOAA 4HJ8A 3OWFA 4QL5A 3E0EA 4DV7Q 2E5LL 1U4MA 4Y7NH 3TBIB 1TS2A 4C3HH 4A3JG 3TN2A 1K8GA 3NHHA 2AQ3B 2QGQA 4ZK9B 3PIO3 2KEDA 4GKKL 4MTNA 3AU7A 1VQEA 2F4IA 4DV1L 2VB2X 1VMPA 2PCFB 3KUPA 3U4VA 2RBMA 3ITPA 1WTRA 1Y1VB 2M9VA 2PZTA 3VR2A 2IW3A 2F0TA 2YYZA 3OOCA 2KCMA 2KCNA 4PMBA 3V2TA 1TWAH 5EJWA 4KJNA 4M8AA 4KHPL 4GKKQ 5IYCG 4A3LH 4OXPA 3Q24A 1HPCA 4JV5L 3Q0AA 1ET9A 4DK1A 4QGUA 1PH6A 4XT1B 3S15H 1HNXQ 1CUKA 3OMCA 2QILA 3H3VI 3E9IA 4IUTA 5JAVA 1K3BC 2K6AA 2AQ1B 2RHSB 5C44H 4LF4L 4BY1H 2A19A 4A3BG 1S4ZA 1NR2A 3UE0A 4OGQC 1PYWD 2ASBA 3T1HQ 2IX3A 4YY3L 3K5LA 3BYTB 3EQLC 4JCVE 1ESRA 1B53A 4FNFA 1KIXA 3R2IA 2VW9A 2A8VA 1VF5C 2ZM6Q 3BZKA 4TKOB 2K28A 2NZ1D 2QA4A 5JPMC 1C8CA 3J81c 1IHZA 4ID6A 4IURA 1JT8A 5C3WA 4A3CG 3CMEA 1UUPA 2JA9A 4CBVA 5LL6S 1F2ZA 4DXFA 4MN3A 3M7GA 3A5ZB 2X6GA 2K14A 2B29A 2HDLA 2DUDA 1EQVA 2PNRC 3OTOL 1GKHA 1RL2A 1WOCA 2YU9B 1ONLA 1L1OB 2EVBA 5BN4A 4L5SA 4CJ1B 2MUYA 2EJFC 4HJ9A 4JW0A 1PZKD 4HAEA 2KJXA 3NK9A 4DV6Q 3QOJA 3V05A 1VQJA 3K7AB 1HRJA 5FK9C 5J39A 2B2WC 1SMXA 3I4OA 1RKNA 4JBJA 1JC7A 1B7YB 3SXHA 1YI2A 3NQTA 4JBWA 2AMCB 3RUZA 2RDFA 2ENBA 1LO5D 4DUYQ 5I6YA 2L15A 2RSNA 1EZ6A 5K36H 4RGNA 4CJ0B 1E0BA 2VB3X 4JI1L 2QCPX 4RHSA 1A6XA 4K8JA 4JC0A
chains in the Genus database with same CATH topology
1F77A 3E6ZX 4M1UB 1BBXC 1I4RA 1S5ED 4KTAA 5EKKA 2EYFA 1FGBD 4K6LA 2D62A 1WTWA 1LT5D 2K32A 1HTPA 1GUSA 5KNBA 2F0OA 4S3SA 5FO8B 4FF4A 1AW7A 5I6WA 3HOWB 2L0CA 4QUFA 1C48A 2E2HB 1B3AA 1SNOA 3S2HB 2TMPA 4PNYA 2Z8LA 1TKWB 2TSSA 4X3KA 1STNA 5EQ0A 1EEFD 5G3LF 4ZLTF 1O7YA 4L8JA 3RLFA 4HR7B 1BCPB 3HGBA 1CT1D 2B2TC 2B63B 5D3IB 2A6EC 2NN6G 1F2MA 3J7YW 1H9KA 2EOTA 5FKAC 4X3TA 1CHQD 3GD7A 3RZOB 1PZJD 1SXTA 3R2TA 2VNUD 3MTSA 1YNJD 1U4RA 1X32A 4OO1G 1HA5A 1ENAA 2DY7A 1D6EC 2F0SA 5CGKA 4MHEA 4ODGA 3QO2A 5EBCA 2LS01 1SDFA 4IALA 1CZGA 1BF4A 2EYMA 1Z47A 1F2LA 2AQ2B 1EU4A 4KJOA 4CKEA 2RDGA 1CHPD 5DM73 5CV6A 1ZKOA 3TSSA 4DXGA 4OL7A 2IL8A 2XWBB 1G291 3A8KE 1BQQT 3J81E 2EYHA 1MSHA 2F0KA 2A6ED 5M3MB 1TWHB 3CRKC 2A68D 2QDBA 2NTTA 1HHVA 1Z7TA 3D31A 3G6JB 1MI2A 1LTBD 2MHVA 1W6JA 1GHKA 4WFN3 2A74C 3QOLA 1YNJC 3F2UA 1EQTA 5A2QE 5CV4A 2F0QA 2CW0C 4J6HA 4G4KA 1EY4A 3S16B 1HFGA 4XDXA 2WV6D 3AB9A 4QUCA 3T4AC 3VYRA 3EFXD 1BNZA 1LTSD 2Z4IA 3MXNA 1TWCB 4CHTB 3GTKB 2HQEA 2R3ZA 3FEWX 5IGEA 1PMRA 3H0GB 1H9RA 1WTPA 1OXXK 4LAAA 5C3EB 1D1IA 1QILA 1LTID 1M8AA 3I70A 3I72A 2JA5B 4RH6A 2B2VA 3EA6A 1JICA 1R4PB 1GUGA 1LV9A 2Z1CA 2JYOA 3MEHA 4LJZC 1Q1EA 4NDXA 3H3VC 1I6VC 4KI0A 3A8JE 1V43A 1H9JA 1CA6A 4EQNA 5M3FB 2FFKB 1D1KA 4PMWA 1B4OA 4HN7A 1YNNC 3NE5B 4OIKA 3H09A 3SE0A 4F87A 1JQYD 3SDZA 2PZUA 5IIFA 5I9OA 3D4DA 1OXSC 3IFDA 4LK1C 4DF7A 4ILWA 4R8IA 1T5XD 2B2WA 4CJ2C 3SVMA 1SMYD 1Z6HA 3I90A 5KRUA 1SFOB 5FLXE 4RAUC 1PTOD 5KYLA 5CV9A 1CZWA 3C2PA 3SHLA 4C3JG 2SOBA 1F9PA 2XVSA 3DXJC 5JEAG 2WAQB 4BY1B 4KKUA 1DM0B 5D3DA 4KHZA 1ZEQX 4H0LC 2NBFA 1RDPD 3W3AA 3HRZC 3S1NB 3R3OA 2XIWA 4L63B 3D4RA 3FMCA 2Q8TA 2KECA 4IUVA 2NB0A 2VXWA 2E2DC 2D5DA 3UI2A 5IT9L 3DEPA 5F2DA 1BCPD 1HFNA 5IGBA 3T13A 4PMCA 2ICEC 4XTCS 3NQIA 1V1PB 3A54A 2Z4HA 1ZYRC 2H1EA 4EQPA 1SNDA 2BCOA 4RFBA 1K8MA 2H4OA 1MGSA 3KLRA 3X3MA 1BCPF 1SE4A 2F1MA 3JAML 1D2BA 1TU2B 3NTIA 1LTRD 2AWNA 2NVYB 5IGDA 1B50A 4NP5A 5JOBA 2DN8A 4KK7A 1R4QB 3ERQA 5JVG3 3FPPA 1SYDA 1TQOA 4K5XA 2LY7A 1W6KA 3IAYA 3K6OA 2N55A 3NTKA 4XQNA 2PPBC 2NVTB 5C5MA 1H9MA 2NYZD 5DEHA 4XT3B 2WIIB 1HTLD 2EY6A 1JOKA 4H7BA 3VA5A 3N6RA 1RCVD 4H13C 2XWJB 1QOHA 4HEDA 3VYTA 1G8ZD 3S1MB 2DNCA 1RODA 2IX1A 3H91A 3NXWA 4EQOA 1DD2A 1A3UA 2O4XA 2V4DA 2EY5A 4K2KA 3NP8A 5K5PA 3BDCA 2F0GA 1ZYRD 3M7NA 1OXTA 1CI3M 1K83B 3S14B 2F0WA 4BA1I 5M5YB 3OIQA 4FP5D 3FDTA 2F0EA 1Y1WB 2KA7A 3I4MB 1EIGA 1TWAB 4ABNA 3KBXA 2A6HC 2RQXA 4UAIA 5FLXL 2EY1A 4C2MB 2WB1B 3DWQA 2F0HA 3OPOA 2EPBA 1KNEA 1H9SB 1O7ZA 1EWHA 4KHVA 1SYFA 2JA7B 2WINB 1SYGA 3NPPA 4A3MB 5CV7A 4RGOS 5COYA 4BBRB 4TRDA 2A69D 1VMCA 2QEJC 4XYOA 1LT4D 4DAVA 1JWUD 3WOEA 2I07B 1QCBD 4G7OC 1GHJA 3NUCA 5EPJA 1A2UA 4ZKCB 1GUOA 3HKZB 1EY5A 4EGVA 3TP5A 1TVXA 1UNSA 1ILPA 1SNPA 3J7AF 5C44B 5BN3A 2MPMA 4A3JB 3FRPB 2ZXOA 4U68A 4C56C 4HTHA 5ELDA 2OT2A 3H94A 3NWSA 3ONAB 5ISRA 3AMUA 2EYPA 2B2TA 5CYUA 3VR4A 2K7VA 3VR6A 2E76C 2J4XA 2NWGA 1ICWA 1M4VA 3MXUA 3MVVA 5C3XA 2XRSD 3BDOA 3T56B 1WD0A 4HSPA 2HDMA 5EBDA 2OF1A 1PRTD 2PO4A 3RZDB 4K6DA 3SR1A 1SNCA 1EWCA 1RD9D 4QF4A 1IL8A 3D6CA 4ZQ3A 2F0UA 5KGUA 2XSCA 4XQJA 4C1NK 1QNUA 2OXPA 1KDCA 2I46A 3GV6A 4UDUC 4Z9CB 2J7ZA 4C3IG 5IGFA 1IW7D 1BCPC 1TS5A 3M4OB 1JORA 2L12A 1I4XA 2HCIA 4A3FB 1WVLA 5IOCA 1GUWA 1O80A 5JJZA 2HUGA 3GTGB 1EFID 1ET6A 3I4NB 1C4QA 1BUVT 2IX0A 3A8IE 3FPUB 3IL8A 1F9SA 5CV5A 3PUYA 2A73B 1KLGD 2JEAI 2LMCB 1T5EA 2KOLA 4ULLA 5E1FA 3QG1A 1TS4A 5J1ZA 5C0XG 4XIGS 3FVQA 1XWEA 2G9HD 1STYA 1GXDC 1LLRD 4IZ8A 3U9SA 1HUMA 1LTGD 1DOKA 4J8QA 1TY0A 3RD4A 1PRTC 2O5JC 2FHTA 2F03A 1PTOF 2B2UA 2BE5C 1CQFA 1STAA 3L7ZC 4EVOA 3R93A 2X6LA 1J9OA 1Y8PB 5EGTA 1UAPA 2B2VC 4U673 3QIAA 3I4LA 1JOOA 4IN3A 3FKIB 4ME5A 1E2WA 5C5LA 5D14A 1B44D 3DUZA 4XXEA 2A5HA 1KTKA 3TP7A 2B2UC 2CHBD 4R9WA 2IPKD 4FXKC 2D9UA 3D3RA 2PYKA 1DZ1A 1LT6D 3OHXC 1U9RA 2SNMA 5E4WC 5C6AA 4HCEA 4QCLA 3HOYB 1SJHD 5T1GA 3VR3A 2BE5D 5C0XI 3TMEA 1HXYD 1L0XB 2FMMA 2KEEA 3KLSX 2F0DA 2GA4B 2PZWA 1G2TA 3VYSA 1S5CD 5ELBA 4B9WA 4PV1C 1PDQA 1PTOB 5EKIA 3HP3A 3EVQA 4A93B 1QJOA 1TIID 1PTOH 1Y8OB 4FXDA 1JWMD 3CRLC 1EZ8A 4WJWA 4IUQA 5JEAH 2OEOA 5JEAJ 3QB3A 1QG7A 2FJ2A 3Q23A 3V96A 5EPLA 1UEAB 3T16A 2CVRA 4N9PA 3WOFA 1Q90A 3EROA 3TP8A 3BVMA 2L55A 4OO1H 3TP6A 1GOZA 1PZID 2AWOA 2EYOA 3PO3B 2C5CA 1BOSA 5KNDA 5A2QL 4MIUA 4FYDA 4OIJA 3KF8A 1U4LA 3I73A 4J1MA 1SE3A 3KBGA 4WORA 1XYIA 2Y0SB 3QJYA 5LHY1 4A3BB 1RF2D 1B9NA 3LX0A 3C3LA 3DWPA 1XTCD 3LNNA 2EYJA 4K5WA 2IWHA 1KLUD 3P1HA 3VR5A 4N9TA 5M9OA 4DN4M 2NUCA 2JA8B 1STBA 3P7JA 1PRTF 3D8GA 4C3HG 3ZYYX 1CA5A 3J81L 4NW2A 3HOXB 1V1PA 3OW7A 3K5MA 2WACA 2EY2A 1A3VA 1G91A 3OMGA 4XYQA 4KY6A 3PMFA 4ZRZA 3GTPB 1EL0A 1L0YB 4FXGC 3K58A 3JAME 4IFDI 5C4ZA 1S5DD 1SSOA 2RKSA 4RHRA 4TQUS 3SK5A 3P75A 2F3VA 1F9RA 3J80E 2NN6H 4IUUA 1R9TB 5HURA 4C3JB 5I4DA 4A3EB 3RMHA 1DCZA 5G3LD 3SEBA 1FNUA 3LWEA 1QE6A 4ZYSA 2L4NA 1QWYA 4KN4C 1EU3A 3S17B 3I3CA 4F8MA 3A7LA 1Y69U 3PUWA 2CW0D 2L11A 5ELCA 3BVGA 1ILQA 3CQZB 4DFAA 5I9PA 1SAPA 1I4HA 1ZXTA 4O42A 4IUNA 1ML0D 2BDOA 1PFMA 3T51B 2KCCA 1Q12A 2EXZA 2R6GA 1SBBB 3HOZB 2WKCA 3J7AV 4A3GB 5IODA 1KABA 1QB5D 5IGGA 3BZDB 4G7ZC 4DAPA 1NSNS 2LFNA 2Q8IB 2KHSA 5I2XA 3NBHA 1LABA 1J8IA 3L3OC 2K04A 2PW5A 3ND9A 1KAAA 2KUMA 4IFDH 5CBEE 1CK1A 3IKJA 2L9HA 3X3NA 3C46A 3GTMB 5HGTA 2JSOA 1BO0A 1JE4A 4DGZA 3I91A 1TR5A 4P2CB 1I4QA 1AEXA 2KQ3A 4HMIA 1GUNA 1CTMA 2EZVA 1WTXA 3A56A 1KDAA 4BY7B 3MZ5A 2F0NA 2K01A 1DOMA 3PO2B 1JWSD 2EJMA 5ELFA 2E2IB 5JVH3 4C3HB 2B2YC 1DJRD 3P20A 4RCNA 4FO2A 5I2YA 4IFDG 3E0JA 4QIWB 1ENFA 5M5XB 4RCOA 1BDOA 4LMQD 1K8OA 1A2TA 4H44C 3GV3A 1OO9B 1Q8IA 2F0IA 2EDGA 1TT2A 2PW7A 2FMCA 3PUZA 1CQVA 3DM1A 3MA2B 5KIXA 1E2ZA 1JR0D 5C4XB 3MC0B 3M85A 3D6WA 4X3UA 2G9DA 4RWSC 1IYUA 4FF3A 2F0VA 5ELEA 1TY2A 4ZUIA 4NKLA 1OXVA 2BA0A 1EYDA 3A55A 3A7AB 3PV0A 5J22A 1HCZA 2BDNA 1BR9A 1HUNA 1EEID 2K5WA 1EIHA 3QWNA 1FR3A 5FO9B 4Q5VA 4G57A 5C4JB 3N52A 4DAYA 1BXTA 4RKLA 2F0MA 1S5FD 4OHJA 1SNMA 3WDNA 2A68C 1H9SA 4HCSA 2R61A 1AP0A 1FYCA 1PLFA 2ZXPA 2K5DA 2B2YA 3SK8A 5KEEA 5EPKA 2B39A 2EJGC 4V190 3NWTA 1STGA 1X3QA 1WTVA 1DYQA 1STEA 1SYCA 3TDQA 1NAPA 2N88A 1PFNA 1SNQA 4Q0FA 3OWEB 1D5ZC 2XNAC 1TWFB 2MP1A 1TS3A 3TZUA 5CBAE 5D65A 2BOSA 5CR3A 5FO7B 4K2LA 2XN9C 4F88A 2JXMB 2XRQD 3G7LA 1Q1BA 5JPNC 3VA7A 2JP1A 3TZDA 4FF1A 1LACA 5K36G 2DNEA 2DY8A 5DNFA 1D5XC 1AZPA 1EYCA 5CMDA 2IT1A 4B9XA 4CKBA 1MD2D 1MBYA 4KKTA 3KLSA 4CGYB 1I4PA 4QMGA 2F0LA 4BS9A 1TWGB 4KN7C 2AUJD 5KYIA 2F0PA 4CKCA 2MJ8A 3HG9A 1QNKA 4KMUC 3HEJA 1SJED 3S1QB 1S5BD 2J0TD 1PXUA 1LTTD 4DU9A 2KVMA 3BG3A 1I6HB 1JCKB 3C1FA 3CKIB 3CU7A 2Q8RE 5C4HA 3VYUA 2NVQB 1B2TA 1CFMA 1AZQA 1YNND 2O2LD 1V1OA 2F0JA 3GTQB 1PFBA 3O13A 4KD4A 4ZAIA 1NCVA 1F2YA 3PUXA 2RVLA 1Y8NB 1B1ZA 2SNSA 4GZYC 4IUPA 1SMYC 3NBIA 1VDZA 3GO5A 1SEBD 5LL6X 1AFPA 3S1RB 1NR4A 5C0XJ 4Y7NB 1PTOC 4G7HC 5E3FA 5FOBB 2EE1A 4A3DB 1D5MC 3S9WA 3GTLB 3K57A 1FNWA 2FINB 1WD1A 1PRTB 2F3WA 2NN6I 3E5SA 1STHA 3HS0C 4OO1I 1VF7A 1CM9A 1SE2A 3BVZA 3ND8A 5DM63 2F0FA 3H6MA 4FF2A 2QF7A 1E2VA 2A69C 1KDBA 2ZXRA 4E6IA 1GUTA 1RTNA 2D2CC 5M5WB 5KNCA 3I8ZA 3NSWA 4BWGB 1NUCA 3D4WA 1FD7D 4RA8A 2E74C 1KNAA 3K5OA 3OIPA 1DONA 2E75C 1HA6A 3GP7A 1O78A 3T53B 2L5TA 3M4YA 5AFWA 1EY0A 1EOTA 4TSSA 4BA2I 3MAQA 1IKLA 4K8IA 2VUMB 1EY6A 2JEBI 1JB3A 2RDHA 2B8GA 1JOQA 1G6ZA 2PMZB 5DAUA 3C1EA 1U4PA 4WRDA 3NTHA 1O7LA 4FVMA 3BS1A 1HQMC 1I4GA 2ZT9C 4A3KB 4DA2A 2NTSA 1EY7A 1I50B 4ZUJA 4DK0A 2E2JB 4I65A 4KY5A 4BBSB 2K5QA 1X3PA 2M2LA 3W2DA 2NVXB 5CC4A 2M00A 3K59A 2AUKA 2QKIC 4RGTA 4XQQA 3GTOB 2IJ0A 2L1BA 3HOVB 3R8BA 2K03A 3DHQA 5BN5A 1RJTA 1II3A 5IT9E 3MXPA 2R7ZB 3BDLA 2K05A 1IKMA 3K0YA 3URYA 4IFDJ 4NMZA 4V0BA 1LT3D 3S2DB 1B9MA 3J80L 2HCCA 5CORA 4KKSA 5E4XA 4C1NI 3MWYW 3EJIA 1RHPA 3K5NA 5TSSA 2CQAA 2B8FA 2A6HD 2EYLA 4RKBA 2ICIA 4JK1C 4K5VA 1IYVA 1EYAA 3BYYB 4F7XA 5EKLA 4HMJA 4A3IB 2K1BA 3PIP3 1WCMB 1ESFA 1EY8A 3GTJB 1A3TA 3M3YB 1GJXA 4ZKBB 4QB4A 5C0XH 4KV6A 4DNTB 5IGCA 4YIJA 3PUVA 4IQZA 3KK7A 2BA1A 4KD3A 3DWAA 1XXGA 4O1NA 3SK4A 2JE6I 3MHBA 2PQEA 1WTOA 4I7ZC 1WTQA 1ENCA 1RTOA 1Q3LA 1G2SA 3GQBA 3DMUA 3Q22A 5T1IA 2JA6B 4K14A 1DOLA 3LWUA 3SK6A 3MFGA 4R8NA 2SDFA 1IW7C 4KY7A 5CV8A 5NUCA 2LKVA 2C9OA 3S15B 1F9QA 1I3QB 2ID0A 3OSOA 1V8QA 1EY9A 3MFYA 1A15A 2RSOA 2RA4A 1SYBA 2R93B 1MSGA 4C3IB 3HZXA 3Q6SA 1SYEA 1XX8A 2MGSA 1OXUA 3U9OA 1LTAD 2WP8J 1DXMA 2WKDA 4X3SA 3L9AX 5A35A 3CHBD 4HSVA 3IFTA 2R92B 2K33A 1AN8A 4PQXA 2X69A 1HQRD 3MXGA 2SEBD 2O5IC 4RGMA 3HOUB 1FNVA 4L6TB 4B08A 3DEOA 4AYBB 1VCIA 4DNRB 3OWFA 1U4MA 3TBIB 1TS2A 3TN2A 3NHHA 2AQ3B 4ZK9B 3PIO3 2KEDA 3AU7A 2F4IA 2VB2X 1VMPA 2PCFB 3KUPA 2RBMA 3ITPA 1WTRA 1Y1VB 2M9VA 2PZTA 3VR2A 2IW3A 2F0TA 2YYZA 3OOCA 4PMBA 2KCNA 3V2TA 5EJWA 4KJNA 4M8AA 3Q24A 1HPCA 3Q0AA 1ET9A 4DK1A 4XT1B 3OMCA 2QILA 4IUTA 5JAVA 2K6AA 2AQ1B 1S4ZA 1NR2A 4OGQC 1PYWD 2IX3A 3K5LA 3BYTB 3EQLC 1ESRA 1B53A 4FNFA 3R2IA 1VF5C 4TKOB 2K28A 2NZ1D 5JPMC 1C8CA 1IHZA 4ID6A 4IURA 5C3WA 1UUPA 4CBVA 5LL6S 1F2ZA 4DXFA 4MN3A 3M7GA 2X6GA 2HDLA 1EQVA 2PNRC 2YU9B 1ONLA 2EVBA 5BN4A 4CJ1B 2MUYA 2EJFC 1PZKD 4HAEA 2KJXA 3NK9A 3QOJA 3V05A 3K7AB 1HRJA 5FK9C 5J39A 2B2WC 1RKNA 1JC7A 3SXHA 3NQTA 4JBWA 3RUZA 2RDFA 2ENBA 1LO5D 5I6YA 2RSNA 1EZ6A 5K36H 4RGNA 4CJ0B 1E0BA 2VB3X 1A6XA 2QCPX 4RHSA 4K8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMC A;  5CV8 A;  5NUC A;  2LKV A;  2F0S A;  3OSO A;  2F0D A;  1STB A;  5JAV A;  5CGK A;  3NXW A;  3D8G A;  2HQE A;  4HTH A;  1EY9 A;  4ODG A;  3V2T A;  3S9W A;  4EQO A;  2PZW A;  4KTA A;  5CC4 A;  1A3U A;  2EYF A;  2M00 A;  5EKK A;  5IOD A;  1SYB A;  2O4X A;  5IGE A;  1KAB A;  2F0V A;  5ISR A;  2F3W A;  3E5S A;  3HZX A;  4IAL A;  4B9W A;  2WAC A;  2EY2 A;  1EYC A;  1STH A;  2EY5 A;  2EYP A;  3R3O A;  4ZUI A;  4K2K A;  1A3V A;  2EYM A;  4B9X A;  5IGG A;  3NP8 A;  4NKL A;  1STA A;  3BDC A;  3DHQ A;  3OMG A;  2F0G A;  4KY6 A;  5K5P A;  4LAA A;  4EVO A;  1SYE A;  1NSN S;  1EYD A;  1II3 A;  2F0O A;  4KJO A;  4QMG A;  3EVQ A;  2KHS A;  3MXP A;  4S3S A;  2F0L A;  2F0W A;  3PMF A;  3BDL A;  5J22 A;  3MVV A;  3U9O A;  5C3X A;  5EGT A;  5F2D A;  2F0F A;  3H6M A;  5CV6 A;  2PW5 A;  4NMZ A;  2OF1 A;  1IHZ A;  4K2L A;  4ID6 A;  3T13 A;  5I6W A;  1KAA A;  5IGB A;  4PMC A;  4K6D A;  5KYI A;  1EZ8 A;  3SR1 A;  1SNC A;  1KDB A;  5C3W A;  4OL7 A;  2F0P A;  4KY5 A;  1JOO A;  4QF4 A;  4E6I A;  2F0E A;  5C4Z A;  2OEO A;  4ME5 A;  3D6C A;  4ZQ3 A;  5C5L A;  4G57 A;  5HGT A;  2F0U A;  3QB3 A;  1F2Z A;  5KGU A;  1SNO A;  4EQP A;  4DGZ A;  2RKS A;  1NUC A;  1SND A;  1TR5 A;  3D4W A;  3HEJ A;  4PNY A;  2EYH A;  1AEX A;  2KQ3 A;  2F0K A;  4HMI A;  3EJI A;  3P75 A;  4RKL A;  3SK5 A;  2F0M A;  2F3V A;  2OXP A;  3T16 A;  3MEH A;  4N9P A;  1KDC A;  2QDB A;  1KDA A;  3ERO A;  3TP8 A;  3MZ5 A;  2F0N A;  4NDX A;  1SNM A;  2EY1 A;  1STN A;  2EYL A;  3TP7 A;  4RKB A;  4DU9 A;  4K5V A;  5IGF A;  1EQV A;  3TP6 A;  1EYA A;  4F7X A;  1JOR A;  5EKL A;  5HUR A;  4EQN A;  3C1F A;  4HMJ A;  3OWF A;  5IGD A;  2F0H A;  5IOC A;  2PYK A;  2EYO A;  4NP5 A;  5JOB A;  5C4H A;  3ERQ A;  4MIU A;  1EY0 A;  3NHH A;  1EY8 A;  3SK8 A;  5KEE A;  1U9R A;  1A3T A;  4K8I A;  4KHV A;  2SNM A;  1SYF A;  2F0J A;  1EY6 A;  1SYD A;  1TQO A;  3NK9 A;  4K5X A;  1SYG A;  4QB4 A;  3QOL A;  5C6A A;  5KRU A;  5CV7 A;  1F2M A;  3QOJ A;  2PZU A;  5IIF A;  5CV5 A;  3D4D A;  4KV6 A;  2RBM A;  3ITP A;  4F8M A;  5I9O A;  1STG A;  5J39 A;  5IGC A;  4YIJ A;  4KD4 A;  4TRD A;  4DF7 A;  2PZT A;  5CV4 A;  4J1M A;  1F2Y A;  1A2T A;  1SYC A;  4KD3 A;  2F0T A;  1JOQ A;  1RKN A;  4PMB A;  4WOR A;  2F0I A;  2SNS A;  5DAU A;  2F0Q A;  3C1E A;  5C5M A;  4I65 A;  3SK4 A;  1TT2 A;  3SXH A;  3NQT A;  3MHB A;  2PQE A;  4WRD A;  1SNQ A;  4DFA A;  3RUZ A;  5I9P A;  2RDF A;  2PW7 A;  3NUC A;  5DEH A;  5E1F A;  2ENB A;  3LX0 A;  1ENC A;  1A2U A;  4J6H A;  4KJN A;  5J1Z A;  5I6Y A;  5KIX A;  1EY4 A;  5KYL A;  2EY6 A;  5CV9 A;  1EY5 A;  4IUN A;  2EYJ A;  3DMU A;  4K5W A;  1EZ6 A;  3SHL A;  1JOK A;  4H7B A;  4K14 A;  3P1H A;  2SOB A;  3SK6 A;  3TME A;  3TP5 A;  3VA5 A;  4N9T A;  4R8N A;  1EY7 A;  5E3F A;  2EXZ A;  1STY A;  4IZ8 A;  5CR3 A;  4ZUJ A;  5M9O A;  1ENA A;  1SNP A;  4K8J A;  2NUC A;  4KY7 A; 
#chains in the Genus database with same CATH topology
 1F77 A;  1ICF B;  3OYY A;  3E6Z X;  4M1U B;  1Q81 C;  1BBX C;  1I4R A;  1S5E D;  4KTA A;  1YVC A;  3KF6 B;  2HD3 A;  5EKK A;  2EYF A;  2K50 A;  2YTX A;  2KCT A;  1M1K C;  2MO1 A;  3A0J A;  4GS3 A;  1FGB D;  4K6L A;  3L0O A;  4JI4 Q;  2D62 A;  1WTW A;  1QVF A;  1LT5 D;  5LMN W;  2K32 A;  1HTP A;  2ZM6 L;  1GUS A;  1PH8 A;  1VS0 A;  5KNB A;  2F0O A;  4B3T Q;  5LMU Q;  4S3S A;  5FO8 B;  1VQK A;  4FF4 A;  2Z6K C;  4HIO A;  1AW7 A;  1PH1 A;  5I6W A;  3HOW B;  2L0C A;  4QUF A;  4PZ7 A;  3PGZ A;  4GNX C;  1C48 A;  2E2H B;  1B3A A;  1SNO A;  4LF6 L;  2IY5 B;  3S2H B;  2TMP A;  4PNY A;  2Z8L A;  1TKW B;  4O2D A;  1A63 A;  1XTD A;  2TSS A;  2OTJ A;  4X3K A;  5IP9 H;  1STN A;  5EQ0 A;  1VQN A;  1EEF D;  2HIX A;  5G3L F;  2E2J H;  2VY3 A;  1O7Y A;  4ZLT F;  4L8J A;  3RLF A;  4HR7 B;  1BCP B;  4LFB L;  3HGB A;  4DR6 Q;  3I4N H;  3G71 A;  1CT1 D;  2B2T C;  2B63 B;  2WAQ G;  3HKZ E;  5D3I B;  2A6E C;  2NN6 G;  4CDC C;  1HNW L;  3AFQ A;  2ZJQ A;  1VQG A;  1F2M A;  3J7Y W;  1H9K A;  2EOT A;  5FKA C;  2CFM A;  4X3T A;  4DV7 L;  2E5L Q;  1CHQ D;  2WAQ E;  3GD7 A;  3TRZ A;  3RZO B;  3TQY A;  5IP7 H;  1PZJ D;  2CQO A;  4DR5 Q;  4JI0 L;  4O0A A;  1SXT A;  1QVC A;  3R2T A;  2VNU D;  5ELN A;  4IO9 A;  3MTS A;  1YNJ D;  1U4R A;  1M90 C;  1X32 A;  4OO1 G;  1HA5 A;  1ENA A;  2DY7 A;  1D6E C;  3IRB A;  2F0S A;  5CGK A;  3U50 C;  2BH8 A;  4MHE A;  1W3S A;  4ODG A;  5JJK A;  5M5X H;  3QO2 A;  2I5H A;  2V1C C;  5EBC A;  2LS0 1;  4GLV B;  1SDF A;  4IAL A;  1CZG A;  1BBW A;  1FL0 A;  1BF4 A;  2EYM A;  1Z47 A;  1F2L A;  2JK8 A;  2RHQ B;  2AQ2 B;  1EU4 A;  2LXJ A;  4ALP A;  4KJO A;  4N8F A;  4CKE A;  2RDG A;  4DV6 L;  2K75 A;  1CHP D;  1HZ9 A;  5DM7 3;  4B3M L;  3S2D H;  3HOW H;  3GTQ H;  5CV6 A;  1ZKO A;  3TSS A;  3K7A H;  4DXG A;  3Q8D A;  4OL7 A;  4LW1 A;  2IL8 A;  1AH9 A;  2XWB B;  1G29 1;  3A8K E;  4DR3 L;  1V1Q A;  1BQQ T;  4EX5 A;  3I4M H;  4BBS G;  3GTM H;  3J81 E;  2EYH A;  1MSH A;  2F0K A;  4OEL B;  1IZ6 A;  2A6E D;  5M3M B;  1TWH B;  3CRK C;  2A68 D;  3CC7 A;  2QDB A;  2NTT A;  1HHV A;  2YU9 H;  1Z7T A;  4OON A;  1SFO H;  3HOU H;  3D31 A;  4N8X 1;  1SN8 A;  1HNZ Q;  3G6J B;  2R93 G;  1MI2 A;  3TS2 A;  1LTB D;  3U58 A;  2MHV A;  1W6J A;  1GHK A;  4DV5 Q;  4BXX H;  5LMN L;  4WFN 3;  2C35 B;  2A74 C;  4UPA A;  5M3F G;  3QOL A;  4LUO A;  4DV4 L;  1YNJ C;  2H5X A;  2IHE A;  3F2U A;  4LF8 L;  1EQT A;  5A2Q E;  1X9N A;  5CV4 A;  2UUC Q;  1IXR A;  4DR1 Q;  2F0Q A;  3E9H A;  2CW0 C;  1XMQ Q;  1N36 L;  1E1O A;  4J6H A;  4G4K A;  1EY4 A;  2GVB A;  3S16 B;  1HFG A;  3FKI H;  4XDX A;  2WV6 D;  3AB9 A;  4QUC A;  1O7I A;  3T4A C;  3EFX D;  3VYR A;  4L5T A;  1BNZ A;  1LTS D;  2Z4I A;  3MXN A;  1K73 C;  1TWC B;  4CHT B;  3GTK B;  2HQE A;  2R3Z A;  2N49 A;  1I3Q H;  4IOC A;  3FEW X;  5IGE A;  2JN4 A;  1PMR A;  4NXN L;  3UE1 A;  3HOX H;  3H0G B;  4LF6 Q;  1H9R A;  1WTP A;  1C9O A;  1OXX K;  4LAA A;  1VQI A;  2RCF A;  5C3E B;  4A3C H;  1TWG H;  4GLX A;  3HFZ B;  1D1I A;  1QIL A;  4UP8 A;  1A8V A;  4JG2 A;  1VQ8 A;  1LTI D;  1M8A A;  3I70 A;  1CSQ A;  3I72 A;  1CKM A;  4YCU A;  2JA5 B;  4YHH Q;  1NMF A;  4RH6 A;  2B2V A;  3EA6 A;  3G4S A;  2YTY A;  1JIC A;  1R4P B;  1GUG A;  4JI4 L;  4DR2 Q;  1LV9 A;  1E1T A;  2Z1C A;  5DLQ E;  4A3D G;  1PVO A;  2JYO A;  3MEH A;  1S40 A;  4JI7 Q;  4LJZ C;  1QZH A;  4POF A;  1Q1E A;  4NDX A;  4JI2 Q;  3H3V C;  1I6V C;  4KI0 A;  1IBK Q;  3A8J E;  1Y1W G;  1V43 A;  4AYB G;  4DUZ Q;  1H9J A;  1X55 A;  1CA6 A;  4EQN A;  5M3F B;  2FFK B;  1D1K A;  4RG1 A;  4PMW A;  2XGT A;  1B4O A;  4HN7 A;  1YNN C;  3NE5 B;  4OIK A;  4QJF A;  3HOU G;  3H09 A;  3SE0 A;  1QUQ B;  3CCS A;  4LF5 Q;  4F87 A;  1VQH A;  1JQY D;  3M4Q A;  1KRT A;  3SDZ A;  2PZU A;  5IIF A;  5I9O A;  3D4D A;  1YHB A;  1OXS C;  3IFD A;  2Q2H A;  4LK1 C;  4DF7 A;  4ILW A;  4R8I A;  1T5X D;  4DAM A;  2B2W A;  4CJ2 C;  3D0F A;  1SMY D;  1Z6H A;  3SVM A;  4AQY Q;  4LFC Q;  3I90 A;  5KRU A;  1SFO B;  5FLX E;  2F4V L;  3S2H H;  4RAU C;  1YJ9 A;  2AHO B;  1PTO D;  5KYL A;  2WB1 E;  5CV9 A;  1CZW A;  3C2P A;  3SHL A;  4C3J G;  4DR4 L;  4IPH A;  2SOB A;  1F9P A;  5IWA Q;  2XVS A;  3DXJ C;  5JEA G;  2Z0S A;  2WAQ B;  4BY1 B;  1X3F A;  4KKU A;  5C4X H;  1DM0 B;  5D3D A;  4DV2 Q;  4KHZ A;  1ZEQ X;  4H0L C;  5IYB H;  1YNX A;  1L2F A;  2NBF A;  1PH9 A;  1RDP D;  5C4X G;  4B3M Q;  3W3A A;  4HJ7 A;  3HRZ C;  3S1N B;  5ELO A;  3R3O A;  4L63 B;  2XIW A;  4JOI A;  3D4R A;  3FMC A;  2Q8T A;  2KEC A;  4IUV A;  3S1N H;  2NB0 A;  2VXW A;  2E2D C;  1MKH A;  2D5D A;  3UI2 A;  5IT9 L;  3DEP A;  2JJQ A;  5C44 G;  4PZ6 A;  5F2D A;  1BCP D;  1Y14 B;  1HFN A;  5IGB A;  3T13 A;  3RN2 A;  4PMC A;  2ICE C;  4GNX B;  4XTC S;  2JA5 G;  3NQI A;  1V1P B;  3RR5 A;  4ME3 A;  3A54 A;  3CW2 C;  4R4T A;  2Z4H A;  1ZYR C;  2H1E A;  4EQP A;  1SND A;  3STB D;  5GAG C;  2BCO A;  4RFB A;  1K8M A;  3RZO H;  2H4O A;  2ALY B;  4IJL A;  1MGS A;  3KLR A;  4DNI A;  3X3M A;  1BCP F;  1SE4 A;  2PI2 A;  2F1M A;  3JAM L;  1D2B A;  3G6E A;  1TU2 B;  3NTI A;  1LTR D;  2PNH A;  1B3Q A;  1L1O C;  2AWN A;  2NVY B;  5IGD A;  4TVA B;  4JI8 L;  1B50 A;  4NP5 A;  5JOB A;  2DN8 A;  1I5F A;  5C3E G;  4KK7 A;  1R4Q B;  3ERQ A;  5JVG 3;  1U5K A;  3FPP A;  1HJP A;  1SYD A;  1TQO A;  4K5X A;  3AEV A;  3W5O A;  4DR7 L;  2LXK A;  2LY7 A;  1W6K A;  1N36 Q;  4LF4 Q;  3IAY A;  3K6O A;  2N55 A;  1V9P A;  3NTK A;  1HZC A;  4XQN A;  4JPB W;  2PPB C;  2NVT B;  5C5M A;  2EQS A;  1H9M A;  4LUZ A;  2NYZ D;  5DEH A;  4XT3 B;  2CWP A;  1VQ9 A;  1DGS A;  2WII B;  5LMN Q;  1HTL D;  2EY6 A;  4JI6 Q;  1Y1W H;  1JOK A;  4H7B A;  3VA5 A;  3N6R A;  1RCV D;  3FHW A;  1B70 B;  4H13 C;  2XWJ B;  2UU9 L;  1QOH A;  4HED A;  1G8Z D;  3VYT A;  4BBS H;  3S1M B;  2DNC A;  1YHA A;  4A3I H;  1ROD A;  2IX1 A;  1D8L A;  1ASZ A;  3H91 A;  3NXW A;  4DR7 Q;  4EQO A;  4DV1 Q;  1DD2 A;  1A3U A;  2O4X A;  1K28 A;  2V4D A;  2EY5 A;  4K2K A;  4A3K G;  3EN2 A;  3NP8 A;  5K5P A;  3BDC A;  5IYD G;  2F0G A;  1ZYR D;  3BZC A;  3M7N A;  1OXT A;  1CI3 M;  1K83 B;  3S14 B;  5M3M G;  2F0W A;  4AH6 A;  4BA1 I;  5M5Y B;  3OIQ A;  4FP5 D;  3I2Z A;  3FDT A;  4OX9 L;  2Q2T A;  2F0E A;  1Y1W B;  2KA7 A;  2R7F A;  3I4M B;  1EIG A;  2JA5 H;  1BBU A;  1TWA B;  5IWA L;  4ABN A;  2UUB L;  3GTO H;  3KBX A;  2A6H C;  2RQX A;  4UAI A;  5FLX L;  3M4O H;  2EY1 A;  4C2M B;  2WB1 B;  3FKI G;  4R1J A;  3EBE A;  1WTH A;  1JJG A;  3CC4 A;  3DWQ A;  4AQY L;  2F0H A;  3GTG H;  3OPO A;  2EPB A;  1KNE A;  1H9S B;  4UHV A;  1O7Z A;  3SGI A;  1EWH A;  4KHV A;  1SYF A;  2JA7 B;  4JI0 Q;  2WIN B;  1SYG A;  3NPP A;  4A3M B;  3GTK H;  5CV7 A;  4RGO S;  5COY A;  4DV2 L;  1P8L A;  2N3S A;  4BBR B;  4TRD A;  2A69 D;  1VMC A;  2QEJ C;  1CKO A;  4XYO A;  1LT4 D;  4DAV A;  3I4N G;  4NB3 A;  1JWU D;  3WOE A;  2I07 B;  1QCB D;  4G7O C;  1HR0 L;  5HGQ A;  1HH2 P;  2AKW B;  1GHJ A;  3NUC A;  5EPJ A;  1A2U A;  1XPR A;  4ZKC B;  1GUO A;  3HKZ B;  1EY5 A;  1PV4 A;  4EGV A;  3TP5 A;  4P74 A;  3S16 H;  4LFC L;  1TVX A;  1UNS A;  1ILP A;  1SNP A;  3UDX A;  3J7A F;  5C44 B;  4C3J H;  1PH7 A;  2UU9 Q;  5BN3 A;  2MPM A;  1PH3 A;  4JBK A;  1YEZ A;  4A3J B;  3FRP B;  4B3R L;  2ZXO A;  4U68 A;  4X6A H;  4FDB A;  4C56 C;  1K8A C;  4HTH A;  5ELD A;  2OT2 A;  3H94 A;  3NWS A;  3ONA B;  4H02 A;  5ISR A;  2P5Z X;  2RCN A;  3M9B A;  3AMU A;  2JA7 G;  2EYP A;  1EIF A;  2B2T A;  4JVZ A;  5CYU A;  3VR4 A;  2K7V A;  2XTI A;  3VR6 A;  2YV5 A;  2E76 C;  5GQO A;  2J4X A;  2NWG A;  1ICW A;  1M4V A;  3MXU A;  1XNQ Q;  3A74 A;  3I55 A;  3MVV A;  2R92 G;  5C3X A;  2XRS D;  2QEX A;  3BDO A;  4DKA C;  3T56 B;  3W1B A;  5EBD A;  4HSP A;  2HDM A;  3T1H L;  2OF1 A;  1PRT D;  1WD0 A;  2PO4 A;  3CCR A;  3RZD B;  4K6D A;  3SR1 A;  1SNC A;  2MNA A;  1EWC A;  1RD9 D;  4QF4 A;  1LUZ A;  1IBM Q;  1IL8 A;  2JA7 H;  3D6C A;  4DV0 L;  4ZQ3 A;  2F0U A;  5KGU A;  2FXQ A;  2XSC A;  4XQJ A;  1PH5 A;  1K9M C;  2OWO A;  4C1N K;  1QNU A;  1S3O A;  2OXP A;  1KDC A;  2I46 A;  3GV6 A;  4UDU C;  4Z9C B;  4X62 L;  2J7Z A;  4C3I G;  5IGF A;  1IW7 D;  1BCP C;  1TS5 A;  3M4O B;  1JOR A;  2L12 A;  1I4X A;  2HCI A;  4A3F B;  1WVL A;  5IOC A;  1GUW A;  1O80 A;  5JJZ A;  2HUG A;  1E22 A;  2F52 A;  3GTG B;  1EFI D;  3MEF A;  2I0Q A;  1ET6 A;  2K5H A;  3I4N B;  1C4Q A;  1BUV T;  2IX0 A;  3A8I E;  3FPU B;  3IL8 A;  5BR8 Q;  2HQL A;  2PQA A;  1JJ2 A;  4RMF A;  1F9S A;  5CV5 A;  4LF9 L;  1YIJ A;  2ZJP A;  1VQ6 A;  3PUY A;  2A73 B;  1KLG D;  2JEA I;  2LMC B;  5E7N A;  1T5E A;  2KOL A;  1UE6 A;  4ULL A;  5E1F A;  3QG1 A;  3S1Q H;  1TS4 A;  5J1Z A;  5C0X G;  4XIG S;  1VQ4 A;  4POG A;  5JJL A;  1VQ7 A;  3FVQ A;  4A3F G;  1XWE A;  2G9H D;  2ZTC A;  4DR1 L;  1STY A;  1GXD C;  1LLR D;  4IZ8 A;  4X66 Q;  3U9S A;  1HUM A;  4NXM Q;  1PHJ A;  1LTG D;  3GTL H;  1JJC B;  1KXL A;  3HKZ G;  5GAH C;  2VQE Q;  1DOK A;  1TXY A;  2I5M X;  4J8Q A;  3OTO Q;  1TY0 A;  1FJG L;  2PQA B;  3RD4 A;  4DUY L;  1PRT C;  2O5J C;  2FHT A;  4LUV A;  3H0G H;  4P72 A;  2F03 A;  1PTO F;  2B2U A;  2BE5 C;  4BY7 G;  1CQF A;  4X64 Q;  1STA A;  3L7Z C;  4IPC A;  5IP9 G;  4L5R C;  4EVO A;  1NJI C;  3R93 A;  4A75 A;  2X6L A;  1UE1 A;  4HID A;  2HHH L;  3J81 j;  1J9O A;  2NVY H;  2NVT H;  1Y8P B;  4GN5 A;  3OW2 A;  5EGT A;  1UAP A;  1N33 Q;  2I5L X;  3DLL A;  1SLJ A;  3ULP A;  2B2V C;  4U67 3;  1I50 H;  3QIA A;  2UUB Q;  3I4L A;  1JOO A;  4IN3 A;  3HOX G;  3FKI B;  2ES2 A;  1NBW A;  4ME5 A;  1E2W A;  5C5L A;  5D14 A;  2EXD A;  2JA8 G;  5J3B A;  1IBK L;  1B44 D;  3DUZ A;  4XXE A;  5AJ3 L;  2OQ0 A;  2A5H A;  1KTK A;  1X65 A;  3TP7 A;  1LM0 A;  2B2U C;  2CHB D;  4R9W A;  2IPK D;  1E24 A;  4A76 A;  4A3G G;  4FXK C;  2D9U A;  3D3R A;  2PYK A;  3H3V H;  1DZ1 A;  3CCV A;  3GTJ H;  3HOZ G;  1LT6 D;  4LF9 Q;  3OHX C;  1U9R A;  1N34 Q;  4DK3 C;  1HNW Q;  2SNM A;  5E4W C;  5C6A A;  5BR8 L;  2B63 H;  4HCE A;  1EQQ A;  3MXN B;  3JC6 6;  4QCL A;  1AE2 A;  1NY4 A;  5M3M H;  1QZG A;  3HOY B;  2IHF A;  4YY3 Q;  1SJH D;  2EIF A;  1EYG A;  5T1G A;  3VR3 A;  2BE5 D;  2G5D A;  5C0X I;  3PF5 A;  3TME A;  2VQF Q;  2VUM G;  1HXY D;  1L0X B;  4DPG A;  2FMM A;  2KEE A;  1C7Y A;  2DJG C;  1RIP A;  1CKN B;  3KLS X;  3PCO B;  4A3G H;  2F0D A;  1UEB A;  2GA4 B;  4JV5 Q;  2PZW A;  1G2T A;  3VYS A;  3HOV G;  1S5C D;  5ELB A;  4B9W A;  4PV1 C;  1PDQ A;  5HY6 A;  1PTO B;  5EKI A;  3HP3 A;  3EVQ A;  4A93 B;  1QJO A;  1TII D;  1BVS A;  3CQZ H;  1PTO H;  1CSP A;  1Y8O B;  1Q7Y C;  4FXD A;  1N34 L;  3T1Y Q;  1JWM D;  3PSI A;  3CRL C;  1EZ8 A;  4X65 Q;  2VZA A;  3CF5 A;  1GVP A;  2VS1 A;  4WJW A;  4IUQ A;  5JEA H;  2OEO A;  5JEA J;  3QB3 A;  1QG7 A;  2FJ2 A;  3Q23 A;  4X64 L;  3V96 A;  2K5V A;  5EPL A;  4A4I A;  1UEA B;  3CP0 A;  3T16 A;  4QY7 A;  2CVR A;  4N9P A;  2GVA A;  3WOF A;  1Q90 A;  1X3G A;  3ERO A;  3TP8 A;  3BVM A;  2L55 A;  4OO1 H;  3TP6 A;  1G51 A;  4DR3 Q;  1GOZ A;  1PZI D;  2AWO A;  4YCW A;  2EYO A;  3PO3 B;  2C5C A;  1BOS A;  5KND A;  5A2Q L;  4MIU A;  4FYD A;  4OIJ A;  3KF8 A;  1N33 L;  1U4L A;  1VQL A;  3I73 A;  2HHH Q;  2UXC Q;  1K0R A;  1Q46 A;  4J1M A;  4JI1 Q;  3S14 H;  1SE3 A;  3KBG A;  4WOR A;  1XYI A;  2Y0S B;  3QJY A;  5LHY 1;  4A3B B;  1RF2 D;  1B9N A;  3LX0 A;  3C3L A;  4LF7 L;  3DWP A;  1XTC D;  3LNN A;  2EYJ A;  1FJG Q;  1X3E A;  2F4V Q;  4K5W A;  2IWH A;  1KLU D;  1E7Z A;  3P1H A;  3VR5 A;  4CDF C;  3HOW G;  4A3L G;  4N9T A;  5M9O A;  2NUC A;  4YWM A;  4DN4 M;  3J81 i;  4A3F H;  3CD6 A;  2BH2 A;  3CC2 A;  2JA8 B;  1STB A;  3P7J A;  2Z9H A;  2PI2 E;  3NEL A;  1PRT F;  5L37 A;  4EQ5 A;  3S1M H;  3D8G A;  4C3H G;  3ZYY X;  1CA5 A;  3J81 L;  1VQM A;  2D0P A;  3NEN A;  4GN4 B;  4A3J H;  1NMG A;  2LSS A;  4NW2 A;  3HOX B;  1V1P A;  3OW7 A;  1VQC A;  1C0A A;  3K5M A;  4JI5 Q;  2WAC A;  2EY2 A;  4CDD C;  3PF4 A;  1A3V A;  1XMO L;  4JI3 Q;  1G91 A;  3OMG A;  4XYQ A;  4KY6 A;  3K8A A;  1I6H H;  5FLM G;  3PMF A;  4ZRZ A;  1J6Q A;  3GTP B;  1YBY A;  4A3M H;  1EL0 A;  4JI7 L;  1L0Y B;  1MJC A;  4FXG C;  4OWX B;  3K58 A;  3JAM E;  1JB7 A;  5IYC H;  4IFD I;  2E2H H;  4QQB X;  1A62 A;  4LFB Q;  5C4Z A;  2Y0S E;  1N32 L;  1S5D D;  1SSO A;  2RKS A;  4RHR A;  2VQF L;  1LYL A;  1E3P A;  4IPD A;  4TQU S;  3SK5 A;  3P75 A;  2MFI A;  2R7Z G;  2F3V A;  4JI6 L;  2YTV A;  1R9T H;  1F9R A;  4A3E G;  1WYD A;  3J80 E;  2NN6 H;  4IUU A;  1R9T B;  1XPU A;  3HKS A;  5HUR A;  2R7Z H;  4C3J B;  5I4D A;  3HOZ H;  4A3E B;  3RMH A;  5GRO A;  1DCZ A;  5G3L D;  3SEB A;  1FNU A;  3CPW A;  3LWE A;  3JAM c;  1QE6 A;  4ZYS A;  2L4N A;  1QWY A;  4KN4 C;  3KJO A;  1EU3 A;  3S17 B;  2PMZ E;  3I3C A;  4F8M A;  1XNQ L;  3A7L A;  1BKB A;  1Y69 U;  2ZTD A;  2R93 H;  3PUW A;  4JOI C;  2CW0 D;  2L11 A;  1HNX L;  5ELC A;  3BVG A;  1ILQ A;  4R4C A;  3HOY G;  3CQZ B;  4DFA A;  1J5E Q;  5I9P A;  3EIV A;  1SAP A;  3RLO A;  3G48 A;  3VDY A;  1I4H A;  1ZXT A;  4O42 A;  3UDG A;  4IUN A;  1ML0 D;  2BDO A;  1PFM A;  3T51 B;  2KCC A;  1Q12 A;  3E3X A;  2EXZ A;  1SRU A;  2R6G A;  3U4Z A;  2JA8 H;  1SBB B;  1GO3 E;  4GOP C;  4LNQ A;  3HOZ B;  2WKC A;  1U0L A;  3F2C A;  1LTL A;  3LGJ A;  3J7A V;  4A3G B;  2CH4 W;  5IOD A;  2OQK A;  1KAB A;  1OTC A;  1KQS A;  4GKJ L;  1QB5 D;  1Q8K A;  4GN3 B;  3F2B A;  5IGG A;  3BZD B;  4G7Z C;  4P75 A;  4DAP A;  1NSN S;  1D7Q A;  2LFN A;  3GTP H;  2Q8I B;  2KHS A;  5I2X A;  3NBH A;  1LAB A;  1J8I A;  3L3O C;  3F8T A;  1IBL L;  2K04 A;  2PW5 A;  3ND9 A;  1KAA A;  2KUM A;  4HIM A;  4IFD H;  5CBE E;  1CK1 A;  3IKJ A;  2L9H A;  3X3N A;  3C46 A;  3GTM B;  1XNR L;  5HGT A;  4NXM L;  2JSO A;  1BO0 A;  4APV A;  4X66 L;  1JE4 A;  4DGZ A;  3I91 A;  1TR5 A;  4P2C B;  1I4Q A;  1AEX A;  2KQ3 A;  1KRS A;  4HMI A;  1GUN A;  2DGY A;  1CTM A;  2EZV A;  1WTX A;  3A56 A;  1KDA A;  1IBL Q;  4BY7 B;  3MZ5 A;  2F0N A;  4KLK A;  2K01 A;  1Y1V G;  1QUQ A;  1DOM A;  3PO2 B;  1JWS D;  2EJM A;  4Y52 H;  2ZJR A;  5ELF A;  1WI5 A;  2GN5 A;  2E2I B;  5JVH 3;  4C3H B;  2B2Y C;  4OX9 Q;  1DJR D;  4HJA A;  3P20 A;  4C3I H;  4RCN A;  4FO2 A;  5I2Y A;  4IFD G;  3E0J A;  4QIW B;  2NVX H;  1NNX A;  1ENF A;  5M5X B;  3GDE A;  4RCO A;  1BDO A;  4LMQ D;  1Q86 C;  1K8O A;  1A2T A;  1K83 H;  2OTL A;  4H44 C;  3GV3 A;  1OO9 B;  1Q8I A;  2F0I A;  2EDG A;  3FP9 A;  3CCQ A;  1TT2 A;  2RF4 A;  2PW7 A;  2FMC A;  3PUZ A;  3J80 i;  4JI2 L;  1CQV A;  4DV3 Q;  3DM1 A;  1Z9F A;  3MA2 B;  5KIX A;  4DR5 L;  1J5E L;  2N78 A;  3S1R H;  1E2Z A;  1JR0 D;  5IY0 A;  2R92 H;  5C4X B;  3MC0 B;  1KC8 C;  3M85 A;  3D6W A;  3M4P A;  4X3U A;  2G9D A;  1S72 A;  4RWS C;  1IYJ B;  1IYU A;  2UXD Q;  3PO3 G;  4FF3 A;  2F0V A;  5ELE A;  1TY2 A;  3RLN A;  1FGU A;  4ZUI A;  1KAW A;  4NKL A;  1OXV A;  2BA0 A;  3J7A 5;  1EYD A;  3A55 A;  3A7A B;  3PV0 A;  5J22 A;  1HCZ A;  2BDN A;  3TRE A;  1BR9 A;  3CCJ A;  1HUN A;  1EEI D;  2K5W A;  3CCM A;  1N8R C;  3J80 c;  5IYB G;  5LMU L;  1EIH A;  1IL2 A;  3B6Y A;  3QWN A;  1FR3 A;  5FO9 B;  3ICE A;  4Q5V A;  4G57 A;  3STB C;  4DV0 Q;  4JI3 L;  5C4J B;  1XMO Q;  1IBM L;  3DM3 A;  3N52 A;  4DAY A;  1BXT A;  4RKL A;  2F0M A;  1S5F D;  3CXC A;  4OEM B;  4OHJ A;  4DV3 L;  1SNM A;  3WDN A;  2A68 C;  2CCZ A;  1H9S A;  4HCS A;  4BY7 H;  4LWC A;  2R61 A;  1AP0 A;  1FYC A;  1PLF A;  3TEH B;  2ZXP A;  3KF6 A;  2K5D A;  3NBH B;  1T9H A;  1L0W A;  4AYB E;  2HT1 A;  2B2Y A;  4J15 A;  1WFQ A;  2VL6 A;  3J7Z C;  3SK8 A;  5KEE A;  4DV4 Q;  2UUA Q;  5EPK A;  4A3I G;  2NVQ H;  2B39 A;  2EJG C;  4V19 0;  4JYA Q;  3NWT A;  1STG A;  1X3Q A;  4DV5 L;  1WTV A;  3HOY H;  4PG3 A;  1DYQ A;  1STE A;  1SYC A;  2B3G A;  3TDQ A;  2K52 A;  1NAP A;  2QDL A;  3W1G A;  5FLM H;  3K0X A;  2UXC L;  2N88 A;  1PFN A;  5C4J H;  1SNQ A;  4Q0F A;  2B63 G;  3OWE B;  1D5Z C;  1YJN A;  2XNA C;  1VQO A;  1TWF B;  4BBR G;  1EWI A;  1GM5 A;  2K4K A;  2MP1 A;  3CCU A;  1TS3 A;  3AYH B;  2UUA L;  4LF7 Q;  2JA6 H;  3TZU A;  5CBA E;  3H0G G;  5D65 A;  1FVI A;  2VQE L;  1TWF H;  3RNU A;  2BOS A;  3CPF A;  4JBM A;  1KL9 A;  5CR3 A;  5FO7 B;  2WB1 G;  4K2L A;  2XN9 C;  4F88 A;  3A5U A;  2JXM B;  2XRQ D;  3G7L A;  1HZB A;  1Q1B A;  5JPN C;  3VA7 A;  3KLW A;  2JP1 A;  3TZD A;  4FF1 A;  1LAC A;  5K36 G;  2DNE A;  2DY8 A;  5DNF A;  1D5X C;  3KDF B;  1AZP A;  1EYC A;  5CMD A;  3S17 H;  2IT1 A;  4B9X A;  4CKB A;  1MD2 D;  1MBY A;  2MO0 A;  4KKT A;  1MHW C;  3F2D A;  3K81 C;  1WCM H;  3HOV H;  3KLS A;  4CGY B;  1I4P A;  4QMG A;  2F0L A;  4BS9 A;  3PIO A;  2CH4 A;  1TWG B;  4KN7 C;  4LF5 L;  2AUJ D;  5KYI A;  1XPO A;  1VQ5 A;  2F0P A;  4CKC A;  2MJ8 A;  3HG9 A;  1QNK A;  2KHJ A;  4KMU C;  3K7U C;  3ER0 A;  1EIY B;  4CDE C;  4DUZ L;  2KEN A;  1VQD A;  3HEJ A;  1SJE D;  3S1Q B;  1S5B D;  4P73 A;  4WJ3 M;  2J0T D;  1YJW A;  1PXU A;  1LTT D;  4DU9 A;  2KVM A;  2HIV A;  3BG3 A;  1I6H B;  4DAY B;  1JCK B;  4PZ8 A;  3C1F A;  4C2M H;  1ASY A;  3CKI B;  3CU7 A;  3JAM i;  2Q8R E;  1P16 A;  5C4H A;  1VQP A;  4WJ4 A;  3VYU A;  2UXB Q;  2NVQ B;  1B2T A;  1CFM A;  1VQB A;  5IT9 c;  2R7D A;  1AZQ A;  1YNN D;  2O2L D;  2Q2U A;  1QVG A;  1V1O A;  1UWV A;  2F0J A;  1WJJ A;  3GTQ B;  1PFB A;  1EUJ A;  1XMQ L;  1SRO A;  1KD1 C;  2UXB L;  3O13 A;  4KD4 A;  2D0O A;  3F1Z A;  4ZAI A;  1NCV A;  1F2Y A;  3PUX A;  5C3E H;  2RVL A;  1Y8N B;  4QIW E;  1UE5 A;  4HJ5 A;  5FJ8 G;  1B1Z A;  2SNS A;  2Y0S G;  4GZY C;  4NXN Q;  4IUP A;  1SMY C;  3NBI A;  1VDZ A;  3GO5 A;  2UXD L;  1SEB D;  5LL6 X;  2F3I A;  1AFP A;  3S1R B;  1NR4 A;  5C0X J;  4IJH A;  4P71 A;  4Y7N B;  1PTO C;  3WWV A;  4G7H C;  1HZA A;  5E3F A;  5FOB B;  2EE1 A;  4UY8 C;  3RZD H;  3KFU A;  4A3D B;  1D5M C;  3CCE A;  1N32 Q;  4MZ9 A;  4GOP A;  1HNZ L;  3S9W A;  3GTL B;  1Y1V H;  3K57 A;  1JE5 A;  1FNW A;  1B8A A;  2Z6B A;  3M3Y H;  2FIN B;  1WD1 A;  1K0S A;  3E5S A;  1PRT B;  2F3W A;  2NN6 I;  3I7F A;  1STH A;  3HS0 C;  4OO1 I;  2WFW A;  1VF7 A;  3CCL A;  1CM9 A;  1SE2 A;  2KHI A;  2Q2I A;  4LF8 Q;  3BVZ A;  3ND8 A;  5DM6 3;  2F0F A;  3H6M A;  3PO2 G;  4FF2 A;  2QF7 A;  1E2V A;  2A69 C;  1KDB A;  1EFW A;  2ZXR A;  1I94 L;  4E6I A;  1GUT A;  1RTN A;  2D2C C;  5M5W B;  5KNC A;  4A3M G;  3I8Z A;  1SR3 A;  1PH2 A;  4A93 G;  3NSW A;  4BWG B;  1NUC A;  3D4W A;  4GNX A;  1FD7 D;  4DR4 Q;  4RA8 A;  1MJE A;  1Q82 C;  4BY1 G;  4A3B H;  4AIM A;  2E74 C;  1NTG A;  3NEM A;  1KNA A;  3K5O A;  4LFA L;  3OIP A;  1DON A;  3AQQ A;  2E75 C;  1HA6 A;  1PYS B;  3GP7 A;  1O78 A;  3T53 B;  1I94 Q;  2L5T A;  2VUM H;  3M4Y A;  5AFW A;  1EY0 A;  2Z6K A;  1EOT A;  4TSS A;  4BA2 I;  3MAQ A;  2E2I H;  1IKL A;  2A1A A;  4K8I A;  2VUM B;  1EY6 A;  3I4M G;  2JEB I;  1JMC A;  1JB3 A;  4OWT B;  2RDH A;  2B8G A;  3L2P A;  4R4Q A;  1JOQ A;  4YCV A;  1G6Z A;  2PMZ B;  4UP7 A;  4A93 H;  5DAU A;  4BXX G;  3C1E A;  1AE3 A;  1U4P A;  2JQO A;  4WRD A;  2CWA A;  3NTH A;  4GKJ Q;  3AFP A;  1O7L A;  4FVM A;  3KJP A;  1YIT A;  3BS1 A;  1HQM C;  4ZCK A;  1I4G A;  2KBN A;  2ZT9 C;  4R4O A;  4A3K B;  4K0K L;  4DA2 A;  2NTS A;  3I56 A;  1EY7 A;  1I50 B;  4ZUJ A;  4DK0 A;  2E2J B;  4I65 A;  4KY5 A;  3TS0 A;  1TWC H;  4BBS B;  1X56 A;  4YHH L;  4X65 L;  2K5Q A;  1X3P A;  2M2L A;  3W2D A;  2NVX B;  5CC4 A;  2M00 A;  4GLA C;  3K59 A;  3T1Y L;  2AUK A;  2QKI C;  4RGT A;  4XQQ A;  2QW7 A;  1X6O A;  3GTO B;  2IJ0 A;  2L1B A;  4GOP B;  3HOV B;  3R8B A;  2K03 A;  3DHQ A;  2NZO A;  4UP9 A;  4L5Q A;  5BN5 A;  1RJT A;  1II3 A;  5IT9 E;  4OWW B;  5H1S E;  3MXP A;  1KHI A;  2R7Z B;  3BDL A;  2K05 A;  4X62 Q;  1IKM A;  1WCM G;  3K0Y A;  3URY A;  4IFD J;  4NPS A;  4NMZ A;  4V0B A;  1SE8 A;  1LT3 D;  1HR0 W;  1B9M A;  3J80 L;  3S2D B;  3BJU A;  4MNO A;  4DR6 L;  4DR2 L;  4B3T L;  3PIP A;  4B3S Q;  2HCC A;  4JI8 Q;  2E8G A;  5COR A;  4B3S L;  4KKS A;  4R4I A;  5E4X A;  3UDF A;  4C1N I;  4JI5 L;  3MWY W;  3KOJ A;  3EJI A;  1A0I A;  1RHP A;  3K5N A;  1L1O A;  5TSS A;  2CQA A;  2B8F A;  4KHP Q;  2A6H D;  2EYL A;  4RKB A;  2ICI A;  4JK1 C;  5M3F H;  4K5V A;  1YHQ A;  1IYV A;  1EYA A;  3BYY B;  4F7X A;  4B3R Q;  5EKL A;  2ATW A;  3ERS X;  1YZ6 A;  4HMJ A;  2JA6 G;  3ULL A;  4A3I B;  2UUC L;  4A3K H;  1H95 A;  5IYD H;  2K1B A;  3S24 A;  5IP7 G;  3PIP 3;  1WCM B;  1ESF A;  3KDF A;  1K3R A;  1VQF A;  3PO3 H;  1EY8 A;  1GD7 A;  1CKN A;  3QR8 A;  3GTJ B;  4I7A A;  1A3T A;  3M3Y B;  1GJX A;  4ZKB B;  5M5W H;  4QB4 A;  3CAM A;  5C0X H;  3UDI A;  2CKZ B;  4KV6 A;  4DNT B;  1PYB A;  5IGC A;  4YIJ A;  3PUV A;  4IQZ A;  4YWL A;  5FJ8 H;  3KK7 A;  1W2B A;  2BA1 A;  4BBR H;  4KD3 A;  3DWA A;  1XXG A;  4O1N A;  3SK4 A;  2JE6 I;  1PA6 A;  4K0K Q;  3MHB A;  2PQE A;  5IE8 A;  3CMA A;  5JJI A;  1WTO A;  4I7Z C;  1WTQ A;  1ENC A;  1RTO A;  3ZJY C;  1NE3 A;  1Q3L A;  1G2S A;  3GQB A;  5FLX c;  3K80 C;  1EQR A;  3DMU A;  5AJ3 Q;  3Q22 A;  5T1I A;  1HR0 Q;  2JA6 B;  4K14 A;  1DOL A;  3LWU A;  3SK6 A;  3MFG A;  4R8N A;  1VQA A;  2SDF A;  2NZH A;  4IPG A;  1IW7 C;  4KY7 A;  2K5N A;  5CV8 A;  5NUC A;  2LKV A;  2C9O A;  3S15 B;  1F9Q A;  1I3Q B;  2ID0 A;  3OSO A;  4LFA Q;  1PFS A;  1V8Q A;  4HIK A;  4A3D H;  1EY9 A;  3MFY A;  1A15 A;  3ULJ A;  2RSO A;  2RA4 A;  1SYB A;  2R93 B;  1MSG A;  4C3I B;  3HZX A;  4A3E H;  3Q6S A;  1G6P A;  1SYE A;  1XX8 A;  2MGS A;  4YWK A;  3PO2 H;  5GAD C;  3KYH C;  2MQH A;  4JYA L;  4MTK A;  3PQI A;  1OXU A;  3U9O A;  1UE7 A;  1LTA D;  3RN5 A;  2WP8 J;  1EOV A;  5M5Y H;  2ZTE A;  1MIU A;  1DXM A;  2WKD A;  3KF8 B;  4X3S A;  3L9A X;  4DK6 C;  5A35 A;  3CHB D;  4HSV A;  1XJV A;  1X54 A;  1PH4 A;  3IFT A;  1XNR Q;  1N9W A;  2R92 B;  2K33 A;  1AN8 A;  5EAY A;  2DJF C;  4PQX A;  2X69 A;  3BU2 A;  1HQR D;  3MXG A;  2SEB D;  2O5I C;  5GAE C;  4RGM A;  3HOU B;  3H15 A;  1FNV A;  2OCE A;  2N8N A;  4L6T B;  1TWH H;  4B08 A;  3DEO A;  4AYB B;  1VCI A;  4DNR B;  4IOA A;  4HJ8 A;  3OWF A;  4QL5 A;  3E0E A;  4DV7 Q;  2E5L L;  1U4M A;  4Y7N H;  3TBI B;  1TS2 A;  4C3H H;  4A3J G;  3TN2 A;  1K8G A;  3NHH A;  2AQ3 B;  2QGQ A;  4ZK9 B;  3PIO 3;  2KED A;  4GKK L;  4MTN A;  3AU7 A;  1VQE A;  2F4I A;  4DV1 L;  2VB2 X;  1VMP A;  2PCF B;  3KUP A;  3U4V A;  2RBM A;  3ITP A;  1WTR A;  1Y1V B;  2M9V A;  2PZT A;  3VR2 A;  2IW3 A;  2F0T A;  2YYZ A;  3OOC A;  2KCM A;  2KCN A;  4PMB A;  3V2T A;  1TWA H;  5EJW A;  4KJN A;  4M8A A;  4KHP L;  4GKK Q;  5IYC G;  4A3L H;  4OXP A;  3Q24 A;  1HPC A;  4JV5 L;  3Q0A A;  1ET9 A;  4DK1 A;  4QGU A;  1PH6 A;  4XT1 B;  3S15 H;  1HNX Q;  1CUK A;  3OMC A;  2QIL A;  3H3V I;  3E9I A;  4IUT A;  5JAV A;  1K3B C;  2K6A A;  2AQ1 B;  2RHS B;  5C44 H;  4LF4 L;  4BY1 H;  2A19 A;  4A3B G;  1S4Z A;  1NR2 A;  3UE0 A;  4OGQ C;  1PYW D;  2ASB A;  3T1H Q;  2IX3 A;  4YY3 L;  3K5L A;  3BYT B;  3EQL C;  4JCV E;  1ESR A;  1B53 A;  4FNF A;  1KIX A;  3R2I A;  2VW9 A;  2A8V A;  1VF5 C;  2ZM6 Q;  3BZK A;  4TKO B;  2K28 A;  2NZ1 D;  2QA4 A;  5JPM C;  1C8C A;  3J81 c;  1IHZ A;  4ID6 A;  4IUR A;  1JT8 A;  5C3W A;  4A3C G;  3CME A;  1UUP A;  2JA9 A;  4CBV A;  5LL6 S;  1F2Z A;  4DXF A;  4MN3 A;  3M7G A;  3A5Z B;  2X6G A;  2K14 A;  2B29 A;  2HDL A;  2DUD A;  1EQV A;  2PNR C;  3OTO L;  1GKH A;  1RL2 A;  1WOC A;  2YU9 B;  1ONL A;  1L1O B;  2EVB A;  5BN4 A;  4L5S A;  4CJ1 B;  2MUY A;  2EJF C;  4HJ9 A;  4JW0 A;  1PZK D;  4HAE A;  2KJX A;  3NK9 A;  4DV6 Q;  3QOJ A;  3V05 A;  1VQJ A;  3K7A B;  1HRJ A;  5FK9 C;  5J39 A;  2B2W C;  1SMX A;  3I4O A;  1RKN A;  4JBJ A;  1JC7 A;  1B7Y B;  3SXH A;  1YI2 A;  3NQT A;  4JBW A;  2AMC B;  3RUZ A;  2RDF A;  2ENB A;  1LO5 D;  4DUY Q;  5I6Y A;  2L15 A;  2RSN A;  1EZ6 A;  5K36 H;  4RGN A;  4CJ0 B;  1E0B A;  2VB3 X;  4JI1 L;  2QCP X;  4RHS A;  1A6X A;  4K8J A;  4JC0 A; 
#chains in the Genus database with same CATH homology
 1F77 A;  3E6Z X;  4M1U B;  1BBX C;  1I4R A;  1S5E D;  4KTA A;  5EKK A;  2EYF A;  1FGB D;  4K6L A;  2D62 A;  1WTW A;  1LT5 D;  2K32 A;  1HTP A;  1GUS A;  5KNB A;  2F0O A;  4S3S A;  5FO8 B;  4FF4 A;  1AW7 A;  5I6W A;  3HOW B;  2L0C A;  4QUF A;  1C48 A;  2E2H B;  1B3A A;  1SNO A;  3S2H B;  2TMP A;  4PNY A;  2Z8L A;  1TKW B;  2TSS A;  4X3K A;  1STN A;  5EQ0 A;  1EEF D;  5G3L F;  4ZLT F;  1O7Y A;  4L8J A;  3RLF A;  4HR7 B;  1BCP B;  3HGB A;  1CT1 D;  2B2T C;  2B63 B;  5D3I B;  2A6E C;  2NN6 G;  1F2M A;  3J7Y W;  1H9K A;  2EOT A;  5FKA C;  4X3T A;  1CHQ D;  3GD7 A;  3RZO B;  1PZJ D;  1SXT A;  3R2T A;  2VNU D;  3MTS A;  1YNJ D;  1U4R A;  1X32 A;  4OO1 G;  1HA5 A;  1ENA A;  2DY7 A;  1D6E C;  2F0S A;  5CGK A;  4MHE A;  4ODG A;  3QO2 A;  5EBC A;  2LS0 1;  1SDF A;  4IAL A;  1CZG A;  1BF4 A;  2EYM A;  1Z47 A;  1F2L A;  2AQ2 B;  1EU4 A;  4KJO A;  4CKE A;  2RDG A;  1CHP D;  5DM7 3;  5CV6 A;  1ZKO A;  3TSS A;  4DXG A;  4OL7 A;  2IL8 A;  2XWB B;  1G29 1;  3A8K E;  1BQQ T;  3J81 E;  2EYH A;  1MSH A;  2F0K A;  2A6E D;  5M3M B;  1TWH B;  3CRK C;  2A68 D;  2QDB A;  2NTT A;  1HHV A;  1Z7T A;  3D31 A;  3G6J B;  1MI2 A;  1LTB D;  2MHV A;  1W6J A;  1GHK A;  4WFN 3;  2A74 C;  3QOL A;  1YNJ C;  3F2U A;  1EQT A;  5A2Q E;  5CV4 A;  2F0Q A;  2CW0 C;  4J6H A;  4G4K A;  1EY4 A;  3S16 B;  1HFG A;  4XDX A;  2WV6 D;  3AB9 A;  4QUC A;  3T4A C;  3VYR A;  3EFX D;  1BNZ A;  1LTS D;  2Z4I A;  3MXN A;  1TWC B;  4CHT B;  3GTK B;  2HQE A;  2R3Z A;  3FEW X;  5IGE A;  1PMR A;  3H0G B;  1H9R A;  1WTP A;  1OXX K;  4LAA A;  5C3E B;  1D1I A;  1QIL A;  1LTI D;  1M8A A;  3I70 A;  3I72 A;  2JA5 B;  4RH6 A;  2B2V A;  3EA6 A;  1JIC A;  1R4P B;  1GUG A;  1LV9 A;  2Z1C A;  2JYO A;  3MEH A;  4LJZ C;  1Q1E A;  4NDX A;  3H3V C;  1I6V C;  4KI0 A;  3A8J E;  1V43 A;  1H9J A;  1CA6 A;  4EQN A;  5M3F B;  2FFK B;  1D1K A;  4PMW A;  1B4O A;  4HN7 A;  1YNN C;  3NE5 B;  4OIK A;  3H09 A;  3SE0 A;  4F87 A;  1JQY D;  3SDZ A;  2PZU A;  5IIF A;  5I9O A;  3D4D A;  1OXS C;  3IFD A;  4LK1 C;  4DF7 A;  4ILW A;  4R8I A;  1T5X D;  2B2W A;  4CJ2 C;  3SVM A;  1SMY D;  1Z6H A;  3I90 A;  5KRU A;  1SFO B;  5FLX E;  4RAU C;  1PTO D;  5KYL A;  5CV9 A;  1CZW A;  3C2P A;  3SHL A;  4C3J G;  2SOB A;  1F9P A;  2XVS A;  3DXJ C;  5JEA G;  2WAQ B;  4BY1 B;  4KKU A;  1DM0 B;  5D3D A;  4KHZ A;  1ZEQ X;  4H0L C;  2NBF A;  1RDP D;  3W3A A;  3HRZ C;  3S1N B;  3R3O A;  2XIW A;  4L63 B;  3D4R A;  3FMC A;  2Q8T A;  2KEC A;  4IUV A;  2NB0 A;  2VXW A;  2E2D C;  2D5D A;  3UI2 A;  5IT9 L;  3DEP A;  5F2D A;  1BCP D;  1HFN A;  5IGB A;  3T13 A;  4PMC A;  2ICE C;  4XTC S;  3NQI A;  1V1P B;  3A54 A;  2Z4H A;  1ZYR C;  2H1E A;  4EQP A;  1SND A;  2BCO A;  4RFB A;  1K8M A;  2H4O A;  1MGS A;  3KLR A;  3X3M A;  1BCP F;  1SE4 A;  2F1M A;  3JAM L;  1D2B A;  1TU2 B;  3NTI A;  1LTR D;  2AWN A;  2NVY B;  5IGD A;  1B50 A;  4NP5 A;  5JOB A;  2DN8 A;  4KK7 A;  1R4Q B;  3ERQ A;  5JVG 3;  3FPP A;  1SYD A;  1TQO A;  4K5X A;  2LY7 A;  1W6K A;  3IAY A;  3K6O A;  2N55 A;  3NTK A;  4XQN A;  2PPB C;  2NVT B;  5C5M A;  1H9M A;  2NYZ D;  5DEH A;  4XT3 B;  2WII B;  1HTL D;  2EY6 A;  1JOK A;  4H7B A;  3VA5 A;  3N6R A;  1RCV D;  4H13 C;  2XWJ B;  1QOH A;  4HED A;  3VYT A;  1G8Z D;  3S1M B;  2DNC A;  1ROD A;  2IX1 A;  3H91 A;  3NXW A;  4EQO A;  1DD2 A;  1A3U A;  2O4X A;  2V4D A;  2EY5 A;  4K2K A;  3NP8 A;  5K5P A;  3BDC A;  2F0G A;  1ZYR D;  3M7N A;  1OXT A;  1CI3 M;  1K83 B;  3S14 B;  2F0W A;  4BA1 I;  5M5Y B;  3OIQ A;  4FP5 D;  3FDT A;  2F0E A;  1Y1W B;  2KA7 A;  3I4M B;  1EIG A;  1TWA B;  4ABN A;  3KBX A;  2A6H C;  2RQX A;  4UAI A;  5FLX L;  2EY1 A;  4C2M B;  2WB1 B;  3DWQ A;  2F0H A;  3OPO A;  2EPB A;  1KNE A;  1H9S B;  1O7Z A;  1EWH A;  4KHV A;  1SYF A;  2JA7 B;  2WIN B;  1SYG A;  3NPP A;  4A3M B;  5CV7 A;  4RGO S;  5COY A;  4BBR B;  4TRD A;  2A69 D;  1VMC A;  2QEJ C;  4XYO A;  1LT4 D;  4DAV A;  1JWU D;  3WOE A;  2I07 B;  1QCB D;  4G7O C;  1GHJ A;  3NUC A;  5EPJ A;  1A2U A;  4ZKC B;  1GUO A;  3HKZ B;  1EY5 A;  4EGV A;  3TP5 A;  1TVX A;  1UNS A;  1ILP A;  1SNP A;  3J7A F;  5C44 B;  5BN3 A;  2MPM A;  4A3J B;  3FRP B;  2ZXO A;  4U68 A;  4C56 C;  4HTH A;  5ELD A;  2OT2 A;  3H94 A;  3NWS A;  3ONA B;  5ISR A;  3AMU A;  2EYP A;  2B2T A;  5CYU A;  3VR4 A;  2K7V A;  3VR6 A;  2E76 C;  2J4X A;  2NWG A;  1ICW A;  1M4V A;  3MXU A;  3MVV A;  5C3X A;  2XRS D;  3BDO A;  3T56 B;  1WD0 A;  4HSP A;  2HDM A;  5EBD A;  2OF1 A;  1PRT D;  2PO4 A;  3RZD B;  4K6D A;  3SR1 A;  1SNC A;  1EWC A;  1RD9 D;  4QF4 A;  1IL8 A;  3D6C A;  4ZQ3 A;  2F0U A;  5KGU A;  2XSC A;  4XQJ A;  4C1N K;  1QNU A;  2OXP A;  1KDC A;  2I46 A;  3GV6 A;  4UDU C;  4Z9C B;  2J7Z A;  4C3I G;  5IGF A;  1IW7 D;  1BCP C;  1TS5 A;  3M4O B;  1JOR A;  2L12 A;  1I4X A;  2HCI A;  4A3F B;  1WVL A;  5IOC A;  1GUW A;  1O80 A;  5JJZ A;  2HUG A;  3GTG B;  1EFI D;  1ET6 A;  3I4N B;  1C4Q A;  1BUV T;  2IX0 A;  3A8I E;  3FPU B;  3IL8 A;  1F9S A;  5CV5 A;  3PUY A;  2A73 B;  1KLG D;  2JEA I;  2LMC B;  1T5E A;  2KOL A;  4ULL A;  5E1F A;  3QG1 A;  1TS4 A;  5J1Z A;  5C0X G;  4XIG S;  3FVQ A;  1XWE A;  2G9H D;  1STY A;  1GXD C;  1LLR D;  4IZ8 A;  3U9S A;  1HUM A;  1LTG D;  1DOK A;  4J8Q A;  1TY0 A;  3RD4 A;  1PRT C;  2O5J C;  2FHT A;  2F03 A;  1PTO F;  2B2U A;  2BE5 C;  1CQF A;  1STA A;  3L7Z C;  4EVO A;  3R93 A;  2X6L A;  1J9O A;  1Y8P B;  5EGT A;  1UAP A;  2B2V C;  4U67 3;  3QIA A;  3I4L A;  1JOO A;  4IN3 A;  3FKI B;  4ME5 A;  1E2W A;  5C5L A;  5D14 A;  1B44 D;  3DUZ A;  4XXE A;  2A5H A;  1KTK A;  3TP7 A;  2B2U C;  2CHB D;  4R9W A;  2IPK D;  4FXK C;  2D9U A;  3D3R A;  2PYK A;  1DZ1 A;  1LT6 D;  3OHX C;  1U9R A;  2SNM A;  5E4W C;  5C6A A;  4HCE A;  4QCL A;  3HOY B;  1SJH D;  5T1G A;  3VR3 A;  2BE5 D;  5C0X I;  3TME A;  1HXY D;  1L0X B;  2FMM A;  2KEE A;  3KLS X;  2F0D A;  2GA4 B;  2PZW A;  1G2T A;  3VYS A;  1S5C D;  5ELB A;  4B9W A;  4PV1 C;  1PDQ A;  1PTO B;  5EKI A;  3HP3 A;  3EVQ A;  4A93 B;  1QJO A;  1TII D;  1PTO H;  1Y8O B;  4FXD A;  1JWM D;  3CRL C;  1EZ8 A;  4WJW A;  4IUQ A;  5JEA H;  2OEO A;  5JEA J;  3QB3 A;  1QG7 A;  2FJ2 A;  3Q23 A;  3V96 A;  5EPL A;  1UEA B;  3T16 A;  2CVR A;  4N9P A;  3WOF A;  1Q90 A;  3ERO A;  3TP8 A;  3BVM A;  2L55 A;  4OO1 H;  3TP6 A;  1GOZ A;  1PZI D;  2AWO A;  2EYO A;  3PO3 B;  2C5C A;  1BOS A;  5KND A;  5A2Q L;  4MIU A;  4FYD A;  4OIJ A;  3KF8 A;  1U4L A;  3I73 A;  4J1M A;  1SE3 A;  3KBG A;  4WOR A;  1XYI A;  2Y0S B;  3QJY A;  5LHY 1;  4A3B B;  1RF2 D;  1B9N A;  3LX0 A;  3C3L A;  3DWP A;  1XTC D;  3LNN A;  2EYJ A;  4K5W A;  2IWH A;  1KLU D;  3P1H A;  3VR5 A;  4N9T A;  5M9O A;  4DN4 M;  2NUC A;  2JA8 B;  1STB A;  3P7J A;  1PRT F;  3D8G A;  4C3H G;  3ZYY X;  1CA5 A;  3J81 L;  4NW2 A;  3HOX B;  1V1P A;  3OW7 A;  3K5M A;  2WAC A;  2EY2 A;  1A3V A;  1G91 A;  3OMG A;  4XYQ A;  4KY6 A;  3PMF A;  4ZRZ A;  3GTP B;  1EL0 A;  1L0Y B;  4FXG C;  3K58 A;  3JAM E;  4IFD I;  5C4Z A;  1S5D D;  1SSO A;  2RKS A;  4RHR A;  4TQU S;  3SK5 A;  3P75 A;  2F3V A;  1F9R A;  3J80 E;  2NN6 H;  4IUU A;  1R9T B;  5HUR A;  4C3J B;  5I4D A;  4A3E B;  3RMH A;  1DCZ A;  5G3L D;  3SEB A;  1FNU A;  3LWE A;  1QE6 A;  4ZYS A;  2L4N A;  1QWY A;  4KN4 C;  1EU3 A;  3S17 B;  3I3C A;  4F8M A;  3A7L A;  1Y69 U;  3PUW A;  2CW0 D;  2L11 A;  5ELC A;  3BVG A;  1ILQ A;  3CQZ B;  4DFA A;  5I9P A;  1SAP A;  1I4H A;  1ZXT A;  4O42 A;  4IUN A;  1ML0 D;  2BDO A;  1PFM A;  3T51 B;  2KCC A;  1Q12 A;  2EXZ A;  2R6G A;  1SBB B;  3HOZ B;  2WKC A;  3J7A V;  4A3G B;  5IOD A;  1KAB A;  1QB5 D;  5IGG A;  3BZD B;  4G7Z C;  4DAP A;  1NSN S;  2LFN A;  2Q8I B;  2KHS A;  5I2X A;  3NBH A;  1LAB A;  1J8I A;  3L3O C;  2K04 A;  2PW5 A;  3ND9 A;  1KAA A;  2KUM A;  4IFD H;  5CBE E;  1CK1 A;  3IKJ A;  2L9H A;  3X3N A;  3C46 A;  3GTM B;  5HGT A;  2JSO A;  1BO0 A;  1JE4 A;  4DGZ A;  3I91 A;  1TR5 A;  4P2C B;  1I4Q A;  1AEX A;  2KQ3 A;  4HMI A;  1GUN A;  1CTM A;  2EZV A;  1WTX A;  3A56 A;  1KDA A;  4BY7 B;  3MZ5 A;  2F0N A;  2K01 A;  1DOM A;  3PO2 B;  1JWS D;  2EJM A;  5ELF A;  2E2I B;  5JVH 3;  4C3H B;  2B2Y C;  1DJR D;  3P20 A;  4RCN A;  4FO2 A;  5I2Y A;  4IFD G;  3E0J A;  4QIW B;  1ENF A;  5M5X B;  4RCO A;  1BDO A;  4LMQ D;  1K8O A;  1A2T A;  4H44 C;  3GV3 A;  1OO9 B;  1Q8I A;  2F0I A;  2EDG A;  1TT2 A;  2PW7 A;  2FMC A;  3PUZ A;  1CQV A;  3DM1 A;  3MA2 B;  5KIX A;  1E2Z A;  1JR0 D;  5C4X B;  3MC0 B;  3M85 A;  3D6W A;  4X3U A;  2G9D A;  4RWS C;  1IYU A;  4FF3 A;  2F0V A;  5ELE A;  1TY2 A;  4ZUI A;  4NKL A;  1OXV A;  2BA0 A;  1EYD A;  3A55 A;  3A7A B;  3PV0 A;  5J22 A;  1HCZ A;  2BDN A;  1BR9 A;  1HUN A;  1EEI D;  2K5W A;  1EIH A;  3QWN A;  1FR3 A;  5FO9 B;  4Q5V A;  4G57 A;  5C4J B;  3N52 A;  4DAY A;  1BXT A;  4RKL A;  2F0M A;  1S5F D;  4OHJ A;  1SNM A;  3WDN A;  2A68 C;  1H9S A;  4HCS A;  2R61 A;  1AP0 A;  1FYC A;  1PLF A;  2ZXP A;  2K5D A;  2B2Y A;  3SK8 A;  5KEE A;  5EPK A;  2B39 A;  2EJG C;  4V19 0;  3NWT A;  1STG A;  1X3Q A;  1WTV A;  1DYQ A;  1STE A;  1SYC A;  3TDQ A;  1NAP A;  2N88 A;  1PFN A;  1SNQ A;  4Q0F A;  3OWE B;  1D5Z C;  2XNA C;  1TWF B;  2MP1 A;  1TS3 A;  3TZU A;  5CBA E;  5D65 A;  2BOS A;  5CR3 A;  5FO7 B;  4K2L A;  2XN9 C;  4F88 A;  2JXM B;  2XRQ D;  3G7L A;  1Q1B A;  5JPN C;  3VA7 A;  2JP1 A;  3TZD A;  4FF1 A;  1LAC A;  5K36 G;  2DNE A;  2DY8 A;  5DNF A;  1D5X C;  1AZP A;  1EYC A;  5CMD A;  2IT1 A;  4B9X A;  4CKB A;  1MD2 D;  1MBY A;  4KKT A;  3KLS A;  4CGY B;  1I4P A;  4QMG A;  2F0L A;  4BS9 A;  1TWG B;  4KN7 C;  2AUJ D;  5KYI A;  2F0P A;  4CKC A;  2MJ8 A;  3HG9 A;  1QNK A;  4KMU C;  3HEJ A;  1SJE D;  3S1Q B;  1S5B D;  2J0T D;  1PXU A;  1LTT D;  4DU9 A;  2KVM A;  3BG3 A;  1I6H B;  1JCK B;  3C1F A;  3CKI B;  3CU7 A;  2Q8R E;  5C4H A;  3VYU A;  2NVQ B;  1B2T A;  1CFM A;  1AZQ A;  1YNN D;  2O2L D;  1V1O A;  2F0J A;  3GTQ B;  1PFB A;  3O13 A;  4KD4 A;  4ZAI A;  1NCV A;  1F2Y A;  3PUX A;  2RVL A;  1Y8N B;  1B1Z A;  2SNS A;  4GZY C;  4IUP A;  1SMY C;  3NBI A;  1VDZ A;  3GO5 A;  1SEB D;  5LL6 X;  1AFP A;  3S1R B;  1NR4 A;  5C0X J;  4Y7N B;  1PTO C;  4G7H C;  5E3F A;  5FOB B;  2EE1 A;  4A3D B;  1D5M C;  3S9W A;  3GTL B;  3K57 A;  1FNW A;  2FIN B;  1WD1 A;  1PRT B;  2F3W A;  2NN6 I;  3E5S A;  1STH A;  3HS0 C;  4OO1 I;  1VF7 A;  1CM9 A;  1SE2 A;  3BVZ A;  3ND8 A;  5DM6 3;  2F0F A;  3H6M A;  4FF2 A;  2QF7 A;  1E2V A;  2A69 C;  1KDB A;  2ZXR A;  4E6I A;  1GUT A;  1RTN A;  2D2C C;  5M5W B;  5KNC A;  3I8Z A;  3NSW A;  4BWG B;  1NUC A;  3D4W A;  1FD7 D;  4RA8 A;  2E74 C;  1KNA A;  3K5O A;  3OIP A;  1DON A;  2E75 C;  1HA6 A;  3GP7 A;  1O78 A;  3T53 B;  2L5T A;  3M4Y A;  5AFW A;  1EY0 A;  1EOT A;  4TSS A;  4BA2 I;  3MAQ A;  1IKL A;  4K8I A;  2VUM B;  1EY6 A;  2JEB I;  1JB3 A;  2RDH A;  2B8G A;  1JOQ A;  1G6Z A;  2PMZ B;  5DAU A;  3C1E A;  1U4P A;  4WRD A;  3NTH A;  1O7L A;  4FVM A;  3BS1 A;  1HQM C;  1I4G A;  2ZT9 C;  4A3K B;  4DA2 A;  2NTS A;  1EY7 A;  1I50 B;  4ZUJ A;  4DK0 A;  2E2J B;  4I65 A;  4KY5 A;  4BBS B;  2K5Q A;  1X3P A;  2M2L A;  3W2D A;  2NVX B;  5CC4 A;  2M00 A;  3K59 A;  2AUK A;  2QKI C;  4RGT A;  4XQQ A;  3GTO B;  2IJ0 A;  2L1B A;  3HOV B;  3R8B A;  2K03 A;  3DHQ A;  5BN5 A;  1RJT A;  1II3 A;  5IT9 E;  3MXP A;  2R7Z B;  3BDL A;  2K05 A;  1IKM A;  3K0Y A;  3URY A;  4IFD J;  4NMZ A;  4V0B A;  1LT3 D;  3S2D B;  1B9M A;  3J80 L;  2HCC A;  5COR A;  4KKS A;  5E4X A;  4C1N I;  3MWY W;  3EJI A;  1RHP A;  3K5N A;  5TSS A;  2CQA A;  2B8F A;  2A6H D;  2EYL A;  4RKB A;  2ICI A;  4JK1 C;  4K5V A;  1IYV A;  1EYA A;  3BYY B;  4F7X A;  5EKL A;  4HMJ A;  4A3I B;  2K1B A;  3PIP 3;  1WCM B;  1ESF A;  1EY8 A;  3GTJ B;  1A3T A;  3M3Y B;  1GJX A;  4ZKB B;  4QB4 A;  5C0X H;  4KV6 A;  4DNT B;  5IGC A;  4YIJ A;  3PUV A;  4IQZ A;  3KK7 A;  2BA1 A;  4KD3 A;  3DWA A;  1XXG A;  4O1N A;  3SK4 A;  2JE6 I;  3MHB A;  2PQE A;  1WTO A;  4I7Z C;  1WTQ A;  1ENC A;  1RTO A;  1Q3L A;  1G2S A;  3GQB A;  3DMU A;  3Q22 A;  5T1I A;  2JA6 B;  4K14 A;  1DOL A;  3LWU A;  3SK6 A;  3MFG A;  4R8N A;  2SDF A;  1IW7 C;  4KY7 A;  5CV8 A;  5NUC A;  2LKV A;  2C9O A;  3S15 B;  1F9Q A;  1I3Q B;  2ID0 A;  3OSO A;  1V8Q A;  1EY9 A;  3MFY A;  1A15 A;  2RSO A;  2RA4 A;  1SYB A;  2R93 B;  1MSG A;  4C3I B;  3HZX A;  3Q6S A;  1SYE A;  1XX8 A;  2MGS A;  1OXU A;  3U9O A;  1LTA D;  2WP8 J;  1DXM A;  2WKD A;  4X3S A;  3L9A X;  5A35 A;  3CHB D;  4HSV A;  3IFT A;  2R92 B;  2K33 A;  1AN8 A;  4PQX A;  2X69 A;  1HQR D;  3MXG A;  2SEB D;  2O5I C;  4RGM A;  3HOU B;  1FNV A;  4L6T B;  4B08 A;  3DEO A;  4AYB B;  1VCI A;  4DNR B;  3OWF A;  1U4M A;  3TBI B;  1TS2 A;  3TN2 A;  3NHH A;  2AQ3 B;  4ZK9 B;  3PIO 3;  2KED A;  3AU7 A;  2F4I A;  2VB2 X;  1VMP A;  2PCF B;  3KUP A;  2RBM A;  3ITP A;  1WTR A;  1Y1V B;  2M9V A;  2PZT A;  3VR2 A;  2IW3 A;  2F0T A;  2YYZ A;  3OOC A;  4PMB A;  2KCN A;  3V2T A;  5EJW A;  4KJN A;  4M8A A;  3Q24 A;  1HPC A;  3Q0A A;  1ET9 A;  4DK1 A;  4XT1 B;  3OMC A;  2QIL A;  4IUT A;  5JAV A;  2K6A A;  2AQ1 B;  1S4Z A;  1NR2 A;  4OGQ C;  1PYW D;  2IX3 A;  3K5L A;  3BYT B;  3EQL C;  1ESR A;  1B53 A;  4FNF A;  3R2I A;  1VF5 C;  4TKO B;  2K28 A;  2NZ1 D;  5JPM C;  1C8C A;  1IHZ A;  4ID6 A;  4IUR A;  5C3W A;  1UUP A;  4CBV A;  5LL6 S;  1F2Z A;  4DXF A;  4MN3 A;  3M7G A;  2X6G A;  2HDL A;  1EQV A;  2PNR C;  2YU9 B;  1ONL A;  2EVB A;  5BN4 A;  4CJ1 B;  2MUY A;  2EJF C;  1PZK D;  4HAE A;  2KJX A;  3NK9 A;  3QOJ A;  3V05 A;  3K7A B;  1HRJ A;  5FK9 C;  5J39 A;  2B2W C;  1RKN A;  1JC7 A;  3SXH A;  3NQT A;  4JBW A;  3RUZ A;  2RDF A;  2ENB A;  1LO5 D;  5I6Y A;  2RSN A;  1EZ6 A;  5K36 H;  4RGN A;  4CJ0 B;  1E0B A;  2VB3 X;  1A6X A;  2QCP X;  4RHS A;  4K8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...