4MNOA

Crystal structure of aif1a from pyrococcus abyssi
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
95
structure length
95
Chain Sequence
VIRVPLPEGNQLFGVVEQALGAGWMDVRCEDGKIRRCRIPGKLRRRVWIRVGDLVIVQPWPVQSDKRGDIVYRYTQTQVDWLLRKGKITQEFLTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 1A
publication title Crystal structure of aIF1A from Pyrococcus abyssi
rcsb
source organism Pyrococcus abyssi
total genus 29
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4mnoA00
1R9TH 4OO1G 4GLAC 1YJWA 1N36Q 2ES2A 3CCQA 3UDFA 1YNXA 4DV0Q 1LUZA 4L5SA 1AH9A 1K8AC 1RL2A 3W5OA 1PYBA 5HGQA 1CSPA 1YZ6A 1E7ZA 1TWHH 4P73A 4XIGS 3HOZG 1PYSB 3AQQA 4IPHA 1HR0Q 3HOVH 4BBRG 1IXRA 2OQ0A 5C44H 1HNWL 4YHHL 2ZJQA 4AQYL 2JA6H 2YTVA 5C3EG 2Q2TA 3S2HH 4JI0Q 2I0QA 1N36L 1KIXA 3RLFA 2FXQA 4DV5L 3PO3G 2VQEQ 1XPOA 2C35B 2YTXA 3L7ZC 4JG2A 3A74A 4R4TA 1IBMQ 1PH8A 2ZTCA 1KQSA 3CCJA 4LF4L 1C0AA 3G71A 4DR4Q 4B3TL 3GTGH 2VUMG 1KRSA 2N3SA 4X64Q 1WCMH 2PQAA 1QVFA 4XTCS 3CXCA 1EYGA 4JBMA 3U4VA 2Z0SA 2JK8A 3L0OA 1XMOL 4A3FH 1NY4A 1NBWA 2F3IA 2K5NA 4JI8L 1TXYA 2H5XA 3G6EA 1XJVA 1SE8A 1YJ9A 3EIVA 5FLMH 2K52A 4KLKA 1UWVA 4YCWA 4DUZQ 1TWAH 2F4VQ 4JI5Q 3GTOH 3PO2H 2LXKA 4IJHA 4YY3L 5FLXc 1JB7A 4APVA 4B3ML 4R4IA 3GTJH 1VQ4A 4LFCQ 5BR8L 2JEAI 1N32L 2ZM6L 1JJ2A 1XNQQ 1HZCA 1TWGH 2JJQA 4OX9Q 1CKNA 3U58A 3PV0A 4JC0A 1PH6A 1KHIA 5IP9G 3GTPH 4LF6L 4HIMA 4A3LH 2IHEA 1KL9A 4DV1Q 4JYAQ 2E2HH 3HOXH 3HOYG 1W3SA 1WOCA 4JBKA 2Y0SG 4PZ7A 1I3QH 1KAWA 1VQGA 5ELNA 3RN5A 3E9HA 4JBWA 4LW1A 4PG3A 5C0XG 1JT8A 3TRZA 1BVSA 3PGZA 1Q7YC 4QGUA 2JA7H 2E5LL 3I7FA 1DGSA 3NEMA 1S72A 3H15A 1HNZQ 5C4XG 1SMXA 2Q2UA 3I4NG 5M3FG 3WWVA 1S40A 2I5LX 4DV4L 2N8NA 2PI2A 1V9PA 5GROA 1E22A 1S3OA 5GADC 3I56A 4DV2Q 4HIKA 2D62A 3K0XA 1FJGQ 4IOCA 2EXDA 2R7DA 5LMUL 3S1QH 3G4SA 4X66Q 3A5ZB 1AE2A 3MEFA 1NTGA 1NMFA 1J5EL 2WFWA 2OTJA 3AFPA 2Q2IA 4GN4B 2RCNA 1WYDA 1HZ9A 2VZAA 1PA6A 3NENA 1Z9FA 3TS0A 1JE5A 3HFZB 3OW2A 4LF5L 3HKZE 1X3GA 5GAGC 4X62Q 1FJGL 3PUWA 4A3JH 3E0EA 4OWXB 1VQCA 4DR5Q 1VQ9A 2JE6I 1P8LA 4NXMQ 3BJUA 1Y1VH 3FHWA 1FVIA 2PNHA 4GS3A 4RG1A 1TWFH 5M5XH 2A19A 3K80C 1D8LA 4HJ8A 4IFDI 3PUVA 1X65A 2R93H 1NE3A 2ZTEA 2ASBA 3M4PA 1PH9A 3ICEA 4LF8Q 1A0IA 3KF8B 4P72A 5HY6A 2VQFQ 1W2BA 3GTLH 2I5MX 1GM5A 1K83H 5IP7G 2YU9H 4AYBG 3RZDH 2BA0A 1PFSA 1Q82C 1K0RA 4C3HH 1OXXK 3LGJA 1YIJA 1SFOH 2KCTA 4KHPL 1V1QA 4DUYL 2AWOA 3VDYA 1HJPA 4DV3Q 2HT1A 3SGIA 4JV5L 1Y1WH 4A3DG 1I5FA 3J81c 2A1AA 3BZCA 1I94L 1IBKL 4A3CH 5GQOA 1WJJA 4A93G 3Q8DA 2JA6G 1A63A 4BY7H 3AFQA 1JJCB 3RZOH 1JMCA 4GKJL 5C0XJ 1YHAA 2NVQH 1B70B 1H95A 4O2DA 4DR6L 3RLOA 3CCRA 1VQKA 4KHZA 1PHJA 2R7ZH 3S15H 4DV3L 1RIPA 1XPRA 1PH4A 3GD7A 4K0KQ 5IP7H 2JA5H 1EQRA 4EX5A 2OQKA 4ALPA 3CCEA 4GN3B 3PF5A 3HOWH 1E1OA 4B3SQ 4R1JA 4HJ5A 4YCVA 3CCMA 2IT1A 2YV5A 3FKIG 2HIXA 2UU9L 4GLXA 5FLMG 4BXXG 2IHFA 4DNIA 1WI5A 1C9OA 3PCOB 5DLQE 4JOIA 4A3EH 4DR7Q 3PUXA 2BA1A 3E9IA 2PQAB 2UUCL 2R7FA 4JI6Q 2B29A 1BBUA 1YHQA 5IYDG 2B63H 1I6HH 1N8RC 3S24A 4DV7Q 4PZ6A 3I55A 2UUBL 4LFAL 3CQZH 3J81j 2UXDQ 5JJKA 1U0LA 4DV0L 2RF4A 1HNXQ 2IX0A 4LF7Q 3CCSA 5IYCH 2CFMA 1X56A 1PH1A 2KCMA 1LYLA 4GLVB 2VY3A 5FJ8H 4WJ4A 4DR7L 1Y14B 4BY1H 2E8GA 3S2DH 3DLLA 1ASYA 1HR0L 1C7YA 1CKNB 2UXBQ 4JCVE 2NZOA 4GN5A 1A62A 2PI2E 4DV7L 1VQNA 2N78A 3J7A5 4JI0L 1OXUA 1VQEA 1VQ8A 3STBC 2VQEL 4GNXC 4C2MH 3CCLA 4J15A 1CUKA 1I50H 1VQMA 1IBML 2UUAQ 1SLJA 2NZHA 2Z6KA 4DR4L 1EIYB 4YWKA 3CCVA 1IZ6A 4P75A 4X64L 2CCZA 3J80i 3CPWA 4A3MH 2KHIA 3CCUA 2VNUD 4X65Q 3CD6A 2NN6G 4JI1Q 4UP9A 3KF6A 1M90C 2K14A 1E3PA 3JC66 4BBSH 3ZJYC 3PUZA 5M3MG 4QJFA 3JAMc 1N34Q 3KYHC 4BA2I 1VCIA 2YTYA 1X6OA 3H0GG 3PIOA 4DUZL 3T1YQ 2F4VL 4LUVA 4R4OA 1GD7A 4JI5L 1K8GA 5LMNW 3CC7A 3RR5A 4YCUA 1Q81C 1MJEA 4LFCL 4A3JG 3HOUH 1Q8KA 4WJ3M 4C3JH 4R4QA 5E7NA 1XNQL 4OX9L 3I2ZA 2VL6A 4JI1L 4OWWB 1QUQA 3KLWA 4HIDA 4MTNA 3I4OA 2MFIA 1EQQA 4IJLA 4DV1L 4GNXA 4JYAL 4YWMA 1NMGA 1VQBA 1UE5A 2LXJA 2EQSA 5JEAG 2HHHQ 4A3BH 3CW2C 4FDBA 2AKWB 1V43A 1B7YB 4O0AA 4UY8C 2Y0SE 5M5WH 3PO3H 2WB1G 3F2CA 3PSIA 3M85A 3M4OH 2Q2HA 3OTOQ 1SR3A 1HNZL 3W1GA 2WAQG 3TS2A 1L2FA 1U5KA 4NB3A 3U4ZA 1IBLQ 2VUMH 3UDIA 4JI7Q 1Y1WG 1YJNA 4DK6C 4DR1Q 1OTCA 4DV2L 1VQLA 4A76A 1GVPA 2XTIA 4LUZA 3KJPA 3S1NH 1YHBA 1VQHA 4BY7G 4A3GH 4BXXH 3DM3A 4B3RQ 3ULPA 4X66L 2MNAA 4OXPA 2K5VA 1NJIC 4LF9Q 2JA8G 3ULLA 1IBLL 2I5HA 2ATWA 1Q1BA 1BBWA 1EWIA 3M9BA 4YWLA 2QA4A 2OTLA 4JI3Q 3RN2A 4X62L 3CAMA 4DR5L 4DR3Q 3S14H 2R93G 4P74A 4AIMA 4NXML 3ERSX 2UXCQ 2V1CC 2K75A 4QIWE 5H1SE 1KRTA 1VQ6A 5IWAQ 1XMQQ 1SRUA 4JOIC 3TQYA 1UE7A 3K8AA 4A3BG 4OO1I 1SROA 2GVBA 5AJ3Q 4LF8L 5C44G 3HOVG 4A4IA 2ALYB 5C4XH 2VQFL 3NELA 5M3FH 1L1OC 3GTKH 4BA1I 3KDFA 2EIFA 4R4CA 1YITA 4QQBX 4DV6Q 3UE1A 2JQOA 1XPUA 4MZ9A 1YBYA 4AYBE 3JAMi 1X9NA 4GKKQ 2CWPA 3J7ZC 1N33Q 5LMNQ 4GOPA 3PUYA 5M5YH 4EQ5A 1TWCH 2R6GA 3K81C 4LFBQ 5JEAJ 2D0PA 3KOJA 2QEXA 1WCMG 3T1HQ 2IX1A 3CC4A 1OXTA 4QY7A 3IRBA 1FL0A 1XNRQ 1PH7A 1QVGA 2KBNA 2AMCB 5IE8A 1E24A 4A3FG 3A0JA 4NXNQ 4A3KH 2R92H 3S16H 1Q86C 1LM0A 4DK3C 4GKKL 1D7QA 4JBJA 3KFUA 4JI4Q 3PO2G 4HJ9A 1N33L 2OCEA 2Z6KC 4IFDG 1SN8A 3BZKA 3W1BA 4DPGA 1KXLA 2GVAA 4K0KL 1EOVA 2CWAA 5C4JH 3PF4A 1O7IA 2CQOA 1IL2A 1WFQA 4B3SL 1L1OA 4RMFA 2ZJRA 1OXSC 4A3LG 1YEZA 3RNUA 1EUJA 2ZTDA 2YYZA 1KC8C 1HNWQ 3HOXG 3CP0A 4YHHQ 4A3IH 4AQYQ 2IY5B 3D0FA 3HOUG 2NVXH 4IPCA 3TEHB 3K7UC 3H3VI 4JI6L 4DV5Q 3M7NA 4L5TA 1XTDA 4L5QA 2JA7G 1AE3A 1X55A 3KF6B 1G291 5IYBH 4LF4Q 2N49A 4A3GG 2UXDL 4L5RC 4B3TQ 4A3DH 3G48A 3EBEA 4TVAB 3CC2A 2RHQB 1HNXL 1VQJA 4OWTB 4LF7L 3CPFA 5C0XI 2AWNA 1MJCA 2JA9A 2KENA 1X54A 4H02A 4ME3A 3UE0A 4POFA 4A93H 1XMOQ 3ER0A 1K73C 1M1KC 3AYHB 2KHJA 2K5HA 4PMWA 4JI8Q 1VQFA 2UXBL 3OYYA 2K50A 1PV4A 3CMEA 1QUQB 1PH3A 4YY3Q 1VQ7A 1A8VA 4B3MQ 4GNXB 1L0WA 3I4MH 1N32Q 5BR8Q 1CKMA 2ZM6Q 3U50C 3M3YH 4DKAC 2GN5A 1VQDA 2UUAL 1PH5A 3J81i 3NBHB 4Y52H 4IO9A 1Q1EA 3K7AH 3EN2A 3FKIH 4UP7A 4LF6Q 4IOAA 1HH2P 4X65L 1K3RA 1Y1VG 1X3FA 2XGTA 3HOZH 2VW9A 1KD1C 2E2IH 1N34L 1HZBA 4LUOA 3KJOA 4BBRH 1B8AA 2AHOB 3T1YL 3GDEA 1Q46A 3S1RH 4LWCA 1T9HA 5GAEC 3D31A 4HJAA 2E5LQ 4IFDJ 5IYDH 5C3EH 1VQPA 4AH6A 4NPSA 4PZ8A 4DV4Q 1G51A 1UEBA 2D0OA 1EIFA 3M4QA 1N9WA 1J6QA 1P16A 1LTLA 2OWOA 1GKHA 1GO3E 3CF5A 1CSQA 1BKBA 2QGQA 3GTMH 1FGUA 2ID0A 3S17H 2HHHL 5LMUQ 3CMAA 4C3IH 4A3CG 2NVTH 1Q12A 2F52A 1J5EQ 3F8TA 3STBD 1G6PA 3ULJA 2WB1E 3HKZG 4LF5Q 3OTOL 2BH2A 4TQUS 2MQHA 2A8VA 1YVCA 4GOPC 2WAQE 4DR2Q 2R7ZG 3S1MH 4JI7L 2HQLA 3GO5A 3UDXA 1HR0W 4DR1L 3F2BA 2B3GA 4DAMA 2JA5G 5EAYA 2DGYA 3HKSA 3KDFB 1JJGA 2NVYH 5IP9H 2LSSA 3HOWG 3H3VH 5M3MH 2R92G 3H0GH 4A3KG 3UDGA 1K9MC 3AEVA 3HOYH 4LNQA 4B3RL 4LF9L 5J3BA 4GOPB 4A75A 1VQOA 2RHSB 4DR2L 4X6AH 4A3EG 2WP8J 3PIPA 4HIOA 5K36G 2JEBI 1QVCA 2ZJPA 2CKZB 1VS0A 3BU2A 4QL5A 4JI3L 1QZHA 3I4NH 5IY0A 2B63G 1QZGA 1VQAA 4DUYQ 4KHPQ 1Z47A 5GAHC 4DR3L 4JV5Q 4IPDA 4P71A 1I94Q 1E1TA 1IBKQ 4DAYB 2UXCL 1PH2A 5IYCG 4A3IG 5IWAL 1XMQL 5JJIA 3J80c 5FJ8G 1ASZA 2PMZE 4JI2Q 4BY1G 4GKJQ 2HIVA 1VQ5A 4MNOA 2L15A 4Y7NH 1UE6A 4UPAA 4UP8A 5AJ3L 1EFWA 4DR6Q 1L1OB 5JJLA 1MKHA 5IYBG 5ELOA 3MXNB 3A5UA 3L2PA 1MIUA 3B6YA 4KI0A 2E2JH 4OONA 4DV6L 3FP9A 4POGA 3TREA 1OXVA 5LMNL 2MO1A 3F1ZA 1IYJB 4JI2L 4LFBL 1CKOA 1VQIA 2UU9Q 4A3MG 3T1HL 2JA8H 2DUDA 1HZAA 2BH8A 2K4KA 5IT9c 3F2DA 1XNRL 3RLNA 3I4MG 4NXNL 4BBSG 2UUCQ 2VS1A 1YI2A 1X3EA 2MO0A 4JI4L 1UE1A 4IPGA 4HJ7A 2UUBQ 1PVOA 3GTQH 2NN6I 4LFAQ
chains in the Genus database with same CATH superfamily
3CCQA 3UDFA 1YNXA 3NK9A 4V190 1K8AC 1PYBA 1CSPA 5JVH3 5I2XA 1HR0Q 2EPBA 1GOZA 3MAQA 5C3EG 2Q2TA 3PO3G 2FXQA 1XPOA 2C35B 4R4TA 4XYOA 4R9WA 1NNXA 3G71A 3A54A 1KRSA 2V4DA 1SYCA 2ZT9C 2E76C 1BCPB 3EA6A 1XMOL 3SE0A 1O80A 1NY4A 4KKUA 2K5NA 3G6EA 2H5XA 4BXXH 3CHBD 1TWAH 1IL8A 3HS0C 1FNWA 1PRTD 4IFDH 5ELCA 4C3JB 4B08A 4N8FA 4DA2A 3GTJH 1S5CD 2L12A 2EY2A 1XNQQ 3TN2A 1ICWA 5IP9G 1B50A 3K59A 4LF6L 4HIMA 2IHEA 4DV1Q 4JYAQ 2E2HH 5EKIA 1HFGA 4CDFC 3HOXH 4L6TB 5FO8B 1VQGA 1CT1D 5KYIA 2AQ2B 4LW1A 3PIO3 3BVMA 2O5JC 1JT8A 1BVSA 1MHWC 4OHJA 1DGSA 5BN4A 5CMDA 5C4XG 2Q2UA 2KECA 3WWVA 1S40A 1SYDA 4ZLTF 4M1UB 2N8NA 1EWCA 1E22A 4DV2Q 2D62A 1JC7A 1PTOF 3SK6A 1AEXA 5LMUL 4CJ0B 1TS3A 1AE2A 1EQTA 4G57A 3AFPA 2Q2IA 1C48A 1WYDA 2VZAA 1RD9D 3TS0A 4X62Q 3S14B 1VQ9A 1P8LA 4G7OC 3BJUA 3FHWA 3MXPA 1FVIA 1VDZA 2LKVA 5M5XH 1PXUA 3R2TA 2QKIC 1DOMA 3QOLA 1K8OA 5M3FB 1SEBD 4K8IA 3GTLH 1K83H 5C4HA 1TS5A 1FD7D 1PTOB 1AN8A 1HJPA 4HR7B 2HT1A 4JV5L 4UHVA 2A1AA 2EJFC 4A3CH 2SNSA 2ENBA 5BN5A 4G7HC 2EYPA 2JA6G 4BY7H 4A3KB 1JJCB 1YHAA 2PZWA 1QCBD 1PHJA 4H44C 1GJXA 1RIPA 1EL0A 4K0KQ 4U673 4XYQA 3NP8A 1ZYRD 2PW5A 3CCEA 3KUPA 2G9HD 3NTIA 4RKBA 3HZXA 3FKIG 1SJED 4A3IB 3AMUA 1C9OA 2K5DA 3W2DA 4A3EH 2UUCL 4CJ2C 2MPMA 2B29A 3K57A 3DWAA 2DJFC 4K2KA 1YHQA 5IYDG 1I6HH 4A3DB 1BUVT 1RCVD 1LABA 3J81j 2UXDQ 1RTNA 1U0LA 3QWNA 4DV0L 2IX0A 1Q90A 5IYCH 4L63B 3D4RA 1I6VC 5DEHA 4RGMA 3C3LA 4BY1H 2E8GA 1PZKD 1C7YA 2NZOA 3T53B 2N78A 1TR5A 1AW7A 1I50H 2A6ED 1VQMA 2Z6KA 3NPPA 2PW7A 3CRLC 4A3MH 4BS9A 3BZDB 4X65Q 3HOZB 3JC66 4BBSH 3A56A 4DF7A 3JAMc 3PUZA 1N34Q 4QJFA 4BA2I 3FEWX 3S1RB 3NWSA 2BOSA 1CHQD 3GQBA 3FMCA 3CC7A 4A3JG 2J0TD 2F0KA 3VR2A 4K2LA 4OX9L 4FF4A 1TIID 3GP7A 4OWWB 1XXGA 1EQQA 2FINB 1NMGA 4YWMA 2LXJA 2Q8TA 1Y8NB 5JEAG 4LK1C 3EQLC 5M5WH 3F2CA 2DY7A 2EY1A 2Q2HA 1HNZL 5IODA 3TS2A 1L2FA 1IBLQ 4HCEA 1Y1WG 1YJNA 1GUSA 4A76A 1GVPA 3S1NH 2OXPA 1EZ6A 3M7GA 3WDNA 1SDFA 1K0SA 3H0GB 3K5LA 3BDOA 3P75A 1E2WA 5I6YA 3DM3A 4B3RQ 1G2TA 4X66L 4LF9Q 2JA8G 3P1HA 1IBLL 2I5HA 5CORA 4ZAIA 2FJ2A 3M9BA 5A35A 2QA4A 4JI3Q 4DR3Q 2HCIA 4AIMA 3K5NA 2UXCQ 2K75A 5H1SE 5IGCA 1VQ6A 2EYLA 2Z4IA 1IHZA 1SRUA 1PRTF 5J39A 1SROA 2GVBA 2DNCA 4PMBA 4LF8L 2A69D 2OF1A 1L1OC 1STNA 4BA1I 2EJMA 4R4CA 1X9NA 1YNND 2CWPA 1CTMA 1BDOA 1TWCH 2L55A 1SNQA 2IX1A 3SHLA 1OXTA 5C3XA 2EY6A 3IRBA 1LTAD 2KBNA 5EJWA 1QVGA 1ZKOA 3S16H 1LACA 3GV3A 4JI4Q 3GTQB 1KNEA 2MGSA 2R93B 4IFDG 3W1BA 1KXLA 2L4NA 1EOVA 1M8AA 5C4JH 2PPBC 2F0VA 1L1OA 1PLFA 2ZJRA 4L8JA 1B53A 5CBEE 2YYZA 1KC8C 1PRTB 3HOXG 1HNWQ 5ISRA 1SNDA 1C8CA 3T56B 4U68A 1KDBA 3MHBA 2NVXH 1CHPD 2B2UC 4DV5Q 1XTDA 1KAAA 1X55A 3L3OC 1G291 3DWPA 4B3TQ 4TVAB 4LF7L 1HNXL 4A3BG 1MJCA 2JA9A 3J80E 1NAPA 1EEFD 1A3TA 2CW0D 1RDPD 2KUMA 1K73C 2K5HA 3PO2B 4CDEC 2UXBL 3OYYA 2K50A 4EQNA 2RDGA 1VQ7A 1ICFB 1R4QB 2PYKA 1A8VA 1LV9A 3NSWA 1L0WA 1TWGB 1ONLA 3U50C 2ZM6Q 2PNRC 1CA5A 4DKAC 1PH5A 1HTLD 4CKBA 1SNOA 5DM73 2K01A 3K7AH 2B2WC 2PCFB 3H6MA 5IT9E 2M2LA 1MBYA 1K8MA 1PYWD 4P2CB 2E2IH 1F9SA 1HZBA 1J9OA 1B8AA 3GDEA 1Q46A 2EYOA 4LWCA 4IUUA 3Q24A 5CR3A 5C3EH 2Q8IB 1UEBA 5M5WB 3F2UA 1LTLA 3MZ5A 1I4QA 3SK4A 2QGQA 4JPBW 2HHHL 4A3CG 1Q12A 2F52A 3V96A 1DOKA 4OIKA 1G6PA 3LX0A 1DZ1A 3S1NB 2BE5D 3HKZG 4LF5Q 3OTOL 4DK0A 1G91A 1MGSA 2I07B 4DR2Q 2E74C 2HQLA 3GO5A 3UDXA 1FNVA 2NN6H 1H9KA 2NVYH 5IP9H 2LSSA 5M3MH 2MUYA 3AEVA 1K9MC 1GUNA 5D65A 5J3BA 5TSSA 4DR2L 3RZDB 4A3EG 4ILWA 1I4GA 4C3HB 1QVCA 4FNFA 4R8NA 3JAME 5IY0A 1QZGA 3GV6A 4LJZC 2IX3A 5IGGA 4IPDA 2DJGC 1D1IA 1I94Q 1IBKQ 1HPCA 5IYCG 5IWAL 4F8MA 1PFNA 2F0TA 4BY1G 1VQ5A 4MNOA 1UE6A 1T5EA 1L1OB 3EFXD 3IKJA 4X3SA 3S15B 2R7ZB 1AFPA 3B6YA 2R3ZA 5JOBA 1ET9A 2I46A 2RA4A 3HOWB 1KLGD 3KF8A 4LFBL 1DXMA 4QF4A 4A3MG 1H9JA 2GA4B 1HZAA 3T51B 4BBSG 2VXWA 3VR3A 1YI2A 2X69A 1X3EA 1D5XC 2B63B 1HUMA 1UE1A 3CQZB 3R3OA 2EXZA 3LNNA 4RWSC 1PVOA 1N36Q 2ES2A 2B2TC 5IOCA 1RL2A 3W5OA 1YZ6A 4N9PA 3S2DB 4IPHA 3TBIB 3HOVH 5C44H 4YHHL 2K28A 2JA6H 3MTSA 4UAIA 1B9NA 1BCPC 4JI0Q 1LTTD 3S2HH 1N36L 4C2MB 1TVXA 1HHVA 2VQEQ 3L7ZC 3A74A 1QOHA 3WOEA 5CV5A 2K03A 4B9XA 1STAA 3ONAB 4X64Q 1V8QA 1YNJC 1WCMH 3J7AV 2PQAA 2PZUA 1STHA 4JBMA 3A7AB 3U4VA 2JK8A 1WTVA 4A3FH 1DD2A 1EY6A 1YJ9A 4KLKA 1UWVA 1HQRD 3NXWA 4JI5Q 3GTOH 2LXKA 4YY3L 3HOUB 2KOLA 2M00A 4APVA 1JB7A 1VQ4A 4LFCQ 5BR8L 1RJTA 1HZCA 1CKNA 3U58A 4JC0A 5C5LA 1KHIA 4C1NI 3GTPH 1SBBB 2K04A 1KL9A 3LWUA 3TZDA 4RCOA 3HOYG 5C3EB 4JBKA 2XRQD 1KAWA 3PO3B 5ELNA 4HCSA 2KA7A 1JOKA 4JBWA 1SNPA 1F2MA 5KGUA 4QGUA 2JA7H 2E5LL 1S72A 3NEMA 3H15A 2XN9C 1XTCD 1SMYD 2I5LX 4DV4L 4HIKA 3I56A 5JJZA 5E4XA 5GADC 3K5MA 2F0LA 5ELFA 1RKNA 4IUVA 2EXDA 3G4SA 3CRKC 1CI3M 2F0GA 1NTGA 1NMFA 2WFWA 3OW2A 3OIQA 4KHVA 2DN8A 1X3PA 3PUWA 4FP5D 4A3JH 3E0EA 4OWXB 2VB3X 4DR5Q 5EGTA 1Y1VH 4UDUC 1VF5C 4GS3A 2A19A 4IFDI 3PUVA 5G3LD 1NE3A 1PTOC 5HGTA 3M4PA 2ASBA 5C4XB 3ICEA 1A0IA 3KF8B 2VQFQ 2AUJD 1W2BA 4FYDA 1TS4A 1Y69U 4I7AA 5IP7G 4G7ZC 3Q6SA 1WTHA 3KBGA 1Q82C 1K0RA 1B3QA 2HUGA 1CK1A 5EPKA 1YIJA 1SFOH 4KHPL 1VMCA 3SGIA 1Y1WH 2ICEC 1BO0A 3J81c 1DCZA 2R92B 3RZOH 3R93A 1SE4A 4GKJL 5C0XJ 1B70B 1DYQA 1XX8A 1CZWA 4O2DA 4KJOA 4DR6L 4KJNA 1VQKA 5I4DA 2B8FA 2F0FA 4JVZA 1XPRA 1PH4A 1I4PA 4QCLA 2LY7A 1EQRA 2A6HD 4XQNA 4MN3A 3MVVA 3PF5A 1QWYA 1CFMA 2IT1A 5FLMG 2IHFA 2WACA 5C5MA 1EZ8A 2BA1A 2PQAB 2B2YA 2R7FA 4JI6Q 4IURA 3BDCA 4ZRZA 2UUBL 3S24A 4DXFA 2PZTA 3I55A 4LFAL 5JJKA 5L37A 3D6CA 3FRPB 1U4RA 2CFMA 2KCMA 3FPPA 1Y14B 5LL6S 1HR0L 4TRDA 1CKNB 1KDCA 3J7AF 1KLUD 4GN5A 1VQNA 1X3QA 3I4MB 1S5ED 2EJGC 3VYSA 1OXUA 1I4XA 1VQEA 4JK1C 2F0HA 4DAVA 1GXDC 1W6KA 2NZHA 5FKAC 3FKIB 2XVSA 2WV6D 2QILA 2Z8LA 1IZ6A 3OMCA 1AZPA 2CCZA 3T13A 4J1MA 5JAVA 2F0PA 3OOCA 5D3DA 2NN6G 1LTSD 4K6LA 3KF6A 4JI1Q 4BBRB 3ZJYC 5M3MG 1HA6A 5IIFA 3DEPA 1VCIA 4XDXA 1X6OA 4ZCKA 4R4OA 1K8GA 2F0OA 2IPKD 5LMNW 3RR5A 1Q81C 5E7NA 4XQQA 1XNQL 2G5DA 5EPLA 2DY8A 1F2ZA 1FGBD 4RGTA 2VL6A 4JI1L 1QUQA 4M8AA 5DAUA 3S17B 1O7ZA 4DV1L 4JYAL 1R4PB 4V0BA 1VQBA 4A3BH 3CU7A 3OSOA 1IW7C 2Y0SE 2WB1G 2KQ3A 5FO9B 3IFDA 3PSIA 3M85A 3M4OH 3J81L 3W1GA 2WAQG 4HN7A 1U5KA 2VUMH 1TS2A 4JI7Q 1WTPA 4DR1Q 4DV2L 4IUTA 3KJPA 1YHBA 1HFNA 5DM63 4A3GH 1G8ZD 2Y0SB 1HRJA 2EDGA 3SR1A 3ULLA 3P7JA 2NTSA 5A2QL 3I72A 3BDLA 4DXGA 3RN2A 4X62L 5K5PA 1B3AA 2ICIA 3NQTA 4KY6A 3ERSX 2V1CC 1Y8PB 1XMQQ 2Q8RE 5I9PA 1EY0A 3TQYA 1UE7A 2H1EA 3HOVG 5C44G 4A4IA 2ALYB 3A8IE 2E2JB 3GTKH 3KDFA 3PIP3 2EIFA 3E5SA 4IZ8A 4RFBA 4X3UA 1W6JA 4AYBE 1SNCA 3J7ZC 1N33Q 1NR4A 5LMNQ 3PUYA 3EJIA 4C1NK 1ILPA 2JA8B 4K14A 1K28A 1WCMG 2CHBD 3CC4A 3M4YA 4F87A 5JPNC 3H09A 1SNMA 3I90A 5E3FA 1WTWA 3RD4A 4A3FG 5EQ0A 2J7ZA 3TMEA 3KFUA 4HJ9A 1N33L 2K5QA 4DAYA 4DK1A 1PRTC 4AYBB 2Z6KC 1SN8A 1VMPA 4RKLA 2QEJC 2CWAA 4K0KL 2PMZB 2FMCA 1O7IA 3PF4A 1STBA 1EY8A 4MHEA 3VR4A 1WFQA 1MD2D 3MXNA 1YEZA 3HEJA 1B9MA 1TY2A 1EUJA 2LFNA 1GHJA 3BVZA 4AQYQ 1TKWB 3H3VI 4L5TA 4B9WA 4RA8A 2JA7G 3KF6B 2F3VA 4RH6A 2N49A 4LF4Q 2UXDL 2D2CC 3CC2A 3QB3A 5G3LF 4X3KA 2RVLA 3UE0A 4POFA 4A93H 1XYIA 3OMGA 3AYHB 4PMWA 3VR5A 4JI8Q 1TWAB 1HTPA 1VQFA 5NUCA 1QUQB 4HMJA 3GTJB 1F2LA 4B3MQ 1WTRA 1RTOA 1N32Q 5T1IA 1CKMA 3M3YH 1EY4A 3H91A 3J81i 2WKDA 1DM0B 4EGVA 4UP7A 2E2HB 3HOXB 2K7VA 4IOAA 1HH2P 3DHQA 4X65L 1Z6HA 1K3RA 1Y1VG 5EKKA 2XWBB 2VW9A 3HGBA 3VYRA 1N34L 4LUOA 3I4LA 1GUGA 1SE3A 1AP0A 1T9HA 5GAEC 1ENCA 3DM1A 4CBVA 4NPSA 2EZVA 4A3BB 4ZYSA 1JWUD 2RDFA 3K5OA 3SEBA 4J6HA 2EYHA 1EIFA 2QDLA 4CDCC 2BDNA 1GO3E 3NWTA 1CSQA 3GTMH 2F0QA 3CMAA 3ZYYX 4C3IH 2NVTH 1J5EQ 2RCFA 3STBD 2DNEA 3TSSA 4NW2A 2K05A 5EKLA 1CQVA 4RHSA 3SK8A 3Q22A 2A8VA 3V05A 5CC4A 3UI2A 3S1MH 1ZXTA 3F2BA 4K5WA 5M5XB 3ERQA 1ZYRC 3HKSA 3KDFB 3H3VH 4A3KG 2JN4A 3HOYH 4B3RL 5CV7A 4LNQA 4LF9L 4NDXA 4N9TA 5BN3A 3GTLB 5FOBB 1K83B 4OL7A 2RHSB 1E2ZA 4GZYC 5K36G 1B1ZA 2ZJPA 2CKZB 1VS0A 3BU2A 4QL5A 4JI3L 5DNFA 3KK7A 4DUYQ 1A3UA 3MXUA 5GAHC 4DR3L 2EYMA 4CJ1B 2UXCL 1KNAA 4DAYB 5F2DA 4BY7B 4A3IG 2L1BA 3HKZB 4HAEA 4JI2Q 4QUFA 3VR6A 2L15A 4Y7NH 2F0EA 1EFWA 3D6WA 5IYBG 3L2PA 2HCCA 3MXNB 2RSOA 1E2VA 2Z4HA 3K6OA 4CDDC 3TREA 1OXVA 1DOLA 2A6EC 3F1ZA 4HEDA 4JI2L 4NMZA 3DUZA 1VQIA 2UU9Q 2F1MA 4A3EB 2DUDA 1ILQA 1A2TA 2HQEA 2QCPX 4TKOB 4R8IA 4JI4L 1I6HB 1JE4A 2NN6I 5IP7H 5CGKA 5FLXL 4XQJA 1R9TH 1EQVA 4GLAC 1YJWA 4TSSA 1AH9A 2F0UA 4BY1B 5HGQA 5AFWA 1E7ZA 1TWHH 4P73A 3HOZG 1PYSB 5I2YA 4FF3A 1HNWL 4DNTB 2L9HA 2YTVA 2WKCA 1GUOA 4OELB 3I3CA 4FXKC 3RLFA 4DV5L 1I50B 4CKEA 4JG2A 2L5TA 2YTXA 2H4OA 3VYTA 1IBMQ 4IUQA 1KQSA 4OGQC 4DR4Q 4B3TL 4A3MB 3I70A 3GTGH 2VUMG 2N3SA 1RF2D 1BNZA 4BBSB 2Z0SA 3L0OA 2RDHA 4A3GG 1XJVA 1SE8A 5FLMH 2K52A 4DUZQ 4YCWA 2F4VQ 3TP6A 4CHTB 2E75C 4IJHA 1KTKA 3C1EA 2ZM6L 3SK5A 4E6IA 2JJQA 1SXTA 1PH6A 3HRZC 3E0JA 1W3SA 1WOCA 2KEDA 4CKCA 1PZID 4QUCA 3E9HA 3RN5A 1WD0A 2O2LD 2J4XA 3AU7A 5C0XG 3TRZA 3PGZA 1Q7YC 1D1KA 3I7FA 2A69C 1S5FD 1SMXA 3I4NG 1NSNS 4FXGC 4IALA 3E3XA 1V9PA 2BDOA 1JB3A 1S3OA 5KEEA 2NVTB 3K0YA 1YNNC 4QB4A 1Z7TA 1FJGQ 4IOCA 1ESRA 3ND8A 3S1QH 3AB9A 1SYFA 3H94A 1PA6A 1Z9FA 4LF5L 4EVOA 2G9DA 5GAGC 1PMRA 1FJGL 3HOYB 1STGA 4ME5A 1LO5D 3MA2B 4NXMQ 4HSVA 1IYVA 2PNHA 4RG1A 1TWFH 3K80C 1D8LA 4HJ8A 1X65A 2P5ZX 1PH9A 1QILA 2I5MX 2MHVA 1GM5A 2YU9H 5IGDA 1JCKB 2BA0A 1A2UA 1TWCB 4K8JA 1V1QA 2AWOA 2K6AA 1I5FA 1I94L 1IBKL 1PDQA 4A93G 1GUWA 1U4LA 3Q8DA 3S16B 2CW0C 3QO2A 3NUCA 1A63A 1JMCA 2NVQH 4MTKA 1O7LA 1H95A 2CH4W 1SYGA 2XNAC 3RLOA 3BS1A 3CCRA 1FYCA 2RKSA 2ZXOA 1JICA 1UNSA 5C4JB 4FF2A 3GD7A 2JA5H 4EX5A 4ALPA 2Z1CA 1E1OA 2F0MA 4B3SQ 4R1JA 1EWHA 4YIJA 2OEOA 3CCMA 5ELDA 2YV5A 3T16A 1WI5A 5DLQE 2NVXB 4JOIA 4DR7Q 3E9IA 3TDQA 1B4OA 1V1OA 4DGZA 1N8RC 2B2VA 2D9UA 2WINB 4F7XA 4ZQ3A 1X56A 1PH1A 1LYLA 4GLVB 3MFGA 4WJ4A 4DR7L 1U9RA 1ASYA 2JSOA 1A62A 4C3IG 4JI0L 1VQ8A 2WIIB 2VQEL 4GNXC 3CCLA 2AQ3B 2MP1A 4J15A 2BE5C 2UUAQ 4FF1A 1NR2A 1SLJA 4XT3B 3K7AB 2LMCB 3ITPA 3PMFA 2RBMA 4P75A 1K3BC 2X6GA 4X64L 1Q3LA 3CCUA 2VNUD 2EOTA 1I4RA 1AZQA 3CD6A 2E2IB 3L9AX 4UP9A 2K14A 1EYCA 3PIOA 3QJYA 3T1YQ 4JI5L 1GD7A 1X32A 3DWQA 4YCUA 1MJEA 4LFCL 5KNDA 2F0WA 4C3JH 2X6LA 1ET6A 4R4QA 3I2ZA 2Z6BA 3QG1A 3OW7A 1NCVA 3X3NA 3KLWA 4MTNA 3I4OA 4IJLA 4GNXA 3V2TA 1UE5A 2EQSA 3CKIB 3CW2C 2A5HA 2AKWB 4RHRA 1WD1A 1V43A 1DJRD 4J8QA 3C1FA 1EYAA 2JP1A 3A8JE 1II3A 2PQEA 2O4XA 1VF7A 1V1PA 1SR3A 1UUPA 3U4ZA 1J8IA 3UDIA 4DK6C 1OTCA 1LT5D 1SAPA 2NVYB 2XTIA 5M3MB 3EVQA 2B39A 3ULPA 4O1NA 2MNAA 4OXPA 2K5VA 3MFYA 1KABA 1QJOA 1O78A 5CV8A 4YWLA 4H7BA 3C46A 4KD4A 1B2TA 2EYFA 1CQFA 3CAMA 4DR5L 4EQPA 3S14H 4QIWE 2KHSA 1H9MA 2WB1B 4EQOA 2FHTA 1XWEA 4Q0FA 4KY5A 2WAQB 2B2YC 5AJ3Q 2VQFL 2ZXRA 1WTXA 5M3FH 2PO4A 1YITA 4DV6Q 4ZUIA 4GOPA 4QIWB 4EQ5A 1PTOH 3U9OA 2QEXA 3T1HQ 4WJWA 1FL0A 1XNRQ 1PH7A 1A15A 1LT3D 2AMCB 2K1BA 5CYUA 5IE8A 1LT4D 5EBDA 4NXNQ 4A3KH 1D7QA 3VA5A 4DK3C 5IGEA 4JBJA 1EYDA 2OCEA 2NTTA 3BVGA 1GHKA 3BZKA 5J22A 1D6EC 5K36H 1EY7A 2CQOA 1IL2A 1LT6D 1PFBA 3HOVB 5C44B 2ZTDA 4WORA 2JA6B 4CGYB 3CP0A 4A3IH 3S2HB 2IY5B 2B8GA 3D4WA 3FPUB 3D0FA 3HOUG 4IPCA 3K7UC 4JI6L 5IYBH 4A3DH 5C3WA 1SMYC 1WCMB 3G48A 1VQJA 1F9PA 2SNMA 5C0XI 2KENA 4H02A 3G7LA 1X54A 5CV4A 3QOJA 4A3FB 2K33A 1XMOQ 3ER0A 4KTAA 1M1KC 2KHJA 2HDMA 5D3IB 3GTOB 1Y8OB 5KYLA 1PFMA 4HTHA 1HQMC 4GNXB 4N8X1 1D2BA 4IUNA 3GTPB 1WTOA 4IO9A 1Q1EA 3N52A 4LF6Q 1LTID 1V1PB 5JVG3 1X3FA 2XGTA 3HOZH 1KD1C 4I65A 2JA7B 3QIAA 3S1RH 3D31A 4XT1B 1VQPA 1JWMD 4AH6A 4RAUC 2OT2A 2F3WA 4ULLA 2D0OA 3HG9A 4ZKCB 2C9OA 1MSHA 2OWOA 4PV1C 1GKHA 2IJ0A 2LS01 3CF5A 2XRSD 3KLRA 4KY7A 1FGUA 2M9VA 5LMUQ 1TT2A 2AUKA 5IGBA 3ULJA 3SXHA 2RQXA 2BH2A 1OO9B 4TQUS 1CZGA 4A3JB 2NYZD 1YVCA 3IAYA 3VYUA 4JI7L 3N6RA 4DR1L 1Y1VB 2B3GA 2JA5G 2A6HC 2A68D 5EAYA 4RGOS 1S4ZA 3I91A 2R92G 3H0GH 3X3MA 2FMMA 2D5DA 4GOPB 4A75A 1EFID 4HIOA 5C0XH 1TU2B 2JEBI 1SFOB 3I4NH 3A55A 1VQAA 1Y1WB 4ID6A 4JV5Q 4OIJA 4P71A 1E1TA 1RODA 4FVMA 1LLRD 5JJIA 1XMQL 3RZOB 3J80c 2PMZE 3T4AC 2HIVA 4DAPA 4UP8A 3J7YW 1C4QA 4FO2A 1MKHA 5ELOA 1MIUA 4KI0A 5I6WA 1HA5A 4H13C 5LMNL 3RMHA 2MO1A 1IYJB 5KRUA 3A8KE 1CKOA 4KK7A 1BBXC 4LMQD 1CA6A 2BH8A 3PQIA 2K4KA 5IT9c 3F2DA 3I4MG 2UUCQ 2MJ8A 2VS1A 4IPGA 5E4WC 4K5VA 3GTQH 4OO1G 4L5SA 2R93H 2EVBA 4C3JG 4DV0Q 1LUZA 2CQAA 1WTQA 4XIGS 3AQQA 4BBRG 1IXRA 2OQ0A 2ZJQA 4AQYL 1LTGD 3OWEB 2I0QA 1KIXA 1B44D 4RCNA 1PH8A 2ZTCA 3FDTA 4LF4L 3CCJA 2NB0A 4G4KA 1C0AA 3J81E 3TP5A 1HXYD 3MWYW 1PZJD 1QVFA 4XTCS 3CXCA 1ENAA 1EYGA 2F3IA 1L0YB 1NBWA 2C5CA 4JI8L 1TXYA 1EEID 1O7YA 3EIVA 3PO2H 4DFAA 5FLXc 4IQZA 1STEA 4B3ML 4R4IA 1S5BD 2JEAI 1N32L 1LTBD 2L0CA 5FO7B 5A2QE 1JJ2A 3FVQA 3BYTB 1TWGH 4OX9Q 1T5XD 3PV0A 2A68C 2EY5A 1EIHA 4LAAA 4A3LH 1JOQA 2L11A 1UEAB 1BOSA 2Y0SG 4PZ7A 1I3QH 1IYUA 5ELEA 5ELBA 4PG3A 1BQQT 1F77A 3M4OB 3OIPA 5CV6A 1UAPA 5C4ZA 1HNZQ 2VUMB 5T1GA 5M3FG 4K5XA 2A74C 4BWGB 4IN3A 3J80L 2PI2A 5GROA 1BF4A 3K0XA 4A3GB 3H3VC 2F0JA 1SYBA 2R7DA 3VA7A 4X66Q 3A5ZB 4ZK9B 3MEFA 4ZUJA 2OTJA 1J5EL 4I7ZC 1SSOA 1ESFA 4GN4B 2RCNA 1HZ9A 2VB2X 4MIUA 3NENA 3DMUA 1JE5A 3HFZB 2F03A 3HKZE 1X3GA 2N55A 4QMGA 1VQCA 2JE6I 5IT9L 4NP5A 3R2IA 2QW7A 2IWHA 1DONA 2EYJA 4XXEA 2ZTEA 3RUZA 3I4NB 4LF8Q 4P72A 3GTKB 5HY6A 1EY5A 3OPOA 1KDAA 2XWJB 4AYBG 3RZDH 1PFSA 2O5IC 2NUCA 4C3HH 1OXXK 3EROA 3LGJA 5EPJA 2KCTA 4DUYL 3VDYA 4DV3Q 1H9SA 4A3DG 5KNCA 3BZCA 3O13A 1G2SA 5GQOA 1WJJA 5COYA 3AFQA 4DN4M 1QNKA 1EIGA 1ENFA 4DU9A 4KHZA 3D4DA 4PQXA 2R7ZH 3S15H 4DV3L 4KN4C 2KJXA 2OQKA 3E6ZX 4GN3B 3HOWH 4HJ5A 4YCVA 5EBCA 2HIXA 2UU9L 4GLXA 4BXXG 4DNIA 2CVRA 1D5MC 3PCOB 3PUXA 3SDZA 1BBUA 3JAML 2B63H 4DV7Q 4PZ6A 3CQZH 4JW0A 2RF4A 1HNXQ 4LF7Q 4A93B 3CCSA 1JR0D 2NWGA 5FJ8H 2VY3A 2NBFA 3S2DH 4KKSA 3DLLA 2UXBQ 2IL8A 4JCVE 4Z9CB 2PI2E 1JWSD 4DV7L 1FR3A 3J7A5 1HCZA 3M3YB 1STYA 4PMCA 3STBC 4C2MH 2HD3A 1CUKA 1IBML 1TQOA 2HDLA 4DR4L 1EIYB 4YWKA 3CCVA 2JYOA 3J80i 3CPWA 2KHIA 1M90C 5JPMC 1E3PA 5CV9A 3TZUA 3SVMA 3KYHC 3TP8A 2YTYA 3H0GG 4DUZL 2F4VL 4LUVA 2NZ1D 5J1ZA 2ZXPA 5CBAE 4WJ3M 3HOUH 1Q8KA 2B2UA 1JOOA 1HUNA 3ND9A 2F4IA 1I3QB 1TY0A 4HIDA 2MFIA 3GTMB 1EY9A 3D8GA 4C3IB 2HHHQ 4FDBA 1B7YB 1BCPD 3OHXC 4O0AA 4UY8C 3NBHA 3PO3H 1GUTA 2EE1A 5HURA 3OTOQ 1U4MA 4RGNA 3S1MB 2IW3A 4NB3A 2XSCA 1YNJD 5D14A 4ODGA 1VQLA 4LUZA 1Q8IA 1VQHA 4BY7G 1QG7A 1H9RA 2B2WA 1NJIC 3NTHA 1H9SB 2ATWA 1Q1BA 1BBWA 1EWIA 3I73A 3QR8A 1RHPA 2JXMB 2OTLA 2BCOA 3KLSX 2QF7A 1JQYD 4IUPA 2R93G 3P20A 5FLXE 4P74A 4NXML 1A3VA 1IKMA 3IL8A 3LWEA 1CM9A 1KRTA 5IWAQ 1A6XA 4JOIC 4Y7NB 3K8AA 4OO1I 4WFN3 1I4HA 3NTKA 3BG3A 5C4XH 3NELA 1F9RA 2KVMA 2B2VC 4QQBX 4KMUC 3UE1A 2JQOA 3NHHA 4MZ9A 1XPUA 1YBYA 3JAMi 4GKKQ 1U4PA 5KIXA 5M5YH 2XIWA 2R6GA 3K81C 4LFBQ 5JEAJ 2D0PA 3KOJA 4QY7A 1SE2A 2Z9HA 3Q23A 1E24A 2R92H 3A0JA 3TP7A 1Q86C 1LM0A 4GKKL 2K32A 4WRDA 3PO2G 1L0XB 1BR9A 1SJHD 1ZEQX 1R9TB 3DEOA 3NE5B 3MEHA 1SYEA 4DPGA 2GVAA 5FK9C 1WVLA 1TWHB 4B3SL 4RMFA 4HMIA 3OWFA 1QB5D 1OXSC 1PTOD 3A7LA 4A3LG 3RNUA 4F88A 1S5DD 4YHHQ 2KCNA 5E1FA 3DXJC 1G6ZA 3TEHB 2SDFA 4H0LC 3M7NA 4L5QA 1AE3A 3GTGB 4L5RC 1NUCA 3EBEA 1QE6A 1F9QA 2RHQB 4OWTB 3URYA 3CPFA 2RSNA 2AWNA 4ME3A 1BXTA 2FFKB 3HP3A 3NBIA 4KKTA 4NKLA 5C6AA 1PV4A 3CMEA 2TMPA 4KV6A 4YY3Q 1PH3A 4HSPA 3Q0AA 1MI2A 3I4MH 1EU4A 5BR8Q 1F2YA 2SEBD 2GN5A 1VQDA 4OEMB 2UUAL 3NBHB 4Y52H 1FNUA 3EN2A 3FKIH 1MSGA 2B2TA 4OO1H 3MC0B 2F0IA 4KD3A 3K58A 1JORA 1E0BA 3KBXA 3KJOA 4BBRH 2AHOB 3T1YL 4HJAA 5IYDH 2E5LQ 4IFDJ 2AQ1B 4PZ8A 1ML0D 4DV4Q 3W3AA 5IGFA 1G51A 1QNUA 3M4QA 4C3HG 4ABNA 1N9WA 1J6QA 1P16A 5LHY1 5M9OA 3S1QB 2CH4A 1BKBA 1M4VA 2F0NA 2ID0A 3S17H 3F8TA 2F0SA 1EU3A 2WB1E 3NQIA 4X3TA 3WOFA 5I9OA 2MQHA 4GOPC 2E2DC 2WAQE 2R7ZG 1D5ZC 1HR0W 3S9WA 4DAMA 3G6JB 1TWFB 2DGYA 2QDBA 4FXDA 1JJGA 3HOWG 2A73B 3UDGA 2F0DA 4ZKBB 3C2PA 2YU9B 1VQOA 4X6AH 2WP8J 3PIPA 5LL6X 4PNYA 1QZHA 2B63G 2K5WA 2KEEA 1IKLA 4KHPQ 1Z47A 3U9SA 5JEAH 4KN7C 1IW7D 1PH2A 5FJ8G 2NVQB 1ASZA 4GKJQ 4UPAA 5AJ3L 4DR6Q 3R8BA 5M5YB 5JJLA 3A5UA 2E2JH 4OONA 3D3RA 2R61A 3FP9A 4DV6L 4POGA 2JA5B 4O42A 4DNRB 1BCPF 3IFTA 3T1HL 4S3SA 2TSSA 3MXGA 2JA8H 2KCCA 1LTRD 2SOBA 5KNBA 1XNRL 3RLNA 4NXNL 2MO0A 2N88A 3KLSA 4C56C 4K6DA 4Q5VA 4HJ7A 3BYYB 2UUBQ 3I8ZA 4LFAQ 1EOTA
chains in the Genus database with same CATH topology
1R9TH 4OO1G 4GLAC 1YJWA 1N36Q 2ES2A 3CCQA 3UDFA 1YNXA 4DV0Q 1LUZA 4L5SA 1AH9A 1K8AC 1RL2A 3W5OA 1PYBA 5HGQA 1CSPA 1YZ6A 1E7ZA 1TWHH 4P73A 4XIGS 3HOZG 1PYSB 3AQQA 4IPHA 1HR0Q 3HOVH 4BBRG 1IXRA 2OQ0A 5C44H 1HNWL 4YHHL 2ZJQA 4AQYL 2JA6H 2YTVA 5C3EG 2Q2TA 3S2HH 4JI0Q 2I0QA 1N36L 1KIXA 3RLFA 2FXQA 4DV5L 3PO3G 2VQEQ 1XPOA 2C35B 2YTXA 3L7ZC 4JG2A 3A74A 4R4TA 1IBMQ 1PH8A 2ZTCA 1KQSA 3CCJA 4LF4L 1C0AA 3G71A 4DR4Q 4B3TL 3GTGH 2VUMG 1KRSA 2N3SA 4X64Q 1WCMH 2PQAA 1QVFA 4XTCS 3CXCA 1EYGA 4JBMA 3U4VA 2Z0SA 2JK8A 3L0OA 1XMOL 4A3FH 1NY4A 1NBWA 2F3IA 2K5NA 4JI8L 1TXYA 2H5XA 3G6EA 1XJVA 1SE8A 1YJ9A 3EIVA 5FLMH 2K52A 4KLKA 1UWVA 4YCWA 4DUZQ 1TWAH 2F4VQ 4JI5Q 3GTOH 3PO2H 2LXKA 4IJHA 4YY3L 5FLXc 1JB7A 4APVA 4B3ML 4R4IA 3GTJH 1VQ4A 4LFCQ 5BR8L 2JEAI 1N32L 2ZM6L 1JJ2A 1XNQQ 1HZCA 1TWGH 2JJQA 4OX9Q 1CKNA 3U58A 3PV0A 4JC0A 1PH6A 1KHIA 5IP9G 3GTPH 4LF6L 4HIMA 4A3LH 2IHEA 1KL9A 4DV1Q 4JYAQ 2E2HH 3HOXH 3HOYG 1W3SA 1WOCA 4JBKA 2Y0SG 4PZ7A 1I3QH 1KAWA 1VQGA 5ELNA 3RN5A 3E9HA 4JBWA 4LW1A 4PG3A 5C0XG 1JT8A 3TRZA 1BVSA 3PGZA 1Q7YC 4QGUA 2JA7H 2E5LL 3I7FA 1DGSA 3NEMA 1S72A 3H15A 1HNZQ 5C4XG 1SMXA 2Q2UA 3I4NG 5M3FG 3WWVA 1S40A 2I5LX 4DV4L 2N8NA 2PI2A 1V9PA 5GROA 1E22A 1S3OA 5GADC 3I56A 4DV2Q 4HIKA 2D62A 3K0XA 1FJGQ 4IOCA 2EXDA 2R7DA 5LMUL 3S1QH 3G4SA 4X66Q 3A5ZB 1AE2A 3MEFA 1NTGA 1NMFA 1J5EL 2WFWA 2OTJA 3AFPA 2Q2IA 4GN4B 2RCNA 1WYDA 1HZ9A 2VZAA 1PA6A 3NENA 1Z9FA 3TS0A 1JE5A 3HFZB 3OW2A 4LF5L 3HKZE 1X3GA 5GAGC 4X62Q 1FJGL 3PUWA 4A3JH 3E0EA 4OWXB 1VQCA 4DR5Q 1VQ9A 2JE6I 1P8LA 4NXMQ 3BJUA 1Y1VH 3FHWA 1FVIA 2PNHA 4GS3A 4RG1A 1TWFH 5M5XH 2A19A 3K80C 1D8LA 4HJ8A 4IFDI 3PUVA 1X65A 2R93H 1NE3A 2ZTEA 2ASBA 3M4PA 1PH9A 3ICEA 4LF8Q 1A0IA 3KF8B 4P72A 5HY6A 2VQFQ 1W2BA 3GTLH 2I5MX 1GM5A 1K83H 5IP7G 2YU9H 4AYBG 3RZDH 2BA0A 1PFSA 1Q82C 1K0RA 4C3HH 1OXXK 3LGJA 1YIJA 1SFOH 2KCTA 4KHPL 1V1QA 4DUYL 2AWOA 3VDYA 1HJPA 4DV3Q 2HT1A 3SGIA 4JV5L 1Y1WH 4A3DG 1I5FA 3J81c 2A1AA 3BZCA 1I94L 1IBKL 4A3CH 5GQOA 1WJJA 4A93G 3Q8DA 2JA6G 1A63A 4BY7H 3AFQA 1JJCB 3RZOH 1JMCA 4GKJL 5C0XJ 1YHAA 2NVQH 1B70B 1H95A 4O2DA 4DR6L 3RLOA 3CCRA 1VQKA 4KHZA 1PHJA 2R7ZH 3S15H 4DV3L 1RIPA 1XPRA 1PH4A 3GD7A 4K0KQ 5IP7H 2JA5H 1EQRA 4EX5A 2OQKA 4ALPA 3CCEA 4GN3B 3PF5A 3HOWH 1E1OA 4B3SQ 4R1JA 4HJ5A 4YCVA 3CCMA 2IT1A 2YV5A 3FKIG 2HIXA 2UU9L 4GLXA 5FLMG 4BXXG 2IHFA 4DNIA 1WI5A 1C9OA 3PCOB 5DLQE 4JOIA 4A3EH 4DR7Q 3PUXA 2BA1A 3E9IA 2PQAB 2UUCL 2R7FA 4JI6Q 2B29A 1BBUA 1YHQA 5IYDG 2B63H 1I6HH 1N8RC 3S24A 4DV7Q 4PZ6A 3I55A 2UUBL 4LFAL 3CQZH 3J81j 2UXDQ 5JJKA 1U0LA 4DV0L 2RF4A 1HNXQ 2IX0A 4LF7Q 3CCSA 5IYCH 2CFMA 1X56A 1PH1A 2KCMA 1LYLA 4GLVB 2VY3A 5FJ8H 4WJ4A 4DR7L 1Y14B 4BY1H 2E8GA 3S2DH 3DLLA 1ASYA 1HR0L 1C7YA 1CKNB 2UXBQ 4JCVE 2NZOA 4GN5A 1A62A 2PI2E 4DV7L 1VQNA 2N78A 3J7A5 4JI0L 1OXUA 1VQEA 1VQ8A 3STBC 2VQEL 4GNXC 4C2MH 3CCLA 4J15A 1CUKA 1I50H 1VQMA 1IBML 2UUAQ 1SLJA 2NZHA 2Z6KA 4DR4L 1EIYB 4YWKA 3CCVA 1IZ6A 4P75A 4X64L 2CCZA 3J80i 3CPWA 4A3MH 2KHIA 3CCUA 2VNUD 4X65Q 3CD6A 2NN6G 4JI1Q 4UP9A 3KF6A 1M90C 2K14A 1E3PA 3JC66 4BBSH 3ZJYC 3PUZA 5M3MG 4QJFA 3JAMc 1N34Q 3KYHC 4BA2I 1VCIA 2YTYA 1X6OA 3H0GG 3PIOA 4DUZL 3T1YQ 2F4VL 4LUVA 4R4OA 1GD7A 4JI5L 1K8GA 5LMNW 3CC7A 3RR5A 4YCUA 1Q81C 1MJEA 4LFCL 4A3JG 3HOUH 1Q8KA 4WJ3M 4C3JH 4R4QA 5E7NA 1XNQL 4OX9L 3I2ZA 2VL6A 4JI1L 4OWWB 1QUQA 3KLWA 4HIDA 4MTNA 3I4OA 2MFIA 1EQQA 4IJLA 4DV1L 4GNXA 4JYAL 4YWMA 1NMGA 1VQBA 1UE5A 2LXJA 2EQSA 5JEAG 2HHHQ 4A3BH 3CW2C 4FDBA 2AKWB 1V43A 1B7YB 4O0AA 4UY8C 2Y0SE 5M5WH 3PO3H 2WB1G 3F2CA 3PSIA 3M85A 3M4OH 2Q2HA 3OTOQ 1SR3A 1HNZL 3W1GA 2WAQG 3TS2A 1L2FA 1U5KA 4NB3A 3U4ZA 1IBLQ 2VUMH 3UDIA 4JI7Q 1Y1WG 1YJNA 4DK6C 4DR1Q 1OTCA 4DV2L 1VQLA 4A76A 1GVPA 2XTIA 4LUZA 3KJPA 3S1NH 1YHBA 1VQHA 4BY7G 4A3GH 4BXXH 3DM3A 4B3RQ 3ULPA 4X66L 2MNAA 4OXPA 2K5VA 1NJIC 4LF9Q 2JA8G 3ULLA 1IBLL 2I5HA 2ATWA 1Q1BA 1BBWA 1EWIA 3M9BA 4YWLA 2QA4A 2OTLA 4JI3Q 3RN2A 4X62L 3CAMA 4DR5L 4DR3Q 3S14H 2R93G 4P74A 4AIMA 4NXML 3ERSX 2UXCQ 2V1CC 2K75A 4QIWE 5H1SE 1KRTA 1VQ6A 5IWAQ 1XMQQ 1SRUA 4JOIC 3TQYA 1UE7A 3K8AA 4A3BG 4OO1I 1SROA 2GVBA 5AJ3Q 4LF8L 5C44G 3HOVG 4A4IA 2ALYB 5C4XH 2VQFL 3NELA 5M3FH 1L1OC 3GTKH 4BA1I 3KDFA 2EIFA 4R4CA 1YITA 4QQBX 4DV6Q 3UE1A 2JQOA 1XPUA 4MZ9A 1YBYA 4AYBE 3JAMi 1X9NA 4GKKQ 2CWPA 3J7ZC 1N33Q 5LMNQ 4GOPA 3PUYA 5M5YH 4EQ5A 1TWCH 2R6GA 3K81C 4LFBQ 5JEAJ 2D0PA 3KOJA 2QEXA 1WCMG 3T1HQ 2IX1A 3CC4A 1OXTA 4QY7A 3IRBA 1FL0A 1XNRQ 1PH7A 1QVGA 2KBNA 2AMCB 5IE8A 1E24A 4A3FG 3A0JA 4NXNQ 4A3KH 2R92H 3S16H 1Q86C 1LM0A 4DK3C 4GKKL 1D7QA 4JBJA 3KFUA 4JI4Q 3PO2G 4HJ9A 1N33L 2OCEA 2Z6KC 4IFDG 1SN8A 3BZKA 3W1BA 4DPGA 1KXLA 2GVAA 4K0KL 1EOVA 2CWAA 5C4JH 3PF4A 1O7IA 2CQOA 1IL2A 1WFQA 4B3SL 1L1OA 4RMFA 2ZJRA 1OXSC 4A3LG 1YEZA 3RNUA 1EUJA 2ZTDA 2YYZA 1KC8C 1HNWQ 3HOXG 3CP0A 4YHHQ 4A3IH 4AQYQ 2IY5B 3D0FA 3HOUG 2NVXH 4IPCA 3TEHB 3K7UC 3H3VI 4JI6L 4DV5Q 3M7NA 4L5TA 1XTDA 4L5QA 2JA7G 1AE3A 1X55A 3KF6B 1G291 5IYBH 4LF4Q 2N49A 4A3GG 2UXDL 4L5RC 4B3TQ 4A3DH 3G48A 3EBEA 4TVAB 3CC2A 2RHQB 1HNXL 1VQJA 4OWTB 4LF7L 3CPFA 5C0XI 2AWNA 1MJCA 2JA9A 2KENA 1X54A 4H02A 4ME3A 3UE0A 4POFA 4A93H 1XMOQ 3ER0A 1K73C 1M1KC 3AYHB 2KHJA 2K5HA 4PMWA 4JI8Q 1VQFA 2UXBL 3OYYA 2K50A 1PV4A 3CMEA 1QUQB 1PH3A 4YY3Q 1VQ7A 1A8VA 4B3MQ 4GNXB 1L0WA 3I4MH 1N32Q 5BR8Q 1CKMA 2ZM6Q 3U50C 3M3YH 4DKAC 2GN5A 1VQDA 2UUAL 1PH5A 3J81i 3NBHB 4Y52H 4IO9A 1Q1EA 3K7AH 3EN2A 3FKIH 4UP7A 4LF6Q 4IOAA 1HH2P 4X65L 1K3RA 1Y1VG 1X3FA 2XGTA 3HOZH 2VW9A 1KD1C 2E2IH 1N34L 1HZBA 4LUOA 3KJOA 4BBRH 1B8AA 2AHOB 3T1YL 3GDEA 1Q46A 3S1RH 4LWCA 1T9HA 5GAEC 3D31A 4HJAA 2E5LQ 4IFDJ 5IYDH 5C3EH 1VQPA 4AH6A 4NPSA 4PZ8A 4DV4Q 1G51A 1UEBA 2D0OA 1EIFA 3M4QA 1N9WA 1J6QA 1P16A 1LTLA 2OWOA 1GKHA 1GO3E 3CF5A 1CSQA 1BKBA 2QGQA 3GTMH 1FGUA 2ID0A 3S17H 2HHHL 5LMUQ 3CMAA 4C3IH 4A3CG 2NVTH 1Q12A 2F52A 1J5EQ 3F8TA 3STBD 1G6PA 3ULJA 2WB1E 3HKZG 4LF5Q 3OTOL 2BH2A 4TQUS 2MQHA 2A8VA 1YVCA 4GOPC 2WAQE 4DR2Q 2R7ZG 3S1MH 4JI7L 2HQLA 3GO5A 3UDXA 1HR0W 4DR1L 3F2BA 2B3GA 4DAMA 2JA5G 5EAYA 2DGYA 3HKSA 3KDFB 1JJGA 2NVYH 5IP9H 2LSSA 3HOWG 3H3VH 5M3MH 2R92G 3H0GH 4A3KG 3UDGA 1K9MC 3AEVA 3HOYH 4LNQA 4B3RL 4LF9L 5J3BA 4GOPB 4A75A 1VQOA 2RHSB 4DR2L 4X6AH 4A3EG 2WP8J 3PIPA 4HIOA 5K36G 2JEBI 1QVCA 2ZJPA 2CKZB 1VS0A 3BU2A 4QL5A 4JI3L 1QZHA 3I4NH 5IY0A 2B63G 1QZGA 1VQAA 4DUYQ 4KHPQ 1Z47A 5GAHC 4DR3L 4JV5Q 4IPDA 4P71A 1I94Q 1E1TA 1IBKQ 4DAYB 2UXCL 1PH2A 5IYCG 4A3IG 5IWAL 1XMQL 5JJIA 3J80c 5FJ8G 1ASZA 2PMZE 4JI2Q 4BY1G 4GKJQ 2HIVA 1VQ5A 4MNOA 2L15A 4Y7NH 1UE6A 4UPAA 4UP8A 5AJ3L 1EFWA 4DR6Q 1L1OB 5JJLA 1MKHA 5IYBG 5ELOA 3MXNB 3A5UA 3L2PA 1MIUA 3B6YA 4KI0A 2E2JH 4OONA 4DV6L 3FP9A 4POGA 3TREA 1OXVA 5LMNL 2MO1A 3F1ZA 1IYJB 4JI2L 4LFBL 1CKOA 1VQIA 2UU9Q 4A3MG 3T1HL 2JA8H 2DUDA 1HZAA 2BH8A 2K4KA 5IT9c 3F2DA 1XNRL 3RLNA 3I4MG 4NXNL 4BBSG 2UUCQ 2VS1A 1YI2A 1X3EA 2MO0A 4JI4L 1UE1A 4IPGA 4HJ7A 2UUBQ 1PVOA 3GTQH 2NN6I 4LFAQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R9T H;  4OO1 G;  4GLA C;  1YJW A;  1N36 Q;  2ES2 A;  3CCQ A;  3UDF A;  1YNX A;  4DV0 Q;  1LUZ A;  4L5S A;  1AH9 A;  1K8A C;  1RL2 A;  3W5O A;  1PYB A;  5HGQ A;  1CSP A;  1YZ6 A;  1E7Z A;  1TWH H;  4P73 A;  4XIG S;  3HOZ G;  1PYS B;  3AQQ A;  4IPH A;  1HR0 Q;  3HOV H;  4BBR G;  1IXR A;  2OQ0 A;  5C44 H;  1HNW L;  4YHH L;  2ZJQ A;  4AQY L;  2JA6 H;  2YTV A;  5C3E G;  2Q2T A;  3S2H H;  4JI0 Q;  2I0Q A;  1N36 L;  1KIX A;  3RLF A;  2FXQ A;  4DV5 L;  3PO3 G;  2VQE Q;  1XPO A;  2C35 B;  2YTX A;  3L7Z C;  4JG2 A;  3A74 A;  4R4T A;  1IBM Q;  1PH8 A;  2ZTC A;  1KQS A;  3CCJ A;  4LF4 L;  1C0A A;  3G71 A;  4DR4 Q;  4B3T L;  3GTG H;  2VUM G;  1KRS A;  2N3S A;  4X64 Q;  1WCM H;  2PQA A;  1QVF A;  4XTC S;  3CXC A;  1EYG A;  4JBM A;  3U4V A;  2Z0S A;  2JK8 A;  3L0O A;  1XMO L;  4A3F H;  1NY4 A;  1NBW A;  2F3I A;  2K5N A;  4JI8 L;  1TXY A;  2H5X A;  3G6E A;  1XJV A;  1SE8 A;  1YJ9 A;  3EIV A;  5FLM H;  2K52 A;  4KLK A;  1UWV A;  4YCW A;  4DUZ Q;  1TWA H;  2F4V Q;  4JI5 Q;  3GTO H;  3PO2 H;  2LXK A;  4IJH A;  4YY3 L;  5FLX c;  1JB7 A;  4APV A;  4B3M L;  4R4I A;  3GTJ H;  1VQ4 A;  4LFC Q;  5BR8 L;  2JEA I;  1N32 L;  2ZM6 L;  1JJ2 A;  1XNQ Q;  1HZC A;  1TWG H;  2JJQ A;  4OX9 Q;  1CKN A;  3U58 A;  3PV0 A;  4JC0 A;  1PH6 A;  1KHI A;  5IP9 G;  3GTP H;  4LF6 L;  4HIM A;  4A3L H;  2IHE A;  1KL9 A;  4DV1 Q;  4JYA Q;  2E2H H;  3HOX H;  3HOY G;  1W3S A;  1WOC A;  4JBK A;  2Y0S G;  4PZ7 A;  1I3Q H;  1KAW A;  1VQG A;  5ELN A;  3RN5 A;  3E9H A;  4JBW A;  4LW1 A;  4PG3 A;  5C0X G;  1JT8 A;  3TRZ A;  1BVS A;  3PGZ A;  1Q7Y C;  4QGU A;  2JA7 H;  2E5L L;  3I7F A;  1DGS A;  3NEM A;  1S72 A;  3H15 A;  1HNZ Q;  5C4X G;  1SMX A;  2Q2U A;  3I4N G;  5M3F G;  3WWV A;  1S40 A;  2I5L X;  4DV4 L;  2N8N A;  2PI2 A;  1V9P A;  5GRO A;  1E22 A;  1S3O A;  5GAD C;  3I56 A;  4DV2 Q;  4HIK A;  2D62 A;  3K0X A;  1FJG Q;  4IOC A;  2EXD A;  2R7D A;  5LMU L;  3S1Q H;  3G4S A;  4X66 Q;  3A5Z B;  1AE2 A;  3MEF A;  1NTG A;  1NMF A;  1J5E L;  2WFW A;  2OTJ A;  3AFP A;  2Q2I A;  4GN4 B;  2RCN A;  1WYD A;  1HZ9 A;  2VZA A;  1PA6 A;  3NEN A;  1Z9F A;  3TS0 A;  1JE5 A;  3HFZ B;  3OW2 A;  4LF5 L;  3HKZ E;  1X3G A;  5GAG C;  4X62 Q;  1FJG L;  3PUW A;  4A3J H;  3E0E A;  4OWX B;  1VQC A;  4DR5 Q;  1VQ9 A;  2JE6 I;  1P8L A;  4NXM Q;  3BJU A;  1Y1V H;  3FHW A;  1FVI A;  2PNH A;  4GS3 A;  4RG1 A;  1TWF H;  5M5X H;  2A19 A;  3K80 C;  1D8L A;  4HJ8 A;  4IFD I;  3PUV A;  1X65 A;  2R93 H;  1NE3 A;  2ZTE A;  2ASB A;  3M4P A;  1PH9 A;  3ICE A;  4LF8 Q;  1A0I A;  3KF8 B;  4P72 A;  5HY6 A;  2VQF Q;  1W2B A;  3GTL H;  2I5M X;  1GM5 A;  1K83 H;  5IP7 G;  2YU9 H;  4AYB G;  3RZD H;  2BA0 A;  1PFS A;  1Q82 C;  1K0R A;  4C3H H;  1OXX K;  3LGJ A;  1YIJ A;  1SFO H;  2KCT A;  4KHP L;  1V1Q A;  4DUY L;  2AWO A;  3VDY A;  1HJP A;  4DV3 Q;  2HT1 A;  3SGI A;  4JV5 L;  1Y1W H;  4A3D G;  1I5F A;  3J81 c;  2A1A A;  3BZC A;  1I94 L;  1IBK L;  4A3C H;  5GQO A;  1WJJ A;  4A93 G;  3Q8D A;  2JA6 G;  1A63 A;  4BY7 H;  3AFQ A;  1JJC B;  3RZO H;  1JMC A;  4GKJ L;  5C0X J;  1YHA A;  2NVQ H;  1B70 B;  1H95 A;  4O2D A;  4DR6 L;  3RLO A;  3CCR A;  1VQK A;  4KHZ A;  1PHJ A;  2R7Z H;  3S15 H;  4DV3 L;  1RIP A;  1XPR A;  1PH4 A;  3GD7 A;  4K0K Q;  5IP7 H;  2JA5 H;  1EQR A;  4EX5 A;  2OQK A;  4ALP A;  3CCE A;  4GN3 B;  3PF5 A;  3HOW H;  1E1O A;  4B3S Q;  4R1J A;  4HJ5 A;  4YCV A;  3CCM A;  2IT1 A;  2YV5 A;  3FKI G;  2HIX A;  2UU9 L;  4GLX A;  5FLM G;  4BXX G;  2IHF A;  4DNI A;  1WI5 A;  1C9O A;  3PCO B;  5DLQ E;  4JOI A;  4A3E H;  4DR7 Q;  3PUX A;  2BA1 A;  3E9I A;  2PQA B;  2UUC L;  2R7F A;  4JI6 Q;  2B29 A;  1BBU A;  1YHQ A;  5IYD G;  2B63 H;  1I6H H;  1N8R C;  3S24 A;  4DV7 Q;  4PZ6 A;  3I55 A;  2UUB L;  4LFA L;  3CQZ H;  3J81 j;  2UXD Q;  5JJK A;  1U0L A;  4DV0 L;  2RF4 A;  1HNX Q;  2IX0 A;  4LF7 Q;  3CCS A;  5IYC H;  2CFM A;  1X56 A;  1PH1 A;  2KCM A;  1LYL A;  4GLV B;  2VY3 A;  5FJ8 H;  4WJ4 A;  4DR7 L;  1Y14 B;  4BY1 H;  2E8G A;  3S2D H;  3DLL A;  1ASY A;  1HR0 L;  1C7Y A;  1CKN B;  2UXB Q;  4JCV E;  2NZO A;  4GN5 A;  1A62 A;  2PI2 E;  4DV7 L;  1VQN A;  2N78 A;  3J7A 5;  4JI0 L;  1OXU A;  1VQE A;  1VQ8 A;  3STB C;  2VQE L;  4GNX C;  4C2M H;  3CCL A;  4J15 A;  1CUK A;  1I50 H;  1VQM A;  1IBM L;  2UUA Q;  1SLJ A;  2NZH A;  2Z6K A;  4DR4 L;  1EIY B;  4YWK A;  3CCV A;  1IZ6 A;  4P75 A;  4X64 L;  2CCZ A;  3J80 i;  3CPW A;  4A3M H;  2KHI A;  3CCU A;  2VNU D;  4X65 Q;  3CD6 A;  2NN6 G;  4JI1 Q;  4UP9 A;  3KF6 A;  1M90 C;  2K14 A;  1E3P A;  3JC6 6;  4BBS H;  3ZJY C;  3PUZ A;  5M3M G;  4QJF A;  3JAM c;  1N34 Q;  3KYH C;  4BA2 I;  1VCI A;  2YTY A;  1X6O A;  3H0G G;  3PIO A;  4DUZ L;  3T1Y Q;  2F4V L;  4LUV A;  4R4O A;  1GD7 A;  4JI5 L;  1K8G A;  5LMN W;  3CC7 A;  3RR5 A;  4YCU A;  1Q81 C;  1MJE A;  4LFC L;  4A3J G;  3HOU H;  1Q8K A;  4WJ3 M;  4C3J H;  4R4Q A;  5E7N A;  1XNQ L;  4OX9 L;  3I2Z A;  2VL6 A;  4JI1 L;  4OWW B;  1QUQ A;  3KLW A;  4HID A;  4MTN A;  3I4O A;  2MFI A;  1EQQ A;  4IJL A;  4DV1 L;  4GNX A;  4JYA L;  4YWM A;  1NMG A;  1VQB A;  1UE5 A;  2LXJ A;  2EQS A;  5JEA G;  2HHH Q;  4A3B H;  3CW2 C;  4FDB A;  2AKW B;  1V43 A;  1B7Y B;  4O0A A;  4UY8 C;  2Y0S E;  5M5W H;  3PO3 H;  2WB1 G;  3F2C A;  3PSI A;  3M85 A;  3M4O H;  2Q2H A;  3OTO Q;  1SR3 A;  1HNZ L;  3W1G A;  2WAQ G;  3TS2 A;  1L2F A;  1U5K A;  4NB3 A;  3U4Z A;  1IBL Q;  2VUM H;  3UDI A;  4JI7 Q;  1Y1W G;  1YJN A;  4DK6 C;  4DR1 Q;  1OTC A;  4DV2 L;  1VQL A;  4A76 A;  1GVP A;  2XTI A;  4LUZ A;  3KJP A;  3S1N H;  1YHB A;  1VQH A;  4BY7 G;  4A3G H;  4BXX H;  3DM3 A;  4B3R Q;  3ULP A;  4X66 L;  2MNA A;  4OXP A;  2K5V A;  1NJI C;  4LF9 Q;  2JA8 G;  3ULL A;  1IBL L;  2I5H A;  2ATW A;  1Q1B A;  1BBW A;  1EWI A;  3M9B A;  4YWL A;  2QA4 A;  2OTL A;  4JI3 Q;  3RN2 A;  4X62 L;  3CAM A;  4DR5 L;  4DR3 Q;  3S14 H;  2R93 G;  4P74 A;  4AIM A;  4NXM L;  3ERS X;  2UXC Q;  2V1C C;  2K75 A;  4QIW E;  5H1S E;  1KRT A;  1VQ6 A;  5IWA Q;  1XMQ Q;  1SRU A;  4JOI C;  3TQY A;  1UE7 A;  3K8A A;  4A3B G;  4OO1 I;  1SRO A;  2GVB A;  5AJ3 Q;  4LF8 L;  5C44 G;  3HOV G;  4A4I A;  2ALY B;  5C4X H;  2VQF L;  3NEL A;  5M3F H;  1L1O C;  3GTK H;  4BA1 I;  3KDF A;  2EIF A;  4R4C A;  1YIT A;  4QQB X;  4DV6 Q;  3UE1 A;  2JQO A;  1XPU A;  4MZ9 A;  1YBY A;  4AYB E;  3JAM i;  1X9N A;  4GKK Q;  2CWP A;  3J7Z C;  1N33 Q;  5LMN Q;  4GOP A;  3PUY A;  5M5Y H;  4EQ5 A;  1TWC H;  2R6G A;  3K81 C;  4LFB Q;  5JEA J;  2D0P A;  3KOJ A;  2QEX A;  1WCM G;  3T1H Q;  2IX1 A;  3CC4 A;  1OXT A;  4QY7 A;  3IRB A;  1FL0 A;  1XNR Q;  1PH7 A;  1QVG A;  2KBN A;  2AMC B;  5IE8 A;  1E24 A;  4A3F G;  3A0J A;  4NXN Q;  4A3K H;  2R92 H;  3S16 H;  1Q86 C;  1LM0 A;  4DK3 C;  4GKK L;  1D7Q A;  4JBJ A;  3KFU A;  4JI4 Q;  3PO2 G;  4HJ9 A;  1N33 L;  2OCE A;  2Z6K C;  4IFD G;  1SN8 A;  3BZK A;  3W1B A;  4DPG A;  1KXL A;  2GVA A;  4K0K L;  1EOV A;  2CWA A;  5C4J H;  3PF4 A;  1O7I A;  2CQO A;  1IL2 A;  1WFQ A;  4B3S L;  1L1O A;  4RMF A;  2ZJR A;  1OXS C;  4A3L G;  1YEZ A;  3RNU A;  1EUJ A;  2ZTD A;  2YYZ A;  1KC8 C;  1HNW Q;  3HOX G;  3CP0 A;  4YHH Q;  4A3I H;  4AQY Q;  2IY5 B;  3D0F A;  3HOU G;  2NVX H;  4IPC A;  3TEH B;  3K7U C;  3H3V I;  4JI6 L;  4DV5 Q;  3M7N A;  4L5T A;  1XTD A;  4L5Q A;  2JA7 G;  1AE3 A;  1X55 A;  3KF6 B;  1G29 1;  5IYB H;  4LF4 Q;  2N49 A;  4A3G G;  2UXD L;  4L5R C;  4B3T Q;  4A3D H;  3G48 A;  3EBE A;  4TVA B;  3CC2 A;  2RHQ B;  1HNX L;  1VQJ A;  4OWT B;  4LF7 L;  3CPF A;  5C0X I;  2AWN A;  1MJC A;  2JA9 A;  2KEN A;  1X54 A;  4H02 A;  4ME3 A;  3UE0 A;  4POF A;  4A93 H;  1XMO Q;  3ER0 A;  1K73 C;  1M1K C;  3AYH B;  2KHJ A;  2K5H A;  4PMW A;  4JI8 Q;  1VQF A;  2UXB L;  3OYY A;  2K50 A;  1PV4 A;  3CME A;  1QUQ B;  1PH3 A;  4YY3 Q;  1VQ7 A;  1A8V A;  4B3M Q;  4GNX B;  1L0W A;  3I4M H;  1N32 Q;  5BR8 Q;  1CKM A;  2ZM6 Q;  3U50 C;  3M3Y H;  4DKA C;  2GN5 A;  1VQD A;  2UUA L;  1PH5 A;  3J81 i;  3NBH B;  4Y52 H;  4IO9 A;  1Q1E A;  3K7A H;  3EN2 A;  3FKI H;  4UP7 A;  4LF6 Q;  4IOA A;  1HH2 P;  4X65 L;  1K3R A;  1Y1V G;  1X3F A;  2XGT A;  3HOZ H;  2VW9 A;  1KD1 C;  2E2I H;  1N34 L;  1HZB A;  4LUO A;  3KJO A;  4BBR H;  1B8A A;  2AHO B;  3T1Y L;  3GDE A;  1Q46 A;  3S1R H;  4LWC A;  1T9H A;  5GAE C;  3D31 A;  4HJA A;  2E5L Q;  4IFD J;  5IYD H;  5C3E H;  1VQP A;  4AH6 A;  4NPS A;  4PZ8 A;  4DV4 Q;  1G51 A;  1UEB A;  2D0O A;  1EIF A;  3M4Q A;  1N9W A;  1J6Q A;  1P16 A;  1LTL A;  2OWO A;  1GKH A;  1GO3 E;  3CF5 A;  1CSQ A;  1BKB A;  2QGQ A;  3GTM H;  1FGU A;  2ID0 A;  3S17 H;  2HHH L;  5LMU Q;  3CMA A;  4C3I H;  4A3C G;  2NVT H;  1Q12 A;  2F52 A;  1J5E Q;  3F8T A;  3STB D;  1G6P A;  3ULJ A;  2WB1 E;  3HKZ G;  4LF5 Q;  3OTO L;  2BH2 A;  4TQU S;  2MQH A;  2A8V A;  1YVC A;  4GOP C;  2WAQ E;  4DR2 Q;  2R7Z G;  3S1M H;  4JI7 L;  2HQL A;  3GO5 A;  3UDX A;  1HR0 W;  4DR1 L;  3F2B A;  2B3G A;  4DAM A;  2JA5 G;  5EAY A;  2DGY A;  3HKS A;  3KDF B;  1JJG A;  2NVY H;  5IP9 H;  2LSS A;  3HOW G;  3H3V H;  5M3M H;  2R92 G;  3H0G H;  4A3K G;  3UDG A;  1K9M C;  3AEV A;  3HOY H;  4LNQ A;  4B3R L;  4LF9 L;  5J3B A;  4GOP B;  4A75 A;  1VQO A;  2RHS B;  4DR2 L;  4X6A H;  4A3E G;  2WP8 J;  3PIP A;  4HIO A;  5K36 G;  2JEB I;  1QVC A;  2ZJP A;  2CKZ B;  1VS0 A;  3BU2 A;  4QL5 A;  4JI3 L;  1QZH A;  3I4N H;  5IY0 A;  2B63 G;  1QZG A;  1VQA A;  4DUY Q;  4KHP Q;  1Z47 A;  5GAH C;  4DR3 L;  4JV5 Q;  4IPD A;  4P71 A;  1I94 Q;  1E1T A;  1IBK Q;  4DAY B;  2UXC L;  1PH2 A;  5IYC G;  4A3I G;  5IWA L;  1XMQ L;  5JJI A;  3J80 c;  5FJ8 G;  1ASZ A;  2PMZ E;  4JI2 Q;  4BY1 G;  4GKJ Q;  2HIV A;  1VQ5 A;  4MNO A;  2L15 A;  4Y7N H;  1UE6 A;  4UPA A;  4UP8 A;  5AJ3 L;  1EFW A;  4DR6 Q;  1L1O B;  5JJL A;  1MKH A;  5IYB G;  5ELO A;  3MXN B;  3A5U A;  3L2P A;  1MIU A;  3B6Y A;  4KI0 A;  2E2J H;  4OON A;  4DV6 L;  3FP9 A;  4POG A;  3TRE A;  1OXV A;  5LMN L;  2MO1 A;  3F1Z A;  1IYJ B;  4JI2 L;  4LFB L;  1CKO A;  1VQI A;  2UU9 Q;  4A3M G;  3T1H L;  2JA8 H;  2DUD A;  1HZA A;  2BH8 A;  2K4K A;  5IT9 c;  3F2D A;  1XNR L;  3RLN A;  3I4M G;  4NXN L;  4BBS G;  2UUC Q;  2VS1 A;  1YI2 A;  1X3E A;  2MO0 A;  4JI4 L;  1UE1 A;  4IPG A;  4HJ7 A;  2UUB Q;  1PVO A;  3GTQ H;  2NN6 I;  4LFA Q; 
#chains in the Genus database with same CATH topology
 3CCQ A;  3UDF A;  1YNX A;  3NK9 A;  4V19 0;  1K8A C;  1PYB A;  1CSP A;  5JVH 3;  5I2X A;  1HR0 Q;  2EPB A;  1GOZ A;  3MAQ A;  5C3E G;  2Q2T A;  3PO3 G;  2FXQ A;  1XPO A;  2C35 B;  4R4T A;  4XYO A;  4R9W A;  1NNX A;  3G71 A;  3A54 A;  1KRS A;  2V4D A;  1SYC A;  2ZT9 C;  2E76 C;  1BCP B;  3EA6 A;  1XMO L;  3SE0 A;  1O80 A;  1NY4 A;  4KKU A;  2K5N A;  3G6E A;  2H5X A;  4BXX H;  3CHB D;  1TWA H;  1IL8 A;  3HS0 C;  1FNW A;  1PRT D;  4IFD H;  5ELC A;  4C3J B;  4B08 A;  4N8F A;  4DA2 A;  3GTJ H;  1S5C D;  2L12 A;  2EY2 A;  1XNQ Q;  3TN2 A;  1ICW A;  5IP9 G;  1B50 A;  3K59 A;  4LF6 L;  4HIM A;  2IHE A;  4DV1 Q;  4JYA Q;  2E2H H;  5EKI A;  1HFG A;  4CDF C;  3HOX H;  4L6T B;  5FO8 B;  1VQG A;  1CT1 D;  5KYI A;  2AQ2 B;  4LW1 A;  3PIO 3;  3BVM A;  2O5J C;  1JT8 A;  1BVS A;  1MHW C;  4OHJ A;  1DGS A;  5BN4 A;  5CMD A;  5C4X G;  2Q2U A;  2KEC A;  3WWV A;  1S40 A;  1SYD A;  4ZLT F;  4M1U B;  2N8N A;  1EWC A;  1E22 A;  4DV2 Q;  2D62 A;  1JC7 A;  1PTO F;  3SK6 A;  1AEX A;  5LMU L;  4CJ0 B;  1TS3 A;  1AE2 A;  1EQT A;  4G57 A;  3AFP A;  2Q2I A;  1C48 A;  1WYD A;  2VZA A;  1RD9 D;  3TS0 A;  4X62 Q;  3S14 B;  1VQ9 A;  1P8L A;  4G7O C;  3BJU A;  3FHW A;  3MXP A;  1FVI A;  1VDZ A;  2LKV A;  5M5X H;  1PXU A;  3R2T A;  2QKI C;  1DOM A;  3QOL A;  1K8O A;  5M3F B;  1SEB D;  4K8I A;  3GTL H;  1K83 H;  5C4H A;  1TS5 A;  1FD7 D;  1PTO B;  1AN8 A;  1HJP A;  4HR7 B;  2HT1 A;  4JV5 L;  4UHV A;  2A1A A;  2EJF C;  4A3C H;  2SNS A;  2ENB A;  5BN5 A;  4G7H C;  2EYP A;  2JA6 G;  4BY7 H;  4A3K B;  1JJC B;  1YHA A;  2PZW A;  1QCB D;  1PHJ A;  4H44 C;  1GJX A;  1RIP A;  1EL0 A;  4K0K Q;  4U67 3;  4XYQ A;  3NP8 A;  1ZYR D;  2PW5 A;  3CCE A;  3KUP A;  2G9H D;  3NTI A;  4RKB A;  3HZX A;  3FKI G;  1SJE D;  4A3I B;  3AMU A;  1C9O A;  2K5D A;  3W2D A;  4A3E H;  2UUC L;  4CJ2 C;  2MPM A;  2B29 A;  3K57 A;  3DWA A;  2DJF C;  4K2K A;  1YHQ A;  5IYD G;  1I6H H;  4A3D B;  1BUV T;  1RCV D;  1LAB A;  3J81 j;  2UXD Q;  1RTN A;  1U0L A;  3QWN A;  4DV0 L;  2IX0 A;  1Q90 A;  5IYC H;  4L63 B;  3D4R A;  1I6V C;  5DEH A;  4RGM A;  3C3L A;  4BY1 H;  2E8G A;  1PZK D;  1C7Y A;  2NZO A;  3T53 B;  2N78 A;  1TR5 A;  1AW7 A;  1I50 H;  2A6E D;  1VQM A;  2Z6K A;  3NPP A;  2PW7 A;  3CRL C;  4A3M H;  4BS9 A;  3BZD B;  4X65 Q;  3HOZ B;  3JC6 6;  4BBS H;  3A56 A;  4DF7 A;  3JAM c;  3PUZ A;  1N34 Q;  4QJF A;  4BA2 I;  3FEW X;  3S1R B;  3NWS A;  2BOS A;  1CHQ D;  3GQB A;  3FMC A;  3CC7 A;  4A3J G;  2J0T D;  2F0K A;  3VR2 A;  4K2L A;  4OX9 L;  4FF4 A;  1TII D;  3GP7 A;  4OWW B;  1XXG A;  1EQQ A;  2FIN B;  1NMG A;  4YWM A;  2LXJ A;  2Q8T A;  1Y8N B;  5JEA G;  4LK1 C;  3EQL C;  5M5W H;  3F2C A;  2DY7 A;  2EY1 A;  2Q2H A;  1HNZ L;  5IOD A;  3TS2 A;  1L2F A;  1IBL Q;  4HCE A;  1Y1W G;  1YJN A;  1GUS A;  4A76 A;  1GVP A;  3S1N H;  2OXP A;  1EZ6 A;  3M7G A;  3WDN A;  1SDF A;  1K0S A;  3H0G B;  3K5L A;  3BDO A;  3P75 A;  1E2W A;  5I6Y A;  3DM3 A;  4B3R Q;  1G2T A;  4X66 L;  4LF9 Q;  2JA8 G;  3P1H A;  1IBL L;  2I5H A;  5COR A;  4ZAI A;  2FJ2 A;  3M9B A;  5A35 A;  2QA4 A;  4JI3 Q;  4DR3 Q;  2HCI A;  4AIM A;  3K5N A;  2UXC Q;  2K75 A;  5H1S E;  5IGC A;  1VQ6 A;  2EYL A;  2Z4I A;  1IHZ A;  1SRU A;  1PRT F;  5J39 A;  1SRO A;  2GVB A;  2DNC A;  4PMB A;  4LF8 L;  2A69 D;  2OF1 A;  1L1O C;  1STN A;  4BA1 I;  2EJM A;  4R4C A;  1X9N A;  1YNN D;  2CWP A;  1CTM A;  1BDO A;  1TWC H;  2L55 A;  1SNQ A;  2IX1 A;  3SHL A;  1OXT A;  5C3X A;  2EY6 A;  3IRB A;  1LTA D;  2KBN A;  5EJW A;  1QVG A;  1ZKO A;  3S16 H;  1LAC A;  3GV3 A;  4JI4 Q;  3GTQ B;  1KNE A;  2MGS A;  2R93 B;  4IFD G;  3W1B A;  1KXL A;  2L4N A;  1EOV A;  1M8A A;  5C4J H;  2PPB C;  2F0V A;  1L1O A;  1PLF A;  2ZJR A;  4L8J A;  1B53 A;  5CBE E;  2YYZ A;  1KC8 C;  1PRT B;  3HOX G;  1HNW Q;  5ISR A;  1SND A;  1C8C A;  3T56 B;  4U68 A;  1KDB A;  3MHB A;  2NVX H;  1CHP D;  2B2U C;  4DV5 Q;  1XTD A;  1KAA A;  1X55 A;  3L3O C;  1G29 1;  3DWP A;  4B3T Q;  4TVA B;  4LF7 L;  1HNX L;  4A3B G;  1MJC A;  2JA9 A;  3J80 E;  1NAP A;  1EEF D;  1A3T A;  2CW0 D;  1RDP D;  2KUM A;  1K73 C;  2K5H A;  3PO2 B;  4CDE C;  2UXB L;  3OYY A;  2K50 A;  4EQN A;  2RDG A;  1VQ7 A;  1ICF B;  1R4Q B;  2PYK A;  1A8V A;  1LV9 A;  3NSW A;  1L0W A;  1TWG B;  1ONL A;  3U50 C;  2ZM6 Q;  2PNR C;  1CA5 A;  4DKA C;  1PH5 A;  1HTL D;  4CKB A;  1SNO A;  5DM7 3;  2K01 A;  3K7A H;  2B2W C;  2PCF B;  3H6M A;  5IT9 E;  2M2L A;  1MBY A;  1K8M A;  1PYW D;  4P2C B;  2E2I H;  1F9S A;  1HZB A;  1J9O A;  1B8A A;  3GDE A;  1Q46 A;  2EYO A;  4LWC A;  4IUU A;  3Q24 A;  5CR3 A;  5C3E H;  2Q8I B;  1UEB A;  5M5W B;  3F2U A;  1LTL A;  3MZ5 A;  1I4Q A;  3SK4 A;  2QGQ A;  4JPB W;  2HHH L;  4A3C G;  1Q12 A;  2F52 A;  3V96 A;  1DOK A;  4OIK A;  1G6P A;  3LX0 A;  1DZ1 A;  3S1N B;  2BE5 D;  3HKZ G;  4LF5 Q;  3OTO L;  4DK0 A;  1G91 A;  1MGS A;  2I07 B;  4DR2 Q;  2E74 C;  2HQL A;  3GO5 A;  3UDX A;  1FNV A;  2NN6 H;  1H9K A;  2NVY H;  5IP9 H;  2LSS A;  5M3M H;  2MUY A;  3AEV A;  1K9M C;  1GUN A;  5D65 A;  5J3B A;  5TSS A;  4DR2 L;  3RZD B;  4A3E G;  4ILW A;  1I4G A;  4C3H B;  1QVC A;  4FNF A;  4R8N A;  3JAM E;  5IY0 A;  1QZG A;  3GV6 A;  4LJZ C;  2IX3 A;  5IGG A;  4IPD A;  2DJG C;  1D1I A;  1I94 Q;  1IBK Q;  1HPC A;  5IYC G;  5IWA L;  4F8M A;  1PFN A;  2F0T A;  4BY1 G;  1VQ5 A;  4MNO A;  1UE6 A;  1T5E A;  1L1O B;  3EFX D;  3IKJ A;  4X3S A;  3S15 B;  2R7Z B;  1AFP A;  3B6Y A;  2R3Z A;  5JOB A;  1ET9 A;  2I46 A;  2RA4 A;  3HOW B;  1KLG D;  3KF8 A;  4LFB L;  1DXM A;  4QF4 A;  4A3M G;  1H9J A;  2GA4 B;  1HZA A;  3T51 B;  4BBS G;  2VXW A;  3VR3 A;  1YI2 A;  2X69 A;  1X3E A;  1D5X C;  2B63 B;  1HUM A;  1UE1 A;  3CQZ B;  3R3O A;  2EXZ A;  3LNN A;  4RWS C;  1PVO A;  1N36 Q;  2ES2 A;  2B2T C;  5IOC A;  1RL2 A;  3W5O A;  1YZ6 A;  4N9P A;  3S2D B;  4IPH A;  3TBI B;  3HOV H;  5C44 H;  4YHH L;  2K28 A;  2JA6 H;  3MTS A;  4UAI A;  1B9N A;  1BCP C;  4JI0 Q;  1LTT D;  3S2H H;  1N36 L;  4C2M B;  1TVX A;  1HHV A;  2VQE Q;  3L7Z C;  3A74 A;  1QOH A;  3WOE A;  5CV5 A;  2K03 A;  4B9X A;  1STA A;  3ONA B;  4X64 Q;  1V8Q A;  1YNJ C;  1WCM H;  3J7A V;  2PQA A;  2PZU A;  1STH A;  4JBM A;  3A7A B;  3U4V A;  2JK8 A;  1WTV A;  4A3F H;  1DD2 A;  1EY6 A;  1YJ9 A;  4KLK A;  1UWV A;  1HQR D;  3NXW A;  4JI5 Q;  3GTO H;  2LXK A;  4YY3 L;  3HOU B;  2KOL A;  2M00 A;  4APV A;  1JB7 A;  1VQ4 A;  4LFC Q;  5BR8 L;  1RJT A;  1HZC A;  1CKN A;  3U58 A;  4JC0 A;  5C5L A;  1KHI A;  4C1N I;  3GTP H;  1SBB B;  2K04 A;  1KL9 A;  3LWU A;  3TZD A;  4RCO A;  3HOY G;  5C3E B;  4JBK A;  2XRQ D;  1KAW A;  3PO3 B;  5ELN A;  4HCS A;  2KA7 A;  1JOK A;  4JBW A;  1SNP A;  1F2M A;  5KGU A;  4QGU A;  2JA7 H;  2E5L L;  1S72 A;  3NEM A;  3H15 A;  2XN9 C;  1XTC D;  1SMY D;  2I5L X;  4DV4 L;  4HIK A;  3I56 A;  5JJZ A;  5E4X A;  5GAD C;  3K5M A;  2F0L A;  5ELF A;  1RKN A;  4IUV A;  2EXD A;  3G4S A;  3CRK C;  1CI3 M;  2F0G A;  1NTG A;  1NMF A;  2WFW A;  3OW2 A;  3OIQ A;  4KHV A;  2DN8 A;  1X3P A;  3PUW A;  4FP5 D;  4A3J H;  3E0E A;  4OWX B;  2VB3 X;  4DR5 Q;  5EGT A;  1Y1V H;  4UDU C;  1VF5 C;  4GS3 A;  2A19 A;  4IFD I;  3PUV A;  5G3L D;  1NE3 A;  1PTO C;  5HGT A;  3M4P A;  2ASB A;  5C4X B;  3ICE A;  1A0I A;  3KF8 B;  2VQF Q;  2AUJ D;  1W2B A;  4FYD A;  1TS4 A;  1Y69 U;  4I7A A;  5IP7 G;  4G7Z C;  3Q6S A;  1WTH A;  3KBG A;  1Q82 C;  1K0R A;  1B3Q A;  2HUG A;  1CK1 A;  5EPK A;  1YIJ A;  1SFO H;  4KHP L;  1VMC A;  3SGI A;  1Y1W H;  2ICE C;  1BO0 A;  3J81 c;  1DCZ A;  2R92 B;  3RZO H;  3R93 A;  1SE4 A;  4GKJ L;  5C0X J;  1B70 B;  1DYQ A;  1XX8 A;  1CZW A;  4O2D A;  4KJO A;  4DR6 L;  4KJN A;  1VQK A;  5I4D A;  2B8F A;  2F0F A;  4JVZ A;  1XPR A;  1PH4 A;  1I4P A;  4QCL A;  2LY7 A;  1EQR A;  2A6H D;  4XQN A;  4MN3 A;  3MVV A;  3PF5 A;  1QWY A;  1CFM A;  2IT1 A;  5FLM G;  2IHF A;  2WAC A;  5C5M A;  1EZ8 A;  2BA1 A;  2PQA B;  2B2Y A;  2R7F A;  4JI6 Q;  4IUR A;  3BDC A;  4ZRZ A;  2UUB L;  3S24 A;  4DXF A;  2PZT A;  3I55 A;  4LFA L;  5JJK A;  5L37 A;  3D6C A;  3FRP B;  1U4R A;  2CFM A;  2KCM A;  3FPP A;  1Y14 B;  5LL6 S;  1HR0 L;  4TRD A;  1CKN B;  1KDC A;  3J7A F;  1KLU D;  4GN5 A;  1VQN A;  1X3Q A;  3I4M B;  1S5E D;  2EJG C;  3VYS A;  1OXU A;  1I4X A;  1VQE A;  4JK1 C;  2F0H A;  4DAV A;  1GXD C;  1W6K A;  2NZH A;  5FKA C;  3FKI B;  2XVS A;  2WV6 D;  2QIL A;  2Z8L A;  1IZ6 A;  3OMC A;  1AZP A;  2CCZ A;  3T13 A;  4J1M A;  5JAV A;  2F0P A;  3OOC A;  5D3D A;  2NN6 G;  1LTS D;  4K6L A;  3KF6 A;  4JI1 Q;  4BBR B;  3ZJY C;  5M3M G;  1HA6 A;  5IIF A;  3DEP A;  1VCI A;  4XDX A;  1X6O A;  4ZCK A;  4R4O A;  1K8G A;  2F0O A;  2IPK D;  5LMN W;  3RR5 A;  1Q81 C;  5E7N A;  4XQQ A;  1XNQ L;  2G5D A;  5EPL A;  2DY8 A;  1F2Z A;  1FGB D;  4RGT A;  2VL6 A;  4JI1 L;  1QUQ A;  4M8A A;  5DAU A;  3S17 B;  1O7Z A;  4DV1 L;  4JYA L;  1R4P B;  4V0B A;  1VQB A;  4A3B H;  3CU7 A;  3OSO A;  1IW7 C;  2Y0S E;  2WB1 G;  2KQ3 A;  5FO9 B;  3IFD A;  3PSI A;  3M85 A;  3M4O H;  3J81 L;  3W1G A;  2WAQ G;  4HN7 A;  1U5K A;  2VUM H;  1TS2 A;  4JI7 Q;  1WTP A;  4DR1 Q;  4DV2 L;  4IUT A;  3KJP A;  1YHB A;  1HFN A;  5DM6 3;  4A3G H;  1G8Z D;  2Y0S B;  1HRJ A;  2EDG A;  3SR1 A;  3ULL A;  3P7J A;  2NTS A;  5A2Q L;  3I72 A;  3BDL A;  4DXG A;  3RN2 A;  4X62 L;  5K5P A;  1B3A A;  2ICI A;  3NQT A;  4KY6 A;  3ERS X;  2V1C C;  1Y8P B;  1XMQ Q;  2Q8R E;  5I9P A;  1EY0 A;  3TQY A;  1UE7 A;  2H1E A;  3HOV G;  5C44 G;  4A4I A;  2ALY B;  3A8I E;  2E2J B;  3GTK H;  3KDF A;  3PIP 3;  2EIF A;  3E5S A;  4IZ8 A;  4RFB A;  4X3U A;  1W6J A;  4AYB E;  1SNC A;  3J7Z C;  1N33 Q;  1NR4 A;  5LMN Q;  3PUY A;  3EJI A;  4C1N K;  1ILP A;  2JA8 B;  4K14 A;  1K28 A;  1WCM G;  2CHB D;  3CC4 A;  3M4Y A;  4F87 A;  5JPN C;  3H09 A;  1SNM A;  3I90 A;  5E3F A;  1WTW A;  3RD4 A;  4A3F G;  5EQ0 A;  2J7Z A;  3TME A;  3KFU A;  4HJ9 A;  1N33 L;  2K5Q A;  4DAY A;  4DK1 A;  1PRT C;  4AYB B;  2Z6K C;  1SN8 A;  1VMP A;  4RKL A;  2QEJ C;  2CWA A;  4K0K L;  2PMZ B;  2FMC A;  1O7I A;  3PF4 A;  1STB A;  1EY8 A;  4MHE A;  3VR4 A;  1WFQ A;  1MD2 D;  3MXN A;  1YEZ A;  3HEJ A;  1B9M A;  1TY2 A;  1EUJ A;  2LFN A;  1GHJ A;  3BVZ A;  4AQY Q;  1TKW B;  3H3V I;  4L5T A;  4B9W A;  4RA8 A;  2JA7 G;  3KF6 B;  2F3V A;  4RH6 A;  2N49 A;  4LF4 Q;  2UXD L;  2D2C C;  3CC2 A;  3QB3 A;  5G3L F;  4X3K A;  2RVL A;  3UE0 A;  4POF A;  4A93 H;  1XYI A;  3OMG A;  3AYH B;  4PMW A;  3VR5 A;  4JI8 Q;  1TWA B;  1HTP A;  1VQF A;  5NUC A;  1QUQ B;  4HMJ A;  3GTJ B;  1F2L A;  4B3M Q;  1WTR A;  1RTO A;  1N32 Q;  5T1I A;  1CKM A;  3M3Y H;  1EY4 A;  3H91 A;  3J81 i;  2WKD A;  1DM0 B;  4EGV A;  4UP7 A;  2E2H B;  3HOX B;  2K7V A;  4IOA A;  1HH2 P;  3DHQ A;  4X65 L;  1Z6H A;  1K3R A;  1Y1V G;  5EKK A;  2XWB B;  2VW9 A;  3HGB A;  3VYR A;  1N34 L;  4LUO A;  3I4L A;  1GUG A;  1SE3 A;  1AP0 A;  1T9H A;  5GAE C;  1ENC A;  3DM1 A;  4CBV A;  4NPS A;  2EZV A;  4A3B B;  4ZYS A;  1JWU D;  2RDF A;  3K5O A;  3SEB A;  4J6H A;  2EYH A;  1EIF A;  2QDL A;  4CDC C;  2BDN A;  1GO3 E;  3NWT A;  1CSQ A;  3GTM H;  2F0Q A;  3CMA A;  3ZYY X;  4C3I H;  2NVT H;  1J5E Q;  2RCF A;  3STB D;  2DNE A;  3TSS A;  4NW2 A;  2K05 A;  5EKL A;  1CQV A;  4RHS A;  3SK8 A;  3Q22 A;  2A8V A;  3V05 A;  5CC4 A;  3UI2 A;  3S1M H;  1ZXT A;  3F2B A;  4K5W A;  5M5X B;  3ERQ A;  1ZYR C;  3HKS A;  3KDF B;  3H3V H;  4A3K G;  2JN4 A;  3HOY H;  4B3R L;  5CV7 A;  4LNQ A;  4LF9 L;  4NDX A;  4N9T A;  5BN3 A;  3GTL B;  5FOB B;  1K83 B;  4OL7 A;  2RHS B;  1E2Z A;  4GZY C;  5K36 G;  1B1Z A;  2ZJP A;  2CKZ B;  1VS0 A;  3BU2 A;  4QL5 A;  4JI3 L;  5DNF A;  3KK7 A;  4DUY Q;  1A3U A;  3MXU A;  5GAH C;  4DR3 L;  2EYM A;  4CJ1 B;  2UXC L;  1KNA A;  4DAY B;  5F2D A;  4BY7 B;  4A3I G;  2L1B A;  3HKZ B;  4HAE A;  4JI2 Q;  4QUF A;  3VR6 A;  2L15 A;  4Y7N H;  2F0E A;  1EFW A;  3D6W A;  5IYB G;  3L2P A;  2HCC A;  3MXN B;  2RSO A;  1E2V A;  2Z4H A;  3K6O A;  4CDD C;  3TRE A;  1OXV A;  1DOL A;  2A6E C;  3F1Z A;  4HED A;  4JI2 L;  4NMZ A;  3DUZ A;  1VQI A;  2UU9 Q;  2F1M A;  4A3E B;  2DUD A;  1ILQ A;  1A2T A;  2HQE A;  2QCP X;  4TKO B;  4R8I A;  4JI4 L;  1I6H B;  1JE4 A;  2NN6 I;  5IP7 H;  5CGK A;  5FLX L;  4XQJ A;  1R9T H;  1EQV A;  4GLA C;  1YJW A;  4TSS A;  1AH9 A;  2F0U A;  4BY1 B;  5HGQ A;  5AFW A;  1E7Z A;  1TWH H;  4P73 A;  3HOZ G;  1PYS B;  5I2Y A;  4FF3 A;  1HNW L;  4DNT B;  2L9H A;  2YTV A;  2WKC A;  1GUO A;  4OEL B;  3I3C A;  4FXK C;  3RLF A;  4DV5 L;  1I50 B;  4CKE A;  4JG2 A;  2L5T A;  2YTX A;  2H4O A;  3VYT A;  1IBM Q;  4IUQ A;  1KQS A;  4OGQ C;  4DR4 Q;  4B3T L;  4A3M B;  3I70 A;  3GTG H;  2VUM G;  2N3S A;  1RF2 D;  1BNZ A;  4BBS B;  2Z0S A;  3L0O A;  2RDH A;  4A3G G;  1XJV A;  1SE8 A;  5FLM H;  2K52 A;  4DUZ Q;  4YCW A;  2F4V Q;  3TP6 A;  4CHT B;  2E75 C;  4IJH A;  1KTK A;  3C1E A;  2ZM6 L;  3SK5 A;  4E6I A;  2JJQ A;  1SXT A;  1PH6 A;  3HRZ C;  3E0J A;  1W3S A;  1WOC A;  2KED A;  4CKC A;  1PZI D;  4QUC A;  3E9H A;  3RN5 A;  1WD0 A;  2O2L D;  2J4X A;  3AU7 A;  5C0X G;  3TRZ A;  3PGZ A;  1Q7Y C;  1D1K A;  3I7F A;  2A69 C;  1S5F D;  1SMX A;  3I4N G;  1NSN S;  4FXG C;  4IAL A;  3E3X A;  1V9P A;  2BDO A;  1JB3 A;  1S3O A;  5KEE A;  2NVT B;  3K0Y A;  1YNN C;  4QB4 A;  1Z7T A;  1FJG Q;  4IOC A;  1ESR A;  3ND8 A;  3S1Q H;  3AB9 A;  1SYF A;  3H94 A;  1PA6 A;  1Z9F A;  4LF5 L;  4EVO A;  2G9D A;  5GAG C;  1PMR A;  1FJG L;  3HOY B;  1STG A;  4ME5 A;  1LO5 D;  3MA2 B;  4NXM Q;  4HSV A;  1IYV A;  2PNH A;  4RG1 A;  1TWF H;  3K80 C;  1D8L A;  4HJ8 A;  1X65 A;  2P5Z X;  1PH9 A;  1QIL A;  2I5M X;  2MHV A;  1GM5 A;  2YU9 H;  5IGD A;  1JCK B;  2BA0 A;  1A2U A;  1TWC B;  4K8J A;  1V1Q A;  2AWO A;  2K6A A;  1I5F A;  1I94 L;  1IBK L;  1PDQ A;  4A93 G;  1GUW A;  1U4L A;  3Q8D A;  3S16 B;  2CW0 C;  3QO2 A;  3NUC A;  1A63 A;  1JMC A;  2NVQ H;  4MTK A;  1O7L A;  1H95 A;  2CH4 W;  1SYG A;  2XNA C;  3RLO A;  3BS1 A;  3CCR A;  1FYC A;  2RKS A;  2ZXO A;  1JIC A;  1UNS A;  5C4J B;  4FF2 A;  3GD7 A;  2JA5 H;  4EX5 A;  4ALP A;  2Z1C A;  1E1O A;  2F0M A;  4B3S Q;  4R1J A;  1EWH A;  4YIJ A;  2OEO A;  3CCM A;  5ELD A;  2YV5 A;  3T16 A;  1WI5 A;  5DLQ E;  2NVX B;  4JOI A;  4DR7 Q;  3E9I A;  3TDQ A;  1B4O A;  1V1O A;  4DGZ A;  1N8R C;  2B2V A;  2D9U A;  2WIN B;  4F7X A;  4ZQ3 A;  1X56 A;  1PH1 A;  1LYL A;  4GLV B;  3MFG A;  4WJ4 A;  4DR7 L;  1U9R A;  1ASY A;  2JSO A;  1A62 A;  4C3I G;  4JI0 L;  1VQ8 A;  2WII B;  2VQE L;  4GNX C;  3CCL A;  2AQ3 B;  2MP1 A;  4J15 A;  2BE5 C;  2UUA Q;  4FF1 A;  1NR2 A;  1SLJ A;  4XT3 B;  3K7A B;  2LMC B;  3ITP A;  3PMF A;  2RBM A;  4P75 A;  1K3B C;  2X6G A;  4X64 L;  1Q3L A;  3CCU A;  2VNU D;  2EOT A;  1I4R A;  1AZQ A;  3CD6 A;  2E2I B;  3L9A X;  4UP9 A;  2K14 A;  1EYC A;  3PIO A;  3QJY A;  3T1Y Q;  4JI5 L;  1GD7 A;  1X32 A;  3DWQ A;  4YCU A;  1MJE A;  4LFC L;  5KND A;  2F0W A;  4C3J H;  2X6L A;  1ET6 A;  4R4Q A;  3I2Z A;  2Z6B A;  3QG1 A;  3OW7 A;  1NCV A;  3X3N A;  3KLW A;  4MTN A;  3I4O A;  4IJL A;  4GNX A;  3V2T A;  1UE5 A;  2EQS A;  3CKI B;  3CW2 C;  2A5H A;  2AKW B;  4RHR A;  1WD1 A;  1V43 A;  1DJR D;  4J8Q A;  3C1F A;  1EYA A;  2JP1 A;  3A8J E;  1II3 A;  2PQE A;  2O4X A;  1VF7 A;  1V1P A;  1SR3 A;  1UUP A;  3U4Z A;  1J8I A;  3UDI A;  4DK6 C;  1OTC A;  1LT5 D;  1SAP A;  2NVY B;  2XTI A;  5M3M B;  3EVQ A;  2B39 A;  3ULP A;  4O1N A;  2MNA A;  4OXP A;  2K5V A;  3MFY A;  1KAB A;  1QJO A;  1O78 A;  5CV8 A;  4YWL A;  4H7B A;  3C46 A;  4KD4 A;  1B2T A;  2EYF A;  1CQF A;  3CAM A;  4DR5 L;  4EQP A;  3S14 H;  4QIW E;  2KHS A;  1H9M A;  2WB1 B;  4EQO A;  2FHT A;  1XWE A;  4Q0F A;  4KY5 A;  2WAQ B;  2B2Y C;  5AJ3 Q;  2VQF L;  2ZXR A;  1WTX A;  5M3F H;  2PO4 A;  1YIT A;  4DV6 Q;  4ZUI A;  4GOP A;  4QIW B;  4EQ5 A;  1PTO H;  3U9O A;  2QEX A;  3T1H Q;  4WJW A;  1FL0 A;  1XNR Q;  1PH7 A;  1A15 A;  1LT3 D;  2AMC B;  2K1B A;  5CYU A;  5IE8 A;  1LT4 D;  5EBD A;  4NXN Q;  4A3K H;  1D7Q A;  3VA5 A;  4DK3 C;  5IGE A;  4JBJ A;  1EYD A;  2OCE A;  2NTT A;  3BVG A;  1GHK A;  3BZK A;  5J22 A;  1D6E C;  5K36 H;  1EY7 A;  2CQO A;  1IL2 A;  1LT6 D;  1PFB A;  3HOV B;  5C44 B;  2ZTD A;  4WOR A;  2JA6 B;  4CGY B;  3CP0 A;  4A3I H;  3S2H B;  2IY5 B;  2B8G A;  3D4W A;  3FPU B;  3D0F A;  3HOU G;  4IPC A;  3K7U C;  4JI6 L;  5IYB H;  4A3D H;  5C3W A;  1SMY C;  1WCM B;  3G48 A;  1VQJ A;  1F9P A;  2SNM A;  5C0X I;  2KEN A;  4H02 A;  3G7L A;  1X54 A;  5CV4 A;  3QOJ A;  4A3F B;  2K33 A;  1XMO Q;  3ER0 A;  4KTA A;  1M1K C;  2KHJ A;  2HDM A;  5D3I B;  3GTO B;  1Y8O B;  5KYL A;  1PFM A;  4HTH A;  1HQM C;  4GNX B;  4N8X 1;  1D2B A;  4IUN A;  3GTP B;  1WTO A;  4IO9 A;  1Q1E A;  3N52 A;  4LF6 Q;  1LTI D;  1V1P B;  5JVG 3;  1X3F A;  2XGT A;  3HOZ H;  1KD1 C;  4I65 A;  2JA7 B;  3QIA A;  3S1R H;  3D31 A;  4XT1 B;  1VQP A;  1JWM D;  4AH6 A;  4RAU C;  2OT2 A;  2F3W A;  4ULL A;  2D0O A;  3HG9 A;  4ZKC B;  2C9O A;  1MSH A;  2OWO A;  4PV1 C;  1GKH A;  2IJ0 A;  2LS0 1;  3CF5 A;  2XRS D;  3KLR A;  4KY7 A;  1FGU A;  2M9V A;  5LMU Q;  1TT2 A;  2AUK A;  5IGB A;  3ULJ A;  3SXH A;  2RQX A;  2BH2 A;  1OO9 B;  4TQU S;  1CZG A;  4A3J B;  2NYZ D;  1YVC A;  3IAY A;  3VYU A;  4JI7 L;  3N6R A;  4DR1 L;  1Y1V B;  2B3G A;  2JA5 G;  2A6H C;  2A68 D;  5EAY A;  4RGO S;  1S4Z A;  3I91 A;  2R92 G;  3H0G H;  3X3M A;  2FMM A;  2D5D A;  4GOP B;  4A75 A;  1EFI D;  4HIO A;  5C0X H;  1TU2 B;  2JEB I;  1SFO B;  3I4N H;  3A55 A;  1VQA A;  1Y1W B;  4ID6 A;  4JV5 Q;  4OIJ A;  4P71 A;  1E1T A;  1ROD A;  4FVM A;  1LLR D;  5JJI A;  1XMQ L;  3RZO B;  3J80 c;  2PMZ E;  3T4A C;  2HIV A;  4DAP A;  4UP8 A;  3J7Y W;  1C4Q A;  4FO2 A;  1MKH A;  5ELO A;  1MIU A;  4KI0 A;  5I6W A;  1HA5 A;  4H13 C;  5LMN L;  3RMH A;  2MO1 A;  1IYJ B;  5KRU A;  3A8K E;  1CKO A;  4KK7 A;  1BBX C;  4LMQ D;  1CA6 A;  2BH8 A;  3PQI A;  2K4K A;  5IT9 c;  3F2D A;  3I4M G;  2UUC Q;  2MJ8 A;  2VS1 A;  4IPG A;  5E4W C;  4K5V A;  3GTQ H;  4OO1 G;  4L5S A;  2R93 H;  2EVB A;  4C3J G;  4DV0 Q;  1LUZ A;  2CQA A;  1WTQ A;  4XIG S;  3AQQ A;  4BBR G;  1IXR A;  2OQ0 A;  2ZJQ A;  4AQY L;  1LTG D;  3OWE B;  2I0Q A;  1KIX A;  1B44 D;  4RCN A;  1PH8 A;  2ZTC A;  3FDT A;  4LF4 L;  3CCJ A;  2NB0 A;  4G4K A;  1C0A A;  3J81 E;  3TP5 A;  1HXY D;  3MWY W;  1PZJ D;  1QVF A;  4XTC S;  3CXC A;  1ENA A;  1EYG A;  2F3I A;  1L0Y B;  1NBW A;  2C5C A;  4JI8 L;  1TXY A;  1EEI D;  1O7Y A;  3EIV A;  3PO2 H;  4DFA A;  5FLX c;  4IQZ A;  1STE A;  4B3M L;  4R4I A;  1S5B D;  2JEA I;  1N32 L;  1LTB D;  2L0C A;  5FO7 B;  5A2Q E;  1JJ2 A;  3FVQ A;  3BYT B;  1TWG H;  4OX9 Q;  1T5X D;  3PV0 A;  2A68 C;  2EY5 A;  1EIH A;  4LAA A;  4A3L H;  1JOQ A;  2L11 A;  1UEA B;  1BOS A;  2Y0S G;  4PZ7 A;  1I3Q H;  1IYU A;  5ELE A;  5ELB A;  4PG3 A;  1BQQ T;  1F77 A;  3M4O B;  3OIP A;  5CV6 A;  1UAP A;  5C4Z A;  1HNZ Q;  2VUM B;  5T1G A;  5M3F G;  4K5X A;  2A74 C;  4BWG B;  4IN3 A;  3J80 L;  2PI2 A;  5GRO A;  1BF4 A;  3K0X A;  4A3G B;  3H3V C;  2F0J A;  1SYB A;  2R7D A;  3VA7 A;  4X66 Q;  3A5Z B;  4ZK9 B;  3MEF A;  4ZUJ A;  2OTJ A;  1J5E L;  4I7Z C;  1SSO A;  1ESF A;  4GN4 B;  2RCN A;  1HZ9 A;  2VB2 X;  4MIU A;  3NEN A;  3DMU A;  1JE5 A;  3HFZ B;  2F03 A;  3HKZ E;  1X3G A;  2N55 A;  4QMG A;  1VQC A;  2JE6 I;  5IT9 L;  4NP5 A;  3R2I A;  2QW7 A;  2IWH A;  1DON A;  2EYJ A;  4XXE A;  2ZTE A;  3RUZ A;  3I4N B;  4LF8 Q;  4P72 A;  3GTK B;  5HY6 A;  1EY5 A;  3OPO A;  1KDA A;  2XWJ B;  4AYB G;  3RZD H;  1PFS A;  2O5I C;  2NUC A;  4C3H H;  1OXX K;  3ERO A;  3LGJ A;  5EPJ A;  2KCT A;  4DUY L;  3VDY A;  4DV3 Q;  1H9S A;  4A3D G;  5KNC A;  3BZC A;  3O13 A;  1G2S A;  5GQO A;  1WJJ A;  5COY A;  3AFQ A;  4DN4 M;  1QNK A;  1EIG A;  1ENF A;  4DU9 A;  4KHZ A;  3D4D A;  4PQX A;  2R7Z H;  3S15 H;  4DV3 L;  4KN4 C;  2KJX A;  2OQK A;  3E6Z X;  4GN3 B;  3HOW H;  4HJ5 A;  4YCV A;  5EBC A;  2HIX A;  2UU9 L;  4GLX A;  4BXX G;  4DNI A;  2CVR A;  1D5M C;  3PCO B;  3PUX A;  3SDZ A;  1BBU A;  3JAM L;  2B63 H;  4DV7 Q;  4PZ6 A;  3CQZ H;  4JW0 A;  2RF4 A;  1HNX Q;  4LF7 Q;  4A93 B;  3CCS A;  1JR0 D;  2NWG A;  5FJ8 H;  2VY3 A;  2NBF A;  3S2D H;  4KKS A;  3DLL A;  2UXB Q;  2IL8 A;  4JCV E;  4Z9C B;  2PI2 E;  1JWS D;  4DV7 L;  1FR3 A;  3J7A 5;  1HCZ A;  3M3Y B;  1STY A;  4PMC A;  3STB C;  4C2M H;  2HD3 A;  1CUK A;  1IBM L;  1TQO A;  2HDL A;  4DR4 L;  1EIY B;  4YWK A;  3CCV A;  2JYO A;  3J80 i;  3CPW A;  2KHI A;  1M90 C;  5JPM C;  1E3P A;  5CV9 A;  3TZU A;  3SVM A;  3KYH C;  3TP8 A;  2YTY A;  3H0G G;  4DUZ L;  2F4V L;  4LUV A;  2NZ1 D;  5J1Z A;  2ZXP A;  5CBA E;  4WJ3 M;  3HOU H;  1Q8K A;  2B2U A;  1JOO A;  1HUN A;  3ND9 A;  2F4I A;  1I3Q B;  1TY0 A;  4HID A;  2MFI A;  3GTM B;  1EY9 A;  3D8G A;  4C3I B;  2HHH Q;  4FDB A;  1B7Y B;  1BCP D;  3OHX C;  4O0A A;  4UY8 C;  3NBH A;  3PO3 H;  1GUT A;  2EE1 A;  5HUR A;  3OTO Q;  1U4M A;  4RGN A;  3S1M B;  2IW3 A;  4NB3 A;  2XSC A;  1YNJ D;  5D14 A;  4ODG A;  1VQL A;  4LUZ A;  1Q8I A;  1VQH A;  4BY7 G;  1QG7 A;  1H9R A;  2B2W A;  1NJI C;  3NTH A;  1H9S B;  2ATW A;  1Q1B A;  1BBW A;  1EWI A;  3I73 A;  3QR8 A;  1RHP A;  2JXM B;  2OTL A;  2BCO A;  3KLS X;  2QF7 A;  1JQY D;  4IUP A;  2R93 G;  3P20 A;  5FLX E;  4P74 A;  4NXM L;  1A3V A;  1IKM A;  3IL8 A;  3LWE A;  1CM9 A;  1KRT A;  5IWA Q;  1A6X A;  4JOI C;  4Y7N B;  3K8A A;  4OO1 I;  4WFN 3;  1I4H A;  3NTK A;  3BG3 A;  5C4X H;  3NEL A;  1F9R A;  2KVM A;  2B2V C;  4QQB X;  4KMU C;  3UE1 A;  2JQO A;  3NHH A;  4MZ9 A;  1XPU A;  1YBY A;  3JAM i;  4GKK Q;  1U4P A;  5KIX A;  5M5Y H;  2XIW A;  2R6G A;  3K81 C;  4LFB Q;  5JEA J;  2D0P A;  3KOJ A;  4QY7 A;  1SE2 A;  2Z9H A;  3Q23 A;  1E24 A;  2R92 H;  3A0J A;  3TP7 A;  1Q86 C;  1LM0 A;  4GKK L;  2K32 A;  4WRD A;  3PO2 G;  1L0X B;  1BR9 A;  1SJH D;  1ZEQ X;  1R9T B;  3DEO A;  3NE5 B;  3MEH A;  1SYE A;  4DPG A;  2GVA A;  5FK9 C;  1WVL A;  1TWH B;  4B3S L;  4RMF A;  4HMI A;  3OWF A;  1QB5 D;  1OXS C;  1PTO D;  3A7L A;  4A3L G;  3RNU A;  4F88 A;  1S5D D;  4YHH Q;  2KCN A;  5E1F A;  3DXJ C;  1G6Z A;  3TEH B;  2SDF A;  4H0L C;  3M7N A;  4L5Q A;  1AE3 A;  3GTG B;  4L5R C;  1NUC A;  3EBE A;  1QE6 A;  1F9Q A;  2RHQ B;  4OWT B;  3URY A;  3CPF A;  2RSN A;  2AWN A;  4ME3 A;  1BXT A;  2FFK B;  3HP3 A;  3NBI A;  4KKT A;  4NKL A;  5C6A A;  1PV4 A;  3CME A;  2TMP A;  4KV6 A;  4YY3 Q;  1PH3 A;  4HSP A;  3Q0A A;  1MI2 A;  3I4M H;  1EU4 A;  5BR8 Q;  1F2Y A;  2SEB D;  2GN5 A;  1VQD A;  4OEM B;  2UUA L;  3NBH B;  4Y52 H;  1FNU A;  3EN2 A;  3FKI H;  1MSG A;  2B2T A;  4OO1 H;  3MC0 B;  2F0I A;  4KD3 A;  3K58 A;  1JOR A;  1E0B A;  3KBX A;  3KJO A;  4BBR H;  2AHO B;  3T1Y L;  4HJA A;  5IYD H;  2E5L Q;  4IFD J;  2AQ1 B;  4PZ8 A;  1ML0 D;  4DV4 Q;  3W3A A;  5IGF A;  1G51 A;  1QNU A;  3M4Q A;  4C3H G;  4ABN A;  1N9W A;  1J6Q A;  1P16 A;  5LHY 1;  5M9O A;  3S1Q B;  2CH4 A;  1BKB A;  1M4V A;  2F0N A;  2ID0 A;  3S17 H;  3F8T A;  2F0S A;  1EU3 A;  2WB1 E;  3NQI A;  4X3T A;  3WOF A;  5I9O A;  2MQH A;  4GOP C;  2E2D C;  2WAQ E;  2R7Z G;  1D5Z C;  1HR0 W;  3S9W A;  4DAM A;  3G6J B;  1TWF B;  2DGY A;  2QDB A;  4FXD A;  1JJG A;  3HOW G;  2A73 B;  3UDG A;  2F0D A;  4ZKB B;  3C2P A;  2YU9 B;  1VQO A;  4X6A H;  2WP8 J;  3PIP A;  5LL6 X;  4PNY A;  1QZH A;  2B63 G;  2K5W A;  2KEE A;  1IKL A;  4KHP Q;  1Z47 A;  3U9S A;  5JEA H;  4KN7 C;  1IW7 D;  1PH2 A;  5FJ8 G;  2NVQ B;  1ASZ A;  4GKJ Q;  4UPA A;  5AJ3 L;  4DR6 Q;  3R8B A;  5M5Y B;  5JJL A;  3A5U A;  2E2J H;  4OON A;  3D3R A;  2R61 A;  3FP9 A;  4DV6 L;  4POG A;  2JA5 B;  4O42 A;  4DNR B;  1BCP F;  3IFT A;  3T1H L;  4S3S A;  2TSS A;  3MXG A;  2JA8 H;  2KCC A;  1LTR D;  2SOB A;  5KNB A;  1XNR L;  3RLN A;  4NXN L;  2MO0 A;  2N88 A;  3KLS A;  4C56 C;  4K6D A;  4Q5V A;  4HJ7 A;  3BYY B;  2UUB Q;  3I8Z A;  4LFA Q;  1EOT A; 
#chains in the Genus database with same CATH homology
 1R9T H;  4OO1 G;  4GLA C;  1YJW A;  1N36 Q;  2ES2 A;  3CCQ A;  3UDF A;  1YNX A;  4DV0 Q;  1LUZ A;  4L5S A;  1AH9 A;  1K8A C;  1RL2 A;  3W5O A;  1PYB A;  5HGQ A;  1CSP A;  1YZ6 A;  1E7Z A;  1TWH H;  4P73 A;  4XIG S;  3HOZ G;  1PYS B;  3AQQ A;  4IPH A;  1HR0 Q;  3HOV H;  4BBR G;  1IXR A;  2OQ0 A;  5C44 H;  1HNW L;  4YHH L;  2ZJQ A;  4AQY L;  2JA6 H;  2YTV A;  5C3E G;  2Q2T A;  3S2H H;  4JI0 Q;  2I0Q A;  1N36 L;  1KIX A;  3RLF A;  2FXQ A;  4DV5 L;  3PO3 G;  2VQE Q;  1XPO A;  2C35 B;  2YTX A;  3L7Z C;  4JG2 A;  3A74 A;  4R4T A;  1IBM Q;  1PH8 A;  2ZTC A;  1KQS A;  3CCJ A;  4LF4 L;  1C0A A;  3G71 A;  4DR4 Q;  4B3T L;  3GTG H;  2VUM G;  1KRS A;  2N3S A;  4X64 Q;  1WCM H;  2PQA A;  1QVF A;  4XTC S;  3CXC A;  1EYG A;  4JBM A;  3U4V A;  2Z0S A;  2JK8 A;  3L0O A;  1XMO L;  4A3F H;  1NY4 A;  1NBW A;  2F3I A;  2K5N A;  4JI8 L;  1TXY A;  2H5X A;  3G6E A;  1XJV A;  1SE8 A;  1YJ9 A;  3EIV A;  5FLM H;  2K52 A;  4KLK A;  1UWV A;  4YCW A;  4DUZ Q;  1TWA H;  2F4V Q;  4JI5 Q;  3GTO H;  3PO2 H;  2LXK A;  4IJH A;  4YY3 L;  5FLX c;  1JB7 A;  4APV A;  4B3M L;  4R4I A;  3GTJ H;  1VQ4 A;  4LFC Q;  5BR8 L;  2JEA I;  1N32 L;  2ZM6 L;  1JJ2 A;  1XNQ Q;  1HZC A;  1TWG H;  2JJQ A;  4OX9 Q;  1CKN A;  3U58 A;  3PV0 A;  4JC0 A;  1PH6 A;  1KHI A;  5IP9 G;  3GTP H;  4LF6 L;  4HIM A;  4A3L H;  2IHE A;  1KL9 A;  4DV1 Q;  4JYA Q;  2E2H H;  3HOX H;  3HOY G;  1W3S A;  1WOC A;  4JBK A;  2Y0S G;  4PZ7 A;  1I3Q H;  1KAW A;  1VQG A;  5ELN A;  3RN5 A;  3E9H A;  4JBW A;  4LW1 A;  4PG3 A;  5C0X G;  1JT8 A;  3TRZ A;  1BVS A;  3PGZ A;  1Q7Y C;  4QGU A;  2JA7 H;  2E5L L;  3I7F A;  1DGS A;  3NEM A;  1S72 A;  3H15 A;  1HNZ Q;  5C4X G;  1SMX A;  2Q2U A;  3I4N G;  5M3F G;  3WWV A;  1S40 A;  2I5L X;  4DV4 L;  2N8N A;  2PI2 A;  1V9P A;  5GRO A;  1E22 A;  1S3O A;  5GAD C;  3I56 A;  4DV2 Q;  4HIK A;  2D62 A;  3K0X A;  1FJG Q;  4IOC A;  2EXD A;  2R7D A;  5LMU L;  3S1Q H;  3G4S A;  4X66 Q;  3A5Z B;  1AE2 A;  3MEF A;  1NTG A;  1NMF A;  1J5E L;  2WFW A;  2OTJ A;  3AFP A;  2Q2I A;  4GN4 B;  2RCN A;  1WYD A;  1HZ9 A;  2VZA A;  1PA6 A;  3NEN A;  1Z9F A;  3TS0 A;  1JE5 A;  3HFZ B;  3OW2 A;  4LF5 L;  3HKZ E;  1X3G A;  5GAG C;  4X62 Q;  1FJG L;  3PUW A;  4A3J H;  3E0E A;  4OWX B;  1VQC A;  4DR5 Q;  1VQ9 A;  2JE6 I;  1P8L A;  4NXM Q;  3BJU A;  1Y1V H;  3FHW A;  1FVI A;  2PNH A;  4GS3 A;  4RG1 A;  1TWF H;  5M5X H;  2A19 A;  3K80 C;  1D8L A;  4HJ8 A;  4IFD I;  3PUV A;  1X65 A;  2R93 H;  1NE3 A;  2ZTE A;  2ASB A;  3M4P A;  1PH9 A;  3ICE A;  4LF8 Q;  1A0I A;  3KF8 B;  4P72 A;  5HY6 A;  2VQF Q;  1W2B A;  3GTL H;  2I5M X;  1GM5 A;  1K83 H;  5IP7 G;  2YU9 H;  4AYB G;  3RZD H;  2BA0 A;  1PFS A;  1Q82 C;  1K0R A;  4C3H H;  1OXX K;  3LGJ A;  1YIJ A;  1SFO H;  2KCT A;  4KHP L;  1V1Q A;  4DUY L;  2AWO A;  3VDY A;  1HJP A;  4DV3 Q;  2HT1 A;  3SGI A;  4JV5 L;  1Y1W H;  4A3D G;  1I5F A;  3J81 c;  2A1A A;  3BZC A;  1I94 L;  1IBK L;  4A3C H;  5GQO A;  1WJJ A;  4A93 G;  3Q8D A;  2JA6 G;  1A63 A;  4BY7 H;  3AFQ A;  1JJC B;  3RZO H;  1JMC A;  4GKJ L;  5C0X J;  1YHA A;  2NVQ H;  1B70 B;  1H95 A;  4O2D A;  4DR6 L;  3RLO A;  3CCR A;  1VQK A;  4KHZ A;  1PHJ A;  2R7Z H;  3S15 H;  4DV3 L;  1RIP A;  1XPR A;  1PH4 A;  3GD7 A;  4K0K Q;  5IP7 H;  2JA5 H;  1EQR A;  4EX5 A;  2OQK A;  4ALP A;  3CCE A;  4GN3 B;  3PF5 A;  3HOW H;  1E1O A;  4B3S Q;  4R1J A;  4HJ5 A;  4YCV A;  3CCM A;  2IT1 A;  2YV5 A;  3FKI G;  2HIX A;  2UU9 L;  4GLX A;  5FLM G;  4BXX G;  2IHF A;  4DNI A;  1WI5 A;  1C9O A;  3PCO B;  5DLQ E;  4JOI A;  4A3E H;  4DR7 Q;  3PUX A;  2BA1 A;  3E9I A;  2PQA B;  2UUC L;  2R7F A;  4JI6 Q;  2B29 A;  1BBU A;  1YHQ A;  5IYD G;  2B63 H;  1I6H H;  1N8R C;  3S24 A;  4DV7 Q;  4PZ6 A;  3I55 A;  2UUB L;  4LFA L;  3CQZ H;  3J81 j;  2UXD Q;  5JJK A;  1U0L A;  4DV0 L;  2RF4 A;  1HNX Q;  2IX0 A;  4LF7 Q;  3CCS A;  5IYC H;  2CFM A;  1X56 A;  1PH1 A;  2KCM A;  1LYL A;  4GLV B;  2VY3 A;  5FJ8 H;  4WJ4 A;  4DR7 L;  1Y14 B;  4BY1 H;  2E8G A;  3S2D H;  3DLL A;  1ASY A;  1HR0 L;  1C7Y A;  1CKN B;  2UXB Q;  4JCV E;  2NZO A;  4GN5 A;  1A62 A;  2PI2 E;  4DV7 L;  1VQN A;  2N78 A;  3J7A 5;  4JI0 L;  1OXU A;  1VQE A;  1VQ8 A;  3STB C;  2VQE L;  4GNX C;  4C2M H;  3CCL A;  4J15 A;  1CUK A;  1I50 H;  1VQM A;  1IBM L;  2UUA Q;  1SLJ A;  2NZH A;  2Z6K A;  4DR4 L;  1EIY B;  4YWK A;  3CCV A;  1IZ6 A;  4P75 A;  4X64 L;  2CCZ A;  3J80 i;  3CPW A;  4A3M H;  2KHI A;  3CCU A;  2VNU D;  4X65 Q;  3CD6 A;  2NN6 G;  4JI1 Q;  4UP9 A;  3KF6 A;  1M90 C;  2K14 A;  1E3P A;  3JC6 6;  4BBS H;  3ZJY C;  3PUZ A;  5M3M G;  4QJF A;  3JAM c;  1N34 Q;  3KYH C;  4BA2 I;  1VCI A;  2YTY A;  1X6O A;  3H0G G;  3PIO A;  4DUZ L;  3T1Y Q;  2F4V L;  4LUV A;  4R4O A;  1GD7 A;  4JI5 L;  1K8G A;  5LMN W;  3CC7 A;  3RR5 A;  4YCU A;  1Q81 C;  1MJE A;  4LFC L;  4A3J G;  3HOU H;  1Q8K A;  4WJ3 M;  4C3J H;  4R4Q A;  5E7N A;  1XNQ L;  4OX9 L;  3I2Z A;  2VL6 A;  4JI1 L;  4OWW B;  1QUQ A;  3KLW A;  4HID A;  4MTN A;  3I4O A;  2MFI A;  1EQQ A;  4IJL A;  4DV1 L;  4GNX A;  4JYA L;  4YWM A;  1NMG A;  1VQB A;  1UE5 A;  2LXJ A;  2EQS A;  5JEA G;  2HHH Q;  4A3B H;  3CW2 C;  4FDB A;  2AKW B;  1V43 A;  1B7Y B;  4O0A A;  4UY8 C;  2Y0S E;  5M5W H;  3PO3 H;  2WB1 G;  3F2C A;  3PSI A;  3M85 A;  3M4O H;  2Q2H A;  3OTO Q;  1SR3 A;  1HNZ L;  3W1G A;  2WAQ G;  3TS2 A;  1L2F A;  1U5K A;  4NB3 A;  3U4Z A;  1IBL Q;  2VUM H;  3UDI A;  4JI7 Q;  1Y1W G;  1YJN A;  4DK6 C;  4DR1 Q;  1OTC A;  4DV2 L;  1VQL A;  4A76 A;  1GVP A;  2XTI A;  4LUZ A;  3KJP A;  3S1N H;  1YHB A;  1VQH A;  4BY7 G;  4A3G H;  4BXX H;  3DM3 A;  4B3R Q;  3ULP A;  4X66 L;  2MNA A;  4OXP A;  2K5V A;  1NJI C;  4LF9 Q;  2JA8 G;  3ULL A;  1IBL L;  2I5H A;  2ATW A;  1Q1B A;  1BBW A;  1EWI A;  3M9B A;  4YWL A;  2QA4 A;  2OTL A;  4JI3 Q;  3RN2 A;  4X62 L;  3CAM A;  4DR5 L;  4DR3 Q;  3S14 H;  2R93 G;  4P74 A;  4AIM A;  4NXM L;  3ERS X;  2UXC Q;  2V1C C;  2K75 A;  4QIW E;  5H1S E;  1KRT A;  1VQ6 A;  5IWA Q;  1XMQ Q;  1SRU A;  4JOI C;  3TQY A;  1UE7 A;  3K8A A;  4A3B G;  4OO1 I;  1SRO A;  2GVB A;  5AJ3 Q;  4LF8 L;  5C44 G;  3HOV G;  4A4I A;  2ALY B;  5C4X H;  2VQF L;  3NEL A;  5M3F H;  1L1O C;  3GTK H;  4BA1 I;  3KDF A;  2EIF A;  4R4C A;  1YIT A;  4QQB X;  4DV6 Q;  3UE1 A;  2JQO A;  1XPU A;  4MZ9 A;  1YBY A;  4AYB E;  3JAM i;  1X9N A;  4GKK Q;  2CWP A;  3J7Z C;  1N33 Q;  5LMN Q;  4GOP A;  3PUY A;  5M5Y H;  4EQ5 A;  1TWC H;  2R6G A;  3K81 C;  4LFB Q;  5JEA J;  2D0P A;  3KOJ A;  2QEX A;  1WCM G;  3T1H Q;  2IX1 A;  3CC4 A;  1OXT A;  4QY7 A;  3IRB A;  1FL0 A;  1XNR Q;  1PH7 A;  1QVG A;  2KBN A;  2AMC B;  5IE8 A;  1E24 A;  4A3F G;  3A0J A;  4NXN Q;  4A3K H;  2R92 H;  3S16 H;  1Q86 C;  1LM0 A;  4DK3 C;  4GKK L;  1D7Q A;  4JBJ A;  3KFU A;  4JI4 Q;  3PO2 G;  4HJ9 A;  1N33 L;  2OCE A;  2Z6K C;  4IFD G;  1SN8 A;  3BZK A;  3W1B A;  4DPG A;  1KXL A;  2GVA A;  4K0K L;  1EOV A;  2CWA A;  5C4J H;  3PF4 A;  1O7I A;  2CQO A;  1IL2 A;  1WFQ A;  4B3S L;  1L1O A;  4RMF A;  2ZJR A;  1OXS C;  4A3L G;  1YEZ A;  3RNU A;  1EUJ A;  2ZTD A;  2YYZ A;  1KC8 C;  1HNW Q;  3HOX G;  3CP0 A;  4YHH Q;  4A3I H;  4AQY Q;  2IY5 B;  3D0F A;  3HOU G;  2NVX H;  4IPC A;  3TEH B;  3K7U C;  3H3V I;  4JI6 L;  4DV5 Q;  3M7N A;  4L5T A;  1XTD A;  4L5Q A;  2JA7 G;  1AE3 A;  1X55 A;  3KF6 B;  1G29 1;  5IYB H;  4LF4 Q;  2N49 A;  4A3G G;  2UXD L;  4L5R C;  4B3T Q;  4A3D H;  3G48 A;  3EBE A;  4TVA B;  3CC2 A;  2RHQ B;  1HNX L;  1VQJ A;  4OWT B;  4LF7 L;  3CPF A;  5C0X I;  2AWN A;  1MJC A;  2JA9 A;  2KEN A;  1X54 A;  4H02 A;  4ME3 A;  3UE0 A;  4POF A;  4A93 H;  1XMO Q;  3ER0 A;  1K73 C;  1M1K C;  3AYH B;  2KHJ A;  2K5H A;  4PMW A;  4JI8 Q;  1VQF A;  2UXB L;  3OYY A;  2K50 A;  1PV4 A;  3CME A;  1QUQ B;  1PH3 A;  4YY3 Q;  1VQ7 A;  1A8V A;  4B3M Q;  4GNX B;  1L0W A;  3I4M H;  1N32 Q;  5BR8 Q;  1CKM A;  2ZM6 Q;  3U50 C;  3M3Y H;  4DKA C;  2GN5 A;  1VQD A;  2UUA L;  1PH5 A;  3J81 i;  3NBH B;  4Y52 H;  4IO9 A;  1Q1E A;  3K7A H;  3EN2 A;  3FKI H;  4UP7 A;  4LF6 Q;  4IOA A;  1HH2 P;  4X65 L;  1K3R A;  1Y1V G;  1X3F A;  2XGT A;  3HOZ H;  2VW9 A;  1KD1 C;  2E2I H;  1N34 L;  1HZB A;  4LUO A;  3KJO A;  4BBR H;  1B8A A;  2AHO B;  3T1Y L;  3GDE A;  1Q46 A;  3S1R H;  4LWC A;  1T9H A;  5GAE C;  3D31 A;  4HJA A;  2E5L Q;  4IFD J;  5IYD H;  5C3E H;  1VQP A;  4AH6 A;  4NPS A;  4PZ8 A;  4DV4 Q;  1G51 A;  1UEB A;  2D0O A;  1EIF A;  3M4Q A;  1N9W A;  1J6Q A;  1P16 A;  1LTL A;  2OWO A;  1GKH A;  1GO3 E;  3CF5 A;  1CSQ A;  1BKB A;  2QGQ A;  3GTM H;  1FGU A;  2ID0 A;  3S17 H;  2HHH L;  5LMU Q;  3CMA A;  4C3I H;  4A3C G;  2NVT H;  1Q12 A;  2F52 A;  1J5E Q;  3F8T A;  3STB D;  1G6P A;  3ULJ A;  2WB1 E;  3HKZ G;  4LF5 Q;  3OTO L;  2BH2 A;  4TQU S;  2MQH A;  2A8V A;  1YVC A;  4GOP C;  2WAQ E;  4DR2 Q;  2R7Z G;  3S1M H;  4JI7 L;  2HQL A;  3GO5 A;  3UDX A;  1HR0 W;  4DR1 L;  3F2B A;  2B3G A;  4DAM A;  2JA5 G;  5EAY A;  2DGY A;  3HKS A;  3KDF B;  1JJG A;  2NVY H;  5IP9 H;  2LSS A;  3HOW G;  3H3V H;  5M3M H;  2R92 G;  3H0G H;  4A3K G;  3UDG A;  1K9M C;  3AEV A;  3HOY H;  4LNQ A;  4B3R L;  4LF9 L;  5J3B A;  4GOP B;  4A75 A;  1VQO A;  2RHS B;  4DR2 L;  4X6A H;  4A3E G;  2WP8 J;  3PIP A;  4HIO A;  5K36 G;  2JEB I;  1QVC A;  2ZJP A;  2CKZ B;  1VS0 A;  3BU2 A;  4QL5 A;  4JI3 L;  1QZH A;  3I4N H;  5IY0 A;  2B63 G;  1QZG A;  1VQA A;  4DUY Q;  4KHP Q;  1Z47 A;  5GAH C;  4DR3 L;  4JV5 Q;  4IPD A;  4P71 A;  1I94 Q;  1E1T A;  1IBK Q;  4DAY B;  2UXC L;  1PH2 A;  5IYC G;  4A3I G;  5IWA L;  1XMQ L;  5JJI A;  3J80 c;  5FJ8 G;  1ASZ A;  2PMZ E;  4JI2 Q;  4BY1 G;  4GKJ Q;  2HIV A;  1VQ5 A;  4MNO A;  2L15 A;  4Y7N H;  1UE6 A;  4UPA A;  4UP8 A;  5AJ3 L;  1EFW A;  4DR6 Q;  1L1O B;  5JJL A;  1MKH A;  5IYB G;  5ELO A;  3MXN B;  3A5U A;  3L2P A;  1MIU A;  3B6Y A;  4KI0 A;  2E2J H;  4OON A;  4DV6 L;  3FP9 A;  4POG A;  3TRE A;  1OXV A;  5LMN L;  2MO1 A;  3F1Z A;  1IYJ B;  4JI2 L;  4LFB L;  1CKO A;  1VQI A;  2UU9 Q;  4A3M G;  3T1H L;  2JA8 H;  2DUD A;  1HZA A;  2BH8 A;  2K4K A;  5IT9 c;  3F2D A;  1XNR L;  3RLN A;  3I4M G;  4NXN L;  4BBS G;  2UUC Q;  2VS1 A;  1YI2 A;  1X3E A;  2MO0 A;  4JI4 L;  1UE1 A;  4IPG A;  4HJ7 A;  2UUB Q;  1PVO A;  3GTQ H;  2NN6 I;  4LFA Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...