1VQGA

Gene v protein mutant with ile 47 replaced by leu 47 (i47l)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKLTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potential use of additivity of mutational effects in simplifying protein engineering.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqgA00
1TWCH 4A3IH 2I0QA 3FKIH 4B3TL 4POGA 4MNOA 4DR3Q 1Q81C 5JJIA 1KC8C 4MZ9A 2R93G 4X65L 3PIPA 1M90C 2QA4A 2D62A 2NZHA 4DUZQ 4GN5A 2JA5H 4PZ6A 1N32Q 1MKHA 3JAMi 5GAGC 1YVCA 3HOZG 5E7NA 3G6EA 4DR5Q 3H3VI 1QVFA 2Q2IA 2CCZA 5FLXc 1HNZQ 1TWGH 1Q1BA 2ASBA 2ZJPA 1EIFA 4YHHQ 1K8AC 4JBJA 1GKHA 5IYBG 3CCSA 4HIMA 1XNRL 5M3FH 2WB1E 2VNUD 2V1CC 5FJ8G 4R4TA 1HNWQ 5M5WH 5FLMG 5IWAL 3ZJYC 3W1BA 3WWVA 1S40A 4LF5L 2CKZB 4JI3L 1IBMQ 1IL2A 3SGIA 1N34L 1PHJA 4DK6C 4DV3Q 1UEBA 1D8LA 4X62L 1HR0Q 3HKSA 2JEBI 5IP9G 2K52A 3CCMA 2PQAA 3CMEA 3KYHC 4JG2A 2LXJA 2IT1A 2MO1A 1HH2P 1VQKA 3GTGH 4R4QA 4DR6Q 3FKIG 2IY5B 4O2DA 1IBLQ 2YTVA 4KHZA 1CSQA 1KAWA 1SR3A 1E1TA 1B7YB 4WJ4A 4YCUA 1VQFA 5GROA 1EIYB 4JI0L 1UE6A 1RL2A 2IHEA 2ZM6Q 4DK3C 3UE0A 4NXML 4A3GG 2NVYH 5C4XH 2E5LQ 4JI5L 4LF6Q 4GKKQ 4DR3L 3I4MH 1IYJB 3J80c 1BBWA 3CCUA 2ZTCA 3F2DA 2RHSB 4A3DH 4LFBQ 5JJKA 3A5ZB 3AQQA 4A75A 2XGTA 4JI4L 4AYBE 5C44H 3GTPH 2HHHQ 2C35B 2JA5G 4IPCA 3IRBA 1VQHA 1WI5A 3I7FA 3BU2A 1VQIA 4P72A 4KHPQ 5IYCG 2DUDA 2OQ0A 3K7UC 2Y0SE 1X6OA 4B3RL 2UXBL 2K50A 4JI6Q 2WAQE 1NY4A 2JA7G 1GM5A 3PSIA 1NBWA 2VUMG 3HOUH 2AHOB 2CWPA 3HOWG 2E8GA 1UE5A 2HIXA 2WB1G 4LUZA 1HNXL 4GN4B 3HOXG 2UUAQ 4JBKA 3G71A 1X55A 4LF7Q 3S1QH 3UDIA 5BR8Q 3U4ZA 1TWAH 3RLNA 2WAQG 3EIVA 1QVCA 4DR6L 5IYCH 1BBUA 1SN8A 2YTYA 1HNZL 4QQBX 4HJ9A 1N33Q 1I6HH 4A3EG 1O7IA 4UP9A 4IFDI 4RMFA 1X56A 2BH8A 1PH8A 1VQEA 1AH9A 1QVGA 3FHWA 1P16A 1T9HA 3KJPA 4JBWA 4XIGS 2BH2A 4DR2Q 3PUWA 3M9BA 1PVOA 4GLXA 2HHHL 1Y14B 2WFWA 4PZ7A 4DAMA 2YU9H 2JA6G 5C44G 1G291 3NELA 1BKBA 1PH9A 3CCRA 1PH6A 3H0GH 4A3IG 1WFQA 2B63H 4JC0A 2XTIA 1WOCA 1SROA 4LUOA 4DV5L 2JJQA 1VQ4A 4LF9L 3M4OH 1E24A 3B6YA 4AYBG 1J5EQ 4IFDJ 4OX9Q 3TQYA 4QY7A 3PO3H 2UXDL 3HOXH 5IY0A 2I5MX 1EOVA 3ER0A 3J81c 4BBRG 4A3KH 1EYGA 1CKNA 4GKKL 4RG1A 2E5LL 2JA6H 1X65A 1B70B 5H1SE 1VQOA 1NMGA 4L5RC 4DV5Q 1K0RA 2VL6A 3KDFA 1Z47A 5AJ3L 4JV5L 4DV0Q 5FJ8H 2Q2HA 4YWMA 2I5LX 5HY6A 2N49A 5C4JH 1XNQQ 4NPSA 1JB7A 1HZ9A 3GO5A 4DUYL 4DV3L 2DGYA 1N34Q 3ICEA 4A3FH 4DV7L 4YCVA 4A3MG 1YNXA 1N36L 1FVIA 1WCMG 3PF5A 3U58A 1YITA 1K9MC 4HIDA 1CSPA 5C0XG 1YIJA 2AMCB 2GN5A 1XNRQ 2R7FA 1JJGA 1S3OA 2K5VA 4BBSH 3S24A 4LWCA 3TEHB 4A3BG 1KRTA 3HKZE 4TQUS 5M5YH 4NXMQ 3W5OA 2Q2TA 3PV0A 1YJNA 4DR4L 4GN3B 1KHIA 2NN6G 4X64Q 1L1OB 4UP7A 1MIUA 4X6AH 3GTJH 3U4VA 4A93H 4UPAA 2EIFA 2F4VQ 2UXDQ 1CKMA 3K80C 1UWVA 5LMUL 3GTOH 2GVAA 3F1ZA 4A3DG 2D0PA 2KENA 3HOZH 2HIVA 2YTXA 3PUVA 3L2PA 1E7ZA 1NE3A 1IBLL 3PIOA 2A1AA 4DV6L 4OWXB 5C3EG 4DR7Q 4DV0L 1GVPA 3OYYA 3RLOA 2A19A 4A3GH 4GKJQ 3JC66 1G6PA 4BY7H 1EWIA 4NXNL 1G51A 1PYBA 3KLWA 3I4MG 3MEFA 2R7ZG 3S1NH 2EQSA 4P73A 1XJVA 4XTCS 2BA1A 4JI1Q 1CKOA 2E2IH 1JJCB 1Y1VH 3AYHB 1LM0A 1UE1A 1VQJA 2LSSA 1I50H 4A3EH 5ELNA 1ASZA 1HJPA 4GLAC 4R1JA 2K75A 4OWTB 2UUAL 1HNXQ 1A8VA 4L5TA 3T1HL 3CCQA 4LFCL 3Q8DA 2YV5A 1X9NA 4GNXC 1R9TH 3GD7A 3TS2A 1K8GA 4OONA 4DPGA 5LMNQ 2OWOA 1Y1VG 3J80i 2JE6I 4C3JH 3I56A 3S2HH 4BY1H 5M3MH 4LF5Q 4BXXH 3BZCA 4PZ8A 3GTMH 4A3LG 2N3SA 1AE3A 3KF6A 3PUYA 3CCLA 3HOYG 4BA1I 4NXNQ 1EUJA 3PO3G 4B3ML 2R7ZH 2FXQA 4BA2I 4DR7L 3G48A 2YYZA 4DUZL 1N32L 3EBEA 1I5FA 3ULLA 2Y0SG 3ULPA 5HGQA 4X66L 1OXUA 2MO0A 3KFUA 1K3RA 1L0WA 1LUZA 4A93G 4JI1L 2NVTH 4JI2Q 2F4VL 4MTNA 1Q46A 1E3PA 4IPDA 3H0GG 3CCEA 4IOCA 3GTLH 4BXXG 4JI5Q 4ALPA 4A3JG 3NBHB 2I5HA 4B3MQ 1JJ2A 4OX9L 1J5EL 1DGSA 3J7ZC 2VQFL 1XPUA 1OXXK 1B8AA 1VQPA 1JMCA 4B3SL 1PH3A 4DV1L 4DV6Q 2UU9L 1C0AA 2Q2UA 2B3GA 3M85A 2UXCL 5C4XG 4R4IA 3A5UA 3CPFA 3PUZA 4LW1A 4JBMA 1U5KA 4YWLA 1HR0L 1C9OA 4BY1G 5C0XJ 1XPRA 3T1HQ 5GQOA 2JA9A 3AFPA 1SMXA 1TWHH 3NENA 4LF8L 2VS1A 3MXNB 1SFOH 4KHPL 3STBC 2UUBQ 2L15A 5LMNL 3D0FA 4DR1L 1VQMA 2ES2A 3PUXA 3KJOA 3E0EA 3HOYH 2QGQA 4OO1I 5GAHC 5IYDH 1KXLA 4Y52H 3CCVA 5M3MG 2UUCQ 3OTOQ 4P75A 3E9HA 4QGUA 2E2JH 3PF4A 2JA8G 3HOVH 1EQQA 1VQ5A 3BZKA 2VUMH 4EX5A 3K8AA 4YY3L 4AQYQ 3HOWH 1HR0W 5JEAG 4DAYB 2OTLA 4OXPA 3VDYA 4A3CG 4DV7Q 4L5SA 3S16H 2PNHA 2RF4A 1S72A 5BR8L 3PO2H 1PYSB 3NEMA 1QUQA 3RN5A 4A3JH 1YZ6A 1EFWA 4B3TQ 4DV2L 1P8LA 3G4SA 2OCEA 2R6GA 4GNXA 4APVA 1Q1EA 2B29A 4R4CA 4YWKA 5IWAQ 5C0XI 1VQ9A 4DV1Q 4GKJL 2IHFA 1HNWL 4B3RQ 2UXBQ 4IO9A 3M4QA 3A74A 4IPHA 2HT1A 4DNIA 2D0OA 1A0IA 1L1OA 2ZTEA 3LGJA 5IE8A 5IP7H 4HIOA 2JA7H 4B3SQ 4JYAL 2R93H 2OTJA 3CF5A 2RCNA 2GVBA 3KDFB 3F8TA 4KI0A 1H95A 3K81C 3FP9A 4UP8A 1I94Q 4LFAQ 2EXDA 1K73C 3AEVA 2N8NA 2ZM6L 1YHQA 4LF6L 2NZOA 3OTOL 1W3SA 1N33L 3PGZA 3CMAA 1JT8A 4P74A 3HOUG 2PI2E 4AH6A 1RIPA 1N9WA 3CQZH 4X62Q 2VW9A 3L7ZC 4DR1Q 4QL5A 3JAMc 1Q7YC 2JA8H 3TS0A 4LNQA 3HOVG 3S14H 3OW2A 2K5HA 1VQNA 2A8VA 3K0XA 3PO2G 4LF4L 3I2ZA 1UE7A 1LTLA 1XMOL 3W1GA 3U50C 2Z0SA 2OQKA 1QZGA 2ZTDA 4IJLA 1V1QA 3J81j 1NMFA 3UE1A 3UDXA 3I55A 1VQAA 4PG3A 3CC7A 4JI8L 5GAEC 1OTCA 3T1YL 3E9IA 3HKZG 2RHQB 3F2CA 1XNQL 3RR5A 3TREA 4C2MH 4DV4Q 1VQLA 1PH2A 4JYAQ 2VY3A 5M5XH 4A76A 5AJ3Q 3M3YH 4JV5Q 4H02A 4A3MH 3S17H 1Q8KA 2R92G 5IP7G 1KL9A 1YJWA 1KD1C 4YCWA 4K0KL 3CAMA 5FLMH 2F3IA 3CC2A 1X3FA 4PMWA 4GOPC 1YJ9A 4OO1G 4JI7Q 3CD6A 2ATWA 1MJCA 1SRUA 4C3IH 4X66Q 4HJAA 1Q82C 2HQLA 2VQEQ 3CPWA 1FJGQ 2Z6KC 3UDFA 1VQ6A 1GD7A 1X3GA 4LFAL 3CP0A 3CW2C 4JI2L 4GOPB 1YI2A 4X64L 1ASYA 4JI6L 4X65Q 1FGUA 3M7NA 1HZBA 2VZAA 4LF7L 1KQSA 2NVQH 1V43A 4OWWB 3EN2A 1M1KC 1X3EA 1AE2A 2KBNA 2LXKA 2ID0A 4WJ3M 1TWFH 3K7AH 3GTQH 4HIKA 1PFSA 3CCJA 4IOAA 2KCMA 5LMUQ 1Q86C 2JEAI 2Z6KA 3CC4A 1VQDA 1N36Q 2B63G 3DLLA 1OXTA 1PA6A 4LF9Q 2IX1A 2CWAA 3KF8B 3T1YQ 4UY8C 1XTDA 3I4OA 4GOPA 4GLVB 1YBYA 5EAYA 5GADC 4NB3A 1KIXA 1HZAA 5C3EH 5IT9c 5IYDG 4BBSG 3UDGA 1QUQB 4DR2L 2K4KA 3J81i 4QJFA 4IPGA 2KHJA 1XPOA 1U0LA 4QIWE 3RLFA 1PV4A 2E2HH 4JI7L 1E1OA 4TVAB 1WJJA 4L5QA 3F2BA 2PQAB 3TRZA 3S1MH 1YEZA 4K0KQ 1LYLA 5IYBH 4FDBA 3KF6B 2ZJQA 3DM3A 4Y7NH 2N78A 3ULJA 1K83H 1XMOQ 2H5XA 3CXCA 4ME3A 2AWNA 1VS0A 4POFA 1W2BA 1IXRA 1E22A 1Q12A 1JE5A 1OXVA 2MFIA 2R7DA 4HJ5A 5JJLA 1HZCA 4JI8Q 4A3KG 1NTGA 4DUYQ 2NVXH 4C3HH 2MNAA 1L2FA 1WCMH 4JOIC 1PH7A 5K36G 4IJHA 1XMQQ 4JI4Q 4LFBL 2KHIA 3KOJA 1IBKL 2ALYB 3GDEA 4A4IA 3RZOH 4A3LH 1PH5A 1I94L 3STBD 1EQRA 4O0AA 2JQOA 4DV2Q 3S1RH 3RNUA 1TXYA 1BVSA 3M4PA 1OXSC 2VQEL 1FJGL 1SLJA 4DR4Q 4JI0Q 3I4NG 2CFMA 4LUVA 4A3FG 4AIMA 2K14A 2AWOA 3GTKH 1KRSA 1VQCA 1MJEA 1IBKQ 4LF8Q 1XMQL 1A63A 1X54A 3D31A 4LFCQ 2F52A 2KCTA 2IX0A 1WYDA 1V9PA 4JOIA 2CQOA 3RN2A 1Y1WG 1D7QA 2QEXA 4GS3A 1IBML 4JI3Q 4IFDG 1C7YA 4A3BH 3PCOB 1Z9FA 3L0OA 4YY3Q 4AQYL 2VQFQ 4GNXB 4A3CH 1I3QH 5IP9H 5J3BA 1NJIC 1VCIA 2R92H 2MQHA 3AFQA 2AKWB 3S15H 2UXCQ 4R4OA 4P71A 2K5NA 4YHHL 4HJ7A 3RZDH 1PH4A 1CUKA 4LF4Q 4DR5L 5M3FG 5JEAJ 3J7A5 5LMNW 1J6QA 4EQ5A 1Y1WH 1VQBA 3ERSX 2UUCL 1IZ6A 1N8RC 4BY7G 1GO3E 2NN6I 1PH1A 1VQGA 4KLKA 1QZHA 3H3VH 5DLQE 4DV4L 1A62A 1FL0A 2UUBL 1YHBA 2JK8A 1YHAA 3HFZB 1L1OC 3S2DH 3BJUA 4DKAC 4BBRH 1VQ8A 1SE8A 3H15A 5ELOA 2UU9Q 2PI2A 1CKNB 3I4NH 2BA0A 2WP8J 2PMZE 1VQ7A 4HJ8A 3A0JA 4J15A 4JCVE 2ZJRA
chains in the Genus database with same CATH superfamily
5EPKA 4A3IH 4B3TL 3OIQA 5JJIA 4KKSA 4MZ9A 1F2ZA 4PQXA 4EGVA 3DMUA 2QA4A 1HXYD 4DUZQ 4GN5A 1N32Q 2QEJC 3JAMi 2KUMA 4BBSB 3SK4A 4KHVA 3G6EA 3H3VI 1SYFA 1QVFA 2O5IC 1TWGH 4YHHQ 4IQZA 5M3FH 3NSWA 3VR2A 1DM0B 5JVH3 2V1CC 3V2TA 5FLMG 5IWAL 5IT9L 4CGYB 4LF5L 1BNZA 2CKZB 4JI3L 1IL2A 1PHJA 5C44B 2D5DA 3HKSA 2PQAA 2Z8LA 3CMEA 4JG2A 2LXJA 2IX3A 1PZID 4HN7A 1XX8A 5KIXA 4WJ4A 3KF8A 4NXML 1KLGD 5C4XH 2RSOA 2F0EA 2A6EC 2I07B 1DYQA 5JJKA 3A5ZB 3AQQA 1BF4A 1TWGB 2XGTA 4JI4L 3QO2A 4XQQA 1I4GA 3GTPH 4IPCA 3IRBA 5IGGA 2KCCA 4FXDA 1WI5A 1VQIA 4P72A 5C3WA 2OQ0A 5NUCA 1X6OA 4B3RL 2UXBL 2WAQE 4K8JA 3HOWG 1NBWA 5DEHA 4BWGB 4LF7Q 4EQNA 1LTSD 5DAUA 2WAQG 4DR6L 4DF7A 4WORA 2YTYA 3S1NB 1HNZL 4HJ9A 3FDTA 3BS1A 1VQEA 1P16A 2RVLA 3KJPA 2MHVA 2BH2A 3PUWA 3M9BA 2RDGA 2HHHL 3MXNA 3NELA 1BKBA 2K32A 3CCRA 3H0GH 1WFQA 5CV4A 4LF9L 1SROA 3E6ZX 2JSOA 3B6YA 1V1PB 2PQEA 4I65A 3I70A 2FMCA 4N9PA 3PO3H 3DEPA 2UXDL 3HOXH 2F0KA 3H91A 4BBRG 4LAAA 1CKNA 1SMYC 1EYGA 5E3FA 4GKKL 4RG1A 1HPCA 2JA6H 1X65A 1B70B 1VQOA 3NP8A 1II3A 3HS0C 3HG9A 1KTKA 3V05A 4PV1C 1NR2A 2Q2HA 2N49A 5BN5A 1XNQQ 4NPSA 1JB3A 5ELEA 2DGYA 2K6AA 5EKLA 1N34Q 4NKLA 4YCVA 1N36L 3TMEA 4DNRB 5C0XG 2AMCB 5M5XB 4CJ1B 1EQVA 3S24A 1WTXA 1U9RA 4BBSH 1Q8IA 1VDZA 5DNFA 1EWHA 1KABA 3OW7A 4DR4L 1KHIA 1QJOA 1L1OB 4UP7A 1MIUA 1SE2A 4RH6A 3U4VA 4TKOB 2F4VQ 1DOKA 5DM63 2J0TD 5LMUL 4A3DG 2D0PA 3PIOA 3SR1A 1TIID 3T51B 3OYYA 3TDQA 1HUMA 1JOKA 4NXNL 2H1EA 2E2JB 5T1GA 3I4MG 1LTTD 5ELCA 4C3HB 1V1OA 4JI1Q 2E2IH 1JJCB 1Y8OB 4UHVA 1NNXA 1VQJA 3BDCA 4A3EH 2GA4B 3HOUB 4IALA 5D65A 4XYOA 4R1JA 4OWTB 1ESFA 2EYPA 4L5TA 4RGMA 4QMGA 3CCQA 4DAPA 3GD7A 1K8GA 4N9TA 4DPGA 3CRKC 2G5DA 1L0YB 1F2YA 4K2LA 4LF5Q 3X3MA 2JYOA 4BXXH 1ENAA 1O7ZA 3BVGA 1AE3A 2BCOA 3I8ZA 4ZKCB 1TWHB 4BA1I 5C3XA 4E6IA 4QIWB 1C8CA 3M3YB 1S5CD 1I5FA 1JOQA 2O2LD 5HGQA 3D4WA 3TSSA 3KFUA 1LUZA 4JI1L 2NVTH 3PIO3 4BXXG 1SMYD 1STYA 1JJ2A 4OX9L 4IN3A 3J7ZC 1J5EL 1J9OA 3K57A 4DV6Q 3DWPA 5CR3A 3A56A 2EY6A 1FYCA 2UXCL 1A15A 2A74C 3LWUA 3CPFA 4F88A 3IFDA 1O80A 2EJMA 1C9OA 5C0XJ 1C48A 3AFPA 1SMXA 1TWHH 3NENA 1WTWA 2E2HB 4DR1L 2ES2A 2F3VA 3NE5B 5GAHC 2KEDA 5IYDH 3CCVA 5M3MG 2AUJD 4XQNA 5BN3A 1RTNA 1EQQA 2VUMH 1HUNA 1RD9D 3K8AA 1BO0A 3CHBD 4L5SA 1S72A 5BR8L 1QB5D 4B3TQ 1V1PA 1YZ6A 4H44C 1EZ8A 4GNXA 4APVA 3OWFA 3J7AV 1LV9A 1H9RA 1ILPA 2F0VA 3A74A 2KOLA 3AU7A 5KNBA 4DNIA 2D0OA 1A0IA 1B53A 3BG3A 2ZTEA 3C1EA 5IE8A 5D3IB 4QUCA 5IP7H 2R93H 3E3XA 1IL8A 1MD2D 3F8TA 5J39A 1F2MA 2VXWA 2ZM6L 1BCPF 2NZOA 2SDFA 4GZYC 3TN2A 1JT8A 2RQXA 2F0UA 2PI2E 4HSPA 4AH6A 3CQZH 1N9WA 4QL5A 1X3PA 3TS0A 3G6JB 2K5HA 5JAVA 4LF4L 1TWFB 3GTQB 1XXGA 1XMOL 5T1IA 2L11A 2ZTDA 1TS3A 1OTCA 4PG3A 5GAEC 4IURA 1XNQL 4DV4Q 4A76A 4IUTA 4A3MH 2R92G 1YJWA 4YCWA 3SXHA 2V4DA 4OO1G 4JPBW 1CFMA 4JI7Q 1SRUA 4X66Q 5I6YA 1GD7A 3ND9A 2Q8IB 2Z9HA 1K8OA 4GOPB 4JI6L 3NUCA 3M4YA 4XT1B 4LF7L 4OWWB 2ZT9C 1X3EA 1AE2A 1RTOA 2EYMA 3G7LA 1S4ZA 2ID0A 4WJ3M 3MZ5A 3CCJA 2KCMA 2SNSA 2Z6KA 1PA6A 3N6RA 5JVG3 4UY8C 3NBHA 4DAYA 4ILWA 1HZAA 1HRJA 5IT9c 3VYTA 4L8JA 3S2DB 1QUQB 2KHJA 1CTMA 2PO4A 4OEMB 4QIWE 2BDNA 3HZXA 1XPOA 1WTRA 1PV4A 4TVAB 1WJJA 3TRZA 2PQAB 3S1MH 1F77A 4FDBA 3HOWB 1G2TA 2DJFC 1BCPD 1W2BA 3P7JA 1B3AA 3A7AB 1Q12A 5JJLA 1JE5A 2AUKA 4A3KG 1NTGA 4A3JB 2WAQB 4JOIC 1EY6A 1ZYRD 4IJHA 1RODA 4K5WA 4XQJA 1IBKL 4A4IA 5I9OA 4O0AA 5M9OA 1PFMA 1TXYA 1OXSC 4ODGA 4C3JB 4Q5VA 1EY4A 3V96A 3A8KE 4A3FG 2AWOA 4A3KB 4KY7A 1MJEA 4LF8Q 1X54A 3BYTB 5E4XA 1LTGD 3LWEA 1NUCA 2KCTA 4ULLA 4ZRZA 1SNCA 2CQOA 4OIKA 3C46A 4Z9CB 2OXPA 4JI3Q 2B2YA 3UI2A 2DY7A 3F2UA 4ME5A 4AQYL 3K6OA 4DA2A 3RD4A 2DNCA 5FKAC 4YHHL 4M1UB 4DR5L 5M3FG 3J7A5 5LMNW 5TSSA 1QNUA 5F2DA 4N8X1 2B2TA 3NQTA 3KBGA 2R93B 1SBBB 3H3VH 1QZHA 1F9SA 3QG1A 1A62A 5E4WC 4DV4L 1FL0A 3GQBA 4QB4A 1YHBA 3BJUA 4DKAC 1VQ8A 1SE8A 4ZLTF 5ELOA 2UU9Q 1CKNB 5CV5A 1PMRA 4ZKBB 2WP8J 2PMZE 3HP3A 4CDFC 1GUGA 3A0JA 2ZJRA 1SE4A 2K33A 5M5YB 2I0QA 4MNOA 4BS9A 4KD4A 4DK0A 1KC8C 3MWYW 3GTGB 4X65L 1I4HA 2NZHA 3E0JA 2ICEC 2B2UC 1BBXC 3CKIB 3O13A 5GAGC 2RDFA 1YVCA 5E7NA 3A7LA 1WD1A 2ASBA 2RDHA 5EKIA 1HNZQ 1EIFA 3ND8A 3CCSA 1PRTF 2VNUD 5E1FA 1XYIA 1SJHD 3I4MB 4L63B 1LTRD 1BQQT 5C4JB 1T5EA 4HCEA 2CH4W 1WCMB 2FMMA 4DV3Q 1HR0Q 3TP8A 2K52A 3CCMA 1AN8A 5EGTA 3P1HA 2MO1A 2NTSA 1HH2P 3SE0A 2YTVA 4KHZA 1KAWA 4K6DA 2G9DA 2O5JC 5GROA 4JI0L 2B63B 4A3GG 2ZM6Q 4GKKQ 2E5LQ 3I4MH 3HRZC 4TRDA 1IYJB 2VB2X 5I2YA 1KNEA 3CCUA 4AYBE 5C44H 2L4NA 2HHHQ 3DWAA 3W3AA 2JA5G 2F0IA 4KHPQ 5D14A 2Y0SE 3EFXD 2EPBA 4IZ8A 2O4XA 2K50A 4X3SA 1SSOA 2Z4IA 2JA7G 3HOUH 2P5ZX 1ESRA 1UE5A 3QWNA 3KLSA 1CHQD 3S1QH 1G6ZA 1GUWA 3VA5A 4R8IA 1KLUD 3K5LA 3U4ZA 3EIVA 5EBDA 2F0WA 1F2LA 3GP7A 1BBUA 4AYBB 4QQBX 2EOTA 1U4LA 2BH8A 4DR2Q 2YU9H 5D3DA 3T4AC 5KRUA 3A8JE 1PH9A 2LFNA 2B63H 4JC0A 4DV5L 2JJQA 2N88A 3M4OH 1D5MC 4AYBG 4IFDJ 4OX9Q 4QY7A 2KVMA 3IAYA 2I5MX 3K59A 1BR9A 1EOVA 2E2DC 1QILA 4C3HG 3J81c 1STAA 4G57A 2A73B 3TP6A 4DXFA 3EQLC 3HGBA 1AP0A 3AB9A 2F1MA 4HEDA 2B2VC 1ZXTA 4KV6A 5FJ8H 1BXTA 3GTKB 1BUVT 2ZXOA 4DUYL 3KK7A 3OIPA 4B08A 2VB3X 3BVZA 4A3FH 4DV7L 4A3MG 4V0BA 1SEBD 1WCMG 3PF5A 4UDUC 5K36H 5C4HA 3U58A 5FLXL 1YITA 4RKBA 3M7GA 1EU4A 1XNRQ 1K3BC 1K8MA 4A3BG 1KRTA 4NXMQ 4TQUS 2JA8B 3A55A 2RSNA 1TY2A 4X64Q 2HUGA 2UXDQ 1ZKOA 3MAQA 2L5TA 3EVQA 1UWVA 2PZWA 3H09A 1JR0D 2HIVA 3PUVA 1NE3A 1IBLL 4DV6L 2A1AA 4B9WA 5C3EG 4DV0L 4A3GH 2Z1CA 1E2VA 1JQYD 4BY7H 4OL7A 4MTKA 1FD7D 1A3UA 2M00A 3S1NH 1MHWC 3PMFA 2XNAC 1G8ZD 3S16B 1Y1VH 3AYHB 1I50H 1LT3D 4K14A 4KKTA 5ELNA 1ASZA 1HJPA 1A3VA 4X3UA 1HNXQ 1A8VA 5LL6S 1TKWB 1SFOB 1DD2A 1DXMA 4OONA 2F0MA 1Y1VG 3J80i 2MJ8A 4PNYA 4BY1H 3BZCA 4PZ8A 3HOYG 3KF6A 5JJZA 4KMUC 3PO3G 4B3ML 1TS4A 1D2BA 4F8MA 3G48A 1GUOA 3CQZB 2BE5C 2F4IA 3ULLA 2Y0SG 1SNPA 2MO0A 3QOLA 2EJFC 1L0WA 4A93G 3GV6A 4JI2Q 2F4VL 4MTNA 3S17B 4IPDA 1CZWA 3CCEA 1Y1VB 4IOCA 1GHJA 3GTLH 4JI5Q 2CW0D 3NBHB 2VQFL 2EVBA 1OXXK 1B8AA 4IUVA 1VQPA 1JMCA 4DV1L 5CORA 1C0AA 2B3GA 3M85A 1QNKA 4R4IA 1STHA 5C5LA 4A3EB 1ICFB 4F7XA 1SE3A 1U5KA 2A6HC 2C9OA 5AFWA 3T1HQ 4C3JG 2JA9A 5KNDA 1DONA 2VS1A 3KLRA 1SFOH 1PDQA 2L15A 4WJWA 5LMNL 1VQMA 3HOYH 3PUXA 3KJOA 3FEWX 4Y52H 2UUCQ 4Q0FA 4P75A 4Y7NB 3HOUG 1SYGA 3BZKA 4IUNA 4AQYQ 4ZK9B 2OTLA 5JEAG 1H9SA 4OXPA 3VDYA 3A54A 4DV7Q 3S16H 3NEMA 3RN5A 4I7ZC 3Q22A 1I50B 4KD3A 2R6GA 2JA5H 1Q1EA 5IWAQ 4R4CA 3MFGA 1VQ9A 3K5NA 1BDOA 4B3RQ 2UXBQ 4PMCA 2EYOA 3M4QA 3HOVB 4B9XA 5CV9A 2K03A 4J1MA 2LY7A 2OTJA 3CF5A 1JICA 4CKBA 2GVBA 2CQAA 1H95A 3D8GA 2R7ZB 3FP9A 1BCPC 1CA6A 3K7AB 1H9MA 3HKZB 4CJ2C 3GTMB 4LF6L 3OTOL 1LT5D 3CMAA 1PZJD 4X62Q 2F0OA 1B3QA 1VQNA 3K0XA 1RF2D 1NR4A 1LTLA 2OT2A 2OQKA 1EL0A 4IJLA 4FF1A 1V1QA 3J81j 1NMFA 3UE1A 4JI8L 3T1YL 2ZXPA 3E9IA 4K2KA 2F0SA 3FPPA 5G3LD 1SNMA 3TREA 4C2MH 1UEAB 4N8FA 2FFKB 2PW5A 1F9QA 1B1ZA 5IP7G 3CAMA 2IJ0A 1G2SA 3EJIA 3CRLC 4HJAA 1UUPA 1EU3A 1KAAA 1L0XB 3CP0A 3QOJA 1YI2A 4X64L 1EY9A 1ASYA 2X6GA 3OSOA 4RKLA 1FGUA 1GXDC 3M7NA 1JE4A 1HZBA 2CHBD 2B2WA 3EN2A 1SNDA 3QB3A 3PIP3 1LACA 3K7AH 1CM9A 1PFSA 2N55A 3HEJA 4QUFA 3DLLA 1OXTA 1LTAD 3KF8B 3T1YQ 1U4MA 4KKUA 5EKKA 1YBYA 5EAYA 2IL8A 1TVXA 2RKSA 1CI3M 4KTAA 4NB3A 5IGFA 5GADC 5C3EH 4BBSG 3UDGA 4DR2L 3J81i 4QJFA 3K0YA 3RLFA 1F9PA 2E2HH 1UNSA 2WINB 2K05A 3I90A 5COYA 1FR3A 1YEZA 4K0KQ 3GTOB 3KF6B 5CV6A 4Y7NH 1XMOQ 3CXCA 1PRTD 1E22A 1A6XA 1EYCA 3J80L 2R7DA 5I9PA 1IKMA 1HZCA 1I3QB 3D4DA 4C3HH 2F0LA 3MXUA 2PPBC 4C56C 1WCMH 1PH7A 5K36G 2KHIA 3RZOH 1I6VC 1O78A 1PH5A 4IUQA 3STBD 5IOCA 2K1BA 3LX0A 1Q3LA 1DJRD 2PZTA 3TZDA 1BVSA 1MBYA 1SLJA 1V8QA 3SEBA 3J7AF 3A8IE 4LUVA 2JA6B 4AIMA 4KJNA 1EYAA 1LO5D 1STNA 4LFCQ 2NVYB 2QDLA 1WYDA 4H7BA 1SNOA 1VF5C 2QEXA 1IBML 1RJTA 1C7YA 3PCOB 3L0OA 2CW0C 1I3QH 5J3BA 1TWAB 2B8FA 2M2LA 2MQHA 2UXCQ 4R4OA 4HJ7A 2K5NA 1GJXA 1PFNA 4K6LA 5IGBA 5JEAJ 4CDDC 1J6QA 3N52A 1TR5A 1N8RC 1TS2A 4BY7G 1VQGA 1ZEQX 2UUBL 3HFZB 1L1OC 5C4ZA 1STEA 5LHY1 3SK6A 2WIIB 4FYDA 4C3IG 2HCIA 4XDXA 1EY0A 4IUUA 4RFBA 4BBRB 4BY7B 1M90C 2E2IB 2PYKA 2D62A 3DM1A 2B8GA 4J8QA 4DN4M 1EYDA 3FMCA 3ZYYX 2Q2IA 5KYIA 2CCZA 4I7AA 3D6WA 4RA8A 1XNRL 1IYVA 5J1ZA 5FJ8G 1HNWQ 3T56B 3Q23A 3W1BA 1S40A 1PTOH 1K28A 1UAPA 4XYQA 4DK6C 1VF7A 1QG7A 3QIAA 5IP9G 3Q6SA 2EJGC 2B39A 2IT1A 3T16A 2CVRA 1GUTA 1VQKA 3GTGH 4DR6Q 3FKIG 4O2DA 1IBLQ 1LT4D 1X3QA 1SR3A 1AW7A 1B7YB 1KDCA 4YCUA 1VQFA 1UE6A 3UE0A 3S1MB 4LF6Q 3HOXB 4DR3L 1Y69U 2ZTCA 1EZ6A 3F2DA 4LFBQ 3OMGA 4ID6A 4A75A 2F0NA 1MSGA 3NK9A 3TBIB 3R2TA 2DUDA 1EY8A 4RCOA 1Q90A 4JI6Q 5I2XA 1NY4A 2K7VA 3PSIA 2VUMG 2KECA 3L3OC 2HIXA 3HOXG 1PLFA 4OHJA 1X55A 2KCNA 4WRDA 2LKVA 2EY1A 3OWEB 3UDIA 4NP5A 1HQRD 1ET6A 2PW7A 1WTHA 2C5CA 1I6HH 4A3EG 4IFDI 4UP9A 4RMFA 1PH8A 1QVGA 3FHWA 1T9HA 4JBWA 1ICWA 1PVOA 4GLXA 1Y14B 4PZ7A 1SYCA 5CMDA 3P20A 5IIFA 1EIGA 2A6HD 1PH6A 4UAIA 1VQ4A 4C3IB 3S1RB 2NN6H 1J5EQ 3FVQA 1J8IA 1H9JA 1EEFD 4G7ZC 4RCNA 5BN4A 5IY0A 3WOEA 2PNRC 1MI2A 1D1IA 2E5LL 5H1SE 1NMGA 1CK1A 4DV5Q 2F0TA 1K0RA 2VL6A 2TSSA 1U4RA 5AJ3L 3EROA 5M3FB 4JV5L 2BOSA 1CZGA 4YWMA 2I5LX 5HY6A 2SOBA 3GO5A 4DV3L 2JA7B 3ICEA 4X3TA 1YNXA 4HAEA 1FVIA 2L55A 2B2VA 2WKCA 3SDZA 1QCBD 1SYBA 2R7FA 1JJGA 2K5VA 4LWCA 4FF3A 2X69A 5C6AA 3HKZE 3PO2B 4KY6A 2Q2TA 3PV0A 3J81L 5CBAE 4GN3B 4X6AH 4EQOA 2HCCA 3GTJH 3RUZA 4A93H 2KEEA 2SNMA 1CKMA 3K80C 3GTOH 2GVAA 1QOHA 1CT1D 1KNAA 1M8AA 2KENA 2OEOA 2F0FA 3L2PA 1PTOB 3TZUA 1PZKD 5ELBA 4V190 3I91A 4O42A 1GVPA 3RLOA 4GKJQ 3JC66 1EWIA 4JVZA 1DCZA 3MEFA 3SVMA 2EQSA 4HCSA 4KN4C 4P73A 1XJVA 1B4OA 1LTBD 3DHQA 4LMQD 2DNEA 1CKOA 3S9WA 3S1QB 1UE1A 2IW3A 5K5PA 3IFTA 4C1NK 4GLAC 1LT6D 2UUAL 1D5ZC 2XRQD 4RGOS 3T1HL 4FF4A 3Q8DA 1X9NA 4GNXC 1WTQA 1R9TH 3TS2A 5LMNQ 2OWOA 4R9WA 5HURA 2IPKD 2JE6I 3I56A 3S2HH 5M3MH 1ILQA 5CV7A 4RGNA 2R92B 2N3SA 2A68C 4NXNQ 1EUJA 1WTPA 2FXQA 4BA2I 4A3BB 4FO2A 2F03A 5KEEA 2YYZA 4DR7L 2B2YC 2FINB 2ENBA 3WOFA 1K3RA 1PTOC 1E0BA 4ZQ3A 1Q46A 1E3PA 3H0GG 5EJWA 5JPNC 3VR3A 1TS5A 2I5HA 4B3MQ 4FXGC 1DGSA 2E74C 3W2DA 4B3SL 2UU9L 4OGQC 5M5WB 3PUZA 4KK7A 1VMPA 4JBMA 1XWEA 3NQIA 4ABNA 1JWMD 1CA5A 2JXMB 3MXNB 3AMUA 3K5OA 3K5MA 4KHPL 3STBC 3T53B 2UUBQ 3Q24A 2QGQA 1KXLA 3OTOQ 1I4XA 1NCVA 3E9HA 1YNNC 4IFDH 3PF4A 1R9TB 1VQ5A 3HOWH 5LL6X 4A3CG 1B2TA 1I4RA 2PNHA 1Z6HA 2RF4A 3PO2H 1QWYA 1EFWA 1P8LA 2LMCB 2OCEA 2B29A 1G91A 4S3SA 3IKJA 5C0XI 1LABA 4DV1Q 3BVMA 1HNWL 4IPHA 2HT1A 4G7OC 3HOYB 3LGJA 2JA7H 2F0GA 2XWJB 1Y8NB 2RCNA 4OO1H 4JK1C 3BDOA 5CV8A 2Y0SB 4UP8A 2F3WA 4LFAQ 1K73C 3AEVA 4KN7C 3KBXA 4OIJA 4A93B 4DFAA 2EE1A 1N33L 2B2WC 4P74A 2MP1A 1RIPA 1Q7YC 1YNJD 3S14H 2A8VA 2QILA 1UE7A 3W1GA 4DK1A 1ENFA 1TY0A 3U50C 1QZGA 3HOZH 3UDXA 3I55A 3CC7A 4BY1B 1XTCD 3F2CA 3RR5A 5FO8B 1VQLA 4JYAQ 1PH2A 5M5XH 3M3YH 3NWTA 2NYZD 3J80E 1KL9A 1KD1C 4K0KL 1AZQA 2F3IA 4PMWA 3CD6A 4P2CB 1Q82C 1FJGQ 3CPWA 1D1KA 1VQ6A 4LFAL 3CW2C 3EA6A 4JI2L 4NDXA 2KQ3A 2B2UA 1GUNA 1OO9B 4X65Q 2EDGA 3MEHA 2BDOA 2VZAA 1KQSA 1WD0A 2PMZB 1V43A 1D5XC 1JOOA 4HIKA 2IWHA 3J7YW 1Z7TA 1EWCA 5ELFA 1N36Q 1C4QA 4LF9Q 1XTDA 1E2WA 4GOPA 2K28A 4DNTB 4HSVA 2K4KA 2PZUA 2RCFA 4IPGA 1ML0D 2XVSA 4U68A 2HDLA 1E1OA 5JEAH 4L5QA 3F2BA 3K58A 1KDBA 5ELDA 2XIWA 2ZJQA 2VUMB 1EFID 3ULJA 1K83H 3MA2B 5A35A 5I4DA 1DOLA 1VS0A 3S15B 2MFIA 3GTJB 4JI8Q 2MPMA 2NVXH 3GV3A 3JAME 1L2FA 2MNAA 1XMQQ 4LFBL 1JWSD 3GDEA 4A3LH 1I94L 2L1BA 4FXKC 4A3GB 4K5VA 1EQRA 2JQOA 3S1RH 2L9HA 5JPMC 3RNUA 2VQEL 3BZDB 1M4VA 5I6WA 3I4NG 2K5DA 4H0LC 2K14A 2NTTA 2NUCA 1KRSA 3I3CA 1A63A 2B2TC 1Y8PB 1EY5A 1HTPA 2IX0A 4JOIA 1ZYRC 3RN2A 3R2IA 1IKLA 4A3BH 1GUSA 1RKNA 5EQ0A 4YY3Q 2VQFQ 4GNXB 4A3CH 1MSHA 1NJIC 2R92H 1ET9A 1SAPA 4EQPA 3S15H 4CHTB 4A3FB 4G4KA 1PH4A 5EPLA 4R8NA 1H9KA 1CUKA 4LK1C 5EPJA 4LF4Q 1T5XD 3FKIB 5DM73 5IGEA 2OF1A 1S5ED 1Y1WH 1VQBA 1R4QB 2NN6I 1PH1A 4KLKA 5DLQE 1QE6A 3S2DH 3J81E 2H4OA 3D3RA 4BBRH 1PRTC 2SEBD 3H15A 1HQMC 2L12A 2BA0A 4L6TB 2K01A 4J15A 4JCVE 1TQOA 1TWCH 3FKIH 4POGA 2WACA 4DR3Q 1Q81C 3NXWA 2CH4A 3SHLA 1O7YA 2R93G 3PIPA 1S5DD 4A3DB 5FOBB 1IHZA 3VYSA 4PZ6A 3C3LA 2E76C 1MKHA 1CQVA 4ZUJA 3HOZG 4DR5Q 5FLXc 1Q1BA 2ZJPA 4HTHA 2Z6BA 2QCPX 1K8AC 4JBJA 1GKHA 5IYBG 4HIMA 1SYEA 2WB1E 3C1FA 3SK5A 1AEXA 4R4TA 1JCKB 5M5WH 3ZJYC 3WWVA 4A3MB 1IBMQ 3SGIA 1N34L 2JP1A 1UEBA 1D8LA 2EY2A 4X62L 2JEBI 4CKCA 3KYHC 2NBFA 5KGUA 4R4QA 2Z4HA 5CBEE 4CJ0B 1CSQA 3M4OB 1E1TA 1EIYB 1RL2A 2IHEA 4DK3C 3D6CA 2WB1B 2NVYH 4JI5L 1S5FD 1TU2B 2AQ2B 3J80c 1BBWA 2PCFB 3I4NB 2Q8RE 4A3DH 2RHSB 3E5SA 1MGSA 5C3EB 2C35B 1W6JA 1VQHA 2K5QA 3I7FA 3BU2A 4TSSA 5IYCG 5ISRA 3K7UC 5KYLA 5J22A 2A5HA 2E75C 2HD3A 3ONAB 1FNVA 1GM5A 4JYAL 2AHOB 2CWPA 2E8GA 1HNXL 2WB1G 4LUZA 4JBKA 4GN4B 1GOZA 2UUAQ 3G71A 3D4RA 5JOBA 1S5BD 3H0GB 5BR8Q 2J7ZA 2FJ2A 4A3IB 1TWAH 3RLNA 1QVCA 2K04A 5IYCH 1SN8A 3KLSX 3JAML 4FVMA 1U4PA 1N33Q 4DGZA 3DWQA 1LLRD 1O7IA 1JWUD 2RA4A 1X56A 1RCVD 1AH9A 3LNNA 1I6HB 1SNQA 2R3ZA 2I46A 2F0JA 4XIGS 4FF2A 1E2ZA 3VR4A 2WFWA 4DAMA 2KJXA 5L37A 2JA6G 5C44G 1G291 1YNJC 4OELB 3BYYB 4A3IG 4HMIA 2XTIA 1WOCA 4LUOA 1E24A 2ICIA 3RZDB 3TQYA 4DXGA 3ER0A 4A3KH 4EVOA 2G9HD 2XN9C 1SJED 3GTPB 2A6ED 1B50A 3HOZB 2XWBB 4L5RC 3KDFA 1Z47A 1CHPD 5G3LF 1FNUA 3FPUB 3U9SA 4DV0Q 3H94A 4XXEA 5C4JH 1RHPA 1JB7A 1HZ9A 1EEID 3OHXC 3I4LA 4M8AA 3R93A 2NVXB 2EY5A 3MFYA 2EYJA 4ZCKA 1K9MC 4HIDA 1CSPA 1YIJA 2GN5A 4KJOA 5FO7B 3MXGA 1S3OA 3TEHB 5M5YH 3W5OA 1YJNA 4J6HA 2NN6G 1EOTA 4RWSC 4QF4A 4UPAA 2EIFA 3OMCA 3F1ZA 1ONLA 2YTXA 5A2QE 1E7ZA 3T13A 2F0DA 4OWXB 4DR7Q 3VA7A 1DOMA 2A19A 1G6PA 1G51A 1PYBA 3KLWA 2JN4A 5CC4A 4G7HC 2EYHA 5IGCA 1EY7A 2R7ZG 1VMCA 3PQIA 3NTKA 4XTCS 1SDFA 1WTVA 2BA1A 3VR6A 3C2PA 1LM0A 3ERQA 2LSSA 1IW7C 4DU9A 2BE5D 1IYUA 4LJZC 4K5XA 2A69D 3NWSA 2K75A 1W6KA 2F0HA 4IUPA 4LFCL 1B9MA 2YV5A 2X6LA 5CYUA 1I4QA 2NVQB 4C3JH 1SXTA 3GTMH 1PTOD 4A3LG 3CCLA 3PUYA 1NAPA 1NSNS 1RDPD 2DJGC 3FRPB 5C4XB 2R7ZH 4C1NI 4DUZL 1N32L 3EBEA 5A2QL 3ULPA 4HR7B 4X66L 1OXUA 4CDCC 5FLXE 3Q0AA 3OPOA 4RAUC 4ALPA 4A3JG 1K83B 1LTID 1XPUA 3GTLB 1PH3A 4FP5D 2Q2UA 3PO3B 2HQEA 5C4XG 5EBCA 3A5UA 4LW1A 1ENCA 4YWLA 1AZPA 1HR0L 4BY1G 1XPRA 5GQOA 4LF8L 2D2CC 2DN8A 3D0FA 4YIJA 2M9VA 3E0EA 4U673 4OO1I 2NB0A 2LS01 3U9OA 2AQ3B 4QGUA 2E2JH 2JA8G 3HOVH 3BDLA 1WTOA 4EX5A 4YY3L 1EIHA 3S14B 1HR0W 4DAYB 1PYSB 1QUQA 4A3JH 1R4PB 2J4XA 4X3KA 3TP5A 4DV2L 3G4SA 4H13C 2IY5B 4YWKA 4DAVA 2IHFA 4HMJA 4GKJL 4IO9A 1K0SA 3OOCA 4MIUA 1HFGA 1L1OA 4F87A 1I4PA 4HIOA 3QJYA 2A68D 3NBIA 4B3SQ 3IL8A 4XT3B 1HA6A 3KDFB 4KI0A 5CGKA 4FNFA 3K81C 3KUPA 2EYFA 3DUZA 1I94Q 1HCZA 2EXDA 4MN3A 2EYLA 2N8NA 2KA7A 1YHQA 1W3SA 2F0PA 3PGZA 1FGBD 5HGTA 3NPPA 4RHRA 2VW9A 4DR1Q 2QKIC 3L7ZC 3JAMc 2JA8H 3HOVG 4LNQA 3OW2A 1B44D 4CDEC 3PO2G 2NVTB 3I2ZA 2D9UA 3NTIA 2Z0SA 4ZUIA 3MVVA 1VQAA 3L9AX 1EQTA 3HKZG 2RHQB 5FO9B 2VY3A 1BOSA 5AJ3Q 4JV5Q 4H02A 3S17H 4C2MB 1Q8KA 5KNCA 5C5MA 5M3MB 5FLMH 3CC2A 1X3FA 3NHHA 4GOPC 3QR8A 1YJ9A 1A3TA 4ZAIA 1PTOF 2ATWA 1MJCA 4C3IH 3RZOB 2HQLA 2VQEQ 2Z6KC 3UDFA 1JC7A 1X3GA 1HHVA 2RBMA 4NW2A 5IGDA 4CBVA 3DXJC 1HFNA 2EXZA 5IT9E 4WFN3 3R3OA 2NVQH 1CQFA 1M1KC 2KBNA 2LXKA 4NMZA 1TWFH 3GTQH 4IOAA 5LMUQ 2QDBA 1Q86C 2JEAI 1A2UA 3CC4A 1VQDA 2B63G 2ZXRA 2IX1A 4RGTA 1X32A 2CWAA 2KHSA 3RMHA 5C0XH 1DZ1A 3I4OA 1O7LA 4GLVB 2WKDA 1KIXA 5IYDG 3P75A 1PYWD 3X3NA 4K8IA 3SK8A 2JA5B 1U0LA 4JI7L 3MC0B 3TP7A 1LYLA 2HDMA 5IYBH 1STGA 3DM3A 2N78A 2H5XA 4ME3A 1B9NA 3DEOA 2AWNA 4POFA 1IXRA 2AQ1B 1OXVA 4HJ5A 3MHBA 2XSCA 4DUYQ 2MUYA 2QF7A 5IODA 3H3VC 3H6MA 4JI4Q 3KOJA 3URYA 1TT2A 2ALYB 1D6EC 1F9RA 3VYUA 2XRSD 3NTHA 3VYRA 4DV2Q 2K5WA 4QCLA 4DR4Q 3M4PA 1FJGL 4JI0Q 2CFMA 1WVLA 1JORA 3MTSA 2MGSA 3I72A 3GTKH 1VQCA 1YNND 1IBKQ 4O1NA 1XMQL 3VR5A 1HTLD 2TMPA 3S2HB 3WDNA 3D31A 4RHSA 1GHKA 2F52A 3CU7A 1H9SB 2DY8A 1V9PA 1D7QA 2WV6D 1Y1WG 1SYDA 4GS3A 1TWCB 4IFDG 1PXUA 1AFPA 1Z9FA 2NWGA 2NZ1D 4CKEA 1HA5A 1STBA 5IP9H 1VCIA 3AFQA 2AKWB 1A2TA 2F0QA 2R61A 4P71A 3RZDH 1FNWA 3I73A 2EZVA 2QW7A 4EQ5A 2A69C 4PMBA 3ERSX 2FHTA 2UUCL 1IZ6A 3ITPA 4JW0A 1IW7D 1GO3E 4MHEA 1PFBA 1Y1WB 2YU9B 4KY5A 2JK8A 1YHAA 3R8BA 5FK9C 3MXPA 4ZYSA 2PI2A 3I4NH 2L0CA 1VQ7A 4HJ8A 1KDAA 2Q8TA 1PRTB 1BCPB
chains in the Genus database with same CATH topology
1TWCH 4A3IH 2I0QA 3FKIH 4B3TL 4POGA 4MNOA 4DR3Q 1Q81C 5JJIA 1KC8C 4MZ9A 2R93G 4X65L 3PIPA 1M90C 2QA4A 2D62A 2NZHA 4DUZQ 4GN5A 2JA5H 4PZ6A 1N32Q 1MKHA 3JAMi 5GAGC 1YVCA 3HOZG 5E7NA 3G6EA 4DR5Q 3H3VI 1QVFA 2Q2IA 2CCZA 5FLXc 1HNZQ 1TWGH 1Q1BA 2ASBA 2ZJPA 1EIFA 4YHHQ 1K8AC 4JBJA 1GKHA 5IYBG 3CCSA 4HIMA 1XNRL 5M3FH 2WB1E 2VNUD 2V1CC 5FJ8G 4R4TA 1HNWQ 5M5WH 5FLMG 5IWAL 3ZJYC 3W1BA 3WWVA 1S40A 4LF5L 2CKZB 4JI3L 1IBMQ 1IL2A 3SGIA 1N34L 1PHJA 4DK6C 4DV3Q 1UEBA 1D8LA 4X62L 1HR0Q 3HKSA 2JEBI 5IP9G 2K52A 3CCMA 2PQAA 3CMEA 3KYHC 4JG2A 2LXJA 2IT1A 2MO1A 1HH2P 1VQKA 3GTGH 4R4QA 4DR6Q 3FKIG 2IY5B 4O2DA 1IBLQ 2YTVA 4KHZA 1CSQA 1KAWA 1SR3A 1E1TA 1B7YB 4WJ4A 4YCUA 1VQFA 5GROA 1EIYB 4JI0L 1UE6A 1RL2A 2IHEA 2ZM6Q 4DK3C 3UE0A 4NXML 4A3GG 2NVYH 5C4XH 2E5LQ 4JI5L 4LF6Q 4GKKQ 4DR3L 3I4MH 1IYJB 3J80c 1BBWA 3CCUA 2ZTCA 3F2DA 2RHSB 4A3DH 4LFBQ 5JJKA 3A5ZB 3AQQA 4A75A 2XGTA 4JI4L 4AYBE 5C44H 3GTPH 2HHHQ 2C35B 2JA5G 4IPCA 3IRBA 1VQHA 1WI5A 3I7FA 3BU2A 1VQIA 4P72A 4KHPQ 5IYCG 2DUDA 2OQ0A 3K7UC 2Y0SE 1X6OA 4B3RL 2UXBL 2K50A 4JI6Q 2WAQE 1NY4A 2JA7G 1GM5A 3PSIA 1NBWA 2VUMG 3HOUH 2AHOB 2CWPA 3HOWG 2E8GA 1UE5A 2HIXA 2WB1G 4LUZA 1HNXL 4GN4B 3HOXG 2UUAQ 4JBKA 3G71A 1X55A 4LF7Q 3S1QH 3UDIA 5BR8Q 3U4ZA 1TWAH 3RLNA 2WAQG 3EIVA 1QVCA 4DR6L 5IYCH 1BBUA 1SN8A 2YTYA 1HNZL 4QQBX 4HJ9A 1N33Q 1I6HH 4A3EG 1O7IA 4UP9A 4IFDI 4RMFA 1X56A 2BH8A 1PH8A 1VQEA 1AH9A 1QVGA 3FHWA 1P16A 1T9HA 3KJPA 4JBWA 4XIGS 2BH2A 4DR2Q 3PUWA 3M9BA 1PVOA 4GLXA 2HHHL 1Y14B 2WFWA 4PZ7A 4DAMA 2YU9H 2JA6G 5C44G 1G291 3NELA 1BKBA 1PH9A 3CCRA 1PH6A 3H0GH 4A3IG 1WFQA 2B63H 4JC0A 2XTIA 1WOCA 1SROA 4LUOA 4DV5L 2JJQA 1VQ4A 4LF9L 3M4OH 1E24A 3B6YA 4AYBG 1J5EQ 4IFDJ 4OX9Q 3TQYA 4QY7A 3PO3H 2UXDL 3HOXH 5IY0A 2I5MX 1EOVA 3ER0A 3J81c 4BBRG 4A3KH 1EYGA 1CKNA 4GKKL 4RG1A 2E5LL 2JA6H 1X65A 1B70B 5H1SE 1VQOA 1NMGA 4L5RC 4DV5Q 1K0RA 2VL6A 3KDFA 1Z47A 5AJ3L 4JV5L 4DV0Q 5FJ8H 2Q2HA 4YWMA 2I5LX 5HY6A 2N49A 5C4JH 1XNQQ 4NPSA 1JB7A 1HZ9A 3GO5A 4DUYL 4DV3L 2DGYA 1N34Q 3ICEA 4A3FH 4DV7L 4YCVA 4A3MG 1YNXA 1N36L 1FVIA 1WCMG 3PF5A 3U58A 1YITA 1K9MC 4HIDA 1CSPA 5C0XG 1YIJA 2AMCB 2GN5A 1XNRQ 2R7FA 1JJGA 1S3OA 2K5VA 4BBSH 3S24A 4LWCA 3TEHB 4A3BG 1KRTA 3HKZE 4TQUS 5M5YH 4NXMQ 3W5OA 2Q2TA 3PV0A 1YJNA 4DR4L 4GN3B 1KHIA 2NN6G 4X64Q 1L1OB 4UP7A 1MIUA 4X6AH 3GTJH 3U4VA 4A93H 4UPAA 2EIFA 2F4VQ 2UXDQ 1CKMA 3K80C 1UWVA 5LMUL 3GTOH 2GVAA 3F1ZA 4A3DG 2D0PA 2KENA 3HOZH 2HIVA 2YTXA 3PUVA 3L2PA 1E7ZA 1NE3A 1IBLL 3PIOA 2A1AA 4DV6L 4OWXB 5C3EG 4DR7Q 4DV0L 1GVPA 3OYYA 3RLOA 2A19A 4A3GH 4GKJQ 3JC66 1G6PA 4BY7H 1EWIA 4NXNL 1G51A 1PYBA 3KLWA 3I4MG 3MEFA 2R7ZG 3S1NH 2EQSA 4P73A 1XJVA 4XTCS 2BA1A 4JI1Q 1CKOA 2E2IH 1JJCB 1Y1VH 3AYHB 1LM0A 1UE1A 1VQJA 2LSSA 1I50H 4A3EH 5ELNA 1ASZA 1HJPA 4GLAC 4R1JA 2K75A 4OWTB 2UUAL 1HNXQ 1A8VA 4L5TA 3T1HL 3CCQA 4LFCL 3Q8DA 2YV5A 1X9NA 4GNXC 1R9TH 3GD7A 3TS2A 1K8GA 4OONA 4DPGA 5LMNQ 2OWOA 1Y1VG 3J80i 2JE6I 4C3JH 3I56A 3S2HH 4BY1H 5M3MH 4LF5Q 4BXXH 3BZCA 4PZ8A 3GTMH 4A3LG 2N3SA 1AE3A 3KF6A 3PUYA 3CCLA 3HOYG 4BA1I 4NXNQ 1EUJA 3PO3G 4B3ML 2R7ZH 2FXQA 4BA2I 4DR7L 3G48A 2YYZA 4DUZL 1N32L 3EBEA 1I5FA 3ULLA 2Y0SG 3ULPA 5HGQA 4X66L 1OXUA 2MO0A 3KFUA 1K3RA 1L0WA 1LUZA 4A93G 4JI1L 2NVTH 4JI2Q 2F4VL 4MTNA 1Q46A 1E3PA 4IPDA 3H0GG 3CCEA 4IOCA 3GTLH 4BXXG 4JI5Q 4ALPA 4A3JG 3NBHB 2I5HA 4B3MQ 1JJ2A 4OX9L 1J5EL 1DGSA 3J7ZC 2VQFL 1XPUA 1OXXK 1B8AA 1VQPA 1JMCA 4B3SL 1PH3A 4DV1L 4DV6Q 2UU9L 1C0AA 2Q2UA 2B3GA 3M85A 2UXCL 5C4XG 4R4IA 3A5UA 3CPFA 3PUZA 4LW1A 4JBMA 1U5KA 4YWLA 1HR0L 1C9OA 4BY1G 5C0XJ 1XPRA 3T1HQ 5GQOA 2JA9A 3AFPA 1SMXA 1TWHH 3NENA 4LF8L 2VS1A 3MXNB 1SFOH 4KHPL 3STBC 2UUBQ 2L15A 5LMNL 3D0FA 4DR1L 1VQMA 2ES2A 3PUXA 3KJOA 3E0EA 3HOYH 2QGQA 4OO1I 5GAHC 5IYDH 1KXLA 4Y52H 3CCVA 5M3MG 2UUCQ 3OTOQ 4P75A 3E9HA 4QGUA 2E2JH 3PF4A 2JA8G 3HOVH 1EQQA 1VQ5A 3BZKA 2VUMH 4EX5A 3K8AA 4YY3L 4AQYQ 3HOWH 1HR0W 5JEAG 4DAYB 2OTLA 4OXPA 3VDYA 4A3CG 4DV7Q 4L5SA 3S16H 2PNHA 2RF4A 1S72A 5BR8L 3PO2H 1PYSB 3NEMA 1QUQA 3RN5A 4A3JH 1YZ6A 1EFWA 4B3TQ 4DV2L 1P8LA 3G4SA 2OCEA 2R6GA 4GNXA 4APVA 1Q1EA 2B29A 4R4CA 4YWKA 5IWAQ 5C0XI 1VQ9A 4DV1Q 4GKJL 2IHFA 1HNWL 4B3RQ 2UXBQ 4IO9A 3M4QA 3A74A 4IPHA 2HT1A 4DNIA 2D0OA 1A0IA 1L1OA 2ZTEA 3LGJA 5IE8A 5IP7H 4HIOA 2JA7H 4B3SQ 4JYAL 2R93H 2OTJA 3CF5A 2RCNA 2GVBA 3KDFB 3F8TA 4KI0A 1H95A 3K81C 3FP9A 4UP8A 1I94Q 4LFAQ 2EXDA 1K73C 3AEVA 2N8NA 2ZM6L 1YHQA 4LF6L 2NZOA 3OTOL 1W3SA 1N33L 3PGZA 3CMAA 1JT8A 4P74A 3HOUG 2PI2E 4AH6A 1RIPA 1N9WA 3CQZH 4X62Q 2VW9A 3L7ZC 4DR1Q 4QL5A 3JAMc 1Q7YC 2JA8H 3TS0A 4LNQA 3HOVG 3S14H 3OW2A 2K5HA 1VQNA 2A8VA 3K0XA 3PO2G 4LF4L 3I2ZA 1UE7A 1LTLA 1XMOL 3W1GA 3U50C 2Z0SA 2OQKA 1QZGA 2ZTDA 4IJLA 1V1QA 3J81j 1NMFA 3UE1A 3UDXA 3I55A 1VQAA 4PG3A 3CC7A 4JI8L 5GAEC 1OTCA 3T1YL 3E9IA 3HKZG 2RHQB 3F2CA 1XNQL 3RR5A 3TREA 4C2MH 4DV4Q 1VQLA 1PH2A 4JYAQ 2VY3A 5M5XH 4A76A 5AJ3Q 3M3YH 4JV5Q 4H02A 4A3MH 3S17H 1Q8KA 2R92G 5IP7G 1KL9A 1YJWA 1KD1C 4YCWA 4K0KL 3CAMA 5FLMH 2F3IA 3CC2A 1X3FA 4PMWA 4GOPC 1YJ9A 4OO1G 4JI7Q 3CD6A 2ATWA 1MJCA 1SRUA 4C3IH 4X66Q 4HJAA 1Q82C 2HQLA 2VQEQ 3CPWA 1FJGQ 2Z6KC 3UDFA 1VQ6A 1GD7A 1X3GA 4LFAL 3CP0A 3CW2C 4JI2L 4GOPB 1YI2A 4X64L 1ASYA 4JI6L 4X65Q 1FGUA 3M7NA 1HZBA 2VZAA 4LF7L 1KQSA 2NVQH 1V43A 4OWWB 3EN2A 1M1KC 1X3EA 1AE2A 2KBNA 2LXKA 2ID0A 4WJ3M 1TWFH 3K7AH 3GTQH 4HIKA 1PFSA 3CCJA 4IOAA 2KCMA 5LMUQ 1Q86C 2JEAI 2Z6KA 3CC4A 1VQDA 1N36Q 2B63G 3DLLA 1OXTA 1PA6A 4LF9Q 2IX1A 2CWAA 3KF8B 3T1YQ 4UY8C 1XTDA 3I4OA 4GOPA 4GLVB 1YBYA 5EAYA 5GADC 4NB3A 1KIXA 1HZAA 5C3EH 5IT9c 5IYDG 4BBSG 3UDGA 1QUQB 4DR2L 2K4KA 3J81i 4QJFA 4IPGA 2KHJA 1XPOA 1U0LA 4QIWE 3RLFA 1PV4A 2E2HH 4JI7L 1E1OA 4TVAB 1WJJA 4L5QA 3F2BA 2PQAB 3TRZA 3S1MH 1YEZA 4K0KQ 1LYLA 5IYBH 4FDBA 3KF6B 2ZJQA 3DM3A 4Y7NH 2N78A 3ULJA 1K83H 1XMOQ 2H5XA 3CXCA 4ME3A 2AWNA 1VS0A 4POFA 1W2BA 1IXRA 1E22A 1Q12A 1JE5A 1OXVA 2MFIA 2R7DA 4HJ5A 5JJLA 1HZCA 4JI8Q 4A3KG 1NTGA 4DUYQ 2NVXH 4C3HH 2MNAA 1L2FA 1WCMH 4JOIC 1PH7A 5K36G 4IJHA 1XMQQ 4JI4Q 4LFBL 2KHIA 3KOJA 1IBKL 2ALYB 3GDEA 4A4IA 3RZOH 4A3LH 1PH5A 1I94L 3STBD 1EQRA 4O0AA 2JQOA 4DV2Q 3S1RH 3RNUA 1TXYA 1BVSA 3M4PA 1OXSC 2VQEL 1FJGL 1SLJA 4DR4Q 4JI0Q 3I4NG 2CFMA 4LUVA 4A3FG 4AIMA 2K14A 2AWOA 3GTKH 1KRSA 1VQCA 1MJEA 1IBKQ 4LF8Q 1XMQL 1A63A 1X54A 3D31A 4LFCQ 2F52A 2KCTA 2IX0A 1WYDA 1V9PA 4JOIA 2CQOA 3RN2A 1Y1WG 1D7QA 2QEXA 4GS3A 1IBML 4JI3Q 4IFDG 1C7YA 4A3BH 3PCOB 1Z9FA 3L0OA 4YY3Q 4AQYL 2VQFQ 4GNXB 4A3CH 1I3QH 5IP9H 5J3BA 1NJIC 1VCIA 2R92H 2MQHA 3AFQA 2AKWB 3S15H 2UXCQ 4R4OA 4P71A 2K5NA 4YHHL 4HJ7A 3RZDH 1PH4A 1CUKA 4LF4Q 4DR5L 5M3FG 5JEAJ 3J7A5 5LMNW 1J6QA 4EQ5A 1Y1WH 1VQBA 3ERSX 2UUCL 1IZ6A 1N8RC 4BY7G 1GO3E 2NN6I 1PH1A 1VQGA 4KLKA 1QZHA 3H3VH 5DLQE 4DV4L 1A62A 1FL0A 2UUBL 1YHBA 2JK8A 1YHAA 3HFZB 1L1OC 3S2DH 3BJUA 4DKAC 4BBRH 1VQ8A 1SE8A 3H15A 5ELOA 2UU9Q 2PI2A 1CKNB 3I4NH 2BA0A 2WP8J 2PMZE 1VQ7A 4HJ8A 3A0JA 4J15A 4JCVE 2ZJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWC H;  4A3I H;  2I0Q A;  3FKI H;  4B3T L;  4POG A;  4MNO A;  4DR3 Q;  1Q81 C;  5JJI A;  1KC8 C;  4MZ9 A;  2R93 G;  4X65 L;  3PIP A;  1M90 C;  2QA4 A;  2D62 A;  2NZH A;  4DUZ Q;  4GN5 A;  2JA5 H;  4PZ6 A;  1N32 Q;  1MKH A;  3JAM i;  5GAG C;  1YVC A;  3HOZ G;  5E7N A;  3G6E A;  4DR5 Q;  3H3V I;  1QVF A;  2Q2I A;  2CCZ A;  5FLX c;  1HNZ Q;  1TWG H;  1Q1B A;  2ASB A;  2ZJP A;  1EIF A;  4YHH Q;  1K8A C;  4JBJ A;  1GKH A;  5IYB G;  3CCS A;  4HIM A;  1XNR L;  5M3F H;  2WB1 E;  2VNU D;  2V1C C;  5FJ8 G;  4R4T A;  1HNW Q;  5M5W H;  5FLM G;  5IWA L;  3ZJY C;  3W1B A;  3WWV A;  1S40 A;  4LF5 L;  2CKZ B;  4JI3 L;  1IBM Q;  1IL2 A;  3SGI A;  1N34 L;  1PHJ A;  4DK6 C;  4DV3 Q;  1UEB A;  1D8L A;  4X62 L;  1HR0 Q;  3HKS A;  2JEB I;  5IP9 G;  2K52 A;  3CCM A;  2PQA A;  3CME A;  3KYH C;  4JG2 A;  2LXJ A;  2IT1 A;  2MO1 A;  1HH2 P;  1VQK A;  3GTG H;  4R4Q A;  4DR6 Q;  3FKI G;  2IY5 B;  4O2D A;  1IBL Q;  2YTV A;  4KHZ A;  1CSQ A;  1KAW A;  1SR3 A;  1E1T A;  1B7Y B;  4WJ4 A;  4YCU A;  1VQF A;  5GRO A;  1EIY B;  4JI0 L;  1UE6 A;  1RL2 A;  2IHE A;  2ZM6 Q;  4DK3 C;  3UE0 A;  4NXM L;  4A3G G;  2NVY H;  5C4X H;  2E5L Q;  4JI5 L;  4LF6 Q;  4GKK Q;  4DR3 L;  3I4M H;  1IYJ B;  3J80 c;  1BBW A;  3CCU A;  2ZTC A;  3F2D A;  2RHS B;  4A3D H;  4LFB Q;  5JJK A;  3A5Z B;  3AQQ A;  4A75 A;  2XGT A;  4JI4 L;  4AYB E;  5C44 H;  3GTP H;  2HHH Q;  2C35 B;  2JA5 G;  4IPC A;  3IRB A;  1VQH A;  1WI5 A;  3I7F A;  3BU2 A;  1VQI A;  4P72 A;  4KHP Q;  5IYC G;  2DUD A;  2OQ0 A;  3K7U C;  2Y0S E;  1X6O A;  4B3R L;  2UXB L;  2K50 A;  4JI6 Q;  2WAQ E;  1NY4 A;  2JA7 G;  1GM5 A;  3PSI A;  1NBW A;  2VUM G;  3HOU H;  2AHO B;  2CWP A;  3HOW G;  2E8G A;  1UE5 A;  2HIX A;  2WB1 G;  4LUZ A;  1HNX L;  4GN4 B;  3HOX G;  2UUA Q;  4JBK A;  3G71 A;  1X55 A;  4LF7 Q;  3S1Q H;  3UDI A;  5BR8 Q;  3U4Z A;  1TWA H;  3RLN A;  2WAQ G;  3EIV A;  1QVC A;  4DR6 L;  5IYC H;  1BBU A;  1SN8 A;  2YTY A;  1HNZ L;  4QQB X;  4HJ9 A;  1N33 Q;  1I6H H;  4A3E G;  1O7I A;  4UP9 A;  4IFD I;  4RMF A;  1X56 A;  2BH8 A;  1PH8 A;  1VQE A;  1AH9 A;  1QVG A;  3FHW A;  1P16 A;  1T9H A;  3KJP A;  4JBW A;  4XIG S;  2BH2 A;  4DR2 Q;  3PUW A;  3M9B A;  1PVO A;  4GLX A;  2HHH L;  1Y14 B;  2WFW A;  4PZ7 A;  4DAM A;  2YU9 H;  2JA6 G;  5C44 G;  1G29 1;  3NEL A;  1BKB A;  1PH9 A;  3CCR A;  1PH6 A;  3H0G H;  4A3I G;  1WFQ A;  2B63 H;  4JC0 A;  2XTI A;  1WOC A;  1SRO A;  4LUO A;  4DV5 L;  2JJQ A;  1VQ4 A;  4LF9 L;  3M4O H;  1E24 A;  3B6Y A;  4AYB G;  1J5E Q;  4IFD J;  4OX9 Q;  3TQY A;  4QY7 A;  3PO3 H;  2UXD L;  3HOX H;  5IY0 A;  2I5M X;  1EOV A;  3ER0 A;  3J81 c;  4BBR G;  4A3K H;  1EYG A;  1CKN A;  4GKK L;  4RG1 A;  2E5L L;  2JA6 H;  1X65 A;  1B70 B;  5H1S E;  1VQO A;  1NMG A;  4L5R C;  4DV5 Q;  1K0R A;  2VL6 A;  3KDF A;  1Z47 A;  5AJ3 L;  4JV5 L;  4DV0 Q;  5FJ8 H;  2Q2H A;  4YWM A;  2I5L X;  5HY6 A;  2N49 A;  5C4J H;  1XNQ Q;  4NPS A;  1JB7 A;  1HZ9 A;  3GO5 A;  4DUY L;  4DV3 L;  2DGY A;  1N34 Q;  3ICE A;  4A3F H;  4DV7 L;  4YCV A;  4A3M G;  1YNX A;  1N36 L;  1FVI A;  1WCM G;  3PF5 A;  3U58 A;  1YIT A;  1K9M C;  4HID A;  1CSP A;  5C0X G;  1YIJ A;  2AMC B;  2GN5 A;  1XNR Q;  2R7F A;  1JJG A;  1S3O A;  2K5V A;  4BBS H;  3S24 A;  4LWC A;  3TEH B;  4A3B G;  1KRT A;  3HKZ E;  4TQU S;  5M5Y H;  4NXM Q;  3W5O A;  2Q2T A;  3PV0 A;  1YJN A;  4DR4 L;  4GN3 B;  1KHI A;  2NN6 G;  4X64 Q;  1L1O B;  4UP7 A;  1MIU A;  4X6A H;  3GTJ H;  3U4V A;  4A93 H;  4UPA A;  2EIF A;  2F4V Q;  2UXD Q;  1CKM A;  3K80 C;  1UWV A;  5LMU L;  3GTO H;  2GVA A;  3F1Z A;  4A3D G;  2D0P A;  2KEN A;  3HOZ H;  2HIV A;  2YTX A;  3PUV A;  3L2P A;  1E7Z A;  1NE3 A;  1IBL L;  3PIO A;  2A1A A;  4DV6 L;  4OWX B;  5C3E G;  4DR7 Q;  4DV0 L;  1GVP A;  3OYY A;  3RLO A;  2A19 A;  4A3G H;  4GKJ Q;  3JC6 6;  1G6P A;  4BY7 H;  1EWI A;  4NXN L;  1G51 A;  1PYB A;  3KLW A;  3I4M G;  3MEF A;  2R7Z G;  3S1N H;  2EQS A;  4P73 A;  1XJV A;  4XTC S;  2BA1 A;  4JI1 Q;  1CKO A;  2E2I H;  1JJC B;  1Y1V H;  3AYH B;  1LM0 A;  1UE1 A;  1VQJ A;  2LSS A;  1I50 H;  4A3E H;  5ELN A;  1ASZ A;  1HJP A;  4GLA C;  4R1J A;  2K75 A;  4OWT B;  2UUA L;  1HNX Q;  1A8V A;  4L5T A;  3T1H L;  3CCQ A;  4LFC L;  3Q8D A;  2YV5 A;  1X9N A;  4GNX C;  1R9T H;  3GD7 A;  3TS2 A;  1K8G A;  4OON A;  4DPG A;  5LMN Q;  2OWO A;  1Y1V G;  3J80 i;  2JE6 I;  4C3J H;  3I56 A;  3S2H H;  4BY1 H;  5M3M H;  4LF5 Q;  4BXX H;  3BZC A;  4PZ8 A;  3GTM H;  4A3L G;  2N3S A;  1AE3 A;  3KF6 A;  3PUY A;  3CCL A;  3HOY G;  4BA1 I;  4NXN Q;  1EUJ A;  3PO3 G;  4B3M L;  2R7Z H;  2FXQ A;  4BA2 I;  4DR7 L;  3G48 A;  2YYZ A;  4DUZ L;  1N32 L;  3EBE A;  1I5F A;  3ULL A;  2Y0S G;  3ULP A;  5HGQ A;  4X66 L;  1OXU A;  2MO0 A;  3KFU A;  1K3R A;  1L0W A;  1LUZ A;  4A93 G;  4JI1 L;  2NVT H;  4JI2 Q;  2F4V L;  4MTN A;  1Q46 A;  1E3P A;  4IPD A;  3H0G G;  3CCE A;  4IOC A;  3GTL H;  4BXX G;  4JI5 Q;  4ALP A;  4A3J G;  3NBH B;  2I5H A;  4B3M Q;  1JJ2 A;  4OX9 L;  1J5E L;  1DGS A;  3J7Z C;  2VQF L;  1XPU A;  1OXX K;  1B8A A;  1VQP A;  1JMC A;  4B3S L;  1PH3 A;  4DV1 L;  4DV6 Q;  2UU9 L;  1C0A A;  2Q2U A;  2B3G A;  3M85 A;  2UXC L;  5C4X G;  4R4I A;  3A5U A;  3CPF A;  3PUZ A;  4LW1 A;  4JBM A;  1U5K A;  4YWL A;  1HR0 L;  1C9O A;  4BY1 G;  5C0X J;  1XPR A;  3T1H Q;  5GQO A;  2JA9 A;  3AFP A;  1SMX A;  1TWH H;  3NEN A;  4LF8 L;  2VS1 A;  3MXN B;  1SFO H;  4KHP L;  3STB C;  2UUB Q;  2L15 A;  5LMN L;  3D0F A;  4DR1 L;  1VQM A;  2ES2 A;  3PUX A;  3KJO A;  3E0E A;  3HOY H;  2QGQ A;  4OO1 I;  5GAH C;  5IYD H;  1KXL A;  4Y52 H;  3CCV A;  5M3M G;  2UUC Q;  3OTO Q;  4P75 A;  3E9H A;  4QGU A;  2E2J H;  3PF4 A;  2JA8 G;  3HOV H;  1EQQ A;  1VQ5 A;  3BZK A;  2VUM H;  4EX5 A;  3K8A A;  4YY3 L;  4AQY Q;  3HOW H;  1HR0 W;  5JEA G;  4DAY B;  2OTL A;  4OXP A;  3VDY A;  4A3C G;  4DV7 Q;  4L5S A;  3S16 H;  2PNH A;  2RF4 A;  1S72 A;  5BR8 L;  3PO2 H;  1PYS B;  3NEM A;  1QUQ A;  3RN5 A;  4A3J H;  1YZ6 A;  1EFW A;  4B3T Q;  4DV2 L;  1P8L A;  3G4S A;  2OCE A;  2R6G A;  4GNX A;  4APV A;  1Q1E A;  2B29 A;  4R4C A;  4YWK A;  5IWA Q;  5C0X I;  1VQ9 A;  4DV1 Q;  4GKJ L;  2IHF A;  1HNW L;  4B3R Q;  2UXB Q;  4IO9 A;  3M4Q A;  3A74 A;  4IPH A;  2HT1 A;  4DNI A;  2D0O A;  1A0I A;  1L1O A;  2ZTE A;  3LGJ A;  5IE8 A;  5IP7 H;  4HIO A;  2JA7 H;  4B3S Q;  4JYA L;  2R93 H;  2OTJ A;  3CF5 A;  2RCN A;  2GVB A;  3KDF B;  3F8T A;  4KI0 A;  1H95 A;  3K81 C;  3FP9 A;  4UP8 A;  1I94 Q;  4LFA Q;  2EXD A;  1K73 C;  3AEV A;  2N8N A;  2ZM6 L;  1YHQ A;  4LF6 L;  2NZO A;  3OTO L;  1W3S A;  1N33 L;  3PGZ A;  3CMA A;  1JT8 A;  4P74 A;  3HOU G;  2PI2 E;  4AH6 A;  1RIP A;  1N9W A;  3CQZ H;  4X62 Q;  2VW9 A;  3L7Z C;  4DR1 Q;  4QL5 A;  3JAM c;  1Q7Y C;  2JA8 H;  3TS0 A;  4LNQ A;  3HOV G;  3S14 H;  3OW2 A;  2K5H A;  1VQN A;  2A8V A;  3K0X A;  3PO2 G;  4LF4 L;  3I2Z A;  1UE7 A;  1LTL A;  1XMO L;  3W1G A;  3U50 C;  2Z0S A;  2OQK A;  1QZG A;  2ZTD A;  4IJL A;  1V1Q A;  3J81 j;  1NMF A;  3UE1 A;  3UDX A;  3I55 A;  1VQA A;  4PG3 A;  3CC7 A;  4JI8 L;  5GAE C;  1OTC A;  3T1Y L;  3E9I A;  3HKZ G;  2RHQ B;  3F2C A;  1XNQ L;  3RR5 A;  3TRE A;  4C2M H;  4DV4 Q;  1VQL A;  1PH2 A;  4JYA Q;  2VY3 A;  5M5X H;  4A76 A;  5AJ3 Q;  3M3Y H;  4JV5 Q;  4H02 A;  4A3M H;  3S17 H;  1Q8K A;  2R92 G;  5IP7 G;  1KL9 A;  1YJW A;  1KD1 C;  4YCW A;  4K0K L;  3CAM A;  5FLM H;  2F3I A;  3CC2 A;  1X3F A;  4PMW A;  4GOP C;  1YJ9 A;  4OO1 G;  4JI7 Q;  3CD6 A;  2ATW A;  1MJC A;  1SRU A;  4C3I H;  4X66 Q;  4HJA A;  1Q82 C;  2HQL A;  2VQE Q;  3CPW A;  1FJG Q;  2Z6K C;  3UDF A;  1VQ6 A;  1GD7 A;  1X3G A;  4LFA L;  3CP0 A;  3CW2 C;  4JI2 L;  4GOP B;  1YI2 A;  4X64 L;  1ASY A;  4JI6 L;  4X65 Q;  1FGU A;  3M7N A;  1HZB A;  2VZA A;  4LF7 L;  1KQS A;  2NVQ H;  1V43 A;  4OWW B;  3EN2 A;  1M1K C;  1X3E A;  1AE2 A;  2KBN A;  2LXK A;  2ID0 A;  4WJ3 M;  1TWF H;  3K7A H;  3GTQ H;  4HIK A;  1PFS A;  3CCJ A;  4IOA A;  2KCM A;  5LMU Q;  1Q86 C;  2JEA I;  2Z6K A;  3CC4 A;  1VQD A;  1N36 Q;  2B63 G;  3DLL A;  1OXT A;  1PA6 A;  4LF9 Q;  2IX1 A;  2CWA A;  3KF8 B;  3T1Y Q;  4UY8 C;  1XTD A;  3I4O A;  4GOP A;  4GLV B;  1YBY A;  5EAY A;  5GAD C;  4NB3 A;  1KIX A;  1HZA A;  5C3E H;  5IT9 c;  5IYD G;  4BBS G;  3UDG A;  1QUQ B;  4DR2 L;  2K4K A;  3J81 i;  4QJF A;  4IPG A;  2KHJ A;  1XPO A;  1U0L A;  4QIW E;  3RLF A;  1PV4 A;  2E2H H;  4JI7 L;  1E1O A;  4TVA B;  1WJJ A;  4L5Q A;  3F2B A;  2PQA B;  3TRZ A;  3S1M H;  1YEZ A;  4K0K Q;  1LYL A;  5IYB H;  4FDB A;  3KF6 B;  2ZJQ A;  3DM3 A;  4Y7N H;  2N78 A;  3ULJ A;  1K83 H;  1XMO Q;  2H5X A;  3CXC A;  4ME3 A;  2AWN A;  1VS0 A;  4POF A;  1W2B A;  1IXR A;  1E22 A;  1Q12 A;  1JE5 A;  1OXV A;  2MFI A;  2R7D A;  4HJ5 A;  5JJL A;  1HZC A;  4JI8 Q;  4A3K G;  1NTG A;  4DUY Q;  2NVX H;  4C3H H;  2MNA A;  1L2F A;  1WCM H;  4JOI C;  1PH7 A;  5K36 G;  4IJH A;  1XMQ Q;  4JI4 Q;  4LFB L;  2KHI A;  3KOJ A;  1IBK L;  2ALY B;  3GDE A;  4A4I A;  3RZO H;  4A3L H;  1PH5 A;  1I94 L;  3STB D;  1EQR A;  4O0A A;  2JQO A;  4DV2 Q;  3S1R H;  3RNU A;  1TXY A;  1BVS A;  3M4P A;  1OXS C;  2VQE L;  1FJG L;  1SLJ A;  4DR4 Q;  4JI0 Q;  3I4N G;  2CFM A;  4LUV A;  4A3F G;  4AIM A;  2K14 A;  2AWO A;  3GTK H;  1KRS A;  1VQC A;  1MJE A;  1IBK Q;  4LF8 Q;  1XMQ L;  1A63 A;  1X54 A;  3D31 A;  4LFC Q;  2F52 A;  2KCT A;  2IX0 A;  1WYD A;  1V9P A;  4JOI A;  2CQO A;  3RN2 A;  1Y1W G;  1D7Q A;  2QEX A;  4GS3 A;  1IBM L;  4JI3 Q;  4IFD G;  1C7Y A;  4A3B H;  3PCO B;  1Z9F A;  3L0O A;  4YY3 Q;  4AQY L;  2VQF Q;  4GNX B;  4A3C H;  1I3Q H;  5IP9 H;  5J3B A;  1NJI C;  1VCI A;  2R92 H;  2MQH A;  3AFQ A;  2AKW B;  3S15 H;  2UXC Q;  4R4O A;  4P71 A;  2K5N A;  4YHH L;  4HJ7 A;  3RZD H;  1PH4 A;  1CUK A;  4LF4 Q;  4DR5 L;  5M3F G;  5JEA J;  3J7A 5;  5LMN W;  1J6Q A;  4EQ5 A;  1Y1W H;  1VQB A;  3ERS X;  2UUC L;  1IZ6 A;  1N8R C;  4BY7 G;  1GO3 E;  2NN6 I;  1PH1 A;  1VQG A;  4KLK A;  1QZH A;  3H3V H;  5DLQ E;  4DV4 L;  1A62 A;  1FL0 A;  2UUB L;  1YHB A;  2JK8 A;  1YHA A;  3HFZ B;  1L1O C;  3S2D H;  3BJU A;  4DKA C;  4BBR H;  1VQ8 A;  1SE8 A;  3H15 A;  5ELO A;  2UU9 Q;  2PI2 A;  1CKN B;  3I4N H;  2BA0 A;  2WP8 J;  2PMZ E;  1VQ7 A;  4HJ8 A;  3A0J A;  4J15 A;  4JCV E;  2ZJR A; 
#chains in the Genus database with same CATH topology
 5EPK A;  4A3I H;  4B3T L;  3OIQ A;  5JJI A;  4KKS A;  4MZ9 A;  1F2Z A;  4PQX A;  4EGV A;  3DMU A;  2QA4 A;  1HXY D;  4DUZ Q;  4GN5 A;  1N32 Q;  2QEJ C;  3JAM i;  2KUM A;  4BBS B;  3SK4 A;  4KHV A;  3G6E A;  3H3V I;  1SYF A;  1QVF A;  2O5I C;  1TWG H;  4YHH Q;  4IQZ A;  5M3F H;  3NSW A;  3VR2 A;  1DM0 B;  5JVH 3;  2V1C C;  3V2T A;  5FLM G;  5IWA L;  5IT9 L;  4CGY B;  4LF5 L;  1BNZ A;  2CKZ B;  4JI3 L;  1IL2 A;  1PHJ A;  5C44 B;  2D5D A;  3HKS A;  2PQA A;  2Z8L A;  3CME A;  4JG2 A;  2LXJ A;  2IX3 A;  1PZI D;  4HN7 A;  1XX8 A;  5KIX A;  4WJ4 A;  3KF8 A;  4NXM L;  1KLG D;  5C4X H;  2RSO A;  2F0E A;  2A6E C;  2I07 B;  1DYQ A;  5JJK A;  3A5Z B;  3AQQ A;  1BF4 A;  1TWG B;  2XGT A;  4JI4 L;  3QO2 A;  4XQQ A;  1I4G A;  3GTP H;  4IPC A;  3IRB A;  5IGG A;  2KCC A;  4FXD A;  1WI5 A;  1VQI A;  4P72 A;  5C3W A;  2OQ0 A;  5NUC A;  1X6O A;  4B3R L;  2UXB L;  2WAQ E;  4K8J A;  3HOW G;  1NBW A;  5DEH A;  4BWG B;  4LF7 Q;  4EQN A;  1LTS D;  5DAU A;  2WAQ G;  4DR6 L;  4DF7 A;  4WOR A;  2YTY A;  3S1N B;  1HNZ L;  4HJ9 A;  3FDT A;  3BS1 A;  1VQE A;  1P16 A;  2RVL A;  3KJP A;  2MHV A;  2BH2 A;  3PUW A;  3M9B A;  2RDG A;  2HHH L;  3MXN A;  3NEL A;  1BKB A;  2K32 A;  3CCR A;  3H0G H;  1WFQ A;  5CV4 A;  4LF9 L;  1SRO A;  3E6Z X;  2JSO A;  3B6Y A;  1V1P B;  2PQE A;  4I65 A;  3I70 A;  2FMC A;  4N9P A;  3PO3 H;  3DEP A;  2UXD L;  3HOX H;  2F0K A;  3H91 A;  4BBR G;  4LAA A;  1CKN A;  1SMY C;  1EYG A;  5E3F A;  4GKK L;  4RG1 A;  1HPC A;  2JA6 H;  1X65 A;  1B70 B;  1VQO A;  3NP8 A;  1II3 A;  3HS0 C;  3HG9 A;  1KTK A;  3V05 A;  4PV1 C;  1NR2 A;  2Q2H A;  2N49 A;  5BN5 A;  1XNQ Q;  4NPS A;  1JB3 A;  5ELE A;  2DGY A;  2K6A A;  5EKL A;  1N34 Q;  4NKL A;  4YCV A;  1N36 L;  3TME A;  4DNR B;  5C0X G;  2AMC B;  5M5X B;  4CJ1 B;  1EQV A;  3S24 A;  1WTX A;  1U9R A;  4BBS H;  1Q8I A;  1VDZ A;  5DNF A;  1EWH A;  1KAB A;  3OW7 A;  4DR4 L;  1KHI A;  1QJO A;  1L1O B;  4UP7 A;  1MIU A;  1SE2 A;  4RH6 A;  3U4V A;  4TKO B;  2F4V Q;  1DOK A;  5DM6 3;  2J0T D;  5LMU L;  4A3D G;  2D0P A;  3PIO A;  3SR1 A;  1TII D;  3T51 B;  3OYY A;  3TDQ A;  1HUM A;  1JOK A;  4NXN L;  2H1E A;  2E2J B;  5T1G A;  3I4M G;  1LTT D;  5ELC A;  4C3H B;  1V1O A;  4JI1 Q;  2E2I H;  1JJC B;  1Y8O B;  4UHV A;  1NNX A;  1VQJ A;  3BDC A;  4A3E H;  2GA4 B;  3HOU B;  4IAL A;  5D65 A;  4XYO A;  4R1J A;  4OWT B;  1ESF A;  2EYP A;  4L5T A;  4RGM A;  4QMG A;  3CCQ A;  4DAP A;  3GD7 A;  1K8G A;  4N9T A;  4DPG A;  3CRK C;  2G5D A;  1L0Y B;  1F2Y A;  4K2L A;  4LF5 Q;  3X3M A;  2JYO A;  4BXX H;  1ENA A;  1O7Z A;  3BVG A;  1AE3 A;  2BCO A;  3I8Z A;  4ZKC B;  1TWH B;  4BA1 I;  5C3X A;  4E6I A;  4QIW B;  1C8C A;  3M3Y B;  1S5C D;  1I5F A;  1JOQ A;  2O2L D;  5HGQ A;  3D4W A;  3TSS A;  3KFU A;  1LUZ A;  4JI1 L;  2NVT H;  3PIO 3;  4BXX G;  1SMY D;  1STY A;  1JJ2 A;  4OX9 L;  4IN3 A;  3J7Z C;  1J5E L;  1J9O A;  3K57 A;  4DV6 Q;  3DWP A;  5CR3 A;  3A56 A;  2EY6 A;  1FYC A;  2UXC L;  1A15 A;  2A74 C;  3LWU A;  3CPF A;  4F88 A;  3IFD A;  1O80 A;  2EJM A;  1C9O A;  5C0X J;  1C48 A;  3AFP A;  1SMX A;  1TWH H;  3NEN A;  1WTW A;  2E2H B;  4DR1 L;  2ES2 A;  2F3V A;  3NE5 B;  5GAH C;  2KED A;  5IYD H;  3CCV A;  5M3M G;  2AUJ D;  4XQN A;  5BN3 A;  1RTN A;  1EQQ A;  2VUM H;  1HUN A;  1RD9 D;  3K8A A;  1BO0 A;  3CHB D;  4L5S A;  1S72 A;  5BR8 L;  1QB5 D;  4B3T Q;  1V1P A;  1YZ6 A;  4H44 C;  1EZ8 A;  4GNX A;  4APV A;  3OWF A;  3J7A V;  1LV9 A;  1H9R A;  1ILP A;  2F0V A;  3A74 A;  2KOL A;  3AU7 A;  5KNB A;  4DNI A;  2D0O A;  1A0I A;  1B53 A;  3BG3 A;  2ZTE A;  3C1E A;  5IE8 A;  5D3I B;  4QUC A;  5IP7 H;  2R93 H;  3E3X A;  1IL8 A;  1MD2 D;  3F8T A;  5J39 A;  1F2M A;  2VXW A;  2ZM6 L;  1BCP F;  2NZO A;  2SDF A;  4GZY C;  3TN2 A;  1JT8 A;  2RQX A;  2F0U A;  2PI2 E;  4HSP A;  4AH6 A;  3CQZ H;  1N9W A;  4QL5 A;  1X3P A;  3TS0 A;  3G6J B;  2K5H A;  5JAV A;  4LF4 L;  1TWF B;  3GTQ B;  1XXG A;  1XMO L;  5T1I A;  2L11 A;  2ZTD A;  1TS3 A;  1OTC A;  4PG3 A;  5GAE C;  4IUR A;  1XNQ L;  4DV4 Q;  4A76 A;  4IUT A;  4A3M H;  2R92 G;  1YJW A;  4YCW A;  3SXH A;  2V4D A;  4OO1 G;  4JPB W;  1CFM A;  4JI7 Q;  1SRU A;  4X66 Q;  5I6Y A;  1GD7 A;  3ND9 A;  2Q8I B;  2Z9H A;  1K8O A;  4GOP B;  4JI6 L;  3NUC A;  3M4Y A;  4XT1 B;  4LF7 L;  4OWW B;  2ZT9 C;  1X3E A;  1AE2 A;  1RTO A;  2EYM A;  3G7L A;  1S4Z A;  2ID0 A;  4WJ3 M;  3MZ5 A;  3CCJ A;  2KCM A;  2SNS A;  2Z6K A;  1PA6 A;  3N6R A;  5JVG 3;  4UY8 C;  3NBH A;  4DAY A;  4ILW A;  1HZA A;  1HRJ A;  5IT9 c;  3VYT A;  4L8J A;  3S2D B;  1QUQ B;  2KHJ A;  1CTM A;  2PO4 A;  4OEM B;  4QIW E;  2BDN A;  3HZX A;  1XPO A;  1WTR A;  1PV4 A;  4TVA B;  1WJJ A;  3TRZ A;  2PQA B;  3S1M H;  1F77 A;  4FDB A;  3HOW B;  1G2T A;  2DJF C;  1BCP D;  1W2B A;  3P7J A;  1B3A A;  3A7A B;  1Q12 A;  5JJL A;  1JE5 A;  2AUK A;  4A3K G;  1NTG A;  4A3J B;  2WAQ B;  4JOI C;  1EY6 A;  1ZYR D;  4IJH A;  1ROD A;  4K5W A;  4XQJ A;  1IBK L;  4A4I A;  5I9O A;  4O0A A;  5M9O A;  1PFM A;  1TXY A;  1OXS C;  4ODG A;  4C3J B;  4Q5V A;  1EY4 A;  3V96 A;  3A8K E;  4A3F G;  2AWO A;  4A3K B;  4KY7 A;  1MJE A;  4LF8 Q;  1X54 A;  3BYT B;  5E4X A;  1LTG D;  3LWE A;  1NUC A;  2KCT A;  4ULL A;  4ZRZ A;  1SNC A;  2CQO A;  4OIK A;  3C46 A;  4Z9C B;  2OXP A;  4JI3 Q;  2B2Y A;  3UI2 A;  2DY7 A;  3F2U A;  4ME5 A;  4AQY L;  3K6O A;  4DA2 A;  3RD4 A;  2DNC A;  5FKA C;  4YHH L;  4M1U B;  4DR5 L;  5M3F G;  3J7A 5;  5LMN W;  5TSS A;  1QNU A;  5F2D A;  4N8X 1;  2B2T A;  3NQT A;  3KBG A;  2R93 B;  1SBB B;  3H3V H;  1QZH A;  1F9S A;  3QG1 A;  1A62 A;  5E4W C;  4DV4 L;  1FL0 A;  3GQB A;  4QB4 A;  1YHB A;  3BJU A;  4DKA C;  1VQ8 A;  1SE8 A;  4ZLT F;  5ELO A;  2UU9 Q;  1CKN B;  5CV5 A;  1PMR A;  4ZKB B;  2WP8 J;  2PMZ E;  3HP3 A;  4CDF C;  1GUG A;  3A0J A;  2ZJR A;  1SE4 A;  2K33 A;  5M5Y B;  2I0Q A;  4MNO A;  4BS9 A;  4KD4 A;  4DK0 A;  1KC8 C;  3MWY W;  3GTG B;  4X65 L;  1I4H A;  2NZH A;  3E0J A;  2ICE C;  2B2U C;  1BBX C;  3CKI B;  3O13 A;  5GAG C;  2RDF A;  1YVC A;  5E7N A;  3A7L A;  1WD1 A;  2ASB A;  2RDH A;  5EKI A;  1HNZ Q;  1EIF A;  3ND8 A;  3CCS A;  1PRT F;  2VNU D;  5E1F A;  1XYI A;  1SJH D;  3I4M B;  4L63 B;  1LTR D;  1BQQ T;  5C4J B;  1T5E A;  4HCE A;  2CH4 W;  1WCM B;  2FMM A;  4DV3 Q;  1HR0 Q;  3TP8 A;  2K52 A;  3CCM A;  1AN8 A;  5EGT A;  3P1H A;  2MO1 A;  2NTS A;  1HH2 P;  3SE0 A;  2YTV A;  4KHZ A;  1KAW A;  4K6D A;  2G9D A;  2O5J C;  5GRO A;  4JI0 L;  2B63 B;  4A3G G;  2ZM6 Q;  4GKK Q;  2E5L Q;  3I4M H;  3HRZ C;  4TRD A;  1IYJ B;  2VB2 X;  5I2Y A;  1KNE A;  3CCU A;  4AYB E;  5C44 H;  2L4N A;  2HHH Q;  3DWA A;  3W3A A;  2JA5 G;  2F0I A;  4KHP Q;  5D14 A;  2Y0S E;  3EFX D;  2EPB A;  4IZ8 A;  2O4X A;  2K50 A;  4X3S A;  1SSO A;  2Z4I A;  2JA7 G;  3HOU H;  2P5Z X;  1ESR A;  1UE5 A;  3QWN A;  3KLS A;  1CHQ D;  3S1Q H;  1G6Z A;  1GUW A;  3VA5 A;  4R8I A;  1KLU D;  3K5L A;  3U4Z A;  3EIV A;  5EBD A;  2F0W A;  1F2L A;  3GP7 A;  1BBU A;  4AYB B;  4QQB X;  2EOT A;  1U4L A;  2BH8 A;  4DR2 Q;  2YU9 H;  5D3D A;  3T4A C;  5KRU A;  3A8J E;  1PH9 A;  2LFN A;  2B63 H;  4JC0 A;  4DV5 L;  2JJQ A;  2N88 A;  3M4O H;  1D5M C;  4AYB G;  4IFD J;  4OX9 Q;  4QY7 A;  2KVM A;  3IAY A;  2I5M X;  3K59 A;  1BR9 A;  1EOV A;  2E2D C;  1QIL A;  4C3H G;  3J81 c;  1STA A;  4G57 A;  2A73 B;  3TP6 A;  4DXF A;  3EQL C;  3HGB A;  1AP0 A;  3AB9 A;  2F1M A;  4HED A;  2B2V C;  1ZXT A;  4KV6 A;  5FJ8 H;  1BXT A;  3GTK B;  1BUV T;  2ZXO A;  4DUY L;  3KK7 A;  3OIP A;  4B08 A;  2VB3 X;  3BVZ A;  4A3F H;  4DV7 L;  4A3M G;  4V0B A;  1SEB D;  1WCM G;  3PF5 A;  4UDU C;  5K36 H;  5C4H A;  3U58 A;  5FLX L;  1YIT A;  4RKB A;  3M7G A;  1EU4 A;  1XNR Q;  1K3B C;  1K8M A;  4A3B G;  1KRT A;  4NXM Q;  4TQU S;  2JA8 B;  3A55 A;  2RSN A;  1TY2 A;  4X64 Q;  2HUG A;  2UXD Q;  1ZKO A;  3MAQ A;  2L5T A;  3EVQ A;  1UWV A;  2PZW A;  3H09 A;  1JR0 D;  2HIV A;  3PUV A;  1NE3 A;  1IBL L;  4DV6 L;  2A1A A;  4B9W A;  5C3E G;  4DV0 L;  4A3G H;  2Z1C A;  1E2V A;  1JQY D;  4BY7 H;  4OL7 A;  4MTK A;  1FD7 D;  1A3U A;  2M00 A;  3S1N H;  1MHW C;  3PMF A;  2XNA C;  1G8Z D;  3S16 B;  1Y1V H;  3AYH B;  1I50 H;  1LT3 D;  4K14 A;  4KKT A;  5ELN A;  1ASZ A;  1HJP A;  1A3V A;  4X3U A;  1HNX Q;  1A8V A;  5LL6 S;  1TKW B;  1SFO B;  1DD2 A;  1DXM A;  4OON A;  2F0M A;  1Y1V G;  3J80 i;  2MJ8 A;  4PNY A;  4BY1 H;  3BZC A;  4PZ8 A;  3HOY G;  3KF6 A;  5JJZ A;  4KMU C;  3PO3 G;  4B3M L;  1TS4 A;  1D2B A;  4F8M A;  3G48 A;  1GUO A;  3CQZ B;  2BE5 C;  2F4I A;  3ULL A;  2Y0S G;  1SNP A;  2MO0 A;  3QOL A;  2EJF C;  1L0W A;  4A93 G;  3GV6 A;  4JI2 Q;  2F4V L;  4MTN A;  3S17 B;  4IPD A;  1CZW A;  3CCE A;  1Y1V B;  4IOC A;  1GHJ A;  3GTL H;  4JI5 Q;  2CW0 D;  3NBH B;  2VQF L;  2EVB A;  1OXX K;  1B8A A;  4IUV A;  1VQP A;  1JMC A;  4DV1 L;  5COR A;  1C0A A;  2B3G A;  3M85 A;  1QNK A;  4R4I A;  1STH A;  5C5L A;  4A3E B;  1ICF B;  4F7X A;  1SE3 A;  1U5K A;  2A6H C;  2C9O A;  5AFW A;  3T1H Q;  4C3J G;  2JA9 A;  5KND A;  1DON A;  2VS1 A;  3KLR A;  1SFO H;  1PDQ A;  2L15 A;  4WJW A;  5LMN L;  1VQM A;  3HOY H;  3PUX A;  3KJO A;  3FEW X;  4Y52 H;  2UUC Q;  4Q0F A;  4P75 A;  4Y7N B;  3HOU G;  1SYG A;  3BZK A;  4IUN A;  4AQY Q;  4ZK9 B;  2OTL A;  5JEA G;  1H9S A;  4OXP A;  3VDY A;  3A54 A;  4DV7 Q;  3S16 H;  3NEM A;  3RN5 A;  4I7Z C;  3Q22 A;  1I50 B;  4KD3 A;  2R6G A;  2JA5 H;  1Q1E A;  5IWA Q;  4R4C A;  3MFG A;  1VQ9 A;  3K5N A;  1BDO A;  4B3R Q;  2UXB Q;  4PMC A;  2EYO A;  3M4Q A;  3HOV B;  4B9X A;  5CV9 A;  2K03 A;  4J1M A;  2LY7 A;  2OTJ A;  3CF5 A;  1JIC A;  4CKB A;  2GVB A;  2CQA A;  1H95 A;  3D8G A;  2R7Z B;  3FP9 A;  1BCP C;  1CA6 A;  3K7A B;  1H9M A;  3HKZ B;  4CJ2 C;  3GTM B;  4LF6 L;  3OTO L;  1LT5 D;  3CMA A;  1PZJ D;  4X62 Q;  2F0O A;  1B3Q A;  1VQN A;  3K0X A;  1RF2 D;  1NR4 A;  1LTL A;  2OT2 A;  2OQK A;  1EL0 A;  4IJL A;  4FF1 A;  1V1Q A;  3J81 j;  1NMF A;  3UE1 A;  4JI8 L;  3T1Y L;  2ZXP A;  3E9I A;  4K2K A;  2F0S A;  3FPP A;  5G3L D;  1SNM A;  3TRE A;  4C2M H;  1UEA B;  4N8F A;  2FFK B;  2PW5 A;  1F9Q A;  1B1Z A;  5IP7 G;  3CAM A;  2IJ0 A;  1G2S A;  3EJI A;  3CRL C;  4HJA A;  1UUP A;  1EU3 A;  1KAA A;  1L0X B;  3CP0 A;  3QOJ A;  1YI2 A;  4X64 L;  1EY9 A;  1ASY A;  2X6G A;  3OSO A;  4RKL A;  1FGU A;  1GXD C;  3M7N A;  1JE4 A;  1HZB A;  2CHB D;  2B2W A;  3EN2 A;  1SND A;  3QB3 A;  3PIP 3;  1LAC A;  3K7A H;  1CM9 A;  1PFS A;  2N55 A;  3HEJ A;  4QUF A;  3DLL A;  1OXT A;  1LTA D;  3KF8 B;  3T1Y Q;  1U4M A;  4KKU A;  5EKK A;  1YBY A;  5EAY A;  2IL8 A;  1TVX A;  2RKS A;  1CI3 M;  4KTA A;  4NB3 A;  5IGF A;  5GAD C;  5C3E H;  4BBS G;  3UDG A;  4DR2 L;  3J81 i;  4QJF A;  3K0Y A;  3RLF A;  1F9P A;  2E2H H;  1UNS A;  2WIN B;  2K05 A;  3I90 A;  5COY A;  1FR3 A;  1YEZ A;  4K0K Q;  3GTO B;  3KF6 B;  5CV6 A;  4Y7N H;  1XMO Q;  3CXC A;  1PRT D;  1E22 A;  1A6X A;  1EYC A;  3J80 L;  2R7D A;  5I9P A;  1IKM A;  1HZC A;  1I3Q B;  3D4D A;  4C3H H;  2F0L A;  3MXU A;  2PPB C;  4C56 C;  1WCM H;  1PH7 A;  5K36 G;  2KHI A;  3RZO H;  1I6V C;  1O78 A;  1PH5 A;  4IUQ A;  3STB D;  5IOC A;  2K1B A;  3LX0 A;  1Q3L A;  1DJR D;  2PZT A;  3TZD A;  1BVS A;  1MBY A;  1SLJ A;  1V8Q A;  3SEB A;  3J7A F;  3A8I E;  4LUV A;  2JA6 B;  4AIM A;  4KJN A;  1EYA A;  1LO5 D;  1STN A;  4LFC Q;  2NVY B;  2QDL A;  1WYD A;  4H7B A;  1SNO A;  1VF5 C;  2QEX A;  1IBM L;  1RJT A;  1C7Y A;  3PCO B;  3L0O A;  2CW0 C;  1I3Q H;  5J3B A;  1TWA B;  2B8F A;  2M2L A;  2MQH A;  2UXC Q;  4R4O A;  4HJ7 A;  2K5N A;  1GJX A;  1PFN A;  4K6L A;  5IGB A;  5JEA J;  4CDD C;  1J6Q A;  3N52 A;  1TR5 A;  1N8R C;  1TS2 A;  4BY7 G;  1VQG A;  1ZEQ X;  2UUB L;  3HFZ B;  1L1O C;  5C4Z A;  1STE A;  5LHY 1;  3SK6 A;  2WII B;  4FYD A;  4C3I G;  2HCI A;  4XDX A;  1EY0 A;  4IUU A;  4RFB A;  4BBR B;  4BY7 B;  1M90 C;  2E2I B;  2PYK A;  2D62 A;  3DM1 A;  2B8G A;  4J8Q A;  4DN4 M;  1EYD A;  3FMC A;  3ZYY X;  2Q2I A;  5KYI A;  2CCZ A;  4I7A A;  3D6W A;  4RA8 A;  1XNR L;  1IYV A;  5J1Z A;  5FJ8 G;  1HNW Q;  3T56 B;  3Q23 A;  3W1B A;  1S40 A;  1PTO H;  1K28 A;  1UAP A;  4XYQ A;  4DK6 C;  1VF7 A;  1QG7 A;  3QIA A;  5IP9 G;  3Q6S A;  2EJG C;  2B39 A;  2IT1 A;  3T16 A;  2CVR A;  1GUT A;  1VQK A;  3GTG H;  4DR6 Q;  3FKI G;  4O2D A;  1IBL Q;  1LT4 D;  1X3Q A;  1SR3 A;  1AW7 A;  1B7Y B;  1KDC A;  4YCU A;  1VQF A;  1UE6 A;  3UE0 A;  3S1M B;  4LF6 Q;  3HOX B;  4DR3 L;  1Y69 U;  2ZTC A;  1EZ6 A;  3F2D A;  4LFB Q;  3OMG A;  4ID6 A;  4A75 A;  2F0N A;  1MSG A;  3NK9 A;  3TBI B;  3R2T A;  2DUD A;  1EY8 A;  4RCO A;  1Q90 A;  4JI6 Q;  5I2X A;  1NY4 A;  2K7V A;  3PSI A;  2VUM G;  2KEC A;  3L3O C;  2HIX A;  3HOX G;  1PLF A;  4OHJ A;  1X55 A;  2KCN A;  4WRD A;  2LKV A;  2EY1 A;  3OWE B;  3UDI A;  4NP5 A;  1HQR D;  1ET6 A;  2PW7 A;  1WTH A;  2C5C A;  1I6H H;  4A3E G;  4IFD I;  4UP9 A;  4RMF A;  1PH8 A;  1QVG A;  3FHW A;  1T9H A;  4JBW A;  1ICW A;  1PVO A;  4GLX A;  1Y14 B;  4PZ7 A;  1SYC A;  5CMD A;  3P20 A;  5IIF A;  1EIG A;  2A6H D;  1PH6 A;  4UAI A;  1VQ4 A;  4C3I B;  3S1R B;  2NN6 H;  1J5E Q;  3FVQ A;  1J8I A;  1H9J A;  1EEF D;  4G7Z C;  4RCN A;  5BN4 A;  5IY0 A;  3WOE A;  2PNR C;  1MI2 A;  1D1I A;  2E5L L;  5H1S E;  1NMG A;  1CK1 A;  4DV5 Q;  2F0T A;  1K0R A;  2VL6 A;  2TSS A;  1U4R A;  5AJ3 L;  3ERO A;  5M3F B;  4JV5 L;  2BOS A;  1CZG A;  4YWM A;  2I5L X;  5HY6 A;  2SOB A;  3GO5 A;  4DV3 L;  2JA7 B;  3ICE A;  4X3T A;  1YNX A;  4HAE A;  1FVI A;  2L55 A;  2B2V A;  2WKC A;  3SDZ A;  1QCB D;  1SYB A;  2R7F A;  1JJG A;  2K5V A;  4LWC A;  4FF3 A;  2X69 A;  5C6A A;  3HKZ E;  3PO2 B;  4KY6 A;  2Q2T A;  3PV0 A;  3J81 L;  5CBA E;  4GN3 B;  4X6A H;  4EQO A;  2HCC A;  3GTJ H;  3RUZ A;  4A93 H;  2KEE A;  2SNM A;  1CKM A;  3K80 C;  3GTO H;  2GVA A;  1QOH A;  1CT1 D;  1KNA A;  1M8A A;  2KEN A;  2OEO A;  2F0F A;  3L2P A;  1PTO B;  3TZU A;  1PZK D;  5ELB A;  4V19 0;  3I91 A;  4O42 A;  1GVP A;  3RLO A;  4GKJ Q;  3JC6 6;  1EWI A;  4JVZ A;  1DCZ A;  3MEF A;  3SVM A;  2EQS A;  4HCS A;  4KN4 C;  4P73 A;  1XJV A;  1B4O A;  1LTB D;  3DHQ A;  4LMQ D;  2DNE A;  1CKO A;  3S9W A;  3S1Q B;  1UE1 A;  2IW3 A;  5K5P A;  3IFT A;  4C1N K;  4GLA C;  1LT6 D;  2UUA L;  1D5Z C;  2XRQ D;  4RGO S;  3T1H L;  4FF4 A;  3Q8D A;  1X9N A;  4GNX C;  1WTQ A;  1R9T H;  3TS2 A;  5LMN Q;  2OWO A;  4R9W A;  5HUR A;  2IPK D;  2JE6 I;  3I56 A;  3S2H H;  5M3M H;  1ILQ A;  5CV7 A;  4RGN A;  2R92 B;  2N3S A;  2A68 C;  4NXN Q;  1EUJ A;  1WTP A;  2FXQ A;  4BA2 I;  4A3B B;  4FO2 A;  2F03 A;  5KEE A;  2YYZ A;  4DR7 L;  2B2Y C;  2FIN B;  2ENB A;  3WOF A;  1K3R A;  1PTO C;  1E0B A;  4ZQ3 A;  1Q46 A;  1E3P A;  3H0G G;  5EJW A;  5JPN C;  3VR3 A;  1TS5 A;  2I5H A;  4B3M Q;  4FXG C;  1DGS A;  2E74 C;  3W2D A;  4B3S L;  2UU9 L;  4OGQ C;  5M5W B;  3PUZ A;  4KK7 A;  1VMP A;  4JBM A;  1XWE A;  3NQI A;  4ABN A;  1JWM D;  1CA5 A;  2JXM B;  3MXN B;  3AMU A;  3K5O A;  3K5M A;  4KHP L;  3STB C;  3T53 B;  2UUB Q;  3Q24 A;  2QGQ A;  1KXL A;  3OTO Q;  1I4X A;  1NCV A;  3E9H A;  1YNN C;  4IFD H;  3PF4 A;  1R9T B;  1VQ5 A;  3HOW H;  5LL6 X;  4A3C G;  1B2T A;  1I4R A;  2PNH A;  1Z6H A;  2RF4 A;  3PO2 H;  1QWY A;  1EFW A;  1P8L A;  2LMC B;  2OCE A;  2B29 A;  1G91 A;  4S3S A;  3IKJ A;  5C0X I;  1LAB A;  4DV1 Q;  3BVM A;  1HNW L;  4IPH A;  2HT1 A;  4G7O C;  3HOY B;  3LGJ A;  2JA7 H;  2F0G A;  2XWJ B;  1Y8N B;  2RCN A;  4OO1 H;  4JK1 C;  3BDO A;  5CV8 A;  2Y0S B;  4UP8 A;  2F3W A;  4LFA Q;  1K73 C;  3AEV A;  4KN7 C;  3KBX A;  4OIJ A;  4A93 B;  4DFA A;  2EE1 A;  1N33 L;  2B2W C;  4P74 A;  2MP1 A;  1RIP A;  1Q7Y C;  1YNJ D;  3S14 H;  2A8V A;  2QIL A;  1UE7 A;  3W1G A;  4DK1 A;  1ENF A;  1TY0 A;  3U50 C;  1QZG A;  3HOZ H;  3UDX A;  3I55 A;  3CC7 A;  4BY1 B;  1XTC D;  3F2C A;  3RR5 A;  5FO8 B;  1VQL A;  4JYA Q;  1PH2 A;  5M5X H;  3M3Y H;  3NWT A;  2NYZ D;  3J80 E;  1KL9 A;  1KD1 C;  4K0K L;  1AZQ A;  2F3I A;  4PMW A;  3CD6 A;  4P2C B;  1Q82 C;  1FJG Q;  3CPW A;  1D1K A;  1VQ6 A;  4LFA L;  3CW2 C;  3EA6 A;  4JI2 L;  4NDX A;  2KQ3 A;  2B2U A;  1GUN A;  1OO9 B;  4X65 Q;  2EDG A;  3MEH A;  2BDO A;  2VZA A;  1KQS A;  1WD0 A;  2PMZ B;  1V43 A;  1D5X C;  1JOO A;  4HIK A;  2IWH A;  3J7Y W;  1Z7T A;  1EWC A;  5ELF A;  1N36 Q;  1C4Q A;  4LF9 Q;  1XTD A;  1E2W A;  4GOP A;  2K28 A;  4DNT B;  4HSV A;  2K4K A;  2PZU A;  2RCF A;  4IPG A;  1ML0 D;  2XVS A;  4U68 A;  2HDL A;  1E1O A;  5JEA H;  4L5Q A;  3F2B A;  3K58 A;  1KDB A;  5ELD A;  2XIW A;  2ZJQ A;  2VUM B;  1EFI D;  3ULJ A;  1K83 H;  3MA2 B;  5A35 A;  5I4D A;  1DOL A;  1VS0 A;  3S15 B;  2MFI A;  3GTJ B;  4JI8 Q;  2MPM A;  2NVX H;  3GV3 A;  3JAM E;  1L2F A;  2MNA A;  1XMQ Q;  4LFB L;  1JWS D;  3GDE A;  4A3L H;  1I94 L;  2L1B A;  4FXK C;  4A3G B;  4K5V A;  1EQR A;  2JQO A;  3S1R H;  2L9H A;  5JPM C;  3RNU A;  2VQE L;  3BZD B;  1M4V A;  5I6W A;  3I4N G;  2K5D A;  4H0L C;  2K14 A;  2NTT A;  2NUC A;  1KRS A;  3I3C A;  1A63 A;  2B2T C;  1Y8P B;  1EY5 A;  1HTP A;  2IX0 A;  4JOI A;  1ZYR C;  3RN2 A;  3R2I A;  1IKL A;  4A3B H;  1GUS A;  1RKN A;  5EQ0 A;  4YY3 Q;  2VQF Q;  4GNX B;  4A3C H;  1MSH A;  1NJI C;  2R92 H;  1ET9 A;  1SAP A;  4EQP A;  3S15 H;  4CHT B;  4A3F B;  4G4K A;  1PH4 A;  5EPL A;  4R8N A;  1H9K A;  1CUK A;  4LK1 C;  5EPJ A;  4LF4 Q;  1T5X D;  3FKI B;  5DM7 3;  5IGE A;  2OF1 A;  1S5E D;  1Y1W H;  1VQB A;  1R4Q B;  2NN6 I;  1PH1 A;  4KLK A;  5DLQ E;  1QE6 A;  3S2D H;  3J81 E;  2H4O A;  3D3R A;  4BBR H;  1PRT C;  2SEB D;  3H15 A;  1HQM C;  2L12 A;  2BA0 A;  4L6T B;  2K01 A;  4J15 A;  4JCV E;  1TQO A;  1TWC H;  3FKI H;  4POG A;  2WAC A;  4DR3 Q;  1Q81 C;  3NXW A;  2CH4 A;  3SHL A;  1O7Y A;  2R93 G;  3PIP A;  1S5D D;  4A3D B;  5FOB B;  1IHZ A;  3VYS A;  4PZ6 A;  3C3L A;  2E76 C;  1MKH A;  1CQV A;  4ZUJ A;  3HOZ G;  4DR5 Q;  5FLX c;  1Q1B A;  2ZJP A;  4HTH A;  2Z6B A;  2QCP X;  1K8A C;  4JBJ A;  1GKH A;  5IYB G;  4HIM A;  1SYE A;  2WB1 E;  3C1F A;  3SK5 A;  1AEX A;  4R4T A;  1JCK B;  5M5W H;  3ZJY C;  3WWV A;  4A3M B;  1IBM Q;  3SGI A;  1N34 L;  2JP1 A;  1UEB A;  1D8L A;  2EY2 A;  4X62 L;  2JEB I;  4CKC A;  3KYH C;  2NBF A;  5KGU A;  4R4Q A;  2Z4H A;  5CBE E;  4CJ0 B;  1CSQ A;  3M4O B;  1E1T A;  1EIY B;  1RL2 A;  2IHE A;  4DK3 C;  3D6C A;  2WB1 B;  2NVY H;  4JI5 L;  1S5F D;  1TU2 B;  2AQ2 B;  3J80 c;  1BBW A;  2PCF B;  3I4N B;  2Q8R E;  4A3D H;  2RHS B;  3E5S A;  1MGS A;  5C3E B;  2C35 B;  1W6J A;  1VQH A;  2K5Q A;  3I7F A;  3BU2 A;  4TSS A;  5IYC G;  5ISR A;  3K7U C;  5KYL A;  5J22 A;  2A5H A;  2E75 C;  2HD3 A;  3ONA B;  1FNV A;  1GM5 A;  4JYA L;  2AHO B;  2CWP A;  2E8G A;  1HNX L;  2WB1 G;  4LUZ A;  4JBK A;  4GN4 B;  1GOZ A;  2UUA Q;  3G71 A;  3D4R A;  5JOB A;  1S5B D;  3H0G B;  5BR8 Q;  2J7Z A;  2FJ2 A;  4A3I B;  1TWA H;  3RLN A;  1QVC A;  2K04 A;  5IYC H;  1SN8 A;  3KLS X;  3JAM L;  4FVM A;  1U4P A;  1N33 Q;  4DGZ A;  3DWQ A;  1LLR D;  1O7I A;  1JWU D;  2RA4 A;  1X56 A;  1RCV D;  1AH9 A;  3LNN A;  1I6H B;  1SNQ A;  2R3Z A;  2I46 A;  2F0J A;  4XIG S;  4FF2 A;  1E2Z A;  3VR4 A;  2WFW A;  4DAM A;  2KJX A;  5L37 A;  2JA6 G;  5C44 G;  1G29 1;  1YNJ C;  4OEL B;  3BYY B;  4A3I G;  4HMI A;  2XTI A;  1WOC A;  4LUO A;  1E24 A;  2ICI A;  3RZD B;  3TQY A;  4DXG A;  3ER0 A;  4A3K H;  4EVO A;  2G9H D;  2XN9 C;  1SJE D;  3GTP B;  2A6E D;  1B50 A;  3HOZ B;  2XWB B;  4L5R C;  3KDF A;  1Z47 A;  1CHP D;  5G3L F;  1FNU A;  3FPU B;  3U9S A;  4DV0 Q;  3H94 A;  4XXE A;  5C4J H;  1RHP A;  1JB7 A;  1HZ9 A;  1EEI D;  3OHX C;  3I4L A;  4M8A A;  3R93 A;  2NVX B;  2EY5 A;  3MFY A;  2EYJ A;  4ZCK A;  1K9M C;  4HID A;  1CSP A;  1YIJ A;  2GN5 A;  4KJO A;  5FO7 B;  3MXG A;  1S3O A;  3TEH B;  5M5Y H;  3W5O A;  1YJN A;  4J6H A;  2NN6 G;  1EOT A;  4RWS C;  4QF4 A;  4UPA A;  2EIF A;  3OMC A;  3F1Z A;  1ONL A;  2YTX A;  5A2Q E;  1E7Z A;  3T13 A;  2F0D A;  4OWX B;  4DR7 Q;  3VA7 A;  1DOM A;  2A19 A;  1G6P A;  1G51 A;  1PYB A;  3KLW A;  2JN4 A;  5CC4 A;  4G7H C;  2EYH A;  5IGC A;  1EY7 A;  2R7Z G;  1VMC A;  3PQI A;  3NTK A;  4XTC S;  1SDF A;  1WTV A;  2BA1 A;  3VR6 A;  3C2P A;  1LM0 A;  3ERQ A;  2LSS A;  1IW7 C;  4DU9 A;  2BE5 D;  1IYU A;  4LJZ C;  4K5X A;  2A69 D;  3NWS A;  2K75 A;  1W6K A;  2F0H A;  4IUP A;  4LFC L;  1B9M A;  2YV5 A;  2X6L A;  5CYU A;  1I4Q A;  2NVQ B;  4C3J H;  1SXT A;  3GTM H;  1PTO D;  4A3L G;  3CCL A;  3PUY A;  1NAP A;  1NSN S;  1RDP D;  2DJG C;  3FRP B;  5C4X B;  2R7Z H;  4C1N I;  4DUZ L;  1N32 L;  3EBE A;  5A2Q L;  3ULP A;  4HR7 B;  4X66 L;  1OXU A;  4CDC C;  5FLX E;  3Q0A A;  3OPO A;  4RAU C;  4ALP A;  4A3J G;  1K83 B;  1LTI D;  1XPU A;  3GTL B;  1PH3 A;  4FP5 D;  2Q2U A;  3PO3 B;  2HQE A;  5C4X G;  5EBC A;  3A5U A;  4LW1 A;  1ENC A;  4YWL A;  1AZP A;  1HR0 L;  4BY1 G;  1XPR A;  5GQO A;  4LF8 L;  2D2C C;  2DN8 A;  3D0F A;  4YIJ A;  2M9V A;  3E0E A;  4U67 3;  4OO1 I;  2NB0 A;  2LS0 1;  3U9O A;  2AQ3 B;  4QGU A;  2E2J H;  2JA8 G;  3HOV H;  3BDL A;  1WTO A;  4EX5 A;  4YY3 L;  1EIH A;  3S14 B;  1HR0 W;  4DAY B;  1PYS B;  1QUQ A;  4A3J H;  1R4P B;  2J4X A;  4X3K A;  3TP5 A;  4DV2 L;  3G4S A;  4H13 C;  2IY5 B;  4YWK A;  4DAV A;  2IHF A;  4HMJ A;  4GKJ L;  4IO9 A;  1K0S A;  3OOC A;  4MIU A;  1HFG A;  1L1O A;  4F87 A;  1I4P A;  4HIO A;  3QJY A;  2A68 D;  3NBI A;  4B3S Q;  3IL8 A;  4XT3 B;  1HA6 A;  3KDF B;  4KI0 A;  5CGK A;  4FNF A;  3K81 C;  3KUP A;  2EYF A;  3DUZ A;  1I94 Q;  1HCZ A;  2EXD A;  4MN3 A;  2EYL A;  2N8N A;  2KA7 A;  1YHQ A;  1W3S A;  2F0P A;  3PGZ A;  1FGB D;  5HGT A;  3NPP A;  4RHR A;  2VW9 A;  4DR1 Q;  2QKI C;  3L7Z C;  3JAM c;  2JA8 H;  3HOV G;  4LNQ A;  3OW2 A;  1B44 D;  4CDE C;  3PO2 G;  2NVT B;  3I2Z A;  2D9U A;  3NTI A;  2Z0S A;  4ZUI A;  3MVV A;  1VQA A;  3L9A X;  1EQT A;  3HKZ G;  2RHQ B;  5FO9 B;  2VY3 A;  1BOS A;  5AJ3 Q;  4JV5 Q;  4H02 A;  3S17 H;  4C2M B;  1Q8K A;  5KNC A;  5C5M A;  5M3M B;  5FLM H;  3CC2 A;  1X3F A;  3NHH A;  4GOP C;  3QR8 A;  1YJ9 A;  1A3T A;  4ZAI A;  1PTO F;  2ATW A;  1MJC A;  4C3I H;  3RZO B;  2HQL A;  2VQE Q;  2Z6K C;  3UDF A;  1JC7 A;  1X3G A;  1HHV A;  2RBM A;  4NW2 A;  5IGD A;  4CBV A;  3DXJ C;  1HFN A;  2EXZ A;  5IT9 E;  4WFN 3;  3R3O A;  2NVQ H;  1CQF A;  1M1K C;  2KBN A;  2LXK A;  4NMZ A;  1TWF H;  3GTQ H;  4IOA A;  5LMU Q;  2QDB A;  1Q86 C;  2JEA I;  1A2U A;  3CC4 A;  1VQD A;  2B63 G;  2ZXR A;  2IX1 A;  4RGT A;  1X32 A;  2CWA A;  2KHS A;  3RMH A;  5C0X H;  1DZ1 A;  3I4O A;  1O7L A;  4GLV B;  2WKD A;  1KIX A;  5IYD G;  3P75 A;  1PYW D;  3X3N A;  4K8I A;  3SK8 A;  2JA5 B;  1U0L A;  4JI7 L;  3MC0 B;  3TP7 A;  1LYL A;  2HDM A;  5IYB H;  1STG A;  3DM3 A;  2N78 A;  2H5X A;  4ME3 A;  1B9N A;  3DEO A;  2AWN A;  4POF A;  1IXR A;  2AQ1 B;  1OXV A;  4HJ5 A;  3MHB A;  2XSC A;  4DUY Q;  2MUY A;  2QF7 A;  5IOD A;  3H3V C;  3H6M A;  4JI4 Q;  3KOJ A;  3URY A;  1TT2 A;  2ALY B;  1D6E C;  1F9R A;  3VYU A;  2XRS D;  3NTH A;  3VYR A;  4DV2 Q;  2K5W A;  4QCL A;  4DR4 Q;  3M4P A;  1FJG L;  4JI0 Q;  2CFM A;  1WVL A;  1JOR A;  3MTS A;  2MGS A;  3I72 A;  3GTK H;  1VQC A;  1YNN D;  1IBK Q;  4O1N A;  1XMQ L;  3VR5 A;  1HTL D;  2TMP A;  3S2H B;  3WDN A;  3D31 A;  4RHS A;  1GHK A;  2F52 A;  3CU7 A;  1H9S B;  2DY8 A;  1V9P A;  1D7Q A;  2WV6 D;  1Y1W G;  1SYD A;  4GS3 A;  1TWC B;  4IFD G;  1PXU A;  1AFP A;  1Z9F A;  2NWG A;  2NZ1 D;  4CKE A;  1HA5 A;  1STB A;  5IP9 H;  1VCI A;  3AFQ A;  2AKW B;  1A2T A;  2F0Q A;  2R61 A;  4P71 A;  3RZD H;  1FNW A;  3I73 A;  2EZV A;  2QW7 A;  4EQ5 A;  2A69 C;  4PMB A;  3ERS X;  2FHT A;  2UUC L;  1IZ6 A;  3ITP A;  4JW0 A;  1IW7 D;  1GO3 E;  4MHE A;  1PFB A;  1Y1W B;  2YU9 B;  4KY5 A;  2JK8 A;  1YHA A;  3R8B A;  5FK9 C;  3MXP A;  4ZYS A;  2PI2 A;  3I4N H;  2L0C A;  1VQ7 A;  4HJ8 A;  1KDA A;  2Q8T A;  1PRT B;  1BCP B; 
#chains in the Genus database with same CATH homology
 1TWC H;  4A3I H;  2I0Q A;  3FKI H;  4B3T L;  4POG A;  4MNO A;  4DR3 Q;  1Q81 C;  5JJI A;  1KC8 C;  4MZ9 A;  2R93 G;  4X65 L;  3PIP A;  1M90 C;  2QA4 A;  2D62 A;  2NZH A;  4DUZ Q;  4GN5 A;  2JA5 H;  4PZ6 A;  1N32 Q;  1MKH A;  3JAM i;  5GAG C;  1YVC A;  3HOZ G;  5E7N A;  3G6E A;  4DR5 Q;  3H3V I;  1QVF A;  2Q2I A;  2CCZ A;  5FLX c;  1HNZ Q;  1TWG H;  1Q1B A;  2ASB A;  2ZJP A;  1EIF A;  4YHH Q;  1K8A C;  4JBJ A;  1GKH A;  5IYB G;  3CCS A;  4HIM A;  1XNR L;  5M3F H;  2WB1 E;  2VNU D;  2V1C C;  5FJ8 G;  4R4T A;  1HNW Q;  5M5W H;  5FLM G;  5IWA L;  3ZJY C;  3W1B A;  3WWV A;  1S40 A;  4LF5 L;  2CKZ B;  4JI3 L;  1IBM Q;  1IL2 A;  3SGI A;  1N34 L;  1PHJ A;  4DK6 C;  4DV3 Q;  1UEB A;  1D8L A;  4X62 L;  1HR0 Q;  3HKS A;  2JEB I;  5IP9 G;  2K52 A;  3CCM A;  2PQA A;  3CME A;  3KYH C;  4JG2 A;  2LXJ A;  2IT1 A;  2MO1 A;  1HH2 P;  1VQK A;  3GTG H;  4R4Q A;  4DR6 Q;  3FKI G;  2IY5 B;  4O2D A;  1IBL Q;  2YTV A;  4KHZ A;  1CSQ A;  1KAW A;  1SR3 A;  1E1T A;  1B7Y B;  4WJ4 A;  4YCU A;  1VQF A;  5GRO A;  1EIY B;  4JI0 L;  1UE6 A;  1RL2 A;  2IHE A;  2ZM6 Q;  4DK3 C;  3UE0 A;  4NXM L;  4A3G G;  2NVY H;  5C4X H;  2E5L Q;  4JI5 L;  4LF6 Q;  4GKK Q;  4DR3 L;  3I4M H;  1IYJ B;  3J80 c;  1BBW A;  3CCU A;  2ZTC A;  3F2D A;  2RHS B;  4A3D H;  4LFB Q;  5JJK A;  3A5Z B;  3AQQ A;  4A75 A;  2XGT A;  4JI4 L;  4AYB E;  5C44 H;  3GTP H;  2HHH Q;  2C35 B;  2JA5 G;  4IPC A;  3IRB A;  1VQH A;  1WI5 A;  3I7F A;  3BU2 A;  1VQI A;  4P72 A;  4KHP Q;  5IYC G;  2DUD A;  2OQ0 A;  3K7U C;  2Y0S E;  1X6O A;  4B3R L;  2UXB L;  2K50 A;  4JI6 Q;  2WAQ E;  1NY4 A;  2JA7 G;  1GM5 A;  3PSI A;  1NBW A;  2VUM G;  3HOU H;  2AHO B;  2CWP A;  3HOW G;  2E8G A;  1UE5 A;  2HIX A;  2WB1 G;  4LUZ A;  1HNX L;  4GN4 B;  3HOX G;  2UUA Q;  4JBK A;  3G71 A;  1X55 A;  4LF7 Q;  3S1Q H;  3UDI A;  5BR8 Q;  3U4Z A;  1TWA H;  3RLN A;  2WAQ G;  3EIV A;  1QVC A;  4DR6 L;  5IYC H;  1BBU A;  1SN8 A;  2YTY A;  1HNZ L;  4QQB X;  4HJ9 A;  1N33 Q;  1I6H H;  4A3E G;  1O7I A;  4UP9 A;  4IFD I;  4RMF A;  1X56 A;  2BH8 A;  1PH8 A;  1VQE A;  1AH9 A;  1QVG A;  3FHW A;  1P16 A;  1T9H A;  3KJP A;  4JBW A;  4XIG S;  2BH2 A;  4DR2 Q;  3PUW A;  3M9B A;  1PVO A;  4GLX A;  2HHH L;  1Y14 B;  2WFW A;  4PZ7 A;  4DAM A;  2YU9 H;  2JA6 G;  5C44 G;  1G29 1;  3NEL A;  1BKB A;  1PH9 A;  3CCR A;  1PH6 A;  3H0G H;  4A3I G;  1WFQ A;  2B63 H;  4JC0 A;  2XTI A;  1WOC A;  1SRO A;  4LUO A;  4DV5 L;  2JJQ A;  1VQ4 A;  4LF9 L;  3M4O H;  1E24 A;  3B6Y A;  4AYB G;  1J5E Q;  4IFD J;  4OX9 Q;  3TQY A;  4QY7 A;  3PO3 H;  2UXD L;  3HOX H;  5IY0 A;  2I5M X;  1EOV A;  3ER0 A;  3J81 c;  4BBR G;  4A3K H;  1EYG A;  1CKN A;  4GKK L;  4RG1 A;  2E5L L;  2JA6 H;  1X65 A;  1B70 B;  5H1S E;  1VQO A;  1NMG A;  4L5R C;  4DV5 Q;  1K0R A;  2VL6 A;  3KDF A;  1Z47 A;  5AJ3 L;  4JV5 L;  4DV0 Q;  5FJ8 H;  2Q2H A;  4YWM A;  2I5L X;  5HY6 A;  2N49 A;  5C4J H;  1XNQ Q;  4NPS A;  1JB7 A;  1HZ9 A;  3GO5 A;  4DUY L;  4DV3 L;  2DGY A;  1N34 Q;  3ICE A;  4A3F H;  4DV7 L;  4YCV A;  4A3M G;  1YNX A;  1N36 L;  1FVI A;  1WCM G;  3PF5 A;  3U58 A;  1YIT A;  1K9M C;  4HID A;  1CSP A;  5C0X G;  1YIJ A;  2AMC B;  2GN5 A;  1XNR Q;  2R7F A;  1JJG A;  1S3O A;  2K5V A;  4BBS H;  3S24 A;  4LWC A;  3TEH B;  4A3B G;  1KRT A;  3HKZ E;  4TQU S;  5M5Y H;  4NXM Q;  3W5O A;  2Q2T A;  3PV0 A;  1YJN A;  4DR4 L;  4GN3 B;  1KHI A;  2NN6 G;  4X64 Q;  1L1O B;  4UP7 A;  1MIU A;  4X6A H;  3GTJ H;  3U4V A;  4A93 H;  4UPA A;  2EIF A;  2F4V Q;  2UXD Q;  1CKM A;  3K80 C;  1UWV A;  5LMU L;  3GTO H;  2GVA A;  3F1Z A;  4A3D G;  2D0P A;  2KEN A;  3HOZ H;  2HIV A;  2YTX A;  3PUV A;  3L2P A;  1E7Z A;  1NE3 A;  1IBL L;  3PIO A;  2A1A A;  4DV6 L;  4OWX B;  5C3E G;  4DR7 Q;  4DV0 L;  1GVP A;  3OYY A;  3RLO A;  2A19 A;  4A3G H;  4GKJ Q;  3JC6 6;  1G6P A;  4BY7 H;  1EWI A;  4NXN L;  1G51 A;  1PYB A;  3KLW A;  3I4M G;  3MEF A;  2R7Z G;  3S1N H;  2EQS A;  4P73 A;  1XJV A;  4XTC S;  2BA1 A;  4JI1 Q;  1CKO A;  2E2I H;  1JJC B;  1Y1V H;  3AYH B;  1LM0 A;  1UE1 A;  1VQJ A;  2LSS A;  1I50 H;  4A3E H;  5ELN A;  1ASZ A;  1HJP A;  4GLA C;  4R1J A;  2K75 A;  4OWT B;  2UUA L;  1HNX Q;  1A8V A;  4L5T A;  3T1H L;  3CCQ A;  4LFC L;  3Q8D A;  2YV5 A;  1X9N A;  4GNX C;  1R9T H;  3GD7 A;  3TS2 A;  1K8G A;  4OON A;  4DPG A;  5LMN Q;  2OWO A;  1Y1V G;  3J80 i;  2JE6 I;  4C3J H;  3I56 A;  3S2H H;  4BY1 H;  5M3M H;  4LF5 Q;  4BXX H;  3BZC A;  4PZ8 A;  3GTM H;  4A3L G;  2N3S A;  1AE3 A;  3KF6 A;  3PUY A;  3CCL A;  3HOY G;  4BA1 I;  4NXN Q;  1EUJ A;  3PO3 G;  4B3M L;  2R7Z H;  2FXQ A;  4BA2 I;  4DR7 L;  3G48 A;  2YYZ A;  4DUZ L;  1N32 L;  3EBE A;  1I5F A;  3ULL A;  2Y0S G;  3ULP A;  5HGQ A;  4X66 L;  1OXU A;  2MO0 A;  3KFU A;  1K3R A;  1L0W A;  1LUZ A;  4A93 G;  4JI1 L;  2NVT H;  4JI2 Q;  2F4V L;  4MTN A;  1Q46 A;  1E3P A;  4IPD A;  3H0G G;  3CCE A;  4IOC A;  3GTL H;  4BXX G;  4JI5 Q;  4ALP A;  4A3J G;  3NBH B;  2I5H A;  4B3M Q;  1JJ2 A;  4OX9 L;  1J5E L;  1DGS A;  3J7Z C;  2VQF L;  1XPU A;  1OXX K;  1B8A A;  1VQP A;  1JMC A;  4B3S L;  1PH3 A;  4DV1 L;  4DV6 Q;  2UU9 L;  1C0A A;  2Q2U A;  2B3G A;  3M85 A;  2UXC L;  5C4X G;  4R4I A;  3A5U A;  3CPF A;  3PUZ A;  4LW1 A;  4JBM A;  1U5K A;  4YWL A;  1HR0 L;  1C9O A;  4BY1 G;  5C0X J;  1XPR A;  3T1H Q;  5GQO A;  2JA9 A;  3AFP A;  1SMX A;  1TWH H;  3NEN A;  4LF8 L;  2VS1 A;  3MXN B;  1SFO H;  4KHP L;  3STB C;  2UUB Q;  2L15 A;  5LMN L;  3D0F A;  4DR1 L;  1VQM A;  2ES2 A;  3PUX A;  3KJO A;  3E0E A;  3HOY H;  2QGQ A;  4OO1 I;  5GAH C;  5IYD H;  1KXL A;  4Y52 H;  3CCV A;  5M3M G;  2UUC Q;  3OTO Q;  4P75 A;  3E9H A;  4QGU A;  2E2J H;  3PF4 A;  2JA8 G;  3HOV H;  1EQQ A;  1VQ5 A;  3BZK A;  2VUM H;  4EX5 A;  3K8A A;  4YY3 L;  4AQY Q;  3HOW H;  1HR0 W;  5JEA G;  4DAY B;  2OTL A;  4OXP A;  3VDY A;  4A3C G;  4DV7 Q;  4L5S A;  3S16 H;  2PNH A;  2RF4 A;  1S72 A;  5BR8 L;  3PO2 H;  1PYS B;  3NEM A;  1QUQ A;  3RN5 A;  4A3J H;  1YZ6 A;  1EFW A;  4B3T Q;  4DV2 L;  1P8L A;  3G4S A;  2OCE A;  2R6G A;  4GNX A;  4APV A;  1Q1E A;  2B29 A;  4R4C A;  4YWK A;  5IWA Q;  5C0X I;  1VQ9 A;  4DV1 Q;  4GKJ L;  2IHF A;  1HNW L;  4B3R Q;  2UXB Q;  4IO9 A;  3M4Q A;  3A74 A;  4IPH A;  2HT1 A;  4DNI A;  2D0O A;  1A0I A;  1L1O A;  2ZTE A;  3LGJ A;  5IE8 A;  5IP7 H;  4HIO A;  2JA7 H;  4B3S Q;  4JYA L;  2R93 H;  2OTJ A;  3CF5 A;  2RCN A;  2GVB A;  3KDF B;  3F8T A;  4KI0 A;  1H95 A;  3K81 C;  3FP9 A;  4UP8 A;  1I94 Q;  4LFA Q;  2EXD A;  1K73 C;  3AEV A;  2N8N A;  2ZM6 L;  1YHQ A;  4LF6 L;  2NZO A;  3OTO L;  1W3S A;  1N33 L;  3PGZ A;  3CMA A;  1JT8 A;  4P74 A;  3HOU G;  2PI2 E;  4AH6 A;  1RIP A;  1N9W A;  3CQZ H;  4X62 Q;  2VW9 A;  3L7Z C;  4DR1 Q;  4QL5 A;  3JAM c;  1Q7Y C;  2JA8 H;  3TS0 A;  4LNQ A;  3HOV G;  3S14 H;  3OW2 A;  2K5H A;  1VQN A;  2A8V A;  3K0X A;  3PO2 G;  4LF4 L;  3I2Z A;  1UE7 A;  1LTL A;  1XMO L;  3W1G A;  3U50 C;  2Z0S A;  2OQK A;  1QZG A;  2ZTD A;  4IJL A;  1V1Q A;  3J81 j;  1NMF A;  3UE1 A;  3UDX A;  3I55 A;  1VQA A;  4PG3 A;  3CC7 A;  4JI8 L;  5GAE C;  1OTC A;  3T1Y L;  3E9I A;  3HKZ G;  2RHQ B;  3F2C A;  1XNQ L;  3RR5 A;  3TRE A;  4C2M H;  4DV4 Q;  1VQL A;  1PH2 A;  4JYA Q;  2VY3 A;  5M5X H;  4A76 A;  5AJ3 Q;  3M3Y H;  4JV5 Q;  4H02 A;  4A3M H;  3S17 H;  1Q8K A;  2R92 G;  5IP7 G;  1KL9 A;  1YJW A;  1KD1 C;  4YCW A;  4K0K L;  3CAM A;  5FLM H;  2F3I A;  3CC2 A;  1X3F A;  4PMW A;  4GOP C;  1YJ9 A;  4OO1 G;  4JI7 Q;  3CD6 A;  2ATW A;  1MJC A;  1SRU A;  4C3I H;  4X66 Q;  4HJA A;  1Q82 C;  2HQL A;  2VQE Q;  3CPW A;  1FJG Q;  2Z6K C;  3UDF A;  1VQ6 A;  1GD7 A;  1X3G A;  4LFA L;  3CP0 A;  3CW2 C;  4JI2 L;  4GOP B;  1YI2 A;  4X64 L;  1ASY A;  4JI6 L;  4X65 Q;  1FGU A;  3M7N A;  1HZB A;  2VZA A;  4LF7 L;  1KQS A;  2NVQ H;  1V43 A;  4OWW B;  3EN2 A;  1M1K C;  1X3E A;  1AE2 A;  2KBN A;  2LXK A;  2ID0 A;  4WJ3 M;  1TWF H;  3K7A H;  3GTQ H;  4HIK A;  1PFS A;  3CCJ A;  4IOA A;  2KCM A;  5LMU Q;  1Q86 C;  2JEA I;  2Z6K A;  3CC4 A;  1VQD A;  1N36 Q;  2B63 G;  3DLL A;  1OXT A;  1PA6 A;  4LF9 Q;  2IX1 A;  2CWA A;  3KF8 B;  3T1Y Q;  4UY8 C;  1XTD A;  3I4O A;  4GOP A;  4GLV B;  1YBY A;  5EAY A;  5GAD C;  4NB3 A;  1KIX A;  1HZA A;  5C3E H;  5IT9 c;  5IYD G;  4BBS G;  3UDG A;  1QUQ B;  4DR2 L;  2K4K A;  3J81 i;  4QJF A;  4IPG A;  2KHJ A;  1XPO A;  1U0L A;  4QIW E;  3RLF A;  1PV4 A;  2E2H H;  4JI7 L;  1E1O A;  4TVA B;  1WJJ A;  4L5Q A;  3F2B A;  2PQA B;  3TRZ A;  3S1M H;  1YEZ A;  4K0K Q;  1LYL A;  5IYB H;  4FDB A;  3KF6 B;  2ZJQ A;  3DM3 A;  4Y7N H;  2N78 A;  3ULJ A;  1K83 H;  1XMO Q;  2H5X A;  3CXC A;  4ME3 A;  2AWN A;  1VS0 A;  4POF A;  1W2B A;  1IXR A;  1E22 A;  1Q12 A;  1JE5 A;  1OXV A;  2MFI A;  2R7D A;  4HJ5 A;  5JJL A;  1HZC A;  4JI8 Q;  4A3K G;  1NTG A;  4DUY Q;  2NVX H;  4C3H H;  2MNA A;  1L2F A;  1WCM H;  4JOI C;  1PH7 A;  5K36 G;  4IJH A;  1XMQ Q;  4JI4 Q;  4LFB L;  2KHI A;  3KOJ A;  1IBK L;  2ALY B;  3GDE A;  4A4I A;  3RZO H;  4A3L H;  1PH5 A;  1I94 L;  3STB D;  1EQR A;  4O0A A;  2JQO A;  4DV2 Q;  3S1R H;  3RNU A;  1TXY A;  1BVS A;  3M4P A;  1OXS C;  2VQE L;  1FJG L;  1SLJ A;  4DR4 Q;  4JI0 Q;  3I4N G;  2CFM A;  4LUV A;  4A3F G;  4AIM A;  2K14 A;  2AWO A;  3GTK H;  1KRS A;  1VQC A;  1MJE A;  1IBK Q;  4LF8 Q;  1XMQ L;  1A63 A;  1X54 A;  3D31 A;  4LFC Q;  2F52 A;  2KCT A;  2IX0 A;  1WYD A;  1V9P A;  4JOI A;  2CQO A;  3RN2 A;  1Y1W G;  1D7Q A;  2QEX A;  4GS3 A;  1IBM L;  4JI3 Q;  4IFD G;  1C7Y A;  4A3B H;  3PCO B;  1Z9F A;  3L0O A;  4YY3 Q;  4AQY L;  2VQF Q;  4GNX B;  4A3C H;  1I3Q H;  5IP9 H;  5J3B A;  1NJI C;  1VCI A;  2R92 H;  2MQH A;  3AFQ A;  2AKW B;  3S15 H;  2UXC Q;  4R4O A;  4P71 A;  2K5N A;  4YHH L;  4HJ7 A;  3RZD H;  1PH4 A;  1CUK A;  4LF4 Q;  4DR5 L;  5M3F G;  5JEA J;  3J7A 5;  5LMN W;  1J6Q A;  4EQ5 A;  1Y1W H;  1VQB A;  3ERS X;  2UUC L;  1IZ6 A;  1N8R C;  4BY7 G;  1GO3 E;  2NN6 I;  1PH1 A;  1VQG A;  4KLK A;  1QZH A;  3H3V H;  5DLQ E;  4DV4 L;  1A62 A;  1FL0 A;  2UUB L;  1YHB A;  2JK8 A;  1YHA A;  3HFZ B;  1L1O C;  3S2D H;  3BJU A;  4DKA C;  4BBR H;  1VQ8 A;  1SE8 A;  3H15 A;  5ELO A;  2UU9 Q;  2PI2 A;  1CKN B;  3I4N H;  2BA0 A;  2WP8 J;  2PMZ E;  1VQ7 A;  4HJ8 A;  3A0J A;  4J15 A;  4JCV E;  2ZJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...