1VQGA

Gene v protein mutant with ile 47 replaced by leu 47 (i47l)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
b'MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKLTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Potential use of additivity of mutational effects in simplifying protein engineering.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqgA00
4DV5L 4JI8Q 5FLMH 4LF8Q 5M5WH 1Q1BA 3M85A 1S72A 3HOYG 4JI2Q 3J7A5 1Y1VH 3PV0A 4A3FG 4OX9Q 2LXJA 1EOVA 2Q2HA 4IPHA 5M5YH 4DV1Q 4GKKL 4DR4L 1VQ5A 1X3GA 2ZM6L 5IY0A 3M7NA 1I5FA 4DUZL 2JA5G 1G51A 4HJ9A 3MXNB 4A3IG 1XNQQ 2UXDQ 2WFWA 1PYBA 4JG2A 5LMNQ 1A62A 1UEBA 3T1YQ 4GLVB 2UUAL 1A63A 1X6OA 4IFDJ 4HIDA 2JEAI 2QGQA 3M4QA 3PGZA 2D0PA 1XMOL 2K50A 5C3EH 3EIVA 1YVCA 2VQEL 4JBWA 3NENA 1P8LA 4J15A 1X54A 3CMEA 4B3MQ 4LF5Q 3S14H 1FL0A 1XMQQ 3F2DA 2K52A 3K81C 3RR5A 4YCVA 4DNIA 4JI1L 4GS3A 5JEAJ 3S1RH 2I5HA 3LGJA 1PYSB 1N36Q 1VQAA 2B3GA 4WJ3M 2HIVA 4DR6Q 1D8LA 1XJVA 1VQCA 4NXNL 3I56A 3TS0A 1E3PA 2E2HH 1HZBA 2JA9A 4H02A 2WP8J 5LMUL 2OTLA 1PH3A 5M3MG 2K4KA 4GOPB 1XTDA 3HOVH 3I7FA 3K7AH 3HOXG 2R7ZH 4DV7L 1BKBA 1HR0W 1VQ6A 3S16H 1YHBA 3T1HL 4JOIC 1QVGA 1G291 1XPOA 3M4PA 1HNZQ 3RLFA 2ZJPA 1HZAA 1VS0A 1W3SA 3RNUA 4POGA 3ULLA 2F52A 5ELOA 3F2CA 2IY5B 4XTCS 4DK3C 2VZAA 3U58A 1JB7A 5HY6A 3HOWG 2YTXA 3A0JA 1NJIC 3CQZH 5IWAL 4A3LG 3L0OA 4JI8L 1J5EQ 3KOJA 3JAMi 4LF7L 2B63H 4LF8L 4GOPA 1PVOA 4EX5A 2PMZE 4JI2L 5K36G 4OX9L 4MZ9A 2VY3A 3CCVA 4A3KH 1X9NA 5C0XI 5FLMG 4DV1L 2C35B 5GAHC 2AHOB 1X56A 1PA6A 1HR0Q 1VQJA 1Y1VG 2VQFQ 2KHJA 1JJGA 3KJOA 1VQNA 1WJJA 1XNQL 2UXDL 4JBJA 4IFDI 5LMNL 3T1YL 5H1SE 1E22A 3CAMA 3CC4A 2I5MX 2ATWA 1IXRA 4DV5Q 1VQOA 2UUBQ 3GTLH 3CD6A 1JE5A 4B3RQ 2R93H 1V9PA 4YWLA 4KI0A 2CWAA 4HJ7A 4JI6L 1SMXA 1K83H 4DR3L 4LF5L 4LWCA 4R1JA 1YITA 1YI2A 1PH5A 1KL9A 4A3GH 3VDYA 5C3EG 3KFUA 2KCTA 1M90C 2KCMA 1BBUA 3KF6B 4DPGA 1N36L 5C44H 5EAYA 1C7YA 3IRBA 4IOAA 4LUZA 5JJKA 4C3IH 3FKIH 4O0AA 3L7ZC 1TWGH 4FDBA 3RLOA 5C4JH 1B7YB 4UP9A 1ASYA 3TRZA 4R4IA 4UP7A 4PZ7A 5FLXc 3RN5A 4DKAC 2D0OA 3CPWA 3J80i 3HOVG 4DV0L 1HNZL 4NXML 1KC8C 3CW2C 4OO1I 4PMWA 2R7ZG 3PO2H 5C0XG 4UP8A 2I0QA 3F1ZA 4GOPC 2YTYA 1SROA 2F3IA 4R4TA 3I55A 4DV6Q 4NXNQ 1ASZA 4JI4L 1KHIA 4QL5A 1K0RA 5IP9H 4ME3A 3CMAA 4IFDG 2JE6I 2OCEA 2PNHA 3HKZG 1J5EL 3ERSX 4AYBE 4BA2I 1VQBA 4A3MH 1G6PA 4L5TA 2R6GA 1EFWA 2UXCQ 1E1TA 3ZJYC 3FP9A 2HQLA 3I2ZA 1L0WA 3T1HQ 2E2IH 4DUYL 2KENA 2BA1A 1Q46A 4LNQA 3UDFA 1HR0L 2VQFL 4YY3L 4A3CH 4JI5Q 3HKZE 2ID0A 1GVPA 1PH7A 1KXLA 1OXTA 3CF5A 1PH9A 1K9MC 5IWAQ 2UUBL 3I4NH 4DK6C 2ZTEA 4LF7Q 4B3RL 3OYYA 4TVAB 2E8GA 1QZGA 3FHWA 3RLNA 2NVQH 1HZ9A 2QEXA 2Q2TA 3WWVA 4BY1H 2DUDA 4BBRH 4P74A 3G71A 3H3VH 3PIOA 2R93G 4JI7Q 1RL2A 1OXXK 2H5XA 5IYCH 1YHQA 4GNXC 4A93H 2L15A 5C4XH 4OO1G 4A3GG 4LF6Q 3E9HA 4OWWB 3B6YA 2E5LQ 1WYDA 2V1CC 1Q86C 4P75A 5C44G 3M9BA 4DR1Q 1I6HH 4X6AH 1A8VA 4A4IA 2B29A 4JI6Q 4X65Q 4DR3Q 1Y14B 3PUWA 1EYGA 1VQLA 3FKIG 4BXXH 1CUKA 1A0IA 5IYBH 3H15A 2F4VQ 5GADC 1VQFA 1JJCB 3H3VI 1GM5A 3BZCA 5J3BA 3A5UA 4YCWA 4PZ6A 5IT9c 1HH2P 2K75A 3UDGA 1QVFA 4DV6L 3S2DH 4K0KQ 1SN8A 3PO2G 4GN4B 4A3DH 3S15H 3I4OA 4Y52H 2PI2A 1AH9A 2JA8H 3NELA 4HIKA 2UUCQ 1PFSA 3UDXA 1TWCH 2UXCL 5IP9G 1OXSC 3W1GA 1N8RC 3KLWA 4QIWE 1JT8A 4DV0Q 1BVSA 4A3MG 4NXMQ 2HT1A 2PI2E 1QVCA 2CFMA 3PSIA 2BH8A 4JI5L 3JAMc 1HNXQ 5GROA 2N49A 4IOCA 4GN3B 2WAQG 4JI4Q 4DR5Q 1B70B 4DV2Q 1XPRA 2EXDA 4UPAA 3OTOQ 1YJWA 4A3CG 1K8GA 2JA6H 2A1AA 3W1BA 4POFA 2UU9Q 4JC0A 4LFBQ 2OTJA 4L5SA 3J81j 4PZ8A 1EWIA 3Q8DA 3EBEA 3K7UC 3TQYA 1IBMQ 3I4NG 4DUYQ 1IZ6A 1K73C 4BY7H 4JI7L 4YY3Q 3ULPA 4R4OA 1WI5A 4DAYB 2WB1G 1YNXA 1VQ8A 4YCUA 3GTKH 3NEMA 5M3FH 3A74A 4BBRG 4LF6L 3J81i 3PIPA 3RZOH 1V43A 4JI3Q 2E5LL 5IYCG 4GNXB 4A93G 1VQ4A 1UE5A 3H0GH 3K0XA 4DR1L 1YEZA 1CSQA 2EIFA 3AFPA 4LUVA 4P71A 4P72A 5C4XG 3PUZA 1WOCA 4X65L 2WB1E 1N32Q 1VQEA 1WCMH 1SE8A 1C0AA 4Y7NH 2F4VL 3EN2A 4QY7A 4L5RC 1X55A 1W2BA 3S1QH 1PV4A 4DR4Q 2FXQA 2NVXH 3UE0A 1PH6A 1VQDA 1I50H 1GO3E 5IYBG 4BXXG 3STBC 1Q82C 4K0KL 1YBYA 3D31A 3G4SA 4IPDA 3HFZB 4DV3Q 2IHFA 4GNXA 4A76A 4GKJL 4QJFA 1B8AA 1EUJA 2RF4A 3J80c 1LUZA 4LF4Q 1FJGQ 4AQYQ 4GN5A 2UUCL 2A8VA 4A3DG 4X62L 1BBWA 1AE3A 3CCUA 1YJ9A 2CKZB 4APVA 2JA8G 5M5XH 4B3SL 2NZOA 3GO5A 1YZ6A 1KRTA 1HNXL 4A3JH 1SLJA 3CCLA 3DM3A 3K80C 1SR3A 4QGUA 2ZJQA 3HOUH 5JJLA 4DR5L 4DV2L 4BBSH 1VQPA 3OTOL 4JI0Q 1LTLA 4KLKA 4IPCA 1VQIA 1VQGA 2UU9L 4LFBL 1TXYA 1E1OA 5AJ3Q 1S40A 2LXKA 2NZHA 4HJ8A 1LM0A 1IBML 5GAGC 3AYHB 2JA6G 3M3YH 2B63G 2MO0A 3S17H 1S3OA 1NTGA 1KIXA 1Q7YC 5JEAG 1YHAA 4A3KG 1VQ9A 4WJ4A 1KQSA 4BY7G 1HNWQ 2IX0A 3GTJH 1EQQA 3GTGH 3W5OA 4HJAA 1H95A 4JI3L 5M3FG 4OWTB 1AE2A 4A3BH 1N32L 1OXVA 2YV5A 5E7NA 3BZKA 1OXUA 3JC66 3CXCA 1VQHA 3H0GG 4JBKA 1FVIA 4OXPA 2QA4A 2JK8A 4LF9Q 2YU9H 2VUMH 3ICEA 1SRUA 2AMCB 3U50C 4X66Q 1WCMG 2D62A 4QQBX 4A3LH 4XIGS 2JA7H 2N3SA 3AQQA 1JMCA 1RIPA 4C2MH 3TREA 5BR8Q 4DV3L 3BJUA 5IYDH 1CKMA 3PF4A 3CCQA 5GQOA 1KRSA 1OTCA 4L5QA 1MJEA 1X3FA 1N34L 2JEBI 1XNRQ 4LF4L 1FJGL 4AQYL 3K8AA 2ZTDA 2VNUD 5DLQE 4IJHA 4DR7Q 1DGSA 2Z0SA 4MTNA 3KJPA 1VQ7A 3AFQA 2RHQB 3I4MH 5C0XJ 4EQ5A 1IYJB 4LFAQ 1Q12A 2KHIA 1IBKL 4YHHQ 1X3EA 2Y0SG 4IJLA 2JJQA 5HGQA 1GKHA 4JI0L 1KD1C 1V1QA 4GKJQ 2MQHA 1P16A 2VW9A 3S1MH 1GD7A 1QUQB 5IP7H 5AJ3L 4IO9A 4A3JG 3HOUG 3TS2A 1TWHH 4JYAQ 2Q2UA 4BBSG 3PUVA 4X62Q 1L1OB 2CWPA 2HHHQ 2R7DA 2Y0SE 1Z9FA 2A19A 4YWKA 2R92H 2LSSA 1Z47A 4JV5L 4OWXB 1E24A 1Y1WH 3DLLA 1FGUA 3G48A 1HZCA 3CCSA 4B3SQ 2GVAA 1K3RA 3U4ZA 1N33Q 4OONA 2K5VA 2RHSB 3ER0A 4DV4Q 2NVYH 4A3EH 4JBMA 4NPSA 2IHEA 3RN2A 1HNWL 1UWVA 2Z6KA 1T9HA 1CKNB 4AH6A 3AEVA 2I5LX 2UXBL 3MEFA 2ZTCA 3UDIA 2NVTH 1QUQA 4UY8C 4DR2Q 2N78A 3SGIA 4C3JH 2OWOA 1HJPA 2AWOA 4HIMA 4YWMA 3S24A 1L1OA 2IX1A 5FJ8H 3STBD 4PG3A 2WAQE 4B3TQ 3F2BA 1TWAH 3J81c 1NMFA 1IBLL 4A3BG 4LF9L 1QZHA 3NBHB 3ULJA 4X66L 1PH8A 3PO3H 4BY1G 4O2DA 1X65A 1IL2A 4KHPL 1I94L 3E9IA 1CSPA 2XGTA 2AKWB 1CKNA 1NY4A 3F8TA 5BR8L 2VUMG 3HOZH 1UE1A 3PUXA 4LW1A 2NN6I 2E2JH 4X64Q 4HIOA 2VL6A 2JA7G 1XNRL 4LFCQ 3RZDH 3PCOB 1O7IA 2JQOA 4IPGA 5IYDG 3A5ZB 3OW2A 3CPFA 4KHZA 1YIJA 1SFOH 2BH2A 4DR7L 2EQSA 1WFQA 4JCVE 3GTQH 5ELNA 3PF5A 1NMGA 3KF8B 1VCIA 4AIMA 4LFAL 3GTOH 4NB3A 4MNOA 4YHHL 3CCJA 3UE1A 4BA1I 1MKHA 1UE6A 2N8NA 4LUOA 4A3FH 3HOYH 3M4OH 2BA0A 1R9TH 4ALPA 4P73A 2K14A 3G6EA 1K8AC 1Q1EA 1U0LA 3I4MG 1Q81C 1PH1A 1N34Q 1LYLA 1L2FA 1MIUA 2MFIA 4JYAL 1NE3A 3J7ZC 2OQ0A 2JA5H 2YYZA 4A3IH 3CC2A 4B3ML 5GAEC 4GLXA 1XMQL 5IP7G 2DGYA 1CKOA 2ZJRA 3CCMA 2Z6KC 2HHHL 1VQMA 2MO1A 1EIYB 1YJNA 4GKKQ 2ZM6Q 2K5HA 1PH2A 4DUZQ 3S2HH 1E7ZA 1IBKQ 1N33L 3KDFB 4DV4L 4DR6L 3E0EA 1D7QA 2UUAQ 2R92G 2ASBA 1XPUA 1Q8KA 1Y1WG 2K5NA 1L1OC 2PQAB 2Q2IA 3CP0A 4R4CA 2AWNA 2VS1A 1XMOQ 2XTIA 4DR2L 2VQEQ 4A3EG 1PHJA 2NN6G 1KAWA 2HIXA 2YTVA 4B3TL 4JV5Q 4AYBG 3GD7A 4JI1Q 1I3QH 2RCNA 3KF6A 4RG1A 2MNAA 3KDFA 5FJ8G 5M3MH 1M1KC 4HJ5A 3GDEA 1UE7A 2R7FA 1C9OA 3D0FA 1N9WA 1EQRA 3PUYA 4GLAC 3HOXH 3CCEA 4A75A 2UXBQ 2PQAA 3CC7A 2CCZA 4C3HH 3PO3G 5LMUQ 4DAMA 4X64L 3BU2A 1EIFA 2OQKA 3HKSA 2ES2A 4LFCL 2IT1A 4DV7Q 3GTPH 3HOZG 5JJIA 3KYHC 1MJCA 1TWFH 4R4QA 2GN5A 1IBLQ 3HOWH 5LMNW 4RMFA 1PH4A 1U5KA 2GVBA 3TEHB 5IE8A 3GTMH 3S1NH 3U4VA 1VQKA 1I94Q 4KHPQ 2CQOA 3CCRA 3L2PA 2ALYB 4JOIA 1JJ2A 1NBWA 2KBNA 1J6QA 4TQUS
chains in the Genus database with same CATH superfamily
4A3IB 2PW7A 4JI8Q 3C46A 1Q1BA 2EJFC 3M85A 3K5NA 1D1KA 1EOVA 1O80A 2Q2HA 4IPHA 3NK9A 4DV1Q 1TR5A 5IY0A 1G51A 2ZXPA 4A3IG 1HHVA 1XNQQ 1PYBA 4JG2A 1I6VC 1UEBA 4GLVB 1K28A 2O4XA 4HN7A 2CQAA 4ZUIA 2FMMA 4H0LC 1HA6A 2K50A 2F0PA 5C3EH 2M9VA 3RD4A 1GUOA 3CMEA 4B3MQ 4L6TB 4CDEC 1FL0A 1XMQQ 3S14H 3EROA 3K81C 3HOXB 4GS3A 1DYQA 2VXWA 3T4AC 1TKWB 4C3HB 1PYSB 3MXNA 1QG7A 1VQAA 2B3GA 4ZKBB 1YNJD 4K6DA 1E3PA 5T1GA 1HZBA 2JA9A 4S3SA 1TVXA 3MVVA 5IGDA 3HOXG 1HR0W 3GTMB 3S1NB 3S16H 1YHBA 4C3HG 4JOIC 3QIAA 4FYDA 2RDFA 1HNZQ 3RLFA 2EYMA 1K8OA 3F2CA 2VZAA 3U58A 2B2VC 1NJIC 5IWAL 1EU4A 4N8X1 4JI8L 4LF7L 1PVOA 4EX5A 2RDGA 3O13A 1K8MA 4A3KH 4DV1L 4V190 3J81L 2KHJA 4HTHA 3KJOA 3BS1A 1XNQL 5C3EB 3DMUA 4JBJA 5H1SE 3CAMA 2O2LD 3GTLH 5EJWA 4NW2A 4JI6L 4K5VA 2EDGA 4DR3L 4CKEA 3R3OA 4A3GH 5C3EG 3F2UA 2KCMA 4KV6A 3MAQA 2VB3X 4JW0A 3OOCA 2EYJA 2E75C 4LUZA 3VR6A 4KKUA 3G7LA 3S16B 2OEOA 1CK1A 2XRQD 5DM73 1TWGH 3RLOA 5C4JH 1II3A 3M4YA 3TZUA 1SNMA 4DKAC 4DV0L 1MSGA 4HSPA 5KRUA 1HNZL 1CZWA 3PIO3 5EGTA 2I0QA 4GOPC 4NMZA 2YTYA 1SROA 1SNQA 4DV6Q 1EL0A 5EQ0A 5C5MA 1TS4A 2B2YC 1KHIA 1X3QA 2QF7A 2JE6I 4BA2I 1SYFA 3GTQB 1PFBA 1I4HA 2AQ3B 1F2LA 1LO5D 1EFWA 3FP9A 2DNCA 3I2ZA 2E2IH 3MFYA 2EZVA 2KENA 2L12A 4YY3L 3GTLB 2K32A 4JI5Q 1GJXA 1PH7A 1OXTA 3CF5A 3I4NH 1EY9A 4A3GB 2E8GA 1QZGA 3FHWA 3RLNA 5CMDA 1HZ9A 1EQTA 2RCFA 3GQBA 1JCKB 2K5WA 1QWYA 1OXXK 1V8QA 1YHQA 4A93H 1WVLA 2L15A 1EZ6A 5C4XH 2MHVA 4A3GG 3BYYB 1TWGB 2QDBA 2EOTA 3E9HA 5C4JB 4K8IA 4OWWB 5ISRA 1NSNS 2V1CC 4WJWA 1I6HH 1A8VA 4A4IA 2JSOA 1A3TA 1VQLA 2F4VQ 5C6AA 5GADC 1JJCB 1H9KA 1E0BA 2EVBA 4CJ0B 2K75A 3C2PA 3KBGA 4DV6L 3S2DH 5DEHA 1TWFB 1RODA 2E2IB 3VYTA 1I4XA 2PI2A 2PW5A 3NELA 3D4RA 4HIKA 2F0MA 4KMUC 1N8RC 3KLWA 2I07B 3I4NB 2BH8A 4RGNA 4JI5L 1VDZA 5FO8B 1HNXQ 2N49A 1CHPD 4GN3B 4BS9A 4LJZC 4JI4Q 5E1FA 3OTOQ 1K8GA 4GZYC 1TQOA 2K1BA 2A1AA 3NP8A 4POFA 2JA6H 3BVGA 3WOEA 2OTJA 4L5SA 3J81j 4PZ8A 5JEAH 4A93B 3EBEA 3K7UC 4KD3A 1IBMQ 3I4NG 5C4XB 2LKVA 1WTPA 1KLUD 1WI5A 4DAYB 1VQ8A 3NEMA 5M3FH 1I6HB 2D5DA 1JOKA 3R8BA 2EPBA 3RZOH 1V43A 5G3LD 4RGMA 4A93G 3W2DA 2IW3A 5C4XG 3S1RB 3SK5A 3PUZA 1G6ZA 3MXUA 2F4VL 3S2DB 3H94A 3X3NA 2FXQA 1SYCA 5IGFA 4F87A 4GKJL 3X3MA 4QJFA 3Q23A 1EUJA 3J80c 4AQYQ 2K7VA 1EEFD 3ZYYX 2A8VA 3JAME 1FGBD 1HPCA 1BNZA 4JK1C 2JA6B 3GO5A 2B63B 1HNXL 1SLJA 3CCLA 5JJLA 2ZJQA 2HQEA 3OTOL 1LTLA 4KLKA 1VQIA 1VQGA 1TXYA 3V2TA 5AJ3Q 2PPBC 2LXKA 1KNEA 4DNTB 3J80L 2NZ1D 5M3FB 1IBML 3AYHB 3I73A 2JA6G 2B63G 1NTGA 3RZOB 4O1NA 4XYOA 5JEAG 1RDPD 3H3VC 4FF1A 1VQ9A 3MXPA 1KTKA 4IUUA 3TN2A 4HJAA 1LTBD 5M3FG 4F7XA 4CKBA 1OXVA 4CGYB 2FHTA 3BZKA 4JBKA 2R3ZA 4O42A 4C3IB 1AFPA 1SRUA 3U50C 4DU9A 2IPKD 4XIGS 2N3SA 1PTOD 5I9OA 1S5BD 1PRTF 2DJFC 2PZTA 4HMIA 4PMCA 3HP3A 3PF4A 1XNRQ 4L5QA 1X3FA 2CH4W 2JEBI 4TKOB 4AQYL 1JORA 4C3IG 2D2CC 2F0GA 5DLQE 1D6EC 4EVOA 4FF3A 1KDCA 1O7LA 3BYTB 2A6ED 3K6OA 1IBKL 5E4WC 2JJQA 2BE5C 1KD1C 1LLRD 1P16A 3EA6A 5IP7H 4I7ZC 5AJ3L 3S1MH 1TWHH 2Q2UA 2Z4HA 2HCCA 4X62Q 1PDQA 1ILPA 4YWKA 2A19A 4F88A 3P75A 2LSSA 1Z47A 2XIWA 4OWXB 1E24A 1Y1WH 5CORA 4B3SQ 3DEOA 1K3RA 1L0YB 3SDZA 3U4ZA 4DR6Q 2K5VA 4DV4Q 4A3EH 2Z6KA 2B8FA 2UXBL 2IL8A 4DR2Q 4C3JH 1Q8IA 4QF4A 2IX1A 3STBD 2WAQE 2XVSA 1AN8A 3L3OC 3NBHB 2L55A 1QZHA 1X65A 1IL2A 3D4WA 4KHPL 1HQRD 1CKNA 2PNRC 3F8TA 3PUXA 3I3CA 2OF1A 4U68A 2VL6A 1ZYRD 1GUSA 4FP5D 5A35A 5IGCA 1XNRL 1WTHA 3OWFA 4B9WA 1CI3M 2F0NA 1YNJC 4X3SA 1O7IA 2BH2A 3AU7A 2CVRA 1SFOH 1LTTD 4IURA 4JCVE 5J39A 1VCIA 1H9SB 4AIMA 3GTOH 3S1MB 1TWHB 1MKHA 4LUOA 4A3FH 1R9TH 3NWTA 1U0LA 4DXFA 1B50A 1LYLA 2MFIA 5I9PA 2ICIA 1Y1WB 2YYZA 3TSSA 3MHBA 5GAEC 4A3EB 5IP7G 4HSVA 1PRTB 3CCMA 2E76C 4ULLA 3NWSA 2E2DC 4DUZQ 3KF8A 4DR6L 4AYBB 2AQ2B 4DV4L 1VF5C 2KQ3A 4G7OC 2UUAQ 4EGVA 2DN8A 2ASBA 1CZGA 1Y1WG 2K5NA 1XMOQ 4DR2L 1LTGD 4A3EG 2NYZD 3Q0AA 1BF4A 5HGTA 1B9MA 1R4QB 4XQNA 3PQIA 4KJOA 4AYBG 4CBVA 4JI1Q 1I3QH 2XSCA 3D4DA 3TBIB 3IAYA 1SNPA 1M1KC 2XWJB 1C9OA 4GLAC 1EQRA 3PUYA 1HFGA 2BCOA 4L8JA 3H91A 3K57A 2IT1A 3KYHC 1MJCA 3DEPA 3GTOB 5CV5A 4DXGA 4R4QA 4A3FB 2F0JA 1IBLQ 1R9TB 3HOWH 5IE8A 3TEHB 5HURA 2F0EA 1VQKA 2LS01 2KCCA 5I2XA 3CCRA 2ALYB 4JOIA 5K36H 4OONA 4DV5L 2SNSA 1JOOA 1H9JA 3J7A5 5M5WH 2GA4B 3PV0A 4A3FG 3T51B 2B2VA 4MHEA 1D2BA 2KEDA 1RHPA 2HUGA 3E6ZX 4DUZL 2SOBA 3W3AA 3MXNB 4Z9CB 3SHLA 2UUAL 1A62A 3T1YQ 1F2ZA 4HIDA 2JEAI 2BDNA 2NWGA 1I4QA 2TSSA 1XMOL 4UDUC 4LMQD 4JBWA 1I3QB 3A7LA 1SEBD 4M8AA 4FF4A 2KA7A 1UEAB 4H13C 2K52A 2OXPA 3NTKA 4YCVA 4DNIA 4JI1L 5JEAJ 1B9NA 2WKCA 3CRKC 3TP7A 2PMZB 3EJIA 3I56A 3I91A 3TP6A 3QJYA 1V1OA 2E2HH 1CA5A 2OTLA 3HOVH 2K4KA 3HOWB 3K7AH 2R7ZH 1HCZA 5C0XH 3HZXA 1NUCA 4TSSA 4KK7A 5KGUA 1G291 3M4PA 3MC0B 3VR3A 1W3SA 3RNUA 3ULLA 4IFDH 3P1HA 5M5WB 4DK3C 1JB7A 3HOWG 3OMCA 3A0JA 3CQZH 2R61A 3S9WA 3KOJA 1J5EQ 4GOPA 3D8GA 2KHSA 2PMZE 4L63B 4IUPA 5K36G 3QG1A 2VY3A 2B2YA 4H7BA 5C0XI 1MD2D 5GAHC 2AHOB 5FKAC 2WKDA 1HR0Q 1KDBA 1BQQT 4IFDI 4RKBA 3T1YL 3E5SA 3GV6A 1E22A 2I5MX 2VB2X 2ATWA 4KN4C 4B3RQ 3CD6A 4YWLA 5LL6X 2O5IC 2RA4A 1SMXA 5A2QE 4LWCA 2RDHA 3KK7A 2NTTA 1YITA 1KL9A 1ICWA 5IT9E 2OT2A 4XT1B 2EJGC 1M90C 4ZYSA 1S5CD 2E2HB 3KF6B 1BBUA 2EYFA 1EY5A 1LTAD 5KNBA 5EAYA 3HOVB 1QJOA 3IRBA 3K7AB 3QOLA 3WDNA 4KKTA 2R7ZB 2WIIB 2K5QA 4PNYA 4B9XA 1ML0D 3L7ZC 4FDBA 4WFN3 1ASYA 1F2YA 4UP9A 2SEBD 5FLXc 3AMUA 3K0YA 3HOVG 3J80i 1KC8C 4PMWA 2R7ZG 5C0XG 4UP8A 3L9AX 4R4TA 4N8FA 5DAUA 3CMAA 4IFDG 1LV9A 1J5EL 3ERSX 4ZLTF 1VQBA 1G6PA 4J8QA 1BCPD 3IFDA 2UXCQ 3NQTA 3RMHA 3TMEA 2F3VA 3SVMA 5FLXL 1HR0L 3A56A 4C1NI 3NE5B 1B53A 3A54A 1KXLA 1LTID 1PH9A 1K9MC 5IWAQ 3D3RA 1SNDA 4B3RL 4DK6C 2ZTEA 4LF7Q 3OYYA 2X6GA 2NVQH 1MHWC 3WOFA 4DAVA 1AEXA 3WWVA 4BBRH 3G71A 3J7AV 4QUCA 2M00A 3PIOA 4JI7Q 1LABA 5IYCH 1W6KA 1M8AA 1EIGA 2L0CA 2E5LQ 4IN3A 4P75A 4DR1Q 1H9RA 3IKJA 1B1ZA 4X6AH 1S4ZA 4JI6Q 4X65Q 4DR3Q 4ODGA 1CUKA 1A0IA 3H15A 5KIXA 1HTLD 1EU3A 4QMGA 4YCWA 4RKLA 5IGGA 3HEJA 1BOSA 2FFKB 4ME5A 4GN4B 4A3DH 3I4OA 2F0SA 4Y52H 1PTOC 1AH9A 1BR9A 2K6AA 2JA8H 1WD0A 2UUCQ 1PFSA 2UXCL 1TWCH 5CGKA 3SE0A 3VR5A 4DV0Q 2HT1A 1MBYA 1QNUA 2PI2E 4XXEA 4K5XA 5JPMC 3JAMc 1EFID 4JPBW 4IOCA 2NVQB 1XYIA 4DR5Q 4XQQA 3ONAB 1TY2A 4BBRB 2J7ZA 3W1BA 4LFBQ 4HAEA 4JC0A 2A6EC 1F9RA 1JWSD 2N55A 3Q8DA 5JOBA 4F8MA 3DHQA 1ZKOA 3MTSA 1IZ6A 4BY7H 4QCLA 4JI7L 4YY3Q 3GTKH 4BBRG 1DJRD 1I4RA 1U4MA 3S14B 3HGBA 2F0HA 2E5LL 5IYCG 1UE5A 2Z9HA 4DR1L 2EIFA 4U673 1WOCA 4X65L 1VQEA 1C0AA 2EY5A 3EN2A 3E3XA 5KEEA 4H44C 2NVXH 3UE0A 4A3DB 2RKSA 3KBXA 3STBC 2JA8B 5C5LA 1TWCB 3HFZB 2EYLA 2IHFA 4GNXA 1TU2B 1CFMA 2F3WA 1HRJA 2UUCL 1T5XD 1FD7D 4A3DG 4QB4A 1AE3A 1ZYRC 3CCUA 5ELEA 4APVA 2JA8G 3T53B 1KRTA 1VMPA 4HCSA 1SR3A 4QGUA 3HOUH 4DR5L 3KUPA 4A3KB 1VQPA 1HFNA 3SXHA 3SK8A 1SYGA 3EQLC 1E1OA 4LFBL 1S40A 2NZHA 4BY7B 3OW7A 1S3OA 2PO4A 3MXGA 3BDLA 4A3KG 2XWBB 1A6XA 3C1EA 4BY7G 3KLSA 5IODA 1DOMA 2A68D 1K3BC 3VYRA 1EYAA 1A2UA 2YV5A 5EKKA 1TS3A 1E2WA 1W6JA 2F0DA 1STNA 4I65A 2VUMH 4LF9Q 2YU9H 4QQBX 4X66Q 2AMCB 2D62A 4IQZA 4A3LH 2K03A 1SE3A 2JA7H 1JMCA 3AQQA 1CKMA 3Q22A 3ITPA 2Y0SB 4X3UA 5CR3A 2Q8TA 2VNUD 4IJHA 5CV4A 3HOUB 1FNWA 3OIPA 3KJPA 1VQ7A 1YNND 5C0XJ 4N9PA 5BN4A 1Q12A 2Y0SG 2EY2A 1GKHA 1SYBA 4GKJQ 2K28A 2VW9A 5ELCA 1GD7A 1EY6A 3I8ZA 2Q8IB 3TS2A 3HOUG 4M1UB 4JYAQ 1IL8A 3PUVA 1U4PA 2Y0SE 1CTMA 1Z9FA 1WTQA 4DF7A 1FGUA 5FK9C 2RHSB 3RN2A 1F9PA 1CKNB 1QILA 2I5LX 5TSSA 2ZTCA 2N78A 2VUMB 1MI2A 2YU9B 2KVMA 2AWOA 4YWMA 2JA7B 5FJ8H 3F2BA 1STBA 4LF9L 1GUNA 4X66L 1LT6D 4O2DA 2NTSA 1I94L 3E9IA 5D3DA 5NUCA 2VUMG 3MEHA 5ELDA 1UE1A 4X64Q 1FYCA 2JA7G 3SR1A 2WACA 3RZDH 2JQOA 3OW2A 1YIJA 1G8ZD 3CPFA 1WFQA 3SK6A 5ELNA 3KF8B 4IZ8A 4MNOA 4BA1I 1UE6A 1M4VA 4ALPA 4P73A 2K14A 4HEDA 4UAIA 1Q81C 1PH1A 2EXZA 4HR7B 4JYAL 1NE3A 1B3QA 4GLXA 2ZXRA 3D6CA 2DGYA 1CKOA 3KLRA 4GKKQ 1VQMA 2MO1A 1EIYB 1YJNA 2ZM6Q 5F2DA 1IBKQ 5CBAE 1G2TA 2Q2IA 1L1OC 4KY6A 3CP0A 4R4CA 2B8GA 2VQEQ 1R4PB 5I6YA 3J81E 1HQMC 1DOKA 4ZK9B 3GD7A 2RCNA 4RG1A 2MNAA 1Q90A 3KDFA 5FJ8G 2K04A 3CKIB 3GDEA 4HJ5A 2EJMA 2R7FA 4K2KA 3D0FA 1N9WA 3RZDB 2UXBQ 5CBEE 4RWSC 2PQAA 3CC7A 3VA7A 4X64L 4RAUC 3BU2A 2WV6D 5JJIA 3GTPH 3P20A 3NPPA 1UNSA 4R8IA 2GN5A 3GP7A 1STAA 4RMFA 5LMNW 1PH4A 4FVMA 4KHPQ 3U4VA 4K5WA 2RBMA 1NBWA 1F77A 5KNDA 1RCVD 4CDDC 4OHJA 4JI2Q 3H09A 1Y1VH 3TP8A 5DNFA 1QCBD 5JAVA 1SBBB 5C4ZA 5IIFA 4GKKL 1VQ5A 1GHJA 1Z6HA 4YIJA 3KLSX 2ZM6L 3M7NA 1BCPC 4HJ9A 1IYVA 1ZXTA 2WFWA 2G9HD 3M4QA 2F03A 1SSOA 4TRDA 2VQEL 3H6MA 3NENA 1V1PA 4J15A 1IYUA 2RVLA 1E2ZA 3RR5A 1SNOA 2I5HA 3LGJA 2G9DA 2Z1CA 3M7GA 2G5DA 1N36Q 2DNEA 1CQVA 1XJVA 1EY7A 4NXNL 3GTPB 4ZUJA 4GOPB 1XTDA 2NBFA 2KJXA 1BKBA 2F0UA 3T1HL 3N52A 1XPOA 1FNVA 1JWMD 1EWHA 2F52A 3K5OA 5ELOA 3NHHA 1DCZA 1Y1VB 5HY6A 2IWHA 2ICEC 2YTXA 4NKLA 4KTAA 3L0OA 2QKIC 1WTOA 2EY6A 3I4LA 3JAMi 4FXGC 4JI2L 1C4QA 1A15A 3DM1A 1Y1VG 3LWEA 3MZ5A 1HUMA 1JJGA 1VQNA 1WJJA 1LT5D 2L4NA 3T56B 3CC4A 4DV5Q 2UUBQ 1O7YA 2N88A 2QILA 2R93H 1V9PA 1PYWD 4KI0A 1EQVA 5JJZA 1TS5A 1JB3A 2K5DA 1K83H 4CDFC 1QNKA 3NQIA 1YI2A 4DA2A 4OO1H 3KFUA 2KCTA 2KCNA 1N36L 5C44H 4C3JB 1GHKA 1C7YA 1SAPA 2F0TA 1ILQA 3QOJA 1UUPA 5CC4A 4ZQ3A 3TRZA 4R4IA 3HKZB 5EPLA 3CU7A 1S5FD 4C3JG 2D0OA 4NXML 1STEA 4OO1I 3PO2H 4KY7A 3E0JA 2KECA 4QL5A 1K0RA 2F4IA 3A7AB 1PZKD 4ME3A 5IP9H 3HKZG 2PNHA 1SFOB 2Q8RE 4AYBE 5LL6S 1U4RA 4L5TA 2R6GA 5C3XA 1E1TA 4DUYL 4RFBA 1Q46A 4LNQA 5FO9B 4Q5VA 2B2TC 2Z4IA 3HKZE 1PRTD 1GVPA 2R93B 1SXTA 2RQXA 4XT3B 1K83B 2NB0A 3LWUA 2UUBL 4TVAB 2QEXA 5C44B 2Q2TA 4BY1H 2DUDA 3H3VH 4I7AA 1TS2A 2R93G 2NUCA 3BVMA 1RL2A 3QB3A 1BCPF 2H5XA 1Q3LA 4IUNA 3J7YW 1HXYD 2HD3A 4OO1G 1SYEA 2JYOA 3B6YA 3NSWA 3J80E 2FINB 1WYDA 3P7JA 5ELFA 4C56C 5L37A 4QIWB 5C44G 1TY0A 1XXGA 2B29A 3PO2B 5I2YA 1Y14B 1KDAA 1EYGA 4BXXH 2A68C 2A6HC 3G6JB 1VQFA 1FR3A 3D6WA 4UHVA 3H3VI 1GM5A 1STHA 3A5UA 4PZ6A 3SK4A 3UDGA 1HH2P 1K0SA 5EPJA 4MIUA 2F0LA 1D5MC 4N9TA 3PO2G 4EQOA 3PIP3 4CJ1B 2ZXOA 4EQNA 1U4LA 2A5HA 3TDQA 5IP9G 1OXSC 3W1GA 4QIWE 4IUQA 5KYLA 1QVCA 4KHVA 4PMBA 3EFXD 3PSIA 2EYOA 2CW0D 4CHTB 3NUCA 1B70B 2C9OA 4DV2Q 2EXDA 4UPAA 1YJWA 1YNNC 1XPRA 2A73B 5I4DA 2UU9Q 1EIHA 1AZPA 3TQYA 2HDMA 1CQFA 1IW7D 2D9UA 3ULPA 1YNXA 3OIQA 1QB5D 3BG3A 4JI3Q 4GNXB 1BBXC 3H0GH 3K0XA 1YEZA 1CSQA 4P72A 4LUVA 3DWQA 5J22A 1WCMH 2H4OA 2KOLA 1QOHA 3U9OA 4Y7NH 4QY7A 4L5RC 1W2BA 3NTHA 1PV4A 4DR4Q 2F0VA 1U9RA 3NBHA 1PH6A 2F0FA 4BXXG 1GO3E 4HCEA 2QDLA 5D3IB 1YBYA 3G4SA 4IPDA 4DGZA 2BOSA 3V05A 2DY8A 3C3LA 1B8AA 4EQPA 2RF4A 4LF4Q 1QE6A 4GN5A 1YJ9A 2QCPX 2CKZB 3CQZB 5JVH3 1CT1D 2NZOA 1YZ6A 2Z8LA 3UI2A 1D5ZC 4DV2L 4IPCA 2UU9L 4KN7C 4HJ8A 1LM0A 3HRZC 5GAGC 1G91A 1JICA 3S17H 2E74C 2MO0A 4FF2A 4R9WA 1Q7YC 4FXKC 3H0GB 4RGOS 4WJ4A 1Z7TA 2CH4A 1KQSA 4OIKA 3N6RA 4ZAIA 5IOCA 3RUZA 2IX0A 3GTJH 1EQQA 3GTGH 3W5OA 1WCMB 4JI3L 2JN4A 4Y7NB 2EY1A 4RGTA 4OWTB 4Q0FA 1AW7A 1Y8PB 4FO2A 4A3BH 4MTKA 1OXUA 5C4HA 2X69A 3H0GG 2L11A 3Q6SA 2QA4A 2JK8A 3ICEA 4DR4L 1WCMG 5D14A 1ET9A 5EBCA 5BR8Q 4KY5A 2RSNA 3CCQA 4K6LA 1KRSA 1FNUA 1MJEA 1Y69U 1N34L 4LF4L 1VMCA 5BN3A 2PYKA 2ZTDA 1RJTA 1DGSA 3TZDA 3AFQA 2RHQB 3FPPA 4DK1A 3I4MH 4EQ5A 1H9MA 4LFAQ 1PFNA 2XRSD 2KHIA 1BDOA 4G57A 1X3EA 4C1NK 5FOBB 2IJ0A 3S17B 4V0BA 1NCVA 1J8IA 1LTRD 3R2IA 2CWPA 1PLFA 5EPKA 3GTJB 3GTGB 4JV5L 5D65A 3G48A 4KKSA 1JWUD 2GVAA 4JBMA 3ER0A 2NVYH 4A3BB 2IHEA 2LMCB 1UWVA 1T9HA 3TP5A 1IKLA 3MEFA 4DK0A 1EWCA 3MFGA 3UDIA 2NVTH 1QUQA 4UY8C 2BDOA 3SGIA 2OWOA 1HJPA 3FVQA 1L1OA 1SMYD 4B3TQ 1TWAH 2HDLA 3J81c 4A3BG 3PO3H 1A2TA 3JAML 1CSPA 2AKWB 1XTCD 3HOZH 5BR8L 2A69D 4LW1A 4HIOA 1SDFA 3ERQA 3I4MB 3DWAA 2MJ8A 3PCOB 1ASZA 3ND8A 2EQSA 1EYDA 3GTQH 1RF2D 1X32A 4IALA 4LFAL 2PZWA 3UE1A 4G4KA 4R8NA 3HOYH 2N8NA 3M4OH 3FEWX 3I4MG 3G6EA 2L1BA 3DXJC 1STYA 1MIUA 5G3LF 4ZKCB 2KEEA 1ONLA 2OQ0A 3J7ZC 2JA5H 1Y8NB 3CC2A 4B3ML 2NVYB 1XMQL 4ID6A 5EKLA 1L0XB 1PH2A 3S2HH 2NVTB 3KDFB 1D7QA 1Q8KA 2PQAB 1TWAB 2XTIA 3GTKB 1RKNA 1PHJA 2K05A 4P2CB 2F0IA 3PO3B 4DAPA 1LT3D 2YTVA 4B3TL 1ENFA 3IL8A 3HOZB 1NNXA 3KF6A 2EYPA 5M3MH 3LNNA 3OPOA 1UE7A 5C3WA 3CCEA 1A3VA 1IHZA 4A75A 2F0OA 2A6HD 3PO3G 3OWEB 5LMUQ 4DAMA 1ZEQX 1EIFA 1WTXA 2NVXB 3HKSA 5J1ZA 2ES2A 4DV7Q 3HOZG 1TWFH 4DFAA 3HOYB 3M4OB 3I70A 1NAPA 1U5KA 2GVBA 1ESRA 4K2LA 1I94Q 2CQOA 1GUTA 3A8JE 1ICFB 1GOZA 1JJ2A 2JA5B 1EOTA 5JVG3 1KNAA 4TQUS 1X3PA 3T13A 5FLMH 5FO7B 5IGBA 2B2WC 4LF8Q 1S72A 3HOYG 4OX9Q 2A74C 4XDXA 1V1PB 2LXJA 4B08A 1EY4A 3S2HB 5M5YH 1X3GA 4LAAA 1AZQA 1J9OA 1I5FA 2WINB 2JA5G 3NXWA 1ENAA 2HCIA 2UXDQ 5LMNQ 1A63A 1XWEA 1X6OA 4IFDJ 2QGQA 1PTOF 3PGZA 3A55A 2D0PA 1PRTC 5FLXE 3EIVA 1YVCA 1P8LA 1DOLA 1X54A 4J6HA 5K5PA 1WTRA 4LF5Q 5M3MB 3F2DA 1KABA 1STGA 3T16A 3EVQA 3S1RH 1NR2A 4WJ3M 2HIVA 4OIJA 1D8LA 1VQCA 3TS0A 2F0WA 1SYDA 3V96A 2KUMA 4H02A 2WP8J 5LMUL 1PH3A 5M3MG 1CHQD 3HG9A 3I7FA 4DV7L 1VQ6A 2ZT9C 2B2UC 3K58A 1QVGA 4OEMB 2ZJPA 4POGA 1HZAA 1VS0A 3R93A 2CHBD 2IY5B 4XTCS 4WRDA 1PTOH 1F9SA 4A3LG 5M5YB 1RTNA 4NP5A 2B63H 4LF8L 3QR8A 1KAAA 4OX9L 2QEJC 4MZ9A 3CCVA 3AB9A 1X9NA 5FLMG 2C35B 1C8CA 3BZDB 1X56A 1PA6A 1VQJA 2VQFQ 2DY7A 1SE2A 2UXDL 5LMNL 1IXRA 1VQOA 1JE5A 2B2TA 1E2VA 2CW0C 3OSOA 2CWAA 4HJ7A 3MA2B 4LF5L 4R1JA 1GUGA 1PH5A 1PXUA 3VDYA 2L5TA 1VF7A 4DN4M 1MGSA 1DONA 3K5LA 4DPGA 3Q24A 4JVZA 4IOAA 1IW7C 5JJKA 4C3IH 3FKIH 1RTOA 4NDXA 4O0AA 4CKCA 3VYUA 1LT4D 4IUVA 1B7YB 4UP7A 4PZ7A 3RN5A 1PZJD 3FPUB 2C5CA 1O78A 1UAPA 2JP1A 3GV3A 3LX0A 3CPWA 1PTOB 3CW2C 1HA5A 4G7HC 3F1ZA 5JPNC 4NXNQ 2F3IA 3I55A 1B44D 4JI4L 5EKIA 4E6IA 1JR0D 1F2MA 2OCEA 4ABNA 2EYHA 4A3MH 4J1MA 3ZJYC 3T1HQ 2HQLA 1L0WA 1Y8OB 5T1IA 2BA1A 3UDFA 2VQFL 2QW7A 4A3CH 2ID0A 4ILWA 5CV9A 2B39A 1JOQA 4G7ZC 2JXMB 3BVZA 1JE4A 2LFNA 4OGQC 1B2TA 5ELBA 4RHSA 4P74A 3URYA 4OELB 3FKIB 2AUKA 1C48A 2P5ZX 4GNXC 1GXDC 5CV7A 4LF6Q 4BWGB 2F0KA 1WTVA 2RSOA 1Q86C 3A8KE 3M9BA 3ND9A 4RA8A 2H1EA 3PUWA 3FKIG 5IYBH 4RHRA 1F9QA 1EYCA 3BZCA 5J3BA 5EBDA 5IT9c 4A3MB 4KJNA 1QVFA 2PCFB 4K0KQ 1SN8A 1AP0A 3S15H 2WAQB 2M2LA 2EE1A 3UDXA 1DD2A 2K33A 1JT8A 1BVSA 4A3MG 1KLGD 4NXMQ 1T5EA 2CFMA 1TIID 5A2QL 5GROA 5IT9L 2WAQG 3A8IE 2WB1B 2O5JC 4A3CG 1O7ZA 5AFWA 3R2TA 3VYSA 1EWIA 4KD4A 4DUYQ 3K5MA 1K73C 2MP1A 1JQYD 4R4OA 4CJ2C 2MUYA 2WB1G 4YCUA 4OL7A 1EY8A 1SJHD 2SNMA 3A74A 2V4DA 4LF6L 3J81i 3PIPA 1WD1A 1VQ4A 4IUTA 4P71A 3AFPA 1WTWA 5BN5A 2WB1E 1HTPA 1N32Q 1SE8A 3CRLC 5E4XA 1A3UA 1X55A 3CHBD 5DM63 1EEID 2F0QA 3S1QH 4DAYA 5I6WA 2XNAC 3S15B 1VQDA 1I50H 5IYBG 1SMYC 1Q82C 4MN3A 4K0KL 1CM9A 1TT2A 3D31A 4RH6A 4DV3Q 4PV1C 3QO2A 4A76A 3U9SA 1LUZA 2X6LA 1FJGQ 2A69C 1EY0A 3PMFA 4X62L 1BBWA 2TMPA 2IX3A 5M5XH 4B3SL 4A3JH 1B4OA 3DM3A 3K80C 3NBIA 3VR2A 1SE4A 4BBSH 1IKMA 4JI0Q 1DXMA 2F1MA 2AQ1B 1DM0B 3FDTA 5E3FA 3QWNA 2FJ2A 3M3YH 1KIXA 1EZ8A 1YHAA 1HNWQ 2PZUA 1H95A 4FXDA 1LTSD 2I46A 1AE2A 3S1QB 1N32L 4HMJA 1LACA 5E7NA 2J4XA 1I50B 3JC66 3CXCA 1VQHA 5KYIA 1SJED 1FVIA 4OXPA 1BUVT 3K59A 1RIPA 4C2MH 3TREA 4K14A 4DV3L 3BJUA 2LY7A 5IYDH 5GQOA 4QUFA 1OTCA 3VR4A 3FMCA 4ZRZA 5M5XB 1FJGL 3K8AA 4PQXA 4RCOA 4A3JB 4DR7Q 2Z0SA 1D1IA 4BBSB 4MTNA 2ENBA 3DUZA 1IYJB 4YHHQ 4IJLA 1PZID 5HGQA 2Z6BA 4JI0L 1V1QA 4X3KA 3M3YB 2MQHA 4A3JG 1QUQB 4IO9A 1ESFA 3BDOA 5M9OA 4BBSG 5IGEA 3I90A 1L1OB 3SEBA 2HHHQ 2R7DA 2R92H 2AUJD 4K8JA 2J0TD 3NTIA 3DLLA 1HZCA 3CCSA 1N33Q 4NPSA 1HNWL 2NN6H 1ET6A 4BY1B 4AH6A 2MPMA 1JC7A 3AEVA 4X3TA 4HIMA 3S24A 3DWPA 3MWYW 4PG3A 2SDFA 1SNCA 1NMFA 4C2MB 1IBLL 1B3AA 3ULJA 1PH8A 3J7AF 4BY1G 2XGTA 2DJGC 1NY4A 2NN6I 2E2JH 4LFCQ 2L9HA 1XX8A 4IPGA 5IYDG 5CYUA 4XQJA 3A5ZB 4DR7L 4KHZA 4WORA 3PF5A 1CA6A 1NMGA 4NB3A 4YHHL 3CCJA 1NR4A 2BA0A 1K8AC 1Q1EA 1BCPB 2R92B 1N34Q 1L2FA 4CDCC 1PFMA 4A3IH 2HHHL 2ZJRA 1I4GA 2B2WA 2Z6KC 2K5HA 3C1FA 1E7ZA 5COYA 1HUNA 1H9SA 1N33L 1DZ1A 3E0EA 4FNFA 3IFTA 1S5ED 1ENCA 4LK1C 2R92G 1G2SA 4XYQA 1XPUA 1S5DD 2AWNA 2VS1A 2K01A 3FRPB 1MSHA 2NN6G 1KAWA 5KNCA 1GUWA 2FMCA 2HIXA 2PQEA 4ZCKA 5CV8A 4JV5Q 1RD9D 5CV6A 3OMGA 2E2JB 3VA5A 4RCNA 1BO0A 1D5XC 2MGSA 3HOXH 2CCZA 4C3HH 5LHY1 3OHXC 1PMRA 2OQKA 1BXTA 4LFCL 4DNRB 3I72A 1I4PA 2BE5D 3BDCA 3GTMH 3S1NH 1OO9B 3HS0C 3L2PA 2B2UA 2KBNA 1J6QA 2XN9C
chains in the Genus database with same CATH topology
4DV5L 4JI8Q 5FLMH 4LF8Q 5M5WH 1Q1BA 3M85A 1S72A 3HOYG 4JI2Q 3J7A5 1Y1VH 3PV0A 4A3FG 4OX9Q 2LXJA 1EOVA 2Q2HA 4IPHA 5M5YH 4DV1Q 4GKKL 4DR4L 1VQ5A 1X3GA 2ZM6L 5IY0A 3M7NA 1I5FA 4DUZL 2JA5G 1G51A 4HJ9A 3MXNB 4A3IG 1XNQQ 2UXDQ 2WFWA 1PYBA 4JG2A 5LMNQ 1A62A 1UEBA 3T1YQ 4GLVB 2UUAL 1A63A 1X6OA 4IFDJ 4HIDA 2JEAI 2QGQA 3M4QA 3PGZA 2D0PA 1XMOL 2K50A 5C3EH 3EIVA 1YVCA 2VQEL 4JBWA 3NENA 1P8LA 4J15A 1X54A 3CMEA 4B3MQ 4LF5Q 3S14H 1FL0A 1XMQQ 3F2DA 2K52A 3K81C 3RR5A 4YCVA 4DNIA 4JI1L 4GS3A 5JEAJ 3S1RH 2I5HA 3LGJA 1PYSB 1N36Q 1VQAA 2B3GA 4WJ3M 2HIVA 4DR6Q 1D8LA 1XJVA 1VQCA 4NXNL 3I56A 3TS0A 1E3PA 2E2HH 1HZBA 2JA9A 4H02A 2WP8J 5LMUL 2OTLA 1PH3A 5M3MG 2K4KA 4GOPB 1XTDA 3HOVH 3I7FA 3K7AH 3HOXG 2R7ZH 4DV7L 1BKBA 1HR0W 1VQ6A 3S16H 1YHBA 3T1HL 4JOIC 1QVGA 1G291 1XPOA 3M4PA 1HNZQ 3RLFA 2ZJPA 1HZAA 1VS0A 1W3SA 3RNUA 4POGA 3ULLA 2F52A 5ELOA 3F2CA 2IY5B 4XTCS 4DK3C 2VZAA 3U58A 1JB7A 5HY6A 3HOWG 2YTXA 3A0JA 1NJIC 3CQZH 5IWAL 4A3LG 3L0OA 4JI8L 1J5EQ 3KOJA 3JAMi 4LF7L 2B63H 4LF8L 4GOPA 1PVOA 4EX5A 2PMZE 4JI2L 5K36G 4OX9L 4MZ9A 2VY3A 3CCVA 4A3KH 1X9NA 5C0XI 5FLMG 4DV1L 2C35B 5GAHC 2AHOB 1X56A 1PA6A 1HR0Q 1VQJA 1Y1VG 2VQFQ 2KHJA 1JJGA 3KJOA 1VQNA 1WJJA 1XNQL 2UXDL 4JBJA 4IFDI 5LMNL 3T1YL 5H1SE 1E22A 3CAMA 3CC4A 2I5MX 2ATWA 1IXRA 4DV5Q 1VQOA 2UUBQ 3GTLH 3CD6A 1JE5A 4B3RQ 2R93H 1V9PA 4YWLA 4KI0A 2CWAA 4HJ7A 4JI6L 1SMXA 1K83H 4DR3L 4LF5L 4LWCA 4R1JA 1YITA 1YI2A 1PH5A 1KL9A 4A3GH 3VDYA 5C3EG 3KFUA 2KCTA 1M90C 2KCMA 1BBUA 3KF6B 4DPGA 1N36L 5C44H 5EAYA 1C7YA 3IRBA 4IOAA 4LUZA 5JJKA 4C3IH 3FKIH 4O0AA 3L7ZC 1TWGH 4FDBA 3RLOA 5C4JH 1B7YB 4UP9A 1ASYA 3TRZA 4R4IA 4UP7A 4PZ7A 5FLXc 3RN5A 4DKAC 2D0OA 3CPWA 3J80i 3HOVG 4DV0L 1HNZL 4NXML 1KC8C 3CW2C 4OO1I 4PMWA 2R7ZG 3PO2H 5C0XG 4UP8A 2I0QA 3F1ZA 4GOPC 2YTYA 1SROA 2F3IA 4R4TA 3I55A 4DV6Q 4NXNQ 1ASZA 4JI4L 1KHIA 4QL5A 1K0RA 5IP9H 4ME3A 3CMAA 4IFDG 2JE6I 2OCEA 2PNHA 3HKZG 1J5EL 3ERSX 4AYBE 4BA2I 1VQBA 4A3MH 1G6PA 4L5TA 2R6GA 1EFWA 2UXCQ 1E1TA 3ZJYC 3FP9A 2HQLA 3I2ZA 1L0WA 3T1HQ 2E2IH 4DUYL 2KENA 2BA1A 1Q46A 4LNQA 3UDFA 1HR0L 2VQFL 4YY3L 4A3CH 4JI5Q 3HKZE 2ID0A 1GVPA 1PH7A 1KXLA 1OXTA 3CF5A 1PH9A 1K9MC 5IWAQ 2UUBL 3I4NH 4DK6C 2ZTEA 4LF7Q 4B3RL 3OYYA 4TVAB 2E8GA 1QZGA 3FHWA 3RLNA 2NVQH 1HZ9A 2QEXA 2Q2TA 3WWVA 4BY1H 2DUDA 4BBRH 4P74A 3G71A 3H3VH 3PIOA 2R93G 4JI7Q 1RL2A 1OXXK 2H5XA 5IYCH 1YHQA 4GNXC 4A93H 2L15A 5C4XH 4OO1G 4A3GG 4LF6Q 3E9HA 4OWWB 3B6YA 2E5LQ 1WYDA 2V1CC 1Q86C 4P75A 5C44G 3M9BA 4DR1Q 1I6HH 4X6AH 1A8VA 4A4IA 2B29A 4JI6Q 4X65Q 4DR3Q 1Y14B 3PUWA 1EYGA 1VQLA 3FKIG 4BXXH 1CUKA 1A0IA 5IYBH 3H15A 2F4VQ 5GADC 1VQFA 1JJCB 3H3VI 1GM5A 3BZCA 5J3BA 3A5UA 4YCWA 4PZ6A 5IT9c 1HH2P 2K75A 3UDGA 1QVFA 4DV6L 3S2DH 4K0KQ 1SN8A 3PO2G 4GN4B 4A3DH 3S15H 3I4OA 4Y52H 2PI2A 1AH9A 2JA8H 3NELA 4HIKA 2UUCQ 1PFSA 3UDXA 1TWCH 2UXCL 5IP9G 1OXSC 3W1GA 1N8RC 3KLWA 4QIWE 1JT8A 4DV0Q 1BVSA 4A3MG 4NXMQ 2HT1A 2PI2E 1QVCA 2CFMA 3PSIA 2BH8A 4JI5L 3JAMc 1HNXQ 5GROA 2N49A 4IOCA 4GN3B 2WAQG 4JI4Q 4DR5Q 1B70B 4DV2Q 1XPRA 2EXDA 4UPAA 3OTOQ 1YJWA 4A3CG 1K8GA 2JA6H 2A1AA 3W1BA 4POFA 2UU9Q 4JC0A 4LFBQ 2OTJA 4L5SA 3J81j 4PZ8A 1EWIA 3Q8DA 3EBEA 3K7UC 3TQYA 1IBMQ 3I4NG 4DUYQ 1IZ6A 1K73C 4BY7H 4JI7L 4YY3Q 3ULPA 4R4OA 1WI5A 4DAYB 2WB1G 1YNXA 1VQ8A 4YCUA 3GTKH 3NEMA 5M3FH 3A74A 4BBRG 4LF6L 3J81i 3PIPA 3RZOH 1V43A 4JI3Q 2E5LL 5IYCG 4GNXB 4A93G 1VQ4A 1UE5A 3H0GH 3K0XA 4DR1L 1YEZA 1CSQA 2EIFA 3AFPA 4LUVA 4P71A 4P72A 5C4XG 3PUZA 1WOCA 4X65L 2WB1E 1N32Q 1VQEA 1WCMH 1SE8A 1C0AA 4Y7NH 2F4VL 3EN2A 4QY7A 4L5RC 1X55A 1W2BA 3S1QH 1PV4A 4DR4Q 2FXQA 2NVXH 3UE0A 1PH6A 1VQDA 1I50H 1GO3E 5IYBG 4BXXG 3STBC 1Q82C 4K0KL 1YBYA 3D31A 3G4SA 4IPDA 3HFZB 4DV3Q 2IHFA 4GNXA 4A76A 4GKJL 4QJFA 1B8AA 1EUJA 2RF4A 3J80c 1LUZA 4LF4Q 1FJGQ 4AQYQ 4GN5A 2UUCL 2A8VA 4A3DG 4X62L 1BBWA 1AE3A 3CCUA 1YJ9A 2CKZB 4APVA 2JA8G 5M5XH 4B3SL 2NZOA 3GO5A 1YZ6A 1KRTA 1HNXL 4A3JH 1SLJA 3CCLA 3DM3A 3K80C 1SR3A 4QGUA 2ZJQA 3HOUH 5JJLA 4DR5L 4DV2L 4BBSH 1VQPA 3OTOL 4JI0Q 1LTLA 4KLKA 4IPCA 1VQIA 1VQGA 2UU9L 4LFBL 1TXYA 1E1OA 5AJ3Q 1S40A 2LXKA 2NZHA 4HJ8A 1LM0A 1IBML 5GAGC 3AYHB 2JA6G 3M3YH 2B63G 2MO0A 3S17H 1S3OA 1NTGA 1KIXA 1Q7YC 5JEAG 1YHAA 4A3KG 1VQ9A 4WJ4A 1KQSA 4BY7G 1HNWQ 2IX0A 3GTJH 1EQQA 3GTGH 3W5OA 4HJAA 1H95A 4JI3L 5M3FG 4OWTB 1AE2A 4A3BH 1N32L 1OXVA 2YV5A 5E7NA 3BZKA 1OXUA 3JC66 3CXCA 1VQHA 3H0GG 4JBKA 1FVIA 4OXPA 2QA4A 2JK8A 4LF9Q 2YU9H 2VUMH 3ICEA 1SRUA 2AMCB 3U50C 4X66Q 1WCMG 2D62A 4QQBX 4A3LH 4XIGS 2JA7H 2N3SA 3AQQA 1JMCA 1RIPA 4C2MH 3TREA 5BR8Q 4DV3L 3BJUA 5IYDH 1CKMA 3PF4A 3CCQA 5GQOA 1KRSA 1OTCA 4L5QA 1MJEA 1X3FA 1N34L 2JEBI 1XNRQ 4LF4L 1FJGL 4AQYL 3K8AA 2ZTDA 2VNUD 5DLQE 4IJHA 4DR7Q 1DGSA 2Z0SA 4MTNA 3KJPA 1VQ7A 3AFQA 2RHQB 3I4MH 5C0XJ 4EQ5A 1IYJB 4LFAQ 1Q12A 2KHIA 1IBKL 4YHHQ 1X3EA 2Y0SG 4IJLA 2JJQA 5HGQA 1GKHA 4JI0L 1KD1C 1V1QA 4GKJQ 2MQHA 1P16A 2VW9A 3S1MH 1GD7A 1QUQB 5IP7H 5AJ3L 4IO9A 4A3JG 3HOUG 3TS2A 1TWHH 4JYAQ 2Q2UA 4BBSG 3PUVA 4X62Q 1L1OB 2CWPA 2HHHQ 2R7DA 2Y0SE 1Z9FA 2A19A 4YWKA 2R92H 2LSSA 1Z47A 4JV5L 4OWXB 1E24A 1Y1WH 3DLLA 1FGUA 3G48A 1HZCA 3CCSA 4B3SQ 2GVAA 1K3RA 3U4ZA 1N33Q 4OONA 2K5VA 2RHSB 3ER0A 4DV4Q 2NVYH 4A3EH 4JBMA 4NPSA 2IHEA 3RN2A 1HNWL 1UWVA 2Z6KA 1T9HA 1CKNB 4AH6A 3AEVA 2I5LX 2UXBL 3MEFA 2ZTCA 3UDIA 2NVTH 1QUQA 4UY8C 4DR2Q 2N78A 3SGIA 4C3JH 2OWOA 1HJPA 2AWOA 4HIMA 4YWMA 3S24A 1L1OA 2IX1A 5FJ8H 3STBD 4PG3A 2WAQE 4B3TQ 3F2BA 1TWAH 3J81c 1NMFA 1IBLL 4A3BG 4LF9L 1QZHA 3NBHB 3ULJA 4X66L 1PH8A 3PO3H 4BY1G 4O2DA 1X65A 1IL2A 4KHPL 1I94L 3E9IA 1CSPA 2XGTA 2AKWB 1CKNA 1NY4A 3F8TA 5BR8L 2VUMG 3HOZH 1UE1A 3PUXA 4LW1A 2NN6I 2E2JH 4X64Q 4HIOA 2VL6A 2JA7G 1XNRL 4LFCQ 3RZDH 3PCOB 1O7IA 2JQOA 4IPGA 5IYDG 3A5ZB 3OW2A 3CPFA 4KHZA 1YIJA 1SFOH 2BH2A 4DR7L 2EQSA 1WFQA 4JCVE 3GTQH 5ELNA 3PF5A 1NMGA 3KF8B 1VCIA 4AIMA 4LFAL 3GTOH 4NB3A 4MNOA 4YHHL 3CCJA 3UE1A 4BA1I 1MKHA 1UE6A 2N8NA 4LUOA 4A3FH 3HOYH 3M4OH 2BA0A 1R9TH 4ALPA 4P73A 2K14A 3G6EA 1K8AC 1Q1EA 1U0LA 3I4MG 1Q81C 1PH1A 1N34Q 1LYLA 1L2FA 1MIUA 2MFIA 4JYAL 1NE3A 3J7ZC 2OQ0A 2JA5H 2YYZA 4A3IH 3CC2A 4B3ML 5GAEC 4GLXA 1XMQL 5IP7G 2DGYA 1CKOA 2ZJRA 3CCMA 2Z6KC 2HHHL 1VQMA 2MO1A 1EIYB 1YJNA 4GKKQ 2ZM6Q 2K5HA 1PH2A 4DUZQ 3S2HH 1E7ZA 1IBKQ 1N33L 3KDFB 4DV4L 4DR6L 3E0EA 1D7QA 2UUAQ 2R92G 2ASBA 1XPUA 1Q8KA 1Y1WG 2K5NA 1L1OC 2PQAB 2Q2IA 3CP0A 4R4CA 2AWNA 2VS1A 1XMOQ 2XTIA 4DR2L 2VQEQ 4A3EG 1PHJA 2NN6G 1KAWA 2HIXA 2YTVA 4B3TL 4JV5Q 4AYBG 3GD7A 4JI1Q 1I3QH 2RCNA 3KF6A 4RG1A 2MNAA 3KDFA 5FJ8G 5M3MH 1M1KC 4HJ5A 3GDEA 1UE7A 2R7FA 1C9OA 3D0FA 1N9WA 1EQRA 3PUYA 4GLAC 3HOXH 3CCEA 4A75A 2UXBQ 2PQAA 3CC7A 2CCZA 4C3HH 3PO3G 5LMUQ 4DAMA 4X64L 3BU2A 1EIFA 2OQKA 3HKSA 2ES2A 4LFCL 2IT1A 4DV7Q 3GTPH 3HOZG 5JJIA 3KYHC 1MJCA 1TWFH 4R4QA 2GN5A 1IBLQ 3HOWH 5LMNW 4RMFA 1PH4A 1U5KA 2GVBA 3TEHB 5IE8A 3GTMH 3S1NH 3U4VA 1VQKA 1I94Q 4KHPQ 2CQOA 3CCRA 3L2PA 2ALYB 4JOIA 1JJ2A 1NBWA 2KBNA 1J6QA 4TQUS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 L;  4JI8 Q;  5FLM H;  4LF8 Q;  5M5W H;  1Q1B A;  3M85 A;  1S72 A;  3HOY G;  4JI2 Q;  3J7A 5;  1Y1V H;  3PV0 A;  4A3F G;  4OX9 Q;  2LXJ A;  1EOV A;  2Q2H A;  4IPH A;  5M5Y H;  4DV1 Q;  4GKK L;  4DR4 L;  1VQ5 A;  1X3G A;  2ZM6 L;  5IY0 A;  3M7N A;  1I5F A;  4DUZ L;  2JA5 G;  1G51 A;  4HJ9 A;  3MXN B;  4A3I G;  1XNQ Q;  2UXD Q;  2WFW A;  1PYB A;  4JG2 A;  5LMN Q;  1A62 A;  1UEB A;  3T1Y Q;  4GLV B;  2UUA L;  1A63 A;  1X6O A;  4IFD J;  4HID A;  2JEA I;  2QGQ A;  3M4Q A;  3PGZ A;  2D0P A;  1XMO L;  2K50 A;  5C3E H;  3EIV A;  1YVC A;  2VQE L;  4JBW A;  3NEN A;  1P8L A;  4J15 A;  1X54 A;  3CME A;  4B3M Q;  4LF5 Q;  3S14 H;  1FL0 A;  1XMQ Q;  3F2D A;  2K52 A;  3K81 C;  3RR5 A;  4YCV A;  4DNI A;  4JI1 L;  4GS3 A;  5JEA J;  3S1R H;  2I5H A;  3LGJ A;  1PYS B;  1N36 Q;  1VQA A;  2B3G A;  4WJ3 M;  2HIV A;  4DR6 Q;  1D8L A;  1XJV A;  1VQC A;  4NXN L;  3I56 A;  3TS0 A;  1E3P A;  2E2H H;  1HZB A;  2JA9 A;  4H02 A;  2WP8 J;  5LMU L;  2OTL A;  1PH3 A;  5M3M G;  2K4K A;  4GOP B;  1XTD A;  3HOV H;  3I7F A;  3K7A H;  3HOX G;  2R7Z H;  4DV7 L;  1BKB A;  1HR0 W;  1VQ6 A;  3S16 H;  1YHB A;  3T1H L;  4JOI C;  1QVG A;  1G29 1;  1XPO A;  3M4P A;  1HNZ Q;  3RLF A;  2ZJP A;  1HZA A;  1VS0 A;  1W3S A;  3RNU A;  4POG A;  3ULL A;  2F52 A;  5ELO A;  3F2C A;  2IY5 B;  4XTC S;  4DK3 C;  2VZA A;  3U58 A;  1JB7 A;  5HY6 A;  3HOW G;  2YTX A;  3A0J A;  1NJI C;  3CQZ H;  5IWA L;  4A3L G;  3L0O A;  4JI8 L;  1J5E Q;  3KOJ A;  3JAM i;  4LF7 L;  2B63 H;  4LF8 L;  4GOP A;  1PVO A;  4EX5 A;  2PMZ E;  4JI2 L;  5K36 G;  4OX9 L;  4MZ9 A;  2VY3 A;  3CCV A;  4A3K H;  1X9N A;  5C0X I;  5FLM G;  4DV1 L;  2C35 B;  5GAH C;  2AHO B;  1X56 A;  1PA6 A;  1HR0 Q;  1VQJ A;  1Y1V G;  2VQF Q;  2KHJ A;  1JJG A;  3KJO A;  1VQN A;  1WJJ A;  1XNQ L;  2UXD L;  4JBJ A;  4IFD I;  5LMN L;  3T1Y L;  5H1S E;  1E22 A;  3CAM A;  3CC4 A;  2I5M X;  2ATW A;  1IXR A;  4DV5 Q;  1VQO A;  2UUB Q;  3GTL H;  3CD6 A;  1JE5 A;  4B3R Q;  2R93 H;  1V9P A;  4YWL A;  4KI0 A;  2CWA A;  4HJ7 A;  4JI6 L;  1SMX A;  1K83 H;  4DR3 L;  4LF5 L;  4LWC A;  4R1J A;  1YIT A;  1YI2 A;  1PH5 A;  1KL9 A;  4A3G H;  3VDY A;  5C3E G;  3KFU A;  2KCT A;  1M90 C;  2KCM A;  1BBU A;  3KF6 B;  4DPG A;  1N36 L;  5C44 H;  5EAY A;  1C7Y A;  3IRB A;  4IOA A;  4LUZ A;  5JJK A;  4C3I H;  3FKI H;  4O0A A;  3L7Z C;  1TWG H;  4FDB A;  3RLO A;  5C4J H;  1B7Y B;  4UP9 A;  1ASY A;  3TRZ A;  4R4I A;  4UP7 A;  4PZ7 A;  5FLX c;  3RN5 A;  4DKA C;  2D0O A;  3CPW A;  3J80 i;  3HOV G;  4DV0 L;  1HNZ L;  4NXM L;  1KC8 C;  3CW2 C;  4OO1 I;  4PMW A;  2R7Z G;  3PO2 H;  5C0X G;  4UP8 A;  2I0Q A;  3F1Z A;  4GOP C;  2YTY A;  1SRO A;  2F3I A;  4R4T A;  3I55 A;  4DV6 Q;  4NXN Q;  1ASZ A;  4JI4 L;  1KHI A;  4QL5 A;  1K0R A;  5IP9 H;  4ME3 A;  3CMA A;  4IFD G;  2JE6 I;  2OCE A;  2PNH A;  3HKZ G;  1J5E L;  3ERS X;  4AYB E;  4BA2 I;  1VQB A;  4A3M H;  1G6P A;  4L5T A;  2R6G A;  1EFW A;  2UXC Q;  1E1T A;  3ZJY C;  3FP9 A;  2HQL A;  3I2Z A;  1L0W A;  3T1H Q;  2E2I H;  4DUY L;  2KEN A;  2BA1 A;  1Q46 A;  4LNQ A;  3UDF A;  1HR0 L;  2VQF L;  4YY3 L;  4A3C H;  4JI5 Q;  3HKZ E;  2ID0 A;  1GVP A;  1PH7 A;  1KXL A;  1OXT A;  3CF5 A;  1PH9 A;  1K9M C;  5IWA Q;  2UUB L;  3I4N H;  4DK6 C;  2ZTE A;  4LF7 Q;  4B3R L;  3OYY A;  4TVA B;  2E8G A;  1QZG A;  3FHW A;  3RLN A;  2NVQ H;  1HZ9 A;  2QEX A;  2Q2T A;  3WWV A;  4BY1 H;  2DUD A;  4BBR H;  4P74 A;  3G71 A;  3H3V H;  3PIO A;  2R93 G;  4JI7 Q;  1RL2 A;  1OXX K;  2H5X A;  5IYC H;  1YHQ A;  4GNX C;  4A93 H;  2L15 A;  5C4X H;  4OO1 G;  4A3G G;  4LF6 Q;  3E9H A;  4OWW B;  3B6Y A;  2E5L Q;  1WYD A;  2V1C C;  1Q86 C;  4P75 A;  5C44 G;  3M9B A;  4DR1 Q;  1I6H H;  4X6A H;  1A8V A;  4A4I A;  2B29 A;  4JI6 Q;  4X65 Q;  4DR3 Q;  1Y14 B;  3PUW A;  1EYG A;  1VQL A;  3FKI G;  4BXX H;  1CUK A;  1A0I A;  5IYB H;  3H15 A;  2F4V Q;  5GAD C;  1VQF A;  1JJC B;  3H3V I;  1GM5 A;  3BZC A;  5J3B A;  3A5U A;  4YCW A;  4PZ6 A;  5IT9 c;  1HH2 P;  2K75 A;  3UDG A;  1QVF A;  4DV6 L;  3S2D H;  4K0K Q;  1SN8 A;  3PO2 G;  4GN4 B;  4A3D H;  3S15 H;  3I4O A;  4Y52 H;  2PI2 A;  1AH9 A;  2JA8 H;  3NEL A;  4HIK A;  2UUC Q;  1PFS A;  3UDX A;  1TWC H;  2UXC L;  5IP9 G;  1OXS C;  3W1G A;  1N8R C;  3KLW A;  4QIW E;  1JT8 A;  4DV0 Q;  1BVS A;  4A3M G;  4NXM Q;  2HT1 A;  2PI2 E;  1QVC A;  2CFM A;  3PSI A;  2BH8 A;  4JI5 L;  3JAM c;  1HNX Q;  5GRO A;  2N49 A;  4IOC A;  4GN3 B;  2WAQ G;  4JI4 Q;  4DR5 Q;  1B70 B;  4DV2 Q;  1XPR A;  2EXD A;  4UPA A;  3OTO Q;  1YJW A;  4A3C G;  1K8G A;  2JA6 H;  2A1A A;  3W1B A;  4POF A;  2UU9 Q;  4JC0 A;  4LFB Q;  2OTJ A;  4L5S A;  3J81 j;  4PZ8 A;  1EWI A;  3Q8D A;  3EBE A;  3K7U C;  3TQY A;  1IBM Q;  3I4N G;  4DUY Q;  1IZ6 A;  1K73 C;  4BY7 H;  4JI7 L;  4YY3 Q;  3ULP A;  4R4O A;  1WI5 A;  4DAY B;  2WB1 G;  1YNX A;  1VQ8 A;  4YCU A;  3GTK H;  3NEM A;  5M3F H;  3A74 A;  4BBR G;  4LF6 L;  3J81 i;  3PIP A;  3RZO H;  1V43 A;  4JI3 Q;  2E5L L;  5IYC G;  4GNX B;  4A93 G;  1VQ4 A;  1UE5 A;  3H0G H;  3K0X A;  4DR1 L;  1YEZ A;  1CSQ A;  2EIF A;  3AFP A;  4LUV A;  4P71 A;  4P72 A;  5C4X G;  3PUZ A;  1WOC A;  4X65 L;  2WB1 E;  1N32 Q;  1VQE A;  1WCM H;  1SE8 A;  1C0A A;  4Y7N H;  2F4V L;  3EN2 A;  4QY7 A;  4L5R C;  1X55 A;  1W2B A;  3S1Q H;  1PV4 A;  4DR4 Q;  2FXQ A;  2NVX H;  3UE0 A;  1PH6 A;  1VQD A;  1I50 H;  1GO3 E;  5IYB G;  4BXX G;  3STB C;  1Q82 C;  4K0K L;  1YBY A;  3D31 A;  3G4S A;  4IPD A;  3HFZ B;  4DV3 Q;  2IHF A;  4GNX A;  4A76 A;  4GKJ L;  4QJF A;  1B8A A;  1EUJ A;  2RF4 A;  3J80 c;  1LUZ A;  4LF4 Q;  1FJG Q;  4AQY Q;  4GN5 A;  2UUC L;  2A8V A;  4A3D G;  4X62 L;  1BBW A;  1AE3 A;  3CCU A;  1YJ9 A;  2CKZ B;  4APV A;  2JA8 G;  5M5X H;  4B3S L;  2NZO A;  3GO5 A;  1YZ6 A;  1KRT A;  1HNX L;  4A3J H;  1SLJ A;  3CCL A;  3DM3 A;  3K80 C;  1SR3 A;  4QGU A;  2ZJQ A;  3HOU H;  5JJL A;  4DR5 L;  4DV2 L;  4BBS H;  1VQP A;  3OTO L;  4JI0 Q;  1LTL A;  4KLK A;  4IPC A;  1VQI A;  1VQG A;  2UU9 L;  4LFB L;  1TXY A;  1E1O A;  5AJ3 Q;  1S40 A;  2LXK A;  2NZH A;  4HJ8 A;  1LM0 A;  1IBM L;  5GAG C;  3AYH B;  2JA6 G;  3M3Y H;  2B63 G;  2MO0 A;  3S17 H;  1S3O A;  1NTG A;  1KIX A;  1Q7Y C;  5JEA G;  1YHA A;  4A3K G;  1VQ9 A;  4WJ4 A;  1KQS A;  4BY7 G;  1HNW Q;  2IX0 A;  3GTJ H;  1EQQ A;  3GTG H;  3W5O A;  4HJA A;  1H95 A;  4JI3 L;  5M3F G;  4OWT B;  1AE2 A;  4A3B H;  1N32 L;  1OXV A;  2YV5 A;  5E7N A;  3BZK A;  1OXU A;  3JC6 6;  3CXC A;  1VQH A;  3H0G G;  4JBK A;  1FVI A;  4OXP A;  2QA4 A;  2JK8 A;  4LF9 Q;  2YU9 H;  2VUM H;  3ICE A;  1SRU A;  2AMC B;  3U50 C;  4X66 Q;  1WCM G;  2D62 A;  4QQB X;  4A3L H;  4XIG S;  2JA7 H;  2N3S A;  3AQQ A;  1JMC A;  1RIP A;  4C2M H;  3TRE A;  5BR8 Q;  4DV3 L;  3BJU A;  5IYD H;  1CKM A;  3PF4 A;  3CCQ A;  5GQO A;  1KRS A;  1OTC A;  4L5Q A;  1MJE A;  1X3F A;  1N34 L;  2JEB I;  1XNR Q;  4LF4 L;  1FJG L;  4AQY L;  3K8A A;  2ZTD A;  2VNU D;  5DLQ E;  4IJH A;  4DR7 Q;  1DGS A;  2Z0S A;  4MTN A;  3KJP A;  1VQ7 A;  3AFQ A;  2RHQ B;  3I4M H;  5C0X J;  4EQ5 A;  1IYJ B;  4LFA Q;  1Q12 A;  2KHI A;  1IBK L;  4YHH Q;  1X3E A;  2Y0S G;  4IJL A;  2JJQ A;  5HGQ A;  1GKH A;  4JI0 L;  1KD1 C;  1V1Q A;  4GKJ Q;  2MQH A;  1P16 A;  2VW9 A;  3S1M H;  1GD7 A;  1QUQ B;  5IP7 H;  5AJ3 L;  4IO9 A;  4A3J G;  3HOU G;  3TS2 A;  1TWH H;  4JYA Q;  2Q2U A;  4BBS G;  3PUV A;  4X62 Q;  1L1O B;  2CWP A;  2HHH Q;  2R7D A;  2Y0S E;  1Z9F A;  2A19 A;  4YWK A;  2R92 H;  2LSS A;  1Z47 A;  4JV5 L;  4OWX B;  1E24 A;  1Y1W H;  3DLL A;  1FGU A;  3G48 A;  1HZC A;  3CCS A;  4B3S Q;  2GVA A;  1K3R A;  3U4Z A;  1N33 Q;  4OON A;  2K5V A;  2RHS B;  3ER0 A;  4DV4 Q;  2NVY H;  4A3E H;  4JBM A;  4NPS A;  2IHE A;  3RN2 A;  1HNW L;  1UWV A;  2Z6K A;  1T9H A;  1CKN B;  4AH6 A;  3AEV A;  2I5L X;  2UXB L;  3MEF A;  2ZTC A;  3UDI A;  2NVT H;  1QUQ A;  4UY8 C;  4DR2 Q;  2N78 A;  3SGI A;  4C3J H;  2OWO A;  1HJP A;  2AWO A;  4HIM A;  4YWM A;  3S24 A;  1L1O A;  2IX1 A;  5FJ8 H;  3STB D;  4PG3 A;  2WAQ E;  4B3T Q;  3F2B A;  1TWA H;  3J81 c;  1NMF A;  1IBL L;  4A3B G;  4LF9 L;  1QZH A;  3NBH B;  3ULJ A;  4X66 L;  1PH8 A;  3PO3 H;  4BY1 G;  4O2D A;  1X65 A;  1IL2 A;  4KHP L;  1I94 L;  3E9I A;  1CSP A;  2XGT A;  2AKW B;  1CKN A;  1NY4 A;  3F8T A;  5BR8 L;  2VUM G;  3HOZ H;  1UE1 A;  3PUX A;  4LW1 A;  2NN6 I;  2E2J H;  4X64 Q;  4HIO A;  2VL6 A;  2JA7 G;  1XNR L;  4LFC Q;  3RZD H;  3PCO B;  1O7I A;  2JQO A;  4IPG A;  5IYD G;  3A5Z B;  3OW2 A;  3CPF A;  4KHZ A;  1YIJ A;  1SFO H;  2BH2 A;  4DR7 L;  2EQS A;  1WFQ A;  4JCV E;  3GTQ H;  5ELN A;  3PF5 A;  1NMG A;  3KF8 B;  1VCI A;  4AIM A;  4LFA L;  3GTO H;  4NB3 A;  4MNO A;  4YHH L;  3CCJ A;  3UE1 A;  4BA1 I;  1MKH A;  1UE6 A;  2N8N A;  4LUO A;  4A3F H;  3HOY H;  3M4O H;  2BA0 A;  1R9T H;  4ALP A;  4P73 A;  2K14 A;  3G6E A;  1K8A C;  1Q1E A;  1U0L A;  3I4M G;  1Q81 C;  1PH1 A;  1N34 Q;  1LYL A;  1L2F A;  1MIU A;  2MFI A;  4JYA L;  1NE3 A;  3J7Z C;  2OQ0 A;  2JA5 H;  2YYZ A;  4A3I H;  3CC2 A;  4B3M L;  5GAE C;  4GLX A;  1XMQ L;  5IP7 G;  2DGY A;  1CKO A;  2ZJR A;  3CCM A;  2Z6K C;  2HHH L;  1VQM A;  2MO1 A;  1EIY B;  1YJN A;  4GKK Q;  2ZM6 Q;  2K5H A;  1PH2 A;  4DUZ Q;  3S2H H;  1E7Z A;  1IBK Q;  1N33 L;  3KDF B;  4DV4 L;  4DR6 L;  3E0E A;  1D7Q A;  2UUA Q;  2R92 G;  2ASB A;  1XPU A;  1Q8K A;  1Y1W G;  2K5N A;  1L1O C;  2PQA B;  2Q2I A;  3CP0 A;  4R4C A;  2AWN A;  2VS1 A;  1XMO Q;  2XTI A;  4DR2 L;  2VQE Q;  4A3E G;  1PHJ A;  2NN6 G;  1KAW A;  2HIX A;  2YTV A;  4B3T L;  4JV5 Q;  4AYB G;  3GD7 A;  4JI1 Q;  1I3Q H;  2RCN A;  3KF6 A;  4RG1 A;  2MNA A;  3KDF A;  5FJ8 G;  5M3M H;  1M1K C;  4HJ5 A;  3GDE A;  1UE7 A;  2R7F A;  1C9O A;  3D0F A;  1N9W A;  1EQR A;  3PUY A;  4GLA C;  3HOX H;  3CCE A;  4A75 A;  2UXB Q;  2PQA A;  3CC7 A;  2CCZ A;  4C3H H;  3PO3 G;  5LMU Q;  4DAM A;  4X64 L;  3BU2 A;  1EIF A;  2OQK A;  3HKS A;  2ES2 A;  4LFC L;  2IT1 A;  4DV7 Q;  3GTP H;  3HOZ G;  5JJI A;  3KYH C;  1MJC A;  1TWF H;  4R4Q A;  2GN5 A;  1IBL Q;  3HOW H;  5LMN W;  4RMF A;  1PH4 A;  1U5K A;  2GVB A;  3TEH B;  5IE8 A;  3GTM H;  3S1N H;  3U4V A;  1VQK A;  1I94 Q;  4KHP Q;  2CQO A;  3CCR A;  3L2P A;  2ALY B;  4JOI A;  1JJ2 A;  1NBW A;  2KBN A;  1J6Q A;  4TQU S; 
#chains in the Genus database with same CATH topology
 4A3I B;  2PW7 A;  4JI8 Q;  3C46 A;  1Q1B A;  2EJF C;  3M85 A;  3K5N A;  1D1K A;  1EOV A;  1O80 A;  2Q2H A;  4IPH A;  3NK9 A;  4DV1 Q;  1TR5 A;  5IY0 A;  1G51 A;  2ZXP A;  4A3I G;  1HHV A;  1XNQ Q;  1PYB A;  4JG2 A;  1I6V C;  1UEB A;  4GLV B;  1K28 A;  2O4X A;  4HN7 A;  2CQA A;  4ZUI A;  2FMM A;  4H0L C;  1HA6 A;  2K50 A;  2F0P A;  5C3E H;  2M9V A;  3RD4 A;  1GUO A;  3CME A;  4B3M Q;  4L6T B;  4CDE C;  1FL0 A;  1XMQ Q;  3S14 H;  3ERO A;  3K81 C;  3HOX B;  4GS3 A;  1DYQ A;  2VXW A;  3T4A C;  1TKW B;  4C3H B;  1PYS B;  3MXN A;  1QG7 A;  1VQA A;  2B3G A;  4ZKB B;  1YNJ D;  4K6D A;  1E3P A;  5T1G A;  1HZB A;  2JA9 A;  4S3S A;  1TVX A;  3MVV A;  5IGD A;  3HOX G;  1HR0 W;  3GTM B;  3S1N B;  3S16 H;  1YHB A;  4C3H G;  4JOI C;  3QIA A;  4FYD A;  2RDF A;  1HNZ Q;  3RLF A;  2EYM A;  1K8O A;  3F2C A;  2VZA A;  3U58 A;  2B2V C;  1NJI C;  5IWA L;  1EU4 A;  4N8X 1;  4JI8 L;  4LF7 L;  1PVO A;  4EX5 A;  2RDG A;  3O13 A;  1K8M A;  4A3K H;  4DV1 L;  4V19 0;  3J81 L;  2KHJ A;  4HTH A;  3KJO A;  3BS1 A;  1XNQ L;  5C3E B;  3DMU A;  4JBJ A;  5H1S E;  3CAM A;  2O2L D;  3GTL H;  5EJW A;  4NW2 A;  4JI6 L;  4K5V A;  2EDG A;  4DR3 L;  4CKE A;  3R3O A;  4A3G H;  5C3E G;  3F2U A;  2KCM A;  4KV6 A;  3MAQ A;  2VB3 X;  4JW0 A;  3OOC A;  2EYJ A;  2E75 C;  4LUZ A;  3VR6 A;  4KKU A;  3G7L A;  3S16 B;  2OEO A;  1CK1 A;  2XRQ D;  5DM7 3;  1TWG H;  3RLO A;  5C4J H;  1II3 A;  3M4Y A;  3TZU A;  1SNM A;  4DKA C;  4DV0 L;  1MSG A;  4HSP A;  5KRU A;  1HNZ L;  1CZW A;  3PIO 3;  5EGT A;  2I0Q A;  4GOP C;  4NMZ A;  2YTY A;  1SRO A;  1SNQ A;  4DV6 Q;  1EL0 A;  5EQ0 A;  5C5M A;  1TS4 A;  2B2Y C;  1KHI A;  1X3Q A;  2QF7 A;  2JE6 I;  4BA2 I;  1SYF A;  3GTQ B;  1PFB A;  1I4H A;  2AQ3 B;  1F2L A;  1LO5 D;  1EFW A;  3FP9 A;  2DNC A;  3I2Z A;  2E2I H;  3MFY A;  2EZV A;  2KEN A;  2L12 A;  4YY3 L;  3GTL B;  2K32 A;  4JI5 Q;  1GJX A;  1PH7 A;  1OXT A;  3CF5 A;  3I4N H;  1EY9 A;  4A3G B;  2E8G A;  1QZG A;  3FHW A;  3RLN A;  5CMD A;  1HZ9 A;  1EQT A;  2RCF A;  3GQB A;  1JCK B;  2K5W A;  1QWY A;  1OXX K;  1V8Q A;  1YHQ A;  4A93 H;  1WVL A;  2L15 A;  1EZ6 A;  5C4X H;  2MHV A;  4A3G G;  3BYY B;  1TWG B;  2QDB A;  2EOT A;  3E9H A;  5C4J B;  4K8I A;  4OWW B;  5ISR A;  1NSN S;  2V1C C;  4WJW A;  1I6H H;  1A8V A;  4A4I A;  2JSO A;  1A3T A;  1VQL A;  2F4V Q;  5C6A A;  5GAD C;  1JJC B;  1H9K A;  1E0B A;  2EVB A;  4CJ0 B;  2K75 A;  3C2P A;  3KBG A;  4DV6 L;  3S2D H;  5DEH A;  1TWF B;  1ROD A;  2E2I B;  3VYT A;  1I4X A;  2PI2 A;  2PW5 A;  3NEL A;  3D4R A;  4HIK A;  2F0M A;  4KMU C;  1N8R C;  3KLW A;  2I07 B;  3I4N B;  2BH8 A;  4RGN A;  4JI5 L;  1VDZ A;  5FO8 B;  1HNX Q;  2N49 A;  1CHP D;  4GN3 B;  4BS9 A;  4LJZ C;  4JI4 Q;  5E1F A;  3OTO Q;  1K8G A;  4GZY C;  1TQO A;  2K1B A;  2A1A A;  3NP8 A;  4POF A;  2JA6 H;  3BVG A;  3WOE A;  2OTJ A;  4L5S A;  3J81 j;  4PZ8 A;  5JEA H;  4A93 B;  3EBE A;  3K7U C;  4KD3 A;  1IBM Q;  3I4N G;  5C4X B;  2LKV A;  1WTP A;  1KLU D;  1WI5 A;  4DAY B;  1VQ8 A;  3NEM A;  5M3F H;  1I6H B;  2D5D A;  1JOK A;  3R8B A;  2EPB A;  3RZO H;  1V43 A;  5G3L D;  4RGM A;  4A93 G;  3W2D A;  2IW3 A;  5C4X G;  3S1R B;  3SK5 A;  3PUZ A;  1G6Z A;  3MXU A;  2F4V L;  3S2D B;  3H94 A;  3X3N A;  2FXQ A;  1SYC A;  5IGF A;  4F87 A;  4GKJ L;  3X3M A;  4QJF A;  3Q23 A;  1EUJ A;  3J80 c;  4AQY Q;  2K7V A;  1EEF D;  3ZYY X;  2A8V A;  3JAM E;  1FGB D;  1HPC A;  1BNZ A;  4JK1 C;  2JA6 B;  3GO5 A;  2B63 B;  1HNX L;  1SLJ A;  3CCL A;  5JJL A;  2ZJQ A;  2HQE A;  3OTO L;  1LTL A;  4KLK A;  1VQI A;  1VQG A;  1TXY A;  3V2T A;  5AJ3 Q;  2PPB C;  2LXK A;  1KNE A;  4DNT B;  3J80 L;  2NZ1 D;  5M3F B;  1IBM L;  3AYH B;  3I73 A;  2JA6 G;  2B63 G;  1NTG A;  3RZO B;  4O1N A;  4XYO A;  5JEA G;  1RDP D;  3H3V C;  4FF1 A;  1VQ9 A;  3MXP A;  1KTK A;  4IUU A;  3TN2 A;  4HJA A;  1LTB D;  5M3F G;  4F7X A;  4CKB A;  1OXV A;  4CGY B;  2FHT A;  3BZK A;  4JBK A;  2R3Z A;  4O42 A;  4C3I B;  1AFP A;  1SRU A;  3U50 C;  4DU9 A;  2IPK D;  4XIG S;  2N3S A;  1PTO D;  5I9O A;  1S5B D;  1PRT F;  2DJF C;  2PZT A;  4HMI A;  4PMC A;  3HP3 A;  3PF4 A;  1XNR Q;  4L5Q A;  1X3F A;  2CH4 W;  2JEB I;  4TKO B;  4AQY L;  1JOR A;  4C3I G;  2D2C C;  2F0G A;  5DLQ E;  1D6E C;  4EVO A;  4FF3 A;  1KDC A;  1O7L A;  3BYT B;  2A6E D;  3K6O A;  1IBK L;  5E4W C;  2JJQ A;  2BE5 C;  1KD1 C;  1LLR D;  1P16 A;  3EA6 A;  5IP7 H;  4I7Z C;  5AJ3 L;  3S1M H;  1TWH H;  2Q2U A;  2Z4H A;  2HCC A;  4X62 Q;  1PDQ A;  1ILP A;  4YWK A;  2A19 A;  4F88 A;  3P75 A;  2LSS A;  1Z47 A;  2XIW A;  4OWX B;  1E24 A;  1Y1W H;  5COR A;  4B3S Q;  3DEO A;  1K3R A;  1L0Y B;  3SDZ A;  3U4Z A;  4DR6 Q;  2K5V A;  4DV4 Q;  4A3E H;  2Z6K A;  2B8F A;  2UXB L;  2IL8 A;  4DR2 Q;  4C3J H;  1Q8I A;  4QF4 A;  2IX1 A;  3STB D;  2WAQ E;  2XVS A;  1AN8 A;  3L3O C;  3NBH B;  2L55 A;  1QZH A;  1X65 A;  1IL2 A;  3D4W A;  4KHP L;  1HQR D;  1CKN A;  2PNR C;  3F8T A;  3PUX A;  3I3C A;  2OF1 A;  4U68 A;  2VL6 A;  1ZYR D;  1GUS A;  4FP5 D;  5A35 A;  5IGC A;  1XNR L;  1WTH A;  3OWF A;  4B9W A;  1CI3 M;  2F0N A;  1YNJ C;  4X3S A;  1O7I A;  2BH2 A;  3AU7 A;  2CVR A;  1SFO H;  1LTT D;  4IUR A;  4JCV E;  5J39 A;  1VCI A;  1H9S B;  4AIM A;  3GTO H;  3S1M B;  1TWH B;  1MKH A;  4LUO A;  4A3F H;  1R9T H;  3NWT A;  1U0L A;  4DXF A;  1B50 A;  1LYL A;  2MFI A;  5I9P A;  2ICI A;  1Y1W B;  2YYZ A;  3TSS A;  3MHB A;  5GAE C;  4A3E B;  5IP7 G;  4HSV A;  1PRT B;  3CCM A;  2E76 C;  4ULL A;  3NWS A;  2E2D C;  4DUZ Q;  3KF8 A;  4DR6 L;  4AYB B;  2AQ2 B;  4DV4 L;  1VF5 C;  2KQ3 A;  4G7O C;  2UUA Q;  4EGV A;  2DN8 A;  2ASB A;  1CZG A;  1Y1W G;  2K5N A;  1XMO Q;  4DR2 L;  1LTG D;  4A3E G;  2NYZ D;  3Q0A A;  1BF4 A;  5HGT A;  1B9M A;  1R4Q B;  4XQN A;  3PQI A;  4KJO A;  4AYB G;  4CBV A;  4JI1 Q;  1I3Q H;  2XSC A;  3D4D A;  3TBI B;  3IAY A;  1SNP A;  1M1K C;  2XWJ B;  1C9O A;  4GLA C;  1EQR A;  3PUY A;  1HFG A;  2BCO A;  4L8J A;  3H91 A;  3K57 A;  2IT1 A;  3KYH C;  1MJC A;  3DEP A;  3GTO B;  5CV5 A;  4DXG A;  4R4Q A;  4A3F B;  2F0J A;  1IBL Q;  1R9T B;  3HOW H;  5IE8 A;  3TEH B;  5HUR A;  2F0E A;  1VQK A;  2LS0 1;  2KCC A;  5I2X A;  3CCR A;  2ALY B;  4JOI A;  5K36 H;  4OON A;  4DV5 L;  2SNS A;  1JOO A;  1H9J A;  3J7A 5;  5M5W H;  2GA4 B;  3PV0 A;  4A3F G;  3T51 B;  2B2V A;  4MHE A;  1D2B A;  2KED A;  1RHP A;  2HUG A;  3E6Z X;  4DUZ L;  2SOB A;  3W3A A;  3MXN B;  4Z9C B;  3SHL A;  2UUA L;  1A62 A;  3T1Y Q;  1F2Z A;  4HID A;  2JEA I;  2BDN A;  2NWG A;  1I4Q A;  2TSS A;  1XMO L;  4UDU C;  4LMQ D;  4JBW A;  1I3Q B;  3A7L A;  1SEB D;  4M8A A;  4FF4 A;  2KA7 A;  1UEA B;  4H13 C;  2K52 A;  2OXP A;  3NTK A;  4YCV A;  4DNI A;  4JI1 L;  5JEA J;  1B9N A;  2WKC A;  3CRK C;  3TP7 A;  2PMZ B;  3EJI A;  3I56 A;  3I91 A;  3TP6 A;  3QJY A;  1V1O A;  2E2H H;  1CA5 A;  2OTL A;  3HOV H;  2K4K A;  3HOW B;  3K7A H;  2R7Z H;  1HCZ A;  5C0X H;  3HZX A;  1NUC A;  4TSS A;  4KK7 A;  5KGU A;  1G29 1;  3M4P A;  3MC0 B;  3VR3 A;  1W3S A;  3RNU A;  3ULL A;  4IFD H;  3P1H A;  5M5W B;  4DK3 C;  1JB7 A;  3HOW G;  3OMC A;  3A0J A;  3CQZ H;  2R61 A;  3S9W A;  3KOJ A;  1J5E Q;  4GOP A;  3D8G A;  2KHS A;  2PMZ E;  4L63 B;  4IUP A;  5K36 G;  3QG1 A;  2VY3 A;  2B2Y A;  4H7B A;  5C0X I;  1MD2 D;  5GAH C;  2AHO B;  5FKA C;  2WKD A;  1HR0 Q;  1KDB A;  1BQQ T;  4IFD I;  4RKB A;  3T1Y L;  3E5S A;  3GV6 A;  1E22 A;  2I5M X;  2VB2 X;  2ATW A;  4KN4 C;  4B3R Q;  3CD6 A;  4YWL A;  5LL6 X;  2O5I C;  2RA4 A;  1SMX A;  5A2Q E;  4LWC A;  2RDH A;  3KK7 A;  2NTT A;  1YIT A;  1KL9 A;  1ICW A;  5IT9 E;  2OT2 A;  4XT1 B;  2EJG C;  1M90 C;  4ZYS A;  1S5C D;  2E2H B;  3KF6 B;  1BBU A;  2EYF A;  1EY5 A;  1LTA D;  5KNB A;  5EAY A;  3HOV B;  1QJO A;  3IRB A;  3K7A B;  3QOL A;  3WDN A;  4KKT A;  2R7Z B;  2WII B;  2K5Q A;  4PNY A;  4B9X A;  1ML0 D;  3L7Z C;  4FDB A;  4WFN 3;  1ASY A;  1F2Y A;  4UP9 A;  2SEB D;  5FLX c;  3AMU A;  3K0Y A;  3HOV G;  3J80 i;  1KC8 C;  4PMW A;  2R7Z G;  5C0X G;  4UP8 A;  3L9A X;  4R4T A;  4N8F A;  5DAU A;  3CMA A;  4IFD G;  1LV9 A;  1J5E L;  3ERS X;  4ZLT F;  1VQB A;  1G6P A;  4J8Q A;  1BCP D;  3IFD A;  2UXC Q;  3NQT A;  3RMH A;  3TME A;  2F3V A;  3SVM A;  5FLX L;  1HR0 L;  3A56 A;  4C1N I;  3NE5 B;  1B53 A;  3A54 A;  1KXL A;  1LTI D;  1PH9 A;  1K9M C;  5IWA Q;  3D3R A;  1SND A;  4B3R L;  4DK6 C;  2ZTE A;  4LF7 Q;  3OYY A;  2X6G A;  2NVQ H;  1MHW C;  3WOF A;  4DAV A;  1AEX A;  3WWV A;  4BBR H;  3G71 A;  3J7A V;  4QUC A;  2M00 A;  3PIO A;  4JI7 Q;  1LAB A;  5IYC H;  1W6K A;  1M8A A;  1EIG A;  2L0C A;  2E5L Q;  4IN3 A;  4P75 A;  4DR1 Q;  1H9R A;  3IKJ A;  1B1Z A;  4X6A H;  1S4Z A;  4JI6 Q;  4X65 Q;  4DR3 Q;  4ODG A;  1CUK A;  1A0I A;  3H15 A;  5KIX A;  1HTL D;  1EU3 A;  4QMG A;  4YCW A;  4RKL A;  5IGG A;  3HEJ A;  1BOS A;  2FFK B;  4ME5 A;  4GN4 B;  4A3D H;  3I4O A;  2F0S A;  4Y52 H;  1PTO C;  1AH9 A;  1BR9 A;  2K6A A;  2JA8 H;  1WD0 A;  2UUC Q;  1PFS A;  2UXC L;  1TWC H;  5CGK A;  3SE0 A;  3VR5 A;  4DV0 Q;  2HT1 A;  1MBY A;  1QNU A;  2PI2 E;  4XXE A;  4K5X A;  5JPM C;  3JAM c;  1EFI D;  4JPB W;  4IOC A;  2NVQ B;  1XYI A;  4DR5 Q;  4XQQ A;  3ONA B;  1TY2 A;  4BBR B;  2J7Z A;  3W1B A;  4LFB Q;  4HAE A;  4JC0 A;  2A6E C;  1F9R A;  1JWS D;  2N55 A;  3Q8D A;  5JOB A;  4F8M A;  3DHQ A;  1ZKO A;  3MTS A;  1IZ6 A;  4BY7 H;  4QCL A;  4JI7 L;  4YY3 Q;  3GTK H;  4BBR G;  1DJR D;  1I4R A;  1U4M A;  3S14 B;  3HGB A;  2F0H A;  2E5L L;  5IYC G;  1UE5 A;  2Z9H A;  4DR1 L;  2EIF A;  4U67 3;  1WOC A;  4X65 L;  1VQE A;  1C0A A;  2EY5 A;  3EN2 A;  3E3X A;  5KEE A;  4H44 C;  2NVX H;  3UE0 A;  4A3D B;  2RKS A;  3KBX A;  3STB C;  2JA8 B;  5C5L A;  1TWC B;  3HFZ B;  2EYL A;  2IHF A;  4GNX A;  1TU2 B;  1CFM A;  2F3W A;  1HRJ A;  2UUC L;  1T5X D;  1FD7 D;  4A3D G;  4QB4 A;  1AE3 A;  1ZYR C;  3CCU A;  5ELE A;  4APV A;  2JA8 G;  3T53 B;  1KRT A;  1VMP A;  4HCS A;  1SR3 A;  4QGU A;  3HOU H;  4DR5 L;  3KUP A;  4A3K B;  1VQP A;  1HFN A;  3SXH A;  3SK8 A;  1SYG A;  3EQL C;  1E1O A;  4LFB L;  1S40 A;  2NZH A;  4BY7 B;  3OW7 A;  1S3O A;  2PO4 A;  3MXG A;  3BDL A;  4A3K G;  2XWB B;  1A6X A;  3C1E A;  4BY7 G;  3KLS A;  5IOD A;  1DOM A;  2A68 D;  1K3B C;  3VYR A;  1EYA A;  1A2U A;  2YV5 A;  5EKK A;  1TS3 A;  1E2W A;  1W6J A;  2F0D A;  1STN A;  4I65 A;  2VUM H;  4LF9 Q;  2YU9 H;  4QQB X;  4X66 Q;  2AMC B;  2D62 A;  4IQZ A;  4A3L H;  2K03 A;  1SE3 A;  2JA7 H;  1JMC A;  3AQQ A;  1CKM A;  3Q22 A;  3ITP A;  2Y0S B;  4X3U A;  5CR3 A;  2Q8T A;  2VNU D;  4IJH A;  5CV4 A;  3HOU B;  1FNW A;  3OIP A;  3KJP A;  1VQ7 A;  1YNN D;  5C0X J;  4N9P A;  5BN4 A;  1Q12 A;  2Y0S G;  2EY2 A;  1GKH A;  1SYB A;  4GKJ Q;  2K28 A;  2VW9 A;  5ELC A;  1GD7 A;  1EY6 A;  3I8Z A;  2Q8I B;  3TS2 A;  3HOU G;  4M1U B;  4JYA Q;  1IL8 A;  3PUV A;  1U4P A;  2Y0S E;  1CTM A;  1Z9F A;  1WTQ A;  4DF7 A;  1FGU A;  5FK9 C;  2RHS B;  3RN2 A;  1F9P A;  1CKN B;  1QIL A;  2I5L X;  5TSS A;  2ZTC A;  2N78 A;  2VUM B;  1MI2 A;  2YU9 B;  2KVM A;  2AWO A;  4YWM A;  2JA7 B;  5FJ8 H;  3F2B A;  1STB A;  4LF9 L;  1GUN A;  4X66 L;  1LT6 D;  4O2D A;  2NTS A;  1I94 L;  3E9I A;  5D3D A;  5NUC A;  2VUM G;  3MEH A;  5ELD A;  1UE1 A;  4X64 Q;  1FYC A;  2JA7 G;  3SR1 A;  2WAC A;  3RZD H;  2JQO A;  3OW2 A;  1YIJ A;  1G8Z D;  3CPF A;  1WFQ A;  3SK6 A;  5ELN A;  3KF8 B;  4IZ8 A;  4MNO A;  4BA1 I;  1UE6 A;  1M4V A;  4ALP A;  4P73 A;  2K14 A;  4HED A;  4UAI A;  1Q81 C;  1PH1 A;  2EXZ A;  4HR7 B;  4JYA L;  1NE3 A;  1B3Q A;  4GLX A;  2ZXR A;  3D6C A;  2DGY A;  1CKO A;  3KLR A;  4GKK Q;  1VQM A;  2MO1 A;  1EIY B;  1YJN A;  2ZM6 Q;  5F2D A;  1IBK Q;  5CBA E;  1G2T A;  2Q2I A;  1L1O C;  4KY6 A;  3CP0 A;  4R4C A;  2B8G A;  2VQE Q;  1R4P B;  5I6Y A;  3J81 E;  1HQM C;  1DOK A;  4ZK9 B;  3GD7 A;  2RCN A;  4RG1 A;  2MNA A;  1Q90 A;  3KDF A;  5FJ8 G;  2K04 A;  3CKI B;  3GDE A;  4HJ5 A;  2EJM A;  2R7F A;  4K2K A;  3D0F A;  1N9W A;  3RZD B;  2UXB Q;  5CBE E;  4RWS C;  2PQA A;  3CC7 A;  3VA7 A;  4X64 L;  4RAU C;  3BU2 A;  2WV6 D;  5JJI A;  3GTP H;  3P20 A;  3NPP A;  1UNS A;  4R8I A;  2GN5 A;  3GP7 A;  1STA A;  4RMF A;  5LMN W;  1PH4 A;  4FVM A;  4KHP Q;  3U4V A;  4K5W A;  2RBM A;  1NBW A;  1F77 A;  5KND A;  1RCV D;  4CDD C;  4OHJ A;  4JI2 Q;  3H09 A;  1Y1V H;  3TP8 A;  5DNF A;  1QCB D;  5JAV A;  1SBB B;  5C4Z A;  5IIF A;  4GKK L;  1VQ5 A;  1GHJ A;  1Z6H A;  4YIJ A;  3KLS X;  2ZM6 L;  3M7N A;  1BCP C;  4HJ9 A;  1IYV A;  1ZXT A;  2WFW A;  2G9H D;  3M4Q A;  2F03 A;  1SSO A;  4TRD A;  2VQE L;  3H6M A;  3NEN A;  1V1P A;  4J15 A;  1IYU A;  2RVL A;  1E2Z A;  3RR5 A;  1SNO A;  2I5H A;  3LGJ A;  2G9D A;  2Z1C A;  3M7G A;  2G5D A;  1N36 Q;  2DNE A;  1CQV A;  1XJV A;  1EY7 A;  4NXN L;  3GTP B;  4ZUJ A;  4GOP B;  1XTD A;  2NBF A;  2KJX A;  1BKB A;  2F0U A;  3T1H L;  3N52 A;  1XPO A;  1FNV A;  1JWM D;  1EWH A;  2F52 A;  3K5O A;  5ELO A;  3NHH A;  1DCZ A;  1Y1V B;  5HY6 A;  2IWH A;  2ICE C;  2YTX A;  4NKL A;  4KTA A;  3L0O A;  2QKI C;  1WTO A;  2EY6 A;  3I4L A;  3JAM i;  4FXG C;  4JI2 L;  1C4Q A;  1A15 A;  3DM1 A;  1Y1V G;  3LWE A;  3MZ5 A;  1HUM A;  1JJG A;  1VQN A;  1WJJ A;  1LT5 D;  2L4N A;  3T56 B;  3CC4 A;  4DV5 Q;  2UUB Q;  1O7Y A;  2N88 A;  2QIL A;  2R93 H;  1V9P A;  1PYW D;  4KI0 A;  1EQV A;  5JJZ A;  1TS5 A;  1JB3 A;  2K5D A;  1K83 H;  4CDF C;  1QNK A;  3NQI A;  1YI2 A;  4DA2 A;  4OO1 H;  3KFU A;  2KCT A;  2KCN A;  1N36 L;  5C44 H;  4C3J B;  1GHK A;  1C7Y A;  1SAP A;  2F0T A;  1ILQ A;  3QOJ A;  1UUP A;  5CC4 A;  4ZQ3 A;  3TRZ A;  4R4I A;  3HKZ B;  5EPL A;  3CU7 A;  1S5F D;  4C3J G;  2D0O A;  4NXM L;  1STE A;  4OO1 I;  3PO2 H;  4KY7 A;  3E0J A;  2KEC A;  4QL5 A;  1K0R A;  2F4I A;  3A7A B;  1PZK D;  4ME3 A;  5IP9 H;  3HKZ G;  2PNH A;  1SFO B;  2Q8R E;  4AYB E;  5LL6 S;  1U4R A;  4L5T A;  2R6G A;  5C3X A;  1E1T A;  4DUY L;  4RFB A;  1Q46 A;  4LNQ A;  5FO9 B;  4Q5V A;  2B2T C;  2Z4I A;  3HKZ E;  1PRT D;  1GVP A;  2R93 B;  1SXT A;  2RQX A;  4XT3 B;  1K83 B;  2NB0 A;  3LWU A;  2UUB L;  4TVA B;  2QEX A;  5C44 B;  2Q2T A;  4BY1 H;  2DUD A;  3H3V H;  4I7A A;  1TS2 A;  2R93 G;  2NUC A;  3BVM A;  1RL2 A;  3QB3 A;  1BCP F;  2H5X A;  1Q3L A;  4IUN A;  3J7Y W;  1HXY D;  2HD3 A;  4OO1 G;  1SYE A;  2JYO A;  3B6Y A;  3NSW A;  3J80 E;  2FIN B;  1WYD A;  3P7J A;  5ELF A;  4C56 C;  5L37 A;  4QIW B;  5C44 G;  1TY0 A;  1XXG A;  2B29 A;  3PO2 B;  5I2Y A;  1Y14 B;  1KDA A;  1EYG A;  4BXX H;  2A68 C;  2A6H C;  3G6J B;  1VQF A;  1FR3 A;  3D6W A;  4UHV A;  3H3V I;  1GM5 A;  1STH A;  3A5U A;  4PZ6 A;  3SK4 A;  3UDG A;  1HH2 P;  1K0S A;  5EPJ A;  4MIU A;  2F0L A;  1D5M C;  4N9T A;  3PO2 G;  4EQO A;  3PIP 3;  4CJ1 B;  2ZXO A;  4EQN A;  1U4L A;  2A5H A;  3TDQ A;  5IP9 G;  1OXS C;  3W1G A;  4QIW E;  4IUQ A;  5KYL A;  1QVC A;  4KHV A;  4PMB A;  3EFX D;  3PSI A;  2EYO A;  2CW0 D;  4CHT B;  3NUC A;  1B70 B;  2C9O A;  4DV2 Q;  2EXD A;  4UPA A;  1YJW A;  1YNN C;  1XPR A;  2A73 B;  5I4D A;  2UU9 Q;  1EIH A;  1AZP A;  3TQY A;  2HDM A;  1CQF A;  1IW7 D;  2D9U A;  3ULP A;  1YNX A;  3OIQ A;  1QB5 D;  3BG3 A;  4JI3 Q;  4GNX B;  1BBX C;  3H0G H;  3K0X A;  1YEZ A;  1CSQ A;  4P72 A;  4LUV A;  3DWQ A;  5J22 A;  1WCM H;  2H4O A;  2KOL A;  1QOH A;  3U9O A;  4Y7N H;  4QY7 A;  4L5R C;  1W2B A;  3NTH A;  1PV4 A;  4DR4 Q;  2F0V A;  1U9R A;  3NBH A;  1PH6 A;  2F0F A;  4BXX G;  1GO3 E;  4HCE A;  2QDL A;  5D3I B;  1YBY A;  3G4S A;  4IPD A;  4DGZ A;  2BOS A;  3V05 A;  2DY8 A;  3C3L A;  1B8A A;  4EQP A;  2RF4 A;  4LF4 Q;  1QE6 A;  4GN5 A;  1YJ9 A;  2QCP X;  2CKZ B;  3CQZ B;  5JVH 3;  1CT1 D;  2NZO A;  1YZ6 A;  2Z8L A;  3UI2 A;  1D5Z C;  4DV2 L;  4IPC A;  2UU9 L;  4KN7 C;  4HJ8 A;  1LM0 A;  3HRZ C;  5GAG C;  1G91 A;  1JIC A;  3S17 H;  2E74 C;  2MO0 A;  4FF2 A;  4R9W A;  1Q7Y C;  4FXK C;  3H0G B;  4RGO S;  4WJ4 A;  1Z7T A;  2CH4 A;  1KQS A;  4OIK A;  3N6R A;  4ZAI A;  5IOC A;  3RUZ A;  2IX0 A;  3GTJ H;  1EQQ A;  3GTG H;  3W5O A;  1WCM B;  4JI3 L;  2JN4 A;  4Y7N B;  2EY1 A;  4RGT A;  4OWT B;  4Q0F A;  1AW7 A;  1Y8P B;  4FO2 A;  4A3B H;  4MTK A;  1OXU A;  5C4H A;  2X69 A;  3H0G G;  2L11 A;  3Q6S A;  2QA4 A;  2JK8 A;  3ICE A;  4DR4 L;  1WCM G;  5D14 A;  1ET9 A;  5EBC A;  5BR8 Q;  4KY5 A;  2RSN A;  3CCQ A;  4K6L A;  1KRS A;  1FNU A;  1MJE A;  1Y69 U;  1N34 L;  4LF4 L;  1VMC A;  5BN3 A;  2PYK A;  2ZTD A;  1RJT A;  1DGS A;  3TZD A;  3AFQ A;  2RHQ B;  3FPP A;  4DK1 A;  3I4M H;  4EQ5 A;  1H9M A;  4LFA Q;  1PFN A;  2XRS D;  2KHI A;  1BDO A;  4G57 A;  1X3E A;  4C1N K;  5FOB B;  2IJ0 A;  3S17 B;  4V0B A;  1NCV A;  1J8I A;  1LTR D;  3R2I A;  2CWP A;  1PLF A;  5EPK A;  3GTJ B;  3GTG B;  4JV5 L;  5D65 A;  3G48 A;  4KKS A;  1JWU D;  2GVA A;  4JBM A;  3ER0 A;  2NVY H;  4A3B B;  2IHE A;  2LMC B;  1UWV A;  1T9H A;  3TP5 A;  1IKL A;  3MEF A;  4DK0 A;  1EWC A;  3MFG A;  3UDI A;  2NVT H;  1QUQ A;  4UY8 C;  2BDO A;  3SGI A;  2OWO A;  1HJP A;  3FVQ A;  1L1O A;  1SMY D;  4B3T Q;  1TWA H;  2HDL A;  3J81 c;  4A3B G;  3PO3 H;  1A2T A;  3JAM L;  1CSP A;  2AKW B;  1XTC D;  3HOZ H;  5BR8 L;  2A69 D;  4LW1 A;  4HIO A;  1SDF A;  3ERQ A;  3I4M B;  3DWA A;  2MJ8 A;  3PCO B;  1ASZ A;  3ND8 A;  2EQS A;  1EYD A;  3GTQ H;  1RF2 D;  1X32 A;  4IAL A;  4LFA L;  2PZW A;  3UE1 A;  4G4K A;  4R8N A;  3HOY H;  2N8N A;  3M4O H;  3FEW X;  3I4M G;  3G6E A;  2L1B A;  3DXJ C;  1STY A;  1MIU A;  5G3L F;  4ZKC B;  2KEE A;  1ONL A;  2OQ0 A;  3J7Z C;  2JA5 H;  1Y8N B;  3CC2 A;  4B3M L;  2NVY B;  1XMQ L;  4ID6 A;  5EKL A;  1L0X B;  1PH2 A;  3S2H H;  2NVT B;  3KDF B;  1D7Q A;  1Q8K A;  2PQA B;  1TWA B;  2XTI A;  3GTK B;  1RKN A;  1PHJ A;  2K05 A;  4P2C B;  2F0I A;  3PO3 B;  4DAP A;  1LT3 D;  2YTV A;  4B3T L;  1ENF A;  3IL8 A;  3HOZ B;  1NNX A;  3KF6 A;  2EYP A;  5M3M H;  3LNN A;  3OPO A;  1UE7 A;  5C3W A;  3CCE A;  1A3V A;  1IHZ A;  4A75 A;  2F0O A;  2A6H D;  3PO3 G;  3OWE B;  5LMU Q;  4DAM A;  1ZEQ X;  1EIF A;  1WTX A;  2NVX B;  3HKS A;  5J1Z A;  2ES2 A;  4DV7 Q;  3HOZ G;  1TWF H;  4DFA A;  3HOY B;  3M4O B;  3I70 A;  1NAP A;  1U5K A;  2GVB A;  1ESR A;  4K2L A;  1I94 Q;  2CQO A;  1GUT A;  3A8J E;  1ICF B;  1GOZ A;  1JJ2 A;  2JA5 B;  1EOT A;  5JVG 3;  1KNA A;  4TQU S;  1X3P A;  3T13 A;  5FLM H;  5FO7 B;  5IGB A;  2B2W C;  4LF8 Q;  1S72 A;  3HOY G;  4OX9 Q;  2A74 C;  4XDX A;  1V1P B;  2LXJ A;  4B08 A;  1EY4 A;  3S2H B;  5M5Y H;  1X3G A;  4LAA A;  1AZQ A;  1J9O A;  1I5F A;  2WIN B;  2JA5 G;  3NXW A;  1ENA A;  2HCI A;  2UXD Q;  5LMN Q;  1A63 A;  1XWE A;  1X6O A;  4IFD J;  2QGQ A;  1PTO F;  3PGZ A;  3A55 A;  2D0P A;  1PRT C;  5FLX E;  3EIV A;  1YVC A;  1P8L A;  1DOL A;  1X54 A;  4J6H A;  5K5P A;  1WTR A;  4LF5 Q;  5M3M B;  3F2D A;  1KAB A;  1STG A;  3T16 A;  3EVQ A;  3S1R H;  1NR2 A;  4WJ3 M;  2HIV A;  4OIJ A;  1D8L A;  1VQC A;  3TS0 A;  2F0W A;  1SYD A;  3V96 A;  2KUM A;  4H02 A;  2WP8 J;  5LMU L;  1PH3 A;  5M3M G;  1CHQ D;  3HG9 A;  3I7F A;  4DV7 L;  1VQ6 A;  2ZT9 C;  2B2U C;  3K58 A;  1QVG A;  4OEM B;  2ZJP A;  4POG A;  1HZA A;  1VS0 A;  3R93 A;  2CHB D;  2IY5 B;  4XTC S;  4WRD A;  1PTO H;  1F9S A;  4A3L G;  5M5Y B;  1RTN A;  4NP5 A;  2B63 H;  4LF8 L;  3QR8 A;  1KAA A;  4OX9 L;  2QEJ C;  4MZ9 A;  3CCV A;  3AB9 A;  1X9N A;  5FLM G;  2C35 B;  1C8C A;  3BZD B;  1X56 A;  1PA6 A;  1VQJ A;  2VQF Q;  2DY7 A;  1SE2 A;  2UXD L;  5LMN L;  1IXR A;  1VQO A;  1JE5 A;  2B2T A;  1E2V A;  2CW0 C;  3OSO A;  2CWA A;  4HJ7 A;  3MA2 B;  4LF5 L;  4R1J A;  1GUG A;  1PH5 A;  1PXU A;  3VDY A;  2L5T A;  1VF7 A;  4DN4 M;  1MGS A;  1DON A;  3K5L A;  4DPG A;  3Q24 A;  4JVZ A;  4IOA A;  1IW7 C;  5JJK A;  4C3I H;  3FKI H;  1RTO A;  4NDX A;  4O0A A;  4CKC A;  3VYU A;  1LT4 D;  4IUV A;  1B7Y B;  4UP7 A;  4PZ7 A;  3RN5 A;  1PZJ D;  3FPU B;  2C5C A;  1O78 A;  1UAP A;  2JP1 A;  3GV3 A;  3LX0 A;  3CPW A;  1PTO B;  3CW2 C;  1HA5 A;  4G7H C;  3F1Z A;  5JPN C;  4NXN Q;  2F3I A;  3I55 A;  1B44 D;  4JI4 L;  5EKI A;  4E6I A;  1JR0 D;  1F2M A;  2OCE A;  4ABN A;  2EYH A;  4A3M H;  4J1M A;  3ZJY C;  3T1H Q;  2HQL A;  1L0W A;  1Y8O B;  5T1I A;  2BA1 A;  3UDF A;  2VQF L;  2QW7 A;  4A3C H;  2ID0 A;  4ILW A;  5CV9 A;  2B39 A;  1JOQ A;  4G7Z C;  2JXM B;  3BVZ A;  1JE4 A;  2LFN A;  4OGQ C;  1B2T A;  5ELB A;  4RHS A;  4P74 A;  3URY A;  4OEL B;  3FKI B;  2AUK A;  1C48 A;  2P5Z X;  4GNX C;  1GXD C;  5CV7 A;  4LF6 Q;  4BWG B;  2F0K A;  1WTV A;  2RSO A;  1Q86 C;  3A8K E;  3M9B A;  3ND9 A;  4RA8 A;  2H1E A;  3PUW A;  3FKI G;  5IYB H;  4RHR A;  1F9Q A;  1EYC A;  3BZC A;  5J3B A;  5EBD A;  5IT9 c;  4A3M B;  4KJN A;  1QVF A;  2PCF B;  4K0K Q;  1SN8 A;  1AP0 A;  3S15 H;  2WAQ B;  2M2L A;  2EE1 A;  3UDX A;  1DD2 A;  2K33 A;  1JT8 A;  1BVS A;  4A3M G;  1KLG D;  4NXM Q;  1T5E A;  2CFM A;  1TII D;  5A2Q L;  5GRO A;  5IT9 L;  2WAQ G;  3A8I E;  2WB1 B;  2O5J C;  4A3C G;  1O7Z A;  5AFW A;  3R2T A;  3VYS A;  1EWI A;  4KD4 A;  4DUY Q;  3K5M A;  1K73 C;  2MP1 A;  1JQY D;  4R4O A;  4CJ2 C;  2MUY A;  2WB1 G;  4YCU A;  4OL7 A;  1EY8 A;  1SJH D;  2SNM A;  3A74 A;  2V4D A;  4LF6 L;  3J81 i;  3PIP A;  1WD1 A;  1VQ4 A;  4IUT A;  4P71 A;  3AFP A;  1WTW A;  5BN5 A;  2WB1 E;  1HTP A;  1N32 Q;  1SE8 A;  3CRL C;  5E4X A;  1A3U A;  1X55 A;  3CHB D;  5DM6 3;  1EEI D;  2F0Q A;  3S1Q H;  4DAY A;  5I6W A;  2XNA C;  3S15 B;  1VQD A;  1I50 H;  5IYB G;  1SMY C;  1Q82 C;  4MN3 A;  4K0K L;  1CM9 A;  1TT2 A;  3D31 A;  4RH6 A;  4DV3 Q;  4PV1 C;  3QO2 A;  4A76 A;  3U9S A;  1LUZ A;  2X6L A;  1FJG Q;  2A69 C;  1EY0 A;  3PMF A;  4X62 L;  1BBW A;  2TMP A;  2IX3 A;  5M5X H;  4B3S L;  4A3J H;  1B4O A;  3DM3 A;  3K80 C;  3NBI A;  3VR2 A;  1SE4 A;  4BBS H;  1IKM A;  4JI0 Q;  1DXM A;  2F1M A;  2AQ1 B;  1DM0 B;  3FDT A;  5E3F A;  3QWN A;  2FJ2 A;  3M3Y H;  1KIX A;  1EZ8 A;  1YHA A;  1HNW Q;  2PZU A;  1H95 A;  4FXD A;  1LTS D;  2I46 A;  1AE2 A;  3S1Q B;  1N32 L;  4HMJ A;  1LAC A;  5E7N A;  2J4X A;  1I50 B;  3JC6 6;  3CXC A;  1VQH A;  5KYI A;  1SJE D;  1FVI A;  4OXP A;  1BUV T;  3K59 A;  1RIP A;  4C2M H;  3TRE A;  4K14 A;  4DV3 L;  3BJU A;  2LY7 A;  5IYD H;  5GQO A;  4QUF A;  1OTC A;  3VR4 A;  3FMC A;  4ZRZ A;  5M5X B;  1FJG L;  3K8A A;  4PQX A;  4RCO A;  4A3J B;  4DR7 Q;  2Z0S A;  1D1I A;  4BBS B;  4MTN A;  2ENB A;  3DUZ A;  1IYJ B;  4YHH Q;  4IJL A;  1PZI D;  5HGQ A;  2Z6B A;  4JI0 L;  1V1Q A;  4X3K A;  3M3Y B;  2MQH A;  4A3J G;  1QUQ B;  4IO9 A;  1ESF A;  3BDO A;  5M9O A;  4BBS G;  5IGE A;  3I90 A;  1L1O B;  3SEB A;  2HHH Q;  2R7D A;  2R92 H;  2AUJ D;  4K8J A;  2J0T D;  3NTI A;  3DLL A;  1HZC A;  3CCS A;  1N33 Q;  4NPS A;  1HNW L;  2NN6 H;  1ET6 A;  4BY1 B;  4AH6 A;  2MPM A;  1JC7 A;  3AEV A;  4X3T A;  4HIM A;  3S24 A;  3DWP A;  3MWY W;  4PG3 A;  2SDF A;  1SNC A;  1NMF A;  4C2M B;  1IBL L;  1B3A A;  3ULJ A;  1PH8 A;  3J7A F;  4BY1 G;  2XGT A;  2DJG C;  1NY4 A;  2NN6 I;  2E2J H;  4LFC Q;  2L9H A;  1XX8 A;  4IPG A;  5IYD G;  5CYU A;  4XQJ A;  3A5Z B;  4DR7 L;  4KHZ A;  4WOR A;  3PF5 A;  1CA6 A;  1NMG A;  4NB3 A;  4YHH L;  3CCJ A;  1NR4 A;  2BA0 A;  1K8A C;  1Q1E A;  1BCP B;  2R92 B;  1N34 Q;  1L2F A;  4CDC C;  1PFM A;  4A3I H;  2HHH L;  2ZJR A;  1I4G A;  2B2W A;  2Z6K C;  2K5H A;  3C1F A;  1E7Z A;  5COY A;  1HUN A;  1H9S A;  1N33 L;  1DZ1 A;  3E0E A;  4FNF A;  3IFT A;  1S5E D;  1ENC A;  4LK1 C;  2R92 G;  1G2S A;  4XYQ A;  1XPU A;  1S5D D;  2AWN A;  2VS1 A;  2K01 A;  3FRP B;  1MSH A;  2NN6 G;  1KAW A;  5KNC A;  1GUW A;  2FMC A;  2HIX A;  2PQE A;  4ZCK A;  5CV8 A;  4JV5 Q;  1RD9 D;  5CV6 A;  3OMG A;  2E2J B;  3VA5 A;  4RCN A;  1BO0 A;  1D5X C;  2MGS A;  3HOX H;  2CCZ A;  4C3H H;  5LHY 1;  3OHX C;  1PMR A;  2OQK A;  1BXT A;  4LFC L;  4DNR B;  3I72 A;  1I4P A;  2BE5 D;  3BDC A;  3GTM H;  3S1N H;  1OO9 B;  3HS0 C;  3L2P A;  2B2U A;  2KBN A;  1J6Q A;  2XN9 C; 
#chains in the Genus database with same CATH homology
 4DV5 L;  4JI8 Q;  5FLM H;  4LF8 Q;  5M5W H;  1Q1B A;  3M85 A;  1S72 A;  3HOY G;  4JI2 Q;  3J7A 5;  1Y1V H;  3PV0 A;  4A3F G;  4OX9 Q;  2LXJ A;  1EOV A;  2Q2H A;  4IPH A;  5M5Y H;  4DV1 Q;  4GKK L;  4DR4 L;  1VQ5 A;  1X3G A;  2ZM6 L;  5IY0 A;  3M7N A;  1I5F A;  4DUZ L;  2JA5 G;  1G51 A;  4HJ9 A;  3MXN B;  4A3I G;  1XNQ Q;  2UXD Q;  2WFW A;  1PYB A;  4JG2 A;  5LMN Q;  1A62 A;  1UEB A;  3T1Y Q;  4GLV B;  2UUA L;  1A63 A;  1X6O A;  4IFD J;  4HID A;  2JEA I;  2QGQ A;  3M4Q A;  3PGZ A;  2D0P A;  1XMO L;  2K50 A;  5C3E H;  3EIV A;  1YVC A;  2VQE L;  4JBW A;  3NEN A;  1P8L A;  4J15 A;  1X54 A;  3CME A;  4B3M Q;  4LF5 Q;  3S14 H;  1FL0 A;  1XMQ Q;  3F2D A;  2K52 A;  3K81 C;  3RR5 A;  4YCV A;  4DNI A;  4JI1 L;  4GS3 A;  5JEA J;  3S1R H;  2I5H A;  3LGJ A;  1PYS B;  1N36 Q;  1VQA A;  2B3G A;  4WJ3 M;  2HIV A;  4DR6 Q;  1D8L A;  1XJV A;  1VQC A;  4NXN L;  3I56 A;  3TS0 A;  1E3P A;  2E2H H;  1HZB A;  2JA9 A;  4H02 A;  2WP8 J;  5LMU L;  2OTL A;  1PH3 A;  5M3M G;  2K4K A;  4GOP B;  1XTD A;  3HOV H;  3I7F A;  3K7A H;  3HOX G;  2R7Z H;  4DV7 L;  1BKB A;  1HR0 W;  1VQ6 A;  3S16 H;  1YHB A;  3T1H L;  4JOI C;  1QVG A;  1G29 1;  1XPO A;  3M4P A;  1HNZ Q;  3RLF A;  2ZJP A;  1HZA A;  1VS0 A;  1W3S A;  3RNU A;  4POG A;  3ULL A;  2F52 A;  5ELO A;  3F2C A;  2IY5 B;  4XTC S;  4DK3 C;  2VZA A;  3U58 A;  1JB7 A;  5HY6 A;  3HOW G;  2YTX A;  3A0J A;  1NJI C;  3CQZ H;  5IWA L;  4A3L G;  3L0O A;  4JI8 L;  1J5E Q;  3KOJ A;  3JAM i;  4LF7 L;  2B63 H;  4LF8 L;  4GOP A;  1PVO A;  4EX5 A;  2PMZ E;  4JI2 L;  5K36 G;  4OX9 L;  4MZ9 A;  2VY3 A;  3CCV A;  4A3K H;  1X9N A;  5C0X I;  5FLM G;  4DV1 L;  2C35 B;  5GAH C;  2AHO B;  1X56 A;  1PA6 A;  1HR0 Q;  1VQJ A;  1Y1V G;  2VQF Q;  2KHJ A;  1JJG A;  3KJO A;  1VQN A;  1WJJ A;  1XNQ L;  2UXD L;  4JBJ A;  4IFD I;  5LMN L;  3T1Y L;  5H1S E;  1E22 A;  3CAM A;  3CC4 A;  2I5M X;  2ATW A;  1IXR A;  4DV5 Q;  1VQO A;  2UUB Q;  3GTL H;  3CD6 A;  1JE5 A;  4B3R Q;  2R93 H;  1V9P A;  4YWL A;  4KI0 A;  2CWA A;  4HJ7 A;  4JI6 L;  1SMX A;  1K83 H;  4DR3 L;  4LF5 L;  4LWC A;  4R1J A;  1YIT A;  1YI2 A;  1PH5 A;  1KL9 A;  4A3G H;  3VDY A;  5C3E G;  3KFU A;  2KCT A;  1M90 C;  2KCM A;  1BBU A;  3KF6 B;  4DPG A;  1N36 L;  5C44 H;  5EAY A;  1C7Y A;  3IRB A;  4IOA A;  4LUZ A;  5JJK A;  4C3I H;  3FKI H;  4O0A A;  3L7Z C;  1TWG H;  4FDB A;  3RLO A;  5C4J H;  1B7Y B;  4UP9 A;  1ASY A;  3TRZ A;  4R4I A;  4UP7 A;  4PZ7 A;  5FLX c;  3RN5 A;  4DKA C;  2D0O A;  3CPW A;  3J80 i;  3HOV G;  4DV0 L;  1HNZ L;  4NXM L;  1KC8 C;  3CW2 C;  4OO1 I;  4PMW A;  2R7Z G;  3PO2 H;  5C0X G;  4UP8 A;  2I0Q A;  3F1Z A;  4GOP C;  2YTY A;  1SRO A;  2F3I A;  4R4T A;  3I55 A;  4DV6 Q;  4NXN Q;  1ASZ A;  4JI4 L;  1KHI A;  4QL5 A;  1K0R A;  5IP9 H;  4ME3 A;  3CMA A;  4IFD G;  2JE6 I;  2OCE A;  2PNH A;  3HKZ G;  1J5E L;  3ERS X;  4AYB E;  4BA2 I;  1VQB A;  4A3M H;  1G6P A;  4L5T A;  2R6G A;  1EFW A;  2UXC Q;  1E1T A;  3ZJY C;  3FP9 A;  2HQL A;  3I2Z A;  1L0W A;  3T1H Q;  2E2I H;  4DUY L;  2KEN A;  2BA1 A;  1Q46 A;  4LNQ A;  3UDF A;  1HR0 L;  2VQF L;  4YY3 L;  4A3C H;  4JI5 Q;  3HKZ E;  2ID0 A;  1GVP A;  1PH7 A;  1KXL A;  1OXT A;  3CF5 A;  1PH9 A;  1K9M C;  5IWA Q;  2UUB L;  3I4N H;  4DK6 C;  2ZTE A;  4LF7 Q;  4B3R L;  3OYY A;  4TVA B;  2E8G A;  1QZG A;  3FHW A;  3RLN A;  2NVQ H;  1HZ9 A;  2QEX A;  2Q2T A;  3WWV A;  4BY1 H;  2DUD A;  4BBR H;  4P74 A;  3G71 A;  3H3V H;  3PIO A;  2R93 G;  4JI7 Q;  1RL2 A;  1OXX K;  2H5X A;  5IYC H;  1YHQ A;  4GNX C;  4A93 H;  2L15 A;  5C4X H;  4OO1 G;  4A3G G;  4LF6 Q;  3E9H A;  4OWW B;  3B6Y A;  2E5L Q;  1WYD A;  2V1C C;  1Q86 C;  4P75 A;  5C44 G;  3M9B A;  4DR1 Q;  1I6H H;  4X6A H;  1A8V A;  4A4I A;  2B29 A;  4JI6 Q;  4X65 Q;  4DR3 Q;  1Y14 B;  3PUW A;  1EYG A;  1VQL A;  3FKI G;  4BXX H;  1CUK A;  1A0I A;  5IYB H;  3H15 A;  2F4V Q;  5GAD C;  1VQF A;  1JJC B;  3H3V I;  1GM5 A;  3BZC A;  5J3B A;  3A5U A;  4YCW A;  4PZ6 A;  5IT9 c;  1HH2 P;  2K75 A;  3UDG A;  1QVF A;  4DV6 L;  3S2D H;  4K0K Q;  1SN8 A;  3PO2 G;  4GN4 B;  4A3D H;  3S15 H;  3I4O A;  4Y52 H;  2PI2 A;  1AH9 A;  2JA8 H;  3NEL A;  4HIK A;  2UUC Q;  1PFS A;  3UDX A;  1TWC H;  2UXC L;  5IP9 G;  1OXS C;  3W1G A;  1N8R C;  3KLW A;  4QIW E;  1JT8 A;  4DV0 Q;  1BVS A;  4A3M G;  4NXM Q;  2HT1 A;  2PI2 E;  1QVC A;  2CFM A;  3PSI A;  2BH8 A;  4JI5 L;  3JAM c;  1HNX Q;  5GRO A;  2N49 A;  4IOC A;  4GN3 B;  2WAQ G;  4JI4 Q;  4DR5 Q;  1B70 B;  4DV2 Q;  1XPR A;  2EXD A;  4UPA A;  3OTO Q;  1YJW A;  4A3C G;  1K8G A;  2JA6 H;  2A1A A;  3W1B A;  4POF A;  2UU9 Q;  4JC0 A;  4LFB Q;  2OTJ A;  4L5S A;  3J81 j;  4PZ8 A;  1EWI A;  3Q8D A;  3EBE A;  3K7U C;  3TQY A;  1IBM Q;  3I4N G;  4DUY Q;  1IZ6 A;  1K73 C;  4BY7 H;  4JI7 L;  4YY3 Q;  3ULP A;  4R4O A;  1WI5 A;  4DAY B;  2WB1 G;  1YNX A;  1VQ8 A;  4YCU A;  3GTK H;  3NEM A;  5M3F H;  3A74 A;  4BBR G;  4LF6 L;  3J81 i;  3PIP A;  3RZO H;  1V43 A;  4JI3 Q;  2E5L L;  5IYC G;  4GNX B;  4A93 G;  1VQ4 A;  1UE5 A;  3H0G H;  3K0X A;  4DR1 L;  1YEZ A;  1CSQ A;  2EIF A;  3AFP A;  4LUV A;  4P71 A;  4P72 A;  5C4X G;  3PUZ A;  1WOC A;  4X65 L;  2WB1 E;  1N32 Q;  1VQE A;  1WCM H;  1SE8 A;  1C0A A;  4Y7N H;  2F4V L;  3EN2 A;  4QY7 A;  4L5R C;  1X55 A;  1W2B A;  3S1Q H;  1PV4 A;  4DR4 Q;  2FXQ A;  2NVX H;  3UE0 A;  1PH6 A;  1VQD A;  1I50 H;  1GO3 E;  5IYB G;  4BXX G;  3STB C;  1Q82 C;  4K0K L;  1YBY A;  3D31 A;  3G4S A;  4IPD A;  3HFZ B;  4DV3 Q;  2IHF A;  4GNX A;  4A76 A;  4GKJ L;  4QJF A;  1B8A A;  1EUJ A;  2RF4 A;  3J80 c;  1LUZ A;  4LF4 Q;  1FJG Q;  4AQY Q;  4GN5 A;  2UUC L;  2A8V A;  4A3D G;  4X62 L;  1BBW A;  1AE3 A;  3CCU A;  1YJ9 A;  2CKZ B;  4APV A;  2JA8 G;  5M5X H;  4B3S L;  2NZO A;  3GO5 A;  1YZ6 A;  1KRT A;  1HNX L;  4A3J H;  1SLJ A;  3CCL A;  3DM3 A;  3K80 C;  1SR3 A;  4QGU A;  2ZJQ A;  3HOU H;  5JJL A;  4DR5 L;  4DV2 L;  4BBS H;  1VQP A;  3OTO L;  4JI0 Q;  1LTL A;  4KLK A;  4IPC A;  1VQI A;  1VQG A;  2UU9 L;  4LFB L;  1TXY A;  1E1O A;  5AJ3 Q;  1S40 A;  2LXK A;  2NZH A;  4HJ8 A;  1LM0 A;  1IBM L;  5GAG C;  3AYH B;  2JA6 G;  3M3Y H;  2B63 G;  2MO0 A;  3S17 H;  1S3O A;  1NTG A;  1KIX A;  1Q7Y C;  5JEA G;  1YHA A;  4A3K G;  1VQ9 A;  4WJ4 A;  1KQS A;  4BY7 G;  1HNW Q;  2IX0 A;  3GTJ H;  1EQQ A;  3GTG H;  3W5O A;  4HJA A;  1H95 A;  4JI3 L;  5M3F G;  4OWT B;  1AE2 A;  4A3B H;  1N32 L;  1OXV A;  2YV5 A;  5E7N A;  3BZK A;  1OXU A;  3JC6 6;  3CXC A;  1VQH A;  3H0G G;  4JBK A;  1FVI A;  4OXP A;  2QA4 A;  2JK8 A;  4LF9 Q;  2YU9 H;  2VUM H;  3ICE A;  1SRU A;  2AMC B;  3U50 C;  4X66 Q;  1WCM G;  2D62 A;  4QQB X;  4A3L H;  4XIG S;  2JA7 H;  2N3S A;  3AQQ A;  1JMC A;  1RIP A;  4C2M H;  3TRE A;  5BR8 Q;  4DV3 L;  3BJU A;  5IYD H;  1CKM A;  3PF4 A;  3CCQ A;  5GQO A;  1KRS A;  1OTC A;  4L5Q A;  1MJE A;  1X3F A;  1N34 L;  2JEB I;  1XNR Q;  4LF4 L;  1FJG L;  4AQY L;  3K8A A;  2ZTD A;  2VNU D;  5DLQ E;  4IJH A;  4DR7 Q;  1DGS A;  2Z0S A;  4MTN A;  3KJP A;  1VQ7 A;  3AFQ A;  2RHQ B;  3I4M H;  5C0X J;  4EQ5 A;  1IYJ B;  4LFA Q;  1Q12 A;  2KHI A;  1IBK L;  4YHH Q;  1X3E A;  2Y0S G;  4IJL A;  2JJQ A;  5HGQ A;  1GKH A;  4JI0 L;  1KD1 C;  1V1Q A;  4GKJ Q;  2MQH A;  1P16 A;  2VW9 A;  3S1M H;  1GD7 A;  1QUQ B;  5IP7 H;  5AJ3 L;  4IO9 A;  4A3J G;  3HOU G;  3TS2 A;  1TWH H;  4JYA Q;  2Q2U A;  4BBS G;  3PUV A;  4X62 Q;  1L1O B;  2CWP A;  2HHH Q;  2R7D A;  2Y0S E;  1Z9F A;  2A19 A;  4YWK A;  2R92 H;  2LSS A;  1Z47 A;  4JV5 L;  4OWX B;  1E24 A;  1Y1W H;  3DLL A;  1FGU A;  3G48 A;  1HZC A;  3CCS A;  4B3S Q;  2GVA A;  1K3R A;  3U4Z A;  1N33 Q;  4OON A;  2K5V A;  2RHS B;  3ER0 A;  4DV4 Q;  2NVY H;  4A3E H;  4JBM A;  4NPS A;  2IHE A;  3RN2 A;  1HNW L;  1UWV A;  2Z6K A;  1T9H A;  1CKN B;  4AH6 A;  3AEV A;  2I5L X;  2UXB L;  3MEF A;  2ZTC A;  3UDI A;  2NVT H;  1QUQ A;  4UY8 C;  4DR2 Q;  2N78 A;  3SGI A;  4C3J H;  2OWO A;  1HJP A;  2AWO A;  4HIM A;  4YWM A;  3S24 A;  1L1O A;  2IX1 A;  5FJ8 H;  3STB D;  4PG3 A;  2WAQ E;  4B3T Q;  3F2B A;  1TWA H;  3J81 c;  1NMF A;  1IBL L;  4A3B G;  4LF9 L;  1QZH A;  3NBH B;  3ULJ A;  4X66 L;  1PH8 A;  3PO3 H;  4BY1 G;  4O2D A;  1X65 A;  1IL2 A;  4KHP L;  1I94 L;  3E9I A;  1CSP A;  2XGT A;  2AKW B;  1CKN A;  1NY4 A;  3F8T A;  5BR8 L;  2VUM G;  3HOZ H;  1UE1 A;  3PUX A;  4LW1 A;  2NN6 I;  2E2J H;  4X64 Q;  4HIO A;  2VL6 A;  2JA7 G;  1XNR L;  4LFC Q;  3RZD H;  3PCO B;  1O7I A;  2JQO A;  4IPG A;  5IYD G;  3A5Z B;  3OW2 A;  3CPF A;  4KHZ A;  1YIJ A;  1SFO H;  2BH2 A;  4DR7 L;  2EQS A;  1WFQ A;  4JCV E;  3GTQ H;  5ELN A;  3PF5 A;  1NMG A;  3KF8 B;  1VCI A;  4AIM A;  4LFA L;  3GTO H;  4NB3 A;  4MNO A;  4YHH L;  3CCJ A;  3UE1 A;  4BA1 I;  1MKH A;  1UE6 A;  2N8N A;  4LUO A;  4A3F H;  3HOY H;  3M4O H;  2BA0 A;  1R9T H;  4ALP A;  4P73 A;  2K14 A;  3G6E A;  1K8A C;  1Q1E A;  1U0L A;  3I4M G;  1Q81 C;  1PH1 A;  1N34 Q;  1LYL A;  1L2F A;  1MIU A;  2MFI A;  4JYA L;  1NE3 A;  3J7Z C;  2OQ0 A;  2JA5 H;  2YYZ A;  4A3I H;  3CC2 A;  4B3M L;  5GAE C;  4GLX A;  1XMQ L;  5IP7 G;  2DGY A;  1CKO A;  2ZJR A;  3CCM A;  2Z6K C;  2HHH L;  1VQM A;  2MO1 A;  1EIY B;  1YJN A;  4GKK Q;  2ZM6 Q;  2K5H A;  1PH2 A;  4DUZ Q;  3S2H H;  1E7Z A;  1IBK Q;  1N33 L;  3KDF B;  4DV4 L;  4DR6 L;  3E0E A;  1D7Q A;  2UUA Q;  2R92 G;  2ASB A;  1XPU A;  1Q8K A;  1Y1W G;  2K5N A;  1L1O C;  2PQA B;  2Q2I A;  3CP0 A;  4R4C A;  2AWN A;  2VS1 A;  1XMO Q;  2XTI A;  4DR2 L;  2VQE Q;  4A3E G;  1PHJ A;  2NN6 G;  1KAW A;  2HIX A;  2YTV A;  4B3T L;  4JV5 Q;  4AYB G;  3GD7 A;  4JI1 Q;  1I3Q H;  2RCN A;  3KF6 A;  4RG1 A;  2MNA A;  3KDF A;  5FJ8 G;  5M3M H;  1M1K C;  4HJ5 A;  3GDE A;  1UE7 A;  2R7F A;  1C9O A;  3D0F A;  1N9W A;  1EQR A;  3PUY A;  4GLA C;  3HOX H;  3CCE A;  4A75 A;  2UXB Q;  2PQA A;  3CC7 A;  2CCZ A;  4C3H H;  3PO3 G;  5LMU Q;  4DAM A;  4X64 L;  3BU2 A;  1EIF A;  2OQK A;  3HKS A;  2ES2 A;  4LFC L;  2IT1 A;  4DV7 Q;  3GTP H;  3HOZ G;  5JJI A;  3KYH C;  1MJC A;  1TWF H;  4R4Q A;  2GN5 A;  1IBL Q;  3HOW H;  5LMN W;  4RMF A;  1PH4 A;  1U5K A;  2GVB A;  3TEH B;  5IE8 A;  3GTM H;  3S1N H;  3U4V A;  1VQK A;  1I94 Q;  4KHP Q;  2CQO A;  3CCR A;  3L2P A;  2ALY B;  4JOI A;  1JJ2 A;  1NBW A;  2KBN A;  1J6Q A;  4TQU S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...