1VQGA

Gene v protein mutant with ile 47 replaced by leu 47 (i47l)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKLTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potential use of additivity of mutational effects in simplifying protein engineering.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqgA00
1W3SA 3S2HH 3T1HL 4A3EH 1D8LA 1KC8C 3OTOQ 3CAMA 2I5LX 1E1TA 3PF4A 1EQQA 3GTPH 1TXYA 1QZHA 3OW2A 1YJ9A 1E3PA 3W1BA 1EQRA 1PYBA 4RMFA 4TQUS 1S72A 2CCZA 4BA1I 1CSQA 1CUKA 2KCMA 2VQFQ 4JI1L 4KI0A 2E5LQ 3FP9A 4A3GG 5JJLA 2IHFA 1UE5A 2A8VA 1XPOA 4JYAL 2CFMA 4OONA 1YBYA 4Y7NH 3NEMA 3S24A 1XNRL 4L5SA 2EXDA 3PGZA 1GD7A 1EWIA 3I2ZA 1QVGA 4JBMA 1N33Q 4L5QA 4A3FG 5IWAQ 1JB7A 3FKIH 1IBMQ 1X3GA 3TQYA 1JJGA 4LF9L 1VS0A 4X62L 4X66Q 1SROA 2OTLA 4JI3Q 4YCVA 4GKJL 4QQBX 1IBML 4P71A 1G291 4OWWB 1N34Q 3TREA 3UE1A 2UUBL 4BBRH 2JA5H 3KF8B 4JI2Q 2R92H 1HR0W 1I50H 2N8NA 3STBD 4AQYQ 2MFIA 3WWVA 4LF8Q 2MO1A 4AYBE 3G6EA 4LF5L 3U50C 4A75A 1VQNA 1PVOA 1Z9FA 4DR5Q 1N36Q 3RN2A 5HY6A 4YHHL 3F2DA 1OXUA 3KLWA 4JI8Q 3AQQA 1JJ2A 4AH6A 4OO1I 1YHBA 2PI2E 1HR0L 2RF4A 2ZJPA 4GOPA 4BY1G 1VQFA 1C0AA 2EIFA 1MJEA 4B3TQ 3NELA 4JC0A 4DV3L 5IYDG 1NE3A 1Q86C 1JT8A 3HFZB 3ER0A 1R9TH 3PIPA 5LMUL 1WFQA 4DR4Q 2NVYH 5JJIA 4NXMQ 2XTIA 2AWOA 4DV7L 4LF6Q 4TVAB 2JEBI 4RG1A 4A93H 5C0XI 3F2CA 2IX1A 3GDEA 1X54A 1B8AA 2R7ZG 3H0GG 2E5LL 4X6AH 4HIMA 3JAMc 4NXNQ 5BR8Q 2KENA 4DR2L 4A3LH 2Q2HA 1RL2A 2JE6I 2HQLA 5E7NA 5M3FH 4A3KG 3PO3G 1MJCA 3ICEA 2E8GA 4LWCA 4OWXB 2B63H 4EQ5A 1B70B 1QVFA 1E22A 3T1YL 4LF4L 5H1SE 2HHHL 2Y0SG 3PV0A 1J6QA 3K7UC 1YZ6A 2I0QA 1HNZQ 4IJLA 1LUZA 2VY3A 1PH1A 3GTKH 2DUDA 2KCTA 4QJFA 3HOYH 2VQEQ 2R7FA 3M4PA 1Y1WG 2PQAB 3CC2A 1ASYA 4KHZA 1XMOL 1VQLA 3U4VA 4DV1Q 3NENA 4LUVA 4DK3C 1NY4A 4HJ5A 2CQOA 2K50A 4IFDI 1VQ4A 3HOXG 5GROA 1A62A 5IT9c 2I5MX 4GKKQ 2WB1E 4LUOA 3J80i 2JA6G 2PNHA 4LFAL 2IX0A 1PYSB 3M4QA 1YVCA 1XPRA 1HNXL 3U58A 3NBHB 3PIOA 2HT1A 4LF5Q 1OXTA 4GN4B 5J3BA 1U0LA 2QEXA 4LF8L 3KOJA 2VUMG 1Z47A 2NN6G 4KLKA 3STBC 3VDYA 4DV3Q 4LFAQ 3CP0A 1J5EQ 1HNZL 1TWFH 4JV5Q 4PZ7A 4QIWE 4A93G 1WOCA 4QGUA 1E24A 4YWLA 1VQMA 1GO3E 4PG3A 2WFWA 4JBJA 3J7A5 1P16A 4A3EG 1QVCA 2PI2A 1RIPA 2Q2IA 3HOZG 2BH8A 4DV1L 4LFBL 5BR8L 4DR2Q 4R4IA 1VQ9A 3ZJYC 1OXVA 2JK8A 1S40A 2Z0SA 2NVXH 2VNUD 1PH9A 1SR3A 1KQSA 4GNXB 1JE5A 1K3RA 3G48A 4JI2L 4IFDG 2R93H 1WI5A 1LTLA 4AIMA 3PUVA 4B3RL 1YNXA 1Q1BA 2LXKA 1BVSA 1A8VA 1V1QA 1G51A 3GTOH 4BXXH 3BZKA 1O7IA 3K81C 3MEFA 4PZ8A 1K9MC 1XNQQ 4X66L 4X62Q 4GKJQ 3CCMA 3HOYG 1S3OA 1BBWA 2KBNA 1CKNB 1NMGA 2OCEA 3T1HQ 2Z6KA 1KXLA 3F8TA 5C3EG 4QY7A 3I4MH 4JBWA 5IP7G 1XNRQ 1J5EL 1P8LA 1HR0Q 2RHSB 3RLNA 2V1CC 4A3BG 3GD7A 3GTLH 1EIYB 1VQ8A 3BZCA 1L0WA 4JI6Q 1I6HH 1WYDA 1HNXQ 4LF6L 1GVPA 4PZ6A 1X55A 1Q7YC 4C2MH 1LYLA 5IYCH 4WJ3M 2ZM6Q 2CWPA 3CXCA 3EBEA 3CCRA 4A3CG 4HJ8A 2E2IH 1EUJA 2C35B 1VQCA 2VUMH 3HOVG 1UE1A 2UUBQ 4GLVB 1HZBA 2JA5G 2UUAL 3AYHB 4LUZA 3RNUA 4C3HH 2UXBL 1Y1VG 5LMNQ 3UE0A 3M85A 3M3YH 3ERSX 1CKMA 1SLJA 2VW9A 4DR3Q 1I94L 2LXJA 3PO2H 4DNIA 1Q12A 5C4XH 3TS2A 3I7FA 4P74A 3CCQA 4AYBG 2K75A 5HGQA 1PHJA 1IZ6A 4O0AA 4YY3L 3L2PA 4WJ4A 5FLMG 1X3FA 4IPCA 3S17H 1YITA 3TS0A 1T9HA 2N78A 4LF4Q 4Y52H 4QL5A 4UP9A 3JAMi 1UWVA 1PH2A 2EQSA 2RCNA 3UDXA 3ULJA 3CCSA 2D0OA 4HJ7A 2JA7H 3S1MH 1KAWA 3KDFB 3I4NH 1FVIA 4DUYL 4IPHA 3Q8DA 2F3IA 5GADC 4JI3L 5M5WH 1XMOQ 2N49A 4BXXG 5K36G 5FJ8H 4OWTB 1VQHA 4DAYB 2OTJA 1SMXA 1A0IA 4A3FH 3GTMH 1UE6A 1W2BA 1X65A 4YWMA 3I56A 2F52A 4DV2L 3HKZG 1PH6A 2JA6H 2Y0SE 2UUCL 4HIKA 3J7ZC 2E2JH 1H95A 3RR5A 4DV7Q 2ZJQA 2ZTCA 3CQZH 4YCWA 4OO1G 2R7ZH 4BBRG 4GLXA 2K5NA 4P75A 4A3KH 1KRTA 1VQGA 4GNXC 3KFUA 1VQIA 1V43A 4X64Q 3H3VI 3IRBA 1DGSA 2UUAQ 1GKHA 3L7ZC 3OTOL 4DV4Q 1HNWL 3D0FA 2NN6I 3GO5A 1WJJA 3PCOB 4YWKA 3CMAA 3AEVA 1Q8KA 1HZCA 4A3IH 5C4JH 2Z6KC 3H15A 3ULPA 2QGQA 1K0RA 3CCVA 1K8GA 4MTNA 2ES2A 1MIUA 4YCUA 4DV5L 1N9WA 2ASBA 5IP9G 2NZOA 4DR5L 1NJIC 1N36L 3M4OH 4DR6L 4B3RQ 3S15H 4A3DH 3D31A 4LFCQ 4IFDJ 1A63A 1SE8A 3HOUH 2K14A 1FJGL 1HJPA 3E9IA 4JCVE 4UP7A 3DLLA 5AJ3Q 2BA0A 5M3FG 4K0KQ 4UY8C 1L1OA 1TWGH 2VL6A 4P73A 3CMEA 2ATWA 1PH3A 4BY1H 2L15A 4DR4L 1X56A 3G71A 4DR3L 1C7YA 2F4VQ 4J15A 1BKBA 2RHQB 4JI8L 1BBUA 1XTDA 3W5OA 2ALYB 1WCMG 3PSIA 2K52A 2B29A 5IYBH 5GAEC 1N8RC 4JI4Q 3E0EA 2JA7G 3CCUA 2Q2UA 1CKOA 4A3MH 1I3QH 5M3MG 4IPDA 2NVTH 4DV6L 2JA8G 1KL9A 2KHJA 1SFOH 4R4QA 3FHWA 4DKAC 2QA4A 3S2DH 2XGTA 3M7NA 3CPWA 1Q1EA 5IYDH 3KYHC 1VQPA 2A1AA 1K8AC 3I4OA 4DAMA 4JI0Q 1Y14B 4NXML 4JI6L 4JI4L 4JOIC 3GTJH 1AH9A 3BJUA 4DV0Q 3MXNB 2R92G 3PUZA 2UXBQ 2GVBA 2K5HA 3A5ZB 4K0KL 1HH2P 3G4SA 3SGIA 1NTGA 4POFA 5C0XG 4POGA 3S1QH 4JYAQ 2OQKA 4DUZQ 2R6GA 5LMNW 3GTQH 4X65Q 2IY5B 4DV0L 2R93G 4O2DA 1KHIA 1XMQL 2I5HA 3K7AH 1XNQL 5IWAL 3KJOA 3FKIG 3A74A 1FGUA 2E2HH 4R4CA 5IP9H 5GAHC 4DR7Q 3PUWA 1D7QA 4A3GH 2UXCQ 3E9HA 4HIOA 3LGJA 2LSSA 4BA2I 2BA1A 5IP7H 3J81c 3HOWH 1JJCB 2AHOB 3UDIA 1QZGA 4XIGS 3J81j 4DUYQ 5M5XH 1YIJA 5M5YH 4B3MQ 2PMZE 2YV5A 2PQAA 1Q81C 1IL2A 3ULLA 3GTGH 3I55A 2VQEL 1VQEA 1N33L 1E1OA 3W1GA 5IYCG 1PH5A 2ZTDA 3PUYA 2K5VA 3DM3A 2YTVA 4A76A 1PV4A 3K0XA 2VZAA 3K8AA 5C44H 3K80C 3T1YQ 4LFCL 1PH4A 4APVA 4JI1Q 2WAQE 2B63G 3TRZA 1JMCA 2UXDQ 3U4ZA 4OX9Q 4HJAA 4BBSG 5DLQE 4GN5A 4DV5Q 5GQOA 2UU9Q 4B3TL 1C9OA 5IY0A 4LF7Q 4BY7G 3I4NG 1M90C 4HJ9A 1LM0A 4GS3A 2CKZB 5JEAJ 4GOPB 4LF7L 1EIFA 3RLOA 1PA6A 1OTCA 3CC4A 3H3VH 3S16H 1XPUA 1NMFA 3A5UA 1U5KA 1N32Q 3H0GH 3RZOH 3KF6A 4A3CH 1QUQB 3UDFA 5FLXc 1IBLL 3M9BA 4X65L 3CCEA 4B3SL 2YU9H 1N32L 1V9PA 1UEBA 4A3JG 1HZ9A 1VCIA 2JEAI 4KHPL 3AFPA 4R1JA 1VQAA 4NPSA 3S14H 4JOIA 4DK6C 1VQ5A 1VQ6A 2DGYA 4UPAA 2CWAA 5GAGC 1L2FA 1Q46A 3PO2G 1FL0A 3OYYA 2YTYA 3BU2A 3KJPA 5JJKA 5LMNL 4DR1Q 2UU9L 4A3LG 1YJWA 1VQOA 4L5TA 2OQ0A 3HOXH 2GN5A 4OX9L 1VQ7A 3PO3H 3HKSA 1Q82C 1VQKA 1EOVA 2YTXA 4JI5L 3CW2C 1GM5A 1IYJB 1HZAA 4IOAA 1EYGA 1VQBA 4A3DG 4DR7L 1E7ZA 4P72A 4MZ9A 3J80c 3CC7A 4DR6Q 2N3SA 3CCJA 1X6OA 2ID0A 3KDFA 1KRSA 4DR1L 2ZJRA 5LMUQ 1Y1WH 1QUQA 2D0PA 1I94Q 5C44G 3S1NH 5C0XJ 2BH2A 1X3EA 1YHAA 1TWHH 3F1ZA 4BBSH 3L0OA 5ELNA 4NXNL 4JV5L 5AJ3L 1TWAH 1PFSA 2AWNA 3HKZE 4GLAC 4KHPQ 3HOUG 5ELOA 1G6PA 3UDGA 2WB1G 3A0JA 1FJGQ 4H02A 4BY7H 4JI7Q 2UXCL 4A3MG 2MO0A 1OXXK 3PF5A 1CSPA 1CKNA 4YHHQ 2MNAA 2VQFL 4DPGA 2ZTEA 2R7DA 4FDBA 4IJHA 4MNOA 4LFBQ 1PH7A 1Y1VH 2D62A 1XJVA 4C3JH 3I4MG 3CD6A 2H5XA 1VQJA 5IE8A 1SRUA 1XMQQ 4DV2Q 1VQDA 2K4KA 4IPGA 4JG2A 1WCMH 1YEZA 4LW1A 4AQYL 1X9NA 3CPFA 1ASZA 4JI7L 2WP8J 4DV6Q 4JI5Q 4LNQA 4XTCS 3F2BA 4DV4L 5FJ8G 4L5RC 3HOWG 5M3MH 4UP8A 4A3JH 4X64L 5FLMH 3S1RH 1YI2A 2YYZA 1UE7A 4A4IA 4EX5A 2HIVA 3JC66 3RLFA 1IBLQ 4B3SQ 1OXSC 2KHIA 1K83H 4LF9Q 3PUXA 1TWCH 1IBKQ 2Q2TA 4ME3A 4IOCA 1B7YB 4R4TA 3TEHB 4JI0L 2NZHA 2GVAA 5EAYA 2UUCQ 4A3IG 1L1OC 3KF6B 5JEAG 2HHHQ 2AKWB 1K73C 1L1OB 4GNXA 4GKKL 2NVQH 1IBKL 2MQHA 3J81i 1EFWA 1N34L 3RZDH 1YHQA 1KIXA 3EN2A 2IHEA 4GOPC 1I5FA 1MKHA 2AMCB 2UXDL 4GN3B 3HOVH 1AE2A 2F4VL 2JA8H 3CF5A 1HNWQ 2JJQA 4ALPA 2ZM6L 5C3EH 2IT1A 1PH8A 4YY3Q 4IO9A 1IXRA 5IYBG 1AE3A 2B3GA 5C4XG 2HIXA 2VS1A 4A3BH 3CCLA 3HOZH 4JBKA 4NB3A 4OXPA 2WAQG 4C3IH 4B3ML 1KD1C 2FXQA 3B6YA 4R4OA 4HIDA 2JQOA 4DUZL 1YJNA 1M1KC 4PMWA 3AFQA 3EIVA 2OWOA 1NBWA 3RN5A 1SN8A 2JA9A 2A19A
chains in the Genus database with same CATH superfamily
3CAMA 1EQQA 4PMBA 1FD7D 3GTPH 3QOLA 1BO0A 4CDDC 3OW2A 4QIWB 4TQUS 1I3QB 2KEDA 3RUZA 2VQFQ 2HQEA 4IURA 4A3GG 1ZEQX 1UE5A 2A74C 1XPOA 4JYAL 3LWUA 1YBYA 2JP1A 1XNRL 3D4DA 3PGZA 3NSWA 1EWIA 4OGQC 4L5QA 5ELFA 5IWAQ 1SE4A 2AQ3B 1JB7A 1S5DD 1X3GA 1HRJA 2L9HA 5J22A 4IUNA 4P71A 1E2WA 1GXDC 4KKUA 3R93A 4BBRH 1HR0W 3STBD 1KDAA 1PRTF 4MIUA 3WWVA 1WTVA 2SDFA 3U50C 1VQNA 1PVOA 1N36Q 2E2DC 3RN2A 4YHHL 1EY9A 1IL8A 2KCCA 4OO1I 3TZUA 2OT2A 4EQNA 4BY1G 2EIFA 3NELA 2B2WC 5IYDG 2A69C 3HFZB 5CV5A 3ER0A 1R9TH 3NQIA 1Y8NB 1DOKA 4OEMB 3QO2A 4NXMQ 4TVAB 4RG1A 5C0XI 5D3IB 5CV8A 5C4XB 2R7ZG 3H0GG 5IT9L 4DR2L 2F0NA 1RL2A 4OIJA 2HQLA 3R8BA 3A56A 3SVMA 4C3JB 4HTHA 4LWCA 1IKMA 1CQVA 2EYFA 1H9SA 1E22A 2JA7B 1H9KA 3D6CA 2VUMB 1S4ZA 3PV0A 3K7UC 1PH1A 2DUDA 3NE5B 3Q23A 2KCTA 3HOYH 4KHZA 1IW7D 1ESRA 1S5BD 3U4VA 3NENA 1NY4A 2QDBA 1VQ4A 1CFMA 3HOXG 2B2TA 3HG9A 2WB1E 1Y8PB 2EE1A 3OWFA 4RGMA 1PYSB 1QJOA 1SJED 1BUVT 4JW0A 4GN4B 2JA8B 2NN6G 1ENCA 2VB2X 3ITPA 4DV3Q 3CP0A 2K1BA 1XXGA 4A3MB 4QGUA 3FPUB 4MTKA 1VQMA 1WTPA 1P16A 1QVCA 3TZDA 4LFBL 4ME5A 4R4IA 2L12A 2N55A 3NTHA 1NUCA 4H44C 1JE5A 4KV6A 1F2YA 3SHLA 4IFDG 1BBXC 2E76C 1LTLA 3QOJA 4IUUA 1YNXA 1Q1BA 3BDLA 1A8VA 1G51A 3GTOH 3MEFA 4E6IA 1XNQQ 3J80L 3S15B 2EYOA 1S3OA 3QB3A 3NP8A 5C4ZA 1BBWA 2KBNA 1CKNB 4L63B 4PV1C 1KXLA 2F0GA 1V1PA 1FNUA 5IP7G 4OO1H 1CZGA 3M3YB 3PO2B 1QWYA 4JVZA 1EIYB 1SMYC 3BZCA 3GTJB 4JI6Q 1HNXQ 4LF6L 1H9JA 2EVBA 2F0VA 2F0HA 2R7ZB 1SNPA 2KUMA 1X55A 4K8JA 4ZQ3A 4WJ3M 1LT4D 3SK4A 3CCRA 2HD3A 2EY5A 2PW5A 2C35B 1VQCA 2JA5G 3TSSA 1GHKA 4S3SA 4FXKC 3S1RB 1Y1VG 3Q0AA 3UE0A 1SLJA 2VW9A 2Z1CA 4DR3Q 2KHSA 4DNIA 5C4XH 3TS2A 3I7FA 4P74A 2D9UA 4AYBG 3HGBA 1TS3A 1MGSA 1X3FA 2XRSD 4IPCA 3S17H 1T9HA 5JJZA 1DYQA 1UWVA 2EQSA 4HJ7A 3TP7A 1KAWA 3KDFB 3I4NH 1SYCA 1XX8A 5GADC 5CYUA 2N49A 5FJ8H 4KD4A 1SMXA 4ID6A 1J8IA 1UE6A 3J80E 1X65A 4YWMA 4Q5VA 3HKZG 1QB5D 5A35A 2E2JH 2ZJQA 4KHVA 1AZQA 1ML0D 3MA2B 3W2DA 4A3DB 2CH4A 2OEOA 1QNUA 4OO1G 1SSOA 4GLXA 2K5NA 1KNEA 4A3KH 4GNXC 1VQGA 1VQIA 4X64Q 1LACA 4X3SA 3D0FA 2M00A 4X3TA 5C4JH 2R93B 2I46A 4O42A 1K0RA 3CCVA 4MTNA 1A3VA 3J81E 1EOTA 4YCUA 2HDMA 4DV5L 2NZOA 3M4OH 2JA5B 3KBXA 2KOLA 3S15H 2ICEC 1XWEA 4LFCQ 1A63A 1EZ8A 3DLLA 3S16B 4Y7NB 4NP5A 2IJ0A 1L1OA 1EY8A 1SE2A 1PH3A 2K01A 3G71A 2NBFA 1JE4A 1EFWA 3PSIA 1U9RA 2K52A 2DJGC 5GAEC 2F0IA 1K28A 3SR1A 5IGBA 5M3MG 2NVTH 4DV6L 3T13A 1KDBA 1SNDA 4CKBA 1BCPC 1HQMC 2XGTA 1MI2A 1VQPA 1GUOA 1Y14B 4JI6L 5HGTA 4JOIC 1AH9A 3BJUA 5COYA 2UXBQ 2GVBA 2K5HA 2LKVA 2NYZD 4K0KL 1HH2P 3G4SA 2CHBD 4POFA 5C0XG 1F77A 2OQKA 3J7AV 3GTQH 1F2ZA 1KHIA 1SXTA 3NPPA 1B50A 1EY6A 4MN3A 3KJOA 3VR5A 2ENBA 3R3OA 2F0FA 4A3GH 4HIOA 2BA1A 5JOBA 5TSSA 3E5SA 5D65A 4DUYQ 4F87A 2F0TA 2WB1B 1YIJA 2YV5A 2TSSA 2ZT9C 5IYCG 1PH5A 2CVRA 5C44B 3OOCA 1HFGA 3K8AA 5C44H 2EPBA 2PQEA 1LTRD 3I3CA 4LFCL 2FFKB 4XT1B 5C5LA 4BBSG 4HJAA 3GTPB 3O13A 4GN5A 4DV5Q 2A6HC 5FOBB 4B3TL 5CC4A 4K2KA 2B63B 3J81L 2CKZB 1EY5A 5JEAJ 1II3A 2F0WA 4GOPB 3H3VH 1Q8IA 1WD0A 3H0GB 4IUTA 3A5UA 2MP1A 3URYA 5M5WB 1T5XD 2QF7A 3RZOH 3FPPA 3UDFA 2MJ8A 3CCEA 3S2HB 1N32L 1O80A 4OHJA 1VCIA 4M1UB 2JEAI 1VQAA 1EIGA 4R9WA 1VQ6A 3NXWA 2DGYA 4UPAA 1Q46A 3PO2G 2NUCA 1K8OA 1HFNA 2UU9L 1YJWA 1VQ7A 2G9DA 1CHPD 5EJWA 3HKSA 4JI5L 4MHEA 1HZAA 4DR7L 1PTOD 4P72A 3J80c 1X6OA 2ID0A 3M4OB 3A55A 5IODA 5C44G 1YHAA 5CBAE 3BZDB 3L0OA 5LHY1 4BBSH 4JV5L 3HKZE 1PFSA 3HOUG 3A0JA 4H02A 2UXCL 1KAAA 2B2YC 3PF5A 4ULLA 2MNAA 5I2YA 4DPGA 3LNNA 4MNOA 4LFBQ 1YNNC 4CDFC 2H5XA 1VQJA 1XMQQ 1S72A 4LW1A 1WCMH 2WP8J 1WCMB 4JI5Q 3F2BA 1O7ZA 4DV4L 4RCOA 3SK8A 5IOCA 1STAA 4A4IA 4EX5A 2EXZA 3JC66 3RLFA 3WOEA 5C4HA 1IBLQ 1OXSC 1K83H 5FLXE 3ZYYX 3EFXD 3L9AX 4ME3A 5KNCA 1B7YB 5CV7A 1TKWB 2A6EC 1VMCA 3J7YW 3KF6B 5JEAG 4A3IG 3BYYB 4DAYA 1LTBD 4QB4A 3GTGB 1N34L 1YHQA 1KIXA 3EN2A 4GOPC 1IHZA 1EFID 2WKDA 5DEHA 2B2WA 2PZUA 4GN3B 3E3XA 1HNWQ 1ZYRD 4ZUJA 1O78A 2JA6B 2F0PA 3UI2A 3KUPA 3HOZH 4JBKA 5IGGA 1NNXA 2F1MA 1XTCD 1KD1C 4PMWA 3VYRA 5C5MA 1NBWA 2O4XA 1SN8A 1PYWD 3P7JA 2A19A 1W3SA 3S2HH 5EPLA 4A3EH 3OTOQ 3PF4A 3W3AA 1JQYD 3JAME 5A2QE 1TXYA 4B08A 3W1BA 1WD1A 1LTTD 4BA1I 1DXMA 2KCMA 2NZ1D 4KI0A 1H9RA 2IHFA 4HMJA 2L5TA 3T56B 2VXWA 4OONA 4A3KB 3NEMA 3S24A 3R2TA 1QVGA 4KK7A 1IBMQ 3TQYA 4X62L 4JI3Q 1SROA 2OTLA 4GKJL 4YCVA 1I6VC 3CHBD 1PZKD 2B2UA 5CORA 3UE1A 3X3MA 3KF8B 2JSOA 2N8NA 3OMGA 4AQYQ 2MFIA 3NBIA 1I4HA 2MO1A 2H1EA 1V1OA 4LF5L 5T1IA 4A75A 1T5EA 3LX0A 1Z9FA 4RKBA 3F2DA 3NQTA 3IAYA 1JJ2A 4AH6A 1STGA 2PI2E 1DOMA 1QG7A 4B9WA 1E2VA 1MJEA 1K3BC 4JC0A 4ZCKA 3GTOB 2FHTA 1JT8A 3Q6SA 3HP3A 2OF1A 5LMUL 5EBDA 4EQOA 2IPKD 2NVYH 2SNMA 3MC0B 3I91A 1K83B 1B8AA 2XWBB 2WINB 2E5LL 4X6AH 2M2LA 4HIMA 3PO3G 5AFWA 1TU2B 1MJCA 1PTOH 4OWXB 4HCSA 3VYTA 3T1YL 4LF4L 4XYQA 2Y0SG 4OIKA 1GUNA 5EKIA 1LUZA 3HOYB 4C3HB 1AEXA 4WRDA 2JXMB 1EWHA 3HOVB 4DV1Q 2A69D 3FDTA 4HJ5A 2K50A 4X3KA 2I5MX 3T4AC 3VA7A 4GKKQ 2IW3A 3KK7A 3J80i 4XQNA 5CGKA 3C2PA 5I6WA 1EZ6A 4LFAL 2A5HA 3M4QA 1XPRA 3U58A 3NBHB 4FF4A 5J3BA 5LL6S 2WKCA 1HNZL 1J5EQ 5DM63 4BBRB 3F2UA 4PZ7A 4F8MA 4QIWE 5KIXA 4A93G 2QILA 1WOCA 1EYCA 2BCOA 1BCPF 3G6JB 3HOUB 4YWLA 1B44D 2EJFC 2AQ2B 1STBA 3HKZB 4FVMA 2PI2A 4NMZA 3C46A 1LT3D 4B9XA 2BH8A 4DV1L 2EYJA 5BR8L 1ICFB 2Z9HA 1VQ9A 1WTHA 2Z0SA 3DWAA 1PH9A 1L0YB 2Z8LA 4GNXB 3VR6A 1DONA 1A2UA 3G48A 1WI5A 4AIMA 4B3RL 1RDPD 3K57A 4G7HC 3BZKA 3K81C 3V2TA 1K9MC 4X66L 5DNFA 3EJIA 1YNJD 3T1HQ 5I2XA 3TMEA 1TWAB 4QY7A 1LTSD 3HS0C 5KYIA 3RLNA 4IUPA 5F2DA 3GD7A 3GTLH 3CKIB 1I6HB 1I6HH 2X6LA 4PZ6A 4C2MH 1SNQA 3CXCA 2CWPA 3EBEA 4ZLTF 2H4OA 2QCPX 1EUJA 5FLXL 3S1MB 3HOVG 1UE1A 2UUAL 1HZBA 3GP7A 3AYHB 4U673 4C3HH 2UXBL 1STYA 1JICA 2RDHA 1HUMA 3M85A 3ERSX 3FMCA 3PO2H 2F0UA 3NTIA 3CCQA 1PHJA 3BDCA 1IZ6A 5FLMG 3U9OA 1I4RA 3GTQB 3P75A 3JAMi 1EQTA 2J0TD 1H95A 3UDXA 4LK1C 5D14A 1LT5D 1B4OA 2Q8IB 2F3IA 4IQZA 2FMCA 1EYAA 1NR2A 1SBBB 4OWTB 2WIIB 2WAQB 1MSHA 3GTMH 1F9RA 1W2BA 3OSOA 2JA6H 3I4LA 2NTTA 2RCFA 2ZTCA 1ET9A 2L1BA 4I7AA 1JCKB 4IN3A 4BBRG 1U4PA 4P75A 3WDNA 4LAAA 3A8JE 4X3UA 3C3LA 2PCFB 2K5WA 1GKHA 3OTOL 4DV4Q 1Q90A 3GO5A 2NN6I 4K8IA 1WJJA 3CMAA 1Q8KA 3TP8A 2QDLA 1TWFB 1MIUA 2ASBA 5FO8B 3P20A 1JWMD 4DR5L 2EYLA 1QE6A 3V05A 4B3RQ 3D31A 5IGDA 1SFOB 5FO9B 4UP7A 2IWHA 1UNSA 5M3FG 2QEJC 3KF8A 4P73A 1X56A 2F4VQ 2X6GA 1BBUA 3SEBA 5IYBH 2B29A 4GZYC 1V8QA 3P1HA 3E0EA 3L3OC 4KJNA 2JA7G 2K5QA 1CKOA 4A3MH 2KHJA 1FR3A 2EYHA 4FF2A 4DKAC 2QA4A 2IX3A 3M7NA 3KYHC 4IFDH 4NXML 3I4OA 1STEA 3A54A 4Q0FA 4K5XA 5EKKA 4DV0Q 3MXNB 4KTAA 2F0LA 1TS4A 1SNOA 1D5MC 3QWNA 1CA5A 3SGIA 2ZXOA 3ONAB 3S1QH 5LMNW 3N52A 2R93G 4O2DA 1HA6A 3SK5A 3RZDB 3FKIG 1FGUA 1HQRD 4DAPA 1MHWC 5M9OA 4R4CA 1JR0D 4DF7A 3E9HA 1Y69U 3LGJA 2R3ZA 5IP7H 3J81c 1MD2D 2PO4A 1JJCB 5M5XH 3H09A 1Q81C 1D5XC 3ULLA 1WTQA 2VQEL 4TKOB 3W1GA 3CRKC 3DM3A 4NKLA 4A76A 1I4XA 4K6DA 2VZAA 1RF2D 1TIID 4JI1Q 4K6LA 2UXDQ 5GQOA 5IY0A 1A2TA 3I4NG 4GS3A 1NAPA 2AQ1B 4G7ZC 4LF7L 2BDOA 3CC4A 2L4NA 4HEDA 1NMFA 2C9OA 3N6RA 1N32Q 1QUQB 4B3SL 4RFBA 1V9PA 1UEBA 1MBYA 1W6JA 1B3QA 1FYCA 4LJZC 4DNTB 4R1JA 1O7YA 4NPSA 3OIPA 2CWAA 4KKTA 1L2FA 1JORA 2D2CC 2YTYA 5LMNL 4DR1Q 1TWHB 2OQ0A 3PO3H 4LMQD 1B2TA 1ICWA 2NVXB 1Q82C 1EY4A 4N9PA 1IYJB 1UAPA 3MHBA 1EYGA 4V190 4MZ9A 4I7ZC 3I70A 4HCEA 4RHRA 3C1FA 3CCJA 1TVXA 4DR1L 5LMUQ 1Y1WH 2D0PA 4C1NI 1I94Q 2R92B 2XRQD 3S1NH 1NCVA 1TWHH 1WTOA 5AJ3L 4GLAC 1QOHA 5ELOA 2KJXA 1IYVA 1D1KA 4XT3B 2L11A 1SJHD 2MO0A 1OXXK 2PZWA 1CSPA 4HSVA 2R7DA 1HXYD 1GJXA 5IE8A 2DN8A 1VQDA 1D6EC 1E2ZA 1YEZA 2F3WA 4JI7L 3PIP3 3RMHA 3HOWG 3D4RA 5M3MH 3RD4A 4X64L 1YI2A 2L55A 2YYZA 5C0XH 4H7BA 3IL8A 3PUXA 1TWCH 3H91A 2Q2TA 4DGZA 4R4TA 3BVZA 2NZHA 2GVAA 3S17B 1L1OB 4GNXA 4GKKL 2NVQH 1NSNS 2MQHA 3J81i 2EYMA 3RZDH 3IKJA 1NR4A 2EDGA 1I5FA 4EQPA 2AMCB 2UXDL 1SYBA 1AE2A 3R2IA 4HMIA 2JJQA 5KNBA 2IT1A 4YY3Q 2KQ3A 4IO9A 1IXRA 4K2LA 2A6HD 5IIFA 5IYBG 2B3GA 1RTOA 5C4XG 2HIXA 4A3BH 4OXPA 2RKSA 4B3ML 2FXQA 4PMCA 4R4OA 5FO7B 1KNAA 4DUZL 2K5DA 5CR3A 1AP0A 1STHA 1XYIA 3D4WA 2JA9A 3V96A 1I4PA 4N8X1 3T1HL 1KC8C 1R4QB 2I5LX 4A3FB 4DXGA 1E1TA 3KBGA 1E3PA 1EQRA 1PYBA 4RMFA 4TRDA 4C3HG 1CUKA 4JI1L 2Y0SB 5JJLA 3FP9A 2A8VA 3K58A 5BN4A 2PZTA 5FKAC 2F0QA 4ZK9B 4XYOA 3VR2A 5CBEE 1GD7A 2BE5C 3I2ZA 1N33Q 1F2LA 5CV4A 3FKIH 4J8QA 4RHSA 1JJGA 1FGBD 2F0OA 5I4DA 1LO5D 1G291 2HUGA 2UUBL 4PQXA 1HTLD 2JA5H 4JI2Q 2R92H 2B8FA 1I50H 3MXNA 2B2UC 1HCZA 1X32A 1EL0A 3DM1A 2XVSA 4DR5Q 3FRPB 4KY5A 4A3GB 3KLWA 4JI8Q 3SDZA 1YHBA 2JN4A 1HR0L 2RF4A 4CDCC 3NWSA 3VA5A 2ZJPA 4GOPA 4ILWA 1VQFA 1C0AA 1TT2A 2RBMA 4B3TQ 4DV3L 1NE3A 1Q86C 3PIPA 3HZXA 1BF4A 2AWOA 4LF6Q 4A93H 4ZKBB 1RODA 3TDQA 3MFGA 4EGVA 4XQJA 1A6XA 3FVQA 3JAMc 2KENA 2Q2HA 2X69A 2AUKA 2JE6I 5M3FH 4NW2A 5E7NA 5IGCA 2FINB 1C4QA 3IFDA 2E8GA 1EQVA 1KLUD 1ZXTA 1B70B 1QVFA 3K7AB 4HSPA 5JPNC 2HHHL 1J6QA 1SYDA 1YZ6A 2MPMA 2VY3A 3GTKH 5HURA 5KNDA 2NB0A 1TY2A 2F0MA 2R7FA 3D6WA 1JOKA 1PFMA 2PQAB 1Y1WG 3CC2A 4A3IB 4JK1C 1XMOL 1WVLA 1K8MA 1Z7TA 5G3LF 1JC7A 4DK3C 5ELDA 5EQ0A 3A8KE 1D1IA 4RKLA 2HCIA 2RA4A 5GROA 1A62A 1PMRA 5IT9c 2EOTA 3JAML 5A2QL 4LUOA 5I9PA 2PNHA 2IX0A 1BR9A 1YVCA 3PIOA 4LF5Q 2KVMA 2K33A 5JVH3 1JOQA 4LF8L 3KOJA 4KLKA 3STBC 4QUFA 3VDYA 1ILQA 4QCLA 4KKSA 1EEFD 4ZAIA 1GO3E 2SNSA 4A3EG 1RIPA 3MEHA 3QIAA 2Q2IA 4DR2Q 2B2YA 1HHVA 1K0SA 3GTLB 1OXVA 1DCZA 2JK8A 3HEJA 4JPBW 4R8NA 1S40A 1SR3A 2VNUD 3H94A 1GUTA 4JI2L 3EROA 3DUZA 3MFYA 3CCMA 2JYOA 1NMGA 2OCEA 1PLFA 2BDNA 2BE5D 3K5MA 3DHQA 1G91A 2Z4HA 3I4MH 1XNRQ 1J5EL 1P8LA 4ZKCB 1HR0Q 1RJTA 4A3BG 1L0WA 1QCBD 3AMUA 5M3FB 2RQXA 4UDUC 1Q7YC 4Z9CB 2ZM6Q 1Q3LA 4M8AA 1STNA 4ZRZA 2UUBQ 2NVYB 2MHVA 1AW7A 3RNUA 3TP6A 4IUVA 5LMNQ 3M3YH 2I07B 2XIWA 4RGTA 2IL8A 2LXJA 1Q12A 4N8FA 3ERQA 1ESFA 5HGQA 1U4MA 4O0AA 4YY3L 3L2PA 4WJ4A 1BCPD 1I4QA 2O5IC 1YITA 4LF4Q 4Y52H 4QL5A 2E2IB 3OMCA 1PH2A 2RCNA 3S1MH 3CCSA 2JA7H 2D0OA 3VR3A 1FVIA 1SNCA 4IPHA 5CV9A 2F3VA 3CU7A 4C3IG 4K14A 3TBIB 4BXXG 5K36G 4DAYB 2OTJA 5KYLA 1A0IA 4ODGA 2F52A 2Y0SE 4HIKA 3VYSA 3J7ZC 4DV7Q 1PRTD 3QJYA 2DNEA 3CQZH 1SDFA 2DNCA 2G9HD 4J1MA 1ILPA 2EZVA 3Q22A 5JVG3 3NWTA 3KFUA 3OPOA 1DZ1A 4TSSA 2PW7A 2PYKA 3IRBA 4RWSC 1DGSA 4UAIA 3L7ZC 3GQBA 3PCOB 2LFNA 2EJGC 1ZYRC 1HZCA 2Z6KC 3H15A 2A68D 2QGQA 1PTOF 1K8GA 2ES2A 1EIHA 2K7VA 1N9WA 2R61A 1VDZA 2EY6A 1SMYD 4KMUC 4K5WA 4DR6L 3S14B 1RCVD 1SE8A 1FJGL 2O2LD 4OL7A 2EY2A 3MXGA 5AJ3Q 3E6ZX 5C3XA 1C48A 4K0KQ 1UEAB 1TWGH 2VL6A 3CMEA 2ATWA 4DR4L 4BY1H 2L15A 1C7YA 1X3QA 4DR3L 4J15A 1BKBA 2RHQB 1WCMG 2Q8RE 1I3QH 1SAPA 1SNMA 4IPDA 4CJ0B 2JA8G 5IT9E 2F0SA 3K0YA 1SFOH 2FMMA 1CQFA 5E1FA 3S2DH 1Q1EA 1TQOA 4JI0Q 4DAMA 4DNRB 3VYUA 4QF4A 1TWGB 3GTJH 1CHQD 2R92G 3PUZA 4H13C 1D5ZC 3A5ZB 4FF1A 1ZKOA 4POGA 2RSNA 2MUYA 3K5OA 1TR5A 4EVOA 3S9WA 1XNQL 4A93B 5M3MB 5D3DA 5IP9H 3PUWA 4XDXA 3K5NA 1H9SB 1RTNA 3I72A 2RSOA 2RDGA 1S5FD 2AHOB 3OWEB 1QZGA 4XIGS 1Y8OB 3IFTA 5M5YH 5I6YA 2PQAA 4NDXA 2HDLA 3I55A 4K5VA 2NVQB 1CK1A 1B1ZA 3T16A 2K5VA 2YTVA 3M4YA 1PV4A 1M8AA 1DM0B 5EPKA 1GUWA 4RH6A 4APVA 3OW7A 3TRZA 2YU9B 3U4ZA 2LMCB 4OX9Q 1A3UA 1IKLA 1A3TA 1C9OA 4KY7A 1PDQA 5ELEA 4LF7Q 1ONLA 3GV3A 1PTOB 4DN4M 1LM0A 4HJ9A 1JWSD 1VF5C 1EIFA 3RLOA 2L0CA 2SEBD 1OTCA 1IYUA 3S16H 3PO3B 1U5KA 2CQAA 1L0XB 3KF6A 1IBLL 4X65L 2YU9H 2Q8TA 4KHPL 4G57A 4F88A 1VQ5A 1DJRD 5GAGC 3KJPA 5JJKA 4A3LG 3EQLC 1VQOA 4L5TA 3HOXH 2GN5A 1IW7C 1EOVA 2YTXA 1AZPA 3CW2C 3K5LA 3FKIB 3BDOA 3WOFA 1GM5A 1VQBA 5KGUA 1E7ZA 3CC7A 4DR6Q 2K6AA 4C2MB 1B9NA 1QUQA 5E3FA 4BWGB 2CH4W 2BH2A 1X3EA 1PZJD 3F1ZA 3EVQA 5ELNA 4NXNL 3LWEA 1TWAH 2AWNA 4KHPQ 1G6PA 1AN8A 2M9VA 3HRZC 3MWYW 4RA8A 4A3MG 3MXUA 3MXPA 1EWCA 4YHHQ 2VQFL 5CV6A 4FDBA 4IJHA 2B39A 1U4LA 1PH7A 3S1QB 4C3JH 3CD6A 2XSCA 4IPGA 1SYEA 3QG1A 1X9NA 1HPCA 3CPFA 1PZID 2HCCA 5FJ8G 4L5RC 3S1RH 2A6ED 4CGYB 1UE7A 2HIVA 1TWCB 3BVGA 1IBKQ 5LL6X 2UUCQ 1L1OC 3CQZB 1PXUA 2AKWB 3Q24A 1K73C 3BVMA 2K03A 2IHEA 1MKHA 1KABA 2RDFA 2F4VL 2JA8H 1B3AA 4WJWA 3T51B 2ZM6L 5C3EH 1PH8A 2XNAC 1AE3A 1LTGD 3CCLA 4NB3A 5CMDA 3KLSX 1RKNA 4HIDA 5BN3A 2JQOA 1M1KC 3VR4A 2A68C 3RN5A 4A3EB 4FYDA 4RCNA 1D8LA 4DK1A 4ABNA 1EYDA 1PFBA 2E75C 1QZHA 1YJ9A 2G5DA 4KJOA 2QW7A 2CCZA 1CSQA 1CA6A 2E5LQ 1JB3A 3T53B 1RD9D 2CFMA 4Y7NH 4L5SA 2EXDA 2WACA 4JBMA 2MGSA 4A3FG 3A8IE 4RGOS 4LF9L 1VS0A 1M4VA 4X66Q 1G8ZD 4QQBX 1IBML 4XXEA 4FF3A 4OWWB 1Z6HA 1N34Q 3TREA 3X3NA 2F0KA 3S1NB 2B2VC 1SEBD 2NVTB 1I50B 4LF8Q 3NBHA 1QILA 4AYBE 3G6EA 1CI3M 3DEOA 2J4XA 5HY6A 1OXUA 5L37A 3AQQA 5EKLA 4DXFA 3GV6A 4BY7B 5G3LD 3SK6A 1ENAA 3MVVA 4KY6A 3G7LA 1KTKA 1GOZA 1R4PB 2CW0D 5E4WC 1WFQA 2LS01 1YNND 4DR4Q 5JJIA 2XTIA 4DV7L 2JEBI 1B53A 1DOLA 3F2CA 2WV6D 2IX1A 1FNVA 3GDEA 1DD2A 1X54A 3CRLC 1F9QA 1A15A 2TMPA 1G6ZA 3GTMB 1TY0A 4NXNQ 3SXHA 5BR8Q 4A3LH 5K5PA 4A3KG 2F03A 3ICEA 4A3BB 1EY7A 3EA6A 2B63H 4EQ5A 1OO9B 3A7AB 1BNZA 1KDCA 3I4NB 3H6MA 5H1SE 2I0QA 1HNZQ 4IJLA 5ELCA 3RZOB 1W6KA 4QJFA 2VQEQ 3M4PA 1KLGD 1ASYA 1VMPA 1ET6A 1VQLA 4LUVA 3HOZB 2CQOA 4IFDI 1U4RA 4HR7B 2JA6G 2ZXPA 1HNXL 2HT1A 5C3WA 1OXTA 3NHHA 4V0BA 1U0LA 2QEXA 2VUMG 1Z47A 4FNFA 4CDEC 1H9MA 4LFAQ 1TWFH 1V1PB 4JV5Q 1CT1D 1CZWA 4KN7C 1E24A 3TN2A 3C1EA 2WFWA 4PG3A 1EEID 4JBJA 3J7A5 3HOZG 5J1ZA 2KEEA 3I73A 3ZJYC 1G2SA 2NVXH 1KQSA 4P2CB 1K3RA 5C4JB 1LT6D 2R93H 4CHTB 3PUVA 2LXKA 1BVSA 5DAUA 1V1QA 4BXXH 1Y1WB 1O7IA 4KN4C 4PZ8A 4X62Q 4GKJQ 3HOYG 2K04A 4DA2A 2Z6KA 5IGEA 3F8TA 5C3EG 3MTSA 4JBWA 4DU9A 4BBSB 3I4MB 2RHSB 3D3RA 4G4KA 2V1CC 2F0JA 1JOOA 1VQ8A 4CKCA 2XN9C 1WYDA 1GVPA 3FEWX 2N88A 1MSGA 5IYCH 1LYLA 1BQQT 2EYPA 4A3CG 4HJ8A 2E2IH 1GUGA 2BOSA 2VUMH 5EPJA 4GLVB 1SYFA 4LUZA 1F2MA 2E2HB 1CKMA 1I94L 1PRTC 1HUNA 3D8GA 5C3EB 3MZ5A 2QKIC 3DWPA 3ND9A 2K75A 5NUCA 3SE0A 1Y1VB 4C56C 2PMZB 3TS0A 2N78A 5M5XB 4UP9A 3ULJA 2EJMA 2PPBC 4DUYL 4A3JB 2D5DA 3Q8DA 3MAQA 4C1NK 3K6OA 4JI3L 1TS5A 5M5WH 1XMOQ 1EU3A 1VQHA 2KA7A 4A3FH 3AB9A 3I56A 4DV2L 1PH6A 1TS2A 5C6AA 2UUCL 5FK9C 3RR5A 4YCWA 1JWUD 1PFNA 5JEAH 4IZ8A 4WFN3 1KRTA 2ICIA 4XQQA 2GA4B 1V43A 4FXGC 3H3VI 2UUAQ 1HNWL 4YWKA 3AEVA 4A3IH 2Z6BA 3ULPA 2DY8A 1G2TA 4DK0A 2RVLA 5IP9G 1NJIC 1N36L 1SYGA 1LV9A 4A3DH 4IFDJ 1BOSA 4O1NA 3HOUH 2K14A 1HJPA 3E9IA 4JCVE 2KCNA 3M7GA 1WTWA 2BA0A 5DM73 1GUSA 4UY8C 1I4GA 3E0JA 4DFAA 2EY1A 5T1GA 4CJ1B 4JI8L 1CTMA 1XTDA 3W5OA 1WTXA 2ALYB 1N8RC 4JI4Q 3CCUA 2Q2UA 1KL9A 4R4QA 4U68A 3FHWA 4HN7A 4PNYA 3OIQA 1BCPB 1J9OA 2DY7A 3CPWA 5IYDH 2P5ZX 1K8AC 2A1AA 2B8GA 5BN5A 3HOXB 4FO2A 3A7LA 4JI4L 4L6TB 5EBCA 2XWJB 5J39A 1PRTB 1NTGA 2E74C 4JYAQ 4DUZQ 2R6GA 4X65Q 2IY5B 2J7ZA 4DV0L 1YNJC 1XMQL 2I5HA 3K7AH 1UUPA 5IWAL 2B2VA 3A74A 4AYBB 1S5ED 2E2HH 4L8JA 3GTKB 4ZUIA 4C3JG 4DR7Q 5GAHC 1D7QA 1HTPA 2K05A 2NWGA 2V4DA 2UXCQ 2VB3X 1HA5A 2LSSA 4BA2I 4ZYSA 3HOWH 3UDIA 2B2TC 3J81j 4QMGA 5M5YB 2C5CA 2PMZE 4C3IB 4F7XA 4B3MQ 1IL2A 3GTGH 2OXPA 1F9SA 1VQEA 1N33L 1E1OA 3AU7A 4FP5D 2ZTDA 3PUYA 1EU4A 3K0XA 4WORA 3K80C 4HAEA 1E0BA 3T1YQ 1PH4A 2B63G 1VF7A 1S5CD 2WAQE 1JMCA 1BXTA 1LTID 5DLQE 2UU9Q 1PTOC 2O5JC 1D2BA 4QUCA 4BY7G 3PQIA 3PMFA 1M90C 4CJ2C 3I8ZA 1PA6A 1XPUA 2F4IA 4R8IA 3H0GH 1BDOA 3BG3A 4A3CH 4G7OC 5FLXc 3M9BA 4A3JG 2SOBA 1HZ9A 1FNWA 4N9TA 3AFPA 2E2JB 3S14H 4JOIA 5I9OA 4DK6C 1X3PA 3H3VC 1FL0A 3OYYA 3BU2A 3DXJC 2F0EA 3S2DB 2LY7A 4OX9L 3NK9A 4BY1B 4YIJA 5IGFA 1VQKA 1RHPA 3ND8A 1ENFA 4IOAA 3DWQA 4A3DG 2DJFC 4RAUC 5E4XA 3PIO3 2N3SA 3KDFA 5KRUA 1KRSA 2ZJRA 5JPMC 5EGTA 4CKEA 4FXDA 4KD3A 5C0XJ 1SE3A 2ZXRA 1O7LA 3UDGA 2WB1G 1FJGQ 4BY7H 3TP5A 4JI7Q 1CKNA 2ZTEA 3HOWB 4RGNA 1CM9A 3NTKA 1Y1VH 2D62A 2FJ2A 1XJVA 1AFPA 3I4MG 2R7ZH 1R9TB 1B9MA 1SRUA 4DV2Q 2CW0C 2K4KA 4JG2A 4OELB 4I65A 4AQYL 1ASZA 4DV6Q 4LNQA 2NN6H 4XTCS 4BS9A 4UHVA 3DMUA 3NUCA 4UP8A 5KEEA 4A3JH 5FLMH 4IUQA 1LTAD 4B3SQ 5ELBA 4J6HA 1C8CA 2KHIA 4LF9Q 2A73B 2NTSA 2K32A 2Z4IA 3TEHB 4IOCA 4JI0L 5EAYA 2HHHQ 1IBKL 1LLRD 2AUJD 3J7AF 3KLRA 1GHJA 3K59A 1WTRA 3OHXC 3HOVH 3I90A 1F9PA 3CF5A 1QNKA 4ALPA 2F0DA 5ISRA 1LABA 3BS1A 4DAVA 2KECA 4H0LC 3BYTB 3U9SA 1EY0A 2VS1A 4CBVA 2WAQG 4C3IH 3QR8A 5K36H 3KLSA 3B6YA 5JAVA 2PNRC 4IALA 1YJNA 2K28A 3AFQA 3EIVA 2OWOA 3DEPA
chains in the Genus database with same CATH topology
1W3SA 3S2HH 3T1HL 4A3EH 1D8LA 1KC8C 3OTOQ 3CAMA 2I5LX 1E1TA 3PF4A 1EQQA 3GTPH 1TXYA 1QZHA 3OW2A 1YJ9A 1E3PA 3W1BA 1EQRA 1PYBA 4RMFA 4TQUS 1S72A 2CCZA 4BA1I 1CSQA 1CUKA 2KCMA 2VQFQ 4JI1L 4KI0A 2E5LQ 3FP9A 4A3GG 5JJLA 2IHFA 1UE5A 2A8VA 1XPOA 4JYAL 2CFMA 4OONA 1YBYA 4Y7NH 3NEMA 3S24A 1XNRL 4L5SA 2EXDA 3PGZA 1GD7A 1EWIA 3I2ZA 1QVGA 4JBMA 1N33Q 4L5QA 4A3FG 5IWAQ 1JB7A 3FKIH 1IBMQ 1X3GA 3TQYA 1JJGA 4LF9L 1VS0A 4X62L 4X66Q 1SROA 2OTLA 4JI3Q 4YCVA 4GKJL 4QQBX 1IBML 4P71A 1G291 4OWWB 1N34Q 3TREA 3UE1A 2UUBL 4BBRH 2JA5H 3KF8B 4JI2Q 2R92H 1HR0W 1I50H 2N8NA 3STBD 4AQYQ 2MFIA 3WWVA 4LF8Q 2MO1A 4AYBE 3G6EA 4LF5L 3U50C 4A75A 1VQNA 1PVOA 1Z9FA 4DR5Q 1N36Q 3RN2A 5HY6A 4YHHL 3F2DA 1OXUA 3KLWA 4JI8Q 3AQQA 1JJ2A 4AH6A 4OO1I 1YHBA 2PI2E 1HR0L 2RF4A 2ZJPA 4GOPA 4BY1G 1VQFA 1C0AA 2EIFA 1MJEA 4B3TQ 3NELA 4JC0A 4DV3L 5IYDG 1NE3A 1Q86C 1JT8A 3HFZB 3ER0A 1R9TH 3PIPA 5LMUL 1WFQA 4DR4Q 2NVYH 5JJIA 4NXMQ 2XTIA 2AWOA 4DV7L 4LF6Q 4TVAB 2JEBI 4RG1A 4A93H 5C0XI 3F2CA 2IX1A 3GDEA 1X54A 1B8AA 2R7ZG 3H0GG 2E5LL 4X6AH 4HIMA 3JAMc 4NXNQ 5BR8Q 2KENA 4DR2L 4A3LH 2Q2HA 1RL2A 2JE6I 2HQLA 5E7NA 5M3FH 4A3KG 3PO3G 1MJCA 3ICEA 2E8GA 4LWCA 4OWXB 2B63H 4EQ5A 1B70B 1QVFA 1E22A 3T1YL 4LF4L 5H1SE 2HHHL 2Y0SG 3PV0A 1J6QA 3K7UC 1YZ6A 2I0QA 1HNZQ 4IJLA 1LUZA 2VY3A 1PH1A 3GTKH 2DUDA 2KCTA 4QJFA 3HOYH 2VQEQ 2R7FA 3M4PA 1Y1WG 2PQAB 3CC2A 1ASYA 4KHZA 1XMOL 1VQLA 3U4VA 4DV1Q 3NENA 4LUVA 4DK3C 1NY4A 4HJ5A 2CQOA 2K50A 4IFDI 1VQ4A 3HOXG 5GROA 1A62A 5IT9c 2I5MX 4GKKQ 2WB1E 4LUOA 3J80i 2JA6G 2PNHA 4LFAL 2IX0A 1PYSB 3M4QA 1YVCA 1XPRA 1HNXL 3U58A 3NBHB 3PIOA 2HT1A 4LF5Q 1OXTA 4GN4B 5J3BA 1U0LA 2QEXA 4LF8L 3KOJA 2VUMG 1Z47A 2NN6G 4KLKA 3STBC 3VDYA 4DV3Q 4LFAQ 3CP0A 1J5EQ 1HNZL 1TWFH 4JV5Q 4PZ7A 4QIWE 4A93G 1WOCA 4QGUA 1E24A 4YWLA 1VQMA 1GO3E 4PG3A 2WFWA 4JBJA 3J7A5 1P16A 4A3EG 1QVCA 2PI2A 1RIPA 2Q2IA 3HOZG 2BH8A 4DV1L 4LFBL 5BR8L 4DR2Q 4R4IA 1VQ9A 3ZJYC 1OXVA 2JK8A 1S40A 2Z0SA 2NVXH 2VNUD 1PH9A 1SR3A 1KQSA 4GNXB 1JE5A 1K3RA 3G48A 4JI2L 4IFDG 2R93H 1WI5A 1LTLA 4AIMA 3PUVA 4B3RL 1YNXA 1Q1BA 2LXKA 1BVSA 1A8VA 1V1QA 1G51A 3GTOH 4BXXH 3BZKA 1O7IA 3K81C 3MEFA 4PZ8A 1K9MC 1XNQQ 4X66L 4X62Q 4GKJQ 3CCMA 3HOYG 1S3OA 1BBWA 2KBNA 1CKNB 1NMGA 2OCEA 3T1HQ 2Z6KA 1KXLA 3F8TA 5C3EG 4QY7A 3I4MH 4JBWA 5IP7G 1XNRQ 1J5EL 1P8LA 1HR0Q 2RHSB 3RLNA 2V1CC 4A3BG 3GD7A 3GTLH 1EIYB 1VQ8A 3BZCA 1L0WA 4JI6Q 1I6HH 1WYDA 1HNXQ 4LF6L 1GVPA 4PZ6A 1X55A 1Q7YC 4C2MH 1LYLA 5IYCH 4WJ3M 2ZM6Q 2CWPA 3CXCA 3EBEA 3CCRA 4A3CG 4HJ8A 2E2IH 1EUJA 2C35B 1VQCA 2VUMH 3HOVG 1UE1A 2UUBQ 4GLVB 1HZBA 2JA5G 2UUAL 3AYHB 4LUZA 3RNUA 4C3HH 2UXBL 1Y1VG 5LMNQ 3UE0A 3M85A 3M3YH 3ERSX 1CKMA 1SLJA 2VW9A 4DR3Q 1I94L 2LXJA 3PO2H 4DNIA 1Q12A 5C4XH 3TS2A 3I7FA 4P74A 3CCQA 4AYBG 2K75A 5HGQA 1PHJA 1IZ6A 4O0AA 4YY3L 3L2PA 4WJ4A 5FLMG 1X3FA 4IPCA 3S17H 1YITA 3TS0A 1T9HA 2N78A 4LF4Q 4Y52H 4QL5A 4UP9A 3JAMi 1UWVA 1PH2A 2EQSA 2RCNA 3UDXA 3ULJA 3CCSA 2D0OA 4HJ7A 2JA7H 3S1MH 1KAWA 3KDFB 3I4NH 1FVIA 4DUYL 4IPHA 3Q8DA 2F3IA 5GADC 4JI3L 5M5WH 1XMOQ 2N49A 4BXXG 5K36G 5FJ8H 4OWTB 1VQHA 4DAYB 2OTJA 1SMXA 1A0IA 4A3FH 3GTMH 1UE6A 1W2BA 1X65A 4YWMA 3I56A 2F52A 4DV2L 3HKZG 1PH6A 2JA6H 2Y0SE 2UUCL 4HIKA 3J7ZC 2E2JH 1H95A 3RR5A 4DV7Q 2ZJQA 2ZTCA 3CQZH 4YCWA 4OO1G 2R7ZH 4BBRG 4GLXA 2K5NA 4P75A 4A3KH 1KRTA 1VQGA 4GNXC 3KFUA 1VQIA 1V43A 4X64Q 3H3VI 3IRBA 1DGSA 2UUAQ 1GKHA 3L7ZC 3OTOL 4DV4Q 1HNWL 3D0FA 2NN6I 3GO5A 1WJJA 3PCOB 4YWKA 3CMAA 3AEVA 1Q8KA 1HZCA 4A3IH 5C4JH 2Z6KC 3H15A 3ULPA 2QGQA 1K0RA 3CCVA 1K8GA 4MTNA 2ES2A 1MIUA 4YCUA 4DV5L 1N9WA 2ASBA 5IP9G 2NZOA 4DR5L 1NJIC 1N36L 3M4OH 4DR6L 4B3RQ 3S15H 4A3DH 3D31A 4LFCQ 4IFDJ 1A63A 1SE8A 3HOUH 2K14A 1FJGL 1HJPA 3E9IA 4JCVE 4UP7A 3DLLA 5AJ3Q 2BA0A 5M3FG 4K0KQ 4UY8C 1L1OA 1TWGH 2VL6A 4P73A 3CMEA 2ATWA 1PH3A 4BY1H 2L15A 4DR4L 1X56A 3G71A 4DR3L 1C7YA 2F4VQ 4J15A 1BKBA 2RHQB 4JI8L 1BBUA 1XTDA 3W5OA 2ALYB 1WCMG 3PSIA 2K52A 2B29A 5IYBH 5GAEC 1N8RC 4JI4Q 3E0EA 2JA7G 3CCUA 2Q2UA 1CKOA 4A3MH 1I3QH 5M3MG 4IPDA 2NVTH 4DV6L 2JA8G 1KL9A 2KHJA 1SFOH 4R4QA 3FHWA 4DKAC 2QA4A 3S2DH 2XGTA 3M7NA 3CPWA 1Q1EA 5IYDH 3KYHC 1VQPA 2A1AA 1K8AC 3I4OA 4DAMA 4JI0Q 1Y14B 4NXML 4JI6L 4JI4L 4JOIC 3GTJH 1AH9A 3BJUA 4DV0Q 3MXNB 2R92G 3PUZA 2UXBQ 2GVBA 2K5HA 3A5ZB 4K0KL 1HH2P 3G4SA 3SGIA 1NTGA 4POFA 5C0XG 4POGA 3S1QH 4JYAQ 2OQKA 4DUZQ 2R6GA 5LMNW 3GTQH 4X65Q 2IY5B 4DV0L 2R93G 4O2DA 1KHIA 1XMQL 2I5HA 3K7AH 1XNQL 5IWAL 3KJOA 3FKIG 3A74A 1FGUA 2E2HH 4R4CA 5IP9H 5GAHC 4DR7Q 3PUWA 1D7QA 4A3GH 2UXCQ 3E9HA 4HIOA 3LGJA 2LSSA 4BA2I 2BA1A 5IP7H 3J81c 3HOWH 1JJCB 2AHOB 3UDIA 1QZGA 4XIGS 3J81j 4DUYQ 5M5XH 1YIJA 5M5YH 4B3MQ 2PMZE 2YV5A 2PQAA 1Q81C 1IL2A 3ULLA 3GTGH 3I55A 2VQEL 1VQEA 1N33L 1E1OA 3W1GA 5IYCG 1PH5A 2ZTDA 3PUYA 2K5VA 3DM3A 2YTVA 4A76A 1PV4A 3K0XA 2VZAA 3K8AA 5C44H 3K80C 3T1YQ 4LFCL 1PH4A 4APVA 4JI1Q 2WAQE 2B63G 3TRZA 1JMCA 2UXDQ 3U4ZA 4OX9Q 4HJAA 4BBSG 5DLQE 4GN5A 4DV5Q 5GQOA 2UU9Q 4B3TL 1C9OA 5IY0A 4LF7Q 4BY7G 3I4NG 1M90C 4HJ9A 1LM0A 4GS3A 2CKZB 5JEAJ 4GOPB 4LF7L 1EIFA 3RLOA 1PA6A 1OTCA 3CC4A 3H3VH 3S16H 1XPUA 1NMFA 3A5UA 1U5KA 1N32Q 3H0GH 3RZOH 3KF6A 4A3CH 1QUQB 3UDFA 5FLXc 1IBLL 3M9BA 4X65L 3CCEA 4B3SL 2YU9H 1N32L 1V9PA 1UEBA 4A3JG 1HZ9A 1VCIA 2JEAI 4KHPL 3AFPA 4R1JA 1VQAA 4NPSA 3S14H 4JOIA 4DK6C 1VQ5A 1VQ6A 2DGYA 4UPAA 2CWAA 5GAGC 1L2FA 1Q46A 3PO2G 1FL0A 3OYYA 2YTYA 3BU2A 3KJPA 5JJKA 5LMNL 4DR1Q 2UU9L 4A3LG 1YJWA 1VQOA 4L5TA 2OQ0A 3HOXH 2GN5A 4OX9L 1VQ7A 3PO3H 3HKSA 1Q82C 1VQKA 1EOVA 2YTXA 4JI5L 3CW2C 1GM5A 1IYJB 1HZAA 4IOAA 1EYGA 1VQBA 4A3DG 4DR7L 1E7ZA 4P72A 4MZ9A 3J80c 3CC7A 4DR6Q 2N3SA 3CCJA 1X6OA 2ID0A 3KDFA 1KRSA 4DR1L 2ZJRA 5LMUQ 1Y1WH 1QUQA 2D0PA 1I94Q 5C44G 3S1NH 5C0XJ 2BH2A 1X3EA 1YHAA 1TWHH 3F1ZA 4BBSH 3L0OA 5ELNA 4NXNL 4JV5L 5AJ3L 1TWAH 1PFSA 2AWNA 3HKZE 4GLAC 4KHPQ 3HOUG 5ELOA 1G6PA 3UDGA 2WB1G 3A0JA 1FJGQ 4H02A 4BY7H 4JI7Q 2UXCL 4A3MG 2MO0A 1OXXK 3PF5A 1CSPA 1CKNA 4YHHQ 2MNAA 2VQFL 4DPGA 2ZTEA 2R7DA 4FDBA 4IJHA 4MNOA 4LFBQ 1PH7A 1Y1VH 2D62A 1XJVA 4C3JH 3I4MG 3CD6A 2H5XA 1VQJA 5IE8A 1SRUA 1XMQQ 4DV2Q 1VQDA 2K4KA 4IPGA 4JG2A 1WCMH 1YEZA 4LW1A 4AQYL 1X9NA 3CPFA 1ASZA 4JI7L 2WP8J 4DV6Q 4JI5Q 4LNQA 4XTCS 3F2BA 4DV4L 5FJ8G 4L5RC 3HOWG 5M3MH 4UP8A 4A3JH 4X64L 5FLMH 3S1RH 1YI2A 2YYZA 1UE7A 4A4IA 4EX5A 2HIVA 3JC66 3RLFA 1IBLQ 4B3SQ 1OXSC 2KHIA 1K83H 4LF9Q 3PUXA 1TWCH 1IBKQ 2Q2TA 4ME3A 4IOCA 1B7YB 4R4TA 3TEHB 4JI0L 2NZHA 2GVAA 5EAYA 2UUCQ 4A3IG 1L1OC 3KF6B 5JEAG 2HHHQ 2AKWB 1K73C 1L1OB 4GNXA 4GKKL 2NVQH 1IBKL 2MQHA 3J81i 1EFWA 1N34L 3RZDH 1YHQA 1KIXA 3EN2A 2IHEA 4GOPC 1I5FA 1MKHA 2AMCB 2UXDL 4GN3B 3HOVH 1AE2A 2F4VL 2JA8H 3CF5A 1HNWQ 2JJQA 4ALPA 2ZM6L 5C3EH 2IT1A 1PH8A 4YY3Q 4IO9A 1IXRA 5IYBG 1AE3A 2B3GA 5C4XG 2HIXA 2VS1A 4A3BH 3CCLA 3HOZH 4JBKA 4NB3A 4OXPA 2WAQG 4C3IH 4B3ML 1KD1C 2FXQA 3B6YA 4R4OA 4HIDA 2JQOA 4DUZL 1YJNA 1M1KC 4PMWA 3AFQA 3EIVA 2OWOA 1NBWA 3RN5A 1SN8A 2JA9A 2A19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3S A;  3S2H H;  3T1H L;  4A3E H;  1D8L A;  1KC8 C;  3OTO Q;  3CAM A;  2I5L X;  1E1T A;  3PF4 A;  1EQQ A;  3GTP H;  1TXY A;  1QZH A;  3OW2 A;  1YJ9 A;  1E3P A;  3W1B A;  1EQR A;  1PYB A;  4RMF A;  4TQU S;  1S72 A;  2CCZ A;  4BA1 I;  1CSQ A;  1CUK A;  2KCM A;  2VQF Q;  4JI1 L;  4KI0 A;  2E5L Q;  3FP9 A;  4A3G G;  5JJL A;  2IHF A;  1UE5 A;  2A8V A;  1XPO A;  4JYA L;  2CFM A;  4OON A;  1YBY A;  4Y7N H;  3NEM A;  3S24 A;  1XNR L;  4L5S A;  2EXD A;  3PGZ A;  1GD7 A;  1EWI A;  3I2Z A;  1QVG A;  4JBM A;  1N33 Q;  4L5Q A;  4A3F G;  5IWA Q;  1JB7 A;  3FKI H;  1IBM Q;  1X3G A;  3TQY A;  1JJG A;  4LF9 L;  1VS0 A;  4X62 L;  4X66 Q;  1SRO A;  2OTL A;  4JI3 Q;  4YCV A;  4GKJ L;  4QQB X;  1IBM L;  4P71 A;  1G29 1;  4OWW B;  1N34 Q;  3TRE A;  3UE1 A;  2UUB L;  4BBR H;  2JA5 H;  3KF8 B;  4JI2 Q;  2R92 H;  1HR0 W;  1I50 H;  2N8N A;  3STB D;  4AQY Q;  2MFI A;  3WWV A;  4LF8 Q;  2MO1 A;  4AYB E;  3G6E A;  4LF5 L;  3U50 C;  4A75 A;  1VQN A;  1PVO A;  1Z9F A;  4DR5 Q;  1N36 Q;  3RN2 A;  5HY6 A;  4YHH L;  3F2D A;  1OXU A;  3KLW A;  4JI8 Q;  3AQQ A;  1JJ2 A;  4AH6 A;  4OO1 I;  1YHB A;  2PI2 E;  1HR0 L;  2RF4 A;  2ZJP A;  4GOP A;  4BY1 G;  1VQF A;  1C0A A;  2EIF A;  1MJE A;  4B3T Q;  3NEL A;  4JC0 A;  4DV3 L;  5IYD G;  1NE3 A;  1Q86 C;  1JT8 A;  3HFZ B;  3ER0 A;  1R9T H;  3PIP A;  5LMU L;  1WFQ A;  4DR4 Q;  2NVY H;  5JJI A;  4NXM Q;  2XTI A;  2AWO A;  4DV7 L;  4LF6 Q;  4TVA B;  2JEB I;  4RG1 A;  4A93 H;  5C0X I;  3F2C A;  2IX1 A;  3GDE A;  1X54 A;  1B8A A;  2R7Z G;  3H0G G;  2E5L L;  4X6A H;  4HIM A;  3JAM c;  4NXN Q;  5BR8 Q;  2KEN A;  4DR2 L;  4A3L H;  2Q2H A;  1RL2 A;  2JE6 I;  2HQL A;  5E7N A;  5M3F H;  4A3K G;  3PO3 G;  1MJC A;  3ICE A;  2E8G A;  4LWC A;  4OWX B;  2B63 H;  4EQ5 A;  1B70 B;  1QVF A;  1E22 A;  3T1Y L;  4LF4 L;  5H1S E;  2HHH L;  2Y0S G;  3PV0 A;  1J6Q A;  3K7U C;  1YZ6 A;  2I0Q A;  1HNZ Q;  4IJL A;  1LUZ A;  2VY3 A;  1PH1 A;  3GTK H;  2DUD A;  2KCT A;  4QJF A;  3HOY H;  2VQE Q;  2R7F A;  3M4P A;  1Y1W G;  2PQA B;  3CC2 A;  1ASY A;  4KHZ A;  1XMO L;  1VQL A;  3U4V A;  4DV1 Q;  3NEN A;  4LUV A;  4DK3 C;  1NY4 A;  4HJ5 A;  2CQO A;  2K50 A;  4IFD I;  1VQ4 A;  3HOX G;  5GRO A;  1A62 A;  5IT9 c;  2I5M X;  4GKK Q;  2WB1 E;  4LUO A;  3J80 i;  2JA6 G;  2PNH A;  4LFA L;  2IX0 A;  1PYS B;  3M4Q A;  1YVC A;  1XPR A;  1HNX L;  3U58 A;  3NBH B;  3PIO A;  2HT1 A;  4LF5 Q;  1OXT A;  4GN4 B;  5J3B A;  1U0L A;  2QEX A;  4LF8 L;  3KOJ A;  2VUM G;  1Z47 A;  2NN6 G;  4KLK A;  3STB C;  3VDY A;  4DV3 Q;  4LFA Q;  3CP0 A;  1J5E Q;  1HNZ L;  1TWF H;  4JV5 Q;  4PZ7 A;  4QIW E;  4A93 G;  1WOC A;  4QGU A;  1E24 A;  4YWL A;  1VQM A;  1GO3 E;  4PG3 A;  2WFW A;  4JBJ A;  3J7A 5;  1P16 A;  4A3E G;  1QVC A;  2PI2 A;  1RIP A;  2Q2I A;  3HOZ G;  2BH8 A;  4DV1 L;  4LFB L;  5BR8 L;  4DR2 Q;  4R4I A;  1VQ9 A;  3ZJY C;  1OXV A;  2JK8 A;  1S40 A;  2Z0S A;  2NVX H;  2VNU D;  1PH9 A;  1SR3 A;  1KQS A;  4GNX B;  1JE5 A;  1K3R A;  3G48 A;  4JI2 L;  4IFD G;  2R93 H;  1WI5 A;  1LTL A;  4AIM A;  3PUV A;  4B3R L;  1YNX A;  1Q1B A;  2LXK A;  1BVS A;  1A8V A;  1V1Q A;  1G51 A;  3GTO H;  4BXX H;  3BZK A;  1O7I A;  3K81 C;  3MEF A;  4PZ8 A;  1K9M C;  1XNQ Q;  4X66 L;  4X62 Q;  4GKJ Q;  3CCM A;  3HOY G;  1S3O A;  1BBW A;  2KBN A;  1CKN B;  1NMG A;  2OCE A;  3T1H Q;  2Z6K A;  1KXL A;  3F8T A;  5C3E G;  4QY7 A;  3I4M H;  4JBW A;  5IP7 G;  1XNR Q;  1J5E L;  1P8L A;  1HR0 Q;  2RHS B;  3RLN A;  2V1C C;  4A3B G;  3GD7 A;  3GTL H;  1EIY B;  1VQ8 A;  3BZC A;  1L0W A;  4JI6 Q;  1I6H H;  1WYD A;  1HNX Q;  4LF6 L;  1GVP A;  4PZ6 A;  1X55 A;  1Q7Y C;  4C2M H;  1LYL A;  5IYC H;  4WJ3 M;  2ZM6 Q;  2CWP A;  3CXC A;  3EBE A;  3CCR A;  4A3C G;  4HJ8 A;  2E2I H;  1EUJ A;  2C35 B;  1VQC A;  2VUM H;  3HOV G;  1UE1 A;  2UUB Q;  4GLV B;  1HZB A;  2JA5 G;  2UUA L;  3AYH B;  4LUZ A;  3RNU A;  4C3H H;  2UXB L;  1Y1V G;  5LMN Q;  3UE0 A;  3M85 A;  3M3Y H;  3ERS X;  1CKM A;  1SLJ A;  2VW9 A;  4DR3 Q;  1I94 L;  2LXJ A;  3PO2 H;  4DNI A;  1Q12 A;  5C4X H;  3TS2 A;  3I7F A;  4P74 A;  3CCQ A;  4AYB G;  2K75 A;  5HGQ A;  1PHJ A;  1IZ6 A;  4O0A A;  4YY3 L;  3L2P A;  4WJ4 A;  5FLM G;  1X3F A;  4IPC A;  3S17 H;  1YIT A;  3TS0 A;  1T9H A;  2N78 A;  4LF4 Q;  4Y52 H;  4QL5 A;  4UP9 A;  3JAM i;  1UWV A;  1PH2 A;  2EQS A;  2RCN A;  3UDX A;  3ULJ A;  3CCS A;  2D0O A;  4HJ7 A;  2JA7 H;  3S1M H;  1KAW A;  3KDF B;  3I4N H;  1FVI A;  4DUY L;  4IPH A;  3Q8D A;  2F3I A;  5GAD C;  4JI3 L;  5M5W H;  1XMO Q;  2N49 A;  4BXX G;  5K36 G;  5FJ8 H;  4OWT B;  1VQH A;  4DAY B;  2OTJ A;  1SMX A;  1A0I A;  4A3F H;  3GTM H;  1UE6 A;  1W2B A;  1X65 A;  4YWM A;  3I56 A;  2F52 A;  4DV2 L;  3HKZ G;  1PH6 A;  2JA6 H;  2Y0S E;  2UUC L;  4HIK A;  3J7Z C;  2E2J H;  1H95 A;  3RR5 A;  4DV7 Q;  2ZJQ A;  2ZTC A;  3CQZ H;  4YCW A;  4OO1 G;  2R7Z H;  4BBR G;  4GLX A;  2K5N A;  4P75 A;  4A3K H;  1KRT A;  1VQG A;  4GNX C;  3KFU A;  1VQI A;  1V43 A;  4X64 Q;  3H3V I;  3IRB A;  1DGS A;  2UUA Q;  1GKH A;  3L7Z C;  3OTO L;  4DV4 Q;  1HNW L;  3D0F A;  2NN6 I;  3GO5 A;  1WJJ A;  3PCO B;  4YWK A;  3CMA A;  3AEV A;  1Q8K A;  1HZC A;  4A3I H;  5C4J H;  2Z6K C;  3H15 A;  3ULP A;  2QGQ A;  1K0R A;  3CCV A;  1K8G A;  4MTN A;  2ES2 A;  1MIU A;  4YCU A;  4DV5 L;  1N9W A;  2ASB A;  5IP9 G;  2NZO A;  4DR5 L;  1NJI C;  1N36 L;  3M4O H;  4DR6 L;  4B3R Q;  3S15 H;  4A3D H;  3D31 A;  4LFC Q;  4IFD J;  1A63 A;  1SE8 A;  3HOU H;  2K14 A;  1FJG L;  1HJP A;  3E9I A;  4JCV E;  4UP7 A;  3DLL A;  5AJ3 Q;  2BA0 A;  5M3F G;  4K0K Q;  4UY8 C;  1L1O A;  1TWG H;  2VL6 A;  4P73 A;  3CME A;  2ATW A;  1PH3 A;  4BY1 H;  2L15 A;  4DR4 L;  1X56 A;  3G71 A;  4DR3 L;  1C7Y A;  2F4V Q;  4J15 A;  1BKB A;  2RHQ B;  4JI8 L;  1BBU A;  1XTD A;  3W5O A;  2ALY B;  1WCM G;  3PSI A;  2K52 A;  2B29 A;  5IYB H;  5GAE C;  1N8R C;  4JI4 Q;  3E0E A;  2JA7 G;  3CCU A;  2Q2U A;  1CKO A;  4A3M H;  1I3Q H;  5M3M G;  4IPD A;  2NVT H;  4DV6 L;  2JA8 G;  1KL9 A;  2KHJ A;  1SFO H;  4R4Q A;  3FHW A;  4DKA C;  2QA4 A;  3S2D H;  2XGT A;  3M7N A;  3CPW A;  1Q1E A;  5IYD H;  3KYH C;  1VQP A;  2A1A A;  1K8A C;  3I4O A;  4DAM A;  4JI0 Q;  1Y14 B;  4NXM L;  4JI6 L;  4JI4 L;  4JOI C;  3GTJ H;  1AH9 A;  3BJU A;  4DV0 Q;  3MXN B;  2R92 G;  3PUZ A;  2UXB Q;  2GVB A;  2K5H A;  3A5Z B;  4K0K L;  1HH2 P;  3G4S A;  3SGI A;  1NTG A;  4POF A;  5C0X G;  4POG A;  3S1Q H;  4JYA Q;  2OQK A;  4DUZ Q;  2R6G A;  5LMN W;  3GTQ H;  4X65 Q;  2IY5 B;  4DV0 L;  2R93 G;  4O2D A;  1KHI A;  1XMQ L;  2I5H A;  3K7A H;  1XNQ L;  5IWA L;  3KJO A;  3FKI G;  3A74 A;  1FGU A;  2E2H H;  4R4C A;  5IP9 H;  5GAH C;  4DR7 Q;  3PUW A;  1D7Q A;  4A3G H;  2UXC Q;  3E9H A;  4HIO A;  3LGJ A;  2LSS A;  4BA2 I;  2BA1 A;  5IP7 H;  3J81 c;  3HOW H;  1JJC B;  2AHO B;  3UDI A;  1QZG A;  4XIG S;  3J81 j;  4DUY Q;  5M5X H;  1YIJ A;  5M5Y H;  4B3M Q;  2PMZ E;  2YV5 A;  2PQA A;  1Q81 C;  1IL2 A;  3ULL A;  3GTG H;  3I55 A;  2VQE L;  1VQE A;  1N33 L;  1E1O A;  3W1G A;  5IYC G;  1PH5 A;  2ZTD A;  3PUY A;  2K5V A;  3DM3 A;  2YTV A;  4A76 A;  1PV4 A;  3K0X A;  2VZA A;  3K8A A;  5C44 H;  3K80 C;  3T1Y Q;  4LFC L;  1PH4 A;  4APV A;  4JI1 Q;  2WAQ E;  2B63 G;  3TRZ A;  1JMC A;  2UXD Q;  3U4Z A;  4OX9 Q;  4HJA A;  4BBS G;  5DLQ E;  4GN5 A;  4DV5 Q;  5GQO A;  2UU9 Q;  4B3T L;  1C9O A;  5IY0 A;  4LF7 Q;  4BY7 G;  3I4N G;  1M90 C;  4HJ9 A;  1LM0 A;  4GS3 A;  2CKZ B;  5JEA J;  4GOP B;  4LF7 L;  1EIF A;  3RLO A;  1PA6 A;  1OTC A;  3CC4 A;  3H3V H;  3S16 H;  1XPU A;  1NMF A;  3A5U A;  1U5K A;  1N32 Q;  3H0G H;  3RZO H;  3KF6 A;  4A3C H;  1QUQ B;  3UDF A;  5FLX c;  1IBL L;  3M9B A;  4X65 L;  3CCE A;  4B3S L;  2YU9 H;  1N32 L;  1V9P A;  1UEB A;  4A3J G;  1HZ9 A;  1VCI A;  2JEA I;  4KHP L;  3AFP A;  4R1J A;  1VQA A;  4NPS A;  3S14 H;  4JOI A;  4DK6 C;  1VQ5 A;  1VQ6 A;  2DGY A;  4UPA A;  2CWA A;  5GAG C;  1L2F A;  1Q46 A;  3PO2 G;  1FL0 A;  3OYY A;  2YTY A;  3BU2 A;  3KJP A;  5JJK A;  5LMN L;  4DR1 Q;  2UU9 L;  4A3L G;  1YJW A;  1VQO A;  4L5T A;  2OQ0 A;  3HOX H;  2GN5 A;  4OX9 L;  1VQ7 A;  3PO3 H;  3HKS A;  1Q82 C;  1VQK A;  1EOV A;  2YTX A;  4JI5 L;  3CW2 C;  1GM5 A;  1IYJ B;  1HZA A;  4IOA A;  1EYG A;  1VQB A;  4A3D G;  4DR7 L;  1E7Z A;  4P72 A;  4MZ9 A;  3J80 c;  3CC7 A;  4DR6 Q;  2N3S A;  3CCJ A;  1X6O A;  2ID0 A;  3KDF A;  1KRS A;  4DR1 L;  2ZJR A;  5LMU Q;  1Y1W H;  1QUQ A;  2D0P A;  1I94 Q;  5C44 G;  3S1N H;  5C0X J;  2BH2 A;  1X3E A;  1YHA A;  1TWH H;  3F1Z A;  4BBS H;  3L0O A;  5ELN A;  4NXN L;  4JV5 L;  5AJ3 L;  1TWA H;  1PFS A;  2AWN A;  3HKZ E;  4GLA C;  4KHP Q;  3HOU G;  5ELO A;  1G6P A;  3UDG A;  2WB1 G;  3A0J A;  1FJG Q;  4H02 A;  4BY7 H;  4JI7 Q;  2UXC L;  4A3M G;  2MO0 A;  1OXX K;  3PF5 A;  1CSP A;  1CKN A;  4YHH Q;  2MNA A;  2VQF L;  4DPG A;  2ZTE A;  2R7D A;  4FDB A;  4IJH A;  4MNO A;  4LFB Q;  1PH7 A;  1Y1V H;  2D62 A;  1XJV A;  4C3J H;  3I4M G;  3CD6 A;  2H5X A;  1VQJ A;  5IE8 A;  1SRU A;  1XMQ Q;  4DV2 Q;  1VQD A;  2K4K A;  4IPG A;  4JG2 A;  1WCM H;  1YEZ A;  4LW1 A;  4AQY L;  1X9N A;  3CPF A;  1ASZ A;  4JI7 L;  2WP8 J;  4DV6 Q;  4JI5 Q;  4LNQ A;  4XTC S;  3F2B A;  4DV4 L;  5FJ8 G;  4L5R C;  3HOW G;  5M3M H;  4UP8 A;  4A3J H;  4X64 L;  5FLM H;  3S1R H;  1YI2 A;  2YYZ A;  1UE7 A;  4A4I A;  4EX5 A;  2HIV A;  3JC6 6;  3RLF A;  1IBL Q;  4B3S Q;  1OXS C;  2KHI A;  1K83 H;  4LF9 Q;  3PUX A;  1TWC H;  1IBK Q;  2Q2T A;  4ME3 A;  4IOC A;  1B7Y B;  4R4T A;  3TEH B;  4JI0 L;  2NZH A;  2GVA A;  5EAY A;  2UUC Q;  4A3I G;  1L1O C;  3KF6 B;  5JEA G;  2HHH Q;  2AKW B;  1K73 C;  1L1O B;  4GNX A;  4GKK L;  2NVQ H;  1IBK L;  2MQH A;  3J81 i;  1EFW A;  1N34 L;  3RZD H;  1YHQ A;  1KIX A;  3EN2 A;  2IHE A;  4GOP C;  1I5F A;  1MKH A;  2AMC B;  2UXD L;  4GN3 B;  3HOV H;  1AE2 A;  2F4V L;  2JA8 H;  3CF5 A;  1HNW Q;  2JJQ A;  4ALP A;  2ZM6 L;  5C3E H;  2IT1 A;  1PH8 A;  4YY3 Q;  4IO9 A;  1IXR A;  5IYB G;  1AE3 A;  2B3G A;  5C4X G;  2HIX A;  2VS1 A;  4A3B H;  3CCL A;  3HOZ H;  4JBK A;  4NB3 A;  4OXP A;  2WAQ G;  4C3I H;  4B3M L;  1KD1 C;  2FXQ A;  3B6Y A;  4R4O A;  4HID A;  2JQO A;  4DUZ L;  1YJN A;  1M1K C;  4PMW A;  3AFQ A;  3EIV A;  2OWO A;  1NBW A;  3RN5 A;  1SN8 A;  2JA9 A;  2A19 A; 
#chains in the Genus database with same CATH topology
 3CAM A;  1EQQ A;  4PMB A;  1FD7 D;  3GTP H;  3QOL A;  1BO0 A;  4CDD C;  3OW2 A;  4QIW B;  4TQU S;  1I3Q B;  2KED A;  3RUZ A;  2VQF Q;  2HQE A;  4IUR A;  4A3G G;  1ZEQ X;  1UE5 A;  2A74 C;  1XPO A;  4JYA L;  3LWU A;  1YBY A;  2JP1 A;  1XNR L;  3D4D A;  3PGZ A;  3NSW A;  1EWI A;  4OGQ C;  4L5Q A;  5ELF A;  5IWA Q;  1SE4 A;  2AQ3 B;  1JB7 A;  1S5D D;  1X3G A;  1HRJ A;  2L9H A;  5J22 A;  4IUN A;  4P71 A;  1E2W A;  1GXD C;  4KKU A;  3R93 A;  4BBR H;  1HR0 W;  3STB D;  1KDA A;  1PRT F;  4MIU A;  3WWV A;  1WTV A;  2SDF A;  3U50 C;  1VQN A;  1PVO A;  1N36 Q;  2E2D C;  3RN2 A;  4YHH L;  1EY9 A;  1IL8 A;  2KCC A;  4OO1 I;  3TZU A;  2OT2 A;  4EQN A;  4BY1 G;  2EIF A;  3NEL A;  2B2W C;  5IYD G;  2A69 C;  3HFZ B;  5CV5 A;  3ER0 A;  1R9T H;  3NQI A;  1Y8N B;  1DOK A;  4OEM B;  3QO2 A;  4NXM Q;  4TVA B;  4RG1 A;  5C0X I;  5D3I B;  5CV8 A;  5C4X B;  2R7Z G;  3H0G G;  5IT9 L;  4DR2 L;  2F0N A;  1RL2 A;  4OIJ A;  2HQL A;  3R8B A;  3A56 A;  3SVM A;  4C3J B;  4HTH A;  4LWC A;  1IKM A;  1CQV A;  2EYF A;  1H9S A;  1E22 A;  2JA7 B;  1H9K A;  3D6C A;  2VUM B;  1S4Z A;  3PV0 A;  3K7U C;  1PH1 A;  2DUD A;  3NE5 B;  3Q23 A;  2KCT A;  3HOY H;  4KHZ A;  1IW7 D;  1ESR A;  1S5B D;  3U4V A;  3NEN A;  1NY4 A;  2QDB A;  1VQ4 A;  1CFM A;  3HOX G;  2B2T A;  3HG9 A;  2WB1 E;  1Y8P B;  2EE1 A;  3OWF A;  4RGM A;  1PYS B;  1QJO A;  1SJE D;  1BUV T;  4JW0 A;  4GN4 B;  2JA8 B;  2NN6 G;  1ENC A;  2VB2 X;  3ITP A;  4DV3 Q;  3CP0 A;  2K1B A;  1XXG A;  4A3M B;  4QGU A;  3FPU B;  4MTK A;  1VQM A;  1WTP A;  1P16 A;  1QVC A;  3TZD A;  4LFB L;  4ME5 A;  4R4I A;  2L12 A;  2N55 A;  3NTH A;  1NUC A;  4H44 C;  1JE5 A;  4KV6 A;  1F2Y A;  3SHL A;  4IFD G;  1BBX C;  2E76 C;  1LTL A;  3QOJ A;  4IUU A;  1YNX A;  1Q1B A;  3BDL A;  1A8V A;  1G51 A;  3GTO H;  3MEF A;  4E6I A;  1XNQ Q;  3J80 L;  3S15 B;  2EYO A;  1S3O A;  3QB3 A;  3NP8 A;  5C4Z A;  1BBW A;  2KBN A;  1CKN B;  4L63 B;  4PV1 C;  1KXL A;  2F0G A;  1V1P A;  1FNU A;  5IP7 G;  4OO1 H;  1CZG A;  3M3Y B;  3PO2 B;  1QWY A;  4JVZ A;  1EIY B;  1SMY C;  3BZC A;  3GTJ B;  4JI6 Q;  1HNX Q;  4LF6 L;  1H9J A;  2EVB A;  2F0V A;  2F0H A;  2R7Z B;  1SNP A;  2KUM A;  1X55 A;  4K8J A;  4ZQ3 A;  4WJ3 M;  1LT4 D;  3SK4 A;  3CCR A;  2HD3 A;  2EY5 A;  2PW5 A;  2C35 B;  1VQC A;  2JA5 G;  3TSS A;  1GHK A;  4S3S A;  4FXK C;  3S1R B;  1Y1V G;  3Q0A A;  3UE0 A;  1SLJ A;  2VW9 A;  2Z1C A;  4DR3 Q;  2KHS A;  4DNI A;  5C4X H;  3TS2 A;  3I7F A;  4P74 A;  2D9U A;  4AYB G;  3HGB A;  1TS3 A;  1MGS A;  1X3F A;  2XRS D;  4IPC A;  3S17 H;  1T9H A;  5JJZ A;  1DYQ A;  1UWV A;  2EQS A;  4HJ7 A;  3TP7 A;  1KAW A;  3KDF B;  3I4N H;  1SYC A;  1XX8 A;  5GAD C;  5CYU A;  2N49 A;  5FJ8 H;  4KD4 A;  1SMX A;  4ID6 A;  1J8I A;  1UE6 A;  3J80 E;  1X65 A;  4YWM A;  4Q5V A;  3HKZ G;  1QB5 D;  5A35 A;  2E2J H;  2ZJQ A;  4KHV A;  1AZQ A;  1ML0 D;  3MA2 B;  3W2D A;  4A3D B;  2CH4 A;  2OEO A;  1QNU A;  4OO1 G;  1SSO A;  4GLX A;  2K5N A;  1KNE A;  4A3K H;  4GNX C;  1VQG A;  1VQI A;  4X64 Q;  1LAC A;  4X3S A;  3D0F A;  2M00 A;  4X3T A;  5C4J H;  2R93 B;  2I46 A;  4O42 A;  1K0R A;  3CCV A;  4MTN A;  1A3V A;  3J81 E;  1EOT A;  4YCU A;  2HDM A;  4DV5 L;  2NZO A;  3M4O H;  2JA5 B;  3KBX A;  2KOL A;  3S15 H;  2ICE C;  1XWE A;  4LFC Q;  1A63 A;  1EZ8 A;  3DLL A;  3S16 B;  4Y7N B;  4NP5 A;  2IJ0 A;  1L1O A;  1EY8 A;  1SE2 A;  1PH3 A;  2K01 A;  3G71 A;  2NBF A;  1JE4 A;  1EFW A;  3PSI A;  1U9R A;  2K52 A;  2DJG C;  5GAE C;  2F0I A;  1K28 A;  3SR1 A;  5IGB A;  5M3M G;  2NVT H;  4DV6 L;  3T13 A;  1KDB A;  1SND A;  4CKB A;  1BCP C;  1HQM C;  2XGT A;  1MI2 A;  1VQP A;  1GUO A;  1Y14 B;  4JI6 L;  5HGT A;  4JOI C;  1AH9 A;  3BJU A;  5COY A;  2UXB Q;  2GVB A;  2K5H A;  2LKV A;  2NYZ D;  4K0K L;  1HH2 P;  3G4S A;  2CHB D;  4POF A;  5C0X G;  1F77 A;  2OQK A;  3J7A V;  3GTQ H;  1F2Z A;  1KHI A;  1SXT A;  3NPP A;  1B50 A;  1EY6 A;  4MN3 A;  3KJO A;  3VR5 A;  2ENB A;  3R3O A;  2F0F A;  4A3G H;  4HIO A;  2BA1 A;  5JOB A;  5TSS A;  3E5S A;  5D65 A;  4DUY Q;  4F87 A;  2F0T A;  2WB1 B;  1YIJ A;  2YV5 A;  2TSS A;  2ZT9 C;  5IYC G;  1PH5 A;  2CVR A;  5C44 B;  3OOC A;  1HFG A;  3K8A A;  5C44 H;  2EPB A;  2PQE A;  1LTR D;  3I3C A;  4LFC L;  2FFK B;  4XT1 B;  5C5L A;  4BBS G;  4HJA A;  3GTP B;  3O13 A;  4GN5 A;  4DV5 Q;  2A6H C;  5FOB B;  4B3T L;  5CC4 A;  4K2K A;  2B63 B;  3J81 L;  2CKZ B;  1EY5 A;  5JEA J;  1II3 A;  2F0W A;  4GOP B;  3H3V H;  1Q8I A;  1WD0 A;  3H0G B;  4IUT A;  3A5U A;  2MP1 A;  3URY A;  5M5W B;  1T5X D;  2QF7 A;  3RZO H;  3FPP A;  3UDF A;  2MJ8 A;  3CCE A;  3S2H B;  1N32 L;  1O80 A;  4OHJ A;  1VCI A;  4M1U B;  2JEA I;  1VQA A;  1EIG A;  4R9W A;  1VQ6 A;  3NXW A;  2DGY A;  4UPA A;  1Q46 A;  3PO2 G;  2NUC A;  1K8O A;  1HFN A;  2UU9 L;  1YJW A;  1VQ7 A;  2G9D A;  1CHP D;  5EJW A;  3HKS A;  4JI5 L;  4MHE A;  1HZA A;  4DR7 L;  1PTO D;  4P72 A;  3J80 c;  1X6O A;  2ID0 A;  3M4O B;  3A55 A;  5IOD A;  5C44 G;  1YHA A;  5CBA E;  3BZD B;  3L0O A;  5LHY 1;  4BBS H;  4JV5 L;  3HKZ E;  1PFS A;  3HOU G;  3A0J A;  4H02 A;  2UXC L;  1KAA A;  2B2Y C;  3PF5 A;  4ULL A;  2MNA A;  5I2Y A;  4DPG A;  3LNN A;  4MNO A;  4LFB Q;  1YNN C;  4CDF C;  2H5X A;  1VQJ A;  1XMQ Q;  1S72 A;  4LW1 A;  1WCM H;  2WP8 J;  1WCM B;  4JI5 Q;  3F2B A;  1O7Z A;  4DV4 L;  4RCO A;  3SK8 A;  5IOC A;  1STA A;  4A4I A;  4EX5 A;  2EXZ A;  3JC6 6;  3RLF A;  3WOE A;  5C4H A;  1IBL Q;  1OXS C;  1K83 H;  5FLX E;  3ZYY X;  3EFX D;  3L9A X;  4ME3 A;  5KNC A;  1B7Y B;  5CV7 A;  1TKW B;  2A6E C;  1VMC A;  3J7Y W;  3KF6 B;  5JEA G;  4A3I G;  3BYY B;  4DAY A;  1LTB D;  4QB4 A;  3GTG B;  1N34 L;  1YHQ A;  1KIX A;  3EN2 A;  4GOP C;  1IHZ A;  1EFI D;  2WKD A;  5DEH A;  2B2W A;  2PZU A;  4GN3 B;  3E3X A;  1HNW Q;  1ZYR D;  4ZUJ A;  1O78 A;  2JA6 B;  2F0P A;  3UI2 A;  3KUP A;  3HOZ H;  4JBK A;  5IGG A;  1NNX A;  2F1M A;  1XTC D;  1KD1 C;  4PMW A;  3VYR A;  5C5M A;  1NBW A;  2O4X A;  1SN8 A;  1PYW D;  3P7J A;  2A19 A;  1W3S A;  3S2H H;  5EPL A;  4A3E H;  3OTO Q;  3PF4 A;  3W3A A;  1JQY D;  3JAM E;  5A2Q E;  1TXY A;  4B08 A;  3W1B A;  1WD1 A;  1LTT D;  4BA1 I;  1DXM A;  2KCM A;  2NZ1 D;  4KI0 A;  1H9R A;  2IHF A;  4HMJ A;  2L5T A;  3T56 B;  2VXW A;  4OON A;  4A3K B;  3NEM A;  3S24 A;  3R2T A;  1QVG A;  4KK7 A;  1IBM Q;  3TQY A;  4X62 L;  4JI3 Q;  1SRO A;  2OTL A;  4GKJ L;  4YCV A;  1I6V C;  3CHB D;  1PZK D;  2B2U A;  5COR A;  3UE1 A;  3X3M A;  3KF8 B;  2JSO A;  2N8N A;  3OMG A;  4AQY Q;  2MFI A;  3NBI A;  1I4H A;  2MO1 A;  2H1E A;  1V1O A;  4LF5 L;  5T1I A;  4A75 A;  1T5E A;  3LX0 A;  1Z9F A;  4RKB A;  3F2D A;  3NQT A;  3IAY A;  1JJ2 A;  4AH6 A;  1STG A;  2PI2 E;  1DOM A;  1QG7 A;  4B9W A;  1E2V A;  1MJE A;  1K3B C;  4JC0 A;  4ZCK A;  3GTO B;  2FHT A;  1JT8 A;  3Q6S A;  3HP3 A;  2OF1 A;  5LMU L;  5EBD A;  4EQO A;  2IPK D;  2NVY H;  2SNM A;  3MC0 B;  3I91 A;  1K83 B;  1B8A A;  2XWB B;  2WIN B;  2E5L L;  4X6A H;  2M2L A;  4HIM A;  3PO3 G;  5AFW A;  1TU2 B;  1MJC A;  1PTO H;  4OWX B;  4HCS A;  3VYT A;  3T1Y L;  4LF4 L;  4XYQ A;  2Y0S G;  4OIK A;  1GUN A;  5EKI A;  1LUZ A;  3HOY B;  4C3H B;  1AEX A;  4WRD A;  2JXM B;  1EWH A;  3HOV B;  4DV1 Q;  2A69 D;  3FDT A;  4HJ5 A;  2K50 A;  4X3K A;  2I5M X;  3T4A C;  3VA7 A;  4GKK Q;  2IW3 A;  3KK7 A;  3J80 i;  4XQN A;  5CGK A;  3C2P A;  5I6W A;  1EZ6 A;  4LFA L;  2A5H A;  3M4Q A;  1XPR A;  3U58 A;  3NBH B;  4FF4 A;  5J3B A;  5LL6 S;  2WKC A;  1HNZ L;  1J5E Q;  5DM6 3;  4BBR B;  3F2U A;  4PZ7 A;  4F8M A;  4QIW E;  5KIX A;  4A93 G;  2QIL A;  1WOC A;  1EYC A;  2BCO A;  1BCP F;  3G6J B;  3HOU B;  4YWL A;  1B44 D;  2EJF C;  2AQ2 B;  1STB A;  3HKZ B;  4FVM A;  2PI2 A;  4NMZ A;  3C46 A;  1LT3 D;  4B9X A;  2BH8 A;  4DV1 L;  2EYJ A;  5BR8 L;  1ICF B;  2Z9H A;  1VQ9 A;  1WTH A;  2Z0S A;  3DWA A;  1PH9 A;  1L0Y B;  2Z8L A;  4GNX B;  3VR6 A;  1DON A;  1A2U A;  3G48 A;  1WI5 A;  4AIM A;  4B3R L;  1RDP D;  3K57 A;  4G7H C;  3BZK A;  3K81 C;  3V2T A;  1K9M C;  4X66 L;  5DNF A;  3EJI A;  1YNJ D;  3T1H Q;  5I2X A;  3TME A;  1TWA B;  4QY7 A;  1LTS D;  3HS0 C;  5KYI A;  3RLN A;  4IUP A;  5F2D A;  3GD7 A;  3GTL H;  3CKI B;  1I6H B;  1I6H H;  2X6L A;  4PZ6 A;  4C2M H;  1SNQ A;  3CXC A;  2CWP A;  3EBE A;  4ZLT F;  2H4O A;  2QCP X;  1EUJ A;  5FLX L;  3S1M B;  3HOV G;  1UE1 A;  2UUA L;  1HZB A;  3GP7 A;  3AYH B;  4U67 3;  4C3H H;  2UXB L;  1STY A;  1JIC A;  2RDH A;  1HUM A;  3M85 A;  3ERS X;  3FMC A;  3PO2 H;  2F0U A;  3NTI A;  3CCQ A;  1PHJ A;  3BDC A;  1IZ6 A;  5FLM G;  3U9O A;  1I4R A;  3GTQ B;  3P75 A;  3JAM i;  1EQT A;  2J0T D;  1H95 A;  3UDX A;  4LK1 C;  5D14 A;  1LT5 D;  1B4O A;  2Q8I B;  2F3I A;  4IQZ A;  2FMC A;  1EYA A;  1NR2 A;  1SBB B;  4OWT B;  2WII B;  2WAQ B;  1MSH A;  3GTM H;  1F9R A;  1W2B A;  3OSO A;  2JA6 H;  3I4L A;  2NTT A;  2RCF A;  2ZTC A;  1ET9 A;  2L1B A;  4I7A A;  1JCK B;  4IN3 A;  4BBR G;  1U4P A;  4P75 A;  3WDN A;  4LAA A;  3A8J E;  4X3U A;  3C3L A;  2PCF B;  2K5W A;  1GKH A;  3OTO L;  4DV4 Q;  1Q90 A;  3GO5 A;  2NN6 I;  4K8I A;  1WJJ A;  3CMA A;  1Q8K A;  3TP8 A;  2QDL A;  1TWF B;  1MIU A;  2ASB A;  5FO8 B;  3P20 A;  1JWM D;  4DR5 L;  2EYL A;  1QE6 A;  3V05 A;  4B3R Q;  3D31 A;  5IGD A;  1SFO B;  5FO9 B;  4UP7 A;  2IWH A;  1UNS A;  5M3F G;  2QEJ C;  3KF8 A;  4P73 A;  1X56 A;  2F4V Q;  2X6G A;  1BBU A;  3SEB A;  5IYB H;  2B29 A;  4GZY C;  1V8Q A;  3P1H A;  3E0E A;  3L3O C;  4KJN A;  2JA7 G;  2K5Q A;  1CKO A;  4A3M H;  2KHJ A;  1FR3 A;  2EYH A;  4FF2 A;  4DKA C;  2QA4 A;  2IX3 A;  3M7N A;  3KYH C;  4IFD H;  4NXM L;  3I4O A;  1STE A;  3A54 A;  4Q0F A;  4K5X A;  5EKK A;  4DV0 Q;  3MXN B;  4KTA A;  2F0L A;  1TS4 A;  1SNO A;  1D5M C;  3QWN A;  1CA5 A;  3SGI A;  2ZXO A;  3ONA B;  3S1Q H;  5LMN W;  3N52 A;  2R93 G;  4O2D A;  1HA6 A;  3SK5 A;  3RZD B;  3FKI G;  1FGU A;  1HQR D;  4DAP A;  1MHW C;  5M9O A;  4R4C A;  1JR0 D;  4DF7 A;  3E9H A;  1Y69 U;  3LGJ A;  2R3Z A;  5IP7 H;  3J81 c;  1MD2 D;  2PO4 A;  1JJC B;  5M5X H;  3H09 A;  1Q81 C;  1D5X C;  3ULL A;  1WTQ A;  2VQE L;  4TKO B;  3W1G A;  3CRK C;  3DM3 A;  4NKL A;  4A76 A;  1I4X A;  4K6D A;  2VZA A;  1RF2 D;  1TII D;  4JI1 Q;  4K6L A;  2UXD Q;  5GQO A;  5IY0 A;  1A2T A;  3I4N G;  4GS3 A;  1NAP A;  2AQ1 B;  4G7Z C;  4LF7 L;  2BDO A;  3CC4 A;  2L4N A;  4HED A;  1NMF A;  2C9O A;  3N6R A;  1N32 Q;  1QUQ B;  4B3S L;  4RFB A;  1V9P A;  1UEB A;  1MBY A;  1W6J A;  1B3Q A;  1FYC A;  4LJZ C;  4DNT B;  4R1J A;  1O7Y A;  4NPS A;  3OIP A;  2CWA A;  4KKT A;  1L2F A;  1JOR A;  2D2C C;  2YTY A;  5LMN L;  4DR1 Q;  1TWH B;  2OQ0 A;  3PO3 H;  4LMQ D;  1B2T A;  1ICW A;  2NVX B;  1Q82 C;  1EY4 A;  4N9P A;  1IYJ B;  1UAP A;  3MHB A;  1EYG A;  4V19 0;  4MZ9 A;  4I7Z C;  3I70 A;  4HCE A;  4RHR A;  3C1F A;  3CCJ A;  1TVX A;  4DR1 L;  5LMU Q;  1Y1W H;  2D0P A;  4C1N I;  1I94 Q;  2R92 B;  2XRQ D;  3S1N H;  1NCV A;  1TWH H;  1WTO A;  5AJ3 L;  4GLA C;  1QOH A;  5ELO A;  2KJX A;  1IYV A;  1D1K A;  4XT3 B;  2L11 A;  1SJH D;  2MO0 A;  1OXX K;  2PZW A;  1CSP A;  4HSV A;  2R7D A;  1HXY D;  1GJX A;  5IE8 A;  2DN8 A;  1VQD A;  1D6E C;  1E2Z A;  1YEZ A;  2F3W A;  4JI7 L;  3PIP 3;  3RMH A;  3HOW G;  3D4R A;  5M3M H;  3RD4 A;  4X64 L;  1YI2 A;  2L55 A;  2YYZ A;  5C0X H;  4H7B A;  3IL8 A;  3PUX A;  1TWC H;  3H91 A;  2Q2T A;  4DGZ A;  4R4T A;  3BVZ A;  2NZH A;  2GVA A;  3S17 B;  1L1O B;  4GNX A;  4GKK L;  2NVQ H;  1NSN S;  2MQH A;  3J81 i;  2EYM A;  3RZD H;  3IKJ A;  1NR4 A;  2EDG A;  1I5F A;  4EQP A;  2AMC B;  2UXD L;  1SYB A;  1AE2 A;  3R2I A;  4HMI A;  2JJQ A;  5KNB A;  2IT1 A;  4YY3 Q;  2KQ3 A;  4IO9 A;  1IXR A;  4K2L A;  2A6H D;  5IIF A;  5IYB G;  2B3G A;  1RTO A;  5C4X G;  2HIX A;  4A3B H;  4OXP A;  2RKS A;  4B3M L;  2FXQ A;  4PMC A;  4R4O A;  5FO7 B;  1KNA A;  4DUZ L;  2K5D A;  5CR3 A;  1AP0 A;  1STH A;  1XYI A;  3D4W A;  2JA9 A;  3V96 A;  1I4P A;  4N8X 1;  3T1H L;  1KC8 C;  1R4Q B;  2I5L X;  4A3F B;  4DXG A;  1E1T A;  3KBG A;  1E3P A;  1EQR A;  1PYB A;  4RMF A;  4TRD A;  4C3H G;  1CUK A;  4JI1 L;  2Y0S B;  5JJL A;  3FP9 A;  2A8V A;  3K58 A;  5BN4 A;  2PZT A;  5FKA C;  2F0Q A;  4ZK9 B;  4XYO A;  3VR2 A;  5CBE E;  1GD7 A;  2BE5 C;  3I2Z A;  1N33 Q;  1F2L A;  5CV4 A;  3FKI H;  4J8Q A;  4RHS A;  1JJG A;  1FGB D;  2F0O A;  5I4D A;  1LO5 D;  1G29 1;  2HUG A;  2UUB L;  4PQX A;  1HTL D;  2JA5 H;  4JI2 Q;  2R92 H;  2B8F A;  1I50 H;  3MXN A;  2B2U C;  1HCZ A;  1X32 A;  1EL0 A;  3DM1 A;  2XVS A;  4DR5 Q;  3FRP B;  4KY5 A;  4A3G B;  3KLW A;  4JI8 Q;  3SDZ A;  1YHB A;  2JN4 A;  1HR0 L;  2RF4 A;  4CDC C;  3NWS A;  3VA5 A;  2ZJP A;  4GOP A;  4ILW A;  1VQF A;  1C0A A;  1TT2 A;  2RBM A;  4B3T Q;  4DV3 L;  1NE3 A;  1Q86 C;  3PIP A;  3HZX A;  1BF4 A;  2AWO A;  4LF6 Q;  4A93 H;  4ZKB B;  1ROD A;  3TDQ A;  3MFG A;  4EGV A;  4XQJ A;  1A6X A;  3FVQ A;  3JAM c;  2KEN A;  2Q2H A;  2X69 A;  2AUK A;  2JE6 I;  5M3F H;  4NW2 A;  5E7N A;  5IGC A;  2FIN B;  1C4Q A;  3IFD A;  2E8G A;  1EQV A;  1KLU D;  1ZXT A;  1B70 B;  1QVF A;  3K7A B;  4HSP A;  5JPN C;  2HHH L;  1J6Q A;  1SYD A;  1YZ6 A;  2MPM A;  2VY3 A;  3GTK H;  5HUR A;  5KND A;  2NB0 A;  1TY2 A;  2F0M A;  2R7F A;  3D6W A;  1JOK A;  1PFM A;  2PQA B;  1Y1W G;  3CC2 A;  4A3I B;  4JK1 C;  1XMO L;  1WVL A;  1K8M A;  1Z7T A;  5G3L F;  1JC7 A;  4DK3 C;  5ELD A;  5EQ0 A;  3A8K E;  1D1I A;  4RKL A;  2HCI A;  2RA4 A;  5GRO A;  1A62 A;  1PMR A;  5IT9 c;  2EOT A;  3JAM L;  5A2Q L;  4LUO A;  5I9P A;  2PNH A;  2IX0 A;  1BR9 A;  1YVC A;  3PIO A;  4LF5 Q;  2KVM A;  2K33 A;  5JVH 3;  1JOQ A;  4LF8 L;  3KOJ A;  4KLK A;  3STB C;  4QUF A;  3VDY A;  1ILQ A;  4QCL A;  4KKS A;  1EEF D;  4ZAI A;  1GO3 E;  2SNS A;  4A3E G;  1RIP A;  3MEH A;  3QIA A;  2Q2I A;  4DR2 Q;  2B2Y A;  1HHV A;  1K0S A;  3GTL B;  1OXV A;  1DCZ A;  2JK8 A;  3HEJ A;  4JPB W;  4R8N A;  1S40 A;  1SR3 A;  2VNU D;  3H94 A;  1GUT A;  4JI2 L;  3ERO A;  3DUZ A;  3MFY A;  3CCM A;  2JYO A;  1NMG A;  2OCE A;  1PLF A;  2BDN A;  2BE5 D;  3K5M A;  3DHQ A;  1G91 A;  2Z4H A;  3I4M H;  1XNR Q;  1J5E L;  1P8L A;  4ZKC B;  1HR0 Q;  1RJT A;  4A3B G;  1L0W A;  1QCB D;  3AMU A;  5M3F B;  2RQX A;  4UDU C;  1Q7Y C;  4Z9C B;  2ZM6 Q;  1Q3L A;  4M8A A;  1STN A;  4ZRZ A;  2UUB Q;  2NVY B;  2MHV A;  1AW7 A;  3RNU A;  3TP6 A;  4IUV A;  5LMN Q;  3M3Y H;  2I07 B;  2XIW A;  4RGT A;  2IL8 A;  2LXJ A;  1Q12 A;  4N8F A;  3ERQ A;  1ESF A;  5HGQ A;  1U4M A;  4O0A A;  4YY3 L;  3L2P A;  4WJ4 A;  1BCP D;  1I4Q A;  2O5I C;  1YIT A;  4LF4 Q;  4Y52 H;  4QL5 A;  2E2I B;  3OMC A;  1PH2 A;  2RCN A;  3S1M H;  3CCS A;  2JA7 H;  2D0O A;  3VR3 A;  1FVI A;  1SNC A;  4IPH A;  5CV9 A;  2F3V A;  3CU7 A;  4C3I G;  4K14 A;  3TBI B;  4BXX G;  5K36 G;  4DAY B;  2OTJ A;  5KYL A;  1A0I A;  4ODG A;  2F52 A;  2Y0S E;  4HIK A;  3VYS A;  3J7Z C;  4DV7 Q;  1PRT D;  3QJY A;  2DNE A;  3CQZ H;  1SDF A;  2DNC A;  2G9H D;  4J1M A;  1ILP A;  2EZV A;  3Q22 A;  5JVG 3;  3NWT A;  3KFU A;  3OPO A;  1DZ1 A;  4TSS A;  2PW7 A;  2PYK A;  3IRB A;  4RWS C;  1DGS A;  4UAI A;  3L7Z C;  3GQB A;  3PCO B;  2LFN A;  2EJG C;  1ZYR C;  1HZC A;  2Z6K C;  3H15 A;  2A68 D;  2QGQ A;  1PTO F;  1K8G A;  2ES2 A;  1EIH A;  2K7V A;  1N9W A;  2R61 A;  1VDZ A;  2EY6 A;  1SMY D;  4KMU C;  4K5W A;  4DR6 L;  3S14 B;  1RCV D;  1SE8 A;  1FJG L;  2O2L D;  4OL7 A;  2EY2 A;  3MXG A;  5AJ3 Q;  3E6Z X;  5C3X A;  1C48 A;  4K0K Q;  1UEA B;  1TWG H;  2VL6 A;  3CME A;  2ATW A;  4DR4 L;  4BY1 H;  2L15 A;  1C7Y A;  1X3Q A;  4DR3 L;  4J15 A;  1BKB A;  2RHQ B;  1WCM G;  2Q8R E;  1I3Q H;  1SAP A;  1SNM A;  4IPD A;  4CJ0 B;  2JA8 G;  5IT9 E;  2F0S A;  3K0Y A;  1SFO H;  2FMM A;  1CQF A;  5E1F A;  3S2D H;  1Q1E A;  1TQO A;  4JI0 Q;  4DAM A;  4DNR B;  3VYU A;  4QF4 A;  1TWG B;  3GTJ H;  1CHQ D;  2R92 G;  3PUZ A;  4H13 C;  1D5Z C;  3A5Z B;  4FF1 A;  1ZKO A;  4POG A;  2RSN A;  2MUY A;  3K5O A;  1TR5 A;  4EVO A;  3S9W A;  1XNQ L;  4A93 B;  5M3M B;  5D3D A;  5IP9 H;  3PUW A;  4XDX A;  3K5N A;  1H9S B;  1RTN A;  3I72 A;  2RSO A;  2RDG A;  1S5F D;  2AHO B;  3OWE B;  1QZG A;  4XIG S;  1Y8O B;  3IFT A;  5M5Y H;  5I6Y A;  2PQA A;  4NDX A;  2HDL A;  3I55 A;  4K5V A;  2NVQ B;  1CK1 A;  1B1Z A;  3T16 A;  2K5V A;  2YTV A;  3M4Y A;  1PV4 A;  1M8A A;  1DM0 B;  5EPK A;  1GUW A;  4RH6 A;  4APV A;  3OW7 A;  3TRZ A;  2YU9 B;  3U4Z A;  2LMC B;  4OX9 Q;  1A3U A;  1IKL A;  1A3T A;  1C9O A;  4KY7 A;  1PDQ A;  5ELE A;  4LF7 Q;  1ONL A;  3GV3 A;  1PTO B;  4DN4 M;  1LM0 A;  4HJ9 A;  1JWS D;  1VF5 C;  1EIF A;  3RLO A;  2L0C A;  2SEB D;  1OTC A;  1IYU A;  3S16 H;  3PO3 B;  1U5K A;  2CQA A;  1L0X B;  3KF6 A;  1IBL L;  4X65 L;  2YU9 H;  2Q8T A;  4KHP L;  4G57 A;  4F88 A;  1VQ5 A;  1DJR D;  5GAG C;  3KJP A;  5JJK A;  4A3L G;  3EQL C;  1VQO A;  4L5T A;  3HOX H;  2GN5 A;  1IW7 C;  1EOV A;  2YTX A;  1AZP A;  3CW2 C;  3K5L A;  3FKI B;  3BDO A;  3WOF A;  1GM5 A;  1VQB A;  5KGU A;  1E7Z A;  3CC7 A;  4DR6 Q;  2K6A A;  4C2M B;  1B9N A;  1QUQ A;  5E3F A;  4BWG B;  2CH4 W;  2BH2 A;  1X3E A;  1PZJ D;  3F1Z A;  3EVQ A;  5ELN A;  4NXN L;  3LWE A;  1TWA H;  2AWN A;  4KHP Q;  1G6P A;  1AN8 A;  2M9V A;  3HRZ C;  3MWY W;  4RA8 A;  4A3M G;  3MXU A;  3MXP A;  1EWC A;  4YHH Q;  2VQF L;  5CV6 A;  4FDB A;  4IJH A;  2B39 A;  1U4L A;  1PH7 A;  3S1Q B;  4C3J H;  3CD6 A;  2XSC A;  4IPG A;  1SYE A;  3QG1 A;  1X9N A;  1HPC A;  3CPF A;  1PZI D;  2HCC A;  5FJ8 G;  4L5R C;  3S1R H;  2A6E D;  4CGY B;  1UE7 A;  2HIV A;  1TWC B;  3BVG A;  1IBK Q;  5LL6 X;  2UUC Q;  1L1O C;  3CQZ B;  1PXU A;  2AKW B;  3Q24 A;  1K73 C;  3BVM A;  2K03 A;  2IHE A;  1MKH A;  1KAB A;  2RDF A;  2F4V L;  2JA8 H;  1B3A A;  4WJW A;  3T51 B;  2ZM6 L;  5C3E H;  1PH8 A;  2XNA C;  1AE3 A;  1LTG D;  3CCL A;  4NB3 A;  5CMD A;  3KLS X;  1RKN A;  4HID A;  5BN3 A;  2JQO A;  1M1K C;  3VR4 A;  2A68 C;  3RN5 A;  4A3E B;  4FYD A;  4RCN A;  1D8L A;  4DK1 A;  4ABN A;  1EYD A;  1PFB A;  2E75 C;  1QZH A;  1YJ9 A;  2G5D A;  4KJO A;  2QW7 A;  2CCZ A;  1CSQ A;  1CA6 A;  2E5L Q;  1JB3 A;  3T53 B;  1RD9 D;  2CFM A;  4Y7N H;  4L5S A;  2EXD A;  2WAC A;  4JBM A;  2MGS A;  4A3F G;  3A8I E;  4RGO S;  4LF9 L;  1VS0 A;  1M4V A;  4X66 Q;  1G8Z D;  4QQB X;  1IBM L;  4XXE A;  4FF3 A;  4OWW B;  1Z6H A;  1N34 Q;  3TRE A;  3X3N A;  2F0K A;  3S1N B;  2B2V C;  1SEB D;  2NVT B;  1I50 B;  4LF8 Q;  3NBH A;  1QIL A;  4AYB E;  3G6E A;  1CI3 M;  3DEO A;  2J4X A;  5HY6 A;  1OXU A;  5L37 A;  3AQQ A;  5EKL A;  4DXF A;  3GV6 A;  4BY7 B;  5G3L D;  3SK6 A;  1ENA A;  3MVV A;  4KY6 A;  3G7L A;  1KTK A;  1GOZ A;  1R4P B;  2CW0 D;  5E4W C;  1WFQ A;  2LS0 1;  1YNN D;  4DR4 Q;  5JJI A;  2XTI A;  4DV7 L;  2JEB I;  1B53 A;  1DOL A;  3F2C A;  2WV6 D;  2IX1 A;  1FNV A;  3GDE A;  1DD2 A;  1X54 A;  3CRL C;  1F9Q A;  1A15 A;  2TMP A;  1G6Z A;  3GTM B;  1TY0 A;  4NXN Q;  3SXH A;  5BR8 Q;  4A3L H;  5K5P A;  4A3K G;  2F03 A;  3ICE A;  4A3B B;  1EY7 A;  3EA6 A;  2B63 H;  4EQ5 A;  1OO9 B;  3A7A B;  1BNZ A;  1KDC A;  3I4N B;  3H6M A;  5H1S E;  2I0Q A;  1HNZ Q;  4IJL A;  5ELC A;  3RZO B;  1W6K A;  4QJF A;  2VQE Q;  3M4P A;  1KLG D;  1ASY A;  1VMP A;  1ET6 A;  1VQL A;  4LUV A;  3HOZ B;  2CQO A;  4IFD I;  1U4R A;  4HR7 B;  2JA6 G;  2ZXP A;  1HNX L;  2HT1 A;  5C3W A;  1OXT A;  3NHH A;  4V0B A;  1U0L A;  2QEX A;  2VUM G;  1Z47 A;  4FNF A;  4CDE C;  1H9M A;  4LFA Q;  1TWF H;  1V1P B;  4JV5 Q;  1CT1 D;  1CZW A;  4KN7 C;  1E24 A;  3TN2 A;  3C1E A;  2WFW A;  4PG3 A;  1EEI D;  4JBJ A;  3J7A 5;  3HOZ G;  5J1Z A;  2KEE A;  3I73 A;  3ZJY C;  1G2S A;  2NVX H;  1KQS A;  4P2C B;  1K3R A;  5C4J B;  1LT6 D;  2R93 H;  4CHT B;  3PUV A;  2LXK A;  1BVS A;  5DAU A;  1V1Q A;  4BXX H;  1Y1W B;  1O7I A;  4KN4 C;  4PZ8 A;  4X62 Q;  4GKJ Q;  3HOY G;  2K04 A;  4DA2 A;  2Z6K A;  5IGE A;  3F8T A;  5C3E G;  3MTS A;  4JBW A;  4DU9 A;  4BBS B;  3I4M B;  2RHS B;  3D3R A;  4G4K A;  2V1C C;  2F0J A;  1JOO A;  1VQ8 A;  4CKC A;  2XN9 C;  1WYD A;  1GVP A;  3FEW X;  2N88 A;  1MSG A;  5IYC H;  1LYL A;  1BQQ T;  2EYP A;  4A3C G;  4HJ8 A;  2E2I H;  1GUG A;  2BOS A;  2VUM H;  5EPJ A;  4GLV B;  1SYF A;  4LUZ A;  1F2M A;  2E2H B;  1CKM A;  1I94 L;  1PRT C;  1HUN A;  3D8G A;  5C3E B;  3MZ5 A;  2QKI C;  3DWP A;  3ND9 A;  2K75 A;  5NUC A;  3SE0 A;  1Y1V B;  4C56 C;  2PMZ B;  3TS0 A;  2N78 A;  5M5X B;  4UP9 A;  3ULJ A;  2EJM A;  2PPB C;  4DUY L;  4A3J B;  2D5D A;  3Q8D A;  3MAQ A;  4C1N K;  3K6O A;  4JI3 L;  1TS5 A;  5M5W H;  1XMO Q;  1EU3 A;  1VQH A;  2KA7 A;  4A3F H;  3AB9 A;  3I56 A;  4DV2 L;  1PH6 A;  1TS2 A;  5C6A A;  2UUC L;  5FK9 C;  3RR5 A;  4YCW A;  1JWU D;  1PFN A;  5JEA H;  4IZ8 A;  4WFN 3;  1KRT A;  2ICI A;  4XQQ A;  2GA4 B;  1V43 A;  4FXG C;  3H3V I;  2UUA Q;  1HNW L;  4YWK A;  3AEV A;  4A3I H;  2Z6B A;  3ULP A;  2DY8 A;  1G2T A;  4DK0 A;  2RVL A;  5IP9 G;  1NJI C;  1N36 L;  1SYG A;  1LV9 A;  4A3D H;  4IFD J;  1BOS A;  4O1N A;  3HOU H;  2K14 A;  1HJP A;  3E9I A;  4JCV E;  2KCN A;  3M7G A;  1WTW A;  2BA0 A;  5DM7 3;  1GUS A;  4UY8 C;  1I4G A;  3E0J A;  4DFA A;  2EY1 A;  5T1G A;  4CJ1 B;  4JI8 L;  1CTM A;  1XTD A;  3W5O A;  1WTX A;  2ALY B;  1N8R C;  4JI4 Q;  3CCU A;  2Q2U A;  1KL9 A;  4R4Q A;  4U68 A;  3FHW A;  4HN7 A;  4PNY A;  3OIQ A;  1BCP B;  1J9O A;  2DY7 A;  3CPW A;  5IYD H;  2P5Z X;  1K8A C;  2A1A A;  2B8G A;  5BN5 A;  3HOX B;  4FO2 A;  3A7L A;  4JI4 L;  4L6T B;  5EBC A;  2XWJ B;  5J39 A;  1PRT B;  1NTG A;  2E74 C;  4JYA Q;  4DUZ Q;  2R6G A;  4X65 Q;  2IY5 B;  2J7Z A;  4DV0 L;  1YNJ C;  1XMQ L;  2I5H A;  3K7A H;  1UUP A;  5IWA L;  2B2V A;  3A74 A;  4AYB B;  1S5E D;  2E2H H;  4L8J A;  3GTK B;  4ZUI A;  4C3J G;  4DR7 Q;  5GAH C;  1D7Q A;  1HTP A;  2K05 A;  2NWG A;  2V4D A;  2UXC Q;  2VB3 X;  1HA5 A;  2LSS A;  4BA2 I;  4ZYS A;  3HOW H;  3UDI A;  2B2T C;  3J81 j;  4QMG A;  5M5Y B;  2C5C A;  2PMZ E;  4C3I B;  4F7X A;  4B3M Q;  1IL2 A;  3GTG H;  2OXP A;  1F9S A;  1VQE A;  1N33 L;  1E1O A;  3AU7 A;  4FP5 D;  2ZTD A;  3PUY A;  1EU4 A;  3K0X A;  4WOR A;  3K80 C;  4HAE A;  1E0B A;  3T1Y Q;  1PH4 A;  2B63 G;  1VF7 A;  1S5C D;  2WAQ E;  1JMC A;  1BXT A;  1LTI D;  5DLQ E;  2UU9 Q;  1PTO C;  2O5J C;  1D2B A;  4QUC A;  4BY7 G;  3PQI A;  3PMF A;  1M90 C;  4CJ2 C;  3I8Z A;  1PA6 A;  1XPU A;  2F4I A;  4R8I A;  3H0G H;  1BDO A;  3BG3 A;  4A3C H;  4G7O C;  5FLX c;  3M9B A;  4A3J G;  2SOB A;  1HZ9 A;  1FNW A;  4N9T A;  3AFP A;  2E2J B;  3S14 H;  4JOI A;  5I9O A;  4DK6 C;  1X3P A;  3H3V C;  1FL0 A;  3OYY A;  3BU2 A;  3DXJ C;  2F0E A;  3S2D B;  2LY7 A;  4OX9 L;  3NK9 A;  4BY1 B;  4YIJ A;  5IGF A;  1VQK A;  1RHP A;  3ND8 A;  1ENF A;  4IOA A;  3DWQ A;  4A3D G;  2DJF C;  4RAU C;  5E4X A;  3PIO 3;  2N3S A;  3KDF A;  5KRU A;  1KRS A;  2ZJR A;  5JPM C;  5EGT A;  4CKE A;  4FXD A;  4KD3 A;  5C0X J;  1SE3 A;  2ZXR A;  1O7L A;  3UDG A;  2WB1 G;  1FJG Q;  4BY7 H;  3TP5 A;  4JI7 Q;  1CKN A;  2ZTE A;  3HOW B;  4RGN A;  1CM9 A;  3NTK A;  1Y1V H;  2D62 A;  2FJ2 A;  1XJV A;  1AFP A;  3I4M G;  2R7Z H;  1R9T B;  1B9M A;  1SRU A;  4DV2 Q;  2CW0 C;  2K4K A;  4JG2 A;  4OEL B;  4I65 A;  4AQY L;  1ASZ A;  4DV6 Q;  4LNQ A;  2NN6 H;  4XTC S;  4BS9 A;  4UHV A;  3DMU A;  3NUC A;  4UP8 A;  5KEE A;  4A3J H;  5FLM H;  4IUQ A;  1LTA D;  4B3S Q;  5ELB A;  4J6H A;  1C8C A;  2KHI A;  4LF9 Q;  2A73 B;  2NTS A;  2K32 A;  2Z4I A;  3TEH B;  4IOC A;  4JI0 L;  5EAY A;  2HHH Q;  1IBK L;  1LLR D;  2AUJ D;  3J7A F;  3KLR A;  1GHJ A;  3K59 A;  1WTR A;  3OHX C;  3HOV H;  3I90 A;  1F9P A;  3CF5 A;  1QNK A;  4ALP A;  2F0D A;  5ISR A;  1LAB A;  3BS1 A;  4DAV A;  2KEC A;  4H0L C;  3BYT B;  3U9S A;  1EY0 A;  2VS1 A;  4CBV A;  2WAQ G;  4C3I H;  3QR8 A;  5K36 H;  3KLS A;  3B6Y A;  5JAV A;  2PNR C;  4IAL A;  1YJN A;  2K28 A;  3AFQ A;  3EIV A;  2OWO A;  3DEP A; 
#chains in the Genus database with same CATH homology
 1W3S A;  3S2H H;  3T1H L;  4A3E H;  1D8L A;  1KC8 C;  3OTO Q;  3CAM A;  2I5L X;  1E1T A;  3PF4 A;  1EQQ A;  3GTP H;  1TXY A;  1QZH A;  3OW2 A;  1YJ9 A;  1E3P A;  3W1B A;  1EQR A;  1PYB A;  4RMF A;  4TQU S;  1S72 A;  2CCZ A;  4BA1 I;  1CSQ A;  1CUK A;  2KCM A;  2VQF Q;  4JI1 L;  4KI0 A;  2E5L Q;  3FP9 A;  4A3G G;  5JJL A;  2IHF A;  1UE5 A;  2A8V A;  1XPO A;  4JYA L;  2CFM A;  4OON A;  1YBY A;  4Y7N H;  3NEM A;  3S24 A;  1XNR L;  4L5S A;  2EXD A;  3PGZ A;  1GD7 A;  1EWI A;  3I2Z A;  1QVG A;  4JBM A;  1N33 Q;  4L5Q A;  4A3F G;  5IWA Q;  1JB7 A;  3FKI H;  1IBM Q;  1X3G A;  3TQY A;  1JJG A;  4LF9 L;  1VS0 A;  4X62 L;  4X66 Q;  1SRO A;  2OTL A;  4JI3 Q;  4YCV A;  4GKJ L;  4QQB X;  1IBM L;  4P71 A;  1G29 1;  4OWW B;  1N34 Q;  3TRE A;  3UE1 A;  2UUB L;  4BBR H;  2JA5 H;  3KF8 B;  4JI2 Q;  2R92 H;  1HR0 W;  1I50 H;  2N8N A;  3STB D;  4AQY Q;  2MFI A;  3WWV A;  4LF8 Q;  2MO1 A;  4AYB E;  3G6E A;  4LF5 L;  3U50 C;  4A75 A;  1VQN A;  1PVO A;  1Z9F A;  4DR5 Q;  1N36 Q;  3RN2 A;  5HY6 A;  4YHH L;  3F2D A;  1OXU A;  3KLW A;  4JI8 Q;  3AQQ A;  1JJ2 A;  4AH6 A;  4OO1 I;  1YHB A;  2PI2 E;  1HR0 L;  2RF4 A;  2ZJP A;  4GOP A;  4BY1 G;  1VQF A;  1C0A A;  2EIF A;  1MJE A;  4B3T Q;  3NEL A;  4JC0 A;  4DV3 L;  5IYD G;  1NE3 A;  1Q86 C;  1JT8 A;  3HFZ B;  3ER0 A;  1R9T H;  3PIP A;  5LMU L;  1WFQ A;  4DR4 Q;  2NVY H;  5JJI A;  4NXM Q;  2XTI A;  2AWO A;  4DV7 L;  4LF6 Q;  4TVA B;  2JEB I;  4RG1 A;  4A93 H;  5C0X I;  3F2C A;  2IX1 A;  3GDE A;  1X54 A;  1B8A A;  2R7Z G;  3H0G G;  2E5L L;  4X6A H;  4HIM A;  3JAM c;  4NXN Q;  5BR8 Q;  2KEN A;  4DR2 L;  4A3L H;  2Q2H A;  1RL2 A;  2JE6 I;  2HQL A;  5E7N A;  5M3F H;  4A3K G;  3PO3 G;  1MJC A;  3ICE A;  2E8G A;  4LWC A;  4OWX B;  2B63 H;  4EQ5 A;  1B70 B;  1QVF A;  1E22 A;  3T1Y L;  4LF4 L;  5H1S E;  2HHH L;  2Y0S G;  3PV0 A;  1J6Q A;  3K7U C;  1YZ6 A;  2I0Q A;  1HNZ Q;  4IJL A;  1LUZ A;  2VY3 A;  1PH1 A;  3GTK H;  2DUD A;  2KCT A;  4QJF A;  3HOY H;  2VQE Q;  2R7F A;  3M4P A;  1Y1W G;  2PQA B;  3CC2 A;  1ASY A;  4KHZ A;  1XMO L;  1VQL A;  3U4V A;  4DV1 Q;  3NEN A;  4LUV A;  4DK3 C;  1NY4 A;  4HJ5 A;  2CQO A;  2K50 A;  4IFD I;  1VQ4 A;  3HOX G;  5GRO A;  1A62 A;  5IT9 c;  2I5M X;  4GKK Q;  2WB1 E;  4LUO A;  3J80 i;  2JA6 G;  2PNH A;  4LFA L;  2IX0 A;  1PYS B;  3M4Q A;  1YVC A;  1XPR A;  1HNX L;  3U58 A;  3NBH B;  3PIO A;  2HT1 A;  4LF5 Q;  1OXT A;  4GN4 B;  5J3B A;  1U0L A;  2QEX A;  4LF8 L;  3KOJ A;  2VUM G;  1Z47 A;  2NN6 G;  4KLK A;  3STB C;  3VDY A;  4DV3 Q;  4LFA Q;  3CP0 A;  1J5E Q;  1HNZ L;  1TWF H;  4JV5 Q;  4PZ7 A;  4QIW E;  4A93 G;  1WOC A;  4QGU A;  1E24 A;  4YWL A;  1VQM A;  1GO3 E;  4PG3 A;  2WFW A;  4JBJ A;  3J7A 5;  1P16 A;  4A3E G;  1QVC A;  2PI2 A;  1RIP A;  2Q2I A;  3HOZ G;  2BH8 A;  4DV1 L;  4LFB L;  5BR8 L;  4DR2 Q;  4R4I A;  1VQ9 A;  3ZJY C;  1OXV A;  2JK8 A;  1S40 A;  2Z0S A;  2NVX H;  2VNU D;  1PH9 A;  1SR3 A;  1KQS A;  4GNX B;  1JE5 A;  1K3R A;  3G48 A;  4JI2 L;  4IFD G;  2R93 H;  1WI5 A;  1LTL A;  4AIM A;  3PUV A;  4B3R L;  1YNX A;  1Q1B A;  2LXK A;  1BVS A;  1A8V A;  1V1Q A;  1G51 A;  3GTO H;  4BXX H;  3BZK A;  1O7I A;  3K81 C;  3MEF A;  4PZ8 A;  1K9M C;  1XNQ Q;  4X66 L;  4X62 Q;  4GKJ Q;  3CCM A;  3HOY G;  1S3O A;  1BBW A;  2KBN A;  1CKN B;  1NMG A;  2OCE A;  3T1H Q;  2Z6K A;  1KXL A;  3F8T A;  5C3E G;  4QY7 A;  3I4M H;  4JBW A;  5IP7 G;  1XNR Q;  1J5E L;  1P8L A;  1HR0 Q;  2RHS B;  3RLN A;  2V1C C;  4A3B G;  3GD7 A;  3GTL H;  1EIY B;  1VQ8 A;  3BZC A;  1L0W A;  4JI6 Q;  1I6H H;  1WYD A;  1HNX Q;  4LF6 L;  1GVP A;  4PZ6 A;  1X55 A;  1Q7Y C;  4C2M H;  1LYL A;  5IYC H;  4WJ3 M;  2ZM6 Q;  2CWP A;  3CXC A;  3EBE A;  3CCR A;  4A3C G;  4HJ8 A;  2E2I H;  1EUJ A;  2C35 B;  1VQC A;  2VUM H;  3HOV G;  1UE1 A;  2UUB Q;  4GLV B;  1HZB A;  2JA5 G;  2UUA L;  3AYH B;  4LUZ A;  3RNU A;  4C3H H;  2UXB L;  1Y1V G;  5LMN Q;  3UE0 A;  3M85 A;  3M3Y H;  3ERS X;  1CKM A;  1SLJ A;  2VW9 A;  4DR3 Q;  1I94 L;  2LXJ A;  3PO2 H;  4DNI A;  1Q12 A;  5C4X H;  3TS2 A;  3I7F A;  4P74 A;  3CCQ A;  4AYB G;  2K75 A;  5HGQ A;  1PHJ A;  1IZ6 A;  4O0A A;  4YY3 L;  3L2P A;  4WJ4 A;  5FLM G;  1X3F A;  4IPC A;  3S17 H;  1YIT A;  3TS0 A;  1T9H A;  2N78 A;  4LF4 Q;  4Y52 H;  4QL5 A;  4UP9 A;  3JAM i;  1UWV A;  1PH2 A;  2EQS A;  2RCN A;  3UDX A;  3ULJ A;  3CCS A;  2D0O A;  4HJ7 A;  2JA7 H;  3S1M H;  1KAW A;  3KDF B;  3I4N H;  1FVI A;  4DUY L;  4IPH A;  3Q8D A;  2F3I A;  5GAD C;  4JI3 L;  5M5W H;  1XMO Q;  2N49 A;  4BXX G;  5K36 G;  5FJ8 H;  4OWT B;  1VQH A;  4DAY B;  2OTJ A;  1SMX A;  1A0I A;  4A3F H;  3GTM H;  1UE6 A;  1W2B A;  1X65 A;  4YWM A;  3I56 A;  2F52 A;  4DV2 L;  3HKZ G;  1PH6 A;  2JA6 H;  2Y0S E;  2UUC L;  4HIK A;  3J7Z C;  2E2J H;  1H95 A;  3RR5 A;  4DV7 Q;  2ZJQ A;  2ZTC A;  3CQZ H;  4YCW A;  4OO1 G;  2R7Z H;  4BBR G;  4GLX A;  2K5N A;  4P75 A;  4A3K H;  1KRT A;  1VQG A;  4GNX C;  3KFU A;  1VQI A;  1V43 A;  4X64 Q;  3H3V I;  3IRB A;  1DGS A;  2UUA Q;  1GKH A;  3L7Z C;  3OTO L;  4DV4 Q;  1HNW L;  3D0F A;  2NN6 I;  3GO5 A;  1WJJ A;  3PCO B;  4YWK A;  3CMA A;  3AEV A;  1Q8K A;  1HZC A;  4A3I H;  5C4J H;  2Z6K C;  3H15 A;  3ULP A;  2QGQ A;  1K0R A;  3CCV A;  1K8G A;  4MTN A;  2ES2 A;  1MIU A;  4YCU A;  4DV5 L;  1N9W A;  2ASB A;  5IP9 G;  2NZO A;  4DR5 L;  1NJI C;  1N36 L;  3M4O H;  4DR6 L;  4B3R Q;  3S15 H;  4A3D H;  3D31 A;  4LFC Q;  4IFD J;  1A63 A;  1SE8 A;  3HOU H;  2K14 A;  1FJG L;  1HJP A;  3E9I A;  4JCV E;  4UP7 A;  3DLL A;  5AJ3 Q;  2BA0 A;  5M3F G;  4K0K Q;  4UY8 C;  1L1O A;  1TWG H;  2VL6 A;  4P73 A;  3CME A;  2ATW A;  1PH3 A;  4BY1 H;  2L15 A;  4DR4 L;  1X56 A;  3G71 A;  4DR3 L;  1C7Y A;  2F4V Q;  4J15 A;  1BKB A;  2RHQ B;  4JI8 L;  1BBU A;  1XTD A;  3W5O A;  2ALY B;  1WCM G;  3PSI A;  2K52 A;  2B29 A;  5IYB H;  5GAE C;  1N8R C;  4JI4 Q;  3E0E A;  2JA7 G;  3CCU A;  2Q2U A;  1CKO A;  4A3M H;  1I3Q H;  5M3M G;  4IPD A;  2NVT H;  4DV6 L;  2JA8 G;  1KL9 A;  2KHJ A;  1SFO H;  4R4Q A;  3FHW A;  4DKA C;  2QA4 A;  3S2D H;  2XGT A;  3M7N A;  3CPW A;  1Q1E A;  5IYD H;  3KYH C;  1VQP A;  2A1A A;  1K8A C;  3I4O A;  4DAM A;  4JI0 Q;  1Y14 B;  4NXM L;  4JI6 L;  4JI4 L;  4JOI C;  3GTJ H;  1AH9 A;  3BJU A;  4DV0 Q;  3MXN B;  2R92 G;  3PUZ A;  2UXB Q;  2GVB A;  2K5H A;  3A5Z B;  4K0K L;  1HH2 P;  3G4S A;  3SGI A;  1NTG A;  4POF A;  5C0X G;  4POG A;  3S1Q H;  4JYA Q;  2OQK A;  4DUZ Q;  2R6G A;  5LMN W;  3GTQ H;  4X65 Q;  2IY5 B;  4DV0 L;  2R93 G;  4O2D A;  1KHI A;  1XMQ L;  2I5H A;  3K7A H;  1XNQ L;  5IWA L;  3KJO A;  3FKI G;  3A74 A;  1FGU A;  2E2H H;  4R4C A;  5IP9 H;  5GAH C;  4DR7 Q;  3PUW A;  1D7Q A;  4A3G H;  2UXC Q;  3E9H A;  4HIO A;  3LGJ A;  2LSS A;  4BA2 I;  2BA1 A;  5IP7 H;  3J81 c;  3HOW H;  1JJC B;  2AHO B;  3UDI A;  1QZG A;  4XIG S;  3J81 j;  4DUY Q;  5M5X H;  1YIJ A;  5M5Y H;  4B3M Q;  2PMZ E;  2YV5 A;  2PQA A;  1Q81 C;  1IL2 A;  3ULL A;  3GTG H;  3I55 A;  2VQE L;  1VQE A;  1N33 L;  1E1O A;  3W1G A;  5IYC G;  1PH5 A;  2ZTD A;  3PUY A;  2K5V A;  3DM3 A;  2YTV A;  4A76 A;  1PV4 A;  3K0X A;  2VZA A;  3K8A A;  5C44 H;  3K80 C;  3T1Y Q;  4LFC L;  1PH4 A;  4APV A;  4JI1 Q;  2WAQ E;  2B63 G;  3TRZ A;  1JMC A;  2UXD Q;  3U4Z A;  4OX9 Q;  4HJA A;  4BBS G;  5DLQ E;  4GN5 A;  4DV5 Q;  5GQO A;  2UU9 Q;  4B3T L;  1C9O A;  5IY0 A;  4LF7 Q;  4BY7 G;  3I4N G;  1M90 C;  4HJ9 A;  1LM0 A;  4GS3 A;  2CKZ B;  5JEA J;  4GOP B;  4LF7 L;  1EIF A;  3RLO A;  1PA6 A;  1OTC A;  3CC4 A;  3H3V H;  3S16 H;  1XPU A;  1NMF A;  3A5U A;  1U5K A;  1N32 Q;  3H0G H;  3RZO H;  3KF6 A;  4A3C H;  1QUQ B;  3UDF A;  5FLX c;  1IBL L;  3M9B A;  4X65 L;  3CCE A;  4B3S L;  2YU9 H;  1N32 L;  1V9P A;  1UEB A;  4A3J G;  1HZ9 A;  1VCI A;  2JEA I;  4KHP L;  3AFP A;  4R1J A;  1VQA A;  4NPS A;  3S14 H;  4JOI A;  4DK6 C;  1VQ5 A;  1VQ6 A;  2DGY A;  4UPA A;  2CWA A;  5GAG C;  1L2F A;  1Q46 A;  3PO2 G;  1FL0 A;  3OYY A;  2YTY A;  3BU2 A;  3KJP A;  5JJK A;  5LMN L;  4DR1 Q;  2UU9 L;  4A3L G;  1YJW A;  1VQO A;  4L5T A;  2OQ0 A;  3HOX H;  2GN5 A;  4OX9 L;  1VQ7 A;  3PO3 H;  3HKS A;  1Q82 C;  1VQK A;  1EOV A;  2YTX A;  4JI5 L;  3CW2 C;  1GM5 A;  1IYJ B;  1HZA A;  4IOA A;  1EYG A;  1VQB A;  4A3D G;  4DR7 L;  1E7Z A;  4P72 A;  4MZ9 A;  3J80 c;  3CC7 A;  4DR6 Q;  2N3S A;  3CCJ A;  1X6O A;  2ID0 A;  3KDF A;  1KRS A;  4DR1 L;  2ZJR A;  5LMU Q;  1Y1W H;  1QUQ A;  2D0P A;  1I94 Q;  5C44 G;  3S1N H;  5C0X J;  2BH2 A;  1X3E A;  1YHA A;  1TWH H;  3F1Z A;  4BBS H;  3L0O A;  5ELN A;  4NXN L;  4JV5 L;  5AJ3 L;  1TWA H;  1PFS A;  2AWN A;  3HKZ E;  4GLA C;  4KHP Q;  3HOU G;  5ELO A;  1G6P A;  3UDG A;  2WB1 G;  3A0J A;  1FJG Q;  4H02 A;  4BY7 H;  4JI7 Q;  2UXC L;  4A3M G;  2MO0 A;  1OXX K;  3PF5 A;  1CSP A;  1CKN A;  4YHH Q;  2MNA A;  2VQF L;  4DPG A;  2ZTE A;  2R7D A;  4FDB A;  4IJH A;  4MNO A;  4LFB Q;  1PH7 A;  1Y1V H;  2D62 A;  1XJV A;  4C3J H;  3I4M G;  3CD6 A;  2H5X A;  1VQJ A;  5IE8 A;  1SRU A;  1XMQ Q;  4DV2 Q;  1VQD A;  2K4K A;  4IPG A;  4JG2 A;  1WCM H;  1YEZ A;  4LW1 A;  4AQY L;  1X9N A;  3CPF A;  1ASZ A;  4JI7 L;  2WP8 J;  4DV6 Q;  4JI5 Q;  4LNQ A;  4XTC S;  3F2B A;  4DV4 L;  5FJ8 G;  4L5R C;  3HOW G;  5M3M H;  4UP8 A;  4A3J H;  4X64 L;  5FLM H;  3S1R H;  1YI2 A;  2YYZ A;  1UE7 A;  4A4I A;  4EX5 A;  2HIV A;  3JC6 6;  3RLF A;  1IBL Q;  4B3S Q;  1OXS C;  2KHI A;  1K83 H;  4LF9 Q;  3PUX A;  1TWC H;  1IBK Q;  2Q2T A;  4ME3 A;  4IOC A;  1B7Y B;  4R4T A;  3TEH B;  4JI0 L;  2NZH A;  2GVA A;  5EAY A;  2UUC Q;  4A3I G;  1L1O C;  3KF6 B;  5JEA G;  2HHH Q;  2AKW B;  1K73 C;  1L1O B;  4GNX A;  4GKK L;  2NVQ H;  1IBK L;  2MQH A;  3J81 i;  1EFW A;  1N34 L;  3RZD H;  1YHQ A;  1KIX A;  3EN2 A;  2IHE A;  4GOP C;  1I5F A;  1MKH A;  2AMC B;  2UXD L;  4GN3 B;  3HOV H;  1AE2 A;  2F4V L;  2JA8 H;  3CF5 A;  1HNW Q;  2JJQ A;  4ALP A;  2ZM6 L;  5C3E H;  2IT1 A;  1PH8 A;  4YY3 Q;  4IO9 A;  1IXR A;  5IYB G;  1AE3 A;  2B3G A;  5C4X G;  2HIX A;  2VS1 A;  4A3B H;  3CCL A;  3HOZ H;  4JBK A;  4NB3 A;  4OXP A;  2WAQ G;  4C3I H;  4B3M L;  1KD1 C;  2FXQ A;  3B6Y A;  4R4O A;  4HID A;  2JQO A;  4DUZ L;  1YJN A;  1M1K C;  4PMW A;  3AFQ A;  3EIV A;  2OWO A;  1NBW A;  3RN5 A;  1SN8 A;  2JA9 A;  2A19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...