1VQGA

Gene v protein mutant with ile 47 replaced by leu 47 (i47l)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKLTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Potential use of additivity of mutational effects in simplifying protein engineering.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqgA00
4DUZL 5IT9c 3CCSA 4AYBG 1PHJA 2Z0SA 5DLQE 4HJAA 4LF6L 4DR6L 5AJ3Q 2EIFA 3U58A 5C3EH 4B3RL 2JA6G 1YVCA 2R7ZH 3GD7A 4WJ4A 3HOVG 2VW9A 1PYSB 2IY5B 1G6PA 3EBEA 1JJGA 2OWOA 2HIVA 4JI6Q 4JI1L 2MO1A 4OX9Q 1MJCA 2AHOB 3CW2C 3G48A 5GAGC 4A3KG 5IP9H 2RHQB 1WFQA 1HR0L 1OTCA 1VQEA 1IYJB 2ATWA 4K0KQ 1N33L 3TEHB 3S1MH 2YTXA 3HOUH 2R7FA 1TXYA 3TRZA 3RZOH 4YHHL 1HNZL 4R4OA 4JI8Q 4L5QA 4BBSH 3H3VI 4A3JG 1DGSA 3KYHC 4DV5Q 4DV6L 1N34Q 1K9MC 1HR0W 3M9BA 4RMFA 2JE6I 3UDXA 2K50A 1O7IA 4DUZQ 1B70B 2ALYB 5FJ8G 1VQAA 4QGUA 1VQ7A 2ZTDA 1T9HA 4A3MG 4LF6Q 4DR7L 4LFCL 3CCQA 2QA4A 2N8NA 2UUCL 4GOPA 1PH4A 1L2FA 1SE8A 3K81C 1XNQQ 4DV0Q 1SMXA 1PH2A 2CWAA 4LUZA 4JI1Q 5K36G 2Y0SG 1X56A 4OXPA 5M5YH 1PH1A 5IYBH 3KOJA 4HIMA 1UE1A 4X66L 4IOAA 3CQZH 2Q2UA 2N78A 3E0EA 2PI2E 1FL0A 1JB7A 4JV5L 4DR1L 3AQQA 2JA7H 1Y1VH 4TVAB 3MEFA 2WAQE 4UP8A 3U4ZA 4X65L 3CCUA 1Q86C 1Z47A 2Q2HA 1HNZQ 4IPHA 1NMGA 4JBJA 2UU9L 2R93H 3W1GA 3PUYA 4EX5A 2QGQA 2HT1A 1MKHA 2PQAB 2CQOA 4B3SQ 2RHSB 4LFAL 1YEZA 4AIMA 3PGZA 3S15H 4YY3Q 1TWGH 3PUVA 4JI5Q 1YJ9A 4DR7Q 4R4TA 3S16H 5C44G 4DV7L 4IFDJ 1PYBA 2LXKA 4RG1A 4YCWA 4AQYL 1J5EQ 2K4KA 1SN8A 3HFZB 1UE7A 2UUCQ 1CKOA 4QQBX 4C2MH 3TREA 4X62Q 4LF9Q 3L7ZC 4PZ7A 2JA5H 4LF5Q 5IYDG 2DGYA 1X65A 3E9IA 3MXNB 2I5LX 3KDFB 2F52A 2ZTEA 4JG2A 5HY6A 3I56A 4GNXC 4A76A 3T1HQ 4JV5Q 1TWFH 3T1YL 2E5LQ 4X65Q 2WP8J 4DK6C 4B3ML 5EAYA 1U5KA 2H5XA 1EIYB 1YIJA 3I4OA 2UU9Q 2FXQA 2F4VL 2ES2A 2JK8A 3FHWA 3ZJYC 3U4VA 1VQJA 4QL5A 3HOYH 4L5RC 3RLOA 1HZCA 2KBNA 5J3BA 4DK3C 1EQQA 5FLMG 2D0OA 4KHPL 3STBC 3F2BA 1YJWA 2OCEA 4HIKA 2VUMG 4DR4L 1C0AA 1N8RC 1I5FA 4P71A 5LMNQ 1LUZA 3JC66 1EIFA 3S1RH 1B8AA 4A3BH 4HJ8A 4OONA 1KAWA 1VCIA 2IT1A 2I0QA 4X64L 5AJ3L 1GM5A 3HOZH 3H0GG 1Q8KA 4DNIA 1EFWA 4IFDI 2AWNA 3ER0A 1EQRA 4IPGA 3KFUA 3CCLA 4GKKQ 5JJLA 1XTDA 1X6OA 1HH2P 4JI6L 4L5TA 3S24A 4OX9L 1LM0A 2QEXA 1HZ9A 2VL6A 1A62A 3A5ZB 3F8TA 1QUQA 1KXLA 4K0KL 3I7FA 3PSIA 4KI0A 4IPCA 2CWPA 1VQ4A 1KQSA 1VQBA 2E2HH 2MO0A 3EN2A 2LSSA 2F4VQ 4BY7H 1SLJA 4JI8L 3NEMA 5IP7H 2ASBA 4C3IH 1N32Q 4DV5L 1HZAA 1IXRA 3AFPA 3FKIH 5M3MG 4A3CG 2KHJA 4P74A 3ICEA 2VNUD 3KJPA 4DR4Q 3W5OA 3RNUA 4QJFA 4GOPB 1X3GA 4A3EG 5JEAJ 2RCNA 2WB1G 2K75A 5ELOA 1YHBA 4X64Q 4HIDA 3GTGH 4FDBA 3D0FA 4GN4B 1Q46A 4LFBQ 2K5NA 4DR2L 3CCVA 3S1QH 4B3TL 1OXUA 4A3LH 1XNQL 3M7NA 1GO3E 4DV0L 5C0XG 1K8GA 4KHZA 4LF8Q 4POFA 1Z9FA 1Q82C 4HIOA 2I5MX 4PMWA 5C3EG 3ERSX 2BH2A 3GDEA 3PUWA 2R7ZG 1L1OC 5C4JH 2OTLA 1I94L 4GS3A 1QVGA 1Y1WH 2NN6G 3CP0A 2UUBQ 1XMQQ 3HOVH 3PO2G 4NPSA 1EYGA 3S17H 3SGIA 2R7DA 4LUOA 1HNXQ 1CKNA 1GD7A 2PI2A 3UDIA 1A8VA 4A3FH 3PO3G 2ZM6Q 1R9TH 1YZ6A 3RZDH 1W3SA 2JJQA 3M85A 4B3SL 1KIXA 5GAEC 4YWMA 1K3RA 4YWLA 3J81j 4A3GH 4DPGA 4JI7Q 2C35B 4YY3L 1KRSA 4OWWB 2A19A 3S2DH 3PIOA 4JI5L 4DR3L 1VQDA 3RLNA 4DV1Q 1A0IA 1TWHH 2UXDQ 1J5EL 4DR2Q 1XPUA 4R4IA 5JJIA 4X62L 2WFWA 4B3TQ 4LWCA 4LF9L 4LF5L 1SFOH 2KCTA 3STBD 4R1JA 1N36Q 3CC2A 2R92H 1XMOQ 3CF5A 2UXCQ 1EUJA 5FJ8H 3VDYA 3T1HL 1B7YB 1BVSA 1K83H 2L15A 3JAMi 1XJVA 4POGA 3G6EA 1I94Q 2E5LL 4BXXH 2BA0A 2D62A 3CCRA 5IYBG 4OO1I 1NMFA 5M5WH 4A3IH 2B29A 3CPFA 2BH8A 1V43A 2NVQH 1P16A 1W2BA 1KHIA 2JA7G 1AE2A 4A75A 4DR5L 3CCMA 4DV2Q 1D8LA 1ASYA 1KL9A 4YCVA 4OWTB 5LMNL 4JI4Q 1PH6A 4DR3Q 5IE8A 2K5VA 4KLKA 2K14A 3I4NH 5GAHC 3GTKH 2HQLA 3CC7A 1XPOA 3GTMH 2E8GA 2IX0A 1VQMA 3CMEA 1X54A 1QUQB 4GKKL 4JCVE 1BBUA 5C4XH 2KCMA 1VS0A 3CMAA 1S40A 4NXNQ 5C0XI 5LMNW 4A93G 1JT8A 5GADC 1TWCH 1G51A 1E7ZA 1X55A 2B63H 1CSPA 1NE3A 4BY1H 4PZ8A 1PH7A 1E22A 3E9HA 4H02A 1VQLA 2ZJQA 1PH5A 3S2HH 1OXTA 5ELNA 1A63A 2PMZE 3PUZA 4PZ6A 3HOXH 1UE5A 3TS0A 1OXXK 4P72A 4Y52H 4BA2I 4DUYL 4LF7Q 5IYDH 5IYCH 4NXML 4JYAQ 1N32L 3KF6A 4GN5A 4JBWA 4GOPC 4DR5Q 3K8AA 3NELA 4IO9A 3H15A 1WCMH 1E1TA 2MFIA 1YJNA 4BBRH 3M4PA 3HOYG 4APVA 4AYBE 2N49A 2GVBA 2OQKA 1QVFA 1YHAA 3J7ZC 4DV4Q 1YI2A 4LFBL 3RLFA 2WAQG 3A74A 2VQFQ 1XNRL 2JA8H 2NVYH 4X6AH 3EIVA 4LF4Q 2JQOA 4A3BG 1CUKA 1D7QA 3KJOA 2N3SA 4AH6A 4LF8L 1U0LA 1WOCA 3WWVA 2UXBQ 3I4MH 4L5SA 1UWVA 1K73C 4WJ3M 1L1OA 1V9PA 4YCUA 1L0WA 1IBMQ 3I2ZA 2VQEL 4A3DH 3DM3A 2IHEA 4QY7A 3UE1A 3H0GH 1CKNB 3PUXA 4DAYB 2HHHQ 2UUBL 1XMQL 2IHFA 3CAMA 5HGQA 3PIPA 3F2DA 1WJJA 3ULPA 1HNXL 3HOWH 4DUYQ 3AYHB 3CXCA 4NXMQ 4GKJQ 2CCZA 3OTOQ 5M3FG 2OTJA 2ZM6L 1YHQA 1Q81C 4JOIC 4HJ9A 1NJIC 1H95A 2CKZB 2Q2TA 4BY7G 1OXVA 4JI7L 2AMCB 5IP7G 1VQOA 1G291 4P75A 3W1BA 3RN5A 1PH3A 1I6HH 2EQSA 3GTQH 4DV3Q 4UP7A 2HIXA 1CKMA 3FKIG 1WYDA 2ZJRA 4OWXB 4C3JH 2ZJPA 4DV1L 1Q1BA 3JAMc 4TQUS 1QVCA 3F2CA 2UXDL 3CC4A 5H1SE 3BU2A 1XNRQ 2F3IA 1Q12A 3G71A 1QZHA 2Y0SE 4PG3A 1PFSA 1N36L 1BBWA 1XMOL 2UXCL 1VQNA 2BA1A 1IBLQ 2VQEQ 3CCEA 2K5HA 4O0AA 1PH8A 3A0JA 1FJGQ 2JA6H 1ASZA 4A3LG 4O2DA 2DUDA 1M90C 1SR3A 2JEBI 4MZ9A 1JE5A 2Q2IA 1KRTA 3F1ZA 4JI0Q 3HKZE 5IP9G 1TWAH 3M3YH 1UE6A 1X3FA 1K8AC 4XIGS 4A3KH 1E1OA 2MQHA 4DAMA 3HOUG 1E24A 4IJLA 1AE3A 1RIPA 4BA1I 1Y1WG 4DV2L 1BKBA 1N9WA 3BZCA 4C3HH 5M5XH 2NVXH 1PV4A 4QIWE 4BBSG 1E3PA 3PO2H 1VQIA 4JI4L 4LUVA 4A3FG 3CPWA 2JEAI 4A3JH 1HZBA 3HKSA 2ZTCA 3PO3H 4A3GG 1I50H 3KF8B 3GTOH 4LNQA 2YYZA 5C0XJ 1MIUA 2XTIA 3LGJA 5GQOA 4MNOA 4NXNL 2GN5A 1HNWQ 1JMCA 1RL2A 3J81i 4GNXA 4A3MH 2YTYA 3K7UC 1IZ6A 2Z6KC 3FP9A 2R92G 3KF6B 3I55A 1IBKL 4JBMA 1JJCB 2I5HA 2LXJA 2RF4A 1KD1C 4DR6Q 2MNAA 4JC0A 4B3RQ 4LF7L 4IFDG 1VQFA 1Y1VG 1WI5A 2JA9A 5IWAL 1YITA 4JYAL 2AWOA 4BXXG 3AEVA 1VQ5A 1PVOA 4UP9A 3CCJA 2R93G 4A3IG 2OQ0A 5LMUL 1HR0Q 1J6QA 2B3GA 1NTGA 4DKAC 3GTLH 3RR5A 1N33Q 1VQ8A 4DV4L 3CD6A 1LTLA 1VQGA 4GN3B 4UY8C 1YNXA 2NZHA 4UPAA 2ID0A 2VQFL 4YHHQ 1XPRA 1S72A 2YV5A 5JJKA 4LF4L 1L1OB 4GLVB 2R6GA 1JJ2A 3HKZG 3I4NG 4XTCS 1P8LA 2D0PA 3ULLA 4IPDA 2UXBL 4DV6Q 2AKWB 3S1NH 3BZKA 4J15A 3U50C 5C44H 2PNHA 1IBML 2JA5G 1V1QA 3J80c 3TQYA 1OXSC 3K80C 2HHHL 5C4XG 1VQ9A 1IBKQ 1SROA 4HJ7A 4YWKA 2NN6I 1CSQA 4ALPA 1M1KC 4LFCQ 2B63G 4GKJL 4GLXA 4A93H 5IWAQ 3OTOL 4BY1G 1HJPA 3UDFA 1FGUA 4JOIA 1SRUA 2CFMA 3B6YA 3M4OH 1VQHA 1EWIA 1AH9A 3Q8DA 1UEBA 2YTVA 3HOXG 1GKHA 4Y7NH 5LMUQ 5IYCG 4X66Q 2WB1E 1Y14B 4DV3L 2K52A 1IL2A 3PF4A 2KENA 1GVPA 1KC8C 4DR1Q 1PH9A 5GROA 5BR8L 1YBYA 2NZOA 4JI3L 1WCMG 1MJEA 2NVTH 3K0XA 1VQKA 5FLMH 4BBRG 3K7AH 5E7NA 2E2JH 2VUMH 4ME3A 2A8VA 4EQ5A 1VQ6A 1X3EA 3GO5A 3HOZG 1VQPA 4A4IA 2UUAL 1NBWA 1Q1EA 2GVAA 2VY3A 4IJHA 4LFAQ 1IBLL 4JI2L 1EOVA 2A1AA 2JA8G 3UE0A 1FJGL 3PCOB 4IOCA 4JI0L 3GTJH 2V1CC 2PQAA 3BJUA 5IY0A 3DLLA 3H3VH 3I4MG 2XGTA 4DV7Q 3S14H 5JEAG 4AQYQ 4A3DG 1FVIA 3M4QA 2E2IH 3L0OA 1C7YA 3RN2A 1QZGA 3J80i 3AFQA 4MTNA 1NY4A 4P73A 3G4SA 3KLWA 1K0RA 1LYLA 1I3QH 3D31A 3ULJA 3A5UA 3HOWG 2VS1A 3GTPH 3IRBA 3J81c 4NB3A 4R4CA 3L2PA 1S3OA 1C9OA 2EXDA 2KHIA 4R4QA 5BR8Q 3T1YQ 1X9NA 5M3FH 4JI3Q 5M3MH 3NBHB 4B3MQ 4A3CH 3KDFA 3J7A5 3OW2A 3PV0A 4OO1G 4GNXB 4HJ5A 4GLAC 3UDGA 1VQCA 4LW1A 1Q7YC 1HNWL 4A3EH 3TS2A 1N34L 3NENA 2UUAQ 5FLXc 4JI2Q 3PF5A 4KHPQ 2VZAA 2IX1A 2Z6KA 3OYYA 4JBKA 1PA6A 2YU9H
chains in the Genus database with same CATH superfamily
1PLFA 2NTTA 4DUZL 3MXUA 1I6HB 5J22A 2JA6G 1CQFA 3CHBD 2F0MA 1PYSB 1G6PA 1MJCA 1KLGD 3K6OA 1F9SA 5GAGC 2ATWA 2RHQB 4K0KQ 4AYBB 3AB9A 3HOUH 4IN3A 1TXYA 3HOVB 1PZKD 4L5QA 1PRTD 5I9PA 1DGSA 1K9MC 4DV6L 3T53B 4F87A 4ODGA 3DWPA 2K32A 3N52A 3SEBA 1UAPA 3UDXA 1DJRD 3K5LA 2IL8A 3BDOA 4C56C 3P7JA 2XRSD 1PH4A 1L2FA 1XNQQ 3GTOB 4DV0Q 5K36G 1G6ZA 2ZXRA 4OXPA 1SFOB 4JW0A 3KOJA 5IYBH 2R92B 4ME5A 4X66L 1HA5A 2N78A 1FL0A 2LY7A 3NXWA 1SNPA 4K8IA 2WAQE 1HNZQ 4XQJA 2BCOA 4JBJA 1SEBD 4NKLA 4CKCA 4LAAA 2N88A 1HUNA 2HT1A 2CQOA 4B3SQ 1RCVD 1RHPA 4YY3Q 1TWGH 4RGNA 4DR7Q 1TY2A 2F3WA 3C1EA 4AQYL 2EPBA 1SN8A 3I73A 1CKOA 3VR3A 1GXDC 3TREA 3TZDA 4X62Q 5IGEA 1CHQD 2F0WA 1EWHA 1KLUD 3LWUA 1DXMA 2F52A 2ZTEA 1LACA 5CV5A 1LABA 5HY6A 3K58A 4GNXC 4A76A 5C44B 1TWFH 3T1YL 2E5LQ 4HAEA 2WP8J 4K14A 4B3ML 1EIYB 1YIJA 3I4OA 2FXQA 3FHWA 3ZJYC 3HGBA 2F0EA 1YNJC 3QJYA 3RLOA 4MN3A 4DK3C 4KHPL 3A8IE 1S5ED 1YJWA 2J0TD 2OCEA 2B2WC 1N8RC 1XXGA 3HEJA 1LUZA 4BS9A 3S1RH 4FXGC 4OONA 1KAWA 1VCIA 2I0QA 4X64L 5AJ3L 1BBXC 5EPJA 1ENFA 2AWNA 2F0FA 1XTDA 3K7AB 1HH2P 4L5TA 4OX9L 2JXMB 2QEXA 1SAPA 2VL6A 3A5ZB 1ZKOA 3I7FA 3PSIA 2CWPA 2L1BA 1SYDA 2EY6A 2MO0A 3EN2A 3H91A 2F4VQ 5FKAC 1SLJA 4TRDA 1IYVA 1LTTD 4A3CG 1L0XB 3ICEA 2E2IB 3KJPA 1R4QB 3HRZC 4ILWA 2K05A 4ULLA 4HCEA 2WB1G 2K75A 4EQNA 5C3XA 4RWSC 5KGUA 5M3MB 1EY9A 5KRUA 2K1BA 1STEA 4HIOA 1B50A 2R7ZG 4A3EB 1L1OC 2H4OA 2OTLA 2UUBQ 3CP0A 3HOVH 1XMQQ 4NPSA 1GUOA 2V4DA 4M8AA 3RUZA 3SGIA 4LUOA 4O42A 1EY0A 1GD7A 4DAYA 3PO3G 4XYQA 1YZ6A 3RZDH 1SMYC 3J81j 5M5XB 3S2DH 3PIOA 1A0IA 2XIWA 2SOBA 3V05A 1SFOH 3RZOB 2R92H 1XMOQ 3T1HL 1K83H 2L15A 1LTSD 4LK1C 2RDFA 3HP3A 2F0HA 3CCRA 4G7ZC 3ITPA 1NMFA 5M5WH 2NVQH 3NP8A 1P16A 3BVMA 5IOCA 4DNRB 1PH6A 2K5VA 1TQOA 3IKJA 3GTKH 3GTLB 3MAQA 3HZXA 2A74C 1JR0D 4GKKL 3A54A 4IQZA 4S3SA 3ZYYX 1K0SA 1BBUA 1VS0A 1JT8A 5GADC 1PYWD 1CSPA 2O4XA 4X3UA 1LT4D 2JN4A 5ELNA 1PDQA 2IX3A 4QMGA 4P72A 5EBCA 4BA2I 3C2PA 4NXML 2XNAC 3W3AA 4GN5A 1H9RA 4GOPC 2EDGA 1YJNA 3CKIB 4APVA 2F0KA 2DJFC 1T5EA 2OQKA 1QVFA 4PNYA 4ZKCB 4KK7A 3RMHA 1CUKA 1D7QA 1B9MA 2F0PA 1WOCA 1X32A 3SK8A 1UWVA 2AUJD 4X3KA 3HOYB 3FMCA 1L0WA 1IBMQ 4A3DH 3UE1A 2HHHQ 2WAQB 1XX8A 3F2DA 1WTVA 2J7ZA 4A3BB 1HNXL 4XDXA 2RBMA 3AYHB 4GKJQ 5BN3A 2L55A 2CCZA 2ZM6L 1Q81C 1L0YB 4JOIC 2Q2TA 1RKNA 3D8GA 1OXVA 3IFTA 2AMCB 4IUTA 1PH3A 3W1BA 2NYZD 4DV3Q 3FKIG 1WYDA 2KQ3A 1Z7TA 2UXDL 1O7LA 3F2CA 2OEOA 4ZRZA 3BU2A 5M3FB 4DFAA 3G71A 1ENCA 2Y0SE 2Z1CA 1BBWA 1X3PA 4CDFC 1IBLQ 1S5BD 2K5HA 4O0AA 1PH8A 2JA6H 1SE3A 5ELCA 4P2CB 2Q2IA 4Z9CB 3S9WA 4N8FA 2ENBA 2K7VA 5M9OA 5C0XH 1M8AA 1BCPB 3HOUG 3OWFA 1AE3A 5IGCA 1BKBA 1N9WA 2QCPX 2AQ2B 4X3SA 4C1NK 5M5XH 1YNND 4JI4L 4LUVA 4A3FG 3CPWA 2A6HD 1TY0A 2JEAI 1STAA 2IW3A 1JCKB 4LNQA 2YYZA 5C0XJ 5CORA 1MIUA 3LGJA 2OXPA 1NR4A 3J81i 1RD9D 5COYA 2J4XA 3K7UC 4E6IA 1MD2D 3KF6B 3I55A 4JBMA 2QKIC 5K36H 2I5HA 2OF1A 1J8IA 4LF7L 2IPKD 4DAVA 1TWHB 3AEVA 4UP9A 3CCJA 1RTNA 3U9OA 5LMUL 5D3IB 1J6QA 1PFNA 3GTLH 1VDZA 1QE6A 1LTLA 1VQGA 2PW7A 3CD6A 3I70A 2ID0A 1PZID 2PPBC 4DGZA 4GLVB 2R6GA 3I4NG 3OMGA 4DV6Q 2WV6D 3J80c 1OXSC 5A35A 1IBKQ 1KDBA 2NN6I 1F9QA 1M1KC 1PTOF 2B63G 3I4LA 4V190 2B2YA 3OTOL 3B6YA 4C2MB 1AH9A 3VYRA 1GKHA 4Y7NH 5A2QL 1Q8IA 4KTAA 2AQ3B 5C4XB 4X66Q 1EQTA 1Z6HA 1NUCA 2Z8LA 3R2TA 4DAPA 1GVPA 3PF4A 5GROA 5BR8L 1D5MC 3K0XA 3K5NA 1QCBD 1D5ZC 1SYBA 4BBRG 5E7NA 5C5MA 4EQ5A 4U68A 3GO5A 4OIJA 4A4IA 4F8MA 4IJHA 1Q1EA 2UUAL 2L4NA 4JI0L 1PFMA 3TP5A 3D6CA 3IL8A 5IY0A 3I4MG 3FEWX 3S14H 4AQYQ 5DM73 3HOZB 3J80i 4NMZA 2JA8B 5DM63 3A7LA 1K0RA 3HOWG 4CJ0B 1A3UA 1HTPA 5HURA 3Q0AA 5JAVA 2NBFA 1C9OA 4JI3Q 2PZTA 3T1YQ 5M3FH 2BOSA 4A3CH 4B3MQ 1CA6A 3KDFA 3J7A5 4GNXB 5C5LA 1VMPA 2R3ZA 1Q7YC 4JI2Q 2ZXPA 4KHPQ 1PA6A 5IIFA 3CCSA 5T1GA 4AYBG 1PHJA 2Z0SA 5DLQE 3GTQB 5AJ3Q 2EIFA 4B3RL 2R7ZH 3IFDA 3HOVG 4ZQ3A 1SXTA 4QUCA 1I4RA 3EBEA 4PMCA 3KLSA 4JI1L 4OX9Q 1IYUA 2B39A 1LT3D 1HRJA 1VQEA 1IYJB 2WINB 4O1NA 3S1MH 1RJTA 4XT3B 3TRZA 3SR1A 3KYHC 4I7AA 1N34Q 3R2IA 1STHA 1WTQA 1HR0W 3BDCA 3KBGA 3I72A 4ZAIA 4RMFA 2B2TC 1O7IA 4NDXA 2NVXB 5KYIA 1VQAA 4QGUA 1JOOA 2BE5D 1T9HA 2Z9HA 4XYOA 1VQ7A 4LF6Q 3CCQA 5C4HA 1AN8A 1PMRA 1SNCA 5M5YH 5BN5A 4HIMA 1UE1A 4IOAA 2XWBB 3CQZH 2FINB 3ONAB 4JV5L 4H0LC 4DR1L 2K33A 1JWMD 4TVAB 4X65L 1Z47A 1D6EC 2CH4A 1E2WA 2UU9L 4K2KA 3W1GA 1O78A 2LMCB 1HXYD 1Y8OB 2Y0SB 4K6LA 2QGQA 4QB4A 2E74C 2PQAB 4LFAL 1YEZA 3L3OC 3S15H 3QR8A 5EQ0A 4IUUA 4OELB 3BZDB 3S16H 2PNRC 5C44G 1PYBA 2LXKA 4YCWA 2MHVA 1UE7A 2UUCQ 4QQBX 4HTHA 4C2MH 4DA2A 4HR7B 4PZ7A 1B3QA 1KABA 1X65A 3LX0A 1F9PA 4DK0A 3T1HQ 4JG2A 2RQXA 3ND9A 3TZUA 2C5CA 4FXDA 4RCNA 1RODA 3EA6A 1Q90A 1U5KA 1VQJA 4QL5A 4L5RC 4IUVA 1IW7C 4DK1A 2PYKA 4I65A 3F2BA 4DR4L 1C0AA 3M4OB 3PMFA 4UAIA 2CVRA 2MP1A 2B2UA 4HJ8A 5JOBA 4FO2A 4KN7C 3HOZH 1BUVT 1BO0A 1GUGA 1Q8KA 5FO7B 1EFWA 1JWSD 3ER0A 1EQRA 2NVTB 3CCLA 4GKKQ 2RSOA 4CDCC 2E2JB 3S24A 5FO9B 4DU9A 2G5DA 3NPPA 1QUQA 4J8QA 4IPCA 5J39A 4OHJA 3A7AB 1VQBA 4EQPA 1U4PA 3H0GB 3K0YA 3GTJB 1TS5A 1KTKA 2X69A 2ASBA 3HOWB 1MSHA 3K57A 4DV5L 3FKIH 1I4GA 5M3MG 2RDGA 3A56A 4P74A 3Q6SA 3K59A 3QOJA 2A6EC 4QJFA 4GOPB 1B2TA 3DHQA 5L37A 1WTHA 4A3EG 1PTOC 1EZ8A 5ELOA 4HIDA 3GTPB 2EVBA 5T1IA 4DR2L 5KEEA 1HA6A 3CCVA 3S1QH 1OXUA 4J1MA 3BYYB 4MHEA 5C0XG 4Q0FA 4KHZA 2L11A 4CBVA 1K8GA 2I5MX 3FRPB 4PMWA 3ERSX 1ICWA 1ZEQX 1SJHD 1TKWB 1B1ZA 3VYUA 4KY6A 2NTSA 4GS3A 1O7ZA 2NN6G 3NWTA 2ZXOA 1EYGA 5I6YA 5K5PA 3WOFA 1HNXQ 1CKNA 2PI2A 4KJOA 4A3FH 1A8VA 3M3YB 2ZM6Q 2LS01 5CMDA 5C3EB 3T13A 2O5JC 1JQYD 3GV3A 1PRTF 2C35B 2KEEA 1KRSA 4DR3L 3MFGA 3PO2B 3BG3A 1JOQA 3RLNA 2UXDQ 2IWHA 1KAAA 1J5EL 1XPUA 4R4IA 5JJIA 1STNA 2WFWA 4B3TQ 4F7XA 3STBD 1ET6A 3CC2A 3CF5A 3EJIA 2AUKA 1EUJA 3E0JA 3MC0B 3JAMi 4POGA 1I94Q 4DXFA 3KLRA 3TP6A 1D1KA 2BA0A 2D62A 1CZGA 4OO1I 2BH8A 1W2BA 1AE2A 4DR5L 1ASYA 1KL9A 1RF2D 4YCVA 1JC7A 4OWTB 1LTRD 5LMNL 1HTLD 4JI4Q 4HCSA 4KKTA 3KK7A 3I4NH 3E5SA 2HQLA 1XPOA 3H94A 1VQMA 1O80A 2JA7B 1IKLA 5CC4A 3D3RA 4JCVE 3MWYW 1KNEA 1S40A 1VMCA 3KF8A 2A69C 1TWCH 1X55A 3S1NB 2B63H 2K01A 3M4YA 1PH7A 4H02A 2L5TA 3S2HH 1OXTA 1A63A 3TS0A 1UE5A 4Y52H 4DUYL 4LF7Q 2B2VC 3E3XA 1ZYRD 2MFIA 4BBRH 3M4PA 3HOYG 2FHTA 3IAYA 3SDZA 3J7ZC 1YI2A 2TMPA 2WAQG 1XNRL 3EIVA 2EY2A 4A3BG 1DD2A 1SNOA 2N3SA 5A2QE 4AH6A 3I4MH 4L5SA 5E1FA 1L1OA 4YCUA 5FO8B 4TSSA 3TDQA 2VQEL 3J80L 3H0GH 3H6MA 3CAMA 1LO5D 3T56B 3MVVA 3HOWH 1QNKA 3OTOQ 5M3FG 3GQBA 1EIGA 1YHQA 3DEPA 1HFNA 1MGSA 1TVXA 2CKZB 4JI7L 1VQOA 5IP7G 3NSWA 3DXJC 3RN5A 1I6HH 2EQSA 4IURA 2N55A 1ZXTA 2ZJRA 4TQUS 5E4XA 5IGBA 4BWGB 3EQLC 1QZHA 5EPLA 4PG3A 1PFSA 2TSSA 4BY7B 1CHPD 2UXCL 1VQNA 4K5WA 4KMUC 4OL7A 4O2DA 2DUDA 1M90C 5ELEA 4JI0Q 2A68D 2F4IA 1WD0A 5CYUA 3M3YH 1UE6A 3NWSA 4H13C 3GTGB 4BA1I 1CM9A 1E3PA 4CKBA 1VQIA 3PO2H 1R4PB 4YIJA 2KEDA 3Q24A 4NP5A 3HKSA 2CHBD 5C4JB 1W6JA 3GTOH 1Y1WB 2EJGC 4MNOA 2PO4A 3S17B 4BBSB 1JMCA 3A8KE 2YTYA 1R9TB 2B8GA 1SYEA 2EJFC 1JICA 2RKSA 3MXPA 4A3GB 2F3VA 4CKEA 1KD1C 3TMEA 2MNAA 4B3RQ 2JA9A 5IWAL 1A2TA 5J1ZA 5JPNC 1H9JA 4RFBA 1NTGA 2DNEA 4ZYSA 3FVQA 4GN3B 4UY8C 2NZHA 2VQFL 4RH6A 1S72A 2YV5A 4LF4L 2D0PA 4IPDA 1TT2A 3S1NH 5C44H 2PNHA 1CT1D 3H3VC 5C4XG 3BYTB 1EU4A 3NTKA 2RA4A 3NHHA 1HJPA 1FGUA 4JOIA 2VB3X 1LTGD 1V1PB 1SNMA 1EWIA 1FNWA 1PRTC 3W2DA 3Q8DA 5G3LD 3OHXC 1B4OA 5IYCG 1IL2A 2LKVA 4DR1Q 1YBYA 2NZOA 1WCMG 1VQKA 3K7AH 5G3LF 4BY1B 2CW0D 1X3EA 3HOZG 3HOXB 4LFAQ 2JA8G 3TP7A 2A1AA 3UE0A 1TU2B 4J6HA 1B9NA 4IOCA 4FXKC 5EKIA 1S5DD 2O2LD 1JORA 2SNSA 3BJUA 2XGTA 4R9WA 4RGMA 1BDOA 1FVIA 3M4QA 2E2IH 3L0OA 5E3FA 1QZGA 2XN9C 1AP0A 1NY4A 2NVYB 2VS1A 4RGOS 3J81c 1S3OA 1SNDA 1X9NA 4R4QA 3NBIA 2Q8TA 5M3MH 3NBHB 3CRKC 1EYAA 3FDTA 3PV0A 4OO1G 4L63B 2F0OA 4LW1A 4A3EH 3KLSX 5FLXc 3PF5A 1PZJD 1ML0D 3GP7A 4K8JA 3OYYA 4JBKA 3BDLA 5IT9c 1DZ1A 1E0BA 4HJAA 1EL0A 4C3JB 1FD7D 1YVCA 3GD7A 4WJ4A 2VW9A 3VR4A 4WRDA 1JJGA 2MPMA 2HIVA 2NN6H 3CW2C 2K28A 4RHRA 5IP9H 1OTCA 1W6KA 1N33L 5KNCA 2QW7A 2VB2X 2R7FA 3RZOH 4YHHL 1BQQT 1HNZL 1DOLA 4FP5D 2BDNA 3DM1A 4BBSH 4PV1C 2PZUA 2DNCA 1TWAB 3SK6A 4DV5Q 4PMBA 4A3KB 1VF7A 3SK4A 3OPOA 1F2MA 1S5CD 2K50A 4C3HB 4DUZQ 2EYFA 2ALYB 2EYLA 2RDHA 4DR7L 2ZTDA 1WVLA 1SE2A 4LFCL 4A3JB 2N8NA 1C4QA 2OT2A 3PQIA 1PTOB 1SE8A 3K81C 1I50B 3F2UA 1PH2A 1SMXA 2CWAA 4FNFA 2Z6BA 2Y0SG 1X56A 4KD4A 1BCPD 3QWNA 5ELBA 3J81E 1JB7A 5JVH3 1Q3LA 4WFN3 3CCUA 4UP8A 2Q2HA 4CDDC 2R61A 1H9SB 4IPHA 1NMGA 2F0IA 4KKUA 3NTIA 4EX5A 5HGTA 1Y8PB 5FLXE 3C1FA 3FPPA 4R8IA 1I4XA 5F2DA 4B08A 3PUVA 5ELFA 3SK5A 1QNUA 4IFDJ 4R8NA 4RG1A 1J5EQ 2PZWA 1EY8A 3HFZB 3GTMB 4RCOA 4WORA 1EEFD 2I5LX 3I56A 2RCFA 3P1HA 3P20A 4DK6C 5EAYA 1GJXA 2H5XA 4KKSA 3EVQA 2F4VL 2ES2A 3U4VA 3HOYH 4G7OC 1A3TA 3VR2A 1HZCA 1K3BC 5J3BA 1EQQA 5FLMG 1F2LA 4HIKA 1JWUD 1I5FA 1WCMB 4P71A 5LMNQ 3JC66 2KUMA 1B8AA 4A3BH 2K5DA 2IT1A 3HS0C 1VF5C 1GM5A 3E6ZX 3H0GG 4IUQA 2EYOA 4L6TB 3VA7A 4IFDI 1SBBB 1EIHA 1JB3A 1X6OA 4JI6L 2L9HA 2VUMB 1RDPD 3DUZA 1J9OA 1HZ9A 3F8TA 1KXLA 2FFKB 3M7GA 4KI0A 1VQ4A 1SYCA 3TSSA 4L8JA 2E2DC 1BOSA 1D5XC 4JI8L 4EVOA 5IP7H 3Q23A 1IXRA 2Z4HA 3J80E 3RNUA 1LLRD 1QILA 3BS1A 1X3GA 3NUCA 4X64Q 1MBYA 3D0FA 1EWCA 3OSOA 1UNSA 3G7LA 1IHZA 4POFA 1Q82C 2XRQD 5C3EG 2BH2A 3GDEA 1A15A 1IKMA 1QVGA 3PO2G 1GUWA 5LL6X 4HEDA 2R7DA 2YU9B 3UDIA 3ND8A 2JJQA 3LNNA 1K3RA 1EY5A 1V1OA 4YWLA 4FF4A 4JI7Q 2EYMA 2F1MA 2A19A 4OWWB 4JI5L 2CQAA 1TWHH 1YNJD 1GHJA 2F0DA 3TBIB 4LF9L 3WOEA 4EQOA 1AEXA 4LF5L 2SDFA 4R1JA 4MTKA 1AFPA 2EYJA 2UXCQ 5FJ8H 1B7YB 1BVSA 1XTCD 1IL8A 1XJVA 5CV8A 2DJGC 5KNBA 4KJNA 4KHVA 2B29A 2QF7A 3CPFA 1AZPA 2JA7G 1KHIA 2H1EA 3D4WA 5ISRA 3CCMA 1D8LA 5DEHA 2JP1A 2I46A 5I2YA 5IE8A 1Y69U 1SYFA 2K14A 5GAHC 5EPKA 3CC7A 1G2TA 3GTMH 5AFWA 3CMEA 4KY7A 2F0UA 4FYDA 5C4XH 2KCMA 5I2XA 1WTRA 4ZUJA 2GA4B 1ESRA 1NE3A 3H09A 1YNNC 4OGQC 1VQLA 1PH5A 2A6HC 1TWGB 5IYDH 2X6GA 5IYCH 1GUSA 1N32L 2DN8A 3KF6A 1SJED 4H7BA 4JBWA 4A93B 3NELA 4K5VA 1II3A 1WCMH 2QDLA 4IUNA 3D4DA 1EQVA 2PCFB 3X3NA 2C9OA 4RAUC 1H9KA 4LFBL 1TWFB 4NW2A 2JA8H 3A74A 2VQFQ 4X6AH 4LF4Q 2JQOA 2M00A 1SMYD 3KJOA 4LF8L 1EYDA 4WJ3M 2DY8A 5EKLA 2VNUD 4QY7A 4DAYB 2HCCA 1A6XA 2IHFA 3SE0A 3ULPA 1WJJA 3S1RB 4NXMQ 4UHVA 4HJ9A 1NJIC 4KN4C 1STBA 3PIP3 4BY7G 4OO1H 2P5ZX 1WTWA 4P75A 4Q5VA 1I3QB 4C3IG 5IODA 3GTQH 4UP7A 1CKMA 1PRTB 4DV1L 1Q1BA 3JAMc 1QVCA 5H1SE 4MIUA 1LV9A 3T51B 2F3IA 3VR6A 2HDMA 1E2VA 4OIKA 1N36L 3N6RA 3O13A 2BA1A 2FMCA 3L9AX 3CCEA 3URYA 1CQVA 4ZUIA 4A3LG 5CBAE 2JEBI 4MZ9A 1JE5A 1KRTA 3F1ZA 2B2UC 2PQEA 5D65A 5IP9G 1X3FA 3KUPA 2PMZB 2SEBD 5CV9A 1AZQA 4XIGS 1E1OA 4WJWA 4IJLA 4UDUC 1Y1WG 1TS2A 4DV2L 2Z4IA 1CTMA 2EYPA 4BBSG 2NVXH 1PV4A 3RD4A 4FVMA 4B9XA 1I6VC 3J81L 2ZTCA 2WIIB 2KVMA 1I4QA 4A3GG 5TSSA 3DWAA 5GQOA 1UEAB 3NQTA 2MJ8A 1EY7A 2NB0A 4NXNL 1ET9A 1LTID 1RL2A 4I7ZC 4GNXA 5FLXL 2Z6KC 3RZDB 3T4AC 1MSGA 1JOKA 1IBKL 2F0QA 5IT9L 2LXJA 2RF4A 3S2DB 4XQQA 3I8ZA 5D14A 4JC0A 3Q22A 1BNZA 4IFDG 1VQFA 2B2VA 1WI5A 4ZLTF 4JYAL 2A73B 4BXXG 4K5XA 4LJZC 1PVOA 2B2WA 4HN7A 1MHWC 4A3IG 5D3DA 4QCLA 2A5HA 1M4VA 3RR5A 1N33Q 4DV4L 3JAME 1K83B 1TR5A 1Y1VB 1XPRA 4YHHQ 5JJKA 1UUPA 1JJ2A 2F03A 1P8LA 5M5WB 1TS4A 2UXBL 2R93B 2RSNA 2CH4W 3BZKA 3U50C 2NVQB 2E76C 2G9DA 4XQNA 1SNQA 3K80C 1SROA 5CGKA 4YWKA 4ALPA 1CSQA 4C1NI 4LFCQ 3HKZB 4GLXA 4A93H 1HUMA 3GTKB 4BY1G 3UDFA 1SRUA 2CFMA 5CV6A 3M4OH 1VQHA 2JA5B 4CHTB 2YTVA 3HOXG 5LMUQ 5EBDA 3AMUA 3FPUB 2WB1E 1Y14B 4QIWB 1EU3A 2KENA 3X3MA 4JI3L 5KIXA 2NVTH 2K5WA 5IGDA 5FLMH 1DONA 1ICFB 2E2JH 2BE5C 1I4PA 5FK9C 2EE1A 3NTHA 1B53A 4KD3A 5E4WC 2VY3A 3V96A 4JI2L 1EOVA 3I3CA 4K2LA 1DM0B 1FJGL 1KDCA 3PCOB 3GTJH 1DOKA 4K6DA 2PQAA 3H3VH 3DLLA 1A3VA 3RN2A 3AFQA 4MTNA 1I4HA 4P73A 3G4SA 3A5UA 1LYLA 1I3QH 3D31A 4ZKBB 1ONLA 3GTPH 3NQIA 4NB3A 4R4CA 3L2PA 1PFBA 2EXDA 2QEJC 5BR8Q 1HPCA 4DNTB 4A3DB 2EY1A 4RKLA 4HJ5A 2E2HB 4G4KA 5LHY1 2X6LA 4GLAC 1VQCA 4C3JG 1HNWL 2F0SA 1N34L 3NENA 2UUAQ 4C3IB 3R8BA 2VZAA 1CZWA 2MUYA 1QWYA 1QJOA 2WKCA 1D2BA 2BDOA 4LF6L 4DR6L 3U58A 5C3EH 4GZYC 2IY5B 3K5MA 2OWOA 4IUPA 4JI6Q 2MO1A 1F77A 3SHLA 2AHOB 3G48A 4A3KG 1HR0L 1WFQA 3TEHB 1HCZA 2YTXA 4C3HG 2JA6B 3VA5A 3LWEA 3MEHA 1ILPA 3K5OA 3QG1A 4R4OA 2Q8RE 4JI8Q 2VXWA 1A2UA 4A3JG 3H3VI 2L12A 2SNMA 4HMIA 3D6WA 3M9BA 2JE6I 4G7HC 1EY4A 5EJWA 1B70B 5FJ8G 3QOLA 4TKOB 4A3MG 4ZCKA 4QF4A 2K5QA 2QA4A 1XWEA 4M1UB 4GOPA 1CI3M 2UUCL 1STGA 4LUZA 4JI1Q 2D9UA 4CDEC 3TP8A 1PH1A 3D4RA 1CK1A 2Q2UA 3E0EA 2PI2E 3AQQA 1T5XD 2JA7H 1Y1VH 2HUGA 3MEFA 3U4ZA 1FYCA 1Q86C 4XXEA 3OW7A 1TIID 4FF3A 2R93H 3PUYA 2AQ1B 4A3IB 3HG9A 1MKHA 2XVSA 2RHSB 4AIMA 1U4RA 3PGZA 4JI5Q 1YJ9A 4R4TA 4DV7L 1NCVA 1G8ZD 2K4KA 5I4DA 3QB3A 2K03A 4LF9Q 1WTXA 3L7ZC 4RA8A 2JA5H 4LF5Q 2ICIA 3J7AV 5IYDG 2DGYA 3E9IA 3MXNB 1AW7A 1BR9A 3KDFB 5JJZA 4JV5Q 5JPMC 4DXGA 1Y8NB 1V8QA 3CU7A 2K04A 4X65Q 3EFXD 2QDBA 2KJXA 2D2CC 1JE4A 1F2YA 2UU9Q 2JK8A 2KBNA 4F88A 2D0OA 3OOCA 3STBC 2VUMG 2M9VA 2FJ2A 1K8OA 1EIFA 4JVZA 5LL6S 1H9MA 4Y7NB 2G9HD 4CGYB 2EY5A 5KNDA 4DNIA 4IPGA 3KFUA 2HQEA 5JJLA 1K28A 2DY7A 1LM0A 1A62A 3J7YW 4K0KL 5JEAH 1KQSA 2E2HH 1GUNA 1EYCA 2LSSA 4BY7H 3NEMA 4CJ1B 2EJMA 4C3IH 1N32Q 1U4LA 3S14B 1HZAA 1HQRD 3AFPA 4DN4M 2KHJA 1ENAA 4DR4Q 3W5OA 2IJ0A 1FNVA 1U4MA 2NUCA 2MGSA 5IGFA 3BVGA 4KV6A 5JEAJ 2RCNA 3GTGH 1YHBA 4FDBA 4JK1C 4GN4B 1G91A 1Q46A 5IGGA 1DCZA 4LFBQ 2K5NA 1QB5D 4FF1A 4B3TL 4A3LH 1XNQL 3M7NA 1GO3E 4DV0L 2HD3A 4LF8Q 1Z9FA 1NSNS 1ZYRC 2EXZA 3PUWA 2WACA 4EGVA 5FOBB 1HFGA 1SE4A 2WB1B 4IZ8A 5C4JH 1I94L 1Y1WH 1SYGA 3S17H 4XT1B 1R9TH 1ESFA 1W3SA 3M85A 4B3SL 1KIXA 5GAEC 2R7ZB 1NNXA 2XWJB 4PQXA 4YWMA 5DNFA 4A3GH 4DPGA 4YY3L 1EFID 4ABNA 1VQDA 4DV1Q 3JAML 4DR2Q 1G2SA 5I6WA 2KOLA 4X62L 3S1MB 3PO3B 4LWCA 1ILQA 1IW7D 1U9RA 2B8FA 2KCTA 3PIO3 1N36Q 3VDYA 3R93A 1B3AA 1QOHA 3G6EA 5C6AA 4A3MB 2E5LL 1WD1A 4IFDH 4BXXH 1XYIA 4QUFA 5IYBG 1BCPF 4A3IH 4U673 1V43A 1HQMC 1OO9B 4H44C 1O7YA 4A75A 4DV2Q 4DR3Q 3G6JB 5BN4A 5C3WA 5IT9E 5M5YB 4KLKA 2KECA 1EOTA 3CQZB 3OIQA 2A68C 2E8GA 2IX0A 3P75A 1QG7A 3A8JE 1X54A 1QUQB 4NXNQ 3CMAA 2A6ED 5C0XI 5LMNW 4A93G 3MA2B 3OWEB 1D1IA 1G51A 1E7ZA 2HDLA 1PTOD 4KY5A 5CR3A 4BY1H 4PZ8A 5EGTA 1E22A 2KHSA 3E9HA 2ZJQA 2PMZE 2L0CA 1DYQA 1F2ZA 3S15B 3PUZA 4PZ6A 3HOXH 1OXXK 3VYSA 3S16B 4JYAQ 1KDAA 4DR5Q 3K8AA 2F0GA 1B44D 3H15A 4IO9A 1E1TA 4AYBE 2N49A 2GVBA 3UI2A 3DMUA 1YHAA 4DV4Q 4RGTA 4HSPA 3RLFA 4V0BA 3NE5B 3TN2A 2D5DA 2NVYH 3MFYA 1U0LA 3WWVA 2UXBQ 1K73C 1V9PA 3GV6A 4RHSA 2E75C 3I2ZA 3I90A 3DM3A 2IHEA 3PUXA 1CKNB 2ZT9C 2UUBL 2F0TA 1BXTA 1XMQL 3PIPA 5HGQA 3NK9A 1FGBD 4DUYQ 3CXCA 2B2YC 1MI2A 2OTJA 1E2ZA 1H95A 1GHKA 2B2TA 2KA7A 4N9PA 1G291 4FF2A 1STYA 2HIXA 1CFMA 1V1PA 4OWXB 4C3JH 2ZJPA 3KBXA 3CC4A 2F0JA 3MXNA 1XNRQ 1SDFA 1Q12A 4CJ2C 1FR3A 1XMOL 5DAUA 1PXUA 1TS3A 2VQEQ 3FKIB 3A0JA 4LMQD 1FJGQ 1ASZA 1SR3A 2K6AA 3HKZE 1TWAH 3AU7A 1K8AC 4A3KH 1S5FD 2MQHA 4G57A 5NUCA 1E24A 4DAMA 1RIPA 2A69D 1DOMA 3S1QB 2CW0C 3BZCA 3EROA 4C3HH 1LTBD 1F9RA 4QIWE 1NAPA 3MTSA 1GUTA 1EEID 2QILA 3A55A 4A3JH 1HZBA 1EY6A 1PTOH 3PO3H 1I50H 3KF8B 3HOUB 3J7AF 2KCCA 5CV7A 2JSOA 2XTIA 2HCIA 2M2LA 2GN5A 1HNWQ 3NBHA 4A3FB 4A3MH 3MXGA 1IZ6A 1WTPA 3FP9A 4N9TA 2R92G 1NR2A 1JJCB 1GOZA 1SSOA 4DR6Q 4DF7A 1Y1VG 3SXHA 1YITA 2AWOA 1VQ5A 2LFNA 1X3QA 2R93G 3MHBA 2OQ0A 4OEMB 1HR0Q 2B3GA 4DKAC 5C4ZA 1VQ8A 4HSVA 1YNXA 1KNAA 4UPAA 5EKKA 1L1OB 3DEOA 1LTAD 3DWQA 3HKZG 4XTCS 3ULLA 2EZVA 2AKWB 2I07B 4J15A 3BVZA 1IBML 2JA5G 1V1QA 3TQYA 3MZ5A 2HHHL 4ZK9B 1VQ9A 4HJ7A 5ELDA 2F0VA 2ICEC 3C3LA 4GKJL 3I4NB 5IWAQ 2KCNA 3U9SA 3ERQA 2F0LA 3WDNA 5I9OA 3OMCA 1UEBA 4ID6A 4HMJA 3VYTA 4DV3L 2K52A 3CRLC 1KC8C 1PH9A 1MJEA 1TWCB 2B63B 1HHVA 4N8X1 1RTOA 3SVMA 5JVG3 3QIAA 2VUMH 4ME3A 1WTOA 3S2HB 2A8VA 1K8MA 1EZ6A 1VQ6A 2EYHA 2PW5A 2F0NA 3T16A 1VQPA 1NBWA 1H9SA 2GVAA 2RVLA 4IALA 4B9WA 1IBLL 3R3OA 1C48A 4RKBA 1BCPC 4X3TA 2V1CC 4BBRB 2FMMA 1BF4A 4DV7Q 2JYOA 5JEAG 4A3DG 2O5IC 1C7YA 5KYLA 1LT5D 5CV4A 3KLWA 3ULJA 3C46A 2EOTA 1LT6D 1S4ZA 3IRBA 3VR5A 3I4MB 1FNUA 2KHIA 3I91A 5CBEE 3V2TA 3OW2A 2WKDA 2NWGA 3UDGA 3QO2A 2Q8IB 3TS2A 1CA5A 4JPBW 2XSCA 1C8CA 2IX1A 2Z6KA 3OIPA 2NZ1D 2YU9H
chains in the Genus database with same CATH topology
4DUZL 5IT9c 3CCSA 4AYBG 1PHJA 2Z0SA 5DLQE 4HJAA 4LF6L 4DR6L 5AJ3Q 2EIFA 3U58A 5C3EH 4B3RL 2JA6G 1YVCA 2R7ZH 3GD7A 4WJ4A 3HOVG 2VW9A 1PYSB 2IY5B 1G6PA 3EBEA 1JJGA 2OWOA 2HIVA 4JI6Q 4JI1L 2MO1A 4OX9Q 1MJCA 2AHOB 3CW2C 3G48A 5GAGC 4A3KG 5IP9H 2RHQB 1WFQA 1HR0L 1OTCA 1VQEA 1IYJB 2ATWA 4K0KQ 1N33L 3TEHB 3S1MH 2YTXA 3HOUH 2R7FA 1TXYA 3TRZA 3RZOH 4YHHL 1HNZL 4R4OA 4JI8Q 4L5QA 4BBSH 3H3VI 4A3JG 1DGSA 3KYHC 4DV5Q 4DV6L 1N34Q 1K9MC 1HR0W 3M9BA 4RMFA 2JE6I 3UDXA 2K50A 1O7IA 4DUZQ 1B70B 2ALYB 5FJ8G 1VQAA 4QGUA 1VQ7A 2ZTDA 1T9HA 4A3MG 4LF6Q 4DR7L 4LFCL 3CCQA 2QA4A 2N8NA 2UUCL 4GOPA 1PH4A 1L2FA 1SE8A 3K81C 1XNQQ 4DV0Q 1SMXA 1PH2A 2CWAA 4LUZA 4JI1Q 5K36G 2Y0SG 1X56A 4OXPA 5M5YH 1PH1A 5IYBH 3KOJA 4HIMA 1UE1A 4X66L 4IOAA 3CQZH 2Q2UA 2N78A 3E0EA 2PI2E 1FL0A 1JB7A 4JV5L 4DR1L 3AQQA 2JA7H 1Y1VH 4TVAB 3MEFA 2WAQE 4UP8A 3U4ZA 4X65L 3CCUA 1Q86C 1Z47A 2Q2HA 1HNZQ 4IPHA 1NMGA 4JBJA 2UU9L 2R93H 3W1GA 3PUYA 4EX5A 2QGQA 2HT1A 1MKHA 2PQAB 2CQOA 4B3SQ 2RHSB 4LFAL 1YEZA 4AIMA 3PGZA 3S15H 4YY3Q 1TWGH 3PUVA 4JI5Q 1YJ9A 4DR7Q 4R4TA 3S16H 5C44G 4DV7L 4IFDJ 1PYBA 2LXKA 4RG1A 4YCWA 4AQYL 1J5EQ 2K4KA 1SN8A 3HFZB 1UE7A 2UUCQ 1CKOA 4QQBX 4C2MH 3TREA 4X62Q 4LF9Q 3L7ZC 4PZ7A 2JA5H 4LF5Q 5IYDG 2DGYA 1X65A 3E9IA 3MXNB 2I5LX 3KDFB 2F52A 2ZTEA 4JG2A 5HY6A 3I56A 4GNXC 4A76A 3T1HQ 4JV5Q 1TWFH 3T1YL 2E5LQ 4X65Q 2WP8J 4DK6C 4B3ML 5EAYA 1U5KA 2H5XA 1EIYB 1YIJA 3I4OA 2UU9Q 2FXQA 2F4VL 2ES2A 2JK8A 3FHWA 3ZJYC 3U4VA 1VQJA 4QL5A 3HOYH 4L5RC 3RLOA 1HZCA 2KBNA 5J3BA 4DK3C 1EQQA 5FLMG 2D0OA 4KHPL 3STBC 3F2BA 1YJWA 2OCEA 4HIKA 2VUMG 4DR4L 1C0AA 1N8RC 1I5FA 4P71A 5LMNQ 1LUZA 3JC66 1EIFA 3S1RH 1B8AA 4A3BH 4HJ8A 4OONA 1KAWA 1VCIA 2IT1A 2I0QA 4X64L 5AJ3L 1GM5A 3HOZH 3H0GG 1Q8KA 4DNIA 1EFWA 4IFDI 2AWNA 3ER0A 1EQRA 4IPGA 3KFUA 3CCLA 4GKKQ 5JJLA 1XTDA 1X6OA 1HH2P 4JI6L 4L5TA 3S24A 4OX9L 1LM0A 2QEXA 1HZ9A 2VL6A 1A62A 3A5ZB 3F8TA 1QUQA 1KXLA 4K0KL 3I7FA 3PSIA 4KI0A 4IPCA 2CWPA 1VQ4A 1KQSA 1VQBA 2E2HH 2MO0A 3EN2A 2LSSA 2F4VQ 4BY7H 1SLJA 4JI8L 3NEMA 5IP7H 2ASBA 4C3IH 1N32Q 4DV5L 1HZAA 1IXRA 3AFPA 3FKIH 5M3MG 4A3CG 2KHJA 4P74A 3ICEA 2VNUD 3KJPA 4DR4Q 3W5OA 3RNUA 4QJFA 4GOPB 1X3GA 4A3EG 5JEAJ 2RCNA 2WB1G 2K75A 5ELOA 1YHBA 4X64Q 4HIDA 3GTGH 4FDBA 3D0FA 4GN4B 1Q46A 4LFBQ 2K5NA 4DR2L 3CCVA 3S1QH 4B3TL 1OXUA 4A3LH 1XNQL 3M7NA 1GO3E 4DV0L 5C0XG 1K8GA 4KHZA 4LF8Q 4POFA 1Z9FA 1Q82C 4HIOA 2I5MX 4PMWA 5C3EG 3ERSX 2BH2A 3GDEA 3PUWA 2R7ZG 1L1OC 5C4JH 2OTLA 1I94L 4GS3A 1QVGA 1Y1WH 2NN6G 3CP0A 2UUBQ 1XMQQ 3HOVH 3PO2G 4NPSA 1EYGA 3S17H 3SGIA 2R7DA 4LUOA 1HNXQ 1CKNA 1GD7A 2PI2A 3UDIA 1A8VA 4A3FH 3PO3G 2ZM6Q 1R9TH 1YZ6A 3RZDH 1W3SA 2JJQA 3M85A 4B3SL 1KIXA 5GAEC 4YWMA 1K3RA 4YWLA 3J81j 4A3GH 4DPGA 4JI7Q 2C35B 4YY3L 1KRSA 4OWWB 2A19A 3S2DH 3PIOA 4JI5L 4DR3L 1VQDA 3RLNA 4DV1Q 1A0IA 1TWHH 2UXDQ 1J5EL 4DR2Q 1XPUA 4R4IA 5JJIA 4X62L 2WFWA 4B3TQ 4LWCA 4LF9L 4LF5L 1SFOH 2KCTA 3STBD 4R1JA 1N36Q 3CC2A 2R92H 1XMOQ 3CF5A 2UXCQ 1EUJA 5FJ8H 3VDYA 3T1HL 1B7YB 1BVSA 1K83H 2L15A 3JAMi 1XJVA 4POGA 3G6EA 1I94Q 2E5LL 4BXXH 2BA0A 2D62A 3CCRA 5IYBG 4OO1I 1NMFA 5M5WH 4A3IH 2B29A 3CPFA 2BH8A 1V43A 2NVQH 1P16A 1W2BA 1KHIA 2JA7G 1AE2A 4A75A 4DR5L 3CCMA 4DV2Q 1D8LA 1ASYA 1KL9A 4YCVA 4OWTB 5LMNL 4JI4Q 1PH6A 4DR3Q 5IE8A 2K5VA 4KLKA 2K14A 3I4NH 5GAHC 3GTKH 2HQLA 3CC7A 1XPOA 3GTMH 2E8GA 2IX0A 1VQMA 3CMEA 1X54A 1QUQB 4GKKL 4JCVE 1BBUA 5C4XH 2KCMA 1VS0A 3CMAA 1S40A 4NXNQ 5C0XI 5LMNW 4A93G 1JT8A 5GADC 1TWCH 1G51A 1E7ZA 1X55A 2B63H 1CSPA 1NE3A 4BY1H 4PZ8A 1PH7A 1E22A 3E9HA 4H02A 1VQLA 2ZJQA 1PH5A 3S2HH 1OXTA 5ELNA 1A63A 2PMZE 3PUZA 4PZ6A 3HOXH 1UE5A 3TS0A 1OXXK 4P72A 4Y52H 4BA2I 4DUYL 4LF7Q 5IYDH 5IYCH 4NXML 4JYAQ 1N32L 3KF6A 4GN5A 4JBWA 4GOPC 4DR5Q 3K8AA 3NELA 4IO9A 3H15A 1WCMH 1E1TA 2MFIA 1YJNA 4BBRH 3M4PA 3HOYG 4APVA 4AYBE 2N49A 2GVBA 2OQKA 1QVFA 1YHAA 3J7ZC 4DV4Q 1YI2A 4LFBL 3RLFA 2WAQG 3A74A 2VQFQ 1XNRL 2JA8H 2NVYH 4X6AH 3EIVA 4LF4Q 2JQOA 4A3BG 1CUKA 1D7QA 3KJOA 2N3SA 4AH6A 4LF8L 1U0LA 1WOCA 3WWVA 2UXBQ 3I4MH 4L5SA 1UWVA 1K73C 4WJ3M 1L1OA 1V9PA 4YCUA 1L0WA 1IBMQ 3I2ZA 2VQEL 4A3DH 3DM3A 2IHEA 4QY7A 3UE1A 3H0GH 1CKNB 3PUXA 4DAYB 2HHHQ 2UUBL 1XMQL 2IHFA 3CAMA 5HGQA 3PIPA 3F2DA 1WJJA 3ULPA 1HNXL 3HOWH 4DUYQ 3AYHB 3CXCA 4NXMQ 4GKJQ 2CCZA 3OTOQ 5M3FG 2OTJA 2ZM6L 1YHQA 1Q81C 4JOIC 4HJ9A 1NJIC 1H95A 2CKZB 2Q2TA 4BY7G 1OXVA 4JI7L 2AMCB 5IP7G 1VQOA 1G291 4P75A 3W1BA 3RN5A 1PH3A 1I6HH 2EQSA 3GTQH 4DV3Q 4UP7A 2HIXA 1CKMA 3FKIG 1WYDA 2ZJRA 4OWXB 4C3JH 2ZJPA 4DV1L 1Q1BA 3JAMc 4TQUS 1QVCA 3F2CA 2UXDL 3CC4A 5H1SE 3BU2A 1XNRQ 2F3IA 1Q12A 3G71A 1QZHA 2Y0SE 4PG3A 1PFSA 1N36L 1BBWA 1XMOL 2UXCL 1VQNA 2BA1A 1IBLQ 2VQEQ 3CCEA 2K5HA 4O0AA 1PH8A 3A0JA 1FJGQ 2JA6H 1ASZA 4A3LG 4O2DA 2DUDA 1M90C 1SR3A 2JEBI 4MZ9A 1JE5A 2Q2IA 1KRTA 3F1ZA 4JI0Q 3HKZE 5IP9G 1TWAH 3M3YH 1UE6A 1X3FA 1K8AC 4XIGS 4A3KH 1E1OA 2MQHA 4DAMA 3HOUG 1E24A 4IJLA 1AE3A 1RIPA 4BA1I 1Y1WG 4DV2L 1BKBA 1N9WA 3BZCA 4C3HH 5M5XH 2NVXH 1PV4A 4QIWE 4BBSG 1E3PA 3PO2H 1VQIA 4JI4L 4LUVA 4A3FG 3CPWA 2JEAI 4A3JH 1HZBA 3HKSA 2ZTCA 3PO3H 4A3GG 1I50H 3KF8B 3GTOH 4LNQA 2YYZA 5C0XJ 1MIUA 2XTIA 3LGJA 5GQOA 4MNOA 4NXNL 2GN5A 1HNWQ 1JMCA 1RL2A 3J81i 4GNXA 4A3MH 2YTYA 3K7UC 1IZ6A 2Z6KC 3FP9A 2R92G 3KF6B 3I55A 1IBKL 4JBMA 1JJCB 2I5HA 2LXJA 2RF4A 1KD1C 4DR6Q 2MNAA 4JC0A 4B3RQ 4LF7L 4IFDG 1VQFA 1Y1VG 1WI5A 2JA9A 5IWAL 1YITA 4JYAL 2AWOA 4BXXG 3AEVA 1VQ5A 1PVOA 4UP9A 3CCJA 2R93G 4A3IG 2OQ0A 5LMUL 1HR0Q 1J6QA 2B3GA 1NTGA 4DKAC 3GTLH 3RR5A 1N33Q 1VQ8A 4DV4L 3CD6A 1LTLA 1VQGA 4GN3B 4UY8C 1YNXA 2NZHA 4UPAA 2ID0A 2VQFL 4YHHQ 1XPRA 1S72A 2YV5A 5JJKA 4LF4L 1L1OB 4GLVB 2R6GA 1JJ2A 3HKZG 3I4NG 4XTCS 1P8LA 2D0PA 3ULLA 4IPDA 2UXBL 4DV6Q 2AKWB 3S1NH 3BZKA 4J15A 3U50C 5C44H 2PNHA 1IBML 2JA5G 1V1QA 3J80c 3TQYA 1OXSC 3K80C 2HHHL 5C4XG 1VQ9A 1IBKQ 1SROA 4HJ7A 4YWKA 2NN6I 1CSQA 4ALPA 1M1KC 4LFCQ 2B63G 4GKJL 4GLXA 4A93H 5IWAQ 3OTOL 4BY1G 1HJPA 3UDFA 1FGUA 4JOIA 1SRUA 2CFMA 3B6YA 3M4OH 1VQHA 1EWIA 1AH9A 3Q8DA 1UEBA 2YTVA 3HOXG 1GKHA 4Y7NH 5LMUQ 5IYCG 4X66Q 2WB1E 1Y14B 4DV3L 2K52A 1IL2A 3PF4A 2KENA 1GVPA 1KC8C 4DR1Q 1PH9A 5GROA 5BR8L 1YBYA 2NZOA 4JI3L 1WCMG 1MJEA 2NVTH 3K0XA 1VQKA 5FLMH 4BBRG 3K7AH 5E7NA 2E2JH 2VUMH 4ME3A 2A8VA 4EQ5A 1VQ6A 1X3EA 3GO5A 3HOZG 1VQPA 4A4IA 2UUAL 1NBWA 1Q1EA 2GVAA 2VY3A 4IJHA 4LFAQ 1IBLL 4JI2L 1EOVA 2A1AA 2JA8G 3UE0A 1FJGL 3PCOB 4IOCA 4JI0L 3GTJH 2V1CC 2PQAA 3BJUA 5IY0A 3DLLA 3H3VH 3I4MG 2XGTA 4DV7Q 3S14H 5JEAG 4AQYQ 4A3DG 1FVIA 3M4QA 2E2IH 3L0OA 1C7YA 3RN2A 1QZGA 3J80i 3AFQA 4MTNA 1NY4A 4P73A 3G4SA 3KLWA 1K0RA 1LYLA 1I3QH 3D31A 3ULJA 3A5UA 3HOWG 2VS1A 3GTPH 3IRBA 3J81c 4NB3A 4R4CA 3L2PA 1S3OA 1C9OA 2EXDA 2KHIA 4R4QA 5BR8Q 3T1YQ 1X9NA 5M3FH 4JI3Q 5M3MH 3NBHB 4B3MQ 4A3CH 3KDFA 3J7A5 3OW2A 3PV0A 4OO1G 4GNXB 4HJ5A 4GLAC 3UDGA 1VQCA 4LW1A 1Q7YC 1HNWL 4A3EH 3TS2A 1N34L 3NENA 2UUAQ 5FLXc 4JI2Q 3PF5A 4KHPQ 2VZAA 2IX1A 2Z6KA 3OYYA 4JBKA 1PA6A 2YU9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ L;  5IT9 c;  3CCS A;  4AYB G;  1PHJ A;  2Z0S A;  5DLQ E;  4HJA A;  4LF6 L;  4DR6 L;  5AJ3 Q;  2EIF A;  3U58 A;  5C3E H;  4B3R L;  2JA6 G;  1YVC A;  2R7Z H;  3GD7 A;  4WJ4 A;  3HOV G;  2VW9 A;  1PYS B;  2IY5 B;  1G6P A;  3EBE A;  1JJG A;  2OWO A;  2HIV A;  4JI6 Q;  4JI1 L;  2MO1 A;  4OX9 Q;  1MJC A;  2AHO B;  3CW2 C;  3G48 A;  5GAG C;  4A3K G;  5IP9 H;  2RHQ B;  1WFQ A;  1HR0 L;  1OTC A;  1VQE A;  1IYJ B;  2ATW A;  4K0K Q;  1N33 L;  3TEH B;  3S1M H;  2YTX A;  3HOU H;  2R7F A;  1TXY A;  3TRZ A;  3RZO H;  4YHH L;  1HNZ L;  4R4O A;  4JI8 Q;  4L5Q A;  4BBS H;  3H3V I;  4A3J G;  1DGS A;  3KYH C;  4DV5 Q;  4DV6 L;  1N34 Q;  1K9M C;  1HR0 W;  3M9B A;  4RMF A;  2JE6 I;  3UDX A;  2K50 A;  1O7I A;  4DUZ Q;  1B70 B;  2ALY B;  5FJ8 G;  1VQA A;  4QGU A;  1VQ7 A;  2ZTD A;  1T9H A;  4A3M G;  4LF6 Q;  4DR7 L;  4LFC L;  3CCQ A;  2QA4 A;  2N8N A;  2UUC L;  4GOP A;  1PH4 A;  1L2F A;  1SE8 A;  3K81 C;  1XNQ Q;  4DV0 Q;  1SMX A;  1PH2 A;  2CWA A;  4LUZ A;  4JI1 Q;  5K36 G;  2Y0S G;  1X56 A;  4OXP A;  5M5Y H;  1PH1 A;  5IYB H;  3KOJ A;  4HIM A;  1UE1 A;  4X66 L;  4IOA A;  3CQZ H;  2Q2U A;  2N78 A;  3E0E A;  2PI2 E;  1FL0 A;  1JB7 A;  4JV5 L;  4DR1 L;  3AQQ A;  2JA7 H;  1Y1V H;  4TVA B;  3MEF A;  2WAQ E;  4UP8 A;  3U4Z A;  4X65 L;  3CCU A;  1Q86 C;  1Z47 A;  2Q2H A;  1HNZ Q;  4IPH A;  1NMG A;  4JBJ A;  2UU9 L;  2R93 H;  3W1G A;  3PUY A;  4EX5 A;  2QGQ A;  2HT1 A;  1MKH A;  2PQA B;  2CQO A;  4B3S Q;  2RHS B;  4LFA L;  1YEZ A;  4AIM A;  3PGZ A;  3S15 H;  4YY3 Q;  1TWG H;  3PUV A;  4JI5 Q;  1YJ9 A;  4DR7 Q;  4R4T A;  3S16 H;  5C44 G;  4DV7 L;  4IFD J;  1PYB A;  2LXK A;  4RG1 A;  4YCW A;  4AQY L;  1J5E Q;  2K4K A;  1SN8 A;  3HFZ B;  1UE7 A;  2UUC Q;  1CKO A;  4QQB X;  4C2M H;  3TRE A;  4X62 Q;  4LF9 Q;  3L7Z C;  4PZ7 A;  2JA5 H;  4LF5 Q;  5IYD G;  2DGY A;  1X65 A;  3E9I A;  3MXN B;  2I5L X;  3KDF B;  2F52 A;  2ZTE A;  4JG2 A;  5HY6 A;  3I56 A;  4GNX C;  4A76 A;  3T1H Q;  4JV5 Q;  1TWF H;  3T1Y L;  2E5L Q;  4X65 Q;  2WP8 J;  4DK6 C;  4B3M L;  5EAY A;  1U5K A;  2H5X A;  1EIY B;  1YIJ A;  3I4O A;  2UU9 Q;  2FXQ A;  2F4V L;  2ES2 A;  2JK8 A;  3FHW A;  3ZJY C;  3U4V A;  1VQJ A;  4QL5 A;  3HOY H;  4L5R C;  3RLO A;  1HZC A;  2KBN A;  5J3B A;  4DK3 C;  1EQQ A;  5FLM G;  2D0O A;  4KHP L;  3STB C;  3F2B A;  1YJW A;  2OCE A;  4HIK A;  2VUM G;  4DR4 L;  1C0A A;  1N8R C;  1I5F A;  4P71 A;  5LMN Q;  1LUZ A;  3JC6 6;  1EIF A;  3S1R H;  1B8A A;  4A3B H;  4HJ8 A;  4OON A;  1KAW A;  1VCI A;  2IT1 A;  2I0Q A;  4X64 L;  5AJ3 L;  1GM5 A;  3HOZ H;  3H0G G;  1Q8K A;  4DNI A;  1EFW A;  4IFD I;  2AWN A;  3ER0 A;  1EQR A;  4IPG A;  3KFU A;  3CCL A;  4GKK Q;  5JJL A;  1XTD A;  1X6O A;  1HH2 P;  4JI6 L;  4L5T A;  3S24 A;  4OX9 L;  1LM0 A;  2QEX A;  1HZ9 A;  2VL6 A;  1A62 A;  3A5Z B;  3F8T A;  1QUQ A;  1KXL A;  4K0K L;  3I7F A;  3PSI A;  4KI0 A;  4IPC A;  2CWP A;  1VQ4 A;  1KQS A;  1VQB A;  2E2H H;  2MO0 A;  3EN2 A;  2LSS A;  2F4V Q;  4BY7 H;  1SLJ A;  4JI8 L;  3NEM A;  5IP7 H;  2ASB A;  4C3I H;  1N32 Q;  4DV5 L;  1HZA A;  1IXR A;  3AFP A;  3FKI H;  5M3M G;  4A3C G;  2KHJ A;  4P74 A;  3ICE A;  2VNU D;  3KJP A;  4DR4 Q;  3W5O A;  3RNU A;  4QJF A;  4GOP B;  1X3G A;  4A3E G;  5JEA J;  2RCN A;  2WB1 G;  2K75 A;  5ELO A;  1YHB A;  4X64 Q;  4HID A;  3GTG H;  4FDB A;  3D0F A;  4GN4 B;  1Q46 A;  4LFB Q;  2K5N A;  4DR2 L;  3CCV A;  3S1Q H;  4B3T L;  1OXU A;  4A3L H;  1XNQ L;  3M7N A;  1GO3 E;  4DV0 L;  5C0X G;  1K8G A;  4KHZ A;  4LF8 Q;  4POF A;  1Z9F A;  1Q82 C;  4HIO A;  2I5M X;  4PMW A;  5C3E G;  3ERS X;  2BH2 A;  3GDE A;  3PUW A;  2R7Z G;  1L1O C;  5C4J H;  2OTL A;  1I94 L;  4GS3 A;  1QVG A;  1Y1W H;  2NN6 G;  3CP0 A;  2UUB Q;  1XMQ Q;  3HOV H;  3PO2 G;  4NPS A;  1EYG A;  3S17 H;  3SGI A;  2R7D A;  4LUO A;  1HNX Q;  1CKN A;  1GD7 A;  2PI2 A;  3UDI A;  1A8V A;  4A3F H;  3PO3 G;  2ZM6 Q;  1R9T H;  1YZ6 A;  3RZD H;  1W3S A;  2JJQ A;  3M85 A;  4B3S L;  1KIX A;  5GAE C;  4YWM A;  1K3R A;  4YWL A;  3J81 j;  4A3G H;  4DPG A;  4JI7 Q;  2C35 B;  4YY3 L;  1KRS A;  4OWW B;  2A19 A;  3S2D H;  3PIO A;  4JI5 L;  4DR3 L;  1VQD A;  3RLN A;  4DV1 Q;  1A0I A;  1TWH H;  2UXD Q;  1J5E L;  4DR2 Q;  1XPU A;  4R4I A;  5JJI A;  4X62 L;  2WFW A;  4B3T Q;  4LWC A;  4LF9 L;  4LF5 L;  1SFO H;  2KCT A;  3STB D;  4R1J A;  1N36 Q;  3CC2 A;  2R92 H;  1XMO Q;  3CF5 A;  2UXC Q;  1EUJ A;  5FJ8 H;  3VDY A;  3T1H L;  1B7Y B;  1BVS A;  1K83 H;  2L15 A;  3JAM i;  1XJV A;  4POG A;  3G6E A;  1I94 Q;  2E5L L;  4BXX H;  2BA0 A;  2D62 A;  3CCR A;  5IYB G;  4OO1 I;  1NMF A;  5M5W H;  4A3I H;  2B29 A;  3CPF A;  2BH8 A;  1V43 A;  2NVQ H;  1P16 A;  1W2B A;  1KHI A;  2JA7 G;  1AE2 A;  4A75 A;  4DR5 L;  3CCM A;  4DV2 Q;  1D8L A;  1ASY A;  1KL9 A;  4YCV A;  4OWT B;  5LMN L;  4JI4 Q;  1PH6 A;  4DR3 Q;  5IE8 A;  2K5V A;  4KLK A;  2K14 A;  3I4N H;  5GAH C;  3GTK H;  2HQL A;  3CC7 A;  1XPO A;  3GTM H;  2E8G A;  2IX0 A;  1VQM A;  3CME A;  1X54 A;  1QUQ B;  4GKK L;  4JCV E;  1BBU A;  5C4X H;  2KCM A;  1VS0 A;  3CMA A;  1S40 A;  4NXN Q;  5C0X I;  5LMN W;  4A93 G;  1JT8 A;  5GAD C;  1TWC H;  1G51 A;  1E7Z A;  1X55 A;  2B63 H;  1CSP A;  1NE3 A;  4BY1 H;  4PZ8 A;  1PH7 A;  1E22 A;  3E9H A;  4H02 A;  1VQL A;  2ZJQ A;  1PH5 A;  3S2H H;  1OXT A;  5ELN A;  1A63 A;  2PMZ E;  3PUZ A;  4PZ6 A;  3HOX H;  1UE5 A;  3TS0 A;  1OXX K;  4P72 A;  4Y52 H;  4BA2 I;  4DUY L;  4LF7 Q;  5IYD H;  5IYC H;  4NXM L;  4JYA Q;  1N32 L;  3KF6 A;  4GN5 A;  4JBW A;  4GOP C;  4DR5 Q;  3K8A A;  3NEL A;  4IO9 A;  3H15 A;  1WCM H;  1E1T A;  2MFI A;  1YJN A;  4BBR H;  3M4P A;  3HOY G;  4APV A;  4AYB E;  2N49 A;  2GVB A;  2OQK A;  1QVF A;  1YHA A;  3J7Z C;  4DV4 Q;  1YI2 A;  4LFB L;  3RLF A;  2WAQ G;  3A74 A;  2VQF Q;  1XNR L;  2JA8 H;  2NVY H;  4X6A H;  3EIV A;  4LF4 Q;  2JQO A;  4A3B G;  1CUK A;  1D7Q A;  3KJO A;  2N3S A;  4AH6 A;  4LF8 L;  1U0L A;  1WOC A;  3WWV A;  2UXB Q;  3I4M H;  4L5S A;  1UWV A;  1K73 C;  4WJ3 M;  1L1O A;  1V9P A;  4YCU A;  1L0W A;  1IBM Q;  3I2Z A;  2VQE L;  4A3D H;  3DM3 A;  2IHE A;  4QY7 A;  3UE1 A;  3H0G H;  1CKN B;  3PUX A;  4DAY B;  2HHH Q;  2UUB L;  1XMQ L;  2IHF A;  3CAM A;  5HGQ A;  3PIP A;  3F2D A;  1WJJ A;  3ULP A;  1HNX L;  3HOW H;  4DUY Q;  3AYH B;  3CXC A;  4NXM Q;  4GKJ Q;  2CCZ A;  3OTO Q;  5M3F G;  2OTJ A;  2ZM6 L;  1YHQ A;  1Q81 C;  4JOI C;  4HJ9 A;  1NJI C;  1H95 A;  2CKZ B;  2Q2T A;  4BY7 G;  1OXV A;  4JI7 L;  2AMC B;  5IP7 G;  1VQO A;  1G29 1;  4P75 A;  3W1B A;  3RN5 A;  1PH3 A;  1I6H H;  2EQS A;  3GTQ H;  4DV3 Q;  4UP7 A;  2HIX A;  1CKM A;  3FKI G;  1WYD A;  2ZJR A;  4OWX B;  4C3J H;  2ZJP A;  4DV1 L;  1Q1B A;  3JAM c;  4TQU S;  1QVC A;  3F2C A;  2UXD L;  3CC4 A;  5H1S E;  3BU2 A;  1XNR Q;  2F3I A;  1Q12 A;  3G71 A;  1QZH A;  2Y0S E;  4PG3 A;  1PFS A;  1N36 L;  1BBW A;  1XMO L;  2UXC L;  1VQN A;  2BA1 A;  1IBL Q;  2VQE Q;  3CCE A;  2K5H A;  4O0A A;  1PH8 A;  3A0J A;  1FJG Q;  2JA6 H;  1ASZ A;  4A3L G;  4O2D A;  2DUD A;  1M90 C;  1SR3 A;  2JEB I;  4MZ9 A;  1JE5 A;  2Q2I A;  1KRT A;  3F1Z A;  4JI0 Q;  3HKZ E;  5IP9 G;  1TWA H;  3M3Y H;  1UE6 A;  1X3F A;  1K8A C;  4XIG S;  4A3K H;  1E1O A;  2MQH A;  4DAM A;  3HOU G;  1E24 A;  4IJL A;  1AE3 A;  1RIP A;  4BA1 I;  1Y1W G;  4DV2 L;  1BKB A;  1N9W A;  3BZC A;  4C3H H;  5M5X H;  2NVX H;  1PV4 A;  4QIW E;  4BBS G;  1E3P A;  3PO2 H;  1VQI A;  4JI4 L;  4LUV A;  4A3F G;  3CPW A;  2JEA I;  4A3J H;  1HZB A;  3HKS A;  2ZTC A;  3PO3 H;  4A3G G;  1I50 H;  3KF8 B;  3GTO H;  4LNQ A;  2YYZ A;  5C0X J;  1MIU A;  2XTI A;  3LGJ A;  5GQO A;  4MNO A;  4NXN L;  2GN5 A;  1HNW Q;  1JMC A;  1RL2 A;  3J81 i;  4GNX A;  4A3M H;  2YTY A;  3K7U C;  1IZ6 A;  2Z6K C;  3FP9 A;  2R92 G;  3KF6 B;  3I55 A;  1IBK L;  4JBM A;  1JJC B;  2I5H A;  2LXJ A;  2RF4 A;  1KD1 C;  4DR6 Q;  2MNA A;  4JC0 A;  4B3R Q;  4LF7 L;  4IFD G;  1VQF A;  1Y1V G;  1WI5 A;  2JA9 A;  5IWA L;  1YIT A;  4JYA L;  2AWO A;  4BXX G;  3AEV A;  1VQ5 A;  1PVO A;  4UP9 A;  3CCJ A;  2R93 G;  4A3I G;  2OQ0 A;  5LMU L;  1HR0 Q;  1J6Q A;  2B3G A;  1NTG A;  4DKA C;  3GTL H;  3RR5 A;  1N33 Q;  1VQ8 A;  4DV4 L;  3CD6 A;  1LTL A;  1VQG A;  4GN3 B;  4UY8 C;  1YNX A;  2NZH A;  4UPA A;  2ID0 A;  2VQF L;  4YHH Q;  1XPR A;  1S72 A;  2YV5 A;  5JJK A;  4LF4 L;  1L1O B;  4GLV B;  2R6G A;  1JJ2 A;  3HKZ G;  3I4N G;  4XTC S;  1P8L A;  2D0P A;  3ULL A;  4IPD A;  2UXB L;  4DV6 Q;  2AKW B;  3S1N H;  3BZK A;  4J15 A;  3U50 C;  5C44 H;  2PNH A;  1IBM L;  2JA5 G;  1V1Q A;  3J80 c;  3TQY A;  1OXS C;  3K80 C;  2HHH L;  5C4X G;  1VQ9 A;  1IBK Q;  1SRO A;  4HJ7 A;  4YWK A;  2NN6 I;  1CSQ A;  4ALP A;  1M1K C;  4LFC Q;  2B63 G;  4GKJ L;  4GLX A;  4A93 H;  5IWA Q;  3OTO L;  4BY1 G;  1HJP A;  3UDF A;  1FGU A;  4JOI A;  1SRU A;  2CFM A;  3B6Y A;  3M4O H;  1VQH A;  1EWI A;  1AH9 A;  3Q8D A;  1UEB A;  2YTV A;  3HOX G;  1GKH A;  4Y7N H;  5LMU Q;  5IYC G;  4X66 Q;  2WB1 E;  1Y14 B;  4DV3 L;  2K52 A;  1IL2 A;  3PF4 A;  2KEN A;  1GVP A;  1KC8 C;  4DR1 Q;  1PH9 A;  5GRO A;  5BR8 L;  1YBY A;  2NZO A;  4JI3 L;  1WCM G;  1MJE A;  2NVT H;  3K0X A;  1VQK A;  5FLM H;  4BBR G;  3K7A H;  5E7N A;  2E2J H;  2VUM H;  4ME3 A;  2A8V A;  4EQ5 A;  1VQ6 A;  1X3E A;  3GO5 A;  3HOZ G;  1VQP A;  4A4I A;  2UUA L;  1NBW A;  1Q1E A;  2GVA A;  2VY3 A;  4IJH A;  4LFA Q;  1IBL L;  4JI2 L;  1EOV A;  2A1A A;  2JA8 G;  3UE0 A;  1FJG L;  3PCO B;  4IOC A;  4JI0 L;  3GTJ H;  2V1C C;  2PQA A;  3BJU A;  5IY0 A;  3DLL A;  3H3V H;  3I4M G;  2XGT A;  4DV7 Q;  3S14 H;  5JEA G;  4AQY Q;  4A3D G;  1FVI A;  3M4Q A;  2E2I H;  3L0O A;  1C7Y A;  3RN2 A;  1QZG A;  3J80 i;  3AFQ A;  4MTN A;  1NY4 A;  4P73 A;  3G4S A;  3KLW A;  1K0R A;  1LYL A;  1I3Q H;  3D31 A;  3ULJ A;  3A5U A;  3HOW G;  2VS1 A;  3GTP H;  3IRB A;  3J81 c;  4NB3 A;  4R4C A;  3L2P A;  1S3O A;  1C9O A;  2EXD A;  2KHI A;  4R4Q A;  5BR8 Q;  3T1Y Q;  1X9N A;  5M3F H;  4JI3 Q;  5M3M H;  3NBH B;  4B3M Q;  4A3C H;  3KDF A;  3J7A 5;  3OW2 A;  3PV0 A;  4OO1 G;  4GNX B;  4HJ5 A;  4GLA C;  3UDG A;  1VQC A;  4LW1 A;  1Q7Y C;  1HNW L;  4A3E H;  3TS2 A;  1N34 L;  3NEN A;  2UUA Q;  5FLX c;  4JI2 Q;  3PF5 A;  4KHP Q;  2VZA A;  2IX1 A;  2Z6K A;  3OYY A;  4JBK A;  1PA6 A;  2YU9 H; 
#chains in the Genus database with same CATH topology
 1PLF A;  2NTT A;  4DUZ L;  3MXU A;  1I6H B;  5J22 A;  2JA6 G;  1CQF A;  3CHB D;  2F0M A;  1PYS B;  1G6P A;  1MJC A;  1KLG D;  3K6O A;  1F9S A;  5GAG C;  2ATW A;  2RHQ B;  4K0K Q;  4AYB B;  3AB9 A;  3HOU H;  4IN3 A;  1TXY A;  3HOV B;  1PZK D;  4L5Q A;  1PRT D;  5I9P A;  1DGS A;  1K9M C;  4DV6 L;  3T53 B;  4F87 A;  4ODG A;  3DWP A;  2K32 A;  3N52 A;  3SEB A;  1UAP A;  3UDX A;  1DJR D;  3K5L A;  2IL8 A;  3BDO A;  4C56 C;  3P7J A;  2XRS D;  1PH4 A;  1L2F A;  1XNQ Q;  3GTO B;  4DV0 Q;  5K36 G;  1G6Z A;  2ZXR A;  4OXP A;  1SFO B;  4JW0 A;  3KOJ A;  5IYB H;  2R92 B;  4ME5 A;  4X66 L;  1HA5 A;  2N78 A;  1FL0 A;  2LY7 A;  3NXW A;  1SNP A;  4K8I A;  2WAQ E;  1HNZ Q;  4XQJ A;  2BCO A;  4JBJ A;  1SEB D;  4NKL A;  4CKC A;  4LAA A;  2N88 A;  1HUN A;  2HT1 A;  2CQO A;  4B3S Q;  1RCV D;  1RHP A;  4YY3 Q;  1TWG H;  4RGN A;  4DR7 Q;  1TY2 A;  2F3W A;  3C1E A;  4AQY L;  2EPB A;  1SN8 A;  3I73 A;  1CKO A;  3VR3 A;  1GXD C;  3TRE A;  3TZD A;  4X62 Q;  5IGE A;  1CHQ D;  2F0W A;  1EWH A;  1KLU D;  3LWU A;  1DXM A;  2F52 A;  2ZTE A;  1LAC A;  5CV5 A;  1LAB A;  5HY6 A;  3K58 A;  4GNX C;  4A76 A;  5C44 B;  1TWF H;  3T1Y L;  2E5L Q;  4HAE A;  2WP8 J;  4K14 A;  4B3M L;  1EIY B;  1YIJ A;  3I4O A;  2FXQ A;  3FHW A;  3ZJY C;  3HGB A;  2F0E A;  1YNJ C;  3QJY A;  3RLO A;  4MN3 A;  4DK3 C;  4KHP L;  3A8I E;  1S5E D;  1YJW A;  2J0T D;  2OCE A;  2B2W C;  1N8R C;  1XXG A;  3HEJ A;  1LUZ A;  4BS9 A;  3S1R H;  4FXG C;  4OON A;  1KAW A;  1VCI A;  2I0Q A;  4X64 L;  5AJ3 L;  1BBX C;  5EPJ A;  1ENF A;  2AWN A;  2F0F A;  1XTD A;  3K7A B;  1HH2 P;  4L5T A;  4OX9 L;  2JXM B;  2QEX A;  1SAP A;  2VL6 A;  3A5Z B;  1ZKO A;  3I7F A;  3PSI A;  2CWP A;  2L1B A;  1SYD A;  2EY6 A;  2MO0 A;  3EN2 A;  3H91 A;  2F4V Q;  5FKA C;  1SLJ A;  4TRD A;  1IYV A;  1LTT D;  4A3C G;  1L0X B;  3ICE A;  2E2I B;  3KJP A;  1R4Q B;  3HRZ C;  4ILW A;  2K05 A;  4ULL A;  4HCE A;  2WB1 G;  2K75 A;  4EQN A;  5C3X A;  4RWS C;  5KGU A;  5M3M B;  1EY9 A;  5KRU A;  2K1B A;  1STE A;  4HIO A;  1B50 A;  2R7Z G;  4A3E B;  1L1O C;  2H4O A;  2OTL A;  2UUB Q;  3CP0 A;  3HOV H;  1XMQ Q;  4NPS A;  1GUO A;  2V4D A;  4M8A A;  3RUZ A;  3SGI A;  4LUO A;  4O42 A;  1EY0 A;  1GD7 A;  4DAY A;  3PO3 G;  4XYQ A;  1YZ6 A;  3RZD H;  1SMY C;  3J81 j;  5M5X B;  3S2D H;  3PIO A;  1A0I A;  2XIW A;  2SOB A;  3V05 A;  1SFO H;  3RZO B;  2R92 H;  1XMO Q;  3T1H L;  1K83 H;  2L15 A;  1LTS D;  4LK1 C;  2RDF A;  3HP3 A;  2F0H A;  3CCR A;  4G7Z C;  3ITP A;  1NMF A;  5M5W H;  2NVQ H;  3NP8 A;  1P16 A;  3BVM A;  5IOC A;  4DNR B;  1PH6 A;  2K5V A;  1TQO A;  3IKJ A;  3GTK H;  3GTL B;  3MAQ A;  3HZX A;  2A74 C;  1JR0 D;  4GKK L;  3A54 A;  4IQZ A;  4S3S A;  3ZYY X;  1K0S A;  1BBU A;  1VS0 A;  1JT8 A;  5GAD C;  1PYW D;  1CSP A;  2O4X A;  4X3U A;  1LT4 D;  2JN4 A;  5ELN A;  1PDQ A;  2IX3 A;  4QMG A;  4P72 A;  5EBC A;  4BA2 I;  3C2P A;  4NXM L;  2XNA C;  3W3A A;  4GN5 A;  1H9R A;  4GOP C;  2EDG A;  1YJN A;  3CKI B;  4APV A;  2F0K A;  2DJF C;  1T5E A;  2OQK A;  1QVF A;  4PNY A;  4ZKC B;  4KK7 A;  3RMH A;  1CUK A;  1D7Q A;  1B9M A;  2F0P A;  1WOC A;  1X32 A;  3SK8 A;  1UWV A;  2AUJ D;  4X3K A;  3HOY B;  3FMC A;  1L0W A;  1IBM Q;  4A3D H;  3UE1 A;  2HHH Q;  2WAQ B;  1XX8 A;  3F2D A;  1WTV A;  2J7Z A;  4A3B B;  1HNX L;  4XDX A;  2RBM A;  3AYH B;  4GKJ Q;  5BN3 A;  2L55 A;  2CCZ A;  2ZM6 L;  1Q81 C;  1L0Y B;  4JOI C;  2Q2T A;  1RKN A;  3D8G A;  1OXV A;  3IFT A;  2AMC B;  4IUT A;  1PH3 A;  3W1B A;  2NYZ D;  4DV3 Q;  3FKI G;  1WYD A;  2KQ3 A;  1Z7T A;  2UXD L;  1O7L A;  3F2C A;  2OEO A;  4ZRZ A;  3BU2 A;  5M3F B;  4DFA A;  3G71 A;  1ENC A;  2Y0S E;  2Z1C A;  1BBW A;  1X3P A;  4CDF C;  1IBL Q;  1S5B D;  2K5H A;  4O0A A;  1PH8 A;  2JA6 H;  1SE3 A;  5ELC A;  4P2C B;  2Q2I A;  4Z9C B;  3S9W A;  4N8F A;  2ENB A;  2K7V A;  5M9O A;  5C0X H;  1M8A A;  1BCP B;  3HOU G;  3OWF A;  1AE3 A;  5IGC A;  1BKB A;  1N9W A;  2QCP X;  2AQ2 B;  4X3S A;  4C1N K;  5M5X H;  1YNN D;  4JI4 L;  4LUV A;  4A3F G;  3CPW A;  2A6H D;  1TY0 A;  2JEA I;  1STA A;  2IW3 A;  1JCK B;  4LNQ A;  2YYZ A;  5C0X J;  5COR A;  1MIU A;  3LGJ A;  2OXP A;  1NR4 A;  3J81 i;  1RD9 D;  5COY A;  2J4X A;  3K7U C;  4E6I A;  1MD2 D;  3KF6 B;  3I55 A;  4JBM A;  2QKI C;  5K36 H;  2I5H A;  2OF1 A;  1J8I A;  4LF7 L;  2IPK D;  4DAV A;  1TWH B;  3AEV A;  4UP9 A;  3CCJ A;  1RTN A;  3U9O A;  5LMU L;  5D3I B;  1J6Q A;  1PFN A;  3GTL H;  1VDZ A;  1QE6 A;  1LTL A;  1VQG A;  2PW7 A;  3CD6 A;  3I70 A;  2ID0 A;  1PZI D;  2PPB C;  4DGZ A;  4GLV B;  2R6G A;  3I4N G;  3OMG A;  4DV6 Q;  2WV6 D;  3J80 c;  1OXS C;  5A35 A;  1IBK Q;  1KDB A;  2NN6 I;  1F9Q A;  1M1K C;  1PTO F;  2B63 G;  3I4L A;  4V19 0;  2B2Y A;  3OTO L;  3B6Y A;  4C2M B;  1AH9 A;  3VYR A;  1GKH A;  4Y7N H;  5A2Q L;  1Q8I A;  4KTA A;  2AQ3 B;  5C4X B;  4X66 Q;  1EQT A;  1Z6H A;  1NUC A;  2Z8L A;  3R2T A;  4DAP A;  1GVP A;  3PF4 A;  5GRO A;  5BR8 L;  1D5M C;  3K0X A;  3K5N A;  1QCB D;  1D5Z C;  1SYB A;  4BBR G;  5E7N A;  5C5M A;  4EQ5 A;  4U68 A;  3GO5 A;  4OIJ A;  4A4I A;  4F8M A;  4IJH A;  1Q1E A;  2UUA L;  2L4N A;  4JI0 L;  1PFM A;  3TP5 A;  3D6C A;  3IL8 A;  5IY0 A;  3I4M G;  3FEW X;  3S14 H;  4AQY Q;  5DM7 3;  3HOZ B;  3J80 i;  4NMZ A;  2JA8 B;  5DM6 3;  3A7L A;  1K0R A;  3HOW G;  4CJ0 B;  1A3U A;  1HTP A;  5HUR A;  3Q0A A;  5JAV A;  2NBF A;  1C9O A;  4JI3 Q;  2PZT A;  3T1Y Q;  5M3F H;  2BOS A;  4A3C H;  4B3M Q;  1CA6 A;  3KDF A;  3J7A 5;  4GNX B;  5C5L A;  1VMP A;  2R3Z A;  1Q7Y C;  4JI2 Q;  2ZXP A;  4KHP Q;  1PA6 A;  5IIF A;  3CCS A;  5T1G A;  4AYB G;  1PHJ A;  2Z0S A;  5DLQ E;  3GTQ B;  5AJ3 Q;  2EIF A;  4B3R L;  2R7Z H;  3IFD A;  3HOV G;  4ZQ3 A;  1SXT A;  4QUC A;  1I4R A;  3EBE A;  4PMC A;  3KLS A;  4JI1 L;  4OX9 Q;  1IYU A;  2B39 A;  1LT3 D;  1HRJ A;  1VQE A;  1IYJ B;  2WIN B;  4O1N A;  3S1M H;  1RJT A;  4XT3 B;  3TRZ A;  3SR1 A;  3KYH C;  4I7A A;  1N34 Q;  3R2I A;  1STH A;  1WTQ A;  1HR0 W;  3BDC A;  3KBG A;  3I72 A;  4ZAI A;  4RMF A;  2B2T C;  1O7I A;  4NDX A;  2NVX B;  5KYI A;  1VQA A;  4QGU A;  1JOO A;  2BE5 D;  1T9H A;  2Z9H A;  4XYO A;  1VQ7 A;  4LF6 Q;  3CCQ A;  5C4H A;  1AN8 A;  1PMR A;  1SNC A;  5M5Y H;  5BN5 A;  4HIM A;  1UE1 A;  4IOA A;  2XWB B;  3CQZ H;  2FIN B;  3ONA B;  4JV5 L;  4H0L C;  4DR1 L;  2K33 A;  1JWM D;  4TVA B;  4X65 L;  1Z47 A;  1D6E C;  2CH4 A;  1E2W A;  2UU9 L;  4K2K A;  3W1G A;  1O78 A;  2LMC B;  1HXY D;  1Y8O B;  2Y0S B;  4K6L A;  2QGQ A;  4QB4 A;  2E74 C;  2PQA B;  4LFA L;  1YEZ A;  3L3O C;  3S15 H;  3QR8 A;  5EQ0 A;  4IUU A;  4OEL B;  3BZD B;  3S16 H;  2PNR C;  5C44 G;  1PYB A;  2LXK A;  4YCW A;  2MHV A;  1UE7 A;  2UUC Q;  4QQB X;  4HTH A;  4C2M H;  4DA2 A;  4HR7 B;  4PZ7 A;  1B3Q A;  1KAB A;  1X65 A;  3LX0 A;  1F9P A;  4DK0 A;  3T1H Q;  4JG2 A;  2RQX A;  3ND9 A;  3TZU A;  2C5C A;  4FXD A;  4RCN A;  1ROD A;  3EA6 A;  1Q90 A;  1U5K A;  1VQJ A;  4QL5 A;  4L5R C;  4IUV A;  1IW7 C;  4DK1 A;  2PYK A;  4I65 A;  3F2B A;  4DR4 L;  1C0A A;  3M4O B;  3PMF A;  4UAI A;  2CVR A;  2MP1 A;  2B2U A;  4HJ8 A;  5JOB A;  4FO2 A;  4KN7 C;  3HOZ H;  1BUV T;  1BO0 A;  1GUG A;  1Q8K A;  5FO7 B;  1EFW A;  1JWS D;  3ER0 A;  1EQR A;  2NVT B;  3CCL A;  4GKK Q;  2RSO A;  4CDC C;  2E2J B;  3S24 A;  5FO9 B;  4DU9 A;  2G5D A;  3NPP A;  1QUQ A;  4J8Q A;  4IPC A;  5J39 A;  4OHJ A;  3A7A B;  1VQB A;  4EQP A;  1U4P A;  3H0G B;  3K0Y A;  3GTJ B;  1TS5 A;  1KTK A;  2X69 A;  2ASB A;  3HOW B;  1MSH A;  3K57 A;  4DV5 L;  3FKI H;  1I4G A;  5M3M G;  2RDG A;  3A56 A;  4P74 A;  3Q6S A;  3K59 A;  3QOJ A;  2A6E C;  4QJF A;  4GOP B;  1B2T A;  3DHQ A;  5L37 A;  1WTH A;  4A3E G;  1PTO C;  1EZ8 A;  5ELO A;  4HID A;  3GTP B;  2EVB A;  5T1I A;  4DR2 L;  5KEE A;  1HA6 A;  3CCV A;  3S1Q H;  1OXU A;  4J1M A;  3BYY B;  4MHE A;  5C0X G;  4Q0F A;  4KHZ A;  2L11 A;  4CBV A;  1K8G A;  2I5M X;  3FRP B;  4PMW A;  3ERS X;  1ICW A;  1ZEQ X;  1SJH D;  1TKW B;  1B1Z A;  3VYU A;  4KY6 A;  2NTS A;  4GS3 A;  1O7Z A;  2NN6 G;  3NWT A;  2ZXO A;  1EYG A;  5I6Y A;  5K5P A;  3WOF A;  1HNX Q;  1CKN A;  2PI2 A;  4KJO A;  4A3F H;  1A8V A;  3M3Y B;  2ZM6 Q;  2LS0 1;  5CMD A;  5C3E B;  3T13 A;  2O5J C;  1JQY D;  3GV3 A;  1PRT F;  2C35 B;  2KEE A;  1KRS A;  4DR3 L;  3MFG A;  3PO2 B;  3BG3 A;  1JOQ A;  3RLN A;  2UXD Q;  2IWH A;  1KAA A;  1J5E L;  1XPU A;  4R4I A;  5JJI A;  1STN A;  2WFW A;  4B3T Q;  4F7X A;  3STB D;  1ET6 A;  3CC2 A;  3CF5 A;  3EJI A;  2AUK A;  1EUJ A;  3E0J A;  3MC0 B;  3JAM i;  4POG A;  1I94 Q;  4DXF A;  3KLR A;  3TP6 A;  1D1K A;  2BA0 A;  2D62 A;  1CZG A;  4OO1 I;  2BH8 A;  1W2B A;  1AE2 A;  4DR5 L;  1ASY A;  1KL9 A;  1RF2 D;  4YCV A;  1JC7 A;  4OWT B;  1LTR D;  5LMN L;  1HTL D;  4JI4 Q;  4HCS A;  4KKT A;  3KK7 A;  3I4N H;  3E5S A;  2HQL A;  1XPO A;  3H94 A;  1VQM A;  1O80 A;  2JA7 B;  1IKL A;  5CC4 A;  3D3R A;  4JCV E;  3MWY W;  1KNE A;  1S40 A;  1VMC A;  3KF8 A;  2A69 C;  1TWC H;  1X55 A;  3S1N B;  2B63 H;  2K01 A;  3M4Y A;  1PH7 A;  4H02 A;  2L5T A;  3S2H H;  1OXT A;  1A63 A;  3TS0 A;  1UE5 A;  4Y52 H;  4DUY L;  4LF7 Q;  2B2V C;  3E3X A;  1ZYR D;  2MFI A;  4BBR H;  3M4P A;  3HOY G;  2FHT A;  3IAY A;  3SDZ A;  3J7Z C;  1YI2 A;  2TMP A;  2WAQ G;  1XNR L;  3EIV A;  2EY2 A;  4A3B G;  1DD2 A;  1SNO A;  2N3S A;  5A2Q E;  4AH6 A;  3I4M H;  4L5S A;  5E1F A;  1L1O A;  4YCU A;  5FO8 B;  4TSS A;  3TDQ A;  2VQE L;  3J80 L;  3H0G H;  3H6M A;  3CAM A;  1LO5 D;  3T56 B;  3MVV A;  3HOW H;  1QNK A;  3OTO Q;  5M3F G;  3GQB A;  1EIG A;  1YHQ A;  3DEP A;  1HFN A;  1MGS A;  1TVX A;  2CKZ B;  4JI7 L;  1VQO A;  5IP7 G;  3NSW A;  3DXJ C;  3RN5 A;  1I6H H;  2EQS A;  4IUR A;  2N55 A;  1ZXT A;  2ZJR A;  4TQU S;  5E4X A;  5IGB A;  4BWG B;  3EQL C;  1QZH A;  5EPL A;  4PG3 A;  1PFS A;  2TSS A;  4BY7 B;  1CHP D;  2UXC L;  1VQN A;  4K5W A;  4KMU C;  4OL7 A;  4O2D A;  2DUD A;  1M90 C;  5ELE A;  4JI0 Q;  2A68 D;  2F4I A;  1WD0 A;  5CYU A;  3M3Y H;  1UE6 A;  3NWS A;  4H13 C;  3GTG B;  4BA1 I;  1CM9 A;  1E3P A;  4CKB A;  1VQI A;  3PO2 H;  1R4P B;  4YIJ A;  2KED A;  3Q24 A;  4NP5 A;  3HKS A;  2CHB D;  5C4J B;  1W6J A;  3GTO H;  1Y1W B;  2EJG C;  4MNO A;  2PO4 A;  3S17 B;  4BBS B;  1JMC A;  3A8K E;  2YTY A;  1R9T B;  2B8G A;  1SYE A;  2EJF C;  1JIC A;  2RKS A;  3MXP A;  4A3G B;  2F3V A;  4CKE A;  1KD1 C;  3TME A;  2MNA A;  4B3R Q;  2JA9 A;  5IWA L;  1A2T A;  5J1Z A;  5JPN C;  1H9J A;  4RFB A;  1NTG A;  2DNE A;  4ZYS A;  3FVQ A;  4GN3 B;  4UY8 C;  2NZH A;  2VQF L;  4RH6 A;  1S72 A;  2YV5 A;  4LF4 L;  2D0P A;  4IPD A;  1TT2 A;  3S1N H;  5C44 H;  2PNH A;  1CT1 D;  3H3V C;  5C4X G;  3BYT B;  1EU4 A;  3NTK A;  2RA4 A;  3NHH A;  1HJP A;  1FGU A;  4JOI A;  2VB3 X;  1LTG D;  1V1P B;  1SNM A;  1EWI A;  1FNW A;  1PRT C;  3W2D A;  3Q8D A;  5G3L D;  3OHX C;  1B4O A;  5IYC G;  1IL2 A;  2LKV A;  4DR1 Q;  1YBY A;  2NZO A;  1WCM G;  1VQK A;  3K7A H;  5G3L F;  4BY1 B;  2CW0 D;  1X3E A;  3HOZ G;  3HOX B;  4LFA Q;  2JA8 G;  3TP7 A;  2A1A A;  3UE0 A;  1TU2 B;  4J6H A;  1B9N A;  4IOC A;  4FXK C;  5EKI A;  1S5D D;  2O2L D;  1JOR A;  2SNS A;  3BJU A;  2XGT A;  4R9W A;  4RGM A;  1BDO A;  1FVI A;  3M4Q A;  2E2I H;  3L0O A;  5E3F A;  1QZG A;  2XN9 C;  1AP0 A;  1NY4 A;  2NVY B;  2VS1 A;  4RGO S;  3J81 c;  1S3O A;  1SND A;  1X9N A;  4R4Q A;  3NBI A;  2Q8T A;  5M3M H;  3NBH B;  3CRK C;  1EYA A;  3FDT A;  3PV0 A;  4OO1 G;  4L63 B;  2F0O A;  4LW1 A;  4A3E H;  3KLS X;  5FLX c;  3PF5 A;  1PZJ D;  1ML0 D;  3GP7 A;  4K8J A;  3OYY A;  4JBK A;  3BDL A;  5IT9 c;  1DZ1 A;  1E0B A;  4HJA A;  1EL0 A;  4C3J B;  1FD7 D;  1YVC A;  3GD7 A;  4WJ4 A;  2VW9 A;  3VR4 A;  4WRD A;  1JJG A;  2MPM A;  2HIV A;  2NN6 H;  3CW2 C;  2K28 A;  4RHR A;  5IP9 H;  1OTC A;  1W6K A;  1N33 L;  5KNC A;  2QW7 A;  2VB2 X;  2R7F A;  3RZO H;  4YHH L;  1BQQ T;  1HNZ L;  1DOL A;  4FP5 D;  2BDN A;  3DM1 A;  4BBS H;  4PV1 C;  2PZU A;  2DNC A;  1TWA B;  3SK6 A;  4DV5 Q;  4PMB A;  4A3K B;  1VF7 A;  3SK4 A;  3OPO A;  1F2M A;  1S5C D;  2K50 A;  4C3H B;  4DUZ Q;  2EYF A;  2ALY B;  2EYL A;  2RDH A;  4DR7 L;  2ZTD A;  1WVL A;  1SE2 A;  4LFC L;  4A3J B;  2N8N A;  1C4Q A;  2OT2 A;  3PQI A;  1PTO B;  1SE8 A;  3K81 C;  1I50 B;  3F2U A;  1PH2 A;  1SMX A;  2CWA A;  4FNF A;  2Z6B A;  2Y0S G;  1X56 A;  4KD4 A;  1BCP D;  3QWN A;  5ELB A;  3J81 E;  1JB7 A;  5JVH 3;  1Q3L A;  4WFN 3;  3CCU A;  4UP8 A;  2Q2H A;  4CDD C;  2R61 A;  1H9S B;  4IPH A;  1NMG A;  2F0I A;  4KKU A;  3NTI A;  4EX5 A;  5HGT A;  1Y8P B;  5FLX E;  3C1F A;  3FPP A;  4R8I A;  1I4X A;  5F2D A;  4B08 A;  3PUV A;  5ELF A;  3SK5 A;  1QNU A;  4IFD J;  4R8N A;  4RG1 A;  1J5E Q;  2PZW A;  1EY8 A;  3HFZ B;  3GTM B;  4RCO A;  4WOR A;  1EEF D;  2I5L X;  3I56 A;  2RCF A;  3P1H A;  3P20 A;  4DK6 C;  5EAY A;  1GJX A;  2H5X A;  4KKS A;  3EVQ A;  2F4V L;  2ES2 A;  3U4V A;  3HOY H;  4G7O C;  1A3T A;  3VR2 A;  1HZC A;  1K3B C;  5J3B A;  1EQQ A;  5FLM G;  1F2L A;  4HIK A;  1JWU D;  1I5F A;  1WCM B;  4P71 A;  5LMN Q;  3JC6 6;  2KUM A;  1B8A A;  4A3B H;  2K5D A;  2IT1 A;  3HS0 C;  1VF5 C;  1GM5 A;  3E6Z X;  3H0G G;  4IUQ A;  2EYO A;  4L6T B;  3VA7 A;  4IFD I;  1SBB B;  1EIH A;  1JB3 A;  1X6O A;  4JI6 L;  2L9H A;  2VUM B;  1RDP D;  3DUZ A;  1J9O A;  1HZ9 A;  3F8T A;  1KXL A;  2FFK B;  3M7G A;  4KI0 A;  1VQ4 A;  1SYC A;  3TSS A;  4L8J A;  2E2D C;  1BOS A;  1D5X C;  4JI8 L;  4EVO A;  5IP7 H;  3Q23 A;  1IXR A;  2Z4H A;  3J80 E;  3RNU A;  1LLR D;  1QIL A;  3BS1 A;  1X3G A;  3NUC A;  4X64 Q;  1MBY A;  3D0F A;  1EWC A;  3OSO A;  1UNS A;  3G7L A;  1IHZ A;  4POF A;  1Q82 C;  2XRQ D;  5C3E G;  2BH2 A;  3GDE A;  1A15 A;  1IKM A;  1QVG A;  3PO2 G;  1GUW A;  5LL6 X;  4HED A;  2R7D A;  2YU9 B;  3UDI A;  3ND8 A;  2JJQ A;  3LNN A;  1K3R A;  1EY5 A;  1V1O A;  4YWL A;  4FF4 A;  4JI7 Q;  2EYM A;  2F1M A;  2A19 A;  4OWW B;  4JI5 L;  2CQA A;  1TWH H;  1YNJ D;  1GHJ A;  2F0D A;  3TBI B;  4LF9 L;  3WOE A;  4EQO A;  1AEX A;  4LF5 L;  2SDF A;  4R1J A;  4MTK A;  1AFP A;  2EYJ A;  2UXC Q;  5FJ8 H;  1B7Y B;  1BVS A;  1XTC D;  1IL8 A;  1XJV A;  5CV8 A;  2DJG C;  5KNB A;  4KJN A;  4KHV A;  2B29 A;  2QF7 A;  3CPF A;  1AZP A;  2JA7 G;  1KHI A;  2H1E A;  3D4W A;  5ISR A;  3CCM A;  1D8L A;  5DEH A;  2JP1 A;  2I46 A;  5I2Y A;  5IE8 A;  1Y69 U;  1SYF A;  2K14 A;  5GAH C;  5EPK A;  3CC7 A;  1G2T A;  3GTM H;  5AFW A;  3CME A;  4KY7 A;  2F0U A;  4FYD A;  5C4X H;  2KCM A;  5I2X A;  1WTR A;  4ZUJ A;  2GA4 B;  1ESR A;  1NE3 A;  3H09 A;  1YNN C;  4OGQ C;  1VQL A;  1PH5 A;  2A6H C;  1TWG B;  5IYD H;  2X6G A;  5IYC H;  1GUS A;  1N32 L;  2DN8 A;  3KF6 A;  1SJE D;  4H7B A;  4JBW A;  4A93 B;  3NEL A;  4K5V A;  1II3 A;  1WCM H;  2QDL A;  4IUN A;  3D4D A;  1EQV A;  2PCF B;  3X3N A;  2C9O A;  4RAU C;  1H9K A;  4LFB L;  1TWF B;  4NW2 A;  2JA8 H;  3A74 A;  2VQF Q;  4X6A H;  4LF4 Q;  2JQO A;  2M00 A;  1SMY D;  3KJO A;  4LF8 L;  1EYD A;  4WJ3 M;  2DY8 A;  5EKL A;  2VNU D;  4QY7 A;  4DAY B;  2HCC A;  1A6X A;  2IHF A;  3SE0 A;  3ULP A;  1WJJ A;  3S1R B;  4NXM Q;  4UHV A;  4HJ9 A;  1NJI C;  4KN4 C;  1STB A;  3PIP 3;  4BY7 G;  4OO1 H;  2P5Z X;  1WTW A;  4P75 A;  4Q5V A;  1I3Q B;  4C3I G;  5IOD A;  3GTQ H;  4UP7 A;  1CKM A;  1PRT B;  4DV1 L;  1Q1B A;  3JAM c;  1QVC A;  5H1S E;  4MIU A;  1LV9 A;  3T51 B;  2F3I A;  3VR6 A;  2HDM A;  1E2V A;  4OIK A;  1N36 L;  3N6R A;  3O13 A;  2BA1 A;  2FMC A;  3L9A X;  3CCE A;  3URY A;  1CQV A;  4ZUI A;  4A3L G;  5CBA E;  2JEB I;  4MZ9 A;  1JE5 A;  1KRT A;  3F1Z A;  2B2U C;  2PQE A;  5D65 A;  5IP9 G;  1X3F A;  3KUP A;  2PMZ B;  2SEB D;  5CV9 A;  1AZQ A;  4XIG S;  1E1O A;  4WJW A;  4IJL A;  4UDU C;  1Y1W G;  1TS2 A;  4DV2 L;  2Z4I A;  1CTM A;  2EYP A;  4BBS G;  2NVX H;  1PV4 A;  3RD4 A;  4FVM A;  4B9X A;  1I6V C;  3J81 L;  2ZTC A;  2WII B;  2KVM A;  1I4Q A;  4A3G G;  5TSS A;  3DWA A;  5GQO A;  1UEA B;  3NQT A;  2MJ8 A;  1EY7 A;  2NB0 A;  4NXN L;  1ET9 A;  1LTI D;  1RL2 A;  4I7Z C;  4GNX A;  5FLX L;  2Z6K C;  3RZD B;  3T4A C;  1MSG A;  1JOK A;  1IBK L;  2F0Q A;  5IT9 L;  2LXJ A;  2RF4 A;  3S2D B;  4XQQ A;  3I8Z A;  5D14 A;  4JC0 A;  3Q22 A;  1BNZ A;  4IFD G;  1VQF A;  2B2V A;  1WI5 A;  4ZLT F;  4JYA L;  2A73 B;  4BXX G;  4K5X A;  4LJZ C;  1PVO A;  2B2W A;  4HN7 A;  1MHW C;  4A3I G;  5D3D A;  4QCL A;  2A5H A;  1M4V A;  3RR5 A;  1N33 Q;  4DV4 L;  3JAM E;  1K83 B;  1TR5 A;  1Y1V B;  1XPR A;  4YHH Q;  5JJK A;  1UUP A;  1JJ2 A;  2F03 A;  1P8L A;  5M5W B;  1TS4 A;  2UXB L;  2R93 B;  2RSN A;  2CH4 W;  3BZK A;  3U50 C;  2NVQ B;  2E76 C;  2G9D A;  4XQN A;  1SNQ A;  3K80 C;  1SRO A;  5CGK A;  4YWK A;  4ALP A;  1CSQ A;  4C1N I;  4LFC Q;  3HKZ B;  4GLX A;  4A93 H;  1HUM A;  3GTK B;  4BY1 G;  3UDF A;  1SRU A;  2CFM A;  5CV6 A;  3M4O H;  1VQH A;  2JA5 B;  4CHT B;  2YTV A;  3HOX G;  5LMU Q;  5EBD A;  3AMU A;  3FPU B;  2WB1 E;  1Y14 B;  4QIW B;  1EU3 A;  2KEN A;  3X3M A;  4JI3 L;  5KIX A;  2NVT H;  2K5W A;  5IGD A;  5FLM H;  1DON A;  1ICF B;  2E2J H;  2BE5 C;  1I4P A;  5FK9 C;  2EE1 A;  3NTH A;  1B53 A;  4KD3 A;  5E4W C;  2VY3 A;  3V96 A;  4JI2 L;  1EOV A;  3I3C A;  4K2L A;  1DM0 B;  1FJG L;  1KDC A;  3PCO B;  3GTJ H;  1DOK A;  4K6D A;  2PQA A;  3H3V H;  3DLL A;  1A3V A;  3RN2 A;  3AFQ A;  4MTN A;  1I4H A;  4P73 A;  3G4S A;  3A5U A;  1LYL A;  1I3Q H;  3D31 A;  4ZKB B;  1ONL A;  3GTP H;  3NQI A;  4NB3 A;  4R4C A;  3L2P A;  1PFB A;  2EXD A;  2QEJ C;  5BR8 Q;  1HPC A;  4DNT B;  4A3D B;  2EY1 A;  4RKL A;  4HJ5 A;  2E2H B;  4G4K A;  5LHY 1;  2X6L A;  4GLA C;  1VQC A;  4C3J G;  1HNW L;  2F0S A;  1N34 L;  3NEN A;  2UUA Q;  4C3I B;  3R8B A;  2VZA A;  1CZW A;  2MUY A;  1QWY A;  1QJO A;  2WKC A;  1D2B A;  2BDO A;  4LF6 L;  4DR6 L;  3U58 A;  5C3E H;  4GZY C;  2IY5 B;  3K5M A;  2OWO A;  4IUP A;  4JI6 Q;  2MO1 A;  1F77 A;  3SHL A;  2AHO B;  3G48 A;  4A3K G;  1HR0 L;  1WFQ A;  3TEH B;  1HCZ A;  2YTX A;  4C3H G;  2JA6 B;  3VA5 A;  3LWE A;  3MEH A;  1ILP A;  3K5O A;  3QG1 A;  4R4O A;  2Q8R E;  4JI8 Q;  2VXW A;  1A2U A;  4A3J G;  3H3V I;  2L12 A;  2SNM A;  4HMI A;  3D6W A;  3M9B A;  2JE6 I;  4G7H C;  1EY4 A;  5EJW A;  1B70 B;  5FJ8 G;  3QOL A;  4TKO B;  4A3M G;  4ZCK A;  4QF4 A;  2K5Q A;  2QA4 A;  1XWE A;  4M1U B;  4GOP A;  1CI3 M;  2UUC L;  1STG A;  4LUZ A;  4JI1 Q;  2D9U A;  4CDE C;  3TP8 A;  1PH1 A;  3D4R A;  1CK1 A;  2Q2U A;  3E0E A;  2PI2 E;  3AQQ A;  1T5X D;  2JA7 H;  1Y1V H;  2HUG A;  3MEF A;  3U4Z A;  1FYC A;  1Q86 C;  4XXE A;  3OW7 A;  1TII D;  4FF3 A;  2R93 H;  3PUY A;  2AQ1 B;  4A3I B;  3HG9 A;  1MKH A;  2XVS A;  2RHS B;  4AIM A;  1U4R A;  3PGZ A;  4JI5 Q;  1YJ9 A;  4R4T A;  4DV7 L;  1NCV A;  1G8Z D;  2K4K A;  5I4D A;  3QB3 A;  2K03 A;  4LF9 Q;  1WTX A;  3L7Z C;  4RA8 A;  2JA5 H;  4LF5 Q;  2ICI A;  3J7A V;  5IYD G;  2DGY A;  3E9I A;  3MXN B;  1AW7 A;  1BR9 A;  3KDF B;  5JJZ A;  4JV5 Q;  5JPM C;  4DXG A;  1Y8N B;  1V8Q A;  3CU7 A;  2K04 A;  4X65 Q;  3EFX D;  2QDB A;  2KJX A;  2D2C C;  1JE4 A;  1F2Y A;  2UU9 Q;  2JK8 A;  2KBN A;  4F88 A;  2D0O A;  3OOC A;  3STB C;  2VUM G;  2M9V A;  2FJ2 A;  1K8O A;  1EIF A;  4JVZ A;  5LL6 S;  1H9M A;  4Y7N B;  2G9H D;  4CGY B;  2EY5 A;  5KND A;  4DNI A;  4IPG A;  3KFU A;  2HQE A;  5JJL A;  1K28 A;  2DY7 A;  1LM0 A;  1A62 A;  3J7Y W;  4K0K L;  5JEA H;  1KQS A;  2E2H H;  1GUN A;  1EYC A;  2LSS A;  4BY7 H;  3NEM A;  4CJ1 B;  2EJM A;  4C3I H;  1N32 Q;  1U4L A;  3S14 B;  1HZA A;  1HQR D;  3AFP A;  4DN4 M;  2KHJ A;  1ENA A;  4DR4 Q;  3W5O A;  2IJ0 A;  1FNV A;  1U4M A;  2NUC A;  2MGS A;  5IGF A;  3BVG A;  4KV6 A;  5JEA J;  2RCN A;  3GTG H;  1YHB A;  4FDB A;  4JK1 C;  4GN4 B;  1G91 A;  1Q46 A;  5IGG A;  1DCZ A;  4LFB Q;  2K5N A;  1QB5 D;  4FF1 A;  4B3T L;  4A3L H;  1XNQ L;  3M7N A;  1GO3 E;  4DV0 L;  2HD3 A;  4LF8 Q;  1Z9F A;  1NSN S;  1ZYR C;  2EXZ A;  3PUW A;  2WAC A;  4EGV A;  5FOB B;  1HFG A;  1SE4 A;  2WB1 B;  4IZ8 A;  5C4J H;  1I94 L;  1Y1W H;  1SYG A;  3S17 H;  4XT1 B;  1R9T H;  1ESF A;  1W3S A;  3M85 A;  4B3S L;  1KIX A;  5GAE C;  2R7Z B;  1NNX A;  2XWJ B;  4PQX A;  4YWM A;  5DNF A;  4A3G H;  4DPG A;  4YY3 L;  1EFI D;  4ABN A;  1VQD A;  4DV1 Q;  3JAM L;  4DR2 Q;  1G2S A;  5I6W A;  2KOL A;  4X62 L;  3S1M B;  3PO3 B;  4LWC A;  1ILQ A;  1IW7 D;  1U9R A;  2B8F A;  2KCT A;  3PIO 3;  1N36 Q;  3VDY A;  3R93 A;  1B3A A;  1QOH A;  3G6E A;  5C6A A;  4A3M B;  2E5L L;  1WD1 A;  4IFD H;  4BXX H;  1XYI A;  4QUF A;  5IYB G;  1BCP F;  4A3I H;  4U67 3;  1V43 A;  1HQM C;  1OO9 B;  4H44 C;  1O7Y A;  4A75 A;  4DV2 Q;  4DR3 Q;  3G6J B;  5BN4 A;  5C3W A;  5IT9 E;  5M5Y B;  4KLK A;  2KEC A;  1EOT A;  3CQZ B;  3OIQ A;  2A68 C;  2E8G A;  2IX0 A;  3P75 A;  1QG7 A;  3A8J E;  1X54 A;  1QUQ B;  4NXN Q;  3CMA A;  2A6E D;  5C0X I;  5LMN W;  4A93 G;  3MA2 B;  3OWE B;  1D1I A;  1G51 A;  1E7Z A;  2HDL A;  1PTO D;  4KY5 A;  5CR3 A;  4BY1 H;  4PZ8 A;  5EGT A;  1E22 A;  2KHS A;  3E9H A;  2ZJQ A;  2PMZ E;  2L0C A;  1DYQ A;  1F2Z A;  3S15 B;  3PUZ A;  4PZ6 A;  3HOX H;  1OXX K;  3VYS A;  3S16 B;  4JYA Q;  1KDA A;  4DR5 Q;  3K8A A;  2F0G A;  1B44 D;  3H15 A;  4IO9 A;  1E1T A;  4AYB E;  2N49 A;  2GVB A;  3UI2 A;  3DMU A;  1YHA A;  4DV4 Q;  4RGT A;  4HSP A;  3RLF A;  4V0B A;  3NE5 B;  3TN2 A;  2D5D A;  2NVY H;  3MFY A;  1U0L A;  3WWV A;  2UXB Q;  1K73 C;  1V9P A;  3GV6 A;  4RHS A;  2E75 C;  3I2Z A;  3I90 A;  3DM3 A;  2IHE A;  3PUX A;  1CKN B;  2ZT9 C;  2UUB L;  2F0T A;  1BXT A;  1XMQ L;  3PIP A;  5HGQ A;  3NK9 A;  1FGB D;  4DUY Q;  3CXC A;  2B2Y C;  1MI2 A;  2OTJ A;  1E2Z A;  1H95 A;  1GHK A;  2B2T A;  2KA7 A;  4N9P A;  1G29 1;  4FF2 A;  1STY A;  2HIX A;  1CFM A;  1V1P A;  4OWX B;  4C3J H;  2ZJP A;  3KBX A;  3CC4 A;  2F0J A;  3MXN A;  1XNR Q;  1SDF A;  1Q12 A;  4CJ2 C;  1FR3 A;  1XMO L;  5DAU A;  1PXU A;  1TS3 A;  2VQE Q;  3FKI B;  3A0J A;  4LMQ D;  1FJG Q;  1ASZ A;  1SR3 A;  2K6A A;  3HKZ E;  1TWA H;  3AU7 A;  1K8A C;  4A3K H;  1S5F D;  2MQH A;  4G57 A;  5NUC A;  1E24 A;  4DAM A;  1RIP A;  2A69 D;  1DOM A;  3S1Q B;  2CW0 C;  3BZC A;  3ERO A;  4C3H H;  1LTB D;  1F9R A;  4QIW E;  1NAP A;  3MTS A;  1GUT A;  1EEI D;  2QIL A;  3A55 A;  4A3J H;  1HZB A;  1EY6 A;  1PTO H;  3PO3 H;  1I50 H;  3KF8 B;  3HOU B;  3J7A F;  2KCC A;  5CV7 A;  2JSO A;  2XTI A;  2HCI A;  2M2L A;  2GN5 A;  1HNW Q;  3NBH A;  4A3F B;  4A3M H;  3MXG A;  1IZ6 A;  1WTP A;  3FP9 A;  4N9T A;  2R92 G;  1NR2 A;  1JJC B;  1GOZ A;  1SSO A;  4DR6 Q;  4DF7 A;  1Y1V G;  3SXH A;  1YIT A;  2AWO A;  1VQ5 A;  2LFN A;  1X3Q A;  2R93 G;  3MHB A;  2OQ0 A;  4OEM B;  1HR0 Q;  2B3G A;  4DKA C;  5C4Z A;  1VQ8 A;  4HSV A;  1YNX A;  1KNA A;  4UPA A;  5EKK A;  1L1O B;  3DEO A;  1LTA D;  3DWQ A;  3HKZ G;  4XTC S;  3ULL A;  2EZV A;  2AKW B;  2I07 B;  4J15 A;  3BVZ A;  1IBM L;  2JA5 G;  1V1Q A;  3TQY A;  3MZ5 A;  2HHH L;  4ZK9 B;  1VQ9 A;  4HJ7 A;  5ELD A;  2F0V A;  2ICE C;  3C3L A;  4GKJ L;  3I4N B;  5IWA Q;  2KCN A;  3U9S A;  3ERQ A;  2F0L A;  3WDN A;  5I9O A;  3OMC A;  1UEB A;  4ID6 A;  4HMJ A;  3VYT A;  4DV3 L;  2K52 A;  3CRL C;  1KC8 C;  1PH9 A;  1MJE A;  1TWC B;  2B63 B;  1HHV A;  4N8X 1;  1RTO A;  3SVM A;  5JVG 3;  3QIA A;  2VUM H;  4ME3 A;  1WTO A;  3S2H B;  2A8V A;  1K8M A;  1EZ6 A;  1VQ6 A;  2EYH A;  2PW5 A;  2F0N A;  3T16 A;  1VQP A;  1NBW A;  1H9S A;  2GVA A;  2RVL A;  4IAL A;  4B9W A;  1IBL L;  3R3O A;  1C48 A;  4RKB A;  1BCP C;  4X3T A;  2V1C C;  4BBR B;  2FMM A;  1BF4 A;  4DV7 Q;  2JYO A;  5JEA G;  4A3D G;  2O5I C;  1C7Y A;  5KYL A;  1LT5 D;  5CV4 A;  3KLW A;  3ULJ A;  3C46 A;  2EOT A;  1LT6 D;  1S4Z A;  3IRB A;  3VR5 A;  3I4M B;  1FNU A;  2KHI A;  3I91 A;  5CBE E;  3V2T A;  3OW2 A;  2WKD A;  2NWG A;  3UDG A;  3QO2 A;  2Q8I B;  3TS2 A;  1CA5 A;  4JPB W;  2XSC A;  1C8C A;  2IX1 A;  2Z6K A;  3OIP A;  2NZ1 D;  2YU9 H; 
#chains in the Genus database with same CATH homology
 4DUZ L;  5IT9 c;  3CCS A;  4AYB G;  1PHJ A;  2Z0S A;  5DLQ E;  4HJA A;  4LF6 L;  4DR6 L;  5AJ3 Q;  2EIF A;  3U58 A;  5C3E H;  4B3R L;  2JA6 G;  1YVC A;  2R7Z H;  3GD7 A;  4WJ4 A;  3HOV G;  2VW9 A;  1PYS B;  2IY5 B;  1G6P A;  3EBE A;  1JJG A;  2OWO A;  2HIV A;  4JI6 Q;  4JI1 L;  2MO1 A;  4OX9 Q;  1MJC A;  2AHO B;  3CW2 C;  3G48 A;  5GAG C;  4A3K G;  5IP9 H;  2RHQ B;  1WFQ A;  1HR0 L;  1OTC A;  1VQE A;  1IYJ B;  2ATW A;  4K0K Q;  1N33 L;  3TEH B;  3S1M H;  2YTX A;  3HOU H;  2R7F A;  1TXY A;  3TRZ A;  3RZO H;  4YHH L;  1HNZ L;  4R4O A;  4JI8 Q;  4L5Q A;  4BBS H;  3H3V I;  4A3J G;  1DGS A;  3KYH C;  4DV5 Q;  4DV6 L;  1N34 Q;  1K9M C;  1HR0 W;  3M9B A;  4RMF A;  2JE6 I;  3UDX A;  2K50 A;  1O7I A;  4DUZ Q;  1B70 B;  2ALY B;  5FJ8 G;  1VQA A;  4QGU A;  1VQ7 A;  2ZTD A;  1T9H A;  4A3M G;  4LF6 Q;  4DR7 L;  4LFC L;  3CCQ A;  2QA4 A;  2N8N A;  2UUC L;  4GOP A;  1PH4 A;  1L2F A;  1SE8 A;  3K81 C;  1XNQ Q;  4DV0 Q;  1SMX A;  1PH2 A;  2CWA A;  4LUZ A;  4JI1 Q;  5K36 G;  2Y0S G;  1X56 A;  4OXP A;  5M5Y H;  1PH1 A;  5IYB H;  3KOJ A;  4HIM A;  1UE1 A;  4X66 L;  4IOA A;  3CQZ H;  2Q2U A;  2N78 A;  3E0E A;  2PI2 E;  1FL0 A;  1JB7 A;  4JV5 L;  4DR1 L;  3AQQ A;  2JA7 H;  1Y1V H;  4TVA B;  3MEF A;  2WAQ E;  4UP8 A;  3U4Z A;  4X65 L;  3CCU A;  1Q86 C;  1Z47 A;  2Q2H A;  1HNZ Q;  4IPH A;  1NMG A;  4JBJ A;  2UU9 L;  2R93 H;  3W1G A;  3PUY A;  4EX5 A;  2QGQ A;  2HT1 A;  1MKH A;  2PQA B;  2CQO A;  4B3S Q;  2RHS B;  4LFA L;  1YEZ A;  4AIM A;  3PGZ A;  3S15 H;  4YY3 Q;  1TWG H;  3PUV A;  4JI5 Q;  1YJ9 A;  4DR7 Q;  4R4T A;  3S16 H;  5C44 G;  4DV7 L;  4IFD J;  1PYB A;  2LXK A;  4RG1 A;  4YCW A;  4AQY L;  1J5E Q;  2K4K A;  1SN8 A;  3HFZ B;  1UE7 A;  2UUC Q;  1CKO A;  4QQB X;  4C2M H;  3TRE A;  4X62 Q;  4LF9 Q;  3L7Z C;  4PZ7 A;  2JA5 H;  4LF5 Q;  5IYD G;  2DGY A;  1X65 A;  3E9I A;  3MXN B;  2I5L X;  3KDF B;  2F52 A;  2ZTE A;  4JG2 A;  5HY6 A;  3I56 A;  4GNX C;  4A76 A;  3T1H Q;  4JV5 Q;  1TWF H;  3T1Y L;  2E5L Q;  4X65 Q;  2WP8 J;  4DK6 C;  4B3M L;  5EAY A;  1U5K A;  2H5X A;  1EIY B;  1YIJ A;  3I4O A;  2UU9 Q;  2FXQ A;  2F4V L;  2ES2 A;  2JK8 A;  3FHW A;  3ZJY C;  3U4V A;  1VQJ A;  4QL5 A;  3HOY H;  4L5R C;  3RLO A;  1HZC A;  2KBN A;  5J3B A;  4DK3 C;  1EQQ A;  5FLM G;  2D0O A;  4KHP L;  3STB C;  3F2B A;  1YJW A;  2OCE A;  4HIK A;  2VUM G;  4DR4 L;  1C0A A;  1N8R C;  1I5F A;  4P71 A;  5LMN Q;  1LUZ A;  3JC6 6;  1EIF A;  3S1R H;  1B8A A;  4A3B H;  4HJ8 A;  4OON A;  1KAW A;  1VCI A;  2IT1 A;  2I0Q A;  4X64 L;  5AJ3 L;  1GM5 A;  3HOZ H;  3H0G G;  1Q8K A;  4DNI A;  1EFW A;  4IFD I;  2AWN A;  3ER0 A;  1EQR A;  4IPG A;  3KFU A;  3CCL A;  4GKK Q;  5JJL A;  1XTD A;  1X6O A;  1HH2 P;  4JI6 L;  4L5T A;  3S24 A;  4OX9 L;  1LM0 A;  2QEX A;  1HZ9 A;  2VL6 A;  1A62 A;  3A5Z B;  3F8T A;  1QUQ A;  1KXL A;  4K0K L;  3I7F A;  3PSI A;  4KI0 A;  4IPC A;  2CWP A;  1VQ4 A;  1KQS A;  1VQB A;  2E2H H;  2MO0 A;  3EN2 A;  2LSS A;  2F4V Q;  4BY7 H;  1SLJ A;  4JI8 L;  3NEM A;  5IP7 H;  2ASB A;  4C3I H;  1N32 Q;  4DV5 L;  1HZA A;  1IXR A;  3AFP A;  3FKI H;  5M3M G;  4A3C G;  2KHJ A;  4P74 A;  3ICE A;  2VNU D;  3KJP A;  4DR4 Q;  3W5O A;  3RNU A;  4QJF A;  4GOP B;  1X3G A;  4A3E G;  5JEA J;  2RCN A;  2WB1 G;  2K75 A;  5ELO A;  1YHB A;  4X64 Q;  4HID A;  3GTG H;  4FDB A;  3D0F A;  4GN4 B;  1Q46 A;  4LFB Q;  2K5N A;  4DR2 L;  3CCV A;  3S1Q H;  4B3T L;  1OXU A;  4A3L H;  1XNQ L;  3M7N A;  1GO3 E;  4DV0 L;  5C0X G;  1K8G A;  4KHZ A;  4LF8 Q;  4POF A;  1Z9F A;  1Q82 C;  4HIO A;  2I5M X;  4PMW A;  5C3E G;  3ERS X;  2BH2 A;  3GDE A;  3PUW A;  2R7Z G;  1L1O C;  5C4J H;  2OTL A;  1I94 L;  4GS3 A;  1QVG A;  1Y1W H;  2NN6 G;  3CP0 A;  2UUB Q;  1XMQ Q;  3HOV H;  3PO2 G;  4NPS A;  1EYG A;  3S17 H;  3SGI A;  2R7D A;  4LUO A;  1HNX Q;  1CKN A;  1GD7 A;  2PI2 A;  3UDI A;  1A8V A;  4A3F H;  3PO3 G;  2ZM6 Q;  1R9T H;  1YZ6 A;  3RZD H;  1W3S A;  2JJQ A;  3M85 A;  4B3S L;  1KIX A;  5GAE C;  4YWM A;  1K3R A;  4YWL A;  3J81 j;  4A3G H;  4DPG A;  4JI7 Q;  2C35 B;  4YY3 L;  1KRS A;  4OWW B;  2A19 A;  3S2D H;  3PIO A;  4JI5 L;  4DR3 L;  1VQD A;  3RLN A;  4DV1 Q;  1A0I A;  1TWH H;  2UXD Q;  1J5E L;  4DR2 Q;  1XPU A;  4R4I A;  5JJI A;  4X62 L;  2WFW A;  4B3T Q;  4LWC A;  4LF9 L;  4LF5 L;  1SFO H;  2KCT A;  3STB D;  4R1J A;  1N36 Q;  3CC2 A;  2R92 H;  1XMO Q;  3CF5 A;  2UXC Q;  1EUJ A;  5FJ8 H;  3VDY A;  3T1H L;  1B7Y B;  1BVS A;  1K83 H;  2L15 A;  3JAM i;  1XJV A;  4POG A;  3G6E A;  1I94 Q;  2E5L L;  4BXX H;  2BA0 A;  2D62 A;  3CCR A;  5IYB G;  4OO1 I;  1NMF A;  5M5W H;  4A3I H;  2B29 A;  3CPF A;  2BH8 A;  1V43 A;  2NVQ H;  1P16 A;  1W2B A;  1KHI A;  2JA7 G;  1AE2 A;  4A75 A;  4DR5 L;  3CCM A;  4DV2 Q;  1D8L A;  1ASY A;  1KL9 A;  4YCV A;  4OWT B;  5LMN L;  4JI4 Q;  1PH6 A;  4DR3 Q;  5IE8 A;  2K5V A;  4KLK A;  2K14 A;  3I4N H;  5GAH C;  3GTK H;  2HQL A;  3CC7 A;  1XPO A;  3GTM H;  2E8G A;  2IX0 A;  1VQM A;  3CME A;  1X54 A;  1QUQ B;  4GKK L;  4JCV E;  1BBU A;  5C4X H;  2KCM A;  1VS0 A;  3CMA A;  1S40 A;  4NXN Q;  5C0X I;  5LMN W;  4A93 G;  1JT8 A;  5GAD C;  1TWC H;  1G51 A;  1E7Z A;  1X55 A;  2B63 H;  1CSP A;  1NE3 A;  4BY1 H;  4PZ8 A;  1PH7 A;  1E22 A;  3E9H A;  4H02 A;  1VQL A;  2ZJQ A;  1PH5 A;  3S2H H;  1OXT A;  5ELN A;  1A63 A;  2PMZ E;  3PUZ A;  4PZ6 A;  3HOX H;  1UE5 A;  3TS0 A;  1OXX K;  4P72 A;  4Y52 H;  4BA2 I;  4DUY L;  4LF7 Q;  5IYD H;  5IYC H;  4NXM L;  4JYA Q;  1N32 L;  3KF6 A;  4GN5 A;  4JBW A;  4GOP C;  4DR5 Q;  3K8A A;  3NEL A;  4IO9 A;  3H15 A;  1WCM H;  1E1T A;  2MFI A;  1YJN A;  4BBR H;  3M4P A;  3HOY G;  4APV A;  4AYB E;  2N49 A;  2GVB A;  2OQK A;  1QVF A;  1YHA A;  3J7Z C;  4DV4 Q;  1YI2 A;  4LFB L;  3RLF A;  2WAQ G;  3A74 A;  2VQF Q;  1XNR L;  2JA8 H;  2NVY H;  4X6A H;  3EIV A;  4LF4 Q;  2JQO A;  4A3B G;  1CUK A;  1D7Q A;  3KJO A;  2N3S A;  4AH6 A;  4LF8 L;  1U0L A;  1WOC A;  3WWV A;  2UXB Q;  3I4M H;  4L5S A;  1UWV A;  1K73 C;  4WJ3 M;  1L1O A;  1V9P A;  4YCU A;  1L0W A;  1IBM Q;  3I2Z A;  2VQE L;  4A3D H;  3DM3 A;  2IHE A;  4QY7 A;  3UE1 A;  3H0G H;  1CKN B;  3PUX A;  4DAY B;  2HHH Q;  2UUB L;  1XMQ L;  2IHF A;  3CAM A;  5HGQ A;  3PIP A;  3F2D A;  1WJJ A;  3ULP A;  1HNX L;  3HOW H;  4DUY Q;  3AYH B;  3CXC A;  4NXM Q;  4GKJ Q;  2CCZ A;  3OTO Q;  5M3F G;  2OTJ A;  2ZM6 L;  1YHQ A;  1Q81 C;  4JOI C;  4HJ9 A;  1NJI C;  1H95 A;  2CKZ B;  2Q2T A;  4BY7 G;  1OXV A;  4JI7 L;  2AMC B;  5IP7 G;  1VQO A;  1G29 1;  4P75 A;  3W1B A;  3RN5 A;  1PH3 A;  1I6H H;  2EQS A;  3GTQ H;  4DV3 Q;  4UP7 A;  2HIX A;  1CKM A;  3FKI G;  1WYD A;  2ZJR A;  4OWX B;  4C3J H;  2ZJP A;  4DV1 L;  1Q1B A;  3JAM c;  4TQU S;  1QVC A;  3F2C A;  2UXD L;  3CC4 A;  5H1S E;  3BU2 A;  1XNR Q;  2F3I A;  1Q12 A;  3G71 A;  1QZH A;  2Y0S E;  4PG3 A;  1PFS A;  1N36 L;  1BBW A;  1XMO L;  2UXC L;  1VQN A;  2BA1 A;  1IBL Q;  2VQE Q;  3CCE A;  2K5H A;  4O0A A;  1PH8 A;  3A0J A;  1FJG Q;  2JA6 H;  1ASZ A;  4A3L G;  4O2D A;  2DUD A;  1M90 C;  1SR3 A;  2JEB I;  4MZ9 A;  1JE5 A;  2Q2I A;  1KRT A;  3F1Z A;  4JI0 Q;  3HKZ E;  5IP9 G;  1TWA H;  3M3Y H;  1UE6 A;  1X3F A;  1K8A C;  4XIG S;  4A3K H;  1E1O A;  2MQH A;  4DAM A;  3HOU G;  1E24 A;  4IJL A;  1AE3 A;  1RIP A;  4BA1 I;  1Y1W G;  4DV2 L;  1BKB A;  1N9W A;  3BZC A;  4C3H H;  5M5X H;  2NVX H;  1PV4 A;  4QIW E;  4BBS G;  1E3P A;  3PO2 H;  1VQI A;  4JI4 L;  4LUV A;  4A3F G;  3CPW A;  2JEA I;  4A3J H;  1HZB A;  3HKS A;  2ZTC A;  3PO3 H;  4A3G G;  1I50 H;  3KF8 B;  3GTO H;  4LNQ A;  2YYZ A;  5C0X J;  1MIU A;  2XTI A;  3LGJ A;  5GQO A;  4MNO A;  4NXN L;  2GN5 A;  1HNW Q;  1JMC A;  1RL2 A;  3J81 i;  4GNX A;  4A3M H;  2YTY A;  3K7U C;  1IZ6 A;  2Z6K C;  3FP9 A;  2R92 G;  3KF6 B;  3I55 A;  1IBK L;  4JBM A;  1JJC B;  2I5H A;  2LXJ A;  2RF4 A;  1KD1 C;  4DR6 Q;  2MNA A;  4JC0 A;  4B3R Q;  4LF7 L;  4IFD G;  1VQF A;  1Y1V G;  1WI5 A;  2JA9 A;  5IWA L;  1YIT A;  4JYA L;  2AWO A;  4BXX G;  3AEV A;  1VQ5 A;  1PVO A;  4UP9 A;  3CCJ A;  2R93 G;  4A3I G;  2OQ0 A;  5LMU L;  1HR0 Q;  1J6Q A;  2B3G A;  1NTG A;  4DKA C;  3GTL H;  3RR5 A;  1N33 Q;  1VQ8 A;  4DV4 L;  3CD6 A;  1LTL A;  1VQG A;  4GN3 B;  4UY8 C;  1YNX A;  2NZH A;  4UPA A;  2ID0 A;  2VQF L;  4YHH Q;  1XPR A;  1S72 A;  2YV5 A;  5JJK A;  4LF4 L;  1L1O B;  4GLV B;  2R6G A;  1JJ2 A;  3HKZ G;  3I4N G;  4XTC S;  1P8L A;  2D0P A;  3ULL A;  4IPD A;  2UXB L;  4DV6 Q;  2AKW B;  3S1N H;  3BZK A;  4J15 A;  3U50 C;  5C44 H;  2PNH A;  1IBM L;  2JA5 G;  1V1Q A;  3J80 c;  3TQY A;  1OXS C;  3K80 C;  2HHH L;  5C4X G;  1VQ9 A;  1IBK Q;  1SRO A;  4HJ7 A;  4YWK A;  2NN6 I;  1CSQ A;  4ALP A;  1M1K C;  4LFC Q;  2B63 G;  4GKJ L;  4GLX A;  4A93 H;  5IWA Q;  3OTO L;  4BY1 G;  1HJP A;  3UDF A;  1FGU A;  4JOI A;  1SRU A;  2CFM A;  3B6Y A;  3M4O H;  1VQH A;  1EWI A;  1AH9 A;  3Q8D A;  1UEB A;  2YTV A;  3HOX G;  1GKH A;  4Y7N H;  5LMU Q;  5IYC G;  4X66 Q;  2WB1 E;  1Y14 B;  4DV3 L;  2K52 A;  1IL2 A;  3PF4 A;  2KEN A;  1GVP A;  1KC8 C;  4DR1 Q;  1PH9 A;  5GRO A;  5BR8 L;  1YBY A;  2NZO A;  4JI3 L;  1WCM G;  1MJE A;  2NVT H;  3K0X A;  1VQK A;  5FLM H;  4BBR G;  3K7A H;  5E7N A;  2E2J H;  2VUM H;  4ME3 A;  2A8V A;  4EQ5 A;  1VQ6 A;  1X3E A;  3GO5 A;  3HOZ G;  1VQP A;  4A4I A;  2UUA L;  1NBW A;  1Q1E A;  2GVA A;  2VY3 A;  4IJH A;  4LFA Q;  1IBL L;  4JI2 L;  1EOV A;  2A1A A;  2JA8 G;  3UE0 A;  1FJG L;  3PCO B;  4IOC A;  4JI0 L;  3GTJ H;  2V1C C;  2PQA A;  3BJU A;  5IY0 A;  3DLL A;  3H3V H;  3I4M G;  2XGT A;  4DV7 Q;  3S14 H;  5JEA G;  4AQY Q;  4A3D G;  1FVI A;  3M4Q A;  2E2I H;  3L0O A;  1C7Y A;  3RN2 A;  1QZG A;  3J80 i;  3AFQ A;  4MTN A;  1NY4 A;  4P73 A;  3G4S A;  3KLW A;  1K0R A;  1LYL A;  1I3Q H;  3D31 A;  3ULJ A;  3A5U A;  3HOW G;  2VS1 A;  3GTP H;  3IRB A;  3J81 c;  4NB3 A;  4R4C A;  3L2P A;  1S3O A;  1C9O A;  2EXD A;  2KHI A;  4R4Q A;  5BR8 Q;  3T1Y Q;  1X9N A;  5M3F H;  4JI3 Q;  5M3M H;  3NBH B;  4B3M Q;  4A3C H;  3KDF A;  3J7A 5;  3OW2 A;  3PV0 A;  4OO1 G;  4GNX B;  4HJ5 A;  4GLA C;  3UDG A;  1VQC A;  4LW1 A;  1Q7Y C;  1HNW L;  4A3E H;  3TS2 A;  1N34 L;  3NEN A;  2UUA Q;  5FLX c;  4JI2 Q;  3PF5 A;  4KHP Q;  2VZA A;  2IX1 A;  2Z6K A;  3OYY A;  4JBK A;  1PA6 A;  2YU9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...