1VQGA

Gene v protein mutant with ile 47 replaced by leu 47 (i47l)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKLTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
publication title Potential use of additivity of mutational effects in simplifying protein engineering.
pubmed doi rcsb
source organism Enterobacteria phage f1
total genus 9
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqgA00
1Y1VH 2IT1A 2YTXA 4IJLA 1E3PA 2RCNA 1JJGA 4LUVA 4JOIC 4POFA 3B6YA 2NVQH 1L1OC 4UP9A 3G6EA 1WFQA 4A4IA 2MNAA 1XMOQ 4JI8L 4QQBX 2UXBL 4KI0A 3OW2A 3F1ZA 1NMGA 2JEBI 3W5OA 2RHQB 4LNQA 1HR0L 3S1RH 3GTPH 2KENA 1TWCH 3H0GH 3J7ZC 2CQOA 3KDFB 3KYHC 3OTOL 1J5EL 3J7A5 1K0RA 4DPGA 4BXXH 4GKKQ 5IE8A 3RR5A 4EQ5A 1EWIA 2RF4A 4Y52H 4BBSG 1CUKA 1Q1BA 4DR5Q 3I4NG 3CP0A 1GKHA 2UXCL 5LMNW 4DR6Q 1KAWA 2R7DA 1BKBA 4IPHA 3S1QH 1XJVA 2JE6I 4A3BH 3A5ZB 1VQOA 4POGA 5K36G 4JI5Q 3I2ZA 3F2CA 2KCTA 5JEAJ 2CFMA 4DV4Q 1XPUA 3HOWH 1H95A 1PH3A 1GM5A 1IBLQ 1N8RC 1OXUA 2YTVA 1B70B 1L1OB 1UWVA 5FLMH 1VQ4A 4HJ9A 3GD7A 4X66L 4B3SL 2ES2A 4A3LG 4YY3L 3UDGA 1VQFA 4C3HH 4O2DA 4BY7G 1V9PA 1XPOA 1YJNA 1XNRQ 1MJCA 1D8LA 1CSQA 3F8TA 1XPRA 3GTOH 3EBEA 4DUZQ 3A5UA 3AQQA 1VQIA 2LSSA 4IOAA 5C44H 4UP7A 2ZTCA 3F2DA 4GKJL 3S16H 2A19A 2BA1A 3CW2C 4DAMA 2N3SA 2VQEL 4DV2L 1VQEA 4LFCL 2K52A 4LF8L 5LMUQ 4A93H 2WB1E 3FHWA 3LGJA 1P16A 2EIFA 2KBNA 1WCMG 5C3EG 5FLXc 3M85A 1LTLA 1VQDA 5C0XG 1NBWA 4LWCA 1C0AA 1JJ2A 4OXPA 2UU9L 2F3IA 1SRUA 4JI7L 4OO1G 5JJIA 4GLVB 5LMNL 4PZ7A 1J6QA 2ZM6Q 4LF6L 3PIOA 4X62L 4X64Q 2QA4A 1SMXA 4L5TA 3ULPA 2Z0SA 1KL9A 4LFAQ 1C9OA 4JCVE 1N34Q 1XNQQ 5C0XI 4MNOA 4A3EH 4H02A 3GTQH 1I3QH 2LXKA 5IYBH 2V1CC 1OXTA 2DGYA 3CMEA 4HJ7A 4B3TQ 4LF5L 1PH6A 3L7ZC 2JA7H 4X6AH 4AQYL 2LXJA 3MEFA 4GOPC 4JI3Q 1HZ9A 4NB3A 1TWFH 2BH8A 3TREA 4KHPQ 1Y1WG 1MIUA 1VQ7A 3JC66 3CC2A 4DUYL 1WI5A 4AH6A 5H1SE 2IHFA 1ASYA 3GO5A 1HR0W 4LFBL 2KCMA 1E1OA 3VDYA 2R93H 4C2MH 4DV0Q 4UPAA 4NPSA 1YBYA 4DV5Q 1PV4A 1YJ9A 1EUJA 4LF9Q 1MKHA 1VQKA 2Q2TA 4NXMQ 3PV0A 1QZHA 2R7ZG 5IYCG 1X9NA 1HNWL 4DR3Q 5IYDH 1A63A 4JI0Q 5M5YH 4P73A 3UE1A 1HH2P 2EXDA 4DR1Q 4PZ6A 1UE5A 1PYBA 2NZHA 4EX5A 4HIOA 2UXBQ 2I5MX 1HZAA 2GN5A 3W1GA 2Z6KA 1S72A 2D62A 3G4SA 4TQUS 1VS0A 4RMFA 3K8AA 2K4KA 1PVOA 2ZJQA 4OWWB 1N32L 5M3FG 4GNXC 3U50C 3CD6A 3CCLA 1OXSC 3OTOQ 4R1JA 4KHZA 1N9WA 4NXNQ 4BBSH 3I4NH 3FKIG 2OCEA 3SGIA 1EYGA 1N33L 4B3RL 2UXCQ 3RN2A 3I55A 2YU9H 5M5XH 3KDFA 2C35B 4Y7NH 3S14H 2VS1A 3PUXA 4DV3Q 2CKZB 1YITA 1YI2A 2UUAL 1VCIA 2BH2A 3A0JA 3BZCA 2PI2A 5GAEC 3G71A 1M90C 3EN2A 3HOVG 3ULLA 2CCZA 1Q7YC 4UY8C 2EQSA 1WOCA 3CF5A 2UUBL 5DLQE 1QUQB 2D0OA 3WWVA 4A3MG 4JV5L 4A3LH 4DKAC 5M5WH 4X66Q 3HOYG 3HOUG 1E22A 4JI6L 3RZDH 3HFZB 4DV6L 4BY7H 3AFQA 4JOIA 3PF5A 1PH7A 4GNXB 3RZOH 2ALYB 3ER0A 4DV7L 2D0PA 1IBKQ 1JJCB 2PQAB 3CCSA 3CAMA 3PSIA 1HNXL 1OXVA 2K5HA 2AWNA 1XTDA 2K14A 3M7NA 4WJ3M 4DV1L 1FVIA 3F2BA 2VQFQ 3Q8DA 4APVA 4DV2Q 1CKOA 4AYBG 1Q86C 2UUCL 3CCMA 3PO3G 4ALPA 4A75A 1GO3E 3HKSA 4LFCQ 5M3MG 5C3EH 5IWAL 4BY1G 4LF7L 1YHAA 3GTJH 4P72A 3A74A 1LYLA 2VY3A 1EOVA 4BBRH 4X65L 1VQ8A 4LF4L 3S24A 1PYSB 3AFPA 4DK6C 4K0KQ 4IJHA 1X56A 1U0LA 4A3CG 1HNZQ 5JEAG 5LMNQ 2ID0A 5BR8Q 2MQHA 4DK3C 2IX1A 5GAHC 4YHHL 4MTNA 1HJPA 2IX0A 4LF6Q 4B3ML 4X62Q 3E9HA 3RN5A 1PH5A 1EIYB 5IY0A 2B3GA 3TS0A 2Q2HA 1X3GA 4A3JG 5JJLA 4TVAB 3ULJA 1RL2A 2H5XA 4DR2Q 1IXRA 1QZGA 4BA2I 1I6HH 1WJJA 4AQYQ 1LM0A 4JBJA 3RNUA 3T1HQ 4DAYB 1Y1WH 1JMCA 3KF6B 4JI2L 2ASBA 2JA6G 4AIMA 3RLFA 1Q46A 2YTYA 3CCQA 1GVPA 2JQOA 2ZJPA 3U4ZA 4DR7Q 5GROA 4A3DG 3UDXA 1NY4A 3UDFA 3U58A 1KIXA 1KD1C 4GKKL 3K80C 4HJAA 4LFBQ 1YEZA 1K8AC 1JT8A 1PA6A 1Q82C 2R7ZH 2NVYH 5IYCH 2RHSB 5HY6A 5AJ3L 1Q81C 3E0EA 5ELOA 4A3FG 4QL5A 1MJEA 4QGUA 3K7UC 2F4VQ 1PH4A 2OTLA 3I7FA 2GVAA 1KRTA 2E2HH 5IT9c 4DR4L 2L15A 2PNHA 4GS3A 1WYDA 3CC7A 1S3OA 2JJQA 4GN3B 5IP9G 1X55A 4A3KG 3S2DH 3PUWA 5FJ8G 3L2PA 1IBLL 1X65A 2FXQA 1L0WA 3D31A 4OX9Q 2I5LX 3STBC 2UXDQ 1N36Q 2JA5G 1OTCA 2K50A 3J81i 1OXXK 1E7ZA 1N32Q 1FL0A 4AYBE 3PGZA 4JBMA 1K8GA 3CMAA 1VQ6A 1IBMQ 2HHHL 3FKIH 1O7IA 3I4MG 4A3GG 2Q2IA 3D0FA 2ZTDA 3I4OA 4OONA 3PF4A 2AHOB 1HZCA 1SROA 5ELNA 1QVCA 3CCEA 2QGQA 2K75A 4YCVA 3JAMi 4HJ8A 4GOPA 1YIJA 4R4CA 1EIFA 1EQRA 2E2IH 2PI2E 2WAQG 5GADC 2UUAQ 2WP8J 4P71A 4JBKA 2JK8A 4RG1A 3HOVH 3CCJA 4YCUA 3J81c 1AE2A 1TWGH 1UE1A 1X54A 2OWOA 1VQNA 2JA8G 1EQQA 4A3MH 1SE8A 1P8LA 2AMCB 4JI8Q 2MFIA 1YHQA 4R4QA 3HOYH 3I56A 1SLJA 5C4XG 1A62A 4P75A 4A93G 1HR0Q 2I5HA 2B63G 1K3RA 4DV6Q 4JI1L 3M4OH 1FGUA 2NN6I 4R4TA 3S1MH 1J5EQ 1QUQA 3NELA 1I94L 3RLOA 1M1KC 1VQJA 1Z9FA 3CCRA 1R9TH 5J3BA 4X64L 2VZAA 2HQLA 1Z47A 1A0IA 1D7QA 3EIVA 3TQYA 4P74A 4GNXA 1VQCA 5C4JH 1N34L 1B8AA 1XNQL 3PO3H 2CWPA 4A3IG 3TRZA 4JI4L 1AE3A 1I50H 5M3MH 2XTIA 3K81C 4BY1H 1E1TA 4JI3L 4LF7Q 1YJWA 3CPWA 4KHPL 1PH2A 1VQBA 4LF4Q 4X65Q 1ASZA 4A3CH 4GN4B 1CKNB 1Q12A 4B3SQ 2A8VA 1AH9A 4YY3Q 5E7NA 1YVCA 2N8NA 2MO1A 3KOJA 1L1OA 3CCVA 4C3JH 4DV0L 3BU2A 3K0XA 3H3VI 4DV5L 2R92G 4B3MQ 4OWXB 1N33Q 4IPDA 5GQOA 4A3JH 5IP7G 4NXML 3ERSX 4JI0L 4GKJQ 1VQ9A 4A76A 2HIVA 1FJGL 3HOXG 4DR1L 5IYDG 4HIDA 3GTGH 4WJ4A 3G48A 2VQEQ 4QY7A 3KJPA 1W2BA 2JA6H 3K7AH 4ME3A 2VW9A 4JYAL 1XNRL 1UE7A 4JI2Q 4LF8Q 1Q8KA 2WAQE 1WCMH 3FP9A 2Q2UA 2JEAI 3M9BA 1NJIC 4A3DH 4LUOA 4JC0A 4IPCA 1BBUA 2WFWA 4PMWA 3T1YL 1EFWA 2YYZA 1CSPA 3KF6A 1XMQL 1G291 2UU9Q 1G6PA 4JI7Q 4NXNL 1IL2A 2HIXA 2R7FA 4A3FH 3S2HH 3PO2G 1A8VA 1IYJB 3HKZG 3OYYA 5AJ3Q 2I0QA 1Y14B 1KC8C 4FDBA 4R4IA 4HIMA 3HOZG 2N49A 4YWMA 4C3IH 4DV3L 1VQ5A 2E5LL 5JJKA 3PUZA 2VUMG 3W1BA 5IP9H 4A3KH 4DR4Q 3CC4A 5FJ8H 1PHJA 4JG2A 4GN5A 3M3YH 4IPGA 3PUYA 5HGQA 4LF5Q 1LUZA 1X6OA 1Y1VG 4L5QA 3RLNA 1VQGA 2BA0A 3DLLA 2JA5H 2Y0SG 1XMOL 1V43A 3L0OA 2IHEA 1I5FA 3I4MH 1T9HA 4A3GH 3CQZH 3GDEA 3GTLH 3BJUA 4DUYQ 2HHHQ 1U5KA 1YZ6A 4MZ9A 1SN8A 1UEBA 4QIWE 1X3EA 4IO9A 3H0GG 3ICEA 4O0AA 2DUDA 1PH9A 1IBKL 1SFOH 4BXXG 4BA1I 4IFDJ 4DR5L 3TEHB 3ZJYC 4DR6L 1K9MC 5C0XJ 1KQSA 2JA8H 1HNWQ 2KHJA 1KHIA 2OQKA 1VQHA 4JI5L 2VQFL 4YWLA 1KRSA 4A3BG 4DV4L 1VQLA 5C4XH 3S17H 2VL6A 3AEVA 2OTJA 2OQ0A 4IFDG 2QEXA 2R6GA 2B63H 3HOWG 4IOCA 1RIPA 5M3FH 4QJFA 3STBD 4XIGS 1BVSA 2CWAA 3KJOA 4JI1Q 4K0KL 2K5VA 1JE5A 4BBRG 1VQMA 3PUVA 1X3FA 5FLMG 1HNZL 1UE6A 1I94Q 5BR8L 2XGTA 3PIPA 3H15A 4HIKA 2ZJRA 2ATWA 1IZ6A 1K83H 4GLXA 4B3RQ 4PG3A 4IFDI 3DM3A 4DUZL 3KLWA 2AWOA 4A3IH 2IY5B 1QVFA 2NVXH 3H3VH 3BZKA 4DR2L 3M4QA 3HKZE 4LUZA 2NN6G 3UDIA 5C44G 1PH1A 4JI4Q 4OO1I 3U4VA 1NTGA 1GD7A 1YHBA 3T1HL 1C7YA 2AKWB 4PZ8A 1VQPA 1KXLA 5LMUL 1S40A 2GVBA 2UUBQ 3IRBA 2NZOA 3HOUH 5GAGC 4DR7L 4JV5Q 3AYHB 1CKMA 4R4OA 1TXYA 2B29A 3JAMc 4JI6Q 2Y0SE 2R92H 1TWHH 2NVTH 2KHIA 2JA9A 5IP7H 4JBWA 4YCWA 4DV7Q 3GTKH 1CKNA 1DGSA 4L5RC 1HNXQ 3J80i 2ZM6L 2N78A 3CCUA 2Z6KC 4OWTB 3HOXH 2F4VL 3KFUA 1G51A 3GTMH 4GLAC 4LFAL 2K5NA 4UP8A 4J15A 1FJGQ 2A1AA 4DV1Q 1NMFA 2PQAA 1NE3A 2UUCQ 1K73C 4B3TL 4A3EG 1VQAA 1JB7A 3TS2A 1Q1EA 3UE0A 5IYBG 1PH8A 2PMZE 4L5SA 4OX9L 4JYAQ 2UXDL 1YNXA 4LW1A 1N36L 5IWAQ 1E24A 4DNIA 1B7YB 3NBHB 2E2JH 2YV5A 2MO0A 2JA7G 1L2FA 4GOPB 3KF8B 4YWKA 3NENA 1V1QA 3T1YQ 1IBML 3J80c 1XMQQ 3CXCA 5EAYA 3PO2H 3NEMA 3J81j 3S1NH 1HZBA 1PFSA 1TWAH 1SR3A 3E9IA 4XTCS 3S15H 3HOZH 3PCOB 4YHHQ 2R93G 1BBWA 2ZTEA 2VNUD 1QVGA 3M4PA 4LF9L 2VUMH 4HJ5A 3CPFA 1W3SA 4KLKA 2E5LQ 2F52A 2E8GA 3MXNB 2WB1G 4DR3L 2HT1A
chains in the Genus database with same CATH superfamily
1JICA 1B3AA 2IT1A 4JOIC 1NUCA 3EVQA 4WORA 4UP9A 3HOXB 2FMMA 2UXBL 3F1ZA 1NMGA 4LNQA 4V190 3FMCA 3KDFB 4M8AA 4DPGA 2K5DA 5IE8A 2E2JB 1EWIA 2RF4A 3DEPA 1Q1BA 3CP0A 3A7LA 1KAWA 2KECA 5IGGA 3TZUA 2L5TA 3S1QH 3S1NB 1VQOA 3F2CA 3S15B 2KCTA 1BXTA 3ONAB 1H95A 1GM5A 2X69A 2YTVA 1SEBD 1B70B 1L1OB 1AEXA 1VQ4A 4A3LG 4K5VA 1VQFA 1ILPA 4BY7G 1XPOA 3D4WA 1YNJC 1AN8A 3EBEA 1YNJD 4EQOA 2NTTA 4DFAA 2ZTCA 4KN4C 5A2QE 3CW2C 4DAMA 4QMGA 5I6WA 2VB2X 4DV2L 5KGUA 4LFCL 1K28A 3N6RA 2KVMA 5LMUQ 4C3IB 3S9WA 3S1QB 3FHWA 3LGJA 1P16A 3VA5A 4IALA 5FLXc 1QNKA 1VQDA 1C0AA 4IUVA 3H91A 4OO1G 1SRUA 2DY7A 4LMQD 5JJIA 4GLVB 4FF4A 1QB5D 1GUWA 4RKLA 2ZM6Q 3PIOA 3I4MB 4A3GB 3I4LA 1XNQQ 5C0XI 2EYMA 3GTQH 2LXKA 1SNCA 4B3TQ 4F8MA 3CMEA 2RBMA 2EPBA 4F88A 2JA7H 2LXJA 3MEFA 1A3VA 4NB3A 1TWFH 1W6KA 2L0CA 2BH8A 3T13A 1VQ7A 3EFXD 1JB3A 1II3A 2IHFA 1FD7D 2KCMA 4HAEA 4DV0Q 4UPAA 1YBYA 4DV5Q 1PV4A 3VR5A 1YJ9A 1EUJA 4NXMQ 1HNWL 1D2BA 2B2VC 4P73A 1UE5A 2NZHA 4EX5A 4HIOA 4KJOA 1RTOA 2EJGC 2Z6KA 4RMFA 4ZKBB 1N32L 4GNXC 3U50C 1U4RA 3MTSA 2JA7B 3OTOQ 4KY6A 4NXNQ 3FPUB 5JJZA 1EYGA 1B2TA 4B3RL 5M9OA 3I70A 3I55A 3J80L 2C35B 4J1MA 1HA6A 3TDQA 1YITA 1YI2A 2UUAL 4O1NA 2F0MA 2XWBB 3A0JA 2WB1B 3NSWA 2F0TA 1EEID 3CF5A 3WWVA 4A3LH 4Z9CB 4DKAC 5M5WH 4X66Q 4BY7H 3LX0A 5BN3A 5IGDA 1DJRD 3RZOH 2ALYB 1IBKQ 4DV7L 1X32A 3CCSA 2AWNA 1XTDA 3HKZB 1V1PB 4DV1L 2TSSA 2VQFQ 3F2BA 3A56A 1CKOA 3PO3G 4I7AA 5M3MG 3TZDA 3I90A 3DMUA 3MXGA 4LF7L 1QCBD 3SK6A 1Y1VB 4OO1H 1JCKB 1JWUD 5A35A 5JPNC 4K0KQ 1A6XA 2NVQB 4KHVA 1HNZQ 5JEAG 5BR8Q 4MTNA 4LF6Q 3NWSA 4FP5D 4X62Q 5M5WB 1H9SA 3E9HA 1EIYB 4C3JG 1HQMC 4BY7B 3H0GB 3TS0A 5CBEE 1X3GA 5JJLA 3RZOB 1FGBD 1SYGA 2K03A 4HMIA 3TP8A 4DR2Q 5FK9C 1C48A 4RAUC 4AQYQ 2F0EA 4JBJA 3RNUA 2ASBA 3SDZA 4RGNA 4I7ZC 2OF1A 1Q46A 4L6TB 3CCQA 3HRZC 1I4QA 4A3DG 5D65A 1PXUA 3SK4A 2ZT9C 3U58A 1KD1C 4GKKL 1YEZA 3ITPA 3ND9A 1JT8A 1TY0A 1Q81C 4A3FG 3K7UC 3Q23A 1IHZA 1F2MA 3P1HA 1ICWA 2BE5D 4L63B 4GS3A 1WYDA 4GN3B 4FF2A 5FJ8G 3HP3A 2UXDQ 4K14A 3J81i 3S16B 1IW7C 2K7VA 2XVSA 2HHHL 2M00A 3DUZA 2ZTDA 5FO7B 1CZGA 4XYOA 3KF8A 1YIJA 2HD3A 1EYAA 1BR9A 5EPJA 1STEA 4KKTA 4ZUJA 4P71A 1DOLA 2JK8A 4RG1A 2L55A 5J22A 1SYEA 4JPBW 1AE2A 1TS4A 1TWGH 1X54A 4DK1A 2JA8G 1UUPA 1P8LA 1TS2A 2AMCB 4JI8Q 2MFIA 3MXNA 5C4XG 1ENFA 4P75A 1F2YA 4A3EB 1HR0Q 2EJFC 3F2UA 3OIPA 1K3RA 1TT2A 4K2KA 2KEDA 4R4TA 3WOEA 3S1MH 3PIO3 1J5EQ 1QUQA 2F0LA 1M1KC 1VQJA 1Z9FA 4J6HA 1EY6A 3TMEA 5I2YA 3PO3H 3E3XA 4ZK9B 4A3IG 5JOBA 2KOLA 3VR6A 5M3MH 2J4XA 1KNAA 3T51B 1G6ZA 2XTIA 1E1TA 3C3LA 4JI3L 1Y69U 2EY6A 2I46A 4OEMB 1YJWA 1PH2A 1VQBA 2EXZA 4ZKCB 5CORA 1GUGA 4LF4Q 1TWGB 1BBXC 5JEAH 1CKNB 4B3SQ 1MI2A 2LFNA 1STYA 4FVMA 3CCVA 4G7HC 3H3VI 1LACA 4C3JH 4ODGA 3S1MB 2CW0C 4JI0L 4GKJQ 2CW0D 2HIVA 4A76A 4BBSB 4OGQC 3GTGH 4QY7A 4RHSA 3IKJA 4ME3A 1SNPA 2VW9A 3VYRA 4JYAL 4Q5VA 4JI2Q 4A3DH 3PO3B 3M9BA 1NJIC 4N9PA 4LUOA 1SYDA 2RVLA 4PMWA 1LLRD 1G6PA 2UU9Q 2SNSA 2HIXA 3S2HH 4A3FH 3KLSX 1A8VA 3OYYA 1SNQA 1Y14B 2N49A 2K32A 2VUMG 1Z6HA 4DR4Q 5FJ8H 1EY8A 1PZID 5HGQA 1X6OA 4L5QA 3DLLA 1VQGA 1CQVA 1JWMD 2K5QA 3NWTA 5JVG3 3KLSA 1TS5A 1I5FA 3GTGB 1T9HA 3GDEA 1WD1A 1U5KA 1YZ6A 4MZ9A 3OWFA 4QIWE 3ERQA 3K5MA 4IO9A 1ZYRC 1ZYRD 2EE1A 2RDHA 3MHBA 4IFDJ 1HUNA 1SJHD 3RUZA 3V2TA 4PNYA 1KQSA 2JA8H 1KHIA 1HA5A 4A3BG 1PLFA 5EBCA 5C4XH 2OQ0A 2XN9C 5E4XA 2QEXA 4IFDG 2A68C 5IT9L 4IOCA 2A68D 2NZ1D 1BOSA 3VYTA 1JORA 1H9SB 4JI1Q 1JE5A 3R3OA 3VYSA 1X3FA 2DY8A 2IWHA 1I4PA 3PIPA 3H15A 1LTTD 5AFWA 2ATWA 1IZ6A 3D4RA 3BVGA 2AWOA 4A3IH 1U4LA 2IY5B 3C1FA 4IUNA 2NVXH 3BZKA 3CRKC 3HKZE 4LUZA 1PH1A 1E2WA 2NVYB 1NTGA 4KN7C 3T1HL 1KXLA 2GVBA 3IRBA 3HOUH 5GAGC 3NTKA 1Q90A 4ZAIA 2G5DA 1GUNA 1M8AA 1TWHH 1ENAA 4KY7A 1KABA 4B9XA 5KIXA 3GTKH 2Z6KC 4XDXA 3CU7A 3GTMH 4LFAL 2K1BA 1FNWA 1NMFA 4K2LA 1VQAA 1JB7A 3TS2A 1Q1EA 1X3QA 1K8MA 5IYBG 4L5SA 1H9KA 1YNXA 5IWAQ 1E24A 1JOOA 2FHTA 2EZVA 2NVXB 3IAYA 2MO0A 1DXMA 3KF8B 4YWKA 4DXGA 1IBML 3HEJA 3NEMA 2NYZD 3E9IA 4HEDA 3HOUB 3HOYB 3PCOB 5CV5A 1EU4A 4YHHQ 1MSGA 1BBWA 4TKOB 2VUMH 4LF9L 1JOKA 3G6EA 3MXNB 1CM9A 4DR3L 5EKIA 1VDZA 5IGCA 1PTOB 2YTXA 1HFNA 2RCNA 1HQRD 4POFA 2CHBD 1S5BD 1LT5D 4KI0A 2CQAA 2JEBI 5C4JB 3BDCA 3W5OA 4AYBB 3GTPH 1SNDA 1RHPA 5ELBA 1HXYD 5C4ZA 4F87A 4X3TA 1D5XC 5LHY1 1GXDC 2EOTA 2F0FA 4X3UA 1GJXA 2PNRC 3I4NG 5LMNW 4DR6Q 5I9PA 2JE6I 4A3BH 2A6EC 4DV4Q 4IFDH 3I72A 2VUMB 2OEOA 1IBLQ 2CH4W 4HCEA 3BDLA 4YY3L 1MJCA 3C2PA 4DUZQ 3A5UA 3T56B 2A19A 2BA1A 2VQEL 1VQEA 2K52A 3N52A 4A3BB 2KBNA 1WCMG 5C0XG 3M3YB 4LWCA 4K8JA 2JA5B 1F9PA 4JI7L 1HCZA 4PZ7A 1GHJA 3FDTA 3PMFA 1J6QA 2Q8IB 4X64Q 2QA4A 3J7YW 4JCVE 1BCPC 4G4KA 1BCPD 1D5MC 5IYBH 2V1CC 2DGYA 4LF5L 4HJ7A 1LTGD 1SFOB 1HZ9A 4FO2A 3QIAA 3TREA 4KHPQ 1MIUA 1JQYD 3JC66 3AU7A 3OMCA 4AH6A 1SXTA 2Q8RE 3GO5A 1ASYA 4LFBL 1E1OA 4RKBA 5C4HA 1HTPA 5EGTA 2XNAC 1QZHA 2R7ZG 2RKSA 4TSSA 5IYDH 1A63A 1PTOD 5M5YH 2CH4A 1TVXA 4DR1Q 4IUTA 2ZXOA 2UXBQ 3EQLC 2PCFB 2HDMA 1A3TA 2QILA 4TQUS 1VS0A 2SDFA 2K4KA 1PVOA 3PIP3 3Q24A 5M3FG 2Z4HA 5DM73 2DJFC 5T1GA 1L0YB 2MPMA 1N9WA 3BS1A 3I4NH 4LAAA 1N33L 2YU9H 5M5XH 4Y7NH 4DV3Q 3PUXA 1HFGA 4CKCA 2SOBA 2KQ3A 1ZKOA 2B2UA 5GAEC 3BZCA 1M90C 3G71A 3ULLA 4P2CB 1Q7YC 1WOCA 2F0KA 5DLQE 4JV5L 3QO2A 5M5YB 1E22A 1AZPA 1BF4A 4DGZA 4IQZA 3PF5A 2PQEA 1PH7A 4GNXB 1JOQA 1KTKA 3CAMA 3PSIA 1HNXL 2K5HA 4DN4M 3M7NA 2M9VA 1H9JA 4DXFA 1D1IA 5CBAE 4DV2Q 3HOZB 2ICIA 5C5LA 2E76C 3CCMA 1Q86C 2YU9B 1DONA 4LFCQ 1CHQD 2A74C 4BY1G 5C0XH 1ESFA 4P72A 2F0WA 4BBRH 4X65L 3S24A 1PYSB 2HQEA 2Y0SB 1X56A 4RGTA 1U0LA 1LTSD 2MQHA 2IX1A 1RJTA 3U9SA 4B3ML 2DJGC 3RN5A 2B3GA 2Q2HA 2EYHA 3ULJA 1RL2A 5LL6X 1QZGA 1I6HH 2LMCB 1WJJA 2VXWA 2WKCA 2JA6G 3RLFA 5K5PA 1GVPA 4DR7Q 4EQNA 1NY4A 1K3BC 1TR5A 5DEHA 2R7ZH 5HY6A 4BBRB 2EYFA 1MJEA 1PRTC 3M7GA 3W2DA 1PRTD 3TP7A 2F4VQ 1PH4A 1KRTA 2E2HH 1A2TA 3DHQA 3CC7A 4RH6A 1S3OA 3L2PA 3UI2A 1X65A 2B8FA 4QUCA 3STBC 3QJYA 1N36Q 5TSSA 2K5WA 1N32Q 4AYBE 1A2UA 3PGZA 4JBMA 1K8GA 3CMAA 4X3SA 3D0FA 3PF4A 1RD9D 2K33A 2AHOB 5EKKA 1HZCA 1SROA 3CCEA 1QVCA 4HJ8A 4GOPA 1T5EA 4R4CA 4H0LC 1RTNA 2PI2E 5FO8B 2WAQG 5GADC 2UUAQ 4Q0FA 4JBKA 2XWJB 3CCJA 3T16A 2P5ZX 1JC7A 2F4IA 1XTCD 2NUCA 4NKLA 4A93G 5CC4A 2I5HA 5L37A 2B63G 3GTQB 3SHLA 4YIJA 3J80E 4UDUC 1TWFB 3CCRA 2K6AA 5J3BA 4H44C 2VZAA 2HQLA 1Z47A 1EIHA 1QG7A 2KJXA 1VQCA 1XNQL 1B8AA 1QWYA 1GUSA 2CWPA 5EKLA 2PZUA 1K0SA 5CV7A 1EU3A 4BY1H 2EVBA 3A8KE 4LF7Q 4TRDA 1EZ8A 1ASZA 3G6JB 1M4VA 1YVCA 2MO1A 2R61A 4DV0L 2F0UA 2PZWA 4DV5L 2R92G 4OWXB 5GQOA 1CHPD 4NXML 3ERSX 1WTRA 3VYUA 4HIDA 2O5JC 1TU2B 1TY2A 4QB4A 1ONLA 2LS01 1SYFA 2JA6H 4FNFA 1SSOA 1UE7A 4OIJA 3J7AF 4LF8Q 3FP9A 4JC0A 3L3OC 1BO0A 4BY1B 2A69C 2QDLA 3T1YL 1EFWA 3KF6A 1CSPA 4NXNL 2R7FA 3PO2G 2I0QA 4FDBA 4G7ZC 2EYLA 4R4IA 4HIMA 5KYLA 4JW0A 1FR3A 4GN5A 4K6DA 1TKWB 2SNMA 1XMOL 4NMZA 1CFMA 3BDOA 2G9DA 3NE5B 2IHEA 3K5OA 5CR3A 1KAAA 3CQZH 3GTLH 4DUYQ 2ICEC 2HHHQ 4DNTB 1PH9A 1IBKL 1WTXA 3H6MA 4DR5L 2KUMA 3ZJYC 1K9MC 1FNUA 3L9AX 1VQHA 4JI5L 2VQFL 1GOZA 1KRSA 2AUJD 3EJIA 1VQLA 2MGSA 3S17H 2O2LD 2B63H 3HOWG 4K5WA 2EJMA 4QJFA 2H4OA 2B2TA 4QUFA 3IL8A 3VA7A 5KRUA 4K0KL 1IW7D 3PUVA 1HNZL 5BR8L 2XGTA 1ICFB 1K83H 4GLXA 5EPLA 4HN7A 1BCPF 1LV9A 2L9HA 3BVMA 1LT6D 5I9OA 3H3VH 1EOTA 4DR2L 1MGSA 3UDIA 5JAVA 2NN6G 5C44G 4OO1I 5E4WC 3U4VA 1PFBA 3P75A 1F2ZA 1MHWC 1C7YA 2AKWB 1VQPA 2UUBQ 2NZOA 1LTBD 3J81L 2KA7A 3AYHB 1B4OA 4E6IA 4JI6Q 4KD3A 3S17B 2PZTA 2Y0SE 2R92H 1NCVA 2LY7A 3C46A 2NVTH 2B63B 2NWGA 4XT1B 1AZQA 2F03A 2JXMB 4L5RC 1PTOF 3URYA 2ENBA 4OWTB 2EY1A 2A5HA 4L8JA 3TN2A 4GLAC 1PZKD 1J8IA 1K83B 2PQAA 1NE3A 2UUCQ 4XQQA 4JYAQ 3UE0A 1PH8A 4MHEA 2UXDL 1R4PB 4IURA 2RSNA 4GOPB 4M1UB 4OHJA 3KUPA 1E2ZA 1V1QA 2HDLA 3J80c 3PO2H 2WV6D 3LWUA 4DU9A 1TWAH 2B2UC 2R93G 1CI3M 5E1FA 3SXHA 3CPFA 1W3SA 1RCVD 3QOJA 2E8GA 3SE0A 2NVTB 2HT1A 2QF7A 4S3SA 3D6CA 4LUVA 4DA2A 1G2TA 3AMUA 3K57A 2MNAA 5I4DA 4QQBX 1I4RA 4JI8L 5FO9B 5IODA 2RHQB 1HR0L 3S1RH 5IGFA 3V05A 4OL7A 3DWPA 2KENA 1TWCH 5M3MB 2CQOA 1PFNA 3ND8A 1J5EL 4DAYA 1K0RA 3NTHA 2KCCA 3RR5A 3GQBA 4EQ5A 4QF4A 4Y52H 3KBXA 1Q3LA 1CUKA 2UXCL 1GKHA 2R7DA 3PO2B 4POGA 3I2ZA 5CGKA 4C3JB 1EY7A 3Q6SA 3E5SA 3HOWH 3D8GA 2B2WA 5BN4A 1PH3A 1N8RC 3I91A 1SNMA 2Q8TA 1UWVA 2F3VA 4G7OC 4B3SL 5C3XA 4EVOA 3MVVA 3UDGA 3BVZA 1WVLA 1S4ZA 1STGA 4A3DB 1XNRQ 1YJNA 3S1RB 1CSQA 3FRPB 1XPRA 3GTOH 5G3LD 1TWCB 1VQIA 5C44H 1ENCA 2IL8A 2NN6H 3F2DA 4GKJL 5IT9E 4F7XA 4WJWA 4A3FB 3S2HB 1EQVA 3MFGA 4U673 2WB1E 1Z7TA 1PMRA 2EIFA 5C3EG 1F77A 2F0DA 4HSPA 3KLRA 4FXDA 2EY2A 1SAPA 1NBWA 3HOWB 4GZYC 1JJ2A 4OXPA 4R8NA 2UU9L 2F3IA 1IYVA 1F9QA 2AQ3B 5LMNL 1PRTF 4FF1A 4XQNA 4L5TA 2QW7A 2Z0SA 1KL9A 4LFAQ 1C9OA 1N34Q 4DR4L 4MNOA 1OXTA 3P20A 3VR3A 2JN4A 3H3VC 5IOCA 2XRSD 5C44B 4GOPC 3SVMA 4R9WA 2DNCA 5IGBA 2JA8B 1I4XA 2RDFA 3K0YA 3CC2A 2F0JA 5C4XB 2R93H 1HR0W 2MHVA 3VDYA 4C2MH 3O13A 4NPSA 5EPKA 5J1ZA 4LF9Q 1MKHA 1VQKA 2Q2TA 3PV0A 4DR3Q 2EYOA 4ZQ3A 2FMCA 2EXDA 1QILA 1BCPB 3H94A 1HZAA 2L4NA 2KHSA 1S72A 2F0HA 4A3IB 1B44D 3G4SA 3VR2A 3K8AA 3IFDA 3I8ZA 2ZJQA 4OWWB 1STAA 3CD6A 3CCLA 5CV8A 1SMYC 3OWEB 4KHZA 1LT4D 1SMYD 3FKIG 2OCEA 3MWYW 1IKMA 3KDFA 3S14H 2VS1A 3A55A 1EY5A 4C2MB 1TWHB 1VCIA 4CDDC 3GTKB 3HOVG 5DM63 3D3RA 4A3MG 1QUQB 2D0OA 3GTMB 4B08A 4DV6L 3AFQA 1B9MA 3ER0A 3A8JE 2D0PA 2PQAB 1EY9A 1OXVA 2L1BA 2F0GA 4XXEA 2OT2A 2X6GA 4WJ3M 1DYQA 2A6ED 3Q8DA 4ALPA 4A75A 4EQPA 2N88A 2Z9HA 3HKSA 2F0OA 5C3EH 1SDFA 5IWAL 1YHAA 4CKEA 5ISRA 4CBVA 3A74A 4MTKA 1VQ8A 1VF7A 4EGVA 1CTMA 1JR0D 2ID0A 4DK3C 1FNVA 4YHHL 3MZ5A 2IX0A 1HUMA 3J7AV 2IW3A 3GTPB 1PH5A 2JP1A 2Z4IA 2Z1CA 1O7YA 1IXRA 1STHA 4XQJA 4BA2I 3TBIB 3K5LA 2PMZB 3BYTB 4DAYB 3OW7A 4AIMA 2BDNA 3U9OA 2YTYA 2JQOA 2ZJPA 4ZCKA 3U4ZA 5GROA 1U9RA 3UDXA 3UDFA 2K01A 4CJ1B 1KIXA 4LFBQ 5C3EB 1PA6A 2XIWA 1Q82C 2NBFA 5FLXL 5ELFA 5AJ3L 2OXPA 3E0EA 1NAPA 1DM0B 3A7AB 4BS9A 2B2TC 2GVAA 1EQTA 3I7FA 5D3IB 2OTLA 1DD2A 5IT9c 5CV6A 2L15A 3T53B 4C3IG 1SE3A 2RQXA 3S2DH 1X55A 1IBLL 4KK7A 2FXQA 4OX9Q 3D31A 1IL8A 4CDEC 1OTCA 3I3CA 5EJWA 1FL0A 2J7ZA 1VQ6A 3FKIH 3JAME 3I4MG 4DK0A 4A3GG 2Q2IA 4OONA 1XXGA 3I4OA 1B9NA 4KJNA 1N33Q 5ELNA 4YCVA 3JAMi 4KMUC 2K05A 1B50A 1EQRA 5JPMC 2IX3A 2E2IH 4PMBA 1PRTB 4IZ8A 3HOVH 2RSOA 2FFKB 4K6LA 1WTOA 1O80A 3QR8A 4A3MH 4R4QA 1LTAD 5ELEA 3I56A 1SNOA 1A62A 1C8CA 1U4MA 2QDBA 3M4OH 4ULLA 3Q22A 1I94L 4KY5A 3RLOA 3HZXA 1LT3D 1CA6A 1R9TH 4X64L 1YNNC 1XYIA 3NBIA 1K8OA 2B8GA 4H13C 5C6AA 4JI4L 3HS0C 1AE3A 1I50H 5D14A 2JYOA 1J9OA 2E2IB 3QB3A 4KHPL 3FEWX 3HOVB 1FYCA 4DAVA 4X65Q 1T5XD 4CDCC 1DZ1A 1Q12A 4A3MB 2A8VA 2MP1A 1AH9A 4MIUA 5IIFA 5E7NA 1H9RA 3KOJA 1V1OA 4B3MQ 1NR2A 4IPDA 3TP5A 5CYUA 5IP7G 3M4OB 1L0XB 3OHXC 2C9OA 1QJOA 1FJGL 1KNEA 4DR1L 2HCIA 3I4NB 4N8FA 1R9TB 3G48A 3OSOA 4WJ4A 3QWNA 4HMJA 5M5XB 4Y7NB 3SK8A 1WCMH 2Q2UA 2JEAI 1ESRA 1I4HA 1I50B 2WFWA 2F0VA 1EWHA 2YYZA 4NDXA 1XMQL 1G291 3HKZG 2B2WC 1KC8C 1TQOA 4KKUA 1MSHA 4YWMA 4C3IH 4DV3L 2E5LL 3PUZA 2IJ0A 2XRQD 1PHJA 4JG2A 1S5ED 4IPGA 1AFPA 1Y1VG 2AUKA 3GV6A 2BA0A 4ILWA 4ZRZA 4OIKA 3I4MH 2H1EA 4A3GH 2A6HC 3RD4A 3SK5A 1X3EA 2A6HD 5G3LF 1WCMB 3H0GG 4O0AA 1XWEA 4BXXG 1ML0D 2RCFA 4H7BA 3MAQA 2L12A 1HNWQ 2KHJA 2OQKA 2WIIB 4YWLA 1ZXTA 1WTPA 3AEVA 2OTJA 5A2QL 2DNEA 2B2YC 5M3FH 3X3MA 4OELB 3STBD 5KNDA 1SBBB 2BDOA 1I6HB 1VQMA 4C1NI 5FLMG 4HIKA 5DNFA 3NTIA 4B3RQ 4C3HG 1G91A 3WDNA 3DM3A 3R8BA 2AQ1B 1QVFA 1IKLA 2R7ZB 4X3KA 3DEOA 1YHBA 2BCOA 4PZ8A 5LMUL 1S40A 2E2HB 5I2XA 4DR7L 1CKMA 4R4OA 4IUQA 3JAMc 2KHIA 1KLGD 1F9RA 5IP7H 4UHVA 5M3FB 4YCWA 4DV7Q 1CKNA 1DGSA 3J80i 2ZM6L 2N78A 3BYYB 1KDAA 1IYUA 2F4VL 1E2VA 4K5XA 1ET6A 1G51A 3KFUA 4C56C 4DV1Q 1K73C 4B3TL 4A3EG 1I6VC 4ME5A 2PMZE 2A73B 1N36L 3OPOA 2R3ZA 1B7YB 4DAPA 2YV5A 1L2FA 4KKSA 4QIWB 4CHTB 4KV6A 3NENA 3T1YQ 3CXCA 4ZLTF 5EAYA 1SE2A 4ZYSA 5CV9A 1PFSA 1SR3A 4XTCS 1CZWA 2DN8A 1WTVA 1D1KA 1S5FD 3M4PA 4HJ5A 2F52A 2TMPA 3FPPA 1Y1VH 4PV1C 4IJLA 1E3PA 1JJGA 1O7LA 2MJ8A 3B6YA 3HGBA 2NVQH 1L1OC 1WFQA 4PQXA 4A4IA 1XMOQ 3X3NA 3OW2A 2PPBC 1EYDA 4C1NK 2J0TD 1B1ZA 3H0GH 1GUTA 3J7ZC 4U68A 3KYHC 3OTOL 3J7A5 4BXXH 2A69D 4GKKQ 4FYDA 4BBSG 4DR5Q 2B39A 3A54A 2EYPA 2Z8LA 1BKBA 4IPHA 4JK1C 1XJVA 1CT1D 3A5ZB 2WINB 4FF3A 5K36G 4JI5Q 5JEAJ 2CFMA 2VB3X 2F0PA 4PMCA 1XPUA 1LTID 1KDBA 2MUYA 1OXUA 1CK1A 1RODA 5FLMH 1EFID 1QE6A 4HJ9A 3GD7A 4X66L 2ES2A 2JA6B 3GV3A 3I73A 1I4GA 5DAUA 4O2DA 4C3HH 1CA5A 1V9PA 1D8LA 3F8TA 1DOMA 1UAPA 3AQQA 2LSSA 4IOAA 4UP7A 1NR4A 2K28A 3S16H 2N3SA 2O4XA 3DM1A 5F2DA 3MXUA 2GA4B 4LF8L 2E75C 4A93H 1EYCA 2PW7A 1EZ6A 3M85A 1S5DD 1LTLA 1EY0A 4FXGC 1AW7A 3W3AA 4RFBA 3R93A 4LF6L 3NXWA 4X62L 3CQZB 3GTLB 5FOBB 3ULPA 1QNUA 1SMXA 3DWAA 2BE5C 1NNXA 3MFYA 4C3HB 4A3EH 4H02A 1I3QH 2F0NA 3BZDB 3J81E 4B9WA 1PH6A 3L7ZC 2WAQB 4X6AH 4AQYL 4JI3Q 2X6LA 1O7ZA 1Y1WG 2WKDA 1SYCA 2SEBD 4DUYL 1G2SA 2JSOA 1WI5A 3RMHA 1HTLD 3GP7A 5H1SE 4A93B 3NK9A 2NB0A 2XSCA 3G7LA 1WD0A 5IYCG 1X9NA 4JI0Q 3UE1A 1HH2P 5CMDA 1D6EC 3IFTA 4I65A 4PZ6A 5C5MA 1ET9A 1PYBA 1PFMA 4XT3B 2PYKA 3K5NA 2I5MX 1X3PA 2GN5A 3W1GA 2D62A 3NQTA 1I3QB 5NUCA 3OOCA 2KCNA 4NW2A 1F9SA 1OXSC 3QOLA 4R1JA 4BBSH 1VMCA 3SGIA 2UXCQ 2FJ2A 3RN2A 5K36H 2E2DC 3DWQA 2CKZB 2R92B 1WTWA 2BH2A 4RA8A 2BOSA 4KTAA 2PI2A 3EN2A 2CCZA 4UY8C 2EQSA 2WACA 2UUBL 1V8QA 4QCLA 1F2LA 2EYJA 3HOYG 3HOUG 5JVH3 4JI6L 3RZDH 3HFZB 4JOIA 3C1EA 2HCCA 1VMPA 2CVRA 1SYBA 4NP5A 5HGTA 1JJCB 4MN3A 3H09A 3EROA 3SEBA 2K14A 3SR1A 1EIGA 3NHHA 4FXKC 1AP0A 1TWAB 1FVIA 2UUCL 4APVA 4AYBG 2M2LA 1GO3E 1EEFD 4JVZA 2N55A 3NPPA 3GTJH 4RGOS 1LYLA 2VY3A 1EOVA 4LF4L 3AFPA 4DK6C 4IJHA 1HHVA 4RWSC 4A3CG 3DXJC 5LMNQ 1EL0A 5GAHC 4N8X1 2PW5A 1HJPA 1STBA 3OIQA 1HPCA 3RZDB 5IY0A 2F3WA 1PDQA 4A3JG 1LABA 2NTSA 4TVAB 5KNBA 2H5XA 5EBDA 1RF2D 4O42A 1LM0A 3T1HQ 1Y1WH 1JMCA 4JI2L 2QEJC 3KF6B 4KD4A 1A15A 2E74C 2O5IC 2RDGA 4RCNA 2G9HD 1BQQT 3K80C 4HJAA 2QCPX 4CGYB 4LJZC 4BWGB 1JE4A 1K8AC 3EA6A 1H9MA 3GTJB 2NVYH 5IYCH 1MD2D 2RHSB 5ELOA 2B2YA 4QL5A 3NQIA 4QGUA 4HR7B 5T1IA 3MEHA 2PNHA 1OO9B 4K8IA 1EY4A 3E6ZX 1KLUD 2JJQA 3MC0B 5IP9G 4A3KG 3GTOB 3PUWA 1L0WA 3MXPA 1GHKA 2I5LX 2ZXRA 4WFN3 2JA5G 2K50A 1OXXK 1E7ZA 1UEAB 2F0SA 2I07B 1IBMQ 1B3QA 1O7IA 1TIID 1Y1WB 3AB9A 3LWEA 3NBHA 1MBYA 1ILQA 1XNRL 2QGQA 2K75A 1DCZA 4ID6A 1S5CD 1EIFA 2WP8J 3K58A 3D4DA 4YCUA 3J81c 1UE1A 5IGEA 2OWOA 1VQNA 1EQQA 1WTHA 2KEEA 1SE8A 5CV4A 5C3WA 1Y8PB 3V96A 2Z6BA 4CKBA 1YHQA 3HOYH 1SLJA 5FKAC 5KEEA 2B2VA 4DV6Q 4JI1L 1FGUA 2NN6I 2F1MA 3NELA 3WOFA 1PTOH 4HTHA 1UNSA 3CKIB 1D7QA 1A0IA 1E0BA 4XYQA 3EIVA 3TQYA 4P74A 4GNXA 5C4JH 1N34L 1JWSD 4CDFC 2R93B 1D5ZC 3TSSA 3TRZA 1EWCA 3K81C 1XX8A 3NP8A 2EDGA 3R2TA 1HRJA 3VR4A 5J39A 3CPWA 1KDCA 5ELCA 4HCSA 4A3CH 4GN4B 5ELDA 1RKNA 4YY3Q 5KNCA 3Q0AA 2N8NA 1L1OA 3A8IE 3BU2A 3K0XA 1A3UA 1LO5D 4A3JH 1B53A 1ZEQX 3E0JA 1VQ9A 3HOXG 5LL6S 5IYDG 2VQEQ 3KJPA 1W2BA 3K7AH 4LK1C 1VF5C 5EQ0A 5E3FA 5BN5A 3S14B 5COYA 1Q8KA 2WAQE 2F0IA 4IPCA 3K6OA 1BBUA 2L11A 1NSNS 2RA4A 3MA2B 4JI7Q 1IL2A 3KK7A 1O78A 3R2IA 4IN3A 1IYJB 5AJ3Q 2D5DA 2ZXPA 3HG9A 1BNZA 3HOZG 1Q8IA 5JJKA 1VQ5A 3W1BA 5IP9H 4A3KH 3CC4A 3M3YH 3PUYA 4LF5Q 4A3JB 1LUZA 1PZJD 3RLNA 2JA5H 2Y0SG 1V43A 3L0OA 4DF7A 1C4QA 2D2CC 5FLXE 3P7JA 4R8IA 1U4PA 1SE4A 2D9UA 3BJUA 3K7AB 4J8QA 3T4AC 1SN8A 1UEBA 4ABNA 3CRLC 3ICEA 2DUDA 2HUGA 1SFOH 4BA1I 2LKVA 3QG1A 3TEHB 4DR6L 5C0XJ 5D3DA 3CHBD 4RGMA 4UAIA 4CJ0B 1BDOA 4DV4L 3D6WA 1STNA 4RCOA 3M4YA 2VL6A 3ZYYX 5I6YA 4IUPA 2R6GA 3FVQA 1RIPA 4A3KB 4DNRB 4XIGS 1BVSA 2CWAA 3KJOA 3PQIA 2K5VA 2EY5A 4BBRG 4G57A 1UE6A 2QKIC 3NUCA 1DOKA 1I94Q 3BG3A 5KYIA 1QOHA 2ZJRA 3LNNA 4IUUA 4RHRA 4PG3A 4IFDI 4DUZL 3KLWA 2C5CA 1WTQA 1W6JA 3M4QA 4JI4Q 1RDPD 2FINB 4V0BA 1GD7A 1G8ZD 4ZUIA 4JV5Q 1BUVT 4WRDA 1TS3A 1TXYA 2B29A 3S2DB 1CQFA 4CJ2C 2JA9A 2IPKD 3KBGA 4JBWA 3TP6A 3K59A 3JAML 1HNXQ 3CCUA 3HOXH 1PTOC 1R4QB 3FKIB 1YNND 2K5NA 1Y8NB 4J15A 4UP8A 1FJGQ 3OMGA 1GUOA 2A1AA 1LTRD 1PYWD 2VNUD 4N9TA 4OX9L 2F0QA 4LW1A 2K04A 1V1PA 4DNIA 3NBHB 2E2JH 1Y8OB 2JA7G 2AQ2B 4HSVA 1XMQQ 2V4DA 3J81j 3S1NH 1HZBA 2PO4A 3S15H 3HOZH 2ZTEA 1QVGA 4KLKA 2E5LQ 1SJED 5HURA 2WB1G
chains in the Genus database with same CATH topology
1Y1VH 2IT1A 2YTXA 4IJLA 1E3PA 2RCNA 1JJGA 4LUVA 4JOIC 4POFA 3B6YA 2NVQH 1L1OC 4UP9A 3G6EA 1WFQA 4A4IA 2MNAA 1XMOQ 4JI8L 4QQBX 2UXBL 4KI0A 3OW2A 3F1ZA 1NMGA 2JEBI 3W5OA 2RHQB 4LNQA 1HR0L 3S1RH 3GTPH 2KENA 1TWCH 3H0GH 3J7ZC 2CQOA 3KDFB 3KYHC 3OTOL 1J5EL 3J7A5 1K0RA 4DPGA 4BXXH 4GKKQ 5IE8A 3RR5A 4EQ5A 1EWIA 2RF4A 4Y52H 4BBSG 1CUKA 1Q1BA 4DR5Q 3I4NG 3CP0A 1GKHA 2UXCL 5LMNW 4DR6Q 1KAWA 2R7DA 1BKBA 4IPHA 3S1QH 1XJVA 2JE6I 4A3BH 3A5ZB 1VQOA 4POGA 5K36G 4JI5Q 3I2ZA 3F2CA 2KCTA 5JEAJ 2CFMA 4DV4Q 1XPUA 3HOWH 1H95A 1PH3A 1GM5A 1IBLQ 1N8RC 1OXUA 2YTVA 1B70B 1L1OB 1UWVA 5FLMH 1VQ4A 4HJ9A 3GD7A 4X66L 4B3SL 2ES2A 4A3LG 4YY3L 3UDGA 1VQFA 4C3HH 4O2DA 4BY7G 1V9PA 1XPOA 1YJNA 1XNRQ 1MJCA 1D8LA 1CSQA 3F8TA 1XPRA 3GTOH 3EBEA 4DUZQ 3A5UA 3AQQA 1VQIA 2LSSA 4IOAA 5C44H 4UP7A 2ZTCA 3F2DA 4GKJL 3S16H 2A19A 2BA1A 3CW2C 4DAMA 2N3SA 2VQEL 4DV2L 1VQEA 4LFCL 2K52A 4LF8L 5LMUQ 4A93H 2WB1E 3FHWA 3LGJA 1P16A 2EIFA 2KBNA 1WCMG 5C3EG 5FLXc 3M85A 1LTLA 1VQDA 5C0XG 1NBWA 4LWCA 1C0AA 1JJ2A 4OXPA 2UU9L 2F3IA 1SRUA 4JI7L 4OO1G 5JJIA 4GLVB 5LMNL 4PZ7A 1J6QA 2ZM6Q 4LF6L 3PIOA 4X62L 4X64Q 2QA4A 1SMXA 4L5TA 3ULPA 2Z0SA 1KL9A 4LFAQ 1C9OA 4JCVE 1N34Q 1XNQQ 5C0XI 4MNOA 4A3EH 4H02A 3GTQH 1I3QH 2LXKA 5IYBH 2V1CC 1OXTA 2DGYA 3CMEA 4HJ7A 4B3TQ 4LF5L 1PH6A 3L7ZC 2JA7H 4X6AH 4AQYL 2LXJA 3MEFA 4GOPC 4JI3Q 1HZ9A 4NB3A 1TWFH 2BH8A 3TREA 4KHPQ 1Y1WG 1MIUA 1VQ7A 3JC66 3CC2A 4DUYL 1WI5A 4AH6A 5H1SE 2IHFA 1ASYA 3GO5A 1HR0W 4LFBL 2KCMA 1E1OA 3VDYA 2R93H 4C2MH 4DV0Q 4UPAA 4NPSA 1YBYA 4DV5Q 1PV4A 1YJ9A 1EUJA 4LF9Q 1MKHA 1VQKA 2Q2TA 4NXMQ 3PV0A 1QZHA 2R7ZG 5IYCG 1X9NA 1HNWL 4DR3Q 5IYDH 1A63A 4JI0Q 5M5YH 4P73A 3UE1A 1HH2P 2EXDA 4DR1Q 4PZ6A 1UE5A 1PYBA 2NZHA 4EX5A 4HIOA 2UXBQ 2I5MX 1HZAA 2GN5A 3W1GA 2Z6KA 1S72A 2D62A 3G4SA 4TQUS 1VS0A 4RMFA 3K8AA 2K4KA 1PVOA 2ZJQA 4OWWB 1N32L 5M3FG 4GNXC 3U50C 3CD6A 3CCLA 1OXSC 3OTOQ 4R1JA 4KHZA 1N9WA 4NXNQ 4BBSH 3I4NH 3FKIG 2OCEA 3SGIA 1EYGA 1N33L 4B3RL 2UXCQ 3RN2A 3I55A 2YU9H 5M5XH 3KDFA 2C35B 4Y7NH 3S14H 2VS1A 3PUXA 4DV3Q 2CKZB 1YITA 1YI2A 2UUAL 1VCIA 2BH2A 3A0JA 3BZCA 2PI2A 5GAEC 3G71A 1M90C 3EN2A 3HOVG 3ULLA 2CCZA 1Q7YC 4UY8C 2EQSA 1WOCA 3CF5A 2UUBL 5DLQE 1QUQB 2D0OA 3WWVA 4A3MG 4JV5L 4A3LH 4DKAC 5M5WH 4X66Q 3HOYG 3HOUG 1E22A 4JI6L 3RZDH 3HFZB 4DV6L 4BY7H 3AFQA 4JOIA 3PF5A 1PH7A 4GNXB 3RZOH 2ALYB 3ER0A 4DV7L 2D0PA 1IBKQ 1JJCB 2PQAB 3CCSA 3CAMA 3PSIA 1HNXL 1OXVA 2K5HA 2AWNA 1XTDA 2K14A 3M7NA 4WJ3M 4DV1L 1FVIA 3F2BA 2VQFQ 3Q8DA 4APVA 4DV2Q 1CKOA 4AYBG 1Q86C 2UUCL 3CCMA 3PO3G 4ALPA 4A75A 1GO3E 3HKSA 4LFCQ 5M3MG 5C3EH 5IWAL 4BY1G 4LF7L 1YHAA 3GTJH 4P72A 3A74A 1LYLA 2VY3A 1EOVA 4BBRH 4X65L 1VQ8A 4LF4L 3S24A 1PYSB 3AFPA 4DK6C 4K0KQ 4IJHA 1X56A 1U0LA 4A3CG 1HNZQ 5JEAG 5LMNQ 2ID0A 5BR8Q 2MQHA 4DK3C 2IX1A 5GAHC 4YHHL 4MTNA 1HJPA 2IX0A 4LF6Q 4B3ML 4X62Q 3E9HA 3RN5A 1PH5A 1EIYB 5IY0A 2B3GA 3TS0A 2Q2HA 1X3GA 4A3JG 5JJLA 4TVAB 3ULJA 1RL2A 2H5XA 4DR2Q 1IXRA 1QZGA 4BA2I 1I6HH 1WJJA 4AQYQ 1LM0A 4JBJA 3RNUA 3T1HQ 4DAYB 1Y1WH 1JMCA 3KF6B 4JI2L 2ASBA 2JA6G 4AIMA 3RLFA 1Q46A 2YTYA 3CCQA 1GVPA 2JQOA 2ZJPA 3U4ZA 4DR7Q 5GROA 4A3DG 3UDXA 1NY4A 3UDFA 3U58A 1KIXA 1KD1C 4GKKL 3K80C 4HJAA 4LFBQ 1YEZA 1K8AC 1JT8A 1PA6A 1Q82C 2R7ZH 2NVYH 5IYCH 2RHSB 5HY6A 5AJ3L 1Q81C 3E0EA 5ELOA 4A3FG 4QL5A 1MJEA 4QGUA 3K7UC 2F4VQ 1PH4A 2OTLA 3I7FA 2GVAA 1KRTA 2E2HH 5IT9c 4DR4L 2L15A 2PNHA 4GS3A 1WYDA 3CC7A 1S3OA 2JJQA 4GN3B 5IP9G 1X55A 4A3KG 3S2DH 3PUWA 5FJ8G 3L2PA 1IBLL 1X65A 2FXQA 1L0WA 3D31A 4OX9Q 2I5LX 3STBC 2UXDQ 1N36Q 2JA5G 1OTCA 2K50A 3J81i 1OXXK 1E7ZA 1N32Q 1FL0A 4AYBE 3PGZA 4JBMA 1K8GA 3CMAA 1VQ6A 1IBMQ 2HHHL 3FKIH 1O7IA 3I4MG 4A3GG 2Q2IA 3D0FA 2ZTDA 3I4OA 4OONA 3PF4A 2AHOB 1HZCA 1SROA 5ELNA 1QVCA 3CCEA 2QGQA 2K75A 4YCVA 3JAMi 4HJ8A 4GOPA 1YIJA 4R4CA 1EIFA 1EQRA 2E2IH 2PI2E 2WAQG 5GADC 2UUAQ 2WP8J 4P71A 4JBKA 2JK8A 4RG1A 3HOVH 3CCJA 4YCUA 3J81c 1AE2A 1TWGH 1UE1A 1X54A 2OWOA 1VQNA 2JA8G 1EQQA 4A3MH 1SE8A 1P8LA 2AMCB 4JI8Q 2MFIA 1YHQA 4R4QA 3HOYH 3I56A 1SLJA 5C4XG 1A62A 4P75A 4A93G 1HR0Q 2I5HA 2B63G 1K3RA 4DV6Q 4JI1L 3M4OH 1FGUA 2NN6I 4R4TA 3S1MH 1J5EQ 1QUQA 3NELA 1I94L 3RLOA 1M1KC 1VQJA 1Z9FA 3CCRA 1R9TH 5J3BA 4X64L 2VZAA 2HQLA 1Z47A 1A0IA 1D7QA 3EIVA 3TQYA 4P74A 4GNXA 1VQCA 5C4JH 1N34L 1B8AA 1XNQL 3PO3H 2CWPA 4A3IG 3TRZA 4JI4L 1AE3A 1I50H 5M3MH 2XTIA 3K81C 4BY1H 1E1TA 4JI3L 4LF7Q 1YJWA 3CPWA 4KHPL 1PH2A 1VQBA 4LF4Q 4X65Q 1ASZA 4A3CH 4GN4B 1CKNB 1Q12A 4B3SQ 2A8VA 1AH9A 4YY3Q 5E7NA 1YVCA 2N8NA 2MO1A 3KOJA 1L1OA 3CCVA 4C3JH 4DV0L 3BU2A 3K0XA 3H3VI 4DV5L 2R92G 4B3MQ 4OWXB 1N33Q 4IPDA 5GQOA 4A3JH 5IP7G 4NXML 3ERSX 4JI0L 4GKJQ 1VQ9A 4A76A 2HIVA 1FJGL 3HOXG 4DR1L 5IYDG 4HIDA 3GTGH 4WJ4A 3G48A 2VQEQ 4QY7A 3KJPA 1W2BA 2JA6H 3K7AH 4ME3A 2VW9A 4JYAL 1XNRL 1UE7A 4JI2Q 4LF8Q 1Q8KA 2WAQE 1WCMH 3FP9A 2Q2UA 2JEAI 3M9BA 1NJIC 4A3DH 4LUOA 4JC0A 4IPCA 1BBUA 2WFWA 4PMWA 3T1YL 1EFWA 2YYZA 1CSPA 3KF6A 1XMQL 1G291 2UU9Q 1G6PA 4JI7Q 4NXNL 1IL2A 2HIXA 2R7FA 4A3FH 3S2HH 3PO2G 1A8VA 1IYJB 3HKZG 3OYYA 5AJ3Q 2I0QA 1Y14B 1KC8C 4FDBA 4R4IA 4HIMA 3HOZG 2N49A 4YWMA 4C3IH 4DV3L 1VQ5A 2E5LL 5JJKA 3PUZA 2VUMG 3W1BA 5IP9H 4A3KH 4DR4Q 3CC4A 5FJ8H 1PHJA 4JG2A 4GN5A 3M3YH 4IPGA 3PUYA 5HGQA 4LF5Q 1LUZA 1X6OA 1Y1VG 4L5QA 3RLNA 1VQGA 2BA0A 3DLLA 2JA5H 2Y0SG 1XMOL 1V43A 3L0OA 2IHEA 1I5FA 3I4MH 1T9HA 4A3GH 3CQZH 3GDEA 3GTLH 3BJUA 4DUYQ 2HHHQ 1U5KA 1YZ6A 4MZ9A 1SN8A 1UEBA 4QIWE 1X3EA 4IO9A 3H0GG 3ICEA 4O0AA 2DUDA 1PH9A 1IBKL 1SFOH 4BXXG 4BA1I 4IFDJ 4DR5L 3TEHB 3ZJYC 4DR6L 1K9MC 5C0XJ 1KQSA 2JA8H 1HNWQ 2KHJA 1KHIA 2OQKA 1VQHA 4JI5L 2VQFL 4YWLA 1KRSA 4A3BG 4DV4L 1VQLA 5C4XH 3S17H 2VL6A 3AEVA 2OTJA 2OQ0A 4IFDG 2QEXA 2R6GA 2B63H 3HOWG 4IOCA 1RIPA 5M3FH 4QJFA 3STBD 4XIGS 1BVSA 2CWAA 3KJOA 4JI1Q 4K0KL 2K5VA 1JE5A 4BBRG 1VQMA 3PUVA 1X3FA 5FLMG 1HNZL 1UE6A 1I94Q 5BR8L 2XGTA 3PIPA 3H15A 4HIKA 2ZJRA 2ATWA 1IZ6A 1K83H 4GLXA 4B3RQ 4PG3A 4IFDI 3DM3A 4DUZL 3KLWA 2AWOA 4A3IH 2IY5B 1QVFA 2NVXH 3H3VH 3BZKA 4DR2L 3M4QA 3HKZE 4LUZA 2NN6G 3UDIA 5C44G 1PH1A 4JI4Q 4OO1I 3U4VA 1NTGA 1GD7A 1YHBA 3T1HL 1C7YA 2AKWB 4PZ8A 1VQPA 1KXLA 5LMUL 1S40A 2GVBA 2UUBQ 3IRBA 2NZOA 3HOUH 5GAGC 4DR7L 4JV5Q 3AYHB 1CKMA 4R4OA 1TXYA 2B29A 3JAMc 4JI6Q 2Y0SE 2R92H 1TWHH 2NVTH 2KHIA 2JA9A 5IP7H 4JBWA 4YCWA 4DV7Q 3GTKH 1CKNA 1DGSA 4L5RC 1HNXQ 3J80i 2ZM6L 2N78A 3CCUA 2Z6KC 4OWTB 3HOXH 2F4VL 3KFUA 1G51A 3GTMH 4GLAC 4LFAL 2K5NA 4UP8A 4J15A 1FJGQ 2A1AA 4DV1Q 1NMFA 2PQAA 1NE3A 2UUCQ 1K73C 4B3TL 4A3EG 1VQAA 1JB7A 3TS2A 1Q1EA 3UE0A 5IYBG 1PH8A 2PMZE 4L5SA 4OX9L 4JYAQ 2UXDL 1YNXA 4LW1A 1N36L 5IWAQ 1E24A 4DNIA 1B7YB 3NBHB 2E2JH 2YV5A 2MO0A 2JA7G 1L2FA 4GOPB 3KF8B 4YWKA 3NENA 1V1QA 3T1YQ 1IBML 3J80c 1XMQQ 3CXCA 5EAYA 3PO2H 3NEMA 3J81j 3S1NH 1HZBA 1PFSA 1TWAH 1SR3A 3E9IA 4XTCS 3S15H 3HOZH 3PCOB 4YHHQ 2R93G 1BBWA 2ZTEA 2VNUD 1QVGA 3M4PA 4LF9L 2VUMH 4HJ5A 3CPFA 1W3SA 4KLKA 2E5LQ 2F52A 2E8GA 3MXNB 2WB1G 4DR3L 2HT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V H;  2IT1 A;  2YTX A;  4IJL A;  1E3P A;  2RCN A;  1JJG A;  4LUV A;  4JOI C;  4POF A;  3B6Y A;  2NVQ H;  1L1O C;  4UP9 A;  3G6E A;  1WFQ A;  4A4I A;  2MNA A;  1XMO Q;  4JI8 L;  4QQB X;  2UXB L;  4KI0 A;  3OW2 A;  3F1Z A;  1NMG A;  2JEB I;  3W5O A;  2RHQ B;  4LNQ A;  1HR0 L;  3S1R H;  3GTP H;  2KEN A;  1TWC H;  3H0G H;  3J7Z C;  2CQO A;  3KDF B;  3KYH C;  3OTO L;  1J5E L;  3J7A 5;  1K0R A;  4DPG A;  4BXX H;  4GKK Q;  5IE8 A;  3RR5 A;  4EQ5 A;  1EWI A;  2RF4 A;  4Y52 H;  4BBS G;  1CUK A;  1Q1B A;  4DR5 Q;  3I4N G;  3CP0 A;  1GKH A;  2UXC L;  5LMN W;  4DR6 Q;  1KAW A;  2R7D A;  1BKB A;  4IPH A;  3S1Q H;  1XJV A;  2JE6 I;  4A3B H;  3A5Z B;  1VQO A;  4POG A;  5K36 G;  4JI5 Q;  3I2Z A;  3F2C A;  2KCT A;  5JEA J;  2CFM A;  4DV4 Q;  1XPU A;  3HOW H;  1H95 A;  1PH3 A;  1GM5 A;  1IBL Q;  1N8R C;  1OXU A;  2YTV A;  1B70 B;  1L1O B;  1UWV A;  5FLM H;  1VQ4 A;  4HJ9 A;  3GD7 A;  4X66 L;  4B3S L;  2ES2 A;  4A3L G;  4YY3 L;  3UDG A;  1VQF A;  4C3H H;  4O2D A;  4BY7 G;  1V9P A;  1XPO A;  1YJN A;  1XNR Q;  1MJC A;  1D8L A;  1CSQ A;  3F8T A;  1XPR A;  3GTO H;  3EBE A;  4DUZ Q;  3A5U A;  3AQQ A;  1VQI A;  2LSS A;  4IOA A;  5C44 H;  4UP7 A;  2ZTC A;  3F2D A;  4GKJ L;  3S16 H;  2A19 A;  2BA1 A;  3CW2 C;  4DAM A;  2N3S A;  2VQE L;  4DV2 L;  1VQE A;  4LFC L;  2K52 A;  4LF8 L;  5LMU Q;  4A93 H;  2WB1 E;  3FHW A;  3LGJ A;  1P16 A;  2EIF A;  2KBN A;  1WCM G;  5C3E G;  5FLX c;  3M85 A;  1LTL A;  1VQD A;  5C0X G;  1NBW A;  4LWC A;  1C0A A;  1JJ2 A;  4OXP A;  2UU9 L;  2F3I A;  1SRU A;  4JI7 L;  4OO1 G;  5JJI A;  4GLV B;  5LMN L;  4PZ7 A;  1J6Q A;  2ZM6 Q;  4LF6 L;  3PIO A;  4X62 L;  4X64 Q;  2QA4 A;  1SMX A;  4L5T A;  3ULP A;  2Z0S A;  1KL9 A;  4LFA Q;  1C9O A;  4JCV E;  1N34 Q;  1XNQ Q;  5C0X I;  4MNO A;  4A3E H;  4H02 A;  3GTQ H;  1I3Q H;  2LXK A;  5IYB H;  2V1C C;  1OXT A;  2DGY A;  3CME A;  4HJ7 A;  4B3T Q;  4LF5 L;  1PH6 A;  3L7Z C;  2JA7 H;  4X6A H;  4AQY L;  2LXJ A;  3MEF A;  4GOP C;  4JI3 Q;  1HZ9 A;  4NB3 A;  1TWF H;  2BH8 A;  3TRE A;  4KHP Q;  1Y1W G;  1MIU A;  1VQ7 A;  3JC6 6;  3CC2 A;  4DUY L;  1WI5 A;  4AH6 A;  5H1S E;  2IHF A;  1ASY A;  3GO5 A;  1HR0 W;  4LFB L;  2KCM A;  1E1O A;  3VDY A;  2R93 H;  4C2M H;  4DV0 Q;  4UPA A;  4NPS A;  1YBY A;  4DV5 Q;  1PV4 A;  1YJ9 A;  1EUJ A;  4LF9 Q;  1MKH A;  1VQK A;  2Q2T A;  4NXM Q;  3PV0 A;  1QZH A;  2R7Z G;  5IYC G;  1X9N A;  1HNW L;  4DR3 Q;  5IYD H;  1A63 A;  4JI0 Q;  5M5Y H;  4P73 A;  3UE1 A;  1HH2 P;  2EXD A;  4DR1 Q;  4PZ6 A;  1UE5 A;  1PYB A;  2NZH A;  4EX5 A;  4HIO A;  2UXB Q;  2I5M X;  1HZA A;  2GN5 A;  3W1G A;  2Z6K A;  1S72 A;  2D62 A;  3G4S A;  4TQU S;  1VS0 A;  4RMF A;  3K8A A;  2K4K A;  1PVO A;  2ZJQ A;  4OWW B;  1N32 L;  5M3F G;  4GNX C;  3U50 C;  3CD6 A;  3CCL A;  1OXS C;  3OTO Q;  4R1J A;  4KHZ A;  1N9W A;  4NXN Q;  4BBS H;  3I4N H;  3FKI G;  2OCE A;  3SGI A;  1EYG A;  1N33 L;  4B3R L;  2UXC Q;  3RN2 A;  3I55 A;  2YU9 H;  5M5X H;  3KDF A;  2C35 B;  4Y7N H;  3S14 H;  2VS1 A;  3PUX A;  4DV3 Q;  2CKZ B;  1YIT A;  1YI2 A;  2UUA L;  1VCI A;  2BH2 A;  3A0J A;  3BZC A;  2PI2 A;  5GAE C;  3G71 A;  1M90 C;  3EN2 A;  3HOV G;  3ULL A;  2CCZ A;  1Q7Y C;  4UY8 C;  2EQS A;  1WOC A;  3CF5 A;  2UUB L;  5DLQ E;  1QUQ B;  2D0O A;  3WWV A;  4A3M G;  4JV5 L;  4A3L H;  4DKA C;  5M5W H;  4X66 Q;  3HOY G;  3HOU G;  1E22 A;  4JI6 L;  3RZD H;  3HFZ B;  4DV6 L;  4BY7 H;  3AFQ A;  4JOI A;  3PF5 A;  1PH7 A;  4GNX B;  3RZO H;  2ALY B;  3ER0 A;  4DV7 L;  2D0P A;  1IBK Q;  1JJC B;  2PQA B;  3CCS A;  3CAM A;  3PSI A;  1HNX L;  1OXV A;  2K5H A;  2AWN A;  1XTD A;  2K14 A;  3M7N A;  4WJ3 M;  4DV1 L;  1FVI A;  3F2B A;  2VQF Q;  3Q8D A;  4APV A;  4DV2 Q;  1CKO A;  4AYB G;  1Q86 C;  2UUC L;  3CCM A;  3PO3 G;  4ALP A;  4A75 A;  1GO3 E;  3HKS A;  4LFC Q;  5M3M G;  5C3E H;  5IWA L;  4BY1 G;  4LF7 L;  1YHA A;  3GTJ H;  4P72 A;  3A74 A;  1LYL A;  2VY3 A;  1EOV A;  4BBR H;  4X65 L;  1VQ8 A;  4LF4 L;  3S24 A;  1PYS B;  3AFP A;  4DK6 C;  4K0K Q;  4IJH A;  1X56 A;  1U0L A;  4A3C G;  1HNZ Q;  5JEA G;  5LMN Q;  2ID0 A;  5BR8 Q;  2MQH A;  4DK3 C;  2IX1 A;  5GAH C;  4YHH L;  4MTN A;  1HJP A;  2IX0 A;  4LF6 Q;  4B3M L;  4X62 Q;  3E9H A;  3RN5 A;  1PH5 A;  1EIY B;  5IY0 A;  2B3G A;  3TS0 A;  2Q2H A;  1X3G A;  4A3J G;  5JJL A;  4TVA B;  3ULJ A;  1RL2 A;  2H5X A;  4DR2 Q;  1IXR A;  1QZG A;  4BA2 I;  1I6H H;  1WJJ A;  4AQY Q;  1LM0 A;  4JBJ A;  3RNU A;  3T1H Q;  4DAY B;  1Y1W H;  1JMC A;  3KF6 B;  4JI2 L;  2ASB A;  2JA6 G;  4AIM A;  3RLF A;  1Q46 A;  2YTY A;  3CCQ A;  1GVP A;  2JQO A;  2ZJP A;  3U4Z A;  4DR7 Q;  5GRO A;  4A3D G;  3UDX A;  1NY4 A;  3UDF A;  3U58 A;  1KIX A;  1KD1 C;  4GKK L;  3K80 C;  4HJA A;  4LFB Q;  1YEZ A;  1K8A C;  1JT8 A;  1PA6 A;  1Q82 C;  2R7Z H;  2NVY H;  5IYC H;  2RHS B;  5HY6 A;  5AJ3 L;  1Q81 C;  3E0E A;  5ELO A;  4A3F G;  4QL5 A;  1MJE A;  4QGU A;  3K7U C;  2F4V Q;  1PH4 A;  2OTL A;  3I7F A;  2GVA A;  1KRT A;  2E2H H;  5IT9 c;  4DR4 L;  2L15 A;  2PNH A;  4GS3 A;  1WYD A;  3CC7 A;  1S3O A;  2JJQ A;  4GN3 B;  5IP9 G;  1X55 A;  4A3K G;  3S2D H;  3PUW A;  5FJ8 G;  3L2P A;  1IBL L;  1X65 A;  2FXQ A;  1L0W A;  3D31 A;  4OX9 Q;  2I5L X;  3STB C;  2UXD Q;  1N36 Q;  2JA5 G;  1OTC A;  2K50 A;  3J81 i;  1OXX K;  1E7Z A;  1N32 Q;  1FL0 A;  4AYB E;  3PGZ A;  4JBM A;  1K8G A;  3CMA A;  1VQ6 A;  1IBM Q;  2HHH L;  3FKI H;  1O7I A;  3I4M G;  4A3G G;  2Q2I A;  3D0F A;  2ZTD A;  3I4O A;  4OON A;  3PF4 A;  2AHO B;  1HZC A;  1SRO A;  5ELN A;  1QVC A;  3CCE A;  2QGQ A;  2K75 A;  4YCV A;  3JAM i;  4HJ8 A;  4GOP A;  1YIJ A;  4R4C A;  1EIF A;  1EQR A;  2E2I H;  2PI2 E;  2WAQ G;  5GAD C;  2UUA Q;  2WP8 J;  4P71 A;  4JBK A;  2JK8 A;  4RG1 A;  3HOV H;  3CCJ A;  4YCU A;  3J81 c;  1AE2 A;  1TWG H;  1UE1 A;  1X54 A;  2OWO A;  1VQN A;  2JA8 G;  1EQQ A;  4A3M H;  1SE8 A;  1P8L A;  2AMC B;  4JI8 Q;  2MFI A;  1YHQ A;  4R4Q A;  3HOY H;  3I56 A;  1SLJ A;  5C4X G;  1A62 A;  4P75 A;  4A93 G;  1HR0 Q;  2I5H A;  2B63 G;  1K3R A;  4DV6 Q;  4JI1 L;  3M4O H;  1FGU A;  2NN6 I;  4R4T A;  3S1M H;  1J5E Q;  1QUQ A;  3NEL A;  1I94 L;  3RLO A;  1M1K C;  1VQJ A;  1Z9F A;  3CCR A;  1R9T H;  5J3B A;  4X64 L;  2VZA A;  2HQL A;  1Z47 A;  1A0I A;  1D7Q A;  3EIV A;  3TQY A;  4P74 A;  4GNX A;  1VQC A;  5C4J H;  1N34 L;  1B8A A;  1XNQ L;  3PO3 H;  2CWP A;  4A3I G;  3TRZ A;  4JI4 L;  1AE3 A;  1I50 H;  5M3M H;  2XTI A;  3K81 C;  4BY1 H;  1E1T A;  4JI3 L;  4LF7 Q;  1YJW A;  3CPW A;  4KHP L;  1PH2 A;  1VQB A;  4LF4 Q;  4X65 Q;  1ASZ A;  4A3C H;  4GN4 B;  1CKN B;  1Q12 A;  4B3S Q;  2A8V A;  1AH9 A;  4YY3 Q;  5E7N A;  1YVC A;  2N8N A;  2MO1 A;  3KOJ A;  1L1O A;  3CCV A;  4C3J H;  4DV0 L;  3BU2 A;  3K0X A;  3H3V I;  4DV5 L;  2R92 G;  4B3M Q;  4OWX B;  1N33 Q;  4IPD A;  5GQO A;  4A3J H;  5IP7 G;  4NXM L;  3ERS X;  4JI0 L;  4GKJ Q;  1VQ9 A;  4A76 A;  2HIV A;  1FJG L;  3HOX G;  4DR1 L;  5IYD G;  4HID A;  3GTG H;  4WJ4 A;  3G48 A;  2VQE Q;  4QY7 A;  3KJP A;  1W2B A;  2JA6 H;  3K7A H;  4ME3 A;  2VW9 A;  4JYA L;  1XNR L;  1UE7 A;  4JI2 Q;  4LF8 Q;  1Q8K A;  2WAQ E;  1WCM H;  3FP9 A;  2Q2U A;  2JEA I;  3M9B A;  1NJI C;  4A3D H;  4LUO A;  4JC0 A;  4IPC A;  1BBU A;  2WFW A;  4PMW A;  3T1Y L;  1EFW A;  2YYZ A;  1CSP A;  3KF6 A;  1XMQ L;  1G29 1;  2UU9 Q;  1G6P A;  4JI7 Q;  4NXN L;  1IL2 A;  2HIX A;  2R7F A;  4A3F H;  3S2H H;  3PO2 G;  1A8V A;  1IYJ B;  3HKZ G;  3OYY A;  5AJ3 Q;  2I0Q A;  1Y14 B;  1KC8 C;  4FDB A;  4R4I A;  4HIM A;  3HOZ G;  2N49 A;  4YWM A;  4C3I H;  4DV3 L;  1VQ5 A;  2E5L L;  5JJK A;  3PUZ A;  2VUM G;  3W1B A;  5IP9 H;  4A3K H;  4DR4 Q;  3CC4 A;  5FJ8 H;  1PHJ A;  4JG2 A;  4GN5 A;  3M3Y H;  4IPG A;  3PUY A;  5HGQ A;  4LF5 Q;  1LUZ A;  1X6O A;  1Y1V G;  4L5Q A;  3RLN A;  1VQG A;  2BA0 A;  3DLL A;  2JA5 H;  2Y0S G;  1XMO L;  1V43 A;  3L0O A;  2IHE A;  1I5F A;  3I4M H;  1T9H A;  4A3G H;  3CQZ H;  3GDE A;  3GTL H;  3BJU A;  4DUY Q;  2HHH Q;  1U5K A;  1YZ6 A;  4MZ9 A;  1SN8 A;  1UEB A;  4QIW E;  1X3E A;  4IO9 A;  3H0G G;  3ICE A;  4O0A A;  2DUD A;  1PH9 A;  1IBK L;  1SFO H;  4BXX G;  4BA1 I;  4IFD J;  4DR5 L;  3TEH B;  3ZJY C;  4DR6 L;  1K9M C;  5C0X J;  1KQS A;  2JA8 H;  1HNW Q;  2KHJ A;  1KHI A;  2OQK A;  1VQH A;  4JI5 L;  2VQF L;  4YWL A;  1KRS A;  4A3B G;  4DV4 L;  1VQL A;  5C4X H;  3S17 H;  2VL6 A;  3AEV A;  2OTJ A;  2OQ0 A;  4IFD G;  2QEX A;  2R6G A;  2B63 H;  3HOW G;  4IOC A;  1RIP A;  5M3F H;  4QJF A;  3STB D;  4XIG S;  1BVS A;  2CWA A;  3KJO A;  4JI1 Q;  4K0K L;  2K5V A;  1JE5 A;  4BBR G;  1VQM A;  3PUV A;  1X3F A;  5FLM G;  1HNZ L;  1UE6 A;  1I94 Q;  5BR8 L;  2XGT A;  3PIP A;  3H15 A;  4HIK A;  2ZJR A;  2ATW A;  1IZ6 A;  1K83 H;  4GLX A;  4B3R Q;  4PG3 A;  4IFD I;  3DM3 A;  4DUZ L;  3KLW A;  2AWO A;  4A3I H;  2IY5 B;  1QVF A;  2NVX H;  3H3V H;  3BZK A;  4DR2 L;  3M4Q A;  3HKZ E;  4LUZ A;  2NN6 G;  3UDI A;  5C44 G;  1PH1 A;  4JI4 Q;  4OO1 I;  3U4V A;  1NTG A;  1GD7 A;  1YHB A;  3T1H L;  1C7Y A;  2AKW B;  4PZ8 A;  1VQP A;  1KXL A;  5LMU L;  1S40 A;  2GVB A;  2UUB Q;  3IRB A;  2NZO A;  3HOU H;  5GAG C;  4DR7 L;  4JV5 Q;  3AYH B;  1CKM A;  4R4O A;  1TXY A;  2B29 A;  3JAM c;  4JI6 Q;  2Y0S E;  2R92 H;  1TWH H;  2NVT H;  2KHI A;  2JA9 A;  5IP7 H;  4JBW A;  4YCW A;  4DV7 Q;  3GTK H;  1CKN A;  1DGS A;  4L5R C;  1HNX Q;  3J80 i;  2ZM6 L;  2N78 A;  3CCU A;  2Z6K C;  4OWT B;  3HOX H;  2F4V L;  3KFU A;  1G51 A;  3GTM H;  4GLA C;  4LFA L;  2K5N A;  4UP8 A;  4J15 A;  1FJG Q;  2A1A A;  4DV1 Q;  1NMF A;  2PQA A;  1NE3 A;  2UUC Q;  1K73 C;  4B3T L;  4A3E G;  1VQA A;  1JB7 A;  3TS2 A;  1Q1E A;  3UE0 A;  5IYB G;  1PH8 A;  2PMZ E;  4L5S A;  4OX9 L;  4JYA Q;  2UXD L;  1YNX A;  4LW1 A;  1N36 L;  5IWA Q;  1E24 A;  4DNI A;  1B7Y B;  3NBH B;  2E2J H;  2YV5 A;  2MO0 A;  2JA7 G;  1L2F A;  4GOP B;  3KF8 B;  4YWK A;  3NEN A;  1V1Q A;  3T1Y Q;  1IBM L;  3J80 c;  1XMQ Q;  3CXC A;  5EAY A;  3PO2 H;  3NEM A;  3J81 j;  3S1N H;  1HZB A;  1PFS A;  1TWA H;  1SR3 A;  3E9I A;  4XTC S;  3S15 H;  3HOZ H;  3PCO B;  4YHH Q;  2R93 G;  1BBW A;  2ZTE A;  2VNU D;  1QVG A;  3M4P A;  4LF9 L;  2VUM H;  4HJ5 A;  3CPF A;  1W3S A;  4KLK A;  2E5L Q;  2F52 A;  2E8G A;  3MXN B;  2WB1 G;  4DR3 L;  2HT1 A; 
#chains in the Genus database with same CATH topology
 1JIC A;  1B3A A;  2IT1 A;  4JOI C;  1NUC A;  3EVQ A;  4WOR A;  4UP9 A;  3HOX B;  2FMM A;  2UXB L;  3F1Z A;  1NMG A;  4LNQ A;  4V19 0;  3FMC A;  3KDF B;  4M8A A;  4DPG A;  2K5D A;  5IE8 A;  2E2J B;  1EWI A;  2RF4 A;  3DEP A;  1Q1B A;  3CP0 A;  3A7L A;  1KAW A;  2KEC A;  5IGG A;  3TZU A;  2L5T A;  3S1Q H;  3S1N B;  1VQO A;  3F2C A;  3S15 B;  2KCT A;  1BXT A;  3ONA B;  1H95 A;  1GM5 A;  2X69 A;  2YTV A;  1SEB D;  1B70 B;  1L1O B;  1AEX A;  1VQ4 A;  4A3L G;  4K5V A;  1VQF A;  1ILP A;  4BY7 G;  1XPO A;  3D4W A;  1YNJ C;  1AN8 A;  3EBE A;  1YNJ D;  4EQO A;  2NTT A;  4DFA A;  2ZTC A;  4KN4 C;  5A2Q E;  3CW2 C;  4DAM A;  4QMG A;  5I6W A;  2VB2 X;  4DV2 L;  5KGU A;  4LFC L;  1K28 A;  3N6R A;  2KVM A;  5LMU Q;  4C3I B;  3S9W A;  3S1Q B;  3FHW A;  3LGJ A;  1P16 A;  3VA5 A;  4IAL A;  5FLX c;  1QNK A;  1VQD A;  1C0A A;  4IUV A;  3H91 A;  4OO1 G;  1SRU A;  2DY7 A;  4LMQ D;  5JJI A;  4GLV B;  4FF4 A;  1QB5 D;  1GUW A;  4RKL A;  2ZM6 Q;  3PIO A;  3I4M B;  4A3G B;  3I4L A;  1XNQ Q;  5C0X I;  2EYM A;  3GTQ H;  2LXK A;  1SNC A;  4B3T Q;  4F8M A;  3CME A;  2RBM A;  2EPB A;  4F88 A;  2JA7 H;  2LXJ A;  3MEF A;  1A3V A;  4NB3 A;  1TWF H;  1W6K A;  2L0C A;  2BH8 A;  3T13 A;  1VQ7 A;  3EFX D;  1JB3 A;  1II3 A;  2IHF A;  1FD7 D;  2KCM A;  4HAE A;  4DV0 Q;  4UPA A;  1YBY A;  4DV5 Q;  1PV4 A;  3VR5 A;  1YJ9 A;  1EUJ A;  4NXM Q;  1HNW L;  1D2B A;  2B2V C;  4P73 A;  1UE5 A;  2NZH A;  4EX5 A;  4HIO A;  4KJO A;  1RTO A;  2EJG C;  2Z6K A;  4RMF A;  4ZKB B;  1N32 L;  4GNX C;  3U50 C;  1U4R A;  3MTS A;  2JA7 B;  3OTO Q;  4KY6 A;  4NXN Q;  3FPU B;  5JJZ A;  1EYG A;  1B2T A;  4B3R L;  5M9O A;  3I70 A;  3I55 A;  3J80 L;  2C35 B;  4J1M A;  1HA6 A;  3TDQ A;  1YIT A;  1YI2 A;  2UUA L;  4O1N A;  2F0M A;  2XWB B;  3A0J A;  2WB1 B;  3NSW A;  2F0T A;  1EEI D;  3CF5 A;  3WWV A;  4A3L H;  4Z9C B;  4DKA C;  5M5W H;  4X66 Q;  4BY7 H;  3LX0 A;  5BN3 A;  5IGD A;  1DJR D;  3RZO H;  2ALY B;  1IBK Q;  4DV7 L;  1X32 A;  3CCS A;  2AWN A;  1XTD A;  3HKZ B;  1V1P B;  4DV1 L;  2TSS A;  2VQF Q;  3F2B A;  3A56 A;  1CKO A;  3PO3 G;  4I7A A;  5M3M G;  3TZD A;  3I90 A;  3DMU A;  3MXG A;  4LF7 L;  1QCB D;  3SK6 A;  1Y1V B;  4OO1 H;  1JCK B;  1JWU D;  5A35 A;  5JPN C;  4K0K Q;  1A6X A;  2NVQ B;  4KHV A;  1HNZ Q;  5JEA G;  5BR8 Q;  4MTN A;  4LF6 Q;  3NWS A;  4FP5 D;  4X62 Q;  5M5W B;  1H9S A;  3E9H A;  1EIY B;  4C3J G;  1HQM C;  4BY7 B;  3H0G B;  3TS0 A;  5CBE E;  1X3G A;  5JJL A;  3RZO B;  1FGB D;  1SYG A;  2K03 A;  4HMI A;  3TP8 A;  4DR2 Q;  5FK9 C;  1C48 A;  4RAU C;  4AQY Q;  2F0E A;  4JBJ A;  3RNU A;  2ASB A;  3SDZ A;  4RGN A;  4I7Z C;  2OF1 A;  1Q46 A;  4L6T B;  3CCQ A;  3HRZ C;  1I4Q A;  4A3D G;  5D65 A;  1PXU A;  3SK4 A;  2ZT9 C;  3U58 A;  1KD1 C;  4GKK L;  1YEZ A;  3ITP A;  3ND9 A;  1JT8 A;  1TY0 A;  1Q81 C;  4A3F G;  3K7U C;  3Q23 A;  1IHZ A;  1F2M A;  3P1H A;  1ICW A;  2BE5 D;  4L63 B;  4GS3 A;  1WYD A;  4GN3 B;  4FF2 A;  5FJ8 G;  3HP3 A;  2UXD Q;  4K14 A;  3J81 i;  3S16 B;  1IW7 C;  2K7V A;  2XVS A;  2HHH L;  2M00 A;  3DUZ A;  2ZTD A;  5FO7 B;  1CZG A;  4XYO A;  3KF8 A;  1YIJ A;  2HD3 A;  1EYA A;  1BR9 A;  5EPJ A;  1STE A;  4KKT A;  4ZUJ A;  4P71 A;  1DOL A;  2JK8 A;  4RG1 A;  2L55 A;  5J22 A;  1SYE A;  4JPB W;  1AE2 A;  1TS4 A;  1TWG H;  1X54 A;  4DK1 A;  2JA8 G;  1UUP A;  1P8L A;  1TS2 A;  2AMC B;  4JI8 Q;  2MFI A;  3MXN A;  5C4X G;  1ENF A;  4P75 A;  1F2Y A;  4A3E B;  1HR0 Q;  2EJF C;  3F2U A;  3OIP A;  1K3R A;  1TT2 A;  4K2K A;  2KED A;  4R4T A;  3WOE A;  3S1M H;  3PIO 3;  1J5E Q;  1QUQ A;  2F0L A;  1M1K C;  1VQJ A;  1Z9F A;  4J6H A;  1EY6 A;  3TME A;  5I2Y A;  3PO3 H;  3E3X A;  4ZK9 B;  4A3I G;  5JOB A;  2KOL A;  3VR6 A;  5M3M H;  2J4X A;  1KNA A;  3T51 B;  1G6Z A;  2XTI A;  1E1T A;  3C3L A;  4JI3 L;  1Y69 U;  2EY6 A;  2I46 A;  4OEM B;  1YJW A;  1PH2 A;  1VQB A;  2EXZ A;  4ZKC B;  5COR A;  1GUG A;  4LF4 Q;  1TWG B;  1BBX C;  5JEA H;  1CKN B;  4B3S Q;  1MI2 A;  2LFN A;  1STY A;  4FVM A;  3CCV A;  4G7H C;  3H3V I;  1LAC A;  4C3J H;  4ODG A;  3S1M B;  2CW0 C;  4JI0 L;  4GKJ Q;  2CW0 D;  2HIV A;  4A76 A;  4BBS B;  4OGQ C;  3GTG H;  4QY7 A;  4RHS A;  3IKJ A;  4ME3 A;  1SNP A;  2VW9 A;  3VYR A;  4JYA L;  4Q5V A;  4JI2 Q;  4A3D H;  3PO3 B;  3M9B A;  1NJI C;  4N9P A;  4LUO A;  1SYD A;  2RVL A;  4PMW A;  1LLR D;  1G6P A;  2UU9 Q;  2SNS A;  2HIX A;  3S2H H;  4A3F H;  3KLS X;  1A8V A;  3OYY A;  1SNQ A;  1Y14 B;  2N49 A;  2K32 A;  2VUM G;  1Z6H A;  4DR4 Q;  5FJ8 H;  1EY8 A;  1PZI D;  5HGQ A;  1X6O A;  4L5Q A;  3DLL A;  1VQG A;  1CQV A;  1JWM D;  2K5Q A;  3NWT A;  5JVG 3;  3KLS A;  1TS5 A;  1I5F A;  3GTG B;  1T9H A;  3GDE A;  1WD1 A;  1U5K A;  1YZ6 A;  4MZ9 A;  3OWF A;  4QIW E;  3ERQ A;  3K5M A;  4IO9 A;  1ZYR C;  1ZYR D;  2EE1 A;  2RDH A;  3MHB A;  4IFD J;  1HUN A;  1SJH D;  3RUZ A;  3V2T A;  4PNY A;  1KQS A;  2JA8 H;  1KHI A;  1HA5 A;  4A3B G;  1PLF A;  5EBC A;  5C4X H;  2OQ0 A;  2XN9 C;  5E4X A;  2QEX A;  4IFD G;  2A68 C;  5IT9 L;  4IOC A;  2A68 D;  2NZ1 D;  1BOS A;  3VYT A;  1JOR A;  1H9S B;  4JI1 Q;  1JE5 A;  3R3O A;  3VYS A;  1X3F A;  2DY8 A;  2IWH A;  1I4P A;  3PIP A;  3H15 A;  1LTT D;  5AFW A;  2ATW A;  1IZ6 A;  3D4R A;  3BVG A;  2AWO A;  4A3I H;  1U4L A;  2IY5 B;  3C1F A;  4IUN A;  2NVX H;  3BZK A;  3CRK C;  3HKZ E;  4LUZ A;  1PH1 A;  1E2W A;  2NVY B;  1NTG A;  4KN7 C;  3T1H L;  1KXL A;  2GVB A;  3IRB A;  3HOU H;  5GAG C;  3NTK A;  1Q90 A;  4ZAI A;  2G5D A;  1GUN A;  1M8A A;  1TWH H;  1ENA A;  4KY7 A;  1KAB A;  4B9X A;  5KIX A;  3GTK H;  2Z6K C;  4XDX A;  3CU7 A;  3GTM H;  4LFA L;  2K1B A;  1FNW A;  1NMF A;  4K2L A;  1VQA A;  1JB7 A;  3TS2 A;  1Q1E A;  1X3Q A;  1K8M A;  5IYB G;  4L5S A;  1H9K A;  1YNX A;  5IWA Q;  1E24 A;  1JOO A;  2FHT A;  2EZV A;  2NVX B;  3IAY A;  2MO0 A;  1DXM A;  3KF8 B;  4YWK A;  4DXG A;  1IBM L;  3HEJ A;  3NEM A;  2NYZ D;  3E9I A;  4HED A;  3HOU B;  3HOY B;  3PCO B;  5CV5 A;  1EU4 A;  4YHH Q;  1MSG A;  1BBW A;  4TKO B;  2VUM H;  4LF9 L;  1JOK A;  3G6E A;  3MXN B;  1CM9 A;  4DR3 L;  5EKI A;  1VDZ A;  5IGC A;  1PTO B;  2YTX A;  1HFN A;  2RCN A;  1HQR D;  4POF A;  2CHB D;  1S5B D;  1LT5 D;  4KI0 A;  2CQA A;  2JEB I;  5C4J B;  3BDC A;  3W5O A;  4AYB B;  3GTP H;  1SND A;  1RHP A;  5ELB A;  1HXY D;  5C4Z A;  4F87 A;  4X3T A;  1D5X C;  5LHY 1;  1GXD C;  2EOT A;  2F0F A;  4X3U A;  1GJX A;  2PNR C;  3I4N G;  5LMN W;  4DR6 Q;  5I9P A;  2JE6 I;  4A3B H;  2A6E C;  4DV4 Q;  4IFD H;  3I72 A;  2VUM B;  2OEO A;  1IBL Q;  2CH4 W;  4HCE A;  3BDL A;  4YY3 L;  1MJC A;  3C2P A;  4DUZ Q;  3A5U A;  3T56 B;  2A19 A;  2BA1 A;  2VQE L;  1VQE A;  2K52 A;  3N52 A;  4A3B B;  2KBN A;  1WCM G;  5C0X G;  3M3Y B;  4LWC A;  4K8J A;  2JA5 B;  1F9P A;  4JI7 L;  1HCZ A;  4PZ7 A;  1GHJ A;  3FDT A;  3PMF A;  1J6Q A;  2Q8I B;  4X64 Q;  2QA4 A;  3J7Y W;  4JCV E;  1BCP C;  4G4K A;  1BCP D;  1D5M C;  5IYB H;  2V1C C;  2DGY A;  4LF5 L;  4HJ7 A;  1LTG D;  1SFO B;  1HZ9 A;  4FO2 A;  3QIA A;  3TRE A;  4KHP Q;  1MIU A;  1JQY D;  3JC6 6;  3AU7 A;  3OMC A;  4AH6 A;  1SXT A;  2Q8R E;  3GO5 A;  1ASY A;  4LFB L;  1E1O A;  4RKB A;  5C4H A;  1HTP A;  5EGT A;  2XNA C;  1QZH A;  2R7Z G;  2RKS A;  4TSS A;  5IYD H;  1A63 A;  1PTO D;  5M5Y H;  2CH4 A;  1TVX A;  4DR1 Q;  4IUT A;  2ZXO A;  2UXB Q;  3EQL C;  2PCF B;  2HDM A;  1A3T A;  2QIL A;  4TQU S;  1VS0 A;  2SDF A;  2K4K A;  1PVO A;  3PIP 3;  3Q24 A;  5M3F G;  2Z4H A;  5DM7 3;  2DJF C;  5T1G A;  1L0Y B;  2MPM A;  1N9W A;  3BS1 A;  3I4N H;  4LAA A;  1N33 L;  2YU9 H;  5M5X H;  4Y7N H;  4DV3 Q;  3PUX A;  1HFG A;  4CKC A;  2SOB A;  2KQ3 A;  1ZKO A;  2B2U A;  5GAE C;  3BZC A;  1M90 C;  3G71 A;  3ULL A;  4P2C B;  1Q7Y C;  1WOC A;  2F0K A;  5DLQ E;  4JV5 L;  3QO2 A;  5M5Y B;  1E22 A;  1AZP A;  1BF4 A;  4DGZ A;  4IQZ A;  3PF5 A;  2PQE A;  1PH7 A;  4GNX B;  1JOQ A;  1KTK A;  3CAM A;  3PSI A;  1HNX L;  2K5H A;  4DN4 M;  3M7N A;  2M9V A;  1H9J A;  4DXF A;  1D1I A;  5CBA E;  4DV2 Q;  3HOZ B;  2ICI A;  5C5L A;  2E76 C;  3CCM A;  1Q86 C;  2YU9 B;  1DON A;  4LFC Q;  1CHQ D;  2A74 C;  4BY1 G;  5C0X H;  1ESF A;  4P72 A;  2F0W A;  4BBR H;  4X65 L;  3S24 A;  1PYS B;  2HQE A;  2Y0S B;  1X56 A;  4RGT A;  1U0L A;  1LTS D;  2MQH A;  2IX1 A;  1RJT A;  3U9S A;  4B3M L;  2DJG C;  3RN5 A;  2B3G A;  2Q2H A;  2EYH A;  3ULJ A;  1RL2 A;  5LL6 X;  1QZG A;  1I6H H;  2LMC B;  1WJJ A;  2VXW A;  2WKC A;  2JA6 G;  3RLF A;  5K5P A;  1GVP A;  4DR7 Q;  4EQN A;  1NY4 A;  1K3B C;  1TR5 A;  5DEH A;  2R7Z H;  5HY6 A;  4BBR B;  2EYF A;  1MJE A;  1PRT C;  3M7G A;  3W2D A;  1PRT D;  3TP7 A;  2F4V Q;  1PH4 A;  1KRT A;  2E2H H;  1A2T A;  3DHQ A;  3CC7 A;  4RH6 A;  1S3O A;  3L2P A;  3UI2 A;  1X65 A;  2B8F A;  4QUC A;  3STB C;  3QJY A;  1N36 Q;  5TSS A;  2K5W A;  1N32 Q;  4AYB E;  1A2U A;  3PGZ A;  4JBM A;  1K8G A;  3CMA A;  4X3S A;  3D0F A;  3PF4 A;  1RD9 D;  2K33 A;  2AHO B;  5EKK A;  1HZC A;  1SRO A;  3CCE A;  1QVC A;  4HJ8 A;  4GOP A;  1T5E A;  4R4C A;  4H0L C;  1RTN A;  2PI2 E;  5FO8 B;  2WAQ G;  5GAD C;  2UUA Q;  4Q0F A;  4JBK A;  2XWJ B;  3CCJ A;  3T16 A;  2P5Z X;  1JC7 A;  2F4I A;  1XTC D;  2NUC A;  4NKL A;  4A93 G;  5CC4 A;  2I5H A;  5L37 A;  2B63 G;  3GTQ B;  3SHL A;  4YIJ A;  3J80 E;  4UDU C;  1TWF B;  3CCR A;  2K6A A;  5J3B A;  4H44 C;  2VZA A;  2HQL A;  1Z47 A;  1EIH A;  1QG7 A;  2KJX A;  1VQC A;  1XNQ L;  1B8A A;  1QWY A;  1GUS A;  2CWP A;  5EKL A;  2PZU A;  1K0S A;  5CV7 A;  1EU3 A;  4BY1 H;  2EVB A;  3A8K E;  4LF7 Q;  4TRD A;  1EZ8 A;  1ASZ A;  3G6J B;  1M4V A;  1YVC A;  2MO1 A;  2R61 A;  4DV0 L;  2F0U A;  2PZW A;  4DV5 L;  2R92 G;  4OWX B;  5GQO A;  1CHP D;  4NXM L;  3ERS X;  1WTR A;  3VYU A;  4HID A;  2O5J C;  1TU2 B;  1TY2 A;  4QB4 A;  1ONL A;  2LS0 1;  1SYF A;  2JA6 H;  4FNF A;  1SSO A;  1UE7 A;  4OIJ A;  3J7A F;  4LF8 Q;  3FP9 A;  4JC0 A;  3L3O C;  1BO0 A;  4BY1 B;  2A69 C;  2QDL A;  3T1Y L;  1EFW A;  3KF6 A;  1CSP A;  4NXN L;  2R7F A;  3PO2 G;  2I0Q A;  4FDB A;  4G7Z C;  2EYL A;  4R4I A;  4HIM A;  5KYL A;  4JW0 A;  1FR3 A;  4GN5 A;  4K6D A;  1TKW B;  2SNM A;  1XMO L;  4NMZ A;  1CFM A;  3BDO A;  2G9D A;  3NE5 B;  2IHE A;  3K5O A;  5CR3 A;  1KAA A;  3CQZ H;  3GTL H;  4DUY Q;  2ICE C;  2HHH Q;  4DNT B;  1PH9 A;  1IBK L;  1WTX A;  3H6M A;  4DR5 L;  2KUM A;  3ZJY C;  1K9M C;  1FNU A;  3L9A X;  1VQH A;  4JI5 L;  2VQF L;  1GOZ A;  1KRS A;  2AUJ D;  3EJI A;  1VQL A;  2MGS A;  3S17 H;  2O2L D;  2B63 H;  3HOW G;  4K5W A;  2EJM A;  4QJF A;  2H4O A;  2B2T A;  4QUF A;  3IL8 A;  3VA7 A;  5KRU A;  4K0K L;  1IW7 D;  3PUV A;  1HNZ L;  5BR8 L;  2XGT A;  1ICF B;  1K83 H;  4GLX A;  5EPL A;  4HN7 A;  1BCP F;  1LV9 A;  2L9H A;  3BVM A;  1LT6 D;  5I9O A;  3H3V H;  1EOT A;  4DR2 L;  1MGS A;  3UDI A;  5JAV A;  2NN6 G;  5C44 G;  4OO1 I;  5E4W C;  3U4V A;  1PFB A;  3P75 A;  1F2Z A;  1MHW C;  1C7Y A;  2AKW B;  1VQP A;  2UUB Q;  2NZO A;  1LTB D;  3J81 L;  2KA7 A;  3AYH B;  1B4O A;  4E6I A;  4JI6 Q;  4KD3 A;  3S17 B;  2PZT A;  2Y0S E;  2R92 H;  1NCV A;  2LY7 A;  3C46 A;  2NVT H;  2B63 B;  2NWG A;  4XT1 B;  1AZQ A;  2F03 A;  2JXM B;  4L5R C;  1PTO F;  3URY A;  2ENB A;  4OWT B;  2EY1 A;  2A5H A;  4L8J A;  3TN2 A;  4GLA C;  1PZK D;  1J8I A;  1K83 B;  2PQA A;  1NE3 A;  2UUC Q;  4XQQ A;  4JYA Q;  3UE0 A;  1PH8 A;  4MHE A;  2UXD L;  1R4P B;  4IUR A;  2RSN A;  4GOP B;  4M1U B;  4OHJ A;  3KUP A;  1E2Z A;  1V1Q A;  2HDL A;  3J80 c;  3PO2 H;  2WV6 D;  3LWU A;  4DU9 A;  1TWA H;  2B2U C;  2R93 G;  1CI3 M;  5E1F A;  3SXH A;  3CPF A;  1W3S A;  1RCV D;  3QOJ A;  2E8G A;  3SE0 A;  2NVT B;  2HT1 A;  2QF7 A;  4S3S A;  3D6C A;  4LUV A;  4DA2 A;  1G2T A;  3AMU A;  3K57 A;  2MNA A;  5I4D A;  4QQB X;  1I4R A;  4JI8 L;  5FO9 B;  5IOD A;  2RHQ B;  1HR0 L;  3S1R H;  5IGF A;  3V05 A;  4OL7 A;  3DWP A;  2KEN A;  1TWC H;  5M3M B;  2CQO A;  1PFN A;  3ND8 A;  1J5E L;  4DAY A;  1K0R A;  3NTH A;  2KCC A;  3RR5 A;  3GQB A;  4EQ5 A;  4QF4 A;  4Y52 H;  3KBX A;  1Q3L A;  1CUK A;  2UXC L;  1GKH A;  2R7D A;  3PO2 B;  4POG A;  3I2Z A;  5CGK A;  4C3J B;  1EY7 A;  3Q6S A;  3E5S A;  3HOW H;  3D8G A;  2B2W A;  5BN4 A;  1PH3 A;  1N8R C;  3I91 A;  1SNM A;  2Q8T A;  1UWV A;  2F3V A;  4G7O C;  4B3S L;  5C3X A;  4EVO A;  3MVV A;  3UDG A;  3BVZ A;  1WVL A;  1S4Z A;  1STG A;  4A3D B;  1XNR Q;  1YJN A;  3S1R B;  1CSQ A;  3FRP B;  1XPR A;  3GTO H;  5G3L D;  1TWC B;  1VQI A;  5C44 H;  1ENC A;  2IL8 A;  2NN6 H;  3F2D A;  4GKJ L;  5IT9 E;  4F7X A;  4WJW A;  4A3F B;  3S2H B;  1EQV A;  3MFG A;  4U67 3;  2WB1 E;  1Z7T A;  1PMR A;  2EIF A;  5C3E G;  1F77 A;  2F0D A;  4HSP A;  3KLR A;  4FXD A;  2EY2 A;  1SAP A;  1NBW A;  3HOW B;  4GZY C;  1JJ2 A;  4OXP A;  4R8N A;  2UU9 L;  2F3I A;  1IYV A;  1F9Q A;  2AQ3 B;  5LMN L;  1PRT F;  4FF1 A;  4XQN A;  4L5T A;  2QW7 A;  2Z0S A;  1KL9 A;  4LFA Q;  1C9O A;  1N34 Q;  4DR4 L;  4MNO A;  1OXT A;  3P20 A;  3VR3 A;  2JN4 A;  3H3V C;  5IOC A;  2XRS D;  5C44 B;  4GOP C;  3SVM A;  4R9W A;  2DNC A;  5IGB A;  2JA8 B;  1I4X A;  2RDF A;  3K0Y A;  3CC2 A;  2F0J A;  5C4X B;  2R93 H;  1HR0 W;  2MHV A;  3VDY A;  4C2M H;  3O13 A;  4NPS A;  5EPK A;  5J1Z A;  4LF9 Q;  1MKH A;  1VQK A;  2Q2T A;  3PV0 A;  4DR3 Q;  2EYO A;  4ZQ3 A;  2FMC A;  2EXD A;  1QIL A;  1BCP B;  3H94 A;  1HZA A;  2L4N A;  2KHS A;  1S72 A;  2F0H A;  4A3I B;  1B44 D;  3G4S A;  3VR2 A;  3K8A A;  3IFD A;  3I8Z A;  2ZJQ A;  4OWW B;  1STA A;  3CD6 A;  3CCL A;  5CV8 A;  1SMY C;  3OWE B;  4KHZ A;  1LT4 D;  1SMY D;  3FKI G;  2OCE A;  3MWY W;  1IKM A;  3KDF A;  3S14 H;  2VS1 A;  3A55 A;  1EY5 A;  4C2M B;  1TWH B;  1VCI A;  4CDD C;  3GTK B;  3HOV G;  5DM6 3;  3D3R A;  4A3M G;  1QUQ B;  2D0O A;  3GTM B;  4B08 A;  4DV6 L;  3AFQ A;  1B9M A;  3ER0 A;  3A8J E;  2D0P A;  2PQA B;  1EY9 A;  1OXV A;  2L1B A;  2F0G A;  4XXE A;  2OT2 A;  2X6G A;  4WJ3 M;  1DYQ A;  2A6E D;  3Q8D A;  4ALP A;  4A75 A;  4EQP A;  2N88 A;  2Z9H A;  3HKS A;  2F0O A;  5C3E H;  1SDF A;  5IWA L;  1YHA A;  4CKE A;  5ISR A;  4CBV A;  3A74 A;  4MTK A;  1VQ8 A;  1VF7 A;  4EGV A;  1CTM A;  1JR0 D;  2ID0 A;  4DK3 C;  1FNV A;  4YHH L;  3MZ5 A;  2IX0 A;  1HUM A;  3J7A V;  2IW3 A;  3GTP B;  1PH5 A;  2JP1 A;  2Z4I A;  2Z1C A;  1O7Y A;  1IXR A;  1STH A;  4XQJ A;  4BA2 I;  3TBI B;  3K5L A;  2PMZ B;  3BYT B;  4DAY B;  3OW7 A;  4AIM A;  2BDN A;  3U9O A;  2YTY A;  2JQO A;  2ZJP A;  4ZCK A;  3U4Z A;  5GRO A;  1U9R A;  3UDX A;  3UDF A;  2K01 A;  4CJ1 B;  1KIX A;  4LFB Q;  5C3E B;  1PA6 A;  2XIW A;  1Q82 C;  2NBF A;  5FLX L;  5ELF A;  5AJ3 L;  2OXP A;  3E0E A;  1NAP A;  1DM0 B;  3A7A B;  4BS9 A;  2B2T C;  2GVA A;  1EQT A;  3I7F A;  5D3I B;  2OTL A;  1DD2 A;  5IT9 c;  5CV6 A;  2L15 A;  3T53 B;  4C3I G;  1SE3 A;  2RQX A;  3S2D H;  1X55 A;  1IBL L;  4KK7 A;  2FXQ A;  4OX9 Q;  3D31 A;  1IL8 A;  4CDE C;  1OTC A;  3I3C A;  5EJW A;  1FL0 A;  2J7Z A;  1VQ6 A;  3FKI H;  3JAM E;  3I4M G;  4DK0 A;  4A3G G;  2Q2I A;  4OON A;  1XXG A;  3I4O A;  1B9N A;  4KJN A;  1N33 Q;  5ELN A;  4YCV A;  3JAM i;  4KMU C;  2K05 A;  1B50 A;  1EQR A;  5JPM C;  2IX3 A;  2E2I H;  4PMB A;  1PRT B;  4IZ8 A;  3HOV H;  2RSO A;  2FFK B;  4K6L A;  1WTO A;  1O80 A;  3QR8 A;  4A3M H;  4R4Q A;  1LTA D;  5ELE A;  3I56 A;  1SNO A;  1A62 A;  1C8C A;  1U4M A;  2QDB A;  3M4O H;  4ULL A;  3Q22 A;  1I94 L;  4KY5 A;  3RLO A;  3HZX A;  1LT3 D;  1CA6 A;  1R9T H;  4X64 L;  1YNN C;  1XYI A;  3NBI A;  1K8O A;  2B8G A;  4H13 C;  5C6A A;  4JI4 L;  3HS0 C;  1AE3 A;  1I50 H;  5D14 A;  2JYO A;  1J9O A;  2E2I B;  3QB3 A;  4KHP L;  3FEW X;  3HOV B;  1FYC A;  4DAV A;  4X65 Q;  1T5X D;  4CDC C;  1DZ1 A;  1Q12 A;  4A3M B;  2A8V A;  2MP1 A;  1AH9 A;  4MIU A;  5IIF A;  5E7N A;  1H9R A;  3KOJ A;  1V1O A;  4B3M Q;  1NR2 A;  4IPD A;  3TP5 A;  5CYU A;  5IP7 G;  3M4O B;  1L0X B;  3OHX C;  2C9O A;  1QJO A;  1FJG L;  1KNE A;  4DR1 L;  2HCI A;  3I4N B;  4N8F A;  1R9T B;  3G48 A;  3OSO A;  4WJ4 A;  3QWN A;  4HMJ A;  5M5X B;  4Y7N B;  3SK8 A;  1WCM H;  2Q2U A;  2JEA I;  1ESR A;  1I4H A;  1I50 B;  2WFW A;  2F0V A;  1EWH A;  2YYZ A;  4NDX A;  1XMQ L;  1G29 1;  3HKZ G;  2B2W C;  1KC8 C;  1TQO A;  4KKU A;  1MSH A;  4YWM A;  4C3I H;  4DV3 L;  2E5L L;  3PUZ A;  2IJ0 A;  2XRQ D;  1PHJ A;  4JG2 A;  1S5E D;  4IPG A;  1AFP A;  1Y1V G;  2AUK A;  3GV6 A;  2BA0 A;  4ILW A;  4ZRZ A;  4OIK A;  3I4M H;  2H1E A;  4A3G H;  2A6H C;  3RD4 A;  3SK5 A;  1X3E A;  2A6H D;  5G3L F;  1WCM B;  3H0G G;  4O0A A;  1XWE A;  4BXX G;  1ML0 D;  2RCF A;  4H7B A;  3MAQ A;  2L12 A;  1HNW Q;  2KHJ A;  2OQK A;  2WII B;  4YWL A;  1ZXT A;  1WTP A;  3AEV A;  2OTJ A;  5A2Q L;  2DNE A;  2B2Y C;  5M3F H;  3X3M A;  4OEL B;  3STB D;  5KND A;  1SBB B;  2BDO A;  1I6H B;  1VQM A;  4C1N I;  5FLM G;  4HIK A;  5DNF A;  3NTI A;  4B3R Q;  4C3H G;  1G91 A;  3WDN A;  3DM3 A;  3R8B A;  2AQ1 B;  1QVF A;  1IKL A;  2R7Z B;  4X3K A;  3DEO A;  1YHB A;  2BCO A;  4PZ8 A;  5LMU L;  1S40 A;  2E2H B;  5I2X A;  4DR7 L;  1CKM A;  4R4O A;  4IUQ A;  3JAM c;  2KHI A;  1KLG D;  1F9R A;  5IP7 H;  4UHV A;  5M3F B;  4YCW A;  4DV7 Q;  1CKN A;  1DGS A;  3J80 i;  2ZM6 L;  2N78 A;  3BYY B;  1KDA A;  1IYU A;  2F4V L;  1E2V A;  4K5X A;  1ET6 A;  1G51 A;  3KFU A;  4C56 C;  4DV1 Q;  1K73 C;  4B3T L;  4A3E G;  1I6V C;  4ME5 A;  2PMZ E;  2A73 B;  1N36 L;  3OPO A;  2R3Z A;  1B7Y B;  4DAP A;  2YV5 A;  1L2F A;  4KKS A;  4QIW B;  4CHT B;  4KV6 A;  3NEN A;  3T1Y Q;  3CXC A;  4ZLT F;  5EAY A;  1SE2 A;  4ZYS A;  5CV9 A;  1PFS A;  1SR3 A;  4XTC S;  1CZW A;  2DN8 A;  1WTV A;  1D1K A;  1S5F D;  3M4P A;  4HJ5 A;  2F52 A;  2TMP A;  3FPP A;  1Y1V H;  4PV1 C;  4IJL A;  1E3P A;  1JJG A;  1O7L A;  2MJ8 A;  3B6Y A;  3HGB A;  2NVQ H;  1L1O C;  1WFQ A;  4PQX A;  4A4I A;  1XMO Q;  3X3N A;  3OW2 A;  2PPB C;  1EYD A;  4C1N K;  2J0T D;  1B1Z A;  3H0G H;  1GUT A;  3J7Z C;  4U68 A;  3KYH C;  3OTO L;  3J7A 5;  4BXX H;  2A69 D;  4GKK Q;  4FYD A;  4BBS G;  4DR5 Q;  2B39 A;  3A54 A;  2EYP A;  2Z8L A;  1BKB A;  4IPH A;  4JK1 C;  1XJV A;  1CT1 D;  3A5Z B;  2WIN B;  4FF3 A;  5K36 G;  4JI5 Q;  5JEA J;  2CFM A;  2VB3 X;  2F0P A;  4PMC A;  1XPU A;  1LTI D;  1KDB A;  2MUY A;  1OXU A;  1CK1 A;  1ROD A;  5FLM H;  1EFI D;  1QE6 A;  4HJ9 A;  3GD7 A;  4X66 L;  2ES2 A;  2JA6 B;  3GV3 A;  3I73 A;  1I4G A;  5DAU A;  4O2D A;  4C3H H;  1CA5 A;  1V9P A;  1D8L A;  3F8T A;  1DOM A;  1UAP A;  3AQQ A;  2LSS A;  4IOA A;  4UP7 A;  1NR4 A;  2K28 A;  3S16 H;  2N3S A;  2O4X A;  3DM1 A;  5F2D A;  3MXU A;  2GA4 B;  4LF8 L;  2E75 C;  4A93 H;  1EYC A;  2PW7 A;  1EZ6 A;  3M85 A;  1S5D D;  1LTL A;  1EY0 A;  4FXG C;  1AW7 A;  3W3A A;  4RFB A;  3R93 A;  4LF6 L;  3NXW A;  4X62 L;  3CQZ B;  3GTL B;  5FOB B;  3ULP A;  1QNU A;  1SMX A;  3DWA A;  2BE5 C;  1NNX A;  3MFY A;  4C3H B;  4A3E H;  4H02 A;  1I3Q H;  2F0N A;  3BZD B;  3J81 E;  4B9W A;  1PH6 A;  3L7Z C;  2WAQ B;  4X6A H;  4AQY L;  4JI3 Q;  2X6L A;  1O7Z A;  1Y1W G;  2WKD A;  1SYC A;  2SEB D;  4DUY L;  1G2S A;  2JSO A;  1WI5 A;  3RMH A;  1HTL D;  3GP7 A;  5H1S E;  4A93 B;  3NK9 A;  2NB0 A;  2XSC A;  3G7L A;  1WD0 A;  5IYC G;  1X9N A;  4JI0 Q;  3UE1 A;  1HH2 P;  5CMD A;  1D6E C;  3IFT A;  4I65 A;  4PZ6 A;  5C5M A;  1ET9 A;  1PYB A;  1PFM A;  4XT3 B;  2PYK A;  3K5N A;  2I5M X;  1X3P A;  2GN5 A;  3W1G A;  2D62 A;  3NQT A;  1I3Q B;  5NUC A;  3OOC A;  2KCN A;  4NW2 A;  1F9S A;  1OXS C;  3QOL A;  4R1J A;  4BBS H;  1VMC A;  3SGI A;  2UXC Q;  2FJ2 A;  3RN2 A;  5K36 H;  2E2D C;  3DWQ A;  2CKZ B;  2R92 B;  1WTW A;  2BH2 A;  4RA8 A;  2BOS A;  4KTA A;  2PI2 A;  3EN2 A;  2CCZ A;  4UY8 C;  2EQS A;  2WAC A;  2UUB L;  1V8Q A;  4QCL A;  1F2L A;  2EYJ A;  3HOY G;  3HOU G;  5JVH 3;  4JI6 L;  3RZD H;  3HFZ B;  4JOI A;  3C1E A;  2HCC A;  1VMP A;  2CVR A;  1SYB A;  4NP5 A;  5HGT A;  1JJC B;  4MN3 A;  3H09 A;  3ERO A;  3SEB A;  2K14 A;  3SR1 A;  1EIG A;  3NHH A;  4FXK C;  1AP0 A;  1TWA B;  1FVI A;  2UUC L;  4APV A;  4AYB G;  2M2L A;  1GO3 E;  1EEF D;  4JVZ A;  2N55 A;  3NPP A;  3GTJ H;  4RGO S;  1LYL A;  2VY3 A;  1EOV A;  4LF4 L;  3AFP A;  4DK6 C;  4IJH A;  1HHV A;  4RWS C;  4A3C G;  3DXJ C;  5LMN Q;  1EL0 A;  5GAH C;  4N8X 1;  2PW5 A;  1HJP A;  1STB A;  3OIQ A;  1HPC A;  3RZD B;  5IY0 A;  2F3W A;  1PDQ A;  4A3J G;  1LAB A;  2NTS A;  4TVA B;  5KNB A;  2H5X A;  5EBD A;  1RF2 D;  4O42 A;  1LM0 A;  3T1H Q;  1Y1W H;  1JMC A;  4JI2 L;  2QEJ C;  3KF6 B;  4KD4 A;  1A15 A;  2E74 C;  2O5I C;  2RDG A;  4RCN A;  2G9H D;  1BQQ T;  3K80 C;  4HJA A;  2QCP X;  4CGY B;  4LJZ C;  4BWG B;  1JE4 A;  1K8A C;  3EA6 A;  1H9M A;  3GTJ B;  2NVY H;  5IYC H;  1MD2 D;  2RHS B;  5ELO A;  2B2Y A;  4QL5 A;  3NQI A;  4QGU A;  4HR7 B;  5T1I A;  3MEH A;  2PNH A;  1OO9 B;  4K8I A;  1EY4 A;  3E6Z X;  1KLU D;  2JJQ A;  3MC0 B;  5IP9 G;  4A3K G;  3GTO B;  3PUW A;  1L0W A;  3MXP A;  1GHK A;  2I5L X;  2ZXR A;  4WFN 3;  2JA5 G;  2K50 A;  1OXX K;  1E7Z A;  1UEA B;  2F0S A;  2I07 B;  1IBM Q;  1B3Q A;  1O7I A;  1TII D;  1Y1W B;  3AB9 A;  3LWE A;  3NBH A;  1MBY A;  1ILQ A;  1XNR L;  2QGQ A;  2K75 A;  1DCZ A;  4ID6 A;  1S5C D;  1EIF A;  2WP8 J;  3K58 A;  3D4D A;  4YCU A;  3J81 c;  1UE1 A;  5IGE A;  2OWO A;  1VQN A;  1EQQ A;  1WTH A;  2KEE A;  1SE8 A;  5CV4 A;  5C3W A;  1Y8P B;  3V96 A;  2Z6B A;  4CKB A;  1YHQ A;  3HOY H;  1SLJ A;  5FKA C;  5KEE A;  2B2V A;  4DV6 Q;  4JI1 L;  1FGU A;  2NN6 I;  2F1M A;  3NEL A;  3WOF A;  1PTO H;  4HTH A;  1UNS A;  3CKI B;  1D7Q A;  1A0I A;  1E0B A;  4XYQ A;  3EIV A;  3TQY A;  4P74 A;  4GNX A;  5C4J H;  1N34 L;  1JWS D;  4CDF C;  2R93 B;  1D5Z C;  3TSS A;  3TRZ A;  1EWC A;  3K81 C;  1XX8 A;  3NP8 A;  2EDG A;  3R2T A;  1HRJ A;  3VR4 A;  5J39 A;  3CPW A;  1KDC A;  5ELC A;  4HCS A;  4A3C H;  4GN4 B;  5ELD A;  1RKN A;  4YY3 Q;  5KNC A;  3Q0A A;  2N8N A;  1L1O A;  3A8I E;  3BU2 A;  3K0X A;  1A3U A;  1LO5 D;  4A3J H;  1B53 A;  1ZEQ X;  3E0J A;  1VQ9 A;  3HOX G;  5LL6 S;  5IYD G;  2VQE Q;  3KJP A;  1W2B A;  3K7A H;  4LK1 C;  1VF5 C;  5EQ0 A;  5E3F A;  5BN5 A;  3S14 B;  5COY A;  1Q8K A;  2WAQ E;  2F0I A;  4IPC A;  3K6O A;  1BBU A;  2L11 A;  1NSN S;  2RA4 A;  3MA2 B;  4JI7 Q;  1IL2 A;  3KK7 A;  1O78 A;  3R2I A;  4IN3 A;  1IYJ B;  5AJ3 Q;  2D5D A;  2ZXP A;  3HG9 A;  1BNZ A;  3HOZ G;  1Q8I A;  5JJK A;  1VQ5 A;  3W1B A;  5IP9 H;  4A3K H;  3CC4 A;  3M3Y H;  3PUY A;  4LF5 Q;  4A3J B;  1LUZ A;  1PZJ D;  3RLN A;  2JA5 H;  2Y0S G;  1V43 A;  3L0O A;  4DF7 A;  1C4Q A;  2D2C C;  5FLX E;  3P7J A;  4R8I A;  1U4P A;  1SE4 A;  2D9U A;  3BJU A;  3K7A B;  4J8Q A;  3T4A C;  1SN8 A;  1UEB A;  4ABN A;  3CRL C;  3ICE A;  2DUD A;  2HUG A;  1SFO H;  4BA1 I;  2LKV A;  3QG1 A;  3TEH B;  4DR6 L;  5C0X J;  5D3D A;  3CHB D;  4RGM A;  4UAI A;  4CJ0 B;  1BDO A;  4DV4 L;  3D6W A;  1STN A;  4RCO A;  3M4Y A;  2VL6 A;  3ZYY X;  5I6Y A;  4IUP A;  2R6G A;  3FVQ A;  1RIP A;  4A3K B;  4DNR B;  4XIG S;  1BVS A;  2CWA A;  3KJO A;  3PQI A;  2K5V A;  2EY5 A;  4BBR G;  4G57 A;  1UE6 A;  2QKI C;  3NUC A;  1DOK A;  1I94 Q;  3BG3 A;  5KYI A;  1QOH A;  2ZJR A;  3LNN A;  4IUU A;  4RHR A;  4PG3 A;  4IFD I;  4DUZ L;  3KLW A;  2C5C A;  1WTQ A;  1W6J A;  3M4Q A;  4JI4 Q;  1RDP D;  2FIN B;  4V0B A;  1GD7 A;  1G8Z D;  4ZUI A;  4JV5 Q;  1BUV T;  4WRD A;  1TS3 A;  1TXY A;  2B29 A;  3S2D B;  1CQF A;  4CJ2 C;  2JA9 A;  2IPK D;  3KBG A;  4JBW A;  3TP6 A;  3K59 A;  3JAM L;  1HNX Q;  3CCU A;  3HOX H;  1PTO C;  1R4Q B;  3FKI B;  1YNN D;  2K5N A;  1Y8N B;  4J15 A;  4UP8 A;  1FJG Q;  3OMG A;  1GUO A;  2A1A A;  1LTR D;  1PYW D;  2VNU D;  4N9T A;  4OX9 L;  2F0Q A;  4LW1 A;  2K04 A;  1V1P A;  4DNI A;  3NBH B;  2E2J H;  1Y8O B;  2JA7 G;  2AQ2 B;  4HSV A;  1XMQ Q;  2V4D A;  3J81 j;  3S1N H;  1HZB A;  2PO4 A;  3S15 H;  3HOZ H;  2ZTE A;  1QVG A;  4KLK A;  2E5L Q;  1SJE D;  5HUR A;  2WB1 G; 
#chains in the Genus database with same CATH homology
 1Y1V H;  2IT1 A;  2YTX A;  4IJL A;  1E3P A;  2RCN A;  1JJG A;  4LUV A;  4JOI C;  4POF A;  3B6Y A;  2NVQ H;  1L1O C;  4UP9 A;  3G6E A;  1WFQ A;  4A4I A;  2MNA A;  1XMO Q;  4JI8 L;  4QQB X;  2UXB L;  4KI0 A;  3OW2 A;  3F1Z A;  1NMG A;  2JEB I;  3W5O A;  2RHQ B;  4LNQ A;  1HR0 L;  3S1R H;  3GTP H;  2KEN A;  1TWC H;  3H0G H;  3J7Z C;  2CQO A;  3KDF B;  3KYH C;  3OTO L;  1J5E L;  3J7A 5;  1K0R A;  4DPG A;  4BXX H;  4GKK Q;  5IE8 A;  3RR5 A;  4EQ5 A;  1EWI A;  2RF4 A;  4Y52 H;  4BBS G;  1CUK A;  1Q1B A;  4DR5 Q;  3I4N G;  3CP0 A;  1GKH A;  2UXC L;  5LMN W;  4DR6 Q;  1KAW A;  2R7D A;  1BKB A;  4IPH A;  3S1Q H;  1XJV A;  2JE6 I;  4A3B H;  3A5Z B;  1VQO A;  4POG A;  5K36 G;  4JI5 Q;  3I2Z A;  3F2C A;  2KCT A;  5JEA J;  2CFM A;  4DV4 Q;  1XPU A;  3HOW H;  1H95 A;  1PH3 A;  1GM5 A;  1IBL Q;  1N8R C;  1OXU A;  2YTV A;  1B70 B;  1L1O B;  1UWV A;  5FLM H;  1VQ4 A;  4HJ9 A;  3GD7 A;  4X66 L;  4B3S L;  2ES2 A;  4A3L G;  4YY3 L;  3UDG A;  1VQF A;  4C3H H;  4O2D A;  4BY7 G;  1V9P A;  1XPO A;  1YJN A;  1XNR Q;  1MJC A;  1D8L A;  1CSQ A;  3F8T A;  1XPR A;  3GTO H;  3EBE A;  4DUZ Q;  3A5U A;  3AQQ A;  1VQI A;  2LSS A;  4IOA A;  5C44 H;  4UP7 A;  2ZTC A;  3F2D A;  4GKJ L;  3S16 H;  2A19 A;  2BA1 A;  3CW2 C;  4DAM A;  2N3S A;  2VQE L;  4DV2 L;  1VQE A;  4LFC L;  2K52 A;  4LF8 L;  5LMU Q;  4A93 H;  2WB1 E;  3FHW A;  3LGJ A;  1P16 A;  2EIF A;  2KBN A;  1WCM G;  5C3E G;  5FLX c;  3M85 A;  1LTL A;  1VQD A;  5C0X G;  1NBW A;  4LWC A;  1C0A A;  1JJ2 A;  4OXP A;  2UU9 L;  2F3I A;  1SRU A;  4JI7 L;  4OO1 G;  5JJI A;  4GLV B;  5LMN L;  4PZ7 A;  1J6Q A;  2ZM6 Q;  4LF6 L;  3PIO A;  4X62 L;  4X64 Q;  2QA4 A;  1SMX A;  4L5T A;  3ULP A;  2Z0S A;  1KL9 A;  4LFA Q;  1C9O A;  4JCV E;  1N34 Q;  1XNQ Q;  5C0X I;  4MNO A;  4A3E H;  4H02 A;  3GTQ H;  1I3Q H;  2LXK A;  5IYB H;  2V1C C;  1OXT A;  2DGY A;  3CME A;  4HJ7 A;  4B3T Q;  4LF5 L;  1PH6 A;  3L7Z C;  2JA7 H;  4X6A H;  4AQY L;  2LXJ A;  3MEF A;  4GOP C;  4JI3 Q;  1HZ9 A;  4NB3 A;  1TWF H;  2BH8 A;  3TRE A;  4KHP Q;  1Y1W G;  1MIU A;  1VQ7 A;  3JC6 6;  3CC2 A;  4DUY L;  1WI5 A;  4AH6 A;  5H1S E;  2IHF A;  1ASY A;  3GO5 A;  1HR0 W;  4LFB L;  2KCM A;  1E1O A;  3VDY A;  2R93 H;  4C2M H;  4DV0 Q;  4UPA A;  4NPS A;  1YBY A;  4DV5 Q;  1PV4 A;  1YJ9 A;  1EUJ A;  4LF9 Q;  1MKH A;  1VQK A;  2Q2T A;  4NXM Q;  3PV0 A;  1QZH A;  2R7Z G;  5IYC G;  1X9N A;  1HNW L;  4DR3 Q;  5IYD H;  1A63 A;  4JI0 Q;  5M5Y H;  4P73 A;  3UE1 A;  1HH2 P;  2EXD A;  4DR1 Q;  4PZ6 A;  1UE5 A;  1PYB A;  2NZH A;  4EX5 A;  4HIO A;  2UXB Q;  2I5M X;  1HZA A;  2GN5 A;  3W1G A;  2Z6K A;  1S72 A;  2D62 A;  3G4S A;  4TQU S;  1VS0 A;  4RMF A;  3K8A A;  2K4K A;  1PVO A;  2ZJQ A;  4OWW B;  1N32 L;  5M3F G;  4GNX C;  3U50 C;  3CD6 A;  3CCL A;  1OXS C;  3OTO Q;  4R1J A;  4KHZ A;  1N9W A;  4NXN Q;  4BBS H;  3I4N H;  3FKI G;  2OCE A;  3SGI A;  1EYG A;  1N33 L;  4B3R L;  2UXC Q;  3RN2 A;  3I55 A;  2YU9 H;  5M5X H;  3KDF A;  2C35 B;  4Y7N H;  3S14 H;  2VS1 A;  3PUX A;  4DV3 Q;  2CKZ B;  1YIT A;  1YI2 A;  2UUA L;  1VCI A;  2BH2 A;  3A0J A;  3BZC A;  2PI2 A;  5GAE C;  3G71 A;  1M90 C;  3EN2 A;  3HOV G;  3ULL A;  2CCZ A;  1Q7Y C;  4UY8 C;  2EQS A;  1WOC A;  3CF5 A;  2UUB L;  5DLQ E;  1QUQ B;  2D0O A;  3WWV A;  4A3M G;  4JV5 L;  4A3L H;  4DKA C;  5M5W H;  4X66 Q;  3HOY G;  3HOU G;  1E22 A;  4JI6 L;  3RZD H;  3HFZ B;  4DV6 L;  4BY7 H;  3AFQ A;  4JOI A;  3PF5 A;  1PH7 A;  4GNX B;  3RZO H;  2ALY B;  3ER0 A;  4DV7 L;  2D0P A;  1IBK Q;  1JJC B;  2PQA B;  3CCS A;  3CAM A;  3PSI A;  1HNX L;  1OXV A;  2K5H A;  2AWN A;  1XTD A;  2K14 A;  3M7N A;  4WJ3 M;  4DV1 L;  1FVI A;  3F2B A;  2VQF Q;  3Q8D A;  4APV A;  4DV2 Q;  1CKO A;  4AYB G;  1Q86 C;  2UUC L;  3CCM A;  3PO3 G;  4ALP A;  4A75 A;  1GO3 E;  3HKS A;  4LFC Q;  5M3M G;  5C3E H;  5IWA L;  4BY1 G;  4LF7 L;  1YHA A;  3GTJ H;  4P72 A;  3A74 A;  1LYL A;  2VY3 A;  1EOV A;  4BBR H;  4X65 L;  1VQ8 A;  4LF4 L;  3S24 A;  1PYS B;  3AFP A;  4DK6 C;  4K0K Q;  4IJH A;  1X56 A;  1U0L A;  4A3C G;  1HNZ Q;  5JEA G;  5LMN Q;  2ID0 A;  5BR8 Q;  2MQH A;  4DK3 C;  2IX1 A;  5GAH C;  4YHH L;  4MTN A;  1HJP A;  2IX0 A;  4LF6 Q;  4B3M L;  4X62 Q;  3E9H A;  3RN5 A;  1PH5 A;  1EIY B;  5IY0 A;  2B3G A;  3TS0 A;  2Q2H A;  1X3G A;  4A3J G;  5JJL A;  4TVA B;  3ULJ A;  1RL2 A;  2H5X A;  4DR2 Q;  1IXR A;  1QZG A;  4BA2 I;  1I6H H;  1WJJ A;  4AQY Q;  1LM0 A;  4JBJ A;  3RNU A;  3T1H Q;  4DAY B;  1Y1W H;  1JMC A;  3KF6 B;  4JI2 L;  2ASB A;  2JA6 G;  4AIM A;  3RLF A;  1Q46 A;  2YTY A;  3CCQ A;  1GVP A;  2JQO A;  2ZJP A;  3U4Z A;  4DR7 Q;  5GRO A;  4A3D G;  3UDX A;  1NY4 A;  3UDF A;  3U58 A;  1KIX A;  1KD1 C;  4GKK L;  3K80 C;  4HJA A;  4LFB Q;  1YEZ A;  1K8A C;  1JT8 A;  1PA6 A;  1Q82 C;  2R7Z H;  2NVY H;  5IYC H;  2RHS B;  5HY6 A;  5AJ3 L;  1Q81 C;  3E0E A;  5ELO A;  4A3F G;  4QL5 A;  1MJE A;  4QGU A;  3K7U C;  2F4V Q;  1PH4 A;  2OTL A;  3I7F A;  2GVA A;  1KRT A;  2E2H H;  5IT9 c;  4DR4 L;  2L15 A;  2PNH A;  4GS3 A;  1WYD A;  3CC7 A;  1S3O A;  2JJQ A;  4GN3 B;  5IP9 G;  1X55 A;  4A3K G;  3S2D H;  3PUW A;  5FJ8 G;  3L2P A;  1IBL L;  1X65 A;  2FXQ A;  1L0W A;  3D31 A;  4OX9 Q;  2I5L X;  3STB C;  2UXD Q;  1N36 Q;  2JA5 G;  1OTC A;  2K50 A;  3J81 i;  1OXX K;  1E7Z A;  1N32 Q;  1FL0 A;  4AYB E;  3PGZ A;  4JBM A;  1K8G A;  3CMA A;  1VQ6 A;  1IBM Q;  2HHH L;  3FKI H;  1O7I A;  3I4M G;  4A3G G;  2Q2I A;  3D0F A;  2ZTD A;  3I4O A;  4OON A;  3PF4 A;  2AHO B;  1HZC A;  1SRO A;  5ELN A;  1QVC A;  3CCE A;  2QGQ A;  2K75 A;  4YCV A;  3JAM i;  4HJ8 A;  4GOP A;  1YIJ A;  4R4C A;  1EIF A;  1EQR A;  2E2I H;  2PI2 E;  2WAQ G;  5GAD C;  2UUA Q;  2WP8 J;  4P71 A;  4JBK A;  2JK8 A;  4RG1 A;  3HOV H;  3CCJ A;  4YCU A;  3J81 c;  1AE2 A;  1TWG H;  1UE1 A;  1X54 A;  2OWO A;  1VQN A;  2JA8 G;  1EQQ A;  4A3M H;  1SE8 A;  1P8L A;  2AMC B;  4JI8 Q;  2MFI A;  1YHQ A;  4R4Q A;  3HOY H;  3I56 A;  1SLJ A;  5C4X G;  1A62 A;  4P75 A;  4A93 G;  1HR0 Q;  2I5H A;  2B63 G;  1K3R A;  4DV6 Q;  4JI1 L;  3M4O H;  1FGU A;  2NN6 I;  4R4T A;  3S1M H;  1J5E Q;  1QUQ A;  3NEL A;  1I94 L;  3RLO A;  1M1K C;  1VQJ A;  1Z9F A;  3CCR A;  1R9T H;  5J3B A;  4X64 L;  2VZA A;  2HQL A;  1Z47 A;  1A0I A;  1D7Q A;  3EIV A;  3TQY A;  4P74 A;  4GNX A;  1VQC A;  5C4J H;  1N34 L;  1B8A A;  1XNQ L;  3PO3 H;  2CWP A;  4A3I G;  3TRZ A;  4JI4 L;  1AE3 A;  1I50 H;  5M3M H;  2XTI A;  3K81 C;  4BY1 H;  1E1T A;  4JI3 L;  4LF7 Q;  1YJW A;  3CPW A;  4KHP L;  1PH2 A;  1VQB A;  4LF4 Q;  4X65 Q;  1ASZ A;  4A3C H;  4GN4 B;  1CKN B;  1Q12 A;  4B3S Q;  2A8V A;  1AH9 A;  4YY3 Q;  5E7N A;  1YVC A;  2N8N A;  2MO1 A;  3KOJ A;  1L1O A;  3CCV A;  4C3J H;  4DV0 L;  3BU2 A;  3K0X A;  3H3V I;  4DV5 L;  2R92 G;  4B3M Q;  4OWX B;  1N33 Q;  4IPD A;  5GQO A;  4A3J H;  5IP7 G;  4NXM L;  3ERS X;  4JI0 L;  4GKJ Q;  1VQ9 A;  4A76 A;  2HIV A;  1FJG L;  3HOX G;  4DR1 L;  5IYD G;  4HID A;  3GTG H;  4WJ4 A;  3G48 A;  2VQE Q;  4QY7 A;  3KJP A;  1W2B A;  2JA6 H;  3K7A H;  4ME3 A;  2VW9 A;  4JYA L;  1XNR L;  1UE7 A;  4JI2 Q;  4LF8 Q;  1Q8K A;  2WAQ E;  1WCM H;  3FP9 A;  2Q2U A;  2JEA I;  3M9B A;  1NJI C;  4A3D H;  4LUO A;  4JC0 A;  4IPC A;  1BBU A;  2WFW A;  4PMW A;  3T1Y L;  1EFW A;  2YYZ A;  1CSP A;  3KF6 A;  1XMQ L;  1G29 1;  2UU9 Q;  1G6P A;  4JI7 Q;  4NXN L;  1IL2 A;  2HIX A;  2R7F A;  4A3F H;  3S2H H;  3PO2 G;  1A8V A;  1IYJ B;  3HKZ G;  3OYY A;  5AJ3 Q;  2I0Q A;  1Y14 B;  1KC8 C;  4FDB A;  4R4I A;  4HIM A;  3HOZ G;  2N49 A;  4YWM A;  4C3I H;  4DV3 L;  1VQ5 A;  2E5L L;  5JJK A;  3PUZ A;  2VUM G;  3W1B A;  5IP9 H;  4A3K H;  4DR4 Q;  3CC4 A;  5FJ8 H;  1PHJ A;  4JG2 A;  4GN5 A;  3M3Y H;  4IPG A;  3PUY A;  5HGQ A;  4LF5 Q;  1LUZ A;  1X6O A;  1Y1V G;  4L5Q A;  3RLN A;  1VQG A;  2BA0 A;  3DLL A;  2JA5 H;  2Y0S G;  1XMO L;  1V43 A;  3L0O A;  2IHE A;  1I5F A;  3I4M H;  1T9H A;  4A3G H;  3CQZ H;  3GDE A;  3GTL H;  3BJU A;  4DUY Q;  2HHH Q;  1U5K A;  1YZ6 A;  4MZ9 A;  1SN8 A;  1UEB A;  4QIW E;  1X3E A;  4IO9 A;  3H0G G;  3ICE A;  4O0A A;  2DUD A;  1PH9 A;  1IBK L;  1SFO H;  4BXX G;  4BA1 I;  4IFD J;  4DR5 L;  3TEH B;  3ZJY C;  4DR6 L;  1K9M C;  5C0X J;  1KQS A;  2JA8 H;  1HNW Q;  2KHJ A;  1KHI A;  2OQK A;  1VQH A;  4JI5 L;  2VQF L;  4YWL A;  1KRS A;  4A3B G;  4DV4 L;  1VQL A;  5C4X H;  3S17 H;  2VL6 A;  3AEV A;  2OTJ A;  2OQ0 A;  4IFD G;  2QEX A;  2R6G A;  2B63 H;  3HOW G;  4IOC A;  1RIP A;  5M3F H;  4QJF A;  3STB D;  4XIG S;  1BVS A;  2CWA A;  3KJO A;  4JI1 Q;  4K0K L;  2K5V A;  1JE5 A;  4BBR G;  1VQM A;  3PUV A;  1X3F A;  5FLM G;  1HNZ L;  1UE6 A;  1I94 Q;  5BR8 L;  2XGT A;  3PIP A;  3H15 A;  4HIK A;  2ZJR A;  2ATW A;  1IZ6 A;  1K83 H;  4GLX A;  4B3R Q;  4PG3 A;  4IFD I;  3DM3 A;  4DUZ L;  3KLW A;  2AWO A;  4A3I H;  2IY5 B;  1QVF A;  2NVX H;  3H3V H;  3BZK A;  4DR2 L;  3M4Q A;  3HKZ E;  4LUZ A;  2NN6 G;  3UDI A;  5C44 G;  1PH1 A;  4JI4 Q;  4OO1 I;  3U4V A;  1NTG A;  1GD7 A;  1YHB A;  3T1H L;  1C7Y A;  2AKW B;  4PZ8 A;  1VQP A;  1KXL A;  5LMU L;  1S40 A;  2GVB A;  2UUB Q;  3IRB A;  2NZO A;  3HOU H;  5GAG C;  4DR7 L;  4JV5 Q;  3AYH B;  1CKM A;  4R4O A;  1TXY A;  2B29 A;  3JAM c;  4JI6 Q;  2Y0S E;  2R92 H;  1TWH H;  2NVT H;  2KHI A;  2JA9 A;  5IP7 H;  4JBW A;  4YCW A;  4DV7 Q;  3GTK H;  1CKN A;  1DGS A;  4L5R C;  1HNX Q;  3J80 i;  2ZM6 L;  2N78 A;  3CCU A;  2Z6K C;  4OWT B;  3HOX H;  2F4V L;  3KFU A;  1G51 A;  3GTM H;  4GLA C;  4LFA L;  2K5N A;  4UP8 A;  4J15 A;  1FJG Q;  2A1A A;  4DV1 Q;  1NMF A;  2PQA A;  1NE3 A;  2UUC Q;  1K73 C;  4B3T L;  4A3E G;  1VQA A;  1JB7 A;  3TS2 A;  1Q1E A;  3UE0 A;  5IYB G;  1PH8 A;  2PMZ E;  4L5S A;  4OX9 L;  4JYA Q;  2UXD L;  1YNX A;  4LW1 A;  1N36 L;  5IWA Q;  1E24 A;  4DNI A;  1B7Y B;  3NBH B;  2E2J H;  2YV5 A;  2MO0 A;  2JA7 G;  1L2F A;  4GOP B;  3KF8 B;  4YWK A;  3NEN A;  1V1Q A;  3T1Y Q;  1IBM L;  3J80 c;  1XMQ Q;  3CXC A;  5EAY A;  3PO2 H;  3NEM A;  3J81 j;  3S1N H;  1HZB A;  1PFS A;  1TWA H;  1SR3 A;  3E9I A;  4XTC S;  3S15 H;  3HOZ H;  3PCO B;  4YHH Q;  2R93 G;  1BBW A;  2ZTE A;  2VNU D;  1QVG A;  3M4P A;  4LF9 L;  2VUM H;  4HJ5 A;  3CPF A;  1W3S A;  4KLK A;  2E5L Q;  2F52 A;  2E8G A;  3MXN B;  2WB1 G;  4DR3 L;  2HT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...