2KCCA

Solution structure of biotinoyl domain from human acetyl-coa carboxylase 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
84
Chain Sequence
b'MENDPTVLRSPSAGKLTQYTVEDGGHVEAGSSYAEMEVMKMIMTLNVQERGRVKYIKRPGAVLEAGCVVARLELDDLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl-CoA carboxylase 2
publication title Biotinoyl domain of human acetyl-CoA carboxylase: Structural insights into the carboxyl transfer mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 7
structure length 84
sequence length 84
ec nomenclature ec 6.3.4.14: Biotin carboxylase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kccA00
5C0XH 3VA7A 2A68C 4DNTB 3N6RA 2PCFB 3A8IE 2QF7A 4KHZA 1Z7TA 4G7OC 1H9KA 1IYVA 1DCZA 1QJOA 3LWUA 2NN6G 3PUYA 1Y69U 1ZKOA 3TZUA 1VF7A 1LACA 3SE0A 3QG1A 4GZYC 3MFYA 3GD7A 3W3AA 3IFTA 4L8JA 5BN5A 1BDOA 1V43A 2BDOA 1K8MA 1FR3A 1OXUA 4KI0A 1O78A 1CTMA 1Z6HA 2E76C 3DXJC 3CRKC 5JEAG 2PPBC 3FMCA 3NE5B 2R6GA 5K36G 2BA1A 1DXMA 3VR5A 2EJMA 3D31A 3VR2A 2B8GA 5JEAH 3M4YA 2A6HC 3D4RA 2PNRC 5K36H 4DNRB 1ZYRC 1HCZA 3I4LA 4OGQC 1V8QA 2DNEA 4PV1C 1VF5C 4KKSA 1H9SA 1I6VC 3QJYA 1OXVA 3VR3A 2EDGA 3IKJA 4DK0A 5KNCA 2A6HD 2D5DA 2Q8IB 2O5IC 4IFDG 3GQBA 1LABA 2EJFC 2IT1A 3PUXA 1K8OA 3T53B 3KLRA 3VR6A 3BDOA 1FYCA 4G7ZC 1TKWB 2NN6H 1IW7C 3HGBA 1Y8NB 4KN4C 4IFDH 1YNNC 2E75C 4LK1C 1GHJA 1GUOA 1OXTA 2ZT9C 2D62A 1ONLA 3ND9A 3ND8A 3PUZA 3MXUA 1G291 2E74C 2A69D 5BN4A 1IW7D 3BG3A 2V4DA 1CI3M 4I7ZC 5A35A 3LNNA 4BA2I 1O7LA 1SMYC 2EJGC 3P20A 1T5EA 1VCIA 2BE5C 4RCNA 1TU2B 2BA0A 4KKTA 4H44C 4IQZA 1GUGA 1H9JA 4KN7C 3RLFA 1HTPA 2LMCB 1E2WA 1VDZA 2L5TA 3EQLC 1GUNA 1Q1EA 2BE5D 5KNBA 1E2VA 1HQMC 3CRLC 1GHKA 1Q1BA 2A69C 2CW0C 2K32A 3WDNA 4BA1I 1OXXK 3FPPA 3OPOA 4KKUA 5C0XG 1B9MA 2KA7A 4OO1G 1YNJC 2D2CC 3H94A 2B8FA 3L7ZC 3OW7A 3I73A 3U9SA 3A7AB 4G7HC 1HPCA 4XIGS 3A8KE 1B9NA 2DN8A 4OO1H 1GUSA 2K33A 3T56B 1GUTA 2YYZA 3SDZA 3OOCA 2JE6I 3VR4A 2A6ED 1A6XA 3A8JE 2JEAI 1Q90A 3QIAA 3I72A 3M7NA 2A68D 4JK1C 4KMUC 5BN3A 3PUWA 3PV0A 1EWHA 1Y8PB 4JBWA 2F1MA 4LJZC 4TKOB 1PMRA 1Y8OB 4TQUS 2DNCA 4XTCS 3AB9A 4HR7B 3T51B 1GJXA 4DK1A 1H9MA 1OXSC 3M85A 2KCCA 1H9RA 2AWOA 2JEBI 3A7LA 2K7VA 5KNDA 1H9SB 2EVBA 4H13C 2JXMB 1IYUA 1CFMA 2NN6I 3PUVA 1DD2A 1E2ZA 4H0LC 2A6EC 2AUJD 1Q12A 2AUKA 2O5JC
chains in the Genus database with same CATH superfamily
4HJ8A 2UXCL 3BVMA 4XXEA 3K6OA 1Q81C 4G7OC 3C2PA 3NXWA 1SLJA 1A63A 4LF4L 4A3JG 3TQYA 1HR0Q 3OTOL 4XQNA 2OEOA 3S2DH 2H5XA 5C44B 1IL2A 1RDPD 1PYBA 3S1QH 4A76A 4DR6L 1X3EA 1FR3A 1YJWA 2JK8A 2NVTH 1SRUA 5EAYA 4MZ9A 3AFPA 3S1NB 2GVBA 4KY7A 4JI6L 2Z6KA 4LF6Q 4DV4L 1EU4A 3Q8DA 2DNEA 4X62L 2JA9A 1JWUD 3CXCA 4JYAL 1SR3A 4WJWA 1WTOA 1N32Q 3S2DB 4XT1B 4YWKA 3S1QB 4XT3B 2K05A 4RWSC 1I4PA 4GKJL 1IBMQ 5A35A 4DV5L 1STYA 2VB2X 2B2UC 4NPSA 4CDEC 4KN7C 3E0EA 2LMCB 4QMGA 5F2DA 1E2VA 3CCMA 1KD1C 1IYJB 3FKIG 3OSOA 4AYBB 5FOBB 3O13A 1Q8KA 3KBXA 4PZ8A 5EKIA 4QL5A 1ML0D 1SBBB 1BF4A 5HGTA 5C0XG 2F3VA 4E6IA 3EBEA 1HNZQ 2ZJPA 3VYRA 1HZBA 1N33L 1YNJD 2QDLA 3MEFA 5C3EH 4OX9Q 1ENAA 4IUVA 4KK7A 1HRJA 1Q46A 1XX8A 1LTSD 3T51B 2QILA 1WD1A 3KLSA 1VQBA 5EBDA 4EQNA 4LNQA 3S2HH 1HFNA 2HDLA 4A3CG 3TEHB 1QVGA 3KJPA 3PUVA 2SNSA 1QILA 4A3EH 4BY7H 4GN4B 5DAUA 1KRTA 3PQIA 3U4VA 2HCCA 2BDNA 1WTQA 4IUTA 4JI5L 3ZJYC 1JB7A 3K8AA 3A54A 2OTLA 5C3EB 3TZUA 3S16H 3MXPA 1J8IA 3HOXG 1P16A 1E1TA 2Q2IA 3PO2H 2F0QA 3K58A 1C8CA 1HA6A 2JA7H 1RTOA 5EQ0A 2ZTCA 1TWGH 3S2HB 3PCOB 2RA4A 3E5SA 1EEID 4LF5Q 4A3GB 4DV6Q 1TWHH 4RFBA 2PNRC 5K36H 1XMOQ 2LKVA 2F0HA 1UE5A 4JI7L 2QGQA 1STNA 5FJ8H 1T9HA 5IGDA 4F7XA 4J6HA 1I4QA 3A55A 1JT8A 3D6CA 2YTVA 1BXTA 4A93G 1QNKA 3S16B 1CT1D 3HGBA 2OQKA 1GUOA 1I94Q 1JOKA 1X3GA 3PO2B 5CV4A 5M3FG 3OWEB 1K0RA 2E74C 1VQGA 3BG3A 2V4DA 2WKCA 2SEBD 1O7LA 1SAPA 4X62Q 4ZUIA 4IPCA 2X6GA 3QO2A 5CC4A 4IO9A 2CCZA 4B3RL 1NSNS 2F0TA 1PH1A 4X3KA 2ZTEA 1BBXC 4F87A 5IY0A 1EQTA 2E5LL 1G51A 1SE2A 2BE5D 4OL7A 1W2BA 3HOVH 3HOYB 3K7UC 1X32A 5C5LA 1XXGA 3CAMA 1EQQA 4FDBA 4M1UB 5FLMH 2N49A 3UE1A 5ELEA 3E6ZX 2HHHQ 3VYTA 4RA8A 5I9OA 1KDAA 1YBYA 3NBHA 2JA5G 1XPOA 4LUVA 1F9QA 1SJHD 1KQSA 4K14A 3U4ZA 2MO1A 3D4DA 1LT4D 4DUZL 3QIAA 3H0GB 4DR5L 2A68D 4JPBW 3H3VH 4LJZC 1NNXA 2G9DA 1YHQA 2UU9L 5CV5A 2HIXA 2NZHA 1B1ZA 4MNOA 3HOVB 3FHWA 1LM0A 4O42A 1B50A 2EVBA 4GLAC 2WB1G 2ZTDA 3JAML 2NN6I 5IYDH 1X55A 4KD4A 2D0OA 1CI3M 3H09A 4PMWA 2RHQB 5IT9c 1N36L 2ZXOA 2K50A 2A68C 5E4XA 2QF7A 5A2QL 1D5XC 2R93B 2VL6A 4EVOA 1DCZA 1NBWA 2KCMA 4X3UA 3J81j 3I4NH 4DR7L 1W3SA 1XWEA 2CH4A 2KQ3A 3W1GA 3OHXC 4C3IH 3SK4A 5H1SE 1K8MA 1SYCA 1TXYA 2F0KA 1FL0A 2Y0SG 2ALYB 3RLOA 4B9XA 3NHHA 4NXNQ 1S4ZA 5LMNL 3D4RA 4HIKA 5AJ3Q 4DNRB 2M9VA 3IFDA 3FVQA 2SDFA 2J4XA 4QQBX 4KTAA 3IRBA 1WTVA 2D5DA 4YCVA 2QW7A 2O5IC 3K5MA 1KXLA 1CKMA 4EQOA 4A3JH 4IPHA 3OIPA 4LK1C 1K73C 4DV3Q 1HUMA 1QZGA 3A5UA 1ONLA 3ND9A 5ELDA 1Y1WH 5J3BA 5C3XA 4RAUC 1TWFH 4OXPA 3FEWX 3S9WA 1I3QH 3J81L 4JI3Q 1JMCA 1EY9A 4ID6A 4L5TA 2ZM6L 2RKSA 4H44C 4FF4A 2F3IA 2L5TA 1YHAA 1YITA 1SJED 3I8ZA 1R9TH 4C3HB 1Q3LA 2RDHA 5IP7H 1AZPA 5EBCA 3ULPA 3T1YL 4DR1L 2EYJA 1F9SA 4OO1G 1G6ZA 2WFWA 4C1NI 1CQVA 5ELOA 1MI2A 1TWFB 1I3QB 1TQOA 5C44G 5FO7B 2PMZB 2JEAI 4YHHL 3M7NA 4BXXG 2VXWA 2ZXRA 4N8X1 5M3MB 1EEFD 3GV3A 1KNEA 3KLSX 1R9TB 2K75A 4QCLA 1I5FA 3FKIH 1QB5D 1IYUA 1EFID 3UE0A 2R92H 2FINB 2WIIB 5KIXA 1AP0A 5C0XH 1K8AC 2KBNA 1SDFA 1KDBA 4DR5Q 3R3OA 3LWUA 3PUYA 2EXDA 3R93A 1ZKOA 3EVQA 4GKKL 4PMCA 1U9RA 1QNUA 4GZYC 3HKZB 3MFYA 4DR2Q 4RHSA 5CYUA 1V43A 5CV7A 2L9HA 3V96A 3AU7A 4K0KL 2K5WA 2Q2UA 2R92B 3D4WA 2EYMA 1CSQA 2RDFA 4A3CH 1HHVA 4IURA 3GTLH 3AFQA 5HY6A 3K81C 2MGSA 2JQOA 1AE2A 2A6HD 3KFUA 1G6PA 2PNHA 1Q7YC 3VYSA 3KF8A 5D65A 1SE8A 3HOXH 1XNRL 3S1RH 1L1OC 2F0JA 4LF7L 2BH8A 3GP7A 1UE1A 1G91A 4A3FH 4R4OA 1A3TA 5IWAQ 3CMEA 3TMEA 4C2MH 1WTHA 4APVA 1PZJD 3GTKH 3GTQH 2PI2A 4DFAA 1JORA 1X3FA 1DOKA 3OPOA 4JVZA 4NXML 4UP9A 2D2CC 3U58A 1NMFA 2UXBL 3OW7A 2PW7A 4X65Q 3S1RB 1BBUA 1HPCA 3TSSA 4DXGA 3NENA 2DN8A 4J15A 5C3EG 2C9OA 3HFZB 1RKNA 2WINB 4B3SQ 5ELCA 1K3BC 2R3ZA 2VB3X 4QJFA 5I2YA 1F77A 2Z6KC 3I7FA 3MXGA 5KNCA 4TKOB 4A3FB 3GTPH 3PIP3 1CZWA 3AB9A 4DA2A 2O2LD 4A3LG 3EA6A 4IPDA 4A3GG 2AQ3B 3M85A 2AWOA 3BZCA 3GTKB 3GTQB 4H13C 3GTOH 1LTRD 1DOMA 1ZEQX 4O2DA 3KK7A 4RGOS 4AQYQ 2N88A 4HJ5A 1C4QA 3TREA 3FRPB 3E9HA 1H9KA 3HRZC 4DAYA 4YWMA 1PDQA 2F52A 4UP7A 3PO2G 2ATWA 1OO9B 3CC7A 2OTJA 1F2YA 3GTPB 2WB1E 4RGNA 1V1PA 1HR0L 4PQXA 1LTAD 1PFNA 1P8LA 4DPGA 3FMCA 4KY5A 2R6GA 5K36G 1DXMA 3SK8A 2JA8H 2QEXA 4CJ0B 4IFDI 3SHLA 2FJ2A 5FJ8G 4EQ5A 3HOYG 2KJXA 4LF6L 4BS9A 4DK0A 4O0AA 2HQLA 1PTOC 5M5YH 1K8OA 3R8BA 1A8VA 4NB3A 3S17H 1Z47A 3PSIA 2NZOA 1SNPA 1F9PA 3E0JA 1FGUA 3ND8A 1N32L 4DF7A 2CW0D 3H0GG 3QOLA 3CCUA 2JA8B 1A62A 3KOJA 1IBML 3PF5A 1N34Q 1H9JA 3HOVG 1X6OA 2VS1A 5IGFA 1Q1EA 5M5YB 2E2IH 1GHKA 4R4TA 2VUMH 1LYLA 2CW0C 2RSOA 3FPPA 3S17B 1VQIA 4DAYB 2R93G 4HEDA 3PIOA 3CCLA 4CGYB 2NVYH 4HMIA 4WRDA 4ZUJA 2NVQH 1HNZL 2N55A 2N78A 3QR8A 2JN4A 2RHSB 2YTYA 3VR4A 1CQFA 1J5EQ 1C0AA 2B2VA 1J6QA 1LO5D 3A0JA 4KLKA 1Y8OB 4TQUS 3NWTA 2EE1A 4DK1A 4OX9L 2Q2TA 1SMXA 1QG7A 3CP0A 3CW2C 3K7AH 2E2IB 3W5OA 1PA6A 5KNDA 2VUMB 4TVAB 5NUCA 1S5ED 4GS3A 3PO3H 5CORA 4JI1Q 1D2BA 1EUJA 1RHPA 1QUQA 3BDLA 2NVQB 1IYVA 1ZYRD 2MQHA 4O1NA 1VF7A 3J80i 3DWPA 2K52A 4BXXH 4P75A 1RD9D 4C1NK 2WP8J 2DJFC 1EL0A 1EYGA 2PPBC 4WJ3M 1JQYD 2HUGA 2AHOB 5C6AA 3J81E 4ZQ3A 3PO3B 1ZYRC 4QUFA 4BWGB 3I4LA 4B9WA 4LF5L 3RLNA 4DV6L 4PV1C 4C3HG 1I50H 2CHBD 3K57A 1GKHA 1XMOL 3S1MH 2IT1A 1PH9A 3VR6A 4ZYSA 3TS2A 3AYHB 2BCOA 1STHA 1Y1WG 1Q8IA 2UXDQ 1JB3A 2ZT9C 3RMHA 1PV4A 4MHEA 5DM63 1RJTA 3SK5A 4CKBA 3LNNA 1I94L 1YVCA 5IODA 1M8AA 5M3MG 1WVLA 2EY5A 5FO8B 3DUZA 2J0TD 1M90C 1OTCA 3G6EA 1I50B 1DJRD 5IP7G 1QOHA 2I07B 3M4PA 3S1MB 1IBKL 1Q1BA 3I4MH 3J7AV 4WORA 5BR8Q 3ER0A 5C0XJ 1OXXK 3K5LA 2F0IA 4DN4M 3KBGA 2Q2HA 1L1OB 4YIJA 2WACA 2XNAC 3Q23A 2E2HB 3MAQA 2ES2A 4GLVB 1SNCA 2HHHL 4GNXB 3HKZG 5C4JH 5I4DA 1JJGA 1JICA 1NR2A 4J8QA 3I72A 1LT6D 5M9OA 3CF5A 4J1MA 2PZWA 1A2TA 2QEJC 4GOPA 1X56A 2P5ZX 2KCCA 2R92G 4L6TB 3I4MB 4PZ6A 2XTIA 2RCFA 1DD2A 1ENFA 4RKBA 2CQOA 4V190 4ZCKA 4FVMA 4GLXA 1IZ6A 5C4JB 1TS2A 4DU9A 4A3MH 1B3AA 3KUPA 3E3XA 1EY8A 1EFWA 4Z9CB 1VQNA 2F0FA 1TS3A 3IFTA 2NWGA 2RDGA 2F0UA 1WTRA 4DKAC 1WI5A 2E76C 2NTTA 1KLGD 4A3LH 3C3LA 3NE5B 1LT5D 4A3GH 2EJMA 3TS0A 1EYCA 3VDYA 4R1JA 1NTGA 1TWAB 4NXNL 3CHBD 1VQDA 3Q22A 4JI0Q 1AZQA 4GN3B 2I0QA 2G5DA 3T16A 1PTOH 2EDGA 2KEEA 1X3PA 5AJ3L 1IKMA 4IALA 3T53B 3ZYYX 4A3MB 1TS4A 1PFSA 5KEEA 3NELA 1Y8NB 1KNAA 1BQQT 1TY2A 3J80E 2K6AA 4RMFA 4UP8A 1STAA 3HOZH 2R7FA 1YEZA 4DV3L 5E7NA 4V0BA 2E2JB 3P20A 4A3FG 2HQEA 1WCMH 3TP5A 4ZRZA 4QIWB 4JI3L 3H6MA 3HOYH 1PTOB 1HZAA 1E24A 1UE6A 1RTNA 1NY4A 4PNYA 2B39A 3CU7A 3RUZA 3STBC 4XYQA 2F0DA 2PO4A 1PFBA 2FFKB 3NQIA 1AFPA 1XJVA 4HSVA 1K3RA 1HFGA 2IL8A 1D8LA 3HOZB 3W1BA 1WOCA 4XQJA 2PQAA 3A8JE 3H0GH 3MTSA 3DHQA 4POFA 1WCMB 2IX1A 1IBKQ 4LAAA 1AH9A 1Y8PB 1GVPA 1HJPA 4ALPA 1SNOA 4OEMB 3G71A 1VQAA 1X54A 2K7VA 1VQEA 1GOZA 4A3DB 4XQQA 2F0SA 5K5PA 1PRTC 1UEBA 2M2LA 4G4KA 3BZDB 3N6RA 3QWNA 3A8IE 2R93H 5IGBA 1E22A 4N8FA 2L15A 1PZID 4QUCA 3OW2A 2X69A 4R4CA 3SK6A 2HT1A 3J80c 2XGTA 3LGJA 4RGMA 1I4XA 2BDOA 4OIKA 5I6WA 2K5VA 2JA8G 3M3YH 1ICWA 1UEAB 1QZHA 3S14H 4DR2L 1MBYA 2B2WA 5AFWA 1JJ2A 5FKAC 4LFBQ 2KHSA 3NWSA 3CPWA 4K6LA 4K8IA 2YV5A 2I5MX 4X66Q 5CV8A 2LS01 2LFNA 1YJNA 2AQ1B 3OIQA 4OONA 4RHRA 1M4VA 4G7ZC 1S40A 1SROA 1FNWA 1WD0A 5EKKA 4NMZA 1GHJA 1DM0B 3MFGA 1NAPA 3LWEA 1SNQA 3M3YB 1CKNA 3S14B 2IX0A 1FD7D 1KIXA 2R61A 4NW2A 4L5RC 1VQ8A 2B63H 3EIVA 1S72A 2VNUD 3ONAB 3U9OA 1HTPA 4OO1I 2VQEL 2VUMG 2XIWA 1VQCA 4R8IA 4JCVE 4C3HH 5ELNA 2MFIA 1S5CD 2KVMA 3NBHB 1L0WA 5IWAL 3DMUA 4EX5A 2SNMA 3Q6SA 4WFN3 2EYLA 3MEHA 2E8GA 1D7QA 1SXTA 2KA7A 3H94A 1BKBA 4XIGS 4QGUA 3UDFA 2K33A 4A3BH 1BUVT 4X65L 3F2CA 4FF1A 2L1BA 2K01A 2B63B 1U5KA 3OWFA 5IIFA 5M3MH 4A4IA 4B3SL 1Q82C 2NZ1D 4HCEA 4DAPA 1QWYA 3DWQA 4B3TQ 2EYOA 1EY7A 3TN2A 1STEA 2RCNA 3D8GA 1NJIC 3WOFA 1BCPC 3PO3G 4IOAA 2A73B 5J22A 1PLFA 4JC0A 4JBKA 1SE4A 4ILWA 3BZKA 2CFMA 3HKZE 4H0LC 2O5JC 1HUNA 4HJ9A 4ODGA 4M8AA 5G3LD 2KUMA 1B3QA 2ICIA 2FMMA 4AQYL 1AE3A 4A3BB 4LF9Q 4DV7Q 1YI2A 1PVOA 4L5SA 1VQKA 1HNWQ 2F0LA 4NP5A 4BY1H 3KF6A 1PH5A 1T5XD 1O78A 3GV6A 3D31A 1PH6A 2I46A 1PRTF 3M4YA 2B2TA 4X64Q 1L2FA 4S3SA 5CBAE 1BVSA 1ESRA 1A3VA 4A3KB 5HGQA 4P73A 1C7YA 1FNUA 4RG1A 4NKLA 2QDBA 3CCJA 2TSSA 1YNNC 3NTKA 2B2VC 4PG3A 4BY1B 3U50C 2AMCB 4NDXA 1YHBA 2NTSA 3MHBA 1G291 2FHTA 1C9OA 1QE6A 4JV5Q 4JI4Q 3NP8A 5ELBA 4KHPQ 4FXGC 5IGGA 1LT3D 3BS1A 1FJGQ 3WOEA 5LL6X 2B2YA 5JAVA 2C35B 4FXKC 4AYBG 4DV1Q 3NUCA 1K83H 1VDZA 4DR4Q 3I4MG 3JAMi 2KHJA 3TZDA 1N34L 1B44D 3NEMA 4FO2A 2UUBQ 3CRLC 3AQQA 1PH7A 4ZKBB 2K32A 4X3SA 1K28A 5JVG3 2PW5A 5GAGC 1PYWD 2B8FA 2R7ZH 3FP9A 4KV6A 4G7HC 4RGTA 5M5XH 3CKIB 4K2KA 2D0PA 2YYZA 4GNXC 2VQEQ 3P1HA 2OXPA 1LLRD 4OIJA 1SFOH 1D6EC 1LTLA 3TP7A 5GAHC 1EY0A 2O4XA 1EWHA 1CK1A 1K83B 1J5EL 4R4QA 1F2MA 1EOTA 3I55A 2UUAQ 2EPBA 1YJ9A 3A7LA 3TP6A 3HS0C 4N9TA 1KRSA 4JI8Q 4CDFC 5GQOA 2R7ZB 4WJ4A 1U4RA 4KD3A 5M5XB 1NMGA 2F4IA 2Z6BA 4KHZA 4A3MG 1X65A 4JI1L 1S5FD 1SFOB 3GDEA 3SE0A 5L37A 3K5OA 3K80C 1G2TA 4X3TA 3I2ZA 1STGA 4P74A 1EWIA 1BO0A 1VQPA 3J81i 4DK3C 4JG2A 1E1OA 1EY5A 4IUPA 5LMNW 2OWOA 1PRTB 5IE8A 5D3DA 3VA5A 3KF8B 4IOCA 2EIFA 2JA6H 4B3MQ 2MNAA 1VQ6A 1RF2D 4UAIA 2IWHA 2A8VA 5IT9L 1HNXQ 3PIO3 5LL6S 1XPRA 5EPJA 3GQBA 3P75A 3L3OC 5E3FA 1VQMA 4HSPA 3A5ZB 3C1EA 2ZXPA 1PTOD 3HOZG 2CKZB 1R4QB 3FDTA 1WTWA 2AQ2B 2GA4B 5G3LF 4K5XA 3J7A5 5BN4A 2UXDL 1ENCA 1WCMG 1KAWA 1GUWA 1CM9A 1NR4A 2F0EA 1CHQD 2OCEA 4RCNA 2FXQA 2RBMA 3AMUA 1XNQQ 1Q86C 3SVMA 2MP1A 5IP9H 3ULJA 2NYZD 2JA6B 1KDCA 3RLFA 5FLXL 4I7AA 1O7ZA 3NK9A 1JC7A 5FK9C 4ABNA 1SSOA 2Y0SE 4A3DG 3RZOH 4AH6A 1XPUA 2EZVA 2QKIC 3GTMB 4KKUA 1V1OA 5J1ZA 3H3VI 1V9PA 1FNVA 2K5HA 3I73A 5BR8L 3A7AB 3H15A 2VQFQ 4LWCA 1EU3A 3A8KE 4ZKCB 1I4RA 3SGIA 2Q8TA 3S15H 1RIPA 1JJCB 3T4AC 4DXFA 4XDXA 1YIJA 2F1MA 4IUNA 3CCQA 2V1CC 3A56A 1PXUA 1B7YB 3RZOB 3H91A 4YY3Q 1GM5A 2PZTA 3JAME 2KCTA 1JWMD 3MC0B 1DONA 1WJJA 2MO0A 4JBJA 3T13A 1IKLA 2GVAA 5A2QE 1D1KA 1V1PB 3S15B 3PF4A 1LV9A 1EIYB 3UDIA 3HOWH 2RQXA 3K5NA 1SNDA 4YCUA 1EIFA 4K8JA 4C3JH 2AKWB 4Y7NH 4L8JA 1O7YA 1CA5A 3FPUB 3ICEA 4FNFA 1BCPB 3CRKC 3K0XA 1EOVA 1VMCA 1AW7A 3W2DA 5JEAH 4EGVA 1BBWA 2L4NA 1FVIA 2OQ0A 1SYBA 5EKLA 1V8QA 1X3QA 4LFCQ 3C1FA 3QJYA 1HZ9A 5C4XH 3HOWB 1VQHA 1PYSB 4P72A 4JI0L 3BYYB 1FYCA 5CR3A 4DV2Q 1IW7C 1SYEA 4C3JB 5FO9B 4Y7NB 3CCSA 1Z9FA 2E75C 5JVH3 2LXJA 4CJ2C 1KC8C 2A1AA 2UUCQ 2BH2A 4L5QA 2B63G 2LXKA 2F3WA 5JJZA 3NBIA 1VQOA 1EY6A 4IJHA 1TU2B 4KKTA 4IQZA 5EGTA 4Y52H 2XWBB 3EQLC 2ZJRA 3R2IA 4B08A 2RF4A 1GUNA 5CBEE 5JJLA 1HQMC 5TSSA 5C4XB 3JAMc 3BU2A 4UPAA 2K14A 4BA1I 4LF8Q 1L0YB 4F88A 3QB3A 5GROA 4BBSH 1B8AA 4A3BG 4CDDC 3DWAA 1IHZA 4AYBE 1PH8A 1DGSA 1B9NA 3ITPA 2E2HH 2IJ0A 5KYIA 4HIDA 1GUTA 4DV0Q 5JOBA 4RH6A 3KYHC 5LMUQ 2A6ED 1SE3A 2MHVA 3TDQA 3RNUA 4GN5A 1V1QA 2B2WC 1K9MC 5C0XI 1HXYD 3PUWA 4JBWA 3OMGA 4RCOA 5IYCH 1PTOF 3RR5A 1SYFA 4XYOA 2F0MA 2F0GA 1QUQB 2WAQB 3CMAA 5KYLA 5I9PA 2HDMA 3MVVA 2I5HA 4Q0FA 2Z8LA 2A6EC 4A3KG 3D3RA 1Q12A 1JWSD 1SNMA 2AUKA 2MPMA 4BBSB 1XMQQ 1E7ZA 5I2XA 1L0XB 2DGYA 1QCBD 3NPPA 4QF4A 3F1ZA 1VQLA 1XYIA 1Y69U 4JBMA 2QA4A 1I6HH 4BY1G 4DR3Q 3M7GA 1TY0A 1HR0W 3W3AA 3MXNA 1BDOA 1VMPA 4X6AH 4DK6C 2VW9A 1AEXA 4LFAQ 1VQ5A 4KI0A 2XN9C 2K5NA 1CTMA 1Z6HA 3J81c 2NVTB 2IPKD 3DXJC 3VYUA 3HOUH 4CBVA 2A74C 1KL9A 3E9IA 3T1HQ 1TWAH 1EZ8A 1HCZA 2HCIA 1B53A 1D1IA 4LW1A 4LFBL 4UDUC 5CMDA 1I6VC 4ZK9B 1OXVA 2X6LA 2ICEC 1IBLQ 2K5DA 4X66L 3GTGH 1I6HB 3MWYW 3V05A 2OT2A 3ERSX 4JW0A 3GO5A 5C5MA 3HP3A 4QIWE 1OXTA 4KJNA 2PQEA 2KOLA 2FMCA 5CV6A 4DNIA 1GO3E 4ME5A 3F2BA 2ZJQA 2JJQA 4JOIA 4KY6A 2A69D 1VQ9A 2E2JH 4I7ZC 3HOUB 1GXDC 2EJGC 4CDCC 5GAEC 5COYA 5JPMC 1I4GA 4QY7A 3MZ5A 3CPFA 2JYOA 3F2UA 1EY4A 3Q24A 3GTGB 1C48A 2A69C 2R7ZG 4ME3A 1UAPA 1FGBD 2IX3A 3D6WA 2F4VL 1B9MA 1YNJC 4DUYQ 5C4HA 1O80A 1JOOA 2ENBA 5GADC 1QVFA 3BVZA 1EIGA 3MXNB 3STBD 4F8MA 4GOPB 3SDZA 2JE6I 2VY3A 3NTHA 3AEVA 1Q90A 2K03A 2CH4W 3TRZA 1EIHA 1PH2A 4L63B 4LUZA 1YNXA 4HR7B 1WYDA 2B2TC 4JI2Q 1Y14B 2K1BA 1H9RA 1RODA 2JEBI 1KLUD 4B3TL 4A3DH 2JXMB 2UXCQ 3CCRA 5C4ZA 3N52A 4A3EB 4BY7B 4LF4Q 1F2ZA 5IT9E 3OTOQ 1CSPA 4TRDA 1PRTD 2MJ8A 2EY1A 2N8NA 4DR6Q 5DNFA 1LACA 2F0NA 1DYQA 2EOTA 4LF9L 4DV7L 2D9UA 1WTPA 1ASYA 4JI6Q 2B2YC 1O7IA 2L12A 2JA7B 2CVRA 4IPGA 4DV4Q 1ZXTA 1HNWL 1TWGB 2JA6G 1VQJA 2B8GA 1ET9A 1TWHB 3I3CA 4CKCA 1D5ZC 3A74A 1ILQA 4FP5D 4LMQD 2K5QA 1TT2A 5FLXE 4JYAQ 1A15A 4MTKA 4KKSA 5E1FA 3IKJA 1JE5A 4X64L 3PMFA 3KLRA 3GTJH 2YU9H 3BDOA 1TKWB 2NUCA 4UHVA 2IHEA 4KN4C 5EPKA 4HN7A 4IFDH 1NUCA 2CWAA 4GKJQ 4DV5Q 3SEBA 1HH2P 3PUZA 1F9RA 3MXUA 4R9WA 1VQ7A 1J9OA 5IP9G 2K04A 4R8NA 2BE5C 1N8RC 4JV5L 4JI4L 1EQRA 4KHPL 1Y1VH 3L2PA 3HEJA 1TWCH 1FJGL 3NQTA 5KGUA 1KHIA 4KJOA 3CQZH 4H7BA 4DV1L 1G2SA 4ZAIA 4DR4L 2PZUA 5I6YA 3GTJB 2E2DC 3TP8A 1LTBD 3WDNA 2YU9B 1EYDA 2PQAB 5HURA 2UUBL 1N33Q 4ULLA 3KJOA 3SXHA 4HCSA 3BJUA 1GUSA 2G9HD 2DJGC 2H4OA 3S24A 3OOCA 4KHVA 1K0SA 2H1EA 1Y1VB 2LSSA 1EYAA 1UE7A 1TWCB 1E3PA 2F4VQ 5C3WA 3CQZB 2B2UA 5JEAJ 1CZGA 2PMZE 1PZKD 4DAMA 4ZLTF 1IL8A 2UUAL 1SN8A 4BBRH 2IHFA 1A3UA 4A3IH 5FLXc 2AUJD 3BYTB 4JI5Q 5M5WH 3HOWG 1BCPD 3NTIA 2PCFB 2EY2A 4JI8L 1Z7TA 1M1KC 1MIUA 2KECA 4MN3A 4CHTB 1U4LA 2NN6G 4C3JG 3RN5A 1TVXA 3I4NB 3HKSA 4FXDA 2HIVA 3KDFA 3GD7A 3G7LA 4C3IB 1OXUA 3C46A 2PYKA 1E0BA 2XWJB 5JEAG 4QB4A 3DLLA 1PHJA 2BA1A 1ILPA 1HZCA 2F0PA 3VR5A 4U673 4JI7Q 3VR2A 1K8GA 4BBRB 4A3IB 1JCKB 4FF3A 5M5WB 2KCNA 5C4XG 3CC2A 4A3KH 1VF5C 3VR3A 4IUUA 4YWLA 4AIMA 1CKNB 4B3ML 2A19A 4OWTB 2EJFC 2R7DA 1B2TA 1HNXL 1KAAA 4A3JB 1MKHA 1CA6A 2D62A 3WWVA 1XTCD 2Z4IA 3UDXA 2VZAA 1Y1WB 1NE3A 1YNND 4Q5VA 5D3IB 4B3RQ 2K4KA 4G57A 4K5WA 1EWCA 1U4MA 2E5LQ 1XTDA 5IYBG 3QOJA 3DM1A 1XNQL 2WAQG 5KNBA 4IUQA 2SOBA 1BR9A 1IXRA 4BBSG 4HMJA 3X3MA 3J7ZC 1HTLD 2MUYA 1ICFB 2BOSA 4U68A 3KDFB 4DUZQ 3T56B 3OYYA 3IL8A 2VQFL 1MSHA 3K59A 2AWNA 5IYCG 3JC66 2UU9Q 1A6XA 4JK1C 1TS5A 3RN2A 4XTCS 5JJIA 1PMRA 1S3OA 2DNCA 1GJXA 2ASBA 1TR5A 2C5CA 2I5LX 1N36Q 2N3SA 1N9WA 2EQSA 3M4QA 2XRSD 3Q0AA 4K2LA 1CFMA 3FKIB 1HQRD 4YY3L 1YZ6A 5JJKA 1JOQA 2JP1A 4CKEA 3VA7A 4DNTB 2RSNA 4DR7Q 4HIMA 3KF6B 1LTGD 4I65A 3J7AF 1QJOA 3G4SA 2EXZA 3CCEA 1DOLA 1TIID 1S5DD 2YTXA 5EJWA 1BOSA 1JR0D 1MHWC 2KEDA 3NSWA 3HOUG 1UUPA 4HTHA 5LMNQ 5DM73 4FF2A 1DZ1A 2DY8A 4EQPA 2KHIA 3I90A 4K6DA 5IGCA 3L0OA 2A6HC 2L55A 3D0FA 3GTLB 4IJLA 4OWWB 4N9PA 3LX0A 4YCWA 3ERQA 1B4OA 1LABA 3I4OA 3PUXA 1S5BD 5T1GA 1QVCA 2PI2E 1KABA 3DM3A 4LFCL 1VS0A 2IW3A 2K28A 4FYDA 2EYPA 3G6JB 4A93H 3F8TA 2L11A 2NVXH 3J80L 1A0IA 5ELFA 4P2CB 3UI2A 4DV2L 3HOXB 4OELB 1BCPF 4DAVA 1BNZA 1LTID 2ZM6Q 4OWXB 5M3FH 1VCIA 2UUCL 5T1IA 1RL2A 1CKOA 3CD6A 4UY8C 2EY6A 1ESFA 4HJAA 4HJ7A 2F03A 1I4HA 3URYA 1E2WA 4CJ1B 3T1YQ 1LTTD 4DR1Q 2OF1A 4C2MB 1KTKA 3GTMH 3B6YA 2B29A 5DLQE 4A3EG 4BY7G 3P7JA 3ULLA 4A93B 4LUOA 1A2UA 3MA2B 3IAYA 2NVXB 3EJIA 5ISRA 4MIUA 1VQFA 4LF8L 4YHHQ 1PH4A 3BDCA 4GOPC 4MTNA 5M3FB 2CQAA 4P71A 2HD3A 3PGZA 3CCVA 2JA5H 5BN3A 4DV0L 4PZ7A 2F0WA 2JA7G 1SYDA 2JSOA 5LMUL 1GD7A 1SEBD 2CWPA 1EZ6A 1STBA 2XVSA 5CGKA 4H02A 2IY5B 1MJEA 1NCVA 3UDGA 3GTOB 3HG9A 4HIOA 1ASZA 3RD4A 1AN8A 4GKKQ 4POGA 1JE4A 1XMQL 4IFDJ 1F2LA 1X9NA 3R2TA 4JOIC 5J39A 2Z0SA 3RZDH 2A5HA 2JA5B 3EFXD 3QG1A 2WV6D 3J7YW 5BN5A 1SYGA 2QCPX 1WFQA 2GN5A 4K0KQ 3DEOA 4DR3L 2Z4HA 4TSSA 1U0LA 4IZ8A 1UNSA 4HAEA 3EROA 4LFAL 2EYHA 3KLWA 3M9BA 1H95A 1G8ZD 3DEPA 3PIPA 2EYFA 2WB1B 4OGQC 5DEHA 2KENA 4PMBA 3T1HL 1H9SA 1SMYD 1PH3A 5E4WC 1U4PA 2Q8IB 4IFDG 2WKDA 2F0OA 3M4OH 2XRQD 3RZDB 1WTXA 1ET6A 1XNRQ 5FLMG 3F2DA 2NN6H 4LF7Q 2B3GA 1W6KA 2Q8RE 1IBLL 4K5VA 2J7ZA 5EPLA 3K0YA 4RKLA 3X3NA 5KRUA 1PFMA 3I91A 5CV9A 1IW7D 3I70A 4BA2I 1RCVD 1Y1VG 1SMYC 1MGSA 2NB0A 2RVLA 2Y0SB 2Z9HA 3V2TA 5IOCA 1T5EA 3CC4A 2BA0A 5D14A 1GUGA 3HZXA 5JPNC 3I56A 1VQ4A 1MSGA 1CHPD 4NXMQ 2ID0A 5IYDG 3M4OB 2UXBQ 3EN2A 3BVGA 1MD2D 3G48A 3TBIB 3L7ZC 3U9SA 1W6JA 2L0CA 3L9AX 1CUKA 1HA5A 4OO1H 1R4PB 3OMCA 4DUYL 2NVYB 3I4NG 2WAQE 1B70B 4R4IA 4C3IG 1UWVA 1II3A 1LUZA 4KMUC 2DUDA 1EQVA 1L1OA 3PV0A 5C44H 3SR1A 3H3VC 5LHY1 4DGZA 2F0VA 1D5MC 5IYBH 2LY7A 4C56C 2M00A 1H9MA 1OXSC 4GNXA 4BBRG 3K7AB 4A3IG 2XSCA 4OHJA 2NBFA 4A75A 1H9SB 3S1NH 4IN3A 1MJCA 4JI2L 1E2ZA 2Z1CA 5IGEA 2DY7A 2TMPA
chains in the Genus database with same CATH topology
3BVMA 4XXEA 3K6OA 4G7OC 3C2PA 3NXWA 4XQNA 2OEOA 5C44B 1RDPD 1FR3A 3S1NB 4KY7A 1EU4A 2DNEA 1JWUD 4WJWA 1WTOA 3S2DB 4XT1B 3S1QB 4XT3B 2K05A 4RWSC 1I4PA 5A35A 1STYA 2VB2X 2B2UC 4KN7C 2LMCB 4QMGA 5F2DA 1E2VA 4AYBB 3OSOA 5FOBB 3O13A 3KBXA 5EKIA 1ML0D 1SBBB 1BF4A 5HGTA 5C0XG 2F3VA 4E6IA 3VYRA 1YNJD 1ENAA 4IUVA 4KK7A 1HRJA 1XX8A 1LTSD 3T51B 2QILA 1WD1A 3KLSA 5EBDA 4EQNA 1HFNA 2HDLA 3PUVA 2SNSA 1QILA 5DAUA 2HCCA 2BDNA 1WTQA 4IUTA 3A54A 5C3EB 3TZUA 3MXPA 1J8IA 2F0QA 3K58A 1C8CA 1HA6A 1RTOA 5EQ0A 3S2HB 2RA4A 3E5SA 1EEID 4A3GB 4RFBA 2PNRC 5K36H 2LKVA 2F0HA 1STNA 5IGDA 4F7XA 4J6HA 1I4QA 3A55A 3D6CA 1BXTA 1QNKA 3S16B 1CT1D 3HGBA 1GUOA 1JOKA 3PO2B 5CV4A 3OWEB 2E74C 3BG3A 2V4DA 2WKCA 2SEBD 1O7LA 1SAPA 4ZUIA 2X6GA 3QO2A 5CC4A 1NSNS 2F0TA 4X3KA 1BBXC 4F87A 1EQTA 1SE2A 2BE5D 4OL7A 3HOYB 1X32A 5C5LA 1XXGA 4M1UB 5ELEA 3E6ZX 3VYTA 4RA8A 5I9OA 1KDAA 3NBHA 1F9QA 1SJHD 4K14A 3D4DA 1LT4D 3QIAA 3H0GB 2A68D 4LJZC 2G9DA 5CV5A 1B1ZA 3HOVB 4O42A 1B50A 2EVBA 3JAML 2NN6I 4KD4A 1CI3M 3H09A 4PMWA 2ZXOA 2A68C 5E4XA 2QF7A 5A2QL 1D5XC 2R93B 4EVOA 1DCZA 4X3UA 1XWEA 2KQ3A 3OHXC 3SK4A 1K8MA 1SYCA 2F0KA 4B9XA 3NHHA 1S4ZA 3D4RA 4DNRB 2M9VA 3IFDA 3FVQA 2SDFA 2J4XA 4KTAA 1WTVA 2D5DA 2O5IC 3K5MA 4EQOA 3OIPA 4LK1C 1HUMA 1ONLA 3ND9A 5ELDA 5C3XA 4RAUC 3FEWX 3S9WA 3J81L 1EY9A 4ID6A 2RKSA 4H44C 4FF4A 2L5TA 1SJED 3I8ZA 4C3HB 1Q3LA 2RDHA 1AZPA 5EBCA 2EYJA 1F9SA 4OO1G 1G6ZA 4C1NI 1CQVA 1MI2A 1TWFB 1I3QB 1TQOA 5FO7B 2PMZB 2JEAI 3M7NA 2VXWA 2ZXRA 5M3MB 1EEFD 3GV3A 1KNEA 3KLSX 1R9TB 4QCLA 1QB5D 1IYUA 1EFID 2FINB 2WIIB 5KIXA 1AP0A 5C0XH 1SDFA 1KDBA 3R3OA 3LWUA 3PUYA 3R93A 1ZKOA 3EVQA 4PMCA 1U9RA 1QNUA 4GZYC 3HKZB 3MFYA 4RHSA 5CYUA 1V43A 5CV7A 2L9HA 3V96A 3AU7A 2K5WA 2R92B 3D4WA 2EYMA 2RDFA 1HHVA 4IURA 2MGSA 2A6HD 3VYSA 3KF8A 5D65A 2F0JA 3GP7A 1G91A 1A3TA 3TMEA 1PZJD 4DFAA 1JORA 1DOKA 3OPOA 2D2CC 3OW7A 2PW7A 3S1RB 1HPCA 3TSSA 4DXGA 2DN8A 2C9OA 1RKNA 2WINB 5ELCA 2R3ZA 2VB3X 5I2YA 1F77A 3MXGA 5KNCA 4TKOB 4A3FB 3PIP3 1CZWA 3AB9A 4DA2A 2O2LD 3EA6A 2AQ3B 3M85A 2AWOA 3GTKB 3GTQB 4H13C 1LTRD 1DOMA 1ZEQX 3KK7A 4RGOS 2N88A 1C4QA 3FRPB 1H9KA 3HRZC 4DAYA 1PDQA 1OO9B 1F2YA 3GTPB 4RGNA 1V1PA 4PQXA 1LTAD 1PFNA 3FMCA 4KY5A 2R6GA 5K36G 1DXMA 3SK8A 4CJ0B 4IFDI 3SHLA 2FJ2A 2KJXA 4BS9A 4DK0A 1PTOC 1K8OA 3R8BA 1Z47A 1SNPA 1F9PA 3E0JA 3ND8A 4DF7A 2CW0D 3QOLA 2JA8B 1H9JA 5IGFA 1Q1EA 5M5YB 1GHKA 2CW0C 2RSOA 3FPPA 3S17B 4HEDA 4CGYB 4HMIA 4WRDA 4ZUJA 2N55A 3VR4A 1CQFA 2B2VA 1LO5D 1Y8OB 4TQUS 3NWTA 2EE1A 4DK1A 1QG7A 2E2IB 5KNDA 2VUMB 5NUCA 1S5ED 5CORA 1D2BA 1RHPA 3BDLA 2NVQB 1IYVA 1ZYRD 4O1NA 1VF7A 3DWPA 1RD9D 4C1NK 2WP8J 1EL0A 2PPBC 1JQYD 2HUGA 5C6AA 3J81E 4ZQ3A 3PO3B 1ZYRC 4QUFA 4BWGB 3I4LA 4B9WA 4PV1C 4C3HG 2CHBD 3K57A 2IT1A 3VR6A 4ZYSA 2BCOA 1STHA 1Q8IA 1JB3A 2ZT9C 3RMHA 4MHEA 5DM63 1RJTA 3SK5A 4CKBA 3LNNA 5IODA 1M8AA 1WVLA 2EY5A 5FO8B 3DUZA 2J0TD 1I50B 1DJRD 1QOHA 2I07B 3S1MB 1Q1BA 3J7AV 4WORA 5C0XJ 1OXXK 3K5LA 2F0IA 4DN4M 3KBGA 4YIJA 2WACA 2XNAC 3Q23A 2E2HB 3MAQA 1SNCA 5I4DA 1JICA 1NR2A 4J8QA 3I72A 1LT6D 5M9OA 4J1MA 2PZWA 1A2TA 2QEJC 2KCCA 4L6TB 3I4MB 1DD2A 1ENFA 4RKBA 4V190 4FVMA 5C4JB 1TS2A 4DU9A 1B3AA 3KUPA 1EY8A 4Z9CB 2F0FA 1TS3A 3IFTA 2NWGA 2RDGA 2F0UA 1WTRA 2E76C 2NTTA 1KLGD 3C3LA 3NE5B 1LT5D 2EJMA 1EYCA 1TWAB 3CHBD 3Q22A 1AZQA 3T16A 1PTOH 2EDGA 2KEEA 1X3PA 1IKMA 4IALA 3T53B 3ZYYX 4A3MB 1TS4A 5KEEA 1Y8NB 1KNAA 1BQQT 1TY2A 3J80E 2K6AA 1STAA 4V0BA 2E2JB 3P20A 2HQEA 3TP5A 4ZRZA 4QIWB 3H6MA 1PTOB 1RTNA 4PNYA 2B39A 3CU7A 3RUZA 4XYQA 1AFPA 2F0DA 2PO4A 1PFBA 2FFKB 3NQIA 4HSVA 1HFGA 2IL8A 3HOZB 4XQJA 3A8JE 3MTSA 3DHQA 2IX1A 1WCMB 4LAAA 1Y8PB 1SNOA 2K7VA 1GOZA 4A3DB 4XQQA 2F0SA 5K5PA 1PRTC 2M2LA 4G4KA 3BZDB 3N6RA 3QWNA 3A8IE 5IGBA 1PZID 4QUCA 2X69A 3SK6A 4RGMA 1I4XA 2BDOA 4OIKA 5I6WA 1ICWA 1UEAB 1MBYA 2B2WA 5AFWA 5FKAC 2KHSA 3NWSA 4K6LA 4K8IA 5CV8A 2LS01 2LFNA 2AQ1B 3OIQA 4RHRA 1M4VA 4G7ZC 1FNWA 1WD0A 5EKKA 4NMZA 1GHJA 1DM0B 3MFGA 1NAPA 3LWEA 1SNQA 3M3YB 3S14B 2IX0A 1FD7D 2R61A 4NW2A 2VNUD 3ONAB 3U9OA 1HTPA 4OO1I 2XIWA 4R8IA 1S5CD 2KVMA 3DMUA 2SNMA 3Q6SA 4WFN3 2EYLA 3MEHA 1SXTA 2KA7A 3H94A 4XIGS 2K33A 1BUVT 4FF1A 2L1BA 2K01A 2B63B 3OWFA 5IIFA 4DAPA 2NZ1D 4HCEA 1QWYA 3DWQA 2EYOA 1EY7A 3TN2A 1STEA 3D8GA 3WOFA 1BCPC 2A73B 5J22A 1PLFA 1SE4A 4ILWA 4H0LC 2O5JC 1HUNA 4ODGA 4M8AA 5G3LD 2KUMA 2ICIA 2FMMA 4A3BB 2F0LA 4NP5A 1T5XD 1O78A 3GV6A 3D31A 2I46A 1PRTF 3M4YA 2B2TA 4S3SA 5CBAE 1ESRA 1A3VA 4A3KB 1FNUA 4NKLA 2QDBA 2TSSA 1YNNC 3NTKA 2B2VC 4BY1B 4NDXA 2NTSA 3MHBA 1G291 2FHTA 1QE6A 3NP8A 5ELBA 4FXGC 5IGGA 1LT3D 3BS1A 3WOEA 5LL6X 2B2YA 5JAVA 4FXKC 3NUCA 1VDZA 3TZDA 1B44D 4FO2A 3CRLC 4ZKBB 2K32A 4X3SA 5JVG3 2PW5A 1PYWD 2B8FA 4KV6A 4G7HC 4RGTA 3CKIB 4K2KA 2YYZA 3P1HA 2OXPA 1LLRD 4OIJA 1D6EC 3TP7A 1EY0A 2O4XA 1EWHA 1CK1A 1K83B 1F2MA 1EOTA 2EPBA 3A7LA 3TP6A 3HS0C 4N9TA 2R7ZB 1U4RA 4KD3A 5M5XB 4KHZA 2F4IA 1S5FD 1SFOB 3SE0A 3K5OA 1G2TA 4X3TA 1STGA 1BO0A 1EY5A 4IUPA 1PRTB 5D3DA 3VA5A 1RF2D 4UAIA 2IWHA 5IT9L 3PIO3 5LL6S 5EPJA 3GQBA 3P75A 3L3OC 5E3FA 4HSPA 3C1EA 2ZXPA 1PTOD 1R4QB 3FDTA 1WTWA 2AQ2B 2GA4B 5G3LF 4K5XA 5BN4A 1ENCA 1GUWA 1CM9A 1NR4A 2F0EA 1CHQD 4RCNA 3AMUA 2RBMA 3SVMA 2MP1A 2NYZD 2JA6B 1KDCA 3RLFA 5FLXL 1O7ZA 3NK9A 1JC7A 5FK9C 4ABNA 1SSOA 2EZVA 2QKIC 3GTMB 4KKUA 1V1OA 5J1ZA 1FNVA 3I73A 3A7AB 1EU3A 3A8KE 4ZKCB 1I4RA 2Q8TA 3T4AC 4DXFA 4XDXA 2F1MA 4IUNA 3A56A 1PXUA 3RZOB 3H91A 2PZTA 3JAME 1JWMD 3MC0B 1DONA 3T13A 1IKLA 5A2QE 1D1KA 1V1PB 3S15B 1LV9A 2RQXA 3K5NA 1SNDA 4K8JA 4L8JA 1O7YA 1CA5A 3FPUB 4FNFA 1BCPB 3CRKC 1VMCA 1AW7A 3W2DA 5JEAH 4EGVA 2L4NA 1SYBA 5EKLA 1V8QA 1X3QA 3C1FA 3QJYA 3HOWB 3BYYB 1FYCA 5CR3A 1IW7C 1SYEA 4C3JB 5FO9B 4Y7NB 5JVH3 2E75C 4CJ2C 2F3WA 5JJZA 3NBIA 1EY6A 1TU2B 4KKTA 4IQZA 5EGTA 2XWBB 3EQLC 3R2IA 4B08A 1GUNA 5CBEE 1HQMC 5TSSA 5C4XB 4BA1I 1L0YB 4F88A 3QB3A 3DWAA 1IHZA 1B9NA 3ITPA 2IJ0A 5KYIA 1GUTA 5JOBA 4RH6A 2A6ED 1SE3A 2MHVA 3TDQA 2B2WC 5C0XI 1HXYD 3PUWA 4JBWA 3OMGA 4RCOA 1PTOF 1SYFA 4XYOA 2F0MA 2F0GA 2WAQB 5KYLA 5I9PA 2HDMA 3MVVA 4Q0FA 2Z8LA 2A6EC 4BBSB 3D3RA 1Q12A 1JWSD 1SNMA 2AUKA 2MPMA 5I2XA 1L0XB 1QCBD 3NPPA 4QF4A 1XYIA 1Y69U 3M7GA 1TY0A 3W3AA 3MXNA 1BDOA 1VMPA 1AEXA 4KI0A 2XN9C 1CTMA 1Z6HA 2NVTB 2IPKD 3DXJC 3VYUA 4CBVA 2A74C 1EZ8A 1HCZA 2HCIA 1B53A 1D1IA 4UDUC 5CMDA 1I6VC 4ZK9B 1OXVA 2X6LA 2ICEC 2K5DA 1I6HB 3MWYW 3V05A 2OT2A 3GO5A 5C5MA 3HP3A 1OXTA 4KJNA 2PQEA 2KOLA 2FMCA 5CV6A 4ME5A 4KY6A 2A69D 4I7ZC 3HOUB 1GXDC 2EJGC 5COYA 5JPMC 1I4GA 3MZ5A 2JYOA 3F2UA 1EY4A 3Q24A 3GTGB 1C48A 2A69C 1UAPA 1FGBD 2IX3A 3D6WA 1B9MA 1YNJC 5C4HA 1O80A 1JOOA 2ENBA 3BVZA 1EIGA 4F8MA 3SDZA 2JE6I 3NTHA 1Q90A 2K03A 1EIHA 4L63B 4HR7B 2B2TC 2K1BA 1H9RA 1RODA 2JEBI 1KLUD 2JXMB 5C4ZA 3N52A 4A3EB 4BY7B 1F2ZA 5IT9E 4TRDA 1PRTD 2MJ8A 2EY1A 5DNFA 1LACA 2F0NA 1DYQA 2EOTA 2D9UA 1WTPA 2B2YC 2L12A 2JA7B 2CVRA 1ZXTA 1TWGB 2B8GA 1ET9A 1TWHB 3I3CA 4CKCA 1D5ZC 1ILQA 4FP5D 4LMQD 2K5QA 1TT2A 5FLXE 1A15A 4KKSA 5E1FA 3IKJA 3PMFA 3KLRA 3BDOA 1TKWB 2NUCA 4KN4C 5EPKA 4HN7A 4IFDH 1NUCA 3SEBA 3PUZA 1F9RA 3MXUA 4R9WA 1J9OA 2K04A 4R8NA 2BE5C 3HEJA 3NQTA 5KGUA 4KJOA 4H7BA 1G2SA 4ZAIA 2PZUA 5I6YA 3GTJB 2E2DC 3TP8A 1LTBD 3WDNA 2YU9B 1EYDA 5HURA 4ULLA 3SXHA 4HCSA 1GUSA 2G9HD 2H4OA 3OOCA 4KHVA 2H1EA 1Y1VB 1EYAA 1TWCB 5C3WA 3CQZB 2B2UA 5JEAJ 1CZGA 1PZKD 4ZLTF 1IL8A 1A3UA 2AUJD 3BYTB 1BCPD 3NTIA 2PCFB 2EY2A 1Z7TA 2KECA 4MN3A 4CHTB 1U4LA 2NN6G 4C3JG 1TVXA 3I4NB 4FXDA 3GD7A 3G7LA 4C3IB 1OXUA 3C46A 2PYKA 1E0BA 2XWJB 5JEAG 4QB4A 2BA1A 1ILPA 2F0PA 3VR5A 4U673 3VR2A 4BBRB 4A3IB 1JCKB 4FF3A 5M5WB 2KCNA 1VF5C 3VR3A 4IUUA 2EJFC 1B2TA 1KAAA 4A3JB 1CA6A 2D62A 1XTCD 2Z4IA 1Y1WB 1YNND 4Q5VA 5D3IB 4G57A 4K5WA 1EWCA 1U4MA 3QOJA 3DM1A 5KNBA 4IUQA 2SOBA 1BR9A 4HMJA 3X3MA 1HTLD 2MUYA 2BOSA 4U68A 3T56B 3IL8A 1MSHA 3K59A 2AWNA 1A6XA 4JK1C 1TS5A 4XTCS 1PMRA 2DNCA 1GJXA 1TR5A 2C5CA 2XRSD 3Q0AA 4K2LA 1CFMA 3FKIB 1HQRD 1JOQA 2JP1A 4CKEA 3VA7A 4DNTB 2RSNA 1LTGD 4I65A 3J7AF 1QJOA 2EXZA 1DOLA 1TIID 1S5DD 5EJWA 1BOSA 1JR0D 2KEDA 3NSWA 1UUPA 4HTHA 5DM73 4FF2A 1DZ1A 2DY8A 4EQPA 3I90A 4K6DA 5IGCA 2A6HC 2L55A 3GTLB 4N9PA 3LX0A 3ERQA 1B4OA 1LABA 3PUXA 1S5BD 5T1GA 1KABA 2IW3A 2K28A 4FYDA 2EYPA 3G6JB 2L11A 3J80L 5ELFA 4P2CB 3UI2A 3HOXB 1BCPF 4DAVA 1BNZA 1LTID 1VCIA 5T1IA 2EY6A 1ESFA 2F03A 1I4HA 3URYA 1E2WA 4CJ1B 1LTTD 2OF1A 4C2MB 1KTKA 3P7JA 4A93B 1A2UA 3MA2B 3IAYA 2NVXB 3EJIA 5ISRA 4MIUA 3BDCA 5M3FB 2CQAA 5BN3A 2F0WA 1SYDA 2JSOA 1SEBD 1EZ6A 1STBA 2XVSA 5CGKA 1NCVA 3GTOB 3HG9A 3RD4A 1AN8A 1JE4A 4IFDJ 1F2LA 3R2TA 5J39A 2A5HA 2JA5B 3EFXD 3QG1A 2WV6D 3J7YW 5BN5A 1SYGA 2QCPX 3DEOA 2Z4HA 4TSSA 4IZ8A 1UNSA 4HAEA 3EROA 2EYHA 1G8ZD 3DEPA 2EYFA 2WB1B 4OGQC 5DEHA 4PMBA 1H9SA 1SMYD 5E4WC 1U4PA 2Q8IB 4IFDG 2WKDA 2F0OA 2XRQD 3RZDB 1WTXA 1ET6A 2NN6H 1W6KA 2Q8RE 4K5VA 5EPLA 2J7ZA 3K0YA 4RKLA 5KRUA 3X3NA 1PFMA 3I91A 5CV9A 1IW7D 3I70A 4BA2I 1RCVD 2NB0A 1SMYC 1MGSA 2RVLA 2Y0SB 3V2TA 5IOCA 1T5EA 2BA0A 5D14A 1GUGA 3HZXA 5JPNC 1MSGA 1CHPD 2ID0A 3M4OB 3BVGA 1MD2D 3TBIB 3L7ZC 3U9SA 1W6JA 2L0CA 3L9AX 4OO1H 1HA5A 1R4PB 3OMCA 2NVYB 4C3IG 1II3A 4KMUC 1EQVA 3PV0A 3SR1A 3H3VC 5LHY1 4DGZA 2F0VA 1D5MC 2LY7A 4C56C 2M00A 1H9MA 1OXSC 3K7AB 2XSCA 4OHJA 2NBFA 1H9SB 4IN3A 1E2ZA 2Z1CA 5IGEA 2DY7A 2TMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X H;  3VA7 A;  2A68 C;  4DNT B;  3N6R A;  2PCF B;  3A8I E;  2QF7 A;  4KHZ A;  1Z7T A;  4G7O C;  1H9K A;  1IYV A;  1DCZ A;  1QJO A;  3LWU A;  2NN6 G;  3PUY A;  1Y69 U;  1ZKO A;  3TZU A;  1VF7 A;  1LAC A;  3SE0 A;  3QG1 A;  4GZY C;  3MFY A;  3GD7 A;  3W3A A;  3IFT A;  4L8J A;  5BN5 A;  1BDO A;  1V43 A;  2BDO A;  1K8M A;  1FR3 A;  1OXU A;  4KI0 A;  1O78 A;  1CTM A;  1Z6H A;  2E76 C;  3DXJ C;  3CRK C;  5JEA G;  2PPB C;  3FMC A;  3NE5 B;  2R6G A;  5K36 G;  2BA1 A;  1DXM A;  3VR5 A;  2EJM A;  3D31 A;  3VR2 A;  2B8G A;  5JEA H;  3M4Y A;  2A6H C;  3D4R A;  2PNR C;  5K36 H;  4DNR B;  1ZYR C;  1HCZ A;  3I4L A;  4OGQ C;  1V8Q A;  2DNE A;  4PV1 C;  1VF5 C;  4KKS A;  1H9S A;  1I6V C;  3QJY A;  1OXV A;  3VR3 A;  2EDG A;  3IKJ A;  4DK0 A;  5KNC A;  2A6H D;  2D5D A;  2Q8I B;  2O5I C;  4IFD G;  3GQB A;  1LAB A;  2EJF C;  2IT1 A;  3PUX A;  1K8O A;  3T53 B;  3KLR A;  3VR6 A;  3BDO A;  1FYC A;  4G7Z C;  1TKW B;  2NN6 H;  1IW7 C;  3HGB A;  1Y8N B;  4KN4 C;  4IFD H;  1YNN C;  2E75 C;  4LK1 C;  1GHJ A;  1GUO A;  1OXT A;  2ZT9 C;  2D62 A;  1ONL A;  3ND9 A;  3ND8 A;  3PUZ A;  3MXU A;  1G29 1;  2E74 C;  2A69 D;  5BN4 A;  1IW7 D;  3BG3 A;  2V4D A;  1CI3 M;  4I7Z C;  5A35 A;  3LNN A;  4BA2 I;  1O7L A;  1SMY C;  2EJG C;  3P20 A;  1T5E A;  1VCI A;  2BE5 C;  4RCN A;  1TU2 B;  2BA0 A;  4KKT A;  4H44 C;  4IQZ A;  1GUG A;  1H9J A;  4KN7 C;  3RLF A;  1HTP A;  2LMC B;  1E2W A;  1VDZ A;  2L5T A;  3EQL C;  1GUN A;  1Q1E A;  2BE5 D;  5KNB A;  1E2V A;  1HQM C;  3CRL C;  1GHK A;  1Q1B A;  2A69 C;  2CW0 C;  2K32 A;  3WDN A;  4BA1 I;  1OXX K;  3FPP A;  3OPO A;  4KKU A;  5C0X G;  1B9M A;  2KA7 A;  4OO1 G;  1YNJ C;  2D2C C;  3H94 A;  2B8F A;  3L7Z C;  3OW7 A;  3I73 A;  3U9S A;  3A7A B;  4G7H C;  1HPC A;  4XIG S;  3A8K E;  1B9N A;  2DN8 A;  4OO1 H;  1GUS A;  2K33 A;  3T56 B;  1GUT A;  2YYZ A;  3SDZ A;  3OOC A;  2JE6 I;  3VR4 A;  2A6E D;  1A6X A;  3A8J E;  2JEA I;  1Q90 A;  3QIA A;  3I72 A;  3M7N A;  2A68 D;  4JK1 C;  4KMU C;  5BN3 A;  3PUW A;  3PV0 A;  1EWH A;  1Y8P B;  4JBW A;  2F1M A;  4LJZ C;  4TKO B;  1PMR A;  1Y8O B;  4TQU S;  2DNC A;  4XTC S;  3AB9 A;  4HR7 B;  3T51 B;  1GJX A;  4DK1 A;  1H9M A;  1OXS C;  3M85 A;  2KCC A;  1H9R A;  2AWO A;  2JEB I;  3A7L A;  2K7V A;  5KND A;  1H9S B;  2EVB A;  4H13 C;  2JXM B;  1IYU A;  1CFM A;  2NN6 I;  3PUV A;  1DD2 A;  1E2Z A;  4H0L C;  2A6E C;  2AUJ D;  1Q12 A;  2AUK A;  2O5J C; 
#chains in the Genus database with same CATH topology
 4HJ8 A;  2UXC L;  3BVM A;  4XXE A;  3K6O A;  1Q81 C;  4G7O C;  3C2P A;  3NXW A;  1SLJ A;  1A63 A;  4LF4 L;  4A3J G;  3TQY A;  1HR0 Q;  3OTO L;  4XQN A;  2OEO A;  3S2D H;  2H5X A;  5C44 B;  1IL2 A;  1RDP D;  1PYB A;  3S1Q H;  4A76 A;  4DR6 L;  1X3E A;  1FR3 A;  1YJW A;  2JK8 A;  2NVT H;  1SRU A;  5EAY A;  4MZ9 A;  3AFP A;  3S1N B;  2GVB A;  4KY7 A;  4JI6 L;  2Z6K A;  4LF6 Q;  4DV4 L;  1EU4 A;  3Q8D A;  2DNE A;  4X62 L;  2JA9 A;  1JWU D;  3CXC A;  4JYA L;  1SR3 A;  4WJW A;  1WTO A;  1N32 Q;  3S2D B;  4XT1 B;  4YWK A;  3S1Q B;  4XT3 B;  2K05 A;  4RWS C;  1I4P A;  4GKJ L;  1IBM Q;  5A35 A;  4DV5 L;  1STY A;  2VB2 X;  2B2U C;  4NPS A;  4CDE C;  4KN7 C;  3E0E A;  2LMC B;  4QMG A;  5F2D A;  1E2V A;  3CCM A;  1KD1 C;  1IYJ B;  3FKI G;  3OSO A;  4AYB B;  5FOB B;  3O13 A;  1Q8K A;  3KBX A;  4PZ8 A;  5EKI A;  4QL5 A;  1ML0 D;  1SBB B;  1BF4 A;  5HGT A;  5C0X G;  2F3V A;  4E6I A;  3EBE A;  1HNZ Q;  2ZJP A;  3VYR A;  1HZB A;  1N33 L;  1YNJ D;  2QDL A;  3MEF A;  5C3E H;  4OX9 Q;  1ENA A;  4IUV A;  4KK7 A;  1HRJ A;  1Q46 A;  1XX8 A;  1LTS D;  3T51 B;  2QIL A;  1WD1 A;  3KLS A;  1VQB A;  5EBD A;  4EQN A;  4LNQ A;  3S2H H;  1HFN A;  2HDL A;  4A3C G;  3TEH B;  1QVG A;  3KJP A;  3PUV A;  2SNS A;  1QIL A;  4A3E H;  4BY7 H;  4GN4 B;  5DAU A;  1KRT A;  3PQI A;  3U4V A;  2HCC A;  2BDN A;  1WTQ A;  4IUT A;  4JI5 L;  3ZJY C;  1JB7 A;  3K8A A;  3A54 A;  2OTL A;  5C3E B;  3TZU A;  3S16 H;  3MXP A;  1J8I A;  3HOX G;  1P16 A;  1E1T A;  2Q2I A;  3PO2 H;  2F0Q A;  3K58 A;  1C8C A;  1HA6 A;  2JA7 H;  1RTO A;  5EQ0 A;  2ZTC A;  1TWG H;  3S2H B;  3PCO B;  2RA4 A;  3E5S A;  1EEI D;  4LF5 Q;  4A3G B;  4DV6 Q;  1TWH H;  4RFB A;  2PNR C;  5K36 H;  1XMO Q;  2LKV A;  2F0H A;  1UE5 A;  4JI7 L;  2QGQ A;  1STN A;  5FJ8 H;  1T9H A;  5IGD A;  4F7X A;  4J6H A;  1I4Q A;  3A55 A;  1JT8 A;  3D6C A;  2YTV A;  1BXT A;  4A93 G;  1QNK A;  3S16 B;  1CT1 D;  3HGB A;  2OQK A;  1GUO A;  1I94 Q;  1JOK A;  1X3G A;  3PO2 B;  5CV4 A;  5M3F G;  3OWE B;  1K0R A;  2E74 C;  1VQG A;  3BG3 A;  2V4D A;  2WKC A;  2SEB D;  1O7L A;  1SAP A;  4X62 Q;  4ZUI A;  4IPC A;  2X6G A;  3QO2 A;  5CC4 A;  4IO9 A;  2CCZ A;  4B3R L;  1NSN S;  2F0T A;  1PH1 A;  4X3K A;  2ZTE A;  1BBX C;  4F87 A;  5IY0 A;  1EQT A;  2E5L L;  1G51 A;  1SE2 A;  2BE5 D;  4OL7 A;  1W2B A;  3HOV H;  3HOY B;  3K7U C;  1X32 A;  5C5L A;  1XXG A;  3CAM A;  1EQQ A;  4FDB A;  4M1U B;  5FLM H;  2N49 A;  3UE1 A;  5ELE A;  3E6Z X;  2HHH Q;  3VYT A;  4RA8 A;  5I9O A;  1KDA A;  1YBY A;  3NBH A;  2JA5 G;  1XPO A;  4LUV A;  1F9Q A;  1SJH D;  1KQS A;  4K14 A;  3U4Z A;  2MO1 A;  3D4D A;  1LT4 D;  4DUZ L;  3QIA A;  3H0G B;  4DR5 L;  2A68 D;  4JPB W;  3H3V H;  4LJZ C;  1NNX A;  2G9D A;  1YHQ A;  2UU9 L;  5CV5 A;  2HIX A;  2NZH A;  1B1Z A;  4MNO A;  3HOV B;  3FHW A;  1LM0 A;  4O42 A;  1B50 A;  2EVB A;  4GLA C;  2WB1 G;  2ZTD A;  3JAM L;  2NN6 I;  5IYD H;  1X55 A;  4KD4 A;  2D0O A;  1CI3 M;  3H09 A;  4PMW A;  2RHQ B;  5IT9 c;  1N36 L;  2ZXO A;  2K50 A;  2A68 C;  5E4X A;  2QF7 A;  5A2Q L;  1D5X C;  2R93 B;  2VL6 A;  4EVO A;  1DCZ A;  1NBW A;  2KCM A;  4X3U A;  3J81 j;  3I4N H;  4DR7 L;  1W3S A;  1XWE A;  2CH4 A;  2KQ3 A;  3W1G A;  3OHX C;  4C3I H;  3SK4 A;  5H1S E;  1K8M A;  1SYC A;  1TXY A;  2F0K A;  1FL0 A;  2Y0S G;  2ALY B;  3RLO A;  4B9X A;  3NHH A;  4NXN Q;  1S4Z A;  5LMN L;  3D4R A;  4HIK A;  5AJ3 Q;  4DNR B;  2M9V A;  3IFD A;  3FVQ A;  2SDF A;  2J4X A;  4QQB X;  4KTA A;  3IRB A;  1WTV A;  2D5D A;  4YCV A;  2QW7 A;  2O5I C;  3K5M A;  1KXL A;  1CKM A;  4EQO A;  4A3J H;  4IPH A;  3OIP A;  4LK1 C;  1K73 C;  4DV3 Q;  1HUM A;  1QZG A;  3A5U A;  1ONL A;  3ND9 A;  5ELD A;  1Y1W H;  5J3B A;  5C3X A;  4RAU C;  1TWF H;  4OXP A;  3FEW X;  3S9W A;  1I3Q H;  3J81 L;  4JI3 Q;  1JMC A;  1EY9 A;  4ID6 A;  4L5T A;  2ZM6 L;  2RKS A;  4H44 C;  4FF4 A;  2F3I A;  2L5T A;  1YHA A;  1YIT A;  1SJE D;  3I8Z A;  1R9T H;  4C3H B;  1Q3L A;  2RDH A;  5IP7 H;  1AZP A;  5EBC A;  3ULP A;  3T1Y L;  4DR1 L;  2EYJ A;  1F9S A;  4OO1 G;  1G6Z A;  2WFW A;  4C1N I;  1CQV A;  5ELO A;  1MI2 A;  1TWF B;  1I3Q B;  1TQO A;  5C44 G;  5FO7 B;  2PMZ B;  2JEA I;  4YHH L;  3M7N A;  4BXX G;  2VXW A;  2ZXR A;  4N8X 1;  5M3M B;  1EEF D;  3GV3 A;  1KNE A;  3KLS X;  1R9T B;  2K75 A;  4QCL A;  1I5F A;  3FKI H;  1QB5 D;  1IYU A;  1EFI D;  3UE0 A;  2R92 H;  2FIN B;  2WII B;  5KIX A;  1AP0 A;  5C0X H;  1K8A C;  2KBN A;  1SDF A;  1KDB A;  4DR5 Q;  3R3O A;  3LWU A;  3PUY A;  2EXD A;  3R93 A;  1ZKO A;  3EVQ A;  4GKK L;  4PMC A;  1U9R A;  1QNU A;  4GZY C;  3HKZ B;  3MFY A;  4DR2 Q;  4RHS A;  5CYU A;  1V43 A;  5CV7 A;  2L9H A;  3V96 A;  3AU7 A;  4K0K L;  2K5W A;  2Q2U A;  2R92 B;  3D4W A;  2EYM A;  1CSQ A;  2RDF A;  4A3C H;  1HHV A;  4IUR A;  3GTL H;  3AFQ A;  5HY6 A;  3K81 C;  2MGS A;  2JQO A;  1AE2 A;  2A6H D;  3KFU A;  1G6P A;  2PNH A;  1Q7Y C;  3VYS A;  3KF8 A;  5D65 A;  1SE8 A;  3HOX H;  1XNR L;  3S1R H;  1L1O C;  2F0J A;  4LF7 L;  2BH8 A;  3GP7 A;  1UE1 A;  1G91 A;  4A3F H;  4R4O A;  1A3T A;  5IWA Q;  3CME A;  3TME A;  4C2M H;  1WTH A;  4APV A;  1PZJ D;  3GTK H;  3GTQ H;  2PI2 A;  4DFA A;  1JOR A;  1X3F A;  1DOK A;  3OPO A;  4JVZ A;  4NXM L;  4UP9 A;  2D2C C;  3U58 A;  1NMF A;  2UXB L;  3OW7 A;  2PW7 A;  4X65 Q;  3S1R B;  1BBU A;  1HPC A;  3TSS A;  4DXG A;  3NEN A;  2DN8 A;  4J15 A;  5C3E G;  2C9O A;  3HFZ B;  1RKN A;  2WIN B;  4B3S Q;  5ELC A;  1K3B C;  2R3Z A;  2VB3 X;  4QJF A;  5I2Y A;  1F77 A;  2Z6K C;  3I7F A;  3MXG A;  5KNC A;  4TKO B;  4A3F B;  3GTP H;  3PIP 3;  1CZW A;  3AB9 A;  4DA2 A;  2O2L D;  4A3L G;  3EA6 A;  4IPD A;  4A3G G;  2AQ3 B;  3M85 A;  2AWO A;  3BZC A;  3GTK B;  3GTQ B;  4H13 C;  3GTO H;  1LTR D;  1DOM A;  1ZEQ X;  4O2D A;  3KK7 A;  4RGO S;  4AQY Q;  2N88 A;  4HJ5 A;  1C4Q A;  3TRE A;  3FRP B;  3E9H A;  1H9K A;  3HRZ C;  4DAY A;  4YWM A;  1PDQ A;  2F52 A;  4UP7 A;  3PO2 G;  2ATW A;  1OO9 B;  3CC7 A;  2OTJ A;  1F2Y A;  3GTP B;  2WB1 E;  4RGN A;  1V1P A;  1HR0 L;  4PQX A;  1LTA D;  1PFN A;  1P8L A;  4DPG A;  3FMC A;  4KY5 A;  2R6G A;  5K36 G;  1DXM A;  3SK8 A;  2JA8 H;  2QEX A;  4CJ0 B;  4IFD I;  3SHL A;  2FJ2 A;  5FJ8 G;  4EQ5 A;  3HOY G;  2KJX A;  4LF6 L;  4BS9 A;  4DK0 A;  4O0A A;  2HQL A;  1PTO C;  5M5Y H;  1K8O A;  3R8B A;  1A8V A;  4NB3 A;  3S17 H;  1Z47 A;  3PSI A;  2NZO A;  1SNP A;  1F9P A;  3E0J A;  1FGU A;  3ND8 A;  1N32 L;  4DF7 A;  2CW0 D;  3H0G G;  3QOL A;  3CCU A;  2JA8 B;  1A62 A;  3KOJ A;  1IBM L;  3PF5 A;  1N34 Q;  1H9J A;  3HOV G;  1X6O A;  2VS1 A;  5IGF A;  1Q1E A;  5M5Y B;  2E2I H;  1GHK A;  4R4T A;  2VUM H;  1LYL A;  2CW0 C;  2RSO A;  3FPP A;  3S17 B;  1VQI A;  4DAY B;  2R93 G;  4HED A;  3PIO A;  3CCL A;  4CGY B;  2NVY H;  4HMI A;  4WRD A;  4ZUJ A;  2NVQ H;  1HNZ L;  2N55 A;  2N78 A;  3QR8 A;  2JN4 A;  2RHS B;  2YTY A;  3VR4 A;  1CQF A;  1J5E Q;  1C0A A;  2B2V A;  1J6Q A;  1LO5 D;  3A0J A;  4KLK A;  1Y8O B;  4TQU S;  3NWT A;  2EE1 A;  4DK1 A;  4OX9 L;  2Q2T A;  1SMX A;  1QG7 A;  3CP0 A;  3CW2 C;  3K7A H;  2E2I B;  3W5O A;  1PA6 A;  5KND A;  2VUM B;  4TVA B;  5NUC A;  1S5E D;  4GS3 A;  3PO3 H;  5COR A;  4JI1 Q;  1D2B A;  1EUJ A;  1RHP A;  1QUQ A;  3BDL A;  2NVQ B;  1IYV A;  1ZYR D;  2MQH A;  4O1N A;  1VF7 A;  3J80 i;  3DWP A;  2K52 A;  4BXX H;  4P75 A;  1RD9 D;  4C1N K;  2WP8 J;  2DJF C;  1EL0 A;  1EYG A;  2PPB C;  4WJ3 M;  1JQY D;  2HUG A;  2AHO B;  5C6A A;  3J81 E;  4ZQ3 A;  3PO3 B;  1ZYR C;  4QUF A;  4BWG B;  3I4L A;  4B9W A;  4LF5 L;  3RLN A;  4DV6 L;  4PV1 C;  4C3H G;  1I50 H;  2CHB D;  3K57 A;  1GKH A;  1XMO L;  3S1M H;  2IT1 A;  1PH9 A;  3VR6 A;  4ZYS A;  3TS2 A;  3AYH B;  2BCO A;  1STH A;  1Y1W G;  1Q8I A;  2UXD Q;  1JB3 A;  2ZT9 C;  3RMH A;  1PV4 A;  4MHE A;  5DM6 3;  1RJT A;  3SK5 A;  4CKB A;  3LNN A;  1I94 L;  1YVC A;  5IOD A;  1M8A A;  5M3M G;  1WVL A;  2EY5 A;  5FO8 B;  3DUZ A;  2J0T D;  1M90 C;  1OTC A;  3G6E A;  1I50 B;  1DJR D;  5IP7 G;  1QOH A;  2I07 B;  3M4P A;  3S1M B;  1IBK L;  1Q1B A;  3I4M H;  3J7A V;  4WOR A;  5BR8 Q;  3ER0 A;  5C0X J;  1OXX K;  3K5L A;  2F0I A;  4DN4 M;  3KBG A;  2Q2H A;  1L1O B;  4YIJ A;  2WAC A;  2XNA C;  3Q23 A;  2E2H B;  3MAQ A;  2ES2 A;  4GLV B;  1SNC A;  2HHH L;  4GNX B;  3HKZ G;  5C4J H;  5I4D A;  1JJG A;  1JIC A;  1NR2 A;  4J8Q A;  3I72 A;  1LT6 D;  5M9O A;  3CF5 A;  4J1M A;  2PZW A;  1A2T A;  2QEJ C;  4GOP A;  1X56 A;  2P5Z X;  2KCC A;  2R92 G;  4L6T B;  3I4M B;  4PZ6 A;  2XTI A;  2RCF A;  1DD2 A;  1ENF A;  4RKB A;  2CQO A;  4V19 0;  4ZCK A;  4FVM A;  4GLX A;  1IZ6 A;  5C4J B;  1TS2 A;  4DU9 A;  4A3M H;  1B3A A;  3KUP A;  3E3X A;  1EY8 A;  1EFW A;  4Z9C B;  1VQN A;  2F0F A;  1TS3 A;  3IFT A;  2NWG A;  2RDG A;  2F0U A;  1WTR A;  4DKA C;  1WI5 A;  2E76 C;  2NTT A;  1KLG D;  4A3L H;  3C3L A;  3NE5 B;  1LT5 D;  4A3G H;  2EJM A;  3TS0 A;  1EYC A;  3VDY A;  4R1J A;  1NTG A;  1TWA B;  4NXN L;  3CHB D;  1VQD A;  3Q22 A;  4JI0 Q;  1AZQ A;  4GN3 B;  2I0Q A;  2G5D A;  3T16 A;  1PTO H;  2EDG A;  2KEE A;  1X3P A;  5AJ3 L;  1IKM A;  4IAL A;  3T53 B;  3ZYY X;  4A3M B;  1TS4 A;  1PFS A;  5KEE A;  3NEL A;  1Y8N B;  1KNA A;  1BQQ T;  1TY2 A;  3J80 E;  2K6A A;  4RMF A;  4UP8 A;  1STA A;  3HOZ H;  2R7F A;  1YEZ A;  4DV3 L;  5E7N A;  4V0B A;  2E2J B;  3P20 A;  4A3F G;  2HQE A;  1WCM H;  3TP5 A;  4ZRZ A;  4QIW B;  4JI3 L;  3H6M A;  3HOY H;  1PTO B;  1HZA A;  1E24 A;  1UE6 A;  1RTN A;  1NY4 A;  4PNY A;  2B39 A;  3CU7 A;  3RUZ A;  3STB C;  4XYQ A;  2F0D A;  2PO4 A;  1PFB A;  2FFK B;  3NQI A;  1AFP A;  1XJV A;  4HSV A;  1K3R A;  1HFG A;  2IL8 A;  1D8L A;  3HOZ B;  3W1B A;  1WOC A;  4XQJ A;  2PQA A;  3A8J E;  3H0G H;  3MTS A;  3DHQ A;  4POF A;  1WCM B;  2IX1 A;  1IBK Q;  4LAA A;  1AH9 A;  1Y8P B;  1GVP A;  1HJP A;  4ALP A;  1SNO A;  4OEM B;  3G71 A;  1VQA A;  1X54 A;  2K7V A;  1VQE A;  1GOZ A;  4A3D B;  4XQQ A;  2F0S A;  5K5P A;  1PRT C;  1UEB A;  2M2L A;  4G4K A;  3BZD B;  3N6R A;  3QWN A;  3A8I E;  2R93 H;  5IGB A;  1E22 A;  4N8F A;  2L15 A;  1PZI D;  4QUC A;  3OW2 A;  2X69 A;  4R4C A;  3SK6 A;  2HT1 A;  3J80 c;  2XGT A;  3LGJ A;  4RGM A;  1I4X A;  2BDO A;  4OIK A;  5I6W A;  2K5V A;  2JA8 G;  3M3Y H;  1ICW A;  1UEA B;  1QZH A;  3S14 H;  4DR2 L;  1MBY A;  2B2W A;  5AFW A;  1JJ2 A;  5FKA C;  4LFB Q;  2KHS A;  3NWS A;  3CPW A;  4K6L A;  4K8I A;  2YV5 A;  2I5M X;  4X66 Q;  5CV8 A;  2LS0 1;  2LFN A;  1YJN A;  2AQ1 B;  3OIQ A;  4OON A;  4RHR A;  1M4V A;  4G7Z C;  1S40 A;  1SRO A;  1FNW A;  1WD0 A;  5EKK A;  4NMZ A;  1GHJ A;  1DM0 B;  3MFG A;  1NAP A;  3LWE A;  1SNQ A;  3M3Y B;  1CKN A;  3S14 B;  2IX0 A;  1FD7 D;  1KIX A;  2R61 A;  4NW2 A;  4L5R C;  1VQ8 A;  2B63 H;  3EIV A;  1S72 A;  2VNU D;  3ONA B;  3U9O A;  1HTP A;  4OO1 I;  2VQE L;  2VUM G;  2XIW A;  1VQC A;  4R8I A;  4JCV E;  4C3H H;  5ELN A;  2MFI A;  1S5C D;  2KVM A;  3NBH B;  1L0W A;  5IWA L;  3DMU A;  4EX5 A;  2SNM A;  3Q6S A;  4WFN 3;  2EYL A;  3MEH A;  2E8G A;  1D7Q A;  1SXT A;  2KA7 A;  3H94 A;  1BKB A;  4XIG S;  4QGU A;  3UDF A;  2K33 A;  4A3B H;  1BUV T;  4X65 L;  3F2C A;  4FF1 A;  2L1B A;  2K01 A;  2B63 B;  1U5K A;  3OWF A;  5IIF A;  5M3M H;  4A4I A;  4B3S L;  1Q82 C;  2NZ1 D;  4HCE A;  4DAP A;  1QWY A;  3DWQ A;  4B3T Q;  2EYO A;  1EY7 A;  3TN2 A;  1STE A;  2RCN A;  3D8G A;  1NJI C;  3WOF A;  1BCP C;  3PO3 G;  4IOA A;  2A73 B;  5J22 A;  1PLF A;  4JC0 A;  4JBK A;  1SE4 A;  4ILW A;  3BZK A;  2CFM A;  3HKZ E;  4H0L C;  2O5J C;  1HUN A;  4HJ9 A;  4ODG A;  4M8A A;  5G3L D;  2KUM A;  1B3Q A;  2ICI A;  2FMM A;  4AQY L;  1AE3 A;  4A3B B;  4LF9 Q;  4DV7 Q;  1YI2 A;  1PVO A;  4L5S A;  1VQK A;  1HNW Q;  2F0L A;  4NP5 A;  4BY1 H;  3KF6 A;  1PH5 A;  1T5X D;  1O78 A;  3GV6 A;  3D31 A;  1PH6 A;  2I46 A;  1PRT F;  3M4Y A;  2B2T A;  4X64 Q;  1L2F A;  4S3S A;  5CBA E;  1BVS A;  1ESR A;  1A3V A;  4A3K B;  5HGQ A;  4P73 A;  1C7Y A;  1FNU A;  4RG1 A;  4NKL A;  2QDB A;  3CCJ A;  2TSS A;  1YNN C;  3NTK A;  2B2V C;  4PG3 A;  4BY1 B;  3U50 C;  2AMC B;  4NDX A;  1YHB A;  2NTS A;  3MHB A;  1G29 1;  2FHT A;  1C9O A;  1QE6 A;  4JV5 Q;  4JI4 Q;  3NP8 A;  5ELB A;  4KHP Q;  4FXG C;  5IGG A;  1LT3 D;  3BS1 A;  1FJG Q;  3WOE A;  5LL6 X;  2B2Y A;  5JAV A;  2C35 B;  4FXK C;  4AYB G;  4DV1 Q;  3NUC A;  1K83 H;  1VDZ A;  4DR4 Q;  3I4M G;  3JAM i;  2KHJ A;  3TZD A;  1N34 L;  1B44 D;  3NEM A;  4FO2 A;  2UUB Q;  3CRL C;  3AQQ A;  1PH7 A;  4ZKB B;  2K32 A;  4X3S A;  1K28 A;  5JVG 3;  2PW5 A;  5GAG C;  1PYW D;  2B8F A;  2R7Z H;  3FP9 A;  4KV6 A;  4G7H C;  4RGT A;  5M5X H;  3CKI B;  4K2K A;  2D0P A;  2YYZ A;  4GNX C;  2VQE Q;  3P1H A;  2OXP A;  1LLR D;  4OIJ A;  1SFO H;  1D6E C;  1LTL A;  3TP7 A;  5GAH C;  1EY0 A;  2O4X A;  1EWH A;  1CK1 A;  1K83 B;  1J5E L;  4R4Q A;  1F2M A;  1EOT A;  3I55 A;  2UUA Q;  2EPB A;  1YJ9 A;  3A7L A;  3TP6 A;  3HS0 C;  4N9T A;  1KRS A;  4JI8 Q;  4CDF C;  5GQO A;  2R7Z B;  4WJ4 A;  1U4R A;  4KD3 A;  5M5X B;  1NMG A;  2F4I A;  2Z6B A;  4KHZ A;  4A3M G;  1X65 A;  4JI1 L;  1S5F D;  1SFO B;  3GDE A;  3SE0 A;  5L37 A;  3K5O A;  3K80 C;  1G2T A;  4X3T A;  3I2Z A;  1STG A;  4P74 A;  1EWI A;  1BO0 A;  1VQP A;  3J81 i;  4DK3 C;  4JG2 A;  1E1O A;  1EY5 A;  4IUP A;  5LMN W;  2OWO A;  1PRT B;  5IE8 A;  5D3D A;  3VA5 A;  3KF8 B;  4IOC A;  2EIF A;  2JA6 H;  4B3M Q;  2MNA A;  1VQ6 A;  1RF2 D;  4UAI A;  2IWH A;  2A8V A;  5IT9 L;  1HNX Q;  3PIO 3;  5LL6 S;  1XPR A;  5EPJ A;  3GQB A;  3P75 A;  3L3O C;  5E3F A;  1VQM A;  4HSP A;  3A5Z B;  3C1E A;  2ZXP A;  1PTO D;  3HOZ G;  2CKZ B;  1R4Q B;  3FDT A;  1WTW A;  2AQ2 B;  2GA4 B;  5G3L F;  4K5X A;  3J7A 5;  5BN4 A;  2UXD L;  1ENC A;  1WCM G;  1KAW A;  1GUW A;  1CM9 A;  1NR4 A;  2F0E A;  1CHQ D;  2OCE A;  4RCN A;  2FXQ A;  2RBM A;  3AMU A;  1XNQ Q;  1Q86 C;  3SVM A;  2MP1 A;  5IP9 H;  3ULJ A;  2NYZ D;  2JA6 B;  1KDC A;  3RLF A;  5FLX L;  4I7A A;  1O7Z A;  3NK9 A;  1JC7 A;  5FK9 C;  4ABN A;  1SSO A;  2Y0S E;  4A3D G;  3RZO H;  4AH6 A;  1XPU A;  2EZV A;  2QKI C;  3GTM B;  4KKU A;  1V1O A;  5J1Z A;  3H3V I;  1V9P A;  1FNV A;  2K5H A;  3I73 A;  5BR8 L;  3A7A B;  3H15 A;  2VQF Q;  4LWC A;  1EU3 A;  3A8K E;  4ZKC B;  1I4R A;  3SGI A;  2Q8T A;  3S15 H;  1RIP A;  1JJC B;  3T4A C;  4DXF A;  4XDX A;  1YIJ A;  2F1M A;  4IUN A;  3CCQ A;  2V1C C;  3A56 A;  1PXU A;  1B7Y B;  3RZO B;  3H91 A;  4YY3 Q;  1GM5 A;  2PZT A;  3JAM E;  2KCT A;  1JWM D;  3MC0 B;  1DON A;  1WJJ A;  2MO0 A;  4JBJ A;  3T13 A;  1IKL A;  2GVA A;  5A2Q E;  1D1K A;  1V1P B;  3S15 B;  3PF4 A;  1LV9 A;  1EIY B;  3UDI A;  3HOW H;  2RQX A;  3K5N A;  1SND A;  4YCU A;  1EIF A;  4K8J A;  4C3J H;  2AKW B;  4Y7N H;  4L8J A;  1O7Y A;  1CA5 A;  3FPU B;  3ICE A;  4FNF A;  1BCP B;  3CRK C;  3K0X A;  1EOV A;  1VMC A;  1AW7 A;  3W2D A;  5JEA H;  4EGV A;  1BBW A;  2L4N A;  1FVI A;  2OQ0 A;  1SYB A;  5EKL A;  1V8Q A;  1X3Q A;  4LFC Q;  3C1F A;  3QJY A;  1HZ9 A;  5C4X H;  3HOW B;  1VQH A;  1PYS B;  4P72 A;  4JI0 L;  3BYY B;  1FYC A;  5CR3 A;  4DV2 Q;  1IW7 C;  1SYE A;  4C3J B;  5FO9 B;  4Y7N B;  3CCS A;  1Z9F A;  2E75 C;  5JVH 3;  2LXJ A;  4CJ2 C;  1KC8 C;  2A1A A;  2UUC Q;  2BH2 A;  4L5Q A;  2B63 G;  2LXK A;  2F3W A;  5JJZ A;  3NBI A;  1VQO A;  1EY6 A;  4IJH A;  1TU2 B;  4KKT A;  4IQZ A;  5EGT A;  4Y52 H;  2XWB B;  3EQL C;  2ZJR A;  3R2I A;  4B08 A;  2RF4 A;  1GUN A;  5CBE E;  5JJL A;  1HQM C;  5TSS A;  5C4X B;  3JAM c;  3BU2 A;  4UPA A;  2K14 A;  4BA1 I;  4LF8 Q;  1L0Y B;  4F88 A;  3QB3 A;  5GRO A;  4BBS H;  1B8A A;  4A3B G;  4CDD C;  3DWA A;  1IHZ A;  4AYB E;  1PH8 A;  1DGS A;  1B9N A;  3ITP A;  2E2H H;  2IJ0 A;  5KYI A;  4HID A;  1GUT A;  4DV0 Q;  5JOB A;  4RH6 A;  3KYH C;  5LMU Q;  2A6E D;  1SE3 A;  2MHV A;  3TDQ A;  3RNU A;  4GN5 A;  1V1Q A;  2B2W C;  1K9M C;  5C0X I;  1HXY D;  3PUW A;  4JBW A;  3OMG A;  4RCO A;  5IYC H;  1PTO F;  3RR5 A;  1SYF A;  4XYO A;  2F0M A;  2F0G A;  1QUQ B;  2WAQ B;  3CMA A;  5KYL A;  5I9P A;  2HDM A;  3MVV A;  2I5H A;  4Q0F A;  2Z8L A;  2A6E C;  4A3K G;  3D3R A;  1Q12 A;  1JWS D;  1SNM A;  2AUK A;  2MPM A;  4BBS B;  1XMQ Q;  1E7Z A;  5I2X A;  1L0X B;  2DGY A;  1QCB D;  3NPP A;  4QF4 A;  3F1Z A;  1VQL A;  1XYI A;  1Y69 U;  4JBM A;  2QA4 A;  1I6H H;  4BY1 G;  4DR3 Q;  3M7G A;  1TY0 A;  1HR0 W;  3W3A A;  3MXN A;  1BDO A;  1VMP A;  4X6A H;  4DK6 C;  2VW9 A;  1AEX A;  4LFA Q;  1VQ5 A;  4KI0 A;  2XN9 C;  2K5N A;  1CTM A;  1Z6H A;  3J81 c;  2NVT B;  2IPK D;  3DXJ C;  3VYU A;  3HOU H;  4CBV A;  2A74 C;  1KL9 A;  3E9I A;  3T1H Q;  1TWA H;  1EZ8 A;  1HCZ A;  2HCI A;  1B53 A;  1D1I A;  4LW1 A;  4LFB L;  4UDU C;  5CMD A;  1I6V C;  4ZK9 B;  1OXV A;  2X6L A;  2ICE C;  1IBL Q;  2K5D A;  4X66 L;  3GTG H;  1I6H B;  3MWY W;  3V05 A;  2OT2 A;  3ERS X;  4JW0 A;  3GO5 A;  5C5M A;  3HP3 A;  4QIW E;  1OXT A;  4KJN A;  2PQE A;  2KOL A;  2FMC A;  5CV6 A;  4DNI A;  1GO3 E;  4ME5 A;  3F2B A;  2ZJQ A;  2JJQ A;  4JOI A;  4KY6 A;  2A69 D;  1VQ9 A;  2E2J H;  4I7Z C;  3HOU B;  1GXD C;  2EJG C;  4CDC C;  5GAE C;  5COY A;  5JPM C;  1I4G A;  4QY7 A;  3MZ5 A;  3CPF A;  2JYO A;  3F2U A;  1EY4 A;  3Q24 A;  3GTG B;  1C48 A;  2A69 C;  2R7Z G;  4ME3 A;  1UAP A;  1FGB D;  2IX3 A;  3D6W A;  2F4V L;  1B9M A;  1YNJ C;  4DUY Q;  5C4H A;  1O80 A;  1JOO A;  2ENB A;  5GAD C;  1QVF A;  3BVZ A;  1EIG A;  3MXN B;  3STB D;  4F8M A;  4GOP B;  3SDZ A;  2JE6 I;  2VY3 A;  3NTH A;  3AEV A;  1Q90 A;  2K03 A;  2CH4 W;  3TRZ A;  1EIH A;  1PH2 A;  4L63 B;  4LUZ A;  1YNX A;  4HR7 B;  1WYD A;  2B2T C;  4JI2 Q;  1Y14 B;  2K1B A;  1H9R A;  1ROD A;  2JEB I;  1KLU D;  4B3T L;  4A3D H;  2JXM B;  2UXC Q;  3CCR A;  5C4Z A;  3N52 A;  4A3E B;  4BY7 B;  4LF4 Q;  1F2Z A;  5IT9 E;  3OTO Q;  1CSP A;  4TRD A;  1PRT D;  2MJ8 A;  2EY1 A;  2N8N A;  4DR6 Q;  5DNF A;  1LAC A;  2F0N A;  1DYQ A;  2EOT A;  4LF9 L;  4DV7 L;  2D9U A;  1WTP A;  1ASY A;  4JI6 Q;  2B2Y C;  1O7I A;  2L12 A;  2JA7 B;  2CVR A;  4IPG A;  4DV4 Q;  1ZXT A;  1HNW L;  1TWG B;  2JA6 G;  1VQJ A;  2B8G A;  1ET9 A;  1TWH B;  3I3C A;  4CKC A;  1D5Z C;  3A74 A;  1ILQ A;  4FP5 D;  4LMQ D;  2K5Q A;  1TT2 A;  5FLX E;  4JYA Q;  1A15 A;  4MTK A;  4KKS A;  5E1F A;  3IKJ A;  1JE5 A;  4X64 L;  3PMF A;  3KLR A;  3GTJ H;  2YU9 H;  3BDO A;  1TKW B;  2NUC A;  4UHV A;  2IHE A;  4KN4 C;  5EPK A;  4HN7 A;  4IFD H;  1NUC A;  2CWA A;  4GKJ Q;  4DV5 Q;  3SEB A;  1HH2 P;  3PUZ A;  1F9R A;  3MXU A;  4R9W A;  1VQ7 A;  1J9O A;  5IP9 G;  2K04 A;  4R8N A;  2BE5 C;  1N8R C;  4JV5 L;  4JI4 L;  1EQR A;  4KHP L;  1Y1V H;  3L2P A;  3HEJ A;  1TWC H;  1FJG L;  3NQT A;  5KGU A;  1KHI A;  4KJO A;  3CQZ H;  4H7B A;  4DV1 L;  1G2S A;  4ZAI A;  4DR4 L;  2PZU A;  5I6Y A;  3GTJ B;  2E2D C;  3TP8 A;  1LTB D;  3WDN A;  2YU9 B;  1EYD A;  2PQA B;  5HUR A;  2UUB L;  1N33 Q;  4ULL A;  3KJO A;  3SXH A;  4HCS A;  3BJU A;  1GUS A;  2G9H D;  2DJG C;  2H4O A;  3S24 A;  3OOC A;  4KHV A;  1K0S A;  2H1E A;  1Y1V B;  2LSS A;  1EYA A;  1UE7 A;  1TWC B;  1E3P A;  2F4V Q;  5C3W A;  3CQZ B;  2B2U A;  5JEA J;  1CZG A;  2PMZ E;  1PZK D;  4DAM A;  4ZLT F;  1IL8 A;  2UUA L;  1SN8 A;  4BBR H;  2IHF A;  1A3U A;  4A3I H;  5FLX c;  2AUJ D;  3BYT B;  4JI5 Q;  5M5W H;  3HOW G;  1BCP D;  3NTI A;  2PCF B;  2EY2 A;  4JI8 L;  1Z7T A;  1M1K C;  1MIU A;  2KEC A;  4MN3 A;  4CHT B;  1U4L A;  2NN6 G;  4C3J G;  3RN5 A;  1TVX A;  3I4N B;  3HKS A;  4FXD A;  2HIV A;  3KDF A;  3GD7 A;  3G7L A;  4C3I B;  1OXU A;  3C46 A;  2PYK A;  1E0B A;  2XWJ B;  5JEA G;  4QB4 A;  3DLL A;  1PHJ A;  2BA1 A;  1ILP A;  1HZC A;  2F0P A;  3VR5 A;  4U67 3;  4JI7 Q;  3VR2 A;  1K8G A;  4BBR B;  4A3I B;  1JCK B;  4FF3 A;  5M5W B;  2KCN A;  5C4X G;  3CC2 A;  4A3K H;  1VF5 C;  3VR3 A;  4IUU A;  4YWL A;  4AIM A;  1CKN B;  4B3M L;  2A19 A;  4OWT B;  2EJF C;  2R7D A;  1B2T A;  1HNX L;  1KAA A;  4A3J B;  1MKH A;  1CA6 A;  2D62 A;  3WWV A;  1XTC D;  2Z4I A;  3UDX A;  2VZA A;  1Y1W B;  1NE3 A;  1YNN D;  4Q5V A;  5D3I B;  4B3R Q;  2K4K A;  4G57 A;  4K5W A;  1EWC A;  1U4M A;  2E5L Q;  1XTD A;  5IYB G;  3QOJ A;  3DM1 A;  1XNQ L;  2WAQ G;  5KNB A;  4IUQ A;  2SOB A;  1BR9 A;  1IXR A;  4BBS G;  4HMJ A;  3X3M A;  3J7Z C;  1HTL D;  2MUY A;  1ICF B;  2BOS A;  4U68 A;  3KDF B;  4DUZ Q;  3T56 B;  3OYY A;  3IL8 A;  2VQF L;  1MSH A;  3K59 A;  2AWN A;  5IYC G;  3JC6 6;  2UU9 Q;  1A6X A;  4JK1 C;  1TS5 A;  3RN2 A;  4XTC S;  5JJI A;  1PMR A;  1S3O A;  2DNC A;  1GJX A;  2ASB A;  1TR5 A;  2C5C A;  2I5L X;  1N36 Q;  2N3S A;  1N9W A;  2EQS A;  3M4Q A;  2XRS D;  3Q0A A;  4K2L A;  1CFM A;  3FKI B;  1HQR D;  4YY3 L;  1YZ6 A;  5JJK A;  1JOQ A;  2JP1 A;  4CKE A;  3VA7 A;  4DNT B;  2RSN A;  4DR7 Q;  4HIM A;  3KF6 B;  1LTG D;  4I65 A;  3J7A F;  1QJO A;  3G4S A;  2EXZ A;  3CCE A;  1DOL A;  1TII D;  1S5D D;  2YTX A;  5EJW A;  1BOS A;  1JR0 D;  1MHW C;  2KED A;  3NSW A;  3HOU G;  1UUP A;  4HTH A;  5LMN Q;  5DM7 3;  4FF2 A;  1DZ1 A;  2DY8 A;  4EQP A;  2KHI A;  3I90 A;  4K6D A;  5IGC A;  3L0O A;  2A6H C;  2L55 A;  3D0F A;  3GTL B;  4IJL A;  4OWW B;  4N9P A;  3LX0 A;  4YCW A;  3ERQ A;  1B4O A;  1LAB A;  3I4O A;  3PUX A;  1S5B D;  5T1G A;  1QVC A;  2PI2 E;  1KAB A;  3DM3 A;  4LFC L;  1VS0 A;  2IW3 A;  2K28 A;  4FYD A;  2EYP A;  3G6J B;  4A93 H;  3F8T A;  2L11 A;  2NVX H;  3J80 L;  1A0I A;  5ELF A;  4P2C B;  3UI2 A;  4DV2 L;  3HOX B;  4OEL B;  1BCP F;  4DAV A;  1BNZ A;  1LTI D;  2ZM6 Q;  4OWX B;  5M3F H;  1VCI A;  2UUC L;  5T1I A;  1RL2 A;  1CKO A;  3CD6 A;  4UY8 C;  2EY6 A;  1ESF A;  4HJA A;  4HJ7 A;  2F03 A;  1I4H A;  3URY A;  1E2W A;  4CJ1 B;  3T1Y Q;  1LTT D;  4DR1 Q;  2OF1 A;  4C2M B;  1KTK A;  3GTM H;  3B6Y A;  2B29 A;  5DLQ E;  4A3E G;  4BY7 G;  3P7J A;  3ULL A;  4A93 B;  4LUO A;  1A2U A;  3MA2 B;  3IAY A;  2NVX B;  3EJI A;  5ISR A;  4MIU A;  1VQF A;  4LF8 L;  4YHH Q;  1PH4 A;  3BDC A;  4GOP C;  4MTN A;  5M3F B;  2CQA A;  4P71 A;  2HD3 A;  3PGZ A;  3CCV A;  2JA5 H;  5BN3 A;  4DV0 L;  4PZ7 A;  2F0W A;  2JA7 G;  1SYD A;  2JSO A;  5LMU L;  1GD7 A;  1SEB D;  2CWP A;  1EZ6 A;  1STB A;  2XVS A;  5CGK A;  4H02 A;  2IY5 B;  1MJE A;  1NCV A;  3UDG A;  3GTO B;  3HG9 A;  4HIO A;  1ASZ A;  3RD4 A;  1AN8 A;  4GKK Q;  4POG A;  1JE4 A;  1XMQ L;  4IFD J;  1F2L A;  1X9N A;  3R2T A;  4JOI C;  5J39 A;  2Z0S A;  3RZD H;  2A5H A;  2JA5 B;  3EFX D;  3QG1 A;  2WV6 D;  3J7Y W;  5BN5 A;  1SYG A;  2QCP X;  1WFQ A;  2GN5 A;  4K0K Q;  3DEO A;  4DR3 L;  2Z4H A;  4TSS A;  1U0L A;  4IZ8 A;  1UNS A;  4HAE A;  3ERO A;  4LFA L;  2EYH A;  3KLW A;  3M9B A;  1H95 A;  1G8Z D;  3DEP A;  3PIP A;  2EYF A;  2WB1 B;  4OGQ C;  5DEH A;  2KEN A;  4PMB A;  3T1H L;  1H9S A;  1SMY D;  1PH3 A;  5E4W C;  1U4P A;  2Q8I B;  4IFD G;  2WKD A;  2F0O A;  3M4O H;  2XRQ D;  3RZD B;  1WTX A;  1ET6 A;  1XNR Q;  5FLM G;  3F2D A;  2NN6 H;  4LF7 Q;  2B3G A;  1W6K A;  2Q8R E;  1IBL L;  4K5V A;  2J7Z A;  5EPL A;  3K0Y A;  4RKL A;  3X3N A;  5KRU A;  1PFM A;  3I91 A;  5CV9 A;  1IW7 D;  3I70 A;  4BA2 I;  1RCV D;  1Y1V G;  1SMY C;  1MGS A;  2NB0 A;  2RVL A;  2Y0S B;  2Z9H A;  3V2T A;  5IOC A;  1T5E A;  3CC4 A;  2BA0 A;  5D14 A;  1GUG A;  3HZX A;  5JPN C;  3I56 A;  1VQ4 A;  1MSG A;  1CHP D;  4NXM Q;  2ID0 A;  5IYD G;  3M4O B;  2UXB Q;  3EN2 A;  3BVG A;  1MD2 D;  3G48 A;  3TBI B;  3L7Z C;  3U9S A;  1W6J A;  2L0C A;  3L9A X;  1CUK A;  1HA5 A;  4OO1 H;  1R4P B;  3OMC A;  4DUY L;  2NVY B;  3I4N G;  2WAQ E;  1B70 B;  4R4I A;  4C3I G;  1UWV A;  1II3 A;  1LUZ A;  4KMU C;  2DUD A;  1EQV A;  1L1O A;  3PV0 A;  5C44 H;  3SR1 A;  3H3V C;  5LHY 1;  4DGZ A;  2F0V A;  1D5M C;  5IYB H;  2LY7 A;  4C56 C;  2M00 A;  1H9M A;  1OXS C;  4GNX A;  4BBR G;  3K7A B;  4A3I G;  2XSC A;  4OHJ A;  2NBF A;  4A75 A;  1H9S B;  3S1N H;  4IN3 A;  1MJC A;  4JI2 L;  1E2Z A;  2Z1C A;  5IGE A;  2DY7 A;  2TMP A; 
#chains in the Genus database with same CATH homology
 3BVM A;  4XXE A;  3K6O A;  4G7O C;  3C2P A;  3NXW A;  4XQN A;  2OEO A;  5C44 B;  1RDP D;  1FR3 A;  3S1N B;  4KY7 A;  1EU4 A;  2DNE A;  1JWU D;  4WJW A;  1WTO A;  3S2D B;  4XT1 B;  3S1Q B;  4XT3 B;  2K05 A;  4RWS C;  1I4P A;  5A35 A;  1STY A;  2VB2 X;  2B2U C;  4KN7 C;  2LMC B;  4QMG A;  5F2D A;  1E2V A;  4AYB B;  3OSO A;  5FOB B;  3O13 A;  3KBX A;  5EKI A;  1ML0 D;  1SBB B;  1BF4 A;  5HGT A;  5C0X G;  2F3V A;  4E6I A;  3VYR A;  1YNJ D;  1ENA A;  4IUV A;  4KK7 A;  1HRJ A;  1XX8 A;  1LTS D;  3T51 B;  2QIL A;  1WD1 A;  3KLS A;  5EBD A;  4EQN A;  1HFN A;  2HDL A;  3PUV A;  2SNS A;  1QIL A;  5DAU A;  2HCC A;  2BDN A;  1WTQ A;  4IUT A;  3A54 A;  5C3E B;  3TZU A;  3MXP A;  1J8I A;  2F0Q A;  3K58 A;  1C8C A;  1HA6 A;  1RTO A;  5EQ0 A;  3S2H B;  2RA4 A;  3E5S A;  1EEI D;  4A3G B;  4RFB A;  2PNR C;  5K36 H;  2LKV A;  2F0H A;  1STN A;  5IGD A;  4F7X A;  4J6H A;  1I4Q A;  3A55 A;  3D6C A;  1BXT A;  1QNK A;  3S16 B;  1CT1 D;  3HGB A;  1GUO A;  1JOK A;  3PO2 B;  5CV4 A;  3OWE B;  2E74 C;  3BG3 A;  2V4D A;  2WKC A;  2SEB D;  1O7L A;  1SAP A;  4ZUI A;  2X6G A;  3QO2 A;  5CC4 A;  1NSN S;  2F0T A;  4X3K A;  1BBX C;  4F87 A;  1EQT A;  1SE2 A;  2BE5 D;  4OL7 A;  3HOY B;  1X32 A;  5C5L A;  1XXG A;  4M1U B;  5ELE A;  3E6Z X;  3VYT A;  4RA8 A;  5I9O A;  1KDA A;  3NBH A;  1F9Q A;  1SJH D;  4K14 A;  3D4D A;  1LT4 D;  3QIA A;  3H0G B;  2A68 D;  4LJZ C;  2G9D A;  5CV5 A;  1B1Z A;  3HOV B;  4O42 A;  1B50 A;  2EVB A;  3JAM L;  2NN6 I;  4KD4 A;  1CI3 M;  3H09 A;  4PMW A;  2ZXO A;  2A68 C;  5E4X A;  2QF7 A;  5A2Q L;  1D5X C;  2R93 B;  4EVO A;  1DCZ A;  4X3U A;  1XWE A;  2KQ3 A;  3OHX C;  3SK4 A;  1K8M A;  1SYC A;  2F0K A;  4B9X A;  3NHH A;  1S4Z A;  3D4R A;  4DNR B;  2M9V A;  3IFD A;  3FVQ A;  2SDF A;  2J4X A;  4KTA A;  1WTV A;  2D5D A;  2O5I C;  3K5M A;  4EQO A;  3OIP A;  4LK1 C;  1HUM A;  1ONL A;  3ND9 A;  5ELD A;  5C3X A;  4RAU C;  3FEW X;  3S9W A;  3J81 L;  1EY9 A;  4ID6 A;  2RKS A;  4H44 C;  4FF4 A;  2L5T A;  1SJE D;  3I8Z A;  4C3H B;  1Q3L A;  2RDH A;  1AZP A;  5EBC A;  2EYJ A;  1F9S A;  4OO1 G;  1G6Z A;  4C1N I;  1CQV A;  1MI2 A;  1TWF B;  1I3Q B;  1TQO A;  5FO7 B;  2PMZ B;  2JEA I;  3M7N A;  2VXW A;  2ZXR A;  5M3M B;  1EEF D;  3GV3 A;  1KNE A;  3KLS X;  1R9T B;  4QCL A;  1QB5 D;  1IYU A;  1EFI D;  2FIN B;  2WII B;  5KIX A;  1AP0 A;  5C0X H;  1SDF A;  1KDB A;  3R3O A;  3LWU A;  3PUY A;  3R93 A;  1ZKO A;  3EVQ A;  4PMC A;  1U9R A;  1QNU A;  4GZY C;  3HKZ B;  3MFY A;  4RHS A;  5CYU A;  1V43 A;  5CV7 A;  2L9H A;  3V96 A;  3AU7 A;  2K5W A;  2R92 B;  3D4W A;  2EYM A;  2RDF A;  1HHV A;  4IUR A;  2MGS A;  2A6H D;  3VYS A;  3KF8 A;  5D65 A;  2F0J A;  3GP7 A;  1G91 A;  1A3T A;  3TME A;  1PZJ D;  4DFA A;  1JOR A;  1DOK A;  3OPO A;  2D2C C;  3OW7 A;  2PW7 A;  3S1R B;  1HPC A;  3TSS A;  4DXG A;  2DN8 A;  2C9O A;  1RKN A;  2WIN B;  5ELC A;  2R3Z A;  2VB3 X;  5I2Y A;  1F77 A;  3MXG A;  5KNC A;  4TKO B;  4A3F B;  3PIP 3;  1CZW A;  3AB9 A;  4DA2 A;  2O2L D;  3EA6 A;  2AQ3 B;  3M85 A;  2AWO A;  3GTK B;  3GTQ B;  4H13 C;  1LTR D;  1DOM A;  1ZEQ X;  3KK7 A;  4RGO S;  2N88 A;  1C4Q A;  3FRP B;  1H9K A;  3HRZ C;  4DAY A;  1PDQ A;  1OO9 B;  1F2Y A;  3GTP B;  4RGN A;  1V1P A;  4PQX A;  1LTA D;  1PFN A;  3FMC A;  4KY5 A;  2R6G A;  5K36 G;  1DXM A;  3SK8 A;  4CJ0 B;  4IFD I;  3SHL A;  2FJ2 A;  2KJX A;  4BS9 A;  4DK0 A;  1PTO C;  1K8O A;  3R8B A;  1Z47 A;  1SNP A;  1F9P A;  3E0J A;  3ND8 A;  4DF7 A;  2CW0 D;  3QOL A;  2JA8 B;  1H9J A;  5IGF A;  1Q1E A;  5M5Y B;  1GHK A;  2CW0 C;  2RSO A;  3FPP A;  3S17 B;  4HED A;  4CGY B;  4HMI A;  4WRD A;  4ZUJ A;  2N55 A;  3VR4 A;  1CQF A;  2B2V A;  1LO5 D;  1Y8O B;  4TQU S;  3NWT A;  2EE1 A;  4DK1 A;  1QG7 A;  2E2I B;  5KND A;  2VUM B;  5NUC A;  1S5E D;  5COR A;  1D2B A;  1RHP A;  3BDL A;  2NVQ B;  1IYV A;  1ZYR D;  4O1N A;  1VF7 A;  3DWP A;  1RD9 D;  4C1N K;  2WP8 J;  1EL0 A;  2PPB C;  1JQY D;  2HUG A;  5C6A A;  3J81 E;  4ZQ3 A;  3PO3 B;  1ZYR C;  4QUF A;  4BWG B;  3I4L A;  4B9W A;  4PV1 C;  4C3H G;  2CHB D;  3K57 A;  2IT1 A;  3VR6 A;  4ZYS A;  2BCO A;  1STH A;  1Q8I A;  1JB3 A;  2ZT9 C;  3RMH A;  4MHE A;  5DM6 3;  1RJT A;  3SK5 A;  4CKB A;  3LNN A;  5IOD A;  1M8A A;  1WVL A;  2EY5 A;  5FO8 B;  3DUZ A;  2J0T D;  1I50 B;  1DJR D;  1QOH A;  2I07 B;  3S1M B;  1Q1B A;  3J7A V;  4WOR A;  5C0X J;  1OXX K;  3K5L A;  2F0I A;  4DN4 M;  3KBG A;  4YIJ A;  2WAC A;  2XNA C;  3Q23 A;  2E2H B;  3MAQ A;  1SNC A;  5I4D A;  1JIC A;  1NR2 A;  4J8Q A;  3I72 A;  1LT6 D;  5M9O A;  4J1M A;  2PZW A;  1A2T A;  2QEJ C;  2KCC A;  4L6T B;  3I4M B;  1DD2 A;  1ENF A;  4RKB A;  4V19 0;  4FVM A;  5C4J B;  1TS2 A;  4DU9 A;  1B3A A;  3KUP A;  1EY8 A;  4Z9C B;  2F0F A;  1TS3 A;  3IFT A;  2NWG A;  2RDG A;  2F0U A;  1WTR A;  2E76 C;  2NTT A;  1KLG D;  3C3L A;  3NE5 B;  1LT5 D;  2EJM A;  1EYC A;  1TWA B;  3CHB D;  3Q22 A;  1AZQ A;  3T16 A;  1PTO H;  2EDG A;  2KEE A;  1X3P A;  1IKM A;  4IAL A;  3T53 B;  3ZYY X;  4A3M B;  1TS4 A;  5KEE A;  1Y8N B;  1KNA A;  1BQQ T;  1TY2 A;  3J80 E;  2K6A A;  1STA A;  4V0B A;  2E2J B;  3P20 A;  2HQE A;  3TP5 A;  4ZRZ A;  4QIW B;  3H6M A;  1PTO B;  1RTN A;  4PNY A;  2B39 A;  3CU7 A;  3RUZ A;  4XYQ A;  1AFP A;  2F0D A;  2PO4 A;  1PFB A;  2FFK B;  3NQI A;  4HSV A;  1HFG A;  2IL8 A;  3HOZ B;  4XQJ A;  3A8J E;  3MTS A;  3DHQ A;  2IX1 A;  1WCM B;  4LAA A;  1Y8P B;  1SNO A;  2K7V A;  1GOZ A;  4A3D B;  4XQQ A;  2F0S A;  5K5P A;  1PRT C;  2M2L A;  4G4K A;  3BZD B;  3N6R A;  3QWN A;  3A8I E;  5IGB A;  1PZI D;  4QUC A;  2X69 A;  3SK6 A;  4RGM A;  1I4X A;  2BDO A;  4OIK A;  5I6W A;  1ICW A;  1UEA B;  1MBY A;  2B2W A;  5AFW A;  5FKA C;  2KHS A;  3NWS A;  4K6L A;  4K8I A;  5CV8 A;  2LS0 1;  2LFN A;  2AQ1 B;  3OIQ A;  4RHR A;  1M4V A;  4G7Z C;  1FNW A;  1WD0 A;  5EKK A;  4NMZ A;  1GHJ A;  1DM0 B;  3MFG A;  1NAP A;  3LWE A;  1SNQ A;  3M3Y B;  3S14 B;  2IX0 A;  1FD7 D;  2R61 A;  4NW2 A;  2VNU D;  3ONA B;  3U9O A;  1HTP A;  4OO1 I;  2XIW A;  4R8I A;  1S5C D;  2KVM A;  3DMU A;  2SNM A;  3Q6S A;  4WFN 3;  2EYL A;  3MEH A;  1SXT A;  2KA7 A;  3H94 A;  4XIG S;  2K33 A;  1BUV T;  4FF1 A;  2L1B A;  2K01 A;  2B63 B;  3OWF A;  5IIF A;  4DAP A;  2NZ1 D;  4HCE A;  1QWY A;  3DWQ A;  2EYO A;  1EY7 A;  3TN2 A;  1STE A;  3D8G A;  3WOF A;  1BCP C;  2A73 B;  5J22 A;  1PLF A;  1SE4 A;  4ILW A;  4H0L C;  2O5J C;  1HUN A;  4ODG A;  4M8A A;  5G3L D;  2KUM A;  2ICI A;  2FMM A;  4A3B B;  2F0L A;  4NP5 A;  1T5X D;  1O78 A;  3GV6 A;  3D31 A;  2I46 A;  1PRT F;  3M4Y A;  2B2T A;  4S3S A;  5CBA E;  1ESR A;  1A3V A;  4A3K B;  1FNU A;  4NKL A;  2QDB A;  2TSS A;  1YNN C;  3NTK A;  2B2V C;  4BY1 B;  4NDX A;  2NTS A;  3MHB A;  1G29 1;  2FHT A;  1QE6 A;  3NP8 A;  5ELB A;  4FXG C;  5IGG A;  1LT3 D;  3BS1 A;  3WOE A;  5LL6 X;  2B2Y A;  5JAV A;  4FXK C;  3NUC A;  1VDZ A;  3TZD A;  1B44 D;  4FO2 A;  3CRL C;  4ZKB B;  2K32 A;  4X3S A;  5JVG 3;  2PW5 A;  1PYW D;  2B8F A;  4KV6 A;  4G7H C;  4RGT A;  3CKI B;  4K2K A;  2YYZ A;  3P1H A;  2OXP A;  1LLR D;  4OIJ A;  1D6E C;  3TP7 A;  1EY0 A;  2O4X A;  1EWH A;  1CK1 A;  1K83 B;  1F2M A;  1EOT A;  2EPB A;  3A7L A;  3TP6 A;  3HS0 C;  4N9T A;  2R7Z B;  1U4R A;  4KD3 A;  5M5X B;  4KHZ A;  2F4I A;  1S5F D;  1SFO B;  3SE0 A;  3K5O A;  1G2T A;  4X3T A;  1STG A;  1BO0 A;  1EY5 A;  4IUP A;  1PRT B;  5D3D A;  3VA5 A;  1RF2 D;  4UAI A;  2IWH A;  5IT9 L;  3PIO 3;  5LL6 S;  5EPJ A;  3GQB A;  3P75 A;  3L3O C;  5E3F A;  4HSP A;  3C1E A;  2ZXP A;  1PTO D;  1R4Q B;  3FDT A;  1WTW A;  2AQ2 B;  2GA4 B;  5G3L F;  4K5X A;  5BN4 A;  1ENC A;  1GUW A;  1CM9 A;  1NR4 A;  2F0E A;  1CHQ D;  4RCN A;  3AMU A;  2RBM A;  3SVM A;  2MP1 A;  2NYZ D;  2JA6 B;  1KDC A;  3RLF A;  5FLX L;  1O7Z A;  3NK9 A;  1JC7 A;  5FK9 C;  4ABN A;  1SSO A;  2EZV A;  2QKI C;  3GTM B;  4KKU A;  1V1O A;  5J1Z A;  1FNV A;  3I73 A;  3A7A B;  1EU3 A;  3A8K E;  4ZKC B;  1I4R A;  2Q8T A;  3T4A C;  4DXF A;  4XDX A;  2F1M A;  4IUN A;  3A56 A;  1PXU A;  3RZO B;  3H91 A;  2PZT A;  3JAM E;  1JWM D;  3MC0 B;  1DON A;  3T13 A;  1IKL A;  5A2Q E;  1D1K A;  1V1P B;  3S15 B;  1LV9 A;  2RQX A;  3K5N A;  1SND A;  4K8J A;  4L8J A;  1O7Y A;  1CA5 A;  3FPU B;  4FNF A;  1BCP B;  3CRK C;  1VMC A;  1AW7 A;  3W2D A;  5JEA H;  4EGV A;  2L4N A;  1SYB A;  5EKL A;  1V8Q A;  1X3Q A;  3C1F A;  3QJY A;  3HOW B;  3BYY B;  1FYC A;  5CR3 A;  1IW7 C;  1SYE A;  4C3J B;  5FO9 B;  4Y7N B;  5JVH 3;  2E75 C;  4CJ2 C;  2F3W A;  5JJZ A;  3NBI A;  1EY6 A;  1TU2 B;  4KKT A;  4IQZ A;  5EGT A;  2XWB B;  3EQL C;  3R2I A;  4B08 A;  1GUN A;  5CBE E;  1HQM C;  5TSS A;  5C4X B;  4BA1 I;  1L0Y B;  4F88 A;  3QB3 A;  3DWA A;  1IHZ A;  1B9N A;  3ITP A;  2IJ0 A;  5KYI A;  1GUT A;  5JOB A;  4RH6 A;  2A6E D;  1SE3 A;  2MHV A;  3TDQ A;  2B2W C;  5C0X I;  1HXY D;  3PUW A;  4JBW A;  3OMG A;  4RCO A;  1PTO F;  1SYF A;  4XYO A;  2F0M A;  2F0G A;  2WAQ B;  5KYL A;  5I9P A;  2HDM A;  3MVV A;  4Q0F A;  2Z8L A;  2A6E C;  4BBS B;  3D3R A;  1Q12 A;  1JWS D;  1SNM A;  2AUK A;  2MPM A;  5I2X A;  1L0X B;  1QCB D;  3NPP A;  4QF4 A;  1XYI A;  1Y69 U;  3M7G A;  1TY0 A;  3W3A A;  3MXN A;  1BDO A;  1VMP A;  1AEX A;  4KI0 A;  2XN9 C;  1CTM A;  1Z6H A;  2NVT B;  2IPK D;  3DXJ C;  3VYU A;  4CBV A;  2A74 C;  1EZ8 A;  1HCZ A;  2HCI A;  1B53 A;  1D1I A;  4UDU C;  5CMD A;  1I6V C;  4ZK9 B;  1OXV A;  2X6L A;  2ICE C;  2K5D A;  1I6H B;  3MWY W;  3V05 A;  2OT2 A;  3GO5 A;  5C5M A;  3HP3 A;  1OXT A;  4KJN A;  2PQE A;  2KOL A;  2FMC A;  5CV6 A;  4ME5 A;  4KY6 A;  2A69 D;  4I7Z C;  3HOU B;  1GXD C;  2EJG C;  5COY A;  5JPM C;  1I4G A;  3MZ5 A;  2JYO A;  3F2U A;  1EY4 A;  3Q24 A;  3GTG B;  1C48 A;  2A69 C;  1UAP A;  1FGB D;  2IX3 A;  3D6W A;  1B9M A;  1YNJ C;  5C4H A;  1O80 A;  1JOO A;  2ENB A;  3BVZ A;  1EIG A;  4F8M A;  3SDZ A;  2JE6 I;  3NTH A;  1Q90 A;  2K03 A;  1EIH A;  4L63 B;  4HR7 B;  2B2T C;  2K1B A;  1H9R A;  1ROD A;  2JEB I;  1KLU D;  2JXM B;  5C4Z A;  3N52 A;  4A3E B;  4BY7 B;  1F2Z A;  5IT9 E;  4TRD A;  1PRT D;  2MJ8 A;  2EY1 A;  5DNF A;  1LAC A;  2F0N A;  1DYQ A;  2EOT A;  2D9U A;  1WTP A;  2B2Y C;  2L12 A;  2JA7 B;  2CVR A;  1ZXT A;  1TWG B;  2B8G A;  1ET9 A;  1TWH B;  3I3C A;  4CKC A;  1D5Z C;  1ILQ A;  4FP5 D;  4LMQ D;  2K5Q A;  1TT2 A;  5FLX E;  1A15 A;  4KKS A;  5E1F A;  3IKJ A;  3PMF A;  3KLR A;  3BDO A;  1TKW B;  2NUC A;  4KN4 C;  5EPK A;  4HN7 A;  4IFD H;  1NUC A;  3SEB A;  3PUZ A;  1F9R A;  3MXU A;  4R9W A;  1J9O A;  2K04 A;  4R8N A;  2BE5 C;  3HEJ A;  3NQT A;  5KGU A;  4KJO A;  4H7B A;  1G2S A;  4ZAI A;  2PZU A;  5I6Y A;  3GTJ B;  2E2D C;  3TP8 A;  1LTB D;  3WDN A;  2YU9 B;  1EYD A;  5HUR A;  4ULL A;  3SXH A;  4HCS A;  1GUS A;  2G9H D;  2H4O A;  3OOC A;  4KHV A;  2H1E A;  1Y1V B;  1EYA A;  1TWC B;  5C3W A;  3CQZ B;  2B2U A;  5JEA J;  1CZG A;  1PZK D;  4ZLT F;  1IL8 A;  1A3U A;  2AUJ D;  3BYT B;  1BCP D;  3NTI A;  2PCF B;  2EY2 A;  1Z7T A;  2KEC A;  4MN3 A;  4CHT B;  1U4L A;  2NN6 G;  4C3J G;  1TVX A;  3I4N B;  4FXD A;  3GD7 A;  3G7L A;  4C3I B;  1OXU A;  3C46 A;  2PYK A;  1E0B A;  2XWJ B;  5JEA G;  4QB4 A;  2BA1 A;  1ILP A;  2F0P A;  3VR5 A;  4U67 3;  3VR2 A;  4BBR B;  4A3I B;  1JCK B;  4FF3 A;  5M5W B;  2KCN A;  1VF5 C;  3VR3 A;  4IUU A;  2EJF C;  1B2T A;  1KAA A;  4A3J B;  1CA6 A;  2D62 A;  1XTC D;  2Z4I A;  1Y1W B;  1YNN D;  4Q5V A;  5D3I B;  4G57 A;  4K5W A;  1EWC A;  1U4M A;  3QOJ A;  3DM1 A;  5KNB A;  4IUQ A;  2SOB A;  1BR9 A;  4HMJ A;  3X3M A;  1HTL D;  2MUY A;  2BOS A;  4U68 A;  3T56 B;  3IL8 A;  1MSH A;  3K59 A;  2AWN A;  1A6X A;  4JK1 C;  1TS5 A;  4XTC S;  1PMR A;  2DNC A;  1GJX A;  1TR5 A;  2C5C A;  2XRS D;  3Q0A A;  4K2L A;  1CFM A;  3FKI B;  1HQR D;  1JOQ A;  2JP1 A;  4CKE A;  3VA7 A;  4DNT B;  2RSN A;  1LTG D;  4I65 A;  3J7A F;  1QJO A;  2EXZ A;  1DOL A;  1TII D;  1S5D D;  5EJW A;  1BOS A;  1JR0 D;  2KED A;  3NSW A;  1UUP A;  4HTH A;  5DM7 3;  4FF2 A;  1DZ1 A;  2DY8 A;  4EQP A;  3I90 A;  4K6D A;  5IGC A;  2A6H C;  2L55 A;  3GTL B;  4N9P A;  3LX0 A;  3ERQ A;  1B4O A;  1LAB A;  3PUX A;  1S5B D;  5T1G A;  1KAB A;  2IW3 A;  2K28 A;  4FYD A;  2EYP A;  3G6J B;  2L11 A;  3J80 L;  5ELF A;  4P2C B;  3UI2 A;  3HOX B;  1BCP F;  4DAV A;  1BNZ A;  1LTI D;  1VCI A;  5T1I A;  2EY6 A;  1ESF A;  2F03 A;  1I4H A;  3URY A;  1E2W A;  4CJ1 B;  1LTT D;  2OF1 A;  4C2M B;  1KTK A;  3P7J A;  4A93 B;  1A2U A;  3MA2 B;  3IAY A;  2NVX B;  3EJI A;  5ISR A;  4MIU A;  3BDC A;  5M3F B;  2CQA A;  5BN3 A;  2F0W A;  1SYD A;  2JSO A;  1SEB D;  1EZ6 A;  1STB A;  2XVS A;  5CGK A;  1NCV A;  3GTO B;  3HG9 A;  3RD4 A;  1AN8 A;  1JE4 A;  4IFD J;  1F2L A;  3R2T A;  5J39 A;  2A5H A;  2JA5 B;  3EFX D;  3QG1 A;  2WV6 D;  3J7Y W;  5BN5 A;  1SYG A;  2QCP X;  3DEO A;  2Z4H A;  4TSS A;  4IZ8 A;  1UNS A;  4HAE A;  3ERO A;  2EYH A;  1G8Z D;  3DEP A;  2EYF A;  2WB1 B;  4OGQ C;  5DEH A;  4PMB A;  1H9S A;  1SMY D;  5E4W C;  1U4P A;  2Q8I B;  4IFD G;  2WKD A;  2F0O A;  2XRQ D;  3RZD B;  1WTX A;  1ET6 A;  2NN6 H;  1W6K A;  2Q8R E;  4K5V A;  5EPL A;  2J7Z A;  3K0Y A;  4RKL A;  5KRU A;  3X3N A;  1PFM A;  3I91 A;  5CV9 A;  1IW7 D;  3I70 A;  4BA2 I;  1RCV D;  2NB0 A;  1SMY C;  1MGS A;  2RVL A;  2Y0S B;  3V2T A;  5IOC A;  1T5E A;  2BA0 A;  5D14 A;  1GUG A;  3HZX A;  5JPN C;  1MSG A;  1CHP D;  2ID0 A;  3M4O B;  3BVG A;  1MD2 D;  3TBI B;  3L7Z C;  3U9S A;  1W6J A;  2L0C A;  3L9A X;  4OO1 H;  1HA5 A;  1R4P B;  3OMC A;  2NVY B;  4C3I G;  1II3 A;  4KMU C;  1EQV A;  3PV0 A;  3SR1 A;  3H3V C;  5LHY 1;  4DGZ A;  2F0V A;  1D5M C;  2LY7 A;  4C56 C;  2M00 A;  1H9M A;  1OXS C;  3K7A B;  2XSC A;  4OHJ A;  2NBF A;  1H9S B;  4IN3 A;  1E2Z A;  2Z1C A;  5IGE A;  2DY7 A;  2TMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...