2KCCA

Solution structure of biotinoyl domain from human acetyl-coa carboxylase 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
84
Chain Sequence
MENDPTVLRSPSAGKLTQYTVEDGGHVEAGSSYAEMEVMKMIMTLNVQERGRVKYIKRPGAVLEAGCVVARLELDDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Acetyl-CoA carboxylase 2
publication title Biotinoyl domain of human acetyl-CoA carboxylase: Structural insights into the carboxyl transfer mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 84
sequence length 84
ec nomenclature ec 6.3.4.14: Biotin carboxylase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kccA00
3FPPA 1CI3M 2A6HC 4HR7B 1ZYRC 2E74C 4H0LC 2B8GA 4DK1A 3ND9A 3A7AB 5JEAH 2V4DA 3RLFA 3A8JE 3CRLC 3I73A 1BDOA 3N6RA 4G7OC 1B9NA 2YYZA 2B8FA 2K32A 1LACA 2A69D 2JE6I 3D4RA 4I7ZC 4XTCS 1Y69U 1CFMA 1GUOA 1GUNA 1H9JA 1K8MA 1Y8OB 2EJGC 3AB9A 2D2CC 3T51B 5C0XH 2O5IC 1IYUA 4IQZA 1H9KA 2NN6G 4TQUS 3T56B 2PNRC 2A6EC 1YNJC 2DN8A 3CRKC 5KNBA 3VR3A 1GJXA 2K33A 3SDZA 1Q90A 3ND8A 3TZUA 2QF7A 1E2ZA 1H9RA 2A68D 4OO1G 1GUSA 4IFDH 1Z7TA 1OXSC 2ZT9C 3M4YA 4DK0A 2NN6I 4H44C 1LABA 3VR4A 4H13C 5K36H 1T5EA 3BDOA 3PV0A 4G7HC 3D31A 1SMYC 1DCZA 1A6XA 1Z6HA 2AUKA 3HGBA 2BA1A 2D5DA 4KI0A 5KNDA 1EWHA 2EJMA 2BDOA 1H9MA 2KA7A 3GQBA 3L7ZC 4KHZA 3KLRA 3PUWA 3MFYA 1ZKOA 2K7VA 2NN6H 4G7ZC 2A69C 3A8KE 3MXUA 4KN4C 2CW0C 3VA7A 2DNCA 1YNNC 4KMUC 1O7LA 3QG1A 3A8IE 3A7LA 1GUGA 1DXMA 2F1MA 5BN3A 3OW7A 4KKTA 1OXXK 1FYCA 4GZYC 1QJOA 1OXUA 1OXTA 5BN5A 1G291 3PUVA 3WDNA 1VCIA 2BA0A 1K8OA 1V8QA 2A68C 2AUJD 4L8JA 2PPBC 1VF7A 4KKUA 3U9SA 1IW7D 3QJYA 1TKWB 1VDZA 1H9SA 3DXJC 1VF5C 2Q8IB 5C0XG 1DD2A 1H9SB 4OGQC 2IT1A 2BE5D 3T53B 2EDGA 1GHKA 3OPOA 1Q1BA 2R6GA 2L5TA 2A6HD 3VR2A 5BN4A 3BG3A 2E76C 3IFTA 3SE0A 3M7NA 2EVBA 5A35A 4BA1I 3OOCA 3VR5A 4LK1C 1Q1EA 1Y8PB 2JEAI 4OO1H 1PMRA 1TU2B 2PCFB 3VR6A 5K36G 3M85A 1O78A 1HTPA 2DNEA 1OXVA 3FMCA 4XIGS 5JEAG 3H94A 1GUTA 3NE5B 1V43A 1Y8NB 3I4LA 2KCCA 1E2WA 4BA2I 2AWOA 4LJZC 4TKOB 1IYVA 4DNRB 1B9MA 2A6ED 3EQLC 2O5JC 3QIAA 1I6VC 1CTMA 1HQMC 4PV1C 3GD7A 3IKJA 3PUXA 1ONLA 3PUZA 1FR3A 1IW7C 4DNTB 2E75C 1HPCA 2EJFC 4RCNA 3LWUA 2D62A 3P20A 2JEBI 2LMCB 3LNNA 4JK1C 4KN7C 4JBWA 2BE5C 3PUYA 5KNCA 1E2VA 1HCZA 3I72A 1GHJA 4IFDG 4KKSA 2JXMB 1Q12A 3W3AA
chains in the Genus database with same CATH superfamily
3GTLB 1I6HH 2Z4HA 5IP7H 1MJEA 4KHPQ 3ULLA 1EOVA 1XNQQ 1IYJB 3RMHA 2F0DA 1STGA 3D4RA 1TS4A 4NB3A 3KJOA 2NB0A 3TQYA 1N32Q 4DK6C 2PNRC 1SE3A 4AIMA 1BCPB 1BCPC 1BO0A 3SHLA 1MBYA 2XIWA 1GO3E 4Y7NB 4FO2A 1H9RA 4K5XA 1JORA 1R9TB 4GKJL 3TN2A 2F0OA 1ILQA 3SK5A 1BCPF 2K04A 3NP8A 3HOYB 2KECA 2K52A 1CKNB 2F3WA 1K8AC 3CCLA 2YV5A 2ASBA 2PQAA 4GLVB 1FGUA 3KLRA 1EQRA 1HRJA 2K7VA 4HMJA 4CKEA 1XYIA 3A8KE 2CW0C 1HUMA 3A55A 4B9WA 1F2ZA 3A74A 4K6LA 1XNRQ 2EZVA 3QOLA 2D9UA 4J8QA 2F0VA 2WINB 1YJWA 2FXQA 1B3AA 5KIXA 4KKUA 2QKIC 5IT9c 1BOSA 2HT1A 4OWWB 3TDQA 4YY3Q 3HOXB 1PLFA 2OQKA 4H02A 3SEBA 3CCQA 1WTXA 3TP5A 2EDGA 5EKKA 2UU9Q 2WAQG 4A3MG 3STBD 2JA7G 5FO7B 5M3MB 2E76C 3IFTA 1YITA 1IBKQ 4LUOA 1PMRA 4OX9Q 2DNEA 1B44D 1GKHA 2I07B 1V43A 1Y8NB 4Q5VA 2JA8H 1TS2A 1HQMC 4A3IB 5IYBG 2WFWA 4X65L 2F0IA 3OMGA 1HNZL 1E1TA 1L1OB 3RN2A 1L1OC 2BE5C 3W1BA 2OTJA 2JJQA 2MO1A 4B3RQ 1YI2A 1ASYA 1QOHA 5AFWA 1QG7A 2VZAA 2Q8TA 2DJFC 3KOJA 4YCUA 2E2IH 2PZWA 4DK1A 3ND9A 4LF6Q 4BY7G 4POFA 1C7YA 3NPPA 3I3CA 3D6WA 4XTCS 1YNJD 1JB3A 1ET9A 1LT6D 4C3HH 5I6YA 1IZ6A 2NN6G 4EQNA 4QMGA 5KNBA 3VR3A 5CBEE 3K58A 2K33A 4LUZA 4LF8Q 1Q90A 2IY5B 2UXBQ 1LTTD 2QF7A 4LFAQ 1IBLQ 5IYDH 4DUZL 3FKIG 1PYSB 3MFGA 4QIWE 1LABA 4LAAA 2A8VA 1FJGL 2QW7A 3A5UA 5C6AA 3HGBA 2MQHA 5CC4A 2B63G 1ICWA 1SYDA 1HA6A 4UP8A 5CYUA 3MFYA 1HZCA 4LW1A 2ALYB 5FO9B 1I4PA 5T1IA 1J5EQ 3I4NH 1J9OA 3I4OA 2HDLA 5CV8A 2JA5G 2AQ1B 3MXNB 3VYSA 2R61A 1MHWC 5BN5A 3ITPA 4NXMQ 1I50B 2MP1A 4JOIA 4RWSC 1IW7D 5EKIA 1TKWB 5CMDA 5J3BA 2F0WA 4DV5Q 2L5TA 3NENA 2F0GA 4IFDJ 4IURA 4FDBA 3CAMA 2EVBA 1G8ZD 1PZID 4FVMA 4C3JB 3GTLH 3QB3A 4DR7Q 2J0TD 3K5LA 1J6QA 5K36G 4QUFA 1HA5A 2F52A 2NVYB 2JSOA 4ZAIA 4IOCA 3S16B 3J7ZC 4A3FB 4CDEC 4P2CB 1WTQA 2E2HB 4BY7B 1CSQA 4B3SQ 4HIMA 3KLWA 2WKDA 1FR3A 4WORA 4DNTB 3HOZB 4RAUC 5EPLA 3P20A 4DAYB 1STAA 5F2DA 4Y7NH 1IBMQ 1HNWQ 1SJHD 4HIDA 3SK4A 1FNWA 1MD2D 1R9TH 1WCMG 1CZGA 4N9TA 5FO8B 2K5HA 1HNXQ 4UAIA 3I56A 3NSWA 1HUNA 3HOYH 5EKLA 5L37A 3L3OC 2NTTA 3FKIB 3BU2A 5IP9G 2I5MX 1XJVA 3KF8B 1UE1A 2KEEA 5FKAC 2B2UC 1Y8OB 2L12A 5C0XH 3NUCA 3GDEA 2L15A 2G9HD 2EYMA 4DV0Q 1HZAA 2B63B 3T56B 2GA4B 3RR5A 4JI2Q 1X3QA 4LF7Q 4WJ4A 3SVMA 4HJ8A 3CC7A 3GTJB 1KLUD 4JI5Q 1L0XB 1XPRA 4L5SA 3NTKA 5IGDA 5GADC 4H13C 1EZ6A 2ZM6L 1MGSA 1XPUA 2JA5B 1PH8A 3M3YB 3RD4A 2K05A 1EY5A 3HOXH 3OYYA 2KCNA 5COYA 1CHPD 4DV3L 1A15A 4FF1A 1E22A 1EQVA 2PQAB 3GTQB 4ZUIA 5M3MH 4IUTA 1PH7A 4KN4C 2YU9H 4MHEA 4JI6Q 1AZPA 1C4QA 5C3EG 2MPMA 3UE0A 3TS0A 2PI2A 1DM0B 3RNUA 1CT1D 3ZJYC 3PIO3 1X9NA 4DR2L 3S1QB 4JI1L 5IWAL 3HOWG 4B9XA 3K0XA 2NVXB 1W6JA 2Q8IB 1V1PA 4A3IH 1IXRA 1PH9A 1WTWA 5DEHA 2IX3A 4E6IA 1KDCA 2F0FA 2A74C 1NTGA 2R6GA 4ME3A 3DLLA 1ENCA 1HFNA 1Y1WG 4O42A 1Y8PB 1TU2B 1GOZA 1U4MA 1ILPA 1WCMB 2CH4W 4DR5L 2KEDA 1JWMD 5J1ZA 4DR6Q 5CORA 1MI2A 2AWOA 1SLJA 4LJZC 2Q2UA 4FF2A 1SNOA 4HMIA 4XYOA 4JI8Q 1M8AA 2B2WA 2F4VL 1BF4A 2B2VA 4QB4A 4QQBX 4GNXC 4DV2Q 4FXGC 1K0SA 2OF1A 3S1NB 3NHHA 5D14A 1SYBA 4NW2A 5KYIA 1SNPA 5C0XI 3SR1A 3PUVA 3P1HA 2E74C 1IKLA 4K0KL 1RF2D 2RA4A 5IYCG 4IUPA 4KK7A 3CD6A 2V4DA 3RLFA 4QY7A 1LM0A 5EPJA 4ILWA 4MTNA 1KAAA 4EGVA 3T1YL 2K32A 5CV6A 1CFMA 1K8MA 4JBJA 1S5DD 5CV9A 3VA5A 2F0PA 2FJ2A 4R4CA 1PFMA 5E1FA 5E3FA 1C0AA 1SJED 1VQHA 2DN8A 4CKCA 1TY0A 4ALPA 2OXPA 1HZBA 1AW7A 4OO1G 2A19A 4UP7A 4IFDH 2IW3A 2XRSD 1OXSC 3MXGA 5JAVA 5C3EB 5I9OA 1TS3A 4CDCC 1I50H 1C8CA 4M1UB 1SMYC 1W3SA 4F88A 5JVG3 2K5QA 1RODA 2WACA 2UUBL 2F0JA 1EWHA 2BDOA 2XTIA 2RDFA 4YHHL 1HR0L 3GQBA 5JJIA 4DGZA 1LYLA 3S2HB 2M2LA 5M3FB 4NXML 4C3JH 2M9VA 2F1MA 3OW7A 2RSOA 4P72A 4NMZA 2NVYH 4A3KB 3K5NA 3WDNA 4A3FH 3NWSA 1HQRD 1Y1WB 3M4QA 1PA6A 1VF7A 2DJGC 2E2HH 2JA8G 4BY7H 1A0IA 1NMGA 2WB1G 1XPOA 1ET6A 4GKJQ 3HOZH 2A73B 1CA6A 1IL8A 3EA6A 1S3OA 2XGTA 5M5WB 2PMZB 3BVGA 3G6EA 4DV1L 4GOPA 2PZUA 1I4RA 1K83B 3VYUA 3ICEA 5EBDA 1EWIA 1UAPA 3FKIH 1OXVA 4XIGS 3NE5B 3KFUA 2RCNA 2KCCA 1BBWA 3ULPA 5BR8L 3S17B 3F2CA 1ESRA 1PV4A 1EY4A 2B63H 1SE4A 1KTKA 2EJFC 1HNXL 5A2QL 3HS0C 3GTJH 3LNNA 4CJ0B 3NQTA 3S1RB 5I2YA 2CCZA 2L1BA 1L0WA 3TP6A 1CK1A 4U68A 5IYDG 2PNHA 3MTSA 2JA5H 4R8NA 2JP1A 1SNCA 1DONA 1QNUA 3M3YH 5H1SE 4KD3A 1F9PA 4BBRG 1XMQL 4R1JA 2QA4A 2LKVA 2NZOA 3BDCA 5K5PA 3HOUB 3GTQH 4C2MB 4EX5A 1EIYB 4IQZA 4TQUS 4CDFC 3CHBD 3CRKC 1PFSA 2MGSA 4L6TB 5IIFA 1E1OA 3I4NG 4U673 3J7YW 3T1HL 3URYA 2E2DC 1QVGA 4X65Q 1BQQT 3M4YA 4IPGA 2K5WA 4XXEA 4DK3C 3M4PA 3MAQA 1VQPA 3S1QH 1KDAA 1HNZQ 5K36H 2NVXH 3PIOA 4HEDA 4FP5D 1VQCA 1YHAA 2BA1A 2YTVA 1SNQA 5KEEA 1SE2A 4A76A 1B70B 2F0SA 2WB1B 5GAEC 4OXPA 2QDLA 3Q22A 5LL6X 4S3SA 2EE1A 2KHIA 1STHA 1WCMH 5JOBA 2FFKB 3ERQA 1Q8IA 5ELCA 3F2DA 1QZHA 4IPDA 4V0BA 3BZCA 4JVZA 2L55A 2F3VA 2LY7A 3QJYA 1QVCA 4I7AA 4IJHA 4KTAA 3S1MB 3PF4A 4DUZQ 3T53B 3S1NH 1YIJA 1RIPA 2B2TA 1FJGQ 3PCOB 4RGOS 5NUCA 3KDFA 1F2YA 3ER0A 1SYCA 1G6PA 3P7JA 5M5YB 1D5ZC 4XQNA 4Q0FA 4X3SA 1HTPA 3HOYG 1AE3A 1PYWD 1UWVA 3BDLA 2AWNA 1J8IA 2A6ED 1LV9A 4BBRB 2JYOA 1STNA 2MUYA 2TMPA 2P5ZX 1YNXA 5ELNA 3J81L 4M8AA 3K7AB 4BBSG 2A5HA 5C3EH 2N88A 4HSVA 4RG1A 1JR0D 5C3XA 4WFN3 1MSGA 2ID0A 3PF5A 1CHQD 3A8JE 3C46A 1BR9A 4KLKA 4ZKCB 2Z6KA 3HOXG 2EY6A 2YYZA 1VQ4A 4HN7A 3SK8A 1KNEA 4DA2A 1GVPA 4HAEA 1YHQA 4KD4A 3S2HH 3I4MB 5M3MG 1D8LA 5M3FH 3PMFA 2N78A 1QILA 3SDZA 5ELOA 2FMCA 1F2MA 3J80E 4BY1G 1EQTA 1G51A 3U4VA 1Y1VB 2B2YC 4A3KH 3K80C 3N52A 2B3GA 1Y1WH 4O0AA 4P73A 2IWHA 4MTKA 3ZYYX 2QILA 4ZCKA 3TRZA 2LS01 4A3IG 5KNDA 1JE5A 1K3RA 5A2QE 4A3GG 3EN2A 2ZTEA 4GLXA 3FP9A 4LUVA 5M5WH 2R7ZG 2L0CA 1EFID 1WTOA 1PDQA 3RZOB 3B6YA 1DGSA 4ZRZA 1K83H 3OIPA 4LWCA 4PMBA 5BN3A 2NVQB 3H6MA 3J7AF 4LF4L 3CCMA 4IUNA 1V8QA 4C3IB 1NCVA 3X3MA 3S17H 5IYCH 1B2TA 1E7ZA 5C3WA 1U9RA 4K14A 4DR3L 1H9SA 1A3VA 2CWPA 1LT4D 3PO2G 3R2IA 3BZKA 4X3TA 2ZM6Q 3S1RH 2IPKD 1RD9D 4QUCA 3AMUA 4A4IA 4IUVA 4LFCL 3J80i 2UUAL 3A0JA 5J22A 4DV3Q 1N33Q 2B29A 4OO1H 4BBSB 2K5DA 3H3VI 4OL7A 1SDFA 4FF4A 4BA2I 4ME5A 5E4WC 1IL2A 2WIIB 1N36L 3HOUH 4QJFA 2DY7A 3DWAA 4C2MH 1V1OA 4PV1C 2F0KA 1BCPD 1TWFB 1SYEA 3GTPB 2F0NA 2E75C 4DR2Q 4ODGA 2RCFA 4IN3A 4JI1Q 5IWAQ 4JK1C 3OWFA 4JI3L 1S5FD 3CKIB 2YU9B 2Z4IA 4DXGA 4IFDG 1LTLA 1VQBA 4HJ5A 1CI3M 4QF4A 4F7XA 4BY1B 3NTHA 3Q23A 2XWJB 4HJAA 4H0LC 2UUCL 1D2BA 4DPGA 4PZ8A 5ELDA 1IHZA 2KHJA 1CZWA 1EU4A 1B9NA 1RHPA 2SDFA 4N8X1 1LACA 2JQOA 3HKZG 4H7BA 5JVH3 2CW0D 2O2LD 3AB9A 4YCWA 1DZ1A 4RFBA 1WD0A 4DR5Q 4A3GB 1GXDC 1YNJC 1K9MC 2R7ZB 4C3JG 2K50A 1GUSA 2F4VQ 1DOKA 5IGGA 1YEZA 3I2ZA 1EIHA 3C3LA 4A3FG 1VQLA 3S2DB 1A62A 3S1MH 3I55A 3HOZG 3CCJA 3J81E 4A93B 2F0UA 3K59A 4K0KQ 2A69C 1L2FA 3MEHA 5FK9C 3PO2B 1YNNC 3HFZB 1X3EA 3T1YQ 5M5YH 4YCVA 1PZKD 2RHSB 2IHFA 3RN5A 2WV6D 5LMNL 5JEAJ 1QCBD 4OHJA 1B53A 4TVAB 4XQQA 5JJZA 1VDZA 4F8MA 4BBRH 4OO1I 1U4PA 1B8AA 4C56C 3U4ZA 1WI5A 3HP3A 3T4AC 3AFQA 2BE5D 3DEPA 3OPOA 4LF9L 2JA9A 2EOTA 3K7AH 4NP5A 3JAML 4IZ8A 2F0LA 2UUBQ 5CV7A 5J39A 1PHJA 4HSPA 3NK9A 1X3PA 4FXDA 1PFBA 4YHHQ 1HR0Q 1VQ5A 3EROA 4NPSA 3V2TA 2RF4A 3ULJA 2CH4A 3KLSA 4QL5A 2UXCL 2PW7A 4A3EB 1E2WA 2Q2HA 2F0EA 3D0FA 3I4MH 3PUXA 4P71A 4R4IA 3J81i 2C35B 3HKZB 3D4WA 4KHVA 1Y1VH 2WP8J 3DWPA 1N9WA 4KKSA 5IGBA 1PTOB 1PTOC 1D1IA 1YHBA 1ZYRC 2RSNA 3KYHC 1VQ8A 2OQ0A 5C4ZA 1NE3A 3OW2A 3K5OA 4MZ9A 2VL6A 1NR4A 4RKBA 3N6RA 4KJNA 3G4SA 4DV1Q 1JE4A 1D5XC 1B3QA 1PTOF 1H9JA 1GUNA 3WWVA 1AE2A 3RZOH 4CKBA 3HG9A 5IOCA 3D8GA 3TZUA 3CW2C 5BR8Q 2E5LL 2NVQH 4K6DA 4RKLA 4JYAL 3S15B 2TSSA 1EY6A 4B08A 2KVMA 2QDBA 4C3IH 5DNFA 2PMZE 5AJ3L 4DKAC 1PYBA 3CC4A 1FNUA 4NXNL 3BYTB 2VXWA 4K5VA 4PMWA 2JA6G 1KXLA 3K5MA 4AYBG 4XYQA 4UHVA 4O2DA 1WFQA 3L9AX 1LTGD 1EWCA 2G5DA 3NBIA 4L5TA 1I94L 4A3BB 1VQAA 3W1GA 1XMQQ 3A8IE 1K3BC 2KENA 4BBSH 1RTOA 1OXXK 1QJOA 3Q6SA 2BA0A 4JV5L 1JOKA 2RDGA 2VUMB 4LFBL 1X3GA 1WTHA 2NZ1D 3T1HQ 1TWFH 1RKNA 1JJ2A 3GTPH 2HCCA 1H9SB 1KD1C 4OGQC 2EYHA 3AU7A 5M9OA 1N33L 4B3ML 5LMUL 3D4DA 1STEA 1O80A 5I9PA 2DGYA 2X6GA 3K81C 2K5VA 2XVSA 1U4LA 1B50A 1A2TA 3EBEA 4BY1H 4X64L 1Q1EA 5IGCA 5JJLA 4O1NA 2ATWA 1MKHA 3D6CA 2HHHL 3E0JA 1FGBD 2BH8A 2EYLA 2HIVA 4JI0L 1Q81C 1U4RA 2GN5A 3IKJA 2I46A 2QEJC 1ONLA 4IPHA 4A3GH 1PH4A 5M3FG 5ELBA 2R7ZH 2NTSA 4HTHA 3K57A 2IL8A 5DM73 1X3FA 4A3KG 2WB1E 3UI2A 4PQXA 3GP7A 3NXWA 1QE6A 3S2DH 1C48A 1ENAA 5JEAH 2NBFA 3CRLC 3I73A 5GAHC 4A93H 2JE6I 3LGJA 2XWBB 4JW0A 3JAME 1GUOA 3TS2A 1M90C 2N8NA 1KQSA 1UUPA 3PO2H 2JA6B 4YWLA 2Q2IA 4AYBB 1GJXA 3AFPA 2L4NA 2HUGA 1E2ZA 2BCOA 4ZQ3A 1WJJA 2EY1A 1TWGB 5JJKA 1G91A 1EYDA 2DUDA 3CQZB 2XNAC 1YJ9A 2KHSA 1X65A 1SE8A 1H9MA 3TMEA 2PW5A 4KHZA 3J7A5 4DV6L 3I91A 1W6KA 4Z9CB 4A3JB 2SOBA 1HTLD 2XRQD 1CA5A 1M1KC 1V1QA 1MIUA 1A3TA 4J6HA 1ZEQX 2KCMA 1S40A 1VQJA 3IRBA 4A3EH 1S4ZA 2A68C 3NEMA 1GM5A 2ENBA 1EEFD 3U9SA 3HOUG 2Y0SB 3QO2A 1VF5C 1PH5A 1PH1A 1TT2A 3JAMi 1U5KA 3BVMA 3CF5A 5IT9L 2PO4A 1Y14B 1LTBD 1PTOH 2BOSA 2K03A 1EYCA 3UDIA 1HH2P 3MA2B 3TZDA 1TWHB 2PCFB 3VR6A 3P75A 3OSOA 4MN3A 3R8BA 1Z9FA 5I2XA 3H94A 4KY6A 5C4XG 5KYLA 1IYVA 1A63A 2I0QA 4NDXA 3QIAA 3RLNA 1CTMA 4XT1B 3DM1A 4JOIC 3PUZA 3GV6A 2DY8A 1TVXA 4LF4Q 3DMUA 4OEMB 5EJWA 3S15H 5C5LA 2ZJRA 4DR3Q 1D7QA 4PMCA 1SMYD 2K4KA 1S5ED 2A6HC 2Z0SA 1HXYD 3J80L 1RTNA 4AH6A 2IHEA 1BDOA 2GVAA 4V190 4LFCQ 4CHTB 2B8FA 2UUAQ 3C2PA 3CPWA 2O5IC 4A3BH 1QVFA 4UPAA 3A5ZB 3G71A 2XN9C 2NYZD 5FLXE 4OELB 1N36Q 2F03A 1E24A 4WRDA 4DU9A 3H0GB 1QB5D 5T1GA 2VUMH 1FD7D 1T5EA 5GROA 5EPKA 4G7HC 3G6JB 4K2KA 1CM9A 4JI3Q 1EY0A 2D5DA 1V9PA 4FNFA 3JC66 1CQFA 2R7FA 4IFDI 1NMFA 2L9HA 2X6LA 3BS1A 3KBXA 3PUWA 1GUWA 2UUCQ 3EFXD 3M9BA 1CSPA 2OWOA 3MXUA 4JBKA 3TP7A 2Z8LA 2K6AA 1G291 1B4OA 4R4TA 4L5QA 5C4JB 1XMOL 3WOFA 1EYGA 1RJTA 2F0TA 2CWAA 2HQLA 1PH2A 1EY9A 4OONA 2CFMA 4RHSA 3RUZA 3I4MG 5C4XB 1HFGA 3I7FA 3C1EA 1A8VA 1L1OA 1TIID 1PRTB 3E6ZX 1PRTC 1Q1BA 1Y1VG 2R93B 3F8TA 3VR2A 4KY7A 3BG3A 2MHVA 4PNYA 2R92B 4DF7A 5HGQA 4LK1C 4X62L 1G6ZA 1EUJA 1SXTA 2K14A 2SNSA 1PRTF 4RH6A 5D3DA 1VQ6A 1KRSA 3T13A 1R4QB 1PH6A 3IFDA 3CC2A 3HOVG 2O5JC 2G9DA 2JA6H 3U50C 4RGNA 5LMNQ 1V1PB 3BZDB 4JCVE 2ES2A 4RCNA 4WJWA 2FMMA 4A3CH 3PUYA 2Q2TA 3V05A 1A2UA 1TWGH 5HURA 3FPPA 3DUZA 4HR7B 4TRDA 4C3IG 4JBMA 1D6EC 1SAPA 3CQZH 4LF9Q 5ISRA 2B8GA 1LTRD 4NKLA 3PO3B 1I5FA 3O13A 1N8RC 5IT9E 4G7OC 1Q8KA 4DAVA 4XT3B 1PXUA 3CCVA 4GN4B 1EEID 1RCVD 2EJGC 3M4OB 3FPUB 2QEXA 4K8IA 3SXHA 2B2WC 5G3LF 4A3JH 1BKBA 1SNMA 1M4VA 2B2VC 2UXCQ 2BDNA 1MSHA 2K1BA 4AQYL 3MXNA 1TWCB 3HKSA 4RCOA 2ZXRA 3F1ZA 1EL0A 3OMCA 4LF5L 1EU3A 2E2JB 1UE7A 1Z6HA 4R4OA 3CMAA 3MWYW 2PZTA 4QGUA 2H5XA 3FDTA 3EVQA 4OIKA 3VA7A 1KHIA 2DNCA 5C44B 1SYFA 1GUGA 1DXMA 4K2LA 2IJ0A 3GTGB 1TWHH 3HKZE 3NBHA 1UEAB 4XQJA 1YBYA 1C9OA 2EQSA 2R7DA 2AUJD 5DLQE 1N34L 1SROA 1Q3LA 2E5LQ 2RHQB 1P8LA 4JYAQ 3DXJC 2H1EA 2SNMA 1DD2A 5HY6A 1GHKA 3HOVB 5FLMH 5AJ3Q 2BH2A 2VB3X 4UP9A 4NXNQ 3BVZA 2GVBA 2HQEA 2K5NA 1B7YB 3Q8DA 1QZGA 3H91A 1FL0A 4EQPA 1VQFA 1VQ9A 2UXDL 2MFIA 1TQOA 3K6OA 1I94Q 5IGEA 2FHTA 3KF8A 5JEAG 3I4LA 3IAYA 2B2UA 2KUMA 2HDMA 4A93G 4F87A 3R3OA 1WTRA 1KDBA 2NVTB 2LXKA 4K5WA 4JC0A 4JV5Q 2VW9A 4EQ5A 1ZXTA 2MNAA 4GKKQ 2D62A 3A56A 1W2BA 4EVOA 4RA8A 1SFOB 4LFBQ 3WOEA 3MEFA 5GAGC 2KOLA 3H0GH 1E2VA 3R93A 3STBC 3W3AA 4GOPB 2CKZB 4B3MQ 4GOPC 5LMUQ 4Y52H 1S5CD 5LHY1 1KIXA 1SSOA 4PG3A 4X66L 4R9WA 3VYTA 4RGMA 4EQOA 4J1MA 4X64Q 4HJ9A 1UE5A 4G57A 2D2CC 5EBCA 2HHHQ 4ZLTF 3MZ5A 4G4KA 3EJIA 4A3DB 2J7ZA 4K8JA 1HR0W 4JI0Q 4QCLA 5EGTA 3MXPA 1JJGA 5C4JH 3OIQA 4A3EG 1WTVA 1CKOA 2QGQA 3CCUA 5C0XJ 3OTOL 1JOOA 1SRUA 3S14B 1FVIA 4IUQA 5C4XH 4MNOA 3LWEA 2EYOA 3BJUA 1VQOA 1TY2A 4FXKC 1I3QB 3AYHB 3F2BA 2AQ2B 2R93H 2R92H 4KMUC 4A3LG 1KC8C 1DOMA 1NBWA 5IY0A 2HCIA 1FYCA 4GN5A 3E9IA 1VCIA 1O7IA 4OIJA 4WJ3M 2F4IA 4HIKA 1VQIA 2K75A 3D3RA 1PZJD 3FHWA 4GNXA 4A75A 1O7YA 3AQQA 1QWYA 1I4HA 1VQ7A 2VY3A 2A1AA 3GO5A 1UEBA 3J80c 5CR3A 4CBVA 3M7NA 1BXTA 1OO9B 4CDDC 3OOCA 3E3XA 4AYBE 2CHBD 5HGTA 1L0YB 4DV6Q 3PO3H 3FMCA 2ZJQA 3W2DA 3T16A 5M5XB 4IOAA 3M4OH 3UDFA 1X55A 2EIFA 4JI7L 2ZTDA 3UDXA 3GD7A 4A3BG 2N3SA 3QR8A 4FF3A 1IW7C 1G2SA 2JEBI 4IUUA 4KN7C 1TWCH 2HIXA 4XDXA 3CU7A 2B2TC 4RMFA 3J7AV 5DM63 3FVQA 5D65A 3BYYB 3KDFB 4DR4L 2VUMG 3TEHB 2QCPX 3E9HA 2E2JH 1K8GA 1E3PA 1YZ6A 3GTMB 4ABNA 1LT3D 2V1CC 3S9WA 1X54A 3PSIA 3KF6A 1EZ8A 2A69D 1VQKA 4I7ZC 1JICA 3ONAB 1Y69U 1YNND 4JI4L 2N49A 5EQ0A 4POGA 5C44H 2D0PA 2Y0SE 2YTYA 3GTGH 2WAQB 4A3MB 1CKMA 2JA7B 3KBGA 3OHXC 5C5MA 2WKCA 2NZHA 4DK0A 2LFNA 4DR1L 2VQEL 3U58A 4YWMA 4L63B 3NQIA 3D31A 1DCZA 1PVOA 2AUKA 1CUKA 3GTOB 1ENFA 3HOVH 4DUYL 3S24A 3CCSA 2Z6KC 1TWAB 4DV7Q 4B3TL 1KRTA 2ZXOA 1ZKOA 3DWQA 2OTLA 3MVVA 4X6AH 5JPNC 3IL8A 3QG1A 4KKTA 1DYQA 2L11A 2VQFL 3NBHB 1OXTA 4DV4L 1SYGA 4PZ7A 1K8OA 1I4XA 4ZKBB 4IALA 2VNUD 3L0OA 1X56A 1MJCA 2NVTH 2VS1A 4L5RC 3G48A 2N55A 4JPBW 3F2UA 1Q82C 1SFOH 5GQOA 4UDUC 1VQDA 4DNIA 4KHPL 1I4GA 1PTOD 1DOLA 2CQAA 1ZYRD 4A3CG 3SE0A 1SEBD 1XNQL 1STBA 2VB2X 4BA1I 2EYPA 1WTPA 4BXXH 2CQOA 1EQQA 5E4XA 1I4QA 2ZJPA 3M85A 3I90A 1N32L 1T5XD 2Z9HA 3ERSX 3MHBA 3QWNA 1GUTA 3HRZC 4GKKL 4R8IA 4FYDA 2RVLA 1B9MA 1JJCB 3X3NA 3J81c 1F9RA 1ESFA 4A3JG 5KRUA 1TXYA 4A3DH 1XMOQ 3LWUA 2M00A 4YWKA 1Q46A 1NSNS 4LMQD 4ID6A 4DAMA 2D0OA 1K73C 3I72A 3FRPB 4CJ2C 2EYFA 1VQGA 4IJLA 1KNAA 5FLXL 1TR5A 3S14H 2Y0SG 2ZXPA 4OWTB 1STYA 3PQIA 3Q0AA 1EFWA 4RGTA 1XNRL 4X62Q 1I3QH 4GN3B 1D5MC 3RZDB 3TREA 3T51B 5IE8A 1NJIC 1UNSA 4P74A 1S72A 1HJPA 3NELA 2IX1A 5I4DA 1UE6A 5CGKA 1LTSD 5E7NA 4YY3L 4UY8C 3AEVA 1KL9A 4H44C 2UU9L 3C1FA 3UE1A 4BS9A 1BUVT 3PV0A 1F9SA 5FJ8G 1LTID 1VQMA 4JG2A 4KI0A 1IBKL 2EJMA 3QOJA 2PI2E 4PZ6A 2KA7A 3GV3A 3L7ZC 2KCTA 5FLMG 4OX9L 1ML0D 4DN4M 3PGZA 4HCSA 1VQEA 3DM3A 2Z1CA 2YTXA 3Q24A 1E0BA 1OTCA 3K0YA 1VS0A 1F9QA 1FNVA 4GZYC 3GTKB 5IP7G 2CVRA 5C4HA 1QUQA 3K7UC 1NNXA 5M5XH 4N8FA 4AQYQ 2B39A 4B3RL 4GNXB 2R3ZA 2AKWB 5IGFA 4LF5Q 1F77A 3KK7A 4LF6L 3UDGA 2F0QA 4QIWB 1NR2A 1B1ZA 1JWSD 5LL6S 5BN4A 3H0GG 4X3UA 4DAPA 1NUCA 1K0RA 5TSSA 1NAPA 3GTMH 2PQEA 2EXZA 4GS3A 4LF8L 4TKOB 1HHVA 1QNKA 1EIGA 2UXBL 5EAYA 3EIVA 4LFAL 1IBLL 2I5HA 3PIP3 3CCRA 1EY8A 3LX0A 4A3MH 1N34Q 2RDHA 1EY7A 1JT8A 2JA7H 2B2YA 3H3VC 1XX8A 3VYRA 4A3LH 2Z6BA 2JXMB 2F3IA 2MO0A 3CPFA 3A7AB 4IPCA 3GTOH 1R4PB 2HD3A 4N9PA 2F0HA 1J5EL 1TWAH 4LNQA 3KF6B 4C1NK 3HOWB 5IYBH 1O7ZA 1IYUA 2UXDQ 2R93G 3RLOA 3CMEA 2X69A 5ELEA 2R92G 1LUZA 3ND8A 1KABA 4KY5A 2A68D 4MIUA 1ICFB 5FOBB 1JCKB 4I65A 1SMXA 3S16H 4DV7L 4DV5L 1AEXA 1I6HB 1CKNA 2XSCA 5LMNW 3KLSX 1JOQA 1CQVA 1JC7A 4DR7L 3U9OA 2NN6H 1SBBB 3I8ZA 1RDPD 4CJ1B 2MJ8A 1GD7A 3SK6A 4X66Q 1O7LA 3E5SA 1WVLA 3A7LA 4R4QA 2I5LX 1JMCA 4TSSA 4ZK9B 4B3SL 3CCEA 5D3IB 3PO3G 1H95A 1WYDA 3H15A 1Q7YC 1VQNA 2EY5A 1KAWA 1A3UA 4L8JA 3TP8A 1IBML 1HNWL 2ZTCA 4BWGB 3HZXA 1BVSA 2C5CA 3JAMc 4C3HG 2J4XA 2KBNA 5CV5A 1U0LA 2IT1A 1PFNA 3R2TA 3NWTA 1PH3A 1X32A 4X3KA 5ELFA 3OTOQ 2KQ3A 2F0MA 2A6HD 4RHRA 1XXGA 2KJXA 1JB7A 2OEOA 1EOTA 3VR5A 1SNDA 2RBMA 2JEAI 2LXJA 2RKSA 1O78A 4DV0L 4DXFA 4YIJA 4JI2L 4P75A 1AZQA 4LF7L 3A54A 5KGUA 4DNRB 3RZDH 4CGYB 1XWEA 4JI5L 1I6VC 2EPBA 1Q86C 3SGIA 1LTAD 5C44G 1HPCA 2K01A 1SR3A 1SN8A 4KV6A 2LMCB 2AMCB 4KJOA 1T9HA 5KNCA 1HCZA 4HJ7A 4HIOA 1Q12A 2PYKA 4JBWA 1IKMA 5CBAE 3OWEB 1AH9A 2AHOB 3I70A 4JI6L 1G2TA 1RL2A 3V96A 3CP0A 2JA8B 2NWGA 2NUCA 1H9KA 1X6OA 2A6EC 2LSSA 1JWUD 5DAUA 1BNZA 3W5OA 3GTKH 1NY4A 4JI7Q 1Z7TA 3E0EA 2ZT9C 3KJPA 1BBUA 1XTDA 2NN6I 1LLRD 4C1NI 3VR4A 1P16A 3FEWX 1ASZA 2AQ3B 3BDOA 5JPMC 1A6XA 2ICEC 5IP9H 2E2IB 1AP0A 1PRTD 1LO5D 1TS5A 1II3A 2OT2A 4DR4Q 1WOCA 1AN8A 1VMCA 4J15A 4C3HB 1DJRD 4G7ZC 4DR6L 2EXDA 1YJNA 3L2PA 3HEJA 4BXXG 2EYJA 4JI8L 4ZUJA 2SEBD 3DHQA 2IX0A 3M7GA 2JK8A 1OXUA 3H09A 1BBXC 1K28A 4JI4Q 4DV2L 2Q8RE 1QUQB 2EY2A 4DFAA 2PPBC 3NTIA 2K28A 1HZ9A 1WD1A 5C0XG 3KUPA 3MC0B 4DR1Q 2VQEQ 5CV4A 3PIPA 4A3DG 3G7LA 3H3VH 1F2LA 4IO9A 5FLXc 4HCEA 1LT5D 5A35A 2OCEA 5G3LD 4APVA 2C9OA 4DUYQ 1XTCD 3I4NB 4B3TQ 1JQYD 1VMPA 2RQXA 2WAQE 4OWXB 2E8GA 2JN4A 5I6WA 1D1KA 5FJ8H 1S5BD 1Z47A 3TBIB 3CXCA 3HOWH 3EQLC 2FINB 5IODA 2VQFQ 4DV4Q 3J81j 3K8AA 2O4XA 1YVCA 4GLAC 4DAYA 3TSSA 1AFPA 2H4OA 1EYAA 4ULLA 1EIFA 3VDYA 2ICIA 3DEOA 4ZYSA 1GHJA 1KLGD
chains in the Genus database with same CATH topology
3GTLB 2Z4HA 3RMHA 2F0DA 1STGA 3D4RA 1TS4A 2NB0A 2PNRC 1SE3A 1BCPB 1BCPC 1BO0A 3SHLA 1MBYA 2XIWA 4Y7NB 4FO2A 1H9RA 4K5XA 1JORA 1R9TB 3TN2A 2F0OA 1ILQA 3SK5A 1BCPF 2K04A 3NP8A 3HOYB 2KECA 2F3WA 3KLRA 1HRJA 2K7VA 4HMJA 4CKEA 1XYIA 3A8KE 2CW0C 1HUMA 3A55A 4B9WA 1F2ZA 4K6LA 2EZVA 3QOLA 2D9UA 4J8QA 2F0VA 2WINB 5KIXA 1B3AA 4KKUA 2QKIC 1BOSA 3TDQA 3HOXB 1PLFA 3SEBA 1WTXA 3TP5A 2EDGA 5EKKA 5FO7B 5M3MB 2E76C 3IFTA 1PMRA 2DNEA 1B44D 2I07B 1V43A 1Y8NB 4Q5VA 1TS2A 1HQMC 4A3IB 2F0IA 3OMGA 2BE5C 1QOHA 5AFWA 1QG7A 2Q8TA 2PZWA 4DK1A 3ND9A 3NPPA 3I3CA 3D6WA 4XTCS 1YNJD 1JB3A 1ET9A 1LT6D 5I6YA 2NN6G 4EQNA 4QMGA 5KNBA 3VR3A 5CBEE 3K58A 2K33A 1Q90A 1LTTD 2QF7A 3MFGA 1LABA 4LAAA 5C6AA 3HGBA 5CC4A 1ICWA 1SYDA 1HA6A 5CYUA 3MFYA 5FO9B 1I4PA 5T1IA 1J9OA 2HDLA 5CV8A 2AQ1B 3VYSA 2R61A 5BN5A 3ITPA 1I50B 2MP1A 4RWSC 1IW7D 5EKIA 1TKWB 5CMDA 2F0WA 2L5TA 2F0GA 4IFDJ 4IURA 2EVBA 1G8ZD 1PZID 4FVMA 4C3JB 3QB3A 2J0TD 3K5LA 5K36G 4QUFA 1HA5A 2NVYB 4ZAIA 2JSOA 3S16B 4A3FB 4P2CB 1WTQA 2E2HB 4BY7B 2WKDA 1FR3A 4WORA 4DNTB 3HOZB 4RAUC 5EPLA 3P20A 1STAA 5F2DA 1SJHD 3SK4A 1FNWA 1MD2D 5FO8B 1CZGA 4N9TA 4UAIA 3NSWA 1HUNA 5EKLA 3L3OC 2NTTA 3FKIB 2KEEA 5FKAC 2B2UC 1Y8OB 2L12A 5C0XH 3NUCA 2G9HD 2EYMA 2B63B 3T56B 2GA4B 1X3QA 3SVMA 3GTJB 1KLUD 1L0XB 3NTKA 5IGDA 4H13C 1EZ6A 1MGSA 2JA5B 3M3YB 3RD4A 2K05A 1EY5A 2KCNA 5COYA 1CHPD 1A15A 4FF1A 1EQVA 3GTQB 4ZUIA 4IUTA 4KN4C 4MHEA 1AZPA 1C4QA 2MPMA 1DM0B 1CT1D 3PIO3 3S1QB 4B9XA 2NVXB 1W6JA 2Q8IB 1V1PA 1WTWA 5DEHA 2IX3A 4E6IA 1KDCA 2F0FA 2A74C 2R6GA 1ENCA 1HFNA 4O42A 1Y8PB 1TU2B 1GOZA 1U4MA 1ILPA 1WCMB 2KEDA 1JWMD 5J1ZA 5CORA 1MI2A 2AWOA 4LJZC 4FF2A 1SNOA 4HMIA 4XYOA 1M8AA 2B2WA 1BF4A 2B2VA 4QB4A 4FXGC 2OF1A 3S1NB 3NHHA 5D14A 1SYBA 4NW2A 5KYIA 1SNPA 5C0XI 3SR1A 3PUVA 3P1HA 2E74C 1IKLA 1RF2D 2RA4A 4IUPA 4KK7A 2V4DA 3RLFA 5EPJA 4ILWA 1KAAA 4EGVA 2K32A 5CV6A 1CFMA 1K8MA 3VA5A 1S5DD 5CV9A 2F0PA 2FJ2A 1PFMA 5E1FA 5E3FA 1SJED 2DN8A 4CKCA 1TY0A 2OXPA 1AW7A 4OO1G 4IFDH 2IW3A 2XRSD 1OXSC 3MXGA 5JAVA 5C3EB 5I9OA 1TS3A 1C8CA 4M1UB 1SMYC 5JVG3 4F88A 2K5QA 1RODA 2WACA 2F0JA 1EWHA 2BDOA 2RDFA 3GQBA 4DGZA 3S2HB 2M2LA 5M3FB 2M9VA 2F1MA 3OW7A 2RSOA 4NMZA 4A3KB 3K5NA 3WDNA 3NWSA 1HQRD 1Y1WB 1VF7A 1ET6A 2A73B 1CA6A 1IL8A 3EA6A 5M5WB 2PMZB 3BVGA 2PZUA 1I4RA 1K83B 3VYUA 5EBDA 1UAPA 1OXVA 4XIGS 3NE5B 2KCCA 3S17B 1ESRA 1EY4A 1SE4A 1KTKA 2EJFC 5A2QL 3HS0C 3LNNA 4CJ0B 3NQTA 3S1RB 5I2YA 2L1BA 3TP6A 1CK1A 4U68A 3MTSA 4R8NA 2JP1A 1SNCA 1DONA 1QNUA 4KD3A 1F9PA 2LKVA 3BDCA 5K5PA 3HOUB 4C2MB 4IQZA 4TQUS 3CHBD 3CRKC 2MGSA 4L6TB 5IIFA 4U673 3J7YW 3URYA 2E2DC 1BQQT 3M4YA 2K5WA 4XXEA 3MAQA 1KDAA 5K36H 4HEDA 4FP5D 2BA1A 1SNQA 5KEEA 1SE2A 2F0SA 2WB1B 3Q22A 5LL6X 4S3SA 2EE1A 1STHA 5JOBA 2FFKB 3ERQA 1Q8IA 5ELCA 4V0BA 2L55A 2F3VA 2LY7A 3QJYA 4KTAA 3S1MB 3T53B 2B2TA 4RGOS 5NUCA 1F2YA 1SYCA 3P7JA 5M5YB 1D5ZC 4XQNA 4Q0FA 4X3SA 1HTPA 1PYWD 3BDLA 2AWNA 1J8IA 2A6ED 1LV9A 4BBRB 2JYOA 1STNA 2MUYA 2TMPA 3J81L 4M8AA 3K7AB 2A5HA 2N88A 4HSVA 1JR0D 5C3XA 4WFN3 1MSGA 2ID0A 1CHQD 3A8JE 3C46A 1BR9A 4ZKCB 2EY6A 2YYZA 4HN7A 3SK8A 1KNEA 4DA2A 4HAEA 4KD4A 3I4MB 3PMFA 1QILA 3SDZA 2FMCA 1F2MA 3J80E 1EQTA 1Y1VB 2B2YC 3N52A 2IWHA 3ZYYX 2QILA 2LS01 5KNDA 5A2QE 2L0CA 1EFID 1WTOA 1PDQA 3RZOB 4ZRZA 3OIPA 4PMBA 5BN3A 2NVQB 3H6MA 3J7AF 4IUNA 1V8QA 4C3IB 1NCVA 3X3MA 1B2TA 5C3WA 1U9RA 4K14A 1H9SA 1A3VA 1LT4D 3R2IA 4X3TA 2IPKD 1RD9D 4QUCA 3AMUA 4IUVA 5J22A 4OO1H 4BBSB 2K5DA 4OL7A 1SDFA 4FF4A 4BA2I 4ME5A 5E4WC 2WIIB 2DY7A 3DWAA 1V1OA 4PV1C 2F0KA 1BCPD 1TWFB 1SYEA 3GTPB 2F0NA 2E75C 4ODGA 4IN3A 4JK1C 3OWFA 1S5FD 3CKIB 2YU9B 2Z4IA 4DXGA 4IFDG 1CI3M 4QF4A 4F7XA 4BY1B 3NTHA 3Q23A 2XWJB 4H0LC 1D2BA 5ELDA 1IHZA 1CZWA 1EU4A 1B9NA 1RHPA 2SDFA 1LACA 4H7BA 5JVH3 2CW0D 2O2LD 3AB9A 1DZ1A 4RFBA 1WD0A 4A3GB 1GXDC 1YNJC 2R7ZB 4C3JG 1GUSA 1DOKA 5IGGA 1EIHA 3C3LA 3S2DB 3J81E 4A93B 2F0UA 3K59A 2A69C 3PO2B 3MEHA 5FK9C 1YNNC 1PZKD 2WV6D 5JEAJ 1QCBD 4OHJA 1B53A 4XQQA 5JJZA 1VDZA 4F8MA 4OO1I 1U4PA 4C56C 3HP3A 3T4AC 2BE5D 3DEPA 3OPOA 2EOTA 4NP5A 3JAML 4IZ8A 2F0LA 5CV7A 5J39A 4HSPA 3NK9A 1X3PA 4FXDA 1PFBA 3EROA 3V2TA 3KLSA 2PW7A 4A3EB 1E2WA 2F0EA 3PUXA 3HKZB 3D4WA 4KHVA 2WP8J 3DWPA 4KKSA 5IGBA 1PTOB 1PTOC 1D1IA 1ZYRC 2RSNA 5C4ZA 3K5OA 1NR4A 4RKBA 3N6RA 4KJNA 1JE4A 1D5XC 1PTOF 1H9JA 1GUNA 4CKBA 3HG9A 5IOCA 3D8GA 3TZUA 4K6DA 4RKLA 3S15B 2TSSA 1EY6A 4B08A 2KVMA 2QDBA 5DNFA 1FNUA 3BYTB 2VXWA 4K5VA 4PMWA 3K5MA 4XYQA 3L9AX 1LTGD 1EWCA 3NBIA 4A3BB 3A8IE 1RTOA 1OXXK 1QJOA 3Q6SA 2BA0A 1JOKA 2RDGA 2VUMB 2NZ1D 1RKNA 2HCCA 1H9SB 4OGQC 2EYHA 3AU7A 5M9OA 3D4DA 1STEA 1O80A 5I9PA 2X6GA 2XVSA 1U4LA 1B50A 1A2TA 1Q1EA 5IGCA 4O1NA 3D6CA 3E0JA 1FGBD 2EYLA 1U4RA 3IKJA 2I46A 2QEJC 1ONLA 5ELBA 2NTSA 4HTHA 3K57A 2IL8A 5DM73 3UI2A 4PQXA 3GP7A 3NXWA 1QE6A 1C48A 1ENAA 5JEAH 2NBFA 3CRLC 3I73A 2JE6I 2XWBB 3JAME 1GUOA 1UUPA 2JA6B 4AYBB 1GJXA 2L4NA 2HUGA 1E2ZA 2BCOA 4ZQ3A 2EY1A 1G91A 1TWGB 1EYDA 3CQZB 2XNAC 2KHSA 1H9MA 3TMEA 2PW5A 4KHZA 3I91A 1W6KA 4Z9CB 4A3JB 2SOBA 1HTLD 2XRQD 1CA5A 1A3TA 4J6HA 1ZEQX 1S4ZA 2A68C 2ENBA 1EEFD 3U9SA 2Y0SB 3QO2A 1VF5C 1TT2A 3BVMA 5IT9L 2PO4A 1LTBD 1PTOH 2BOSA 2K03A 1EYCA 3VR6A 3TZDA 3MA2B 1TWHB 2PCFB 3P75A 3OSOA 4MN3A 3R8BA 5I2XA 3H94A 4KY6A 5KYLA 1IYVA 4NDXA 3QIAA 1CTMA 4XT1B 3DM1A 3PUZA 3GV6A 2DY8A 1TVXA 3DMUA 5EJWA 5C5LA 4PMCA 1SMYD 1S5ED 2A6HC 1HXYD 3J80L 1RTNA 1BDOA 4V190 4CHTB 2B8FA 3C2PA 2O5IC 2XN9C 2NYZD 5FLXE 2F03A 4WRDA 4DU9A 3H0GB 1QB5D 5T1GA 1FD7D 1T5EA 5EPKA 4G7HC 3G6JB 4K2KA 1CM9A 1EY0A 2D5DA 4FNFA 1CQFA 4IFDI 2L9HA 2X6LA 3BS1A 3KBXA 3PUWA 1GUWA 3EFXD 3MXUA 3TP7A 2Z8LA 2K6AA 1G291 1B4OA 5C4JB 3WOFA 1RJTA 2F0TA 1EY9A 4RHSA 3RUZA 5C4XB 1HFGA 3C1EA 1TIID 1PRTB 3E6ZX 1PRTC 1Q1BA 2R93B 3VR2A 4KY7A 3BG3A 2MHVA 4PNYA 2R92B 4DF7A 4LK1C 1G6ZA 1SXTA 2SNSA 1PRTF 4RH6A 5D3DA 3T13A 1R4QB 3IFDA 2O5JC 2G9DA 4RGNA 1V1PB 3BZDB 4RCNA 4WJWA 2FMMA 3PUYA 3V05A 1A2UA 5HURA 3FPPA 3DUZA 4HR7B 4TRDA 4C3IG 1D6EC 1SAPA 5ISRA 2B8GA 1LTRD 4NKLA 3PO3B 3O13A 5IT9E 4G7OC 4DAVA 4XT3B 1PXUA 1EEID 2EJGC 1RCVD 3M4OB 3FPUB 4K8IA 3SXHA 2B2WC 5G3LF 1SNMA 1M4VA 2B2VC 2BDNA 1MSHA 2K1BA 3MXNA 1TWCB 4RCOA 2ZXRA 1EL0A 3OMCA 1EU3A 2E2JB 1Z6HA 3MWYW 2PZTA 3FDTA 3EVQA 4OIKA 3VA7A 2DNCA 5C44B 1SYFA 1GUGA 1DXMA 4K2LA 2IJ0A 3GTGB 3NBHA 4XQJA 1UEAB 2AUJD 1Q3LA 3DXJC 2H1EA 2SNMA 1DD2A 1GHKA 3HOVB 2VB3X 3BVZA 2HQEA 3H91A 4EQPA 1TQOA 3K6OA 5IGEA 2FHTA 3KF8A 5JEAG 3I4LA 3IAYA 2B2UA 2KUMA 2HDMA 4F87A 3R3OA 1WTRA 1KDBA 2NVTB 4K5WA 1ZXTA 2D62A 3A56A 4EVOA 4RA8A 1SFOB 3WOEA 2KOLA 1E2VA 3R93A 3W3AA 1S5CD 5LHY1 1SSOA 4R9WA 3VYTA 4RGMA 4EQOA 4J1MA 4G57A 2D2CC 5EBCA 4ZLTF 3MZ5A 4G4KA 3EJIA 4A3DB 2J7ZA 4K8JA 4QCLA 5EGTA 3MXPA 3OIQA 1WTVA 5C0XJ 1JOOA 3S14B 4IUQA 3LWEA 2EYOA 1TY2A 4FXKC 1I3QB 2AQ2B 4KMUC 1DOMA 2HCIA 1FYCA 1VCIA 4OIJA 2F4IA 3D3RA 1PZJD 1O7YA 1QWYA 1I4HA 3GO5A 5CR3A 4CBVA 3M7NA 1BXTA 1OO9B 3OOCA 2CHBD 5HGTA 1L0YB 3FMCA 3W2DA 3T16A 5M5XB 3GD7A 4FF3A 1IW7C 1G2SA 2JEBI 4IUUA 4KN7C 4XDXA 3CU7A 2B2TC 3J7AV 5DM63 3FVQA 5D65A 3BYYB 2QCPX 3GTMB 4ABNA 1LT3D 3S9WA 1EZ8A 2A69D 4I7ZC 1JICA 3ONAB 1Y69U 1YNND 5EQ0A 2WAQB 4A3MB 2JA7B 3KBGA 3OHXC 5C5MA 2WKCA 4DK0A 2LFNA 4L63B 3NQIA 3D31A 1DCZA 2AUKA 3GTOB 1ENFA 1TWAB 2ZXOA 1ZKOA 3DWQA 3MVVA 5JPNC 3IL8A 3QG1A 4KKTA 1DYQA 2L11A 1OXTA 1SYGA 1K8OA 1I4XA 4ZKBB 4IALA 2VNUD 2N55A 3F2UA 4UDUC 1I4GA 1PTOD 1DOLA 2CQAA 1ZYRD 3SE0A 1SEBD 1STBA 2VB2X 4BA1I 2EYPA 1WTPA 5E4XA 1I4QA 3M85A 3I90A 1T5XD 3MHBA 3QWNA 1GUTA 3HRZC 4R8IA 4FYDA 2RVLA 1B9MA 3X3NA 1F9RA 1ESFA 5KRUA 3LWUA 2M00A 1NSNS 4LMQD 4ID6A 3I72A 3FRPB 4CJ2C 2EYFA 1KNAA 5FLXL 1TR5A 2ZXPA 1STYA 3Q0AA 4RGTA 3RZDB 1D5MC 3T51B 1UNSA 2IX1A 5I4DA 5CGKA 1LTSD 4H44C 3C1FA 4BS9A 1BUVT 3PV0A 1F9SA 1LTID 4KI0A 2EJMA 3QOJA 2KA7A 3GV3A 3L7ZC 1ML0D 4DN4M 4HCSA 2Z1CA 3Q24A 1E0BA 3K0YA 1F9QA 1FNVA 4GZYC 3GTKB 2CVRA 5C4HA 2B39A 2R3ZA 5IGFA 1F77A 3KK7A 2F0QA 4QIWB 1NR2A 5BN4A 1B1ZA 1JWSD 5LL6S 4DAPA 4X3UA 1NUCA 5TSSA 1NAPA 2PQEA 2EXZA 1HHVA 4TKOB 1QNKA 1EIGA 3PIP3 1EY8A 3LX0A 2RDHA 1EY7A 2B2YA 3H3VC 1XX8A 3VYRA 2JXMB 3A7AB 1R4PB 4N9PA 2F0HA 4C1NK 3HOWB 1O7ZA 1IYUA 2X69A 5ELEA 3ND8A 1KABA 4KY5A 2A68D 4MIUA 5FOBB 1JCKB 4I65A 1AEXA 1I6HB 2XSCA 3KLSX 1JOQA 1CQVA 1JC7A 3U9OA 2NN6H 1SBBB 3I8ZA 4CJ1B 1RDPD 2MJ8A 3SK6A 1O7LA 3E5SA 1WVLA 3A7LA 4TSSA 4ZK9B 5D3IB 2EY5A 1A3UA 4L8JA 3TP8A 4BWGB 3HZXA 2C5CA 4C3HG 2J4XA 5CV5A 2IT1A 1PFNA 3R2TA 3NWTA 1X32A 4X3KA 5ELFA 2KQ3A 2F0MA 2A6HD 4RHRA 1XXGA 2KJXA 2OEOA 1EOTA 3VR5A 1SNDA 2RBMA 2JEAI 2RKSA 1O78A 4DXFA 4YIJA 1AZQA 3A54A 5KGUA 4DNRB 4CGYB 1XWEA 1I6VC 2EPBA 1LTAD 1HPCA 2K01A 4KV6A 2LMCB 4KJOA 5KNCA 1HCZA 1Q12A 2PYKA 4JBWA 1IKMA 5CBAE 3OWEB 3I70A 1G2TA 3V96A 2JA8B 2NWGA 2NUCA 1H9KA 2A6EC 1JWUD 5DAUA 1BNZA 1Z7TA 2ZT9C 2NN6I 1LLRD 4C1NI 3VR4A 3FEWX 2AQ3B 3BDOA 5JPMC 1A6XA 2ICEC 2E2IB 1AP0A 1PRTD 1LO5D 1TS5A 1II3A 2OT2A 1AN8A 1VMCA 4C3HB 1DJRD 4G7ZC 3HEJA 2EYJA 4ZUJA 2SEBD 3DHQA 2IX0A 3M7GA 1OXUA 3H09A 1BBXC 2Q8RE 2EY2A 4DFAA 2PPBC 3NTIA 2K28A 1WD1A 5C0XG 3KUPA 3MC0B 5CV4A 3G7LA 1F2LA 4HCEA 1LT5D 5A35A 5G3LD 2C9OA 1XTCD 3I4NB 1JQYD 1VMPA 2RQXA 5I6WA 1D1KA 1S5BD 1Z47A 3TBIB 3EQLC 2FINB 5IODA 2O4XA 4DAYA 3TSSA 1AFPA 2H4OA 1EYAA 4ULLA 2ICIA 3DEOA 4ZYSA 1GHJA 1KLGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPP A;  1CI3 M;  2A6H C;  4HR7 B;  1ZYR C;  2E74 C;  4H0L C;  2B8G A;  4DK1 A;  3ND9 A;  3A7A B;  5JEA H;  2V4D A;  3RLF A;  3A8J E;  3CRL C;  3I73 A;  1BDO A;  3N6R A;  4G7O C;  1B9N A;  2YYZ A;  2B8F A;  2K32 A;  1LAC A;  2A69 D;  2JE6 I;  3D4R A;  4I7Z C;  4XTC S;  1Y69 U;  1CFM A;  1GUO A;  1GUN A;  1H9J A;  1K8M A;  1Y8O B;  2EJG C;  3AB9 A;  2D2C C;  3T51 B;  5C0X H;  2O5I C;  1IYU A;  4IQZ A;  1H9K A;  2NN6 G;  4TQU S;  3T56 B;  2PNR C;  2A6E C;  1YNJ C;  2DN8 A;  3CRK C;  5KNB A;  3VR3 A;  1GJX A;  2K33 A;  3SDZ A;  1Q90 A;  3ND8 A;  3TZU A;  2QF7 A;  1E2Z A;  1H9R A;  2A68 D;  4OO1 G;  1GUS A;  4IFD H;  1Z7T A;  1OXS C;  2ZT9 C;  3M4Y A;  4DK0 A;  2NN6 I;  4H44 C;  1LAB A;  3VR4 A;  4H13 C;  5K36 H;  1T5E A;  3BDO A;  3PV0 A;  4G7H C;  3D31 A;  1SMY C;  1DCZ A;  1A6X A;  1Z6H A;  2AUK A;  3HGB A;  2BA1 A;  2D5D A;  4KI0 A;  5KND A;  1EWH A;  2EJM A;  2BDO A;  1H9M A;  2KA7 A;  3GQB A;  3L7Z C;  4KHZ A;  3KLR A;  3PUW A;  3MFY A;  1ZKO A;  2K7V A;  2NN6 H;  4G7Z C;  2A69 C;  3A8K E;  3MXU A;  4KN4 C;  2CW0 C;  3VA7 A;  2DNC A;  1YNN C;  4KMU C;  1O7L A;  3QG1 A;  3A8I E;  3A7L A;  1GUG A;  1DXM A;  2F1M A;  5BN3 A;  3OW7 A;  4KKT A;  1OXX K;  1FYC A;  4GZY C;  1QJO A;  1OXU A;  1OXT A;  5BN5 A;  1G29 1;  3PUV A;  3WDN A;  1VCI A;  2BA0 A;  1K8O A;  1V8Q A;  2A68 C;  2AUJ D;  4L8J A;  2PPB C;  1VF7 A;  4KKU A;  3U9S A;  1IW7 D;  3QJY A;  1TKW B;  1VDZ A;  1H9S A;  3DXJ C;  1VF5 C;  2Q8I B;  5C0X G;  1DD2 A;  1H9S B;  4OGQ C;  2IT1 A;  2BE5 D;  3T53 B;  2EDG A;  1GHK A;  3OPO A;  1Q1B A;  2R6G A;  2L5T A;  2A6H D;  3VR2 A;  5BN4 A;  3BG3 A;  2E76 C;  3IFT A;  3SE0 A;  3M7N A;  2EVB A;  5A35 A;  4BA1 I;  3OOC A;  3VR5 A;  4LK1 C;  1Q1E A;  1Y8P B;  2JEA I;  4OO1 H;  1PMR A;  1TU2 B;  2PCF B;  3VR6 A;  5K36 G;  3M85 A;  1O78 A;  1HTP A;  2DNE A;  1OXV A;  3FMC A;  4XIG S;  5JEA G;  3H94 A;  1GUT A;  3NE5 B;  1V43 A;  1Y8N B;  3I4L A;  2KCC A;  1E2W A;  4BA2 I;  2AWO A;  4LJZ C;  4TKO B;  1IYV A;  4DNR B;  1B9M A;  2A6E D;  3EQL C;  2O5J C;  3QIA A;  1I6V C;  1CTM A;  1HQM C;  4PV1 C;  3GD7 A;  3IKJ A;  3PUX A;  1ONL A;  3PUZ A;  1FR3 A;  1IW7 C;  4DNT B;  2E75 C;  1HPC A;  2EJF C;  4RCN A;  3LWU A;  2D62 A;  3P20 A;  2JEB I;  2LMC B;  3LNN A;  4JK1 C;  4KN7 C;  4JBW A;  2BE5 C;  3PUY A;  5KNC A;  1E2V A;  1HCZ A;  3I72 A;  1GHJ A;  4IFD G;  4KKS A;  2JXM B;  1Q12 A;  3W3A A; 
#chains in the Genus database with same CATH topology
 3GTL B;  1I6H H;  2Z4H A;  5IP7 H;  1MJE A;  4KHP Q;  3ULL A;  1EOV A;  1XNQ Q;  1IYJ B;  3RMH A;  2F0D A;  1STG A;  3D4R A;  1TS4 A;  4NB3 A;  3KJO A;  2NB0 A;  3TQY A;  1N32 Q;  4DK6 C;  2PNR C;  1SE3 A;  4AIM A;  1BCP B;  1BCP C;  1BO0 A;  3SHL A;  1MBY A;  2XIW A;  1GO3 E;  4Y7N B;  4FO2 A;  1H9R A;  4K5X A;  1JOR A;  1R9T B;  4GKJ L;  3TN2 A;  2F0O A;  1ILQ A;  3SK5 A;  1BCP F;  2K04 A;  3NP8 A;  3HOY B;  2KEC A;  2K52 A;  1CKN B;  2F3W A;  1K8A C;  3CCL A;  2YV5 A;  2ASB A;  2PQA A;  4GLV B;  1FGU A;  3KLR A;  1EQR A;  1HRJ A;  2K7V A;  4HMJ A;  4CKE A;  1XYI A;  3A8K E;  2CW0 C;  1HUM A;  3A55 A;  4B9W A;  1F2Z A;  3A74 A;  4K6L A;  1XNR Q;  2EZV A;  3QOL A;  2D9U A;  4J8Q A;  2F0V A;  2WIN B;  1YJW A;  2FXQ A;  1B3A A;  5KIX A;  4KKU A;  2QKI C;  5IT9 c;  1BOS A;  2HT1 A;  4OWW B;  3TDQ A;  4YY3 Q;  3HOX B;  1PLF A;  2OQK A;  4H02 A;  3SEB A;  3CCQ A;  1WTX A;  3TP5 A;  2EDG A;  5EKK A;  2UU9 Q;  2WAQ G;  4A3M G;  3STB D;  2JA7 G;  5FO7 B;  5M3M B;  2E76 C;  3IFT A;  1YIT A;  1IBK Q;  4LUO A;  1PMR A;  4OX9 Q;  2DNE A;  1B44 D;  1GKH A;  2I07 B;  1V43 A;  1Y8N B;  4Q5V A;  2JA8 H;  1TS2 A;  1HQM C;  4A3I B;  5IYB G;  2WFW A;  4X65 L;  2F0I A;  3OMG A;  1HNZ L;  1E1T A;  1L1O B;  3RN2 A;  1L1O C;  2BE5 C;  3W1B A;  2OTJ A;  2JJQ A;  2MO1 A;  4B3R Q;  1YI2 A;  1ASY A;  1QOH A;  5AFW A;  1QG7 A;  2VZA A;  2Q8T A;  2DJF C;  3KOJ A;  4YCU A;  2E2I H;  2PZW A;  4DK1 A;  3ND9 A;  4LF6 Q;  4BY7 G;  4POF A;  1C7Y A;  3NPP A;  3I3C A;  3D6W A;  4XTC S;  1YNJ D;  1JB3 A;  1ET9 A;  1LT6 D;  4C3H H;  5I6Y A;  1IZ6 A;  2NN6 G;  4EQN A;  4QMG A;  5KNB A;  3VR3 A;  5CBE E;  3K58 A;  2K33 A;  4LUZ A;  4LF8 Q;  1Q90 A;  2IY5 B;  2UXB Q;  1LTT D;  2QF7 A;  4LFA Q;  1IBL Q;  5IYD H;  4DUZ L;  3FKI G;  1PYS B;  3MFG A;  4QIW E;  1LAB A;  4LAA A;  2A8V A;  1FJG L;  2QW7 A;  3A5U A;  5C6A A;  3HGB A;  2MQH A;  5CC4 A;  2B63 G;  1ICW A;  1SYD A;  1HA6 A;  4UP8 A;  5CYU A;  3MFY A;  1HZC A;  4LW1 A;  2ALY B;  5FO9 B;  1I4P A;  5T1I A;  1J5E Q;  3I4N H;  1J9O A;  3I4O A;  2HDL A;  5CV8 A;  2JA5 G;  2AQ1 B;  3MXN B;  3VYS A;  2R61 A;  1MHW C;  5BN5 A;  3ITP A;  4NXM Q;  1I50 B;  2MP1 A;  4JOI A;  4RWS C;  1IW7 D;  5EKI A;  1TKW B;  5CMD A;  5J3B A;  2F0W A;  4DV5 Q;  2L5T A;  3NEN A;  2F0G A;  4IFD J;  4IUR A;  4FDB A;  3CAM A;  2EVB A;  1G8Z D;  1PZI D;  4FVM A;  4C3J B;  3GTL H;  3QB3 A;  4DR7 Q;  2J0T D;  3K5L A;  1J6Q A;  5K36 G;  4QUF A;  1HA5 A;  2F52 A;  2NVY B;  2JSO A;  4ZAI A;  4IOC A;  3S16 B;  3J7Z C;  4A3F B;  4CDE C;  4P2C B;  1WTQ A;  2E2H B;  4BY7 B;  1CSQ A;  4B3S Q;  4HIM A;  3KLW A;  2WKD A;  1FR3 A;  4WOR A;  4DNT B;  3HOZ B;  4RAU C;  5EPL A;  3P20 A;  4DAY B;  1STA A;  5F2D A;  4Y7N H;  1IBM Q;  1HNW Q;  1SJH D;  4HID A;  3SK4 A;  1FNW A;  1MD2 D;  1R9T H;  1WCM G;  1CZG A;  4N9T A;  5FO8 B;  2K5H A;  1HNX Q;  4UAI A;  3I56 A;  3NSW A;  1HUN A;  3HOY H;  5EKL A;  5L37 A;  3L3O C;  2NTT A;  3FKI B;  3BU2 A;  5IP9 G;  2I5M X;  1XJV A;  3KF8 B;  1UE1 A;  2KEE A;  5FKA C;  2B2U C;  1Y8O B;  2L12 A;  5C0X H;  3NUC A;  3GDE A;  2L15 A;  2G9H D;  2EYM A;  4DV0 Q;  1HZA A;  2B63 B;  3T56 B;  2GA4 B;  3RR5 A;  4JI2 Q;  1X3Q A;  4LF7 Q;  4WJ4 A;  3SVM A;  4HJ8 A;  3CC7 A;  3GTJ B;  1KLU D;  4JI5 Q;  1L0X B;  1XPR A;  4L5S A;  3NTK A;  5IGD A;  5GAD C;  4H13 C;  1EZ6 A;  2ZM6 L;  1MGS A;  1XPU A;  2JA5 B;  1PH8 A;  3M3Y B;  3RD4 A;  2K05 A;  1EY5 A;  3HOX H;  3OYY A;  2KCN A;  5COY A;  1CHP D;  4DV3 L;  1A15 A;  4FF1 A;  1E22 A;  1EQV A;  2PQA B;  3GTQ B;  4ZUI A;  5M3M H;  4IUT A;  1PH7 A;  4KN4 C;  2YU9 H;  4MHE A;  4JI6 Q;  1AZP A;  1C4Q A;  5C3E G;  2MPM A;  3UE0 A;  3TS0 A;  2PI2 A;  1DM0 B;  3RNU A;  1CT1 D;  3ZJY C;  3PIO 3;  1X9N A;  4DR2 L;  3S1Q B;  4JI1 L;  5IWA L;  3HOW G;  4B9X A;  3K0X A;  2NVX B;  1W6J A;  2Q8I B;  1V1P A;  4A3I H;  1IXR A;  1PH9 A;  1WTW A;  5DEH A;  2IX3 A;  4E6I A;  1KDC A;  2F0F A;  2A74 C;  1NTG A;  2R6G A;  4ME3 A;  3DLL A;  1ENC A;  1HFN A;  1Y1W G;  4O42 A;  1Y8P B;  1TU2 B;  1GOZ A;  1U4M A;  1ILP A;  1WCM B;  2CH4 W;  4DR5 L;  2KED A;  1JWM D;  5J1Z A;  4DR6 Q;  5COR A;  1MI2 A;  2AWO A;  1SLJ A;  4LJZ C;  2Q2U A;  4FF2 A;  1SNO A;  4HMI A;  4XYO A;  4JI8 Q;  1M8A A;  2B2W A;  2F4V L;  1BF4 A;  2B2V A;  4QB4 A;  4QQB X;  4GNX C;  4DV2 Q;  4FXG C;  1K0S A;  2OF1 A;  3S1N B;  3NHH A;  5D14 A;  1SYB A;  4NW2 A;  5KYI A;  1SNP A;  5C0X I;  3SR1 A;  3PUV A;  3P1H A;  2E74 C;  1IKL A;  4K0K L;  1RF2 D;  2RA4 A;  5IYC G;  4IUP A;  4KK7 A;  3CD6 A;  2V4D A;  3RLF A;  4QY7 A;  1LM0 A;  5EPJ A;  4ILW A;  4MTN A;  1KAA A;  4EGV A;  3T1Y L;  2K32 A;  5CV6 A;  1CFM A;  1K8M A;  4JBJ A;  1S5D D;  5CV9 A;  3VA5 A;  2F0P A;  2FJ2 A;  4R4C A;  1PFM A;  5E1F A;  5E3F A;  1C0A A;  1SJE D;  1VQH A;  2DN8 A;  4CKC A;  1TY0 A;  4ALP A;  2OXP A;  1HZB A;  1AW7 A;  4OO1 G;  2A19 A;  4UP7 A;  4IFD H;  2IW3 A;  2XRS D;  1OXS C;  3MXG A;  5JAV A;  5C3E B;  5I9O A;  1TS3 A;  4CDC C;  1I50 H;  1C8C A;  4M1U B;  1SMY C;  1W3S A;  4F88 A;  5JVG 3;  2K5Q A;  1ROD A;  2WAC A;  2UUB L;  2F0J A;  1EWH A;  2BDO A;  2XTI A;  2RDF A;  4YHH L;  1HR0 L;  3GQB A;  5JJI A;  4DGZ A;  1LYL A;  3S2H B;  2M2L A;  5M3F B;  4NXM L;  4C3J H;  2M9V A;  2F1M A;  3OW7 A;  2RSO A;  4P72 A;  4NMZ A;  2NVY H;  4A3K B;  3K5N A;  3WDN A;  4A3F H;  3NWS A;  1HQR D;  1Y1W B;  3M4Q A;  1PA6 A;  1VF7 A;  2DJG C;  2E2H H;  2JA8 G;  4BY7 H;  1A0I A;  1NMG A;  2WB1 G;  1XPO A;  1ET6 A;  4GKJ Q;  3HOZ H;  2A73 B;  1CA6 A;  1IL8 A;  3EA6 A;  1S3O A;  2XGT A;  5M5W B;  2PMZ B;  3BVG A;  3G6E A;  4DV1 L;  4GOP A;  2PZU A;  1I4R A;  1K83 B;  3VYU A;  3ICE A;  5EBD A;  1EWI A;  1UAP A;  3FKI H;  1OXV A;  4XIG S;  3NE5 B;  3KFU A;  2RCN A;  2KCC A;  1BBW A;  3ULP A;  5BR8 L;  3S17 B;  3F2C A;  1ESR A;  1PV4 A;  1EY4 A;  2B63 H;  1SE4 A;  1KTK A;  2EJF C;  1HNX L;  5A2Q L;  3HS0 C;  3GTJ H;  3LNN A;  4CJ0 B;  3NQT A;  3S1R B;  5I2Y A;  2CCZ A;  2L1B A;  1L0W A;  3TP6 A;  1CK1 A;  4U68 A;  5IYD G;  2PNH A;  3MTS A;  2JA5 H;  4R8N A;  2JP1 A;  1SNC A;  1DON A;  1QNU A;  3M3Y H;  5H1S E;  4KD3 A;  1F9P A;  4BBR G;  1XMQ L;  4R1J A;  2QA4 A;  2LKV A;  2NZO A;  3BDC A;  5K5P A;  3HOU B;  3GTQ H;  4C2M B;  4EX5 A;  1EIY B;  4IQZ A;  4TQU S;  4CDF C;  3CHB D;  3CRK C;  1PFS A;  2MGS A;  4L6T B;  5IIF A;  1E1O A;  3I4N G;  4U67 3;  3J7Y W;  3T1H L;  3URY A;  2E2D C;  1QVG A;  4X65 Q;  1BQQ T;  3M4Y A;  4IPG A;  2K5W A;  4XXE A;  4DK3 C;  3M4P A;  3MAQ A;  1VQP A;  3S1Q H;  1KDA A;  1HNZ Q;  5K36 H;  2NVX H;  3PIO A;  4HED A;  4FP5 D;  1VQC A;  1YHA A;  2BA1 A;  2YTV A;  1SNQ A;  5KEE A;  1SE2 A;  4A76 A;  1B70 B;  2F0S A;  2WB1 B;  5GAE C;  4OXP A;  2QDL A;  3Q22 A;  5LL6 X;  4S3S A;  2EE1 A;  2KHI A;  1STH A;  1WCM H;  5JOB A;  2FFK B;  3ERQ A;  1Q8I A;  5ELC A;  3F2D A;  1QZH A;  4IPD A;  4V0B A;  3BZC A;  4JVZ A;  2L55 A;  2F3V A;  2LY7 A;  3QJY A;  1QVC A;  4I7A A;  4IJH A;  4KTA A;  3S1M B;  3PF4 A;  4DUZ Q;  3T53 B;  3S1N H;  1YIJ A;  1RIP A;  2B2T A;  1FJG Q;  3PCO B;  4RGO S;  5NUC A;  3KDF A;  1F2Y A;  3ER0 A;  1SYC A;  1G6P A;  3P7J A;  5M5Y B;  1D5Z C;  4XQN A;  4Q0F A;  4X3S A;  1HTP A;  3HOY G;  1AE3 A;  1PYW D;  1UWV A;  3BDL A;  2AWN A;  1J8I A;  2A6E D;  1LV9 A;  4BBR B;  2JYO A;  1STN A;  2MUY A;  2TMP A;  2P5Z X;  1YNX A;  5ELN A;  3J81 L;  4M8A A;  3K7A B;  4BBS G;  2A5H A;  5C3E H;  2N88 A;  4HSV A;  4RG1 A;  1JR0 D;  5C3X A;  4WFN 3;  1MSG A;  2ID0 A;  3PF5 A;  1CHQ D;  3A8J E;  3C46 A;  1BR9 A;  4KLK A;  4ZKC B;  2Z6K A;  3HOX G;  2EY6 A;  2YYZ A;  1VQ4 A;  4HN7 A;  3SK8 A;  1KNE A;  4DA2 A;  1GVP A;  4HAE A;  1YHQ A;  4KD4 A;  3S2H H;  3I4M B;  5M3M G;  1D8L A;  5M3F H;  3PMF A;  2N78 A;  1QIL A;  3SDZ A;  5ELO A;  2FMC A;  1F2M A;  3J80 E;  4BY1 G;  1EQT A;  1G51 A;  3U4V A;  1Y1V B;  2B2Y C;  4A3K H;  3K80 C;  3N52 A;  2B3G A;  1Y1W H;  4O0A A;  4P73 A;  2IWH A;  4MTK A;  3ZYY X;  2QIL A;  4ZCK A;  3TRZ A;  2LS0 1;  4A3I G;  5KND A;  1JE5 A;  1K3R A;  5A2Q E;  4A3G G;  3EN2 A;  2ZTE A;  4GLX A;  3FP9 A;  4LUV A;  5M5W H;  2R7Z G;  2L0C A;  1EFI D;  1WTO A;  1PDQ A;  3RZO B;  3B6Y A;  1DGS A;  4ZRZ A;  1K83 H;  3OIP A;  4LWC A;  4PMB A;  5BN3 A;  2NVQ B;  3H6M A;  3J7A F;  4LF4 L;  3CCM A;  4IUN A;  1V8Q A;  4C3I B;  1NCV A;  3X3M A;  3S17 H;  5IYC H;  1B2T A;  1E7Z A;  5C3W A;  1U9R A;  4K14 A;  4DR3 L;  1H9S A;  1A3V A;  2CWP A;  1LT4 D;  3PO2 G;  3R2I A;  3BZK A;  4X3T A;  2ZM6 Q;  3S1R H;  2IPK D;  1RD9 D;  4QUC A;  3AMU A;  4A4I A;  4IUV A;  4LFC L;  3J80 i;  2UUA L;  3A0J A;  5J22 A;  4DV3 Q;  1N33 Q;  2B29 A;  4OO1 H;  4BBS B;  2K5D A;  3H3V I;  4OL7 A;  1SDF A;  4FF4 A;  4BA2 I;  4ME5 A;  5E4W C;  1IL2 A;  2WII B;  1N36 L;  3HOU H;  4QJF A;  2DY7 A;  3DWA A;  4C2M H;  1V1O A;  4PV1 C;  2F0K A;  1BCP D;  1TWF B;  1SYE A;  3GTP B;  2F0N A;  2E75 C;  4DR2 Q;  4ODG A;  2RCF A;  4IN3 A;  4JI1 Q;  5IWA Q;  4JK1 C;  3OWF A;  4JI3 L;  1S5F D;  3CKI B;  2YU9 B;  2Z4I A;  4DXG A;  4IFD G;  1LTL A;  1VQB A;  4HJ5 A;  1CI3 M;  4QF4 A;  4F7X A;  4BY1 B;  3NTH A;  3Q23 A;  2XWJ B;  4HJA A;  4H0L C;  2UUC L;  1D2B A;  4DPG A;  4PZ8 A;  5ELD A;  1IHZ A;  2KHJ A;  1CZW A;  1EU4 A;  1B9N A;  1RHP A;  2SDF A;  4N8X 1;  1LAC A;  2JQO A;  3HKZ G;  4H7B A;  5JVH 3;  2CW0 D;  2O2L D;  3AB9 A;  4YCW A;  1DZ1 A;  4RFB A;  1WD0 A;  4DR5 Q;  4A3G B;  1GXD C;  1YNJ C;  1K9M C;  2R7Z B;  4C3J G;  2K50 A;  1GUS A;  2F4V Q;  1DOK A;  5IGG A;  1YEZ A;  3I2Z A;  1EIH A;  3C3L A;  4A3F G;  1VQL A;  3S2D B;  1A62 A;  3S1M H;  3I55 A;  3HOZ G;  3CCJ A;  3J81 E;  4A93 B;  2F0U A;  3K59 A;  4K0K Q;  2A69 C;  1L2F A;  3MEH A;  5FK9 C;  3PO2 B;  1YNN C;  3HFZ B;  1X3E A;  3T1Y Q;  5M5Y H;  4YCV A;  1PZK D;  2RHS B;  2IHF A;  3RN5 A;  2WV6 D;  5LMN L;  5JEA J;  1QCB D;  4OHJ A;  1B53 A;  4TVA B;  4XQQ A;  5JJZ A;  1VDZ A;  4F8M A;  4BBR H;  4OO1 I;  1U4P A;  1B8A A;  4C56 C;  3U4Z A;  1WI5 A;  3HP3 A;  3T4A C;  3AFQ A;  2BE5 D;  3DEP A;  3OPO A;  4LF9 L;  2JA9 A;  2EOT A;  3K7A H;  4NP5 A;  3JAM L;  4IZ8 A;  2F0L A;  2UUB Q;  5CV7 A;  5J39 A;  1PHJ A;  4HSP A;  3NK9 A;  1X3P A;  4FXD A;  1PFB A;  4YHH Q;  1HR0 Q;  1VQ5 A;  3ERO A;  4NPS A;  3V2T A;  2RF4 A;  3ULJ A;  2CH4 A;  3KLS A;  4QL5 A;  2UXC L;  2PW7 A;  4A3E B;  1E2W A;  2Q2H A;  2F0E A;  3D0F A;  3I4M H;  3PUX A;  4P71 A;  4R4I A;  3J81 i;  2C35 B;  3HKZ B;  3D4W A;  4KHV A;  1Y1V H;  2WP8 J;  3DWP A;  1N9W A;  4KKS A;  5IGB A;  1PTO B;  1PTO C;  1D1I A;  1YHB A;  1ZYR C;  2RSN A;  3KYH C;  1VQ8 A;  2OQ0 A;  5C4Z A;  1NE3 A;  3OW2 A;  3K5O A;  4MZ9 A;  2VL6 A;  1NR4 A;  4RKB A;  3N6R A;  4KJN A;  3G4S A;  4DV1 Q;  1JE4 A;  1D5X C;  1B3Q A;  1PTO F;  1H9J A;  1GUN A;  3WWV A;  1AE2 A;  3RZO H;  4CKB A;  3HG9 A;  5IOC A;  3D8G A;  3TZU A;  3CW2 C;  5BR8 Q;  2E5L L;  2NVQ H;  4K6D A;  4RKL A;  4JYA L;  3S15 B;  2TSS A;  1EY6 A;  4B08 A;  2KVM A;  2QDB A;  4C3I H;  5DNF A;  2PMZ E;  5AJ3 L;  4DKA C;  1PYB A;  3CC4 A;  1FNU A;  4NXN L;  3BYT B;  2VXW A;  4K5V A;  4PMW A;  2JA6 G;  1KXL A;  3K5M A;  4AYB G;  4XYQ A;  4UHV A;  4O2D A;  1WFQ A;  3L9A X;  1LTG D;  1EWC A;  2G5D A;  3NBI A;  4L5T A;  1I94 L;  4A3B B;  1VQA A;  3W1G A;  1XMQ Q;  3A8I E;  1K3B C;  2KEN A;  4BBS H;  1RTO A;  1OXX K;  1QJO A;  3Q6S A;  2BA0 A;  4JV5 L;  1JOK A;  2RDG A;  2VUM B;  4LFB L;  1X3G A;  1WTH A;  2NZ1 D;  3T1H Q;  1TWF H;  1RKN A;  1JJ2 A;  3GTP H;  2HCC A;  1H9S B;  1KD1 C;  4OGQ C;  2EYH A;  3AU7 A;  5M9O A;  1N33 L;  4B3M L;  5LMU L;  3D4D A;  1STE A;  1O80 A;  5I9P A;  2DGY A;  2X6G A;  3K81 C;  2K5V A;  2XVS A;  1U4L A;  1B50 A;  1A2T A;  3EBE A;  4BY1 H;  4X64 L;  1Q1E A;  5IGC A;  5JJL A;  4O1N A;  2ATW A;  1MKH A;  3D6C A;  2HHH L;  3E0J A;  1FGB D;  2BH8 A;  2EYL A;  2HIV A;  4JI0 L;  1Q81 C;  1U4R A;  2GN5 A;  3IKJ A;  2I46 A;  2QEJ C;  1ONL A;  4IPH A;  4A3G H;  1PH4 A;  5M3F G;  5ELB A;  2R7Z H;  2NTS A;  4HTH A;  3K57 A;  2IL8 A;  5DM7 3;  1X3F A;  4A3K G;  2WB1 E;  3UI2 A;  4PQX A;  3GP7 A;  3NXW A;  1QE6 A;  3S2D H;  1C48 A;  1ENA A;  5JEA H;  2NBF A;  3CRL C;  3I73 A;  5GAH C;  4A93 H;  2JE6 I;  3LGJ A;  2XWB B;  4JW0 A;  3JAM E;  1GUO A;  3TS2 A;  1M90 C;  2N8N A;  1KQS A;  1UUP A;  3PO2 H;  2JA6 B;  4YWL A;  2Q2I A;  4AYB B;  1GJX A;  3AFP A;  2L4N A;  2HUG A;  1E2Z A;  2BCO A;  4ZQ3 A;  1WJJ A;  2EY1 A;  1TWG B;  5JJK A;  1G91 A;  1EYD A;  2DUD A;  3CQZ B;  2XNA C;  1YJ9 A;  2KHS A;  1X65 A;  1SE8 A;  1H9M A;  3TME A;  2PW5 A;  4KHZ A;  3J7A 5;  4DV6 L;  3I91 A;  1W6K A;  4Z9C B;  4A3J B;  2SOB A;  1HTL D;  2XRQ D;  1CA5 A;  1M1K C;  1V1Q A;  1MIU A;  1A3T A;  4J6H A;  1ZEQ X;  2KCM A;  1S40 A;  1VQJ A;  3IRB A;  4A3E H;  1S4Z A;  2A68 C;  3NEM A;  1GM5 A;  2ENB A;  1EEF D;  3U9S A;  3HOU G;  2Y0S B;  3QO2 A;  1VF5 C;  1PH5 A;  1PH1 A;  1TT2 A;  3JAM i;  1U5K A;  3BVM A;  3CF5 A;  5IT9 L;  2PO4 A;  1Y14 B;  1LTB D;  1PTO H;  2BOS A;  2K03 A;  1EYC A;  3UDI A;  1HH2 P;  3MA2 B;  3TZD A;  1TWH B;  2PCF B;  3VR6 A;  3P75 A;  3OSO A;  4MN3 A;  3R8B A;  1Z9F A;  5I2X A;  3H94 A;  4KY6 A;  5C4X G;  5KYL A;  1IYV A;  1A63 A;  2I0Q A;  4NDX A;  3QIA A;  3RLN A;  1CTM A;  4XT1 B;  3DM1 A;  4JOI C;  3PUZ A;  3GV6 A;  2DY8 A;  1TVX A;  4LF4 Q;  3DMU A;  4OEM B;  5EJW A;  3S15 H;  5C5L A;  2ZJR A;  4DR3 Q;  1D7Q A;  4PMC A;  1SMY D;  2K4K A;  1S5E D;  2A6H C;  2Z0S A;  1HXY D;  3J80 L;  1RTN A;  4AH6 A;  2IHE A;  1BDO A;  2GVA A;  4V19 0;  4LFC Q;  4CHT B;  2B8F A;  2UUA Q;  3C2P A;  3CPW A;  2O5I C;  4A3B H;  1QVF A;  4UPA A;  3A5Z B;  3G71 A;  2XN9 C;  2NYZ D;  5FLX E;  4OEL B;  1N36 Q;  2F03 A;  1E24 A;  4WRD A;  4DU9 A;  3H0G B;  1QB5 D;  5T1G A;  2VUM H;  1FD7 D;  1T5E A;  5GRO A;  5EPK A;  4G7H C;  3G6J B;  4K2K A;  1CM9 A;  4JI3 Q;  1EY0 A;  2D5D A;  1V9P A;  4FNF A;  3JC6 6;  1CQF A;  2R7F A;  4IFD I;  1NMF A;  2L9H A;  2X6L A;  3BS1 A;  3KBX A;  3PUW A;  1GUW A;  2UUC Q;  3EFX D;  3M9B A;  1CSP A;  2OWO A;  3MXU A;  4JBK A;  3TP7 A;  2Z8L A;  2K6A A;  1G29 1;  1B4O A;  4R4T A;  4L5Q A;  5C4J B;  1XMO L;  3WOF A;  1EYG A;  1RJT A;  2F0T A;  2CWA A;  2HQL A;  1PH2 A;  1EY9 A;  4OON A;  2CFM A;  4RHS A;  3RUZ A;  3I4M G;  5C4X B;  1HFG A;  3I7F A;  3C1E A;  1A8V A;  1L1O A;  1TII D;  1PRT B;  3E6Z X;  1PRT C;  1Q1B A;  1Y1V G;  2R93 B;  3F8T A;  3VR2 A;  4KY7 A;  3BG3 A;  2MHV A;  4PNY A;  2R92 B;  4DF7 A;  5HGQ A;  4LK1 C;  4X62 L;  1G6Z A;  1EUJ A;  1SXT A;  2K14 A;  2SNS A;  1PRT F;  4RH6 A;  5D3D A;  1VQ6 A;  1KRS A;  3T13 A;  1R4Q B;  1PH6 A;  3IFD A;  3CC2 A;  3HOV G;  2O5J C;  2G9D A;  2JA6 H;  3U50 C;  4RGN A;  5LMN Q;  1V1P B;  3BZD B;  4JCV E;  2ES2 A;  4RCN A;  4WJW A;  2FMM A;  4A3C H;  3PUY A;  2Q2T A;  3V05 A;  1A2U A;  1TWG H;  5HUR A;  3FPP A;  3DUZ A;  4HR7 B;  4TRD A;  4C3I G;  4JBM A;  1D6E C;  1SAP A;  3CQZ H;  4LF9 Q;  5ISR A;  2B8G A;  1LTR D;  4NKL A;  3PO3 B;  1I5F A;  3O13 A;  1N8R C;  5IT9 E;  4G7O C;  1Q8K A;  4DAV A;  4XT3 B;  1PXU A;  3CCV A;  4GN4 B;  1EEI D;  1RCV D;  2EJG C;  3M4O B;  3FPU B;  2QEX A;  4K8I A;  3SXH A;  2B2W C;  5G3L F;  4A3J H;  1BKB A;  1SNM A;  1M4V A;  2B2V C;  2UXC Q;  2BDN A;  1MSH A;  2K1B A;  4AQY L;  3MXN A;  1TWC B;  3HKS A;  4RCO A;  2ZXR A;  3F1Z A;  1EL0 A;  3OMC A;  4LF5 L;  1EU3 A;  2E2J B;  1UE7 A;  1Z6H A;  4R4O A;  3CMA A;  3MWY W;  2PZT A;  4QGU A;  2H5X A;  3FDT A;  3EVQ A;  4OIK A;  3VA7 A;  1KHI A;  2DNC A;  5C44 B;  1SYF A;  1GUG A;  1DXM A;  4K2L A;  2IJ0 A;  3GTG B;  1TWH H;  3HKZ E;  3NBH A;  1UEA B;  4XQJ A;  1YBY A;  1C9O A;  2EQS A;  2R7D A;  2AUJ D;  5DLQ E;  1N34 L;  1SRO A;  1Q3L A;  2E5L Q;  2RHQ B;  1P8L A;  4JYA Q;  3DXJ C;  2H1E A;  2SNM A;  1DD2 A;  5HY6 A;  1GHK A;  3HOV B;  5FLM H;  5AJ3 Q;  2BH2 A;  2VB3 X;  4UP9 A;  4NXN Q;  3BVZ A;  2GVB A;  2HQE A;  2K5N A;  1B7Y B;  3Q8D A;  1QZG A;  3H91 A;  1FL0 A;  4EQP A;  1VQF A;  1VQ9 A;  2UXD L;  2MFI A;  1TQO A;  3K6O A;  1I94 Q;  5IGE A;  2FHT A;  3KF8 A;  5JEA G;  3I4L A;  3IAY A;  2B2U A;  2KUM A;  2HDM A;  4A93 G;  4F87 A;  3R3O A;  1WTR A;  1KDB A;  2NVT B;  2LXK A;  4K5W A;  4JC0 A;  4JV5 Q;  2VW9 A;  4EQ5 A;  1ZXT A;  2MNA A;  4GKK Q;  2D62 A;  3A56 A;  1W2B A;  4EVO A;  4RA8 A;  1SFO B;  4LFB Q;  3WOE A;  3MEF A;  5GAG C;  2KOL A;  3H0G H;  1E2V A;  3R93 A;  3STB C;  3W3A A;  4GOP B;  2CKZ B;  4B3M Q;  4GOP C;  5LMU Q;  4Y52 H;  1S5C D;  5LHY 1;  1KIX A;  1SSO A;  4PG3 A;  4X66 L;  4R9W A;  3VYT A;  4RGM A;  4EQO A;  4J1M A;  4X64 Q;  4HJ9 A;  1UE5 A;  4G57 A;  2D2C C;  5EBC A;  2HHH Q;  4ZLT F;  3MZ5 A;  4G4K A;  3EJI A;  4A3D B;  2J7Z A;  4K8J A;  1HR0 W;  4JI0 Q;  4QCL A;  5EGT A;  3MXP A;  1JJG A;  5C4J H;  3OIQ A;  4A3E G;  1WTV A;  1CKO A;  2QGQ A;  3CCU A;  5C0X J;  3OTO L;  1JOO A;  1SRU A;  3S14 B;  1FVI A;  4IUQ A;  5C4X H;  4MNO A;  3LWE A;  2EYO A;  3BJU A;  1VQO A;  1TY2 A;  4FXK C;  1I3Q B;  3AYH B;  3F2B A;  2AQ2 B;  2R93 H;  2R92 H;  4KMU C;  4A3L G;  1KC8 C;  1DOM A;  1NBW A;  5IY0 A;  2HCI A;  1FYC A;  4GN5 A;  3E9I A;  1VCI A;  1O7I A;  4OIJ A;  4WJ3 M;  2F4I A;  4HIK A;  1VQI A;  2K75 A;  3D3R A;  1PZJ D;  3FHW A;  4GNX A;  4A75 A;  1O7Y A;  3AQQ A;  1QWY A;  1I4H A;  1VQ7 A;  2VY3 A;  2A1A A;  3GO5 A;  1UEB A;  3J80 c;  5CR3 A;  4CBV A;  3M7N A;  1BXT A;  1OO9 B;  4CDD C;  3OOC A;  3E3X A;  4AYB E;  2CHB D;  5HGT A;  1L0Y B;  4DV6 Q;  3PO3 H;  3FMC A;  2ZJQ A;  3W2D A;  3T16 A;  5M5X B;  4IOA A;  3M4O H;  3UDF A;  1X55 A;  2EIF A;  4JI7 L;  2ZTD A;  3UDX A;  3GD7 A;  4A3B G;  2N3S A;  3QR8 A;  4FF3 A;  1IW7 C;  1G2S A;  2JEB I;  4IUU A;  4KN7 C;  1TWC H;  2HIX A;  4XDX A;  3CU7 A;  2B2T C;  4RMF A;  3J7A V;  5DM6 3;  3FVQ A;  5D65 A;  3BYY B;  3KDF B;  4DR4 L;  2VUM G;  3TEH B;  2QCP X;  3E9H A;  2E2J H;  1K8G A;  1E3P A;  1YZ6 A;  3GTM B;  4ABN A;  1LT3 D;  2V1C C;  3S9W A;  1X54 A;  3PSI A;  3KF6 A;  1EZ8 A;  2A69 D;  1VQK A;  4I7Z C;  1JIC A;  3ONA B;  1Y69 U;  1YNN D;  4JI4 L;  2N49 A;  5EQ0 A;  4POG A;  5C44 H;  2D0P A;  2Y0S E;  2YTY A;  3GTG H;  2WAQ B;  4A3M B;  1CKM A;  2JA7 B;  3KBG A;  3OHX C;  5C5M A;  2WKC A;  2NZH A;  4DK0 A;  2LFN A;  4DR1 L;  2VQE L;  3U58 A;  4YWM A;  4L63 B;  3NQI A;  3D31 A;  1DCZ A;  1PVO A;  2AUK A;  1CUK A;  3GTO B;  1ENF A;  3HOV H;  4DUY L;  3S24 A;  3CCS A;  2Z6K C;  1TWA B;  4DV7 Q;  4B3T L;  1KRT A;  2ZXO A;  1ZKO A;  3DWQ A;  2OTL A;  3MVV A;  4X6A H;  5JPN C;  3IL8 A;  3QG1 A;  4KKT A;  1DYQ A;  2L11 A;  2VQF L;  3NBH B;  1OXT A;  4DV4 L;  1SYG A;  4PZ7 A;  1K8O A;  1I4X A;  4ZKB B;  4IAL A;  2VNU D;  3L0O A;  1X56 A;  1MJC A;  2NVT H;  2VS1 A;  4L5R C;  3G48 A;  2N55 A;  4JPB W;  3F2U A;  1Q82 C;  1SFO H;  5GQO A;  4UDU C;  1VQD A;  4DNI A;  4KHP L;  1I4G A;  1PTO D;  1DOL A;  2CQA A;  1ZYR D;  4A3C G;  3SE0 A;  1SEB D;  1XNQ L;  1STB A;  2VB2 X;  4BA1 I;  2EYP A;  1WTP A;  4BXX H;  2CQO A;  1EQQ A;  5E4X A;  1I4Q A;  2ZJP A;  3M85 A;  3I90 A;  1N32 L;  1T5X D;  2Z9H A;  3ERS X;  3MHB A;  3QWN A;  1GUT A;  3HRZ C;  4GKK L;  4R8I A;  4FYD A;  2RVL A;  1B9M A;  1JJC B;  3X3N A;  3J81 c;  1F9R A;  1ESF A;  4A3J G;  5KRU A;  1TXY A;  4A3D H;  1XMO Q;  3LWU A;  2M00 A;  4YWK A;  1Q46 A;  1NSN S;  4LMQ D;  4ID6 A;  4DAM A;  2D0O A;  1K73 C;  3I72 A;  3FRP B;  4CJ2 C;  2EYF A;  1VQG A;  4IJL A;  1KNA A;  5FLX L;  1TR5 A;  3S14 H;  2Y0S G;  2ZXP A;  4OWT B;  1STY A;  3PQI A;  3Q0A A;  1EFW A;  4RGT A;  1XNR L;  4X62 Q;  1I3Q H;  4GN3 B;  1D5M C;  3RZD B;  3TRE A;  3T51 B;  5IE8 A;  1NJI C;  1UNS A;  4P74 A;  1S72 A;  1HJP A;  3NEL A;  2IX1 A;  5I4D A;  1UE6 A;  5CGK A;  1LTS D;  5E7N A;  4YY3 L;  4UY8 C;  3AEV A;  1KL9 A;  4H44 C;  2UU9 L;  3C1F A;  3UE1 A;  4BS9 A;  1BUV T;  3PV0 A;  1F9S A;  5FJ8 G;  1LTI D;  1VQM A;  4JG2 A;  4KI0 A;  1IBK L;  2EJM A;  3QOJ A;  2PI2 E;  4PZ6 A;  2KA7 A;  3GV3 A;  3L7Z C;  2KCT A;  5FLM G;  4OX9 L;  1ML0 D;  4DN4 M;  3PGZ A;  4HCS A;  1VQE A;  3DM3 A;  2Z1C A;  2YTX A;  3Q24 A;  1E0B A;  1OTC A;  3K0Y A;  1VS0 A;  1F9Q A;  1FNV A;  4GZY C;  3GTK B;  5IP7 G;  2CVR A;  5C4H A;  1QUQ A;  3K7U C;  1NNX A;  5M5X H;  4N8F A;  4AQY Q;  2B39 A;  4B3R L;  4GNX B;  2R3Z A;  2AKW B;  5IGF A;  4LF5 Q;  1F77 A;  3KK7 A;  4LF6 L;  3UDG A;  2F0Q A;  4QIW B;  1NR2 A;  1B1Z A;  1JWS D;  5LL6 S;  5BN4 A;  3H0G G;  4X3U A;  4DAP A;  1NUC A;  1K0R A;  5TSS A;  1NAP A;  3GTM H;  2PQE A;  2EXZ A;  4GS3 A;  4LF8 L;  4TKO B;  1HHV A;  1QNK A;  1EIG A;  2UXB L;  5EAY A;  3EIV A;  4LFA L;  1IBL L;  2I5H A;  3PIP 3;  3CCR A;  1EY8 A;  3LX0 A;  4A3M H;  1N34 Q;  2RDH A;  1EY7 A;  1JT8 A;  2JA7 H;  2B2Y A;  3H3V C;  1XX8 A;  3VYR A;  4A3L H;  2Z6B A;  2JXM B;  2F3I A;  2MO0 A;  3CPF A;  3A7A B;  4IPC A;  3GTO H;  1R4P B;  2HD3 A;  4N9P A;  2F0H A;  1J5E L;  1TWA H;  4LNQ A;  3KF6 B;  4C1N K;  3HOW B;  5IYB H;  1O7Z A;  1IYU A;  2UXD Q;  2R93 G;  3RLO A;  3CME A;  2X69 A;  5ELE A;  2R92 G;  1LUZ A;  3ND8 A;  1KAB A;  4KY5 A;  2A68 D;  4MIU A;  1ICF B;  5FOB B;  1JCK B;  4I65 A;  1SMX A;  3S16 H;  4DV7 L;  4DV5 L;  1AEX A;  1I6H B;  1CKN A;  2XSC A;  5LMN W;  3KLS X;  1JOQ A;  1CQV A;  1JC7 A;  4DR7 L;  3U9O A;  2NN6 H;  1SBB B;  3I8Z A;  1RDP D;  4CJ1 B;  2MJ8 A;  1GD7 A;  3SK6 A;  4X66 Q;  1O7L A;  3E5S A;  1WVL A;  3A7L A;  4R4Q A;  2I5L X;  1JMC A;  4TSS A;  4ZK9 B;  4B3S L;  3CCE A;  5D3I B;  3PO3 G;  1H95 A;  1WYD A;  3H15 A;  1Q7Y C;  1VQN A;  2EY5 A;  1KAW A;  1A3U A;  4L8J A;  3TP8 A;  1IBM L;  1HNW L;  2ZTC A;  4BWG B;  3HZX A;  1BVS A;  2C5C A;  3JAM c;  4C3H G;  2J4X A;  2KBN A;  5CV5 A;  1U0L A;  2IT1 A;  1PFN A;  3R2T A;  3NWT A;  1PH3 A;  1X32 A;  4X3K A;  5ELF A;  3OTO Q;  2KQ3 A;  2F0M A;  2A6H D;  4RHR A;  1XXG A;  2KJX A;  1JB7 A;  2OEO A;  1EOT A;  3VR5 A;  1SND A;  2RBM A;  2JEA I;  2LXJ A;  2RKS A;  1O78 A;  4DV0 L;  4DXF A;  4YIJ A;  4JI2 L;  4P75 A;  1AZQ A;  4LF7 L;  3A54 A;  5KGU A;  4DNR B;  3RZD H;  4CGY B;  1XWE A;  4JI5 L;  1I6V C;  2EPB A;  1Q86 C;  3SGI A;  1LTA D;  5C44 G;  1HPC A;  2K01 A;  1SR3 A;  1SN8 A;  4KV6 A;  2LMC B;  2AMC B;  4KJO A;  1T9H A;  5KNC A;  1HCZ A;  4HJ7 A;  4HIO A;  1Q12 A;  2PYK A;  4JBW A;  1IKM A;  5CBA E;  3OWE B;  1AH9 A;  2AHO B;  3I70 A;  4JI6 L;  1G2T A;  1RL2 A;  3V96 A;  3CP0 A;  2JA8 B;  2NWG A;  2NUC A;  1H9K A;  1X6O A;  2A6E C;  2LSS A;  1JWU D;  5DAU A;  1BNZ A;  3W5O A;  3GTK H;  1NY4 A;  4JI7 Q;  1Z7T A;  3E0E A;  2ZT9 C;  3KJP A;  1BBU A;  1XTD A;  2NN6 I;  1LLR D;  4C1N I;  3VR4 A;  1P16 A;  3FEW X;  1ASZ A;  2AQ3 B;  3BDO A;  5JPM C;  1A6X A;  2ICE C;  5IP9 H;  2E2I B;  1AP0 A;  1PRT D;  1LO5 D;  1TS5 A;  1II3 A;  2OT2 A;  4DR4 Q;  1WOC A;  1AN8 A;  1VMC A;  4J15 A;  4C3H B;  1DJR D;  4G7Z C;  4DR6 L;  2EXD A;  1YJN A;  3L2P A;  3HEJ A;  4BXX G;  2EYJ A;  4JI8 L;  4ZUJ A;  2SEB D;  3DHQ A;  2IX0 A;  3M7G A;  2JK8 A;  1OXU A;  3H09 A;  1BBX C;  1K28 A;  4JI4 Q;  4DV2 L;  2Q8R E;  1QUQ B;  2EY2 A;  4DFA A;  2PPB C;  3NTI A;  2K28 A;  1HZ9 A;  1WD1 A;  5C0X G;  3KUP A;  3MC0 B;  4DR1 Q;  2VQE Q;  5CV4 A;  3PIP A;  4A3D G;  3G7L A;  3H3V H;  1F2L A;  4IO9 A;  5FLX c;  4HCE A;  1LT5 D;  5A35 A;  2OCE A;  5G3L D;  4APV A;  2C9O A;  4DUY Q;  1XTC D;  3I4N B;  4B3T Q;  1JQY D;  1VMP A;  2RQX A;  2WAQ E;  4OWX B;  2E8G A;  2JN4 A;  5I6W A;  1D1K A;  5FJ8 H;  1S5B D;  1Z47 A;  3TBI B;  3CXC A;  3HOW H;  3EQL C;  2FIN B;  5IOD A;  2VQF Q;  4DV4 Q;  3J81 j;  3K8A A;  2O4X A;  1YVC A;  4GLA C;  4DAY A;  3TSS A;  1AFP A;  2H4O A;  1EYA A;  4ULL A;  1EIF A;  3VDY A;  2ICI A;  3DEO A;  4ZYS A;  1GHJ A;  1KLG D; 
#chains in the Genus database with same CATH homology
 3GTL B;  2Z4H A;  3RMH A;  2F0D A;  1STG A;  3D4R A;  1TS4 A;  2NB0 A;  2PNR C;  1SE3 A;  1BCP B;  1BCP C;  1BO0 A;  3SHL A;  1MBY A;  2XIW A;  4Y7N B;  4FO2 A;  1H9R A;  4K5X A;  1JOR A;  1R9T B;  3TN2 A;  2F0O A;  1ILQ A;  3SK5 A;  1BCP F;  2K04 A;  3NP8 A;  3HOY B;  2KEC A;  2F3W A;  3KLR A;  1HRJ A;  2K7V A;  4HMJ A;  4CKE A;  1XYI A;  3A8K E;  2CW0 C;  1HUM A;  3A55 A;  4B9W A;  1F2Z A;  4K6L A;  2EZV A;  3QOL A;  2D9U A;  4J8Q A;  2F0V A;  2WIN B;  5KIX A;  1B3A A;  4KKU A;  2QKI C;  1BOS A;  3TDQ A;  3HOX B;  1PLF A;  3SEB A;  1WTX A;  3TP5 A;  2EDG A;  5EKK A;  5FO7 B;  5M3M B;  2E76 C;  3IFT A;  1PMR A;  2DNE A;  1B44 D;  2I07 B;  1V43 A;  1Y8N B;  4Q5V A;  1TS2 A;  1HQM C;  4A3I B;  2F0I A;  3OMG A;  2BE5 C;  1QOH A;  5AFW A;  1QG7 A;  2Q8T A;  2PZW A;  4DK1 A;  3ND9 A;  3NPP A;  3I3C A;  3D6W A;  4XTC S;  1YNJ D;  1JB3 A;  1ET9 A;  1LT6 D;  5I6Y A;  2NN6 G;  4EQN A;  4QMG A;  5KNB A;  3VR3 A;  5CBE E;  3K58 A;  2K33 A;  1Q90 A;  1LTT D;  2QF7 A;  3MFG A;  1LAB A;  4LAA A;  5C6A A;  3HGB A;  5CC4 A;  1ICW A;  1SYD A;  1HA6 A;  5CYU A;  3MFY A;  5FO9 B;  1I4P A;  5T1I A;  1J9O A;  2HDL A;  5CV8 A;  2AQ1 B;  3VYS A;  2R61 A;  5BN5 A;  3ITP A;  1I50 B;  2MP1 A;  4RWS C;  1IW7 D;  5EKI A;  1TKW B;  5CMD A;  2F0W A;  2L5T A;  2F0G A;  4IFD J;  4IUR A;  2EVB A;  1G8Z D;  1PZI D;  4FVM A;  4C3J B;  3QB3 A;  2J0T D;  3K5L A;  5K36 G;  4QUF A;  1HA5 A;  2NVY B;  4ZAI A;  2JSO A;  3S16 B;  4A3F B;  4P2C B;  1WTQ A;  2E2H B;  4BY7 B;  2WKD A;  1FR3 A;  4WOR A;  4DNT B;  3HOZ B;  4RAU C;  5EPL A;  3P20 A;  1STA A;  5F2D A;  1SJH D;  3SK4 A;  1FNW A;  1MD2 D;  5FO8 B;  1CZG A;  4N9T A;  4UAI A;  3NSW A;  1HUN A;  5EKL A;  3L3O C;  2NTT A;  3FKI B;  2KEE A;  5FKA C;  2B2U C;  1Y8O B;  2L12 A;  5C0X H;  3NUC A;  2G9H D;  2EYM A;  2B63 B;  3T56 B;  2GA4 B;  1X3Q A;  3SVM A;  3GTJ B;  1KLU D;  1L0X B;  3NTK A;  5IGD A;  4H13 C;  1EZ6 A;  1MGS A;  2JA5 B;  3M3Y B;  3RD4 A;  2K05 A;  1EY5 A;  2KCN A;  5COY A;  1CHP D;  1A15 A;  4FF1 A;  1EQV A;  3GTQ B;  4ZUI A;  4IUT A;  4KN4 C;  4MHE A;  1AZP A;  1C4Q A;  2MPM A;  1DM0 B;  1CT1 D;  3PIO 3;  3S1Q B;  4B9X A;  2NVX B;  1W6J A;  2Q8I B;  1V1P A;  1WTW A;  5DEH A;  2IX3 A;  4E6I A;  1KDC A;  2F0F A;  2A74 C;  2R6G A;  1ENC A;  1HFN A;  4O42 A;  1Y8P B;  1TU2 B;  1GOZ A;  1U4M A;  1ILP A;  1WCM B;  2KED A;  1JWM D;  5J1Z A;  5COR A;  1MI2 A;  2AWO A;  4LJZ C;  4FF2 A;  1SNO A;  4HMI A;  4XYO A;  1M8A A;  2B2W A;  1BF4 A;  2B2V A;  4QB4 A;  4FXG C;  2OF1 A;  3S1N B;  3NHH A;  5D14 A;  1SYB A;  4NW2 A;  5KYI A;  1SNP A;  5C0X I;  3SR1 A;  3PUV A;  3P1H A;  2E74 C;  1IKL A;  1RF2 D;  2RA4 A;  4IUP A;  4KK7 A;  2V4D A;  3RLF A;  5EPJ A;  4ILW A;  1KAA A;  4EGV A;  2K32 A;  5CV6 A;  1CFM A;  1K8M A;  3VA5 A;  1S5D D;  5CV9 A;  2F0P A;  2FJ2 A;  1PFM A;  5E1F A;  5E3F A;  1SJE D;  2DN8 A;  4CKC A;  1TY0 A;  2OXP A;  1AW7 A;  4OO1 G;  4IFD H;  2IW3 A;  2XRS D;  1OXS C;  3MXG A;  5JAV A;  5C3E B;  5I9O A;  1TS3 A;  1C8C A;  4M1U B;  1SMY C;  5JVG 3;  4F88 A;  2K5Q A;  1ROD A;  2WAC A;  2F0J A;  1EWH A;  2BDO A;  2RDF A;  3GQB A;  4DGZ A;  3S2H B;  2M2L A;  5M3F B;  2M9V A;  2F1M A;  3OW7 A;  2RSO A;  4NMZ A;  4A3K B;  3K5N A;  3WDN A;  3NWS A;  1HQR D;  1Y1W B;  1VF7 A;  1ET6 A;  2A73 B;  1CA6 A;  1IL8 A;  3EA6 A;  5M5W B;  2PMZ B;  3BVG A;  2PZU A;  1I4R A;  1K83 B;  3VYU A;  5EBD A;  1UAP A;  1OXV A;  4XIG S;  3NE5 B;  2KCC A;  3S17 B;  1ESR A;  1EY4 A;  1SE4 A;  1KTK A;  2EJF C;  5A2Q L;  3HS0 C;  3LNN A;  4CJ0 B;  3NQT A;  3S1R B;  5I2Y A;  2L1B A;  3TP6 A;  1CK1 A;  4U68 A;  3MTS A;  4R8N A;  2JP1 A;  1SNC A;  1DON A;  1QNU A;  4KD3 A;  1F9P A;  2LKV A;  3BDC A;  5K5P A;  3HOU B;  4C2M B;  4IQZ A;  4TQU S;  3CHB D;  3CRK C;  2MGS A;  4L6T B;  5IIF A;  4U67 3;  3J7Y W;  3URY A;  2E2D C;  1BQQ T;  3M4Y A;  2K5W A;  4XXE A;  3MAQ A;  1KDA A;  5K36 H;  4HED A;  4FP5 D;  2BA1 A;  1SNQ A;  5KEE A;  1SE2 A;  2F0S A;  2WB1 B;  3Q22 A;  5LL6 X;  4S3S A;  2EE1 A;  1STH A;  5JOB A;  2FFK B;  3ERQ A;  1Q8I A;  5ELC A;  4V0B A;  2L55 A;  2F3V A;  2LY7 A;  3QJY A;  4KTA A;  3S1M B;  3T53 B;  2B2T A;  4RGO S;  5NUC A;  1F2Y A;  1SYC A;  3P7J A;  5M5Y B;  1D5Z C;  4XQN A;  4Q0F A;  4X3S A;  1HTP A;  1PYW D;  3BDL A;  2AWN A;  1J8I A;  2A6E D;  1LV9 A;  4BBR B;  2JYO A;  1STN A;  2MUY A;  2TMP A;  3J81 L;  4M8A A;  3K7A B;  2A5H A;  2N88 A;  4HSV A;  1JR0 D;  5C3X A;  4WFN 3;  1MSG A;  2ID0 A;  1CHQ D;  3A8J E;  3C46 A;  1BR9 A;  4ZKC B;  2EY6 A;  2YYZ A;  4HN7 A;  3SK8 A;  1KNE A;  4DA2 A;  4HAE A;  4KD4 A;  3I4M B;  3PMF A;  1QIL A;  3SDZ A;  2FMC A;  1F2M A;  3J80 E;  1EQT A;  1Y1V B;  2B2Y C;  3N52 A;  2IWH A;  3ZYY X;  2QIL A;  2LS0 1;  5KND A;  5A2Q E;  2L0C A;  1EFI D;  1WTO A;  1PDQ A;  3RZO B;  4ZRZ A;  3OIP A;  4PMB A;  5BN3 A;  2NVQ B;  3H6M A;  3J7A F;  4IUN A;  1V8Q A;  4C3I B;  1NCV A;  3X3M A;  1B2T A;  5C3W A;  1U9R A;  4K14 A;  1H9S A;  1A3V A;  1LT4 D;  3R2I A;  4X3T A;  2IPK D;  1RD9 D;  4QUC A;  3AMU A;  4IUV A;  5J22 A;  4OO1 H;  4BBS B;  2K5D A;  4OL7 A;  1SDF A;  4FF4 A;  4BA2 I;  4ME5 A;  5E4W C;  2WII B;  2DY7 A;  3DWA A;  1V1O A;  4PV1 C;  2F0K A;  1BCP D;  1TWF B;  1SYE A;  3GTP B;  2F0N A;  2E75 C;  4ODG A;  4IN3 A;  4JK1 C;  3OWF A;  1S5F D;  3CKI B;  2YU9 B;  2Z4I A;  4DXG A;  4IFD G;  1CI3 M;  4QF4 A;  4F7X A;  4BY1 B;  3NTH A;  3Q23 A;  2XWJ B;  4H0L C;  1D2B A;  5ELD A;  1IHZ A;  1CZW A;  1EU4 A;  1B9N A;  1RHP A;  2SDF A;  1LAC A;  4H7B A;  5JVH 3;  2CW0 D;  2O2L D;  3AB9 A;  1DZ1 A;  4RFB A;  1WD0 A;  4A3G B;  1GXD C;  1YNJ C;  2R7Z B;  4C3J G;  1GUS A;  1DOK A;  5IGG A;  1EIH A;  3C3L A;  3S2D B;  3J81 E;  4A93 B;  2F0U A;  3K59 A;  2A69 C;  3PO2 B;  3MEH A;  5FK9 C;  1YNN C;  1PZK D;  2WV6 D;  5JEA J;  1QCB D;  4OHJ A;  1B53 A;  4XQQ A;  5JJZ A;  1VDZ A;  4F8M A;  4OO1 I;  1U4P A;  4C56 C;  3HP3 A;  3T4A C;  2BE5 D;  3DEP A;  3OPO A;  2EOT A;  4NP5 A;  3JAM L;  4IZ8 A;  2F0L A;  5CV7 A;  5J39 A;  4HSP A;  3NK9 A;  1X3P A;  4FXD A;  1PFB A;  3ERO A;  3V2T A;  3KLS A;  2PW7 A;  4A3E B;  1E2W A;  2F0E A;  3PUX A;  3HKZ B;  3D4W A;  4KHV A;  2WP8 J;  3DWP A;  4KKS A;  5IGB A;  1PTO B;  1PTO C;  1D1I A;  1ZYR C;  2RSN A;  5C4Z A;  3K5O A;  1NR4 A;  4RKB A;  3N6R A;  4KJN A;  1JE4 A;  1D5X C;  1PTO F;  1H9J A;  1GUN A;  4CKB A;  3HG9 A;  5IOC A;  3D8G A;  3TZU A;  4K6D A;  4RKL A;  3S15 B;  2TSS A;  1EY6 A;  4B08 A;  2KVM A;  2QDB A;  5DNF A;  1FNU A;  3BYT B;  2VXW A;  4K5V A;  4PMW A;  3K5M A;  4XYQ A;  3L9A X;  1LTG D;  1EWC A;  3NBI A;  4A3B B;  3A8I E;  1RTO A;  1OXX K;  1QJO A;  3Q6S A;  2BA0 A;  1JOK A;  2RDG A;  2VUM B;  2NZ1 D;  1RKN A;  2HCC A;  1H9S B;  4OGQ C;  2EYH A;  3AU7 A;  5M9O A;  3D4D A;  1STE A;  1O80 A;  5I9P A;  2X6G A;  2XVS A;  1U4L A;  1B50 A;  1A2T A;  1Q1E A;  5IGC A;  4O1N A;  3D6C A;  3E0J A;  1FGB D;  2EYL A;  1U4R A;  3IKJ A;  2I46 A;  2QEJ C;  1ONL A;  5ELB A;  2NTS A;  4HTH A;  3K57 A;  2IL8 A;  5DM7 3;  3UI2 A;  4PQX A;  3GP7 A;  3NXW A;  1QE6 A;  1C48 A;  1ENA A;  5JEA H;  2NBF A;  3CRL C;  3I73 A;  2JE6 I;  2XWB B;  3JAM E;  1GUO A;  1UUP A;  2JA6 B;  4AYB B;  1GJX A;  2L4N A;  2HUG A;  1E2Z A;  2BCO A;  4ZQ3 A;  2EY1 A;  1G91 A;  1TWG B;  1EYD A;  3CQZ B;  2XNA C;  2KHS A;  1H9M A;  3TME A;  2PW5 A;  4KHZ A;  3I91 A;  1W6K A;  4Z9C B;  4A3J B;  2SOB A;  1HTL D;  2XRQ D;  1CA5 A;  1A3T A;  4J6H A;  1ZEQ X;  1S4Z A;  2A68 C;  2ENB A;  1EEF D;  3U9S A;  2Y0S B;  3QO2 A;  1VF5 C;  1TT2 A;  3BVM A;  5IT9 L;  2PO4 A;  1LTB D;  1PTO H;  2BOS A;  2K03 A;  1EYC A;  3VR6 A;  3TZD A;  3MA2 B;  1TWH B;  2PCF B;  3P75 A;  3OSO A;  4MN3 A;  3R8B A;  5I2X A;  3H94 A;  4KY6 A;  5KYL A;  1IYV A;  4NDX A;  3QIA A;  1CTM A;  4XT1 B;  3DM1 A;  3PUZ A;  3GV6 A;  2DY8 A;  1TVX A;  3DMU A;  5EJW A;  5C5L A;  4PMC A;  1SMY D;  1S5E D;  2A6H C;  1HXY D;  3J80 L;  1RTN A;  1BDO A;  4V19 0;  4CHT B;  2B8F A;  3C2P A;  2O5I C;  2XN9 C;  2NYZ D;  5FLX E;  2F03 A;  4WRD A;  4DU9 A;  3H0G B;  1QB5 D;  5T1G A;  1FD7 D;  1T5E A;  5EPK A;  4G7H C;  3G6J B;  4K2K A;  1CM9 A;  1EY0 A;  2D5D A;  4FNF A;  1CQF A;  4IFD I;  2L9H A;  2X6L A;  3BS1 A;  3KBX A;  3PUW A;  1GUW A;  3EFX D;  3MXU A;  3TP7 A;  2Z8L A;  2K6A A;  1G29 1;  1B4O A;  5C4J B;  3WOF A;  1RJT A;  2F0T A;  1EY9 A;  4RHS A;  3RUZ A;  5C4X B;  1HFG A;  3C1E A;  1TII D;  1PRT B;  3E6Z X;  1PRT C;  1Q1B A;  2R93 B;  3VR2 A;  4KY7 A;  3BG3 A;  2MHV A;  4PNY A;  2R92 B;  4DF7 A;  4LK1 C;  1G6Z A;  1SXT A;  2SNS A;  1PRT F;  4RH6 A;  5D3D A;  3T13 A;  1R4Q B;  3IFD A;  2O5J C;  2G9D A;  4RGN A;  1V1P B;  3BZD B;  4RCN A;  4WJW A;  2FMM A;  3PUY A;  3V05 A;  1A2U A;  5HUR A;  3FPP A;  3DUZ A;  4HR7 B;  4TRD A;  4C3I G;  1D6E C;  1SAP A;  5ISR A;  2B8G A;  1LTR D;  4NKL A;  3PO3 B;  3O13 A;  5IT9 E;  4G7O C;  4DAV A;  4XT3 B;  1PXU A;  1EEI D;  2EJG C;  1RCV D;  3M4O B;  3FPU B;  4K8I A;  3SXH A;  2B2W C;  5G3L F;  1SNM A;  1M4V A;  2B2V C;  2BDN A;  1MSH A;  2K1B A;  3MXN A;  1TWC B;  4RCO A;  2ZXR A;  1EL0 A;  3OMC A;  1EU3 A;  2E2J B;  1Z6H A;  3MWY W;  2PZT A;  3FDT A;  3EVQ A;  4OIK A;  3VA7 A;  2DNC A;  5C44 B;  1SYF A;  1GUG A;  1DXM A;  4K2L A;  2IJ0 A;  3GTG B;  3NBH A;  4XQJ A;  1UEA B;  2AUJ D;  1Q3L A;  3DXJ C;  2H1E A;  2SNM A;  1DD2 A;  1GHK A;  3HOV B;  2VB3 X;  3BVZ A;  2HQE A;  3H91 A;  4EQP A;  1TQO A;  3K6O A;  5IGE A;  2FHT A;  3KF8 A;  5JEA G;  3I4L A;  3IAY A;  2B2U A;  2KUM A;  2HDM A;  4F87 A;  3R3O A;  1WTR A;  1KDB A;  2NVT B;  4K5W A;  1ZXT A;  2D62 A;  3A56 A;  4EVO A;  4RA8 A;  1SFO B;  3WOE A;  2KOL A;  1E2V A;  3R93 A;  3W3A A;  1S5C D;  5LHY 1;  1SSO A;  4R9W A;  3VYT A;  4RGM A;  4EQO A;  4J1M A;  4G57 A;  2D2C C;  5EBC A;  4ZLT F;  3MZ5 A;  4G4K A;  3EJI A;  4A3D B;  2J7Z A;  4K8J A;  4QCL A;  5EGT A;  3MXP A;  3OIQ A;  1WTV A;  5C0X J;  1JOO A;  3S14 B;  4IUQ A;  3LWE A;  2EYO A;  1TY2 A;  4FXK C;  1I3Q B;  2AQ2 B;  4KMU C;  1DOM A;  2HCI A;  1FYC A;  1VCI A;  4OIJ A;  2F4I A;  3D3R A;  1PZJ D;  1O7Y A;  1QWY A;  1I4H A;  3GO5 A;  5CR3 A;  4CBV A;  3M7N A;  1BXT A;  1OO9 B;  3OOC A;  2CHB D;  5HGT A;  1L0Y B;  3FMC A;  3W2D A;  3T16 A;  5M5X B;  3GD7 A;  4FF3 A;  1IW7 C;  1G2S A;  2JEB I;  4IUU A;  4KN7 C;  4XDX A;  3CU7 A;  2B2T C;  3J7A V;  5DM6 3;  3FVQ A;  5D65 A;  3BYY B;  2QCP X;  3GTM B;  4ABN A;  1LT3 D;  3S9W A;  1EZ8 A;  2A69 D;  4I7Z C;  1JIC A;  3ONA B;  1Y69 U;  1YNN D;  5EQ0 A;  2WAQ B;  4A3M B;  2JA7 B;  3KBG A;  3OHX C;  5C5M A;  2WKC A;  4DK0 A;  2LFN A;  4L63 B;  3NQI A;  3D31 A;  1DCZ A;  2AUK A;  3GTO B;  1ENF A;  1TWA B;  2ZXO A;  1ZKO A;  3DWQ A;  3MVV A;  5JPN C;  3IL8 A;  3QG1 A;  4KKT A;  1DYQ A;  2L11 A;  1OXT A;  1SYG A;  1K8O A;  1I4X A;  4ZKB B;  4IAL A;  2VNU D;  2N55 A;  3F2U A;  4UDU C;  1I4G A;  1PTO D;  1DOL A;  2CQA A;  1ZYR D;  3SE0 A;  1SEB D;  1STB A;  2VB2 X;  4BA1 I;  2EYP A;  1WTP A;  5E4X A;  1I4Q A;  3M85 A;  3I90 A;  1T5X D;  3MHB A;  3QWN A;  1GUT A;  3HRZ C;  4R8I A;  4FYD A;  2RVL A;  1B9M A;  3X3N A;  1F9R A;  1ESF A;  5KRU A;  3LWU A;  2M00 A;  1NSN S;  4LMQ D;  4ID6 A;  3I72 A;  3FRP B;  4CJ2 C;  2EYF A;  1KNA A;  5FLX L;  1TR5 A;  2ZXP A;  1STY A;  3Q0A A;  4RGT A;  3RZD B;  1D5M C;  3T51 B;  1UNS A;  2IX1 A;  5I4D A;  5CGK A;  1LTS D;  4H44 C;  3C1F A;  4BS9 A;  1BUV T;  3PV0 A;  1F9S A;  1LTI D;  4KI0 A;  2EJM A;  3QOJ A;  2KA7 A;  3GV3 A;  3L7Z C;  1ML0 D;  4DN4 M;  4HCS A;  2Z1C A;  3Q24 A;  1E0B A;  3K0Y A;  1F9Q A;  1FNV A;  4GZY C;  3GTK B;  2CVR A;  5C4H A;  2B39 A;  2R3Z A;  5IGF A;  1F77 A;  3KK7 A;  2F0Q A;  4QIW B;  1NR2 A;  5BN4 A;  1B1Z A;  1JWS D;  5LL6 S;  4DAP A;  4X3U A;  1NUC A;  5TSS A;  1NAP A;  2PQE A;  2EXZ A;  1HHV A;  4TKO B;  1QNK A;  1EIG A;  3PIP 3;  1EY8 A;  3LX0 A;  2RDH A;  1EY7 A;  2B2Y A;  3H3V C;  1XX8 A;  3VYR A;  2JXM B;  3A7A B;  1R4P B;  4N9P A;  2F0H A;  4C1N K;  3HOW B;  1O7Z A;  1IYU A;  2X69 A;  5ELE A;  3ND8 A;  1KAB A;  4KY5 A;  2A68 D;  4MIU A;  5FOB B;  1JCK B;  4I65 A;  1AEX A;  1I6H B;  2XSC A;  3KLS X;  1JOQ A;  1CQV A;  1JC7 A;  3U9O A;  2NN6 H;  1SBB B;  3I8Z A;  4CJ1 B;  1RDP D;  2MJ8 A;  3SK6 A;  1O7L A;  3E5S A;  1WVL A;  3A7L A;  4TSS A;  4ZK9 B;  5D3I B;  2EY5 A;  1A3U A;  4L8J A;  3TP8 A;  4BWG B;  3HZX A;  2C5C A;  4C3H G;  2J4X A;  5CV5 A;  2IT1 A;  1PFN A;  3R2T A;  3NWT A;  1X32 A;  4X3K A;  5ELF A;  2KQ3 A;  2F0M A;  2A6H D;  4RHR A;  1XXG A;  2KJX A;  2OEO A;  1EOT A;  3VR5 A;  1SND A;  2RBM A;  2JEA I;  2RKS A;  1O78 A;  4DXF A;  4YIJ A;  1AZQ A;  3A54 A;  5KGU A;  4DNR B;  4CGY B;  1XWE A;  1I6V C;  2EPB A;  1LTA D;  1HPC A;  2K01 A;  4KV6 A;  2LMC B;  4KJO A;  5KNC A;  1HCZ A;  1Q12 A;  2PYK A;  4JBW A;  1IKM A;  5CBA E;  3OWE B;  3I70 A;  1G2T A;  3V96 A;  2JA8 B;  2NWG A;  2NUC A;  1H9K A;  2A6E C;  1JWU D;  5DAU A;  1BNZ A;  1Z7T A;  2ZT9 C;  2NN6 I;  1LLR D;  4C1N I;  3VR4 A;  3FEW X;  2AQ3 B;  3BDO A;  5JPM C;  1A6X A;  2ICE C;  2E2I B;  1AP0 A;  1PRT D;  1LO5 D;  1TS5 A;  1II3 A;  2OT2 A;  1AN8 A;  1VMC A;  4C3H B;  1DJR D;  4G7Z C;  3HEJ A;  2EYJ A;  4ZUJ A;  2SEB D;  3DHQ A;  2IX0 A;  3M7G A;  1OXU A;  3H09 A;  1BBX C;  2Q8R E;  2EY2 A;  4DFA A;  2PPB C;  3NTI A;  2K28 A;  1WD1 A;  5C0X G;  3KUP A;  3MC0 B;  5CV4 A;  3G7L A;  1F2L A;  4HCE A;  1LT5 D;  5A35 A;  5G3L D;  2C9O A;  1XTC D;  3I4N B;  1JQY D;  1VMP A;  2RQX A;  5I6W A;  1D1K A;  1S5B D;  1Z47 A;  3TBI B;  3EQL C;  2FIN B;  5IOD A;  2O4X A;  4DAY A;  3TSS A;  1AFP A;  2H4O A;  1EYA A;  4ULL A;  2ICI A;  3DEO A;  4ZYS A;  1GHJ A;  1KLG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...