3A7AB

Crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
b'NVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLEDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoate-protein ligase A
publication title Global conformational change associated with the two-step reaction catalyzed by Escherichia coli lipoate-protein ligase A.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 24
structure length 127
sequence length 127
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a7aB00
2K33A 4RCNA 3VR6A 1I6VC 2KCCA 1Q1BA 1V8QA 2D5DA 3IFTA 3U9SA 2BE5D 1B9NA 3MXUA 4G7ZC 2A69D 4BA1I 3QJYA 4BA2I 5K36H 1LACA 1GUNA 4H44C 3SDZA 3AB9A 2AUJD 3M7NA 4DNTB 2JE6I 5BN3A 4KN4C 3KLRA 1K8OA 1GUOA 3PUXA 1LABA 1CTMA 2EDGA 2JEAI 1GHKA 2YYZA 2V4DA 2IT1A 1DD2A 1GJXA 4HR7B 2BA1A 4IQZA 1SMYC 2F1MA 1FR3A 2BDOA 1DCZA 1T5EA 3I73A 3QG1A 3VA7A 1BDOA 2K32A 1QJOA 3FPPA 1H9SA 3A8JE 5JEAG 1VF5C 2EJMA 2E76C 1H9KA 2PCFB 4DK0A 1HCZA 4JK1C 3P20A 5KNCA 4LK1C 2JEBI 1VCIA 4GZYC 2EJFC 3PUYA 1CFMA 3MFYA 1GHJA 1EWHA 3DXJC 1GUSA 1O78A 4OO1H 1OXXK 3PUZA 3A8KE 5C0XH 2PNRC 1Y8PB 1B9MA 2AWOA 1IYUA 3VR4A 2LMCB 5KNDA 5A35A 4DNRB 2D62A 3CRKC 3OW7A 3TZUA 2QF7A 2O5IC 1ZYRC 4OGQC 5BN4A 1E2ZA 3GD7A 4XTCS 1TU2B 3L7ZC 3M85A 1YNJC 3EQLC 3WDNA 3RLFA 2E74C 4L8JA 3I72A 1Q12A 4KKSA 3BG3A 1ONLA 4IFDH 4XIGS 1HPCA 1OXSC 1Q90A 2E75C 3N6RA 4KMUC 2A6HC 3QIAA 3OOCA 1H9SB 1OXTA 2B8FA 4KI0A 3T56B 1V43A 2A6EC 3D31A 1VF7A 3IKJA 2D2CC 4JBWA 1IW7C 1Y8OB 3HGBA 1Z7TA 4G7HC 1O7LA 2A68C 3M4YA 2B8GA 2NN6G 3A8IE 1A6XA 1OXUA 1Q1EA 2DN8A 1ZKOA 3PUVA 5JEAH 2NN6I 1YNNC 3A7LA 4LJZC 4KKTA 1FYCA 3PV0A 1E2WA 2K7VA 2ZT9C 3LWUA 1Y69U 4DK1A 3NE5B 2EVBA 1Z6HA 3SE0A 4KHZA 2AUKA 2DNCA 2KA7A 3VR2A 5K36G 3OPOA 4H13C 1TKWB 3D4RA 1HQMC 1G291 2R6GA 2DNEA 4PV1C 1GUTA 2A6HD 2JXMB 3LNNA 4OO1G 1K8MA 4I7ZC 4KKUA 2BE5C 2A6ED 3GQBA 3ND9A 5C0XG 2A69C 4KN7C 2O5JC 3VR5A 1IW7D 4TKOB 4TQUS 5KNBA 4G7OC 1IYVA 2A68D 1OXVA 1H9RA 1HTPA 1VDZA 1E2VA 2CW0C 3FMCA 1Y8NB 3ND8A 2PPBC 2L5TA 3W3AA 4H0LC 3PUWA 3T51B 3A7AB 3CRLC 2EJGC 1H9MA 4IFDG 3BDOA 1GUGA 2BA0A 1H9JA 2NN6H 3I4LA 2Q8IB 5BN5A 1PMRA 3T53B 3VR3A 3H94A 1DXMA 1CI3M
chains in the Genus database with same CATH superfamily
1DOKA 2O4XA 3NXWA 3S1NH 2E8GA 2JA7G 1MJCA 2CQOA 1D2BA 2K6AA 2C35B 1B2TA 4KLKA 4R8IA 5C3XA 5C3EB 2CW0D 5C0XI 4HSVA 4ZLTF 1PXUA 4FF3A 2LS01 1PLFA 2ICIA 1TWGH 1BBXC 1EY9A 4OX9L 1L1OC 1DGSA 4RHSA 1VQKA 3BVZA 2ZTDA 1E3PA 4A3LG 4K6LA 1I4PA 4RGMA 4LF7L 3DEPA 5IYBG 3H09A 3QG1A 1TWHH 4J1MA 2AQ2B 1JB3A 3A8JE 3KDFB 1VS0A 4CKEA 2KBNA 4JK1C 2JA7H 1PH7A 1IHZA 3L0OA 4DUZL 1QG7A 1S40A 2VNUD 3MFYA 2M00A 1O78A 4YWMA 3TBIB 2YU9H 1I50H 2YTYA 1K83B 3HOYH 4X62L 5E1FA 4IUUA 3FVQA 2D62A 4JI8L 1B3AA 3TRZA 3DHQA 3LWEA 1SRUA 4NP5A 4DR1Q 1R9TB 5LMUQ 2EXZA 1UEBA 4HCEA 1LTLA 3TP7A 5EQ0A 2Q8TA 1IZ6A 1SJED 2G9HD 3T16A 1Q86C 1HPCA 4YIJA 2JA5G 4X66Q 1MBYA 1RF2D 1RTNA 3K57A 1K3BC 4P71A 2D2CC 5NUCA 4OIJA 1EY0A 4NXNQ 1FJGQ 5D3IB 2K5HA 1XMQQ 3WOEA 1V1PB 3RD4A 4GLVB 4A3GH 2QGQA 4C3JB 2AUKA 3NQTA 5FJ8H 5IT9L 2B29A 1X3EA 4H13C 1BR9A 1FNWA 2RVLA 4X3TA 3M4OB 1VQHA 3DWPA 3AEVA 3S1MH 4DU9A 1EWIA 1EOTA 5E7NA 3K5MA 3G4SA 3QOLA 1XXGA 2JA5H 5GAEC 1PH3A 3ND8A 3O13A 4NMZA 2NUCA 2MO1A 1JB7A 1JJGA 4K14A 2EPBA 1OTCA 4LNQA 3D6WA 2NYZD 1XMQL 1JWUD 1U0LA 2M2LA 3CCEA 2PZTA 2XGTA 1HNZL 2UUAL 2J0TD 1SNDA 1SBBB 1NNXA 1QCBD 1YIJA 3GTGB 3PF5A 5D14A 3PIPA 1STHA 4C3HB 1UE5A 3KOJA 1GUNA 2ZJPA 2DY7A 4H44C 4GKJL 2CVRA 2CWPA 1U5KA 1JOOA 2JE6I 1W3SA 1E22A 1EEID 3OYYA 2ASBA 4LW1A 1KDAA 5GADC 3I3CA 1R4PB 4IUPA 4PNYA 2EDGA 3TN2A 4A3CG 4JI3L 1EU3A 1YZ6A 3H6MA 2Z6KA 3TEHB 3K5OA 2HQLA 2BA1A 3C46A 3RLOA 1DCZA 5C3EG 1W2BA 3HOZH 1KDBA 1RD9D 3FPPA 1N34Q 1PTOD 2PCFB 2XWJB 3OWFA 4DK0A 1SYCA 3ZJYC 2JEBI 2F0LA 1VQ5A 2EJFC 2X6GA 3M4PA 4GZYC 3A55A 1I4GA 1MIUA 1JE4A 2F0QA 2KOLA 4B3TL 1KDCA 5I9PA 4IUVA 3TZUA 1KABA 3OMGA 2N78A 2F0DA 2H5XA 3OTOQ 2ZM6Q 2CH4W 3I72A 1X56A 3S1RB 1PDQA 4JW0A 4JI4Q 1OXSC 3N6RA 4KMUC 1VQPA 3QO2A 4EQPA 5C3EH 2LFNA 1PZID 1VQ4A 4F88A 4U673 4DR7Q 2F03A 1WTWA 1AZQA 1STYA 4KJNA 2IL8A 3H3VH 4LF9L 3LWUA 4B9WA 3I90A 5IYDG 2WAQB 3UE0A 1D5XC 2DNCA 3CCSA 4XT1B 1LT4D 1WD0A 3KYHC 2PZUA 1YHQA 1GUTA 4APVA 5C4JH 5T1GA 1B53A 2A69C 1Q46A 1K0SA 2A68D 1BBWA 1OXVA 2L12A 2Z4HA 3I91A 4C3JG 1EQQA 1WTXA 1HNWQ 5JJZA 1XX8A 1EIGA 3J80E 1H9JA 3I4LA 3PO2B 1WI5A 1R9TH 5CV9A 1YI2A 4B3ML 3I4MH 4GNXB 1EIHA 2L4NA 2PQEA 1IBKQ 5I4DA 1RDPD 5EBDA 5IYDH 2D5DA 1CZGA 3FKIH 5FLMG 2AUJD 1X54A 5BN3A 2BOSA 1TT2A 1K28A 3K80C 1PTOF 3A5ZB 3X3NA 3NWTA 2KENA 4C3JH 5I9OA 1K73C 5BR8Q 4C3HG 4JC0A 4XQJA 2ZXPA 3I4NB 3BVGA 2ZXOA 1T5EA 4ID6A 2Z6KC 2YTVA 3SXHA 1KRSA 1TWFH 4L5TA 4CDEC 2K32A 4KD4A 3NTKA 4FDBA 2R93H 2L11A 3NBHB 3BS1A 1PFBA 2IY5B 4X3UA 1I4HA 2PQAA 1KC8C 1VQFA 2B39A 1Q8KA 2CWAA 3TSSA 2E2IH 2O5IC 5EKKA 4MIUA 4IUQA 4GS3A 2B2VC 4KK7A 2DJGC 3GTGH 3E9IA 4OIKA 2E75C 4C3HH 1LO5D 4DR3Q 3PO3B 1OXTA 1MHWC 2B8FA 4QIWB 4ALPA 1NR2A 2RHQB 3A8IE 2AHOB 1Q1EA 1QWYA 1TY2A 2HIXA 3DMUA 3E0EA 4O2DA 4UY8C 1N8RC 1GXDC 1KQSA 2IJ0A 2VB3X 1NTGA 2Q2IA 4ZQ3A 2F0OA 3RN5A 1K8MA 2CH4A 4A3KB 1IBLQ 4HMJA 4A3BB 2NVYB 3MEHA 3ER0A 2WAQG 1B3QA 3FMCA 3E9HA 1TIID 4I7AA 2L5TA 3T1HQ 4A3JB 1HUNA 2XRQD 1PRTB 3KLSA 4JCVE 3HOVB 3VR3A 1W6JA 5KRUA 3S1RH 1T5XD 2VUMB 1E24A 2RCFA 1B9NA 1EYCA 2F0SA 2F0PA 3C2PA 3GTLB 4MNOA 1SAPA 3OIQA 3PO2G 1HR0Q 1V1QA 4L5QA 4BXXG 3ERSX 2XRSD 1K8AC 1A15A 1CTMA 1F2ZA 5EGTA 4K0KQ 2F0MA 4KHPQ 2XVSA 4X6AH 4XXEA 5ELBA 5IGBA 4FNFA 4A93B 1B70B 1JCKB 4ULLA 1WD1A 1VQ7A 4DV1Q 4ME5A 1KAWA 3ULJA 2PQAB 5FO9B 1VQGA 1Y1WH 3AFQA 1LYLA 3H3VI 5H1SE 4YY3Q 3I4NG 1MD2D 1N32L 2XSCA 1EEFD 5HURA 2RSNA 3F2BA 1I94Q 1HZCA 2LXJA 4EQ5A 2F0UA 2F0TA 1GUWA 4IPGA 4N9PA 3S9WA 2E74C 3PCOB 4IOAA 4M8AA 2I5HA 3W2DA 4ZYSA 4R4QA 4DFAA 4LFCQ 1WJJA 4LFBL 4RAUC 3STBC 5IGCA 1Y1VH 2PMZE 4G7HC 1CQVA 5DAUA 5KYLA 2UU9L 3E5SA 4AH6A 1Q8IA 2A1AA 3A7LA 1LTSD 2A5HA 4R4IA 2X6LA 3S15H 3PO3G 4Y7NB 1UE6A 3I4NH 4F8MA 5K36G 1G51A 1F2MA 1UE7A 1AE3A 2R6GA 2A6HD 3LNNA 3BJUA 2WB1E 5CV7A 1RKNA 1S5FD 1IW7D 1BCPC 2IHEA 1HR0W 2N55A 2JYOA 3MA2B 3GTJB 2K5VA 2HD3A 5EPJA 3A7AB 3NSWA 1QVFA 1SEBD 1G2SA 2Q8IB 1LTGD 3FRPB 3CU7A 4OELB 4A3KG 1SR3A 1VMPA 4A3BG 4GN3B 2E2JB 5CGKA 3MEFA 2E2HB 4PZ7A 3IFTA 2NVXB 4J6HA 4YCWA 2KECA 1PH2A 3QJYA 5T1IA 4A3JG 5K36H 4DR5L 1YNXA 2DUDA 5C4XB 5LMNL 3T1YQ 1JOKA 1L2FA 3J81j 1LM0A 4JI6L 5GQOA 3HOVG 3GDEA 3CD6A 1YEZA 4DUYL 2VUMG 3E0JA 3DWAA 3GTOB 2PI2E 2F0VA 1DJRD 1SNMA 1STBA 2ALYB 1GJXA 1HA5A 3QB3A 3Q22A 2PW7A 4IQZA 5J1ZA 1C7YA 1VQCA 2RDHA 3BDLA 1BDOA 3SGIA 4OL7A 1QJOA 4RCOA 4A3KH 5JOBA 5JEAG 4A3BH 3CQZH 2OEOA 2WV6D 2NVYH 1ILQA 4IURA 5E3FA 3SK6A 2EYMA 3RN2A 2G5DA 3KUPA 1SNCA 3K8AA 2UXDQ 2KCNA 4A3JH 4DV0L 1FL0A 4QQBX 4OO1H 2UUBL 4A93G 2NVQB 2RF4A 4MHEA 3HOVH 1TU2B 1SE8A 1IBML 2B2UA 5K5PA 1K9MC 1SMYD 5M9OA 1CA5A 2VUMH 1XMOQ 2JA8H 1WVLA 3HOUB 3HOXB 4IFDH 1NMGA 4C1NK 4DPGA 2B3GA 4ILWA 1E7ZA 4I65A 4AIMA 1VF7A 3KF8A 4R4TA 2TSSA 2C5CA 1VQBA 4K8IA 4C1NI 5C6AA 3K5NA 4K8JA 1UAPA 2HHHQ 4B3RQ 1II3A 1N9WA 4DNIA 5JEAH 1QVCA 3DM3A 4FO2A 4A3FH 3CPWA 5ELCA 1EL0A 1EY6A 4FVMA 3V05A 4JI1L 2EIFA 2VQFQ 1MSGA 4PV1C 4JI2L 3CF5A 1VQAA 2R92B 1TXYA 3BYTB 4ZUIA 3BZCA 1LTBD 2HQEA 1JT8A 2FMMA 2QW7A 1ICWA 2MJ8A 5FK9C 1JJCB 1AW7A 1PRTD 2R3ZA 3W1GA 1RHPA 4N8X1 4PQXA 4UP7A 4WJ4A 5EBCA 1HA6A 1TWCB 3SDZA 2Z6BA 2FINB 2I07B 2VY3A 4POGA 3QWNA 4OX9Q 3K59A 5EAYA 3UDFA 1I3QB 1GHKA 4Y7NH 1MJEA 2H4OA 5HY6A 4HJ5A 1ET6A 1JQYD 4LF7Q 2EE1A 5C4XG 4F7XA 1PA6A 3HOWG 1F9PA 3M4QA 3FPUB 1CSPA 3KF6A 4JI0L 1H9KA 2CQAA 4DUZQ 1U4PA 4HJAA 2E5LL 2F0IA 3S2HH 3HS0C 2AKWB 1L1OB 1EWHA 3AMUA 4FXGC 4X62Q 1V9PA 1SLJA 4JI8Q 1IYUA 1PFSA 4DNRB 3U50C 3OW7A 1SJHD 3J81c 1EIFA 5BN4A 4B3SL 2SEBD 1JOQA 1ENFA 3MVVA 4IPDA 2E2HH 2NVXH 1KL9A 2GN5A 3SK4A 4LF8L 2B2UC 4L6TB 5M5XB 3NQIA 3KF8B 4RFBA 5TSSA 5IWAL 5EJWA 5IYCG 3HOWH 3HGBA 2HT1A 3NWSA 4C2MB 5M3FB 4CDFC 4FF4A 5FO7B 2QCPX 3GTOH 2L15A 3HOUG 3HOXG 3RUZA 1BQQT 1TS4A 2P5ZX 2A19A 3SE0A 2OWOA 2EZVA 1IYJB 1B8AA 3K7UC 1FGBD 3D4RA 1WYDA 1XNRL 5DEHA 5JJIA 3EVQA 2JXMB 4CJ0B 1EQRA 1XTDA 5I6YA 1PYBA 4DAPA 1GM5A 4A3LH 4AYBB 2F4VL 1XPUA 1PRTF 1AH9A 1H9RA 3UDXA 5IYBH 1E2VA 4QJFA 5CBEE 2IX3A 3U4ZA 2NBFA 3M3YH 1C4QA 3GP7A 3CXCA 1YNJD 1HNZQ 2UUAQ 2R92G 1C0AA 3HOUH 1YVCA 1PTOH 4R1JA 4GKJQ 1SYFA 1WTHA 2VW9A 3MZ5A 5G3LD 3J80i 2F0NA 4OO1I 1TQOA 4X3SA 4OWTB 1QUQA 4L63B 4JI3Q 3W1BA 1EU4A 4RG1A 4Z9CB 1D6EC 2EXDA 4X65L 2VS1A 1SE3A 4MTNA 4IFDI 3GTKB 4L5SA 3JAML 3H15A 4PG3A 1JE5A 3W5OA 1STGA 3GV3A 1JC7A 2EY1A 4WRDA 2EJMA 3B6YA 3VYSA 4IPHA 2WKCA 1F2YA 2AQ1B 4B3TQ 3DXJC 1DONA 4IALA 4R4CA 1X3QA 3A8KE 1EWCA 4JOIA 1I6HH 3NTIA 3GO5A 3CC7A 4A75A 2K14A 2L9HA 4L8JA 4KKSA 2K1BA 1PZJD 1VQ8A 4XIGS 5COYA 3H91A 3R3OA 4KHVA 3CCQA 4JI7L 3T56B 2A6EC 3F2CA 3DUZA 4LF5Q 1BOSA 2DN8A 2N49A 1U4LA 4LF9Q 4HJ9A 2XWBB 1PH5A 1LV9A 2B2VA 2RQXA 2K7VA 2VZAA 1A8VA 1NE3A 4JI5L 1Z6HA 1EFWA 2NZOA 3BU2A 1HZBA 3HP3A 2AQ3B 4A3CH 5M3FG 1AZPA 4TSSA 2BE5C 3GQBA 2O5JC 1IYVA 4TQUS 4ZAIA 2F0FA 2WFWA 2RCNA 1Y8NB 4LF5L 1QE6A 2EYLA 4ZKBB 3CRLC 2F4IA 3D6CA 5G3LF 2LY7A 2UXBL 5FLXL 2R7FA 3T53B 5IP9G 3RLNA 4B3MQ 4IJLA 4AYBG 5JJLA 2YYZA 4V0BA 2CKZB 2VQEL 1I6VC 1I4RA 2K5NA 1IKLA 3EROA 1V8QA 3AYHB 3Q23A 1KTKA 4DF7A 1EY8A 1AEXA 2KCMA 2E2DC 4C2MH 5M3FH 1O80A 3KK7A 2FMCA 3G7LA 5CV4A 2WAQE 1K83H 1VQNA 2IT1A 1YJ9A 3FDTA 1PYWD 4KY6A 5HGQA 2F0GA 3R8BA 4OXPA 5IP9H 3M9BA 2B63B 1D8LA 1VF5C 2LKVA 2CFMA 2SDFA 1CFMA 4A3DB 4WFN3 1EOVA 1JJ2A 3HKZB 1B9MA 1X65A 1RL2A 4IUNA 3Q8DA 2XN9C 1OO9B 4JOIC 3KJOA 1TY0A 3M4OH 4Y52H 1SE4A 3X3MA 4YHHQ 2RA4A 4P72A 1Q7YC 2I0QA 4LUOA 2OQ0A 1J5EL 1FNVA 4C3IB 2WIIB 1PH9A 1IXRA 5KYIA 3S2DB 3FEWX 1ZKOA 3CHBD 5FLMH 2K4KA 4DGZA 3K58A 3J80c 4P73A 1E2WA 1Y69U 2EYOA 2QILA 2Y0SB 3GTKH 1QOHA 1WCMB 1QVGA 3A5UA 4R4OA 5JAVA 1LT6D 1HFGA 4YHHL 5IGGA 1YHAA 4GOPC 4E6IA 1SE2A 3P7JA 4DR4L 1FD7D 3L3OC 3ONAB 1SSOA 1VQDA 4X64L 1H9MA 4YCUA 1PFMA 3BDOA 4HSPA 2MNAA 1UUPA 1WTQA 1PMRA 1A2UA 4J15A 1UNSA 3TP8A 4QIWE 2KCCA 3SK8A 1SMXA 2N8NA 2FXQA 4CKCA 1PVOA 2F0KA 2KUMA 2PZWA 4ABNA 3I8ZA 1X55A 1IKMA 1JMCA 5C44B 3U58A 2CHBD 4LFAL 1S5BD 1ZXTA 3S14B 3I73A 1KLUD 4H7BA 3KLSX 4GLXA 1A3UA 1H9SA 1EQTA 4UDUC 5ELOA 3EN2A 1S5CD 4C56C 2NWGA 2YTXA 4PZ6A 3MXGA 1N32Q 1OXXK 3CKIB 1KHIA 5CV6A 4HIKA 1BF4A 1ZYRC 4CGYB 1X3FA 1HTLD 2B63G 3EQLC 2PI2A 2L0CA 5EKLA 4BY7B 1HFNA 3MXNA 2QEXA 4A3DG 3MC0B 4LFBQ 4CHTB 2JSOA 2R7DA 3HKZG 5ELDA 2ICEC 4HIMA 1VMCA 2UU9Q 1M4VA 3MWYW 4YCVA 1STAA 1YNNC 1EZ6A 3KJPA 3PO2H 4ZRZA 4BXXH 1KNEA 2Z8LA 4C3IG 3S1QB 3V2TA 1A3VA 3J7AF 5EKIA 1D7QA 1KIXA 2VB2X 4I7ZC 3CW2C 5C0XG 3TQYA 1NY4A 2JK8A 5C4ZA 2ZTEA 4TKOB 1X3GA 2B2WC 3NBIA 4A3MB 4O42A 4QGUA 4A3DH 1NCVA 2Y0SG 3I55A 2CW0C 1WCMG 1G6PA 5E4XA 1MKHA 1G91A 4YWKA 2KHIA 2BA0A 2OTLA 2J7ZA 3A74A 4HIDA 1Q3LA 3H94A 3JAME 4IPCA 2HCCA 4DV6L 4PMBA 3LGJA 5M3MB 1BCPB 3HRZC 1EFID 3K81C 1PYSB 4DR5Q 2EQSA 4G7ZC 3D4DA 2KJXA 2A69D 3RZOB 1O7IA 2ENBA 1TS2A 2I46A 3NEMA 5LMNQ 4IO9A 1VQIA 5FKAC 3GTMB 3AB9A 4JI6Q 2F0HA 2L55A 1XPOA 3M7NA 2WINB 3G6EA 1K8OA 4DUYQ 1J6QA 4P2CB 5C0XJ 3NELA 3CC2A 4GKKL 1PHJA 1YJNA 1CSQA 3S24A 2HDLA 1HZ9A 3NP8A 5IT9c 1NAPA 4HR7B 4OWWB 5LHY1 4PZ8A 5D3DA 4ME3A 4UP8A 4AQYL 4UPAA 1NJIC 1TS3A 2QDLA 3PO3H 2PNHA 1HHVA 2UUCL 2SNMA 3P75A 4ZCKA 1VCIA 3G48A 5C44G 5I2YA 4DV0Q 1BUVT 2FHTA 2PO4A 2UUBQ 4LF6L 1ET9A 4KY7A 2PNRC 3J7AV 1ML0D 4IZ8A 3OIPA 5A35A 1FGUA 4N9TA 1IBMQ 3VYUA 1YNJC 3I7FA 3Q0AA 3MXNB 3F1ZA 4X3KA 1Q90A 1EZ8A 3S17B 1TWHB 4DV4L 1SFOB 1IL2A 2MGSA 1U4RA 4XDXA 3OHXC 4NKLA 4OEMB 3CCVA 1KRTA 4S3SA 1E1TA 4IJHA 3HOYB 4BY7G 1HUMA 4FF2A 1HRJA 1BVSA 2JA9A 5FLXE 2ZT9C 5C44H 4LF4L 3NE5B 2EY6A 1NMFA 4KY5A 2KA7A 3SK5A 3OPOA 4JI1Q 4RGTA 4DAYA 1TKWB 3F2DA 4PMWA 4JI2Q 1RCVD 1T9HA 1BKBA 3FP9A 1GOZA 3KBXA 3KFUA 5EPKA 2K28A 3GTLH 1MSHA 4BBRB 5LMNW 2RDGA 2IHFA 2K5DA 3PMFA 4JV5L 4DV3L 3K0XA 2MFIA 1F9RA 2PPBC 1K0RA 3KLWA 5CR3A 1YITA 4XQNA 1RIPA 1GUGA 4GN4B 1C8CA 4A3GB 3CCJA 5KEEA 2F3IA 1XTCD 2Z1CA 4DK3C 5C4HA 1L0YB 1DXMA 1CI3M 1KXLA 4BY7H 4A3MG 4IFDJ 4A93H 2EYPA 1LTTD 2IPKD 4DR2L 1J8IA 3SEBA 3KDFA 1X6OA 1LACA 4JYAL 1UE1A 1PTOC 4DV2L 1F9QA 5IP7G 1M1KC 3R2IA 1VQEA 5GROA 4RHRA 1G2TA 1WTOA 1LABA 5M3MG 4DV5L 2Q8RE 1R4QB 4XYQA 1DD2A 3GTQB 2UXCL 2B2YA 3SHLA 4DR6L 1FVIA 2K52A 2JJQA 2EYJA 3NK9A 5D65A 3BZDB 3VA7A 1HNXL 3PGZA 1VQ9A 4JI0Q 2XNAC 2E5LQ 1HZAA 2E76C 5LL6X 4A3MH 1CHPD 1NBWA 3P20A 4MN3A 3GV6A 1SNOA 1P8LA 1GHJA 5LL6S 1ILPA 3F8TA 1PFNA 4EVOA 5JPNC 2AWOA 2LMCB 4B3SQ 4RGNA 1V1PA 3URYA 3VA5A 4OGQC 1N33L 2MP1A 1E2ZA 5IP7H 1VQJA 1BBUA 2Z4IA 2IWHA 1QZHA 4FXKC 4HEDA 1B50A 5M3MH 2Q2HA 1SXTA 2SNSA 4UP9A 4LF8Q 4NB3A 4QMGA 1DOLA 3RMHA 1DOMA 1LT5D 1DYQA 3RZOH 3HOZB 2IX1A 3PQIA 1JR0D 3TZDA 4NXMQ 5IWAQ 3K6OA 4FF1A 2A68C 2B8GA 1A63A 1OXUA 3GTJH 4L5RC 1RJTA 3CAMA 1EIYB 1YBYA 1XNQL 5IIFA 5C3WA 3PV0A 1ZEQX 1PZKD 3S16B 1C48A 1CKNA 4DAMA 5AJ3L 4DAYB 1KNAA 1CA6A 1XNRQ 1D1KA 2E2JH 1PH1A 1ENCA 1G291 1TS5A 3JC66 3SR1A 1N36L 3STBD 2F4VQ 3HOYG 4NXML 4FXDA 5C4XH 4RKBA 1VDZA 3NPPA 1K8GA 3UDIA 2PYKA 4A76A 3W3AA 1S72A 4H0LC 4CBVA 1STNA 2N3SA 2YV5A 2JQOA 5BN5A 5ELEA 4WJ3M 1FNUA 4IN3A 3FHWA 4BBRG 1CT1D 3H3VC 3S17H 1GD7A 1Q1BA 3F2UA 1RODA 2AWNA 4HAEA 3D4WA 3TP5A 5C4JB 1SFOH 1AN8A 3TDQA 4U68A 4QUCA 3DM1A 4UHVA 1BCPD 3Q6SA 3WWVA 1YJWA 4A3GG 4BY1B 2XTIA 1HH2P 2WKDA 5FJ8G 3PUXA 5CORA 2KEDA 1TR5A 2NVQH 3MXPA 5IYCH 2K5QA 2BH2A 4X65Q 4P74A 1C9OA 1NUCA 4WJWA 3I4MB 1FR3A 3HOXH 4AYBE 1I4QA 1U9RA 2B2YC 3FKIB 5FOBB 2HDMA 4BBRH 2RKSA 1Z9FA 2ZJRA 1A2TA 1HCZA 2PW5A 2IX0A 5KNCA 5CMDA 4JPBW 4A3IB 2Z0SA 3KBGA 1GUSA 3PUZA 3VR4A 4DAVA 5CV8A 1XJVA 4QY7A 4A3EB 3PSIA 3CMEA 1G6ZA 3RLFA 3EBEA 4DR1L 5LMUL 1RTOA 5C5LA 2KQ3A 3EIVA 1D5ZC 4GN5A 1GKHA 1TWFB 4FYDA 3G6JB 5IGEA 4JI7Q 3QIAA 4CJ1B 4X66L 2R93B 3CMAA 3KF6B 2R92H 5JVG3 2NTSA 2K04A 2R7ZB 3M4YA 4QCLA 2BDNA 2HUGA 1B44D 4BBSB 4NXNL 1FJGL 2D0OA 1EY5A 2E2IB 4KKTA 1M90C 4JI5Q 3HOZG 1CKNB 3GTQH 4Q5VA 1WOCA 1A3TA 2B2TC 1SYEA 3V96A 4GNXA 2QEJC 4CJ2C 3A0JA 3I4OA 5M5YB 2A74C 3IL8A 4KKUA 3ND9A 2KVMA 1NSNS 3VR5A 1TWCH 1EUJA 3R93A 1VQOA 1VQLA 4O1NA 2R61A 1TVXA 4M1UB 1EQVA 3I2ZA 1UWVA 2M9VA 5DNFA 4EQNA 2UXBQ 1I3QH 4DK6C 3VDYA 4K5XA 2GA4B 3ULLA 2OF1A 3A56A 1BCPF 2F0WA 3A54A 3DLLA 1AFPA 2EYHA 2OCEA 2VQEQ 3TS0A 3C1EA 1AP0A 3J7YW 2DY8A 4GOPA 3HG9A 1E1OA 1SDFA 2K01A 1WTVA 3U9SA 2ZXRA 4RMFA 3NBHA 2DJFC 4WORA 2XIWA 3MHBA 4KN4C 5F2DA 1S4ZA 4JBJA 4RA8A 4DXFA 2JEAI 3J7A5 1GVPA 3S16H 2D9UA 2V4DA 3C1FA 1K3RA 4B08A 3BYYB 1SROA 2WP8J 3D0FA 1BO0A 2RHSB 1Q81C 4K2KA 4BY1G 1O7ZA 4XT3B 5IE8A 1Y14B 3HZXA 5M5XH 2K50A 2MUYA 1QNUA 3CCLA 1SN8A 4DN4M 3C3LA 2RDFA 1N34L 2ZJQA 2OTJA 4QF4A 3TS2A 3Q24A 4GLAC 4LUVA 2G9DA 3MAQA 1QUQB 1B1ZA 1QB5D 5KIXA 1QZGA 3I4MG 5KNDA 2MQHA 2JN4A 4NDXA 3FKIG 4XTCS 1LLRD 2RSOA 1LTID 4RKLA 4KTAA 4BS9A 3OWEB 3OTOL 5A2QL 1QNKA 2ZM6L 2I5LX 4A3IG 4JI4L 2A6HC 1NR4A 1J5EQ 2H1EA 5IOCA 5CV5A 3D31A 4JG2A 5ELNA 1IW7C 2NB0A 5HGTA 1Y8OB 4BY1H 1SYDA 4A3EG 1O7LA 1Q82C 2NN6G 2N88A 3EFXD 1Y1WB 4DR7L 5M5WB 2EYFA 4DXGA 5I2XA 1HQRD 2R93G 4DK1A 1G8ZD 2BCOA 4KHZA 2F52A 1D5MC 3MFGA 4P75A 1KD1C 1D1IA 2R7ZG 1SNPA 5C5MA 3LX0A 2MPMA 2DNEA 4RH6A 2VXWA 4K2LA 3AU7A 4BBSG 1YHBA 4LMQD 1Y1VB 1STEA 3HKZE 3U4VA 4GNXC 2QKIC 4DR4Q 4A3IH 4X64Q 1HNWL 2F3VA 5CYUA 1JWSD 3T51B 1I5FA 4A3EH 2WACA 2NN6H 3J81L 1CUKA 3S15B 1DZ1A 4PMCA 2AMCB 4MZ9A 4GOPB 4RCNA 4V190 4CDDC 3CC4A 4JBMA 1ASYA 2B2WA 1IBKL 5CC4A 3RR5A 2LSSA 5JVH3 2K75A 1XYIA 1CM9A 2R7ZH 5IGDA 1SYBA 4POFA 1CHQD 4EQOA 3CCMA 3QR8A 3H0GB 4RGOS 1F9SA 5IODA 2A8VA 4BBSH 1GUOA 2Y0SE 4DA2A 3PIO3 3JAMi 2K5WA 4LFAQ 1KAAA 5DLQE 4HJ8A 4LUZA 5BR8L 1SMYC 2BDOA 3ULPA 1GO3E 5M5YH 2OQKA 4B9XA 4HCSA 4HMIA 2JA6B 1V1OA 4OWXB 4HN7A 2Z9HA 3TP6A 4QUFA 2LXKA 2NTTA 3RZDB 4H02A 3BZKA 2MO0A 5E4WC 1Y8PB 1XWEA 1TWAB 2QF7A 3HEJA 1BNZA 4KV6A 3M85A 3WDNA 3M7GA 1SNQA 3T4AC 3K7AB 1Q12A 3BG3A 3UDGA 4TVAB 3WOFA 4O0AA 2NZHA 3OSOA 4ZUJA 3OOCA 1PH4A 4DR3L 3CQZB 3IKJA 1A6XA 3VYTA 4J8QA 3PUVA 1A62A 5EPLA 5GAHC 3OW2A 2IW3A 4HTHA 5J39A 1LUZA 3NHHA 3TREA 1PRTC 3HKSA 2JA8B 3I70A 2Q2TA 1MGSA 1Y1WG 4IOCA 2HCIA 4A4IA 2A6ED 1LT3D 5KNBA 3ERQA 4G7OC 1IBLL 5AFWA 5JPMC 3I56A 1VQMA 4DKAC 1O7YA 3MTSA 3DWQA 3T1HL 3BVMA 3TMEA 2DGYA 4G4KA 3NTHA 4MTKA 4A3FB 3GTPB 1L0WA 4DV6Q 4IUTA 1Y1VG 2C9OA 2FFKB 1DM0B 1LTAD 4F87A 2KEEA 4QL5A 2BE5D 2ZTCA 3MXUA 2J4XA 4BA1I 2B63H 4BA2I 4DV7Q 4CKBA 5CBAE 2EY5A 2F0JA 4DNTB 5DM73 2TMPA 1HR0L 5FO8B 2K03A 3BDCA 3KLRA 2F3WA 1JWMD 2PMZB 5M5WH 3CCRA 4EGVA 4EX5A 4JVZA 4GKKQ 3EJIA 5IT9E 2ATWA 4K0KL 4ZKCB 4OONA 4RWSC 4CDCC 1XPRA 2MHVA 4KHPL 1ASZA 2KHJA 2I5MX 3NENA 3D8GA 3IAYA 1E0BA 4AQYQ 1SYGA 3H0GG 1JORA 2SOBA 4BWGB 2UUCQ 4HJ7A 4C3IH 4DV1L 3AQQA 4LK1C 4DV7L 2O2LD 4YWLA 2WB1B 3S2DH 1ENAA 4LF6Q 3E6ZX 5ISRA 4KJOA 5C0XH 4YY3L 2ES2A 2NVTB 3CRKC 1MI2A 3P1HA 2JA6G 3K0YA 3L9AX 1I94L 5J22A 1WCMH 3ITPA 3E3XA 1ONLA 4TRDA 3S1NB 4DV4Q 3ICEA 1S5DD 1PH8A 1H9SB 4LFCL 1V43A 5GAGC 1CZWA 4JBWA 3J81i 3CCUA 3S2HB 1VQ6A 4UAIA 3H0GH 1F77A 1B7YB 1EY4A 3DEOA 2NN6I 4LWCA 5J3BA 4OHJA 1TWGB 1FYCA 4LF4Q 4QB4A 1ICFB 1KLGD 3RNUA 5DM63 2X69A 3VR2A 3N52A 3JAMc 1PH6A 2QDBA 4N8FA 2ID0A 2V1CC 4KD3A 2KHSA 3PIP3 1Z47A 2JA6H 4OO1G 3IFDA 4JBKA 1WFQA 4KN7C 4G57A 2JP1A 4JV5Q 3RZDH 3HOWB 4DV3Q 3HFZB 1CKMA 2JA7B 1WTPA 1L0XB 2A73B 2YU9B 2JA8G 1I50B 1IL8A 1TWAH 4IFDG 4HIOA 1ESFA 5KGUA 4NPSA 1P16A 3G71A 3K7AH 4NW2A 5ELFA 3S14H 2K33A 3VR6A 4DR2Q 4K5VA 3SVMA 1X32A 4XYOA 2FJ2A 4JYAQ 3ZYYX 4DV2Q 4A3FG 4R9WA 1X3PA 1L1OA 3T1YL 3VYRA 5IGFA 1QILA 4DV5Q 2OXPA 3NUCA 1A0IA 2NZ1D 3R2TA 4XQQA 3CP0A 2VL6A 3J80L 1HXYD 5L37A 1M8AA 2UXCQ 3M3YB 2OT2A 1AE2A 4DR6Q 2BH8A 5A2QE 2F1MA 1W6KA 3K5LA 1PTOB 1HNXQ 3S1MB 2HIVA 2KCTA 5IY0A 1S3OA 1BXTA 2K05A 3UE1A 3IRBA 3T13A 3AFPA 3PUYA 2JA5B 3PF4A 1J9OA 5JEAJ 2UXDL 3PIOA 1N33Q 3GTPH 4Q0FA 1WTRA 5FLXc 3GD7A 1HJPA 2EY2A 2L1BA 3L7ZC 3S1QH 4ZK9B 2WB1G 1XMOL 1CQFA 3OMCA 4K6DA 3QOJA 4LAAA 4KI0A 4FP5D 2Q2UA 1Z7TA 4K5WA 1B4OA 1JICA 1X9NA 1XNQQ 2HHHL 3CPFA 4B3RL 4ODGA 1EYDA 2RBMA 4LJZC 1I6HB 1ZYRD 3J81E 1EYAA 5AJ3Q 2EVBA 1S5ED 3U9OA 1CK1A 1EY7A 3UI2A 1HQMC 5I6WA 2EOTA 2QA4A 2GVBA 1N36Q 2CCZA 2VQFL 1U4MA 2D0PA 5JJKA 1UEAB 1LTRD 1I4XA 3GTMH 1EYGA 1H95A 1F2LA 1HTPA 2F0EA 3J7ZC 1PV4A 1YNND 3L2PA 3PUWA 2EJGC 2NVTH 2B2TA 1ESRA 2GVAA 3D3RA 1CKOA 4R8NA 3EA6A
chains in the Genus database with same CATH topology
1DOKA 2O4XA 3NXWA 1D2BA 2K6AA 1B2TA 4R8IA 5C3XA 5C3EB 2CW0D 5C0XI 4HSVA 4ZLTF 1PXUA 4FF3A 2LS01 1PLFA 2ICIA 1BBXC 1EY9A 4RHSA 3BVZA 4K6LA 1I4PA 4RGMA 3DEPA 3H09A 3QG1A 4J1MA 2AQ2B 1JB3A 3A8JE 4CKEA 4JK1C 1IHZA 1QG7A 2VNUD 3MFYA 2M00A 1O78A 3TBIB 1K83B 5E1FA 4IUUA 3FVQA 2D62A 1B3AA 3DHQA 3LWEA 4NP5A 1R9TB 2EXZA 4HCEA 3TP7A 5EQ0A 2Q8TA 1SJED 3T16A 2G9HD 1HPCA 4YIJA 1MBYA 1RF2D 1RTNA 3K57A 2D2CC 5NUCA 4OIJA 1EY0A 5D3IB 3WOEA 1V1PB 3RD4A 4C3JB 2AUKA 3NQTA 5IT9L 4H13C 1BR9A 1FNWA 2RVLA 4X3TA 3M4OB 3DWPA 4DU9A 1EOTA 3K5MA 3QOLA 1XXGA 3ND8A 3O13A 4NMZA 2NUCA 4K14A 2EPBA 3D6WA 2NYZD 1JWUD 2M2LA 2PZTA 2J0TD 1SNDA 1SBBB 1QCBD 3GTGB 5D14A 1STHA 4C3HB 1GUNA 2DY7A 4H44C 2CVRA 1JOOA 2JE6I 1EEID 1KDAA 3I3CA 1R4PB 4IUPA 4PNYA 2EDGA 3TN2A 1EU3A 3H6MA 3K5OA 2BA1A 3C46A 1DCZA 1KDBA 1RD9D 3FPPA 1PTOD 2PCFB 2XWJB 3OWFA 4DK0A 1SYCA 2JEBI 2F0LA 4GZYC 2EJFC 2X6GA 3A55A 1I4GA 1JE4A 2F0QA 2KOLA 1KDCA 5I9PA 4IUVA 3TZUA 1KABA 3OMGA 2F0DA 3I72A 3S1RB 1PDQA 1OXSC 3N6RA 4KMUC 3QO2A 4EQPA 2LFNA 1PZID 4F88A 4U673 2F03A 1WTWA 1AZQA 1STYA 4KJNA 2IL8A 3LWUA 4B9WA 3I90A 2WAQB 1D5XC 2DNCA 4XT1B 1LT4D 1WD0A 2PZUA 1GUTA 5T1GA 1B53A 2A69C 2A68D 1OXVA 2L12A 2Z4HA 3I91A 4C3JG 1WTXA 5JJZA 1XX8A 1EIGA 3J80E 1H9JA 3I4LA 3PO2B 5CV9A 1EIHA 2L4NA 2PQEA 5I4DA 1RDPD 5EBDA 2D5DA 1CZGA 2AUJD 5BN3A 2BOSA 1TT2A 1PTOF 3X3NA 3NWTA 5I9OA 4C3HG 4XQJA 2ZXPA 3I4NB 3BVGA 2ZXOA 1T5EA 4ID6A 3SXHA 2K32A 4KD4A 3NTKA 2L11A 3BS1A 1PFBA 4X3UA 1I4HA 2B39A 3TSSA 2O5IC 5EKKA 4MIUA 4IUQA 2B2VC 4KK7A 4OIKA 2E75C 1LO5D 3PO3B 1OXTA 2B8FA 4QIWB 1NR2A 3A8IE 1Q1EA 1QWYA 1TY2A 3DMUA 1GXDC 2IJ0A 2VB3X 4ZQ3A 2F0OA 1K8MA 4A3KB 4HMJA 4A3BB 2NVYB 3MEHA 3FMCA 1TIID 2L5TA 4A3JB 1HUNA 2XRQD 1PRTB 3KLSA 3HOVB 3VR3A 1W6JA 5KRUA 1T5XD 2VUMB 1B9NA 1EYCA 2F0SA 2F0PA 3C2PA 3GTLB 1SAPA 3OIQA 2XRSD 1A15A 1CTMA 1F2ZA 5EGTA 2F0MA 2XVSA 4XXEA 5ELBA 5IGBA 4FNFA 4A93B 1JCKB 4ULLA 1WD1A 4ME5A 5FO9B 1MD2D 2XSCA 1EEFD 5HURA 2RSNA 2F0UA 2F0TA 1GUWA 4N9PA 3S9WA 2E74C 4M8AA 3W2DA 4ZYSA 4DFAA 4RAUC 5IGCA 4G7HC 1CQVA 5DAUA 5KYLA 3E5SA 1Q8IA 3A7LA 1LTSD 2A5HA 2X6LA 4Y7NB 4F8MA 5K36G 1F2MA 2R6GA 2A6HD 3LNNA 5CV7A 1RKNA 1S5FD 1IW7D 1BCPC 2N55A 2JYOA 3MA2B 3GTJB 5EPJA 3A7AB 3NSWA 1SEBD 1G2SA 2Q8IB 1LTGD 3FRPB 3CU7A 1VMPA 2E2JB 5CGKA 2E2HB 3IFTA 2NVXB 4J6HA 2KECA 3QJYA 5T1IA 5K36H 5C4XB 1JOKA 3E0JA 3DWAA 3GTOB 2F0VA 1DJRD 1SNMA 1STBA 1GJXA 1HA5A 3QB3A 3Q22A 2PW7A 4IQZA 5J1ZA 2RDHA 3BDLA 1BDOA 4OL7A 1QJOA 4RCOA 5JOBA 5JEAG 2OEOA 2WV6D 1ILQA 4IURA 5E3FA 3SK6A 2EYMA 3KUPA 1SNCA 2KCNA 4OO1H 2NVQB 4MHEA 1TU2B 2B2UA 5K5PA 1SMYD 5M9OA 1CA5A 1WVLA 3HOUB 3HOXB 4IFDH 4C1NK 4ILWA 4I65A 1VF7A 3KF8A 2TSSA 2C5CA 4K8IA 4C1NI 5C6AA 3K5NA 4K8JA 1UAPA 1II3A 5JEAH 4FO2A 1EL0A 5ELCA 1EY6A 4FVMA 3V05A 1MSGA 4PV1C 2R92B 3BYTB 4ZUIA 1LTBD 2HQEA 2FMMA 1ICWA 2MJ8A 5FK9C 1AW7A 1PRTD 2R3ZA 1RHPA 4PQXA 5EBCA 1HA6A 1TWCB 3SDZA 2FINB 2I07B 3QWNA 3K59A 1I3QB 1GHKA 2H4OA 1ET6A 1JQYD 2EE1A 4F7XA 1F9PA 3FPUB 1H9KA 2CQAA 1U4PA 2F0IA 3HS0C 1EWHA 3AMUA 4FXGC 1IYUA 4DNRB 3OW7A 1SJHD 5BN4A 2SEBD 1JOQA 1ENFA 3MVVA 3SK4A 2B2UC 4L6TB 5M5XB 3NQIA 4RFBA 5TSSA 5EJWA 3HGBA 3NWSA 4C2MB 5M3FB 4FF4A 5FO7B 2QCPX 3RUZA 1BQQT 1TS4A 3SE0A 2EZVA 1FGBD 3D4RA 5DEHA 3EVQA 2JXMB 4CJ0B 5I6YA 4DAPA 4AYBB 1PRTF 1H9RA 1E2VA 5CBEE 2IX3A 2NBFA 1C4QA 3GP7A 1YNJD 1PTOH 1SYFA 3MZ5A 5G3LD 2F0NA 4OO1I 1TQOA 4X3SA 4L63B 1EU4A 4Z9CB 1D6EC 1SE3A 4IFDI 3GTKB 3JAML 1STGA 3GV3A 1JC7A 2EY1A 4WRDA 2EJMA 3VYSA 2WKCA 1F2YA 2AQ1B 3DXJC 1DONA 4IALA 1X3QA 3A8KE 1EWCA 3NTIA 3GO5A 2L9HA 4L8JA 4KKSA 2K1BA 1PZJD 4XIGS 5COYA 3H91A 3R3OA 4KHVA 3T56B 2A6EC 3DUZA 1BOSA 2DN8A 1U4LA 2XWBB 1LV9A 2B2VA 2RQXA 2K7VA 1Z6HA 3HP3A 2AQ3B 1AZPA 4TSSA 2BE5C 3GQBA 2O5JC 1IYVA 4TQUS 4ZAIA 2F0FA 1Y8NB 1QE6A 2EYLA 4ZKBB 3CRLC 2F4IA 3D6CA 5G3LF 2LY7A 5FLXL 3T53B 2YYZA 4V0BA 1I6VC 1I4RA 1IKLA 3EROA 1V8QA 3Q23A 1KTKA 4DF7A 1EY8A 1AEXA 2E2DC 1O80A 3KK7A 2FMCA 3G7LA 5CV4A 2IT1A 3FDTA 1PYWD 4KY6A 2F0GA 3R8BA 2B63B 1VF5C 2LKVA 2SDFA 1CFMA 4A3DB 4WFN3 3HKZB 1B9MA 4IUNA 2XN9C 1OO9B 1TY0A 1SE4A 3X3MA 2RA4A 1FNVA 4C3IB 2WIIB 5KYIA 3S2DB 3FEWX 1ZKOA 3CHBD 4DGZA 3K58A 1E2WA 1Y69U 2EYOA 2QILA 2Y0SB 1QOHA 1WCMB 5JAVA 1LT6D 1HFGA 5IGGA 4E6IA 1SE2A 3P7JA 1FD7D 3L3OC 3ONAB 1SSOA 1H9MA 1PFMA 3BDOA 4HSPA 1UUPA 1WTQA 1PMRA 1A2UA 1UNSA 3TP8A 2KCCA 3SK8A 4CKCA 2F0KA 2KUMA 2PZWA 4ABNA 3I8ZA 1IKMA 5C44B 2CHBD 1S5BD 1ZXTA 3S14B 3I73A 1KLUD 4H7BA 3KLSX 1A3UA 1H9SA 1EQTA 4UDUC 1S5CD 4C56C 2NWGA 3MXGA 1OXXK 3CKIB 5CV6A 1BF4A 1ZYRC 4CGYB 1HTLD 3EQLC 2L0CA 5EKLA 4BY7B 1HFNA 3MXNA 3MC0B 4CHTB 2JSOA 5ELDA 2ICEC 1VMCA 1M4VA 3MWYW 1STAA 1YNNC 1EZ6A 4ZRZA 1KNEA 2Z8LA 4C3IG 3S1QB 3V2TA 1A3VA 3J7AF 5EKIA 2VB2X 4I7ZC 5C0XG 5C4ZA 4TKOB 2B2WC 3NBIA 4A3MB 4O42A 1NCVA 2CW0C 5E4XA 1G91A 2BA0A 2J7ZA 1Q3LA 3H94A 3JAME 2HCCA 4PMBA 5M3MB 1BCPB 3HRZC 1EFID 4G7ZC 3D4DA 2KJXA 2A69D 3RZOB 2ENBA 1TS2A 2I46A 5FKAC 3GTMB 3AB9A 2F0HA 2L55A 3M7NA 2WINB 1K8OA 4P2CB 5C0XJ 2HDLA 3NP8A 1NAPA 4HR7B 5LHY1 5D3DA 1TS3A 1HHVA 2SNMA 3P75A 1VCIA 5I2YA 1BUVT 2FHTA 2PO4A 1ET9A 4KY7A 2PNRC 3J7AV 1ML0D 4IZ8A 3OIPA 5A35A 4N9TA 3VYUA 1YNJC 3Q0AA 4X3KA 1Q90A 1EZ8A 3S17B 1TWHB 1SFOB 2MGSA 1U4RA 4XDXA 3OHXC 4NKLA 4S3SA 3HOYB 1HUMA 4FF2A 1HRJA 5FLXE 2ZT9C 3NE5B 2EY6A 4KY5A 2KA7A 3SK5A 3OPOA 4DAYA 4RGTA 1TKWB 4PMWA 1RCVD 3KBXA 1GOZA 5EPKA 2K28A 1MSHA 4BBRB 2RDGA 2K5DA 3PMFA 1F9RA 2PPBC 5CR3A 4XQNA 1GUGA 1C8CA 4A3GB 5KEEA 1XTCD 2Z1CA 5C4HA 1L0YB 1DXMA 1CI3M 4IFDJ 2EYPA 1LTTD 2IPKD 1J8IA 3SEBA 1LACA 1PTOC 1F9QA 3R2IA 4RHRA 1G2TA 1WTOA 1LABA 2Q8RE 1R4QB 4XYQA 1DD2A 3GTQB 2B2YA 3SHLA 3NK9A 2EYJA 5D65A 3BZDB 3VA7A 2XNAC 2E76C 5LL6X 1CHPD 3P20A 4MN3A 3GV6A 1SNOA 1GHJA 5LL6S 1ILPA 1PFNA 4EVOA 5JPNC 2AWOA 2LMCB 4RGNA 1V1PA 3URYA 3VA5A 4OGQC 2MP1A 1E2ZA 2Z4IA 2IWHA 4FXKC 4HEDA 1B50A 1SXTA 2SNSA 4QMGA 1DOLA 3RMHA 1DOMA 1LT5D 1DYQA 3HOZB 2IX1A 1JR0D 3TZDA 3K6OA 4FF1A 2A68C 2B8GA 1OXUA 1RJTA 5IIFA 5C3WA 3PV0A 1ZEQX 1PZKD 3S16B 1C48A 1KNAA 1CA6A 1D1KA 1ENCA 1G291 1TS5A 3SR1A 4FXDA 4RKBA 1VDZA 3NPPA 2PYKA 3W3AA 4H0LC 4CBVA 1STNA 5BN5A 5ELEA 1FNUA 4IN3A 1CT1D 3H3VC 1Q1BA 3F2UA 1RODA 2AWNA 4HAEA 3D4WA 3TP5A 5C4JB 1AN8A 3TDQA 4U68A 4QUCA 3DM1A 1BCPD 3Q6SA 4BY1B 2WKDA 3PUXA 5CORA 2KEDA 1TR5A 3MXPA 2K5QA 4WJWA 1NUCA 3I4MB 1FR3A 1I4QA 1U9RA 2B2YC 3FKIB 5FOBB 2HDMA 2RKSA 1A2TA 1HCZA 2PW5A 2IX0A 5KNCA 5CMDA 4A3IB 3KBGA 1GUSA 3PUZA 3VR4A 4DAVA 5CV8A 4A3EB 1G6ZA 3RLFA 1RTOA 5C5LA 2KQ3A 1D5ZC 1TWFB 4FYDA 3G6JB 5IGEA 2R93B 3QIAA 4CJ1B 5JVG3 2NTSA 2K04A 2R7ZB 3M4YA 4QCLA 2BDNA 2HUGA 1B44D 4BBSB 1EY5A 2E2IB 4KKTA 4Q5VA 1A3TA 2B2TC 1SYEA 3V96A 2QEJC 4CJ2C 5M5YB 2A74C 3IL8A 4KKUA 3ND9A 2KVMA 1NSNS 3VR5A 3R93A 4O1NA 2R61A 1TVXA 4M1UB 1EQVA 2M9VA 5DNFA 4EQNA 4K5XA 2GA4B 2OF1A 3A56A 1BCPF 2F0WA 3A54A 1AFPA 2EYHA 1AP0A 3C1EA 3J7YW 2DY8A 3HG9A 1SDFA 2K01A 1WTVA 3U9SA 2ZXRA 3NBHA 4WORA 2XIWA 3MHBA 4KN4C 5F2DA 1S4ZA 4RA8A 4DXFA 2JEAI 2D9UA 2V4DA 3C1FA 4B08A 3BYYB 2WP8J 1BO0A 4K2KA 1O7ZA 4XT3B 3HZXA 2MUYA 1QNUA 4DN4M 3C3LA 2RDFA 4QF4A 3Q24A 2G9DA 3MAQA 1B1ZA 1QB5D 5KIXA 5KNDA 4NDXA 4XTCS 1LLRD 2RSOA 1LTID 4RKLA 4KTAA 4BS9A 3OWEB 5A2QL 1QNKA 2A6HC 1NR4A 2H1EA 5IOCA 5CV5A 3D31A 5HGTA 1IW7C 2NB0A 1Y8OB 1SYDA 1O7LA 2NN6G 2N88A 3EFXD 1Y1WB 5M5WB 2EYFA 4DXGA 5I2XA 1HQRD 4DK1A 1G8ZD 2BCOA 4KHZA 1D5MC 3MFGA 1D1IA 1SNPA 5C5MA 3LX0A 2MPMA 2DNEA 4RH6A 2VXWA 4K2LA 3AU7A 4LMQD 1Y1VB 1STEA 2QKIC 2F3VA 5CYUA 1JWSD 3T51B 2WACA 2NN6H 3J81L 3S15B 1DZ1A 4PMCA 4RCNA 4V190 2B2WA 5CC4A 5JVH3 1XYIA 1CM9A 5IGDA 1SYBA 1CHQD 4EQOA 4RGOS 3H0GB 1F9SA 5IODA 1GUOA 4DA2A 3PIO3 2K5WA 1KAAA 1SMYC 2BDOA 4B9XA 4HCSA 4HMIA 2JA6B 1V1OA 4HN7A 3TP6A 4QUFA 2NTTA 3RZDB 5E4WC 1Y8PB 1XWEA 1TWAB 2QF7A 3HEJA 1BNZA 4KV6A 3M85A 3WDNA 3M7GA 1SNQA 3T4AC 3K7AB 1Q12A 3BG3A 3WOFA 3OSOA 4ZUJA 3OOCA 3CQZB 3IKJA 1A6XA 3VYTA 4J8QA 3PUVA 5EPLA 2IW3A 4HTHA 5J39A 3NHHA 1PRTC 2JA8B 3I70A 1MGSA 2HCIA 2A6ED 1LT3D 5KNBA 3ERQA 4G7OC 5AFWA 5JPMC 1O7YA 3MTSA 3DWQA 3BVMA 3TMEA 4G4KA 3NTHA 3GTPB 4A3FB 4IUTA 2C9OA 2FFKB 1DM0B 1LTAD 4F87A 2KEEA 2BE5D 3MXUA 2J4XA 4BA1I 4BA2I 4CKBA 5CBAE 2EY5A 2F0JA 4DNTB 5DM73 2TMPA 5FO8B 2K03A 3BDCA 3KLRA 2F3WA 1JWMD 2PMZB 4EGVA 3EJIA 5IT9E 4ZKCB 4RWSC 2MHVA 3D8GA 3IAYA 1E0BA 1SYGA 1JORA 2SOBA 4BWGB 4LK1C 2O2LD 2WB1B 1ENAA 3E6ZX 5ISRA 4KJOA 5C0XH 2NVTB 3CRKC 1MI2A 3P1HA 3K0YA 3L9AX 5J22A 3ITPA 1ONLA 4TRDA 3S1NB 1S5DD 1H9SB 1V43A 1CZWA 4JBWA 3S2HB 4UAIA 1F77A 1EY4A 3DEOA 2NN6I 4OHJA 1TWGB 1FYCA 4QB4A 1KLGD 5DM63 2X69A 3VR2A 3N52A 2QDBA 2ID0A 4KD3A 2KHSA 3PIP3 1Z47A 4OO1G 3IFDA 4KN7C 4G57A 2JP1A 3HOWB 2JA7B 1WTPA 1L0XB 2A73B 2YU9B 1I50B 1IL8A 4IFDG 1ESFA 5KGUA 4NW2A 5ELFA 2K33A 3VR6A 4K5VA 3SVMA 1X32A 4XYOA 2FJ2A 3ZYYX 4R9WA 1X3PA 3VYRA 5IGFA 1QILA 2OXPA 3NUCA 2NZ1D 4XQQA 3R2TA 3J80L 1HXYD 1M8AA 3M3YB 2OT2A 5A2QE 2F1MA 1W6KA 3K5LA 1PTOB 3S1MB 1BXTA 2K05A 3T13A 3PUYA 2JA5B 1J9OA 5JEAJ 4Q0FA 1WTRA 3GD7A 2EY2A 2L1BA 3L7ZC 4ZK9B 1CQFA 3OMCA 4K6DA 3QOJA 4LAAA 4KI0A 4FP5D 1Z7TA 4K5WA 1B4OA 1JICA 4ODGA 1EYDA 2RBMA 4LJZC 1I6HB 1ZYRD 3J81E 1EYAA 2EVBA 1S5ED 3U9OA 1CK1A 1EY7A 3UI2A 1HQMC 5I6WA 2EOTA 1U4MA 1UEAB 1LTRD 1I4XA 1F2LA 1HTPA 2F0EA 1YNND 3PUWA 2EJGC 2B2TA 1ESRA 3D3RA 4R8NA 3EA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K33 A;  4RCN A;  3VR6 A;  1I6V C;  2KCC A;  1Q1B A;  1V8Q A;  2D5D A;  3IFT A;  3U9S A;  2BE5 D;  1B9N A;  3MXU A;  4G7Z C;  2A69 D;  4BA1 I;  3QJY A;  4BA2 I;  5K36 H;  1LAC A;  1GUN A;  4H44 C;  3SDZ A;  3AB9 A;  2AUJ D;  3M7N A;  4DNT B;  2JE6 I;  5BN3 A;  4KN4 C;  3KLR A;  1K8O A;  1GUO A;  3PUX A;  1LAB A;  1CTM A;  2EDG A;  2JEA I;  1GHK A;  2YYZ A;  2V4D A;  2IT1 A;  1DD2 A;  1GJX A;  4HR7 B;  2BA1 A;  4IQZ A;  1SMY C;  2F1M A;  1FR3 A;  2BDO A;  1DCZ A;  1T5E A;  3I73 A;  3QG1 A;  3VA7 A;  1BDO A;  2K32 A;  1QJO A;  3FPP A;  1H9S A;  3A8J E;  5JEA G;  1VF5 C;  2EJM A;  2E76 C;  1H9K A;  2PCF B;  4DK0 A;  1HCZ A;  4JK1 C;  3P20 A;  5KNC A;  4LK1 C;  2JEB I;  1VCI A;  4GZY C;  2EJF C;  3PUY A;  1CFM A;  3MFY A;  1GHJ A;  1EWH A;  3DXJ C;  1GUS A;  1O78 A;  4OO1 H;  1OXX K;  3PUZ A;  3A8K E;  5C0X H;  2PNR C;  1Y8P B;  1B9M A;  2AWO A;  1IYU A;  3VR4 A;  2LMC B;  5KND A;  5A35 A;  4DNR B;  2D62 A;  3CRK C;  3OW7 A;  3TZU A;  2QF7 A;  2O5I C;  1ZYR C;  4OGQ C;  5BN4 A;  1E2Z A;  3GD7 A;  4XTC S;  1TU2 B;  3L7Z C;  3M85 A;  1YNJ C;  3EQL C;  3WDN A;  3RLF A;  2E74 C;  4L8J A;  3I72 A;  1Q12 A;  4KKS A;  3BG3 A;  1ONL A;  4IFD H;  4XIG S;  1HPC A;  1OXS C;  1Q90 A;  2E75 C;  3N6R A;  4KMU C;  2A6H C;  3QIA A;  3OOC A;  1H9S B;  1OXT A;  2B8F A;  4KI0 A;  3T56 B;  1V43 A;  2A6E C;  3D31 A;  1VF7 A;  3IKJ A;  2D2C C;  4JBW A;  1IW7 C;  1Y8O B;  3HGB A;  1Z7T A;  4G7H C;  1O7L A;  2A68 C;  3M4Y A;  2B8G A;  2NN6 G;  3A8I E;  1A6X A;  1OXU A;  1Q1E A;  2DN8 A;  1ZKO A;  3PUV A;  5JEA H;  2NN6 I;  1YNN C;  3A7L A;  4LJZ C;  4KKT A;  1FYC A;  3PV0 A;  1E2W A;  2K7V A;  2ZT9 C;  3LWU A;  1Y69 U;  4DK1 A;  3NE5 B;  2EVB A;  1Z6H A;  3SE0 A;  4KHZ A;  2AUK A;  2DNC A;  2KA7 A;  3VR2 A;  5K36 G;  3OPO A;  4H13 C;  1TKW B;  3D4R A;  1HQM C;  1G29 1;  2R6G A;  2DNE A;  4PV1 C;  1GUT A;  2A6H D;  2JXM B;  3LNN A;  4OO1 G;  1K8M A;  4I7Z C;  4KKU A;  2BE5 C;  2A6E D;  3GQB A;  3ND9 A;  5C0X G;  2A69 C;  4KN7 C;  2O5J C;  3VR5 A;  1IW7 D;  4TKO B;  4TQU S;  5KNB A;  4G7O C;  1IYV A;  2A68 D;  1OXV A;  1H9R A;  1HTP A;  1VDZ A;  1E2V A;  2CW0 C;  3FMC A;  1Y8N B;  3ND8 A;  2PPB C;  2L5T A;  3W3A A;  4H0L C;  3PUW A;  3T51 B;  3A7A B;  3CRL C;  2EJG C;  1H9M A;  4IFD G;  3BDO A;  1GUG A;  2BA0 A;  1H9J A;  2NN6 H;  3I4L A;  2Q8I B;  5BN5 A;  1PMR A;  3T53 B;  3VR3 A;  3H94 A;  1DXM A;  1CI3 M; 
#chains in the Genus database with same CATH topology
 1DOK A;  2O4X A;  3NXW A;  3S1N H;  2E8G A;  2JA7 G;  1MJC A;  2CQO A;  1D2B A;  2K6A A;  2C35 B;  1B2T A;  4KLK A;  4R8I A;  5C3X A;  5C3E B;  2CW0 D;  5C0X I;  4HSV A;  4ZLT F;  1PXU A;  4FF3 A;  2LS0 1;  1PLF A;  2ICI A;  1TWG H;  1BBX C;  1EY9 A;  4OX9 L;  1L1O C;  1DGS A;  4RHS A;  1VQK A;  3BVZ A;  2ZTD A;  1E3P A;  4A3L G;  4K6L A;  1I4P A;  4RGM A;  4LF7 L;  3DEP A;  5IYB G;  3H09 A;  3QG1 A;  1TWH H;  4J1M A;  2AQ2 B;  1JB3 A;  3A8J E;  3KDF B;  1VS0 A;  4CKE A;  2KBN A;  4JK1 C;  2JA7 H;  1PH7 A;  1IHZ A;  3L0O A;  4DUZ L;  1QG7 A;  1S40 A;  2VNU D;  3MFY A;  2M00 A;  1O78 A;  4YWM A;  3TBI B;  2YU9 H;  1I50 H;  2YTY A;  1K83 B;  3HOY H;  4X62 L;  5E1F A;  4IUU A;  3FVQ A;  2D62 A;  4JI8 L;  1B3A A;  3TRZ A;  3DHQ A;  3LWE A;  1SRU A;  4NP5 A;  4DR1 Q;  1R9T B;  5LMU Q;  2EXZ A;  1UEB A;  4HCE A;  1LTL A;  3TP7 A;  5EQ0 A;  2Q8T A;  1IZ6 A;  1SJE D;  2G9H D;  3T16 A;  1Q86 C;  1HPC A;  4YIJ A;  2JA5 G;  4X66 Q;  1MBY A;  1RF2 D;  1RTN A;  3K57 A;  1K3B C;  4P71 A;  2D2C C;  5NUC A;  4OIJ A;  1EY0 A;  4NXN Q;  1FJG Q;  5D3I B;  2K5H A;  1XMQ Q;  3WOE A;  1V1P B;  3RD4 A;  4GLV B;  4A3G H;  2QGQ A;  4C3J B;  2AUK A;  3NQT A;  5FJ8 H;  5IT9 L;  2B29 A;  1X3E A;  4H13 C;  1BR9 A;  1FNW A;  2RVL A;  4X3T A;  3M4O B;  1VQH A;  3DWP A;  3AEV A;  3S1M H;  4DU9 A;  1EWI A;  1EOT A;  5E7N A;  3K5M A;  3G4S A;  3QOL A;  1XXG A;  2JA5 H;  5GAE C;  1PH3 A;  3ND8 A;  3O13 A;  4NMZ A;  2NUC A;  2MO1 A;  1JB7 A;  1JJG A;  4K14 A;  2EPB A;  1OTC A;  4LNQ A;  3D6W A;  2NYZ D;  1XMQ L;  1JWU D;  1U0L A;  2M2L A;  3CCE A;  2PZT A;  2XGT A;  1HNZ L;  2UUA L;  2J0T D;  1SND A;  1SBB B;  1NNX A;  1QCB D;  1YIJ A;  3GTG B;  3PF5 A;  5D14 A;  3PIP A;  1STH A;  4C3H B;  1UE5 A;  3KOJ A;  1GUN A;  2ZJP A;  2DY7 A;  4H44 C;  4GKJ L;  2CVR A;  2CWP A;  1U5K A;  1JOO A;  2JE6 I;  1W3S A;  1E22 A;  1EEI D;  3OYY A;  2ASB A;  4LW1 A;  1KDA A;  5GAD C;  3I3C A;  1R4P B;  4IUP A;  4PNY A;  2EDG A;  3TN2 A;  4A3C G;  4JI3 L;  1EU3 A;  1YZ6 A;  3H6M A;  2Z6K A;  3TEH B;  3K5O A;  2HQL A;  2BA1 A;  3C46 A;  3RLO A;  1DCZ A;  5C3E G;  1W2B A;  3HOZ H;  1KDB A;  1RD9 D;  3FPP A;  1N34 Q;  1PTO D;  2PCF B;  2XWJ B;  3OWF A;  4DK0 A;  1SYC A;  3ZJY C;  2JEB I;  2F0L A;  1VQ5 A;  2EJF C;  2X6G A;  3M4P A;  4GZY C;  3A55 A;  1I4G A;  1MIU A;  1JE4 A;  2F0Q A;  2KOL A;  4B3T L;  1KDC A;  5I9P A;  4IUV A;  3TZU A;  1KAB A;  3OMG A;  2N78 A;  2F0D A;  2H5X A;  3OTO Q;  2ZM6 Q;  2CH4 W;  3I72 A;  1X56 A;  3S1R B;  1PDQ A;  4JW0 A;  4JI4 Q;  1OXS C;  3N6R A;  4KMU C;  1VQP A;  3QO2 A;  4EQP A;  5C3E H;  2LFN A;  1PZI D;  1VQ4 A;  4F88 A;  4U67 3;  4DR7 Q;  2F03 A;  1WTW A;  1AZQ A;  1STY A;  4KJN A;  2IL8 A;  3H3V H;  4LF9 L;  3LWU A;  4B9W A;  3I90 A;  5IYD G;  2WAQ B;  3UE0 A;  1D5X C;  2DNC A;  3CCS A;  4XT1 B;  1LT4 D;  1WD0 A;  3KYH C;  2PZU A;  1YHQ A;  1GUT A;  4APV A;  5C4J H;  5T1G A;  1B53 A;  2A69 C;  1Q46 A;  1K0S A;  2A68 D;  1BBW A;  1OXV A;  2L12 A;  2Z4H A;  3I91 A;  4C3J G;  1EQQ A;  1WTX A;  1HNW Q;  5JJZ A;  1XX8 A;  1EIG A;  3J80 E;  1H9J A;  3I4L A;  3PO2 B;  1WI5 A;  1R9T H;  5CV9 A;  1YI2 A;  4B3M L;  3I4M H;  4GNX B;  1EIH A;  2L4N A;  2PQE A;  1IBK Q;  5I4D A;  1RDP D;  5EBD A;  5IYD H;  2D5D A;  1CZG A;  3FKI H;  5FLM G;  2AUJ D;  1X54 A;  5BN3 A;  2BOS A;  1TT2 A;  1K28 A;  3K80 C;  1PTO F;  3A5Z B;  3X3N A;  3NWT A;  2KEN A;  4C3J H;  5I9O A;  1K73 C;  5BR8 Q;  4C3H G;  4JC0 A;  4XQJ A;  2ZXP A;  3I4N B;  3BVG A;  2ZXO A;  1T5E A;  4ID6 A;  2Z6K C;  2YTV A;  3SXH A;  1KRS A;  1TWF H;  4L5T A;  4CDE C;  2K32 A;  4KD4 A;  3NTK A;  4FDB A;  2R93 H;  2L11 A;  3NBH B;  3BS1 A;  1PFB A;  2IY5 B;  4X3U A;  1I4H A;  2PQA A;  1KC8 C;  1VQF A;  2B39 A;  1Q8K A;  2CWA A;  3TSS A;  2E2I H;  2O5I C;  5EKK A;  4MIU A;  4IUQ A;  4GS3 A;  2B2V C;  4KK7 A;  2DJG C;  3GTG H;  3E9I A;  4OIK A;  2E75 C;  4C3H H;  1LO5 D;  4DR3 Q;  3PO3 B;  1OXT A;  1MHW C;  2B8F A;  4QIW B;  4ALP A;  1NR2 A;  2RHQ B;  3A8I E;  2AHO B;  1Q1E A;  1QWY A;  1TY2 A;  2HIX A;  3DMU A;  3E0E A;  4O2D A;  4UY8 C;  1N8R C;  1GXD C;  1KQS A;  2IJ0 A;  2VB3 X;  1NTG A;  2Q2I A;  4ZQ3 A;  2F0O A;  3RN5 A;  1K8M A;  2CH4 A;  4A3K B;  1IBL Q;  4HMJ A;  4A3B B;  2NVY B;  3MEH A;  3ER0 A;  2WAQ G;  1B3Q A;  3FMC A;  3E9H A;  1TII D;  4I7A A;  2L5T A;  3T1H Q;  4A3J B;  1HUN A;  2XRQ D;  1PRT B;  3KLS A;  4JCV E;  3HOV B;  3VR3 A;  1W6J A;  5KRU A;  3S1R H;  1T5X D;  2VUM B;  1E24 A;  2RCF A;  1B9N A;  1EYC A;  2F0S A;  2F0P A;  3C2P A;  3GTL B;  4MNO A;  1SAP A;  3OIQ A;  3PO2 G;  1HR0 Q;  1V1Q A;  4L5Q A;  4BXX G;  3ERS X;  2XRS D;  1K8A C;  1A15 A;  1CTM A;  1F2Z A;  5EGT A;  4K0K Q;  2F0M A;  4KHP Q;  2XVS A;  4X6A H;  4XXE A;  5ELB A;  5IGB A;  4FNF A;  4A93 B;  1B70 B;  1JCK B;  4ULL A;  1WD1 A;  1VQ7 A;  4DV1 Q;  4ME5 A;  1KAW A;  3ULJ A;  2PQA B;  5FO9 B;  1VQG A;  1Y1W H;  3AFQ A;  1LYL A;  3H3V I;  5H1S E;  4YY3 Q;  3I4N G;  1MD2 D;  1N32 L;  2XSC A;  1EEF D;  5HUR A;  2RSN A;  3F2B A;  1I94 Q;  1HZC A;  2LXJ A;  4EQ5 A;  2F0U A;  2F0T A;  1GUW A;  4IPG A;  4N9P A;  3S9W A;  2E74 C;  3PCO B;  4IOA A;  4M8A A;  2I5H A;  3W2D A;  4ZYS A;  4R4Q A;  4DFA A;  4LFC Q;  1WJJ A;  4LFB L;  4RAU C;  3STB C;  5IGC A;  1Y1V H;  2PMZ E;  4G7H C;  1CQV A;  5DAU A;  5KYL A;  2UU9 L;  3E5S A;  4AH6 A;  1Q8I A;  2A1A A;  3A7L A;  1LTS D;  2A5H A;  4R4I A;  2X6L A;  3S15 H;  3PO3 G;  4Y7N B;  1UE6 A;  3I4N H;  4F8M A;  5K36 G;  1G51 A;  1F2M A;  1UE7 A;  1AE3 A;  2R6G A;  2A6H D;  3LNN A;  3BJU A;  2WB1 E;  5CV7 A;  1RKN A;  1S5F D;  1IW7 D;  1BCP C;  2IHE A;  1HR0 W;  2N55 A;  2JYO A;  3MA2 B;  3GTJ B;  2K5V A;  2HD3 A;  5EPJ A;  3A7A B;  3NSW A;  1QVF A;  1SEB D;  1G2S A;  2Q8I B;  1LTG D;  3FRP B;  3CU7 A;  4OEL B;  4A3K G;  1SR3 A;  1VMP A;  4A3B G;  4GN3 B;  2E2J B;  5CGK A;  3MEF A;  2E2H B;  4PZ7 A;  3IFT A;  2NVX B;  4J6H A;  4YCW A;  2KEC A;  1PH2 A;  3QJY A;  5T1I A;  4A3J G;  5K36 H;  4DR5 L;  1YNX A;  2DUD A;  5C4X B;  5LMN L;  3T1Y Q;  1JOK A;  1L2F A;  3J81 j;  1LM0 A;  4JI6 L;  5GQO A;  3HOV G;  3GDE A;  3CD6 A;  1YEZ A;  4DUY L;  2VUM G;  3E0J A;  3DWA A;  3GTO B;  2PI2 E;  2F0V A;  1DJR D;  1SNM A;  1STB A;  2ALY B;  1GJX A;  1HA5 A;  3QB3 A;  3Q22 A;  2PW7 A;  4IQZ A;  5J1Z A;  1C7Y A;  1VQC A;  2RDH A;  3BDL A;  1BDO A;  3SGI A;  4OL7 A;  1QJO A;  4RCO A;  4A3K H;  5JOB A;  5JEA G;  4A3B H;  3CQZ H;  2OEO A;  2WV6 D;  2NVY H;  1ILQ A;  4IUR A;  5E3F A;  3SK6 A;  2EYM A;  3RN2 A;  2G5D A;  3KUP A;  1SNC A;  3K8A A;  2UXD Q;  2KCN A;  4A3J H;  4DV0 L;  1FL0 A;  4QQB X;  4OO1 H;  2UUB L;  4A93 G;  2NVQ B;  2RF4 A;  4MHE A;  3HOV H;  1TU2 B;  1SE8 A;  1IBM L;  2B2U A;  5K5P A;  1K9M C;  1SMY D;  5M9O A;  1CA5 A;  2VUM H;  1XMO Q;  2JA8 H;  1WVL A;  3HOU B;  3HOX B;  4IFD H;  1NMG A;  4C1N K;  4DPG A;  2B3G A;  4ILW A;  1E7Z A;  4I65 A;  4AIM A;  1VF7 A;  3KF8 A;  4R4T A;  2TSS A;  2C5C A;  1VQB A;  4K8I A;  4C1N I;  5C6A A;  3K5N A;  4K8J A;  1UAP A;  2HHH Q;  4B3R Q;  1II3 A;  1N9W A;  4DNI A;  5JEA H;  1QVC A;  3DM3 A;  4FO2 A;  4A3F H;  3CPW A;  5ELC A;  1EL0 A;  1EY6 A;  4FVM A;  3V05 A;  4JI1 L;  2EIF A;  2VQF Q;  1MSG A;  4PV1 C;  4JI2 L;  3CF5 A;  1VQA A;  2R92 B;  1TXY A;  3BYT B;  4ZUI A;  3BZC A;  1LTB D;  2HQE A;  1JT8 A;  2FMM A;  2QW7 A;  1ICW A;  2MJ8 A;  5FK9 C;  1JJC B;  1AW7 A;  1PRT D;  2R3Z A;  3W1G A;  1RHP A;  4N8X 1;  4PQX A;  4UP7 A;  4WJ4 A;  5EBC A;  1HA6 A;  1TWC B;  3SDZ A;  2Z6B A;  2FIN B;  2I07 B;  2VY3 A;  4POG A;  3QWN A;  4OX9 Q;  3K59 A;  5EAY A;  3UDF A;  1I3Q B;  1GHK A;  4Y7N H;  1MJE A;  2H4O A;  5HY6 A;  4HJ5 A;  1ET6 A;  1JQY D;  4LF7 Q;  2EE1 A;  5C4X G;  4F7X A;  1PA6 A;  3HOW G;  1F9P A;  3M4Q A;  3FPU B;  1CSP A;  3KF6 A;  4JI0 L;  1H9K A;  2CQA A;  4DUZ Q;  1U4P A;  4HJA A;  2E5L L;  2F0I A;  3S2H H;  3HS0 C;  2AKW B;  1L1O B;  1EWH A;  3AMU A;  4FXG C;  4X62 Q;  1V9P A;  1SLJ A;  4JI8 Q;  1IYU A;  1PFS A;  4DNR B;  3U50 C;  3OW7 A;  1SJH D;  3J81 c;  1EIF A;  5BN4 A;  4B3S L;  2SEB D;  1JOQ A;  1ENF A;  3MVV A;  4IPD A;  2E2H H;  2NVX H;  1KL9 A;  2GN5 A;  3SK4 A;  4LF8 L;  2B2U C;  4L6T B;  5M5X B;  3NQI A;  3KF8 B;  4RFB A;  5TSS A;  5IWA L;  5EJW A;  5IYC G;  3HOW H;  3HGB A;  2HT1 A;  3NWS A;  4C2M B;  5M3F B;  4CDF C;  4FF4 A;  5FO7 B;  2QCP X;  3GTO H;  2L15 A;  3HOU G;  3HOX G;  3RUZ A;  1BQQ T;  1TS4 A;  2P5Z X;  2A19 A;  3SE0 A;  2OWO A;  2EZV A;  1IYJ B;  1B8A A;  3K7U C;  1FGB D;  3D4R A;  1WYD A;  1XNR L;  5DEH A;  5JJI A;  3EVQ A;  2JXM B;  4CJ0 B;  1EQR A;  1XTD A;  5I6Y A;  1PYB A;  4DAP A;  1GM5 A;  4A3L H;  4AYB B;  2F4V L;  1XPU A;  1PRT F;  1AH9 A;  1H9R A;  3UDX A;  5IYB H;  1E2V A;  4QJF A;  5CBE E;  2IX3 A;  3U4Z A;  2NBF A;  3M3Y H;  1C4Q A;  3GP7 A;  3CXC A;  1YNJ D;  1HNZ Q;  2UUA Q;  2R92 G;  1C0A A;  3HOU H;  1YVC A;  1PTO H;  4R1J A;  4GKJ Q;  1SYF A;  1WTH A;  2VW9 A;  3MZ5 A;  5G3L D;  3J80 i;  2F0N A;  4OO1 I;  1TQO A;  4X3S A;  4OWT B;  1QUQ A;  4L63 B;  4JI3 Q;  3W1B A;  1EU4 A;  4RG1 A;  4Z9C B;  1D6E C;  2EXD A;  4X65 L;  2VS1 A;  1SE3 A;  4MTN A;  4IFD I;  3GTK B;  4L5S A;  3JAM L;  3H15 A;  4PG3 A;  1JE5 A;  3W5O A;  1STG A;  3GV3 A;  1JC7 A;  2EY1 A;  4WRD A;  2EJM A;  3B6Y A;  3VYS A;  4IPH A;  2WKC A;  1F2Y A;  2AQ1 B;  4B3T Q;  3DXJ C;  1DON A;  4IAL A;  4R4C A;  1X3Q A;  3A8K E;  1EWC A;  4JOI A;  1I6H H;  3NTI A;  3GO5 A;  3CC7 A;  4A75 A;  2K14 A;  2L9H A;  4L8J A;  4KKS A;  2K1B A;  1PZJ D;  1VQ8 A;  4XIG S;  5COY A;  3H91 A;  3R3O A;  4KHV A;  3CCQ A;  4JI7 L;  3T56 B;  2A6E C;  3F2C A;  3DUZ A;  4LF5 Q;  1BOS A;  2DN8 A;  2N49 A;  1U4L A;  4LF9 Q;  4HJ9 A;  2XWB B;  1PH5 A;  1LV9 A;  2B2V A;  2RQX A;  2K7V A;  2VZA A;  1A8V A;  1NE3 A;  4JI5 L;  1Z6H A;  1EFW A;  2NZO A;  3BU2 A;  1HZB A;  3HP3 A;  2AQ3 B;  4A3C H;  5M3F G;  1AZP A;  4TSS A;  2BE5 C;  3GQB A;  2O5J C;  1IYV A;  4TQU S;  4ZAI A;  2F0F A;  2WFW A;  2RCN A;  1Y8N B;  4LF5 L;  1QE6 A;  2EYL A;  4ZKB B;  3CRL C;  2F4I A;  3D6C A;  5G3L F;  2LY7 A;  2UXB L;  5FLX L;  2R7F A;  3T53 B;  5IP9 G;  3RLN A;  4B3M Q;  4IJL A;  4AYB G;  5JJL A;  2YYZ A;  4V0B A;  2CKZ B;  2VQE L;  1I6V C;  1I4R A;  2K5N A;  1IKL A;  3ERO A;  1V8Q A;  3AYH B;  3Q23 A;  1KTK A;  4DF7 A;  1EY8 A;  1AEX A;  2KCM A;  2E2D C;  4C2M H;  5M3F H;  1O80 A;  3KK7 A;  2FMC A;  3G7L A;  5CV4 A;  2WAQ E;  1K83 H;  1VQN A;  2IT1 A;  1YJ9 A;  3FDT A;  1PYW D;  4KY6 A;  5HGQ A;  2F0G A;  3R8B A;  4OXP A;  5IP9 H;  3M9B A;  2B63 B;  1D8L A;  1VF5 C;  2LKV A;  2CFM A;  2SDF A;  1CFM A;  4A3D B;  4WFN 3;  1EOV A;  1JJ2 A;  3HKZ B;  1B9M A;  1X65 A;  1RL2 A;  4IUN A;  3Q8D A;  2XN9 C;  1OO9 B;  4JOI C;  3KJO A;  1TY0 A;  3M4O H;  4Y52 H;  1SE4 A;  3X3M A;  4YHH Q;  2RA4 A;  4P72 A;  1Q7Y C;  2I0Q A;  4LUO A;  2OQ0 A;  1J5E L;  1FNV A;  4C3I B;  2WII B;  1PH9 A;  1IXR A;  5KYI A;  3S2D B;  3FEW X;  1ZKO A;  3CHB D;  5FLM H;  2K4K A;  4DGZ A;  3K58 A;  3J80 c;  4P73 A;  1E2W A;  1Y69 U;  2EYO A;  2QIL A;  2Y0S B;  3GTK H;  1QOH A;  1WCM B;  1QVG A;  3A5U A;  4R4O A;  5JAV A;  1LT6 D;  1HFG A;  4YHH L;  5IGG A;  1YHA A;  4GOP C;  4E6I A;  1SE2 A;  3P7J A;  4DR4 L;  1FD7 D;  3L3O C;  3ONA B;  1SSO A;  1VQD A;  4X64 L;  1H9M A;  4YCU A;  1PFM A;  3BDO A;  4HSP A;  2MNA A;  1UUP A;  1WTQ A;  1PMR A;  1A2U A;  4J15 A;  1UNS A;  3TP8 A;  4QIW E;  2KCC A;  3SK8 A;  1SMX A;  2N8N A;  2FXQ A;  4CKC A;  1PVO A;  2F0K A;  2KUM A;  2PZW A;  4ABN A;  3I8Z A;  1X55 A;  1IKM A;  1JMC A;  5C44 B;  3U58 A;  2CHB D;  4LFA L;  1S5B D;  1ZXT A;  3S14 B;  3I73 A;  1KLU D;  4H7B A;  3KLS X;  4GLX A;  1A3U A;  1H9S A;  1EQT A;  4UDU C;  5ELO A;  3EN2 A;  1S5C D;  4C56 C;  2NWG A;  2YTX A;  4PZ6 A;  3MXG A;  1N32 Q;  1OXX K;  3CKI B;  1KHI A;  5CV6 A;  4HIK A;  1BF4 A;  1ZYR C;  4CGY B;  1X3F A;  1HTL D;  2B63 G;  3EQL C;  2PI2 A;  2L0C A;  5EKL A;  4BY7 B;  1HFN A;  3MXN A;  2QEX A;  4A3D G;  3MC0 B;  4LFB Q;  4CHT B;  2JSO A;  2R7D A;  3HKZ G;  5ELD A;  2ICE C;  4HIM A;  1VMC A;  2UU9 Q;  1M4V A;  3MWY W;  4YCV A;  1STA A;  1YNN C;  1EZ6 A;  3KJP A;  3PO2 H;  4ZRZ A;  4BXX H;  1KNE A;  2Z8L A;  4C3I G;  3S1Q B;  3V2T A;  1A3V A;  3J7A F;  5EKI A;  1D7Q A;  1KIX A;  2VB2 X;  4I7Z C;  3CW2 C;  5C0X G;  3TQY A;  1NY4 A;  2JK8 A;  5C4Z A;  2ZTE A;  4TKO B;  1X3G A;  2B2W C;  3NBI A;  4A3M B;  4O42 A;  4QGU A;  4A3D H;  1NCV A;  2Y0S G;  3I55 A;  2CW0 C;  1WCM G;  1G6P A;  5E4X A;  1MKH A;  1G91 A;  4YWK A;  2KHI A;  2BA0 A;  2OTL A;  2J7Z A;  3A74 A;  4HID A;  1Q3L A;  3H94 A;  3JAM E;  4IPC A;  2HCC A;  4DV6 L;  4PMB A;  3LGJ A;  5M3M B;  1BCP B;  3HRZ C;  1EFI D;  3K81 C;  1PYS B;  4DR5 Q;  2EQS A;  4G7Z C;  3D4D A;  2KJX A;  2A69 D;  3RZO B;  1O7I A;  2ENB A;  1TS2 A;  2I46 A;  3NEM A;  5LMN Q;  4IO9 A;  1VQI A;  5FKA C;  3GTM B;  3AB9 A;  4JI6 Q;  2F0H A;  2L55 A;  1XPO A;  3M7N A;  2WIN B;  3G6E A;  1K8O A;  4DUY Q;  1J6Q A;  4P2C B;  5C0X J;  3NEL A;  3CC2 A;  4GKK L;  1PHJ A;  1YJN A;  1CSQ A;  3S24 A;  2HDL A;  1HZ9 A;  3NP8 A;  5IT9 c;  1NAP A;  4HR7 B;  4OWW B;  5LHY 1;  4PZ8 A;  5D3D A;  4ME3 A;  4UP8 A;  4AQY L;  4UPA A;  1NJI C;  1TS3 A;  2QDL A;  3PO3 H;  2PNH A;  1HHV A;  2UUC L;  2SNM A;  3P75 A;  4ZCK A;  1VCI A;  3G48 A;  5C44 G;  5I2Y A;  4DV0 Q;  1BUV T;  2FHT A;  2PO4 A;  2UUB Q;  4LF6 L;  1ET9 A;  4KY7 A;  2PNR C;  3J7A V;  1ML0 D;  4IZ8 A;  3OIP A;  5A35 A;  1FGU A;  4N9T A;  1IBM Q;  3VYU A;  1YNJ C;  3I7F A;  3Q0A A;  3MXN B;  3F1Z A;  4X3K A;  1Q90 A;  1EZ8 A;  3S17 B;  1TWH B;  4DV4 L;  1SFO B;  1IL2 A;  2MGS A;  1U4R A;  4XDX A;  3OHX C;  4NKL A;  4OEM B;  3CCV A;  1KRT A;  4S3S A;  1E1T A;  4IJH A;  3HOY B;  4BY7 G;  1HUM A;  4FF2 A;  1HRJ A;  1BVS A;  2JA9 A;  5FLX E;  2ZT9 C;  5C44 H;  4LF4 L;  3NE5 B;  2EY6 A;  1NMF A;  4KY5 A;  2KA7 A;  3SK5 A;  3OPO A;  4JI1 Q;  4RGT A;  4DAY A;  1TKW B;  3F2D A;  4PMW A;  4JI2 Q;  1RCV D;  1T9H A;  1BKB A;  3FP9 A;  1GOZ A;  3KBX A;  3KFU A;  5EPK A;  2K28 A;  3GTL H;  1MSH A;  4BBR B;  5LMN W;  2RDG A;  2IHF A;  2K5D A;  3PMF A;  4JV5 L;  4DV3 L;  3K0X A;  2MFI A;  1F9R A;  2PPB C;  1K0R A;  3KLW A;  5CR3 A;  1YIT A;  4XQN A;  1RIP A;  1GUG A;  4GN4 B;  1C8C A;  4A3G B;  3CCJ A;  5KEE A;  2F3I A;  1XTC D;  2Z1C A;  4DK3 C;  5C4H A;  1L0Y B;  1DXM A;  1CI3 M;  1KXL A;  4BY7 H;  4A3M G;  4IFD J;  4A93 H;  2EYP A;  1LTT D;  2IPK D;  4DR2 L;  1J8I A;  3SEB A;  3KDF A;  1X6O A;  1LAC A;  4JYA L;  1UE1 A;  1PTO C;  4DV2 L;  1F9Q A;  5IP7 G;  1M1K C;  3R2I A;  1VQE A;  5GRO A;  4RHR A;  1G2T A;  1WTO A;  1LAB A;  5M3M G;  4DV5 L;  2Q8R E;  1R4Q B;  4XYQ A;  1DD2 A;  3GTQ B;  2UXC L;  2B2Y A;  3SHL A;  4DR6 L;  1FVI A;  2K52 A;  2JJQ A;  2EYJ A;  3NK9 A;  5D65 A;  3BZD B;  3VA7 A;  1HNX L;  3PGZ A;  1VQ9 A;  4JI0 Q;  2XNA C;  2E5L Q;  1HZA A;  2E76 C;  5LL6 X;  4A3M H;  1CHP D;  1NBW A;  3P20 A;  4MN3 A;  3GV6 A;  1SNO A;  1P8L A;  1GHJ A;  5LL6 S;  1ILP A;  3F8T A;  1PFN A;  4EVO A;  5JPN C;  2AWO A;  2LMC B;  4B3S Q;  4RGN A;  1V1P A;  3URY A;  3VA5 A;  4OGQ C;  1N33 L;  2MP1 A;  1E2Z A;  5IP7 H;  1VQJ A;  1BBU A;  2Z4I A;  2IWH A;  1QZH A;  4FXK C;  4HED A;  1B50 A;  5M3M H;  2Q2H A;  1SXT A;  2SNS A;  4UP9 A;  4LF8 Q;  4NB3 A;  4QMG A;  1DOL A;  3RMH A;  1DOM A;  1LT5 D;  1DYQ A;  3RZO H;  3HOZ B;  2IX1 A;  3PQI A;  1JR0 D;  3TZD A;  4NXM Q;  5IWA Q;  3K6O A;  4FF1 A;  2A68 C;  2B8G A;  1A63 A;  1OXU A;  3GTJ H;  4L5R C;  1RJT A;  3CAM A;  1EIY B;  1YBY A;  1XNQ L;  5IIF A;  5C3W A;  3PV0 A;  1ZEQ X;  1PZK D;  3S16 B;  1C48 A;  1CKN A;  4DAM A;  5AJ3 L;  4DAY B;  1KNA A;  1CA6 A;  1XNR Q;  1D1K A;  2E2J H;  1PH1 A;  1ENC A;  1G29 1;  1TS5 A;  3JC6 6;  3SR1 A;  1N36 L;  3STB D;  2F4V Q;  3HOY G;  4NXM L;  4FXD A;  5C4X H;  4RKB A;  1VDZ A;  3NPP A;  1K8G A;  3UDI A;  2PYK A;  4A76 A;  3W3A A;  1S72 A;  4H0L C;  4CBV A;  1STN A;  2N3S A;  2YV5 A;  2JQO A;  5BN5 A;  5ELE A;  4WJ3 M;  1FNU A;  4IN3 A;  3FHW A;  4BBR G;  1CT1 D;  3H3V C;  3S17 H;  1GD7 A;  1Q1B A;  3F2U A;  1ROD A;  2AWN A;  4HAE A;  3D4W A;  3TP5 A;  5C4J B;  1SFO H;  1AN8 A;  3TDQ A;  4U68 A;  4QUC A;  3DM1 A;  4UHV A;  1BCP D;  3Q6S A;  3WWV A;  1YJW A;  4A3G G;  4BY1 B;  2XTI A;  1HH2 P;  2WKD A;  5FJ8 G;  3PUX A;  5COR A;  2KED A;  1TR5 A;  2NVQ H;  3MXP A;  5IYC H;  2K5Q A;  2BH2 A;  4X65 Q;  4P74 A;  1C9O A;  1NUC A;  4WJW A;  3I4M B;  1FR3 A;  3HOX H;  4AYB E;  1I4Q A;  1U9R A;  2B2Y C;  3FKI B;  5FOB B;  2HDM A;  4BBR H;  2RKS A;  1Z9F A;  2ZJR A;  1A2T A;  1HCZ A;  2PW5 A;  2IX0 A;  5KNC A;  5CMD A;  4JPB W;  4A3I B;  2Z0S A;  3KBG A;  1GUS A;  3PUZ A;  3VR4 A;  4DAV A;  5CV8 A;  1XJV A;  4QY7 A;  4A3E B;  3PSI A;  3CME A;  1G6Z A;  3RLF A;  3EBE A;  4DR1 L;  5LMU L;  1RTO A;  5C5L A;  2KQ3 A;  3EIV A;  1D5Z C;  4GN5 A;  1GKH A;  1TWF B;  4FYD A;  3G6J B;  5IGE A;  4JI7 Q;  3QIA A;  4CJ1 B;  4X66 L;  2R93 B;  3CMA A;  3KF6 B;  2R92 H;  5JVG 3;  2NTS A;  2K04 A;  2R7Z B;  3M4Y A;  4QCL A;  2BDN A;  2HUG A;  1B44 D;  4BBS B;  4NXN L;  1FJG L;  2D0O A;  1EY5 A;  2E2I B;  4KKT A;  1M90 C;  4JI5 Q;  3HOZ G;  1CKN B;  3GTQ H;  4Q5V A;  1WOC A;  1A3T A;  2B2T C;  1SYE A;  3V96 A;  4GNX A;  2QEJ C;  4CJ2 C;  3A0J A;  3I4O A;  5M5Y B;  2A74 C;  3IL8 A;  4KKU A;  3ND9 A;  2KVM A;  1NSN S;  3VR5 A;  1TWC H;  1EUJ A;  3R93 A;  1VQO A;  1VQL A;  4O1N A;  2R61 A;  1TVX A;  4M1U B;  1EQV A;  3I2Z A;  1UWV A;  2M9V A;  5DNF A;  4EQN A;  2UXB Q;  1I3Q H;  4DK6 C;  3VDY A;  4K5X A;  2GA4 B;  3ULL A;  2OF1 A;  3A56 A;  1BCP F;  2F0W A;  3A54 A;  3DLL A;  1AFP A;  2EYH A;  2OCE A;  2VQE Q;  3TS0 A;  3C1E A;  1AP0 A;  3J7Y W;  2DY8 A;  4GOP A;  3HG9 A;  1E1O A;  1SDF A;  2K01 A;  1WTV A;  3U9S A;  2ZXR A;  4RMF A;  3NBH A;  2DJF C;  4WOR A;  2XIW A;  3MHB A;  4KN4 C;  5F2D A;  1S4Z A;  4JBJ A;  4RA8 A;  4DXF A;  2JEA I;  3J7A 5;  1GVP A;  3S16 H;  2D9U A;  2V4D A;  3C1F A;  1K3R A;  4B08 A;  3BYY B;  1SRO A;  2WP8 J;  3D0F A;  1BO0 A;  2RHS B;  1Q81 C;  4K2K A;  4BY1 G;  1O7Z A;  4XT3 B;  5IE8 A;  1Y14 B;  3HZX A;  5M5X H;  2K50 A;  2MUY A;  1QNU A;  3CCL A;  1SN8 A;  4DN4 M;  3C3L A;  2RDF A;  1N34 L;  2ZJQ A;  2OTJ A;  4QF4 A;  3TS2 A;  3Q24 A;  4GLA C;  4LUV A;  2G9D A;  3MAQ A;  1QUQ B;  1B1Z A;  1QB5 D;  5KIX A;  1QZG A;  3I4M G;  5KND A;  2MQH A;  2JN4 A;  4NDX A;  3FKI G;  4XTC S;  1LLR D;  2RSO A;  1LTI D;  4RKL A;  4KTA A;  4BS9 A;  3OWE B;  3OTO L;  5A2Q L;  1QNK A;  2ZM6 L;  2I5L X;  4A3I G;  4JI4 L;  2A6H C;  1NR4 A;  1J5E Q;  2H1E A;  5IOC A;  5CV5 A;  3D31 A;  4JG2 A;  5ELN A;  1IW7 C;  2NB0 A;  5HGT A;  1Y8O B;  4BY1 H;  1SYD A;  4A3E G;  1O7L A;  1Q82 C;  2NN6 G;  2N88 A;  3EFX D;  1Y1W B;  4DR7 L;  5M5W B;  2EYF A;  4DXG A;  5I2X A;  1HQR D;  2R93 G;  4DK1 A;  1G8Z D;  2BCO A;  4KHZ A;  2F52 A;  1D5M C;  3MFG A;  4P75 A;  1KD1 C;  1D1I A;  2R7Z G;  1SNP A;  5C5M A;  3LX0 A;  2MPM A;  2DNE A;  4RH6 A;  2VXW A;  4K2L A;  3AU7 A;  4BBS G;  1YHB A;  4LMQ D;  1Y1V B;  1STE A;  3HKZ E;  3U4V A;  4GNX C;  2QKI C;  4DR4 Q;  4A3I H;  4X64 Q;  1HNW L;  2F3V A;  5CYU A;  1JWS D;  3T51 B;  1I5F A;  4A3E H;  2WAC A;  2NN6 H;  3J81 L;  1CUK A;  3S15 B;  1DZ1 A;  4PMC A;  2AMC B;  4MZ9 A;  4GOP B;  4RCN A;  4V19 0;  4CDD C;  3CC4 A;  4JBM A;  1ASY A;  2B2W A;  1IBK L;  5CC4 A;  3RR5 A;  2LSS A;  5JVH 3;  2K75 A;  1XYI A;  1CM9 A;  2R7Z H;  5IGD A;  1SYB A;  4POF A;  1CHQ D;  4EQO A;  3CCM A;  3QR8 A;  3H0G B;  4RGO S;  1F9S A;  5IOD A;  2A8V A;  4BBS H;  1GUO A;  2Y0S E;  4DA2 A;  3PIO 3;  3JAM i;  2K5W A;  4LFA Q;  1KAA A;  5DLQ E;  4HJ8 A;  4LUZ A;  5BR8 L;  1SMY C;  2BDO A;  3ULP A;  1GO3 E;  5M5Y H;  2OQK A;  4B9X A;  4HCS A;  4HMI A;  2JA6 B;  1V1O A;  4OWX B;  4HN7 A;  2Z9H A;  3TP6 A;  4QUF A;  2LXK A;  2NTT A;  3RZD B;  4H02 A;  3BZK A;  2MO0 A;  5E4W C;  1Y8P B;  1XWE A;  1TWA B;  2QF7 A;  3HEJ A;  1BNZ A;  4KV6 A;  3M85 A;  3WDN A;  3M7G A;  1SNQ A;  3T4A C;  3K7A B;  1Q12 A;  3BG3 A;  3UDG A;  4TVA B;  3WOF A;  4O0A A;  2NZH A;  3OSO A;  4ZUJ A;  3OOC A;  1PH4 A;  4DR3 L;  3CQZ B;  3IKJ A;  1A6X A;  3VYT A;  4J8Q A;  3PUV A;  1A62 A;  5EPL A;  5GAH C;  3OW2 A;  2IW3 A;  4HTH A;  5J39 A;  1LUZ A;  3NHH A;  3TRE A;  1PRT C;  3HKS A;  2JA8 B;  3I70 A;  2Q2T A;  1MGS A;  1Y1W G;  4IOC A;  2HCI A;  4A4I A;  2A6E D;  1LT3 D;  5KNB A;  3ERQ A;  4G7O C;  1IBL L;  5AFW A;  5JPM C;  3I56 A;  1VQM A;  4DKA C;  1O7Y A;  3MTS A;  3DWQ A;  3T1H L;  3BVM A;  3TME A;  2DGY A;  4G4K A;  3NTH A;  4MTK A;  4A3F B;  3GTP B;  1L0W A;  4DV6 Q;  4IUT A;  1Y1V G;  2C9O A;  2FFK B;  1DM0 B;  1LTA D;  4F87 A;  2KEE A;  4QL5 A;  2BE5 D;  2ZTC A;  3MXU A;  2J4X A;  4BA1 I;  2B63 H;  4BA2 I;  4DV7 Q;  4CKB A;  5CBA E;  2EY5 A;  2F0J A;  4DNT B;  5DM7 3;  2TMP A;  1HR0 L;  5FO8 B;  2K03 A;  3BDC A;  3KLR A;  2F3W A;  1JWM D;  2PMZ B;  5M5W H;  3CCR A;  4EGV A;  4EX5 A;  4JVZ A;  4GKK Q;  3EJI A;  5IT9 E;  2ATW A;  4K0K L;  4ZKC B;  4OON A;  4RWS C;  4CDC C;  1XPR A;  2MHV A;  4KHP L;  1ASZ A;  2KHJ A;  2I5M X;  3NEN A;  3D8G A;  3IAY A;  1E0B A;  4AQY Q;  1SYG A;  3H0G G;  1JOR A;  2SOB A;  4BWG B;  2UUC Q;  4HJ7 A;  4C3I H;  4DV1 L;  3AQQ A;  4LK1 C;  4DV7 L;  2O2L D;  4YWL A;  2WB1 B;  3S2D H;  1ENA A;  4LF6 Q;  3E6Z X;  5ISR A;  4KJO A;  5C0X H;  4YY3 L;  2ES2 A;  2NVT B;  3CRK C;  1MI2 A;  3P1H A;  2JA6 G;  3K0Y A;  3L9A X;  1I94 L;  5J22 A;  1WCM H;  3ITP A;  3E3X A;  1ONL A;  4TRD A;  3S1N B;  4DV4 Q;  3ICE A;  1S5D D;  1PH8 A;  1H9S B;  4LFC L;  1V43 A;  5GAG C;  1CZW A;  4JBW A;  3J81 i;  3CCU A;  3S2H B;  1VQ6 A;  4UAI A;  3H0G H;  1F77 A;  1B7Y B;  1EY4 A;  3DEO A;  2NN6 I;  4LWC A;  5J3B A;  4OHJ A;  1TWG B;  1FYC A;  4LF4 Q;  4QB4 A;  1ICF B;  1KLG D;  3RNU A;  5DM6 3;  2X69 A;  3VR2 A;  3N52 A;  3JAM c;  1PH6 A;  2QDB A;  4N8F A;  2ID0 A;  2V1C C;  4KD3 A;  2KHS A;  3PIP 3;  1Z47 A;  2JA6 H;  4OO1 G;  3IFD A;  4JBK A;  1WFQ A;  4KN7 C;  4G57 A;  2JP1 A;  4JV5 Q;  3RZD H;  3HOW B;  4DV3 Q;  3HFZ B;  1CKM A;  2JA7 B;  1WTP A;  1L0X B;  2A73 B;  2YU9 B;  2JA8 G;  1I50 B;  1IL8 A;  1TWA H;  4IFD G;  4HIO A;  1ESF A;  5KGU A;  4NPS A;  1P16 A;  3G71 A;  3K7A H;  4NW2 A;  5ELF A;  3S14 H;  2K33 A;  3VR6 A;  4DR2 Q;  4K5V A;  3SVM A;  1X32 A;  4XYO A;  2FJ2 A;  4JYA Q;  3ZYY X;  4DV2 Q;  4A3F G;  4R9W A;  1X3P A;  1L1O A;  3T1Y L;  3VYR A;  5IGF A;  1QIL A;  4DV5 Q;  2OXP A;  3NUC A;  1A0I A;  2NZ1 D;  3R2T A;  4XQQ A;  3CP0 A;  2VL6 A;  3J80 L;  1HXY D;  5L37 A;  1M8A A;  2UXC Q;  3M3Y B;  2OT2 A;  1AE2 A;  4DR6 Q;  2BH8 A;  5A2Q E;  2F1M A;  1W6K A;  3K5L A;  1PTO B;  1HNX Q;  3S1M B;  2HIV A;  2KCT A;  5IY0 A;  1S3O A;  1BXT A;  2K05 A;  3UE1 A;  3IRB A;  3T13 A;  3AFP A;  3PUY A;  2JA5 B;  3PF4 A;  1J9O A;  5JEA J;  2UXD L;  3PIO A;  1N33 Q;  3GTP H;  4Q0F A;  1WTR A;  5FLX c;  3GD7 A;  1HJP A;  2EY2 A;  2L1B A;  3L7Z C;  3S1Q H;  4ZK9 B;  2WB1 G;  1XMO L;  1CQF A;  3OMC A;  4K6D A;  3QOJ A;  4LAA A;  4KI0 A;  4FP5 D;  2Q2U A;  1Z7T A;  4K5W A;  1B4O A;  1JIC A;  1X9N A;  1XNQ Q;  2HHH L;  3CPF A;  4B3R L;  4ODG A;  1EYD A;  2RBM A;  4LJZ C;  1I6H B;  1ZYR D;  3J81 E;  1EYA A;  5AJ3 Q;  2EVB A;  1S5E D;  3U9O A;  1CK1 A;  1EY7 A;  3UI2 A;  1HQM C;  5I6W A;  2EOT A;  2QA4 A;  2GVB A;  1N36 Q;  2CCZ A;  2VQF L;  1U4M A;  2D0P A;  5JJK A;  1UEA B;  1LTR D;  1I4X A;  3GTM H;  1EYG A;  1H95 A;  1F2L A;  1HTP A;  2F0E A;  3J7Z C;  1PV4 A;  1YNN D;  3L2P A;  3PUW A;  2EJG C;  2NVT H;  2B2T A;  1ESR A;  2GVA A;  3D3R A;  1CKO A;  4R8N A;  3EA6 A; 
#chains in the Genus database with same CATH homology
 1DOK A;  2O4X A;  3NXW A;  1D2B A;  2K6A A;  1B2T A;  4R8I A;  5C3X A;  5C3E B;  2CW0 D;  5C0X I;  4HSV A;  4ZLT F;  1PXU A;  4FF3 A;  2LS0 1;  1PLF A;  2ICI A;  1BBX C;  1EY9 A;  4RHS A;  3BVZ A;  4K6L A;  1I4P A;  4RGM A;  3DEP A;  3H09 A;  3QG1 A;  4J1M A;  2AQ2 B;  1JB3 A;  3A8J E;  4CKE A;  4JK1 C;  1IHZ A;  1QG7 A;  2VNU D;  3MFY A;  2M00 A;  1O78 A;  3TBI B;  1K83 B;  5E1F A;  4IUU A;  3FVQ A;  2D62 A;  1B3A A;  3DHQ A;  3LWE A;  4NP5 A;  1R9T B;  2EXZ A;  4HCE A;  3TP7 A;  5EQ0 A;  2Q8T A;  1SJE D;  3T16 A;  2G9H D;  1HPC A;  4YIJ A;  1MBY A;  1RF2 D;  1RTN A;  3K57 A;  2D2C C;  5NUC A;  4OIJ A;  1EY0 A;  5D3I B;  3WOE A;  1V1P B;  3RD4 A;  4C3J B;  2AUK A;  3NQT A;  5IT9 L;  4H13 C;  1BR9 A;  1FNW A;  2RVL A;  4X3T A;  3M4O B;  3DWP A;  4DU9 A;  1EOT A;  3K5M A;  3QOL A;  1XXG A;  3ND8 A;  3O13 A;  4NMZ A;  2NUC A;  4K14 A;  2EPB A;  3D6W A;  2NYZ D;  1JWU D;  2M2L A;  2PZT A;  2J0T D;  1SND A;  1SBB B;  1QCB D;  3GTG B;  5D14 A;  1STH A;  4C3H B;  1GUN A;  2DY7 A;  4H44 C;  2CVR A;  1JOO A;  2JE6 I;  1EEI D;  1KDA A;  3I3C A;  1R4P B;  4IUP A;  4PNY A;  2EDG A;  3TN2 A;  1EU3 A;  3H6M A;  3K5O A;  2BA1 A;  3C46 A;  1DCZ A;  1KDB A;  1RD9 D;  3FPP A;  1PTO D;  2PCF B;  2XWJ B;  3OWF A;  4DK0 A;  1SYC A;  2JEB I;  2F0L A;  4GZY C;  2EJF C;  2X6G A;  3A55 A;  1I4G A;  1JE4 A;  2F0Q A;  2KOL A;  1KDC A;  5I9P A;  4IUV A;  3TZU A;  1KAB A;  3OMG A;  2F0D A;  3I72 A;  3S1R B;  1PDQ A;  1OXS C;  3N6R A;  4KMU C;  3QO2 A;  4EQP A;  2LFN A;  1PZI D;  4F88 A;  4U67 3;  2F03 A;  1WTW A;  1AZQ A;  1STY A;  4KJN A;  2IL8 A;  3LWU A;  4B9W A;  3I90 A;  2WAQ B;  1D5X C;  2DNC A;  4XT1 B;  1LT4 D;  1WD0 A;  2PZU A;  1GUT A;  5T1G A;  1B53 A;  2A69 C;  2A68 D;  1OXV A;  2L12 A;  2Z4H A;  3I91 A;  4C3J G;  1WTX A;  5JJZ A;  1XX8 A;  1EIG A;  3J80 E;  1H9J A;  3I4L A;  3PO2 B;  5CV9 A;  1EIH A;  2L4N A;  2PQE A;  5I4D A;  1RDP D;  5EBD A;  2D5D A;  1CZG A;  2AUJ D;  5BN3 A;  2BOS A;  1TT2 A;  1PTO F;  3X3N A;  3NWT A;  5I9O A;  4C3H G;  4XQJ A;  2ZXP A;  3I4N B;  3BVG A;  2ZXO A;  1T5E A;  4ID6 A;  3SXH A;  2K32 A;  4KD4 A;  3NTK A;  2L11 A;  3BS1 A;  1PFB A;  4X3U A;  1I4H A;  2B39 A;  3TSS A;  2O5I C;  5EKK A;  4MIU A;  4IUQ A;  2B2V C;  4KK7 A;  4OIK A;  2E75 C;  1LO5 D;  3PO3 B;  1OXT A;  2B8F A;  4QIW B;  1NR2 A;  3A8I E;  1Q1E A;  1QWY A;  1TY2 A;  3DMU A;  1GXD C;  2IJ0 A;  2VB3 X;  4ZQ3 A;  2F0O A;  1K8M A;  4A3K B;  4HMJ A;  4A3B B;  2NVY B;  3MEH A;  3FMC A;  1TII D;  2L5T A;  4A3J B;  1HUN A;  2XRQ D;  1PRT B;  3KLS A;  3HOV B;  3VR3 A;  1W6J A;  5KRU A;  1T5X D;  2VUM B;  1B9N A;  1EYC A;  2F0S A;  2F0P A;  3C2P A;  3GTL B;  1SAP A;  3OIQ A;  2XRS D;  1A15 A;  1CTM A;  1F2Z A;  5EGT A;  2F0M A;  2XVS A;  4XXE A;  5ELB A;  5IGB A;  4FNF A;  4A93 B;  1JCK B;  4ULL A;  1WD1 A;  4ME5 A;  5FO9 B;  1MD2 D;  2XSC A;  1EEF D;  5HUR A;  2RSN A;  2F0U A;  2F0T A;  1GUW A;  4N9P A;  3S9W A;  2E74 C;  4M8A A;  3W2D A;  4ZYS A;  4DFA A;  4RAU C;  5IGC A;  4G7H C;  1CQV A;  5DAU A;  5KYL A;  3E5S A;  1Q8I A;  3A7L A;  1LTS D;  2A5H A;  2X6L A;  4Y7N B;  4F8M A;  5K36 G;  1F2M A;  2R6G A;  2A6H D;  3LNN A;  5CV7 A;  1RKN A;  1S5F D;  1IW7 D;  1BCP C;  2N55 A;  2JYO A;  3MA2 B;  3GTJ B;  5EPJ A;  3A7A B;  3NSW A;  1SEB D;  1G2S A;  2Q8I B;  1LTG D;  3FRP B;  3CU7 A;  1VMP A;  2E2J B;  5CGK A;  2E2H B;  3IFT A;  2NVX B;  4J6H A;  2KEC A;  3QJY A;  5T1I A;  5K36 H;  5C4X B;  1JOK A;  3E0J A;  3DWA A;  3GTO B;  2F0V A;  1DJR D;  1SNM A;  1STB A;  1GJX A;  1HA5 A;  3QB3 A;  3Q22 A;  2PW7 A;  4IQZ A;  5J1Z A;  2RDH A;  3BDL A;  1BDO A;  4OL7 A;  1QJO A;  4RCO A;  5JOB A;  5JEA G;  2OEO A;  2WV6 D;  1ILQ A;  4IUR A;  5E3F A;  3SK6 A;  2EYM A;  3KUP A;  1SNC A;  2KCN A;  4OO1 H;  2NVQ B;  4MHE A;  1TU2 B;  2B2U A;  5K5P A;  1SMY D;  5M9O A;  1CA5 A;  1WVL A;  3HOU B;  3HOX B;  4IFD H;  4C1N K;  4ILW A;  4I65 A;  1VF7 A;  3KF8 A;  2TSS A;  2C5C A;  4K8I A;  4C1N I;  5C6A A;  3K5N A;  4K8J A;  1UAP A;  1II3 A;  5JEA H;  4FO2 A;  1EL0 A;  5ELC A;  1EY6 A;  4FVM A;  3V05 A;  1MSG A;  4PV1 C;  2R92 B;  3BYT B;  4ZUI A;  1LTB D;  2HQE A;  2FMM A;  1ICW A;  2MJ8 A;  5FK9 C;  1AW7 A;  1PRT D;  2R3Z A;  1RHP A;  4PQX A;  5EBC A;  1HA6 A;  1TWC B;  3SDZ A;  2FIN B;  2I07 B;  3QWN A;  3K59 A;  1I3Q B;  1GHK A;  2H4O A;  1ET6 A;  1JQY D;  2EE1 A;  4F7X A;  1F9P A;  3FPU B;  1H9K A;  2CQA A;  1U4P A;  2F0I A;  3HS0 C;  1EWH A;  3AMU A;  4FXG C;  1IYU A;  4DNR B;  3OW7 A;  1SJH D;  5BN4 A;  2SEB D;  1JOQ A;  1ENF A;  3MVV A;  3SK4 A;  2B2U C;  4L6T B;  5M5X B;  3NQI A;  4RFB A;  5TSS A;  5EJW A;  3HGB A;  3NWS A;  4C2M B;  5M3F B;  4FF4 A;  5FO7 B;  2QCP X;  3RUZ A;  1BQQ T;  1TS4 A;  3SE0 A;  2EZV A;  1FGB D;  3D4R A;  5DEH A;  3EVQ A;  2JXM B;  4CJ0 B;  5I6Y A;  4DAP A;  4AYB B;  1PRT F;  1H9R A;  1E2V A;  5CBE E;  2IX3 A;  2NBF A;  1C4Q A;  3GP7 A;  1YNJ D;  1PTO H;  1SYF A;  3MZ5 A;  5G3L D;  2F0N A;  4OO1 I;  1TQO A;  4X3S A;  4L63 B;  1EU4 A;  4Z9C B;  1D6E C;  1SE3 A;  4IFD I;  3GTK B;  3JAM L;  1STG A;  3GV3 A;  1JC7 A;  2EY1 A;  4WRD A;  2EJM A;  3VYS A;  2WKC A;  1F2Y A;  2AQ1 B;  3DXJ C;  1DON A;  4IAL A;  1X3Q A;  3A8K E;  1EWC A;  3NTI A;  3GO5 A;  2L9H A;  4L8J A;  4KKS A;  2K1B A;  1PZJ D;  4XIG S;  5COY A;  3H91 A;  3R3O A;  4KHV A;  3T56 B;  2A6E C;  3DUZ A;  1BOS A;  2DN8 A;  1U4L A;  2XWB B;  1LV9 A;  2B2V A;  2RQX A;  2K7V A;  1Z6H A;  3HP3 A;  2AQ3 B;  1AZP A;  4TSS A;  2BE5 C;  3GQB A;  2O5J C;  1IYV A;  4TQU S;  4ZAI A;  2F0F A;  1Y8N B;  1QE6 A;  2EYL A;  4ZKB B;  3CRL C;  2F4I A;  3D6C A;  5G3L F;  2LY7 A;  5FLX L;  3T53 B;  2YYZ A;  4V0B A;  1I6V C;  1I4R A;  1IKL A;  3ERO A;  1V8Q A;  3Q23 A;  1KTK A;  4DF7 A;  1EY8 A;  1AEX A;  2E2D C;  1O80 A;  3KK7 A;  2FMC A;  3G7L A;  5CV4 A;  2IT1 A;  3FDT A;  1PYW D;  4KY6 A;  2F0G A;  3R8B A;  2B63 B;  1VF5 C;  2LKV A;  2SDF A;  1CFM A;  4A3D B;  4WFN 3;  3HKZ B;  1B9M A;  4IUN A;  2XN9 C;  1OO9 B;  1TY0 A;  1SE4 A;  3X3M A;  2RA4 A;  1FNV A;  4C3I B;  2WII B;  5KYI A;  3S2D B;  3FEW X;  1ZKO A;  3CHB D;  4DGZ A;  3K58 A;  1E2W A;  1Y69 U;  2EYO A;  2QIL A;  2Y0S B;  1QOH A;  1WCM B;  5JAV A;  1LT6 D;  1HFG A;  5IGG A;  4E6I A;  1SE2 A;  3P7J A;  1FD7 D;  3L3O C;  3ONA B;  1SSO A;  1H9M A;  1PFM A;  3BDO A;  4HSP A;  1UUP A;  1WTQ A;  1PMR A;  1A2U A;  1UNS A;  3TP8 A;  2KCC A;  3SK8 A;  4CKC A;  2F0K A;  2KUM A;  2PZW A;  4ABN A;  3I8Z A;  1IKM A;  5C44 B;  2CHB D;  1S5B D;  1ZXT A;  3S14 B;  3I73 A;  1KLU D;  4H7B A;  3KLS X;  1A3U A;  1H9S A;  1EQT A;  4UDU C;  1S5C D;  4C56 C;  2NWG A;  3MXG A;  1OXX K;  3CKI B;  5CV6 A;  1BF4 A;  1ZYR C;  4CGY B;  1HTL D;  3EQL C;  2L0C A;  5EKL A;  4BY7 B;  1HFN A;  3MXN A;  3MC0 B;  4CHT B;  2JSO A;  5ELD A;  2ICE C;  1VMC A;  1M4V A;  3MWY W;  1STA A;  1YNN C;  1EZ6 A;  4ZRZ A;  1KNE A;  2Z8L A;  4C3I G;  3S1Q B;  3V2T A;  1A3V A;  3J7A F;  5EKI A;  2VB2 X;  4I7Z C;  5C0X G;  5C4Z A;  4TKO B;  2B2W C;  3NBI A;  4A3M B;  4O42 A;  1NCV A;  2CW0 C;  5E4X A;  1G91 A;  2BA0 A;  2J7Z A;  1Q3L A;  3H94 A;  3JAM E;  2HCC A;  4PMB A;  5M3M B;  1BCP B;  3HRZ C;  1EFI D;  4G7Z C;  3D4D A;  2KJX A;  2A69 D;  3RZO B;  2ENB A;  1TS2 A;  2I46 A;  5FKA C;  3GTM B;  3AB9 A;  2F0H A;  2L55 A;  3M7N A;  2WIN B;  1K8O A;  4P2C B;  5C0X J;  2HDL A;  3NP8 A;  1NAP A;  4HR7 B;  5LHY 1;  5D3D A;  1TS3 A;  1HHV A;  2SNM A;  3P75 A;  1VCI A;  5I2Y A;  1BUV T;  2FHT A;  2PO4 A;  1ET9 A;  4KY7 A;  2PNR C;  3J7A V;  1ML0 D;  4IZ8 A;  3OIP A;  5A35 A;  4N9T A;  3VYU A;  1YNJ C;  3Q0A A;  4X3K A;  1Q90 A;  1EZ8 A;  3S17 B;  1TWH B;  1SFO B;  2MGS A;  1U4R A;  4XDX A;  3OHX C;  4NKL A;  4S3S A;  3HOY B;  1HUM A;  4FF2 A;  1HRJ A;  5FLX E;  2ZT9 C;  3NE5 B;  2EY6 A;  4KY5 A;  2KA7 A;  3SK5 A;  3OPO A;  4DAY A;  4RGT A;  1TKW B;  4PMW A;  1RCV D;  3KBX A;  1GOZ A;  5EPK A;  2K28 A;  1MSH A;  4BBR B;  2RDG A;  2K5D A;  3PMF A;  1F9R A;  2PPB C;  5CR3 A;  4XQN A;  1GUG A;  1C8C A;  4A3G B;  5KEE A;  1XTC D;  2Z1C A;  5C4H A;  1L0Y B;  1DXM A;  1CI3 M;  4IFD J;  2EYP A;  1LTT D;  2IPK D;  1J8I A;  3SEB A;  1LAC A;  1PTO C;  1F9Q A;  3R2I A;  4RHR A;  1G2T A;  1WTO A;  1LAB A;  2Q8R E;  1R4Q B;  4XYQ A;  1DD2 A;  3GTQ B;  2B2Y A;  3SHL A;  3NK9 A;  2EYJ A;  5D65 A;  3BZD B;  3VA7 A;  2XNA C;  2E76 C;  5LL6 X;  1CHP D;  3P20 A;  4MN3 A;  3GV6 A;  1SNO A;  1GHJ A;  5LL6 S;  1ILP A;  1PFN A;  4EVO A;  5JPN C;  2AWO A;  2LMC B;  4RGN A;  1V1P A;  3URY A;  3VA5 A;  4OGQ C;  2MP1 A;  1E2Z A;  2Z4I A;  2IWH A;  4FXK C;  4HED A;  1B50 A;  1SXT A;  2SNS A;  4QMG A;  1DOL A;  3RMH A;  1DOM A;  1LT5 D;  1DYQ A;  3HOZ B;  2IX1 A;  1JR0 D;  3TZD A;  3K6O A;  4FF1 A;  2A68 C;  2B8G A;  1OXU A;  1RJT A;  5IIF A;  5C3W A;  3PV0 A;  1ZEQ X;  1PZK D;  3S16 B;  1C48 A;  1KNA A;  1CA6 A;  1D1K A;  1ENC A;  1G29 1;  1TS5 A;  3SR1 A;  4FXD A;  4RKB A;  1VDZ A;  3NPP A;  2PYK A;  3W3A A;  4H0L C;  4CBV A;  1STN A;  5BN5 A;  5ELE A;  1FNU A;  4IN3 A;  1CT1 D;  3H3V C;  1Q1B A;  3F2U A;  1ROD A;  2AWN A;  4HAE A;  3D4W A;  3TP5 A;  5C4J B;  1AN8 A;  3TDQ A;  4U68 A;  4QUC A;  3DM1 A;  1BCP D;  3Q6S A;  4BY1 B;  2WKD A;  3PUX A;  5COR A;  2KED A;  1TR5 A;  3MXP A;  2K5Q A;  4WJW A;  1NUC A;  3I4M B;  1FR3 A;  1I4Q A;  1U9R A;  2B2Y C;  3FKI B;  5FOB B;  2HDM A;  2RKS A;  1A2T A;  1HCZ A;  2PW5 A;  2IX0 A;  5KNC A;  5CMD A;  4A3I B;  3KBG A;  1GUS A;  3PUZ A;  3VR4 A;  4DAV A;  5CV8 A;  4A3E B;  1G6Z A;  3RLF A;  1RTO A;  5C5L A;  2KQ3 A;  1D5Z C;  1TWF B;  4FYD A;  3G6J B;  5IGE A;  2R93 B;  3QIA A;  4CJ1 B;  5JVG 3;  2NTS A;  2K04 A;  2R7Z B;  3M4Y A;  4QCL A;  2BDN A;  2HUG A;  1B44 D;  4BBS B;  1EY5 A;  2E2I B;  4KKT A;  4Q5V A;  1A3T A;  2B2T C;  1SYE A;  3V96 A;  2QEJ C;  4CJ2 C;  5M5Y B;  2A74 C;  3IL8 A;  4KKU A;  3ND9 A;  2KVM A;  1NSN S;  3VR5 A;  3R93 A;  4O1N A;  2R61 A;  1TVX A;  4M1U B;  1EQV A;  2M9V A;  5DNF A;  4EQN A;  4K5X A;  2GA4 B;  2OF1 A;  3A56 A;  1BCP F;  2F0W A;  3A54 A;  1AFP A;  2EYH A;  1AP0 A;  3C1E A;  3J7Y W;  2DY8 A;  3HG9 A;  1SDF A;  2K01 A;  1WTV A;  3U9S A;  2ZXR A;  3NBH A;  4WOR A;  2XIW A;  3MHB A;  4KN4 C;  5F2D A;  1S4Z A;  4RA8 A;  4DXF A;  2JEA I;  2D9U A;  2V4D A;  3C1F A;  4B08 A;  3BYY B;  2WP8 J;  1BO0 A;  4K2K A;  1O7Z A;  4XT3 B;  3HZX A;  2MUY A;  1QNU A;  4DN4 M;  3C3L A;  2RDF A;  4QF4 A;  3Q24 A;  2G9D A;  3MAQ A;  1B1Z A;  1QB5 D;  5KIX A;  5KND A;  4NDX A;  4XTC S;  1LLR D;  2RSO A;  1LTI D;  4RKL A;  4KTA A;  4BS9 A;  3OWE B;  5A2Q L;  1QNK A;  2A6H C;  1NR4 A;  2H1E A;  5IOC A;  5CV5 A;  3D31 A;  5HGT A;  1IW7 C;  2NB0 A;  1Y8O B;  1SYD A;  1O7L A;  2NN6 G;  2N88 A;  3EFX D;  1Y1W B;  5M5W B;  2EYF A;  4DXG A;  5I2X A;  1HQR D;  4DK1 A;  1G8Z D;  2BCO A;  4KHZ A;  1D5M C;  3MFG A;  1D1I A;  1SNP A;  5C5M A;  3LX0 A;  2MPM A;  2DNE A;  4RH6 A;  2VXW A;  4K2L A;  3AU7 A;  4LMQ D;  1Y1V B;  1STE A;  2QKI C;  2F3V A;  5CYU A;  1JWS D;  3T51 B;  2WAC A;  2NN6 H;  3J81 L;  3S15 B;  1DZ1 A;  4PMC A;  4RCN A;  4V19 0;  2B2W A;  5CC4 A;  5JVH 3;  1XYI A;  1CM9 A;  5IGD A;  1SYB A;  1CHQ D;  4EQO A;  4RGO S;  3H0G B;  1F9S A;  5IOD A;  1GUO A;  4DA2 A;  3PIO 3;  2K5W A;  1KAA A;  1SMY C;  2BDO A;  4B9X A;  4HCS A;  4HMI A;  2JA6 B;  1V1O A;  4HN7 A;  3TP6 A;  4QUF A;  2NTT A;  3RZD B;  5E4W C;  1Y8P B;  1XWE A;  1TWA B;  2QF7 A;  3HEJ A;  1BNZ A;  4KV6 A;  3M85 A;  3WDN A;  3M7G A;  1SNQ A;  3T4A C;  3K7A B;  1Q12 A;  3BG3 A;  3WOF A;  3OSO A;  4ZUJ A;  3OOC A;  3CQZ B;  3IKJ A;  1A6X A;  3VYT A;  4J8Q A;  3PUV A;  5EPL A;  2IW3 A;  4HTH A;  5J39 A;  3NHH A;  1PRT C;  2JA8 B;  3I70 A;  1MGS A;  2HCI A;  2A6E D;  1LT3 D;  5KNB A;  3ERQ A;  4G7O C;  5AFW A;  5JPM C;  1O7Y A;  3MTS A;  3DWQ A;  3BVM A;  3TME A;  4G4K A;  3NTH A;  3GTP B;  4A3F B;  4IUT A;  2C9O A;  2FFK B;  1DM0 B;  1LTA D;  4F87 A;  2KEE A;  2BE5 D;  3MXU A;  2J4X A;  4BA1 I;  4BA2 I;  4CKB A;  5CBA E;  2EY5 A;  2F0J A;  4DNT B;  5DM7 3;  2TMP A;  5FO8 B;  2K03 A;  3BDC A;  3KLR A;  2F3W A;  1JWM D;  2PMZ B;  4EGV A;  3EJI A;  5IT9 E;  4ZKC B;  4RWS C;  2MHV A;  3D8G A;  3IAY A;  1E0B A;  1SYG A;  1JOR A;  2SOB A;  4BWG B;  4LK1 C;  2O2L D;  2WB1 B;  1ENA A;  3E6Z X;  5ISR A;  4KJO A;  5C0X H;  2NVT B;  3CRK C;  1MI2 A;  3P1H A;  3K0Y A;  3L9A X;  5J22 A;  3ITP A;  1ONL A;  4TRD A;  3S1N B;  1S5D D;  1H9S B;  1V43 A;  1CZW A;  4JBW A;  3S2H B;  4UAI A;  1F77 A;  1EY4 A;  3DEO A;  2NN6 I;  4OHJ A;  1TWG B;  1FYC A;  4QB4 A;  1KLG D;  5DM6 3;  2X69 A;  3VR2 A;  3N52 A;  2QDB A;  2ID0 A;  4KD3 A;  2KHS A;  3PIP 3;  1Z47 A;  4OO1 G;  3IFD A;  4KN7 C;  4G57 A;  2JP1 A;  3HOW B;  2JA7 B;  1WTP A;  1L0X B;  2A73 B;  2YU9 B;  1I50 B;  1IL8 A;  4IFD G;  1ESF A;  5KGU A;  4NW2 A;  5ELF A;  2K33 A;  3VR6 A;  4K5V A;  3SVM A;  1X32 A;  4XYO A;  2FJ2 A;  3ZYY X;  4R9W A;  1X3P A;  3VYR A;  5IGF A;  1QIL A;  2OXP A;  3NUC A;  2NZ1 D;  4XQQ A;  3R2T A;  3J80 L;  1HXY D;  1M8A A;  3M3Y B;  2OT2 A;  5A2Q E;  2F1M A;  1W6K A;  3K5L A;  1PTO B;  3S1M B;  1BXT A;  2K05 A;  3T13 A;  3PUY A;  2JA5 B;  1J9O A;  5JEA J;  4Q0F A;  1WTR A;  3GD7 A;  2EY2 A;  2L1B A;  3L7Z C;  4ZK9 B;  1CQF A;  3OMC A;  4K6D A;  3QOJ A;  4LAA A;  4KI0 A;  4FP5 D;  1Z7T A;  4K5W A;  1B4O A;  1JIC A;  4ODG A;  1EYD A;  2RBM A;  4LJZ C;  1I6H B;  1ZYR D;  3J81 E;  1EYA A;  2EVB A;  1S5E D;  3U9O A;  1CK1 A;  1EY7 A;  3UI2 A;  1HQM C;  5I6W A;  2EOT A;  1U4M A;  1UEA B;  1LTR D;  1I4X A;  1F2L A;  1HTP A;  2F0E A;  1YNN D;  3PUW A;  2EJG C;  2B2T A;  1ESR A;  3D3R A;  4R8N A;  3EA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...