3A7AB

Crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
NVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Lipoate-protein ligase A
publication title Global conformational change associated with the two-step reaction catalyzed by Escherichia coli lipoate-protein ligase A.
pubmed doi rcsb
source organism Escherichia coli
total genus 24
structure length 127
sequence length 127
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a7aB00
4IQZA 2K7VA 5K36G 3OOCA 2BE5D 2IT1A 3A8IE 2F1MA 2EJGC 3AB9A 1Q90A 4IFDH 3A7AB 1HTPA 2AUJD 2E75C 1H9SB 2A68C 2B8FA 4DK0A 1TU2B 4KN4C 1H9JA 1GUSA 2A6ED 2PCFB 3I73A 3MXUA 2A69D 2AUKA 2EJMA 2LMCB 2R6GA 3T56B 3I4LA 2DN8A 1QJOA 2E74C 3VR6A 1OXSC 2D2CC 2V4DA 1ZKOA 2BA0A 3OPOA 3NE5B 1GJXA 1ZYRC 3HGBA 3VR2A 1BDOA 1K8MA 1T5EA 5JEAG 1IYVA 1IYUA 3CRKC 3MFYA 2JEBI 2A6HC 3BG3A 4KHZA 4BA2I 3FMCA 2O5JC 4TQUS 4L8JA 2EVBA 2O5IC 4TKOB 4G7OC 2A68D 5KNCA 1HPCA 4IFDG 1G291 1V43A 2AWOA 3ND8A 1GUGA 3M4YA 2BA1A 2EJFC 1EWHA 4G7HC 1O7LA 2DNCA 3LWUA 2Q8IB 1B9NA 3A7LA 4BA1I 5A35A 1YNNC 1FR3A 1OXVA 2E76C 3PUYA 3U9SA 1OXXK 3M85A 1I6VC 3PUVA 2NN6H 4OO1G 2A6HD 1Q1EA 1ONLA 4LK1C 3IKJA 1Y69U 3P20A 3IFTA 1GUOA 1OXTA 3GQBA 4OGQC 5K36H 3PUWA 1FYCA 1H9SA 1H9KA 3PUXA 3N6RA 4KMUC 3WDNA 5BN3A 3I72A 3SE0A 4DNTB 2B8GA 2K32A 3FPPA 4RCNA 2QF7A 4JBWA 3SDZA 4H13C 2PPBC 1GUNA 3A8KE 5KNDA 3TZUA 3VA7A 3H94A 1TKWB 3PV0A 3PUZA 4H0LC 3VR5A 2KCCA 4DK1A 2BDOA 3QG1A 2JXMB 1SMYC 1A6XA 1H9RA 3D4RA 2D62A 1Z7TA 1IW7C 1GUTA 4XIGS 5KNBA 2JEAI 4H44C 3RLFA 1E2WA 4JK1C 5C0XH 2PNRC 2ZT9C 3W3AA 1Y8PB 3L7ZC 4DNRB 4KI0A 1E2VA 3KLRA 2DNEA 3M7NA 4GZYC 1K8OA 1VF5C 3CRLC 1PMRA 2K33A 2YYZA 3VR4A 5BN5A 1DD2A 4KN7C 1Q12A 1CTMA 1Z6HA 4HR7B 3T53B 1O78A 4LJZC 3ND9A 1CFMA 2BE5C 3T51B 1LACA 1E2ZA 2D5DA 3QIAA 2EDGA 3DXJC 1HQMC 2NN6I 3LNNA 3OW7A 4KKTA 1Q1BA 2KA7A 1H9MA 3A8JE 1IW7D 4XTCS 1CI3M 1GHJA 3GD7A 3QJYA 1B9MA 1DCZA 1V8QA 1VDZA 1DXMA 4PV1C 4OO1H 1GHKA 1Y8OB 2A6EC 3BDOA 1OXUA 1VF7A 2A69C 2L5TA 3EQLC 2NN6G 3D31A 4KKSA 1YNJC 3VR3A 4I7ZC 2CW0C 5JEAH 1Y8NB 5C0XG 1VCIA 4KKUA 5BN4A 1HCZA 2JE6I 1LABA 4G7ZC
chains in the Genus database with same CATH superfamily
4E6IA 1WVLA 1I4XA 1WTOA 4CGYB 2EYHA 3T4AC 5EPJA 1PDQA 2F0IA 3I73A 3RZOH 2C35B 4C56C 3EIVA 4DK3C 4GS3A 4DF7A 5FJ8H 2B63B 2N3SA 2UXDL 4QJFA 4X64L 2JA7G 3TSSA 3VR2A 3MFYA 1MIUA 4BA2I 3HKZE 2F0TA 1PH6A 3KOJA 2YTVA 5FLXc 4A3DH 2AWOA 2KUMA 2ZJPA 2EXZA 4JPBW 4B9WA 2NVYB 4A3BB 2FJ2A 3PUYA 3TP8A 2MGSA 4Y52H 1XXGA 1SROA 4NXNL 3MXNA 2K6AA 1O80A 3J7ZC 1I50B 2SNMA 4CKBA 2JN4A 4IPHA 4BBSB 4GOPB 1JR0D 3GO5A 1PA6A 2F0DA 3BVGA 1VQHA 5BN3A 1A63A 5GAGC 2IJ0A 2B8GA 4JI4Q 4A3MG 4UP8A 4KHPL 3MFGA 4JBWA 3KF6B 1VQFA 4R9WA 2L9HA 4H0LC 3OW2A 3HFZB 1F2ZA 3HOXG 2F3IA 4A3KB 5KEEA 3I4MB 5CC4A 4BY1B 2IHEA 3ER0A 2PMZB 5D65A 1JOKA 1SAPA 1LM0A 1RDPD 1PRTC 5CYUA 2UXDQ 5C44B 3VR4A 1C7YA 3FVQA 3MC0B 4Z9CB 3PIPA 4G57A 2JA8B 1O78A 4HJ7A 1SNOA 4B3RL 2F4VQ 2RDFA 2NN6I 5NUCA 4A93G 3NEMA 3QJYA 3PSIA 1V8QA 2RCFA 2A6EC 4CHTB 2L5TA 1UE1A 2VY3A 4KK7A 3S1NH 4ME5A 2UU9L 3TZDA 3ERQA 2WFWA 4NXNQ 3TDQA 3VYSA 1UWVA 4CKEA 4EQPA 3A7AB 4IUTA 3RN5A 3OSOA 1Y1VG 5IGDA 4DR7L 5M3FG 1SE2A 1GUSA 2JYOA 1G2TA 3ZYYX 5LMUQ 5HGTA 4BXXG 2G5DA 2RHQB 4YWMA 1QZGA 1PFNA 3OWEB 5ELBA 1L0WA 4FVMA 4J15A 4C3HG 2JEBI 4KHZA 1Q8KA 3SGIA 2ES2A 1TVXA 4TKOB 1I94L 4G7OC 2JJQA 1GD7A 2WIIB 4IFDG 2K75A 1V43A 2EPBA 3L3OC 2PW7A 2F4IA 2IX0A 1JOOA 3HOWH 3MVVA 1Y1WH 5IYBG 4OXPA 3U4ZA 2E76C 1K28A 5GADC 4B3RQ 1MI2A 1Y69U 1GOZA 1B2TA 2RKSA 4DK6C 2PO4A 1IYJB 1CK1A 4IOCA 3FKIH 4A3LG 2B2YC 1K0RA 3CD6A 1TS3A 1VQ7A 4UP9A 3HOYG 4HCEA 1HNZQ 4RCNA 1EU3A 2HD3A 2PZTA 1HZ9A 2OQKA 1HNXQ 5EAYA 1TKWB 1VQ5A 4RGMA 3VR5A 1K9MC 4YY3Q 3HZXA 3GTKB 3A0JA 2EE1A 1SBBB 3ITPA 1ENAA 5KRUA 1IL2A 1EY0A 2AQ3B 4A3FH 4DR7Q 1Q46A 2O4XA 2RA4A 1EYCA 4JOIA 1QCBD 4X62L 4GNXA 2WAQE 4RGOS 3VYUA 1VQ8A 3PIO3 3NBHA 1PTOH 1PZJD 2CHBD 2G9DA 5FLMG 4QQBX 1EOTA 1HHVA 4HEDA 5ISRA 5J3BA 3S1MH 3HOUH 2OTLA 2Z0SA 5J1ZA 4MTNA 4LF6L 5IT9E 5KIXA 1FNWA 1I4RA 3EA6A 3DM3A 1CUKA 4LFCQ 4RGNA 2VQEL 4AYBE 2UXCQ 3A55A 3M4PA 4ODGA 2B63G 2PW5A 2NB0A 3I7FA 2K03A 3AQQA 2FHTA 1C48A 2R6GA 4DR6Q 3I4LA 2QA4A 4JI8L 2VW9A 3BS1A 4DV5L 2CW0D 3FEWX 2BA0A 4DV4Q 4M1UB 1VQKA 1HJPA 5KYLA 3WOEA 5I2YA 4I65A 3O13A 1T5EA 5JEAG 1PHJA 2B29A 1G91A 1FGUA 2O5IC 2R7ZH 1T5XD 3AYHB 5FLXE 4FP5D 1GO3E 4A3BG 1PTOF 1EY4A 1CA6A 4O0AA 2AQ2B 2RCNA 1N32L 3G48A 5HY6A 3I4NB 5LMNL 4RGTA 1EQTA 3QO2A 4X62Q 1SE8A 4BBSG 1GVPA 3VYRA 1QNKA 4A3EB 1D7QA 3CKIB 1WTWA 4OO1G 1G6PA 2F0WA 1NUCA 3BVZA 1B7YB 2UUCL 1AZPA 1D6EC 4FF1A 1A8VA 2UXBL 3CC7A 2B2UA 1EIGA 4C1NK 1F2MA 2TSSA 4OGQC 1EQQA 2Z9HA 4RAUC 5DM73 1TS4A 2K5HA 1EYAA 4A3KG 3I4MG 4BY1G 3PV0A 2WB1B 4RHRA 3MEHA 4KJOA 3H3VH 1A6XA 5J22A 2DY8A 2K14A 5C44G 2ZXRA 3KF8A 1HZBA 1Q81C 2ZT9C 4R1JA 3KDFA 2JA8G 3GTLH 1HFNA 4KV6A 2DNEA 3SR1A 1A2TA 2E2DC 4R8IA 2E8GA 1EZ6A 5EQ0A 3TBIB 1C4QA 1JC7A 4K14A 4A76A 1VQEA 1WTQA 3HP3A 4JI0L 3HKZB 4NKLA 4WJWA 1P8LA 1GHJA 2MO0A 3K59A 1W3SA 1STBA 3SVMA 1D5MC 5LMNQ 4JI5Q 1XYIA 1TR5A 5FOBB 4LUOA 1MSGA 4GLVB 4UP7A 3S1RH 3IL8A 2HDLA 5K36G 2BE5D 4U673 3AFPA 1Q90A 3DWAA 2UUCQ 4JBMA 2CH4A 3TMEA 1KQSA 3CMEA 4K0KQ 2OXPA 1EWIA 2RBMA 2I46A 1NR2A 4KN4C 1ET6A 3WOFA 2AQ1B 1YNJD 1EY7A 1OXSC 1ZKOA 2UUBL 2NVXH 1IBLQ 4JBKA 3D6WA 3SHLA 2NZ1D 4DAMA 4GLXA 2RVLA 4K2LA 1P16A 4TQUS 4L8JA 5A2QE 1BO0A 3S1NB 2KHJA 1HPCA 1L1OB 5ELCA 1HXYD 2LFNA 1WCMH 4FNFA 4DGZA 5BR8Q 1EWHA 4LF4L 2DNCA 5J39A 1B9NA 3A7LA 4JBJA 5CBAE 4LF5L 1SNDA 4DUZL 3U9SA 4JI0Q 1E3PA 3E0EA 4L5SA 2A6HD 1AFPA 1RODA 3H0GH 4LFBL 4EQ5A 1BBUA 3I55A 1ENCA 4P2CB 4GKKQ 2F0EA 4A3CG 4IPCA 5KNDA 3OTOQ 1PXUA 4N8FA 4XQNA 1LT5D 1DM0B 3Q24A 1I4GA 2F0KA 4GLAC 1KIXA 2EYOA 1MBYA 4AIMA 2WKDA 4XIGS 2HIVA 5IT9L 4H44C 4OX9Q 3HOWB 4JK1C 4DV7L 1Y1WB 4XQQA 2EXDA 1CT1D 3KLRA 4MHEA 2F3WA 4DKAC 1W6KA 3EN2A 1MD2D 3H15A 2RSOA 1Z6HA 4DV2Q 4CBVA 4IOAA 1D1KA 1E2ZA 4BA1I 3ULPA 1RKNA 4RH6A 4OIJA 1TWFH 1GM5A 1EL0A 3U9OA 3GP7A 5JEAJ 1LTSD 2KHSA 4IPGA 3EQLC 1LT4D 2NN6G 1B44D 3AFQA 1ASZA 2CW0C 4KY6A 4QGUA 2JE6I 1ESRA 4JOIC 1NNXA 4MNOA 1PH9A 2VUMH 1I6HB 3E6ZX 1AN8A 4GNXC 4PMCA 5FLXL 3NUCA 3OIQA 4ZKBB 4DK0A 3CCUA 4A4IA 1LTGD 3MXUA 2A69D 3ULJA 1OTCA 4N9PA 3HGBA 1K8MA 3T16A 1FNVA 3S1MB 3HOUB 4DR3L 2VB2X 4C2MH 3I4NG 3HS0C 1TWGH 4I7AA 5KNCA 2EQSA 1BR9A 1RTNA 2J4XA 5EKLA 5IP9H 1K0SA 4UDUC 1PFMA 2R92B 4X3KA 4DV7Q 3FHWA 4A3EG 1FL0A 1NE3A 1NR4A 4HCSA 3S16B 2WAQB 3K7AH 3SK8A 2K5QA 4G7ZC 4L5TA 4XYQA 1VQ4A 2BH2A 5H1SE 3M85A 1JWUD 1STNA 2Z4IA 4JI2L 3F2CA 1XTDA 1ONLA 5C3XA 4A3JH 4EQOA 4FYDA 4Y7NH 1EEID 5EPKA 1TWHH 1VQGA 3D3RA 1EY8A 2SEBD 2B2YA 4LF7Q 1PYBA 1SMYD 2KHIA 1CKNA 2JA6H 4AYBB 3S14B 4UY8C 1B50A 1KLGD 3E3XA 1DYQA 2I5MX 1GUTA 1Q8IA 5KNBA 5EGTA 2B2UC 2PNRC 5C3EB 3S2DH 1B4OA 2FXQA 3HKZG 1STYA 1I4PA 3A5ZB 1D5XC 1F9SA 3PIP3 1U4PA 2BE5C 1CKMA 4DR3Q 1HQMC 1VMPA 1U4MA 4YCUA 3A8JE 4O2DA 1NCVA 4RCOA 4DA2A 4PV1C 2B2TA 3BZCA 2MHVA 2CWAA 5C5LA 1IXRA 1YNJC 4BWGB 4JI1Q 3R93A 3PMFA 4HIOA 1FGBD 4MIUA 2L11A 1SLJA 2Y0SE 2EYJA 5A2QL 1TWCH 2KCTA 3QOLA 4KY5A 1L2FA 3K5NA 4XT1B 3NQTA 3GTLB 2E75C 3KLWA 3AEVA 3UE0A 4YCVA 3J7AF 1HFGA 3G6JB 2Q2UA 5I4DA 2F0FA 1LTAD 2A1AA 2ZTDA 4WFN3 1NMFA 3CPFA 4R8NA 2Q2TA 1PRTF 4JI4L 3RMHA 2LXKA 3CAMA 2A6HC 4C3JB 2F03A 3HOVH 4HMJA 3OHXC 1B53A 3K8AA 3RN2A 3S15H 2GN5A 2R93H 3D0FA 1IBKQ 2F0UA 1LO5D 1SNMA 1PFSA 5AJ3L 4LUVA 3CF5A 4FXKC 3S1RB 4DXGA 2E2JH 1A0IA 1II3A 3FDTA 1KTKA 1VS0A 4PZ7A 3CHBD 5A35A 4JCVE 1HR0W 3FPUB 2BCOA 1TWAB 1DOLA 2QDBA 3DHQA 1E1TA 1YJ9A 1LT6D 2NVXB 3K0XA 1H9KA 2M2LA 2F4VL 3KYHC 4R4TA 1HH2P 1PH1A 1ZXTA 1K8AC 3J81i 2K28A 2L0CA 3URYA 3HOWG 1Y1WG 4XXEA 2PI2E 2JXMB 2E5LQ 1STGA 3M3YB 3M4OH 4POFA 2ZM6Q 5C0XH 2G9HD 2HUGA 3L7ZC 3FKIG 4KI0A 5M5XH 3FP9A 2CWPA 2DGYA 2F0VA 3CRLC 1PMRA 5CV8A 1VQOA 2NVTB 3H0GB 5M9OA 4BBRH 3PO3H 1Z47A 4LJZC 3NPPA 5LMUL 1G6ZA 4QUFA 1KC8C 4LF9Q 1SNCA 4LFAL 1K83H 3OW7A 3J7YW 2PQAA 3K0YA 3K81C 4DAYB 4LF8L 4AH6A 3CP0A 2VNUD 1OXUA 1WTRA 2A69C 2NVQH 1QILA 2NZOA 5C4XB 4PG3A 2F0JA 5AJ3Q 1ET9A 2K5VA 2TMPA 5M3MH 2A5HA 3RD4A 3MXPA 4R4CA 2F3VA 1QZHA 3AB9A 1BUVT 3KDFB 3SK4A 1SFOH 1AE2A 3F2UA 2NTSA 1CHPD 1HZAA 2LS01 4JI7Q 1TY2A 1ZYRD 2EOTA 5CV5A 1D5ZC 3Q8DA 1QJOA 3HOUG 4C3IH 4J1MA 3R8BA 4HAEA 1CZWA 1W2BA 4YIJA 1BDOA 4DUYQ 2F0LA 3CCSA 1TWFB 1HNZL 2R92G 1LYLA 2P5ZX 3MZ5A 1HNXL 2WAQG 4IUPA 3V2TA 4YY3L 2XRSD 3NBIA 1S72A 1IBML 4DN4M 3ND8A 1X55A 4WORA 3S1QH 3STBC 2VUMB 2MQHA 3GTPH 2K4KA 3RZDH 1O7ZA 2YV5A 1JB7A 4WJ4A 3W2DA 3HKSA 3S24A 4LWCA 3GTOB 4OL7A 1OXXK 1UEBA 1S4ZA 2F0MA 4JI3Q 5I6YA 1VQ6A 1Q1EA 3R2TA 2EYFA 2NTTA 4LFAQ 3K58A 1Q86C 2QILA 2QEJC 4LF8Q 2R7ZG 1JJ2A 3CQZB 5GAEC 4AYBG 3SE0A 2QKIC 3TREA 4DNTB 1NSNS 4X3UA 5FO9B 3RUZA 2QF7A 1Y14B 1UE7A 2NBFA 1SMXA 2HDMA 4CDCC 1GUWA 1UAPA 5C3EG 4R4IA 1SE3A 2H1EA 2JQOA 4LFCL 2JA7H 3CCEA 5IGBA 3A74A 3BZKA 5CV7A 3K7AB 4OWTB 2VZAA 5I9OA 2KEDA 3CCVA 4ZUJA 2UXCL 2XRQD 4XT3B 2F52A 1KABA 3GTMH 4LW1A 3S2HH 4DR6L 1VQLA 1S5CD 2DY7A 4AQYL 4Y7NB 4DV4L 1PH7A 1TWHB 1BF4A 4HIKA 1H9MA 4CJ2C 1S5FD 3GD7A 2ZJRA 3ONAB 4CDDC 3BYTB 5C0XI 3KFUA 1DOKA 1IBMQ 1WTHA 4YWKA 1HZCA 1F2YA 1D1IA 1VF7A 4NMZA 3TRZA 5G3LD 5M5WB 4I7ZC 2FFKB 1E0BA 1Y8NB 2SOBA 3X3MA 2XGTA 5ELNA 1J8IA 1M1KC 4JI6L 2A8VA 2IX1A 1TT2A 1SYGA 1UEAB 3A8IE 4A3MH 4P74A 3T1YQ 3HEJA 2PZUA 1TXYA 1SYEA 3S2DB 1X56A 1H9SB 1TU2B 4IUVA 3JAME 3HOXH 3KJPA 2YU9H 1IZ6A 1C0AA 2B2TC 2E74C 3PO2H 1RIPA 4C3JG 4GN5A 4FXDA 1NAPA 2D9UA 4ULLA 1IYVA 4B3TL 3SK5A 2XIWA 5M5YH 2O5JC 3LWEA 4DU9A 3EROA 2ZJQA 2HT1A 1VQMA 1DZ1A 1CM9A 1KNEA 2AWNA 4X3SA 5IYDG 4IALA 4CJ0B 1PH4A 4AQYQ 5GROA 3EJIA 4RKLA 3PUVA 3ULLA 3SXHA 4IO9A 1EYGA 2YTYA 3P20A 5ELOA 2RDHA 1KXLA 5IY0A 1GUOA 1OXTA 4MTKA 2L1BA 2B2WC 2Z4HA 3GV3A 1YJNA 1U9RA 1MGSA 4DR2Q 1Y1VH 5COYA 2I5HA 1I3QH 3FPPA 1ICFB 2EIFA 4K5VA 5M3FH 1YNND 3MAQA 4DR1Q 2LKVA 2Y0SB 4HJ5A 1KD1C 4JI6Q 1AH9A 3OIPA 4JI5L 4DV6Q 1BCPD 1QUQB 4DK1A 3QOJA 3MWYW 1F9RA 3MHBA 4BXXH 2LSSA 3I90A 2VL6A 5FK9C 5CMDA 1JORA 2E2JB 1E2WA 1L1OC 3RZOB 1DGSA 1ICWA 2BDNA 3H0GG 1EIHA 4HJ8A 4H7BA 4K0KL 2V1CC 1FJGL 2KECA 1YNXA 5E4XA 1ENFA 2YYZA 3NTKA 4ZKCB 3J81E 1QWYA 4K6LA 1YITA 4PQXA 3G71A 4B3TQ 1IBLL 5C4XG 3GV6A 3WDNA 3CPWA 4V0BA 2I07B 3A54A 2F0OA 4L63B 4A3DB 3T13A 1QE6A 4GOPA 2K5DA 1EIYB 1EU4A 1ILQA 4WRDA 1NBWA 2HCIA 4A3LH 4QMGA 1LABA 3KF6A 5BR8L 3M4OB 1G51A 3L9AX 3HOYH 4IJLA 1SJHD 1A62A 1TY0A 1A2UA 1XNQQ 5T1IA 2F0HA 4HJ9A 1V1OA 4RKBA 5IE8A 3UDXA 2HHHL 2CCZA 1O7IA 2PCFB 2K5NA 3WWVA 3PO3B 4BBRB 2VQFL 4KLKA 3BU2A 1RJTA 3C2PA 1K83B 1L0XB 1EOVA 1LT3D 1WTVA 4GKKL 3H09A 2Q8TA 1IYUA 2J7ZA 1WTXA 3BVMA 3KBGA 2VUMG 2X69A 3OTOL 4IFDJ 1HTLD 2WINB 1VQNA 1JWSD 4GKJL 1AW7A 4IN3A 3GTJH 3T1HQ 5FLMH 1FJGQ 4OX9L 1JOQA 1LUZA 4DAVA 3GTGH 4HSPA 3VA5A 4HIDA 2OQ0A 4LK1C 3IFTA 3J80E 5GQOA 3ZJYC 4DV2L 4YHHQ 1FYCA 4NB3A 1K3RA 4O1NA 2IWHA 1KRSA 3PIOA 3GDEA 1WI5A 4ZUIA 3A8KE 3D6CA 2YTXA 1F9QA 1SXTA 3PUZA 1BCPF 3N52A 3DWQA 3IRBA 3P75A 1SE4A 1Z7TA 3G4SA 2HHHQ 1SYBA 3RLFA 2Z6KA 2CVRA 4EVOA 3W3AA 1Y8PB 3I2ZA 5LMNW 2NVYH 2VQFQ 1Q7YC 4A3BH 1PV4A 2H4OA 1DD2A 2ICEC 1MSHA 5IWAL 4FO2A 1MJCA 1SYCA 3ND9A 1LACA 1I50H 1VQ9A 1N8RC 1M8AA 4F7XA 2Z1CA 3JAML 3J7A5 4BBSH 1GXDC 1CZGA 4OO1H 4GKJQ 1Q3LA 1FD7D 4FXGC 1J5EL 3I56A 1SEBD 2UUAL 4B3MQ 1LTRD 3MXNB 2SDFA 4R4QA 3I4MH 3CCRA 4BY1H 5C4HA 2AUJD 3SK6A 1WJJA 3MA2B 4A3IH 3FKIB 5E3FA 3H3VI 3T56B 3S2HB 1YBYA 2ALYB 2EYLA 3P7JA 2D0OA 1B3AA 5E1FA 4BS9A 3RR5A 3K7UC 3NE5B 5C44H 2PQAB 4TSSA 1WYDA 4HN7A 4C1NI 3F2BA 2H5XA 2JA8H 4LF7L 1FVIA 3CCLA 4QIWE 1EEFD 2BOSA 1N33Q 4A3FB 2EZVA 3EBEA 1YIJA 1FNUA 2XSCA 5IGEA 4Q0FA 1CSPA 5LL6X 2B2VA 1YNNC 3UI2A 5IYCG 5IWAQ 3JC66 1BCPC 4A75A 3H91A 1L0YB 1PTOB 2X6GA 2IW3A 2ASBA 4IUUA 5T1GA 3PO2B 1ILPA 2EY2A 5K36H 2Y0SG 2QW7A 4QUCA 4KMUC 1J5EQ 3J81L 1K73C 2UUAQ 3DEOA 4RHSA 2NYZD 3DMUA 5IP7H 1IKMA 2B39A 5M5YB 1PH3A 4JI1L 3NQIA 1JB3A 3VYTA 5FKAC 2RQXA 3NSWA 2IY5B 2MJ8A 1HUMA 1H9RA 3NTIA 5FJ8G 3SEBA 4IPDA 1UE5A 1HA6A 2N8NA 3PF4A 3L2PA 4Q5VA 2KBNA 2K33A 5BN5A 5EKKA 4LAAA 3LGJA 5DLQE 3A56A 4A3DG 2KOLA 2E2HH 4CKCA 5E4WC 3DWPA 5JVG3 2K50A 3BZDB 5I9PA 3QIAA 4KKTA 5DNFA 2R7ZB 5C4ZA 5L37A 1JT8A 1X32A 1B9MA 1I3QB 2C9OA 4ZK9B 4JC0A 2J0TD 3HOZH 1E24A 4JYAQ 5HURA 1IBKL 5C0XG 4F88A 5BN4A 1TS2A 1B3QA 4QF4A 5C6AA 3M4QA 1F77A 3J7AV 2N88A 3GTKH 2IT1A 3M7GA 2IL8A 1N34Q 4CDFC 3PO3G 4BBRG 1NY4A 1X3EA 5C4JH 3PGZA 1VMCA 3E5SA 2RF4A 4DNIA 2QEXA 3VR6A 4GOPC 2F0SA 3W1BA 2AHOB 4X66L 1XPOA 1M4VA 3JAMi 1SYFA 1PZKD 2GA4B 3BDCA 3J80L 1KHIA 2E2IH 1T9HA 4LMQD 2EVBA 4EX5A 4X6AH 4DPGA 4P72A 1GUGA 2E5LL 4DV1Q 1QVCA 1WOCA 2ZM6L 4GNXB 3G6EA 4HIMA 1QVFA 4XYOA 4JV5L 4F87A 3W5OA 3JAMc 5CBEE 3NBHB 1TIID 2NN6H 5HGQA 3IKJA 4BY7H 5D3IB 1X3GA 4DV3Q 4WJ3M 2XWBB 1NTGA 1C9OA 5IGGA 4LF9L 4KTAA 2N78A 3PUWA 2B2WA 3GTQH 1EY5A 4K8IA 2FINB 2K32A 3SDZA 4H13C 1QB5D 1SRUA 3NELA 3TN2A 1LTID 1HNWQ 1VQAA 4QB4A 3F8TA 3U4VA 4EQNA 1V9PA 3QG1A 3RNUA 3OMGA 1JWMD 2JK8A 2JEAI 4A3GH 5D3DA 4G4KA 1PH8A 1EY9A 2KQ3A 3GTGB 2Q2HA 3I4NH 1L1OA 4JI7L 1UE6A 1QG7A 4X66Q 3K57A 2WB1E 3I8ZA 3E0JA 4UAIA 4A3EH 1Q12A 3NXWA 5E7NA 4X65Q 4KY7A 1DONA 2EDGA 1R9TH 4DUYL 4DV0Q 1XNRQ 1KRTA 3J81j 1DCZA 1J6QA 4IURA 4ZCKA 2R3ZA 2F0QA 5IGCA 2Z6KC 3R3OA 1WCMB 3UDGA 1N36L 4J6HA 4DAPA 1TQOA 4JV5Q 5JAVA 1JICA 2I0QA 4FF3A 2M00A 1XMQL 1DOMA 1R4QB 2ZXOA 1B8AA 2K7VA 5JPMC 3U58A 1HTPA 2N55A 3J81c 2HCCA 2WP8J 4JI3L 1K8GA 4PMBA 2LY7A 2AUKA 4NDXA 1UUPA 3NWTA 2V4DA 3S9WA 2FMCA 2EYPA 3EVQA 3KBXA 4A3FG 3UDFA 4DR5L 3ICEA 2VXWA 1I4QA 4IZ8A 2L12A 2OCEA 2EY6A 2JA5H 2MNAA 1S3OA 2A68D 3KF8B 1X54A 2L55A 3S17H 4JW0A 3DLLA 4J8QA 2FMMA 4IJHA 3LWUA 2X6LA 1BQQT 1FR3A 4K8JA 3PO2G 4MZ9A 4RMFA 4OWXB 1EIFA 1EYDA 4A3IB 5KYIA 5I2XA 2ZXPA 2EY5A 1JMCA 2O2LD 2NZHA 1G2SA 3E9HA 4X64Q 1QOHA 3N6RA 1YZ6A 2NWGA 3J80i 5DEHA 1MKHA 2Q8RE 5JJLA 1N36Q 2F0PA 1HA5A 3K5OA 5ELFA 3IAYA 1PZID 1XMQQ 4GN3B 2B2VC 2F0NA 1SNQA 4PMWA 2KVMA 5EJWA 1Z9FA 5C0XJ 4X3TA 1SMYC 1LTLA 5EBCA 4UPAA 4NW2A 3QR8A 3T1YL 2CKZB 4K5WA 5EKIA 3R2IA 4NP5A 3EFXD 3HG9A 4DNRB 1E2VA 3J80c 3Q0AA 4P73A 3M7NA 4GZYC 1VF5C 2CQOA 5FO8B 2K05A 1PH2A 5KGUA 4KN7C 4DR5Q 2JSOA 1HQRD 4QIWB 5IOCA 3T51B 1LTTD 4C2MB 1D2BA 2Z6BA 1TWGB 1IW7D 1CI3M 1ML0D 1SR3A 1CA5A 4KHPQ 5LHY1 1EFID 3D31A 1YVCA 1ZEQX 3K5LA 2CH4W 4QCLA 2DUDA 5EBDA 4PZ6A 1HCZA 4HR7B 4F8MA 1LLRD 1R4PB 3TS2A 3KK7A 3OOCA 1PTOD 1ESFA 4A3JB 1A3VA 4RWSC 1STEA 5CV4A 2JP1A 4B08A 1CSQA 3G7LA 3D4DA 4IUNA 1AP0A 3CW2C 1CQVA 4KHVA 4XDXA 2E2HB 2Z8LA 3OPOA 3C46A 3RLOA 1RL2A 1X65A 1E22A 1IHZA 3TP6A 1V1PA 4DR2L 2JA6B 1C8CA 3NK9A 3CRKC 1EZ8A 3BG3A 5JOBA 3FMCA 4DR1L 4JG2A 3HOZB 4DV6L 2OEOA 2IX3A 2PNHA 2UU9Q 1A15A 1G291 4HSVA 1KNAA 2RDGA 3OYYA 2EJFC 4GN4B 1PRTB 4G7HC 1I6HH 1OXVA 1VQPA 5IGFA 1I6VC 2RSNA 5C4JB 1VQIA 1Q82C 5CV9A 1S40A 4R4OA 4B9XA 2MFIA 1AE3A 1WFQA 1KAWA 4ZLTF 1X3QA 2E2IB 3TZUA 1JJGA 3H94A 4A93H 1I94Q 1TWCB 1KLUD 1JE5A 1KAAA 1LV9A 2VB3X 3MTSA 2R92H 1VQCA 2L4NA 1O7YA 2K1BA 3V96A 1XNQL 4ABNA 4YWLA 4B3SL 3S16H 1RD9D 3UE1A 1PFBA 2WKCA 3HRZC 1XJVA 3B6YA 3PF5A 4BY7B 1F2LA 1CTMA 4POGA 1WD1A 4MN3A 2D5DA 4TVAB 3NTHA 3HOVB 1WCMG 4OELB 3AU7A 1PYSB 3GTQB 3S15B 3PCOB 2R93B 5CR3A 1DXMA 5JJIA 1Y8OB 1RF2D 1VQJA 2CQAA 4U68A 3DM1A 1M90C 3CMAA 2ZTCA 4C3HH 1HUNA 3BDLA 4DR4L 1PLFA 4OWWB 3T1HL 4HMIA 4OIKA 4FF2A 5TSSA 3S14H 4A3GB 2EJGC 1U4RA 4IFDH 5GAHC 3QWNA 1F9PA 2A68C 2B8FA 2KENA 3CC4A 1H9JA 1BXTA 5C3EH 5IYBH 2DN8A 4PNYA 4YHHL 1CKNB 2R7FA 5CV6A 1ZYRC 3P1HA 2BH8A 2EY1A 1XMOL 1R9TB 1X3FA 5G3LF 1WD0A 5DAUA 3TS0A 3IFDA 2HQEA 4ZQ3A 1YEZA 1BBXC 5I6WA 3NENA 1ASYA 3OMCA 1SDFA 4LF6Q 1I5FA 1NMGA 4DXFA 1S5DD 3X3NA 4K2KA 1KL9A 4DAYA 2BA1A 4A3IG 2VQEQ 4B3SQ 5M5XB 1NJIC 1O7LA 5EPLA 2Q8IB 2D0PA 1X9NA 1U4LA 4KD4A 4ZRZA 1EWCA 3A5UA 5CORA 4IUQA 1XTCD 2R61A 3GQBA 4JI8Q 4DV5Q 3CXCA 3MEFA 2NVQB 4LUZA 1HRJA 3BJUA 4K5XA 2PPBC 1X6OA 4DR4Q 3MXGA 1X3PA 5M3MB 3VA7A 3F1ZA 2JA5B 5IODA 2KCCA 4B3ML 2N49A 3S17B 4C3JH 2BDOA 1SFOB 1N32Q 5JPNC 1QVGA 5C3WA 3LX0A 2MUYA 5K5PA 4V190 1IW7C 2KJXA 5FO7B 1EQVA 3KLSA 2VS1A 3CCJA 4N8X1 4C3IB 1XMOQ 1CKOA 2B63H 2UXBQ 3C1FA 5IP9G 3T53B 2GVAA 1A3TA 1PYWD 1TWAH 1CQFA 5IP7G 1PTOC 4HTHA 4O42A 4CJ1B 5IYDH 1PH5A 2KCNA 1VDZA 1N33L 1N9WA 1AEXA 3NP8A 1AZQA 3S1QB 4UHVA 3VDYA 3GTPB 3RZDB 4KD3A 4A3JG 1E1OA 3K5MA 1XX8A 5JEAH 1GHKA 4IQZA 5D14A 2OF1A 1BVSA 2C5CA 3L0OA 1EY6A 1U5KA 1XWEA 2WV6D 3M3YH 5CGKA 1MHWC 4ME3A 2EJMA 1W6JA 2PMZE 2MP1A 1JCKB 2JA6G 5LL6S 3RLNA 1KDBA 3HOZG 4P75A 1GJXA 3KUPA 3F2DA 2NVTH 2KEEA 4RA8A 1YHQA 1PVOA 2XTIA 4IFDI 4ALPA 2DJGC 2PQEA 2JA7B 1RTOA 1QNUA 1RCVD 4A3KH 3NHHA 3C1EA 4TRDA 3DEPA 3TP5A 5C4XH 2L15A 1DJRD 2XN9C 3GTMB 2ID0A 3OWFA 1V1QA 1E7ZA 1EQRA 2M9VA 4L5QA 2OTJA 3CC2A 3D4WA 1MJEA 5JJKA 4FDBA 5ELEA 4FF4A 4XQJA 4ID6A 4OONA 2UUBQ 1H9SA 1YHAA 4LNQA 3PUXA 4K6DA 4N9TA 3I4OA 3I91A 2JA9A 1XPUA 1TS5A 2IPKD 2MO1A 2HQLA 4JYAL 2LXJA 3M9BA 3UDIA 4A3MB 3H3VC 2NUCA 3Q6SA 3D4RA 3AMUA 1XPRA 2QDLA 1J9OA 4LF4Q 4BY7G 4KJNA 1N34L 3HOXB 4LF5Q 2YU9B 3I3CA 2SNSA 1EUJA 4DUZQ 2I5LX 1JQYD 1VQBA 2KCMA 3CCMA 1H95A 1K8OA 3TEHB 4RG1A 3TP7A 2HIXA 3HOVG 1WTPA 3D8GA 3PQIA 3Q22A 3GTOH 2ZTEA 2AKWB 4LFBQ 2R93G 2A73B 1G8ZD 4YCWA 1VQDA 1A3UA 1SSOA 5F2DA 1SJED 3LNNA 2KA7A 2K52A 1B1ZA 4XTCS 1U0LA 1UNSA 4H02A 2XWJB 3BDOA 3CQZH 1JJCB 4P71A 4A93B 1LTBD 2B3GA 4A3GG 3VR3A 1PRTD 1D8LA 2RHSB 2AMCB 2MPMA 1VCIA 2F0GA 2PZWA 4DV1L 1HR0L 2F1MA 1QUQA 5JVH3 5ELDA 4NXML 2A6ED 4DFAA 4NPSA 1IKLA 2LMCB 3FRPB 1RHPA 2A74C 2ICIA 3QB3A 3DUZA 4DV3L 2XVSA 2OT2A 1Y1VB 2D2CC 3V05A 2K01A 5M3FB 4L5RC 2K5WA 2DJFC 4ILWA 1BNZA 4L6TB 1S5ED 2A19A 2QGQA 3NWSA 3STBD 2GVBA 5IIFA 1KDAA 1YI2A 2WACA 2WB1G 5C5MA 1HNWL 2IHFA 4C3HB 3Q23A 4A3CH 4S3SA 3M4YA 2XNAC 3C3LA 4OO1I 5M5WH 1YJWA 4RFBA 4HJAA 1EFWA 3ERSX 3KJOA 2CFMA 1JE4A 2ENBA 1BOSA 4X65L 1V1PB 5M3MG 2R7DA 2JA5G 1CHQD 4JVZA 4DV0L 4QY7A 3I72A 1XNRL 3BYYB 1B70B 3U50C 2K04A 4OHJA 1GUNA 3CU7A 3I70A 3K6OA 3K80C 3CCQA 1HR0Q 1STAA 1GKHA 4QL5A 5AFWA 3HOYB 2PI2A 1I4HA 4C3IG 4CDEC 4EGVA 2D62A 4NXMQ 1SNPA 2EYMA 4ZYSA 2ATWA 1OO9B 2QCPX 1BBWA 1BCPB 4JI2Q 1SYDA 1YHBA 4PZ8A 5DM63 1CFMA 3TQYA 3DXJC 1S5BD 5JJZA 4ZAIA 3H6MA 1Q1BA 4OEMB 1K3BC 5IYCH 2Q2IA 3W1GA 4APVA 1IL8A 1STHA 3GTJB 3E9IA 4KKSA 1KDCA 1SN8A 5IT9c 4M8AA 4KKUA 2OWOA 2PYKA 1BKBA 3KLSX
chains in the Genus database with same CATH topology
4E6IA 1WVLA 1I4XA 1WTOA 4CGYB 2EYHA 3T4AC 5EPJA 1PDQA 2F0IA 3I73A 4C56C 2B63B 4DF7A 3TSSA 3VR2A 3MFYA 4BA2I 2F0TA 2AWOA 2KUMA 2EXZA 4B9WA 2NVYB 4A3BB 2FJ2A 3PUYA 3TP8A 2MGSA 1XXGA 3MXNA 2K6AA 1O80A 1I50B 2SNMA 4CKBA 4BBSB 1JR0D 3GO5A 2F0DA 3BVGA 5BN3A 2IJ0A 2B8GA 3MFGA 4JBWA 4R9WA 2L9HA 4H0LC 1F2ZA 4A3KB 5KEEA 3I4MB 5CC4A 4BY1B 2PMZB 5D65A 1JOKA 1SAPA 1RDPD 1PRTC 5CYUA 5C44B 3VR4A 3FVQA 3MC0B 4Z9CB 4G57A 2JA8B 1O78A 1SNOA 2RDFA 2NN6I 5NUCA 3QJYA 1V8QA 2A6EC 4CHTB 2L5TA 4KK7A 4ME5A 3TZDA 3ERQA 3TDQA 3VYSA 4CKEA 4EQPA 3A7AB 4IUTA 3OSOA 5IGDA 1SE2A 1GUSA 2JYOA 1G2TA 3ZYYX 5HGTA 1PFNA 3OWEB 5ELBA 4FVMA 4C3HG 2JEBI 4KHZA 1TVXA 4TKOB 4G7OC 2WIIB 4IFDG 1V43A 2EPBA 3L3OC 2PW7A 2F4IA 2IX0A 1JOOA 3MVVA 2E76C 1MI2A 1Y69U 1GOZA 1B2TA 2RKSA 2PO4A 1CK1A 2B2YC 1TS3A 4HCEA 4RCNA 1EU3A 2PZTA 1TKWB 4RGMA 3VR5A 3HZXA 3GTKB 2EE1A 1SBBB 3ITPA 1ENAA 5KRUA 1EY0A 2AQ3B 2O4XA 2RA4A 1EYCA 1QCBD 4RGOS 3VYUA 3PIO3 3NBHA 1PTOH 1PZJD 2CHBD 2G9DA 1EOTA 1HHVA 4HEDA 5ISRA 5J1ZA 5IT9E 5KIXA 1FNWA 1I4RA 3EA6A 4RGNA 3A55A 4ODGA 2PW5A 2NB0A 2K03A 2FHTA 1C48A 2R6GA 3I4LA 3BS1A 2CW0D 3FEWX 2BA0A 4M1UB 5KYLA 3WOEA 5I2YA 4I65A 3O13A 1T5EA 5JEAG 1G91A 2O5IC 1T5XD 5FLXE 4FP5D 1PTOF 1EY4A 1CA6A 2AQ2B 3I4NB 4RGTA 1EQTA 3QO2A 3VYRA 1QNKA 4A3EB 3CKIB 1WTWA 4OO1G 2F0WA 1NUCA 3BVZA 1AZPA 1D6EC 4FF1A 2B2UA 1EIGA 4C1NK 1F2MA 2TSSA 4OGQC 4RAUC 5DM73 1TS4A 1EYAA 3PV0A 2WB1B 4RHRA 3MEHA 4KJOA 1A6XA 5J22A 2DY8A 2ZXRA 3KF8A 2ZT9C 1HFNA 4KV6A 2DNEA 3SR1A 1A2TA 2E2DC 4R8IA 1EZ6A 5EQ0A 3TBIB 1C4QA 1JC7A 4K14A 1WTQA 3HP3A 3HKZB 4NKLA 4WJWA 1GHJA 3K59A 1STBA 3SVMA 1D5MC 1XYIA 1TR5A 5FOBB 1MSGA 3IL8A 2HDLA 5K36G 2BE5D 4U673 1Q90A 3DWAA 3TMEA 2OXPA 2RBMA 2I46A 1NR2A 4KN4C 1ET6A 3WOFA 2AQ1B 1YNJD 1EY7A 1OXSC 1ZKOA 3D6WA 3SHLA 2NZ1D 2RVLA 4K2LA 4TQUS 4L8JA 5A2QE 1BO0A 3S1NB 1HPCA 5ELCA 1HXYD 2LFNA 4FNFA 4DGZA 1EWHA 2DNCA 5J39A 1B9NA 3A7LA 5CBAE 1SNDA 3U9SA 2A6HD 1AFPA 1RODA 1ENCA 4P2CB 2F0EA 5KNDA 1PXUA 4XQNA 1LT5D 1DM0B 3Q24A 1I4GA 2F0KA 2EYOA 1MBYA 2WKDA 4XIGS 5IT9L 4H44C 3HOWB 4JK1C 1Y1WB 4XQQA 1CT1D 3KLRA 4MHEA 2F3WA 1W6KA 1MD2D 2RSOA 1Z6HA 4CBVA 1D1KA 1E2ZA 4BA1I 1RKNA 4RH6A 4OIJA 1EL0A 3U9OA 3GP7A 5JEAJ 1LTSD 2KHSA 1LT4D 3EQLC 2NN6G 1B44D 2CW0C 4KY6A 2JE6I 1ESRA 1I6HB 3E6ZX 1AN8A 4PMCA 5FLXL 3NUCA 3OIQA 4ZKBB 4DK0A 1LTGD 3MXUA 2A69D 4N9PA 3HGBA 1K8MA 3T16A 1FNVA 3S1MB 3HOUB 2VB2X 3HS0C 5KNCA 1BR9A 1RTNA 2J4XA 5EKLA 4UDUC 1PFMA 2R92B 4X3KA 1NR4A 4HCSA 3S16B 2WAQB 3SK8A 2K5QA 4G7ZC 4XYQA 3M85A 1JWUD 1STNA 2Z4IA 5C3XA 1ONLA 4EQOA 4FYDA 1EEID 5EPKA 3D3RA 1EY8A 2SEBD 2B2YA 1SMYD 4AYBB 3S14B 1B50A 1KLGD 1DYQA 1GUTA 1Q8IA 5KNBA 5EGTA 2B2UC 2PNRC 5C3EB 1B4OA 1STYA 1I4PA 1D5XC 1F9SA 3PIP3 1U4PA 2BE5C 1HQMC 1VMPA 1U4MA 3A8JE 1NCVA 4RCOA 4DA2A 4PV1C 2B2TA 2MHVA 5C5LA 1YNJC 4BWGB 3R93A 3PMFA 1FGBD 4MIUA 2L11A 2EYJA 5A2QL 3QOLA 4KY5A 3K5NA 4XT1B 3NQTA 3GTLB 2E75C 3J7AF 1HFGA 3G6JB 5I4DA 2F0FA 1LTAD 4WFN3 4R8NA 1PRTF 3RMHA 2A6HC 4C3JB 2F03A 4HMJA 3OHXC 1B53A 2F0UA 1LO5D 1SNMA 3S1RB 4FXKC 4DXGA 1II3A 3FDTA 1KTKA 3CHBD 5A35A 3FPUB 2BCOA 1TWAB 1DOLA 2QDBA 3DHQA 1LT6D 2NVXB 1H9KA 2M2LA 1ZXTA 2K28A 2L0CA 3URYA 4XXEA 2JXMB 1STGA 3M3YB 5C0XH 2G9HD 2HUGA 3L7ZC 4KI0A 2F0VA 3CRLC 1PMRA 5CV8A 2NVTB 3H0GB 5M9OA 1Z47A 4LJZC 3NPPA 1G6ZA 4QUFA 1SNCA 3OW7A 3J7YW 3K0YA 2VNUD 1OXUA 1WTRA 2A69C 1QILA 5C4XB 2F0JA 1ET9A 2TMPA 2A5HA 3RD4A 3MXPA 2F3VA 3AB9A 1BUVT 3SK4A 3F2UA 2NTSA 1CHPD 2LS01 1TY2A 1ZYRD 2EOTA 5CV5A 1D5ZC 1QJOA 4J1MA 3R8BA 4HAEA 1CZWA 4YIJA 1BDOA 2F0LA 1TWFB 3MZ5A 4IUPA 3V2TA 2XRSD 3NBIA 4DN4M 3ND8A 4WORA 2VUMB 1O7ZA 3W2DA 3GTOB 4OL7A 1OXXK 1S4ZA 2F0MA 5I6YA 1Q1EA 3R2TA 2EYFA 2NTTA 3K58A 2QILA 2QEJC 3CQZB 3SE0A 2QKIC 4DNTB 1NSNS 4X3UA 5FO9B 3RUZA 2QF7A 2NBFA 2HDMA 1GUWA 1UAPA 1SE3A 2H1EA 5IGBA 5CV7A 3K7AB 5I9OA 2KEDA 4ZUJA 2XRQD 4XT3B 1KABA 1S5CD 2DY7A 4Y7NB 1TWHB 1BF4A 1H9MA 4CJ2C 1S5FD 3GD7A 3ONAB 3BYTB 5C0XI 1DOKA 1F2YA 1D1IA 1VF7A 4NMZA 5G3LD 5M5WB 4I7ZC 2FFKB 1E0BA 1Y8NB 2SOBA 3X3MA 1J8IA 2IX1A 1TT2A 1SYGA 1UEAB 3A8IE 3HEJA 2PZUA 1SYEA 3S2DB 1H9SB 1TU2B 4IUVA 3JAME 2B2TC 2E74C 4C3JG 4FXDA 1NAPA 2D9UA 4ULLA 1IYVA 3SK5A 2XIWA 2O5JC 3LWEA 4DU9A 3EROA 1DZ1A 1CM9A 1KNEA 2AWNA 4X3SA 4IALA 4CJ0B 3EJIA 4RKLA 3PUVA 3SXHA 3P20A 2RDHA 1GUOA 1OXTA 2L1BA 2B2WC 2Z4HA 3GV3A 1U9RA 1MGSA 5COYA 3FPPA 4K5VA 1YNND 3MAQA 2LKVA 2Y0SB 3OIPA 1BCPD 4DK1A 3QOJA 3MWYW 1F9RA 3MHBA 3I90A 5FK9C 5CMDA 1JORA 2E2JB 1E2WA 3RZOB 1ICWA 2BDNA 1EIHA 4H7BA 2KECA 5E4XA 1ENFA 2YYZA 3NTKA 4ZKCB 3J81E 1QWYA 4K6LA 4PQXA 3GV6A 3WDNA 4V0BA 2I07B 3A54A 2F0OA 4L63B 4A3DB 3T13A 1QE6A 2K5DA 1EU4A 1ILQA 4WRDA 2HCIA 4QMGA 1LABA 3M4OB 3L9AX 1SJHD 1TY0A 1A2UA 5T1IA 2F0HA 1V1OA 4RKBA 2PCFB 3PO3B 4BBRB 1RJTA 3C2PA 1K83B 1L0XB 1LT3D 1WTVA 3H09A 2Q8TA 1IYUA 2J7ZA 1WTXA 3BVMA 3KBGA 2X69A 4IFDJ 1HTLD 2WINB 1JWSD 1AW7A 4IN3A 1JOQA 4DAVA 4HSPA 3VA5A 4LK1C 3IFTA 3J80E 1FYCA 4O1NA 2IWHA 4ZUIA 3A8KE 3D6CA 1F9QA 1SXTA 3PUZA 1BCPF 3N52A 3DWQA 3P75A 1SE4A 1Z7TA 1SYBA 3RLFA 2CVRA 4EVOA 3W3AA 1Y8PB 2H4OA 1DD2A 2ICEC 1MSHA 4FO2A 1SYCA 3ND9A 1LACA 1M8AA 4F7XA 2Z1CA 3JAML 1GXDC 1CZGA 4OO1H 1Q3LA 1FD7D 4FXGC 1SEBD 1LTRD 2SDFA 5C4HA 2AUJD 3SK6A 3MA2B 3FKIB 5E3FA 3T56B 3S2HB 2EYLA 3P7JA 5E1FA 1B3AA 4BS9A 3NE5B 4TSSA 4HN7A 4C1NI 1EEFD 2BOSA 4A3FB 2EZVA 1FNUA 2XSCA 5IGEA 4Q0FA 5LL6X 2B2VA 1YNNC 3UI2A 1BCPC 3H91A 1L0YB 1PTOB 2X6GA 2IW3A 4IUUA 5T1GA 3PO2B 1ILPA 2EY2A 5K36H 4QUCA 4KMUC 3J81L 3DEOA 4RHSA 2NYZD 3DMUA 1IKMA 2B39A 5M5YB 3NQIA 1JB3A 3VYTA 5FKAC 2RQXA 3NSWA 2MJ8A 1HUMA 1H9RA 3NTIA 3SEBA 1HA6A 4Q5VA 2K33A 5BN5A 5EKKA 4LAAA 3A56A 2KOLA 4CKCA 5E4WC 3DWPA 5JVG3 3BZDB 5I9PA 3QIAA 4KKTA 5DNFA 2R7ZB 5C4ZA 1X32A 1B9MA 1I3QB 2C9OA 4ZK9B 2J0TD 5HURA 5C0XG 4F88A 5BN4A 1TS2A 4QF4A 5C6AA 1F77A 3J7AV 2N88A 2IT1A 3M7GA 2IL8A 1VMCA 3E5SA 3VR6A 2F0SA 1M4VA 1SYFA 1PZKD 2GA4B 3BDCA 3J80L 4LMQD 2EVBA 1GUGA 4XYOA 4F87A 5CBEE 1TIID 2NN6H 3IKJA 5D3IB 2XWBB 5IGGA 4KTAA 3PUWA 2B2WA 1EY5A 4K8IA 2FINB 2K32A 3SDZA 4H13C 1QB5D 3TN2A 1LTID 4QB4A 4EQNA 3QG1A 3OMGA 1JWMD 2JEAI 5D3DA 4G4KA 1EY9A 2KQ3A 3GTGB 1QG7A 3K57A 4UAIA 3I8ZA 3E0JA 1Q12A 3NXWA 4KY7A 1DONA 2EDGA 1DCZA 4IURA 2R3ZA 2F0QA 5IGCA 3R3OA 1WCMB 4DAPA 4J6HA 1TQOA 5JAVA 1JICA 4FF3A 2M00A 1DOMA 1R4QB 2ZXOA 2K7VA 5JPMC 1HTPA 2N55A 2HCCA 2WP8J 4PMBA 2LY7A 2AUKA 4NDXA 1UUPA 3NWTA 2V4DA 3S9WA 2FMCA 2EYPA 3EVQA 3KBXA 2VXWA 1I4QA 4IZ8A 2L12A 2EY6A 2A68D 2L55A 4J8QA 2FMMA 3LWUA 2X6LA 1BQQT 1FR3A 4K8JA 1EYDA 4A3IB 5KYIA 5I2XA 2ZXPA 2EY5A 2O2LD 1G2SA 1QOHA 3N6RA 2NWGA 5DEHA 2Q8RE 2F0PA 1HA5A 3K5OA 5ELFA 3IAYA 1PZID 2B2VC 2F0NA 1SNQA 4PMWA 2KVMA 5EJWA 5C0XJ 4X3TA 1SMYC 5EBCA 4NW2A 4K5WA 5EKIA 3R2IA 4NP5A 3EFXD 3HG9A 4DNRB 1E2VA 3Q0AA 3M7NA 4GZYC 1VF5C 5FO8B 2K05A 5KGUA 4KN7C 2JSOA 1HQRD 4QIWB 5IOCA 3T51B 1LTTD 4C2MB 1D2BA 1TWGB 1IW7D 1CI3M 1ML0D 1CA5A 5LHY1 1EFID 3D31A 1ZEQX 3K5LA 4QCLA 5EBDA 1HCZA 4HR7B 4F8MA 1LLRD 1R4PB 3KK7A 3OOCA 1PTOD 1ESFA 4A3JB 1A3VA 4RWSC 1STEA 5CV4A 2JP1A 4B08A 3G7LA 3D4DA 4IUNA 1AP0A 1CQVA 4KHVA 4XDXA 2E2HB 2Z8LA 3OPOA 3C46A 1IHZA 3TP6A 1V1PA 2JA6B 1C8CA 3NK9A 3CRKC 1EZ8A 3BG3A 5JOBA 3FMCA 3HOZB 2OEOA 2IX3A 1A15A 1G291 4HSVA 1KNAA 2RDGA 2EJFC 1PRTB 4G7HC 1OXVA 5IGFA 1I6VC 2RSNA 5C4JB 5CV9A 4B9XA 4ZLTF 1X3QA 2E2IB 3TZUA 3H94A 1TWCB 1KLUD 1KAAA 1LV9A 2VB3X 3MTSA 2L4NA 1O7YA 2K1BA 3V96A 4ABNA 1RD9D 1PFBA 2WKCA 3HRZC 4BY7B 1F2LA 1CTMA 1WD1A 4MN3A 2D5DA 3HOVB 3NTHA 3AU7A 3GTQB 3S15B 2R93B 5CR3A 1DXMA 1Y8OB 1RF2D 2CQAA 4U68A 3DM1A 1HUNA 3BDLA 1PLFA 4HMIA 4OIKA 4FF2A 5TSSA 4A3GB 2EJGC 1U4RA 4IFDH 3QWNA 1F9PA 2A68C 2B8FA 1H9JA 1BXTA 2DN8A 4PNYA 5CV6A 1ZYRC 3P1HA 2EY1A 1R9TB 5G3LF 1WD0A 5DAUA 3IFDA 2HQEA 4ZQ3A 1BBXC 5I6WA 3OMCA 1SDFA 4DXFA 1S5DD 3X3NA 4K2KA 4DAYA 2BA1A 5M5XB 1O7LA 5EPLA 2Q8IB 1U4LA 4KD4A 4ZRZA 1EWCA 5CORA 4IUQA 1XTCD 2R61A 3GQBA 2NVQB 1HRJA 4K5XA 2PPBC 3MXGA 1X3PA 5M3MB 3VA7A 2JA5B 5IODA 2KCCA 3S17B 2BDOA 1SFOB 5JPNC 5C3WA 3LX0A 2MUYA 5K5PA 4V190 1IW7C 2KJXA 5FO7B 1EQVA 3KLSA 4C3IB 3C1FA 3T53B 1A3TA 1PYWD 1CQFA 1PTOC 4HTHA 4O42A 4CJ1B 2KCNA 1VDZA 1AEXA 3NP8A 1AZQA 3S1QB 3GTPB 3RZDB 4KD3A 3K5MA 1XX8A 5JEAH 1GHKA 4IQZA 5D14A 2OF1A 2C5CA 1EY6A 1XWEA 2WV6D 5CGKA 2EJMA 1W6JA 2MP1A 1JCKB 5LL6S 1KDBA 1GJXA 3KUPA 2KEEA 4RA8A 4IFDI 2PQEA 2JA7B 1RTOA 1QNUA 1RCVD 3NHHA 3C1EA 4TRDA 3DEPA 3TP5A 1DJRD 2XN9C 3GTMB 2ID0A 3OWFA 2M9VA 3D4WA 5ELEA 4FF4A 4XQJA 4ID6A 1H9SA 3PUXA 4K6DA 4N9TA 3I91A 1TS5A 2IPKD 4A3MB 3H3VC 2NUCA 3Q6SA 3D4RA 3AMUA 1J9OA 4KJNA 3HOXB 2YU9B 3I3CA 2SNSA 1JQYD 1K8OA 3TP7A 1WTPA 3D8GA 3Q22A 2A73B 1G8ZD 1A3UA 1SSOA 5F2DA 1SJED 3LNNA 2KA7A 1B1ZA 4XTCS 1UNSA 2XWJB 3BDOA 4A93B 1LTBD 3VR3A 1PRTD 2MPMA 1VCIA 2F0GA 2PZWA 2F1MA 5JVH3 5ELDA 2A6ED 4DFAA 1IKLA 2LMCB 1RHPA 2A74C 2ICIA 3DUZA 3QB3A 3FRPB 2XVSA 2OT2A 1Y1VB 2D2CC 3V05A 2K01A 5M3FB 2K5WA 4ILWA 1BNZA 4L6TB 1S5ED 3NWSA 5IIFA 1KDAA 2WACA 5C5MA 4C3HB 3Q23A 4S3SA 3M4YA 2XNAC 3C3LA 4OO1I 4RFBA 1JE4A 2ENBA 1BOSA 1V1PB 1CHQD 3I72A 3BYYB 2K04A 4OHJA 1GUNA 3CU7A 3I70A 3K6OA 1STAA 5AFWA 3HOYB 1I4HA 4C3IG 4EGVA 2D62A 1SNPA 2EYMA 4ZYSA 1OO9B 2QCPX 1BCPB 1SYDA 5DM63 1CFMA 5JJZA 3DXJC 1S5BD 4ZAIA 3H6MA 1Q1BA 1STHA 1IL8A 3GTJB 4KKSA 1KDCA 4M8AA 4KKUA 2PYKA 3KLSX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQZ A;  2K7V A;  5K36 G;  3OOC A;  2BE5 D;  2IT1 A;  3A8I E;  2F1M A;  2EJG C;  3AB9 A;  1Q90 A;  4IFD H;  3A7A B;  1HTP A;  2AUJ D;  2E75 C;  1H9S B;  2A68 C;  2B8F A;  4DK0 A;  1TU2 B;  4KN4 C;  1H9J A;  1GUS A;  2A6E D;  2PCF B;  3I73 A;  3MXU A;  2A69 D;  2AUK A;  2EJM A;  2LMC B;  2R6G A;  3T56 B;  3I4L A;  2DN8 A;  1QJO A;  2E74 C;  3VR6 A;  1OXS C;  2D2C C;  2V4D A;  1ZKO A;  2BA0 A;  3OPO A;  3NE5 B;  1GJX A;  1ZYR C;  3HGB A;  3VR2 A;  1BDO A;  1K8M A;  1T5E A;  5JEA G;  1IYV A;  1IYU A;  3CRK C;  3MFY A;  2JEB I;  2A6H C;  3BG3 A;  4KHZ A;  4BA2 I;  3FMC A;  2O5J C;  4TQU S;  4L8J A;  2EVB A;  2O5I C;  4TKO B;  4G7O C;  2A68 D;  5KNC A;  1HPC A;  4IFD G;  1G29 1;  1V43 A;  2AWO A;  3ND8 A;  1GUG A;  3M4Y A;  2BA1 A;  2EJF C;  1EWH A;  4G7H C;  1O7L A;  2DNC A;  3LWU A;  2Q8I B;  1B9N A;  3A7L A;  4BA1 I;  5A35 A;  1YNN C;  1FR3 A;  1OXV A;  2E76 C;  3PUY A;  3U9S A;  1OXX K;  3M85 A;  1I6V C;  3PUV A;  2NN6 H;  4OO1 G;  2A6H D;  1Q1E A;  1ONL A;  4LK1 C;  3IKJ A;  1Y69 U;  3P20 A;  3IFT A;  1GUO A;  1OXT A;  3GQB A;  4OGQ C;  5K36 H;  3PUW A;  1FYC A;  1H9S A;  1H9K A;  3PUX A;  3N6R A;  4KMU C;  3WDN A;  5BN3 A;  3I72 A;  3SE0 A;  4DNT B;  2B8G A;  2K32 A;  3FPP A;  4RCN A;  2QF7 A;  4JBW A;  3SDZ A;  4H13 C;  2PPB C;  1GUN A;  3A8K E;  5KND A;  3TZU A;  3VA7 A;  3H94 A;  1TKW B;  3PV0 A;  3PUZ A;  4H0L C;  3VR5 A;  2KCC A;  4DK1 A;  2BDO A;  3QG1 A;  2JXM B;  1SMY C;  1A6X A;  1H9R A;  3D4R A;  2D62 A;  1Z7T A;  1IW7 C;  1GUT A;  4XIG S;  5KNB A;  2JEA I;  4H44 C;  3RLF A;  1E2W A;  4JK1 C;  5C0X H;  2PNR C;  2ZT9 C;  3W3A A;  1Y8P B;  3L7Z C;  4DNR B;  4KI0 A;  1E2V A;  3KLR A;  2DNE A;  3M7N A;  4GZY C;  1K8O A;  1VF5 C;  3CRL C;  1PMR A;  2K33 A;  2YYZ A;  3VR4 A;  5BN5 A;  1DD2 A;  4KN7 C;  1Q12 A;  1CTM A;  1Z6H A;  4HR7 B;  3T53 B;  1O78 A;  4LJZ C;  3ND9 A;  1CFM A;  2BE5 C;  3T51 B;  1LAC A;  1E2Z A;  2D5D A;  3QIA A;  2EDG A;  3DXJ C;  1HQM C;  2NN6 I;  3LNN A;  3OW7 A;  4KKT A;  1Q1B A;  2KA7 A;  1H9M A;  3A8J E;  1IW7 D;  4XTC S;  1CI3 M;  1GHJ A;  3GD7 A;  3QJY A;  1B9M A;  1DCZ A;  1V8Q A;  1VDZ A;  1DXM A;  4PV1 C;  4OO1 H;  1GHK A;  1Y8O B;  2A6E C;  3BDO A;  1OXU A;  1VF7 A;  2A69 C;  2L5T A;  3EQL C;  2NN6 G;  3D31 A;  4KKS A;  1YNJ C;  3VR3 A;  4I7Z C;  2CW0 C;  5JEA H;  1Y8N B;  5C0X G;  1VCI A;  4KKU A;  5BN4 A;  1HCZ A;  2JE6 I;  1LAB A;  4G7Z C; 
#chains in the Genus database with same CATH topology
 4E6I A;  1WVL A;  1I4X A;  1WTO A;  4CGY B;  2EYH A;  3T4A C;  5EPJ A;  1PDQ A;  2F0I A;  3I73 A;  3RZO H;  2C35 B;  4C56 C;  3EIV A;  4DK3 C;  4GS3 A;  4DF7 A;  5FJ8 H;  2B63 B;  2N3S A;  2UXD L;  4QJF A;  4X64 L;  2JA7 G;  3TSS A;  3VR2 A;  3MFY A;  1MIU A;  4BA2 I;  3HKZ E;  2F0T A;  1PH6 A;  3KOJ A;  2YTV A;  5FLX c;  4A3D H;  2AWO A;  2KUM A;  2ZJP A;  2EXZ A;  4JPB W;  4B9W A;  2NVY B;  4A3B B;  2FJ2 A;  3PUY A;  3TP8 A;  2MGS A;  4Y52 H;  1XXG A;  1SRO A;  4NXN L;  3MXN A;  2K6A A;  1O80 A;  3J7Z C;  1I50 B;  2SNM A;  4CKB A;  2JN4 A;  4IPH A;  4BBS B;  4GOP B;  1JR0 D;  3GO5 A;  1PA6 A;  2F0D A;  3BVG A;  1VQH A;  5BN3 A;  1A63 A;  5GAG C;  2IJ0 A;  2B8G A;  4JI4 Q;  4A3M G;  4UP8 A;  4KHP L;  3MFG A;  4JBW A;  3KF6 B;  1VQF A;  4R9W A;  2L9H A;  4H0L C;  3OW2 A;  3HFZ B;  1F2Z A;  3HOX G;  2F3I A;  4A3K B;  5KEE A;  3I4M B;  5CC4 A;  4BY1 B;  2IHE A;  3ER0 A;  2PMZ B;  5D65 A;  1JOK A;  1SAP A;  1LM0 A;  1RDP D;  1PRT C;  5CYU A;  2UXD Q;  5C44 B;  3VR4 A;  1C7Y A;  3FVQ A;  3MC0 B;  4Z9C B;  3PIP A;  4G57 A;  2JA8 B;  1O78 A;  4HJ7 A;  1SNO A;  4B3R L;  2F4V Q;  2RDF A;  2NN6 I;  5NUC A;  4A93 G;  3NEM A;  3QJY A;  3PSI A;  1V8Q A;  2RCF A;  2A6E C;  4CHT B;  2L5T A;  1UE1 A;  2VY3 A;  4KK7 A;  3S1N H;  4ME5 A;  2UU9 L;  3TZD A;  3ERQ A;  2WFW A;  4NXN Q;  3TDQ A;  3VYS A;  1UWV A;  4CKE A;  4EQP A;  3A7A B;  4IUT A;  3RN5 A;  3OSO A;  1Y1V G;  5IGD A;  4DR7 L;  5M3F G;  1SE2 A;  1GUS A;  2JYO A;  1G2T A;  3ZYY X;  5LMU Q;  5HGT A;  4BXX G;  2G5D A;  2RHQ B;  4YWM A;  1QZG A;  1PFN A;  3OWE B;  5ELB A;  1L0W A;  4FVM A;  4J15 A;  4C3H G;  2JEB I;  4KHZ A;  1Q8K A;  3SGI A;  2ES2 A;  1TVX A;  4TKO B;  1I94 L;  4G7O C;  2JJQ A;  1GD7 A;  2WII B;  4IFD G;  2K75 A;  1V43 A;  2EPB A;  3L3O C;  2PW7 A;  2F4I A;  2IX0 A;  1JOO A;  3HOW H;  3MVV A;  1Y1W H;  5IYB G;  4OXP A;  3U4Z A;  2E76 C;  1K28 A;  5GAD C;  4B3R Q;  1MI2 A;  1Y69 U;  1GOZ A;  1B2T A;  2RKS A;  4DK6 C;  2PO4 A;  1IYJ B;  1CK1 A;  4IOC A;  3FKI H;  4A3L G;  2B2Y C;  1K0R A;  3CD6 A;  1TS3 A;  1VQ7 A;  4UP9 A;  3HOY G;  4HCE A;  1HNZ Q;  4RCN A;  1EU3 A;  2HD3 A;  2PZT A;  1HZ9 A;  2OQK A;  1HNX Q;  5EAY A;  1TKW B;  1VQ5 A;  4RGM A;  3VR5 A;  1K9M C;  4YY3 Q;  3HZX A;  3GTK B;  3A0J A;  2EE1 A;  1SBB B;  3ITP A;  1ENA A;  5KRU A;  1IL2 A;  1EY0 A;  2AQ3 B;  4A3F H;  4DR7 Q;  1Q46 A;  2O4X A;  2RA4 A;  1EYC A;  4JOI A;  1QCB D;  4X62 L;  4GNX A;  2WAQ E;  4RGO S;  3VYU A;  1VQ8 A;  3PIO 3;  3NBH A;  1PTO H;  1PZJ D;  2CHB D;  2G9D A;  5FLM G;  4QQB X;  1EOT A;  1HHV A;  4HED A;  5ISR A;  5J3B A;  3S1M H;  3HOU H;  2OTL A;  2Z0S A;  5J1Z A;  4MTN A;  4LF6 L;  5IT9 E;  5KIX A;  1FNW A;  1I4R A;  3EA6 A;  3DM3 A;  1CUK A;  4LFC Q;  4RGN A;  2VQE L;  4AYB E;  2UXC Q;  3A55 A;  3M4P A;  4ODG A;  2B63 G;  2PW5 A;  2NB0 A;  3I7F A;  2K03 A;  3AQQ A;  2FHT A;  1C48 A;  2R6G A;  4DR6 Q;  3I4L A;  2QA4 A;  4JI8 L;  2VW9 A;  3BS1 A;  4DV5 L;  2CW0 D;  3FEW X;  2BA0 A;  4DV4 Q;  4M1U B;  1VQK A;  1HJP A;  5KYL A;  3WOE A;  5I2Y A;  4I65 A;  3O13 A;  1T5E A;  5JEA G;  1PHJ A;  2B29 A;  1G91 A;  1FGU A;  2O5I C;  2R7Z H;  1T5X D;  3AYH B;  5FLX E;  4FP5 D;  1GO3 E;  4A3B G;  1PTO F;  1EY4 A;  1CA6 A;  4O0A A;  2AQ2 B;  2RCN A;  1N32 L;  3G48 A;  5HY6 A;  3I4N B;  5LMN L;  4RGT A;  1EQT A;  3QO2 A;  4X62 Q;  1SE8 A;  4BBS G;  1GVP A;  3VYR A;  1QNK A;  4A3E B;  1D7Q A;  3CKI B;  1WTW A;  4OO1 G;  1G6P A;  2F0W A;  1NUC A;  3BVZ A;  1B7Y B;  2UUC L;  1AZP A;  1D6E C;  4FF1 A;  1A8V A;  2UXB L;  3CC7 A;  2B2U A;  1EIG A;  4C1N K;  1F2M A;  2TSS A;  4OGQ C;  1EQQ A;  2Z9H A;  4RAU C;  5DM7 3;  1TS4 A;  2K5H A;  1EYA A;  4A3K G;  3I4M G;  4BY1 G;  3PV0 A;  2WB1 B;  4RHR A;  3MEH A;  4KJO A;  3H3V H;  1A6X A;  5J22 A;  2DY8 A;  2K14 A;  5C44 G;  2ZXR A;  3KF8 A;  1HZB A;  1Q81 C;  2ZT9 C;  4R1J A;  3KDF A;  2JA8 G;  3GTL H;  1HFN A;  4KV6 A;  2DNE A;  3SR1 A;  1A2T A;  2E2D C;  4R8I A;  2E8G A;  1EZ6 A;  5EQ0 A;  3TBI B;  1C4Q A;  1JC7 A;  4K14 A;  4A76 A;  1VQE A;  1WTQ A;  3HP3 A;  4JI0 L;  3HKZ B;  4NKL A;  4WJW A;  1P8L A;  1GHJ A;  2MO0 A;  3K59 A;  1W3S A;  1STB A;  3SVM A;  1D5M C;  5LMN Q;  4JI5 Q;  1XYI A;  1TR5 A;  5FOB B;  4LUO A;  1MSG A;  4GLV B;  4UP7 A;  3S1R H;  3IL8 A;  2HDL A;  5K36 G;  2BE5 D;  4U67 3;  3AFP A;  1Q90 A;  3DWA A;  2UUC Q;  4JBM A;  2CH4 A;  3TME A;  1KQS A;  3CME A;  4K0K Q;  2OXP A;  1EWI A;  2RBM A;  2I46 A;  1NR2 A;  4KN4 C;  1ET6 A;  3WOF A;  2AQ1 B;  1YNJ D;  1EY7 A;  1OXS C;  1ZKO A;  2UUB L;  2NVX H;  1IBL Q;  4JBK A;  3D6W A;  3SHL A;  2NZ1 D;  4DAM A;  4GLX A;  2RVL A;  4K2L A;  1P16 A;  4TQU S;  4L8J A;  5A2Q E;  1BO0 A;  3S1N B;  2KHJ A;  1HPC A;  1L1O B;  5ELC A;  1HXY D;  2LFN A;  1WCM H;  4FNF A;  4DGZ A;  5BR8 Q;  1EWH A;  4LF4 L;  2DNC A;  5J39 A;  1B9N A;  3A7L A;  4JBJ A;  5CBA E;  4LF5 L;  1SND A;  4DUZ L;  3U9S A;  4JI0 Q;  1E3P A;  3E0E A;  4L5S A;  2A6H D;  1AFP A;  1ROD A;  3H0G H;  4LFB L;  4EQ5 A;  1BBU A;  3I55 A;  1ENC A;  4P2C B;  4GKK Q;  2F0E A;  4A3C G;  4IPC A;  5KND A;  3OTO Q;  1PXU A;  4N8F A;  4XQN A;  1LT5 D;  1DM0 B;  3Q24 A;  1I4G A;  2F0K A;  4GLA C;  1KIX A;  2EYO A;  1MBY A;  4AIM A;  2WKD A;  4XIG S;  2HIV A;  5IT9 L;  4H44 C;  4OX9 Q;  3HOW B;  4JK1 C;  4DV7 L;  1Y1W B;  4XQQ A;  2EXD A;  1CT1 D;  3KLR A;  4MHE A;  2F3W A;  4DKA C;  1W6K A;  3EN2 A;  1MD2 D;  3H15 A;  2RSO A;  1Z6H A;  4DV2 Q;  4CBV A;  4IOA A;  1D1K A;  1E2Z A;  4BA1 I;  3ULP A;  1RKN A;  4RH6 A;  4OIJ A;  1TWF H;  1GM5 A;  1EL0 A;  3U9O A;  3GP7 A;  5JEA J;  1LTS D;  2KHS A;  4IPG A;  3EQL C;  1LT4 D;  2NN6 G;  1B44 D;  3AFQ A;  1ASZ A;  2CW0 C;  4KY6 A;  4QGU A;  2JE6 I;  1ESR A;  4JOI C;  1NNX A;  4MNO A;  1PH9 A;  2VUM H;  1I6H B;  3E6Z X;  1AN8 A;  4GNX C;  4PMC A;  5FLX L;  3NUC A;  3OIQ A;  4ZKB B;  4DK0 A;  3CCU A;  4A4I A;  1LTG D;  3MXU A;  2A69 D;  3ULJ A;  1OTC A;  4N9P A;  3HGB A;  1K8M A;  3T16 A;  1FNV A;  3S1M B;  3HOU B;  4DR3 L;  2VB2 X;  4C2M H;  3I4N G;  3HS0 C;  1TWG H;  4I7A A;  5KNC A;  2EQS A;  1BR9 A;  1RTN A;  2J4X A;  5EKL A;  5IP9 H;  1K0S A;  4UDU C;  1PFM A;  2R92 B;  4X3K A;  4DV7 Q;  3FHW A;  4A3E G;  1FL0 A;  1NE3 A;  1NR4 A;  4HCS A;  3S16 B;  2WAQ B;  3K7A H;  3SK8 A;  2K5Q A;  4G7Z C;  4L5T A;  4XYQ A;  1VQ4 A;  2BH2 A;  5H1S E;  3M85 A;  1JWU D;  1STN A;  2Z4I A;  4JI2 L;  3F2C A;  1XTD A;  1ONL A;  5C3X A;  4A3J H;  4EQO A;  4FYD A;  4Y7N H;  1EEI D;  5EPK A;  1TWH H;  1VQG A;  3D3R A;  1EY8 A;  2SEB D;  2B2Y A;  4LF7 Q;  1PYB A;  1SMY D;  2KHI A;  1CKN A;  2JA6 H;  4AYB B;  3S14 B;  4UY8 C;  1B50 A;  1KLG D;  3E3X A;  1DYQ A;  2I5M X;  1GUT A;  1Q8I A;  5KNB A;  5EGT A;  2B2U C;  2PNR C;  5C3E B;  3S2D H;  1B4O A;  2FXQ A;  3HKZ G;  1STY A;  1I4P A;  3A5Z B;  1D5X C;  1F9S A;  3PIP 3;  1U4P A;  2BE5 C;  1CKM A;  4DR3 Q;  1HQM C;  1VMP A;  1U4M A;  4YCU A;  3A8J E;  4O2D A;  1NCV A;  4RCO A;  4DA2 A;  4PV1 C;  2B2T A;  3BZC A;  2MHV A;  2CWA A;  5C5L A;  1IXR A;  1YNJ C;  4BWG B;  4JI1 Q;  3R93 A;  3PMF A;  4HIO A;  1FGB D;  4MIU A;  2L11 A;  1SLJ A;  2Y0S E;  2EYJ A;  5A2Q L;  1TWC H;  2KCT A;  3QOL A;  4KY5 A;  1L2F A;  3K5N A;  4XT1 B;  3NQT A;  3GTL B;  2E75 C;  3KLW A;  3AEV A;  3UE0 A;  4YCV A;  3J7A F;  1HFG A;  3G6J B;  2Q2U A;  5I4D A;  2F0F A;  1LTA D;  2A1A A;  2ZTD A;  4WFN 3;  1NMF A;  3CPF A;  4R8N A;  2Q2T A;  1PRT F;  4JI4 L;  3RMH A;  2LXK A;  3CAM A;  2A6H C;  4C3J B;  2F03 A;  3HOV H;  4HMJ A;  3OHX C;  1B53 A;  3K8A A;  3RN2 A;  3S15 H;  2GN5 A;  2R93 H;  3D0F A;  1IBK Q;  2F0U A;  1LO5 D;  1SNM A;  1PFS A;  5AJ3 L;  4LUV A;  3CF5 A;  4FXK C;  3S1R B;  4DXG A;  2E2J H;  1A0I A;  1II3 A;  3FDT A;  1KTK A;  1VS0 A;  4PZ7 A;  3CHB D;  5A35 A;  4JCV E;  1HR0 W;  3FPU B;  2BCO A;  1TWA B;  1DOL A;  2QDB A;  3DHQ A;  1E1T A;  1YJ9 A;  1LT6 D;  2NVX B;  3K0X A;  1H9K A;  2M2L A;  2F4V L;  3KYH C;  4R4T A;  1HH2 P;  1PH1 A;  1ZXT A;  1K8A C;  3J81 i;  2K28 A;  2L0C A;  3URY A;  3HOW G;  1Y1W G;  4XXE A;  2PI2 E;  2JXM B;  2E5L Q;  1STG A;  3M3Y B;  3M4O H;  4POF A;  2ZM6 Q;  5C0X H;  2G9H D;  2HUG A;  3L7Z C;  3FKI G;  4KI0 A;  5M5X H;  3FP9 A;  2CWP A;  2DGY A;  2F0V A;  3CRL C;  1PMR A;  5CV8 A;  1VQO A;  2NVT B;  3H0G B;  5M9O A;  4BBR H;  3PO3 H;  1Z47 A;  4LJZ C;  3NPP A;  5LMU L;  1G6Z A;  4QUF A;  1KC8 C;  4LF9 Q;  1SNC A;  4LFA L;  1K83 H;  3OW7 A;  3J7Y W;  2PQA A;  3K0Y A;  3K81 C;  4DAY B;  4LF8 L;  4AH6 A;  3CP0 A;  2VNU D;  1OXU A;  1WTR A;  2A69 C;  2NVQ H;  1QIL A;  2NZO A;  5C4X B;  4PG3 A;  2F0J A;  5AJ3 Q;  1ET9 A;  2K5V A;  2TMP A;  5M3M H;  2A5H A;  3RD4 A;  3MXP A;  4R4C A;  2F3V A;  1QZH A;  3AB9 A;  1BUV T;  3KDF B;  3SK4 A;  1SFO H;  1AE2 A;  3F2U A;  2NTS A;  1CHP D;  1HZA A;  2LS0 1;  4JI7 Q;  1TY2 A;  1ZYR D;  2EOT A;  5CV5 A;  1D5Z C;  3Q8D A;  1QJO A;  3HOU G;  4C3I H;  4J1M A;  3R8B A;  4HAE A;  1CZW A;  1W2B A;  4YIJ A;  1BDO A;  4DUY Q;  2F0L A;  3CCS A;  1TWF B;  1HNZ L;  2R92 G;  1LYL A;  2P5Z X;  3MZ5 A;  1HNX L;  2WAQ G;  4IUP A;  3V2T A;  4YY3 L;  2XRS D;  3NBI A;  1S72 A;  1IBM L;  4DN4 M;  3ND8 A;  1X55 A;  4WOR A;  3S1Q H;  3STB C;  2VUM B;  2MQH A;  3GTP H;  2K4K A;  3RZD H;  1O7Z A;  2YV5 A;  1JB7 A;  4WJ4 A;  3W2D A;  3HKS A;  3S24 A;  4LWC A;  3GTO B;  4OL7 A;  1OXX K;  1UEB A;  1S4Z A;  2F0M A;  4JI3 Q;  5I6Y A;  1VQ6 A;  1Q1E A;  3R2T A;  2EYF A;  2NTT A;  4LFA Q;  3K58 A;  1Q86 C;  2QIL A;  2QEJ C;  4LF8 Q;  2R7Z G;  1JJ2 A;  3CQZ B;  5GAE C;  4AYB G;  3SE0 A;  2QKI C;  3TRE A;  4DNT B;  1NSN S;  4X3U A;  5FO9 B;  3RUZ A;  2QF7 A;  1Y14 B;  1UE7 A;  2NBF A;  1SMX A;  2HDM A;  4CDC C;  1GUW A;  1UAP A;  5C3E G;  4R4I A;  1SE3 A;  2H1E A;  2JQO A;  4LFC L;  2JA7 H;  3CCE A;  5IGB A;  3A74 A;  3BZK A;  5CV7 A;  3K7A B;  4OWT B;  2VZA A;  5I9O A;  2KED A;  3CCV A;  4ZUJ A;  2UXC L;  2XRQ D;  4XT3 B;  2F52 A;  1KAB A;  3GTM H;  4LW1 A;  3S2H H;  4DR6 L;  1VQL A;  1S5C D;  2DY7 A;  4AQY L;  4Y7N B;  4DV4 L;  1PH7 A;  1TWH B;  1BF4 A;  4HIK A;  1H9M A;  4CJ2 C;  1S5F D;  3GD7 A;  2ZJR A;  3ONA B;  4CDD C;  3BYT B;  5C0X I;  3KFU A;  1DOK A;  1IBM Q;  1WTH A;  4YWK A;  1HZC A;  1F2Y A;  1D1I A;  1VF7 A;  4NMZ A;  3TRZ A;  5G3L D;  5M5W B;  4I7Z C;  2FFK B;  1E0B A;  1Y8N B;  2SOB A;  3X3M A;  2XGT A;  5ELN A;  1J8I A;  1M1K C;  4JI6 L;  2A8V A;  2IX1 A;  1TT2 A;  1SYG A;  1UEA B;  3A8I E;  4A3M H;  4P74 A;  3T1Y Q;  3HEJ A;  2PZU A;  1TXY A;  1SYE A;  3S2D B;  1X56 A;  1H9S B;  1TU2 B;  4IUV A;  3JAM E;  3HOX H;  3KJP A;  2YU9 H;  1IZ6 A;  1C0A A;  2B2T C;  2E74 C;  3PO2 H;  1RIP A;  4C3J G;  4GN5 A;  4FXD A;  1NAP A;  2D9U A;  4ULL A;  1IYV A;  4B3T L;  3SK5 A;  2XIW A;  5M5Y H;  2O5J C;  3LWE A;  4DU9 A;  3ERO A;  2ZJQ A;  2HT1 A;  1VQM A;  1DZ1 A;  1CM9 A;  1KNE A;  2AWN A;  4X3S A;  5IYD G;  4IAL A;  4CJ0 B;  1PH4 A;  4AQY Q;  5GRO A;  3EJI A;  4RKL A;  3PUV A;  3ULL A;  3SXH A;  4IO9 A;  1EYG A;  2YTY A;  3P20 A;  5ELO A;  2RDH A;  1KXL A;  5IY0 A;  1GUO A;  1OXT A;  4MTK A;  2L1B A;  2B2W C;  2Z4H A;  3GV3 A;  1YJN A;  1U9R A;  1MGS A;  4DR2 Q;  1Y1V H;  5COY A;  2I5H A;  1I3Q H;  3FPP A;  1ICF B;  2EIF A;  4K5V A;  5M3F H;  1YNN D;  3MAQ A;  4DR1 Q;  2LKV A;  2Y0S B;  4HJ5 A;  1KD1 C;  4JI6 Q;  1AH9 A;  3OIP A;  4JI5 L;  4DV6 Q;  1BCP D;  1QUQ B;  4DK1 A;  3QOJ A;  3MWY W;  1F9R A;  3MHB A;  4BXX H;  2LSS A;  3I90 A;  2VL6 A;  5FK9 C;  5CMD A;  1JOR A;  2E2J B;  1E2W A;  1L1O C;  3RZO B;  1DGS A;  1ICW A;  2BDN A;  3H0G G;  1EIH A;  4HJ8 A;  4H7B A;  4K0K L;  2V1C C;  1FJG L;  2KEC A;  1YNX A;  5E4X A;  1ENF A;  2YYZ A;  3NTK A;  4ZKC B;  3J81 E;  1QWY A;  4K6L A;  1YIT A;  4PQX A;  3G71 A;  4B3T Q;  1IBL L;  5C4X G;  3GV6 A;  3WDN A;  3CPW A;  4V0B A;  2I07 B;  3A54 A;  2F0O A;  4L63 B;  4A3D B;  3T13 A;  1QE6 A;  4GOP A;  2K5D A;  1EIY B;  1EU4 A;  1ILQ A;  4WRD A;  1NBW A;  2HCI A;  4A3L H;  4QMG A;  1LAB A;  3KF6 A;  5BR8 L;  3M4O B;  1G51 A;  3L9A X;  3HOY H;  4IJL A;  1SJH D;  1A62 A;  1TY0 A;  1A2U A;  1XNQ Q;  5T1I A;  2F0H A;  4HJ9 A;  1V1O A;  4RKB A;  5IE8 A;  3UDX A;  2HHH L;  2CCZ A;  1O7I A;  2PCF B;  2K5N A;  3WWV A;  3PO3 B;  4BBR B;  2VQF L;  4KLK A;  3BU2 A;  1RJT A;  3C2P A;  1K83 B;  1L0X B;  1EOV A;  1LT3 D;  1WTV A;  4GKK L;  3H09 A;  2Q8T A;  1IYU A;  2J7Z A;  1WTX A;  3BVM A;  3KBG A;  2VUM G;  2X69 A;  3OTO L;  4IFD J;  1HTL D;  2WIN B;  1VQN A;  1JWS D;  4GKJ L;  1AW7 A;  4IN3 A;  3GTJ H;  3T1H Q;  5FLM H;  1FJG Q;  4OX9 L;  1JOQ A;  1LUZ A;  4DAV A;  3GTG H;  4HSP A;  3VA5 A;  4HID A;  2OQ0 A;  4LK1 C;  3IFT A;  3J80 E;  5GQO A;  3ZJY C;  4DV2 L;  4YHH Q;  1FYC A;  4NB3 A;  1K3R A;  4O1N A;  2IWH A;  1KRS A;  3PIO A;  3GDE A;  1WI5 A;  4ZUI A;  3A8K E;  3D6C A;  2YTX A;  1F9Q A;  1SXT A;  3PUZ A;  1BCP F;  3N52 A;  3DWQ A;  3IRB A;  3P75 A;  1SE4 A;  1Z7T A;  3G4S A;  2HHH Q;  1SYB A;  3RLF A;  2Z6K A;  2CVR A;  4EVO A;  3W3A A;  1Y8P B;  3I2Z A;  5LMN W;  2NVY H;  2VQF Q;  1Q7Y C;  4A3B H;  1PV4 A;  2H4O A;  1DD2 A;  2ICE C;  1MSH A;  5IWA L;  4FO2 A;  1MJC A;  1SYC A;  3ND9 A;  1LAC A;  1I50 H;  1VQ9 A;  1N8R C;  1M8A A;  4F7X A;  2Z1C A;  3JAM L;  3J7A 5;  4BBS H;  1GXD C;  1CZG A;  4OO1 H;  4GKJ Q;  1Q3L A;  1FD7 D;  4FXG C;  1J5E L;  3I56 A;  1SEB D;  2UUA L;  4B3M Q;  1LTR D;  3MXN B;  2SDF A;  4R4Q A;  3I4M H;  3CCR A;  4BY1 H;  5C4H A;  2AUJ D;  3SK6 A;  1WJJ A;  3MA2 B;  4A3I H;  3FKI B;  5E3F A;  3H3V I;  3T56 B;  3S2H B;  1YBY A;  2ALY B;  2EYL A;  3P7J A;  2D0O A;  1B3A A;  5E1F A;  4BS9 A;  3RR5 A;  3K7U C;  3NE5 B;  5C44 H;  2PQA B;  4TSS A;  1WYD A;  4HN7 A;  4C1N I;  3F2B A;  2H5X A;  2JA8 H;  4LF7 L;  1FVI A;  3CCL A;  4QIW E;  1EEF D;  2BOS A;  1N33 Q;  4A3F B;  2EZV A;  3EBE A;  1YIJ A;  1FNU A;  2XSC A;  5IGE A;  4Q0F A;  1CSP A;  5LL6 X;  2B2V A;  1YNN C;  3UI2 A;  5IYC G;  5IWA Q;  3JC6 6;  1BCP C;  4A75 A;  3H91 A;  1L0Y B;  1PTO B;  2X6G A;  2IW3 A;  2ASB A;  4IUU A;  5T1G A;  3PO2 B;  1ILP A;  2EY2 A;  5K36 H;  2Y0S G;  2QW7 A;  4QUC A;  4KMU C;  1J5E Q;  3J81 L;  1K73 C;  2UUA Q;  3DEO A;  4RHS A;  2NYZ D;  3DMU A;  5IP7 H;  1IKM A;  2B39 A;  5M5Y B;  1PH3 A;  4JI1 L;  3NQI A;  1JB3 A;  3VYT A;  5FKA C;  2RQX A;  3NSW A;  2IY5 B;  2MJ8 A;  1HUM A;  1H9R A;  3NTI A;  5FJ8 G;  3SEB A;  4IPD A;  1UE5 A;  1HA6 A;  2N8N A;  3PF4 A;  3L2P A;  4Q5V A;  2KBN A;  2K33 A;  5BN5 A;  5EKK A;  4LAA A;  3LGJ A;  5DLQ E;  3A56 A;  4A3D G;  2KOL A;  2E2H H;  4CKC A;  5E4W C;  3DWP A;  5JVG 3;  2K50 A;  3BZD B;  5I9P A;  3QIA A;  4KKT A;  5DNF A;  2R7Z B;  5C4Z A;  5L37 A;  1JT8 A;  1X32 A;  1B9M A;  1I3Q B;  2C9O A;  4ZK9 B;  4JC0 A;  2J0T D;  3HOZ H;  1E24 A;  4JYA Q;  5HUR A;  1IBK L;  5C0X G;  4F88 A;  5BN4 A;  1TS2 A;  1B3Q A;  4QF4 A;  5C6A A;  3M4Q A;  1F77 A;  3J7A V;  2N88 A;  3GTK H;  2IT1 A;  3M7G A;  2IL8 A;  1N34 Q;  4CDF C;  3PO3 G;  4BBR G;  1NY4 A;  1X3E A;  5C4J H;  3PGZ A;  1VMC A;  3E5S A;  2RF4 A;  4DNI A;  2QEX A;  3VR6 A;  4GOP C;  2F0S A;  3W1B A;  2AHO B;  4X66 L;  1XPO A;  1M4V A;  3JAM i;  1SYF A;  1PZK D;  2GA4 B;  3BDC A;  3J80 L;  1KHI A;  2E2I H;  1T9H A;  4LMQ D;  2EVB A;  4EX5 A;  4X6A H;  4DPG A;  4P72 A;  1GUG A;  2E5L L;  4DV1 Q;  1QVC A;  1WOC A;  2ZM6 L;  4GNX B;  3G6E A;  4HIM A;  1QVF A;  4XYO A;  4JV5 L;  4F87 A;  3W5O A;  3JAM c;  5CBE E;  3NBH B;  1TII D;  2NN6 H;  5HGQ A;  3IKJ A;  4BY7 H;  5D3I B;  1X3G A;  4DV3 Q;  4WJ3 M;  2XWB B;  1NTG A;  1C9O A;  5IGG A;  4LF9 L;  4KTA A;  2N78 A;  3PUW A;  2B2W A;  3GTQ H;  1EY5 A;  4K8I A;  2FIN B;  2K32 A;  3SDZ A;  4H13 C;  1QB5 D;  1SRU A;  3NEL A;  3TN2 A;  1LTI D;  1HNW Q;  1VQA A;  4QB4 A;  3F8T A;  3U4V A;  4EQN A;  1V9P A;  3QG1 A;  3RNU A;  3OMG A;  1JWM D;  2JK8 A;  2JEA I;  4A3G H;  5D3D A;  4G4K A;  1PH8 A;  1EY9 A;  2KQ3 A;  3GTG B;  2Q2H A;  3I4N H;  1L1O A;  4JI7 L;  1UE6 A;  1QG7 A;  4X66 Q;  3K57 A;  2WB1 E;  3I8Z A;  3E0J A;  4UAI A;  4A3E H;  1Q12 A;  3NXW A;  5E7N A;  4X65 Q;  4KY7 A;  1DON A;  2EDG A;  1R9T H;  4DUY L;  4DV0 Q;  1XNR Q;  1KRT A;  3J81 j;  1DCZ A;  1J6Q A;  4IUR A;  4ZCK A;  2R3Z A;  2F0Q A;  5IGC A;  2Z6K C;  3R3O A;  1WCM B;  3UDG A;  1N36 L;  4J6H A;  4DAP A;  1TQO A;  4JV5 Q;  5JAV A;  1JIC A;  2I0Q A;  4FF3 A;  2M00 A;  1XMQ L;  1DOM A;  1R4Q B;  2ZXO A;  1B8A A;  2K7V A;  5JPM C;  3U58 A;  1HTP A;  2N55 A;  3J81 c;  2HCC A;  2WP8 J;  4JI3 L;  1K8G A;  4PMB A;  2LY7 A;  2AUK A;  4NDX A;  1UUP A;  3NWT A;  2V4D A;  3S9W A;  2FMC A;  2EYP A;  3EVQ A;  3KBX A;  4A3F G;  3UDF A;  4DR5 L;  3ICE A;  2VXW A;  1I4Q A;  4IZ8 A;  2L12 A;  2OCE A;  2EY6 A;  2JA5 H;  2MNA A;  1S3O A;  2A68 D;  3KF8 B;  1X54 A;  2L55 A;  3S17 H;  4JW0 A;  3DLL A;  4J8Q A;  2FMM A;  4IJH A;  3LWU A;  2X6L A;  1BQQ T;  1FR3 A;  4K8J A;  3PO2 G;  4MZ9 A;  4RMF A;  4OWX B;  1EIF A;  1EYD A;  4A3I B;  5KYI A;  5I2X A;  2ZXP A;  2EY5 A;  1JMC A;  2O2L D;  2NZH A;  1G2S A;  3E9H A;  4X64 Q;  1QOH A;  3N6R A;  1YZ6 A;  2NWG A;  3J80 i;  5DEH A;  1MKH A;  2Q8R E;  5JJL A;  1N36 Q;  2F0P A;  1HA5 A;  3K5O A;  5ELF A;  3IAY A;  1PZI D;  1XMQ Q;  4GN3 B;  2B2V C;  2F0N A;  1SNQ A;  4PMW A;  2KVM A;  5EJW A;  1Z9F A;  5C0X J;  4X3T A;  1SMY C;  1LTL A;  5EBC A;  4UPA A;  4NW2 A;  3QR8 A;  3T1Y L;  2CKZ B;  4K5W A;  5EKI A;  3R2I A;  4NP5 A;  3EFX D;  3HG9 A;  4DNR B;  1E2V A;  3J80 c;  3Q0A A;  4P73 A;  3M7N A;  4GZY C;  1VF5 C;  2CQO A;  5FO8 B;  2K05 A;  1PH2 A;  5KGU A;  4KN7 C;  4DR5 Q;  2JSO A;  1HQR D;  4QIW B;  5IOC A;  3T51 B;  1LTT D;  4C2M B;  1D2B A;  2Z6B A;  1TWG B;  1IW7 D;  1CI3 M;  1ML0 D;  1SR3 A;  1CA5 A;  4KHP Q;  5LHY 1;  1EFI D;  3D31 A;  1YVC A;  1ZEQ X;  3K5L A;  2CH4 W;  4QCL A;  2DUD A;  5EBD A;  4PZ6 A;  1HCZ A;  4HR7 B;  4F8M A;  1LLR D;  1R4P B;  3TS2 A;  3KK7 A;  3OOC A;  1PTO D;  1ESF A;  4A3J B;  1A3V A;  4RWS C;  1STE A;  5CV4 A;  2JP1 A;  4B08 A;  1CSQ A;  3G7L A;  3D4D A;  4IUN A;  1AP0 A;  3CW2 C;  1CQV A;  4KHV A;  4XDX A;  2E2H B;  2Z8L A;  3OPO A;  3C46 A;  3RLO A;  1RL2 A;  1X65 A;  1E22 A;  1IHZ A;  3TP6 A;  1V1P A;  4DR2 L;  2JA6 B;  1C8C A;  3NK9 A;  3CRK C;  1EZ8 A;  3BG3 A;  5JOB A;  3FMC A;  4DR1 L;  4JG2 A;  3HOZ B;  4DV6 L;  2OEO A;  2IX3 A;  2PNH A;  2UU9 Q;  1A15 A;  1G29 1;  4HSV A;  1KNA A;  2RDG A;  3OYY A;  2EJF C;  4GN4 B;  1PRT B;  4G7H C;  1I6H H;  1OXV A;  1VQP A;  5IGF A;  1I6V C;  2RSN A;  5C4J B;  1VQI A;  1Q82 C;  5CV9 A;  1S40 A;  4R4O A;  4B9X A;  2MFI A;  1AE3 A;  1WFQ A;  1KAW A;  4ZLT F;  1X3Q A;  2E2I B;  3TZU A;  1JJG A;  3H94 A;  4A93 H;  1I94 Q;  1TWC B;  1KLU D;  1JE5 A;  1KAA A;  1LV9 A;  2VB3 X;  3MTS A;  2R92 H;  1VQC A;  2L4N A;  1O7Y A;  2K1B A;  3V96 A;  1XNQ L;  4ABN A;  4YWL A;  4B3S L;  3S16 H;  1RD9 D;  3UE1 A;  1PFB A;  2WKC A;  3HRZ C;  1XJV A;  3B6Y A;  3PF5 A;  4BY7 B;  1F2L A;  1CTM A;  4POG A;  1WD1 A;  4MN3 A;  2D5D A;  4TVA B;  3NTH A;  3HOV B;  1WCM G;  4OEL B;  3AU7 A;  1PYS B;  3GTQ B;  3S15 B;  3PCO B;  2R93 B;  5CR3 A;  1DXM A;  5JJI A;  1Y8O B;  1RF2 D;  1VQJ A;  2CQA A;  4U68 A;  3DM1 A;  1M90 C;  3CMA A;  2ZTC A;  4C3H H;  1HUN A;  3BDL A;  4DR4 L;  1PLF A;  4OWW B;  3T1H L;  4HMI A;  4OIK A;  4FF2 A;  5TSS A;  3S14 H;  4A3G B;  2EJG C;  1U4R A;  4IFD H;  5GAH C;  3QWN A;  1F9P A;  2A68 C;  2B8F A;  2KEN A;  3CC4 A;  1H9J A;  1BXT A;  5C3E H;  5IYB H;  2DN8 A;  4PNY A;  4YHH L;  1CKN B;  2R7F A;  5CV6 A;  1ZYR C;  3P1H A;  2BH8 A;  2EY1 A;  1XMO L;  1R9T B;  1X3F A;  5G3L F;  1WD0 A;  5DAU A;  3TS0 A;  3IFD A;  2HQE A;  4ZQ3 A;  1YEZ A;  1BBX C;  5I6W A;  3NEN A;  1ASY A;  3OMC A;  1SDF A;  4LF6 Q;  1I5F A;  1NMG A;  4DXF A;  1S5D D;  3X3N A;  4K2K A;  1KL9 A;  4DAY A;  2BA1 A;  4A3I G;  2VQE Q;  4B3S Q;  5M5X B;  1NJI C;  1O7L A;  5EPL A;  2Q8I B;  2D0P A;  1X9N A;  1U4L A;  4KD4 A;  4ZRZ A;  1EWC A;  3A5U A;  5COR A;  4IUQ A;  1XTC D;  2R61 A;  3GQB A;  4JI8 Q;  4DV5 Q;  3CXC A;  3MEF A;  2NVQ B;  4LUZ A;  1HRJ A;  3BJU A;  4K5X A;  2PPB C;  1X6O A;  4DR4 Q;  3MXG A;  1X3P A;  5M3M B;  3VA7 A;  3F1Z A;  2JA5 B;  5IOD A;  2KCC A;  4B3M L;  2N49 A;  3S17 B;  4C3J H;  2BDO A;  1SFO B;  1N32 Q;  5JPN C;  1QVG A;  5C3W A;  3LX0 A;  2MUY A;  5K5P A;  4V19 0;  1IW7 C;  2KJX A;  5FO7 B;  1EQV A;  3KLS A;  2VS1 A;  3CCJ A;  4N8X 1;  4C3I B;  1XMO Q;  1CKO A;  2B63 H;  2UXB Q;  3C1F A;  5IP9 G;  3T53 B;  2GVA A;  1A3T A;  1PYW D;  1TWA H;  1CQF A;  5IP7 G;  1PTO C;  4HTH A;  4O42 A;  4CJ1 B;  5IYD H;  1PH5 A;  2KCN A;  1VDZ A;  1N33 L;  1N9W A;  1AEX A;  3NP8 A;  1AZQ A;  3S1Q B;  4UHV A;  3VDY A;  3GTP B;  3RZD B;  4KD3 A;  4A3J G;  1E1O A;  3K5M A;  1XX8 A;  5JEA H;  1GHK A;  4IQZ A;  5D14 A;  2OF1 A;  1BVS A;  2C5C A;  3L0O A;  1EY6 A;  1U5K A;  1XWE A;  2WV6 D;  3M3Y H;  5CGK A;  1MHW C;  4ME3 A;  2EJM A;  1W6J A;  2PMZ E;  2MP1 A;  1JCK B;  2JA6 G;  5LL6 S;  3RLN A;  1KDB A;  3HOZ G;  4P75 A;  1GJX A;  3KUP A;  3F2D A;  2NVT H;  2KEE A;  4RA8 A;  1YHQ A;  1PVO A;  2XTI A;  4IFD I;  4ALP A;  2DJG C;  2PQE A;  2JA7 B;  1RTO A;  1QNU A;  1RCV D;  4A3K H;  3NHH A;  3C1E A;  4TRD A;  3DEP A;  3TP5 A;  5C4X H;  2L15 A;  1DJR D;  2XN9 C;  3GTM B;  2ID0 A;  3OWF A;  1V1Q A;  1E7Z A;  1EQR A;  2M9V A;  4L5Q A;  2OTJ A;  3CC2 A;  3D4W A;  1MJE A;  5JJK A;  4FDB A;  5ELE A;  4FF4 A;  4XQJ A;  4ID6 A;  4OON A;  2UUB Q;  1H9S A;  1YHA A;  4LNQ A;  3PUX A;  4K6D A;  4N9T A;  3I4O A;  3I91 A;  2JA9 A;  1XPU A;  1TS5 A;  2IPK D;  2MO1 A;  2HQL A;  4JYA L;  2LXJ A;  3M9B A;  3UDI A;  4A3M B;  3H3V C;  2NUC A;  3Q6S A;  3D4R A;  3AMU A;  1XPR A;  2QDL A;  1J9O A;  4LF4 Q;  4BY7 G;  4KJN A;  1N34 L;  3HOX B;  4LF5 Q;  2YU9 B;  3I3C A;  2SNS A;  1EUJ A;  4DUZ Q;  2I5L X;  1JQY D;  1VQB A;  2KCM A;  3CCM A;  1H95 A;  1K8O A;  3TEH B;  4RG1 A;  3TP7 A;  2HIX A;  3HOV G;  1WTP A;  3D8G A;  3PQI A;  3Q22 A;  3GTO H;  2ZTE A;  2AKW B;  4LFB Q;  2R93 G;  2A73 B;  1G8Z D;  4YCW A;  1VQD A;  1A3U A;  1SSO A;  5F2D A;  1SJE D;  3LNN A;  2KA7 A;  2K52 A;  1B1Z A;  4XTC S;  1U0L A;  1UNS A;  4H02 A;  2XWJ B;  3BDO A;  3CQZ H;  1JJC B;  4P71 A;  4A93 B;  1LTB D;  2B3G A;  4A3G G;  3VR3 A;  1PRT D;  1D8L A;  2RHS B;  2AMC B;  2MPM A;  1VCI A;  2F0G A;  2PZW A;  4DV1 L;  1HR0 L;  2F1M A;  1QUQ A;  5JVH 3;  5ELD A;  4NXM L;  2A6E D;  4DFA A;  4NPS A;  1IKL A;  2LMC B;  3FRP B;  1RHP A;  2A74 C;  2ICI A;  3QB3 A;  3DUZ A;  4DV3 L;  2XVS A;  2OT2 A;  1Y1V B;  2D2C C;  3V05 A;  2K01 A;  5M3F B;  4L5R C;  2K5W A;  2DJF C;  4ILW A;  1BNZ A;  4L6T B;  1S5E D;  2A19 A;  2QGQ A;  3NWS A;  3STB D;  2GVB A;  5IIF A;  1KDA A;  1YI2 A;  2WAC A;  2WB1 G;  5C5M A;  1HNW L;  2IHF A;  4C3H B;  3Q23 A;  4A3C H;  4S3S A;  3M4Y A;  2XNA C;  3C3L A;  4OO1 I;  5M5W H;  1YJW A;  4RFB A;  4HJA A;  1EFW A;  3ERS X;  3KJO A;  2CFM A;  1JE4 A;  2ENB A;  1BOS A;  4X65 L;  1V1P B;  5M3M G;  2R7D A;  2JA5 G;  1CHQ D;  4JVZ A;  4DV0 L;  4QY7 A;  3I72 A;  1XNR L;  3BYY B;  1B70 B;  3U50 C;  2K04 A;  4OHJ A;  1GUN A;  3CU7 A;  3I70 A;  3K6O A;  3K80 C;  3CCQ A;  1HR0 Q;  1STA A;  1GKH A;  4QL5 A;  5AFW A;  3HOY B;  2PI2 A;  1I4H A;  4C3I G;  4CDE C;  4EGV A;  2D62 A;  4NXM Q;  1SNP A;  2EYM A;  4ZYS A;  2ATW A;  1OO9 B;  2QCP X;  1BBW A;  1BCP B;  4JI2 Q;  1SYD A;  1YHB A;  4PZ8 A;  5DM6 3;  1CFM A;  3TQY A;  3DXJ C;  1S5B D;  5JJZ A;  4ZAI A;  3H6M A;  1Q1B A;  4OEM B;  1K3B C;  5IYC H;  2Q2I A;  3W1G A;  4APV A;  1IL8 A;  1STH A;  3GTJ B;  3E9I A;  4KKS A;  1KDC A;  1SN8 A;  5IT9 c;  4M8A A;  4KKU A;  2OWO A;  2PYK A;  1BKB A;  3KLS X; 
#chains in the Genus database with same CATH homology
 4E6I A;  1WVL A;  1I4X A;  1WTO A;  4CGY B;  2EYH A;  3T4A C;  5EPJ A;  1PDQ A;  2F0I A;  3I73 A;  4C56 C;  2B63 B;  4DF7 A;  3TSS A;  3VR2 A;  3MFY A;  4BA2 I;  2F0T A;  2AWO A;  2KUM A;  2EXZ A;  4B9W A;  2NVY B;  4A3B B;  2FJ2 A;  3PUY A;  3TP8 A;  2MGS A;  1XXG A;  3MXN A;  2K6A A;  1O80 A;  1I50 B;  2SNM A;  4CKB A;  4BBS B;  1JR0 D;  3GO5 A;  2F0D A;  3BVG A;  5BN3 A;  2IJ0 A;  2B8G A;  3MFG A;  4JBW A;  4R9W A;  2L9H A;  4H0L C;  1F2Z A;  4A3K B;  5KEE A;  3I4M B;  5CC4 A;  4BY1 B;  2PMZ B;  5D65 A;  1JOK A;  1SAP A;  1RDP D;  1PRT C;  5CYU A;  5C44 B;  3VR4 A;  3FVQ A;  3MC0 B;  4Z9C B;  4G57 A;  2JA8 B;  1O78 A;  1SNO A;  2RDF A;  2NN6 I;  5NUC A;  3QJY A;  1V8Q A;  2A6E C;  4CHT B;  2L5T A;  4KK7 A;  4ME5 A;  3TZD A;  3ERQ A;  3TDQ A;  3VYS A;  4CKE A;  4EQP A;  3A7A B;  4IUT A;  3OSO A;  5IGD A;  1SE2 A;  1GUS A;  2JYO A;  1G2T A;  3ZYY X;  5HGT A;  1PFN A;  3OWE B;  5ELB A;  4FVM A;  4C3H G;  2JEB I;  4KHZ A;  1TVX A;  4TKO B;  4G7O C;  2WII B;  4IFD G;  1V43 A;  2EPB A;  3L3O C;  2PW7 A;  2F4I A;  2IX0 A;  1JOO A;  3MVV A;  2E76 C;  1MI2 A;  1Y69 U;  1GOZ A;  1B2T A;  2RKS A;  2PO4 A;  1CK1 A;  2B2Y C;  1TS3 A;  4HCE A;  4RCN A;  1EU3 A;  2PZT A;  1TKW B;  4RGM A;  3VR5 A;  3HZX A;  3GTK B;  2EE1 A;  1SBB B;  3ITP A;  1ENA A;  5KRU A;  1EY0 A;  2AQ3 B;  2O4X A;  2RA4 A;  1EYC A;  1QCB D;  4RGO S;  3VYU A;  3PIO 3;  3NBH A;  1PTO H;  1PZJ D;  2CHB D;  2G9D A;  1EOT A;  1HHV A;  4HED A;  5ISR A;  5J1Z A;  5IT9 E;  5KIX A;  1FNW A;  1I4R A;  3EA6 A;  4RGN A;  3A55 A;  4ODG A;  2PW5 A;  2NB0 A;  2K03 A;  2FHT A;  1C48 A;  2R6G A;  3I4L A;  3BS1 A;  2CW0 D;  3FEW X;  2BA0 A;  4M1U B;  5KYL A;  3WOE A;  5I2Y A;  4I65 A;  3O13 A;  1T5E A;  5JEA G;  1G91 A;  2O5I C;  1T5X D;  5FLX E;  4FP5 D;  1PTO F;  1EY4 A;  1CA6 A;  2AQ2 B;  3I4N B;  4RGT A;  1EQT A;  3QO2 A;  3VYR A;  1QNK A;  4A3E B;  3CKI B;  1WTW A;  4OO1 G;  2F0W A;  1NUC A;  3BVZ A;  1AZP A;  1D6E C;  4FF1 A;  2B2U A;  1EIG A;  4C1N K;  1F2M A;  2TSS A;  4OGQ C;  4RAU C;  5DM7 3;  1TS4 A;  1EYA A;  3PV0 A;  2WB1 B;  4RHR A;  3MEH A;  4KJO A;  1A6X A;  5J22 A;  2DY8 A;  2ZXR A;  3KF8 A;  2ZT9 C;  1HFN A;  4KV6 A;  2DNE A;  3SR1 A;  1A2T A;  2E2D C;  4R8I A;  1EZ6 A;  5EQ0 A;  3TBI B;  1C4Q A;  1JC7 A;  4K14 A;  1WTQ A;  3HP3 A;  3HKZ B;  4NKL A;  4WJW A;  1GHJ A;  3K59 A;  1STB A;  3SVM A;  1D5M C;  1XYI A;  1TR5 A;  5FOB B;  1MSG A;  3IL8 A;  2HDL A;  5K36 G;  2BE5 D;  4U67 3;  1Q90 A;  3DWA A;  3TME A;  2OXP A;  2RBM A;  2I46 A;  1NR2 A;  4KN4 C;  1ET6 A;  3WOF A;  2AQ1 B;  1YNJ D;  1EY7 A;  1OXS C;  1ZKO A;  3D6W A;  3SHL A;  2NZ1 D;  2RVL A;  4K2L A;  4TQU S;  4L8J A;  5A2Q E;  1BO0 A;  3S1N B;  1HPC A;  5ELC A;  1HXY D;  2LFN A;  4FNF A;  4DGZ A;  1EWH A;  2DNC A;  5J39 A;  1B9N A;  3A7L A;  5CBA E;  1SND A;  3U9S A;  2A6H D;  1AFP A;  1ROD A;  1ENC A;  4P2C B;  2F0E A;  5KND A;  1PXU A;  4XQN A;  1LT5 D;  1DM0 B;  3Q24 A;  1I4G A;  2F0K A;  2EYO A;  1MBY A;  2WKD A;  4XIG S;  5IT9 L;  4H44 C;  3HOW B;  4JK1 C;  1Y1W B;  4XQQ A;  1CT1 D;  3KLR A;  4MHE A;  2F3W A;  1W6K A;  1MD2 D;  2RSO A;  1Z6H A;  4CBV A;  1D1K A;  1E2Z A;  4BA1 I;  1RKN A;  4RH6 A;  4OIJ A;  1EL0 A;  3U9O A;  3GP7 A;  5JEA J;  1LTS D;  2KHS A;  1LT4 D;  3EQL C;  2NN6 G;  1B44 D;  2CW0 C;  4KY6 A;  2JE6 I;  1ESR A;  1I6H B;  3E6Z X;  1AN8 A;  4PMC A;  5FLX L;  3NUC A;  3OIQ A;  4ZKB B;  4DK0 A;  1LTG D;  3MXU A;  2A69 D;  4N9P A;  3HGB A;  1K8M A;  3T16 A;  1FNV A;  3S1M B;  3HOU B;  2VB2 X;  3HS0 C;  5KNC A;  1BR9 A;  1RTN A;  2J4X A;  5EKL A;  4UDU C;  1PFM A;  2R92 B;  4X3K A;  1NR4 A;  4HCS A;  3S16 B;  2WAQ B;  3SK8 A;  2K5Q A;  4G7Z C;  4XYQ A;  3M85 A;  1JWU D;  1STN A;  2Z4I A;  5C3X A;  1ONL A;  4EQO A;  4FYD A;  1EEI D;  5EPK A;  3D3R A;  1EY8 A;  2SEB D;  2B2Y A;  1SMY D;  4AYB B;  3S14 B;  1B50 A;  1KLG D;  1DYQ A;  1GUT A;  1Q8I A;  5KNB A;  5EGT A;  2B2U C;  2PNR C;  5C3E B;  1B4O A;  1STY A;  1I4P A;  1D5X C;  1F9S A;  3PIP 3;  1U4P A;  2BE5 C;  1HQM C;  1VMP A;  1U4M A;  3A8J E;  1NCV A;  4RCO A;  4DA2 A;  4PV1 C;  2B2T A;  2MHV A;  5C5L A;  1YNJ C;  4BWG B;  3R93 A;  3PMF A;  1FGB D;  4MIU A;  2L11 A;  2EYJ A;  5A2Q L;  3QOL A;  4KY5 A;  3K5N A;  4XT1 B;  3NQT A;  3GTL B;  2E75 C;  3J7A F;  1HFG A;  3G6J B;  5I4D A;  2F0F A;  1LTA D;  4WFN 3;  4R8N A;  1PRT F;  3RMH A;  2A6H C;  4C3J B;  2F03 A;  4HMJ A;  3OHX C;  1B53 A;  2F0U A;  1LO5 D;  1SNM A;  3S1R B;  4FXK C;  4DXG A;  1II3 A;  3FDT A;  1KTK A;  3CHB D;  5A35 A;  3FPU B;  2BCO A;  1TWA B;  1DOL A;  2QDB A;  3DHQ A;  1LT6 D;  2NVX B;  1H9K A;  2M2L A;  1ZXT A;  2K28 A;  2L0C A;  3URY A;  4XXE A;  2JXM B;  1STG A;  3M3Y B;  5C0X H;  2G9H D;  2HUG A;  3L7Z C;  4KI0 A;  2F0V A;  3CRL C;  1PMR A;  5CV8 A;  2NVT B;  3H0G B;  5M9O A;  1Z47 A;  4LJZ C;  3NPP A;  1G6Z A;  4QUF A;  1SNC A;  3OW7 A;  3J7Y W;  3K0Y A;  2VNU D;  1OXU A;  1WTR A;  2A69 C;  1QIL A;  5C4X B;  2F0J A;  1ET9 A;  2TMP A;  2A5H A;  3RD4 A;  3MXP A;  2F3V A;  3AB9 A;  1BUV T;  3SK4 A;  3F2U A;  2NTS A;  1CHP D;  2LS0 1;  1TY2 A;  1ZYR D;  2EOT A;  5CV5 A;  1D5Z C;  1QJO A;  4J1M A;  3R8B A;  4HAE A;  1CZW A;  4YIJ A;  1BDO A;  2F0L A;  1TWF B;  3MZ5 A;  4IUP A;  3V2T A;  2XRS D;  3NBI A;  4DN4 M;  3ND8 A;  4WOR A;  2VUM B;  1O7Z A;  3W2D A;  3GTO B;  4OL7 A;  1OXX K;  1S4Z A;  2F0M A;  5I6Y A;  1Q1E A;  3R2T A;  2EYF A;  2NTT A;  3K58 A;  2QIL A;  2QEJ C;  3CQZ B;  3SE0 A;  2QKI C;  4DNT B;  1NSN S;  4X3U A;  5FO9 B;  3RUZ A;  2QF7 A;  2NBF A;  2HDM A;  1GUW A;  1UAP A;  1SE3 A;  2H1E A;  5IGB A;  5CV7 A;  3K7A B;  5I9O A;  2KED A;  4ZUJ A;  2XRQ D;  4XT3 B;  1KAB A;  1S5C D;  2DY7 A;  4Y7N B;  1TWH B;  1BF4 A;  1H9M A;  4CJ2 C;  1S5F D;  3GD7 A;  3ONA B;  3BYT B;  5C0X I;  1DOK A;  1F2Y A;  1D1I A;  1VF7 A;  4NMZ A;  5G3L D;  5M5W B;  4I7Z C;  2FFK B;  1E0B A;  1Y8N B;  2SOB A;  3X3M A;  1J8I A;  2IX1 A;  1TT2 A;  1SYG A;  1UEA B;  3A8I E;  3HEJ A;  2PZU A;  1SYE A;  3S2D B;  1H9S B;  1TU2 B;  4IUV A;  3JAM E;  2B2T C;  2E74 C;  4C3J G;  4FXD A;  1NAP A;  2D9U A;  4ULL A;  1IYV A;  3SK5 A;  2XIW A;  2O5J C;  3LWE A;  4DU9 A;  3ERO A;  1DZ1 A;  1CM9 A;  1KNE A;  2AWN A;  4X3S A;  4IAL A;  4CJ0 B;  3EJI A;  4RKL A;  3PUV A;  3SXH A;  3P20 A;  2RDH A;  1GUO A;  1OXT A;  2L1B A;  2B2W C;  2Z4H A;  3GV3 A;  1U9R A;  1MGS A;  5COY A;  3FPP A;  4K5V A;  1YNN D;  3MAQ A;  2LKV A;  2Y0S B;  3OIP A;  1BCP D;  4DK1 A;  3QOJ A;  3MWY W;  1F9R A;  3MHB A;  3I90 A;  5FK9 C;  5CMD A;  1JOR A;  2E2J B;  1E2W A;  3RZO B;  1ICW A;  2BDN A;  1EIH A;  4H7B A;  2KEC A;  5E4X A;  1ENF A;  2YYZ A;  3NTK A;  4ZKC B;  3J81 E;  1QWY A;  4K6L A;  4PQX A;  3GV6 A;  3WDN A;  4V0B A;  2I07 B;  3A54 A;  2F0O A;  4L63 B;  4A3D B;  3T13 A;  1QE6 A;  2K5D A;  1EU4 A;  1ILQ A;  4WRD A;  2HCI A;  4QMG A;  1LAB A;  3M4O B;  3L9A X;  1SJH D;  1TY0 A;  1A2U A;  5T1I A;  2F0H A;  1V1O A;  4RKB A;  2PCF B;  3PO3 B;  4BBR B;  1RJT A;  3C2P A;  1K83 B;  1L0X B;  1LT3 D;  1WTV A;  3H09 A;  2Q8T A;  1IYU A;  2J7Z A;  1WTX A;  3BVM A;  3KBG A;  2X69 A;  4IFD J;  1HTL D;  2WIN B;  1JWS D;  1AW7 A;  4IN3 A;  1JOQ A;  4DAV A;  4HSP A;  3VA5 A;  4LK1 C;  3IFT A;  3J80 E;  1FYC A;  4O1N A;  2IWH A;  4ZUI A;  3A8K E;  3D6C A;  1F9Q A;  1SXT A;  3PUZ A;  1BCP F;  3N52 A;  3DWQ A;  3P75 A;  1SE4 A;  1Z7T A;  1SYB A;  3RLF A;  2CVR A;  4EVO A;  3W3A A;  1Y8P B;  2H4O A;  1DD2 A;  2ICE C;  1MSH A;  4FO2 A;  1SYC A;  3ND9 A;  1LAC A;  1M8A A;  4F7X A;  2Z1C A;  3JAM L;  1GXD C;  1CZG A;  4OO1 H;  1Q3L A;  1FD7 D;  4FXG C;  1SEB D;  1LTR D;  2SDF A;  5C4H A;  2AUJ D;  3SK6 A;  3MA2 B;  3FKI B;  5E3F A;  3T56 B;  3S2H B;  2EYL A;  3P7J A;  5E1F A;  1B3A A;  4BS9 A;  3NE5 B;  4TSS A;  4HN7 A;  4C1N I;  1EEF D;  2BOS A;  4A3F B;  2EZV A;  1FNU A;  2XSC A;  5IGE A;  4Q0F A;  5LL6 X;  2B2V A;  1YNN C;  3UI2 A;  1BCP C;  3H91 A;  1L0Y B;  1PTO B;  2X6G A;  2IW3 A;  4IUU A;  5T1G A;  3PO2 B;  1ILP A;  2EY2 A;  5K36 H;  4QUC A;  4KMU C;  3J81 L;  3DEO A;  4RHS A;  2NYZ D;  3DMU A;  1IKM A;  2B39 A;  5M5Y B;  3NQI A;  1JB3 A;  3VYT A;  5FKA C;  2RQX A;  3NSW A;  2MJ8 A;  1HUM A;  1H9R A;  3NTI A;  3SEB A;  1HA6 A;  4Q5V A;  2K33 A;  5BN5 A;  5EKK A;  4LAA A;  3A56 A;  2KOL A;  4CKC A;  5E4W C;  3DWP A;  5JVG 3;  3BZD B;  5I9P A;  3QIA A;  4KKT A;  5DNF A;  2R7Z B;  5C4Z A;  1X32 A;  1B9M A;  1I3Q B;  2C9O A;  4ZK9 B;  2J0T D;  5HUR A;  5C0X G;  4F88 A;  5BN4 A;  1TS2 A;  4QF4 A;  5C6A A;  1F77 A;  3J7A V;  2N88 A;  2IT1 A;  3M7G A;  2IL8 A;  1VMC A;  3E5S A;  3VR6 A;  2F0S A;  1M4V A;  1SYF A;  1PZK D;  2GA4 B;  3BDC A;  3J80 L;  4LMQ D;  2EVB A;  1GUG A;  4XYO A;  4F87 A;  5CBE E;  1TII D;  2NN6 H;  3IKJ A;  5D3I B;  2XWB B;  5IGG A;  4KTA A;  3PUW A;  2B2W A;  1EY5 A;  4K8I A;  2FIN B;  2K32 A;  3SDZ A;  4H13 C;  1QB5 D;  3TN2 A;  1LTI D;  4QB4 A;  4EQN A;  3QG1 A;  3OMG A;  1JWM D;  2JEA I;  5D3D A;  4G4K A;  1EY9 A;  2KQ3 A;  3GTG B;  1QG7 A;  3K57 A;  4UAI A;  3I8Z A;  3E0J A;  1Q12 A;  3NXW A;  4KY7 A;  1DON A;  2EDG A;  1DCZ A;  4IUR A;  2R3Z A;  2F0Q A;  5IGC A;  3R3O A;  1WCM B;  4DAP A;  4J6H A;  1TQO A;  5JAV A;  1JIC A;  4FF3 A;  2M00 A;  1DOM A;  1R4Q B;  2ZXO A;  2K7V A;  5JPM C;  1HTP A;  2N55 A;  2HCC A;  2WP8 J;  4PMB A;  2LY7 A;  2AUK A;  4NDX A;  1UUP A;  3NWT A;  2V4D A;  3S9W A;  2FMC A;  2EYP A;  3EVQ A;  3KBX A;  2VXW A;  1I4Q A;  4IZ8 A;  2L12 A;  2EY6 A;  2A68 D;  2L55 A;  4J8Q A;  2FMM A;  3LWU A;  2X6L A;  1BQQ T;  1FR3 A;  4K8J A;  1EYD A;  4A3I B;  5KYI A;  5I2X A;  2ZXP A;  2EY5 A;  2O2L D;  1G2S A;  1QOH A;  3N6R A;  2NWG A;  5DEH A;  2Q8R E;  2F0P A;  1HA5 A;  3K5O A;  5ELF A;  3IAY A;  1PZI D;  2B2V C;  2F0N A;  1SNQ A;  4PMW A;  2KVM A;  5EJW A;  5C0X J;  4X3T A;  1SMY C;  5EBC A;  4NW2 A;  4K5W A;  5EKI A;  3R2I A;  4NP5 A;  3EFX D;  3HG9 A;  4DNR B;  1E2V A;  3Q0A A;  3M7N A;  4GZY C;  1VF5 C;  5FO8 B;  2K05 A;  5KGU A;  4KN7 C;  2JSO A;  1HQR D;  4QIW B;  5IOC A;  3T51 B;  1LTT D;  4C2M B;  1D2B A;  1TWG B;  1IW7 D;  1CI3 M;  1ML0 D;  1CA5 A;  5LHY 1;  1EFI D;  3D31 A;  1ZEQ X;  3K5L A;  4QCL A;  5EBD A;  1HCZ A;  4HR7 B;  4F8M A;  1LLR D;  1R4P B;  3KK7 A;  3OOC A;  1PTO D;  1ESF A;  4A3J B;  1A3V A;  4RWS C;  1STE A;  5CV4 A;  2JP1 A;  4B08 A;  3G7L A;  3D4D A;  4IUN A;  1AP0 A;  1CQV A;  4KHV A;  4XDX A;  2E2H B;  2Z8L A;  3OPO A;  3C46 A;  1IHZ A;  3TP6 A;  1V1P A;  2JA6 B;  1C8C A;  3NK9 A;  3CRK C;  1EZ8 A;  3BG3 A;  5JOB A;  3FMC A;  3HOZ B;  2OEO A;  2IX3 A;  1A15 A;  1G29 1;  4HSV A;  1KNA A;  2RDG A;  2EJF C;  1PRT B;  4G7H C;  1OXV A;  5IGF A;  1I6V C;  2RSN A;  5C4J B;  5CV9 A;  4B9X A;  4ZLT F;  1X3Q A;  2E2I B;  3TZU A;  3H94 A;  1TWC B;  1KLU D;  1KAA A;  1LV9 A;  2VB3 X;  3MTS A;  2L4N A;  1O7Y A;  2K1B A;  3V96 A;  4ABN A;  1RD9 D;  1PFB A;  2WKC A;  3HRZ C;  4BY7 B;  1F2L A;  1CTM A;  1WD1 A;  4MN3 A;  2D5D A;  3HOV B;  3NTH A;  3AU7 A;  3GTQ B;  3S15 B;  2R93 B;  5CR3 A;  1DXM A;  1Y8O B;  1RF2 D;  2CQA A;  4U68 A;  3DM1 A;  1HUN A;  3BDL A;  1PLF A;  4HMI A;  4OIK A;  4FF2 A;  5TSS A;  4A3G B;  2EJG C;  1U4R A;  4IFD H;  3QWN A;  1F9P A;  2A68 C;  2B8F A;  1H9J A;  1BXT A;  2DN8 A;  4PNY A;  5CV6 A;  1ZYR C;  3P1H A;  2EY1 A;  1R9T B;  5G3L F;  1WD0 A;  5DAU A;  3IFD A;  2HQE A;  4ZQ3 A;  1BBX C;  5I6W A;  3OMC A;  1SDF A;  4DXF A;  1S5D D;  3X3N A;  4K2K A;  4DAY A;  2BA1 A;  5M5X B;  1O7L A;  5EPL A;  2Q8I B;  1U4L A;  4KD4 A;  4ZRZ A;  1EWC A;  5COR A;  4IUQ A;  1XTC D;  2R61 A;  3GQB A;  2NVQ B;  1HRJ A;  4K5X A;  2PPB C;  3MXG A;  1X3P A;  5M3M B;  3VA7 A;  2JA5 B;  5IOD A;  2KCC A;  3S17 B;  2BDO A;  1SFO B;  5JPN C;  5C3W A;  3LX0 A;  2MUY A;  5K5P A;  4V19 0;  1IW7 C;  2KJX A;  5FO7 B;  1EQV A;  3KLS A;  4C3I B;  3C1F A;  3T53 B;  1A3T A;  1PYW D;  1CQF A;  1PTO C;  4HTH A;  4O42 A;  4CJ1 B;  2KCN A;  1VDZ A;  1AEX A;  3NP8 A;  1AZQ A;  3S1Q B;  3GTP B;  3RZD B;  4KD3 A;  3K5M A;  1XX8 A;  5JEA H;  1GHK A;  4IQZ A;  5D14 A;  2OF1 A;  2C5C A;  1EY6 A;  1XWE A;  2WV6 D;  5CGK A;  2EJM A;  1W6J A;  2MP1 A;  1JCK B;  5LL6 S;  1KDB A;  1GJX A;  3KUP A;  2KEE A;  4RA8 A;  4IFD I;  2PQE A;  2JA7 B;  1RTO A;  1QNU A;  1RCV D;  3NHH A;  3C1E A;  4TRD A;  3DEP A;  3TP5 A;  1DJR D;  2XN9 C;  3GTM B;  2ID0 A;  3OWF A;  2M9V A;  3D4W A;  5ELE A;  4FF4 A;  4XQJ A;  4ID6 A;  1H9S A;  3PUX A;  4K6D A;  4N9T A;  3I91 A;  1TS5 A;  2IPK D;  4A3M B;  3H3V C;  2NUC A;  3Q6S A;  3D4R A;  3AMU A;  1J9O A;  4KJN A;  3HOX B;  2YU9 B;  3I3C A;  2SNS A;  1JQY D;  1K8O A;  3TP7 A;  1WTP A;  3D8G A;  3Q22 A;  2A73 B;  1G8Z D;  1A3U A;  1SSO A;  5F2D A;  1SJE D;  3LNN A;  2KA7 A;  1B1Z A;  4XTC S;  1UNS A;  2XWJ B;  3BDO A;  4A93 B;  1LTB D;  3VR3 A;  1PRT D;  2MPM A;  1VCI A;  2F0G A;  2PZW A;  2F1M A;  5JVH 3;  5ELD A;  2A6E D;  4DFA A;  1IKL A;  2LMC B;  1RHP A;  2A74 C;  2ICI A;  3DUZ A;  3QB3 A;  3FRP B;  2XVS A;  2OT2 A;  1Y1V B;  2D2C C;  3V05 A;  2K01 A;  5M3F B;  2K5W A;  4ILW A;  1BNZ A;  4L6T B;  1S5E D;  3NWS A;  5IIF A;  1KDA A;  2WAC A;  5C5M A;  4C3H B;  3Q23 A;  4S3S A;  3M4Y A;  2XNA C;  3C3L A;  4OO1 I;  4RFB A;  1JE4 A;  2ENB A;  1BOS A;  1V1P B;  1CHQ D;  3I72 A;  3BYY B;  2K04 A;  4OHJ A;  1GUN A;  3CU7 A;  3I70 A;  3K6O A;  1STA A;  5AFW A;  3HOY B;  1I4H A;  4C3I G;  4EGV A;  2D62 A;  1SNP A;  2EYM A;  4ZYS A;  1OO9 B;  2QCP X;  1BCP B;  1SYD A;  5DM6 3;  1CFM A;  5JJZ A;  3DXJ C;  1S5B D;  4ZAI A;  3H6M A;  1Q1B A;  1STH A;  1IL8 A;  3GTJ B;  4KKS A;  1KDC A;  4M8A A;  4KKU A;  2PYK A;  3KLS X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...