4IJHA

Fragment-based discovery of protein-protein interaction inhibitors of replication protein a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of Protein-Protein Interaction Inhibitors of Replication Protein A.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ijhA00
3RN5A 4IOCA 5C44H 5AJ3L 3K7UC 1IL2A 4X64L 1HR0Q 1Q1BA 5LMUQ 1XPOA 3HOWH 1VQ7A 2E5LL 2ZM6Q 1MJCA 2EXDA 1J5EL 3J81c 3MXNB 3NBHB 1K73C 3GTQH 1LYLA 2NVYH 2JEBI 1S72A 4A93G 2VQFQ 4JV5L 3I55A 1J6QA 3PO3G 4KI0A 1WCMH 2F4VL 4LF4Q 3HOUG 1VQ4A 3KDFA 4A93H 2MO1A 3PO3H 3RNUA 1Q86C 2OQ0A 2UUBL 1ASYA 1SN8A 4BBSG 4ME3A 4P71A 1L2FA 2OCEA 3CMEA 2VQEQ 3GTPH 3HOUH 3PIPA 4LFBL 4BBSH 4IJHA 4O0AA 1Z9FA 2GVBA 4GOPB 2I5MX 1A0IA 1OXSC 4GKKQ 1KD1C 4DV5Q 4TQUS 3OTOL 4MTNA 4DV2L 3M85A 2I5HA 2YYZA 2NZHA 1HNZQ 1DGSA 3UDGA 1AE3A 1XNRL 2ZTEA 4O2DA 1SMXA 2LXKA 2D62A 1YIJA 4AIMA 1UE5A 2ZTCA 1EIFA 4NXNL 3KLWA 4JG2A 5IWAL 1IBMQ 4DV1Q 5M5XH 2WAQE 2A8VA 2JA8G 4AQYQ 3ERSX 4B3SL 5M3MG 1EFWA 4UP9A 4BXXG 4PZ8A 4DR1Q 1NBWA 4POGA 4C3JH 4OX9Q 3GD7A 4JI4Q 2DUDA 3CPWA 3CCSA 2B3GA 1SE8A 4B3MQ 4BXXH 1HH2P 4JI0L 2AHOB 3I4OA 5HY6A 4R4OA 3HOZG 4DV3Q 4JYAQ 1GD7A 5IYBG 3JC66 3W1BA 4X65L 3KF6A 2JE6I 4RMFA 3RR5A 4L5SA 2HT1A 5IYCG 2ASBA 2PNHA 4LFCL 3EN2A 4GS3A 1WFQA 4OXPA 2LSSA 2R7ZG 3HOZH 4GNXC 4DR4Q 4JI1L 4DV4L 1LM0A 4LF7L 1A8VA 4IPCA 3H3VI 5IYCH 3HOVG 1VQNA 4JI5L 1BBWA 1CKOA 3HOYG 2UXCL 3U4ZA 2N8NA 1OXUA 5HGQA 3K81C 3BU2A 1KL9A 1YI2A 2AWOA 3UDIA 4EQ5A 3HOVH 2BA1A 3PCOB 1MKHA 1BVSA 1CSQA 1IBKL 3KDFB 3HOYH 2RCNA 1TWFH 3T1HQ 4QJFA 4DR7Q 3E9IA 2ZTDA 1QZGA 1X3FA 3STBD 1Q12A 3M4QA 4GLAC 1GM5A 4NXMQ 1V9PA 3ULJA 3U4VA 2VW9A 4B3TQ 1N34Q 2XGTA 1YNXA 2ZJPA 2UU9Q 1UE6A 3KJOA 1N32L 1M1KC 4LF8L 4DNIA 4OONA 3F2DA 2OWOA 1KRSA 3KOJA 4YCVA 1W3SA 3EBEA 1WYDA 3HFZB 4GOPA 4DR6L 4JI2L 4IJLA 3S1RH 1CKMA 2WP8J 3CCJA 3T1YL 2VY3A 4DV5L 2D0OA 2QA4A 1PVOA 2GVAA 2UXBQ 1Y1VH 3PUVA 3PGZA 4Y52H 4LWCA 3ER0A 1XNQL 1N36L 5LMNW 3FKIG 4UPAA 1VQLA 4DR5L 1VQDA 4A3IG 3D31A 1N33L 1VQ6A 2VZAA 2LXJA 2VL6A 4DAYB 4UY8C 2R92G 2E2JH 4IPDA 2HHHQ 2I5LX 4DR2Q 3TQYA 3L0OA 2IHFA 4DV6Q 3FKIH 3AQQA 4PZ6A 3ULPA 4A3IH 1GKHA 4GLXA 2R92H 3K7AH 4LFAQ 1L1OA 3HKZG 4JBMA 3CCVA 4DUZQ 2JA5H 4A76A 3B6YA 1YVCA 5BR8L 1FGUA 5IE8A 3HKZE 1VQHA 1X6OA 3CPFA 3KF6B 2QEXA 1MJEA 1HNXQ 1Y1WG 3GTMH 4YWKA 3UE0A 4AYBG 1VQJA 4AH6A 2YTVA 4X66Q 3M4OH 1C9OA 1Q8KA 3S1QH 2JA7H 1YJNA 1Y1WH 2MFIA 1CSPA 3PO2H 4L5QA 2IHEA 1SLJA 2NN6I 2Q2UA 1XMQQ 2K5HA 3TRZA 4LF5Q 3U58A 1KRTA 2E2IH 1A63A 4C3IH 1I94Q 4DKAC 1EYGA 4IO9A 4LF9L 1G291 4OWTB 1OXTA 1N8RC 2JK8A 1I50H 2ALYB 3PV0A 2WFWA 2JJQA 3OYYA 3SGIA 4YY3L 3E0EA 4JI7L 4IOAA 2F3IA 4DV0Q 2N78A 1JJ2A 1N9WA 3CCQA 1VQPA 2K5NA 3CXCA 2CFMA 2PI2E 3G48A 4DUYQ 4GKJL 4XIGS 1IBLQ 2E2HH 3PUYA 5IP9G 5FJ8G 1KQSA 4B3RQ 4KHPQ 2R93G 2Z6KA 4PMWA 5JEAJ 1V1QA 1HJPA 1K0RA 4LUZA 1Q81C 4A4IA 4LNQA 1I5FA 4A3LG 1YHBA 4NXML 2RHSB 2JA6G 2UUCQ 4B3TL 4JI6Q 3ZJYC 5IP9H 4LF6Q 5IYDG 1PV4A 5M3FG 4A3LH 2Q2HA 3RZDH 2EIFA 4BY1G 3I7FA 1VQIA 4JBJA 4JBKA 3STBC 1EIYB 3I2ZA 5M3FH 4JI8L 4X62Q 2FXQA 4GN4B 3J80c 1YZ6A 2JQOA 4BY1H 2UXBL 2VNUD 1A62A 1PFSA 2PQAA 1IXRA 2Q2IA 4OO1G 3PF4A 1B8AA 4A3KG 1FJGQ 1X65A 5EAYA 3CCRA 2UUAQ 4OO1I 1L1OB 1KHIA 1HNWQ 2HHHL 5LMNQ 3TS2A 1EWIA 1E1TA 4K0KQ 4R1JA 4QL5A 1PH8A 1V43A 4A3KH 2JA8H 1D7QA 3IRBA 4YHHL 2UXDQ 5M3MH 3EIVA 3WWVA 2C35B 2H5XA 3DM3A 1K8AC 1Z47A 1TWCH 1XMOL 1C0AA 2R7DA 4KLKA 1PA6A 1TWAH 5H1SE 2QGQA 1B7YB 1OXXK 3U50C 3J81i 4HJ7A 1JJCB 3BZCA 4DR3L 4JI3Q 4IFDJ 1X9NA 4DV7Q 4J15A 2KENA 3JAMc 5IYBH 4A3JG 1KIXA 1NE3A 4GN5A 1WI5A 2BA0A 4TVAB 3J7A5 4HIDA 3UDXA 2VS1A 4UP7A 4QIWE 3KF8B 4UP8A 2KHJA 1HR0L 5LMUL 1SRUA 3PUZA 3H3VH 1E7ZA 2R7ZH 3F8TA 4A75A 2ZM6L 2CWPA 1G51A 4A3JH 3BJUA 3I4NG 3S16H 1EUJA 3RN2A 1PH9A 3K80C 1GVPA 3I4MG 1YEZA 1Q46A 5DLQE 3ULLA 2VQFL 1GO3E 1OXVA 2F52A 2R6GA 4QY7A 2XTIA 4RG1A 3I4NH 1U5KA 1WOCA 4HJ5A 1QUQA 4PG3A 4A3GG 1MIUA 4GOPC 5IP7G 4C3HH 5AJ3Q 1VQMA 5C0XJ 1PH7A 4X64Q 4LF4L 3F2BA 3I4MH 1VQBA 5JEAG 1VQCA 2E5LQ 1IBLL 1FL0A 1J5EQ 1H95A 3E9HA 3BZKA 1P8LA 1IYJB 4L5TA 3RLOA 2VQEL 2OTLA 1VQOA 1LUZA 2IT1A 4JV5Q 4DPGA 4A3BG 1KAWA 1PH5A 1PHJA 4GKKL 3CP0A 4A3MG 1UE7A 2F4VQ 3A5ZB 5IY0A 1X56A 3CCUA 4GNXA 1W2BA 1I6HH 4GLVB 2JEAI 1M90C 2UUBQ 1HNZL 2I0QA 3CCLA 2PQAB 4NB3A 3HOXG 2CKZB 1R9TH 4LFBQ 1G6PA 2KCTA 3Q8DA 4QGUA 3A74A 1UEBA 4DK3C 1TWHH 3HOXH 1YHAA 3H0GG 2AKWB 4DV1L 1IBML 1EQRA 1P16A 3PSIA 1UWVA 4JBWA 4BBRG 3OTOQ 3J7ZC 1AE2A 4AQYL 3S2HH 2BH2A 1HNWL 3K8AA 2ZJRA 1Q7YC 1NMGA 3H0GH 4DR1L 2ZJQA 4HJ9A 1XNRQ 4BBRH 4LUVA 4FDBA 4OX9L 4JI4L 1PYSB 1IZ6A 2UXDL 2ATWA 2L15A 4DAMA 4B3ML 1E3PA 4NXNQ 3CQZH 3M9BA 1PH1A 4KHZA 4DV3L 4JYAL 2V1CC 5JJKA 5C4XG 3S15H 3PUWA 3GDEA 2NN6G 3K0XA 4OWXB 4B3SQ 4AYBE 1K9MC 1VQGA 1VQ9A 4IFDI 2HQLA 3G4SA 1ASZA 4A3CG 3S1MH 4DR4L 5C4XH 2CCZA 1BBUA 1RIPA 3HKSA 4R4IA 4HIKA 2YU9H 4A3CH 1KC8C 2Q2TA 1E22A 3L2PA 1AH9A 2Y0SG 3AEVA 2CWAA 4X65Q 1I3QH 1QUQB 4JOIA 2NVXH 1WJJA 1U0LA 2JA9A 2N49A 4POFA 2Y0SE 3F1ZA 4LFCQ 3S2DH 4BA2I 2K75A 1JE5A 3T1HL 4DR7L 4JI1Q 4DV4Q 4LF7Q 4YWMA 5C0XI 1QVFA 1NTGA 4HJAA 4JI5Q 1SR3A 2K4KA 2R7FA 1N34L 2UXCQ 2UU9L 5FJ8H 3LGJA 4H02A 4YWLA 2R93H 1E1OA 2VUMG 3CCMA 1Y14B 3PIOA 3TS0A 1WCMG 3KYHC 4GNXB 2JA6H 3PUXA 3FHWA 2YTXA 1IBKQ 1CKNA 2B63G 1K8GA 3ICEA 3W5OA 2VUMH 3NENA 5IYDH 1OTCA 2DGYA 1PH2A 2YV5A 1VQ8A 2GN5A 2B63H 5C3EG 3OW2A 1VQFA 1YJ9A 1N32Q 4LF8Q 2IY5B 2K14A 3S14H 1D8LA 1L0WA 4L5RC 1HZBA 4R4CA 4WJ3M 4DR6Q 1HZ9A 1TXYA 4JI2Q 5C3EH 1TWGH 4R4QA 4DV6L 4DR2L 4A3EG 3T1YQ 3CW2C 1KXLA 3RLFA 3KFUA 3DLLA 4YCWA 1EOVA 1SFOH 2AMCB 4JCVE 1PH6A 4LFAL 2K52A 4X6AH 4DUZL 4A3EH 3S1NH 1XNQQ 1N36Q 1VQKA 2BH8A 4APVA 4DR5Q 1N33Q 1X54A 2WAQG 1Q82C 4YCUA 1PH3A 1HNXL 4A3DG 1EQQA 3UE1A 4BA1I 1Q1EA 3TEHB 4QQBX 2MNAA 4ALPA 4X66L 4Y7NH 1QVCA 4IPHA 1JMCA 1VCIA 3GTOH 3NELA 2ES2A 4A3DH 5BR8Q 5M5WH 2WB1G 1XMQL 3RLNA 3CD6A 3AFPA 3M4PA 4LF5L 3A0JA 4EX5A 4C2MH 1QZHA 2WB1E 1I94L 4OWWB 1X3EA 3S24A 3VDYA 1XTDA 1YITA 4MZ9A 1HR0W 1K83H 1K3RA 3G71A 4HIMA 3L7ZC 5ELOA 3D0FA 1HZAA 2IX1A 3F2CA 4P74A 4DV0L 3PF5A 2NZOA 3KJPA 4DUYL 2PMZE 4B3RL 4P73A 3S17H 4A3GH 1PYBA 2K50A 5IP7H 2OQKA 4KHPL 2D0PA 2A19A 3J80i 4LF9Q 2MQHA 1SROA 2ID0A 3CAMA 2UUCL 4JI6L 2MO0A 4LF6L 1CKNB 4GN3B 2EQSA 5GQOA 4JI7Q 4YY3Q 3GO5A 5GAEC 1YBYA 2NVTH 4LUOA 3M7NA 1JJGA 5GROA 4A3BH 4WJ4A 4GKJQ 1XPUA 2Z0SA 1PH4A 4LW1A 5GAGC 4A3MH 1L1OC 3CMAA 4X62L 1FVIA 1S3OA 5FLMG 5ELNA 5GAHC 3CC7A 4XTCS 3UDFA 2KCMA 3MEFA 3GTGH 2CQOA 1HZCA 2E8GA 5K36G 2KBNA 5M5YH 1YJWA 1C7YA 5FLMH 2N3SA 2PI2A 4NPSA 3G6EA 1FJGL 1LTLA 5IT9c 1X3GA 4DV2Q 2UUAL 4BY7G 5JJIA 1NMFA 1VQ5A 1Y1VG 5LMNL 1NJIC 4DK6C 4K0KL 3NEMA 1YHQA 2OTJA 3JAMi 4JI8Q 1VQEA 2B29A 1NY4A 4HIOA 4BY7H 4P75A 2HIVA 2YTYA 4PZ7A 3GTJH 5JJLA 2IX0A 1E24A 3W1GA 5IWAQ 3GTKH 2A1AA 4IFDG 3GTLH 4R4TA 1JT8A 4A3FG 3RZOH 4JI3L 1VQAA 2JA5G 4P72A 4DV7L 3FP9A 4JOIC 4HJ8A 1S40A 3H15A 4YHHQ 5FLXc 5C4JH 4A3FH 2NVQH 1B70B 2AWNA 3TREA 1JB7A 5J3BA 2K5VA 4IPGA 5E7NA 4JI0Q 2KHIA 2Z6KC 3AYHB 1XMOQ 3CF5A 1VS0A 3I56A 1QVGA 1CUKA 3M3YH 5GADC 3CCEA 1BKBA 1XJVA 5C44G 2JA7G 2HIXA 3CC2A 4MNOA 3AFQA 4DR3Q 3A5UA 2RHQB 1X55A 1UE1A 1XPRA 3CC4A 2RF4A 3HOWG 3PO2G 5C0XG 3J81j 1O7IA 4JC0A 1RL2A 1T9HA
chains in the Genus database with same CATH superfamily
3FRPB 3DWPA 5JVH3 2F0MA 3S9WA 1HR0Q 3KLSA 2Z4HA 1BCPD 2JA7B 2IW3A 3OOCA 3PO2B 1SNDA 2HDMA 5JAVA 1EY8A 3OWEB 3I55A 2A5HA 4CJ1B 3P20A 2WV6D 2PQEA 1WCMH 1MGSA 2BCOA 1Q86C 2UUBL 4ME3A 4P71A 1L2FA 3CMEA 3URYA 3PIPA 4CGYB 1IKMA 2B2VC 2I5MX 1A0IA 1OXSC 3J80L 4GKKQ 1X3QA 3BG3A 4ID6A 4TQUS 3SDZA 1ENFA 2RSNA 5FO8B 4DV2L 3M85A 2NZHA 1GUWA 2F0JA 3ND8A 3KBXA 4F87A 2D62A 1YIJA 5JPNC 4AIMA 1UE5A 2ZTCA 1B2TA 1HQRD 3KLWA 4JG2A 4L63B 1V8QA 5M5XH 3R2TA 4B3SL 4IUPA 5CV4A 4J6HA 1DM0B 4DR1Q 4FF1A 1KTKA 4OX9Q 2Q8TA 1STHA 3CCSA 2K5WA 2EDGA 4A3KB 4BXXH 2Z4IA 3OPOA 5IYBG 2B2UC 4RMFA 3RR5A 5IYCG 2PNHA 1TWAB 3VR6A 2R7ZG 4DR4Q 2LSSA 4NMZA 4DV4L 4IPCA 3H3VI 3SK6A 1VQNA 4OGQC 4JI5L 4O42A 5E3FA 2SNSA 3K81C 3BU2A 3NBHA 1ICWA 4QIWB 2BA1A 4A3JB 1BVSA 1CSQA 1CI3M 2JSOA 4XYQA 4ZKCB 1IBKL 3HOYH 1TWFH 3VR2A 5ELBA 2CVRA 4DR7Q 5EKKA 2ZTDA 5C5MA 1X3FA 3A8KE 1GM5A 3GV6A 3I8ZA 1LV9A 1N34Q 4IUVA 3T16A 3QO2A 3KJOA 1M1KC 4DNIA 3F2DA 3KOJA 4DK0A 4YCVA 4GOPA 1ZKOA 2B2YC 3T1YL 3FVQA 4C1NI 4EVOA 3NWSA 5LMNW 3BS1A 1PZID 1VDZA 4DR5L 4A3IG 3D31A 2LXJA 2VL6A 4ZK9B 2L9HA 4IPDA 2I5LX 1ZXTA 3FKIH 2XRQD 3FKIB 2JA5H 4A76A 3CRLC 5IE8A 1DOKA 2QEXA 1WD1A 2EY2A 5EPKA 4BBRB 4V0BA 3MHBA 2YTVA 2RKSA 1C9OA 4XXEA 3S1QH 1LT5D 2WIIB 5C6AA 1Y1WH 4C3IG 1CSPA 3S15B 3F2UA 3GP7A 3Q24A 1Y1WB 2TMPA 2D5DA 3KF8A 4LF9L 4DNTB 1EYGA 3DWQA 4K2KA 1IKLA 4PV1C 2JK8A 2YU9B 2WFWA 4YY3L 2XNAC 2A74C 3CU7A 4KY6A 2F0WA 1JR0D 5I6YA 4MIUA 1YNJD 4ZUIA 4G7OC 2PI2E 4XQNA 3G48A 1XWEA 4XIGS 4GKJL 1KQSA 5IP9G 4KHPQ 4KK7A 3VR4A 2R93G 3S14H 1JORA 2NTTA 4LUZA 1CQVA 1I5FA 1O7LA 5IODA 1S5DD 2UUCQ 3ZJYC 2GA4B 1PV4A 5M3FG 1C8CA 4FXDA 3RZDH 3JAME 2KEDA 4JBJA 4RGNA 1R4QB 1EIYB 4X62Q 1A15A 4PQXA 1PFSA 1Y69U 5HURA 4DFAA 3NQIA 1NAPA 1FJGQ 5EAYA 1SE3A 2IX3A 4LMQD 1JICA 4K8JA 3WDNA 1D7QA 3IRBA 4YHHL 3V05A 3WWVA 3DM3A 4JPBW 1K8AC 3BVMA 1PLFA 1TWCH 2R7DA 2F0PA 4HMIA 4KLKA 2B2VA 1PA6A 2QGQA 1OXXK 3J7AF 3BYTB 1J9OA 4WJWA 1X9NA 4XT1B 4J15A 2AUKA 1ZYRD 1O80A 5IYBH 3NTHA 1NE3A 5BN5A 4HIDA 1B1ZA 1V1PB 4UP8A 1PTOB 1SRUA 2R7ZH 4RH6A 1G51A 2CWPA 4A3DB 5A35A 1KDCA 1GVPA 1U4LA 2OXPA 2R6GA 4KHVA 1WOCA 4HJ5A 4PG3A 4A3GG 1PH7A 1VQMA 3F2BA 4X3KA 3TDQA 5JEAG 2E5LQ 2OTLA 1VQOA 4RHRA 4DPGA 4A3BG 1KAWA 3C2PA 3MXPA 2F4VQ 1I6HH 4U68A 1ENCA 3AB9A 4ZLTF 2N55A 2R3ZA 2HUGA 3DEOA 3HOXG 3HEJA 2O2LD 4LFBQ 1G6PA 4QGUA 1JB3A 4A3MB 4RGTA 3A74A 1K28A 5CGKA 3A55A 1OO9B 4DV1L 3S2HH 3J7ZC 2KCCA 3K8AA 4P2CB 4H0LC 3S2HB 5CBAE 1XNRQ 4FDBA 4N9PA 4JI4L 2DJGC 2LFNA 4DV3L 4JYAL 1B9NA 5C4XG 1RDPD 4HCSA 3K0XA 1VQGA 1EYCA 4DF7A 3G4SA 4M8AA 1S5ED 1BBUA 2EYJA 2L12A 4H7BA 4OIJA 1DD2A 3L2PA 1FNVA 1LO5D 2NZ1D 2Y0SG 4JOIA 1KLUD 3RD4A 1U0LA 3ND9A 5E4XA 5KEEA 4LFCQ 4BA2I 2K75A 1JE5A 3T1HL 5BN4A 1NTGA 2K4KA 3A54A 2L55A 4H02A 2R93H 3CCMA 3PIOA 2QW7A 2EJMA 5EKLA 4GNXB 3FHWA 1KDAA 2F0LA 3GTQB 3GV3A 4PMCA 4K5WA 5L37A 2J4XA 5CYUA 3IAYA 2B63H 1W6KA 1IW7D 3E6ZX 3OW2A 3D8GA 2B63B 5JJZA 4WJ3M 4DR6Q 1TXYA 4JI2Q 3A7LA 5D14A 4WFN3 2M00A 3K5NA 4BBSB 3DLLA 3HG9A 2RBMA 4DGZA 3TZUA 4NKLA 5D65A 1XNQQ 2BH8A 1YNND 1JE4A 3KK7A 4MTKA 2WAQG 1Q82C 1HNXL 1ML0D 2EYOA 4HR7B 2DY7A 2X69A 1QVCA 4C3JG 1VCIA 1MD2D 5BR8Q 3HGBA 4CJ0B 1L0YB 2EZVA 1EQTA 3CD6A 4LF5L 3A0JA 2F0TA 2WB1E 2JN4A 1X3EA 1RHPA 1XTDA 1YITA 4MZ9A 5A2QE 1EY4A 1K83H 1NR2A 2FMCA 4N8FA 1STNA 1K83B 4QUFA 3KJPA 1MI2A 1O7YA 1PRTB 3S17H 4A3GH 1G91A 3EQLC 5I2XA 3L3OC 3J80i 4JK1C 1A2UA 3L9AX 1SYCA 2F0UA 4FP5D 1WTXA 1A6XA 5GROA 4A3BH 4WJ4A 1II3A 3W2DA 1MSHA 1L1OC 1ONLA 2KQ3A 5FLMG 1SEBD 4XTCS 1UAPA 1U4PA 4ZUJA 1C7YA 4N9TA 1GHJA 4BY7G 1VQ5A 1XXGA 1NJIC 4K0KL 1NY4A 3D6CA 4P75A 2HIVA 5JJLA 1QOHA 3OW7A 4ILWA 4B08A 2A6HC 5IWAQ 3NWTA 4CDFC 4F7XA 1JT8A 4CHTB 3W3AA 1K0SA 1VQAA 1XX8A 2SOBA 4IFDH 4DAPA 2E2JB 3H15A 4HAEA 4L8JA 1EEID 4A3FH 2XN9C 2IPKD 3H09A 4JI0Q 2KHIA 2B2WC 1XMOQ 1CUKA 5EKIA 1D1IA 1KNAA 3CCEA 2A6EC 2JA7G 3D6WA 3PO2G 1GUGA 3OSOA 3J81j 4JC0A 4IOCA 2RDHA 5C44H 3K7UC 2EOTA 5FO7B 3BVZA 4X64L 3M4OB 1XPOA 1VQ7A 5C0XH 4Z9CB 4K2LA 3J81c 3NBHB 1S72A 2VQFQ 5KNBA 4DN4M 2EJFC 3FEWX 5KNCA 3ERQA 3KDFA 4A93H 3PO3H 3RNUA 2BDNA 3QG1A 2A6HD 2VQEQ 3PO3B 2E2HB 3IFTA 2GVBA 4GOPB 2FFKB 1GUTA 3NE5B 1KD1C 1EOTA 4MTNA 1HNZQ 3UDGA 1AE3A 3A8JE 2K33A 1AN8A 3CRKC 1LTGD 1PFNA 2A6ED 1B3QA 5IWAL 1IBMQ 4B9XA 4DAYA 3ERSX 1EU4A 1KNEA 1EFWA 4X3UA 4BXXG 4G57A 5LL6X 5BN3A 1PTOF 1HXYD 4C3JH 3GD7A 2NBFA 2B3GA 5I2YA 4B3MQ 4JI0L 1PMRA 2AHOB 3BVGA 4JVZA 4R8IA 4ABNA 3JC66 3KF6A 1EY6A 2L11A 5C3WA 2HT1A 2KVMA 1SSOA 1SMYC 3R8BA 1TR5A 4IALA 3HOZH 4BS9A 4G7HC 1KDBA 4NDXA 1CKOA 3HOYG 2UXCL 1OXUA 1O7ZA 2XWJB 3HOVH 4X3TA 3T53B 3E9IA 2PW7A 4RAUC 3STBD 3SXHA 2VW9A 2XGTA 1HCZA 3MXUA 3I4MB 1JOQA 1AZQA 1SNPA 4LF8L 2OWOA 1KRSA 1STBA 4LJZC 2SEBD 3HFZB 1RTNA 1VMCA 1WTQA 5ELFA 1Y8NB 2QA4A 2MGSA 2GVAA 3QOJA 4ZKBB 2UXBQ 4K8IA 1EIGA 3PUVA 1N36L 3FKIG 1IL8A 1TY0A 1QJOA 1SMYD 1GKHA 2A73B 2F3WA 2R92H 3K7AH 4LFAQ 1L1OA 4JBMA 4KTAA 1YVCA 2R92B 4RGOS 1CQFA 1VQHA 2PO4A 1Y1WG 4YWKA 3HKZB 1I4GA 1CTMA 3G6JB 1Q8KA 2JA7H 3K58A 3X3NA 3PO2H 2IHEA 2K5HA 3J80E 5JPMC 4FF4A 3U58A 1WTOA 1EY9A 4CDCC 4ME5A 1MBYA 4DKAC 1I94Q 1A63A 1HUNA 4KKUA 1H9MA 5DM63 2IL8A 3SGIA 4JI7L 4DV0Q 2N78A 1NR4A 1VQPA 4TKOB 1D5ZC 2CFMA 3A7AB 4XQJA 1BBXC 4B3RQ 2B2WA 4PMWA 3S2DB 4A4IA 5JVG3 3ONAB 2RHSB 3E0JA 4Q0FA 4LF6Q 5EPLA 1I4XA 2DN8A 2F0GA 4A3LH 1ZEQX 3LNNA 1I4RA 2JA6B 3I2ZA 1ENAA 2CHBD 2G5DA 1JOKA 1YZ6A 2LY7A 2JQOA 1D6EC 2UXBL 2EYHA 2PQAA 5FKAC 1B8AA 1C4QA 4OO1I 1KHIA 4UDUC 1EWIA 1PH8A 2F0KA 3SK8A 4A3KH 3NBIA 2UXDQ 2H5XA 4R9WA 1LTAD 2F0HA 1Z47A 2MUYA 3R3OA 1TWAH 4FYDA 4A3EB 4HJ7A 4OHJA 4JI3Q 1RF2D 4LK1C 3JAMc 2I07B 3C3LA 2BA0A 3J7A5 4KV6A 2VS1A 1EZ8A 1PRTF 1HR0L 4Y7NB 1SYBA 3H3VH 3F8TA 4A75A 4A3JH 3C46A 1EUJA 5M5WB 3EFXD 3RN2A 2X6GA 3K80C 4XT3B 1YEZA 1TIID 3TBIB 3ULLA 4C2MB 2F52A 1OXVA 2XTIA 4RHSA 1G8ZD 1U5KA 4RG1A 3DMUA 3I4NH 2WB1B 5IP7G 5AJ3Q 3I4NB 1ILPA 3LX0A 2AUJD 3I3CA 1J5EQ 1SYGA 3RLOA 3D4DA 4JV5Q 1PHJA 4GKKL 1V1OA 4A3MG 2B8GA 1YNJC 3A5ZB 4FXKC 4Q5VA 3CCUA 2RVLA 4GLVB 2JEAI 4FNFA 5IT9L 2EYFA 2D2CC 2N88A 1R9TH 1WTHA 2J7ZA 2KCTA 4IQZA 1UEBA 4DK3C 2RA4A 1TWHH 1R9TB 1DZ1A 2AKWB 2PCFB 3PSIA 2VB3X 4PMBA 3OTOQ 1SE2A 1TWHB 3TP8A 2BH2A 3SHLA 1Q7YC 2K04A 3H0GH 4DR1L 4BBRH 4LUVA 5KIXA 4OX9L 1RODA 1PYSB 2UXDL 3H0GB 5J39A 2F3VA 2PW5A 1E3PA 4NXNQ 5FLXL 5JJKA 4G7ZC 3GTJB 2TSSA 3S15H 2NN6G 4XDXA 4AYBE 3GTKB 1VQ9A 1EY5A 2HQLA 1EYDA 3S1MH 4DR4L 3OHXC 5DNFA 4O1NA 4R4IA 4HIKA 1AP0A 2YU9H 1Y8PB 2RQXA 3S1MB 1PFMA 3SE0A 1KC8C 2Q2TA 1H9KA 2NVQB 3Q6SA 2CWAA 4X65Q 1QUQB 1GUSA 3SVMA 1WJJA 2JA9A 1ZYRC 2Y0SE 3F1ZA 3H91A 3TP6A 1I4HA 3V96A 4DR7L 4JI1Q 4LF7Q 1QVFA 1Q3LA 1ILQA 1N34L 1B3AA 1E1OA 1F9QA 3TS0A 5IGBA 4IUTA 3PUXA 2B63G 1K8GA 4CJ2C 4FF2A 1FGBD 2VXWA 1N32Q 2EYLA 1D8LA 1L0WA 4ZQ3A 4L5RC 5CV9A 1HZ9A 3NQTA 5C3EH 2M2LA 4R4QA 3GTPB 1KXLA 3CW2C 3RLFA 3KFUA 5C3EB 1PH6A 1SXTA 1I4QA 2F0QA 3BZDB 3EA6A 1PZKD 1I6VC 4DU9A 1SBBB 4APVA 1N33Q 1LTSD 1WTWA 2RDGA 1H9SB 1HA5A 1STAA 4BA1I 1PTOH 3TEHB 2MJ8A 4CKBA 2I46A 4WORA 2L0CA 4A3DH 4IURA 2O5IC 3X3MA 3M4PA 1HRJA 4QF4A 4I7ZC 2ZT9C 4EX5A 1F2LA 3TSSA 3S24A 2JP1A 3VDYA 1HR0W 1BOSA 3G71A 3L7ZC 1S5CD 3D0FA 1EIHA 4DAVA 2IX1A 2KOLA 2NZOA 2MHVA 2E75C 5C4HA 3T4AC 4KHPL 5IP7H 3E3XA 2A19A 1G2SA 5CC4A 2UUCL 2B2UA 2DJFC 1CKNB 2AQ2B 5GQOA 1B44D 2NTSA 5GAEC 1MHWC 1G6ZA 3T13A 4LUOA 3M7NA 2A69C 1JJGA 1LLRD 4ZRZA 3VR5A 5GAGC 4A3MH 3CMAA 4X62L 1FVIA 1EEFD 3CC7A 3UDFA 4KJOA 2CQOA 1HZCA 2LS01 1RD9D 1RTOA 5M5YH 1FJGL 1SYFA 4CKCA 1NMFA 2M9VA 5IGEA 4R8NA 5M5YB 2B2TC 5I6WA 5EJWA 3NEMA 1YHQA 2OTJA 4YIJA 4JI8Q 2F0NA 1D5MC 1IW7C 2YTYA 2FJ2A 2IX0A 1E24A 1PTOC 1XYIA 1Y1VB 2K01A 2BOSA 4IFDG 2B2YA 4A3FG 4P72A 1F77A 1NNXA 2K7VA 2NN6H 2K03A 2AWNA 1FR3A 1YNNC 3AYHB 1QG7A 3CF5A 1VS0A 5GADC 3QOLA 5C44G 2HIXA 3CC2A 4MNOA 4DR3Q 3A5UA 2RHQB 1XPRA 2A69D 5C0XG 1O7IA 3NELA 3RN5A 3GTMB 1QE6A 4RKBA 5EBCA 1IL2A 2X6LA 5LMUQ 2E5LL 4K5VA 4HSPA 2ZM6Q 4KN4C 1ESRA 3MXNB 3GTQH 1LYLA 3MTSA 5IGCA 1QB5D 4A93G 1C48A 1J6QA 2EVBA 3PO3G 2E2IB 4KI0A 3I72A 1TT2A 2F4VL 4LF4Q 1I50B 1VQ4A 2MO1A 2HD3A 3G7LA 2OQ0A 3TP5A 1EFID 3HOUH 1PTOD 4LFBL 4BBSH 4IJHA 1S5BD 3FPPA 4DK1A 3HOUB 4BWGB 2K28A 3ZYYX 1DCZA 1HFGA 3H94A 2EPBA 1XNRL 2ZTEA 3KBGA 2CH4A 5M3FB 3PIP3 5DEHA 2FMMA 4AQYQ 3CHBD 2R61A 3P75A 4B9WA 1EYAA 3HP3A 2BE5C 3I90A 1QNUA 1VF5C 3CPWA 5J1ZA 3EVQA 5AFWA 2JA8B 5HY6A 4R4OA 3HOZG 3NXWA 1UUPA 3J7AV 5M3MB 1U4MA 1GUNA 3H6MA 5KYLA 5T1IA 2ASBA 4LFCL 3EN2A 3NPPA 1WFQA 4GS3A 4OXPA 5EQ0A 3V2TA 3K5MA 1CK1A 4GNXC 3NHHA 1LM0A 1JCKB 1A8VA 1B4OA 2ICEC 3OIPA 3HOVG 1AFPA 1BBWA 1STYA 2ZXPA 2N8NA 3A56A 1TU2B 4NP5A 2AWOA 3M4YA 4EQ5A 4C56C 3KLRA 1JWSD 2RCNA 2Z9HA 4QJFA 1QZGA 3R2IA 3TMEA 3MAQA 3MZ5A 3I91A 1PXUA 1XTCD 2UU9Q 2ZJPA 4HCEA 4CDDC 2L1BA 4DR6L 5IGDA 4JI2L 1ET9A 2WP8J 3DUZA 1PVOA 2BE5D 3P7JA 3OMCA 3ER0A 4EGVA 1XNQL 4JW0A 3FPUB 1NSNS 1TQOA 4UPAA 1VQLA 1GOZA 4UAIA 1VQ6A 2R92G 1X3PA 2E2JH 2HHHQ 4DR2Q 3TQYA 3L0OA 4DV6Q 1BXTA 3AQQA 4PZ6A 3ULPA 5TSSA 3HKZG 3HOXB 3CCVA 2ENBA 3QR8A 4DUZQ 3B6YA 1TKWB 5BR8L 1TVXA 1FGUA 2QDBA 2F0OA 3CPFA 4QUCA 1GJXA 4QCLA 1PRTC 1X32A 1W6JA 4X66Q 2B2TA 3M4OH 2QCPX 2E2DC 1YJNA 1E2ZA 2MFIA 4L5QA 5IGFA 1XMQQ 4AYBB 1KRTA 1V1PA 3K59A 5DM73 2EY5A 2Z6BA 5C4XB 4OWTB 1OXTA 5I9OA 1N8RC 3N52A 2ALYB 2JJQA 3OYYA 3E0EA 4DA2A 4DUYQ 1I3QB 2E2HH 2NVXB 2C5CA 2KA7A 1HJPA 1D5XC 4A3LG 2Y0SB 1HA6A 2JA6G 4JI6Q 5IYDG 5C4ZA 5LL6S 1UNSA 3BDLA 3I7FA 4JBKA 1F9PA 3STBC 4K5XA 2J0TD 1KLGD 4GN4B 1CT1D 3J80c 4BY1H 2WACA 2VNUD 1A62A 5E1FA 1IXRA 1PRTD 4OO1G 1G2TA 4ZAIA 4BY1B 3PF4A 1B9MA 4A3KG 1X65A 1WD0A 1JC7A 2UUAQ 1VMPA 3I70A 4FVMA 1HNWQ 2HHHL 5LMNQ 3TS2A 1E1TA 1BCPB 1V43A 4EQPA 1TWGB 1LTID 2B8FA 3VYTA 4LAAA 4U673 2L4NA 1WTVA 1AZPA 4OEMB 1XMOL 3S1NB 1B7YB 3BZCA 4DV7Q 1RCVD 4KD4A 3MFYA 4A3JG 5DAUA 4GN5A 4K6LA 1WI5A 4TVAB 3UDXA 3KF8B 2KHJA 3R93A 1CHPD 3KLSX 4HEDA 1JQYD 3I4NG 3Q23A 1I4PA 3DHQA 1PH9A 1K8MA 2ICIA 3I73A 4HTHA 2VQFL 1GO3E 4QY7A 4H44C 1QCBD 4G4KA 4GOPC 4C3HH 3I4MH 1VQBA 1VQCA 1HQMC 5F2DA 4C3HB 1H95A 1AEXA 3E9HA 3BZKA 1P8LA 1IYJB 2D9UA 2LKVA 3HZXA 3T56B 2VQEL 1TS3A 1LUZA 2IT1A 4IN3A 1LT6D 3CP0A 1F2MA 1Z7TA 1E0BA 5IY0A 1X56A 4GNXA 2A68C 1QWYA 1M90C 2UUBQ 1HNZL 1T5EA 4NB3A 2NYZD 1JWUD 1PYWD 4KKSA 1EY7A 1YHAA 3H0GG 1IBML 3GTGB 4BBRG 3SK5A 1AE2A 1JWMD 2AQ3B 1HNWL 1FNWA 3OMGA 2ZJRA 1NMGA 4HJ9A 1IZ6A 3TN2A 1ICFB 2KHSA 2L15A 5CBEE 4B3ML 2XSCA 3M9BA 1PH1A 4BY7B 1A3TA 2CH4W 3PUWA 5D3DA 4J8QA 1EWCA 4OWXB 4B3SQ 1LTRD 1SE4A 4FO2A 3GTLB 1ASZA 2CCZA 1E2WA 4RFBA 3RZOB 5KGUA 4H13C 5G3LD 4A3CH 1AH9A 1E22A 4KKTA 2K6AA 4KN7C 4CDEC 2N49A 3S2DH 3J81L 2F03A 2A68D 3K57A 2KJXA 4DV4Q 1EU3A 4YWMA 2ZXRA 1CZWA 4HJAA 4JI5Q 3A8IE 2R7FA 2F0VA 5IIFA 4YWLA 5CV6A 2JA6H 1IBKQ 2YTXA 5CV5A 1H9RA 2RCFA 5IOCA 3ICEA 2VUMH 3NENA 5IYDH 4DNRB 1OTCA 2DGYA 1VQ8A 2VUMB 2GN5A 1D2BA 1GUOA 1WCMB 5C3EG 4EQNA 1YJ9A 1T5XD 2KECA 3PIO3 2K5DA 1RKNA 2Q8IB 1F2ZA 3WOEA 3T1YQ 4OO1H 2NUCA 5ELDA 1TS4A 1SFOH 4LFAL 4JCVE 4X6AH 4A3EH 2FINB 1SFOB 2F0DA 1VQKA 4DR5Q 2XIWA 1X54A 4YCUA 4A3DG 3LWUA 3UE1A 1Q1EA 4QQBX 4ALPA 1SJHD 4Y7NH 2DY8A 3NP8A 1R4PB 2RSOA 4IPHA 2ES2A 4DXGA 3D4WA 5M5WH 5M5XB 3OIQA 3RLNA 3AFPA 2K32A 4C2MH 1QZHA 1I94L 4KMUC 4HIMA 5IT9E 1HZAA 4PNYA 4DV0L 3PF5A 1K8OA 2QEJC 3GQBA 2PMZE 4B3RL 1PYBA 4MHEA 2OQKA 1LTTD 2FHTA 4LF9Q 1SROA 2ID0A 5NUCA 2F0FA 2IWHA 2MO0A 4LF6L 4GN3B 2EQSA 4YY3Q 3GO5A 2PZUA 2RDFA 2NVTH 4GKJQ 2NVTB 4LW1A 5FLXE 4XYOA 3HOYB 3IL8A 1TWFB 5GAHC 4TRDA 2KCMA 4F88A 5EGTA 2E8GA 2KBNA 3AU7A 3C1EA 3U9SA 2N3SA 2PI2A 4NPSA 3G6EA 3K5OA 5CV8A 1Y1VG 5K36H 2JYOA 3IKJA 1VQEA 2B29A 3D4RA 3GTJH 5M9OA 3BYYB 1KAAA 1BO0A 3GTKH 3NTIA 2O5JC 2L5TA 1K3BC 4CKEA 4JI3L 2G9DA 2OF1A 3H3VC 1EQVA 4JOIC 4TSSA 3WOFA 2OT2A 4HJ8A 1S40A 4YHHQ 2NVQH 1B70B 1CZGA 2KUMA 3TREA 3K5LA 2K5VA 4IPGA 5E7NA 2Z6KC 1NUCA 2XRSD 1BQQT 1DYQA 3M3YH 2JA5B 1QNKA 3MC0B 4XQQA 3AFQA 1UE1A 3M3YB 5KRUA 1WVLA 1RL2A 1T9HA 4QMGA 4C1NK 5AJ3L 1CA6A 5CR3A 1Q1BA 2EYMA 3QWNA 3HOWH 3S1QB 5FK9C 4IZ8A 1L0XB 1MJCA 2EXDA 1J5EL 2K05A 3HOWB 1K73C 2NVYH 3BDCA 2JEBI 4JV5L 4QB4A 2NVYB 5JOBA 4K14A 5ISRA 5I9PA 5G3LF 3HOUG 4RCNA 4ZYSA 3NK9A 1U9RA 4BBSG 1ASYA 1SN8A 2P5ZX 2OCEA 3GTPH 1HUMA 1ESFA 2EYPA 4O0AA 4OIKA 1HPCA 1Z9FA 2DNCA 2HQEA 3S14B 4DV5Q 5ELCA 4RKLA 3OTOL 1BCPF 1BF4A 2I5HA 2YYZA 3RZDB 1DGSA 2OEOA 2EY6A 4O2DA 3NTKA 1SMXA 2LXKA 3DXJC 4KJNA 4L6TB 1EIFA 4S3SA 4NXNL 4DV1Q 2A8VA 2WAQE 1MSGA 2JA8G 5M3MG 4UP9A 1BNZA 4PZ8A 1NBWA 4POGA 4JI4Q 1Q8IA 2DUDA 3EJIA 2F0SA 1SE8A 2VB2X 3JAML 1HH2P 2WKCA 5D3IB 3I4OA 2C9OA 3QJYA 4DV3Q 1GD7A 4JYAQ 3W1BA 4X65L 1H9JA 2JE6I 4K6DA 4L5SA 1TWCB 2H1EA 1LT3D 3VYSA 4JI1L 4LF7L 3K0YA 5IYCH 1SNOA 1FNUA 1IYUA 1NCVA 3U4ZA 5CMDA 5HGQA 2O4XA 3BDOA 3P1HA 3QIAA 1KL9A 1YI2A 3IFDA 3UDIA 2R7ZB 3PCOB 1MKHA 3TZDA 3KDFB 3DEPA 3T1HQ 3NUCA 1STGA 1Q12A 3M4QA 4GLAC 3D3RA 2E74C 3VYRA 1V9PA 3ULJA 3Q0AA 4NXMQ 3U4VA 5EPJA 4B3TQ 1YNXA 1UE6A 2B39A 1SNQA 1N32L 4FF3A 4OONA 5CV7A 2HDLA 4V190 1W3SA 3EBEA 1WYDA 2PPBC 4IJLA 3S1RH 1CKMA 3CCJA 2VY3A 1DOLA 4DV5L 2D0OA 5E4WC 3S1RB 3SK4A 1Y1VH 1J8IA 3PGZA 4Y52H 4LWCA 1I6HB 2HCIA 1VQDA 4DXFA 1N33L 2VZAA 4DAYB 4UY8C 4I65A 2EJGC 2IHFA 3C1FA 4A3IH 1B53A 4GLXA 1A3UA 4A3IB 2XVSA 1O78A 3HKZE 3VYUA 1X6OA 3HRZC 4RGMA 3KF6B 1MJEA 5T1GA 1HNXQ 3GTMH 5KNDA 4OL7A 3UE0A 4I7AA 4AYBG 1VQJA 4AH6A 1BUVT 1PZJD 5COYA 1ET6A 1EZ6A 3DM1A 1VF7A 3TRZA 2Q2UA 1SLJA 2NN6I 4NW2A 1F9RA 4LF5Q 2Z1CA 2E2IH 4C3IH 4IO9A 1G291 4GZYC 2NWGA 4HN7A 1I50H 3PV0A 4C3IB 3DWAA 3NSWA 2QILA 1Y8OB 2F3IA 1JJ2A 4IOAA 1JOOA 1N9WA 3CCQA 4MN3A 4M1UB 2K5NA 3CXCA 1IBLQ 3PUYA 5FJ8G 1B50A 2Z6KA 5JEAJ 1V1QA 1K0RA 5J22A 1Q81C 2WINB 4LNQA 1YHBA 4NXML 4B3TL 4HMJA 5IP9H 1PFBA 1DJRD 2Q2HA 2EIFA 2R93B 3OWFA 4BY1G 2QF7A 4WRDA 1VQIA 3SEBA 2QKIC 2CQAA 4JI8L 5M3FH 2FXQA 3T51B 1A2TA 2Q2IA 2AQ1B 1M4VA 2SDFA 4IUUA 3CCRA 1CHQD 1L1OB 1CFMA 4K0KQ 2DNEA 4R1JA 4QL5A 1SAPA 1QILA 2JA8H 3HS0C 3Q22A 1KABA 1Z6HA 5M3MH 3EIVA 2C35B 5FOBB 4IUQA 1C0AA 5H1SE 3U50C 3J81i 3FMCA 1JJCB 4DR3L 4IFDJ 3E5SA 3O13A 2KENA 2F4IA 2PZTA 3MWYW 1KIXA 4HSVA 4UP7A 4QIWE 5LMUL 3PUZA 1E7ZA 2ZM6L 3BJUA 3S16H 5IGGA 4C3HG 3I4MG 1Q46A 5DLQE 3S16B 2Z8LA 4ULLA 3MA2B 3KUPA 3AMUA 1QUQA 1MIUA 1EWHA 5C0XJ 4LF4L 4X64Q 1S5FD 1HFNA 1IBLL 2PNRC 1FL0A 2K5QA 2H4OA 4L5TA 2CW0C 1GHKA 5JEAH 2PMZB 2SNMA 3S17B 4A3GB 1PH5A 1S4ZA 2F1MA 1UE7A 1W2BA 1HHVA 3PMFA 5C5LA 5A2QL 2I0QA 3CCLA 2PQAB 4A3BB 2CKZB 2Q8RE 3EROA 3Q8DA 1SNMA 1PDQA 3HOXH 1SYDA 2NB0A 1EQRA 1P16A 1UWVA 4JBWA 4AQYL 1DOMA 2ZJQA 1TS2A 2ATWA 4OELB 4DAMA 3K6OA 3CQZH 4KHZA 1BDOA 2V1CC 3GDEA 3CQZB 2QDLA 1K9MC 1H9SA 4IFDI 4KY5A 2MP1A 4A3CG 5I4DA 5C4XH 2ZXOA 1RIPA 3HKSA 4KD3A 3CKIB 2CW0D 4A3FB 3VA5A 3AEVA 1I3QH 2NVXH 1F2YA 3MVVA 4POFA 1STEA 3PQIA 5C0XI 1DXMA 1SR3A 2WKDA 3LWEA 5C44B 2UXCQ 5K5PA 5FJ8H 2UU9L 3LGJA 1HTPA 5C3XA 1EL0A 4EQOA 2VUMG 1Y14B 1WCMG 3KYHC 4RA8A 3U9OA 1SYEA 1UEAB 1LABA 1EY0A 1CKNA 3W5OA 1GXDC 3N6RA 1WTPA 1PH2A 2YV5A 1TS5A 3RUZA 5FO9B 1VQFA 4A93B 4LF8Q 1RJTA 1BR9A 4RWSC 2IY5B 2K14A 1HZBA 4R4CA 1HTLD 1TWGH 4DR2L 3TP7A 4DV6L 4A3EG 1AW7A 1SJED 4ZCKA 2F0IA 4YCWA 2IJ0A 1EOVA 2AMCB 2K52A 4X3SA 4DUZL 3S1NH 1U4RA 3QB3A 2PZWA 4IUNA 1A3VA 1N36Q 5LHY1 1LT4D 1PH3A 4E6IA 1EQQA 2EE1A 1SDFA 3ITPA 2MPMA 2MNAA 4UHVA 4X66L 2V4DA 1JMCA 3GTOH 5KYIA 3FDTA 2WB1G 2G9HD 2JXMB 1XMQL 2WAQB 3GTOB 2PYKA 3RMHA 2KEEA 4OWWB 3M7GA 4C3JB 1K3RA 1LACA 5ELOA 3F2CA 4P74A 1M8AA 1IHZA 4J1MA 4DUYL 3I4LA 4P73A 3SR1A 2KCNA 2K50A 3VR3A 2D0PA 3HOZB 1IYVA 1E2VA 2MQHA 1LTBD 3CAMA 4JI6L 5HGTA 3MEHA 1F9SA 4FXGC 4JI7Q 3MXNA 1TY2A 5CORA 1YBYA 4KY7A 3J7YW 1DONA 1XPUA 3HOVB 2Z0SA 1PH4A 1D1KA 2EY1A 4CBVA 1S3OA 5ELNA 1BCPC 1WTRA 3MEFA 4N8X1 3GTGH 5K36G 2K1BA 2F0EA 1YJWA 3UI2A 5FLMH 1SNCA 1LTLA 5IT9c 1X3GA 4DV2Q 2UUAL 5JJIA 4F8MA 5LMNL 1FD7D 4DK6C 4RCOA 3MFGA 3JAMi 3VA7A 1CM9A 4HIOA 4BY7H 4PZ7A 3W1GA 3J81E 2A1AA 2XWBB 3GTLH 4R4TA 5EBDA 3RZOH 2JA5G 4DV7L 3FP9A 2EXZA 5FLXc 5C4JH 1JB7A 5J3BA 2LMCB 3K7AB 1CA5A 2E76C 5C4JB 3MXGA 3I56A 1QVGA 5ELEA 1BKBA 1XJVA 1Q90A 1X55A 2BDOA 1FYCA 2RF4A 3CC4A 3HOWG 4ODGA 2HCCA
chains in the Genus database with same CATH topology
3RN5A 4IOCA 5C44H 5AJ3L 3K7UC 1IL2A 4X64L 1HR0Q 1Q1BA 5LMUQ 1XPOA 3HOWH 1VQ7A 2E5LL 2ZM6Q 1MJCA 2EXDA 1J5EL 3J81c 3MXNB 3NBHB 1K73C 3GTQH 1LYLA 2NVYH 2JEBI 1S72A 4A93G 2VQFQ 4JV5L 3I55A 1J6QA 3PO3G 4KI0A 1WCMH 2F4VL 4LF4Q 3HOUG 1VQ4A 3KDFA 4A93H 2MO1A 3PO3H 3RNUA 1Q86C 2OQ0A 2UUBL 1ASYA 1SN8A 4BBSG 4ME3A 4P71A 1L2FA 2OCEA 3CMEA 2VQEQ 3GTPH 3HOUH 3PIPA 4LFBL 4BBSH 4IJHA 4O0AA 1Z9FA 2GVBA 4GOPB 2I5MX 1A0IA 1OXSC 4GKKQ 1KD1C 4DV5Q 4TQUS 3OTOL 4MTNA 4DV2L 3M85A 2I5HA 2YYZA 2NZHA 1HNZQ 1DGSA 3UDGA 1AE3A 1XNRL 2ZTEA 4O2DA 1SMXA 2LXKA 2D62A 1YIJA 4AIMA 1UE5A 2ZTCA 1EIFA 4NXNL 3KLWA 4JG2A 5IWAL 1IBMQ 4DV1Q 5M5XH 2WAQE 2A8VA 2JA8G 4AQYQ 3ERSX 4B3SL 5M3MG 1EFWA 4UP9A 4BXXG 4PZ8A 4DR1Q 1NBWA 4POGA 4C3JH 4OX9Q 3GD7A 4JI4Q 2DUDA 3CPWA 3CCSA 2B3GA 1SE8A 4B3MQ 4BXXH 1HH2P 4JI0L 2AHOB 3I4OA 5HY6A 4R4OA 3HOZG 4DV3Q 4JYAQ 1GD7A 5IYBG 3JC66 3W1BA 4X65L 3KF6A 2JE6I 4RMFA 3RR5A 4L5SA 2HT1A 5IYCG 2ASBA 2PNHA 4LFCL 3EN2A 4GS3A 1WFQA 4OXPA 2LSSA 2R7ZG 3HOZH 4GNXC 4DR4Q 4JI1L 4DV4L 1LM0A 4LF7L 1A8VA 4IPCA 3H3VI 5IYCH 3HOVG 1VQNA 4JI5L 1BBWA 1CKOA 3HOYG 2UXCL 3U4ZA 2N8NA 1OXUA 5HGQA 3K81C 3BU2A 1KL9A 1YI2A 2AWOA 3UDIA 4EQ5A 3HOVH 2BA1A 3PCOB 1MKHA 1BVSA 1CSQA 1IBKL 3KDFB 3HOYH 2RCNA 1TWFH 3T1HQ 4QJFA 4DR7Q 3E9IA 2ZTDA 1QZGA 1X3FA 3STBD 1Q12A 3M4QA 4GLAC 1GM5A 4NXMQ 1V9PA 3ULJA 3U4VA 2VW9A 4B3TQ 1N34Q 2XGTA 1YNXA 2ZJPA 2UU9Q 1UE6A 3KJOA 1N32L 1M1KC 4LF8L 4DNIA 4OONA 3F2DA 2OWOA 1KRSA 3KOJA 4YCVA 1W3SA 3EBEA 1WYDA 3HFZB 4GOPA 4DR6L 4JI2L 4IJLA 3S1RH 1CKMA 2WP8J 3CCJA 3T1YL 2VY3A 4DV5L 2D0OA 2QA4A 1PVOA 2GVAA 2UXBQ 1Y1VH 3PUVA 3PGZA 4Y52H 4LWCA 3ER0A 1XNQL 1N36L 5LMNW 3FKIG 4UPAA 1VQLA 4DR5L 1VQDA 4A3IG 3D31A 1N33L 1VQ6A 2VZAA 2LXJA 2VL6A 4DAYB 4UY8C 2R92G 2E2JH 4IPDA 2HHHQ 2I5LX 4DR2Q 3TQYA 3L0OA 2IHFA 4DV6Q 3FKIH 3AQQA 4PZ6A 3ULPA 4A3IH 1GKHA 4GLXA 2R92H 3K7AH 4LFAQ 1L1OA 3HKZG 4JBMA 3CCVA 4DUZQ 2JA5H 4A76A 3B6YA 1YVCA 5BR8L 1FGUA 5IE8A 3HKZE 1VQHA 1X6OA 3CPFA 3KF6B 2QEXA 1MJEA 1HNXQ 1Y1WG 3GTMH 4YWKA 3UE0A 4AYBG 1VQJA 4AH6A 2YTVA 4X66Q 3M4OH 1C9OA 1Q8KA 3S1QH 2JA7H 1YJNA 1Y1WH 2MFIA 1CSPA 3PO2H 4L5QA 2IHEA 1SLJA 2NN6I 2Q2UA 1XMQQ 2K5HA 3TRZA 4LF5Q 3U58A 1KRTA 2E2IH 1A63A 4C3IH 1I94Q 4DKAC 1EYGA 4IO9A 4LF9L 1G291 4OWTB 1OXTA 1N8RC 2JK8A 1I50H 2ALYB 3PV0A 2WFWA 2JJQA 3OYYA 3SGIA 4YY3L 3E0EA 4JI7L 4IOAA 2F3IA 4DV0Q 2N78A 1JJ2A 1N9WA 3CCQA 1VQPA 2K5NA 3CXCA 2CFMA 2PI2E 3G48A 4DUYQ 4GKJL 4XIGS 1IBLQ 2E2HH 3PUYA 5IP9G 5FJ8G 1KQSA 4B3RQ 4KHPQ 2R93G 2Z6KA 4PMWA 5JEAJ 1V1QA 1HJPA 1K0RA 4LUZA 1Q81C 4A4IA 4LNQA 1I5FA 4A3LG 1YHBA 4NXML 2RHSB 2JA6G 2UUCQ 4B3TL 4JI6Q 3ZJYC 5IP9H 4LF6Q 5IYDG 1PV4A 5M3FG 4A3LH 2Q2HA 3RZDH 2EIFA 4BY1G 3I7FA 1VQIA 4JBJA 4JBKA 3STBC 1EIYB 3I2ZA 5M3FH 4JI8L 4X62Q 2FXQA 4GN4B 3J80c 1YZ6A 2JQOA 4BY1H 2UXBL 2VNUD 1A62A 1PFSA 2PQAA 1IXRA 2Q2IA 4OO1G 3PF4A 1B8AA 4A3KG 1FJGQ 1X65A 5EAYA 3CCRA 2UUAQ 4OO1I 1L1OB 1KHIA 1HNWQ 2HHHL 5LMNQ 3TS2A 1EWIA 1E1TA 4K0KQ 4R1JA 4QL5A 1PH8A 1V43A 4A3KH 2JA8H 1D7QA 3IRBA 4YHHL 2UXDQ 5M3MH 3EIVA 3WWVA 2C35B 2H5XA 3DM3A 1K8AC 1Z47A 1TWCH 1XMOL 1C0AA 2R7DA 4KLKA 1PA6A 1TWAH 5H1SE 2QGQA 1B7YB 1OXXK 3U50C 3J81i 4HJ7A 1JJCB 3BZCA 4DR3L 4JI3Q 4IFDJ 1X9NA 4DV7Q 4J15A 2KENA 3JAMc 5IYBH 4A3JG 1KIXA 1NE3A 4GN5A 1WI5A 2BA0A 4TVAB 3J7A5 4HIDA 3UDXA 2VS1A 4UP7A 4QIWE 3KF8B 4UP8A 2KHJA 1HR0L 5LMUL 1SRUA 3PUZA 3H3VH 1E7ZA 2R7ZH 3F8TA 4A75A 2ZM6L 2CWPA 1G51A 4A3JH 3BJUA 3I4NG 3S16H 1EUJA 3RN2A 1PH9A 3K80C 1GVPA 3I4MG 1YEZA 1Q46A 5DLQE 3ULLA 2VQFL 1GO3E 1OXVA 2F52A 2R6GA 4QY7A 2XTIA 4RG1A 3I4NH 1U5KA 1WOCA 4HJ5A 1QUQA 4PG3A 4A3GG 1MIUA 4GOPC 5IP7G 4C3HH 5AJ3Q 1VQMA 5C0XJ 1PH7A 4X64Q 4LF4L 3F2BA 3I4MH 1VQBA 5JEAG 1VQCA 2E5LQ 1IBLL 1FL0A 1J5EQ 1H95A 3E9HA 3BZKA 1P8LA 1IYJB 4L5TA 3RLOA 2VQEL 2OTLA 1VQOA 1LUZA 2IT1A 4JV5Q 4DPGA 4A3BG 1KAWA 1PH5A 1PHJA 4GKKL 3CP0A 4A3MG 1UE7A 2F4VQ 3A5ZB 5IY0A 1X56A 3CCUA 4GNXA 1W2BA 1I6HH 4GLVB 2JEAI 1M90C 2UUBQ 1HNZL 2I0QA 3CCLA 2PQAB 4NB3A 3HOXG 2CKZB 1R9TH 4LFBQ 1G6PA 2KCTA 3Q8DA 4QGUA 3A74A 1UEBA 4DK3C 1TWHH 3HOXH 1YHAA 3H0GG 2AKWB 4DV1L 1IBML 1EQRA 1P16A 3PSIA 1UWVA 4JBWA 4BBRG 3OTOQ 3J7ZC 1AE2A 4AQYL 3S2HH 2BH2A 1HNWL 3K8AA 2ZJRA 1Q7YC 1NMGA 3H0GH 4DR1L 2ZJQA 4HJ9A 1XNRQ 4BBRH 4LUVA 4FDBA 4OX9L 4JI4L 1PYSB 1IZ6A 2UXDL 2ATWA 2L15A 4DAMA 4B3ML 1E3PA 4NXNQ 3CQZH 3M9BA 1PH1A 4KHZA 4DV3L 4JYAL 2V1CC 5JJKA 5C4XG 3S15H 3PUWA 3GDEA 2NN6G 3K0XA 4OWXB 4B3SQ 4AYBE 1K9MC 1VQGA 1VQ9A 4IFDI 2HQLA 3G4SA 1ASZA 4A3CG 3S1MH 4DR4L 5C4XH 2CCZA 1BBUA 1RIPA 3HKSA 4R4IA 4HIKA 2YU9H 4A3CH 1KC8C 2Q2TA 1E22A 3L2PA 1AH9A 2Y0SG 3AEVA 2CWAA 4X65Q 1I3QH 1QUQB 4JOIA 2NVXH 1WJJA 1U0LA 2JA9A 2N49A 4POFA 2Y0SE 3F1ZA 4LFCQ 3S2DH 4BA2I 2K75A 1JE5A 3T1HL 4DR7L 4JI1Q 4DV4Q 4LF7Q 4YWMA 5C0XI 1QVFA 1NTGA 4HJAA 4JI5Q 1SR3A 2K4KA 2R7FA 1N34L 2UXCQ 2UU9L 5FJ8H 3LGJA 4H02A 4YWLA 2R93H 1E1OA 2VUMG 3CCMA 1Y14B 3PIOA 3TS0A 1WCMG 3KYHC 4GNXB 2JA6H 3PUXA 3FHWA 2YTXA 1IBKQ 1CKNA 2B63G 1K8GA 3ICEA 3W5OA 2VUMH 3NENA 5IYDH 1OTCA 2DGYA 1PH2A 2YV5A 1VQ8A 2GN5A 2B63H 5C3EG 3OW2A 1VQFA 1YJ9A 1N32Q 4LF8Q 2IY5B 2K14A 3S14H 1D8LA 1L0WA 4L5RC 1HZBA 4R4CA 4WJ3M 4DR6Q 1HZ9A 1TXYA 4JI2Q 5C3EH 1TWGH 4R4QA 4DV6L 4DR2L 4A3EG 3T1YQ 3CW2C 1KXLA 3RLFA 3KFUA 3DLLA 4YCWA 1EOVA 1SFOH 2AMCB 4JCVE 1PH6A 4LFAL 2K52A 4X6AH 4DUZL 4A3EH 3S1NH 1XNQQ 1N36Q 1VQKA 2BH8A 4APVA 4DR5Q 1N33Q 1X54A 2WAQG 1Q82C 4YCUA 1PH3A 1HNXL 4A3DG 1EQQA 3UE1A 4BA1I 1Q1EA 3TEHB 4QQBX 2MNAA 4ALPA 4X66L 4Y7NH 1QVCA 4IPHA 1JMCA 1VCIA 3GTOH 3NELA 2ES2A 4A3DH 5BR8Q 5M5WH 2WB1G 1XMQL 3RLNA 3CD6A 3AFPA 3M4PA 4LF5L 3A0JA 4EX5A 4C2MH 1QZHA 2WB1E 1I94L 4OWWB 1X3EA 3S24A 3VDYA 1XTDA 1YITA 4MZ9A 1HR0W 1K83H 1K3RA 3G71A 4HIMA 3L7ZC 5ELOA 3D0FA 1HZAA 2IX1A 3F2CA 4P74A 4DV0L 3PF5A 2NZOA 3KJPA 4DUYL 2PMZE 4B3RL 4P73A 3S17H 4A3GH 1PYBA 2K50A 5IP7H 2OQKA 4KHPL 2D0PA 2A19A 3J80i 4LF9Q 2MQHA 1SROA 2ID0A 3CAMA 2UUCL 4JI6L 2MO0A 4LF6L 1CKNB 4GN3B 2EQSA 5GQOA 4JI7Q 4YY3Q 3GO5A 5GAEC 1YBYA 2NVTH 4LUOA 3M7NA 1JJGA 5GROA 4A3BH 4WJ4A 4GKJQ 1XPUA 2Z0SA 1PH4A 4LW1A 5GAGC 4A3MH 1L1OC 3CMAA 4X62L 1FVIA 1S3OA 5FLMG 5ELNA 5GAHC 3CC7A 4XTCS 3UDFA 2KCMA 3MEFA 3GTGH 2CQOA 1HZCA 2E8GA 5K36G 2KBNA 5M5YH 1YJWA 1C7YA 5FLMH 2N3SA 2PI2A 4NPSA 3G6EA 1FJGL 1LTLA 5IT9c 1X3GA 4DV2Q 2UUAL 4BY7G 5JJIA 1NMFA 1VQ5A 1Y1VG 5LMNL 1NJIC 4DK6C 4K0KL 3NEMA 1YHQA 2OTJA 3JAMi 4JI8Q 1VQEA 2B29A 1NY4A 4HIOA 4BY7H 4P75A 2HIVA 2YTYA 4PZ7A 3GTJH 5JJLA 2IX0A 1E24A 3W1GA 5IWAQ 3GTKH 2A1AA 4IFDG 3GTLH 4R4TA 1JT8A 4A3FG 3RZOH 4JI3L 1VQAA 2JA5G 4P72A 4DV7L 3FP9A 4JOIC 4HJ8A 1S40A 3H15A 4YHHQ 5FLXc 5C4JH 4A3FH 2NVQH 1B70B 2AWNA 3TREA 1JB7A 5J3BA 2K5VA 4IPGA 5E7NA 4JI0Q 2KHIA 2Z6KC 3AYHB 1XMOQ 3CF5A 1VS0A 3I56A 1QVGA 1CUKA 3M3YH 5GADC 3CCEA 1BKBA 1XJVA 5C44G 2JA7G 2HIXA 3CC2A 4MNOA 3AFQA 4DR3Q 3A5UA 2RHQB 1X55A 1UE1A 1XPRA 3CC4A 2RF4A 3HOWG 3PO2G 5C0XG 3J81j 1O7IA 4JC0A 1RL2A 1T9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN5 A;  4IOC A;  5C44 H;  5AJ3 L;  3K7U C;  1IL2 A;  4X64 L;  1HR0 Q;  1Q1B A;  5LMU Q;  1XPO A;  3HOW H;  1VQ7 A;  2E5L L;  2ZM6 Q;  1MJC A;  2EXD A;  1J5E L;  3J81 c;  3MXN B;  3NBH B;  1K73 C;  3GTQ H;  1LYL A;  2NVY H;  2JEB I;  1S72 A;  4A93 G;  2VQF Q;  4JV5 L;  3I55 A;  1J6Q A;  3PO3 G;  4KI0 A;  1WCM H;  2F4V L;  4LF4 Q;  3HOU G;  1VQ4 A;  3KDF A;  4A93 H;  2MO1 A;  3PO3 H;  3RNU A;  1Q86 C;  2OQ0 A;  2UUB L;  1ASY A;  1SN8 A;  4BBS G;  4ME3 A;  4P71 A;  1L2F A;  2OCE A;  3CME A;  2VQE Q;  3GTP H;  3HOU H;  3PIP A;  4LFB L;  4BBS H;  4IJH A;  4O0A A;  1Z9F A;  2GVB A;  4GOP B;  2I5M X;  1A0I A;  1OXS C;  4GKK Q;  1KD1 C;  4DV5 Q;  4TQU S;  3OTO L;  4MTN A;  4DV2 L;  3M85 A;  2I5H A;  2YYZ A;  2NZH A;  1HNZ Q;  1DGS A;  3UDG A;  1AE3 A;  1XNR L;  2ZTE A;  4O2D A;  1SMX A;  2LXK A;  2D62 A;  1YIJ A;  4AIM A;  1UE5 A;  2ZTC A;  1EIF A;  4NXN L;  3KLW A;  4JG2 A;  5IWA L;  1IBM Q;  4DV1 Q;  5M5X H;  2WAQ E;  2A8V A;  2JA8 G;  4AQY Q;  3ERS X;  4B3S L;  5M3M G;  1EFW A;  4UP9 A;  4BXX G;  4PZ8 A;  4DR1 Q;  1NBW A;  4POG A;  4C3J H;  4OX9 Q;  3GD7 A;  4JI4 Q;  2DUD A;  3CPW A;  3CCS A;  2B3G A;  1SE8 A;  4B3M Q;  4BXX H;  1HH2 P;  4JI0 L;  2AHO B;  3I4O A;  5HY6 A;  4R4O A;  3HOZ G;  4DV3 Q;  4JYA Q;  1GD7 A;  5IYB G;  3JC6 6;  3W1B A;  4X65 L;  3KF6 A;  2JE6 I;  4RMF A;  3RR5 A;  4L5S A;  2HT1 A;  5IYC G;  2ASB A;  2PNH A;  4LFC L;  3EN2 A;  4GS3 A;  1WFQ A;  4OXP A;  2LSS A;  2R7Z G;  3HOZ H;  4GNX C;  4DR4 Q;  4JI1 L;  4DV4 L;  1LM0 A;  4LF7 L;  1A8V A;  4IPC A;  3H3V I;  5IYC H;  3HOV G;  1VQN A;  4JI5 L;  1BBW A;  1CKO A;  3HOY G;  2UXC L;  3U4Z A;  2N8N A;  1OXU A;  5HGQ A;  3K81 C;  3BU2 A;  1KL9 A;  1YI2 A;  2AWO A;  3UDI A;  4EQ5 A;  3HOV H;  2BA1 A;  3PCO B;  1MKH A;  1BVS A;  1CSQ A;  1IBK L;  3KDF B;  3HOY H;  2RCN A;  1TWF H;  3T1H Q;  4QJF A;  4DR7 Q;  3E9I A;  2ZTD A;  1QZG A;  1X3F A;  3STB D;  1Q12 A;  3M4Q A;  4GLA C;  1GM5 A;  4NXM Q;  1V9P A;  3ULJ A;  3U4V A;  2VW9 A;  4B3T Q;  1N34 Q;  2XGT A;  1YNX A;  2ZJP A;  2UU9 Q;  1UE6 A;  3KJO A;  1N32 L;  1M1K C;  4LF8 L;  4DNI A;  4OON A;  3F2D A;  2OWO A;  1KRS A;  3KOJ A;  4YCV A;  1W3S A;  3EBE A;  1WYD A;  3HFZ B;  4GOP A;  4DR6 L;  4JI2 L;  4IJL A;  3S1R H;  1CKM A;  2WP8 J;  3CCJ A;  3T1Y L;  2VY3 A;  4DV5 L;  2D0O A;  2QA4 A;  1PVO A;  2GVA A;  2UXB Q;  1Y1V H;  3PUV A;  3PGZ A;  4Y52 H;  4LWC A;  3ER0 A;  1XNQ L;  1N36 L;  5LMN W;  3FKI G;  4UPA A;  1VQL A;  4DR5 L;  1VQD A;  4A3I G;  3D31 A;  1N33 L;  1VQ6 A;  2VZA A;  2LXJ A;  2VL6 A;  4DAY B;  4UY8 C;  2R92 G;  2E2J H;  4IPD A;  2HHH Q;  2I5L X;  4DR2 Q;  3TQY A;  3L0O A;  2IHF A;  4DV6 Q;  3FKI H;  3AQQ A;  4PZ6 A;  3ULP A;  4A3I H;  1GKH A;  4GLX A;  2R92 H;  3K7A H;  4LFA Q;  1L1O A;  3HKZ G;  4JBM A;  3CCV A;  4DUZ Q;  2JA5 H;  4A76 A;  3B6Y A;  1YVC A;  5BR8 L;  1FGU A;  5IE8 A;  3HKZ E;  1VQH A;  1X6O A;  3CPF A;  3KF6 B;  2QEX A;  1MJE A;  1HNX Q;  1Y1W G;  3GTM H;  4YWK A;  3UE0 A;  4AYB G;  1VQJ A;  4AH6 A;  2YTV A;  4X66 Q;  3M4O H;  1C9O A;  1Q8K A;  3S1Q H;  2JA7 H;  1YJN A;  1Y1W H;  2MFI A;  1CSP A;  3PO2 H;  4L5Q A;  2IHE A;  1SLJ A;  2NN6 I;  2Q2U A;  1XMQ Q;  2K5H A;  3TRZ A;  4LF5 Q;  3U58 A;  1KRT A;  2E2I H;  1A63 A;  4C3I H;  1I94 Q;  4DKA C;  1EYG A;  4IO9 A;  4LF9 L;  1G29 1;  4OWT B;  1OXT A;  1N8R C;  2JK8 A;  1I50 H;  2ALY B;  3PV0 A;  2WFW A;  2JJQ A;  3OYY A;  3SGI A;  4YY3 L;  3E0E A;  4JI7 L;  4IOA A;  2F3I A;  4DV0 Q;  2N78 A;  1JJ2 A;  1N9W A;  3CCQ A;  1VQP A;  2K5N A;  3CXC A;  2CFM A;  2PI2 E;  3G48 A;  4DUY Q;  4GKJ L;  4XIG S;  1IBL Q;  2E2H H;  3PUY A;  5IP9 G;  5FJ8 G;  1KQS A;  4B3R Q;  4KHP Q;  2R93 G;  2Z6K A;  4PMW A;  5JEA J;  1V1Q A;  1HJP A;  1K0R A;  4LUZ A;  1Q81 C;  4A4I A;  4LNQ A;  1I5F A;  4A3L G;  1YHB A;  4NXM L;  2RHS B;  2JA6 G;  2UUC Q;  4B3T L;  4JI6 Q;  3ZJY C;  5IP9 H;  4LF6 Q;  5IYD G;  1PV4 A;  5M3F G;  4A3L H;  2Q2H A;  3RZD H;  2EIF A;  4BY1 G;  3I7F A;  1VQI A;  4JBJ A;  4JBK A;  3STB C;  1EIY B;  3I2Z A;  5M3F H;  4JI8 L;  4X62 Q;  2FXQ A;  4GN4 B;  3J80 c;  1YZ6 A;  2JQO A;  4BY1 H;  2UXB L;  2VNU D;  1A62 A;  1PFS A;  2PQA A;  1IXR A;  2Q2I A;  4OO1 G;  3PF4 A;  1B8A A;  4A3K G;  1FJG Q;  1X65 A;  5EAY A;  3CCR A;  2UUA Q;  4OO1 I;  1L1O B;  1KHI A;  1HNW Q;  2HHH L;  5LMN Q;  3TS2 A;  1EWI A;  1E1T A;  4K0K Q;  4R1J A;  4QL5 A;  1PH8 A;  1V43 A;  4A3K H;  2JA8 H;  1D7Q A;  3IRB A;  4YHH L;  2UXD Q;  5M3M H;  3EIV A;  3WWV A;  2C35 B;  2H5X A;  3DM3 A;  1K8A C;  1Z47 A;  1TWC H;  1XMO L;  1C0A A;  2R7D A;  4KLK A;  1PA6 A;  1TWA H;  5H1S E;  2QGQ A;  1B7Y B;  1OXX K;  3U50 C;  3J81 i;  4HJ7 A;  1JJC B;  3BZC A;  4DR3 L;  4JI3 Q;  4IFD J;  1X9N A;  4DV7 Q;  4J15 A;  2KEN A;  3JAM c;  5IYB H;  4A3J G;  1KIX A;  1NE3 A;  4GN5 A;  1WI5 A;  2BA0 A;  4TVA B;  3J7A 5;  4HID A;  3UDX A;  2VS1 A;  4UP7 A;  4QIW E;  3KF8 B;  4UP8 A;  2KHJ A;  1HR0 L;  5LMU L;  1SRU A;  3PUZ A;  3H3V H;  1E7Z A;  2R7Z H;  3F8T A;  4A75 A;  2ZM6 L;  2CWP A;  1G51 A;  4A3J H;  3BJU A;  3I4N G;  3S16 H;  1EUJ A;  3RN2 A;  1PH9 A;  3K80 C;  1GVP A;  3I4M G;  1YEZ A;  1Q46 A;  5DLQ E;  3ULL A;  2VQF L;  1GO3 E;  1OXV A;  2F52 A;  2R6G A;  4QY7 A;  2XTI A;  4RG1 A;  3I4N H;  1U5K A;  1WOC A;  4HJ5 A;  1QUQ A;  4PG3 A;  4A3G G;  1MIU A;  4GOP C;  5IP7 G;  4C3H H;  5AJ3 Q;  1VQM A;  5C0X J;  1PH7 A;  4X64 Q;  4LF4 L;  3F2B A;  3I4M H;  1VQB A;  5JEA G;  1VQC A;  2E5L Q;  1IBL L;  1FL0 A;  1J5E Q;  1H95 A;  3E9H A;  3BZK A;  1P8L A;  1IYJ B;  4L5T A;  3RLO A;  2VQE L;  2OTL A;  1VQO A;  1LUZ A;  2IT1 A;  4JV5 Q;  4DPG A;  4A3B G;  1KAW A;  1PH5 A;  1PHJ A;  4GKK L;  3CP0 A;  4A3M G;  1UE7 A;  2F4V Q;  3A5Z B;  5IY0 A;  1X56 A;  3CCU A;  4GNX A;  1W2B A;  1I6H H;  4GLV B;  2JEA I;  1M90 C;  2UUB Q;  1HNZ L;  2I0Q A;  3CCL A;  2PQA B;  4NB3 A;  3HOX G;  2CKZ B;  1R9T H;  4LFB Q;  1G6P A;  2KCT A;  3Q8D A;  4QGU A;  3A74 A;  1UEB A;  4DK3 C;  1TWH H;  3HOX H;  1YHA A;  3H0G G;  2AKW B;  4DV1 L;  1IBM L;  1EQR A;  1P16 A;  3PSI A;  1UWV A;  4JBW A;  4BBR G;  3OTO Q;  3J7Z C;  1AE2 A;  4AQY L;  3S2H H;  2BH2 A;  1HNW L;  3K8A A;  2ZJR A;  1Q7Y C;  1NMG A;  3H0G H;  4DR1 L;  2ZJQ A;  4HJ9 A;  1XNR Q;  4BBR H;  4LUV A;  4FDB A;  4OX9 L;  4JI4 L;  1PYS B;  1IZ6 A;  2UXD L;  2ATW A;  2L15 A;  4DAM A;  4B3M L;  1E3P A;  4NXN Q;  3CQZ H;  3M9B A;  1PH1 A;  4KHZ A;  4DV3 L;  4JYA L;  2V1C C;  5JJK A;  5C4X G;  3S15 H;  3PUW A;  3GDE A;  2NN6 G;  3K0X A;  4OWX B;  4B3S Q;  4AYB E;  1K9M C;  1VQG A;  1VQ9 A;  4IFD I;  2HQL A;  3G4S A;  1ASZ A;  4A3C G;  3S1M H;  4DR4 L;  5C4X H;  2CCZ A;  1BBU A;  1RIP A;  3HKS A;  4R4I A;  4HIK A;  2YU9 H;  4A3C H;  1KC8 C;  2Q2T A;  1E22 A;  3L2P A;  1AH9 A;  2Y0S G;  3AEV A;  2CWA A;  4X65 Q;  1I3Q H;  1QUQ B;  4JOI A;  2NVX H;  1WJJ A;  1U0L A;  2JA9 A;  2N49 A;  4POF A;  2Y0S E;  3F1Z A;  4LFC Q;  3S2D H;  4BA2 I;  2K75 A;  1JE5 A;  3T1H L;  4DR7 L;  4JI1 Q;  4DV4 Q;  4LF7 Q;  4YWM A;  5C0X I;  1QVF A;  1NTG A;  4HJA A;  4JI5 Q;  1SR3 A;  2K4K A;  2R7F A;  1N34 L;  2UXC Q;  2UU9 L;  5FJ8 H;  3LGJ A;  4H02 A;  4YWL A;  2R93 H;  1E1O A;  2VUM G;  3CCM A;  1Y14 B;  3PIO A;  3TS0 A;  1WCM G;  3KYH C;  4GNX B;  2JA6 H;  3PUX A;  3FHW A;  2YTX A;  1IBK Q;  1CKN A;  2B63 G;  1K8G A;  3ICE A;  3W5O A;  2VUM H;  3NEN A;  5IYD H;  1OTC A;  2DGY A;  1PH2 A;  2YV5 A;  1VQ8 A;  2GN5 A;  2B63 H;  5C3E G;  3OW2 A;  1VQF A;  1YJ9 A;  1N32 Q;  4LF8 Q;  2IY5 B;  2K14 A;  3S14 H;  1D8L A;  1L0W A;  4L5R C;  1HZB A;  4R4C A;  4WJ3 M;  4DR6 Q;  1HZ9 A;  1TXY A;  4JI2 Q;  5C3E H;  1TWG H;  4R4Q A;  4DV6 L;  4DR2 L;  4A3E G;  3T1Y Q;  3CW2 C;  1KXL A;  3RLF A;  3KFU A;  3DLL A;  4YCW A;  1EOV A;  1SFO H;  2AMC B;  4JCV E;  1PH6 A;  4LFA L;  2K52 A;  4X6A H;  4DUZ L;  4A3E H;  3S1N H;  1XNQ Q;  1N36 Q;  1VQK A;  2BH8 A;  4APV A;  4DR5 Q;  1N33 Q;  1X54 A;  2WAQ G;  1Q82 C;  4YCU A;  1PH3 A;  1HNX L;  4A3D G;  1EQQ A;  3UE1 A;  4BA1 I;  1Q1E A;  3TEH B;  4QQB X;  2MNA A;  4ALP A;  4X66 L;  4Y7N H;  1QVC A;  4IPH A;  1JMC A;  1VCI A;  3GTO H;  3NEL A;  2ES2 A;  4A3D H;  5BR8 Q;  5M5W H;  2WB1 G;  1XMQ L;  3RLN A;  3CD6 A;  3AFP A;  3M4P A;  4LF5 L;  3A0J A;  4EX5 A;  4C2M H;  1QZH A;  2WB1 E;  1I94 L;  4OWW B;  1X3E A;  3S24 A;  3VDY A;  1XTD A;  1YIT A;  4MZ9 A;  1HR0 W;  1K83 H;  1K3R A;  3G71 A;  4HIM A;  3L7Z C;  5ELO A;  3D0F A;  1HZA A;  2IX1 A;  3F2C A;  4P74 A;  4DV0 L;  3PF5 A;  2NZO A;  3KJP A;  4DUY L;  2PMZ E;  4B3R L;  4P73 A;  3S17 H;  4A3G H;  1PYB A;  2K50 A;  5IP7 H;  2OQK A;  4KHP L;  2D0P A;  2A19 A;  3J80 i;  4LF9 Q;  2MQH A;  1SRO A;  2ID0 A;  3CAM A;  2UUC L;  4JI6 L;  2MO0 A;  4LF6 L;  1CKN B;  4GN3 B;  2EQS A;  5GQO A;  4JI7 Q;  4YY3 Q;  3GO5 A;  5GAE C;  1YBY A;  2NVT H;  4LUO A;  3M7N A;  1JJG A;  5GRO A;  4A3B H;  4WJ4 A;  4GKJ Q;  1XPU A;  2Z0S A;  1PH4 A;  4LW1 A;  5GAG C;  4A3M H;  1L1O C;  3CMA A;  4X62 L;  1FVI A;  1S3O A;  5FLM G;  5ELN A;  5GAH C;  3CC7 A;  4XTC S;  3UDF A;  2KCM A;  3MEF A;  3GTG H;  2CQO A;  1HZC A;  2E8G A;  5K36 G;  2KBN A;  5M5Y H;  1YJW A;  1C7Y A;  5FLM H;  2N3S A;  2PI2 A;  4NPS A;  3G6E A;  1FJG L;  1LTL A;  5IT9 c;  1X3G A;  4DV2 Q;  2UUA L;  4BY7 G;  5JJI A;  1NMF A;  1VQ5 A;  1Y1V G;  5LMN L;  1NJI C;  4DK6 C;  4K0K L;  3NEM A;  1YHQ A;  2OTJ A;  3JAM i;  4JI8 Q;  1VQE A;  2B29 A;  1NY4 A;  4HIO A;  4BY7 H;  4P75 A;  2HIV A;  2YTY A;  4PZ7 A;  3GTJ H;  5JJL A;  2IX0 A;  1E24 A;  3W1G A;  5IWA Q;  3GTK H;  2A1A A;  4IFD G;  3GTL H;  4R4T A;  1JT8 A;  4A3F G;  3RZO H;  4JI3 L;  1VQA A;  2JA5 G;  4P72 A;  4DV7 L;  3FP9 A;  4JOI C;  4HJ8 A;  1S40 A;  3H15 A;  4YHH Q;  5FLX c;  5C4J H;  4A3F H;  2NVQ H;  1B70 B;  2AWN A;  3TRE A;  1JB7 A;  5J3B A;  2K5V A;  4IPG A;  5E7N A;  4JI0 Q;  2KHI A;  2Z6K C;  3AYH B;  1XMO Q;  3CF5 A;  1VS0 A;  3I56 A;  1QVG A;  1CUK A;  3M3Y H;  5GAD C;  3CCE A;  1BKB A;  1XJV A;  5C44 G;  2JA7 G;  2HIX A;  3CC2 A;  4MNO A;  3AFQ A;  4DR3 Q;  3A5U A;  2RHQ B;  1X55 A;  1UE1 A;  1XPR A;  3CC4 A;  2RF4 A;  3HOW G;  3PO2 G;  5C0X G;  3J81 j;  1O7I A;  4JC0 A;  1RL2 A;  1T9H A; 
#chains in the Genus database with same CATH topology
 3FRP B;  3DWP A;  5JVH 3;  2F0M A;  3S9W A;  1HR0 Q;  3KLS A;  2Z4H A;  1BCP D;  2JA7 B;  2IW3 A;  3OOC A;  3PO2 B;  1SND A;  2HDM A;  5JAV A;  1EY8 A;  3OWE B;  3I55 A;  2A5H A;  4CJ1 B;  3P20 A;  2WV6 D;  2PQE A;  1WCM H;  1MGS A;  2BCO A;  1Q86 C;  2UUB L;  4ME3 A;  4P71 A;  1L2F A;  3CME A;  3URY A;  3PIP A;  4CGY B;  1IKM A;  2B2V C;  2I5M X;  1A0I A;  1OXS C;  3J80 L;  4GKK Q;  1X3Q A;  3BG3 A;  4ID6 A;  4TQU S;  3SDZ A;  1ENF A;  2RSN A;  5FO8 B;  4DV2 L;  3M85 A;  2NZH A;  1GUW A;  2F0J A;  3ND8 A;  3KBX A;  4F87 A;  2D62 A;  1YIJ A;  5JPN C;  4AIM A;  1UE5 A;  2ZTC A;  1B2T A;  1HQR D;  3KLW A;  4JG2 A;  4L63 B;  1V8Q A;  5M5X H;  3R2T A;  4B3S L;  4IUP A;  5CV4 A;  4J6H A;  1DM0 B;  4DR1 Q;  4FF1 A;  1KTK A;  4OX9 Q;  2Q8T A;  1STH A;  3CCS A;  2K5W A;  2EDG A;  4A3K B;  4BXX H;  2Z4I A;  3OPO A;  5IYB G;  2B2U C;  4RMF A;  3RR5 A;  5IYC G;  2PNH A;  1TWA B;  3VR6 A;  2R7Z G;  4DR4 Q;  2LSS A;  4NMZ A;  4DV4 L;  4IPC A;  3H3V I;  3SK6 A;  1VQN A;  4OGQ C;  4JI5 L;  4O42 A;  5E3F A;  2SNS A;  3K81 C;  3BU2 A;  3NBH A;  1ICW A;  4QIW B;  2BA1 A;  4A3J B;  1BVS A;  1CSQ A;  1CI3 M;  2JSO A;  4XYQ A;  4ZKC B;  1IBK L;  3HOY H;  1TWF H;  3VR2 A;  5ELB A;  2CVR A;  4DR7 Q;  5EKK A;  2ZTD A;  5C5M A;  1X3F A;  3A8K E;  1GM5 A;  3GV6 A;  3I8Z A;  1LV9 A;  1N34 Q;  4IUV A;  3T16 A;  3QO2 A;  3KJO A;  1M1K C;  4DNI A;  3F2D A;  3KOJ A;  4DK0 A;  4YCV A;  4GOP A;  1ZKO A;  2B2Y C;  3T1Y L;  3FVQ A;  4C1N I;  4EVO A;  3NWS A;  5LMN W;  3BS1 A;  1PZI D;  1VDZ A;  4DR5 L;  4A3I G;  3D31 A;  2LXJ A;  2VL6 A;  4ZK9 B;  2L9H A;  4IPD A;  2I5L X;  1ZXT A;  3FKI H;  2XRQ D;  3FKI B;  2JA5 H;  4A76 A;  3CRL C;  5IE8 A;  1DOK A;  2QEX A;  1WD1 A;  2EY2 A;  5EPK A;  4BBR B;  4V0B A;  3MHB A;  2YTV A;  2RKS A;  1C9O A;  4XXE A;  3S1Q H;  1LT5 D;  2WII B;  5C6A A;  1Y1W H;  4C3I G;  1CSP A;  3S15 B;  3F2U A;  3GP7 A;  3Q24 A;  1Y1W B;  2TMP A;  2D5D A;  3KF8 A;  4LF9 L;  4DNT B;  1EYG A;  3DWQ A;  4K2K A;  1IKL A;  4PV1 C;  2JK8 A;  2YU9 B;  2WFW A;  4YY3 L;  2XNA C;  2A74 C;  3CU7 A;  4KY6 A;  2F0W A;  1JR0 D;  5I6Y A;  4MIU A;  1YNJ D;  4ZUI A;  4G7O C;  2PI2 E;  4XQN A;  3G48 A;  1XWE A;  4XIG S;  4GKJ L;  1KQS A;  5IP9 G;  4KHP Q;  4KK7 A;  3VR4 A;  2R93 G;  3S14 H;  1JOR A;  2NTT A;  4LUZ A;  1CQV A;  1I5F A;  1O7L A;  5IOD A;  1S5D D;  2UUC Q;  3ZJY C;  2GA4 B;  1PV4 A;  5M3F G;  1C8C A;  4FXD A;  3RZD H;  3JAM E;  2KED A;  4JBJ A;  4RGN A;  1R4Q B;  1EIY B;  4X62 Q;  1A15 A;  4PQX A;  1PFS A;  1Y69 U;  5HUR A;  4DFA A;  3NQI A;  1NAP A;  1FJG Q;  5EAY A;  1SE3 A;  2IX3 A;  4LMQ D;  1JIC A;  4K8J A;  3WDN A;  1D7Q A;  3IRB A;  4YHH L;  3V05 A;  3WWV A;  3DM3 A;  4JPB W;  1K8A C;  3BVM A;  1PLF A;  1TWC H;  2R7D A;  2F0P A;  4HMI A;  4KLK A;  2B2V A;  1PA6 A;  2QGQ A;  1OXX K;  3J7A F;  3BYT B;  1J9O A;  4WJW A;  1X9N A;  4XT1 B;  4J15 A;  2AUK A;  1ZYR D;  1O80 A;  5IYB H;  3NTH A;  1NE3 A;  5BN5 A;  4HID A;  1B1Z A;  1V1P B;  4UP8 A;  1PTO B;  1SRU A;  2R7Z H;  4RH6 A;  1G51 A;  2CWP A;  4A3D B;  5A35 A;  1KDC A;  1GVP A;  1U4L A;  2OXP A;  2R6G A;  4KHV A;  1WOC A;  4HJ5 A;  4PG3 A;  4A3G G;  1PH7 A;  1VQM A;  3F2B A;  4X3K A;  3TDQ A;  5JEA G;  2E5L Q;  2OTL A;  1VQO A;  4RHR A;  4DPG A;  4A3B G;  1KAW A;  3C2P A;  3MXP A;  2F4V Q;  1I6H H;  4U68 A;  1ENC A;  3AB9 A;  4ZLT F;  2N55 A;  2R3Z A;  2HUG A;  3DEO A;  3HOX G;  3HEJ A;  2O2L D;  4LFB Q;  1G6P A;  4QGU A;  1JB3 A;  4A3M B;  4RGT A;  3A74 A;  1K28 A;  5CGK A;  3A55 A;  1OO9 B;  4DV1 L;  3S2H H;  3J7Z C;  2KCC A;  3K8A A;  4P2C B;  4H0L C;  3S2H B;  5CBA E;  1XNR Q;  4FDB A;  4N9P A;  4JI4 L;  2DJG C;  2LFN A;  4DV3 L;  4JYA L;  1B9N A;  5C4X G;  1RDP D;  4HCS A;  3K0X A;  1VQG A;  1EYC A;  4DF7 A;  3G4S A;  4M8A A;  1S5E D;  1BBU A;  2EYJ A;  2L12 A;  4H7B A;  4OIJ A;  1DD2 A;  3L2P A;  1FNV A;  1LO5 D;  2NZ1 D;  2Y0S G;  4JOI A;  1KLU D;  3RD4 A;  1U0L A;  3ND9 A;  5E4X A;  5KEE A;  4LFC Q;  4BA2 I;  2K75 A;  1JE5 A;  3T1H L;  5BN4 A;  1NTG A;  2K4K A;  3A54 A;  2L55 A;  4H02 A;  2R93 H;  3CCM A;  3PIO A;  2QW7 A;  2EJM A;  5EKL A;  4GNX B;  3FHW A;  1KDA A;  2F0L A;  3GTQ B;  3GV3 A;  4PMC A;  4K5W A;  5L37 A;  2J4X A;  5CYU A;  3IAY A;  2B63 H;  1W6K A;  1IW7 D;  3E6Z X;  3OW2 A;  3D8G A;  2B63 B;  5JJZ A;  4WJ3 M;  4DR6 Q;  1TXY A;  4JI2 Q;  3A7L A;  5D14 A;  4WFN 3;  2M00 A;  3K5N A;  4BBS B;  3DLL A;  3HG9 A;  2RBM A;  4DGZ A;  3TZU A;  4NKL A;  5D65 A;  1XNQ Q;  2BH8 A;  1YNN D;  1JE4 A;  3KK7 A;  4MTK A;  2WAQ G;  1Q82 C;  1HNX L;  1ML0 D;  2EYO A;  4HR7 B;  2DY7 A;  2X69 A;  1QVC A;  4C3J G;  1VCI A;  1MD2 D;  5BR8 Q;  3HGB A;  4CJ0 B;  1L0Y B;  2EZV A;  1EQT A;  3CD6 A;  4LF5 L;  3A0J A;  2F0T A;  2WB1 E;  2JN4 A;  1X3E A;  1RHP A;  1XTD A;  1YIT A;  4MZ9 A;  5A2Q E;  1EY4 A;  1K83 H;  1NR2 A;  2FMC A;  4N8F A;  1STN A;  1K83 B;  4QUF A;  3KJP A;  1MI2 A;  1O7Y A;  1PRT B;  3S17 H;  4A3G H;  1G91 A;  3EQL C;  5I2X A;  3L3O C;  3J80 i;  4JK1 C;  1A2U A;  3L9A X;  1SYC A;  2F0U A;  4FP5 D;  1WTX A;  1A6X A;  5GRO A;  4A3B H;  4WJ4 A;  1II3 A;  3W2D A;  1MSH A;  1L1O C;  1ONL A;  2KQ3 A;  5FLM G;  1SEB D;  4XTC S;  1UAP A;  1U4P A;  4ZUJ A;  1C7Y A;  4N9T A;  1GHJ A;  4BY7 G;  1VQ5 A;  1XXG A;  1NJI C;  4K0K L;  1NY4 A;  3D6C A;  4P75 A;  2HIV A;  5JJL A;  1QOH A;  3OW7 A;  4ILW A;  4B08 A;  2A6H C;  5IWA Q;  3NWT A;  4CDF C;  4F7X A;  1JT8 A;  4CHT B;  3W3A A;  1K0S A;  1VQA A;  1XX8 A;  2SOB A;  4IFD H;  4DAP A;  2E2J B;  3H15 A;  4HAE A;  4L8J A;  1EEI D;  4A3F H;  2XN9 C;  2IPK D;  3H09 A;  4JI0 Q;  2KHI A;  2B2W C;  1XMO Q;  1CUK A;  5EKI A;  1D1I A;  1KNA A;  3CCE A;  2A6E C;  2JA7 G;  3D6W A;  3PO2 G;  1GUG A;  3OSO A;  3J81 j;  4JC0 A;  4IOC A;  2RDH A;  5C44 H;  3K7U C;  2EOT A;  5FO7 B;  3BVZ A;  4X64 L;  3M4O B;  1XPO A;  1VQ7 A;  5C0X H;  4Z9C B;  4K2L A;  3J81 c;  3NBH B;  1S72 A;  2VQF Q;  5KNB A;  4DN4 M;  2EJF C;  3FEW X;  5KNC A;  3ERQ A;  3KDF A;  4A93 H;  3PO3 H;  3RNU A;  2BDN A;  3QG1 A;  2A6H D;  2VQE Q;  3PO3 B;  2E2H B;  3IFT A;  2GVB A;  4GOP B;  2FFK B;  1GUT A;  3NE5 B;  1KD1 C;  1EOT A;  4MTN A;  1HNZ Q;  3UDG A;  1AE3 A;  3A8J E;  2K33 A;  1AN8 A;  3CRK C;  1LTG D;  1PFN A;  2A6E D;  1B3Q A;  5IWA L;  1IBM Q;  4B9X A;  4DAY A;  3ERS X;  1EU4 A;  1KNE A;  1EFW A;  4X3U A;  4BXX G;  4G57 A;  5LL6 X;  5BN3 A;  1PTO F;  1HXY D;  4C3J H;  3GD7 A;  2NBF A;  2B3G A;  5I2Y A;  4B3M Q;  4JI0 L;  1PMR A;  2AHO B;  3BVG A;  4JVZ A;  4R8I A;  4ABN A;  3JC6 6;  3KF6 A;  1EY6 A;  2L11 A;  5C3W A;  2HT1 A;  2KVM A;  1SSO A;  1SMY C;  3R8B A;  1TR5 A;  4IAL A;  3HOZ H;  4BS9 A;  4G7H C;  1KDB A;  4NDX A;  1CKO A;  3HOY G;  2UXC L;  1OXU A;  1O7Z A;  2XWJ B;  3HOV H;  4X3T A;  3T53 B;  3E9I A;  2PW7 A;  4RAU C;  3STB D;  3SXH A;  2VW9 A;  2XGT A;  1HCZ A;  3MXU A;  3I4M B;  1JOQ A;  1AZQ A;  1SNP A;  4LF8 L;  2OWO A;  1KRS A;  1STB A;  4LJZ C;  2SEB D;  3HFZ B;  1RTN A;  1VMC A;  1WTQ A;  5ELF A;  1Y8N B;  2QA4 A;  2MGS A;  2GVA A;  3QOJ A;  4ZKB B;  2UXB Q;  4K8I A;  1EIG A;  3PUV A;  1N36 L;  3FKI G;  1IL8 A;  1TY0 A;  1QJO A;  1SMY D;  1GKH A;  2A73 B;  2F3W A;  2R92 H;  3K7A H;  4LFA Q;  1L1O A;  4JBM A;  4KTA A;  1YVC A;  2R92 B;  4RGO S;  1CQF A;  1VQH A;  2PO4 A;  1Y1W G;  4YWK A;  3HKZ B;  1I4G A;  1CTM A;  3G6J B;  1Q8K A;  2JA7 H;  3K58 A;  3X3N A;  3PO2 H;  2IHE A;  2K5H A;  3J80 E;  5JPM C;  4FF4 A;  3U58 A;  1WTO A;  1EY9 A;  4CDC C;  4ME5 A;  1MBY A;  4DKA C;  1I94 Q;  1A63 A;  1HUN A;  4KKU A;  1H9M A;  5DM6 3;  2IL8 A;  3SGI A;  4JI7 L;  4DV0 Q;  2N78 A;  1NR4 A;  1VQP A;  4TKO B;  1D5Z C;  2CFM A;  3A7A B;  4XQJ A;  1BBX C;  4B3R Q;  2B2W A;  4PMW A;  3S2D B;  4A4I A;  5JVG 3;  3ONA B;  2RHS B;  3E0J A;  4Q0F A;  4LF6 Q;  5EPL A;  1I4X A;  2DN8 A;  2F0G A;  4A3L H;  1ZEQ X;  3LNN A;  1I4R A;  2JA6 B;  3I2Z A;  1ENA A;  2CHB D;  2G5D A;  1JOK A;  1YZ6 A;  2LY7 A;  2JQO A;  1D6E C;  2UXB L;  2EYH A;  2PQA A;  5FKA C;  1B8A A;  1C4Q A;  4OO1 I;  1KHI A;  4UDU C;  1EWI A;  1PH8 A;  2F0K A;  3SK8 A;  4A3K H;  3NBI A;  2UXD Q;  2H5X A;  4R9W A;  1LTA D;  2F0H A;  1Z47 A;  2MUY A;  3R3O A;  1TWA H;  4FYD A;  4A3E B;  4HJ7 A;  4OHJ A;  4JI3 Q;  1RF2 D;  4LK1 C;  3JAM c;  2I07 B;  3C3L A;  2BA0 A;  3J7A 5;  4KV6 A;  2VS1 A;  1EZ8 A;  1PRT F;  1HR0 L;  4Y7N B;  1SYB A;  3H3V H;  3F8T A;  4A75 A;  4A3J H;  3C46 A;  1EUJ A;  5M5W B;  3EFX D;  3RN2 A;  2X6G A;  3K80 C;  4XT3 B;  1YEZ A;  1TII D;  3TBI B;  3ULL A;  4C2M B;  2F52 A;  1OXV A;  2XTI A;  4RHS A;  1G8Z D;  1U5K A;  4RG1 A;  3DMU A;  3I4N H;  2WB1 B;  5IP7 G;  5AJ3 Q;  3I4N B;  1ILP A;  3LX0 A;  2AUJ D;  3I3C A;  1J5E Q;  1SYG A;  3RLO A;  3D4D A;  4JV5 Q;  1PHJ A;  4GKK L;  1V1O A;  4A3M G;  2B8G A;  1YNJ C;  3A5Z B;  4FXK C;  4Q5V A;  3CCU A;  2RVL A;  4GLV B;  2JEA I;  4FNF A;  5IT9 L;  2EYF A;  2D2C C;  2N88 A;  1R9T H;  1WTH A;  2J7Z A;  2KCT A;  4IQZ A;  1UEB A;  4DK3 C;  2RA4 A;  1TWH H;  1R9T B;  1DZ1 A;  2AKW B;  2PCF B;  3PSI A;  2VB3 X;  4PMB A;  3OTO Q;  1SE2 A;  1TWH B;  3TP8 A;  2BH2 A;  3SHL A;  1Q7Y C;  2K04 A;  3H0G H;  4DR1 L;  4BBR H;  4LUV A;  5KIX A;  4OX9 L;  1ROD A;  1PYS B;  2UXD L;  3H0G B;  5J39 A;  2F3V A;  2PW5 A;  1E3P A;  4NXN Q;  5FLX L;  5JJK A;  4G7Z C;  3GTJ B;  2TSS A;  3S15 H;  2NN6 G;  4XDX A;  4AYB E;  3GTK B;  1VQ9 A;  1EY5 A;  2HQL A;  1EYD A;  3S1M H;  4DR4 L;  3OHX C;  5DNF A;  4O1N A;  4R4I A;  4HIK A;  1AP0 A;  2YU9 H;  1Y8P B;  2RQX A;  3S1M B;  1PFM A;  3SE0 A;  1KC8 C;  2Q2T A;  1H9K A;  2NVQ B;  3Q6S A;  2CWA A;  4X65 Q;  1QUQ B;  1GUS A;  3SVM A;  1WJJ A;  2JA9 A;  1ZYR C;  2Y0S E;  3F1Z A;  3H91 A;  3TP6 A;  1I4H A;  3V96 A;  4DR7 L;  4JI1 Q;  4LF7 Q;  1QVF A;  1Q3L A;  1ILQ A;  1N34 L;  1B3A A;  1E1O A;  1F9Q A;  3TS0 A;  5IGB A;  4IUT A;  3PUX A;  2B63 G;  1K8G A;  4CJ2 C;  4FF2 A;  1FGB D;  2VXW A;  1N32 Q;  2EYL A;  1D8L A;  1L0W A;  4ZQ3 A;  4L5R C;  5CV9 A;  1HZ9 A;  3NQT A;  5C3E H;  2M2L A;  4R4Q A;  3GTP B;  1KXL A;  3CW2 C;  3RLF A;  3KFU A;  5C3E B;  1PH6 A;  1SXT A;  1I4Q A;  2F0Q A;  3BZD B;  3EA6 A;  1PZK D;  1I6V C;  4DU9 A;  1SBB B;  4APV A;  1N33 Q;  1LTS D;  1WTW A;  2RDG A;  1H9S B;  1HA5 A;  1STA A;  4BA1 I;  1PTO H;  3TEH B;  2MJ8 A;  4CKB A;  2I46 A;  4WOR A;  2L0C A;  4A3D H;  4IUR A;  2O5I C;  3X3M A;  3M4P A;  1HRJ A;  4QF4 A;  4I7Z C;  2ZT9 C;  4EX5 A;  1F2L A;  3TSS A;  3S24 A;  2JP1 A;  3VDY A;  1HR0 W;  1BOS A;  3G71 A;  3L7Z C;  1S5C D;  3D0F A;  1EIH A;  4DAV A;  2IX1 A;  2KOL A;  2NZO A;  2MHV A;  2E75 C;  5C4H A;  3T4A C;  4KHP L;  5IP7 H;  3E3X A;  2A19 A;  1G2S A;  5CC4 A;  2UUC L;  2B2U A;  2DJF C;  1CKN B;  2AQ2 B;  5GQO A;  1B44 D;  2NTS A;  5GAE C;  1MHW C;  1G6Z A;  3T13 A;  4LUO A;  3M7N A;  2A69 C;  1JJG A;  1LLR D;  4ZRZ A;  3VR5 A;  5GAG C;  4A3M H;  3CMA A;  4X62 L;  1FVI A;  1EEF D;  3CC7 A;  3UDF A;  4KJO A;  2CQO A;  1HZC A;  2LS0 1;  1RD9 D;  1RTO A;  5M5Y H;  1FJG L;  1SYF A;  4CKC A;  1NMF A;  2M9V A;  5IGE A;  4R8N A;  5M5Y B;  2B2T C;  5I6W A;  5EJW A;  3NEM A;  1YHQ A;  2OTJ A;  4YIJ A;  4JI8 Q;  2F0N A;  1D5M C;  1IW7 C;  2YTY A;  2FJ2 A;  2IX0 A;  1E24 A;  1PTO C;  1XYI A;  1Y1V B;  2K01 A;  2BOS A;  4IFD G;  2B2Y A;  4A3F G;  4P72 A;  1F77 A;  1NNX A;  2K7V A;  2NN6 H;  2K03 A;  2AWN A;  1FR3 A;  1YNN C;  3AYH B;  1QG7 A;  3CF5 A;  1VS0 A;  5GAD C;  3QOL A;  5C44 G;  2HIX A;  3CC2 A;  4MNO A;  4DR3 Q;  3A5U A;  2RHQ B;  1XPR A;  2A69 D;  5C0X G;  1O7I A;  3NEL A;  3RN5 A;  3GTM B;  1QE6 A;  4RKB A;  5EBC A;  1IL2 A;  2X6L A;  5LMU Q;  2E5L L;  4K5V A;  4HSP A;  2ZM6 Q;  4KN4 C;  1ESR A;  3MXN B;  3GTQ H;  1LYL A;  3MTS A;  5IGC A;  1QB5 D;  4A93 G;  1C48 A;  1J6Q A;  2EVB A;  3PO3 G;  2E2I B;  4KI0 A;  3I72 A;  1TT2 A;  2F4V L;  4LF4 Q;  1I50 B;  1VQ4 A;  2MO1 A;  2HD3 A;  3G7L A;  2OQ0 A;  3TP5 A;  1EFI D;  3HOU H;  1PTO D;  4LFB L;  4BBS H;  4IJH A;  1S5B D;  3FPP A;  4DK1 A;  3HOU B;  4BWG B;  2K28 A;  3ZYY X;  1DCZ A;  1HFG A;  3H94 A;  2EPB A;  1XNR L;  2ZTE A;  3KBG A;  2CH4 A;  5M3F B;  3PIP 3;  5DEH A;  2FMM A;  4AQY Q;  3CHB D;  2R61 A;  3P75 A;  4B9W A;  1EYA A;  3HP3 A;  2BE5 C;  3I90 A;  1QNU A;  1VF5 C;  3CPW A;  5J1Z A;  3EVQ A;  5AFW A;  2JA8 B;  5HY6 A;  4R4O A;  3HOZ G;  3NXW A;  1UUP A;  3J7A V;  5M3M B;  1U4M A;  1GUN A;  3H6M A;  5KYL A;  5T1I A;  2ASB A;  4LFC L;  3EN2 A;  3NPP A;  1WFQ A;  4GS3 A;  4OXP A;  5EQ0 A;  3V2T A;  3K5M A;  1CK1 A;  4GNX C;  3NHH A;  1LM0 A;  1JCK B;  1A8V A;  1B4O A;  2ICE C;  3OIP A;  3HOV G;  1AFP A;  1BBW A;  1STY A;  2ZXP A;  2N8N A;  3A56 A;  1TU2 B;  4NP5 A;  2AWO A;  3M4Y A;  4EQ5 A;  4C56 C;  3KLR A;  1JWS D;  2RCN A;  2Z9H A;  4QJF A;  1QZG A;  3R2I A;  3TME A;  3MAQ A;  3MZ5 A;  3I91 A;  1PXU A;  1XTC D;  2UU9 Q;  2ZJP A;  4HCE A;  4CDD C;  2L1B A;  4DR6 L;  5IGD A;  4JI2 L;  1ET9 A;  2WP8 J;  3DUZ A;  1PVO A;  2BE5 D;  3P7J A;  3OMC A;  3ER0 A;  4EGV A;  1XNQ L;  4JW0 A;  3FPU B;  1NSN S;  1TQO A;  4UPA A;  1VQL A;  1GOZ A;  4UAI A;  1VQ6 A;  2R92 G;  1X3P A;  2E2J H;  2HHH Q;  4DR2 Q;  3TQY A;  3L0O A;  4DV6 Q;  1BXT A;  3AQQ A;  4PZ6 A;  3ULP A;  5TSS A;  3HKZ G;  3HOX B;  3CCV A;  2ENB A;  3QR8 A;  4DUZ Q;  3B6Y A;  1TKW B;  5BR8 L;  1TVX A;  1FGU A;  2QDB A;  2F0O A;  3CPF A;  4QUC A;  1GJX A;  4QCL A;  1PRT C;  1X32 A;  1W6J A;  4X66 Q;  2B2T A;  3M4O H;  2QCP X;  2E2D C;  1YJN A;  1E2Z A;  2MFI A;  4L5Q A;  5IGF A;  1XMQ Q;  4AYB B;  1KRT A;  1V1P A;  3K59 A;  5DM7 3;  2EY5 A;  2Z6B A;  5C4X B;  4OWT B;  1OXT A;  5I9O A;  1N8R C;  3N52 A;  2ALY B;  2JJQ A;  3OYY A;  3E0E A;  4DA2 A;  4DUY Q;  1I3Q B;  2E2H H;  2NVX B;  2C5C A;  2KA7 A;  1HJP A;  1D5X C;  4A3L G;  2Y0S B;  1HA6 A;  2JA6 G;  4JI6 Q;  5IYD G;  5C4Z A;  5LL6 S;  1UNS A;  3BDL A;  3I7F A;  4JBK A;  1F9P A;  3STB C;  4K5X A;  2J0T D;  1KLG D;  4GN4 B;  1CT1 D;  3J80 c;  4BY1 H;  2WAC A;  2VNU D;  1A62 A;  5E1F A;  1IXR A;  1PRT D;  4OO1 G;  1G2T A;  4ZAI A;  4BY1 B;  3PF4 A;  1B9M A;  4A3K G;  1X65 A;  1WD0 A;  1JC7 A;  2UUA Q;  1VMP A;  3I70 A;  4FVM A;  1HNW Q;  2HHH L;  5LMN Q;  3TS2 A;  1E1T A;  1BCP B;  1V43 A;  4EQP A;  1TWG B;  1LTI D;  2B8F A;  3VYT A;  4LAA A;  4U67 3;  2L4N A;  1WTV A;  1AZP A;  4OEM B;  1XMO L;  3S1N B;  1B7Y B;  3BZC A;  4DV7 Q;  1RCV D;  4KD4 A;  3MFY A;  4A3J G;  5DAU A;  4GN5 A;  4K6L A;  1WI5 A;  4TVA B;  3UDX A;  3KF8 B;  2KHJ A;  3R93 A;  1CHP D;  3KLS X;  4HED A;  1JQY D;  3I4N G;  3Q23 A;  1I4P A;  3DHQ A;  1PH9 A;  1K8M A;  2ICI A;  3I73 A;  4HTH A;  2VQF L;  1GO3 E;  4QY7 A;  4H44 C;  1QCB D;  4G4K A;  4GOP C;  4C3H H;  3I4M H;  1VQB A;  1VQC A;  1HQM C;  5F2D A;  4C3H B;  1H95 A;  1AEX A;  3E9H A;  3BZK A;  1P8L A;  1IYJ B;  2D9U A;  2LKV A;  3HZX A;  3T56 B;  2VQE L;  1TS3 A;  1LUZ A;  2IT1 A;  4IN3 A;  1LT6 D;  3CP0 A;  1F2M A;  1Z7T A;  1E0B A;  5IY0 A;  1X56 A;  4GNX A;  2A68 C;  1QWY A;  1M90 C;  2UUB Q;  1HNZ L;  1T5E A;  4NB3 A;  2NYZ D;  1JWU D;  1PYW D;  4KKS A;  1EY7 A;  1YHA A;  3H0G G;  1IBM L;  3GTG B;  4BBR G;  3SK5 A;  1AE2 A;  1JWM D;  2AQ3 B;  1HNW L;  1FNW A;  3OMG A;  2ZJR A;  1NMG A;  4HJ9 A;  1IZ6 A;  3TN2 A;  1ICF B;  2KHS A;  2L15 A;  5CBE E;  4B3M L;  2XSC A;  3M9B A;  1PH1 A;  4BY7 B;  1A3T A;  2CH4 W;  3PUW A;  5D3D A;  4J8Q A;  1EWC A;  4OWX B;  4B3S Q;  1LTR D;  1SE4 A;  4FO2 A;  3GTL B;  1ASZ A;  2CCZ A;  1E2W A;  4RFB A;  3RZO B;  5KGU A;  4H13 C;  5G3L D;  4A3C H;  1AH9 A;  1E22 A;  4KKT A;  2K6A A;  4KN7 C;  4CDE C;  2N49 A;  3S2D H;  3J81 L;  2F03 A;  2A68 D;  3K57 A;  2KJX A;  4DV4 Q;  1EU3 A;  4YWM A;  2ZXR A;  1CZW A;  4HJA A;  4JI5 Q;  3A8I E;  2R7F A;  2F0V A;  5IIF A;  4YWL A;  5CV6 A;  2JA6 H;  1IBK Q;  2YTX A;  5CV5 A;  1H9R A;  2RCF A;  5IOC A;  3ICE A;  2VUM H;  3NEN A;  5IYD H;  4DNR B;  1OTC A;  2DGY A;  1VQ8 A;  2VUM B;  2GN5 A;  1D2B A;  1GUO A;  1WCM B;  5C3E G;  4EQN A;  1YJ9 A;  1T5X D;  2KEC A;  3PIO 3;  2K5D A;  1RKN A;  2Q8I B;  1F2Z A;  3WOE A;  3T1Y Q;  4OO1 H;  2NUC A;  5ELD A;  1TS4 A;  1SFO H;  4LFA L;  4JCV E;  4X6A H;  4A3E H;  2FIN B;  1SFO B;  2F0D A;  1VQK A;  4DR5 Q;  2XIW A;  1X54 A;  4YCU A;  4A3D G;  3LWU A;  3UE1 A;  1Q1E A;  4QQB X;  4ALP A;  1SJH D;  4Y7N H;  2DY8 A;  3NP8 A;  1R4P B;  2RSO A;  4IPH A;  2ES2 A;  4DXG A;  3D4W A;  5M5W H;  5M5X B;  3OIQ A;  3RLN A;  3AFP A;  2K32 A;  4C2M H;  1QZH A;  1I94 L;  4KMU C;  4HIM A;  5IT9 E;  1HZA A;  4PNY A;  4DV0 L;  3PF5 A;  1K8O A;  2QEJ C;  3GQB A;  2PMZ E;  4B3R L;  1PYB A;  4MHE A;  2OQK A;  1LTT D;  2FHT A;  4LF9 Q;  1SRO A;  2ID0 A;  5NUC A;  2F0F A;  2IWH A;  2MO0 A;  4LF6 L;  4GN3 B;  2EQS A;  4YY3 Q;  3GO5 A;  2PZU A;  2RDF A;  2NVT H;  4GKJ Q;  2NVT B;  4LW1 A;  5FLX E;  4XYO A;  3HOY B;  3IL8 A;  1TWF B;  5GAH C;  4TRD A;  2KCM A;  4F88 A;  5EGT A;  2E8G A;  2KBN A;  3AU7 A;  3C1E A;  3U9S A;  2N3S A;  2PI2 A;  4NPS A;  3G6E A;  3K5O A;  5CV8 A;  1Y1V G;  5K36 H;  2JYO A;  3IKJ A;  1VQE A;  2B29 A;  3D4R A;  3GTJ H;  5M9O A;  3BYY B;  1KAA A;  1BO0 A;  3GTK H;  3NTI A;  2O5J C;  2L5T A;  1K3B C;  4CKE A;  4JI3 L;  2G9D A;  2OF1 A;  3H3V C;  1EQV A;  4JOI C;  4TSS A;  3WOF A;  2OT2 A;  4HJ8 A;  1S40 A;  4YHH Q;  2NVQ H;  1B70 B;  1CZG A;  2KUM A;  3TRE A;  3K5L A;  2K5V A;  4IPG A;  5E7N A;  2Z6K C;  1NUC A;  2XRS D;  1BQQ T;  1DYQ A;  3M3Y H;  2JA5 B;  1QNK A;  3MC0 B;  4XQQ A;  3AFQ A;  1UE1 A;  3M3Y B;  5KRU A;  1WVL A;  1RL2 A;  1T9H A;  4QMG A;  4C1N K;  5AJ3 L;  1CA6 A;  5CR3 A;  1Q1B A;  2EYM A;  3QWN A;  3HOW H;  3S1Q B;  5FK9 C;  4IZ8 A;  1L0X B;  1MJC A;  2EXD A;  1J5E L;  2K05 A;  3HOW B;  1K73 C;  2NVY H;  3BDC A;  2JEB I;  4JV5 L;  4QB4 A;  2NVY B;  5JOB A;  4K14 A;  5ISR A;  5I9P A;  5G3L F;  3HOU G;  4RCN A;  4ZYS A;  3NK9 A;  1U9R A;  4BBS G;  1ASY A;  1SN8 A;  2P5Z X;  2OCE A;  3GTP H;  1HUM A;  1ESF A;  2EYP A;  4O0A A;  4OIK A;  1HPC A;  1Z9F A;  2DNC A;  2HQE A;  3S14 B;  4DV5 Q;  5ELC A;  4RKL A;  3OTO L;  1BCP F;  1BF4 A;  2I5H A;  2YYZ A;  3RZD B;  1DGS A;  2OEO A;  2EY6 A;  4O2D A;  3NTK A;  1SMX A;  2LXK A;  3DXJ C;  4KJN A;  4L6T B;  1EIF A;  4S3S A;  4NXN L;  4DV1 Q;  2A8V A;  2WAQ E;  1MSG A;  2JA8 G;  5M3M G;  4UP9 A;  1BNZ A;  4PZ8 A;  1NBW A;  4POG A;  4JI4 Q;  1Q8I A;  2DUD A;  3EJI A;  2F0S A;  1SE8 A;  2VB2 X;  3JAM L;  1HH2 P;  2WKC A;  5D3I B;  3I4O A;  2C9O A;  3QJY A;  4DV3 Q;  1GD7 A;  4JYA Q;  3W1B A;  4X65 L;  1H9J A;  2JE6 I;  4K6D A;  4L5S A;  1TWC B;  2H1E A;  1LT3 D;  3VYS A;  4JI1 L;  4LF7 L;  3K0Y A;  5IYC H;  1SNO A;  1FNU A;  1IYU A;  1NCV A;  3U4Z A;  5CMD A;  5HGQ A;  2O4X A;  3BDO A;  3P1H A;  3QIA A;  1KL9 A;  1YI2 A;  3IFD A;  3UDI A;  2R7Z B;  3PCO B;  1MKH A;  3TZD A;  3KDF B;  3DEP A;  3T1H Q;  3NUC A;  1STG A;  1Q12 A;  3M4Q A;  4GLA C;  3D3R A;  2E74 C;  3VYR A;  1V9P A;  3ULJ A;  3Q0A A;  4NXM Q;  3U4V A;  5EPJ A;  4B3T Q;  1YNX A;  1UE6 A;  2B39 A;  1SNQ A;  1N32 L;  4FF3 A;  4OON A;  5CV7 A;  2HDL A;  4V19 0;  1W3S A;  3EBE A;  1WYD A;  2PPB C;  4IJL A;  3S1R H;  1CKM A;  3CCJ A;  2VY3 A;  1DOL A;  4DV5 L;  2D0O A;  5E4W C;  3S1R B;  3SK4 A;  1Y1V H;  1J8I A;  3PGZ A;  4Y52 H;  4LWC A;  1I6H B;  2HCI A;  1VQD A;  4DXF A;  1N33 L;  2VZA A;  4DAY B;  4UY8 C;  4I65 A;  2EJG C;  2IHF A;  3C1F A;  4A3I H;  1B53 A;  4GLX A;  1A3U A;  4A3I B;  2XVS A;  1O78 A;  3HKZ E;  3VYU A;  1X6O A;  3HRZ C;  4RGM A;  3KF6 B;  1MJE A;  5T1G A;  1HNX Q;  3GTM H;  5KND A;  4OL7 A;  3UE0 A;  4I7A A;  4AYB G;  1VQJ A;  4AH6 A;  1BUV T;  1PZJ D;  5COY A;  1ET6 A;  1EZ6 A;  3DM1 A;  1VF7 A;  3TRZ A;  2Q2U A;  1SLJ A;  2NN6 I;  4NW2 A;  1F9R A;  4LF5 Q;  2Z1C A;  2E2I H;  4C3I H;  4IO9 A;  1G29 1;  4GZY C;  2NWG A;  4HN7 A;  1I50 H;  3PV0 A;  4C3I B;  3DWA A;  3NSW A;  2QIL A;  1Y8O B;  2F3I A;  1JJ2 A;  4IOA A;  1JOO A;  1N9W A;  3CCQ A;  4MN3 A;  4M1U B;  2K5N A;  3CXC A;  1IBL Q;  3PUY A;  5FJ8 G;  1B50 A;  2Z6K A;  5JEA J;  1V1Q A;  1K0R A;  5J22 A;  1Q81 C;  2WIN B;  4LNQ A;  1YHB A;  4NXM L;  4B3T L;  4HMJ A;  5IP9 H;  1PFB A;  1DJR D;  2Q2H A;  2EIF A;  2R93 B;  3OWF A;  4BY1 G;  2QF7 A;  4WRD A;  1VQI A;  3SEB A;  2QKI C;  2CQA A;  4JI8 L;  5M3F H;  2FXQ A;  3T51 B;  1A2T A;  2Q2I A;  2AQ1 B;  1M4V A;  2SDF A;  4IUU A;  3CCR A;  1CHQ D;  1L1O B;  1CFM A;  4K0K Q;  2DNE A;  4R1J A;  4QL5 A;  1SAP A;  1QIL A;  2JA8 H;  3HS0 C;  3Q22 A;  1KAB A;  1Z6H A;  5M3M H;  3EIV A;  2C35 B;  5FOB B;  4IUQ A;  1C0A A;  5H1S E;  3U50 C;  3J81 i;  3FMC A;  1JJC B;  4DR3 L;  4IFD J;  3E5S A;  3O13 A;  2KEN A;  2F4I A;  2PZT A;  3MWY W;  1KIX A;  4HSV A;  4UP7 A;  4QIW E;  5LMU L;  3PUZ A;  1E7Z A;  2ZM6 L;  3BJU A;  3S16 H;  5IGG A;  4C3H G;  3I4M G;  1Q46 A;  5DLQ E;  3S16 B;  2Z8L A;  4ULL A;  3MA2 B;  3KUP A;  3AMU A;  1QUQ A;  1MIU A;  1EWH A;  5C0X J;  4LF4 L;  4X64 Q;  1S5F D;  1HFN A;  1IBL L;  2PNR C;  1FL0 A;  2K5Q A;  2H4O A;  4L5T A;  2CW0 C;  1GHK A;  5JEA H;  2PMZ B;  2SNM A;  3S17 B;  4A3G B;  1PH5 A;  1S4Z A;  2F1M A;  1UE7 A;  1W2B A;  1HHV A;  3PMF A;  5C5L A;  5A2Q L;  2I0Q A;  3CCL A;  2PQA B;  4A3B B;  2CKZ B;  2Q8R E;  3ERO A;  3Q8D A;  1SNM A;  1PDQ A;  3HOX H;  1SYD A;  2NB0 A;  1EQR A;  1P16 A;  1UWV A;  4JBW A;  4AQY L;  1DOM A;  2ZJQ A;  1TS2 A;  2ATW A;  4OEL B;  4DAM A;  3K6O A;  3CQZ H;  4KHZ A;  1BDO A;  2V1C C;  3GDE A;  3CQZ B;  2QDL A;  1K9M C;  1H9S A;  4IFD I;  4KY5 A;  2MP1 A;  4A3C G;  5I4D A;  5C4X H;  2ZXO A;  1RIP A;  3HKS A;  4KD3 A;  3CKI B;  2CW0 D;  4A3F B;  3VA5 A;  3AEV A;  1I3Q H;  2NVX H;  1F2Y A;  3MVV A;  4POF A;  1STE A;  3PQI A;  5C0X I;  1DXM A;  1SR3 A;  2WKD A;  3LWE A;  5C44 B;  2UXC Q;  5K5P A;  5FJ8 H;  2UU9 L;  3LGJ A;  1HTP A;  5C3X A;  1EL0 A;  4EQO A;  2VUM G;  1Y14 B;  1WCM G;  3KYH C;  4RA8 A;  3U9O A;  1SYE A;  1UEA B;  1LAB A;  1EY0 A;  1CKN A;  3W5O A;  1GXD C;  3N6R A;  1WTP A;  1PH2 A;  2YV5 A;  1TS5 A;  3RUZ A;  5FO9 B;  1VQF A;  4A93 B;  4LF8 Q;  1RJT A;  1BR9 A;  4RWS C;  2IY5 B;  2K14 A;  1HZB A;  4R4C A;  1HTL D;  1TWG H;  4DR2 L;  3TP7 A;  4DV6 L;  4A3E G;  1AW7 A;  1SJE D;  4ZCK A;  2F0I A;  4YCW A;  2IJ0 A;  1EOV A;  2AMC B;  2K52 A;  4X3S A;  4DUZ L;  3S1N H;  1U4R A;  3QB3 A;  2PZW A;  4IUN A;  1A3V A;  1N36 Q;  5LHY 1;  1LT4 D;  1PH3 A;  4E6I A;  1EQQ A;  2EE1 A;  1SDF A;  3ITP A;  2MPM A;  2MNA A;  4UHV A;  4X66 L;  2V4D A;  1JMC A;  3GTO H;  5KYI A;  3FDT A;  2WB1 G;  2G9H D;  2JXM B;  1XMQ L;  2WAQ B;  3GTO B;  2PYK A;  3RMH A;  2KEE A;  4OWW B;  3M7G A;  4C3J B;  1K3R A;  1LAC A;  5ELO A;  3F2C A;  4P74 A;  1M8A A;  1IHZ A;  4J1M A;  4DUY L;  3I4L A;  4P73 A;  3SR1 A;  2KCN A;  2K50 A;  3VR3 A;  2D0P A;  3HOZ B;  1IYV A;  1E2V A;  2MQH A;  1LTB D;  3CAM A;  4JI6 L;  5HGT A;  3MEH A;  1F9S A;  4FXG C;  4JI7 Q;  3MXN A;  1TY2 A;  5COR A;  1YBY A;  4KY7 A;  3J7Y W;  1DON A;  1XPU A;  3HOV B;  2Z0S A;  1PH4 A;  1D1K A;  2EY1 A;  4CBV A;  1S3O A;  5ELN A;  1BCP C;  1WTR A;  3MEF A;  4N8X 1;  3GTG H;  5K36 G;  2K1B A;  2F0E A;  1YJW A;  3UI2 A;  5FLM H;  1SNC A;  1LTL A;  5IT9 c;  1X3G A;  4DV2 Q;  2UUA L;  5JJI A;  4F8M A;  5LMN L;  1FD7 D;  4DK6 C;  4RCO A;  3MFG A;  3JAM i;  3VA7 A;  1CM9 A;  4HIO A;  4BY7 H;  4PZ7 A;  3W1G A;  3J81 E;  2A1A A;  2XWB B;  3GTL H;  4R4T A;  5EBD A;  3RZO H;  2JA5 G;  4DV7 L;  3FP9 A;  2EXZ A;  5FLX c;  5C4J H;  1JB7 A;  5J3B A;  2LMC B;  3K7A B;  1CA5 A;  2E76 C;  5C4J B;  3MXG A;  3I56 A;  1QVG A;  5ELE A;  1BKB A;  1XJV A;  1Q90 A;  1X55 A;  2BDO A;  1FYC A;  2RF4 A;  3CC4 A;  3HOW G;  4ODG A;  2HCC A; 
#chains in the Genus database with same CATH homology
 3RN5 A;  4IOC A;  5C44 H;  5AJ3 L;  3K7U C;  1IL2 A;  4X64 L;  1HR0 Q;  1Q1B A;  5LMU Q;  1XPO A;  3HOW H;  1VQ7 A;  2E5L L;  2ZM6 Q;  1MJC A;  2EXD A;  1J5E L;  3J81 c;  3MXN B;  3NBH B;  1K73 C;  3GTQ H;  1LYL A;  2NVY H;  2JEB I;  1S72 A;  4A93 G;  2VQF Q;  4JV5 L;  3I55 A;  1J6Q A;  3PO3 G;  4KI0 A;  1WCM H;  2F4V L;  4LF4 Q;  3HOU G;  1VQ4 A;  3KDF A;  4A93 H;  2MO1 A;  3PO3 H;  3RNU A;  1Q86 C;  2OQ0 A;  2UUB L;  1ASY A;  1SN8 A;  4BBS G;  4ME3 A;  4P71 A;  1L2F A;  2OCE A;  3CME A;  2VQE Q;  3GTP H;  3HOU H;  3PIP A;  4LFB L;  4BBS H;  4IJH A;  4O0A A;  1Z9F A;  2GVB A;  4GOP B;  2I5M X;  1A0I A;  1OXS C;  4GKK Q;  1KD1 C;  4DV5 Q;  4TQU S;  3OTO L;  4MTN A;  4DV2 L;  3M85 A;  2I5H A;  2YYZ A;  2NZH A;  1HNZ Q;  1DGS A;  3UDG A;  1AE3 A;  1XNR L;  2ZTE A;  4O2D A;  1SMX A;  2LXK A;  2D62 A;  1YIJ A;  4AIM A;  1UE5 A;  2ZTC A;  1EIF A;  4NXN L;  3KLW A;  4JG2 A;  5IWA L;  1IBM Q;  4DV1 Q;  5M5X H;  2WAQ E;  2A8V A;  2JA8 G;  4AQY Q;  3ERS X;  4B3S L;  5M3M G;  1EFW A;  4UP9 A;  4BXX G;  4PZ8 A;  4DR1 Q;  1NBW A;  4POG A;  4C3J H;  4OX9 Q;  3GD7 A;  4JI4 Q;  2DUD A;  3CPW A;  3CCS A;  2B3G A;  1SE8 A;  4B3M Q;  4BXX H;  1HH2 P;  4JI0 L;  2AHO B;  3I4O A;  5HY6 A;  4R4O A;  3HOZ G;  4DV3 Q;  4JYA Q;  1GD7 A;  5IYB G;  3JC6 6;  3W1B A;  4X65 L;  3KF6 A;  2JE6 I;  4RMF A;  3RR5 A;  4L5S A;  2HT1 A;  5IYC G;  2ASB A;  2PNH A;  4LFC L;  3EN2 A;  4GS3 A;  1WFQ A;  4OXP A;  2LSS A;  2R7Z G;  3HOZ H;  4GNX C;  4DR4 Q;  4JI1 L;  4DV4 L;  1LM0 A;  4LF7 L;  1A8V A;  4IPC A;  3H3V I;  5IYC H;  3HOV G;  1VQN A;  4JI5 L;  1BBW A;  1CKO A;  3HOY G;  2UXC L;  3U4Z A;  2N8N A;  1OXU A;  5HGQ A;  3K81 C;  3BU2 A;  1KL9 A;  1YI2 A;  2AWO A;  3UDI A;  4EQ5 A;  3HOV H;  2BA1 A;  3PCO B;  1MKH A;  1BVS A;  1CSQ A;  1IBK L;  3KDF B;  3HOY H;  2RCN A;  1TWF H;  3T1H Q;  4QJF A;  4DR7 Q;  3E9I A;  2ZTD A;  1QZG A;  1X3F A;  3STB D;  1Q12 A;  3M4Q A;  4GLA C;  1GM5 A;  4NXM Q;  1V9P A;  3ULJ A;  3U4V A;  2VW9 A;  4B3T Q;  1N34 Q;  2XGT A;  1YNX A;  2ZJP A;  2UU9 Q;  1UE6 A;  3KJO A;  1N32 L;  1M1K C;  4LF8 L;  4DNI A;  4OON A;  3F2D A;  2OWO A;  1KRS A;  3KOJ A;  4YCV A;  1W3S A;  3EBE A;  1WYD A;  3HFZ B;  4GOP A;  4DR6 L;  4JI2 L;  4IJL A;  3S1R H;  1CKM A;  2WP8 J;  3CCJ A;  3T1Y L;  2VY3 A;  4DV5 L;  2D0O A;  2QA4 A;  1PVO A;  2GVA A;  2UXB Q;  1Y1V H;  3PUV A;  3PGZ A;  4Y52 H;  4LWC A;  3ER0 A;  1XNQ L;  1N36 L;  5LMN W;  3FKI G;  4UPA A;  1VQL A;  4DR5 L;  1VQD A;  4A3I G;  3D31 A;  1N33 L;  1VQ6 A;  2VZA A;  2LXJ A;  2VL6 A;  4DAY B;  4UY8 C;  2R92 G;  2E2J H;  4IPD A;  2HHH Q;  2I5L X;  4DR2 Q;  3TQY A;  3L0O A;  2IHF A;  4DV6 Q;  3FKI H;  3AQQ A;  4PZ6 A;  3ULP A;  4A3I H;  1GKH A;  4GLX A;  2R92 H;  3K7A H;  4LFA Q;  1L1O A;  3HKZ G;  4JBM A;  3CCV A;  4DUZ Q;  2JA5 H;  4A76 A;  3B6Y A;  1YVC A;  5BR8 L;  1FGU A;  5IE8 A;  3HKZ E;  1VQH A;  1X6O A;  3CPF A;  3KF6 B;  2QEX A;  1MJE A;  1HNX Q;  1Y1W G;  3GTM H;  4YWK A;  3UE0 A;  4AYB G;  1VQJ A;  4AH6 A;  2YTV A;  4X66 Q;  3M4O H;  1C9O A;  1Q8K A;  3S1Q H;  2JA7 H;  1YJN A;  1Y1W H;  2MFI A;  1CSP A;  3PO2 H;  4L5Q A;  2IHE A;  1SLJ A;  2NN6 I;  2Q2U A;  1XMQ Q;  2K5H A;  3TRZ A;  4LF5 Q;  3U58 A;  1KRT A;  2E2I H;  1A63 A;  4C3I H;  1I94 Q;  4DKA C;  1EYG A;  4IO9 A;  4LF9 L;  1G29 1;  4OWT B;  1OXT A;  1N8R C;  2JK8 A;  1I50 H;  2ALY B;  3PV0 A;  2WFW A;  2JJQ A;  3OYY A;  3SGI A;  4YY3 L;  3E0E A;  4JI7 L;  4IOA A;  2F3I A;  4DV0 Q;  2N78 A;  1JJ2 A;  1N9W A;  3CCQ A;  1VQP A;  2K5N A;  3CXC A;  2CFM A;  2PI2 E;  3G48 A;  4DUY Q;  4GKJ L;  4XIG S;  1IBL Q;  2E2H H;  3PUY A;  5IP9 G;  5FJ8 G;  1KQS A;  4B3R Q;  4KHP Q;  2R93 G;  2Z6K A;  4PMW A;  5JEA J;  1V1Q A;  1HJP A;  1K0R A;  4LUZ A;  1Q81 C;  4A4I A;  4LNQ A;  1I5F A;  4A3L G;  1YHB A;  4NXM L;  2RHS B;  2JA6 G;  2UUC Q;  4B3T L;  4JI6 Q;  3ZJY C;  5IP9 H;  4LF6 Q;  5IYD G;  1PV4 A;  5M3F G;  4A3L H;  2Q2H A;  3RZD H;  2EIF A;  4BY1 G;  3I7F A;  1VQI A;  4JBJ A;  4JBK A;  3STB C;  1EIY B;  3I2Z A;  5M3F H;  4JI8 L;  4X62 Q;  2FXQ A;  4GN4 B;  3J80 c;  1YZ6 A;  2JQO A;  4BY1 H;  2UXB L;  2VNU D;  1A62 A;  1PFS A;  2PQA A;  1IXR A;  2Q2I A;  4OO1 G;  3PF4 A;  1B8A A;  4A3K G;  1FJG Q;  1X65 A;  5EAY A;  3CCR A;  2UUA Q;  4OO1 I;  1L1O B;  1KHI A;  1HNW Q;  2HHH L;  5LMN Q;  3TS2 A;  1EWI A;  1E1T A;  4K0K Q;  4R1J A;  4QL5 A;  1PH8 A;  1V43 A;  4A3K H;  2JA8 H;  1D7Q A;  3IRB A;  4YHH L;  2UXD Q;  5M3M H;  3EIV A;  3WWV A;  2C35 B;  2H5X A;  3DM3 A;  1K8A C;  1Z47 A;  1TWC H;  1XMO L;  1C0A A;  2R7D A;  4KLK A;  1PA6 A;  1TWA H;  5H1S E;  2QGQ A;  1B7Y B;  1OXX K;  3U50 C;  3J81 i;  4HJ7 A;  1JJC B;  3BZC A;  4DR3 L;  4JI3 Q;  4IFD J;  1X9N A;  4DV7 Q;  4J15 A;  2KEN A;  3JAM c;  5IYB H;  4A3J G;  1KIX A;  1NE3 A;  4GN5 A;  1WI5 A;  2BA0 A;  4TVA B;  3J7A 5;  4HID A;  3UDX A;  2VS1 A;  4UP7 A;  4QIW E;  3KF8 B;  4UP8 A;  2KHJ A;  1HR0 L;  5LMU L;  1SRU A;  3PUZ A;  3H3V H;  1E7Z A;  2R7Z H;  3F8T A;  4A75 A;  2ZM6 L;  2CWP A;  1G51 A;  4A3J H;  3BJU A;  3I4N G;  3S16 H;  1EUJ A;  3RN2 A;  1PH9 A;  3K80 C;  1GVP A;  3I4M G;  1YEZ A;  1Q46 A;  5DLQ E;  3ULL A;  2VQF L;  1GO3 E;  1OXV A;  2F52 A;  2R6G A;  4QY7 A;  2XTI A;  4RG1 A;  3I4N H;  1U5K A;  1WOC A;  4HJ5 A;  1QUQ A;  4PG3 A;  4A3G G;  1MIU A;  4GOP C;  5IP7 G;  4C3H H;  5AJ3 Q;  1VQM A;  5C0X J;  1PH7 A;  4X64 Q;  4LF4 L;  3F2B A;  3I4M H;  1VQB A;  5JEA G;  1VQC A;  2E5L Q;  1IBL L;  1FL0 A;  1J5E Q;  1H95 A;  3E9H A;  3BZK A;  1P8L A;  1IYJ B;  4L5T A;  3RLO A;  2VQE L;  2OTL A;  1VQO A;  1LUZ A;  2IT1 A;  4JV5 Q;  4DPG A;  4A3B G;  1KAW A;  1PH5 A;  1PHJ A;  4GKK L;  3CP0 A;  4A3M G;  1UE7 A;  2F4V Q;  3A5Z B;  5IY0 A;  1X56 A;  3CCU A;  4GNX A;  1W2B A;  1I6H H;  4GLV B;  2JEA I;  1M90 C;  2UUB Q;  1HNZ L;  2I0Q A;  3CCL A;  2PQA B;  4NB3 A;  3HOX G;  2CKZ B;  1R9T H;  4LFB Q;  1G6P A;  2KCT A;  3Q8D A;  4QGU A;  3A74 A;  1UEB A;  4DK3 C;  1TWH H;  3HOX H;  1YHA A;  3H0G G;  2AKW B;  4DV1 L;  1IBM L;  1EQR A;  1P16 A;  3PSI A;  1UWV A;  4JBW A;  4BBR G;  3OTO Q;  3J7Z C;  1AE2 A;  4AQY L;  3S2H H;  2BH2 A;  1HNW L;  3K8A A;  2ZJR A;  1Q7Y C;  1NMG A;  3H0G H;  4DR1 L;  2ZJQ A;  4HJ9 A;  1XNR Q;  4BBR H;  4LUV A;  4FDB A;  4OX9 L;  4JI4 L;  1PYS B;  1IZ6 A;  2UXD L;  2ATW A;  2L15 A;  4DAM A;  4B3M L;  1E3P A;  4NXN Q;  3CQZ H;  3M9B A;  1PH1 A;  4KHZ A;  4DV3 L;  4JYA L;  2V1C C;  5JJK A;  5C4X G;  3S15 H;  3PUW A;  3GDE A;  2NN6 G;  3K0X A;  4OWX B;  4B3S Q;  4AYB E;  1K9M C;  1VQG A;  1VQ9 A;  4IFD I;  2HQL A;  3G4S A;  1ASZ A;  4A3C G;  3S1M H;  4DR4 L;  5C4X H;  2CCZ A;  1BBU A;  1RIP A;  3HKS A;  4R4I A;  4HIK A;  2YU9 H;  4A3C H;  1KC8 C;  2Q2T A;  1E22 A;  3L2P A;  1AH9 A;  2Y0S G;  3AEV A;  2CWA A;  4X65 Q;  1I3Q H;  1QUQ B;  4JOI A;  2NVX H;  1WJJ A;  1U0L A;  2JA9 A;  2N49 A;  4POF A;  2Y0S E;  3F1Z A;  4LFC Q;  3S2D H;  4BA2 I;  2K75 A;  1JE5 A;  3T1H L;  4DR7 L;  4JI1 Q;  4DV4 Q;  4LF7 Q;  4YWM A;  5C0X I;  1QVF A;  1NTG A;  4HJA A;  4JI5 Q;  1SR3 A;  2K4K A;  2R7F A;  1N34 L;  2UXC Q;  2UU9 L;  5FJ8 H;  3LGJ A;  4H02 A;  4YWL A;  2R93 H;  1E1O A;  2VUM G;  3CCM A;  1Y14 B;  3PIO A;  3TS0 A;  1WCM G;  3KYH C;  4GNX B;  2JA6 H;  3PUX A;  3FHW A;  2YTX A;  1IBK Q;  1CKN A;  2B63 G;  1K8G A;  3ICE A;  3W5O A;  2VUM H;  3NEN A;  5IYD H;  1OTC A;  2DGY A;  1PH2 A;  2YV5 A;  1VQ8 A;  2GN5 A;  2B63 H;  5C3E G;  3OW2 A;  1VQF A;  1YJ9 A;  1N32 Q;  4LF8 Q;  2IY5 B;  2K14 A;  3S14 H;  1D8L A;  1L0W A;  4L5R C;  1HZB A;  4R4C A;  4WJ3 M;  4DR6 Q;  1HZ9 A;  1TXY A;  4JI2 Q;  5C3E H;  1TWG H;  4R4Q A;  4DV6 L;  4DR2 L;  4A3E G;  3T1Y Q;  3CW2 C;  1KXL A;  3RLF A;  3KFU A;  3DLL A;  4YCW A;  1EOV A;  1SFO H;  2AMC B;  4JCV E;  1PH6 A;  4LFA L;  2K52 A;  4X6A H;  4DUZ L;  4A3E H;  3S1N H;  1XNQ Q;  1N36 Q;  1VQK A;  2BH8 A;  4APV A;  4DR5 Q;  1N33 Q;  1X54 A;  2WAQ G;  1Q82 C;  4YCU A;  1PH3 A;  1HNX L;  4A3D G;  1EQQ A;  3UE1 A;  4BA1 I;  1Q1E A;  3TEH B;  4QQB X;  2MNA A;  4ALP A;  4X66 L;  4Y7N H;  1QVC A;  4IPH A;  1JMC A;  1VCI A;  3GTO H;  3NEL A;  2ES2 A;  4A3D H;  5BR8 Q;  5M5W H;  2WB1 G;  1XMQ L;  3RLN A;  3CD6 A;  3AFP A;  3M4P A;  4LF5 L;  3A0J A;  4EX5 A;  4C2M H;  1QZH A;  2WB1 E;  1I94 L;  4OWW B;  1X3E A;  3S24 A;  3VDY A;  1XTD A;  1YIT A;  4MZ9 A;  1HR0 W;  1K83 H;  1K3R A;  3G71 A;  4HIM A;  3L7Z C;  5ELO A;  3D0F A;  1HZA A;  2IX1 A;  3F2C A;  4P74 A;  4DV0 L;  3PF5 A;  2NZO A;  3KJP A;  4DUY L;  2PMZ E;  4B3R L;  4P73 A;  3S17 H;  4A3G H;  1PYB A;  2K50 A;  5IP7 H;  2OQK A;  4KHP L;  2D0P A;  2A19 A;  3J80 i;  4LF9 Q;  2MQH A;  1SRO A;  2ID0 A;  3CAM A;  2UUC L;  4JI6 L;  2MO0 A;  4LF6 L;  1CKN B;  4GN3 B;  2EQS A;  5GQO A;  4JI7 Q;  4YY3 Q;  3GO5 A;  5GAE C;  1YBY A;  2NVT H;  4LUO A;  3M7N A;  1JJG A;  5GRO A;  4A3B H;  4WJ4 A;  4GKJ Q;  1XPU A;  2Z0S A;  1PH4 A;  4LW1 A;  5GAG C;  4A3M H;  1L1O C;  3CMA A;  4X62 L;  1FVI A;  1S3O A;  5FLM G;  5ELN A;  5GAH C;  3CC7 A;  4XTC S;  3UDF A;  2KCM A;  3MEF A;  3GTG H;  2CQO A;  1HZC A;  2E8G A;  5K36 G;  2KBN A;  5M5Y H;  1YJW A;  1C7Y A;  5FLM H;  2N3S A;  2PI2 A;  4NPS A;  3G6E A;  1FJG L;  1LTL A;  5IT9 c;  1X3G A;  4DV2 Q;  2UUA L;  4BY7 G;  5JJI A;  1NMF A;  1VQ5 A;  1Y1V G;  5LMN L;  1NJI C;  4DK6 C;  4K0K L;  3NEM A;  1YHQ A;  2OTJ A;  3JAM i;  4JI8 Q;  1VQE A;  2B29 A;  1NY4 A;  4HIO A;  4BY7 H;  4P75 A;  2HIV A;  2YTY A;  4PZ7 A;  3GTJ H;  5JJL A;  2IX0 A;  1E24 A;  3W1G A;  5IWA Q;  3GTK H;  2A1A A;  4IFD G;  3GTL H;  4R4T A;  1JT8 A;  4A3F G;  3RZO H;  4JI3 L;  1VQA A;  2JA5 G;  4P72 A;  4DV7 L;  3FP9 A;  4JOI C;  4HJ8 A;  1S40 A;  3H15 A;  4YHH Q;  5FLX c;  5C4J H;  4A3F H;  2NVQ H;  1B70 B;  2AWN A;  3TRE A;  1JB7 A;  5J3B A;  2K5V A;  4IPG A;  5E7N A;  4JI0 Q;  2KHI A;  2Z6K C;  3AYH B;  1XMO Q;  3CF5 A;  1VS0 A;  3I56 A;  1QVG A;  1CUK A;  3M3Y H;  5GAD C;  3CCE A;  1BKB A;  1XJV A;  5C44 G;  2JA7 G;  2HIX A;  3CC2 A;  4MNO A;  3AFQ A;  4DR3 Q;  3A5U A;  2RHQ B;  1X55 A;  1UE1 A;  1XPR A;  3CC4 A;  2RF4 A;  3HOW G;  3PO2 G;  5C0X G;  3J81 j;  1O7I A;  4JC0 A;  1RL2 A;  1T9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...