4IJHA

Fragment-based discovery of protein-protein interaction inhibitors of replication protein a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of Protein-Protein Interaction Inhibitors of Replication Protein A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
total genus 28
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ijhA00
4IOAA 3HOWH 1BVSA 2NVYH 2ZM6L 3TQYA 2K50A 4HIMA 4GKJQ 2N8NA 1E3PA 4B3SL 4DR5L 1PH4A 4LF7L 2YTVA 4X64L 4HIDA 4IPHA 2NVQH 4QY7A 2NZHA 2YTYA 3UDIA 5IYBG 2MNAA 1NE3A 2R7DA 4HIKA 2LXJA 1YNXA 4DR3L 3ULJA 1SRUA 3PUWA 4B3TQ 1WOCA 5IYBH 3RN5A 2LXKA 1M90C 1NY4A 3PV0A 1HNZQ 2QGQA 2Z0SA 1E1OA 5IY0A 1Y1WH 3K80C 3CCEA 2ASBA 3H0GG 3NEMA 1A8VA 4A3MH 1HNWQ 4IPDA 4P73A 5C4JH 4AQYQ 1XNRL 2NZOA 2GVAA 2E2HH 1N32Q 3H0GH 1VQ8A 4WJ4A 4R4QA 2VQFL 2WAQG 2N78A 2UU9Q 1UE5A 2RHSB 1DGSA 3D0FA 1CSPA 4OWTB 1IBML 4JCVE 1OTCA 3HOXH 3AQQA 1Q1BA 4BA1I 2QA4A 2CWAA 4NXMQ 2IX1A 3BZCA 2H5XA 4A3JG 1AE2A 1VS0A 2K52A 4LW1A 1GKHA 4GN3B 4K0KL 4A3JH 4TVAB 1IXRA 2GN5A 4JBMA 4UPAA 2JE6I 2WP8J 2CCZA 1LM0A 2JEBI 3BZKA 3PGZA 1X3GA 1VQ5A 5M5XH 4B3ML 3PO2G 1V9PA 2MQHA 3W1BA 3WWVA 1S3OA 3EBEA 2AKWB 1NMFA 5H1SE 3IRBA 1WFQA 5BR8Q 1GM5A 3GTKH 2CQOA 3PO2H 1IBLL 4A3LG 2RHQB 4JV5Q 1BBUA 4YY3L 1PH5A 2JA8H 1SR3A 2Q2IA 4JI2Q 1D7QA 1HZAA 2PQAA 3MEFA 4DV3Q 4ALPA 4A3LH 3S1QH 2RCNA 2AWOA 1N33L 4JI8Q 3CF5A 4LFCL 1YBYA 3VDYA 3M3YH 3S2DH 4EQ5A 5IT9c 2OQ0A 2A19A 2KHJA 3CC7A 4DUZQ 2ALYB 4X62L 4QL5A 1VQDA 2JA5G 4IFDI 1CKMA 2CKZB 1QVFA 4JI7Q 1K9MC 3U4ZA 3ICEA 4LUOA 2JA5H 2NVTH 2NN6G 5M3MH 3CCVA 4AIMA 1HH2P 2ZTCA 4L5TA 2EIFA 1YHQA 1N34Q 2BH8A 3HKSA 2EQSA 4KHZA 4LF9Q 3I7FA 4NB3A 4HIOA 2QEXA 1B70B 1N8RC 3KOJA 2F52A 2HHHQ 5LMUL 1A62A 1VQOA 2BH2A 4GN4B 1MKHA 4IPCA 1VQ7A 3JAMc 2UXDL 1N36L 4A93G 2IHFA 5GAHC 3I4OA 1MIUA 1IYJB 2K4KA 5IP9G 1YVCA 4LUVA 5IWAL 2Q2TA 3FKIG 4GOPC 4C2MH 2HT1A 2JA6H 1UEBA 4PZ7A 3H3VH 4P74A 1SROA 4A93H 4DK6C 4R4CA 1SLJA 4HJ9A 5IP9H 1AH9A 1Z9FA 1I6HH 4P72A 4OX9L 2UXBL 4DV5Q 1KL9A 3RN2A 2I5LX 3RLOA 3CCMA 3PUYA 3KLWA 4HJ8A 3ERSX 3CCSA 4LF8L 2OQKA 4RMFA 2UXCL 3KF8B 2UUCL 3CMAA 2Z6KC 5C0XJ 2K5VA 4LF5Q 5LMNQ 4UP7A 1LTLA 4DV1Q 4OXPA 4AYBE 5GAEC 2PI2E 1B8AA 1VQHA 1VQJA 3S14H 4TQUS 1CKNA 4A3EG 3CC2A 2B29A 3S2HH 4A3FG 1XMQQ 1JMCA 4BBSG 1Q82C 3T1HQ 3J81i 3T1YQ 3PO3G 1I50H 1UE6A 1Q7YC 4A3EH 3KDFB 3PF4A 1Y14B 1MJCA 1WCMG 4DV0L 4BBSH 3NELA 3I55A 5AJ3L 1S40A 3PO3H 4DV6Q 4DV2Q 5JJIA 4JI3Q 3TRZA 1WCMH 1OXVA 4IO9A 1BKBA 4L5SA 3D31A 3ZJYC 4DV7L 1XPOA 2E2IH 4JI1L 2R93G 3UE0A 4R1JA 2R6GA 2Y0SE 2JJQA 4GOPB 1P8LA 2HIXA 4J15A 4DR7L 4DR4L 3TS2A 1FJGL 2A1AA 2UUBQ 2R93H 3GDEA 5FLMG 4IJLA 1OXSC 4DR6Q 1ASZA 1YHAA 2PQAB 2ZM6Q 1Y1WG 1G51A 2E5LL 3ULPA 4HJAA 1PH7A 1NJIC 4DR5Q 4A3MG 4B3SQ 5FLMH 1K8AC 4LF7Q 3PSIA 4X64Q 3J7A5 1V43A 3CQZH 4DPGA 4JI6L 3GTGH 4A3GH 2BA0A 2AMCB 3PIOA 1GVPA 4B3RL 5ELNA 1X3EA 4DR3Q 3HOXG 1HR0L 1K8GA 1X9NA 3BJUA 1AE3A 4YWKA 2PNHA 2F4VL 3KFUA 1IBKQ 3UDXA 4DAMA 2PI2A 1Y1VG 1T9HA 1JB7A 2YTXA 2VY3A 4DR2L 3KDFA 3ULLA 2WAQE 1XNRQ 4GLAC 1VQ9A 1Y1VH 3S1NH 3RZOH 4A3IG 3OTOL 3JC66 2VQFQ 1VCIA 1VQAA 3I56A 2F4VQ 4YCWA 2OTLA 2B63G 2DUDA 4BXXG 2L15A 1HZ9A 5FJ8G 1IBMQ 3EN2A 1EQRA 4A3IH 1PH2A 3CC4A 1KHIA 2JA8G 1U0LA 4QIWE 4GOPA 2B63H 1PFSA 1Q86C 5FJ8H 4GN5A 1VQKA 4BXXH 1UE7A 4A3GG 1SN8A 3KF6A 4QJFA 4K0KQ 4IFDG 4QGUA 4PG3A 4IOCA 4UY8C 3EIVA 1BBWA 1I94L 4PZ8A 1HNXL 4GKKL 1OXXK 1SE8A 1Q1EA 2WB1G 4B3MQ 2VW9A 5HY6A 5EAYA 4JI0L 1KXLA 3GTJH 1VQLA 4P75A 1J5EL 2JA9A 3S1RH 1IL2A 3STBC 2ZJPA 2GVBA 3L7ZC 4LFAL 4UP8A 2Z6KA 3F8TA 1C7YA 1IBLQ 1EIFA 1TWFH 4JOIA 4X66L 3U4VA 1CKNB 4YY3Q 2ZTEA 4JI5L 5M3MG 5LMNW 3M4OH 2DGYA 1VQ4A 4OO1G 5JEAG 2VS1A 1D8LA 1XTDA 4DK3C 2YU9H 2I5MX 1N33Q 3A74A 1YI2A 4LFCQ 3HKZG 4UP9A 4LNQA 1NBWA 4XTCS 1FGUA 3CXCA 4JI4L 5M5YH 4PZ6A 4KHPL 3S17H 4JBJA 4X62Q 4KI0A 4LUZA 2EXDA 1GD7A 1MJEA 1VQIA 2JA6G 5C0XI 1YITA 1KRSA 1S72A 3A0JA 4KLKA 4YCUA 4GNXA 1HZBA 1JE5A 5IYCG 2UUCQ 2I0QA 4JG2A 1SFOH 2LSSA 2AWNA 3DM3A 3J81c 5E7NA 1YJ9A 4KHPQ 1PH9A 5IP7G 2IY5B 4DV4L 3HOZG 1K0RA 1Q46A 1VQCA 3PCOB 4JYAL 1U5KA 4C3IH 4POFA 5IYCH 5LMUQ 1XPRA 1XNQL 2XTIA 2JQOA 3FHWA 4NXNL 1Z47A 5IP7H 2UXDQ 1N36Q 3HOZH 1L1OA 1QUQB 3J81j 1X3FA 4WJ3M 1I5FA 4MZ9A 2MO1A 3FP9A 1CSQA 1EOVA 2D0PA 5IWAQ 1YJWA 1YJNA 3Q8DA 4BBRG 4XIGS 1EFWA 2K5HA 3UDFA 3RZDH 1YIJA 3J80i 2VQEL 4JOIC 4JC0A 3GO5A 4DNIA 4C3HH 4DAYB 4OX9Q 4BBRH 3PUVA 2UXBQ 3K81C 3HOUG 4JBWA 1B7YB 1KRTA 2CWPA 1J6QA 1OXTA 4LF8Q 1XMOL 1VQPA 1JT8A 3HOUH 2UXCQ 4A4IA 3STBD 4BY7G 4BY1H 2VQEQ 3HFZB 4YHHL 4LF4L 1C0AA 2JA7G 4GLVB 5GAGC 1E24A 3H3VI 2R92G 3UE1A 5HGQA 1X6OA 4BY7H 3F2BA 1E7ZA 4LFBL 1YEZA 4AH6A 4LF6L 1K83H 3H15A 2JA7H 3M85A 4GNXC 1EYGA 1NMGA 1TWGH 2ATWA 2R92H 3GTMH 3PUZA 1TWCH 3F2DA 5JJKA 2HIVA 1RL2A 3LGJA 1C9OA 4C3JH 4OWXB 3KF6B 3W5OA 4DV0Q 1IBKL 5AJ3Q 1A63A 2Q2UA 4GKJL 3F1ZA 1SMXA 2RF4A 4OWWB 3GTQH 1L1OC 2Q2HA 4DV7Q 4BA2I 3S24A 4JI1Q 4A3KH 1WYDA 1QUQA 3M9BA 3CMEA 1UWVA 4DR7Q 1QVGA 1VQEA 1H95A 4DR4Q 1GO3E 3K0XA 3M4QA 3MXNB 1FL0A 3TREA 1LYLA 4B3TL 1FJGQ 4OONA 1X65A 5M5WH 3DLLA 1P16A 1XJVA 1PH1A 2FXQA 3J7ZC 1HNZL 1CUKA 5C3EG 2E5LQ 1VQNA 5C44G 4JBKA 3SGIA 3F2CA 1EQQA 1HNWL 4AQYL 4JI6Q 5C3EH 1TWAH 2WFWA 5C44H 1PYSB 1L0WA 1N32L 1EUJA 3CCJA 4O2DA 4YWLA 2UU9L 4R4OA 4L5QA 4B3RQ 2ZJRA 4YWMA 1HR0Q 2IHEA 2NVXH 2MFIA 1X55A 4NXML 4GNXB 2UUAL 5DLQE 1M1KC 3UDGA 2E2JH 2E8GA 3AEVA 1E1TA 1YZ6A 2A8VA 4IJHA 2D62A 2V1CC 4DKAC 4HJ7A 4DR2Q 3KJOA 2K75A 3G6EA 3BU2A 1V1QA 3OTOQ 3RR5A 1K73C 2AHOB 4MTNA 2C35B 1W2BA 1L1OB 5GADC 3NENA 4PMWA 3L2PA 2UUAQ 3GTOH 5BR8L 1LUZA 1E22A 3B6YA 1JJ2A 5K36G 4H02A 4DR1L 4JV5L 3AFQA 3RNUA 4JI2L 2VL6A 3OYYA 1UE1A 3K7AH 2WB1E 1VQBA 3I4MG 4DV3L 2ID0A 1I94Q 1HNXQ 5C0XG 4GKKQ 4POGA 3CCLA 4JI8L 4A3BG 2R7ZG 3CPWA 1Q81C 4JI0Q 4GS3A 3U58A 3PF5A 3I4MH 2K5NA 4X6AH 1J5EQ 2KCMA 2IT1A 3E9HA 3RLNA 3PUXA 1HZCA 3KYHC 4DR1Q 4DUZL 4A3BH 4LFAQ 2R7ZH 1KC8C 4QQBX 3KJPA 1IZ6A 1OXUA 3W1GA 4X66Q 1PV4A 3K8AA 3J80c 4JI7L 4EX5A 4YCVA 3HOYG 4JI5Q 1PHJA 5FLXc 3HKZE 3G48A 2KENA 2D0OA 1A0IA 1N34L 4LF9L 1PH3A 1TXYA 3HOYH 1PH6A 2VNUD 4DUYL 4NPSA 2HHHL 2XGTA 4JI4Q 3S1MH 1G291 1PA6A 5GQOA 1FVIA 1XPUA 1N9WA 4GLXA 2I5HA 1G6PA 3CP0A 3CD6A 3S16H 2KCTA 4APVA 1K3RA 1X54A 4X65L 1EWIA 3PIPA 1EIYB 3GTPH 3OW2A 2HQLA 1L2FA 3G71A 4DUYQ 3AFPA 1NTGA 4IPGA 1W3SA 5IYDG 2JK8A 1YHBA 3TEHB 1VQGA 4DV4Q 2YYZA 1X56A 4DV5L 3I4NG 4JYAQ 2K14A 1R9TH 3CW2C 2PMZE 1I3QH 2YV5A 2N3SA 5M3FG 1XNQQ 4OO1I 5IYDH 4NXNQ 2F3IA 2VUMG 3GTLH 3E9IA 4X65Q 4A3DG 3I4NH 3L0OA 1KAWA 4IFDJ 4BY1G 4A75A 2NN6I 1KIXA 4LF5L 2JEAI 3ER0A 5LMNL 5M3FH 2R7FA 1QZHA 4DV1L 3A5UA 1ASYA 1QZGA 2VUMH 2VZAA 1JJGA 4A3DH 3FKIH 3M4PA 3E0EA 2OCEA 4R4TA 1KQSA 3GD7A 4AYBG 4Y52H 4A3CG 2CFMA 4FDBA 3CAMA 4P71A 3S15H 1Q12A 1XMQL 3TS0A 3G4SA 3T1HL 1PVOA 3T1YL 1PH8A 1RIPA 5IE8A 4A3CH 1VQMA 1XMOQ 4R4IA 4Y7NH 1O7IA 5ELOA 1WJJA 1JJCB 1HR0W 2KBNA 1Q8KA 3K7UC 5JEAJ 5C4XG 4DV6L 5JJLA 4ME3A 5J3BA 1TWHH 3NBHB 3JAMi 4YHHQ 4DV2L 3RLFA 4LF4Q 2KHIA 4JI3L 3A5ZB 1CKOA 4L5RC 1WI5A 3M7NA 1HJPA 3CCUA 2MO0A 4MNOA 2ES2A 1VQ6A 4HJ5A 5C4XH 4A3KG 2OTJA 4LFBQ 1PYBA 2ZTDA 1KD1C 3HOVG 4LF6Q 2IX0A 2N49A 4A3FH 3U50C 3CCRA 3HOWG 2OWOA 3AYHB 3CCQA 2Y0SG 2ZJQA 2UUBL 3I2ZA 2BA1A 4RG1A 5GROA 3HOVH 4LWCA 2B3GA 4O0AA 1QVCA 3CPFA 4DR6L 4A76A 1VQFA
chains in the Genus database with same CATH superfamily
4IOAA 5CYUA 3GTQB 2K50A 1WTHA 4B3SL 4DR5L 1PDQA 5E4WC 4LF7L 5A35A 2O4XA 2NVQH 1B9NA 4RKLA 1GUOA 4QY7A 3UDIA 4HIKA 3K5LA 5T1IA 3SE0A 5IYBH 5C3XA 1I6VC 1CQFA 1O7LA 3F2UA 3BDLA 2FMMA 1NR2A 5CV4A 3SXHA 4OELB 5C4JH 2E2HH 2N78A 1JWMD 2NVXB 1UE5A 1SNPA 3D0FA 4OWTB 1OTCA 2KCNA 3AQQA 4A3JG 2B39A 4CHTB 1LV9A 1AE2A 1VS0A 1GKHA 1YNNC 2SNMA 1I4GA 4K0KL 3OOCA 1IXRA 2WP8J 1QILA 3PO2G 1PRTC 3MWYW 1V9PA 2MQHA 5G3LF 5ELDA 1S3OA 3IRBA 3EFXD 1ML0D 2CQOA 3LWEA 1IBLL 4A3LG 1D5MC 5DM63 1PH5A 2F0SA 2PQAA 5FK9C 3S1QH 2RCNA 2L5TA 1K28A 4XT3B 3VDYA 4BS9A 4RGTA 2XNAC 2L4NA 4K14A 5IT9c 2R7ZB 2CVRA 2KHJA 1ENCA 4HCEA 2K32A 2QILA 1QVFA 4JI7Q 3DWAA 3U4ZA 4IUNA 1WTXA 5I2XA 5M3MH 2ZTCA 2EIFA 4DXGA 3I7FA 1S5FD 2NN6H 1KDBA 2MGSA 1A62A 1TR5A 2BH2A 1MKHA 4IPCA 3C1FA 1W6JA 3A8JE 1IHZA 1CA5A 4ZYSA 4RFBA 3T16A 2B2VA 2Z1CA 5KYLA 1I6HH 3RN2A 1CHQD 2I5LX 3GTLB 2AQ1B 3H91A 2UXCL 1PTOC 3QB3A 2MHVA 3OIQA 4K6LA 5LMNQ 3BDCA 4HCSA 1F2LA 4DV1Q 5GAEC 3EVQA 3S15B 1VQHA 2F4IA 3CC2A 1KABA 2B29A 1O7YA 3CU7A 4HN7A 4BBSG 1Q82C 3T1HQ 3PQIA 3PO3G 3P75A 4A3EH 5EPJA 3PF4A 5IGGA 1Y14B 4C3JB 1STBA 3AU7A 4IUVA 3TRZA 3D31A 5IGFA 4DV7L 2B2TA 2CH4A 2OF1A 1FD7D 4Q0FA 3NHHA 3HOVB 1ZEQX 2B2VC 2A1AA 2C5CA 4IJLA 1OXSC 3TP8A 1GUGA 3AB9A 2ZM6Q 1MD2D 3H09A 5FLMH 1K8AC 1ZKOA 3I72A 1V43A 2EE1A 3GTGH 5KEEA 1L0XB 4DNRB 1SNQA 3PIOA 1X3EA 1QOHA 1K8GA 2O5IC 3J81E 1AE3A 4YWKA 2KJXA 2XIWA 1JOQA 4RHRA 1Y1VG 2RDFA 2N88A 1JB7A 2DNCA 1KTKA 2YTXA 2WAQE 4GLAC 2L55A 4KN4C 2F0WA 1NSNS 4YCWA 4BXXG 2DUDA 2L15A 3EN2A 4ZCKA 2HDMA 4A3IH 3CC4A 1XYIA 1KHIA 1SSOA 2PW5A 4A3JB 1SYEA 5FJ8H 2VXWA 5CGKA 4PZ8A 1ILPA 1Q1EA 2VW9A 1DOLA 2F0GA 3GTJH 3H3VC 3C46A 3S1RH 3PO2B 1MGSA 1TWFH 2A5HA 4JOIA 4OL7A 1B44D 1CKNB 5IOCA 4JI5L 4IN3A 5M3MG 1XTDA 2XN9C 4LFCQ 1NBWA 4XYOA 4OO1H 5JEAH 3VR6A 4PZ6A 4ME5A 3S1MB 4JBJA 1LT6D 4G7OC 1MJEA 4YCUA 1H9RA 5NUCA 4QUCA 1HZBA 4C3IG 5IYCG 2UUCQ 2I0QA 4JG2A 1IKLA 2LSSA 1YJ9A 1BCPD 4KHPQ 5IP7G 2B2WC 3DM1A 4DV4L 5M9OA 3PCOB 4JYAL 1U5KA 3OHXC 1I4QA 5LMUQ 1XPRA 2FMCA 2MJ8A 2XTIA 4NXNL 1Z47A 3TBIB 3I70A 1X3FA 4WJ3M 1YNJC 1S5BD 3VA7A 2V4DA 3P7JA 5IGEA 4JOIC 2LS01 5E1FA 3VR3A 4OX9Q 4DAYB 3K81C 1CHPD 2CWPA 2IPKD 1XMOL 1B53A 1HHVA 4J6HA 3HOUH 1Q8IA 5KYIA 4JW0A 1O7ZA 2VQEQ 4YHHL 1J8IA 2JA7G 1TU2B 4GLVB 3UE1A 4BY7H 3TN2A 3HRZC 1I50B 2K7VA 1TWGH 3NTIA 2CW0C 2F0LA 4ZUIA 4BBSB 4KN7C 3PO3B 5JJKA 4DV0Q 5CBAE 5AJ3Q 2Q2UA 4BWGB 3A54A 1PYWD 4RWSC 2E2IB 1CA6A 3GTQH 1SYBA 4JI1Q 2MP1A 4O1NA 4RGNA 3J80E 4UHVA 4RKBA 4JK1C 3CMEA 1KAAA 3FPPA 2KCCA 3RUZA 4B08A 1P16A 2FXQA 4EVOA 1BDOA 3TZDA 1VQNA 5C44G 1C4QA 1XXGA 4OGQC 1G6ZA 4IUPA 5EQ0A 5C4JB 2K1BA 4JI6Q 4KKSA 2WINB 2WFWA 1L0WA 1B9MA 2IHEA 2NVXH 3T56B 2EYPA 4GNXB 3UDGA 3ND9A 3AEVA 1E1TA 1NR4A 4DKAC 2LFNA 1Y1VB 3RZOB 1O80A 4F8MA 4I65A 2K75A 5J39A 5EPKA 3OTOQ 2NZ1D 2M9VA 1EWHA 1W2BA 5GADC 3DEPA 1LUZA 2ICEC 3B6YA 4HMIA 4DR1L 3RNUA 2VL6A 3OYYA 3I4MG 4DXFA 1K8OA 1HNXQ 3QWNA 4A3BG 5BN4A 2I46A 1Q81C 4JI0Q 3U9OA 3MZ5A 4GS3A 3IFDA 3OWFA 1J5EQ 5C0XH 1I4RA 3RLNA 1G8ZD 1ZYRC 3L3OC 3N52A 3RMHA 2R7ZH 4X3SA 2B8GA 1LTGD 1IW7C 3KJPA 1OXUA 4X66Q 3MTSA 4JI7L 3HOYG 1ET9A 4MTKA 2WACA 4F87A 3G48A 2KENA 5M3MB 1PH3A 5ELFA 1D1KA 2KEDA 1PH6A 4FF1A 2VNUD 4DUYL 5I2YA 1RTOA 1FVIA 1XPUA 1SDFA 4KTAA 4Z9CB 3T53B 3CP0A 3NXWA 1G6PA 1H9JA 2KCTA 1EWIA 3PIPA 1NNXA 1L2FA 3NQTA 1NTGA 4IPGA 4C3IB 1I6HB 3I4NG 3A55A 1HRJA 2PNRC 2PMZE 1BXTA 1I3QH 2N3SA 5IYDH 3GTLH 1GHKA 3E9IA 4IUTA 4EGVA 4A3DG 1B2TA 5LMNL 1QZHA 2R7FA 4DV1L 1ASYA 4FXKC 3A8IE 2K28A 2OCEA 3E0EA 4Y52H 4A3CG 3S15H 2TMPA 3JAML 2WV6D 1ESRA 3T1HL 2B2YC 1C8CA 3A56A 1VQMA 5E4XA 1O7IA 5ELOA 3ITPA 4H44C 5JEAJ 1HTPA 3DWPA 5J3BA 1Y69U 4ID6A 1BR9A 1F9SA 3CKIB 1WI5A 2CH4W 4MNOA 5EKKA 3GTMB 4LF6Q 2N49A 5KNBA 3HOWG 4F7XA 2G5DA 3I2ZA 3HOVH 4QCLA 1JWSD 4O0AA 1IBKQ 2ZM6L 3TQYA 4GKJQ 2XWJB 2N8NA 1E3PA 1PH4A 1SE4A 2Z6BA 3NUCA 1C48A 1TS2A 3GV6A 1U4RA 2HD3A 4DN4M 1EY9A 2YTYA 3CRLC 2R7DA 4ZRZA 1YNXA 1LLRD 1SRUA 4B3TQ 2L12A 1WOCA 3RN5A 2EJMA 2NTSA 4B9WA 3KF8A 4A3MH 5C44B 2NZOA 1UEAB 3IAYA 1N32Q 4R4QA 2WAQG 3NQIA 4LJZC 2X6GA 5I9PA 1SYGA 1UNSA 4JCVE 3HOXH 4BA1I 1Q1BA 3LWUA 3VYSA 2IX1A 3BZCA 1PZKD 4LW1A 2NTTA 1KNEA 4GN3B 4A3JH 4JBMA 2I07B 2CCZA 2F0UA 3BZKA 5JAVA 3GTOB 4V190 3W1BA 3V2TA 5BR8Q 2Q8IB 4KY7A 3PO2H 2PQEA 5C5LA 3K59A 2F0HA 2J7ZA 1BBUA 4IUQA 2JA8H 3KK7A 2RA4A 1STYA 2DJGC 4DV3Q 4A3LH 3HG9A 2K03A 3E3XA 3I4MB 4IQZA 2FINB 4ILWA 4LFCL 3SK5A 3M3YH 4A3BB 4KD4A 2RBMA 4EQ5A 2VB2X 2A19A 1PRTF 1M8AA 2JA5G 3D6CA 2F0VA 4KKUA 4XYQA 1HFGA 3KLSA 1K9MC 4LUOA 1TIID 3HOYB 2UUCL 2XVSA 2BH8A 4DF7A 3KOJA 3QO2A 2K04A 5LMUL 1VQOA 4GN4B 1SMYC 3JAMc 4A93G 2IHFA 1PRTB 3W2DA 3I4OA 1IYJB 2JYOA 4CKEA 1QWYA 2K4KA 1SBBB 1PZJD 5ISRA 3S2HH 4PQXA 3NP8A 5I6WA 1RKNA 1A2TA 4DK6C 4R4CA 1JOKA 1SLJA 1YNND 3FRPB 1RD9D 1R9TB 2E2DC 4FP5D 3J80L 4P72A 4OX9L 1SEBD 3E0JA 1AH9A 1KL9A 3CCMA 3PUYA 5CC4A 5DM73 3KLWA 3I4NB 1JE4A 4HJ8A 3ERSX 3CCSA 1PRTD 2X6LA 4FXDA 2K5QA 2OQKA 4RMFA 3CMAA 4A3DB 5C0XJ 1VF5C 4UP7A 1LTLA 1EEFD 1VQJA 3S14H 4TQUS 1K8MA 1E2ZA 1XMQQ 1JMCA 1HQRD 1TKWB 1I50H 2RSNA 1TWGB 2QDLA 1D5XC 3KDFB 4DV0L 4BBSH 5AJ3L 1S40A 3PO3H 1RJTA 1DJRD 3BVGA 1PFMA 1D6EC 3EJIA 1PTOF 2E2IH 2BCOA 4JI1L 2R93G 1QB5D 2DJFC 4R1JA 2Y0SE 2HIXA 3DMUA 1U4MA 3TS2A 3R2TA 3HOWB 1HTLD 1GXDC 3HEJA 2F03A 4DR6Q 1B3QA 1YHAA 2PQAB 1DZ1A 3J7AF 4A3GG 4Q5VA 4DFAA 4HR7B 4A3MG 3PSIA 4X64Q 1A15A 1PTOB 4JI6L 2BA0A 3AMUA 1GVPA 4OIJA 1BNZA 1STNA 4DR3Q 3HOXG 2KEEA 4K2KA 3S9WA 2XRQD 2H1EA 3KFUA 2VB3X 3NSWA 4DAMA 2H4OA 1T9HA 1PTOD 3R2IA 3QIAA 1EQTA 3KDFA 3ULLA 1VQ9A 1Y1VH 3RZOH 3OTOL 3X3MA 1VCIA 1VQAA 4EQOA 5DEHA 2F4VQ 3IKJA 2G9HD 2WAQB 1H9MA 1HZ9A 1II3A 4J8QA 3ONAB 1EQRA 1PH2A 2JA8G 1U0LA 4BXXH 1VQKA 3M7GA 1UE7A 1SN8A 3KF6A 4FF3A 1DXMA 1HNXL 2B8FA 4K5XA 1OXXK 4JI0L 5CMDA 1VQLA 4ZLTF 1J5EL 3GTKB 4RCOA 3L7ZC 4UP8A 4X66L 1F2ZA 4CJ1B 3BS1A 1CZWA 2RQXA 2ZTEA 4XQQA 1LT3D 4LMQD 4DK3C 1N33Q 4KJOA 1EZ6A 4LNQA 2M2LA 3GP7A 1FGUA 5M5YH 2X69A 3Q23A 5C4HA 3DWQA 4CGYB 2FHTA 5G3LD 1GD7A 2JA5B 1SNMA 1KRSA 4KLKA 4I7ZC 3UI2A 2B2UC 2AWNA 1WD0A 1PH9A 3HOZG 1K0RA 2ZXOA 4C3IH 4POFA 5IYCH 5CV8A 1I3QB 2JQOA 5IP7H 2UXDQ 1N36Q 1L1OA 1QUQB 3J81j 1I5FA 4MZ9A 4A93B 4DK1A 1CSQA 1S5CD 4XQJA 5IWAQ 1EFWA 1A2UA 4MIUA 3P20A 2KOLA 4JC0A 2E75C 4K5VA 4DNIA 4JBWA 5JVH3 2F0OA 3C1EA 4LF8Q 1RF2D 3WOFA 5EKIA 1ONLA 5A2QE 2QDBA 4DU9A 1M4VA 4NMZA 2R92G 5HGQA 1U4PA 1Y8PB 1E7ZA 3R3OA 1RHPA 2NBFA 3HS0C 1AEXA 5JOBA 4AH6A 4LF6L 3H15A 2JA7H 1EYGA 5J22A 1NMGA 2P5ZX 4MN3A 3DUZA 3GTMH 3F2DA 4XXEA 2HIVA 2A68C 1A63A 1JWUD 4OWXB 1IBKL 5DNFA 4GKJL 1L0YB 2RF4A 2Z4IA 4HSPA 4OWWB 1L1OC 4CDEC 2RKSA 3WOEA 1QUQA 3M9BA 4K2LA 4DR7Q 1QJOA 5FLXE 1VQEA 1H95A 4DR4Q 1GO3E 1EYDA 3TREA 1FJGQ 4B3TL 3X3NA 3URYA 5C3EG 2F0QA 3G6JB 1E0BA 3CQZB 1YNJD 4CKCA 4A3GB 3V96A 4A3MB 2J4XA 5LL6S 1D2BA 1VF7A 5C44H 1N32L 4YWLA 1EOTA 4R4OA 1AN8A 4L5QA 2ZJRA 2DY8A 2BDOA 2EJGC 1X55A 2MFIA 3HOXB 3FVQA 2QCPX 1YZ6A 2A8VA 1EYAA 2D62A 2V1CC 4HJ7A 1LTAD 4RAUC 1AW7A 2B2WA 1STGA 1V1OA 1V1QA 5EBDA 2PW7A 1FYCA 1XWEA 4MTNA 3SEBA 3NENA 2UUAQ 5KNCA 3GTOH 5EPLA 1I4XA 1LTSD 2AQ2B 4K8JA 5BR8L 2ENBA 4ZKCB 2CW0D 3Q22A 3HGBA 1Z6HA 2JA8B 2KHSA 2WB1E 3VYRA 4DV3L 3QJYA 1I94Q 4GKKQ 1EZ8A 2JP1A 3U58A 3I4MH 3SK8A 3M3YB 2EYFA 3KYHC 4A3BH 3M4OB 4YCVA 1A3VA 2YU9B 2EYJA 2D2CC 2D0OA 2EYHA 3HOYH 2L0CA 5ELCA 4NPSA 3S17B 2XGTA 3FMCA 3KLRA 2C9OA 5IGBA 3CD6A 2O2LD 1X54A 1SFOB 1H9SA 3S2HB 2ZXRA 1W3SA 3TEHB 2YYZA 1R9TH 1KNAA 1EEID 3HOZB 5M3FG 1XNQQ 3O13A 1KLUD 4OO1I 2F3IA 4X65Q 3NBIA 5HGTA 3L0OA 1KAWA 3I4NH 3L9AX 2PMZB 1KIXA 3ER0A 3P1HA 5L37A 1JJGA 2VZAA 4A3DH 3FKIH 3M4PA 1UUPA 4FVMA 5ELEA 3S14B 1G2SA 2OEOA 1A3TA 4FDBA 4P71A 1XMQL 1EYCA 4TKOB 4A3CH 4R4IA 1HFNA 1HR0W 1Q8KA 1ZYRD 5C4XG 5JJLA 1PLFA 3JAMi 1JB3A 1IW7D 4FNFA 3DHQA 4R8IA 2ES2A 1TT2A 4HJ5A 2OTJA 1W6KA 1E2WA 4LFBQ 1PYBA 2ZTDA 2R92B 1T5EA 4HTHA 1TWCB 1DYQA 3CCRA 2DNEA 2OWOA 3CCQA 3BVZA 2Y0SG 3J7YW 3MXGA 3OPOA 5GROA 3K6OA 2AQ3B 1CFMA 1QVCA 4DR6L 3HOWH 5IT9E 5FO8B 3ND8A 1EY7A 4KK7A 4X3TA 2YTVA 4X64L 4HIDA 4K5WA 1SYDA 2OXPA 3HZXA 2NZHA 1PTOH 2MNAA 1NE3A 3BYTB 2LXJA 4DR3L 2ZT9C 4QMGA 1NY4A 4WORA 3C3LA 5IY0A 2ASBA 3H0GG 3D3RA 5C3EB 1LT4D 1HNWQ 4K8IA 4IPDA 4OIKA 4R8NA 1K0SA 2UU9Q 2RHSB 1A3UA 1CM9A 1FNVA 2RDGA 1D5ZC 1CT1D 3I91A 4G7HC 2E2JB 2EOTA 2CWAA 2RDHA 1BCPC 2SDFA 2Q8TA 2K52A 4PV1C 3M4YA 4ZKBB 5J1ZA 2A6HC 2GN5A 2R3ZA 4UPAA 2JE6I 4IUUA 1LM0A 2JEBI 2KUMA 2BOSA 1X3GA 2WIIB 3MVVA 1R4PB 1GHJA 1BUVT 3WWVA 1CI3M 2FJ2A 2AKWB 1WFQA 2A6EC 3FPUB 3GTKH 1EU4A 3MXPA 2GA4B 2Q2IA 1D7QA 1U9RA 1HZAA 1R4QB 1PFBA 2AWOA 2K5WA 1N33L 4JI8Q 3CF5A 2B2YA 3OW7A 1J9OA 4K6DA 3S2DH 2O5JC 2CHBD 1Z7TA 5M5YB 2EYMA 1JORA 4IFDI 2CKZB 5T1GA 1JR0D 3ICEA 2JA5H 2NVTH 4AIMA 4L5TA 1N34Q 3WDNA 4LF9Q 2G9DA 2EQSA 2MPMA 2E74C 4L8JA 4NB3A 4HIOA 1G91A 3D4WA 1STHA 1SYCA 2F1MA 2HHHQ 4ABNA 3S16B 2KECA 2UXDL 1N36L 4TSSA 1MIUA 2A69C 5IP9G 5IWAL 2Q2TA 3FKIG 2EYOA 4GOPC 2HT1A 3H3VH 1I4HA 1UEBA 4PZ7A 1SROA 4A93H 3FDTA 2K33A 2LKVA 4HJ9A 4U673 1EU3A 4E6IA 1X32A 3RLOA 3BDOA 5FLXL 4F88A 5TSSA 2QF7A 4PMBA 4LF8L 1SAPA 4WFN3 5M3FB 2KQ3A 3KF8B 2Z6KC 2K5VA 3J81L 4N8FA 4OXPA 4AYBE 2PI2E 4DNTB 1EY6A 1CQVA 1DM0B 4Y7NB 2JA7B 1UE6A 1Q7YC 2BE5C 1WCMG 1B4OA 3PMFA 3I55A 1T5XD 1EL0A 4CJ2C 1I4PA 1CTMA 3ZYYX 4ZQ3A 4JI3Q 1LABA 1OXVA 4LK1C 4IO9A 4L5SA 4GZYC 3ZJYC 1XPOA 2R6GA 4DR7L 1QCBD 2IX3A 4DR4L 4RH6A 2SEBD 2Q8RE 1FJGL 2R93H 3GDEA 2Y0SB 1EY8A 1RDPD 1G51A 4R9WA 4HJAA 1NJIC 5I4DA 3J7A5 3CQZH 4DPGA 4A3GH 3IFTA 2QW7A 4V0BA 1BBXC 1NCVA 4HEDA 1X3PA 5EGTA 3BJUA 3OWEB 2PNHA 2WKCA 1AP0A 1TY0A 2BDNA 3H0GB 2SNSA 1XNRQ 3MFGA 2IWHA 2EY2A 5KRUA 1HPCA 2VQFQ 2HDLA 2MUYA 2B63G 2JN4A 1GJXA 1IBMQ 4KJNA 1EQVA 2EZVA 1GUTA 1EIGA 4QIWE 1PFSA 1Q86C 4GN5A 4IFDG 4QGUA 1WTVA 4UY8C 1I94L 5M5XB 4GKKL 3R93A 1SE8A 2WB1G 4B3MQ 5HY6A 5EAYA 1KXLA 3N6RA 1SNCA 3OMCA 1XX8A 2F0EA 3NWSA 1QNUA 3T51B 5C3WA 3STBC 2GVBA 5EBCA 1TVXA 3F8TA 4FF4A 3U4VA 1EY0A 3D6WA 3E6ZX 4YY3Q 3M4OH 2VS1A 1D8LA 2YU9H 4YIJA 5D65A 3DEOA 3I8ZA 2EJFC 4XTCS 3CXCA 4CDCC 4KHPL 1HA6A 1STAA 1PXUA 3S17H 4X62Q 1PMRA 4KI0A 4LUZA 2N55A 1HCZA 2EXDA 1VQIA 5C4ZA 4RGMA 1S72A 1QE6A 2EY5A 2OT2A 1JE5A 5D3DA 1SFOH 3KBGA 3DM3A 4G57A 5E7NA 3J81c 2HCIA 2HUGA 1Q46A 1VQCA 5I9OA 2EY1A 1XNQL 1ILQA 3HOZH 4C2MB 3MFYA 1ENFA 2MO1A 1DCZA 1MSHA 1WTOA 4C3HG 3EQLC 3Q8DA 4BBRG 4XIGS 2K5HA 3UDFA 1YIJA 1WTRA 3FKIB 3VYTA 2VQEL 4QB4A 2UXBQ 3PUVA 1B7YB 1KRTA 1NAPA 5AFWA 1J6QA 3R8BA 1CZGA 1JT8A 3IL8A 1LTID 4BY1H 2NWGA 3HFZB 1VMCA 1C0AA 4DK0A 5GAGC 4PNYA 3F2BA 4LFBL 5CV7A 1YEZA 4QF4A 2R92H 3PUZA 1TWCH 3ERQA 1C9OA 3KF6B 3W5OA 5D14A 3HP3A 2F0FA 1WCMB 1LACA 1B50A 2PPBC 4BA2I 3S24A 1IKMA 4A3KH 2QEJC 5JJZA 1RODA 1UWVA 5KGUA 1QVGA 2K5DA 4EQPA 1LTBD 3K0XA 3M4QA 1FL0A 1S5DD 4OONA 1FGBD 1GUNA 1XJVA 1SJHD 1JQYD 1UAPA 2E5LQ 5I6YA 1HNWL 1VDZA 3W3AA 4C1NK 5C3EH 3MA2B 1PYSB 3CCJA 3MAQA 2UU9L 4B3RQ 4YWMA 1HR0Q 5FO9B 1BF4A 2NUCA 1M1KC 2E2JH 2K01A 2E8GA 1HA5A 4PMCA 3NWTA 3S1NB 1S4ZA 2B2UA 4DR2Q 4S3SA 3KJOA 3G6EA 3NTHA 3SK4A 1WTWA 4KY6A 3RR5A 3TSSA 1K73C 1S5ED 2C35B 4OHJA 3LX0A 1L1OB 1SE3A 3L2PA 2B63B 1E22A 2EDGA 1TQOA 5K36G 4NP5A 2A68D 1RTNA 1SYFA 3K7AH 1VQBA 2RCFA 2ID0A 2L1BA 1TS4A 3OSOA 4XQNA 3CCLA 4JI8L 1DONA 3I4LA 3CPWA 4KMUC 3PF5A 4XDXA 2K5NA 2WB1B 3S2DB 3E9HA 3MXUA 3PUXA 4DR1Q 4LFAQ 4IZ8A 4N9PA 3VYUA 1PV4A 3K8AA 3J80c 5CR3A 1PHJA 3HKZE 2NVTB 1N34L 4ODGA 4LF9L 1F2MA 4M1UB 4QUFA 5C5MA 1JOOA 2HHHL 4JI4Q 3J7AV 5GQOA 3TP5A 1OO9B 2I5HA 3S16H 4M8AA 5JVG3 5COYA 1K3RA 1EIYB 3G71A 4FO2A 4DUYQ 3AFPA 2JK8A 4DAVA 2YV5A 5FOBB 4G7ZC 2VUMG 1F9QA 4H13C 4CBVA 4BY1G 2F0DA 1GUSA 2NN6I 3RZDB 2JEAI 1X3QA 5M3FH 1F77A 2XRSD 1TS5A 4R4TA 4C3HB 4BBRB 4AYBG 2HQEA 4RHSA 3MC0B 1Q12A 4H0LC 4C56C 4CDFC 3G4SA 1PVOA 1RIPA 5IE8A 4EQNA 4DA2A 4Y7NH 1JJCB 3K7UC 4ZK9B 3C2PA 3DXJC 3TZUA 5CV9A 3NBHB 3RLFA 4LF4Q 4JI3L 3M7NA 3CCUA 1F2YA 2MO0A 4X3KA 1VQ6A 1K83B 5C4XH 4A3KG 1D1IA 4KHVA 4A3FH 3AYHB 2F0KA 1F9RA 4RG1A 2R93B 3J7ZC 1LO5D 3CPFA 4A76A 3NE5B 1VQFA 1BVSA 2NVYH 2ZXPA 4HIMA 1SNDA 2L11A 2RVLA 3Q24A 4CKBA 3QR8A 4IPHA 4CJ0B 2AUKA 5IYBG 4O42A 4B9XA 5M5WB 1DOMA 1LTRD 3ULJA 3PUWA 2LXKA 1M90C 3PV0A 1MBYA 2QGQA 1HNZQ 2Z0SA 1XTCD 1E1OA 1Y1WH 3K80C 4HAEA 3CCEA 3NEMA 1A8VA 3JAME 1TWAB 4P73A 4AQYQ 1XNRL 2GVAA 3Q6SA 3TP6A 1DOKA 3H0GH 2EYLA 4RGOS 1VQ8A 2VQFL 4WJ4A 3NBHA 1DGSA 1AZQA 1CSPA 1KDCA 1IBML 2QA4A 4NXMQ 4IALA 2H5XA 1H9SB 3MHBA 4N9TA 3I73A 1EWCA 3D8GA 2DY7A 4TVAB 3BYYB 4B3ML 2B2TC 3PGZA 2PCFB 5M5XH 1VQ5A 5H1SE 3EBEA 1NMFA 4NDXA 1GM5A 1ESFA 1JCKB 1WTQA 1QG7A 2RHQB 4JV5Q 4YY3L 1BCPF 1SR3A 4JI2Q 3MEFA 1GUWA 4ALPA 2IW3A 3VR5A 4G4KA 1YBYA 4RCNA 2D5DA 2OQ0A 3CC7A 5BN3A 4DUZQ 2IL8A 2ALYB 4X62L 4QL5A 1VQDA 3A7AB 1CKMA 4UDUC 2NN6G 3A7LA 3CCVA 1BCPB 1HH2P 5C6AA 1YHQA 3GQBA 2A74C 3HKSA 4KHZA 5D3IB 3KLSX 1B70B 2QEXA 1N8RC 2F52A 3EROA 1FR3A 2J0TD 1VQ7A 2K6AA 3NPPA 1HXYD 3CHBD 5GAHC 3TDQA 5HURA 3GTPB 1ET6A 1YVCA 4LUVA 2JA6H 4C2MH 4DGZA 1MI2A 4P74A 4ZAIA 1MSGA 2SOBA 5IP9H 1Z9FA 2UXBL 2F0PA 3VA5A 4DV5Q 4U68A 2A6HD 1EY5A 4ULLA 2VUMB 4LF5Q 1IL8A 3T4AC 2A6ED 4BY1B 2FFKB 2PYKA 1TS3A 1B8AA 1CKNA 5FO7B 4A3EG 4UAIA 2DN8A 2M00A 4AYBB 4A3FG 3J81i 3T1YQ 2F0MA 3SDZA 1TWHB 1MJCA 3NELA 2JXMB 4DAPA 4DV6Q 4DV2Q 1H9KA 4KKTA 2F0IA 5JJIA 4C1NI 1WCMH 3BG3A 1BKBA 1BQQT 3SR1A 5CORA 3UE0A 4A3KB 4GOPB 1FNWA 2JJQA 1P8LA 1Q3LA 4J15A 4JVZA 2WKDA 2QKIC 2UUBQ 1KDAA 5FLMG 1ASZA 4L63B 3FEWX 2HCCA 2XWBB 1Y1WG 2ICIA 2E5LL 3ULPA 1PH7A 2NVQB 4B3SQ 1SJED 2F0NA 3SK6A 4DR5Q 2A69D 4LF7Q 2AMCB 1B3AA 1TY2A 4B3RL 5ELNA 3PIO3 4DAYA 1HR0L 1X9NA 2F4VL 3LNNA 3UDXA 2PI2A 4KV6A 2CQAA 2E2HB 3A8KE 3D4DA 2VY3A 4DR2L 3S1NH 4A3IG 3JC66 3I56A 2OTLA 4WJWA 5FJ8G 1LT5D 2KA7A 4KD3A 2PZWA 2BE5D 4GOPA 2B63H 1AFPA 1Y8OB 4QJFA 4K0KQ 1G2TA 3QOLA 4IOCA 4PG3A 3K7AB 3EIVA 1BBWA 5LHY1 4QIWB 2R61A 1KLGD 1HUMA 4IFDH 4P75A 2JA9A 3K57A 1IL2A 2ZJPA 4LFAL 2Z6KA 1C7YA 2XSCA 1EIFA 1IBLQ 3CRKC 3K5NA 5JPNC 4FF2A 3S1QB 2K05A 5LMNW 2DGYA 1VQ4A 4OO1G 5JEAG 5A2QL 2I5MX 3A74A 1YI2A 3HKZG 4UP9A 4NW2A 4JI4L 4RA8A 1JICA 2JA6G 3H6MA 5C0XI 1YITA 2IJ0A 3A0JA 4GNXA 5IGCA 4FYDA 5F2DA 2IY5B 3NK9A 1AZPA 4MHEA 2F0JA 2Z8LA 3FHWA 1ZXTA 1RCVD 2AUJD 3VR2A 1VMPA 3FP9A 3I90A 1EOVA 2D0PA 1YJWA 1YJNA 2NYZD 5IODA 3RZDH 3J80i 1HQMC 4P2CB 3GO5A 4X3UA 4C3HH 5KNDA 3K5OA 4BBRH 3HOUG 2LY7A 1OXTA 3BZDB 5DAUA 1VQPA 2PO4A 4TRDA 2LMCB 2UXCQ 4A4IA 1IYUA 4HMJA 3STBD 4BY7G 5K5PA 4LF4L 1EIHA 1SE2A 1IYVA 1E24A 3H3VI 1X6OA 1CK1A 1DD2A 5C4XB 5KIXA 1K83H 4A3EB 3M85A 4GNXC 5IGDA 2ATWA 4A3FB 1V1PB 1RL2A 3LGJA 3QOJA 4ZUJA 4C3JH 1EY4A 2NVYB 3F1ZA 1SMXA 3VR4A 1HUNA 1JC7A 1SMYD 2Q2HA 3SHLA 4DV7Q 1WTPA 3G7LA 1WYDA 4HSVA 1SNOA 1GOZA 3BVMA 3MXNB 1LYLA 3RD4A 5JPMC 1X65A 5M5WH 3DLLA 1PH1A 1V8QA 3NTKA 1HNZL 1CUKA 1ENAA 4JBKA 1Y1WB 3SGIA 3GTGB 3F2CA 1EQQA 4AQYL 2EVBA 5EKLA 1TWAH 1QNKA 3K58A 1EFID 3SVMA 1EUJA 4O2DA 5IIFA 2EPBA 1F9PA 4NXML 2D9UA 2UUAL 2TSSA 5DLQE 3T13A 1BOSA 2L9HA 4IJHA 1V1PA 3U9SA 1ICWA 1O78A 2EY6A 3BU2A 4CDDC 1WVLA 2PZUA 4WRDA 2AHOB 5CV6A 1Y8NB 4L6TB 5ELBA 4A3IB 4PMWA 2E76C 4LAAA 3MEHA 1JJ2A 4H02A 4JV5L 3AFQA 4JI2L 3MXNA 1UE1A 1BO0A 1LTTD 5C0XG 4POGA 5K36H 3GTJB 1K3BC 3S1RB 2R7ZG 3EA6A 4X6AH 3E5SA 2KCMA 1B1ZA 2IT1A 2EXZA 1HZCA 1TWFB 1Q90A 4DUZL 1KC8C 4QQBX 5FKAC 3V05A 1IZ6A 1PFNA 2F0TA 4FXGC 3W1GA 4EX5A 4JI5Q 2JSOA 5FLXc 3OIPA 1A0IA 3QG1A 1TXYA 3OMGA 2F3VA 4JPBW 2Z4HA 3HKZB 3S1MH 1G291 4J1MA 1WD1A 1N9WA 2PZTA 3K0YA 4GLXA 3H94A 1STEA 4IURA 3GV3A 4APVA 4X65L 2A73B 2JA6B 1SXTA 3OW2A 2HQLA 3GTPH 5LL6X 5IT9L 3PIP3 5IYDG 1YHBA 1VQGA 4DV4Q 1X56A 4DV5L 4KY5A 2K14A 4JYAQ 3CW2C 2F3WA 4N8X1 4NXNQ 3I3CA 5BN5A 4IFDJ 4NKLA 4A75A 3D4RA 1E2VA 1NUCA 3KUPA 4LF5L 4XT1B 3A5UA 1QZGA 2VUMH 1KQSA 2Z9HA 3TP7A 3GD7A 3Q0AA 2CFMA 2KVMA 3CAMA 1A6XA 5E3FA 3TS0A 4H7BA 5EJWA 3T1YL 1PH8A 1U4LA 3HOUB 1XMOQ 4C3JG 3TMEA 1WJJA 2KBNA 4OEMB 3KBXA 2NB0A 4DV6L 4ME3A 4DV2L 1TWHH 4L5RC 4YHHQ 4BY7B 2KHIA 3A5ZB 1CKOA 1MHWC 1HJPA 1FNUA 4I7AA 1ICFB 1KD1C 3HOVG 2IX0A 5CV5A 3U50C 2ZJQA 2UUBL 2BA1A 5CBEE 2RSOA 4LWCA 2B3GA 1PZID 1PA6A 3K5MA
chains in the Genus database with same CATH topology
4IOAA 3HOWH 1BVSA 2NVYH 2ZM6L 3TQYA 2K50A 4HIMA 4GKJQ 2N8NA 1E3PA 4B3SL 4DR5L 1PH4A 4LF7L 2YTVA 4X64L 4HIDA 4IPHA 2NVQH 4QY7A 2NZHA 2YTYA 3UDIA 5IYBG 2MNAA 1NE3A 2R7DA 4HIKA 2LXJA 1YNXA 4DR3L 3ULJA 1SRUA 3PUWA 4B3TQ 1WOCA 5IYBH 3RN5A 2LXKA 1M90C 1NY4A 3PV0A 1HNZQ 2QGQA 2Z0SA 1E1OA 5IY0A 1Y1WH 3K80C 3CCEA 2ASBA 3H0GG 3NEMA 1A8VA 4A3MH 1HNWQ 4IPDA 4P73A 5C4JH 4AQYQ 1XNRL 2NZOA 2GVAA 2E2HH 1N32Q 3H0GH 1VQ8A 4WJ4A 4R4QA 2VQFL 2WAQG 2N78A 2UU9Q 1UE5A 2RHSB 1DGSA 3D0FA 1CSPA 4OWTB 1IBML 4JCVE 1OTCA 3HOXH 3AQQA 1Q1BA 4BA1I 2QA4A 2CWAA 4NXMQ 2IX1A 3BZCA 2H5XA 4A3JG 1AE2A 1VS0A 2K52A 4LW1A 1GKHA 4GN3B 4K0KL 4A3JH 4TVAB 1IXRA 2GN5A 4JBMA 4UPAA 2JE6I 2WP8J 2CCZA 1LM0A 2JEBI 3BZKA 3PGZA 1X3GA 1VQ5A 5M5XH 4B3ML 3PO2G 1V9PA 2MQHA 3W1BA 3WWVA 1S3OA 3EBEA 2AKWB 1NMFA 5H1SE 3IRBA 1WFQA 5BR8Q 1GM5A 3GTKH 2CQOA 3PO2H 1IBLL 4A3LG 2RHQB 4JV5Q 1BBUA 4YY3L 1PH5A 2JA8H 1SR3A 2Q2IA 4JI2Q 1D7QA 1HZAA 2PQAA 3MEFA 4DV3Q 4ALPA 4A3LH 3S1QH 2RCNA 2AWOA 1N33L 4JI8Q 3CF5A 4LFCL 1YBYA 3VDYA 3M3YH 3S2DH 4EQ5A 5IT9c 2OQ0A 2A19A 2KHJA 3CC7A 4DUZQ 2ALYB 4X62L 4QL5A 1VQDA 2JA5G 4IFDI 1CKMA 2CKZB 1QVFA 4JI7Q 1K9MC 3U4ZA 3ICEA 4LUOA 2JA5H 2NVTH 2NN6G 5M3MH 3CCVA 4AIMA 1HH2P 2ZTCA 4L5TA 2EIFA 1YHQA 1N34Q 2BH8A 3HKSA 2EQSA 4KHZA 4LF9Q 3I7FA 4NB3A 4HIOA 2QEXA 1B70B 1N8RC 3KOJA 2F52A 2HHHQ 5LMUL 1A62A 1VQOA 2BH2A 4GN4B 1MKHA 4IPCA 1VQ7A 3JAMc 2UXDL 1N36L 4A93G 2IHFA 5GAHC 3I4OA 1MIUA 1IYJB 2K4KA 5IP9G 1YVCA 4LUVA 5IWAL 2Q2TA 3FKIG 4GOPC 4C2MH 2HT1A 2JA6H 1UEBA 4PZ7A 3H3VH 4P74A 1SROA 4A93H 4DK6C 4R4CA 1SLJA 4HJ9A 5IP9H 1AH9A 1Z9FA 1I6HH 4P72A 4OX9L 2UXBL 4DV5Q 1KL9A 3RN2A 2I5LX 3RLOA 3CCMA 3PUYA 3KLWA 4HJ8A 3ERSX 3CCSA 4LF8L 2OQKA 4RMFA 2UXCL 3KF8B 2UUCL 3CMAA 2Z6KC 5C0XJ 2K5VA 4LF5Q 5LMNQ 4UP7A 1LTLA 4DV1Q 4OXPA 4AYBE 5GAEC 2PI2E 1B8AA 1VQHA 1VQJA 3S14H 4TQUS 1CKNA 4A3EG 3CC2A 2B29A 3S2HH 4A3FG 1XMQQ 1JMCA 4BBSG 1Q82C 3T1HQ 3J81i 3T1YQ 3PO3G 1I50H 1UE6A 1Q7YC 4A3EH 3KDFB 3PF4A 1Y14B 1MJCA 1WCMG 4DV0L 4BBSH 3NELA 3I55A 5AJ3L 1S40A 3PO3H 4DV6Q 4DV2Q 5JJIA 4JI3Q 3TRZA 1WCMH 1OXVA 4IO9A 1BKBA 4L5SA 3D31A 3ZJYC 4DV7L 1XPOA 2E2IH 4JI1L 2R93G 3UE0A 4R1JA 2R6GA 2Y0SE 2JJQA 4GOPB 1P8LA 2HIXA 4J15A 4DR7L 4DR4L 3TS2A 1FJGL 2A1AA 2UUBQ 2R93H 3GDEA 5FLMG 4IJLA 1OXSC 4DR6Q 1ASZA 1YHAA 2PQAB 2ZM6Q 1Y1WG 1G51A 2E5LL 3ULPA 4HJAA 1PH7A 1NJIC 4DR5Q 4A3MG 4B3SQ 5FLMH 1K8AC 4LF7Q 3PSIA 4X64Q 3J7A5 1V43A 3CQZH 4DPGA 4JI6L 3GTGH 4A3GH 2BA0A 2AMCB 3PIOA 1GVPA 4B3RL 5ELNA 1X3EA 4DR3Q 3HOXG 1HR0L 1K8GA 1X9NA 3BJUA 1AE3A 4YWKA 2PNHA 2F4VL 3KFUA 1IBKQ 3UDXA 4DAMA 2PI2A 1Y1VG 1T9HA 1JB7A 2YTXA 2VY3A 4DR2L 3KDFA 3ULLA 2WAQE 1XNRQ 4GLAC 1VQ9A 1Y1VH 3S1NH 3RZOH 4A3IG 3OTOL 3JC66 2VQFQ 1VCIA 1VQAA 3I56A 2F4VQ 4YCWA 2OTLA 2B63G 2DUDA 4BXXG 2L15A 1HZ9A 5FJ8G 1IBMQ 3EN2A 1EQRA 4A3IH 1PH2A 3CC4A 1KHIA 2JA8G 1U0LA 4QIWE 4GOPA 2B63H 1PFSA 1Q86C 5FJ8H 4GN5A 1VQKA 4BXXH 1UE7A 4A3GG 1SN8A 3KF6A 4QJFA 4K0KQ 4IFDG 4QGUA 4PG3A 4IOCA 4UY8C 3EIVA 1BBWA 1I94L 4PZ8A 1HNXL 4GKKL 1OXXK 1SE8A 1Q1EA 2WB1G 4B3MQ 2VW9A 5HY6A 5EAYA 4JI0L 1KXLA 3GTJH 1VQLA 4P75A 1J5EL 2JA9A 3S1RH 1IL2A 3STBC 2ZJPA 2GVBA 3L7ZC 4LFAL 4UP8A 2Z6KA 3F8TA 1C7YA 1IBLQ 1EIFA 1TWFH 4JOIA 4X66L 3U4VA 1CKNB 4YY3Q 2ZTEA 4JI5L 5M3MG 5LMNW 3M4OH 2DGYA 1VQ4A 4OO1G 5JEAG 2VS1A 1D8LA 1XTDA 4DK3C 2YU9H 2I5MX 1N33Q 3A74A 1YI2A 4LFCQ 3HKZG 4UP9A 4LNQA 1NBWA 4XTCS 1FGUA 3CXCA 4JI4L 5M5YH 4PZ6A 4KHPL 3S17H 4JBJA 4X62Q 4KI0A 4LUZA 2EXDA 1GD7A 1MJEA 1VQIA 2JA6G 5C0XI 1YITA 1KRSA 1S72A 3A0JA 4KLKA 4YCUA 4GNXA 1HZBA 1JE5A 5IYCG 2UUCQ 2I0QA 4JG2A 1SFOH 2LSSA 2AWNA 3DM3A 3J81c 5E7NA 1YJ9A 4KHPQ 1PH9A 5IP7G 2IY5B 4DV4L 3HOZG 1K0RA 1Q46A 1VQCA 3PCOB 4JYAL 1U5KA 4C3IH 4POFA 5IYCH 5LMUQ 1XPRA 1XNQL 2XTIA 2JQOA 3FHWA 4NXNL 1Z47A 5IP7H 2UXDQ 1N36Q 3HOZH 1L1OA 1QUQB 3J81j 1X3FA 4WJ3M 1I5FA 4MZ9A 2MO1A 3FP9A 1CSQA 1EOVA 2D0PA 5IWAQ 1YJWA 1YJNA 3Q8DA 4BBRG 4XIGS 1EFWA 2K5HA 3UDFA 3RZDH 1YIJA 3J80i 2VQEL 4JOIC 4JC0A 3GO5A 4DNIA 4C3HH 4DAYB 4OX9Q 4BBRH 3PUVA 2UXBQ 3K81C 3HOUG 4JBWA 1B7YB 1KRTA 2CWPA 1J6QA 1OXTA 4LF8Q 1XMOL 1VQPA 1JT8A 3HOUH 2UXCQ 4A4IA 3STBD 4BY7G 4BY1H 2VQEQ 3HFZB 4YHHL 4LF4L 1C0AA 2JA7G 4GLVB 5GAGC 1E24A 3H3VI 2R92G 3UE1A 5HGQA 1X6OA 4BY7H 3F2BA 1E7ZA 4LFBL 1YEZA 4AH6A 4LF6L 1K83H 3H15A 2JA7H 3M85A 4GNXC 1EYGA 1NMGA 1TWGH 2ATWA 2R92H 3GTMH 3PUZA 1TWCH 3F2DA 5JJKA 2HIVA 1RL2A 3LGJA 1C9OA 4C3JH 4OWXB 3KF6B 3W5OA 4DV0Q 1IBKL 5AJ3Q 1A63A 2Q2UA 4GKJL 3F1ZA 1SMXA 2RF4A 4OWWB 3GTQH 1L1OC 2Q2HA 4DV7Q 4BA2I 3S24A 4JI1Q 4A3KH 1WYDA 1QUQA 3M9BA 3CMEA 1UWVA 4DR7Q 1QVGA 1VQEA 1H95A 4DR4Q 1GO3E 3K0XA 3M4QA 3MXNB 1FL0A 3TREA 1LYLA 4B3TL 1FJGQ 4OONA 1X65A 5M5WH 3DLLA 1P16A 1XJVA 1PH1A 2FXQA 3J7ZC 1HNZL 1CUKA 5C3EG 2E5LQ 1VQNA 5C44G 4JBKA 3SGIA 3F2CA 1EQQA 1HNWL 4AQYL 4JI6Q 5C3EH 1TWAH 2WFWA 5C44H 1PYSB 1L0WA 1N32L 1EUJA 3CCJA 4O2DA 4YWLA 2UU9L 4R4OA 4L5QA 4B3RQ 2ZJRA 4YWMA 1HR0Q 2IHEA 2NVXH 2MFIA 1X55A 4NXML 4GNXB 2UUAL 5DLQE 1M1KC 3UDGA 2E2JH 2E8GA 3AEVA 1E1TA 1YZ6A 2A8VA 4IJHA 2D62A 2V1CC 4DKAC 4HJ7A 4DR2Q 3KJOA 2K75A 3G6EA 3BU2A 1V1QA 3OTOQ 3RR5A 1K73C 2AHOB 4MTNA 2C35B 1W2BA 1L1OB 5GADC 3NENA 4PMWA 3L2PA 2UUAQ 3GTOH 5BR8L 1LUZA 1E22A 3B6YA 1JJ2A 5K36G 4H02A 4DR1L 4JV5L 3AFQA 3RNUA 4JI2L 2VL6A 3OYYA 1UE1A 3K7AH 2WB1E 1VQBA 3I4MG 4DV3L 2ID0A 1I94Q 1HNXQ 5C0XG 4GKKQ 4POGA 3CCLA 4JI8L 4A3BG 2R7ZG 3CPWA 1Q81C 4JI0Q 4GS3A 3U58A 3PF5A 3I4MH 2K5NA 4X6AH 1J5EQ 2KCMA 2IT1A 3E9HA 3RLNA 3PUXA 1HZCA 3KYHC 4DR1Q 4DUZL 4A3BH 4LFAQ 2R7ZH 1KC8C 4QQBX 3KJPA 1IZ6A 1OXUA 3W1GA 4X66Q 1PV4A 3K8AA 3J80c 4JI7L 4EX5A 4YCVA 3HOYG 4JI5Q 1PHJA 5FLXc 3HKZE 3G48A 2KENA 2D0OA 1A0IA 1N34L 4LF9L 1PH3A 1TXYA 3HOYH 1PH6A 2VNUD 4DUYL 4NPSA 2HHHL 2XGTA 4JI4Q 3S1MH 1G291 1PA6A 5GQOA 1FVIA 1XPUA 1N9WA 4GLXA 2I5HA 1G6PA 3CP0A 3CD6A 3S16H 2KCTA 4APVA 1K3RA 1X54A 4X65L 1EWIA 3PIPA 1EIYB 3GTPH 3OW2A 2HQLA 1L2FA 3G71A 4DUYQ 3AFPA 1NTGA 4IPGA 1W3SA 5IYDG 2JK8A 1YHBA 3TEHB 1VQGA 4DV4Q 2YYZA 1X56A 4DV5L 3I4NG 4JYAQ 2K14A 1R9TH 3CW2C 2PMZE 1I3QH 2YV5A 2N3SA 5M3FG 1XNQQ 4OO1I 5IYDH 4NXNQ 2F3IA 2VUMG 3GTLH 3E9IA 4X65Q 4A3DG 3I4NH 3L0OA 1KAWA 4IFDJ 4BY1G 4A75A 2NN6I 1KIXA 4LF5L 2JEAI 3ER0A 5LMNL 5M3FH 2R7FA 1QZHA 4DV1L 3A5UA 1ASYA 1QZGA 2VUMH 2VZAA 1JJGA 4A3DH 3FKIH 3M4PA 3E0EA 2OCEA 4R4TA 1KQSA 3GD7A 4AYBG 4Y52H 4A3CG 2CFMA 4FDBA 3CAMA 4P71A 3S15H 1Q12A 1XMQL 3TS0A 3G4SA 3T1HL 1PVOA 3T1YL 1PH8A 1RIPA 5IE8A 4A3CH 1VQMA 1XMOQ 4R4IA 4Y7NH 1O7IA 5ELOA 1WJJA 1JJCB 1HR0W 2KBNA 1Q8KA 3K7UC 5JEAJ 5C4XG 4DV6L 5JJLA 4ME3A 5J3BA 1TWHH 3NBHB 3JAMi 4YHHQ 4DV2L 3RLFA 4LF4Q 2KHIA 4JI3L 3A5ZB 1CKOA 4L5RC 1WI5A 3M7NA 1HJPA 3CCUA 2MO0A 4MNOA 2ES2A 1VQ6A 4HJ5A 5C4XH 4A3KG 2OTJA 4LFBQ 1PYBA 2ZTDA 1KD1C 3HOVG 4LF6Q 2IX0A 2N49A 4A3FH 3U50C 3CCRA 3HOWG 2OWOA 3AYHB 3CCQA 2Y0SG 2ZJQA 2UUBL 3I2ZA 2BA1A 4RG1A 5GROA 3HOVH 4LWCA 2B3GA 4O0AA 1QVCA 3CPFA 4DR6L 4A76A 1VQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOA A;  3HOW H;  1BVS A;  2NVY H;  2ZM6 L;  3TQY A;  2K50 A;  4HIM A;  4GKJ Q;  2N8N A;  1E3P A;  4B3S L;  4DR5 L;  1PH4 A;  4LF7 L;  2YTV A;  4X64 L;  4HID A;  4IPH A;  2NVQ H;  4QY7 A;  2NZH A;  2YTY A;  3UDI A;  5IYB G;  2MNA A;  1NE3 A;  2R7D A;  4HIK A;  2LXJ A;  1YNX A;  4DR3 L;  3ULJ A;  1SRU A;  3PUW A;  4B3T Q;  1WOC A;  5IYB H;  3RN5 A;  2LXK A;  1M90 C;  1NY4 A;  3PV0 A;  1HNZ Q;  2QGQ A;  2Z0S A;  1E1O A;  5IY0 A;  1Y1W H;  3K80 C;  3CCE A;  2ASB A;  3H0G G;  3NEM A;  1A8V A;  4A3M H;  1HNW Q;  4IPD A;  4P73 A;  5C4J H;  4AQY Q;  1XNR L;  2NZO A;  2GVA A;  2E2H H;  1N32 Q;  3H0G H;  1VQ8 A;  4WJ4 A;  4R4Q A;  2VQF L;  2WAQ G;  2N78 A;  2UU9 Q;  1UE5 A;  2RHS B;  1DGS A;  3D0F A;  1CSP A;  4OWT B;  1IBM L;  4JCV E;  1OTC A;  3HOX H;  3AQQ A;  1Q1B A;  4BA1 I;  2QA4 A;  2CWA A;  4NXM Q;  2IX1 A;  3BZC A;  2H5X A;  4A3J G;  1AE2 A;  1VS0 A;  2K52 A;  4LW1 A;  1GKH A;  4GN3 B;  4K0K L;  4A3J H;  4TVA B;  1IXR A;  2GN5 A;  4JBM A;  4UPA A;  2JE6 I;  2WP8 J;  2CCZ A;  1LM0 A;  2JEB I;  3BZK A;  3PGZ A;  1X3G A;  1VQ5 A;  5M5X H;  4B3M L;  3PO2 G;  1V9P A;  2MQH A;  3W1B A;  3WWV A;  1S3O A;  3EBE A;  2AKW B;  1NMF A;  5H1S E;  3IRB A;  1WFQ A;  5BR8 Q;  1GM5 A;  3GTK H;  2CQO A;  3PO2 H;  1IBL L;  4A3L G;  2RHQ B;  4JV5 Q;  1BBU A;  4YY3 L;  1PH5 A;  2JA8 H;  1SR3 A;  2Q2I A;  4JI2 Q;  1D7Q A;  1HZA A;  2PQA A;  3MEF A;  4DV3 Q;  4ALP A;  4A3L H;  3S1Q H;  2RCN A;  2AWO A;  1N33 L;  4JI8 Q;  3CF5 A;  4LFC L;  1YBY A;  3VDY A;  3M3Y H;  3S2D H;  4EQ5 A;  5IT9 c;  2OQ0 A;  2A19 A;  2KHJ A;  3CC7 A;  4DUZ Q;  2ALY B;  4X62 L;  4QL5 A;  1VQD A;  2JA5 G;  4IFD I;  1CKM A;  2CKZ B;  1QVF A;  4JI7 Q;  1K9M C;  3U4Z A;  3ICE A;  4LUO A;  2JA5 H;  2NVT H;  2NN6 G;  5M3M H;  3CCV A;  4AIM A;  1HH2 P;  2ZTC A;  4L5T A;  2EIF A;  1YHQ A;  1N34 Q;  2BH8 A;  3HKS A;  2EQS A;  4KHZ A;  4LF9 Q;  3I7F A;  4NB3 A;  4HIO A;  2QEX A;  1B70 B;  1N8R C;  3KOJ A;  2F52 A;  2HHH Q;  5LMU L;  1A62 A;  1VQO A;  2BH2 A;  4GN4 B;  1MKH A;  4IPC A;  1VQ7 A;  3JAM c;  2UXD L;  1N36 L;  4A93 G;  2IHF A;  5GAH C;  3I4O A;  1MIU A;  1IYJ B;  2K4K A;  5IP9 G;  1YVC A;  4LUV A;  5IWA L;  2Q2T A;  3FKI G;  4GOP C;  4C2M H;  2HT1 A;  2JA6 H;  1UEB A;  4PZ7 A;  3H3V H;  4P74 A;  1SRO A;  4A93 H;  4DK6 C;  4R4C A;  1SLJ A;  4HJ9 A;  5IP9 H;  1AH9 A;  1Z9F A;  1I6H H;  4P72 A;  4OX9 L;  2UXB L;  4DV5 Q;  1KL9 A;  3RN2 A;  2I5L X;  3RLO A;  3CCM A;  3PUY A;  3KLW A;  4HJ8 A;  3ERS X;  3CCS A;  4LF8 L;  2OQK A;  4RMF A;  2UXC L;  3KF8 B;  2UUC L;  3CMA A;  2Z6K C;  5C0X J;  2K5V A;  4LF5 Q;  5LMN Q;  4UP7 A;  1LTL A;  4DV1 Q;  4OXP A;  4AYB E;  5GAE C;  2PI2 E;  1B8A A;  1VQH A;  1VQJ A;  3S14 H;  4TQU S;  1CKN A;  4A3E G;  3CC2 A;  2B29 A;  3S2H H;  4A3F G;  1XMQ Q;  1JMC A;  4BBS G;  1Q82 C;  3T1H Q;  3J81 i;  3T1Y Q;  3PO3 G;  1I50 H;  1UE6 A;  1Q7Y C;  4A3E H;  3KDF B;  3PF4 A;  1Y14 B;  1MJC A;  1WCM G;  4DV0 L;  4BBS H;  3NEL A;  3I55 A;  5AJ3 L;  1S40 A;  3PO3 H;  4DV6 Q;  4DV2 Q;  5JJI A;  4JI3 Q;  3TRZ A;  1WCM H;  1OXV A;  4IO9 A;  1BKB A;  4L5S A;  3D31 A;  3ZJY C;  4DV7 L;  1XPO A;  2E2I H;  4JI1 L;  2R93 G;  3UE0 A;  4R1J A;  2R6G A;  2Y0S E;  2JJQ A;  4GOP B;  1P8L A;  2HIX A;  4J15 A;  4DR7 L;  4DR4 L;  3TS2 A;  1FJG L;  2A1A A;  2UUB Q;  2R93 H;  3GDE A;  5FLM G;  4IJL A;  1OXS C;  4DR6 Q;  1ASZ A;  1YHA A;  2PQA B;  2ZM6 Q;  1Y1W G;  1G51 A;  2E5L L;  3ULP A;  4HJA A;  1PH7 A;  1NJI C;  4DR5 Q;  4A3M G;  4B3S Q;  5FLM H;  1K8A C;  4LF7 Q;  3PSI A;  4X64 Q;  3J7A 5;  1V43 A;  3CQZ H;  4DPG A;  4JI6 L;  3GTG H;  4A3G H;  2BA0 A;  2AMC B;  3PIO A;  1GVP A;  4B3R L;  5ELN A;  1X3E A;  4DR3 Q;  3HOX G;  1HR0 L;  1K8G A;  1X9N A;  3BJU A;  1AE3 A;  4YWK A;  2PNH A;  2F4V L;  3KFU A;  1IBK Q;  3UDX A;  4DAM A;  2PI2 A;  1Y1V G;  1T9H A;  1JB7 A;  2YTX A;  2VY3 A;  4DR2 L;  3KDF A;  3ULL A;  2WAQ E;  1XNR Q;  4GLA C;  1VQ9 A;  1Y1V H;  3S1N H;  3RZO H;  4A3I G;  3OTO L;  3JC6 6;  2VQF Q;  1VCI A;  1VQA A;  3I56 A;  2F4V Q;  4YCW A;  2OTL A;  2B63 G;  2DUD A;  4BXX G;  2L15 A;  1HZ9 A;  5FJ8 G;  1IBM Q;  3EN2 A;  1EQR A;  4A3I H;  1PH2 A;  3CC4 A;  1KHI A;  2JA8 G;  1U0L A;  4QIW E;  4GOP A;  2B63 H;  1PFS A;  1Q86 C;  5FJ8 H;  4GN5 A;  1VQK A;  4BXX H;  1UE7 A;  4A3G G;  1SN8 A;  3KF6 A;  4QJF A;  4K0K Q;  4IFD G;  4QGU A;  4PG3 A;  4IOC A;  4UY8 C;  3EIV A;  1BBW A;  1I94 L;  4PZ8 A;  1HNX L;  4GKK L;  1OXX K;  1SE8 A;  1Q1E A;  2WB1 G;  4B3M Q;  2VW9 A;  5HY6 A;  5EAY A;  4JI0 L;  1KXL A;  3GTJ H;  1VQL A;  4P75 A;  1J5E L;  2JA9 A;  3S1R H;  1IL2 A;  3STB C;  2ZJP A;  2GVB A;  3L7Z C;  4LFA L;  4UP8 A;  2Z6K A;  3F8T A;  1C7Y A;  1IBL Q;  1EIF A;  1TWF H;  4JOI A;  4X66 L;  3U4V A;  1CKN B;  4YY3 Q;  2ZTE A;  4JI5 L;  5M3M G;  5LMN W;  3M4O H;  2DGY A;  1VQ4 A;  4OO1 G;  5JEA G;  2VS1 A;  1D8L A;  1XTD A;  4DK3 C;  2YU9 H;  2I5M X;  1N33 Q;  3A74 A;  1YI2 A;  4LFC Q;  3HKZ G;  4UP9 A;  4LNQ A;  1NBW A;  4XTC S;  1FGU A;  3CXC A;  4JI4 L;  5M5Y H;  4PZ6 A;  4KHP L;  3S17 H;  4JBJ A;  4X62 Q;  4KI0 A;  4LUZ A;  2EXD A;  1GD7 A;  1MJE A;  1VQI A;  2JA6 G;  5C0X I;  1YIT A;  1KRS A;  1S72 A;  3A0J A;  4KLK A;  4YCU A;  4GNX A;  1HZB A;  1JE5 A;  5IYC G;  2UUC Q;  2I0Q A;  4JG2 A;  1SFO H;  2LSS A;  2AWN A;  3DM3 A;  3J81 c;  5E7N A;  1YJ9 A;  4KHP Q;  1PH9 A;  5IP7 G;  2IY5 B;  4DV4 L;  3HOZ G;  1K0R A;  1Q46 A;  1VQC A;  3PCO B;  4JYA L;  1U5K A;  4C3I H;  4POF A;  5IYC H;  5LMU Q;  1XPR A;  1XNQ L;  2XTI A;  2JQO A;  3FHW A;  4NXN L;  1Z47 A;  5IP7 H;  2UXD Q;  1N36 Q;  3HOZ H;  1L1O A;  1QUQ B;  3J81 j;  1X3F A;  4WJ3 M;  1I5F A;  4MZ9 A;  2MO1 A;  3FP9 A;  1CSQ A;  1EOV A;  2D0P A;  5IWA Q;  1YJW A;  1YJN A;  3Q8D A;  4BBR G;  4XIG S;  1EFW A;  2K5H A;  3UDF A;  3RZD H;  1YIJ A;  3J80 i;  2VQE L;  4JOI C;  4JC0 A;  3GO5 A;  4DNI A;  4C3H H;  4DAY B;  4OX9 Q;  4BBR H;  3PUV A;  2UXB Q;  3K81 C;  3HOU G;  4JBW A;  1B7Y B;  1KRT A;  2CWP A;  1J6Q A;  1OXT A;  4LF8 Q;  1XMO L;  1VQP A;  1JT8 A;  3HOU H;  2UXC Q;  4A4I A;  3STB D;  4BY7 G;  4BY1 H;  2VQE Q;  3HFZ B;  4YHH L;  4LF4 L;  1C0A A;  2JA7 G;  4GLV B;  5GAG C;  1E24 A;  3H3V I;  2R92 G;  3UE1 A;  5HGQ A;  1X6O A;  4BY7 H;  3F2B A;  1E7Z A;  4LFB L;  1YEZ A;  4AH6 A;  4LF6 L;  1K83 H;  3H15 A;  2JA7 H;  3M85 A;  4GNX C;  1EYG A;  1NMG A;  1TWG H;  2ATW A;  2R92 H;  3GTM H;  3PUZ A;  1TWC H;  3F2D A;  5JJK A;  2HIV A;  1RL2 A;  3LGJ A;  1C9O A;  4C3J H;  4OWX B;  3KF6 B;  3W5O A;  4DV0 Q;  1IBK L;  5AJ3 Q;  1A63 A;  2Q2U A;  4GKJ L;  3F1Z A;  1SMX A;  2RF4 A;  4OWW B;  3GTQ H;  1L1O C;  2Q2H A;  4DV7 Q;  4BA2 I;  3S24 A;  4JI1 Q;  4A3K H;  1WYD A;  1QUQ A;  3M9B A;  3CME A;  1UWV A;  4DR7 Q;  1QVG A;  1VQE A;  1H95 A;  4DR4 Q;  1GO3 E;  3K0X A;  3M4Q A;  3MXN B;  1FL0 A;  3TRE A;  1LYL A;  4B3T L;  1FJG Q;  4OON A;  1X65 A;  5M5W H;  3DLL A;  1P16 A;  1XJV A;  1PH1 A;  2FXQ A;  3J7Z C;  1HNZ L;  1CUK A;  5C3E G;  2E5L Q;  1VQN A;  5C44 G;  4JBK A;  3SGI A;  3F2C A;  1EQQ A;  1HNW L;  4AQY L;  4JI6 Q;  5C3E H;  1TWA H;  2WFW A;  5C44 H;  1PYS B;  1L0W A;  1N32 L;  1EUJ A;  3CCJ A;  4O2D A;  4YWL A;  2UU9 L;  4R4O A;  4L5Q A;  4B3R Q;  2ZJR A;  4YWM A;  1HR0 Q;  2IHE A;  2NVX H;  2MFI A;  1X55 A;  4NXM L;  4GNX B;  2UUA L;  5DLQ E;  1M1K C;  3UDG A;  2E2J H;  2E8G A;  3AEV A;  1E1T A;  1YZ6 A;  2A8V A;  4IJH A;  2D62 A;  2V1C C;  4DKA C;  4HJ7 A;  4DR2 Q;  3KJO A;  2K75 A;  3G6E A;  3BU2 A;  1V1Q A;  3OTO Q;  3RR5 A;  1K73 C;  2AHO B;  4MTN A;  2C35 B;  1W2B A;  1L1O B;  5GAD C;  3NEN A;  4PMW A;  3L2P A;  2UUA Q;  3GTO H;  5BR8 L;  1LUZ A;  1E22 A;  3B6Y A;  1JJ2 A;  5K36 G;  4H02 A;  4DR1 L;  4JV5 L;  3AFQ A;  3RNU A;  4JI2 L;  2VL6 A;  3OYY A;  1UE1 A;  3K7A H;  2WB1 E;  1VQB A;  3I4M G;  4DV3 L;  2ID0 A;  1I94 Q;  1HNX Q;  5C0X G;  4GKK Q;  4POG A;  3CCL A;  4JI8 L;  4A3B G;  2R7Z G;  3CPW A;  1Q81 C;  4JI0 Q;  4GS3 A;  3U58 A;  3PF5 A;  3I4M H;  2K5N A;  4X6A H;  1J5E Q;  2KCM A;  2IT1 A;  3E9H A;  3RLN A;  3PUX A;  1HZC A;  3KYH C;  4DR1 Q;  4DUZ L;  4A3B H;  4LFA Q;  2R7Z H;  1KC8 C;  4QQB X;  3KJP A;  1IZ6 A;  1OXU A;  3W1G A;  4X66 Q;  1PV4 A;  3K8A A;  3J80 c;  4JI7 L;  4EX5 A;  4YCV A;  3HOY G;  4JI5 Q;  1PHJ A;  5FLX c;  3HKZ E;  3G48 A;  2KEN A;  2D0O A;  1A0I A;  1N34 L;  4LF9 L;  1PH3 A;  1TXY A;  3HOY H;  1PH6 A;  2VNU D;  4DUY L;  4NPS A;  2HHH L;  2XGT A;  4JI4 Q;  3S1M H;  1G29 1;  1PA6 A;  5GQO A;  1FVI A;  1XPU A;  1N9W A;  4GLX A;  2I5H A;  1G6P A;  3CP0 A;  3CD6 A;  3S16 H;  2KCT A;  4APV A;  1K3R A;  1X54 A;  4X65 L;  1EWI A;  3PIP A;  1EIY B;  3GTP H;  3OW2 A;  2HQL A;  1L2F A;  3G71 A;  4DUY Q;  3AFP A;  1NTG A;  4IPG A;  1W3S A;  5IYD G;  2JK8 A;  1YHB A;  3TEH B;  1VQG A;  4DV4 Q;  2YYZ A;  1X56 A;  4DV5 L;  3I4N G;  4JYA Q;  2K14 A;  1R9T H;  3CW2 C;  2PMZ E;  1I3Q H;  2YV5 A;  2N3S A;  5M3F G;  1XNQ Q;  4OO1 I;  5IYD H;  4NXN Q;  2F3I A;  2VUM G;  3GTL H;  3E9I A;  4X65 Q;  4A3D G;  3I4N H;  3L0O A;  1KAW A;  4IFD J;  4BY1 G;  4A75 A;  2NN6 I;  1KIX A;  4LF5 L;  2JEA I;  3ER0 A;  5LMN L;  5M3F H;  2R7F A;  1QZH A;  4DV1 L;  3A5U A;  1ASY A;  1QZG A;  2VUM H;  2VZA A;  1JJG A;  4A3D H;  3FKI H;  3M4P A;  3E0E A;  2OCE A;  4R4T A;  1KQS A;  3GD7 A;  4AYB G;  4Y52 H;  4A3C G;  2CFM A;  4FDB A;  3CAM A;  4P71 A;  3S15 H;  1Q12 A;  1XMQ L;  3TS0 A;  3G4S A;  3T1H L;  1PVO A;  3T1Y L;  1PH8 A;  1RIP A;  5IE8 A;  4A3C H;  1VQM A;  1XMO Q;  4R4I A;  4Y7N H;  1O7I A;  5ELO A;  1WJJ A;  1JJC B;  1HR0 W;  2KBN A;  1Q8K A;  3K7U C;  5JEA J;  5C4X G;  4DV6 L;  5JJL A;  4ME3 A;  5J3B A;  1TWH H;  3NBH B;  3JAM i;  4YHH Q;  4DV2 L;  3RLF A;  4LF4 Q;  2KHI A;  4JI3 L;  3A5Z B;  1CKO A;  4L5R C;  1WI5 A;  3M7N A;  1HJP A;  3CCU A;  2MO0 A;  4MNO A;  2ES2 A;  1VQ6 A;  4HJ5 A;  5C4X H;  4A3K G;  2OTJ A;  4LFB Q;  1PYB A;  2ZTD A;  1KD1 C;  3HOV G;  4LF6 Q;  2IX0 A;  2N49 A;  4A3F H;  3U50 C;  3CCR A;  3HOW G;  2OWO A;  3AYH B;  3CCQ A;  2Y0S G;  2ZJQ A;  2UUB L;  3I2Z A;  2BA1 A;  4RG1 A;  5GRO A;  3HOV H;  4LWC A;  2B3G A;  4O0A A;  1QVC A;  3CPF A;  4DR6 L;  4A76 A;  1VQF A; 
#chains in the Genus database with same CATH topology
 4IOA A;  5CYU A;  3GTQ B;  2K50 A;  1WTH A;  4B3S L;  4DR5 L;  1PDQ A;  5E4W C;  4LF7 L;  5A35 A;  2O4X A;  2NVQ H;  1B9N A;  4RKL A;  1GUO A;  4QY7 A;  3UDI A;  4HIK A;  3K5L A;  5T1I A;  3SE0 A;  5IYB H;  5C3X A;  1I6V C;  1CQF A;  1O7L A;  3F2U A;  3BDL A;  2FMM A;  1NR2 A;  5CV4 A;  3SXH A;  4OEL B;  5C4J H;  2E2H H;  2N78 A;  1JWM D;  2NVX B;  1UE5 A;  1SNP A;  3D0F A;  4OWT B;  1OTC A;  2KCN A;  3AQQ A;  4A3J G;  2B39 A;  4CHT B;  1LV9 A;  1AE2 A;  1VS0 A;  1GKH A;  1YNN C;  2SNM A;  1I4G A;  4K0K L;  3OOC A;  1IXR A;  2WP8 J;  1QIL A;  3PO2 G;  1PRT C;  3MWY W;  1V9P A;  2MQH A;  5G3L F;  5ELD A;  1S3O A;  3IRB A;  3EFX D;  1ML0 D;  2CQO A;  3LWE A;  1IBL L;  4A3L G;  1D5M C;  5DM6 3;  1PH5 A;  2F0S A;  2PQA A;  5FK9 C;  3S1Q H;  2RCN A;  2L5T A;  1K28 A;  4XT3 B;  3VDY A;  4BS9 A;  4RGT A;  2XNA C;  2L4N A;  4K14 A;  5IT9 c;  2R7Z B;  2CVR A;  2KHJ A;  1ENC A;  4HCE A;  2K32 A;  2QIL A;  1QVF A;  4JI7 Q;  3DWA A;  3U4Z A;  4IUN A;  1WTX A;  5I2X A;  5M3M H;  2ZTC A;  2EIF A;  4DXG A;  3I7F A;  1S5F D;  2NN6 H;  1KDB A;  2MGS A;  1A62 A;  1TR5 A;  2BH2 A;  1MKH A;  4IPC A;  3C1F A;  1W6J A;  3A8J E;  1IHZ A;  1CA5 A;  4ZYS A;  4RFB A;  3T16 A;  2B2V A;  2Z1C A;  5KYL A;  1I6H H;  3RN2 A;  1CHQ D;  2I5L X;  3GTL B;  2AQ1 B;  3H91 A;  2UXC L;  1PTO C;  3QB3 A;  2MHV A;  3OIQ A;  4K6L A;  5LMN Q;  3BDC A;  4HCS A;  1F2L A;  4DV1 Q;  5GAE C;  3EVQ A;  3S15 B;  1VQH A;  2F4I A;  3CC2 A;  1KAB A;  2B29 A;  1O7Y A;  3CU7 A;  4HN7 A;  4BBS G;  1Q82 C;  3T1H Q;  3PQI A;  3PO3 G;  3P75 A;  4A3E H;  5EPJ A;  3PF4 A;  5IGG A;  1Y14 B;  4C3J B;  1STB A;  3AU7 A;  4IUV A;  3TRZ A;  3D31 A;  5IGF A;  4DV7 L;  2B2T A;  2CH4 A;  2OF1 A;  1FD7 D;  4Q0F A;  3NHH A;  3HOV B;  1ZEQ X;  2B2V C;  2A1A A;  2C5C A;  4IJL A;  1OXS C;  3TP8 A;  1GUG A;  3AB9 A;  2ZM6 Q;  1MD2 D;  3H09 A;  5FLM H;  1K8A C;  1ZKO A;  3I72 A;  1V43 A;  2EE1 A;  3GTG H;  5KEE A;  1L0X B;  4DNR B;  1SNQ A;  3PIO A;  1X3E A;  1QOH A;  1K8G A;  2O5I C;  3J81 E;  1AE3 A;  4YWK A;  2KJX A;  2XIW A;  1JOQ A;  4RHR A;  1Y1V G;  2RDF A;  2N88 A;  1JB7 A;  2DNC A;  1KTK A;  2YTX A;  2WAQ E;  4GLA C;  2L55 A;  4KN4 C;  2F0W A;  1NSN S;  4YCW A;  4BXX G;  2DUD A;  2L15 A;  3EN2 A;  4ZCK A;  2HDM A;  4A3I H;  3CC4 A;  1XYI A;  1KHI A;  1SSO A;  2PW5 A;  4A3J B;  1SYE A;  5FJ8 H;  2VXW A;  5CGK A;  4PZ8 A;  1ILP A;  1Q1E A;  2VW9 A;  1DOL A;  2F0G A;  3GTJ H;  3H3V C;  3C46 A;  3S1R H;  3PO2 B;  1MGS A;  1TWF H;  2A5H A;  4JOI A;  4OL7 A;  1B44 D;  1CKN B;  5IOC A;  4JI5 L;  4IN3 A;  5M3M G;  1XTD A;  2XN9 C;  4LFC Q;  1NBW A;  4XYO A;  4OO1 H;  5JEA H;  3VR6 A;  4PZ6 A;  4ME5 A;  3S1M B;  4JBJ A;  1LT6 D;  4G7O C;  1MJE A;  4YCU A;  1H9R A;  5NUC A;  4QUC A;  1HZB A;  4C3I G;  5IYC G;  2UUC Q;  2I0Q A;  4JG2 A;  1IKL A;  2LSS A;  1YJ9 A;  1BCP D;  4KHP Q;  5IP7 G;  2B2W C;  3DM1 A;  4DV4 L;  5M9O A;  3PCO B;  4JYA L;  1U5K A;  3OHX C;  1I4Q A;  5LMU Q;  1XPR A;  2FMC A;  2MJ8 A;  2XTI A;  4NXN L;  1Z47 A;  3TBI B;  3I70 A;  1X3F A;  4WJ3 M;  1YNJ C;  1S5B D;  3VA7 A;  2V4D A;  3P7J A;  5IGE A;  4JOI C;  2LS0 1;  5E1F A;  3VR3 A;  4OX9 Q;  4DAY B;  3K81 C;  1CHP D;  2CWP A;  2IPK D;  1XMO L;  1B53 A;  1HHV A;  4J6H A;  3HOU H;  1Q8I A;  5KYI A;  4JW0 A;  1O7Z A;  2VQE Q;  4YHH L;  1J8I A;  2JA7 G;  1TU2 B;  4GLV B;  3UE1 A;  4BY7 H;  3TN2 A;  3HRZ C;  1I50 B;  2K7V A;  1TWG H;  3NTI A;  2CW0 C;  2F0L A;  4ZUI A;  4BBS B;  4KN7 C;  3PO3 B;  5JJK A;  4DV0 Q;  5CBA E;  5AJ3 Q;  2Q2U A;  4BWG B;  3A54 A;  1PYW D;  4RWS C;  2E2I B;  1CA6 A;  3GTQ H;  1SYB A;  4JI1 Q;  2MP1 A;  4O1N A;  4RGN A;  3J80 E;  4UHV A;  4RKB A;  4JK1 C;  3CME A;  1KAA A;  3FPP A;  2KCC A;  3RUZ A;  4B08 A;  1P16 A;  2FXQ A;  4EVO A;  1BDO A;  3TZD A;  1VQN A;  5C44 G;  1C4Q A;  1XXG A;  4OGQ C;  1G6Z A;  4IUP A;  5EQ0 A;  5C4J B;  2K1B A;  4JI6 Q;  4KKS A;  2WIN B;  2WFW A;  1L0W A;  1B9M A;  2IHE A;  2NVX H;  3T56 B;  2EYP A;  4GNX B;  3UDG A;  3ND9 A;  3AEV A;  1E1T A;  1NR4 A;  4DKA C;  2LFN A;  1Y1V B;  3RZO B;  1O80 A;  4F8M A;  4I65 A;  2K75 A;  5J39 A;  5EPK A;  3OTO Q;  2NZ1 D;  2M9V A;  1EWH A;  1W2B A;  5GAD C;  3DEP A;  1LUZ A;  2ICE C;  3B6Y A;  4HMI A;  4DR1 L;  3RNU A;  2VL6 A;  3OYY A;  3I4M G;  4DXF A;  1K8O A;  1HNX Q;  3QWN A;  4A3B G;  5BN4 A;  2I46 A;  1Q81 C;  4JI0 Q;  3U9O A;  3MZ5 A;  4GS3 A;  3IFD A;  3OWF A;  1J5E Q;  5C0X H;  1I4R A;  3RLN A;  1G8Z D;  1ZYR C;  3L3O C;  3N52 A;  3RMH A;  2R7Z H;  4X3S A;  2B8G A;  1LTG D;  1IW7 C;  3KJP A;  1OXU A;  4X66 Q;  3MTS A;  4JI7 L;  3HOY G;  1ET9 A;  4MTK A;  2WAC A;  4F87 A;  3G48 A;  2KEN A;  5M3M B;  1PH3 A;  5ELF A;  1D1K A;  2KED A;  1PH6 A;  4FF1 A;  2VNU D;  4DUY L;  5I2Y A;  1RTO A;  1FVI A;  1XPU A;  1SDF A;  4KTA A;  4Z9C B;  3T53 B;  3CP0 A;  3NXW A;  1G6P A;  1H9J A;  2KCT A;  1EWI A;  3PIP A;  1NNX A;  1L2F A;  3NQT A;  1NTG A;  4IPG A;  4C3I B;  1I6H B;  3I4N G;  3A55 A;  1HRJ A;  2PNR C;  2PMZ E;  1BXT A;  1I3Q H;  2N3S A;  5IYD H;  3GTL H;  1GHK A;  3E9I A;  4IUT A;  4EGV A;  4A3D G;  1B2T A;  5LMN L;  1QZH A;  2R7F A;  4DV1 L;  1ASY A;  4FXK C;  3A8I E;  2K28 A;  2OCE A;  3E0E A;  4Y52 H;  4A3C G;  3S15 H;  2TMP A;  3JAM L;  2WV6 D;  1ESR A;  3T1H L;  2B2Y C;  1C8C A;  3A56 A;  1VQM A;  5E4X A;  1O7I A;  5ELO A;  3ITP A;  4H44 C;  5JEA J;  1HTP A;  3DWP A;  5J3B A;  1Y69 U;  4ID6 A;  1BR9 A;  1F9S A;  3CKI B;  1WI5 A;  2CH4 W;  4MNO A;  5EKK A;  3GTM B;  4LF6 Q;  2N49 A;  5KNB A;  3HOW G;  4F7X A;  2G5D A;  3I2Z A;  3HOV H;  4QCL A;  1JWS D;  4O0A A;  1IBK Q;  2ZM6 L;  3TQY A;  4GKJ Q;  2XWJ B;  2N8N A;  1E3P A;  1PH4 A;  1SE4 A;  2Z6B A;  3NUC A;  1C48 A;  1TS2 A;  3GV6 A;  1U4R A;  2HD3 A;  4DN4 M;  1EY9 A;  2YTY A;  3CRL C;  2R7D A;  4ZRZ A;  1YNX A;  1LLR D;  1SRU A;  4B3T Q;  2L12 A;  1WOC A;  3RN5 A;  2EJM A;  2NTS A;  4B9W A;  3KF8 A;  4A3M H;  5C44 B;  2NZO A;  1UEA B;  3IAY A;  1N32 Q;  4R4Q A;  2WAQ G;  3NQI A;  4LJZ C;  2X6G A;  5I9P A;  1SYG A;  1UNS A;  4JCV E;  3HOX H;  4BA1 I;  1Q1B A;  3LWU A;  3VYS A;  2IX1 A;  3BZC A;  1PZK D;  4LW1 A;  2NTT A;  1KNE A;  4GN3 B;  4A3J H;  4JBM A;  2I07 B;  2CCZ A;  2F0U A;  3BZK A;  5JAV A;  3GTO B;  4V19 0;  3W1B A;  3V2T A;  5BR8 Q;  2Q8I B;  4KY7 A;  3PO2 H;  2PQE A;  5C5L A;  3K59 A;  2F0H A;  2J7Z A;  1BBU A;  4IUQ A;  2JA8 H;  3KK7 A;  2RA4 A;  1STY A;  2DJG C;  4DV3 Q;  4A3L H;  3HG9 A;  2K03 A;  3E3X A;  3I4M B;  4IQZ A;  2FIN B;  4ILW A;  4LFC L;  3SK5 A;  3M3Y H;  4A3B B;  4KD4 A;  2RBM A;  4EQ5 A;  2VB2 X;  2A19 A;  1PRT F;  1M8A A;  2JA5 G;  3D6C A;  2F0V A;  4KKU A;  4XYQ A;  1HFG A;  3KLS A;  1K9M C;  4LUO A;  1TII D;  3HOY B;  2UUC L;  2XVS A;  2BH8 A;  4DF7 A;  3KOJ A;  3QO2 A;  2K04 A;  5LMU L;  1VQO A;  4GN4 B;  1SMY C;  3JAM c;  4A93 G;  2IHF A;  1PRT B;  3W2D A;  3I4O A;  1IYJ B;  2JYO A;  4CKE A;  1QWY A;  2K4K A;  1SBB B;  1PZJ D;  5ISR A;  3S2H H;  4PQX A;  3NP8 A;  5I6W A;  1RKN A;  1A2T A;  4DK6 C;  4R4C A;  1JOK A;  1SLJ A;  1YNN D;  3FRP B;  1RD9 D;  1R9T B;  2E2D C;  4FP5 D;  3J80 L;  4P72 A;  4OX9 L;  1SEB D;  3E0J A;  1AH9 A;  1KL9 A;  3CCM A;  3PUY A;  5CC4 A;  5DM7 3;  3KLW A;  3I4N B;  1JE4 A;  4HJ8 A;  3ERS X;  3CCS A;  1PRT D;  2X6L A;  4FXD A;  2K5Q A;  2OQK A;  4RMF A;  3CMA A;  4A3D B;  5C0X J;  1VF5 C;  4UP7 A;  1LTL A;  1EEF D;  1VQJ A;  3S14 H;  4TQU S;  1K8M A;  1E2Z A;  1XMQ Q;  1JMC A;  1HQR D;  1TKW B;  1I50 H;  2RSN A;  1TWG B;  2QDL A;  1D5X C;  3KDF B;  4DV0 L;  4BBS H;  5AJ3 L;  1S40 A;  3PO3 H;  1RJT A;  1DJR D;  3BVG A;  1PFM A;  1D6E C;  3EJI A;  1PTO F;  2E2I H;  2BCO A;  4JI1 L;  2R93 G;  1QB5 D;  2DJF C;  4R1J A;  2Y0S E;  2HIX A;  3DMU A;  1U4M A;  3TS2 A;  3R2T A;  3HOW B;  1HTL D;  1GXD C;  3HEJ A;  2F03 A;  4DR6 Q;  1B3Q A;  1YHA A;  2PQA B;  1DZ1 A;  3J7A F;  4A3G G;  4Q5V A;  4DFA A;  4HR7 B;  4A3M G;  3PSI A;  4X64 Q;  1A15 A;  1PTO B;  4JI6 L;  2BA0 A;  3AMU A;  1GVP A;  4OIJ A;  1BNZ A;  1STN A;  4DR3 Q;  3HOX G;  2KEE A;  4K2K A;  3S9W A;  2XRQ D;  2H1E A;  3KFU A;  2VB3 X;  3NSW A;  4DAM A;  2H4O A;  1T9H A;  1PTO D;  3R2I A;  3QIA A;  1EQT A;  3KDF A;  3ULL A;  1VQ9 A;  1Y1V H;  3RZO H;  3OTO L;  3X3M A;  1VCI A;  1VQA A;  4EQO A;  5DEH A;  2F4V Q;  3IKJ A;  2G9H D;  2WAQ B;  1H9M A;  1HZ9 A;  1II3 A;  4J8Q A;  3ONA B;  1EQR A;  1PH2 A;  2JA8 G;  1U0L A;  4BXX H;  1VQK A;  3M7G A;  1UE7 A;  1SN8 A;  3KF6 A;  4FF3 A;  1DXM A;  1HNX L;  2B8F A;  4K5X A;  1OXX K;  4JI0 L;  5CMD A;  1VQL A;  4ZLT F;  1J5E L;  3GTK B;  4RCO A;  3L7Z C;  4UP8 A;  4X66 L;  1F2Z A;  4CJ1 B;  3BS1 A;  1CZW A;  2RQX A;  2ZTE A;  4XQQ A;  1LT3 D;  4LMQ D;  4DK3 C;  1N33 Q;  4KJO A;  1EZ6 A;  4LNQ A;  2M2L A;  3GP7 A;  1FGU A;  5M5Y H;  2X69 A;  3Q23 A;  5C4H A;  3DWQ A;  4CGY B;  2FHT A;  5G3L D;  1GD7 A;  2JA5 B;  1SNM A;  1KRS A;  4KLK A;  4I7Z C;  3UI2 A;  2B2U C;  2AWN A;  1WD0 A;  1PH9 A;  3HOZ G;  1K0R A;  2ZXO A;  4C3I H;  4POF A;  5IYC H;  5CV8 A;  1I3Q B;  2JQO A;  5IP7 H;  2UXD Q;  1N36 Q;  1L1O A;  1QUQ B;  3J81 j;  1I5F A;  4MZ9 A;  4A93 B;  4DK1 A;  1CSQ A;  1S5C D;  4XQJ A;  5IWA Q;  1EFW A;  1A2U A;  4MIU A;  3P20 A;  2KOL A;  4JC0 A;  2E75 C;  4K5V A;  4DNI A;  4JBW A;  5JVH 3;  2F0O A;  3C1E A;  4LF8 Q;  1RF2 D;  3WOF A;  5EKI A;  1ONL A;  5A2Q E;  2QDB A;  4DU9 A;  1M4V A;  4NMZ A;  2R92 G;  5HGQ A;  1U4P A;  1Y8P B;  1E7Z A;  3R3O A;  1RHP A;  2NBF A;  3HS0 C;  1AEX A;  5JOB A;  4AH6 A;  4LF6 L;  3H15 A;  2JA7 H;  1EYG A;  5J22 A;  1NMG A;  2P5Z X;  4MN3 A;  3DUZ A;  3GTM H;  3F2D A;  4XXE A;  2HIV A;  2A68 C;  1A63 A;  1JWU D;  4OWX B;  1IBK L;  5DNF A;  4GKJ L;  1L0Y B;  2RF4 A;  2Z4I A;  4HSP A;  4OWW B;  1L1O C;  4CDE C;  2RKS A;  3WOE A;  1QUQ A;  3M9B A;  4K2L A;  4DR7 Q;  1QJO A;  5FLX E;  1VQE A;  1H95 A;  4DR4 Q;  1GO3 E;  1EYD A;  3TRE A;  1FJG Q;  4B3T L;  3X3N A;  3URY A;  5C3E G;  2F0Q A;  3G6J B;  1E0B A;  3CQZ B;  1YNJ D;  4CKC A;  4A3G B;  3V96 A;  4A3M B;  2J4X A;  5LL6 S;  1D2B A;  1VF7 A;  5C44 H;  1N32 L;  4YWL A;  1EOT A;  4R4O A;  1AN8 A;  4L5Q A;  2ZJR A;  2DY8 A;  2BDO A;  2EJG C;  1X55 A;  2MFI A;  3HOX B;  3FVQ A;  2QCP X;  1YZ6 A;  2A8V A;  1EYA A;  2D62 A;  2V1C C;  4HJ7 A;  1LTA D;  4RAU C;  1AW7 A;  2B2W A;  1STG A;  1V1O A;  1V1Q A;  5EBD A;  2PW7 A;  1FYC A;  1XWE A;  4MTN A;  3SEB A;  3NEN A;  2UUA Q;  5KNC A;  3GTO H;  5EPL A;  1I4X A;  1LTS D;  2AQ2 B;  4K8J A;  5BR8 L;  2ENB A;  4ZKC B;  2CW0 D;  3Q22 A;  3HGB A;  1Z6H A;  2JA8 B;  2KHS A;  2WB1 E;  3VYR A;  4DV3 L;  3QJY A;  1I94 Q;  4GKK Q;  1EZ8 A;  2JP1 A;  3U58 A;  3I4M H;  3SK8 A;  3M3Y B;  2EYF A;  3KYH C;  4A3B H;  3M4O B;  4YCV A;  1A3V A;  2YU9 B;  2EYJ A;  2D2C C;  2D0O A;  2EYH A;  3HOY H;  2L0C A;  5ELC A;  4NPS A;  3S17 B;  2XGT A;  3FMC A;  3KLR A;  2C9O A;  5IGB A;  3CD6 A;  2O2L D;  1X54 A;  1SFO B;  1H9S A;  3S2H B;  2ZXR A;  1W3S A;  3TEH B;  2YYZ A;  1R9T H;  1KNA A;  1EEI D;  3HOZ B;  5M3F G;  1XNQ Q;  3O13 A;  1KLU D;  4OO1 I;  2F3I A;  4X65 Q;  3NBI A;  5HGT A;  3L0O A;  1KAW A;  3I4N H;  3L9A X;  2PMZ B;  1KIX A;  3ER0 A;  3P1H A;  5L37 A;  1JJG A;  2VZA A;  4A3D H;  3FKI H;  3M4P A;  1UUP A;  4FVM A;  5ELE A;  3S14 B;  1G2S A;  2OEO A;  1A3T A;  4FDB A;  4P71 A;  1XMQ L;  1EYC A;  4TKO B;  4A3C H;  4R4I A;  1HFN A;  1HR0 W;  1Q8K A;  1ZYR D;  5C4X G;  5JJL A;  1PLF A;  3JAM i;  1JB3 A;  1IW7 D;  4FNF A;  3DHQ A;  4R8I A;  2ES2 A;  1TT2 A;  4HJ5 A;  2OTJ A;  1W6K A;  1E2W A;  4LFB Q;  1PYB A;  2ZTD A;  2R92 B;  1T5E A;  4HTH A;  1TWC B;  1DYQ A;  3CCR A;  2DNE A;  2OWO A;  3CCQ A;  3BVZ A;  2Y0S G;  3J7Y W;  3MXG A;  3OPO A;  5GRO A;  3K6O A;  2AQ3 B;  1CFM A;  1QVC A;  4DR6 L;  3HOW H;  5IT9 E;  5FO8 B;  3ND8 A;  1EY7 A;  4KK7 A;  4X3T A;  2YTV A;  4X64 L;  4HID A;  4K5W A;  1SYD A;  2OXP A;  3HZX A;  2NZH A;  1PTO H;  2MNA A;  1NE3 A;  3BYT B;  2LXJ A;  4DR3 L;  2ZT9 C;  4QMG A;  1NY4 A;  4WOR A;  3C3L A;  5IY0 A;  2ASB A;  3H0G G;  3D3R A;  5C3E B;  1LT4 D;  1HNW Q;  4K8I A;  4IPD A;  4OIK A;  4R8N A;  1K0S A;  2UU9 Q;  2RHS B;  1A3U A;  1CM9 A;  1FNV A;  2RDG A;  1D5Z C;  1CT1 D;  3I91 A;  4G7H C;  2E2J B;  2EOT A;  2CWA A;  2RDH A;  1BCP C;  2SDF A;  2Q8T A;  2K52 A;  4PV1 C;  3M4Y A;  4ZKB B;  5J1Z A;  2A6H C;  2GN5 A;  2R3Z A;  4UPA A;  2JE6 I;  4IUU A;  1LM0 A;  2JEB I;  2KUM A;  2BOS A;  1X3G A;  2WII B;  3MVV A;  1R4P B;  1GHJ A;  1BUV T;  3WWV A;  1CI3 M;  2FJ2 A;  2AKW B;  1WFQ A;  2A6E C;  3FPU B;  3GTK H;  1EU4 A;  3MXP A;  2GA4 B;  2Q2I A;  1D7Q A;  1U9R A;  1HZA A;  1R4Q B;  1PFB A;  2AWO A;  2K5W A;  1N33 L;  4JI8 Q;  3CF5 A;  2B2Y A;  3OW7 A;  1J9O A;  4K6D A;  3S2D H;  2O5J C;  2CHB D;  1Z7T A;  5M5Y B;  2EYM A;  1JOR A;  4IFD I;  2CKZ B;  5T1G A;  1JR0 D;  3ICE A;  2JA5 H;  2NVT H;  4AIM A;  4L5T A;  1N34 Q;  3WDN A;  4LF9 Q;  2G9D A;  2EQS A;  2MPM A;  2E74 C;  4L8J A;  4NB3 A;  4HIO A;  1G91 A;  3D4W A;  1STH A;  1SYC A;  2F1M A;  2HHH Q;  4ABN A;  3S16 B;  2KEC A;  2UXD L;  1N36 L;  4TSS A;  1MIU A;  2A69 C;  5IP9 G;  5IWA L;  2Q2T A;  3FKI G;  2EYO A;  4GOP C;  2HT1 A;  3H3V H;  1I4H A;  1UEB A;  4PZ7 A;  1SRO A;  4A93 H;  3FDT A;  2K33 A;  2LKV A;  4HJ9 A;  4U67 3;  1EU3 A;  4E6I A;  1X32 A;  3RLO A;  3BDO A;  5FLX L;  4F88 A;  5TSS A;  2QF7 A;  4PMB A;  4LF8 L;  1SAP A;  4WFN 3;  5M3F B;  2KQ3 A;  3KF8 B;  2Z6K C;  2K5V A;  3J81 L;  4N8F A;  4OXP A;  4AYB E;  2PI2 E;  4DNT B;  1EY6 A;  1CQV A;  1DM0 B;  4Y7N B;  2JA7 B;  1UE6 A;  1Q7Y C;  2BE5 C;  1WCM G;  1B4O A;  3PMF A;  3I55 A;  1T5X D;  1EL0 A;  4CJ2 C;  1I4P A;  1CTM A;  3ZYY X;  4ZQ3 A;  4JI3 Q;  1LAB A;  1OXV A;  4LK1 C;  4IO9 A;  4L5S A;  4GZY C;  3ZJY C;  1XPO A;  2R6G A;  4DR7 L;  1QCB D;  2IX3 A;  4DR4 L;  4RH6 A;  2SEB D;  2Q8R E;  1FJG L;  2R93 H;  3GDE A;  2Y0S B;  1EY8 A;  1RDP D;  1G51 A;  4R9W A;  4HJA A;  1NJI C;  5I4D A;  3J7A 5;  3CQZ H;  4DPG A;  4A3G H;  3IFT A;  2QW7 A;  4V0B A;  1BBX C;  1NCV A;  4HED A;  1X3P A;  5EGT A;  3BJU A;  3OWE B;  2PNH A;  2WKC A;  1AP0 A;  1TY0 A;  2BDN A;  3H0G B;  2SNS A;  1XNR Q;  3MFG A;  2IWH A;  2EY2 A;  5KRU A;  1HPC A;  2VQF Q;  2HDL A;  2MUY A;  2B63 G;  2JN4 A;  1GJX A;  1IBM Q;  4KJN A;  1EQV A;  2EZV A;  1GUT A;  1EIG A;  4QIW E;  1PFS A;  1Q86 C;  4GN5 A;  4IFD G;  4QGU A;  1WTV A;  4UY8 C;  1I94 L;  5M5X B;  4GKK L;  3R93 A;  1SE8 A;  2WB1 G;  4B3M Q;  5HY6 A;  5EAY A;  1KXL A;  3N6R A;  1SNC A;  3OMC A;  1XX8 A;  2F0E A;  3NWS A;  1QNU A;  3T51 B;  5C3W A;  3STB C;  2GVB A;  5EBC A;  1TVX A;  3F8T A;  4FF4 A;  3U4V A;  1EY0 A;  3D6W A;  3E6Z X;  4YY3 Q;  3M4O H;  2VS1 A;  1D8L A;  2YU9 H;  4YIJ A;  5D65 A;  3DEO A;  3I8Z A;  2EJF C;  4XTC S;  3CXC A;  4CDC C;  4KHP L;  1HA6 A;  1STA A;  1PXU A;  3S17 H;  4X62 Q;  1PMR A;  4KI0 A;  4LUZ A;  2N55 A;  1HCZ A;  2EXD A;  1VQI A;  5C4Z A;  4RGM A;  1S72 A;  1QE6 A;  2EY5 A;  2OT2 A;  1JE5 A;  5D3D A;  1SFO H;  3KBG A;  3DM3 A;  4G57 A;  5E7N A;  3J81 c;  2HCI A;  2HUG A;  1Q46 A;  1VQC A;  5I9O A;  2EY1 A;  1XNQ L;  1ILQ A;  3HOZ H;  4C2M B;  3MFY A;  1ENF A;  2MO1 A;  1DCZ A;  1MSH A;  1WTO A;  4C3H G;  3EQL C;  3Q8D A;  4BBR G;  4XIG S;  2K5H A;  3UDF A;  1YIJ A;  1WTR A;  3FKI B;  3VYT A;  2VQE L;  4QB4 A;  2UXB Q;  3PUV A;  1B7Y B;  1KRT A;  1NAP A;  5AFW A;  1J6Q A;  3R8B A;  1CZG A;  1JT8 A;  3IL8 A;  1LTI D;  4BY1 H;  2NWG A;  3HFZ B;  1VMC A;  1C0A A;  4DK0 A;  5GAG C;  4PNY A;  3F2B A;  4LFB L;  5CV7 A;  1YEZ A;  4QF4 A;  2R92 H;  3PUZ A;  1TWC H;  3ERQ A;  1C9O A;  3KF6 B;  3W5O A;  5D14 A;  3HP3 A;  2F0F A;  1WCM B;  1LAC A;  1B50 A;  2PPB C;  4BA2 I;  3S24 A;  1IKM A;  4A3K H;  2QEJ C;  5JJZ A;  1ROD A;  1UWV A;  5KGU A;  1QVG A;  2K5D A;  4EQP A;  1LTB D;  3K0X A;  3M4Q A;  1FL0 A;  1S5D D;  4OON A;  1FGB D;  1GUN A;  1XJV A;  1SJH D;  1JQY D;  1UAP A;  2E5L Q;  5I6Y A;  1HNW L;  1VDZ A;  3W3A A;  4C1N K;  5C3E H;  3MA2 B;  1PYS B;  3CCJ A;  3MAQ A;  2UU9 L;  4B3R Q;  4YWM A;  1HR0 Q;  5FO9 B;  1BF4 A;  2NUC A;  1M1K C;  2E2J H;  2K01 A;  2E8G A;  1HA5 A;  4PMC A;  3NWT A;  3S1N B;  1S4Z A;  2B2U A;  4DR2 Q;  4S3S A;  3KJO A;  3G6E A;  3NTH A;  3SK4 A;  1WTW A;  4KY6 A;  3RR5 A;  3TSS A;  1K73 C;  1S5E D;  2C35 B;  4OHJ A;  3LX0 A;  1L1O B;  1SE3 A;  3L2P A;  2B63 B;  1E22 A;  2EDG A;  1TQO A;  5K36 G;  4NP5 A;  2A68 D;  1RTN A;  1SYF A;  3K7A H;  1VQB A;  2RCF A;  2ID0 A;  2L1B A;  1TS4 A;  3OSO A;  4XQN A;  3CCL A;  4JI8 L;  1DON A;  3I4L A;  3CPW A;  4KMU C;  3PF5 A;  4XDX A;  2K5N A;  2WB1 B;  3S2D B;  3E9H A;  3MXU A;  3PUX A;  4DR1 Q;  4LFA Q;  4IZ8 A;  4N9P A;  3VYU A;  1PV4 A;  3K8A A;  3J80 c;  5CR3 A;  1PHJ A;  3HKZ E;  2NVT B;  1N34 L;  4ODG A;  4LF9 L;  1F2M A;  4M1U B;  4QUF A;  5C5M A;  1JOO A;  2HHH L;  4JI4 Q;  3J7A V;  5GQO A;  3TP5 A;  1OO9 B;  2I5H A;  3S16 H;  4M8A A;  5JVG 3;  5COY A;  1K3R A;  1EIY B;  3G71 A;  4FO2 A;  4DUY Q;  3AFP A;  2JK8 A;  4DAV A;  2YV5 A;  5FOB B;  4G7Z C;  2VUM G;  1F9Q A;  4H13 C;  4CBV A;  4BY1 G;  2F0D A;  1GUS A;  2NN6 I;  3RZD B;  2JEA I;  1X3Q A;  5M3F H;  1F77 A;  2XRS D;  1TS5 A;  4R4T A;  4C3H B;  4BBR B;  4AYB G;  2HQE A;  4RHS A;  3MC0 B;  1Q12 A;  4H0L C;  4C56 C;  4CDF C;  3G4S A;  1PVO A;  1RIP A;  5IE8 A;  4EQN A;  4DA2 A;  4Y7N H;  1JJC B;  3K7U C;  4ZK9 B;  3C2P A;  3DXJ C;  3TZU A;  5CV9 A;  3NBH B;  3RLF A;  4LF4 Q;  4JI3 L;  3M7N A;  3CCU A;  1F2Y A;  2MO0 A;  4X3K A;  1VQ6 A;  1K83 B;  5C4X H;  4A3K G;  1D1I A;  4KHV A;  4A3F H;  3AYH B;  2F0K A;  1F9R A;  4RG1 A;  2R93 B;  3J7Z C;  1LO5 D;  3CPF A;  4A76 A;  3NE5 B;  1VQF A;  1BVS A;  2NVY H;  2ZXP A;  4HIM A;  1SND A;  2L11 A;  2RVL A;  3Q24 A;  4CKB A;  3QR8 A;  4IPH A;  4CJ0 B;  2AUK A;  5IYB G;  4O42 A;  4B9X A;  5M5W B;  1DOM A;  1LTR D;  3ULJ A;  3PUW A;  2LXK A;  1M90 C;  3PV0 A;  1MBY A;  2QGQ A;  1HNZ Q;  2Z0S A;  1XTC D;  1E1O A;  1Y1W H;  3K80 C;  4HAE A;  3CCE A;  3NEM A;  1A8V A;  3JAM E;  1TWA B;  4P73 A;  4AQY Q;  1XNR L;  2GVA A;  3Q6S A;  3TP6 A;  1DOK A;  3H0G H;  2EYL A;  4RGO S;  1VQ8 A;  2VQF L;  4WJ4 A;  3NBH A;  1DGS A;  1AZQ A;  1CSP A;  1KDC A;  1IBM L;  2QA4 A;  4NXM Q;  4IAL A;  2H5X A;  1H9S B;  3MHB A;  4N9T A;  3I73 A;  1EWC A;  3D8G A;  2DY7 A;  4TVA B;  3BYY B;  4B3M L;  2B2T C;  3PGZ A;  2PCF B;  5M5X H;  1VQ5 A;  5H1S E;  3EBE A;  1NMF A;  4NDX A;  1GM5 A;  1ESF A;  1JCK B;  1WTQ A;  1QG7 A;  2RHQ B;  4JV5 Q;  4YY3 L;  1BCP F;  1SR3 A;  4JI2 Q;  3MEF A;  1GUW A;  4ALP A;  2IW3 A;  3VR5 A;  4G4K A;  1YBY A;  4RCN A;  2D5D A;  2OQ0 A;  3CC7 A;  5BN3 A;  4DUZ Q;  2IL8 A;  2ALY B;  4X62 L;  4QL5 A;  1VQD A;  3A7A B;  1CKM A;  4UDU C;  2NN6 G;  3A7L A;  3CCV A;  1BCP B;  1HH2 P;  5C6A A;  1YHQ A;  3GQB A;  2A74 C;  3HKS A;  4KHZ A;  5D3I B;  3KLS X;  1B70 B;  2QEX A;  1N8R C;  2F52 A;  3ERO A;  1FR3 A;  2J0T D;  1VQ7 A;  2K6A A;  3NPP A;  1HXY D;  3CHB D;  5GAH C;  3TDQ A;  5HUR A;  3GTP B;  1ET6 A;  1YVC A;  4LUV A;  2JA6 H;  4C2M H;  4DGZ A;  1MI2 A;  4P74 A;  4ZAI A;  1MSG A;  2SOB A;  5IP9 H;  1Z9F A;  2UXB L;  2F0P A;  3VA5 A;  4DV5 Q;  4U68 A;  2A6H D;  1EY5 A;  4ULL A;  2VUM B;  4LF5 Q;  1IL8 A;  3T4A C;  2A6E D;  4BY1 B;  2FFK B;  2PYK A;  1TS3 A;  1B8A A;  1CKN A;  5FO7 B;  4A3E G;  4UAI A;  2DN8 A;  2M00 A;  4AYB B;  4A3F G;  3J81 i;  3T1Y Q;  2F0M A;  3SDZ A;  1TWH B;  1MJC A;  3NEL A;  2JXM B;  4DAP A;  4DV6 Q;  4DV2 Q;  1H9K A;  4KKT A;  2F0I A;  5JJI A;  4C1N I;  1WCM H;  3BG3 A;  1BKB A;  1BQQ T;  3SR1 A;  5COR A;  3UE0 A;  4A3K B;  4GOP B;  1FNW A;  2JJQ A;  1P8L A;  1Q3L A;  4J15 A;  4JVZ A;  2WKD A;  2QKI C;  2UUB Q;  1KDA A;  5FLM G;  1ASZ A;  4L63 B;  3FEW X;  2HCC A;  2XWB B;  1Y1W G;  2ICI A;  2E5L L;  3ULP A;  1PH7 A;  2NVQ B;  4B3S Q;  1SJE D;  2F0N A;  3SK6 A;  4DR5 Q;  2A69 D;  4LF7 Q;  2AMC B;  1B3A A;  1TY2 A;  4B3R L;  5ELN A;  3PIO 3;  4DAY A;  1HR0 L;  1X9N A;  2F4V L;  3LNN A;  3UDX A;  2PI2 A;  4KV6 A;  2CQA A;  2E2H B;  3A8K E;  3D4D A;  2VY3 A;  4DR2 L;  3S1N H;  4A3I G;  3JC6 6;  3I56 A;  2OTL A;  4WJW A;  5FJ8 G;  1LT5 D;  2KA7 A;  4KD3 A;  2PZW A;  2BE5 D;  4GOP A;  2B63 H;  1AFP A;  1Y8O B;  4QJF A;  4K0K Q;  1G2T A;  3QOL A;  4IOC A;  4PG3 A;  3K7A B;  3EIV A;  1BBW A;  5LHY 1;  4QIW B;  2R61 A;  1KLG D;  1HUM A;  4IFD H;  4P75 A;  2JA9 A;  3K57 A;  1IL2 A;  2ZJP A;  4LFA L;  2Z6K A;  1C7Y A;  2XSC A;  1EIF A;  1IBL Q;  3CRK C;  3K5N A;  5JPN C;  4FF2 A;  3S1Q B;  2K05 A;  5LMN W;  2DGY A;  1VQ4 A;  4OO1 G;  5JEA G;  5A2Q L;  2I5M X;  3A74 A;  1YI2 A;  3HKZ G;  4UP9 A;  4NW2 A;  4JI4 L;  4RA8 A;  1JIC A;  2JA6 G;  3H6M A;  5C0X I;  1YIT A;  2IJ0 A;  3A0J A;  4GNX A;  5IGC A;  4FYD A;  5F2D A;  2IY5 B;  3NK9 A;  1AZP A;  4MHE A;  2F0J A;  2Z8L A;  3FHW A;  1ZXT A;  1RCV D;  2AUJ D;  3VR2 A;  1VMP A;  3FP9 A;  3I90 A;  1EOV A;  2D0P A;  1YJW A;  1YJN A;  2NYZ D;  5IOD A;  3RZD H;  3J80 i;  1HQM C;  4P2C B;  3GO5 A;  4X3U A;  4C3H H;  5KND A;  3K5O A;  4BBR H;  3HOU G;  2LY7 A;  1OXT A;  3BZD B;  5DAU A;  1VQP A;  2PO4 A;  4TRD A;  2LMC B;  2UXC Q;  4A4I A;  1IYU A;  4HMJ A;  3STB D;  4BY7 G;  5K5P A;  4LF4 L;  1EIH A;  1SE2 A;  1IYV A;  1E24 A;  3H3V I;  1X6O A;  1CK1 A;  1DD2 A;  5C4X B;  5KIX A;  1K83 H;  4A3E B;  3M85 A;  4GNX C;  5IGD A;  2ATW A;  4A3F B;  1V1P B;  1RL2 A;  3LGJ A;  3QOJ A;  4ZUJ A;  4C3J H;  1EY4 A;  2NVY B;  3F1Z A;  1SMX A;  3VR4 A;  1HUN A;  1JC7 A;  1SMY D;  2Q2H A;  3SHL A;  4DV7 Q;  1WTP A;  3G7L A;  1WYD A;  4HSV A;  1SNO A;  1GOZ A;  3BVM A;  3MXN B;  1LYL A;  3RD4 A;  5JPM C;  1X65 A;  5M5W H;  3DLL A;  1PH1 A;  1V8Q A;  3NTK A;  1HNZ L;  1CUK A;  1ENA A;  4JBK A;  1Y1W B;  3SGI A;  3GTG B;  3F2C A;  1EQQ A;  4AQY L;  2EVB A;  5EKL A;  1TWA H;  1QNK A;  3K58 A;  1EFI D;  3SVM A;  1EUJ A;  4O2D A;  5IIF A;  2EPB A;  1F9P A;  4NXM L;  2D9U A;  2UUA L;  2TSS A;  5DLQ E;  3T13 A;  1BOS A;  2L9H A;  4IJH A;  1V1P A;  3U9S A;  1ICW A;  1O78 A;  2EY6 A;  3BU2 A;  4CDD C;  1WVL A;  2PZU A;  4WRD A;  2AHO B;  5CV6 A;  1Y8N B;  4L6T B;  5ELB A;  4A3I B;  4PMW A;  2E76 C;  4LAA A;  3MEH A;  1JJ2 A;  4H02 A;  4JV5 L;  3AFQ A;  4JI2 L;  3MXN A;  1UE1 A;  1BO0 A;  1LTT D;  5C0X G;  4POG A;  5K36 H;  3GTJ B;  1K3B C;  3S1R B;  2R7Z G;  3EA6 A;  4X6A H;  3E5S A;  2KCM A;  1B1Z A;  2IT1 A;  2EXZ A;  1HZC A;  1TWF B;  1Q90 A;  4DUZ L;  1KC8 C;  4QQB X;  5FKA C;  3V05 A;  1IZ6 A;  1PFN A;  2F0T A;  4FXG C;  3W1G A;  4EX5 A;  4JI5 Q;  2JSO A;  5FLX c;  3OIP A;  1A0I A;  3QG1 A;  1TXY A;  3OMG A;  2F3V A;  4JPB W;  2Z4H A;  3HKZ B;  3S1M H;  1G29 1;  4J1M A;  1WD1 A;  1N9W A;  2PZT A;  3K0Y A;  4GLX A;  3H94 A;  1STE A;  4IUR A;  3GV3 A;  4APV A;  4X65 L;  2A73 B;  2JA6 B;  1SXT A;  3OW2 A;  2HQL A;  3GTP H;  5LL6 X;  5IT9 L;  3PIP 3;  5IYD G;  1YHB A;  1VQG A;  4DV4 Q;  1X56 A;  4DV5 L;  4KY5 A;  2K14 A;  4JYA Q;  3CW2 C;  2F3W A;  4N8X 1;  4NXN Q;  3I3C A;  5BN5 A;  4IFD J;  4NKL A;  4A75 A;  3D4R A;  1E2V A;  1NUC A;  3KUP A;  4LF5 L;  4XT1 B;  3A5U A;  1QZG A;  2VUM H;  1KQS A;  2Z9H A;  3TP7 A;  3GD7 A;  3Q0A A;  2CFM A;  2KVM A;  3CAM A;  1A6X A;  5E3F A;  3TS0 A;  4H7B A;  5EJW A;  3T1Y L;  1PH8 A;  1U4L A;  3HOU B;  1XMO Q;  4C3J G;  3TME A;  1WJJ A;  2KBN A;  4OEM B;  3KBX A;  2NB0 A;  4DV6 L;  4ME3 A;  4DV2 L;  1TWH H;  4L5R C;  4YHH Q;  4BY7 B;  2KHI A;  3A5Z B;  1CKO A;  1MHW C;  1HJP A;  1FNU A;  4I7A A;  1ICF B;  1KD1 C;  3HOV G;  2IX0 A;  5CV5 A;  3U50 C;  2ZJQ A;  2UUB L;  2BA1 A;  5CBE E;  2RSO A;  4LWC A;  2B3G A;  1PZI D;  1PA6 A;  3K5M A; 
#chains in the Genus database with same CATH homology
 4IOA A;  3HOW H;  1BVS A;  2NVY H;  2ZM6 L;  3TQY A;  2K50 A;  4HIM A;  4GKJ Q;  2N8N A;  1E3P A;  4B3S L;  4DR5 L;  1PH4 A;  4LF7 L;  2YTV A;  4X64 L;  4HID A;  4IPH A;  2NVQ H;  4QY7 A;  2NZH A;  2YTY A;  3UDI A;  5IYB G;  2MNA A;  1NE3 A;  2R7D A;  4HIK A;  2LXJ A;  1YNX A;  4DR3 L;  3ULJ A;  1SRU A;  3PUW A;  4B3T Q;  1WOC A;  5IYB H;  3RN5 A;  2LXK A;  1M90 C;  1NY4 A;  3PV0 A;  1HNZ Q;  2QGQ A;  2Z0S A;  1E1O A;  5IY0 A;  1Y1W H;  3K80 C;  3CCE A;  2ASB A;  3H0G G;  3NEM A;  1A8V A;  4A3M H;  1HNW Q;  4IPD A;  4P73 A;  5C4J H;  4AQY Q;  1XNR L;  2NZO A;  2GVA A;  2E2H H;  1N32 Q;  3H0G H;  1VQ8 A;  4WJ4 A;  4R4Q A;  2VQF L;  2WAQ G;  2N78 A;  2UU9 Q;  1UE5 A;  2RHS B;  1DGS A;  3D0F A;  1CSP A;  4OWT B;  1IBM L;  4JCV E;  1OTC A;  3HOX H;  3AQQ A;  1Q1B A;  4BA1 I;  2QA4 A;  2CWA A;  4NXM Q;  2IX1 A;  3BZC A;  2H5X A;  4A3J G;  1AE2 A;  1VS0 A;  2K52 A;  4LW1 A;  1GKH A;  4GN3 B;  4K0K L;  4A3J H;  4TVA B;  1IXR A;  2GN5 A;  4JBM A;  4UPA A;  2JE6 I;  2WP8 J;  2CCZ A;  1LM0 A;  2JEB I;  3BZK A;  3PGZ A;  1X3G A;  1VQ5 A;  5M5X H;  4B3M L;  3PO2 G;  1V9P A;  2MQH A;  3W1B A;  3WWV A;  1S3O A;  3EBE A;  2AKW B;  1NMF A;  5H1S E;  3IRB A;  1WFQ A;  5BR8 Q;  1GM5 A;  3GTK H;  2CQO A;  3PO2 H;  1IBL L;  4A3L G;  2RHQ B;  4JV5 Q;  1BBU A;  4YY3 L;  1PH5 A;  2JA8 H;  1SR3 A;  2Q2I A;  4JI2 Q;  1D7Q A;  1HZA A;  2PQA A;  3MEF A;  4DV3 Q;  4ALP A;  4A3L H;  3S1Q H;  2RCN A;  2AWO A;  1N33 L;  4JI8 Q;  3CF5 A;  4LFC L;  1YBY A;  3VDY A;  3M3Y H;  3S2D H;  4EQ5 A;  5IT9 c;  2OQ0 A;  2A19 A;  2KHJ A;  3CC7 A;  4DUZ Q;  2ALY B;  4X62 L;  4QL5 A;  1VQD A;  2JA5 G;  4IFD I;  1CKM A;  2CKZ B;  1QVF A;  4JI7 Q;  1K9M C;  3U4Z A;  3ICE A;  4LUO A;  2JA5 H;  2NVT H;  2NN6 G;  5M3M H;  3CCV A;  4AIM A;  1HH2 P;  2ZTC A;  4L5T A;  2EIF A;  1YHQ A;  1N34 Q;  2BH8 A;  3HKS A;  2EQS A;  4KHZ A;  4LF9 Q;  3I7F A;  4NB3 A;  4HIO A;  2QEX A;  1B70 B;  1N8R C;  3KOJ A;  2F52 A;  2HHH Q;  5LMU L;  1A62 A;  1VQO A;  2BH2 A;  4GN4 B;  1MKH A;  4IPC A;  1VQ7 A;  3JAM c;  2UXD L;  1N36 L;  4A93 G;  2IHF A;  5GAH C;  3I4O A;  1MIU A;  1IYJ B;  2K4K A;  5IP9 G;  1YVC A;  4LUV A;  5IWA L;  2Q2T A;  3FKI G;  4GOP C;  4C2M H;  2HT1 A;  2JA6 H;  1UEB A;  4PZ7 A;  3H3V H;  4P74 A;  1SRO A;  4A93 H;  4DK6 C;  4R4C A;  1SLJ A;  4HJ9 A;  5IP9 H;  1AH9 A;  1Z9F A;  1I6H H;  4P72 A;  4OX9 L;  2UXB L;  4DV5 Q;  1KL9 A;  3RN2 A;  2I5L X;  3RLO A;  3CCM A;  3PUY A;  3KLW A;  4HJ8 A;  3ERS X;  3CCS A;  4LF8 L;  2OQK A;  4RMF A;  2UXC L;  3KF8 B;  2UUC L;  3CMA A;  2Z6K C;  5C0X J;  2K5V A;  4LF5 Q;  5LMN Q;  4UP7 A;  1LTL A;  4DV1 Q;  4OXP A;  4AYB E;  5GAE C;  2PI2 E;  1B8A A;  1VQH A;  1VQJ A;  3S14 H;  4TQU S;  1CKN A;  4A3E G;  3CC2 A;  2B29 A;  3S2H H;  4A3F G;  1XMQ Q;  1JMC A;  4BBS G;  1Q82 C;  3T1H Q;  3J81 i;  3T1Y Q;  3PO3 G;  1I50 H;  1UE6 A;  1Q7Y C;  4A3E H;  3KDF B;  3PF4 A;  1Y14 B;  1MJC A;  1WCM G;  4DV0 L;  4BBS H;  3NEL A;  3I55 A;  5AJ3 L;  1S40 A;  3PO3 H;  4DV6 Q;  4DV2 Q;  5JJI A;  4JI3 Q;  3TRZ A;  1WCM H;  1OXV A;  4IO9 A;  1BKB A;  4L5S A;  3D31 A;  3ZJY C;  4DV7 L;  1XPO A;  2E2I H;  4JI1 L;  2R93 G;  3UE0 A;  4R1J A;  2R6G A;  2Y0S E;  2JJQ A;  4GOP B;  1P8L A;  2HIX A;  4J15 A;  4DR7 L;  4DR4 L;  3TS2 A;  1FJG L;  2A1A A;  2UUB Q;  2R93 H;  3GDE A;  5FLM G;  4IJL A;  1OXS C;  4DR6 Q;  1ASZ A;  1YHA A;  2PQA B;  2ZM6 Q;  1Y1W G;  1G51 A;  2E5L L;  3ULP A;  4HJA A;  1PH7 A;  1NJI C;  4DR5 Q;  4A3M G;  4B3S Q;  5FLM H;  1K8A C;  4LF7 Q;  3PSI A;  4X64 Q;  3J7A 5;  1V43 A;  3CQZ H;  4DPG A;  4JI6 L;  3GTG H;  4A3G H;  2BA0 A;  2AMC B;  3PIO A;  1GVP A;  4B3R L;  5ELN A;  1X3E A;  4DR3 Q;  3HOX G;  1HR0 L;  1K8G A;  1X9N A;  3BJU A;  1AE3 A;  4YWK A;  2PNH A;  2F4V L;  3KFU A;  1IBK Q;  3UDX A;  4DAM A;  2PI2 A;  1Y1V G;  1T9H A;  1JB7 A;  2YTX A;  2VY3 A;  4DR2 L;  3KDF A;  3ULL A;  2WAQ E;  1XNR Q;  4GLA C;  1VQ9 A;  1Y1V H;  3S1N H;  3RZO H;  4A3I G;  3OTO L;  3JC6 6;  2VQF Q;  1VCI A;  1VQA A;  3I56 A;  2F4V Q;  4YCW A;  2OTL A;  2B63 G;  2DUD A;  4BXX G;  2L15 A;  1HZ9 A;  5FJ8 G;  1IBM Q;  3EN2 A;  1EQR A;  4A3I H;  1PH2 A;  3CC4 A;  1KHI A;  2JA8 G;  1U0L A;  4QIW E;  4GOP A;  2B63 H;  1PFS A;  1Q86 C;  5FJ8 H;  4GN5 A;  1VQK A;  4BXX H;  1UE7 A;  4A3G G;  1SN8 A;  3KF6 A;  4QJF A;  4K0K Q;  4IFD G;  4QGU A;  4PG3 A;  4IOC A;  4UY8 C;  3EIV A;  1BBW A;  1I94 L;  4PZ8 A;  1HNX L;  4GKK L;  1OXX K;  1SE8 A;  1Q1E A;  2WB1 G;  4B3M Q;  2VW9 A;  5HY6 A;  5EAY A;  4JI0 L;  1KXL A;  3GTJ H;  1VQL A;  4P75 A;  1J5E L;  2JA9 A;  3S1R H;  1IL2 A;  3STB C;  2ZJP A;  2GVB A;  3L7Z C;  4LFA L;  4UP8 A;  2Z6K A;  3F8T A;  1C7Y A;  1IBL Q;  1EIF A;  1TWF H;  4JOI A;  4X66 L;  3U4V A;  1CKN B;  4YY3 Q;  2ZTE A;  4JI5 L;  5M3M G;  5LMN W;  3M4O H;  2DGY A;  1VQ4 A;  4OO1 G;  5JEA G;  2VS1 A;  1D8L A;  1XTD A;  4DK3 C;  2YU9 H;  2I5M X;  1N33 Q;  3A74 A;  1YI2 A;  4LFC Q;  3HKZ G;  4UP9 A;  4LNQ A;  1NBW A;  4XTC S;  1FGU A;  3CXC A;  4JI4 L;  5M5Y H;  4PZ6 A;  4KHP L;  3S17 H;  4JBJ A;  4X62 Q;  4KI0 A;  4LUZ A;  2EXD A;  1GD7 A;  1MJE A;  1VQI A;  2JA6 G;  5C0X I;  1YIT A;  1KRS A;  1S72 A;  3A0J A;  4KLK A;  4YCU A;  4GNX A;  1HZB A;  1JE5 A;  5IYC G;  2UUC Q;  2I0Q A;  4JG2 A;  1SFO H;  2LSS A;  2AWN A;  3DM3 A;  3J81 c;  5E7N A;  1YJ9 A;  4KHP Q;  1PH9 A;  5IP7 G;  2IY5 B;  4DV4 L;  3HOZ G;  1K0R A;  1Q46 A;  1VQC A;  3PCO B;  4JYA L;  1U5K A;  4C3I H;  4POF A;  5IYC H;  5LMU Q;  1XPR A;  1XNQ L;  2XTI A;  2JQO A;  3FHW A;  4NXN L;  1Z47 A;  5IP7 H;  2UXD Q;  1N36 Q;  3HOZ H;  1L1O A;  1QUQ B;  3J81 j;  1X3F A;  4WJ3 M;  1I5F A;  4MZ9 A;  2MO1 A;  3FP9 A;  1CSQ A;  1EOV A;  2D0P A;  5IWA Q;  1YJW A;  1YJN A;  3Q8D A;  4BBR G;  4XIG S;  1EFW A;  2K5H A;  3UDF A;  3RZD H;  1YIJ A;  3J80 i;  2VQE L;  4JOI C;  4JC0 A;  3GO5 A;  4DNI A;  4C3H H;  4DAY B;  4OX9 Q;  4BBR H;  3PUV A;  2UXB Q;  3K81 C;  3HOU G;  4JBW A;  1B7Y B;  1KRT A;  2CWP A;  1J6Q A;  1OXT A;  4LF8 Q;  1XMO L;  1VQP A;  1JT8 A;  3HOU H;  2UXC Q;  4A4I A;  3STB D;  4BY7 G;  4BY1 H;  2VQE Q;  3HFZ B;  4YHH L;  4LF4 L;  1C0A A;  2JA7 G;  4GLV B;  5GAG C;  1E24 A;  3H3V I;  2R92 G;  3UE1 A;  5HGQ A;  1X6O A;  4BY7 H;  3F2B A;  1E7Z A;  4LFB L;  1YEZ A;  4AH6 A;  4LF6 L;  1K83 H;  3H15 A;  2JA7 H;  3M85 A;  4GNX C;  1EYG A;  1NMG A;  1TWG H;  2ATW A;  2R92 H;  3GTM H;  3PUZ A;  1TWC H;  3F2D A;  5JJK A;  2HIV A;  1RL2 A;  3LGJ A;  1C9O A;  4C3J H;  4OWX B;  3KF6 B;  3W5O A;  4DV0 Q;  1IBK L;  5AJ3 Q;  1A63 A;  2Q2U A;  4GKJ L;  3F1Z A;  1SMX A;  2RF4 A;  4OWW B;  3GTQ H;  1L1O C;  2Q2H A;  4DV7 Q;  4BA2 I;  3S24 A;  4JI1 Q;  4A3K H;  1WYD A;  1QUQ A;  3M9B A;  3CME A;  1UWV A;  4DR7 Q;  1QVG A;  1VQE A;  1H95 A;  4DR4 Q;  1GO3 E;  3K0X A;  3M4Q A;  3MXN B;  1FL0 A;  3TRE A;  1LYL A;  4B3T L;  1FJG Q;  4OON A;  1X65 A;  5M5W H;  3DLL A;  1P16 A;  1XJV A;  1PH1 A;  2FXQ A;  3J7Z C;  1HNZ L;  1CUK A;  5C3E G;  2E5L Q;  1VQN A;  5C44 G;  4JBK A;  3SGI A;  3F2C A;  1EQQ A;  1HNW L;  4AQY L;  4JI6 Q;  5C3E H;  1TWA H;  2WFW A;  5C44 H;  1PYS B;  1L0W A;  1N32 L;  1EUJ A;  3CCJ A;  4O2D A;  4YWL A;  2UU9 L;  4R4O A;  4L5Q A;  4B3R Q;  2ZJR A;  4YWM A;  1HR0 Q;  2IHE A;  2NVX H;  2MFI A;  1X55 A;  4NXM L;  4GNX B;  2UUA L;  5DLQ E;  1M1K C;  3UDG A;  2E2J H;  2E8G A;  3AEV A;  1E1T A;  1YZ6 A;  2A8V A;  4IJH A;  2D62 A;  2V1C C;  4DKA C;  4HJ7 A;  4DR2 Q;  3KJO A;  2K75 A;  3G6E A;  3BU2 A;  1V1Q A;  3OTO Q;  3RR5 A;  1K73 C;  2AHO B;  4MTN A;  2C35 B;  1W2B A;  1L1O B;  5GAD C;  3NEN A;  4PMW A;  3L2P A;  2UUA Q;  3GTO H;  5BR8 L;  1LUZ A;  1E22 A;  3B6Y A;  1JJ2 A;  5K36 G;  4H02 A;  4DR1 L;  4JV5 L;  3AFQ A;  3RNU A;  4JI2 L;  2VL6 A;  3OYY A;  1UE1 A;  3K7A H;  2WB1 E;  1VQB A;  3I4M G;  4DV3 L;  2ID0 A;  1I94 Q;  1HNX Q;  5C0X G;  4GKK Q;  4POG A;  3CCL A;  4JI8 L;  4A3B G;  2R7Z G;  3CPW A;  1Q81 C;  4JI0 Q;  4GS3 A;  3U58 A;  3PF5 A;  3I4M H;  2K5N A;  4X6A H;  1J5E Q;  2KCM A;  2IT1 A;  3E9H A;  3RLN A;  3PUX A;  1HZC A;  3KYH C;  4DR1 Q;  4DUZ L;  4A3B H;  4LFA Q;  2R7Z H;  1KC8 C;  4QQB X;  3KJP A;  1IZ6 A;  1OXU A;  3W1G A;  4X66 Q;  1PV4 A;  3K8A A;  3J80 c;  4JI7 L;  4EX5 A;  4YCV A;  3HOY G;  4JI5 Q;  1PHJ A;  5FLX c;  3HKZ E;  3G48 A;  2KEN A;  2D0O A;  1A0I A;  1N34 L;  4LF9 L;  1PH3 A;  1TXY A;  3HOY H;  1PH6 A;  2VNU D;  4DUY L;  4NPS A;  2HHH L;  2XGT A;  4JI4 Q;  3S1M H;  1G29 1;  1PA6 A;  5GQO A;  1FVI A;  1XPU A;  1N9W A;  4GLX A;  2I5H A;  1G6P A;  3CP0 A;  3CD6 A;  3S16 H;  2KCT A;  4APV A;  1K3R A;  1X54 A;  4X65 L;  1EWI A;  3PIP A;  1EIY B;  3GTP H;  3OW2 A;  2HQL A;  1L2F A;  3G71 A;  4DUY Q;  3AFP A;  1NTG A;  4IPG A;  1W3S A;  5IYD G;  2JK8 A;  1YHB A;  3TEH B;  1VQG A;  4DV4 Q;  2YYZ A;  1X56 A;  4DV5 L;  3I4N G;  4JYA Q;  2K14 A;  1R9T H;  3CW2 C;  2PMZ E;  1I3Q H;  2YV5 A;  2N3S A;  5M3F G;  1XNQ Q;  4OO1 I;  5IYD H;  4NXN Q;  2F3I A;  2VUM G;  3GTL H;  3E9I A;  4X65 Q;  4A3D G;  3I4N H;  3L0O A;  1KAW A;  4IFD J;  4BY1 G;  4A75 A;  2NN6 I;  1KIX A;  4LF5 L;  2JEA I;  3ER0 A;  5LMN L;  5M3F H;  2R7F A;  1QZH A;  4DV1 L;  3A5U A;  1ASY A;  1QZG A;  2VUM H;  2VZA A;  1JJG A;  4A3D H;  3FKI H;  3M4P A;  3E0E A;  2OCE A;  4R4T A;  1KQS A;  3GD7 A;  4AYB G;  4Y52 H;  4A3C G;  2CFM A;  4FDB A;  3CAM A;  4P71 A;  3S15 H;  1Q12 A;  1XMQ L;  3TS0 A;  3G4S A;  3T1H L;  1PVO A;  3T1Y L;  1PH8 A;  1RIP A;  5IE8 A;  4A3C H;  1VQM A;  1XMO Q;  4R4I A;  4Y7N H;  1O7I A;  5ELO A;  1WJJ A;  1JJC B;  1HR0 W;  2KBN A;  1Q8K A;  3K7U C;  5JEA J;  5C4X G;  4DV6 L;  5JJL A;  4ME3 A;  5J3B A;  1TWH H;  3NBH B;  3JAM i;  4YHH Q;  4DV2 L;  3RLF A;  4LF4 Q;  2KHI A;  4JI3 L;  3A5Z B;  1CKO A;  4L5R C;  1WI5 A;  3M7N A;  1HJP A;  3CCU A;  2MO0 A;  4MNO A;  2ES2 A;  1VQ6 A;  4HJ5 A;  5C4X H;  4A3K G;  2OTJ A;  4LFB Q;  1PYB A;  2ZTD A;  1KD1 C;  3HOV G;  4LF6 Q;  2IX0 A;  2N49 A;  4A3F H;  3U50 C;  3CCR A;  3HOW G;  2OWO A;  3AYH B;  3CCQ A;  2Y0S G;  2ZJQ A;  2UUB L;  3I2Z A;  2BA1 A;  4RG1 A;  5GRO A;  3HOV H;  4LWC A;  2B3G A;  4O0A A;  1QVC A;  3CPF A;  4DR6 L;  4A76 A;  1VQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...