4IJHA

Fragment-based discovery of protein-protein interaction inhibitors of replication protein a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Protein-Protein Interaction Inhibitors of Replication Protein A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 28
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ijhA00
4JI8Q 1GVPA 4IPDA 1UE7A 2K5VA 1WOCA 2PQAB 1VQEA 4LWCA 3CC2A 2R7DA 1IZ6A 1N32Q 1Q8KA 1VQFA 4PZ6A 2R92G 3F8TA 2JA6H 1U5KA 1B8AA 5C0XJ 4DV6Q 1OXVA 1LYLA 5LMNQ 4OX9Q 3CC7A 3CCLA 4JV5Q 3MXNB 4DV6L 2ZM6Q 1PH5A 4IFDG 5E7NA 3J81j 1VQ5A 1KL9A 3GTLH 4A3LG 4X65L 4GNXC 3GTJH 4B3MQ 2UXCQ 2K5NA 1VQCA 4A93H 1DGSA 1KAWA 2JJQA 4HIDA 3GD7A 1Q81C 3PUXA 4P73A 1QVFA 4O0AA 2Y0SG 1CUKA 3UE1A 4HJAA 1Y1VG 4R1JA 1S40A 1JE5A 3FKIG 3HOVG 4DKAC 2K14A 5M3MH 2D0OA 1N8RC 2Q2IA 2OTJA 1KHIA 2OQ0A 5C0XI 1PYSB 2JQOA 2RHQB 4YWKA 1I6HH 3HOZH 4PZ7A 1K9MC 4C3IH 4BBRH 4KLKA 4UPAA 1Y14B 2Y0SE 4QGUA 3T1HQ 4OWTB 1M90C 2E5LL 2F4VL 2EQSA 3BZKA 1X65A 1XMQQ 4P74A 3I4MG 4DUYL 2GVAA 4DR6Q 4Y52H 4LF7L 4RMFA 5FLMH 3I55A 4JBMA 4HJ7A 2HHHQ 5IE8A 4AIMA 1M1KC 3HFZB 1SN8A 3M4PA 1VQMA 3PO3H 4DR4L 1VQIA 4DR5L 3FHWA 4JI7Q 4A3DH 4DR3L 1HJPA 2WP8J 4IPCA 5BR8Q 5GADC 5HY6A 5IYBH 5EAYA 1HNXQ 1HNWQ 3EN2A 5IYCH 3G71A 3ULJA 2YYZA 3S16H 3T1YQ 2N8NA 4JG2A 2XGTA 4JI3Q 3H3VH 4LNQA 4NXNQ 2K75A 1EUJA 4YWMA 3F2BA 1GM5A 3PO2H 3HOXH 3EBEA 2CFMA 2F52A 3AFQA 3I4NG 2UXDQ 4BXXG 1JJCB 4UP7A 4A3LH 4DV0L 4GN5A 1L2FA 4LF6L 3DM3A 4APVA 1SE8A 1E3PA 1CKOA 3KLWA 3CCUA 4RG1A 4A3MG 1LM0A 1BKBA 1KIXA 1GKHA 2K50A 4A3GG 3UDFA 1EIYB 2JK8A 1XJVA 1VQBA 1IBML 3F2CA 1A63A 4JBWA 2I0QA 3A5ZB 1NJIC 3TREA 4KHPL 4LFAL 1K8GA 4X6AH 4IPGA 1N33Q 3A5UA 1PH1A 1OXXK 1IXRA 4LF5Q 1VQDA 3S2HH 2HQLA 4QY7A 1E1TA 1WCMH 2F4VQ 3E9HA 3CCEA 4B3RQ 1WI5A 1MKHA 4ALPA 3L2PA 1EYGA 1YEZA 1YVCA 4UY8C 2JA5G 4JOIA 4HIOA 3W5OA 1K0RA 2JA7G 4BY7H 4PG3A 1VQPA 1QVCA 1OXTA 2B29A 4DV2Q 4JI4L 1KXLA 5M5XH 4B3RL 2PNHA 3KDFA 1CKNA 3HOWG 4LUOA 3CXCA 1X54A 4LF9L 4A3KG 2R7FA 2B3GA 1YNXA 4DV3Q 4DUZL 4A3FG 3CPWA 5GAHC 1EQQA 2JA9A 1QUQB 4L5SA 3CCRA 2E2JH 1CSPA 1B70B 2D0PA 1GD7A 3EIVA 2EXDA 4DR3Q 1G6PA 4BBRG 1HR0W 1LUZA 1P8LA 1TWAH 1PH3A 1VQKA 4NXML 3TRZA 4A3GH 1S72A 2AMCB 5AJ3Q 4GLXA 4JV5L 2QGQA 3RN2A 2AKWB 3HOXG 3L7ZC 1HH2P 3PF4A 3BJUA 3E9IA 1MJEA 1XPUA 2VQEL 2BA0A 2AWOA 3J80c 2IHEA 2DUDA 1UE5A 3STBC 1JJ2A 1ASZA 4LF4Q 5AJ3L 1YJWA 3LGJA 4DPGA 2VQEQ 2A19A 2ALYB 5C0XG 3BZCA 3K7AH 1PH7A 4AH6A 1IBLQ 3S1RH 4X62Q 3FP9A 4GN4B 1B7YB 4X64L 5IYBG 4B3SQ 2KBNA 4X62L 5M5WH 3JAMi 4AQYQ 2UU9Q 3KFUA 1W3SA 4IJLA 1WFQA 4OWXB 4IJHA 4AYBE 1YHQA 4JI1L 4DV1L 4LF9Q 2I5LX 1VQ7A 2I5MX 4QL5A 4PMWA 3M85A 4A3JG 5IP9G 1G51A 4BXXH 3U4VA 3GO5A 3PIPA 1PH9A 2L15A 5C3EH 4DUZQ 3PCOB 3PUZA 1HNWL 3Q8DA 4C3JH 1U0LA 1NMFA 4DV4Q 1PV4A 3NEMA 5BR8L 5HGQA 1VQ9A 1HR0L 1XNRQ 4NXMQ 4DV2L 4BBSG 1HR0Q 4Y7NH 1BVSA 5IYDH 1X3FA 4KI0A 3U58A 3K0XA 3TS2A 1D7QA 2R7ZH 4LFBL 4DV0Q 3CAMA 2OTLA 2UXDL 2VZAA 3HKZG 3AYHB 4R4TA 3S2DH 1L1OC 1XNRL 2Q2TA 2B63H 2D62A 1NY4A 1TXYA 4EX5A 4JBJA 2CWPA 4BY1G 4A3CH 1N9WA 4BY1H 1X56A 4AQYL 2UU9L 1NE3A 4UP8A 2GVBA 3M9BA 4LFBQ 2E2HH 2VUMH 4X64Q 3S24A 2K5HA 3U4ZA 2LSSA 4BY7G 1VQLA 1VQJA 2XTIA 2R92H 1E1OA 3K80C 3KF6A 3KJOA 2R93G 2OCEA 3PUYA 3CF5A 1K83H 2N78A 2YTXA 4A3EH 3UE0A 1EOVA 5J3BA 5JEAG 1PH8A 3CCSA 5FJ8H 1V1QA 3NBHB 4EQ5A 1Y1WH 4DR6L 4KHPQ 1NMGA 5M3FG 1Q1EA 4GS3A 1XMQL 1XMOQ 2Z6KC 5IWAQ 1RIPA 4JCVE 2PMZE 3CC4A 5IYDG 3OTOQ 1PFSA 1I50H 3FKIH 1SRUA 1Q12A 1TWFH 3K8AA 4JOIC 2WB1G 4A3IG 1I5FA 1O7IA 1VQ6A 3TQYA 4IOCA 2AHOB 3J80i 3U50C 4A4IA 5FLMG 2R6GA 3ER0A 3OTOL 1VQOA 1IBLL 2KCMA 2NN6G 4J15A 5IWAL 3CMAA 4NPSA 4JI6Q 2ZTCA 4DNIA 2VS1A 4IPHA 3G6EA 3DLLA 1KRTA 3KYHC 2PI2E 4WJ3M 1YHAA 3AFPA 2MQHA 4KHZA 5IT9c 1KD1C 2JA7H 4GNXA 5K36G 3PIOA 2Q2UA 2C35B 1EWIA 3HKZE 2N49A 4HJ5A 4JI7L 2JA8H 3RNUA 4A3BG 3KJPA 4GKJQ 4AYBG 1L1OB 3I4NH 3CD6A 1V9PA 5JJKA 4B3SL 4POFA 4L5QA 2WAQG 1N34L 1Y1WG 4R4CA 5IY0A 5GAEC 2IX1A 5M3FH 4JI8L 1PYBA 2NVYH 3M4QA 4HJ9A 1IBMQ 5GQOA 2A8VA 4HIKA 4LF4L 3ICEA 3PGZA 2KHIA 3I4OA 5IP7G 1NBWA 4JI1Q 4DV1Q 1C9OA 3H15A 4A3KH 2VNUD 3RR5A 3S1NH 2IHFA 4QJFA 5JJIA 4L5RC 5IP9H 1AE3A 2KHJA 4JI0L 1VS0A 2QEXA 1JB7A 4TVAB 4DK3C 4OO1I 3D0FA 2RHSB 4DR4Q 4X66Q 4YCVA 4DV5L 1C0AA 1TWHH 4HIMA 3CPFA 4A3CG 2B63G 5C4JH 1AE2A 3PUVA 4DV4L 1PH4A 3I4MH 4OONA 5GROA 1A62A 1NTGA 1VQHA 1T9HA 2N3SA 2ZTEA 1WYDA 3W1BA 2NVXH 4LF7Q 2YTVA 4LFAQ 4DV3L 1QVGA 3J81i 3RLOA 4JC0A 2VW9A 2IY5B 1VQAA 1FVIA 1X3EA 4MNOA 1Q1BA 3TEHB 3T1HL 2R93H 2WFWA 4JI4Q 4A3BH 4ME3A 1E24A 3NENA 1PH6A 1MIUA 2CKZB 2HIXA 4A3EG 1E7ZA 1EIFA 1I94L 4DR7L 1HNXL 4LFCL 4A3DG 1MJCA 3HOYH 1I3QH 4R4OA 1ASYA 3M4OH 3CQZH 1VQ8A 5C4XH 4GNXB 4DUYQ 3I7FA 4R4QA 3M3YH 4QIWE 5JEAJ 3J7A5 4YWLA 1K3RA 3AEVA 3E0EA 4A3JH 1VQNA 1K8AC 4JI3L 5IP7H 2QA4A 2V1CC 1N33L 3UDGA 4YHHL 4DAYB 1E22A 1CKMA 2ZJPA 3S17H 5LMUL 1JMCA 3GTOH 3UDIA 3S14H 5ELNA 1W2BA 4IFDI 1P16A 2MFIA 4PZ8A 2K52A 3RN5A 2ATWA 1A0IA 3S1QH 4JBKA 4C3HH 4DR2Q 5C44G 4OXPA 2UUAL 1IBKL 1HNZQ 2AWNA 2KCTA 1YIJA 4B3TQ 1TWGH 4YCUA 3HOVH 3S15H 4OO1G 1LTLA 4X65Q 4GOPB 1PHJA 2DGYA 3RZDH 4OWWB 3KDFB 4POGA 1G291 4LUVA 2RCNA 4P71A 4DV7L 4A3MH 4LF8Q 2WAQE 1OTCA 4GOPC 4LUZA 4YY3Q 3HOYG 4K0KQ 2PQAA 1XPRA 4A75A 1TWCH 1CSQA 1VCIA 3CCVA 3GTKH 4TQUS 3GTQH 4JI6L 2NZHA 2VUMG 2LXKA 4BA2I 2ZM6L 4YY3L 2JA6G 4R4IA 1PH2A 1XNQQ 3HOWH 4DV7Q 2E2IH 2HHHL 2VQFL 4LF8L 1YBYA 4LF5L 3M7NA 4UP9A 1WJJA 3PO2G 3T1YL 3CCMA 2JEAI 1Z47A 2UUCL 4JYAL 1X9NA 2ES2A 1XTDA 2FXQA 3G48A 3OW2A 1Q86C 5DLQE 2YV5A 1EFWA 1X6OA 1YJNA 1UWVA 3CW2C 4WJ4A 3ERSX 1OXUA 2K4KA 3D31A 4DR1Q 5FLXc 1RL2A 5M3MG 4DR5Q 3PV0A 1FGUA 2Q2HA 4GN3B 1IBKQ 4DR7Q 5C44H 3RLNA 1UEBA 2UXBL 2Z0SA 1JJGA 2EIFA 2CCZA 2MO0A 1KC8C 3J81c 1PVOA 1JT8A 2RF4A 4NB3A 3RLFA 4YHHQ 1UE1A 4XTCS 1PA6A 3K7UC 2VY3A 3BU2A 4FDBA 3PF5A 4GKKL 2NZOA 1FL0A 4NXNL 3MEFA 1FJGL 3F2DA 2UUAQ 3HOZG 3H3VI 3B6YA 3AQQA 1BBWA 4GOPA 4X66L 4DV5Q 1Q7YC 3S1MH 2LXJA 5H1SE 4B3ML 5C4XG 4L5TA 4JI2Q 2ASBA 5LMUQ 3I2ZA 3CCQA 2NVTH 1QZGA 3CP0A 2OQKA 2JA5H 3HOUG 1X3GA 3H0GG 2YU9H 4IFDJ 1SMXA 2F3IA 2H5XA 1HZAA 2JE6I 3H0GH 4JI5Q 3HKSA 4BBSH 4C2MH 2VL6A 2VQFQ 1KQSA 5LMNW 2CWAA 3K81C 2MO1A 1XMOL 2KENA 3CCJA 3F1ZA 4LW1A 1N36L 4A76A 4B3TL 2JEBI 2E5LQ 2CQOA 4GLVB 2BH8A 1L0WA 4K0KL 1IYJB 1A8VA 2ID0A 2UUBQ 3GTMH 2IT1A 1HZBA 5LMNL 3GTGH 4GKJL 2UUBL 1VQGA 2PI2A 4GLAC 4LF6Q 2BA1A 1D8LA 3ZJYC 1N32L 3A0JA 1HZ9A 1N36Q 1YZ6A 3KOJA 3G4SA 2OWOA 4IOAA 1Q46A 2UUCQ 4JYAQ 1J5EL 1UE6A 3W1GA 1AH9A 1H95A 2GN5A 1J5EQ 3GTPH 3KF8B 3WWVA 1C7YA 3ULLA 3I56A 2NN6I 2UXCL 3L0OA 5FJ8G 1HZCA 4DAMA 5IYCG 2MNAA 3HOUH 4HJ8A 4JI0Q 2R7ZG 4YCWA 4LFCQ 2HT1A 2JA8G 4BA1I 4IO9A 2ZTDA 1GO3E 3ULPA 1BBUA 1J6QA 3STBD 1K73C 4MZ9A 1Y1VH 2Z6KA 4JI5L 4OX9L 3PO3G 1IL2A 3J7ZC 1QZHA 2BH2A 1FJGQ 4O2DA 1Z9FA 5GAGC 1YI2A 3UDXA 1SFOH 1YITA 5JJLA 2HIVA 3RZOH 4A3FH 4XIGS 5C3EG 3JC66 4P72A 3OYYA 3GDEA 5M5YH 3JAMc 1V43A 1XPOA 4A93G 1N34Q 1YHBA 5ELOA 1X55A 1HNZL 3CMEA 3VDYA 2I5HA 1Q82C 1I94Q 4DR2L 1KRSA 2IX0A 3KF6B 4GKKQ 4QQBX 1S3OA 1VQ4A 1SR3A 4DR1L 3IRBA 2WB1E 4MTNA 4JI2L 1EQRA 2NVQH 4A3IH 2ZJQA 2A1AA 1QUQA 1CKNB 4H02A 1R9TH 1SLJA 4DK6C 2UXBQ 1WCMG 2ZJRA 3TS0A 2E8GA 3NELA 4P75A 1L1OA 3SGIA 1YJ9A 2YTYA 1XNQL 1OXSC 3PSIA 3A74A 3PUWA 1SROA
chains in the Genus database with same CATH superfamily
4JI8Q 3CC2A 4PZ6A 5E4WC 2JA6H 4G7ZC 1LYLA 3S1QB 3CC7A 2K6AA 2IPKD 2F3VA 5E7NA 3J81j 3T56B 4BY7B 1CTMA 4FVMA 3A7LA 4QF4A 1SYCA 3G7LA 1DGSA 3A56A 4FXGC 3A8JE 1QVFA 2KECA 3TP6A 2Y0SG 2ENBA 4ABNA 1Y1VG 2PZWA 2KCNA 2JA6B 1ZYRC 4OO1H 4KN4C 3K7AB 2K14A 1D5XC 1IW7D 1KAAA 1KHIA 5ELDA 2JQOA 2RHQB 4YWKA 1MSHA 1I6HH 1K9MC 3T1HQ 4UPAA 1Y14B 2Y0SE 2E5LL 3QWNA 3I4MG 2KVMA 1O78A 1B44D 4LF7L 4HTHA 3I55A 4JBMA 2F0WA 1M1KC 1F2MA 3J80E 1VQMA 4DR4L 3NE5B 4DR5L 3C46A 4JI7Q 4A3DH 1HJPA 1S5DD 4IPCA 2J0TD 5HY6A 5ISRA 1FNVA 5EAYA 1HNXQ 3O13A 3EN2A 2RVLA 2YYZA 3T1YQ 4JG2A 2K75A 1GM5A 2B63B 2HDMA 3EBEA 2F52A 3AFQA 1JJCB 1PFMA 5JEAH 3E0JA 4APVA 2A6HC 3P20A 1CFMA 5KNCA 4A3MG 1Y1VB 2Z8LA 3R93A 1G8ZD 2WV6D 1NSNS 1IBML 3EJIA 2PW7A 1IKMA 4LFAL 1K8GA 1VF5C 4IPGA 3A5UA 1KLGD 3T13A 4LF5Q 1JR0D 1LTAD 1DZ1A 1E1TA 2F4VQ 1WCMB 1O7LA 4B3RQ 4C3HG 1MKHA 4U68A 1EYGA 1YEZA 2WB1B 1ESRA 4JOIA 2WINB 1BCPF 3MEHA 3W5OA 1HQRD 1S5BD 2MJ8A 2JA7G 2IL8A 3HOVB 3S15B 4PG3A 4JI4L 3BDLA 4B3RL 3HOWG 4A3KG 2Q8TA 1ILQA 1K3BC 1ESFA 1YNXA 4DV3Q 4DUZL 4HSVA 1CSPA 3OHXC 1GD7A 3EIVA 3BG3A 2TMPA 4DR3Q 4BBRG 1KABA 2C9OA 4H44C 1PH3A 4H0LC 4GLXA 4CHTB 1U9RA 2AKWB 4OEMB 3RN2A 3HOXG 1ENCA 1XWEA 3BJUA 2XRQD 3QR8A 5JVG3 2K28A 5FO9B 4F88A 3K5LA 4LF4Q 2AQ2B 1YJWA 3LGJA 5DAUA 4XQQA 1A2TA 2F0QA 2ALYB 5C0XG 3K7AH 1IBLQ 4GN4B 1E2WA 1BOSA 4AQYQ 2UU9Q 1IKLA 1W3SA 1LTTD 2A68C 1PMRA 1JICA 3NK9A 2E2IB 1A3UA 4JI1L 1II3A 3T53B 4A3JG 3KF8A 1G51A 2NB0A 3PIPA 2X6LA 4ZUIA 1BDOA 3Q8DA 4DV4Q 3HG9A 4BBSG 4RHRA 5IYDH 3K0XA 1LTBD 4DV0Q 3CAMA 1B9NA 4HAEA 4NW2A 1XYIA 2FJ2A 2TSSA 1TVXA 2B63H 2D62A 1NY4A 1TXYA 1F9SA 2Z6BA 4BY1G 4A3CH 4BY1H 1Q90A 4X64Q 4ID6A 4BY7G 1SE3A 3TZUA 4CJ0B 1Y8OB 2R93G 3OSOA 3PUYA 2YTXA 4A3EH 1RODA 3UE0A 5J3BA 1M8AA 4RKBA 3E6ZX 4DR6L 4DFAA 4EQ5A 4A3KB 1Y1WH 1NMGA 3RUZA 4FO2A 2KJXA 3AB9A 2BDOA 1WTWA 2Z6KC 5CYUA 2PMZE 3GP7A 2KOLA 1D5MC 2NZ1D 1SRUA 1V1PB 1Q12A 4JOIC 5JJZA 2WB1G 1O7IA 5CV5A 4A3IB 3TQYA 2AHOB 3J80i 3ER0A 2KCMA 4J15A 2ZTCA 1HUNA 3DLLA 1KRTA 3KYHC 1SEBD 2HUGA 2VB2X 1DCZA 2MQHA 4KHZA 2EVBA 4GNXA 5K36G 2FMCA 4JI7L 5COYA 2N49A 2F03A 4GKJQ 3S17B 5I6YA 1GUGA 1V9PA 1DOMA 3S2DB 4L5QA 3H91A 5EKIA 4RCOA 5M3FH 2IX1A 3CHBD 4MHEA 1PYBA 1V1PA 4JI1Q 3D3RA 3S1NH 2IHFA 4L5RC 1SNPA 1AE3A 3NXWA 1B3QA 4JI0L 2QEXA 4DK3C 4OO1I 4DR4Q 1HUMA 4YCVA 4DNTB 4X66Q 1C0AA 3K58A 2L11A 4OONA 4IURA 3W1BA 2N3SA 5D3DA 5KNDA 3SR1A 4LF7Q 2YTVA 1QVGA 5JPNC 1BCPB 4EQPA 2IY5B 1WTVA 4MNOA 1X3EA 2F0NA 3I4LA 3T1HL 4A3BH 1PH6A 1EIFA 1JWUD 3NTIA 1HNXL 3CQZB 2E74C 5EPLA 3V2TA 1I3QB 3DWQA 1PDQA 1MBYA 2B2YA 4DAPA 4DUYQ 3I7FA 3M3YH 2QW7A 4N8X1 1WD0A 3J7A5 1K8OA 3AEVA 4JI3L 5IP7H 2QA4A 3BZDB 2ICEC 3T51B 4DAYB 3G6JB 2E2HB 5FLXE 5JOBA 3GTOH 5ELNA 1CZWA 4PZ8A 5CV8A 5T1GA 3RN5A 2ATWA 3S1QH 1SNQA 5C44G 2Y0SB 4OXPA 1IBKL 3OIPA 3IFTA 4XYQA 2B2TC 5M5YB 4S3SA 3TP8A 2RDGA 4GOPB 5I2XA 3GTMB 2DGYA 1F9PA 3UI2A 4OWWB 4LUVA 4A3MH 4GOPC 4DA2A 4LUZA 3AU7A 3HOYG 1TWCH 2XN9C 2O2LD 3GTQH 3GTKB 4U673 1STYA 3BDOA 4J1MA 4RGOS 5CV7A 3I4NB 2ZM6L 4BA2I 2D2CC 1PH2A 1XNQQ 2VQFL 3SE0A 4LF5L 1B9MA 1G2SA 1WJJA 2JEAI 1CHQD 3Q24A 2K04A 1D5ZC 1STNA 1RL2A 2EOTA 4DR5Q 3C2PA 2K7VA 3DHQA 4GN3B 4E6IA 1G91A 1RHPA 1TS2A 3KK7A 1RTOA 1UEBA 2QDBA 3FPUB 5KIXA 1HFGA 2XRSD 1JT8A 1PA6A 2PCFB 3TMEA 5DM73 4NXNL 2RSOA 3OOCA 3AQQA 5LHY1 3QO2A 1STAA 5J1ZA 2NVQB 3I2ZA 2Q8RE 2F0SA 3HKSA 5M5XB 4C2MH 1KQSA 4PNYA 4V0BA 5C4ZA 2KENA 2EYJA 4LMQD 5K5PA 1ET6A 1H9RA 1N36L 2E5LQ 1LT3D 1GHKA 3R3OA 2UUBL 3I3CA 2PI2A 4GLAC 1D8LA 4UAIA 2KQ3A 5I9OA 2R7ZB 3IFDA 1N36Q 3KOJA 3OWEB 4IOAA 2BE5D 2UUCQ 1EQVA 3W1GA 2K5WA 1J5EQ 3KF8B 3WWVA 1BNZA 3I56A 1MD2D 1X3PA 3Q22A 4JI0Q 4KV6A 4OIJA 2HT1A 3S9WA 4IO9A 2ZTDA 1GO3E 4R9WA 4MZ9A 1SYFA 3PO3G 4O2DA 1Z9FA 2CVRA 5GAGC 3OW7A 1SFOH 4A3FH 5IGEA 4P72A 3GDEA 1V43A 4K8IA 3CMEA 4C3IG 3HEJA 1KRSA 2IX0A 3KF6B 5C6AA 4Y7NB 5T1IA 3D4DA 4QQBX 3JAML 3CKIB 4EVOA 2WB1E 2Z1CA 3I90A 5C4JB 2ZJQA 1SLJA 2UXBQ 2LY7A 3I70A 1K8MA 1ENAA 5CMDA 2ZJRA 1AN8A 3HOZB 1L1OA 5M9OA 2L5TA 2YTYA 1XNQL 3PIOA 1JWSD 3PUWA 1IW7C 1EZ6A 2B2WC 1GVPA 4IPDA 1WOCA 1S5FD 5AFWA 1PZKD 1N32Q 1Q8KA 1AW7A 1VQFA 2NTTA 1KDCA 2DJFC 1B8AA 5C0XJ 4JV5Q 3MXNB 4DV6L 2F0JA 1H9JA 4A3LG 2NBFA 2QDLA 3DEPA 4HIDA 2F0TA 3GD7A 1JWMD 1Q81C 4HJAA 4NKLA 1JE5A 4KD3A 3VYSA 1QNKA 2LS01 3NQTA 1H9SB 1QE6A 1Y8NB 2O5JC 5M3MH 2D0OA 2HQEA 2Q2IA 1NR4A 2F0DA 5C0XI 2RDHA 3HOZH 1F9RA 5ELEA 1SYDA 2MGSA 4IZ8A 3J7AF 1M90C 2F4VL 3BZKA 1X65A 4P74A 1TY2A 3W3AA 3T4AC 4DUYL 2EY2A 2N55A 4F7XA 3SK5A 5FLMH 5IE8A 2BOSA 1NUCA 1VQIA 2Z4IA 3A55A 2PNRC 4B9WA 4UDUC 5IYBH 1H9KA 4TRDA 4BS9A 1LTRD 5IYCH 3NTKA 1TS4A 4JI3Q 3H3VH 2EYOA 1ZXTA 5HURA 2CFMA 4BXXG 4UP7A 2HDLA 4IUPA 4DV0L 3GV6A 5DNFA 5E1FA 1E3PA 4PV1C 1CKOA 2BDNA 4B08A 3J7AV 1LM0A 3SEBA 2LMCB 1DYQA 3F2UA 2P5ZX 2JK8A 1XJVA 1TR5A 1D1KA 4RWSC 2I0QA 4KKUA 3OMCA 1IXRA 2IX3A 4ZK9B 4QY7A 1WCMH 1WTRA 1PZID 1HTLD 3L2PA 3X3MA 2JA5G 1I6VC 1LTID 3MFGA 1A3VA 3VYTA 3GTLB 1EZ8A 1QVCA 2B29A 1KXLA 4RKLA 1I4XA 2XWJB 1SE2A 2F0FA 4HSPA 4FYDA 4FF1A 1SAPA 1EU3A 4A3FG 3CPWA 5GAHC 1PRTB 1EQQA 4G7OC 2E2JH 5L37A 2EXDA 1W6JA 1G6PA 1P8LA 4A3GH 1S72A 5AJ3Q 2NUCA 4QIWB 4LAAA 4DXFA 3L7ZC 1EEID 1MJEA 1ILPA 3MXGA 4RCNA 1LACA 2AWOA 1PTOD 2DUDA 2QCPX 3RZDB 1UE5A 1ASZA 5AJ3L 4EQNA 4UY8C 4CDDC 1SMYC 5A2QE 3KBXA 4X62Q 1SSOA 3FP9A 4X64L 4RFBA 2KBNA 5M5WH 3JAMi 4IJLA 1WFQA 3MXPA 3D4RA 1SYBA 4AYBE 1YHQA 4DV1L 2I5LX 1A3TA 3M85A 1CQVA 5IP9G 5EBDA 3GO5A 1HNWL 3VR2A 1Y8PB 1PV4A 4XDXA 1NMFA 1VQ9A 1DONA 5BR8L 1DJRD 1HR0L 1JOKA 4NXMQ 1BVSA 2RBMA 4OIKA 1TWHB 3ERQA 1Z7TA 2OTLA 2UXDL 2VZAA 4R4TA 2VXWA 3S2DH 3D4WA 2CWPA 2K05A 1FGBD 1N9WA 1X56A 2XVSA 4LFBQ 1O7YA 5C3WA 2VUMH 2K5HA 2LSSA 1VQLA 4FXDA 4XT1B 3K80C 5EPJA 4C3HB 3VR3A 4KMUC 2ZXPA 4IUQA 2N78A 4DNRB 2YU9B 1R9TB 1KNAA 5JEAG 4C56C 1PH8A 3CCSA 3M7GA 5M3FG 2A69D 1XMOQ 2CH4A 3EFXD 5IWAQ 3OTOQ 2D5DA 1HQMC 1PFSA 3Q6SA 1TWFH 2AQ3B 3FKIH 2R3ZA 1JQYD 4IOCA 3TP5A 5FLMG 4A4IA 3OTOL 3TDQA 1LABA 3K57A 2HCIA 5IWAL 4DAVA 2EJMA 1JC7A 4NPSA 4JI6Q 2B39A 4QB4A 3ND8A 3T16A 4G57A 1YNJC 4WJ3M 1EIGA 1EWHA 2VUMB 3AFPA 1KD1C 1FD7D 4R8IA 2JA7H 2Q2UA 1EWIA 2SNMA 3HKZE 2JA8H 5G3LF 4K5WA 4A3BG 1L1OB 3CD6A 2SNSA 3I91A 1N34L 1SYGA 4KKSA 3NHHA 1SE4A 4HJ9A 4C3JG 4LF4L 3ICEA 3RZOB 3I4OA 5HGTA 5IP7G 1NBWA 1FR3A 4DV1Q 1WVLA 1C9OA 5FOBB 4LJZC 3RR5A 5CORA 4JW0A 1BQQT 1VF7A 4J6HA 5JVH3 4TVAB 3VR5A 3E5SA 4BBSB 2DNEA 2NWGA 3CPFA 2NTSA 1AE2A 4WORA 5NUCA 1PH4A 3I4MH 1NTGA 2ZTEA 4DGZA 4DV3L 3QG1A 3RLOA 1GUWA 1QG7A 4KJNA 1B4OA 1TWCB 1I4GA 2R93B 4JI4Q 3MC0B 2CKZB 1IYUA 5IODA 4DR7L 1PRTD 3HOYH 3LNNA 1I3QH 3M4OH 1A6XA 3DEOA 5C4XH 1PRTF 2F0PA 2RQXA 5I2YA 1K83B 5JEAJ 1MGSA 4YWLA 2DJGC 2V1CC 1N33L 2SDFA 2O4XA 5CBEE 2ZJPA 1O7ZA 5LMUL 3GTOB 4HMIA 3S14H 4KKTA 3NTHA 1P16A 1A0IA 4JBKA 4B9XA 2PMZB 1PTOC 1EY5A 4KY7A 4RGNA 3HOVH 3S15H 1TWGH 1SNMA 2B2VC 5FO8B 2CH4W 1PHJA 4IALA 1SXTA 1EWCA 3KDFB 4POGA 4P71A 4ZLTF 2WAQE 1OTCA 4YY3Q 4WRDA 1I50B 1LT5D 1VCIA 1EYDA 3CCVA 4C1NI 4TQUS 3GTKH 3GTQB 3C1FA 2PPBC 2X69A 1VDZA 2VUMG 3J81E 2Z4HA 1JORA 3HOWH 5JPMC 4DV7Q 4LF8L 1CA5A 1SJHD 1X9NA 2ES2A 3OW2A 5DLQE 2K33A 1YJNA 1DOLA 4A3DB 3D31A 3HRZC 5M3MG 4K14A 3OMGA 5FLXc 5M3MB 2Z9HA 4CKBA 1JJGA 3K0YA 2EIFA 1M4VA 2CCZA 2MO0A 4OL7A 1PVOA 2RF4A 5EKKA 4YHHQ 4XTCS 2NN6H 3BU2A 1FL0A 1HRJA 1PFBA 3MEFA 5CV9A 3BVZA 4DV5Q 2BE5C 4JVZA 5H1SE 5LMUQ 2NVTH 3HOUB 4IFDJ 1QZGA 4NMZA 3H0GG 1SMXA 2F3IA 2JE6I 3BYTB 3H0GH 5CBAE 1HXYD 5IT9L 3DXJC 5I4DA 2CHBD 2CWAA 2MO1A 3EVQA 1HPCA 1XMOL 5I6WA 2A6ED 2ZXOA 4L8JA 2CQOA 5D14A 1SNDA 1MHWC 2EPBA 1QILA 5F2DA 5LMNL 1Z6HA 3GTGH 4GKJL 4J8QA 1Q3LA 5IGDA 5C4HA 1UEAB 4ODGA 4CDEC 1N32L 1HZ9A 3BYYB 5IGBA 3D6WA 3G4SA 2ZT9C 3NPPA 1UE6A 4A3JB 3GTPH 1ICFB 3EROA 3L0OA 4RAUC 5LL6S 4DAMA 2MNAA 3HOUH 2F1MA 1CT1D 4BA1I 1O80A 4O1NA 1J6QA 4JI5L 1Y1VH 2KEEA 1IL2A 1FJGQ 2EXZA 3UDXA 1YITA 2HIVA 5DM63 3AMUA 2QEJC 4XQJA 2A74C 1HTPA 5ELOA 1S5ED 1HNZL 3VDYA 2I5HA 1Q82C 3J81L 1U4RA 3URYA 1VQ4A 1SR3A 3IRBA 3NBHA 1KDAA 1EQRA 4A3IH 2F0IA 1QUQA 4H02A 3K5NA 1RJTA 3R2TA 3NELA 4XXEA 2F0LA 1NNXA 2FINB 3A74A 1LTGD 3U9SA 1UE7A 2PQAB 1VQEA 2B2YC 1RCVD 2L9HA 2A6EC 1IZ6A 1WTXA 3LX0A 1GUTA 2M00A 3ITPA 5D65A 3H94A 3KLRA 2I07B 1OXVA 4OX9Q 2IWHA 2PO4A 3MA2B 2ZM6Q 1PH5A 4IFDG 1STHA 1VQ5A 1KL9A 4HMJA 2A68D 4X65L 3FEWX 2L1BA 4IUUA 4WJWA 2K5NA 1VQCA 2JJQA 2CQAA 1PLFA 3PUXA 4O0AA 1CUKA 1IL8A 4R1JA 5IT9E 5KEEA 3FKIG 3HOVG 4DKAC 4KN7C 3TP7A 1W6KA 4I7AA 1N8RC 4CKEA 1ONLA 2KUMA 1TU2B 2WKCA 4BBRH 3NSWA 2JYOA 3M3YB 2GVAA 3NWSA 4Y52H 2KCCA 4FNFA 2RDFA 5IGFA 2A5HA 3HOXB 2HHHQ 1F2YA 1HA6A 1RTNA 2J7ZA 5C0XH 3FHWA 4DR3L 5BR8Q 5GADC 1HFNA 1HNWQ 3HZXA 4RGMA 4ULLA 3G71A 3ULJA 3S16H 2PQEA 2EYMA 4NXNQ 3PO2H 3ONAB 2WACA 3HOXH 4A93B 1QWYA 3I4NG 2UXDQ 2HCCA 4GN5A 5IGCA 3R8BA 4HN7A 5IOCA 1SE8A 5BN5A 2M9VA 1BKBA 2K50A 4A3GG 3H3VC 3UDFA 1RF2D 1A63A 3Q0AA 1NJIC 3TREA 3GTJB 5FKAC 3BVGA 1PH1A 1N33Q 2K03A 4BY1B 1VQDA 1UNSA 3GQBA 4A3MB 4ALPA 4X3UA 1K0RA 2C5CA 4BY7H 1EOTA 1NR2A 1QNUA 5EKLA 1VQPA 2PNHA 1TS3A 1X54A 3HGBA 4LF9L 2R7FA 4NDXA 4H13C 4L5SA 3CCRA 2D0PA 2BCOA 3FDTA 1YNJD 5C44B 1AFPA 2F0EA 1LUZA 3J80L 3P75A 4JV5L 2QGQA 3KLSX 1B2TA 3PF4A 2I46A 2VQEL 3I4MB 3FVQA 1X3QA 1DOKA 1U4PA 2E2DC 3ND9A 4MIUA 4DPGA 1BCPC 1PH7A 1F2ZA 4B3SQ 3VYUA 2EY5A 4LF9Q 4H7BA 4BBRB 1GUSA 1VQ7A 2GA4B 4QL5A 4PMWA 1T5XD 4DN4M 3U4VA 4L63B 1LLRD 1PH9A 2L15A 1ICWA 1U0LA 1G6ZA 4G4KA 5HGQA 1ML0D 1XNRQ 1LO5D 4CDFC 4DV2L 1WD1A 1HR0Q 1ET9A 4JPBW 4KI0A 1EY6A 3TS2A 2R7ZH 4LFBL 1U4MA 5K36H 1QJOA 2MHVA 3DMUA 3HKZG 3A8IE 2OT2A 3AYHB 1L1OC 3J7YW 2B2VA 2Q2TA 1XNRL 3PO2B 3K5OA 4JBJA 1CM9A 1LV9A 1WTHA 1NE3A 4UP8A 1XTCD 2GVBA 2E2HH 1S5CD 1JOQA 4FF4A 5CV6A 3M4YA 1J9OA 1VQJA 3CRLC 4KD4A 2XTIA 4P2CB 1E1OA 4XQNA 2R92H 4ILWA 3KJOA 1TWAB 3MHBA 2OCEA 1STGA 3CF5A 1EY0A 4A3FB 1FYCA 2RA4A 1V1QA 3NBHB 4PQXA 5CC4A 1AP0A 4NP5A 1XMQL 1UUPA 3S1RB 4IUTA 1E2VA 1PTOF 4JCVE 3SK6A 1I5FA 1SMYD 4OELB 4I7ZC 2NVTB 1VQ6A 1LTSD 4JK1C 4TKOB 2NN6G 3MTSA 5EGTA 4IUNA 3G6EA 4C3JB 1YHAA 4IN3A 5IT9c 2C35B 3FRPB 4G7HC 3HOYB 3M4OB 1EIHA 3KJPA 4AYBG 3I4NH 3IL8A 1D2BA 2WAQG 5GAEC 3TZDA 3D6CA 2NVYH 2A8VA 5GQOA 1B50A 3PGZA 2KHIA 1STEA 1K28A 2RKSA 3ZYYX 3H15A 3U9OA 1Q8IA 2DNCA 2O5IC 4QJFA 5JJIA 5IP9H 3S1MB 1YNNC 2KHJA 1GOZA 3NQIA 3HS0C 1JB7A 3D0FA 2RHSB 1CQFA 4DV5L 5JAVA 4HIMA 1E0BA 2G9DA 2B63G 4A3CG 5C4JH 4DV4L 3PUVA 4GZYC 5GROA 1A62A 1VQHA 2L55A 1T9HA 1WYDA 2A69C 3J81i 1DXMA 2EYHA 4JC0A 1VQAA 2R93H 2M2LA 1Q1BA 3TEHB 2B2UA 2WFWA 1OO9B 1DD2A 1E24A 3NENA 2CW0D 4A3EG 2HIXA 4MN3A 4V190 2QILA 4A3DG 4R4OA 2A6HD 2K32A 1ASYA 5C4XB 1VQ8A 1GUNA 2XWBB 1F2LA 4R4QA 1K0SA 4QIWE 4EQOA 2B8GA 2DN8A 1GXDC 3E0EA 5IIFA 4XT3B 1WTPA 4R8NA 3QOLA 5BN4A 1VQNA 2F4IA 3UDGA 3MXUA 4YHHL 1CKMA 3PMFA 1J8IA 1GHJA 4M8AA 4IFDI 1ZEQX 2NYZD 4DR2Q 2UUAL 3BDCA 4CKCA 1HNZQ 1TWGB 3LWEA 4K2LA 1XXGA 2F0GA 5A2QL 3SK8A 1V1OA 1MI2A 1ZKOA 1Y1WB 4CDCC 1S4ZA 1G291 4ZRZA 4DV7L 4LF8Q 1GJXA 4IFDH 4K0KQ 1TIID 1XPRA 2EZVA 4N8FA 1X32A 1BBXC 4YY3L 2JA6G 3HP3A 4R4IA 4ZCKA 1A2UA 2V4DA 2E2IH 3GTPB 3SHLA 1YBYA 3M7NA 2K5QA 3T1YL 1Z47A 4QUCA 4JYAL 1XTDA 3G48A 3HKZB 1EFWA 1Q86C 4IUVA 2YV5A 1RDPD 2QKIC 1UWVA 3CW2C 4EGVA 2K4KA 4DR1Q 1SNOA 4DR7Q 1FGUA 2Q2HA 2K1BA 2B2UC 4ME5A 3RLNA 4FF2A 2Z0SA 4RGTA 1G2TA 1KC8C 4C1NK 5FO7B 4KK7A 4NB3A 1UE1A 2EY1A 1FNUA 2B8FA 2VY3A 3PF5A 1IHZA 4FDBA 1CI3M 2UUAQ 1L0XB 3H3VI 3B6YA 3E3XA 1Q7YC 1SNCA 3S1MH 4B3ML 3QOJA 2FFKB 1MSGA 3CP0A 2OQKA 2JA5H 2SEBD 1STBA 1X3GA 3HOUG 4DF7A 5J22A 1HZAA 4JI5Q 4DU9A 2R61A 3I73A 5J39A 1F9QA 5LMNW 5EQ0A 3K81C 3CCJA 3F1ZA 5C5MA 2E2JB 3PIP3 4A76A 3H09A 3KBGA 4GLVB 2OF1A 4TSSA 2BH8A 5KYLA 1IYJB 1CHPD 5IGGA 2UUBQ 3GTGB 2F3WA 4A3BB 1VQGA 4LF6Q 5KGUA 3R2IA 4M1UB 1YZ6A 1EY8A 2PYKA 2JN4A 3K5MA 2NVXB 1J5EL 4DK1A 1AH9A 1H95A 2GN5A 1F77A 2OXPA 3MFYA 2NN6I 3V96A 1JE4A 5FJ8G 1Y69U 2EJFC 4HJ8A 2R7ZG 1ZYRD 4DK0A 3ULPA 1K73C 1BBUA 4OX9L 3DWAA 1QZHA 3IAYA 2OEOA 5JJLA 4FXKC 4XIGS 3JC66 4K5VA 5M5YH 1BF4A 1SDFA 1XPOA 1HCZA 1YNND 3C3LA 1I94Q 5KRUA 4LK1C 4GKKQ 5E3FA 2VB3X 1S3OA 2EYFA 4DR1L 2JA8B 2RSNA 1EYCA 1JB3A 3N52A 2PW5A 4A3EB 4DK6C 3TSSA 1I4RA 3PQIA 3NUCA 3A7AB 3TS0A 3WOEA 4P75A 2XSCA 4C3IB 3PSIA 1LTLA 3LWUA 5C3XA 1SROA 2K5VA 4LWCA 2XIWA 2R7DA 1EQTA 2R92G 3F8TA 1U5KA 2A73B 4DV6Q 3V05A 5LMNQ 3CCLA 1R4QB 3TN2A 2X6GA 3GTLH 1PTOH 4GNXC 3GTJH 4B3MQ 2UXCQ 4A93H 1KAWA 2LFNA 4CGYB 4P73A 3UE1A 1NCVA 1S40A 2RCFA 2K01A 4X3KA 2OTJA 1V8QA 2OQ0A 4CBVA 1PYSB 2IW3A 4PZ7A 4C3IH 4QGUA 4KLKA 4C2MB 2EY6A 2ICIA 4OWTB 2E76C 2EQSA 3WDNA 1XMQQ 2E75C 4OHJA 4DR6Q 5C3EB 4RMFA 4HJ7A 1B53A 4RA8A 4AIMA 3HFZB 1SN8A 3M4PA 2F0VA 3PO3H 4F87A 3S14B 2WP8J 4MTKA 4N9TA 3NP8A 1B3AA 2N8NA 2XGTA 4RH6A 3QIAA 4LNQA 1TS5A 4YWMA 1EUJA 3P1HA 3F2BA 2JSOA 4ZAIA 4A3LH 1PRTC 1L2FA 4LF6L 2IJ0A 3DM3A 2H4OA 1AZPA 2F0KA 3KLWA 3CCUA 4RG1A 3JAME 4KTAA 1KIXA 1GKHA 4BWGB 3BVMA 1EIYB 1VQBA 3F2CA 4ZYSA 4JBWA 2AQ1B 3A5ZB 1LT4D 4KHPL 4X6AH 1A15A 1BXTA 1OXXK 1C8CA 3S2HH 2LKVA 1I4PA 2HQLA 3I72A 3E9HA 3CCEA 3QJYA 1FNWA 3KLSA 1WI5A 1I6HB 1YVCA 4ZKCB 1E2ZA 4HIOA 1BCPD 1OXTA 4DV2Q 5M5XH 4CJ2C 5BN3A 3KDFA 1CKNA 4LUOA 3CXCA 3S2HB 2B3GA 2JA9A 1QUQB 2EJGC 3A54A 1B70B 3NWTA 3EA6A 1TY0A 1HR0W 3TRZA 1TWAH 1VQKA 4NXML 2AMCB 2JXMB 5G3LD 1L0YB 4K2KA 3VA5A 1HH2P 3E9IA 4XYOA 3EQLC 1XPUA 2BA0A 3J80c 2IHEA 1VMCA 4KHVA 1SYEA 3STBC 1JJ2A 5TSSA 1QOHA 1T5EA 1EL0A 2VQEQ 2A19A 3BZCA 4I65A 4AH6A 3S1RH 1B7YB 4IQZA 5IYBG 4X62L 1SFOB 2SOBA 3KFUA 4OWXB 4IJHA 1U4LA 3X3NA 3SXHA 4K5XA 2I5MX 2J4XA 1TKWB 4BXXH 1AZQA 5C3EH 4DUZQ 3PCOB 3PUZA 4C3JH 3NEMA 4AYBB 3PO3B 4Y7NH 1IYVA 5ELFA 1X3FA 1EY4A 3U58A 2N88A 1D7QA 4DAYA 1SJED 3P7JA 1EY7A 2MUYA 2EDGA 2G5DA 3MXNA 1LT6D 4EX5A 1HHVA 4UHVA 4PMCA 1KLUD 4AQYL 2UU9L 3M9BA 3S24A 5E4XA 3U4ZA 2EYLA 3MZ5A 3C1EA 3KF6A 5I9PA 1K83H 1EOVA 1BR9A 2ZXRA 5FJ8H 4KHPQ 1Q1EA 4GS3A 1RIPA 3CC4A 5IYDG 2KA7A 2DY7A 1CK1A 3L3OC 1I50H 3H6MA 1I4HA 3K8AA 4A3IG 1IBLL 3U50C 2R6GA 1VQOA 1PXUA 5KYIA 3CMAA 4DNIA 2VS1A 4IPHA 4FF3A 2F0HA 2PI2E 3FMCA 4ZUJA 1RD9D 2L0CA 3DM1A 5EJWA 5LL6X 4HJ5A 1JCKB 3RNUA 3RMHA 2L4NA 3OPOA 1AEXA 3KUPA 5JJKA 4B3SL 4PMBA 4POFA 4QCLA 1Y1WG 4R4CA 5IY0A 1NAPA 2WKDA 4JI8L 3M4QA 1IBMQ 1C4QA 4HIKA 5CR3A 3RD4A 1R4PB 4A3KH 4HCEA 2VNUD 2K5DA 3VA7A 5ELCA 4HCSA 4HEDA 1VS0A 5C5LA 2MP1A 2F0OA 1TWHH 3I8ZA 5FLXL 4Z9CB 2NVXH 4LFAQ 3SDZA 3VR4A 2VW9A 2HD3A 1FVIA 1H9MA 1XX8A 4ME3A 1B1ZA 1MIUA 1UAPA 1E7ZA 1I94L 3H0GB 4LFCL 1MJCA 3CU7A 2AUJD 3CQZH 5CV4A 4KJOA 4GNXB 2KEDA 1WTQA 3PIO3 1C48A 1K3RA 4F8MA 4A3JH 1PFNA 1K8AC 3MVVA 2L12A 5M3FB 2QF7A 2PZUA 1E22A 3OWFA 1KDBA 1TT2A 1TQOA 3GV3A 4ZQ3A 3S17H 2JA5B 1JMCA 4KY6A 3UDIA 3MWYW 3S1NB 1CZGA 1W2BA 2MFIA 5A35A 2K52A 1TWFB 3FKIB 1EYAA 4KY5A 4C3HH 1KNEA 2AWNA 2KCTA 1YIJA 4B3TQ 4OO1G 4YCUA 4X65Q 3RZDH 2D9UA 2RCNA 1KTKA 3K6OA 2F0MA 2KHSA 3A8KE 2PQAA 2FHTA 4A75A 3IKJA 1CSQA 2F0UA 3SK4A 4JI6L 2NZHA 1I4QA 2LXKA 4K6DA 4K6LA 2HHHL 3BS1A 1HA5A 4UP9A 3PO2G 3CCMA 2UUCL 2FXQA 2FMMA 1X6OA 4QUFA 4WJ4A 3ERSX 1OXUA 2AUKA 2H1EA 3PV0A 1IBKQ 4A3GB 5C44H 2UXBL 4ZKBB 3CRKC 3J81c 2Q8IB 2B2TA 4CJ1B 3W2DA 1PYWD 2DY8A 2JP1A 3RLFA 3K7UC 5DEHA 4GKKL 1CA6A 2NZOA 5ELBA 1FJGL 3F2DA 3HOZG 4RHSA 3SVMA 1BBWA 4GOPA 1ENFA 4X66L 1EFID 2WIIB 1BUVT 2LXJA 4K8JA 5C4XG 4L5TA 1DM0B 4JI2Q 2ASBA 3CCQA 2PZTA 5M5WB 2YU9H 3TBIB 4WFN3 4FP5D 3DUZA 2H5XA 1EEFD 1QB5D 4OGQC 4BBSH 2VL6A 2VQFQ 2EE1A 1D1IA 1EU4A 5D3IB 3DWPA 5EBCA 4LW1A 2WAQB 2JEBI 3L9AX 4B3TL 2MPMA 4N9PA 4K0KL 1L0WA 2ID0A 1A8VA 4Q5VA 3GTMH 2IT1A 1HZBA 2EYPA 2JA7B 2BA1A 3ZJYC 2R92B 3A0JA 3WOFA 2OWOA 1H9SA 1Q46A 4JYAQ 1PTOB 4DXGA 4O42A 5EPKA 1BO0A 1C7YA 3ULLA 4HR7B 2UXCL 3VYRA 4QMGA 1HZCA 5IYCG 3K59A 4YCWA 4LFCQ 2JA8G 3STBD 1PZJD 2Z6KA 2CW0C 3J7ZC 1EY9A 2B2WA 2BH2A 1YI2A 3S16B 1SBBB 1GUOA 3OIQA 3RZOH 5C3EG 3D8GA 3OYYA 3JAMc 3QB3A 2XNAC 3N6RA 4A93G 1N34Q 1JOOA 1YHBA 1X55A 1QCBD 5FK9C 4DR2L 3NBIA 4Q0FA 4L6TB 3MAQA 4X3TA 5KNBA 1D6EC 4MTNA 4JI2L 1WTOA 3FPPA 2NVQH 3VR6A 2G9HD 1VMPA 2A1AA 1CKNB 1R9TH 4X3SA 1RKNA 1WCMG 2E8GA 3SGIA 3Q23A 1YJ9A 3HOWB 1OXSC 4YIJA 5CGKA 2NVYB
chains in the Genus database with same CATH topology
4JI8Q 1GVPA 4IPDA 1UE7A 2K5VA 1WOCA 2PQAB 1VQEA 4LWCA 3CC2A 2R7DA 1IZ6A 1N32Q 1Q8KA 1VQFA 4PZ6A 2R92G 3F8TA 2JA6H 1U5KA 1B8AA 5C0XJ 4DV6Q 1OXVA 1LYLA 5LMNQ 4OX9Q 3CC7A 3CCLA 4JV5Q 3MXNB 4DV6L 2ZM6Q 1PH5A 4IFDG 5E7NA 3J81j 1VQ5A 1KL9A 3GTLH 4A3LG 4X65L 4GNXC 3GTJH 4B3MQ 2UXCQ 2K5NA 1VQCA 4A93H 1DGSA 1KAWA 2JJQA 4HIDA 3GD7A 1Q81C 3PUXA 4P73A 1QVFA 4O0AA 2Y0SG 1CUKA 3UE1A 4HJAA 1Y1VG 4R1JA 1S40A 1JE5A 3FKIG 3HOVG 4DKAC 2K14A 5M3MH 2D0OA 1N8RC 2Q2IA 2OTJA 1KHIA 2OQ0A 5C0XI 1PYSB 2JQOA 2RHQB 4YWKA 1I6HH 3HOZH 4PZ7A 1K9MC 4C3IH 4BBRH 4KLKA 4UPAA 1Y14B 2Y0SE 4QGUA 3T1HQ 4OWTB 1M90C 2E5LL 2F4VL 2EQSA 3BZKA 1X65A 1XMQQ 4P74A 3I4MG 4DUYL 2GVAA 4DR6Q 4Y52H 4LF7L 4RMFA 5FLMH 3I55A 4JBMA 4HJ7A 2HHHQ 5IE8A 4AIMA 1M1KC 3HFZB 1SN8A 3M4PA 1VQMA 3PO3H 4DR4L 1VQIA 4DR5L 3FHWA 4JI7Q 4A3DH 4DR3L 1HJPA 2WP8J 4IPCA 5BR8Q 5GADC 5HY6A 5IYBH 5EAYA 1HNXQ 1HNWQ 3EN2A 5IYCH 3G71A 3ULJA 2YYZA 3S16H 3T1YQ 2N8NA 4JG2A 2XGTA 4JI3Q 3H3VH 4LNQA 4NXNQ 2K75A 1EUJA 4YWMA 3F2BA 1GM5A 3PO2H 3HOXH 3EBEA 2CFMA 2F52A 3AFQA 3I4NG 2UXDQ 4BXXG 1JJCB 4UP7A 4A3LH 4DV0L 4GN5A 1L2FA 4LF6L 3DM3A 4APVA 1SE8A 1E3PA 1CKOA 3KLWA 3CCUA 4RG1A 4A3MG 1LM0A 1BKBA 1KIXA 1GKHA 2K50A 4A3GG 3UDFA 1EIYB 2JK8A 1XJVA 1VQBA 1IBML 3F2CA 1A63A 4JBWA 2I0QA 3A5ZB 1NJIC 3TREA 4KHPL 4LFAL 1K8GA 4X6AH 4IPGA 1N33Q 3A5UA 1PH1A 1OXXK 1IXRA 4LF5Q 1VQDA 3S2HH 2HQLA 4QY7A 1E1TA 1WCMH 2F4VQ 3E9HA 3CCEA 4B3RQ 1WI5A 1MKHA 4ALPA 3L2PA 1EYGA 1YEZA 1YVCA 4UY8C 2JA5G 4JOIA 4HIOA 3W5OA 1K0RA 2JA7G 4BY7H 4PG3A 1VQPA 1QVCA 1OXTA 2B29A 4DV2Q 4JI4L 1KXLA 5M5XH 4B3RL 2PNHA 3KDFA 1CKNA 3HOWG 4LUOA 3CXCA 1X54A 4LF9L 4A3KG 2R7FA 2B3GA 1YNXA 4DV3Q 4DUZL 4A3FG 3CPWA 5GAHC 1EQQA 2JA9A 1QUQB 4L5SA 3CCRA 2E2JH 1CSPA 1B70B 2D0PA 1GD7A 3EIVA 2EXDA 4DR3Q 1G6PA 4BBRG 1HR0W 1LUZA 1P8LA 1TWAH 1PH3A 1VQKA 4NXML 3TRZA 4A3GH 1S72A 2AMCB 5AJ3Q 4GLXA 4JV5L 2QGQA 3RN2A 2AKWB 3HOXG 3L7ZC 1HH2P 3PF4A 3BJUA 3E9IA 1MJEA 1XPUA 2VQEL 2BA0A 2AWOA 3J80c 2IHEA 2DUDA 1UE5A 3STBC 1JJ2A 1ASZA 4LF4Q 5AJ3L 1YJWA 3LGJA 4DPGA 2VQEQ 2A19A 2ALYB 5C0XG 3BZCA 3K7AH 1PH7A 4AH6A 1IBLQ 3S1RH 4X62Q 3FP9A 4GN4B 1B7YB 4X64L 5IYBG 4B3SQ 2KBNA 4X62L 5M5WH 3JAMi 4AQYQ 2UU9Q 3KFUA 1W3SA 4IJLA 1WFQA 4OWXB 4IJHA 4AYBE 1YHQA 4JI1L 4DV1L 4LF9Q 2I5LX 1VQ7A 2I5MX 4QL5A 4PMWA 3M85A 4A3JG 5IP9G 1G51A 4BXXH 3U4VA 3GO5A 3PIPA 1PH9A 2L15A 5C3EH 4DUZQ 3PCOB 3PUZA 1HNWL 3Q8DA 4C3JH 1U0LA 1NMFA 4DV4Q 1PV4A 3NEMA 5BR8L 5HGQA 1VQ9A 1HR0L 1XNRQ 4NXMQ 4DV2L 4BBSG 1HR0Q 4Y7NH 1BVSA 5IYDH 1X3FA 4KI0A 3U58A 3K0XA 3TS2A 1D7QA 2R7ZH 4LFBL 4DV0Q 3CAMA 2OTLA 2UXDL 2VZAA 3HKZG 3AYHB 4R4TA 3S2DH 1L1OC 1XNRL 2Q2TA 2B63H 2D62A 1NY4A 1TXYA 4EX5A 4JBJA 2CWPA 4BY1G 4A3CH 1N9WA 4BY1H 1X56A 4AQYL 2UU9L 1NE3A 4UP8A 2GVBA 3M9BA 4LFBQ 2E2HH 2VUMH 4X64Q 3S24A 2K5HA 3U4ZA 2LSSA 4BY7G 1VQLA 1VQJA 2XTIA 2R92H 1E1OA 3K80C 3KF6A 3KJOA 2R93G 2OCEA 3PUYA 3CF5A 1K83H 2N78A 2YTXA 4A3EH 3UE0A 1EOVA 5J3BA 5JEAG 1PH8A 3CCSA 5FJ8H 1V1QA 3NBHB 4EQ5A 1Y1WH 4DR6L 4KHPQ 1NMGA 5M3FG 1Q1EA 4GS3A 1XMQL 1XMOQ 2Z6KC 5IWAQ 1RIPA 4JCVE 2PMZE 3CC4A 5IYDG 3OTOQ 1PFSA 1I50H 3FKIH 1SRUA 1Q12A 1TWFH 3K8AA 4JOIC 2WB1G 4A3IG 1I5FA 1O7IA 1VQ6A 3TQYA 4IOCA 2AHOB 3J80i 3U50C 4A4IA 5FLMG 2R6GA 3ER0A 3OTOL 1VQOA 1IBLL 2KCMA 2NN6G 4J15A 5IWAL 3CMAA 4NPSA 4JI6Q 2ZTCA 4DNIA 2VS1A 4IPHA 3G6EA 3DLLA 1KRTA 3KYHC 2PI2E 4WJ3M 1YHAA 3AFPA 2MQHA 4KHZA 5IT9c 1KD1C 2JA7H 4GNXA 5K36G 3PIOA 2Q2UA 2C35B 1EWIA 3HKZE 2N49A 4HJ5A 4JI7L 2JA8H 3RNUA 4A3BG 3KJPA 4GKJQ 4AYBG 1L1OB 3I4NH 3CD6A 1V9PA 5JJKA 4B3SL 4POFA 4L5QA 2WAQG 1N34L 1Y1WG 4R4CA 5IY0A 5GAEC 2IX1A 5M3FH 4JI8L 1PYBA 2NVYH 3M4QA 4HJ9A 1IBMQ 5GQOA 2A8VA 4HIKA 4LF4L 3ICEA 3PGZA 2KHIA 3I4OA 5IP7G 1NBWA 4JI1Q 4DV1Q 1C9OA 3H15A 4A3KH 2VNUD 3RR5A 3S1NH 2IHFA 4QJFA 5JJIA 4L5RC 5IP9H 1AE3A 2KHJA 4JI0L 1VS0A 2QEXA 1JB7A 4TVAB 4DK3C 4OO1I 3D0FA 2RHSB 4DR4Q 4X66Q 4YCVA 4DV5L 1C0AA 1TWHH 4HIMA 3CPFA 4A3CG 2B63G 5C4JH 1AE2A 3PUVA 4DV4L 1PH4A 3I4MH 4OONA 5GROA 1A62A 1NTGA 1VQHA 1T9HA 2N3SA 2ZTEA 1WYDA 3W1BA 2NVXH 4LF7Q 2YTVA 4LFAQ 4DV3L 1QVGA 3J81i 3RLOA 4JC0A 2VW9A 2IY5B 1VQAA 1FVIA 1X3EA 4MNOA 1Q1BA 3TEHB 3T1HL 2R93H 2WFWA 4JI4Q 4A3BH 4ME3A 1E24A 3NENA 1PH6A 1MIUA 2CKZB 2HIXA 4A3EG 1E7ZA 1EIFA 1I94L 4DR7L 1HNXL 4LFCL 4A3DG 1MJCA 3HOYH 1I3QH 4R4OA 1ASYA 3M4OH 3CQZH 1VQ8A 5C4XH 4GNXB 4DUYQ 3I7FA 4R4QA 3M3YH 4QIWE 5JEAJ 3J7A5 4YWLA 1K3RA 3AEVA 3E0EA 4A3JH 1VQNA 1K8AC 4JI3L 5IP7H 2QA4A 2V1CC 1N33L 3UDGA 4YHHL 4DAYB 1E22A 1CKMA 2ZJPA 3S17H 5LMUL 1JMCA 3GTOH 3UDIA 3S14H 5ELNA 1W2BA 4IFDI 1P16A 2MFIA 4PZ8A 2K52A 3RN5A 2ATWA 1A0IA 3S1QH 4JBKA 4C3HH 4DR2Q 5C44G 4OXPA 2UUAL 1IBKL 1HNZQ 2AWNA 2KCTA 1YIJA 4B3TQ 1TWGH 4YCUA 3HOVH 3S15H 4OO1G 1LTLA 4X65Q 4GOPB 1PHJA 2DGYA 3RZDH 4OWWB 3KDFB 4POGA 1G291 4LUVA 2RCNA 4P71A 4DV7L 4A3MH 4LF8Q 2WAQE 1OTCA 4GOPC 4LUZA 4YY3Q 3HOYG 4K0KQ 2PQAA 1XPRA 4A75A 1TWCH 1CSQA 1VCIA 3CCVA 3GTKH 4TQUS 3GTQH 4JI6L 2NZHA 2VUMG 2LXKA 4BA2I 2ZM6L 4YY3L 2JA6G 4R4IA 1PH2A 1XNQQ 3HOWH 4DV7Q 2E2IH 2HHHL 2VQFL 4LF8L 1YBYA 4LF5L 3M7NA 4UP9A 1WJJA 3PO2G 3T1YL 3CCMA 2JEAI 1Z47A 2UUCL 4JYAL 1X9NA 2ES2A 1XTDA 2FXQA 3G48A 3OW2A 1Q86C 5DLQE 2YV5A 1EFWA 1X6OA 1YJNA 1UWVA 3CW2C 4WJ4A 3ERSX 1OXUA 2K4KA 3D31A 4DR1Q 5FLXc 1RL2A 5M3MG 4DR5Q 3PV0A 1FGUA 2Q2HA 4GN3B 1IBKQ 4DR7Q 5C44H 3RLNA 1UEBA 2UXBL 2Z0SA 1JJGA 2EIFA 2CCZA 2MO0A 1KC8C 3J81c 1PVOA 1JT8A 2RF4A 4NB3A 3RLFA 4YHHQ 1UE1A 4XTCS 1PA6A 3K7UC 2VY3A 3BU2A 4FDBA 3PF5A 4GKKL 2NZOA 1FL0A 4NXNL 3MEFA 1FJGL 3F2DA 2UUAQ 3HOZG 3H3VI 3B6YA 3AQQA 1BBWA 4GOPA 4X66L 4DV5Q 1Q7YC 3S1MH 2LXJA 5H1SE 4B3ML 5C4XG 4L5TA 4JI2Q 2ASBA 5LMUQ 3I2ZA 3CCQA 2NVTH 1QZGA 3CP0A 2OQKA 2JA5H 3HOUG 1X3GA 3H0GG 2YU9H 4IFDJ 1SMXA 2F3IA 2H5XA 1HZAA 2JE6I 3H0GH 4JI5Q 3HKSA 4BBSH 4C2MH 2VL6A 2VQFQ 1KQSA 5LMNW 2CWAA 3K81C 2MO1A 1XMOL 2KENA 3CCJA 3F1ZA 4LW1A 1N36L 4A76A 4B3TL 2JEBI 2E5LQ 2CQOA 4GLVB 2BH8A 1L0WA 4K0KL 1IYJB 1A8VA 2ID0A 2UUBQ 3GTMH 2IT1A 1HZBA 5LMNL 3GTGH 4GKJL 2UUBL 1VQGA 2PI2A 4GLAC 4LF6Q 2BA1A 1D8LA 3ZJYC 1N32L 3A0JA 1HZ9A 1N36Q 1YZ6A 3KOJA 3G4SA 2OWOA 4IOAA 1Q46A 2UUCQ 4JYAQ 1J5EL 1UE6A 3W1GA 1AH9A 1H95A 2GN5A 1J5EQ 3GTPH 3KF8B 3WWVA 1C7YA 3ULLA 3I56A 2NN6I 2UXCL 3L0OA 5FJ8G 1HZCA 4DAMA 5IYCG 2MNAA 3HOUH 4HJ8A 4JI0Q 2R7ZG 4YCWA 4LFCQ 2HT1A 2JA8G 4BA1I 4IO9A 2ZTDA 1GO3E 3ULPA 1BBUA 1J6QA 3STBD 1K73C 4MZ9A 1Y1VH 2Z6KA 4JI5L 4OX9L 3PO3G 1IL2A 3J7ZC 1QZHA 2BH2A 1FJGQ 4O2DA 1Z9FA 5GAGC 1YI2A 3UDXA 1SFOH 1YITA 5JJLA 2HIVA 3RZOH 4A3FH 4XIGS 5C3EG 3JC66 4P72A 3OYYA 3GDEA 5M5YH 3JAMc 1V43A 1XPOA 4A93G 1N34Q 1YHBA 5ELOA 1X55A 1HNZL 3CMEA 3VDYA 2I5HA 1Q82C 1I94Q 4DR2L 1KRSA 2IX0A 3KF6B 4GKKQ 4QQBX 1S3OA 1VQ4A 1SR3A 4DR1L 3IRBA 2WB1E 4MTNA 4JI2L 1EQRA 2NVQH 4A3IH 2ZJQA 2A1AA 1QUQA 1CKNB 4H02A 1R9TH 1SLJA 4DK6C 2UXBQ 1WCMG 2ZJRA 3TS0A 2E8GA 3NELA 4P75A 1L1OA 3SGIA 1YJ9A 2YTYA 1XNQL 1OXSC 3PSIA 3A74A 3PUWA 1SROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 Q;  1GVP A;  4IPD A;  1UE7 A;  2K5V A;  1WOC A;  2PQA B;  1VQE A;  4LWC A;  3CC2 A;  2R7D A;  1IZ6 A;  1N32 Q;  1Q8K A;  1VQF A;  4PZ6 A;  2R92 G;  3F8T A;  2JA6 H;  1U5K A;  1B8A A;  5C0X J;  4DV6 Q;  1OXV A;  1LYL A;  5LMN Q;  4OX9 Q;  3CC7 A;  3CCL A;  4JV5 Q;  3MXN B;  4DV6 L;  2ZM6 Q;  1PH5 A;  4IFD G;  5E7N A;  3J81 j;  1VQ5 A;  1KL9 A;  3GTL H;  4A3L G;  4X65 L;  4GNX C;  3GTJ H;  4B3M Q;  2UXC Q;  2K5N A;  1VQC A;  4A93 H;  1DGS A;  1KAW A;  2JJQ A;  4HID A;  3GD7 A;  1Q81 C;  3PUX A;  4P73 A;  1QVF A;  4O0A A;  2Y0S G;  1CUK A;  3UE1 A;  4HJA A;  1Y1V G;  4R1J A;  1S40 A;  1JE5 A;  3FKI G;  3HOV G;  4DKA C;  2K14 A;  5M3M H;  2D0O A;  1N8R C;  2Q2I A;  2OTJ A;  1KHI A;  2OQ0 A;  5C0X I;  1PYS B;  2JQO A;  2RHQ B;  4YWK A;  1I6H H;  3HOZ H;  4PZ7 A;  1K9M C;  4C3I H;  4BBR H;  4KLK A;  4UPA A;  1Y14 B;  2Y0S E;  4QGU A;  3T1H Q;  4OWT B;  1M90 C;  2E5L L;  2F4V L;  2EQS A;  3BZK A;  1X65 A;  1XMQ Q;  4P74 A;  3I4M G;  4DUY L;  2GVA A;  4DR6 Q;  4Y52 H;  4LF7 L;  4RMF A;  5FLM H;  3I55 A;  4JBM A;  4HJ7 A;  2HHH Q;  5IE8 A;  4AIM A;  1M1K C;  3HFZ B;  1SN8 A;  3M4P A;  1VQM A;  3PO3 H;  4DR4 L;  1VQI A;  4DR5 L;  3FHW A;  4JI7 Q;  4A3D H;  4DR3 L;  1HJP A;  2WP8 J;  4IPC A;  5BR8 Q;  5GAD C;  5HY6 A;  5IYB H;  5EAY A;  1HNX Q;  1HNW Q;  3EN2 A;  5IYC H;  3G71 A;  3ULJ A;  2YYZ A;  3S16 H;  3T1Y Q;  2N8N A;  4JG2 A;  2XGT A;  4JI3 Q;  3H3V H;  4LNQ A;  4NXN Q;  2K75 A;  1EUJ A;  4YWM A;  3F2B A;  1GM5 A;  3PO2 H;  3HOX H;  3EBE A;  2CFM A;  2F52 A;  3AFQ A;  3I4N G;  2UXD Q;  4BXX G;  1JJC B;  4UP7 A;  4A3L H;  4DV0 L;  4GN5 A;  1L2F A;  4LF6 L;  3DM3 A;  4APV A;  1SE8 A;  1E3P A;  1CKO A;  3KLW A;  3CCU A;  4RG1 A;  4A3M G;  1LM0 A;  1BKB A;  1KIX A;  1GKH A;  2K50 A;  4A3G G;  3UDF A;  1EIY B;  2JK8 A;  1XJV A;  1VQB A;  1IBM L;  3F2C A;  1A63 A;  4JBW A;  2I0Q A;  3A5Z B;  1NJI C;  3TRE A;  4KHP L;  4LFA L;  1K8G A;  4X6A H;  4IPG A;  1N33 Q;  3A5U A;  1PH1 A;  1OXX K;  1IXR A;  4LF5 Q;  1VQD A;  3S2H H;  2HQL A;  4QY7 A;  1E1T A;  1WCM H;  2F4V Q;  3E9H A;  3CCE A;  4B3R Q;  1WI5 A;  1MKH A;  4ALP A;  3L2P A;  1EYG A;  1YEZ A;  1YVC A;  4UY8 C;  2JA5 G;  4JOI A;  4HIO A;  3W5O A;  1K0R A;  2JA7 G;  4BY7 H;  4PG3 A;  1VQP A;  1QVC A;  1OXT A;  2B29 A;  4DV2 Q;  4JI4 L;  1KXL A;  5M5X H;  4B3R L;  2PNH A;  3KDF A;  1CKN A;  3HOW G;  4LUO A;  3CXC A;  1X54 A;  4LF9 L;  4A3K G;  2R7F A;  2B3G A;  1YNX A;  4DV3 Q;  4DUZ L;  4A3F G;  3CPW A;  5GAH C;  1EQQ A;  2JA9 A;  1QUQ B;  4L5S A;  3CCR A;  2E2J H;  1CSP A;  1B70 B;  2D0P A;  1GD7 A;  3EIV A;  2EXD A;  4DR3 Q;  1G6P A;  4BBR G;  1HR0 W;  1LUZ A;  1P8L A;  1TWA H;  1PH3 A;  1VQK A;  4NXM L;  3TRZ A;  4A3G H;  1S72 A;  2AMC B;  5AJ3 Q;  4GLX A;  4JV5 L;  2QGQ A;  3RN2 A;  2AKW B;  3HOX G;  3L7Z C;  1HH2 P;  3PF4 A;  3BJU A;  3E9I A;  1MJE A;  1XPU A;  2VQE L;  2BA0 A;  2AWO A;  3J80 c;  2IHE A;  2DUD A;  1UE5 A;  3STB C;  1JJ2 A;  1ASZ A;  4LF4 Q;  5AJ3 L;  1YJW A;  3LGJ A;  4DPG A;  2VQE Q;  2A19 A;  2ALY B;  5C0X G;  3BZC A;  3K7A H;  1PH7 A;  4AH6 A;  1IBL Q;  3S1R H;  4X62 Q;  3FP9 A;  4GN4 B;  1B7Y B;  4X64 L;  5IYB G;  4B3S Q;  2KBN A;  4X62 L;  5M5W H;  3JAM i;  4AQY Q;  2UU9 Q;  3KFU A;  1W3S A;  4IJL A;  1WFQ A;  4OWX B;  4IJH A;  4AYB E;  1YHQ A;  4JI1 L;  4DV1 L;  4LF9 Q;  2I5L X;  1VQ7 A;  2I5M X;  4QL5 A;  4PMW A;  3M85 A;  4A3J G;  5IP9 G;  1G51 A;  4BXX H;  3U4V A;  3GO5 A;  3PIP A;  1PH9 A;  2L15 A;  5C3E H;  4DUZ Q;  3PCO B;  3PUZ A;  1HNW L;  3Q8D A;  4C3J H;  1U0L A;  1NMF A;  4DV4 Q;  1PV4 A;  3NEM A;  5BR8 L;  5HGQ A;  1VQ9 A;  1HR0 L;  1XNR Q;  4NXM Q;  4DV2 L;  4BBS G;  1HR0 Q;  4Y7N H;  1BVS A;  5IYD H;  1X3F A;  4KI0 A;  3U58 A;  3K0X A;  3TS2 A;  1D7Q A;  2R7Z H;  4LFB L;  4DV0 Q;  3CAM A;  2OTL A;  2UXD L;  2VZA A;  3HKZ G;  3AYH B;  4R4T A;  3S2D H;  1L1O C;  1XNR L;  2Q2T A;  2B63 H;  2D62 A;  1NY4 A;  1TXY A;  4EX5 A;  4JBJ A;  2CWP A;  4BY1 G;  4A3C H;  1N9W A;  4BY1 H;  1X56 A;  4AQY L;  2UU9 L;  1NE3 A;  4UP8 A;  2GVB A;  3M9B A;  4LFB Q;  2E2H H;  2VUM H;  4X64 Q;  3S24 A;  2K5H A;  3U4Z A;  2LSS A;  4BY7 G;  1VQL A;  1VQJ A;  2XTI A;  2R92 H;  1E1O A;  3K80 C;  3KF6 A;  3KJO A;  2R93 G;  2OCE A;  3PUY A;  3CF5 A;  1K83 H;  2N78 A;  2YTX A;  4A3E H;  3UE0 A;  1EOV A;  5J3B A;  5JEA G;  1PH8 A;  3CCS A;  5FJ8 H;  1V1Q A;  3NBH B;  4EQ5 A;  1Y1W H;  4DR6 L;  4KHP Q;  1NMG A;  5M3F G;  1Q1E A;  4GS3 A;  1XMQ L;  1XMO Q;  2Z6K C;  5IWA Q;  1RIP A;  4JCV E;  2PMZ E;  3CC4 A;  5IYD G;  3OTO Q;  1PFS A;  1I50 H;  3FKI H;  1SRU A;  1Q12 A;  1TWF H;  3K8A A;  4JOI C;  2WB1 G;  4A3I G;  1I5F A;  1O7I A;  1VQ6 A;  3TQY A;  4IOC A;  2AHO B;  3J80 i;  3U50 C;  4A4I A;  5FLM G;  2R6G A;  3ER0 A;  3OTO L;  1VQO A;  1IBL L;  2KCM A;  2NN6 G;  4J15 A;  5IWA L;  3CMA A;  4NPS A;  4JI6 Q;  2ZTC A;  4DNI A;  2VS1 A;  4IPH A;  3G6E A;  3DLL A;  1KRT A;  3KYH C;  2PI2 E;  4WJ3 M;  1YHA A;  3AFP A;  2MQH A;  4KHZ A;  5IT9 c;  1KD1 C;  2JA7 H;  4GNX A;  5K36 G;  3PIO A;  2Q2U A;  2C35 B;  1EWI A;  3HKZ E;  2N49 A;  4HJ5 A;  4JI7 L;  2JA8 H;  3RNU A;  4A3B G;  3KJP A;  4GKJ Q;  4AYB G;  1L1O B;  3I4N H;  3CD6 A;  1V9P A;  5JJK A;  4B3S L;  4POF A;  4L5Q A;  2WAQ G;  1N34 L;  1Y1W G;  4R4C A;  5IY0 A;  5GAE C;  2IX1 A;  5M3F H;  4JI8 L;  1PYB A;  2NVY H;  3M4Q A;  4HJ9 A;  1IBM Q;  5GQO A;  2A8V A;  4HIK A;  4LF4 L;  3ICE A;  3PGZ A;  2KHI A;  3I4O A;  5IP7 G;  1NBW A;  4JI1 Q;  4DV1 Q;  1C9O A;  3H15 A;  4A3K H;  2VNU D;  3RR5 A;  3S1N H;  2IHF A;  4QJF A;  5JJI A;  4L5R C;  5IP9 H;  1AE3 A;  2KHJ A;  4JI0 L;  1VS0 A;  2QEX A;  1JB7 A;  4TVA B;  4DK3 C;  4OO1 I;  3D0F A;  2RHS B;  4DR4 Q;  4X66 Q;  4YCV A;  4DV5 L;  1C0A A;  1TWH H;  4HIM A;  3CPF A;  4A3C G;  2B63 G;  5C4J H;  1AE2 A;  3PUV A;  4DV4 L;  1PH4 A;  3I4M H;  4OON A;  5GRO A;  1A62 A;  1NTG A;  1VQH A;  1T9H A;  2N3S A;  2ZTE A;  1WYD A;  3W1B A;  2NVX H;  4LF7 Q;  2YTV A;  4LFA Q;  4DV3 L;  1QVG A;  3J81 i;  3RLO A;  4JC0 A;  2VW9 A;  2IY5 B;  1VQA A;  1FVI A;  1X3E A;  4MNO A;  1Q1B A;  3TEH B;  3T1H L;  2R93 H;  2WFW A;  4JI4 Q;  4A3B H;  4ME3 A;  1E24 A;  3NEN A;  1PH6 A;  1MIU A;  2CKZ B;  2HIX A;  4A3E G;  1E7Z A;  1EIF A;  1I94 L;  4DR7 L;  1HNX L;  4LFC L;  4A3D G;  1MJC A;  3HOY H;  1I3Q H;  4R4O A;  1ASY A;  3M4O H;  3CQZ H;  1VQ8 A;  5C4X H;  4GNX B;  4DUY Q;  3I7F A;  4R4Q A;  3M3Y H;  4QIW E;  5JEA J;  3J7A 5;  4YWL A;  1K3R A;  3AEV A;  3E0E A;  4A3J H;  1VQN A;  1K8A C;  4JI3 L;  5IP7 H;  2QA4 A;  2V1C C;  1N33 L;  3UDG A;  4YHH L;  4DAY B;  1E22 A;  1CKM A;  2ZJP A;  3S17 H;  5LMU L;  1JMC A;  3GTO H;  3UDI A;  3S14 H;  5ELN A;  1W2B A;  4IFD I;  1P16 A;  2MFI A;  4PZ8 A;  2K52 A;  3RN5 A;  2ATW A;  1A0I A;  3S1Q H;  4JBK A;  4C3H H;  4DR2 Q;  5C44 G;  4OXP A;  2UUA L;  1IBK L;  1HNZ Q;  2AWN A;  2KCT A;  1YIJ A;  4B3T Q;  1TWG H;  4YCU A;  3HOV H;  3S15 H;  4OO1 G;  1LTL A;  4X65 Q;  4GOP B;  1PHJ A;  2DGY A;  3RZD H;  4OWW B;  3KDF B;  4POG A;  1G29 1;  4LUV A;  2RCN A;  4P71 A;  4DV7 L;  4A3M H;  4LF8 Q;  2WAQ E;  1OTC A;  4GOP C;  4LUZ A;  4YY3 Q;  3HOY G;  4K0K Q;  2PQA A;  1XPR A;  4A75 A;  1TWC H;  1CSQ A;  1VCI A;  3CCV A;  3GTK H;  4TQU S;  3GTQ H;  4JI6 L;  2NZH A;  2VUM G;  2LXK A;  4BA2 I;  2ZM6 L;  4YY3 L;  2JA6 G;  4R4I A;  1PH2 A;  1XNQ Q;  3HOW H;  4DV7 Q;  2E2I H;  2HHH L;  2VQF L;  4LF8 L;  1YBY A;  4LF5 L;  3M7N A;  4UP9 A;  1WJJ A;  3PO2 G;  3T1Y L;  3CCM A;  2JEA I;  1Z47 A;  2UUC L;  4JYA L;  1X9N A;  2ES2 A;  1XTD A;  2FXQ A;  3G48 A;  3OW2 A;  1Q86 C;  5DLQ E;  2YV5 A;  1EFW A;  1X6O A;  1YJN A;  1UWV A;  3CW2 C;  4WJ4 A;  3ERS X;  1OXU A;  2K4K A;  3D31 A;  4DR1 Q;  5FLX c;  1RL2 A;  5M3M G;  4DR5 Q;  3PV0 A;  1FGU A;  2Q2H A;  4GN3 B;  1IBK Q;  4DR7 Q;  5C44 H;  3RLN A;  1UEB A;  2UXB L;  2Z0S A;  1JJG A;  2EIF A;  2CCZ A;  2MO0 A;  1KC8 C;  3J81 c;  1PVO A;  1JT8 A;  2RF4 A;  4NB3 A;  3RLF A;  4YHH Q;  1UE1 A;  4XTC S;  1PA6 A;  3K7U C;  2VY3 A;  3BU2 A;  4FDB A;  3PF5 A;  4GKK L;  2NZO A;  1FL0 A;  4NXN L;  3MEF A;  1FJG L;  3F2D A;  2UUA Q;  3HOZ G;  3H3V I;  3B6Y A;  3AQQ A;  1BBW A;  4GOP A;  4X66 L;  4DV5 Q;  1Q7Y C;  3S1M H;  2LXJ A;  5H1S E;  4B3M L;  5C4X G;  4L5T A;  4JI2 Q;  2ASB A;  5LMU Q;  3I2Z A;  3CCQ A;  2NVT H;  1QZG A;  3CP0 A;  2OQK A;  2JA5 H;  3HOU G;  1X3G A;  3H0G G;  2YU9 H;  4IFD J;  1SMX A;  2F3I A;  2H5X A;  1HZA A;  2JE6 I;  3H0G H;  4JI5 Q;  3HKS A;  4BBS H;  4C2M H;  2VL6 A;  2VQF Q;  1KQS A;  5LMN W;  2CWA A;  3K81 C;  2MO1 A;  1XMO L;  2KEN A;  3CCJ A;  3F1Z A;  4LW1 A;  1N36 L;  4A76 A;  4B3T L;  2JEB I;  2E5L Q;  2CQO A;  4GLV B;  2BH8 A;  1L0W A;  4K0K L;  1IYJ B;  1A8V A;  2ID0 A;  2UUB Q;  3GTM H;  2IT1 A;  1HZB A;  5LMN L;  3GTG H;  4GKJ L;  2UUB L;  1VQG A;  2PI2 A;  4GLA C;  4LF6 Q;  2BA1 A;  1D8L A;  3ZJY C;  1N32 L;  3A0J A;  1HZ9 A;  1N36 Q;  1YZ6 A;  3KOJ A;  3G4S A;  2OWO A;  4IOA A;  1Q46 A;  2UUC Q;  4JYA Q;  1J5E L;  1UE6 A;  3W1G A;  1AH9 A;  1H95 A;  2GN5 A;  1J5E Q;  3GTP H;  3KF8 B;  3WWV A;  1C7Y A;  3ULL A;  3I56 A;  2NN6 I;  2UXC L;  3L0O A;  5FJ8 G;  1HZC A;  4DAM A;  5IYC G;  2MNA A;  3HOU H;  4HJ8 A;  4JI0 Q;  2R7Z G;  4YCW A;  4LFC Q;  2HT1 A;  2JA8 G;  4BA1 I;  4IO9 A;  2ZTD A;  1GO3 E;  3ULP A;  1BBU A;  1J6Q A;  3STB D;  1K73 C;  4MZ9 A;  1Y1V H;  2Z6K A;  4JI5 L;  4OX9 L;  3PO3 G;  1IL2 A;  3J7Z C;  1QZH A;  2BH2 A;  1FJG Q;  4O2D A;  1Z9F A;  5GAG C;  1YI2 A;  3UDX A;  1SFO H;  1YIT A;  5JJL A;  2HIV A;  3RZO H;  4A3F H;  4XIG S;  5C3E G;  3JC6 6;  4P72 A;  3OYY A;  3GDE A;  5M5Y H;  3JAM c;  1V43 A;  1XPO A;  4A93 G;  1N34 Q;  1YHB A;  5ELO A;  1X55 A;  1HNZ L;  3CME A;  3VDY A;  2I5H A;  1Q82 C;  1I94 Q;  4DR2 L;  1KRS A;  2IX0 A;  3KF6 B;  4GKK Q;  4QQB X;  1S3O A;  1VQ4 A;  1SR3 A;  4DR1 L;  3IRB A;  2WB1 E;  4MTN A;  4JI2 L;  1EQR A;  2NVQ H;  4A3I H;  2ZJQ A;  2A1A A;  1QUQ A;  1CKN B;  4H02 A;  1R9T H;  1SLJ A;  4DK6 C;  2UXB Q;  1WCM G;  2ZJR A;  3TS0 A;  2E8G A;  3NEL A;  4P75 A;  1L1O A;  3SGI A;  1YJ9 A;  2YTY A;  1XNQ L;  1OXS C;  3PSI A;  3A74 A;  3PUW A;  1SRO A; 
#chains in the Genus database with same CATH topology
 4JI8 Q;  3CC2 A;  4PZ6 A;  5E4W C;  2JA6 H;  4G7Z C;  1LYL A;  3S1Q B;  3CC7 A;  2K6A A;  2IPK D;  2F3V A;  5E7N A;  3J81 j;  3T56 B;  4BY7 B;  1CTM A;  4FVM A;  3A7L A;  4QF4 A;  1SYC A;  3G7L A;  1DGS A;  3A56 A;  4FXG C;  3A8J E;  1QVF A;  2KEC A;  3TP6 A;  2Y0S G;  2ENB A;  4ABN A;  1Y1V G;  2PZW A;  2KCN A;  2JA6 B;  1ZYR C;  4OO1 H;  4KN4 C;  3K7A B;  2K14 A;  1D5X C;  1IW7 D;  1KAA A;  1KHI A;  5ELD A;  2JQO A;  2RHQ B;  4YWK A;  1MSH A;  1I6H H;  1K9M C;  3T1H Q;  4UPA A;  1Y14 B;  2Y0S E;  2E5L L;  3QWN A;  3I4M G;  2KVM A;  1O78 A;  1B44 D;  4LF7 L;  4HTH A;  3I55 A;  4JBM A;  2F0W A;  1M1K C;  1F2M A;  3J80 E;  1VQM A;  4DR4 L;  3NE5 B;  4DR5 L;  3C46 A;  4JI7 Q;  4A3D H;  1HJP A;  1S5D D;  4IPC A;  2J0T D;  5HY6 A;  5ISR A;  1FNV A;  5EAY A;  1HNX Q;  3O13 A;  3EN2 A;  2RVL A;  2YYZ A;  3T1Y Q;  4JG2 A;  2K75 A;  1GM5 A;  2B63 B;  2HDM A;  3EBE A;  2F52 A;  3AFQ A;  1JJC B;  1PFM A;  5JEA H;  3E0J A;  4APV A;  2A6H C;  3P20 A;  1CFM A;  5KNC A;  4A3M G;  1Y1V B;  2Z8L A;  3R93 A;  1G8Z D;  2WV6 D;  1NSN S;  1IBM L;  3EJI A;  2PW7 A;  1IKM A;  4LFA L;  1K8G A;  1VF5 C;  4IPG A;  3A5U A;  1KLG D;  3T13 A;  4LF5 Q;  1JR0 D;  1LTA D;  1DZ1 A;  1E1T A;  2F4V Q;  1WCM B;  1O7L A;  4B3R Q;  4C3H G;  1MKH A;  4U68 A;  1EYG A;  1YEZ A;  2WB1 B;  1ESR A;  4JOI A;  2WIN B;  1BCP F;  3MEH A;  3W5O A;  1HQR D;  1S5B D;  2MJ8 A;  2JA7 G;  2IL8 A;  3HOV B;  3S15 B;  4PG3 A;  4JI4 L;  3BDL A;  4B3R L;  3HOW G;  4A3K G;  2Q8T A;  1ILQ A;  1K3B C;  1ESF A;  1YNX A;  4DV3 Q;  4DUZ L;  4HSV A;  1CSP A;  3OHX C;  1GD7 A;  3EIV A;  3BG3 A;  2TMP A;  4DR3 Q;  4BBR G;  1KAB A;  2C9O A;  4H44 C;  1PH3 A;  4H0L C;  4GLX A;  4CHT B;  1U9R A;  2AKW B;  4OEM B;  3RN2 A;  3HOX G;  1ENC A;  1XWE A;  3BJU A;  2XRQ D;  3QR8 A;  5JVG 3;  2K28 A;  5FO9 B;  4F88 A;  3K5L A;  4LF4 Q;  2AQ2 B;  1YJW A;  3LGJ A;  5DAU A;  4XQQ A;  1A2T A;  2F0Q A;  2ALY B;  5C0X G;  3K7A H;  1IBL Q;  4GN4 B;  1E2W A;  1BOS A;  4AQY Q;  2UU9 Q;  1IKL A;  1W3S A;  1LTT D;  2A68 C;  1PMR A;  1JIC A;  3NK9 A;  2E2I B;  1A3U A;  4JI1 L;  1II3 A;  3T53 B;  4A3J G;  3KF8 A;  1G51 A;  2NB0 A;  3PIP A;  2X6L A;  4ZUI A;  1BDO A;  3Q8D A;  4DV4 Q;  3HG9 A;  4BBS G;  4RHR A;  5IYD H;  3K0X A;  1LTB D;  4DV0 Q;  3CAM A;  1B9N A;  4HAE A;  4NW2 A;  1XYI A;  2FJ2 A;  2TSS A;  1TVX A;  2B63 H;  2D62 A;  1NY4 A;  1TXY A;  1F9S A;  2Z6B A;  4BY1 G;  4A3C H;  4BY1 H;  1Q90 A;  4X64 Q;  4ID6 A;  4BY7 G;  1SE3 A;  3TZU A;  4CJ0 B;  1Y8O B;  2R93 G;  3OSO A;  3PUY A;  2YTX A;  4A3E H;  1ROD A;  3UE0 A;  5J3B A;  1M8A A;  4RKB A;  3E6Z X;  4DR6 L;  4DFA A;  4EQ5 A;  4A3K B;  1Y1W H;  1NMG A;  3RUZ A;  4FO2 A;  2KJX A;  3AB9 A;  2BDO A;  1WTW A;  2Z6K C;  5CYU A;  2PMZ E;  3GP7 A;  2KOL A;  1D5M C;  2NZ1 D;  1SRU A;  1V1P B;  1Q12 A;  4JOI C;  5JJZ A;  2WB1 G;  1O7I A;  5CV5 A;  4A3I B;  3TQY A;  2AHO B;  3J80 i;  3ER0 A;  2KCM A;  4J15 A;  2ZTC A;  1HUN A;  3DLL A;  1KRT A;  3KYH C;  1SEB D;  2HUG A;  2VB2 X;  1DCZ A;  2MQH A;  4KHZ A;  2EVB A;  4GNX A;  5K36 G;  2FMC A;  4JI7 L;  5COY A;  2N49 A;  2F03 A;  4GKJ Q;  3S17 B;  5I6Y A;  1GUG A;  1V9P A;  1DOM A;  3S2D B;  4L5Q A;  3H91 A;  5EKI A;  4RCO A;  5M3F H;  2IX1 A;  3CHB D;  4MHE A;  1PYB A;  1V1P A;  4JI1 Q;  3D3R A;  3S1N H;  2IHF A;  4L5R C;  1SNP A;  1AE3 A;  3NXW A;  1B3Q A;  4JI0 L;  2QEX A;  4DK3 C;  4OO1 I;  4DR4 Q;  1HUM A;  4YCV A;  4DNT B;  4X66 Q;  1C0A A;  3K58 A;  2L11 A;  4OON A;  4IUR A;  3W1B A;  2N3S A;  5D3D A;  5KND A;  3SR1 A;  4LF7 Q;  2YTV A;  1QVG A;  5JPN C;  1BCP B;  4EQP A;  2IY5 B;  1WTV A;  4MNO A;  1X3E A;  2F0N A;  3I4L A;  3T1H L;  4A3B H;  1PH6 A;  1EIF A;  1JWU D;  3NTI A;  1HNX L;  3CQZ B;  2E74 C;  5EPL A;  3V2T A;  1I3Q B;  3DWQ A;  1PDQ A;  1MBY A;  2B2Y A;  4DAP A;  4DUY Q;  3I7F A;  3M3Y H;  2QW7 A;  4N8X 1;  1WD0 A;  3J7A 5;  1K8O A;  3AEV A;  4JI3 L;  5IP7 H;  2QA4 A;  3BZD B;  2ICE C;  3T51 B;  4DAY B;  3G6J B;  2E2H B;  5FLX E;  5JOB A;  3GTO H;  5ELN A;  1CZW A;  4PZ8 A;  5CV8 A;  5T1G A;  3RN5 A;  2ATW A;  3S1Q H;  1SNQ A;  5C44 G;  2Y0S B;  4OXP A;  1IBK L;  3OIP A;  3IFT A;  4XYQ A;  2B2T C;  5M5Y B;  4S3S A;  3TP8 A;  2RDG A;  4GOP B;  5I2X A;  3GTM B;  2DGY A;  1F9P A;  3UI2 A;  4OWW B;  4LUV A;  4A3M H;  4GOP C;  4DA2 A;  4LUZ A;  3AU7 A;  3HOY G;  1TWC H;  2XN9 C;  2O2L D;  3GTQ H;  3GTK B;  4U67 3;  1STY A;  3BDO A;  4J1M A;  4RGO S;  5CV7 A;  3I4N B;  2ZM6 L;  4BA2 I;  2D2C C;  1PH2 A;  1XNQ Q;  2VQF L;  3SE0 A;  4LF5 L;  1B9M A;  1G2S A;  1WJJ A;  2JEA I;  1CHQ D;  3Q24 A;  2K04 A;  1D5Z C;  1STN A;  1RL2 A;  2EOT A;  4DR5 Q;  3C2P A;  2K7V A;  3DHQ A;  4GN3 B;  4E6I A;  1G91 A;  1RHP A;  1TS2 A;  3KK7 A;  1RTO A;  1UEB A;  2QDB A;  3FPU B;  5KIX A;  1HFG A;  2XRS D;  1JT8 A;  1PA6 A;  2PCF B;  3TME A;  5DM7 3;  4NXN L;  2RSO A;  3OOC A;  3AQQ A;  5LHY 1;  3QO2 A;  1STA A;  5J1Z A;  2NVQ B;  3I2Z A;  2Q8R E;  2F0S A;  3HKS A;  5M5X B;  4C2M H;  1KQS A;  4PNY A;  4V0B A;  5C4Z A;  2KEN A;  2EYJ A;  4LMQ D;  5K5P A;  1ET6 A;  1H9R A;  1N36 L;  2E5L Q;  1LT3 D;  1GHK A;  3R3O A;  2UUB L;  3I3C A;  2PI2 A;  4GLA C;  1D8L A;  4UAI A;  2KQ3 A;  5I9O A;  2R7Z B;  3IFD A;  1N36 Q;  3KOJ A;  3OWE B;  4IOA A;  2BE5 D;  2UUC Q;  1EQV A;  3W1G A;  2K5W A;  1J5E Q;  3KF8 B;  3WWV A;  1BNZ A;  3I56 A;  1MD2 D;  1X3P A;  3Q22 A;  4JI0 Q;  4KV6 A;  4OIJ A;  2HT1 A;  3S9W A;  4IO9 A;  2ZTD A;  1GO3 E;  4R9W A;  4MZ9 A;  1SYF A;  3PO3 G;  4O2D A;  1Z9F A;  2CVR A;  5GAG C;  3OW7 A;  1SFO H;  4A3F H;  5IGE A;  4P72 A;  3GDE A;  1V43 A;  4K8I A;  3CME A;  4C3I G;  3HEJ A;  1KRS A;  2IX0 A;  3KF6 B;  5C6A A;  4Y7N B;  5T1I A;  3D4D A;  4QQB X;  3JAM L;  3CKI B;  4EVO A;  2WB1 E;  2Z1C A;  3I90 A;  5C4J B;  2ZJQ A;  1SLJ A;  2UXB Q;  2LY7 A;  3I70 A;  1K8M A;  1ENA A;  5CMD A;  2ZJR A;  1AN8 A;  3HOZ B;  1L1O A;  5M9O A;  2L5T A;  2YTY A;  1XNQ L;  3PIO A;  1JWS D;  3PUW A;  1IW7 C;  1EZ6 A;  2B2W C;  1GVP A;  4IPD A;  1WOC A;  1S5F D;  5AFW A;  1PZK D;  1N32 Q;  1Q8K A;  1AW7 A;  1VQF A;  2NTT A;  1KDC A;  2DJF C;  1B8A A;  5C0X J;  4JV5 Q;  3MXN B;  4DV6 L;  2F0J A;  1H9J A;  4A3L G;  2NBF A;  2QDL A;  3DEP A;  4HID A;  2F0T A;  3GD7 A;  1JWM D;  1Q81 C;  4HJA A;  4NKL A;  1JE5 A;  4KD3 A;  3VYS A;  1QNK A;  2LS0 1;  3NQT A;  1H9S B;  1QE6 A;  1Y8N B;  2O5J C;  5M3M H;  2D0O A;  2HQE A;  2Q2I A;  1NR4 A;  2F0D A;  5C0X I;  2RDH A;  3HOZ H;  1F9R A;  5ELE A;  1SYD A;  2MGS A;  4IZ8 A;  3J7A F;  1M90 C;  2F4V L;  3BZK A;  1X65 A;  4P74 A;  1TY2 A;  3W3A A;  3T4A C;  4DUY L;  2EY2 A;  2N55 A;  4F7X A;  3SK5 A;  5FLM H;  5IE8 A;  2BOS A;  1NUC A;  1VQI A;  2Z4I A;  3A55 A;  2PNR C;  4B9W A;  4UDU C;  5IYB H;  1H9K A;  4TRD A;  4BS9 A;  1LTR D;  5IYC H;  3NTK A;  1TS4 A;  4JI3 Q;  3H3V H;  2EYO A;  1ZXT A;  5HUR A;  2CFM A;  4BXX G;  4UP7 A;  2HDL A;  4IUP A;  4DV0 L;  3GV6 A;  5DNF A;  5E1F A;  1E3P A;  4PV1 C;  1CKO A;  2BDN A;  4B08 A;  3J7A V;  1LM0 A;  3SEB A;  2LMC B;  1DYQ A;  3F2U A;  2P5Z X;  2JK8 A;  1XJV A;  1TR5 A;  1D1K A;  4RWS C;  2I0Q A;  4KKU A;  3OMC A;  1IXR A;  2IX3 A;  4ZK9 B;  4QY7 A;  1WCM H;  1WTR A;  1PZI D;  1HTL D;  3L2P A;  3X3M A;  2JA5 G;  1I6V C;  1LTI D;  3MFG A;  1A3V A;  3VYT A;  3GTL B;  1EZ8 A;  1QVC A;  2B29 A;  1KXL A;  4RKL A;  1I4X A;  2XWJ B;  1SE2 A;  2F0F A;  4HSP A;  4FYD A;  4FF1 A;  1SAP A;  1EU3 A;  4A3F G;  3CPW A;  5GAH C;  1PRT B;  1EQQ A;  4G7O C;  2E2J H;  5L37 A;  2EXD A;  1W6J A;  1G6P A;  1P8L A;  4A3G H;  1S72 A;  5AJ3 Q;  2NUC A;  4QIW B;  4LAA A;  4DXF A;  3L7Z C;  1EEI D;  1MJE A;  1ILP A;  3MXG A;  4RCN A;  1LAC A;  2AWO A;  1PTO D;  2DUD A;  2QCP X;  3RZD B;  1UE5 A;  1ASZ A;  5AJ3 L;  4EQN A;  4UY8 C;  4CDD C;  1SMY C;  5A2Q E;  3KBX A;  4X62 Q;  1SSO A;  3FP9 A;  4X64 L;  4RFB A;  2KBN A;  5M5W H;  3JAM i;  4IJL A;  1WFQ A;  3MXP A;  3D4R A;  1SYB A;  4AYB E;  1YHQ A;  4DV1 L;  2I5L X;  1A3T A;  3M85 A;  1CQV A;  5IP9 G;  5EBD A;  3GO5 A;  1HNW L;  3VR2 A;  1Y8P B;  1PV4 A;  4XDX A;  1NMF A;  1VQ9 A;  1DON A;  5BR8 L;  1DJR D;  1HR0 L;  1JOK A;  4NXM Q;  1BVS A;  2RBM A;  4OIK A;  1TWH B;  3ERQ A;  1Z7T A;  2OTL A;  2UXD L;  2VZA A;  4R4T A;  2VXW A;  3S2D H;  3D4W A;  2CWP A;  2K05 A;  1FGB D;  1N9W A;  1X56 A;  2XVS A;  4LFB Q;  1O7Y A;  5C3W A;  2VUM H;  2K5H A;  2LSS A;  1VQL A;  4FXD A;  4XT1 B;  3K80 C;  5EPJ A;  4C3H B;  3VR3 A;  4KMU C;  2ZXP A;  4IUQ A;  2N78 A;  4DNR B;  2YU9 B;  1R9T B;  1KNA A;  5JEA G;  4C56 C;  1PH8 A;  3CCS A;  3M7G A;  5M3F G;  2A69 D;  1XMO Q;  2CH4 A;  3EFX D;  5IWA Q;  3OTO Q;  2D5D A;  1HQM C;  1PFS A;  3Q6S A;  1TWF H;  2AQ3 B;  3FKI H;  2R3Z A;  1JQY D;  4IOC A;  3TP5 A;  5FLM G;  4A4I A;  3OTO L;  3TDQ A;  1LAB A;  3K57 A;  2HCI A;  5IWA L;  4DAV A;  2EJM A;  1JC7 A;  4NPS A;  4JI6 Q;  2B39 A;  4QB4 A;  3ND8 A;  3T16 A;  4G57 A;  1YNJ C;  4WJ3 M;  1EIG A;  1EWH A;  2VUM B;  3AFP A;  1KD1 C;  1FD7 D;  4R8I A;  2JA7 H;  2Q2U A;  1EWI A;  2SNM A;  3HKZ E;  2JA8 H;  5G3L F;  4K5W A;  4A3B G;  1L1O B;  3CD6 A;  2SNS A;  3I91 A;  1N34 L;  1SYG A;  4KKS A;  3NHH A;  1SE4 A;  4HJ9 A;  4C3J G;  4LF4 L;  3ICE A;  3RZO B;  3I4O A;  5HGT A;  5IP7 G;  1NBW A;  1FR3 A;  4DV1 Q;  1WVL A;  1C9O A;  5FOB B;  4LJZ C;  3RR5 A;  5COR A;  4JW0 A;  1BQQ T;  1VF7 A;  4J6H A;  5JVH 3;  4TVA B;  3VR5 A;  3E5S A;  4BBS B;  2DNE A;  2NWG A;  3CPF A;  2NTS A;  1AE2 A;  4WOR A;  5NUC A;  1PH4 A;  3I4M H;  1NTG A;  2ZTE A;  4DGZ A;  4DV3 L;  3QG1 A;  3RLO A;  1GUW A;  1QG7 A;  4KJN A;  1B4O A;  1TWC B;  1I4G A;  2R93 B;  4JI4 Q;  3MC0 B;  2CKZ B;  1IYU A;  5IOD A;  4DR7 L;  1PRT D;  3HOY H;  3LNN A;  1I3Q H;  3M4O H;  1A6X A;  3DEO A;  5C4X H;  1PRT F;  2F0P A;  2RQX A;  5I2Y A;  1K83 B;  5JEA J;  1MGS A;  4YWL A;  2DJG C;  2V1C C;  1N33 L;  2SDF A;  2O4X A;  5CBE E;  2ZJP A;  1O7Z A;  5LMU L;  3GTO B;  4HMI A;  3S14 H;  4KKT A;  3NTH A;  1P16 A;  1A0I A;  4JBK A;  4B9X A;  2PMZ B;  1PTO C;  1EY5 A;  4KY7 A;  4RGN A;  3HOV H;  3S15 H;  1TWG H;  1SNM A;  2B2V C;  5FO8 B;  2CH4 W;  1PHJ A;  4IAL A;  1SXT A;  1EWC A;  3KDF B;  4POG A;  4P71 A;  4ZLT F;  2WAQ E;  1OTC A;  4YY3 Q;  4WRD A;  1I50 B;  1LT5 D;  1VCI A;  1EYD A;  3CCV A;  4C1N I;  4TQU S;  3GTK H;  3GTQ B;  3C1F A;  2PPB C;  2X69 A;  1VDZ A;  2VUM G;  3J81 E;  2Z4H A;  1JOR A;  3HOW H;  5JPM C;  4DV7 Q;  4LF8 L;  1CA5 A;  1SJH D;  1X9N A;  2ES2 A;  3OW2 A;  5DLQ E;  2K33 A;  1YJN A;  1DOL A;  4A3D B;  3D31 A;  3HRZ C;  5M3M G;  4K14 A;  3OMG A;  5FLX c;  5M3M B;  2Z9H A;  4CKB A;  1JJG A;  3K0Y A;  2EIF A;  1M4V A;  2CCZ A;  2MO0 A;  4OL7 A;  1PVO A;  2RF4 A;  5EKK A;  4YHH Q;  4XTC S;  2NN6 H;  3BU2 A;  1FL0 A;  1HRJ A;  1PFB A;  3MEF A;  5CV9 A;  3BVZ A;  4DV5 Q;  2BE5 C;  4JVZ A;  5H1S E;  5LMU Q;  2NVT H;  3HOU B;  4IFD J;  1QZG A;  4NMZ A;  3H0G G;  1SMX A;  2F3I A;  2JE6 I;  3BYT B;  3H0G H;  5CBA E;  1HXY D;  5IT9 L;  3DXJ C;  5I4D A;  2CHB D;  2CWA A;  2MO1 A;  3EVQ A;  1HPC A;  1XMO L;  5I6W A;  2A6E D;  2ZXO A;  4L8J A;  2CQO A;  5D14 A;  1SND A;  1MHW C;  2EPB A;  1QIL A;  5F2D A;  5LMN L;  1Z6H A;  3GTG H;  4GKJ L;  4J8Q A;  1Q3L A;  5IGD A;  5C4H A;  1UEA B;  4ODG A;  4CDE C;  1N32 L;  1HZ9 A;  3BYY B;  5IGB A;  3D6W A;  3G4S A;  2ZT9 C;  3NPP A;  1UE6 A;  4A3J B;  3GTP H;  1ICF B;  3ERO A;  3L0O A;  4RAU C;  5LL6 S;  4DAM A;  2MNA A;  3HOU H;  2F1M A;  1CT1 D;  4BA1 I;  1O80 A;  4O1N A;  1J6Q A;  4JI5 L;  1Y1V H;  2KEE A;  1IL2 A;  1FJG Q;  2EXZ A;  3UDX A;  1YIT A;  2HIV A;  5DM6 3;  3AMU A;  2QEJ C;  4XQJ A;  2A74 C;  1HTP A;  5ELO A;  1S5E D;  1HNZ L;  3VDY A;  2I5H A;  1Q82 C;  3J81 L;  1U4R A;  3URY A;  1VQ4 A;  1SR3 A;  3IRB A;  3NBH A;  1KDA A;  1EQR A;  4A3I H;  2F0I A;  1QUQ A;  4H02 A;  3K5N A;  1RJT A;  3R2T A;  3NEL A;  4XXE A;  2F0L A;  1NNX A;  2FIN B;  3A74 A;  1LTG D;  3U9S A;  1UE7 A;  2PQA B;  1VQE A;  2B2Y C;  1RCV D;  2L9H A;  2A6E C;  1IZ6 A;  1WTX A;  3LX0 A;  1GUT A;  2M00 A;  3ITP A;  5D65 A;  3H94 A;  3KLR A;  2I07 B;  1OXV A;  4OX9 Q;  2IWH A;  2PO4 A;  3MA2 B;  2ZM6 Q;  1PH5 A;  4IFD G;  1STH A;  1VQ5 A;  1KL9 A;  4HMJ A;  2A68 D;  4X65 L;  3FEW X;  2L1B A;  4IUU A;  4WJW A;  2K5N A;  1VQC A;  2JJQ A;  2CQA A;  1PLF A;  3PUX A;  4O0A A;  1CUK A;  1IL8 A;  4R1J A;  5IT9 E;  5KEE A;  3FKI G;  3HOV G;  4DKA C;  4KN7 C;  3TP7 A;  1W6K A;  4I7A A;  1N8R C;  4CKE A;  1ONL A;  2KUM A;  1TU2 B;  2WKC A;  4BBR H;  3NSW A;  2JYO A;  3M3Y B;  2GVA A;  3NWS A;  4Y52 H;  2KCC A;  4FNF A;  2RDF A;  5IGF A;  2A5H A;  3HOX B;  2HHH Q;  1F2Y A;  1HA6 A;  1RTN A;  2J7Z A;  5C0X H;  3FHW A;  4DR3 L;  5BR8 Q;  5GAD C;  1HFN A;  1HNW Q;  3HZX A;  4RGM A;  4ULL A;  3G71 A;  3ULJ A;  3S16 H;  2PQE A;  2EYM A;  4NXN Q;  3PO2 H;  3ONA B;  2WAC A;  3HOX H;  4A93 B;  1QWY A;  3I4N G;  2UXD Q;  2HCC A;  4GN5 A;  5IGC A;  3R8B A;  4HN7 A;  5IOC A;  1SE8 A;  5BN5 A;  2M9V A;  1BKB A;  2K50 A;  4A3G G;  3H3V C;  3UDF A;  1RF2 D;  1A63 A;  3Q0A A;  1NJI C;  3TRE A;  3GTJ B;  5FKA C;  3BVG A;  1PH1 A;  1N33 Q;  2K03 A;  4BY1 B;  1VQD A;  1UNS A;  3GQB A;  4A3M B;  4ALP A;  4X3U A;  1K0R A;  2C5C A;  4BY7 H;  1EOT A;  1NR2 A;  1QNU A;  5EKL A;  1VQP A;  2PNH A;  1TS3 A;  1X54 A;  3HGB A;  4LF9 L;  2R7F A;  4NDX A;  4H13 C;  4L5S A;  3CCR A;  2D0P A;  2BCO A;  3FDT A;  1YNJ D;  5C44 B;  1AFP A;  2F0E A;  1LUZ A;  3J80 L;  3P75 A;  4JV5 L;  2QGQ A;  3KLS X;  1B2T A;  3PF4 A;  2I46 A;  2VQE L;  3I4M B;  3FVQ A;  1X3Q A;  1DOK A;  1U4P A;  2E2D C;  3ND9 A;  4MIU A;  4DPG A;  1BCP C;  1PH7 A;  1F2Z A;  4B3S Q;  3VYU A;  2EY5 A;  4LF9 Q;  4H7B A;  4BBR B;  1GUS A;  1VQ7 A;  2GA4 B;  4QL5 A;  4PMW A;  1T5X D;  4DN4 M;  3U4V A;  4L63 B;  1LLR D;  1PH9 A;  2L15 A;  1ICW A;  1U0L A;  1G6Z A;  4G4K A;  5HGQ A;  1ML0 D;  1XNR Q;  1LO5 D;  4CDF C;  4DV2 L;  1WD1 A;  1HR0 Q;  1ET9 A;  4JPB W;  4KI0 A;  1EY6 A;  3TS2 A;  2R7Z H;  4LFB L;  1U4M A;  5K36 H;  1QJO A;  2MHV A;  3DMU A;  3HKZ G;  3A8I E;  2OT2 A;  3AYH B;  1L1O C;  3J7Y W;  2B2V A;  2Q2T A;  1XNR L;  3PO2 B;  3K5O A;  4JBJ A;  1CM9 A;  1LV9 A;  1WTH A;  1NE3 A;  4UP8 A;  1XTC D;  2GVB A;  2E2H H;  1S5C D;  1JOQ A;  4FF4 A;  5CV6 A;  3M4Y A;  1J9O A;  1VQJ A;  3CRL C;  4KD4 A;  2XTI A;  4P2C B;  1E1O A;  4XQN A;  2R92 H;  4ILW A;  3KJO A;  1TWA B;  3MHB A;  2OCE A;  1STG A;  3CF5 A;  1EY0 A;  4A3F B;  1FYC A;  2RA4 A;  1V1Q A;  3NBH B;  4PQX A;  5CC4 A;  1AP0 A;  4NP5 A;  1XMQ L;  1UUP A;  3S1R B;  4IUT A;  1E2V A;  1PTO F;  4JCV E;  3SK6 A;  1I5F A;  1SMY D;  4OEL B;  4I7Z C;  2NVT B;  1VQ6 A;  1LTS D;  4JK1 C;  4TKO B;  2NN6 G;  3MTS A;  5EGT A;  4IUN A;  3G6E A;  4C3J B;  1YHA A;  4IN3 A;  5IT9 c;  2C35 B;  3FRP B;  4G7H C;  3HOY B;  3M4O B;  1EIH A;  3KJP A;  4AYB G;  3I4N H;  3IL8 A;  1D2B A;  2WAQ G;  5GAE C;  3TZD A;  3D6C A;  2NVY H;  2A8V A;  5GQO A;  1B50 A;  3PGZ A;  2KHI A;  1STE A;  1K28 A;  2RKS A;  3ZYY X;  3H15 A;  3U9O A;  1Q8I A;  2DNC A;  2O5I C;  4QJF A;  5JJI A;  5IP9 H;  3S1M B;  1YNN C;  2KHJ A;  1GOZ A;  3NQI A;  3HS0 C;  1JB7 A;  3D0F A;  2RHS B;  1CQF A;  4DV5 L;  5JAV A;  4HIM A;  1E0B A;  2G9D A;  2B63 G;  4A3C G;  5C4J H;  4DV4 L;  3PUV A;  4GZY C;  5GRO A;  1A62 A;  1VQH A;  2L55 A;  1T9H A;  1WYD A;  2A69 C;  3J81 i;  1DXM A;  2EYH A;  4JC0 A;  1VQA A;  2R93 H;  2M2L A;  1Q1B A;  3TEH B;  2B2U A;  2WFW A;  1OO9 B;  1DD2 A;  1E24 A;  3NEN A;  2CW0 D;  4A3E G;  2HIX A;  4MN3 A;  4V19 0;  2QIL A;  4A3D G;  4R4O A;  2A6H D;  2K32 A;  1ASY A;  5C4X B;  1VQ8 A;  1GUN A;  2XWB B;  1F2L A;  4R4Q A;  1K0S A;  4QIW E;  4EQO A;  2B8G A;  2DN8 A;  1GXD C;  3E0E A;  5IIF A;  4XT3 B;  1WTP A;  4R8N A;  3QOL A;  5BN4 A;  1VQN A;  2F4I A;  3UDG A;  3MXU A;  4YHH L;  1CKM A;  3PMF A;  1J8I A;  1GHJ A;  4M8A A;  4IFD I;  1ZEQ X;  2NYZ D;  4DR2 Q;  2UUA L;  3BDC A;  4CKC A;  1HNZ Q;  1TWG B;  3LWE A;  4K2L A;  1XXG A;  2F0G A;  5A2Q L;  3SK8 A;  1V1O A;  1MI2 A;  1ZKO A;  1Y1W B;  4CDC C;  1S4Z A;  1G29 1;  4ZRZ A;  4DV7 L;  4LF8 Q;  1GJX A;  4IFD H;  4K0K Q;  1TII D;  1XPR A;  2EZV A;  4N8F A;  1X32 A;  1BBX C;  4YY3 L;  2JA6 G;  3HP3 A;  4R4I A;  4ZCK A;  1A2U A;  2V4D A;  2E2I H;  3GTP B;  3SHL A;  1YBY A;  3M7N A;  2K5Q A;  3T1Y L;  1Z47 A;  4QUC A;  4JYA L;  1XTD A;  3G48 A;  3HKZ B;  1EFW A;  1Q86 C;  4IUV A;  2YV5 A;  1RDP D;  2QKI C;  1UWV A;  3CW2 C;  4EGV A;  2K4K A;  4DR1 Q;  1SNO A;  4DR7 Q;  1FGU A;  2Q2H A;  2K1B A;  2B2U C;  4ME5 A;  3RLN A;  4FF2 A;  2Z0S A;  4RGT A;  1G2T A;  1KC8 C;  4C1N K;  5FO7 B;  4KK7 A;  4NB3 A;  1UE1 A;  2EY1 A;  1FNU A;  2B8F A;  2VY3 A;  3PF5 A;  1IHZ A;  4FDB A;  1CI3 M;  2UUA Q;  1L0X B;  3H3V I;  3B6Y A;  3E3X A;  1Q7Y C;  1SNC A;  3S1M H;  4B3M L;  3QOJ A;  2FFK B;  1MSG A;  3CP0 A;  2OQK A;  2JA5 H;  2SEB D;  1STB A;  1X3G A;  3HOU G;  4DF7 A;  5J22 A;  1HZA A;  4JI5 Q;  4DU9 A;  2R61 A;  3I73 A;  5J39 A;  1F9Q A;  5LMN W;  5EQ0 A;  3K81 C;  3CCJ A;  3F1Z A;  5C5M A;  2E2J B;  3PIP 3;  4A76 A;  3H09 A;  3KBG A;  4GLV B;  2OF1 A;  4TSS A;  2BH8 A;  5KYL A;  1IYJ B;  1CHP D;  5IGG A;  2UUB Q;  3GTG B;  2F3W A;  4A3B B;  1VQG A;  4LF6 Q;  5KGU A;  3R2I A;  4M1U B;  1YZ6 A;  1EY8 A;  2PYK A;  2JN4 A;  3K5M A;  2NVX B;  1J5E L;  4DK1 A;  1AH9 A;  1H95 A;  2GN5 A;  1F77 A;  2OXP A;  3MFY A;  2NN6 I;  3V96 A;  1JE4 A;  5FJ8 G;  1Y69 U;  2EJF C;  4HJ8 A;  2R7Z G;  1ZYR D;  4DK0 A;  3ULP A;  1K73 C;  1BBU A;  4OX9 L;  3DWA A;  1QZH A;  3IAY A;  2OEO A;  5JJL A;  4FXK C;  4XIG S;  3JC6 6;  4K5V A;  5M5Y H;  1BF4 A;  1SDF A;  1XPO A;  1HCZ A;  1YNN D;  3C3L A;  1I94 Q;  5KRU A;  4LK1 C;  4GKK Q;  5E3F A;  2VB3 X;  1S3O A;  2EYF A;  4DR1 L;  2JA8 B;  2RSN A;  1EYC A;  1JB3 A;  3N52 A;  2PW5 A;  4A3E B;  4DK6 C;  3TSS A;  1I4R A;  3PQI A;  3NUC A;  3A7A B;  3TS0 A;  3WOE A;  4P75 A;  2XSC A;  4C3I B;  3PSI A;  1LTL A;  3LWU A;  5C3X A;  1SRO A;  2K5V A;  4LWC A;  2XIW A;  2R7D A;  1EQT A;  2R92 G;  3F8T A;  1U5K A;  2A73 B;  4DV6 Q;  3V05 A;  5LMN Q;  3CCL A;  1R4Q B;  3TN2 A;  2X6G A;  3GTL H;  1PTO H;  4GNX C;  3GTJ H;  4B3M Q;  2UXC Q;  4A93 H;  1KAW A;  2LFN A;  4CGY B;  4P73 A;  3UE1 A;  1NCV A;  1S40 A;  2RCF A;  2K01 A;  4X3K A;  2OTJ A;  1V8Q A;  2OQ0 A;  4CBV A;  1PYS B;  2IW3 A;  4PZ7 A;  4C3I H;  4QGU A;  4KLK A;  4C2M B;  2EY6 A;  2ICI A;  4OWT B;  2E76 C;  2EQS A;  3WDN A;  1XMQ Q;  2E75 C;  4OHJ A;  4DR6 Q;  5C3E B;  4RMF A;  4HJ7 A;  1B53 A;  4RA8 A;  4AIM A;  3HFZ B;  1SN8 A;  3M4P A;  2F0V A;  3PO3 H;  4F87 A;  3S14 B;  2WP8 J;  4MTK A;  4N9T A;  3NP8 A;  1B3A A;  2N8N A;  2XGT A;  4RH6 A;  3QIA A;  4LNQ A;  1TS5 A;  4YWM A;  1EUJ A;  3P1H A;  3F2B A;  2JSO A;  4ZAI A;  4A3L H;  1PRT C;  1L2F A;  4LF6 L;  2IJ0 A;  3DM3 A;  2H4O A;  1AZP A;  2F0K A;  3KLW A;  3CCU A;  4RG1 A;  3JAM E;  4KTA A;  1KIX A;  1GKH A;  4BWG B;  3BVM A;  1EIY B;  1VQB A;  3F2C A;  4ZYS A;  4JBW A;  2AQ1 B;  3A5Z B;  1LT4 D;  4KHP L;  4X6A H;  1A15 A;  1BXT A;  1OXX K;  1C8C A;  3S2H H;  2LKV A;  1I4P A;  2HQL A;  3I72 A;  3E9H A;  3CCE A;  3QJY A;  1FNW A;  3KLS A;  1WI5 A;  1I6H B;  1YVC A;  4ZKC B;  1E2Z A;  4HIO A;  1BCP D;  1OXT A;  4DV2 Q;  5M5X H;  4CJ2 C;  5BN3 A;  3KDF A;  1CKN A;  4LUO A;  3CXC A;  3S2H B;  2B3G A;  2JA9 A;  1QUQ B;  2EJG C;  3A54 A;  1B70 B;  3NWT A;  3EA6 A;  1TY0 A;  1HR0 W;  3TRZ A;  1TWA H;  1VQK A;  4NXM L;  2AMC B;  2JXM B;  5G3L D;  1L0Y B;  4K2K A;  3VA5 A;  1HH2 P;  3E9I A;  4XYO A;  3EQL C;  1XPU A;  2BA0 A;  3J80 c;  2IHE A;  1VMC A;  4KHV A;  1SYE A;  3STB C;  1JJ2 A;  5TSS A;  1QOH A;  1T5E A;  1EL0 A;  2VQE Q;  2A19 A;  3BZC A;  4I65 A;  4AH6 A;  3S1R H;  1B7Y B;  4IQZ A;  5IYB G;  4X62 L;  1SFO B;  2SOB A;  3KFU A;  4OWX B;  4IJH A;  1U4L A;  3X3N A;  3SXH A;  4K5X A;  2I5M X;  2J4X A;  1TKW B;  4BXX H;  1AZQ A;  5C3E H;  4DUZ Q;  3PCO B;  3PUZ A;  4C3J H;  3NEM A;  4AYB B;  3PO3 B;  4Y7N H;  1IYV A;  5ELF A;  1X3F A;  1EY4 A;  3U58 A;  2N88 A;  1D7Q A;  4DAY A;  1SJE D;  3P7J A;  1EY7 A;  2MUY A;  2EDG A;  2G5D A;  3MXN A;  1LT6 D;  4EX5 A;  1HHV A;  4UHV A;  4PMC A;  1KLU D;  4AQY L;  2UU9 L;  3M9B A;  3S24 A;  5E4X A;  3U4Z A;  2EYL A;  3MZ5 A;  3C1E A;  3KF6 A;  5I9P A;  1K83 H;  1EOV A;  1BR9 A;  2ZXR A;  5FJ8 H;  4KHP Q;  1Q1E A;  4GS3 A;  1RIP A;  3CC4 A;  5IYD G;  2KA7 A;  2DY7 A;  1CK1 A;  3L3O C;  1I50 H;  3H6M A;  1I4H A;  3K8A A;  4A3I G;  1IBL L;  3U50 C;  2R6G A;  1VQO A;  1PXU A;  5KYI A;  3CMA A;  4DNI A;  2VS1 A;  4IPH A;  4FF3 A;  2F0H A;  2PI2 E;  3FMC A;  4ZUJ A;  1RD9 D;  2L0C A;  3DM1 A;  5EJW A;  5LL6 X;  4HJ5 A;  1JCK B;  3RNU A;  3RMH A;  2L4N A;  3OPO A;  1AEX A;  3KUP A;  5JJK A;  4B3S L;  4PMB A;  4POF A;  4QCL A;  1Y1W G;  4R4C A;  5IY0 A;  1NAP A;  2WKD A;  4JI8 L;  3M4Q A;  1IBM Q;  1C4Q A;  4HIK A;  5CR3 A;  3RD4 A;  1R4P B;  4A3K H;  4HCE A;  2VNU D;  2K5D A;  3VA7 A;  5ELC A;  4HCS A;  4HED A;  1VS0 A;  5C5L A;  2MP1 A;  2F0O A;  1TWH H;  3I8Z A;  5FLX L;  4Z9C B;  2NVX H;  4LFA Q;  3SDZ A;  3VR4 A;  2VW9 A;  2HD3 A;  1FVI A;  1H9M A;  1XX8 A;  4ME3 A;  1B1Z A;  1MIU A;  1UAP A;  1E7Z A;  1I94 L;  3H0G B;  4LFC L;  1MJC A;  3CU7 A;  2AUJ D;  3CQZ H;  5CV4 A;  4KJO A;  4GNX B;  2KED A;  1WTQ A;  3PIO 3;  1C48 A;  1K3R A;  4F8M A;  4A3J H;  1PFN A;  1K8A C;  3MVV A;  2L12 A;  5M3F B;  2QF7 A;  2PZU A;  1E22 A;  3OWF A;  1KDB A;  1TT2 A;  1TQO A;  3GV3 A;  4ZQ3 A;  3S17 H;  2JA5 B;  1JMC A;  4KY6 A;  3UDI A;  3MWY W;  3S1N B;  1CZG A;  1W2B A;  2MFI A;  5A35 A;  2K52 A;  1TWF B;  3FKI B;  1EYA A;  4KY5 A;  4C3H H;  1KNE A;  2AWN A;  2KCT A;  1YIJ A;  4B3T Q;  4OO1 G;  4YCU A;  4X65 Q;  3RZD H;  2D9U A;  2RCN A;  1KTK A;  3K6O A;  2F0M A;  2KHS A;  3A8K E;  2PQA A;  2FHT A;  4A75 A;  3IKJ A;  1CSQ A;  2F0U A;  3SK4 A;  4JI6 L;  2NZH A;  1I4Q A;  2LXK A;  4K6D A;  4K6L A;  2HHH L;  3BS1 A;  1HA5 A;  4UP9 A;  3PO2 G;  3CCM A;  2UUC L;  2FXQ A;  2FMM A;  1X6O A;  4QUF A;  4WJ4 A;  3ERS X;  1OXU A;  2AUK A;  2H1E A;  3PV0 A;  1IBK Q;  4A3G B;  5C44 H;  2UXB L;  4ZKB B;  3CRK C;  3J81 c;  2Q8I B;  2B2T A;  4CJ1 B;  3W2D A;  1PYW D;  2DY8 A;  2JP1 A;  3RLF A;  3K7U C;  5DEH A;  4GKK L;  1CA6 A;  2NZO A;  5ELB A;  1FJG L;  3F2D A;  3HOZ G;  4RHS A;  3SVM A;  1BBW A;  4GOP A;  1ENF A;  4X66 L;  1EFI D;  2WII B;  1BUV T;  2LXJ A;  4K8J A;  5C4X G;  4L5T A;  1DM0 B;  4JI2 Q;  2ASB A;  3CCQ A;  2PZT A;  5M5W B;  2YU9 H;  3TBI B;  4WFN 3;  4FP5 D;  3DUZ A;  2H5X A;  1EEF D;  1QB5 D;  4OGQ C;  4BBS H;  2VL6 A;  2VQF Q;  2EE1 A;  1D1I A;  1EU4 A;  5D3I B;  3DWP A;  5EBC A;  4LW1 A;  2WAQ B;  2JEB I;  3L9A X;  4B3T L;  2MPM A;  4N9P A;  4K0K L;  1L0W A;  2ID0 A;  1A8V A;  4Q5V A;  3GTM H;  2IT1 A;  1HZB A;  2EYP A;  2JA7 B;  2BA1 A;  3ZJY C;  2R92 B;  3A0J A;  3WOF A;  2OWO A;  1H9S A;  1Q46 A;  4JYA Q;  1PTO B;  4DXG A;  4O42 A;  5EPK A;  1BO0 A;  1C7Y A;  3ULL A;  4HR7 B;  2UXC L;  3VYR A;  4QMG A;  1HZC A;  5IYC G;  3K59 A;  4YCW A;  4LFC Q;  2JA8 G;  3STB D;  1PZJ D;  2Z6K A;  2CW0 C;  3J7Z C;  1EY9 A;  2B2W A;  2BH2 A;  1YI2 A;  3S16 B;  1SBB B;  1GUO A;  3OIQ A;  3RZO H;  5C3E G;  3D8G A;  3OYY A;  3JAM c;  3QB3 A;  2XNA C;  3N6R A;  4A93 G;  1N34 Q;  1JOO A;  1YHB A;  1X55 A;  1QCB D;  5FK9 C;  4DR2 L;  3NBI A;  4Q0F A;  4L6T B;  3MAQ A;  4X3T A;  5KNB A;  1D6E C;  4MTN A;  4JI2 L;  1WTO A;  3FPP A;  2NVQ H;  3VR6 A;  2G9H D;  1VMP A;  2A1A A;  1CKN B;  1R9T H;  4X3S A;  1RKN A;  1WCM G;  2E8G A;  3SGI A;  3Q23 A;  1YJ9 A;  3HOW B;  1OXS C;  4YIJ A;  5CGK A;  2NVY B; 
#chains in the Genus database with same CATH homology
 4JI8 Q;  1GVP A;  4IPD A;  1UE7 A;  2K5V A;  1WOC A;  2PQA B;  1VQE A;  4LWC A;  3CC2 A;  2R7D A;  1IZ6 A;  1N32 Q;  1Q8K A;  1VQF A;  4PZ6 A;  2R92 G;  3F8T A;  2JA6 H;  1U5K A;  1B8A A;  5C0X J;  4DV6 Q;  1OXV A;  1LYL A;  5LMN Q;  4OX9 Q;  3CC7 A;  3CCL A;  4JV5 Q;  3MXN B;  4DV6 L;  2ZM6 Q;  1PH5 A;  4IFD G;  5E7N A;  3J81 j;  1VQ5 A;  1KL9 A;  3GTL H;  4A3L G;  4X65 L;  4GNX C;  3GTJ H;  4B3M Q;  2UXC Q;  2K5N A;  1VQC A;  4A93 H;  1DGS A;  1KAW A;  2JJQ A;  4HID A;  3GD7 A;  1Q81 C;  3PUX A;  4P73 A;  1QVF A;  4O0A A;  2Y0S G;  1CUK A;  3UE1 A;  4HJA A;  1Y1V G;  4R1J A;  1S40 A;  1JE5 A;  3FKI G;  3HOV G;  4DKA C;  2K14 A;  5M3M H;  2D0O A;  1N8R C;  2Q2I A;  2OTJ A;  1KHI A;  2OQ0 A;  5C0X I;  1PYS B;  2JQO A;  2RHQ B;  4YWK A;  1I6H H;  3HOZ H;  4PZ7 A;  1K9M C;  4C3I H;  4BBR H;  4KLK A;  4UPA A;  1Y14 B;  2Y0S E;  4QGU A;  3T1H Q;  4OWT B;  1M90 C;  2E5L L;  2F4V L;  2EQS A;  3BZK A;  1X65 A;  1XMQ Q;  4P74 A;  3I4M G;  4DUY L;  2GVA A;  4DR6 Q;  4Y52 H;  4LF7 L;  4RMF A;  5FLM H;  3I55 A;  4JBM A;  4HJ7 A;  2HHH Q;  5IE8 A;  4AIM A;  1M1K C;  3HFZ B;  1SN8 A;  3M4P A;  1VQM A;  3PO3 H;  4DR4 L;  1VQI A;  4DR5 L;  3FHW A;  4JI7 Q;  4A3D H;  4DR3 L;  1HJP A;  2WP8 J;  4IPC A;  5BR8 Q;  5GAD C;  5HY6 A;  5IYB H;  5EAY A;  1HNX Q;  1HNW Q;  3EN2 A;  5IYC H;  3G71 A;  3ULJ A;  2YYZ A;  3S16 H;  3T1Y Q;  2N8N A;  4JG2 A;  2XGT A;  4JI3 Q;  3H3V H;  4LNQ A;  4NXN Q;  2K75 A;  1EUJ A;  4YWM A;  3F2B A;  1GM5 A;  3PO2 H;  3HOX H;  3EBE A;  2CFM A;  2F52 A;  3AFQ A;  3I4N G;  2UXD Q;  4BXX G;  1JJC B;  4UP7 A;  4A3L H;  4DV0 L;  4GN5 A;  1L2F A;  4LF6 L;  3DM3 A;  4APV A;  1SE8 A;  1E3P A;  1CKO A;  3KLW A;  3CCU A;  4RG1 A;  4A3M G;  1LM0 A;  1BKB A;  1KIX A;  1GKH A;  2K50 A;  4A3G G;  3UDF A;  1EIY B;  2JK8 A;  1XJV A;  1VQB A;  1IBM L;  3F2C A;  1A63 A;  4JBW A;  2I0Q A;  3A5Z B;  1NJI C;  3TRE A;  4KHP L;  4LFA L;  1K8G A;  4X6A H;  4IPG A;  1N33 Q;  3A5U A;  1PH1 A;  1OXX K;  1IXR A;  4LF5 Q;  1VQD A;  3S2H H;  2HQL A;  4QY7 A;  1E1T A;  1WCM H;  2F4V Q;  3E9H A;  3CCE A;  4B3R Q;  1WI5 A;  1MKH A;  4ALP A;  3L2P A;  1EYG A;  1YEZ A;  1YVC A;  4UY8 C;  2JA5 G;  4JOI A;  4HIO A;  3W5O A;  1K0R A;  2JA7 G;  4BY7 H;  4PG3 A;  1VQP A;  1QVC A;  1OXT A;  2B29 A;  4DV2 Q;  4JI4 L;  1KXL A;  5M5X H;  4B3R L;  2PNH A;  3KDF A;  1CKN A;  3HOW G;  4LUO A;  3CXC A;  1X54 A;  4LF9 L;  4A3K G;  2R7F A;  2B3G A;  1YNX A;  4DV3 Q;  4DUZ L;  4A3F G;  3CPW A;  5GAH C;  1EQQ A;  2JA9 A;  1QUQ B;  4L5S A;  3CCR A;  2E2J H;  1CSP A;  1B70 B;  2D0P A;  1GD7 A;  3EIV A;  2EXD A;  4DR3 Q;  1G6P A;  4BBR G;  1HR0 W;  1LUZ A;  1P8L A;  1TWA H;  1PH3 A;  1VQK A;  4NXM L;  3TRZ A;  4A3G H;  1S72 A;  2AMC B;  5AJ3 Q;  4GLX A;  4JV5 L;  2QGQ A;  3RN2 A;  2AKW B;  3HOX G;  3L7Z C;  1HH2 P;  3PF4 A;  3BJU A;  3E9I A;  1MJE A;  1XPU A;  2VQE L;  2BA0 A;  2AWO A;  3J80 c;  2IHE A;  2DUD A;  1UE5 A;  3STB C;  1JJ2 A;  1ASZ A;  4LF4 Q;  5AJ3 L;  1YJW A;  3LGJ A;  4DPG A;  2VQE Q;  2A19 A;  2ALY B;  5C0X G;  3BZC A;  3K7A H;  1PH7 A;  4AH6 A;  1IBL Q;  3S1R H;  4X62 Q;  3FP9 A;  4GN4 B;  1B7Y B;  4X64 L;  5IYB G;  4B3S Q;  2KBN A;  4X62 L;  5M5W H;  3JAM i;  4AQY Q;  2UU9 Q;  3KFU A;  1W3S A;  4IJL A;  1WFQ A;  4OWX B;  4IJH A;  4AYB E;  1YHQ A;  4JI1 L;  4DV1 L;  4LF9 Q;  2I5L X;  1VQ7 A;  2I5M X;  4QL5 A;  4PMW A;  3M85 A;  4A3J G;  5IP9 G;  1G51 A;  4BXX H;  3U4V A;  3GO5 A;  3PIP A;  1PH9 A;  2L15 A;  5C3E H;  4DUZ Q;  3PCO B;  3PUZ A;  1HNW L;  3Q8D A;  4C3J H;  1U0L A;  1NMF A;  4DV4 Q;  1PV4 A;  3NEM A;  5BR8 L;  5HGQ A;  1VQ9 A;  1HR0 L;  1XNR Q;  4NXM Q;  4DV2 L;  4BBS G;  1HR0 Q;  4Y7N H;  1BVS A;  5IYD H;  1X3F A;  4KI0 A;  3U58 A;  3K0X A;  3TS2 A;  1D7Q A;  2R7Z H;  4LFB L;  4DV0 Q;  3CAM A;  2OTL A;  2UXD L;  2VZA A;  3HKZ G;  3AYH B;  4R4T A;  3S2D H;  1L1O C;  1XNR L;  2Q2T A;  2B63 H;  2D62 A;  1NY4 A;  1TXY A;  4EX5 A;  4JBJ A;  2CWP A;  4BY1 G;  4A3C H;  1N9W A;  4BY1 H;  1X56 A;  4AQY L;  2UU9 L;  1NE3 A;  4UP8 A;  2GVB A;  3M9B A;  4LFB Q;  2E2H H;  2VUM H;  4X64 Q;  3S24 A;  2K5H A;  3U4Z A;  2LSS A;  4BY7 G;  1VQL A;  1VQJ A;  2XTI A;  2R92 H;  1E1O A;  3K80 C;  3KF6 A;  3KJO A;  2R93 G;  2OCE A;  3PUY A;  3CF5 A;  1K83 H;  2N78 A;  2YTX A;  4A3E H;  3UE0 A;  1EOV A;  5J3B A;  5JEA G;  1PH8 A;  3CCS A;  5FJ8 H;  1V1Q A;  3NBH B;  4EQ5 A;  1Y1W H;  4DR6 L;  4KHP Q;  1NMG A;  5M3F G;  1Q1E A;  4GS3 A;  1XMQ L;  1XMO Q;  2Z6K C;  5IWA Q;  1RIP A;  4JCV E;  2PMZ E;  3CC4 A;  5IYD G;  3OTO Q;  1PFS A;  1I50 H;  3FKI H;  1SRU A;  1Q12 A;  1TWF H;  3K8A A;  4JOI C;  2WB1 G;  4A3I G;  1I5F A;  1O7I A;  1VQ6 A;  3TQY A;  4IOC A;  2AHO B;  3J80 i;  3U50 C;  4A4I A;  5FLM G;  2R6G A;  3ER0 A;  3OTO L;  1VQO A;  1IBL L;  2KCM A;  2NN6 G;  4J15 A;  5IWA L;  3CMA A;  4NPS A;  4JI6 Q;  2ZTC A;  4DNI A;  2VS1 A;  4IPH A;  3G6E A;  3DLL A;  1KRT A;  3KYH C;  2PI2 E;  4WJ3 M;  1YHA A;  3AFP A;  2MQH A;  4KHZ A;  5IT9 c;  1KD1 C;  2JA7 H;  4GNX A;  5K36 G;  3PIO A;  2Q2U A;  2C35 B;  1EWI A;  3HKZ E;  2N49 A;  4HJ5 A;  4JI7 L;  2JA8 H;  3RNU A;  4A3B G;  3KJP A;  4GKJ Q;  4AYB G;  1L1O B;  3I4N H;  3CD6 A;  1V9P A;  5JJK A;  4B3S L;  4POF A;  4L5Q A;  2WAQ G;  1N34 L;  1Y1W G;  4R4C A;  5IY0 A;  5GAE C;  2IX1 A;  5M3F H;  4JI8 L;  1PYB A;  2NVY H;  3M4Q A;  4HJ9 A;  1IBM Q;  5GQO A;  2A8V A;  4HIK A;  4LF4 L;  3ICE A;  3PGZ A;  2KHI A;  3I4O A;  5IP7 G;  1NBW A;  4JI1 Q;  4DV1 Q;  1C9O A;  3H15 A;  4A3K H;  2VNU D;  3RR5 A;  3S1N H;  2IHF A;  4QJF A;  5JJI A;  4L5R C;  5IP9 H;  1AE3 A;  2KHJ A;  4JI0 L;  1VS0 A;  2QEX A;  1JB7 A;  4TVA B;  4DK3 C;  4OO1 I;  3D0F A;  2RHS B;  4DR4 Q;  4X66 Q;  4YCV A;  4DV5 L;  1C0A A;  1TWH H;  4HIM A;  3CPF A;  4A3C G;  2B63 G;  5C4J H;  1AE2 A;  3PUV A;  4DV4 L;  1PH4 A;  3I4M H;  4OON A;  5GRO A;  1A62 A;  1NTG A;  1VQH A;  1T9H A;  2N3S A;  2ZTE A;  1WYD A;  3W1B A;  2NVX H;  4LF7 Q;  2YTV A;  4LFA Q;  4DV3 L;  1QVG A;  3J81 i;  3RLO A;  4JC0 A;  2VW9 A;  2IY5 B;  1VQA A;  1FVI A;  1X3E A;  4MNO A;  1Q1B A;  3TEH B;  3T1H L;  2R93 H;  2WFW A;  4JI4 Q;  4A3B H;  4ME3 A;  1E24 A;  3NEN A;  1PH6 A;  1MIU A;  2CKZ B;  2HIX A;  4A3E G;  1E7Z A;  1EIF A;  1I94 L;  4DR7 L;  1HNX L;  4LFC L;  4A3D G;  1MJC A;  3HOY H;  1I3Q H;  4R4O A;  1ASY A;  3M4O H;  3CQZ H;  1VQ8 A;  5C4X H;  4GNX B;  4DUY Q;  3I7F A;  4R4Q A;  3M3Y H;  4QIW E;  5JEA J;  3J7A 5;  4YWL A;  1K3R A;  3AEV A;  3E0E A;  4A3J H;  1VQN A;  1K8A C;  4JI3 L;  5IP7 H;  2QA4 A;  2V1C C;  1N33 L;  3UDG A;  4YHH L;  4DAY B;  1E22 A;  1CKM A;  2ZJP A;  3S17 H;  5LMU L;  1JMC A;  3GTO H;  3UDI A;  3S14 H;  5ELN A;  1W2B A;  4IFD I;  1P16 A;  2MFI A;  4PZ8 A;  2K52 A;  3RN5 A;  2ATW A;  1A0I A;  3S1Q H;  4JBK A;  4C3H H;  4DR2 Q;  5C44 G;  4OXP A;  2UUA L;  1IBK L;  1HNZ Q;  2AWN A;  2KCT A;  1YIJ A;  4B3T Q;  1TWG H;  4YCU A;  3HOV H;  3S15 H;  4OO1 G;  1LTL A;  4X65 Q;  4GOP B;  1PHJ A;  2DGY A;  3RZD H;  4OWW B;  3KDF B;  4POG A;  1G29 1;  4LUV A;  2RCN A;  4P71 A;  4DV7 L;  4A3M H;  4LF8 Q;  2WAQ E;  1OTC A;  4GOP C;  4LUZ A;  4YY3 Q;  3HOY G;  4K0K Q;  2PQA A;  1XPR A;  4A75 A;  1TWC H;  1CSQ A;  1VCI A;  3CCV A;  3GTK H;  4TQU S;  3GTQ H;  4JI6 L;  2NZH A;  2VUM G;  2LXK A;  4BA2 I;  2ZM6 L;  4YY3 L;  2JA6 G;  4R4I A;  1PH2 A;  1XNQ Q;  3HOW H;  4DV7 Q;  2E2I H;  2HHH L;  2VQF L;  4LF8 L;  1YBY A;  4LF5 L;  3M7N A;  4UP9 A;  1WJJ A;  3PO2 G;  3T1Y L;  3CCM A;  2JEA I;  1Z47 A;  2UUC L;  4JYA L;  1X9N A;  2ES2 A;  1XTD A;  2FXQ A;  3G48 A;  3OW2 A;  1Q86 C;  5DLQ E;  2YV5 A;  1EFW A;  1X6O A;  1YJN A;  1UWV A;  3CW2 C;  4WJ4 A;  3ERS X;  1OXU A;  2K4K A;  3D31 A;  4DR1 Q;  5FLX c;  1RL2 A;  5M3M G;  4DR5 Q;  3PV0 A;  1FGU A;  2Q2H A;  4GN3 B;  1IBK Q;  4DR7 Q;  5C44 H;  3RLN A;  1UEB A;  2UXB L;  2Z0S A;  1JJG A;  2EIF A;  2CCZ A;  2MO0 A;  1KC8 C;  3J81 c;  1PVO A;  1JT8 A;  2RF4 A;  4NB3 A;  3RLF A;  4YHH Q;  1UE1 A;  4XTC S;  1PA6 A;  3K7U C;  2VY3 A;  3BU2 A;  4FDB A;  3PF5 A;  4GKK L;  2NZO A;  1FL0 A;  4NXN L;  3MEF A;  1FJG L;  3F2D A;  2UUA Q;  3HOZ G;  3H3V I;  3B6Y A;  3AQQ A;  1BBW A;  4GOP A;  4X66 L;  4DV5 Q;  1Q7Y C;  3S1M H;  2LXJ A;  5H1S E;  4B3M L;  5C4X G;  4L5T A;  4JI2 Q;  2ASB A;  5LMU Q;  3I2Z A;  3CCQ A;  2NVT H;  1QZG A;  3CP0 A;  2OQK A;  2JA5 H;  3HOU G;  1X3G A;  3H0G G;  2YU9 H;  4IFD J;  1SMX A;  2F3I A;  2H5X A;  1HZA A;  2JE6 I;  3H0G H;  4JI5 Q;  3HKS A;  4BBS H;  4C2M H;  2VL6 A;  2VQF Q;  1KQS A;  5LMN W;  2CWA A;  3K81 C;  2MO1 A;  1XMO L;  2KEN A;  3CCJ A;  3F1Z A;  4LW1 A;  1N36 L;  4A76 A;  4B3T L;  2JEB I;  2E5L Q;  2CQO A;  4GLV B;  2BH8 A;  1L0W A;  4K0K L;  1IYJ B;  1A8V A;  2ID0 A;  2UUB Q;  3GTM H;  2IT1 A;  1HZB A;  5LMN L;  3GTG H;  4GKJ L;  2UUB L;  1VQG A;  2PI2 A;  4GLA C;  4LF6 Q;  2BA1 A;  1D8L A;  3ZJY C;  1N32 L;  3A0J A;  1HZ9 A;  1N36 Q;  1YZ6 A;  3KOJ A;  3G4S A;  2OWO A;  4IOA A;  1Q46 A;  2UUC Q;  4JYA Q;  1J5E L;  1UE6 A;  3W1G A;  1AH9 A;  1H95 A;  2GN5 A;  1J5E Q;  3GTP H;  3KF8 B;  3WWV A;  1C7Y A;  3ULL A;  3I56 A;  2NN6 I;  2UXC L;  3L0O A;  5FJ8 G;  1HZC A;  4DAM A;  5IYC G;  2MNA A;  3HOU H;  4HJ8 A;  4JI0 Q;  2R7Z G;  4YCW A;  4LFC Q;  2HT1 A;  2JA8 G;  4BA1 I;  4IO9 A;  2ZTD A;  1GO3 E;  3ULP A;  1BBU A;  1J6Q A;  3STB D;  1K73 C;  4MZ9 A;  1Y1V H;  2Z6K A;  4JI5 L;  4OX9 L;  3PO3 G;  1IL2 A;  3J7Z C;  1QZH A;  2BH2 A;  1FJG Q;  4O2D A;  1Z9F A;  5GAG C;  1YI2 A;  3UDX A;  1SFO H;  1YIT A;  5JJL A;  2HIV A;  3RZO H;  4A3F H;  4XIG S;  5C3E G;  3JC6 6;  4P72 A;  3OYY A;  3GDE A;  5M5Y H;  3JAM c;  1V43 A;  1XPO A;  4A93 G;  1N34 Q;  1YHB A;  5ELO A;  1X55 A;  1HNZ L;  3CME A;  3VDY A;  2I5H A;  1Q82 C;  1I94 Q;  4DR2 L;  1KRS A;  2IX0 A;  3KF6 B;  4GKK Q;  4QQB X;  1S3O A;  1VQ4 A;  1SR3 A;  4DR1 L;  3IRB A;  2WB1 E;  4MTN A;  4JI2 L;  1EQR A;  2NVQ H;  4A3I H;  2ZJQ A;  2A1A A;  1QUQ A;  1CKN B;  4H02 A;  1R9T H;  1SLJ A;  4DK6 C;  2UXB Q;  1WCM G;  2ZJR A;  3TS0 A;  2E8G A;  3NEL A;  4P75 A;  1L1O A;  3SGI A;  1YJ9 A;  2YTY A;  1XNQ L;  1OXS C;  3PSI A;  3A74 A;  3PUW A;  1SRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...