4IJHA

Fragment-based discovery of protein-protein interaction inhibitors of replication protein a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of Protein-Protein Interaction Inhibitors of Replication Protein A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
total genus 28
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ijhA00
1FL0A 1GVPA 1XMOQ 1PH8A 3LGJA 1VQHA 4A4IA 1N36Q 4GNXA 1OTCA 2NVTH 4YCUA 2JA7H 5M3MH 4A3DG 5IT9c 1XPRA 4JI2Q 2PMZE 2N49A 1VQOA 4UY8C 1Y1WH 1HNXQ 3HKZE 1KRTA 1JMCA 3GDEA 2CFMA 4OXPA 4AYBE 3ERSX 3U4VA 1X3FA 5HY6A 4X64L 4IOAA 5IWAQ 3TS0A 4DR1L 3I55A 1VQPA 4O0AA 2VZAA 3ER0A 3M3YH 3HFZB 1Q1BA 1YEZA 4X62L 1HJPA 4P75A 3K81C 1Q81C 3KOJA 2LXKA 4L5RC 1A8VA 1XNRQ 1W3SA 3TS2A 4OO1G 3CC4A 5JJLA 1VS0A 4DV6L 4DR1Q 3H0GH 4GOPC 5M5YH 1YI2A 1P16A 2ES2A 1JE5A 3PF5A 2GN5A 4BBRH 5M5WH 3I7FA 2E8GA 5IP9G 1QUQB 5C44G 4GOPB 1I5FA 1N8RC 2OTLA 1K8AC 1HZAA 4JI5Q 1BBUA 3RLOA 4WJ4A 2E5LL 2R92H 2VQFL 4DV6Q 1E24A 1SFOH 1PH5A 2QGQA 2KENA 5C4JH 4DUYL 1BKBA 2RCNA 4OX9L 3PCOB 1PV4A 4LW1A 1IYJB 3H3VH 1VQJA 2ZJPA 4PG3A 2E2JH 2N3SA 5LMUQ 4IPHA 4H02A 4IJHA 3G4SA 1SR3A 4LF4L 1JJGA 1NMGA 2KHIA 5GADC 2E5LQ 2AMCB 3CCUA 2JJQA 1I3QH 3CC7A 3KF6B 3DM3A 2WB1E 4YWMA 4EX5A 2NVYH 2WAQG 4JG2A 5C0XI 4LF8Q 4OX9Q 3BZKA 3RN2A 5GAGC 1VQCA 2K4KA 4A3KG 4PZ6A 3W1BA 4RMFA 1AE3A 2AKWB 3CQZH 4NPSA 1H95A 2Q2UA 1EIFA 2UUCL 3KJPA 5EAYA 3STBC 1FGUA 1YBYA 4DKAC 3DLLA 2Y0SE 1N34L 4BXXG 1CSPA 4LUVA 1R9TH 5IP7G 4DV3Q 3HOZG 1E3PA 1M90C 4ME3A 3KDFB 1J5EL 1I50H 1C0AA 2F4VL 1NBWA 2UUCQ 2KCMA 4A3LG 1X56A 4MZ9A 1NE3A 2ASBA 3IRBA 2VS1A 2EXDA 2K5HA 3J7ZC 3T1YL 2B63G 3HOWG 4QIWE 2BH8A 3E9HA 2VNUD 5IYBG 3A74A 4JOIA 3TRZA 4FDBA 4HJ8A 2ZJRA 2HHHL 3GTPH 1VQEA 4YWLA 2UXCQ 5GAHC 1GM5A 4A3FH 1HNWL 5C3EH 1TWCH 1KQSA 3PIOA 3PUWA 1PH3A 4PMWA 4DR7Q 1LUZA 1RIPA 5IY0A 1MJCA 4A93H 1XMQQ 4DV5L 3K0XA 5AJ3L 1U0LA 2VL6A 3CCRA 1JJCB 4JI3Q 3M4OH 3FP9A 4QL5A 4LFCQ 3M4PA 1KHIA 2CQOA 1AE2A 1X55A 1E7ZA 1JJ2A 1C9OA 1MIUA 1PH4A 2MNAA 2UUAQ 2MO1A 4L5SA 1IBLL 4DR2Q 4JYAL 2K75A 1A0IA 3CCQA 4DV5Q 4LF9L 3OW2A 4LF6L 1KAWA 4L5TA 2RHQB 4B3TQ 2YTVA 4DV4L 4IFDG 4POGA 1RL2A 1VQ5A 3CP0A 5M3FG 2IX1A 1Z9FA 4JC0A 1WCMG 4JI6L 1TWFH 1Q1EA 2R6GA 4LFBL 1L1OC 2BA1A 1C7YA 2PI2A 3HOUH 3PO2G 4DV1L 1HZCA 4DV0Q 3HOYH 4LF6Q 4DK6C 1XJVA 4A3BG 1PH7A 1YJWA 2R93H 1BBWA 2ALYB 2KBNA 1Y1VG 4JBKA 1L1OB 1XTDA 1PH9A 1IBML 1QUQA 1EUJA 3Q8DA 2ID0A 1HR0Q 4GOPA 3EBEA 1N32Q 4JI6Q 1YITA 4LFBQ 4C3IH 4GKKQ 1IBKL 4DV1Q 4NXNL 4P73A 1HZ9A 3AYHB 4L5QA 3CMAA 2OTJA 2UXBQ 2I5HA 3CCJA 1Y14B 2R7DA 3HOVH 2JA8G 3AFQA 3NELA 3RR5A 4POFA 4TVAB 1IBMQ 2UU9L 1MJEA 1XNQQ 2R7ZG 4IFDI 2ZM6L 1GD7A 2VUMG 2AWOA 3AQQA 2JEAI 1G291 4UP8A 3S2DH 3CPWA 4B3MQ 1YNXA 3CPFA 2JA6G 5GROA 2HIXA 3S24A 3OTOQ 3ULPA 3UE1A 5M3MG 3KF6A 2Q2IA 1VQ8A 3CCSA 1CKMA 3GTLH 1EFWA 4KHPL 1Y1WG 1CSQA 2UU9Q 3S1RH 1AH9A 2H5XA 4YHHL 1HNZL 1S3OA 4JBJA 1HR0W 3RNUA 1OXXK 1L0WA 1SE8A 2JEBI 2FXQA 1CKNB 2PI2E 2D0OA 4KHPQ 1EWIA 2YYZA 2C35B 5E7NA 4JI1L 2OQ0A 1HNZQ 4X64Q 3SGIA 4DNIA 5C0XG 2XTIA 1FJGL 3KDFA 3ICEA 1UEBA 4APVA 4HIKA 1NMFA 4LF5L 3S1NH 3CC2A 2F52A 4LUOA 1UWVA 4JI8L 4X62Q 4JBMA 3PF4A 1KXLA 3H0GG 2Z6KC 1QZGA 4A3IH 2I5MX 4JI0L 1IXRA 2R7FA 1LTLA 3I2ZA 3G71A 4GN5A 2LXJA 4LF7L 1N33L 3GTQH 4IJLA 3W1GA 4BY7H 4OWTB 4AQYL 3GTGH 3ZJYC 3STBD 2OCEA 5LMNL 1TXYA 3GTJH 3I4NG 1X3GA 3J81i 1LYLA 2MQHA 1K3RA 5FLMG 4JI4L 3TEHB 3S1QH 1EYGA 1HH2P 4LWCA 2VQFQ 1YZ6A 4LF7Q 1Q46A 4C3JH 3L7ZC 1K73C 1PA6A 3D31A 4LFAL 4DUYQ 4AQYQ 4PZ8A 3GD7A 2A19A 1B8AA 2OWOA 4A3EH 2YU9H 1Q7YC 2UUBL 2UXDL 5JJIA 4LF4Q 3GTOH 2AHOB 2IX0A 4A3CH 4R1JA 1K0RA 2VW9A 2HT1A 1QZHA 2IY5B 1EQRA 2V1CC 2N78A 4LFAQ 4Y52H 2EQSA 4X65L 4JI7L 3CCMA 1WOCA 3J81c 1VQKA 1GKHA 3K7AH 1TWAH 1I94L 3S1MH 2K14A 3PSIA 4A3KH 4TQUS 1YHAA 3NEMA 1TWHH 3BZCA 4HIMA 1D7QA 2Q2HA 2D62A 5J3BA 3F2CA 1N34Q 2A8VA 2VY3A 1CKOA 2MO0A 1D8LA 4XTCS 1S72A 4B3SL 3AEVA 1A63A 2ZTCA 3CF5A 2HQLA 2MFIA 1Q8KA 2JA5G 4LNQA 4BXXH 2WFWA 1J5EQ 3I4MG 4GN3B 1VQBA 2D0PA 5IP7H 3HOZH 2JE6I 2F4VQ 4HJAA 2Z0SA 3I4OA 1K8GA 4KI0A 4HJ9A 3F2DA 1SROA 2K5VA 3T1YQ 4A3LH 4QQBX 4UP9A 4UP7A 3KJOA 1YJNA 4BY1H 2BH2A 1OXSC 1NJIC 2B63H 3HOWH 3S14H 5C3EG 2PNHA 4QJFA 3UE0A 4IFDJ 4DAMA 2PQAB 1VQLA 1X54A 5DLQE 4A93G 4Y7NH 4DV2L 1HNWQ 1G51A 2VQEL 1WJJA 5C4XH 3G6EA 3B6YA 4DV7L 4A3JG 2IHFA 1PFSA 5AJ3Q 3GTKH 3HKZG 2NVQH 2K5NA 5JJKA 1VQIA 4DR3L 4YY3L 1CKNA 2CKZB 2WAQE 1U5KA 5H1SE 3CCVA 3HOXH 2VQEQ 4BA1I 1OXUA 1IBLQ 3PO3H 4JYAQ 1IZ6A 1VCIA 1X3EA 4O2DA 4LF9Q 2A1AA 2K50A 5FJ8G 5FLXc 4DV4Q 1YJ9A 5IYDH 5ELNA 4A3MH 2E2IH 1E22A 3TQYA 5IE8A 1YIJA 4AH6A 4OWWB 4BBSG 1CUKA 4MTNA 5JEAG 3EIVA 5M3FH 2EIFA 1DGSA 3PV0A 4P71A 1YHQA 3K80C 4R4CA 3CW2C 4KHZA 3FKIG 4K0KL 2Z6KA 4A3GH 3MXNB 5K36G 3PO2H 3I56A 1VQFA 2KHJA 4IPCA 4DAYB 2RHSB 1Y1VH 4QGUA 1ASZA 1TWGH 1WI5A 3PUZA 1IBKQ 4NXNQ 4EQ5A 4QY7A 2JA7G 3CAMA 1VQMA 1M1KC 1NTGA 5IYCH 4MNOA 1SRUA 2ZM6Q 3W5OA 1V9PA 4JI2L 2JA8H 4B3RL 1J6QA 1N9WA 3NENA 5C0XJ 4ALPA 1HNXL 4OWXB 1UE1A 3U58A 2VUMH 3CD6A 4A3DH 4BA2I 1BVSA 2F3IA 2JA6H 3TREA 1K83H 3K7UC 1IL2A 2L15A 4GLXA 4AIMA 4YCWA 4YHHQ 1EQQA 3M4QA 1KIXA 5IWAL 4X6AH 1VQ6A 4B3RQ 2I0QA 4C3HH 4YWKA 1PHJA 2Y0SG 1UE7A 4DUZL 5GQOA 3T1HL 3PUYA 1UE5A 3CMEA 1XPUA 2N8NA 1G6PA 3S2HH 2NN6G 2CWPA 4JI1Q 3U50C 1O7IA 3HKSA 1XNRL 3L2PA 1PVOA 3E9IA 4BBRG 3UDFA 4R4QA 1FJGQ 3CCEA 4A3IG 4LF5Q 1VQ9A 4DUZQ 1P8LA 4KLKA 3T1HQ 3K8AA 4JI8Q 4XIGS 3RLFA 2R92G 4JI5L 3BU2A 4JI0Q 4GLVB 5M5XH 5IP9H 2NZOA 2ATWA 4BY7G 3JAMi 5ELOA 3A0JA 2GVBA 2RF4A 5C44H 3A5UA 4R4IA 1N33Q 1NY4A 3M9BA 4JCVE 2PQAA 2B3GA 3KFUA 2B29A 1V1QA 4DR4L 3RLNA 3OYYA 5LMNQ 4IOCA 4WJ3M 3RZDH 1V43A 5LMUL 2KCTA 3J80i 4OONA 2OQKA 4J15A 4JI4Q 3I4NH 1A62A 4GNXC 2NN6I 4R4OA 5FLMH 4A3EG 3E0EA 2NZHA 1B7YB 4LF8L 4DR4Q 4IPDA 4GNXB 2JQOA 4A3CG 1ASYA 3VDYA 2UUBQ 2UXDQ 3UDIA 1L2FA 4JBWA 3JAMc 4YCVA 4JV5L 1LM0A 2JK8A 4X66L 2YTXA 4OO1I 4X65Q 4JI7Q 1WYDA 4DV3L 1L1OA 3H3VI 2K52A 1YVCA 4NB3A 5LMNW 3J80c 2YTYA 2NVXH 4HIOA 3H15A 1X6OA 1I94Q 5BR8L 1VQDA 4JV5Q 2WP8J 3D0FA 1XPOA 3BJUA 4X66Q 2ZTEA 1PH1A 3RZOH 1VQGA 4R4TA 1Q86C 1X9NA 1KD1C 1X65A 4B3SQ 1E1TA 3F1ZA 3J81j 1HZBA 3RN5A 3NBHB 4DR5L 2LSSA 4A75A 4A3FG 3UDGA 3KF8B 3EN2A 5BR8Q 1UE6A 1JB7A 2CCZA 1OXTA 3CCLA 2JA5H 1FVIA 1SN8A 1VQNA 1PYBA 5IYBH 2UXCL 3I4MH 3A5ZB 4BY1G 3ULLA 4DR7L 2IT1A 1W2BA 3KYHC 3L0OA 3PUVA 1VQ4A 4RG1A 1XMQL 1SLJA 2DGYA 3GO5A 1PYSB 4DR5Q 2HHHQ 4HJ7A 4JI3L 4LFCL 5C4XG 1YHBA 3M85A 2HIVA 3S16H 3MEFA 1MKHA 4DV2Q 1EIYB 4AYBG 2E2HH 3PGZA 4C2MH 2XGTA 2UUAL 1QVFA 2ZJQA 1VQAA 4DR2L 5JEAJ 3M7NA 4DV7Q 1E1OA 2QA4A 4B3TL 4GLAC 1Q12A 4A3JH 3HOXG 1PH2A 1SMXA 3FHWA 2Q2TA 4DR6L 2IHEA 2JA9A 2ZTDA 5GAEC 4HIDA 3WWVA 4YY3Q 4HJ5A 4DR3Q 3PO3G 3HOUG 4IO9A 3HOYG 1VQ7A 2I5LX 1T9HA 4DPGA 2R93G 5IYDG 1QVCA 4A3MG 4DV0L 1S40A 3G48A 1KL9A 1WCMH 1QVGA 1Q82C 3PUXA 3GTMH 1PH6A 3ULJA 4DR6Q 3JC66 3U4ZA 4IPGA 3KLWA 4GS3A 1KRSA 2AWNA 3S17H 3F8TA 4GN4B 2GVAA 5FJ8H 3UDXA 1HR0L 4A3BH 3F2BA 1N32L 1JT8A 2BA0A 4LUZA 4GKJL 1GO3E 3S15H 1WFQA 3CXCA 4A3GG 4GKKL 3HOVG 2DUDA 1OXVA 4BBSH 3PIPA 1Z47A 4NXML 4JOIC 1K9MC 4K0KQ 2UXBL 2YV5A 4P74A 1XMOL 1XNQL 1I6HH 1N36L 3J7A5 3FKIH 4UPAA 3AFPA 4GKJQ 4B3ML 2QEXA 2R7ZH 5HGQA 1B70B 4A76A 2WB1G 1EOVA 5IYCG 4DK3C 3OTOL 4PZ7A 1KC8C 4P72A 4NXMQ 2CWAA
chains in the Genus database with same CATH superfamily
4A3FB 1PH8A 1VQHA 1DJRD 1OTCA 1F2YA 4YCUA 4EQOA 4JI2Q 2PMZE 1VQOA 1JORA 1MHWC 5ELFA 1NR2A 3R8BA 1PTOC 3P1HA 1BUVT 4Y7NB 4IUTA 1L0YB 1PRTD 4OXPA 4AYBE 3ERSX 3U4VA 1X3FA 4X64L 3FMCA 4KHVA 1VQPA 2AQ2B 4O0AA 4AYBB 4H44C 1T5XD 3C1FA 5I2XA 4G7HC 4L5RC 1W3SA 4S3SA 3TS2A 2HCIA 4DR1Q 4GOPC 3Q22A 3HOUB 1JE5A 4BBRH 3CHBD 1QUQB 5IP9G 5M9OA 3K5MA 4A3MB 1K8AC 3SXHA 4JI5Q 4V0BA 5CR3A 1E24A 2M00A 2KENA 2RCNA 5BN5A 1PV4A 3H3VH 4HAEA 1GHJA 2ZJPA 4PG3A 2N3SA 1IYUA 4QMGA 1SR3A 3C1EA 1HQMC 3CCUA 3MC0B 2BCOA 2RDGA 2PO4A 3GP7A 4OX9Q 4EX5A 4JG2A 1SE2A 3BZKA 3GTLB 3D4DA 1CT1D 4M1UB 4RMFA 1FR3A 3Q6SA 1Z7TA 3U9SA 2DY7A 4DKAC 2B8FA 2Y0SE 2G5DA 1BCPC 1CSPA 4LUVA 4EQPA 4BXXG 1XXGA 4O1NA 4LAAA 2QF7A 1QNUA 3HOZG 1K83B 2F0FA 2Y0SB 1E3PA 4K8JA 3D6CA 1I50H 4IALA 4JW0A 3KBGA 5D14A 1IKLA 4NDXA 5G3LF 1DZ1A 4FP5D 2K5HA 5T1GA 1HA5A 3E9HA 2VNUD 3J81E 2Z8LA 1EZ8A 3H6MA 4YWLA 5GAHC 4K5XA 2AQ1B 1SNQA 5C3EH 1ILPA 5IY0A 3GTJB 1MJCA 4A93H 2D9UA 1AW7A 4JI3Q 3CCRA 3M4OH 4QL5A 2NB0A 4C3JB 5IGCA 1KHIA 2CQOA 1ZEQX 2C9OA 1XWEA 4ZUIA 2MNAA 2E74C 4MIUA 2O5JC 2K75A 4DV5Q 4LF9L 1HA6A 3H91A 4CJ1B 4IFDG 1KAWA 2YTVA 4DV4L 2MPMA 1PZKD 5K5PA 1RL2A 3MFYA 5M3FG 1EOTA 1WCMG 2PZTA 4LFBL 2BA1A 2WAQB 4DV1L 3MA2B 1WTVA 3QIAA 2CW0C 1BOSA 4GOPA 2HDLA 3EBEA 1CQVA 1YITA 1HR0Q 2FHTA 4C3IH 1HUMA 3NTIA 5AFWA 5EPJA 2KEEA 4P73A 5FLXE 4L5QA 4PNYA 5I6YA 3CMAA 2I5HA 1Y14B 3HOVH 4POFA 1JQYD 4IFDI 1S5DD 1VMPA 2JEAI 1G291 3S2DH 2K5QA 3CPFA 4K8IA 2HIXA 3S24A 3HOWB 3J7YW 5L37A 5M3MG 3I3CA 1A3UA 3AU7A 3CCSA 1CKMA 4KHPL 1Y1WG 1CSQA 2UU9Q 4K5VA 4FO2A 3I73A 2MGSA 4JBJA 1SE8A 2JEBI 2EVBA 2D0OA 2RQXA 1EWIA 1LTAD 2F0OA 3SGIA 1CHPD 2Z1CA 2NN6H 3ICEA 3S1NH 5ISRA 1CI3M 1WTHA 1UWVA 4JBMA 3PF4A 2E2IB 2L0CA 1QZGA 2I5MX 1IXRA 2O2LD 2LFNA 4DXGA 1SEBD 5ELEA 2JP1A 5LMNL 1TXYA 3I4NG 3OMCA 1LYLA 3J81i 1TWGB 3E0JA 1K73C 3VYSA 1A15A 3CKIB 1PRTC 2A19A 1O7YA 1B8AA 3GD7A 3J80L 2OWOA 4A3EH 2UXDL 1BCPF 4R1JA 2R7ZB 4IUVA 1U4MA 3VR3A 2IY5B 2VUMB 2EQSA 2EJFC 1VQKA 1HRJA 3S1MH 2K14A 3TP8A 4TQUS 5E1FA 3NEMA 4HIMA 2D62A 3QO2A 1N34Q 1SYGA 2VY3A 4ZRZA 3D4RA 4B3SL 1A63A 2ZTCA 3CF5A 2HQLA 2MFIA 4LNQA 2WFWA 4XYQA 3JAME 1A2TA 2F4VQ 2Z0SA 4L6TB 1K8GA 2KA7A 4KI0A 2I07B 4HJ9A 2L12A 2K5VA 3T1YQ 4QQBX 4RCNA 4BY1H 5M5XB 4QJFA 3UE0A 1VQLA 1X54A 3VYUA 3P7JA 1G51A 2N55A 1WJJA 1CA6A 3LWEA 2IHFA 3VYRA 1PFSA 1CFMA 1VQIA 4HMJA 4DR3L 1X3PA 4YY3L 1CKNA 1F2ZA 1U5KA 2F0IA 2TSSA 5FJ8G 1E22A 3TQYA 3TP5A 3A8KE 5J39A 3MAQA 3D4WA 4CKBA 2CQAA 5KRUA 1SAPA 1SYBA 3I56A 3PO2H 5IT9L 2KHJA 3I70A 4KD3A 1HXYD 4CDDC 3A8IE 2K04A 2JA7G 3CAMA 1VQMA 4KKTA 1A3TA 4JVZA 3H94A 5IYCH 1M1KC 1TY2A 1ZYRD 5C0XJ 3NENA 2EPBA 4OWXB 1UE1A 4A3DH 4BA2I 1BVSA 5BN4A 2A68C 3TREA 1IL2A 5C3EB 4GLXA 4YHHQ 3M4QA 4RHSA 4B3RQ 2I0QA 4A93B 5KNCA 4YWKA 2EYHA 4DF7A 1LT5D 4FF2A 4WJWA 1UE7A 3M4OB 4DUZL 3T1HL 3CMEA 1GJXA 3HKZB 1G6PA 3UI2A 5KIXA 3U50C 3NTHA 2KCCA 3UDFA 2Z6BA 5C0XH 1VQ9A 4JI8Q 1CM9A 4JI0Q 4GLVB 3CU7A 2ATWA 4BY7G 3JAMi 5ELOA 1K8OA 1PRTF 1N33Q 1ET6A 4BBSB 3P75A 4ZYSA 3M9BA 2B3GA 1DOMA 1SNCA 2OQKA 4JI4Q 3PIP3 4R8NA 4R4OA 4HN7A 2NZHA 2Q8IB 4NW2A 4LF8L 5IGGA 4A3CG 1CQFA 3BVMA 2UUBQ 2NVTB 1XX8A 1EIHA 4JV5L 3S2DB 2YTXA 4OO1I 4X65Q 4JI7Q 5E4XA 1TS5A 3NWSA 1AN8A 2HQEA 2YTYA 3J80c 3H15A 2NVXH 4H13C 5DAUA 1LTSD 4X66Q 5CV6A 1VQGA 1X9NA 1X65A 1E1TA 5JPNC 1WTRA 3RN5A 1NNXA 4A3FG 2LSSA 4A75A 2CCZA 5LL6X 2K03A 5BR8Q 1JB7A 1SN8A 2BDNA 3I4MH 3S1NB 3A5ZB 2IT1A 4N9PA 4RG1A 1VQ4A 1HFGA 2EE1A 1S4ZA 1IYVA 2R92B 2J0TD 4XDXA 3NWTA 2HIVA 1ICFB 4DV2Q 4FF1A 4AYBG 2XGTA 2B2VC 3M7NA 4DV7Q 2E2JB 1DOKA 1Q12A 4A3JH 4DR6L 3A55A 2IHEA 1I3QB 2JA9A 2NVYB 3HOUG 4ZKCB 4IO9A 1VQ7A 3OW7A 4A3EB 5IGFA 5IYDG 4A3MG 3MWYW 1QVGA 1Q82C 3GTMH 4L63B 3U4ZA 4JPBW 2AUJD 4O42A 4A3BH 2GVAA 1JOOA 4YIJA 1V8QA 3S15H 3CXCA 3A54A 4GKKL 2DUDA 5ELBA 5JAVA 1ZXTA 3PIPA 3S1MB 3QJYA 1Z47A 4NXML 4JOIC 1K9MC 5CV8A 3AB9A 4HTHA 1XNQL 3MEHA 1N36L 2LKVA 3FKIH 4NKLA 1NAPA 2Q8RE 1SYCA 4B3ML 1DONA 2XN9C 3C3LA 3OTOL 2MP1A 4PZ7A 4P72A 3KFUA 1I4HA 2J4XA 1GVPA 3LGJA 1BR9A 1YNJD 1TQOA 5IT9c 4UY8C 4BY1B 1HNXQ 1QJOA 2QDBA 4RHRA 4CJ0B 3D6WA 3NUCA 2O5IC 5IWAQ 5EPLA 4DFAA 3DWPA 2VZAA 3M3YH 1Q1BA 3NE5B 4P75A 1EL0A 2X6GA 1Q81C 1A8VA 1XNRQ 4IURA 1D5MC 1MGSA 2F0NA 5JJLA 4XXEA 1YI2A 5M5YH 5CBAE 3PF5A 3I7FA 2F0UA 2RKSA 1I5FA 1K8MA 3TZUA 1ZYRC 3MXUA 4C3JG 1RTOA 4WJ4A 2E5LL 1LTRD 2M9VA 4KY7A 1SFOH 3R2TA 4OIJA 2DNCA 1EY8A 4IPHA 2O4XA 3G4SA 1NMGA 5JOBA 1PLFA 2B2VA 4I65A 2WAQG 1LTID 1U9RA 3CQZH 4NPSA 4F88A 1QE6A 1H95A 2Q2UA 4X3SA 2UUCL 3A8JE 5EAYA 4QUCA 2EY2A 4ME5A 1ESFA 5CV5A 4Q5VA 5IP7G 1VDZA 4ME3A 3KDFB 3FPUB 3A7LA 3NQTA 4RKBA 4V190 5IGEA 1NBWA 2B2UC 2KCMA 4A3LG 4MZ9A 2EY5A 3IRBA 2VS1A 3HOWG 4QIWE 2AUKA 2BH8A 1G91A 4JOIA 3TRZA 4QIWB 2ZJRA 3DEPA 2UXCQ 1NSNS 4FF4A 4MTKA 1TWCH 2F0HA 4IN3A 3PUWA 4DR7Q 4WORA 2EDGA 5AJ3L 3Q0AA 4X3TA 2EJGC 1SMYD 4LFCQ 1AE2A 3J7AV 1C9OA 2MO1A 4DR2Q 4KKUA 4JYAL 1NCVA 1B9NA 2BE5D 1A0IA 3CCQA 3MTSA 3GTOB 4B3TQ 4XQJA 3H09A 3NPPA 4JC0A 4JI6L 1TWFH 3BVZA 1L1OC 5COYA 1HZCA 1TWAB 1H9KA 3HOYH 1XJVA 1PH7A 4A3KB 2R93H 1XYIA 1BBWA 2ALYB 3FPPA 1XTDA 2RSOA 1IBML 5EKKA 3Q8DA 1TU2B 3N6RA 1SNPA 1XTCD 2GA4B 3DWAA 3X3MA 4LFBQ 1IBKL 4C1NK 4DV1Q 1EIGA 1K3BC 1HZ9A 1KDAA 3AYHB 2UXBQ 3CCJA 4J1MA 2R7DA 1EEFD 2R7ZG 1MJEA 2ZM6L 2VUMG 3AQQA 1YNXA 5GROA 2B63B 4NP5A 4LK1C 5EKIA 3UE1A 2IJ0A 3T53B 2PZUA 3KF6A 1VQ8A 1EFWA 5CV7A 3SDZA 3S1RH 2E76C 1T5EA 2KHSA 3RNUA 1MBYA 1VF7A 5CGKA 3EROA 2F0MA 1MI2A 4KHPQ 3KUPA 5BN3A 4C1NI 2OQ0A 2F3VA 2XTIA 3IKJA 2L9HA 4HIKA 4RKLA 2H4OA 4LUOA 4IUPA 1GUSA 1QG7A 4FNFA 2K32A 4X62Q 4FXDA 2ZXOA 3V05A 3G71A 5FK9C 5EKLA 3VR5A 2LXJA 4DN4M 1DXMA 3GTQH 4Q0FA 2BOSA 4AQYL 3GTGH 3GTMB 3E6ZX 3STBD 4RFBA 1YNJC 1X3GA 4A3BB 5ELCA 3T51B 5FLMG 1Y1VB 3S15B 1HH2P 2VQFQ 1M8AA 1PA6A 3VYTA 3D31A 3NSWA 5EBDA 4DUYQ 4LFAL 1JWUD 4KJNA 1WTWA 4LF4Q 2CH4A 2IX0A 1KNEA 1AP0A 2JA8B 4DU9A 1EQRA 4XQNA 4Y52H 3EQLC 1ET9A 4RA8A 1PFMA 3CCMA 2JA6B 3DEOA 1V1PA 5LL6S 4DGZA 1GKHA 3K7AH 1ENFA 1G6ZA 4C3HB 3BZCA 4ID6A 1D1KA 1D7QA 3RUZA 3F2CA 2A8VA 3AEVA 4CHTB 4BXXH 1GXDC 1J5EQ 4X3KA 1VQBA 2D0PA 3HOZH 1R4PB 4HJAA 5IGDA 3QG1A 1G2SA 1FYCA 4UP9A 1TS3A 3FDTA 3S14H 5C3EG 2PNHA 4IFDJ 2PQAB 1H9MA 3E5SA 4A93G 1HNWQ 1PTOH 3G6EA 3GTKH 3HKZG 3I8ZA 2NVQH 5JJKA 1BDOA 3TP6A 1CA5A 1SFOB 5KEEA 2WAQE 1CK1A 3A56A 1GUWA 1OXUA 3Q24A 1IBLQ 3PO3H 1IZ6A 3K0YA 1VCIA 4DNTB 1X3EA 4O2DA 4CKEA 2A1AA 1EY5A 3HZXA 4QUFA 5IE8A 4G7ZC 4IFDH 1YIJA 4BBSG 5JEAG 2EYMA 2EY1A 4RAUC 1H9SA 5M3FH 3OOCA 3FRPB 1D2BA 5I4DA 1DGSA 1F2LA 1STBA 4P71A 1I4XA 1EQTA 4A3GH 2DJFC 2A6HD 2WKCA 3RZOB 1I4PA 2QDLA 3GV6A 4DAYB 1PTOF 1I4QA 2PW7A 1SMYC 2KEDA 1GUGA 1CHQD 3PUZA 2B8GA 4NXNQ 1QCBD 2A73B 4QY7A 4LJZC 5ELDA 2JA5B 1NTGA 2JSOA 2F0GA 1B3QA 4JI2L 1EZ6A 4I7ZC 5A2QE 4ALPA 1IKMA 3SHLA 4U673 1EY6A 2F3IA 2KOLA 2CHBD 1C48A 1TWCB 4C2MB 4AIMA 4YCWA 2QEJC 4X3UA 4X6AH 1W6KA 3BDLA 1WTXA 1JWSD 3S2HH 2NN6G 4JI1Q 3L2PA 1PVOA 1S5CD 4R4QA 1FJGQ 3K5NA 5E4WC 1X3QA 4LF5Q 4DUZQ 3T1HQ 4KLKA 1D1IA 2EYJA 4XIGS 2R92G 4JI5L 4QCLA 1AEXA 1B4OA 2GVBA 2RF4A 5C44H 4R4IA 3NP8A 4F8MA 2K33A 4K14A 1V1QA 4DR4L 3RLNA 4IOCA 2NWGA 1I6HB 1V43A 2KCTA 3I4NH 4FXKC 4GNXC 4KKSA 2NN6I 4A3EG 5I9PA 1B7YB 4IPDA 1STNA 1EU3A 2B2WC 3T4AC 3DXJC 2MHVA 4KY6A 1LM0A 4R9WA 2JK8A 1RHPA 1RJTA 1K28A 2FJ2A 3W2DA 5LMNW 4HIOA 4MN3A 2KUMA 1PFBA 3ITPA 1I94Q 3I4LA 4JV5Q 2WP8J 3D0FA 3BJUA 3DM1A 2ZTEA 1PH1A 1ILQA 2K05A 1WD0A 1HCZA 1LO5D 3MXNA 4R4TA 3T13A 4EGVA 4CBVA 4UDUC 2HHHL 1EYCA 5IYBH 4BY1G 4BBRB 1W2BA 3VR6A 2RDFA 1SLJA 2DGYA 3GO5A 4JI3L 1RF2D 3ZYYX 3M85A 3S16H 1EIYB 2E2HH 4E6IA 4IUQA 1VQAA 1E1OA 1EEID 3WOFA 2F03A 2Q2TA 3FHWA 4QB4A 4HJ5A 2DJGC 2WINB 1KABA 2I5LX 3G48A 1MSGA 1IW7D 1DOLA 1Q3LA 3PUXA 4DR6Q 3JC66 1KRSA 3S17H 5FJ8H 3UDXA 1HR0L 3DHQA 1OXVA 3K7AB 1I50B 4K0KQ 3J7AF 1XMOL 2L4NA 3J7A5 1ENAA 2QEXA 1B70B 5A35A 1B9MA 5IYCG 2K5DA 1KC8C 4NXMQ 1C0AA 1FL0A 2IX3A 1S5FD 1GUNA 3BDCA 1N36Q 4GNXA 4EQNA 2JA7H 2KECA 3FVQA 1XPRA 4A3DG 1F9RA 3HKZE 1EY0A 1JOQA 1JMCA 1U4RA 4BS9A 3GDEA 1MSHA 1WVLA 1PTOB 1GHKA 3IL8A 2NUCA 3I55A 4G7OC 2A6HC 1CZWA 4M8AA 2R61A 3VR4A 3HFZB 2F0PA 1HJPA 3K81C 4FF3A 2LXKA 3I90A 3CC4A 4OO1G 1VS0A 5IOCA 5KNDA 4DV6L 3H0GH 3PO3B 3KF8A 5NUCA 2OT2A 1JE4A 4GOPB 4RH6A 1N8RC 3HGBA 1BBUA 1BNZA 2IWHA 1O7LA 4C3IB 4PMCA 2K5WA 3DWQA 2QGQA 1PH5A 5EJWA 1BKBA 4JK1C 4LW1A 4A3GB 1VMCA 3HOVB 1MD2D 5LMUQ 1WTOA 4H02A 1SNDA 2E5LQ 1JR0D 2JJQA 3DM3A 2WB1E 1ICWA 5C0XI 4CGYB 4OEMB 1VQCA 2K4KA 4P2CB 4A3KG 4PZ6A 2WB1B 3W1BA 2FFKB 2ZXRA 1AE3A 1B3AA 3K6OA 3T56B 4CDFC 1I4GA 3MHBA 1FNVA 1FGUA 1KLUD 1N34L 4DV3Q 1Y8PB 1M90C 1BCPB 2F4VL 2UUCQ 4UHVA 1KNAA 2VXWA 2ASBA 5C5MA 2B63G 1PFNA 3T1YL 1FGBD 3S2HB 1SJED 2RDHA 5KYLA 1BBXC 1VQEA 2F3WA 3KLSA 3GTPH 1LTBD 4A3FH 4QF4A 5JVG3 1PH3A 4PMWA 3RD4A 2EYLA 1XMQQ 5FLXL 2F0DA 3K5LA 1U0LA 5C44B 1JJCB 1CZGA 3FP9A 2V4DA 1E7ZA 4IUNA 1DCZA 1PH4A 1PYWD 3EFXD 1BQQT 2UUAQ 1STEA 4N8X1 4RGOS 3OW2A 4LF6L 4L5TA 4POGA 1VQ5A 3KK7A 2IX1A 1Z9FA 3TN2A 2AQ3B 1E0BA 4L8JA 1C7YA 2L5TA 3HOUH 4B08A 4DV0Q 4RCOA 2CVRA 4A3BG 4DK6C 1YJWA 2KBNA 1Y1VG 4JBKA 5FOBB 1PH9A 1QUQA 1EUJA 3E3XA 1AFPA 1N32Q 4JI6Q 3HG9A 2PQEA 3LNNA 1EYAA 1LTGD 2WV6D 1TT2A 2JA8G 3NELA 3RR5A 4TVAB 1IBMQ 1STGA 1GD7A 4HR7B 4RGTA 4XQQA 3CPWA 1F9QA 2JA6G 2PNRC 2X6LA 5LHY1 3EVQA 1JOKA 3GTLH 3K58A 4C3HG 1AH9A 2NYZD 2H5XA 4YHHL 1HNZL 1IW7C 1S3OA 1I4RA 1OXXK 1L0WA 1FNUA 4KN4C 1CKNB 3KBXA 2FINB 4G57A 2PI2E 3K59A 5E7NA 3S16B 2E2HB 2RVLA 1LT4D 1TS2A 4X64Q 2M2LA 1UEBA 3SE0A 2XWJB 4OHJA 1KXLA 4JI8L 5CYUA 1OO9B 3DMUA 4R8IA 4A3IH 4JI0L 2R7FA 3I2ZA 5IODA 4GN5A 4LF7L 1N33L 4IJLA 3W1GA 3SVMA 4DK1A 4OWTB 3ZJYC 2OCEA 3GTJH 3PO2B 2G9HD 3S17B 3JAML 4JI4L 3S1QH 1UUPA 3D8GA 1YZ6A 1Q46A 4C3JH 3L7ZC 4AQYQ 2K6AA 5IIFA 2HDMA 1HQRD 1O78A 4ZUJA 1WTPA 1GUOA 2UUBL 3OSOA 2MUYA 1PRTB 5I9OA 2XIWA 2VW9A 1EU4A 1LACA 3ND8A 1QZHA 3CRLC 4LFAQ 2N78A 1SYDA 3KLSX 4X65L 2EY6A 4JI7L 4A3DB 3GV3A 4B9XA 3J81c 3W3AA 3PSIA 1YHAA 3NXWA 2EYFA 1TWHH 2Q2HA 5J3BA 2F0JA 3V2TA 2MO0A 1S72A 1D8LA 4J6HA 1O80A 3I91A 2JA5G 1HPCA 5IP7H 1JWMD 2JE6I 2L55A 2BDOA 5FO7B 4CJ2C 3F2DA 1BO0A 2IL8A 2K1BA 4A3LH 4UP7A 3KJOA 4K6DA 3J80E 1G2TA 1H9RA 2Q8TA 3HOWH 4DAMA 3H0GB 1WD1A 4DV2L 5CC4A 2VQEL 5C4XH 3B6YA 4DV7L 2EYPA 2CW0D 1F2MA 2JN4A 4B9WA 4CKCA 3O13A 2K5NA 2A5HA 1M4VA 1S5BD 4XYOA 5H1SE 3HOXH 3MZ5A 4LF9Q 4U68A 5FLXc 4DV4Q 5ELNA 4DXFA 2A74C 2E2IH 1K0SA 4OWWB 1B44D 2SEBD 2WKDA 3EIVA 4HMIA 2EIFA 2NVXB 3ERQA 3PV0A 4CDEC 1YHQA 1FNWA 3NTKA 5K36G 2F4IA 1SNOA 1VQFA 4IPCA 3C2PA 1ASZA 1TWGH 1WI5A 1SDFA 2QW7A 1SSOA 1Q90A 3I4MB 4FVMA 2JXMB 4IZ8A 4MNOA 3SK8A 3OIPA 1V9PA 1HNXL 2VUMH 1LV9A 3QWNA 2SDFA 3L9AX 3LX0A 3K7UC 2L15A 4K5WA 3BYYB 1EQQA 5IWAL 1VQ6A 5TSSA 1PHJA 3OWFA 2PMZB 4A3JB 3PUYA 4HEDA 2N8NA 1O7IA 3HKSA 1XNRL 1J9OA 1SE3A 3E9IA 4BBRG 2B2UA 5IT9E 2HD3A 1CTMA 3BG3A 2KCNA 3QB3A 2D2CC 1P8LA 3M4YA 3K8AA 3TBIB 3RLFA 3BU2A 5C3WA 3NHHA 5M5XH 2N88A 5IP9H 4G4KA 2H1EA 3C46A 1STAA 2J7ZA 1E2ZA 4IUUA 4RWSC 1KAAA 5EGTA 4HSPA 4JCVE 2B29A 3TSSA 5LMNQ 3RZDH 3J80i 1EFID 4OGQC 4PQXA 3FKIB 4J15A 4ABNA 5KNBA 5FLMH 3M7GA 1RD9D 4K6LA 4DR4Q 2JQOA 3SK5A 3TZDA 1ASYA 3VDYA 2UXDQ 3UDIA 1L2FA 2OF1A 5KGUA 1C8CA 3JAMc 3MXPA 1PMRA 4I7AA 1L1OA 3H3VI 2K52A 1U4PA 2A69D 1YVCA 4HSVA 4ZCKA 4PMBA 2Z4HA 1X6OA 2EYOA 2MJ8A 1XPOA 1TR5A 1ML0D 3M3YB 1Y8OB 1KD1C 4B3SQ 3F1ZA 1HZBA 1TS4A 1SYEA 4DR5L 1WTQA 3UDGA 3EN2A 1YNND 1EYDA 1OXTA 3G7LA 1VQNA 1FVIA 2EXZA 2UXCL 5M5YB 2PZWA 5CV9A 3ULLA 4DR7L 4A3IB 4ILWA 1LT3D 1W6JA 2HHHQ 3F2UA 4HJ7A 4KV6A 1QOHA 4H0LC 2F0WA 2SNSA 4LFCL 4C56C 1TVXA 3DUZA 1MKHA 1ESRA 2ZJQA 2VB3X 4DR2L 5JEAJ 2LMCB 4RGMA 3S1QB 4ZQ3A 3K5OA 4B3TL 1PH2A 1SMXA 5GAEC 2ZTDA 1LABA 4HIDA 3PO3G 4DR3Q 4YY3Q 1E2VA 4XT1B 1TIID 1TKWB 3CQZB 1S40A 1WCMH 1PH6A 4IPGA 4GS3A 4C3IG 4GN4B 2A68D 4HCEA 1JT8A 2BA0A 2PYKA 3BS1A 4LUZA 3SK6A 1GO3E 2B2YC 4GKJL 4A3GG 3HOVG 4BBSH 5JPMC 1RCVD 5JEAH 2UXBL 2NZ1D 1TWHB 3PQIA 4P74A 3IFTA 2BE5C 3VR2A 5HGQA 1TY0A 2WB1G 1EOVA 2QKIC 3MVVA 5CV4A 1XMOQ 5J22A 4A4IA 2NVTH 5M3MH 2N49A 1Y1WH 2XSCA 3EJIA 1KRTA 3QR8A 4J8QA 3PIO3 2CFMA 2DN8A 4DNRB 5C4XB 4K2KA 2KJXA 4TSSA 5HY6A 4IOAA 3TS0A 4DR1L 1RTNA 2E75C 3ER0A 3TMEA 1YEZA 4ULLA 4X62L 5DM63 3KOJA 2FMMA 3R93A 4OELB 3HOXB 2ICIA 4KTAA 1TWFB 3QOLA 1V1OA 1P16A 2ES2A 3HOYB 2GN5A 5M5WH 3TP7A 2E8GA 1SYFA 2R93B 5C44G 1GUTA 2SOBA 2OTLA 1HZAA 3RLOA 3OIQA 5DM73 2R92H 3SEBA 2VQFL 4DV6Q 2NTTA 4DUYL 5C4JH 4OX9L 1NR4A 3PCOB 1QILA 3S9WA 1IYJB 1VQJA 2E2JH 1KDBA 1ZKOA 4IJHA 4LF4L 1JJGA 2QILA 2KHIA 5GADC 2AMCB 4KK7A 1B53A 5FKAC 2C5CA 3OWEB 1I3QH 3CC7A 3KF6B 4YWMA 1IHZA 1QWYA 1Y8NB 2NVYH 4N8FA 4LF8Q 2TMPA 3RN2A 4CDCC 5GAGC 2PPBC 1PDQA 4ZK9B 3S1RB 2AKWB 1HUNA 5C4ZA 3PMFA 1EIFA 3KJPA 4WRDA 3STBC 1YBYA 3DLLA 1STHA 1R9TH 4KY5A 3G6JB 3L3OC 1J5EL 2IW3A 2IPKD 1X56A 1NE3A 1GOZA 2XWBB 2B2YA 2EXDA 1SXTA 2K01A 3J7ZC 4PV1C 2OXPA 3T16A 3URYA 5IYBG 3A74A 4N9TA 2XNAC 4FDBA 4HJ8A 4H7BA 3FEWX 1GM5A 3GTQB 1HNWL 1II3A 4NMZA 3GTGB 1KQSA 5JJZA 3PIOA 1LLRD 1LUZA 1RIPA 5C6AA 4DV5L 3K0XA 5EBCA 2K28A 2VL6A 2DNEA 1F9PA 1QB5D 2ZXPA 3M4PA 1JJ2A 1HTLD 1X55A 2A69C 1MIUA 2PW5A 4L5SA 2D5DA 3RMHA 1IBLL 3RZDB 1EWHA 1JCKB 2L11A 2Z9HA 2RHQB 4FYDA 1HTPA 2R3ZA 3CP0A 4DA2A 1V1PB 2RSNA 2R6GA 1Q1EA 1YNNC 2PI2A 3PO2G 1HFNA 3LWUA 3ND9A 4KJOA 4F7XA 4LF6Q 1L1OB 1DM0B 5CORA 1UEAB 2ID0A 4DAVA 4UAIA 5FO9B 1EY9A 3BDOA 4GKKQ 1SNMA 4NXNL 2F0TA 3HOZB 2DY8A 2OTJA 3AFQA 1STYA 2A6ED 1XNQQ 2UU9L 2HCCA 3K57A 1U4LA 2AWOA 4UP8A 4B3MQ 3S14B 3OTOQ 3ULPA 2XRSD 5T1IA 2B2WA 2Q2IA 2HUGA 3MFGA 2NBFA 1HR0W 3P20A 3GTKB 2NVQB 3X3NA 2FXQA 3VA7A 4DAPA 2YYZA 2C35B 4JI1L 3Q23A 5D3DA 3U9OA 1HNZQ 4DNIA 5C0XG 4ZLTF 1FJGL 1JC7A 3KDFA 3NBHA 4DK0A 1D5XC 4APVA 4LF5L 1NMFA 3CC2A 1LTTD 1Z6HA 2F52A 1EY7A 3H0GG 1KDCA 2Z6KC 1H9SB 1LTLA 2JYOA 3GQBA 5M3FB 1G8ZD 1B1ZA 1UAPA 5D65A 1WCMB 1A3VA 1SBBB 2F0SA 4BY7H 4OO1H 1JB3A 5IGBA 3J81L 4ZAIA 1EWCA 2MQHA 1K3RA 1X32A 4ODGA 3TEHB 1UNSA 2FMCA 1EYGA 3OPOA 5HGTA 4LWCA 4LF7Q 3CRKC 5KYIA 4PZ8A 2YU9H 1J8IA 2G9DA 1Q7YC 5JJIA 3GTOH 2AHOB 4KMUC 2XVSA 4A3CH 5G3LD 1K0RA 3NBIA 2HT1A 2V1CC 5F2DA 2ICEC 1WOCA 2PCFB 2RA4A 4FXGC 1F9SA 1TWAH 1D6EC 5M3MB 1I94L 1D5ZC 4A3KH 4WFN3 1Y1WB 2K7VA 2X69A 1CKOA 4XTCS 1VF5C 1Q8IA 2B2TC 2F0VA 1Q8KA 3I4MG 4GN3B 2F0QA 1RODA 2L1BA 1F77A 3D3RA 1Y69U 3I4OA 1HHVA 2OEOA 1SROA 4K2LA 1YJNA 2BH2A 1OXSC 1NJIC 2B63H 1DYQA 5DLQE 4Y7NH 5M5WB 1PXUA 4A3JG 4MHEA 2NTSA 5AJ3Q 1AZPA 4Z9CB 3I4NB 3MXGA 3N52A 5C4JB 2B39A 2CKZB 2P5ZX 1PZID 3CCVA 5A2QL 2VQEQ 5E3FA 4BA1I 4JYAQ 3R3OA 1AZQA 2K50A 1YJ9A 5IYDH 4A3MH 1PTOD 3NQIA 4AH6A 1CUKA 4MTNA 1EY4A 2F0EA 3K80C 1C4QA 4R4CA 3CW2C 4KHZA 3FKIG 3WOEA 2VB2X 2Z6KA 3KLRA 3MXNB 4K0KL 4F87A 4TKOB 1R9TB 4IQZA 1PZJD 2RHSB 1Y1VH 2QCPX 2F1MA 4TRDA 2ENBA 4QGUA 3I72A 1IBKQ 4EQ5A 1A2UA 3QOJA 1SRUA 2ZM6Q 3W5OA 2JA8H 4B3RL 3R2IA 1J6QA 1N9WA 2EJMA 3ONAB 3U58A 1E2WA 1NUCA 3CD6A 2F0KA 2XRQD 2JA6H 1K83H 1KIXA 2EZVA 5C5LA 4C3HH 1S5ED 1KTKA 2Y0SG 5FO8B 5GQOA 1XPUA 1UE5A 2CWPA 1BXTA 1RDPD 3VA5A 3AMUA 3HRZC 3HEJA 4KD4A 3CCEA 5HURA 5D3IB 1RKNA 4A3IG 2A6EC 2B2TA 3SR1A 2KQ3A 1BCPD 1SJHD 5DEHA 2NZOA 1BF4A 2SNMA 3A0JA 1KLGD 4RGNA 3A5UA 1B50A 4LMQD 3WDNA 1NY4A 4GZYC 2PQAA 5C3XA 5CBEE 4WJ3M 3OYYA 1LT6D 5LMUL 3OHXC 4OONA 3BZDB 1A62A 4OL7A 1FD7D 2Z4IA 3E0EA 4GNXB 1O7ZA 5C4HA 5I2YA 2E2DC 4JBWA 2JA7B 4YCVA 3SK4A 4X66L 1WYDA 5CMDA 4DV3L 2WACA 4NB3A 5BR8L 1VQDA 4BWGB 1EQVA 4EVOA 5JVH3 3RZOH 1SE4A 1Q86C 2I46A 3J81j 4DAYA 5J1ZA 3HS0C 3NBHB 3KF8B 1UE6A 3CCLA 2JA5H 1PYBA 2CH4W 3KYHC 1ONLA 3L0OA 3NK9A 3PUVA 3IFDA 1R4QB 2WIIB 4ZKBB 2LS01 1XMQL 1I6VC 1PYSB 2F0LA 4DR5Q 4HCSA 2LY7A 3BYTB 2KVMA 3H3VC 5C4XG 1YHBA 2RBMA 4BY7B 3MEFA 1H9JA 3PGZA 4C2MH 1QVFA 2UUAL 1DD2A 2EOTA 5DNFA 2QA4A 3BVGA 4GLAC 1B2TA 3EA6A 3HOXG 3WWVA 3HOYG 1ENCA 1T9HA 4DPGA 2YU9B 2R93G 1QVCA 3A7AB 4DV0L 1JICA 1KL9A 5I6WA 3HP3A 3ULJA 3KLWA 2AWNA 3V96A 3F8TA 3F2BA 1N32L 4OIKA 3TDQA 1WFQA 3OMGA 1A6XA 5EQ0A 2ZT9C 5EPKA 4XT3B 2YV5A 1I6HH 5K36H 4UPAA 3AFPA 4GKJQ 1IL8A 1L0XB 2R7ZH 4A76A 4KN7C 3IAYA 4DK3C 1QNKA 3GTPB 2CWAA 2RCFA
chains in the Genus database with same CATH topology
1FL0A 1GVPA 1XMOQ 1PH8A 3LGJA 1VQHA 4A4IA 1N36Q 4GNXA 1OTCA 2NVTH 4YCUA 2JA7H 5M3MH 4A3DG 5IT9c 1XPRA 4JI2Q 2PMZE 2N49A 1VQOA 4UY8C 1Y1WH 1HNXQ 3HKZE 1KRTA 1JMCA 3GDEA 2CFMA 4OXPA 4AYBE 3ERSX 3U4VA 1X3FA 5HY6A 4X64L 4IOAA 5IWAQ 3TS0A 4DR1L 3I55A 1VQPA 4O0AA 2VZAA 3ER0A 3M3YH 3HFZB 1Q1BA 1YEZA 4X62L 1HJPA 4P75A 3K81C 1Q81C 3KOJA 2LXKA 4L5RC 1A8VA 1XNRQ 1W3SA 3TS2A 4OO1G 3CC4A 5JJLA 1VS0A 4DV6L 4DR1Q 3H0GH 4GOPC 5M5YH 1YI2A 1P16A 2ES2A 1JE5A 3PF5A 2GN5A 4BBRH 5M5WH 3I7FA 2E8GA 5IP9G 1QUQB 5C44G 4GOPB 1I5FA 1N8RC 2OTLA 1K8AC 1HZAA 4JI5Q 1BBUA 3RLOA 4WJ4A 2E5LL 2R92H 2VQFL 4DV6Q 1E24A 1SFOH 1PH5A 2QGQA 2KENA 5C4JH 4DUYL 1BKBA 2RCNA 4OX9L 3PCOB 1PV4A 4LW1A 1IYJB 3H3VH 1VQJA 2ZJPA 4PG3A 2E2JH 2N3SA 5LMUQ 4IPHA 4H02A 4IJHA 3G4SA 1SR3A 4LF4L 1JJGA 1NMGA 2KHIA 5GADC 2E5LQ 2AMCB 3CCUA 2JJQA 1I3QH 3CC7A 3KF6B 3DM3A 2WB1E 4YWMA 4EX5A 2NVYH 2WAQG 4JG2A 5C0XI 4LF8Q 4OX9Q 3BZKA 3RN2A 5GAGC 1VQCA 2K4KA 4A3KG 4PZ6A 3W1BA 4RMFA 1AE3A 2AKWB 3CQZH 4NPSA 1H95A 2Q2UA 1EIFA 2UUCL 3KJPA 5EAYA 3STBC 1FGUA 1YBYA 4DKAC 3DLLA 2Y0SE 1N34L 4BXXG 1CSPA 4LUVA 1R9TH 5IP7G 4DV3Q 3HOZG 1E3PA 1M90C 4ME3A 3KDFB 1J5EL 1I50H 1C0AA 2F4VL 1NBWA 2UUCQ 2KCMA 4A3LG 1X56A 4MZ9A 1NE3A 2ASBA 3IRBA 2VS1A 2EXDA 2K5HA 3J7ZC 3T1YL 2B63G 3HOWG 4QIWE 2BH8A 3E9HA 2VNUD 5IYBG 3A74A 4JOIA 3TRZA 4FDBA 4HJ8A 2ZJRA 2HHHL 3GTPH 1VQEA 4YWLA 2UXCQ 5GAHC 1GM5A 4A3FH 1HNWL 5C3EH 1TWCH 1KQSA 3PIOA 3PUWA 1PH3A 4PMWA 4DR7Q 1LUZA 1RIPA 5IY0A 1MJCA 4A93H 1XMQQ 4DV5L 3K0XA 5AJ3L 1U0LA 2VL6A 3CCRA 1JJCB 4JI3Q 3M4OH 3FP9A 4QL5A 4LFCQ 3M4PA 1KHIA 2CQOA 1AE2A 1X55A 1E7ZA 1JJ2A 1C9OA 1MIUA 1PH4A 2MNAA 2UUAQ 2MO1A 4L5SA 1IBLL 4DR2Q 4JYAL 2K75A 1A0IA 3CCQA 4DV5Q 4LF9L 3OW2A 4LF6L 1KAWA 4L5TA 2RHQB 4B3TQ 2YTVA 4DV4L 4IFDG 4POGA 1RL2A 1VQ5A 3CP0A 5M3FG 2IX1A 1Z9FA 4JC0A 1WCMG 4JI6L 1TWFH 1Q1EA 2R6GA 4LFBL 1L1OC 2BA1A 1C7YA 2PI2A 3HOUH 3PO2G 4DV1L 1HZCA 4DV0Q 3HOYH 4LF6Q 4DK6C 1XJVA 4A3BG 1PH7A 1YJWA 2R93H 1BBWA 2ALYB 2KBNA 1Y1VG 4JBKA 1L1OB 1XTDA 1PH9A 1IBML 1QUQA 1EUJA 3Q8DA 2ID0A 1HR0Q 4GOPA 3EBEA 1N32Q 4JI6Q 1YITA 4LFBQ 4C3IH 4GKKQ 1IBKL 4DV1Q 4NXNL 4P73A 1HZ9A 3AYHB 4L5QA 3CMAA 2OTJA 2UXBQ 2I5HA 3CCJA 1Y14B 2R7DA 3HOVH 2JA8G 3AFQA 3NELA 3RR5A 4POFA 4TVAB 1IBMQ 2UU9L 1MJEA 1XNQQ 2R7ZG 4IFDI 2ZM6L 1GD7A 2VUMG 2AWOA 3AQQA 2JEAI 1G291 4UP8A 3S2DH 3CPWA 4B3MQ 1YNXA 3CPFA 2JA6G 5GROA 2HIXA 3S24A 3OTOQ 3ULPA 3UE1A 5M3MG 3KF6A 2Q2IA 1VQ8A 3CCSA 1CKMA 3GTLH 1EFWA 4KHPL 1Y1WG 1CSQA 2UU9Q 3S1RH 1AH9A 2H5XA 4YHHL 1HNZL 1S3OA 4JBJA 1HR0W 3RNUA 1OXXK 1L0WA 1SE8A 2JEBI 2FXQA 1CKNB 2PI2E 2D0OA 4KHPQ 1EWIA 2YYZA 2C35B 5E7NA 4JI1L 2OQ0A 1HNZQ 4X64Q 3SGIA 4DNIA 5C0XG 2XTIA 1FJGL 3KDFA 3ICEA 1UEBA 4APVA 4HIKA 1NMFA 4LF5L 3S1NH 3CC2A 2F52A 4LUOA 1UWVA 4JI8L 4X62Q 4JBMA 3PF4A 1KXLA 3H0GG 2Z6KC 1QZGA 4A3IH 2I5MX 4JI0L 1IXRA 2R7FA 1LTLA 3I2ZA 3G71A 4GN5A 2LXJA 4LF7L 1N33L 3GTQH 4IJLA 3W1GA 4BY7H 4OWTB 4AQYL 3GTGH 3ZJYC 3STBD 2OCEA 5LMNL 1TXYA 3GTJH 3I4NG 1X3GA 3J81i 1LYLA 2MQHA 1K3RA 5FLMG 4JI4L 3TEHB 3S1QH 1EYGA 1HH2P 4LWCA 2VQFQ 1YZ6A 4LF7Q 1Q46A 4C3JH 3L7ZC 1K73C 1PA6A 3D31A 4LFAL 4DUYQ 4AQYQ 4PZ8A 3GD7A 2A19A 1B8AA 2OWOA 4A3EH 2YU9H 1Q7YC 2UUBL 2UXDL 5JJIA 4LF4Q 3GTOH 2AHOB 2IX0A 4A3CH 4R1JA 1K0RA 2VW9A 2HT1A 1QZHA 2IY5B 1EQRA 2V1CC 2N78A 4LFAQ 4Y52H 2EQSA 4X65L 4JI7L 3CCMA 1WOCA 3J81c 1VQKA 1GKHA 3K7AH 1TWAH 1I94L 3S1MH 2K14A 3PSIA 4A3KH 4TQUS 1YHAA 3NEMA 1TWHH 3BZCA 4HIMA 1D7QA 2Q2HA 2D62A 5J3BA 3F2CA 1N34Q 2A8VA 2VY3A 1CKOA 2MO0A 1D8LA 4XTCS 1S72A 4B3SL 3AEVA 1A63A 2ZTCA 3CF5A 2HQLA 2MFIA 1Q8KA 2JA5G 4LNQA 4BXXH 2WFWA 1J5EQ 3I4MG 4GN3B 1VQBA 2D0PA 5IP7H 3HOZH 2JE6I 2F4VQ 4HJAA 2Z0SA 3I4OA 1K8GA 4KI0A 4HJ9A 3F2DA 1SROA 2K5VA 3T1YQ 4A3LH 4QQBX 4UP9A 4UP7A 3KJOA 1YJNA 4BY1H 2BH2A 1OXSC 1NJIC 2B63H 3HOWH 3S14H 5C3EG 2PNHA 4QJFA 3UE0A 4IFDJ 4DAMA 2PQAB 1VQLA 1X54A 5DLQE 4A93G 4Y7NH 4DV2L 1HNWQ 1G51A 2VQEL 1WJJA 5C4XH 3G6EA 3B6YA 4DV7L 4A3JG 2IHFA 1PFSA 5AJ3Q 3GTKH 3HKZG 2NVQH 2K5NA 5JJKA 1VQIA 4DR3L 4YY3L 1CKNA 2CKZB 2WAQE 1U5KA 5H1SE 3CCVA 3HOXH 2VQEQ 4BA1I 1OXUA 1IBLQ 3PO3H 4JYAQ 1IZ6A 1VCIA 1X3EA 4O2DA 4LF9Q 2A1AA 2K50A 5FJ8G 5FLXc 4DV4Q 1YJ9A 5IYDH 5ELNA 4A3MH 2E2IH 1E22A 3TQYA 5IE8A 1YIJA 4AH6A 4OWWB 4BBSG 1CUKA 4MTNA 5JEAG 3EIVA 5M3FH 2EIFA 1DGSA 3PV0A 4P71A 1YHQA 3K80C 4R4CA 3CW2C 4KHZA 3FKIG 4K0KL 2Z6KA 4A3GH 3MXNB 5K36G 3PO2H 3I56A 1VQFA 2KHJA 4IPCA 4DAYB 2RHSB 1Y1VH 4QGUA 1ASZA 1TWGH 1WI5A 3PUZA 1IBKQ 4NXNQ 4EQ5A 4QY7A 2JA7G 3CAMA 1VQMA 1M1KC 1NTGA 5IYCH 4MNOA 1SRUA 2ZM6Q 3W5OA 1V9PA 4JI2L 2JA8H 4B3RL 1J6QA 1N9WA 3NENA 5C0XJ 4ALPA 1HNXL 4OWXB 1UE1A 3U58A 2VUMH 3CD6A 4A3DH 4BA2I 1BVSA 2F3IA 2JA6H 3TREA 1K83H 3K7UC 1IL2A 2L15A 4GLXA 4AIMA 4YCWA 4YHHQ 1EQQA 3M4QA 1KIXA 5IWAL 4X6AH 1VQ6A 4B3RQ 2I0QA 4C3HH 4YWKA 1PHJA 2Y0SG 1UE7A 4DUZL 5GQOA 3T1HL 3PUYA 1UE5A 3CMEA 1XPUA 2N8NA 1G6PA 3S2HH 2NN6G 2CWPA 4JI1Q 3U50C 1O7IA 3HKSA 1XNRL 3L2PA 1PVOA 3E9IA 4BBRG 3UDFA 4R4QA 1FJGQ 3CCEA 4A3IG 4LF5Q 1VQ9A 4DUZQ 1P8LA 4KLKA 3T1HQ 3K8AA 4JI8Q 4XIGS 3RLFA 2R92G 4JI5L 3BU2A 4JI0Q 4GLVB 5M5XH 5IP9H 2NZOA 2ATWA 4BY7G 3JAMi 5ELOA 3A0JA 2GVBA 2RF4A 5C44H 3A5UA 4R4IA 1N33Q 1NY4A 3M9BA 4JCVE 2PQAA 2B3GA 3KFUA 2B29A 1V1QA 4DR4L 3RLNA 3OYYA 5LMNQ 4IOCA 4WJ3M 3RZDH 1V43A 5LMUL 2KCTA 3J80i 4OONA 2OQKA 4J15A 4JI4Q 3I4NH 1A62A 4GNXC 2NN6I 4R4OA 5FLMH 4A3EG 3E0EA 2NZHA 1B7YB 4LF8L 4DR4Q 4IPDA 4GNXB 2JQOA 4A3CG 1ASYA 3VDYA 2UUBQ 2UXDQ 3UDIA 1L2FA 4JBWA 3JAMc 4YCVA 4JV5L 1LM0A 2JK8A 4X66L 2YTXA 4OO1I 4X65Q 4JI7Q 1WYDA 4DV3L 1L1OA 3H3VI 2K52A 1YVCA 4NB3A 5LMNW 3J80c 2YTYA 2NVXH 4HIOA 3H15A 1X6OA 1I94Q 5BR8L 1VQDA 4JV5Q 2WP8J 3D0FA 1XPOA 3BJUA 4X66Q 2ZTEA 1PH1A 3RZOH 1VQGA 4R4TA 1Q86C 1X9NA 1KD1C 1X65A 4B3SQ 1E1TA 3F1ZA 3J81j 1HZBA 3RN5A 3NBHB 4DR5L 2LSSA 4A75A 4A3FG 3UDGA 3KF8B 3EN2A 5BR8Q 1UE6A 1JB7A 2CCZA 1OXTA 3CCLA 2JA5H 1FVIA 1SN8A 1VQNA 1PYBA 5IYBH 2UXCL 3I4MH 3A5ZB 4BY1G 3ULLA 4DR7L 2IT1A 1W2BA 3KYHC 3L0OA 3PUVA 1VQ4A 4RG1A 1XMQL 1SLJA 2DGYA 3GO5A 1PYSB 4DR5Q 2HHHQ 4HJ7A 4JI3L 4LFCL 5C4XG 1YHBA 3M85A 2HIVA 3S16H 3MEFA 1MKHA 4DV2Q 1EIYB 4AYBG 2E2HH 3PGZA 4C2MH 2XGTA 2UUAL 1QVFA 2ZJQA 1VQAA 4DR2L 5JEAJ 3M7NA 4DV7Q 1E1OA 2QA4A 4B3TL 4GLAC 1Q12A 4A3JH 3HOXG 1PH2A 1SMXA 3FHWA 2Q2TA 4DR6L 2IHEA 2JA9A 2ZTDA 5GAEC 4HIDA 3WWVA 4YY3Q 4HJ5A 4DR3Q 3PO3G 3HOUG 4IO9A 3HOYG 1VQ7A 2I5LX 1T9HA 4DPGA 2R93G 5IYDG 1QVCA 4A3MG 4DV0L 1S40A 3G48A 1KL9A 1WCMH 1QVGA 1Q82C 3PUXA 3GTMH 1PH6A 3ULJA 4DR6Q 3JC66 3U4ZA 4IPGA 3KLWA 4GS3A 1KRSA 2AWNA 3S17H 3F8TA 4GN4B 2GVAA 5FJ8H 3UDXA 1HR0L 4A3BH 3F2BA 1N32L 1JT8A 2BA0A 4LUZA 4GKJL 1GO3E 3S15H 1WFQA 3CXCA 4A3GG 4GKKL 3HOVG 2DUDA 1OXVA 4BBSH 3PIPA 1Z47A 4NXML 4JOIC 1K9MC 4K0KQ 2UXBL 2YV5A 4P74A 1XMOL 1XNQL 1I6HH 1N36L 3J7A5 3FKIH 4UPAA 3AFPA 4GKJQ 4B3ML 2QEXA 2R7ZH 5HGQA 1B70B 4A76A 2WB1G 1EOVA 5IYCG 4DK3C 3OTOL 4PZ7A 1KC8C 4P72A 4NXMQ 2CWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FL0 A;  1GVP A;  1XMO Q;  1PH8 A;  3LGJ A;  1VQH A;  4A4I A;  1N36 Q;  4GNX A;  1OTC A;  2NVT H;  4YCU A;  2JA7 H;  5M3M H;  4A3D G;  5IT9 c;  1XPR A;  4JI2 Q;  2PMZ E;  2N49 A;  1VQO A;  4UY8 C;  1Y1W H;  1HNX Q;  3HKZ E;  1KRT A;  1JMC A;  3GDE A;  2CFM A;  4OXP A;  4AYB E;  3ERS X;  3U4V A;  1X3F A;  5HY6 A;  4X64 L;  4IOA A;  5IWA Q;  3TS0 A;  4DR1 L;  3I55 A;  1VQP A;  4O0A A;  2VZA A;  3ER0 A;  3M3Y H;  3HFZ B;  1Q1B A;  1YEZ A;  4X62 L;  1HJP A;  4P75 A;  3K81 C;  1Q81 C;  3KOJ A;  2LXK A;  4L5R C;  1A8V A;  1XNR Q;  1W3S A;  3TS2 A;  4OO1 G;  3CC4 A;  5JJL A;  1VS0 A;  4DV6 L;  4DR1 Q;  3H0G H;  4GOP C;  5M5Y H;  1YI2 A;  1P16 A;  2ES2 A;  1JE5 A;  3PF5 A;  2GN5 A;  4BBR H;  5M5W H;  3I7F A;  2E8G A;  5IP9 G;  1QUQ B;  5C44 G;  4GOP B;  1I5F A;  1N8R C;  2OTL A;  1K8A C;  1HZA A;  4JI5 Q;  1BBU A;  3RLO A;  4WJ4 A;  2E5L L;  2R92 H;  2VQF L;  4DV6 Q;  1E24 A;  1SFO H;  1PH5 A;  2QGQ A;  2KEN A;  5C4J H;  4DUY L;  1BKB A;  2RCN A;  4OX9 L;  3PCO B;  1PV4 A;  4LW1 A;  1IYJ B;  3H3V H;  1VQJ A;  2ZJP A;  4PG3 A;  2E2J H;  2N3S A;  5LMU Q;  4IPH A;  4H02 A;  4IJH A;  3G4S A;  1SR3 A;  4LF4 L;  1JJG A;  1NMG A;  2KHI A;  5GAD C;  2E5L Q;  2AMC B;  3CCU A;  2JJQ A;  1I3Q H;  3CC7 A;  3KF6 B;  3DM3 A;  2WB1 E;  4YWM A;  4EX5 A;  2NVY H;  2WAQ G;  4JG2 A;  5C0X I;  4LF8 Q;  4OX9 Q;  3BZK A;  3RN2 A;  5GAG C;  1VQC A;  2K4K A;  4A3K G;  4PZ6 A;  3W1B A;  4RMF A;  1AE3 A;  2AKW B;  3CQZ H;  4NPS A;  1H95 A;  2Q2U A;  1EIF A;  2UUC L;  3KJP A;  5EAY A;  3STB C;  1FGU A;  1YBY A;  4DKA C;  3DLL A;  2Y0S E;  1N34 L;  4BXX G;  1CSP A;  4LUV A;  1R9T H;  5IP7 G;  4DV3 Q;  3HOZ G;  1E3P A;  1M90 C;  4ME3 A;  3KDF B;  1J5E L;  1I50 H;  1C0A A;  2F4V L;  1NBW A;  2UUC Q;  2KCM A;  4A3L G;  1X56 A;  4MZ9 A;  1NE3 A;  2ASB A;  3IRB A;  2VS1 A;  2EXD A;  2K5H A;  3J7Z C;  3T1Y L;  2B63 G;  3HOW G;  4QIW E;  2BH8 A;  3E9H A;  2VNU D;  5IYB G;  3A74 A;  4JOI A;  3TRZ A;  4FDB A;  4HJ8 A;  2ZJR A;  2HHH L;  3GTP H;  1VQE A;  4YWL A;  2UXC Q;  5GAH C;  1GM5 A;  4A3F H;  1HNW L;  5C3E H;  1TWC H;  1KQS A;  3PIO A;  3PUW A;  1PH3 A;  4PMW A;  4DR7 Q;  1LUZ A;  1RIP A;  5IY0 A;  1MJC A;  4A93 H;  1XMQ Q;  4DV5 L;  3K0X A;  5AJ3 L;  1U0L A;  2VL6 A;  3CCR A;  1JJC B;  4JI3 Q;  3M4O H;  3FP9 A;  4QL5 A;  4LFC Q;  3M4P A;  1KHI A;  2CQO A;  1AE2 A;  1X55 A;  1E7Z A;  1JJ2 A;  1C9O A;  1MIU A;  1PH4 A;  2MNA A;  2UUA Q;  2MO1 A;  4L5S A;  1IBL L;  4DR2 Q;  4JYA L;  2K75 A;  1A0I A;  3CCQ A;  4DV5 Q;  4LF9 L;  3OW2 A;  4LF6 L;  1KAW A;  4L5T A;  2RHQ B;  4B3T Q;  2YTV A;  4DV4 L;  4IFD G;  4POG A;  1RL2 A;  1VQ5 A;  3CP0 A;  5M3F G;  2IX1 A;  1Z9F A;  4JC0 A;  1WCM G;  4JI6 L;  1TWF H;  1Q1E A;  2R6G A;  4LFB L;  1L1O C;  2BA1 A;  1C7Y A;  2PI2 A;  3HOU H;  3PO2 G;  4DV1 L;  1HZC A;  4DV0 Q;  3HOY H;  4LF6 Q;  4DK6 C;  1XJV A;  4A3B G;  1PH7 A;  1YJW A;  2R93 H;  1BBW A;  2ALY B;  2KBN A;  1Y1V G;  4JBK A;  1L1O B;  1XTD A;  1PH9 A;  1IBM L;  1QUQ A;  1EUJ A;  3Q8D A;  2ID0 A;  1HR0 Q;  4GOP A;  3EBE A;  1N32 Q;  4JI6 Q;  1YIT A;  4LFB Q;  4C3I H;  4GKK Q;  1IBK L;  4DV1 Q;  4NXN L;  4P73 A;  1HZ9 A;  3AYH B;  4L5Q A;  3CMA A;  2OTJ A;  2UXB Q;  2I5H A;  3CCJ A;  1Y14 B;  2R7D A;  3HOV H;  2JA8 G;  3AFQ A;  3NEL A;  3RR5 A;  4POF A;  4TVA B;  1IBM Q;  2UU9 L;  1MJE A;  1XNQ Q;  2R7Z G;  4IFD I;  2ZM6 L;  1GD7 A;  2VUM G;  2AWO A;  3AQQ A;  2JEA I;  1G29 1;  4UP8 A;  3S2D H;  3CPW A;  4B3M Q;  1YNX A;  3CPF A;  2JA6 G;  5GRO A;  2HIX A;  3S24 A;  3OTO Q;  3ULP A;  3UE1 A;  5M3M G;  3KF6 A;  2Q2I A;  1VQ8 A;  3CCS A;  1CKM A;  3GTL H;  1EFW A;  4KHP L;  1Y1W G;  1CSQ A;  2UU9 Q;  3S1R H;  1AH9 A;  2H5X A;  4YHH L;  1HNZ L;  1S3O A;  4JBJ A;  1HR0 W;  3RNU A;  1OXX K;  1L0W A;  1SE8 A;  2JEB I;  2FXQ A;  1CKN B;  2PI2 E;  2D0O A;  4KHP Q;  1EWI A;  2YYZ A;  2C35 B;  5E7N A;  4JI1 L;  2OQ0 A;  1HNZ Q;  4X64 Q;  3SGI A;  4DNI A;  5C0X G;  2XTI A;  1FJG L;  3KDF A;  3ICE A;  1UEB A;  4APV A;  4HIK A;  1NMF A;  4LF5 L;  3S1N H;  3CC2 A;  2F52 A;  4LUO A;  1UWV A;  4JI8 L;  4X62 Q;  4JBM A;  3PF4 A;  1KXL A;  3H0G G;  2Z6K C;  1QZG A;  4A3I H;  2I5M X;  4JI0 L;  1IXR A;  2R7F A;  1LTL A;  3I2Z A;  3G71 A;  4GN5 A;  2LXJ A;  4LF7 L;  1N33 L;  3GTQ H;  4IJL A;  3W1G A;  4BY7 H;  4OWT B;  4AQY L;  3GTG H;  3ZJY C;  3STB D;  2OCE A;  5LMN L;  1TXY A;  3GTJ H;  3I4N G;  1X3G A;  3J81 i;  1LYL A;  2MQH A;  1K3R A;  5FLM G;  4JI4 L;  3TEH B;  3S1Q H;  1EYG A;  1HH2 P;  4LWC A;  2VQF Q;  1YZ6 A;  4LF7 Q;  1Q46 A;  4C3J H;  3L7Z C;  1K73 C;  1PA6 A;  3D31 A;  4LFA L;  4DUY Q;  4AQY Q;  4PZ8 A;  3GD7 A;  2A19 A;  1B8A A;  2OWO A;  4A3E H;  2YU9 H;  1Q7Y C;  2UUB L;  2UXD L;  5JJI A;  4LF4 Q;  3GTO H;  2AHO B;  2IX0 A;  4A3C H;  4R1J A;  1K0R A;  2VW9 A;  2HT1 A;  1QZH A;  2IY5 B;  1EQR A;  2V1C C;  2N78 A;  4LFA Q;  4Y52 H;  2EQS A;  4X65 L;  4JI7 L;  3CCM A;  1WOC A;  3J81 c;  1VQK A;  1GKH A;  3K7A H;  1TWA H;  1I94 L;  3S1M H;  2K14 A;  3PSI A;  4A3K H;  4TQU S;  1YHA A;  3NEM A;  1TWH H;  3BZC A;  4HIM A;  1D7Q A;  2Q2H A;  2D62 A;  5J3B A;  3F2C A;  1N34 Q;  2A8V A;  2VY3 A;  1CKO A;  2MO0 A;  1D8L A;  4XTC S;  1S72 A;  4B3S L;  3AEV A;  1A63 A;  2ZTC A;  3CF5 A;  2HQL A;  2MFI A;  1Q8K A;  2JA5 G;  4LNQ A;  4BXX H;  2WFW A;  1J5E Q;  3I4M G;  4GN3 B;  1VQB A;  2D0P A;  5IP7 H;  3HOZ H;  2JE6 I;  2F4V Q;  4HJA A;  2Z0S A;  3I4O A;  1K8G A;  4KI0 A;  4HJ9 A;  3F2D A;  1SRO A;  2K5V A;  3T1Y Q;  4A3L H;  4QQB X;  4UP9 A;  4UP7 A;  3KJO A;  1YJN A;  4BY1 H;  2BH2 A;  1OXS C;  1NJI C;  2B63 H;  3HOW H;  3S14 H;  5C3E G;  2PNH A;  4QJF A;  3UE0 A;  4IFD J;  4DAM A;  2PQA B;  1VQL A;  1X54 A;  5DLQ E;  4A93 G;  4Y7N H;  4DV2 L;  1HNW Q;  1G51 A;  2VQE L;  1WJJ A;  5C4X H;  3G6E A;  3B6Y A;  4DV7 L;  4A3J G;  2IHF A;  1PFS A;  5AJ3 Q;  3GTK H;  3HKZ G;  2NVQ H;  2K5N A;  5JJK A;  1VQI A;  4DR3 L;  4YY3 L;  1CKN A;  2CKZ B;  2WAQ E;  1U5K A;  5H1S E;  3CCV A;  3HOX H;  2VQE Q;  4BA1 I;  1OXU A;  1IBL Q;  3PO3 H;  4JYA Q;  1IZ6 A;  1VCI A;  1X3E A;  4O2D A;  4LF9 Q;  2A1A A;  2K50 A;  5FJ8 G;  5FLX c;  4DV4 Q;  1YJ9 A;  5IYD H;  5ELN A;  4A3M H;  2E2I H;  1E22 A;  3TQY A;  5IE8 A;  1YIJ A;  4AH6 A;  4OWW B;  4BBS G;  1CUK A;  4MTN A;  5JEA G;  3EIV A;  5M3F H;  2EIF A;  1DGS A;  3PV0 A;  4P71 A;  1YHQ A;  3K80 C;  4R4C A;  3CW2 C;  4KHZ A;  3FKI G;  4K0K L;  2Z6K A;  4A3G H;  3MXN B;  5K36 G;  3PO2 H;  3I56 A;  1VQF A;  2KHJ A;  4IPC A;  4DAY B;  2RHS B;  1Y1V H;  4QGU A;  1ASZ A;  1TWG H;  1WI5 A;  3PUZ A;  1IBK Q;  4NXN Q;  4EQ5 A;  4QY7 A;  2JA7 G;  3CAM A;  1VQM A;  1M1K C;  1NTG A;  5IYC H;  4MNO A;  1SRU A;  2ZM6 Q;  3W5O A;  1V9P A;  4JI2 L;  2JA8 H;  4B3R L;  1J6Q A;  1N9W A;  3NEN A;  5C0X J;  4ALP A;  1HNX L;  4OWX B;  1UE1 A;  3U58 A;  2VUM H;  3CD6 A;  4A3D H;  4BA2 I;  1BVS A;  2F3I A;  2JA6 H;  3TRE A;  1K83 H;  3K7U C;  1IL2 A;  2L15 A;  4GLX A;  4AIM A;  4YCW A;  4YHH Q;  1EQQ A;  3M4Q A;  1KIX A;  5IWA L;  4X6A H;  1VQ6 A;  4B3R Q;  2I0Q A;  4C3H H;  4YWK A;  1PHJ A;  2Y0S G;  1UE7 A;  4DUZ L;  5GQO A;  3T1H L;  3PUY A;  1UE5 A;  3CME A;  1XPU A;  2N8N A;  1G6P A;  3S2H H;  2NN6 G;  2CWP A;  4JI1 Q;  3U50 C;  1O7I A;  3HKS A;  1XNR L;  3L2P A;  1PVO A;  3E9I A;  4BBR G;  3UDF A;  4R4Q A;  1FJG Q;  3CCE A;  4A3I G;  4LF5 Q;  1VQ9 A;  4DUZ Q;  1P8L A;  4KLK A;  3T1H Q;  3K8A A;  4JI8 Q;  4XIG S;  3RLF A;  2R92 G;  4JI5 L;  3BU2 A;  4JI0 Q;  4GLV B;  5M5X H;  5IP9 H;  2NZO A;  2ATW A;  4BY7 G;  3JAM i;  5ELO A;  3A0J A;  2GVB A;  2RF4 A;  5C44 H;  3A5U A;  4R4I A;  1N33 Q;  1NY4 A;  3M9B A;  4JCV E;  2PQA A;  2B3G A;  3KFU A;  2B29 A;  1V1Q A;  4DR4 L;  3RLN A;  3OYY A;  5LMN Q;  4IOC A;  4WJ3 M;  3RZD H;  1V43 A;  5LMU L;  2KCT A;  3J80 i;  4OON A;  2OQK A;  4J15 A;  4JI4 Q;  3I4N H;  1A62 A;  4GNX C;  2NN6 I;  4R4O A;  5FLM H;  4A3E G;  3E0E A;  2NZH A;  1B7Y B;  4LF8 L;  4DR4 Q;  4IPD A;  4GNX B;  2JQO A;  4A3C G;  1ASY A;  3VDY A;  2UUB Q;  2UXD Q;  3UDI A;  1L2F A;  4JBW A;  3JAM c;  4YCV A;  4JV5 L;  1LM0 A;  2JK8 A;  4X66 L;  2YTX A;  4OO1 I;  4X65 Q;  4JI7 Q;  1WYD A;  4DV3 L;  1L1O A;  3H3V I;  2K52 A;  1YVC A;  4NB3 A;  5LMN W;  3J80 c;  2YTY A;  2NVX H;  4HIO A;  3H15 A;  1X6O A;  1I94 Q;  5BR8 L;  1VQD A;  4JV5 Q;  2WP8 J;  3D0F A;  1XPO A;  3BJU A;  4X66 Q;  2ZTE A;  1PH1 A;  3RZO H;  1VQG A;  4R4T A;  1Q86 C;  1X9N A;  1KD1 C;  1X65 A;  4B3S Q;  1E1T A;  3F1Z A;  3J81 j;  1HZB A;  3RN5 A;  3NBH B;  4DR5 L;  2LSS A;  4A75 A;  4A3F G;  3UDG A;  3KF8 B;  3EN2 A;  5BR8 Q;  1UE6 A;  1JB7 A;  2CCZ A;  1OXT A;  3CCL A;  2JA5 H;  1FVI A;  1SN8 A;  1VQN A;  1PYB A;  5IYB H;  2UXC L;  3I4M H;  3A5Z B;  4BY1 G;  3ULL A;  4DR7 L;  2IT1 A;  1W2B A;  3KYH C;  3L0O A;  3PUV A;  1VQ4 A;  4RG1 A;  1XMQ L;  1SLJ A;  2DGY A;  3GO5 A;  1PYS B;  4DR5 Q;  2HHH Q;  4HJ7 A;  4JI3 L;  4LFC L;  5C4X G;  1YHB A;  3M85 A;  2HIV A;  3S16 H;  3MEF A;  1MKH A;  4DV2 Q;  1EIY B;  4AYB G;  2E2H H;  3PGZ A;  4C2M H;  2XGT A;  2UUA L;  1QVF A;  2ZJQ A;  1VQA A;  4DR2 L;  5JEA J;  3M7N A;  4DV7 Q;  1E1O A;  2QA4 A;  4B3T L;  4GLA C;  1Q12 A;  4A3J H;  3HOX G;  1PH2 A;  1SMX A;  3FHW A;  2Q2T A;  4DR6 L;  2IHE A;  2JA9 A;  2ZTD A;  5GAE C;  4HID A;  3WWV A;  4YY3 Q;  4HJ5 A;  4DR3 Q;  3PO3 G;  3HOU G;  4IO9 A;  3HOY G;  1VQ7 A;  2I5L X;  1T9H A;  4DPG A;  2R93 G;  5IYD G;  1QVC A;  4A3M G;  4DV0 L;  1S40 A;  3G48 A;  1KL9 A;  1WCM H;  1QVG A;  1Q82 C;  3PUX A;  3GTM H;  1PH6 A;  3ULJ A;  4DR6 Q;  3JC6 6;  3U4Z A;  4IPG A;  3KLW A;  4GS3 A;  1KRS A;  2AWN A;  3S17 H;  3F8T A;  4GN4 B;  2GVA A;  5FJ8 H;  3UDX A;  1HR0 L;  4A3B H;  3F2B A;  1N32 L;  1JT8 A;  2BA0 A;  4LUZ A;  4GKJ L;  1GO3 E;  3S15 H;  1WFQ A;  3CXC A;  4A3G G;  4GKK L;  3HOV G;  2DUD A;  1OXV A;  4BBS H;  3PIP A;  1Z47 A;  4NXM L;  4JOI C;  1K9M C;  4K0K Q;  2UXB L;  2YV5 A;  4P74 A;  1XMO L;  1XNQ L;  1I6H H;  1N36 L;  3J7A 5;  3FKI H;  4UPA A;  3AFP A;  4GKJ Q;  4B3M L;  2QEX A;  2R7Z H;  5HGQ A;  1B70 B;  4A76 A;  2WB1 G;  1EOV A;  5IYC G;  4DK3 C;  3OTO L;  4PZ7 A;  1KC8 C;  4P72 A;  4NXM Q;  2CWA A; 
#chains in the Genus database with same CATH topology
 4A3F B;  1PH8 A;  1VQH A;  1DJR D;  1OTC A;  1F2Y A;  4YCU A;  4EQO A;  4JI2 Q;  2PMZ E;  1VQO A;  1JOR A;  1MHW C;  5ELF A;  1NR2 A;  3R8B A;  1PTO C;  3P1H A;  1BUV T;  4Y7N B;  4IUT A;  1L0Y B;  1PRT D;  4OXP A;  4AYB E;  3ERS X;  3U4V A;  1X3F A;  4X64 L;  3FMC A;  4KHV A;  1VQP A;  2AQ2 B;  4O0A A;  4AYB B;  4H44 C;  1T5X D;  3C1F A;  5I2X A;  4G7H C;  4L5R C;  1W3S A;  4S3S A;  3TS2 A;  2HCI A;  4DR1 Q;  4GOP C;  3Q22 A;  3HOU B;  1JE5 A;  4BBR H;  3CHB D;  1QUQ B;  5IP9 G;  5M9O A;  3K5M A;  4A3M B;  1K8A C;  3SXH A;  4JI5 Q;  4V0B A;  5CR3 A;  1E24 A;  2M00 A;  2KEN A;  2RCN A;  5BN5 A;  1PV4 A;  3H3V H;  4HAE A;  1GHJ A;  2ZJP A;  4PG3 A;  2N3S A;  1IYU A;  4QMG A;  1SR3 A;  3C1E A;  1HQM C;  3CCU A;  3MC0 B;  2BCO A;  2RDG A;  2PO4 A;  3GP7 A;  4OX9 Q;  4EX5 A;  4JG2 A;  1SE2 A;  3BZK A;  3GTL B;  3D4D A;  1CT1 D;  4M1U B;  4RMF A;  1FR3 A;  3Q6S A;  1Z7T A;  3U9S A;  2DY7 A;  4DKA C;  2B8F A;  2Y0S E;  2G5D A;  1BCP C;  1CSP A;  4LUV A;  4EQP A;  4BXX G;  1XXG A;  4O1N A;  4LAA A;  2QF7 A;  1QNU A;  3HOZ G;  1K83 B;  2F0F A;  2Y0S B;  1E3P A;  4K8J A;  3D6C A;  1I50 H;  4IAL A;  4JW0 A;  3KBG A;  5D14 A;  1IKL A;  4NDX A;  5G3L F;  1DZ1 A;  4FP5 D;  2K5H A;  5T1G A;  1HA5 A;  3E9H A;  2VNU D;  3J81 E;  2Z8L A;  1EZ8 A;  3H6M A;  4YWL A;  5GAH C;  4K5X A;  2AQ1 B;  1SNQ A;  5C3E H;  1ILP A;  5IY0 A;  3GTJ B;  1MJC A;  4A93 H;  2D9U A;  1AW7 A;  4JI3 Q;  3CCR A;  3M4O H;  4QL5 A;  2NB0 A;  4C3J B;  5IGC A;  1KHI A;  2CQO A;  1ZEQ X;  2C9O A;  1XWE A;  4ZUI A;  2MNA A;  2E74 C;  4MIU A;  2O5J C;  2K75 A;  4DV5 Q;  4LF9 L;  1HA6 A;  3H91 A;  4CJ1 B;  4IFD G;  1KAW A;  2YTV A;  4DV4 L;  2MPM A;  1PZK D;  5K5P A;  1RL2 A;  3MFY A;  5M3F G;  1EOT A;  1WCM G;  2PZT A;  4LFB L;  2BA1 A;  2WAQ B;  4DV1 L;  3MA2 B;  1WTV A;  3QIA A;  2CW0 C;  1BOS A;  4GOP A;  2HDL A;  3EBE A;  1CQV A;  1YIT A;  1HR0 Q;  2FHT A;  4C3I H;  1HUM A;  3NTI A;  5AFW A;  5EPJ A;  2KEE A;  4P73 A;  5FLX E;  4L5Q A;  4PNY A;  5I6Y A;  3CMA A;  2I5H A;  1Y14 B;  3HOV H;  4POF A;  1JQY D;  4IFD I;  1S5D D;  1VMP A;  2JEA I;  1G29 1;  3S2D H;  2K5Q A;  3CPF A;  4K8I A;  2HIX A;  3S24 A;  3HOW B;  3J7Y W;  5L37 A;  5M3M G;  3I3C A;  1A3U A;  3AU7 A;  3CCS A;  1CKM A;  4KHP L;  1Y1W G;  1CSQ A;  2UU9 Q;  4K5V A;  4FO2 A;  3I73 A;  2MGS A;  4JBJ A;  1SE8 A;  2JEB I;  2EVB A;  2D0O A;  2RQX A;  1EWI A;  1LTA D;  2F0O A;  3SGI A;  1CHP D;  2Z1C A;  2NN6 H;  3ICE A;  3S1N H;  5ISR A;  1CI3 M;  1WTH A;  1UWV A;  4JBM A;  3PF4 A;  2E2I B;  2L0C A;  1QZG A;  2I5M X;  1IXR A;  2O2L D;  2LFN A;  4DXG A;  1SEB D;  5ELE A;  2JP1 A;  5LMN L;  1TXY A;  3I4N G;  3OMC A;  1LYL A;  3J81 i;  1TWG B;  3E0J A;  1K73 C;  3VYS A;  1A15 A;  3CKI B;  1PRT C;  2A19 A;  1O7Y A;  1B8A A;  3GD7 A;  3J80 L;  2OWO A;  4A3E H;  2UXD L;  1BCP F;  4R1J A;  2R7Z B;  4IUV A;  1U4M A;  3VR3 A;  2IY5 B;  2VUM B;  2EQS A;  2EJF C;  1VQK A;  1HRJ A;  3S1M H;  2K14 A;  3TP8 A;  4TQU S;  5E1F A;  3NEM A;  4HIM A;  2D62 A;  3QO2 A;  1N34 Q;  1SYG A;  2VY3 A;  4ZRZ A;  3D4R A;  4B3S L;  1A63 A;  2ZTC A;  3CF5 A;  2HQL A;  2MFI A;  4LNQ A;  2WFW A;  4XYQ A;  3JAM E;  1A2T A;  2F4V Q;  2Z0S A;  4L6T B;  1K8G A;  2KA7 A;  4KI0 A;  2I07 B;  4HJ9 A;  2L12 A;  2K5V A;  3T1Y Q;  4QQB X;  4RCN A;  4BY1 H;  5M5X B;  4QJF A;  3UE0 A;  1VQL A;  1X54 A;  3VYU A;  3P7J A;  1G51 A;  2N55 A;  1WJJ A;  1CA6 A;  3LWE A;  2IHF A;  3VYR A;  1PFS A;  1CFM A;  1VQI A;  4HMJ A;  4DR3 L;  1X3P A;  4YY3 L;  1CKN A;  1F2Z A;  1U5K A;  2F0I A;  2TSS A;  5FJ8 G;  1E22 A;  3TQY A;  3TP5 A;  3A8K E;  5J39 A;  3MAQ A;  3D4W A;  4CKB A;  2CQA A;  5KRU A;  1SAP A;  1SYB A;  3I56 A;  3PO2 H;  5IT9 L;  2KHJ A;  3I70 A;  4KD3 A;  1HXY D;  4CDD C;  3A8I E;  2K04 A;  2JA7 G;  3CAM A;  1VQM A;  4KKT A;  1A3T A;  4JVZ A;  3H94 A;  5IYC H;  1M1K C;  1TY2 A;  1ZYR D;  5C0X J;  3NEN A;  2EPB A;  4OWX B;  1UE1 A;  4A3D H;  4BA2 I;  1BVS A;  5BN4 A;  2A68 C;  3TRE A;  1IL2 A;  5C3E B;  4GLX A;  4YHH Q;  3M4Q A;  4RHS A;  4B3R Q;  2I0Q A;  4A93 B;  5KNC A;  4YWK A;  2EYH A;  4DF7 A;  1LT5 D;  4FF2 A;  4WJW A;  1UE7 A;  3M4O B;  4DUZ L;  3T1H L;  3CME A;  1GJX A;  3HKZ B;  1G6P A;  3UI2 A;  5KIX A;  3U50 C;  3NTH A;  2KCC A;  3UDF A;  2Z6B A;  5C0X H;  1VQ9 A;  4JI8 Q;  1CM9 A;  4JI0 Q;  4GLV B;  3CU7 A;  2ATW A;  4BY7 G;  3JAM i;  5ELO A;  1K8O A;  1PRT F;  1N33 Q;  1ET6 A;  4BBS B;  3P75 A;  4ZYS A;  3M9B A;  2B3G A;  1DOM A;  1SNC A;  2OQK A;  4JI4 Q;  3PIP 3;  4R8N A;  4R4O A;  4HN7 A;  2NZH A;  2Q8I B;  4NW2 A;  4LF8 L;  5IGG A;  4A3C G;  1CQF A;  3BVM A;  2UUB Q;  2NVT B;  1XX8 A;  1EIH A;  4JV5 L;  3S2D B;  2YTX A;  4OO1 I;  4X65 Q;  4JI7 Q;  5E4X A;  1TS5 A;  3NWS A;  1AN8 A;  2HQE A;  2YTY A;  3J80 c;  3H15 A;  2NVX H;  4H13 C;  5DAU A;  1LTS D;  4X66 Q;  5CV6 A;  1VQG A;  1X9N A;  1X65 A;  1E1T A;  5JPN C;  1WTR A;  3RN5 A;  1NNX A;  4A3F G;  2LSS A;  4A75 A;  2CCZ A;  5LL6 X;  2K03 A;  5BR8 Q;  1JB7 A;  1SN8 A;  2BDN A;  3I4M H;  3S1N B;  3A5Z B;  2IT1 A;  4N9P A;  4RG1 A;  1VQ4 A;  1HFG A;  2EE1 A;  1S4Z A;  1IYV A;  2R92 B;  2J0T D;  4XDX A;  3NWT A;  2HIV A;  1ICF B;  4DV2 Q;  4FF1 A;  4AYB G;  2XGT A;  2B2V C;  3M7N A;  4DV7 Q;  2E2J B;  1DOK A;  1Q12 A;  4A3J H;  4DR6 L;  3A55 A;  2IHE A;  1I3Q B;  2JA9 A;  2NVY B;  3HOU G;  4ZKC B;  4IO9 A;  1VQ7 A;  3OW7 A;  4A3E B;  5IGF A;  5IYD G;  4A3M G;  3MWY W;  1QVG A;  1Q82 C;  3GTM H;  4L63 B;  3U4Z A;  4JPB W;  2AUJ D;  4O42 A;  4A3B H;  2GVA A;  1JOO A;  4YIJ A;  1V8Q A;  3S15 H;  3CXC A;  3A54 A;  4GKK L;  2DUD A;  5ELB A;  5JAV A;  1ZXT A;  3PIP A;  3S1M B;  3QJY A;  1Z47 A;  4NXM L;  4JOI C;  1K9M C;  5CV8 A;  3AB9 A;  4HTH A;  1XNQ L;  3MEH A;  1N36 L;  2LKV A;  3FKI H;  4NKL A;  1NAP A;  2Q8R E;  1SYC A;  4B3M L;  1DON A;  2XN9 C;  3C3L A;  3OTO L;  2MP1 A;  4PZ7 A;  4P72 A;  3KFU A;  1I4H A;  2J4X A;  1GVP A;  3LGJ A;  1BR9 A;  1YNJ D;  1TQO A;  5IT9 c;  4UY8 C;  4BY1 B;  1HNX Q;  1QJO A;  2QDB A;  4RHR A;  4CJ0 B;  3D6W A;  3NUC A;  2O5I C;  5IWA Q;  5EPL A;  4DFA A;  3DWP A;  2VZA A;  3M3Y H;  1Q1B A;  3NE5 B;  4P75 A;  1EL0 A;  2X6G A;  1Q81 C;  1A8V A;  1XNR Q;  4IUR A;  1D5M C;  1MGS A;  2F0N A;  5JJL A;  4XXE A;  1YI2 A;  5M5Y H;  5CBA E;  3PF5 A;  3I7F A;  2F0U A;  2RKS A;  1I5F A;  1K8M A;  3TZU A;  1ZYR C;  3MXU A;  4C3J G;  1RTO A;  4WJ4 A;  2E5L L;  1LTR D;  2M9V A;  4KY7 A;  1SFO H;  3R2T A;  4OIJ A;  2DNC A;  1EY8 A;  4IPH A;  2O4X A;  3G4S A;  1NMG A;  5JOB A;  1PLF A;  2B2V A;  4I65 A;  2WAQ G;  1LTI D;  1U9R A;  3CQZ H;  4NPS A;  4F88 A;  1QE6 A;  1H95 A;  2Q2U A;  4X3S A;  2UUC L;  3A8J E;  5EAY A;  4QUC A;  2EY2 A;  4ME5 A;  1ESF A;  5CV5 A;  4Q5V A;  5IP7 G;  1VDZ A;  4ME3 A;  3KDF B;  3FPU B;  3A7L A;  3NQT A;  4RKB A;  4V19 0;  5IGE A;  1NBW A;  2B2U C;  2KCM A;  4A3L G;  4MZ9 A;  2EY5 A;  3IRB A;  2VS1 A;  3HOW G;  4QIW E;  2AUK A;  2BH8 A;  1G91 A;  4JOI A;  3TRZ A;  4QIW B;  2ZJR A;  3DEP A;  2UXC Q;  1NSN S;  4FF4 A;  4MTK A;  1TWC H;  2F0H A;  4IN3 A;  3PUW A;  4DR7 Q;  4WOR A;  2EDG A;  5AJ3 L;  3Q0A A;  4X3T A;  2EJG C;  1SMY D;  4LFC Q;  1AE2 A;  3J7A V;  1C9O A;  2MO1 A;  4DR2 Q;  4KKU A;  4JYA L;  1NCV A;  1B9N A;  2BE5 D;  1A0I A;  3CCQ A;  3MTS A;  3GTO B;  4B3T Q;  4XQJ A;  3H09 A;  3NPP A;  4JC0 A;  4JI6 L;  1TWF H;  3BVZ A;  1L1O C;  5COY A;  1HZC A;  1TWA B;  1H9K A;  3HOY H;  1XJV A;  1PH7 A;  4A3K B;  2R93 H;  1XYI A;  1BBW A;  2ALY B;  3FPP A;  1XTD A;  2RSO A;  1IBM L;  5EKK A;  3Q8D A;  1TU2 B;  3N6R A;  1SNP A;  1XTC D;  2GA4 B;  3DWA A;  3X3M A;  4LFB Q;  1IBK L;  4C1N K;  4DV1 Q;  1EIG A;  1K3B C;  1HZ9 A;  1KDA A;  3AYH B;  2UXB Q;  3CCJ A;  4J1M A;  2R7D A;  1EEF D;  2R7Z G;  1MJE A;  2ZM6 L;  2VUM G;  3AQQ A;  1YNX A;  5GRO A;  2B63 B;  4NP5 A;  4LK1 C;  5EKI A;  3UE1 A;  2IJ0 A;  3T53 B;  2PZU A;  3KF6 A;  1VQ8 A;  1EFW A;  5CV7 A;  3SDZ A;  3S1R H;  2E76 C;  1T5E A;  2KHS A;  3RNU A;  1MBY A;  1VF7 A;  5CGK A;  3ERO A;  2F0M A;  1MI2 A;  4KHP Q;  3KUP A;  5BN3 A;  4C1N I;  2OQ0 A;  2F3V A;  2XTI A;  3IKJ A;  2L9H A;  4HIK A;  4RKL A;  2H4O A;  4LUO A;  4IUP A;  1GUS A;  1QG7 A;  4FNF A;  2K32 A;  4X62 Q;  4FXD A;  2ZXO A;  3V05 A;  3G71 A;  5FK9 C;  5EKL A;  3VR5 A;  2LXJ A;  4DN4 M;  1DXM A;  3GTQ H;  4Q0F A;  2BOS A;  4AQY L;  3GTG H;  3GTM B;  3E6Z X;  3STB D;  4RFB A;  1YNJ C;  1X3G A;  4A3B B;  5ELC A;  3T51 B;  5FLM G;  1Y1V B;  3S15 B;  1HH2 P;  2VQF Q;  1M8A A;  1PA6 A;  3VYT A;  3D31 A;  3NSW A;  5EBD A;  4DUY Q;  4LFA L;  1JWU D;  4KJN A;  1WTW A;  4LF4 Q;  2CH4 A;  2IX0 A;  1KNE A;  1AP0 A;  2JA8 B;  4DU9 A;  1EQR A;  4XQN A;  4Y52 H;  3EQL C;  1ET9 A;  4RA8 A;  1PFM A;  3CCM A;  2JA6 B;  3DEO A;  1V1P A;  5LL6 S;  4DGZ A;  1GKH A;  3K7A H;  1ENF A;  1G6Z A;  4C3H B;  3BZC A;  4ID6 A;  1D1K A;  1D7Q A;  3RUZ A;  3F2C A;  2A8V A;  3AEV A;  4CHT B;  4BXX H;  1GXD C;  1J5E Q;  4X3K A;  1VQB A;  2D0P A;  3HOZ H;  1R4P B;  4HJA A;  5IGD A;  3QG1 A;  1G2S A;  1FYC A;  4UP9 A;  1TS3 A;  3FDT A;  3S14 H;  5C3E G;  2PNH A;  4IFD J;  2PQA B;  1H9M A;  3E5S A;  4A93 G;  1HNW Q;  1PTO H;  3G6E A;  3GTK H;  3HKZ G;  3I8Z A;  2NVQ H;  5JJK A;  1BDO A;  3TP6 A;  1CA5 A;  1SFO B;  5KEE A;  2WAQ E;  1CK1 A;  3A56 A;  1GUW A;  1OXU A;  3Q24 A;  1IBL Q;  3PO3 H;  1IZ6 A;  3K0Y A;  1VCI A;  4DNT B;  1X3E A;  4O2D A;  4CKE A;  2A1A A;  1EY5 A;  3HZX A;  4QUF A;  5IE8 A;  4G7Z C;  4IFD H;  1YIJ A;  4BBS G;  5JEA G;  2EYM A;  2EY1 A;  4RAU C;  1H9S A;  5M3F H;  3OOC A;  3FRP B;  1D2B A;  5I4D A;  1DGS A;  1F2L A;  1STB A;  4P71 A;  1I4X A;  1EQT A;  4A3G H;  2DJF C;  2A6H D;  2WKC A;  3RZO B;  1I4P A;  2QDL A;  3GV6 A;  4DAY B;  1PTO F;  1I4Q A;  2PW7 A;  1SMY C;  2KED A;  1GUG A;  1CHQ D;  3PUZ A;  2B8G A;  4NXN Q;  1QCB D;  2A73 B;  4QY7 A;  4LJZ C;  5ELD A;  2JA5 B;  1NTG A;  2JSO A;  2F0G A;  1B3Q A;  4JI2 L;  1EZ6 A;  4I7Z C;  5A2Q E;  4ALP A;  1IKM A;  3SHL A;  4U67 3;  1EY6 A;  2F3I A;  2KOL A;  2CHB D;  1C48 A;  1TWC B;  4C2M B;  4AIM A;  4YCW A;  2QEJ C;  4X3U A;  4X6A H;  1W6K A;  3BDL A;  1WTX A;  1JWS D;  3S2H H;  2NN6 G;  4JI1 Q;  3L2P A;  1PVO A;  1S5C D;  4R4Q A;  1FJG Q;  3K5N A;  5E4W C;  1X3Q A;  4LF5 Q;  4DUZ Q;  3T1H Q;  4KLK A;  1D1I A;  2EYJ A;  4XIG S;  2R92 G;  4JI5 L;  4QCL A;  1AEX A;  1B4O A;  2GVB A;  2RF4 A;  5C44 H;  4R4I A;  3NP8 A;  4F8M A;  2K33 A;  4K14 A;  1V1Q A;  4DR4 L;  3RLN A;  4IOC A;  2NWG A;  1I6H B;  1V43 A;  2KCT A;  3I4N H;  4FXK C;  4GNX C;  4KKS A;  2NN6 I;  4A3E G;  5I9P A;  1B7Y B;  4IPD A;  1STN A;  1EU3 A;  2B2W C;  3T4A C;  3DXJ C;  2MHV A;  4KY6 A;  1LM0 A;  4R9W A;  2JK8 A;  1RHP A;  1RJT A;  1K28 A;  2FJ2 A;  3W2D A;  5LMN W;  4HIO A;  4MN3 A;  2KUM A;  1PFB A;  3ITP A;  1I94 Q;  3I4L A;  4JV5 Q;  2WP8 J;  3D0F A;  3BJU A;  3DM1 A;  2ZTE A;  1PH1 A;  1ILQ A;  2K05 A;  1WD0 A;  1HCZ A;  1LO5 D;  3MXN A;  4R4T A;  3T13 A;  4EGV A;  4CBV A;  4UDU C;  2HHH L;  1EYC A;  5IYB H;  4BY1 G;  4BBR B;  1W2B A;  3VR6 A;  2RDF A;  1SLJ A;  2DGY A;  3GO5 A;  4JI3 L;  1RF2 D;  3ZYY X;  3M85 A;  3S16 H;  1EIY B;  2E2H H;  4E6I A;  4IUQ A;  1VQA A;  1E1O A;  1EEI D;  3WOF A;  2F03 A;  2Q2T A;  3FHW A;  4QB4 A;  4HJ5 A;  2DJG C;  2WIN B;  1KAB A;  2I5L X;  3G48 A;  1MSG A;  1IW7 D;  1DOL A;  1Q3L A;  3PUX A;  4DR6 Q;  3JC6 6;  1KRS A;  3S17 H;  5FJ8 H;  3UDX A;  1HR0 L;  3DHQ A;  1OXV A;  3K7A B;  1I50 B;  4K0K Q;  3J7A F;  1XMO L;  2L4N A;  3J7A 5;  1ENA A;  2QEX A;  1B70 B;  5A35 A;  1B9M A;  5IYC G;  2K5D A;  1KC8 C;  4NXM Q;  1C0A A;  1FL0 A;  2IX3 A;  1S5F D;  1GUN A;  3BDC A;  1N36 Q;  4GNX A;  4EQN A;  2JA7 H;  2KEC A;  3FVQ A;  1XPR A;  4A3D G;  1F9R A;  3HKZ E;  1EY0 A;  1JOQ A;  1JMC A;  1U4R A;  4BS9 A;  3GDE A;  1MSH A;  1WVL A;  1PTO B;  1GHK A;  3IL8 A;  2NUC A;  3I55 A;  4G7O C;  2A6H C;  1CZW A;  4M8A A;  2R61 A;  3VR4 A;  3HFZ B;  2F0P A;  1HJP A;  3K81 C;  4FF3 A;  2LXK A;  3I90 A;  3CC4 A;  4OO1 G;  1VS0 A;  5IOC A;  5KND A;  4DV6 L;  3H0G H;  3PO3 B;  3KF8 A;  5NUC A;  2OT2 A;  1JE4 A;  4GOP B;  4RH6 A;  1N8R C;  3HGB A;  1BBU A;  1BNZ A;  2IWH A;  1O7L A;  4C3I B;  4PMC A;  2K5W A;  3DWQ A;  2QGQ A;  1PH5 A;  5EJW A;  1BKB A;  4JK1 C;  4LW1 A;  4A3G B;  1VMC A;  3HOV B;  1MD2 D;  5LMU Q;  1WTO A;  4H02 A;  1SND A;  2E5L Q;  1JR0 D;  2JJQ A;  3DM3 A;  2WB1 E;  1ICW A;  5C0X I;  4CGY B;  4OEM B;  1VQC A;  2K4K A;  4P2C B;  4A3K G;  4PZ6 A;  2WB1 B;  3W1B A;  2FFK B;  2ZXR A;  1AE3 A;  1B3A A;  3K6O A;  3T56 B;  4CDF C;  1I4G A;  3MHB A;  1FNV A;  1FGU A;  1KLU D;  1N34 L;  4DV3 Q;  1Y8P B;  1M90 C;  1BCP B;  2F4V L;  2UUC Q;  4UHV A;  1KNA A;  2VXW A;  2ASB A;  5C5M A;  2B63 G;  1PFN A;  3T1Y L;  1FGB D;  3S2H B;  1SJE D;  2RDH A;  5KYL A;  1BBX C;  1VQE A;  2F3W A;  3KLS A;  3GTP H;  1LTB D;  4A3F H;  4QF4 A;  5JVG 3;  1PH3 A;  4PMW A;  3RD4 A;  2EYL A;  1XMQ Q;  5FLX L;  2F0D A;  3K5L A;  1U0L A;  5C44 B;  1JJC B;  1CZG A;  3FP9 A;  2V4D A;  1E7Z A;  4IUN A;  1DCZ A;  1PH4 A;  1PYW D;  3EFX D;  1BQQ T;  2UUA Q;  1STE A;  4N8X 1;  4RGO S;  3OW2 A;  4LF6 L;  4L5T A;  4POG A;  1VQ5 A;  3KK7 A;  2IX1 A;  1Z9F A;  3TN2 A;  2AQ3 B;  1E0B A;  4L8J A;  1C7Y A;  2L5T A;  3HOU H;  4B08 A;  4DV0 Q;  4RCO A;  2CVR A;  4A3B G;  4DK6 C;  1YJW A;  2KBN A;  1Y1V G;  4JBK A;  5FOB B;  1PH9 A;  1QUQ A;  1EUJ A;  3E3X A;  1AFP A;  1N32 Q;  4JI6 Q;  3HG9 A;  2PQE A;  3LNN A;  1EYA A;  1LTG D;  2WV6 D;  1TT2 A;  2JA8 G;  3NEL A;  3RR5 A;  4TVA B;  1IBM Q;  1STG A;  1GD7 A;  4HR7 B;  4RGT A;  4XQQ A;  3CPW A;  1F9Q A;  2JA6 G;  2PNR C;  2X6L A;  5LHY 1;  3EVQ A;  1JOK A;  3GTL H;  3K58 A;  4C3H G;  1AH9 A;  2NYZ D;  2H5X A;  4YHH L;  1HNZ L;  1IW7 C;  1S3O A;  1I4R A;  1OXX K;  1L0W A;  1FNU A;  4KN4 C;  1CKN B;  3KBX A;  2FIN B;  4G57 A;  2PI2 E;  3K59 A;  5E7N A;  3S16 B;  2E2H B;  2RVL A;  1LT4 D;  1TS2 A;  4X64 Q;  2M2L A;  1UEB A;  3SE0 A;  2XWJ B;  4OHJ A;  1KXL A;  4JI8 L;  5CYU A;  1OO9 B;  3DMU A;  4R8I A;  4A3I H;  4JI0 L;  2R7F A;  3I2Z A;  5IOD A;  4GN5 A;  4LF7 L;  1N33 L;  4IJL A;  3W1G A;  3SVM A;  4DK1 A;  4OWT B;  3ZJY C;  2OCE A;  3GTJ H;  3PO2 B;  2G9H D;  3S17 B;  3JAM L;  4JI4 L;  3S1Q H;  1UUP A;  3D8G A;  1YZ6 A;  1Q46 A;  4C3J H;  3L7Z C;  4AQY Q;  2K6A A;  5IIF A;  2HDM A;  1HQR D;  1O78 A;  4ZUJ A;  1WTP A;  1GUO A;  2UUB L;  3OSO A;  2MUY A;  1PRT B;  5I9O A;  2XIW A;  2VW9 A;  1EU4 A;  1LAC A;  3ND8 A;  1QZH A;  3CRL C;  4LFA Q;  2N78 A;  1SYD A;  3KLS X;  4X65 L;  2EY6 A;  4JI7 L;  4A3D B;  3GV3 A;  4B9X A;  3J81 c;  3W3A A;  3PSI A;  1YHA A;  3NXW A;  2EYF A;  1TWH H;  2Q2H A;  5J3B A;  2F0J A;  3V2T A;  2MO0 A;  1S72 A;  1D8L A;  4J6H A;  1O80 A;  3I91 A;  2JA5 G;  1HPC A;  5IP7 H;  1JWM D;  2JE6 I;  2L55 A;  2BDO A;  5FO7 B;  4CJ2 C;  3F2D A;  1BO0 A;  2IL8 A;  2K1B A;  4A3L H;  4UP7 A;  3KJO A;  4K6D A;  3J80 E;  1G2T A;  1H9R A;  2Q8T A;  3HOW H;  4DAM A;  3H0G B;  1WD1 A;  4DV2 L;  5CC4 A;  2VQE L;  5C4X H;  3B6Y A;  4DV7 L;  2EYP A;  2CW0 D;  1F2M A;  2JN4 A;  4B9W A;  4CKC A;  3O13 A;  2K5N A;  2A5H A;  1M4V A;  1S5B D;  4XYO A;  5H1S E;  3HOX H;  3MZ5 A;  4LF9 Q;  4U68 A;  5FLX c;  4DV4 Q;  5ELN A;  4DXF A;  2A74 C;  2E2I H;  1K0S A;  4OWW B;  1B44 D;  2SEB D;  2WKD A;  3EIV A;  4HMI A;  2EIF A;  2NVX B;  3ERQ A;  3PV0 A;  4CDE C;  1YHQ A;  1FNW A;  3NTK A;  5K36 G;  2F4I A;  1SNO A;  1VQF A;  4IPC A;  3C2P A;  1ASZ A;  1TWG H;  1WI5 A;  1SDF A;  2QW7 A;  1SSO A;  1Q90 A;  3I4M B;  4FVM A;  2JXM B;  4IZ8 A;  4MNO A;  3SK8 A;  3OIP A;  1V9P A;  1HNX L;  2VUM H;  1LV9 A;  3QWN A;  2SDF A;  3L9A X;  3LX0 A;  3K7U C;  2L15 A;  4K5W A;  3BYY B;  1EQQ A;  5IWA L;  1VQ6 A;  5TSS A;  1PHJ A;  3OWF A;  2PMZ B;  4A3J B;  3PUY A;  4HED A;  2N8N A;  1O7I A;  3HKS A;  1XNR L;  1J9O A;  1SE3 A;  3E9I A;  4BBR G;  2B2U A;  5IT9 E;  2HD3 A;  1CTM A;  3BG3 A;  2KCN A;  3QB3 A;  2D2C C;  1P8L A;  3M4Y A;  3K8A A;  3TBI B;  3RLF A;  3BU2 A;  5C3W A;  3NHH A;  5M5X H;  2N88 A;  5IP9 H;  4G4K A;  2H1E A;  3C46 A;  1STA A;  2J7Z A;  1E2Z A;  4IUU A;  4RWS C;  1KAA A;  5EGT A;  4HSP A;  4JCV E;  2B29 A;  3TSS A;  5LMN Q;  3RZD H;  3J80 i;  1EFI D;  4OGQ C;  4PQX A;  3FKI B;  4J15 A;  4ABN A;  5KNB A;  5FLM H;  3M7G A;  1RD9 D;  4K6L A;  4DR4 Q;  2JQO A;  3SK5 A;  3TZD A;  1ASY A;  3VDY A;  2UXD Q;  3UDI A;  1L2F A;  2OF1 A;  5KGU A;  1C8C A;  3JAM c;  3MXP A;  1PMR A;  4I7A A;  1L1O A;  3H3V I;  2K52 A;  1U4P A;  2A69 D;  1YVC A;  4HSV A;  4ZCK A;  4PMB A;  2Z4H A;  1X6O A;  2EYO A;  2MJ8 A;  1XPO A;  1TR5 A;  1ML0 D;  3M3Y B;  1Y8O B;  1KD1 C;  4B3S Q;  3F1Z A;  1HZB A;  1TS4 A;  1SYE A;  4DR5 L;  1WTQ A;  3UDG A;  3EN2 A;  1YNN D;  1EYD A;  1OXT A;  3G7L A;  1VQN A;  1FVI A;  2EXZ A;  2UXC L;  5M5Y B;  2PZW A;  5CV9 A;  3ULL A;  4DR7 L;  4A3I B;  4ILW A;  1LT3 D;  1W6J A;  2HHH Q;  3F2U A;  4HJ7 A;  4KV6 A;  1QOH A;  4H0L C;  2F0W A;  2SNS A;  4LFC L;  4C56 C;  1TVX A;  3DUZ A;  1MKH A;  1ESR A;  2ZJQ A;  2VB3 X;  4DR2 L;  5JEA J;  2LMC B;  4RGM A;  3S1Q B;  4ZQ3 A;  3K5O A;  4B3T L;  1PH2 A;  1SMX A;  5GAE C;  2ZTD A;  1LAB A;  4HID A;  3PO3 G;  4DR3 Q;  4YY3 Q;  1E2V A;  4XT1 B;  1TII D;  1TKW B;  3CQZ B;  1S40 A;  1WCM H;  1PH6 A;  4IPG A;  4GS3 A;  4C3I G;  4GN4 B;  2A68 D;  4HCE A;  1JT8 A;  2BA0 A;  2PYK A;  3BS1 A;  4LUZ A;  3SK6 A;  1GO3 E;  2B2Y C;  4GKJ L;  4A3G G;  3HOV G;  4BBS H;  5JPM C;  1RCV D;  5JEA H;  2UXB L;  2NZ1 D;  1TWH B;  3PQI A;  4P74 A;  3IFT A;  2BE5 C;  3VR2 A;  5HGQ A;  1TY0 A;  2WB1 G;  1EOV A;  2QKI C;  3MVV A;  5CV4 A;  1XMO Q;  5J22 A;  4A4I A;  2NVT H;  5M3M H;  2N49 A;  1Y1W H;  2XSC A;  3EJI A;  1KRT A;  3QR8 A;  4J8Q A;  3PIO 3;  2CFM A;  2DN8 A;  4DNR B;  5C4X B;  4K2K A;  2KJX A;  4TSS A;  5HY6 A;  4IOA A;  3TS0 A;  4DR1 L;  1RTN A;  2E75 C;  3ER0 A;  3TME A;  1YEZ A;  4ULL A;  4X62 L;  5DM6 3;  3KOJ A;  2FMM A;  3R93 A;  4OEL B;  3HOX B;  2ICI A;  4KTA A;  1TWF B;  3QOL A;  1V1O A;  1P16 A;  2ES2 A;  3HOY B;  2GN5 A;  5M5W H;  3TP7 A;  2E8G A;  1SYF A;  2R93 B;  5C44 G;  1GUT A;  2SOB A;  2OTL A;  1HZA A;  3RLO A;  3OIQ A;  5DM7 3;  2R92 H;  3SEB A;  2VQF L;  4DV6 Q;  2NTT A;  4DUY L;  5C4J H;  4OX9 L;  1NR4 A;  3PCO B;  1QIL A;  3S9W A;  1IYJ B;  1VQJ A;  2E2J H;  1KDB A;  1ZKO A;  4IJH A;  4LF4 L;  1JJG A;  2QIL A;  2KHI A;  5GAD C;  2AMC B;  4KK7 A;  1B53 A;  5FKA C;  2C5C A;  3OWE B;  1I3Q H;  3CC7 A;  3KF6 B;  4YWM A;  1IHZ A;  1QWY A;  1Y8N B;  2NVY H;  4N8F A;  4LF8 Q;  2TMP A;  3RN2 A;  4CDC C;  5GAG C;  2PPB C;  1PDQ A;  4ZK9 B;  3S1R B;  2AKW B;  1HUN A;  5C4Z A;  3PMF A;  1EIF A;  3KJP A;  4WRD A;  3STB C;  1YBY A;  3DLL A;  1STH A;  1R9T H;  4KY5 A;  3G6J B;  3L3O C;  1J5E L;  2IW3 A;  2IPK D;  1X56 A;  1NE3 A;  1GOZ A;  2XWB B;  2B2Y A;  2EXD A;  1SXT A;  2K01 A;  3J7Z C;  4PV1 C;  2OXP A;  3T16 A;  3URY A;  5IYB G;  3A74 A;  4N9T A;  2XNA C;  4FDB A;  4HJ8 A;  4H7B A;  3FEW X;  1GM5 A;  3GTQ B;  1HNW L;  1II3 A;  4NMZ A;  3GTG B;  1KQS A;  5JJZ A;  3PIO A;  1LLR D;  1LUZ A;  1RIP A;  5C6A A;  4DV5 L;  3K0X A;  5EBC A;  2K28 A;  2VL6 A;  2DNE A;  1F9P A;  1QB5 D;  2ZXP A;  3M4P A;  1JJ2 A;  1HTL D;  1X55 A;  2A69 C;  1MIU A;  2PW5 A;  4L5S A;  2D5D A;  3RMH A;  1IBL L;  3RZD B;  1EWH A;  1JCK B;  2L11 A;  2Z9H A;  2RHQ B;  4FYD A;  1HTP A;  2R3Z A;  3CP0 A;  4DA2 A;  1V1P B;  2RSN A;  2R6G A;  1Q1E A;  1YNN C;  2PI2 A;  3PO2 G;  1HFN A;  3LWU A;  3ND9 A;  4KJO A;  4F7X A;  4LF6 Q;  1L1O B;  1DM0 B;  5COR A;  1UEA B;  2ID0 A;  4DAV A;  4UAI A;  5FO9 B;  1EY9 A;  3BDO A;  4GKK Q;  1SNM A;  4NXN L;  2F0T A;  3HOZ B;  2DY8 A;  2OTJ A;  3AFQ A;  1STY A;  2A6E D;  1XNQ Q;  2UU9 L;  2HCC A;  3K57 A;  1U4L A;  2AWO A;  4UP8 A;  4B3M Q;  3S14 B;  3OTO Q;  3ULP A;  2XRS D;  5T1I A;  2B2W A;  2Q2I A;  2HUG A;  3MFG A;  2NBF A;  1HR0 W;  3P20 A;  3GTK B;  2NVQ B;  3X3N A;  2FXQ A;  3VA7 A;  4DAP A;  2YYZ A;  2C35 B;  4JI1 L;  3Q23 A;  5D3D A;  3U9O A;  1HNZ Q;  4DNI A;  5C0X G;  4ZLT F;  1FJG L;  1JC7 A;  3KDF A;  3NBH A;  4DK0 A;  1D5X C;  4APV A;  4LF5 L;  1NMF A;  3CC2 A;  1LTT D;  1Z6H A;  2F52 A;  1EY7 A;  3H0G G;  1KDC A;  2Z6K C;  1H9S B;  1LTL A;  2JYO A;  3GQB A;  5M3F B;  1G8Z D;  1B1Z A;  1UAP A;  5D65 A;  1WCM B;  1A3V A;  1SBB B;  2F0S A;  4BY7 H;  4OO1 H;  1JB3 A;  5IGB A;  3J81 L;  4ZAI A;  1EWC A;  2MQH A;  1K3R A;  1X32 A;  4ODG A;  3TEH B;  1UNS A;  2FMC A;  1EYG A;  3OPO A;  5HGT A;  4LWC A;  4LF7 Q;  3CRK C;  5KYI A;  4PZ8 A;  2YU9 H;  1J8I A;  2G9D A;  1Q7Y C;  5JJI A;  3GTO H;  2AHO B;  4KMU C;  2XVS A;  4A3C H;  5G3L D;  1K0R A;  3NBI A;  2HT1 A;  2V1C C;  5F2D A;  2ICE C;  1WOC A;  2PCF B;  2RA4 A;  4FXG C;  1F9S A;  1TWA H;  1D6E C;  5M3M B;  1I94 L;  1D5Z C;  4A3K H;  4WFN 3;  1Y1W B;  2K7V A;  2X69 A;  1CKO A;  4XTC S;  1VF5 C;  1Q8I A;  2B2T C;  2F0V A;  1Q8K A;  3I4M G;  4GN3 B;  2F0Q A;  1ROD A;  2L1B A;  1F77 A;  3D3R A;  1Y69 U;  3I4O A;  1HHV A;  2OEO A;  1SRO A;  4K2L A;  1YJN A;  2BH2 A;  1OXS C;  1NJI C;  2B63 H;  1DYQ A;  5DLQ E;  4Y7N H;  5M5W B;  1PXU A;  4A3J G;  4MHE A;  2NTS A;  5AJ3 Q;  1AZP A;  4Z9C B;  3I4N B;  3MXG A;  3N52 A;  5C4J B;  2B39 A;  2CKZ B;  2P5Z X;  1PZI D;  3CCV A;  5A2Q L;  2VQE Q;  5E3F A;  4BA1 I;  4JYA Q;  3R3O A;  1AZQ A;  2K50 A;  1YJ9 A;  5IYD H;  4A3M H;  1PTO D;  3NQI A;  4AH6 A;  1CUK A;  4MTN A;  1EY4 A;  2F0E A;  3K80 C;  1C4Q A;  4R4C A;  3CW2 C;  4KHZ A;  3FKI G;  3WOE A;  2VB2 X;  2Z6K A;  3KLR A;  3MXN B;  4K0K L;  4F87 A;  4TKO B;  1R9T B;  4IQZ A;  1PZJ D;  2RHS B;  1Y1V H;  2QCP X;  2F1M A;  4TRD A;  2ENB A;  4QGU A;  3I72 A;  1IBK Q;  4EQ5 A;  1A2U A;  3QOJ A;  1SRU A;  2ZM6 Q;  3W5O A;  2JA8 H;  4B3R L;  3R2I A;  1J6Q A;  1N9W A;  2EJM A;  3ONA B;  3U58 A;  1E2W A;  1NUC A;  3CD6 A;  2F0K A;  2XRQ D;  2JA6 H;  1K83 H;  1KIX A;  2EZV A;  5C5L A;  4C3H H;  1S5E D;  1KTK A;  2Y0S G;  5FO8 B;  5GQO A;  1XPU A;  1UE5 A;  2CWP A;  1BXT A;  1RDP D;  3VA5 A;  3AMU A;  3HRZ C;  3HEJ A;  4KD4 A;  3CCE A;  5HUR A;  5D3I B;  1RKN A;  4A3I G;  2A6E C;  2B2T A;  3SR1 A;  2KQ3 A;  1BCP D;  1SJH D;  5DEH A;  2NZO A;  1BF4 A;  2SNM A;  3A0J A;  1KLG D;  4RGN A;  3A5U A;  1B50 A;  4LMQ D;  3WDN A;  1NY4 A;  4GZY C;  2PQA A;  5C3X A;  5CBE E;  4WJ3 M;  3OYY A;  1LT6 D;  5LMU L;  3OHX C;  4OON A;  3BZD B;  1A62 A;  4OL7 A;  1FD7 D;  2Z4I A;  3E0E A;  4GNX B;  1O7Z A;  5C4H A;  5I2Y A;  2E2D C;  4JBW A;  2JA7 B;  4YCV A;  3SK4 A;  4X66 L;  1WYD A;  5CMD A;  4DV3 L;  2WAC A;  4NB3 A;  5BR8 L;  1VQD A;  4BWG B;  1EQV A;  4EVO A;  5JVH 3;  3RZO H;  1SE4 A;  1Q86 C;  2I46 A;  3J81 j;  4DAY A;  5J1Z A;  3HS0 C;  3NBH B;  3KF8 B;  1UE6 A;  3CCL A;  2JA5 H;  1PYB A;  2CH4 W;  3KYH C;  1ONL A;  3L0O A;  3NK9 A;  3PUV A;  3IFD A;  1R4Q B;  2WII B;  4ZKB B;  2LS0 1;  1XMQ L;  1I6V C;  1PYS B;  2F0L A;  4DR5 Q;  4HCS A;  2LY7 A;  3BYT B;  2KVM A;  3H3V C;  5C4X G;  1YHB A;  2RBM A;  4BY7 B;  3MEF A;  1H9J A;  3PGZ A;  4C2M H;  1QVF A;  2UUA L;  1DD2 A;  2EOT A;  5DNF A;  2QA4 A;  3BVG A;  4GLA C;  1B2T A;  3EA6 A;  3HOX G;  3WWV A;  3HOY G;  1ENC A;  1T9H A;  4DPG A;  2YU9 B;  2R93 G;  1QVC A;  3A7A B;  4DV0 L;  1JIC A;  1KL9 A;  5I6W A;  3HP3 A;  3ULJ A;  3KLW A;  2AWN A;  3V96 A;  3F8T A;  3F2B A;  1N32 L;  4OIK A;  3TDQ A;  1WFQ A;  3OMG A;  1A6X A;  5EQ0 A;  2ZT9 C;  5EPK A;  4XT3 B;  2YV5 A;  1I6H H;  5K36 H;  4UPA A;  3AFP A;  4GKJ Q;  1IL8 A;  1L0X B;  2R7Z H;  4A76 A;  4KN7 C;  3IAY A;  4DK3 C;  1QNK A;  3GTP B;  2CWA A;  2RCF A; 
#chains in the Genus database with same CATH homology
 1FL0 A;  1GVP A;  1XMO Q;  1PH8 A;  3LGJ A;  1VQH A;  4A4I A;  1N36 Q;  4GNX A;  1OTC A;  2NVT H;  4YCU A;  2JA7 H;  5M3M H;  4A3D G;  5IT9 c;  1XPR A;  4JI2 Q;  2PMZ E;  2N49 A;  1VQO A;  4UY8 C;  1Y1W H;  1HNX Q;  3HKZ E;  1KRT A;  1JMC A;  3GDE A;  2CFM A;  4OXP A;  4AYB E;  3ERS X;  3U4V A;  1X3F A;  5HY6 A;  4X64 L;  4IOA A;  5IWA Q;  3TS0 A;  4DR1 L;  3I55 A;  1VQP A;  4O0A A;  2VZA A;  3ER0 A;  3M3Y H;  3HFZ B;  1Q1B A;  1YEZ A;  4X62 L;  1HJP A;  4P75 A;  3K81 C;  1Q81 C;  3KOJ A;  2LXK A;  4L5R C;  1A8V A;  1XNR Q;  1W3S A;  3TS2 A;  4OO1 G;  3CC4 A;  5JJL A;  1VS0 A;  4DV6 L;  4DR1 Q;  3H0G H;  4GOP C;  5M5Y H;  1YI2 A;  1P16 A;  2ES2 A;  1JE5 A;  3PF5 A;  2GN5 A;  4BBR H;  5M5W H;  3I7F A;  2E8G A;  5IP9 G;  1QUQ B;  5C44 G;  4GOP B;  1I5F A;  1N8R C;  2OTL A;  1K8A C;  1HZA A;  4JI5 Q;  1BBU A;  3RLO A;  4WJ4 A;  2E5L L;  2R92 H;  2VQF L;  4DV6 Q;  1E24 A;  1SFO H;  1PH5 A;  2QGQ A;  2KEN A;  5C4J H;  4DUY L;  1BKB A;  2RCN A;  4OX9 L;  3PCO B;  1PV4 A;  4LW1 A;  1IYJ B;  3H3V H;  1VQJ A;  2ZJP A;  4PG3 A;  2E2J H;  2N3S A;  5LMU Q;  4IPH A;  4H02 A;  4IJH A;  3G4S A;  1SR3 A;  4LF4 L;  1JJG A;  1NMG A;  2KHI A;  5GAD C;  2E5L Q;  2AMC B;  3CCU A;  2JJQ A;  1I3Q H;  3CC7 A;  3KF6 B;  3DM3 A;  2WB1 E;  4YWM A;  4EX5 A;  2NVY H;  2WAQ G;  4JG2 A;  5C0X I;  4LF8 Q;  4OX9 Q;  3BZK A;  3RN2 A;  5GAG C;  1VQC A;  2K4K A;  4A3K G;  4PZ6 A;  3W1B A;  4RMF A;  1AE3 A;  2AKW B;  3CQZ H;  4NPS A;  1H95 A;  2Q2U A;  1EIF A;  2UUC L;  3KJP A;  5EAY A;  3STB C;  1FGU A;  1YBY A;  4DKA C;  3DLL A;  2Y0S E;  1N34 L;  4BXX G;  1CSP A;  4LUV A;  1R9T H;  5IP7 G;  4DV3 Q;  3HOZ G;  1E3P A;  1M90 C;  4ME3 A;  3KDF B;  1J5E L;  1I50 H;  1C0A A;  2F4V L;  1NBW A;  2UUC Q;  2KCM A;  4A3L G;  1X56 A;  4MZ9 A;  1NE3 A;  2ASB A;  3IRB A;  2VS1 A;  2EXD A;  2K5H A;  3J7Z C;  3T1Y L;  2B63 G;  3HOW G;  4QIW E;  2BH8 A;  3E9H A;  2VNU D;  5IYB G;  3A74 A;  4JOI A;  3TRZ A;  4FDB A;  4HJ8 A;  2ZJR A;  2HHH L;  3GTP H;  1VQE A;  4YWL A;  2UXC Q;  5GAH C;  1GM5 A;  4A3F H;  1HNW L;  5C3E H;  1TWC H;  1KQS A;  3PIO A;  3PUW A;  1PH3 A;  4PMW A;  4DR7 Q;  1LUZ A;  1RIP A;  5IY0 A;  1MJC A;  4A93 H;  1XMQ Q;  4DV5 L;  3K0X A;  5AJ3 L;  1U0L A;  2VL6 A;  3CCR A;  1JJC B;  4JI3 Q;  3M4O H;  3FP9 A;  4QL5 A;  4LFC Q;  3M4P A;  1KHI A;  2CQO A;  1AE2 A;  1X55 A;  1E7Z A;  1JJ2 A;  1C9O A;  1MIU A;  1PH4 A;  2MNA A;  2UUA Q;  2MO1 A;  4L5S A;  1IBL L;  4DR2 Q;  4JYA L;  2K75 A;  1A0I A;  3CCQ A;  4DV5 Q;  4LF9 L;  3OW2 A;  4LF6 L;  1KAW A;  4L5T A;  2RHQ B;  4B3T Q;  2YTV A;  4DV4 L;  4IFD G;  4POG A;  1RL2 A;  1VQ5 A;  3CP0 A;  5M3F G;  2IX1 A;  1Z9F A;  4JC0 A;  1WCM G;  4JI6 L;  1TWF H;  1Q1E A;  2R6G A;  4LFB L;  1L1O C;  2BA1 A;  1C7Y A;  2PI2 A;  3HOU H;  3PO2 G;  4DV1 L;  1HZC A;  4DV0 Q;  3HOY H;  4LF6 Q;  4DK6 C;  1XJV A;  4A3B G;  1PH7 A;  1YJW A;  2R93 H;  1BBW A;  2ALY B;  2KBN A;  1Y1V G;  4JBK A;  1L1O B;  1XTD A;  1PH9 A;  1IBM L;  1QUQ A;  1EUJ A;  3Q8D A;  2ID0 A;  1HR0 Q;  4GOP A;  3EBE A;  1N32 Q;  4JI6 Q;  1YIT A;  4LFB Q;  4C3I H;  4GKK Q;  1IBK L;  4DV1 Q;  4NXN L;  4P73 A;  1HZ9 A;  3AYH B;  4L5Q A;  3CMA A;  2OTJ A;  2UXB Q;  2I5H A;  3CCJ A;  1Y14 B;  2R7D A;  3HOV H;  2JA8 G;  3AFQ A;  3NEL A;  3RR5 A;  4POF A;  4TVA B;  1IBM Q;  2UU9 L;  1MJE A;  1XNQ Q;  2R7Z G;  4IFD I;  2ZM6 L;  1GD7 A;  2VUM G;  2AWO A;  3AQQ A;  2JEA I;  1G29 1;  4UP8 A;  3S2D H;  3CPW A;  4B3M Q;  1YNX A;  3CPF A;  2JA6 G;  5GRO A;  2HIX A;  3S24 A;  3OTO Q;  3ULP A;  3UE1 A;  5M3M G;  3KF6 A;  2Q2I A;  1VQ8 A;  3CCS A;  1CKM A;  3GTL H;  1EFW A;  4KHP L;  1Y1W G;  1CSQ A;  2UU9 Q;  3S1R H;  1AH9 A;  2H5X A;  4YHH L;  1HNZ L;  1S3O A;  4JBJ A;  1HR0 W;  3RNU A;  1OXX K;  1L0W A;  1SE8 A;  2JEB I;  2FXQ A;  1CKN B;  2PI2 E;  2D0O A;  4KHP Q;  1EWI A;  2YYZ A;  2C35 B;  5E7N A;  4JI1 L;  2OQ0 A;  1HNZ Q;  4X64 Q;  3SGI A;  4DNI A;  5C0X G;  2XTI A;  1FJG L;  3KDF A;  3ICE A;  1UEB A;  4APV A;  4HIK A;  1NMF A;  4LF5 L;  3S1N H;  3CC2 A;  2F52 A;  4LUO A;  1UWV A;  4JI8 L;  4X62 Q;  4JBM A;  3PF4 A;  1KXL A;  3H0G G;  2Z6K C;  1QZG A;  4A3I H;  2I5M X;  4JI0 L;  1IXR A;  2R7F A;  1LTL A;  3I2Z A;  3G71 A;  4GN5 A;  2LXJ A;  4LF7 L;  1N33 L;  3GTQ H;  4IJL A;  3W1G A;  4BY7 H;  4OWT B;  4AQY L;  3GTG H;  3ZJY C;  3STB D;  2OCE A;  5LMN L;  1TXY A;  3GTJ H;  3I4N G;  1X3G A;  3J81 i;  1LYL A;  2MQH A;  1K3R A;  5FLM G;  4JI4 L;  3TEH B;  3S1Q H;  1EYG A;  1HH2 P;  4LWC A;  2VQF Q;  1YZ6 A;  4LF7 Q;  1Q46 A;  4C3J H;  3L7Z C;  1K73 C;  1PA6 A;  3D31 A;  4LFA L;  4DUY Q;  4AQY Q;  4PZ8 A;  3GD7 A;  2A19 A;  1B8A A;  2OWO A;  4A3E H;  2YU9 H;  1Q7Y C;  2UUB L;  2UXD L;  5JJI A;  4LF4 Q;  3GTO H;  2AHO B;  2IX0 A;  4A3C H;  4R1J A;  1K0R A;  2VW9 A;  2HT1 A;  1QZH A;  2IY5 B;  1EQR A;  2V1C C;  2N78 A;  4LFA Q;  4Y52 H;  2EQS A;  4X65 L;  4JI7 L;  3CCM A;  1WOC A;  3J81 c;  1VQK A;  1GKH A;  3K7A H;  1TWA H;  1I94 L;  3S1M H;  2K14 A;  3PSI A;  4A3K H;  4TQU S;  1YHA A;  3NEM A;  1TWH H;  3BZC A;  4HIM A;  1D7Q A;  2Q2H A;  2D62 A;  5J3B A;  3F2C A;  1N34 Q;  2A8V A;  2VY3 A;  1CKO A;  2MO0 A;  1D8L A;  4XTC S;  1S72 A;  4B3S L;  3AEV A;  1A63 A;  2ZTC A;  3CF5 A;  2HQL A;  2MFI A;  1Q8K A;  2JA5 G;  4LNQ A;  4BXX H;  2WFW A;  1J5E Q;  3I4M G;  4GN3 B;  1VQB A;  2D0P A;  5IP7 H;  3HOZ H;  2JE6 I;  2F4V Q;  4HJA A;  2Z0S A;  3I4O A;  1K8G A;  4KI0 A;  4HJ9 A;  3F2D A;  1SRO A;  2K5V A;  3T1Y Q;  4A3L H;  4QQB X;  4UP9 A;  4UP7 A;  3KJO A;  1YJN A;  4BY1 H;  2BH2 A;  1OXS C;  1NJI C;  2B63 H;  3HOW H;  3S14 H;  5C3E G;  2PNH A;  4QJF A;  3UE0 A;  4IFD J;  4DAM A;  2PQA B;  1VQL A;  1X54 A;  5DLQ E;  4A93 G;  4Y7N H;  4DV2 L;  1HNW Q;  1G51 A;  2VQE L;  1WJJ A;  5C4X H;  3G6E A;  3B6Y A;  4DV7 L;  4A3J G;  2IHF A;  1PFS A;  5AJ3 Q;  3GTK H;  3HKZ G;  2NVQ H;  2K5N A;  5JJK A;  1VQI A;  4DR3 L;  4YY3 L;  1CKN A;  2CKZ B;  2WAQ E;  1U5K A;  5H1S E;  3CCV A;  3HOX H;  2VQE Q;  4BA1 I;  1OXU A;  1IBL Q;  3PO3 H;  4JYA Q;  1IZ6 A;  1VCI A;  1X3E A;  4O2D A;  4LF9 Q;  2A1A A;  2K50 A;  5FJ8 G;  5FLX c;  4DV4 Q;  1YJ9 A;  5IYD H;  5ELN A;  4A3M H;  2E2I H;  1E22 A;  3TQY A;  5IE8 A;  1YIJ A;  4AH6 A;  4OWW B;  4BBS G;  1CUK A;  4MTN A;  5JEA G;  3EIV A;  5M3F H;  2EIF A;  1DGS A;  3PV0 A;  4P71 A;  1YHQ A;  3K80 C;  4R4C A;  3CW2 C;  4KHZ A;  3FKI G;  4K0K L;  2Z6K A;  4A3G H;  3MXN B;  5K36 G;  3PO2 H;  3I56 A;  1VQF A;  2KHJ A;  4IPC A;  4DAY B;  2RHS B;  1Y1V H;  4QGU A;  1ASZ A;  1TWG H;  1WI5 A;  3PUZ A;  1IBK Q;  4NXN Q;  4EQ5 A;  4QY7 A;  2JA7 G;  3CAM A;  1VQM A;  1M1K C;  1NTG A;  5IYC H;  4MNO A;  1SRU A;  2ZM6 Q;  3W5O A;  1V9P A;  4JI2 L;  2JA8 H;  4B3R L;  1J6Q A;  1N9W A;  3NEN A;  5C0X J;  4ALP A;  1HNX L;  4OWX B;  1UE1 A;  3U58 A;  2VUM H;  3CD6 A;  4A3D H;  4BA2 I;  1BVS A;  2F3I A;  2JA6 H;  3TRE A;  1K83 H;  3K7U C;  1IL2 A;  2L15 A;  4GLX A;  4AIM A;  4YCW A;  4YHH Q;  1EQQ A;  3M4Q A;  1KIX A;  5IWA L;  4X6A H;  1VQ6 A;  4B3R Q;  2I0Q A;  4C3H H;  4YWK A;  1PHJ A;  2Y0S G;  1UE7 A;  4DUZ L;  5GQO A;  3T1H L;  3PUY A;  1UE5 A;  3CME A;  1XPU A;  2N8N A;  1G6P A;  3S2H H;  2NN6 G;  2CWP A;  4JI1 Q;  3U50 C;  1O7I A;  3HKS A;  1XNR L;  3L2P A;  1PVO A;  3E9I A;  4BBR G;  3UDF A;  4R4Q A;  1FJG Q;  3CCE A;  4A3I G;  4LF5 Q;  1VQ9 A;  4DUZ Q;  1P8L A;  4KLK A;  3T1H Q;  3K8A A;  4JI8 Q;  4XIG S;  3RLF A;  2R92 G;  4JI5 L;  3BU2 A;  4JI0 Q;  4GLV B;  5M5X H;  5IP9 H;  2NZO A;  2ATW A;  4BY7 G;  3JAM i;  5ELO A;  3A0J A;  2GVB A;  2RF4 A;  5C44 H;  3A5U A;  4R4I A;  1N33 Q;  1NY4 A;  3M9B A;  4JCV E;  2PQA A;  2B3G A;  3KFU A;  2B29 A;  1V1Q A;  4DR4 L;  3RLN A;  3OYY A;  5LMN Q;  4IOC A;  4WJ3 M;  3RZD H;  1V43 A;  5LMU L;  2KCT A;  3J80 i;  4OON A;  2OQK A;  4J15 A;  4JI4 Q;  3I4N H;  1A62 A;  4GNX C;  2NN6 I;  4R4O A;  5FLM H;  4A3E G;  3E0E A;  2NZH A;  1B7Y B;  4LF8 L;  4DR4 Q;  4IPD A;  4GNX B;  2JQO A;  4A3C G;  1ASY A;  3VDY A;  2UUB Q;  2UXD Q;  3UDI A;  1L2F A;  4JBW A;  3JAM c;  4YCV A;  4JV5 L;  1LM0 A;  2JK8 A;  4X66 L;  2YTX A;  4OO1 I;  4X65 Q;  4JI7 Q;  1WYD A;  4DV3 L;  1L1O A;  3H3V I;  2K52 A;  1YVC A;  4NB3 A;  5LMN W;  3J80 c;  2YTY A;  2NVX H;  4HIO A;  3H15 A;  1X6O A;  1I94 Q;  5BR8 L;  1VQD A;  4JV5 Q;  2WP8 J;  3D0F A;  1XPO A;  3BJU A;  4X66 Q;  2ZTE A;  1PH1 A;  3RZO H;  1VQG A;  4R4T A;  1Q86 C;  1X9N A;  1KD1 C;  1X65 A;  4B3S Q;  1E1T A;  3F1Z A;  3J81 j;  1HZB A;  3RN5 A;  3NBH B;  4DR5 L;  2LSS A;  4A75 A;  4A3F G;  3UDG A;  3KF8 B;  3EN2 A;  5BR8 Q;  1UE6 A;  1JB7 A;  2CCZ A;  1OXT A;  3CCL A;  2JA5 H;  1FVI A;  1SN8 A;  1VQN A;  1PYB A;  5IYB H;  2UXC L;  3I4M H;  3A5Z B;  4BY1 G;  3ULL A;  4DR7 L;  2IT1 A;  1W2B A;  3KYH C;  3L0O A;  3PUV A;  1VQ4 A;  4RG1 A;  1XMQ L;  1SLJ A;  2DGY A;  3GO5 A;  1PYS B;  4DR5 Q;  2HHH Q;  4HJ7 A;  4JI3 L;  4LFC L;  5C4X G;  1YHB A;  3M85 A;  2HIV A;  3S16 H;  3MEF A;  1MKH A;  4DV2 Q;  1EIY B;  4AYB G;  2E2H H;  3PGZ A;  4C2M H;  2XGT A;  2UUA L;  1QVF A;  2ZJQ A;  1VQA A;  4DR2 L;  5JEA J;  3M7N A;  4DV7 Q;  1E1O A;  2QA4 A;  4B3T L;  4GLA C;  1Q12 A;  4A3J H;  3HOX G;  1PH2 A;  1SMX A;  3FHW A;  2Q2T A;  4DR6 L;  2IHE A;  2JA9 A;  2ZTD A;  5GAE C;  4HID A;  3WWV A;  4YY3 Q;  4HJ5 A;  4DR3 Q;  3PO3 G;  3HOU G;  4IO9 A;  3HOY G;  1VQ7 A;  2I5L X;  1T9H A;  4DPG A;  2R93 G;  5IYD G;  1QVC A;  4A3M G;  4DV0 L;  1S40 A;  3G48 A;  1KL9 A;  1WCM H;  1QVG A;  1Q82 C;  3PUX A;  3GTM H;  1PH6 A;  3ULJ A;  4DR6 Q;  3JC6 6;  3U4Z A;  4IPG A;  3KLW A;  4GS3 A;  1KRS A;  2AWN A;  3S17 H;  3F8T A;  4GN4 B;  2GVA A;  5FJ8 H;  3UDX A;  1HR0 L;  4A3B H;  3F2B A;  1N32 L;  1JT8 A;  2BA0 A;  4LUZ A;  4GKJ L;  1GO3 E;  3S15 H;  1WFQ A;  3CXC A;  4A3G G;  4GKK L;  3HOV G;  2DUD A;  1OXV A;  4BBS H;  3PIP A;  1Z47 A;  4NXM L;  4JOI C;  1K9M C;  4K0K Q;  2UXB L;  2YV5 A;  4P74 A;  1XMO L;  1XNQ L;  1I6H H;  1N36 L;  3J7A 5;  3FKI H;  4UPA A;  3AFP A;  4GKJ Q;  4B3M L;  2QEX A;  2R7Z H;  5HGQ A;  1B70 B;  4A76 A;  2WB1 G;  1EOV A;  5IYC G;  4DK3 C;  3OTO L;  4PZ7 A;  1KC8 C;  4P72 A;  4NXM Q;  2CWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...