4RHRA

Crystal structure of pltb
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
EWTGDNTNAYYSDEVISELHVGQIDTSPYFCIKTVKANGSGTPVVACAVSKQSIWAPSFKELLDQARYFYSTGQSVRIHVQKNIWTYPLFVNTFSANALVGLSSCSATQCFGPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative pertussis-like toxin subunit
publication title Host adaptation of a bacterial toxin from the human pathogen salmonella typhi.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Sugar binding protein
total genus 29
structure length 114
sequence length 114
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rhrA00
1CQVA 3BZDB 1PZKD 3BVMA 1AW7A 4O1NA 1MD2D 1PTOH 1D5ZC 1ET6A 1LTID 1LTGD 4RFBA 1XTCD 4RCOA 3MFGA 1PTOD 1CT1D 1EEID 1JR0D 1M4VA 1HA5A 1QILA 1I4HA 4RHRA 1JWUD 2SEBD 1JQYD 1FGBD 1CK1A 1BCPD 4TSSA 1BCPC 1F77A 1HQRD 1UUPA 4RGNA 1B1ZA 1S5CD 2G9HD 1RD9D 2Z8LA 1EWCA 4RGMA 2J4XA 3EFXD 2QEJC 2AQ2B 1CHQD 1HTLD 1GOZA 1LTAD 3R2IA 4OHJA 4L6TB 1FNUA 3SEBA 3BVZA 4BWGB 1I4QA 2RDHA 1FD7D 2CHBD 3W2DA 3BYTB 4RGTA 1LTSD 3BVGA 1LO5D 5D3DA 2NTTA 3R8BA 1D5XC 1EU3A 1JWSD 1STEA 5TSSA 2XRQD 3R2TA 1SJED 1SBBB 1PTOB 1SXTA 3OWEB 5D3IB 1PRTF 1PRTC 5ELDA 4C56C 1I4RA 2RDGA 1I4PA 1FNVA 2AQ3B 3V05A 3TSSA 1EFID 5ELCA 1BCPB 3GP7A 1TY2A 1KLUD 1DJRD 2R61A 2IJ0A 1SE4A 1TS5A 1SEBD 4ZYSA 2AQ1B 1UNSA 1I4GA 1ESFA 1B44D 5FK9C 1KLGD 1L0XB 3BYYB 3DWAA 3MC0B 1LTRD 1PYWD 4RH6A 4DXGA 1S5BD 1JWMD 4DXFA 1TS3A 1S5ED 5FKAC 1PZID 1SE2A 1TS4A 1LT5D 3URYA 2XRSD 1I4XA 3DWQA 1D6EC 1TY0A 1JCKB 4L63B 1LTTD 1PZJD 5I4DA 1PRTD 5ELBA 2XNAC 1T5XD 1PRTB 2O2LD 4RGOS 1V1PB 1BXTA 2QILA 1EEFD 1LT6D 1RF2D 1XXGA 1DYQA 1AN8A 2TSSA 2XN9C 1V1OA 3KLSX 3DWPA 1ENFA 1EU4A 1ET9A 1V1PA 1SE3A 1CHPD 1KTKA 2ICIA 1PTOF 1PTOC 5ELFA 2NTSA 3O13A 1RDPD 5ELEA 1S5DD 4UDUC 4K6LA 1G8ZD 1L0YB 2IPKD 1BCPF 3EA6A 4Z9CB 1LLRD 1TS2A 2WV6D 1S5FD 1SJHD 1FNWA 1HXYD 1LT4D 1D5MC 3CHBD 1LTBD 4RHSA 1RCVD 1LT3D
chains in the Genus database with same CATH superfamily
1H95A 3J80i 1XJVA 1VS0A 2YYZA 4DFAA 2VZAA 3HOZH 4R1JA 3CRKC 1DCZA 1EEID 3NPPA 4ZUJA 4RMFA 1GXDC 2F0VA 4IFDJ 2QDLA 2I5MX 2SEBD 2F0DA 1SMYD 4JW0A 2B29A 4I7AA 3NHHA 3X3MA 3CPWA 3OIPA 2PW7A 4Y52H 5KRUA 4LAAA 1F9QA 4LF7L 2EYLA 3TREA 3BVZA 3Q8DA 5J3BA 2VY3A 3JAME 1PH6A 1P8LA 4ZUIA 2CW0D 2E2IH 1DXMA 3R2TA 3T1YQ 1SXTA 4DR4L 1UE7A 5A2QL 1EY8A 3PIPA 1W6KA 3I8ZA 4DNRB 3FP9A 1PH3A 1V1QA 1TWFH 4IQZA 4K0KL 1KLUD 5LMNQ 2YU9B 2DNCA 2WFWA 1RTNA 3EQLC 4DF7A 1X32A 4C3IH 4NPSA 2K1BA 5HGTA 1QCBD 1SYBA 3H3VH 4H13C 1KHIA 2F0HA 3K7AH 4JI5Q 3MXNB 3NTHA 2X69A 4IFDG 3CPFA 1PZJD 2LY7A 4DV2L 2VQFQ 3NTIA 2O2LD 3M9BA 1Q86C 3GTLB 2RF4A 5C4JH 2ZM6L 2H1EA 3M4OB 1XXGA 2EY2A 1NY4A 4APVA 4KTAA 4A3EH 4OEMB 4XYQA 4R4IA 2O5JC 4ZQ3A 1FGUA 1O80A 2B2VC 1EY4A 3FRPB 5EQ0A 1GVPA 2DGYA 4WRDA 5KNDA 3VYRA 2YTYA 3TMEA 1A3UA 1B50A 1DOKA 3NEMA 2F0EA 1HNWQ 3S1QB 2E2JB 1PTOF 1HNXQ 2OQKA 2NTSA 5ELEA 4A3MH 2MUYA 2EJFC 2HCIA 4B3TL 1BCPF 3OMCA 1VQLA 3QO2A 1PYBA 2Z4HA 3I91A 2R7DA 3VYUA 4K8JA 5FLMG 1Y1WG 2A73B 1E3PA 1WD0A 1Z47A 2NB0A 5JAVA 1CZWA 3UDIA 1TVXA 4KKSA 1X3GA 1Y1VH 1UE1A 1PTOH 2F52A 3PSIA 2K5QA 3TQYA 4DK6C 5I6YA 4IPGA 3HOUB 3T16A 1UEAB 3TRZA 4A3LG 1IBLL 3EJIA 2IX0A 1JICA 4IFDI 4XT3B 3PV0A 1CHQD 1JE4A 3I4NG 1FNUA 1WTPA 2UXBL 4A3DH 2AWNA 4LF4Q 5EGTA 1VF7A 3HKZG 2KEEA 1F2LA 3T4AC 3S24A 1XNRL 2NTTA 4PMCA 1SNOA 4DAYA 5M5WB 1PRTF 1SNMA 5C44B 4G57A 3V05A 1H9SA 2VUMG 2DJFC 4LUZA 1SYGA 3PGZA 2B2VA 2OQ0A 2Z0SA 3AU7A 4X66Q 2ASBA 4BY7G 4BY1H 3S2HH 2AQ1B 3A5UA 1B53A 1K9MC 3TDQA 2VL6A 1A15A 1OXVA 3I3CA 5H1SE 3M3YB 5FKAC 2NWGA 2NVYB 1PFBA 4JV5Q 1JJ2A 1CI3M 3WWVA 4PV1C 4DV0L 5EPKA 2B63G 3J7A5 2EQSA 1LTTD 3T1HQ 1T5XD 3RLNA 2EY5A 5A35A 4KN4C 1VQNA 4JI6L 3MAQA 2JA7G 3L7ZC 5JEAH 3P20A 2O4XA 4IZ8A 3DWPA 4YCUA 2DJGC 4NB3A 1N33L 1SR3A 1SYEA 2EPBA 3A8KE 3S1NB 1WTVA 1KQSA 1YNND 1CA6A 4R4QA 5CBEE 5IYBH 4A76A 5FO7B 5CGKA 1LTLA 4B3MQ 2D0OA 4Z9CB 3STBC 3PF4A 1W3SA 3I4OA 3I73A 1FL0A 1PV4A 3RZOB 5IWAQ 2CQOA 1CQVA 4GOPB 2K14A 1K83B 1ENCA 1Q3LA 4GLXA 2X6GA 4JYAL 1C48A 4IPHA 2IT1A 2IWHA 4KY6A 3HOVB 2L12A 1HNWL 3VR4A 1JR0D 3J7AF 4A3BG 1GUNA 3SR1A 4CKBA 2YU9H 3OW2A 4X3SA 3OOCA 3L0OA 4OO1G 1S5CD 4P2CB 2DNEA 3CCUA 4B3SQ 3Q6SA 3M85A 2I0QA 2AQ2B 3HS0C 1GOZA 4NXNL 3TP6A 2KCCA 1SRUA 2UXDL 1STBA 4BWGB 1YHAA 4AH6A 1I94Q 3NP8A 4AQYL 1Q1BA 4C3HG 2LKVA 1PA6A 4QQBX 5FO8B 1E24A 3GTLH 4JI7Q 3DXJC 3M4OH 1HTPA 3D6WA 1I4RA 1S4ZA 2Q2HA 3MHBA 3HKSA 2Z6BA 4LF6L 2R61A 2ZTDA 2QEXA 1UNSA 2HCCA 2JN4A 2E2JH 3S1QH 3PO2G 5J39A 1EIFA 5C0XJ 3J80L 3CU7A 4ZCKA 1QVCA 4QF4A 1A3VA 2Z9HA 1U4RA 4FXKC 4JC0A 1L2FA 3J80c 3I2ZA 4LWCA 1Q46A 1U4MA 2PQEA 1DOMA 3H15A 5GROA 1X3QA 2JXMB 1EYDA 2RVLA 2IW3A 1EWHA 3I90A 1WTWA 2HHHQ 5ELOA 4YHHQ 3HOUH 1B9MA 3AFPA 3U58A 2RQXA 1O7LA 1HZCA 1JJCB 3HOWG 1KTKA 3L3OC 4KHPQ 2PQAB 1LM0A 4MN3A 4LF8L 5M9OA 4KV6A 4DUYL 1Z9FA 4JVZA 3SK8A 1YVCA 4OGQC 3PUZA 4L5SA 3F2BA 1AE3A 1M8AA 4JI0L 2K5NA 1AW7A 5C0XG 3B6YA 1HZAA 2CH4A 1S40A 4F8MA 5C4XB 5M5WH 1CFMA 1F2ZA 1GUGA 5C44H 4CGYB 1NBWA 3H0GG 3DM3A 4ZLTF 1Z7TA 2CWPA 1PXUA 4RHRA 4LFBQ 1A6XA 3AB9A 3A0JA 3QIAA 3M3YH 4N8FA 3K81C 2A69D 2NVYH 1Y8OB 1SE8A 4JI1Q 1VQMA 3TS2A 3BG3A 3SK6A 2C5CA 4TVAB 4PZ8A 1A2TA 3M7NA 1ML0D 4YWLA 4U68A 2OTJA 4KJOA 5C3EB 1NCVA 4JI8Q 2M00A 4HIKA 3MEFA 1A62A 1CKNB 4IUNA 3VA5A 4X3TA 1EFID 3PF5A 3W1BA 3K7UC 3FKIG 4DA2A 5KEEA 3S1NH 1GKHA 4OIJA 1B3AA 1B44D 3QR8A 3E6ZX 4KHVA 3CMAA 3KYHC 2NVQB 1K3BC 1WTRA 2NN6H 4CJ2C 1XNQL 1VF5C 5CV6A 1E1OA 1SFOB 1F9PA 5M5XB 5G3LD 4JBWA 2JA8B 3NWTA 3K5LA 1JCKB 2XWBB 3RZOH 1MJCA 1H9MA 1EY6A 3RUZA 1EEFD 2F0QA 1K83H 1PH4A 1IYUA 2GA4B 1X3EA 3CCSA 5T1IA 4KI0A 1I50B 3HOVH 4N8X1 3T51B 2E76C 3CKIB 2YV5A 4A3CG 1ET9A 1YJNA 1IBML 1N32Q 4HIMA 2L1BA 2LXJA 5IP7H 4CDDC 1IL8A 1I5FA 3OTOL 1IW7D 5EJWA 4P75A 4UY8C 2HT1A 1PH8A 1TU2B 3ND8A 1HXYD 3ULPA 1O7YA 1D5MC 3NBHB 4KK7A 4YIJA 1YHQA 1ZYRD 3QOLA 1GJXA 1LT3D 1Q82C 2HHHL 2VXWA 1KRSA 2G9DA 3Q22A 1HNZL 1SNDA 2ZJPA 3OWFA 5GAGC 5C4ZA 2IHEA 2K33A 3R3OA 4I7ZC 3J81E 4DV1L 4R4CA 1CK1A 4TSSA 3D4DA 2HUGA 1F77A 2AUKA 2JA5B 4L8JA 4DKAC 3HKZE 4TRDA 1XMQL 2R93B 4L6TB 4NXML 4IALA 4JI4Q 1EYGA 1I4QA 4R8IA 1PH1A 4A3JG 1R4QB 4DK3C 1QNKA 5IT9E 3S9WA 1D5XC 4P73A 1YBYA 2IHFA 3KDFA 3U9SA 3NXWA 1Y8NB 4HEDA 4GN4B 4UP7A 3G4SA 2RSNA 3UE1A 3G48A 3C46A 4LFBL 1C9OA 5CV7A 5KYIA 1EOTA 4KKUA 1W2BA 1VQ8A 2EY6A 1PYWD 2F4VL 1U4LA 2BE5C 2RA4A 3NUCA 1A63A 2PCFB 1B8AA 4C1NK 1SE2A 4KY5A 1KC8C 4IUTA 1Y69U 3G7LA 3E5SA 4DV7Q 2R6GA 2MJ8A 5IP9H 2N8NA 2R7FA 3HRZC 4Y7NB 2EYOA 2E2DC 1YI2A 5C4XH 1HPCA 2GN5A 1C7YA 3GTKB 4MIUA 2F0NA 2CQAA 3RN5A 1JORA 1ONLA 2MQHA 1GUSA 2F0PA 1V1PA 4J1MA 4NW2A 2A8VA 4XXEA 1RDPD 2H5XA 4JOIC 3GO5A 4UDUC 4K6DA 3D3RA 5DLQE 1TWGB 1EYAA 2K50A 4YCWA 2WB1B 1KABA 2DY7A 5L37A 1K28A 4DAYB 4BBRG 3CCRA 2RHQB 1G51A 4LFAL 1DONA 3JAMc 1P16A 2WINB 1IKLA 4NKLA 5IYCG 1H9SB 5C3EH 4RA8A 4JBKA 5KNBA 2Q8IB 3SGIA 3MVVA 2EE1A 2R92G 2HQEA 4RG1A 4B08A 3GTOB 2R7ZB 1XPOA 1CT1D 1VCIA 3TZUA 4BY7B 4X64L 1YNJC 3I4MG 2Y0SB 1HR0L 2WKDA 1NR2A 4GKKQ 1HQRD 2LS01 1SMXA 3TP7A 1ASYA 2NVQH 5EBCA 1C8CA 1LUZA 1NUCA 1KAWA 1SFOH 3BU2A 3R2IA 1WCMB 2KQ3A 1QOHA 1Z6HA 5M5XH 1HQMC 2JA8H 4DR5L 1E0BA 1UE5A 4QJFA 1H9JA 4K5WA 2FFKB 2JA6B 1VMPA 5G3LF 1JWSD 4DN4M 3HP3A 1KL9A 2B39A 3KF6A 5BN5A 1I50H 2AQ3B 3BDOA 3DHQA 4HJ9A 2RBMA 3ERSX 3GV3A 1JE5A 3D4WA 2F0JA 3I70A 1T5EA 4RH6A 3UDGA 4PG3A 4JOIA 4RWSC 1EUJA 1EY5A 2K5WA 2F0IA 3HGBA 1E7ZA 3T13A 3W5OA 5LMUL 2XRSD 1TXYA 3RN2A 4IOAA 4LFCL 4LF5Q 4UP9A 2E75C 3A56A 3I72A 4HTHA 3K0YA 3CD6A 2BCOA 4IUVA 1U9RA 2RSOA 1WYDA 2BA1A 3CC2A 1NSNS 3QWNA 1I6HB 4HIDA 3S16B 4K14A 1EZ8A 4GNXB 5C4HA 4B9WA 2Q2IA 4DV4Q 4HJ7A 4M1UB 3CW2C 1BBWA 1SE3A 3M7GA 4JI3L 1PTOC 3SXHA 2RCNA 2JA5H 1PH5A 1MIUA 1JB7A 2EXDA 2EIFA 2A68C 3S15B 1QVFA 2R93H 4C3IG 4CKEA 2B2TA 1S5FD 1FNWA 2PMZB 4C3JB 1LYLA 1RJTA 1VQKA 1X3FA 2HQLA 2JYOA 4XTCS 4OX9Q 2E5LL 4KN7C 2ID0A 4EQPA 4A3GB 5CYUA 4GLVB 1JOKA 3SDZA 3NELA 3QOJA 1JOQA 1JQYD 3ND9A 3PO2B 2F3VA 3EROA 1B1ZA 4ZKCB 4A3KG 1RD9D 3D6CA 1VQJA 4DR6L 1FR3A 3N52A 1SN8A 5IGGA 3M4YA 2KECA 4IO9A 4LF9Q 2RDHA 1CA5A 4RKBA 3MEHA 1BF4A 3KJPA 4HIOA 5DM63 5JJZA 4MTKA 2BH8A 3I7FA 1WOCA 4Y7NH 5I2YA 1SAPA 3ERQA 4DV5Q 4CBVA 3CCMA 1ASZA 2ENBA 3PO3B 3OWEB 1PRTC 3PIO3 4KD4A 2XIWA 1KNAA 3GTKH 4OL7A 4DR2L 4JI2L 1PMRA 1Y1VG 2AMCB 3NWSA 1DJRD 4DV3Q 1FYCA 5JPNC 2HD3A 2UUCL 1II3A 2DUDA 3DWAA 3H3VI 1VQAA 5GADC 5BN4A 4ZRZA 3C3LA 3A74A 2VQEQ 2EVBA 4FF3A 2K7VA 1EQRA 3AMUA 1CKMA 1TWGH 1HUMA 3VA7A 1HZ9A 3GTMB 2OEOA 1XYIA 4L63B 4A3IG 4XQNA 5JEAJ 1U5KA 3A54A 1HJPA 1XMOQ 4TKOB 1LT6D 5AJ3Q 1B2TA 3C1EA 2ZJRA 1E1TA 3GTOH 3G6JB 1N36Q 2KCMA 2R7ZH 1C0AA 3AQQA 3L2PA 1V1OA 1LABA 4BY7H 1ENFA 1X6OA 2JEAI 5IYDH 5CV5A 3RZDB 2WKCA 4BY1G 1HR0W 4KKTA 2IPKD 3A7LA 2N55A 4ME5A 4DUZQ 3T1YL 1MHWC 1WCMH 2ZT9C 1ILQA 4G4KA 3K80C 5EKLA 1F9SA 2D62A 4U673 1EIHA 1TQOA 1BVSA 2K32A 1ESRA 2MO0A 5LMNL 2JA6H 4O1NA 3KF8B 3MZ5A 4AYBG 3Q0AA 1AP0A 2J7ZA 4QB4A 1LTID 4V190 4A75A 1GUWA 4JI5L 1A0IA 5CV4A 1WTOA 3RD4A 1QILA 2BDOA 5JEAG 1SYFA 5D65A 3T53B 4DNIA 5D14A 4ULLA 1N8RC 4LUOA 2VQFL 1TWAB 4YWKA 1NTGA 5CV8A 4DR7Q 3NQTA 1VQ9A 3NQIA 4QL5A 4J8QA 4Q0FA 4A93B 2CHBD 4JCVE 3BYTB 2JE6I 4RGTA 1LTSD 4TQUS 1Q90A 4BXXH 3M4QA 1STEA 1RHPA 3D4RA 2H4OA 1GD7A 3HOXB 1HNXL 1A3TA 1JJGA 4QMGA 1AZQA 2X6LA 5HY6A 1I6HH 1K0RA 3S16H 2HIVA 2PNHA 1LV9A 4HMIA 2K28A 1IKMA 4CDCC 3GTJB 5E7NA 1EL0A 3X3NA 2MHVA 4LNQA 4BA2I 2JA9A 1Q7YC 1KAAA 5NUCA 2IX3A 1EIYB 5JJIA 1L0XB 1STNA 1E22A 1ZEQX 3G6EA 3LNNA 2A6HC 4OWTB 3DLLA 3VYTA 2B2WC 3S15H 2QDBA 2OXPA 1BBUA 1WTXA 3MWYW 3JAMi 1YITA 1TWHB 5I6WA 3H94A 3WDNA 4C3JH 5EPJA 4DV6Q 5M3FB 2PNRC 5C5LA 1N9WA 2EYHA 3GV6A 5C5MA 5IGEA 1YHBA 1GHJA 2P5ZX 2Q8TA 4B3RQ 1EFWA 4A3GH 4WJ3M 1ICWA 2ZXPA 3RLOA 4X6AH 3HEJA 5CBAE 5DNFA 1RKNA 4G7OC 4CDFC 1V9PA 3FPPA 3S2DB 1PDQA 2L11A 4LF4L 1A8VA 1NE3A 3PO2H 3Q23A 3P1HA 5M3MB 4GZYC 4CJ0B 1G8ZD 2I07B 1G6PA 4A3JB 5CV9A 2MPMA 3H09A 1XMOL 3KDFB 4QIWE 4R8NA 1LT4D 3PIOA 4X66L 4X62Q 2CKZB 4OO1I 2MGSA 4ZKBB 3MXPA 1SYDA 2N49A 3PO3H 1XPRA 2KHIA 2UXCQ 4FXDA 4JV5L 3MFYA 1AE2A 1EZ6A 2V1CC 2M9VA 4XQJA 1IYJB 3PMFA 2B2UC 2F3WA 4FP5D 2Z4IA 4NDXA 1D1IA 2LXKA 3T1HL 4BBSG 1RL2A 2B2WA 1BR9A 4GKJQ 4OXPA 1HTLD 1G2SA 4OHJA 1BOSA 4ZAIA 4WFN3 4HJ5A 3S1RB 1B4OA 3JC66 3GTMH 1QWYA 1VQBA 4PNYA 3W2DA 4FF2A 3CCEA 1WI5A 2HIXA 4GLAC 1EU3A 3HOYG 2B2YC 1J5EQ 1GUOA 2D5DA 3CRLC 4J15A 1J8IA 1E2ZA 2AUJD 3U9OA 1BUVT 1KDCA 4PZ7A 4B3ML 3GP7A 4DAMA 3UE0A 3U4ZA 3NENA 5F2DA 3L9AX 2IJ0A 1CKOA 2BA0A 2XTIA 1ESFA 5C44G 4NMZA 2KHJA 3RZDH 2L55A 4A3FB 5IWAL 5FJ8G 1O7ZA 1TS3A 1QB5D 5ISRA 5K36H 1YNNC 1KXLA 5EKKA 3PCOB 1LT5D 3URYA 5J22A 4DR1Q 2F0GA 1C4QA 5ELNA 5KNCA 1IL2A 1BO0A 4H0LC 3C2PA 2R92B 1AN8A 4DK1A 5LMNW 5IE8A 1EY0A 2F0TA 2XN9C 4B3SL 4OONA 3HZXA 3CAMA 4DNTB 3J81L 3ONAB 5E1FA 3VR5A 3GTGB 2UUAQ 2RKSA 4C2MB 1HZBA 5FO9B 1I94L 1J6QA 2LSSA 1EWIA 2B2UA 5C0XI 4X65Q 1TWAH 3J81c 5IGCA 4ABNA 3EA6A 4JI7L 1T9HA 2K01A 4O2DA 2FMMA 2HDMA 1LACA 5IT9L 3CQZB 1XTDA 1U0LA 2NN6G 4A93H 1GHKA 3DMUA 1RCVD 2EYMA 4ODGA 1O7IA 5IT9c 5GAHC 3HOXH 3E9HA 4QGUA 2B2YA 4JK1C 1DOLA 4RFBA 1IBKQ 5CORA 4G7ZC 4LJZC 3GTJH 1VQDA 3KBXA 2A6EC 2ES2A 1JWUD 4ZK9B 2N3SA 4GOPA 1R9TB 1CSQA 1FJGQ 3HOVG 5I9PA 5BR8Q 3M4PA 2ZXOA 3FHWA 2DY8A 1AEXA 1EY9A 2F0KA 3EFXD 1PH7A 5HGQA 4FF1A 1LTAD 2O5IC 3KBGA 2XSCA 1K8AC 1K3RA 1G91A 4HJ8A 5T1GA 5IGFA 4YHHL 1TWHH 4IURA 4HMJA 5KYLA 5M3FH 4FO2A 2K5VA 2KA7A 4HSVA 1G2TA 4YY3Q 4JBMA 4KHPL 4HCSA 5D3IB 2KOLA 5ELDA 3CC4A 2Q2UA 3EBEA 2FHTA 2SNMA 5IODA 3IL8A 3QJYA 4R9WA 1VQIA 3GTQB 3D0FA 3S2DH 1STAA 1I4GA 5FK9C 4XYOA 1SDFA 1QNUA 3IAYA 5C3XA 1WTQA 1JB3A 5M3MH 4IPDA 3J7AV 1XPUA 4A3JH 3K57A 3DWQA 3PUXA 4UP8A 1ZXTA 4HJAA 1EQTA 1QJOA 5ELBA 1B3QA 1WJJA 2XNAC 4RGOS 4PQXA 4LF7Q 1VQOA 1DYQA 2L15A 2TSSA 4HR7B 3KLSX 2E8GA 4JI1L 4PMBA 4XDXA 1NJIC 4QUCA 4OWWB 4CHTB 1NR4A 4DR4Q 4A3KB 1ZKOA 2YTXA 2ATWA 1Q8KA 1Y1WB 4JI8L 1MSGA 4K0KQ 1HFNA 3A8IE 2PPBC 4AIMA 3K0XA 3S1RH 4H7BA 4EQOA 2KCTA 2L9HA 4AYBE 3WOEA 3CHBD 2PQAA 1Q1EA 2IY5B 4E6IA 3BVMA 5FLXE 1SNQA 1UWVA 5K5PA 3W1GA 5IP9G 3MFGA 1HFGA 3NK9A 4QY7A 4DV2Q 2JEBI 2EZVA 5C4XG 2PI2A 1IXRA 1VQPA 1FGBD 3I4NB 3JAML 2EYJA 2WP8J 4A3FH 4K5XA 3HKZB 3D8GA 2QEJC 3WOFA 2EOTA 1A2UA 2K4KA 2NUCA 3H91A 3PUWA 2EYFA 1SSOA 1D2BA 4A3IB 1IZ6A 4FDBA 3S14B 2N78A 3BS1A 3R8BA 1H9RA 1QZGA 2VUMB 1Q8IA 4B3TQ 1G291 1SYCA 4X3UA 5BN3A 1N32L 2R92H 1CM9A 4P74A 2PZTA 2JP1A 3VR2A 1EQVA 5C3EG 3GTGH 1VQ6A 4ZYSA 4C2MH 1QZHA 1XWEA 3CP0A 3QG1A 2FMCA 5JVG3 2B2TC 5EBDA 1CKNA 1DGSA 2Q2TA 2B63B 1STGA 4IUPA 4RKLA 1PZID 3VR6A 1CZGA 5DEHA 1AH9A 5FOBB 3H3VC 4F7XA 3CQZH 1W6JA 3N6RA 1IBLQ 3TS0A 5I4DA 2JA7B 1VQHA 2Z6KA 3MA2B 1PRTB 1F2YA 4YWMA 3BJUA 3MXGA 3DM1A 3V2TA 1I3QB 3HOZG 2UXBQ 3EVQA 4IUQA 3KFUA 2JK8A 4DK0A 4IPCA 1XNRQ 4JI4L 1D7QA 3GTPB 1R9TH 2JQOA 1S5DD 4F87A 1TIID 2OCEA 3F1ZA 1L1OC 1LTBD 3AFQA 4RHSA 2NZOA 1PZKD 3OMGA 3CCVA 4A3BB 1TT2A 1V43A 3CCLA 4HAEA 4BA1I 4DV0Q 2A5HA 3NBHA 3DUZA 3GTQH 1SLJA 4DV7L 1BCPC 1UUPA 4B9XA 4JI6Q 3STBD 2G9HD 1EWCA 3OIQA 2XVSA 4IFDH 1EOVA 2C35B 2OF1A 4C3HB 1HCZA 2PW5A 1N33Q 2ICEC 1N34Q 2JA5G 4QUFA 5GAEC 1ENAA 3KLSA 1TKWB 4DR3Q 1D1KA 5COYA 1R4PB 2R93G 5CR3A 3A7AB 5JVH3 5IGDA 1H9KA 4JBJA 3P7JA 2OT2A 4HSPA 1CSPA 4A3EG 1VQ5A 4I65A 4MHEA 1I4PA 4A4IA 1M90C 2UU9Q 1TY2A 1VQGA 5EPLA 4DAPA 1VQ4A 3KLRA 1V8QA 3J81i 2A6HD 4JYAQ 4A3KH 2E2HB 4DXFA 2F0FA 2NYZD 4A3MG 5FLMH 1Y1WH 1STHA 3S1MB 3KJOA 5IGBA 5JPMC 1TS4A 3SE0A 1YZ6A 2EYPA 1QUQA 2KUMA 4POFA 1BKBA 2BOSA 1L1OA 2I5LX 5LHY1 3DEPA 3OSOA 1EQQA 3KLWA 4GKKL 4L5TA 4NXNQ 3CMEA 2XWJB 2UXDQ 3HOWB 4A3LH 3NE5B 3D31A 2XGTA 3OW7A 5A2QE 2Z1CA 3E0JA 4AQYQ 2Q8RE 4PZ6A 1PVOA 5KGUA 3HFZB 1PYSB 1D8LA 1VQEA 1HH2P 3I4NH 5JJLA 1WTHA 2GVAA 4FVMA 3OHXC 2QW7A 2E74C 2IX1A 4BBSB 3MXUA 4ILWA 3H6MA 3TEHB 1TS2A 4LF6Q 2WV6D 5M5YB 3EN2A 3TP8A 2EJGC 4A3DG 2MFIA 2PYKA 4O0AA 4A3IH 1K0SA 4O42A 3S14H 3BZDB 3HOYB 2VUMH 1HHVA 1YJWA 2WB1G 3H0GB 4H02A 2F0UA 1MD2D 1Y14B 5DAUA 1NMFA 1BBXC 4PMWA 2QA4A 1PH9A 3NSWA 1B70B 1HA6A 2C9OA 4HN7A 1I4HA 4S3SA 2R7ZG 2WAQG 2NZ1D 4LF5L 4RGNA 1SMYC 2Y0SG 4RGMA 2B63H 4POGA 2CVRA 4GNXC 3OYYA 5IYDG 1O78A 2CH4W 2KVMA 1EY7A 5LL6X 2F0WA 4UPAA 2JA7H 4DV4L 4LF8Q 1LO5D 1XX8A 1WCMG 2CW0C 2F4IA 3AYHB 1VMCA 2HDLA 1SJED 1SBBB 1K8GA 4FYDA 2K5DA 2I46A 4DUYQ 3FKIB 1I3QH 1OXTA 4C56C 3FPUB 3MTSA 1MBYA 2JA6G 1K8MA 2JJQA 4P72A 1DD2A 2K52A 1EYCA 1RIPA 2F0OA 4IJLA 3F8TA 1AFPA 1STYA 1TS5A 1SEBD 2F0LA 2FINB 5IIFA 4JI0Q 3GTPH 1OO9B 3BYYB 2I5HA 2PO4A 3C1FA 1E2VA 3E0EA 1M1KC 2UUBQ 1N34L 3S17B 2PZUA 1S5ED 5IYBG 4G7HC 4IOCA 5CMDA 4OX9L 4DR3L 1X9NA 1SNCA 4EQ5A 2CFMA 2M2LA 1I4XA 1PFSA 1D6EC 3E3XA 2FJ2A 1JT8A 4XT1B 3DEOA 1X65A 3K5MA 5E4XA 3CCQA 1S72A 2CCZA 1JOOA 2A1AA 2UU9L 4A3BH 4RCNA 2A74C 4BXXG 4R4TA 2OWOA 3TP5A 4OO1H 3TN2A 2EJMA 3UDXA 2JSOA 4LF9L 2N88A 1CHPD 2ICIA 4KD3A 3BZCA 3LWUA 4OIKA 1I6VC 3T56B 3J7ZC 1NMGA 3I55A 3OPOA 3KOJA 3A8JE 2R3ZA 1F9RA 2K6AA 4DV5L 1KD1C 1X3PA 1KRTA 2IL8A 2L4NA 4GNXA 3BDCA 3K8AA 4LMQD 4C3HH 3J7YW 1SJHD 1MKHA 2KHSA 4KHZA 3MXNA 4DV3L 2GVBA 2PI2E 4CJ1B 1XNQQ 2F0SA 3BZKA 4DGZA 2ZTEA 3EIVA 2B8GA 4C3JG 1UAPA 1LTGD 2VQEL 1XTCD 1K73C 4K2KA 2QGQA 5IY0A 2A6ED 2B8FA 2F03A 4MNOA 1VQFA 2SOBA 3GQBA 4A3GG 3K58A 1VQ7A 2ZJQA 1CTMA 1UE6A 5C6AA 3U4VA 2E2HH 2Z8LA 5CC4A 5HURA 5AJ3L 4EGVA 4LUVA 3CC7A 3S1MH 3SK4A 1N36L 1FD7D 1IBMQ 3A55A 1VDZA 5D3DA 5JJKA 2MO1A 2L5TA 3RLFA 4IN3A 3ITPA 1DZ1A 4EVOA 1RTOA 3OTOQ 3HOWH 2D0PA 1FNVA 2VS1A 4KY7A 4C1NI 2NZHA 3HOUG 3UI2A 4DUZL 1GM5A 5AFWA 3LWEA 4UHVA 3TBIB 3SVMA 3PO3G 1HNZQ 1KIXA 4RAUC 5J1ZA 3ULLA 1SROA 1LTRD 2MP1A 2KENA 1UEBA 4BBSH 4N9PA 4V0BA 2G5DA 4ID6A 1Q12A 3K6OA 3ZYYX 5M5YH 1PH2A 5C0XH 4DV1Q 3KK7A 2BDNA 3Q24A 2KBNA 4MZ9A 2VB2X 2F1MA 3E9IA 1V1PB 3HOYH 2YTVA 2QILA 3H0GH 1OTCA 2K03A 1Q81C 4CKCA 1KDAA 1XMQQ 3W3AA 5KIXA 4NXMQ 4GOPC 4DR7L 4K8IA 4WJ4A 1CUKA 3GDEA 2TMPA 3KUPA 2BE5D 4K5VA 2UUBL 3HG9A 1S3OA 1PLFA 1X54A 5E4WC 3CXCA 4XQQA 5FJ8H 1KNEA 1F2MA 4BBRB 2CWAA 4BS9A 3P75A 1SNPA 3J80E 3F2CA 3IKJA 4QIWB 1YNXA 3AEVA 2WIIB 2SDFA 5K36G 2F4VQ 4J6HA 2LFNA 2AKWB 2F0MA 1MJEA 1BNZA 3I4MB 1G6ZA 3FKIH 1NAPA 3I4LA 3UDFA 1ET6A 2NVXB 3VDYA 1M4VA 1MI2A 3V96A 3IFTA 3NTKA 1DM0B 2AWOA 3ICEA 3CCJA 2NVTB 3KF8A 1L0WA 1TWCB 4ME3A 4DV6L 3S17H 4X3KA 5E3FA 2J4XA 5GQOA 1OXUA 3KF6B 4WORA 3SEBA 1WVLA 1Y8PB 3PUYA 2K05A 4B3RL 1CQFA 4M8AA 4DAVA 1MGSA 4LK1C 1OXXK 4YCVA 1BQQT 1QG7A 3BVGA 3K5OA 2QF7A 1EIGA 3QB3A 4WJWA 5TSSA 3U50C 1VQCA 4A93G 4KJNA 3FMCA 1YNJD 3HOZB 1B7YB 2VNUD 4A3CH 2RDGA 5IOCA 2K04A 3BDLA 3HOXG 3ER0A 2PZWA 4LFAQ 4MTNA 3K5NA 3RNUA 1SE4A 1YIJA 1HRJA 1YEZA 2LMCB 3RR5A 2D9UA 4DXGA 5EKIA 4X62L 1JWMD 2ZTCA 3J81j 4FF4A 3F2DA 4X64Q 4JPBW 5IP7G 2J0TD 4F88A 3VR3A 1HR0Q 4Q5VA 1JMCA 1E2WA 1RODA 3SK5A 5FLXL 2UXCL 5EAYA 2E2IB 3ZJYC 3I56A 4DU9A 4KLKA 1RF2D 4FNFA 5FLXc 4DR5Q 5M3FG 4GKJL 2NN6I 1TWFB 4OWXB 4HCEA 5DM73 1FVIA 3PIP3 5C3WA 4C3IB 3O13A 4KMUC 4EX5A 5I9OA 4K6LA 3K7AB 1ICFB 4K2LA 1J5EL 1AZPA 1U4PA 4NP5A 3R93A 3TZDA 1LLRD 4GS3A 2WB1E 4GN3B 5M3MG 2MNAA 2EY1A 4N9TA 3FDTA 5JOBA 2SNSA 5C4JB 3RMHA 4A3EB 1D5ZC 5LMUQ 1QE6A 4ALPA 4RCOA 4DPGA 2WAQE 4LFCQ 1PTOD 2QKIC 4JG2A 2K5HA 1PHJA 2EXZA 1HA5A 2VB3X 2Y0SE 4DR1L 1MSHA 2EDGA 1BCPD 2A68D 1NNXA 2RCFA 3PQIA 4IUUA 1JC7A 1GO3E 1QVGA 2KCNA 4A3MB 1QUQB 4FXGC 1L1OB 2A69C 2Z6KC 3IRBA 2QCPX 3F2UA 3G71A 4JI3Q 2AHOB 3LGJA 4EQNA 2KJXA 2A19A 2UUAL 2K75A 2XRQD 1Y1VB 1PTOB 3CF5A 1K8OA 4X65L 1B9NA 2ZM6Q 1PFMA 2OTLA 3TSSA 5ELCA 1BCPB 3K59A 3ULJA 4P71A 1X56A 3A5ZB 2BH2A 2D2CC 1KLGD 3MC0B 2E5LQ 3SHLA 1S5BD 4GN5A 4L5RC 4BBRH 1BDOA 3VYSA 3IFDA 5IYCH 4A3DB 1PFNA 4XIGS 4A3FG 1IBKL 1TY0A 2NBFA 4L5QA 1PRTD 2ZXRA 1BXTA 1FJGL 4DR6Q 1WFQA 1WD1A 5LL6S 3FEWX 2V4DA 3I4MH 5BR8L 2VW9A 1HUNA 4IJHA 2RDFA 4H44C 4QCLA 3NBIA 1TR5A 2FXQA 2WACA 1KDBA 5I2XA 2NVXH 3PUVA 4OELB 3LX0A 4BY1B 3S2HB 1EU4A 4R4OA 1IYVA 1IHZA 2L0CA 2WAQB 1X55A 2KEDA 5ELFA 2ALYB 1J9OA 1OXSC 2NVTH 1GUTA 3FVQA 1TWCH 3GD7A 1L0YB 4CDEC 1YJ9A 1ILPA 4YY3L 4DR2Q 4JI2Q 2RHSB 1IW7C 2DN8A 4LW1A 2JA8G 2F3IA 2UUCQ 4AYBB 2B3GA 2PMZE 4UAIA 1ZYRC
chains in the Genus database with same CATH topology
2YYZA 4DFAA 3CRKC 1DCZA 1EEID 3NPPA 4ZUJA 1GXDC 2F0VA 4IFDJ 2SEBD 2F0DA 1SMYD 3NHHA 3X3MA 3OIPA 2PW7A 5KRUA 4LAAA 1F9QA 2EYLA 3BVZA 3JAME 4ZUIA 2CW0D 1DXMA 3R2TA 1SXTA 5A2QL 1EY8A 1W6KA 3I8ZA 4DNRB 4IQZA 1KLUD 2YU9B 2DNCA 1RTNA 3EQLC 4DF7A 1X32A 2K1BA 5HGTA 1QCBD 1SYBA 4H13C 2F0HA 3NTHA 2X69A 4IFDG 1PZJD 2LY7A 3NTIA 2O2LD 3GTLB 2H1EA 3M4OB 1XXGA 2EY2A 4KTAA 4XYQA 2O5JC 4ZQ3A 1O80A 2B2VC 1EY4A 3FRPB 5EQ0A 4WRDA 5KNDA 3VYRA 3TMEA 1A3UA 1B50A 1DOKA 2F0EA 3S1QB 2E2JB 1PTOF 2NTSA 5ELEA 2MUYA 2EJFC 2HCIA 1BCPF 3OMCA 3QO2A 2Z4HA 3I91A 3VYUA 4K8JA 2A73B 1WD0A 1Z47A 2NB0A 5JAVA 1CZWA 1TVXA 4KKSA 1PTOH 2K5QA 5I6YA 3HOUB 3T16A 1UEAB 3EJIA 2IX0A 1JICA 4IFDI 4XT3B 3PV0A 1CHQD 1JE4A 1FNUA 1WTPA 2AWNA 5EGTA 1VF7A 2KEEA 1F2LA 3T4AC 2NTTA 4PMCA 1SNOA 4DAYA 5M5WB 1PRTF 1SNMA 5C44B 4G57A 3V05A 1H9SA 1SYGA 2B2VA 3AU7A 2AQ1B 1B53A 3TDQA 1A15A 1OXVA 3I3CA 3M3YB 5FKAC 2NWGA 2NVYB 1PFBA 1CI3M 4PV1C 5EPKA 1LTTD 1T5XD 2EY5A 5A35A 4KN4C 3MAQA 3L7ZC 5JEAH 3P20A 2O4XA 4IZ8A 3DWPA 1SYEA 2EPBA 3A8KE 3S1NB 1WTVA 1YNND 1CA6A 5CBEE 5FO7B 5CGKA 4Z9CB 3I73A 3RZOB 1CQVA 1K83B 1ENCA 1Q3LA 2X6GA 1C48A 2IT1A 2IWHA 4KY6A 3HOVB 2L12A 3VR4A 1JR0D 3J7AF 1GUNA 3SR1A 4CKBA 4X3SA 3OOCA 4OO1G 1S5CD 4P2CB 2DNEA 3Q6SA 3M85A 2AQ2B 3HS0C 1GOZA 3TP6A 2KCCA 1STBA 4BWGB 3NP8A 1Q1BA 4C3HG 2LKVA 5FO8B 3DXJC 1HTPA 3D6WA 1I4RA 1S4ZA 3MHBA 2R61A 1UNSA 2HCCA 5J39A 5C0XJ 3J80L 3CU7A 4QF4A 1A3VA 1U4RA 4FXKC 2PQEA 1U4MA 1DOMA 1X3QA 2JXMB 1EYDA 2RVLA 2IW3A 1EWHA 3I90A 1WTWA 1B9MA 2RQXA 1O7LA 1KTKA 3L3OC 4MN3A 5M9OA 4KV6A 3SK8A 4OGQC 3PUZA 1M8AA 1AW7A 5C0XG 4F8MA 5C4XB 1CFMA 1F2ZA 1GUGA 4CGYB 4ZLTF 1Z7TA 1PXUA 4RHRA 1A6XA 3AB9A 3QIAA 2A69D 1Y8OB 3BG3A 3SK6A 2C5CA 1A2TA 3M7NA 1ML0D 4U68A 4KJOA 5C3EB 1NCVA 2M00A 4IUNA 3VA5A 4X3TA 1EFID 4DA2A 5KEEA 4OIJA 1B3AA 1B44D 4KHVA 3E6ZX 2NVQB 1WTRA 2NN6H 4CJ2C 1VF5C 5CV6A 1SFOB 1F9PA 5M5XB 5G3LD 4JBWA 2JA8B 3NWTA 3K5LA 1JCKB 2XWBB 1H9MA 1EY6A 3RUZA 1EEFD 2F0QA 1IYUA 2GA4B 5T1IA 4KI0A 1I50B 3T51B 2E76C 3CKIB 1ET9A 2L1BA 1IL8A 1IW7D 5EJWA 1TU2B 3ND8A 1HXYD 1O7YA 1D5MC 4KK7A 4YIJA 1ZYRD 3QOLA 1GJXA 1LT3D 2VXWA 2G9DA 3Q22A 1SNDA 3OWFA 5C4ZA 2K33A 3R3OA 4I7ZC 3J81E 4TSSA 1CK1A 3D4DA 2HUGA 1F77A 2AUKA 2JA5B 4L8JA 4TRDA 2R93B 4L6TB 4IALA 1I4QA 4R8IA 1R4QB 1QNKA 5IT9E 3S9WA 1D5XC 3U9SA 3NXWA 1Y8NB 4HEDA 2RSNA 3C46A 5CV7A 5KYIA 1EOTA 4KKUA 2EY6A 1PYWD 1U4LA 2BE5C 2RA4A 3NUCA 2PCFB 4C1NK 1SE2A 4KY5A 4IUTA 1Y69U 3G7LA 3E5SA 2R6GA 2MJ8A 4Y7NB 3HRZC 2EYOA 2E2DC 1HPCA 3GTKB 4MIUA 2F0NA 2CQAA 1JORA 1ONLA 1GUSA 2F0PA 1V1PA 4J1MA 4NW2A 4XXEA 1RDPD 4UDUC 3GO5A 4K6DA 3D3RA 1TWGB 1EYAA 2WB1B 1KABA 2DY7A 1DONA 2WINB 1IKLA 4NKLA 1H9SB 4RA8A 5KNBA 2Q8IB 3MVVA 2EE1A 2HQEA 4B08A 3GTOB 2R7ZB 1CT1D 1VCIA 3TZUA 4BY7B 1YNJC 2Y0SB 2WKDA 1NR2A 1HQRD 2LS01 3TP7A 5EBCA 1C8CA 1NUCA 3R2IA 1WCMB 2KQ3A 1QOHA 1Z6HA 1HQMC 1E0BA 1H9JA 4K5WA 2FFKB 2JA6B 1VMPA 5G3LF 1JWSD 4DN4M 3HP3A 2B39A 5BN5A 2AQ3B 3BDOA 3DHQA 2RBMA 3GV3A 3D4WA 2F0JA 3I70A 1T5EA 4RH6A 4RWSC 1EY5A 2K5WA 2F0IA 3HGBA 3T13A 2XRSD 2E75C 3A56A 3I72A 4HTHA 3K0YA 2BCOA 4IUVA 1U9RA 2RSOA 2BA1A 1NSNS 3QWNA 1I6HB 3S16B 4K14A 1EZ8A 5C4HA 4B9WA 4M1UB 1SE3A 3M7GA 1PTOC 3SXHA 2A68C 3S15B 4C3IG 4CKEA 2B2TA 1S5FD 1FNWA 2PMZB 4C3JB 1RJTA 2JYOA 4XTCS 4KN7C 2ID0A 4EQPA 4A3GB 5CYUA 1JOKA 3SDZA 3QOJA 1JOQA 1JQYD 3ND9A 3PO2B 2F3VA 3EROA 1B1ZA 4ZKCB 1RD9D 3D6CA 1FR3A 3N52A 5IGGA 3M4YA 2KECA 2RDHA 1CA5A 4RKBA 3MEHA 1BF4A 5DM63 5JJZA 5I2YA 1SAPA 3ERQA 4CBVA 2ENBA 3PO3B 3OWEB 1PRTC 3PIO3 4KD4A 2XIWA 1KNAA 4OL7A 1PMRA 3NWSA 1DJRD 1FYCA 5JPNC 1II3A 3DWAA 5BN4A 4ZRZA 3C3LA 2EVBA 4FF3A 2K7VA 3AMUA 1HUMA 3VA7A 3GTMB 2OEOA 1XYIA 4L63B 4XQNA 5JEAJ 3A54A 4TKOB 1LT6D 1B2TA 3C1EA 3G6JB 1V1OA 1LABA 1ENFA 2JEAI 5CV5A 3RZDB 2WKCA 4KKTA 2IPKD 3A7LA 2N55A 4ME5A 2ZT9C 1ILQA 4G4KA 5EKLA 1F9SA 2D62A 4U673 1EIHA 1TQOA 2K32A 1ESRA 4O1NA 3MZ5A 3Q0AA 1AP0A 2J7ZA 4QB4A 1LTID 4V190 1GUWA 1WTOA 5CV4A 3RD4A 1QILA 2BDOA 5JEAG 1SYFA 5D65A 3T53B 5D14A 4ULLA 1TWAB 5CV8A 3NQTA 3NQIA 4J8QA 4Q0FA 4A93B 2CHBD 3BYTB 2JE6I 4RGTA 1LTSD 4TQUS 1Q90A 1STEA 1RHPA 3D4RA 2H4OA 3HOXB 1A3TA 4QMGA 1AZQA 2X6LA 1LV9A 4HMIA 2K28A 1IKMA 3GTJB 1EL0A 3X3NA 2MHVA 4BA2I 1KAAA 5NUCA 2IX3A 1L0XB 1STNA 1ZEQX 3LNNA 2A6HC 3VYTA 2B2WC 2QDBA 2OXPA 1WTXA 3MWYW 1TWHB 5I6WA 3H94A 3WDNA 5EPJA 5M3FB 2PNRC 5C5LA 2EYHA 3GV6A 5C5MA 5IGEA 1GHJA 2Q8TA 1ICWA 2ZXPA 3HEJA 5CBAE 5DNFA 1RKNA 4G7OC 3FPPA 3S2DB 1PDQA 2L11A 3Q23A 3P1HA 5M3MB 4GZYC 4CJ0B 1G8ZD 2I07B 4A3JB 5CV9A 2MPMA 3H09A 4R8NA 1LT4D 4OO1I 2MGSA 4ZKBB 3MXPA 1SYDA 4FXDA 3MFYA 1EZ6A 4XQJA 2M9VA 2B2UC 3PMFA 2F3WA 4FP5D 2Z4IA 4NDXA 1D1IA 2B2WA 1BR9A 1HTLD 1G2SA 4OHJA 1BOSA 4ZAIA 4WFN3 3S1RB 1B4OA 1QWYA 4PNYA 3W2DA 4FF2A 1EU3A 2B2YC 1GUOA 2D5DA 3CRLC 1J8IA 1E2ZA 2AUJD 3U9OA 1BUVT 1KDCA 3GP7A 5F2DA 3L9AX 2IJ0A 2BA0A 1ESFA 4NMZA 2L55A 4A3FB 1O7ZA 1TS3A 1QB5D 5ISRA 5K36H 1YNNC 5EKKA 1LT5D 3URYA 5J22A 2F0GA 1C4QA 5KNCA 1BO0A 4H0LC 3C2PA 2R92B 1AN8A 4DK1A 1EY0A 2F0TA 2XN9C 3HZXA 4DNTB 3J81L 3ONAB 5E1FA 3VR5A 3GTGB 2RKSA 4C2MB 5FO9B 2B2UA 5C0XI 5IGCA 4ABNA 3EA6A 2K01A 2FMMA 2HDMA 1LACA 5IT9L 3CQZB 2NN6G 1GHKA 3DMUA 1RCVD 2EYMA 4ODGA 2B2YA 4JK1C 1DOLA 4RFBA 5CORA 4G7ZC 4LJZC 3KBXA 2A6EC 1JWUD 4ZK9B 1R9TB 5I9PA 2ZXOA 2DY8A 1AEXA 1EY9A 2F0KA 3EFXD 4FF1A 1LTAD 2O5IC 3KBGA 2XSCA 1G91A 5T1GA 5IGFA 4IURA 4HMJA 5KYLA 4FO2A 2KA7A 4HSVA 1G2TA 4HCSA 5D3IB 2KOLA 5ELDA 2FHTA 2SNMA 5IODA 3IL8A 3QJYA 4R9WA 3GTQB 1STAA 1I4GA 5FK9C 4XYOA 1SDFA 1QNUA 3IAYA 5C3XA 1WTQA 1JB3A 3J7AV 3K57A 3DWQA 3PUXA 1ZXTA 1EQTA 1QJOA 5ELBA 2XNAC 4RGOS 4PQXA 1DYQA 2TSSA 4HR7B 3KLSX 4PMBA 4XDXA 4QUCA 4CHTB 1NR4A 4A3KB 1ZKOA 1Y1WB 1MSGA 1HFNA 3A8IE 2PPBC 4H7BA 4EQOA 2L9HA 3WOEA 3CHBD 1Q1EA 4E6IA 3BVMA 5FLXE 1SNQA 5K5PA 3MFGA 1HFGA 3NK9A 2JEBI 2EZVA 1FGBD 3I4NB 3JAML 2EYJA 2WP8J 4K5XA 3HKZB 3D8GA 2QEJC 3WOFA 2EOTA 1A2UA 2NUCA 3H91A 3PUWA 2EYFA 1SSOA 1D2BA 4A3IB 3S14B 3BS1A 3R8BA 1H9RA 2VUMB 1Q8IA 1G291 1SYCA 4X3UA 5BN3A 1CM9A 2PZTA 2JP1A 3VR2A 1EQVA 4ZYSA 1XWEA 3QG1A 2FMCA 5JVG3 2B2TC 5EBDA 2B63B 1STGA 4IUPA 4RKLA 1PZID 3VR6A 1CZGA 5DEHA 5FOBB 3H3VC 4F7XA 1W6JA 3N6RA 2JA7B 5I4DA 3MA2B 1PRTB 1F2YA 3MXGA 3DM1A 3V2TA 1I3QB 3EVQA 4IUQA 4DK0A 3GTPB 1S5DD 4F87A 1TIID 1LTBD 4RHSA 1PZKD 3OMGA 4A3BB 1TT2A 1V43A 4HAEA 4BA1I 2A5HA 3NBHA 3DUZA 1BCPC 1UUPA 4B9XA 2G9HD 1EWCA 3OIQA 2XVSA 4IFDH 2OF1A 4C3HB 1HCZA 2PW5A 2ICEC 4QUFA 1ENAA 3KLSA 1TKWB 1D1KA 5COYA 1R4PB 5CR3A 3A7AB 5JVH3 5IGDA 1H9KA 3P7JA 2OT2A 4HSPA 4I65A 4MHEA 1I4PA 1TY2A 5EPLA 4DAPA 3KLRA 1V8QA 2A6HD 2E2HB 4DXFA 2F0FA 2NYZD 1STHA 3S1MB 5IGBA 5JPMC 1TS4A 3SE0A 2EYPA 2KUMA 2BOSA 5LHY1 3DEPA 3OSOA 2XWJB 3HOWB 3NE5B 3D31A 3OW7A 5A2QE 2Z1CA 3E0JA 2Q8RE 5KGUA 3OHXC 4FVMA 2E74C 2IX1A 4BBSB 3MXUA 4ILWA 3H6MA 1TS2A 2WV6D 5M5YB 3TP8A 2EJGC 2PYKA 4O42A 3BZDB 3HOYB 1HHVA 3H0GB 2F0UA 1MD2D 5DAUA 1BBXC 4PMWA 3NSWA 1HA6A 2C9OA 4HN7A 1I4HA 4S3SA 2NZ1D 4RGNA 1SMYC 4RGMA 2CVRA 1O78A 2KVMA 1EY7A 5LL6X 2F0WA 1LO5D 1XX8A 2CW0C 2F4IA 1VMCA 2HDLA 1SJED 1SBBB 4FYDA 2K5DA 2I46A 3FKIB 1OXTA 4C56C 3FPUB 3MTSA 1MBYA 1K8MA 1DD2A 1EYCA 2F0OA 1AFPA 1STYA 1TS5A 1SEBD 2F0LA 2FINB 5IIFA 1OO9B 3BYYB 2PO4A 3C1FA 1E2VA 3S17B 2PZUA 1S5ED 4G7HC 5CMDA 1SNCA 2M2LA 1I4XA 1D6EC 2FJ2A 4XT1B 3DEOA 3K5MA 5E4XA 1JOOA 4RCNA 2A74C 3TP5A 4OO1H 3TN2A 2EJMA 2JSOA 2N88A 1CHPD 2ICIA 4KD3A 3T56B 3LWUA 4OIKA 1I6VC 3OPOA 3A8JE 2R3ZA 1F9RA 2K6AA 1X3PA 2IL8A 2L4NA 3BDCA 4LMQD 3J7YW 1SJHD 2KHSA 4KHZA 3MXNA 4CJ1B 2F0SA 4DGZA 2B8GA 4C3JG 1UAPA 1LTGD 1XTCD 4K2KA 2A6ED 2B8FA 2F03A 2SOBA 3GQBA 3K58A 1CTMA 5C6AA 2Z8LA 5CC4A 5HURA 4EGVA 3SK4A 1FD7D 3A55A 1VDZA 5D3DA 2L5TA 3RLFA 4IN3A 3ITPA 1DZ1A 4EVOA 1RTOA 1FNVA 4KY7A 4C1NI 3UI2A 5AFWA 3LWEA 3TBIB 3SVMA 4RAUC 5J1ZA 1LTRD 2MP1A 4N9PA 4V0BA 4ID6A 1Q12A 3K6OA 3ZYYX 5C0XH 3KK7A 2BDNA 3Q24A 2VB2X 2F1MA 1V1PB 2QILA 2K03A 4CKCA 1KDAA 3W3AA 5KIXA 4K8IA 2TMPA 3KUPA 2BE5D 4K5VA 3HG9A 1PLFA 5E4WC 4XQQA 1KNEA 1F2MA 4BBRB 4BS9A 3P75A 1SNPA 3J80E 3IKJA 4QIWB 2WIIB 2SDFA 5K36G 4J6HA 2LFNA 2F0MA 1BNZA 3I4MB 1G6ZA 3I4LA 1NAPA 1ET6A 2NVXB 1M4VA 1MI2A 3V96A 3IFTA 3NTKA 1DM0B 2AWOA 2NVTB 3KF8A 1TWCB 4X3KA 5E3FA 2J4XA 1OXUA 3SEBA 4WORA 1WVLA 1Y8PB 3PUYA 2K05A 1CQFA 4M8AA 4DAVA 1MGSA 4LK1C 1OXXK 1BQQT 1QG7A 3BVGA 3K5OA 2QF7A 1EIGA 3QB3A 4WJWA 5TSSA 4KJNA 3FMCA 1YNJD 3HOZB 2VNUD 2RDGA 5IOCA 2K04A 3BDLA 2PZWA 3K5NA 1SE4A 1HRJA 2LMCB 2D9UA 4DXGA 5EKIA 1JWMD 4FF4A 2J0TD 4F88A 3VR3A 4Q5VA 1E2WA 1RODA 3SK5A 5FLXL 2E2IB 4DU9A 1RF2D 4FNFA 2NN6I 1TWFB 4HCEA 5DM73 3PIP3 5C3WA 4C3IB 3O13A 4KMUC 5I9OA 4K6LA 3K7AB 4K2LA 1AZPA 1U4PA 4NP5A 3R93A 3TZDA 1LLRD 2EY1A 4N9TA 3FDTA 5JOBA 2SNSA 5C4JB 3RMHA 4A3EB 1D5ZC 1QE6A 4RCOA 1PTOD 2QKIC 2EXZA 1HA5A 2VB3X 1MSHA 2EDGA 1BCPD 2A68D 4IUUA 1JC7A 2KCNA 4A3MB 4FXGC 2A69C 2QCPX 3F2UA 4EQNA 2KJXA 2XRQD 1Y1VB 1PTOB 1K8OA 1B9NA 1PFMA 3TSSA 5ELCA 1BCPB 3K59A 2D2CC 1KLGD 3MC0B 3SHLA 1S5BD 1BDOA 3VYSA 3IFDA 4A3DB 1PFNA 4XIGS 1TY0A 2NBFA 1PRTD 2ZXRA 1BXTA 1WD1A 5LL6S 3FEWX 2V4DA 1HUNA 2RDFA 4H44C 4QCLA 3NBIA 1TR5A 2WACA 1KDBA 5I2XA 3PUVA 3LX0A 4BY1B 3S2HB 1EU4A 1IYVA 1IHZA 2L0CA 2WAQB 2KEDA 5ELFA 1J9OA 1OXSC 1GUTA 3FVQA 3GD7A 1L0YB 1ILPA 1IW7C 2DN8A 4AYBB 4UAIA 1ZYRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CQV A;  3BZD B;  1PZK D;  3BVM A;  1AW7 A;  4O1N A;  1MD2 D;  1PTO H;  1D5Z C;  1ET6 A;  1LTI D;  1LTG D;  4RFB A;  1XTC D;  4RCO A;  3MFG A;  1PTO D;  1CT1 D;  1EEI D;  1JR0 D;  1M4V A;  1HA5 A;  1QIL A;  1I4H A;  4RHR A;  1JWU D;  2SEB D;  1JQY D;  1FGB D;  1CK1 A;  1BCP D;  4TSS A;  1BCP C;  1F77 A;  1HQR D;  1UUP A;  4RGN A;  1B1Z A;  1S5C D;  2G9H D;  1RD9 D;  2Z8L A;  1EWC A;  4RGM A;  2J4X A;  3EFX D;  2QEJ C;  2AQ2 B;  1CHQ D;  1HTL D;  1GOZ A;  1LTA D;  3R2I A;  4OHJ A;  4L6T B;  1FNU A;  3SEB A;  3BVZ A;  4BWG B;  1I4Q A;  2RDH A;  1FD7 D;  2CHB D;  3W2D A;  3BYT B;  4RGT A;  1LTS D;  3BVG A;  1LO5 D;  5D3D A;  2NTT A;  3R8B A;  1D5X C;  1EU3 A;  1JWS D;  1STE A;  5TSS A;  2XRQ D;  3R2T A;  1SJE D;  1SBB B;  1PTO B;  1SXT A;  3OWE B;  5D3I B;  1PRT F;  1PRT C;  5ELD A;  4C56 C;  1I4R A;  2RDG A;  1I4P A;  1FNV A;  2AQ3 B;  3V05 A;  3TSS A;  1EFI D;  5ELC A;  1BCP B;  3GP7 A;  1TY2 A;  1KLU D;  1DJR D;  2R61 A;  2IJ0 A;  1SE4 A;  1TS5 A;  1SEB D;  4ZYS A;  2AQ1 B;  1UNS A;  1I4G A;  1ESF A;  1B44 D;  5FK9 C;  1KLG D;  1L0X B;  3BYY B;  3DWA A;  3MC0 B;  1LTR D;  1PYW D;  4RH6 A;  4DXG A;  1S5B D;  1JWM D;  4DXF A;  1TS3 A;  1S5E D;  5FKA C;  1PZI D;  1SE2 A;  1TS4 A;  1LT5 D;  3URY A;  2XRS D;  1I4X A;  3DWQ A;  1D6E C;  1TY0 A;  1JCK B;  4L63 B;  1LTT D;  1PZJ D;  5I4D A;  1PRT D;  5ELB A;  2XNA C;  1T5X D;  1PRT B;  2O2L D;  4RGO S;  1V1P B;  1BXT A;  2QIL A;  1EEF D;  1LT6 D;  1RF2 D;  1XXG A;  1DYQ A;  1AN8 A;  2TSS A;  2XN9 C;  1V1O A;  3KLS X;  3DWP A;  1ENF A;  1EU4 A;  1ET9 A;  1V1P A;  1SE3 A;  1CHP D;  1KTK A;  2ICI A;  1PTO F;  1PTO C;  5ELF A;  2NTS A;  3O13 A;  1RDP D;  5ELE A;  1S5D D;  4UDU C;  4K6L A;  1G8Z D;  1L0Y B;  2IPK D;  1BCP F;  3EA6 A;  4Z9C B;  1LLR D;  1TS2 A;  2WV6 D;  1S5F D;  1SJH D;  1FNW A;  1HXY D;  1LT4 D;  1D5M C;  3CHB D;  1LTB D;  4RHS A;  1RCV D;  1LT3 D; 
#chains in the Genus database with same CATH topology
 1H95 A;  3J80 i;  1XJV A;  1VS0 A;  2YYZ A;  4DFA A;  2VZA A;  3HOZ H;  4R1J A;  3CRK C;  1DCZ A;  1EEI D;  3NPP A;  4ZUJ A;  4RMF A;  1GXD C;  2F0V A;  4IFD J;  2QDL A;  2I5M X;  2SEB D;  2F0D A;  1SMY D;  4JW0 A;  2B29 A;  4I7A A;  3NHH A;  3X3M A;  3CPW A;  3OIP A;  2PW7 A;  4Y52 H;  5KRU A;  4LAA A;  1F9Q A;  4LF7 L;  2EYL A;  3TRE A;  3BVZ A;  3Q8D A;  5J3B A;  2VY3 A;  3JAM E;  1PH6 A;  1P8L A;  4ZUI A;  2CW0 D;  2E2I H;  1DXM A;  3R2T A;  3T1Y Q;  1SXT A;  4DR4 L;  1UE7 A;  5A2Q L;  1EY8 A;  3PIP A;  1W6K A;  3I8Z A;  4DNR B;  3FP9 A;  1PH3 A;  1V1Q A;  1TWF H;  4IQZ A;  4K0K L;  1KLU D;  5LMN Q;  2YU9 B;  2DNC A;  2WFW A;  1RTN A;  3EQL C;  4DF7 A;  1X32 A;  4C3I H;  4NPS A;  2K1B A;  5HGT A;  1QCB D;  1SYB A;  3H3V H;  4H13 C;  1KHI A;  2F0H A;  3K7A H;  4JI5 Q;  3MXN B;  3NTH A;  2X69 A;  4IFD G;  3CPF A;  1PZJ D;  2LY7 A;  4DV2 L;  2VQF Q;  3NTI A;  2O2L D;  3M9B A;  1Q86 C;  3GTL B;  2RF4 A;  5C4J H;  2ZM6 L;  2H1E A;  3M4O B;  1XXG A;  2EY2 A;  1NY4 A;  4APV A;  4KTA A;  4A3E H;  4OEM B;  4XYQ A;  4R4I A;  2O5J C;  4ZQ3 A;  1FGU A;  1O80 A;  2B2V C;  1EY4 A;  3FRP B;  5EQ0 A;  1GVP A;  2DGY A;  4WRD A;  5KND A;  3VYR A;  2YTY A;  3TME A;  1A3U A;  1B50 A;  1DOK A;  3NEM A;  2F0E A;  1HNW Q;  3S1Q B;  2E2J B;  1PTO F;  1HNX Q;  2OQK A;  2NTS A;  5ELE A;  4A3M H;  2MUY A;  2EJF C;  2HCI A;  4B3T L;  1BCP F;  3OMC A;  1VQL A;  3QO2 A;  1PYB A;  2Z4H A;  3I91 A;  2R7D A;  3VYU A;  4K8J A;  5FLM G;  1Y1W G;  2A73 B;  1E3P A;  1WD0 A;  1Z47 A;  2NB0 A;  5JAV A;  1CZW A;  3UDI A;  1TVX A;  4KKS A;  1X3G A;  1Y1V H;  1UE1 A;  1PTO H;  2F52 A;  3PSI A;  2K5Q A;  3TQY A;  4DK6 C;  5I6Y A;  4IPG A;  3HOU B;  3T16 A;  1UEA B;  3TRZ A;  4A3L G;  1IBL L;  3EJI A;  2IX0 A;  1JIC A;  4IFD I;  4XT3 B;  3PV0 A;  1CHQ D;  1JE4 A;  3I4N G;  1FNU A;  1WTP A;  2UXB L;  4A3D H;  2AWN A;  4LF4 Q;  5EGT A;  1VF7 A;  3HKZ G;  2KEE A;  1F2L A;  3T4A C;  3S24 A;  1XNR L;  2NTT A;  4PMC A;  1SNO A;  4DAY A;  5M5W B;  1PRT F;  1SNM A;  5C44 B;  4G57 A;  3V05 A;  1H9S A;  2VUM G;  2DJF C;  4LUZ A;  1SYG A;  3PGZ A;  2B2V A;  2OQ0 A;  2Z0S A;  3AU7 A;  4X66 Q;  2ASB A;  4BY7 G;  4BY1 H;  3S2H H;  2AQ1 B;  3A5U A;  1B53 A;  1K9M C;  3TDQ A;  2VL6 A;  1A15 A;  1OXV A;  3I3C A;  5H1S E;  3M3Y B;  5FKA C;  2NWG A;  2NVY B;  1PFB A;  4JV5 Q;  1JJ2 A;  1CI3 M;  3WWV A;  4PV1 C;  4DV0 L;  5EPK A;  2B63 G;  3J7A 5;  2EQS A;  1LTT D;  3T1H Q;  1T5X D;  3RLN A;  2EY5 A;  5A35 A;  4KN4 C;  1VQN A;  4JI6 L;  3MAQ A;  2JA7 G;  3L7Z C;  5JEA H;  3P20 A;  2O4X A;  4IZ8 A;  3DWP A;  4YCU A;  2DJG C;  4NB3 A;  1N33 L;  1SR3 A;  1SYE A;  2EPB A;  3A8K E;  3S1N B;  1WTV A;  1KQS A;  1YNN D;  1CA6 A;  4R4Q A;  5CBE E;  5IYB H;  4A76 A;  5FO7 B;  5CGK A;  1LTL A;  4B3M Q;  2D0O A;  4Z9C B;  3STB C;  3PF4 A;  1W3S A;  3I4O A;  3I73 A;  1FL0 A;  1PV4 A;  3RZO B;  5IWA Q;  2CQO A;  1CQV A;  4GOP B;  2K14 A;  1K83 B;  1ENC A;  1Q3L A;  4GLX A;  2X6G A;  4JYA L;  1C48 A;  4IPH A;  2IT1 A;  2IWH A;  4KY6 A;  3HOV B;  2L12 A;  1HNW L;  3VR4 A;  1JR0 D;  3J7A F;  4A3B G;  1GUN A;  3SR1 A;  4CKB A;  2YU9 H;  3OW2 A;  4X3S A;  3OOC A;  3L0O A;  4OO1 G;  1S5C D;  4P2C B;  2DNE A;  3CCU A;  4B3S Q;  3Q6S A;  3M85 A;  2I0Q A;  2AQ2 B;  3HS0 C;  1GOZ A;  4NXN L;  3TP6 A;  2KCC A;  1SRU A;  2UXD L;  1STB A;  4BWG B;  1YHA A;  4AH6 A;  1I94 Q;  3NP8 A;  4AQY L;  1Q1B A;  4C3H G;  2LKV A;  1PA6 A;  4QQB X;  5FO8 B;  1E24 A;  3GTL H;  4JI7 Q;  3DXJ C;  3M4O H;  1HTP A;  3D6W A;  1I4R A;  1S4Z A;  2Q2H A;  3MHB A;  3HKS A;  2Z6B A;  4LF6 L;  2R61 A;  2ZTD A;  2QEX A;  1UNS A;  2HCC A;  2JN4 A;  2E2J H;  3S1Q H;  3PO2 G;  5J39 A;  1EIF A;  5C0X J;  3J80 L;  3CU7 A;  4ZCK A;  1QVC A;  4QF4 A;  1A3V A;  2Z9H A;  1U4R A;  4FXK C;  4JC0 A;  1L2F A;  3J80 c;  3I2Z A;  4LWC A;  1Q46 A;  1U4M A;  2PQE A;  1DOM A;  3H15 A;  5GRO A;  1X3Q A;  2JXM B;  1EYD A;  2RVL A;  2IW3 A;  1EWH A;  3I90 A;  1WTW A;  2HHH Q;  5ELO A;  4YHH Q;  3HOU H;  1B9M A;  3AFP A;  3U58 A;  2RQX A;  1O7L A;  1HZC A;  1JJC B;  3HOW G;  1KTK A;  3L3O C;  4KHP Q;  2PQA B;  1LM0 A;  4MN3 A;  4LF8 L;  5M9O A;  4KV6 A;  4DUY L;  1Z9F A;  4JVZ A;  3SK8 A;  1YVC A;  4OGQ C;  3PUZ A;  4L5S A;  3F2B A;  1AE3 A;  1M8A A;  4JI0 L;  2K5N A;  1AW7 A;  5C0X G;  3B6Y A;  1HZA A;  2CH4 A;  1S40 A;  4F8M A;  5C4X B;  5M5W H;  1CFM A;  1F2Z A;  1GUG A;  5C44 H;  4CGY B;  1NBW A;  3H0G G;  3DM3 A;  4ZLT F;  1Z7T A;  2CWP A;  1PXU A;  4RHR A;  4LFB Q;  1A6X A;  3AB9 A;  3A0J A;  3QIA A;  3M3Y H;  4N8F A;  3K81 C;  2A69 D;  2NVY H;  1Y8O B;  1SE8 A;  4JI1 Q;  1VQM A;  3TS2 A;  3BG3 A;  3SK6 A;  2C5C A;  4TVA B;  4PZ8 A;  1A2T A;  3M7N A;  1ML0 D;  4YWL A;  4U68 A;  2OTJ A;  4KJO A;  5C3E B;  1NCV A;  4JI8 Q;  2M00 A;  4HIK A;  3MEF A;  1A62 A;  1CKN B;  4IUN A;  3VA5 A;  4X3T A;  1EFI D;  3PF5 A;  3W1B A;  3K7U C;  3FKI G;  4DA2 A;  5KEE A;  3S1N H;  1GKH A;  4OIJ A;  1B3A A;  1B44 D;  3QR8 A;  3E6Z X;  4KHV A;  3CMA A;  3KYH C;  2NVQ B;  1K3B C;  1WTR A;  2NN6 H;  4CJ2 C;  1XNQ L;  1VF5 C;  5CV6 A;  1E1O A;  1SFO B;  1F9P A;  5M5X B;  5G3L D;  4JBW A;  2JA8 B;  3NWT A;  3K5L A;  1JCK B;  2XWB B;  3RZO H;  1MJC A;  1H9M A;  1EY6 A;  3RUZ A;  1EEF D;  2F0Q A;  1K83 H;  1PH4 A;  1IYU A;  2GA4 B;  1X3E A;  3CCS A;  5T1I A;  4KI0 A;  1I50 B;  3HOV H;  4N8X 1;  3T51 B;  2E76 C;  3CKI B;  2YV5 A;  4A3C G;  1ET9 A;  1YJN A;  1IBM L;  1N32 Q;  4HIM A;  2L1B A;  2LXJ A;  5IP7 H;  4CDD C;  1IL8 A;  1I5F A;  3OTO L;  1IW7 D;  5EJW A;  4P75 A;  4UY8 C;  2HT1 A;  1PH8 A;  1TU2 B;  3ND8 A;  1HXY D;  3ULP A;  1O7Y A;  1D5M C;  3NBH B;  4KK7 A;  4YIJ A;  1YHQ A;  1ZYR D;  3QOL A;  1GJX A;  1LT3 D;  1Q82 C;  2HHH L;  2VXW A;  1KRS A;  2G9D A;  3Q22 A;  1HNZ L;  1SND A;  2ZJP A;  3OWF A;  5GAG C;  5C4Z A;  2IHE A;  2K33 A;  3R3O A;  4I7Z C;  3J81 E;  4DV1 L;  4R4C A;  1CK1 A;  4TSS A;  3D4D A;  2HUG A;  1F77 A;  2AUK A;  2JA5 B;  4L8J A;  4DKA C;  3HKZ E;  4TRD A;  1XMQ L;  2R93 B;  4L6T B;  4NXM L;  4IAL A;  4JI4 Q;  1EYG A;  1I4Q A;  4R8I A;  1PH1 A;  4A3J G;  1R4Q B;  4DK3 C;  1QNK A;  5IT9 E;  3S9W A;  1D5X C;  4P73 A;  1YBY A;  2IHF A;  3KDF A;  3U9S A;  3NXW A;  1Y8N B;  4HED A;  4GN4 B;  4UP7 A;  3G4S A;  2RSN A;  3UE1 A;  3G48 A;  3C46 A;  4LFB L;  1C9O A;  5CV7 A;  5KYI A;  1EOT A;  4KKU A;  1W2B A;  1VQ8 A;  2EY6 A;  1PYW D;  2F4V L;  1U4L A;  2BE5 C;  2RA4 A;  3NUC A;  1A63 A;  2PCF B;  1B8A A;  4C1N K;  1SE2 A;  4KY5 A;  1KC8 C;  4IUT A;  1Y69 U;  3G7L A;  3E5S A;  4DV7 Q;  2R6G A;  2MJ8 A;  5IP9 H;  2N8N A;  2R7F A;  3HRZ C;  4Y7N B;  2EYO A;  2E2D C;  1YI2 A;  5C4X H;  1HPC A;  2GN5 A;  1C7Y A;  3GTK B;  4MIU A;  2F0N A;  2CQA A;  3RN5 A;  1JOR A;  1ONL A;  2MQH A;  1GUS A;  2F0P A;  1V1P A;  4J1M A;  4NW2 A;  2A8V A;  4XXE A;  1RDP D;  2H5X A;  4JOI C;  3GO5 A;  4UDU C;  4K6D A;  3D3R A;  5DLQ E;  1TWG B;  1EYA A;  2K50 A;  4YCW A;  2WB1 B;  1KAB A;  2DY7 A;  5L37 A;  1K28 A;  4DAY B;  4BBR G;  3CCR A;  2RHQ B;  1G51 A;  4LFA L;  1DON A;  3JAM c;  1P16 A;  2WIN B;  1IKL A;  4NKL A;  5IYC G;  1H9S B;  5C3E H;  4RA8 A;  4JBK A;  5KNB A;  2Q8I B;  3SGI A;  3MVV A;  2EE1 A;  2R92 G;  2HQE A;  4RG1 A;  4B08 A;  3GTO B;  2R7Z B;  1XPO A;  1CT1 D;  1VCI A;  3TZU A;  4BY7 B;  4X64 L;  1YNJ C;  3I4M G;  2Y0S B;  1HR0 L;  2WKD A;  1NR2 A;  4GKK Q;  1HQR D;  2LS0 1;  1SMX A;  3TP7 A;  1ASY A;  2NVQ H;  5EBC A;  1C8C A;  1LUZ A;  1NUC A;  1KAW A;  1SFO H;  3BU2 A;  3R2I A;  1WCM B;  2KQ3 A;  1QOH A;  1Z6H A;  5M5X H;  1HQM C;  2JA8 H;  4DR5 L;  1E0B A;  1UE5 A;  4QJF A;  1H9J A;  4K5W A;  2FFK B;  2JA6 B;  1VMP A;  5G3L F;  1JWS D;  4DN4 M;  3HP3 A;  1KL9 A;  2B39 A;  3KF6 A;  5BN5 A;  1I50 H;  2AQ3 B;  3BDO A;  3DHQ A;  4HJ9 A;  2RBM A;  3ERS X;  3GV3 A;  1JE5 A;  3D4W A;  2F0J A;  3I70 A;  1T5E A;  4RH6 A;  3UDG A;  4PG3 A;  4JOI A;  4RWS C;  1EUJ A;  1EY5 A;  2K5W A;  2F0I A;  3HGB A;  1E7Z A;  3T13 A;  3W5O A;  5LMU L;  2XRS D;  1TXY A;  3RN2 A;  4IOA A;  4LFC L;  4LF5 Q;  4UP9 A;  2E75 C;  3A56 A;  3I72 A;  4HTH A;  3K0Y A;  3CD6 A;  2BCO A;  4IUV A;  1U9R A;  2RSO A;  1WYD A;  2BA1 A;  3CC2 A;  1NSN S;  3QWN A;  1I6H B;  4HID A;  3S16 B;  4K14 A;  1EZ8 A;  4GNX B;  5C4H A;  4B9W A;  2Q2I A;  4DV4 Q;  4HJ7 A;  4M1U B;  3CW2 C;  1BBW A;  1SE3 A;  3M7G A;  4JI3 L;  1PTO C;  3SXH A;  2RCN A;  2JA5 H;  1PH5 A;  1MIU A;  1JB7 A;  2EXD A;  2EIF A;  2A68 C;  3S15 B;  1QVF A;  2R93 H;  4C3I G;  4CKE A;  2B2T A;  1S5F D;  1FNW A;  2PMZ B;  4C3J B;  1LYL A;  1RJT A;  1VQK A;  1X3F A;  2HQL A;  2JYO A;  4XTC S;  4OX9 Q;  2E5L L;  4KN7 C;  2ID0 A;  4EQP A;  4A3G B;  5CYU A;  4GLV B;  1JOK A;  3SDZ A;  3NEL A;  3QOJ A;  1JOQ A;  1JQY D;  3ND9 A;  3PO2 B;  2F3V A;  3ERO A;  1B1Z A;  4ZKC B;  4A3K G;  1RD9 D;  3D6C A;  1VQJ A;  4DR6 L;  1FR3 A;  3N52 A;  1SN8 A;  5IGG A;  3M4Y A;  2KEC A;  4IO9 A;  4LF9 Q;  2RDH A;  1CA5 A;  4RKB A;  3MEH A;  1BF4 A;  3KJP A;  4HIO A;  5DM6 3;  5JJZ A;  4MTK A;  2BH8 A;  3I7F A;  1WOC A;  4Y7N H;  5I2Y A;  1SAP A;  3ERQ A;  4DV5 Q;  4CBV A;  3CCM A;  1ASZ A;  2ENB A;  3PO3 B;  3OWE B;  1PRT C;  3PIO 3;  4KD4 A;  2XIW A;  1KNA A;  3GTK H;  4OL7 A;  4DR2 L;  4JI2 L;  1PMR A;  1Y1V G;  2AMC B;  3NWS A;  1DJR D;  4DV3 Q;  1FYC A;  5JPN C;  2HD3 A;  2UUC L;  1II3 A;  2DUD A;  3DWA A;  3H3V I;  1VQA A;  5GAD C;  5BN4 A;  4ZRZ A;  3C3L A;  3A74 A;  2VQE Q;  2EVB A;  4FF3 A;  2K7V A;  1EQR A;  3AMU A;  1CKM A;  1TWG H;  1HUM A;  3VA7 A;  1HZ9 A;  3GTM B;  2OEO A;  1XYI A;  4L63 B;  4A3I G;  4XQN A;  5JEA J;  1U5K A;  3A54 A;  1HJP A;  1XMO Q;  4TKO B;  1LT6 D;  5AJ3 Q;  1B2T A;  3C1E A;  2ZJR A;  1E1T A;  3GTO H;  3G6J B;  1N36 Q;  2KCM A;  2R7Z H;  1C0A A;  3AQQ A;  3L2P A;  1V1O A;  1LAB A;  4BY7 H;  1ENF A;  1X6O A;  2JEA I;  5IYD H;  5CV5 A;  3RZD B;  2WKC A;  4BY1 G;  1HR0 W;  4KKT A;  2IPK D;  3A7L A;  2N55 A;  4ME5 A;  4DUZ Q;  3T1Y L;  1MHW C;  1WCM H;  2ZT9 C;  1ILQ A;  4G4K A;  3K80 C;  5EKL A;  1F9S A;  2D62 A;  4U67 3;  1EIH A;  1TQO A;  1BVS A;  2K32 A;  1ESR A;  2MO0 A;  5LMN L;  2JA6 H;  4O1N A;  3KF8 B;  3MZ5 A;  4AYB G;  3Q0A A;  1AP0 A;  2J7Z A;  4QB4 A;  1LTI D;  4V19 0;  4A75 A;  1GUW A;  4JI5 L;  1A0I A;  5CV4 A;  1WTO A;  3RD4 A;  1QIL A;  2BDO A;  5JEA G;  1SYF A;  5D65 A;  3T53 B;  4DNI A;  5D14 A;  4ULL A;  1N8R C;  4LUO A;  2VQF L;  1TWA B;  4YWK A;  1NTG A;  5CV8 A;  4DR7 Q;  3NQT A;  1VQ9 A;  3NQI A;  4QL5 A;  4J8Q A;  4Q0F A;  4A93 B;  2CHB D;  4JCV E;  3BYT B;  2JE6 I;  4RGT A;  1LTS D;  4TQU S;  1Q90 A;  4BXX H;  3M4Q A;  1STE A;  1RHP A;  3D4R A;  2H4O A;  1GD7 A;  3HOX B;  1HNX L;  1A3T A;  1JJG A;  4QMG A;  1AZQ A;  2X6L A;  5HY6 A;  1I6H H;  1K0R A;  3S16 H;  2HIV A;  2PNH A;  1LV9 A;  4HMI A;  2K28 A;  1IKM A;  4CDC C;  3GTJ B;  5E7N A;  1EL0 A;  3X3N A;  2MHV A;  4LNQ A;  4BA2 I;  2JA9 A;  1Q7Y C;  1KAA A;  5NUC A;  2IX3 A;  1EIY B;  5JJI A;  1L0X B;  1STN A;  1E22 A;  1ZEQ X;  3G6E A;  3LNN A;  2A6H C;  4OWT B;  3DLL A;  3VYT A;  2B2W C;  3S15 H;  2QDB A;  2OXP A;  1BBU A;  1WTX A;  3MWY W;  3JAM i;  1YIT A;  1TWH B;  5I6W A;  3H94 A;  3WDN A;  4C3J H;  5EPJ A;  4DV6 Q;  5M3F B;  2PNR C;  5C5L A;  1N9W A;  2EYH A;  3GV6 A;  5C5M A;  5IGE A;  1YHB A;  1GHJ A;  2P5Z X;  2Q8T A;  4B3R Q;  1EFW A;  4A3G H;  4WJ3 M;  1ICW A;  2ZXP A;  3RLO A;  4X6A H;  3HEJ A;  5CBA E;  5DNF A;  1RKN A;  4G7O C;  4CDF C;  1V9P A;  3FPP A;  3S2D B;  1PDQ A;  2L11 A;  4LF4 L;  1A8V A;  1NE3 A;  3PO2 H;  3Q23 A;  3P1H A;  5M3M B;  4GZY C;  4CJ0 B;  1G8Z D;  2I07 B;  1G6P A;  4A3J B;  5CV9 A;  2MPM A;  3H09 A;  1XMO L;  3KDF B;  4QIW E;  4R8N A;  1LT4 D;  3PIO A;  4X66 L;  4X62 Q;  2CKZ B;  4OO1 I;  2MGS A;  4ZKB B;  3MXP A;  1SYD A;  2N49 A;  3PO3 H;  1XPR A;  2KHI A;  2UXC Q;  4FXD A;  4JV5 L;  3MFY A;  1AE2 A;  1EZ6 A;  2V1C C;  2M9V A;  4XQJ A;  1IYJ B;  3PMF A;  2B2U C;  2F3W A;  4FP5 D;  2Z4I A;  4NDX A;  1D1I A;  2LXK A;  3T1H L;  4BBS G;  1RL2 A;  2B2W A;  1BR9 A;  4GKJ Q;  4OXP A;  1HTL D;  1G2S A;  4OHJ A;  1BOS A;  4ZAI A;  4WFN 3;  4HJ5 A;  3S1R B;  1B4O A;  3JC6 6;  3GTM H;  1QWY A;  1VQB A;  4PNY A;  3W2D A;  4FF2 A;  3CCE A;  1WI5 A;  2HIX A;  4GLA C;  1EU3 A;  3HOY G;  2B2Y C;  1J5E Q;  1GUO A;  2D5D A;  3CRL C;  4J15 A;  1J8I A;  1E2Z A;  2AUJ D;  3U9O A;  1BUV T;  1KDC A;  4PZ7 A;  4B3M L;  3GP7 A;  4DAM A;  3UE0 A;  3U4Z A;  3NEN A;  5F2D A;  3L9A X;  2IJ0 A;  1CKO A;  2BA0 A;  2XTI A;  1ESF A;  5C44 G;  4NMZ A;  2KHJ A;  3RZD H;  2L55 A;  4A3F B;  5IWA L;  5FJ8 G;  1O7Z A;  1TS3 A;  1QB5 D;  5ISR A;  5K36 H;  1YNN C;  1KXL A;  5EKK A;  3PCO B;  1LT5 D;  3URY A;  5J22 A;  4DR1 Q;  2F0G A;  1C4Q A;  5ELN A;  5KNC A;  1IL2 A;  1BO0 A;  4H0L C;  3C2P A;  2R92 B;  1AN8 A;  4DK1 A;  5LMN W;  5IE8 A;  1EY0 A;  2F0T A;  2XN9 C;  4B3S L;  4OON A;  3HZX A;  3CAM A;  4DNT B;  3J81 L;  3ONA B;  5E1F A;  3VR5 A;  3GTG B;  2UUA Q;  2RKS A;  4C2M B;  1HZB A;  5FO9 B;  1I94 L;  1J6Q A;  2LSS A;  1EWI A;  2B2U A;  5C0X I;  4X65 Q;  1TWA H;  3J81 c;  5IGC A;  4ABN A;  3EA6 A;  4JI7 L;  1T9H A;  2K01 A;  4O2D A;  2FMM A;  2HDM A;  1LAC A;  5IT9 L;  3CQZ B;  1XTD A;  1U0L A;  2NN6 G;  4A93 H;  1GHK A;  3DMU A;  1RCV D;  2EYM A;  4ODG A;  1O7I A;  5IT9 c;  5GAH C;  3HOX H;  3E9H A;  4QGU A;  2B2Y A;  4JK1 C;  1DOL A;  4RFB A;  1IBK Q;  5COR A;  4G7Z C;  4LJZ C;  3GTJ H;  1VQD A;  3KBX A;  2A6E C;  2ES2 A;  1JWU D;  4ZK9 B;  2N3S A;  4GOP A;  1R9T B;  1CSQ A;  1FJG Q;  3HOV G;  5I9P A;  5BR8 Q;  3M4P A;  2ZXO A;  3FHW A;  2DY8 A;  1AEX A;  1EY9 A;  2F0K A;  3EFX D;  1PH7 A;  5HGQ A;  4FF1 A;  1LTA D;  2O5I C;  3KBG A;  2XSC A;  1K8A C;  1K3R A;  1G91 A;  4HJ8 A;  5T1G A;  5IGF A;  4YHH L;  1TWH H;  4IUR A;  4HMJ A;  5KYL A;  5M3F H;  4FO2 A;  2K5V A;  2KA7 A;  4HSV A;  1G2T A;  4YY3 Q;  4JBM A;  4KHP L;  4HCS A;  5D3I B;  2KOL A;  5ELD A;  3CC4 A;  2Q2U A;  3EBE A;  2FHT A;  2SNM A;  5IOD A;  3IL8 A;  3QJY A;  4R9W A;  1VQI A;  3GTQ B;  3D0F A;  3S2D H;  1STA A;  1I4G A;  5FK9 C;  4XYO A;  1SDF A;  1QNU A;  3IAY A;  5C3X A;  1WTQ A;  1JB3 A;  5M3M H;  4IPD A;  3J7A V;  1XPU A;  4A3J H;  3K57 A;  3DWQ A;  3PUX A;  4UP8 A;  1ZXT A;  4HJA A;  1EQT A;  1QJO A;  5ELB A;  1B3Q A;  1WJJ A;  2XNA C;  4RGO S;  4PQX A;  4LF7 Q;  1VQO A;  1DYQ A;  2L15 A;  2TSS A;  4HR7 B;  3KLS X;  2E8G A;  4JI1 L;  4PMB A;  4XDX A;  1NJI C;  4QUC A;  4OWW B;  4CHT B;  1NR4 A;  4DR4 Q;  4A3K B;  1ZKO A;  2YTX A;  2ATW A;  1Q8K A;  1Y1W B;  4JI8 L;  1MSG A;  4K0K Q;  1HFN A;  3A8I E;  2PPB C;  4AIM A;  3K0X A;  3S1R H;  4H7B A;  4EQO A;  2KCT A;  2L9H A;  4AYB E;  3WOE A;  3CHB D;  2PQA A;  1Q1E A;  2IY5 B;  4E6I A;  3BVM A;  5FLX E;  1SNQ A;  1UWV A;  5K5P A;  3W1G A;  5IP9 G;  3MFG A;  1HFG A;  3NK9 A;  4QY7 A;  4DV2 Q;  2JEB I;  2EZV A;  5C4X G;  2PI2 A;  1IXR A;  1VQP A;  1FGB D;  3I4N B;  3JAM L;  2EYJ A;  2WP8 J;  4A3F H;  4K5X A;  3HKZ B;  3D8G A;  2QEJ C;  3WOF A;  2EOT A;  1A2U A;  2K4K A;  2NUC A;  3H91 A;  3PUW A;  2EYF A;  1SSO A;  1D2B A;  4A3I B;  1IZ6 A;  4FDB A;  3S14 B;  2N78 A;  3BS1 A;  3R8B A;  1H9R A;  1QZG A;  2VUM B;  1Q8I A;  4B3T Q;  1G29 1;  1SYC A;  4X3U A;  5BN3 A;  1N32 L;  2R92 H;  1CM9 A;  4P74 A;  2PZT A;  2JP1 A;  3VR2 A;  1EQV A;  5C3E G;  3GTG H;  1VQ6 A;  4ZYS A;  4C2M H;  1QZH A;  1XWE A;  3CP0 A;  3QG1 A;  2FMC A;  5JVG 3;  2B2T C;  5EBD A;  1CKN A;  1DGS A;  2Q2T A;  2B63 B;  1STG A;  4IUP A;  4RKL A;  1PZI D;  3VR6 A;  1CZG A;  5DEH A;  1AH9 A;  5FOB B;  3H3V C;  4F7X A;  3CQZ H;  1W6J A;  3N6R A;  1IBL Q;  3TS0 A;  5I4D A;  2JA7 B;  1VQH A;  2Z6K A;  3MA2 B;  1PRT B;  1F2Y A;  4YWM A;  3BJU A;  3MXG A;  3DM1 A;  3V2T A;  1I3Q B;  3HOZ G;  2UXB Q;  3EVQ A;  4IUQ A;  3KFU A;  2JK8 A;  4DK0 A;  4IPC A;  1XNR Q;  4JI4 L;  1D7Q A;  3GTP B;  1R9T H;  2JQO A;  1S5D D;  4F87 A;  1TII D;  2OCE A;  3F1Z A;  1L1O C;  1LTB D;  3AFQ A;  4RHS A;  2NZO A;  1PZK D;  3OMG A;  3CCV A;  4A3B B;  1TT2 A;  1V43 A;  3CCL A;  4HAE A;  4BA1 I;  4DV0 Q;  2A5H A;  3NBH A;  3DUZ A;  3GTQ H;  1SLJ A;  4DV7 L;  1BCP C;  1UUP A;  4B9X A;  4JI6 Q;  3STB D;  2G9H D;  1EWC A;  3OIQ A;  2XVS A;  4IFD H;  1EOV A;  2C35 B;  2OF1 A;  4C3H B;  1HCZ A;  2PW5 A;  1N33 Q;  2ICE C;  1N34 Q;  2JA5 G;  4QUF A;  5GAE C;  1ENA A;  3KLS A;  1TKW B;  4DR3 Q;  1D1K A;  5COY A;  1R4P B;  2R93 G;  5CR3 A;  3A7A B;  5JVH 3;  5IGD A;  1H9K A;  4JBJ A;  3P7J A;  2OT2 A;  4HSP A;  1CSP A;  4A3E G;  1VQ5 A;  4I65 A;  4MHE A;  1I4P A;  4A4I A;  1M90 C;  2UU9 Q;  1TY2 A;  1VQG A;  5EPL A;  4DAP A;  1VQ4 A;  3KLR A;  1V8Q A;  3J81 i;  2A6H D;  4JYA Q;  4A3K H;  2E2H B;  4DXF A;  2F0F A;  2NYZ D;  4A3M G;  5FLM H;  1Y1W H;  1STH A;  3S1M B;  3KJO A;  5IGB A;  5JPM C;  1TS4 A;  3SE0 A;  1YZ6 A;  2EYP A;  1QUQ A;  2KUM A;  4POF A;  1BKB A;  2BOS A;  1L1O A;  2I5L X;  5LHY 1;  3DEP A;  3OSO A;  1EQQ A;  3KLW A;  4GKK L;  4L5T A;  4NXN Q;  3CME A;  2XWJ B;  2UXD Q;  3HOW B;  4A3L H;  3NE5 B;  3D31 A;  2XGT A;  3OW7 A;  5A2Q E;  2Z1C A;  3E0J A;  4AQY Q;  2Q8R E;  4PZ6 A;  1PVO A;  5KGU A;  3HFZ B;  1PYS B;  1D8L A;  1VQE A;  1HH2 P;  3I4N H;  5JJL A;  1WTH A;  2GVA A;  4FVM A;  3OHX C;  2QW7 A;  2E74 C;  2IX1 A;  4BBS B;  3MXU A;  4ILW A;  3H6M A;  3TEH B;  1TS2 A;  4LF6 Q;  2WV6 D;  5M5Y B;  3EN2 A;  3TP8 A;  2EJG C;  4A3D G;  2MFI A;  2PYK A;  4O0A A;  4A3I H;  1K0S A;  4O42 A;  3S14 H;  3BZD B;  3HOY B;  2VUM H;  1HHV A;  1YJW A;  2WB1 G;  3H0G B;  4H02 A;  2F0U A;  1MD2 D;  1Y14 B;  5DAU A;  1NMF A;  1BBX C;  4PMW A;  2QA4 A;  1PH9 A;  3NSW A;  1B70 B;  1HA6 A;  2C9O A;  4HN7 A;  1I4H A;  4S3S A;  2R7Z G;  2WAQ G;  2NZ1 D;  4LF5 L;  4RGN A;  1SMY C;  2Y0S G;  4RGM A;  2B63 H;  4POG A;  2CVR A;  4GNX C;  3OYY A;  5IYD G;  1O78 A;  2CH4 W;  2KVM A;  1EY7 A;  5LL6 X;  2F0W A;  4UPA A;  2JA7 H;  4DV4 L;  4LF8 Q;  1LO5 D;  1XX8 A;  1WCM G;  2CW0 C;  2F4I A;  3AYH B;  1VMC A;  2HDL A;  1SJE D;  1SBB B;  1K8G A;  4FYD A;  2K5D A;  2I46 A;  4DUY Q;  3FKI B;  1I3Q H;  1OXT A;  4C56 C;  3FPU B;  3MTS A;  1MBY A;  2JA6 G;  1K8M A;  2JJQ A;  4P72 A;  1DD2 A;  2K52 A;  1EYC A;  1RIP A;  2F0O A;  4IJL A;  3F8T A;  1AFP A;  1STY A;  1TS5 A;  1SEB D;  2F0L A;  2FIN B;  5IIF A;  4JI0 Q;  3GTP H;  1OO9 B;  3BYY B;  2I5H A;  2PO4 A;  3C1F A;  1E2V A;  3E0E A;  1M1K C;  2UUB Q;  1N34 L;  3S17 B;  2PZU A;  1S5E D;  5IYB G;  4G7H C;  4IOC A;  5CMD A;  4OX9 L;  4DR3 L;  1X9N A;  1SNC A;  4EQ5 A;  2CFM A;  2M2L A;  1I4X A;  1PFS A;  1D6E C;  3E3X A;  2FJ2 A;  1JT8 A;  4XT1 B;  3DEO A;  1X65 A;  3K5M A;  5E4X A;  3CCQ A;  1S72 A;  2CCZ A;  1JOO A;  2A1A A;  2UU9 L;  4A3B H;  4RCN A;  2A74 C;  4BXX G;  4R4T A;  2OWO A;  3TP5 A;  4OO1 H;  3TN2 A;  2EJM A;  3UDX A;  2JSO A;  4LF9 L;  2N88 A;  1CHP D;  2ICI A;  4KD3 A;  3BZC A;  3LWU A;  4OIK A;  1I6V C;  3T56 B;  3J7Z C;  1NMG A;  3I55 A;  3OPO A;  3KOJ A;  3A8J E;  2R3Z A;  1F9R A;  2K6A A;  4DV5 L;  1KD1 C;  1X3P A;  1KRT A;  2IL8 A;  2L4N A;  4GNX A;  3BDC A;  3K8A A;  4LMQ D;  4C3H H;  3J7Y W;  1SJH D;  1MKH A;  2KHS A;  4KHZ A;  3MXN A;  4DV3 L;  2GVB A;  2PI2 E;  4CJ1 B;  1XNQ Q;  2F0S A;  3BZK A;  4DGZ A;  2ZTE A;  3EIV A;  2B8G A;  4C3J G;  1UAP A;  1LTG D;  2VQE L;  1XTC D;  1K73 C;  4K2K A;  2QGQ A;  5IY0 A;  2A6E D;  2B8F A;  2F03 A;  4MNO A;  1VQF A;  2SOB A;  3GQB A;  4A3G G;  3K58 A;  1VQ7 A;  2ZJQ A;  1CTM A;  1UE6 A;  5C6A A;  3U4V A;  2E2H H;  2Z8L A;  5CC4 A;  5HUR A;  5AJ3 L;  4EGV A;  4LUV A;  3CC7 A;  3S1M H;  3SK4 A;  1N36 L;  1FD7 D;  1IBM Q;  3A55 A;  1VDZ A;  5D3D A;  5JJK A;  2MO1 A;  2L5T A;  3RLF A;  4IN3 A;  3ITP A;  1DZ1 A;  4EVO A;  1RTO A;  3OTO Q;  3HOW H;  2D0P A;  1FNV A;  2VS1 A;  4KY7 A;  4C1N I;  2NZH A;  3HOU G;  3UI2 A;  4DUZ L;  1GM5 A;  5AFW A;  3LWE A;  4UHV A;  3TBI B;  3SVM A;  3PO3 G;  1HNZ Q;  1KIX A;  4RAU C;  5J1Z A;  3ULL A;  1SRO A;  1LTR D;  2MP1 A;  2KEN A;  1UEB A;  4BBS H;  4N9P A;  4V0B A;  2G5D A;  4ID6 A;  1Q12 A;  3K6O A;  3ZYY X;  5M5Y H;  1PH2 A;  5C0X H;  4DV1 Q;  3KK7 A;  2BDN A;  3Q24 A;  2KBN A;  4MZ9 A;  2VB2 X;  2F1M A;  3E9I A;  1V1P B;  3HOY H;  2YTV A;  2QIL A;  3H0G H;  1OTC A;  2K03 A;  1Q81 C;  4CKC A;  1KDA A;  1XMQ Q;  3W3A A;  5KIX A;  4NXM Q;  4GOP C;  4DR7 L;  4K8I A;  4WJ4 A;  1CUK A;  3GDE A;  2TMP A;  3KUP A;  2BE5 D;  4K5V A;  2UUB L;  3HG9 A;  1S3O A;  1PLF A;  1X54 A;  5E4W C;  3CXC A;  4XQQ A;  5FJ8 H;  1KNE A;  1F2M A;  4BBR B;  2CWA A;  4BS9 A;  3P75 A;  1SNP A;  3J80 E;  3F2C A;  3IKJ A;  4QIW B;  1YNX A;  3AEV A;  2WII B;  2SDF A;  5K36 G;  2F4V Q;  4J6H A;  2LFN A;  2AKW B;  2F0M A;  1MJE A;  1BNZ A;  3I4M B;  1G6Z A;  3FKI H;  1NAP A;  3I4L A;  3UDF A;  1ET6 A;  2NVX B;  3VDY A;  1M4V A;  1MI2 A;  3V96 A;  3IFT A;  3NTK A;  1DM0 B;  2AWO A;  3ICE A;  3CCJ A;  2NVT B;  3KF8 A;  1L0W A;  1TWC B;  4ME3 A;  4DV6 L;  3S17 H;  4X3K A;  5E3F A;  2J4X A;  5GQO A;  1OXU A;  3KF6 B;  4WOR A;  3SEB A;  1WVL A;  1Y8P B;  3PUY A;  2K05 A;  4B3R L;  1CQF A;  4M8A A;  4DAV A;  1MGS A;  4LK1 C;  1OXX K;  4YCV A;  1BQQ T;  1QG7 A;  3BVG A;  3K5O A;  2QF7 A;  1EIG A;  3QB3 A;  4WJW A;  5TSS A;  3U50 C;  1VQC A;  4A93 G;  4KJN A;  3FMC A;  1YNJ D;  3HOZ B;  1B7Y B;  2VNU D;  4A3C H;  2RDG A;  5IOC A;  2K04 A;  3BDL A;  3HOX G;  3ER0 A;  2PZW A;  4LFA Q;  4MTN A;  3K5N A;  3RNU A;  1SE4 A;  1YIJ A;  1HRJ A;  1YEZ A;  2LMC B;  3RR5 A;  2D9U A;  4DXG A;  5EKI A;  4X62 L;  1JWM D;  2ZTC A;  3J81 j;  4FF4 A;  3F2D A;  4X64 Q;  4JPB W;  5IP7 G;  2J0T D;  4F88 A;  3VR3 A;  1HR0 Q;  4Q5V A;  1JMC A;  1E2W A;  1ROD A;  3SK5 A;  5FLX L;  2UXC L;  5EAY A;  2E2I B;  3ZJY C;  3I56 A;  4DU9 A;  4KLK A;  1RF2 D;  4FNF A;  5FLX c;  4DR5 Q;  5M3F G;  4GKJ L;  2NN6 I;  1TWF B;  4OWX B;  4HCE A;  5DM7 3;  1FVI A;  3PIP 3;  5C3W A;  4C3I B;  3O13 A;  4KMU C;  4EX5 A;  5I9O A;  4K6L A;  3K7A B;  1ICF B;  4K2L A;  1J5E L;  1AZP A;  1U4P A;  4NP5 A;  3R93 A;  3TZD A;  1LLR D;  4GS3 A;  2WB1 E;  4GN3 B;  5M3M G;  2MNA A;  2EY1 A;  4N9T A;  3FDT A;  5JOB A;  2SNS A;  5C4J B;  3RMH A;  4A3E B;  1D5Z C;  5LMU Q;  1QE6 A;  4ALP A;  4RCO A;  4DPG A;  2WAQ E;  4LFC Q;  1PTO D;  2QKI C;  4JG2 A;  2K5H A;  1PHJ A;  2EXZ A;  1HA5 A;  2VB3 X;  2Y0S E;  4DR1 L;  1MSH A;  2EDG A;  1BCP D;  2A68 D;  1NNX A;  2RCF A;  3PQI A;  4IUU A;  1JC7 A;  1GO3 E;  1QVG A;  2KCN A;  4A3M B;  1QUQ B;  4FXG C;  1L1O B;  2A69 C;  2Z6K C;  3IRB A;  2QCP X;  3F2U A;  3G71 A;  4JI3 Q;  2AHO B;  3LGJ A;  4EQN A;  2KJX A;  2A19 A;  2UUA L;  2K75 A;  2XRQ D;  1Y1V B;  1PTO B;  3CF5 A;  1K8O A;  4X65 L;  1B9N A;  2ZM6 Q;  1PFM A;  2OTL A;  3TSS A;  5ELC A;  1BCP B;  3K59 A;  3ULJ A;  4P71 A;  1X56 A;  3A5Z B;  2BH2 A;  2D2C C;  1KLG D;  3MC0 B;  2E5L Q;  3SHL A;  1S5B D;  4GN5 A;  4L5R C;  4BBR H;  1BDO A;  3VYS A;  3IFD A;  5IYC H;  4A3D B;  1PFN A;  4XIG S;  4A3F G;  1IBK L;  1TY0 A;  2NBF A;  4L5Q A;  1PRT D;  2ZXR A;  1BXT A;  1FJG L;  4DR6 Q;  1WFQ A;  1WD1 A;  5LL6 S;  3FEW X;  2V4D A;  3I4M H;  5BR8 L;  2VW9 A;  1HUN A;  4IJH A;  2RDF A;  4H44 C;  4QCL A;  3NBI A;  1TR5 A;  2FXQ A;  2WAC A;  1KDB A;  5I2X A;  2NVX H;  3PUV A;  4OEL B;  3LX0 A;  4BY1 B;  3S2H B;  1EU4 A;  4R4O A;  1IYV A;  1IHZ A;  2L0C A;  2WAQ B;  1X55 A;  2KED A;  5ELF A;  2ALY B;  1J9O A;  1OXS C;  2NVT H;  1GUT A;  3FVQ A;  1TWC H;  3GD7 A;  1L0Y B;  4CDE C;  1YJ9 A;  1ILP A;  4YY3 L;  4DR2 Q;  4JI2 Q;  2RHS B;  1IW7 C;  2DN8 A;  4LW1 A;  2JA8 G;  2F3I A;  2UUC Q;  4AYB B;  2B3G A;  2PMZ E;  4UAI A;  1ZYR C; 
#chains in the Genus database with same CATH homology
 2YYZ A;  4DFA A;  3CRK C;  1DCZ A;  1EEI D;  3NPP A;  4ZUJ A;  1GXD C;  2F0V A;  4IFD J;  2SEB D;  2F0D A;  1SMY D;  3NHH A;  3X3M A;  3OIP A;  2PW7 A;  5KRU A;  4LAA A;  1F9Q A;  2EYL A;  3BVZ A;  3JAM E;  4ZUI A;  2CW0 D;  1DXM A;  3R2T A;  1SXT A;  5A2Q L;  1EY8 A;  1W6K A;  3I8Z A;  4DNR B;  4IQZ A;  1KLU D;  2YU9 B;  2DNC A;  1RTN A;  3EQL C;  4DF7 A;  1X32 A;  2K1B A;  5HGT A;  1QCB D;  1SYB A;  4H13 C;  2F0H A;  3NTH A;  2X69 A;  4IFD G;  1PZJ D;  2LY7 A;  3NTI A;  2O2L D;  3GTL B;  2H1E A;  3M4O B;  1XXG A;  2EY2 A;  4KTA A;  4XYQ A;  2O5J C;  4ZQ3 A;  1O80 A;  2B2V C;  1EY4 A;  3FRP B;  5EQ0 A;  4WRD A;  5KND A;  3VYR A;  3TME A;  1A3U A;  1B50 A;  1DOK A;  2F0E A;  3S1Q B;  2E2J B;  1PTO F;  2NTS A;  5ELE A;  2MUY A;  2EJF C;  2HCI A;  1BCP F;  3OMC A;  3QO2 A;  2Z4H A;  3I91 A;  3VYU A;  4K8J A;  2A73 B;  1WD0 A;  1Z47 A;  2NB0 A;  5JAV A;  1CZW A;  1TVX A;  4KKS A;  1PTO H;  2K5Q A;  5I6Y A;  3HOU B;  3T16 A;  1UEA B;  3EJI A;  2IX0 A;  1JIC A;  4IFD I;  4XT3 B;  3PV0 A;  1CHQ D;  1JE4 A;  1FNU A;  1WTP A;  2AWN A;  5EGT A;  1VF7 A;  2KEE A;  1F2L A;  3T4A C;  2NTT A;  4PMC A;  1SNO A;  4DAY A;  5M5W B;  1PRT F;  1SNM A;  5C44 B;  4G57 A;  3V05 A;  1H9S A;  1SYG A;  2B2V A;  3AU7 A;  2AQ1 B;  1B53 A;  3TDQ A;  1A15 A;  1OXV A;  3I3C A;  3M3Y B;  5FKA C;  2NWG A;  2NVY B;  1PFB A;  1CI3 M;  4PV1 C;  5EPK A;  1LTT D;  1T5X D;  2EY5 A;  5A35 A;  4KN4 C;  3MAQ A;  3L7Z C;  5JEA H;  3P20 A;  2O4X A;  4IZ8 A;  3DWP A;  1SYE A;  2EPB A;  3A8K E;  3S1N B;  1WTV A;  1YNN D;  1CA6 A;  5CBE E;  5FO7 B;  5CGK A;  4Z9C B;  3I73 A;  3RZO B;  1CQV A;  1K83 B;  1ENC A;  1Q3L A;  2X6G A;  1C48 A;  2IT1 A;  2IWH A;  4KY6 A;  3HOV B;  2L12 A;  3VR4 A;  1JR0 D;  3J7A F;  1GUN A;  3SR1 A;  4CKB A;  4X3S A;  3OOC A;  4OO1 G;  1S5C D;  4P2C B;  2DNE A;  3Q6S A;  3M85 A;  2AQ2 B;  3HS0 C;  1GOZ A;  3TP6 A;  2KCC A;  1STB A;  4BWG B;  3NP8 A;  1Q1B A;  4C3H G;  2LKV A;  5FO8 B;  3DXJ C;  1HTP A;  3D6W A;  1I4R A;  1S4Z A;  3MHB A;  2R61 A;  1UNS A;  2HCC A;  5J39 A;  5C0X J;  3J80 L;  3CU7 A;  4QF4 A;  1A3V A;  1U4R A;  4FXK C;  2PQE A;  1U4M A;  1DOM A;  1X3Q A;  2JXM B;  1EYD A;  2RVL A;  2IW3 A;  1EWH A;  3I90 A;  1WTW A;  1B9M A;  2RQX A;  1O7L A;  1KTK A;  3L3O C;  4MN3 A;  5M9O A;  4KV6 A;  3SK8 A;  4OGQ C;  3PUZ A;  1M8A A;  1AW7 A;  5C0X G;  4F8M A;  5C4X B;  1CFM A;  1F2Z A;  1GUG A;  4CGY B;  4ZLT F;  1Z7T A;  1PXU A;  4RHR A;  1A6X A;  3AB9 A;  3QIA A;  2A69 D;  1Y8O B;  3BG3 A;  3SK6 A;  2C5C A;  1A2T A;  3M7N A;  1ML0 D;  4U68 A;  4KJO A;  5C3E B;  1NCV A;  2M00 A;  4IUN A;  3VA5 A;  4X3T A;  1EFI D;  4DA2 A;  5KEE A;  4OIJ A;  1B3A A;  1B44 D;  4KHV A;  3E6Z X;  2NVQ B;  1WTR A;  2NN6 H;  4CJ2 C;  1VF5 C;  5CV6 A;  1SFO B;  1F9P A;  5M5X B;  5G3L D;  4JBW A;  2JA8 B;  3NWT A;  3K5L A;  1JCK B;  2XWB B;  1H9M A;  1EY6 A;  3RUZ A;  1EEF D;  2F0Q A;  1IYU A;  2GA4 B;  5T1I A;  4KI0 A;  1I50 B;  3T51 B;  2E76 C;  3CKI B;  1ET9 A;  2L1B A;  1IL8 A;  1IW7 D;  5EJW A;  1TU2 B;  3ND8 A;  1HXY D;  1O7Y A;  1D5M C;  4KK7 A;  4YIJ A;  1ZYR D;  3QOL A;  1GJX A;  1LT3 D;  2VXW A;  2G9D A;  3Q22 A;  1SND A;  3OWF A;  5C4Z A;  2K33 A;  3R3O A;  4I7Z C;  3J81 E;  4TSS A;  1CK1 A;  3D4D A;  2HUG A;  1F77 A;  2AUK A;  2JA5 B;  4L8J A;  4TRD A;  2R93 B;  4L6T B;  4IAL A;  1I4Q A;  4R8I A;  1R4Q B;  1QNK A;  5IT9 E;  3S9W A;  1D5X C;  3U9S A;  3NXW A;  1Y8N B;  4HED A;  2RSN A;  3C46 A;  5CV7 A;  5KYI A;  1EOT A;  4KKU A;  2EY6 A;  1PYW D;  1U4L A;  2BE5 C;  2RA4 A;  3NUC A;  2PCF B;  4C1N K;  1SE2 A;  4KY5 A;  4IUT A;  1Y69 U;  3G7L A;  3E5S A;  2R6G A;  2MJ8 A;  4Y7N B;  3HRZ C;  2EYO A;  2E2D C;  1HPC A;  3GTK B;  4MIU A;  2F0N A;  2CQA A;  1JOR A;  1ONL A;  1GUS A;  2F0P A;  1V1P A;  4J1M A;  4NW2 A;  4XXE A;  1RDP D;  4UDU C;  3GO5 A;  4K6D A;  3D3R A;  1TWG B;  1EYA A;  2WB1 B;  1KAB A;  2DY7 A;  1DON A;  2WIN B;  1IKL A;  4NKL A;  1H9S B;  4RA8 A;  5KNB A;  2Q8I B;  3MVV A;  2EE1 A;  2HQE A;  4B08 A;  3GTO B;  2R7Z B;  1CT1 D;  1VCI A;  3TZU A;  4BY7 B;  1YNJ C;  2Y0S B;  2WKD A;  1NR2 A;  1HQR D;  2LS0 1;  3TP7 A;  5EBC A;  1C8C A;  1NUC A;  3R2I A;  1WCM B;  2KQ3 A;  1QOH A;  1Z6H A;  1HQM C;  1E0B A;  1H9J A;  4K5W A;  2FFK B;  2JA6 B;  1VMP A;  5G3L F;  1JWS D;  4DN4 M;  3HP3 A;  2B39 A;  5BN5 A;  2AQ3 B;  3BDO A;  3DHQ A;  2RBM A;  3GV3 A;  3D4W A;  2F0J A;  3I70 A;  1T5E A;  4RH6 A;  4RWS C;  1EY5 A;  2K5W A;  2F0I A;  3HGB A;  3T13 A;  2XRS D;  2E75 C;  3A56 A;  3I72 A;  4HTH A;  3K0Y A;  2BCO A;  4IUV A;  1U9R A;  2RSO A;  2BA1 A;  1NSN S;  3QWN A;  1I6H B;  3S16 B;  4K14 A;  1EZ8 A;  5C4H A;  4B9W A;  4M1U B;  1SE3 A;  3M7G A;  1PTO C;  3SXH A;  2A68 C;  3S15 B;  4C3I G;  4CKE A;  2B2T A;  1S5F D;  1FNW A;  2PMZ B;  4C3J B;  1RJT A;  2JYO A;  4XTC S;  4KN7 C;  2ID0 A;  4EQP A;  4A3G B;  5CYU A;  1JOK A;  3SDZ A;  3QOJ A;  1JOQ A;  1JQY D;  3ND9 A;  3PO2 B;  2F3V A;  3ERO A;  1B1Z A;  4ZKC B;  1RD9 D;  3D6C A;  1FR3 A;  3N52 A;  5IGG A;  3M4Y A;  2KEC A;  2RDH A;  1CA5 A;  4RKB A;  3MEH A;  1BF4 A;  5DM6 3;  5JJZ A;  5I2Y A;  1SAP A;  3ERQ A;  4CBV A;  2ENB A;  3PO3 B;  3OWE B;  1PRT C;  3PIO 3;  4KD4 A;  2XIW A;  1KNA A;  4OL7 A;  1PMR A;  3NWS A;  1DJR D;  1FYC A;  5JPN C;  1II3 A;  3DWA A;  5BN4 A;  4ZRZ A;  3C3L A;  2EVB A;  4FF3 A;  2K7V A;  3AMU A;  1HUM A;  3VA7 A;  3GTM B;  2OEO A;  1XYI A;  4L63 B;  4XQN A;  5JEA J;  3A54 A;  4TKO B;  1LT6 D;  1B2T A;  3C1E A;  3G6J B;  1V1O A;  1LAB A;  1ENF A;  2JEA I;  5CV5 A;  3RZD B;  2WKC A;  4KKT A;  2IPK D;  3A7L A;  2N55 A;  4ME5 A;  2ZT9 C;  1ILQ A;  4G4K A;  5EKL A;  1F9S A;  2D62 A;  4U67 3;  1EIH A;  1TQO A;  2K32 A;  1ESR A;  4O1N A;  3MZ5 A;  3Q0A A;  1AP0 A;  2J7Z A;  4QB4 A;  1LTI D;  4V19 0;  1GUW A;  1WTO A;  5CV4 A;  3RD4 A;  1QIL A;  2BDO A;  5JEA G;  1SYF A;  5D65 A;  3T53 B;  5D14 A;  4ULL A;  1TWA B;  5CV8 A;  3NQT A;  3NQI A;  4J8Q A;  4Q0F A;  4A93 B;  2CHB D;  3BYT B;  2JE6 I;  4RGT A;  1LTS D;  4TQU S;  1Q90 A;  1STE A;  1RHP A;  3D4R A;  2H4O A;  3HOX B;  1A3T A;  4QMG A;  1AZQ A;  2X6L A;  1LV9 A;  4HMI A;  2K28 A;  1IKM A;  3GTJ B;  1EL0 A;  3X3N A;  2MHV A;  4BA2 I;  1KAA A;  5NUC A;  2IX3 A;  1L0X B;  1STN A;  1ZEQ X;  3LNN A;  2A6H C;  3VYT A;  2B2W C;  2QDB A;  2OXP A;  1WTX A;  3MWY W;  1TWH B;  5I6W A;  3H94 A;  3WDN A;  5EPJ A;  5M3F B;  2PNR C;  5C5L A;  2EYH A;  3GV6 A;  5C5M A;  5IGE A;  1GHJ A;  2Q8T A;  1ICW A;  2ZXP A;  3HEJ A;  5CBA E;  5DNF A;  1RKN A;  4G7O C;  3FPP A;  3S2D B;  1PDQ A;  2L11 A;  3Q23 A;  3P1H A;  5M3M B;  4GZY C;  4CJ0 B;  1G8Z D;  2I07 B;  4A3J B;  5CV9 A;  2MPM A;  3H09 A;  4R8N A;  1LT4 D;  4OO1 I;  2MGS A;  4ZKB B;  3MXP A;  1SYD A;  4FXD A;  3MFY A;  1EZ6 A;  4XQJ A;  2M9V A;  2B2U C;  3PMF A;  2F3W A;  4FP5 D;  2Z4I A;  4NDX A;  1D1I A;  2B2W A;  1BR9 A;  1HTL D;  1G2S A;  4OHJ A;  1BOS A;  4ZAI A;  4WFN 3;  3S1R B;  1B4O A;  1QWY A;  4PNY A;  3W2D A;  4FF2 A;  1EU3 A;  2B2Y C;  1GUO A;  2D5D A;  3CRL C;  1J8I A;  1E2Z A;  2AUJ D;  3U9O A;  1BUV T;  1KDC A;  3GP7 A;  5F2D A;  3L9A X;  2IJ0 A;  2BA0 A;  1ESF A;  4NMZ A;  2L55 A;  4A3F B;  1O7Z A;  1TS3 A;  1QB5 D;  5ISR A;  5K36 H;  1YNN C;  5EKK A;  1LT5 D;  3URY A;  5J22 A;  2F0G A;  1C4Q A;  5KNC A;  1BO0 A;  4H0L C;  3C2P A;  2R92 B;  1AN8 A;  4DK1 A;  1EY0 A;  2F0T A;  2XN9 C;  3HZX A;  4DNT B;  3J81 L;  3ONA B;  5E1F A;  3VR5 A;  3GTG B;  2RKS A;  4C2M B;  5FO9 B;  2B2U A;  5C0X I;  5IGC A;  4ABN A;  3EA6 A;  2K01 A;  2FMM A;  2HDM A;  1LAC A;  5IT9 L;  3CQZ B;  2NN6 G;  1GHK A;  3DMU A;  1RCV D;  2EYM A;  4ODG A;  2B2Y A;  4JK1 C;  1DOL A;  4RFB A;  5COR A;  4G7Z C;  4LJZ C;  3KBX A;  2A6E C;  1JWU D;  4ZK9 B;  1R9T B;  5I9P A;  2ZXO A;  2DY8 A;  1AEX A;  1EY9 A;  2F0K A;  3EFX D;  4FF1 A;  1LTA D;  2O5I C;  3KBG A;  2XSC A;  1G91 A;  5T1G A;  5IGF A;  4IUR A;  4HMJ A;  5KYL A;  4FO2 A;  2KA7 A;  4HSV A;  1G2T A;  4HCS A;  5D3I B;  2KOL A;  5ELD A;  2FHT A;  2SNM A;  5IOD A;  3IL8 A;  3QJY A;  4R9W A;  3GTQ B;  1STA A;  1I4G A;  5FK9 C;  4XYO A;  1SDF A;  1QNU A;  3IAY A;  5C3X A;  1WTQ A;  1JB3 A;  3J7A V;  3K57 A;  3DWQ A;  3PUX A;  1ZXT A;  1EQT A;  1QJO A;  5ELB A;  2XNA C;  4RGO S;  4PQX A;  1DYQ A;  2TSS A;  4HR7 B;  3KLS X;  4PMB A;  4XDX A;  4QUC A;  4CHT B;  1NR4 A;  4A3K B;  1ZKO A;  1Y1W B;  1MSG A;  1HFN A;  3A8I E;  2PPB C;  4H7B A;  4EQO A;  2L9H A;  3WOE A;  3CHB D;  1Q1E A;  4E6I A;  3BVM A;  5FLX E;  1SNQ A;  5K5P A;  3MFG A;  1HFG A;  3NK9 A;  2JEB I;  2EZV A;  1FGB D;  3I4N B;  3JAM L;  2EYJ A;  2WP8 J;  4K5X A;  3HKZ B;  3D8G A;  2QEJ C;  3WOF A;  2EOT A;  1A2U A;  2NUC A;  3H91 A;  3PUW A;  2EYF A;  1SSO A;  1D2B A;  4A3I B;  3S14 B;  3BS1 A;  3R8B A;  1H9R A;  2VUM B;  1Q8I A;  1G29 1;  1SYC A;  4X3U A;  5BN3 A;  1CM9 A;  2PZT A;  2JP1 A;  3VR2 A;  1EQV A;  4ZYS A;  1XWE A;  3QG1 A;  2FMC A;  5JVG 3;  2B2T C;  5EBD A;  2B63 B;  1STG A;  4IUP A;  4RKL A;  1PZI D;  3VR6 A;  1CZG A;  5DEH A;  5FOB B;  3H3V C;  4F7X A;  1W6J A;  3N6R A;  2JA7 B;  5I4D A;  3MA2 B;  1PRT B;  1F2Y A;  3MXG A;  3DM1 A;  3V2T A;  1I3Q B;  3EVQ A;  4IUQ A;  4DK0 A;  3GTP B;  1S5D D;  4F87 A;  1TII D;  1LTB D;  4RHS A;  1PZK D;  3OMG A;  4A3B B;  1TT2 A;  1V43 A;  4HAE A;  4BA1 I;  2A5H A;  3NBH A;  3DUZ A;  1BCP C;  1UUP A;  4B9X A;  2G9H D;  1EWC A;  3OIQ A;  2XVS A;  4IFD H;  2OF1 A;  4C3H B;  1HCZ A;  2PW5 A;  2ICE C;  4QUF A;  1ENA A;  3KLS A;  1TKW B;  1D1K A;  5COY A;  1R4P B;  5CR3 A;  3A7A B;  5JVH 3;  5IGD A;  1H9K A;  3P7J A;  2OT2 A;  4HSP A;  4I65 A;  4MHE A;  1I4P A;  1TY2 A;  5EPL A;  4DAP A;  3KLR A;  1V8Q A;  2A6H D;  2E2H B;  4DXF A;  2F0F A;  2NYZ D;  1STH A;  3S1M B;  5IGB A;  5JPM C;  1TS4 A;  3SE0 A;  2EYP A;  2KUM A;  2BOS A;  5LHY 1;  3DEP A;  3OSO A;  2XWJ B;  3HOW B;  3NE5 B;  3D31 A;  3OW7 A;  5A2Q E;  2Z1C A;  3E0J A;  2Q8R E;  5KGU A;  3OHX C;  4FVM A;  2E74 C;  2IX1 A;  4BBS B;  3MXU A;  4ILW A;  3H6M A;  1TS2 A;  2WV6 D;  5M5Y B;  3TP8 A;  2EJG C;  2PYK A;  4O42 A;  3BZD B;  3HOY B;  1HHV A;  3H0G B;  2F0U A;  1MD2 D;  5DAU A;  1BBX C;  4PMW A;  3NSW A;  1HA6 A;  2C9O A;  4HN7 A;  1I4H A;  4S3S A;  2NZ1 D;  4RGN A;  1SMY C;  4RGM A;  2CVR A;  1O78 A;  2KVM A;  1EY7 A;  5LL6 X;  2F0W A;  1LO5 D;  1XX8 A;  2CW0 C;  2F4I A;  1VMC A;  2HDL A;  1SJE D;  1SBB B;  4FYD A;  2K5D A;  2I46 A;  3FKI B;  1OXT A;  4C56 C;  3FPU B;  3MTS A;  1MBY A;  1K8M A;  1DD2 A;  1EYC A;  2F0O A;  1AFP A;  1STY A;  1TS5 A;  1SEB D;  2F0L A;  2FIN B;  5IIF A;  1OO9 B;  3BYY B;  2PO4 A;  3C1F A;  1E2V A;  3S17 B;  2PZU A;  1S5E D;  4G7H C;  5CMD A;  1SNC A;  2M2L A;  1I4X A;  1D6E C;  2FJ2 A;  4XT1 B;  3DEO A;  3K5M A;  5E4X A;  1JOO A;  4RCN A;  2A74 C;  3TP5 A;  4OO1 H;  3TN2 A;  2EJM A;  2JSO A;  2N88 A;  1CHP D;  2ICI A;  4KD3 A;  3T56 B;  3LWU A;  4OIK A;  1I6V C;  3OPO A;  3A8J E;  2R3Z A;  1F9R A;  2K6A A;  1X3P A;  2IL8 A;  2L4N A;  3BDC A;  4LMQ D;  3J7Y W;  1SJH D;  2KHS A;  4KHZ A;  3MXN A;  4CJ1 B;  2F0S A;  4DGZ A;  2B8G A;  4C3J G;  1UAP A;  1LTG D;  1XTC D;  4K2K A;  2A6E D;  2B8F A;  2F03 A;  2SOB A;  3GQB A;  3K58 A;  1CTM A;  5C6A A;  2Z8L A;  5CC4 A;  5HUR A;  4EGV A;  3SK4 A;  1FD7 D;  3A55 A;  1VDZ A;  5D3D A;  2L5T A;  3RLF A;  4IN3 A;  3ITP A;  1DZ1 A;  4EVO A;  1RTO A;  1FNV A;  4KY7 A;  4C1N I;  3UI2 A;  5AFW A;  3LWE A;  3TBI B;  3SVM A;  4RAU C;  5J1Z A;  1LTR D;  2MP1 A;  4N9P A;  4V0B A;  4ID6 A;  1Q12 A;  3K6O A;  3ZYY X;  5C0X H;  3KK7 A;  2BDN A;  3Q24 A;  2VB2 X;  2F1M A;  1V1P B;  2QIL A;  2K03 A;  4CKC A;  1KDA A;  3W3A A;  5KIX A;  4K8I A;  2TMP A;  3KUP A;  2BE5 D;  4K5V A;  3HG9 A;  1PLF A;  5E4W C;  4XQQ A;  1KNE A;  1F2M A;  4BBR B;  4BS9 A;  3P75 A;  1SNP A;  3J80 E;  3IKJ A;  4QIW B;  2WII B;  2SDF A;  5K36 G;  4J6H A;  2LFN A;  2F0M A;  1BNZ A;  3I4M B;  1G6Z A;  3I4L A;  1NAP A;  1ET6 A;  2NVX B;  1M4V A;  1MI2 A;  3V96 A;  3IFT A;  3NTK A;  1DM0 B;  2AWO A;  2NVT B;  3KF8 A;  1TWC B;  4X3K A;  5E3F A;  2J4X A;  1OXU A;  3SEB A;  4WOR A;  1WVL A;  1Y8P B;  3PUY A;  2K05 A;  1CQF A;  4M8A A;  4DAV A;  1MGS A;  4LK1 C;  1OXX K;  1BQQ T;  1QG7 A;  3BVG A;  3K5O A;  2QF7 A;  1EIG A;  3QB3 A;  4WJW A;  5TSS A;  4KJN A;  3FMC A;  1YNJ D;  3HOZ B;  2VNU D;  2RDG A;  5IOC A;  2K04 A;  3BDL A;  2PZW A;  3K5N A;  1SE4 A;  1HRJ A;  2LMC B;  2D9U A;  4DXG A;  5EKI A;  1JWM D;  4FF4 A;  2J0T D;  4F88 A;  3VR3 A;  4Q5V A;  1E2W A;  1ROD A;  3SK5 A;  5FLX L;  2E2I B;  4DU9 A;  1RF2 D;  4FNF A;  2NN6 I;  1TWF B;  4HCE A;  5DM7 3;  3PIP 3;  5C3W A;  4C3I B;  3O13 A;  4KMU C;  5I9O A;  4K6L A;  3K7A B;  4K2L A;  1AZP A;  1U4P A;  4NP5 A;  3R93 A;  3TZD A;  1LLR D;  2EY1 A;  4N9T A;  3FDT A;  5JOB A;  2SNS A;  5C4J B;  3RMH A;  4A3E B;  1D5Z C;  1QE6 A;  4RCO A;  1PTO D;  2QKI C;  2EXZ A;  1HA5 A;  2VB3 X;  1MSH A;  2EDG A;  1BCP D;  2A68 D;  4IUU A;  1JC7 A;  2KCN A;  4A3M B;  4FXG C;  2A69 C;  2QCP X;  3F2U A;  4EQN A;  2KJX A;  2XRQ D;  1Y1V B;  1PTO B;  1K8O A;  1B9N A;  1PFM A;  3TSS A;  5ELC A;  1BCP B;  3K59 A;  2D2C C;  1KLG D;  3MC0 B;  3SHL A;  1S5B D;  1BDO A;  3VYS A;  3IFD A;  4A3D B;  1PFN A;  4XIG S;  1TY0 A;  2NBF A;  1PRT D;  2ZXR A;  1BXT A;  1WD1 A;  5LL6 S;  3FEW X;  2V4D A;  1HUN A;  2RDF A;  4H44 C;  4QCL A;  3NBI A;  1TR5 A;  2WAC A;  1KDB A;  5I2X A;  3PUV A;  3LX0 A;  4BY1 B;  3S2H B;  1EU4 A;  1IYV A;  1IHZ A;  2L0C A;  2WAQ B;  2KED A;  5ELF A;  1J9O A;  1OXS C;  1GUT A;  3FVQ A;  3GD7 A;  1L0Y B;  1ILP A;  1IW7 C;  2DN8 A;  4AYB B;  4UAI A;  1ZYR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...