4RHRA

Crystal structure of pltb
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
EWTGDNTNAYYSDEVISELHVGQIDTSPYFCIKTVKANGSGTPVVACAVSKQSIWAPSFKELLDQARYFYSTGQSVRIHVQKNIWTYPLFVNTFSANALVGLSSCSATQCFGPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Putative pertussis-like toxin subunit
publication title Host adaptation of a bacterial toxin from the human pathogen salmonella typhi.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
total genus 29
structure length 114
sequence length 114
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rhrA00
1S5FD 1FNUA 1FNWA 1G8ZD 1EEID 1XTCD 1JWSD 1SJHD 3GP7A 3BZDB 3DWQA 1HXYD 1MD2D 1LTBD 1I4HA 1EU3A 1DJRD 1UNSA 1PTOB 1S5DD 1S5BD 1JQYD 2NTTA 3TSSA 2NTSA 1AW7A 5ELDA 1PTOD 1CQVA 1PRTC 2TSSA 1FGBD 1TY2A 4RH6A 5I4DA 4L6TB 1FNVA 1RDPD 3BYTB 4RGTA 1LTGD 2J4XA 1EFID 1RF2D 2RDGA 1D5MC 1S5ED 4RGOS 1GOZA 1PZID 1EU4A 1I4GA 2XRSD 1SEBD 1LTAD 1D5ZC 3O13A 1B44D 1LTSD 1UUPA 2QILA 1LT4D 1BCPD 1PTOH 2XNAC 1T5XD 5ELEA 2IJ0A 3BVZA 1PRTB 4DXFA 1PZKD 4C56C 1PYWD 1KLUD 3BVGA 1PRTD 1HA5A 2AQ2B 1LT6D 3MC0B 1JWMD 4Z9CB 2SEBD 4RGNA 3SEBA 1BXTA 1TY0A 1D6EC 1ESFA 5FKAC 4K6LA 1XXGA 3CHBD 3KLSX 1SE3A 2QEJC 1I4RA 3EFXD 3R2TA 4O1NA 1PTOF 2CHBD 1ET6A 3R8BA 4UDUC 2AQ1B 1LTID 1SE4A 1CT1D 2WV6D 2AQ3B 4BWGB 4TSSA 1V1OA 5D3IB 1HTLD 5FK9C 3MFGA 1TS4A 1SE2A 1I4QA 2XRQD 1LT3D 1EEFD 4OHJA 4RGMA 1B1ZA 1EWCA 2Z8LA 1D5XC 1SBBB 4RFBA 1BCPF 3URYA 1I4XA 1LO5D 4RHRA 5TSSA 1M4VA 3R2IA 3DWPA 4DXGA 1LLRD 1RCVD 1I4PA 1CK1A 1TS3A 1ET9A 1KTKA 5D3DA 1QILA 1KLGD 1SJED 5ELBA 3OWEB 1JCKB 1F77A 1FD7D 3BYYB 1ENFA 1V1PB 4RHSA 1CHPD 1RD9D 3BVMA 1SXTA 1LTRD 5ELFA 1CHQD 2XN9C 1PZJD 1AN8A 1BCPC 1S5CD 3W2DA 2R61A 1DYQA 3DWAA 4L63B 2RDHA 1HQRD 1TS5A 4ZYSA 3EA6A 2G9HD 2IPKD 1JWUD 1PTOC 1LT5D 1L0XB 3V05A 2ICIA 4RCOA 2O2LD 1PRTF 1L0YB 1LTTD 5ELCA 1TS2A 1STEA 1JR0D 1BCPB 1V1PA
chains in the Genus database with same CATH superfamily
3A56A 3G6EA 3TRZA 3KF8A 4A3KH 3BZDB 2PCFB 3RMHA 1MIUA 3MXPA 1I4HA 2AUJD 2HDMA 2VS1A 3I4OA 1A15A 4K6DA 5E4WC 4DNIA 1VQ6A 4H44C 3NWTA 3KBXA 4YWLA 3RLFA 3PCOB 2VL6A 2JJQA 5CC4A 2F0LA 1SYDA 3NK9A 2J4XA 3U4VA 4DK6C 3NPPA 2ALYB 3I4MH 3G71A 1GOZA 3SK8A 1EYAA 3QWNA 2KCNA 1Q46A 1B44D 1VF5C 4AH6A 1BCPD 2X6LA 3SR1A 5FLXc 1SNDA 1AZPA 2PI2A 5G3LD 4X65L 5ELNA 3M85A 1VQKA 1LTLA 2EY2A 1BBWA 4U68A 4MNOA 3DM3A 4AYBB 2ATWA 2MPMA 4KKSA 3U50C 1XPRA 4ZUIA 1EY7A 1XMQQ 1TY0A 4OIJA 1P8LA 2RHSB 2SNMA 4HJ8A 2UXBL 2Q2IA 5FK9C 4A3EG 4FF1A 5C0XJ 4HJAA 2WAQG 2I5MX 1HH2P 2PO4A 4RGMA 2J7ZA 4UP8A 4NMZA 4FDBA 1PH4A 1GVPA 4CGYB 1G291 2F52A 1IKLA 2A73B 5TSSA 1SAPA 4DNTB 5EBDA 1EOTA 1DCZA 3Q23A 4JI0Q 2R7ZB 1DZ1A 1VMPA 2PQEA 3R2IA 1UE1A 1CA6A 4BBRG 3ONAB 1KTKA 3DMUA 3T1YL 1SJED 2IL8A 4ABNA 3OWEB 1VQDA 3BYYB 1JJ2A 1VQMA 4Y7NB 4DAYA 4HIDA 2ASBA 1IBLQ 1HR0L 1T9HA 2VQEQ 1VQNA 1OXVA 1S3OA 4MHEA 1Y8PB 3CCRA 3S2DH 4TKOB 1G91A 3U9OA 2Q2UA 4X62Q 2JSOA 3C1FA 1HZ9A 4JG2A 1HUMA 3D6WA 5T1GA 5JPMC 3TDQA 2R6GA 1F9QA 1G8ZD 3KJPA 1K0SA 2GVBA 4E6IA 1HXYD 5JEAG 1N36Q 3GTKB 3BZKA 1BVSA 3MXUA 1PA6A 3FPPA 4DK0A 2RKSA 3VA5A 3S17H 4IJLA 4CDEC 3FPUB 1I3QB 2TSSA 5IGEA 1TY2A 1X32A 1EZ6A 1LTGD 3WDNA 2FMMA 1YI2A 4WORA 1IXRA 3KUPA 3EN2A 1WTVA 3S1RH 2NVYB 3N6RA 4DR6Q 3CQZB 4JW0A 3L3OC 4K5WA 3I3CA 3GDEA 1Y1VB 1GUNA 3BVZA 1I50H 4DXFA 3T13A 3RZOB 3G7LA 1X3FA 2NZ1D 3TZUA 3W5OA 3GTOB 5C3EH 1KRTA 1C0AA 2ZJPA 1D1KA 1E22A 1SR3A 2Q8IB 4A3EB 1PH7A 1A0IA 1I6HH 2WAQB 3VYTA 2EJFC 2L5TA 1SE3A 2K05A 3NBIA 1HNWL 2NVQB 4CDCC 4KV6A 4QJFA 5M3FG 4BBRH 4HTHA 3HOVB 2Y0SE 3BG3A 2ICEC 2I5LX 1WVLA 2OTLA 4OHJA 2G9DA 4PNYA 2DJFC 3RN5A 2DNCA 3A8IE 2UUBQ 3D4DA 2RSOA 4DR1L 2CW0D 1QOHA 3GO5A 1BQQT 2R93G 2OXPA 4ZQ3A 3NENA 4X3KA 2HDLA 1JCKB 1FD7D 4BBSG 2EYHA 1CKMA 1X3GA 1F9PA 1PV4A 4NPSA 2QDBA 1PZJD 2ID0A 1Z9FA 2A6ED 4NXMQ 3FDTA 5NUCA 4U673 3FKIG 5M5WH 2NWGA 3BS1A 4EQOA 1V43A 3PIPA 3GTJB 1YNXA 2IPKD 3VYUA 1G51A 2A6HD 2EYMA 1Y8OB 2BE5C 4RA8A 5EJWA 3J7ZC 1QB5D 3RNUA 3A74A 3NHHA 1EUJA 2FFKB 1ILPA 3G4SA 4OO1G 1K83B 3PUZA 2BCOA 4YCUA 1I6VC 4FNFA 5CYUA 4X64Q 1SYGA 1BR9A 2V4DA 1SJHD 5JJKA 2A68D 3P1HA 1MSHA 2CWAA 1TWFH 1BUVT 3OTOQ 2JEAI 4KTAA 2N3SA 3AQQA 1UNSA 5GAEC 1UWVA 2FJ2A 4ME5A 1PTOD 3HOWG 1B53A 2JQOA 3IKJA 4KKUA 3HKZE 1N8RC 1S5ED 4HIOA 1M8AA 4L5TA 2QA4A 4ME3A 1LTSD 2K75A 2E2JH 4C2MH 3A8KE 5EPKA 2A5HA 1X56A 2PYKA 2NZOA 4J1MA 3CCUA 1Q86C 5JJIA 3VDYA 2BH8A 5FO9B 2ZJQA 5C6AA 1QVCA 1XNRQ 1LM0A 2XSCA 5M3FB 5AFWA 5KEEA 3MWYW 2K5HA 3K0YA 2DN8A 3EFXD 3F2BA 4DUZQ 3ULJA 2M00A 5BR8Q 1EY4A 2R93H 1TR5A 3C46A 3J81i 4AQYQ 1GKHA 2KEDA 1PVOA 4N9PA 1NR2A 1JE4A 4BXXG 4IZ8A 3NEMA 1LO5D 3NQIA 1KC8C 1SRUA 1PH5A 3SE0A 5I9PA 3FKIH 4V190 3LX0A 3TZDA 1SE8A 1LLRD 1RCVD 3QIAA 3S1QB 1ET9A 1GHKA 3UDXA 1ILQA 3E9IA 2MJ8A 1RD9D 3DEOA 3FP9A 1SNCA 1CHQD 2XN9C 2RCNA 5CV5A 4ZUJA 2EYFA 1F9SA 1FR3A 1HQRD 2K5WA 3GTPB 1BF4A 2F0JA 4Y52H 1JWUD 1Q3LA 2B63H 4IPDA 4R4QA 1U4LA 2B8GA 4QB4A 1LTTD 1U4MA 3CXCA 4N9TA 4A3BH 1PH8A 2J0TD 5FJ8H 3HOWH 1XTCD 1GHJA 4UHVA 1GUWA 3C1EA 4LF9L 1VDZA 1AEXA 3F2CA 2KCTA 4LW1A 1IL8A 3CRKC 1NSNS 1PTOB 4NKLA 4RG1A 3DHQA 1G2SA 2NN6H 3T4AC 3NWSA 3A5ZB 3ZJYC 2VQFL 2HCIA 3K59A 1A62A 3E6ZX 2F4VQ 4O42A 1IBKL 2BH2A 2R92G 2L11A 3D4WA 4XYOA 2F0HA 1YJ9A 3O13A 2Q8TA 3VYRA 2QILA 3HP3A 4XT1B 1IYVA 2F4IA 1O7IA 1TKWB 4LF4Q 1SYBA 5E4XA 1JT8A 4X3UA 5DAUA 1MJCA 4FXGC 1DONA 4DAPA 2K52A 5CV4A 1NE3A 4HMJA 2KHJA 1K9MC 4BXXH 2VY3A 3OIQA 5C0XG 5DLQE 1TU2B 3STBC 3HOXG 1EY9A 2AWOA 3RZDH 5EKKA 2JYOA 2UXDL 4WJ4A 1EZ8A 3MAQA 2JA8G 4KI0A 2ZTEA 1D7QA 2B2YC 2JA5G 1U9RA 2L12A 4HIMA 5I6YA 3PMFA 3NQTA 5F2DA 2Z6BA 3W1GA 4IUUA 4IUTA 3DEPA 4DPGA 3AU7A 2G5DA 4QUCA 1H95A 1EIYB 1YZ6A 4HMIA 4UP7A 1V1PB 3KYHC 4OX9L 3AFQA 1TVXA 1QCBD 1S5CD 3GD7A 5JPNC 1MGSA 1A6XA 4IOAA 2WP8J 2F0WA 3C2PA 4PMWA 2PQAB 4LFAQ 3KLSA 4BS9A 2YTYA 1XNQQ 1PRTF 5EBCA 3JAML 2JA6B 4A3MH 5FO8B 4XIGS 1JWSD 3GP7A 1Q8IA 1U4PA 3UDFA 2E2DC 2R92H 3TS0A 2F3WA 3TS2A 3S15H 3GTGB 2WKCA 1PFBA 2VZAA 4R1JA 4P72A 4ID6A 2MO1A 3QG1A 1HFNA 4KHPQ 1OXXK 1PHJA 2D5DA 1T5EA 4QQBX 1NMFA 3PIP3 4IALA 5IGFA 2NBFA 4A3GH 2VUMB 1B2TA 3Q22A 1LTAD 1D5ZC 3J7AV 2ENBA 4DA2A 4EQPA 2XNAC 4IN3A 1Y8NB 1D1IA 1AE3A 5CV7A 4LF8Q 4LFBQ 3VR6A 3HOXH 3A8JE 4DV5L 3F2UA 3OOCA 1PYWD 4LF6L 4A93B 2F0SA 1F9RA 1TWAB 4RMFA 2SEBD 4JI2Q 1L0WA 2BE5D 4B3SQ 5K36H 2JA5H 4IUVA 3H0GG 1WTHA 4GOPB 1XXGA 3KLSX 4RWSC 3TP6A 1GUOA 4HJ7A 2JA8B 2B2WA 2Q8RE 3S1MB 4DV3Q 1RTNA 2RF4A 4DR2L 2IT1A 3F1ZA 2KEEA 3PO2H 4LJZC 4JI8Q 1YHBA 2YYZA 1O7ZA 2KENA 4PV1C 1SE2A 2QDLA 1IYUA 2CKZB 3CW2C 1X65A 4DAVA 5IT9c 3M4OB 1ICFB 1Q12A 2DNEA 4GKKQ 4NXNL 2EVBA 2A6EC 4DN4M 2M9VA 3M3YH 1KDCA 4DUYL 1DXMA 1RHPA 4GLVB 3TQYA 4FVMA 2SOBA 2A6HC 5JJZA 1LACA 3P75A 4AYBG 5A2QE 5M3MH 2KQ3A 4EVOA 1R9TH 1SSOA 4CKCA 2B2WC 3IAYA 2A68C 4K5VA 3I90A 2K5DA 2R3ZA 4POFA 2KA7A 1WTPA 3D8GA 3J7AF 4R8IA 4ZK9B 3T53B 1EY5A 3KLWA 2B39A 5CV9A 1PTOC 5IYBG 4JOIA 1W6JA 3H3VC 1K3RA 3H15A 1VQEA 4QY7A 3VR4A 3JAMi 3B6YA 2R7ZG 5EPJA 4X65Q 2R7DA 2BOSA 4IPCA 2A1AA 3TSSA 5HURA 2LXKA 5IWAL 4G7OC 2F0KA 2NVXB 4ZKCB 2IX3A 1Z47A 3S24A 4WJ3M 4RGOS 2P5ZX 1ASZA 5J39A 2I5HA 4JOIC 2KHSA 1DOMA 2F0NA 1YITA 5DEHA 1WTQA 5C4XB 4HN7A 1S72A 3CPFA 2YU9B 1KAWA 3H0GB 4C3HB 1KIXA 2PW7A 3ULLA 1CZWA 1PRTD 2VB2X 1UE7A 2AQ2B 3UI2A 4A3JH 3I72A 1Q1EA 1ZYRD 2PQAA 5IP7G 3UE1A 5KIXA 4IFDH 3IFDA 1N9WA 4OWWB 2EIFA 4PZ8A 4CDFC 2HIVA 2L55A 5I6WA 4K6LA 4DR5L 5C44G 4B3ML 4BY1B 3T1YQ 5CBAE 4JI1Q 2VXWA 1HPCA 1YEZA 4DGZA 3CMAA 1LTID 4B08A 3TBIB 1F2YA 3HOYB 3RD4A 4ZKBB 1PYBA 1SLJA 3MFGA 4PMBA 2WIIB 3QO2A 1LT3D 4KLKA 2EDGA 4R4IA 1PLFA 2Y0SB 2KVMA 4LUZA 1CM9A 1KRSA 2Z1CA 3URYA 1CSPA 5KYLA 2CVRA 2HHHL 1M4VA 1Y1VG 3PUYA 4UPAA 2D2CC 1C48A 2FXQA 4A3IB 1TS3A 1E2WA 2UUAL 1KLGD 3HEJA 5IYBH 3NTKA 1QUQB 5D65A 3NBHB 1W2BA 3FMCA 3KOJA 2UXCQ 1OXTA 5IGCA 5IYCH 2PMZB 2R7ZH 5AJ3L 3AB9A 4YHHQ 1TS5A 2NB0A 4HEDA 1AFPA 5IYDH 4ZYSA 3L2PA 4KMUC 3CF5A 2F3IA 3LNNA 1QZGA 3HOVG 2IWHA 5LMUL 4GOPA 1L0XB 2ICIA 5HGQA 1QZHA 3STBD 4Y7NH 4DV7L 4JCVE 5J22A 1S5FD 3A55A 1N34L 3CCVA 2ES2A 4XQQA 2L15A 1EFWA 1MJEA 4QGUA 5GROA 1O7LA 2K5NA 5IT9L 5LMNL 3I2ZA 1ML0D 1Y69U 2K7VA 4R4TA 4O2DA 4LF7Q 1IZ6A 5IP7H 3KK7A 1VF7A 1HRJA 3KBGA 1PZID 4DK1A 4X66Q 3GTKH 3VR2A 3HKZB 4C1NK 1G6ZA 1STGA 4GOPC 1EYGA 1FJGL 5KNDA 5ELEA 1T5XD 1CKNB 1PRTB 4I7ZC 3U58A 1D8LA 4WRDA 1I3QH 1KABA 5C44B 3UDIA 2EYLA 1NUCA 4F8MA 5M5XB 1E0BA 1V9PA 2A69C 3NTHA 4LFCL 1R4PB 4Z9CB 3C3LA 3ITPA 1GM5A 5IGGA 1NR4A 2CWPA 4CJ0B 4RKBA 1XMQL 4MN3A 2B2VA 1XPOA 2NVYH 2K5VA 2QGQA 1RL2A 3CQZH 2KCMA 4XTCS 2N78A 2K1BA 2CHBD 4DR7Q 3UE0A 5LL6S 3GTQB 4K8IA 1Y1VH 3S1NB 3KLRA 4PZ6A 3RZOH 4L5QA 5M5YH 1X55A 2PZUA 1HHVA 3PGZA 4LK1C 4IUNA 2MNAA 4RCNA 1TXYA 4A3EH 2RBMA 3KDFB 4FYDA 4BA1I 2NVQH 1SNMA 4RHRA 4JI0L 1VQFA 4EQ5A 2BA1A 1F2LA 1U0LA 3HOVH 3HS0C 1CKOA 5ELBA 4DV4L 5M9OA 1A3TA 1FGUA 2B2VC 4N8X1 3J81L 2OQKA 2X6GA 1KDAA 1LTRD 4ODGA 3TN2A 4B9WA 4NDXA 3Q0AA 2VQEL 4MTKA 3WWVA 4OXPA 3SK4A 4M1UB 5JOBA 1XPUA 2G9HD 4C3JG 1WTXA 4JI3Q 1EY6A 3V05A 5IP9G 3ERSX 1WD1A 2Z6KA 1IBML 1A63A 1IW7C 1FNWA 4EGVA 2EOTA 3M7NA 1VQAA 3U4ZA 1K8MA 3D4RA 3GTJH 1BO0A 3NSWA 3OIPA 1S5DD 4K2KA 2NTTA 3ULPA 2RDFA 1AW7A 2TMPA 5JEAH 2NVTB 1FGBD 4ULLA 1JE5A 5I4DA 3H91A 1K83H 1G2TA 1D5MC 3BDCA 4YIJA 4CHTB 2N8NA 1MSGA 1I4GA 3LWUA 1QUQA 5C5MA 3NBHA 4DR6L 1KQSA 1VQ4A 3ER0A 1TT2A 4JBJA 2UUCL 1CI3M 2F3VA 1WTRA 2XWJB 4JK1C 4B3RL 2KHIA 2O5JC 1PZKD 2Z6KC 1Z6HA 3CKIB 1PXUA 3HG9A 4H0LC 5LL6X 5H1SE 1ZXTA 5KYIA 2F0TA 4KJOA 3BZCA 3RR5A 1BXTA 1H9JA 3I55A 2F0OA 1HTPA 2F0QA 4HJ9A 4KN7C 1QNUA 4GKJQ 1X3QA 1VQ7A 4XQJA 4KHVA 5K5PA 3J80L 2L1BA 1ENAA 5IY0A 2F03A 1PH6A 4H7BA 5FLXE 5KGUA 1E3PA 3I8ZA 4BY7G 5KNBA 3VR5A 5M3FH 2KUMA 3H09A 5BN4A 2UUBL 4ZAIA 2LFNA 1F2MA 1VCIA 1GJXA 4LUOA 2D0OA 2D9UA 4C3IB 4HSPA 3JAMc 1N33L 1I5FA 1SMYC 2PPBC 4OWXB 4RHSA 3ND9A 4LF9Q 4JBWA 3HZXA 2MUYA 2ZM6Q 1CKNA 2OEOA 3CC2A 4C3JB 4A3LG 3K5LA 3GTLB 4LUVA 2EY6A 1VQCA 1EWIA 4JI5L 1DYQA 4DFAA 3I73A 4YCVA 1YHQA 4BBSH 1A3VA 3K5OA 4R4CA 4YY3L 3EA6A 2VQFQ 3S1QH 2A74C 3CC4A 5EPLA 1IBKQ 5IGDA 1RJTA 1TS2A 2F0PA 5CMDA 3A7LA 1I94L 1CQFA 1KNAA 2ZXOA 3BU2A 2K50A 3GTPH 4WJWA 4FXDA 1C4QA 4OO1H 1DJRD 3KDFA 2I46A 5ELDA 2WAQE 5HGTA 2EPBA 1PRTC 4OEMB 4P74A 2NZHA 1EY0A 2YTXA 3PO3G 1ZYRC 1XMOL 1WD0A 3KJOA 3S16B 1TWHB 4YCWA 3SGIA 5EGTA 1X9NA 4KD3A 4DR3Q 1PTOH 1B9NA 4A3FB 3H3VH 4IPHA 3HOZB 2E74C 2MP1A 3A7AB 5J1ZA 1HA5A 2L0CA 3L0OA 4HR7B 2JA6G 1LT6D 2RVLA 3G6JB 5CBEE 4RGNA 1CUKA 1XNRL 4DV0Q 3CAMA 1PMRA 4J6HA 2PNRC 2OQ0A 1LABA 3R2TA 1LV9A 4BY7B 2HUGA 2EZVA 4HAEA 4DV2L 2E2HB 2AQ3B 4TSSA 4OX9Q 4A3BB 4BA2I 3WOEA 4PG3A 1PFMA 2XWBB 1PH2A 3J80i 1B1ZA 2VUMG 2LMCB 1SBBB 4QF4A 4JI4Q 2CFMA 3PUVA 4A3LH 1I4XA 2WB1E 2E5LL 4JI7L 3RLNA 2XVSA 4L8JA 1HCZA 2F1MA 3EBEA 1GXDC 1Q8KA 2EYOA 2IX1A 4A93G 1DD2A 3W3AA 1BOSA 3I56A 5E1FA 3HKSA 3J7A5 4A3DB 2Z0SA 1J5EL 3MXNB 2F0MA 1PH9A 3KFUA 3S2HB 2JN4A 2CH4W 2CCZA 1VQHA 2RA4A 3SK5A 2ZXPA 1FYCA 5C5LA 2A69D 2RDHA 1CZGA 2PW5A 3MA2B 1YIJA 4GN3B 4GZYC 4GNXB 1OO9B 1SN8A 2N49A 4IJHA 1R4QB 4K2LA 5LHY1 4QIWB 1J9OA 3A0JA 4JV5L 2Q2HA 4P2CB 1SFOB 1O78A 4DR4L 1HNZQ 1HNXL 2EXDA 2WINB 4JYAQ 5C3WA 2EQSA 1ZEQX 4IUPA 3PO3B 1EU3A 1UEBA 1W3SA 3CU7A 4P75A 4HJ5A 1CQVA 1GO3E 2VNUD 3R3OA 1VQBA 4JI6L 3E0EA 2JA6H 3FHWA 5I2XA 2CQAA 5CV6A 1F2ZA 3N52A 1YNJD 2K6AA 3GTGH 2NN6I 4K0KQ 1HUNA 3MTSA 1AP0A 4DK3C 1VMCA 5I9OA 3OYYA 3ZYYX 3DLLA 1J6QA 3WOFA 5A35A 2MO0A 1QWYA 1X3EA 2L9HA 5CV8A 2VUMH 1AH9A 1IW7D 1JB7A 1X6OA 4JPBW 2XIWA 3RUZA 4A75A 1SE4A 2Q2TA 2OT2A 1QE6A 5D3IB 3M7GA 1HTLD 2F0DA 1K0RA 1SNQA 5C0XH 4A93H 4GLXA 1TWAH 4A3MB 3E3XA 2FHTA 1KXLA 5CR3A 1BCPF 1H9SB 1WCMG 2JA8H 4CKEA 5G3LF 4OWTB 2K32A 2ZXRA 3TP8A 3S1MH 3IRBA 5C4XG 3OMGA 3I4NG 4C3HG 4DAMA 3FVQA 3JAME 1DOKA 1F77A 3M4OH 1TWCB 3MFYA 3MEFA 3GTMB 3DUZA 1Y1WG 2X69A 3BVMA 2K5QA 3MZ5A 3S9WA 3I7FA 4B3TQ 2K01A 3TEHB 4L63B 4BY1G 1U5KA 1EY8A 2XTIA 4GLAC 1AZQA 3HOYG 4LFAL 2QF7A 2O5IC 2E76C 4DV6Q 5KNCA 4KY7A 1DM0B 2E2IB 1TWGB 1C9OA 4A3KG 1L0YB 2RHQB 4LAAA 2K28A 1RODA 2Y0SG 3MHBA 3CCSA 1FNUA 3LGJA 1EEID 3JC66 4ALPA 2KCCA 5HY6A 1JOKA 3NE5B 3K80C 1MD2D 4GN4B 3NXWA 4A3IG 3D0FA 3OPOA 4KHPL 1B3QA 3PIOA 3I4MG 2JA7B 1GUTA 3HFZB 3CCJA 3PUWA 3RLOA 1RDPD 2NYZD 1TIID 1RF2D 5EKIA 2BDOA 1SMYD 3I70A 1EU4A 3F8TA 4QMGA 4DNRB 1VQ5A 3CP0A 3PV0A 3Q24A 2MFIA 3MXNA 1NBWA 1ASYA 4LFBL 2AMCB 4DU9A 5C4JB 3QOLA 4RAUC 1MBYA 1KLUD 2NVXH 3R93A 4GNXA 1B70B 4B3SL 4V0BA 3SEBA 4L5SA 1SYFA 1KL9A 3HOUB 1ESFA 3EQLC 1JOOA 4LWCA 1PYSB 4DF7A 3M4YA 1M90C 1QNKA 1K8OA 5C4XH 3CCMA 4FXKC 1CT1D 2QCPX 3H0GH 1STHA 3W1BA 2UU9L 1WCMB 2NUCA 3M4PA 2UXBQ 1OTCA 3J81c 1TS4A 2DY8A 1WTOA 3A5UA 1I4QA 3K7AB 3I91A 3I4NB 1JOQA 4C1NI 2D62A 4NB3A 1HZCA 3HKZG 3T1HL 1DGSA 4KY6A 5LMUQ 4BY1H 1M1KC 5ELOA 1Y1WB 4HCSA 1YJNA 2JK8A 1WI5A 3HOYH 4DV7Q 2Z4IA 3S14B 4GNXC 5C4HA 1A3UA 5EKLA 4CDDC 1N34Q 1VQGA 4POGA 1CA5A 2PI2E 5GADC 3L9AX 1VQ8A 1H9KA 1HR0Q 2V1CC 1XWEA 2B2TA 3DWAA 5LMNQ 3I4LA 4A3KB 2B2UA 4MIUA 3H94A 3SXHA 2IY5B 2CH4A 4A3IH 1G6PA 2RCFA 4A3JB 4A76A 1C8CA 1LT5D 1J8IA 3J81j 2Z4HA 4S3SA 4FF2A 2SDFA 2LY7A 2F0EA 1VQ9A 4L5RC 2ZTDA 4LF5L 5DM63 1FJGQ 1FL0A 1TQOA 1WFQA 3I4MB 3CPWA 2MQHA 5COYA 1NJIC 1LTBD 4F7XA 3CRLC 1NNXA 5CGKA 1KD1C 1VQPA 1N32L 2K4KA 4LFCQ 1H9SA 4OGQC 1CFMA 4KD4A 3HRZC 2A19A 1KDBA 2B2TC 4JC0A 2B2UC 4DV1L 2RDGA 2EXZA 1ONLA 2GN5A 1SNPA 1STBA 1UUPA 3J80c 5C3EG 1JORA 1E1OA 3P20A 2HIXA 3FEWX 1KHIA 4IO9A 4A3CG 1B7YB 2EYJA 1ESRA 2R7FA 2MGSA 5FO7B 3LWEA 4ZRZA 1D6EC 5FKAC 3K8AA 1HNWQ 4P71A 1PTOF 4QUFA 4CKBA 4JI1L 4DV4Q 4UDUC 2AQ1B 2JE6I 1Q7YC 2LSSA 5C44H 4IFDI 1K28A 2F0IA 1YJWA 5M5XH 2VB3X 1EEFD 1K8AC 1L1OB 4AIMA 4UAIA 2H5XA 3AEVA 1OXUA 2M2LA 1EWHA 2HCCA 5E7NA 4DR1Q 3GTQH 2EE1A 3S1NH 3DWPA 3S2DB 1CK1A 1UE6A 1IBMQ 4KY5A 2IHEA 1JJGA 1CHPD 1SXTA 3K58A 2WB1G 1AN8A 2UXCL 3E5SA 3GTOH 4I7AA 3K5NA 3D3RA 3NP8A 5C3XA 5IT9E 4YHHL 3CMEA 2B3GA 4NXML 5JAVA 1SYCA 1IKMA 3T56B 3S17B 1EQVA 5IODA 1K73C 2H4OA 1X54A 1Y14B 1BCPB 3BVGA 1UAPA 1PFSA 5BN3A 2UUCQ 1YNJC 3X3NA 3DWQA 1XTDA 3K7UC 3S1RB 1IBLL 4B3RQ 3ERQA 4X3SA 1HFGA 4C3IG 5M5YB 2F0GA 1QVGA 3OW7A 4TQUS 5DNFA 4DKAC 1SNOA 1I50B 1B8AA 3IL8A 1RIPA 1O80A 3BYTB 3KF6B 3D31A 4KK7A 2AHOB 2IHFA 4RGTA 4X62L 5C3EB 3F2DA 4LF7L 4A3CH 4KJNA 4X66L 1I6HB 2K33A 5EAYA 1B9MA 1SROA 4XYQA 2YTVA 3GV6A 3SVMA 2K04A 3RN2A 2N55A 4P73A 1N36L 2L4NA 2NVTH 4AYBE 4BBRB 4H02A 1YHAA 3SHLA 1JWMD 2BA0A 3PIO3 4IFDJ 2HT1A 3K57A 1MI2A 1VQLA 2JXMB 3T16A 4TRDA 5C4ZA 2N88A 4O1NA 1H9MA 3E9HA 4DR7L 5CORA 1ET6A 1N33Q 3BDOA 2WV6D 1YVCA 2KBNA 2PMZE 4ZLTF 5FLXL 2YV5A 3J81E 3AYHB 4EQNA 1EYDA 4JI5Q 4X6AH 1QJOA 1AE2A 1YNNC 1X3PA 2K03A 5IOCA 2KECA 1EWCA 2Z8LA 1D5XC 4YY3Q 2HQLA 5IIFA 2SNSA 3CCLA 1IHZA 1S40A 4A3FG 5M5WB 3PUXA 4IUQA 2WB1B 3HOZG 4DXGA 2C5CA 1I4PA 4OONA 1YBYA 2AKWB 3V2TA 3K5MA 1CTMA 1I94Q 2PNHA 1ENFA 2OCEA 3AFPA 3MEHA 1HZAA 4QCLA 2B8FA 3FRPB 4WFN3 3PF4A 2VW9A 3W2DA 1BDOA 2B63G 4G7ZC 4OIKA 1TWFB 4R9WA 4XXEA 1ENCA 2EJGC 4I65A 4C3IH 4A3BG 4JI3L 5FJ8G 3L7ZC 1XMOQ 3TP7A 1HZBA 1RTOA 1VQIA 1KNEA 3CCEA 5ELCA 1STEA 5T1IA 1QVFA 3A54A 4C3JH 1BKBA 1ZKOA 3GTLH 1JC7A 3SK6A 2I07B 5IP9H 1D2BA 1BNZA 2NN6G 1L1OA 2E2JB 1SDFA 3NUCA 5KRUA 4RKLA 1JQYD 2HD3A 2HQEA 4C2MB 1DOLA 3OHXC 4IQZA 4A3DG 2I0QA 4RH6A 1MKHA 3M4QA 4F88A 2C35B 4MZ9A 1EQQA 1RKNA 4CBVA 3TP5A 1WOCA 5E3FA 3U9SA 1QG7A 4DV2Q 2DJGC 4X64L 1LT4D 4KN4C 4A4IA 3UDGA 3J80E 5GAHC 3OTOL 4GS3A 2WACA 2R93B 2H1EA 4XDXA 3VYSA 3VR3A 3AMUA 5I2YA 4BBSB 3S16H 2E5LQ 1TWHH 4ILWA 4JI7Q 1L1OC 1OXSC 1UE5A 3MXGA 1EQTA 3OSOA 2QEJC 1SYEA 4Q0FA 4H13C 4A3FH 3FKIB 3R8BA 2O4XA 3CCQA 4GKJL 3HOZH 3VA7A 1J5EQ 1V1OA 2UXDQ 3DM1A 2D0PA 3Q8DA 3PF5A 3IFTA 2ZJRA 1V8QA 3M9BA 1XX8A 2A8VA 2BDNA 4N8FA 3KF6A 2QKIC 1C7YA 3T51B 4BY7H 2E2HH 1JICA 4DUZL 4Q5VA 2B63B 5D3DA 1QILA 4JV5Q 4JBMA 4IPGA 4DR4Q 1HNXQ 3QR8A 5BR8L 2ZT9C 2ZM6L 1STNA 3HOWB 1BCPC 4YWKA 2R61A 2WFWA 4AQYL 1E1TA 4PMCA 5D14A 4IURA 4NW2A 5GAGC 2KJXA 4JI6Q 2F0VA 1GD7A 4NP5A 3OW2A 4A3MG 1EIHA 2PZWA 4A3DH 2KOLA 2B2YA 3S2HH 4CJ1B 1XJVA 2FMCA 2LXJA 2EYPA 1E2ZA 2LS01 1GUGA 2DY7A 3TMEA 2E8GA 5JJLA 1S5BD 4JBKA 1LYLA 3QJYA 4A3GG 4K8JA 3K6OA 5JEAJ 2EJMA 4L6TB 1NAPA 4UP9A 4OO1I 1EFID 1SFOH 2RSNA 4FP5D 4X3TA 2XRSD 3PO3H 1NTGA 4DR3L 1HA6A 2IJ0A 1NCVA 5FLMG 4G7HC 1H9RA 1W6KA 4DV5Q 3RZDB 5K36G 1PH1A 4LF6Q 4XT3B 1EIGA 2OWOA 1Q1BA 4K5XA 4PQXA 4R4OA 4DV0L 4GN5A 5GQOA 3PO2G 1EL0A 3H3VI 3D6CA 3PSIA 1WTWA 3X3MA 4KHZA 2AUKA 4M8AA 2F4VL 1EOVA 1EYCA 2DUDA 4DR2Q 1P16A 2XGTA 2JA7G 5IGBA 1VS0A 3KF8B 4XQNA 2XRQD 2RQXA 4J15A 3J7YW 1K3BC 3E0JA 4LF4L 5IE8A 2F0UA 4JI4L 1A2UA 4UY8C 1II3A 4NXNQ 1PH3A 1EIFA 1HQMC 1VQOA 4K14A 4DUYQ 2JEBI 3EIVA 5M3MG 2OTJA 5ISRA 1JB3A 5JVH3 5DM73 3CC7A 2CQOA 2F0FA 3K0XA 1KAAA 4F87A 1B4OA 3EROA 3HOUG 3EJIA 4LMQD 4LNQA 2B29A 3OMCA 1E2VA 2R92B 1A2TA 3S15B 1UEAB 2QW7A 5JVG3 3PQIA 2PZTA 1JMCA 2C9OA 2IW3A 1TWCH 3GTMH 2DGYA 3EVQA 4PZ7A 1B50A 5A2QL 1LUZA 2ZTCA 4A3GB 4ZCKA 3ND8A 1HNZL 4G57A 3DXJC 4JYAL 1YNND 2FINB 3GV3A 2E75C 5FLMH 2NTSA 3HOXB 4APVA 5IWAQ 2E2IH 1TWGH 1S4ZA 4IOCA 4FF4A 1FNVA 1Q90A 1XNQL 3MVVA 1BBXC 2CW0C 2JA5B 1Q81C 1V1QA 2UU9Q 1SEBD 1XYIA 1WJJA 4K0KL 2MHVA 3QOJA 4JVZA 2JA9A 4A3JG 1IL2A 1HR0W 4OELB 4DAYB 4CJ2C 1L2FA 3PO2B 1Z7TA 3P7JA 3V96A 5LMNW 3ICEA 4IFDG 4C56C 2JA7H 1CSQA 1O7YA 1ICWA 3HGBA 3NELA 2GVAA 3MC0B 3T1HQ 1A8VA 4HSVA 2EY1A 1JJCB 4OL7A 2K14A 3BDLA 1FVIA 3BJUA 3CHBD 4DR5Q 3M3YB 1I4RA 4B3MQ 2GA4B 1NMGA 3CD6A 2Z9HA 4R8NA 5C4JH 5J3BA 4BWGB 1SMXA 1U4RA 1NY4A 4LF8L 3K81C 5EQ0A 1K8GA 4EX5A 5M3MB 1Q82C 2LKVA 4MTNA 3G48A 4O0AA 1R9TB 4RFBA 1IYJB 1STYA 2AWNA 3HOUH 4HIKA 4G4KA 2QEXA 4JI2L 1E7ZA 4QIWE 5FOBB 2HHHQ 5C0XI 4FO2A 3SDZA 4J8QA 1WCMH 4B9XA 4FF3A 1VQJA 4DV3L 2UUAQ 4LF5Q 3H6MA 5IYCG 4KKTA 3K7AH 1PFNA 4QL5A 2YU9H 3I4NH 1E24A 2IX0A 3OWFA 4JI8L 4C3HH 4YWMA 2WKDA 5IYDG 5ELFA 4B3TL 4HCEA 1PDQA 1N32Q 2EY5A 1MHWC 5AJ3Q 1Y1WH 3NTIA 4GKKL 1B3AA 5BN5A 2JP1A 1BBUA 1EQRA 1GUSA 3QB3A 3S14H 1STAA 4DV6L 3GQBA 2OF1A 4TVAB 4DV1Q 4RCOA 1JR0D 1HJPA 3TREA 1WYDA 3Q6SA 5L37A 2O2LD 1V1PA
chains in the Genus database with same CATH topology
3A56A 3KF8A 3BZDB 2PCFB 3RMHA 3MXPA 1I4HA 2AUJD 2HDMA 1A15A 4K6DA 5E4WC 4H44C 3NWTA 3KBXA 3RLFA 5CC4A 2F0LA 1SYDA 3NK9A 2J4XA 3NPPA 1GOZA 3SK8A 1EYAA 3QWNA 2KCNA 1B44D 1VF5C 1BCPD 2X6LA 3SR1A 1SNDA 1AZPA 5G3LD 3M85A 2EY2A 4U68A 4AYBB 2MPMA 4KKSA 4ZUIA 1EY7A 1TY0A 4OIJA 2SNMA 5FK9C 4FF1A 5C0XJ 2PO4A 4RGMA 2J7ZA 4NMZA 4CGYB 1G291 1IKLA 2A73B 5TSSA 1SAPA 4DNTB 5EBDA 1EOTA 1DCZA 3Q23A 2R7ZB 1DZ1A 1VMPA 2PQEA 3R2IA 1CA6A 3ONAB 1KTKA 3DMUA 1SJED 2IL8A 4ABNA 3OWEB 3BYYB 4Y7NB 4DAYA 1OXVA 4MHEA 1Y8PB 4TKOB 1G91A 3U9OA 2JSOA 3C1FA 1HUMA 3D6WA 5T1GA 5JPMC 3TDQA 2R6GA 1F9QA 1G8ZD 4E6IA 5JEAG 1HXYD 3GTKB 3MXUA 3FPPA 4DK0A 2RKSA 3VA5A 3FPUB 1I3QB 2TSSA 5IGEA 1TY2A 1X32A 1EZ6A 1LTGD 3WDNA 2FMMA 4WORA 3KUPA 1WTVA 2NVYB 3N6RA 3CQZB 3L3OC 4K5WA 3I3CA 1Y1VB 1GUNA 3BVZA 4DXFA 3T13A 3RZOB 3G7LA 2NZ1D 3TZUA 3GTOB 1D1KA 2Q8IB 4A3EB 2WAQB 3VYTA 2EJFC 2L5TA 1SE3A 2K05A 3NBIA 2NVQB 4KV6A 4HTHA 3HOVB 3BG3A 2ICEC 1WVLA 4OHJA 2G9DA 4PNYA 2DNCA 3A8IE 3D4DA 2RSOA 2CW0D 1QOHA 3GO5A 1BQQT 2OXPA 4ZQ3A 4X3KA 2HDLA 1JCKB 1FD7D 2EYHA 1F9PA 2QDBA 1PZJD 2ID0A 2A6ED 3FDTA 5NUCA 4U673 2NWGA 3BS1A 4EQOA 1V43A 3GTJB 2IPKD 3VYUA 2A6HD 2EYMA 1Y8OB 2BE5C 4RA8A 5EJWA 1QB5D 3NHHA 1ILPA 2FFKB 4OO1G 1K83B 3PUZA 2BCOA 1I6VC 4FNFA 5CYUA 1SYGA 1BR9A 2V4DA 1SJHD 2A68D 3P1HA 1MSHA 1BUVT 2JEAI 4KTAA 1UNSA 2FJ2A 4ME5A 1PTOD 1B53A 3IKJA 4KKUA 1S5ED 1M8AA 1LTSD 3A8KE 5EPKA 2A5HA 2PYKA 4J1MA 5FO9B 5C6AA 2XSCA 5M3FB 5AFWA 5KEEA 3MWYW 3K0YA 2DN8A 3EFXD 2M00A 1EY4A 1TR5A 3C46A 2KEDA 4N9PA 1NR2A 1JE4A 4IZ8A 1LO5D 3NQIA 3SE0A 5I9PA 4V190 3LX0A 3TZDA 1LLRD 1RCVD 3QIAA 3S1QB 1ET9A 1GHKA 1ILQA 2MJ8A 1RD9D 3DEOA 1SNCA 1CHQD 2XN9C 5CV5A 4ZUJA 2EYFA 1F9SA 1FR3A 1HQRD 2K5WA 3GTPB 1BF4A 2F0JA 1JWUD 1Q3LA 1U4LA 2B8GA 4QB4A 1LTTD 1U4MA 4N9TA 2J0TD 1XTCD 1GHJA 1GUWA 3C1EA 1VDZA 1AEXA 1IL8A 3CRKC 1NSNS 1PTOB 4NKLA 3DHQA 1G2SA 2NN6H 3T4AC 3NWSA 2HCIA 3K59A 3E6ZX 4O42A 2L11A 3D4WA 4XYOA 2F0HA 3O13A 2Q8TA 3VYRA 2QILA 3HP3A 4XT1B 1IYVA 2F4IA 1TKWB 1SYBA 5E4XA 4X3UA 5DAUA 4FXGC 1DONA 4DAPA 5CV4A 4HMJA 3OIQA 5C0XG 1TU2B 1EY9A 2AWOA 5EKKA 2JYOA 1EZ8A 3MAQA 4KI0A 2B2YC 1U9RA 2L12A 5I6YA 3PMFA 3NQTA 5F2DA 4IUUA 4IUTA 3DEPA 3AU7A 4QUCA 4HMIA 1V1PB 1TVXA 1QCBD 1S5CD 3GD7A 5JPNC 1MGSA 1A6XA 2WP8J 2F0WA 3C2PA 4PMWA 3KLSA 4BS9A 1PRTF 5EBCA 3JAML 2JA6B 5FO8B 4XIGS 1JWSD 3GP7A 1Q8IA 1U4PA 2E2DC 2F3WA 3GTGB 2WKCA 1PFBA 4ID6A 3QG1A 1HFNA 1OXXK 2D5DA 1T5EA 3PIP3 4IALA 5IGFA 2NBFA 2VUMB 1B2TA 3Q22A 1LTAD 1D5ZC 3J7AV 2ENBA 4DA2A 4EQPA 2XNAC 4IN3A 1Y8NB 1D1IA 5CV7A 3VR6A 3A8JE 3F2UA 3OOCA 1PYWD 4A93B 2F0SA 1F9RA 1TWAB 2SEBD 2BE5D 5K36H 4IUVA 1XXGA 3KLSX 4RWSC 3TP6A 1GUOA 2JA8B 2B2WA 2Q8RE 3S1MB 1RTNA 2IT1A 2KEEA 4LJZC 2YYZA 1O7ZA 4PV1C 1SE2A 1IYUA 4DAVA 3M4OB 1Q12A 2DNEA 2EVBA 2A6EC 4DN4M 2M9VA 1KDCA 1DXMA 1RHPA 4FVMA 2SOBA 2A6HC 5JJZA 1LACA 3P75A 5A2QE 2KQ3A 4EVOA 1SSOA 4CKCA 2B2WC 3IAYA 2A68C 4K5VA 3I90A 2K5DA 2R3ZA 2KA7A 1WTPA 3D8GA 3J7AF 4R8IA 4ZK9B 3T53B 1EY5A 2B39A 5CV9A 1PTOC 1W6JA 3H3VC 3VR4A 5EPJA 2BOSA 3TSSA 5HURA 4G7OC 2F0KA 2NVXB 4ZKCB 2IX3A 1Z47A 4RGOS 5J39A 2KHSA 1DOMA 2F0NA 5DEHA 1WTQA 5C4XB 4HN7A 2YU9B 3H0GB 4C3HB 2PW7A 1CZWA 1PRTD 2VB2X 2AQ2B 3UI2A 3I72A 1Q1EA 1ZYRD 5KIXA 4IFDH 3IFDA 2L55A 5I6WA 4K6LA 4BY1B 5CBAE 2VXWA 1HPCA 4DGZA 1LTID 4B08A 3TBIB 1F2YA 3HOYB 3RD4A 4ZKBB 3MFGA 4PMBA 2WIIB 3QO2A 1LT3D 2EDGA 1PLFA 2Y0SB 2KVMA 1CM9A 2Z1CA 3URYA 5KYLA 2CVRA 1M4VA 3PUYA 2D2CC 1C48A 4A3IB 1TS3A 1E2WA 1KLGD 3HEJA 3NTKA 5D65A 3FMCA 1OXTA 5IGCA 2PMZB 3AB9A 1TS5A 2NB0A 4HEDA 1AFPA 4ZYSA 4KMUC 3LNNA 2IWHA 1L0XB 2ICIA 5J22A 1S5FD 3A55A 4XQQA 1O7LA 5IT9L 1ML0D 1Y69U 2K7VA 3KK7A 1VF7A 1HRJA 3KBGA 1PZID 4DK1A 3VR2A 3HKZB 4C1NK 1G6ZA 1STGA 5KNDA 5ELEA 1T5XD 1PRTB 4I7ZC 4WRDA 1KABA 5C44B 2EYLA 1NUCA 4F8MA 5M5XB 1E0BA 2A69C 3NTHA 1R4PB 4Z9CB 3C3LA 3ITPA 5IGGA 1NR4A 4CJ0B 4RKBA 4MN3A 2B2VA 4XTCS 2K1BA 2CHBD 5LL6S 3GTQB 4K8IA 3S1NB 3KLRA 2PZUA 1HHVA 4LK1C 4IUNA 4RCNA 2RBMA 4FYDA 4BA1I 1SNMA 4RHRA 2BA1A 1F2LA 3HS0C 5ELBA 5M9OA 1A3TA 2B2VC 3J81L 2X6GA 1KDAA 1LTRD 4ODGA 3TN2A 4B9WA 4NDXA 3Q0AA 3SK4A 4M1UB 5JOBA 2G9HD 4C3JG 1WTXA 1EY6A 3V05A 1WD1A 1IW7C 1FNWA 4EGVA 2EOTA 3M7NA 1K8MA 3D4RA 1BO0A 3NSWA 3OIPA 1S5DD 4K2KA 2NTTA 2RDFA 1AW7A 2TMPA 5JEAH 2NVTB 1FGBD 4ULLA 5I4DA 3H91A 1G2TA 1D5MC 3BDCA 4YIJA 4CHTB 1MSGA 1I4GA 3LWUA 5C5MA 3NBHA 1TT2A 1CI3M 2F3VA 1WTRA 2XWJB 4JK1C 2O5JC 1PZKD 1Z6HA 3CKIB 1PXUA 3HG9A 4H0LC 5LL6X 1ZXTA 5KYIA 2F0TA 4KJOA 1BXTA 1H9JA 2F0OA 1HTPA 2F0QA 4KN7C 1QNUA 1X3QA 4XQJA 4KHVA 5K5PA 3J80L 2L1BA 1ENAA 2F03A 4H7BA 5FLXE 5KGUA 3I8ZA 5KNBA 3VR5A 2KUMA 3H09A 5BN4A 4ZAIA 2LFNA 1F2MA 1VCIA 1GJXA 2D9UA 4C3IB 4HSPA 1SMYC 2PPBC 4RHSA 3ND9A 4JBWA 3HZXA 2MUYA 2OEOA 4C3JB 3K5LA 3GTLB 2EY6A 4DFAA 1DYQA 3I73A 1A3VA 3K5OA 3EA6A 2A74C 5EPLA 5IGDA 1RJTA 1TS2A 2F0PA 5CMDA 3A7LA 1CQFA 1KNAA 2ZXOA 4FXDA 4WJWA 1C4QA 4OO1H 1DJRD 2I46A 5ELDA 5HGTA 2EPBA 1PRTC 1EY0A 1ZYRC 1WD0A 3S16B 1TWHB 5EGTA 4KD3A 1PTOH 1B9NA 4A3FB 3HOZB 2E74C 2MP1A 3A7AB 5J1ZA 1HA5A 2L0CA 4HR7B 1LT6D 2RVLA 3G6JB 5CBEE 4RGNA 1PMRA 4J6HA 2PNRC 3R2TA 1LABA 1LV9A 4BY7B 2HUGA 2EZVA 4HAEA 2E2HB 2AQ3B 4TSSA 4A3BB 4BA2I 3WOEA 1PFMA 2XWBB 1B1ZA 2LMCB 1SBBB 4QF4A 3PUVA 1I4XA 2XVSA 4L8JA 1HCZA 2F1MA 2IX1A 1GXDC 2EYOA 1DD2A 3W3AA 1BOSA 5E1FA 4A3DB 2F0MA 3S2HB 2RA4A 3SK5A 2ZXPA 1FYCA 5C5LA 2A69D 2RDHA 1CZGA 2PW5A 3MA2B 4GZYC 1OO9B 1R4QB 4K2LA 5LHY1 4QIWB 1J9OA 4P2CB 1SFOB 1O78A 2WINB 5C3WA 1ZEQX 4IUPA 3PO3B 1EU3A 3CU7A 1CQVA 2VNUD 3R3OA 5I2XA 2CQAA 5CV6A 1F2ZA 3N52A 1YNJD 2K6AA 2NN6I 1HUNA 3MTSA 1AP0A 1VMCA 5I9OA 3ZYYX 3WOFA 5A35A 1QWYA 2L9HA 5CV8A 1IW7D 2XIWA 3RUZA 1SE4A 2OT2A 1QE6A 5D3IB 1HTLD 2F0DA 3M7GA 1SNQA 5C0XH 4A3MB 2FHTA 5CR3A 1BCPF 1H9SB 4CKEA 5G3LF 2K32A 2ZXRA 3TP8A 3OMGA 4C3HG 3FVQA 3JAME 1DOKA 1F77A 1TWCB 3MFYA 3GTMB 3DUZA 2X69A 3BVMA 2K5QA 3MZ5A 3S9WA 2K01A 4L63B 1EY8A 1AZQA 2QF7A 2O5IC 2E76C 5KNCA 4KY7A 1DM0B 2E2IB 1TWGB 1L0YB 4LAAA 2K28A 1RODA 3MHBA 1FNUA 1EEID 2KCCA 1JOKA 3NE5B 1MD2D 3NXWA 3OPOA 2JA7B 1GUTA 3PUWA 1RDPD 2NYZD 1TIID 1RF2D 5EKIA 2BDOA 1SMYD 3I70A 1EU4A 4QMGA 4DNRB 3PV0A 3Q24A 3MXNA 4DU9A 5C4JB 3QOLA 4RAUC 1MBYA 1KLUD 3R93A 4V0BA 3SEBA 1SYFA 3HOUB 1ESFA 3EQLC 1JOOA 4DF7A 3M4YA 1QNKA 1K8OA 4FXKC 1CT1D 2QCPX 1STHA 1WCMB 2NUCA 1TS4A 2DY8A 1WTOA 1I4QA 3K7AB 3I91A 3I4NB 1JOQA 4C1NI 2D62A 4KY6A 1Y1WB 4HCSA 2Z4IA 3S14B 5C4HA 1A3UA 5EKLA 1CA5A 3L9AX 1H9KA 1XWEA 2B2TA 3DWAA 3I4LA 4A3KB 2B2UA 4MIUA 3H94A 3SXHA 4A3JB 1C8CA 1LT5D 1J8IA 2Z4HA 4S3SA 4FF2A 2SDFA 2LY7A 2F0EA 5DM63 1TQOA 3I4MB 5COYA 1LTBD 4F7XA 3CRLC 5CGKA 1H9SA 4OGQC 1CFMA 4KD4A 3HRZC 1KDBA 2B2TC 2B2UC 2RDGA 2EXZA 1ONLA 1SNPA 1STBA 1UUPA 1JORA 3P20A 3FEWX 2EYJA 1ESRA 2MGSA 5FO7B 3LWEA 4ZRZA 1D6EC 5FKAC 1PTOF 4QUFA 4CKBA 4UDUC 2AQ1B 2JE6I 4IFDI 2F0IA 2VB3X 1EEFD 4UAIA 1OXUA 2M2LA 1EWHA 2HCCA 2EE1A 3DWPA 3S2DB 1CK1A 4KY5A 1CHPD 1SXTA 3K58A 1AN8A 3E5SA 3K5NA 3D3RA 3NP8A 5C3XA 5IT9E 5JAVA 1SYCA 1IKMA 3T56B 3S17B 1EQVA 5IODA 2H4OA 1BCPB 3BVGA 1UAPA 5BN3A 1YNJC 3X3NA 3DWQA 3S1RB 3ERQA 4X3SA 1HFGA 4C3IG 5M5YB 2F0GA 3OW7A 4TQUS 5DNFA 1SNOA 1I50B 3IL8A 4KK7A 1O80A 3BYTB 3D31A 4RGTA 5C3EB 4KJNA 1I6HB 2K33A 1B9MA 4XYQA 3GV6A 3SVMA 2K04A 2N55A 2L4NA 4BBRB 3SHLA 1JWMD 2BA0A 3PIO3 4IFDJ 3K57A 1MI2A 2JXMB 3T16A 4TRDA 5C4ZA 2N88A 4O1NA 1H9MA 5CORA 1ET6A 3BDOA 2WV6D 4ZLTF 5FLXL 3J81E 4EQNA 1EYDA 1QJOA 1YNNC 1X3PA 2K03A 5IOCA 2KECA 1EWCA 2Z8LA 1D5XC 5IIFA 2SNSA 1IHZA 5M5WB 3PUXA 4IUQA 2WB1B 4DXGA 2C5CA 1I4PA 3V2TA 3K5MA 1CTMA 1ENFA 3MEHA 4QCLA 2B8FA 3FRPB 4WFN3 3W2DA 1BDOA 4G7ZC 4OIKA 1TWFB 4R9WA 4XXEA 1ENCA 2EJGC 4I65A 3L7ZC 3TP7A 1RTOA 1KNEA 5ELCA 1STEA 5T1IA 3A54A 1ZKOA 1JC7A 3SK6A 2I07B 1D2BA 1BNZA 2NN6G 2E2JB 1SDFA 3NUCA 5KRUA 4RKLA 1JQYD 2HQEA 4C2MB 1DOLA 3OHXC 4IQZA 4RH6A 4F88A 1RKNA 4CBVA 3TP5A 5E3FA 3U9SA 1QG7A 1LT4D 4KN4C 3J80E 2WACA 2R93B 2H1EA 4XDXA 3VYSA 3VR3A 3AMUA 5I2YA 4BBSB 4ILWA 1OXSC 3MXGA 1EQTA 3OSOA 2QEJC 1SYEA 4Q0FA 4H13C 3FKIB 3R8BA 2O4XA 3VA7A 1V1OA 3DM1A 3IFTA 1V8QA 1XX8A 2BDNA 2QKIC 3T51B 1JICA 4Q5VA 2B63B 5D3DA 1QILA 2ZT9C 1STNA 3HOWB 1BCPC 2R61A 4PMCA 5D14A 4IURA 4NW2A 2KJXA 2F0VA 4NP5A 1EIHA 2PZWA 2KOLA 2B2YA 4CJ1B 2FMCA 2EYPA 1E2ZA 2LS01 1GUGA 2DY7A 3TMEA 1S5BD 3QJYA 4K8JA 3K6OA 5JEAJ 2EJMA 4L6TB 1NAPA 4OO1I 1EFID 2RSNA 4FP5D 4X3TA 2XRSD 1HA6A 2IJ0A 1NCVA 4G7HC 1H9RA 1W6KA 3RZDB 5K36G 4XT3B 1EIGA 1Q1BA 4K5XA 4PQXA 1EL0A 3D6CA 1WTWA 3X3MA 4KHZA 2AUKA 4M8AA 1EYCA 5IGBA 4XQNA 2XRQD 2RQXA 3J7YW 3E0JA 2F0UA 1A2UA 1II3A 1HQMC 4K14A 2JEBI 5ISRA 1JB3A 5JVH3 5DM73 2F0FA 1KAAA 4F87A 1B4OA 3EROA 3EJIA 4LMQD 3OMCA 1E2VA 2R92B 1A2TA 3S15B 1UEAB 5JVG3 2PZTA 2C9OA 2IW3A 3EVQA 1B50A 5A2QL 4A3GB 3ND8A 4G57A 3DXJC 1YNND 2FINB 3GV3A 2E75C 2NTSA 3HOXB 1S4ZA 4FF4A 1FNVA 1Q90A 3MVVA 1BBXC 2CW0C 2JA5B 1SEBD 1XYIA 2MHVA 3QOJA 4CJ2C 3PO2B 1Z7TA 3P7JA 3V96A 4IFDG 4C56C 1O7YA 1ICWA 3HGBA 3MC0B 4HSVA 2EY1A 4OL7A 3BDLA 3CHBD 3M3YB 1I4RA 2GA4B 4R8NA 4BWGB 1U4RA 5EQ0A 5M3MB 2LKVA 1R9TB 4RFBA 1STYA 2AWNA 4G4KA 5FOBB 5C0XI 4FO2A 3SDZA 4J8QA 4B9XA 4FF3A 3H6MA 4KKTA 1PFNA 2IX0A 3OWFA 2WKDA 5ELFA 4HCEA 1PDQA 2EY5A 3NTIA 1B3AA 5BN5A 2JP1A 1GUSA 3QB3A 1STAA 3GQBA 2OF1A 4RCOA 1JR0D 3Q6SA 2O2LD 1V1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5F D;  1FNU A;  1FNW A;  1G8Z D;  1EEI D;  1XTC D;  1JWS D;  1SJH D;  3GP7 A;  3BZD B;  3DWQ A;  1HXY D;  1MD2 D;  1LTB D;  1I4H A;  1EU3 A;  1DJR D;  1UNS A;  1PTO B;  1S5D D;  1S5B D;  1JQY D;  2NTT A;  3TSS A;  2NTS A;  1AW7 A;  5ELD A;  1PTO D;  1CQV A;  1PRT C;  2TSS A;  1FGB D;  1TY2 A;  4RH6 A;  5I4D A;  4L6T B;  1FNV A;  1RDP D;  3BYT B;  4RGT A;  1LTG D;  2J4X A;  1EFI D;  1RF2 D;  2RDG A;  1D5M C;  1S5E D;  4RGO S;  1GOZ A;  1PZI D;  1EU4 A;  1I4G A;  2XRS D;  1SEB D;  1LTA D;  1D5Z C;  3O13 A;  1B44 D;  1LTS D;  1UUP A;  2QIL A;  1LT4 D;  1BCP D;  1PTO H;  2XNA C;  1T5X D;  5ELE A;  2IJ0 A;  3BVZ A;  1PRT B;  4DXF A;  1PZK D;  4C56 C;  1PYW D;  1KLU D;  3BVG A;  1PRT D;  1HA5 A;  2AQ2 B;  1LT6 D;  3MC0 B;  1JWM D;  4Z9C B;  2SEB D;  4RGN A;  3SEB A;  1BXT A;  1TY0 A;  1D6E C;  1ESF A;  5FKA C;  4K6L A;  1XXG A;  3CHB D;  3KLS X;  1SE3 A;  2QEJ C;  1I4R A;  3EFX D;  3R2T A;  4O1N A;  1PTO F;  2CHB D;  1ET6 A;  3R8B A;  4UDU C;  2AQ1 B;  1LTI D;  1SE4 A;  1CT1 D;  2WV6 D;  2AQ3 B;  4BWG B;  4TSS A;  1V1O A;  5D3I B;  1HTL D;  5FK9 C;  3MFG A;  1TS4 A;  1SE2 A;  1I4Q A;  2XRQ D;  1LT3 D;  1EEF D;  4OHJ A;  4RGM A;  1B1Z A;  1EWC A;  2Z8L A;  1D5X C;  1SBB B;  4RFB A;  1BCP F;  3URY A;  1I4X A;  1LO5 D;  4RHR A;  5TSS A;  1M4V A;  3R2I A;  3DWP A;  4DXG A;  1LLR D;  1RCV D;  1I4P A;  1CK1 A;  1TS3 A;  1ET9 A;  1KTK A;  5D3D A;  1QIL A;  1KLG D;  1SJE D;  5ELB A;  3OWE B;  1JCK B;  1F77 A;  1FD7 D;  3BYY B;  1ENF A;  1V1P B;  4RHS A;  1CHP D;  1RD9 D;  3BVM A;  1SXT A;  1LTR D;  5ELF A;  1CHQ D;  2XN9 C;  1PZJ D;  1AN8 A;  1BCP C;  1S5C D;  3W2D A;  2R61 A;  1DYQ A;  3DWA A;  4L63 B;  2RDH A;  1HQR D;  1TS5 A;  4ZYS A;  3EA6 A;  2G9H D;  2IPK D;  1JWU D;  1PTO C;  1LT5 D;  1L0X B;  3V05 A;  2ICI A;  4RCO A;  2O2L D;  1PRT F;  1L0Y B;  1LTT D;  5ELC A;  1TS2 A;  1STE A;  1JR0 D;  1BCP B;  1V1P A; 
#chains in the Genus database with same CATH topology
 3A56 A;  3G6E A;  3TRZ A;  3KF8 A;  4A3K H;  3BZD B;  2PCF B;  3RMH A;  1MIU A;  3MXP A;  1I4H A;  2AUJ D;  2HDM A;  2VS1 A;  3I4O A;  1A15 A;  4K6D A;  5E4W C;  4DNI A;  1VQ6 A;  4H44 C;  3NWT A;  3KBX A;  4YWL A;  3RLF A;  3PCO B;  2VL6 A;  2JJQ A;  5CC4 A;  2F0L A;  1SYD A;  3NK9 A;  2J4X A;  3U4V A;  4DK6 C;  3NPP A;  2ALY B;  3I4M H;  3G71 A;  1GOZ A;  3SK8 A;  1EYA A;  3QWN A;  2KCN A;  1Q46 A;  1B44 D;  1VF5 C;  4AH6 A;  1BCP D;  2X6L A;  3SR1 A;  5FLX c;  1SND A;  1AZP A;  2PI2 A;  5G3L D;  4X65 L;  5ELN A;  3M85 A;  1VQK A;  1LTL A;  2EY2 A;  1BBW A;  4U68 A;  4MNO A;  3DM3 A;  4AYB B;  2ATW A;  2MPM A;  4KKS A;  3U50 C;  1XPR A;  4ZUI A;  1EY7 A;  1XMQ Q;  1TY0 A;  4OIJ A;  1P8L A;  2RHS B;  2SNM A;  4HJ8 A;  2UXB L;  2Q2I A;  5FK9 C;  4A3E G;  4FF1 A;  5C0X J;  4HJA A;  2WAQ G;  2I5M X;  1HH2 P;  2PO4 A;  4RGM A;  2J7Z A;  4UP8 A;  4NMZ A;  4FDB A;  1PH4 A;  1GVP A;  4CGY B;  1G29 1;  2F52 A;  1IKL A;  2A73 B;  5TSS A;  1SAP A;  4DNT B;  5EBD A;  1EOT A;  1DCZ A;  3Q23 A;  4JI0 Q;  2R7Z B;  1DZ1 A;  1VMP A;  2PQE A;  3R2I A;  1UE1 A;  1CA6 A;  4BBR G;  3ONA B;  1KTK A;  3DMU A;  3T1Y L;  1SJE D;  2IL8 A;  4ABN A;  3OWE B;  1VQD A;  3BYY B;  1JJ2 A;  1VQM A;  4Y7N B;  4DAY A;  4HID A;  2ASB A;  1IBL Q;  1HR0 L;  1T9H A;  2VQE Q;  1VQN A;  1OXV A;  1S3O A;  4MHE A;  1Y8P B;  3CCR A;  3S2D H;  4TKO B;  1G91 A;  3U9O A;  2Q2U A;  4X62 Q;  2JSO A;  3C1F A;  1HZ9 A;  4JG2 A;  1HUM A;  3D6W A;  5T1G A;  5JPM C;  3TDQ A;  2R6G A;  1F9Q A;  1G8Z D;  3KJP A;  1K0S A;  2GVB A;  4E6I A;  1HXY D;  5JEA G;  1N36 Q;  3GTK B;  3BZK A;  1BVS A;  3MXU A;  1PA6 A;  3FPP A;  4DK0 A;  2RKS A;  3VA5 A;  3S17 H;  4IJL A;  4CDE C;  3FPU B;  1I3Q B;  2TSS A;  5IGE A;  1TY2 A;  1X32 A;  1EZ6 A;  1LTG D;  3WDN A;  2FMM A;  1YI2 A;  4WOR A;  1IXR A;  3KUP A;  3EN2 A;  1WTV A;  3S1R H;  2NVY B;  3N6R A;  4DR6 Q;  3CQZ B;  4JW0 A;  3L3O C;  4K5W A;  3I3C A;  3GDE A;  1Y1V B;  1GUN A;  3BVZ A;  1I50 H;  4DXF A;  3T13 A;  3RZO B;  3G7L A;  1X3F A;  2NZ1 D;  3TZU A;  3W5O A;  3GTO B;  5C3E H;  1KRT A;  1C0A A;  2ZJP A;  1D1K A;  1E22 A;  1SR3 A;  2Q8I B;  4A3E B;  1PH7 A;  1A0I A;  1I6H H;  2WAQ B;  3VYT A;  2EJF C;  2L5T A;  1SE3 A;  2K05 A;  3NBI A;  1HNW L;  2NVQ B;  4CDC C;  4KV6 A;  4QJF A;  5M3F G;  4BBR H;  4HTH A;  3HOV B;  2Y0S E;  3BG3 A;  2ICE C;  2I5L X;  1WVL A;  2OTL A;  4OHJ A;  2G9D A;  4PNY A;  2DJF C;  3RN5 A;  2DNC A;  3A8I E;  2UUB Q;  3D4D A;  2RSO A;  4DR1 L;  2CW0 D;  1QOH A;  3GO5 A;  1BQQ T;  2R93 G;  2OXP A;  4ZQ3 A;  3NEN A;  4X3K A;  2HDL A;  1JCK B;  1FD7 D;  4BBS G;  2EYH A;  1CKM A;  1X3G A;  1F9P A;  1PV4 A;  4NPS A;  2QDB A;  1PZJ D;  2ID0 A;  1Z9F A;  2A6E D;  4NXM Q;  3FDT A;  5NUC A;  4U67 3;  3FKI G;  5M5W H;  2NWG A;  3BS1 A;  4EQO A;  1V43 A;  3PIP A;  3GTJ B;  1YNX A;  2IPK D;  3VYU A;  1G51 A;  2A6H D;  2EYM A;  1Y8O B;  2BE5 C;  4RA8 A;  5EJW A;  3J7Z C;  1QB5 D;  3RNU A;  3A74 A;  3NHH A;  1EUJ A;  2FFK B;  1ILP A;  3G4S A;  4OO1 G;  1K83 B;  3PUZ A;  2BCO A;  4YCU A;  1I6V C;  4FNF A;  5CYU A;  4X64 Q;  1SYG A;  1BR9 A;  2V4D A;  1SJH D;  5JJK A;  2A68 D;  3P1H A;  1MSH A;  2CWA A;  1TWF H;  1BUV T;  3OTO Q;  2JEA I;  4KTA A;  2N3S A;  3AQQ A;  1UNS A;  5GAE C;  1UWV A;  2FJ2 A;  4ME5 A;  1PTO D;  3HOW G;  1B53 A;  2JQO A;  3IKJ A;  4KKU A;  3HKZ E;  1N8R C;  1S5E D;  4HIO A;  1M8A A;  4L5T A;  2QA4 A;  4ME3 A;  1LTS D;  2K75 A;  2E2J H;  4C2M H;  3A8K E;  5EPK A;  2A5H A;  1X56 A;  2PYK A;  2NZO A;  4J1M A;  3CCU A;  1Q86 C;  5JJI A;  3VDY A;  2BH8 A;  5FO9 B;  2ZJQ A;  5C6A A;  1QVC A;  1XNR Q;  1LM0 A;  2XSC A;  5M3F B;  5AFW A;  5KEE A;  3MWY W;  2K5H A;  3K0Y A;  2DN8 A;  3EFX D;  3F2B A;  4DUZ Q;  3ULJ A;  2M00 A;  5BR8 Q;  1EY4 A;  2R93 H;  1TR5 A;  3C46 A;  3J81 i;  4AQY Q;  1GKH A;  2KED A;  1PVO A;  4N9P A;  1NR2 A;  1JE4 A;  4BXX G;  4IZ8 A;  3NEM A;  1LO5 D;  3NQI A;  1KC8 C;  1SRU A;  1PH5 A;  3SE0 A;  5I9P A;  3FKI H;  4V19 0;  3LX0 A;  3TZD A;  1SE8 A;  1LLR D;  1RCV D;  3QIA A;  3S1Q B;  1ET9 A;  1GHK A;  3UDX A;  1ILQ A;  3E9I A;  2MJ8 A;  1RD9 D;  3DEO A;  3FP9 A;  1SNC A;  1CHQ D;  2XN9 C;  2RCN A;  5CV5 A;  4ZUJ A;  2EYF A;  1F9S A;  1FR3 A;  1HQR D;  2K5W A;  3GTP B;  1BF4 A;  2F0J A;  4Y52 H;  1JWU D;  1Q3L A;  2B63 H;  4IPD A;  4R4Q A;  1U4L A;  2B8G A;  4QB4 A;  1LTT D;  1U4M A;  3CXC A;  4N9T A;  4A3B H;  1PH8 A;  2J0T D;  5FJ8 H;  3HOW H;  1XTC D;  1GHJ A;  4UHV A;  1GUW A;  3C1E A;  4LF9 L;  1VDZ A;  1AEX A;  3F2C A;  2KCT A;  4LW1 A;  1IL8 A;  3CRK C;  1NSN S;  1PTO B;  4NKL A;  4RG1 A;  3DHQ A;  1G2S A;  2NN6 H;  3T4A C;  3NWS A;  3A5Z B;  3ZJY C;  2VQF L;  2HCI A;  3K59 A;  1A62 A;  3E6Z X;  2F4V Q;  4O42 A;  1IBK L;  2BH2 A;  2R92 G;  2L11 A;  3D4W A;  4XYO A;  2F0H A;  1YJ9 A;  3O13 A;  2Q8T A;  3VYR A;  2QIL A;  3HP3 A;  4XT1 B;  1IYV A;  2F4I A;  1O7I A;  1TKW B;  4LF4 Q;  1SYB A;  5E4X A;  1JT8 A;  4X3U A;  5DAU A;  1MJC A;  4FXG C;  1DON A;  4DAP A;  2K52 A;  5CV4 A;  1NE3 A;  4HMJ A;  2KHJ A;  1K9M C;  4BXX H;  2VY3 A;  3OIQ A;  5C0X G;  5DLQ E;  1TU2 B;  3STB C;  3HOX G;  1EY9 A;  2AWO A;  3RZD H;  5EKK A;  2JYO A;  2UXD L;  4WJ4 A;  1EZ8 A;  3MAQ A;  2JA8 G;  4KI0 A;  2ZTE A;  1D7Q A;  2B2Y C;  2JA5 G;  1U9R A;  2L12 A;  4HIM A;  5I6Y A;  3PMF A;  3NQT A;  5F2D A;  2Z6B A;  3W1G A;  4IUU A;  4IUT A;  3DEP A;  4DPG A;  3AU7 A;  2G5D A;  4QUC A;  1H95 A;  1EIY B;  1YZ6 A;  4HMI A;  4UP7 A;  1V1P B;  3KYH C;  4OX9 L;  3AFQ A;  1TVX A;  1QCB D;  1S5C D;  3GD7 A;  5JPN C;  1MGS A;  1A6X A;  4IOA A;  2WP8 J;  2F0W A;  3C2P A;  4PMW A;  2PQA B;  4LFA Q;  3KLS A;  4BS9 A;  2YTY A;  1XNQ Q;  1PRT F;  5EBC A;  3JAM L;  2JA6 B;  4A3M H;  5FO8 B;  4XIG S;  1JWS D;  3GP7 A;  1Q8I A;  1U4P A;  3UDF A;  2E2D C;  2R92 H;  3TS0 A;  2F3W A;  3TS2 A;  3S15 H;  3GTG B;  2WKC A;  1PFB A;  2VZA A;  4R1J A;  4P72 A;  4ID6 A;  2MO1 A;  3QG1 A;  1HFN A;  4KHP Q;  1OXX K;  1PHJ A;  2D5D A;  1T5E A;  4QQB X;  1NMF A;  3PIP 3;  4IAL A;  5IGF A;  2NBF A;  4A3G H;  2VUM B;  1B2T A;  3Q22 A;  1LTA D;  1D5Z C;  3J7A V;  2ENB A;  4DA2 A;  4EQP A;  2XNA C;  4IN3 A;  1Y8N B;  1D1I A;  1AE3 A;  5CV7 A;  4LF8 Q;  4LFB Q;  3VR6 A;  3HOX H;  3A8J E;  4DV5 L;  3F2U A;  3OOC A;  1PYW D;  4LF6 L;  4A93 B;  2F0S A;  1F9R A;  1TWA B;  4RMF A;  2SEB D;  4JI2 Q;  1L0W A;  2BE5 D;  4B3S Q;  5K36 H;  2JA5 H;  4IUV A;  3H0G G;  1WTH A;  4GOP B;  1XXG A;  3KLS X;  4RWS C;  3TP6 A;  1GUO A;  4HJ7 A;  2JA8 B;  2B2W A;  2Q8R E;  3S1M B;  4DV3 Q;  1RTN A;  2RF4 A;  4DR2 L;  2IT1 A;  3F1Z A;  2KEE A;  3PO2 H;  4LJZ C;  4JI8 Q;  1YHB A;  2YYZ A;  1O7Z A;  2KEN A;  4PV1 C;  1SE2 A;  2QDL A;  1IYU A;  2CKZ B;  3CW2 C;  1X65 A;  4DAV A;  5IT9 c;  3M4O B;  1ICF B;  1Q12 A;  2DNE A;  4GKK Q;  4NXN L;  2EVB A;  2A6E C;  4DN4 M;  2M9V A;  3M3Y H;  1KDC A;  4DUY L;  1DXM A;  1RHP A;  4GLV B;  3TQY A;  4FVM A;  2SOB A;  2A6H C;  5JJZ A;  1LAC A;  3P75 A;  4AYB G;  5A2Q E;  5M3M H;  2KQ3 A;  4EVO A;  1R9T H;  1SSO A;  4CKC A;  2B2W C;  3IAY A;  2A68 C;  4K5V A;  3I90 A;  2K5D A;  2R3Z A;  4POF A;  2KA7 A;  1WTP A;  3D8G A;  3J7A F;  4R8I A;  4ZK9 B;  3T53 B;  1EY5 A;  3KLW A;  2B39 A;  5CV9 A;  1PTO C;  5IYB G;  4JOI A;  1W6J A;  3H3V C;  1K3R A;  3H15 A;  1VQE A;  4QY7 A;  3VR4 A;  3JAM i;  3B6Y A;  2R7Z G;  5EPJ A;  4X65 Q;  2R7D A;  2BOS A;  4IPC A;  2A1A A;  3TSS A;  5HUR A;  2LXK A;  5IWA L;  4G7O C;  2F0K A;  2NVX B;  4ZKC B;  2IX3 A;  1Z47 A;  3S24 A;  4WJ3 M;  4RGO S;  2P5Z X;  1ASZ A;  5J39 A;  2I5H A;  4JOI C;  2KHS A;  1DOM A;  2F0N A;  1YIT A;  5DEH A;  1WTQ A;  5C4X B;  4HN7 A;  1S72 A;  3CPF A;  2YU9 B;  1KAW A;  3H0G B;  4C3H B;  1KIX A;  2PW7 A;  3ULL A;  1CZW A;  1PRT D;  2VB2 X;  1UE7 A;  2AQ2 B;  3UI2 A;  4A3J H;  3I72 A;  1Q1E A;  1ZYR D;  2PQA A;  5IP7 G;  3UE1 A;  5KIX A;  4IFD H;  3IFD A;  1N9W A;  4OWW B;  2EIF A;  4PZ8 A;  4CDF C;  2HIV A;  2L55 A;  5I6W A;  4K6L A;  4DR5 L;  5C44 G;  4B3M L;  4BY1 B;  3T1Y Q;  5CBA E;  4JI1 Q;  2VXW A;  1HPC A;  1YEZ A;  4DGZ A;  3CMA A;  1LTI D;  4B08 A;  3TBI B;  1F2Y A;  3HOY B;  3RD4 A;  4ZKB B;  1PYB A;  1SLJ A;  3MFG A;  4PMB A;  2WII B;  3QO2 A;  1LT3 D;  4KLK A;  2EDG A;  4R4I A;  1PLF A;  2Y0S B;  2KVM A;  4LUZ A;  1CM9 A;  1KRS A;  2Z1C A;  3URY A;  1CSP A;  5KYL A;  2CVR A;  2HHH L;  1M4V A;  1Y1V G;  3PUY A;  4UPA A;  2D2C C;  1C48 A;  2FXQ A;  4A3I B;  1TS3 A;  1E2W A;  2UUA L;  1KLG D;  3HEJ A;  5IYB H;  3NTK A;  1QUQ B;  5D65 A;  3NBH B;  1W2B A;  3FMC A;  3KOJ A;  2UXC Q;  1OXT A;  5IGC A;  5IYC H;  2PMZ B;  2R7Z H;  5AJ3 L;  3AB9 A;  4YHH Q;  1TS5 A;  2NB0 A;  4HED A;  1AFP A;  5IYD H;  4ZYS A;  3L2P A;  4KMU C;  3CF5 A;  2F3I A;  3LNN A;  1QZG A;  3HOV G;  2IWH A;  5LMU L;  4GOP A;  1L0X B;  2ICI A;  5HGQ A;  1QZH A;  3STB D;  4Y7N H;  4DV7 L;  4JCV E;  5J22 A;  1S5F D;  3A55 A;  1N34 L;  3CCV A;  2ES2 A;  4XQQ A;  2L15 A;  1EFW A;  1MJE A;  4QGU A;  5GRO A;  1O7L A;  2K5N A;  5IT9 L;  5LMN L;  3I2Z A;  1ML0 D;  1Y69 U;  2K7V A;  4R4T A;  4O2D A;  4LF7 Q;  1IZ6 A;  5IP7 H;  3KK7 A;  1VF7 A;  1HRJ A;  3KBG A;  1PZI D;  4DK1 A;  4X66 Q;  3GTK H;  3VR2 A;  3HKZ B;  4C1N K;  1G6Z A;  1STG A;  4GOP C;  1EYG A;  1FJG L;  5KND A;  5ELE A;  1T5X D;  1CKN B;  1PRT B;  4I7Z C;  3U58 A;  1D8L A;  4WRD A;  1I3Q H;  1KAB A;  5C44 B;  3UDI A;  2EYL A;  1NUC A;  4F8M A;  5M5X B;  1E0B A;  1V9P A;  2A69 C;  3NTH A;  4LFC L;  1R4P B;  4Z9C B;  3C3L A;  3ITP A;  1GM5 A;  5IGG A;  1NR4 A;  2CWP A;  4CJ0 B;  4RKB A;  1XMQ L;  4MN3 A;  2B2V A;  1XPO A;  2NVY H;  2K5V A;  2QGQ A;  1RL2 A;  3CQZ H;  2KCM A;  4XTC S;  2N78 A;  2K1B A;  2CHB D;  4DR7 Q;  3UE0 A;  5LL6 S;  3GTQ B;  4K8I A;  1Y1V H;  3S1N B;  3KLR A;  4PZ6 A;  3RZO H;  4L5Q A;  5M5Y H;  1X55 A;  2PZU A;  1HHV A;  3PGZ A;  4LK1 C;  4IUN A;  2MNA A;  4RCN A;  1TXY A;  4A3E H;  2RBM A;  3KDF B;  4FYD A;  4BA1 I;  2NVQ H;  1SNM A;  4RHR A;  4JI0 L;  1VQF A;  4EQ5 A;  2BA1 A;  1F2L A;  1U0L A;  3HOV H;  3HS0 C;  1CKO A;  5ELB A;  4DV4 L;  5M9O A;  1A3T A;  1FGU A;  2B2V C;  4N8X 1;  3J81 L;  2OQK A;  2X6G A;  1KDA A;  1LTR D;  4ODG A;  3TN2 A;  4B9W A;  4NDX A;  3Q0A A;  2VQE L;  4MTK A;  3WWV A;  4OXP A;  3SK4 A;  4M1U B;  5JOB A;  1XPU A;  2G9H D;  4C3J G;  1WTX A;  4JI3 Q;  1EY6 A;  3V05 A;  5IP9 G;  3ERS X;  1WD1 A;  2Z6K A;  1IBM L;  1A63 A;  1IW7 C;  1FNW A;  4EGV A;  2EOT A;  3M7N A;  1VQA A;  3U4Z A;  1K8M A;  3D4R A;  3GTJ H;  1BO0 A;  3NSW A;  3OIP A;  1S5D D;  4K2K A;  2NTT A;  3ULP A;  2RDF A;  1AW7 A;  2TMP A;  5JEA H;  2NVT B;  1FGB D;  4ULL A;  1JE5 A;  5I4D A;  3H91 A;  1K83 H;  1G2T A;  1D5M C;  3BDC A;  4YIJ A;  4CHT B;  2N8N A;  1MSG A;  1I4G A;  3LWU A;  1QUQ A;  5C5M A;  3NBH A;  4DR6 L;  1KQS A;  1VQ4 A;  3ER0 A;  1TT2 A;  4JBJ A;  2UUC L;  1CI3 M;  2F3V A;  1WTR A;  2XWJ B;  4JK1 C;  4B3R L;  2KHI A;  2O5J C;  1PZK D;  2Z6K C;  1Z6H A;  3CKI B;  1PXU A;  3HG9 A;  4H0L C;  5LL6 X;  5H1S E;  1ZXT A;  5KYI A;  2F0T A;  4KJO A;  3BZC A;  3RR5 A;  1BXT A;  1H9J A;  3I55 A;  2F0O A;  1HTP A;  2F0Q A;  4HJ9 A;  4KN7 C;  1QNU A;  4GKJ Q;  1X3Q A;  1VQ7 A;  4XQJ A;  4KHV A;  5K5P A;  3J80 L;  2L1B A;  1ENA A;  5IY0 A;  2F03 A;  1PH6 A;  4H7B A;  5FLX E;  5KGU A;  1E3P A;  3I8Z A;  4BY7 G;  5KNB A;  3VR5 A;  5M3F H;  2KUM A;  3H09 A;  5BN4 A;  2UUB L;  4ZAI A;  2LFN A;  1F2M A;  1VCI A;  1GJX A;  4LUO A;  2D0O A;  2D9U A;  4C3I B;  4HSP A;  3JAM c;  1N33 L;  1I5F A;  1SMY C;  2PPB C;  4OWX B;  4RHS A;  3ND9 A;  4LF9 Q;  4JBW A;  3HZX A;  2MUY A;  2ZM6 Q;  1CKN A;  2OEO A;  3CC2 A;  4C3J B;  4A3L G;  3K5L A;  3GTL B;  4LUV A;  2EY6 A;  1VQC A;  1EWI A;  4JI5 L;  1DYQ A;  4DFA A;  3I73 A;  4YCV A;  1YHQ A;  4BBS H;  1A3V A;  3K5O A;  4R4C A;  4YY3 L;  3EA6 A;  2VQF Q;  3S1Q H;  2A74 C;  3CC4 A;  5EPL A;  1IBK Q;  5IGD A;  1RJT A;  1TS2 A;  2F0P A;  5CMD A;  3A7L A;  1I94 L;  1CQF A;  1KNA A;  2ZXO A;  3BU2 A;  2K50 A;  3GTP H;  4WJW A;  4FXD A;  1C4Q A;  4OO1 H;  1DJR D;  3KDF A;  2I46 A;  5ELD A;  2WAQ E;  5HGT A;  2EPB A;  1PRT C;  4OEM B;  4P74 A;  2NZH A;  1EY0 A;  2YTX A;  3PO3 G;  1ZYR C;  1XMO L;  1WD0 A;  3KJO A;  3S16 B;  1TWH B;  4YCW A;  3SGI A;  5EGT A;  1X9N A;  4KD3 A;  4DR3 Q;  1PTO H;  1B9N A;  4A3F B;  3H3V H;  4IPH A;  3HOZ B;  2E74 C;  2MP1 A;  3A7A B;  5J1Z A;  1HA5 A;  2L0C A;  3L0O A;  4HR7 B;  2JA6 G;  1LT6 D;  2RVL A;  3G6J B;  5CBE E;  4RGN A;  1CUK A;  1XNR L;  4DV0 Q;  3CAM A;  1PMR A;  4J6H A;  2PNR C;  2OQ0 A;  1LAB A;  3R2T A;  1LV9 A;  4BY7 B;  2HUG A;  2EZV A;  4HAE A;  4DV2 L;  2E2H B;  2AQ3 B;  4TSS A;  4OX9 Q;  4A3B B;  4BA2 I;  3WOE A;  4PG3 A;  1PFM A;  2XWB B;  1PH2 A;  3J80 i;  1B1Z A;  2VUM G;  2LMC B;  1SBB B;  4QF4 A;  4JI4 Q;  2CFM A;  3PUV A;  4A3L H;  1I4X A;  2WB1 E;  2E5L L;  4JI7 L;  3RLN A;  2XVS A;  4L8J A;  1HCZ A;  2F1M A;  3EBE A;  1GXD C;  1Q8K A;  2EYO A;  2IX1 A;  4A93 G;  1DD2 A;  3W3A A;  1BOS A;  3I56 A;  5E1F A;  3HKS A;  3J7A 5;  4A3D B;  2Z0S A;  1J5E L;  3MXN B;  2F0M A;  1PH9 A;  3KFU A;  3S2H B;  2JN4 A;  2CH4 W;  2CCZ A;  1VQH A;  2RA4 A;  3SK5 A;  2ZXP A;  1FYC A;  5C5L A;  2A69 D;  2RDH A;  1CZG A;  2PW5 A;  3MA2 B;  1YIJ A;  4GN3 B;  4GZY C;  4GNX B;  1OO9 B;  1SN8 A;  2N49 A;  4IJH A;  1R4Q B;  4K2L A;  5LHY 1;  4QIW B;  1J9O A;  3A0J A;  4JV5 L;  2Q2H A;  4P2C B;  1SFO B;  1O78 A;  4DR4 L;  1HNZ Q;  1HNX L;  2EXD A;  2WIN B;  4JYA Q;  5C3W A;  2EQS A;  1ZEQ X;  4IUP A;  3PO3 B;  1EU3 A;  1UEB A;  1W3S A;  3CU7 A;  4P75 A;  4HJ5 A;  1CQV A;  1GO3 E;  2VNU D;  3R3O A;  1VQB A;  4JI6 L;  3E0E A;  2JA6 H;  3FHW A;  5I2X A;  2CQA A;  5CV6 A;  1F2Z A;  3N52 A;  1YNJ D;  2K6A A;  3GTG H;  2NN6 I;  4K0K Q;  1HUN A;  3MTS A;  1AP0 A;  4DK3 C;  1VMC A;  5I9O A;  3OYY A;  3ZYY X;  3DLL A;  1J6Q A;  3WOF A;  5A35 A;  2MO0 A;  1QWY A;  1X3E A;  2L9H A;  5CV8 A;  2VUM H;  1AH9 A;  1IW7 D;  1JB7 A;  1X6O A;  4JPB W;  2XIW A;  3RUZ A;  4A75 A;  1SE4 A;  2Q2T A;  2OT2 A;  1QE6 A;  5D3I B;  3M7G A;  1HTL D;  2F0D A;  1K0R A;  1SNQ A;  5C0X H;  4A93 H;  4GLX A;  1TWA H;  4A3M B;  3E3X A;  2FHT A;  1KXL A;  5CR3 A;  1BCP F;  1H9S B;  1WCM G;  2JA8 H;  4CKE A;  5G3L F;  4OWT B;  2K32 A;  2ZXR A;  3TP8 A;  3S1M H;  3IRB A;  5C4X G;  3OMG A;  3I4N G;  4C3H G;  4DAM A;  3FVQ A;  3JAM E;  1DOK A;  1F77 A;  3M4O H;  1TWC B;  3MFY A;  3MEF A;  3GTM B;  3DUZ A;  1Y1W G;  2X69 A;  3BVM A;  2K5Q A;  3MZ5 A;  3S9W A;  3I7F A;  4B3T Q;  2K01 A;  3TEH B;  4L63 B;  4BY1 G;  1U5K A;  1EY8 A;  2XTI A;  4GLA C;  1AZQ A;  3HOY G;  4LFA L;  2QF7 A;  2O5I C;  2E76 C;  4DV6 Q;  5KNC A;  4KY7 A;  1DM0 B;  2E2I B;  1TWG B;  1C9O A;  4A3K G;  1L0Y B;  2RHQ B;  4LAA A;  2K28 A;  1ROD A;  2Y0S G;  3MHB A;  3CCS A;  1FNU A;  3LGJ A;  1EEI D;  3JC6 6;  4ALP A;  2KCC A;  5HY6 A;  1JOK A;  3NE5 B;  3K80 C;  1MD2 D;  4GN4 B;  3NXW A;  4A3I G;  3D0F A;  3OPO A;  4KHP L;  1B3Q A;  3PIO A;  3I4M G;  2JA7 B;  1GUT A;  3HFZ B;  3CCJ A;  3PUW A;  3RLO A;  1RDP D;  2NYZ D;  1TII D;  1RF2 D;  5EKI A;  2BDO A;  1SMY D;  3I70 A;  1EU4 A;  3F8T A;  4QMG A;  4DNR B;  1VQ5 A;  3CP0 A;  3PV0 A;  3Q24 A;  2MFI A;  3MXN A;  1NBW A;  1ASY A;  4LFB L;  2AMC B;  4DU9 A;  5C4J B;  3QOL A;  4RAU C;  1MBY A;  1KLU D;  2NVX H;  3R93 A;  4GNX A;  1B70 B;  4B3S L;  4V0B A;  3SEB A;  4L5S A;  1SYF A;  1KL9 A;  3HOU B;  1ESF A;  3EQL C;  1JOO A;  4LWC A;  1PYS B;  4DF7 A;  3M4Y A;  1M90 C;  1QNK A;  1K8O A;  5C4X H;  3CCM A;  4FXK C;  1CT1 D;  2QCP X;  3H0G H;  1STH A;  3W1B A;  2UU9 L;  1WCM B;  2NUC A;  3M4P A;  2UXB Q;  1OTC A;  3J81 c;  1TS4 A;  2DY8 A;  1WTO A;  3A5U A;  1I4Q A;  3K7A B;  3I91 A;  3I4N B;  1JOQ A;  4C1N I;  2D62 A;  4NB3 A;  1HZC A;  3HKZ G;  3T1H L;  1DGS A;  4KY6 A;  5LMU Q;  4BY1 H;  1M1K C;  5ELO A;  1Y1W B;  4HCS A;  1YJN A;  2JK8 A;  1WI5 A;  3HOY H;  4DV7 Q;  2Z4I A;  3S14 B;  4GNX C;  5C4H A;  1A3U A;  5EKL A;  4CDD C;  1N34 Q;  1VQG A;  4POG A;  1CA5 A;  2PI2 E;  5GAD C;  3L9A X;  1VQ8 A;  1H9K A;  1HR0 Q;  2V1C C;  1XWE A;  2B2T A;  3DWA A;  5LMN Q;  3I4L A;  4A3K B;  2B2U A;  4MIU A;  3H94 A;  3SXH A;  2IY5 B;  2CH4 A;  4A3I H;  1G6P A;  2RCF A;  4A3J B;  4A76 A;  1C8C A;  1LT5 D;  1J8I A;  3J81 j;  2Z4H A;  4S3S A;  4FF2 A;  2SDF A;  2LY7 A;  2F0E A;  1VQ9 A;  4L5R C;  2ZTD A;  4LF5 L;  5DM6 3;  1FJG Q;  1FL0 A;  1TQO A;  1WFQ A;  3I4M B;  3CPW A;  2MQH A;  5COY A;  1NJI C;  1LTB D;  4F7X A;  3CRL C;  1NNX A;  5CGK A;  1KD1 C;  1VQP A;  1N32 L;  2K4K A;  4LFC Q;  1H9S A;  4OGQ C;  1CFM A;  4KD4 A;  3HRZ C;  2A19 A;  1KDB A;  2B2T C;  4JC0 A;  2B2U C;  4DV1 L;  2RDG A;  2EXZ A;  1ONL A;  2GN5 A;  1SNP A;  1STB A;  1UUP A;  3J80 c;  5C3E G;  1JOR A;  1E1O A;  3P20 A;  2HIX A;  3FEW X;  1KHI A;  4IO9 A;  4A3C G;  1B7Y B;  2EYJ A;  1ESR A;  2R7F A;  2MGS A;  5FO7 B;  3LWE A;  4ZRZ A;  1D6E C;  5FKA C;  3K8A A;  1HNW Q;  4P71 A;  1PTO F;  4QUF A;  4CKB A;  4JI1 L;  4DV4 Q;  4UDU C;  2AQ1 B;  2JE6 I;  1Q7Y C;  2LSS A;  5C44 H;  4IFD I;  1K28 A;  2F0I A;  1YJW A;  5M5X H;  2VB3 X;  1EEF D;  1K8A C;  1L1O B;  4AIM A;  4UAI A;  2H5X A;  3AEV A;  1OXU A;  2M2L A;  1EWH A;  2HCC A;  5E7N A;  4DR1 Q;  3GTQ H;  2EE1 A;  3S1N H;  3DWP A;  3S2D B;  1CK1 A;  1UE6 A;  1IBM Q;  4KY5 A;  2IHE A;  1JJG A;  1CHP D;  1SXT A;  3K58 A;  2WB1 G;  1AN8 A;  2UXC L;  3E5S A;  3GTO H;  4I7A A;  3K5N A;  3D3R A;  3NP8 A;  5C3X A;  5IT9 E;  4YHH L;  3CME A;  2B3G A;  4NXM L;  5JAV A;  1SYC A;  1IKM A;  3T56 B;  3S17 B;  1EQV A;  5IOD A;  1K73 C;  2H4O A;  1X54 A;  1Y14 B;  1BCP B;  3BVG A;  1UAP A;  1PFS A;  5BN3 A;  2UUC Q;  1YNJ C;  3X3N A;  3DWQ A;  1XTD A;  3K7U C;  3S1R B;  1IBL L;  4B3R Q;  3ERQ A;  4X3S A;  1HFG A;  4C3I G;  5M5Y B;  2F0G A;  1QVG A;  3OW7 A;  4TQU S;  5DNF A;  4DKA C;  1SNO A;  1I50 B;  1B8A A;  3IL8 A;  1RIP A;  1O80 A;  3BYT B;  3KF6 B;  3D31 A;  4KK7 A;  2AHO B;  2IHF A;  4RGT A;  4X62 L;  5C3E B;  3F2D A;  4LF7 L;  4A3C H;  4KJN A;  4X66 L;  1I6H B;  2K33 A;  5EAY A;  1B9M A;  1SRO A;  4XYQ A;  2YTV A;  3GV6 A;  3SVM A;  2K04 A;  3RN2 A;  2N55 A;  4P73 A;  1N36 L;  2L4N A;  2NVT H;  4AYB E;  4BBR B;  4H02 A;  1YHA A;  3SHL A;  1JWM D;  2BA0 A;  3PIO 3;  4IFD J;  2HT1 A;  3K57 A;  1MI2 A;  1VQL A;  2JXM B;  3T16 A;  4TRD A;  5C4Z A;  2N88 A;  4O1N A;  1H9M A;  3E9H A;  4DR7 L;  5COR A;  1ET6 A;  1N33 Q;  3BDO A;  2WV6 D;  1YVC A;  2KBN A;  2PMZ E;  4ZLT F;  5FLX L;  2YV5 A;  3J81 E;  3AYH B;  4EQN A;  1EYD A;  4JI5 Q;  4X6A H;  1QJO A;  1AE2 A;  1YNN C;  1X3P A;  2K03 A;  5IOC A;  2KEC A;  1EWC A;  2Z8L A;  1D5X C;  4YY3 Q;  2HQL A;  5IIF A;  2SNS A;  3CCL A;  1IHZ A;  1S40 A;  4A3F G;  5M5W B;  3PUX A;  4IUQ A;  2WB1 B;  3HOZ G;  4DXG A;  2C5C A;  1I4P A;  4OON A;  1YBY A;  2AKW B;  3V2T A;  3K5M A;  1CTM A;  1I94 Q;  2PNH A;  1ENF A;  2OCE A;  3AFP A;  3MEH A;  1HZA A;  4QCL A;  2B8F A;  3FRP B;  4WFN 3;  3PF4 A;  2VW9 A;  3W2D A;  1BDO A;  2B63 G;  4G7Z C;  4OIK A;  1TWF B;  4R9W A;  4XXE A;  1ENC A;  2EJG C;  4I65 A;  4C3I H;  4A3B G;  4JI3 L;  5FJ8 G;  3L7Z C;  1XMO Q;  3TP7 A;  1HZB A;  1RTO A;  1VQI A;  1KNE A;  3CCE A;  5ELC A;  1STE A;  5T1I A;  1QVF A;  3A54 A;  4C3J H;  1BKB A;  1ZKO A;  3GTL H;  1JC7 A;  3SK6 A;  2I07 B;  5IP9 H;  1D2B A;  1BNZ A;  2NN6 G;  1L1O A;  2E2J B;  1SDF A;  3NUC A;  5KRU A;  4RKL A;  1JQY D;  2HD3 A;  2HQE A;  4C2M B;  1DOL A;  3OHX C;  4IQZ A;  4A3D G;  2I0Q A;  4RH6 A;  1MKH A;  3M4Q A;  4F88 A;  2C35 B;  4MZ9 A;  1EQQ A;  1RKN A;  4CBV A;  3TP5 A;  1WOC A;  5E3F A;  3U9S A;  1QG7 A;  4DV2 Q;  2DJG C;  4X64 L;  1LT4 D;  4KN4 C;  4A4I A;  3UDG A;  3J80 E;  5GAH C;  3OTO L;  4GS3 A;  2WAC A;  2R93 B;  2H1E A;  4XDX A;  3VYS A;  3VR3 A;  3AMU A;  5I2Y A;  4BBS B;  3S16 H;  2E5L Q;  1TWH H;  4ILW A;  4JI7 Q;  1L1O C;  1OXS C;  1UE5 A;  3MXG A;  1EQT A;  3OSO A;  2QEJ C;  1SYE A;  4Q0F A;  4H13 C;  4A3F H;  3FKI B;  3R8B A;  2O4X A;  3CCQ A;  4GKJ L;  3HOZ H;  3VA7 A;  1J5E Q;  1V1O A;  2UXD Q;  3DM1 A;  2D0P A;  3Q8D A;  3PF5 A;  3IFT A;  2ZJR A;  1V8Q A;  3M9B A;  1XX8 A;  2A8V A;  2BDN A;  4N8F A;  3KF6 A;  2QKI C;  1C7Y A;  3T51 B;  4BY7 H;  2E2H H;  1JIC A;  4DUZ L;  4Q5V A;  2B63 B;  5D3D A;  1QIL A;  4JV5 Q;  4JBM A;  4IPG A;  4DR4 Q;  1HNX Q;  3QR8 A;  5BR8 L;  2ZT9 C;  2ZM6 L;  1STN A;  3HOW B;  1BCP C;  4YWK A;  2R61 A;  2WFW A;  4AQY L;  1E1T A;  4PMC A;  5D14 A;  4IUR A;  4NW2 A;  5GAG C;  2KJX A;  4JI6 Q;  2F0V A;  1GD7 A;  4NP5 A;  3OW2 A;  4A3M G;  1EIH A;  2PZW A;  4A3D H;  2KOL A;  2B2Y A;  3S2H H;  4CJ1 B;  1XJV A;  2FMC A;  2LXJ A;  2EYP A;  1E2Z A;  2LS0 1;  1GUG A;  2DY7 A;  3TME A;  2E8G A;  5JJL A;  1S5B D;  4JBK A;  1LYL A;  3QJY A;  4A3G G;  4K8J A;  3K6O A;  5JEA J;  2EJM A;  4L6T B;  1NAP A;  4UP9 A;  4OO1 I;  1EFI D;  1SFO H;  2RSN A;  4FP5 D;  4X3T A;  2XRS D;  3PO3 H;  1NTG A;  4DR3 L;  1HA6 A;  2IJ0 A;  1NCV A;  5FLM G;  4G7H C;  1H9R A;  1W6K A;  4DV5 Q;  3RZD B;  5K36 G;  1PH1 A;  4LF6 Q;  4XT3 B;  1EIG A;  2OWO A;  1Q1B A;  4K5X A;  4PQX A;  4R4O A;  4DV0 L;  4GN5 A;  5GQO A;  3PO2 G;  1EL0 A;  3H3V I;  3D6C A;  3PSI A;  1WTW A;  3X3M A;  4KHZ A;  2AUK A;  4M8A A;  2F4V L;  1EOV A;  1EYC A;  2DUD A;  4DR2 Q;  1P16 A;  2XGT A;  2JA7 G;  5IGB A;  1VS0 A;  3KF8 B;  4XQN A;  2XRQ D;  2RQX A;  4J15 A;  3J7Y W;  1K3B C;  3E0J A;  4LF4 L;  5IE8 A;  2F0U A;  4JI4 L;  1A2U A;  4UY8 C;  1II3 A;  4NXN Q;  1PH3 A;  1EIF A;  1HQM C;  1VQO A;  4K14 A;  4DUY Q;  2JEB I;  3EIV A;  5M3M G;  2OTJ A;  5ISR A;  1JB3 A;  5JVH 3;  5DM7 3;  3CC7 A;  2CQO A;  2F0F A;  3K0X A;  1KAA A;  4F87 A;  1B4O A;  3ERO A;  3HOU G;  3EJI A;  4LMQ D;  4LNQ A;  2B29 A;  3OMC A;  1E2V A;  2R92 B;  1A2T A;  3S15 B;  1UEA B;  2QW7 A;  5JVG 3;  3PQI A;  2PZT A;  1JMC A;  2C9O A;  2IW3 A;  1TWC H;  3GTM H;  2DGY A;  3EVQ A;  4PZ7 A;  1B50 A;  5A2Q L;  1LUZ A;  2ZTC A;  4A3G B;  4ZCK A;  3ND8 A;  1HNZ L;  4G57 A;  3DXJ C;  4JYA L;  1YNN D;  2FIN B;  3GV3 A;  2E75 C;  5FLM H;  2NTS A;  3HOX B;  4APV A;  5IWA Q;  2E2I H;  1TWG H;  1S4Z A;  4IOC A;  4FF4 A;  1FNV A;  1Q90 A;  1XNQ L;  3MVV A;  1BBX C;  2CW0 C;  2JA5 B;  1Q81 C;  1V1Q A;  2UU9 Q;  1SEB D;  1XYI A;  1WJJ A;  4K0K L;  2MHV A;  3QOJ A;  4JVZ A;  2JA9 A;  4A3J G;  1IL2 A;  1HR0 W;  4OEL B;  4DAY B;  4CJ2 C;  1L2F A;  3PO2 B;  1Z7T A;  3P7J A;  3V96 A;  5LMN W;  3ICE A;  4IFD G;  4C56 C;  2JA7 H;  1CSQ A;  1O7Y A;  1ICW A;  3HGB A;  3NEL A;  2GVA A;  3MC0 B;  3T1H Q;  1A8V A;  4HSV A;  2EY1 A;  1JJC B;  4OL7 A;  2K14 A;  3BDL A;  1FVI A;  3BJU A;  3CHB D;  4DR5 Q;  3M3Y B;  1I4R A;  4B3M Q;  2GA4 B;  1NMG A;  3CD6 A;  2Z9H A;  4R8N A;  5C4J H;  5J3B A;  4BWG B;  1SMX A;  1U4R A;  1NY4 A;  4LF8 L;  3K81 C;  5EQ0 A;  1K8G A;  4EX5 A;  5M3M B;  1Q82 C;  2LKV A;  4MTN A;  3G48 A;  4O0A A;  1R9T B;  4RFB A;  1IYJ B;  1STY A;  2AWN A;  3HOU H;  4HIK A;  4G4K A;  2QEX A;  4JI2 L;  1E7Z A;  4QIW E;  5FOB B;  2HHH Q;  5C0X I;  4FO2 A;  3SDZ A;  4J8Q A;  1WCM H;  4B9X A;  4FF3 A;  1VQJ A;  4DV3 L;  2UUA Q;  4LF5 Q;  3H6M A;  5IYC G;  4KKT A;  3K7A H;  1PFN A;  4QL5 A;  2YU9 H;  3I4N H;  1E24 A;  2IX0 A;  3OWF A;  4JI8 L;  4C3H H;  4YWM A;  2WKD A;  5IYD G;  5ELF A;  4B3T L;  4HCE A;  1PDQ A;  1N32 Q;  2EY5 A;  1MHW C;  5AJ3 Q;  1Y1W H;  3NTI A;  4GKK L;  1B3A A;  5BN5 A;  2JP1 A;  1BBU A;  1EQR A;  1GUS A;  3QB3 A;  3S14 H;  1STA A;  4DV6 L;  3GQB A;  2OF1 A;  4TVA B;  4DV1 Q;  4RCO A;  1JR0 D;  1HJP A;  3TRE A;  1WYD A;  3Q6S A;  5L37 A;  2O2L D;  1V1P A; 
#chains in the Genus database with same CATH homology
 3A56 A;  3KF8 A;  3BZD B;  2PCF B;  3RMH A;  3MXP A;  1I4H A;  2AUJ D;  2HDM A;  1A15 A;  4K6D A;  5E4W C;  4H44 C;  3NWT A;  3KBX A;  3RLF A;  5CC4 A;  2F0L A;  1SYD A;  3NK9 A;  2J4X A;  3NPP A;  1GOZ A;  3SK8 A;  1EYA A;  3QWN A;  2KCN A;  1B44 D;  1VF5 C;  1BCP D;  2X6L A;  3SR1 A;  1SND A;  1AZP A;  5G3L D;  3M85 A;  2EY2 A;  4U68 A;  4AYB B;  2MPM A;  4KKS A;  4ZUI A;  1EY7 A;  1TY0 A;  4OIJ A;  2SNM A;  5FK9 C;  4FF1 A;  5C0X J;  2PO4 A;  4RGM A;  2J7Z A;  4NMZ A;  4CGY B;  1G29 1;  1IKL A;  2A73 B;  5TSS A;  1SAP A;  4DNT B;  5EBD A;  1EOT A;  1DCZ A;  3Q23 A;  2R7Z B;  1DZ1 A;  1VMP A;  2PQE A;  3R2I A;  1CA6 A;  3ONA B;  1KTK A;  3DMU A;  1SJE D;  2IL8 A;  4ABN A;  3OWE B;  3BYY B;  4Y7N B;  4DAY A;  1OXV A;  4MHE A;  1Y8P B;  4TKO B;  1G91 A;  3U9O A;  2JSO A;  3C1F A;  1HUM A;  3D6W A;  5T1G A;  5JPM C;  3TDQ A;  2R6G A;  1F9Q A;  1G8Z D;  4E6I A;  5JEA G;  1HXY D;  3GTK B;  3MXU A;  3FPP A;  4DK0 A;  2RKS A;  3VA5 A;  3FPU B;  1I3Q B;  2TSS A;  5IGE A;  1TY2 A;  1X32 A;  1EZ6 A;  1LTG D;  3WDN A;  2FMM A;  4WOR A;  3KUP A;  1WTV A;  2NVY B;  3N6R A;  3CQZ B;  3L3O C;  4K5W A;  3I3C A;  1Y1V B;  1GUN A;  3BVZ A;  4DXF A;  3T13 A;  3RZO B;  3G7L A;  2NZ1 D;  3TZU A;  3GTO B;  1D1K A;  2Q8I B;  4A3E B;  2WAQ B;  3VYT A;  2EJF C;  2L5T A;  1SE3 A;  2K05 A;  3NBI A;  2NVQ B;  4KV6 A;  4HTH A;  3HOV B;  3BG3 A;  2ICE C;  1WVL A;  4OHJ A;  2G9D A;  4PNY A;  2DNC A;  3A8I E;  3D4D A;  2RSO A;  2CW0 D;  1QOH A;  3GO5 A;  1BQQ T;  2OXP A;  4ZQ3 A;  4X3K A;  2HDL A;  1JCK B;  1FD7 D;  2EYH A;  1F9P A;  2QDB A;  1PZJ D;  2ID0 A;  2A6E D;  3FDT A;  5NUC A;  4U67 3;  2NWG A;  3BS1 A;  4EQO A;  1V43 A;  3GTJ B;  2IPK D;  3VYU A;  2A6H D;  2EYM A;  1Y8O B;  2BE5 C;  4RA8 A;  5EJW A;  1QB5 D;  3NHH A;  1ILP A;  2FFK B;  4OO1 G;  1K83 B;  3PUZ A;  2BCO A;  1I6V C;  4FNF A;  5CYU A;  1SYG A;  1BR9 A;  2V4D A;  1SJH D;  2A68 D;  3P1H A;  1MSH A;  1BUV T;  2JEA I;  4KTA A;  1UNS A;  2FJ2 A;  4ME5 A;  1PTO D;  1B53 A;  3IKJ A;  4KKU A;  1S5E D;  1M8A A;  1LTS D;  3A8K E;  5EPK A;  2A5H A;  2PYK A;  4J1M A;  5FO9 B;  5C6A A;  2XSC A;  5M3F B;  5AFW A;  5KEE A;  3MWY W;  3K0Y A;  2DN8 A;  3EFX D;  2M00 A;  1EY4 A;  1TR5 A;  3C46 A;  2KED A;  4N9P A;  1NR2 A;  1JE4 A;  4IZ8 A;  1LO5 D;  3NQI A;  3SE0 A;  5I9P A;  4V19 0;  3LX0 A;  3TZD A;  1LLR D;  1RCV D;  3QIA A;  3S1Q B;  1ET9 A;  1GHK A;  1ILQ A;  2MJ8 A;  1RD9 D;  3DEO A;  1SNC A;  1CHQ D;  2XN9 C;  5CV5 A;  4ZUJ A;  2EYF A;  1F9S A;  1FR3 A;  1HQR D;  2K5W A;  3GTP B;  1BF4 A;  2F0J A;  1JWU D;  1Q3L A;  1U4L A;  2B8G A;  4QB4 A;  1LTT D;  1U4M A;  4N9T A;  2J0T D;  1XTC D;  1GHJ A;  1GUW A;  3C1E A;  1VDZ A;  1AEX A;  1IL8 A;  3CRK C;  1NSN S;  1PTO B;  4NKL A;  3DHQ A;  1G2S A;  2NN6 H;  3T4A C;  3NWS A;  2HCI A;  3K59 A;  3E6Z X;  4O42 A;  2L11 A;  3D4W A;  4XYO A;  2F0H A;  3O13 A;  2Q8T A;  3VYR A;  2QIL A;  3HP3 A;  4XT1 B;  1IYV A;  2F4I A;  1TKW B;  1SYB A;  5E4X A;  4X3U A;  5DAU A;  4FXG C;  1DON A;  4DAP A;  5CV4 A;  4HMJ A;  3OIQ A;  5C0X G;  1TU2 B;  1EY9 A;  2AWO A;  5EKK A;  2JYO A;  1EZ8 A;  3MAQ A;  4KI0 A;  2B2Y C;  1U9R A;  2L12 A;  5I6Y A;  3PMF A;  3NQT A;  5F2D A;  4IUU A;  4IUT A;  3DEP A;  3AU7 A;  4QUC A;  4HMI A;  1V1P B;  1TVX A;  1QCB D;  1S5C D;  3GD7 A;  5JPN C;  1MGS A;  1A6X A;  2WP8 J;  2F0W A;  3C2P A;  4PMW A;  3KLS A;  4BS9 A;  1PRT F;  5EBC A;  3JAM L;  2JA6 B;  5FO8 B;  4XIG S;  1JWS D;  3GP7 A;  1Q8I A;  1U4P A;  2E2D C;  2F3W A;  3GTG B;  2WKC A;  1PFB A;  4ID6 A;  3QG1 A;  1HFN A;  1OXX K;  2D5D A;  1T5E A;  3PIP 3;  4IAL A;  5IGF A;  2NBF A;  2VUM B;  1B2T A;  3Q22 A;  1LTA D;  1D5Z C;  3J7A V;  2ENB A;  4DA2 A;  4EQP A;  2XNA C;  4IN3 A;  1Y8N B;  1D1I A;  5CV7 A;  3VR6 A;  3A8J E;  3F2U A;  3OOC A;  1PYW D;  4A93 B;  2F0S A;  1F9R A;  1TWA B;  2SEB D;  2BE5 D;  5K36 H;  4IUV A;  1XXG A;  3KLS X;  4RWS C;  3TP6 A;  1GUO A;  2JA8 B;  2B2W A;  2Q8R E;  3S1M B;  1RTN A;  2IT1 A;  2KEE A;  4LJZ C;  2YYZ A;  1O7Z A;  4PV1 C;  1SE2 A;  1IYU A;  4DAV A;  3M4O B;  1Q12 A;  2DNE A;  2EVB A;  2A6E C;  4DN4 M;  2M9V A;  1KDC A;  1DXM A;  1RHP A;  4FVM A;  2SOB A;  2A6H C;  5JJZ A;  1LAC A;  3P75 A;  5A2Q E;  2KQ3 A;  4EVO A;  1SSO A;  4CKC A;  2B2W C;  3IAY A;  2A68 C;  4K5V A;  3I90 A;  2K5D A;  2R3Z A;  2KA7 A;  1WTP A;  3D8G A;  3J7A F;  4R8I A;  4ZK9 B;  3T53 B;  1EY5 A;  2B39 A;  5CV9 A;  1PTO C;  1W6J A;  3H3V C;  3VR4 A;  5EPJ A;  2BOS A;  3TSS A;  5HUR A;  4G7O C;  2F0K A;  2NVX B;  4ZKC B;  2IX3 A;  1Z47 A;  4RGO S;  5J39 A;  2KHS A;  1DOM A;  2F0N A;  5DEH A;  1WTQ A;  5C4X B;  4HN7 A;  2YU9 B;  3H0G B;  4C3H B;  2PW7 A;  1CZW A;  1PRT D;  2VB2 X;  2AQ2 B;  3UI2 A;  3I72 A;  1Q1E A;  1ZYR D;  5KIX A;  4IFD H;  3IFD A;  2L55 A;  5I6W A;  4K6L A;  4BY1 B;  5CBA E;  2VXW A;  1HPC A;  4DGZ A;  1LTI D;  4B08 A;  3TBI B;  1F2Y A;  3HOY B;  3RD4 A;  4ZKB B;  3MFG A;  4PMB A;  2WII B;  3QO2 A;  1LT3 D;  2EDG A;  1PLF A;  2Y0S B;  2KVM A;  1CM9 A;  2Z1C A;  3URY A;  5KYL A;  2CVR A;  1M4V A;  3PUY A;  2D2C C;  1C48 A;  4A3I B;  1TS3 A;  1E2W A;  1KLG D;  3HEJ A;  3NTK A;  5D65 A;  3FMC A;  1OXT A;  5IGC A;  2PMZ B;  3AB9 A;  1TS5 A;  2NB0 A;  4HED A;  1AFP A;  4ZYS A;  4KMU C;  3LNN A;  2IWH A;  1L0X B;  2ICI A;  5J22 A;  1S5F D;  3A55 A;  4XQQ A;  1O7L A;  5IT9 L;  1ML0 D;  1Y69 U;  2K7V A;  3KK7 A;  1VF7 A;  1HRJ A;  3KBG A;  1PZI D;  4DK1 A;  3VR2 A;  3HKZ B;  4C1N K;  1G6Z A;  1STG A;  5KND A;  5ELE A;  1T5X D;  1PRT B;  4I7Z C;  4WRD A;  1KAB A;  5C44 B;  2EYL A;  1NUC A;  4F8M A;  5M5X B;  1E0B A;  2A69 C;  3NTH A;  1R4P B;  4Z9C B;  3C3L A;  3ITP A;  5IGG A;  1NR4 A;  4CJ0 B;  4RKB A;  4MN3 A;  2B2V A;  4XTC S;  2K1B A;  2CHB D;  5LL6 S;  3GTQ B;  4K8I A;  3S1N B;  3KLR A;  2PZU A;  1HHV A;  4LK1 C;  4IUN A;  4RCN A;  2RBM A;  4FYD A;  4BA1 I;  1SNM A;  4RHR A;  2BA1 A;  1F2L A;  3HS0 C;  5ELB A;  5M9O A;  1A3T A;  2B2V C;  3J81 L;  2X6G A;  1KDA A;  1LTR D;  4ODG A;  3TN2 A;  4B9W A;  4NDX A;  3Q0A A;  3SK4 A;  4M1U B;  5JOB A;  2G9H D;  4C3J G;  1WTX A;  1EY6 A;  3V05 A;  1WD1 A;  1IW7 C;  1FNW A;  4EGV A;  2EOT A;  3M7N A;  1K8M A;  3D4R A;  1BO0 A;  3NSW A;  3OIP A;  1S5D D;  4K2K A;  2NTT A;  2RDF A;  1AW7 A;  2TMP A;  5JEA H;  2NVT B;  1FGB D;  4ULL A;  5I4D A;  3H91 A;  1G2T A;  1D5M C;  3BDC A;  4YIJ A;  4CHT B;  1MSG A;  1I4G A;  3LWU A;  5C5M A;  3NBH A;  1TT2 A;  1CI3 M;  2F3V A;  1WTR A;  2XWJ B;  4JK1 C;  2O5J C;  1PZK D;  1Z6H A;  3CKI B;  1PXU A;  3HG9 A;  4H0L C;  5LL6 X;  1ZXT A;  5KYI A;  2F0T A;  4KJO A;  1BXT A;  1H9J A;  2F0O A;  1HTP A;  2F0Q A;  4KN7 C;  1QNU A;  1X3Q A;  4XQJ A;  4KHV A;  5K5P A;  3J80 L;  2L1B A;  1ENA A;  2F03 A;  4H7B A;  5FLX E;  5KGU A;  3I8Z A;  5KNB A;  3VR5 A;  2KUM A;  3H09 A;  5BN4 A;  4ZAI A;  2LFN A;  1F2M A;  1VCI A;  1GJX A;  2D9U A;  4C3I B;  4HSP A;  1SMY C;  2PPB C;  4RHS A;  3ND9 A;  4JBW A;  3HZX A;  2MUY A;  2OEO A;  4C3J B;  3K5L A;  3GTL B;  2EY6 A;  4DFA A;  1DYQ A;  3I73 A;  1A3V A;  3K5O A;  3EA6 A;  2A74 C;  5EPL A;  5IGD A;  1RJT A;  1TS2 A;  2F0P A;  5CMD A;  3A7L A;  1CQF A;  1KNA A;  2ZXO A;  4FXD A;  4WJW A;  1C4Q A;  4OO1 H;  1DJR D;  2I46 A;  5ELD A;  5HGT A;  2EPB A;  1PRT C;  1EY0 A;  1ZYR C;  1WD0 A;  3S16 B;  1TWH B;  5EGT A;  4KD3 A;  1PTO H;  1B9N A;  4A3F B;  3HOZ B;  2E74 C;  2MP1 A;  3A7A B;  5J1Z A;  1HA5 A;  2L0C A;  4HR7 B;  1LT6 D;  2RVL A;  3G6J B;  5CBE E;  4RGN A;  1PMR A;  4J6H A;  2PNR C;  3R2T A;  1LAB A;  1LV9 A;  4BY7 B;  2HUG A;  2EZV A;  4HAE A;  2E2H B;  2AQ3 B;  4TSS A;  4A3B B;  4BA2 I;  3WOE A;  1PFM A;  2XWB B;  1B1Z A;  2LMC B;  1SBB B;  4QF4 A;  3PUV A;  1I4X A;  2XVS A;  4L8J A;  1HCZ A;  2F1M A;  2IX1 A;  1GXD C;  2EYO A;  1DD2 A;  3W3A A;  1BOS A;  5E1F A;  4A3D B;  2F0M A;  3S2H B;  2RA4 A;  3SK5 A;  2ZXP A;  1FYC A;  5C5L A;  2A69 D;  2RDH A;  1CZG A;  2PW5 A;  3MA2 B;  4GZY C;  1OO9 B;  1R4Q B;  4K2L A;  5LHY 1;  4QIW B;  1J9O A;  4P2C B;  1SFO B;  1O78 A;  2WIN B;  5C3W A;  1ZEQ X;  4IUP A;  3PO3 B;  1EU3 A;  3CU7 A;  1CQV A;  2VNU D;  3R3O A;  5I2X A;  2CQA A;  5CV6 A;  1F2Z A;  3N52 A;  1YNJ D;  2K6A A;  2NN6 I;  1HUN A;  3MTS A;  1AP0 A;  1VMC A;  5I9O A;  3ZYY X;  3WOF A;  5A35 A;  1QWY A;  2L9H A;  5CV8 A;  1IW7 D;  2XIW A;  3RUZ A;  1SE4 A;  2OT2 A;  1QE6 A;  5D3I B;  1HTL D;  2F0D A;  3M7G A;  1SNQ A;  5C0X H;  4A3M B;  2FHT A;  5CR3 A;  1BCP F;  1H9S B;  4CKE A;  5G3L F;  2K32 A;  2ZXR A;  3TP8 A;  3OMG A;  4C3H G;  3FVQ A;  3JAM E;  1DOK A;  1F77 A;  1TWC B;  3MFY A;  3GTM B;  3DUZ A;  2X69 A;  3BVM A;  2K5Q A;  3MZ5 A;  3S9W A;  2K01 A;  4L63 B;  1EY8 A;  1AZQ A;  2QF7 A;  2O5I C;  2E76 C;  5KNC A;  4KY7 A;  1DM0 B;  2E2I B;  1TWG B;  1L0Y B;  4LAA A;  2K28 A;  1ROD A;  3MHB A;  1FNU A;  1EEI D;  2KCC A;  1JOK A;  3NE5 B;  1MD2 D;  3NXW A;  3OPO A;  2JA7 B;  1GUT A;  3PUW A;  1RDP D;  2NYZ D;  1TII D;  1RF2 D;  5EKI A;  2BDO A;  1SMY D;  3I70 A;  1EU4 A;  4QMG A;  4DNR B;  3PV0 A;  3Q24 A;  3MXN A;  4DU9 A;  5C4J B;  3QOL A;  4RAU C;  1MBY A;  1KLU D;  3R93 A;  4V0B A;  3SEB A;  1SYF A;  3HOU B;  1ESF A;  3EQL C;  1JOO A;  4DF7 A;  3M4Y A;  1QNK A;  1K8O A;  4FXK C;  1CT1 D;  2QCP X;  1STH A;  1WCM B;  2NUC A;  1TS4 A;  2DY8 A;  1WTO A;  1I4Q A;  3K7A B;  3I91 A;  3I4N B;  1JOQ A;  4C1N I;  2D62 A;  4KY6 A;  1Y1W B;  4HCS A;  2Z4I A;  3S14 B;  5C4H A;  1A3U A;  5EKL A;  1CA5 A;  3L9A X;  1H9K A;  1XWE A;  2B2T A;  3DWA A;  3I4L A;  4A3K B;  2B2U A;  4MIU A;  3H94 A;  3SXH A;  4A3J B;  1C8C A;  1LT5 D;  1J8I A;  2Z4H A;  4S3S A;  4FF2 A;  2SDF A;  2LY7 A;  2F0E A;  5DM6 3;  1TQO A;  3I4M B;  5COY A;  1LTB D;  4F7X A;  3CRL C;  5CGK A;  1H9S A;  4OGQ C;  1CFM A;  4KD4 A;  3HRZ C;  1KDB A;  2B2T C;  2B2U C;  2RDG A;  2EXZ A;  1ONL A;  1SNP A;  1STB A;  1UUP A;  1JOR A;  3P20 A;  3FEW X;  2EYJ A;  1ESR A;  2MGS A;  5FO7 B;  3LWE A;  4ZRZ A;  1D6E C;  5FKA C;  1PTO F;  4QUF A;  4CKB A;  4UDU C;  2AQ1 B;  2JE6 I;  4IFD I;  2F0I A;  2VB3 X;  1EEF D;  4UAI A;  1OXU A;  2M2L A;  1EWH A;  2HCC A;  2EE1 A;  3DWP A;  3S2D B;  1CK1 A;  4KY5 A;  1CHP D;  1SXT A;  3K58 A;  1AN8 A;  3E5S A;  3K5N A;  3D3R A;  3NP8 A;  5C3X A;  5IT9 E;  5JAV A;  1SYC A;  1IKM A;  3T56 B;  3S17 B;  1EQV A;  5IOD A;  2H4O A;  1BCP B;  3BVG A;  1UAP A;  5BN3 A;  1YNJ C;  3X3N A;  3DWQ A;  3S1R B;  3ERQ A;  4X3S A;  1HFG A;  4C3I G;  5M5Y B;  2F0G A;  3OW7 A;  4TQU S;  5DNF A;  1SNO A;  1I50 B;  3IL8 A;  4KK7 A;  1O80 A;  3BYT B;  3D31 A;  4RGT A;  5C3E B;  4KJN A;  1I6H B;  2K33 A;  1B9M A;  4XYQ A;  3GV6 A;  3SVM A;  2K04 A;  2N55 A;  2L4N A;  4BBR B;  3SHL A;  1JWM D;  2BA0 A;  3PIO 3;  4IFD J;  3K57 A;  1MI2 A;  2JXM B;  3T16 A;  4TRD A;  5C4Z A;  2N88 A;  4O1N A;  1H9M A;  5COR A;  1ET6 A;  3BDO A;  2WV6 D;  4ZLT F;  5FLX L;  3J81 E;  4EQN A;  1EYD A;  1QJO A;  1YNN C;  1X3P A;  2K03 A;  5IOC A;  2KEC A;  1EWC A;  2Z8L A;  1D5X C;  5IIF A;  2SNS A;  1IHZ A;  5M5W B;  3PUX A;  4IUQ A;  2WB1 B;  4DXG A;  2C5C A;  1I4P A;  3V2T A;  3K5M A;  1CTM A;  1ENF A;  3MEH A;  4QCL A;  2B8F A;  3FRP B;  4WFN 3;  3W2D A;  1BDO A;  4G7Z C;  4OIK A;  1TWF B;  4R9W A;  4XXE A;  1ENC A;  2EJG C;  4I65 A;  3L7Z C;  3TP7 A;  1RTO A;  1KNE A;  5ELC A;  1STE A;  5T1I A;  3A54 A;  1ZKO A;  1JC7 A;  3SK6 A;  2I07 B;  1D2B A;  1BNZ A;  2NN6 G;  2E2J B;  1SDF A;  3NUC A;  5KRU A;  4RKL A;  1JQY D;  2HQE A;  4C2M B;  1DOL A;  3OHX C;  4IQZ A;  4RH6 A;  4F88 A;  1RKN A;  4CBV A;  3TP5 A;  5E3F A;  3U9S A;  1QG7 A;  1LT4 D;  4KN4 C;  3J80 E;  2WAC A;  2R93 B;  2H1E A;  4XDX A;  3VYS A;  3VR3 A;  3AMU A;  5I2Y A;  4BBS B;  4ILW A;  1OXS C;  3MXG A;  1EQT A;  3OSO A;  2QEJ C;  1SYE A;  4Q0F A;  4H13 C;  3FKI B;  3R8B A;  2O4X A;  3VA7 A;  1V1O A;  3DM1 A;  3IFT A;  1V8Q A;  1XX8 A;  2BDN A;  2QKI C;  3T51 B;  1JIC A;  4Q5V A;  2B63 B;  5D3D A;  1QIL A;  2ZT9 C;  1STN A;  3HOW B;  1BCP C;  2R61 A;  4PMC A;  5D14 A;  4IUR A;  4NW2 A;  2KJX A;  2F0V A;  4NP5 A;  1EIH A;  2PZW A;  2KOL A;  2B2Y A;  4CJ1 B;  2FMC A;  2EYP A;  1E2Z A;  2LS0 1;  1GUG A;  2DY7 A;  3TME A;  1S5B D;  3QJY A;  4K8J A;  3K6O A;  5JEA J;  2EJM A;  4L6T B;  1NAP A;  4OO1 I;  1EFI D;  2RSN A;  4FP5 D;  4X3T A;  2XRS D;  1HA6 A;  2IJ0 A;  1NCV A;  4G7H C;  1H9R A;  1W6K A;  3RZD B;  5K36 G;  4XT3 B;  1EIG A;  1Q1B A;  4K5X A;  4PQX A;  1EL0 A;  3D6C A;  1WTW A;  3X3M A;  4KHZ A;  2AUK A;  4M8A A;  1EYC A;  5IGB A;  4XQN A;  2XRQ D;  2RQX A;  3J7Y W;  3E0J A;  2F0U A;  1A2U A;  1II3 A;  1HQM C;  4K14 A;  2JEB I;  5ISR A;  1JB3 A;  5JVH 3;  5DM7 3;  2F0F A;  1KAA A;  4F87 A;  1B4O A;  3ERO A;  3EJI A;  4LMQ D;  3OMC A;  1E2V A;  2R92 B;  1A2T A;  3S15 B;  1UEA B;  5JVG 3;  2PZT A;  2C9O A;  2IW3 A;  3EVQ A;  1B50 A;  5A2Q L;  4A3G B;  3ND8 A;  4G57 A;  3DXJ C;  1YNN D;  2FIN B;  3GV3 A;  2E75 C;  2NTS A;  3HOX B;  1S4Z A;  4FF4 A;  1FNV A;  1Q90 A;  3MVV A;  1BBX C;  2CW0 C;  2JA5 B;  1SEB D;  1XYI A;  2MHV A;  3QOJ A;  4CJ2 C;  3PO2 B;  1Z7T A;  3P7J A;  3V96 A;  4IFD G;  4C56 C;  1O7Y A;  1ICW A;  3HGB A;  3MC0 B;  4HSV A;  2EY1 A;  4OL7 A;  3BDL A;  3CHB D;  3M3Y B;  1I4R A;  2GA4 B;  4R8N A;  4BWG B;  1U4R A;  5EQ0 A;  5M3M B;  2LKV A;  1R9T B;  4RFB A;  1STY A;  2AWN A;  4G4K A;  5FOB B;  5C0X I;  4FO2 A;  3SDZ A;  4J8Q A;  4B9X A;  4FF3 A;  3H6M A;  4KKT A;  1PFN A;  2IX0 A;  3OWF A;  2WKD A;  5ELF A;  4HCE A;  1PDQ A;  2EY5 A;  3NTI A;  1B3A A;  5BN5 A;  2JP1 A;  1GUS A;  3QB3 A;  1STA A;  3GQB A;  2OF1 A;  4RCO A;  1JR0 D;  3Q6S A;  2O2L D;  1V1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...