4IPHA

Structure of n-terminal domain of rpa70 in complex with vu079104 inhibitor
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Surface Reengineering of RPA70N Enables Cocrystallization with an Inhibitor of the Replication Protein A Interaction Motif of ATR Interacting Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4iphA00
4BBRH 2NN6I 1XMOQ 4JI6Q 1SMXA 3VDYA 1EWIA 4UP9A 1J6QA 4DUYL 1YJ9A 3F8TA 4A3EH 3KYHC 3S2DH 4P71A 4EX5A 3EIVA 4TQUS 4BBRG 5M3FH 3ERSX 3J80c 1VQPA 1PA6A 1MJEA 4IOAA 4DR2L 3FP9A 2NN6G 2UUAQ 4LF8Q 5JJKA 1CSPA 3K0XA 4GN5A 4DAMA 3J7ZC 3AFPA 4LF6L 1K73C 4L5TA 3KFUA 2KBNA 2UUBQ 5FLMG 2KCTA 1XNQQ 4BA2I 1X65A 2RCNA 2OTJA 1WI5A 2YU9H 1E7ZA 1X6OA 4UY8C 5H1SE 1B8AA 1UWVA 3T1HL 2K52A 2ZJQA 3H3VI 3NELA 2ZTDA 5M5XH 2B3GA 1PV4A 2D0PA 4DR4Q 2IY5B 2IHFA 3G48A 4GN3B 5IWAL 4JOIA 5J3BA 4DV1Q 1CKMA 1CKNB 5JEAJ 2VL6A 2KENA 5IP7H 1KHIA 2VZAA 5C0XJ 1PH8A 4MZ9A 2ASBA 1EQRA 4DV6Q 3CCUA 4QL5A 4DAYB 2VY3A 4JI8Q 3ULJA 1J5EL 2OWOA 2UU9Q 4B3TQ 1YHAA 2FXQA 1KAWA 1FJGQ 4MNOA 2Z6KA 3CQZH 5GADC 4HIKA 2ZTEA 4BY1H 4WJ3M 3I55A 2GVAA 4LF7Q 4P72A 1NBWA 3CCLA 2N78A 3L7ZC 4DV3L 2NZOA 2ID0A 1Q82C 2VQEL 3HOUH 4KHPL 3HOZH 3OW2A 3I7FA 3J81j 1YI2A 2K75A 1VQ6A 4OX9L 4BXXG 3S1RH 3HOXH 4DV2L 1NE3A 1OXUA 4DK3C 1RIPA 3JAMi 2NVYH 1JB7A 3HOZG 2I5HA 1VQIA 1Y1VH 4X66L 4DV5Q 1WOCA 4DR3L 1X56A 1YIJA 1Q7YC 3A0JA 1VQDA 4C2MH 5FJ8H 2NVQH 2UXDQ 1EOVA 4YCWA 4DR1Q 4DK6C 1M90C 3M4PA 2JA7H 1I5FA 1JE5A 4YHHQ 4LFBL 4RG1A 3CCSA 3CMAA 4LF4Q 4POGA 3KJOA 2JA7G 4JC0A 3HKZG 4IPCA 3ER0A 4UP7A 1YVCA 3PUZA 3GO5A 3S24A 1HZAA 1TXYA 5DLQE 4X62L 2V1CC 1PH3A 3H0GG 4B3MQ 3S16H 3J80i 5AJ3L 2Y0SG 2BH2A 2R92H 2A1AA 1I50H 4X64L 1KXLA 4IPDA 4LF9Q 3BZKA 1K3RA 1HH2P 5M3MH 1XNRL 3PO3H 1Y1WH 1NMGA 1SN8A 1VQLA 1W2BA 3S2HH 1Q46A 3K80C 2ZM6Q 1IBLQ 1WJJA 3GTGH 4X65L 4R4QA 3PO3G 2F4VQ 4JI7L 3CW2C 1AE2A 1Y1WG 5IYCH 1E22A 4J15A 1AH9A 4P75A 1E3PA 3K81C 3CCEA 3RN5A 3HOVH 4LFCL 2JJQA 1X3GA 3UDXA 5BR8L 4HIMA 4YWKA 2UXBQ 2AKWB 1S3OA 2K5VA 3JC66 4GN4B 3STBC 1HNXL 5LMUL 1VQJA 2ALYB 3HOVG 1P16A 1SROA 1W3SA 4QJFA 3K8AA 4KI0A 2MQHA 1VQAA 1WCMH 4JI5Q 2LXJA 3AQQA 4JI3L 3PO2G 2MO1A 5ELNA 1OXTA 1QUQA 3CCVA 3EBEA 2Q2UA 2AWOA 4DV4Q 1LYLA 3CCJA 4A3GH 3CCRA 4PZ6A 4A75A 2PQAA 3RN2A 1GD7A 2PI2A 3OTOL 1L1OA 5LMNQ 2CWAA 3ULLA 4A3FH 2D62A 2VS1A 3M85A 4DUZL 4O0AA 4JOIC 1FGUA 3UE0A 2ZTCA 2AHOB 3NBHB 1E24A 4HJ8A 5IYDH 1QVGA 4NXML 2E5LQ 3S1NH 3CD6A 4GKKQ 3E9HA 1EYGA 1VQFA 2WFWA 1QVCA 3RNUA 2K5HA 3HFZB 4IJLA 3G71A 2Z6KC 2RHSB 2MO0A 3F2CA 2WP8J 2EXDA 4Y7NH 1K8AC 1IBML 2XGTA 2E2HH 1QVFA 3J7A5 5E7NA 3HKZE 4IFDI 3GTJH 4OO1I 1OXVA 2E8GA 3CCQA 4LF5L 4NXNQ 3U4VA 1HNWQ 1EFWA 3I56A 4IPGA 4LUOA 5M5WH 2RF4A 2UUCQ 2Y0SE 4DV7L 5EAYA 3PIOA 2LXKA 2VW9A 4IO9A 2IX1A 3PF4A 4B3RL 4A93G 3PUWA 2E2IH 2Q2HA 3F2BA 4IFDG 4JI4L 2YYZA 5FLMH 4PMWA 2HIVA 3LGJA 2VQFL 1JT8A 4YWLA 1S72A 3GTPH 2K14A 3GTOH 4DR7Q 3RZOH 1N33L 2N3SA 1TWCH 4LW1A 2I5MX 4R1JA 1X3EA 1T9HA 4LWCA 1DGSA 4ME3A 4A3JG 4DR6L 5C4XH 1YJWA 1V1QA 2H5XA 1HNZL 4BY7G 4X6AH 4JI2L 2B63G 3H3VH 1HZBA 4EQ5A 5HGQA 4GLXA 5C4XG 5C0XI 4DPGA 1HJPA 4AH6A 2YTVA 1PVOA 4DV0L 2UXCL 1IL2A 1E1OA 1GKHA 5C44H 2WB1G 4YY3L 1BKBA 2GVBA 3FHWA 4A3CH 1G6PA 1TWHH 1IYJB 2JEBI 5JEAG 1XMOL 4JI6L 4DV2Q 4RMFA 3UDIA 4HIOA 5C0XG 2NVXH 2AMCB 1Y14B 1YEZA 2KHIA 2PMZE 1AE3A 5C44G 4BXXH 2MFIA 4A3CG 2JA9A 1UE5A 2PI2E 1VQ5A 1R9TH 2KHJA 2BA0A 1E1TA 2K50A 1YJNA 2HQLA 2N49A 4LF8L 2UUAL 2BH8A 2JE6I 3EN2A 1JMCA 1PYSB 1UE7A 3D31A 4ALPA 3Q8DA 3WWVA 3J81c 1I6HH 3S14H 2UUBL 1XNQL 3S1QH 4LFAQ 1GVPA 1GM5A 1LTLA 3PSIA 1PH7A 4OXPA 4HJ5A 1X9NA 3I4NH 3W1GA 1A63A 4LFBQ 1UE1A 2K4KA 3PV0A 1PH6A 2JA8G 1FVIA 2R7ZG 1VQGA 1L2FA 4DR4L 5M5YH 4DV1L 3I4NG 4OWXB 2QA4A 1N8RC 3TS0A 2NZHA 3CMEA 1N32Q 4LUZA 3ICEA 4DV6L 3M9BA 5GAHC 3T1YQ 1A0IA 1I94Q 4JI8L 1OXXK 3U50C 4B3TL 2UU9L 3H0GH 1FJGL 1CUKA 1Q12A 2HHHQ 1P8LA 3UDFA 4A3LG 4LF7L 2VUMG 1L1OC 1ASYA 1KIXA 1JJGA 4JI1Q 3CC4A 4LNQA 4JI0Q 2CKZB 1N36Q 1K0RA 3KDFA 3PUVA 1M1KC 1O7IA 4NPSA 4GOPA 1V9PA 3GTLH 3CAMA 4H02A 4YCVA 1SE8A 4GS3A 2KCMA 3AEVA 1XMQQ 3CP0A 3M7NA 4OWTB 4JBWA 1UEBA 3IRBA 3RLNA 3STBD 3D0FA 1C9OA 1X55A 4IJHA 1HNXQ 4DV5L 1VQEA 5GROA 3RLFA 5LMUQ 2JA6G 1B7YB 1KC8C 1L0WA 1IXRA 4YCUA 4KLKA 4DR1L 3A5ZB 4JV5Q 2UXDL 3KF6A 2WB1E 3M4QA 1PH4A 1XJVA 1SLJA 1C7YA 3M3YH 1H95A 4HJ7A 1QZGA 2Q2TA 2XTIA 3S17H 2OCEA 1VQBA 4YHHL 3PO2H 4R4TA 1PYBA 4QGUA 3PGZA 1EUJA 4LF4L 1IZ6A 4A3IH 3PF5A 1OTCA 1UE6A 1Q86C 4DR5Q 2JA5G 4GKJQ 3ULPA 1LUZA 1PH2A 4DUZQ 1YHBA 1N34Q 3I4OA 4C3JH 4B3ML 1XTDA 4A3IG 1LM0A 1NY4A 4YWMA 1HR0Q 1XPOA 4O2DA 1YHQA 1EIFA 4LF9L 1VQ7A 4JYAQ 1VQMA 1G291 2GN5A 4AQYQ 1PH9A 1TWAH 4R4CA 2R6GA 4GNXA 2ZM6L 2QGQA 1IBLL 1EQQA 4A3DH 1Q8KA 4B3SQ 1YBYA 2EIFA 2BA1A 4BA1I 3RZDH 2F4VL 1CSQA 1WFQA 2DUDA 3BZCA 5C3EG 1TWFH 4BBSG 2JEAI 5LMNW 4DUYQ 4A3DG 1SRUA 2DGYA 1I3QH 4AIMA 3F1ZA 4C3IH 4A76A 2N8NA 5GAGC 2Z0SA 2UXBL 2OQKA 4FDBA 4LUVA 3U58A 1QUQB 3GTQH 4A93H 4C3HH 4DR2Q 3A5UA 5IE8A 4HIDA 4LF6Q 4JI5L 4QQBX 2PQAB 3DM3A 1PFSA 4JG2A 2CCZA 1L1OB 4OWWB 4OO1G 1V43A 2R93G 2CFMA 4DV4L 1HZ9A 3HOWG 3OYYA 4DR6Q 5IY0A 3T1HQ 4GLAC 4A4IA 2E2JH 1NTGA 4A3JH 1VQ9A 4A3BH 4DKAC 4Y52H 4POFA 5FLXc 5LMNL 2YTXA 5IWAQ 3K7UC 4BY7H 1VQHA 3KJPA 3CCMA 2D0OA 3PUXA 2ZJRA 2B63H 4A3BG 2WAQE 3I4MG 3G4SA 4A3MH 2NVTH 1J5EQ 2R7DA 3U4ZA 4IOCA 1WYDA 4P74A 2E5LL 3MEFA 4GKKL 1X54A 1CKNA 1PH1A 1GO3E 2RHQB 4A3MG 4K0KL 3TREA 4DV3Q 1K9MC 4KHPQ 2VQEQ 1IBKL 3A74A 3AFQA 1NJIC 2QEXA 4NXNL 4OX9Q 1HNWL 4XTCS 1KRTA 3FKIH 4A3EG 2UUCL 1MIUA 2MNAA 4GOPC 2CQOA 1YITA 5M3FG 4HJ9A 3I2ZA 1QZHA 4A3KH 1MJCA 3FKIG 3NENA 2EQSA 4X66Q 4DR3Q 3UDGA 2HIXA 2JQOA 3PUYA 3NEMA 1YNXA 2IHEA 3KLWA 4L5RC 2HT1A 3BU2A 4DR7L 4JBJA 5HY6A 3G6EA 4A3KG 1BVSA 3K7AH 3KOJA 3F2DA 1Q81C 2JA8H 4DNIA 4APVA 2R7ZH 2B29A 1KQSA 1VQ4A 3HKSA 2K5NA 1K8GA 1NMFA 4R4OA 1RL2A 2C35B 3MXNB 1KL9A 5IP7G 1VQOA 3KF8B 1SR3A 2Q2IA 1CKOA 4X62Q 3CPFA 1D7QA 3CF5A 5AJ3Q 4A3LH 2VUMH 4BY1G 4X64Q 1SFOH 1Q1EA 3L0OA 4GLVB 2IX0A 2OTLA 4PZ7A 2LSSA 1D8LA 1Q1BA 1TWGH 1YZ6A 4HJAA 4JBKA 1XNRQ 2OQ0A 3HOUG 1VS0A 4JCVE 4TVAB 4X65Q 4L5SA 1A62A 4GNXC 4QY7A 3HOXG 4JI7Q 4MTNA 1BBWA 2ES2A 2A8VA 4R4IA 3HOYH 2ATWA 2YTYA 3W1BA 4LFCQ 2JA6H 1Y1VG 4AYBE 1PHJA 4LFAL 1XPRA 1S40A 5BR8Q 5JJIA 1FL0A 5FJ8G 3SGIA 3PIPA 3H15A 4NB3A 3HOYG 3B6YA 4UP8A 2PNHA 2WAQG 1C0AA 1X3FA 4JI3Q 5IT9c 1N32L 4JBMA 3TQYA 5K36G 2JA5H 4KHZA 3T1YL 1I94L 2JK8A 3UE1A 2HHHL 3DLLA 5GQOA 1EIYB 2ZJPA 3KDFB 3OTOQ 3RR5A 3GTMH 5IYBH 4GOPB 3BJUA 2A19A 2L15A 1VQNA 2R92G 3PCOB 3RLOA 4JI1L 3TS2A 5M3MG 4JI0L 1N36L 4NXMQ 4IPHA 2R7FA 5IYBG 1U0LA 4WJ4A 1MKHA 3GTKH 5C4JH 3L2PA 1K83H 3J81i 1Z47A 5JJLA 1XMQL 1A8VA 4XIGS 5C3EH 1IBMQ 2I0QA 2AWNA 4P73A 5IYCG 4BBSH 3KF6B 2VNUD 2CWPA 4LF5Q 5ELOA 1HR0W 1OXSC 1JJCB 3CC2A 4JV5L 3TEHB 4DV7Q 4B3RQ 1Z9FA 2F52A 1VQCA 3GDEA 1N9WA 1B70B 1VQ8A 1BBUA 3S15H 4JI4Q 5IP9H 1XPUA 3TRZA 1WCMG 3M4OH 3E0EA 2VQFQ 3S1MH 2R93H 3CPWA 3HOWH 4A3GG 1N33Q 2I5LX 4QIWE 5IP9G 4DR5L 3ZJYC 4GKJL 2YV5A 1G51A 3JAMc 3E9IA 1N34L 1KD1C 1VCIA 4GNXB 4A3FG 1HR0L 1JJ2A 3GD7A 4OONA 5GAEC 1HNZQ 4UPAA 1HZCA 3I4MH 4PG3A 4JYAL 4JI2Q 3CC7A 4PZ8A 4AQYL 3AYHB 4L5QA 1PH5A 4K0KQ 5IYDG 3W5OA 3CXCA 4DV0Q 2IT1A 1KRSA 2UXCQ 2F3IA 1VQKA 1IBKQ 4B3SL 1ASZA 1U5KA 4YY3Q 4IFDJ 4AYBG
chains in the Genus database with same CATH superfamily
2K1BA 1ESFA 4BBRH 4JI6Q 1PTOD 1YJ9A 4P71A 1MJEA 4TQUS 5M3FH 3ERSX 4LF8Q 2HCCA 1GHJA 3HOWB 1AW7A 4DAMA 5K5PA 3ERQA 3J7ZC 3KFUA 2K6AA 2KBNA 3UI2A 4BA2I 2K33A 2B2WA 4UY8C 1C4QA 1UWVA 3H3VI 2I46A 2ZTDA 5M5XH 4AYBB 2IY5B 4DV1Q 1G2TA 2CQAA 4JOIA 4QUCA 5ELDA 3IAYA 1CKMA 1PH8A 5C0XJ 4A3MB 4DAYB 2OWOA 1FJGQ 4MNOA 3CQZH 4BY1H 3I55A 1KNAA 2N55A 1BNZA 2F0PA 5M3FB 3CCLA 3M4YA 1DJRD 4KKUA 4L6TB 3HOUH 4IQZA 3HOZH 3OW2A 4NDXA 1YI2A 4F88A 1QG7A 2NTSA 3IFDA 3HOXH 1ONLA 4HCEA 3JAMi 1JB7A 2K05A 3A55A 1Y8PB 1GJXA 3NP8A 2I5HA 1LV9A 1Y1VH 4X66L 1WOCA 4ZQ3A 5M5XB 4B08A 3CRLC 4DR1Q 4YCWA 4GZYC 2B2YA 1KTKA 3SVMA 4KJOA 5CYUA 3CMAA 4LF4Q 1ZXTA 3CQZB 3TP6A 1ENCA 3KJOA 4BY1B 4IPCA 1SNOA 4UP7A 1YNJC 2B2VA 3GO5A 3S24A 4N8FA 2V1CC 2M9VA 4B3MQ 3HOUB 3HOZB 1QILA 4X64L 4PMCA 3HOXB 1NMGA 1W2BA 1Y1VB 4X65L 4RWSC 1AH9A 1E3PA 2FHTA 3LNNA 4DAPA 2E76C 3HOVH 1YNND 2H4OA 1L0YB 3JC66 1HNXL 5JJLA 4G7OC 3K5MA 1F9RA 1W3SA 4KI0A 2MQHA 2RKSA 2LXJA 3AQQA 4JI5Q 3A8KE 1OXTA 3EBEA 1LYLA 3H94A 4DF7A 2B2WC 4PZ6A 3DWPA 5A2QL 1L1OA 5LMNQ 2CWAA 3ULLA 2VS1A 3GV3A 3I73A 4DUZL 4JOIC 1SYCA 3UE0A 2AHOB 3J80E 1SAPA 2BOSA 3A54A 5IYDH 3S1NH 3E9HA 4QB4A 1VQFA 2DY8A 3HOVB 3BDOA 1MSGA 1D2BA 3FPPA 1D1IA 2MO0A 4Y7NH 2EXDA 1E2VA 1NAPA 5J22A 1QVFA 4G57A 1DOKA 2HD3A 2E8GA 4Z9CB 3U4VA 4LUOA 5M5WH 4NMZA 3PF4A 4DV7L 4CDCC 4IO9A 2F0UA 4DNRB 2DN8A 1JT8A 3DXJC 3GTOH 1N33L 1TWCH 4ID6A 1X3EA 5I6YA 1EFID 4A3JG 2B2YC 1PRTC 3S1NB 1YJWA 1JWUD 2ZXRA 4U68A 1EY7A 3H3VH 5HGQA 4Y7NB 4DPGA 4PQXA 4OIKA 2B2VC 2UXCL 4R9WA 1D5ZC 3DM1A 1S5CD 2GVBA 4YY3L 4KTAA 5M5WB 1TWHH 3EA6A 5ELFA 4R8NA 5JEAG 1PZJD 2H1EA 1F9PA 2KHIA 4O1NA 1AE3A 3OW7A 4A3CG 2JA9A 1UE5A 2WIIB 2PNRC 3IKJA 1R9TH 1TT2A 3TZDA 2BA0A 1YJNA 2UUAL 3GTOB 4N9PA 1JMCA 1SBBB 1EL0A 2F0EA 1TWCB 1I6HH 1S5ED 1GVPA 1SYFA 1MD2D 1STEA 1R4PB 4HJ5A 3I4NH 3Q23A 3K58A 2K4KA 2O4XA 1FVIA 3VA7A 4DR4L 2P5ZX 4FVMA 2XWJB 3V96A 3TS0A 3MAQA 1AEXA 5GAHC 1I94Q 1TWHB 2JN4A 4JI8L 1OXXK 3U50C 1SE2A 2HHHQ 1P8LA 4I7AA 4XQJA 1ILQA 3UDFA 1HFNA 2Q8RE 4LF7L 2VUMG 1L1OC 1ASYA 1I4RA 1W6KA 5BN4A 1R9TB 3J80L 2CKZB 1CZGA 1M1KC 4KN4C 1H9JA 1O7IA 1I6HB 3AU7A 3CAMA 2NVYB 4TSSA 3V2TA 5LHY1 1HA6A 3I3CA 3D0FA 1HNXQ 1ZEQX 1L0WA 2UXDL 4KLKA 1GUSA 1H95A 1XJVA 4HJ7A 2Q2TA 4JVZA 4YHHL 4JK1C 1PYBA 4QGUA 1K3BC 3NXWA 1M4VA 3WOFA 3A7AB 4DUZQ 1MSHA 1X3QA 4BS9A 4KD4A 3MFYA 1K8OA 4A3IG 2F0HA 3EJIA 1QNUA 1XPOA 2EYFA 3TBIB 5ELCA 1UUPA 5CC4A 1CM9A 2GN5A 4AQYQ 1TWAH 3GTGB 1A2UA 4GNXA 2ZM6L 1IBLL 3I72A 4A3DH 1EYDA 1YBYA 2EIFA 2BA1A 2NZ1D 5E3FA 4BBSG 4JW0A 2JEAI 1I3QH 1PLFA 5ELBA 2UXBL 1PMRA 2OQKA 3FRPB 4CHTB 3A5UA 1EY6A 2K7VA 2LY7A 1XWEA 3DM3A 1PFSA 4JG2A 4C3HG 4OO1G 2R93G 1HZ9A 3T1HQ 4A4IA 2E2JH 4A3JH 4Y52H 1EEID 1TWAB 1LACA 3QG1A 2VXWA 5IWAQ 3D4RA 2ZXOA 4PMBA 1C8CA 4A3DB 2ZJRA 5M9OA 4XT3B 2NVTH 1J5EQ 2EYMA 2R7DA 3BYTB 1PH1A 1H9MA 1I3QB 2QILA 1PXUA 3TREA 5JEAH 5C4HA 2F0KA 2V4DA 2RQXA 3AFQA 5DNFA 4OX9Q 1HNWL 2RSNA 2MJ8A 2UUCL 5C4ZA 1PTOC 3WOEA 3I2ZA 1QZHA 1RDPD 3FKIG 4FO2A 3UDGA 2E2JB 2ENBA 2JQOA 3HEJA 3NEMA 4A3JB 3KLWA 3P7JA 4JBJA 5HY6A 3G6EA 3CRKC 4A3KG 1AZQA 2EVBA 3Q6SA 5I4DA 2B29A 1KQSA 2NVTB 2EYJA 3DHQA 4IZ8A 1RL2A 2C35B 5IP7G 1O7ZA 1MHWC 2Q8TA 3ZYYX 5AJ3Q 2RBMA 2VUMH 1SFOH 4GLVB 3VR3A 4E6IA 2LSSA 4JBKA 1YZ6A 1G6ZA 4DFAA 1SNPA 4JCVE 4TVAB 4EQPA 4L5SA 4GNXC 4RGMA 2K01A 4JI7Q 3HOYH 2ATWA 1HPCA 4LFCQ 1WTHA 1S40A 1FL0A 5FJ8G 3H15A 3FPUB 1C0AA 3SEBA 3SE0A 1X3FA 4JI3Q 1VMCA 3TQYA 2VUMB 4KY5A 1S5FD 2IW3A 3MWYW 2EY5A 1DD2A 1HCZA 2F0LA 5FO7B 1MI2A 4HAEA 4ME5A 1GUNA 1JOKA 5KIXA 2R92G 3PCOB 4FXDA 5M3MG 1EZ6A 1N36L 4NXMQ 2R7FA 3SHLA 3SR1A 4WJ4A 3HOYB 2D2CC 3L2PA 3J81i 4G4KA 2EJGC 1Z47A 4KN7C 4H44C 1XMQL 2G5DA 3NBHA 1SJHD 4BBSH 3OIQA 1SNDA 1RJTA 2NUCA 2CWPA 1HR0W 3RMHA 1B50A 3IL8A 4NW2A 3EQLC 1YNNC 3S15H 2F0MA 5IP9H 1MGSA 1WCMG 3BZDB 1NR4A 3E0EA 3P75A 4U673 2VQFQ 3S1MH 3M4OH 3AMUA 2R93H 4ODGA 1LTBD 4YIJA 4XDXA 1IHZA 1EY8A 2YV5A 2L0CA 4A3FG 3ND8A 1BR9A 3OIPA 4IUNA 2FJ2A 1LTRD 3OWFA 1RCVD 4KJNA 5KRUA 4BBSB 1IL8A 4DV0Q 1ASZA 1BQQT 3DEPA 4AYBG 1XMOQ 1GHKA 4DUYL 4WFN3 4IUPA 3S15B 3F8TA 3VYTA 2J4XA 2JYOA 3EIVA 4BBRG 2PPBC 4IOAA 3S1MB 3M4OB 1PA6A 2R93B 4IUTA 1GUWA 2E2DC 4L5TA 1XNQQ 1IW7D 2X6GA 2BDOA 1E7ZA 1X6OA 4G7ZC 1I6VC 3VR5A 1I4HA 2ZJQA 3NELA 4RCOA 1PV4A 2D0PA 4GN3B 3G48A 3TZUA 3MXUA 1CKNB 5JEAJ 2ZXPA 5IP7H 1KHIA 2VZAA 2PQEA 1FNUA 5EPLA 1EYAA 2NTTA 2XVSA 3MFGA 2FXQA 1KAWA 2EOTA 2UU9Q 3NSWA 2E74C 4MTKA 3L7ZC 2VQEL 5AFWA 3I7FA 3J81j 3FKIB 1K0SA 2QDLA 4EQNA 3S1RH 2CVRA 1NE3A 5EJWA 4DK3C 3HOZG 2HCIA 3QO2A 1Q7YC 2F03A 1LTSD 3EVQA 4DK1A 5FJ8H 2NVQH 2RDGA 3M4PA 2A68C 1HFGA 1JCKB 4HMJA 2XWBB 3D4WA 3SK4A 1B1ZA 3D4DA 2WKCA 3S2DH 5DLQE 1PH3A 4IUUA 3S16H 1FD7D 2BH2A 2R92H 1DOMA 3S1RB 4LF9Q 5M3MH 3PO3H 3VA5A 1V1PB 2PW7A 1VQLA 5KGUA 1BCPB 2A6ED 3C1FA 3K80C 3S2HH 4R4QA 1A3VA 2NVQB 3K81C 3CCEA 3RN5A 1D1KA 2QEJC 3K59A 4HR7B 2RDHA 1X3GA 5BR8L 1S3OA 2K5VA 2ICIA 3HOVG 1P16A 3K0YA 3K8AA 1VQAA 1WCMH 4JPBW 5CGKA 1BBXC 3S2DB 2MO1A 4FP5D 3S16B 2KEDA 4ZUJA 1D6EC 2AWOA 4DV4Q 3CCJA 2R92B 3TSSA 2PCFB 4WRDA 2PYKA 3D6CA 2F0NA 4R8IA 2FMCA 5M3MB 2PQAA 3RN2A 3PO3B 2PI2A 4A3FH 3S2HB 1CA5A 3R2TA 1E24A 5CBAE 2L5TA 1QVGA 2E5LQ 4UHVA 3R8BA 1QVCA 3RNUA 1JICA 3G71A 5CBEE 3F2CA 1IBML 2BDNA 1K8AC 4LF5L 2F0SA 3I56A 1A3TA 1CZWA 4IPGA 1WCMB 2AUJD 1G2SA 5EAYA 2LXKA 2VW9A 4B3RL 3PQIA 5IT9L 4C56C 2KEEA 2E2IH 3F2BA 4JI4L 1XXGA 3EFXD 2CHBD 5JAVA 2YYZA 1J9OA 3SDZA 2HUGA 3MTSA 4A3FB 4NP5A 4DR7Q 4FF1A 2N3SA 4LW1A 3MXPA 1T9HA 4LWCA 4ME3A 3PIP3 3DMUA 2H5XA 1I4QA 2HDLA 2XRSD 4LAAA 5A2QE 2B63G 1WTQA 3I8ZA 2FINB 1PVOA 2YTVA 3NPPA 1IL2A 3MXNA 4FNFA 4BBRB 2A6HD 2JEBI 4ZCKA 1Y14B 1B3QA 1YEZA 2E2IB 3KK7A 2WV6D 2X6LA 1VQ5A 2KHJA 1TS2A 2BH8A 1TR5A 3D31A 3Q8DA 4FF3A 2UUBL 3S1QH 4DK0A 3PSIA 1PH7A 1EU4A 1A63A 4ZKCB 1UE1A 1PH6A 3PV0A 2R7ZG 2QKIC 1VQGA 1HQMC 3I4NG 1N8RC 3MZ5A 1G91A 4PNYA 3ICEA 3DWQA 4DV6L 2K5DA 3TMEA 3M9BA 1A0IA 4B3TL 3J7AV 4A3LG 2L12A 1JJGA 3C1EA 1FR3A 4JI0Q 2B8FA 3KDFA 1ZYRD 2XSCA 3HS0C 4NPSA 4GOPA 1V9PA 4YCVA 1SE8A 1QB5D 2KCMA 3S1QB 3GP7A 3VYSA 3TP8A 4DV5L 3RLFA 1LTGD 2JA6G 1KC8C 2MPMA 3NQTA 4JV5Q 1JOOA 1EQTA 1C7YA 1BDOA 4I65A 1SLJA 2WINB 2XTIA 4MN3A 5J1ZA 1VQBA 3OMCA 1UE6A 1Q86C 2PW5A 2QDBA 2JA5G 4GKJQ 3ULPA 1LUZA 1PH2A 2BCOA 1N34Q 2KCNA 3I4OA 4K8JA 3HZXA 2RCFA 1XTDA 1EEFD 3K5OA 4JYAQ 1G291 4K5XA 3K6OA 2QGQA 1EQQA 4B3SQ 2F4VL 1WFQA 2DUDA 5C3EG 2MHVA 2SNMA 4CJ2C 1SSOA 5LMNW 4A3DG 2DGYA 3QB3A 2EYHA 1C48A 5GAGC 1DONA 4HMIA 4LUVA 4FDBA 1QUQB 2KCCA 5FOBB 1EOTA 5EPKA 1XX8A 1BUVT 5IE8A 4HIDA 3A7LA 4F8MA 1V43A 1ET9A 3OYYA 1Q8IA 3MXGA 1VQ9A 2F0VA 3KUPA 1U4PA 4POFA 2O2LD 3K7UC 1KDCA 4DU9A 2B63H 2QCPX 3J7YW 4ULLA 1LT6D 2MP1A 3U4ZA 2F1MA 1WYDA 4GKKL 1RTOA 1EU3A 4K0KL 4M1UB 4DAYA 3KBXA 1QCBD 3Q22A 3A74A 4NXNL 2IJ0A 4A3EG 4GOPC 1YITA 4ZUIA 1B3AA 3NENA 4X66Q 3PUYA 1HXYD 4V0BA 1KLGD 3BU2A 5CV8A 1Q81C 2R7ZH 2B63B 5G3LF 1VQ4A 3NUCA 1RD9D 4R4OA 5L37A 3WDNA 1KL9A 5C6AA 1UEAB 2Z4IA 2Q2IA 3KF8B 3CPFA 5I9PA 3ONAB 5G3LD 4ZK9B 2IL8A 4A3LH 4X64Q 3L0OA 3H6MA 2L11A 2F4IA 3GV6A 1VS0A 2F0DA 4HN7A 2EE1A 4X65Q 1BBWA 2YTYA 3W1BA 3K5LA 2JA6H 2R7ZB 1PHJA 4LFAL 1BOSA 3I4NB 2SOBA 1CHPD 3H91A 1S4ZA 2EZVA 3HOYG 2FFKB 2C5CA 1JC7A 3B6YA 1SYDA 2PNHA 1NCVA 1N32L 1STBA 3KLRA 1I4GA 2JA5H 3T1YL 2JK8A 2NB0A 4BWGB 3UE1A 3DLLA 1HQRD 3BYYB 3RR5A 5IYBH 3BJUA 2A19A 1O80A 4L8JA 4JI1L 3S9WA 2D9UA 1PFBA 4IPHA 5C4JH 2JA6B 3J81L 4OEMB 3TN2A 1I4XA 1A8VA 4XIGS 5C3EH 2I0QA 2AWNA 2MUYA 4P73A 1HUMA 3KF6B 5IYCG 2XIWA 2A5HA 5ELOA 1JJCB 4QMGA 5FLXE 4DV7Q 1Z9FA 1VQCA 3GDEA 2A69D 1N9WA 1B70B 1STAA 1FNWA 5ISRA 2OT2A 3HGBA 1LLRD 2JA5B 2CH4W 3OPOA 2LMCB 1XPUA 2DY7A 1B9NA 5A35A 4A3GG 2CH4A 1N33Q 2MGSA 5IP9G 4DR5L 3ZJYC 3E9IA 3QJYA 1KD1C 4CBVA 4IUQA 3KLSX 5KNBA 1HR0L 3GD7A 5C4JB 1HZCA 4X3UA 4PZ8A 2DNCA 5C3EB 4K0KQ 3DEOA 1SYBA 1O7LA 4PV1C 2GA4B 2UXCQ 5D3IB 2K5QA 1VQKA 2OXPA 4YY3Q 1DYQA 2NN6I 3MEHA 3VDYA 1EWIA 1J6QA 3MHBA 4A3EH 3KYHC 1VQPA 3J80c 1SE3A 4DR2L 3FP9A 2NN6G 2UUAQ 2K28A 2X69A 4GN5A 1G8ZD 3AFPA 4MHEA 4LF6L 1IKMA 4F7XA 2OTJA 5FLMG 5EBDA 4HEDA 1X65A 4ZLTF 5H1SE 1B8AA 3NBIA 3OMGA 4DA2A 1QNKA 5EQ0A 2B3GA 4DR4Q 4LMQD 1HA5A 2KENA 2R3ZA 4MZ9A 1EQRA 2ASBA 2RVLA 3CCUA 5DEHA 2VY3A 4JI8Q 1DZ1A 2KOLA 4WJ3M 5CV5A 2GVAA 4LF7Q 4A3EB 4P72A 5KNCA 2JXMB 1B2TA 1Y8NB 2N78A 4DV3L 2ID0A 4KHPL 1WTVA 3VR6A 4FXGC 4BXXG 2NYZD 4I7ZC 2A6HC 1FNVA 4DV2L 1OXUA 1RIPA 1FYCA 4S3SA 1VQIA 4DR3L 1X56A 5DM73 2O5IC 5FLXL 2UXDQ 1II3A 3QR8A 4DK6C 2JA7H 1I5FA 1JE5A 4YHHQ 4LFBL 2F0FA 1QJOA 4IALA 1PFMA 4FF2A 5EPJA 2IX3A 1YVCA 1H9RA 4WJWA 4X62L 1VF7A 3J80i 1EZ8A 1SFOB 1KXLA 4IPDA 2CW0D 3BZKA 5D65A 1K3RA 1HH2P 1XNRL 1Y1WH 1SN8A 4RCNA 3BVGA 1PYWD 2ZM6Q 1IBLQ 3PO3G 3CW2C 5IYCH 1DM0B 2KQ3A 4XXEA 1STHA 2JA7B 2JJQA 5IIFA 3JAME 3UDXA 2PZTA 2UXBQ 2AKWB 4GN4B 3D3RA 2ALYB 1WTWA 5IGCA 4XT1B 1LTAD 3NTHA 3GQBA 2Q2UA 4A3GH 5JOBA 5JPMC 1RODA 5C3WA 3G6JB 3CCRA 3ITPA 4KKSA 1GD7A 3OTOL 1Y1WB 5COYA 2KHSA 4H13C 5JJZA 4O0AA 1FGUA 1B53A 1BF4A 1H9SB 2I07B 1RKNA 3H3VC 1EYGA 2HQEA 2RHSB 4C1NI 1W6JA 3X3NA 3J7A5 5DAUA 1CTMA 2XGTA 5E7NA 3GTJH 5I2YA 1T5XD 4XQQA 1JB3A 3CCQA 2L4NA 1HNWQ 1EFWA 2UUCQ 3U9OA 2IX1A 1BCPD 2NN6H 4A93G 3PUWA 4A3GB 2Q2HA 3A8JE 3NE5B 5FLMH 2HIVA 4YWLA 1MBYA 2K14A 1CQVA 3RZOH 3CKIB 1TIID 2LFNA 4J1MA 5E4XA 4ZKBB 5C4XH 1SJED 1V1QA 4BY7G 1HNZL 4X6AH 1PZKD 4JI2L 1HZBA 1PDQA 1U9RA 4EQ5A 4GLXA 1WD0A 1HJPA 2EY6A 1GUGA 5FKAC 5D14A 1E1OA 1GKHA 5C44H 2B2UA 1G6PA 5DM63 1Q3LA 4JI6L 4DV2Q 4RMFA 3UDIA 2NVXH 2HDMA 4BXXH 2MFIA 1E1TA 1Y8OB 2K50A 2N49A 4LF8L 1BO0A 4M8AA 5EKKA 1PYSB 1UE7A 4ALPA 3WWVA 3S14H 3JAML 1K8MA 5IT9E 2RDFA 4OXPA 5C4XB 4LK1C 2F0GA 2EXZA 4LFBQ 5CV6A 1EY9A 1LABA 3NK9A 4L63B 2JA8G 3SK5A 4Q5VA 2E75C 1L2FA 1T5EA 3KLSA 5M5YH 4DV1L 4OWXB 2QA4A 1U4RA 2NZHA 5FO8B 3CMEA 1KABA 4LUZA 2M00A 1FJGL 1CUKA 2NVXB 1QOHA 4QCLA 1KIXA 2VB3X 3CC4A 3NWSA 1N36Q 2EY2A 3PUVA 4DXGA 1VDZA 1EY5A 3S14B 1F9QA 4GS3A 3AEVA 2F0QA 3RUZA 1XMQQ 3URYA 4OWTB 4JBWA 3IRBA 3STBD 5LL6S 4IJHA 2AQ3B 1PRTB 3M7GA 5CMDA 1SEBD 3P20A 3OOCA 1SNQA 4DR1L 3A5ZB 2F0IA 3BVZA 1GUTA 3E5SA 2OCEA 4OHJA 3C2PA 4RH6A 1EUJA 4LF4L 3PF5A 1OTCA 4HTHA 1GOZA 4B3ML 3ND9A 1NY4A 4YWMA 1JQYD 3T53B 2PZWA 2K5WA 4O2DA 2AUKA 1VQMA 2IPKD 1PH9A 1ZKOA 2R6GA 4XQNA 1WVLA 4BA1I 1CSQA 4K2LA 1KDBA 3BZCA 2B2UC 3TP5A 1TWFH 4N9TA 3VYUA 4LJZC 4DUYQ 1SRUA 3LX0A 4XYQA 2FMMA 1CK1A 4K5WA 3CHBD 2Z0SA 2SNSA 2DNEA 3U58A 3GTQH 4A93H 5CV4A 1STNA 1ENFA 3I4LA 5IGDA 4JI5L 4FF4A 4FYDA 4OGQC 1L1OB 1STYA 2A69C 2CFMA 1A2TA 1WTPA 2WACA 2EY1A 4GLAC 5C5MA 1NTGA 4KY6A 4A3BH 2Q8IB 3NHHA 1U4MA 4RGNA 5LMNL 3K5NA 1TS4A 1TU2B 4BY7H 1VQHA 2JSOA 3PUXA 2WAQE 3I4MG 3G4SA 4A3MH 4IOCA 1TWFB 1F2MA 3MEFA 1AP0A 1HUNA 1CKNA 1LO5D 4UDUC 2Z9HA 1NUCA 1QE6A 3SXHA 3GTQB 4A93B 2VQEQ 4K2KA 1IBKL 1NJIC 1KRTA 1E2WA 5IGGA 1MIUA 4HJ9A 1HTLD 3F2UA 1LTTD 1OO9B 2EQSA 2QF7A 2HIXA 4A3BB 3BVMA 2HT1A 4G7HC 3T56B 4BY7B 2JA8H 1SNCA 1STGA 2K5NA 1VMPA 4X3SA 3J7AF 4EGVA 1NMFA 1S5DD 4F87A 1DXMA 5KNDA 2DJGC 3TDQA 1SMYD 1CKOA 2AQ1B 3MA2B 1E2ZA 2TMPA 2XRQD 2IX0A 1D8LA 1Q1BA 4HJAA 2OQ0A 5JVG3 5CV7A 1PZID 1PTOH 5IGFA 1A62A 3LWEA 4MTNA 5TSSA 1V1PA 2A8VA 3FVQA 4R4IA 2JA8B 2F0OA 1CT1D 5BR8Q 5FK9C 3EROA 2IWHA 5IT9c 2K04A 1SXTA 5IOCA 2XN9C 3CU7A 4EVOA 5K36G 4KHZA 1I94L 2L1BA 2HHHL 1EIYB 2ZJPA 1EWHA 3GTMH 3Q24A 1PTOB 4C1NK 1RHPA 3RLOA 5F2DA 1TVXA 3TS2A 3T13A 2EJFC 5IYBG 1MKHA 2CW0C 1F9SA 4RFBA 1JR0D 1Z6HA 2WAQB 4OL7A 1IBMQ 1HHVA 2XNAC 2BE5D 2VNUD 2K32A 4LF5Q 1OXSC 5EKLA 1D5MC 4B3RQ 2F52A 3KBGA 1VQ8A 4JI4Q 4KY7A 2PO4A 3GTMB 1O7YA 2I5LX 4QIWE 1EIHA 5IGEA 1EY0A 1G51A 1Q90A 4Q0FA 1B44D 4WORA 2B2TA 4GNXB 1IYUA 2F3WA 1TS5A 4OONA 5GAEC 1KAAA 3I4MH 4PG3A 3QOLA 3CC7A 1PH5A 4AQYL 2IT1A 1IBKQ 1U5KA 4QUFA 4RA8A 1TKWB 3R2IA 4XYOA 1SMXA 3E6ZX 4UP9A 3SK8A 3J81E 3D8GA 4EX5A 4CKCA 3VR2A 2NWGA 2Z1CA 5JJKA 1CSPA 3K0XA 1UNSA 1F77A 1K73C 5CV9A 2UUBQ 2KCTA 5HGTA 1BCPC 2RCNA 2ZT9C 1WI5A 2YU9H 5C3XA 3T1HL 2K52A 2EYLA 4NKLA 3I4MB 1TS3A 2IHFA 2A74C 2F0WA 5J3BA 5C5LA 5IWAL 2B8GA 3A8IE 2VL6A 1IW7C 4DV6Q 1ESRA 2SDFA 4QL5A 1J5EL 3ULJA 4B3TQ 4KKTA 1YHAA 2G9HD 2Z6KA 4HIKA 5GADC 2ZTEA 5T1GA 1NBWA 5KYIA 2NZOA 1Q82C 2K75A 1VQ6A 4OX9L 5KEEA 2A68D 2NVYH 2EDGA 4RKLA 3T4AC 5CORA 2YU9B 3SK6A 1YIJA 4DV5Q 4X3KA 3A0JA 1SDFA 1EIGA 1VQDA 4C2MH 1EOVA 1M90C 3AB9A 4RG1A 3CCSA 4POGA 2JA7G 4JC0A 5K36H 3HKZG 3ER0A 2R61A 4O42A 3PUZA 4UAIA 1HZAA 1TXYA 3H0GG 5AJ3L 2Y0SG 4TRDA 3FMCA 2A1AA 1I50H 2B2TC 4QIWB 4IN3A 1SE4A 1EYCA 1Q46A 1WJJA 4IURA 3GTGH 4P2CB 4CDFC 4DAVA 5FO9B 2F4VQ 4JI7L 4C2MB 1AE2A 1Y1WG 1NSNS 1E22A 4J15A 1A6XA 4P75A 4LFCL 5J39A 2PZUA 5EGTA 4HIMA 2A6EC 4YWKA 3STBC 1U4LA 5LMUL 1VQJA 3C3LA 1I4PA 1SROA 4QJFA 4HCSA 4KMUC 4JI3L 2EPBA 3PO2G 5ELNA 3C46A 2F0TA 1JORA 1QUQA 3CCVA 1SYEA 1I50B 4A75A 4C3JG 2D62A 3M85A 4KV6A 1R4QB 3U9SA 1LT5D 1V1OA 4IUVA 2ZTCA 3NBHB 4RGOS 4CKEA 4HJ8A 4NXML 3CD6A 1Y69U 3D6WA 4GKKQ 1K28A 2WFWA 3W2DA 2EJMA 2K5HA 3HFZB 4IJLA 2KJXA 2Z6KC 1B9MA 2E2HH 1GUOA 2WP8J 3QIAA 3DWAA 4IFDI 3HKZE 4J8QA 4OO1I 1OXVA 1B4OA 4NXNQ 2O5JC 1F2LA 1GXDC 2RF4A 4C3IG 2Y0SE 4ZRZA 3PIOA 2KUMA 1J8IA 1WTXA 4IFDG 3I70A 3MC0B 2N88A 4PMWA 5IODA 3LGJA 5ELEA 2VQFL 1ICWA 5I6WA 1S72A 3GTPH 4RKBA 3FDTA 4ILWA 4B9WA 2EYOA 4R1JA 2I5MX 1DGSA 4DR6L 1A3UA 3PMFA 2B39A 2E2HB 5C4XG 5C0XI 4AH6A 4DV0L 4ABNA 3TP7A 2WB1G 4A3CH 1BKBA 1X3PA 3FHWA 3KF8A 3LWUA 1IYJB 1CQFA 1XMOL 4HIOA 5C0XG 2AMCB 4CDDC 1NR2A 2PMZE 5C44G 2Z4HA 5BN5A 2PI2E 1JWSD 2DJFC 1V8QA 2LKVA 3GTPB 3I91A 2HQLA 1HRJA 5IGBA 2JE6I 3EN2A 1ICFB 4K5VA 3J81c 1XNQL 4KD3A 3I90A 4LFAQ 4RGTA 1GM5A 1LTLA 1X9NA 1X32A 3W1GA 1RTNA 1SNMA 1YNJD 4J6HA 4X3TA 1N32Q 4CJ1B 3T1YQ 2UU9L 3H0GH 1F2YA 1Q12A 3X3MA 2L9HA 2AQ2B 1DCZA 4V190 1SMYC 3MVVA 4JI1Q 4LNQA 3IFTA 1K0RA 3GTLH 2KECA 4H02A 1TY2A 3CP0A 5I9OA 3M7NA 1O78A 1UEBA 3QOJA 2F3VA 3NTIA 3RLNA 1C9OA 1X55A 2Z6BA 1VQEA 5GROA 2RSOA 5LMUQ 1B7YB 5E4WC 2J0TD 1JOQA 1ZYRC 1IXRA 4YCUA 3PIO3 3L9AX 3KF6A 2WB1E 3M4QA 1PH4A 3M3YH 3HKZB 1QZGA 2F0JA 1LT3D 1FGBD 2TSSA 3QWNA 3S17H 3PO2H 3BDLA 4R4TA 3H0GB 5I2XA 3PGZA 2Y0SB 1IZ6A 4A3IH 3N6RA 4OIJA 4DR5Q 1A15A 1YHBA 1CA6A 4C3JH 1LM0A 1AN8A 2QW7A 1HR0Q 4B9XA 3GTLB 1YHQA 1EIFA 4LF9L 1VQ7A 1CI3M 1XYIA 1AFPA 1SYGA 1S5BD 4R4CA 2D5DA 2OF1A 4N8X1 3R93A 1KDAA 4HSVA 4DNTB 1Q8KA 3HG9A 4RHSA 3RZDH 1BCPF 3M3YB 1EWCA 1PRTF 5BN3A 3R3OA 3L3OC 4AIMA 1DOLA 3F1ZA 4C3IH 4A76A 1UAPA 2N8NA 3PO2B 3S17B 4H0LC 5D3DA 2BE5C 4C3HH 4DR2Q 2EYPA 1KNEA 4A3IB 4IFDH 4OO1H 2PMZB 4LF6Q 4QQBX 2PQAB 1TQOA 2M2LA 2CCZA 4DXFA 1E0BA 4C3JB 1WD1A 4OWWB 1PRTD 1WTRA 3K57A 4DV4L 1ILPA 4H7BA 1KLUD 3HOWG 4DR6Q 5IY0A 3OHXC 5E1FA 1RF2D 4CJ0B 1XTCD 4DKAC 3BS1A 5FLXc 2OEOA 2YTXA 1D5XC 1EY4A 3KJPA 1HTPA 3CCMA 2D0OA 4A3BG 3RZDB 4TKOB 3V05A 5T1IA 2E5LL 4P74A 4ZYSA 1M8AA 1X54A 1IKLA 5KYLA 1GO3E 2RHQB 4A3MG 1F2ZA 4C3IB 1JE4A 4DV3Q 1K9MC 3GTJB 5C0XH 4KHPQ 4C3HB 2QEXA 2K03A 4XTCS 1L0XB 3FKIH 2MNAA 2CQOA 5M3FG 3A56A 3BDCA 4A3KH 1MJCA 4DR3Q 2LS01 1YNXA 2IHEA 3T16A 4L5RC 3RZOB 2NBFA 1BXTA 4DR7L 1BVSA 3DUZA 3K7AH 3KOJA 3F2DA 3FEWX 2SEBD 4APVA 4DNIA 3T51B 1CHQD 3HKSA 3BG3A 3W3AA 1K8GA 3MXNB 2WB1B 1VQOA 1SR3A 2A73B 1NNXA 4DGZA 4X62Q 1D7QA 3CF5A 5C44B 4DN4M 4BY1G 1Q1EA 2KVMA 2OTLA 4PZ7A 4HSPA 1TWGH 1XNRQ 1VF5C 4K6LA 3HOUG 4A3KB 2RA4A 3N52A 3HRZC 4QY7A 3HOXG 2ES2A 3K7AB 2C9OA 4EQOA 1ML0D 4K8IA 1Y1VG 4AYBE 1XPRA 5EKIA 5JJIA 3PIPA 4RHRA 3SGIA 2Z8LA 4NB3A 4CGYB 4MIUA 1ET6A 4UP8A 1ENAA 5M5YB 3OWEB 2WAQG 1CFMA 5JVH3 5LL6X 5NUCA 3VYRA 3G7LA 1LT4D 4CDEC 4JBMA 2J7ZA 4KHVA 1TWGB 2G9DA 3H09A 5GQOA 3KDFB 3OTOQ 3RD4A 1EQVA 4GOPB 2L15A 1VQNA 2KA7A 4K6DA 4QF4A 4JI0L 5JPNC 1IYVA 1U0LA 4CKBA 3GTKH 1K83H 3NQIA 1H9SA 1PFNA 1AZPA 3NWTA 5EBCA 5CR3A 1H9KA 3HP3A 4K14A 3CC2A 4JV5L 3TEHB 2ICEC 4RAUC 1BBUA 1QWYA 3E0JA 3TRZA 2VB2X 4FXKC 4KK7A 3CPWA 3HOWH 4GKJL 3JAMc 1N34L 1LTID 3Q0AA 3OSOA 1WTOA 1VCIA 1JJ2A 3O13A 3GTKB 1PTOF 1TY0A 1K83B 1HNZQ 1JWMD 4UPAA 3E3XA 4JYAL 4JI2Q 3P1HA 2JP1A 4OELB 3AYHB 4L5QA 3NTKA 5IYDG 3W5OA 3CXCA 1KRSA 2F3IA 2WKDA 4ZAIA 4B3SL 1Z7TA 3VR4A 5HURA 4IFDJ 2L55A
chains in the Genus database with same CATH topology
4BBRH 2NN6I 1XMOQ 4JI6Q 1SMXA 3VDYA 1EWIA 4UP9A 1J6QA 4DUYL 1YJ9A 3F8TA 4A3EH 3KYHC 3S2DH 4P71A 4EX5A 3EIVA 4TQUS 4BBRG 5M3FH 3ERSX 3J80c 1VQPA 1PA6A 1MJEA 4IOAA 4DR2L 3FP9A 2NN6G 2UUAQ 4LF8Q 5JJKA 1CSPA 3K0XA 4GN5A 4DAMA 3J7ZC 3AFPA 4LF6L 1K73C 4L5TA 3KFUA 2KBNA 2UUBQ 5FLMG 2KCTA 1XNQQ 4BA2I 1X65A 2RCNA 2OTJA 1WI5A 2YU9H 1E7ZA 1X6OA 4UY8C 5H1SE 1B8AA 1UWVA 3T1HL 2K52A 2ZJQA 3H3VI 3NELA 2ZTDA 5M5XH 2B3GA 1PV4A 2D0PA 4DR4Q 2IY5B 2IHFA 3G48A 4GN3B 5IWAL 4JOIA 5J3BA 4DV1Q 1CKMA 1CKNB 5JEAJ 2VL6A 2KENA 5IP7H 1KHIA 2VZAA 5C0XJ 1PH8A 4MZ9A 2ASBA 1EQRA 4DV6Q 3CCUA 4QL5A 4DAYB 2VY3A 4JI8Q 3ULJA 1J5EL 2OWOA 2UU9Q 4B3TQ 1YHAA 2FXQA 1KAWA 1FJGQ 4MNOA 2Z6KA 3CQZH 5GADC 4HIKA 2ZTEA 4BY1H 4WJ3M 3I55A 2GVAA 4LF7Q 4P72A 1NBWA 3CCLA 2N78A 3L7ZC 4DV3L 2NZOA 2ID0A 1Q82C 2VQEL 3HOUH 4KHPL 3HOZH 3OW2A 3I7FA 3J81j 1YI2A 2K75A 1VQ6A 4OX9L 4BXXG 3S1RH 3HOXH 4DV2L 1NE3A 1OXUA 4DK3C 1RIPA 3JAMi 2NVYH 1JB7A 3HOZG 2I5HA 1VQIA 1Y1VH 4X66L 4DV5Q 1WOCA 4DR3L 1X56A 1YIJA 1Q7YC 3A0JA 1VQDA 4C2MH 5FJ8H 2NVQH 2UXDQ 1EOVA 4YCWA 4DR1Q 4DK6C 1M90C 3M4PA 2JA7H 1I5FA 1JE5A 4YHHQ 4LFBL 4RG1A 3CCSA 3CMAA 4LF4Q 4POGA 3KJOA 2JA7G 4JC0A 3HKZG 4IPCA 3ER0A 4UP7A 1YVCA 3PUZA 3GO5A 3S24A 1HZAA 1TXYA 5DLQE 4X62L 2V1CC 1PH3A 3H0GG 4B3MQ 3S16H 3J80i 5AJ3L 2Y0SG 2BH2A 2R92H 2A1AA 1I50H 4X64L 1KXLA 4IPDA 4LF9Q 3BZKA 1K3RA 1HH2P 5M3MH 1XNRL 3PO3H 1Y1WH 1NMGA 1SN8A 1VQLA 1W2BA 3S2HH 1Q46A 3K80C 2ZM6Q 1IBLQ 1WJJA 3GTGH 4X65L 4R4QA 3PO3G 2F4VQ 4JI7L 3CW2C 1AE2A 1Y1WG 5IYCH 1E22A 4J15A 1AH9A 4P75A 1E3PA 3K81C 3CCEA 3RN5A 3HOVH 4LFCL 2JJQA 1X3GA 3UDXA 5BR8L 4HIMA 4YWKA 2UXBQ 2AKWB 1S3OA 2K5VA 3JC66 4GN4B 3STBC 1HNXL 5LMUL 1VQJA 2ALYB 3HOVG 1P16A 1SROA 1W3SA 4QJFA 3K8AA 4KI0A 2MQHA 1VQAA 1WCMH 4JI5Q 2LXJA 3AQQA 4JI3L 3PO2G 2MO1A 5ELNA 1OXTA 1QUQA 3CCVA 3EBEA 2Q2UA 2AWOA 4DV4Q 1LYLA 3CCJA 4A3GH 3CCRA 4PZ6A 4A75A 2PQAA 3RN2A 1GD7A 2PI2A 3OTOL 1L1OA 5LMNQ 2CWAA 3ULLA 4A3FH 2D62A 2VS1A 3M85A 4DUZL 4O0AA 4JOIC 1FGUA 3UE0A 2ZTCA 2AHOB 3NBHB 1E24A 4HJ8A 5IYDH 1QVGA 4NXML 2E5LQ 3S1NH 3CD6A 4GKKQ 3E9HA 1EYGA 1VQFA 2WFWA 1QVCA 3RNUA 2K5HA 3HFZB 4IJLA 3G71A 2Z6KC 2RHSB 2MO0A 3F2CA 2WP8J 2EXDA 4Y7NH 1K8AC 1IBML 2XGTA 2E2HH 1QVFA 3J7A5 5E7NA 3HKZE 4IFDI 3GTJH 4OO1I 1OXVA 2E8GA 3CCQA 4LF5L 4NXNQ 3U4VA 1HNWQ 1EFWA 3I56A 4IPGA 4LUOA 5M5WH 2RF4A 2UUCQ 2Y0SE 4DV7L 5EAYA 3PIOA 2LXKA 2VW9A 4IO9A 2IX1A 3PF4A 4B3RL 4A93G 3PUWA 2E2IH 2Q2HA 3F2BA 4IFDG 4JI4L 2YYZA 5FLMH 4PMWA 2HIVA 3LGJA 2VQFL 1JT8A 4YWLA 1S72A 3GTPH 2K14A 3GTOH 4DR7Q 3RZOH 1N33L 2N3SA 1TWCH 4LW1A 2I5MX 4R1JA 1X3EA 1T9HA 4LWCA 1DGSA 4ME3A 4A3JG 4DR6L 5C4XH 1YJWA 1V1QA 2H5XA 1HNZL 4BY7G 4X6AH 4JI2L 2B63G 3H3VH 1HZBA 4EQ5A 5HGQA 4GLXA 5C4XG 5C0XI 4DPGA 1HJPA 4AH6A 2YTVA 1PVOA 4DV0L 2UXCL 1IL2A 1E1OA 1GKHA 5C44H 2WB1G 4YY3L 1BKBA 2GVBA 3FHWA 4A3CH 1G6PA 1TWHH 1IYJB 2JEBI 5JEAG 1XMOL 4JI6L 4DV2Q 4RMFA 3UDIA 4HIOA 5C0XG 2NVXH 2AMCB 1Y14B 1YEZA 2KHIA 2PMZE 1AE3A 5C44G 4BXXH 2MFIA 4A3CG 2JA9A 1UE5A 2PI2E 1VQ5A 1R9TH 2KHJA 2BA0A 1E1TA 2K50A 1YJNA 2HQLA 2N49A 4LF8L 2UUAL 2BH8A 2JE6I 3EN2A 1JMCA 1PYSB 1UE7A 3D31A 4ALPA 3Q8DA 3WWVA 3J81c 1I6HH 3S14H 2UUBL 1XNQL 3S1QH 4LFAQ 1GVPA 1GM5A 1LTLA 3PSIA 1PH7A 4OXPA 4HJ5A 1X9NA 3I4NH 3W1GA 1A63A 4LFBQ 1UE1A 2K4KA 3PV0A 1PH6A 2JA8G 1FVIA 2R7ZG 1VQGA 1L2FA 4DR4L 5M5YH 4DV1L 3I4NG 4OWXB 2QA4A 1N8RC 3TS0A 2NZHA 3CMEA 1N32Q 4LUZA 3ICEA 4DV6L 3M9BA 5GAHC 3T1YQ 1A0IA 1I94Q 4JI8L 1OXXK 3U50C 4B3TL 2UU9L 3H0GH 1FJGL 1CUKA 1Q12A 2HHHQ 1P8LA 3UDFA 4A3LG 4LF7L 2VUMG 1L1OC 1ASYA 1KIXA 1JJGA 4JI1Q 3CC4A 4LNQA 4JI0Q 2CKZB 1N36Q 1K0RA 3KDFA 3PUVA 1M1KC 1O7IA 4NPSA 4GOPA 1V9PA 3GTLH 3CAMA 4H02A 4YCVA 1SE8A 4GS3A 2KCMA 3AEVA 1XMQQ 3CP0A 3M7NA 4OWTB 4JBWA 1UEBA 3IRBA 3RLNA 3STBD 3D0FA 1C9OA 1X55A 4IJHA 1HNXQ 4DV5L 1VQEA 5GROA 3RLFA 5LMUQ 2JA6G 1B7YB 1KC8C 1L0WA 1IXRA 4YCUA 4KLKA 4DR1L 3A5ZB 4JV5Q 2UXDL 3KF6A 2WB1E 3M4QA 1PH4A 1XJVA 1SLJA 1C7YA 3M3YH 1H95A 4HJ7A 1QZGA 2Q2TA 2XTIA 3S17H 2OCEA 1VQBA 4YHHL 3PO2H 4R4TA 1PYBA 4QGUA 3PGZA 1EUJA 4LF4L 1IZ6A 4A3IH 3PF5A 1OTCA 1UE6A 1Q86C 4DR5Q 2JA5G 4GKJQ 3ULPA 1LUZA 1PH2A 4DUZQ 1YHBA 1N34Q 3I4OA 4C3JH 4B3ML 1XTDA 4A3IG 1LM0A 1NY4A 4YWMA 1HR0Q 1XPOA 4O2DA 1YHQA 1EIFA 4LF9L 1VQ7A 4JYAQ 1VQMA 1G291 2GN5A 4AQYQ 1PH9A 1TWAH 4R4CA 2R6GA 4GNXA 2ZM6L 2QGQA 1IBLL 1EQQA 4A3DH 1Q8KA 4B3SQ 1YBYA 2EIFA 2BA1A 4BA1I 3RZDH 2F4VL 1CSQA 1WFQA 2DUDA 3BZCA 5C3EG 1TWFH 4BBSG 2JEAI 5LMNW 4DUYQ 4A3DG 1SRUA 2DGYA 1I3QH 4AIMA 3F1ZA 4C3IH 4A76A 2N8NA 5GAGC 2Z0SA 2UXBL 2OQKA 4FDBA 4LUVA 3U58A 1QUQB 3GTQH 4A93H 4C3HH 4DR2Q 3A5UA 5IE8A 4HIDA 4LF6Q 4JI5L 4QQBX 2PQAB 3DM3A 1PFSA 4JG2A 2CCZA 1L1OB 4OWWB 4OO1G 1V43A 2R93G 2CFMA 4DV4L 1HZ9A 3HOWG 3OYYA 4DR6Q 5IY0A 3T1HQ 4GLAC 4A4IA 2E2JH 1NTGA 4A3JH 1VQ9A 4A3BH 4DKAC 4Y52H 4POFA 5FLXc 5LMNL 2YTXA 5IWAQ 3K7UC 4BY7H 1VQHA 3KJPA 3CCMA 2D0OA 3PUXA 2ZJRA 2B63H 4A3BG 2WAQE 3I4MG 3G4SA 4A3MH 2NVTH 1J5EQ 2R7DA 3U4ZA 4IOCA 1WYDA 4P74A 2E5LL 3MEFA 4GKKL 1X54A 1CKNA 1PH1A 1GO3E 2RHQB 4A3MG 4K0KL 3TREA 4DV3Q 1K9MC 4KHPQ 2VQEQ 1IBKL 3A74A 3AFQA 1NJIC 2QEXA 4NXNL 4OX9Q 1HNWL 4XTCS 1KRTA 3FKIH 4A3EG 2UUCL 1MIUA 2MNAA 4GOPC 2CQOA 1YITA 5M3FG 4HJ9A 3I2ZA 1QZHA 4A3KH 1MJCA 3FKIG 3NENA 2EQSA 4X66Q 4DR3Q 3UDGA 2HIXA 2JQOA 3PUYA 3NEMA 1YNXA 2IHEA 3KLWA 4L5RC 2HT1A 3BU2A 4DR7L 4JBJA 5HY6A 3G6EA 4A3KG 1BVSA 3K7AH 3KOJA 3F2DA 1Q81C 2JA8H 4DNIA 4APVA 2R7ZH 2B29A 1KQSA 1VQ4A 3HKSA 2K5NA 1K8GA 1NMFA 4R4OA 1RL2A 2C35B 3MXNB 1KL9A 5IP7G 1VQOA 3KF8B 1SR3A 2Q2IA 1CKOA 4X62Q 3CPFA 1D7QA 3CF5A 5AJ3Q 4A3LH 2VUMH 4BY1G 4X64Q 1SFOH 1Q1EA 3L0OA 4GLVB 2IX0A 2OTLA 4PZ7A 2LSSA 1D8LA 1Q1BA 1TWGH 1YZ6A 4HJAA 4JBKA 1XNRQ 2OQ0A 3HOUG 1VS0A 4JCVE 4TVAB 4X65Q 4L5SA 1A62A 4GNXC 4QY7A 3HOXG 4JI7Q 4MTNA 1BBWA 2ES2A 2A8VA 4R4IA 3HOYH 2ATWA 2YTYA 3W1BA 4LFCQ 2JA6H 1Y1VG 4AYBE 1PHJA 4LFAL 1XPRA 1S40A 5BR8Q 5JJIA 1FL0A 5FJ8G 3SGIA 3PIPA 3H15A 4NB3A 3HOYG 3B6YA 4UP8A 2PNHA 2WAQG 1C0AA 1X3FA 4JI3Q 5IT9c 1N32L 4JBMA 3TQYA 5K36G 2JA5H 4KHZA 3T1YL 1I94L 2JK8A 3UE1A 2HHHL 3DLLA 5GQOA 1EIYB 2ZJPA 3KDFB 3OTOQ 3RR5A 3GTMH 5IYBH 4GOPB 3BJUA 2A19A 2L15A 1VQNA 2R92G 3PCOB 3RLOA 4JI1L 3TS2A 5M3MG 4JI0L 1N36L 4NXMQ 4IPHA 2R7FA 5IYBG 1U0LA 4WJ4A 1MKHA 3GTKH 5C4JH 3L2PA 1K83H 3J81i 1Z47A 5JJLA 1XMQL 1A8VA 4XIGS 5C3EH 1IBMQ 2I0QA 2AWNA 4P73A 5IYCG 4BBSH 3KF6B 2VNUD 2CWPA 4LF5Q 5ELOA 1HR0W 1OXSC 1JJCB 3CC2A 4JV5L 3TEHB 4DV7Q 4B3RQ 1Z9FA 2F52A 1VQCA 3GDEA 1N9WA 1B70B 1VQ8A 1BBUA 3S15H 4JI4Q 5IP9H 1XPUA 3TRZA 1WCMG 3M4OH 3E0EA 2VQFQ 3S1MH 2R93H 3CPWA 3HOWH 4A3GG 1N33Q 2I5LX 4QIWE 5IP9G 4DR5L 3ZJYC 4GKJL 2YV5A 1G51A 3JAMc 3E9IA 1N34L 1KD1C 1VCIA 4GNXB 4A3FG 1HR0L 1JJ2A 3GD7A 4OONA 5GAEC 1HNZQ 4UPAA 1HZCA 3I4MH 4PG3A 4JYAL 4JI2Q 3CC7A 4PZ8A 4AQYL 3AYHB 4L5QA 1PH5A 4K0KQ 5IYDG 3W5OA 3CXCA 4DV0Q 2IT1A 1KRSA 2UXCQ 2F3IA 1VQKA 1IBKQ 4B3SL 1ASZA 1U5KA 4YY3Q 4IFDJ 4AYBG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBR H;  2NN6 I;  1XMO Q;  4JI6 Q;  1SMX A;  3VDY A;  1EWI A;  4UP9 A;  1J6Q A;  4DUY L;  1YJ9 A;  3F8T A;  4A3E H;  3KYH C;  3S2D H;  4P71 A;  4EX5 A;  3EIV A;  4TQU S;  4BBR G;  5M3F H;  3ERS X;  3J80 c;  1VQP A;  1PA6 A;  1MJE A;  4IOA A;  4DR2 L;  3FP9 A;  2NN6 G;  2UUA Q;  4LF8 Q;  5JJK A;  1CSP A;  3K0X A;  4GN5 A;  4DAM A;  3J7Z C;  3AFP A;  4LF6 L;  1K73 C;  4L5T A;  3KFU A;  2KBN A;  2UUB Q;  5FLM G;  2KCT A;  1XNQ Q;  4BA2 I;  1X65 A;  2RCN A;  2OTJ A;  1WI5 A;  2YU9 H;  1E7Z A;  1X6O A;  4UY8 C;  5H1S E;  1B8A A;  1UWV A;  3T1H L;  2K52 A;  2ZJQ A;  3H3V I;  3NEL A;  2ZTD A;  5M5X H;  2B3G A;  1PV4 A;  2D0P A;  4DR4 Q;  2IY5 B;  2IHF A;  3G48 A;  4GN3 B;  5IWA L;  4JOI A;  5J3B A;  4DV1 Q;  1CKM A;  1CKN B;  5JEA J;  2VL6 A;  2KEN A;  5IP7 H;  1KHI A;  2VZA A;  5C0X J;  1PH8 A;  4MZ9 A;  2ASB A;  1EQR A;  4DV6 Q;  3CCU A;  4QL5 A;  4DAY B;  2VY3 A;  4JI8 Q;  3ULJ A;  1J5E L;  2OWO A;  2UU9 Q;  4B3T Q;  1YHA A;  2FXQ A;  1KAW A;  1FJG Q;  4MNO A;  2Z6K A;  3CQZ H;  5GAD C;  4HIK A;  2ZTE A;  4BY1 H;  4WJ3 M;  3I55 A;  2GVA A;  4LF7 Q;  4P72 A;  1NBW A;  3CCL A;  2N78 A;  3L7Z C;  4DV3 L;  2NZO A;  2ID0 A;  1Q82 C;  2VQE L;  3HOU H;  4KHP L;  3HOZ H;  3OW2 A;  3I7F A;  3J81 j;  1YI2 A;  2K75 A;  1VQ6 A;  4OX9 L;  4BXX G;  3S1R H;  3HOX H;  4DV2 L;  1NE3 A;  1OXU A;  4DK3 C;  1RIP A;  3JAM i;  2NVY H;  1JB7 A;  3HOZ G;  2I5H A;  1VQI A;  1Y1V H;  4X66 L;  4DV5 Q;  1WOC A;  4DR3 L;  1X56 A;  1YIJ A;  1Q7Y C;  3A0J A;  1VQD A;  4C2M H;  5FJ8 H;  2NVQ H;  2UXD Q;  1EOV A;  4YCW A;  4DR1 Q;  4DK6 C;  1M90 C;  3M4P A;  2JA7 H;  1I5F A;  1JE5 A;  4YHH Q;  4LFB L;  4RG1 A;  3CCS A;  3CMA A;  4LF4 Q;  4POG A;  3KJO A;  2JA7 G;  4JC0 A;  3HKZ G;  4IPC A;  3ER0 A;  4UP7 A;  1YVC A;  3PUZ A;  3GO5 A;  3S24 A;  1HZA A;  1TXY A;  5DLQ E;  4X62 L;  2V1C C;  1PH3 A;  3H0G G;  4B3M Q;  3S16 H;  3J80 i;  5AJ3 L;  2Y0S G;  2BH2 A;  2R92 H;  2A1A A;  1I50 H;  4X64 L;  1KXL A;  4IPD A;  4LF9 Q;  3BZK A;  1K3R A;  1HH2 P;  5M3M H;  1XNR L;  3PO3 H;  1Y1W H;  1NMG A;  1SN8 A;  1VQL A;  1W2B A;  3S2H H;  1Q46 A;  3K80 C;  2ZM6 Q;  1IBL Q;  1WJJ A;  3GTG H;  4X65 L;  4R4Q A;  3PO3 G;  2F4V Q;  4JI7 L;  3CW2 C;  1AE2 A;  1Y1W G;  5IYC H;  1E22 A;  4J15 A;  1AH9 A;  4P75 A;  1E3P A;  3K81 C;  3CCE A;  3RN5 A;  3HOV H;  4LFC L;  2JJQ A;  1X3G A;  3UDX A;  5BR8 L;  4HIM A;  4YWK A;  2UXB Q;  2AKW B;  1S3O A;  2K5V A;  3JC6 6;  4GN4 B;  3STB C;  1HNX L;  5LMU L;  1VQJ A;  2ALY B;  3HOV G;  1P16 A;  1SRO A;  1W3S A;  4QJF A;  3K8A A;  4KI0 A;  2MQH A;  1VQA A;  1WCM H;  4JI5 Q;  2LXJ A;  3AQQ A;  4JI3 L;  3PO2 G;  2MO1 A;  5ELN A;  1OXT A;  1QUQ A;  3CCV A;  3EBE A;  2Q2U A;  2AWO A;  4DV4 Q;  1LYL A;  3CCJ A;  4A3G H;  3CCR A;  4PZ6 A;  4A75 A;  2PQA A;  3RN2 A;  1GD7 A;  2PI2 A;  3OTO L;  1L1O A;  5LMN Q;  2CWA A;  3ULL A;  4A3F H;  2D62 A;  2VS1 A;  3M85 A;  4DUZ L;  4O0A A;  4JOI C;  1FGU A;  3UE0 A;  2ZTC A;  2AHO B;  3NBH B;  1E24 A;  4HJ8 A;  5IYD H;  1QVG A;  4NXM L;  2E5L Q;  3S1N H;  3CD6 A;  4GKK Q;  3E9H A;  1EYG A;  1VQF A;  2WFW A;  1QVC A;  3RNU A;  2K5H A;  3HFZ B;  4IJL A;  3G71 A;  2Z6K C;  2RHS B;  2MO0 A;  3F2C A;  2WP8 J;  2EXD A;  4Y7N H;  1K8A C;  1IBM L;  2XGT A;  2E2H H;  1QVF A;  3J7A 5;  5E7N A;  3HKZ E;  4IFD I;  3GTJ H;  4OO1 I;  1OXV A;  2E8G A;  3CCQ A;  4LF5 L;  4NXN Q;  3U4V A;  1HNW Q;  1EFW A;  3I56 A;  4IPG A;  4LUO A;  5M5W H;  2RF4 A;  2UUC Q;  2Y0S E;  4DV7 L;  5EAY A;  3PIO A;  2LXK A;  2VW9 A;  4IO9 A;  2IX1 A;  3PF4 A;  4B3R L;  4A93 G;  3PUW A;  2E2I H;  2Q2H A;  3F2B A;  4IFD G;  4JI4 L;  2YYZ A;  5FLM H;  4PMW A;  2HIV A;  3LGJ A;  2VQF L;  1JT8 A;  4YWL A;  1S72 A;  3GTP H;  2K14 A;  3GTO H;  4DR7 Q;  3RZO H;  1N33 L;  2N3S A;  1TWC H;  4LW1 A;  2I5M X;  4R1J A;  1X3E A;  1T9H A;  4LWC A;  1DGS A;  4ME3 A;  4A3J G;  4DR6 L;  5C4X H;  1YJW A;  1V1Q A;  2H5X A;  1HNZ L;  4BY7 G;  4X6A H;  4JI2 L;  2B63 G;  3H3V H;  1HZB A;  4EQ5 A;  5HGQ A;  4GLX A;  5C4X G;  5C0X I;  4DPG A;  1HJP A;  4AH6 A;  2YTV A;  1PVO A;  4DV0 L;  2UXC L;  1IL2 A;  1E1O A;  1GKH A;  5C44 H;  2WB1 G;  4YY3 L;  1BKB A;  2GVB A;  3FHW A;  4A3C H;  1G6P A;  1TWH H;  1IYJ B;  2JEB I;  5JEA G;  1XMO L;  4JI6 L;  4DV2 Q;  4RMF A;  3UDI A;  4HIO A;  5C0X G;  2NVX H;  2AMC B;  1Y14 B;  1YEZ A;  2KHI A;  2PMZ E;  1AE3 A;  5C44 G;  4BXX H;  2MFI A;  4A3C G;  2JA9 A;  1UE5 A;  2PI2 E;  1VQ5 A;  1R9T H;  2KHJ A;  2BA0 A;  1E1T A;  2K50 A;  1YJN A;  2HQL A;  2N49 A;  4LF8 L;  2UUA L;  2BH8 A;  2JE6 I;  3EN2 A;  1JMC A;  1PYS B;  1UE7 A;  3D31 A;  4ALP A;  3Q8D A;  3WWV A;  3J81 c;  1I6H H;  3S14 H;  2UUB L;  1XNQ L;  3S1Q H;  4LFA Q;  1GVP A;  1GM5 A;  1LTL A;  3PSI A;  1PH7 A;  4OXP A;  4HJ5 A;  1X9N A;  3I4N H;  3W1G A;  1A63 A;  4LFB Q;  1UE1 A;  2K4K A;  3PV0 A;  1PH6 A;  2JA8 G;  1FVI A;  2R7Z G;  1VQG A;  1L2F A;  4DR4 L;  5M5Y H;  4DV1 L;  3I4N G;  4OWX B;  2QA4 A;  1N8R C;  3TS0 A;  2NZH A;  3CME A;  1N32 Q;  4LUZ A;  3ICE A;  4DV6 L;  3M9B A;  5GAH C;  3T1Y Q;  1A0I A;  1I94 Q;  4JI8 L;  1OXX K;  3U50 C;  4B3T L;  2UU9 L;  3H0G H;  1FJG L;  1CUK A;  1Q12 A;  2HHH Q;  1P8L A;  3UDF A;  4A3L G;  4LF7 L;  2VUM G;  1L1O C;  1ASY A;  1KIX A;  1JJG A;  4JI1 Q;  3CC4 A;  4LNQ A;  4JI0 Q;  2CKZ B;  1N36 Q;  1K0R A;  3KDF A;  3PUV A;  1M1K C;  1O7I A;  4NPS A;  4GOP A;  1V9P A;  3GTL H;  3CAM A;  4H02 A;  4YCV A;  1SE8 A;  4GS3 A;  2KCM A;  3AEV A;  1XMQ Q;  3CP0 A;  3M7N A;  4OWT B;  4JBW A;  1UEB A;  3IRB A;  3RLN A;  3STB D;  3D0F A;  1C9O A;  1X55 A;  4IJH A;  1HNX Q;  4DV5 L;  1VQE A;  5GRO A;  3RLF A;  5LMU Q;  2JA6 G;  1B7Y B;  1KC8 C;  1L0W A;  1IXR A;  4YCU A;  4KLK A;  4DR1 L;  3A5Z B;  4JV5 Q;  2UXD L;  3KF6 A;  2WB1 E;  3M4Q A;  1PH4 A;  1XJV A;  1SLJ A;  1C7Y A;  3M3Y H;  1H95 A;  4HJ7 A;  1QZG A;  2Q2T A;  2XTI A;  3S17 H;  2OCE A;  1VQB A;  4YHH L;  3PO2 H;  4R4T A;  1PYB A;  4QGU A;  3PGZ A;  1EUJ A;  4LF4 L;  1IZ6 A;  4A3I H;  3PF5 A;  1OTC A;  1UE6 A;  1Q86 C;  4DR5 Q;  2JA5 G;  4GKJ Q;  3ULP A;  1LUZ A;  1PH2 A;  4DUZ Q;  1YHB A;  1N34 Q;  3I4O A;  4C3J H;  4B3M L;  1XTD A;  4A3I G;  1LM0 A;  1NY4 A;  4YWM A;  1HR0 Q;  1XPO A;  4O2D A;  1YHQ A;  1EIF A;  4LF9 L;  1VQ7 A;  4JYA Q;  1VQM A;  1G29 1;  2GN5 A;  4AQY Q;  1PH9 A;  1TWA H;  4R4C A;  2R6G A;  4GNX A;  2ZM6 L;  2QGQ A;  1IBL L;  1EQQ A;  4A3D H;  1Q8K A;  4B3S Q;  1YBY A;  2EIF A;  2BA1 A;  4BA1 I;  3RZD H;  2F4V L;  1CSQ A;  1WFQ A;  2DUD A;  3BZC A;  5C3E G;  1TWF H;  4BBS G;  2JEA I;  5LMN W;  4DUY Q;  4A3D G;  1SRU A;  2DGY A;  1I3Q H;  4AIM A;  3F1Z A;  4C3I H;  4A76 A;  2N8N A;  5GAG C;  2Z0S A;  2UXB L;  2OQK A;  4FDB A;  4LUV A;  3U58 A;  1QUQ B;  3GTQ H;  4A93 H;  4C3H H;  4DR2 Q;  3A5U A;  5IE8 A;  4HID A;  4LF6 Q;  4JI5 L;  4QQB X;  2PQA B;  3DM3 A;  1PFS A;  4JG2 A;  2CCZ A;  1L1O B;  4OWW B;  4OO1 G;  1V43 A;  2R93 G;  2CFM A;  4DV4 L;  1HZ9 A;  3HOW G;  3OYY A;  4DR6 Q;  5IY0 A;  3T1H Q;  4GLA C;  4A4I A;  2E2J H;  1NTG A;  4A3J H;  1VQ9 A;  4A3B H;  4DKA C;  4Y52 H;  4POF A;  5FLX c;  5LMN L;  2YTX A;  5IWA Q;  3K7U C;  4BY7 H;  1VQH A;  3KJP A;  3CCM A;  2D0O A;  3PUX A;  2ZJR A;  2B63 H;  4A3B G;  2WAQ E;  3I4M G;  3G4S A;  4A3M H;  2NVT H;  1J5E Q;  2R7D A;  3U4Z A;  4IOC A;  1WYD A;  4P74 A;  2E5L L;  3MEF A;  4GKK L;  1X54 A;  1CKN A;  1PH1 A;  1GO3 E;  2RHQ B;  4A3M G;  4K0K L;  3TRE A;  4DV3 Q;  1K9M C;  4KHP Q;  2VQE Q;  1IBK L;  3A74 A;  3AFQ A;  1NJI C;  2QEX A;  4NXN L;  4OX9 Q;  1HNW L;  4XTC S;  1KRT A;  3FKI H;  4A3E G;  2UUC L;  1MIU A;  2MNA A;  4GOP C;  2CQO A;  1YIT A;  5M3F G;  4HJ9 A;  3I2Z A;  1QZH A;  4A3K H;  1MJC A;  3FKI G;  3NEN A;  2EQS A;  4X66 Q;  4DR3 Q;  3UDG A;  2HIX A;  2JQO A;  3PUY A;  3NEM A;  1YNX A;  2IHE A;  3KLW A;  4L5R C;  2HT1 A;  3BU2 A;  4DR7 L;  4JBJ A;  5HY6 A;  3G6E A;  4A3K G;  1BVS A;  3K7A H;  3KOJ A;  3F2D A;  1Q81 C;  2JA8 H;  4DNI A;  4APV A;  2R7Z H;  2B29 A;  1KQS A;  1VQ4 A;  3HKS A;  2K5N A;  1K8G A;  1NMF A;  4R4O A;  1RL2 A;  2C35 B;  3MXN B;  1KL9 A;  5IP7 G;  1VQO A;  3KF8 B;  1SR3 A;  2Q2I A;  1CKO A;  4X62 Q;  3CPF A;  1D7Q A;  3CF5 A;  5AJ3 Q;  4A3L H;  2VUM H;  4BY1 G;  4X64 Q;  1SFO H;  1Q1E A;  3L0O A;  4GLV B;  2IX0 A;  2OTL A;  4PZ7 A;  2LSS A;  1D8L A;  1Q1B A;  1TWG H;  1YZ6 A;  4HJA A;  4JBK A;  1XNR Q;  2OQ0 A;  3HOU G;  1VS0 A;  4JCV E;  4TVA B;  4X65 Q;  4L5S A;  1A62 A;  4GNX C;  4QY7 A;  3HOX G;  4JI7 Q;  4MTN A;  1BBW A;  2ES2 A;  2A8V A;  4R4I A;  3HOY H;  2ATW A;  2YTY A;  3W1B A;  4LFC Q;  2JA6 H;  1Y1V G;  4AYB E;  1PHJ A;  4LFA L;  1XPR A;  1S40 A;  5BR8 Q;  5JJI A;  1FL0 A;  5FJ8 G;  3SGI A;  3PIP A;  3H15 A;  4NB3 A;  3HOY G;  3B6Y A;  4UP8 A;  2PNH A;  2WAQ G;  1C0A A;  1X3F A;  4JI3 Q;  5IT9 c;  1N32 L;  4JBM A;  3TQY A;  5K36 G;  2JA5 H;  4KHZ A;  3T1Y L;  1I94 L;  2JK8 A;  3UE1 A;  2HHH L;  3DLL A;  5GQO A;  1EIY B;  2ZJP A;  3KDF B;  3OTO Q;  3RR5 A;  3GTM H;  5IYB H;  4GOP B;  3BJU A;  2A19 A;  2L15 A;  1VQN A;  2R92 G;  3PCO B;  3RLO A;  4JI1 L;  3TS2 A;  5M3M G;  4JI0 L;  1N36 L;  4NXM Q;  4IPH A;  2R7F A;  5IYB G;  1U0L A;  4WJ4 A;  1MKH A;  3GTK H;  5C4J H;  3L2P A;  1K83 H;  3J81 i;  1Z47 A;  5JJL A;  1XMQ L;  1A8V A;  4XIG S;  5C3E H;  1IBM Q;  2I0Q A;  2AWN A;  4P73 A;  5IYC G;  4BBS H;  3KF6 B;  2VNU D;  2CWP A;  4LF5 Q;  5ELO A;  1HR0 W;  1OXS C;  1JJC B;  3CC2 A;  4JV5 L;  3TEH B;  4DV7 Q;  4B3R Q;  1Z9F A;  2F52 A;  1VQC A;  3GDE A;  1N9W A;  1B70 B;  1VQ8 A;  1BBU A;  3S15 H;  4JI4 Q;  5IP9 H;  1XPU A;  3TRZ A;  1WCM G;  3M4O H;  3E0E A;  2VQF Q;  3S1M H;  2R93 H;  3CPW A;  3HOW H;  4A3G G;  1N33 Q;  2I5L X;  4QIW E;  5IP9 G;  4DR5 L;  3ZJY C;  4GKJ L;  2YV5 A;  1G51 A;  3JAM c;  3E9I A;  1N34 L;  1KD1 C;  1VCI A;  4GNX B;  4A3F G;  1HR0 L;  1JJ2 A;  3GD7 A;  4OON A;  5GAE C;  1HNZ Q;  4UPA A;  1HZC A;  3I4M H;  4PG3 A;  4JYA L;  4JI2 Q;  3CC7 A;  4PZ8 A;  4AQY L;  3AYH B;  4L5Q A;  1PH5 A;  4K0K Q;  5IYD G;  3W5O A;  3CXC A;  4DV0 Q;  2IT1 A;  1KRS A;  2UXC Q;  2F3I A;  1VQK A;  1IBK Q;  4B3S L;  1ASZ A;  1U5K A;  4YY3 Q;  4IFD J;  4AYB G; 
#chains in the Genus database with same CATH topology
 2K1B A;  1ESF A;  4BBR H;  4JI6 Q;  1PTO D;  1YJ9 A;  4P71 A;  1MJE A;  4TQU S;  5M3F H;  3ERS X;  4LF8 Q;  2HCC A;  1GHJ A;  3HOW B;  1AW7 A;  4DAM A;  5K5P A;  3ERQ A;  3J7Z C;  3KFU A;  2K6A A;  2KBN A;  3UI2 A;  4BA2 I;  2K33 A;  2B2W A;  4UY8 C;  1C4Q A;  1UWV A;  3H3V I;  2I46 A;  2ZTD A;  5M5X H;  4AYB B;  2IY5 B;  4DV1 Q;  1G2T A;  2CQA A;  4JOI A;  4QUC A;  5ELD A;  3IAY A;  1CKM A;  1PH8 A;  5C0X J;  4A3M B;  4DAY B;  2OWO A;  1FJG Q;  4MNO A;  3CQZ H;  4BY1 H;  3I55 A;  1KNA A;  2N55 A;  1BNZ A;  2F0P A;  5M3F B;  3CCL A;  3M4Y A;  1DJR D;  4KKU A;  4L6T B;  3HOU H;  4IQZ A;  3HOZ H;  3OW2 A;  4NDX A;  1YI2 A;  4F88 A;  1QG7 A;  2NTS A;  3IFD A;  3HOX H;  1ONL A;  4HCE A;  3JAM i;  1JB7 A;  2K05 A;  3A55 A;  1Y8P B;  1GJX A;  3NP8 A;  2I5H A;  1LV9 A;  1Y1V H;  4X66 L;  1WOC A;  4ZQ3 A;  5M5X B;  4B08 A;  3CRL C;  4DR1 Q;  4YCW A;  4GZY C;  2B2Y A;  1KTK A;  3SVM A;  4KJO A;  5CYU A;  3CMA A;  4LF4 Q;  1ZXT A;  3CQZ B;  3TP6 A;  1ENC A;  3KJO A;  4BY1 B;  4IPC A;  1SNO A;  4UP7 A;  1YNJ C;  2B2V A;  3GO5 A;  3S24 A;  4N8F A;  2V1C C;  2M9V A;  4B3M Q;  3HOU B;  3HOZ B;  1QIL A;  4X64 L;  4PMC A;  3HOX B;  1NMG A;  1W2B A;  1Y1V B;  4X65 L;  4RWS C;  1AH9 A;  1E3P A;  2FHT A;  3LNN A;  4DAP A;  2E76 C;  3HOV H;  1YNN D;  2H4O A;  1L0Y B;  3JC6 6;  1HNX L;  5JJL A;  4G7O C;  3K5M A;  1F9R A;  1W3S A;  4KI0 A;  2MQH A;  2RKS A;  2LXJ A;  3AQQ A;  4JI5 Q;  3A8K E;  1OXT A;  3EBE A;  1LYL A;  3H94 A;  4DF7 A;  2B2W C;  4PZ6 A;  3DWP A;  5A2Q L;  1L1O A;  5LMN Q;  2CWA A;  3ULL A;  2VS1 A;  3GV3 A;  3I73 A;  4DUZ L;  4JOI C;  1SYC A;  3UE0 A;  2AHO B;  3J80 E;  1SAP A;  2BOS A;  3A54 A;  5IYD H;  3S1N H;  3E9H A;  4QB4 A;  1VQF A;  2DY8 A;  3HOV B;  3BDO A;  1MSG A;  1D2B A;  3FPP A;  1D1I A;  2MO0 A;  4Y7N H;  2EXD A;  1E2V A;  1NAP A;  5J22 A;  1QVF A;  4G57 A;  1DOK A;  2HD3 A;  2E8G A;  4Z9C B;  3U4V A;  4LUO A;  5M5W H;  4NMZ A;  3PF4 A;  4DV7 L;  4CDC C;  4IO9 A;  2F0U A;  4DNR B;  2DN8 A;  1JT8 A;  3DXJ C;  3GTO H;  1N33 L;  1TWC H;  4ID6 A;  1X3E A;  5I6Y A;  1EFI D;  4A3J G;  2B2Y C;  1PRT C;  3S1N B;  1YJW A;  1JWU D;  2ZXR A;  4U68 A;  1EY7 A;  3H3V H;  5HGQ A;  4Y7N B;  4DPG A;  4PQX A;  4OIK A;  2B2V C;  2UXC L;  4R9W A;  1D5Z C;  3DM1 A;  1S5C D;  2GVB A;  4YY3 L;  4KTA A;  5M5W B;  1TWH H;  3EA6 A;  5ELF A;  4R8N A;  5JEA G;  1PZJ D;  2H1E A;  1F9P A;  2KHI A;  4O1N A;  1AE3 A;  3OW7 A;  4A3C G;  2JA9 A;  1UE5 A;  2WII B;  2PNR C;  3IKJ A;  1R9T H;  1TT2 A;  3TZD A;  2BA0 A;  1YJN A;  2UUA L;  3GTO B;  4N9P A;  1JMC A;  1SBB B;  1EL0 A;  2F0E A;  1TWC B;  1I6H H;  1S5E D;  1GVP A;  1SYF A;  1MD2 D;  1STE A;  1R4P B;  4HJ5 A;  3I4N H;  3Q23 A;  3K58 A;  2K4K A;  2O4X A;  1FVI A;  3VA7 A;  4DR4 L;  2P5Z X;  4FVM A;  2XWJ B;  3V96 A;  3TS0 A;  3MAQ A;  1AEX A;  5GAH C;  1I94 Q;  1TWH B;  2JN4 A;  4JI8 L;  1OXX K;  3U50 C;  1SE2 A;  2HHH Q;  1P8L A;  4I7A A;  4XQJ A;  1ILQ A;  3UDF A;  1HFN A;  2Q8R E;  4LF7 L;  2VUM G;  1L1O C;  1ASY A;  1I4R A;  1W6K A;  5BN4 A;  1R9T B;  3J80 L;  2CKZ B;  1CZG A;  1M1K C;  4KN4 C;  1H9J A;  1O7I A;  1I6H B;  3AU7 A;  3CAM A;  2NVY B;  4TSS A;  3V2T A;  5LHY 1;  1HA6 A;  3I3C A;  3D0F A;  1HNX Q;  1ZEQ X;  1L0W A;  2UXD L;  4KLK A;  1GUS A;  1H95 A;  1XJV A;  4HJ7 A;  2Q2T A;  4JVZ A;  4YHH L;  4JK1 C;  1PYB A;  4QGU A;  1K3B C;  3NXW A;  1M4V A;  3WOF A;  3A7A B;  4DUZ Q;  1MSH A;  1X3Q A;  4BS9 A;  4KD4 A;  3MFY A;  1K8O A;  4A3I G;  2F0H A;  3EJI A;  1QNU A;  1XPO A;  2EYF A;  3TBI B;  5ELC A;  1UUP A;  5CC4 A;  1CM9 A;  2GN5 A;  4AQY Q;  1TWA H;  3GTG B;  1A2U A;  4GNX A;  2ZM6 L;  1IBL L;  3I72 A;  4A3D H;  1EYD A;  1YBY A;  2EIF A;  2BA1 A;  2NZ1 D;  5E3F A;  4BBS G;  4JW0 A;  2JEA I;  1I3Q H;  1PLF A;  5ELB A;  2UXB L;  1PMR A;  2OQK A;  3FRP B;  4CHT B;  3A5U A;  1EY6 A;  2K7V A;  2LY7 A;  1XWE A;  3DM3 A;  1PFS A;  4JG2 A;  4C3H G;  4OO1 G;  2R93 G;  1HZ9 A;  3T1H Q;  4A4I A;  2E2J H;  4A3J H;  4Y52 H;  1EEI D;  1TWA B;  1LAC A;  3QG1 A;  2VXW A;  5IWA Q;  3D4R A;  2ZXO A;  4PMB A;  1C8C A;  4A3D B;  2ZJR A;  5M9O A;  4XT3 B;  2NVT H;  1J5E Q;  2EYM A;  2R7D A;  3BYT B;  1PH1 A;  1H9M A;  1I3Q B;  2QIL A;  1PXU A;  3TRE A;  5JEA H;  5C4H A;  2F0K A;  2V4D A;  2RQX A;  3AFQ A;  5DNF A;  4OX9 Q;  1HNW L;  2RSN A;  2MJ8 A;  2UUC L;  5C4Z A;  1PTO C;  3WOE A;  3I2Z A;  1QZH A;  1RDP D;  3FKI G;  4FO2 A;  3UDG A;  2E2J B;  2ENB A;  2JQO A;  3HEJ A;  3NEM A;  4A3J B;  3KLW A;  3P7J A;  4JBJ A;  5HY6 A;  3G6E A;  3CRK C;  4A3K G;  1AZQ A;  2EVB A;  3Q6S A;  5I4D A;  2B29 A;  1KQS A;  2NVT B;  2EYJ A;  3DHQ A;  4IZ8 A;  1RL2 A;  2C35 B;  5IP7 G;  1O7Z A;  1MHW C;  2Q8T A;  3ZYY X;  5AJ3 Q;  2RBM A;  2VUM H;  1SFO H;  4GLV B;  3VR3 A;  4E6I A;  2LSS A;  4JBK A;  1YZ6 A;  1G6Z A;  4DFA A;  1SNP A;  4JCV E;  4TVA B;  4EQP A;  4L5S A;  4GNX C;  4RGM A;  2K01 A;  4JI7 Q;  3HOY H;  2ATW A;  1HPC A;  4LFC Q;  1WTH A;  1S40 A;  1FL0 A;  5FJ8 G;  3H15 A;  3FPU B;  1C0A A;  3SEB A;  3SE0 A;  1X3F A;  4JI3 Q;  1VMC A;  3TQY A;  2VUM B;  4KY5 A;  1S5F D;  2IW3 A;  3MWY W;  2EY5 A;  1DD2 A;  1HCZ A;  2F0L A;  5FO7 B;  1MI2 A;  4HAE A;  4ME5 A;  1GUN A;  1JOK A;  5KIX A;  2R92 G;  3PCO B;  4FXD A;  5M3M G;  1EZ6 A;  1N36 L;  4NXM Q;  2R7F A;  3SHL A;  3SR1 A;  4WJ4 A;  3HOY B;  2D2C C;  3L2P A;  3J81 i;  4G4K A;  2EJG C;  1Z47 A;  4KN7 C;  4H44 C;  1XMQ L;  2G5D A;  3NBH A;  1SJH D;  4BBS H;  3OIQ A;  1SND A;  1RJT A;  2NUC A;  2CWP A;  1HR0 W;  3RMH A;  1B50 A;  3IL8 A;  4NW2 A;  3EQL C;  1YNN C;  3S15 H;  2F0M A;  5IP9 H;  1MGS A;  1WCM G;  3BZD B;  1NR4 A;  3E0E A;  3P75 A;  4U67 3;  2VQF Q;  3S1M H;  3M4O H;  3AMU A;  2R93 H;  4ODG A;  1LTB D;  4YIJ A;  4XDX A;  1IHZ A;  1EY8 A;  2YV5 A;  2L0C A;  4A3F G;  3ND8 A;  1BR9 A;  3OIP A;  4IUN A;  2FJ2 A;  1LTR D;  3OWF A;  1RCV D;  4KJN A;  5KRU A;  4BBS B;  1IL8 A;  4DV0 Q;  1ASZ A;  1BQQ T;  3DEP A;  4AYB G;  1XMO Q;  1GHK A;  4DUY L;  4WFN 3;  4IUP A;  3S15 B;  3F8T A;  3VYT A;  2J4X A;  2JYO A;  3EIV A;  4BBR G;  2PPB C;  4IOA A;  3S1M B;  3M4O B;  1PA6 A;  2R93 B;  4IUT A;  1GUW A;  2E2D C;  4L5T A;  1XNQ Q;  1IW7 D;  2X6G A;  2BDO A;  1E7Z A;  1X6O A;  4G7Z C;  1I6V C;  3VR5 A;  1I4H A;  2ZJQ A;  3NEL A;  4RCO A;  1PV4 A;  2D0P A;  4GN3 B;  3G48 A;  3TZU A;  3MXU A;  1CKN B;  5JEA J;  2ZXP A;  5IP7 H;  1KHI A;  2VZA A;  2PQE A;  1FNU A;  5EPL A;  1EYA A;  2NTT A;  2XVS A;  3MFG A;  2FXQ A;  1KAW A;  2EOT A;  2UU9 Q;  3NSW A;  2E74 C;  4MTK A;  3L7Z C;  2VQE L;  5AFW A;  3I7F A;  3J81 j;  3FKI B;  1K0S A;  2QDL A;  4EQN A;  3S1R H;  2CVR A;  1NE3 A;  5EJW A;  4DK3 C;  3HOZ G;  2HCI A;  3QO2 A;  1Q7Y C;  2F03 A;  1LTS D;  3EVQ A;  4DK1 A;  5FJ8 H;  2NVQ H;  2RDG A;  3M4P A;  2A68 C;  1HFG A;  1JCK B;  4HMJ A;  2XWB B;  3D4W A;  3SK4 A;  1B1Z A;  3D4D A;  2WKC A;  3S2D H;  5DLQ E;  1PH3 A;  4IUU A;  3S16 H;  1FD7 D;  2BH2 A;  2R92 H;  1DOM A;  3S1R B;  4LF9 Q;  5M3M H;  3PO3 H;  3VA5 A;  1V1P B;  2PW7 A;  1VQL A;  5KGU A;  1BCP B;  2A6E D;  3C1F A;  3K80 C;  3S2H H;  4R4Q A;  1A3V A;  2NVQ B;  3K81 C;  3CCE A;  3RN5 A;  1D1K A;  2QEJ C;  3K59 A;  4HR7 B;  2RDH A;  1X3G A;  5BR8 L;  1S3O A;  2K5V A;  2ICI A;  3HOV G;  1P16 A;  3K0Y A;  3K8A A;  1VQA A;  1WCM H;  4JPB W;  5CGK A;  1BBX C;  3S2D B;  2MO1 A;  4FP5 D;  3S16 B;  2KED A;  4ZUJ A;  1D6E C;  2AWO A;  4DV4 Q;  3CCJ A;  2R92 B;  3TSS A;  2PCF B;  4WRD A;  2PYK A;  3D6C A;  2F0N A;  4R8I A;  2FMC A;  5M3M B;  2PQA A;  3RN2 A;  3PO3 B;  2PI2 A;  4A3F H;  3S2H B;  1CA5 A;  3R2T A;  1E24 A;  5CBA E;  2L5T A;  1QVG A;  2E5L Q;  4UHV A;  3R8B A;  1QVC A;  3RNU A;  1JIC A;  3G71 A;  5CBE E;  3F2C A;  1IBM L;  2BDN A;  1K8A C;  4LF5 L;  2F0S A;  3I56 A;  1A3T A;  1CZW A;  4IPG A;  1WCM B;  2AUJ D;  1G2S A;  5EAY A;  2LXK A;  2VW9 A;  4B3R L;  3PQI A;  5IT9 L;  4C56 C;  2KEE A;  2E2I H;  3F2B A;  4JI4 L;  1XXG A;  3EFX D;  2CHB D;  5JAV A;  2YYZ A;  1J9O A;  3SDZ A;  2HUG A;  3MTS A;  4A3F B;  4NP5 A;  4DR7 Q;  4FF1 A;  2N3S A;  4LW1 A;  3MXP A;  1T9H A;  4LWC A;  4ME3 A;  3PIP 3;  3DMU A;  2H5X A;  1I4Q A;  2HDL A;  2XRS D;  4LAA A;  5A2Q E;  2B63 G;  1WTQ A;  3I8Z A;  2FIN B;  1PVO A;  2YTV A;  3NPP A;  1IL2 A;  3MXN A;  4FNF A;  4BBR B;  2A6H D;  2JEB I;  4ZCK A;  1Y14 B;  1B3Q A;  1YEZ A;  2E2I B;  3KK7 A;  2WV6 D;  2X6L A;  1VQ5 A;  2KHJ A;  1TS2 A;  2BH8 A;  1TR5 A;  3D31 A;  3Q8D A;  4FF3 A;  2UUB L;  3S1Q H;  4DK0 A;  3PSI A;  1PH7 A;  1EU4 A;  1A63 A;  4ZKC B;  1UE1 A;  1PH6 A;  3PV0 A;  2R7Z G;  2QKI C;  1VQG A;  1HQM C;  3I4N G;  1N8R C;  3MZ5 A;  1G91 A;  4PNY A;  3ICE A;  3DWQ A;  4DV6 L;  2K5D A;  3TME A;  3M9B A;  1A0I A;  4B3T L;  3J7A V;  4A3L G;  2L12 A;  1JJG A;  3C1E A;  1FR3 A;  4JI0 Q;  2B8F A;  3KDF A;  1ZYR D;  2XSC A;  3HS0 C;  4NPS A;  4GOP A;  1V9P A;  4YCV A;  1SE8 A;  1QB5 D;  2KCM A;  3S1Q B;  3GP7 A;  3VYS A;  3TP8 A;  4DV5 L;  3RLF A;  1LTG D;  2JA6 G;  1KC8 C;  2MPM A;  3NQT A;  4JV5 Q;  1JOO A;  1EQT A;  1C7Y A;  1BDO A;  4I65 A;  1SLJ A;  2WIN B;  2XTI A;  4MN3 A;  5J1Z A;  1VQB A;  3OMC A;  1UE6 A;  1Q86 C;  2PW5 A;  2QDB A;  2JA5 G;  4GKJ Q;  3ULP A;  1LUZ A;  1PH2 A;  2BCO A;  1N34 Q;  2KCN A;  3I4O A;  4K8J A;  3HZX A;  2RCF A;  1XTD A;  1EEF D;  3K5O A;  4JYA Q;  1G29 1;  4K5X A;  3K6O A;  2QGQ A;  1EQQ A;  4B3S Q;  2F4V L;  1WFQ A;  2DUD A;  5C3E G;  2MHV A;  2SNM A;  4CJ2 C;  1SSO A;  5LMN W;  4A3D G;  2DGY A;  3QB3 A;  2EYH A;  1C48 A;  5GAG C;  1DON A;  4HMI A;  4LUV A;  4FDB A;  1QUQ B;  2KCC A;  5FOB B;  1EOT A;  5EPK A;  1XX8 A;  1BUV T;  5IE8 A;  4HID A;  3A7L A;  4F8M A;  1V43 A;  1ET9 A;  3OYY A;  1Q8I A;  3MXG A;  1VQ9 A;  2F0V A;  3KUP A;  1U4P A;  4POF A;  2O2L D;  3K7U C;  1KDC A;  4DU9 A;  2B63 H;  2QCP X;  3J7Y W;  4ULL A;  1LT6 D;  2MP1 A;  3U4Z A;  2F1M A;  1WYD A;  4GKK L;  1RTO A;  1EU3 A;  4K0K L;  4M1U B;  4DAY A;  3KBX A;  1QCB D;  3Q22 A;  3A74 A;  4NXN L;  2IJ0 A;  4A3E G;  4GOP C;  1YIT A;  4ZUI A;  1B3A A;  3NEN A;  4X66 Q;  3PUY A;  1HXY D;  4V0B A;  1KLG D;  3BU2 A;  5CV8 A;  1Q81 C;  2R7Z H;  2B63 B;  5G3L F;  1VQ4 A;  3NUC A;  1RD9 D;  4R4O A;  5L37 A;  3WDN A;  1KL9 A;  5C6A A;  1UEA B;  2Z4I A;  2Q2I A;  3KF8 B;  3CPF A;  5I9P A;  3ONA B;  5G3L D;  4ZK9 B;  2IL8 A;  4A3L H;  4X64 Q;  3L0O A;  3H6M A;  2L11 A;  2F4I A;  3GV6 A;  1VS0 A;  2F0D A;  4HN7 A;  2EE1 A;  4X65 Q;  1BBW A;  2YTY A;  3W1B A;  3K5L A;  2JA6 H;  2R7Z B;  1PHJ A;  4LFA L;  1BOS A;  3I4N B;  2SOB A;  1CHP D;  3H91 A;  1S4Z A;  2EZV A;  3HOY G;  2FFK B;  2C5C A;  1JC7 A;  3B6Y A;  1SYD A;  2PNH A;  1NCV A;  1N32 L;  1STB A;  3KLR A;  1I4G A;  2JA5 H;  3T1Y L;  2JK8 A;  2NB0 A;  4BWG B;  3UE1 A;  3DLL A;  1HQR D;  3BYY B;  3RR5 A;  5IYB H;  3BJU A;  2A19 A;  1O80 A;  4L8J A;  4JI1 L;  3S9W A;  2D9U A;  1PFB A;  4IPH A;  5C4J H;  2JA6 B;  3J81 L;  4OEM B;  3TN2 A;  1I4X A;  1A8V A;  4XIG S;  5C3E H;  2I0Q A;  2AWN A;  2MUY A;  4P73 A;  1HUM A;  3KF6 B;  5IYC G;  2XIW A;  2A5H A;  5ELO A;  1JJC B;  4QMG A;  5FLX E;  4DV7 Q;  1Z9F A;  1VQC A;  3GDE A;  2A69 D;  1N9W A;  1B70 B;  1STA A;  1FNW A;  5ISR A;  2OT2 A;  3HGB A;  1LLR D;  2JA5 B;  2CH4 W;  3OPO A;  2LMC B;  1XPU A;  2DY7 A;  1B9N A;  5A35 A;  4A3G G;  2CH4 A;  1N33 Q;  2MGS A;  5IP9 G;  4DR5 L;  3ZJY C;  3E9I A;  3QJY A;  1KD1 C;  4CBV A;  4IUQ A;  3KLS X;  5KNB A;  1HR0 L;  3GD7 A;  5C4J B;  1HZC A;  4X3U A;  4PZ8 A;  2DNC A;  5C3E B;  4K0K Q;  3DEO A;  1SYB A;  1O7L A;  4PV1 C;  2GA4 B;  2UXC Q;  5D3I B;  2K5Q A;  1VQK A;  2OXP A;  4YY3 Q;  1DYQ A;  2NN6 I;  3MEH A;  3VDY A;  1EWI A;  1J6Q A;  3MHB A;  4A3E H;  3KYH C;  1VQP A;  3J80 c;  1SE3 A;  4DR2 L;  3FP9 A;  2NN6 G;  2UUA Q;  2K28 A;  2X69 A;  4GN5 A;  1G8Z D;  3AFP A;  4MHE A;  4LF6 L;  1IKM A;  4F7X A;  2OTJ A;  5FLM G;  5EBD A;  4HED A;  1X65 A;  4ZLT F;  5H1S E;  1B8A A;  3NBI A;  3OMG A;  4DA2 A;  1QNK A;  5EQ0 A;  2B3G A;  4DR4 Q;  4LMQ D;  1HA5 A;  2KEN A;  2R3Z A;  4MZ9 A;  1EQR A;  2ASB A;  2RVL A;  3CCU A;  5DEH A;  2VY3 A;  4JI8 Q;  1DZ1 A;  2KOL A;  4WJ3 M;  5CV5 A;  2GVA A;  4LF7 Q;  4A3E B;  4P72 A;  5KNC A;  2JXM B;  1B2T A;  1Y8N B;  2N78 A;  4DV3 L;  2ID0 A;  4KHP L;  1WTV A;  3VR6 A;  4FXG C;  4BXX G;  2NYZ D;  4I7Z C;  2A6H C;  1FNV A;  4DV2 L;  1OXU A;  1RIP A;  1FYC A;  4S3S A;  1VQI A;  4DR3 L;  1X56 A;  5DM7 3;  2O5I C;  5FLX L;  2UXD Q;  1II3 A;  3QR8 A;  4DK6 C;  2JA7 H;  1I5F A;  1JE5 A;  4YHH Q;  4LFB L;  2F0F A;  1QJO A;  4IAL A;  1PFM A;  4FF2 A;  5EPJ A;  2IX3 A;  1YVC A;  1H9R A;  4WJW A;  4X62 L;  1VF7 A;  3J80 i;  1EZ8 A;  1SFO B;  1KXL A;  4IPD A;  2CW0 D;  3BZK A;  5D65 A;  1K3R A;  1HH2 P;  1XNR L;  1Y1W H;  1SN8 A;  4RCN A;  3BVG A;  1PYW D;  2ZM6 Q;  1IBL Q;  3PO3 G;  3CW2 C;  5IYC H;  1DM0 B;  2KQ3 A;  4XXE A;  1STH A;  2JA7 B;  2JJQ A;  5IIF A;  3JAM E;  3UDX A;  2PZT A;  2UXB Q;  2AKW B;  4GN4 B;  3D3R A;  2ALY B;  1WTW A;  5IGC A;  4XT1 B;  1LTA D;  3NTH A;  3GQB A;  2Q2U A;  4A3G H;  5JOB A;  5JPM C;  1ROD A;  5C3W A;  3G6J B;  3CCR A;  3ITP A;  4KKS A;  1GD7 A;  3OTO L;  1Y1W B;  5COY A;  2KHS A;  4H13 C;  5JJZ A;  4O0A A;  1FGU A;  1B53 A;  1BF4 A;  1H9S B;  2I07 B;  1RKN A;  3H3V C;  1EYG A;  2HQE A;  2RHS B;  4C1N I;  1W6J A;  3X3N A;  3J7A 5;  5DAU A;  1CTM A;  2XGT A;  5E7N A;  3GTJ H;  5I2Y A;  1T5X D;  4XQQ A;  1JB3 A;  3CCQ A;  2L4N A;  1HNW Q;  1EFW A;  2UUC Q;  3U9O A;  2IX1 A;  1BCP D;  2NN6 H;  4A93 G;  3PUW A;  4A3G B;  2Q2H A;  3A8J E;  3NE5 B;  5FLM H;  2HIV A;  4YWL A;  1MBY A;  2K14 A;  1CQV A;  3RZO H;  3CKI B;  1TII D;  2LFN A;  4J1M A;  5E4X A;  4ZKB B;  5C4X H;  1SJE D;  1V1Q A;  4BY7 G;  1HNZ L;  4X6A H;  1PZK D;  4JI2 L;  1HZB A;  1PDQ A;  1U9R A;  4EQ5 A;  4GLX A;  1WD0 A;  1HJP A;  2EY6 A;  1GUG A;  5FKA C;  5D14 A;  1E1O A;  1GKH A;  5C44 H;  2B2U A;  1G6P A;  5DM6 3;  1Q3L A;  4JI6 L;  4DV2 Q;  4RMF A;  3UDI A;  2NVX H;  2HDM A;  4BXX H;  2MFI A;  1E1T A;  1Y8O B;  2K50 A;  2N49 A;  4LF8 L;  1BO0 A;  4M8A A;  5EKK A;  1PYS B;  1UE7 A;  4ALP A;  3WWV A;  3S14 H;  3JAM L;  1K8M A;  5IT9 E;  2RDF A;  4OXP A;  5C4X B;  4LK1 C;  2F0G A;  2EXZ A;  4LFB Q;  5CV6 A;  1EY9 A;  1LAB A;  3NK9 A;  4L63 B;  2JA8 G;  3SK5 A;  4Q5V A;  2E75 C;  1L2F A;  1T5E A;  3KLS A;  5M5Y H;  4DV1 L;  4OWX B;  2QA4 A;  1U4R A;  2NZH A;  5FO8 B;  3CME A;  1KAB A;  4LUZ A;  2M00 A;  1FJG L;  1CUK A;  2NVX B;  1QOH A;  4QCL A;  1KIX A;  2VB3 X;  3CC4 A;  3NWS A;  1N36 Q;  2EY2 A;  3PUV A;  4DXG A;  1VDZ A;  1EY5 A;  3S14 B;  1F9Q A;  4GS3 A;  3AEV A;  2F0Q A;  3RUZ A;  1XMQ Q;  3URY A;  4OWT B;  4JBW A;  3IRB A;  3STB D;  5LL6 S;  4IJH A;  2AQ3 B;  1PRT B;  3M7G A;  5CMD A;  1SEB D;  3P20 A;  3OOC A;  1SNQ A;  4DR1 L;  3A5Z B;  2F0I A;  3BVZ A;  1GUT A;  3E5S A;  2OCE A;  4OHJ A;  3C2P A;  4RH6 A;  1EUJ A;  4LF4 L;  3PF5 A;  1OTC A;  4HTH A;  1GOZ A;  4B3M L;  3ND9 A;  1NY4 A;  4YWM A;  1JQY D;  3T53 B;  2PZW A;  2K5W A;  4O2D A;  2AUK A;  1VQM A;  2IPK D;  1PH9 A;  1ZKO A;  2R6G A;  4XQN A;  1WVL A;  4BA1 I;  1CSQ A;  4K2L A;  1KDB A;  3BZC A;  2B2U C;  3TP5 A;  1TWF H;  4N9T A;  3VYU A;  4LJZ C;  4DUY Q;  1SRU A;  3LX0 A;  4XYQ A;  2FMM A;  1CK1 A;  4K5W A;  3CHB D;  2Z0S A;  2SNS A;  2DNE A;  3U58 A;  3GTQ H;  4A93 H;  5CV4 A;  1STN A;  1ENF A;  3I4L A;  5IGD A;  4JI5 L;  4FF4 A;  4FYD A;  4OGQ C;  1L1O B;  1STY A;  2A69 C;  2CFM A;  1A2T A;  1WTP A;  2WAC A;  2EY1 A;  4GLA C;  5C5M A;  1NTG A;  4KY6 A;  4A3B H;  2Q8I B;  3NHH A;  1U4M A;  4RGN A;  5LMN L;  3K5N A;  1TS4 A;  1TU2 B;  4BY7 H;  1VQH A;  2JSO A;  3PUX A;  2WAQ E;  3I4M G;  3G4S A;  4A3M H;  4IOC A;  1TWF B;  1F2M A;  3MEF A;  1AP0 A;  1HUN A;  1CKN A;  1LO5 D;  4UDU C;  2Z9H A;  1NUC A;  1QE6 A;  3SXH A;  3GTQ B;  4A93 B;  2VQE Q;  4K2K A;  1IBK L;  1NJI C;  1KRT A;  1E2W A;  5IGG A;  1MIU A;  4HJ9 A;  1HTL D;  3F2U A;  1LTT D;  1OO9 B;  2EQS A;  2QF7 A;  2HIX A;  4A3B B;  3BVM A;  2HT1 A;  4G7H C;  3T56 B;  4BY7 B;  2JA8 H;  1SNC A;  1STG A;  2K5N A;  1VMP A;  4X3S A;  3J7A F;  4EGV A;  1NMF A;  1S5D D;  4F87 A;  1DXM A;  5KND A;  2DJG C;  3TDQ A;  1SMY D;  1CKO A;  2AQ1 B;  3MA2 B;  1E2Z A;  2TMP A;  2XRQ D;  2IX0 A;  1D8L A;  1Q1B A;  4HJA A;  2OQ0 A;  5JVG 3;  5CV7 A;  1PZI D;  1PTO H;  5IGF A;  1A62 A;  3LWE A;  4MTN A;  5TSS A;  1V1P A;  2A8V A;  3FVQ A;  4R4I A;  2JA8 B;  2F0O A;  1CT1 D;  5BR8 Q;  5FK9 C;  3ERO A;  2IWH A;  5IT9 c;  2K04 A;  1SXT A;  5IOC A;  2XN9 C;  3CU7 A;  4EVO A;  5K36 G;  4KHZ A;  1I94 L;  2L1B A;  2HHH L;  1EIY B;  2ZJP A;  1EWH A;  3GTM H;  3Q24 A;  1PTO B;  4C1N K;  1RHP A;  3RLO A;  5F2D A;  1TVX A;  3TS2 A;  3T13 A;  2EJF C;  5IYB G;  1MKH A;  2CW0 C;  1F9S A;  4RFB A;  1JR0 D;  1Z6H A;  2WAQ B;  4OL7 A;  1IBM Q;  1HHV A;  2XNA C;  2BE5 D;  2VNU D;  2K32 A;  4LF5 Q;  1OXS C;  5EKL A;  1D5M C;  4B3R Q;  2F52 A;  3KBG A;  1VQ8 A;  4JI4 Q;  4KY7 A;  2PO4 A;  3GTM B;  1O7Y A;  2I5L X;  4QIW E;  1EIH A;  5IGE A;  1EY0 A;  1G51 A;  1Q90 A;  4Q0F A;  1B44 D;  4WOR A;  2B2T A;  4GNX B;  1IYU A;  2F3W A;  1TS5 A;  4OON A;  5GAE C;  1KAA A;  3I4M H;  4PG3 A;  3QOL A;  3CC7 A;  1PH5 A;  4AQY L;  2IT1 A;  1IBK Q;  1U5K A;  4QUF A;  4RA8 A;  1TKW B;  3R2I A;  4XYO A;  1SMX A;  3E6Z X;  4UP9 A;  3SK8 A;  3J81 E;  3D8G A;  4EX5 A;  4CKC A;  3VR2 A;  2NWG A;  2Z1C A;  5JJK A;  1CSP A;  3K0X A;  1UNS A;  1F77 A;  1K73 C;  5CV9 A;  2UUB Q;  2KCT A;  5HGT A;  1BCP C;  2RCN A;  2ZT9 C;  1WI5 A;  2YU9 H;  5C3X A;  3T1H L;  2K52 A;  2EYL A;  4NKL A;  3I4M B;  1TS3 A;  2IHF A;  2A74 C;  2F0W A;  5J3B A;  5C5L A;  5IWA L;  2B8G A;  3A8I E;  2VL6 A;  1IW7 C;  4DV6 Q;  1ESR A;  2SDF A;  4QL5 A;  1J5E L;  3ULJ A;  4B3T Q;  4KKT A;  1YHA A;  2G9H D;  2Z6K A;  4HIK A;  5GAD C;  2ZTE A;  5T1G A;  1NBW A;  5KYI A;  2NZO A;  1Q82 C;  2K75 A;  1VQ6 A;  4OX9 L;  5KEE A;  2A68 D;  2NVY H;  2EDG A;  4RKL A;  3T4A C;  5COR A;  2YU9 B;  3SK6 A;  1YIJ A;  4DV5 Q;  4X3K A;  3A0J A;  1SDF A;  1EIG A;  1VQD A;  4C2M H;  1EOV A;  1M90 C;  3AB9 A;  4RG1 A;  3CCS A;  4POG A;  2JA7 G;  4JC0 A;  5K36 H;  3HKZ G;  3ER0 A;  2R61 A;  4O42 A;  3PUZ A;  4UAI A;  1HZA A;  1TXY A;  3H0G G;  5AJ3 L;  2Y0S G;  4TRD A;  3FMC A;  2A1A A;  1I50 H;  2B2T C;  4QIW B;  4IN3 A;  1SE4 A;  1EYC A;  1Q46 A;  1WJJ A;  4IUR A;  3GTG H;  4P2C B;  4CDF C;  4DAV A;  5FO9 B;  2F4V Q;  4JI7 L;  4C2M B;  1AE2 A;  1Y1W G;  1NSN S;  1E22 A;  4J15 A;  1A6X A;  4P75 A;  4LFC L;  5J39 A;  2PZU A;  5EGT A;  4HIM A;  2A6E C;  4YWK A;  3STB C;  1U4L A;  5LMU L;  1VQJ A;  3C3L A;  1I4P A;  1SRO A;  4QJF A;  4HCS A;  4KMU C;  4JI3 L;  2EPB A;  3PO2 G;  5ELN A;  3C46 A;  2F0T A;  1JOR A;  1QUQ A;  3CCV A;  1SYE A;  1I50 B;  4A75 A;  4C3J G;  2D62 A;  3M85 A;  4KV6 A;  1R4Q B;  3U9S A;  1LT5 D;  1V1O A;  4IUV A;  2ZTC A;  3NBH B;  4RGO S;  4CKE A;  4HJ8 A;  4NXM L;  3CD6 A;  1Y69 U;  3D6W A;  4GKK Q;  1K28 A;  2WFW A;  3W2D A;  2EJM A;  2K5H A;  3HFZ B;  4IJL A;  2KJX A;  2Z6K C;  1B9M A;  2E2H H;  1GUO A;  2WP8 J;  3QIA A;  3DWA A;  4IFD I;  3HKZ E;  4J8Q A;  4OO1 I;  1OXV A;  1B4O A;  4NXN Q;  2O5J C;  1F2L A;  1GXD C;  2RF4 A;  4C3I G;  2Y0S E;  4ZRZ A;  3PIO A;  2KUM A;  1J8I A;  1WTX A;  4IFD G;  3I70 A;  3MC0 B;  2N88 A;  4PMW A;  5IOD A;  3LGJ A;  5ELE A;  2VQF L;  1ICW A;  5I6W A;  1S72 A;  3GTP H;  4RKB A;  3FDT A;  4ILW A;  4B9W A;  2EYO A;  4R1J A;  2I5M X;  1DGS A;  4DR6 L;  1A3U A;  3PMF A;  2B39 A;  2E2H B;  5C4X G;  5C0X I;  4AH6 A;  4DV0 L;  4ABN A;  3TP7 A;  2WB1 G;  4A3C H;  1BKB A;  1X3P A;  3FHW A;  3KF8 A;  3LWU A;  1IYJ B;  1CQF A;  1XMO L;  4HIO A;  5C0X G;  2AMC B;  4CDD C;  1NR2 A;  2PMZ E;  5C44 G;  2Z4H A;  5BN5 A;  2PI2 E;  1JWS D;  2DJF C;  1V8Q A;  2LKV A;  3GTP B;  3I91 A;  2HQL A;  1HRJ A;  5IGB A;  2JE6 I;  3EN2 A;  1ICF B;  4K5V A;  3J81 c;  1XNQ L;  4KD3 A;  3I90 A;  4LFA Q;  4RGT A;  1GM5 A;  1LTL A;  1X9N A;  1X32 A;  3W1G A;  1RTN A;  1SNM A;  1YNJ D;  4J6H A;  4X3T A;  1N32 Q;  4CJ1 B;  3T1Y Q;  2UU9 L;  3H0G H;  1F2Y A;  1Q12 A;  3X3M A;  2L9H A;  2AQ2 B;  1DCZ A;  4V19 0;  1SMY C;  3MVV A;  4JI1 Q;  4LNQ A;  3IFT A;  1K0R A;  3GTL H;  2KEC A;  4H02 A;  1TY2 A;  3CP0 A;  5I9O A;  3M7N A;  1O78 A;  1UEB A;  3QOJ A;  2F3V A;  3NTI A;  3RLN A;  1C9O A;  1X55 A;  2Z6B A;  1VQE A;  5GRO A;  2RSO A;  5LMU Q;  1B7Y B;  5E4W C;  2J0T D;  1JOQ A;  1ZYR C;  1IXR A;  4YCU A;  3PIO 3;  3L9A X;  3KF6 A;  2WB1 E;  3M4Q A;  1PH4 A;  3M3Y H;  3HKZ B;  1QZG A;  2F0J A;  1LT3 D;  1FGB D;  2TSS A;  3QWN A;  3S17 H;  3PO2 H;  3BDL A;  4R4T A;  3H0G B;  5I2X A;  3PGZ A;  2Y0S B;  1IZ6 A;  4A3I H;  3N6R A;  4OIJ A;  4DR5 Q;  1A15 A;  1YHB A;  1CA6 A;  4C3J H;  1LM0 A;  1AN8 A;  2QW7 A;  1HR0 Q;  4B9X A;  3GTL B;  1YHQ A;  1EIF A;  4LF9 L;  1VQ7 A;  1CI3 M;  1XYI A;  1AFP A;  1SYG A;  1S5B D;  4R4C A;  2D5D A;  2OF1 A;  4N8X 1;  3R93 A;  1KDA A;  4HSV A;  4DNT B;  1Q8K A;  3HG9 A;  4RHS A;  3RZD H;  1BCP F;  3M3Y B;  1EWC A;  1PRT F;  5BN3 A;  3R3O A;  3L3O C;  4AIM A;  1DOL A;  3F1Z A;  4C3I H;  4A76 A;  1UAP A;  2N8N A;  3PO2 B;  3S17 B;  4H0L C;  5D3D A;  2BE5 C;  4C3H H;  4DR2 Q;  2EYP A;  1KNE A;  4A3I B;  4IFD H;  4OO1 H;  2PMZ B;  4LF6 Q;  4QQB X;  2PQA B;  1TQO A;  2M2L A;  2CCZ A;  4DXF A;  1E0B A;  4C3J B;  1WD1 A;  4OWW B;  1PRT D;  1WTR A;  3K57 A;  4DV4 L;  1ILP A;  4H7B A;  1KLU D;  3HOW G;  4DR6 Q;  5IY0 A;  3OHX C;  5E1F A;  1RF2 D;  4CJ0 B;  1XTC D;  4DKA C;  3BS1 A;  5FLX c;  2OEO A;  2YTX A;  1D5X C;  1EY4 A;  3KJP A;  1HTP A;  3CCM A;  2D0O A;  4A3B G;  3RZD B;  4TKO B;  3V05 A;  5T1I A;  2E5L L;  4P74 A;  4ZYS A;  1M8A A;  1X54 A;  1IKL A;  5KYL A;  1GO3 E;  2RHQ B;  4A3M G;  1F2Z A;  4C3I B;  1JE4 A;  4DV3 Q;  1K9M C;  3GTJ B;  5C0X H;  4KHP Q;  4C3H B;  2QEX A;  2K03 A;  4XTC S;  1L0X B;  3FKI H;  2MNA A;  2CQO A;  5M3F G;  3A56 A;  3BDC A;  4A3K H;  1MJC A;  4DR3 Q;  2LS0 1;  1YNX A;  2IHE A;  3T16 A;  4L5R C;  3RZO B;  2NBF A;  1BXT A;  4DR7 L;  1BVS A;  3DUZ A;  3K7A H;  3KOJ A;  3F2D A;  3FEW X;  2SEB D;  4APV A;  4DNI A;  3T51 B;  1CHQ D;  3HKS A;  3BG3 A;  3W3A A;  1K8G A;  3MXN B;  2WB1 B;  1VQO A;  1SR3 A;  2A73 B;  1NNX A;  4DGZ A;  4X62 Q;  1D7Q A;  3CF5 A;  5C44 B;  4DN4 M;  4BY1 G;  1Q1E A;  2KVM A;  2OTL A;  4PZ7 A;  4HSP A;  1TWG H;  1XNR Q;  1VF5 C;  4K6L A;  3HOU G;  4A3K B;  2RA4 A;  3N52 A;  3HRZ C;  4QY7 A;  3HOX G;  2ES2 A;  3K7A B;  2C9O A;  4EQO A;  1ML0 D;  4K8I A;  1Y1V G;  4AYB E;  1XPR A;  5EKI A;  5JJI A;  3PIP A;  4RHR A;  3SGI A;  2Z8L A;  4NB3 A;  4CGY B;  4MIU A;  1ET6 A;  4UP8 A;  1ENA A;  5M5Y B;  3OWE B;  2WAQ G;  1CFM A;  5JVH 3;  5LL6 X;  5NUC A;  3VYR A;  3G7L A;  1LT4 D;  4CDE C;  4JBM A;  2J7Z A;  4KHV A;  1TWG B;  2G9D A;  3H09 A;  5GQO A;  3KDF B;  3OTO Q;  3RD4 A;  1EQV A;  4GOP B;  2L15 A;  1VQN A;  2KA7 A;  4K6D A;  4QF4 A;  4JI0 L;  5JPN C;  1IYV A;  1U0L A;  4CKB A;  3GTK H;  1K83 H;  3NQI A;  1H9S A;  1PFN A;  1AZP A;  3NWT A;  5EBC A;  5CR3 A;  1H9K A;  3HP3 A;  4K14 A;  3CC2 A;  4JV5 L;  3TEH B;  2ICE C;  4RAU C;  1BBU A;  1QWY A;  3E0J A;  3TRZ A;  2VB2 X;  4FXK C;  4KK7 A;  3CPW A;  3HOW H;  4GKJ L;  3JAM c;  1N34 L;  1LTI D;  3Q0A A;  3OSO A;  1WTO A;  1VCI A;  1JJ2 A;  3O13 A;  3GTK B;  1PTO F;  1TY0 A;  1K83 B;  1HNZ Q;  1JWM D;  4UPA A;  3E3X A;  4JYA L;  4JI2 Q;  3P1H A;  2JP1 A;  4OEL B;  3AYH B;  4L5Q A;  3NTK A;  5IYD G;  3W5O A;  3CXC A;  1KRS A;  2F3I A;  2WKD A;  4ZAI A;  4B3S L;  1Z7T A;  3VR4 A;  5HUR A;  4IFD J;  2L55 A; 
#chains in the Genus database with same CATH homology
 4BBR H;  2NN6 I;  1XMO Q;  4JI6 Q;  1SMX A;  3VDY A;  1EWI A;  4UP9 A;  1J6Q A;  4DUY L;  1YJ9 A;  3F8T A;  4A3E H;  3KYH C;  3S2D H;  4P71 A;  4EX5 A;  3EIV A;  4TQU S;  4BBR G;  5M3F H;  3ERS X;  3J80 c;  1VQP A;  1PA6 A;  1MJE A;  4IOA A;  4DR2 L;  3FP9 A;  2NN6 G;  2UUA Q;  4LF8 Q;  5JJK A;  1CSP A;  3K0X A;  4GN5 A;  4DAM A;  3J7Z C;  3AFP A;  4LF6 L;  1K73 C;  4L5T A;  3KFU A;  2KBN A;  2UUB Q;  5FLM G;  2KCT A;  1XNQ Q;  4BA2 I;  1X65 A;  2RCN A;  2OTJ A;  1WI5 A;  2YU9 H;  1E7Z A;  1X6O A;  4UY8 C;  5H1S E;  1B8A A;  1UWV A;  3T1H L;  2K52 A;  2ZJQ A;  3H3V I;  3NEL A;  2ZTD A;  5M5X H;  2B3G A;  1PV4 A;  2D0P A;  4DR4 Q;  2IY5 B;  2IHF A;  3G48 A;  4GN3 B;  5IWA L;  4JOI A;  5J3B A;  4DV1 Q;  1CKM A;  1CKN B;  5JEA J;  2VL6 A;  2KEN A;  5IP7 H;  1KHI A;  2VZA A;  5C0X J;  1PH8 A;  4MZ9 A;  2ASB A;  1EQR A;  4DV6 Q;  3CCU A;  4QL5 A;  4DAY B;  2VY3 A;  4JI8 Q;  3ULJ A;  1J5E L;  2OWO A;  2UU9 Q;  4B3T Q;  1YHA A;  2FXQ A;  1KAW A;  1FJG Q;  4MNO A;  2Z6K A;  3CQZ H;  5GAD C;  4HIK A;  2ZTE A;  4BY1 H;  4WJ3 M;  3I55 A;  2GVA A;  4LF7 Q;  4P72 A;  1NBW A;  3CCL A;  2N78 A;  3L7Z C;  4DV3 L;  2NZO A;  2ID0 A;  1Q82 C;  2VQE L;  3HOU H;  4KHP L;  3HOZ H;  3OW2 A;  3I7F A;  3J81 j;  1YI2 A;  2K75 A;  1VQ6 A;  4OX9 L;  4BXX G;  3S1R H;  3HOX H;  4DV2 L;  1NE3 A;  1OXU A;  4DK3 C;  1RIP A;  3JAM i;  2NVY H;  1JB7 A;  3HOZ G;  2I5H A;  1VQI A;  1Y1V H;  4X66 L;  4DV5 Q;  1WOC A;  4DR3 L;  1X56 A;  1YIJ A;  1Q7Y C;  3A0J A;  1VQD A;  4C2M H;  5FJ8 H;  2NVQ H;  2UXD Q;  1EOV A;  4YCW A;  4DR1 Q;  4DK6 C;  1M90 C;  3M4P A;  2JA7 H;  1I5F A;  1JE5 A;  4YHH Q;  4LFB L;  4RG1 A;  3CCS A;  3CMA A;  4LF4 Q;  4POG A;  3KJO A;  2JA7 G;  4JC0 A;  3HKZ G;  4IPC A;  3ER0 A;  4UP7 A;  1YVC A;  3PUZ A;  3GO5 A;  3S24 A;  1HZA A;  1TXY A;  5DLQ E;  4X62 L;  2V1C C;  1PH3 A;  3H0G G;  4B3M Q;  3S16 H;  3J80 i;  5AJ3 L;  2Y0S G;  2BH2 A;  2R92 H;  2A1A A;  1I50 H;  4X64 L;  1KXL A;  4IPD A;  4LF9 Q;  3BZK A;  1K3R A;  1HH2 P;  5M3M H;  1XNR L;  3PO3 H;  1Y1W H;  1NMG A;  1SN8 A;  1VQL A;  1W2B A;  3S2H H;  1Q46 A;  3K80 C;  2ZM6 Q;  1IBL Q;  1WJJ A;  3GTG H;  4X65 L;  4R4Q A;  3PO3 G;  2F4V Q;  4JI7 L;  3CW2 C;  1AE2 A;  1Y1W G;  5IYC H;  1E22 A;  4J15 A;  1AH9 A;  4P75 A;  1E3P A;  3K81 C;  3CCE A;  3RN5 A;  3HOV H;  4LFC L;  2JJQ A;  1X3G A;  3UDX A;  5BR8 L;  4HIM A;  4YWK A;  2UXB Q;  2AKW B;  1S3O A;  2K5V A;  3JC6 6;  4GN4 B;  3STB C;  1HNX L;  5LMU L;  1VQJ A;  2ALY B;  3HOV G;  1P16 A;  1SRO A;  1W3S A;  4QJF A;  3K8A A;  4KI0 A;  2MQH A;  1VQA A;  1WCM H;  4JI5 Q;  2LXJ A;  3AQQ A;  4JI3 L;  3PO2 G;  2MO1 A;  5ELN A;  1OXT A;  1QUQ A;  3CCV A;  3EBE A;  2Q2U A;  2AWO A;  4DV4 Q;  1LYL A;  3CCJ A;  4A3G H;  3CCR A;  4PZ6 A;  4A75 A;  2PQA A;  3RN2 A;  1GD7 A;  2PI2 A;  3OTO L;  1L1O A;  5LMN Q;  2CWA A;  3ULL A;  4A3F H;  2D62 A;  2VS1 A;  3M85 A;  4DUZ L;  4O0A A;  4JOI C;  1FGU A;  3UE0 A;  2ZTC A;  2AHO B;  3NBH B;  1E24 A;  4HJ8 A;  5IYD H;  1QVG A;  4NXM L;  2E5L Q;  3S1N H;  3CD6 A;  4GKK Q;  3E9H A;  1EYG A;  1VQF A;  2WFW A;  1QVC A;  3RNU A;  2K5H A;  3HFZ B;  4IJL A;  3G71 A;  2Z6K C;  2RHS B;  2MO0 A;  3F2C A;  2WP8 J;  2EXD A;  4Y7N H;  1K8A C;  1IBM L;  2XGT A;  2E2H H;  1QVF A;  3J7A 5;  5E7N A;  3HKZ E;  4IFD I;  3GTJ H;  4OO1 I;  1OXV A;  2E8G A;  3CCQ A;  4LF5 L;  4NXN Q;  3U4V A;  1HNW Q;  1EFW A;  3I56 A;  4IPG A;  4LUO A;  5M5W H;  2RF4 A;  2UUC Q;  2Y0S E;  4DV7 L;  5EAY A;  3PIO A;  2LXK A;  2VW9 A;  4IO9 A;  2IX1 A;  3PF4 A;  4B3R L;  4A93 G;  3PUW A;  2E2I H;  2Q2H A;  3F2B A;  4IFD G;  4JI4 L;  2YYZ A;  5FLM H;  4PMW A;  2HIV A;  3LGJ A;  2VQF L;  1JT8 A;  4YWL A;  1S72 A;  3GTP H;  2K14 A;  3GTO H;  4DR7 Q;  3RZO H;  1N33 L;  2N3S A;  1TWC H;  4LW1 A;  2I5M X;  4R1J A;  1X3E A;  1T9H A;  4LWC A;  1DGS A;  4ME3 A;  4A3J G;  4DR6 L;  5C4X H;  1YJW A;  1V1Q A;  2H5X A;  1HNZ L;  4BY7 G;  4X6A H;  4JI2 L;  2B63 G;  3H3V H;  1HZB A;  4EQ5 A;  5HGQ A;  4GLX A;  5C4X G;  5C0X I;  4DPG A;  1HJP A;  4AH6 A;  2YTV A;  1PVO A;  4DV0 L;  2UXC L;  1IL2 A;  1E1O A;  1GKH A;  5C44 H;  2WB1 G;  4YY3 L;  1BKB A;  2GVB A;  3FHW A;  4A3C H;  1G6P A;  1TWH H;  1IYJ B;  2JEB I;  5JEA G;  1XMO L;  4JI6 L;  4DV2 Q;  4RMF A;  3UDI A;  4HIO A;  5C0X G;  2NVX H;  2AMC B;  1Y14 B;  1YEZ A;  2KHI A;  2PMZ E;  1AE3 A;  5C44 G;  4BXX H;  2MFI A;  4A3C G;  2JA9 A;  1UE5 A;  2PI2 E;  1VQ5 A;  1R9T H;  2KHJ A;  2BA0 A;  1E1T A;  2K50 A;  1YJN A;  2HQL A;  2N49 A;  4LF8 L;  2UUA L;  2BH8 A;  2JE6 I;  3EN2 A;  1JMC A;  1PYS B;  1UE7 A;  3D31 A;  4ALP A;  3Q8D A;  3WWV A;  3J81 c;  1I6H H;  3S14 H;  2UUB L;  1XNQ L;  3S1Q H;  4LFA Q;  1GVP A;  1GM5 A;  1LTL A;  3PSI A;  1PH7 A;  4OXP A;  4HJ5 A;  1X9N A;  3I4N H;  3W1G A;  1A63 A;  4LFB Q;  1UE1 A;  2K4K A;  3PV0 A;  1PH6 A;  2JA8 G;  1FVI A;  2R7Z G;  1VQG A;  1L2F A;  4DR4 L;  5M5Y H;  4DV1 L;  3I4N G;  4OWX B;  2QA4 A;  1N8R C;  3TS0 A;  2NZH A;  3CME A;  1N32 Q;  4LUZ A;  3ICE A;  4DV6 L;  3M9B A;  5GAH C;  3T1Y Q;  1A0I A;  1I94 Q;  4JI8 L;  1OXX K;  3U50 C;  4B3T L;  2UU9 L;  3H0G H;  1FJG L;  1CUK A;  1Q12 A;  2HHH Q;  1P8L A;  3UDF A;  4A3L G;  4LF7 L;  2VUM G;  1L1O C;  1ASY A;  1KIX A;  1JJG A;  4JI1 Q;  3CC4 A;  4LNQ A;  4JI0 Q;  2CKZ B;  1N36 Q;  1K0R A;  3KDF A;  3PUV A;  1M1K C;  1O7I A;  4NPS A;  4GOP A;  1V9P A;  3GTL H;  3CAM A;  4H02 A;  4YCV A;  1SE8 A;  4GS3 A;  2KCM A;  3AEV A;  1XMQ Q;  3CP0 A;  3M7N A;  4OWT B;  4JBW A;  1UEB A;  3IRB A;  3RLN A;  3STB D;  3D0F A;  1C9O A;  1X55 A;  4IJH A;  1HNX Q;  4DV5 L;  1VQE A;  5GRO A;  3RLF A;  5LMU Q;  2JA6 G;  1B7Y B;  1KC8 C;  1L0W A;  1IXR A;  4YCU A;  4KLK A;  4DR1 L;  3A5Z B;  4JV5 Q;  2UXD L;  3KF6 A;  2WB1 E;  3M4Q A;  1PH4 A;  1XJV A;  1SLJ A;  1C7Y A;  3M3Y H;  1H95 A;  4HJ7 A;  1QZG A;  2Q2T A;  2XTI A;  3S17 H;  2OCE A;  1VQB A;  4YHH L;  3PO2 H;  4R4T A;  1PYB A;  4QGU A;  3PGZ A;  1EUJ A;  4LF4 L;  1IZ6 A;  4A3I H;  3PF5 A;  1OTC A;  1UE6 A;  1Q86 C;  4DR5 Q;  2JA5 G;  4GKJ Q;  3ULP A;  1LUZ A;  1PH2 A;  4DUZ Q;  1YHB A;  1N34 Q;  3I4O A;  4C3J H;  4B3M L;  1XTD A;  4A3I G;  1LM0 A;  1NY4 A;  4YWM A;  1HR0 Q;  1XPO A;  4O2D A;  1YHQ A;  1EIF A;  4LF9 L;  1VQ7 A;  4JYA Q;  1VQM A;  1G29 1;  2GN5 A;  4AQY Q;  1PH9 A;  1TWA H;  4R4C A;  2R6G A;  4GNX A;  2ZM6 L;  2QGQ A;  1IBL L;  1EQQ A;  4A3D H;  1Q8K A;  4B3S Q;  1YBY A;  2EIF A;  2BA1 A;  4BA1 I;  3RZD H;  2F4V L;  1CSQ A;  1WFQ A;  2DUD A;  3BZC A;  5C3E G;  1TWF H;  4BBS G;  2JEA I;  5LMN W;  4DUY Q;  4A3D G;  1SRU A;  2DGY A;  1I3Q H;  4AIM A;  3F1Z A;  4C3I H;  4A76 A;  2N8N A;  5GAG C;  2Z0S A;  2UXB L;  2OQK A;  4FDB A;  4LUV A;  3U58 A;  1QUQ B;  3GTQ H;  4A93 H;  4C3H H;  4DR2 Q;  3A5U A;  5IE8 A;  4HID A;  4LF6 Q;  4JI5 L;  4QQB X;  2PQA B;  3DM3 A;  1PFS A;  4JG2 A;  2CCZ A;  1L1O B;  4OWW B;  4OO1 G;  1V43 A;  2R93 G;  2CFM A;  4DV4 L;  1HZ9 A;  3HOW G;  3OYY A;  4DR6 Q;  5IY0 A;  3T1H Q;  4GLA C;  4A4I A;  2E2J H;  1NTG A;  4A3J H;  1VQ9 A;  4A3B H;  4DKA C;  4Y52 H;  4POF A;  5FLX c;  5LMN L;  2YTX A;  5IWA Q;  3K7U C;  4BY7 H;  1VQH A;  3KJP A;  3CCM A;  2D0O A;  3PUX A;  2ZJR A;  2B63 H;  4A3B G;  2WAQ E;  3I4M G;  3G4S A;  4A3M H;  2NVT H;  1J5E Q;  2R7D A;  3U4Z A;  4IOC A;  1WYD A;  4P74 A;  2E5L L;  3MEF A;  4GKK L;  1X54 A;  1CKN A;  1PH1 A;  1GO3 E;  2RHQ B;  4A3M G;  4K0K L;  3TRE A;  4DV3 Q;  1K9M C;  4KHP Q;  2VQE Q;  1IBK L;  3A74 A;  3AFQ A;  1NJI C;  2QEX A;  4NXN L;  4OX9 Q;  1HNW L;  4XTC S;  1KRT A;  3FKI H;  4A3E G;  2UUC L;  1MIU A;  2MNA A;  4GOP C;  2CQO A;  1YIT A;  5M3F G;  4HJ9 A;  3I2Z A;  1QZH A;  4A3K H;  1MJC A;  3FKI G;  3NEN A;  2EQS A;  4X66 Q;  4DR3 Q;  3UDG A;  2HIX A;  2JQO A;  3PUY A;  3NEM A;  1YNX A;  2IHE A;  3KLW A;  4L5R C;  2HT1 A;  3BU2 A;  4DR7 L;  4JBJ A;  5HY6 A;  3G6E A;  4A3K G;  1BVS A;  3K7A H;  3KOJ A;  3F2D A;  1Q81 C;  2JA8 H;  4DNI A;  4APV A;  2R7Z H;  2B29 A;  1KQS A;  1VQ4 A;  3HKS A;  2K5N A;  1K8G A;  1NMF A;  4R4O A;  1RL2 A;  2C35 B;  3MXN B;  1KL9 A;  5IP7 G;  1VQO A;  3KF8 B;  1SR3 A;  2Q2I A;  1CKO A;  4X62 Q;  3CPF A;  1D7Q A;  3CF5 A;  5AJ3 Q;  4A3L H;  2VUM H;  4BY1 G;  4X64 Q;  1SFO H;  1Q1E A;  3L0O A;  4GLV B;  2IX0 A;  2OTL A;  4PZ7 A;  2LSS A;  1D8L A;  1Q1B A;  1TWG H;  1YZ6 A;  4HJA A;  4JBK A;  1XNR Q;  2OQ0 A;  3HOU G;  1VS0 A;  4JCV E;  4TVA B;  4X65 Q;  4L5S A;  1A62 A;  4GNX C;  4QY7 A;  3HOX G;  4JI7 Q;  4MTN A;  1BBW A;  2ES2 A;  2A8V A;  4R4I A;  3HOY H;  2ATW A;  2YTY A;  3W1B A;  4LFC Q;  2JA6 H;  1Y1V G;  4AYB E;  1PHJ A;  4LFA L;  1XPR A;  1S40 A;  5BR8 Q;  5JJI A;  1FL0 A;  5FJ8 G;  3SGI A;  3PIP A;  3H15 A;  4NB3 A;  3HOY G;  3B6Y A;  4UP8 A;  2PNH A;  2WAQ G;  1C0A A;  1X3F A;  4JI3 Q;  5IT9 c;  1N32 L;  4JBM A;  3TQY A;  5K36 G;  2JA5 H;  4KHZ A;  3T1Y L;  1I94 L;  2JK8 A;  3UE1 A;  2HHH L;  3DLL A;  5GQO A;  1EIY B;  2ZJP A;  3KDF B;  3OTO Q;  3RR5 A;  3GTM H;  5IYB H;  4GOP B;  3BJU A;  2A19 A;  2L15 A;  1VQN A;  2R92 G;  3PCO B;  3RLO A;  4JI1 L;  3TS2 A;  5M3M G;  4JI0 L;  1N36 L;  4NXM Q;  4IPH A;  2R7F A;  5IYB G;  1U0L A;  4WJ4 A;  1MKH A;  3GTK H;  5C4J H;  3L2P A;  1K83 H;  3J81 i;  1Z47 A;  5JJL A;  1XMQ L;  1A8V A;  4XIG S;  5C3E H;  1IBM Q;  2I0Q A;  2AWN A;  4P73 A;  5IYC G;  4BBS H;  3KF6 B;  2VNU D;  2CWP A;  4LF5 Q;  5ELO A;  1HR0 W;  1OXS C;  1JJC B;  3CC2 A;  4JV5 L;  3TEH B;  4DV7 Q;  4B3R Q;  1Z9F A;  2F52 A;  1VQC A;  3GDE A;  1N9W A;  1B70 B;  1VQ8 A;  1BBU A;  3S15 H;  4JI4 Q;  5IP9 H;  1XPU A;  3TRZ A;  1WCM G;  3M4O H;  3E0E A;  2VQF Q;  3S1M H;  2R93 H;  3CPW A;  3HOW H;  4A3G G;  1N33 Q;  2I5L X;  4QIW E;  5IP9 G;  4DR5 L;  3ZJY C;  4GKJ L;  2YV5 A;  1G51 A;  3JAM c;  3E9I A;  1N34 L;  1KD1 C;  1VCI A;  4GNX B;  4A3F G;  1HR0 L;  1JJ2 A;  3GD7 A;  4OON A;  5GAE C;  1HNZ Q;  4UPA A;  1HZC A;  3I4M H;  4PG3 A;  4JYA L;  4JI2 Q;  3CC7 A;  4PZ8 A;  4AQY L;  3AYH B;  4L5Q A;  1PH5 A;  4K0K Q;  5IYD G;  3W5O A;  3CXC A;  4DV0 Q;  2IT1 A;  1KRS A;  2UXC Q;  2F3I A;  1VQK A;  1IBK Q;  4B3S L;  1ASZ A;  1U5K A;  4YY3 Q;  4IFD J;  4AYB G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...