4IPHA

Structure of n-terminal domain of rpa70 in complex with vu079104 inhibitor
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
b'GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Surface Reengineering of RPA70N Enables Cocrystallization with an Inhibitor of the Replication Protein A Interaction Motif of ATR Interacting Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/inhibitor
total genus 30
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4iphA00
3GTPH 4JI4L 2HT1A 5IYDG 4BBSG 4IPCA 2K4KA 3BJUA 4A3FG 1YVCA 1EQQA 4LFCQ 2VZAA 1YNXA 3M4OH 1WFQA 4QQBX 1XMQL 3TRZA 4JI0Q 1YIJA 4JBMA 1UE6A 1YHAA 2BH2A 4OO1I 1K0RA 4FDBA 1HR0W 2D0PA 4RMFA 1X56A 2GVAA 2R6GA 1L0WA 3S24A 3W5OA 4DV5Q 1IBKL 2IX1A 1HR0L 4JV5Q 2BA0A 1YJNA 4YHHL 3PGZA 1IL2A 4X66L 4A4IA 3H15A 1N36Q 4B3SQ 4LF6L 3HOWG 1SN8A 3K7UC 5GADC 3PCOB 1PH5A 4YCWA 2IHEA 1K8GA 1N33Q 2VW9A 3K0XA 5IP9G 1VQPA 1N34Q 4JBWA 1QZGA 2R92G 3S14H 2KCMA 4QIWE 3HOYH 4NB3A 1NBWA 4DAMA 4X64Q 3M4PA 1VQOA 4YWKA 4DUYL 2QEXA 3AEVA 2KHIA 1HZAA 2NVYH 2HHHL 4BXXH 1PH6A 1BBWA 4DV6L 2E8GA 2UXBL 1HZ9A 1VQJA 4DV4L 4A3GH 2ZJQA 1E3PA 2Q2IA 5JEAJ 1VQAA 2B63H 4GKKQ 4HIMA 3W1GA 4LF4L 2F3IA 4Y52H 3HKSA 3F1ZA 1C9OA 3OYYA 1B7YB 2Z6KA 3PF5A 3T1YQ 4JI5Q 3RLOA 2E2IH 4LFCL 5IWAQ 1CKOA 4DR2Q 2A1AA 2AHOB 3UE1A 4YWMA 4JI0L 5GAEC 1Q86C 2AMCB 4R4TA 1NJIC 4TVAB 2Q2UA 2ES2A 1TWCH 3WWVA 3PO2G 1V43A 4A75A 3J80c 4A3BH 1Q82C 4BY7G 4A3DH 2N78A 5IP7G 2GVBA 3CC7A 4DV5L 1MJEA 1N8RC 5DLQE 5C4XH 2Q2TA 4JV5L 2F52A 1W2BA 4GNXA 3PUVA 4LWCA 3HOYG 2WB1G 1BKBA 1N36L 4B3SL 1KRTA 4R4QA 2I5MX 3FKIH 1PV4A 2R7DA 4GN3B 4C3HH 4A93G 4X65L 1N32Q 1N33L 5IYBH 3JAMc 4JYAQ 1RIPA 2N49A 1N34L 3ICEA 4POGA 5EAYA 3J7A5 4A3GG 2WB1E 3S2HH 1Q1BA 4MZ9A 1Y14B 4KHZA 3CMEA 2ZM6Q 1X55A 2YYZA 2CFMA 3K81C 4GN4B 2MNAA 1KIXA 5C3EH 2I5LX 1I3QH 4A3IH 3CCMA 2VQFQ 1KAWA 2ALYB 3GTOH 3H0GH 3KDFA 4DV0Q 4DR7Q 4HIDA 2D62A 1J6QA 1X65A 1GD7A 4GKJQ 3ER0A 3CAMA 1XMOQ 4GKKL 1CKNB 1A0IA 1PYSB 5M3MG 2YTVA 4A3JH 2R7FA 5FLXc 4GLAC 3CPFA 3CP0A 1PHJA 1TWGH 1A63A 4AYBE 4PZ7A 4JI5L 1EWIA 5C4JH 3T1YL 5IWAL 1X9NA 4DR2L 2RF4A 3U58A 3S1QH 4AQYQ 1HNXQ 2WP8J 1WCMG 1IBLQ 3PO3H 2OQKA 1WOCA 2BA1A 5LMUQ 4HIKA 3EIVA 3I4NH 3CCJA 4R4IA 4GOPA 3GTJH 3GD7A 4X62Q 4JCVE 5IE8A 2Z0SA 4P72A 3KJPA 3ULPA 4BY1H 2IT1A 4UY8C 1N9WA 1HZBA 5IYDH 4A3FH 2B29A 3I7FA 4DV2Q 5HY6A 4A3IG 3U4ZA 2JA7G 4OO1G 1WI5A 1N32L 1P8LA 4DK6C 1LM0A 2AWNA 4GLXA 4JYAL 1U5KA 3S15H 1L1OB 3CQZH 3I2ZA 3I4OA 2R93G 2NVXH 1SMXA 1JJCB 2NZOA 3K8AA 1PFSA 2ZM6L 1ASYA 3S1NH 3TS2A 4LFBL 1JJGA 1UEBA 2DUDA 1K73C 3SGIA 2UUBQ 2UUCQ 4OX9Q 2NVTH 3GTMH 2Z6KC 2UXCQ 2VQFL 4UP8A 4DV0L 1VQEA 3HOWH 3PF4A 3PSIA 4DR7L 1OXXK 3F2DA 3PO3G 1OXUA 1PH3A 1VQ9A 3M7NA 4GKJL 1C0AA 1QVFA 1XMOL 2KCTA 2R92H 2DGYA 3E0EA 5IP9H 3UDXA 3PIOA 1BBUA 2JA6G 3U4VA 1PYBA 4DR5Q 4JI6Q 4K0KQ 3H3VI 4GNXC 1HNXL 4DR1Q 1IBLL 4IPGA 2PQAB 3TS0A 3AFPA 1C7YA 4X6AH 5LMUL 3RN2A 3CF5A 3IRBA 1KD1C 4J15A 1EIFA 1B8AA 2MO0A 4X62L 2KBNA 1XNRQ 2HQLA 4KI0A 1W3SA 4A3EG 1TWAH 2I5HA 3HOXG 3CCQA 3CCUA 3RR5A 1VQDA 5AJ3Q 3S16H 4IFDG 3S2DH 2V1CC 4JBKA 4HJ8A 1CKMA 2K5VA 3HOVG 1GVPA 1LUZA 2EQSA 2RHQB 2OWOA 4B3MQ 2CWAA 3PO2H 1D8LA 1H95A 1EIYB 3BZCA 4BY7H 2OCEA 5IP7H 1D7QA 4DNIA 1S3OA 2UUCL 2UUBL 2UXCL 2LXKA 4YCUA 2C35B 5H1SE 4OX9L 1Y1WG 3HOZG 4POFA 5LMNQ 1VQNA 1X3GA 2K5HA 1JE5A 3G48A 3PUZA 5J3BA 3MEFA 3MXNB 3TEHB 3ULLA 5M5YH 3KFUA 1YBYA 4EX5A 4A93H 4QJFA 3A74A 5IYCG 3J81j 4IO9A 1XJVA 2E5LQ 4JI7Q 2JA8G 3HKZG 3M85A 4GOPC 1PVOA 3HFZB 4UP9A 4JBJA 4JI8Q 4DR5L 4UP7A 4JI6L 4K0KL 5C0XI 5BR8Q 2JEAI 2R7ZG 3UDFA 4IPHA 1YZ6A 2YTYA 4JI1Q 4DKAC 4LF5Q 2F4VQ 4DR1L 1E1TA 1O7IA 3E9HA 1HH2P 1MJCA 1MIUA 3FHWA 1HJPA 4P71A 2XTIA 3HKZE 4JG2A 5K36G 4OWXB 4AIMA 2PNHA 1X6OA 3BZKA 3HOUG 2WAQG 3CCLA 4IFDI 5JJIA 3PUXA 1XNRL 2VUMG 1ASZA 2OQ0A 2EXDA 1Q46A 5M3MH 2BH8A 1VQFA 2JQOA 2OTJA 2E2JH 4HJ7A 2A19A 5AJ3L 1PH2A 1I6HH 5GAHC 1GO3E 2WAQE 4O2DA 3BU2A 1WCMH 3CCSA 4R4CA 1K8AC 4B3ML 2K14A 1IBMQ 2N8NA 4LF8Q 1CKNA 1E7ZA 1HNZQ 1V9PA 4DV7Q 4DR4Q 4BBRG 2I0QA 2QGQA 5C44H 4X64L 3ERSX 1KHIA 1EUJA 1L2FA 3CC4A 1EOVA 3PV0A 2JA7H 5C44G 3PUYA 4JI7L 3DM3A 2E5LL 3CW2C 5HGQA 1MKHA 5GAGC 2VS1A 1CSPA 2K75A 4TQUS 3GDEA 2MFIA 2PI2E 4JI8L 3GTKH 2R93H 1I5FA 1WYDA 3F2CA 5BR8L 2RCNA 1OTCA 4JI2Q 1I50H 4LF5L 2F4VL 3AQQA 2VL6A 2CKZB 5M5XH 3AYHB 3RLFA 3J7ZC 1I94L 1X3FA 4PZ8A 1LTLA 3J80i 4A3MG 1E22A 4L5TA 4OONA 1SFOH 2LXJA 4OWTB 5FJ8G 1CSQA 3G4SA 4IPDA 3G71A 4A3LG 3UDGA 4LUZA 3STBC 2JA6H 1G6PA 1VQBA 4EQ5A 4QL5A 1XPRA 1VQCA 4JOIC 4C3JH 3CMAA 5M3FG 3JAMi 3A5UA 4AH6A 5E7NA 1KXLA 3M9BA 1IBML 4ALPA 1GM5A 4NXMQ 2YU9H 4LF8L 4MNOA 4DUZQ 1FVIA 1FL0A 2Q2HA 1HNZL 4DK3C 1JT8A 4DR4L 4DV3Q 1QUQA 1EYGA 4A3EH 2CQOA 5IY0A 4NXNQ 3HOXH 1UE7A 4A3KG 1J5EQ 4A3CG 3KF8B 3S17H 3E9IA 3PIPA 1KC8C 3CD6A 1VQHA 3J81c 2KHJA 1YHBA 2LSSA 3NBHB 2PQAA 3PUWA 4XIGS 3HOVH 3KJOA 2JE6I 1A8VA 1X54A 1NMFA 2K52A 3RLNA 3CPWA 4DV1Q 2AWOA 2Y0SE 3D31A 1HR0Q 1XPOA 4JI2L 3F2BA 3GO5A 1EQRA 1QVCA 1Y1WH 3HOZH 3KF6B 2ID0A 1TWHH 2HIVA 2NN6I 1VQ4A 4AQYL 2ZTCA 2VQEQ 3GTQH 3L0OA 4O0AA 2OTLA 3K7AH 2JA8H 5IYCH 4JC0A 1PA6A 3TQYA 5C0XG 3AFQA 1U0LA 1VS0A 1FJGQ 3D0FA 2R7ZH 1FGUA 1TWFH 1VQ5A 1S40A 1R9TH 3OW2A 2JJQA 5FLMG 2YTXA 4DV2L 1VQ6A 3CCEA 2NZHA 4A76A 4NPSA 4DUZL 1A62A 1PH9A 2ZJPA 3HOUH 3LGJA 2K50A 4DV3L 2VUMH 4YCVA 2KENA 4NXNL 1B70B 4HJAA 1Q12A 1J5EL 3CXCA 1PH4A 1M90C 3F8TA 4C3IH 4B3RQ 4JOIA 1OXTA 3W1BA 1Y1VG 4KHPQ 4DAYB 3I4MG 1V1QA 2HIXA 4DV1L 1TXYA 1L1OC 4AYBG 1JB7A 1BVSA 4YY3Q 4BBRH 1XNQQ 1CUKA 3RNUA 1PH7A 1AH9A 2RHSB 5GQOA 4JI3Q 3U50C 4YWLA 1SR3A 1UE5A 4X65Q 2VQEL 1YJ9A 1AE3A 4KLKA 3L2PA 4GLVB 4BA1I 1X3EA 2ZTEA 4P74A 1VQMA 2ZJRA 1FJGL 3UE0A 3S1MH 3G6EA 3KYHC 1SRUA 3M3YH 3KLWA 1SROA 2QA4A 4OXPA 4L5QA 1S72A 5M5WH 1LYLA 4A3MH 1Q81C 1YJWA 1VQ8A 1YITA 4R1JA 5FJ8H 2IY5B 1HNWQ 1G291 1NY4A 1XTDA 4DR6Q 1M1KC 3OTOQ 4A3LH 2A8VA 1K9MC 4L5SA 3H3VH 5LMNW 3VDYA 1NE3A 4XTCS 4B3RL 1YEZA 2ATWA 4R4OA 5M3FH 4HJ5A 5LMNL 1UWVA 2JEBI 4LUOA 4KHPL 1DGSA 5ELOA 4LF7Q 2JA5H 2CWPA 1QVGA 4WJ3M 5JJKA 4QY7A 1VCIA 2N3SA 5ELNA 1SE8A 1VQIA 4YY3L 1XNQL 2NVQH 5JJLA 3L7ZC 2H5XA 4LUVA 4ME3A 4IOAA 4A3CH 2AKWB 4A3KH 1P16A 1SLJA 4Y7NH 4IJHA 4JI1L 4JI3L 4BXXG 5JEAG 1VQKA 1NTGA 2VY3A 3DLLA 3CCVA 3CC2A 1GKHA 2B63G 3EN2A 3JC66 4H02A 2JA9A 1L1OA 1VQLA 4LFBQ 4GN5A 1I94Q 3T1HQ 4OWWB 2IHFA 4GNXB 2UUAQ 2UXDQ 1G51A 4LF4Q 2NN6G 4APVA 1JJ2A 1IZ6A 4DPGA 4P73A 1T9HA 4LF9Q 1HNWL 3UDIA 3NEMA 5IT9c 2JA5G 4DR6L 3NENA 3OTOL 3RZDH 4LFAQ 4LNQA 4A3BG 3GTLH 4A3DG 4MTNA 4DR3Q 3TREA 2K5NA 4LW1A 4B3TQ 4DV7L 1QZHA 2UU9Q 1Q8KA 3K80C 3RN5A 1EFWA 1Q7YC 2ASBA 4BA2I 5C0XJ 1OXVA 3KF6A 3FKIG 5FLMH 4JI4Q 1YI2A 2Y0SG 3A5ZB 3KDFB 1JMCA 2MQHA 4LF7L 1Z9FA 1KRSA 1E24A 3NELA 1XMQQ 1Z47A 5IYBG 2D0OA 1E1OA 1YHQA 4IFDJ 1PH8A 4QGUA 2EIFA 4PG3A 4P75A 1IXRA 3ZJYC 1IBKQ 4BBSH 4C2MH 5C3EG 4YHHQ 4UPAA 4PMWA 4IJLA 4HJ9A 3STBD 4X66Q 2L15A 1HZCA 2FXQA 1KQSA 3EBEA 3H0GG 3I56A 4LF6Q 3RZOH 2WFWA 1Y1VH 3M4QA 5GROA 4RG1A 4HIOA 2E2HH 3ULJA 1XPUA 1AE2A 1K83H 4GOPB 3I4MH 2PMZE 1Q1EA 4GS3A 1K3RA 2ZTDA 4A3JG 3T1HL 5C4XG 2UUAL 2MO1A 2UXDL 2GN5A 2CCZA 2PI2A 4L5RC 2VNUD 1RL2A 2B3GA 1IYJB 3KOJA 3B6YA 1KL9A 1NMGA 4DUYQ 4LF9L 4PZ6A 1UE1A 2JK8A 2XGTA 2HHHQ 1VQGA 4DV6Q 4NXML 3I4NG 4LFAL 2UXBQ 1QUQB 4WJ4A 4DV4Q 2IX0A 1OXSC 3GTGH 3CCRA 4DR3L 3A0JA 1PH1A 4B3TL 1WJJA 3FP9A 3J81i 3I55A 3Q8DA 4IOCA 3S1RH 2YV5A 2UU9L 1VQ7A 4BY1G
chains in the Genus database with same CATH superfamily
4KTAA 3VYTA 2XVSA 3RUZA 3M4OH 4RAUC 4IUNA 1YHAA 3EQLC 4RKLA 4FO2A 1X56A 2GVAA 2R6GA 5CV5A 2WB1B 3W5OA 1IW7C 5T1IA 1G2TA 1IL2A 3NK9A 1GJXA 2F3VA 2WV6D 5I9OA 4B3SQ 4LF6L 1SN8A 5GADC 3QOLA 3K5MA 2QILA 2VW9A 1N34Q 4JBWA 4F87A 1EIGA 1ET9A 1SYFA 1NBWA 3X3MA 4X64Q 4B9WA 3MWYW 4DUYL 1S5BD 2QEXA 4BXXH 1SNCA 3TZUA 1BBWA 1CK1A 4DV6L 1KNAA 5M3MB 4DV4L 1Z7TA 2Q8TA 2EXZA 5IOCA 2ZJQA 5JEAJ 4HIMA 3EROA 1I6HB 3HKSA 3F1ZA 2F0UA 3OYYA 3NQTA 3MC0B 3VYRA 2E2IH 4LFCL 5IWAQ 1CKOA 2A1AA 4R8IA 4JI0L 1SSOA 4TVAB 1TWCH 4XQJA 1TKWB 3BVGA 4DV5L 3K58A 4J1MA 5C4XH 1DJRD 2F0MA 2F52A 3EJIA 4MIUA 4GNXA 2F0DA 2RDHA 3PUVA 1W2BA 3HOYG 2WB1G 4L63B 2VXWA 2R7DA 2SNMA 4C3HH 2DN8A 2N49A 3ICEA 5EAYA 4A3GG 1I50B 4EQPA 1Y14B 3CMEA 5KGUA 1PTOB 1SYCA 1X55A 2CFMA 4GN4B 1KIXA 5C3EH 2I5LX 1SFOB 2RBMA 1PRTC 3VA5A 1DXMA 3T56B 4FF4A 2ALYB 3H0GH 3KDFA 4HAEA 4HIDA 3ND9A 1GD7A 3OMCA 4XXEA 5M3MG 4A3JH 1QILA 4JI5L 5C4JH 3U58A 3S1QH 2YU9B 1IBLQ 3BVMA 3OHXC 5LHY1 4RWSC 3CCJA 4GOPA 4A3EB 1VF7A 1HQRD 3HOXB 3GD7A 1BCPD 1SNQA 3OWEB 5EKIA 5IYDH 1CA5A 2DY8A 3I7FA 1ML0D 4DV2Q 1ICFB 4A3FH 3G7LA 1WI5A 1N32L 2QF7A 4GLXA 4JYAL 2A5HA 5IT9E 1JJCB 1RKNA 2L4NA 3K8AA 1PFSA 2M2LA 4LFBL 1JJGA 4OX9Q 1AW7A 4UP8A 3K7AB 3PF4A 3HOWH 2F0SA 3PSIA 3PO3G 4GKJL 1B3QA 1QVFA 3EFXD 2KECA 1S4ZA 4K5XA 4DAVA 3E0EA 2R7ZB 2FFKB 4K0KQ 2FMCA 4DN4M 4DR1Q 2F0VA 2WAQB 3AFPA 4ZYSA 3S1RB 3CF5A 5J22A 3IRBA 1KD1C 1EIFA 2MO0A 1PTOD 2VB3X 4N9TA 4X62L 3R3OA 1XNRQ 1KDCA 4A3EG 2I5HA 3HOXG 2RQXA 3W2DA 1SYEA 2JYOA 3J7AF 1HUMA 1VQDA 4JBKA 3MXPA 2O5JC 2ZT9C 2K5VA 5IT9L 1GVPA 1EWHA 3NWTA 4BY7H 4DNIA 2LXKA 2EY5A 5D14A 4POFA 5LMNQ 3K5OA 2E76C 3PUZA 3KFUA 4EX5A 4QJFA 5IYCG 3HFZB 4UP7A 3K57A 3M3YB 5C0XI 4KN4C 5BR8Q 2R7ZG 2RCFA 4DK0A 4IPHA 2YTYA 4JI1Q 2D5DA 4EQNA 3PIO3 5C44H 3E9HA 1I94Q 4P71A 5JPNC 1HJPA 5KYLA 4IFDI 2WAQG 4J8QA 3PUXA 2EXDA 1Q46A 2VB2X 3H94A 3I90A 2BH8A 1VQFA 5M3FB 2OTJA 1GUWA 4HJ7A 5AJ3L 5GAHC 3KLSX 4S3SA 2N8NA 4I7ZC 2EVBA 5ELDA 1CKNA 1E7ZA 4IURA 2K1BA 4DV7Q 4DR4Q 2Y0SB 4QF4A 3PV0A 1LABA 3DM3A 3NQIA 2RSOA 1MKHA 5HGQA 3DWQA 1ILPA 1C48A 4TQUS 3E3XA 1JWUD 2MFIA 3GDEA 4R9WA 4JI8L 5E1FA 3GTKH 1I5FA 2R93H 1GHJA 4G7ZC 4JI2Q 1OTCA 3W3AA 2F4VL 3AQQA 4K8IA 2VL6A 1H95A 1I4RA 4RFBA 3SE0A 2MP1A 4A3MG 1JQYD 5FJ8G 2RA4A 4RCOA 2EZVA 4G4KA 1XPRA 3MA2B 1VQCA 4M1UB 2XWJB 5M3FG 1EOTA 5E7NA 1RD9D 3OSOA 5KNDA 4NXMQ 1MGSA 4MNOA 4BY1B 2Q2HA 4DK3C 1IKMA 4ABNA 5IY0A 2MJ8A 1Y1VB 3QG1A 3I4MB 3PUWA 2LSSA 1F2MA 4CJ0B 3KJOA 1A8VA 1M8AA 1B4OA 1SNPA 5CV7A 1HR0Q 2MPMA 1EU3A 1Y1WH 1PTOC 3HOZH 1CM9A 2ID0A 1TWHH 4K2LA 1VQ4A 1QWYA 2VQEQ 3L0OA 3GTGB 2JA8H 3A7LA 5EKLA 1F9PA 5EJWA 5C0XG 1Y8PB 1U0LA 4EQOA 1LTRD 1FJGQ 2B2WC 3C1FA 2NYZD 4KK7A 3M4OB 1TWFH 1U4MA 4ZK9B 2NZ1D 3T13A 1R9TH 2JJQA 3J81E 4CKCA 2EYLA 1PZJD 4A76A 3I70A 2B2YA 5FLXL 2VUMH 4YCVA 2KENA 1J5EL 1PH4A 1E2ZA 3P7JA 3MZ5A 3PO2B 4JOIA 3BDLA 4DA2A 3U9SA 4WORA 1Y1VG 4HTHA 1NR2A 4DAYB 3I4MG 3DWPA 3J7AV 3PIP3 4DV1L 2EJMA 1TXYA 1JB7A 4BBRH 1XNQQ 1CUKA 1MSHA 1PH7A 1GOZA 1KLGD 4BWGB 3U50C 4DF7A 3VYUA 3T4AC 1I4HA 3NWSA 3C1EA 3SR1A 3NTHA 5HGTA 3UE0A 2E2IB 3IL8A 4YIJA 1DD2A 1SRUA 1SROA 1CI3M 5IGCA 4C3IG 1TWCB 1YJWA 3KUPA 3TSSA 1HNWQ 2IY5B 1HTLD 1G291 1NY4A 2KHSA 3OTOQ 4G7HC 4A3LH 1F2ZA 1K9MC 4L5SA 1WCMB 4IALA 3ITPA 3QOJA 3VDYA 1NE3A 4B3RL 4C3HB 5EKKA 5FO7B 1RCVD 3SK8A 1LV9A 1ET6A 1HPCA 1TU2B 4NW2A 3HZXA 5ELOA 3D4DA 4LF7Q 2CWPA 1SNOA 1VQIA 4YY3L 2H5XA 4IOAA 4FF1A 3Q23A 3T53B 3FMCA 3H0GB 4IJHA 4BXXG 4DNRB 4PNYA 4KV6A 1GKHA 4A3JB 3NUCA 4XT1B 3EN2A 3JC66 4ZKCB 1O78A 1STYA 5C4JB 5I9PA 3S1QB 3OIPA 1ESFA 2CQAA 1JJ2A 1IZ6A 3R93A 2QW7A 4F88A 3NEMA 5IT9c 1GUNA 3LWUA 4LFAQ 3SEBA 4LNQA 5BN5A 4DR3Q 1FNUA 4LW1A 5C4XG 2ASBA 2UU9Q 1EFWA 3K80C 4A3FB 1Q7YC 5ELBA 4BA2I 3L9AX 4CGYB 4Q5VA 4DU9A 4IN3A 4JI4Q 1R4PB 4C3HG 3FPPA 1T5EA 3NELA 4RGOS 1EY9A 1Z47A 1YHQA 1PH8A 4QGUA 2EIFA 4KY5A 1YNJD 2CH4W 2R61A 4I65A 1SMYD 3HG9A 1IBKQ 3HOWB 5C3EG 4IJLA 3VR2A 4X66Q 5COYA 2L15A 2FXQA 1KQSA 3H0GG 3RZOH 1B44D 4UAIA 3M4QA 2C9OA 3GTQH 3ULJA 1AE2A 2PMZE 4GS3A 1K3RA 1F9SA 4A3JG 5EGTA 1LT6D 2E74C 5DAUA 2GN5A 3V2TA 1IYJB 3DMUA 4ME5A 3B6YA 1PYWD 1SAPA 2XRSD 3C3LA 4LF9L 1UAPA 1UE1A 2JK8A 4DXFA 2F0GA 2UXBQ 4WJ4A 2IX0A 1STNA 1DOLA 3I55A 3J81i 4IOCA 3S1RH 1VQ7A 1EWCA 2HT1A 5IYDG 3I91A 4IPCA 4BBSG 4A3FG 1LACA 4QQBX 2Z1CA 2BH2A 1RODA 2RDFA 1AP0A 2D0PA 2KUMA 2A68D 4RMFA 3E6ZX 4JV5Q 2IX1A 2F0EA 1B9MA 3H15A 1TVXA 5CBEE 3HOWG 4EVOA 1ENCA 4FF3A 1SJHD 3MFGA 1PH5A 1D6EC 2IHEA 5KRUA 1N33Q 1VQPA 3VR5A 3S9WA 3V05A 3S14H 1H9SA 1XWEA 1CT1D 4NKLA 3AB9A 5C44B 1FNVA 3P1HA 1ZYRC 4ZQ3A 2KHIA 2NVYH 3H6MA 1BNZA 5JEAH 1PH6A 2HHHL 1HZ9A 1WTXA 4GKKQ 2X69A 2NB0A 4LF4L 1C9OA 1B7YB 2Z6KA 2NN6H 4CKBA 1M4VA 2DNCA 3UE1A 4YWMA 1NJIC 1AFPA 2AMCB 1EZ6A 1RJTA 4O42A 1PFBA 4K5VA 3QJYA 4A75A 4H13C 4A3BH 4BY7G 4A3DH 1MJEA 4OELB 2Q2TA 1NNXA 2B2UA 3P75A 4G7OC 4B3SL 2K5QA 1PV4A 2AUJD 4X65L 3GTKB 3I4LA 5FKAC 5JJZA 4A3KB 3CU7A 2EYHA 1N34L 4ZKBB 4POGA 2WB1E 4MZ9A 2F0TA 3ND8A 2JN4A 2WIIB 2ZM6Q 2MGSA 4O1NA 4RCNA 4A3IH 2L55A 1XXGA 2LS01 4DR7Q 3WOEA 1J6QA 1X65A 1R4QB 3ER0A 3J80E 1G6ZA 1PYSB 4TSSA 4HCEA 5FLXc 1S5FD 3TBIB 3CPFA 3CP0A 1I6VC 4CHTB 5KNCA 5IWAL 2A69C 1IYVA 1SMYC 5LMUQ 3EIVA 1PRTF 3JAME 1PFNA 4R4IA 1KDAA 1E0BA 4PMBA 1FD7D 3ULPA 4BY1H 2IT1A 4UY8C 2HDLA 1B50A 4I7AA 5AFWA 2PNRC 4DK6C 2AWNA 2QDLA 4KJOA 3I4OA 2BOSA 3KLSA 2R93G 2NVXH 2G9DA 2K33A 3HOZB 3NXWA 1ASYA 1TWHB 1BXTA 2NVTH 2UUBQ 3BVZA 1PDQA 2AQ1B 2J0TD 4CJ2C 3F2DA 1OXUA 2KCTA 2R92H 2DGYA 3UDXA 1JE4A 2Q8IB 1TWFB 3U4VA 1PYBA 4DR5Q 1R9TB 1U9RA 1HFGA 2B2TA 3VA7A 2A68C 1IBLL 1SXTA 5IGGA 4X6AH 4KHVA 2VUMB 3FDTA 4ZUJA 2B2VA 3C2PA 2KBNA 1W3SA 2RSNA 1TWAH 1Q8IA 4DGZA 3M4YA 3S2DH 2V1CC 2O2LD 5L37A 1CKMA 3P20A 1LUZA 4HSVA 1K3BC 3MTSA 3PO2H 4BBRB 4N9PA 1EIYB 1TQOA 2OCEA 5KYIA 1K8MA 5IGDA 4YCUA 4OX9L 2QKIC 1Y1WG 3HOZG 3SK5A 2B8FA 1BCPB 1X3GA 3VR6A 3CPWA 1JE5A 3CKIB 5J3BA 1JORA 3MXNB 1SYDA 2SEBD 3J81j 4JI7Q 2JA8G 2E5LQ 1MHWC 2F0IA 4K0KL 1HRJA 4KMUC 3UDFA 3BDCA 1PZID 1I4PA 1YZ6A 1O80A 4RGTA 4DR1L 1HH2P 2XTIA 2KQ3A 3TDQA 2PNHA 3BZKA 3CCLA 2L5TA 1XNRL 2VUMG 1VMPA 2E2JH 4KY7A 2A19A 4IUTA 2WAQE 4O2DA 2Z4HA 1WCMH 3QB3A 4R4CA 3CCSA 2K14A 1IKLA 1HNZQ 1V9PA 4BBRG 1B1ZA 4XDXA 4C56C 3CC4A 4OO1H 2IX3A 3FPUB 2VS1A 1CSPA 2K75A 4FF2A 1I3QB 1Q3LA 3T51B 3F2CA 1NCVA 5BR8L 4HN7A 2FJ2A 1I94L 3J7ZC 3LNNA 3J80i 4OONA 4OWTB 1CSQA 3G4SA 2L0CA 2B2YC 4ZUIA 3G71A 4A3LG 3UDGA 5DNFA 2JA6H 1LLRD 3DHQA 3SVMA 5BN3A 4JOIC 4C3JH 3I4NB 4P2CB 4DK1A 3JAMi 3A5UA 2F0QA 4AH6A 1V1PA 1KXLA 2F0HA 1GM5A 5LL6S 5KIXA 4DUZQ 1FL0A 4DR4L 1EYGA 2IPKD 4XYOA 4NXNQ 1UE7A 1WD1A 1NUCA 3KF8B 3RZOB 1EU4A 3E9IA 5IGEA 1O7ZA 3GTQB 4F7XA 2KHJA 3NBHB 2PQAA 3A54A 4XIGS 5NUCA 1NMFA 2D9UA 2Y0SE 3DM1A 3LX0A 3BG3A 4JI2L 3QIAA 3F2BA 2KVMA 1EQRA 4KY6A 3A7AB 3DUZA 2NN6I 1K28A 4AQYL 5IGFA 2K05A 5CV9A 2OTLA 4O0AA 4LAAA 4CKEA 1EY6A 5KNBA 1MI2A 5EBDA 4CDCC 3TQYA 3AFQA 3D0FA 4RH6A 1FGUA 1EL0A 3OW2A 4E6IA 2YTXA 3KLRA 2BDNA 2NZHA 5K36H 2CH4A 1PTOF 4NPSA 1A62A 1TS4A 4U673 3HOUH 1QNUA 1NSNS 4ZLTF 1B3AA 4HR7B 4HJAA 2XWBB 2A74C 3CXCA 3SHLA 1TS3A 5A2QE 3F8TA 2JSOA 5HURA 4TRDA 1F9QA 1OXTA 3W1BA 2DJGC 3S14B 2K32A 2HIXA 5E3FA 1F9RA 5C6AA 1WD0A 1EIHA 1I4QA 2EYPA 2NVYB 1II3A 4JI3Q 4X3TA 2VQEL 1YJ9A 1HUNA 1EY7A 1AE3A 3L2PA 4GLVB 1VQMA 1FJGL 2ZJRA 1LTGD 3S1MH 1F2LA 3KYHC 2F0FA 3KLWA 2FINB 4A3BB 1YITA 3RD4A 4A3DB 3BYYB 4DR6Q 5I2YA 2A8VA 5LMNW 3BDOA 3D4WA 4XTCS 1YEZA 2ATWA 4R4OA 3CRLC 1LO5D 3ONAB 1UWVA 4XT3B 1SEBD 5C4ZA 5C5LA 2JA5H 2K01A 1LTID 1O7YA 4HMIA 3HS0C 4G57A 4QY7A 5F2DA 5JJKA 1XNQL 4LUVA 4ME3A 4A3IB 2JA7B 4A3KH 4Y7NH 2ZXOA 4H44C 1BCPC 5JEAG 2VY3A 3CCVA 3CC2A 1LTAD 1L1OA 4LFBQ 2IHFA 4GNXB 4R8NA 2UXDQ 2F03A 2NN6G 4APVA 5FO9B 1EY0A 5EQ0A 3CHBD 4DPGA 1VMCA 2F0LA 1HNWL 1ILQA 3OTOL 3RZDH 4A3BG 2X6LA 4A3DG 1HFNA 4DXGA 2K5NA 4B3TQ 5J1ZA 4NMZA 4KKSA 3KF6A 2WACA 5C5MA 2Y0SG 3KDFB 4LF7L 2QCPX 4IUUA 1JWSD 2CW0D 3NPPA 2JP1A 2A73B 1XMQQ 2NVXB 4KKUA 3E0JA 1D5ZC 2RKSA 2NVTB 4P75A 4L8JA 2PPBC 4QIWB 2EY2A 3BS1A 4YHHQ 4PMWA 3STBD 2X6GA 1HZCA 3EBEA 1SYGA 2R92B 1K83H 4GOPB 1Q1EA 2F3WA 1A3TA 1CHPD 2PI2A 1YNND 2B3GA 2IW3A 1KL9A 5M9OA 1EEID 4EGVA 1D2BA 4LFAL 1MD2D 1ZXTA 3EA6A 1TWAB 3CCRA 4DR3L 1PH1A 1WJJA 2FHTA 2B2UC 2UU9L 2ICIA 4BY1G 3S2DB 5ELEA 4JI4L 2XIWA 3BJUA 1SDFA 1YNXA 3D3RA 5D3DA 3TRZA 1UUPA 4WFN3 4OO1I 1EZ8A 4XQNA 4FDBA 1HR0W 1QB5D 5JOBA 2AQ2B 1PMRA 3S24A 1L0WA 1IBKL 1YJNA 3PGZA 4X66L 4A4IA 1EYAA 1N36Q 4OHJA 3D6WA 4X3UA 3K7UC 1W6KA 3PCOB 1K8GA 2R92G 3K0XA 2KCMA 4ODGA 3HOYH 1CTMA 4NB3A 1JOQA 3NHHA 4DAMA 3J81L 4U68A 3NTIA 1VQOA 1JC7A 1HZAA 4ILWA 2UXBL 1VQJA 4A3GH 1E3PA 2Q2IA 1VQAA 3QO2A 2E2JB 3W1GA 4Y52H 2F3IA 3OMGA 2KJXA 2F0PA 3T1YQ 2OF1A 1L0XB 4DR2Q 2H4OA 5GAEC 1Q86C 4H0LC 4R4TA 1CHQD 4UDUC 4K5WA 4JPBW 3TMEA 3WWVA 3PO2G 1V43A 4MN3A 2GVBA 3CC7A 4JV5L 5DLQE 1ENFA 4ULLA 5LL6X 2NWGA 1KRTA 2I5MX 3FKIH 5FO8B 1AZPA 2N88A 2NVQB 1N33L 3NSWA 1RIPA 2PW5A 3S2HH 3A8IE 5EPKA 5CV4A 2YYZA 1VDZA 1I3QH 2BDOA 1ONLA 2VQFQ 2EY6A 3GTOH 3Q22A 4DV0Q 3K59A 2D62A 2JA6B 1XMOQ 4GKKL 1CKNB 1A0IA 3R2TA 1GUSA 2R7FA 4C3JB 4GLAC 3DWAA 1A63A 4RGNA 4PZ7A 1X9NA 1EWIA 3VR4A 4H7BA 3IFTA 3ZYYX 2RF4A 2BE5D 5CV8A 1TIID 1WTHA 1WCMG 3IKJA 1HNXQ 2DJFC 2OQKA 3PO3H 5E4XA 2BA1A 4HIKA 3I4NH 4K6DA 5IE8A 2Z0SA 4P72A 3KJPA 1CQVA 1N9WA 1IL8A 1JR0D 2B29A 5HY6A 3U4ZA 3A56A 2NTTA 4OO1G 1WTPA 1LM0A 4OL7A 4DFAA 2LKVA 2EOTA 1L1OB 3I2ZA 4TKOB 2WINB 2I07B 2NZOA 4IUQA 2PZWA 4LK1C 2ZM6L 2XN9C 1K73C 2UUCQ 3SGIA 2UXCQ 1U4LA 1E2VA 1VQEA 4AYBB 4DR7L 1OXXK 3HKZB 1PH3A 1VQ9A 1HCZA 3KBXA 5IP9H 3I73A 3PIOA 2JA6G 4JI6Q 1BO0A 1GUGA 1C8CA 4QB4A 4GNXC 4C3JG 5JPMC 5G3LF 3HOUB 4ZRZA 3TS0A 5LMUL 3RN2A 1B8AA 1QJOA 2HQLA 4KI0A 4MHEA 3H91A 3CCQA 2K28A 3RR5A 2QDBA 2L1BA 4N8FA 2KA7A 2TSSA 2EQSA 4WJWA 3OW7A 4B3MQ 2CWAA 3BZCA 5IP7H 1D7QA 2UUBL 2D2CC 2C35B 4ZCKA 4KD4A 1EYDA 1VQNA 4ZAIA 1E2WA 2K5HA 5M5YH 2HDMA 3OWFA 3MXUA 4A93H 1YBYA 1C0AA 3A74A 4QUFA 5CORA 3HKZG 4RA8A 3S1MB 2PZUA 4GOPC 4UP9A 4JBJA 4DR5L 2KCNA 2JEAI 3TP7A 5C3XA 4DKAC 3NTKA 4LF5Q 1SE3A 1E1TA 1O7IA 3FHWA 1MJCA 2B63B 1IW7D 4JG2A 1FR3A 5K36G 4QMGA 4AIMA 5JJIA 3HOUG 1KTKA 2EJGC 1CZWA 1O7LA 1TY0A 2IWHA 1S5CD 1PH2A 3V96A 1S5DD 2JA5B 2L9HA 1GO3E 1K8AC 5JVH3 2V4DA 1IBMQ 1A2UA 3OPOA 1L0YB 4LF8Q 3IAYA 1RHPA 2B2WA 3O13A 4Y7NB 2I0QA 2QGQA 1G2SA 1STHA 1XX8A 4X64L 1STAA 2J4XA 2IJ0A 1EUJA 1L2FA 1EOVA 2JA7H 5C44G 4JI7L 2E5LL 2KEDA 5GAGC 5JAVA 3N6RA 4FXGC 4XQQA 1BF4A 1WYDA 4C1NK 2CKZB 5M5XH 3RLFA 1SE2A 1X3FA 4PZ8A 4V0BA 3VR3A 1AZQA 2AQ3B 1E22A 4L5TA 1YNJC 3RZDB 2LXJA 1SBBB 1TWGB 1QE6A 1VQBA 1TR5A 2WKCA 3SK4A 4XYQA 2F1MA 1I4XA 1V8QA 3D8GA 4ALPA 4HSPA 2F0JA 1HNZL 4DV3Q 1QUQA 1SE4A 3M7GA 2DY7A 4A3KG 2EYFA 3PIPA 4IFDH 3J81c 1K83B 3RMHA 3HOVH 1GUOA 1Y69U 3J80L 2K52A 5IODA 2AWOA 3D31A 1SNMA 1CFMA 3K5LA 1QVCA 1V1OA 2HIVA 2PO4A 3R2IA 3JAML 4K8JA 4JC0A 1PA6A 1K8OA 1VS0A 1GHKA 4N8X1 3L3OC 1VQ5A 1S40A 2BCOA 4Z9CB 4DV2L 2ICEC 5ISRA 4DUZL 3PMFA 2QEJC 2ZJPA 1X32A 3A55A 4NXNL 1B70B 1DOKA 4C3IH 3NE5B 3WDNA 2RDGA 4KHPQ 1V1QA 5C3WA 1LTSD 2Z9HA 3HOYB 1JICA 1L1OC 1BVSA 1BBXC 2EY1A 1WTOA 3N52A 2P5ZX 1ESRA 1G91A 2KCCA 1UNSA 1CA6A 1SR3A 4X65Q 2G9HD 4A3GB 2AUKA 4HMJA 2DNEA 2ZTEA 2J7ZA 4KJNA 1X3PA 3I72A 4M8AA 3GV3A 1STEA 1ZKOA 2EJFC 3Q24A 3FRPB 1S72A 2RVLA 5M5WH 1Q81C 3HP3A 1VQ8A 1D5MC 1M1KC 2A6HD 1H9SB 3H3VH 1EY5A 3FKIB 1LTTD 2G5DA 4L6TB 4HJ5A 5LMNL 2JEBI 3URYA 4LUOA 3H09A 1QVGA 3S2HB 1U4RA 4IUPA 3SK6A 2N3SA 1SNDA 2NVQH 3L7ZC 1DCZA 4A3CH 4RHRA 4GZYC 3GTOB 1SLJA 4Q0FA 4JI1L 2F0NA 4JI3L 1VQKA 1NTGA 4OIJA 1WVLA 1MSGA 4RHSA 1VQLA 2F0OA 1BDOA 4GN5A 3T1HQ 1A6XA 2UUAQ 2A6ED 5A35A 1G51A 4LF4Q 3PO3B 1S5ED 3TZDA 1T9HA 3UDIA 3NBIA 4DR6L 1BCPF 3GTLH 4FP5D 3TREA 1DOMA 4DV7L 4CDFC 1QZHA 1Q8KA 5K5PA 3RN5A 2EYMA 5D65A 5C0XJ 1WTRA 3FKIG 5FLMH 3A5ZB 4RKBA 4JW0A 1TY2A 1KRSA 4X3SA 2B39A 3VYSA 2D0OA 1E1OA 4IFDJ 3S17B 3FVQA 1GUTA 1JOOA 3ZJYC 4BBSH 1G8ZD 4C2MH 4CJ1B 4UPAA 4PQXA 4HJ9A 3GV6A 4LF6Q 3I56A 2WFWA 1XPUA 5GROA 4RG1A 1NR4A 4HIOA 2SNSA 2E2HH 3HGBA 3R8BA 4IQZA 2MO1A 2UXDL 1XTCD 4L5RC 1RL2A 4IZ8A 3KOJA 4DUYQ 2XGTA 1VQGA 4DAYA 4DV6Q 4NXML 3I4NG 1QUQB 4DV4Q 3Q0AA 1OXSC 3A0JA 4B3TL 3Q8DA 2YV5A 1WTQA 3GTPH 2FMMA 2K04A 2K4KA 5D3IB 1YVCA 1EQQA 4LFCQ 1K0SA 2VZAA 1WFQA 1VF5C 1XMQL 4JI0Q 1MBYA 1DONA 1YIJA 4JBMA 1UE6A 1K0RA 2Z8LA 3F2UA 1KLUD 4HEDA 5EPLA 4OIKA 4DV5Q 1HR0L 2BA0A 3J7YW 1BQQT 3MXGA 4YHHL 3KK7A 5M5YB 2I46A 4RGMA 4A93B 5KEEA 2M9VA 4IUVA 4V190 3HEJA 4YCWA 1LTBD 5IP9G 1QZGA 3MAQA 2OXPA 1FNWA 4QIWE 3DXJC 4FXKC 3M4PA 2A6HC 4YWKA 3AEVA 2EYOA 1EYCA 2E8GA 1TS5A 3GP7A 1CQFA 2EDGA 2B63H 2WKDA 4JK1C 3I3CA 5CGKA 4A3MB 5A2QL 5JVG3 3PF5A 4JI5Q 3RLOA 2AHOB 2LFNA 5CC4A 2Q2UA 2ES2A 1DYQA 1IYUA 2Z6BA 1XYIA 3J80c 1Q82C 2N78A 5IP7G 1N8RC 4LWCA 1N36L 1BKBA 4R4QA 4GN3B 3MEHA 4A93G 4LJZC 2A6EC 1N32Q 5IYBH 3JAMc 4JYAQ 3BYTB 3J7A5 2OT2A 1Q1BA 2K03A 5M5XB 4KHZA 2KOLA 1BR9A 3K81C 2MNAA 4JVZA 3T16A 3CCMA 1RF2D 1KAWA 2LMCB 3UI2A 1EFID 4GKJQ 3CAMA 2HQEA 2YTVA 1PHJA 1TWGH 5E4WC 3T1YL 4DR2L 1B9NA 4AQYQ 1C4QA 2WP8J 1WOCA 1WTWA 2CHBD 1Y8OB 2K5DA 5I6WA 3GTJH 4X62Q 4JCVE 3EVQA 4CDDC 4PV1C 2XNAC 3FEWX 2XRQD 1HZBA 3HOVB 2HCCA 4PMCA 4A3IG 2JA7G 1P8LA 1U5KA 3S15H 1EEFD 3CQZH 1U4PA 2PYKA 1SMXA 2L11A 5FLXE 3S1NH 3TS2A 1UEBA 1EY8A 2DUDA 3GTMH 3HRZC 2TMPA 2Z6KC 2VQFL 3TP5A 1V1PB 1H9RA 3AU7A 4DV0L 3M7NA 2CVRA 1T5XD 1XMOL 1QNKA 2K7VA 1BBUA 2NUCA 1FGBD 3H3VI 1J8IA 2PZTA 4KN7C 3CRKC 1HNXL 4IPGA 2PQAB 1C7YA 3K6OA 4UHVA 1A15A 2ZXRA 4J15A 4FNFA 5DEHA 1LT4D 4C3IB 3CCUA 1TS2A 1H9MA 5AJ3Q 3S16H 4IFDG 4FYDA 2N55A 2IL8A 3HOVG 2RHQB 2OWOA 2EPBA 1D8LA 3LWEA 4KKTA 1S3OA 2UUCL 2UXCL 5H1SE 2PCFB 4FVMA 1B2TA 1GXDC 2K6AA 2C5CA 2GA4B 3G48A 3TEHB 3MEFA 3ULLA 4IO9A 1KABA 1XJVA 5C4HA 4K2KA 1STBA 3M85A 3QR8A 3TN2A 4DNTB 4JI8Q 1PVOA 4JI6L 1A2TA 1WTVA 5M5WB 3E5SA 2F4VQ 4AYBE 1MIUA 3HKZE 5IIFA 4OWXB 1Y8NB 1F2YA 1J9OA 1X6OA 4WRDA 1ASZA 2OQ0A 5M3MH 1PLFA 2JQOA 1I6HH 1KNEA 3BU2A 2EYJA 4B3ML 5C4XB 1ZYRD 4KD3A 5CBAE 4B08A 2HUGA 3I8ZA 2PQEA 3S16B 1D1KA 2O4XA 2B2TC 3ERSX 1KHIA 1JB3A 3OOCA 3PUYA 1Z6HA 2F0WA 5I4DA 1HHVA 3CW2C 1W6JA 1HA6A 5C3EB 2PI2E 3AMUA 1A3VA 1BOSA 2B2VC 3X3NA 2RCNA 1FYCA 3QWNA 2CW0C 1I50H 5J39A 4LF5L 3MHBA 3C46A 3AYHB 1PTOH 2MUYA 1LTLA 2XSCA 4OEMB 4F8MA 4HCSA 1SFOH 3GTLB 3A8JE 1X3QA 4IPDA 4LUZA 4OGQC 3STBC 1G6PA 4EQ5A 4QL5A 1QG7A 3CMAA 1PFMA 1HQMC 5I6YA 5EPJA 4QCLA 3M9BA 1IBML 2NBFA 2YU9H 1F77A 4LF8L 1FVIA 1YNNC 3U9OA 1RDPD 1JT8A 2PW7A 4BBSB 4C2MB 3KBGA 5IGBA 4A3EH 2CQOA 4A3CG 3HOXH 1J5EQ 3S17H 1KC8C 3CD6A 1VQHA 2E2HB 1PZKD 1YHBA 1IHZA 2JE6I 1X54A 2E2DC 1QOHA 2HCIA 3RLNA 2A69D 4DV1Q 1BUVT 1SJED 1XPOA 3GO5A 4B9XA 1PXUA 2SOBA 3WOFA 5DM73 3K0YA 3KF6B 4MTKA 3TP8A 2EE1A 3G6JB 3NP8A 4QUCA 4X3KA 2KEEA 2ZTCA 3D4RA 3K7AH 5IYCH 3MVVA 1ICWA 3GTPB 2R7ZH 4C1NI 1Q90A 1D5XC 1B53A 2NTSA 5FLMG 1AN8A 5G3LD 3SDZA 3CCEA 1VQ6A 4ID6A 4K14A 3MXNA 1PH9A 3LGJA 2K50A 4DV3L 3ERQA 1Q12A 1JOKA 1M90C 1H9KA 2JXMB 3SXHA 4B3RQ 2M00A 5CR3A 4BY7B 1STGA 4NDXA 4AYBG 4YY3Q 3RNUA 1AH9A 2RHSB 1PRTB 1JCKB 5GQOA 4LMQD 1CZGA 4YWLA 1UE5A 5EBCA 1HA5A 5ELCA 4KLKA 4BA1I 1X3EA 4P74A 3OIQA 2L12A 5CV6A 3G6EA 4CBVA 4K6LA 1LT3D 5FOBB 2Q8RE 5DM63 3M3YH 1I4GA 2QA4A 4OXPA 4L5QA 1LYLA 4A3MH 4R1JA 5FJ8H 4J6HA 1XTDA 2F0KA 1ENAA 5FK9C 5M3FH 1RTNA 4KHPL 1DGSA 3D6CA 2E75C 5I2XA 4WJ3M 2OEOA 1VCIA 5ELNA 1SE8A 2PMZB 2B8GA 2BE5C 4NP5A 1H9JA 4BS9A 5JJLA 2AKWB 1P16A 2Z4IA 2R93B 3DLLA 3MFYA 2H1EA 2B63G 4H02A 2JA9A 1SYBA 4OWWB 3KF8A 1JWMD 2K5WA 3NBHA 4P73A 5T1GA 4LF9Q 3GTJB 2JA5G 3NENA 3GQBA 3Q6SA 1AEXA 4MTNA 1PRTD 5C0XH 3H3VC 1DZ1A 1HTPA 1KAAA 3PQIA 1RTOA 1OXVA 3TP6A 1YI2A 1JMCA 1UEAB 2MQHA 3S15B 1Z9FA 3CQZB 1E24A 3DEPA 5IYBG 3S1NB 1EQVA 1HXYD 1ZEQX 2LY7A 4PG3A 3GTMB 1IXRA 1D1IA 1DM0B 3IFDA 1OO9B 3BZDB 2ENBA 1Y1VH 5CMDA 3I4MH 5TSSA 1Y1WB 3A8KE 2HD3A 1KDBA 2ZTDA 2ZXPA 3T1HL 2UUAL 2F4IA 4FXDA 1LT5D 2CCZA 2O5IC 5ELFA 4DAPA 1EY4A 3K5NA 2VNUD 1QCBD 2JA8B 2MHVA 4CDEC 1NMGA 4PZ6A 5CYUA 2HHHQ 1EQTA 1A3UA 2R3ZA 2SDFA 1TT2A 3GTGH 1NAPA 3FP9A 4HJ8A 5BN4A 3DEOA
chains in the Genus database with same CATH topology
3GTPH 4JI4L 2HT1A 5IYDG 4BBSG 4IPCA 2K4KA 3BJUA 4A3FG 1YVCA 1EQQA 4LFCQ 2VZAA 1YNXA 3M4OH 1WFQA 4QQBX 1XMQL 3TRZA 4JI0Q 1YIJA 4JBMA 1UE6A 1YHAA 2BH2A 4OO1I 1K0RA 4FDBA 1HR0W 2D0PA 4RMFA 1X56A 2GVAA 2R6GA 1L0WA 3S24A 3W5OA 4DV5Q 1IBKL 2IX1A 1HR0L 4JV5Q 2BA0A 1YJNA 4YHHL 3PGZA 1IL2A 4X66L 4A4IA 3H15A 1N36Q 4B3SQ 4LF6L 3HOWG 1SN8A 3K7UC 5GADC 3PCOB 1PH5A 4YCWA 2IHEA 1K8GA 1N33Q 2VW9A 3K0XA 5IP9G 1VQPA 1N34Q 4JBWA 1QZGA 2R92G 3S14H 2KCMA 4QIWE 3HOYH 4NB3A 1NBWA 4DAMA 4X64Q 3M4PA 1VQOA 4YWKA 4DUYL 2QEXA 3AEVA 2KHIA 1HZAA 2NVYH 2HHHL 4BXXH 1PH6A 1BBWA 4DV6L 2E8GA 2UXBL 1HZ9A 1VQJA 4DV4L 4A3GH 2ZJQA 1E3PA 2Q2IA 5JEAJ 1VQAA 2B63H 4GKKQ 4HIMA 3W1GA 4LF4L 2F3IA 4Y52H 3HKSA 3F1ZA 1C9OA 3OYYA 1B7YB 2Z6KA 3PF5A 3T1YQ 4JI5Q 3RLOA 2E2IH 4LFCL 5IWAQ 1CKOA 4DR2Q 2A1AA 2AHOB 3UE1A 4YWMA 4JI0L 5GAEC 1Q86C 2AMCB 4R4TA 1NJIC 4TVAB 2Q2UA 2ES2A 1TWCH 3WWVA 3PO2G 1V43A 4A75A 3J80c 4A3BH 1Q82C 4BY7G 4A3DH 2N78A 5IP7G 2GVBA 3CC7A 4DV5L 1MJEA 1N8RC 5DLQE 5C4XH 2Q2TA 4JV5L 2F52A 1W2BA 4GNXA 3PUVA 4LWCA 3HOYG 2WB1G 1BKBA 1N36L 4B3SL 1KRTA 4R4QA 2I5MX 3FKIH 1PV4A 2R7DA 4GN3B 4C3HH 4A93G 4X65L 1N32Q 1N33L 5IYBH 3JAMc 4JYAQ 1RIPA 2N49A 1N34L 3ICEA 4POGA 5EAYA 3J7A5 4A3GG 2WB1E 3S2HH 1Q1BA 4MZ9A 1Y14B 4KHZA 3CMEA 2ZM6Q 1X55A 2YYZA 2CFMA 3K81C 4GN4B 2MNAA 1KIXA 5C3EH 2I5LX 1I3QH 4A3IH 3CCMA 2VQFQ 1KAWA 2ALYB 3GTOH 3H0GH 3KDFA 4DV0Q 4DR7Q 4HIDA 2D62A 1J6QA 1X65A 1GD7A 4GKJQ 3ER0A 3CAMA 1XMOQ 4GKKL 1CKNB 1A0IA 1PYSB 5M3MG 2YTVA 4A3JH 2R7FA 5FLXc 4GLAC 3CPFA 3CP0A 1PHJA 1TWGH 1A63A 4AYBE 4PZ7A 4JI5L 1EWIA 5C4JH 3T1YL 5IWAL 1X9NA 4DR2L 2RF4A 3U58A 3S1QH 4AQYQ 1HNXQ 2WP8J 1WCMG 1IBLQ 3PO3H 2OQKA 1WOCA 2BA1A 5LMUQ 4HIKA 3EIVA 3I4NH 3CCJA 4R4IA 4GOPA 3GTJH 3GD7A 4X62Q 4JCVE 5IE8A 2Z0SA 4P72A 3KJPA 3ULPA 4BY1H 2IT1A 4UY8C 1N9WA 1HZBA 5IYDH 4A3FH 2B29A 3I7FA 4DV2Q 5HY6A 4A3IG 3U4ZA 2JA7G 4OO1G 1WI5A 1N32L 1P8LA 4DK6C 1LM0A 2AWNA 4GLXA 4JYAL 1U5KA 3S15H 1L1OB 3CQZH 3I2ZA 3I4OA 2R93G 2NVXH 1SMXA 1JJCB 2NZOA 3K8AA 1PFSA 2ZM6L 1ASYA 3S1NH 3TS2A 4LFBL 1JJGA 1UEBA 2DUDA 1K73C 3SGIA 2UUBQ 2UUCQ 4OX9Q 2NVTH 3GTMH 2Z6KC 2UXCQ 2VQFL 4UP8A 4DV0L 1VQEA 3HOWH 3PF4A 3PSIA 4DR7L 1OXXK 3F2DA 3PO3G 1OXUA 1PH3A 1VQ9A 3M7NA 4GKJL 1C0AA 1QVFA 1XMOL 2KCTA 2R92H 2DGYA 3E0EA 5IP9H 3UDXA 3PIOA 1BBUA 2JA6G 3U4VA 1PYBA 4DR5Q 4JI6Q 4K0KQ 3H3VI 4GNXC 1HNXL 4DR1Q 1IBLL 4IPGA 2PQAB 3TS0A 3AFPA 1C7YA 4X6AH 5LMUL 3RN2A 3CF5A 3IRBA 1KD1C 4J15A 1EIFA 1B8AA 2MO0A 4X62L 2KBNA 1XNRQ 2HQLA 4KI0A 1W3SA 4A3EG 1TWAH 2I5HA 3HOXG 3CCQA 3CCUA 3RR5A 1VQDA 5AJ3Q 3S16H 4IFDG 3S2DH 2V1CC 4JBKA 4HJ8A 1CKMA 2K5VA 3HOVG 1GVPA 1LUZA 2EQSA 2RHQB 2OWOA 4B3MQ 2CWAA 3PO2H 1D8LA 1H95A 1EIYB 3BZCA 4BY7H 2OCEA 5IP7H 1D7QA 4DNIA 1S3OA 2UUCL 2UUBL 2UXCL 2LXKA 4YCUA 2C35B 5H1SE 4OX9L 1Y1WG 3HOZG 4POFA 5LMNQ 1VQNA 1X3GA 2K5HA 1JE5A 3G48A 3PUZA 5J3BA 3MEFA 3MXNB 3TEHB 3ULLA 5M5YH 3KFUA 1YBYA 4EX5A 4A93H 4QJFA 3A74A 5IYCG 3J81j 4IO9A 1XJVA 2E5LQ 4JI7Q 2JA8G 3HKZG 3M85A 4GOPC 1PVOA 3HFZB 4UP9A 4JBJA 4JI8Q 4DR5L 4UP7A 4JI6L 4K0KL 5C0XI 5BR8Q 2JEAI 2R7ZG 3UDFA 4IPHA 1YZ6A 2YTYA 4JI1Q 4DKAC 4LF5Q 2F4VQ 4DR1L 1E1TA 1O7IA 3E9HA 1HH2P 1MJCA 1MIUA 3FHWA 1HJPA 4P71A 2XTIA 3HKZE 4JG2A 5K36G 4OWXB 4AIMA 2PNHA 1X6OA 3BZKA 3HOUG 2WAQG 3CCLA 4IFDI 5JJIA 3PUXA 1XNRL 2VUMG 1ASZA 2OQ0A 2EXDA 1Q46A 5M3MH 2BH8A 1VQFA 2JQOA 2OTJA 2E2JH 4HJ7A 2A19A 5AJ3L 1PH2A 1I6HH 5GAHC 1GO3E 2WAQE 4O2DA 3BU2A 1WCMH 3CCSA 4R4CA 1K8AC 4B3ML 2K14A 1IBMQ 2N8NA 4LF8Q 1CKNA 1E7ZA 1HNZQ 1V9PA 4DV7Q 4DR4Q 4BBRG 2I0QA 2QGQA 5C44H 4X64L 3ERSX 1KHIA 1EUJA 1L2FA 3CC4A 1EOVA 3PV0A 2JA7H 5C44G 3PUYA 4JI7L 3DM3A 2E5LL 3CW2C 5HGQA 1MKHA 5GAGC 2VS1A 1CSPA 2K75A 4TQUS 3GDEA 2MFIA 2PI2E 4JI8L 3GTKH 2R93H 1I5FA 1WYDA 3F2CA 5BR8L 2RCNA 1OTCA 4JI2Q 1I50H 4LF5L 2F4VL 3AQQA 2VL6A 2CKZB 5M5XH 3AYHB 3RLFA 3J7ZC 1I94L 1X3FA 4PZ8A 1LTLA 3J80i 4A3MG 1E22A 4L5TA 4OONA 1SFOH 2LXJA 4OWTB 5FJ8G 1CSQA 3G4SA 4IPDA 3G71A 4A3LG 3UDGA 4LUZA 3STBC 2JA6H 1G6PA 1VQBA 4EQ5A 4QL5A 1XPRA 1VQCA 4JOIC 4C3JH 3CMAA 5M3FG 3JAMi 3A5UA 4AH6A 5E7NA 1KXLA 3M9BA 1IBML 4ALPA 1GM5A 4NXMQ 2YU9H 4LF8L 4MNOA 4DUZQ 1FVIA 1FL0A 2Q2HA 1HNZL 4DK3C 1JT8A 4DR4L 4DV3Q 1QUQA 1EYGA 4A3EH 2CQOA 5IY0A 4NXNQ 3HOXH 1UE7A 4A3KG 1J5EQ 4A3CG 3KF8B 3S17H 3E9IA 3PIPA 1KC8C 3CD6A 1VQHA 3J81c 2KHJA 1YHBA 2LSSA 3NBHB 2PQAA 3PUWA 4XIGS 3HOVH 3KJOA 2JE6I 1A8VA 1X54A 1NMFA 2K52A 3RLNA 3CPWA 4DV1Q 2AWOA 2Y0SE 3D31A 1HR0Q 1XPOA 4JI2L 3F2BA 3GO5A 1EQRA 1QVCA 1Y1WH 3HOZH 3KF6B 2ID0A 1TWHH 2HIVA 2NN6I 1VQ4A 4AQYL 2ZTCA 2VQEQ 3GTQH 3L0OA 4O0AA 2OTLA 3K7AH 2JA8H 5IYCH 4JC0A 1PA6A 3TQYA 5C0XG 3AFQA 1U0LA 1VS0A 1FJGQ 3D0FA 2R7ZH 1FGUA 1TWFH 1VQ5A 1S40A 1R9TH 3OW2A 2JJQA 5FLMG 2YTXA 4DV2L 1VQ6A 3CCEA 2NZHA 4A76A 4NPSA 4DUZL 1A62A 1PH9A 2ZJPA 3HOUH 3LGJA 2K50A 4DV3L 2VUMH 4YCVA 2KENA 4NXNL 1B70B 4HJAA 1Q12A 1J5EL 3CXCA 1PH4A 1M90C 3F8TA 4C3IH 4B3RQ 4JOIA 1OXTA 3W1BA 1Y1VG 4KHPQ 4DAYB 3I4MG 1V1QA 2HIXA 4DV1L 1TXYA 1L1OC 4AYBG 1JB7A 1BVSA 4YY3Q 4BBRH 1XNQQ 1CUKA 3RNUA 1PH7A 1AH9A 2RHSB 5GQOA 4JI3Q 3U50C 4YWLA 1SR3A 1UE5A 4X65Q 2VQEL 1YJ9A 1AE3A 4KLKA 3L2PA 4GLVB 4BA1I 1X3EA 2ZTEA 4P74A 1VQMA 2ZJRA 1FJGL 3UE0A 3S1MH 3G6EA 3KYHC 1SRUA 3M3YH 3KLWA 1SROA 2QA4A 4OXPA 4L5QA 1S72A 5M5WH 1LYLA 4A3MH 1Q81C 1YJWA 1VQ8A 1YITA 4R1JA 5FJ8H 2IY5B 1HNWQ 1G291 1NY4A 1XTDA 4DR6Q 1M1KC 3OTOQ 4A3LH 2A8VA 1K9MC 4L5SA 3H3VH 5LMNW 3VDYA 1NE3A 4XTCS 4B3RL 1YEZA 2ATWA 4R4OA 5M3FH 4HJ5A 5LMNL 1UWVA 2JEBI 4LUOA 4KHPL 1DGSA 5ELOA 4LF7Q 2JA5H 2CWPA 1QVGA 4WJ3M 5JJKA 4QY7A 1VCIA 2N3SA 5ELNA 1SE8A 1VQIA 4YY3L 1XNQL 2NVQH 5JJLA 3L7ZC 2H5XA 4LUVA 4ME3A 4IOAA 4A3CH 2AKWB 4A3KH 1P16A 1SLJA 4Y7NH 4IJHA 4JI1L 4JI3L 4BXXG 5JEAG 1VQKA 1NTGA 2VY3A 3DLLA 3CCVA 3CC2A 1GKHA 2B63G 3EN2A 3JC66 4H02A 2JA9A 1L1OA 1VQLA 4LFBQ 4GN5A 1I94Q 3T1HQ 4OWWB 2IHFA 4GNXB 2UUAQ 2UXDQ 1G51A 4LF4Q 2NN6G 4APVA 1JJ2A 1IZ6A 4DPGA 4P73A 1T9HA 4LF9Q 1HNWL 3UDIA 3NEMA 5IT9c 2JA5G 4DR6L 3NENA 3OTOL 3RZDH 4LFAQ 4LNQA 4A3BG 3GTLH 4A3DG 4MTNA 4DR3Q 3TREA 2K5NA 4LW1A 4B3TQ 4DV7L 1QZHA 2UU9Q 1Q8KA 3K80C 3RN5A 1EFWA 1Q7YC 2ASBA 4BA2I 5C0XJ 1OXVA 3KF6A 3FKIG 5FLMH 4JI4Q 1YI2A 2Y0SG 3A5ZB 3KDFB 1JMCA 2MQHA 4LF7L 1Z9FA 1KRSA 1E24A 3NELA 1XMQQ 1Z47A 5IYBG 2D0OA 1E1OA 1YHQA 4IFDJ 1PH8A 4QGUA 2EIFA 4PG3A 4P75A 1IXRA 3ZJYC 1IBKQ 4BBSH 4C2MH 5C3EG 4YHHQ 4UPAA 4PMWA 4IJLA 4HJ9A 3STBD 4X66Q 2L15A 1HZCA 2FXQA 1KQSA 3EBEA 3H0GG 3I56A 4LF6Q 3RZOH 2WFWA 1Y1VH 3M4QA 5GROA 4RG1A 4HIOA 2E2HH 3ULJA 1XPUA 1AE2A 1K83H 4GOPB 3I4MH 2PMZE 1Q1EA 4GS3A 1K3RA 2ZTDA 4A3JG 3T1HL 5C4XG 2UUAL 2MO1A 2UXDL 2GN5A 2CCZA 2PI2A 4L5RC 2VNUD 1RL2A 2B3GA 1IYJB 3KOJA 3B6YA 1KL9A 1NMGA 4DUYQ 4LF9L 4PZ6A 1UE1A 2JK8A 2XGTA 2HHHQ 1VQGA 4DV6Q 4NXML 3I4NG 4LFAL 2UXBQ 1QUQB 4WJ4A 4DV4Q 2IX0A 1OXSC 3GTGH 3CCRA 4DR3L 3A0JA 1PH1A 4B3TL 1WJJA 3FP9A 3J81i 3I55A 3Q8DA 4IOCA 3S1RH 2YV5A 2UU9L 1VQ7A 4BY1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTP H;  4JI4 L;  2HT1 A;  5IYD G;  4BBS G;  4IPC A;  2K4K A;  3BJU A;  4A3F G;  1YVC A;  1EQQ A;  4LFC Q;  2VZA A;  1YNX A;  3M4O H;  1WFQ A;  4QQB X;  1XMQ L;  3TRZ A;  4JI0 Q;  1YIJ A;  4JBM A;  1UE6 A;  1YHA A;  2BH2 A;  4OO1 I;  1K0R A;  4FDB A;  1HR0 W;  2D0P A;  4RMF A;  1X56 A;  2GVA A;  2R6G A;  1L0W A;  3S24 A;  3W5O A;  4DV5 Q;  1IBK L;  2IX1 A;  1HR0 L;  4JV5 Q;  2BA0 A;  1YJN A;  4YHH L;  3PGZ A;  1IL2 A;  4X66 L;  4A4I A;  3H15 A;  1N36 Q;  4B3S Q;  4LF6 L;  3HOW G;  1SN8 A;  3K7U C;  5GAD C;  3PCO B;  1PH5 A;  4YCW A;  2IHE A;  1K8G A;  1N33 Q;  2VW9 A;  3K0X A;  5IP9 G;  1VQP A;  1N34 Q;  4JBW A;  1QZG A;  2R92 G;  3S14 H;  2KCM A;  4QIW E;  3HOY H;  4NB3 A;  1NBW A;  4DAM A;  4X64 Q;  3M4P A;  1VQO A;  4YWK A;  4DUY L;  2QEX A;  3AEV A;  2KHI A;  1HZA A;  2NVY H;  2HHH L;  4BXX H;  1PH6 A;  1BBW A;  4DV6 L;  2E8G A;  2UXB L;  1HZ9 A;  1VQJ A;  4DV4 L;  4A3G H;  2ZJQ A;  1E3P A;  2Q2I A;  5JEA J;  1VQA A;  2B63 H;  4GKK Q;  4HIM A;  3W1G A;  4LF4 L;  2F3I A;  4Y52 H;  3HKS A;  3F1Z A;  1C9O A;  3OYY A;  1B7Y B;  2Z6K A;  3PF5 A;  3T1Y Q;  4JI5 Q;  3RLO A;  2E2I H;  4LFC L;  5IWA Q;  1CKO A;  4DR2 Q;  2A1A A;  2AHO B;  3UE1 A;  4YWM A;  4JI0 L;  5GAE C;  1Q86 C;  2AMC B;  4R4T A;  1NJI C;  4TVA B;  2Q2U A;  2ES2 A;  1TWC H;  3WWV A;  3PO2 G;  1V43 A;  4A75 A;  3J80 c;  4A3B H;  1Q82 C;  4BY7 G;  4A3D H;  2N78 A;  5IP7 G;  2GVB A;  3CC7 A;  4DV5 L;  1MJE A;  1N8R C;  5DLQ E;  5C4X H;  2Q2T A;  4JV5 L;  2F52 A;  1W2B A;  4GNX A;  3PUV A;  4LWC A;  3HOY G;  2WB1 G;  1BKB A;  1N36 L;  4B3S L;  1KRT A;  4R4Q A;  2I5M X;  3FKI H;  1PV4 A;  2R7D A;  4GN3 B;  4C3H H;  4A93 G;  4X65 L;  1N32 Q;  1N33 L;  5IYB H;  3JAM c;  4JYA Q;  1RIP A;  2N49 A;  1N34 L;  3ICE A;  4POG A;  5EAY A;  3J7A 5;  4A3G G;  2WB1 E;  3S2H H;  1Q1B A;  4MZ9 A;  1Y14 B;  4KHZ A;  3CME A;  2ZM6 Q;  1X55 A;  2YYZ A;  2CFM A;  3K81 C;  4GN4 B;  2MNA A;  1KIX A;  5C3E H;  2I5L X;  1I3Q H;  4A3I H;  3CCM A;  2VQF Q;  1KAW A;  2ALY B;  3GTO H;  3H0G H;  3KDF A;  4DV0 Q;  4DR7 Q;  4HID A;  2D62 A;  1J6Q A;  1X65 A;  1GD7 A;  4GKJ Q;  3ER0 A;  3CAM A;  1XMO Q;  4GKK L;  1CKN B;  1A0I A;  1PYS B;  5M3M G;  2YTV A;  4A3J H;  2R7F A;  5FLX c;  4GLA C;  3CPF A;  3CP0 A;  1PHJ A;  1TWG H;  1A63 A;  4AYB E;  4PZ7 A;  4JI5 L;  1EWI A;  5C4J H;  3T1Y L;  5IWA L;  1X9N A;  4DR2 L;  2RF4 A;  3U58 A;  3S1Q H;  4AQY Q;  1HNX Q;  2WP8 J;  1WCM G;  1IBL Q;  3PO3 H;  2OQK A;  1WOC A;  2BA1 A;  5LMU Q;  4HIK A;  3EIV A;  3I4N H;  3CCJ A;  4R4I A;  4GOP A;  3GTJ H;  3GD7 A;  4X62 Q;  4JCV E;  5IE8 A;  2Z0S A;  4P72 A;  3KJP A;  3ULP A;  4BY1 H;  2IT1 A;  4UY8 C;  1N9W A;  1HZB A;  5IYD H;  4A3F H;  2B29 A;  3I7F A;  4DV2 Q;  5HY6 A;  4A3I G;  3U4Z A;  2JA7 G;  4OO1 G;  1WI5 A;  1N32 L;  1P8L A;  4DK6 C;  1LM0 A;  2AWN A;  4GLX A;  4JYA L;  1U5K A;  3S15 H;  1L1O B;  3CQZ H;  3I2Z A;  3I4O A;  2R93 G;  2NVX H;  1SMX A;  1JJC B;  2NZO A;  3K8A A;  1PFS A;  2ZM6 L;  1ASY A;  3S1N H;  3TS2 A;  4LFB L;  1JJG A;  1UEB A;  2DUD A;  1K73 C;  3SGI A;  2UUB Q;  2UUC Q;  4OX9 Q;  2NVT H;  3GTM H;  2Z6K C;  2UXC Q;  2VQF L;  4UP8 A;  4DV0 L;  1VQE A;  3HOW H;  3PF4 A;  3PSI A;  4DR7 L;  1OXX K;  3F2D A;  3PO3 G;  1OXU A;  1PH3 A;  1VQ9 A;  3M7N A;  4GKJ L;  1C0A A;  1QVF A;  1XMO L;  2KCT A;  2R92 H;  2DGY A;  3E0E A;  5IP9 H;  3UDX A;  3PIO A;  1BBU A;  2JA6 G;  3U4V A;  1PYB A;  4DR5 Q;  4JI6 Q;  4K0K Q;  3H3V I;  4GNX C;  1HNX L;  4DR1 Q;  1IBL L;  4IPG A;  2PQA B;  3TS0 A;  3AFP A;  1C7Y A;  4X6A H;  5LMU L;  3RN2 A;  3CF5 A;  3IRB A;  1KD1 C;  4J15 A;  1EIF A;  1B8A A;  2MO0 A;  4X62 L;  2KBN A;  1XNR Q;  2HQL A;  4KI0 A;  1W3S A;  4A3E G;  1TWA H;  2I5H A;  3HOX G;  3CCQ A;  3CCU A;  3RR5 A;  1VQD A;  5AJ3 Q;  3S16 H;  4IFD G;  3S2D H;  2V1C C;  4JBK A;  4HJ8 A;  1CKM A;  2K5V A;  3HOV G;  1GVP A;  1LUZ A;  2EQS A;  2RHQ B;  2OWO A;  4B3M Q;  2CWA A;  3PO2 H;  1D8L A;  1H95 A;  1EIY B;  3BZC A;  4BY7 H;  2OCE A;  5IP7 H;  1D7Q A;  4DNI A;  1S3O A;  2UUC L;  2UUB L;  2UXC L;  2LXK A;  4YCU A;  2C35 B;  5H1S E;  4OX9 L;  1Y1W G;  3HOZ G;  4POF A;  5LMN Q;  1VQN A;  1X3G A;  2K5H A;  1JE5 A;  3G48 A;  3PUZ A;  5J3B A;  3MEF A;  3MXN B;  3TEH B;  3ULL A;  5M5Y H;  3KFU A;  1YBY A;  4EX5 A;  4A93 H;  4QJF A;  3A74 A;  5IYC G;  3J81 j;  4IO9 A;  1XJV A;  2E5L Q;  4JI7 Q;  2JA8 G;  3HKZ G;  3M85 A;  4GOP C;  1PVO A;  3HFZ B;  4UP9 A;  4JBJ A;  4JI8 Q;  4DR5 L;  4UP7 A;  4JI6 L;  4K0K L;  5C0X I;  5BR8 Q;  2JEA I;  2R7Z G;  3UDF A;  4IPH A;  1YZ6 A;  2YTY A;  4JI1 Q;  4DKA C;  4LF5 Q;  2F4V Q;  4DR1 L;  1E1T A;  1O7I A;  3E9H A;  1HH2 P;  1MJC A;  1MIU A;  3FHW A;  1HJP A;  4P71 A;  2XTI A;  3HKZ E;  4JG2 A;  5K36 G;  4OWX B;  4AIM A;  2PNH A;  1X6O A;  3BZK A;  3HOU G;  2WAQ G;  3CCL A;  4IFD I;  5JJI A;  3PUX A;  1XNR L;  2VUM G;  1ASZ A;  2OQ0 A;  2EXD A;  1Q46 A;  5M3M H;  2BH8 A;  1VQF A;  2JQO A;  2OTJ A;  2E2J H;  4HJ7 A;  2A19 A;  5AJ3 L;  1PH2 A;  1I6H H;  5GAH C;  1GO3 E;  2WAQ E;  4O2D A;  3BU2 A;  1WCM H;  3CCS A;  4R4C A;  1K8A C;  4B3M L;  2K14 A;  1IBM Q;  2N8N A;  4LF8 Q;  1CKN A;  1E7Z A;  1HNZ Q;  1V9P A;  4DV7 Q;  4DR4 Q;  4BBR G;  2I0Q A;  2QGQ A;  5C44 H;  4X64 L;  3ERS X;  1KHI A;  1EUJ A;  1L2F A;  3CC4 A;  1EOV A;  3PV0 A;  2JA7 H;  5C44 G;  3PUY A;  4JI7 L;  3DM3 A;  2E5L L;  3CW2 C;  5HGQ A;  1MKH A;  5GAG C;  2VS1 A;  1CSP A;  2K75 A;  4TQU S;  3GDE A;  2MFI A;  2PI2 E;  4JI8 L;  3GTK H;  2R93 H;  1I5F A;  1WYD A;  3F2C A;  5BR8 L;  2RCN A;  1OTC A;  4JI2 Q;  1I50 H;  4LF5 L;  2F4V L;  3AQQ A;  2VL6 A;  2CKZ B;  5M5X H;  3AYH B;  3RLF A;  3J7Z C;  1I94 L;  1X3F A;  4PZ8 A;  1LTL A;  3J80 i;  4A3M G;  1E22 A;  4L5T A;  4OON A;  1SFO H;  2LXJ A;  4OWT B;  5FJ8 G;  1CSQ A;  3G4S A;  4IPD A;  3G71 A;  4A3L G;  3UDG A;  4LUZ A;  3STB C;  2JA6 H;  1G6P A;  1VQB A;  4EQ5 A;  4QL5 A;  1XPR A;  1VQC A;  4JOI C;  4C3J H;  3CMA A;  5M3F G;  3JAM i;  3A5U A;  4AH6 A;  5E7N A;  1KXL A;  3M9B A;  1IBM L;  4ALP A;  1GM5 A;  4NXM Q;  2YU9 H;  4LF8 L;  4MNO A;  4DUZ Q;  1FVI A;  1FL0 A;  2Q2H A;  1HNZ L;  4DK3 C;  1JT8 A;  4DR4 L;  4DV3 Q;  1QUQ A;  1EYG A;  4A3E H;  2CQO A;  5IY0 A;  4NXN Q;  3HOX H;  1UE7 A;  4A3K G;  1J5E Q;  4A3C G;  3KF8 B;  3S17 H;  3E9I A;  3PIP A;  1KC8 C;  3CD6 A;  1VQH A;  3J81 c;  2KHJ A;  1YHB A;  2LSS A;  3NBH B;  2PQA A;  3PUW A;  4XIG S;  3HOV H;  3KJO A;  2JE6 I;  1A8V A;  1X54 A;  1NMF A;  2K52 A;  3RLN A;  3CPW A;  4DV1 Q;  2AWO A;  2Y0S E;  3D31 A;  1HR0 Q;  1XPO A;  4JI2 L;  3F2B A;  3GO5 A;  1EQR A;  1QVC A;  1Y1W H;  3HOZ H;  3KF6 B;  2ID0 A;  1TWH H;  2HIV A;  2NN6 I;  1VQ4 A;  4AQY L;  2ZTC A;  2VQE Q;  3GTQ H;  3L0O A;  4O0A A;  2OTL A;  3K7A H;  2JA8 H;  5IYC H;  4JC0 A;  1PA6 A;  3TQY A;  5C0X G;  3AFQ A;  1U0L A;  1VS0 A;  1FJG Q;  3D0F A;  2R7Z H;  1FGU A;  1TWF H;  1VQ5 A;  1S40 A;  1R9T H;  3OW2 A;  2JJQ A;  5FLM G;  2YTX A;  4DV2 L;  1VQ6 A;  3CCE A;  2NZH A;  4A76 A;  4NPS A;  4DUZ L;  1A62 A;  1PH9 A;  2ZJP A;  3HOU H;  3LGJ A;  2K50 A;  4DV3 L;  2VUM H;  4YCV A;  2KEN A;  4NXN L;  1B70 B;  4HJA A;  1Q12 A;  1J5E L;  3CXC A;  1PH4 A;  1M90 C;  3F8T A;  4C3I H;  4B3R Q;  4JOI A;  1OXT A;  3W1B A;  1Y1V G;  4KHP Q;  4DAY B;  3I4M G;  1V1Q A;  2HIX A;  4DV1 L;  1TXY A;  1L1O C;  4AYB G;  1JB7 A;  1BVS A;  4YY3 Q;  4BBR H;  1XNQ Q;  1CUK A;  3RNU A;  1PH7 A;  1AH9 A;  2RHS B;  5GQO A;  4JI3 Q;  3U50 C;  4YWL A;  1SR3 A;  1UE5 A;  4X65 Q;  2VQE L;  1YJ9 A;  1AE3 A;  4KLK A;  3L2P A;  4GLV B;  4BA1 I;  1X3E A;  2ZTE A;  4P74 A;  1VQM A;  2ZJR A;  1FJG L;  3UE0 A;  3S1M H;  3G6E A;  3KYH C;  1SRU A;  3M3Y H;  3KLW A;  1SRO A;  2QA4 A;  4OXP A;  4L5Q A;  1S72 A;  5M5W H;  1LYL A;  4A3M H;  1Q81 C;  1YJW A;  1VQ8 A;  1YIT A;  4R1J A;  5FJ8 H;  2IY5 B;  1HNW Q;  1G29 1;  1NY4 A;  1XTD A;  4DR6 Q;  1M1K C;  3OTO Q;  4A3L H;  2A8V A;  1K9M C;  4L5S A;  3H3V H;  5LMN W;  3VDY A;  1NE3 A;  4XTC S;  4B3R L;  1YEZ A;  2ATW A;  4R4O A;  5M3F H;  4HJ5 A;  5LMN L;  1UWV A;  2JEB I;  4LUO A;  4KHP L;  1DGS A;  5ELO A;  4LF7 Q;  2JA5 H;  2CWP A;  1QVG A;  4WJ3 M;  5JJK A;  4QY7 A;  1VCI A;  2N3S A;  5ELN A;  1SE8 A;  1VQI A;  4YY3 L;  1XNQ L;  2NVQ H;  5JJL A;  3L7Z C;  2H5X A;  4LUV A;  4ME3 A;  4IOA A;  4A3C H;  2AKW B;  4A3K H;  1P16 A;  1SLJ A;  4Y7N H;  4IJH A;  4JI1 L;  4JI3 L;  4BXX G;  5JEA G;  1VQK A;  1NTG A;  2VY3 A;  3DLL A;  3CCV A;  3CC2 A;  1GKH A;  2B63 G;  3EN2 A;  3JC6 6;  4H02 A;  2JA9 A;  1L1O A;  1VQL A;  4LFB Q;  4GN5 A;  1I94 Q;  3T1H Q;  4OWW B;  2IHF A;  4GNX B;  2UUA Q;  2UXD Q;  1G51 A;  4LF4 Q;  2NN6 G;  4APV A;  1JJ2 A;  1IZ6 A;  4DPG A;  4P73 A;  1T9H A;  4LF9 Q;  1HNW L;  3UDI A;  3NEM A;  5IT9 c;  2JA5 G;  4DR6 L;  3NEN A;  3OTO L;  3RZD H;  4LFA Q;  4LNQ A;  4A3B G;  3GTL H;  4A3D G;  4MTN A;  4DR3 Q;  3TRE A;  2K5N A;  4LW1 A;  4B3T Q;  4DV7 L;  1QZH A;  2UU9 Q;  1Q8K A;  3K80 C;  3RN5 A;  1EFW A;  1Q7Y C;  2ASB A;  4BA2 I;  5C0X J;  1OXV A;  3KF6 A;  3FKI G;  5FLM H;  4JI4 Q;  1YI2 A;  2Y0S G;  3A5Z B;  3KDF B;  1JMC A;  2MQH A;  4LF7 L;  1Z9F A;  1KRS A;  1E24 A;  3NEL A;  1XMQ Q;  1Z47 A;  5IYB G;  2D0O A;  1E1O A;  1YHQ A;  4IFD J;  1PH8 A;  4QGU A;  2EIF A;  4PG3 A;  4P75 A;  1IXR A;  3ZJY C;  1IBK Q;  4BBS H;  4C2M H;  5C3E G;  4YHH Q;  4UPA A;  4PMW A;  4IJL A;  4HJ9 A;  3STB D;  4X66 Q;  2L15 A;  1HZC A;  2FXQ A;  1KQS A;  3EBE A;  3H0G G;  3I56 A;  4LF6 Q;  3RZO H;  2WFW A;  1Y1V H;  3M4Q A;  5GRO A;  4RG1 A;  4HIO A;  2E2H H;  3ULJ A;  1XPU A;  1AE2 A;  1K83 H;  4GOP B;  3I4M H;  2PMZ E;  1Q1E A;  4GS3 A;  1K3R A;  2ZTD A;  4A3J G;  3T1H L;  5C4X G;  2UUA L;  2MO1 A;  2UXD L;  2GN5 A;  2CCZ A;  2PI2 A;  4L5R C;  2VNU D;  1RL2 A;  2B3G A;  1IYJ B;  3KOJ A;  3B6Y A;  1KL9 A;  1NMG A;  4DUY Q;  4LF9 L;  4PZ6 A;  1UE1 A;  2JK8 A;  2XGT A;  2HHH Q;  1VQG A;  4DV6 Q;  4NXM L;  3I4N G;  4LFA L;  2UXB Q;  1QUQ B;  4WJ4 A;  4DV4 Q;  2IX0 A;  1OXS C;  3GTG H;  3CCR A;  4DR3 L;  3A0J A;  1PH1 A;  4B3T L;  1WJJ A;  3FP9 A;  3J81 i;  3I55 A;  3Q8D A;  4IOC A;  3S1R H;  2YV5 A;  2UU9 L;  1VQ7 A;  4BY1 G; 
#chains in the Genus database with same CATH topology
 4KTA A;  3VYT A;  2XVS A;  3RUZ A;  3M4O H;  4RAU C;  4IUN A;  1YHA A;  3EQL C;  4RKL A;  4FO2 A;  1X56 A;  2GVA A;  2R6G A;  5CV5 A;  2WB1 B;  3W5O A;  1IW7 C;  5T1I A;  1G2T A;  1IL2 A;  3NK9 A;  1GJX A;  2F3V A;  2WV6 D;  5I9O A;  4B3S Q;  4LF6 L;  1SN8 A;  5GAD C;  3QOL A;  3K5M A;  2QIL A;  2VW9 A;  1N34 Q;  4JBW A;  4F87 A;  1EIG A;  1ET9 A;  1SYF A;  1NBW A;  3X3M A;  4X64 Q;  4B9W A;  3MWY W;  4DUY L;  1S5B D;  2QEX A;  4BXX H;  1SNC A;  3TZU A;  1BBW A;  1CK1 A;  4DV6 L;  1KNA A;  5M3M B;  4DV4 L;  1Z7T A;  2Q8T A;  2EXZ A;  5IOC A;  2ZJQ A;  5JEA J;  4HIM A;  3ERO A;  1I6H B;  3HKS A;  3F1Z A;  2F0U A;  3OYY A;  3NQT A;  3MC0 B;  3VYR A;  2E2I H;  4LFC L;  5IWA Q;  1CKO A;  2A1A A;  4R8I A;  4JI0 L;  1SSO A;  4TVA B;  1TWC H;  4XQJ A;  1TKW B;  3BVG A;  4DV5 L;  3K58 A;  4J1M A;  5C4X H;  1DJR D;  2F0M A;  2F52 A;  3EJI A;  4MIU A;  4GNX A;  2F0D A;  2RDH A;  3PUV A;  1W2B A;  3HOY G;  2WB1 G;  4L63 B;  2VXW A;  2R7D A;  2SNM A;  4C3H H;  2DN8 A;  2N49 A;  3ICE A;  5EAY A;  4A3G G;  1I50 B;  4EQP A;  1Y14 B;  3CME A;  5KGU A;  1PTO B;  1SYC A;  1X55 A;  2CFM A;  4GN4 B;  1KIX A;  5C3E H;  2I5L X;  1SFO B;  2RBM A;  1PRT C;  3VA5 A;  1DXM A;  3T56 B;  4FF4 A;  2ALY B;  3H0G H;  3KDF A;  4HAE A;  4HID A;  3ND9 A;  1GD7 A;  3OMC A;  4XXE A;  5M3M G;  4A3J H;  1QIL A;  4JI5 L;  5C4J H;  3U58 A;  3S1Q H;  2YU9 B;  1IBL Q;  3BVM A;  3OHX C;  5LHY 1;  4RWS C;  3CCJ A;  4GOP A;  4A3E B;  1VF7 A;  1HQR D;  3HOX B;  3GD7 A;  1BCP D;  1SNQ A;  3OWE B;  5EKI A;  5IYD H;  1CA5 A;  2DY8 A;  3I7F A;  1ML0 D;  4DV2 Q;  1ICF B;  4A3F H;  3G7L A;  1WI5 A;  1N32 L;  2QF7 A;  4GLX A;  4JYA L;  2A5H A;  5IT9 E;  1JJC B;  1RKN A;  2L4N A;  3K8A A;  1PFS A;  2M2L A;  4LFB L;  1JJG A;  4OX9 Q;  1AW7 A;  4UP8 A;  3K7A B;  3PF4 A;  3HOW H;  2F0S A;  3PSI A;  3PO3 G;  4GKJ L;  1B3Q A;  1QVF A;  3EFX D;  2KEC A;  1S4Z A;  4K5X A;  4DAV A;  3E0E A;  2R7Z B;  2FFK B;  4K0K Q;  2FMC A;  4DN4 M;  4DR1 Q;  2F0V A;  2WAQ B;  3AFP A;  4ZYS A;  3S1R B;  3CF5 A;  5J22 A;  3IRB A;  1KD1 C;  1EIF A;  2MO0 A;  1PTO D;  2VB3 X;  4N9T A;  4X62 L;  3R3O A;  1XNR Q;  1KDC A;  4A3E G;  2I5H A;  3HOX G;  2RQX A;  3W2D A;  1SYE A;  2JYO A;  3J7A F;  1HUM A;  1VQD A;  4JBK A;  3MXP A;  2O5J C;  2ZT9 C;  2K5V A;  5IT9 L;  1GVP A;  1EWH A;  3NWT A;  4BY7 H;  4DNI A;  2LXK A;  2EY5 A;  5D14 A;  4POF A;  5LMN Q;  3K5O A;  2E76 C;  3PUZ A;  3KFU A;  4EX5 A;  4QJF A;  5IYC G;  3HFZ B;  4UP7 A;  3K57 A;  3M3Y B;  5C0X I;  4KN4 C;  5BR8 Q;  2R7Z G;  2RCF A;  4DK0 A;  4IPH A;  2YTY A;  4JI1 Q;  2D5D A;  4EQN A;  3PIO 3;  5C44 H;  3E9H A;  1I94 Q;  4P71 A;  5JPN C;  1HJP A;  5KYL A;  4IFD I;  2WAQ G;  4J8Q A;  3PUX A;  2EXD A;  1Q46 A;  2VB2 X;  3H94 A;  3I90 A;  2BH8 A;  1VQF A;  5M3F B;  2OTJ A;  1GUW A;  4HJ7 A;  5AJ3 L;  5GAH C;  3KLS X;  4S3S A;  2N8N A;  4I7Z C;  2EVB A;  5ELD A;  1CKN A;  1E7Z A;  4IUR A;  2K1B A;  4DV7 Q;  4DR4 Q;  2Y0S B;  4QF4 A;  3PV0 A;  1LAB A;  3DM3 A;  3NQI A;  2RSO A;  1MKH A;  5HGQ A;  3DWQ A;  1ILP A;  1C48 A;  4TQU S;  3E3X A;  1JWU D;  2MFI A;  3GDE A;  4R9W A;  4JI8 L;  5E1F A;  3GTK H;  1I5F A;  2R93 H;  1GHJ A;  4G7Z C;  4JI2 Q;  1OTC A;  3W3A A;  2F4V L;  3AQQ A;  4K8I A;  2VL6 A;  1H95 A;  1I4R A;  4RFB A;  3SE0 A;  2MP1 A;  4A3M G;  1JQY D;  5FJ8 G;  2RA4 A;  4RCO A;  2EZV A;  4G4K A;  1XPR A;  3MA2 B;  1VQC A;  4M1U B;  2XWJ B;  5M3F G;  1EOT A;  5E7N A;  1RD9 D;  3OSO A;  5KND A;  4NXM Q;  1MGS A;  4MNO A;  4BY1 B;  2Q2H A;  4DK3 C;  1IKM A;  4ABN A;  5IY0 A;  2MJ8 A;  1Y1V B;  3QG1 A;  3I4M B;  3PUW A;  2LSS A;  1F2M A;  4CJ0 B;  3KJO A;  1A8V A;  1M8A A;  1B4O A;  1SNP A;  5CV7 A;  1HR0 Q;  2MPM A;  1EU3 A;  1Y1W H;  1PTO C;  3HOZ H;  1CM9 A;  2ID0 A;  1TWH H;  4K2L A;  1VQ4 A;  1QWY A;  2VQE Q;  3L0O A;  3GTG B;  2JA8 H;  3A7L A;  5EKL A;  1F9P A;  5EJW A;  5C0X G;  1Y8P B;  1U0L A;  4EQO A;  1LTR D;  1FJG Q;  2B2W C;  3C1F A;  2NYZ D;  4KK7 A;  3M4O B;  1TWF H;  1U4M A;  4ZK9 B;  2NZ1 D;  3T13 A;  1R9T H;  2JJQ A;  3J81 E;  4CKC A;  2EYL A;  1PZJ D;  4A76 A;  3I70 A;  2B2Y A;  5FLX L;  2VUM H;  4YCV A;  2KEN A;  1J5E L;  1PH4 A;  1E2Z A;  3P7J A;  3MZ5 A;  3PO2 B;  4JOI A;  3BDL A;  4DA2 A;  3U9S A;  4WOR A;  1Y1V G;  4HTH A;  1NR2 A;  4DAY B;  3I4M G;  3DWP A;  3J7A V;  3PIP 3;  4DV1 L;  2EJM A;  1TXY A;  1JB7 A;  4BBR H;  1XNQ Q;  1CUK A;  1MSH A;  1PH7 A;  1GOZ A;  1KLG D;  4BWG B;  3U50 C;  4DF7 A;  3VYU A;  3T4A C;  1I4H A;  3NWS A;  3C1E A;  3SR1 A;  3NTH A;  5HGT A;  3UE0 A;  2E2I B;  3IL8 A;  4YIJ A;  1DD2 A;  1SRU A;  1SRO A;  1CI3 M;  5IGC A;  4C3I G;  1TWC B;  1YJW A;  3KUP A;  3TSS A;  1HNW Q;  2IY5 B;  1HTL D;  1G29 1;  1NY4 A;  2KHS A;  3OTO Q;  4G7H C;  4A3L H;  1F2Z A;  1K9M C;  4L5S A;  1WCM B;  4IAL A;  3ITP A;  3QOJ A;  3VDY A;  1NE3 A;  4B3R L;  4C3H B;  5EKK A;  5FO7 B;  1RCV D;  3SK8 A;  1LV9 A;  1ET6 A;  1HPC A;  1TU2 B;  4NW2 A;  3HZX A;  5ELO A;  3D4D A;  4LF7 Q;  2CWP A;  1SNO A;  1VQI A;  4YY3 L;  2H5X A;  4IOA A;  4FF1 A;  3Q23 A;  3T53 B;  3FMC A;  3H0G B;  4IJH A;  4BXX G;  4DNR B;  4PNY A;  4KV6 A;  1GKH A;  4A3J B;  3NUC A;  4XT1 B;  3EN2 A;  3JC6 6;  4ZKC B;  1O78 A;  1STY A;  5C4J B;  5I9P A;  3S1Q B;  3OIP A;  1ESF A;  2CQA A;  1JJ2 A;  1IZ6 A;  3R93 A;  2QW7 A;  4F88 A;  3NEM A;  5IT9 c;  1GUN A;  3LWU A;  4LFA Q;  3SEB A;  4LNQ A;  5BN5 A;  4DR3 Q;  1FNU A;  4LW1 A;  5C4X G;  2ASB A;  2UU9 Q;  1EFW A;  3K80 C;  4A3F B;  1Q7Y C;  5ELB A;  4BA2 I;  3L9A X;  4CGY B;  4Q5V A;  4DU9 A;  4IN3 A;  4JI4 Q;  1R4P B;  4C3H G;  3FPP A;  1T5E A;  3NEL A;  4RGO S;  1EY9 A;  1Z47 A;  1YHQ A;  1PH8 A;  4QGU A;  2EIF A;  4KY5 A;  1YNJ D;  2CH4 W;  2R61 A;  4I65 A;  1SMY D;  3HG9 A;  1IBK Q;  3HOW B;  5C3E G;  4IJL A;  3VR2 A;  4X66 Q;  5COY A;  2L15 A;  2FXQ A;  1KQS A;  3H0G G;  3RZO H;  1B44 D;  4UAI A;  3M4Q A;  2C9O A;  3GTQ H;  3ULJ A;  1AE2 A;  2PMZ E;  4GS3 A;  1K3R A;  1F9S A;  4A3J G;  5EGT A;  1LT6 D;  2E74 C;  5DAU A;  2GN5 A;  3V2T A;  1IYJ B;  3DMU A;  4ME5 A;  3B6Y A;  1PYW D;  1SAP A;  2XRS D;  3C3L A;  4LF9 L;  1UAP A;  1UE1 A;  2JK8 A;  4DXF A;  2F0G A;  2UXB Q;  4WJ4 A;  2IX0 A;  1STN A;  1DOL A;  3I55 A;  3J81 i;  4IOC A;  3S1R H;  1VQ7 A;  1EWC A;  2HT1 A;  5IYD G;  3I91 A;  4IPC A;  4BBS G;  4A3F G;  1LAC A;  4QQB X;  2Z1C A;  2BH2 A;  1ROD A;  2RDF A;  1AP0 A;  2D0P A;  2KUM A;  2A68 D;  4RMF A;  3E6Z X;  4JV5 Q;  2IX1 A;  2F0E A;  1B9M A;  3H15 A;  1TVX A;  5CBE E;  3HOW G;  4EVO A;  1ENC A;  4FF3 A;  1SJH D;  3MFG A;  1PH5 A;  1D6E C;  2IHE A;  5KRU A;  1N33 Q;  1VQP A;  3VR5 A;  3S9W A;  3V05 A;  3S14 H;  1H9S A;  1XWE A;  1CT1 D;  4NKL A;  3AB9 A;  5C44 B;  1FNV A;  3P1H A;  1ZYR C;  4ZQ3 A;  2KHI A;  2NVY H;  3H6M A;  1BNZ A;  5JEA H;  1PH6 A;  2HHH L;  1HZ9 A;  1WTX A;  4GKK Q;  2X69 A;  2NB0 A;  4LF4 L;  1C9O A;  1B7Y B;  2Z6K A;  2NN6 H;  4CKB A;  1M4V A;  2DNC A;  3UE1 A;  4YWM A;  1NJI C;  1AFP A;  2AMC B;  1EZ6 A;  1RJT A;  4O42 A;  1PFB A;  4K5V A;  3QJY A;  4A75 A;  4H13 C;  4A3B H;  4BY7 G;  4A3D H;  1MJE A;  4OEL B;  2Q2T A;  1NNX A;  2B2U A;  3P75 A;  4G7O C;  4B3S L;  2K5Q A;  1PV4 A;  2AUJ D;  4X65 L;  3GTK B;  3I4L A;  5FKA C;  5JJZ A;  4A3K B;  3CU7 A;  2EYH A;  1N34 L;  4ZKB B;  4POG A;  2WB1 E;  4MZ9 A;  2F0T A;  3ND8 A;  2JN4 A;  2WII B;  2ZM6 Q;  2MGS A;  4O1N A;  4RCN A;  4A3I H;  2L55 A;  1XXG A;  2LS0 1;  4DR7 Q;  3WOE A;  1J6Q A;  1X65 A;  1R4Q B;  3ER0 A;  3J80 E;  1G6Z A;  1PYS B;  4TSS A;  4HCE A;  5FLX c;  1S5F D;  3TBI B;  3CPF A;  3CP0 A;  1I6V C;  4CHT B;  5KNC A;  5IWA L;  2A69 C;  1IYV A;  1SMY C;  5LMU Q;  3EIV A;  1PRT F;  3JAM E;  1PFN A;  4R4I A;  1KDA A;  1E0B A;  4PMB A;  1FD7 D;  3ULP A;  4BY1 H;  2IT1 A;  4UY8 C;  2HDL A;  1B50 A;  4I7A A;  5AFW A;  2PNR C;  4DK6 C;  2AWN A;  2QDL A;  4KJO A;  3I4O A;  2BOS A;  3KLS A;  2R93 G;  2NVX H;  2G9D A;  2K33 A;  3HOZ B;  3NXW A;  1ASY A;  1TWH B;  1BXT A;  2NVT H;  2UUB Q;  3BVZ A;  1PDQ A;  2AQ1 B;  2J0T D;  4CJ2 C;  3F2D A;  1OXU A;  2KCT A;  2R92 H;  2DGY A;  3UDX A;  1JE4 A;  2Q8I B;  1TWF B;  3U4V A;  1PYB A;  4DR5 Q;  1R9T B;  1U9R A;  1HFG A;  2B2T A;  3VA7 A;  2A68 C;  1IBL L;  1SXT A;  5IGG A;  4X6A H;  4KHV A;  2VUM B;  3FDT A;  4ZUJ A;  2B2V A;  3C2P A;  2KBN A;  1W3S A;  2RSN A;  1TWA H;  1Q8I A;  4DGZ A;  3M4Y A;  3S2D H;  2V1C C;  2O2L D;  5L37 A;  1CKM A;  3P20 A;  1LUZ A;  4HSV A;  1K3B C;  3MTS A;  3PO2 H;  4BBR B;  4N9P A;  1EIY B;  1TQO A;  2OCE A;  5KYI A;  1K8M A;  5IGD A;  4YCU A;  4OX9 L;  2QKI C;  1Y1W G;  3HOZ G;  3SK5 A;  2B8F A;  1BCP B;  1X3G A;  3VR6 A;  3CPW A;  1JE5 A;  3CKI B;  5J3B A;  1JOR A;  3MXN B;  1SYD A;  2SEB D;  3J81 j;  4JI7 Q;  2JA8 G;  2E5L Q;  1MHW C;  2F0I A;  4K0K L;  1HRJ A;  4KMU C;  3UDF A;  3BDC A;  1PZI D;  1I4P A;  1YZ6 A;  1O80 A;  4RGT A;  4DR1 L;  1HH2 P;  2XTI A;  2KQ3 A;  3TDQ A;  2PNH A;  3BZK A;  3CCL A;  2L5T A;  1XNR L;  2VUM G;  1VMP A;  2E2J H;  4KY7 A;  2A19 A;  4IUT A;  2WAQ E;  4O2D A;  2Z4H A;  1WCM H;  3QB3 A;  4R4C A;  3CCS A;  2K14 A;  1IKL A;  1HNZ Q;  1V9P A;  4BBR G;  1B1Z A;  4XDX A;  4C56 C;  3CC4 A;  4OO1 H;  2IX3 A;  3FPU B;  2VS1 A;  1CSP A;  2K75 A;  4FF2 A;  1I3Q B;  1Q3L A;  3T51 B;  3F2C A;  1NCV A;  5BR8 L;  4HN7 A;  2FJ2 A;  1I94 L;  3J7Z C;  3LNN A;  3J80 i;  4OON A;  4OWT B;  1CSQ A;  3G4S A;  2L0C A;  2B2Y C;  4ZUI A;  3G71 A;  4A3L G;  3UDG A;  5DNF A;  2JA6 H;  1LLR D;  3DHQ A;  3SVM A;  5BN3 A;  4JOI C;  4C3J H;  3I4N B;  4P2C B;  4DK1 A;  3JAM i;  3A5U A;  2F0Q A;  4AH6 A;  1V1P A;  1KXL A;  2F0H A;  1GM5 A;  5LL6 S;  5KIX A;  4DUZ Q;  1FL0 A;  4DR4 L;  1EYG A;  2IPK D;  4XYO A;  4NXN Q;  1UE7 A;  1WD1 A;  1NUC A;  3KF8 B;  3RZO B;  1EU4 A;  3E9I A;  5IGE A;  1O7Z A;  3GTQ B;  4F7X A;  2KHJ A;  3NBH B;  2PQA A;  3A54 A;  4XIG S;  5NUC A;  1NMF A;  2D9U A;  2Y0S E;  3DM1 A;  3LX0 A;  3BG3 A;  4JI2 L;  3QIA A;  3F2B A;  2KVM A;  1EQR A;  4KY6 A;  3A7A B;  3DUZ A;  2NN6 I;  1K28 A;  4AQY L;  5IGF A;  2K05 A;  5CV9 A;  2OTL A;  4O0A A;  4LAA A;  4CKE A;  1EY6 A;  5KNB A;  1MI2 A;  5EBD A;  4CDC C;  3TQY A;  3AFQ A;  3D0F A;  4RH6 A;  1FGU A;  1EL0 A;  3OW2 A;  4E6I A;  2YTX A;  3KLR A;  2BDN A;  2NZH A;  5K36 H;  2CH4 A;  1PTO F;  4NPS A;  1A62 A;  1TS4 A;  4U67 3;  3HOU H;  1QNU A;  1NSN S;  4ZLT F;  1B3A A;  4HR7 B;  4HJA A;  2XWB B;  2A74 C;  3CXC A;  3SHL A;  1TS3 A;  5A2Q E;  3F8T A;  2JSO A;  5HUR A;  4TRD A;  1F9Q A;  1OXT A;  3W1B A;  2DJG C;  3S14 B;  2K32 A;  2HIX A;  5E3F A;  1F9R A;  5C6A A;  1WD0 A;  1EIH A;  1I4Q A;  2EYP A;  2NVY B;  1II3 A;  4JI3 Q;  4X3T A;  2VQE L;  1YJ9 A;  1HUN A;  1EY7 A;  1AE3 A;  3L2P A;  4GLV B;  1VQM A;  1FJG L;  2ZJR A;  1LTG D;  3S1M H;  1F2L A;  3KYH C;  2F0F A;  3KLW A;  2FIN B;  4A3B B;  1YIT A;  3RD4 A;  4A3D B;  3BYY B;  4DR6 Q;  5I2Y A;  2A8V A;  5LMN W;  3BDO A;  3D4W A;  4XTC S;  1YEZ A;  2ATW A;  4R4O A;  3CRL C;  1LO5 D;  3ONA B;  1UWV A;  4XT3 B;  1SEB D;  5C4Z A;  5C5L A;  2JA5 H;  2K01 A;  1LTI D;  1O7Y A;  4HMI A;  3HS0 C;  4G57 A;  4QY7 A;  5F2D A;  5JJK A;  1XNQ L;  4LUV A;  4ME3 A;  4A3I B;  2JA7 B;  4A3K H;  4Y7N H;  2ZXO A;  4H44 C;  1BCP C;  5JEA G;  2VY3 A;  3CCV A;  3CC2 A;  1LTA D;  1L1O A;  4LFB Q;  2IHF A;  4GNX B;  4R8N A;  2UXD Q;  2F03 A;  2NN6 G;  4APV A;  5FO9 B;  1EY0 A;  5EQ0 A;  3CHB D;  4DPG A;  1VMC A;  2F0L A;  1HNW L;  1ILQ A;  3OTO L;  3RZD H;  4A3B G;  2X6L A;  4A3D G;  1HFN A;  4DXG A;  2K5N A;  4B3T Q;  5J1Z A;  4NMZ A;  4KKS A;  3KF6 A;  2WAC A;  5C5M A;  2Y0S G;  3KDF B;  4LF7 L;  2QCP X;  4IUU A;  1JWS D;  2CW0 D;  3NPP A;  2JP1 A;  2A73 B;  1XMQ Q;  2NVX B;  4KKU A;  3E0J A;  1D5Z C;  2RKS A;  2NVT B;  4P75 A;  4L8J A;  2PPB C;  4QIW B;  2EY2 A;  3BS1 A;  4YHH Q;  4PMW A;  3STB D;  2X6G A;  1HZC A;  3EBE A;  1SYG A;  2R92 B;  1K83 H;  4GOP B;  1Q1E A;  2F3W A;  1A3T A;  1CHP D;  2PI2 A;  1YNN D;  2B3G A;  2IW3 A;  1KL9 A;  5M9O A;  1EEI D;  4EGV A;  1D2B A;  4LFA L;  1MD2 D;  1ZXT A;  3EA6 A;  1TWA B;  3CCR A;  4DR3 L;  1PH1 A;  1WJJ A;  2FHT A;  2B2U C;  2UU9 L;  2ICI A;  4BY1 G;  3S2D B;  5ELE A;  4JI4 L;  2XIW A;  3BJU A;  1SDF A;  1YNX A;  3D3R A;  5D3D A;  3TRZ A;  1UUP A;  4WFN 3;  4OO1 I;  1EZ8 A;  4XQN A;  4FDB A;  1HR0 W;  1QB5 D;  5JOB A;  2AQ2 B;  1PMR A;  3S24 A;  1L0W A;  1IBK L;  1YJN A;  3PGZ A;  4X66 L;  4A4I A;  1EYA A;  1N36 Q;  4OHJ A;  3D6W A;  4X3U A;  3K7U C;  1W6K A;  3PCO B;  1K8G A;  2R92 G;  3K0X A;  2KCM A;  4ODG A;  3HOY H;  1CTM A;  4NB3 A;  1JOQ A;  3NHH A;  4DAM A;  3J81 L;  4U68 A;  3NTI A;  1VQO A;  1JC7 A;  1HZA A;  4ILW A;  2UXB L;  1VQJ A;  4A3G H;  1E3P A;  2Q2I A;  1VQA A;  3QO2 A;  2E2J B;  3W1G A;  4Y52 H;  2F3I A;  3OMG A;  2KJX A;  2F0P A;  3T1Y Q;  2OF1 A;  1L0X B;  4DR2 Q;  2H4O A;  5GAE C;  1Q86 C;  4H0L C;  4R4T A;  1CHQ D;  4UDU C;  4K5W A;  4JPB W;  3TME A;  3WWV A;  3PO2 G;  1V43 A;  4MN3 A;  2GVB A;  3CC7 A;  4JV5 L;  5DLQ E;  1ENF A;  4ULL A;  5LL6 X;  2NWG A;  1KRT A;  2I5M X;  3FKI H;  5FO8 B;  1AZP A;  2N88 A;  2NVQ B;  1N33 L;  3NSW A;  1RIP A;  2PW5 A;  3S2H H;  3A8I E;  5EPK A;  5CV4 A;  2YYZ A;  1VDZ A;  1I3Q H;  2BDO A;  1ONL A;  2VQF Q;  2EY6 A;  3GTO H;  3Q22 A;  4DV0 Q;  3K59 A;  2D62 A;  2JA6 B;  1XMO Q;  4GKK L;  1CKN B;  1A0I A;  3R2T A;  1GUS A;  2R7F A;  4C3J B;  4GLA C;  3DWA A;  1A63 A;  4RGN A;  4PZ7 A;  1X9N A;  1EWI A;  3VR4 A;  4H7B A;  3IFT A;  3ZYY X;  2RF4 A;  2BE5 D;  5CV8 A;  1TII D;  1WTH A;  1WCM G;  3IKJ A;  1HNX Q;  2DJF C;  2OQK A;  3PO3 H;  5E4X A;  2BA1 A;  4HIK A;  3I4N H;  4K6D A;  5IE8 A;  2Z0S A;  4P72 A;  3KJP A;  1CQV A;  1N9W A;  1IL8 A;  1JR0 D;  2B29 A;  5HY6 A;  3U4Z A;  3A56 A;  2NTT A;  4OO1 G;  1WTP A;  1LM0 A;  4OL7 A;  4DFA A;  2LKV A;  2EOT A;  1L1O B;  3I2Z A;  4TKO B;  2WIN B;  2I07 B;  2NZO A;  4IUQ A;  2PZW A;  4LK1 C;  2ZM6 L;  2XN9 C;  1K73 C;  2UUC Q;  3SGI A;  2UXC Q;  1U4L A;  1E2V A;  1VQE A;  4AYB B;  4DR7 L;  1OXX K;  3HKZ B;  1PH3 A;  1VQ9 A;  1HCZ A;  3KBX A;  5IP9 H;  3I73 A;  3PIO A;  2JA6 G;  4JI6 Q;  1BO0 A;  1GUG A;  1C8C A;  4QB4 A;  4GNX C;  4C3J G;  5JPM C;  5G3L F;  3HOU B;  4ZRZ A;  3TS0 A;  5LMU L;  3RN2 A;  1B8A A;  1QJO A;  2HQL A;  4KI0 A;  4MHE A;  3H91 A;  3CCQ A;  2K28 A;  3RR5 A;  2QDB A;  2L1B A;  4N8F A;  2KA7 A;  2TSS A;  2EQS A;  4WJW A;  3OW7 A;  4B3M Q;  2CWA A;  3BZC A;  5IP7 H;  1D7Q A;  2UUB L;  2D2C C;  2C35 B;  4ZCK A;  4KD4 A;  1EYD A;  1VQN A;  4ZAI A;  1E2W A;  2K5H A;  5M5Y H;  2HDM A;  3OWF A;  3MXU A;  4A93 H;  1YBY A;  1C0A A;  3A74 A;  4QUF A;  5COR A;  3HKZ G;  4RA8 A;  3S1M B;  2PZU A;  4GOP C;  4UP9 A;  4JBJ A;  4DR5 L;  2KCN A;  2JEA I;  3TP7 A;  5C3X A;  4DKA C;  3NTK A;  4LF5 Q;  1SE3 A;  1E1T A;  1O7I A;  3FHW A;  1MJC A;  2B63 B;  1IW7 D;  4JG2 A;  1FR3 A;  5K36 G;  4QMG A;  4AIM A;  5JJI A;  3HOU G;  1KTK A;  2EJG C;  1CZW A;  1O7L A;  1TY0 A;  2IWH A;  1S5C D;  1PH2 A;  3V96 A;  1S5D D;  2JA5 B;  2L9H A;  1GO3 E;  1K8A C;  5JVH 3;  2V4D A;  1IBM Q;  1A2U A;  3OPO A;  1L0Y B;  4LF8 Q;  3IAY A;  1RHP A;  2B2W A;  3O13 A;  4Y7N B;  2I0Q A;  2QGQ A;  1G2S A;  1STH A;  1XX8 A;  4X64 L;  1STA A;  2J4X A;  2IJ0 A;  1EUJ A;  1L2F A;  1EOV A;  2JA7 H;  5C44 G;  4JI7 L;  2E5L L;  2KED A;  5GAG C;  5JAV A;  3N6R A;  4FXG C;  4XQQ A;  1BF4 A;  1WYD A;  4C1N K;  2CKZ B;  5M5X H;  3RLF A;  1SE2 A;  1X3F A;  4PZ8 A;  4V0B A;  3VR3 A;  1AZQ A;  2AQ3 B;  1E22 A;  4L5T A;  1YNJ C;  3RZD B;  2LXJ A;  1SBB B;  1TWG B;  1QE6 A;  1VQB A;  1TR5 A;  2WKC A;  3SK4 A;  4XYQ A;  2F1M A;  1I4X A;  1V8Q A;  3D8G A;  4ALP A;  4HSP A;  2F0J A;  1HNZ L;  4DV3 Q;  1QUQ A;  1SE4 A;  3M7G A;  2DY7 A;  4A3K G;  2EYF A;  3PIP A;  4IFD H;  3J81 c;  1K83 B;  3RMH A;  3HOV H;  1GUO A;  1Y69 U;  3J80 L;  2K52 A;  5IOD A;  2AWO A;  3D31 A;  1SNM A;  1CFM A;  3K5L A;  1QVC A;  1V1O A;  2HIV A;  2PO4 A;  3R2I A;  3JAM L;  4K8J A;  4JC0 A;  1PA6 A;  1K8O A;  1VS0 A;  1GHK A;  4N8X 1;  3L3O C;  1VQ5 A;  1S40 A;  2BCO A;  4Z9C B;  4DV2 L;  2ICE C;  5ISR A;  4DUZ L;  3PMF A;  2QEJ C;  2ZJP A;  1X32 A;  3A55 A;  4NXN L;  1B70 B;  1DOK A;  4C3I H;  3NE5 B;  3WDN A;  2RDG A;  4KHP Q;  1V1Q A;  5C3W A;  1LTS D;  2Z9H A;  3HOY B;  1JIC A;  1L1O C;  1BVS A;  1BBX C;  2EY1 A;  1WTO A;  3N52 A;  2P5Z X;  1ESR A;  1G91 A;  2KCC A;  1UNS A;  1CA6 A;  1SR3 A;  4X65 Q;  2G9H D;  4A3G B;  2AUK A;  4HMJ A;  2DNE A;  2ZTE A;  2J7Z A;  4KJN A;  1X3P A;  3I72 A;  4M8A A;  3GV3 A;  1STE A;  1ZKO A;  2EJF C;  3Q24 A;  3FRP B;  1S72 A;  2RVL A;  5M5W H;  1Q81 C;  3HP3 A;  1VQ8 A;  1D5M C;  1M1K C;  2A6H D;  1H9S B;  3H3V H;  1EY5 A;  3FKI B;  1LTT D;  2G5D A;  4L6T B;  4HJ5 A;  5LMN L;  2JEB I;  3URY A;  4LUO A;  3H09 A;  1QVG A;  3S2H B;  1U4R A;  4IUP A;  3SK6 A;  2N3S A;  1SND A;  2NVQ H;  3L7Z C;  1DCZ A;  4A3C H;  4RHR A;  4GZY C;  3GTO B;  1SLJ A;  4Q0F A;  4JI1 L;  2F0N A;  4JI3 L;  1VQK A;  1NTG A;  4OIJ A;  1WVL A;  1MSG A;  4RHS A;  1VQL A;  2F0O A;  1BDO A;  4GN5 A;  3T1H Q;  1A6X A;  2UUA Q;  2A6E D;  5A35 A;  1G51 A;  4LF4 Q;  3PO3 B;  1S5E D;  3TZD A;  1T9H A;  3UDI A;  3NBI A;  4DR6 L;  1BCP F;  3GTL H;  4FP5 D;  3TRE A;  1DOM A;  4DV7 L;  4CDF C;  1QZH A;  1Q8K A;  5K5P A;  3RN5 A;  2EYM A;  5D65 A;  5C0X J;  1WTR A;  3FKI G;  5FLM H;  3A5Z B;  4RKB A;  4JW0 A;  1TY2 A;  1KRS A;  4X3S A;  2B39 A;  3VYS A;  2D0O A;  1E1O A;  4IFD J;  3S17 B;  3FVQ A;  1GUT A;  1JOO A;  3ZJY C;  4BBS H;  1G8Z D;  4C2M H;  4CJ1 B;  4UPA A;  4PQX A;  4HJ9 A;  3GV6 A;  4LF6 Q;  3I56 A;  2WFW A;  1XPU A;  5GRO A;  4RG1 A;  1NR4 A;  4HIO A;  2SNS A;  2E2H H;  3HGB A;  3R8B A;  4IQZ A;  2MO1 A;  2UXD L;  1XTC D;  4L5R C;  1RL2 A;  4IZ8 A;  3KOJ A;  4DUY Q;  2XGT A;  1VQG A;  4DAY A;  4DV6 Q;  4NXM L;  3I4N G;  1QUQ B;  4DV4 Q;  3Q0A A;  1OXS C;  3A0J A;  4B3T L;  3Q8D A;  2YV5 A;  1WTQ A;  3GTP H;  2FMM A;  2K04 A;  2K4K A;  5D3I B;  1YVC A;  1EQQ A;  4LFC Q;  1K0S A;  2VZA A;  1WFQ A;  1VF5 C;  1XMQ L;  4JI0 Q;  1MBY A;  1DON A;  1YIJ A;  4JBM A;  1UE6 A;  1K0R A;  2Z8L A;  3F2U A;  1KLU D;  4HED A;  5EPL A;  4OIK A;  4DV5 Q;  1HR0 L;  2BA0 A;  3J7Y W;  1BQQ T;  3MXG A;  4YHH L;  3KK7 A;  5M5Y B;  2I46 A;  4RGM A;  4A93 B;  5KEE A;  2M9V A;  4IUV A;  4V19 0;  3HEJ A;  4YCW A;  1LTB D;  5IP9 G;  1QZG A;  3MAQ A;  2OXP A;  1FNW A;  4QIW E;  3DXJ C;  4FXK C;  3M4P A;  2A6H C;  4YWK A;  3AEV A;  2EYO A;  1EYC A;  2E8G A;  1TS5 A;  3GP7 A;  1CQF A;  2EDG A;  2B63 H;  2WKD A;  4JK1 C;  3I3C A;  5CGK A;  4A3M B;  5A2Q L;  5JVG 3;  3PF5 A;  4JI5 Q;  3RLO A;  2AHO B;  2LFN A;  5CC4 A;  2Q2U A;  2ES2 A;  1DYQ A;  1IYU A;  2Z6B A;  1XYI A;  3J80 c;  1Q82 C;  2N78 A;  5IP7 G;  1N8R C;  4LWC A;  1N36 L;  1BKB A;  4R4Q A;  4GN3 B;  3MEH A;  4A93 G;  4LJZ C;  2A6E C;  1N32 Q;  5IYB H;  3JAM c;  4JYA Q;  3BYT B;  3J7A 5;  2OT2 A;  1Q1B A;  2K03 A;  5M5X B;  4KHZ A;  2KOL A;  1BR9 A;  3K81 C;  2MNA A;  4JVZ A;  3T16 A;  3CCM A;  1RF2 D;  1KAW A;  2LMC B;  3UI2 A;  1EFI D;  4GKJ Q;  3CAM A;  2HQE A;  2YTV A;  1PHJ A;  1TWG H;  5E4W C;  3T1Y L;  4DR2 L;  1B9N A;  4AQY Q;  1C4Q A;  2WP8 J;  1WOC A;  1WTW A;  2CHB D;  1Y8O B;  2K5D A;  5I6W A;  3GTJ H;  4X62 Q;  4JCV E;  3EVQ A;  4CDD C;  4PV1 C;  2XNA C;  3FEW X;  2XRQ D;  1HZB A;  3HOV B;  2HCC A;  4PMC A;  4A3I G;  2JA7 G;  1P8L A;  1U5K A;  3S15 H;  1EEF D;  3CQZ H;  1U4P A;  2PYK A;  1SMX A;  2L11 A;  5FLX E;  3S1N H;  3TS2 A;  1UEB A;  1EY8 A;  2DUD A;  3GTM H;  3HRZ C;  2TMP A;  2Z6K C;  2VQF L;  3TP5 A;  1V1P B;  1H9R A;  3AU7 A;  4DV0 L;  3M7N A;  2CVR A;  1T5X D;  1XMO L;  1QNK A;  2K7V A;  1BBU A;  2NUC A;  1FGB D;  3H3V I;  1J8I A;  2PZT A;  4KN7 C;  3CRK C;  1HNX L;  4IPG A;  2PQA B;  1C7Y A;  3K6O A;  4UHV A;  1A15 A;  2ZXR A;  4J15 A;  4FNF A;  5DEH A;  1LT4 D;  4C3I B;  3CCU A;  1TS2 A;  1H9M A;  5AJ3 Q;  3S16 H;  4IFD G;  4FYD A;  2N55 A;  2IL8 A;  3HOV G;  2RHQ B;  2OWO A;  2EPB A;  1D8L A;  3LWE A;  4KKT A;  1S3O A;  2UUC L;  2UXC L;  5H1S E;  2PCF B;  4FVM A;  1B2T A;  1GXD C;  2K6A A;  2C5C A;  2GA4 B;  3G48 A;  3TEH B;  3MEF A;  3ULL A;  4IO9 A;  1KAB A;  1XJV A;  5C4H A;  4K2K A;  1STB A;  3M85 A;  3QR8 A;  3TN2 A;  4DNT B;  4JI8 Q;  1PVO A;  4JI6 L;  1A2T A;  1WTV A;  5M5W B;  3E5S A;  2F4V Q;  4AYB E;  1MIU A;  3HKZ E;  5IIF A;  4OWX B;  1Y8N B;  1F2Y A;  1J9O A;  1X6O A;  4WRD A;  1ASZ A;  2OQ0 A;  5M3M H;  1PLF A;  2JQO A;  1I6H H;  1KNE A;  3BU2 A;  2EYJ A;  4B3M L;  5C4X B;  1ZYR D;  4KD3 A;  5CBA E;  4B08 A;  2HUG A;  3I8Z A;  2PQE A;  3S16 B;  1D1K A;  2O4X A;  2B2T C;  3ERS X;  1KHI A;  1JB3 A;  3OOC A;  3PUY A;  1Z6H A;  2F0W A;  5I4D A;  1HHV A;  3CW2 C;  1W6J A;  1HA6 A;  5C3E B;  2PI2 E;  3AMU A;  1A3V A;  1BOS A;  2B2V C;  3X3N A;  2RCN A;  1FYC A;  3QWN A;  2CW0 C;  1I50 H;  5J39 A;  4LF5 L;  3MHB A;  3C46 A;  3AYH B;  1PTO H;  2MUY A;  1LTL A;  2XSC A;  4OEM B;  4F8M A;  4HCS A;  1SFO H;  3GTL B;  3A8J E;  1X3Q A;  4IPD A;  4LUZ A;  4OGQ C;  3STB C;  1G6P A;  4EQ5 A;  4QL5 A;  1QG7 A;  3CMA A;  1PFM A;  1HQM C;  5I6Y A;  5EPJ A;  4QCL A;  3M9B A;  1IBM L;  2NBF A;  2YU9 H;  1F77 A;  4LF8 L;  1FVI A;  1YNN C;  3U9O A;  1RDP D;  1JT8 A;  2PW7 A;  4BBS B;  4C2M B;  3KBG A;  5IGB A;  4A3E H;  2CQO A;  4A3C G;  3HOX H;  1J5E Q;  3S17 H;  1KC8 C;  3CD6 A;  1VQH A;  2E2H B;  1PZK D;  1YHB A;  1IHZ A;  2JE6 I;  1X54 A;  2E2D C;  1QOH A;  2HCI A;  3RLN A;  2A69 D;  4DV1 Q;  1BUV T;  1SJE D;  1XPO A;  3GO5 A;  4B9X A;  1PXU A;  2SOB A;  3WOF A;  5DM7 3;  3K0Y A;  3KF6 B;  4MTK A;  3TP8 A;  2EE1 A;  3G6J B;  3NP8 A;  4QUC A;  4X3K A;  2KEE A;  2ZTC A;  3D4R A;  3K7A H;  5IYC H;  3MVV A;  1ICW A;  3GTP B;  2R7Z H;  4C1N I;  1Q90 A;  1D5X C;  1B53 A;  2NTS A;  5FLM G;  1AN8 A;  5G3L D;  3SDZ A;  3CCE A;  1VQ6 A;  4ID6 A;  4K14 A;  3MXN A;  1PH9 A;  3LGJ A;  2K50 A;  4DV3 L;  3ERQ A;  1Q12 A;  1JOK A;  1M90 C;  1H9K A;  2JXM B;  3SXH A;  4B3R Q;  2M00 A;  5CR3 A;  4BY7 B;  1STG A;  4NDX A;  4AYB G;  4YY3 Q;  3RNU A;  1AH9 A;  2RHS B;  1PRT B;  1JCK B;  5GQO A;  4LMQ D;  1CZG A;  4YWL A;  1UE5 A;  5EBC A;  1HA5 A;  5ELC A;  4KLK A;  4BA1 I;  1X3E A;  4P74 A;  3OIQ A;  2L12 A;  5CV6 A;  3G6E A;  4CBV A;  4K6L A;  1LT3 D;  5FOB B;  2Q8R E;  5DM6 3;  3M3Y H;  1I4G A;  2QA4 A;  4OXP A;  4L5Q A;  1LYL A;  4A3M H;  4R1J A;  5FJ8 H;  4J6H A;  1XTD A;  2F0K A;  1ENA A;  5FK9 C;  5M3F H;  1RTN A;  4KHP L;  1DGS A;  3D6C A;  2E75 C;  5I2X A;  4WJ3 M;  2OEO A;  1VCI A;  5ELN A;  1SE8 A;  2PMZ B;  2B8G A;  2BE5 C;  4NP5 A;  1H9J A;  4BS9 A;  5JJL A;  2AKW B;  1P16 A;  2Z4I A;  2R93 B;  3DLL A;  3MFY A;  2H1E A;  2B63 G;  4H02 A;  2JA9 A;  1SYB A;  4OWW B;  3KF8 A;  1JWM D;  2K5W A;  3NBH A;  4P73 A;  5T1G A;  4LF9 Q;  3GTJ B;  2JA5 G;  3NEN A;  3GQB A;  3Q6S A;  1AEX A;  4MTN A;  1PRT D;  5C0X H;  3H3V C;  1DZ1 A;  1HTP A;  1KAA A;  3PQI A;  1RTO A;  1OXV A;  3TP6 A;  1YI2 A;  1JMC A;  1UEA B;  2MQH A;  3S15 B;  1Z9F A;  3CQZ B;  1E24 A;  3DEP A;  5IYB G;  3S1N B;  1EQV A;  1HXY D;  1ZEQ X;  2LY7 A;  4PG3 A;  3GTM B;  1IXR A;  1D1I A;  1DM0 B;  3IFD A;  1OO9 B;  3BZD B;  2ENB A;  1Y1V H;  5CMD A;  3I4M H;  5TSS A;  1Y1W B;  3A8K E;  2HD3 A;  1KDB A;  2ZTD A;  2ZXP A;  3T1H L;  2UUA L;  2F4I A;  4FXD A;  1LT5 D;  2CCZ A;  2O5I C;  5ELF A;  4DAP A;  1EY4 A;  3K5N A;  2VNU D;  1QCB D;  2JA8 B;  2MHV A;  4CDE C;  1NMG A;  4PZ6 A;  5CYU A;  2HHH Q;  1EQT A;  1A3U A;  2R3Z A;  2SDF A;  1TT2 A;  3GTG H;  1NAP A;  3FP9 A;  4HJ8 A;  5BN4 A;  3DEO A; 
#chains in the Genus database with same CATH homology
 3GTP H;  4JI4 L;  2HT1 A;  5IYD G;  4BBS G;  4IPC A;  2K4K A;  3BJU A;  4A3F G;  1YVC A;  1EQQ A;  4LFC Q;  2VZA A;  1YNX A;  3M4O H;  1WFQ A;  4QQB X;  1XMQ L;  3TRZ A;  4JI0 Q;  1YIJ A;  4JBM A;  1UE6 A;  1YHA A;  2BH2 A;  4OO1 I;  1K0R A;  4FDB A;  1HR0 W;  2D0P A;  4RMF A;  1X56 A;  2GVA A;  2R6G A;  1L0W A;  3S24 A;  3W5O A;  4DV5 Q;  1IBK L;  2IX1 A;  1HR0 L;  4JV5 Q;  2BA0 A;  1YJN A;  4YHH L;  3PGZ A;  1IL2 A;  4X66 L;  4A4I A;  3H15 A;  1N36 Q;  4B3S Q;  4LF6 L;  3HOW G;  1SN8 A;  3K7U C;  5GAD C;  3PCO B;  1PH5 A;  4YCW A;  2IHE A;  1K8G A;  1N33 Q;  2VW9 A;  3K0X A;  5IP9 G;  1VQP A;  1N34 Q;  4JBW A;  1QZG A;  2R92 G;  3S14 H;  2KCM A;  4QIW E;  3HOY H;  4NB3 A;  1NBW A;  4DAM A;  4X64 Q;  3M4P A;  1VQO A;  4YWK A;  4DUY L;  2QEX A;  3AEV A;  2KHI A;  1HZA A;  2NVY H;  2HHH L;  4BXX H;  1PH6 A;  1BBW A;  4DV6 L;  2E8G A;  2UXB L;  1HZ9 A;  1VQJ A;  4DV4 L;  4A3G H;  2ZJQ A;  1E3P A;  2Q2I A;  5JEA J;  1VQA A;  2B63 H;  4GKK Q;  4HIM A;  3W1G A;  4LF4 L;  2F3I A;  4Y52 H;  3HKS A;  3F1Z A;  1C9O A;  3OYY A;  1B7Y B;  2Z6K A;  3PF5 A;  3T1Y Q;  4JI5 Q;  3RLO A;  2E2I H;  4LFC L;  5IWA Q;  1CKO A;  4DR2 Q;  2A1A A;  2AHO B;  3UE1 A;  4YWM A;  4JI0 L;  5GAE C;  1Q86 C;  2AMC B;  4R4T A;  1NJI C;  4TVA B;  2Q2U A;  2ES2 A;  1TWC H;  3WWV A;  3PO2 G;  1V43 A;  4A75 A;  3J80 c;  4A3B H;  1Q82 C;  4BY7 G;  4A3D H;  2N78 A;  5IP7 G;  2GVB A;  3CC7 A;  4DV5 L;  1MJE A;  1N8R C;  5DLQ E;  5C4X H;  2Q2T A;  4JV5 L;  2F52 A;  1W2B A;  4GNX A;  3PUV A;  4LWC A;  3HOY G;  2WB1 G;  1BKB A;  1N36 L;  4B3S L;  1KRT A;  4R4Q A;  2I5M X;  3FKI H;  1PV4 A;  2R7D A;  4GN3 B;  4C3H H;  4A93 G;  4X65 L;  1N32 Q;  1N33 L;  5IYB H;  3JAM c;  4JYA Q;  1RIP A;  2N49 A;  1N34 L;  3ICE A;  4POG A;  5EAY A;  3J7A 5;  4A3G G;  2WB1 E;  3S2H H;  1Q1B A;  4MZ9 A;  1Y14 B;  4KHZ A;  3CME A;  2ZM6 Q;  1X55 A;  2YYZ A;  2CFM A;  3K81 C;  4GN4 B;  2MNA A;  1KIX A;  5C3E H;  2I5L X;  1I3Q H;  4A3I H;  3CCM A;  2VQF Q;  1KAW A;  2ALY B;  3GTO H;  3H0G H;  3KDF A;  4DV0 Q;  4DR7 Q;  4HID A;  2D62 A;  1J6Q A;  1X65 A;  1GD7 A;  4GKJ Q;  3ER0 A;  3CAM A;  1XMO Q;  4GKK L;  1CKN B;  1A0I A;  1PYS B;  5M3M G;  2YTV A;  4A3J H;  2R7F A;  5FLX c;  4GLA C;  3CPF A;  3CP0 A;  1PHJ A;  1TWG H;  1A63 A;  4AYB E;  4PZ7 A;  4JI5 L;  1EWI A;  5C4J H;  3T1Y L;  5IWA L;  1X9N A;  4DR2 L;  2RF4 A;  3U58 A;  3S1Q H;  4AQY Q;  1HNX Q;  2WP8 J;  1WCM G;  1IBL Q;  3PO3 H;  2OQK A;  1WOC A;  2BA1 A;  5LMU Q;  4HIK A;  3EIV A;  3I4N H;  3CCJ A;  4R4I A;  4GOP A;  3GTJ H;  3GD7 A;  4X62 Q;  4JCV E;  5IE8 A;  2Z0S A;  4P72 A;  3KJP A;  3ULP A;  4BY1 H;  2IT1 A;  4UY8 C;  1N9W A;  1HZB A;  5IYD H;  4A3F H;  2B29 A;  3I7F A;  4DV2 Q;  5HY6 A;  4A3I G;  3U4Z A;  2JA7 G;  4OO1 G;  1WI5 A;  1N32 L;  1P8L A;  4DK6 C;  1LM0 A;  2AWN A;  4GLX A;  4JYA L;  1U5K A;  3S15 H;  1L1O B;  3CQZ H;  3I2Z A;  3I4O A;  2R93 G;  2NVX H;  1SMX A;  1JJC B;  2NZO A;  3K8A A;  1PFS A;  2ZM6 L;  1ASY A;  3S1N H;  3TS2 A;  4LFB L;  1JJG A;  1UEB A;  2DUD A;  1K73 C;  3SGI A;  2UUB Q;  2UUC Q;  4OX9 Q;  2NVT H;  3GTM H;  2Z6K C;  2UXC Q;  2VQF L;  4UP8 A;  4DV0 L;  1VQE A;  3HOW H;  3PF4 A;  3PSI A;  4DR7 L;  1OXX K;  3F2D A;  3PO3 G;  1OXU A;  1PH3 A;  1VQ9 A;  3M7N A;  4GKJ L;  1C0A A;  1QVF A;  1XMO L;  2KCT A;  2R92 H;  2DGY A;  3E0E A;  5IP9 H;  3UDX A;  3PIO A;  1BBU A;  2JA6 G;  3U4V A;  1PYB A;  4DR5 Q;  4JI6 Q;  4K0K Q;  3H3V I;  4GNX C;  1HNX L;  4DR1 Q;  1IBL L;  4IPG A;  2PQA B;  3TS0 A;  3AFP A;  1C7Y A;  4X6A H;  5LMU L;  3RN2 A;  3CF5 A;  3IRB A;  1KD1 C;  4J15 A;  1EIF A;  1B8A A;  2MO0 A;  4X62 L;  2KBN A;  1XNR Q;  2HQL A;  4KI0 A;  1W3S A;  4A3E G;  1TWA H;  2I5H A;  3HOX G;  3CCQ A;  3CCU A;  3RR5 A;  1VQD A;  5AJ3 Q;  3S16 H;  4IFD G;  3S2D H;  2V1C C;  4JBK A;  4HJ8 A;  1CKM A;  2K5V A;  3HOV G;  1GVP A;  1LUZ A;  2EQS A;  2RHQ B;  2OWO A;  4B3M Q;  2CWA A;  3PO2 H;  1D8L A;  1H95 A;  1EIY B;  3BZC A;  4BY7 H;  2OCE A;  5IP7 H;  1D7Q A;  4DNI A;  1S3O A;  2UUC L;  2UUB L;  2UXC L;  2LXK A;  4YCU A;  2C35 B;  5H1S E;  4OX9 L;  1Y1W G;  3HOZ G;  4POF A;  5LMN Q;  1VQN A;  1X3G A;  2K5H A;  1JE5 A;  3G48 A;  3PUZ A;  5J3B A;  3MEF A;  3MXN B;  3TEH B;  3ULL A;  5M5Y H;  3KFU A;  1YBY A;  4EX5 A;  4A93 H;  4QJF A;  3A74 A;  5IYC G;  3J81 j;  4IO9 A;  1XJV A;  2E5L Q;  4JI7 Q;  2JA8 G;  3HKZ G;  3M85 A;  4GOP C;  1PVO A;  3HFZ B;  4UP9 A;  4JBJ A;  4JI8 Q;  4DR5 L;  4UP7 A;  4JI6 L;  4K0K L;  5C0X I;  5BR8 Q;  2JEA I;  2R7Z G;  3UDF A;  4IPH A;  1YZ6 A;  2YTY A;  4JI1 Q;  4DKA C;  4LF5 Q;  2F4V Q;  4DR1 L;  1E1T A;  1O7I A;  3E9H A;  1HH2 P;  1MJC A;  1MIU A;  3FHW A;  1HJP A;  4P71 A;  2XTI A;  3HKZ E;  4JG2 A;  5K36 G;  4OWX B;  4AIM A;  2PNH A;  1X6O A;  3BZK A;  3HOU G;  2WAQ G;  3CCL A;  4IFD I;  5JJI A;  3PUX A;  1XNR L;  2VUM G;  1ASZ A;  2OQ0 A;  2EXD A;  1Q46 A;  5M3M H;  2BH8 A;  1VQF A;  2JQO A;  2OTJ A;  2E2J H;  4HJ7 A;  2A19 A;  5AJ3 L;  1PH2 A;  1I6H H;  5GAH C;  1GO3 E;  2WAQ E;  4O2D A;  3BU2 A;  1WCM H;  3CCS A;  4R4C A;  1K8A C;  4B3M L;  2K14 A;  1IBM Q;  2N8N A;  4LF8 Q;  1CKN A;  1E7Z A;  1HNZ Q;  1V9P A;  4DV7 Q;  4DR4 Q;  4BBR G;  2I0Q A;  2QGQ A;  5C44 H;  4X64 L;  3ERS X;  1KHI A;  1EUJ A;  1L2F A;  3CC4 A;  1EOV A;  3PV0 A;  2JA7 H;  5C44 G;  3PUY A;  4JI7 L;  3DM3 A;  2E5L L;  3CW2 C;  5HGQ A;  1MKH A;  5GAG C;  2VS1 A;  1CSP A;  2K75 A;  4TQU S;  3GDE A;  2MFI A;  2PI2 E;  4JI8 L;  3GTK H;  2R93 H;  1I5F A;  1WYD A;  3F2C A;  5BR8 L;  2RCN A;  1OTC A;  4JI2 Q;  1I50 H;  4LF5 L;  2F4V L;  3AQQ A;  2VL6 A;  2CKZ B;  5M5X H;  3AYH B;  3RLF A;  3J7Z C;  1I94 L;  1X3F A;  4PZ8 A;  1LTL A;  3J80 i;  4A3M G;  1E22 A;  4L5T A;  4OON A;  1SFO H;  2LXJ A;  4OWT B;  5FJ8 G;  1CSQ A;  3G4S A;  4IPD A;  3G71 A;  4A3L G;  3UDG A;  4LUZ A;  3STB C;  2JA6 H;  1G6P A;  1VQB A;  4EQ5 A;  4QL5 A;  1XPR A;  1VQC A;  4JOI C;  4C3J H;  3CMA A;  5M3F G;  3JAM i;  3A5U A;  4AH6 A;  5E7N A;  1KXL A;  3M9B A;  1IBM L;  4ALP A;  1GM5 A;  4NXM Q;  2YU9 H;  4LF8 L;  4MNO A;  4DUZ Q;  1FVI A;  1FL0 A;  2Q2H A;  1HNZ L;  4DK3 C;  1JT8 A;  4DR4 L;  4DV3 Q;  1QUQ A;  1EYG A;  4A3E H;  2CQO A;  5IY0 A;  4NXN Q;  3HOX H;  1UE7 A;  4A3K G;  1J5E Q;  4A3C G;  3KF8 B;  3S17 H;  3E9I A;  3PIP A;  1KC8 C;  3CD6 A;  1VQH A;  3J81 c;  2KHJ A;  1YHB A;  2LSS A;  3NBH B;  2PQA A;  3PUW A;  4XIG S;  3HOV H;  3KJO A;  2JE6 I;  1A8V A;  1X54 A;  1NMF A;  2K52 A;  3RLN A;  3CPW A;  4DV1 Q;  2AWO A;  2Y0S E;  3D31 A;  1HR0 Q;  1XPO A;  4JI2 L;  3F2B A;  3GO5 A;  1EQR A;  1QVC A;  1Y1W H;  3HOZ H;  3KF6 B;  2ID0 A;  1TWH H;  2HIV A;  2NN6 I;  1VQ4 A;  4AQY L;  2ZTC A;  2VQE Q;  3GTQ H;  3L0O A;  4O0A A;  2OTL A;  3K7A H;  2JA8 H;  5IYC H;  4JC0 A;  1PA6 A;  3TQY A;  5C0X G;  3AFQ A;  1U0L A;  1VS0 A;  1FJG Q;  3D0F A;  2R7Z H;  1FGU A;  1TWF H;  1VQ5 A;  1S40 A;  1R9T H;  3OW2 A;  2JJQ A;  5FLM G;  2YTX A;  4DV2 L;  1VQ6 A;  3CCE A;  2NZH A;  4A76 A;  4NPS A;  4DUZ L;  1A62 A;  1PH9 A;  2ZJP A;  3HOU H;  3LGJ A;  2K50 A;  4DV3 L;  2VUM H;  4YCV A;  2KEN A;  4NXN L;  1B70 B;  4HJA A;  1Q12 A;  1J5E L;  3CXC A;  1PH4 A;  1M90 C;  3F8T A;  4C3I H;  4B3R Q;  4JOI A;  1OXT A;  3W1B A;  1Y1V G;  4KHP Q;  4DAY B;  3I4M G;  1V1Q A;  2HIX A;  4DV1 L;  1TXY A;  1L1O C;  4AYB G;  1JB7 A;  1BVS A;  4YY3 Q;  4BBR H;  1XNQ Q;  1CUK A;  3RNU A;  1PH7 A;  1AH9 A;  2RHS B;  5GQO A;  4JI3 Q;  3U50 C;  4YWL A;  1SR3 A;  1UE5 A;  4X65 Q;  2VQE L;  1YJ9 A;  1AE3 A;  4KLK A;  3L2P A;  4GLV B;  4BA1 I;  1X3E A;  2ZTE A;  4P74 A;  1VQM A;  2ZJR A;  1FJG L;  3UE0 A;  3S1M H;  3G6E A;  3KYH C;  1SRU A;  3M3Y H;  3KLW A;  1SRO A;  2QA4 A;  4OXP A;  4L5Q A;  1S72 A;  5M5W H;  1LYL A;  4A3M H;  1Q81 C;  1YJW A;  1VQ8 A;  1YIT A;  4R1J A;  5FJ8 H;  2IY5 B;  1HNW Q;  1G29 1;  1NY4 A;  1XTD A;  4DR6 Q;  1M1K C;  3OTO Q;  4A3L H;  2A8V A;  1K9M C;  4L5S A;  3H3V H;  5LMN W;  3VDY A;  1NE3 A;  4XTC S;  4B3R L;  1YEZ A;  2ATW A;  4R4O A;  5M3F H;  4HJ5 A;  5LMN L;  1UWV A;  2JEB I;  4LUO A;  4KHP L;  1DGS A;  5ELO A;  4LF7 Q;  2JA5 H;  2CWP A;  1QVG A;  4WJ3 M;  5JJK A;  4QY7 A;  1VCI A;  2N3S A;  5ELN A;  1SE8 A;  1VQI A;  4YY3 L;  1XNQ L;  2NVQ H;  5JJL A;  3L7Z C;  2H5X A;  4LUV A;  4ME3 A;  4IOA A;  4A3C H;  2AKW B;  4A3K H;  1P16 A;  1SLJ A;  4Y7N H;  4IJH A;  4JI1 L;  4JI3 L;  4BXX G;  5JEA G;  1VQK A;  1NTG A;  2VY3 A;  3DLL A;  3CCV A;  3CC2 A;  1GKH A;  2B63 G;  3EN2 A;  3JC6 6;  4H02 A;  2JA9 A;  1L1O A;  1VQL A;  4LFB Q;  4GN5 A;  1I94 Q;  3T1H Q;  4OWW B;  2IHF A;  4GNX B;  2UUA Q;  2UXD Q;  1G51 A;  4LF4 Q;  2NN6 G;  4APV A;  1JJ2 A;  1IZ6 A;  4DPG A;  4P73 A;  1T9H A;  4LF9 Q;  1HNW L;  3UDI A;  3NEM A;  5IT9 c;  2JA5 G;  4DR6 L;  3NEN A;  3OTO L;  3RZD H;  4LFA Q;  4LNQ A;  4A3B G;  3GTL H;  4A3D G;  4MTN A;  4DR3 Q;  3TRE A;  2K5N A;  4LW1 A;  4B3T Q;  4DV7 L;  1QZH A;  2UU9 Q;  1Q8K A;  3K80 C;  3RN5 A;  1EFW A;  1Q7Y C;  2ASB A;  4BA2 I;  5C0X J;  1OXV A;  3KF6 A;  3FKI G;  5FLM H;  4JI4 Q;  1YI2 A;  2Y0S G;  3A5Z B;  3KDF B;  1JMC A;  2MQH A;  4LF7 L;  1Z9F A;  1KRS A;  1E24 A;  3NEL A;  1XMQ Q;  1Z47 A;  5IYB G;  2D0O A;  1E1O A;  1YHQ A;  4IFD J;  1PH8 A;  4QGU A;  2EIF A;  4PG3 A;  4P75 A;  1IXR A;  3ZJY C;  1IBK Q;  4BBS H;  4C2M H;  5C3E G;  4YHH Q;  4UPA A;  4PMW A;  4IJL A;  4HJ9 A;  3STB D;  4X66 Q;  2L15 A;  1HZC A;  2FXQ A;  1KQS A;  3EBE A;  3H0G G;  3I56 A;  4LF6 Q;  3RZO H;  2WFW A;  1Y1V H;  3M4Q A;  5GRO A;  4RG1 A;  4HIO A;  2E2H H;  3ULJ A;  1XPU A;  1AE2 A;  1K83 H;  4GOP B;  3I4M H;  2PMZ E;  1Q1E A;  4GS3 A;  1K3R A;  2ZTD A;  4A3J G;  3T1H L;  5C4X G;  2UUA L;  2MO1 A;  2UXD L;  2GN5 A;  2CCZ A;  2PI2 A;  4L5R C;  2VNU D;  1RL2 A;  2B3G A;  1IYJ B;  3KOJ A;  3B6Y A;  1KL9 A;  1NMG A;  4DUY Q;  4LF9 L;  4PZ6 A;  1UE1 A;  2JK8 A;  2XGT A;  2HHH Q;  1VQG A;  4DV6 Q;  4NXM L;  3I4N G;  4LFA L;  2UXB Q;  1QUQ B;  4WJ4 A;  4DV4 Q;  2IX0 A;  1OXS C;  3GTG H;  3CCR A;  4DR3 L;  3A0J A;  1PH1 A;  4B3T L;  1WJJ A;  3FP9 A;  3J81 i;  3I55 A;  3Q8D A;  4IOC A;  3S1R H;  2YV5 A;  2UU9 L;  1VQ7 A;  4BY1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...