4IPHA

Structure of n-terminal domain of rpa70 in complex with vu079104 inhibitor
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Surface Reengineering of RPA70N Enables Cocrystallization with an Inhibitor of the Replication Protein A Interaction Motif of ATR Interacting Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 30
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4iphA00
4DR7Q 4NB3A 4MZ9A 4R4TA 3H3VH 4JI5Q 2OQKA 1N32Q 3T1YQ 1KHIA 1K9MC 2K4KA 1L1OC 4XIGS 4GKKQ 4K0KL 1SR3A 4DPGA 2Q2HA 1IBKL 1FJGL 4KHPQ 4PG3A 3PF4A 1I6HH 4P75A 4X64Q 1M90C 4PMWA 1MIUA 1NJIC 4A3JG 2JK8A 3F8TA 4APVA 1Z47A 4DR2L 4LF8Q 2ATWA 2HT1A 1E24A 1L2FA 5LMUL 2Q2UA 3J7A5 3PGZA 1Y1WG 1PH7A 2JA5H 4LF7Q 4LF9Q 4YWKA 2I5HA 3ER0A 4HJAA 1AE2A 4JI2Q 4LFAQ 3A5ZB 4JI5L 1NE3A 4A4IA 1WCMH 4HIDA 1M1KC 4DR6L 3BZCA 3M4PA 1FJGQ 1FGUA 2RF4A 1HJPA 1VQLA 2XGTA 4IOAA 1I50H 3S15H 4XTCS 4A3LH 1TWHH 4X64L 4DNIA 4A3IH 1PH4A 4JI6L 5C4XG 2ES2A 4GOPB 4YWMA 1Q86C 1GVPA 2AKWB 3CQZH 5ELNA 1TWCH 5IWAQ 1G291 2FXQA 3U4ZA 1IBLL 3M3YH 2UXBQ 4JV5Q 1HZCA 2VL6A 5EAYA 3S16H 2JA9A 1YZ6A 4LFBQ 1IBML 4R4QA 4DV1Q 4GLVB 3HOZH 1E7ZA 3AFPA 4L5QA 4FDBA 2E5LL 5M3FH 5IY0A 4JI2L 3T1YL 4GKKL 2VS1A 4K0KQ 3RR5A 4DUZQ 3FP9A 3S2HH 2WAQE 1TXYA 3K8AA 1K0RA 2LXJA 1VQDA 2JA8H 4IPDA 4X66L 2K5VA 2UUAQ 4GKJQ 3PV0A 3PCOB 4A76A 4J15A 2D62A 1VQ4A 3G6EA 3CP0A 3J81c 4JOIC 1N33Q 4BBRH 2QEXA 1XNRL 3HOZG 1X3EA 1VQPA 3G48A 4LFBL 1WYDA 4JV5L 3UE0A 1S72A 1U5KA 4LF9L 2OTJA 2IY5B 2PI2A 4IPCA 2BH2A 1K8GA 5C0XI 2LXKA 4LUZA 1NTGA 4JI8L 1PVOA 4JI7L 4DR1L 1VQOA 3CAMA 1Y1WH 2F52A 3CC7A 4DR6Q 3PIPA 5FLMH 2QGQA 3CCVA 1QZGA 1DGSA 2VQEL 1I94L 4B3ML 3CD6A 1HH2P 1C7YA 3Q8DA 4POFA 2N78A 2JQOA 4YCVA 2ZTEA 4BBSH 4GOPA 1G51A 4OXPA 2WP8J 4KI0A 5BR8Q 4BY1G 4X62Q 1N33L 2UUBQ 3HOUH 3M7NA 3PO3H 4YCUA 2Q2IA 4IJHA 3NENA 1PH8A 2HHHQ 4YCWA 1OXXK 4P74A 1HR0L 1LM0A 2R7DA 3KFUA 3WWVA 4DUZL 4QIWE 4DV2Q 5M5YH 4OO1G 4AH6A 1TWAH 2F3IA 2I0QA 2L15A 2YYZA 2IHFA 1GO3E 3S17H 5M3FG 3FKIG 2B3GA 1HNZQ 4B3TL 3G4SA 4JI4Q 4OWTB 3I4MG 1EOVA 1QZHA 3HOUG 1QUQB 2UU9L 3UDXA 4HIOA 3RN5A 2A8VA 4R1JA 1YJ9A 3VDYA 2RHSB 1YJNA 3RN2A 1B8AA 4AQYL 4GLXA 1PH2A 4HJ7A 3GTPH 2WAQG 2NVXH 4DV3Q 1XMQL 5JJIA 3H0GH 5FLXc 3K81C 4LF5Q 4JI7Q 5M3MH 1AH9A 4DV5Q 1EIYB 1XPUA 2JA7G 2R6GA 4B3MQ 1L1OA 1JMCA 4BBRG 2B29A 2R92H 1X3FA 5IYBH 3H3VI 3S1QH 2PI2E 3W1BA 1OXUA 1YHBA 1MJEA 1VS0A 5FLMG 3CPWA 3A0JA 3TREA 5LMNQ 4GN4B 3KYHC 4LF6Q 1U0LA 5BR8L 3TRZA 4IFDJ 2R7ZH 2PQAB 3HOWG 1D8LA 2KBNA 1N34Q 2UUBL 4IJLA 1T9HA 2VW9A 3LGJA 4B3RQ 1B7YB 1SRUA 4JI3L 1MJCA 2NN6I 2JA5G 3F2BA 3PUWA 1UWVA 2CFMA 4TVAB 3GD7A 4LF5L 2UXDQ 2BA1A 4DV5L 4X65Q 4A93G 1SE8A 4LWCA 1FL0A 4A3DG 3BJUA 4QJFA 1K8AC 3HOWH 2R7ZG 3PO3G 1HZAA 2D0OA 4LF4L 1L1OB 3NEMA 3HKZE 1GKHA 3A5UA 2WB1G 3W5OA 3E0EA 3ERSX 4DV6L 2K5HA 1N34L 2YU9H 1WCMG 2KHIA 1KC8C 1PH3A 4GN3B 2VNUD 3I7FA 4RMFA 1XPRA 1S3OA 3HOYG 4NPSA 3TQYA 2Y0SG 1OXVA 4C3IH 1CKNB 3U58A 3F1ZA 5DLQE 1JJ2A 1CKMA 2MO0A 4OX9L 1CUKA 1VQCA 2XTIA 1BBUA 1TWGH 1Q1BA 4C2MH 3D31A 4DAYB 4X65L 3PIOA 3I56A 2HIVA 3PO2G 1Q82C 1LYLA 4LNQA 5C3EG 1Q46A 1K73C 1V1QA 2MFIA 1PH6A 4LF6L 1LUZA 4PZ6A 4AYBE 4DV4Q 3K7AH 1PH1A 2GN5A 4DR4Q 3PF5A 4JI3Q 3E9HA 2CKZB 4LW1A 1KRTA 4DK6C 2KHJA 1VQBA 5GAHC 3CCQA 1PHJA 4A3GH 3CCLA 1E1OA 1Y1VG 4R4OA 5M5WH 3F2DA 1IBKQ 4KHPL 2R93G 4HIKA 4DV7Q 2UXDL 1V9PA 2YTVA 3AYHB 4P73A 4DR5Q 1N36Q 1CKOA 3BU2A 3HKZG 1W3SA 3GTGH 1KAWA 1Q12A 2A19A 4OWWB 2JEAI 1P8LA 4YWLA 1VQ9A 2PMZE 4UPAA 3STBD 3M4QA 3I4OA 3E9IA 3RLNA 1X55A 4DAMA 4NXNQ 1NMGA 4BY1H 4BY7H 4R4IA 3RZDH 1YHAA 3HOVG 3AFQA 4A3EG 4BA2I 4L5SA 4O0AA 1HZ9A 1YEZA 5AJ3L 1PFSA 4BA1I 3M85A 2IX0A 1D7QA 1IZ6A 5C0XJ 1X3GA 3FHWA 4DV0Q 1TWFH 1JT8A 4DR5L 1WI5A 1N36L 3HOYH 3KJPA 4TQUS 5C44G 3OTOL 5IYDG 1LTLA 3S1NH 3K80C 2MO1A 4MTNA 5C0XG 3CCMA 4JG2A 4ALPA 1OXTA 1GM5A 1E3PA 4A75A 2AMCB 1PYBA 3DM3A 4DV4L 4GNXB 4JBKA 4LF7L 2PQAA 4GNXC 4LUOA 4NXNL 3EN2A 3KJOA 4LFCQ 5GROA 2E5LQ 2VUMG 5FJ8G 3J7ZC 1VQHA 1XJVA 4C3HH 5JJLA 4JBJA 2NZHA 3D0FA 4H02A 1N8RC 4JI0L 4WJ3M 3G71A 2K14A 2UUAL 4IFDI 2E2JH 1B70B 1EUJA 3CCEA 2ZJPA 2JA7H 4KLKA 2EQSA 2KENA 3UDFA 4OWXB 3BZKA 3OTOQ 4L5RC 4JYAQ 4IPHA 3ULLA 5JEAJ 4DR3Q 3S14H 1EYGA 3CXCA 3OYYA 1HNXQ 3UE1A 4JBMA 2JJQA 3TEHB 3TS0A 2OTLA 4A3CH 2F4VL 4IO9A 1SLJA 4OONA 2K50A 2V1CC 1ASZA 3L2PA 5AJ3Q 4UP7A 3GTQH 1VQ7A 2DGYA 4JC0A 3HOVH 5IE8A 2K52A 4YY3L 4EX5A 1XNQQ 4EQ5A 4QGUA 2D0PA 1WOCA 4ME3A 1IL2A 1N9WA 1JE5A 5IT9c 1XNRQ 1VQ8A 4A3MG 3OW2A 2WFWA 2JEBI 1VQMA 3KOJA 1L0WA 4L5TA 4QY7A 1JJGA 3CMAA 2OCEA 1A0IA 1Q7YC 1QVFA 4HJ9A 4DR1Q 1ASYA 2B63H 3I4NG 1N32L 1PYSB 2I5LX 4A3DH 2AHOB 3S1MH 1C0AA 2CQOA 3I2ZA 4DKAC 3M4OH 3RLFA 1VQEA 2KCMA 2HIXA 1YVCA 2AWOA 2DUDA 3ULJA 1QVGA 4JI4L 1PH9A 1EIFA 1NBWA 5IP7G 2VY3A 2ALYB 5J3BA 4C3JH 3PO2H 4Y52H 2CWPA 2JA6H 1IBLQ 1K3RA 1UE6A 1OTCA 1WJJA 4JI1Q 1Q1EA 4A3BG 2GVBA 5IYCH 1WFQA 4NXML 1VQAA 2F4VQ 1P16A 3UDGA 4A3FG 2ZTCA 4B3SQ 3CW2C 4IFDG 1UE1A 1VQNA 5C3EH 2BA0A 2IT1A 5LMNW 4A3CG 3H0GG 3J80c 3HKSA 3CMEA 4UP9A 4JI6Q 1VQKA 1AE3A 4UP8A 2UU9Q 2OQ0A 1VQ6A 2YTXA 3GTKH 1CSPA 5K36G 1A8VA 3JAMi 2E2HH 2UXBL 4GN5A 1KRSA 2RCNA 1IXRA 4A3GG 1IBMQ 4DV1L 4PZ7A 1VQIA 4QL5A 4DV3L 1XMQQ 3ZJYC 1IYJB 5GAEC 3CCSA 1PH5A 1KIXA 4NXMQ 1E22A 1HNWL 3KDFA 4A3MH 4B3SL 4WJ4A 2NVYH 2NVTH 2H5XA 3S24A 5IP9H 3J81j 3CC4A 2RHQB 4X66Q 3RLOA 4GKJL 2VQEQ 1XTDA 5HY6A 1I94Q 4POGA 3I4NH 3CF5A 2B63G 3RZOH 4JBWA 3MXNB 3A74A 3PSIA 3PUYA 4LF4Q 4O2DA 1W2BA 1VCIA 2R92G 2ZTDA 3K7UC 3RNUA 4YHHL 4AIMA 3I55A 4JI1L 1KQSA 4R4CA 3F2CA 5M3MG 1Z9FA 3L7ZC 1Q81C 2JE6I 2HHHL 2E2IH 1YHQA 3CC2A 4JI8Q 1YBYA 2YTYA 2N49A 2HQLA 4GLAC 3SGIA 2NVQH 1RIPA 4A3BH 4QQBX 1RL2A 4RG1A 3DLLA 2Z0SA 1VQGA 1NMFA 4HJ5A 3CPFA 2ZJQA 3NBHB 2JA6G 1EQRA 1BBWA 3K0XA 3AEVA 2Y0SE 2ZJRA 2UUCQ 2BH8A 1YI2A 1XPOA 3CCRA 2A1AA 2ID0A 2MNAA 1BKBA 3GO5A 1E1TA 1I3QH 1VQJA 4X62L 1XMOQ 1VQ5A 2VUMH 1OXSC 1Q8KA 1Y14B 2VZAA 4DR4L 4YHHQ 4UY8C 4A3KH 1K83H 1HR0Q 1CKNA 1YJWA 4Y7NH 1HNWQ 4DK3C 2KCTA 4A93H 2C35B 3KDFB 2Z6KA 5ELOA 1HZBA 5GQOA 4DV2L 1YITA 1KD1C 4OX9Q 3GTLH 3I4MH 3MEFA 5IYDH 5JJKA 1S40A 1PV4A 2R93H 2GVAA 1HNZL 4B3TQ 2N8NA 2JA8G 5IP9G 3PUVA 4DUYL 1QUQA 4A3KG 1A63A 1NY4A 4BXXG 5GADC 5H1SE 2I5MX 5FJ8H 4AQYQ 1YIJA 1MKHA 2CWAA 3JAMc 1XMOL 4B3RL 1O7IA 1CSQA 2EXDA 1X6OA 1BVSA 3S1RH 4X6AH 4P71A 2UXCL 2R7FA 3M9BA 4MNOA 1SMXA 4OO1I 1UE5A 3B6YA 5E7NA 1UEBA 3TS2A 2UXCQ 1A62A 4GNXA 2PNHA 3GDEA 5JEAG 2EIFA 2LSSA 3U4VA 1UE7A 3GTJH 1X65A 2K5NA 3KF6B 4BXXH 2NN6G 3U50C 1I5FA 1J5EL 2UUCL 1X54A 2CCZA 1KXLA 3FKIH 5LMNL 1R9TH 2ZM6Q 1KL9A 4HIMA 3EIVA 3HFZB 5M5XH 2N3SA 3EBEA 1HR0W 1SN8A 4DV6Q 1EFWA 4A3JH 2OWOA 1EQQA 4DR7L 1Y1VH 3J81i 4HJ8A 4LFCL 1YNXA 2E8GA 3ULPA 3T1HL 4GOPC 4GS3A 3J80i 3ICEA 1QVCA 4JI0Q 1X56A 1V43A 3CCUA 4DV0L 5IP7H 2VQFQ 1FVIA 3GTMH 4BBSG 2QA4A 1X9NA 5C4JH 1SFOH 2ASBA 1G6PA 1JJCB 1J6QA 1PA6A 3KF8B 4PZ8A 3HOXH 4DUYQ 2Z6KC 4DR2Q 2IX1A 2YV5A 5IYBG 4DR3L 1H95A 2IHEA 5LMUQ 1JB7A 4BY7G 3PUXA 4A3FH 3KF6A 4A3EH 2Q2TA 3JC66 2WB1E 4IOCA 4JOIA 4A3LG 4IPGA 3W1GA 4LFAL 3PUZA 1GD7A 1VQFA 5HGQA 3T1HQ 3S2DH 3GTOH 4A3IG 3UDIA 5C4XH 2MQHA 2NZOA 4KHZA 5C44H 4DV7L 1C9OA 3L0OA 4AYBG 1SROA 4YY3Q 3HOXG 2VQFL 3STBC 3CCJA 4LUVA 1XNQL 4JYAL 1J5EQ 3NELA 4P72A 4LF8L 3IRBA 3H15A 5IWAL 2ZM6L 5IYCG 1HNXL 1EWIA 3AQQA 2K75A 4JCVE 5GAGC 2AWNA 3KLWA
chains in the Genus database with same CATH superfamily
4MZ9A 4R4TA 1LABA 4BY7B 5KNBA 1N32Q 2K03A 4K0KL 1L1OC 1SR3A 2JSOA 2Q2HA 3URYA 3D4RA 3MWYW 1KAAA 4S3SA 2EXZA 1NJIC 4A3JG 3J7YW 2HT1A 1E24A 1L2FA 5LMUL 4RCNA 1CZWA 2JYOA 1Y1WG 1PH7A 4LF7Q 1TWCB 1QILA 4JI2Q 1AZPA 5BN4A 5IGGA 3X3NA 4A4IA 4HIDA 4X3UA 1HA6A 1FGUA 1HJPA 3S1MB 1STAA 4X64L 1PTOF 3I73A 4JI6L 2SNMA 1W6KA 4OIJA 3M3YH 2VL6A 3S16H 3GTLB 1F9RA 1IBML 2N55A 4R4QA 2F0EA 1E7ZA 4MIUA 4JI2L 1A3TA 3T1YL 1QWYA 2HD3A 1PTOB 2JA8H 4ME5A 4GKJQ 2TSSA 4A76A 1SXTA 4DA2A 2D2CC 1VQPA 4A3BB 2F0JA 4XXEA 1S72A 2BH2A 1UEAB 4JI8L 5C3WA 1NUCA 2KQ3A 3CC7A 4XT1B 5CYUA 2QGQA 4B3ML 1CQVA 1HH2P 5IT9E 3Q8DA 4POFA 4XYOA 3EFXD 2N78A 5BN5A 4X3TA 3DWAA 3KF8A 2B2VA 4LJZC 2H1EA 1G51A 2PCFB 2WP8J 4OXPA 5BR8Q 1EU3A 3G7LA 3QG1A 1I4XA 3HOUH 2O5JC 3PO3H 2Q2IA 2HHHQ 1SJED 1GHJA 4WORA 1O78A 4F7XA 2L15A 5KGUA 1EOTA 2H4OA 3S17H 2F4IA 3SK5A 1BCPB 2UU9L 4PMBA 5IGCA 2A8VA 3VDYA 1YJNA 1LTID 3MXGA 5M5YB 4I65A 4QCLA 1ESRA 3J7AV 4C3JB 4HJ7A 1SYCA 5JJIA 1G91A 3SHLA 2F0DA 2CW0C 2FMMA 1L1OA 4K5WA 4OELB 1B3QA 3FMCA 2FHTA 2PI2E 1SE3A 3W1BA 5FLMG 3R3OA 4RFBA 3A0JA 3TREA 3BG3A 4LF6Q 2F0SA 1U0LA 5BR8L 3TRZA 4IFDJ 2KBNA 1N34Q 2UUBL 2VW9A 4C3JG 3NTHA 1B7YB 1SRUA 1ZKOA 3DWPA 2NN6I 2JA5G 2K1BA 3F2BA 2B2YA 1RHPA 3MFYA 2UXDQ 3OPOA 1SE8A 1KTKA 1GXDC 5M3FB 3AU7A 3HEJA 2R7ZG 2X6LA 3OIQA 1DOKA 3BDOA 2BE5D 1HA5A 2F0QA 3KUPA 4O42A 2VNUD 2HDLA 1WD0A 3HOYG 3TQYA 2EY5A 1B53A 1CKMA 2F0VA 4MN3A 4OX9L 1EWHA 2XTIA 1H9RA 1BBUA 3PIOA 1B44D 2HIVA 4JK1C 3FRPB 3PO2G 1Q82C 1LYLA 5C3EG 3I70A 4NP5A 5DAUA 2MFIA 3I4LA 3QJYA 3FPPA 4PZ6A 1HUMA 3K7AH 2GN5A 3E9HA 4ODGA 4DU9A 4CKCA 5GAHC 4CJ1B 1E1OA 2CW0D 1TQOA 3I4NB 3CHBD 4HIKA 4P73A 1L0YB 4RKLA 2EYLA 3BU2A 2NTTA 2A19A 3W3AA 3RZDB 5EPJA 3RLNA 3E9IA 4OL7A 1CT1D 1SYFA 1I4PA 4NXNQ 3KK7A 2F03A 1AP0A 2L4NA 2EY1A 1I4QA 3AFQA 4BA2I 1ML0D 1YNNC 1YEZA 5AJ3L 3GTGB 4BA1I 3K5NA 3FHWA 2R61A 4RA8A 1TWFH 1JT8A 1LTGD 3KJPA 2K6AA 2KCNA 1STEA 1LTLA 3K80C 2K33A 3MC0B 1O7LA 2Q8TA 3N52A 4ALPA 2AMCB 1M4VA 3DM3A 2PQAA 4LUOA 4NXNL 3V2TA 1SSOA 1XJVA 1SNQA 5JJLA 1N8RC 4H02A 1RJTA 4WJ3M 3CCEA 1EUJA 2ZJPA 4MTKA 3ONAB 2EQSA 2KENA 1AW7A 3UDFA 3D6WA 1TWGB 3BVGA 4BWGB 3OMGA 1LT6D 3CXCA 1EYAA 4XQJA 1PTOH 2JJQA 3TEHB 5KEEA 1J8IA 1VDZA 5EGTA 2QF7A 3KLSX 4IO9A 2B2YC 3K5OA 1MSGA 1TS2A 1ASZA 3GTQH 5AJ3Q 4UP7A 4EQOA 3LWUA 2DGYA 5IE8A 2NUCA 5KNDA 4AYBB 1TS3A 4EX5A 4QGUA 1WOCA 1Y8OB 5CBEE 1JE5A 3HG9A 1VQ8A 2WFWA 2O5IC 1WCMB 4QY7A 1IW7C 3NXWA 1QVFA 4HJ9A 2B63H 4A3DH 2CQOA 2OT2A 5E1FA 2K5QA 2KCMA 2AWOA 1QVGA 5DEHA 5IP7G 3K6OA 3P20A 2ALYB 5J3BA 4Y52H 1I6HB 1SE2A 1DXMA 1ZEQX 2JA6H 1IBLQ 1UE6A 4JI1Q 1Q1EA 4A3BG 1VQAA 2Z4HA 2R3ZA 3X3MA 4H0LC 1CA5A 3KBXA 4HMJA 1TWFB 5C3EH 5DM63 5LMNW 1IYUA 4CJ2C 4UP9A 4XT3B 2JA7B 3EROA 5K36G 2RDFA 2YTXA 3GTKH 2B2VC 4DFAA 2UXBL 3SEBA 3QR8A 1VQIA 4M1UB 2DNCA 3CCSA 4NXMQ 2AQ2B 1Y69U 4B3SL 1TVXA 4BS9A 4WJ4A 2NVTH 1L0XB 1XWEA 5IP9H 3CC4A 5CBAE 3RLOA 3I4NH 2EJGC 4JBWA 3Q6SA 1JOKA 4O2DA 1VCIA 4G4KA 1NR4A 3RNUA 4YHHL 2RCFA 3I55A 4JI1L 2K32A 1Y1WB 3DEPA 2A6ED 1KQSA 2O4XA 5M3MG 1Q81C 3CC2A 3EJIA 4R8IA 2YTYA 4CDFC 1AZQA 2HQLA 2L1BA 4J1MA 1I4GA 3Q0AA 2NVQH 2E2HB 4RG1A 4FXKC 2Z0SA 3AB9A 1EQRA 1G2TA 2A69D 2BH8A 3CCRA 4ZUIA 3GO5A 1PXUA 3H94A 1VQ5A 1JC7A 4DR4L 5EBDA 1K83H 2M00A 1HR0Q 1CKNA 1YJWA 3ERQA 2KCTA 4DK3C 2C35B 3P1HA 1KD1C 4OX9Q 1ICFB 3MEFA 5JJKA 3VR3A 2B63B 2GVAA 2N8NA 1CQFA 2WB1B 1YNND 1II3A 4AQYQ 1R4QB 3BVMA 1MKHA 5I4DA 3JAMc 2EE1A 4G7HC 4P71A 4X6AH 2R7FA 3M9BA 5EBCA 3D4DA 4RKBA 4OO1I 4IQZA 1U4RA 4GNXA 2PNHA 3GDEA 1LTSD 2EIFA 2LSSA 2FINB 2ZT9C 1J5EL 1K8MA 5LMNL 1CHQD 1PFBA 1KLGD 2XWJB 3L9AX 1HR0W 2N3SA 4UDUC 3LNNA 1SN8A 4A3JH 3T51B 2WV6D 4DR7L 2NWGA 3J81i 3ULPA 4CKBA 4HJ8A 3EQLC 4DNTB 3J80i 5ELCA 4ZKCB 1FVIA 1AFPA 3GTMH 1X9NA 5DNFA 1K28A 2SEBD 2YV5A 1H95A 3HOUB 5E4XA 4A3EH 3KBGA 2J7ZA 3W1GA 4YIJA 3T1HQ 2F0KA 3S2DH 3GTOH 2XSCA 1MI2A 2Y0SB 2XRQD 4I7AA 4ZCKA 3M7GA 5CC4A 4QB4A 4YY3Q 4HCEA 3HOXB 3CCJA 4JYAL 3GTMB 1ONLA 2PO4A 2KOLA 2R92H 3J81E 4NB3A 2KEEA 4ZQ3A 1KHIA 1IBKL 2XIWA 4V0BA 5L37A 4PG3A 1TKWB 3U9OA 3HZXA 4X64Q 1M90C 1JQYD 4KJOA 4PMWA 2JK8A 4APVA 4DK0A 4LF8Q 1WTRA 3S16B 1D1KA 2Q2UA 2KUMA 3PGZA 4LF9Q 2EY2A 4LFAQ 2B2WA 4DR6L 2PQEA 3M4PA 1VF5C 2RF4A 4IOAA 2RSOA 4N8X1 1TWHH 2GA4B 4C3IG 2F0NA 2B2UA 5C4XG 1K83B 4RGOS 2ES2A 1SYEA 1GUTA 1TWCH 5IWAQ 1WD1A 1IBLL 1FD7D 4FF2A 1E2WA 5EAYA 2JA9A 5D65A 1SJHD 1FNUA 1Q3LA 2F0HA 3AFPA 4FDBA 2E5LL 5IY0A 4GKKL 1WTHA 4CGYB 3MEHA 1RODA 3FP9A 2WAQE 1TXYA 5A2QE 1ZYRD 4HN7A 4FXGC 3PCOB 1VQ4A 3R8BA 1TWHB 3HS0C 3HOZG 1IW7D 4BBRH 2QEXA 1N33Q 5KRUA 2MUYA 3CU7A 4IUQA 4LFBL 4JV5L 1U5KA 4X3KA 3K5LA 1K8GA 2KJXA 5C0XI 4JVZA 1Y8PB 2K28A 2RVLA 4DR6Q 1CHPD 2VQEL 4I7ZC 1ENAA 1SEBD 3S1NB 3T4AC 5JVG3 1WTVA 3TSSA 2PW5A 3FDTA 4X62Q 1JWMD 5M3MB 3M7NA 4IJHA 4A3MB 3I72A 1PH8A 1FR3A 5F2DA 3FPUB 1OXXK 4P74A 1HR0L 1LM0A 4QIWE 5M5YH 4N9TA 4AH6A 2I0QA 4KTAA 3SR1A 1NAPA 3BDCA 4B3TL 4JI4Q 4HMIA 1S5CD 3I4MG 3UDXA 1YJ9A 1YNJD 1BQQT 4NMZA 3GV3A 3BYYB 4AQYL 5M5WB 4B9WA 1PH2A 2WAQG 1ET9A 5FLXc 4LF5Q 4DK1A 4ZKBB 4DAVA 1HRJA 1XPUA 2JA7G 4B3MQ 4O1NA 2B29A 1X3FA 5IYBH 3S1QH 1YHBA 3KLRA 1MJEA 1VS0A 2EY6A 3CPWA 5LMNQ 2N88A 3MHBA 3HOWG 5KYIA 4IJLA 1T9HA 1EIGA 3HRZC 1UAPA 3QIAA 1MJCA 2D9UA 4PNYA 4IUUA 4DXGA 2AQ1B 4F88A 3JAML 1X3PA 4E6IA 2BA1A 4DV5L 1G6ZA 1FL0A 4C3IB 4A3DG 2DY8A 4QJFA 1S5BD 5JJZA 3HOWH 1MSHA 4A3KB 4K14A 4LF4L 3QO2A 3ERSX 1O7ZA 1N34L 1WCMG 3K0YA 2EJFC 2KHIA 1KC8C 3OW7A 2Y0SG 3TN2A 3U58A 1CKNB 3F1ZA 1K3BC 5I9PA 1F9PA 1QE6A 1VMPA 1VQCA 4C2MH 3D31A 5I2YA 5D3DA 4X3SA 1UUPA 2NTSA 1K73C 1V1QA 1GUOA 1LT4D 4AYBE 1U4PA 5C5LA 1ET6A 4LW1A 4HSVA 2L5TA 2LMCB 1KRTA 3GTPB 1STGA 2VXWA 4RGTA 2FJ2A 2LKVA 3BVZA 3CCLA 3RZOB 4KHPL 5I6YA 2R93G 1D7QA 1V9PA 1FYCA 1N36Q 1W3SA 3GTGH 1Q12A 1STBA 2PMZE 1S5DD 2RQXA 4K8JA 4M8AA 4RWSC 1NMGA 4EQNA 4C1NI 4R4IA 1TS4A 3RZDH 4IALA 1S5FD 4IUTA 3HOVG 3NUCA 4L5SA 4O0AA 3A56A 1HZ9A 2IX0A 1TWAB 4DV0Q 1ENCA 1HQRD 3I91A 4ZUJA 3TP5A 4DNRB 1HUNA 3OTOL 3S1NH 1IKLA 4MTNA 5C0XG 3NWSA 4JG2A 3CCMA 1OXTA 1E3PA 4A75A 4LF7L 2F0LA 1BCPC 1T5XD 3KJOA 3C1FA 1WVLA 5FJ8G 2ICEC 1VQHA 1V8QA 4C3HH 1NSNS 3MTSA 4JI0L 3C3LA 2K14A 4BBRB 4IFDI 2E2JH 3A8JE 3I3CA 3GTKB 1B70B 2JA7H 1RKNA 4G7OC 3OTOQ 2EYJA 1TIID 1B4OA 1OO9B 3J80E 3OYYA 1HNXQ 3TS0A 3S2HB 3DUZA 1F2MA 4KHVA 5C6AA 5FKAC 3WOEA 1XXGA 3PIP3 1ZXTA 3HOVB 3IFDA 3NHHA 5DM73 5JOBA 1ESFA 3PO2B 4RAUC 4EVOA 1XNQQ 2D0PA 5IT9c 1XNRQ 3WDNA 3H09A 5FO7B 3K58A 3OW2A 2JEBI 1VQMA 3IKJA 1L0WA 2A6EC 1Q7YC 3I4NG 1N32L 2R93B 3DXJC 2I5LX 5CV4A 2AHOB 4DKAC 3I2ZA 3M4OH 1VQEA 2AQ3B 2HIXA 1B50A 4HTHA 3N6RA 1EIFA 2JN4A 1EU4A 4FYDA 3VR6A 4C3JH 1X32A 2I46A 1K3RA 1OTCA 1WJJA 1V1PA 1WTXA 1CA6A 2GVBA 1WFQA 1P16A 3UDGA 3Q22A 1HFGA 3HOYB 4IFDG 1UE1A 1VQNA 5EPKA 4A3CG 3NQTA 3H0GG 2L55A 1JE4A 1U9RA 5FO9B 1AE3A 2UU9Q 3PQIA 1CSPA 2RA4A 1A8VA 2ENBA 1BNZA 3S17B 4GN5A 1KRSA 4KD3A 5C5MA 1IBMQ 4DV1L 1TR5A 4PZ7A 4QL5A 3NP8A 4K8IA 3ZJYC 1KIXA 2L0CA 3KDFA 2WKCA 3S24A 1I94Q 1XTDA 4POGA 3CF5A 3RZOH 3E5SA 2X69A 3PSIA 2R92G 5T1IA 3K7UC 4AIMA 1MGSA 2ZXOA 2MPMA 1Z9FA 2RSNA 5JEAH 5FOBB 1YHQA 4JI8Q 4QF4A 1YBYA 2KVMA 3VYTA 1H9SA 4QQBX 1RL2A 4R8NA 2QEJC 2BDNA 2F0MA 1SYBA 4TRDA 1BBWA 4WFN3 4U68A 4KY7A 3AEVA 1V1OA 2ZJRA 2UUCQ 1YI2A 3QWNA 3MXNA 4K5XA 2MNAA 1E1TA 1I3QH 1SMYD 1VQJA 2K05A 2DJGC 1Q8KA 2KECA 2VZAA 1EY7A 2PZUA 5IGDA 4UY8C 1BOSA 2A74C 1CTMA 1HNWQ 3K7AB 4DV2L 2PPBC 1YITA 3GTLH 1D1IA 3M3YB 1EQTA 4XQNA 1PV4A 4OEMB 2R93H 4B3TQ 1B1ZA 5IP9G 4PMCA 1QUQA 1U4MA 5JPNC 5C4HA 4A3KG 4P2CB 4ABNA 5FJ8H 3VA5A 1XMOL 4R9WA 1GUNA 2HQEA 4B3RL 4A93B 1CSQA 1BVSA 1C48A 1HHVA 1O80A 1DM0B 5E7NA 1STHA 1E2ZA 2L12A 5JEAG 1UE7A 2P5ZX 3KF6B 3HGBA 2MP1A 1PTOC 3H0GB 4FXDA 3U50C 2UUCL 1X54A 1HCZA 3HP3A 1R9TH 2SNSA 1EFWA 4DV6Q 1GUGA 2NZ1D 1EZ6A 1J9OA 1Y1VH 2MGSA 2E8GA 1CFMA 4GS3A 5E3FA 4JI0Q 4K6LA 5LHY1 3CCUA 5IP7H 2VQFQ 5C4JH 4IURA 4FVMA 5COYA 1G6PA 1PZKD 1J6QA 2JXMB 2Z6KC 2IX1A 1O7YA 5IYBG 4DR3L 5K36H 2IHEA 1DJRD 4BY7G 1C4QA 2MHVA 1KABA 1ILQA 2NVXB 5JAVA 5EJWA 2O2LD 1I4RA 4LFAL 2CQAA 4RHRA 4G57A 5HGQA 5C4JB 3UDIA 4KHZA 2NVYB 4DV7L 3L0OA 5ELEA 3HOXG 3STBC 1EEID 3IL8A 4P72A 4BY1B 4FO2A 1D2BA 2A73B 2LY7A 3SK8A 5CMDA 1DONA 1LACA 3ND9A 1VQ9A 1DD2A 1YNJC 3QOJA 1IYVA 3H3VH 3V05A 3V96A 4GKKQ 2K4KA 2K04A 1FJGL 4DPGA 4KHPQ 1LTBD 5C3EB 5ELFA 3PF4A 2JA6B 1NCVA 2L11A 3ITPA 2B8GA 1I6HH 3J81L 3F8TA 3HOZB 4DR2L 2DJFC 3GV6A 2ATWA 5NUCA 1B2TA 4YWKA 2I5HA 4HJAA 1AE2A 4A3IB 1M1KC 4JI5L 1NE3A 1WCMH 3MZ5A 3BZCA 1FJGQ 4N8FA 1I50H 3S15H 4A3LH 2QDBA 4A3DB 3MXPA 4YWMA 1F9SA 1GVPA 2AKWB 1Q86C 3A7AB 5IGFA 4QIWB 2A68C 2YU9B 2JA5B 1G291 2FXQA 3U4ZA 3TP7A 2CHBD 1PFNA 3GTQB 1YZ6A 4KK7A 4DV1Q 3MFGA 4GLVB 2M2LA 3HOWB 4L5QA 2VS1A 3RR5A 4DUZQ 3NBIA 4XQQA 3K8AA 2D5DA 2LXJA 4IPDA 2UUAQ 1ZYRC 1VMCA 2D62A 3G6EA 3J81c 3BDLA 1I50B 3S15B 3EVQA 4JOIC 1XNRL 2K5WA 3G48A 1WYDA 1ILPA 2IL8A 5EPLA 4LF9L 2PI2A 1WTQA 1EIHA 4IFDH 2LXKA 4LUZA 4CDDC 4JI7L 1VQOA 2EPBA 2A6HC 4KN4C 3PIPA 5FLMH 3CCVA 2NN6H 4IUPA 1DGSA 3DWQA 1CI3M 2B2UC 4KKSA 1XYIA 1C7YA 2Z9HA 1PMRA 5KIXA 3FEWX 2RBMA 2JQOA 4YCVA 2ZTEA 5IOCA 3S9WA 2PYKA 4KI0A 4BY1G 3TBIB 5IGEA 1KLUD 1PYWD 4Q0FA 3SK6A 1UNSA 4ZLTF 4YCWA 1B3AA 2R7DA 3K57A 3KFUA 3WWVA 3SE0A 4DV2Q 4OO1G 1BXTA 3W2DA 1GO3E 1D5ZC 2B3GA 3FKIG 3G4SA 1A2UA 1H9MA 2F0WA 3HOUG 3OWFA 1BDOA 3RN5A 4R1JA 2I07B 1PZID 1B8AA 1A2TA 3RUZA 4GLXA 1HTLD 2NVXH 5M3MH 1AH9A 4DV5Q 1EIYB 1LTAD 4XYQA 1DYQA 1TS5A 1JMCA 3H3VC 3H3VI 4KV6A 1OXUA 2B39A 2L9HA 1JWUD 3A55A 3VA7A 2R7ZH 2PQAB 1LV9A 1KNEA 2WAQB 5CV6A 1A3VA 3D6CA 5EQ0A 5EKKA 3PUWA 1UWVA 1HQMC 3H6MA 4LF5L 3H91A 4X65Q 1R9TB 3BJUA 1K8AC 1SNDA 1STNA 1MD2D 1B9MA 5E4WC 5FK9C 3HKZE 1GKHA 2EYHA 3A5UA 3W5OA 1S5ED 3WOFA 1XPRA 2XVSA 4NPSA 5CR3A 5DLQE 1QNUA 2G9HD 1GJXA 4X65L 3S14B 4XDXA 3I56A 1EYCA 5EKLA 2A6HD 1FNVA 1TY2A 1PH6A 4LF6L 1TU2B 1JWSD 2F0PA 2NYZD 4HAEA 1PH1A 4DR4Q 3K5MA 1X3QA 3PF5A 3E0JA 5FLXE 4DK6C 2F0GA 2KHJA 1VQBA 2UXCQ 1PHJA 1K0SA 1Y1VG 4R4OA 3F2DA 1IBKQ 3AYHB 4DR5Q 3M4YA 1CKOA 3C2PA 1H9KA 3HKZG 4DAPA 1KAWA 2ICIA 4YWLA 2F0TA 2EYPA 2R92B 4RGNA 1EFID 3M4QA 1D5XC 1PFMA 1Z7TA 1YHAA 1RCVD 4A3EG 1FGBD 1PFSA 1QNKA 3BZDB 1IZ6A 5C0XJ 1X3GA 3NWTA 3NE5B 4DR5L 2X6GA 4TQUS 1TY0A 2PNRC 2PW7A 5I6WA 2MO1A 4B9XA 5IGBA 1GM5A 4DV4L 4JBKA 4GZYC 4GNXC 1LO5D 4OO1H 1A15A 2F3VA 2E5LQ 5IIFA 3J7ZC 4ZYSA 1HFNA 1H9SB 4KKTA 4A3FB 5J1ZA 3G71A 4JW0A 1IKMA 1D6EC 3GP7A 4KLKA 4OWXB 3IAYA 3BZKA 4IPHA 4C2MB 1EEFD 5I2XA 4OIKA 3CRKC 3DHQA 5JVH3 3UE1A 3U9SA 5T1GA 3NK9A 2F4VL 4OONA 2PMZB 4FP5D 1DZ1A 1SYGA 3L2PA 2JA8B 3A8KE 4J8QA 4JC0A 4YY3L 2K52A 2BCOA 4OGQC 4EQ5A 2SOBA 4CDEC 1K8OA 3M4OB 3PMFA 3I90A 4DR1Q 4J6HA 2KEDA 3S1QB 1PYSB 3S1MH 1KDBA 1RD9D 3RLFA 3OWEB 3E6ZX 1EYDA 1NBWA 4KJNA 1STYA 3SVMA 1BF4A 3PO2H 2A69C 3LX0A 3OIPA 1EY6A 1F77A 3ND8A 4NKLA 5IYCH 1TT2A 4B3SQ 2DN8A 3CW2C 1PRTF 2VUMB 3ZYYX 4IUNA 2IT1A 3J80c 1V1PB 1BBXC 1JORA 5M9OA 4JI6Q 2FMCA 2OQ0A 3MAQA 4CHTB 1SNCA 2E2HH 2EJMA 2HDMA 3P75A 4G7ZC 4C3HB 2RCNA 4A3GG 4FF4A 3O13A 1EZ8A 4CBVA 1SYDA 4WJWA 1HNWL 1ENFA 4PQXA 5A2QL 4A3MH 1JB3A 2NVYH 1HXYD 3MA2B 2EDGA 2RHQB 4GKJL 5EKIA 2B63G 3MXNB 3A74A 1LLRD 4HCSA 3PUYA 2F1MA 1XTCD 2B2TC 2KHSA 4LF4Q 3F2CA 2JE6I 1G2SA 1Y1VB 5C4ZA 5C3XA 4GLAC 4CKEA 4Z9CB 1NMFA 4HJ5A 3CPFA 3D4WA 4K5VA 3K0XA 3SDZA 4U673 1SNOA 5CV5A 1XPOA 2A1AA 2ID0A 1QJOA 2VUMH 1OXSC 4L6TB 4YHHQ 4RH6A 3R2TA 4A93H 2Z6KA 3FVQA 5J22A 5IYDH 3CQZB 3NQIA 1KNAA 5C0XH 5HURA 2IX3A 1PRTD 1JICA 4DUYL 2DY7A 1A63A 4MHEA 1NY4A 4BXXG 5GADC 2R7ZB 4DGZA 2I5MX 1YIJA 2QDLA 1KDCA 2CWAA 2F0UA 2EXDA 3CKIB 2UXCL 2EZVA 1SMXA 2CH4W 4KD4A 3C46A 1UEBA 3TS2A 3EA6A 1A62A 2EYOA 5CV9A 1EL0A 1SMYC 3U4VA 1X65A 2K5NA 2NN6G 1I5FA 1KXLA 2LFNA 2CCZA 2KCCA 2ZM6Q 5G3LD 2C5CA 1WTWA 2ZXRA 4DAYA 2OWOA 3VYSA 2E2IB 2QILA 3T13A 3T1HL 1BUVT 4GOPC 1RTOA 2F3WA 3ICEA 1QVCA 4HEDA 1X56A 4FNFA 5C44B 4LMQD 3A54A 3A8IE 4BBSG 2QA4A 1SFOH 2ASBA 2DNEA 2XNAC 5K5PA 1U4LA 1PA6A 5CGKA 3DM1A 4PZ8A 3HOXH 1RF2D 4DUYQ 3SK4A 4A3FH 3KF6A 2SDFA 2Q2TA 2QCPX 3NPPA 3R93A 3JC66 4A3LG 4IPGA 2NB0A 2F0OA 4QUFA 3OSOA 5ISRA 5C44H 4AYBG 1SROA 2OF1A 2VQFL 4LUVA 2OXPA 4K6DA 4LF8L 3IRBA 5IWAL 5IYCG 4A3JB 1HNXL 5TSSA 1W6JA 1WTOA 1EWIA 3AQQA 2K75A 4DNIA 2WACA 4DR7Q 1Q8IA 4JI5Q 2OQKA 3T1YQ 1K9MC 4XIGS 2E2DC 1EY4A 2EVBA 1MHWC 1LTRD 4BBSB 4P75A 3VR4A 3OMCA 2BE5C 1MIUA 1Z47A 2Z1CA 4ULLA 1NNXA 1LT5D 3J7A5 2JA5H 3T16A 3ER0A 3A5ZB 1WTPA 2F0FA 3P7JA 1VQLA 2XGTA 3SXHA 4XTCS 1RDPD 5AFWA 1PH4A 4A3IH 4GOPB 3CQZH 5ELNA 1EY9A 4OHJA 2UXBQ 4JV5Q 1HZCA 4LFBQ 1EY8A 4C3HG 2XWBB 4UHVA 1F2ZA 3HOZH 1AEXA 5M3FH 4K0KQ 1F2YA 3S2HH 1K0RA 1VQDA 1FNWA 4LK1C 4X66L 2K5VA 1HPCA 3PV0A 3TDQA 2RKSA 4J15A 3CP0A 4QUCA 2G5DA 2K5DA 1KDAA 1EY0A 2C9OA 3Q24A 1X3EA 3L3OC 2IW3A 1QB5D 3UE0A 2IY5B 2OTJA 4IPCA 3J7AF 1NTGA 4F8MA 3TZDA 1PVOA 4DR1L 1Y1WH 3CAMA 2F52A 2PZWA 1QZGA 1GHKA 3LWEA 1I94L 3CD6A 3T56B 2QKIC 4BBSH 4GOPA 1G8ZD 5HGTA 1N33L 1SDFA 4UAIA 2UUBQ 1Q90A 4YCUA 3NENA 2Z6BA 2BOSA 1E0BA 4DUZL 1TWAH 2F3IA 3TMEA 2YYZA 2IHFA 1F9QA 1PZJD 5M3FG 5KNCA 5FLXL 1HNZQ 3D3RA 4OWTB 1BCPF 1EOVA 1QZHA 1QUQB 3NTIA 5LL6X 4KMUC 1VF7A 4KN7C 4HIOA 2RHSB 1T5EA 2Z4IA 3VR2A 3RN2A 5M5XB 3S2DB 2Q8RE 4A3GB 3GTPH 3NSWA 1CZGA 4C56C 4DV3Q 1XMQL 3H0GH 1F2LA 3K81C 4JI7Q 3GQBA 2R6GA 3R2IA 4BBRG 4IZ8A 3S1RB 4JPBW 1I4HA 4GN4B 3IFTA 3KYHC 5LL6S 4K2LA 1D8LA 4CDCC 4B3RQ 3LGJA 3NBHA 4C1NK 4JI3L 4DF7A 1IL8A 4ZK9B 1R4PB 2CFMA 4TVAB 3GD7A 1SE4A 4ZRZA 5CORA 4A93G 3I4MB 1GUWA 4LWCA 5FO8B 2A68D 4KY6A 4V190 1B9NA 4Y7NB 3PO3G 1HZAA 2D0OA 1L1OB 3NEMA 4DV6L 3DMUA 2WB1G 3E0EA 2K5HA 2YU9H 1PH3A 4GN3B 5G3LF 3I7FA 4RMFA 2B8FA 1S3OA 1ICWA 1OXVA 4C3IH 4RGMA 1JJ2A 4Q5VA 2MO0A 1CUKA 1TWGH 1Q1BA 5D3IB 4DAYB 1GUSA 4LNQA 1Q46A 2RDGA 1DOLA 2VB2X 1LUZA 2WINB 1XX8A 4DV4Q 3TP6A 4JI3Q 4NDXA 1Y8NB 2CKZB 4EQPA 3CCQA 3I8ZA 4A3GH 1LT3D 2A5HA 5M5WH 2UXDL 1PTOD 4DV7Q 2CH4A 2EOTA 2YTVA 4HSPA 4FF1A 2JP1A 4OWWB 2JEAI 1P8LA 5I9OA 1BR9A 3VR5A 3PIO3 1EWCA 2QW7A 4UPAA 3STBD 5ELDA 3I4OA 1X55A 4DAMA 1HTPA 4BY1H 1JOOA 4BY7H 5ELBA 4K2KA 3TZUA 5IODA 3QOLA 3M85A 3QB3A 5C4XB 1N36L 1WI5A 3HOYH 5C44G 5CV7A 1EY5A 5IYDG 4H13C 3A7LA 3RD4A 2J0TD 1PYBA 4GNXB 2EYFA 4DN4M 1A3UA 3EN2A 4L8JA 4LFCQ 5GROA 2VUMG 5J39A 4JBJA 2NZHA 3D0FA 1SAPA 4DXFA 2CVRA 2VB3X 2UUAL 3HKZB 2OEOA 1M8AA 2HCIA 4L5RC 4JYAQ 1DOMA 3ULLA 5JEAJ 4DR3Q 4B08A 3S14H 1EYGA 4HR7B 2E76C 4JBMA 1DCZA 2OTLA 1GOZA 2B2TA 3G6JB 4A3CH 1AN8A 1SLJA 2AUKA 3BYTB 3GTJB 2K50A 2V1CC 4ZAIA 4H7BA 1VQ7A 3FKIB 3HOVH 5KYLA 2Z8LA 4CJ0B 3NTKA 2ZXPA 4ME3A 1IL2A 1N9WA 1CK1A 4A3MG 1A6XA 3KOJA 4L5TA 1JJGA 3CMAA 2OCEA 1A0IA 3K59A 1ASYA 5BN3A 2KA7A 1C0AA 3TP8A 1YVCA 2DUDA 3ULJA 1H9JA 1LTTD 4JI4L 1PH9A 1MBYA 2Q8IB 2VY3A 1I6VC 4WRDA 2CWPA 4TKOB 1IHZA 1PRTB 1I3QB 2E74C 5D14A 4NXML 2F4VQ 2IJ0A 4A3FG 2ZTCA 4IUVA 2G9DA 2BDOA 1QCBD 4KKUA 2BA0A 3AMUA 3HKSA 3CMEA 4PV1C 1VQKA 3OHXC 4UP8A 1VQ6A 2K01A 1JOQA 3JAMi 3PO3B 5A35A 1IXRA 2NBFA 1EQVA 1PH5A 4DV3L 1XMQQ 1IYJB 5GAEC 1E22A 1PDQA 4A3EB 2XRSD 3Q23A 3VYRA 2H5XA 3J81j 4X66Q 3GTOB 2VQEQ 5HY6A 4EGVA 1SBBB 1SFOB 1S4ZA 2AUJD 1W2BA 2ZTDA 4KY5A 4R4CA 3L7ZC 2HHHL 2K7VA 2E2IH 3OOCA 2N49A 1QG7A 3SGIA 1RIPA 4A3BH 4QMGA 1JCKB 3DLLA 1VQGA 2ZJQA 2JA6G 3NBHB 1SNMA 2Y0SE 1BKBA 4X62L 3VYUA 1XMOQ 1Y14B 2PZTA 4RHSA 3F2UA 5IT9L 4A3KH 4LAAA 1SNPA 4Y7NH 2B2WC 3KDFB 5GQOA 5ELOA 1HZBA 3CRLC 3I4MH 1NR2A 3BS1A 1S40A 1HNZL 1C8CA 2JA8G 3PUVA 4H44C 2WKDA 2XN9C 3MXUA 4N9PA 4RCOA 1BO0A 5H1SE 3T53B 4L63B 1RTNA 1O7IA 2F0IA 1Z6HA 3RMHA 1X6OA 3DEOA 3S1RH 2HCCA 1PLFA 4MNOA 1UE5A 3B6YA 1BCPD 4F87A 3GTJH 2FFKB 4NW2A 4BXXH 1E2VA 3E3XA 3FKIH 5CV8A 4FF3A 4HIMA 1KL9A 3EIVA 3HFZB 5M5XH 1D5MC 3EBEA 3D8GA 4ILWA 1EQQA 1JR0D 2MJ8A 4LFCL 1YNXA 2HUGA 2LS01 2IWHA 2IPKD 3KLSA 3JAME 1V43A 4DV0L 2NVQB 1CM9A 1JJCB 2WIIB 3KF8B 2E2JB 4DR2Q 5LMUQ 1JB7A 3J80L 5JPMC 3PUXA 2M9VA 1QOHA 2WB1E 4IOCA 4JOIA 3PUZA 1GD7A 1VQFA 2J4XA 2RDHA 3C1EA 4IN3A 2E75C 4A3IG 4ID6A 5C4XH 2MQHA 2NZOA 2NVTB 1C9OA 1PRTC 2V4DA 1XNQL 3MVVA 3NELA 1J5EQ 3H15A 2ZM6L 2EYMA 4TSSA 3UI2A 2TMPA 4JCVE 5GAGC 2AWNA 3KLWA
chains in the Genus database with same CATH topology
4DR7Q 4NB3A 4MZ9A 4R4TA 3H3VH 4JI5Q 2OQKA 1N32Q 3T1YQ 1KHIA 1K9MC 2K4KA 1L1OC 4XIGS 4GKKQ 4K0KL 1SR3A 4DPGA 2Q2HA 1IBKL 1FJGL 4KHPQ 4PG3A 3PF4A 1I6HH 4P75A 4X64Q 1M90C 4PMWA 1MIUA 1NJIC 4A3JG 2JK8A 3F8TA 4APVA 1Z47A 4DR2L 4LF8Q 2ATWA 2HT1A 1E24A 1L2FA 5LMUL 2Q2UA 3J7A5 3PGZA 1Y1WG 1PH7A 2JA5H 4LF7Q 4LF9Q 4YWKA 2I5HA 3ER0A 4HJAA 1AE2A 4JI2Q 4LFAQ 3A5ZB 4JI5L 1NE3A 4A4IA 1WCMH 4HIDA 1M1KC 4DR6L 3BZCA 3M4PA 1FJGQ 1FGUA 2RF4A 1HJPA 1VQLA 2XGTA 4IOAA 1I50H 3S15H 4XTCS 4A3LH 1TWHH 4X64L 4DNIA 4A3IH 1PH4A 4JI6L 5C4XG 2ES2A 4GOPB 4YWMA 1Q86C 1GVPA 2AKWB 3CQZH 5ELNA 1TWCH 5IWAQ 1G291 2FXQA 3U4ZA 1IBLL 3M3YH 2UXBQ 4JV5Q 1HZCA 2VL6A 5EAYA 3S16H 2JA9A 1YZ6A 4LFBQ 1IBML 4R4QA 4DV1Q 4GLVB 3HOZH 1E7ZA 3AFPA 4L5QA 4FDBA 2E5LL 5M3FH 5IY0A 4JI2L 3T1YL 4GKKL 2VS1A 4K0KQ 3RR5A 4DUZQ 3FP9A 3S2HH 2WAQE 1TXYA 3K8AA 1K0RA 2LXJA 1VQDA 2JA8H 4IPDA 4X66L 2K5VA 2UUAQ 4GKJQ 3PV0A 3PCOB 4A76A 4J15A 2D62A 1VQ4A 3G6EA 3CP0A 3J81c 4JOIC 1N33Q 4BBRH 2QEXA 1XNRL 3HOZG 1X3EA 1VQPA 3G48A 4LFBL 1WYDA 4JV5L 3UE0A 1S72A 1U5KA 4LF9L 2OTJA 2IY5B 2PI2A 4IPCA 2BH2A 1K8GA 5C0XI 2LXKA 4LUZA 1NTGA 4JI8L 1PVOA 4JI7L 4DR1L 1VQOA 3CAMA 1Y1WH 2F52A 3CC7A 4DR6Q 3PIPA 5FLMH 2QGQA 3CCVA 1QZGA 1DGSA 2VQEL 1I94L 4B3ML 3CD6A 1HH2P 1C7YA 3Q8DA 4POFA 2N78A 2JQOA 4YCVA 2ZTEA 4BBSH 4GOPA 1G51A 4OXPA 2WP8J 4KI0A 5BR8Q 4BY1G 4X62Q 1N33L 2UUBQ 3HOUH 3M7NA 3PO3H 4YCUA 2Q2IA 4IJHA 3NENA 1PH8A 2HHHQ 4YCWA 1OXXK 4P74A 1HR0L 1LM0A 2R7DA 3KFUA 3WWVA 4DUZL 4QIWE 4DV2Q 5M5YH 4OO1G 4AH6A 1TWAH 2F3IA 2I0QA 2L15A 2YYZA 2IHFA 1GO3E 3S17H 5M3FG 3FKIG 2B3GA 1HNZQ 4B3TL 3G4SA 4JI4Q 4OWTB 3I4MG 1EOVA 1QZHA 3HOUG 1QUQB 2UU9L 3UDXA 4HIOA 3RN5A 2A8VA 4R1JA 1YJ9A 3VDYA 2RHSB 1YJNA 3RN2A 1B8AA 4AQYL 4GLXA 1PH2A 4HJ7A 3GTPH 2WAQG 2NVXH 4DV3Q 1XMQL 5JJIA 3H0GH 5FLXc 3K81C 4LF5Q 4JI7Q 5M3MH 1AH9A 4DV5Q 1EIYB 1XPUA 2JA7G 2R6GA 4B3MQ 1L1OA 1JMCA 4BBRG 2B29A 2R92H 1X3FA 5IYBH 3H3VI 3S1QH 2PI2E 3W1BA 1OXUA 1YHBA 1MJEA 1VS0A 5FLMG 3CPWA 3A0JA 3TREA 5LMNQ 4GN4B 3KYHC 4LF6Q 1U0LA 5BR8L 3TRZA 4IFDJ 2R7ZH 2PQAB 3HOWG 1D8LA 2KBNA 1N34Q 2UUBL 4IJLA 1T9HA 2VW9A 3LGJA 4B3RQ 1B7YB 1SRUA 4JI3L 1MJCA 2NN6I 2JA5G 3F2BA 3PUWA 1UWVA 2CFMA 4TVAB 3GD7A 4LF5L 2UXDQ 2BA1A 4DV5L 4X65Q 4A93G 1SE8A 4LWCA 1FL0A 4A3DG 3BJUA 4QJFA 1K8AC 3HOWH 2R7ZG 3PO3G 1HZAA 2D0OA 4LF4L 1L1OB 3NEMA 3HKZE 1GKHA 3A5UA 2WB1G 3W5OA 3E0EA 3ERSX 4DV6L 2K5HA 1N34L 2YU9H 1WCMG 2KHIA 1KC8C 1PH3A 4GN3B 2VNUD 3I7FA 4RMFA 1XPRA 1S3OA 3HOYG 4NPSA 3TQYA 2Y0SG 1OXVA 4C3IH 1CKNB 3U58A 3F1ZA 5DLQE 1JJ2A 1CKMA 2MO0A 4OX9L 1CUKA 1VQCA 2XTIA 1BBUA 1TWGH 1Q1BA 4C2MH 3D31A 4DAYB 4X65L 3PIOA 3I56A 2HIVA 3PO2G 1Q82C 1LYLA 4LNQA 5C3EG 1Q46A 1K73C 1V1QA 2MFIA 1PH6A 4LF6L 1LUZA 4PZ6A 4AYBE 4DV4Q 3K7AH 1PH1A 2GN5A 4DR4Q 3PF5A 4JI3Q 3E9HA 2CKZB 4LW1A 1KRTA 4DK6C 2KHJA 1VQBA 5GAHC 3CCQA 1PHJA 4A3GH 3CCLA 1E1OA 1Y1VG 4R4OA 5M5WH 3F2DA 1IBKQ 4KHPL 2R93G 4HIKA 4DV7Q 2UXDL 1V9PA 2YTVA 3AYHB 4P73A 4DR5Q 1N36Q 1CKOA 3BU2A 3HKZG 1W3SA 3GTGH 1KAWA 1Q12A 2A19A 4OWWB 2JEAI 1P8LA 4YWLA 1VQ9A 2PMZE 4UPAA 3STBD 3M4QA 3I4OA 3E9IA 3RLNA 1X55A 4DAMA 4NXNQ 1NMGA 4BY1H 4BY7H 4R4IA 3RZDH 1YHAA 3HOVG 3AFQA 4A3EG 4BA2I 4L5SA 4O0AA 1HZ9A 1YEZA 5AJ3L 1PFSA 4BA1I 3M85A 2IX0A 1D7QA 1IZ6A 5C0XJ 1X3GA 3FHWA 4DV0Q 1TWFH 1JT8A 4DR5L 1WI5A 1N36L 3HOYH 3KJPA 4TQUS 5C44G 3OTOL 5IYDG 1LTLA 3S1NH 3K80C 2MO1A 4MTNA 5C0XG 3CCMA 4JG2A 4ALPA 1OXTA 1GM5A 1E3PA 4A75A 2AMCB 1PYBA 3DM3A 4DV4L 4GNXB 4JBKA 4LF7L 2PQAA 4GNXC 4LUOA 4NXNL 3EN2A 3KJOA 4LFCQ 5GROA 2E5LQ 2VUMG 5FJ8G 3J7ZC 1VQHA 1XJVA 4C3HH 5JJLA 4JBJA 2NZHA 3D0FA 4H02A 1N8RC 4JI0L 4WJ3M 3G71A 2K14A 2UUAL 4IFDI 2E2JH 1B70B 1EUJA 3CCEA 2ZJPA 2JA7H 4KLKA 2EQSA 2KENA 3UDFA 4OWXB 3BZKA 3OTOQ 4L5RC 4JYAQ 4IPHA 3ULLA 5JEAJ 4DR3Q 3S14H 1EYGA 3CXCA 3OYYA 1HNXQ 3UE1A 4JBMA 2JJQA 3TEHB 3TS0A 2OTLA 4A3CH 2F4VL 4IO9A 1SLJA 4OONA 2K50A 2V1CC 1ASZA 3L2PA 5AJ3Q 4UP7A 3GTQH 1VQ7A 2DGYA 4JC0A 3HOVH 5IE8A 2K52A 4YY3L 4EX5A 1XNQQ 4EQ5A 4QGUA 2D0PA 1WOCA 4ME3A 1IL2A 1N9WA 1JE5A 5IT9c 1XNRQ 1VQ8A 4A3MG 3OW2A 2WFWA 2JEBI 1VQMA 3KOJA 1L0WA 4L5TA 4QY7A 1JJGA 3CMAA 2OCEA 1A0IA 1Q7YC 1QVFA 4HJ9A 4DR1Q 1ASYA 2B63H 3I4NG 1N32L 1PYSB 2I5LX 4A3DH 2AHOB 3S1MH 1C0AA 2CQOA 3I2ZA 4DKAC 3M4OH 3RLFA 1VQEA 2KCMA 2HIXA 1YVCA 2AWOA 2DUDA 3ULJA 1QVGA 4JI4L 1PH9A 1EIFA 1NBWA 5IP7G 2VY3A 2ALYB 5J3BA 4C3JH 3PO2H 4Y52H 2CWPA 2JA6H 1IBLQ 1K3RA 1UE6A 1OTCA 1WJJA 4JI1Q 1Q1EA 4A3BG 2GVBA 5IYCH 1WFQA 4NXML 1VQAA 2F4VQ 1P16A 3UDGA 4A3FG 2ZTCA 4B3SQ 3CW2C 4IFDG 1UE1A 1VQNA 5C3EH 2BA0A 2IT1A 5LMNW 4A3CG 3H0GG 3J80c 3HKSA 3CMEA 4UP9A 4JI6Q 1VQKA 1AE3A 4UP8A 2UU9Q 2OQ0A 1VQ6A 2YTXA 3GTKH 1CSPA 5K36G 1A8VA 3JAMi 2E2HH 2UXBL 4GN5A 1KRSA 2RCNA 1IXRA 4A3GG 1IBMQ 4DV1L 4PZ7A 1VQIA 4QL5A 4DV3L 1XMQQ 3ZJYC 1IYJB 5GAEC 3CCSA 1PH5A 1KIXA 4NXMQ 1E22A 1HNWL 3KDFA 4A3MH 4B3SL 4WJ4A 2NVYH 2NVTH 2H5XA 3S24A 5IP9H 3J81j 3CC4A 2RHQB 4X66Q 3RLOA 4GKJL 2VQEQ 1XTDA 5HY6A 1I94Q 4POGA 3I4NH 3CF5A 2B63G 3RZOH 4JBWA 3MXNB 3A74A 3PSIA 3PUYA 4LF4Q 4O2DA 1W2BA 1VCIA 2R92G 2ZTDA 3K7UC 3RNUA 4YHHL 4AIMA 3I55A 4JI1L 1KQSA 4R4CA 3F2CA 5M3MG 1Z9FA 3L7ZC 1Q81C 2JE6I 2HHHL 2E2IH 1YHQA 3CC2A 4JI8Q 1YBYA 2YTYA 2N49A 2HQLA 4GLAC 3SGIA 2NVQH 1RIPA 4A3BH 4QQBX 1RL2A 4RG1A 3DLLA 2Z0SA 1VQGA 1NMFA 4HJ5A 3CPFA 2ZJQA 3NBHB 2JA6G 1EQRA 1BBWA 3K0XA 3AEVA 2Y0SE 2ZJRA 2UUCQ 2BH8A 1YI2A 1XPOA 3CCRA 2A1AA 2ID0A 2MNAA 1BKBA 3GO5A 1E1TA 1I3QH 1VQJA 4X62L 1XMOQ 1VQ5A 2VUMH 1OXSC 1Q8KA 1Y14B 2VZAA 4DR4L 4YHHQ 4UY8C 4A3KH 1K83H 1HR0Q 1CKNA 1YJWA 4Y7NH 1HNWQ 4DK3C 2KCTA 4A93H 2C35B 3KDFB 2Z6KA 5ELOA 1HZBA 5GQOA 4DV2L 1YITA 1KD1C 4OX9Q 3GTLH 3I4MH 3MEFA 5IYDH 5JJKA 1S40A 1PV4A 2R93H 2GVAA 1HNZL 4B3TQ 2N8NA 2JA8G 5IP9G 3PUVA 4DUYL 1QUQA 4A3KG 1A63A 1NY4A 4BXXG 5GADC 5H1SE 2I5MX 5FJ8H 4AQYQ 1YIJA 1MKHA 2CWAA 3JAMc 1XMOL 4B3RL 1O7IA 1CSQA 2EXDA 1X6OA 1BVSA 3S1RH 4X6AH 4P71A 2UXCL 2R7FA 3M9BA 4MNOA 1SMXA 4OO1I 1UE5A 3B6YA 5E7NA 1UEBA 3TS2A 2UXCQ 1A62A 4GNXA 2PNHA 3GDEA 5JEAG 2EIFA 2LSSA 3U4VA 1UE7A 3GTJH 1X65A 2K5NA 3KF6B 4BXXH 2NN6G 3U50C 1I5FA 1J5EL 2UUCL 1X54A 2CCZA 1KXLA 3FKIH 5LMNL 1R9TH 2ZM6Q 1KL9A 4HIMA 3EIVA 3HFZB 5M5XH 2N3SA 3EBEA 1HR0W 1SN8A 4DV6Q 1EFWA 4A3JH 2OWOA 1EQQA 4DR7L 1Y1VH 3J81i 4HJ8A 4LFCL 1YNXA 2E8GA 3ULPA 3T1HL 4GOPC 4GS3A 3J80i 3ICEA 1QVCA 4JI0Q 1X56A 1V43A 3CCUA 4DV0L 5IP7H 2VQFQ 1FVIA 3GTMH 4BBSG 2QA4A 1X9NA 5C4JH 1SFOH 2ASBA 1G6PA 1JJCB 1J6QA 1PA6A 3KF8B 4PZ8A 3HOXH 4DUYQ 2Z6KC 4DR2Q 2IX1A 2YV5A 5IYBG 4DR3L 1H95A 2IHEA 5LMUQ 1JB7A 4BY7G 3PUXA 4A3FH 3KF6A 4A3EH 2Q2TA 3JC66 2WB1E 4IOCA 4JOIA 4A3LG 4IPGA 3W1GA 4LFAL 3PUZA 1GD7A 1VQFA 5HGQA 3T1HQ 3S2DH 3GTOH 4A3IG 3UDIA 5C4XH 2MQHA 2NZOA 4KHZA 5C44H 4DV7L 1C9OA 3L0OA 4AYBG 1SROA 4YY3Q 3HOXG 2VQFL 3STBC 3CCJA 4LUVA 1XNQL 4JYAL 1J5EQ 3NELA 4P72A 4LF8L 3IRBA 3H15A 5IWAL 2ZM6L 5IYCG 1HNXL 1EWIA 3AQQA 2K75A 4JCVE 5GAGC 2AWNA 3KLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 Q;  4NB3 A;  4MZ9 A;  4R4T A;  3H3V H;  4JI5 Q;  2OQK A;  1N32 Q;  3T1Y Q;  1KHI A;  1K9M C;  2K4K A;  1L1O C;  4XIG S;  4GKK Q;  4K0K L;  1SR3 A;  4DPG A;  2Q2H A;  1IBK L;  1FJG L;  4KHP Q;  4PG3 A;  3PF4 A;  1I6H H;  4P75 A;  4X64 Q;  1M90 C;  4PMW A;  1MIU A;  1NJI C;  4A3J G;  2JK8 A;  3F8T A;  4APV A;  1Z47 A;  4DR2 L;  4LF8 Q;  2ATW A;  2HT1 A;  1E24 A;  1L2F A;  5LMU L;  2Q2U A;  3J7A 5;  3PGZ A;  1Y1W G;  1PH7 A;  2JA5 H;  4LF7 Q;  4LF9 Q;  4YWK A;  2I5H A;  3ER0 A;  4HJA A;  1AE2 A;  4JI2 Q;  4LFA Q;  3A5Z B;  4JI5 L;  1NE3 A;  4A4I A;  1WCM H;  4HID A;  1M1K C;  4DR6 L;  3BZC A;  3M4P A;  1FJG Q;  1FGU A;  2RF4 A;  1HJP A;  1VQL A;  2XGT A;  4IOA A;  1I50 H;  3S15 H;  4XTC S;  4A3L H;  1TWH H;  4X64 L;  4DNI A;  4A3I H;  1PH4 A;  4JI6 L;  5C4X G;  2ES2 A;  4GOP B;  4YWM A;  1Q86 C;  1GVP A;  2AKW B;  3CQZ H;  5ELN A;  1TWC H;  5IWA Q;  1G29 1;  2FXQ A;  3U4Z A;  1IBL L;  3M3Y H;  2UXB Q;  4JV5 Q;  1HZC A;  2VL6 A;  5EAY A;  3S16 H;  2JA9 A;  1YZ6 A;  4LFB Q;  1IBM L;  4R4Q A;  4DV1 Q;  4GLV B;  3HOZ H;  1E7Z A;  3AFP A;  4L5Q A;  4FDB A;  2E5L L;  5M3F H;  5IY0 A;  4JI2 L;  3T1Y L;  4GKK L;  2VS1 A;  4K0K Q;  3RR5 A;  4DUZ Q;  3FP9 A;  3S2H H;  2WAQ E;  1TXY A;  3K8A A;  1K0R A;  2LXJ A;  1VQD A;  2JA8 H;  4IPD A;  4X66 L;  2K5V A;  2UUA Q;  4GKJ Q;  3PV0 A;  3PCO B;  4A76 A;  4J15 A;  2D62 A;  1VQ4 A;  3G6E A;  3CP0 A;  3J81 c;  4JOI C;  1N33 Q;  4BBR H;  2QEX A;  1XNR L;  3HOZ G;  1X3E A;  1VQP A;  3G48 A;  4LFB L;  1WYD A;  4JV5 L;  3UE0 A;  1S72 A;  1U5K A;  4LF9 L;  2OTJ A;  2IY5 B;  2PI2 A;  4IPC A;  2BH2 A;  1K8G A;  5C0X I;  2LXK A;  4LUZ A;  1NTG A;  4JI8 L;  1PVO A;  4JI7 L;  4DR1 L;  1VQO A;  3CAM A;  1Y1W H;  2F52 A;  3CC7 A;  4DR6 Q;  3PIP A;  5FLM H;  2QGQ A;  3CCV A;  1QZG A;  1DGS A;  2VQE L;  1I94 L;  4B3M L;  3CD6 A;  1HH2 P;  1C7Y A;  3Q8D A;  4POF A;  2N78 A;  2JQO A;  4YCV A;  2ZTE A;  4BBS H;  4GOP A;  1G51 A;  4OXP A;  2WP8 J;  4KI0 A;  5BR8 Q;  4BY1 G;  4X62 Q;  1N33 L;  2UUB Q;  3HOU H;  3M7N A;  3PO3 H;  4YCU A;  2Q2I A;  4IJH A;  3NEN A;  1PH8 A;  2HHH Q;  4YCW A;  1OXX K;  4P74 A;  1HR0 L;  1LM0 A;  2R7D A;  3KFU A;  3WWV A;  4DUZ L;  4QIW E;  4DV2 Q;  5M5Y H;  4OO1 G;  4AH6 A;  1TWA H;  2F3I A;  2I0Q A;  2L15 A;  2YYZ A;  2IHF A;  1GO3 E;  3S17 H;  5M3F G;  3FKI G;  2B3G A;  1HNZ Q;  4B3T L;  3G4S A;  4JI4 Q;  4OWT B;  3I4M G;  1EOV A;  1QZH A;  3HOU G;  1QUQ B;  2UU9 L;  3UDX A;  4HIO A;  3RN5 A;  2A8V A;  4R1J A;  1YJ9 A;  3VDY A;  2RHS B;  1YJN A;  3RN2 A;  1B8A A;  4AQY L;  4GLX A;  1PH2 A;  4HJ7 A;  3GTP H;  2WAQ G;  2NVX H;  4DV3 Q;  1XMQ L;  5JJI A;  3H0G H;  5FLX c;  3K81 C;  4LF5 Q;  4JI7 Q;  5M3M H;  1AH9 A;  4DV5 Q;  1EIY B;  1XPU A;  2JA7 G;  2R6G A;  4B3M Q;  1L1O A;  1JMC A;  4BBR G;  2B29 A;  2R92 H;  1X3F A;  5IYB H;  3H3V I;  3S1Q H;  2PI2 E;  3W1B A;  1OXU A;  1YHB A;  1MJE A;  1VS0 A;  5FLM G;  3CPW A;  3A0J A;  3TRE A;  5LMN Q;  4GN4 B;  3KYH C;  4LF6 Q;  1U0L A;  5BR8 L;  3TRZ A;  4IFD J;  2R7Z H;  2PQA B;  3HOW G;  1D8L A;  2KBN A;  1N34 Q;  2UUB L;  4IJL A;  1T9H A;  2VW9 A;  3LGJ A;  4B3R Q;  1B7Y B;  1SRU A;  4JI3 L;  1MJC A;  2NN6 I;  2JA5 G;  3F2B A;  3PUW A;  1UWV A;  2CFM A;  4TVA B;  3GD7 A;  4LF5 L;  2UXD Q;  2BA1 A;  4DV5 L;  4X65 Q;  4A93 G;  1SE8 A;  4LWC A;  1FL0 A;  4A3D G;  3BJU A;  4QJF A;  1K8A C;  3HOW H;  2R7Z G;  3PO3 G;  1HZA A;  2D0O A;  4LF4 L;  1L1O B;  3NEM A;  3HKZ E;  1GKH A;  3A5U A;  2WB1 G;  3W5O A;  3E0E A;  3ERS X;  4DV6 L;  2K5H A;  1N34 L;  2YU9 H;  1WCM G;  2KHI A;  1KC8 C;  1PH3 A;  4GN3 B;  2VNU D;  3I7F A;  4RMF A;  1XPR A;  1S3O A;  3HOY G;  4NPS A;  3TQY A;  2Y0S G;  1OXV A;  4C3I H;  1CKN B;  3U58 A;  3F1Z A;  5DLQ E;  1JJ2 A;  1CKM A;  2MO0 A;  4OX9 L;  1CUK A;  1VQC A;  2XTI A;  1BBU A;  1TWG H;  1Q1B A;  4C2M H;  3D31 A;  4DAY B;  4X65 L;  3PIO A;  3I56 A;  2HIV A;  3PO2 G;  1Q82 C;  1LYL A;  4LNQ A;  5C3E G;  1Q46 A;  1K73 C;  1V1Q A;  2MFI A;  1PH6 A;  4LF6 L;  1LUZ A;  4PZ6 A;  4AYB E;  4DV4 Q;  3K7A H;  1PH1 A;  2GN5 A;  4DR4 Q;  3PF5 A;  4JI3 Q;  3E9H A;  2CKZ B;  4LW1 A;  1KRT A;  4DK6 C;  2KHJ A;  1VQB A;  5GAH C;  3CCQ A;  1PHJ A;  4A3G H;  3CCL A;  1E1O A;  1Y1V G;  4R4O A;  5M5W H;  3F2D A;  1IBK Q;  4KHP L;  2R93 G;  4HIK A;  4DV7 Q;  2UXD L;  1V9P A;  2YTV A;  3AYH B;  4P73 A;  4DR5 Q;  1N36 Q;  1CKO A;  3BU2 A;  3HKZ G;  1W3S A;  3GTG H;  1KAW A;  1Q12 A;  2A19 A;  4OWW B;  2JEA I;  1P8L A;  4YWL A;  1VQ9 A;  2PMZ E;  4UPA A;  3STB D;  3M4Q A;  3I4O A;  3E9I A;  3RLN A;  1X55 A;  4DAM A;  4NXN Q;  1NMG A;  4BY1 H;  4BY7 H;  4R4I A;  3RZD H;  1YHA A;  3HOV G;  3AFQ A;  4A3E G;  4BA2 I;  4L5S A;  4O0A A;  1HZ9 A;  1YEZ A;  5AJ3 L;  1PFS A;  4BA1 I;  3M85 A;  2IX0 A;  1D7Q A;  1IZ6 A;  5C0X J;  1X3G A;  3FHW A;  4DV0 Q;  1TWF H;  1JT8 A;  4DR5 L;  1WI5 A;  1N36 L;  3HOY H;  3KJP A;  4TQU S;  5C44 G;  3OTO L;  5IYD G;  1LTL A;  3S1N H;  3K80 C;  2MO1 A;  4MTN A;  5C0X G;  3CCM A;  4JG2 A;  4ALP A;  1OXT A;  1GM5 A;  1E3P A;  4A75 A;  2AMC B;  1PYB A;  3DM3 A;  4DV4 L;  4GNX B;  4JBK A;  4LF7 L;  2PQA A;  4GNX C;  4LUO A;  4NXN L;  3EN2 A;  3KJO A;  4LFC Q;  5GRO A;  2E5L Q;  2VUM G;  5FJ8 G;  3J7Z C;  1VQH A;  1XJV A;  4C3H H;  5JJL A;  4JBJ A;  2NZH A;  3D0F A;  4H02 A;  1N8R C;  4JI0 L;  4WJ3 M;  3G71 A;  2K14 A;  2UUA L;  4IFD I;  2E2J H;  1B70 B;  1EUJ A;  3CCE A;  2ZJP A;  2JA7 H;  4KLK A;  2EQS A;  2KEN A;  3UDF A;  4OWX B;  3BZK A;  3OTO Q;  4L5R C;  4JYA Q;  4IPH A;  3ULL A;  5JEA J;  4DR3 Q;  3S14 H;  1EYG A;  3CXC A;  3OYY A;  1HNX Q;  3UE1 A;  4JBM A;  2JJQ A;  3TEH B;  3TS0 A;  2OTL A;  4A3C H;  2F4V L;  4IO9 A;  1SLJ A;  4OON A;  2K50 A;  2V1C C;  1ASZ A;  3L2P A;  5AJ3 Q;  4UP7 A;  3GTQ H;  1VQ7 A;  2DGY A;  4JC0 A;  3HOV H;  5IE8 A;  2K52 A;  4YY3 L;  4EX5 A;  1XNQ Q;  4EQ5 A;  4QGU A;  2D0P A;  1WOC A;  4ME3 A;  1IL2 A;  1N9W A;  1JE5 A;  5IT9 c;  1XNR Q;  1VQ8 A;  4A3M G;  3OW2 A;  2WFW A;  2JEB I;  1VQM A;  3KOJ A;  1L0W A;  4L5T A;  4QY7 A;  1JJG A;  3CMA A;  2OCE A;  1A0I A;  1Q7Y C;  1QVF A;  4HJ9 A;  4DR1 Q;  1ASY A;  2B63 H;  3I4N G;  1N32 L;  1PYS B;  2I5L X;  4A3D H;  2AHO B;  3S1M H;  1C0A A;  2CQO A;  3I2Z A;  4DKA C;  3M4O H;  3RLF A;  1VQE A;  2KCM A;  2HIX A;  1YVC A;  2AWO A;  2DUD A;  3ULJ A;  1QVG A;  4JI4 L;  1PH9 A;  1EIF A;  1NBW A;  5IP7 G;  2VY3 A;  2ALY B;  5J3B A;  4C3J H;  3PO2 H;  4Y52 H;  2CWP A;  2JA6 H;  1IBL Q;  1K3R A;  1UE6 A;  1OTC A;  1WJJ A;  4JI1 Q;  1Q1E A;  4A3B G;  2GVB A;  5IYC H;  1WFQ A;  4NXM L;  1VQA A;  2F4V Q;  1P16 A;  3UDG A;  4A3F G;  2ZTC A;  4B3S Q;  3CW2 C;  4IFD G;  1UE1 A;  1VQN A;  5C3E H;  2BA0 A;  2IT1 A;  5LMN W;  4A3C G;  3H0G G;  3J80 c;  3HKS A;  3CME A;  4UP9 A;  4JI6 Q;  1VQK A;  1AE3 A;  4UP8 A;  2UU9 Q;  2OQ0 A;  1VQ6 A;  2YTX A;  3GTK H;  1CSP A;  5K36 G;  1A8V A;  3JAM i;  2E2H H;  2UXB L;  4GN5 A;  1KRS A;  2RCN A;  1IXR A;  4A3G G;  1IBM Q;  4DV1 L;  4PZ7 A;  1VQI A;  4QL5 A;  4DV3 L;  1XMQ Q;  3ZJY C;  1IYJ B;  5GAE C;  3CCS A;  1PH5 A;  1KIX A;  4NXM Q;  1E22 A;  1HNW L;  3KDF A;  4A3M H;  4B3S L;  4WJ4 A;  2NVY H;  2NVT H;  2H5X A;  3S24 A;  5IP9 H;  3J81 j;  3CC4 A;  2RHQ B;  4X66 Q;  3RLO A;  4GKJ L;  2VQE Q;  1XTD A;  5HY6 A;  1I94 Q;  4POG A;  3I4N H;  3CF5 A;  2B63 G;  3RZO H;  4JBW A;  3MXN B;  3A74 A;  3PSI A;  3PUY A;  4LF4 Q;  4O2D A;  1W2B A;  1VCI A;  2R92 G;  2ZTD A;  3K7U C;  3RNU A;  4YHH L;  4AIM A;  3I55 A;  4JI1 L;  1KQS A;  4R4C A;  3F2C A;  5M3M G;  1Z9F A;  3L7Z C;  1Q81 C;  2JE6 I;  2HHH L;  2E2I H;  1YHQ A;  3CC2 A;  4JI8 Q;  1YBY A;  2YTY A;  2N49 A;  2HQL A;  4GLA C;  3SGI A;  2NVQ H;  1RIP A;  4A3B H;  4QQB X;  1RL2 A;  4RG1 A;  3DLL A;  2Z0S A;  1VQG A;  1NMF A;  4HJ5 A;  3CPF A;  2ZJQ A;  3NBH B;  2JA6 G;  1EQR A;  1BBW A;  3K0X A;  3AEV A;  2Y0S E;  2ZJR A;  2UUC Q;  2BH8 A;  1YI2 A;  1XPO A;  3CCR A;  2A1A A;  2ID0 A;  2MNA A;  1BKB A;  3GO5 A;  1E1T A;  1I3Q H;  1VQJ A;  4X62 L;  1XMO Q;  1VQ5 A;  2VUM H;  1OXS C;  1Q8K A;  1Y14 B;  2VZA A;  4DR4 L;  4YHH Q;  4UY8 C;  4A3K H;  1K83 H;  1HR0 Q;  1CKN A;  1YJW A;  4Y7N H;  1HNW Q;  4DK3 C;  2KCT A;  4A93 H;  2C35 B;  3KDF B;  2Z6K A;  5ELO A;  1HZB A;  5GQO A;  4DV2 L;  1YIT A;  1KD1 C;  4OX9 Q;  3GTL H;  3I4M H;  3MEF A;  5IYD H;  5JJK A;  1S40 A;  1PV4 A;  2R93 H;  2GVA A;  1HNZ L;  4B3T Q;  2N8N A;  2JA8 G;  5IP9 G;  3PUV A;  4DUY L;  1QUQ A;  4A3K G;  1A63 A;  1NY4 A;  4BXX G;  5GAD C;  5H1S E;  2I5M X;  5FJ8 H;  4AQY Q;  1YIJ A;  1MKH A;  2CWA A;  3JAM c;  1XMO L;  4B3R L;  1O7I A;  1CSQ A;  2EXD A;  1X6O A;  1BVS A;  3S1R H;  4X6A H;  4P71 A;  2UXC L;  2R7F A;  3M9B A;  4MNO A;  1SMX A;  4OO1 I;  1UE5 A;  3B6Y A;  5E7N A;  1UEB A;  3TS2 A;  2UXC Q;  1A62 A;  4GNX A;  2PNH A;  3GDE A;  5JEA G;  2EIF A;  2LSS A;  3U4V A;  1UE7 A;  3GTJ H;  1X65 A;  2K5N A;  3KF6 B;  4BXX H;  2NN6 G;  3U50 C;  1I5F A;  1J5E L;  2UUC L;  1X54 A;  2CCZ A;  1KXL A;  3FKI H;  5LMN L;  1R9T H;  2ZM6 Q;  1KL9 A;  4HIM A;  3EIV A;  3HFZ B;  5M5X H;  2N3S A;  3EBE A;  1HR0 W;  1SN8 A;  4DV6 Q;  1EFW A;  4A3J H;  2OWO A;  1EQQ A;  4DR7 L;  1Y1V H;  3J81 i;  4HJ8 A;  4LFC L;  1YNX A;  2E8G A;  3ULP A;  3T1H L;  4GOP C;  4GS3 A;  3J80 i;  3ICE A;  1QVC A;  4JI0 Q;  1X56 A;  1V43 A;  3CCU A;  4DV0 L;  5IP7 H;  2VQF Q;  1FVI A;  3GTM H;  4BBS G;  2QA4 A;  1X9N A;  5C4J H;  1SFO H;  2ASB A;  1G6P A;  1JJC B;  1J6Q A;  1PA6 A;  3KF8 B;  4PZ8 A;  3HOX H;  4DUY Q;  2Z6K C;  4DR2 Q;  2IX1 A;  2YV5 A;  5IYB G;  4DR3 L;  1H95 A;  2IHE A;  5LMU Q;  1JB7 A;  4BY7 G;  3PUX A;  4A3F H;  3KF6 A;  4A3E H;  2Q2T A;  3JC6 6;  2WB1 E;  4IOC A;  4JOI A;  4A3L G;  4IPG A;  3W1G A;  4LFA L;  3PUZ A;  1GD7 A;  1VQF A;  5HGQ A;  3T1H Q;  3S2D H;  3GTO H;  4A3I G;  3UDI A;  5C4X H;  2MQH A;  2NZO A;  4KHZ A;  5C44 H;  4DV7 L;  1C9O A;  3L0O A;  4AYB G;  1SRO A;  4YY3 Q;  3HOX G;  2VQF L;  3STB C;  3CCJ A;  4LUV A;  1XNQ L;  4JYA L;  1J5E Q;  3NEL A;  4P72 A;  4LF8 L;  3IRB A;  3H15 A;  5IWA L;  2ZM6 L;  5IYC G;  1HNX L;  1EWI A;  3AQQ A;  2K75 A;  4JCV E;  5GAG C;  2AWN A;  3KLW A; 
#chains in the Genus database with same CATH topology
 4MZ9 A;  4R4T A;  1LAB A;  4BY7 B;  5KNB A;  1N32 Q;  2K03 A;  4K0K L;  1L1O C;  1SR3 A;  2JSO A;  2Q2H A;  3URY A;  3D4R A;  3MWY W;  1KAA A;  4S3S A;  2EXZ A;  1NJI C;  4A3J G;  3J7Y W;  2HT1 A;  1E24 A;  1L2F A;  5LMU L;  4RCN A;  1CZW A;  2JYO A;  1Y1W G;  1PH7 A;  4LF7 Q;  1TWC B;  1QIL A;  4JI2 Q;  1AZP A;  5BN4 A;  5IGG A;  3X3N A;  4A4I A;  4HID A;  4X3U A;  1HA6 A;  1FGU A;  1HJP A;  3S1M B;  1STA A;  4X64 L;  1PTO F;  3I73 A;  4JI6 L;  2SNM A;  1W6K A;  4OIJ A;  3M3Y H;  2VL6 A;  3S16 H;  3GTL B;  1F9R A;  1IBM L;  2N55 A;  4R4Q A;  2F0E A;  1E7Z A;  4MIU A;  4JI2 L;  1A3T A;  3T1Y L;  1QWY A;  2HD3 A;  1PTO B;  2JA8 H;  4ME5 A;  4GKJ Q;  2TSS A;  4A76 A;  1SXT A;  4DA2 A;  2D2C C;  1VQP A;  4A3B B;  2F0J A;  4XXE A;  1S72 A;  2BH2 A;  1UEA B;  4JI8 L;  5C3W A;  1NUC A;  2KQ3 A;  3CC7 A;  4XT1 B;  5CYU A;  2QGQ A;  4B3M L;  1CQV A;  1HH2 P;  5IT9 E;  3Q8D A;  4POF A;  4XYO A;  3EFX D;  2N78 A;  5BN5 A;  4X3T A;  3DWA A;  3KF8 A;  2B2V A;  4LJZ C;  2H1E A;  1G51 A;  2PCF B;  2WP8 J;  4OXP A;  5BR8 Q;  1EU3 A;  3G7L A;  3QG1 A;  1I4X A;  3HOU H;  2O5J C;  3PO3 H;  2Q2I A;  2HHH Q;  1SJE D;  1GHJ A;  4WOR A;  1O78 A;  4F7X A;  2L15 A;  5KGU A;  1EOT A;  2H4O A;  3S17 H;  2F4I A;  3SK5 A;  1BCP B;  2UU9 L;  4PMB A;  5IGC A;  2A8V A;  3VDY A;  1YJN A;  1LTI D;  3MXG A;  5M5Y B;  4I65 A;  4QCL A;  1ESR A;  3J7A V;  4C3J B;  4HJ7 A;  1SYC A;  5JJI A;  1G91 A;  3SHL A;  2F0D A;  2CW0 C;  2FMM A;  1L1O A;  4K5W A;  4OEL B;  1B3Q A;  3FMC A;  2FHT A;  2PI2 E;  1SE3 A;  3W1B A;  5FLM G;  3R3O A;  4RFB A;  3A0J A;  3TRE A;  3BG3 A;  4LF6 Q;  2F0S A;  1U0L A;  5BR8 L;  3TRZ A;  4IFD J;  2KBN A;  1N34 Q;  2UUB L;  2VW9 A;  4C3J G;  3NTH A;  1B7Y B;  1SRU A;  1ZKO A;  3DWP A;  2NN6 I;  2JA5 G;  2K1B A;  3F2B A;  2B2Y A;  1RHP A;  3MFY A;  2UXD Q;  3OPO A;  1SE8 A;  1KTK A;  1GXD C;  5M3F B;  3AU7 A;  3HEJ A;  2R7Z G;  2X6L A;  3OIQ A;  1DOK A;  3BDO A;  2BE5 D;  1HA5 A;  2F0Q A;  3KUP A;  4O42 A;  2VNU D;  2HDL A;  1WD0 A;  3HOY G;  3TQY A;  2EY5 A;  1B53 A;  1CKM A;  2F0V A;  4MN3 A;  4OX9 L;  1EWH A;  2XTI A;  1H9R A;  1BBU A;  3PIO A;  1B44 D;  2HIV A;  4JK1 C;  3FRP B;  3PO2 G;  1Q82 C;  1LYL A;  5C3E G;  3I70 A;  4NP5 A;  5DAU A;  2MFI A;  3I4L A;  3QJY A;  3FPP A;  4PZ6 A;  1HUM A;  3K7A H;  2GN5 A;  3E9H A;  4ODG A;  4DU9 A;  4CKC A;  5GAH C;  4CJ1 B;  1E1O A;  2CW0 D;  1TQO A;  3I4N B;  3CHB D;  4HIK A;  4P73 A;  1L0Y B;  4RKL A;  2EYL A;  3BU2 A;  2NTT A;  2A19 A;  3W3A A;  3RZD B;  5EPJ A;  3RLN A;  3E9I A;  4OL7 A;  1CT1 D;  1SYF A;  1I4P A;  4NXN Q;  3KK7 A;  2F03 A;  1AP0 A;  2L4N A;  2EY1 A;  1I4Q A;  3AFQ A;  4BA2 I;  1ML0 D;  1YNN C;  1YEZ A;  5AJ3 L;  3GTG B;  4BA1 I;  3K5N A;  3FHW A;  2R61 A;  4RA8 A;  1TWF H;  1JT8 A;  1LTG D;  3KJP A;  2K6A A;  2KCN A;  1STE A;  1LTL A;  3K80 C;  2K33 A;  3MC0 B;  1O7L A;  2Q8T A;  3N52 A;  4ALP A;  2AMC B;  1M4V A;  3DM3 A;  2PQA A;  4LUO A;  4NXN L;  3V2T A;  1SSO A;  1XJV A;  1SNQ A;  5JJL A;  1N8R C;  4H02 A;  1RJT A;  4WJ3 M;  3CCE A;  1EUJ A;  2ZJP A;  4MTK A;  3ONA B;  2EQS A;  2KEN A;  1AW7 A;  3UDF A;  3D6W A;  1TWG B;  3BVG A;  4BWG B;  3OMG A;  1LT6 D;  3CXC A;  1EYA A;  4XQJ A;  1PTO H;  2JJQ A;  3TEH B;  5KEE A;  1J8I A;  1VDZ A;  5EGT A;  2QF7 A;  3KLS X;  4IO9 A;  2B2Y C;  3K5O A;  1MSG A;  1TS2 A;  1ASZ A;  3GTQ H;  5AJ3 Q;  4UP7 A;  4EQO A;  3LWU A;  2DGY A;  5IE8 A;  2NUC A;  5KND A;  4AYB B;  1TS3 A;  4EX5 A;  4QGU A;  1WOC A;  1Y8O B;  5CBE E;  1JE5 A;  3HG9 A;  1VQ8 A;  2WFW A;  2O5I C;  1WCM B;  4QY7 A;  1IW7 C;  3NXW A;  1QVF A;  4HJ9 A;  2B63 H;  4A3D H;  2CQO A;  2OT2 A;  5E1F A;  2K5Q A;  2KCM A;  2AWO A;  1QVG A;  5DEH A;  5IP7 G;  3K6O A;  3P20 A;  2ALY B;  5J3B A;  4Y52 H;  1I6H B;  1SE2 A;  1DXM A;  1ZEQ X;  2JA6 H;  1IBL Q;  1UE6 A;  4JI1 Q;  1Q1E A;  4A3B G;  1VQA A;  2Z4H A;  2R3Z A;  3X3M A;  4H0L C;  1CA5 A;  3KBX A;  4HMJ A;  1TWF B;  5C3E H;  5DM6 3;  5LMN W;  1IYU A;  4CJ2 C;  4UP9 A;  4XT3 B;  2JA7 B;  3ERO A;  5K36 G;  2RDF A;  2YTX A;  3GTK H;  2B2V C;  4DFA A;  2UXB L;  3SEB A;  3QR8 A;  1VQI A;  4M1U B;  2DNC A;  3CCS A;  4NXM Q;  2AQ2 B;  1Y69 U;  4B3S L;  1TVX A;  4BS9 A;  4WJ4 A;  2NVT H;  1L0X B;  1XWE A;  5IP9 H;  3CC4 A;  5CBA E;  3RLO A;  3I4N H;  2EJG C;  4JBW A;  3Q6S A;  1JOK A;  4O2D A;  1VCI A;  4G4K A;  1NR4 A;  3RNU A;  4YHH L;  2RCF A;  3I55 A;  4JI1 L;  2K32 A;  1Y1W B;  3DEP A;  2A6E D;  1KQS A;  2O4X A;  5M3M G;  1Q81 C;  3CC2 A;  3EJI A;  4R8I A;  2YTY A;  4CDF C;  1AZQ A;  2HQL A;  2L1B A;  4J1M A;  1I4G A;  3Q0A A;  2NVQ H;  2E2H B;  4RG1 A;  4FXK C;  2Z0S A;  3AB9 A;  1EQR A;  1G2T A;  2A69 D;  2BH8 A;  3CCR A;  4ZUI A;  3GO5 A;  1PXU A;  3H94 A;  1VQ5 A;  1JC7 A;  4DR4 L;  5EBD A;  1K83 H;  2M00 A;  1HR0 Q;  1CKN A;  1YJW A;  3ERQ A;  2KCT A;  4DK3 C;  2C35 B;  3P1H A;  1KD1 C;  4OX9 Q;  1ICF B;  3MEF A;  5JJK A;  3VR3 A;  2B63 B;  2GVA A;  2N8N A;  1CQF A;  2WB1 B;  1YNN D;  1II3 A;  4AQY Q;  1R4Q B;  3BVM A;  1MKH A;  5I4D A;  3JAM c;  2EE1 A;  4G7H C;  4P71 A;  4X6A H;  2R7F A;  3M9B A;  5EBC A;  3D4D A;  4RKB A;  4OO1 I;  4IQZ A;  1U4R A;  4GNX A;  2PNH A;  3GDE A;  1LTS D;  2EIF A;  2LSS A;  2FIN B;  2ZT9 C;  1J5E L;  1K8M A;  5LMN L;  1CHQ D;  1PFB A;  1KLG D;  2XWJ B;  3L9A X;  1HR0 W;  2N3S A;  4UDU C;  3LNN A;  1SN8 A;  4A3J H;  3T51 B;  2WV6 D;  4DR7 L;  2NWG A;  3J81 i;  3ULP A;  4CKB A;  4HJ8 A;  3EQL C;  4DNT B;  3J80 i;  5ELC A;  4ZKC B;  1FVI A;  1AFP A;  3GTM H;  1X9N A;  5DNF A;  1K28 A;  2SEB D;  2YV5 A;  1H95 A;  3HOU B;  5E4X A;  4A3E H;  3KBG A;  2J7Z A;  3W1G A;  4YIJ A;  3T1H Q;  2F0K A;  3S2D H;  3GTO H;  2XSC A;  1MI2 A;  2Y0S B;  2XRQ D;  4I7A A;  4ZCK A;  3M7G A;  5CC4 A;  4QB4 A;  4YY3 Q;  4HCE A;  3HOX B;  3CCJ A;  4JYA L;  3GTM B;  1ONL A;  2PO4 A;  2KOL A;  2R92 H;  3J81 E;  4NB3 A;  2KEE A;  4ZQ3 A;  1KHI A;  1IBK L;  2XIW A;  4V0B A;  5L37 A;  4PG3 A;  1TKW B;  3U9O A;  3HZX A;  4X64 Q;  1M90 C;  1JQY D;  4KJO A;  4PMW A;  2JK8 A;  4APV A;  4DK0 A;  4LF8 Q;  1WTR A;  3S16 B;  1D1K A;  2Q2U A;  2KUM A;  3PGZ A;  4LF9 Q;  2EY2 A;  4LFA Q;  2B2W A;  4DR6 L;  2PQE A;  3M4P A;  1VF5 C;  2RF4 A;  4IOA A;  2RSO A;  4N8X 1;  1TWH H;  2GA4 B;  4C3I G;  2F0N A;  2B2U A;  5C4X G;  1K83 B;  4RGO S;  2ES2 A;  1SYE A;  1GUT A;  1TWC H;  5IWA Q;  1WD1 A;  1IBL L;  1FD7 D;  4FF2 A;  1E2W A;  5EAY A;  2JA9 A;  5D65 A;  1SJH D;  1FNU A;  1Q3L A;  2F0H A;  3AFP A;  4FDB A;  2E5L L;  5IY0 A;  4GKK L;  1WTH A;  4CGY B;  3MEH A;  1ROD A;  3FP9 A;  2WAQ E;  1TXY A;  5A2Q E;  1ZYR D;  4HN7 A;  4FXG C;  3PCO B;  1VQ4 A;  3R8B A;  1TWH B;  3HS0 C;  3HOZ G;  1IW7 D;  4BBR H;  2QEX A;  1N33 Q;  5KRU A;  2MUY A;  3CU7 A;  4IUQ A;  4LFB L;  4JV5 L;  1U5K A;  4X3K A;  3K5L A;  1K8G A;  2KJX A;  5C0X I;  4JVZ A;  1Y8P B;  2K28 A;  2RVL A;  4DR6 Q;  1CHP D;  2VQE L;  4I7Z C;  1ENA A;  1SEB D;  3S1N B;  3T4A C;  5JVG 3;  1WTV A;  3TSS A;  2PW5 A;  3FDT A;  4X62 Q;  1JWM D;  5M3M B;  3M7N A;  4IJH A;  4A3M B;  3I72 A;  1PH8 A;  1FR3 A;  5F2D A;  3FPU B;  1OXX K;  4P74 A;  1HR0 L;  1LM0 A;  4QIW E;  5M5Y H;  4N9T A;  4AH6 A;  2I0Q A;  4KTA A;  3SR1 A;  1NAP A;  3BDC A;  4B3T L;  4JI4 Q;  4HMI A;  1S5C D;  3I4M G;  3UDX A;  1YJ9 A;  1YNJ D;  1BQQ T;  4NMZ A;  3GV3 A;  3BYY B;  4AQY L;  5M5W B;  4B9W A;  1PH2 A;  2WAQ G;  1ET9 A;  5FLX c;  4LF5 Q;  4DK1 A;  4ZKB B;  4DAV A;  1HRJ A;  1XPU A;  2JA7 G;  4B3M Q;  4O1N A;  2B29 A;  1X3F A;  5IYB H;  3S1Q H;  1YHB A;  3KLR A;  1MJE A;  1VS0 A;  2EY6 A;  3CPW A;  5LMN Q;  2N88 A;  3MHB A;  3HOW G;  5KYI A;  4IJL A;  1T9H A;  1EIG A;  3HRZ C;  1UAP A;  3QIA A;  1MJC A;  2D9U A;  4PNY A;  4IUU A;  4DXG A;  2AQ1 B;  4F88 A;  3JAM L;  1X3P A;  4E6I A;  2BA1 A;  4DV5 L;  1G6Z A;  1FL0 A;  4C3I B;  4A3D G;  2DY8 A;  4QJF A;  1S5B D;  5JJZ A;  3HOW H;  1MSH A;  4A3K B;  4K14 A;  4LF4 L;  3QO2 A;  3ERS X;  1O7Z A;  1N34 L;  1WCM G;  3K0Y A;  2EJF C;  2KHI A;  1KC8 C;  3OW7 A;  2Y0S G;  3TN2 A;  3U58 A;  1CKN B;  3F1Z A;  1K3B C;  5I9P A;  1F9P A;  1QE6 A;  1VMP A;  1VQC A;  4C2M H;  3D31 A;  5I2Y A;  5D3D A;  4X3S A;  1UUP A;  2NTS A;  1K73 C;  1V1Q A;  1GUO A;  1LT4 D;  4AYB E;  1U4P A;  5C5L A;  1ET6 A;  4LW1 A;  4HSV A;  2L5T A;  2LMC B;  1KRT A;  3GTP B;  1STG A;  2VXW A;  4RGT A;  2FJ2 A;  2LKV A;  3BVZ A;  3CCL A;  3RZO B;  4KHP L;  5I6Y A;  2R93 G;  1D7Q A;  1V9P A;  1FYC A;  1N36 Q;  1W3S A;  3GTG H;  1Q12 A;  1STB A;  2PMZ E;  1S5D D;  2RQX A;  4K8J A;  4M8A A;  4RWS C;  1NMG A;  4EQN A;  4C1N I;  4R4I A;  1TS4 A;  3RZD H;  4IAL A;  1S5F D;  4IUT A;  3HOV G;  3NUC A;  4L5S A;  4O0A A;  3A56 A;  1HZ9 A;  2IX0 A;  1TWA B;  4DV0 Q;  1ENC A;  1HQR D;  3I91 A;  4ZUJ A;  3TP5 A;  4DNR B;  1HUN A;  3OTO L;  3S1N H;  1IKL A;  4MTN A;  5C0X G;  3NWS A;  4JG2 A;  3CCM A;  1OXT A;  1E3P A;  4A75 A;  4LF7 L;  2F0L A;  1BCP C;  1T5X D;  3KJO A;  3C1F A;  1WVL A;  5FJ8 G;  2ICE C;  1VQH A;  1V8Q A;  4C3H H;  1NSN S;  3MTS A;  4JI0 L;  3C3L A;  2K14 A;  4BBR B;  4IFD I;  2E2J H;  3A8J E;  3I3C A;  3GTK B;  1B70 B;  2JA7 H;  1RKN A;  4G7O C;  3OTO Q;  2EYJ A;  1TII D;  1B4O A;  1OO9 B;  3J80 E;  3OYY A;  1HNX Q;  3TS0 A;  3S2H B;  3DUZ A;  1F2M A;  4KHV A;  5C6A A;  5FKA C;  3WOE A;  1XXG A;  3PIP 3;  1ZXT A;  3HOV B;  3IFD A;  3NHH A;  5DM7 3;  5JOB A;  1ESF A;  3PO2 B;  4RAU C;  4EVO A;  1XNQ Q;  2D0P A;  5IT9 c;  1XNR Q;  3WDN A;  3H09 A;  5FO7 B;  3K58 A;  3OW2 A;  2JEB I;  1VQM A;  3IKJ A;  1L0W A;  2A6E C;  1Q7Y C;  3I4N G;  1N32 L;  2R93 B;  3DXJ C;  2I5L X;  5CV4 A;  2AHO B;  4DKA C;  3I2Z A;  3M4O H;  1VQE A;  2AQ3 B;  2HIX A;  1B50 A;  4HTH A;  3N6R A;  1EIF A;  2JN4 A;  1EU4 A;  4FYD A;  3VR6 A;  4C3J H;  1X32 A;  2I46 A;  1K3R A;  1OTC A;  1WJJ A;  1V1P A;  1WTX A;  1CA6 A;  2GVB A;  1WFQ A;  1P16 A;  3UDG A;  3Q22 A;  1HFG A;  3HOY B;  4IFD G;  1UE1 A;  1VQN A;  5EPK A;  4A3C G;  3NQT A;  3H0G G;  2L55 A;  1JE4 A;  1U9R A;  5FO9 B;  1AE3 A;  2UU9 Q;  3PQI A;  1CSP A;  2RA4 A;  1A8V A;  2ENB A;  1BNZ A;  3S17 B;  4GN5 A;  1KRS A;  4KD3 A;  5C5M A;  1IBM Q;  4DV1 L;  1TR5 A;  4PZ7 A;  4QL5 A;  3NP8 A;  4K8I A;  3ZJY C;  1KIX A;  2L0C A;  3KDF A;  2WKC A;  3S24 A;  1I94 Q;  1XTD A;  4POG A;  3CF5 A;  3RZO H;  3E5S A;  2X69 A;  3PSI A;  2R92 G;  5T1I A;  3K7U C;  4AIM A;  1MGS A;  2ZXO A;  2MPM A;  1Z9F A;  2RSN A;  5JEA H;  5FOB B;  1YHQ A;  4JI8 Q;  4QF4 A;  1YBY A;  2KVM A;  3VYT A;  1H9S A;  4QQB X;  1RL2 A;  4R8N A;  2QEJ C;  2BDN A;  2F0M A;  1SYB A;  4TRD A;  1BBW A;  4WFN 3;  4U68 A;  4KY7 A;  3AEV A;  1V1O A;  2ZJR A;  2UUC Q;  1YI2 A;  3QWN A;  3MXN A;  4K5X A;  2MNA A;  1E1T A;  1I3Q H;  1SMY D;  1VQJ A;  2K05 A;  2DJG C;  1Q8K A;  2KEC A;  2VZA A;  1EY7 A;  2PZU A;  5IGD A;  4UY8 C;  1BOS A;  2A74 C;  1CTM A;  1HNW Q;  3K7A B;  4DV2 L;  2PPB C;  1YIT A;  3GTL H;  1D1I A;  3M3Y B;  1EQT A;  4XQN A;  1PV4 A;  4OEM B;  2R93 H;  4B3T Q;  1B1Z A;  5IP9 G;  4PMC A;  1QUQ A;  1U4M A;  5JPN C;  5C4H A;  4A3K G;  4P2C B;  4ABN A;  5FJ8 H;  3VA5 A;  1XMO L;  4R9W A;  1GUN A;  2HQE A;  4B3R L;  4A93 B;  1CSQ A;  1BVS A;  1C48 A;  1HHV A;  1O80 A;  1DM0 B;  5E7N A;  1STH A;  1E2Z A;  2L12 A;  5JEA G;  1UE7 A;  2P5Z X;  3KF6 B;  3HGB A;  2MP1 A;  1PTO C;  3H0G B;  4FXD A;  3U50 C;  2UUC L;  1X54 A;  1HCZ A;  3HP3 A;  1R9T H;  2SNS A;  1EFW A;  4DV6 Q;  1GUG A;  2NZ1 D;  1EZ6 A;  1J9O A;  1Y1V H;  2MGS A;  2E8G A;  1CFM A;  4GS3 A;  5E3F A;  4JI0 Q;  4K6L A;  5LHY 1;  3CCU A;  5IP7 H;  2VQF Q;  5C4J H;  4IUR A;  4FVM A;  5COY A;  1G6P A;  1PZK D;  1J6Q A;  2JXM B;  2Z6K C;  2IX1 A;  1O7Y A;  5IYB G;  4DR3 L;  5K36 H;  2IHE A;  1DJR D;  4BY7 G;  1C4Q A;  2MHV A;  1KAB A;  1ILQ A;  2NVX B;  5JAV A;  5EJW A;  2O2L D;  1I4R A;  4LFA L;  2CQA A;  4RHR A;  4G57 A;  5HGQ A;  5C4J B;  3UDI A;  4KHZ A;  2NVY B;  4DV7 L;  3L0O A;  5ELE A;  3HOX G;  3STB C;  1EEI D;  3IL8 A;  4P72 A;  4BY1 B;  4FO2 A;  1D2B A;  2A73 B;  2LY7 A;  3SK8 A;  5CMD A;  1DON A;  1LAC A;  3ND9 A;  1VQ9 A;  1DD2 A;  1YNJ C;  3QOJ A;  1IYV A;  3H3V H;  3V05 A;  3V96 A;  4GKK Q;  2K4K A;  2K04 A;  1FJG L;  4DPG A;  4KHP Q;  1LTB D;  5C3E B;  5ELF A;  3PF4 A;  2JA6 B;  1NCV A;  2L11 A;  3ITP A;  2B8G A;  1I6H H;  3J81 L;  3F8T A;  3HOZ B;  4DR2 L;  2DJF C;  3GV6 A;  2ATW A;  5NUC A;  1B2T A;  4YWK A;  2I5H A;  4HJA A;  1AE2 A;  4A3I B;  1M1K C;  4JI5 L;  1NE3 A;  1WCM H;  3MZ5 A;  3BZC A;  1FJG Q;  4N8F A;  1I50 H;  3S15 H;  4A3L H;  2QDB A;  4A3D B;  3MXP A;  4YWM A;  1F9S A;  1GVP A;  2AKW B;  1Q86 C;  3A7A B;  5IGF A;  4QIW B;  2A68 C;  2YU9 B;  2JA5 B;  1G29 1;  2FXQ A;  3U4Z A;  3TP7 A;  2CHB D;  1PFN A;  3GTQ B;  1YZ6 A;  4KK7 A;  4DV1 Q;  3MFG A;  4GLV B;  2M2L A;  3HOW B;  4L5Q A;  2VS1 A;  3RR5 A;  4DUZ Q;  3NBI A;  4XQQ A;  3K8A A;  2D5D A;  2LXJ A;  4IPD A;  2UUA Q;  1ZYR C;  1VMC A;  2D62 A;  3G6E A;  3J81 c;  3BDL A;  1I50 B;  3S15 B;  3EVQ A;  4JOI C;  1XNR L;  2K5W A;  3G48 A;  1WYD A;  1ILP A;  2IL8 A;  5EPL A;  4LF9 L;  2PI2 A;  1WTQ A;  1EIH A;  4IFD H;  2LXK A;  4LUZ A;  4CDD C;  4JI7 L;  1VQO A;  2EPB A;  2A6H C;  4KN4 C;  3PIP A;  5FLM H;  3CCV A;  2NN6 H;  4IUP A;  1DGS A;  3DWQ A;  1CI3 M;  2B2U C;  4KKS A;  1XYI A;  1C7Y A;  2Z9H A;  1PMR A;  5KIX A;  3FEW X;  2RBM A;  2JQO A;  4YCV A;  2ZTE A;  5IOC A;  3S9W A;  2PYK A;  4KI0 A;  4BY1 G;  3TBI B;  5IGE A;  1KLU D;  1PYW D;  4Q0F A;  3SK6 A;  1UNS A;  4ZLT F;  4YCW A;  1B3A A;  2R7D A;  3K57 A;  3KFU A;  3WWV A;  3SE0 A;  4DV2 Q;  4OO1 G;  1BXT A;  3W2D A;  1GO3 E;  1D5Z C;  2B3G A;  3FKI G;  3G4S A;  1A2U A;  1H9M A;  2F0W A;  3HOU G;  3OWF A;  1BDO A;  3RN5 A;  4R1J A;  2I07 B;  1PZI D;  1B8A A;  1A2T A;  3RUZ A;  4GLX A;  1HTL D;  2NVX H;  5M3M H;  1AH9 A;  4DV5 Q;  1EIY B;  1LTA D;  4XYQ A;  1DYQ A;  1TS5 A;  1JMC A;  3H3V C;  3H3V I;  4KV6 A;  1OXU A;  2B39 A;  2L9H A;  1JWU D;  3A55 A;  3VA7 A;  2R7Z H;  2PQA B;  1LV9 A;  1KNE A;  2WAQ B;  5CV6 A;  1A3V A;  3D6C A;  5EQ0 A;  5EKK A;  3PUW A;  1UWV A;  1HQM C;  3H6M A;  4LF5 L;  3H91 A;  4X65 Q;  1R9T B;  3BJU A;  1K8A C;  1SND A;  1STN A;  1MD2 D;  1B9M A;  5E4W C;  5FK9 C;  3HKZ E;  1GKH A;  2EYH A;  3A5U A;  3W5O A;  1S5E D;  3WOF A;  1XPR A;  2XVS A;  4NPS A;  5CR3 A;  5DLQ E;  1QNU A;  2G9H D;  1GJX A;  4X65 L;  3S14 B;  4XDX A;  3I56 A;  1EYC A;  5EKL A;  2A6H D;  1FNV A;  1TY2 A;  1PH6 A;  4LF6 L;  1TU2 B;  1JWS D;  2F0P A;  2NYZ D;  4HAE A;  1PH1 A;  4DR4 Q;  3K5M A;  1X3Q A;  3PF5 A;  3E0J A;  5FLX E;  4DK6 C;  2F0G A;  2KHJ A;  1VQB A;  2UXC Q;  1PHJ A;  1K0S A;  1Y1V G;  4R4O A;  3F2D A;  1IBK Q;  3AYH B;  4DR5 Q;  3M4Y A;  1CKO A;  3C2P A;  1H9K A;  3HKZ G;  4DAP A;  1KAW A;  2ICI A;  4YWL A;  2F0T A;  2EYP A;  2R92 B;  4RGN A;  1EFI D;  3M4Q A;  1D5X C;  1PFM A;  1Z7T A;  1YHA A;  1RCV D;  4A3E G;  1FGB D;  1PFS A;  1QNK A;  3BZD B;  1IZ6 A;  5C0X J;  1X3G A;  3NWT A;  3NE5 B;  4DR5 L;  2X6G A;  4TQU S;  1TY0 A;  2PNR C;  2PW7 A;  5I6W A;  2MO1 A;  4B9X A;  5IGB A;  1GM5 A;  4DV4 L;  4JBK A;  4GZY C;  4GNX C;  1LO5 D;  4OO1 H;  1A15 A;  2F3V A;  2E5L Q;  5IIF A;  3J7Z C;  4ZYS A;  1HFN A;  1H9S B;  4KKT A;  4A3F B;  5J1Z A;  3G71 A;  4JW0 A;  1IKM A;  1D6E C;  3GP7 A;  4KLK A;  4OWX B;  3IAY A;  3BZK A;  4IPH A;  4C2M B;  1EEF D;  5I2X A;  4OIK A;  3CRK C;  3DHQ A;  5JVH 3;  3UE1 A;  3U9S A;  5T1G A;  3NK9 A;  2F4V L;  4OON A;  2PMZ B;  4FP5 D;  1DZ1 A;  1SYG A;  3L2P A;  2JA8 B;  3A8K E;  4J8Q A;  4JC0 A;  4YY3 L;  2K52 A;  2BCO A;  4OGQ C;  4EQ5 A;  2SOB A;  4CDE C;  1K8O A;  3M4O B;  3PMF A;  3I90 A;  4DR1 Q;  4J6H A;  2KED A;  3S1Q B;  1PYS B;  3S1M H;  1KDB A;  1RD9 D;  3RLF A;  3OWE B;  3E6Z X;  1EYD A;  1NBW A;  4KJN A;  1STY A;  3SVM A;  1BF4 A;  3PO2 H;  2A69 C;  3LX0 A;  3OIP A;  1EY6 A;  1F77 A;  3ND8 A;  4NKL A;  5IYC H;  1TT2 A;  4B3S Q;  2DN8 A;  3CW2 C;  1PRT F;  2VUM B;  3ZYY X;  4IUN A;  2IT1 A;  3J80 c;  1V1P B;  1BBX C;  1JOR A;  5M9O A;  4JI6 Q;  2FMC A;  2OQ0 A;  3MAQ A;  4CHT B;  1SNC A;  2E2H H;  2EJM A;  2HDM A;  3P75 A;  4G7Z C;  4C3H B;  2RCN A;  4A3G G;  4FF4 A;  3O13 A;  1EZ8 A;  4CBV A;  1SYD A;  4WJW A;  1HNW L;  1ENF A;  4PQX A;  5A2Q L;  4A3M H;  1JB3 A;  2NVY H;  1HXY D;  3MA2 B;  2EDG A;  2RHQ B;  4GKJ L;  5EKI A;  2B63 G;  3MXN B;  3A74 A;  1LLR D;  4HCS A;  3PUY A;  2F1M A;  1XTC D;  2B2T C;  2KHS A;  4LF4 Q;  3F2C A;  2JE6 I;  1G2S A;  1Y1V B;  5C4Z A;  5C3X A;  4GLA C;  4CKE A;  4Z9C B;  1NMF A;  4HJ5 A;  3CPF A;  3D4W A;  4K5V A;  3K0X A;  3SDZ A;  4U67 3;  1SNO A;  5CV5 A;  1XPO A;  2A1A A;  2ID0 A;  1QJO A;  2VUM H;  1OXS C;  4L6T B;  4YHH Q;  4RH6 A;  3R2T A;  4A93 H;  2Z6K A;  3FVQ A;  5J22 A;  5IYD H;  3CQZ B;  3NQI A;  1KNA A;  5C0X H;  5HUR A;  2IX3 A;  1PRT D;  1JIC A;  4DUY L;  2DY7 A;  1A63 A;  4MHE A;  1NY4 A;  4BXX G;  5GAD C;  2R7Z B;  4DGZ A;  2I5M X;  1YIJ A;  2QDL A;  1KDC A;  2CWA A;  2F0U A;  2EXD A;  3CKI B;  2UXC L;  2EZV A;  1SMX A;  2CH4 W;  4KD4 A;  3C46 A;  1UEB A;  3TS2 A;  3EA6 A;  1A62 A;  2EYO A;  5CV9 A;  1EL0 A;  1SMY C;  3U4V A;  1X65 A;  2K5N A;  2NN6 G;  1I5F A;  1KXL A;  2LFN A;  2CCZ A;  2KCC A;  2ZM6 Q;  5G3L D;  2C5C A;  1WTW A;  2ZXR A;  4DAY A;  2OWO A;  3VYS A;  2E2I B;  2QIL A;  3T13 A;  3T1H L;  1BUV T;  4GOP C;  1RTO A;  2F3W A;  3ICE A;  1QVC A;  4HED A;  1X56 A;  4FNF A;  5C44 B;  4LMQ D;  3A54 A;  3A8I E;  4BBS G;  2QA4 A;  1SFO H;  2ASB A;  2DNE A;  2XNA C;  5K5P A;  1U4L A;  1PA6 A;  5CGK A;  3DM1 A;  4PZ8 A;  3HOX H;  1RF2 D;  4DUY Q;  3SK4 A;  4A3F H;  3KF6 A;  2SDF A;  2Q2T A;  2QCP X;  3NPP A;  3R93 A;  3JC6 6;  4A3L G;  4IPG A;  2NB0 A;  2F0O A;  4QUF A;  3OSO A;  5ISR A;  5C44 H;  4AYB G;  1SRO A;  2OF1 A;  2VQF L;  4LUV A;  2OXP A;  4K6D A;  4LF8 L;  3IRB A;  5IWA L;  5IYC G;  4A3J B;  1HNX L;  5TSS A;  1W6J A;  1WTO A;  1EWI A;  3AQQ A;  2K75 A;  4DNI A;  2WAC A;  4DR7 Q;  1Q8I A;  4JI5 Q;  2OQK A;  3T1Y Q;  1K9M C;  4XIG S;  2E2D C;  1EY4 A;  2EVB A;  1MHW C;  1LTR D;  4BBS B;  4P75 A;  3VR4 A;  3OMC A;  2BE5 C;  1MIU A;  1Z47 A;  2Z1C A;  4ULL A;  1NNX A;  1LT5 D;  3J7A 5;  2JA5 H;  3T16 A;  3ER0 A;  3A5Z B;  1WTP A;  2F0F A;  3P7J A;  1VQL A;  2XGT A;  3SXH A;  4XTC S;  1RDP D;  5AFW A;  1PH4 A;  4A3I H;  4GOP B;  3CQZ H;  5ELN A;  1EY9 A;  4OHJ A;  2UXB Q;  4JV5 Q;  1HZC A;  4LFB Q;  1EY8 A;  4C3H G;  2XWB B;  4UHV A;  1F2Z A;  3HOZ H;  1AEX A;  5M3F H;  4K0K Q;  1F2Y A;  3S2H H;  1K0R A;  1VQD A;  1FNW A;  4LK1 C;  4X66 L;  2K5V A;  1HPC A;  3PV0 A;  3TDQ A;  2RKS A;  4J15 A;  3CP0 A;  4QUC A;  2G5D A;  2K5D A;  1KDA A;  1EY0 A;  2C9O A;  3Q24 A;  1X3E A;  3L3O C;  2IW3 A;  1QB5 D;  3UE0 A;  2IY5 B;  2OTJ A;  4IPC A;  3J7A F;  1NTG A;  4F8M A;  3TZD A;  1PVO A;  4DR1 L;  1Y1W H;  3CAM A;  2F52 A;  2PZW A;  1QZG A;  1GHK A;  3LWE A;  1I94 L;  3CD6 A;  3T56 B;  2QKI C;  4BBS H;  4GOP A;  1G8Z D;  5HGT A;  1N33 L;  1SDF A;  4UAI A;  2UUB Q;  1Q90 A;  4YCU A;  3NEN A;  2Z6B A;  2BOS A;  1E0B A;  4DUZ L;  1TWA H;  2F3I A;  3TME A;  2YYZ A;  2IHF A;  1F9Q A;  1PZJ D;  5M3F G;  5KNC A;  5FLX L;  1HNZ Q;  3D3R A;  4OWT B;  1BCP F;  1EOV A;  1QZH A;  1QUQ B;  3NTI A;  5LL6 X;  4KMU C;  1VF7 A;  4KN7 C;  4HIO A;  2RHS B;  1T5E A;  2Z4I A;  3VR2 A;  3RN2 A;  5M5X B;  3S2D B;  2Q8R E;  4A3G B;  3GTP H;  3NSW A;  1CZG A;  4C56 C;  4DV3 Q;  1XMQ L;  3H0G H;  1F2L A;  3K81 C;  4JI7 Q;  3GQB A;  2R6G A;  3R2I A;  4BBR G;  4IZ8 A;  3S1R B;  4JPB W;  1I4H A;  4GN4 B;  3IFT A;  3KYH C;  5LL6 S;  4K2L A;  1D8L A;  4CDC C;  4B3R Q;  3LGJ A;  3NBH A;  4C1N K;  4JI3 L;  4DF7 A;  1IL8 A;  4ZK9 B;  1R4P B;  2CFM A;  4TVA B;  3GD7 A;  1SE4 A;  4ZRZ A;  5COR A;  4A93 G;  3I4M B;  1GUW A;  4LWC A;  5FO8 B;  2A68 D;  4KY6 A;  4V19 0;  1B9N A;  4Y7N B;  3PO3 G;  1HZA A;  2D0O A;  1L1O B;  3NEM A;  4DV6 L;  3DMU A;  2WB1 G;  3E0E A;  2K5H A;  2YU9 H;  1PH3 A;  4GN3 B;  5G3L F;  3I7F A;  4RMF A;  2B8F A;  1S3O A;  1ICW A;  1OXV A;  4C3I H;  4RGM A;  1JJ2 A;  4Q5V A;  2MO0 A;  1CUK A;  1TWG H;  1Q1B A;  5D3I B;  4DAY B;  1GUS A;  4LNQ A;  1Q46 A;  2RDG A;  1DOL A;  2VB2 X;  1LUZ A;  2WIN B;  1XX8 A;  4DV4 Q;  3TP6 A;  4JI3 Q;  4NDX A;  1Y8N B;  2CKZ B;  4EQP A;  3CCQ A;  3I8Z A;  4A3G H;  1LT3 D;  2A5H A;  5M5W H;  2UXD L;  1PTO D;  4DV7 Q;  2CH4 A;  2EOT A;  2YTV A;  4HSP A;  4FF1 A;  2JP1 A;  4OWW B;  2JEA I;  1P8L A;  5I9O A;  1BR9 A;  3VR5 A;  3PIO 3;  1EWC A;  2QW7 A;  4UPA A;  3STB D;  5ELD A;  3I4O A;  1X55 A;  4DAM A;  1HTP A;  4BY1 H;  1JOO A;  4BY7 H;  5ELB A;  4K2K A;  3TZU A;  5IOD A;  3QOL A;  3M85 A;  3QB3 A;  5C4X B;  1N36 L;  1WI5 A;  3HOY H;  5C44 G;  5CV7 A;  1EY5 A;  5IYD G;  4H13 C;  3A7L A;  3RD4 A;  2J0T D;  1PYB A;  4GNX B;  2EYF A;  4DN4 M;  1A3U A;  3EN2 A;  4L8J A;  4LFC Q;  5GRO A;  2VUM G;  5J39 A;  4JBJ A;  2NZH A;  3D0F A;  1SAP A;  4DXF A;  2CVR A;  2VB3 X;  2UUA L;  3HKZ B;  2OEO A;  1M8A A;  2HCI A;  4L5R C;  4JYA Q;  1DOM A;  3ULL A;  5JEA J;  4DR3 Q;  4B08 A;  3S14 H;  1EYG A;  4HR7 B;  2E76 C;  4JBM A;  1DCZ A;  2OTL A;  1GOZ A;  2B2T A;  3G6J B;  4A3C H;  1AN8 A;  1SLJ A;  2AUK A;  3BYT B;  3GTJ B;  2K50 A;  2V1C C;  4ZAI A;  4H7B A;  1VQ7 A;  3FKI B;  3HOV H;  5KYL A;  2Z8L A;  4CJ0 B;  3NTK A;  2ZXP A;  4ME3 A;  1IL2 A;  1N9W A;  1CK1 A;  4A3M G;  1A6X A;  3KOJ A;  4L5T A;  1JJG A;  3CMA A;  2OCE A;  1A0I A;  3K59 A;  1ASY A;  5BN3 A;  2KA7 A;  1C0A A;  3TP8 A;  1YVC A;  2DUD A;  3ULJ A;  1H9J A;  1LTT D;  4JI4 L;  1PH9 A;  1MBY A;  2Q8I B;  2VY3 A;  1I6V C;  4WRD A;  2CWP A;  4TKO B;  1IHZ A;  1PRT B;  1I3Q B;  2E74 C;  5D14 A;  4NXM L;  2F4V Q;  2IJ0 A;  4A3F G;  2ZTC A;  4IUV A;  2G9D A;  2BDO A;  1QCB D;  4KKU A;  2BA0 A;  3AMU A;  3HKS A;  3CME A;  4PV1 C;  1VQK A;  3OHX C;  4UP8 A;  1VQ6 A;  2K01 A;  1JOQ A;  3JAM i;  3PO3 B;  5A35 A;  1IXR A;  2NBF A;  1EQV A;  1PH5 A;  4DV3 L;  1XMQ Q;  1IYJ B;  5GAE C;  1E22 A;  1PDQ A;  4A3E B;  2XRS D;  3Q23 A;  3VYR A;  2H5X A;  3J81 j;  4X66 Q;  3GTO B;  2VQE Q;  5HY6 A;  4EGV A;  1SBB B;  1SFO B;  1S4Z A;  2AUJ D;  1W2B A;  2ZTD A;  4KY5 A;  4R4C A;  3L7Z C;  2HHH L;  2K7V A;  2E2I H;  3OOC A;  2N49 A;  1QG7 A;  3SGI A;  1RIP A;  4A3B H;  4QMG A;  1JCK B;  3DLL A;  1VQG A;  2ZJQ A;  2JA6 G;  3NBH B;  1SNM A;  2Y0S E;  1BKB A;  4X62 L;  3VYU A;  1XMO Q;  1Y14 B;  2PZT A;  4RHS A;  3F2U A;  5IT9 L;  4A3K H;  4LAA A;  1SNP A;  4Y7N H;  2B2W C;  3KDF B;  5GQO A;  5ELO A;  1HZB A;  3CRL C;  3I4M H;  1NR2 A;  3BS1 A;  1S40 A;  1HNZ L;  1C8C A;  2JA8 G;  3PUV A;  4H44 C;  2WKD A;  2XN9 C;  3MXU A;  4N9P A;  4RCO A;  1BO0 A;  5H1S E;  3T53 B;  4L63 B;  1RTN A;  1O7I A;  2F0I A;  1Z6H A;  3RMH A;  1X6O A;  3DEO A;  3S1R H;  2HCC A;  1PLF A;  4MNO A;  1UE5 A;  3B6Y A;  1BCP D;  4F87 A;  3GTJ H;  2FFK B;  4NW2 A;  4BXX H;  1E2V A;  3E3X A;  3FKI H;  5CV8 A;  4FF3 A;  4HIM A;  1KL9 A;  3EIV A;  3HFZ B;  5M5X H;  1D5M C;  3EBE A;  3D8G A;  4ILW A;  1EQQ A;  1JR0 D;  2MJ8 A;  4LFC L;  1YNX A;  2HUG A;  2LS0 1;  2IWH A;  2IPK D;  3KLS A;  3JAM E;  1V43 A;  4DV0 L;  2NVQ B;  1CM9 A;  1JJC B;  2WII B;  3KF8 B;  2E2J B;  4DR2 Q;  5LMU Q;  1JB7 A;  3J80 L;  5JPM C;  3PUX A;  2M9V A;  1QOH A;  2WB1 E;  4IOC A;  4JOI A;  3PUZ A;  1GD7 A;  1VQF A;  2J4X A;  2RDH A;  3C1E A;  4IN3 A;  2E75 C;  4A3I G;  4ID6 A;  5C4X H;  2MQH A;  2NZO A;  2NVT B;  1C9O A;  1PRT C;  2V4D A;  1XNQ L;  3MVV A;  3NEL A;  1J5E Q;  3H15 A;  2ZM6 L;  2EYM A;  4TSS A;  3UI2 A;  2TMP A;  4JCV E;  5GAG C;  2AWN A;  3KLW A; 
#chains in the Genus database with same CATH homology
 4DR7 Q;  4NB3 A;  4MZ9 A;  4R4T A;  3H3V H;  4JI5 Q;  2OQK A;  1N32 Q;  3T1Y Q;  1KHI A;  1K9M C;  2K4K A;  1L1O C;  4XIG S;  4GKK Q;  4K0K L;  1SR3 A;  4DPG A;  2Q2H A;  1IBK L;  1FJG L;  4KHP Q;  4PG3 A;  3PF4 A;  1I6H H;  4P75 A;  4X64 Q;  1M90 C;  4PMW A;  1MIU A;  1NJI C;  4A3J G;  2JK8 A;  3F8T A;  4APV A;  1Z47 A;  4DR2 L;  4LF8 Q;  2ATW A;  2HT1 A;  1E24 A;  1L2F A;  5LMU L;  2Q2U A;  3J7A 5;  3PGZ A;  1Y1W G;  1PH7 A;  2JA5 H;  4LF7 Q;  4LF9 Q;  4YWK A;  2I5H A;  3ER0 A;  4HJA A;  1AE2 A;  4JI2 Q;  4LFA Q;  3A5Z B;  4JI5 L;  1NE3 A;  4A4I A;  1WCM H;  4HID A;  1M1K C;  4DR6 L;  3BZC A;  3M4P A;  1FJG Q;  1FGU A;  2RF4 A;  1HJP A;  1VQL A;  2XGT A;  4IOA A;  1I50 H;  3S15 H;  4XTC S;  4A3L H;  1TWH H;  4X64 L;  4DNI A;  4A3I H;  1PH4 A;  4JI6 L;  5C4X G;  2ES2 A;  4GOP B;  4YWM A;  1Q86 C;  1GVP A;  2AKW B;  3CQZ H;  5ELN A;  1TWC H;  5IWA Q;  1G29 1;  2FXQ A;  3U4Z A;  1IBL L;  3M3Y H;  2UXB Q;  4JV5 Q;  1HZC A;  2VL6 A;  5EAY A;  3S16 H;  2JA9 A;  1YZ6 A;  4LFB Q;  1IBM L;  4R4Q A;  4DV1 Q;  4GLV B;  3HOZ H;  1E7Z A;  3AFP A;  4L5Q A;  4FDB A;  2E5L L;  5M3F H;  5IY0 A;  4JI2 L;  3T1Y L;  4GKK L;  2VS1 A;  4K0K Q;  3RR5 A;  4DUZ Q;  3FP9 A;  3S2H H;  2WAQ E;  1TXY A;  3K8A A;  1K0R A;  2LXJ A;  1VQD A;  2JA8 H;  4IPD A;  4X66 L;  2K5V A;  2UUA Q;  4GKJ Q;  3PV0 A;  3PCO B;  4A76 A;  4J15 A;  2D62 A;  1VQ4 A;  3G6E A;  3CP0 A;  3J81 c;  4JOI C;  1N33 Q;  4BBR H;  2QEX A;  1XNR L;  3HOZ G;  1X3E A;  1VQP A;  3G48 A;  4LFB L;  1WYD A;  4JV5 L;  3UE0 A;  1S72 A;  1U5K A;  4LF9 L;  2OTJ A;  2IY5 B;  2PI2 A;  4IPC A;  2BH2 A;  1K8G A;  5C0X I;  2LXK A;  4LUZ A;  1NTG A;  4JI8 L;  1PVO A;  4JI7 L;  4DR1 L;  1VQO A;  3CAM A;  1Y1W H;  2F52 A;  3CC7 A;  4DR6 Q;  3PIP A;  5FLM H;  2QGQ A;  3CCV A;  1QZG A;  1DGS A;  2VQE L;  1I94 L;  4B3M L;  3CD6 A;  1HH2 P;  1C7Y A;  3Q8D A;  4POF A;  2N78 A;  2JQO A;  4YCV A;  2ZTE A;  4BBS H;  4GOP A;  1G51 A;  4OXP A;  2WP8 J;  4KI0 A;  5BR8 Q;  4BY1 G;  4X62 Q;  1N33 L;  2UUB Q;  3HOU H;  3M7N A;  3PO3 H;  4YCU A;  2Q2I A;  4IJH A;  3NEN A;  1PH8 A;  2HHH Q;  4YCW A;  1OXX K;  4P74 A;  1HR0 L;  1LM0 A;  2R7D A;  3KFU A;  3WWV A;  4DUZ L;  4QIW E;  4DV2 Q;  5M5Y H;  4OO1 G;  4AH6 A;  1TWA H;  2F3I A;  2I0Q A;  2L15 A;  2YYZ A;  2IHF A;  1GO3 E;  3S17 H;  5M3F G;  3FKI G;  2B3G A;  1HNZ Q;  4B3T L;  3G4S A;  4JI4 Q;  4OWT B;  3I4M G;  1EOV A;  1QZH A;  3HOU G;  1QUQ B;  2UU9 L;  3UDX A;  4HIO A;  3RN5 A;  2A8V A;  4R1J A;  1YJ9 A;  3VDY A;  2RHS B;  1YJN A;  3RN2 A;  1B8A A;  4AQY L;  4GLX A;  1PH2 A;  4HJ7 A;  3GTP H;  2WAQ G;  2NVX H;  4DV3 Q;  1XMQ L;  5JJI A;  3H0G H;  5FLX c;  3K81 C;  4LF5 Q;  4JI7 Q;  5M3M H;  1AH9 A;  4DV5 Q;  1EIY B;  1XPU A;  2JA7 G;  2R6G A;  4B3M Q;  1L1O A;  1JMC A;  4BBR G;  2B29 A;  2R92 H;  1X3F A;  5IYB H;  3H3V I;  3S1Q H;  2PI2 E;  3W1B A;  1OXU A;  1YHB A;  1MJE A;  1VS0 A;  5FLM G;  3CPW A;  3A0J A;  3TRE A;  5LMN Q;  4GN4 B;  3KYH C;  4LF6 Q;  1U0L A;  5BR8 L;  3TRZ A;  4IFD J;  2R7Z H;  2PQA B;  3HOW G;  1D8L A;  2KBN A;  1N34 Q;  2UUB L;  4IJL A;  1T9H A;  2VW9 A;  3LGJ A;  4B3R Q;  1B7Y B;  1SRU A;  4JI3 L;  1MJC A;  2NN6 I;  2JA5 G;  3F2B A;  3PUW A;  1UWV A;  2CFM A;  4TVA B;  3GD7 A;  4LF5 L;  2UXD Q;  2BA1 A;  4DV5 L;  4X65 Q;  4A93 G;  1SE8 A;  4LWC A;  1FL0 A;  4A3D G;  3BJU A;  4QJF A;  1K8A C;  3HOW H;  2R7Z G;  3PO3 G;  1HZA A;  2D0O A;  4LF4 L;  1L1O B;  3NEM A;  3HKZ E;  1GKH A;  3A5U A;  2WB1 G;  3W5O A;  3E0E A;  3ERS X;  4DV6 L;  2K5H A;  1N34 L;  2YU9 H;  1WCM G;  2KHI A;  1KC8 C;  1PH3 A;  4GN3 B;  2VNU D;  3I7F A;  4RMF A;  1XPR A;  1S3O A;  3HOY G;  4NPS A;  3TQY A;  2Y0S G;  1OXV A;  4C3I H;  1CKN B;  3U58 A;  3F1Z A;  5DLQ E;  1JJ2 A;  1CKM A;  2MO0 A;  4OX9 L;  1CUK A;  1VQC A;  2XTI A;  1BBU A;  1TWG H;  1Q1B A;  4C2M H;  3D31 A;  4DAY B;  4X65 L;  3PIO A;  3I56 A;  2HIV A;  3PO2 G;  1Q82 C;  1LYL A;  4LNQ A;  5C3E G;  1Q46 A;  1K73 C;  1V1Q A;  2MFI A;  1PH6 A;  4LF6 L;  1LUZ A;  4PZ6 A;  4AYB E;  4DV4 Q;  3K7A H;  1PH1 A;  2GN5 A;  4DR4 Q;  3PF5 A;  4JI3 Q;  3E9H A;  2CKZ B;  4LW1 A;  1KRT A;  4DK6 C;  2KHJ A;  1VQB A;  5GAH C;  3CCQ A;  1PHJ A;  4A3G H;  3CCL A;  1E1O A;  1Y1V G;  4R4O A;  5M5W H;  3F2D A;  1IBK Q;  4KHP L;  2R93 G;  4HIK A;  4DV7 Q;  2UXD L;  1V9P A;  2YTV A;  3AYH B;  4P73 A;  4DR5 Q;  1N36 Q;  1CKO A;  3BU2 A;  3HKZ G;  1W3S A;  3GTG H;  1KAW A;  1Q12 A;  2A19 A;  4OWW B;  2JEA I;  1P8L A;  4YWL A;  1VQ9 A;  2PMZ E;  4UPA A;  3STB D;  3M4Q A;  3I4O A;  3E9I A;  3RLN A;  1X55 A;  4DAM A;  4NXN Q;  1NMG A;  4BY1 H;  4BY7 H;  4R4I A;  3RZD H;  1YHA A;  3HOV G;  3AFQ A;  4A3E G;  4BA2 I;  4L5S A;  4O0A A;  1HZ9 A;  1YEZ A;  5AJ3 L;  1PFS A;  4BA1 I;  3M85 A;  2IX0 A;  1D7Q A;  1IZ6 A;  5C0X J;  1X3G A;  3FHW A;  4DV0 Q;  1TWF H;  1JT8 A;  4DR5 L;  1WI5 A;  1N36 L;  3HOY H;  3KJP A;  4TQU S;  5C44 G;  3OTO L;  5IYD G;  1LTL A;  3S1N H;  3K80 C;  2MO1 A;  4MTN A;  5C0X G;  3CCM A;  4JG2 A;  4ALP A;  1OXT A;  1GM5 A;  1E3P A;  4A75 A;  2AMC B;  1PYB A;  3DM3 A;  4DV4 L;  4GNX B;  4JBK A;  4LF7 L;  2PQA A;  4GNX C;  4LUO A;  4NXN L;  3EN2 A;  3KJO A;  4LFC Q;  5GRO A;  2E5L Q;  2VUM G;  5FJ8 G;  3J7Z C;  1VQH A;  1XJV A;  4C3H H;  5JJL A;  4JBJ A;  2NZH A;  3D0F A;  4H02 A;  1N8R C;  4JI0 L;  4WJ3 M;  3G71 A;  2K14 A;  2UUA L;  4IFD I;  2E2J H;  1B70 B;  1EUJ A;  3CCE A;  2ZJP A;  2JA7 H;  4KLK A;  2EQS A;  2KEN A;  3UDF A;  4OWX B;  3BZK A;  3OTO Q;  4L5R C;  4JYA Q;  4IPH A;  3ULL A;  5JEA J;  4DR3 Q;  3S14 H;  1EYG A;  3CXC A;  3OYY A;  1HNX Q;  3UE1 A;  4JBM A;  2JJQ A;  3TEH B;  3TS0 A;  2OTL A;  4A3C H;  2F4V L;  4IO9 A;  1SLJ A;  4OON A;  2K50 A;  2V1C C;  1ASZ A;  3L2P A;  5AJ3 Q;  4UP7 A;  3GTQ H;  1VQ7 A;  2DGY A;  4JC0 A;  3HOV H;  5IE8 A;  2K52 A;  4YY3 L;  4EX5 A;  1XNQ Q;  4EQ5 A;  4QGU A;  2D0P A;  1WOC A;  4ME3 A;  1IL2 A;  1N9W A;  1JE5 A;  5IT9 c;  1XNR Q;  1VQ8 A;  4A3M G;  3OW2 A;  2WFW A;  2JEB I;  1VQM A;  3KOJ A;  1L0W A;  4L5T A;  4QY7 A;  1JJG A;  3CMA A;  2OCE A;  1A0I A;  1Q7Y C;  1QVF A;  4HJ9 A;  4DR1 Q;  1ASY A;  2B63 H;  3I4N G;  1N32 L;  1PYS B;  2I5L X;  4A3D H;  2AHO B;  3S1M H;  1C0A A;  2CQO A;  3I2Z A;  4DKA C;  3M4O H;  3RLF A;  1VQE A;  2KCM A;  2HIX A;  1YVC A;  2AWO A;  2DUD A;  3ULJ A;  1QVG A;  4JI4 L;  1PH9 A;  1EIF A;  1NBW A;  5IP7 G;  2VY3 A;  2ALY B;  5J3B A;  4C3J H;  3PO2 H;  4Y52 H;  2CWP A;  2JA6 H;  1IBL Q;  1K3R A;  1UE6 A;  1OTC A;  1WJJ A;  4JI1 Q;  1Q1E A;  4A3B G;  2GVB A;  5IYC H;  1WFQ A;  4NXM L;  1VQA A;  2F4V Q;  1P16 A;  3UDG A;  4A3F G;  2ZTC A;  4B3S Q;  3CW2 C;  4IFD G;  1UE1 A;  1VQN A;  5C3E H;  2BA0 A;  2IT1 A;  5LMN W;  4A3C G;  3H0G G;  3J80 c;  3HKS A;  3CME A;  4UP9 A;  4JI6 Q;  1VQK A;  1AE3 A;  4UP8 A;  2UU9 Q;  2OQ0 A;  1VQ6 A;  2YTX A;  3GTK H;  1CSP A;  5K36 G;  1A8V A;  3JAM i;  2E2H H;  2UXB L;  4GN5 A;  1KRS A;  2RCN A;  1IXR A;  4A3G G;  1IBM Q;  4DV1 L;  4PZ7 A;  1VQI A;  4QL5 A;  4DV3 L;  1XMQ Q;  3ZJY C;  1IYJ B;  5GAE C;  3CCS A;  1PH5 A;  1KIX A;  4NXM Q;  1E22 A;  1HNW L;  3KDF A;  4A3M H;  4B3S L;  4WJ4 A;  2NVY H;  2NVT H;  2H5X A;  3S24 A;  5IP9 H;  3J81 j;  3CC4 A;  2RHQ B;  4X66 Q;  3RLO A;  4GKJ L;  2VQE Q;  1XTD A;  5HY6 A;  1I94 Q;  4POG A;  3I4N H;  3CF5 A;  2B63 G;  3RZO H;  4JBW A;  3MXN B;  3A74 A;  3PSI A;  3PUY A;  4LF4 Q;  4O2D A;  1W2B A;  1VCI A;  2R92 G;  2ZTD A;  3K7U C;  3RNU A;  4YHH L;  4AIM A;  3I55 A;  4JI1 L;  1KQS A;  4R4C A;  3F2C A;  5M3M G;  1Z9F A;  3L7Z C;  1Q81 C;  2JE6 I;  2HHH L;  2E2I H;  1YHQ A;  3CC2 A;  4JI8 Q;  1YBY A;  2YTY A;  2N49 A;  2HQL A;  4GLA C;  3SGI A;  2NVQ H;  1RIP A;  4A3B H;  4QQB X;  1RL2 A;  4RG1 A;  3DLL A;  2Z0S A;  1VQG A;  1NMF A;  4HJ5 A;  3CPF A;  2ZJQ A;  3NBH B;  2JA6 G;  1EQR A;  1BBW A;  3K0X A;  3AEV A;  2Y0S E;  2ZJR A;  2UUC Q;  2BH8 A;  1YI2 A;  1XPO A;  3CCR A;  2A1A A;  2ID0 A;  2MNA A;  1BKB A;  3GO5 A;  1E1T A;  1I3Q H;  1VQJ A;  4X62 L;  1XMO Q;  1VQ5 A;  2VUM H;  1OXS C;  1Q8K A;  1Y14 B;  2VZA A;  4DR4 L;  4YHH Q;  4UY8 C;  4A3K H;  1K83 H;  1HR0 Q;  1CKN A;  1YJW A;  4Y7N H;  1HNW Q;  4DK3 C;  2KCT A;  4A93 H;  2C35 B;  3KDF B;  2Z6K A;  5ELO A;  1HZB A;  5GQO A;  4DV2 L;  1YIT A;  1KD1 C;  4OX9 Q;  3GTL H;  3I4M H;  3MEF A;  5IYD H;  5JJK A;  1S40 A;  1PV4 A;  2R93 H;  2GVA A;  1HNZ L;  4B3T Q;  2N8N A;  2JA8 G;  5IP9 G;  3PUV A;  4DUY L;  1QUQ A;  4A3K G;  1A63 A;  1NY4 A;  4BXX G;  5GAD C;  5H1S E;  2I5M X;  5FJ8 H;  4AQY Q;  1YIJ A;  1MKH A;  2CWA A;  3JAM c;  1XMO L;  4B3R L;  1O7I A;  1CSQ A;  2EXD A;  1X6O A;  1BVS A;  3S1R H;  4X6A H;  4P71 A;  2UXC L;  2R7F A;  3M9B A;  4MNO A;  1SMX A;  4OO1 I;  1UE5 A;  3B6Y A;  5E7N A;  1UEB A;  3TS2 A;  2UXC Q;  1A62 A;  4GNX A;  2PNH A;  3GDE A;  5JEA G;  2EIF A;  2LSS A;  3U4V A;  1UE7 A;  3GTJ H;  1X65 A;  2K5N A;  3KF6 B;  4BXX H;  2NN6 G;  3U50 C;  1I5F A;  1J5E L;  2UUC L;  1X54 A;  2CCZ A;  1KXL A;  3FKI H;  5LMN L;  1R9T H;  2ZM6 Q;  1KL9 A;  4HIM A;  3EIV A;  3HFZ B;  5M5X H;  2N3S A;  3EBE A;  1HR0 W;  1SN8 A;  4DV6 Q;  1EFW A;  4A3J H;  2OWO A;  1EQQ A;  4DR7 L;  1Y1V H;  3J81 i;  4HJ8 A;  4LFC L;  1YNX A;  2E8G A;  3ULP A;  3T1H L;  4GOP C;  4GS3 A;  3J80 i;  3ICE A;  1QVC A;  4JI0 Q;  1X56 A;  1V43 A;  3CCU A;  4DV0 L;  5IP7 H;  2VQF Q;  1FVI A;  3GTM H;  4BBS G;  2QA4 A;  1X9N A;  5C4J H;  1SFO H;  2ASB A;  1G6P A;  1JJC B;  1J6Q A;  1PA6 A;  3KF8 B;  4PZ8 A;  3HOX H;  4DUY Q;  2Z6K C;  4DR2 Q;  2IX1 A;  2YV5 A;  5IYB G;  4DR3 L;  1H95 A;  2IHE A;  5LMU Q;  1JB7 A;  4BY7 G;  3PUX A;  4A3F H;  3KF6 A;  4A3E H;  2Q2T A;  3JC6 6;  2WB1 E;  4IOC A;  4JOI A;  4A3L G;  4IPG A;  3W1G A;  4LFA L;  3PUZ A;  1GD7 A;  1VQF A;  5HGQ A;  3T1H Q;  3S2D H;  3GTO H;  4A3I G;  3UDI A;  5C4X H;  2MQH A;  2NZO A;  4KHZ A;  5C44 H;  4DV7 L;  1C9O A;  3L0O A;  4AYB G;  1SRO A;  4YY3 Q;  3HOX G;  2VQF L;  3STB C;  3CCJ A;  4LUV A;  1XNQ L;  4JYA L;  1J5E Q;  3NEL A;  4P72 A;  4LF8 L;  3IRB A;  3H15 A;  5IWA L;  2ZM6 L;  5IYC G;  1HNX L;  1EWI A;  3AQQ A;  2K75 A;  4JCV E;  5GAG C;  2AWN A;  3KLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...