1V8QA

Crystal structure of ribosomal protein l27 from thermus thermophilus hb8
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
b'RLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TT0826
publication title Crystal structure of ribosomal protein L27 from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Translation
total genus 17
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01016 Ribosomal_L27 Ribosomal L27 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v8qA00
2BE5D 1V8QA 1I6VC 3T51B 2A6HC 2KA7A 3ND8A 5BN3A 1GJXA 3A7LA 4XIGS 1CTMA 2R6GA 3N6RA 2YYZA 3SDZA 2A6EC 3GD7A 3VA7A 3LNNA 1H9JA 1IW7C 2DN8A 1OXXK 3PUVA 1H9SA 5C0XH 3M85A 2O5JC 3D31A 1H9SB 1Q12A 1GHKA 2V4DA 1K8MA 1DCZA 2D2CC 1A6XA 1YNNC 1V43A 5JEAG 1HPCA 3NE5B 3A7AB 1Q90A 3OOCA 3P20A 4BA1I 3QJYA 2D5DA 1FYCA 4JBWA 2BDOA 3PUYA 1Y8NB 2PNRC 3BG3A 3OW7A 4I7ZC 3VR6A 1CFMA 1Q1BA 4IFDG 4OO1H 1O78A 2BA0A 2O5IC 2A69D 2EJGC 2K7VA 2KCCA 1FR3A 1TU2B 1TKWB 3M7NA 3GQBA 5C0XG 4G7OC 3SE0A 5JEAH 3H94A 3HGBA 2BE5C 4IFDH 2DNCA 4KHZA 1HCZA 2EJMA 1OXSC 1ZKOA 4DK1A 4H13C 1B9NA 2NN6I 2K33A 3KLRA 4LJZC 4OO1G 4KN4C 1H9MA 3VR3A 1VCIA 3LWUA 1Q1EA 3I72A 2JEAI 2E74C 1ONLA 1OXTA 5BN4A 1Y69U 3PUWA 2A68D 1IYUA 1GUOA 3QIAA 3IFTA 4TQUS 3FPPA 1E2VA 4XTCS 3I73A 1Y8PB 3A8KE 4KKSA 2JE6I 4RCNA 3PV0A 1GHJA 4DNTB 1K8OA 1T5EA 1VF5C 2K32A 3A8IE 2E75C 4H44C 2A69C 3D4RA 2JEBI 2EVBA 4JK1C 3T53B 3U9SA 1DD2A 2AUJD 3W3AA 3MXUA 2JXMB 3FMCA 4PV1C 1B9MA 3ND9A 2D62A 1GUSA 3IKJA 2BA1A 4HR7B 1GUTA 1H9KA 1EWHA 1E2WA 1IYVA 1CI3M 1QJOA 3QG1A 1E2ZA 1H9RA 2CW0C 5KNBA 5K36H 2PPBC 1G291 4BA2I 2B8FA 1Y8OB 2NN6G 3DXJC 1LABA 1YNJC 2QF7A 3A8JE 3OPOA 4LK1C 4KN7C 4L8JA 3I4LA 4KKUA 2AUKA 2AWOA 1DXMA 4DNRB 2A68C 2L5TA 3M4YA 1GUGA 1Z6HA 2A6HD 3AB9A 1PMRA 2NN6H 1VF7A 3TZUA 1HQMC 2Q8IB 4DK0A 5KNDA 2DNEA 2A6ED 3VR4A 1O7LA 4OGQC 3CRKC 4H0LC 1IW7D 2LMCB 3RLFA 3VR2A 5BN5A 5K36G 3L7ZC 2EDGA 4TKOB 4KMUC 4KI0A 2E76C 4GZYC 1HTPA 4KKTA 5KNCA 3WDNA 2ZT9C 2B8GA 4IQZA 4G7ZC 1GUNA 3EQLC 2PCFB 4G7HC 3T56B 3PUZA 3CRLC 1LACA 1SMYC 3VR5A 5A35A 1OXVA 2IT1A 3PUXA 3MFYA 1OXUA 1VDZA 3BDOA 2F1MA 1ZYRC 2EJFC 1BDOA 1Z7TA
chains in the Genus database with same CATH superfamily
4RFBA 1PXUA 2RKSA 1OO9B 4J6HA 1WTPA 2NZHA 3T1YL 3PO2G 4NXNQ 5LMNW 1F2LA 1PFBA 3I7FA 3MZ5A 5EJWA 5CV5A 2ZM6L 2ICIA 3GTJB 1EQVA 4BA1I 5BR8Q 4B08A 3OW7A 3R2IA 2JA5G 2BA0A 1STNA 2YTXA 3NTKA 2F0VA 1N34L 1AZPA 5M3FB 4DR6Q 4G7OC 1SNCA 1QUQB 1LTLA 1V1QA 4IFDH 3OW2A 1EY6A 2F0EA 2ATWA 4H13C 3GDEA 2K14A 3I90A 2K5QA 5CGKA 1N36Q 3AFPA 2HUGA 3BJUA 4ME3A 5M5WH 4OWXB 4JW0A 5BN4A 3A74A 5C3EG 4JI7Q 1T9HA 2B3GA 4XT3B 1PRTD 5G3LF 1XMQQ 4RGNA 1TWFH 2PZUA 1V1OA 3S1NH 3DM1A 1S4ZA 1VF5C 3C1EA 3OMCA 1CKOA 1JB7A 3D4RA 5JJLA 1VQGA 2JXMB 1D8LA 3P1HA 1BBUA 1XMOQ 1EY4A 4HMIA 4J1MA 4CKEA 4DXGA 3S2DB 1KAAA 1T5XD 3GTGH 1SAPA 4A93H 1LT3D 5ELCA 4L8JA 3MXGA 2N55A 5KGUA 5LL6X 1EYGA 4A3MG 4JI3Q 3WOFA 3NENA 1PV4A 1TWHB 5IGBA 1JJGA 1EIYB 1TXYA 2ZXRA 4NB3A 3VR4A 1B2TA 4OO1I 3BZDB 3H3VC 3Q6SA 3VR2A 3HEJA 3OMGA 2AWNA 2EYJA 5CBEE 4KMUC 3HOXB 1E1OA 1TS5A 3WDNA 2DGYA 5C44B 3TREA 3EQLC 3GTPH 1PH8A 4JI5Q 1VMPA 1PRTB 3CAMA 2LXJA 4IJHA 2B2UC 3K7AH 3MWYW 4CGYB 4X64L 4GKJL 2A6HC 1GXDC 3D4DA 4LWCA 1VQBA 1LYLA 4OL7A 2HDLA 2NVQH 2ID0A 1C4QA 1JB3A 1QNUA 2TSSA 4YCUA 1TWGH 3PUVA 4QUFA 1PA6A 1JC7A 3LWEA 1EQRA 1EEFD 1HPCA 2X6LA 3OOCA 4S3SA 4XQQA 5FLXE 3S16H 3H6MA 2BDOA 4MHEA 4ZK9B 4J15A 3SK6A 3UDIA 1W6JA 2IX1A 2LS01 1B4OA 4A3GB 2KCCA 1NCVA 2Z8LA 4CDCC 3MVVA 3RZOH 4A3KG 2R7DA 5COYA 1UE6A 2JA8H 2EYHA 5G3LD 1H95A 1STYA 1KQSA 1WCMG 2E2HB 1A15A 3FHWA 1MD2D 4NKLA 2F4VQ 4BY1G 3KLRA 1EWCA 1Z9FA 4IPDA 4XDXA 5EQ0A 1BVSA 1Q81C 1I6HH 3L2PA 3HOZB 4OIKA 4R1JA 2A68D 1W6KA 4KK7A 5FO8B 5IGDA 1WTVA 3FPUB 1HNZL 1RIPA 3BYYB 5IWAL 1IKMA 3PV0A 1GHJA 4JI4Q 1IYVA 2A69C 3VYRA 5IYCH 4QQBX 5L37A 1N8RC 3I4MB 1EY0A 3QR8A 1B9MA 2ZM6Q 1F77A 1WVLA 5JPMC 2MNAA 3PSIA 1P16A 1WI5A 2MJ8A 4EQPA 1H9RA 1I4QA 2BOSA 4JOIC 5IT9L 3MFGA 4C3IG 1X65A 2EIFA 3EBEA 3S9WA 1XXGA 1N34Q 4A3FH 2XRQD 1DM0B 1WTQA 3H09A 3OSOA 4H0LC 4HCEA 4FDBA 5IIFA 2VNUD 2QW7A 3E9IA 4P71A 2R92G 4JI8L 4GZYC 2BCOA 1QE6A 1LO5D 2M00A 4K8IA 4C2MB 4OXPA 1WTWA 3GTQB 5EPKA 3DWQA 3VR5A 3FRPB 3PUXA 5D14A 5TSSA 1ZYRC 3QO2A 4AH6A 1YITA 3ERSX 2BE5D 2JA7H 1X3EA 2MFIA 2ZXPA 2SDFA 1RF2D 2EYOA 3MEHA 2NVYB 2F0UA 4BBSH 1TWAH 1B44D 2I5MX 3IFDA 1L2FA 1X3FA 2QDBA 5J1ZA 1C48A 4BXXH 3VYUA 4HEDA 2MO1A 4LF4L 2B2WA 2EYMA 5GADC 1EU3A 4HTHA 3FP9A 3OWEB 3S1RB 1X56A 1WJJA 5LMUL 4HJAA 4J8QA 1QUQA 3J7A5 5ELEA 1ZKOA 5H1SE 5A2QE 2J7ZA 4AQYL 1U4MA 2QA4A 4LJZC 2Q2UA 3D6CA 2R3ZA 1PTOD 3LWUA 2WB1G 1OXTA 1GUOA 3HOVB 2WIIB 5CV7A 4O0AA 1FGBD 4JYAL 1VQCA 3FVQA 3KK7A 1KDAA 2A1AA 4MTNA 3MTSA 3AQQA 1L0YB 3OIQA 4LAAA 4IN3A 1X3QA 3GTMH 3C2PA 2AUJD 1I3QH 4C3HH 3RZDH 1XYIA 2R7FA 1EQTA 3IKJA 4HR7B 3M4OH 1JWMD 2K75A 4DV1L 1YHBA 2L4NA 3W1GA 2CW0C 4YHHQ 3I4NG 3AYHB 1G291 3BU2A 1IBKL 2PW7A 1LABA 4LW1A 2FINB 1EWIA 4MTKA 1I5FA 3S15B 2UXCL 3FKIH 1S5FD 3ZJYC 2L9HA 2A6ED 2NVXB 3K5LA 5M5XH 1RODA 1DYQA 4DKAC 4B3TL 2HIVA 1PFNA 1ML0D 1YI2A 2Z4HA 1CA5A 2CH4A 2D9UA 4QB4A 5I4DA 1PTOB 4GNXB 5KRUA 3E0JA 1GUNA 2RDGA 1B3AA 4IFDI 1HH2P 4ZKCB 1N9WA 3TMEA 1PFMA 3CP0A 5IWAQ 4X62L 2B63G 1XWEA 3SK8A 4ZRZA 2NWGA 1GD7A 1Q3LA 3I2ZA 3HKZG 1YJNA 3MEFA 4C3JH 2EY5A 1SNDA 1RTOA 1EY9A 1CTMA 3D4WA 3H0GB 3N6RA 1MSGA 3E5SA 4FXDA 2L11A 2E8GA 4FP5D 2KECA 2H1EA 1DOKA 4HMJA 4ILWA 4GOPA 1GHKA 4RAUC 1PYSB 4LFCL 3S1QB 1PZID 2Z1CA 2NYZD 3S2HH 4BY7H 5C6AA 1CFMA 3TN2A 1GUWA 1LT5D 3OYYA 3KFUA 1GKHA 2NVTB 3BDLA 1RTNA 2VS1A 4K6DA 2Z4IA 5D3DA 1E7ZA 2F0LA 4JI8Q 4HIDA 1KC8C 3AEVA 2WAQE 2EPBA 4JVZA 3UE1A 1NNXA 3T4AC 2VB2X 4HIOA 1EQQA 5E4XA 2JEAI 4A3DG 3DMUA 4CDFC 5DM73 1N33L 3HOZG 1QILA 4YCWA 4WJWA 3A54A 4A3BB 1D6EC 2XIWA 4YY3L 3DHQA 3S24A 1EY7A 4XYOA 1WTHA 3HOUH 1C7YA 1ET9A 1YNXA 5J39A 3I4MG 4PV1C 3ND9A 1S5DD 3PO3B 2D62A 2F0IA 3U50C 1CSPA 2KUMA 4LF4Q 1QJOA 5HY6A 3K7UC 2B8FA 4DK6C 3A8JE 3OPOA 2WP8J 3I4LA 1G2SA 1NSNS 3J7AF 1KNAA 1EIFA 2UU9Q 2IX0A 2D0OA 3AB9A 1II3A 3GV6A 2DNEA 1IW7D 3RLFA 1XJVA 1G6ZA 1YVCA 3NK9A 3P75A 4IURA 3K5MA 4IPGA 5ELBA 2B8GA 4HJ7A 1HHVA 3T56B 2YU9H 1FGUA 2H5XA 4LF5Q 2ES2A 1SNMA 3SXHA 1WTXA 2B2WC 4PZ6A 4DAVA 4EQ5A 3I70A 1JORA 1I6VC 1Z47A 1K3RA 4HAEA 1EYCA 4X3SA 1SFOH 3HOWG 2C5CA 4AYBE 2L15A 5FLXL 3S17H 4NDXA 1Q12A 1HR0W 5EBCA 3EIVA 3K0XA 3M9BA 2R93H 4R4CA 1IZ6A 1SYBA 3VR6A 3BVZA 2UXCQ 2IJ0A 4HIMA 2FXQA 1PH1A 1DZ1A 1SYDA 2XTIA 3CMEA 5M5WB 5GAHC 3GTLH 1RL2A 4IUQA 5FLXc 5JJKA 1Q8IA 4AIMA 2FHTA 1TWFB 1F9SA 1MBYA 1HUMA 1K3BC 3CQZH 1PH5A 4CKCA 4X6AH 3DUZA 3M7GA 3PUWA 1VQOA 1NR2A 3IFTA 3MAQA 1TWCH 4LFBL 2Y0SB 1ENCA 3KYHC 1SYEA 3PQIA 5KIXA 1SMXA 3I4OA 2E75C 5C4JH 3T53B 3RN5A 3GTGB 2JYOA 1E1TA 3J80c 2PYKA 4PZ8A 4A93B 2K6AA 3M3YH 1Q46A 5I9OA 5M3MH 1A3UA 4H02A 3IL8A 5LL6S 3NTHA 1NUCA 3QG1A 4MIUA 5DLQE 1TS4A 3TP7A 5K36H 3H91A 3DXJC 4N8FA 3KBXA 5I2XA 4X66L 1QZHA 4DN4M 3UDFA 4POFA 4UY8C 3EA6A 3M4YA 4HJ5A 1D7QA 1PRTC 2EZVA 1QVGA 2HCIA 2NN6H 2TMPA 5M5YH 3NQIA 1X32A 4R9WA 4YIJA 1VQIA 3GTPB 1VQJA 1EEID 1YEZA 1Q7YC 1ILPA 3CD6A 1KLUD 1YNND 5DEHA 1R4PB 4GNXA 3NSWA 1VS0A 1PRTF 2IX3A 1O7YA 3K7AB 4V190 3PO2H 3IAYA 2PCFB 2XWBB 3SHLA 3PUZA 4DV7Q 3ONAB 1OXVA 4X65Q 1VMCA 1JMCA 2K1BA 2KHJA 3MFYA 3NELA 1TWGB 2VQEQ 4L5RC 3G48A 2IY5B 2VUMG 3E3XA 3U9OA 2CFMA 4MN3A 1LLRD 1IBLQ 2WFWA 1PHJA 3NXWA 4A3JB 4DK3C 2JA5H 4DR4L 3S16B 4ME5A 4LF7Q 4K2LA 1TY2A 1IBMQ 2ENBA 2Z6BA 1K0SA 5CV4A 5IGCA 3J7AV 2R7ZG 3URYA 1DCZA 2RVLA 2MPMA 2ZXOA 3RZOB 1VQEA 3P20A 4ZQ3A 3S1MH 3J80i 3PUYA 3BG3A 4I7ZC 1CT1D 2JA8B 3DWAA 4Y7NH 4IPCA 2EJGC 1CKNB 4GN5A 5C3EH 4QMGA 3ITPA 3G7LA 2F3VA 5C0XG 1I6HB 4MZ9A 4KHZA 5DM63 1BXTA 2IHEA 5CR3A 1OXSC 4JI6L 4A75A 2K33A 1YNJD 1RHPA 4FYDA 1X9NA 2OQKA 2UXDQ 2PNHA 5M9OA 2QEXA 2XWJB 1HNWL 3PIPA 3BZCA 4A3BG 3T16A 4KKSA 4LF9Q 3VA5A 1T5EA 1BCPD 5FJ8H 1E24A 1TY0A 5C0XJ 2AQ1B 4X3TA 4NXML 3TS0A 1IL8A 2K5WA 4BBRB 2B2YC 3AU7A 1CHPD 4A3MH 2WKDA 3PO3G 4DUYQ 4JI1L 4G57A 1HNXL 4A3FB 1AN8A 1PH4A 2VZAA 4X3KA 4ID6A 1VQDA 2KOLA 4WORA 4B3MQ 2DJFC 2Y0SE 1ESFA 2K5DA 2A68C 4KHVA 1SJHD 4EQNA 3MXNB 2UUCL 4DV5Q 1DJRD 3ULJA 1CHQD 2JP1A 1B3QA 1I4RA 1QZGA 2NB0A 5IGEA 5C4XG 2JA7B 3GTKH 1STAA 4UPAA 3OHXC 4BBSB 1TWAB 1YZ6A 4IZ8A 3Q0AA 3F2UA 1BCPB 4UP8A 5F2DA 2JJQA 1JOQA 3F8TA 5BN3A 5IYBH 4QJFA 2EQSA 4RH6A 1PFSA 2OTJA 4RHSA 4IUNA 3MA2B 4A3KH 3C3LA 2K4KA 1K8AC 2V4DA 3D0FA 4X66Q 1X6OA 2D2CC 2FMCA 3C1FA 5JEAG 2F0MA 1WCMH 4DR1L 3JAMc 2PO4A 3QJYA 4IALA 3D3RA 1Y8NB 4BY1H 1Q1BA 4IFDG 3CC2A 3BDCA 1SYCA 2MQHA 2E2IH 3QB3A 3G71A 4JI0L 1ENAA 1TKWB 4A3LG 4OONA 1X3GA 4FNFA 3G6JB 2BE5C 1HCZA 1PDQA 4RGOS 1YHAA 4YWMA 2M9VA 4DR3L 4FXKC 1NMFA 3HOYB 2QDLA 3HKSA 4KD3A 5JPNC 5EAYA 2EXZA 4DV4L 3GTMB 3GV3A 4JV5L 1I3QB 4C3HB 3CC7A 4O2DA 5JVH3 3RZDB 3Q23A 4DR4Q 3M4OB 4DV0L 4H44C 4C3IH 4JK1C 3EROA 1EIHA 2UUAL 4M1UB 1WD1A 1PH6A 4L5TA 2F0JA 2RQXA 1LT4D 1I4HA 1HTLD 3IRBA 2XSCA 4A93G 1E2WA 1FNVA 2N49A 1EIGA 1GOZA 1SLJA 4NMZA 4U68A 3RNUA 1CUKA 4POGA 5HGTA 3FKIB 2PPBC 2RCNA 3J80E 4FF3A 4GNXC 1JE5A 1PTOC 1B70B 5M5XB 3A5ZB 4K14A 2AWOA 1A63A 3QOJA 1R9TH 4GLAC 1MI2A 3T1YQ 5C5MA 3K5NA 3CW2C 1PTOF 3JAMi 3JC66 2P5ZX 1HZAA 3KLSX 2ZJPA 2N8NA 1VQFA 2OQ0A 1LM0A 1LTAD 1Y14B 4OX9L 1CSQA 1HQRD 2K5VA 1VQ4A 4DR7L 1CQFA 2N3SA 4DXFA 2FMMA 1HTPA 4DR2L 3FDTA 3HG9A 1NAPA 4GLVB 5IP7G 4PNYA 3J81i 5A35A 4C3JB 2K52A 4DFAA 2IW3A 4KHPL 1DOMA 3A0JA 4NXMQ 2OWOA 1D5MC 1G51A 4JI2L 1YBYA 1ASZA 2JA6B 4NW2A 4A3JG 4JI1Q 2R6GA 3S2HB 5ELNA 4BY7B 2A6EC 3LNNA 3QOLA 4UP7A 5GAEC 2DN8A 1EL0A 1H9SB 5CV8A 1K8MA 4JCVE 4P2CB 2KEEA 4OIJA 2NZOA 1GVPA 1EY8A 1Q90A 3M4PA 4F8MA 1FYCA 3ULPA 3WWVA 1O78A 1CKNA 1Y1WG 2RCFA 1FL0A 1PH9A 3HP3A 1AE3A 1U4PA 1S5BD 4B9XA 4K5VA 1LTID 1L0WA 4PZ7A 2L1BA 3STBD 2EY6A 3W5OA 1KDCA 4DK1A 3CPFA 2WAQB 2F4IA 1VQMA 2NN6I 4NP5A 3MXPA 1JWUD 1CZGA 4RGTA 1CZWA 4U673 4LF8L 4B3RL 1STBA 3R2TA 3I4NH 5HGQA 2CQOA 2XRSD 3LX0A 5M3FG 4N9TA 3K80C 4IOAA 3FMCA 2AQ2B 4GKKL 2F0QA 4BBRG 2KVMA 1SNQA 1EWHA 4DR1Q 1GM5A 1C8CA 3PGZA 3RR5A 2IPKD 2JA9A 2UXBL 1UEAB 2LSSA 3GTOH 1C0AA 3NP8A 1K0RA 1W2BA 1I4GA 3F2CA 4DNRB 1Y1VB 1MJEA 4UP9A 4C56C 3D8GA 4X64Q 4GKJQ 3MXNA 1HR0L 1STGA 1C9OA 5E7NA 1ICWA 2Q8IB 2B63H 3CXCA 1U4LA 2F0GA 2YU9B 4GS3A 4QF4A 2K03A 4DR3Q 2F0DA 1B7YB 3NEMA 1WTOA 4A3IH 4TRDA 1GO3E 1LTTD 4YCVA 2CHBD 4IJLA 4JV5Q 1VQKA 2C9OA 1F2ZA 1EZ6A 2Z6KC 3PIO3 5KEEA 2RA4A 1IHZA 4DV0Q 1PH7A 2XGTA 4DAYB 2F1MA 4LK1C 2UUAQ 1X54A 4GN4B 4OEMB 1V8QA 3K59A 2WACA 4O1NA 4HJ9A 4KY7A 2R93B 1GJXA 2GVAA 3VA7A 3CCRA 5E3FA 1IW7C 4AYBB 2UUBL 3D31A 3HOXG 2O5JC 1ZXTA 3BZKA 3F2BA 3HS0C 3NE5B 4NPSA 5C44G 1SE2A 4JBWA 4DF7A 1SE4A 2AKWB 3Q8DA 3CF5A 3GTLB 1HNZQ 2HHHL 2GVBA 2VQFL 4A3DH 3EN2A 1K83B 4DV3L 2L55A 2L0CA 3GQBA 3L0OA 3CQZB 1JJCB 3OTOL 4C1NI 3JAME 1M8AA 3TP5A 1JOKA 5EBDA 4DR7Q 1LTSD 1B1ZA 4DR2Q 1KRSA 1TWCB 3SK4A 1I4XA 4GLXA 5EKIA 4B3SL 3NPPA 3UE0A 1RKNA 3HOYG 3KLWA 1HXYD 5C4JB 3J81E 1EFID 3NWTA 3NBHB 3I73A 1Y8PB 4EGVA 4JI2Q 5M3MB 5FO7B 4ULLA 4A3GG 3A56A 1SNOA 2RSNA 3VYTA 2IWHA 3I3CA 2E5LL 2CWPA 4A3EH 4C1NK 1D5ZC 5K5PA 3KF8B 2FJ2A 2EXDA 5JAVA 3FKIG 1KTKA 5M5YB 1E3PA 4KN7C 3DWPA 3K8AA 3R3OA 4KKUA 1DXMA 5D3IB 3KDFB 3MC0B 1Z6HA 4QL5A 4LUVA 3BVGA 4M8AA 1PMRA 1A2UA 4LFAL 1PYBA 3PO2B 1IXRA 3E6ZX 2EDGA 2VW9A 1LTRD 1PVOA 1AEXA 4KKTA 5KNCA 4DA2A 4G7ZC 3I8ZA 3RMHA 4FF1A 4HIKA 1P8LA 2Q8RE 1QNKA 4RMFA 3HOWH 2IHFA 3RUZA 2JA5B 4DR5L 1G8ZD 3S14H 2B2VA 1HFGA 3V2TA 1E0BA 5LMNL 5LMUQ 5E4WC 1Z7TA 2B2YA 1J5EL 3T51B 4GKKQ 4IUUA 2JA6G 3S1MB 4AQYQ 1EOVA 2OT2A 1BQQT 2I07B 4E6IA 5IYDG 5JOBA 5JJZA 2UXBQ 3H3VH 1H9SA 1JQYD 2CQAA 4K0KL 5C3EB 1YNNC 4RG1A 4JYAQ 4XQNA 1FVIA 3EJIA 3DLLA 3V05A 4P74A 2K7VA 3EFXD 1NE3A 2LXKA 1FR3A 1TU2B 4ZUIA 3AMUA 5CORA 1A8VA 4ZLTF 1PH2A 3PCOB 5AFWA 3CCJA 4DV1Q 4NXNL 2WAQG 1DGSA 1IBKQ 4OO1G 3I56A 4KN4C 4DUZL 1VCIA 1Q1EA 3I72A 2RDFA 3T1HL 1ONLA 5IP9G 1EFWA 2CWAA 5LHY1 3QIAA 4ZCKA 1EUJA 2RSOA 5CC4A 4Q5VA 4A3MB 5IT9E 5BR8L 4CKBA 3TS2A 2F0KA 1DOLA 1J6QA 1J9OA 5FKAC 4K5WA 4K5XA 1D1KA 1L1OB 1B8AA 1NJIC 4LF6L 2ASBA 3KJPA 4BS9A 1DD2A 4B3TQ 5FK9C 4YWLA 3TEHB 4DR6L 2UUBQ 1SBBB 4UHVA 4WJ3M 2O4XA 5ELDA 3VYSA 3J80L 1I4PA 1CI3M 2LY7A 1N36L 3S1NB 4A3CG 1BBWA 2JQOA 4EVOA 4X62Q 4BA2I 1YNJC 3F1ZA 3BS1A 4JI7L 3HOVG 2DY8A 2A74C 2DUDA 1ZEQX 1HZ9A 1Y1VG 3OTOQ 1DONA 3TZUA 5T1GA 1ILQA 2AMCB 3CRKC 3GTKB 1BCPC 1EZ8A 1XNRL 3PIOA 2VUMH 2GA4B 4TKOB 2F3WA 2PW5A 3KLSA 4LFCQ 1N32L 5J3BA 1RCVD 1LUZA 1SEBD 1QCBD 1EYAA 1FNWA 2C35B 1YIJA 1BCPF 2R7ZH 1QVFA 2IT1A 1JOOA 4LMQD 4DAYA 4B9WA 4DPGA 1OXUA 1M1KC 1VDZA 2F0WA 2EYLA 2KENA 2G9HD 2E5LQ 1E22A 4Z9CB 2DJGC 4JI3L 1BF4A 1NTGA 4RA8A 2PQAB 4RCOA 4A76A 1WCMB 2VXWA 2R61A 2HIXA 2KHIA 2E2JH 4BY1B 2EY1A 5C0XH 5EKLA 3DEPA 4AYBG 5CMDA 2E2IB 1N33Q 1ICFB 3N52A 4R4TA 4KD4A 3NQTA 1IKLA 2PNRC 2NVQB 4YY3Q 4JI5L 4JC0A 3QWNA 4Y52H 2K5HA 1WYDA 3KOJA 3H94A 4A3BH 4CBVA 3F2DA 2JSOA 4R8NA 2YTYA 3H0GG 1FD7D 1TIID 4CJ1B 4DAPA 2Q8TA 2AQ3B 1UUPA 5CBAE 1LT6D 1STHA 1R4QB 4DU9A 1SYGA 4C3IB 2N78A 5LMNQ 1S72A 1XNQL 3NBHA 2F0PA 3SK5A 4N9PA 1UE7A 1BNZA 1E2VA 3TQYA 1J5EQ 1ET6A 3A8KE 1TVXA 1D1IA 3KBGA 2LFNA 2QGQA 1Q8KA 2RHQB 1IL2A 3DEOA 3PF4A 1G6PA 3W3AA 5GROA 5A2QL 3G4SA 2OXPA 4K0KQ 1HA6A 2SNSA 5IGGA 2SNMA 3L9AX 1H9KA 1R9TB 1SMYD 5FLMG 2G5DA 1AP0A 2NN6G 2QF7A 5EGTA 4PMWA 2HDMA 5DNFA 5I6WA 3UDXA 2LKVA 2I5LX 3KDFA 5C4XH 1VQPA 4A4IA 2QCPX 1YJ9A 2B2VC 3K57A 1RD9D 3B6YA 4JI4L 5C4HA 1SRUA 4DUZQ 4RGMA 2E76C 3T1HQ 2G9DA 2EYPA 1KNEA 2NUCA 1PZJD 2X6GA 1KAWA 4G7HC 2I0QA 2H4OA 5I6YA 4QIWB 1U0LA 2OF1A 1EYDA 4LF6Q 3P7JA 4KLKA 1SSOA 5JEAH 1MHWC 1TS3A 4DAMA 4ODGA 4P73A 2A8VA 1XPUA 1MJCA 1Q86C 2A73B 1UEBA 4UDUC 4A3LH 3M85A 2WB1B 2ZTEA 1V43A 1VQ6A 4LFBQ 3M7NA 5FOBB 4IUTA 1HRJA 3JAML 1I94L 1XNRQ 2PMZE 3SE0A 1N32Q 3TSSA 1KDBA 1RJTA 2EJMA 3CCQA 3CCMA 3J81L 1Q82C 2NZ1D 2Z6KA 1K73C 3VDYA 4L5SA 4PMCA 3I4NB 1KABA 4DNIA 1XPOA 1JWSD 5FJ8G 1UE5A 3J7ZC 4TQUS 2GN5A 1BUVT 3FPPA 5IGFA 3HFZB 1NR4A 2JE6I 3KUPA 4HSPA 1L1OA 3A5UA 3U9SA 2EE1A 5E1FA 5I9PA 2AHOB 2QILA 4CDDC 3GTOB 3J81c 1SXTA 1L0XB 2MGSA 4TSSA 1PYWD 3STBC 4HJ8A 1MSHA 1BOSA 2F0TA 3GP7A 2Q2IA 1Y8OB 5JEAJ 2HQLA 1WD0A 2B63B 1WFQA 1EU4A 1SYFA 2AUKA 3OWFA 3H3VI 3RD4A 4IFDJ 1MKHA 1UE1A 4A3IB 4L5QA 4WRDA 2Y0SG 5IP7H 3HKZB 1QB5D 3NUCA 1HQMC 2KCTA 3CHBD 3CCVA 1BR9A 2F0HA 3L7ZC 1HUNA 5AJ3L 1NY4A 3SR1A 4R4IA 4GOPB 2SEBD 2J4XA 2ZT9C 4A3JH 4H7BA 1XNQQ 1K9MC 1VQ9A 1V1PB 1I50H 4YHHL 2R92H 2HD3A 2NTSA 1S5CD 5IYBG 1D5XC 5C5LA 1SE8A 1SROA 3BDOA 1AH9A 2EJFC 3ICEA 5ELFA 3D6WA 4FF4A 2PQAA 2KA7A 4R4OA 1JCKB 1Y1WH 4OWWB 2YYZA 5CV9A 4JI6Q 2DY7A 3SDZA 2Z9HA 1H9JA 1X55A 1XPRA 4EQOA 4A3DB 3TP8A 4IUVA 1A6XA 2CH4W 3J81j 1HNWQ 4QIWE 3R8BA 5C3WA 1EY5A 2L12A 1FNUA 4L6TB 4ABNA 3GTJH 2I46A 2K01A 5DAUA 2F52A 1CM9A 1SE3A 4QY7A 4BWGB 1HNXQ 5KYLA 2JN4A 4CJ2C 2WB1E 1KIXA 5M3FH 1SN8A 2OEOA 3SGIA 3RLNA 3U4ZA 3VR3A 1KXLA 3O13A 4BBRH 5CYUA 3CU7A 4CJ0B 4XTCS 4A3EB 2JA8G 5IOCA 2UUCQ 4F7XA 1U9RA 2N88A 1BBXC 4APVA 4L63B 2Q2TA 4LUOA 3BYTB 2BA1A 4PMBA 4ZAIA 5IT9c 5JVG3 1BO0A 1S3OA 1M4VA 3K5OA 2E2DC 1X3PA 3K81C 1MGSA 5GQOA 3RN2A 1B50A 2F0SA 5IYCG 4OELB 4QCLA 3HOUB 3V96A 5C0XI 4I65A 1I94Q 3S2DH 4CHTB 4KY6A 2Q2HA 2A6HD 5C4ZA 2K28A 2KCMA 4JBMA 2ZJQA 3C46A 3HOWB 5BN5A 2HT1A 3M4QA 3CCLA 3L3OC 3S14B 2A19A 1TWHH 4IQZA 4A3FG 1F9PA 2ZJRA 2F0NA 1JT8A 3PF5A 4JI0Q 3HOXH 3TRZA 3R93A 1G2TA 5EKKA 3HKZE 2RF4A 5C44H 2UU9L 3KF6B 4KTAA 2BDNA 3TDQA 1S40A 2ZTDA 2RDHA 2RBMA 3BVMA 3ULLA 1OXXK 3W2DA 1AZQA 3SEBA 1U5KA 4CDEC 4DV4Q 1VQLA 3UI2A 4FVMA 1XX8A 2JA7G 1J8IA 2Z0SA 5KYIA 1JJ2A 3K6OA 3AFQA 2A69D 1SFOB 3HOYH 4BBSG 4LF5L 3NBIA 4HSVA 3ZYYX 3S17B 1HJPA 1ESRA 4BXXG 4K2KA 5AJ3Q 3HRZC 1L1OC 3CMAA 1K28A 2VY3A 3U4VA 1K8GA 1U4RA 4A3GH 2J0TD 2V1CC 2SOBA 1H9MA 1TQOA 1JE4A 3H15A 1Y69U 1IYUA 2FFKB 3FEWX 4N8X1 1VQAA 2XN9C 2E2HH 1LV9A 2B2TA 2CVRA 5ELOA 3A55A 2PI2E 4ZYSA 3A8IE 3HOZH 1SDFA 2PQEA 4OX9Q 2OTLA 2MUYA 3NHHA 4DV2L 3PMFA 1GUSA 5FO9B 3CCUA 1CA6A 2KCNA 3X3NA 1SR3A 5KNBA 1V9PA 3I4MH 4JG2A 2PZWA 4G4KA 4KHPQ 1ZYRD 2B29A 3RLOA 4I7AA 4PG3A 2VUMB 2L5TA 3M3YB 2XNAC 1GUGA 2F3IA 4C3HG 4A3IG 2D0PA 2ZTCA 3U58A 4V0BA 1NBWA 5C3XA 4DK0A 5NUCA 1O7LA 1YHQA 5GAGC 1PZKD 1TT2A 1UAPA 1PH3A 2R7ZB 1LTGD 2IL8A 4KI0A 1KL9A 3I91A 1CK1A 4GN3B 2K5NA 2JA6H 5HURA 2ALYB 4FF2A 1A0IA 1V1PA 2KJXA 4ZUJA 3KJOA 5IYDH 3TBIB 2YV5A 1IYJB 4RWSC 2NBFA 2E2JB 2QKIC 2X69A 3Q22A 3TP6A 4C2MH 1FJGL 1WOCA 3GTQH 5IY0A 1SJED 3TZDA 1ENFA 3CC4A 4XIGS 1NMGA 2KHSA 4P72A 3CCEA 2M2LA 2WINB 3EVQA 4IUPA 5EPLA 2NVYH 2D5DA 4LF8Q 1G91A 4B3RQ 1AW7A 4DV7L 4OO1H 2MHVA 4C3JG 1S5ED 2O5IC 4X65L 4RKLA 3G6EA 1UNSA 5IP9H 1LTBD 3T13A 2PI2A 2VQEL 3E0EA 2CCZA 3PIP3 1A2TA 3HGBA 5T1IA 2DNCA 1IBLL 3W1BA 4K6LA 4LF7L 3S1RH 2CW0D 1IBML 1B9NA 4BY7G 4Y7NB 2A5HA 2MP1A 2F03A 3I55A 3GO5A 1VQ8A 2BH2A 4DGZA 4QGUA 3UDGA 2XVSA 4KY5A 2KEDA 4DV6L 1STEA 1HR0Q 4A3EG 3OIPA 4A3CH 1JR0D 4DNTB 1EOTA 2K32A 2EVBA 1D2BA 3HOVH 1QG7A 1F2YA 2F0FA 1JICA 1OTCA 1CKMA 1Y1VH 4WFN3 2QEJC 4R8IA 1F9QA 2WV6D 1GUTA 4UAIA 3MHBA 5C4XB 4ALPA 4PQXA 1RDPD 4F88A 4TVAB 2UXDL 1KRTA 1F2MA 3HOUG 1O80A 1HFNA 2ICEC 5D65A 1VF7A 4LF9L 3K0YA 4HN7A 3DM3A 2K05A 2K04A 3K58A 3S15H 4EX5A 4JBJA 1KLGD 4DUYL 1TS2A 4XT1B 4JBKA 4KV6A 2HHHQ 2NVXH 3CRLC 1LACA 1SMYC 2VQFQ 2O2LD 4DV3Q 4B3ML 1A3VA 1PTOH 1W3SA 4X3UA 1VQ7A 2MO0A 1VQ5A 1QVCA 1XMQL 2PZTA 4DV2Q 1KD1C 2VB3X 3KF6A 4MNOA 3X3MA 4HCSA 3ND8A 5JJIA 3CCSA 3A7LA 4RHRA 4B3SQ 3GD7A 1K83H 4DV5L 4KJOA 1WTRA 4ZKBB 2EYFA 1XMOL 1YJWA 5I2YA 2RHSB 3CPWA 2B2UA 3A7AB 4YWKA 3H0GH 4IO9A 2HQEA 2B39A 4K8JA 3S1QH 2K50A 4QUCA 4A3KB 3NWSA 2B2TC 1F9RA 4FXGC 3J7YW 2PMZB 3NTIA 1TR5A 2R93G 4IOCA 1AE2A 3Q24A 2OCEA 5IODA 2NVTH 3HZXA 2I5HA 5IE8A 2E74C 4KJNA 4R4QA 4P75A 4XYQA 1QOHA 2KBNA 4OWTB 1FJGQ 3E9HA 3SVMA 2YTVA 2CKZB 5FLMH 4WJ4A 4RCNA 4LFAQ 3ER0A 1K8OA 1CQVA 2KQ3A 2JEBI 1QWYA 4RKBA 4LNQA 1HZBA 3MXUA 1O7IA 1B53A 4JPBW 1BKBA 4OHJA 1O7ZA 5J22A 2EY2A 1KHIA 2EOTA 4LUZA 1E2ZA 4DR5Q 1HZCA 2BH8A 5CV6A 4GOPC 2WKCA 3PO3H 1A3TA 2VL6A 4XQJA 1ASYA 1SNPA 1VQHA 1VQNA 2NTTA 2HCCA 1AFPA 4F87A 3WOEA 5M3MG 5KNDA 1XTDA 4OGQC 2LMCB 5ISRA 5K36G 1I50B 4JOIA 2R92B 5EPJA 4XXEA 4O42A 3CKIB 2JK8A 4Q0FA 3KF8A 4FO2A 1UWVA 1MIUA 4DV6Q 2F4VL 1XTCD 2F0OA 1PLFA 1Y1WB 3ERQA 1A62A 1M90C 3LGJA 1HA5A 1BDOA 4IPHA
chains in the Genus database with same CATH topology
4RFBA 1PXUA 2RKSA 1OO9B 4J6HA 1WTPA 1F2LA 1PFBA 3MZ5A 5EJWA 5CV5A 2ICIA 3GTJB 1EQVA 4BA1I 4B08A 3OW7A 3R2IA 2BA0A 1STNA 3NTKA 2F0VA 1AZPA 5M3FB 4G7OC 1SNCA 4IFDH 1EY6A 2F0EA 4H13C 3I90A 2K5QA 5CGKA 2HUGA 5BN4A 4XT3B 1PRTD 5G3LF 4RGNA 2PZUA 1V1OA 3DM1A 1S4ZA 1VF5C 3C1EA 3OMCA 3D4RA 2JXMB 3P1HA 1EY4A 4HMIA 4J1MA 4DXGA 4CKEA 3S2DB 1KAAA 1T5XD 1SAPA 1LT3D 5ELCA 4L8JA 3MXGA 2N55A 5KGUA 5LL6X 3WOFA 1TWHB 5IGBA 2ZXRA 3VR4A 1B2TA 4OO1I 3BZDB 3H3VC 3Q6SA 3VR2A 3HEJA 3OMGA 2AWNA 2EYJA 5CBEE 4KMUC 3HOXB 1TS5A 3WDNA 5C44B 3EQLC 1VMPA 1PRTB 2B2UC 3MWYW 4CGYB 2A6HC 1GXDC 3D4DA 4OL7A 2HDLA 2ID0A 1C4QA 1JB3A 1QNUA 2TSSA 3PUVA 4QUFA 1JC7A 3LWEA 1EEFD 1HPCA 2X6LA 3OOCA 4S3SA 4XQQA 5FLXE 3H6MA 2BDOA 4MHEA 4ZK9B 3SK6A 1W6JA 2IX1A 2LS01 1B4OA 4A3GB 2KCCA 1NCVA 2Z8LA 3MVVA 5COYA 2EYHA 5G3LD 1STYA 2E2HB 1A15A 1MD2D 4NKLA 3KLRA 1EWCA 4XDXA 5EQ0A 3HOZB 4OIKA 2A68D 1W6KA 4KK7A 5FO8B 5IGDA 1WTVA 3FPUB 3BYYB 1IKMA 3PV0A 1GHJA 1IYVA 2A69C 3VYRA 3I4MB 1EY0A 1B9MA 1F77A 1WVLA 5JPMC 2MJ8A 4EQPA 1H9RA 1I4QA 2BOSA 5IT9L 3MFGA 4C3IG 3S9WA 1XXGA 2XRQD 1DM0B 1WTQA 3H09A 3OSOA 4H0LC 4HCEA 5IIFA 2VNUD 4GZYC 2BCOA 1QE6A 1LO5D 2M00A 4K8IA 4C2MB 1WTWA 3GTQB 5EPKA 3DWQA 3VR5A 3FRPB 3PUXA 5D14A 5TSSA 1ZYRC 3QO2A 2BE5D 2ZXPA 2SDFA 1RF2D 2EYOA 3MEHA 2NVYB 2F0UA 1B44D 3IFDA 2QDBA 5J1ZA 1C48A 3VYUA 4HEDA 2B2WA 2EYMA 1EU3A 4HTHA 3OWEB 3S1RB 4J8QA 5ELEA 1ZKOA 5A2QE 2J7ZA 1U4MA 4LJZC 3D6CA 2R3ZA 1PTOD 3LWUA 1OXTA 1GUOA 3HOVB 2WIIB 5CV7A 1FGBD 3FVQA 3KK7A 1KDAA 3MTSA 3OIQA 1L0YB 4LAAA 4IN3A 1X3QA 3C2PA 2AUJD 1XYIA 1EQTA 3IKJA 4HR7B 1JWMD 2L4NA 2CW0C 1G291 2PW7A 1LABA 2FINB 3S15B 1S5FD 2L9HA 2A6ED 2NVXB 3K5LA 1RODA 1DYQA 1PFNA 1ML0D 2Z4HA 1CA5A 2D9UA 4QB4A 5I4DA 1PTOB 5KRUA 3E0JA 1GUNA 2RDGA 1B3AA 4IFDI 4ZKCB 3TMEA 1PFMA 1XWEA 3SK8A 4ZRZA 2NWGA 1Q3LA 2EY5A 1SNDA 1RTOA 1EY9A 1CTMA 3D4WA 3H0GB 3N6RA 1MSGA 3E5SA 4FXDA 2L11A 4FP5D 2KECA 2H1EA 1DOKA 4HMJA 4ILWA 1GHKA 4RAUC 3S1QB 1PZID 2Z1CA 2NYZD 5C6AA 1CFMA 3TN2A 1GUWA 1LT5D 2NVTB 3BDLA 1RTNA 4K6DA 2Z4IA 5D3DA 2F0LA 2EPBA 3T4AC 2VB2X 2JEAI 5E4XA 3DMUA 5DM73 1QILA 4WJWA 3A54A 4A3BB 1D6EC 2XIWA 3DHQA 1EY7A 4XYOA 1ET9A 5J39A 4PV1C 3ND9A 1S5DD 3PO3B 2D62A 2F0IA 2KUMA 1QJOA 2B8FA 3A8JE 3OPOA 2WP8J 3I4LA 1G2SA 1NSNS 3J7AF 1KNAA 2IX0A 3AB9A 1II3A 3GV6A 2DNEA 1IW7D 3RLFA 1G6ZA 3NK9A 3P75A 4IURA 3K5MA 5ELBA 2B8GA 1HHVA 3T56B 1SNMA 3SXHA 1WTXA 2B2WC 4DAVA 3I70A 1JORA 1I6VC 1Z47A 4HAEA 1EYCA 4X3SA 2C5CA 5FLXL 4NDXA 1Q12A 5EBCA 1SYBA 3VR6A 3BVZA 2IJ0A 1DZ1A 1SYDA 5M5WB 4IUQA 1Q8IA 2FHTA 1TWFB 1F9SA 1MBYA 1HUMA 4CKCA 3DUZA 3M7GA 3PUWA 1NR2A 3IFTA 3MAQA 2Y0SB 1ENCA 1SYEA 5KIXA 2E75C 3T53B 3GTGB 2JYOA 2PYKA 4A93B 2K6AA 5I9OA 1A3UA 3IL8A 5LL6S 3NTHA 1NUCA 3QG1A 4MIUA 1TS4A 3TP7A 5K36H 3H91A 3DXJC 3KBXA 5I2XA 4DN4M 3EA6A 3M4YA 1PRTC 2EZVA 2HCIA 2NN6H 2TMPA 3NQIA 1X32A 4R9WA 4YIJA 3GTPB 1EEID 1ILPA 1KLUD 1YNND 5DEHA 1R4PB 3NSWA 1PRTF 2IX3A 1O7YA 3K7AB 4V190 3IAYA 2PCFB 2XWBB 3SHLA 3PUZA 3ONAB 1OXVA 1VMCA 2K1BA 3MFYA 1TWGB 3U9OA 4MN3A 1LLRD 3NXWA 4A3JB 3S16B 4ME5A 4K2LA 1TY2A 2ENBA 5CV4A 5IGCA 3J7AV 3URYA 1DCZA 2RVLA 2MPMA 2ZXOA 3RZOB 3P20A 4ZQ3A 3PUYA 3BG3A 4I7ZC 1CT1D 2JA8B 3DWAA 2EJGC 4QMGA 3ITPA 3G7LA 2F3VA 5C0XG 1I6HB 4KHZA 5DM63 1BXTA 5CR3A 1OXSC 2K33A 1YNJD 1RHPA 4FYDA 5M9OA 2XWJB 3T16A 4KKSA 3VA5A 1T5EA 1BCPD 1TY0A 5C0XJ 2AQ1B 4X3TA 1IL8A 2K5WA 4BBRB 2B2YC 3AU7A 1CHPD 2WKDA 4G57A 4A3FB 1AN8A 4X3KA 4ID6A 2KOLA 4WORA 1ESFA 2K5DA 2A68C 4KHVA 1SJHD 4EQNA 1DJRD 1CHQD 2JP1A 1I4RA 2NB0A 5IGEA 2JA7B 1STAA 3OHXC 4BBSB 1TWAB 4IZ8A 3Q0AA 3F2UA 1BCPB 5F2DA 1JOQA 5BN3A 4RH6A 4RHSA 4IUNA 3MA2B 3C3LA 2V4DA 2D2CC 2FMCA 3C1FA 5JEAG 2F0MA 2PO4A 3QJYA 4IALA 3D3RA 1Y8NB 1Q1BA 4IFDG 3BDCA 1SYCA 3QB3A 1ENAA 1TKWB 4FNFA 3G6JB 2BE5C 1HCZA 1PDQA 4RGOS 2M9VA 4FXKC 3HOYB 4KD3A 5JPNC 2EXZA 3GTMB 3GV3A 1I3QB 4C3HB 5JVH3 3RZDB 3Q23A 3M4OB 4H44C 4JK1C 3EROA 1EIHA 4M1UB 1WD1A 2F0JA 2RQXA 1LT4D 1I4HA 1HTLD 2XSCA 1E2WA 1FNVA 1EIGA 1GOZA 4NMZA 4U68A 5HGTA 3FKIB 2PPBC 3J80E 4FF3A 1PTOC 5M5XB 4K14A 2AWOA 3QOJA 1MI2A 5C5MA 3K5NA 1PTOF 3KLSX 1LTAD 1HQRD 1CQFA 4DXFA 2FMMA 1HTPA 3FDTA 3HG9A 1NAPA 4PNYA 5A35A 4C3JB 4DFAA 2IW3A 1DOMA 1D5MC 2JA6B 4NW2A 2R6GA 3S2HB 4BY7B 2A6EC 3LNNA 3QOLA 2DN8A 1EL0A 1H9SB 5CV8A 1K8MA 4P2CB 2KEEA 4OIJA 1EY8A 1Q90A 4F8MA 1FYCA 1O78A 3HP3A 1U4PA 1S5BD 4B9XA 4K5VA 1LTID 2L1BA 2EY6A 1KDCA 4DK1A 2WAQB 2F4IA 2NN6I 4NP5A 3MXPA 1JWUD 1CZGA 4RGTA 1CZWA 4U673 1STBA 3R2TA 2XRSD 3LX0A 4N9TA 3FMCA 2AQ2B 2F0QA 2KVMA 1SNQA 1EWHA 1C8CA 2IPKD 1UEAB 3NP8A 1I4GA 4DNRB 1Y1VB 4C56C 3D8GA 3MXNA 1STGA 2Q8IB 1ICWA 1U4LA 2F0GA 2YU9B 4QF4A 2K03A 2F0DA 1WTOA 4TRDA 1LTTD 2CHBD 2C9OA 1F2ZA 1EZ6A 3PIO3 5KEEA 2RA4A 1IHZA 2F1MA 4LK1C 1V8QA 3K59A 2WACA 4O1NA 4KY7A 2R93B 1GJXA 3VA7A 5E3FA 1IW7C 4AYBB 2O5JC 3D31A 1ZXTA 3HS0C 3NE5B 1SE2A 4JBWA 4DF7A 1SE4A 3GTLB 1K83B 2L55A 2L0CA 3GQBA 3CQZB 4C1NI 3JAME 1M8AA 3TP5A 1JOKA 5EBDA 1LTSD 1B1ZA 1TWCB 3SK4A 1I4XA 5EKIA 3NPPA 1RKNA 1HXYD 5C4JB 3J81E 1EFID 3NWTA 3I73A 1Y8PB 4EGVA 5M3MB 5FO7B 4ULLA 3A56A 1SNOA 2RSNA 3VYTA 2IWHA 3I3CA 4C1NK 1D5ZC 5K5PA 2FJ2A 5JAVA 1KTKA 5M5YB 4KN7C 3DWPA 3R3OA 4KKUA 1DXMA 5D3IB 3MC0B 1Z6HA 3BVGA 4M8AA 1PMRA 1A2UA 3PO2B 3E6ZX 2EDGA 1LTRD 1AEXA 4KKTA 5KNCA 4DA2A 4G7ZC 3I8ZA 3RMHA 4FF1A 2Q8RE 1QNKA 3RUZA 2JA5B 1G8ZD 2B2VA 1HFGA 3V2TA 1E0BA 5E4WC 1Z7TA 2B2YA 3T51B 4IUUA 3S1MB 2OT2A 1BQQT 2I07B 4E6IA 5JOBA 5JJZA 1H9SA 1JQYD 2CQAA 5C3EB 1YNNC 4XQNA 3EJIA 3V05A 2K7VA 3EFXD 1FR3A 1TU2B 4ZUIA 3AMUA 5CORA 4ZLTF 5AFWA 4OO1G 4KN4C 1VCIA 1Q1EA 3I72A 2RDFA 1ONLA 5LHY1 3QIAA 5CC4A 2RSOA 4Q5VA 4A3MB 5IT9E 4CKBA 2F0KA 1DOLA 1J9OA 5FKAC 4K5WA 4K5XA 1D1KA 4BS9A 1DD2A 5FK9C 1SBBB 2O4XA 5ELDA 3VYSA 3J80L 1I4PA 1CI3M 2LY7A 3S1NB 4EVOA 4BA2I 1YNJC 3BS1A 2DY8A 2A74C 1ZEQX 1DONA 3TZUA 5T1GA 1ILQA 3CRKC 3GTKB 1BCPC 1EZ8A 2GA4B 4TKOB 2F3WA 2PW5A 3KLSA 1RCVD 1SEBD 1QCBD 1EYAA 1FNWA 1BCPF 2IT1A 1JOOA 4LMQD 4DAYA 4B9WA 1OXUA 1VDZA 2F0WA 2EYLA 2G9HD 4Z9CB 1BF4A 4RA8A 4RCOA 1WCMB 2VXWA 2R61A 4BY1B 2EY1A 5C0XH 5EKLA 3DEPA 5CMDA 2E2IB 3N52A 4KD4A 3NQTA 1IKLA 2PNRC 2NVQB 3QWNA 3H94A 4CBVA 2JSOA 4R8NA 1FD7D 1TIID 4CJ1B 4DAPA 2Q8TA 2AQ3B 1UUPA 5CBAE 1LT6D 1STHA 1R4QB 4DU9A 1SYGA 4C3IB 3NBHA 2F0PA 3SK5A 4N9PA 1BNZA 1E2VA 1ET6A 3A8KE 1TVXA 1D1IA 3KBGA 2LFNA 3DEOA 3W3AA 5A2QL 2OXPA 1HA6A 2SNSA 5IGGA 2SNMA 3L9AX 1H9KA 1R9TB 1SMYD 1AP0A 2NN6G 2QF7A 5EGTA 4PMWA 2HDMA 5DNFA 5I6WA 2LKVA 2QCPX 2B2VC 3K57A 1RD9D 5C4HA 4RGMA 2E76C 2G9DA 2EYPA 1KNEA 2NUCA 1PZJD 2X6GA 4G7HC 2H4OA 5I6YA 4QIWB 2OF1A 1EYDA 3P7JA 1SSOA 5JEAH 1TS3A 4ODGA 2A73B 4UDUC 3M85A 2WB1B 1V43A 3M7NA 5FOBB 4IUTA 1HRJA 3JAML 3SE0A 3TSSA 1KDBA 1RJTA 2EJMA 3J81L 2NZ1D 4PMCA 3I4NB 1KABA 1JWSD 4TQUS 1BUVT 3FPPA 5IGFA 1NR4A 2JE6I 3KUPA 4HSPA 3U9SA 2EE1A 5E1FA 5I9PA 2QILA 3GTOB 1SXTA 1L0XB 2MGSA 4TSSA 1PYWD 1MSHA 1BOSA 2F0TA 3GP7A 1Y8OB 5JEAJ 1WD0A 2B63B 1EU4A 1SYFA 2AUKA 3OWFA 3RD4A 4IFDJ 4A3IB 4WRDA 3HKZB 1QB5D 3NUCA 1HQMC 3CHBD 1BR9A 2F0HA 3L7ZC 1HUNA 3SR1A 2SEBD 2J4XA 2ZT9C 4H7BA 1V1PB 2NTSA 1S5CD 1D5XC 5C5LA 3BDOA 2EJFC 5ELFA 3D6WA 4FF4A 2KA7A 1JCKB 2YYZA 5CV9A 2DY7A 3SDZA 1H9JA 4EQOA 4A3DB 3TP8A 4IUVA 1A6XA 3R8BA 5C3WA 1EY5A 2L12A 1FNUA 4L6TB 4ABNA 2I46A 2K01A 5DAUA 1CM9A 1SE3A 4BWGB 5KYLA 4CJ2C 2OEOA 3VR3A 3O13A 5CYUA 3CU7A 4CJ0B 4XTCS 4A3EB 5IOCA 4F7XA 1U9RA 2N88A 1BBXC 4L63B 3BYTB 2BA1A 4PMBA 4ZAIA 5JVG3 1BO0A 1M4VA 3K5OA 2E2DC 1X3PA 1MGSA 1B50A 2F0SA 4QCLA 3HOUB 3V96A 5C0XI 4I65A 4CHTB 4KY6A 2A6HD 5C4ZA 2K28A 3C46A 3HOWB 5BN5A 3L3OC 3S14B 4IQZA 1F9PA 2F0NA 3R93A 1G2TA 5EKKA 4KTAA 2BDNA 3TDQA 2RDHA 2RBMA 3BVMA 1OXXK 3W2DA 1AZQA 3SEBA 3UI2A 4FVMA 1XX8A 1J8IA 5KYIA 3K6OA 2A69D 1SFOB 3NBIA 4HSVA 3ZYYX 3S17B 1ESRA 4K2KA 3HRZC 1U4RA 2J0TD 2SOBA 1H9MA 1TQOA 1JE4A 1Y69U 1IYUA 2FFKB 3FEWX 2XN9C 1LV9A 2B2TA 2CVRA 3A55A 4ZYSA 3A8IE 1SDFA 2PQEA 2MUYA 3NHHA 3PMFA 1GUSA 5FO9B 1CA6A 2KCNA 3X3NA 5KNBA 2PZWA 4G4KA 1ZYRD 2VUMB 2L5TA 3M3YB 2XNAC 1GUGA 4C3HG 4V0BA 5C3XA 4DK0A 5NUCA 1O7LA 1PZKD 1TT2A 1UAPA 2R7ZB 1LTGD 2IL8A 4KI0A 3I91A 1CK1A 5HURA 4FF2A 1V1PA 2KJXA 4ZUJA 3TBIB 4RWSC 2NBFA 2E2JB 2QKIC 2X69A 3Q22A 3TP6A 1SJED 3TZDA 1ENFA 4XIGS 2KHSA 2M2LA 2WINB 3EVQA 4IUPA 5EPLA 2D5DA 1G91A 1AW7A 4OO1H 2MHVA 4C3JG 1S5ED 2O5IC 4RKLA 1UNSA 1LTBD 3T13A 3PIP3 1A2TA 3HGBA 5T1IA 2DNCA 4K6LA 2CW0D 1B9NA 4Y7NB 2A5HA 2MP1A 2F03A 3GO5A 4DGZA 2XVSA 4KY5A 2KEDA 1STEA 3OIPA 1JR0D 4DNTB 1EOTA 2K32A 2EVBA 1D2BA 1QG7A 1F2YA 2F0FA 1JICA 4WFN3 2QEJC 4R8IA 1F9QA 2WV6D 1GUTA 4UAIA 3MHBA 5C4XB 4PQXA 1RDPD 4F88A 1F2MA 1O80A 1HFNA 2ICEC 5D65A 1VF7A 3K0YA 4HN7A 2K05A 2K04A 3K58A 1KLGD 1TS2A 4XT1B 4KV6A 3CRLC 1LACA 1SMYC 2O2LD 1A3VA 1PTOH 4X3UA 2PZTA 2VB3X 3X3MA 4HCSA 3ND8A 3A7LA 4RHRA 3GD7A 4KJOA 1WTRA 4ZKBB 2EYFA 5I2YA 2B2UA 3A7AB 2HQEA 2B39A 4K8JA 4QUCA 4A3KB 3NWSA 2B2TC 1F9RA 4FXGC 3J7YW 2PMZB 3NTIA 1TR5A 3Q24A 5IODA 3HZXA 2E74C 4KJNA 4XYQA 1QOHA 3SVMA 4RCNA 1K8OA 1CQVA 2KQ3A 2JEBI 1QWYA 4RKBA 3MXUA 1B53A 4OHJA 1O7ZA 5J22A 2EY2A 2EOTA 1E2ZA 5CV6A 2WKCA 1A3TA 4XQJA 1SNPA 2NTTA 2HCCA 1AFPA 4F87A 3WOEA 5KNDA 4OGQC 2LMCB 5ISRA 5K36G 1I50B 2R92B 5EPJA 4XXEA 4O42A 3CKIB 4Q0FA 3KF8A 4FO2A 1XTCD 2F0OA 1PLFA 1Y1WB 3ERQA 1HA5A 1BDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE5 D;  1V8Q A;  1I6V C;  3T51 B;  2A6H C;  2KA7 A;  3ND8 A;  5BN3 A;  1GJX A;  3A7L A;  4XIG S;  1CTM A;  2R6G A;  3N6R A;  2YYZ A;  3SDZ A;  2A6E C;  3GD7 A;  3VA7 A;  3LNN A;  1H9J A;  1IW7 C;  2DN8 A;  1OXX K;  3PUV A;  1H9S A;  5C0X H;  3M85 A;  2O5J C;  3D31 A;  1H9S B;  1Q12 A;  1GHK A;  2V4D A;  1K8M A;  1DCZ A;  2D2C C;  1A6X A;  1YNN C;  1V43 A;  5JEA G;  1HPC A;  3NE5 B;  3A7A B;  1Q90 A;  3OOC A;  3P20 A;  4BA1 I;  3QJY A;  2D5D A;  1FYC A;  4JBW A;  2BDO A;  3PUY A;  1Y8N B;  2PNR C;  3BG3 A;  3OW7 A;  4I7Z C;  3VR6 A;  1CFM A;  1Q1B A;  4IFD G;  4OO1 H;  1O78 A;  2BA0 A;  2O5I C;  2A69 D;  2EJG C;  2K7V A;  2KCC A;  1FR3 A;  1TU2 B;  1TKW B;  3M7N A;  3GQB A;  5C0X G;  4G7O C;  3SE0 A;  5JEA H;  3H94 A;  3HGB A;  2BE5 C;  4IFD H;  2DNC A;  4KHZ A;  1HCZ A;  2EJM A;  1OXS C;  1ZKO A;  4DK1 A;  4H13 C;  1B9N A;  2NN6 I;  2K33 A;  3KLR A;  4LJZ C;  4OO1 G;  4KN4 C;  1H9M A;  3VR3 A;  1VCI A;  3LWU A;  1Q1E A;  3I72 A;  2JEA I;  2E74 C;  1ONL A;  1OXT A;  5BN4 A;  1Y69 U;  3PUW A;  2A68 D;  1IYU A;  1GUO A;  3QIA A;  3IFT A;  4TQU S;  3FPP A;  1E2V A;  4XTC S;  3I73 A;  1Y8P B;  3A8K E;  4KKS A;  2JE6 I;  4RCN A;  3PV0 A;  1GHJ A;  4DNT B;  1K8O A;  1T5E A;  1VF5 C;  2K32 A;  3A8I E;  2E75 C;  4H44 C;  2A69 C;  3D4R A;  2JEB I;  2EVB A;  4JK1 C;  3T53 B;  3U9S A;  1DD2 A;  2AUJ D;  3W3A A;  3MXU A;  2JXM B;  3FMC A;  4PV1 C;  1B9M A;  3ND9 A;  2D62 A;  1GUS A;  3IKJ A;  2BA1 A;  4HR7 B;  1GUT A;  1H9K A;  1EWH A;  1E2W A;  1IYV A;  1CI3 M;  1QJO A;  3QG1 A;  1E2Z A;  1H9R A;  2CW0 C;  5KNB A;  5K36 H;  2PPB C;  1G29 1;  4BA2 I;  2B8F A;  1Y8O B;  2NN6 G;  3DXJ C;  1LAB A;  1YNJ C;  2QF7 A;  3A8J E;  3OPO A;  4LK1 C;  4KN7 C;  4L8J A;  3I4L A;  4KKU A;  2AUK A;  2AWO A;  1DXM A;  4DNR B;  2A68 C;  2L5T A;  3M4Y A;  1GUG A;  1Z6H A;  2A6H D;  3AB9 A;  1PMR A;  2NN6 H;  1VF7 A;  3TZU A;  1HQM C;  2Q8I B;  4DK0 A;  5KND A;  2DNE A;  2A6E D;  3VR4 A;  1O7L A;  4OGQ C;  3CRK C;  4H0L C;  1IW7 D;  2LMC B;  3RLF A;  3VR2 A;  5BN5 A;  5K36 G;  3L7Z C;  2EDG A;  4TKO B;  4KMU C;  4KI0 A;  2E76 C;  4GZY C;  1HTP A;  4KKT A;  5KNC A;  3WDN A;  2ZT9 C;  2B8G A;  4IQZ A;  4G7Z C;  1GUN A;  3EQL C;  2PCF B;  4G7H C;  3T56 B;  3PUZ A;  3CRL C;  1LAC A;  1SMY C;  3VR5 A;  5A35 A;  1OXV A;  2IT1 A;  3PUX A;  3MFY A;  1OXU A;  1VDZ A;  3BDO A;  2F1M A;  1ZYR C;  2EJF C;  1BDO A;  1Z7T A; 
#chains in the Genus database with same CATH topology
 4RFB A;  1PXU A;  2RKS A;  1OO9 B;  4J6H A;  1WTP A;  2NZH A;  3T1Y L;  3PO2 G;  4NXN Q;  5LMN W;  1F2L A;  1PFB A;  3I7F A;  3MZ5 A;  5EJW A;  5CV5 A;  2ZM6 L;  2ICI A;  3GTJ B;  1EQV A;  4BA1 I;  5BR8 Q;  4B08 A;  3OW7 A;  3R2I A;  2JA5 G;  2BA0 A;  1STN A;  2YTX A;  3NTK A;  2F0V A;  1N34 L;  1AZP A;  5M3F B;  4DR6 Q;  4G7O C;  1SNC A;  1QUQ B;  1LTL A;  1V1Q A;  4IFD H;  3OW2 A;  1EY6 A;  2F0E A;  2ATW A;  4H13 C;  3GDE A;  2K14 A;  3I90 A;  2K5Q A;  5CGK A;  1N36 Q;  3AFP A;  2HUG A;  3BJU A;  4ME3 A;  5M5W H;  4OWX B;  4JW0 A;  5BN4 A;  3A74 A;  5C3E G;  4JI7 Q;  1T9H A;  2B3G A;  4XT3 B;  1PRT D;  5G3L F;  1XMQ Q;  4RGN A;  1TWF H;  2PZU A;  1V1O A;  3S1N H;  3DM1 A;  1S4Z A;  1VF5 C;  3C1E A;  3OMC A;  1CKO A;  1JB7 A;  3D4R A;  5JJL A;  1VQG A;  2JXM B;  1D8L A;  3P1H A;  1BBU A;  1XMO Q;  1EY4 A;  4HMI A;  4J1M A;  4CKE A;  4DXG A;  3S2D B;  1KAA A;  1T5X D;  3GTG H;  1SAP A;  4A93 H;  1LT3 D;  5ELC A;  4L8J A;  3MXG A;  2N55 A;  5KGU A;  5LL6 X;  1EYG A;  4A3M G;  4JI3 Q;  3WOF A;  3NEN A;  1PV4 A;  1TWH B;  5IGB A;  1JJG A;  1EIY B;  1TXY A;  2ZXR A;  4NB3 A;  3VR4 A;  1B2T A;  4OO1 I;  3BZD B;  3H3V C;  3Q6S A;  3VR2 A;  3HEJ A;  3OMG A;  2AWN A;  2EYJ A;  5CBE E;  4KMU C;  3HOX B;  1E1O A;  1TS5 A;  3WDN A;  2DGY A;  5C44 B;  3TRE A;  3EQL C;  3GTP H;  1PH8 A;  4JI5 Q;  1VMP A;  1PRT B;  3CAM A;  2LXJ A;  4IJH A;  2B2U C;  3K7A H;  3MWY W;  4CGY B;  4X64 L;  4GKJ L;  2A6H C;  1GXD C;  3D4D A;  4LWC A;  1VQB A;  1LYL A;  4OL7 A;  2HDL A;  2NVQ H;  2ID0 A;  1C4Q A;  1JB3 A;  1QNU A;  2TSS A;  4YCU A;  1TWG H;  3PUV A;  4QUF A;  1PA6 A;  1JC7 A;  3LWE A;  1EQR A;  1EEF D;  1HPC A;  2X6L A;  3OOC A;  4S3S A;  4XQQ A;  5FLX E;  3S16 H;  3H6M A;  2BDO A;  4MHE A;  4ZK9 B;  4J15 A;  3SK6 A;  3UDI A;  1W6J A;  2IX1 A;  2LS0 1;  1B4O A;  4A3G B;  2KCC A;  1NCV A;  2Z8L A;  4CDC C;  3MVV A;  3RZO H;  4A3K G;  2R7D A;  5COY A;  1UE6 A;  2JA8 H;  2EYH A;  5G3L D;  1H95 A;  1STY A;  1KQS A;  1WCM G;  2E2H B;  1A15 A;  3FHW A;  1MD2 D;  4NKL A;  2F4V Q;  4BY1 G;  3KLR A;  1EWC A;  1Z9F A;  4IPD A;  4XDX A;  5EQ0 A;  1BVS A;  1Q81 C;  1I6H H;  3L2P A;  3HOZ B;  4OIK A;  4R1J A;  2A68 D;  1W6K A;  4KK7 A;  5FO8 B;  5IGD A;  1WTV A;  3FPU B;  1HNZ L;  1RIP A;  3BYY B;  5IWA L;  1IKM A;  3PV0 A;  1GHJ A;  4JI4 Q;  1IYV A;  2A69 C;  3VYR A;  5IYC H;  4QQB X;  5L37 A;  1N8R C;  3I4M B;  1EY0 A;  3QR8 A;  1B9M A;  2ZM6 Q;  1F77 A;  1WVL A;  5JPM C;  2MNA A;  3PSI A;  1P16 A;  1WI5 A;  2MJ8 A;  4EQP A;  1H9R A;  1I4Q A;  2BOS A;  4JOI C;  5IT9 L;  3MFG A;  4C3I G;  1X65 A;  2EIF A;  3EBE A;  3S9W A;  1XXG A;  1N34 Q;  4A3F H;  2XRQ D;  1DM0 B;  1WTQ A;  3H09 A;  3OSO A;  4H0L C;  4HCE A;  4FDB A;  5IIF A;  2VNU D;  2QW7 A;  3E9I A;  4P71 A;  2R92 G;  4JI8 L;  4GZY C;  2BCO A;  1QE6 A;  1LO5 D;  2M00 A;  4K8I A;  4C2M B;  4OXP A;  1WTW A;  3GTQ B;  5EPK A;  3DWQ A;  3VR5 A;  3FRP B;  3PUX A;  5D14 A;  5TSS A;  1ZYR C;  3QO2 A;  4AH6 A;  1YIT A;  3ERS X;  2BE5 D;  2JA7 H;  1X3E A;  2MFI A;  2ZXP A;  2SDF A;  1RF2 D;  2EYO A;  3MEH A;  2NVY B;  2F0U A;  4BBS H;  1TWA H;  1B44 D;  2I5M X;  3IFD A;  1L2F A;  1X3F A;  2QDB A;  5J1Z A;  1C48 A;  4BXX H;  3VYU A;  4HED A;  2MO1 A;  4LF4 L;  2B2W A;  2EYM A;  5GAD C;  1EU3 A;  4HTH A;  3FP9 A;  3OWE B;  3S1R B;  1X56 A;  1WJJ A;  5LMU L;  4HJA A;  4J8Q A;  1QUQ A;  3J7A 5;  5ELE A;  1ZKO A;  5H1S E;  5A2Q E;  2J7Z A;  4AQY L;  1U4M A;  2QA4 A;  4LJZ C;  2Q2U A;  3D6C A;  2R3Z A;  1PTO D;  3LWU A;  2WB1 G;  1OXT A;  1GUO A;  3HOV B;  2WII B;  5CV7 A;  4O0A A;  1FGB D;  4JYA L;  1VQC A;  3FVQ A;  3KK7 A;  1KDA A;  2A1A A;  4MTN A;  3MTS A;  3AQQ A;  1L0Y B;  3OIQ A;  4LAA A;  4IN3 A;  1X3Q A;  3GTM H;  3C2P A;  2AUJ D;  1I3Q H;  4C3H H;  3RZD H;  1XYI A;  2R7F A;  1EQT A;  3IKJ A;  4HR7 B;  3M4O H;  1JWM D;  2K75 A;  4DV1 L;  1YHB A;  2L4N A;  3W1G A;  2CW0 C;  4YHH Q;  3I4N G;  3AYH B;  1G29 1;  3BU2 A;  1IBK L;  2PW7 A;  1LAB A;  4LW1 A;  2FIN B;  1EWI A;  4MTK A;  1I5F A;  3S15 B;  2UXC L;  3FKI H;  1S5F D;  3ZJY C;  2L9H A;  2A6E D;  2NVX B;  3K5L A;  5M5X H;  1ROD A;  1DYQ A;  4DKA C;  4B3T L;  2HIV A;  1PFN A;  1ML0 D;  1YI2 A;  2Z4H A;  1CA5 A;  2CH4 A;  2D9U A;  4QB4 A;  5I4D A;  1PTO B;  4GNX B;  5KRU A;  3E0J A;  1GUN A;  2RDG A;  1B3A A;  4IFD I;  1HH2 P;  4ZKC B;  1N9W A;  3TME A;  1PFM A;  3CP0 A;  5IWA Q;  4X62 L;  2B63 G;  1XWE A;  3SK8 A;  4ZRZ A;  2NWG A;  1GD7 A;  1Q3L A;  3I2Z A;  3HKZ G;  1YJN A;  3MEF A;  4C3J H;  2EY5 A;  1SND A;  1RTO A;  1EY9 A;  1CTM A;  3D4W A;  3H0G B;  3N6R A;  1MSG A;  3E5S A;  4FXD A;  2L11 A;  2E8G A;  4FP5 D;  2KEC A;  2H1E A;  1DOK A;  4HMJ A;  4ILW A;  4GOP A;  1GHK A;  4RAU C;  1PYS B;  4LFC L;  3S1Q B;  1PZI D;  2Z1C A;  2NYZ D;  3S2H H;  4BY7 H;  5C6A A;  1CFM A;  3TN2 A;  1GUW A;  1LT5 D;  3OYY A;  3KFU A;  1GKH A;  2NVT B;  3BDL A;  1RTN A;  2VS1 A;  4K6D A;  2Z4I A;  5D3D A;  1E7Z A;  2F0L A;  4JI8 Q;  4HID A;  1KC8 C;  3AEV A;  2WAQ E;  2EPB A;  4JVZ A;  3UE1 A;  1NNX A;  3T4A C;  2VB2 X;  4HIO A;  1EQQ A;  5E4X A;  2JEA I;  4A3D G;  3DMU A;  4CDF C;  5DM7 3;  1N33 L;  3HOZ G;  1QIL A;  4YCW A;  4WJW A;  3A54 A;  4A3B B;  1D6E C;  2XIW A;  4YY3 L;  3DHQ A;  3S24 A;  1EY7 A;  4XYO A;  1WTH A;  3HOU H;  1C7Y A;  1ET9 A;  1YNX A;  5J39 A;  3I4M G;  4PV1 C;  3ND9 A;  1S5D D;  3PO3 B;  2D62 A;  2F0I A;  3U50 C;  1CSP A;  2KUM A;  4LF4 Q;  1QJO A;  5HY6 A;  3K7U C;  2B8F A;  4DK6 C;  3A8J E;  3OPO A;  2WP8 J;  3I4L A;  1G2S A;  1NSN S;  3J7A F;  1KNA A;  1EIF A;  2UU9 Q;  2IX0 A;  2D0O A;  3AB9 A;  1II3 A;  3GV6 A;  2DNE A;  1IW7 D;  3RLF A;  1XJV A;  1G6Z A;  1YVC A;  3NK9 A;  3P75 A;  4IUR A;  3K5M A;  4IPG A;  5ELB A;  2B8G A;  4HJ7 A;  1HHV A;  3T56 B;  2YU9 H;  1FGU A;  2H5X A;  4LF5 Q;  2ES2 A;  1SNM A;  3SXH A;  1WTX A;  2B2W C;  4PZ6 A;  4DAV A;  4EQ5 A;  3I70 A;  1JOR A;  1I6V C;  1Z47 A;  1K3R A;  4HAE A;  1EYC A;  4X3S A;  1SFO H;  3HOW G;  2C5C A;  4AYB E;  2L15 A;  5FLX L;  3S17 H;  4NDX A;  1Q12 A;  1HR0 W;  5EBC A;  3EIV A;  3K0X A;  3M9B A;  2R93 H;  4R4C A;  1IZ6 A;  1SYB A;  3VR6 A;  3BVZ A;  2UXC Q;  2IJ0 A;  4HIM A;  2FXQ A;  1PH1 A;  1DZ1 A;  1SYD A;  2XTI A;  3CME A;  5M5W B;  5GAH C;  3GTL H;  1RL2 A;  4IUQ A;  5FLX c;  5JJK A;  1Q8I A;  4AIM A;  2FHT A;  1TWF B;  1F9S A;  1MBY A;  1HUM A;  1K3B C;  3CQZ H;  1PH5 A;  4CKC A;  4X6A H;  3DUZ A;  3M7G A;  3PUW A;  1VQO A;  1NR2 A;  3IFT A;  3MAQ A;  1TWC H;  4LFB L;  2Y0S B;  1ENC A;  3KYH C;  1SYE A;  3PQI A;  5KIX A;  1SMX A;  3I4O A;  2E75 C;  5C4J H;  3T53 B;  3RN5 A;  3GTG B;  2JYO A;  1E1T A;  3J80 c;  2PYK A;  4PZ8 A;  4A93 B;  2K6A A;  3M3Y H;  1Q46 A;  5I9O A;  5M3M H;  1A3U A;  4H02 A;  3IL8 A;  5LL6 S;  3NTH A;  1NUC A;  3QG1 A;  4MIU A;  5DLQ E;  1TS4 A;  3TP7 A;  5K36 H;  3H91 A;  3DXJ C;  4N8F A;  3KBX A;  5I2X A;  4X66 L;  1QZH A;  4DN4 M;  3UDF A;  4POF A;  4UY8 C;  3EA6 A;  3M4Y A;  4HJ5 A;  1D7Q A;  1PRT C;  2EZV A;  1QVG A;  2HCI A;  2NN6 H;  2TMP A;  5M5Y H;  3NQI A;  1X32 A;  4R9W A;  4YIJ A;  1VQI A;  3GTP B;  1VQJ A;  1EEI D;  1YEZ A;  1Q7Y C;  1ILP A;  3CD6 A;  1KLU D;  1YNN D;  5DEH A;  1R4P B;  4GNX A;  3NSW A;  1VS0 A;  1PRT F;  2IX3 A;  1O7Y A;  3K7A B;  4V19 0;  3PO2 H;  3IAY A;  2PCF B;  2XWB B;  3SHL A;  3PUZ A;  4DV7 Q;  3ONA B;  1OXV A;  4X65 Q;  1VMC A;  1JMC A;  2K1B A;  2KHJ A;  3MFY A;  3NEL A;  1TWG B;  2VQE Q;  4L5R C;  3G48 A;  2IY5 B;  2VUM G;  3E3X A;  3U9O A;  2CFM A;  4MN3 A;  1LLR D;  1IBL Q;  2WFW A;  1PHJ A;  3NXW A;  4A3J B;  4DK3 C;  2JA5 H;  4DR4 L;  3S16 B;  4ME5 A;  4LF7 Q;  4K2L A;  1TY2 A;  1IBM Q;  2ENB A;  2Z6B A;  1K0S A;  5CV4 A;  5IGC A;  3J7A V;  2R7Z G;  3URY A;  1DCZ A;  2RVL A;  2MPM A;  2ZXO A;  3RZO B;  1VQE A;  3P20 A;  4ZQ3 A;  3S1M H;  3J80 i;  3PUY A;  3BG3 A;  4I7Z C;  1CT1 D;  2JA8 B;  3DWA A;  4Y7N H;  4IPC A;  2EJG C;  1CKN B;  4GN5 A;  5C3E H;  4QMG A;  3ITP A;  3G7L A;  2F3V A;  5C0X G;  1I6H B;  4MZ9 A;  4KHZ A;  5DM6 3;  1BXT A;  2IHE A;  5CR3 A;  1OXS C;  4JI6 L;  4A75 A;  2K33 A;  1YNJ D;  1RHP A;  4FYD A;  1X9N A;  2OQK A;  2UXD Q;  2PNH A;  5M9O A;  2QEX A;  2XWJ B;  1HNW L;  3PIP A;  3BZC A;  4A3B G;  3T16 A;  4KKS A;  4LF9 Q;  3VA5 A;  1T5E A;  1BCP D;  5FJ8 H;  1E24 A;  1TY0 A;  5C0X J;  2AQ1 B;  4X3T A;  4NXM L;  3TS0 A;  1IL8 A;  2K5W A;  4BBR B;  2B2Y C;  3AU7 A;  1CHP D;  4A3M H;  2WKD A;  3PO3 G;  4DUY Q;  4JI1 L;  4G57 A;  1HNX L;  4A3F B;  1AN8 A;  1PH4 A;  2VZA A;  4X3K A;  4ID6 A;  1VQD A;  2KOL A;  4WOR A;  4B3M Q;  2DJF C;  2Y0S E;  1ESF A;  2K5D A;  2A68 C;  4KHV A;  1SJH D;  4EQN A;  3MXN B;  2UUC L;  4DV5 Q;  1DJR D;  3ULJ A;  1CHQ D;  2JP1 A;  1B3Q A;  1I4R A;  1QZG A;  2NB0 A;  5IGE A;  5C4X G;  2JA7 B;  3GTK H;  1STA A;  4UPA A;  3OHX C;  4BBS B;  1TWA B;  1YZ6 A;  4IZ8 A;  3Q0A A;  3F2U A;  1BCP B;  4UP8 A;  5F2D A;  2JJQ A;  1JOQ A;  3F8T A;  5BN3 A;  5IYB H;  4QJF A;  2EQS A;  4RH6 A;  1PFS A;  2OTJ A;  4RHS A;  4IUN A;  3MA2 B;  4A3K H;  3C3L A;  2K4K A;  1K8A C;  2V4D A;  3D0F A;  4X66 Q;  1X6O A;  2D2C C;  2FMC A;  3C1F A;  5JEA G;  2F0M A;  1WCM H;  4DR1 L;  3JAM c;  2PO4 A;  3QJY A;  4IAL A;  3D3R A;  1Y8N B;  4BY1 H;  1Q1B A;  4IFD G;  3CC2 A;  3BDC A;  1SYC A;  2MQH A;  2E2I H;  3QB3 A;  3G71 A;  4JI0 L;  1ENA A;  1TKW B;  4A3L G;  4OON A;  1X3G A;  4FNF A;  3G6J B;  2BE5 C;  1HCZ A;  1PDQ A;  4RGO S;  1YHA A;  4YWM A;  2M9V A;  4DR3 L;  4FXK C;  1NMF A;  3HOY B;  2QDL A;  3HKS A;  4KD3 A;  5JPN C;  5EAY A;  2EXZ A;  4DV4 L;  3GTM B;  3GV3 A;  4JV5 L;  1I3Q B;  4C3H B;  3CC7 A;  4O2D A;  5JVH 3;  3RZD B;  3Q23 A;  4DR4 Q;  3M4O B;  4DV0 L;  4H44 C;  4C3I H;  4JK1 C;  3ERO A;  1EIH A;  2UUA L;  4M1U B;  1WD1 A;  1PH6 A;  4L5T A;  2F0J A;  2RQX A;  1LT4 D;  1I4H A;  1HTL D;  3IRB A;  2XSC A;  4A93 G;  1E2W A;  1FNV A;  2N49 A;  1EIG A;  1GOZ A;  1SLJ A;  4NMZ A;  4U68 A;  3RNU A;  1CUK A;  4POG A;  5HGT A;  3FKI B;  2PPB C;  2RCN A;  3J80 E;  4FF3 A;  4GNX C;  1JE5 A;  1PTO C;  1B70 B;  5M5X B;  3A5Z B;  4K14 A;  2AWO A;  1A63 A;  3QOJ A;  1R9T H;  4GLA C;  1MI2 A;  3T1Y Q;  5C5M A;  3K5N A;  3CW2 C;  1PTO F;  3JAM i;  3JC6 6;  2P5Z X;  1HZA A;  3KLS X;  2ZJP A;  2N8N A;  1VQF A;  2OQ0 A;  1LM0 A;  1LTA D;  1Y14 B;  4OX9 L;  1CSQ A;  1HQR D;  2K5V A;  1VQ4 A;  4DR7 L;  1CQF A;  2N3S A;  4DXF A;  2FMM A;  1HTP A;  4DR2 L;  3FDT A;  3HG9 A;  1NAP A;  4GLV B;  5IP7 G;  4PNY A;  3J81 i;  5A35 A;  4C3J B;  2K52 A;  4DFA A;  2IW3 A;  4KHP L;  1DOM A;  3A0J A;  4NXM Q;  2OWO A;  1D5M C;  1G51 A;  4JI2 L;  1YBY A;  1ASZ A;  2JA6 B;  4NW2 A;  4A3J G;  4JI1 Q;  2R6G A;  3S2H B;  5ELN A;  4BY7 B;  2A6E C;  3LNN A;  3QOL A;  4UP7 A;  5GAE C;  2DN8 A;  1EL0 A;  1H9S B;  5CV8 A;  1K8M A;  4JCV E;  4P2C B;  2KEE A;  4OIJ A;  2NZO A;  1GVP A;  1EY8 A;  1Q90 A;  3M4P A;  4F8M A;  1FYC A;  3ULP A;  3WWV A;  1O78 A;  1CKN A;  1Y1W G;  2RCF A;  1FL0 A;  1PH9 A;  3HP3 A;  1AE3 A;  1U4P A;  1S5B D;  4B9X A;  4K5V A;  1LTI D;  1L0W A;  4PZ7 A;  2L1B A;  3STB D;  2EY6 A;  3W5O A;  1KDC A;  4DK1 A;  3CPF A;  2WAQ B;  2F4I A;  1VQM A;  2NN6 I;  4NP5 A;  3MXP A;  1JWU D;  1CZG A;  4RGT A;  1CZW A;  4U67 3;  4LF8 L;  4B3R L;  1STB A;  3R2T A;  3I4N H;  5HGQ A;  2CQO A;  2XRS D;  3LX0 A;  5M3F G;  4N9T A;  3K80 C;  4IOA A;  3FMC A;  2AQ2 B;  4GKK L;  2F0Q A;  4BBR G;  2KVM A;  1SNQ A;  1EWH A;  4DR1 Q;  1GM5 A;  1C8C A;  3PGZ A;  3RR5 A;  2IPK D;  2JA9 A;  2UXB L;  1UEA B;  2LSS A;  3GTO H;  1C0A A;  3NP8 A;  1K0R A;  1W2B A;  1I4G A;  3F2C A;  4DNR B;  1Y1V B;  1MJE A;  4UP9 A;  4C56 C;  3D8G A;  4X64 Q;  4GKJ Q;  3MXN A;  1HR0 L;  1STG A;  1C9O A;  5E7N A;  1ICW A;  2Q8I B;  2B63 H;  3CXC A;  1U4L A;  2F0G A;  2YU9 B;  4GS3 A;  4QF4 A;  2K03 A;  4DR3 Q;  2F0D A;  1B7Y B;  3NEM A;  1WTO A;  4A3I H;  4TRD A;  1GO3 E;  1LTT D;  4YCV A;  2CHB D;  4IJL A;  4JV5 Q;  1VQK A;  2C9O A;  1F2Z A;  1EZ6 A;  2Z6K C;  3PIO 3;  5KEE A;  2RA4 A;  1IHZ A;  4DV0 Q;  1PH7 A;  2XGT A;  4DAY B;  2F1M A;  4LK1 C;  2UUA Q;  1X54 A;  4GN4 B;  4OEM B;  1V8Q A;  3K59 A;  2WAC A;  4O1N A;  4HJ9 A;  4KY7 A;  2R93 B;  1GJX A;  2GVA A;  3VA7 A;  3CCR A;  5E3F A;  1IW7 C;  4AYB B;  2UUB L;  3D31 A;  3HOX G;  2O5J C;  1ZXT A;  3BZK A;  3F2B A;  3HS0 C;  3NE5 B;  4NPS A;  5C44 G;  1SE2 A;  4JBW A;  4DF7 A;  1SE4 A;  2AKW B;  3Q8D A;  3CF5 A;  3GTL B;  1HNZ Q;  2HHH L;  2GVB A;  2VQF L;  4A3D H;  3EN2 A;  1K83 B;  4DV3 L;  2L55 A;  2L0C A;  3GQB A;  3L0O A;  3CQZ B;  1JJC B;  3OTO L;  4C1N I;  3JAM E;  1M8A A;  3TP5 A;  1JOK A;  5EBD A;  4DR7 Q;  1LTS D;  1B1Z A;  4DR2 Q;  1KRS A;  1TWC B;  3SK4 A;  1I4X A;  4GLX A;  5EKI A;  4B3S L;  3NPP A;  3UE0 A;  1RKN A;  3HOY G;  3KLW A;  1HXY D;  5C4J B;  3J81 E;  1EFI D;  3NWT A;  3NBH B;  3I73 A;  1Y8P B;  4EGV A;  4JI2 Q;  5M3M B;  5FO7 B;  4ULL A;  4A3G G;  3A56 A;  1SNO A;  2RSN A;  3VYT A;  2IWH A;  3I3C A;  2E5L L;  2CWP A;  4A3E H;  4C1N K;  1D5Z C;  5K5P A;  3KF8 B;  2FJ2 A;  2EXD A;  5JAV A;  3FKI G;  1KTK A;  5M5Y B;  1E3P A;  4KN7 C;  3DWP A;  3K8A A;  3R3O A;  4KKU A;  1DXM A;  5D3I B;  3KDF B;  3MC0 B;  1Z6H A;  4QL5 A;  4LUV A;  3BVG A;  4M8A A;  1PMR A;  1A2U A;  4LFA L;  1PYB A;  3PO2 B;  1IXR A;  3E6Z X;  2EDG A;  2VW9 A;  1LTR D;  1PVO A;  1AEX A;  4KKT A;  5KNC A;  4DA2 A;  4G7Z C;  3I8Z A;  3RMH A;  4FF1 A;  4HIK A;  1P8L A;  2Q8R E;  1QNK A;  4RMF A;  3HOW H;  2IHF A;  3RUZ A;  2JA5 B;  4DR5 L;  1G8Z D;  3S14 H;  2B2V A;  1HFG A;  3V2T A;  1E0B A;  5LMN L;  5LMU Q;  5E4W C;  1Z7T A;  2B2Y A;  1J5E L;  3T51 B;  4GKK Q;  4IUU A;  2JA6 G;  3S1M B;  4AQY Q;  1EOV A;  2OT2 A;  1BQQ T;  2I07 B;  4E6I A;  5IYD G;  5JOB A;  5JJZ A;  2UXB Q;  3H3V H;  1H9S A;  1JQY D;  2CQA A;  4K0K L;  5C3E B;  1YNN C;  4RG1 A;  4JYA Q;  4XQN A;  1FVI A;  3EJI A;  3DLL A;  3V05 A;  4P74 A;  2K7V A;  3EFX D;  1NE3 A;  2LXK A;  1FR3 A;  1TU2 B;  4ZUI A;  3AMU A;  5COR A;  1A8V A;  4ZLT F;  1PH2 A;  3PCO B;  5AFW A;  3CCJ A;  4DV1 Q;  4NXN L;  2WAQ G;  1DGS A;  1IBK Q;  4OO1 G;  3I56 A;  4KN4 C;  4DUZ L;  1VCI A;  1Q1E A;  3I72 A;  2RDF A;  3T1H L;  1ONL A;  5IP9 G;  1EFW A;  2CWA A;  5LHY 1;  3QIA A;  4ZCK A;  1EUJ A;  2RSO A;  5CC4 A;  4Q5V A;  4A3M B;  5IT9 E;  5BR8 L;  4CKB A;  3TS2 A;  2F0K A;  1DOL A;  1J6Q A;  1J9O A;  5FKA C;  4K5W A;  4K5X A;  1D1K A;  1L1O B;  1B8A A;  1NJI C;  4LF6 L;  2ASB A;  3KJP A;  4BS9 A;  1DD2 A;  4B3T Q;  5FK9 C;  4YWL A;  3TEH B;  4DR6 L;  2UUB Q;  1SBB B;  4UHV A;  4WJ3 M;  2O4X A;  5ELD A;  3VYS A;  3J80 L;  1I4P A;  1CI3 M;  2LY7 A;  1N36 L;  3S1N B;  4A3C G;  1BBW A;  2JQO A;  4EVO A;  4X62 Q;  4BA2 I;  1YNJ C;  3F1Z A;  3BS1 A;  4JI7 L;  3HOV G;  2DY8 A;  2A74 C;  2DUD A;  1ZEQ X;  1HZ9 A;  1Y1V G;  3OTO Q;  1DON A;  3TZU A;  5T1G A;  1ILQ A;  2AMC B;  3CRK C;  3GTK B;  1BCP C;  1EZ8 A;  1XNR L;  3PIO A;  2VUM H;  2GA4 B;  4TKO B;  2F3W A;  2PW5 A;  3KLS A;  4LFC Q;  1N32 L;  5J3B A;  1RCV D;  1LUZ A;  1SEB D;  1QCB D;  1EYA A;  1FNW A;  2C35 B;  1YIJ A;  1BCP F;  2R7Z H;  1QVF A;  2IT1 A;  1JOO A;  4LMQ D;  4DAY A;  4B9W A;  4DPG A;  1OXU A;  1M1K C;  1VDZ A;  2F0W A;  2EYL A;  2KEN A;  2G9H D;  2E5L Q;  1E22 A;  4Z9C B;  2DJG C;  4JI3 L;  1BF4 A;  1NTG A;  4RA8 A;  2PQA B;  4RCO A;  4A76 A;  1WCM B;  2VXW A;  2R61 A;  2HIX A;  2KHI A;  2E2J H;  4BY1 B;  2EY1 A;  5C0X H;  5EKL A;  3DEP A;  4AYB G;  5CMD A;  2E2I B;  1N33 Q;  1ICF B;  3N52 A;  4R4T A;  4KD4 A;  3NQT A;  1IKL A;  2PNR C;  2NVQ B;  4YY3 Q;  4JI5 L;  4JC0 A;  3QWN A;  4Y52 H;  2K5H A;  1WYD A;  3KOJ A;  3H94 A;  4A3B H;  4CBV A;  3F2D A;  2JSO A;  4R8N A;  2YTY A;  3H0G G;  1FD7 D;  1TII D;  4CJ1 B;  4DAP A;  2Q8T A;  2AQ3 B;  1UUP A;  5CBA E;  1LT6 D;  1STH A;  1R4Q B;  4DU9 A;  1SYG A;  4C3I B;  2N78 A;  5LMN Q;  1S72 A;  1XNQ L;  3NBH A;  2F0P A;  3SK5 A;  4N9P A;  1UE7 A;  1BNZ A;  1E2V A;  3TQY A;  1J5E Q;  1ET6 A;  3A8K E;  1TVX A;  1D1I A;  3KBG A;  2LFN A;  2QGQ A;  1Q8K A;  2RHQ B;  1IL2 A;  3DEO A;  3PF4 A;  1G6P A;  3W3A A;  5GRO A;  5A2Q L;  3G4S A;  2OXP A;  4K0K Q;  1HA6 A;  2SNS A;  5IGG A;  2SNM A;  3L9A X;  1H9K A;  1R9T B;  1SMY D;  5FLM G;  2G5D A;  1AP0 A;  2NN6 G;  2QF7 A;  5EGT A;  4PMW A;  2HDM A;  5DNF A;  5I6W A;  3UDX A;  2LKV A;  2I5L X;  3KDF A;  5C4X H;  1VQP A;  4A4I A;  2QCP X;  1YJ9 A;  2B2V C;  3K57 A;  1RD9 D;  3B6Y A;  4JI4 L;  5C4H A;  1SRU A;  4DUZ Q;  4RGM A;  2E76 C;  3T1H Q;  2G9D A;  2EYP A;  1KNE A;  2NUC A;  1PZJ D;  2X6G A;  1KAW A;  4G7H C;  2I0Q A;  2H4O A;  5I6Y A;  4QIW B;  1U0L A;  2OF1 A;  1EYD A;  4LF6 Q;  3P7J A;  4KLK A;  1SSO A;  5JEA H;  1MHW C;  1TS3 A;  4DAM A;  4ODG A;  4P73 A;  2A8V A;  1XPU A;  1MJC A;  1Q86 C;  2A73 B;  1UEB A;  4UDU C;  4A3L H;  3M85 A;  2WB1 B;  2ZTE A;  1V43 A;  1VQ6 A;  4LFB Q;  3M7N A;  5FOB B;  4IUT A;  1HRJ A;  3JAM L;  1I94 L;  1XNR Q;  2PMZ E;  3SE0 A;  1N32 Q;  3TSS A;  1KDB A;  1RJT A;  2EJM A;  3CCQ A;  3CCM A;  3J81 L;  1Q82 C;  2NZ1 D;  2Z6K A;  1K73 C;  3VDY A;  4L5S A;  4PMC A;  3I4N B;  1KAB A;  4DNI A;  1XPO A;  1JWS D;  5FJ8 G;  1UE5 A;  3J7Z C;  4TQU S;  2GN5 A;  1BUV T;  3FPP A;  5IGF A;  3HFZ B;  1NR4 A;  2JE6 I;  3KUP A;  4HSP A;  1L1O A;  3A5U A;  3U9S A;  2EE1 A;  5E1F A;  5I9P A;  2AHO B;  2QIL A;  4CDD C;  3GTO B;  3J81 c;  1SXT A;  1L0X B;  2MGS A;  4TSS A;  1PYW D;  3STB C;  4HJ8 A;  1MSH A;  1BOS A;  2F0T A;  3GP7 A;  2Q2I A;  1Y8O B;  5JEA J;  2HQL A;  1WD0 A;  2B63 B;  1WFQ A;  1EU4 A;  1SYF A;  2AUK A;  3OWF A;  3H3V I;  3RD4 A;  4IFD J;  1MKH A;  1UE1 A;  4A3I B;  4L5Q A;  4WRD A;  2Y0S G;  5IP7 H;  3HKZ B;  1QB5 D;  3NUC A;  1HQM C;  2KCT A;  3CHB D;  3CCV A;  1BR9 A;  2F0H A;  3L7Z C;  1HUN A;  5AJ3 L;  1NY4 A;  3SR1 A;  4R4I A;  4GOP B;  2SEB D;  2J4X A;  2ZT9 C;  4A3J H;  4H7B A;  1XNQ Q;  1K9M C;  1VQ9 A;  1V1P B;  1I50 H;  4YHH L;  2R92 H;  2HD3 A;  2NTS A;  1S5C D;  5IYB G;  1D5X C;  5C5L A;  1SE8 A;  1SRO A;  3BDO A;  1AH9 A;  2EJF C;  3ICE A;  5ELF A;  3D6W A;  4FF4 A;  2PQA A;  2KA7 A;  4R4O A;  1JCK B;  1Y1W H;  4OWW B;  2YYZ A;  5CV9 A;  4JI6 Q;  2DY7 A;  3SDZ A;  2Z9H A;  1H9J A;  1X55 A;  1XPR A;  4EQO A;  4A3D B;  3TP8 A;  4IUV A;  1A6X A;  2CH4 W;  3J81 j;  1HNW Q;  4QIW E;  3R8B A;  5C3W A;  1EY5 A;  2L12 A;  1FNU A;  4L6T B;  4ABN A;  3GTJ H;  2I46 A;  2K01 A;  5DAU A;  2F52 A;  1CM9 A;  1SE3 A;  4QY7 A;  4BWG B;  1HNX Q;  5KYL A;  2JN4 A;  4CJ2 C;  2WB1 E;  1KIX A;  5M3F H;  1SN8 A;  2OEO A;  3SGI A;  3RLN A;  3U4Z A;  3VR3 A;  1KXL A;  3O13 A;  4BBR H;  5CYU A;  3CU7 A;  4CJ0 B;  4XTC S;  4A3E B;  2JA8 G;  5IOC A;  2UUC Q;  4F7X A;  1U9R A;  2N88 A;  1BBX C;  4APV A;  4L63 B;  2Q2T A;  4LUO A;  3BYT B;  2BA1 A;  4PMB A;  4ZAI A;  5IT9 c;  5JVG 3;  1BO0 A;  1S3O A;  1M4V A;  3K5O A;  2E2D C;  1X3P A;  3K81 C;  1MGS A;  5GQO A;  3RN2 A;  1B50 A;  2F0S A;  5IYC G;  4OEL B;  4QCL A;  3HOU B;  3V96 A;  5C0X I;  4I65 A;  1I94 Q;  3S2D H;  4CHT B;  4KY6 A;  2Q2H A;  2A6H D;  5C4Z A;  2K28 A;  2KCM A;  4JBM A;  2ZJQ A;  3C46 A;  3HOW B;  5BN5 A;  2HT1 A;  3M4Q A;  3CCL A;  3L3O C;  3S14 B;  2A19 A;  1TWH H;  4IQZ A;  4A3F G;  1F9P A;  2ZJR A;  2F0N A;  1JT8 A;  3PF5 A;  4JI0 Q;  3HOX H;  3TRZ A;  3R93 A;  1G2T A;  5EKK A;  3HKZ E;  2RF4 A;  5C44 H;  2UU9 L;  3KF6 B;  4KTA A;  2BDN A;  3TDQ A;  1S40 A;  2ZTD A;  2RDH A;  2RBM A;  3BVM A;  3ULL A;  1OXX K;  3W2D A;  1AZQ A;  3SEB A;  1U5K A;  4CDE C;  4DV4 Q;  1VQL A;  3UI2 A;  4FVM A;  1XX8 A;  2JA7 G;  1J8I A;  2Z0S A;  5KYI A;  1JJ2 A;  3K6O A;  3AFQ A;  2A69 D;  1SFO B;  3HOY H;  4BBS G;  4LF5 L;  3NBI A;  4HSV A;  3ZYY X;  3S17 B;  1HJP A;  1ESR A;  4BXX G;  4K2K A;  5AJ3 Q;  3HRZ C;  1L1O C;  3CMA A;  1K28 A;  2VY3 A;  3U4V A;  1K8G A;  1U4R A;  4A3G H;  2J0T D;  2V1C C;  2SOB A;  1H9M A;  1TQO A;  1JE4 A;  3H15 A;  1Y69 U;  1IYU A;  2FFK B;  3FEW X;  4N8X 1;  1VQA A;  2XN9 C;  2E2H H;  1LV9 A;  2B2T A;  2CVR A;  5ELO A;  3A55 A;  2PI2 E;  4ZYS A;  3A8I E;  3HOZ H;  1SDF A;  2PQE A;  4OX9 Q;  2OTL A;  2MUY A;  3NHH A;  4DV2 L;  3PMF A;  1GUS A;  5FO9 B;  3CCU A;  1CA6 A;  2KCN A;  3X3N A;  1SR3 A;  5KNB A;  1V9P A;  3I4M H;  4JG2 A;  2PZW A;  4G4K A;  4KHP Q;  1ZYR D;  2B29 A;  3RLO A;  4I7A A;  4PG3 A;  2VUM B;  2L5T A;  3M3Y B;  2XNA C;  1GUG A;  2F3I A;  4C3H G;  4A3I G;  2D0P A;  2ZTC A;  3U58 A;  4V0B A;  1NBW A;  5C3X A;  4DK0 A;  5NUC A;  1O7L A;  1YHQ A;  5GAG C;  1PZK D;  1TT2 A;  1UAP A;  1PH3 A;  2R7Z B;  1LTG D;  2IL8 A;  4KI0 A;  1KL9 A;  3I91 A;  1CK1 A;  4GN3 B;  2K5N A;  2JA6 H;  5HUR A;  2ALY B;  4FF2 A;  1A0I A;  1V1P A;  2KJX A;  4ZUJ A;  3KJO A;  5IYD H;  3TBI B;  2YV5 A;  1IYJ B;  4RWS C;  2NBF A;  2E2J B;  2QKI C;  2X69 A;  3Q22 A;  3TP6 A;  4C2M H;  1FJG L;  1WOC A;  3GTQ H;  5IY0 A;  1SJE D;  3TZD A;  1ENF A;  3CC4 A;  4XIG S;  1NMG A;  2KHS A;  4P72 A;  3CCE A;  2M2L A;  2WIN B;  3EVQ A;  4IUP A;  5EPL A;  2NVY H;  2D5D A;  4LF8 Q;  1G91 A;  4B3R Q;  1AW7 A;  4DV7 L;  4OO1 H;  2MHV A;  4C3J G;  1S5E D;  2O5I C;  4X65 L;  4RKL A;  3G6E A;  1UNS A;  5IP9 H;  1LTB D;  3T13 A;  2PI2 A;  2VQE L;  3E0E A;  2CCZ A;  3PIP 3;  1A2T A;  3HGB A;  5T1I A;  2DNC A;  1IBL L;  3W1B A;  4K6L A;  4LF7 L;  3S1R H;  2CW0 D;  1IBM L;  1B9N A;  4BY7 G;  4Y7N B;  2A5H A;  2MP1 A;  2F03 A;  3I55 A;  3GO5 A;  1VQ8 A;  2BH2 A;  4DGZ A;  4QGU A;  3UDG A;  2XVS A;  4KY5 A;  2KED A;  4DV6 L;  1STE A;  1HR0 Q;  4A3E G;  3OIP A;  4A3C H;  1JR0 D;  4DNT B;  1EOT A;  2K32 A;  2EVB A;  1D2B A;  3HOV H;  1QG7 A;  1F2Y A;  2F0F A;  1JIC A;  1OTC A;  1CKM A;  1Y1V H;  4WFN 3;  2QEJ C;  4R8I A;  1F9Q A;  2WV6 D;  1GUT A;  4UAI A;  3MHB A;  5C4X B;  4ALP A;  4PQX A;  1RDP D;  4F88 A;  4TVA B;  2UXD L;  1KRT A;  1F2M A;  3HOU G;  1O80 A;  1HFN A;  2ICE C;  5D65 A;  1VF7 A;  4LF9 L;  3K0Y A;  4HN7 A;  3DM3 A;  2K05 A;  2K04 A;  3K58 A;  3S15 H;  4EX5 A;  4JBJ A;  1KLG D;  4DUY L;  1TS2 A;  4XT1 B;  4JBK A;  4KV6 A;  2HHH Q;  2NVX H;  3CRL C;  1LAC A;  1SMY C;  2VQF Q;  2O2L D;  4DV3 Q;  4B3M L;  1A3V A;  1PTO H;  1W3S A;  4X3U A;  1VQ7 A;  2MO0 A;  1VQ5 A;  1QVC A;  1XMQ L;  2PZT A;  4DV2 Q;  1KD1 C;  2VB3 X;  3KF6 A;  4MNO A;  3X3M A;  4HCS A;  3ND8 A;  5JJI A;  3CCS A;  3A7L A;  4RHR A;  4B3S Q;  3GD7 A;  1K83 H;  4DV5 L;  4KJO A;  1WTR A;  4ZKB B;  2EYF A;  1XMO L;  1YJW A;  5I2Y A;  2RHS B;  3CPW A;  2B2U A;  3A7A B;  4YWK A;  3H0G H;  4IO9 A;  2HQE A;  2B39 A;  4K8J A;  3S1Q H;  2K50 A;  4QUC A;  4A3K B;  3NWS A;  2B2T C;  1F9R A;  4FXG C;  3J7Y W;  2PMZ B;  3NTI A;  1TR5 A;  2R93 G;  4IOC A;  1AE2 A;  3Q24 A;  2OCE A;  5IOD A;  2NVT H;  3HZX A;  2I5H A;  5IE8 A;  2E74 C;  4KJN A;  4R4Q A;  4P75 A;  4XYQ A;  1QOH A;  2KBN A;  4OWT B;  1FJG Q;  3E9H A;  3SVM A;  2YTV A;  2CKZ B;  5FLM H;  4WJ4 A;  4RCN A;  4LFA Q;  3ER0 A;  1K8O A;  1CQV A;  2KQ3 A;  2JEB I;  1QWY A;  4RKB A;  4LNQ A;  1HZB A;  3MXU A;  1O7I A;  1B53 A;  4JPB W;  1BKB A;  4OHJ A;  1O7Z A;  5J22 A;  2EY2 A;  1KHI A;  2EOT A;  4LUZ A;  1E2Z A;  4DR5 Q;  1HZC A;  2BH8 A;  5CV6 A;  4GOP C;  2WKC A;  3PO3 H;  1A3T A;  2VL6 A;  4XQJ A;  1ASY A;  1SNP A;  1VQH A;  1VQN A;  2NTT A;  2HCC A;  1AFP A;  4F87 A;  3WOE A;  5M3M G;  5KND A;  1XTD A;  4OGQ C;  2LMC B;  5ISR A;  5K36 G;  1I50 B;  4JOI A;  2R92 B;  5EPJ A;  4XXE A;  4O42 A;  3CKI B;  2JK8 A;  4Q0F A;  3KF8 A;  4FO2 A;  1UWV A;  1MIU A;  4DV6 Q;  2F4V L;  1XTC D;  2F0O A;  1PLF A;  1Y1W B;  3ERQ A;  1A62 A;  1M90 C;  3LGJ A;  1HA5 A;  1BDO A;  4IPH A; 
#chains in the Genus database with same CATH homology
 4RFB A;  1PXU A;  2RKS A;  1OO9 B;  4J6H A;  1WTP A;  1F2L A;  1PFB A;  3MZ5 A;  5EJW A;  5CV5 A;  2ICI A;  3GTJ B;  1EQV A;  4BA1 I;  4B08 A;  3OW7 A;  3R2I A;  2BA0 A;  1STN A;  3NTK A;  2F0V A;  1AZP A;  5M3F B;  4G7O C;  1SNC A;  4IFD H;  1EY6 A;  2F0E A;  4H13 C;  3I90 A;  2K5Q A;  5CGK A;  2HUG A;  5BN4 A;  4XT3 B;  1PRT D;  5G3L F;  4RGN A;  2PZU A;  1V1O A;  3DM1 A;  1S4Z A;  1VF5 C;  3C1E A;  3OMC A;  3D4R A;  2JXM B;  3P1H A;  1EY4 A;  4HMI A;  4J1M A;  4DXG A;  4CKE A;  3S2D B;  1KAA A;  1T5X D;  1SAP A;  1LT3 D;  5ELC A;  4L8J A;  3MXG A;  2N55 A;  5KGU A;  5LL6 X;  3WOF A;  1TWH B;  5IGB A;  2ZXR A;  3VR4 A;  1B2T A;  4OO1 I;  3BZD B;  3H3V C;  3Q6S A;  3VR2 A;  3HEJ A;  3OMG A;  2AWN A;  2EYJ A;  5CBE E;  4KMU C;  3HOX B;  1TS5 A;  3WDN A;  5C44 B;  3EQL C;  1VMP A;  1PRT B;  2B2U C;  3MWY W;  4CGY B;  2A6H C;  1GXD C;  3D4D A;  4OL7 A;  2HDL A;  2ID0 A;  1C4Q A;  1JB3 A;  1QNU A;  2TSS A;  3PUV A;  4QUF A;  1JC7 A;  3LWE A;  1EEF D;  1HPC A;  2X6L A;  3OOC A;  4S3S A;  4XQQ A;  5FLX E;  3H6M A;  2BDO A;  4MHE A;  4ZK9 B;  3SK6 A;  1W6J A;  2IX1 A;  2LS0 1;  1B4O A;  4A3G B;  2KCC A;  1NCV A;  2Z8L A;  3MVV A;  5COY A;  2EYH A;  5G3L D;  1STY A;  2E2H B;  1A15 A;  1MD2 D;  4NKL A;  3KLR A;  1EWC A;  4XDX A;  5EQ0 A;  3HOZ B;  4OIK A;  2A68 D;  1W6K A;  4KK7 A;  5FO8 B;  5IGD A;  1WTV A;  3FPU B;  3BYY B;  1IKM A;  3PV0 A;  1GHJ A;  1IYV A;  2A69 C;  3VYR A;  3I4M B;  1EY0 A;  1B9M A;  1F77 A;  1WVL A;  5JPM C;  2MJ8 A;  4EQP A;  1H9R A;  1I4Q A;  2BOS A;  5IT9 L;  3MFG A;  4C3I G;  3S9W A;  1XXG A;  2XRQ D;  1DM0 B;  1WTQ A;  3H09 A;  3OSO A;  4H0L C;  4HCE A;  5IIF A;  2VNU D;  4GZY C;  2BCO A;  1QE6 A;  1LO5 D;  2M00 A;  4K8I A;  4C2M B;  1WTW A;  3GTQ B;  5EPK A;  3DWQ A;  3VR5 A;  3FRP B;  3PUX A;  5D14 A;  5TSS A;  1ZYR C;  3QO2 A;  2BE5 D;  2ZXP A;  2SDF A;  1RF2 D;  2EYO A;  3MEH A;  2NVY B;  2F0U A;  1B44 D;  3IFD A;  2QDB A;  5J1Z A;  1C48 A;  3VYU A;  4HED A;  2B2W A;  2EYM A;  1EU3 A;  4HTH A;  3OWE B;  3S1R B;  4J8Q A;  5ELE A;  1ZKO A;  5A2Q E;  2J7Z A;  1U4M A;  4LJZ C;  3D6C A;  2R3Z A;  1PTO D;  3LWU A;  1OXT A;  1GUO A;  3HOV B;  2WII B;  5CV7 A;  1FGB D;  3FVQ A;  3KK7 A;  1KDA A;  3MTS A;  3OIQ A;  1L0Y B;  4LAA A;  4IN3 A;  1X3Q A;  3C2P A;  2AUJ D;  1XYI A;  1EQT A;  3IKJ A;  4HR7 B;  1JWM D;  2L4N A;  2CW0 C;  1G29 1;  2PW7 A;  1LAB A;  2FIN B;  3S15 B;  1S5F D;  2L9H A;  2A6E D;  2NVX B;  3K5L A;  1ROD A;  1DYQ A;  1PFN A;  1ML0 D;  2Z4H A;  1CA5 A;  2D9U A;  4QB4 A;  5I4D A;  1PTO B;  5KRU A;  3E0J A;  1GUN A;  2RDG A;  1B3A A;  4IFD I;  4ZKC B;  3TME A;  1PFM A;  1XWE A;  3SK8 A;  4ZRZ A;  2NWG A;  1Q3L A;  2EY5 A;  1SND A;  1RTO A;  1EY9 A;  1CTM A;  3D4W A;  3H0G B;  3N6R A;  1MSG A;  3E5S A;  4FXD A;  2L11 A;  4FP5 D;  2KEC A;  2H1E A;  1DOK A;  4HMJ A;  4ILW A;  1GHK A;  4RAU C;  3S1Q B;  1PZI D;  2Z1C A;  2NYZ D;  5C6A A;  1CFM A;  3TN2 A;  1GUW A;  1LT5 D;  2NVT B;  3BDL A;  1RTN A;  4K6D A;  2Z4I A;  5D3D A;  2F0L A;  2EPB A;  3T4A C;  2VB2 X;  2JEA I;  5E4X A;  3DMU A;  5DM7 3;  1QIL A;  4WJW A;  3A54 A;  4A3B B;  1D6E C;  2XIW A;  3DHQ A;  1EY7 A;  4XYO A;  1ET9 A;  5J39 A;  4PV1 C;  3ND9 A;  1S5D D;  3PO3 B;  2D62 A;  2F0I A;  2KUM A;  1QJO A;  2B8F A;  3A8J E;  3OPO A;  2WP8 J;  3I4L A;  1G2S A;  1NSN S;  3J7A F;  1KNA A;  2IX0 A;  3AB9 A;  1II3 A;  3GV6 A;  2DNE A;  1IW7 D;  3RLF A;  1G6Z A;  3NK9 A;  3P75 A;  4IUR A;  3K5M A;  5ELB A;  2B8G A;  1HHV A;  3T56 B;  1SNM A;  3SXH A;  1WTX A;  2B2W C;  4DAV A;  3I70 A;  1JOR A;  1I6V C;  1Z47 A;  4HAE A;  1EYC A;  4X3S A;  2C5C A;  5FLX L;  4NDX A;  1Q12 A;  5EBC A;  1SYB A;  3VR6 A;  3BVZ A;  2IJ0 A;  1DZ1 A;  1SYD A;  5M5W B;  4IUQ A;  1Q8I A;  2FHT A;  1TWF B;  1F9S A;  1MBY A;  1HUM A;  4CKC A;  3DUZ A;  3M7G A;  3PUW A;  1NR2 A;  3IFT A;  3MAQ A;  2Y0S B;  1ENC A;  1SYE A;  5KIX A;  2E75 C;  3T53 B;  3GTG B;  2JYO A;  2PYK A;  4A93 B;  2K6A A;  5I9O A;  1A3U A;  3IL8 A;  5LL6 S;  3NTH A;  1NUC A;  3QG1 A;  4MIU A;  1TS4 A;  3TP7 A;  5K36 H;  3H91 A;  3DXJ C;  3KBX A;  5I2X A;  4DN4 M;  3EA6 A;  3M4Y A;  1PRT C;  2EZV A;  2HCI A;  2NN6 H;  2TMP A;  3NQI A;  1X32 A;  4R9W A;  4YIJ A;  3GTP B;  1EEI D;  1ILP A;  1KLU D;  1YNN D;  5DEH A;  1R4P B;  3NSW A;  1PRT F;  2IX3 A;  1O7Y A;  3K7A B;  4V19 0;  3IAY A;  2PCF B;  2XWB B;  3SHL A;  3PUZ A;  3ONA B;  1OXV A;  1VMC A;  2K1B A;  3MFY A;  1TWG B;  3U9O A;  4MN3 A;  1LLR D;  3NXW A;  4A3J B;  3S16 B;  4ME5 A;  4K2L A;  1TY2 A;  2ENB A;  5CV4 A;  5IGC A;  3J7A V;  3URY A;  1DCZ A;  2RVL A;  2MPM A;  2ZXO A;  3RZO B;  3P20 A;  4ZQ3 A;  3PUY A;  3BG3 A;  4I7Z C;  1CT1 D;  2JA8 B;  3DWA A;  2EJG C;  4QMG A;  3ITP A;  3G7L A;  2F3V A;  5C0X G;  1I6H B;  4KHZ A;  5DM6 3;  1BXT A;  5CR3 A;  1OXS C;  2K33 A;  1YNJ D;  1RHP A;  4FYD A;  5M9O A;  2XWJ B;  3T16 A;  4KKS A;  3VA5 A;  1T5E A;  1BCP D;  1TY0 A;  5C0X J;  2AQ1 B;  4X3T A;  1IL8 A;  2K5W A;  4BBR B;  2B2Y C;  3AU7 A;  1CHP D;  2WKD A;  4G57 A;  4A3F B;  1AN8 A;  4X3K A;  4ID6 A;  2KOL A;  4WOR A;  1ESF A;  2K5D A;  2A68 C;  4KHV A;  1SJH D;  4EQN A;  1DJR D;  1CHQ D;  2JP1 A;  1I4R A;  2NB0 A;  5IGE A;  2JA7 B;  1STA A;  3OHX C;  4BBS B;  1TWA B;  4IZ8 A;  3Q0A A;  3F2U A;  1BCP B;  5F2D A;  1JOQ A;  5BN3 A;  4RH6 A;  4RHS A;  4IUN A;  3MA2 B;  3C3L A;  2V4D A;  2D2C C;  2FMC A;  3C1F A;  5JEA G;  2F0M A;  2PO4 A;  3QJY A;  4IAL A;  3D3R A;  1Y8N B;  1Q1B A;  4IFD G;  3BDC A;  1SYC A;  3QB3 A;  1ENA A;  1TKW B;  4FNF A;  3G6J B;  2BE5 C;  1HCZ A;  1PDQ A;  4RGO S;  2M9V A;  4FXK C;  3HOY B;  4KD3 A;  5JPN C;  2EXZ A;  3GTM B;  3GV3 A;  1I3Q B;  4C3H B;  5JVH 3;  3RZD B;  3Q23 A;  3M4O B;  4H44 C;  4JK1 C;  3ERO A;  1EIH A;  4M1U B;  1WD1 A;  2F0J A;  2RQX A;  1LT4 D;  1I4H A;  1HTL D;  2XSC A;  1E2W A;  1FNV A;  1EIG A;  1GOZ A;  4NMZ A;  4U68 A;  5HGT A;  3FKI B;  2PPB C;  3J80 E;  4FF3 A;  1PTO C;  5M5X B;  4K14 A;  2AWO A;  3QOJ A;  1MI2 A;  5C5M A;  3K5N A;  1PTO F;  3KLS X;  1LTA D;  1HQR D;  1CQF A;  4DXF A;  2FMM A;  1HTP A;  3FDT A;  3HG9 A;  1NAP A;  4PNY A;  5A35 A;  4C3J B;  4DFA A;  2IW3 A;  1DOM A;  1D5M C;  2JA6 B;  4NW2 A;  2R6G A;  3S2H B;  4BY7 B;  2A6E C;  3LNN A;  3QOL A;  2DN8 A;  1EL0 A;  1H9S B;  5CV8 A;  1K8M A;  4P2C B;  2KEE A;  4OIJ A;  1EY8 A;  1Q90 A;  4F8M A;  1FYC A;  1O78 A;  3HP3 A;  1U4P A;  1S5B D;  4B9X A;  4K5V A;  1LTI D;  2L1B A;  2EY6 A;  1KDC A;  4DK1 A;  2WAQ B;  2F4I A;  2NN6 I;  4NP5 A;  3MXP A;  1JWU D;  1CZG A;  4RGT A;  1CZW A;  4U67 3;  1STB A;  3R2T A;  2XRS D;  3LX0 A;  4N9T A;  3FMC A;  2AQ2 B;  2F0Q A;  2KVM A;  1SNQ A;  1EWH A;  1C8C A;  2IPK D;  1UEA B;  3NP8 A;  1I4G A;  4DNR B;  1Y1V B;  4C56 C;  3D8G A;  3MXN A;  1STG A;  2Q8I B;  1ICW A;  1U4L A;  2F0G A;  2YU9 B;  4QF4 A;  2K03 A;  2F0D A;  1WTO A;  4TRD A;  1LTT D;  2CHB D;  2C9O A;  1F2Z A;  1EZ6 A;  3PIO 3;  5KEE A;  2RA4 A;  1IHZ A;  2F1M A;  4LK1 C;  1V8Q A;  3K59 A;  2WAC A;  4O1N A;  4KY7 A;  2R93 B;  1GJX A;  3VA7 A;  5E3F A;  1IW7 C;  4AYB B;  2O5J C;  3D31 A;  1ZXT A;  3HS0 C;  3NE5 B;  1SE2 A;  4JBW A;  4DF7 A;  1SE4 A;  3GTL B;  1K83 B;  2L55 A;  2L0C A;  3GQB A;  3CQZ B;  4C1N I;  3JAM E;  1M8A A;  3TP5 A;  1JOK A;  5EBD A;  1LTS D;  1B1Z A;  1TWC B;  3SK4 A;  1I4X A;  5EKI A;  3NPP A;  1RKN A;  1HXY D;  5C4J B;  3J81 E;  1EFI D;  3NWT A;  3I73 A;  1Y8P B;  4EGV A;  5M3M B;  5FO7 B;  4ULL A;  3A56 A;  1SNO A;  2RSN A;  3VYT A;  2IWH A;  3I3C A;  4C1N K;  1D5Z C;  5K5P A;  2FJ2 A;  5JAV A;  1KTK A;  5M5Y B;  4KN7 C;  3DWP A;  3R3O A;  4KKU A;  1DXM A;  5D3I B;  3MC0 B;  1Z6H A;  3BVG A;  4M8A A;  1PMR A;  1A2U A;  3PO2 B;  3E6Z X;  2EDG A;  1LTR D;  1AEX A;  4KKT A;  5KNC A;  4DA2 A;  4G7Z C;  3I8Z A;  3RMH A;  4FF1 A;  2Q8R E;  1QNK A;  3RUZ A;  2JA5 B;  1G8Z D;  2B2V A;  1HFG A;  3V2T A;  1E0B A;  5E4W C;  1Z7T A;  2B2Y A;  3T51 B;  4IUU A;  3S1M B;  2OT2 A;  1BQQ T;  2I07 B;  4E6I A;  5JOB A;  5JJZ A;  1H9S A;  1JQY D;  2CQA A;  5C3E B;  1YNN C;  4XQN A;  3EJI A;  3V05 A;  2K7V A;  3EFX D;  1FR3 A;  1TU2 B;  4ZUI A;  3AMU A;  5COR A;  4ZLT F;  5AFW A;  4OO1 G;  4KN4 C;  1VCI A;  1Q1E A;  3I72 A;  2RDF A;  1ONL A;  5LHY 1;  3QIA A;  5CC4 A;  2RSO A;  4Q5V A;  4A3M B;  5IT9 E;  4CKB A;  2F0K A;  1DOL A;  1J9O A;  5FKA C;  4K5W A;  4K5X A;  1D1K A;  4BS9 A;  1DD2 A;  5FK9 C;  1SBB B;  2O4X A;  5ELD A;  3VYS A;  3J80 L;  1I4P A;  1CI3 M;  2LY7 A;  3S1N B;  4EVO A;  4BA2 I;  1YNJ C;  3BS1 A;  2DY8 A;  2A74 C;  1ZEQ X;  1DON A;  3TZU A;  5T1G A;  1ILQ A;  3CRK C;  3GTK B;  1BCP C;  1EZ8 A;  2GA4 B;  4TKO B;  2F3W A;  2PW5 A;  3KLS A;  1RCV D;  1SEB D;  1QCB D;  1EYA A;  1FNW A;  1BCP F;  2IT1 A;  1JOO A;  4LMQ D;  4DAY A;  4B9W A;  1OXU A;  1VDZ A;  2F0W A;  2EYL A;  2G9H D;  4Z9C B;  1BF4 A;  4RA8 A;  4RCO A;  1WCM B;  2VXW A;  2R61 A;  4BY1 B;  2EY1 A;  5C0X H;  5EKL A;  3DEP A;  5CMD A;  2E2I B;  3N52 A;  4KD4 A;  3NQT A;  1IKL A;  2PNR C;  2NVQ B;  3QWN A;  3H94 A;  4CBV A;  2JSO A;  4R8N A;  1FD7 D;  1TII D;  4CJ1 B;  4DAP A;  2Q8T A;  2AQ3 B;  1UUP A;  5CBA E;  1LT6 D;  1STH A;  1R4Q B;  4DU9 A;  1SYG A;  4C3I B;  3NBH A;  2F0P A;  3SK5 A;  4N9P A;  1BNZ A;  1E2V A;  1ET6 A;  3A8K E;  1TVX A;  1D1I A;  3KBG A;  2LFN A;  3DEO A;  3W3A A;  5A2Q L;  2OXP A;  1HA6 A;  2SNS A;  5IGG A;  2SNM A;  3L9A X;  1H9K A;  1R9T B;  1SMY D;  1AP0 A;  2NN6 G;  2QF7 A;  5EGT A;  4PMW A;  2HDM A;  5DNF A;  5I6W A;  2LKV A;  2QCP X;  2B2V C;  3K57 A;  1RD9 D;  5C4H A;  4RGM A;  2E76 C;  2G9D A;  2EYP A;  1KNE A;  2NUC A;  1PZJ D;  2X6G A;  4G7H C;  2H4O A;  5I6Y A;  4QIW B;  2OF1 A;  1EYD A;  3P7J A;  1SSO A;  5JEA H;  1TS3 A;  4ODG A;  2A73 B;  4UDU C;  3M85 A;  2WB1 B;  1V43 A;  3M7N A;  5FOB B;  4IUT A;  1HRJ A;  3JAM L;  3SE0 A;  3TSS A;  1KDB A;  1RJT A;  2EJM A;  3J81 L;  2NZ1 D;  4PMC A;  3I4N B;  1KAB A;  1JWS D;  4TQU S;  1BUV T;  3FPP A;  5IGF A;  1NR4 A;  2JE6 I;  3KUP A;  4HSP A;  3U9S A;  2EE1 A;  5E1F A;  5I9P A;  2QIL A;  3GTO B;  1SXT A;  1L0X B;  2MGS A;  4TSS A;  1PYW D;  1MSH A;  1BOS A;  2F0T A;  3GP7 A;  1Y8O B;  5JEA J;  1WD0 A;  2B63 B;  1EU4 A;  1SYF A;  2AUK A;  3OWF A;  3RD4 A;  4IFD J;  4A3I B;  4WRD A;  3HKZ B;  1QB5 D;  3NUC A;  1HQM C;  3CHB D;  1BR9 A;  2F0H A;  3L7Z C;  1HUN A;  3SR1 A;  2SEB D;  2J4X A;  2ZT9 C;  4H7B A;  1V1P B;  2NTS A;  1S5C D;  1D5X C;  5C5L A;  3BDO A;  2EJF C;  5ELF A;  3D6W A;  4FF4 A;  2KA7 A;  1JCK B;  2YYZ A;  5CV9 A;  2DY7 A;  3SDZ A;  1H9J A;  4EQO A;  4A3D B;  3TP8 A;  4IUV A;  1A6X A;  3R8B A;  5C3W A;  1EY5 A;  2L12 A;  1FNU A;  4L6T B;  4ABN A;  2I46 A;  2K01 A;  5DAU A;  1CM9 A;  1SE3 A;  4BWG B;  5KYL A;  4CJ2 C;  2OEO A;  3VR3 A;  3O13 A;  5CYU A;  3CU7 A;  4CJ0 B;  4XTC S;  4A3E B;  5IOC A;  4F7X A;  1U9R A;  2N88 A;  1BBX C;  4L63 B;  3BYT B;  2BA1 A;  4PMB A;  4ZAI A;  5JVG 3;  1BO0 A;  1M4V A;  3K5O A;  2E2D C;  1X3P A;  1MGS A;  1B50 A;  2F0S A;  4QCL A;  3HOU B;  3V96 A;  5C0X I;  4I65 A;  4CHT B;  4KY6 A;  2A6H D;  5C4Z A;  2K28 A;  3C46 A;  3HOW B;  5BN5 A;  3L3O C;  3S14 B;  4IQZ A;  1F9P A;  2F0N A;  3R93 A;  1G2T A;  5EKK A;  4KTA A;  2BDN A;  3TDQ A;  2RDH A;  2RBM A;  3BVM A;  1OXX K;  3W2D A;  1AZQ A;  3SEB A;  3UI2 A;  4FVM A;  1XX8 A;  1J8I A;  5KYI A;  3K6O A;  2A69 D;  1SFO B;  3NBI A;  4HSV A;  3ZYY X;  3S17 B;  1ESR A;  4K2K A;  3HRZ C;  1U4R A;  2J0T D;  2SOB A;  1H9M A;  1TQO A;  1JE4 A;  1Y69 U;  1IYU A;  2FFK B;  3FEW X;  2XN9 C;  1LV9 A;  2B2T A;  2CVR A;  3A55 A;  4ZYS A;  3A8I E;  1SDF A;  2PQE A;  2MUY A;  3NHH A;  3PMF A;  1GUS A;  5FO9 B;  1CA6 A;  2KCN A;  3X3N A;  5KNB A;  2PZW A;  4G4K A;  1ZYR D;  2VUM B;  2L5T A;  3M3Y B;  2XNA C;  1GUG A;  4C3H G;  4V0B A;  5C3X A;  4DK0 A;  5NUC A;  1O7L A;  1PZK D;  1TT2 A;  1UAP A;  2R7Z B;  1LTG D;  2IL8 A;  4KI0 A;  3I91 A;  1CK1 A;  5HUR A;  4FF2 A;  1V1P A;  2KJX A;  4ZUJ A;  3TBI B;  4RWS C;  2NBF A;  2E2J B;  2QKI C;  2X69 A;  3Q22 A;  3TP6 A;  1SJE D;  3TZD A;  1ENF A;  4XIG S;  2KHS A;  2M2L A;  2WIN B;  3EVQ A;  4IUP A;  5EPL A;  2D5D A;  1G91 A;  1AW7 A;  4OO1 H;  2MHV A;  4C3J G;  1S5E D;  2O5I C;  4RKL A;  1UNS A;  1LTB D;  3T13 A;  3PIP 3;  1A2T A;  3HGB A;  5T1I A;  2DNC A;  4K6L A;  2CW0 D;  1B9N A;  4Y7N B;  2A5H A;  2MP1 A;  2F03 A;  3GO5 A;  4DGZ A;  2XVS A;  4KY5 A;  2KED A;  1STE A;  3OIP A;  1JR0 D;  4DNT B;  1EOT A;  2K32 A;  2EVB A;  1D2B A;  1QG7 A;  1F2Y A;  2F0F A;  1JIC A;  4WFN 3;  2QEJ C;  4R8I A;  1F9Q A;  2WV6 D;  1GUT A;  4UAI A;  3MHB A;  5C4X B;  4PQX A;  1RDP D;  4F88 A;  1F2M A;  1O80 A;  1HFN A;  2ICE C;  5D65 A;  1VF7 A;  3K0Y A;  4HN7 A;  2K05 A;  2K04 A;  3K58 A;  1KLG D;  1TS2 A;  4XT1 B;  4KV6 A;  3CRL C;  1LAC A;  1SMY C;  2O2L D;  1A3V A;  1PTO H;  4X3U A;  2PZT A;  2VB3 X;  3X3M A;  4HCS A;  3ND8 A;  3A7L A;  4RHR A;  3GD7 A;  4KJO A;  1WTR A;  4ZKB B;  2EYF A;  5I2Y A;  2B2U A;  3A7A B;  2HQE A;  2B39 A;  4K8J A;  4QUC A;  4A3K B;  3NWS A;  2B2T C;  1F9R A;  4FXG C;  3J7Y W;  2PMZ B;  3NTI A;  1TR5 A;  3Q24 A;  5IOD A;  3HZX A;  2E74 C;  4KJN A;  4XYQ A;  1QOH A;  3SVM A;  4RCN A;  1K8O A;  1CQV A;  2KQ3 A;  2JEB I;  1QWY A;  4RKB A;  3MXU A;  1B53 A;  4OHJ A;  1O7Z A;  5J22 A;  2EY2 A;  2EOT A;  1E2Z A;  5CV6 A;  2WKC A;  1A3T A;  4XQJ A;  1SNP A;  2NTT A;  2HCC A;  1AFP A;  4F87 A;  3WOE A;  5KND A;  4OGQ C;  2LMC B;  5ISR A;  5K36 G;  1I50 B;  2R92 B;  5EPJ A;  4XXE A;  4O42 A;  3CKI B;  4Q0F A;  3KF8 A;  4FO2 A;  1XTC D;  2F0O A;  1PLF A;  1Y1W B;  3ERQ A;  1HA5 A;  1BDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...