1V8QA

Crystal structure of ribosomal protein l27 from thermus thermophilus hb8
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
RLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TT0826
publication title Crystal structure of ribosomal protein L27 from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Translation
total genus 17
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01016 Ribosomal_L27 Ribosomal L27 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v8qA00
3RLFA 1H9SB 1Z7TA 2O5JC 1A6XA 4XIGS 4HR7B 4OO1H 4BA1I 1OXTA 4KMUC 1T5EA 4H44C 4KKTA 2A6EC 3LWUA 2A68D 2F1MA 1B9MA 1OXVA 1OXXK 2IT1A 3H94A 2K33A 3MXUA 1HQMC 2EDGA 4IFDG 1Y8PB 3M4YA 4KN4C 1G291 3A7LA 5C0XG 1V8QA 2EVBA 1V43A 4IQZA 3GQBA 1DXMA 5C0XH 2DNEA 1TU2B 3I72A 3T56B 1E2WA 1PMRA 1CTMA 1Q1EA 3W3AA 4TQUS 1O78A 4DNRB 3MFYA 2JXMB 3FPPA 3A7AB 4KKSA 3VA7A 1GHKA 2ZT9C 4KN7C 1IYVA 4DK1A 2PNRC 3PUZA 4BA2I 2V4DA 2QF7A 1Y8OB 2LMCB 2NN6G 2D62A 3D4RA 2A6HD 3I73A 1HCZA 4RCNA 1BDOA 1FYCA 2CW0C 2YYZA 1H9MA 3VR6A 1Q12A 1VCIA 2BE5D 3OPOA 2KCCA 1SMYC 3QIAA 2Q8IB 2JE6I 3PUYA 4I7ZC 4IFDH 1GJXA 4KKUA 3IKJA 2D2CC 2BA0A 1TKWB 1VF7A 2AUJD 2EJMA 3OW7A 1LABA 3PUWA 5K36G 3T53B 3VR5A 2PPBC 2A6HC 1HTPA 4KI0A 1I6VC 1GUSA 3PUXA 1FR3A 5BN3A 5JEAG 2AWOA 2NN6I 2DNCA 1H9SA 3LNNA 3BG3A 3FMCA 3VR3A 1H9KA 1CFMA 2BE5C 4DNTB 1GUNA 1VF5C 2DN8A 2E76C 1GUGA 1IW7D 3TZUA 1Q1BA 5KNCA 2NN6H 2D5DA 3D31A 3P20A 1ONLA 4OGQC 5KNBA 5KNDA 4TKOB 4G7HC 4LJZC 1LACA 3N6RA 1Z6HA 3EQLC 3NE5B 3I4LA 1HPCA 3M85A 3PUVA 5A35A 2K7VA 3M7NA 3ND9A 4XTCS 3CRLC 4JK1C 1OXSC 1H9RA 3VR2A 2R6GA 1YNJC 3DXJC 4OO1G 2A69D 4PV1C 2JEBI 2B8FA 4H13C 4JBWA 2JEAI 1IW7C 2E75C 1ZKOA 3T51B 5K36H 3BDOA 3ND8A 1VDZA 4L8JA 4G7OC 3OOCA 1Y69U 4KHZA 4GZYC 1QJOA 1CI3M 2K32A 3SE0A 5JEAH 5BN4A 3GD7A 1E2ZA 1Q90A 2B8GA 1B9NA 2E74C 3A8JE 2A6ED 3SDZA 4LK1C 2AUKA 1K8MA 3QJYA 3KLRA 3U9SA 1E2VA 1O7LA 2PCFB 4H0LC 1GHJA 3VR4A 2A69C 3QG1A 2KA7A 3IFTA 2EJFC 3L7ZC 1GUOA 3A8IE 3WDNA 1IYUA 3AB9A 1DD2A 1YNNC 1EWHA 1OXUA 4G7ZC 2O5IC 2L5TA 2EJGC 2A68C 1DCZA 3A8KE 2BDOA 3CRKC 1GUTA 3HGBA 3PV0A 5BN5A 1H9JA 2BA1A 1K8OA 4DK0A 1Y8NB 1ZYRC
chains in the Genus database with same CATH superfamily
3HRZC 4TRDA 1EY9A 1TXYA 1X55A 5FLXE 1SDFA 4BBRH 4X66Q 2MNAA 4X6AH 1I4PA 2L1BA 2I07B 1CM9A 3CQZB 2EDGA 1EIYB 1Y8PB 1X3QA 1KABA 5M3MG 2KVMA 5NUCA 3J81c 1ET6A 2WAQG 3QO2A 1KDCA 1VMPA 4RHSA 1YJNA 4IQZA 3KF8A 3M7GA 4IOAA 2EYLA 3SK5A 1N34Q 1EYDA 4DV4L 4LF4Q 4RGMA 3MFYA 1EWIA 3S1QH 3E0JA 1HR0W 1BCPF 1GHKA 1SMXA 2N8NA 1UEAB 1U0LA 1QG7A 1NR2A 1Y8OB 3MZ5A 2D62A 2PNHA 5C4HA 1A2UA 2EY6A 2I5HA 1CKOA 4F88A 1D1IA 1XPOA 1BXTA 2KHIA 3LWEA 5CC4A 2YYZA 5FLXL 1S5DD 3TZDA 4DK3C 2JE6I 4L5RC 4ID6A 3KDFB 2ZTDA 3FDTA 1UWVA 1QVFA 2VZAA 5I9OA 3N52A 4C3HG 4DR5L 4FXDA 1WTXA 4B3SQ 4J15A 1LTSD 4CDFC 1XMOQ 5BN3A 4A3FB 3VR3A 4LF8L 4ZUJA 4HEDA 4A3EH 4IUQA 1B7YB 1L1OB 1T5XD 1VQCA 3HP3A 1PH5A 3K6OA 1F2MA 3S1NH 1D5XC 1TS5A 1SSOA 5IYDH 1A3UA 5M3MB 3J80c 2UXBQ 3I4OA 1HZAA 2BCOA 3PIP3 3HOXH 1CKNB 2NB0A 4A3GH 1EY5A 4WJ3M 3CC7A 4QMGA 3T1HL 3S1RH 1N33Q 2N88A 2ZTEA 4TSSA 1SLJA 4KHZA 2PZWA 1TY2A 4JI3Q 5CBEE 3GV3A 5HGQA 2KA7A 3GTKB 4BS9A 1XNQL 4JV5Q 4LF5L 1EOVA 1JOKA 3A8KE 2XRSD 2K28A 1WVLA 1LO5D 3TDQA 4PG3A 3PO3G 1I3QH 1RJTA 4MTNA 4A3DH 4X64Q 1TS4A 4NXNL 2AHOB 2HDLA 4A3MG 1LM0A 3M4YA 2EIFA 4POGA 5EPLA 1AP0A 2F0FA 4OX9Q 2RDFA 3EJIA 3S2DH 5J1ZA 5IOCA 1QB5D 4HCSA 1VQEA 1W2BA 3S17H 1G91A 4Z9CB 1EUJA 1EFWA 1PA6A 3W1BA 3CHBD 1HFGA 1CK1A 4QQBX 4DK1A 2CWAA 2PNRC 4R8IA 4L5SA 3MEHA 1IXRA 4IUNA 4WFN3 4POFA 1PTOH 5EKLA 1A8VA 3UE1A 1VCIA 5EAYA 2Z1CA 3A54A 4C3JG 3RN2A 1GJXA 4HN7A 2ZJQA 4JI7L 3K0XA 3OIQA 4WRDA 4B9XA 4JBMA 2EJMA 2NYZD 4A3BG 1SAPA 1PVOA 5FLMG 1JT8A 2A6HC 2UUAQ 3Q8DA 1Y1WH 2ZJRA 4HJ9A 4B08A 4HJ7A 4DR2L 1GUNA 2E76C 1GUGA 1E0BA 4CHTB 3OWFA 5M9OA 3PO3B 1U5KA 1X3EA 3KOJA 1YVCA 1N9WA 3GTJB 1TWGH 1BOSA 1U4PA 5FKAC 4C3IG 4QUFA 4QIWE 1WTRA 5TSSA 3NQIA 2CWPA 1PTOD 4JW0A 1L0YB 1YNND 3H0GH 5K36H 1IBLQ 3BDOA 1FNWA 4L8JA 1Y14B 1EFID 1CKMA 1K83B 2Q2IA 3NK9A 4LF7Q 1V9PA 3I91A 5IODA 3CMEA 3FP9A 4LFBL 1LTBD 4IJLA 2R93G 4PZ6A 5KYLA 4QJFA 1GHJA 3VR4A 1J5EQ 1TQOA 2UXDQ 3VYSA 3MC0B 1E7ZA 2L5TA 2IPKD 2I0QA 4OO1I 2EJGC 3OIPA 2CQOA 1H9SB 4J1MA 3S24A 4KMUC 1VQ6A 3I2ZA 2A6EC 4A3BB 2F1MA 4RCOA 5CR3A 1MI2A 4ILWA 2RCNA 4KY7A 1PFBA 2KQ3A 1PRTF 4DV2L 5AFWA 3CXCA 2VNUD 4HIDA 2EVBA 1L2FA 2HIVA 4JI6L 2F0IA 1D6EC 2CW0D 1LTTD 3NBHA 4BY7B 3I72A 3W3AA 1XTCD 1CTMA 5FO7B 1HR0L 1VQ5A 2XWJB 4IO9A 2YTXA 3MXGA 2VQFL 1NY4A 3K57A 3OTOL 2ZT9C 2RCFA 4YY3L 2F0NA 2KBNA 1ENCA 1TWAH 3CP0A 1O7YA 4K8JA 4DUZQ 2H4OA 3V96A 1C4QA 3HOVH 3HFZB 4OEMB 3RZOB 3NELA 2I46A 4A3KG 2HHHL 2L55A 2JA5G 3NTIA 4DUYL 1TWHH 3AFQA 4KHPQ 5GQOA 3UI2A 1GUSA 4A3EG 1KLUD 1PH7A 4G7OC 3LNNA 2SDFA 3BU2A 4JC0A 3QOLA 2V1CC 3KBGA 3P20A 4BBRB 4XT1B 2NVXH 4FO2A 1FVIA 5C44G 4C1NK 4OWXB 3UDFA 4JI2L 3S14H 3CCRA 4V190 2FMCA 2F0KA 3U4ZA 2F0VA 4P72A 1Q8IA 3FKIH 1PH8A 1N36Q 3HOZH 4KD3A 4OO1G 4EQPA 2MPMA 2RKSA 2IHEA 4IURA 2WB1E 2MP1A 3BYTB 1LTGD 1UE1A 3ND8A 4G4KA 3CC2A 2RHQB 3S1QB 4HSPA 1O7IA 3G6JB 1BBUA 4B3RL 3E6ZX 3F1ZA 1PH6A 5BN4A 3GD7A 2B63G 1IBKL 1F2ZA 2ZTCA 1CHPD 2VW9A 3U4VA 5IP9H 1Q81C 3IFTA 1YHQA 3FHWA 3L7ZC 1VQDA 1VQHA 4R1JA 4DV1Q 1DD2A 1Y1VG 1HH2P 3HGBA 3PV0A 4FF2A 1D1KA 1RL2A 2MHVA 3HS0C 2F0LA 4A3DG 4HAEA 5HURA 2HCIA 4XQQA 3H94A 3KF6A 1YITA 5E7NA 5DAUA 4A3EB 1LLRD 1X6OA 2RQXA 4K8IA 1HNXL 3GDEA 2BH8A 2F0WA 1RF2D 1GKHA 3S1NB 2UUBQ 2SOBA 3M9BA 5K5PA 3TQYA 1WCMG 1U4RA 3ER0A 4OL7A 4NDXA 4KLKA 5C5MA 3HOXB 3PUZA 2E2IH 1IKLA 4A3GB 1MD2D 1I5FA 3S1RB 2OTLA 2AQ2B 1BDOA 1O7ZA 5ELBA 4LUVA 3QIAA 4PZ7A 1K3RA 3GTGH 5FOBB 1PZKD 4DGZA 5GAGC 1NR4A 1F9PA 2IY5B 1SYFA 3OYYA 4JI5Q 5DM63 1S5CD 3VA5A 1PYSB 1QE6A 2AWOA 4DU9A 4R4CA 4K0KQ 1CFMA 2BE5C 2KUMA 2OQ0A 3NUCA 3ZJYC 3VYUA 1X9NA 1I3QB 4A3DB 1JMCA 3B6YA 1PZJD 1M1KC 3DUZA 1ET9A 3I55A 3M85A 4OWWB 2X6GA 1WYDA 4OELB 3PMFA 2K1BA 4ZKBB 2FMMA 4J6HA 2PW5A 5IE8A 1EY4A 3S2DB 4PV1C 4JBWA 5E1FA 3S17B 1BBWA 3T51B 1ZKOA 4C3HH 3A0JA 3RD4A 4LF8Q 4YCWA 1ICFB 4G57A 2G5DA 4RGNA 4IJHA 4EX5A 1YNXA 4JBJA 1PTOB 1PTOF 4DAYA 1AZPA 4ALPA 3BYYB 2XIWA 2EQSA 2H5XA 1UUPA 3MEFA 4R8NA 2N55A 3T1HQ 2B3GA 5FO9B 1A63A 5E3FA 2JA8H 3KJPA 5C4XG 2OQKA 2Q8TA 4NXML 3J81E 1Y1WB 4GNXA 2N78A 1BUVT 2JA9A 1D2BA 5JJIA 5ELDA 4GKKL 2Y0SB 3S16H 1AE3A 1FNUA 1WTQA 1VQ8A 4Y7NH 3Q24A 2KENA 2O2LD 3NPPA 2DNEA 4HJ8A 4LF5Q 4IPCA 2K50A 1VMCA 3CMAA 2B2VA 2C9OA 3CCVA 1TWGB 1WTPA 1NBWA 4DV7L 1YEZA 3DM3A 2LMCB 3M4OH 3WOEA 2KEEA 2ZXPA 3H0GB 4LFAL 2R92G 3BVZA 1XMQL 4C2MH 2VUMH 2Z9HA 3HOVG 5D65A 3J81L 3HKZE 2LY7A 3GTJH 4OIJA 4A3MH 1MIUA 2EXZA 3C2PA 1S5FD 2F03A 1EQVA 1G6ZA 1JJ2A 1I4XA 2A19A 1XX8A 1RHPA 1YNJD 1FJGL 1PV4A 2F0PA 1G8ZD 5C0XJ 2QDBA 3FVQA 3EBEA 5EQ0A 1GUWA 1GXDC 4A75A 2F0SA 5LMNQ 4X65L 4OGQC 1EOTA 4RG1A 2HT1A 1Q7YC 3J80E 3Q6SA 4H02A 4N9PA 5CV4A 4JI7Q 4JYAL 1G6PA 1S5ED 3I4LA 4DR3L 5A35A 1E1OA 4C3JH 3QR8A 1KHIA 1H9RA 2B2UA 1CSQA 2N3SA 3TP7A 5D14A 4OIKA 5C6AA 1N32L 1EIGA 4L5QA 5FLMH 1A0IA 4DR2Q 4AYBB 1Y69U 2L12A 1E2ZA 2E74C 4Y52H 2FFKB 4QUCA 1K8MA 1TWAB 4IOCA 2NVTB 5ISRA 4N9TA 4R4QA 2EZVA 1HNWL 2AWNA 3J80L 1OXUA 3HOVB 1TWFH 1U4LA 1J8IA 1JR0D 5D3IB 4L5TA 3MFGA 1PZID 1LACA 4C3IH 4H44C 1TWHB 1VQGA 5JJLA 1EU3A 2F0DA 1B9MA 4IN3A 4UDUC 1HUNA 2IT1A 1ILQA 1E1TA 2EY2A 3JAML 1JORA 1XXGA 2MGSA 5F2DA 3L9AX 2IWHA 1HXYD 4HIKA 1OO9B 3HG9A 4JI1Q 2R93H 2NVXB 1PXUA 1SNMA 1HJPA 2ZXOA 1FL0A 2WINB 1SEBD 3MXNA 3OHXC 4CGYB 3S14B 2L0CA 1CUKA 3AQQA 4GLVB 4NW2A 3FKIB 5I2XA 5ELCA 4KKSA 4CJ2C 2DY7A 1XNRQ 1SJHD 4DV3Q 3HOZB 1LUZA 1B44D 4BA2I 1EZ6A 1CA6A 1DGSA 1RD9D 4IFDI 3NBIA 4KTAA 1ML0D 4K2LA 1P8LA 4FP5D 1XPRA 2Q2HA 2VQEL 1SMYC 3V2TA 3RR5A 1SE8A 4F7XA 1LTLA 2QEXA 1HR0Q 2EYOA 1PFSA 4BBSG 5JOBA 3VR5A 2X69A 2R61A 2FXQA 2XNAC 2K03A 4XYQA 1F9SA 5JEAG 5C3EG 1KRTA 4GNXC 1VQNA 3I7FA 4HJ5A 2AQ1B 2NVYH 3NTHA 1XJVA 2K52A 3CW2C 1ENFA 1XWEA 3BZCA 1EY0A 1NMGA 2HHHQ 2EYFA 4DUYQ 3S9WA 3K5LA 2F0EA 1LT4D 1RIPA 1VQPA 4A3KH 2JA5H 1VQLA 1LTAD 4K5WA 2JA7H 2R7DA 3I3CA 2E2IB 2PQAB 2Q2TA 2A1AA 4JI2Q 5KRUA 3TSSA 5IP7G 3QG1A 3D8GA 5IGBA 4DR1L 5C44H 2NZOA 1UNSA 3R93A 3KK7A 2E5LL 2CHBD 3C1EA 3GTGB 4G7ZC 4KV6A 1A3TA 5DEHA 2WAQB 1DONA 3KBXA 4GN3B 1JWSD 2JA8G 2O5JC 1Z7TA 4FDBA 3TREA 4OO1H 1A6XA 3PF5A 4A3IG 5FK9C 3A56A 3DEOA 5BR8Q 4IUVA 4B3RQ 3J81j 4AQYQ 1I94L 4JBKA 1SR3A 1KC8C 1IBKQ 4NMZA 4IFDG 3JAMc 1M90C 1G291 5EKKA 1GOZA 1W6KA 2B63H 1L1OA 1QUQB 1MHWC 2QILA 5M5YH 2B2UC 1JCKB 4DKAC 4GOPB 2IX0A 1LYLA 4DNRB 5KYIA 1JOOA 1Y1VH 1BVSA 3RLNA 3VA7A 1SFOH 5EPKA 4CJ0B 2PYKA 3MWYW 1L0WA 4C3HB 4B3ML 2VUMG 5I9PA 4IALA 2JP1A 2OEOA 1Q12A 1HNXQ 2F0MA 1TT2A 2KCNA 3PUYA 4LWCA 4TVAB 1A3VA 2D2CC 4V0BA 3CCMA 1AZQA 3I90A 2YV5A 3O13A 4PQXA 4RAUC 4X3UA 2EE1A 1BBXC 5T1IA 3EFXD 2UUCL 1B50A 4GN4B 3D0FA 1WCMH 4DK6C 1U9RA 3J7YW 2X6LA 4RHRA 2JQOA 3T13A 2JA8B 5KNCA 4PMWA 1S3OA 3HOUG 1CQFA 4F8MA 3R8BA 3KLWA 4LJZC 3G4SA 1HZ9A 2BDNA 2CQAA 3N6RA 1YI2A 1JQYD 3S16B 1E22A 1B2TA 4Y7NB 1OXSC 1Z9FA 4MTKA 4H13C 4UP7A 1SNOA 1IW7C 1VQBA 4EGVA 1V1PB 1QJOA 2K32A 4JG2A 4WJWA 4DPGA 2SNMA 1BO0A 3M4OB 1X56A 2Z6KA 2K01A 5IYBG 3PO2G 1IZ6A 5IT9c 1HA6A 3T4AC 4C2MB 2VUMB 4IUTA 1BKBA 3STBC 4A3MB 2EXDA 3G48A 1DCZA 5BN5A 5CV8A 5H1SE 4LW1A 2EPBA 2FHTA 1KAAA 3L0OA 1EY7A 2Z6BA 3M3YH 2KHJA 1HQMC 1K28A 1WI5A 2E2DC 3QWNA 3BDLA 3NSWA 4JPBW 1WTVA 2XN9C 5C0XI 4A3LH 3NWTA 1V43A 4R4IA 2NTSA 2NZHA 3CD6A 2KEDA 2DGYA 1HNZQ 3NTKA 4C3JB 5I6YA 1BCPC 2UXCL 3AEVA 1SRUA 4EQ5A 2V4DA 2RHSB 3RN5A 3CCJA 1HCZA 4DXGA 5C4XH 2VY3A 4O42A 1QZHA 5FJ8G 3A5ZB 3OPOA 2AMCB 1STAA 4DR4Q 1QILA 4K14A 2GA4B 2RA4A 1NTGA 2BA0A 2XVSA 1JWUD 3G7LA 3KFUA 4LUOA 2AUJD 3FEWX 1CSPA 1YZ6A 3T1YL 1PYBA 3CCLA 3UDXA 5ELOA 3UDIA 1HTPA 4KI0A 4DV7Q 1JE5A 1TWFB 2ATWA 2NN6I 1H9SA 4LFAQ 3AU7A 4C3IB 1C9OA 3RNUA 1LT6D 4GKJQ 1XMQQ 4DA2A 1EQTA 2NVTH 4A3CG 4DV0L 1L1OC 1F77A 2R92H 4CJ1B 4G7HC 1JJGA 2IW3A 1KXLA 3IFDA 1C8CA 3ND9A 1WTOA 2R93B 1AFPA 4CDDC 4LF4L 3JC66 1Z47A 1RKNA 3SHLA 1P16A 1C7YA 1IBMQ 4DV6Q 3H3VC 4I7AA 1KAWA 4K5XA 4X62L 4IUUA 2JA7G 1HTLD 1WOCA 5I6WA 1WTHA 4DFAA 1X3PA 2QW7A 4XXEA 5LL6S 4P74A 1SXTA 4MHEA 1E2VA 2EJFC 3K58A 3TP6A 5E4WC 3AB9A 2WV6D 2BDOA 3CRKC 1UEBA 1N32Q 2B2WA 2F4VL 1TWCH 1IHZA 5JVH3 3S1MH 1IL2A 1HQRD 2F3WA 1DJRD 4A93G 2KOLA 5CBAE 4NP5A 4JOIA 4YIJA 2NVYB 3NHHA 1GVPA 3F2UA 3W2DA 2IJ0A 3SGIA 2ICEC 2MFIA 1N8RC 1E2WA 1Q1EA 3W5OA 1MJEA 5CV6A 2NZ1D 3G71A 2NWGA 1RCVD 4NKLA 1WTWA 1IYVA 1CHQD 5DNFA 1N33L 2NN6G 2A6HD 1D5ZC 4A3KB 1JICA 2JA5B 4YWLA 1KRSA 3Q0AA 4ULLA 2HDMA 2JA7B 5J3BA 1TR5A 2WB1G 4RH6A 3ULJA 4KKUA 5ELNA 1KLGD 2F0TA 2WFWA 5AJ3L 4JV5L 5C4JH 5C44B 2SNSA 4R9WA 1HFNA 2PI2E 4O1NA 4DN4M 2TSSA 2D0OA 1BQQT 1YJWA 2HQEA 2WKDA 3PUXA 2E2JH 4UPAA 3W1GA 5JJKA 3TP5A 2R7ZG 1VF5C 3RLOA 1NUCA 3TZUA 1Q1BA 3J7ZC 2D5DA 2VQEQ 1VQIA 1ESRA 5KNBA 2Y0SE 5J39A 4BY1H 3EQLC 1FGBD 2B63B 1D8LA 3PUVA 4J8QA 3CRLC 4JK1C 4DV4Q 3DXJC 5M5YB 3MVVA 4ZCKA 5CYUA 4BBSH 3HEJA 2XRQD 1Y1VB 3OOCA 3C3LA 3CC4A 2MQHA 1KL9A 2XWBB 5JEAH 1SFOB 4DR7L 5C3EH 3URYA 2B8GA 3P75A 1Q8KA 2WACA 2A6ED 1R4QB 1V1OA 3E9IA 1VQ9A 4LK1C 1FNVA 1EEFD 4NB3A 1EYCA 2A69C 1NMFA 3KYHC 4YCVA 3H3VH 2QGQA 1X32A 3H6MA 1JWMD 2MO0A 2N49A 4DR5Q 2C5CA 4RMFA 4GLXA 4MNOA 2F0JA 2QKIC 1I50H 1SNDA 1T5EA 5HY6A 1VQKA 4CKCA 2EY5A 2KJXA 1WCMB 4JI8L 1NCVA 2K33A 4BWGB 1STGA 2KCMA 3MXUA 5CGKA 3A74A 3F8TA 1PRTC 4A3LG 2D9UA 3A7LA 1WD0A 4DR1Q 3HOWG 3IAYA 4JVZA 1DXMA 3U58A 1AH9A 5IP7H 3T56B 4C56C 3PIOA 1QZGA 4P71A 5HGTA 3CPWA 4LF6L 3X3NA 3RZDH 4LF9L 4GNXB 2EYJA 1CQVA 1R9TH 1IBLL 5EKIA 1JB3A 4R4TA 1I4QA 2A73B 3EROA 3OWEB 4A3IH 4AYBE 1E24A 5COYA 1H9MA 5IWAL 1SBBB 4B9WA 4IFDH 4APVA 3J7A5 1UE6A 2L4NA 2G9HD 1STEA 5ELFA 1J5EL 3ERSX 2UXDL 3KLSX 4ZAIA 1XNQQ 4B3TL 3MA2B 2B2WC 2VB2X 1M4VA 4FXKC 2PPBC 1XPUA 2LFNA 1TS3A 3K7AH 1FR3A 1H9KA 1SE3A 3V05A 4B3MQ 2L11A 1EQQA 4NXNQ 3EN2A 4JOIC 4U68A 4IPGA 3HOYH 1O80A 1SNQA 2PZUA 3M3YB 5M5XH 1S40A 1PFMA 4ME3A 2GVAA 5KNDA 3S2HH 2JN4A 3ERQA 3L3OC 4H7BA 1PHJA 3NE5B 3M7NA 1B70B 3OSOA 4MIUA 3I4MG 2PQEA 1QCBD 3EIVA 4A3JG 2R7FA 2K6AA 2IX1A 1L0XB 2NBFA 2KHSA 5M3FG 2TMPA 4RKBA 1RTNA 2NUCA 1BF4A 1DM0B 4C1NI 3K5NA 5CORA 1A62A 1RTOA 2M9VA 4GZYC 1DOKA 3TEHB 1Q90A 4ZKCB 3TMEA 1B9NA 4PZ8A 5IIFA 3QJYA 3J7AF 3PQIA 4KHVA 3U9OA 4AIMA 5C4XB 3HOUH 4FXGC 3Q23A 1GUOA 3WDNA 5EBCA 2F0HA 1I4HA 1PYWD 2XSCA 2P5ZX 1FGUA 2JA6G 1BNZA 2HD3A 3HKZG 1XTDA 4BA1I 3BVMA 4N8FA 4KHPL 4DXFA 3LWUA 3JAME 2H1EA 1OXXK 1EY8A 4A76A 2CH4W 3BVGA 1F9QA 4KN4C 2ICIA 4F87A 3H3VI 3J81i 1V8QA 5LMNW 4P73A 3GTPH 4CDEC 2R92B 5IYBH 3I70A 3PO2H 5IGEA 3BZDB 5FO8B 4BXXG 3R2IA 4MN3A 3FPUB 1EYGA 2QF7A 3GTMH 1JJCB 1H95A 3GTLH 1NSNS 2C35B 1VQJA 5LL6X 1F2LA 1K9MC 4GLAC 4RA8A 1VQ4A 4LFBQ 4AH6A 3EVQA 3CCEA 3MXPA 2BE5D 2MO1A 2CVRA 5KGUA 5GROA 3H15A 5LMUL 1B1ZA 3ULPA 3OMCA 3VYRA 1PH1A 2ID0A 3PUWA 2Z4IA 4Q5VA 2UXCQ 4YWMA 3A55A 2WAQE 4FVMA 2UU9L 3H09A 3WWVA 1SYDA 4FF1A 1TWCB 4DNTB 5IGGA 3S1MB 1MSHA 1VQ7A 4DV2Q 1SE4A 4PMCA 1EIHA 1ILPA 4BY1G 3KF8B 4TKOB 4JI6Q 5I4DA 5FJ8H 1VQFA 1HPCA 2PO4A 4YCUA 2SEBD 4A3FG 2UUBL 2K5WA 1ZXTA 1IL8A 3T1YQ 3J80i 2OXPA 4RKLA 2VQFQ 1KQSA 5CV7A 3OTOQ 3F2CA 2E75C 4YY3Q 3GP7A 5CV9A 5KEEA 1EIFA 3SE0A 1CI3M 3ONAB 4DV0Q 5IT9E 1ZEQX 3A8JE 3X3MA 4DR6L 1K0SA 2F52A 3JAMi 3MAQA 3DLLA 2RSOA 1EWCA 1PDQA 2K5VA 4A3CH 2AKWB 4ZQ3A 1PTOC 3PIO3 4FNFA 1HZCA 1YNNC 3E3XA 2B2VC 4DAPA 1BCPB 1SNPA 3K59A 4UAIA 4WJ4A 1E3PA 4DK0A 5EBDA 4X62Q 4XIGS 5C4JB 5JAVA 4JI5L 3RMHA 2K5HA 3FRPB 3M4PA 4XQNA 2A68D 2O4XA 2F3IA 3D6CA 1ASYA 4K0KL 2F0UA 2E2JB 5L37A 3MHBA 3ULLA 3NP8A 5I2YA 1I4RA 2EOTA 2NVQH 1F2YA 5IT9L 5IY0A 3A5UA 5C0XH 2PMZB 1YIJA 1STHA 4BY1B 4UHVA 1MKHA 3KDFA 3WOFA 2F4VQ 1EY6A 4LFCL 3FPPA 3LGJA 1STNA 3A7AB 3G6EA 2M00A 3CKIB 4DV5L 4BBSB 3P7JA 5A2QE 2ES2A 1B53A 3D3RA 4CBVA 2CW0C 4A93H 1OTCA 3PGZA 1QNKA 4X3KA 4UY8C 4QY7A 2M2LA 4M8AA 1LT3D 2PQAA 4I7ZC 3SR1A 5C3EB 2RVLA 2JK8A 2OT2A 5EJWA 1FD7D 1IKMA 3U50C 2LXJA 3DWPA 2NTTA 1DYQA 1Q46A 4UP8A 3R2TA 1YBYA 1PFNA 1CKNA 2F3VA 3BG3A 2JSOA 4K5VA 4ZUIA 3HOYG 1I50B 1W6JA 5M5WH 4KY5A 4QCLA 2NN6H 3ICEA 4ZLTF 2LKVA 2CCZA 5A2QL 2D0PA 5GAEC 1QVGA 1JC7A 1Z6HA 5AJ3Q 1Q86C 4P2CB 1QUQA 3K5OA 3DEPA 4XTCS 3CPFA 2R6GA 4ZYSA 1X3GA 3GTQH 4GOPA 4JI4L 4QF4A 3P1HA 2XGTA 1GO3E 1KDAA 3NXWA 4RGOS 3RZDB 3M4QA 2XTIA 1R9TB 3J7AV 4DNIA 3F2BA 4M1UB 2R7ZH 3C1FA 3GTOH 2EYPA 4A3IB 2AUKA 4HJAA 1O7LA 4ME5A 1KNEA 5DM73 2LS01 2HUGA 3KUPA 4HTHA 1SJED 4P75A 4K6DA 2KCTA 3BZKA 1IYUA 4JI0L 2O5IC 1TIID 1ICWA 3D4RA 3KLSA 3RLFA 5IGFA 4HR7B 1S5BD 3AFPA 4KKTA 5CV5A 4WORA 1I6HH 4DR7Q 3K7AB 1SYBA 4RFBA 2R3ZA 1ZYRD 2HIXA 1EL0A 5FLXc 5LMNL 2B29A 2RDGA 1YHAA 2GN5A 1QOHA 4IPHA 3HOYB 5C5LA 1IYJB 5M5XB 3GQBA 1Q82C 1TU2B 3S2HB 1SMYD 2JYOA 2E2HH 1SYGA 4DAMA 2JXMB 4HMJA 2DY8A 1SE2A 3VDYA 2Z4HA 4JI8Q 3T16A 2PW7A 1K3BC 3TS0A 3I8ZA 4BY7G 4RCNA 5JPMC 4NPSA 1STBA 1V1PA 5KIXA 2CFMA 4CDCC 2I5LX 2DJGC 4QB4A 3HOWH 2WKCA 3HOUB 2RBMA 1LV9A 3OW7A 4LF6Q 2ZM6L 4MZ9A 3T53B 4LF9Q 4YHHL 1NNXA 2YTYA 5GAHC 2A8VA 2B39A 1ESFA 2VXWA 1VQOA 4NXMQ 1KNAA 2DN8A 1D5MC 5IWAQ 4GKKQ 2ZJPA 1MGSA 2JJQA 3NBHB 1J9OA 3HZXA 2LXKA 3NEMA 4B3TQ 2K5DA 5G3LD 4JI1L 5C4ZA 4OXPA 4X3TA 3I56A 3DMUA 2L9HA 3NQTA 3PSIA 3GTPB 3PO2B 2CH4A 2K04A 1EYAA 2BOSA 4BBRG 1XNRL 4DV3L 3D4DA 5D3DA 5T1GA 1M8AA 1PRTB 4L63B 4X66L 3GTMB 2WP8J 3CF5A 1PH3A 4LNQA 3GTLB 2GVBA 2RSNA 1X54A 2Z0SA 2YU9H 1CZGA 4K6LA 2IX3A 2IL8A 1HZBA 3CCSA 2ASBA 3F2DA 5LHY1 5JEAJ 1CZWA 3SVMA 5GADC 3SK6A 3S15H 4A4IA 1N34L 3I4MH 1Y8NB 1I4GA 3I4NH 3KJOA 1FJGQ 3GV6A 4A3JH 1GD7A 5JVG3 1HHVA 5M3FH 4EQOA 1X65A 1DOMA 1DOLA 3CAMA 1KD1C 4X65Q 5CMDA 3CCUA 2F0OA 3DM1A 5IYCH 4JYAQ 5C0XG 4FF4A 4DR3Q 4QIWB 4LAAA 1LTID 1AN8A 3TN2A 4GOPC 1NE3A 4XYOA 1S4ZA 4EQNA 2CKZB 3DHQA 4B3SL 3C46A 2JA6H 4KY6A 5EGTA 1XMOL 4PMBA 4QGUA 1FYCA 1R4PB 2KECA 2KCCA 3MTSA 5IYDG 1HNWQ 1LTRD 2VB3X 1G2SA 1MSGA 3HOXG 2QA4A 1VF7A 1C48A 4X3SA 5ELEA 3K0YA 4A3GG 1EEID 4S3SA 1LABA 2UXBL 4LUZA 2A74C 4IFDJ 1QVCA 4BXXH 1I6VC 3KF6B 2B2YA 3CQZH 1WFQA 5BR8L 4AQYL 1B3QA 4K2KA 1IW7D 3QOJA 5JPNC 1VQMA 1ONLA 1VQAA 1SYCA 2Z6KC 4JI3L 4HIMA 1HUMA 5LMUQ 2J7ZA 2PZTA 4DAVA 4ZRZA 3SEBA 2K7VA 2NVQB 3RUZA 1YNJC 3ZYYX 3CCQA 2FJ2A 2JEBI 2UU9Q 3STBD 2JEAI 1ASZA 4FYDA 1B8AA 1AEXA 2Q2UA 4X64L 2VL6A 4EVOA 1II3A 3SDZA 4HIOA 2ALYB 3KLRA 4H0LC 2PCFB 1STYA 1YJ9A 4A93B 2B2TA 3DWQA 4OX9L 3TBIB 1K73C 1GUTA 4A3FH 2BA1A 4PNYA 1GM5A 2OCEA 5E4XA 4I65A 4IUPA 1OXTA 4YWKA 3L2PA 4U673 1OXVA 3SK4A 1BCPD 2F0QA 2EYHA 4XQJA 1A2TA 4DR6Q 3EA6A 1U4MA 2J4XA 3LX0A 5M5WB 5M3MH 4XT3B 2Q8RE 4CKEA 1PMRA 1O78A 3AYHB 1Y1WG 1KTKA 1PH9A 2K5NA 2WB1B 3D4WA 2RF4A 4RWSC 1TY0A 2Y0SG 1Q3LA 3GTQB 3K8AA 1MJCA 2A5HA 2K14A 3H91A 2UUAL 3BS1A 1XYIA 3I73A 1EU4A 5DLQE 2Z8LA 4R4OA 4HSVA 3VR6A 2L15A 2G9DA 2VS1A 2Q8IB 4DAYB 3GTKH 4DF7A 1HRJA 3GTOB 2R7ZB 1CT1D 3NWSA 2E5LQ 2OF1A 2IHFA 2OWOA 4ODGA 1TS2A 4LFCQ 3PF4A 3H0GG 5K36G 2OTJA 4RGTA 2YTVA 1WJJA 1B3AA 4DV5Q 2DNCA 1I94Q 2ENBA 4UP9A 4CKBA 5C3WA 1RDPD 1JOQA 4HMIA 3D31A 1I6HB 2MUYA 4OHJA 4LF7L 1J6QA 3TRZA 1PH4A 3R3OA 3TS2A 4O0AA 2F0GA 3BDCA 5IGDA 1NJIC 4KJNA 3DWAA 4Q0FA 4KJOA 1CA5A 1HNZL 5J22A 5C3XA 4LMQD 2B8FA 3IL8A 1HA5A 2PI2A 2E2HB 2E8GA 1RODA 2FINB 2HCCA 2K4KA 1VDZA 1PLFA 5G3LF 5JJZA 1JE4A 1DZ1A 4DR4L 1S72A 1X3FA 4GS3A 3NENA 2K05A 1MBYA 1NAPA 4KK7A 4N8X1 1EWHA 4O2DA 4AYBG 1QWYA 2A68C 2K75A 4JI4Q 1AE2A 3I4NG 3HOWB 2UUCQ 3PIPA 1C0AA 2RDHA 1T9HA 3GO5A 3K80C 1AW7A 2B2YC 2F4IA 1W3SA 4OONA 2MJ8A 1G51A 4GKJL 3PO3H 4GN5A 4L6TB 1EZ8A 5IYCG 3E5SA 4JCVE 1D7QA 2BH2A 2QCPX 2I5MX 4DUZL 4HCEA 2HQLA 2AQ3B 2WIIB 4JI0Q 4TQUS 1G2TA 3D6WA 1JB7A 3VYTA 1QNUA 2ZXRA 1K8GA 1IBML 4KN7C 4OWTB 4DV6L 3UE0A 1K83H 5IGCA 1VS0A 1TVXA 3K5MA 1K8AC 4FF3A 3CU7A 2B2TC 3FKIG 1EQRA 1KDBA 2QEJC 3HOZG 3IKJA 2EY1A 3IRBA 1TKWB 3OW2A 4KD4A 2YU9B 3AMUA 1B4OA 3UDGA 1N36L 4A3BH 3E9HA 2LSSA 3BJUA 5EPJA 3TP8A 3SXHA 3S15B 1ENAA 3I4MB 1SROA 3FMCA 3SK8A 3I4NB 3E0EA 2EYMA 4A3JB 5IP9G 5M3FB 1BR9A 4BY7H 4XDXA 3MXNB 4ZK9B 2QDLA 1KIXA 3OMGA 3VR2A 2DJFC 2ZM6Q 4DV1L 1YHBA 2DUDA 4IZ8A 2A69D 2PMZE 4YHHQ 1UE5A 1PH2A 1SN8A 1SYEA 3ITPA 1K0RA 3Q22A 1UAPA 1F9RA 2J0TD 4IPDA 1A15A 1UE7A 2JA6B 3K81C 4E6IA 3K7UC 3HKZB 3HKSA 4ABNA 3U9SA 1WD1A 3RZOH 3QB3A 1PRTD 3A8IE 2K5QA 1SNCA 1V1QA 3PCOB 1LT5D 4QL5A 1H9JA 1K8OA 1ZYRC
chains in the Genus database with same CATH topology
3HRZC 4TRDA 1EY9A 5FLXE 1SDFA 1I4PA 2L1BA 2I07B 1CM9A 3CQZB 2EDGA 1Y8PB 1X3QA 1KABA 2KVMA 5NUCA 1ET6A 3QO2A 1KDCA 1VMPA 4RHSA 4IQZA 3KF8A 3M7GA 2EYLA 3SK5A 1EYDA 4RGMA 3MFYA 3E0JA 1BCPF 1GHKA 1UEAB 1QG7A 1NR2A 1Y8OB 3MZ5A 2D62A 5C4HA 1A2UA 2EY6A 4F88A 1D1IA 1BXTA 3LWEA 5CC4A 2YYZA 5FLXL 1S5DD 3TZDA 2JE6I 4ID6A 3FDTA 5I9OA 3N52A 4C3HG 4FXDA 1WTXA 1LTSD 5BN3A 4A3FB 3VR3A 4ZUJA 4HEDA 4IUQA 1T5XD 3HP3A 3K6OA 1F2MA 1D5XC 1TS5A 1SSOA 1A3UA 5M3MB 2BCOA 3PIP3 2NB0A 1EY5A 4QMGA 2N88A 4TSSA 4KHZA 2PZWA 1TY2A 5CBEE 3GV3A 2KA7A 3GTKB 4BS9A 1JOKA 3A8KE 2XRSD 2K28A 1WVLA 1LO5D 3TDQA 1RJTA 1TS4A 2HDLA 3M4YA 5EPLA 1AP0A 2F0FA 2RDFA 3EJIA 5J1ZA 5IOCA 1QB5D 4HCSA 1G91A 4Z9CB 3CHBD 1HFGA 1CK1A 4DK1A 2PNRC 4R8IA 3MEHA 4IUNA 4WFN3 1PTOH 5EKLA 1VCIA 2Z1CA 3A54A 4C3JG 1GJXA 4HN7A 3OIQA 4WRDA 4B9XA 2EJMA 2NYZD 1SAPA 2A6HC 4B08A 1GUNA 2E76C 1GUGA 1E0BA 4CHTB 3OWFA 5M9OA 3PO3B 3GTJB 1BOSA 1U4PA 5FKAC 4C3IG 4QUFA 1WTRA 5TSSA 3NQIA 1PTOD 1L0YB 1YNND 5K36H 3BDOA 1FNWA 4L8JA 1EFID 1K83B 3NK9A 3I91A 5IODA 1LTBD 5KYLA 1GHJA 3VR4A 1TQOA 3VYSA 3MC0B 2L5TA 2IPKD 4OO1I 2EJGC 3OIPA 1H9SB 4J1MA 4KMUC 4A3BB 2A6EC 2F1MA 4RCOA 5CR3A 1MI2A 4ILWA 4KY7A 1PFBA 2KQ3A 1PRTF 5AFWA 2VNUD 2EVBA 2F0IA 1D6EC 2CW0D 1LTTD 3NBHA 4BY7B 3I72A 3W3AA 1XTCD 1CTMA 5FO7B 2XWJB 3MXGA 3K57A 2ZT9C 2F0NA 1ENCA 4K8JA 1O7YA 2H4OA 3V96A 1C4QA 3RZOB 2I46A 2L55A 3NTIA 3UI2A 1GUSA 1KLUD 4G7OC 3LNNA 2SDFA 3QOLA 3KBGA 3P20A 4BBRB 4XT1B 4FO2A 4C1NK 4V190 2FMCA 2F0KA 2F0VA 1Q8IA 4KD3A 4OO1G 4EQPA 2MPMA 2RKSA 4IURA 2MP1A 3BYTB 1LTGD 3ND8A 4G4KA 3S1QB 4HSPA 3G6JB 3E6ZX 5BN4A 3GD7A 1F2ZA 1CHPD 3IFTA 3L7ZC 1DD2A 3HGBA 3PV0A 4FF2A 1D1KA 2MHVA 3HS0C 2F0LA 4HAEA 5HURA 2HCIA 4XQQA 3H94A 5DAUA 4A3EB 1LLRD 2RQXA 4K8IA 2F0WA 1RF2D 3S1NB 2SOBA 5K5PA 1U4RA 4OL7A 4NDXA 5C5MA 3HOXB 3PUZA 1IKLA 4A3GB 1MD2D 3S1RB 2AQ2B 1BDOA 1O7ZA 5ELBA 3QIAA 5FOBB 1PZKD 4DGZA 1NR4A 1F9PA 1SYFA 5DM63 1S5CD 3VA5A 1QE6A 2AWOA 4DU9A 1CFMA 2BE5C 2KUMA 3NUCA 3VYUA 1I3QB 4A3DB 1PZJD 3DUZA 1ET9A 3M85A 2X6GA 3PMFA 2K1BA 4ZKBB 2FMMA 4J6HA 2PW5A 1EY4A 3S2DB 4PV1C 4JBWA 5E1FA 3S17B 3T51B 1ZKOA 3RD4A 4G57A 4RGNA 1PTOB 1PTOF 4DAYA 1AZPA 3BYYB 2XIWA 1UUPA 4R8NA 2N55A 5FO9B 5E3FA 2Q8TA 3J81E 1Y1WB 1BUVT 1D2BA 5ELDA 2Y0SB 1FNUA 1WTQA 3Q24A 2O2LD 3NPPA 2DNEA 1VMCA 2B2VA 2C9OA 1TWGB 1WTPA 2LMCB 3WOEA 2KEEA 2ZXPA 3H0GB 3BVZA 5D65A 3J81L 2LY7A 4OIJA 2EXZA 3C2PA 1S5FD 2F03A 1EQVA 1G6ZA 1I4XA 1XX8A 1RHPA 1YNJD 2F0PA 1G8ZD 5C0XJ 2QDBA 3FVQA 5EQ0A 1GUWA 1GXDC 2F0SA 4OGQC 1EOTA 3J80E 3Q6SA 4N9PA 5CV4A 1S5ED 3I4LA 5A35A 1H9RA 2B2UA 3TP7A 5D14A 4OIKA 5C6AA 1EIGA 4AYBB 1Y69U 2L12A 1E2ZA 2E74C 2FFKB 4QUCA 1K8MA 1TWAB 2NVTB 5ISRA 4N9TA 2EZVA 2AWNA 3J80L 1OXUA 3HOVB 1U4LA 1J8IA 1JR0D 5D3IB 3MFGA 1PZID 1LACA 4H44C 1TWHB 1EU3A 2F0DA 1B9MA 4IN3A 4UDUC 1HUNA 2IT1A 1ILQA 2EY2A 3JAML 1JORA 1XXGA 2MGSA 5F2DA 3L9AX 2IWHA 1HXYD 1OO9B 3HG9A 2NVXB 1PXUA 1SNMA 2ZXOA 2WINB 1SEBD 3MXNA 3OHXC 4CGYB 3S14B 2L0CA 4NW2A 3FKIB 5I2XA 5ELCA 4KKSA 4CJ2C 2DY7A 3HOZB 1SJHD 1B44D 4BA2I 1EZ6A 1CA6A 1RD9D 4IFDI 3NBIA 4KTAA 1ML0D 4K2LA 4FP5D 1SMYC 3V2TA 4F7XA 2EYOA 5JOBA 3VR5A 2X69A 2R61A 2XNAC 2K03A 4XYQA 1F9SA 5JEAG 2AQ1B 3NTHA 1ENFA 1XWEA 1EY0A 2EYFA 3S9WA 3K5LA 2F0EA 1LT4D 1LTAD 4K5WA 3I3CA 2E2IB 5KRUA 3TSSA 3QG1A 3D8GA 5IGBA 1UNSA 3R93A 3KK7A 2CHBD 3C1EA 3GTGB 4G7ZC 4KV6A 1A3TA 5DEHA 2WAQB 1DONA 3KBXA 1JWSD 2O5JC 1Z7TA 1A6XA 4OO1H 5FK9C 3A56A 3DEOA 4IUVA 4NMZA 4IFDG 1G291 5EKKA 1GOZA 1W6KA 2QILA 2B2UC 1JCKB 2IX0A 4DNRB 5KYIA 1JOOA 3VA7A 5EPKA 4CJ0B 2PYKA 3MWYW 4C3HB 5I9PA 4IALA 2JP1A 2OEOA 1Q12A 2F0MA 1TT2A 2KCNA 3PUYA 1A3VA 2D2CC 4V0BA 1AZQA 3I90A 3O13A 4PQXA 4RAUC 4X3UA 2EE1A 1BBXC 5T1IA 3EFXD 1B50A 1U9RA 3J7YW 2X6LA 4RHRA 3T13A 2JA8B 5KNCA 4PMWA 1CQFA 4F8MA 3R8BA 4LJZC 2BDNA 2CQAA 3N6RA 1JQYD 3S16B 1B2TA 4Y7NB 1OXSC 4H13C 1SNOA 1IW7C 4EGVA 1V1PB 1QJOA 2K32A 4WJWA 2SNMA 1BO0A 3M4OB 2K01A 1HA6A 3T4AC 4C2MB 2VUMB 4IUTA 4A3MB 1DCZA 5BN5A 5CV8A 2EPBA 2FHTA 1KAAA 1EY7A 1HQMC 2E2DC 3QWNA 3BDLA 3NSWA 1WTVA 2XN9C 5C0XI 3NWTA 1V43A 2NTSA 2KEDA 3NTKA 4C3JB 5I6YA 1BCPC 2V4DA 1HCZA 4DXGA 4O42A 3OPOA 1STAA 1QILA 4K14A 2GA4B 2RA4A 2BA0A 2XVSA 1JWUD 3G7LA 2AUJD 3FEWX 1HTPA 4KI0A 1TWFB 2NN6I 1H9SA 3AU7A 4C3IB 1LT6D 4DA2A 1EQTA 1F77A 4CJ1B 4G7HC 2IW3A 3IFDA 1C8CA 3ND9A 1WTOA 2R93B 1AFPA 1Z47A 1RKNA 3SHLA 3H3VC 4K5XA 4IUUA 1HTLD 5I6WA 4DFAA 1X3PA 4XXEA 5LL6S 1SXTA 4MHEA 1E2VA 2EJFC 3K58A 3TP6A 5E4WC 3AB9A 2WV6D 2BDOA 3CRKC 2B2WA 1IHZA 5JVH3 1HQRD 2F3WA 1DJRD 2KOLA 5CBAE 4NP5A 4YIJA 2NVYB 3NHHA 3F2UA 3W2DA 2IJ0A 2ICEC 1E2WA 1Q1EA 5CV6A 2NZ1D 2NWGA 1RCVD 4NKLA 1WTWA 1IYVA 1CHQD 5DNFA 2NN6G 2A6HD 1D5ZC 4A3KB 1JICA 2JA5B 3Q0AA 4ULLA 2HDMA 2JA7B 1TR5A 4RH6A 4KKUA 1KLGD 2F0TA 5C44B 2SNSA 4R9WA 1HFNA 4O1NA 4DN4M 2TSSA 1BQQT 2HQEA 2WKDA 3PUXA 3TP5A 1VF5C 1NUCA 3TZUA 1Q1BA 2D5DA 1ESRA 5KNBA 5J39A 3EQLC 1FGBD 2B63B 3PUVA 4J8QA 3CRLC 4JK1C 3DXJC 5M5YB 3MVVA 5CYUA 3HEJA 2XRQD 1Y1VB 3OOCA 3C3LA 2XWBB 5JEAH 1SFOB 3URYA 2B8GA 3P75A 2WACA 2A6ED 1R4QB 1V1OA 4LK1C 1FNVA 1EEFD 1EYCA 2A69C 1X32A 3H6MA 1JWMD 2C5CA 2F0JA 2QKIC 1SNDA 1T5EA 4CKCA 2EY5A 2KJXA 1WCMB 1NCVA 2K33A 4BWGB 1STGA 3MXUA 5CGKA 1PRTC 2D9UA 3A7LA 1WD0A 3IAYA 1DXMA 3T56B 4C56C 5HGTA 3X3NA 2EYJA 1CQVA 5EKIA 1JB3A 1I4QA 2A73B 3EROA 3OWEB 5COYA 1H9MA 1SBBB 4B9WA 4IFDH 2L4NA 2G9HD 1STEA 5ELFA 3KLSX 4ZAIA 3MA2B 2B2WC 2VB2X 1M4VA 4FXKC 2PPBC 2LFNA 1TS3A 1FR3A 1H9KA 1SE3A 3V05A 2L11A 4U68A 1O80A 1SNQA 2PZUA 3M3YB 1PFMA 5KNDA 3ERQA 3L3OC 4H7BA 3NE5B 3M7NA 3OSOA 4MIUA 2PQEA 1QCBD 2IX1A 2K6AA 1L0XB 2NBFA 2KHSA 2TMPA 4RKBA 1RTNA 2NUCA 1BF4A 1DM0B 4C1NI 3K5NA 5CORA 1RTOA 2M9VA 4GZYC 1DOKA 1Q90A 4ZKCB 3TMEA 1B9NA 5IIFA 3QJYA 3J7AF 4KHVA 3U9OA 5C4XB 4FXGC 3Q23A 1GUOA 3WDNA 5EBCA 2F0HA 1I4HA 1PYWD 2XSCA 1BNZA 4BA1I 3BVMA 4DXFA 3LWUA 3JAME 2H1EA 1OXXK 1EY8A 3BVGA 1F9QA 4KN4C 2ICIA 4F87A 1V8QA 2R92B 3I70A 5IGEA 3BZDB 5FO8B 3R2IA 4MN3A 3FPUB 2QF7A 1NSNS 5LL6X 1F2LA 4RA8A 3EVQA 3MXPA 2BE5D 2CVRA 5KGUA 1B1ZA 3OMCA 3VYRA 2ID0A 3PUWA 2Z4IA 4Q5VA 3A55A 4FVMA 3H09A 1SYDA 4FF1A 1TWCB 4DNTB 5IGGA 3S1MB 1MSHA 1SE4A 4PMCA 1EIHA 1ILPA 4TKOB 5I4DA 1HPCA 2PO4A 2SEBD 2K5WA 1ZXTA 1IL8A 2OXPA 4RKLA 5CV7A 2E75C 3GP7A 5CV9A 5KEEA 3SE0A 1CI3M 3ONAB 5IT9E 1ZEQX 3A8JE 3X3MA 3MAQA 2RSOA 1EWCA 1PDQA 4ZQ3A 1PTOC 3PIO3 4FNFA 1YNNC 2B2VC 4DAPA 1SNPA 1BCPB 3K59A 4UAIA 4DK0A 5EBDA 4XIGS 5C4JB 5JAVA 3RMHA 3FRPB 4XQNA 2A68D 2O4XA 3D6CA 2F0UA 2E2JB 3MHBA 3NP8A 5I2YA 1I4RA 2EOTA 1F2YA 5IT9L 5C0XH 2PMZB 4BY1B 1STHA 3WOFA 1EY6A 3FPPA 1STNA 3A7AB 2M00A 3CKIB 4BBSB 3P7JA 5A2QE 1B53A 3D3RA 4CBVA 2CW0C 1QNKA 4X3KA 2M2LA 4M8AA 1LT3D 5C3EB 4I7ZC 3SR1A 2RVLA 2OT2A 5EJWA 1FD7D 1IKMA 3DWPA 2NTTA 1DYQA 3R2TA 1PFNA 2F3VA 2JSOA 3BG3A 4K5VA 4ZUIA 1I50B 1W6JA 4KY5A 4QCLA 2NN6H 4ZLTF 2LKVA 5A2QL 1JC7A 1Z6HA 4P2CB 3K5OA 3DEPA 4XTCS 2R6GA 4ZYSA 4QF4A 3P1HA 1KDAA 3NXWA 4RGOS 3RZDB 1R9TB 3J7AV 4M1UB 3C1FA 2EYPA 4A3IB 2AUKA 1O7LA 4ME5A 1KNEA 5DM73 2LS01 2HUGA 3KUPA 4HTHA 1SJED 4K6DA 1IYUA 2O5IC 1TIID 1ICWA 3D4RA 3KLSA 3RLFA 5IGFA 4HR7B 1S5BD 4KKTA 5CV5A 4WORA 3K7AB 1SYBA 4RFBA 2R3ZA 1ZYRD 1EL0A 2RDGA 1QOHA 3HOYB 5C5LA 5M5XB 3GQBA 1TU2B 3S2HB 1SMYD 2JYOA 1SYGA 2JXMB 4HMJA 2DY8A 1SE2A 2Z4HA 3T16A 2PW7A 3I8ZA 4RCNA 5JPMC 1STBA 1V1PA 5KIXA 4QB4A 2WKCA 3HOUB 2RBMA 1LV9A 3OW7A 3T53B 2B39A 1ESFA 2VXWA 1KNAA 2DN8A 1D5MC 1MGSA 1J9OA 3HZXA 2K5DA 5G3LD 5C4ZA 4X3TA 3DMUA 2L9HA 3NQTA 3GTPB 3PO2B 2K04A 1EYAA 2BOSA 3D4DA 5D3DA 5T1GA 1M8AA 1PRTB 4L63B 3GTMB 2WP8J 3GTLB 2RSNA 1CZGA 4K6LA 2IX3A 2IL8A 5LHY1 5JEAJ 1CZWA 3SVMA 3SK6A 1Y8NB 1I4GA 3GV6A 5JVG3 1HHVA 4EQOA 1DOMA 1DOLA 5CMDA 2F0OA 3DM1A 5C0XG 4FF4A 4QIWB 4LAAA 1LTID 1AN8A 3TN2A 4XYOA 1S4ZA 4EQNA 3DHQA 3C46A 4KY6A 5EGTA 4PMBA 1FYCA 1R4PB 2KECA 2KCCA 3MTSA 1LTRD 2VB3X 1G2SA 1MSGA 1VF7A 1C48A 4X3SA 5ELEA 3K0YA 1EEID 4S3SA 1LABA 2A74C 4IFDJ 1I6VC 2B2YA 4K2KA 1IW7D 3QOJA 5JPNC 1ONLA 1SYCA 1HUMA 2J7ZA 2PZTA 4DAVA 4ZRZA 3SEBA 2K7VA 2NVQB 3RUZA 1YNJC 3ZYYX 2FJ2A 2JEBI 2JEAI 4FYDA 1AEXA 4EVOA 1II3A 3SDZA 3KLRA 4H0LC 2PCFB 1STYA 4A93B 2B2TA 3DWQA 3TBIB 1GUTA 2BA1A 4PNYA 5E4XA 4I65A 4IUPA 1OXTA 4U673 1OXVA 3SK4A 1BCPD 2F0QA 2EYHA 4XQJA 1A2TA 3EA6A 1U4MA 2J4XA 3LX0A 5M5WB 4XT3B 2Q8RE 4CKEA 1PMRA 1O78A 1KTKA 2WB1B 3D4WA 4RWSC 1TY0A 3GTQB 1Q3LA 2A5HA 3H91A 3BS1A 1XYIA 3I73A 1EU4A 2Z8LA 4HSVA 3VR6A 2G9DA 2Q8IB 4DF7A 1HRJA 3GTOB 2R7ZB 1CT1D 3NWSA 2OF1A 4ODGA 1TS2A 5K36G 4RGTA 1B3AA 2DNCA 2ENBA 4CKBA 5C3WA 1RDPD 1JOQA 4HMIA 3D31A 1I6HB 2MUYA 4OHJA 3R3OA 2F0GA 3BDCA 5IGDA 4KJNA 3DWAA 4Q0FA 4KJOA 1CA5A 5J22A 5C3XA 4LMQD 2B8FA 3IL8A 1HA5A 2E2HB 1RODA 2FINB 2HCCA 1VDZA 1PLFA 5G3LF 5JJZA 1JE4A 1DZ1A 2K05A 1MBYA 1NAPA 4KK7A 1EWHA 1QWYA 2A68C 3HOWB 2RDHA 3GO5A 1AW7A 2B2YC 2F4IA 2MJ8A 4L6TB 1EZ8A 3E5SA 2QCPX 4HCEA 2AQ3B 2WIIB 4TQUS 1G2TA 3D6WA 3VYTA 1QNUA 2ZXRA 4KN7C 5IGCA 3K5MA 1TVXA 4FF3A 3CU7A 2B2TC 1KDBA 2QEJC 3IKJA 2EY1A 1TKWB 2YU9B 4KD4A 3AMUA 1B4OA 5EPJA 3TP8A 3SXHA 3S15B 1ENAA 3I4MB 3SK8A 3FMCA 3I4NB 2EYMA 4A3JB 5M3FB 1BR9A 4XDXA 4ZK9B 3OMGA 3VR2A 4IZ8A 2A69D 1SYEA 3ITPA 3Q22A 1UAPA 1F9RA 2J0TD 1A15A 2JA6B 4E6IA 3HKZB 4ABNA 3U9SA 1WD1A 3QB3A 1PRTD 3A8IE 2K5QA 1SNCA 1LT5D 1H9JA 1K8OA 1ZYRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RLF A;  1H9S B;  1Z7T A;  2O5J C;  1A6X A;  4XIG S;  4HR7 B;  4OO1 H;  4BA1 I;  1OXT A;  4KMU C;  1T5E A;  4H44 C;  4KKT A;  2A6E C;  3LWU A;  2A68 D;  2F1M A;  1B9M A;  1OXV A;  1OXX K;  2IT1 A;  3H94 A;  2K33 A;  3MXU A;  1HQM C;  2EDG A;  4IFD G;  1Y8P B;  3M4Y A;  4KN4 C;  1G29 1;  3A7L A;  5C0X G;  1V8Q A;  2EVB A;  1V43 A;  4IQZ A;  3GQB A;  1DXM A;  5C0X H;  2DNE A;  1TU2 B;  3I72 A;  3T56 B;  1E2W A;  1PMR A;  1CTM A;  1Q1E A;  3W3A A;  4TQU S;  1O78 A;  4DNR B;  3MFY A;  2JXM B;  3FPP A;  3A7A B;  4KKS A;  3VA7 A;  1GHK A;  2ZT9 C;  4KN7 C;  1IYV A;  4DK1 A;  2PNR C;  3PUZ A;  4BA2 I;  2V4D A;  2QF7 A;  1Y8O B;  2LMC B;  2NN6 G;  2D62 A;  3D4R A;  2A6H D;  3I73 A;  1HCZ A;  4RCN A;  1BDO A;  1FYC A;  2CW0 C;  2YYZ A;  1H9M A;  3VR6 A;  1Q12 A;  1VCI A;  2BE5 D;  3OPO A;  2KCC A;  1SMY C;  3QIA A;  2Q8I B;  2JE6 I;  3PUY A;  4I7Z C;  4IFD H;  1GJX A;  4KKU A;  3IKJ A;  2D2C C;  2BA0 A;  1TKW B;  1VF7 A;  2AUJ D;  2EJM A;  3OW7 A;  1LAB A;  3PUW A;  5K36 G;  3T53 B;  3VR5 A;  2PPB C;  2A6H C;  1HTP A;  4KI0 A;  1I6V C;  1GUS A;  3PUX A;  1FR3 A;  5BN3 A;  5JEA G;  2AWO A;  2NN6 I;  2DNC A;  1H9S A;  3LNN A;  3BG3 A;  3FMC A;  3VR3 A;  1H9K A;  1CFM A;  2BE5 C;  4DNT B;  1GUN A;  1VF5 C;  2DN8 A;  2E76 C;  1GUG A;  1IW7 D;  3TZU A;  1Q1B A;  5KNC A;  2NN6 H;  2D5D A;  3D31 A;  3P20 A;  1ONL A;  4OGQ C;  5KNB A;  5KND A;  4TKO B;  4G7H C;  4LJZ C;  1LAC A;  3N6R A;  1Z6H A;  3EQL C;  3NE5 B;  3I4L A;  1HPC A;  3M85 A;  3PUV A;  5A35 A;  2K7V A;  3M7N A;  3ND9 A;  4XTC S;  3CRL C;  4JK1 C;  1OXS C;  1H9R A;  3VR2 A;  2R6G A;  1YNJ C;  3DXJ C;  4OO1 G;  2A69 D;  4PV1 C;  2JEB I;  2B8F A;  4H13 C;  4JBW A;  2JEA I;  1IW7 C;  2E75 C;  1ZKO A;  3T51 B;  5K36 H;  3BDO A;  3ND8 A;  1VDZ A;  4L8J A;  4G7O C;  3OOC A;  1Y69 U;  4KHZ A;  4GZY C;  1QJO A;  1CI3 M;  2K32 A;  3SE0 A;  5JEA H;  5BN4 A;  3GD7 A;  1E2Z A;  1Q90 A;  2B8G A;  1B9N A;  2E74 C;  3A8J E;  2A6E D;  3SDZ A;  4LK1 C;  2AUK A;  1K8M A;  3QJY A;  3KLR A;  3U9S A;  1E2V A;  1O7L A;  2PCF B;  4H0L C;  1GHJ A;  3VR4 A;  2A69 C;  3QG1 A;  2KA7 A;  3IFT A;  2EJF C;  3L7Z C;  1GUO A;  3A8I E;  3WDN A;  1IYU A;  3AB9 A;  1DD2 A;  1YNN C;  1EWH A;  1OXU A;  4G7Z C;  2O5I C;  2L5T A;  2EJG C;  2A68 C;  1DCZ A;  3A8K E;  2BDO A;  3CRK C;  1GUT A;  3HGB A;  3PV0 A;  5BN5 A;  1H9J A;  2BA1 A;  1K8O A;  4DK0 A;  1Y8N B;  1ZYR C; 
#chains in the Genus database with same CATH topology
 3HRZ C;  4TRD A;  1EY9 A;  1TXY A;  1X55 A;  5FLX E;  1SDF A;  4BBR H;  4X66 Q;  2MNA A;  4X6A H;  1I4P A;  2L1B A;  2I07 B;  1CM9 A;  3CQZ B;  2EDG A;  1EIY B;  1Y8P B;  1X3Q A;  1KAB A;  5M3M G;  2KVM A;  5NUC A;  3J81 c;  1ET6 A;  2WAQ G;  3QO2 A;  1KDC A;  1VMP A;  4RHS A;  1YJN A;  4IQZ A;  3KF8 A;  3M7G A;  4IOA A;  2EYL A;  3SK5 A;  1N34 Q;  1EYD A;  4DV4 L;  4LF4 Q;  4RGM A;  3MFY A;  1EWI A;  3S1Q H;  3E0J A;  1HR0 W;  1BCP F;  1GHK A;  1SMX A;  2N8N A;  1UEA B;  1U0L A;  1QG7 A;  1NR2 A;  1Y8O B;  3MZ5 A;  2D62 A;  2PNH A;  5C4H A;  1A2U A;  2EY6 A;  2I5H A;  1CKO A;  4F88 A;  1D1I A;  1XPO A;  1BXT A;  2KHI A;  3LWE A;  5CC4 A;  2YYZ A;  5FLX L;  1S5D D;  3TZD A;  4DK3 C;  2JE6 I;  4L5R C;  4ID6 A;  3KDF B;  2ZTD A;  3FDT A;  1UWV A;  1QVF A;  2VZA A;  5I9O A;  3N52 A;  4C3H G;  4DR5 L;  4FXD A;  1WTX A;  4B3S Q;  4J15 A;  1LTS D;  4CDF C;  1XMO Q;  5BN3 A;  4A3F B;  3VR3 A;  4LF8 L;  4ZUJ A;  4HED A;  4A3E H;  4IUQ A;  1B7Y B;  1L1O B;  1T5X D;  1VQC A;  3HP3 A;  1PH5 A;  3K6O A;  1F2M A;  3S1N H;  1D5X C;  1TS5 A;  1SSO A;  5IYD H;  1A3U A;  5M3M B;  3J80 c;  2UXB Q;  3I4O A;  1HZA A;  2BCO A;  3PIP 3;  3HOX H;  1CKN B;  2NB0 A;  4A3G H;  1EY5 A;  4WJ3 M;  3CC7 A;  4QMG A;  3T1H L;  3S1R H;  1N33 Q;  2N88 A;  2ZTE A;  4TSS A;  1SLJ A;  4KHZ A;  2PZW A;  1TY2 A;  4JI3 Q;  5CBE E;  3GV3 A;  5HGQ A;  2KA7 A;  3GTK B;  4BS9 A;  1XNQ L;  4JV5 Q;  4LF5 L;  1EOV A;  1JOK A;  3A8K E;  2XRS D;  2K28 A;  1WVL A;  1LO5 D;  3TDQ A;  4PG3 A;  3PO3 G;  1I3Q H;  1RJT A;  4MTN A;  4A3D H;  4X64 Q;  1TS4 A;  4NXN L;  2AHO B;  2HDL A;  4A3M G;  1LM0 A;  3M4Y A;  2EIF A;  4POG A;  5EPL A;  1AP0 A;  2F0F A;  4OX9 Q;  2RDF A;  3EJI A;  3S2D H;  5J1Z A;  5IOC A;  1QB5 D;  4HCS A;  1VQE A;  1W2B A;  3S17 H;  1G91 A;  4Z9C B;  1EUJ A;  1EFW A;  1PA6 A;  3W1B A;  3CHB D;  1HFG A;  1CK1 A;  4QQB X;  4DK1 A;  2CWA A;  2PNR C;  4R8I A;  4L5S A;  3MEH A;  1IXR A;  4IUN A;  4WFN 3;  4POF A;  1PTO H;  5EKL A;  1A8V A;  3UE1 A;  1VCI A;  5EAY A;  2Z1C A;  3A54 A;  4C3J G;  3RN2 A;  1GJX A;  4HN7 A;  2ZJQ A;  4JI7 L;  3K0X A;  3OIQ A;  4WRD A;  4B9X A;  4JBM A;  2EJM A;  2NYZ D;  4A3B G;  1SAP A;  1PVO A;  5FLM G;  1JT8 A;  2A6H C;  2UUA Q;  3Q8D A;  1Y1W H;  2ZJR A;  4HJ9 A;  4B08 A;  4HJ7 A;  4DR2 L;  1GUN A;  2E76 C;  1GUG A;  1E0B A;  4CHT B;  3OWF A;  5M9O A;  3PO3 B;  1U5K A;  1X3E A;  3KOJ A;  1YVC A;  1N9W A;  3GTJ B;  1TWG H;  1BOS A;  1U4P A;  5FKA C;  4C3I G;  4QUF A;  4QIW E;  1WTR A;  5TSS A;  3NQI A;  2CWP A;  1PTO D;  4JW0 A;  1L0Y B;  1YNN D;  3H0G H;  5K36 H;  1IBL Q;  3BDO A;  1FNW A;  4L8J A;  1Y14 B;  1EFI D;  1CKM A;  1K83 B;  2Q2I A;  3NK9 A;  4LF7 Q;  1V9P A;  3I91 A;  5IOD A;  3CME A;  3FP9 A;  4LFB L;  1LTB D;  4IJL A;  2R93 G;  4PZ6 A;  5KYL A;  4QJF A;  1GHJ A;  3VR4 A;  1J5E Q;  1TQO A;  2UXD Q;  3VYS A;  3MC0 B;  1E7Z A;  2L5T A;  2IPK D;  2I0Q A;  4OO1 I;  2EJG C;  3OIP A;  2CQO A;  1H9S B;  4J1M A;  3S24 A;  4KMU C;  1VQ6 A;  3I2Z A;  2A6E C;  4A3B B;  2F1M A;  4RCO A;  5CR3 A;  1MI2 A;  4ILW A;  2RCN A;  4KY7 A;  1PFB A;  2KQ3 A;  1PRT F;  4DV2 L;  5AFW A;  3CXC A;  2VNU D;  4HID A;  2EVB A;  1L2F A;  2HIV A;  4JI6 L;  2F0I A;  1D6E C;  2CW0 D;  1LTT D;  3NBH A;  4BY7 B;  3I72 A;  3W3A A;  1XTC D;  1CTM A;  5FO7 B;  1HR0 L;  1VQ5 A;  2XWJ B;  4IO9 A;  2YTX A;  3MXG A;  2VQF L;  1NY4 A;  3K57 A;  3OTO L;  2ZT9 C;  2RCF A;  4YY3 L;  2F0N A;  2KBN A;  1ENC A;  1TWA H;  3CP0 A;  1O7Y A;  4K8J A;  4DUZ Q;  2H4O A;  3V96 A;  1C4Q A;  3HOV H;  3HFZ B;  4OEM B;  3RZO B;  3NEL A;  2I46 A;  4A3K G;  2HHH L;  2L55 A;  2JA5 G;  3NTI A;  4DUY L;  1TWH H;  3AFQ A;  4KHP Q;  5GQO A;  3UI2 A;  1GUS A;  4A3E G;  1KLU D;  1PH7 A;  4G7O C;  3LNN A;  2SDF A;  3BU2 A;  4JC0 A;  3QOL A;  2V1C C;  3KBG A;  3P20 A;  4BBR B;  4XT1 B;  2NVX H;  4FO2 A;  1FVI A;  5C44 G;  4C1N K;  4OWX B;  3UDF A;  4JI2 L;  3S14 H;  3CCR A;  4V19 0;  2FMC A;  2F0K A;  3U4Z A;  2F0V A;  4P72 A;  1Q8I A;  3FKI H;  1PH8 A;  1N36 Q;  3HOZ H;  4KD3 A;  4OO1 G;  4EQP A;  2MPM A;  2RKS A;  2IHE A;  4IUR A;  2WB1 E;  2MP1 A;  3BYT B;  1LTG D;  1UE1 A;  3ND8 A;  4G4K A;  3CC2 A;  2RHQ B;  3S1Q B;  4HSP A;  1O7I A;  3G6J B;  1BBU A;  4B3R L;  3E6Z X;  3F1Z A;  1PH6 A;  5BN4 A;  3GD7 A;  2B63 G;  1IBK L;  1F2Z A;  2ZTC A;  1CHP D;  2VW9 A;  3U4V A;  5IP9 H;  1Q81 C;  3IFT A;  1YHQ A;  3FHW A;  3L7Z C;  1VQD A;  1VQH A;  4R1J A;  4DV1 Q;  1DD2 A;  1Y1V G;  1HH2 P;  3HGB A;  3PV0 A;  4FF2 A;  1D1K A;  1RL2 A;  2MHV A;  3HS0 C;  2F0L A;  4A3D G;  4HAE A;  5HUR A;  2HCI A;  4XQQ A;  3H94 A;  3KF6 A;  1YIT A;  5E7N A;  5DAU A;  4A3E B;  1LLR D;  1X6O A;  2RQX A;  4K8I A;  1HNX L;  3GDE A;  2BH8 A;  2F0W A;  1RF2 D;  1GKH A;  3S1N B;  2UUB Q;  2SOB A;  3M9B A;  5K5P A;  3TQY A;  1WCM G;  1U4R A;  3ER0 A;  4OL7 A;  4NDX A;  4KLK A;  5C5M A;  3HOX B;  3PUZ A;  2E2I H;  1IKL A;  4A3G B;  1MD2 D;  1I5F A;  3S1R B;  2OTL A;  2AQ2 B;  1BDO A;  1O7Z A;  5ELB A;  4LUV A;  3QIA A;  4PZ7 A;  1K3R A;  3GTG H;  5FOB B;  1PZK D;  4DGZ A;  5GAG C;  1NR4 A;  1F9P A;  2IY5 B;  1SYF A;  3OYY A;  4JI5 Q;  5DM6 3;  1S5C D;  3VA5 A;  1PYS B;  1QE6 A;  2AWO A;  4DU9 A;  4R4C A;  4K0K Q;  1CFM A;  2BE5 C;  2KUM A;  2OQ0 A;  3NUC A;  3ZJY C;  3VYU A;  1X9N A;  1I3Q B;  4A3D B;  1JMC A;  3B6Y A;  1PZJ D;  1M1K C;  3DUZ A;  1ET9 A;  3I55 A;  3M85 A;  4OWW B;  2X6G A;  1WYD A;  4OEL B;  3PMF A;  2K1B A;  4ZKB B;  2FMM A;  4J6H A;  2PW5 A;  5IE8 A;  1EY4 A;  3S2D B;  4PV1 C;  4JBW A;  5E1F A;  3S17 B;  1BBW A;  3T51 B;  1ZKO A;  4C3H H;  3A0J A;  3RD4 A;  4LF8 Q;  4YCW A;  1ICF B;  4G57 A;  2G5D A;  4RGN A;  4IJH A;  4EX5 A;  1YNX A;  4JBJ A;  1PTO B;  1PTO F;  4DAY A;  1AZP A;  4ALP A;  3BYY B;  2XIW A;  2EQS A;  2H5X A;  1UUP A;  3MEF A;  4R8N A;  2N55 A;  3T1H Q;  2B3G A;  5FO9 B;  1A63 A;  5E3F A;  2JA8 H;  3KJP A;  5C4X G;  2OQK A;  2Q8T A;  4NXM L;  3J81 E;  1Y1W B;  4GNX A;  2N78 A;  1BUV T;  2JA9 A;  1D2B A;  5JJI A;  5ELD A;  4GKK L;  2Y0S B;  3S16 H;  1AE3 A;  1FNU A;  1WTQ A;  1VQ8 A;  4Y7N H;  3Q24 A;  2KEN A;  2O2L D;  3NPP A;  2DNE A;  4HJ8 A;  4LF5 Q;  4IPC A;  2K50 A;  1VMC A;  3CMA A;  2B2V A;  2C9O A;  3CCV A;  1TWG B;  1WTP A;  1NBW A;  4DV7 L;  1YEZ A;  3DM3 A;  2LMC B;  3M4O H;  3WOE A;  2KEE A;  2ZXP A;  3H0G B;  4LFA L;  2R92 G;  3BVZ A;  1XMQ L;  4C2M H;  2VUM H;  2Z9H A;  3HOV G;  5D65 A;  3J81 L;  3HKZ E;  2LY7 A;  3GTJ H;  4OIJ A;  4A3M H;  1MIU A;  2EXZ A;  3C2P A;  1S5F D;  2F03 A;  1EQV A;  1G6Z A;  1JJ2 A;  1I4X A;  2A19 A;  1XX8 A;  1RHP A;  1YNJ D;  1FJG L;  1PV4 A;  2F0P A;  1G8Z D;  5C0X J;  2QDB A;  3FVQ A;  3EBE A;  5EQ0 A;  1GUW A;  1GXD C;  4A75 A;  2F0S A;  5LMN Q;  4X65 L;  4OGQ C;  1EOT A;  4RG1 A;  2HT1 A;  1Q7Y C;  3J80 E;  3Q6S A;  4H02 A;  4N9P A;  5CV4 A;  4JI7 Q;  4JYA L;  1G6P A;  1S5E D;  3I4L A;  4DR3 L;  5A35 A;  1E1O A;  4C3J H;  3QR8 A;  1KHI A;  1H9R A;  2B2U A;  1CSQ A;  2N3S A;  3TP7 A;  5D14 A;  4OIK A;  5C6A A;  1N32 L;  1EIG A;  4L5Q A;  5FLM H;  1A0I A;  4DR2 Q;  4AYB B;  1Y69 U;  2L12 A;  1E2Z A;  2E74 C;  4Y52 H;  2FFK B;  4QUC A;  1K8M A;  1TWA B;  4IOC A;  2NVT B;  5ISR A;  4N9T A;  4R4Q A;  2EZV A;  1HNW L;  2AWN A;  3J80 L;  1OXU A;  3HOV B;  1TWF H;  1U4L A;  1J8I A;  1JR0 D;  5D3I B;  4L5T A;  3MFG A;  1PZI D;  1LAC A;  4C3I H;  4H44 C;  1TWH B;  1VQG A;  5JJL A;  1EU3 A;  2F0D A;  1B9M A;  4IN3 A;  4UDU C;  1HUN A;  2IT1 A;  1ILQ A;  1E1T A;  2EY2 A;  3JAM L;  1JOR A;  1XXG A;  2MGS A;  5F2D A;  3L9A X;  2IWH A;  1HXY D;  4HIK A;  1OO9 B;  3HG9 A;  4JI1 Q;  2R93 H;  2NVX B;  1PXU A;  1SNM A;  1HJP A;  2ZXO A;  1FL0 A;  2WIN B;  1SEB D;  3MXN A;  3OHX C;  4CGY B;  3S14 B;  2L0C A;  1CUK A;  3AQQ A;  4GLV B;  4NW2 A;  3FKI B;  5I2X A;  5ELC A;  4KKS A;  4CJ2 C;  2DY7 A;  1XNR Q;  1SJH D;  4DV3 Q;  3HOZ B;  1LUZ A;  1B44 D;  4BA2 I;  1EZ6 A;  1CA6 A;  1DGS A;  1RD9 D;  4IFD I;  3NBI A;  4KTA A;  1ML0 D;  4K2L A;  1P8L A;  4FP5 D;  1XPR A;  2Q2H A;  2VQE L;  1SMY C;  3V2T A;  3RR5 A;  1SE8 A;  4F7X A;  1LTL A;  2QEX A;  1HR0 Q;  2EYO A;  1PFS A;  4BBS G;  5JOB A;  3VR5 A;  2X69 A;  2R61 A;  2FXQ A;  2XNA C;  2K03 A;  4XYQ A;  1F9S A;  5JEA G;  5C3E G;  1KRT A;  4GNX C;  1VQN A;  3I7F A;  4HJ5 A;  2AQ1 B;  2NVY H;  3NTH A;  1XJV A;  2K52 A;  3CW2 C;  1ENF A;  1XWE A;  3BZC A;  1EY0 A;  1NMG A;  2HHH Q;  2EYF A;  4DUY Q;  3S9W A;  3K5L A;  2F0E A;  1LT4 D;  1RIP A;  1VQP A;  4A3K H;  2JA5 H;  1VQL A;  1LTA D;  4K5W A;  2JA7 H;  2R7D A;  3I3C A;  2E2I B;  2PQA B;  2Q2T A;  2A1A A;  4JI2 Q;  5KRU A;  3TSS A;  5IP7 G;  3QG1 A;  3D8G A;  5IGB A;  4DR1 L;  5C44 H;  2NZO A;  1UNS A;  3R93 A;  3KK7 A;  2E5L L;  2CHB D;  3C1E A;  3GTG B;  4G7Z C;  4KV6 A;  1A3T A;  5DEH A;  2WAQ B;  1DON A;  3KBX A;  4GN3 B;  1JWS D;  2JA8 G;  2O5J C;  1Z7T A;  4FDB A;  3TRE A;  4OO1 H;  1A6X A;  3PF5 A;  4A3I G;  5FK9 C;  3A56 A;  3DEO A;  5BR8 Q;  4IUV A;  4B3R Q;  3J81 j;  4AQY Q;  1I94 L;  4JBK A;  1SR3 A;  1KC8 C;  1IBK Q;  4NMZ A;  4IFD G;  3JAM c;  1M90 C;  1G29 1;  5EKK A;  1GOZ A;  1W6K A;  2B63 H;  1L1O A;  1QUQ B;  1MHW C;  2QIL A;  5M5Y H;  2B2U C;  1JCK B;  4DKA C;  4GOP B;  2IX0 A;  1LYL A;  4DNR B;  5KYI A;  1JOO A;  1Y1V H;  1BVS A;  3RLN A;  3VA7 A;  1SFO H;  5EPK A;  4CJ0 B;  2PYK A;  3MWY W;  1L0W A;  4C3H B;  4B3M L;  2VUM G;  5I9P A;  4IAL A;  2JP1 A;  2OEO A;  1Q12 A;  1HNX Q;  2F0M A;  1TT2 A;  2KCN A;  3PUY A;  4LWC A;  4TVA B;  1A3V A;  2D2C C;  4V0B A;  3CCM A;  1AZQ A;  3I90 A;  2YV5 A;  3O13 A;  4PQX A;  4RAU C;  4X3U A;  2EE1 A;  1BBX C;  5T1I A;  3EFX D;  2UUC L;  1B50 A;  4GN4 B;  3D0F A;  1WCM H;  4DK6 C;  1U9R A;  3J7Y W;  2X6L A;  4RHR A;  2JQO A;  3T13 A;  2JA8 B;  5KNC A;  4PMW A;  1S3O A;  3HOU G;  1CQF A;  4F8M A;  3R8B A;  3KLW A;  4LJZ C;  3G4S A;  1HZ9 A;  2BDN A;  2CQA A;  3N6R A;  1YI2 A;  1JQY D;  3S16 B;  1E22 A;  1B2T A;  4Y7N B;  1OXS C;  1Z9F A;  4MTK A;  4H13 C;  4UP7 A;  1SNO A;  1IW7 C;  1VQB A;  4EGV A;  1V1P B;  1QJO A;  2K32 A;  4JG2 A;  4WJW A;  4DPG A;  2SNM A;  1BO0 A;  3M4O B;  1X56 A;  2Z6K A;  2K01 A;  5IYB G;  3PO2 G;  1IZ6 A;  5IT9 c;  1HA6 A;  3T4A C;  4C2M B;  2VUM B;  4IUT A;  1BKB A;  3STB C;  4A3M B;  2EXD A;  3G48 A;  1DCZ A;  5BN5 A;  5CV8 A;  5H1S E;  4LW1 A;  2EPB A;  2FHT A;  1KAA A;  3L0O A;  1EY7 A;  2Z6B A;  3M3Y H;  2KHJ A;  1HQM C;  1K28 A;  1WI5 A;  2E2D C;  3QWN A;  3BDL A;  3NSW A;  4JPB W;  1WTV A;  2XN9 C;  5C0X I;  4A3L H;  3NWT A;  1V43 A;  4R4I A;  2NTS A;  2NZH A;  3CD6 A;  2KED A;  2DGY A;  1HNZ Q;  3NTK A;  4C3J B;  5I6Y A;  1BCP C;  2UXC L;  3AEV A;  1SRU A;  4EQ5 A;  2V4D A;  2RHS B;  3RN5 A;  3CCJ A;  1HCZ A;  4DXG A;  5C4X H;  2VY3 A;  4O42 A;  1QZH A;  5FJ8 G;  3A5Z B;  3OPO A;  2AMC B;  1STA A;  4DR4 Q;  1QIL A;  4K14 A;  2GA4 B;  2RA4 A;  1NTG A;  2BA0 A;  2XVS A;  1JWU D;  3G7L A;  3KFU A;  4LUO A;  2AUJ D;  3FEW X;  1CSP A;  1YZ6 A;  3T1Y L;  1PYB A;  3CCL A;  3UDX A;  5ELO A;  3UDI A;  1HTP A;  4KI0 A;  4DV7 Q;  1JE5 A;  1TWF B;  2ATW A;  2NN6 I;  1H9S A;  4LFA Q;  3AU7 A;  4C3I B;  1C9O A;  3RNU A;  1LT6 D;  4GKJ Q;  1XMQ Q;  4DA2 A;  1EQT A;  2NVT H;  4A3C G;  4DV0 L;  1L1O C;  1F77 A;  2R92 H;  4CJ1 B;  4G7H C;  1JJG A;  2IW3 A;  1KXL A;  3IFD A;  1C8C A;  3ND9 A;  1WTO A;  2R93 B;  1AFP A;  4CDD C;  4LF4 L;  3JC6 6;  1Z47 A;  1RKN A;  3SHL A;  1P16 A;  1C7Y A;  1IBM Q;  4DV6 Q;  3H3V C;  4I7A A;  1KAW A;  4K5X A;  4X62 L;  4IUU A;  2JA7 G;  1HTL D;  1WOC A;  5I6W A;  1WTH A;  4DFA A;  1X3P A;  2QW7 A;  4XXE A;  5LL6 S;  4P74 A;  1SXT A;  4MHE A;  1E2V A;  2EJF C;  3K58 A;  3TP6 A;  5E4W C;  3AB9 A;  2WV6 D;  2BDO A;  3CRK C;  1UEB A;  1N32 Q;  2B2W A;  2F4V L;  1TWC H;  1IHZ A;  5JVH 3;  3S1M H;  1IL2 A;  1HQR D;  2F3W A;  1DJR D;  4A93 G;  2KOL A;  5CBA E;  4NP5 A;  4JOI A;  4YIJ A;  2NVY B;  3NHH A;  1GVP A;  3F2U A;  3W2D A;  2IJ0 A;  3SGI A;  2ICE C;  2MFI A;  1N8R C;  1E2W A;  1Q1E A;  3W5O A;  1MJE A;  5CV6 A;  2NZ1 D;  3G71 A;  2NWG A;  1RCV D;  4NKL A;  1WTW A;  1IYV A;  1CHQ D;  5DNF A;  1N33 L;  2NN6 G;  2A6H D;  1D5Z C;  4A3K B;  1JIC A;  2JA5 B;  4YWL A;  1KRS A;  3Q0A A;  4ULL A;  2HDM A;  2JA7 B;  5J3B A;  1TR5 A;  2WB1 G;  4RH6 A;  3ULJ A;  4KKU A;  5ELN A;  1KLG D;  2F0T A;  2WFW A;  5AJ3 L;  4JV5 L;  5C4J H;  5C44 B;  2SNS A;  4R9W A;  1HFN A;  2PI2 E;  4O1N A;  4DN4 M;  2TSS A;  2D0O A;  1BQQ T;  1YJW A;  2HQE A;  2WKD A;  3PUX A;  2E2J H;  4UPA A;  3W1G A;  5JJK A;  3TP5 A;  2R7Z G;  1VF5 C;  3RLO A;  1NUC A;  3TZU A;  1Q1B A;  3J7Z C;  2D5D A;  2VQE Q;  1VQI A;  1ESR A;  5KNB A;  2Y0S E;  5J39 A;  4BY1 H;  3EQL C;  1FGB D;  2B63 B;  1D8L A;  3PUV A;  4J8Q A;  3CRL C;  4JK1 C;  4DV4 Q;  3DXJ C;  5M5Y B;  3MVV A;  4ZCK A;  5CYU A;  4BBS H;  3HEJ A;  2XRQ D;  1Y1V B;  3OOC A;  3C3L A;  3CC4 A;  2MQH A;  1KL9 A;  2XWB B;  5JEA H;  1SFO B;  4DR7 L;  5C3E H;  3URY A;  2B8G A;  3P75 A;  1Q8K A;  2WAC A;  2A6E D;  1R4Q B;  1V1O A;  3E9I A;  1VQ9 A;  4LK1 C;  1FNV A;  1EEF D;  4NB3 A;  1EYC A;  2A69 C;  1NMF A;  3KYH C;  4YCV A;  3H3V H;  2QGQ A;  1X32 A;  3H6M A;  1JWM D;  2MO0 A;  2N49 A;  4DR5 Q;  2C5C A;  4RMF A;  4GLX A;  4MNO A;  2F0J A;  2QKI C;  1I50 H;  1SND A;  1T5E A;  5HY6 A;  1VQK A;  4CKC A;  2EY5 A;  2KJX A;  1WCM B;  4JI8 L;  1NCV A;  2K33 A;  4BWG B;  1STG A;  2KCM A;  3MXU A;  5CGK A;  3A74 A;  3F8T A;  1PRT C;  4A3L G;  2D9U A;  3A7L A;  1WD0 A;  4DR1 Q;  3HOW G;  3IAY A;  4JVZ A;  1DXM A;  3U58 A;  1AH9 A;  5IP7 H;  3T56 B;  4C56 C;  3PIO A;  1QZG A;  4P71 A;  5HGT A;  3CPW A;  4LF6 L;  3X3N A;  3RZD H;  4LF9 L;  4GNX B;  2EYJ A;  1CQV A;  1R9T H;  1IBL L;  5EKI A;  1JB3 A;  4R4T A;  1I4Q A;  2A73 B;  3ERO A;  3OWE B;  4A3I H;  4AYB E;  1E24 A;  5COY A;  1H9M A;  5IWA L;  1SBB B;  4B9W A;  4IFD H;  4APV A;  3J7A 5;  1UE6 A;  2L4N A;  2G9H D;  1STE A;  5ELF A;  1J5E L;  3ERS X;  2UXD L;  3KLS X;  4ZAI A;  1XNQ Q;  4B3T L;  3MA2 B;  2B2W C;  2VB2 X;  1M4V A;  4FXK C;  2PPB C;  1XPU A;  2LFN A;  1TS3 A;  3K7A H;  1FR3 A;  1H9K A;  1SE3 A;  3V05 A;  4B3M Q;  2L11 A;  1EQQ A;  4NXN Q;  3EN2 A;  4JOI C;  4U68 A;  4IPG A;  3HOY H;  1O80 A;  1SNQ A;  2PZU A;  3M3Y B;  5M5X H;  1S40 A;  1PFM A;  4ME3 A;  2GVA A;  5KND A;  3S2H H;  2JN4 A;  3ERQ A;  3L3O C;  4H7B A;  1PHJ A;  3NE5 B;  3M7N A;  1B70 B;  3OSO A;  4MIU A;  3I4M G;  2PQE A;  1QCB D;  3EIV A;  4A3J G;  2R7F A;  2K6A A;  2IX1 A;  1L0X B;  2NBF A;  2KHS A;  5M3F G;  2TMP A;  4RKB A;  1RTN A;  2NUC A;  1BF4 A;  1DM0 B;  4C1N I;  3K5N A;  5COR A;  1A62 A;  1RTO A;  2M9V A;  4GZY C;  1DOK A;  3TEH B;  1Q90 A;  4ZKC B;  3TME A;  1B9N A;  4PZ8 A;  5IIF A;  3QJY A;  3J7A F;  3PQI A;  4KHV A;  3U9O A;  4AIM A;  5C4X B;  3HOU H;  4FXG C;  3Q23 A;  1GUO A;  3WDN A;  5EBC A;  2F0H A;  1I4H A;  1PYW D;  2XSC A;  2P5Z X;  1FGU A;  2JA6 G;  1BNZ A;  2HD3 A;  3HKZ G;  1XTD A;  4BA1 I;  3BVM A;  4N8F A;  4KHP L;  4DXF A;  3LWU A;  3JAM E;  2H1E A;  1OXX K;  1EY8 A;  4A76 A;  2CH4 W;  3BVG A;  1F9Q A;  4KN4 C;  2ICI A;  4F87 A;  3H3V I;  3J81 i;  1V8Q A;  5LMN W;  4P73 A;  3GTP H;  4CDE C;  2R92 B;  5IYB H;  3I70 A;  3PO2 H;  5IGE A;  3BZD B;  5FO8 B;  4BXX G;  3R2I A;  4MN3 A;  3FPU B;  1EYG A;  2QF7 A;  3GTM H;  1JJC B;  1H95 A;  3GTL H;  1NSN S;  2C35 B;  1VQJ A;  5LL6 X;  1F2L A;  1K9M C;  4GLA C;  4RA8 A;  1VQ4 A;  4LFB Q;  4AH6 A;  3EVQ A;  3CCE A;  3MXP A;  2BE5 D;  2MO1 A;  2CVR A;  5KGU A;  5GRO A;  3H15 A;  5LMU L;  1B1Z A;  3ULP A;  3OMC A;  3VYR A;  1PH1 A;  2ID0 A;  3PUW A;  2Z4I A;  4Q5V A;  2UXC Q;  4YWM A;  3A55 A;  2WAQ E;  4FVM A;  2UU9 L;  3H09 A;  3WWV A;  1SYD A;  4FF1 A;  1TWC B;  4DNT B;  5IGG A;  3S1M B;  1MSH A;  1VQ7 A;  4DV2 Q;  1SE4 A;  4PMC A;  1EIH A;  1ILP A;  4BY1 G;  3KF8 B;  4TKO B;  4JI6 Q;  5I4D A;  5FJ8 H;  1VQF A;  1HPC A;  2PO4 A;  4YCU A;  2SEB D;  4A3F G;  2UUB L;  2K5W A;  1ZXT A;  1IL8 A;  3T1Y Q;  3J80 i;  2OXP A;  4RKL A;  2VQF Q;  1KQS A;  5CV7 A;  3OTO Q;  3F2C A;  2E75 C;  4YY3 Q;  3GP7 A;  5CV9 A;  5KEE A;  1EIF A;  3SE0 A;  1CI3 M;  3ONA B;  4DV0 Q;  5IT9 E;  1ZEQ X;  3A8J E;  3X3M A;  4DR6 L;  1K0S A;  2F52 A;  3JAM i;  3MAQ A;  3DLL A;  2RSO A;  1EWC A;  1PDQ A;  2K5V A;  4A3C H;  2AKW B;  4ZQ3 A;  1PTO C;  3PIO 3;  4FNF A;  1HZC A;  1YNN C;  3E3X A;  2B2V C;  4DAP A;  1BCP B;  1SNP A;  3K59 A;  4UAI A;  4WJ4 A;  1E3P A;  4DK0 A;  5EBD A;  4X62 Q;  4XIG S;  5C4J B;  5JAV A;  4JI5 L;  3RMH A;  2K5H A;  3FRP B;  3M4P A;  4XQN A;  2A68 D;  2O4X A;  2F3I A;  3D6C A;  1ASY A;  4K0K L;  2F0U A;  2E2J B;  5L37 A;  3MHB A;  3ULL A;  3NP8 A;  5I2Y A;  1I4R A;  2EOT A;  2NVQ H;  1F2Y A;  5IT9 L;  5IY0 A;  3A5U A;  5C0X H;  2PMZ B;  1YIJ A;  1STH A;  4BY1 B;  4UHV A;  1MKH A;  3KDF A;  3WOF A;  2F4V Q;  1EY6 A;  4LFC L;  3FPP A;  3LGJ A;  1STN A;  3A7A B;  3G6E A;  2M00 A;  3CKI B;  4DV5 L;  4BBS B;  3P7J A;  5A2Q E;  2ES2 A;  1B53 A;  3D3R A;  4CBV A;  2CW0 C;  4A93 H;  1OTC A;  3PGZ A;  1QNK A;  4X3K A;  4UY8 C;  4QY7 A;  2M2L A;  4M8A A;  1LT3 D;  2PQA A;  4I7Z C;  3SR1 A;  5C3E B;  2RVL A;  2JK8 A;  2OT2 A;  5EJW A;  1FD7 D;  1IKM A;  3U50 C;  2LXJ A;  3DWP A;  2NTT A;  1DYQ A;  1Q46 A;  4UP8 A;  3R2T A;  1YBY A;  1PFN A;  1CKN A;  2F3V A;  3BG3 A;  2JSO A;  4K5V A;  4ZUI A;  3HOY G;  1I50 B;  1W6J A;  5M5W H;  4KY5 A;  4QCL A;  2NN6 H;  3ICE A;  4ZLT F;  2LKV A;  2CCZ A;  5A2Q L;  2D0P A;  5GAE C;  1QVG A;  1JC7 A;  1Z6H A;  5AJ3 Q;  1Q86 C;  4P2C B;  1QUQ A;  3K5O A;  3DEP A;  4XTC S;  3CPF A;  2R6G A;  4ZYS A;  1X3G A;  3GTQ H;  4GOP A;  4JI4 L;  4QF4 A;  3P1H A;  2XGT A;  1GO3 E;  1KDA A;  3NXW A;  4RGO S;  3RZD B;  3M4Q A;  2XTI A;  1R9T B;  3J7A V;  4DNI A;  3F2B A;  4M1U B;  2R7Z H;  3C1F A;  3GTO H;  2EYP A;  4A3I B;  2AUK A;  4HJA A;  1O7L A;  4ME5 A;  1KNE A;  5DM7 3;  2LS0 1;  2HUG A;  3KUP A;  4HTH A;  1SJE D;  4P75 A;  4K6D A;  2KCT A;  3BZK A;  1IYU A;  4JI0 L;  2O5I C;  1TII D;  1ICW A;  3D4R A;  3KLS A;  3RLF A;  5IGF A;  4HR7 B;  1S5B D;  3AFP A;  4KKT A;  5CV5 A;  4WOR A;  1I6H H;  4DR7 Q;  3K7A B;  1SYB A;  4RFB A;  2R3Z A;  1ZYR D;  2HIX A;  1EL0 A;  5FLX c;  5LMN L;  2B29 A;  2RDG A;  1YHA A;  2GN5 A;  1QOH A;  4IPH A;  3HOY B;  5C5L A;  1IYJ B;  5M5X B;  3GQB A;  1Q82 C;  1TU2 B;  3S2H B;  1SMY D;  2JYO A;  2E2H H;  1SYG A;  4DAM A;  2JXM B;  4HMJ A;  2DY8 A;  1SE2 A;  3VDY A;  2Z4H A;  4JI8 Q;  3T16 A;  2PW7 A;  1K3B C;  3TS0 A;  3I8Z A;  4BY7 G;  4RCN A;  5JPM C;  4NPS A;  1STB A;  1V1P A;  5KIX A;  2CFM A;  4CDC C;  2I5L X;  2DJG C;  4QB4 A;  3HOW H;  2WKC A;  3HOU B;  2RBM A;  1LV9 A;  3OW7 A;  4LF6 Q;  2ZM6 L;  4MZ9 A;  3T53 B;  4LF9 Q;  4YHH L;  1NNX A;  2YTY A;  5GAH C;  2A8V A;  2B39 A;  1ESF A;  2VXW A;  1VQO A;  4NXM Q;  1KNA A;  2DN8 A;  1D5M C;  5IWA Q;  4GKK Q;  2ZJP A;  1MGS A;  2JJQ A;  3NBH B;  1J9O A;  3HZX A;  2LXK A;  3NEM A;  4B3T Q;  2K5D A;  5G3L D;  4JI1 L;  5C4Z A;  4OXP A;  4X3T A;  3I56 A;  3DMU A;  2L9H A;  3NQT A;  3PSI A;  3GTP B;  3PO2 B;  2CH4 A;  2K04 A;  1EYA A;  2BOS A;  4BBR G;  1XNR L;  4DV3 L;  3D4D A;  5D3D A;  5T1G A;  1M8A A;  1PRT B;  4L63 B;  4X66 L;  3GTM B;  2WP8 J;  3CF5 A;  1PH3 A;  4LNQ A;  3GTL B;  2GVB A;  2RSN A;  1X54 A;  2Z0S A;  2YU9 H;  1CZG A;  4K6L A;  2IX3 A;  2IL8 A;  1HZB A;  3CCS A;  2ASB A;  3F2D A;  5LHY 1;  5JEA J;  1CZW A;  3SVM A;  5GAD C;  3SK6 A;  3S15 H;  4A4I A;  1N34 L;  3I4M H;  1Y8N B;  1I4G A;  3I4N H;  3KJO A;  1FJG Q;  3GV6 A;  4A3J H;  1GD7 A;  5JVG 3;  1HHV A;  5M3F H;  4EQO A;  1X65 A;  1DOM A;  1DOL A;  3CAM A;  1KD1 C;  4X65 Q;  5CMD A;  3CCU A;  2F0O A;  3DM1 A;  5IYC H;  4JYA Q;  5C0X G;  4FF4 A;  4DR3 Q;  4QIW B;  4LAA A;  1LTI D;  1AN8 A;  3TN2 A;  4GOP C;  1NE3 A;  4XYO A;  1S4Z A;  4EQN A;  2CKZ B;  3DHQ A;  4B3S L;  3C46 A;  2JA6 H;  4KY6 A;  5EGT A;  1XMO L;  4PMB A;  4QGU A;  1FYC A;  1R4P B;  2KEC A;  2KCC A;  3MTS A;  5IYD G;  1HNW Q;  1LTR D;  2VB3 X;  1G2S A;  1MSG A;  3HOX G;  2QA4 A;  1VF7 A;  1C48 A;  4X3S A;  5ELE A;  3K0Y A;  4A3G G;  1EEI D;  4S3S A;  1LAB A;  2UXB L;  4LUZ A;  2A74 C;  4IFD J;  1QVC A;  4BXX H;  1I6V C;  3KF6 B;  2B2Y A;  3CQZ H;  1WFQ A;  5BR8 L;  4AQY L;  1B3Q A;  4K2K A;  1IW7 D;  3QOJ A;  5JPN C;  1VQM A;  1ONL A;  1VQA A;  1SYC A;  2Z6K C;  4JI3 L;  4HIM A;  1HUM A;  5LMU Q;  2J7Z A;  2PZT A;  4DAV A;  4ZRZ A;  3SEB A;  2K7V A;  2NVQ B;  3RUZ A;  1YNJ C;  3ZYY X;  3CCQ A;  2FJ2 A;  2JEB I;  2UU9 Q;  3STB D;  2JEA I;  1ASZ A;  4FYD A;  1B8A A;  1AEX A;  2Q2U A;  4X64 L;  2VL6 A;  4EVO A;  1II3 A;  3SDZ A;  4HIO A;  2ALY B;  3KLR A;  4H0L C;  2PCF B;  1STY A;  1YJ9 A;  4A93 B;  2B2T A;  3DWQ A;  4OX9 L;  3TBI B;  1K73 C;  1GUT A;  4A3F H;  2BA1 A;  4PNY A;  1GM5 A;  2OCE A;  5E4X A;  4I65 A;  4IUP A;  1OXT A;  4YWK A;  3L2P A;  4U67 3;  1OXV A;  3SK4 A;  1BCP D;  2F0Q A;  2EYH A;  4XQJ A;  1A2T A;  4DR6 Q;  3EA6 A;  1U4M A;  2J4X A;  3LX0 A;  5M5W B;  5M3M H;  4XT3 B;  2Q8R E;  4CKE A;  1PMR A;  1O78 A;  3AYH B;  1Y1W G;  1KTK A;  1PH9 A;  2K5N A;  2WB1 B;  3D4W A;  2RF4 A;  4RWS C;  1TY0 A;  2Y0S G;  1Q3L A;  3GTQ B;  3K8A A;  1MJC A;  2A5H A;  2K14 A;  3H91 A;  2UUA L;  3BS1 A;  1XYI A;  3I73 A;  1EU4 A;  5DLQ E;  2Z8L A;  4R4O A;  4HSV A;  3VR6 A;  2L15 A;  2G9D A;  2VS1 A;  2Q8I B;  4DAY B;  3GTK H;  4DF7 A;  1HRJ A;  3GTO B;  2R7Z B;  1CT1 D;  3NWS A;  2E5L Q;  2OF1 A;  2IHF A;  2OWO A;  4ODG A;  1TS2 A;  4LFC Q;  3PF4 A;  3H0G G;  5K36 G;  2OTJ A;  4RGT A;  2YTV A;  1WJJ A;  1B3A A;  4DV5 Q;  2DNC A;  1I94 Q;  2ENB A;  4UP9 A;  4CKB A;  5C3W A;  1RDP D;  1JOQ A;  4HMI A;  3D31 A;  1I6H B;  2MUY A;  4OHJ A;  4LF7 L;  1J6Q A;  3TRZ A;  1PH4 A;  3R3O A;  3TS2 A;  4O0A A;  2F0G A;  3BDC A;  5IGD A;  1NJI C;  4KJN A;  3DWA A;  4Q0F A;  4KJO A;  1CA5 A;  1HNZ L;  5J22 A;  5C3X A;  4LMQ D;  2B8F A;  3IL8 A;  1HA5 A;  2PI2 A;  2E2H B;  2E8G A;  1ROD A;  2FIN B;  2HCC A;  2K4K A;  1VDZ A;  1PLF A;  5G3L F;  5JJZ A;  1JE4 A;  1DZ1 A;  4DR4 L;  1S72 A;  1X3F A;  4GS3 A;  3NEN A;  2K05 A;  1MBY A;  1NAP A;  4KK7 A;  4N8X 1;  1EWH A;  4O2D A;  4AYB G;  1QWY A;  2A68 C;  2K75 A;  4JI4 Q;  1AE2 A;  3I4N G;  3HOW B;  2UUC Q;  3PIP A;  1C0A A;  2RDH A;  1T9H A;  3GO5 A;  3K80 C;  1AW7 A;  2B2Y C;  2F4I A;  1W3S A;  4OON A;  2MJ8 A;  1G51 A;  4GKJ L;  3PO3 H;  4GN5 A;  4L6T B;  1EZ8 A;  5IYC G;  3E5S A;  4JCV E;  1D7Q A;  2BH2 A;  2QCP X;  2I5M X;  4DUZ L;  4HCE A;  2HQL A;  2AQ3 B;  2WII B;  4JI0 Q;  4TQU S;  1G2T A;  3D6W A;  1JB7 A;  3VYT A;  1QNU A;  2ZXR A;  1K8G A;  1IBM L;  4KN7 C;  4OWT B;  4DV6 L;  3UE0 A;  1K83 H;  5IGC A;  1VS0 A;  1TVX A;  3K5M A;  1K8A C;  4FF3 A;  3CU7 A;  2B2T C;  3FKI G;  1EQR A;  1KDB A;  2QEJ C;  3HOZ G;  3IKJ A;  2EY1 A;  3IRB A;  1TKW B;  3OW2 A;  4KD4 A;  2YU9 B;  3AMU A;  1B4O A;  3UDG A;  1N36 L;  4A3B H;  3E9H A;  2LSS A;  3BJU A;  5EPJ A;  3TP8 A;  3SXH A;  3S15 B;  1ENA A;  3I4M B;  1SRO A;  3FMC A;  3SK8 A;  3I4N B;  3E0E A;  2EYM A;  4A3J B;  5IP9 G;  5M3F B;  1BR9 A;  4BY7 H;  4XDX A;  3MXN B;  4ZK9 B;  2QDL A;  1KIX A;  3OMG A;  3VR2 A;  2DJF C;  2ZM6 Q;  4DV1 L;  1YHB A;  2DUD A;  4IZ8 A;  2A69 D;  2PMZ E;  4YHH Q;  1UE5 A;  1PH2 A;  1SN8 A;  1SYE A;  3ITP A;  1K0R A;  3Q22 A;  1UAP A;  1F9R A;  2J0T D;  4IPD A;  1A15 A;  1UE7 A;  2JA6 B;  3K81 C;  4E6I A;  3K7U C;  3HKZ B;  3HKS A;  4ABN A;  3U9S A;  1WD1 A;  3RZO H;  3QB3 A;  1PRT D;  3A8I E;  2K5Q A;  1SNC A;  1V1Q A;  3PCO B;  1LT5 D;  4QL5 A;  1H9J A;  1K8O A;  1ZYR C; 
#chains in the Genus database with same CATH homology
 3HRZ C;  4TRD A;  1EY9 A;  5FLX E;  1SDF A;  1I4P A;  2L1B A;  2I07 B;  1CM9 A;  3CQZ B;  2EDG A;  1Y8P B;  1X3Q A;  1KAB A;  2KVM A;  5NUC A;  1ET6 A;  3QO2 A;  1KDC A;  1VMP A;  4RHS A;  4IQZ A;  3KF8 A;  3M7G A;  2EYL A;  3SK5 A;  1EYD A;  4RGM A;  3MFY A;  3E0J A;  1BCP F;  1GHK A;  1UEA B;  1QG7 A;  1NR2 A;  1Y8O B;  3MZ5 A;  2D62 A;  5C4H A;  1A2U A;  2EY6 A;  4F88 A;  1D1I A;  1BXT A;  3LWE A;  5CC4 A;  2YYZ A;  5FLX L;  1S5D D;  3TZD A;  2JE6 I;  4ID6 A;  3FDT A;  5I9O A;  3N52 A;  4C3H G;  4FXD A;  1WTX A;  1LTS D;  5BN3 A;  4A3F B;  3VR3 A;  4ZUJ A;  4HED A;  4IUQ A;  1T5X D;  3HP3 A;  3K6O A;  1F2M A;  1D5X C;  1TS5 A;  1SSO A;  1A3U A;  5M3M B;  2BCO A;  3PIP 3;  2NB0 A;  1EY5 A;  4QMG A;  2N88 A;  4TSS A;  4KHZ A;  2PZW A;  1TY2 A;  5CBE E;  3GV3 A;  2KA7 A;  3GTK B;  4BS9 A;  1JOK A;  3A8K E;  2XRS D;  2K28 A;  1WVL A;  1LO5 D;  3TDQ A;  1RJT A;  1TS4 A;  2HDL A;  3M4Y A;  5EPL A;  1AP0 A;  2F0F A;  2RDF A;  3EJI A;  5J1Z A;  5IOC A;  1QB5 D;  4HCS A;  1G91 A;  4Z9C B;  3CHB D;  1HFG A;  1CK1 A;  4DK1 A;  2PNR C;  4R8I A;  3MEH A;  4IUN A;  4WFN 3;  1PTO H;  5EKL A;  1VCI A;  2Z1C A;  3A54 A;  4C3J G;  1GJX A;  4HN7 A;  3OIQ A;  4WRD A;  4B9X A;  2EJM A;  2NYZ D;  1SAP A;  2A6H C;  4B08 A;  1GUN A;  2E76 C;  1GUG A;  1E0B A;  4CHT B;  3OWF A;  5M9O A;  3PO3 B;  3GTJ B;  1BOS A;  1U4P A;  5FKA C;  4C3I G;  4QUF A;  1WTR A;  5TSS A;  3NQI A;  1PTO D;  1L0Y B;  1YNN D;  5K36 H;  3BDO A;  1FNW A;  4L8J A;  1EFI D;  1K83 B;  3NK9 A;  3I91 A;  5IOD A;  1LTB D;  5KYL A;  1GHJ A;  3VR4 A;  1TQO A;  3VYS A;  3MC0 B;  2L5T A;  2IPK D;  4OO1 I;  2EJG C;  3OIP A;  1H9S B;  4J1M A;  4KMU C;  4A3B B;  2A6E C;  2F1M A;  4RCO A;  5CR3 A;  1MI2 A;  4ILW A;  4KY7 A;  1PFB A;  2KQ3 A;  1PRT F;  5AFW A;  2VNU D;  2EVB A;  2F0I A;  1D6E C;  2CW0 D;  1LTT D;  3NBH A;  4BY7 B;  3I72 A;  3W3A A;  1XTC D;  1CTM A;  5FO7 B;  2XWJ B;  3MXG A;  3K57 A;  2ZT9 C;  2F0N A;  1ENC A;  4K8J A;  1O7Y A;  2H4O A;  3V96 A;  1C4Q A;  3RZO B;  2I46 A;  2L55 A;  3NTI A;  3UI2 A;  1GUS A;  1KLU D;  4G7O C;  3LNN A;  2SDF A;  3QOL A;  3KBG A;  3P20 A;  4BBR B;  4XT1 B;  4FO2 A;  4C1N K;  4V19 0;  2FMC A;  2F0K A;  2F0V A;  1Q8I A;  4KD3 A;  4OO1 G;  4EQP A;  2MPM A;  2RKS A;  4IUR A;  2MP1 A;  3BYT B;  1LTG D;  3ND8 A;  4G4K A;  3S1Q B;  4HSP A;  3G6J B;  3E6Z X;  5BN4 A;  3GD7 A;  1F2Z A;  1CHP D;  3IFT A;  3L7Z C;  1DD2 A;  3HGB A;  3PV0 A;  4FF2 A;  1D1K A;  2MHV A;  3HS0 C;  2F0L A;  4HAE A;  5HUR A;  2HCI A;  4XQQ A;  3H94 A;  5DAU A;  4A3E B;  1LLR D;  2RQX A;  4K8I A;  2F0W A;  1RF2 D;  3S1N B;  2SOB A;  5K5P A;  1U4R A;  4OL7 A;  4NDX A;  5C5M A;  3HOX B;  3PUZ A;  1IKL A;  4A3G B;  1MD2 D;  3S1R B;  2AQ2 B;  1BDO A;  1O7Z A;  5ELB A;  3QIA A;  5FOB B;  1PZK D;  4DGZ A;  1NR4 A;  1F9P A;  1SYF A;  5DM6 3;  1S5C D;  3VA5 A;  1QE6 A;  2AWO A;  4DU9 A;  1CFM A;  2BE5 C;  2KUM A;  3NUC A;  3VYU A;  1I3Q B;  4A3D B;  1PZJ D;  3DUZ A;  1ET9 A;  3M85 A;  2X6G A;  3PMF A;  2K1B A;  4ZKB B;  2FMM A;  4J6H A;  2PW5 A;  1EY4 A;  3S2D B;  4PV1 C;  4JBW A;  5E1F A;  3S17 B;  3T51 B;  1ZKO A;  3RD4 A;  4G57 A;  4RGN A;  1PTO B;  1PTO F;  4DAY A;  1AZP A;  3BYY B;  2XIW A;  1UUP A;  4R8N A;  2N55 A;  5FO9 B;  5E3F A;  2Q8T A;  3J81 E;  1Y1W B;  1BUV T;  1D2B A;  5ELD A;  2Y0S B;  1FNU A;  1WTQ A;  3Q24 A;  2O2L D;  3NPP A;  2DNE A;  1VMC A;  2B2V A;  2C9O A;  1TWG B;  1WTP A;  2LMC B;  3WOE A;  2KEE A;  2ZXP A;  3H0G B;  3BVZ A;  5D65 A;  3J81 L;  2LY7 A;  4OIJ A;  2EXZ A;  3C2P A;  1S5F D;  2F03 A;  1EQV A;  1G6Z A;  1I4X A;  1XX8 A;  1RHP A;  1YNJ D;  2F0P A;  1G8Z D;  5C0X J;  2QDB A;  3FVQ A;  5EQ0 A;  1GUW A;  1GXD C;  2F0S A;  4OGQ C;  1EOT A;  3J80 E;  3Q6S A;  4N9P A;  5CV4 A;  1S5E D;  3I4L A;  5A35 A;  1H9R A;  2B2U A;  3TP7 A;  5D14 A;  4OIK A;  5C6A A;  1EIG A;  4AYB B;  1Y69 U;  2L12 A;  1E2Z A;  2E74 C;  2FFK B;  4QUC A;  1K8M A;  1TWA B;  2NVT B;  5ISR A;  4N9T A;  2EZV A;  2AWN A;  3J80 L;  1OXU A;  3HOV B;  1U4L A;  1J8I A;  1JR0 D;  5D3I B;  3MFG A;  1PZI D;  1LAC A;  4H44 C;  1TWH B;  1EU3 A;  2F0D A;  1B9M A;  4IN3 A;  4UDU C;  1HUN A;  2IT1 A;  1ILQ A;  2EY2 A;  3JAM L;  1JOR A;  1XXG A;  2MGS A;  5F2D A;  3L9A X;  2IWH A;  1HXY D;  1OO9 B;  3HG9 A;  2NVX B;  1PXU A;  1SNM A;  2ZXO A;  2WIN B;  1SEB D;  3MXN A;  3OHX C;  4CGY B;  3S14 B;  2L0C A;  4NW2 A;  3FKI B;  5I2X A;  5ELC A;  4KKS A;  4CJ2 C;  2DY7 A;  3HOZ B;  1SJH D;  1B44 D;  4BA2 I;  1EZ6 A;  1CA6 A;  1RD9 D;  4IFD I;  3NBI A;  4KTA A;  1ML0 D;  4K2L A;  4FP5 D;  1SMY C;  3V2T A;  4F7X A;  2EYO A;  5JOB A;  3VR5 A;  2X69 A;  2R61 A;  2XNA C;  2K03 A;  4XYQ A;  1F9S A;  5JEA G;  2AQ1 B;  3NTH A;  1ENF A;  1XWE A;  1EY0 A;  2EYF A;  3S9W A;  3K5L A;  2F0E A;  1LT4 D;  1LTA D;  4K5W A;  3I3C A;  2E2I B;  5KRU A;  3TSS A;  3QG1 A;  3D8G A;  5IGB A;  1UNS A;  3R93 A;  3KK7 A;  2CHB D;  3C1E A;  3GTG B;  4G7Z C;  4KV6 A;  1A3T A;  5DEH A;  2WAQ B;  1DON A;  3KBX A;  1JWS D;  2O5J C;  1Z7T A;  1A6X A;  4OO1 H;  5FK9 C;  3A56 A;  3DEO A;  4IUV A;  4NMZ A;  4IFD G;  1G29 1;  5EKK A;  1GOZ A;  1W6K A;  2QIL A;  2B2U C;  1JCK B;  2IX0 A;  4DNR B;  5KYI A;  1JOO A;  3VA7 A;  5EPK A;  4CJ0 B;  2PYK A;  3MWY W;  4C3H B;  5I9P A;  4IAL A;  2JP1 A;  2OEO A;  1Q12 A;  2F0M A;  1TT2 A;  2KCN A;  3PUY A;  1A3V A;  2D2C C;  4V0B A;  1AZQ A;  3I90 A;  3O13 A;  4PQX A;  4RAU C;  4X3U A;  2EE1 A;  1BBX C;  5T1I A;  3EFX D;  1B50 A;  1U9R A;  3J7Y W;  2X6L A;  4RHR A;  3T13 A;  2JA8 B;  5KNC A;  4PMW A;  1CQF A;  4F8M A;  3R8B A;  4LJZ C;  2BDN A;  2CQA A;  3N6R A;  1JQY D;  3S16 B;  1B2T A;  4Y7N B;  1OXS C;  4H13 C;  1SNO A;  1IW7 C;  4EGV A;  1V1P B;  1QJO A;  2K32 A;  4WJW A;  2SNM A;  1BO0 A;  3M4O B;  2K01 A;  1HA6 A;  3T4A C;  4C2M B;  2VUM B;  4IUT A;  4A3M B;  1DCZ A;  5BN5 A;  5CV8 A;  2EPB A;  2FHT A;  1KAA A;  1EY7 A;  1HQM C;  2E2D C;  3QWN A;  3BDL A;  3NSW A;  1WTV A;  2XN9 C;  5C0X I;  3NWT A;  1V43 A;  2NTS A;  2KED A;  3NTK A;  4C3J B;  5I6Y A;  1BCP C;  2V4D A;  1HCZ A;  4DXG A;  4O42 A;  3OPO A;  1STA A;  1QIL A;  4K14 A;  2GA4 B;  2RA4 A;  2BA0 A;  2XVS A;  1JWU D;  3G7L A;  2AUJ D;  3FEW X;  1HTP A;  4KI0 A;  1TWF B;  2NN6 I;  1H9S A;  3AU7 A;  4C3I B;  1LT6 D;  4DA2 A;  1EQT A;  1F77 A;  4CJ1 B;  4G7H C;  2IW3 A;  3IFD A;  1C8C A;  3ND9 A;  1WTO A;  2R93 B;  1AFP A;  1Z47 A;  1RKN A;  3SHL A;  3H3V C;  4K5X A;  4IUU A;  1HTL D;  5I6W A;  4DFA A;  1X3P A;  4XXE A;  5LL6 S;  1SXT A;  4MHE A;  1E2V A;  2EJF C;  3K58 A;  3TP6 A;  5E4W C;  3AB9 A;  2WV6 D;  2BDO A;  3CRK C;  2B2W A;  1IHZ A;  5JVH 3;  1HQR D;  2F3W A;  1DJR D;  2KOL A;  5CBA E;  4NP5 A;  4YIJ A;  2NVY B;  3NHH A;  3F2U A;  3W2D A;  2IJ0 A;  2ICE C;  1E2W A;  1Q1E A;  5CV6 A;  2NZ1 D;  2NWG A;  1RCV D;  4NKL A;  1WTW A;  1IYV A;  1CHQ D;  5DNF A;  2NN6 G;  2A6H D;  1D5Z C;  4A3K B;  1JIC A;  2JA5 B;  3Q0A A;  4ULL A;  2HDM A;  2JA7 B;  1TR5 A;  4RH6 A;  4KKU A;  1KLG D;  2F0T A;  5C44 B;  2SNS A;  4R9W A;  1HFN A;  4O1N A;  4DN4 M;  2TSS A;  1BQQ T;  2HQE A;  2WKD A;  3PUX A;  3TP5 A;  1VF5 C;  1NUC A;  3TZU A;  1Q1B A;  2D5D A;  1ESR A;  5KNB A;  5J39 A;  3EQL C;  1FGB D;  2B63 B;  3PUV A;  4J8Q A;  3CRL C;  4JK1 C;  3DXJ C;  5M5Y B;  3MVV A;  5CYU A;  3HEJ A;  2XRQ D;  1Y1V B;  3OOC A;  3C3L A;  2XWB B;  5JEA H;  1SFO B;  3URY A;  2B8G A;  3P75 A;  2WAC A;  2A6E D;  1R4Q B;  1V1O A;  4LK1 C;  1FNV A;  1EEF D;  1EYC A;  2A69 C;  1X32 A;  3H6M A;  1JWM D;  2C5C A;  2F0J A;  2QKI C;  1SND A;  1T5E A;  4CKC A;  2EY5 A;  2KJX A;  1WCM B;  1NCV A;  2K33 A;  4BWG B;  1STG A;  3MXU A;  5CGK A;  1PRT C;  2D9U A;  3A7L A;  1WD0 A;  3IAY A;  1DXM A;  3T56 B;  4C56 C;  5HGT A;  3X3N A;  2EYJ A;  1CQV A;  5EKI A;  1JB3 A;  1I4Q A;  2A73 B;  3ERO A;  3OWE B;  5COY A;  1H9M A;  1SBB B;  4B9W A;  4IFD H;  2L4N A;  2G9H D;  1STE A;  5ELF A;  3KLS X;  4ZAI A;  3MA2 B;  2B2W C;  2VB2 X;  1M4V A;  4FXK C;  2PPB C;  2LFN A;  1TS3 A;  1FR3 A;  1H9K A;  1SE3 A;  3V05 A;  2L11 A;  4U68 A;  1O80 A;  1SNQ A;  2PZU A;  3M3Y B;  1PFM A;  5KND A;  3ERQ A;  3L3O C;  4H7B A;  3NE5 B;  3M7N A;  3OSO A;  4MIU A;  2PQE A;  1QCB D;  2IX1 A;  2K6A A;  1L0X B;  2NBF A;  2KHS A;  2TMP A;  4RKB A;  1RTN A;  2NUC A;  1BF4 A;  1DM0 B;  4C1N I;  3K5N A;  5COR A;  1RTO A;  2M9V A;  4GZY C;  1DOK A;  1Q90 A;  4ZKC B;  3TME A;  1B9N A;  5IIF A;  3QJY A;  3J7A F;  4KHV A;  3U9O A;  5C4X B;  4FXG C;  3Q23 A;  1GUO A;  3WDN A;  5EBC A;  2F0H A;  1I4H A;  1PYW D;  2XSC A;  1BNZ A;  4BA1 I;  3BVM A;  4DXF A;  3LWU A;  3JAM E;  2H1E A;  1OXX K;  1EY8 A;  3BVG A;  1F9Q A;  4KN4 C;  2ICI A;  4F87 A;  1V8Q A;  2R92 B;  3I70 A;  5IGE A;  3BZD B;  5FO8 B;  3R2I A;  4MN3 A;  3FPU B;  2QF7 A;  1NSN S;  5LL6 X;  1F2L A;  4RA8 A;  3EVQ A;  3MXP A;  2BE5 D;  2CVR A;  5KGU A;  1B1Z A;  3OMC A;  3VYR A;  2ID0 A;  3PUW A;  2Z4I A;  4Q5V A;  3A55 A;  4FVM A;  3H09 A;  1SYD A;  4FF1 A;  1TWC B;  4DNT B;  5IGG A;  3S1M B;  1MSH A;  1SE4 A;  4PMC A;  1EIH A;  1ILP A;  4TKO B;  5I4D A;  1HPC A;  2PO4 A;  2SEB D;  2K5W A;  1ZXT A;  1IL8 A;  2OXP A;  4RKL A;  5CV7 A;  2E75 C;  3GP7 A;  5CV9 A;  5KEE A;  3SE0 A;  1CI3 M;  3ONA B;  5IT9 E;  1ZEQ X;  3A8J E;  3X3M A;  3MAQ A;  2RSO A;  1EWC A;  1PDQ A;  4ZQ3 A;  1PTO C;  3PIO 3;  4FNF A;  1YNN C;  2B2V C;  4DAP A;  1SNP A;  1BCP B;  3K59 A;  4UAI A;  4DK0 A;  5EBD A;  4XIG S;  5C4J B;  5JAV A;  3RMH A;  3FRP B;  4XQN A;  2A68 D;  2O4X A;  3D6C A;  2F0U A;  2E2J B;  3MHB A;  3NP8 A;  5I2Y A;  1I4R A;  2EOT A;  1F2Y A;  5IT9 L;  5C0X H;  2PMZ B;  4BY1 B;  1STH A;  3WOF A;  1EY6 A;  3FPP A;  1STN A;  3A7A B;  2M00 A;  3CKI B;  4BBS B;  3P7J A;  5A2Q E;  1B53 A;  3D3R A;  4CBV A;  2CW0 C;  1QNK A;  4X3K A;  2M2L A;  4M8A A;  1LT3 D;  5C3E B;  4I7Z C;  3SR1 A;  2RVL A;  2OT2 A;  5EJW A;  1FD7 D;  1IKM A;  3DWP A;  2NTT A;  1DYQ A;  3R2T A;  1PFN A;  2F3V A;  2JSO A;  3BG3 A;  4K5V A;  4ZUI A;  1I50 B;  1W6J A;  4KY5 A;  4QCL A;  2NN6 H;  4ZLT F;  2LKV A;  5A2Q L;  1JC7 A;  1Z6H A;  4P2C B;  3K5O A;  3DEP A;  4XTC S;  2R6G A;  4ZYS A;  4QF4 A;  3P1H A;  1KDA A;  3NXW A;  4RGO S;  3RZD B;  1R9T B;  3J7A V;  4M1U B;  3C1F A;  2EYP A;  4A3I B;  2AUK A;  1O7L A;  4ME5 A;  1KNE A;  5DM7 3;  2LS0 1;  2HUG A;  3KUP A;  4HTH A;  1SJE D;  4K6D A;  1IYU A;  2O5I C;  1TII D;  1ICW A;  3D4R A;  3KLS A;  3RLF A;  5IGF A;  4HR7 B;  1S5B D;  4KKT A;  5CV5 A;  4WOR A;  3K7A B;  1SYB A;  4RFB A;  2R3Z A;  1ZYR D;  1EL0 A;  2RDG A;  1QOH A;  3HOY B;  5C5L A;  5M5X B;  3GQB A;  1TU2 B;  3S2H B;  1SMY D;  2JYO A;  1SYG A;  2JXM B;  4HMJ A;  2DY8 A;  1SE2 A;  2Z4H A;  3T16 A;  2PW7 A;  3I8Z A;  4RCN A;  5JPM C;  1STB A;  1V1P A;  5KIX A;  4QB4 A;  2WKC A;  3HOU B;  2RBM A;  1LV9 A;  3OW7 A;  3T53 B;  2B39 A;  1ESF A;  2VXW A;  1KNA A;  2DN8 A;  1D5M C;  1MGS A;  1J9O A;  3HZX A;  2K5D A;  5G3L D;  5C4Z A;  4X3T A;  3DMU A;  2L9H A;  3NQT A;  3GTP B;  3PO2 B;  2K04 A;  1EYA A;  2BOS A;  3D4D A;  5D3D A;  5T1G A;  1M8A A;  1PRT B;  4L63 B;  3GTM B;  2WP8 J;  3GTL B;  2RSN A;  1CZG A;  4K6L A;  2IX3 A;  2IL8 A;  5LHY 1;  5JEA J;  1CZW A;  3SVM A;  3SK6 A;  1Y8N B;  1I4G A;  3GV6 A;  5JVG 3;  1HHV A;  4EQO A;  1DOM A;  1DOL A;  5CMD A;  2F0O A;  3DM1 A;  5C0X G;  4FF4 A;  4QIW B;  4LAA A;  1LTI D;  1AN8 A;  3TN2 A;  4XYO A;  1S4Z A;  4EQN A;  3DHQ A;  3C46 A;  4KY6 A;  5EGT A;  4PMB A;  1FYC A;  1R4P B;  2KEC A;  2KCC A;  3MTS A;  1LTR D;  2VB3 X;  1G2S A;  1MSG A;  1VF7 A;  1C48 A;  4X3S A;  5ELE A;  3K0Y A;  1EEI D;  4S3S A;  1LAB A;  2A74 C;  4IFD J;  1I6V C;  2B2Y A;  4K2K A;  1IW7 D;  3QOJ A;  5JPN C;  1ONL A;  1SYC A;  1HUM A;  2J7Z A;  2PZT A;  4DAV A;  4ZRZ A;  3SEB A;  2K7V A;  2NVQ B;  3RUZ A;  1YNJ C;  3ZYY X;  2FJ2 A;  2JEB I;  2JEA I;  4FYD A;  1AEX A;  4EVO A;  1II3 A;  3SDZ A;  3KLR A;  4H0L C;  2PCF B;  1STY A;  4A93 B;  2B2T A;  3DWQ A;  3TBI B;  1GUT A;  2BA1 A;  4PNY A;  5E4X A;  4I65 A;  4IUP A;  1OXT A;  4U67 3;  1OXV A;  3SK4 A;  1BCP D;  2F0Q A;  2EYH A;  4XQJ A;  1A2T A;  3EA6 A;  1U4M A;  2J4X A;  3LX0 A;  5M5W B;  4XT3 B;  2Q8R E;  4CKE A;  1PMR A;  1O78 A;  1KTK A;  2WB1 B;  3D4W A;  4RWS C;  1TY0 A;  3GTQ B;  1Q3L A;  2A5H A;  3H91 A;  3BS1 A;  1XYI A;  3I73 A;  1EU4 A;  2Z8L A;  4HSV A;  3VR6 A;  2G9D A;  2Q8I B;  4DF7 A;  1HRJ A;  3GTO B;  2R7Z B;  1CT1 D;  3NWS A;  2OF1 A;  4ODG A;  1TS2 A;  5K36 G;  4RGT A;  1B3A A;  2DNC A;  2ENB A;  4CKB A;  5C3W A;  1RDP D;  1JOQ A;  4HMI A;  3D31 A;  1I6H B;  2MUY A;  4OHJ A;  3R3O A;  2F0G A;  3BDC A;  5IGD A;  4KJN A;  3DWA A;  4Q0F A;  4KJO A;  1CA5 A;  5J22 A;  5C3X A;  4LMQ D;  2B8F A;  3IL8 A;  1HA5 A;  2E2H B;  1ROD A;  2FIN B;  2HCC A;  1VDZ A;  1PLF A;  5G3L F;  5JJZ A;  1JE4 A;  1DZ1 A;  2K05 A;  1MBY A;  1NAP A;  4KK7 A;  1EWH A;  1QWY A;  2A68 C;  3HOW B;  2RDH A;  3GO5 A;  1AW7 A;  2B2Y C;  2F4I A;  2MJ8 A;  4L6T B;  1EZ8 A;  3E5S A;  2QCP X;  4HCE A;  2AQ3 B;  2WII B;  4TQU S;  1G2T A;  3D6W A;  3VYT A;  1QNU A;  2ZXR A;  4KN7 C;  5IGC A;  3K5M A;  1TVX A;  4FF3 A;  3CU7 A;  2B2T C;  1KDB A;  2QEJ C;  3IKJ A;  2EY1 A;  1TKW B;  2YU9 B;  4KD4 A;  3AMU A;  1B4O A;  5EPJ A;  3TP8 A;  3SXH A;  3S15 B;  1ENA A;  3I4M B;  3SK8 A;  3FMC A;  3I4N B;  2EYM A;  4A3J B;  5M3F B;  1BR9 A;  4XDX A;  4ZK9 B;  3OMG A;  3VR2 A;  4IZ8 A;  2A69 D;  1SYE A;  3ITP A;  3Q22 A;  1UAP A;  1F9R A;  2J0T D;  1A15 A;  2JA6 B;  4E6I A;  3HKZ B;  4ABN A;  3U9S A;  1WD1 A;  3QB3 A;  1PRT D;  3A8I E;  2K5Q A;  1SNC A;  1LT5 D;  1H9J A;  1K8O A;  1ZYR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...