1V8QA

Crystal structure of ribosomal protein l27 from thermus thermophilus hb8
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
b'RLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TT0826
publication title Crystal structure of ribosomal protein L27 from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Translation
total genus 17
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01016 Ribosomal_L27 Ribosomal L27 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v8qA00
1Y8NB 1CTMA 3AB9A 3LNNA 1E2ZA 4BA2I 2BE5D 3WDNA 1GUTA 4XIGS 2JEAI 4H0LC 3DXJC 3MFYA 2EJGC 2IT1A 1Q12A 3VR3A 1OXXK 3T53B 3P20A 2DN8A 3CRLC 3BDOA 1GUSA 1TKWB 2AUKA 3OOCA 4DNTB 1GHKA 2PCFB 3OW7A 3D4RA 5BN4A 1H9SA 1Z6HA 1IYUA 1BDOA 3HGBA 1HQMC 3GQBA 5KNCA 1DCZA 2JEBI 1HPCA 1OXSC 1DD2A 4KMUC 3QJYA 1K8MA 1FR3A 1I6VC 1LABA 2NN6I 3VA7A 3KLRA 3SDZA 3M7NA 5A35A 2YYZA 2O5JC 4IFDH 1H9MA 3L7ZC 4G7ZC 2A68C 3PV0A 1VF5C 1VDZA 1H9KA 4HR7B 4LJZC 1FYCA 2A6HD 2E76C 3A7LA 3PUXA 1Q1BA 2A6EC 2ZT9C 3OPOA 3TZUA 1B9NA 3IFTA 1HTPA 4KKTA 1GHJA 3ND8A 2V4DA 3A8KE 3MXUA 2DNEA 1HCZA 3VR5A 3FMCA 4G7HC 3M85A 2O5IC 1K8OA 4TQUS 2JE6I 2A69D 3FPPA 4OGQC 1IW7D 2B8GA 2AWOA 4BA1I 2KCCA 1Z7TA 2EVBA 1YNJC 3I72A 4KHZA 4OO1H 1ZKOA 1H9RA 2EJFC 3I4LA 2K32A 4H44C 4G7OC 4GZYC 1EWHA 5BN3A 3NE5B 3QIAA 1VCIA 5K36H 1TU2B 1Y69U 5KNDA 1OXUA 3CRKC 3LWUA 3GD7A 3QG1A 1CFMA 4IFDG 2BDOA 3U9SA 2BA0A 3EQLC 4XTCS 1GUOA 1Y8PB 1G291 2E75C 3M4YA 3VR6A 1B9MA 5JEAH 5KNBA 1SMYC 3PUYA 2D5DA 2E74C 2BE5C 4LK1C 1H9SB 4DK1A 2A68D 2K33A 2NN6H 3A8IE 4H13C 5C0XH 3A7AB 1V43A 2K7VA 1GUNA 1O78A 1QJOA 2A6ED 2NN6G 3SE0A 1H9JA 1Y8OB 4IQZA 2KA7A 2A69C 2L5TA 3BG3A 1T5EA 4DNRB 4OO1G 3PUVA 2BA1A 2D62A 4JK1C 1IYVA 3W3AA 2B8FA 3PUZA 4TKOB 1CI3M 4JBWA 1ZYRC 4KI0A 5BN5A 1O7LA 1YNNC 4KKUA 5K36G 2DNCA 1GJXA 4DK0A 2PPBC 3I73A 2PNRC 2AUJD 3A8JE 2CW0C 2D2CC 4I7ZC 1OXVA 4L8JA 2EDGA 3VR4A 3ND9A 2QF7A 1Q1EA 2LMCB 2F1MA 1LACA 3N6RA 3T51B 1GUGA 1ONLA 3VR2A 4KN4C 2A6HC 3H94A 4RCNA 1Q90A 2Q8IB 4PV1C 3T56B 3IKJA 5JEAG 1VF7A 1A6XA 4KN7C 1E2WA 1V8QA 2JXMB 3D31A 1PMRA 4KKSA 2R6GA 1OXTA 5C0XG 3PUWA 3RLFA 1E2VA 1IW7C 2EJMA 1DXMA
chains in the Genus database with same CATH superfamily
4CDEC 1NR2A 2IX1A 5FJ8H 4JYAQ 1S4ZA 3HOUB 2EJGC 1I4RA 2YU9H 5ELFA 2VZAA 3S1NH 5IGDA 2GN5A 1SJHD 2JN4A 1L0WA 5C44G 1TWGB 2RHSB 1SBBB 2CHBD 3OHXC 2HIXA 1FR3A 3WOEA 3JAME 1IBLL 1EYAA 2R7ZG 2RBMA 3SHLA 4XT1B 4GLXA 3M4PA 1VDZA 5CGKA 2H4OA 3L9AX 5J3BA 3GV6A 3PUXA 3RUZA 1XTCD 4ZYSA 4KTAA 1MSHA 1MIUA 1TWCB 4IUQA 3AMUA 4K0KL 2XRQD 2EY2A 2K52A 3D3RA 1PTOH 3FVQA 1PH1A 3TMEA 2VB2X 2WAQE 3DM3A 4O1NA 4JI7Q 1EQRA 4BY7G 4C3IG 1EWHA 4DF7A 1PYSB 2ASBA 5I4DA 4RKLA 2OQ0A 5JOBA 2Q8RE 1KQSA 1YVCA 3I91A 3OIPA 3UDIA 1UAPA 1M90C 2E5LL 1XNQL 2Q8TA 3HOYB 3U9SA 2HHHQ 1WCMH 2D9UA 3LGJA 3I8ZA 2EZVA 4DV4L 3S2DB 2MPMA 4DV2L 4EX5A 4KD4A 5C5MA 1A62A 4A3LH 4JI2L 3F2UA 3H15A 4IO9A 1RL2A 2L11A 4QGUA 1JWMD 4GKJL 1X55A 4RWSC 2KOLA 4A3JG 2JQOA 2GVAA 3MZ5A 1FGUA 1UNSA 3TSSA 1TXYA 1IZ6A 1VQ6A 3S2HH 1CQVA 2DNCA 4EVOA 2ALYB 1XXGA 4FF2A 1VQLA 4B3TQ 1I94L 4C3HH 2LMCB 4QQBX 4I65A 1RJTA 4A3EH 3HS0C 4PV1C 1K8GA 3GTPB 2PI2A 3KUPA 1UE7A 1U4MA 1HUMA 1D2BA 3CMAA 4BS9A 1EWIA 1MI2A 4ZCKA 1GUTA 2Z4HA 5IT9L 3DXJC 5H1SE 1C8CA 3R8BA 5K5PA 1R4PB 1S5ED 3H6MA 5IP7H 1XPUA 1UE5A 5IYBH 4DK6C 2R93G 3GTGB 2JA9A 1TWFH 3PIPA 3GQBA 3NWSA 5LL6X 2F3WA 1PH7A 1XMOL 2NN6I 3M3YH 3J7AV 1VQNA 4X64Q 4LF9L 1VQCA 3K5LA 1X3QA 2HT1A 4MTNA 5LMUQ 2E76C 2BCOA 2JA8B 5M3FB 3OPOA 1EY5A 4YIJA 3ND8A 1D6EC 5J22A 1HCZA 3SEBA 2SDFA 2A69D 2OEOA 3S17B 3HOXG 4X6AH 1F9QA 1QUQB 3RZOH 4YCUA 5M5YB 4KHZA 3CC2A 4OO1H 1HTLD 3S1MB 4RA8A 2N78A 3Q0AA 1PH6A 4XQJA 4OX9Q 3HKSA 1TS2A 4RGNA 4BY1B 5KNDA 4KHPL 2F0GA 4IPHA 4JV5L 5E3FA 2DJFC 4XQNA 2J7ZA 2JA5G 2E75C 4DV5Q 1C48A 5KNBA 4EQ5A 1JCKB 4P73A 1Q3LA 3HOVG 4A93H 3K80C 4DV3Q 1VS0A 1CT1D 3E9IA 1JWUD 5KRUA 4DR5L 2MUYA 1GUNA 2A6ED 1E3PA 2ICIA 3OTOQ 5FO8B 1YZ6A 3UDXA 2P5ZX 1FGBD 1EY8A 1QOHA 1X6OA 2HDLA 5FLXL 4JBWA 5EPJA 1TIID 4L5RC 1N32Q 1I50H 4F88A 3KOJA 1L1OC 5M5XH 3V96A 4M8AA 4DR3Q 5CR3A 3S9WA 4C2MB 2Q8IB 1J5EL 3ULPA 2F0QA 1KIXA 4QMGA 2JXMB 3MFGA 3TQYA 3T1YL 2PNHA 1RF2D 1YHAA 2VXWA 5HY6A 4DXFA 1IW7C 1DXMA 5IODA 4CKCA 1O7ZA 5FK9C 3RN2A 1U9RA 1S3OA 4GOPC 1KNAA 5EAYA 5EGTA 5FJ8G 1CSPA 1JICA 1U5KA 5C4JH 3E0EA 5BN4A 1N33Q 1Z6HA 3QR8A 3S15H 5EBCA 1HFGA 1YIJA 1X65A 1HPCA 3K6OA 2QEXA 2OWOA 2NVTH 1VQ7A 1B50A 4ID6A 1S5DD 2L55A 3D4DA 4Y52H 2CW0D 4RHRA 3CCJA 3T1HL 5C0XI 5IOCA 1G2TA 4P71A 3UDFA 1EU4A 5KGUA 1R9TB 5L37A 2Q2IA 1PRTD 1MJCA 3R3OA 1BNZA 4KY7A 5I9PA 5KEEA 5E4XA 3D6WA 5AJ3Q 4B08A 2E2JB 3V05A 2C5CA 5EPKA 4G7HC 3MXUA 4X3UA 3FPPA 2VQEQ 2EYMA 4DU9A 4ZAIA 2VNUD 1PZID 4RHSA 1P16A 2R7DA 3I4LA 5GAEC 4BBSG 1K83H 2KECA 4IJLA 1LTTD 5JEAJ 1VQOA 4GZYC 1KLUD 5FLMG 2MJ8A 3MXGA 1PH8A 2Z6BA 1MGSA 1IL2A 1CFMA 3TS0A 1STEA 2BA0A 4A76A 4YY3Q 2B39A 4XTCS 1SLJA 5IIFA 1N34Q 4DUZQ 5ELOA 4LW1A 2HCCA 2VW9A 1E1TA 3JAMc 4NW2A 1I4HA 4DR1Q 4GNXC 4FF3A 3DEOA 2R7ZB 2KA7A 1NAPA 1WJJA 2D62A 2B8FA 3H09A 3RR5A 4P75A 4WJ3M 3VYTA 3HOUG 1GM5A 2EDGA 1L1OB 1EOTA 3CCUA 1KXLA 1YBYA 2JK8A 2CWPA 4JBMA 3T56B 2CFMA 3OWEB 4XQQA 4C3IB 1D1IA 2EQSA 3RNUA 2M9VA 2A73B 1I4XA 4JC0A 4BBRH 2PQEA 4IUUA 1PTOD 2YTXA 5LHY1 2UUAQ 4DR6L 4Y7NB 2BE5D 2FXQA 1ILQA 1SE3A 2CVRA 1GVPA 5C4ZA 4A3IB 1LTGD 4GOPB 1W2BA 3CC4A 4YWKA 3GTJH 2K5WA 2TMPA 2HD3A 5IYBG 1PH5A 2QILA 2WP8J 1K3BC 1YNND 2EYJA 1BBXC 1DD2A 1S5BD 1MKHA 2F0MA 1F2YA 1SAPA 3QOLA 3NXWA 4IFDH 1VQIA 3H0GB 1PYBA 1UUPA 4JI3Q 5E1FA 1N36Q 2R92H 1S72A 3S24A 3HOYG 5D14A 3CCEA 1HTPA 1WD0A 5ELCA 5GAGC 2V1CC 4CDDC 3KLWA 3FMCA 1EYGA 4CKBA 1RIPA 1X54A 2IY5B 4HJ7A 3I72A 3TS2A 1JMCA 3S1QB 2F4VL 2F0NA 1EIFA 3A54A 2PI2E 3R2TA 4ABNA 2F0PA 1NBWA 4DV0L 4J6HA 2Z9HA 3QG1A 3U50C 2J0TD 1FJGL 4IZ8A 1EOVA 2R93B 1UWVA 2HQLA 1ASYA 1G6PA 2L15A 3M4YA 1BO0A 5ELEA 3GTKH 2R61A 3K7UC 3CD6A 2JA7H 3D4WA 3I2ZA 2Y0SB 5T1IA 2Q2TA 5LMNW 3M7GA 5IWAQ 3GDEA 2IX3A 3NBHA 1S5FD 3OW2A 1QCBD 1HNWL 4JBJA 3MWYW 4KI0A 2XWJB 4NB3A 5C3EH 4X66Q 3I4MH 3FKIH 1K8AC 4R8IA 1D5ZC 3C1FA 1LT6D 4CJ1B 3JAMi 1GUGA 5A2QL 2JA6B 2AMCB 2NB0A 5JEAG 4RGOS 4X62L 1K28A 3ERSX 5KIXA 3J81i 3S16H 1FNUA 2AWNA 4KV6A 1VQGA 1SROA 4GKKQ 4E6IA 3K81C 2Z6KA 1E2ZA 2NVXH 3S14B 3Q23A 3CHBD 4LF5Q 2IT1A 1PZKD 1Q12A 4DV6Q 3CCSA 3MXNA 2JA8G 5M3FG 4FXGC 1GUSA 1SYBA 1JJGA 3T13A 2PMZE 1H9SA 5DM73 3BVGA 1U0LA 3M4OH 3SVMA 1PRTB 5CV8A 1NMFA 1LT4D 2RVLA 5IY0A 3L2PA 4KMUC 1B70B 2WFWA 2K50A 4JI4Q 3M7NA 2VL6A 4IUTA 5M9OA 2E2DC 3B6YA 2HIVA 1KAWA 3U9OA 4HJAA 3TBIB 1B9NA 4AQYQ 4A3DB 2YTYA 5JPMC 3J7AF 4A3KB 3K5OA 1TWAH 4IOAA 4MZ9A 2AQ3B 1HNXL 4HJ8A 4JI6L 4RMFA 4BA1I 1BOSA 1YNJC 1SE2A 3VYSA 1HFNA 1ZKOA 3G6JB 1JR0D 2XTIA 2FHTA 2OCEA 1P8LA 2QW7A 2NZ1D 3QIAA 1LM0A 1O7IA 2X69A 3C1EA 4QJFA 2VB3X 1XWEA 1SEBD 2WIIB 3DWQA 4LUOA 1ILPA 2YU9B 5D3IB 2KCMA 3S1NB 1WOCA 5CV7A 4H02A 1V9PA 2NWGA 1IBKL 3EBEA 5FO9B 4Q0FA 3M4QA 2K7VA 2XVSA 2FFKB 1B53A 5JPNC 2F0OA 2RSOA 1H95A 2RDGA 1DOLA 1I3QH 2MHVA 1WTVA 5I9OA 4DGZA 4KY6A 3HOZH 3K5NA 1YJ9A 1PFNA 3MXNB 5IYDG 1PFBA 4OXPA 4U673 2KEDA 3MXPA 2A6HC 1PTOB 5GQOA 1W3SA 3X3NA 4KN7C 1TT2A 4KHVA 5IGCA 4A3FH 1XMQQ 1S5CD 3VYUA 2HCIA 4N8X1 5J1ZA 1AFPA 3LNNA 1YITA 3CMEA 4GS3A 5TSSA 3NTKA 3D0FA 3MFYA 2UXDQ 2WV6D 4JYAL 4DV7Q 3A0JA 4OONA 1Q7YC 1TY2A 3CRLC 1SYEA 1WCMB 1ICFB 3A5ZB 1TKWB 4JI8L 2NUCA 1A3TA 4UDUC 3HOWH 4FXDA 1VQBA 4XXEA 3KK7A 2NVQH 5A35A 2O5JC 4PMWA 1EEFD 3V2TA 1H9MA 3TRZA 4O2DA 2PZUA 2A19A 1HR0Q 3S2HB 2ZT9C 1XJVA 3TZUA 2EYPA 4ODGA 1JE5A 3P1HA 5KYIA 5COYA 1EWCA 2ID0A 1C4QA 4C3HB 2B2TC 2F3IA 2E8GA 3BVZA 2VUMH 2AWOA 4A3EB 1KAAA 3GO5A 4HJ5A 2K03A 3CQZB 3J80L 1HJPA 1SNQA 2F0DA 4JI7L 5LMNQ 1CKMA 2B2VA 2FJ2A 3NP8A 5JJLA 3H3VI 1EZ8A 2HDMA 3MEFA 2I5LX 1WTXA 1M4VA 1M1KC 2CWAA 1NE3A 3J81E 3IRBA 2UU9Q 4N9TA 1KABA 4FDBA 2QCPX 1WTQA 1XPOA 5T1GA 2HHHL 1E1OA 3FHWA 4YWMA 1MD2D 3KBXA 2NN6H 1TWFB 4K2LA 2F4IA 3PO3H 1QJOA 4X3TA 3BS1A 2LXJA 4PZ8A 3OSOA 3M3YB 1UE6A 5LL6S 2ZM6Q 1QNUA 2ZTEA 2NTTA 3S1RH 1GOZA 1EY7A 1WYDA 4A3IG 3E6ZX 5EKKA 3I4NH 3N6RA 1Y1WH 4LMQD 4B3TL 5GROA 1SE8A 4FNFA 2Z0SA 1QUQA 1JOOA 1PFSA 3G48A 3RZOB 1JT8A 1YHQA 1M8AA 1SRUA 2E2HH 3PUWA 5IGFA 3MAQA 3NHHA 2ZTCA 3M9BA 3BZDB 3H0GG 1EIHA 3SK6A 2JJQA 2B63H 4DAYA 1LO5D 1IBMQ 4AIMA 1N8RC 3NPPA 2F0IA 1XYIA 2RA4A 3A56A 3OOCA 5HURA 2E2IH 3CXCA 5IP9G 4A93B 2LS01 2C9OA 3I7FA 4DR7L 3TP5A 4LFCQ 1ESRA 3LWEA 2IJ0A 3HKZE 1LABA 3VA7A 4OEMB 3SDZA 3PIO3 4WJ4A 3UE1A 5M5WH 4X64L 1E24A 5I2YA 1QG7A 4JI5Q 3A7LA 2RF4A 2IWHA 4DV2Q 4X65Q 5LMUL 4HIMA 1I50B 2V4DA 1AH9A 1UEAB 4CKEA 1K8OA 4RH6A 1IW7D 2B3GA 1SNCA 2B8GA 1SNPA 4IUVA 2KCCA 1HRJA 3C3LA 4AH6A 3WOFA 1E7ZA 1B4OA 1X3PA 2AQ2B 2Y0SG 1B3QA 3IAYA 4HMJA 2QKIC 2ZXOA 5BN3A 3UDGA 4OX9L 1PYWD 3DUZA 2DGYA 2HQEA 4A3CH 4DFAA 1HA6A 4OWWB 1EEID 3RMHA 2YTVA 1GUOA 4XYQA 4DV1Q 1XPRA 1EY4A 1TS3A 3FP9A 3NELA 4DV5L 2K33A 3A8IE 2JA6G 4A3GG 4H13C 4RFBA 4TVAB 5C0XH 3S15B 3E0JA 2FINB 4LFAQ 3SXHA 2NVTB 1Z47A 2WKDA 4JOIC 1Y8OB 3EN2A 4FF4A 3OTOL 2IPKD 3CCMA 2WB1B 1LTAD 1Q46A 5NUCA 5K36G 2RCFA 2PNRC 1PA6A 4I7ZC 2SNMA 4L8JA 1EIYB 1N32L 4DAYB 3CU7A 1SR3A 3VR2A 1LUZA 3K7AH 3OMCA 3T51B 5M3MH 4ZK9B 2PZTA 1F9RA 3MTSA 4QIWE 5C4HA 5C3XA 3K57A 1YI2A 1EY9A 3NUCA 2H5XA 2UUCQ 1KDCA 1CTMA 1STAA 3MC0B 2CQOA 4A3FG 4YHHL 3KLSA 4ZQ3A 3J7A5 1NR4A 2NBFA 1STHA 1BKBA 4LF8Q 1SYDA 3HG9A 2MNAA 5DM63 4ME3A 1D1KA 1J9OA 4K8IA 4A3DG 3D4RA 2KHIA 1TQOA 5JVH3 4A3KG 1HQMC 5EKIA 1EYCA 1N33L 2K6AA 5F2DA 4BXXG 1K3RA 1FD7D 2OTLA 3PF5A 4DAMA 2UUBQ 5C4XG 3Q22A 5IT9E 2A68C 2RDHA 3L0OA 4KK7A 1PZJD 3BVMA 1BVSA 1TVXA 5AJ3L 1L1OA 3M85A 2LSSA 4DXGA 2VQEL 3HRZC 4KY5A 5JJKA 1I6HH 1VQ9A 1JB3A 2FMCA 2KQ3A 3P75A 1W6JA 4BBRB 4UHVA 2LKVA 1DZ1A 3KF6B 4FXKC 4GLVB 4PQXA 1QE6A 1RTNA 1FL0A 5G3LD 4GOPA 5IE8A 4RG1A 4LF7Q 4YY3L 1SMYC 3GTJB 1AW7A 5FOBB 1N34L 2KHSA 5M5YH 3OYYA 4A4IA 4QB4A 1ENCA 4DUZL 2EIFA 1PVOA 5DAUA 4C3JH 2K04A 3A7AB 4APVA 1O78A 2NN6G 4WRDA 4XT3B 1QWYA 1EFWA 4DR1L 2A69C 1KDAA 2LFNA 4U68A 1KHIA 1RTOA 1X56A 1QILA 3E9HA 3EVQA 5JJIA 4NXMQ 4RGMA 4DK0A 2AUJD 2BH2A 2EE1A 2QF7A 1RODA 1Q1EA 1ONLA 1WCMG 2I5HA 1VQKA 3GTMB 4K8JA 1B3AA 4KJNA 1C7YA 3IKJA 1ZEQX 4A3LG 4KKSA 3KYHC 3ER0A 1C0AA 3TP7A 2G5DA 2EY5A 3RLFA 5FLXE 3J81c 1STGA 1Y8NB 4K5WA 1I4GA 1DM0B 2UUAL 3C46A 4RGTA 3GTLH 2B2WC 4DUYQ 1SNDA 2AUKA 3FEWX 3VDYA 1Y14B 3HGBA 2QDBA 4C3HG 3H3VC 3CAMA 2JA7B 4A3EG 1G8ZD 4DA2A 4GNXA 1I6VC 1ENFA 5CV5A 1SXTA 3F2CA 1SNOA 2GA4B 1VQAA 2IHEA 3QB3A 2DY7A 3DMUA 4LJZC 3UI2A 5IYCH 4JI1Q 1STNA 3F8TA 1Q1BA 2D0PA 1N36L 3FPUB 4QL5A 5C3EB 4IALA 2RQXA 3I4MB 3FKIB 3KDFB 4CDCC 1VQEA 5IP7G 1NJIC 2G9HD 1W6KA 1XTDA 3SK4A 4YCVA 1G2SA 4H44C 4G7OC 2X6LA 3S16B 4ZRZA 1U4PA 2QA4A 3R2IA 1GUWA 1A3UA 1VQDA 3P7JA 2NVXB 4B3SQ 2UXBQ 3SK5A 4K5VA 2BOSA 5CV4A 1ICWA 4IURA 1LYLA 3GP7A 3K0YA 3QWNA 4UP8A 3TP6A 5ELDA 4A3BH 4AYBG 3M4OB 3L3OC 2N3SA 4J1MA 2K01A 3J81j 2HUGA 1NNXA 5AFWA 4OO1G 4A3MH 1EZ6A 1SYFA 4WFN3 5IWAL 2XN9C 2WACA 3PUZA 4FP5D 2VQFQ 1ZYRC 1SYCA 1O7LA 1MSGA 1YNJD 3CCVA 2L12A 5C44H 2XWBB 4LF6Q 3ND9A 4X66L 1JC7A 1A3VA 1NCVA 3H94A 1NY4A 4I7AA 4DPGA 4EQPA 1S40A 5M3MG 2JSOA 4A93G 1CM9A 1FNWA 3KJOA 3STBC 3KBGA 4DR2Q 3H91A 1XNRQ 1QB5D 1JE4A 2CKZB 4GNXB 3T4AC 4C56C 1BCPC 4IN3A 2M00A 1D8LA 4ILWA 2K5DA 2NVYH 1LTRD 4NXNQ 1PLFA 3BZCA 4GKKL 2B2YA 2PYKA 4YCWA 2KVMA 1F2MA 4NMZA 5EPLA 4S3SA 2O4XA 3P20A 1PRTF 3W2DA 4DV6L 4IFDJ 1ENAA 5G3LF 4A3GB 1VMPA 1IYUA 4R4CA 4BY7H 2XNAC 4C3IH 2X6GA 1OXSC 4JBKA 1UE1A 3KLRA 5HGQA 1ASZA 2Z6KC 4GN4B 4R9WA 1ZXTA 4JI4L 1I3QB 4LF4Q 2A6HD 4PZ6A 5E7NA 1AEXA 1F9PA 5D65A 1HH2P 5C5LA 3HOZB 2UXCQ 4HIDA 2L9HA 4OIKA 1A8VA 1HNZQ 2WAQB 1STYA 4A3JH 1VQHA 4FVMA 1WTOA 1YEZA 5EKLA 4XYOA 2F0SA 1Y1VH 2F0EA 4A3FB 2ES2A 3I4OA 2ZJPA 2DY8A 3PO2H 4CJ2C 2OT2A 2BDOA 2WB1G 3A74A 5JVG3 1CK1A 3KF8B 4PZ7A 1EL0A 2TSSA 1QZHA 3F2BA 5DEHA 4IPCA 3HOWB 4FO2A 3S1QH 2FMMA 3NQTA 4OWTB 1K9MC 4C3JG 5IT9c 4F7XA 3GTOH 3HP3A 5C4XB 2L5TA 2L0CA 1SFOB 3PUVA 2NVQB 5EJWA 4B3RQ 2B2UA 2R93H 2ZXPA 1GJXA 2F3VA 4F8MA 2EYOA 1VQJA 3I73A 1PTOF 3TDQA 1MJEA 2F0FA 1FVIA 2F1MA 4Q5VA 1CHQD 5HGTA 2VUMB 2EY1A 2I07B 3PIP3 3BU2A 1E2WA 3D31A 4WORA 1WTHA 1PMRA 3H3VH 2EOTA 4HIKA 2A5HA 1CKOA 5CBEE 5BR8Q 4J8QA 4LUZA 1YJWA 4IPGA 4L6TB 3JAML 4PG3A 2KJXA 2KUMA 1RD9D 1XMQL 5CORA 3WDNA 3J80i 1Z9FA 1CHPD 3T53B 4DR4Q 3HOXH 4DV7L 5A2QE 1EFID 4JI0Q 4KLKA 3A55A 5IGBA 2F0JA 1HZCA 1IXRA 1PHJA 4N8FA 3J7ZC 3PO3B 1K8MA 3E5SA 3RLNA 4LFBQ 1C9OA 2ENBA 2I5MX 5C3WA 2QGQA 1VF5C 1H9KA 1A2TA 4BBRG 2JA5H 4B3MQ 4FYDA 1D5MC 4OELB 3IFTA 2YV5A 3S1RB 1HR0L 3HOVH 1GHJA 3AEVA 2IL8A 4TSSA 1LTID 1Y1WB 2AKWB 1PV4A 2K5VA 3K58A 4GN3B 5FO7B 1IKLA 2MGSA 1KD1C 2MFIA 1PH3A 2ZXRA 2R3ZA 1EU3A 2WKCA 2MP1A 3D8GA 4ME5A 2M2LA 1V1PB 1RCVD 2E2HB 4RAUC 1HUNA 1T5XD 1X32A 3GD7A 3OIQA 4IFDG 1I4PA 4HSVA 4A75A 1PH4A 1V1OA 1D5XC 1B7YB 4LAAA 2K75A 2R92G 1ET9A 1CQFA 2UU9L 2F0KA 1X9NA 4R4QA 2E2IB 4K6LA 3OMGA 5ELNA 1E0BA 3GTQH 4A3BG 1B2TA 3SGIA 2F0UA 2AHOB 2KHJA 2Y0SE 3SE0A 4IUPA 2K14A 3EJIA 1PDQA 2IHFA 4A3MG 4PMBA 5M5WB 1XX8A 2ZM6L 1JQYD 4JI8Q 3CC7A 2PPBC 2EXDA 3A8JE 3ZYYX 1OXVA 1EUJA 3AQQA 3TREA 4RKBA 3J7YW 4HJ9A 1A0IA 2B2TA 2ZTDA 2ICEC 1KRTA 4DN4M 1SDFA 4CGYB 5EBDA 2KBNA 2OXPA 1F2ZA 2JA7G 3Q24A 4OWXB 1RKNA 1KNEA 4UP7A 1Q81C 2EJMA 3AB9A 1HZAA 1LTSD 3DM1A 4DAVA 2JEAI 2K5NA 1LV9A 1OXXK 1I4QA 3BDOA 2PQAB 1X3EA 4DNTB 1IBML 4AYBB 5C3EG 1ESFA 3I4MG 2OF1A 1BDOA 3FKIG 4BBSH 4BWGB 2RSNA 3CKIB 1RDPD 3MA2B 4UP9A 5FLMH 1IBLQ 1ET6A 1V1QA 1G51A 2QEJC 2K4KA 4LFCL 3I56A 3BYYB 5ELBA 3RLOA 4CBVA 3AFQA 3PV0A 4HR7B 2CH4A 3O13A 2LY7A 2CCZA 1CKNB 2ZJRA 4F87A 4JI5L 4POFA 4V0BA 4K0KQ 3RZDH 4X65L 1NTGA 2O5IC 1AP0A 1NSNS 4IJHA 3K7AB 1LTBD 5M3MB 4TRDA 5DLQE 1Z7TA 1GO3E 1H9RA 1PH2A 1TR5A 4B9WA 3KFUA 1TWHH 3DWPA 1KTKA 1VCIA 1TU2B 3TP8A 2E5LQ 1XNQQ 3LWUA 2K1BA 1Y1VG 3HOUH 2CH4W 2O2LD 1JOKA 4DV4Q 3PO2G 1B9MA 3EFXD 4JI2Q 2RDFA 1VQ8A 4DV1L 1TWGH 1X3GA 4L5QA 5M5XB 3CQZH 3J80E 4B9XA 2D0OA 2A68D 1MHWC 4GKJQ 4OIJA 4G57A 4NKLA 1V43A 2RKSA 3MHBA 1EIGA 3CP0A 3U4ZA 4IQZA 4QY7A 1SNMA 4LFAL 4DNRB 3QO2A 1VQ4A 1TS4A 3TN2A 3C2PA 2F52A 1WTPA 1K0SA 2JP1A 2XGTA 1TWCH 1I94Q 1QVFA 4HCSA 1CZGA 4DNIA 3E3XA 2LXKA 4QUCA 2AQ1B 5I2XA 4DR7Q 5C4JB 1YJNA 3A5UA 3CCQA 4DV3L 1F2LA 1PH9A 4HAEA 5CBAE 1I6HB 3OWFA 1T9HA 3NWTA 2R7FA 1WVLA 1SMYD 2XIWA 4ZKCB 3HOYH 2PW5A 3I55A 2UUCL 4IPDA 3KF6A 4HSPA 3S2DH 3X3MA 3K8AA 3U4VA 2ZJQA 4LF8L 1IYJB 1OTCA 2F0TA 3HOZG 1HZBA 2I46A 2ATWA 3NBIA 4QF4A 3G71A 1DCZA 2WAQG 5IGEA 4DR3L 1EQTA 1U4RA 2KCTA 4C3JB 3JC66 4DAPA 1XMOQ 4PNYA 4LF9Q 1DOMA 4JOIA 3I90A 1K83B 1L0XB 4HIOA 2L4NA 2N49A 2UUBL 3GV3A 1BUVT 3EIVA 5C6AA 4KD3A 5J39A 1DOKA 2DNEA 5CMDA 1EYDA 2JE6I 3LX0A 1OO9B 1AZPA 3GTPH 1O80A 3TEHB 4GN5A 2EVBA 1A15A 2EJFC 2K32A 3HOWG 3W1BA 3NENA 3DEPA 4KHPQ 2OTJA 1Y69U 2PZWA 3Q8DA 4JV5Q 5C0XJ 3PSIA 4X3SA 5I6WA 2IX0A 4LNQA 3EQLC 3GTLB 1Y8PB 3GTGH 3VR6A 1KDBA 5JEAH 3IL8A 4LF7L 2Z8LA 2MO0A 1SMXA 4LK1C 4ZLTF 1TY0A 4DR5Q 1B1ZA 1HA5A 4R8NA 1YHBA 3FDTA 2VUMG 4FF1A 3ICEA 3K59A 3HKZG 1QVGA 2NZOA 2N8NA 2GVBA 4YHHQ 2BA1A 4OL7A 3UE0A 2F0HA 3I70A 2JA8H 5M3FH 1VMCA 1E22A 4NXML 3NSWA 2DJGC 2VY3A 3KDFA 1WI5A 4L5SA 3S17H 1J5EQ 4AYBE 4RCNA 4RCOA 3T1YQ 5KYLA 3S1MH 1V8QA 1Q8IA 1GD7A 4BY1H 1WFQA 3K0XA 1O7YA 3PMFA 3PO3G 4OO1I 2KENA 5CYUA 4UPAA 4BA2I 1I5FA 1CA6A 4K5XA 2R92B 4XDXA 2XRSD 3DWAA 2PMZB 2Z1CA 1J8IA 2PCFB 4DUYL 3BJUA 5KNCA 4A3BB 3AYHB 1NUCA 3I4NG 4C1NI 1Y1WG 1ZYRD 3T1HQ 4PMCA 3BZKA 1PXUA 3SR1A 1JJCB 3I3CA 3R93A 3G4SA 1J6QA 4A3MB 4G7ZC 3BDLA 5E4WC 1L0YB 1A2UA 2SNSA 1Q8KA 2A6EC 2BH8A 1QNKA 4KKTA 4JI1L 3STBD 4DKAC 3A8KE 1F9SA 3CCRA 5C44B 1B8AA 1UEBA 4CJ0B 1BR9A 2B63G 4C2MH 1BCPD 3GTKB 4O0AA 1VQFA 4L5TA 1SYGA 3ULLA 1U4LA 2C35B 1WTWA 3MVVA 3PIOA 5CV9A 1EQQA 2A74C 3PQIA 4X3KA 3VA5A 2NVYB 5IYDH 3CW2C 3DHQA 1GKHA 4MTKA 4JI3L 2B2WA 4B3SL 2UXBL 5CV6A 2A1AA 3F2DA 2EPBA 4P2CB 4YWLA 4BY7B 1EY6A 2N88A 1PFMA 1H9JA 4EQOA 1F77A 2K05A 4Z9CB 1DJRD 1R9TH 1IYVA 3K5MA 2SEBD 4TKOB 1AZQA 1CI3M 3CF5A 1BF4A 4KKUA 3ULJA 2E2JH 2WB1E 4UAIA 2VQFL 2CW0C 2MQHA 1SSOA 4A3CG 3VR4A 1IKMA 3HZXA 4LF6L 1PRTC 3F1ZA 3ITPA 1Q90A 4P74A 4A3JB 1LT5D 1A6XA 1RHPA 2IW3A 1II3A 4MIUA 3G6EA 5C0XG 2WINB 4V190 4DR2L 2I0QA 4DR6Q 1TS5A 1XNRL 1Y1VB 5I6YA 2EY6A 4XIGS 4H0LC 5GAHC 4JW0A 1FNVA 3PO2B 3SK8A 4NXNL 3NQIA 2DN8A 1CSQA 3J80c 3KF8A 4GLAC 2PW7A 3GTMH 1GHKA 4R4OA 4NDXA 3OW7A 1TWAB 1LLRD 2DUDA 2JEBI 4JCVE 2OQKA 4R4TA 3WWVA 5CC4A 4J15A 2R7ZH 1KL9A 3RN5A 3GTOB 4JPBW 2YYZA 1K0RA 1A63A 1HR0W 2B2YC 4HN7A 3L7ZC 2MO1A 4MN3A 3W1GA 4LF4L 3PF4A 5JAVA 2A8VA 4LF5L 2BDNA 3RD4A 3ZJYC 2UXCL 4JG2A 4DK3C 1ML0D 4OGQC 1BQQT 5IGGA 3CCLA 2F03A 1HNZL 4POGA 2F4VQ 2J4XA 5DNFA 4ZUIA 2JYOA 3URYA 2EYFA 1STBA 2EXZA 3NE5B 1LTLA 2NYZD 4DV0Q 3CRKC 2K28A 4Y7NH 1FJGQ 3NK9A 1LT3D 4A3IH 1BBUA 2G9DA 3AU7A 2F0WA 3NTHA 1PTOC 3ERQA 2QDLA 2Q2UA 3HOXB 4H7BA 4AQYL 4MNOA 2BE5C 4N9PA 1DYQA 1JWSD 1DGSA 4KJOA 1G91A 4G4KA 1WD1A 1MBYA 3TZDA 4UY8C 1HNWQ 2KEEA 3BG3A 3H0GH 1CUKA 1KLGD 1AE2A 4M1UB 4LWCA 4B3RL 3AFPA 5BN5A 1YNNC 1HQRD 4IFDI 2JA5B 2D2CC 4WJWA 1R4QB 1HZ9A 5IP9H 3HOVB 4R4IA 1VQMA 2N55A 3Q6SA 1LACA 3KJPA 1JORA 2RCNA 4KN4C 4HMIA 4X62Q 4K6DA 2EYLA 2XSCA 1IHZA 4K14A 1BCPF 4QCLA 3CPWA 2Q2HA 4QUFA 1V1PA 3N52A 4ZKBB 1K73C 1E2VA 2B2UC 4BY1G 5BR8L 1G6ZA 2K5QA 2NZHA 5GADC 1B44D 5JJZA 3VR3A 1YNXA 4LUVA 3PCOB 1EY0A 2VS1A 4P72A 4DR4L 3BDCA 4JI0L 1DONA 1KC8C 4IOCA 1WTRA 3IFDA 3DLLA 2K5HA 4HCEA 4HTHA 3HKZB 1Q86C 3GTQB 3EROA 3QJYA 4EQNA 2SOBA 3NTIA 3HEJA 4R1JA 1QZGA 2L1BA 3NBHB 4LFBL 4JVZA 1QVCA 4ZUJA 1JJ2A 4NP5A 1FYCA 1BCPB 2H1EA 3CPFA 4OHJA 4L63B 4B3ML 4CDFC 1AN8A 3J81L 2UXDL 3VR5A 2JA6H 4A3GH 1HNXQ 4TQUS 3EA6A 5D3DA 4JI6Q 3NEMA 3QOJA 2NTSA 4HEDA 1HXYD 1JOQA 2Z4IA 2F0VA 3FRPB 3ONAB 3MEHA 4O42A 4NPSA 2F0LA 1SN8A 2B29A 5K36H 1X3FA 1OXUA 1Q82C 5EQ0A 3S14H 3HFZB 1VQ5A 4ULLA 1NMGA 2CQAA 1EQVA 2PQAA 5IYCG 1G291 3PUYA 2D5DA 2E74C 4EGVA 1IBKQ 2EYHA 1KRSA 1H9SB 4DK1A 3I4NB 1JB7A 4BBSB 2KCNA 1BXTA 2PO4A 1GXDC 4IUNA 1CZWA 5FLXc 3VYRA 4MHEA 1T5EA 1IL8A 1BBWA 4CHTB 1L2FA 4JK1C 3W3AA 5LMNL 3G7LA 1CKNA 5ISRA 4ALPA 1N9WA 1SE4A 4K2KA 3U58A 4A3DH 4C1NK 3KLSX 1CA5A 4A3KH 2B63B 3RZDB 3PGZA 5FKAC 2RHQB 4BXXH 1HHVA 3BYTB 1D7QA 4QIWB 3W5OA 1VF7A 1AE3A 2R6GA 5C4XH 1OXTA 1SFOH 3D6CA 2B2VC 1SJED 1TWHB 3T16A 1VQPA
chains in the Genus database with same CATH topology
1NR2A 2IX1A 1S4ZA 3HOUB 2EJGC 1I4RA 5ELFA 5IGDA 1SJHD 1TWGB 1SBBB 2CHBD 3OHXC 1FR3A 3WOEA 3JAME 1EYAA 2RBMA 3SHLA 4XT1B 1VDZA 5CGKA 2H4OA 3L9AX 3GV6A 3PUXA 3RUZA 1XTCD 4ZYSA 4KTAA 1MSHA 1TWCB 4IUQA 3AMUA 2XRQD 2EY2A 3D3RA 1PTOH 3FVQA 3TMEA 2VB2X 4O1NA 4C3IG 1EWHA 4DF7A 5I4DA 4RKLA 5JOBA 2Q8RE 3I91A 3OIPA 1UAPA 3HOYB 2Q8TA 3U9SA 2D9UA 2EZVA 3I8ZA 3S2DB 2MPMA 4KD4A 5C5MA 3F2UA 2L11A 1JWMD 4RWSC 2KOLA 3MZ5A 1UNSA 3TSSA 1CQVA 2DNCA 4EVOA 1XXGA 4FF2A 2LMCB 4I65A 1RJTA 3HS0C 4PV1C 3GTPB 3KUPA 1U4MA 1HUMA 1D2BA 4BS9A 1MI2A 1GUTA 2Z4HA 5IT9L 3DXJC 1C8CA 3R8BA 5K5PA 1R4PB 1S5ED 3H6MA 3GTGB 3GQBA 3NWSA 5LL6X 2F3WA 2NN6I 3J7AV 3K5LA 1X3QA 2E76C 2BCOA 2JA8B 5M3FB 3OPOA 1EY5A 4YIJA 3ND8A 1D6EC 5J22A 1HCZA 3SEBA 2SDFA 2A69D 2OEOA 3S17B 1F9QA 5M5YB 4KHZA 4OO1H 1HTLD 3S1MB 4RA8A 3Q0AA 4XQJA 1TS2A 4RGNA 4BY1B 5KNDA 2F0GA 5E3FA 4XQNA 2J7ZA 2E75C 1C48A 5KNBA 1JCKB 1Q3LA 1CT1D 1JWUD 5KRUA 2MUYA 1GUNA 2A6ED 2ICIA 5FO8B 1FGBD 1EY8A 1QOHA 2HDLA 5FLXL 4JBWA 5EPJA 1TIID 4F88A 3V96A 4M8AA 5CR3A 3S9WA 4C2MB 2Q8IB 2F0QA 4QMGA 2JXMB 3MFGA 1RF2D 2VXWA 4DXFA 1IW7C 1DXMA 5IODA 4CKCA 1O7ZA 5FK9C 1U9RA 1KNAA 5EGTA 1JICA 5BN4A 1Z6HA 5EBCA 1HFGA 1HPCA 3K6OA 1B50A 4ID6A 1S5DD 2L55A 3D4DA 2CW0D 4RHRA 5C0XI 5IOCA 1G2TA 1EU4A 5KGUA 1R9TB 1PRTD 3R3OA 1BNZA 4KY7A 5I9PA 5KEEA 5E4XA 3D6WA 4B08A 2E2JB 3V05A 2C5CA 5EPKA 4G7HC 3MXUA 4X3UA 3FPPA 2EYMA 4DU9A 4ZAIA 2VNUD 1PZID 4RHSA 3I4LA 2KECA 4GZYC 1LTTD 5JEAJ 1KLUD 2MJ8A 3MXGA 1MGSA 1CFMA 1STEA 2BA0A 2B39A 4XTCS 5IIFA 2HCCA 4NW2A 1I4HA 4FF3A 3DEOA 2R7ZB 2KA7A 1NAPA 2D62A 2B8FA 3H09A 3VYTA 2EDGA 1EOTA 3T56B 3OWEB 4XQQA 4C3IB 1D1IA 2M9VA 2A73B 1I4XA 2PQEA 4IUUA 1PTOD 5LHY1 4Y7NB 2BE5D 1ILQA 1SE3A 2CVRA 5C4ZA 4A3IB 1LTGD 2K5WA 2TMPA 2QILA 2WP8J 1YNND 2EYJA 1BBXC 1DD2A 1S5BD 2F0MA 1F2YA 1SAPA 3QOLA 3NXWA 4IFDH 3H0GB 1UUPA 5E1FA 5D14A 1HTPA 1WD0A 5ELCA 3FMCA 4CKBA 3I72A 3S1QB 2F0NA 3R2TA 3A54A 4ABNA 2F0PA 4J6HA 3QG1A 2J0TD 4IZ8A 2R93B 3M4YA 1BO0A 5ELEA 2R61A 3D4WA 2Y0SB 5T1IA 3M7GA 2IX3A 3NBHA 1S5FD 1QCBD 3MWYW 4KI0A 2XWJB 4R8IA 1D5ZC 3C1FA 1LT6D 4CJ1B 2JA6B 1GUGA 5A2QL 2NB0A 5JEAG 4RGOS 5KIXA 1FNUA 2AWNA 4KV6A 4E6IA 1E2ZA 3S14B 3Q23A 3CHBD 2IT1A 1PZKD 1Q12A 3MXNA 4FXGC 1GUSA 1SYBA 3T13A 1H9SA 5DM73 3BVGA 3SVMA 1PRTB 5CV8A 1LT4D 2RVLA 4KMUC 3M7NA 4IUTA 5M9OA 2E2DC 3U9OA 3TBIB 1B9NA 4A3DB 5JPMC 3J7AF 4A3KB 3K5OA 2AQ3B 4BA1I 1BOSA 1YNJC 1SE2A 3VYSA 1HFNA 1ZKOA 3G6JB 1JR0D 2FHTA 2NZ1D 3QIAA 2X69A 3C1EA 2VB3X 1XWEA 1SEBD 2WIIB 3DWQA 1ILPA 2YU9B 5D3IB 3S1NB 5CV7A 2NWGA 5FO9B 4Q0FA 2K7VA 2XVSA 2FFKB 1B53A 5JPNC 2F0OA 2RSOA 2RDGA 1DOLA 2MHVA 1WTVA 5I9OA 4DGZA 4KY6A 3K5NA 1PFNA 1PFBA 4U673 2KEDA 3MXPA 2A6HC 1PTOB 3X3NA 4KN7C 1TT2A 4KHVA 5IGCA 1S5CD 3VYUA 2HCIA 5J1ZA 1AFPA 3LNNA 5TSSA 3NTKA 3MFYA 2WV6D 1TY2A 3CRLC 1SYEA 1WCMB 1TKWB 2NUCA 1A3TA 4UDUC 4FXDA 4XXEA 3KK7A 5A35A 2O5JC 4PMWA 1EEFD 3V2TA 1H9MA 2PZUA 3S2HB 2ZT9C 3TZUA 2EYPA 4ODGA 3P1HA 5KYIA 5COYA 1EWCA 2ID0A 1C4QA 4C3HB 2B2TC 3BVZA 2AWOA 4A3EB 1KAAA 3GO5A 2K03A 3CQZB 3J80L 1SNQA 2F0DA 2B2VA 2FJ2A 3NP8A 1EZ8A 2HDMA 1WTXA 1M4VA 3J81E 4N9TA 1KABA 2QCPX 1WTQA 5T1GA 1MD2D 3KBXA 2NN6H 1TWFB 4K2LA 2F4IA 1QJOA 4X3TA 3BS1A 3OSOA 3M3YB 5LL6S 1QNUA 2NTTA 1GOZA 1EY7A 3E6ZX 5EKKA 3N6RA 4LMQD 4FNFA 1JOOA 3RZOB 1M8AA 3PUWA 5IGFA 3MAQA 3NHHA 3BZDB 1EIHA 3SK6A 4DAYA 1LO5D 3NPPA 2F0IA 1XYIA 2RA4A 3A56A 3OOCA 5HURA 4A93B 2LS01 2C9OA 3TP5A 1ESRA 3LWEA 2IJ0A 1LABA 3VA7A 3SDZA 3PIO3 5I2YA 1QG7A 3A7LA 2IWHA 1I50B 2V4DA 1UEAB 4CKEA 1K8OA 4RH6A 1IW7D 2B8GA 1SNCA 1SNPA 4IUVA 2KCCA 1HRJA 3C3LA 3WOFA 1X3PA 1B4OA 2AQ2B 3IAYA 4HMJA 2QKIC 2ZXOA 5BN3A 1PYWD 3DUZA 2HQEA 4DFAA 1HA6A 1EEID 3RMHA 1GUOA 4XYQA 1EY4A 1TS3A 2K33A 3A8IE 4H13C 4RFBA 3S15B 5C0XH 3E0JA 2FINB 3SXHA 2NVTB 1Z47A 2WKDA 1Y8OB 4FF4A 2IPKD 2WB1B 1LTAD 5K36G 5NUCA 2PNRC 4I7ZC 2SNMA 4L8JA 3CU7A 3VR2A 3OMCA 3T51B 4ZK9B 2PZTA 1F9RA 3MTSA 5C3XA 5C4HA 3K57A 1EY9A 3NUCA 1KDCA 1CTMA 1STAA 3MC0B 3KLSA 4ZQ3A 1NR4A 2NBFA 1STHA 1SYDA 3HG9A 5DM63 1D1KA 1J9OA 4K8IA 3D4RA 1TQOA 5JVH3 1HQMC 5EKIA 1EYCA 2K6AA 5F2DA 1FD7D 3Q22A 5IT9E 2A68C 2RDHA 4KK7A 1PZJD 3BVMA 1TVXA 3M85A 4DXGA 3HRZC 4KY5A 1JB3A 2FMCA 2KQ3A 3P75A 1W6JA 4BBRB 2LKVA 1DZ1A 4FXKC 4PQXA 1QE6A 1RTNA 5G3LD 1SMYC 3GTJB 1AW7A 5FOBB 2KHSA 4QB4A 1ENCA 5DAUA 2K04A 3A7AB 1O78A 2NN6G 4WRDA 4XT3B 1QWYA 2A69C 1KDAA 2LFNA 4U68A 1RTOA 1QILA 3EVQA 4RGMA 4DK0A 2AUJD 2EE1A 2QF7A 1RODA 1Q1EA 1ONLA 3GTMB 4K8JA 1B3AA 4KJNA 3IKJA 1ZEQX 4KKSA 3TP7A 3RLFA 2EY5A 5FLXE 1STGA 1Y8NB 4K5WA 1I4GA 1DM0B 3C46A 4RGTA 2B2WC 1SNDA 2AUKA 3FEWX 3HGBA 2QDBA 4C3HG 3H3VC 2JA7B 1G8ZD 4DA2A 1I6VC 1ENFA 5CV5A 1SXTA 1SNOA 2GA4B 3QB3A 2DY7A 3DMUA 4LJZC 3UI2A 1STNA 1Q1BA 3FPUB 5C3EB 4IALA 2RQXA 3I4MB 3FKIB 2G9HD 1W6KA 3SK4A 1G2SA 4H44C 4G7OC 2X6LA 3S16B 4ZRZA 1U4PA 1GUWA 3R2IA 1A3UA 3P7JA 2NVXB 3SK5A 4K5VA 2BOSA 5CV4A 1ICWA 4IURA 3GP7A 3K0YA 3QWNA 3TP6A 5ELDA 3M4OB 3L3OC 4J1MA 2K01A 2HUGA 5AFWA 4OO1G 1EZ6A 1SYFA 4WFN3 2XN9C 2WACA 3PUZA 4FP5D 1ZYRC 1SYCA 1O7LA 1MSGA 1YNJD 2L12A 2XWBB 3ND9A 1JC7A 1A3VA 1NCVA 3H94A 4EQPA 2JSOA 1CM9A 1FNWA 3KBGA 3H91A 1QB5D 1JE4A 3T4AC 4C56C 1BCPC 4IN3A 2M00A 4ILWA 2K5DA 1LTRD 1PLFA 2B2YA 2PYKA 2KVMA 1F2MA 4NMZA 5EPLA 4S3SA 2O4XA 3P20A 1PRTF 3W2DA 4IFDJ 1ENAA 5G3LF 4A3GB 1VMPA 1IYUA 2XNAC 2X6GA 1OXSC 3KLRA 4R9WA 1ZXTA 1I3QB 2A6HD 1AEXA 1F9PA 5D65A 5C5LA 3HOZB 2L9HA 4OIKA 2WAQB 1STYA 4FVMA 1WTOA 5EKLA 4XYOA 2F0SA 2F0EA 4A3FB 2DY8A 4CJ2C 2OT2A 2BDOA 5JVG3 1CK1A 1EL0A 2TSSA 5DEHA 3HOWB 4FO2A 2FMMA 3NQTA 4C3JG 4F7XA 3HP3A 5C4XB 2L5TA 2L0CA 1SFOB 3PUVA 2NVQB 5EJWA 2B2UA 2ZXPA 1GJXA 2F3VA 4F8MA 2EYOA 3I73A 1PTOF 3TDQA 2F0FA 2F1MA 4Q5VA 1CHQD 5HGTA 2VUMB 2EY1A 2I07B 3PIP3 1E2WA 3D31A 4WORA 1PMRA 2EOTA 2A5HA 5CBEE 4J8QA 4L6TB 3JAML 2KJXA 2KUMA 1RD9D 5CORA 3WDNA 1CHPD 3T53B 5A2QE 1EFID 3A55A 5IGBA 2F0JA 3PO3B 1K8MA 3E5SA 2ENBA 5C3WA 1VF5C 1H9KA 1A2TA 4FYDA 1D5MC 3IFTA 3S1RB 1GHJA 2IL8A 4TSSA 1LTID 1Y1WB 3K58A 5FO7B 1IKLA 2MGSA 2ZXRA 2R3ZA 1EU3A 2WKCA 2MP1A 3D8GA 4ME5A 2M2LA 1V1PB 1RCVD 2E2HB 4RAUC 1HUNA 1T5XD 1X32A 3GD7A 3OIQA 4IFDG 1I4PA 4HSVA 1V1OA 1D5XC 4LAAA 1ET9A 1CQFA 2F0KA 2E2IB 4K6LA 3OMGA 1E0BA 1B2TA 2F0UA 3SE0A 4IUPA 3EJIA 1PDQA 4PMBA 5M5WB 1XX8A 1JQYD 2PPBC 3A8JE 3ZYYX 1OXVA 4RKBA 3J7YW 2B2TA 2ICEC 4DN4M 1SDFA 4CGYB 5EBDA 2OXPA 1F2ZA 3Q24A 1RKNA 1KNEA 2EJMA 3AB9A 1LTSD 3DM1A 4DAVA 2JEAI 1LV9A 1OXXK 1I4QA 3BDOA 4DNTB 4AYBB 1ESFA 2OF1A 1BDOA 4BWGB 2RSNA 3CKIB 1RDPD 3MA2B 1ET6A 2QEJC 3BYYB 5ELBA 4CBVA 3PV0A 4HR7B 3O13A 2LY7A 4F87A 4V0BA 2O5IC 1AP0A 1NSNS 3K7AB 1LTBD 5M3MB 4TRDA 1Z7TA 1H9RA 1TR5A 4B9WA 3DWPA 1KTKA 1VCIA 1TU2B 3TP8A 3LWUA 2K1BA 2O2LD 1JOKA 1B9MA 3EFXD 2RDFA 5M5XB 3J80E 4B9XA 2A68D 4OIJA 4G57A 4NKLA 1V43A 2RKSA 3MHBA 1EIGA 4IQZA 1SNMA 4DNRB 3QO2A 1TS4A 3TN2A 3C2PA 1WTPA 2JP1A 4HCSA 1CZGA 5I2XA 4QUCA 2AQ1B 5C4JB 1F2LA 4HAEA 5CBAE 1I6HB 3OWFA 3NWTA 1WVLA 1SMYD 2XIWA 4ZKCB 2PW5A 4HSPA 3X3MA 2F0TA 2I46A 3NBIA 4QF4A 1DCZA 5IGEA 1EQTA 1U4RA 4C3JB 4DAPA 4PNYA 1DOMA 3I90A 1K83B 1L0XB 2L4NA 3GV3A 1BUVT 5C6AA 4KD3A 5J39A 1DOKA 2DNEA 5CMDA 1EYDA 2JE6I 3LX0A 1OO9B 1AZPA 1O80A 2EVBA 1A15A 2EJFC 2K32A 3DEPA 1Y69U 2PZWA 5C0XJ 4X3SA 5I6WA 2IX0A 3EQLC 3GTLB 1Y8PB 3VR6A 1KDBA 5JEAH 3IL8A 2Z8LA 4LK1C 4ZLTF 1TY0A 1B1ZA 1HA5A 4R8NA 3FDTA 4FF1A 3K59A 2BA1A 4OL7A 2F0HA 3I70A 1VMCA 3NSWA 4RCNA 4RCOA 5KYLA 1V8QA 1Q8IA 1O7YA 3PMFA 4OO1I 5CYUA 4BA2I 1CA6A 4K5XA 2R92B 4XDXA 2XRSD 3DWAA 2PMZB 2Z1CA 1J8IA 2PCFB 5KNCA 4A3BB 1NUCA 4C1NI 1ZYRD 4PMCA 1PXUA 3SR1A 3I3CA 3R93A 4A3MB 4G7ZC 3BDLA 5E4WC 1L0YB 1A2UA 2SNSA 2A6EC 1QNKA 4KKTA 3A8KE 1F9SA 5C44B 4CJ0B 1BR9A 1BCPD 3GTKB 1SYGA 1U4LA 1WTWA 3MVVA 5CV9A 2A74C 4X3KA 3VA5A 2NVYB 3DHQA 2B2WA 5CV6A 2EPBA 4P2CB 4BY7B 1EY6A 2N88A 1PFMA 1H9JA 4EQOA 1F77A 2K05A 4Z9CB 1DJRD 1IYVA 3K5MA 2SEBD 4TKOB 1AZQA 1CI3M 1BF4A 4KKUA 4UAIA 2CW0C 1SSOA 3VR4A 1IKMA 3HZXA 1PRTC 3ITPA 1Q90A 4A3JB 1LT5D 1A6XA 1RHPA 2IW3A 1II3A 4MIUA 5C0XG 2WINB 4V190 1TS5A 1Y1VB 5I6YA 2EY6A 4XIGS 4H0LC 1FNVA 3PO2B 3SK8A 3NQIA 2DN8A 3KF8A 2PW7A 1GHKA 4NDXA 3OW7A 1TWAB 1LLRD 2JEBI 5CC4A 3GTOB 2YYZA 2B2YC 4HN7A 3L7ZC 4MN3A 5JAVA 2BDNA 3RD4A 1ML0D 4OGQC 1BQQT 5IGGA 2F03A 2J4XA 5DNFA 4ZUIA 2JYOA 3URYA 2EYFA 1STBA 2EXZA 3NE5B 2NYZD 3CRKC 2K28A 3NK9A 1LT3D 2G9DA 3AU7A 2F0WA 3NTHA 1PTOC 3ERQA 3HOXB 4H7BA 2BE5C 4N9PA 1DYQA 1JWSD 4KJOA 1G91A 4G4KA 1WD1A 1MBYA 3TZDA 2KEEA 3BG3A 1KLGD 4M1UB 5BN5A 1YNNC 1HQRD 4IFDI 2JA5B 2D2CC 4WJWA 1R4QB 3HOVB 2N55A 3Q6SA 1LACA 1JORA 4KN4C 4HMIA 4K6DA 2EYLA 2XSCA 1IHZA 4K14A 1BCPF 4QCLA 4QUFA 1V1PA 3N52A 4ZKBB 1E2VA 2B2UC 1G6ZA 2K5QA 1B44D 5JJZA 3VR3A 1EY0A 3BDCA 1DONA 1WTRA 3IFDA 4HCEA 4HTHA 3HKZB 3GTQB 3EROA 3QJYA 4EQNA 2SOBA 3NTIA 3HEJA 2L1BA 4ZUJA 4NP5A 1FYCA 1BCPB 2H1EA 4OHJA 4L63B 1AN8A 3J81L 3VR5A 4TQUS 3EA6A 5D3DA 3QOJA 2NTSA 4HEDA 1HXYD 1JOQA 2Z4IA 2F0VA 3FRPB 3ONAB 3MEHA 4O42A 2F0LA 5K36H 1OXUA 5EQ0A 4ULLA 2CQAA 1EQVA 1G291 3PUYA 2D5DA 2E74C 4EGVA 2EYHA 3I4NB 1H9SB 4DK1A 4BBSB 2KCNA 1BXTA 2PO4A 1GXDC 4IUNA 1CZWA 3VYRA 4MHEA 1T5EA 1IL8A 4CHTB 4JK1C 3W3AA 3G7LA 5ISRA 1SE4A 4K2KA 4C1NK 3KLSX 1CA5A 2B63B 3RZDB 5FKAC 1HHVA 3BYTB 4QIWB 1VF7A 2R6GA 1OXTA 3D6CA 2B2VC 1SJED 1TWHB 3T16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8N B;  1CTM A;  3AB9 A;  3LNN A;  1E2Z A;  4BA2 I;  2BE5 D;  3WDN A;  1GUT A;  4XIG S;  2JEA I;  4H0L C;  3DXJ C;  3MFY A;  2EJG C;  2IT1 A;  1Q12 A;  3VR3 A;  1OXX K;  3T53 B;  3P20 A;  2DN8 A;  3CRL C;  3BDO A;  1GUS A;  1TKW B;  2AUK A;  3OOC A;  4DNT B;  1GHK A;  2PCF B;  3OW7 A;  3D4R A;  5BN4 A;  1H9S A;  1Z6H A;  1IYU A;  1BDO A;  3HGB A;  1HQM C;  3GQB A;  5KNC A;  1DCZ A;  2JEB I;  1HPC A;  1OXS C;  1DD2 A;  4KMU C;  3QJY A;  1K8M A;  1FR3 A;  1I6V C;  1LAB A;  2NN6 I;  3VA7 A;  3KLR A;  3SDZ A;  3M7N A;  5A35 A;  2YYZ A;  2O5J C;  4IFD H;  1H9M A;  3L7Z C;  4G7Z C;  2A68 C;  3PV0 A;  1VF5 C;  1VDZ A;  1H9K A;  4HR7 B;  4LJZ C;  1FYC A;  2A6H D;  2E76 C;  3A7L A;  3PUX A;  1Q1B A;  2A6E C;  2ZT9 C;  3OPO A;  3TZU A;  1B9N A;  3IFT A;  1HTP A;  4KKT A;  1GHJ A;  3ND8 A;  2V4D A;  3A8K E;  3MXU A;  2DNE A;  1HCZ A;  3VR5 A;  3FMC A;  4G7H C;  3M85 A;  2O5I C;  1K8O A;  4TQU S;  2JE6 I;  2A69 D;  3FPP A;  4OGQ C;  1IW7 D;  2B8G A;  2AWO A;  4BA1 I;  2KCC A;  1Z7T A;  2EVB A;  1YNJ C;  3I72 A;  4KHZ A;  4OO1 H;  1ZKO A;  1H9R A;  2EJF C;  3I4L A;  2K32 A;  4H44 C;  4G7O C;  4GZY C;  1EWH A;  5BN3 A;  3NE5 B;  3QIA A;  1VCI A;  5K36 H;  1TU2 B;  1Y69 U;  5KND A;  1OXU A;  3CRK C;  3LWU A;  3GD7 A;  3QG1 A;  1CFM A;  4IFD G;  2BDO A;  3U9S A;  2BA0 A;  3EQL C;  4XTC S;  1GUO A;  1Y8P B;  1G29 1;  2E75 C;  3M4Y A;  3VR6 A;  1B9M A;  5JEA H;  5KNB A;  1SMY C;  3PUY A;  2D5D A;  2E74 C;  2BE5 C;  4LK1 C;  1H9S B;  4DK1 A;  2A68 D;  2K33 A;  2NN6 H;  3A8I E;  4H13 C;  5C0X H;  3A7A B;  1V43 A;  2K7V A;  1GUN A;  1O78 A;  1QJO A;  2A6E D;  2NN6 G;  3SE0 A;  1H9J A;  1Y8O B;  4IQZ A;  2KA7 A;  2A69 C;  2L5T A;  3BG3 A;  1T5E A;  4DNR B;  4OO1 G;  3PUV A;  2BA1 A;  2D62 A;  4JK1 C;  1IYV A;  3W3A A;  2B8F A;  3PUZ A;  4TKO B;  1CI3 M;  4JBW A;  1ZYR C;  4KI0 A;  5BN5 A;  1O7L A;  1YNN C;  4KKU A;  5K36 G;  2DNC A;  1GJX A;  4DK0 A;  2PPB C;  3I73 A;  2PNR C;  2AUJ D;  3A8J E;  2CW0 C;  2D2C C;  4I7Z C;  1OXV A;  4L8J A;  2EDG A;  3VR4 A;  3ND9 A;  2QF7 A;  1Q1E A;  2LMC B;  2F1M A;  1LAC A;  3N6R A;  3T51 B;  1GUG A;  1ONL A;  3VR2 A;  4KN4 C;  2A6H C;  3H94 A;  4RCN A;  1Q90 A;  2Q8I B;  4PV1 C;  3T56 B;  3IKJ A;  5JEA G;  1VF7 A;  1A6X A;  4KN7 C;  1E2W A;  1V8Q A;  2JXM B;  3D31 A;  1PMR A;  4KKS A;  2R6G A;  1OXT A;  5C0X G;  3PUW A;  3RLF A;  1E2V A;  1IW7 C;  2EJM A;  1DXM A; 
#chains in the Genus database with same CATH topology
 4CDE C;  1NR2 A;  2IX1 A;  5FJ8 H;  4JYA Q;  1S4Z A;  3HOU B;  2EJG C;  1I4R A;  2YU9 H;  5ELF A;  2VZA A;  3S1N H;  5IGD A;  2GN5 A;  1SJH D;  2JN4 A;  1L0W A;  5C44 G;  1TWG B;  2RHS B;  1SBB B;  2CHB D;  3OHX C;  2HIX A;  1FR3 A;  3WOE A;  3JAM E;  1IBL L;  1EYA A;  2R7Z G;  2RBM A;  3SHL A;  4XT1 B;  4GLX A;  3M4P A;  1VDZ A;  5CGK A;  2H4O A;  3L9A X;  5J3B A;  3GV6 A;  3PUX A;  3RUZ A;  1XTC D;  4ZYS A;  4KTA A;  1MSH A;  1MIU A;  1TWC B;  4IUQ A;  3AMU A;  4K0K L;  2XRQ D;  2EY2 A;  2K52 A;  3D3R A;  1PTO H;  3FVQ A;  1PH1 A;  3TME A;  2VB2 X;  2WAQ E;  3DM3 A;  4O1N A;  4JI7 Q;  1EQR A;  4BY7 G;  4C3I G;  1EWH A;  4DF7 A;  1PYS B;  2ASB A;  5I4D A;  4RKL A;  2OQ0 A;  5JOB A;  2Q8R E;  1KQS A;  1YVC A;  3I91 A;  3OIP A;  3UDI A;  1UAP A;  1M90 C;  2E5L L;  1XNQ L;  2Q8T A;  3HOY B;  3U9S A;  2HHH Q;  1WCM H;  2D9U A;  3LGJ A;  3I8Z A;  2EZV A;  4DV4 L;  3S2D B;  2MPM A;  4DV2 L;  4EX5 A;  4KD4 A;  5C5M A;  1A62 A;  4A3L H;  4JI2 L;  3F2U A;  3H15 A;  4IO9 A;  1RL2 A;  2L11 A;  4QGU A;  1JWM D;  4GKJ L;  1X55 A;  4RWS C;  2KOL A;  4A3J G;  2JQO A;  2GVA A;  3MZ5 A;  1FGU A;  1UNS A;  3TSS A;  1TXY A;  1IZ6 A;  1VQ6 A;  3S2H H;  1CQV A;  2DNC A;  4EVO A;  2ALY B;  1XXG A;  4FF2 A;  1VQL A;  4B3T Q;  1I94 L;  4C3H H;  2LMC B;  4QQB X;  4I65 A;  1RJT A;  4A3E H;  3HS0 C;  4PV1 C;  1K8G A;  3GTP B;  2PI2 A;  3KUP A;  1UE7 A;  1U4M A;  1HUM A;  1D2B A;  3CMA A;  4BS9 A;  1EWI A;  1MI2 A;  4ZCK A;  1GUT A;  2Z4H A;  5IT9 L;  3DXJ C;  5H1S E;  1C8C A;  3R8B A;  5K5P A;  1R4P B;  1S5E D;  3H6M A;  5IP7 H;  1XPU A;  1UE5 A;  5IYB H;  4DK6 C;  2R93 G;  3GTG B;  2JA9 A;  1TWF H;  3PIP A;  3GQB A;  3NWS A;  5LL6 X;  2F3W A;  1PH7 A;  1XMO L;  2NN6 I;  3M3Y H;  3J7A V;  1VQN A;  4X64 Q;  4LF9 L;  1VQC A;  3K5L A;  1X3Q A;  2HT1 A;  4MTN A;  5LMU Q;  2E76 C;  2BCO A;  2JA8 B;  5M3F B;  3OPO A;  1EY5 A;  4YIJ A;  3ND8 A;  1D6E C;  5J22 A;  1HCZ A;  3SEB A;  2SDF A;  2A69 D;  2OEO A;  3S17 B;  3HOX G;  4X6A H;  1F9Q A;  1QUQ B;  3RZO H;  4YCU A;  5M5Y B;  4KHZ A;  3CC2 A;  4OO1 H;  1HTL D;  3S1M B;  4RA8 A;  2N78 A;  3Q0A A;  1PH6 A;  4XQJ A;  4OX9 Q;  3HKS A;  1TS2 A;  4RGN A;  4BY1 B;  5KND A;  4KHP L;  2F0G A;  4IPH A;  4JV5 L;  5E3F A;  2DJF C;  4XQN A;  2J7Z A;  2JA5 G;  2E75 C;  4DV5 Q;  1C48 A;  5KNB A;  4EQ5 A;  1JCK B;  4P73 A;  1Q3L A;  3HOV G;  4A93 H;  3K80 C;  4DV3 Q;  1VS0 A;  1CT1 D;  3E9I A;  1JWU D;  5KRU A;  4DR5 L;  2MUY A;  1GUN A;  2A6E D;  1E3P A;  2ICI A;  3OTO Q;  5FO8 B;  1YZ6 A;  3UDX A;  2P5Z X;  1FGB D;  1EY8 A;  1QOH A;  1X6O A;  2HDL A;  5FLX L;  4JBW A;  5EPJ A;  1TII D;  4L5R C;  1N32 Q;  1I50 H;  4F88 A;  3KOJ A;  1L1O C;  5M5X H;  3V96 A;  4M8A A;  4DR3 Q;  5CR3 A;  3S9W A;  4C2M B;  2Q8I B;  1J5E L;  3ULP A;  2F0Q A;  1KIX A;  4QMG A;  2JXM B;  3MFG A;  3TQY A;  3T1Y L;  2PNH A;  1RF2 D;  1YHA A;  2VXW A;  5HY6 A;  4DXF A;  1IW7 C;  1DXM A;  5IOD A;  4CKC A;  1O7Z A;  5FK9 C;  3RN2 A;  1U9R A;  1S3O A;  4GOP C;  1KNA A;  5EAY A;  5EGT A;  5FJ8 G;  1CSP A;  1JIC A;  1U5K A;  5C4J H;  3E0E A;  5BN4 A;  1N33 Q;  1Z6H A;  3QR8 A;  3S15 H;  5EBC A;  1HFG A;  1YIJ A;  1X65 A;  1HPC A;  3K6O A;  2QEX A;  2OWO A;  2NVT H;  1VQ7 A;  1B50 A;  4ID6 A;  1S5D D;  2L55 A;  3D4D A;  4Y52 H;  2CW0 D;  4RHR A;  3CCJ A;  3T1H L;  5C0X I;  5IOC A;  1G2T A;  4P71 A;  3UDF A;  1EU4 A;  5KGU A;  1R9T B;  5L37 A;  2Q2I A;  1PRT D;  1MJC A;  3R3O A;  1BNZ A;  4KY7 A;  5I9P A;  5KEE A;  5E4X A;  3D6W A;  5AJ3 Q;  4B08 A;  2E2J B;  3V05 A;  2C5C A;  5EPK A;  4G7H C;  3MXU A;  4X3U A;  3FPP A;  2VQE Q;  2EYM A;  4DU9 A;  4ZAI A;  2VNU D;  1PZI D;  4RHS A;  1P16 A;  2R7D A;  3I4L A;  5GAE C;  4BBS G;  1K83 H;  2KEC A;  4IJL A;  1LTT D;  5JEA J;  1VQO A;  4GZY C;  1KLU D;  5FLM G;  2MJ8 A;  3MXG A;  1PH8 A;  2Z6B A;  1MGS A;  1IL2 A;  1CFM A;  3TS0 A;  1STE A;  2BA0 A;  4A76 A;  4YY3 Q;  2B39 A;  4XTC S;  1SLJ A;  5IIF A;  1N34 Q;  4DUZ Q;  5ELO A;  4LW1 A;  2HCC A;  2VW9 A;  1E1T A;  3JAM c;  4NW2 A;  1I4H A;  4DR1 Q;  4GNX C;  4FF3 A;  3DEO A;  2R7Z B;  2KA7 A;  1NAP A;  1WJJ A;  2D62 A;  2B8F A;  3H09 A;  3RR5 A;  4P75 A;  4WJ3 M;  3VYT A;  3HOU G;  1GM5 A;  2EDG A;  1L1O B;  1EOT A;  3CCU A;  1KXL A;  1YBY A;  2JK8 A;  2CWP A;  4JBM A;  3T56 B;  2CFM A;  3OWE B;  4XQQ A;  4C3I B;  1D1I A;  2EQS A;  3RNU A;  2M9V A;  2A73 B;  1I4X A;  4JC0 A;  4BBR H;  2PQE A;  4IUU A;  1PTO D;  2YTX A;  5LHY 1;  2UUA Q;  4DR6 L;  4Y7N B;  2BE5 D;  2FXQ A;  1ILQ A;  1SE3 A;  2CVR A;  1GVP A;  5C4Z A;  4A3I B;  1LTG D;  4GOP B;  1W2B A;  3CC4 A;  4YWK A;  3GTJ H;  2K5W A;  2TMP A;  2HD3 A;  5IYB G;  1PH5 A;  2QIL A;  2WP8 J;  1K3B C;  1YNN D;  2EYJ A;  1BBX C;  1DD2 A;  1S5B D;  1MKH A;  2F0M A;  1F2Y A;  1SAP A;  3QOL A;  3NXW A;  4IFD H;  1VQI A;  3H0G B;  1PYB A;  1UUP A;  4JI3 Q;  5E1F A;  1N36 Q;  2R92 H;  1S72 A;  3S24 A;  3HOY G;  5D14 A;  3CCE A;  1HTP A;  1WD0 A;  5ELC A;  5GAG C;  2V1C C;  4CDD C;  3KLW A;  3FMC A;  1EYG A;  4CKB A;  1RIP A;  1X54 A;  2IY5 B;  4HJ7 A;  3I72 A;  3TS2 A;  1JMC A;  3S1Q B;  2F4V L;  2F0N A;  1EIF A;  3A54 A;  2PI2 E;  3R2T A;  4ABN A;  2F0P A;  1NBW A;  4DV0 L;  4J6H A;  2Z9H A;  3QG1 A;  3U50 C;  2J0T D;  1FJG L;  4IZ8 A;  1EOV A;  2R93 B;  1UWV A;  2HQL A;  1ASY A;  1G6P A;  2L15 A;  3M4Y A;  1BO0 A;  5ELE A;  3GTK H;  2R61 A;  3K7U C;  3CD6 A;  2JA7 H;  3D4W A;  3I2Z A;  2Y0S B;  5T1I A;  2Q2T A;  5LMN W;  3M7G A;  5IWA Q;  3GDE A;  2IX3 A;  3NBH A;  1S5F D;  3OW2 A;  1QCB D;  1HNW L;  4JBJ A;  3MWY W;  4KI0 A;  2XWJ B;  4NB3 A;  5C3E H;  4X66 Q;  3I4M H;  3FKI H;  1K8A C;  4R8I A;  1D5Z C;  3C1F A;  1LT6 D;  4CJ1 B;  3JAM i;  1GUG A;  5A2Q L;  2JA6 B;  2AMC B;  2NB0 A;  5JEA G;  4RGO S;  4X62 L;  1K28 A;  3ERS X;  5KIX A;  3J81 i;  3S16 H;  1FNU A;  2AWN A;  4KV6 A;  1VQG A;  1SRO A;  4GKK Q;  4E6I A;  3K81 C;  2Z6K A;  1E2Z A;  2NVX H;  3S14 B;  3Q23 A;  3CHB D;  4LF5 Q;  2IT1 A;  1PZK D;  1Q12 A;  4DV6 Q;  3CCS A;  3MXN A;  2JA8 G;  5M3F G;  4FXG C;  1GUS A;  1SYB A;  1JJG A;  3T13 A;  2PMZ E;  1H9S A;  5DM7 3;  3BVG A;  1U0L A;  3M4O H;  3SVM A;  1PRT B;  5CV8 A;  1NMF A;  1LT4 D;  2RVL A;  5IY0 A;  3L2P A;  4KMU C;  1B70 B;  2WFW A;  2K50 A;  4JI4 Q;  3M7N A;  2VL6 A;  4IUT A;  5M9O A;  2E2D C;  3B6Y A;  2HIV A;  1KAW A;  3U9O A;  4HJA A;  3TBI B;  1B9N A;  4AQY Q;  4A3D B;  2YTY A;  5JPM C;  3J7A F;  4A3K B;  3K5O A;  1TWA H;  4IOA A;  4MZ9 A;  2AQ3 B;  1HNX L;  4HJ8 A;  4JI6 L;  4RMF A;  4BA1 I;  1BOS A;  1YNJ C;  1SE2 A;  3VYS A;  1HFN A;  1ZKO A;  3G6J B;  1JR0 D;  2XTI A;  2FHT A;  2OCE A;  1P8L A;  2QW7 A;  2NZ1 D;  3QIA A;  1LM0 A;  1O7I A;  2X69 A;  3C1E A;  4QJF A;  2VB3 X;  1XWE A;  1SEB D;  2WII B;  3DWQ A;  4LUO A;  1ILP A;  2YU9 B;  5D3I B;  2KCM A;  3S1N B;  1WOC A;  5CV7 A;  4H02 A;  1V9P A;  2NWG A;  1IBK L;  3EBE A;  5FO9 B;  4Q0F A;  3M4Q A;  2K7V A;  2XVS A;  2FFK B;  1B53 A;  5JPN C;  2F0O A;  2RSO A;  1H95 A;  2RDG A;  1DOL A;  1I3Q H;  2MHV A;  1WTV A;  5I9O A;  4DGZ A;  4KY6 A;  3HOZ H;  3K5N A;  1YJ9 A;  1PFN A;  3MXN B;  5IYD G;  1PFB A;  4OXP A;  4U67 3;  2KED A;  3MXP A;  2A6H C;  1PTO B;  5GQO A;  1W3S A;  3X3N A;  4KN7 C;  1TT2 A;  4KHV A;  5IGC A;  4A3F H;  1XMQ Q;  1S5C D;  3VYU A;  2HCI A;  4N8X 1;  5J1Z A;  1AFP A;  3LNN A;  1YIT A;  3CME A;  4GS3 A;  5TSS A;  3NTK A;  3D0F A;  3MFY A;  2UXD Q;  2WV6 D;  4JYA L;  4DV7 Q;  3A0J A;  4OON A;  1Q7Y C;  1TY2 A;  3CRL C;  1SYE A;  1WCM B;  1ICF B;  3A5Z B;  1TKW B;  4JI8 L;  2NUC A;  1A3T A;  4UDU C;  3HOW H;  4FXD A;  1VQB A;  4XXE A;  3KK7 A;  2NVQ H;  5A35 A;  2O5J C;  4PMW A;  1EEF D;  3V2T A;  1H9M A;  3TRZ A;  4O2D A;  2PZU A;  2A19 A;  1HR0 Q;  3S2H B;  2ZT9 C;  1XJV A;  3TZU A;  2EYP A;  4ODG A;  1JE5 A;  3P1H A;  5KYI A;  5COY A;  1EWC A;  2ID0 A;  1C4Q A;  4C3H B;  2B2T C;  2F3I A;  2E8G A;  3BVZ A;  2VUM H;  2AWO A;  4A3E B;  1KAA A;  3GO5 A;  4HJ5 A;  2K03 A;  3CQZ B;  3J80 L;  1HJP A;  1SNQ A;  2F0D A;  4JI7 L;  5LMN Q;  1CKM A;  2B2V A;  2FJ2 A;  3NP8 A;  5JJL A;  3H3V I;  1EZ8 A;  2HDM A;  3MEF A;  2I5L X;  1WTX A;  1M4V A;  1M1K C;  2CWA A;  1NE3 A;  3J81 E;  3IRB A;  2UU9 Q;  4N9T A;  1KAB A;  4FDB A;  2QCP X;  1WTQ A;  1XPO A;  5T1G A;  2HHH L;  1E1O A;  3FHW A;  4YWM A;  1MD2 D;  3KBX A;  2NN6 H;  1TWF B;  4K2L A;  2F4I A;  3PO3 H;  1QJO A;  4X3T A;  3BS1 A;  2LXJ A;  4PZ8 A;  3OSO A;  3M3Y B;  1UE6 A;  5LL6 S;  2ZM6 Q;  1QNU A;  2ZTE A;  2NTT A;  3S1R H;  1GOZ A;  1EY7 A;  1WYD A;  4A3I G;  3E6Z X;  5EKK A;  3I4N H;  3N6R A;  1Y1W H;  4LMQ D;  4B3T L;  5GRO A;  1SE8 A;  4FNF A;  2Z0S A;  1QUQ A;  1JOO A;  1PFS A;  3G48 A;  3RZO B;  1JT8 A;  1YHQ A;  1M8A A;  1SRU A;  2E2H H;  3PUW A;  5IGF A;  3MAQ A;  3NHH A;  2ZTC A;  3M9B A;  3BZD B;  3H0G G;  1EIH A;  3SK6 A;  2JJQ A;  2B63 H;  4DAY A;  1LO5 D;  1IBM Q;  4AIM A;  1N8R C;  3NPP A;  2F0I A;  1XYI A;  2RA4 A;  3A56 A;  3OOC A;  5HUR A;  2E2I H;  3CXC A;  5IP9 G;  4A93 B;  2LS0 1;  2C9O A;  3I7F A;  4DR7 L;  3TP5 A;  4LFC Q;  1ESR A;  3LWE A;  2IJ0 A;  3HKZ E;  1LAB A;  3VA7 A;  4OEM B;  3SDZ A;  3PIO 3;  4WJ4 A;  3UE1 A;  5M5W H;  4X64 L;  1E24 A;  5I2Y A;  1QG7 A;  4JI5 Q;  3A7L A;  2RF4 A;  2IWH A;  4DV2 Q;  4X65 Q;  5LMU L;  4HIM A;  1I50 B;  2V4D A;  1AH9 A;  1UEA B;  4CKE A;  1K8O A;  4RH6 A;  1IW7 D;  2B3G A;  1SNC A;  2B8G A;  1SNP A;  4IUV A;  2KCC A;  1HRJ A;  3C3L A;  4AH6 A;  3WOF A;  1E7Z A;  1B4O A;  1X3P A;  2AQ2 B;  2Y0S G;  1B3Q A;  3IAY A;  4HMJ A;  2QKI C;  2ZXO A;  5BN3 A;  3UDG A;  4OX9 L;  1PYW D;  3DUZ A;  2DGY A;  2HQE A;  4A3C H;  4DFA A;  1HA6 A;  4OWW B;  1EEI D;  3RMH A;  2YTV A;  1GUO A;  4XYQ A;  4DV1 Q;  1XPR A;  1EY4 A;  1TS3 A;  3FP9 A;  3NEL A;  4DV5 L;  2K33 A;  3A8I E;  2JA6 G;  4A3G G;  4H13 C;  4RFB A;  4TVA B;  5C0X H;  3S15 B;  3E0J A;  2FIN B;  4LFA Q;  3SXH A;  2NVT B;  1Z47 A;  2WKD A;  4JOI C;  1Y8O B;  3EN2 A;  4FF4 A;  3OTO L;  2IPK D;  3CCM A;  2WB1 B;  1LTA D;  1Q46 A;  5NUC A;  5K36 G;  2RCF A;  2PNR C;  1PA6 A;  4I7Z C;  2SNM A;  4L8J A;  1EIY B;  1N32 L;  4DAY B;  3CU7 A;  1SR3 A;  3VR2 A;  1LUZ A;  3K7A H;  3OMC A;  3T51 B;  5M3M H;  4ZK9 B;  2PZT A;  1F9R A;  3MTS A;  4QIW E;  5C4H A;  5C3X A;  3K57 A;  1YI2 A;  1EY9 A;  3NUC A;  2H5X A;  2UUC Q;  1KDC A;  1CTM A;  1STA A;  3MC0 B;  2CQO A;  4A3F G;  4YHH L;  3KLS A;  4ZQ3 A;  3J7A 5;  1NR4 A;  2NBF A;  1STH A;  1BKB A;  4LF8 Q;  1SYD A;  3HG9 A;  2MNA A;  5DM6 3;  4ME3 A;  1D1K A;  1J9O A;  4K8I A;  4A3D G;  3D4R A;  2KHI A;  1TQO A;  5JVH 3;  4A3K G;  1HQM C;  5EKI A;  1EYC A;  1N33 L;  2K6A A;  5F2D A;  4BXX G;  1K3R A;  1FD7 D;  2OTL A;  3PF5 A;  4DAM A;  2UUB Q;  5C4X G;  3Q22 A;  5IT9 E;  2A68 C;  2RDH A;  3L0O A;  4KK7 A;  1PZJ D;  3BVM A;  1BVS A;  1TVX A;  5AJ3 L;  1L1O A;  3M85 A;  2LSS A;  4DXG A;  2VQE L;  3HRZ C;  4KY5 A;  5JJK A;  1I6H H;  1VQ9 A;  1JB3 A;  2FMC A;  2KQ3 A;  3P75 A;  1W6J A;  4BBR B;  4UHV A;  2LKV A;  1DZ1 A;  3KF6 B;  4FXK C;  4GLV B;  4PQX A;  1QE6 A;  1RTN A;  1FL0 A;  5G3L D;  4GOP A;  5IE8 A;  4RG1 A;  4LF7 Q;  4YY3 L;  1SMY C;  3GTJ B;  1AW7 A;  5FOB B;  1N34 L;  2KHS A;  5M5Y H;  3OYY A;  4A4I A;  4QB4 A;  1ENC A;  4DUZ L;  2EIF A;  1PVO A;  5DAU A;  4C3J H;  2K04 A;  3A7A B;  4APV A;  1O78 A;  2NN6 G;  4WRD A;  4XT3 B;  1QWY A;  1EFW A;  4DR1 L;  2A69 C;  1KDA A;  2LFN A;  4U68 A;  1KHI A;  1RTO A;  1X56 A;  1QIL A;  3E9H A;  3EVQ A;  5JJI A;  4NXM Q;  4RGM A;  4DK0 A;  2AUJ D;  2BH2 A;  2EE1 A;  2QF7 A;  1ROD A;  1Q1E A;  1ONL A;  1WCM G;  2I5H A;  1VQK A;  3GTM B;  4K8J A;  1B3A A;  4KJN A;  1C7Y A;  3IKJ A;  1ZEQ X;  4A3L G;  4KKS A;  3KYH C;  3ER0 A;  1C0A A;  3TP7 A;  2G5D A;  2EY5 A;  3RLF A;  5FLX E;  3J81 c;  1STG A;  1Y8N B;  4K5W A;  1I4G A;  1DM0 B;  2UUA L;  3C46 A;  4RGT A;  3GTL H;  2B2W C;  4DUY Q;  1SND A;  2AUK A;  3FEW X;  3VDY A;  1Y14 B;  3HGB A;  2QDB A;  4C3H G;  3H3V C;  3CAM A;  2JA7 B;  4A3E G;  1G8Z D;  4DA2 A;  4GNX A;  1I6V C;  1ENF A;  5CV5 A;  1SXT A;  3F2C A;  1SNO A;  2GA4 B;  1VQA A;  2IHE A;  3QB3 A;  2DY7 A;  3DMU A;  4LJZ C;  3UI2 A;  5IYC H;  4JI1 Q;  1STN A;  3F8T A;  1Q1B A;  2D0P A;  1N36 L;  3FPU B;  4QL5 A;  5C3E B;  4IAL A;  2RQX A;  3I4M B;  3FKI B;  3KDF B;  4CDC C;  1VQE A;  5IP7 G;  1NJI C;  2G9H D;  1W6K A;  1XTD A;  3SK4 A;  4YCV A;  1G2S A;  4H44 C;  4G7O C;  2X6L A;  3S16 B;  4ZRZ A;  1U4P A;  2QA4 A;  3R2I A;  1GUW A;  1A3U A;  1VQD A;  3P7J A;  2NVX B;  4B3S Q;  2UXB Q;  3SK5 A;  4K5V A;  2BOS A;  5CV4 A;  1ICW A;  4IUR A;  1LYL A;  3GP7 A;  3K0Y A;  3QWN A;  4UP8 A;  3TP6 A;  5ELD A;  4A3B H;  4AYB G;  3M4O B;  3L3O C;  2N3S A;  4J1M A;  2K01 A;  3J81 j;  2HUG A;  1NNX A;  5AFW A;  4OO1 G;  4A3M H;  1EZ6 A;  1SYF A;  4WFN 3;  5IWA L;  2XN9 C;  2WAC A;  3PUZ A;  4FP5 D;  2VQF Q;  1ZYR C;  1SYC A;  1O7L A;  1MSG A;  1YNJ D;  3CCV A;  2L12 A;  5C44 H;  2XWB B;  4LF6 Q;  3ND9 A;  4X66 L;  1JC7 A;  1A3V A;  1NCV A;  3H94 A;  1NY4 A;  4I7A A;  4DPG A;  4EQP A;  1S40 A;  5M3M G;  2JSO A;  4A93 G;  1CM9 A;  1FNW A;  3KJO A;  3STB C;  3KBG A;  4DR2 Q;  3H91 A;  1XNR Q;  1QB5 D;  1JE4 A;  2CKZ B;  4GNX B;  3T4A C;  4C56 C;  1BCP C;  4IN3 A;  2M00 A;  1D8L A;  4ILW A;  2K5D A;  2NVY H;  1LTR D;  4NXN Q;  1PLF A;  3BZC A;  4GKK L;  2B2Y A;  2PYK A;  4YCW A;  2KVM A;  1F2M A;  4NMZ A;  5EPL A;  4S3S A;  2O4X A;  3P20 A;  1PRT F;  3W2D A;  4DV6 L;  4IFD J;  1ENA A;  5G3L F;  4A3G B;  1VMP A;  1IYU A;  4R4C A;  4BY7 H;  2XNA C;  4C3I H;  2X6G A;  1OXS C;  4JBK A;  1UE1 A;  3KLR A;  5HGQ A;  1ASZ A;  2Z6K C;  4GN4 B;  4R9W A;  1ZXT A;  4JI4 L;  1I3Q B;  4LF4 Q;  2A6H D;  4PZ6 A;  5E7N A;  1AEX A;  1F9P A;  5D65 A;  1HH2 P;  5C5L A;  3HOZ B;  2UXC Q;  4HID A;  2L9H A;  4OIK A;  1A8V A;  1HNZ Q;  2WAQ B;  1STY A;  4A3J H;  1VQH A;  4FVM A;  1WTO A;  1YEZ A;  5EKL A;  4XYO A;  2F0S A;  1Y1V H;  2F0E A;  4A3F B;  2ES2 A;  3I4O A;  2ZJP A;  2DY8 A;  3PO2 H;  4CJ2 C;  2OT2 A;  2BDO A;  2WB1 G;  3A74 A;  5JVG 3;  1CK1 A;  3KF8 B;  4PZ7 A;  1EL0 A;  2TSS A;  1QZH A;  3F2B A;  5DEH A;  4IPC A;  3HOW B;  4FO2 A;  3S1Q H;  2FMM A;  3NQT A;  4OWT B;  1K9M C;  4C3J G;  5IT9 c;  4F7X A;  3GTO H;  3HP3 A;  5C4X B;  2L5T A;  2L0C A;  1SFO B;  3PUV A;  2NVQ B;  5EJW A;  4B3R Q;  2B2U A;  2R93 H;  2ZXP A;  1GJX A;  2F3V A;  4F8M A;  2EYO A;  1VQJ A;  3I73 A;  1PTO F;  3TDQ A;  1MJE A;  2F0F A;  1FVI A;  2F1M A;  4Q5V A;  1CHQ D;  5HGT A;  2VUM B;  2EY1 A;  2I07 B;  3PIP 3;  3BU2 A;  1E2W A;  3D31 A;  4WOR A;  1WTH A;  1PMR A;  3H3V H;  2EOT A;  4HIK A;  2A5H A;  1CKO A;  5CBE E;  5BR8 Q;  4J8Q A;  4LUZ A;  1YJW A;  4IPG A;  4L6T B;  3JAM L;  4PG3 A;  2KJX A;  2KUM A;  1RD9 D;  1XMQ L;  5COR A;  3WDN A;  3J80 i;  1Z9F A;  1CHP D;  3T53 B;  4DR4 Q;  3HOX H;  4DV7 L;  5A2Q E;  1EFI D;  4JI0 Q;  4KLK A;  3A55 A;  5IGB A;  2F0J A;  1HZC A;  1IXR A;  1PHJ A;  4N8F A;  3J7Z C;  3PO3 B;  1K8M A;  3E5S A;  3RLN A;  4LFB Q;  1C9O A;  2ENB A;  2I5M X;  5C3W A;  2QGQ A;  1VF5 C;  1H9K A;  1A2T A;  4BBR G;  2JA5 H;  4B3M Q;  4FYD A;  1D5M C;  4OEL B;  3IFT A;  2YV5 A;  3S1R B;  1HR0 L;  3HOV H;  1GHJ A;  3AEV A;  2IL8 A;  4TSS A;  1LTI D;  1Y1W B;  2AKW B;  1PV4 A;  2K5V A;  3K58 A;  4GN3 B;  5FO7 B;  1IKL A;  2MGS A;  1KD1 C;  2MFI A;  1PH3 A;  2ZXR A;  2R3Z A;  1EU3 A;  2WKC A;  2MP1 A;  3D8G A;  4ME5 A;  2M2L A;  1V1P B;  1RCV D;  2E2H B;  4RAU C;  1HUN A;  1T5X D;  1X32 A;  3GD7 A;  3OIQ A;  4IFD G;  1I4P A;  4HSV A;  4A75 A;  1PH4 A;  1V1O A;  1D5X C;  1B7Y B;  4LAA A;  2K75 A;  2R92 G;  1ET9 A;  1CQF A;  2UU9 L;  2F0K A;  1X9N A;  4R4Q A;  2E2I B;  4K6L A;  3OMG A;  5ELN A;  1E0B A;  3GTQ H;  4A3B G;  1B2T A;  3SGI A;  2F0U A;  2AHO B;  2KHJ A;  2Y0S E;  3SE0 A;  4IUP A;  2K14 A;  3EJI A;  1PDQ A;  2IHF A;  4A3M G;  4PMB A;  5M5W B;  1XX8 A;  2ZM6 L;  1JQY D;  4JI8 Q;  3CC7 A;  2PPB C;  2EXD A;  3A8J E;  3ZYY X;  1OXV A;  1EUJ A;  3AQQ A;  3TRE A;  4RKB A;  3J7Y W;  4HJ9 A;  1A0I A;  2B2T A;  2ZTD A;  2ICE C;  1KRT A;  4DN4 M;  1SDF A;  4CGY B;  5EBD A;  2KBN A;  2OXP A;  1F2Z A;  2JA7 G;  3Q24 A;  4OWX B;  1RKN A;  1KNE A;  4UP7 A;  1Q81 C;  2EJM A;  3AB9 A;  1HZA A;  1LTS D;  3DM1 A;  4DAV A;  2JEA I;  2K5N A;  1LV9 A;  1OXX K;  1I4Q A;  3BDO A;  2PQA B;  1X3E A;  4DNT B;  1IBM L;  4AYB B;  5C3E G;  1ESF A;  3I4M G;  2OF1 A;  1BDO A;  3FKI G;  4BBS H;  4BWG B;  2RSN A;  3CKI B;  1RDP D;  3MA2 B;  4UP9 A;  5FLM H;  1IBL Q;  1ET6 A;  1V1Q A;  1G51 A;  2QEJ C;  2K4K A;  4LFC L;  3I56 A;  3BYY B;  5ELB A;  3RLO A;  4CBV A;  3AFQ A;  3PV0 A;  4HR7 B;  2CH4 A;  3O13 A;  2LY7 A;  2CCZ A;  1CKN B;  2ZJR A;  4F87 A;  4JI5 L;  4POF A;  4V0B A;  4K0K Q;  3RZD H;  4X65 L;  1NTG A;  2O5I C;  1AP0 A;  1NSN S;  4IJH A;  3K7A B;  1LTB D;  5M3M B;  4TRD A;  5DLQ E;  1Z7T A;  1GO3 E;  1H9R A;  1PH2 A;  1TR5 A;  4B9W A;  3KFU A;  1TWH H;  3DWP A;  1KTK A;  1VCI A;  1TU2 B;  3TP8 A;  2E5L Q;  1XNQ Q;  3LWU A;  2K1B A;  1Y1V G;  3HOU H;  2CH4 W;  2O2L D;  1JOK A;  4DV4 Q;  3PO2 G;  1B9M A;  3EFX D;  4JI2 Q;  2RDF A;  1VQ8 A;  4DV1 L;  1TWG H;  1X3G A;  4L5Q A;  5M5X B;  3CQZ H;  3J80 E;  4B9X A;  2D0O A;  2A68 D;  1MHW C;  4GKJ Q;  4OIJ A;  4G57 A;  4NKL A;  1V43 A;  2RKS A;  3MHB A;  1EIG A;  3CP0 A;  3U4Z A;  4IQZ A;  4QY7 A;  1SNM A;  4LFA L;  4DNR B;  3QO2 A;  1VQ4 A;  1TS4 A;  3TN2 A;  3C2P A;  2F52 A;  1WTP A;  1K0S A;  2JP1 A;  2XGT A;  1TWC H;  1I94 Q;  1QVF A;  4HCS A;  1CZG A;  4DNI A;  3E3X A;  2LXK A;  4QUC A;  2AQ1 B;  5I2X A;  4DR7 Q;  5C4J B;  1YJN A;  3A5U A;  3CCQ A;  4DV3 L;  1F2L A;  1PH9 A;  4HAE A;  5CBA E;  1I6H B;  3OWF A;  1T9H A;  3NWT A;  2R7F A;  1WVL A;  1SMY D;  2XIW A;  4ZKC B;  3HOY H;  2PW5 A;  3I55 A;  2UUC L;  4IPD A;  3KF6 A;  4HSP A;  3S2D H;  3X3M A;  3K8A A;  3U4V A;  2ZJQ A;  4LF8 L;  1IYJ B;  1OTC A;  2F0T A;  3HOZ G;  1HZB A;  2I46 A;  2ATW A;  3NBI A;  4QF4 A;  3G71 A;  1DCZ A;  2WAQ G;  5IGE A;  4DR3 L;  1EQT A;  1U4R A;  2KCT A;  4C3J B;  3JC6 6;  4DAP A;  1XMO Q;  4PNY A;  4LF9 Q;  1DOM A;  4JOI A;  3I90 A;  1K83 B;  1L0X B;  4HIO A;  2L4N A;  2N49 A;  2UUB L;  3GV3 A;  1BUV T;  3EIV A;  5C6A A;  4KD3 A;  5J39 A;  1DOK A;  2DNE A;  5CMD A;  1EYD A;  2JE6 I;  3LX0 A;  1OO9 B;  1AZP A;  3GTP H;  1O80 A;  3TEH B;  4GN5 A;  2EVB A;  1A15 A;  2EJF C;  2K32 A;  3HOW G;  3W1B A;  3NEN A;  3DEP A;  4KHP Q;  2OTJ A;  1Y69 U;  2PZW A;  3Q8D A;  4JV5 Q;  5C0X J;  3PSI A;  4X3S A;  5I6W A;  2IX0 A;  4LNQ A;  3EQL C;  3GTL B;  1Y8P B;  3GTG H;  3VR6 A;  1KDB A;  5JEA H;  3IL8 A;  4LF7 L;  2Z8L A;  2MO0 A;  1SMX A;  4LK1 C;  4ZLT F;  1TY0 A;  4DR5 Q;  1B1Z A;  1HA5 A;  4R8N A;  1YHB A;  3FDT A;  2VUM G;  4FF1 A;  3ICE A;  3K59 A;  3HKZ G;  1QVG A;  2NZO A;  2N8N A;  2GVB A;  4YHH Q;  2BA1 A;  4OL7 A;  3UE0 A;  2F0H A;  3I70 A;  2JA8 H;  5M3F H;  1VMC A;  1E22 A;  4NXM L;  3NSW A;  2DJG C;  2VY3 A;  3KDF A;  1WI5 A;  4L5S A;  3S17 H;  1J5E Q;  4AYB E;  4RCN A;  4RCO A;  3T1Y Q;  5KYL A;  3S1M H;  1V8Q A;  1Q8I A;  1GD7 A;  4BY1 H;  1WFQ A;  3K0X A;  1O7Y A;  3PMF A;  3PO3 G;  4OO1 I;  2KEN A;  5CYU A;  4UPA A;  4BA2 I;  1I5F A;  1CA6 A;  4K5X A;  2R92 B;  4XDX A;  2XRS D;  3DWA A;  2PMZ B;  2Z1C A;  1J8I A;  2PCF B;  4DUY L;  3BJU A;  5KNC A;  4A3B B;  3AYH B;  1NUC A;  3I4N G;  4C1N I;  1Y1W G;  1ZYR D;  3T1H Q;  4PMC A;  3BZK A;  1PXU A;  3SR1 A;  1JJC B;  3I3C A;  3R93 A;  3G4S A;  1J6Q A;  4A3M B;  4G7Z C;  3BDL A;  5E4W C;  1L0Y B;  1A2U A;  2SNS A;  1Q8K A;  2A6E C;  2BH8 A;  1QNK A;  4KKT A;  4JI1 L;  3STB D;  4DKA C;  3A8K E;  1F9S A;  3CCR A;  5C44 B;  1B8A A;  1UEB A;  4CJ0 B;  1BR9 A;  2B63 G;  4C2M H;  1BCP D;  3GTK B;  4O0A A;  1VQF A;  4L5T A;  1SYG A;  3ULL A;  1U4L A;  2C35 B;  1WTW A;  3MVV A;  3PIO A;  5CV9 A;  1EQQ A;  2A74 C;  3PQI A;  4X3K A;  3VA5 A;  2NVY B;  5IYD H;  3CW2 C;  3DHQ A;  1GKH A;  4MTK A;  4JI3 L;  2B2W A;  4B3S L;  2UXB L;  5CV6 A;  2A1A A;  3F2D A;  2EPB A;  4P2C B;  4YWL A;  4BY7 B;  1EY6 A;  2N88 A;  1PFM A;  1H9J A;  4EQO A;  1F77 A;  2K05 A;  4Z9C B;  1DJR D;  1R9T H;  1IYV A;  3K5M A;  2SEB D;  4TKO B;  1AZQ A;  1CI3 M;  3CF5 A;  1BF4 A;  4KKU A;  3ULJ A;  2E2J H;  2WB1 E;  4UAI A;  2VQF L;  2CW0 C;  2MQH A;  1SSO A;  4A3C G;  3VR4 A;  1IKM A;  3HZX A;  4LF6 L;  1PRT C;  3F1Z A;  3ITP A;  1Q90 A;  4P74 A;  4A3J B;  1LT5 D;  1A6X A;  1RHP A;  2IW3 A;  1II3 A;  4MIU A;  3G6E A;  5C0X G;  2WIN B;  4V19 0;  4DR2 L;  2I0Q A;  4DR6 Q;  1TS5 A;  1XNR L;  1Y1V B;  5I6Y A;  2EY6 A;  4XIG S;  4H0L C;  5GAH C;  4JW0 A;  1FNV A;  3PO2 B;  3SK8 A;  4NXN L;  3NQI A;  2DN8 A;  1CSQ A;  3J80 c;  3KF8 A;  4GLA C;  2PW7 A;  3GTM H;  1GHK A;  4R4O A;  4NDX A;  3OW7 A;  1TWA B;  1LLR D;  2DUD A;  2JEB I;  4JCV E;  2OQK A;  4R4T A;  3WWV A;  5CC4 A;  4J15 A;  2R7Z H;  1KL9 A;  3RN5 A;  3GTO B;  4JPB W;  2YYZ A;  1K0R A;  1A63 A;  1HR0 W;  2B2Y C;  4HN7 A;  3L7Z C;  2MO1 A;  4MN3 A;  3W1G A;  4LF4 L;  3PF4 A;  5JAV A;  2A8V A;  4LF5 L;  2BDN A;  3RD4 A;  3ZJY C;  2UXC L;  4JG2 A;  4DK3 C;  1ML0 D;  4OGQ C;  1BQQ T;  5IGG A;  3CCL A;  2F03 A;  1HNZ L;  4POG A;  2F4V Q;  2J4X A;  5DNF A;  4ZUI A;  2JYO A;  3URY A;  2EYF A;  1STB A;  2EXZ A;  3NE5 B;  1LTL A;  2NYZ D;  4DV0 Q;  3CRK C;  2K28 A;  4Y7N H;  1FJG Q;  3NK9 A;  1LT3 D;  4A3I H;  1BBU A;  2G9D A;  3AU7 A;  2F0W A;  3NTH A;  1PTO C;  3ERQ A;  2QDL A;  2Q2U A;  3HOX B;  4H7B A;  4AQY L;  4MNO A;  2BE5 C;  4N9P A;  1DYQ A;  1JWS D;  1DGS A;  4KJO A;  1G91 A;  4G4K A;  1WD1 A;  1MBY A;  3TZD A;  4UY8 C;  1HNW Q;  2KEE A;  3BG3 A;  3H0G H;  1CUK A;  1KLG D;  1AE2 A;  4M1U B;  4LWC A;  4B3R L;  3AFP A;  5BN5 A;  1YNN C;  1HQR D;  4IFD I;  2JA5 B;  2D2C C;  4WJW A;  1R4Q B;  1HZ9 A;  5IP9 H;  3HOV B;  4R4I A;  1VQM A;  2N55 A;  3Q6S A;  1LAC A;  3KJP A;  1JOR A;  2RCN A;  4KN4 C;  4HMI A;  4X62 Q;  4K6D A;  2EYL A;  2XSC A;  1IHZ A;  4K14 A;  1BCP F;  4QCL A;  3CPW A;  2Q2H A;  4QUF A;  1V1P A;  3N52 A;  4ZKB B;  1K73 C;  1E2V A;  2B2U C;  4BY1 G;  5BR8 L;  1G6Z A;  2K5Q A;  2NZH A;  5GAD C;  1B44 D;  5JJZ A;  3VR3 A;  1YNX A;  4LUV A;  3PCO B;  1EY0 A;  2VS1 A;  4P72 A;  4DR4 L;  3BDC A;  4JI0 L;  1DON A;  1KC8 C;  4IOC A;  1WTR A;  3IFD A;  3DLL A;  2K5H A;  4HCE A;  4HTH A;  3HKZ B;  1Q86 C;  3GTQ B;  3ERO A;  3QJY A;  4EQN A;  2SOB A;  3NTI A;  3HEJ A;  4R1J A;  1QZG A;  2L1B A;  3NBH B;  4LFB L;  4JVZ A;  1QVC A;  4ZUJ A;  1JJ2 A;  4NP5 A;  1FYC A;  1BCP B;  2H1E A;  3CPF A;  4OHJ A;  4L63 B;  4B3M L;  4CDF C;  1AN8 A;  3J81 L;  2UXD L;  3VR5 A;  2JA6 H;  4A3G H;  1HNX Q;  4TQU S;  3EA6 A;  5D3D A;  4JI6 Q;  3NEM A;  3QOJ A;  2NTS A;  4HED A;  1HXY D;  1JOQ A;  2Z4I A;  2F0V A;  3FRP B;  3ONA B;  3MEH A;  4O42 A;  4NPS A;  2F0L A;  1SN8 A;  2B29 A;  5K36 H;  1X3F A;  1OXU A;  1Q82 C;  5EQ0 A;  3S14 H;  3HFZ B;  1VQ5 A;  4ULL A;  1NMG A;  2CQA A;  1EQV A;  2PQA A;  5IYC G;  1G29 1;  3PUY A;  2D5D A;  2E74 C;  4EGV A;  1IBK Q;  2EYH A;  1KRS A;  1H9S B;  4DK1 A;  3I4N B;  1JB7 A;  4BBS B;  2KCN A;  1BXT A;  2PO4 A;  1GXD C;  4IUN A;  1CZW A;  5FLX c;  3VYR A;  4MHE A;  1T5E A;  1IL8 A;  1BBW A;  4CHT B;  1L2F A;  4JK1 C;  3W3A A;  5LMN L;  3G7L A;  1CKN A;  5ISR A;  4ALP A;  1N9W A;  1SE4 A;  4K2K A;  3U58 A;  4A3D H;  4C1N K;  3KLS X;  1CA5 A;  4A3K H;  2B63 B;  3RZD B;  3PGZ A;  5FKA C;  2RHQ B;  4BXX H;  1HHV A;  3BYT B;  1D7Q A;  4QIW B;  3W5O A;  1VF7 A;  1AE3 A;  2R6G A;  5C4X H;  1OXT A;  1SFO H;  3D6C A;  2B2V C;  1SJE D;  1TWH B;  3T16 A;  1VQP A; 
#chains in the Genus database with same CATH homology
 1NR2 A;  2IX1 A;  1S4Z A;  3HOU B;  2EJG C;  1I4R A;  5ELF A;  5IGD A;  1SJH D;  1TWG B;  1SBB B;  2CHB D;  3OHX C;  1FR3 A;  3WOE A;  3JAM E;  1EYA A;  2RBM A;  3SHL A;  4XT1 B;  1VDZ A;  5CGK A;  2H4O A;  3L9A X;  3GV6 A;  3PUX A;  3RUZ A;  1XTC D;  4ZYS A;  4KTA A;  1MSH A;  1TWC B;  4IUQ A;  3AMU A;  2XRQ D;  2EY2 A;  3D3R A;  1PTO H;  3FVQ A;  3TME A;  2VB2 X;  4O1N A;  4C3I G;  1EWH A;  4DF7 A;  5I4D A;  4RKL A;  5JOB A;  2Q8R E;  3I91 A;  3OIP A;  1UAP A;  3HOY B;  2Q8T A;  3U9S A;  2D9U A;  2EZV A;  3I8Z A;  3S2D B;  2MPM A;  4KD4 A;  5C5M A;  3F2U A;  2L11 A;  1JWM D;  4RWS C;  2KOL A;  3MZ5 A;  1UNS A;  3TSS A;  1CQV A;  2DNC A;  4EVO A;  1XXG A;  4FF2 A;  2LMC B;  4I65 A;  1RJT A;  3HS0 C;  4PV1 C;  3GTP B;  3KUP A;  1U4M A;  1HUM A;  1D2B A;  4BS9 A;  1MI2 A;  1GUT A;  2Z4H A;  5IT9 L;  3DXJ C;  1C8C A;  3R8B A;  5K5P A;  1R4P B;  1S5E D;  3H6M A;  3GTG B;  3GQB A;  3NWS A;  5LL6 X;  2F3W A;  2NN6 I;  3J7A V;  3K5L A;  1X3Q A;  2E76 C;  2BCO A;  2JA8 B;  5M3F B;  3OPO A;  1EY5 A;  4YIJ A;  3ND8 A;  1D6E C;  5J22 A;  1HCZ A;  3SEB A;  2SDF A;  2A69 D;  2OEO A;  3S17 B;  1F9Q A;  5M5Y B;  4KHZ A;  4OO1 H;  1HTL D;  3S1M B;  4RA8 A;  3Q0A A;  4XQJ A;  1TS2 A;  4RGN A;  4BY1 B;  5KND A;  2F0G A;  5E3F A;  4XQN A;  2J7Z A;  2E75 C;  1C48 A;  5KNB A;  1JCK B;  1Q3L A;  1CT1 D;  1JWU D;  5KRU A;  2MUY A;  1GUN A;  2A6E D;  2ICI A;  5FO8 B;  1FGB D;  1EY8 A;  1QOH A;  2HDL A;  5FLX L;  4JBW A;  5EPJ A;  1TII D;  4F88 A;  3V96 A;  4M8A A;  5CR3 A;  3S9W A;  4C2M B;  2Q8I B;  2F0Q A;  4QMG A;  2JXM B;  3MFG A;  1RF2 D;  2VXW A;  4DXF A;  1IW7 C;  1DXM A;  5IOD A;  4CKC A;  1O7Z A;  5FK9 C;  1U9R A;  1KNA A;  5EGT A;  1JIC A;  5BN4 A;  1Z6H A;  5EBC A;  1HFG A;  1HPC A;  3K6O A;  1B50 A;  4ID6 A;  1S5D D;  2L55 A;  3D4D A;  2CW0 D;  4RHR A;  5C0X I;  5IOC A;  1G2T A;  1EU4 A;  5KGU A;  1R9T B;  1PRT D;  3R3O A;  1BNZ A;  4KY7 A;  5I9P A;  5KEE A;  5E4X A;  3D6W A;  4B08 A;  2E2J B;  3V05 A;  2C5C A;  5EPK A;  4G7H C;  3MXU A;  4X3U A;  3FPP A;  2EYM A;  4DU9 A;  4ZAI A;  2VNU D;  1PZI D;  4RHS A;  3I4L A;  2KEC A;  4GZY C;  1LTT D;  5JEA J;  1KLU D;  2MJ8 A;  3MXG A;  1MGS A;  1CFM A;  1STE A;  2BA0 A;  2B39 A;  4XTC S;  5IIF A;  2HCC A;  4NW2 A;  1I4H A;  4FF3 A;  3DEO A;  2R7Z B;  2KA7 A;  1NAP A;  2D62 A;  2B8F A;  3H09 A;  3VYT A;  2EDG A;  1EOT A;  3T56 B;  3OWE B;  4XQQ A;  4C3I B;  1D1I A;  2M9V A;  2A73 B;  1I4X A;  2PQE A;  4IUU A;  1PTO D;  5LHY 1;  4Y7N B;  2BE5 D;  1ILQ A;  1SE3 A;  2CVR A;  5C4Z A;  4A3I B;  1LTG D;  2K5W A;  2TMP A;  2QIL A;  2WP8 J;  1YNN D;  2EYJ A;  1BBX C;  1DD2 A;  1S5B D;  2F0M A;  1F2Y A;  1SAP A;  3QOL A;  3NXW A;  4IFD H;  3H0G B;  1UUP A;  5E1F A;  5D14 A;  1HTP A;  1WD0 A;  5ELC A;  3FMC A;  4CKB A;  3I72 A;  3S1Q B;  2F0N A;  3R2T A;  3A54 A;  4ABN A;  2F0P A;  4J6H A;  3QG1 A;  2J0T D;  4IZ8 A;  2R93 B;  3M4Y A;  1BO0 A;  5ELE A;  2R61 A;  3D4W A;  2Y0S B;  5T1I A;  3M7G A;  2IX3 A;  3NBH A;  1S5F D;  1QCB D;  3MWY W;  4KI0 A;  2XWJ B;  4R8I A;  1D5Z C;  3C1F A;  1LT6 D;  4CJ1 B;  2JA6 B;  1GUG A;  5A2Q L;  2NB0 A;  5JEA G;  4RGO S;  5KIX A;  1FNU A;  2AWN A;  4KV6 A;  4E6I A;  1E2Z A;  3S14 B;  3Q23 A;  3CHB D;  2IT1 A;  1PZK D;  1Q12 A;  3MXN A;  4FXG C;  1GUS A;  1SYB A;  3T13 A;  1H9S A;  5DM7 3;  3BVG A;  3SVM A;  1PRT B;  5CV8 A;  1LT4 D;  2RVL A;  4KMU C;  3M7N A;  4IUT A;  5M9O A;  2E2D C;  3U9O A;  3TBI B;  1B9N A;  4A3D B;  5JPM C;  3J7A F;  4A3K B;  3K5O A;  2AQ3 B;  4BA1 I;  1BOS A;  1YNJ C;  1SE2 A;  3VYS A;  1HFN A;  1ZKO A;  3G6J B;  1JR0 D;  2FHT A;  2NZ1 D;  3QIA A;  2X69 A;  3C1E A;  2VB3 X;  1XWE A;  1SEB D;  2WII B;  3DWQ A;  1ILP A;  2YU9 B;  5D3I B;  3S1N B;  5CV7 A;  2NWG A;  5FO9 B;  4Q0F A;  2K7V A;  2XVS A;  2FFK B;  1B53 A;  5JPN C;  2F0O A;  2RSO A;  2RDG A;  1DOL A;  2MHV A;  1WTV A;  5I9O A;  4DGZ A;  4KY6 A;  3K5N A;  1PFN A;  1PFB A;  4U67 3;  2KED A;  3MXP A;  2A6H C;  1PTO B;  3X3N A;  4KN7 C;  1TT2 A;  4KHV A;  5IGC A;  1S5C D;  3VYU A;  2HCI A;  5J1Z A;  1AFP A;  3LNN A;  5TSS A;  3NTK A;  3MFY A;  2WV6 D;  1TY2 A;  3CRL C;  1SYE A;  1WCM B;  1TKW B;  2NUC A;  1A3T A;  4UDU C;  4FXD A;  4XXE A;  3KK7 A;  5A35 A;  2O5J C;  4PMW A;  1EEF D;  3V2T A;  1H9M A;  2PZU A;  3S2H B;  2ZT9 C;  3TZU A;  2EYP A;  4ODG A;  3P1H A;  5KYI A;  5COY A;  1EWC A;  2ID0 A;  1C4Q A;  4C3H B;  2B2T C;  3BVZ A;  2AWO A;  4A3E B;  1KAA A;  3GO5 A;  2K03 A;  3CQZ B;  3J80 L;  1SNQ A;  2F0D A;  2B2V A;  2FJ2 A;  3NP8 A;  1EZ8 A;  2HDM A;  1WTX A;  1M4V A;  3J81 E;  4N9T A;  1KAB A;  2QCP X;  1WTQ A;  5T1G A;  1MD2 D;  3KBX A;  2NN6 H;  1TWF B;  4K2L A;  2F4I A;  1QJO A;  4X3T A;  3BS1 A;  3OSO A;  3M3Y B;  5LL6 S;  1QNU A;  2NTT A;  1GOZ A;  1EY7 A;  3E6Z X;  5EKK A;  3N6R A;  4LMQ D;  4FNF A;  1JOO A;  3RZO B;  1M8A A;  3PUW A;  5IGF A;  3MAQ A;  3NHH A;  3BZD B;  1EIH A;  3SK6 A;  4DAY A;  1LO5 D;  3NPP A;  2F0I A;  1XYI A;  2RA4 A;  3A56 A;  3OOC A;  5HUR A;  4A93 B;  2LS0 1;  2C9O A;  3TP5 A;  1ESR A;  3LWE A;  2IJ0 A;  1LAB A;  3VA7 A;  3SDZ A;  3PIO 3;  5I2Y A;  1QG7 A;  3A7L A;  2IWH A;  1I50 B;  2V4D A;  1UEA B;  4CKE A;  1K8O A;  4RH6 A;  1IW7 D;  2B8G A;  1SNC A;  1SNP A;  4IUV A;  2KCC A;  1HRJ A;  3C3L A;  3WOF A;  1X3P A;  1B4O A;  2AQ2 B;  3IAY A;  4HMJ A;  2QKI C;  2ZXO A;  5BN3 A;  1PYW D;  3DUZ A;  2HQE A;  4DFA A;  1HA6 A;  1EEI D;  3RMH A;  1GUO A;  4XYQ A;  1EY4 A;  1TS3 A;  2K33 A;  3A8I E;  4H13 C;  4RFB A;  3S15 B;  5C0X H;  3E0J A;  2FIN B;  3SXH A;  2NVT B;  1Z47 A;  2WKD A;  1Y8O B;  4FF4 A;  2IPK D;  2WB1 B;  1LTA D;  5K36 G;  5NUC A;  2PNR C;  4I7Z C;  2SNM A;  4L8J A;  3CU7 A;  3VR2 A;  3OMC A;  3T51 B;  4ZK9 B;  2PZT A;  1F9R A;  3MTS A;  5C3X A;  5C4H A;  3K57 A;  1EY9 A;  3NUC A;  1KDC A;  1CTM A;  1STA A;  3MC0 B;  3KLS A;  4ZQ3 A;  1NR4 A;  2NBF A;  1STH A;  1SYD A;  3HG9 A;  5DM6 3;  1D1K A;  1J9O A;  4K8I A;  3D4R A;  1TQO A;  5JVH 3;  1HQM C;  5EKI A;  1EYC A;  2K6A A;  5F2D A;  1FD7 D;  3Q22 A;  5IT9 E;  2A68 C;  2RDH A;  4KK7 A;  1PZJ D;  3BVM A;  1TVX A;  3M85 A;  4DXG A;  3HRZ C;  4KY5 A;  1JB3 A;  2FMC A;  2KQ3 A;  3P75 A;  1W6J A;  4BBR B;  2LKV A;  1DZ1 A;  4FXK C;  4PQX A;  1QE6 A;  1RTN A;  5G3L D;  1SMY C;  3GTJ B;  1AW7 A;  5FOB B;  2KHS A;  4QB4 A;  1ENC A;  5DAU A;  2K04 A;  3A7A B;  1O78 A;  2NN6 G;  4WRD A;  4XT3 B;  1QWY A;  2A69 C;  1KDA A;  2LFN A;  4U68 A;  1RTO A;  1QIL A;  3EVQ A;  4RGM A;  4DK0 A;  2AUJ D;  2EE1 A;  2QF7 A;  1ROD A;  1Q1E A;  1ONL A;  3GTM B;  4K8J A;  1B3A A;  4KJN A;  3IKJ A;  1ZEQ X;  4KKS A;  3TP7 A;  3RLF A;  2EY5 A;  5FLX E;  1STG A;  1Y8N B;  4K5W A;  1I4G A;  1DM0 B;  3C46 A;  4RGT A;  2B2W C;  1SND A;  2AUK A;  3FEW X;  3HGB A;  2QDB A;  4C3H G;  3H3V C;  2JA7 B;  1G8Z D;  4DA2 A;  1I6V C;  1ENF A;  5CV5 A;  1SXT A;  1SNO A;  2GA4 B;  3QB3 A;  2DY7 A;  3DMU A;  4LJZ C;  3UI2 A;  1STN A;  1Q1B A;  3FPU B;  5C3E B;  4IAL A;  2RQX A;  3I4M B;  3FKI B;  2G9H D;  1W6K A;  3SK4 A;  1G2S A;  4H44 C;  4G7O C;  2X6L A;  3S16 B;  4ZRZ A;  1U4P A;  1GUW A;  3R2I A;  1A3U A;  3P7J A;  2NVX B;  3SK5 A;  4K5V A;  2BOS A;  5CV4 A;  1ICW A;  4IUR A;  3GP7 A;  3K0Y A;  3QWN A;  3TP6 A;  5ELD A;  3M4O B;  3L3O C;  4J1M A;  2K01 A;  2HUG A;  5AFW A;  4OO1 G;  1EZ6 A;  1SYF A;  4WFN 3;  2XN9 C;  2WAC A;  3PUZ A;  4FP5 D;  1ZYR C;  1SYC A;  1O7L A;  1MSG A;  1YNJ D;  2L12 A;  2XWB B;  3ND9 A;  1JC7 A;  1A3V A;  1NCV A;  3H94 A;  4EQP A;  2JSO A;  1CM9 A;  1FNW A;  3KBG A;  3H91 A;  1QB5 D;  1JE4 A;  3T4A C;  4C56 C;  1BCP C;  4IN3 A;  2M00 A;  4ILW A;  2K5D A;  1LTR D;  1PLF A;  2B2Y A;  2PYK A;  2KVM A;  1F2M A;  4NMZ A;  5EPL A;  4S3S A;  2O4X A;  3P20 A;  1PRT F;  3W2D A;  4IFD J;  1ENA A;  5G3L F;  4A3G B;  1VMP A;  1IYU A;  2XNA C;  2X6G A;  1OXS C;  3KLR A;  4R9W A;  1ZXT A;  1I3Q B;  2A6H D;  1AEX A;  1F9P A;  5D65 A;  5C5L A;  3HOZ B;  2L9H A;  4OIK A;  2WAQ B;  1STY A;  4FVM A;  1WTO A;  5EKL A;  4XYO A;  2F0S A;  2F0E A;  4A3F B;  2DY8 A;  4CJ2 C;  2OT2 A;  2BDO A;  5JVG 3;  1CK1 A;  1EL0 A;  2TSS A;  5DEH A;  3HOW B;  4FO2 A;  2FMM A;  3NQT A;  4C3J G;  4F7X A;  3HP3 A;  5C4X B;  2L5T A;  2L0C A;  1SFO B;  3PUV A;  2NVQ B;  5EJW A;  2B2U A;  2ZXP A;  1GJX A;  2F3V A;  4F8M A;  2EYO A;  3I73 A;  1PTO F;  3TDQ A;  2F0F A;  2F1M A;  4Q5V A;  1CHQ D;  5HGT A;  2VUM B;  2EY1 A;  2I07 B;  3PIP 3;  1E2W A;  3D31 A;  4WOR A;  1PMR A;  2EOT A;  2A5H A;  5CBE E;  4J8Q A;  4L6T B;  3JAM L;  2KJX A;  2KUM A;  1RD9 D;  5COR A;  3WDN A;  1CHP D;  3T53 B;  5A2Q E;  1EFI D;  3A55 A;  5IGB A;  2F0J A;  3PO3 B;  1K8M A;  3E5S A;  2ENB A;  5C3W A;  1VF5 C;  1H9K A;  1A2T A;  4FYD A;  1D5M C;  3IFT A;  3S1R B;  1GHJ A;  2IL8 A;  4TSS A;  1LTI D;  1Y1W B;  3K58 A;  5FO7 B;  1IKL A;  2MGS A;  2ZXR A;  2R3Z A;  1EU3 A;  2WKC A;  2MP1 A;  3D8G A;  4ME5 A;  2M2L A;  1V1P B;  1RCV D;  2E2H B;  4RAU C;  1HUN A;  1T5X D;  1X32 A;  3GD7 A;  3OIQ A;  4IFD G;  1I4P A;  4HSV A;  1V1O A;  1D5X C;  4LAA A;  1ET9 A;  1CQF A;  2F0K A;  2E2I B;  4K6L A;  3OMG A;  1E0B A;  1B2T A;  2F0U A;  3SE0 A;  4IUP A;  3EJI A;  1PDQ A;  4PMB A;  5M5W B;  1XX8 A;  1JQY D;  2PPB C;  3A8J E;  3ZYY X;  1OXV A;  4RKB A;  3J7Y W;  2B2T A;  2ICE C;  4DN4 M;  1SDF A;  4CGY B;  5EBD A;  2OXP A;  1F2Z A;  3Q24 A;  1RKN A;  1KNE A;  2EJM A;  3AB9 A;  1LTS D;  3DM1 A;  4DAV A;  2JEA I;  1LV9 A;  1OXX K;  1I4Q A;  3BDO A;  4DNT B;  4AYB B;  1ESF A;  2OF1 A;  1BDO A;  4BWG B;  2RSN A;  3CKI B;  1RDP D;  3MA2 B;  1ET6 A;  2QEJ C;  3BYY B;  5ELB A;  4CBV A;  3PV0 A;  4HR7 B;  3O13 A;  2LY7 A;  4F87 A;  4V0B A;  2O5I C;  1AP0 A;  1NSN S;  3K7A B;  1LTB D;  5M3M B;  4TRD A;  1Z7T A;  1H9R A;  1TR5 A;  4B9W A;  3DWP A;  1KTK A;  1VCI A;  1TU2 B;  3TP8 A;  3LWU A;  2K1B A;  2O2L D;  1JOK A;  1B9M A;  3EFX D;  2RDF A;  5M5X B;  3J80 E;  4B9X A;  2A68 D;  4OIJ A;  4G57 A;  4NKL A;  1V43 A;  2RKS A;  3MHB A;  1EIG A;  4IQZ A;  1SNM A;  4DNR B;  3QO2 A;  1TS4 A;  3TN2 A;  3C2P A;  1WTP A;  2JP1 A;  4HCS A;  1CZG A;  5I2X A;  4QUC A;  2AQ1 B;  5C4J B;  1F2L A;  4HAE A;  5CBA E;  1I6H B;  3OWF A;  3NWT A;  1WVL A;  1SMY D;  2XIW A;  4ZKC B;  2PW5 A;  4HSP A;  3X3M A;  2F0T A;  2I46 A;  3NBI A;  4QF4 A;  1DCZ A;  5IGE A;  1EQT A;  1U4R A;  4C3J B;  4DAP A;  4PNY A;  1DOM A;  3I90 A;  1K83 B;  1L0X B;  2L4N A;  3GV3 A;  1BUV T;  5C6A A;  4KD3 A;  5J39 A;  1DOK A;  2DNE A;  5CMD A;  1EYD A;  2JE6 I;  3LX0 A;  1OO9 B;  1AZP A;  1O80 A;  2EVB A;  1A15 A;  2EJF C;  2K32 A;  3DEP A;  1Y69 U;  2PZW A;  5C0X J;  4X3S A;  5I6W A;  2IX0 A;  3EQL C;  3GTL B;  1Y8P B;  3VR6 A;  1KDB A;  5JEA H;  3IL8 A;  2Z8L A;  4LK1 C;  4ZLT F;  1TY0 A;  1B1Z A;  1HA5 A;  4R8N A;  3FDT A;  4FF1 A;  3K59 A;  2BA1 A;  4OL7 A;  2F0H A;  3I70 A;  1VMC A;  3NSW A;  4RCN A;  4RCO A;  5KYL A;  1V8Q A;  1Q8I A;  1O7Y A;  3PMF A;  4OO1 I;  5CYU A;  4BA2 I;  1CA6 A;  4K5X A;  2R92 B;  4XDX A;  2XRS D;  3DWA A;  2PMZ B;  2Z1C A;  1J8I A;  2PCF B;  5KNC A;  4A3B B;  1NUC A;  4C1N I;  1ZYR D;  4PMC A;  1PXU A;  3SR1 A;  3I3C A;  3R93 A;  4A3M B;  4G7Z C;  3BDL A;  5E4W C;  1L0Y B;  1A2U A;  2SNS A;  2A6E C;  1QNK A;  4KKT A;  3A8K E;  1F9S A;  5C44 B;  4CJ0 B;  1BR9 A;  1BCP D;  3GTK B;  1SYG A;  1U4L A;  1WTW A;  3MVV A;  5CV9 A;  2A74 C;  4X3K A;  3VA5 A;  2NVY B;  3DHQ A;  2B2W A;  5CV6 A;  2EPB A;  4P2C B;  4BY7 B;  1EY6 A;  2N88 A;  1PFM A;  1H9J A;  4EQO A;  1F77 A;  2K05 A;  4Z9C B;  1DJR D;  1IYV A;  3K5M A;  2SEB D;  4TKO B;  1AZQ A;  1CI3 M;  1BF4 A;  4KKU A;  4UAI A;  2CW0 C;  1SSO A;  3VR4 A;  1IKM A;  3HZX A;  1PRT C;  3ITP A;  1Q90 A;  4A3J B;  1LT5 D;  1A6X A;  1RHP A;  2IW3 A;  1II3 A;  4MIU A;  5C0X G;  2WIN B;  4V19 0;  1TS5 A;  1Y1V B;  5I6Y A;  2EY6 A;  4XIG S;  4H0L C;  1FNV A;  3PO2 B;  3SK8 A;  3NQI A;  2DN8 A;  3KF8 A;  2PW7 A;  1GHK A;  4NDX A;  3OW7 A;  1TWA B;  1LLR D;  2JEB I;  5CC4 A;  3GTO B;  2YYZ A;  2B2Y C;  4HN7 A;  3L7Z C;  4MN3 A;  5JAV A;  2BDN A;  3RD4 A;  1ML0 D;  4OGQ C;  1BQQ T;  5IGG A;  2F03 A;  2J4X A;  5DNF A;  4ZUI A;  2JYO A;  3URY A;  2EYF A;  1STB A;  2EXZ A;  3NE5 B;  2NYZ D;  3CRK C;  2K28 A;  3NK9 A;  1LT3 D;  2G9D A;  3AU7 A;  2F0W A;  3NTH A;  1PTO C;  3ERQ A;  3HOX B;  4H7B A;  2BE5 C;  4N9P A;  1DYQ A;  1JWS D;  4KJO A;  1G91 A;  4G4K A;  1WD1 A;  1MBY A;  3TZD A;  2KEE A;  3BG3 A;  1KLG D;  4M1U B;  5BN5 A;  1YNN C;  1HQR D;  4IFD I;  2JA5 B;  2D2C C;  4WJW A;  1R4Q B;  3HOV B;  2N55 A;  3Q6S A;  1LAC A;  1JOR A;  4KN4 C;  4HMI A;  4K6D A;  2EYL A;  2XSC A;  1IHZ A;  4K14 A;  1BCP F;  4QCL A;  4QUF A;  1V1P A;  3N52 A;  4ZKB B;  1E2V A;  2B2U C;  1G6Z A;  2K5Q A;  1B44 D;  5JJZ A;  3VR3 A;  1EY0 A;  3BDC A;  1DON A;  1WTR A;  3IFD A;  4HCE A;  4HTH A;  3HKZ B;  3GTQ B;  3ERO A;  3QJY A;  4EQN A;  2SOB A;  3NTI A;  3HEJ A;  2L1B A;  4ZUJ A;  4NP5 A;  1FYC A;  1BCP B;  2H1E A;  4OHJ A;  4L63 B;  1AN8 A;  3J81 L;  3VR5 A;  4TQU S;  3EA6 A;  5D3D A;  3QOJ A;  2NTS A;  4HED A;  1HXY D;  1JOQ A;  2Z4I A;  2F0V A;  3FRP B;  3ONA B;  3MEH A;  4O42 A;  2F0L A;  5K36 H;  1OXU A;  5EQ0 A;  4ULL A;  2CQA A;  1EQV A;  1G29 1;  3PUY A;  2D5D A;  2E74 C;  4EGV A;  2EYH A;  3I4N B;  1H9S B;  4DK1 A;  4BBS B;  2KCN A;  1BXT A;  2PO4 A;  1GXD C;  4IUN A;  1CZW A;  3VYR A;  4MHE A;  1T5E A;  1IL8 A;  4CHT B;  4JK1 C;  3W3A A;  3G7L A;  5ISR A;  1SE4 A;  4K2K A;  4C1N K;  3KLS X;  1CA5 A;  2B63 B;  3RZD B;  5FKA C;  1HHV A;  3BYT B;  4QIW B;  1VF7 A;  2R6G A;  1OXT A;  3D6C A;  2B2V C;  1SJE D;  1TWH B;  3T16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...