3HOZH

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
146
structure length
136
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 19
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hozH00
4YY3Q 5IYDG 3CMAA 2AMCB 3PUVA 2B63H 2ASBA 4L5TA 3LGJA 4LFBQ 2GN5A 1YZ6A 2IHFA 1EUJA 2K14A 3RLOA 4JI3L 2D0OA 4LF5L 4JOIA 4B3SL 1LUZA 1A8VA 2CCZA 1B8AA 4P73A 4IPGA 4R1JA 4A3CG 2BH8A 2JA7H 3E9HA 4AH6A 1K0RA 4GLAC 1N9WA 4NB3A 3BZCA 5BR8Q 1Q46A 1X3EA 3U4VA 5C44G 1U0LA 2F52A 5EAYA 1VQ9A 4IFDI 1MKHA 1YJNA 3HOWG 4UP8A 5M3MG 2R6GA 1GM5A 4JCVE 2ATWA 4HJ5A 1CKNA 2K4KA 3JAMc 4LF6L 2LSSA 4YWMA 4MTNA 4JBKA 2Z6KC 4JI7L 1PH5A 4LFAQ 2JA8G 4BY7H 3T1HL 4RG1A 5FJ8H 4AYBG 5C4JH 1K83H 1N36L 4OWWB 2L15A 1TWCH 2DUDA 1L1OB 3JC66 4IPCA 5FLMG 3UDGA 3GD7A 4NPSA 1PV4A 1HZCA 2A19A 4TQUS 2UUCQ 1K3RA 4QY7A 1JB7A 3U58A 2R7ZG 1AE3A 4A3BH 3MEFA 4DV3Q 1V43A 4GOPB 2EQSA 1YIJA 3IRBA 1N32L 2LXKA 2V1CC 1HZAA 5GADC 1D7QA 4HJ8A 2BH2A 1VQPA 2DGYA 1Q8KA 1VQJA 3MXNB 3M7NA 1QUQB 2I5HA 2F3IA 5M3MH 2ZJQA 4P71A 4IPHA 1L1OA 3HOUH 2JJQA 1UE6A 1HZ9A 3CC2A 3J80i 4PZ6A 2ZM6Q 5HY6A 1I3QH 2MQHA 2Q2UA 3A74A 4P75A 2OCEA 1CKMA 2VUMG 4BBSH 3K8AA 4DV6L 4LF6Q 3AYHB 1MIUA 3H0GG 1ASZA 3PO3H 3HOYG 4X62L 4LFBL 1HNXL 4YHHQ 2K5VA 4AQYQ 4KHZA 4A3JG 2N8NA 5IP7H 2JK8A 3KF6A 1E3PA 4YY3L 1HNZL 4X65Q 2AKWB 2UXBQ 2Y0SG 3PUWA 4GKKL 1WI5A 5JJKA 3S1RH 1X56A 3CXCA 1EQQA 4MZ9A 4BA2I 2CWPA 3G48A 4JI0Q 1L2FA 5H1SE 1K9MC 4JC0A 2YU9H 4AIMA 1YITA 4DV7L 1E22A 2JQOA 1EFWA 2R92H 4A3DH 2N3SA 4O0AA 4QGUA 3ULLA 3Q8DA 4GN3B 4YHHL 4JYAL 4DV2Q 1NJIC 2YV5A 1Y1WH 2GVBA 3WWVA 3EN2A 3A5ZB 4IJLA 1KIXA 1XNRQ 2UXCQ 5IWAL 3K7AH 1E1TA 1QVGA 4GN5A 2WB1G 4IJHA 4NXNL 3G6EA 1M1KC 2UXDQ 3K80C 3I2ZA 3M85A 5LMUQ 1E7ZA 3A0JA 3HOZH 2KBNA 2NN6I 3PUZA 3S2DH 1PH9A 4O2DA 1SROA 2A1AA 5C0XG 4A3KH 3CP0A 4DV2L 1J5EQ 5HGQA 4JYAQ 2KHIA 1IZ6A 3S2HH 3CCSA 1PYSB 1X3FA 4DR1Q 2VY3A 3HOXH 2PQAA 3RN5A 2AWNA 1S72A 1C9OA 2JA5H 4LNQA 3H0GH 3H15A 3S15H 3ER0A 4LWCA 3TQYA 3RR5A 1S40A 4DKAC 3HKSA 1N34L 2E2IH 4B3MQ 4GKKQ 1B7YB 4GLVB 4UP7A 1P16A 4XTCS 4JI0L 1HNXQ 4ME3A 4DK3C 3I56A 3TS2A 1KQSA 3S1MH 5J3BA 1Z9FA 4YCWA 5IYBG 3T1HQ 2VUMH 4B3RL 1VS0A 1PFSA 2PNHA 2C35B 5M5WH 5IP7G 1G291 1SLJA 4DUZL 3KDFB 2I5LX 2VNUD 2YYZA 3CCRA 1I94L 1G6PA 4JG2A 4IOCA 3J81j 4EQ5A 3CQZH 2MNAA 4LUZA 3CPWA 4DV6Q 1R9TH 1IBKQ 1VQ5A 3CCEA 2JEAI 3PIPA 3HOVH 2N78A 4DV1L 5BR8L 2VW9A 3M4QA 2B3GA 1PHJA 4A3MH 2PMZE 3I7FA 1YI2A 1TWHH 1VQCA 1NY4A 3OTOQ 3HKZG 4HIMA 4JI8L 1BBUA 4JI6L 3CCJA 2Z6KA 1CUKA 1KHIA 2IT1A 1YHBA 2RHQB 4A4IA 4AYBE 5LMNL 4A3IG 1A0IA 1YJ9A 1UE1A 1PA6A 4BY1H 1FGUA 1RL2A 1N8RC 1XMQQ 1SMXA 3TEHB 3ICEA 2N49A 3CCUA 3AFQA 2QA4A 4X64Q 1I5FA 1PVOA 5C4XG 2I5MX 3RZDH 4POGA 2JA8H 2BA0A 1YVCA 4IFDG 4A3FG 2IY5B 1N33Q 5LMNQ 2ZTDA 1OXUA 3CPFA 2E2HH 5K36G 2VQEQ 4DR5L 2VQFQ 2HIVA 4A3BG 1TWGH 2HQLA 1NBWA 5M5XH 5FLMH 1HNWL 1H95A 1O7IA 3KLWA 1CSQA 5C3EG 4B3RQ 2K75A 3CAMA 1WOCA 2JEBI 1VQAA 4APVA 1VQDA 1GVPA 4DV4L 2R92G 1IBKL 3PUXA 1PH7A 3K81C 1SFOH 4A75A 3K0XA 5IE8A 4A3LG 1HNWQ 2D0PA 4IO9A 1NMFA 4K0KL 2HHHL 3GTQH 4HJ7A 3STBC 1LTLA 1KXLA 3E0EA 3VDYA 1JMCA 1UE7A 2NVTH 3CCMA 1P8LA 4LF7L 1TXYA 4DUYQ 3B6YA 2ZJRA 3HOZG 2NZOA 1EWIA 1A62A 3AEVA 4DAMA 3M4OH 3PO2G 4J15A 3PGZA 1KL9A 2HHHQ 1VQFA 4NXMQ 5IYDH 2OTJA 4L5RC 2D62A 3OW2A 1BVSA 4GLXA 4JV5L 1Q12A 4RMFA 1Q81C 1XMQL 3KF8B 1VQGA 2I0QA 4A3EH 1PH6A 4JBJA 5IYCG 3HOXG 1EYGA 5M3FG 5GAGC 4JBMA 1XNQQ 2IHEA 4DK6C 1EIYB 3PO2H 4JI8Q 1Y1VG 1OXVA 2K52A 1A63A 4YWLA 4A3DG 4C3JH 2MO1A 3UDXA 2XTIA 2UXDL 2MFIA 4DV7Q 4JI2Q 2JE6I 1K8GA 2OWOA 1BBWA 5GROA 4GOPC 1X3GA 1XNRL 3UDIA 3S1QH 4A3LH 4JBWA 3M9BA 5AJ3Q 1I94Q 2QGQA 1N36Q 1WCMG 4X64L 1XMOL 2B29A 2UXBL 3CCVA 4GNXA 1NTGA 3STBD 5IYCH 4DR3Q 1I6HH 1XTDA 1CKOA 4LF7Q 1QVFA 1PYBA 4GKJQ 2JA6G 3PO3G 3T1YQ 1MJEA 1VQOA 1W3SA 4GN4B 2YTYA 4L5QA 3HOUG 4JI5L 1I50H 1VQMA 4YCUA 1BKBA 3NEMA 1QUQA 1IL2A 4B3TQ 4HJ9A 4R4CA 3ULJA 2R93H 4GNXB 2PQAB 3KF6B 1WYDA 1E24A 4LW1A 4X66L 3GTJH 2FXQA 2EIFA 2Q2IA 3J81i 3T1YL 3RN2A 3W5OA 1GKHA 3TS0A 4LF9Q 5JEAG 4LF4L 3I4MH 2WAQE 3CC7A 1QZHA 4DUZQ 4BY1G 3L7ZC 3CCQA 4UY8C 5IP9H 4OX9L 1SRUA 1FJGL 3F8TA 1HJPA 2WAQG 1IBML 3KYHC 4WJ3M 4PZ7A 4BBSG 2KHJA 2VL6A 1EIFA 1XPRA 4PZ8A 4KHPL 3CMEA 3HFZB 2Q2HA 2IX1A 4BBRH 2AHOB 1OXXK 4BXXG 4HIKA 2Z0SA 5FJ8G 5JJLA 3GTPH 2R93G 5GQOA 4JI7Q 5ELOA 2R7ZH 2CQOA 3GTGH 1VCIA 2UUCL 2NVQH 3J81c 3KJPA 2NVYH 1OXSC 3OTOL 3ERSX 4YCVA 2F4VQ 4DR6Q 2WFWA 4OWXB 4BXXH 4QQBX 3PCOB 5C44H 4R4QA 2E2JH 3J7ZC 1JJ2A 2CWAA 2ID0A 2JA7G 3CW2C 4KI0A 4QIWE 3S24A 4NXNQ 4X62Q 1OTCA 2E5LL 1AE2A 3U4ZA 4DR5Q 1QVCA 3GDEA 4P72A 5C0XJ 2OQKA 2BA1A 4DUYL 4DR4Q 2EXDA 1TWAH 3S17H 4BY7G 1J6QA 5GAHC 3DM3A 3A5UA 4DV0L 1PH3A 4QL5A 4B3TL 1X9NA 3GTLH 1VQBA 3FKIG 3BJUA 5JJIA 1X6OA 1YHAA 4C2MH 1LYLA 4LFCQ 2MO0A 4A3GG 3RLNA 1VQ7A 4JI5Q 3I55A 2R7FA 4JOIC 4DV5L 2VZAA 3KDFA 1EOVA 1V1QA 3H3VH 1VQIA 3S1NH 2PI2E 3EIVA 5M5YH 3F2DA 4DR3L 1Y1VH 4JI1Q 1OXTA 4LFCL 3DLLA 1VQNA 2KENA 1HR0W 4PMWA 1D8LA 3H3VI 1J5EL 2VQFL 4TVAB 3RLFA 4YWKA 1XPOA 4GOPA 2UUBQ 1K8AC 4XIGS 3GTKH 1Q1BA 3W1GA 2R7DA 3W1BA 2ES2A 2UU9Q 3UDFA 1YJWA 4QJFA 2JA5G 4OX9Q 1FJGQ 4JV5Q 1WJJA 3AQQA 3AFPA 1IBLL 3UE1A 3F2CA 1HR0Q 3RZOH 2LXJA 4IFDJ 2KCMA 1JJCB 4JI6Q 2QEXA 4DR6L 1ASYA 3G71A 1C0AA 2YTXA 3F2BA 4K0KQ 1X55A 1JE5A 4X65L 1HNZQ 4B3SQ 3KJOA 5M3FH 1YHQA 1VQLA 1VQ6A 1AH9A 1RIPA 3K7UC 1NE3A 4HIDA 4A3EG 1Q86C 1X65A 1CSPA 3BU2A 3NBHB 3HOYH 1S3OA 1PH2A 4OXPA 3SGIA 2ZJPA 1YNXA 4DR1L 1IBMQ 1HZBA 1TWFH 1YBYA 4HJAA 4A3JH 3D0FA 3L2PA 3D31A 3PF4A 2ZM6L 3GO5A 4DV0Q 4LF9L 4DR7L 5JEAJ 2PI2A 1KRSA 4DR2L 3TRZA 5LMUL 1UWVA 4DAYB 4DV4Q 4A3GH 2KCTA 3OYYA 3ULPA 5C3EH 1UE5A 2CFMA 4BBRG 3FKIH 1VQ4A 4A93H 2UXCL 1Q1EA 2A8VA 1KRTA 4WJ4A 4JI4L 5C4XH 3M3YH 2ALYB 1X54A 1M90C 3G4SA 3J7A5 3FHWA 1IXRA 1CKNB 1IYJB 5LMNW 3NELA 3CF5A 1VQ8A 1N32Q 4LUVA 4A76A 4UPAA 1N33L 4A3FH 1FVIA 3BZKA 2CKZB 2VS1A 3KOJA 4HIOA 1W2BA 2OTLA 2HT1A 2ZTCA 4DNIA 3I4MG 2YTVA 4LF8Q 2UUAL 1V9PA 4POFA 1L1OC 1FL0A 5AJ3L 2K5NA 4JI4Q 4NXML 1QZGA 1XPUA 4LFAL 2UU9L 4AQYL 3RNUA 1K73C 2RF4A 4EX5A 2GVAA 1Y14B 1PH8A 4DR4L 1VQEA 4UP9A 5IWAQ 2NZHA 1GO3E 1EQRA 1Z47A 4H02A 4LUOA 1LM0A 5IP9G 4DPGA 4MNOA 5FLXc 2Q2TA 1Q82C 1GD7A 3GTMH 1SE8A 4LF4Q 4GNXC 4A3CH 1VQHA 3HKZE 4DV1Q 4A3IH 1SN8A 1KD1C 3HOVG 1U5KA 3GTOH 1YEZA 4JI1L 4PG3A 4X66Q 4L5SA 3HOWH 1JT8A 2WB1E 4IPDA 2ZTEA 4DR2Q 4C3IH 3CC4A 3M4PA 3E9IA 4A3MG 2JA6H 5IY0A 3PIOA 1SR3A 4DR7Q 3L0OA 2NN6G 3FP9A 4DV5Q 4A93G 3PV0A 1DGSA 4OO1I 3NENA 1KAWA 3J80c 2OQ0A 5DLQE 5ELNA 1N34Q 4B3ML 1MJCA 2E8GA 2NVXH 1WCMH 4Y52H 1XMOQ 4KLKA 2H5XA 5GAEC 1L0WA 3UE0A 4DV3L 4GKJL 5C0XI 4X6AH 3CD6A 1E1OA 2WP8J 3TREA 3KFUA 4KHPQ 2E5LQ 4BA1I 4ALPA 1IBLQ 2UUAQ 5IYBH 4GS3A 4OWTB 1XJVA 1WFQA 4R4IA 3I4NG 3ZJYC 1Y1WG 4Y7NH 1C7YA 2F4VL 4R4OA 2B63G 1HR0L 3F1ZA 4JI2L 3S14H 4C3HH 1KC8C 3PF5A 2RCNA 4OONA 5IT9c 1PH1A 3PSIA 2IX0A 4R4TA 3S16H 3I4NH 1UEBA 2VQEL 2RHSB 4FDBA 1JJGA 1Q7YC 1PH4A 3EBEA 4P74A 1T9HA 2XGTA 5E7NA 1G51A 2JA9A 2K50A 2K5HA 3U50C 3JAMi 2UUBL 1XNQL 2Y0SE 4OO1G 4LF5Q 3CCLA 1HH2P 4JI3Q 1NMGA 3I4OA 4A3KG 1B70B 2HIXA 3PUYA 4IOAA 2AWOA 4LF8L 1VQKA
chains in the Genus database with same CATH superfamily
3PUVA 3LGJA 2Q8TA 3VR4A 4EVOA 5I2YA 3O13A 4JI3L 5EPLA 2B63B 4R1JA 4A3CG 3OIQA 3BDOA 3U4VA 4KK7A 5K36H 1S5CD 3DWAA 4UP8A 4JCVE 1CKNA 2HCIA 1RKNA 5IGBA 1U4MA 1PH5A 4LFAQ 4ZKCB 1C4QA 3AMUA 5FJ8H 4AYBG 3I4MB 2L15A 4CJ1B 4IPCA 4BXXH 1GJXA 3UDGA 1WD1A 2R7ZG 3I90A 4JW0A 2KHSA 4A3BH 1PTOB 5IOCA 3MEFA 4DV3Q 4FF4A 2EQSA 1YIJA 2LXKA 4KY6A 5CC4A 1HZAA 1D7QA 2Z6BA 2DGYA 1EY4A 2OXPA 1JWUD 5KYIA 3HOUH 2NVXB 3CC2A 3VYSA 1EYAA 5K5PA 2F1MA 5IT9L 3IL8A 5HY6A 1I3QH 2F0IA 3NHHA 3A74A 2OCEA 4N9PA 4BBSH 1BOSA 4FF3A 4LF6Q 1PFBA 4X62L 2VB2X 4YHHQ 4AQYQ 2EDGA 2QF7A 1HNZL 2SOBA 4X65Q 2UXBQ 3PUWA 1H9MA 3CXCA 2B2TA 3R8BA 1IW7D 4JI0Q 1L2FA 1K9MC 1D5XC 1E2ZA 2RDFA 4CJ2C 1O7YA 3IKJA 4A3DH 3Q8DA 3QB3A 3E0JA 4NDXA 2LKVA 2YV5A 5D3IB 3A5ZB 1XNRQ 1KIXA 2UXCQ 4U673 5I6YA 4R9WA 1M1KC 1EEFD 3MTSA 3V96A 3PUZA 1J5EQ 5HGQA 1IZ6A 1SDFA 1CZWA 2AQ1B 3RUZA 4GZYC 3HOXH 4EQOA 1D5ZC 4JVZA 2D5DA 1D1IA 2B2VC 3H15A 3S15H 3TQYA 2KVMA 3E5SA 4DKAC 1IW7C 1N34L 2WAQB 1KAAA 2TMPA 1DJRD 1ILPA 2FINB 2KA7A 3NQIA 2A6EC 2VUMH 4B3RL 1A3TA 5KEEA 2I5LX 2YYZA 3CCRA 4H7BA 4E6IA 4N8X1 1R9TH 5ELFA 2MNAA 3RZOB 1GUOA 2JEAI 3HOVH 4DV1L 5BR8L 5CYUA 4ZKBB 4QUFA 4X3SA 4G7ZC 1SMYC 3MFGA 1TWHH 3OTOQ 3HKZG 1PZKD 1BBUA 1F9PA 3CCJA 1C0AA 1KHIA 2IT1A 1KD1C 3DWPA 1RL2A 1N8RC 1EEID 1MSHA 3AFQA 4X64Q 1E2VA 2F0PA 4LJZC 5C4XG 3NXWA 3PO2B 1PMRA 3S1NB 1OXUA 2BDOA 2VQEQ 5M3FB 3FEWX 1GXDC 4XQJA 3KF8A 3MZ5A 1U9RA 4RGMA 1H95A 1HNWL 3H0GB 3I70A 1O7IA 3S17B 1V1PA 1SNDA 1WOCA 2DY7A 1VQAA 1PRTD 2F0KA 2R92G 3PUXA 1M8AA 3S2HB 1HNWQ 4IO9A 1S5BD 3DM1A 5C44B 4K0KL 3KLSA 2HHHL 4C3JG 4HJ7A 3VDYA 1JMCA 1UE7A 1IHZA 2LMCB 4A93B 4LF7L 1TXYA 4BWGB 4A3GB 4DAMA 2CH4W 3CQZB 5FLXL 4ZAIA 2D62A 2B2UC 1XMQL 2E2DC 2K6AA 3VYUA 1R4PB 1PH6A 2AUKA 4KKTA 5GAGC 4IUPA 2IHEA 5C4JB 1B44D 1OXVA 1DONA 5D65A 2K52A 3GTLB 1HUMA 4PMCA 4C3JH 4FF2A 4IN3A 2XTIA 3SHLA 2JE6I 4PQXA 1XNRL 1LO5D 4JBWA 5AJ3Q 2QGQA 1WCMG 1XMOL 2B29A 1CFMA 1FGBD 1NTGA 1NUCA 2A73B 3STBD 5DM63 2L5TA 4DR3Q 1XTDA 4LF7Q 3J7YW 3HOVB 4ID6A 4QUCA 3T1YQ 3V05A 1VQOA 1W3SA 1MSGA 2DNCA 1HA6A 3JAME 2IJ0A 1I50H 1ENFA 1NNXA 4YCUA 1BKBA 4TKOB 5C5LA 4A3BB 1TWFB 2R93H 2PQAB 1WYDA 2KCNA 4X66L 4XT1B 2Q2IA 1DOMA 3J81i 4YIJA 4IQZA 2GA4B 5IP9H 1TR5A 3SK6A 1JR0D 1HJPA 1IBML 1Y8OB 1O7LA 4PZ7A 4BBSG 1JOQA 1XPRA 4ME5A 2L11A 3HFZB 4Y7NB 5CMDA 4BBRH 4HIKA 3MXGA 3OSOA 3AU7A 5JJLA 2R93G 4OELB 5ELOA 1SSOA 3U9OA 3GTGH 1SJHD 2J0TD 4G57A 2WB1B 3ERSX 1VDZA 1QILA 2WFWA 4QQBX 3PCOB 5C44H 4R4QA 2E2JH 2F0MA 3S24A 1SNOA 2E5LL 2KCCA 4HSPA 2CQAA 3ONAB 4CDFC 5C0XJ 3S17H 1F2YA 5GAHC 3BS1A 4UDUC 5FO9B 4QL5A 3T4AC 3S1RB 3VA7A 4C2MH 4LFCQ 3C46A 2MO0A 2DNEA 4JOIC 2F0TA 5NUCA 3KDFA 4L6TB 1O7ZA 4A3EB 3F2DA 1Y1VH 4AYBB 2BOSA 5CV5A 1EU4A 3DLLA 1VQNA 2AUJD 4OL7A 4I7ZC 1Q3LA 2VQFL 4YWKA 2A68D 4KD4A 3RMHA 2I07B 2NVQB 3GTKH 4LMQD 3DMUA 3T51B 3LWEA 3W1BA 1YJWA 4QJFA 1BBXC 1WJJA 1HRJA 3AFPA 1IBLL 3HRZC 3MA2B 4O1NA 4ILWA 3A7AB 4K2KA 5ISRA 4LAAA 2YTXA 3F2BA 1SBBB 1RDPD 1VQ6A 1YHQA 1RIPA 1X65A 1CSPA 4OXPA 5A2QE 3GTJB 3BVZA 1YNXA 4PV1C 2R93B 4ZRZA 1YBYA 3MXUA 4BS9A 4IUTA 3PF4A 2ZM6L 4LF9L 5JEAJ 3VR2A 2PI2A 3QG1A 4DR2L 5DAUA 4DAYB 4A3GH 2KCTA 4DU9A 1IYUA 2B2YC 3FKIH 1MI2A 2NVTB 1JWSD 3IFTA 1SE4A 1M90C 3J7A5 3FHWA 5LMNW 3NELA 4LUVA 3BVGA 2HT1A 2EJMA 3I4MG 4G7HC 2F0UA 1A3VA 5EKIA 1XPUA 4IUVA 3PIP3 4AQYL 5M5YB 1STAA 4DR4L 2NWGA 1GO3E 2HDMA 5CV6A 1I4QA 5L37A 4KY7A 5IP9G 4B08A 1GD7A 4IUQA 4HMIA 4A3CH 2JA5B 1SN8A 4B9XA 3PO3B 1YEZA 1Y8PB 5LL6S 4PG3A 4L5SA 4IPDA 1HXYD 4CBVA 4DR2Q 4A3FB 3FP9A 5EQ0A 1HFGA 2QEJC 2F0FA 1DGSA 1AFPA 3NENA 3TP7A 4KD3A 3ERQA 4B3ML 2E8GA 1B9NA 5J1ZA 1B1ZA 4KLKA 3UE0A 4GKJL 3M7GA 1E1OA 2WP8J 3BG3A 3K58A 2M9VA 4ALPA 2N55A 2UUAQ 4GS3A 1ENCA 1MBYA 5FO7B 2F0NA 3GTMB 4R4OA 2B63G 3K5NA 3KUPA 1I4PA 3PF5A 2RCNA 4U68A 3PSIA 2IX0A 3I4NH 4F87A 4CDDC 1PH4A 3EBEA 2XNAC 4FO2A 2JA9A 1XNQL 2K5HA 4OO1G 2PZWA 1NMGA 4JI3Q 4KV6A 2HIXA 5E4WC 4IOAA 4LF8L 4YY3Q 3CMAA 1A6XA 1PTOF 2OEOA 2B63H 3C3LA 1JOKA 4KKUA 1VMPA 1YZ6A 2IHFA 3RLOA 2R7ZB 3K7AB 4FVMA 1SXTA 4JOIA 2O4XA 1WTRA 2EPBA 1B8AA 3J7AV 1VMCA 4GLAC 4NB3A 1EIGA 1EQTA 1X3EA 3W3AA 1U0LA 5T1GA 2F52A 5EAYA 1MKHA 2HDLA 1TWCB 1LABA 2R6GA 5FLXE 1BR9A 3BYTB 4CGYB 1SNMA 4YWMA 1LT6D 4BY7H 1XTCD 1K83H 4OWWB 3S15B 4H44C 3QJYA 3JC66 1L1OB 5BN4A 5FLMG 1PV4A 4NPSA 1K3RA 4QY7A 3U58A 4DF7A 1N32L 5GADC 1HHVA 2K03A 4HJ8A 3Q24A 3NWTA 3M7NA 1LV9A 2B2WC 2Z9HA 1STYA 4F88A 2RDGA 3A8JE 2JJQA 3N6RA 2F0EA 2HCCA 2L9HA 1AZQA 4PZ6A 2Q2UA 4HEDA 4KN4C 1V8QA 2O2LD 1WD0A 3KBGA 1VF7A 1SMYD 3H0GG 3PO3H 1LTSD 1HNXL 4A3JG 5IP7H 1TT2A 1E3PA 1EY8A 1STGA 3EFXD 5JJKA 4NP5A 2MUYA 5FO8B 2V4DA 1G2SA 2CWPA 3G48A 2SDFA 3QOLA 5H1SE 1K28A 1UUPA 4BBSB 1YNJD 2YU9H 4AIMA 1YITA 1E22A 4MIUA 4G4KA 2XRSD 2N3SA 2M2LA 4GN3B 1NJIC 1Y1WH 3WWVA 4IJLA 2IWHA 5IWAL 1A2TA 1STNA 4NXNL 3K80C 3M85A 3A0JA 3HOZH 2NZ1D 3R2TA 1SROA 5C0XG 4JYAQ 3S2HH 1LACA 1PYSB 3K5OA 4DK0A 4DR1Q 2VY3A 2PQAA 2NN6H 2AWNA 3PMFA 4RHSA 4LNQA 3FPUB 2E2IH 4GKKQ 4UP7A 5LL6X 3P75A 5BN3A 4FNFA 4ME3A 4HR7B 3GQBA 4C3HB 1KQSA 3TS2A 1Z9FA 4YCWA 3T1HQ 4RCOA 1B50A 1RODA 1SLJA 4QF4A 3NP8A 2PQEA 3J81E 3MXPA 5COYA 4DV6Q 4DR6L 1IBKQ 3PIPA 2N78A 3R3OA 2VW9A 3M4QA 2QCPX 4ULLA 3KBXA 4A3MH 1NY4A 3MVVA 4JI8L 4JI6L 2Z6KA 1CUKA 4A4IA 1YJ9A 1YHBA 2ICEC 4BY1H 1UE1A 2FHTA 1X3PA 1R9TB 2N49A 3CCUA 4ZUJA 4XQQA 1KNEA 2SNSA 4V0BA 3K5LA 1PVOA 4RKBA 4RA8A 2I5MX 2JA8H 1FNWA 1YVCA 3MC0B 4IFDG 4A3FG 1N33Q 3S14B 2E2HH 3H91A 2DJFC 1WTXA 2JA8B 1S5FD 2HQLA 4WJWA 5FLMH 1U4RA 3KLWA 3QR8A 1GVPA 4DV4L 1H9RA 2X6LA 4A75A 3K0XA 3TP8A 5IE8A 3K5MA 3T16A 4V190 1CZGA 3SDZA 1A3UA 4G7OC 2RSOA 1SNCA 3NTHA 4IZ8A 2NTTA 3STBC 1LTLA 3Q22A 3E0EA 3D4WA 3CCMA 1L0YB 1P8LA 1YNND 4DUYQ 1EWHA 1EWIA 1A62A 3AEVA 4JPBW 1Y1WB 1D1KA 4J15A 2OTJA 2PPBC 3OW2A 1BCPD 1E2WA 4HMJA 1Q12A 5M5WB 1PTOH 1BUVT 1VQGA 2B2VA 4A3EH 2VUMB 3HOXG 1EYGA 2E2HB 4JBMA 5M3FG 1BCPF 1XNQQ 4ZQ3A 3CRKC 1EIYB 1U4LA 4YWLA 5HURA 3UDXA 4F8MA 3Q0AA 1S5ED 4DV7Q 4JI2Q 2OWOA 4DAPA 1ZXTA 4GOPC 4HCSA 3UDIA 1J8IA 3HP3A 3FPPA 1HA5A 1I94Q 1N36Q 4K6LA 2FJ2A 4X64L 3CCVA 4GNXA 3TBIB 5JPNC 1PYBA 1ONLA 1T5XD 4M8AA 3OWFA 1BCPC 4GKJQ 2F3WA 4GN4B 3MXNA 4L5QA 2LS01 1DXMA 1QUQA 1IL2A 2EY5A 4R4CA 2XWBB 1E24A 3GTJH 2FXQA 3RN2A 2PNRC 4LF4L 2WAQE 3CHBD 4BY1G 1SRUA 2G5DA 3F8TA 3URYA 2PYKA 2Z4HA 3C2PA 3MWYW 4PZ8A 2Q2HA 2F0DA 4BXXG 2O5IC 4FYDA 4DK1A 3QIAA 5I9OA 5GQOA 4ABNA 1VCIA 2EE1A 1SNPA 2F0WA 4K6DA 2RSNA 3KJPA 2NVYH 3OTOL 3WOFA 4YCVA 2F4VQ 4DR6Q 3SXHA 5CORA 2Z8LA 2ID0A 5KYLA 1DM0B 4C1NI 1I4XA 4NXNQ 3J80E 1OTCA 4OIJA 4FXKC 1AE2A 3IFDA 1QVCA 4P72A 1GUGA 2EXDA 4DV0L 1KLGD 3DM3A 5A35A 2I46A 2A6ED 1NCVA 3FKIG 2K5DA 3BJUA 1X6OA 5JJZA 5JJIA 1B53A 1LYLA 2JXMB 1CK1A 3H3VH 1EOVA 3S1NH 3EJIA 1JCKB 5J22A 2CHBD 4JI1Q 1OXTA 1S5DD 1A15A 4PMWA 3H3VI 1DOLA 2E2JB 4RWSC 2LY7A 4BY1B 3RLFA 3TP6A 4GOPA 3MHBA 2IPKD 4XIGS 3K57A 2R7DA 2UU9Q 4ZYSA 3H3VC 5FK9C 5ELBA 2B8FA 2P5ZX 4QMGA 1MD2D 3UE1A 4R8IA 2KUMA 1HR0Q 3N52A 3RZOH 4IFDJ 4JI6Q 1LTID 1UNSA 4K0KQ 2JYOA 1HNZQ 3KJOA 5M3FH 1VQLA 3K7UC 4A3EG 1HQMC 3HOYH 1BF4A 3SGIA 5HGTA 2ZJPA 5TSSA 4CKEA 4EQNA 1HZBA 2BE5C 4TRDA 2JA7B 4IFDH 3V2TA 4DV0Q 2AQ3B 1FNUA 1SEBD 3TRZA 2B2TC 4DV4Q 2PCFB 2K01A 3OYYA 3LWUA 5C3EH 1UE5A 4BBRG 4A93H 2UXCL 1JOOA 1LTTD 3L3OC 4MHEA 1SYGA 1KRTA 2A8VA 4JI4L 1CQFA 5C4XH 3M3YH 2ALYB 1N32Q 3FDTA 1VQ8A 1LT4D 4UPAA 1FD7D 1B4OA 4A3FH 1N33L 2VS1A 1BDOA 1CI3M 2YTVA 4LF8Q 1SNQA 1FL0A 2K5NA 3PQIA 1FYCA 4C56C 4LFAL 1G91A 4ZK9B 2NB0A 5T1IA 3RNUA 1K73C 4EX5A 5CV7A 1O80A 4KY5A 1B3QA 5IWAQ 3R2IA 1V1OA 1Z47A 1LM0A 1ESRA 4WFN3 1HCZA 4MNOA 4DXFA 5FLXc 3GV6A 1Q82C 3GTMH 4LF4Q 4GNXC 4DV1Q 2R61A 5JVH3 3HOVG 1U5KA 4X66Q 4RAUC 2MPMA 1EZ6A 2ZTEA 3CC4A 3E9IA 3C1FA 4XDXA 4DR7Q 3TZDA 4DV5Q 1WCMB 2A6HC 1KAWA 1ZYRC 3GTKB 4Y52H 4K5WA 2H5XA 4DV3L 4X6AH 4ZLTF 3CD6A 2KQ3A 2BE5D 2QDBA 3DUZA 1PRTF 2SEBD 5IYBH 1K8OA 5ELCA 3I4NG 5C0XH 3ZJYC 3VA5A 4BBRB 3J7AF 1EYCA 1AW7A 2Q8RE 4JI2L 1TS2A 3S14H 2Q8IB 1KC8C 3NBHA 1L0XB 1SE3A 3KK7A 2F0GA 1QNKA 1TQOA 3A56A 3HEJA 4FDBA 1T9HA 2XGTA 4K5XA 2K50A 5EPJA 2Y0SE 2A6HD 5BN5A 2R3ZA 3H6MA 2PZUA 3D4RA 1EIHA 4JK1C 1VQKA 3NE5B 5IYDG 3WOEA 5CGKA 2ASBA 1IYVA 2K14A 1EUJA 3VR5A 5C3EB 4LF5L 2A74C 2NTSA 4B3SL 1LUZA 5F2DA 2PMZB 1BQQT 4P73A 1IKMA 3I8ZA 1II3A 3E9HA 1ZKOA 1K0RA 4AH6A 3CCSA 1QZGA 1G2TA 1EQVA 1EY6A 1Q46A 1TU2B 1EU3A 5M9OA 1VQ9A 3S1MB 3CU7A 3ITPA 2ATWA 4HJ5A 2LSSA 4MTNA 2Z6KC 4JI7L 1QE6A 1PTOC 2EY2A 4RG1A 2A5HA 4DNRB 3GD7A 5KNDA 1HZCA 2A19A 4EGVA 2UUCQ 2EJGC 4RH6A 1AE3A 2B2WA 3KLSX 1V43A 4KHVA 3IRBA 2JN4A 5JOBA 5IGFA 2V1CC 4J8QA 3MXNB 1Q8KA 3H94A 2C5CA 1Z7TA 2B39A 4N9TA 5G3LD 3DXJC 1QUQB 2I5HA 2F3IA 1GUSA 4P71A 1L1OA 3TN2A 3J80i 4MTKA 1GOZA 5IIFA 2ZM6Q 2MQHA 1CTMA 2ENBA 1OO9B 4DV6L 1LT3D 1MIUA 1Q90A 1ASZA 1SE2A 2K5VA 3S16B 2N8NA 3EROA 2JK8A 3KF6A 4YY3L 2AKWB 1WI5A 4CDCC 1EQQA 4MZ9A 4QCLA 2RBMA 3SVMA 4JC0A 1YNJC 3I72A 3VR6A 4CKCA 4DV7L 3JAML 4QGUA 3ULLA 4JYAL 4DV2Q 3FMCA 3EN2A 3I4LA 2EJFC 2EVBA 4KTAA 1E1TA 4XYQA 2QILA 4C3HG 1QVGA 4IJHA 2UXDQ 4Z9CB 5LMUQ 3MFYA 1CA5A 1E7ZA 1TWHB 1PRTC 3S2DH 3CP0A 4DV2L 4S3SA 2EZVA 1PDQA 4HN7A 4C3IB 1X3FA 1D2BA 2WIIB 3ND8A 1S72A 1C9OA 2JA5H 3H0GH 3ER0A 2VB3X 4B3MQ 2A68C 1BCPB 1P16A 1H9SB 4C1NK 4JI0L 1HNXQ 3NPPA 3D6WA 3OMCA 4DK3C 1HQRD 3AB9A 4L63B 3VYRA 5J3BA 1VS0A 2DY8A 2PNHA 2C35B 3KDFB 5C3WA 1G6PA 4JG2A 1STEA 2EYOA 1LT5D 4DXGA 3CQZH 1H9SA 1TS4A 1W6JA 4KJNA 1QB5D 1I6HB 3C1EA 2B3GA 5IODA 2PMZE 2CVRA 1TY0A 1F2LA 4A3IG 4AYBE 1A0IA 2OF1A 1I4GA 4R8NA 3ICEA 3TEHB 2G9DA 2QA4A 2RQXA 1CQVA 1EY0A 4LK1C 5EBDA 3E3XA 2F0JA 1PYWD 4POGA 4ZCKA 3P7JA 1B2TA 1EY5A 3A7LA 1RCVD 4OHJA 5LMNQ 2ZTDA 3CPFA 1DZ1A 1WTVA 2VQFQ 3D4DA 2XIWA 2HIVA 4A3BG 1HUNA 4PNYA 2K75A 2JEBI 2RKSA 1VQDA 1PH7A 3K81C 1SFOH 1EOTA 4A3LG 4DA2A 2D0PA 4KN7C 4DFAA 3T56B 3HZXA 3LNNA 1KXLA 1SFOB 3HOZG 3HOWB 2J4XA 2HHHQ 1SYDA 3PGZA 4NXMQ 2KEDA 5IYDH 2EY6A 4DGZA 2EYJA 1BVSA 1GUTA 4RMFA 1K3BC 3KF8B 2F0OA 1QWYA 4DK6C 1K83B 2O5JC 3PO2H 5G3LF 2XN9C 1RTOA 1A63A 5CBAE 4A3DG 2MFIA 3TMEA 1K8GA 4K2LA 5CR3A 5GROA 1X3GA 4F7XA 1C48A 2DJGC 3M9BA 5KNBA 5CV9A 5D14A 1KTKA 3HG9A 3Q23A 1I50B 2H1EA 3TP5A 3NK9A 3KLRA 3S2DB 5KIXA 1QVFA 2HD3A 2JA6G 1EYDA 1BXTA 1PTOD 5DM73 1MJEA 2YTYA 4B9WA 3VYTA 4DAYA 3NEMA 4J1MA 4XYOA 4HJ9A 1LTAD 4GNXB 1SJED 3I4MH 4LF9Q 3CC7A 1QZHA 4IUNA 3CCQA 4UY8C 2VXWA 4OX9L 1FJGL 2WAQG 3KYHC 2VL6A 1A2UA 2L55A 1EIFA 3CMEA 3OHXC 1C8CA 2B2YA 2AHOB 1OXXK 4DNTB 3T53B 2Z0SA 3BZDB 1AEXA 5AFWA 5I2XA 2AQ2B 1EY7A 3M4OB 4JI7Q 3HOZB 2CQOA 1BNZA 5E4XA 2NVQH 5ELDA 4X3UA 5JAVA 4OWXB 2K5QA 3J7ZC 1GUWA 3CW2C 4QIWE 3W2DA 1SYFA 3RD4A 2MGSA 2N88A 4DR5Q 2YU9B 3GDEA 4ZUIA 4DUYL 4XT3B 5EKLA 4XQNA 4DR4Q 4BY7G 4B3TL 2A69C 5CBEE 3GTLH 1VQBA 2L0CA 2QW7A 4HSVA 4C2MB 4NKLA 1DCZA 3I55A 2R7FA 2OT2A 1I4HA 2VZAA 1UAPA 1VQIA 2PI2E 4KMUC 5M5YH 4DR3L 4H13C 4LFCL 3PIO3 2KENA 1WTHA 1HR0W 1I3QB 1J5EL 4I7AA 4RGNA 3OWEB 1SYCA 4CHTB 1XPOA 3IAYA 2UUBQ 2F0QA 5I6WA 1K8AC 4HTHA 2ES2A 3GTQB 3UDFA 2E75C 1PXUA 1CM9A 2E76C 2JA5G 5LHY1 3AQQA 3GTPB 5JVG3 1T5EA 5C5MA 1MGSA 4TSSA 2JP1A 1ET9A 1K0SA 4NMZA 4Q5VA 3GTOB 2KCMA 1QOHA 5M5XB 1JJCB 3G71A 1X3QA 1XX8A 2WKDA 1X55A 1JE5A 4X65L 4RKLA 4B3SQ 1PLFA 1AH9A 4HIDA 1NE3A 2PW5A 2XRQD 1PZID 1IBMQ 1TWFH 4L8JA 5E3FA 4A3JH 3GO5A 4DR7L 1J9OA 2CW0C 5LMUL 2CFMA 2K28A 4QIWB 1V1PB 1TKWB 3OOCA 2EYLA 2C9OA 1X54A 3G6JB 3G4SA 3TSSA 3Q6SA 1CKNB 1IYJB 3TDQA 2F0HA 5IGCA 3KOJA 2OTLA 2ZTCA 1STHA 2Z1CA 4DNIA 2ZXPA 3K59A 2UUAL 1V9PA 5AJ3L 4JI4Q 3L9AX 2FFKB 3MAQA 1MHWC 1AZPA 2RF4A 2EYHA 3DHQA 2K1BA 1VQEA 3I73A 2A69D 4Q0FA 4LUOA 2XWJB 2XVSA 4DPGA 2E2IB 1G6ZA 1SE8A 4A3IH 3DEOA 2Z4IA 2WB1E 2F0LA 4C3IH 4UAIA 4A3MG 1PFMA 4RGTA 1CHQD 1SR3A 3PIOA 3L0OA 1ET6A 4MN3A 4A93G 3PV0A 1KLUD 1ML0D 2HQEA 3J80c 1EWCA 2OQ0A 2RCFA 1N34Q 2F03A 1MJCA 2NVXH 3HOUB 1WCMH 2ZXRA 5GAEC 1L0WA 3E6ZX 1ESFA 5C3XA 3A54A 3KFUA 1TY2A 4A3IB 1IBLQ 5EPKA 4A3DB 1XJVA 1WFQA 3I91A 4R4IA 2B2UA 1Y1WG 1C7YA 1F9QA 2IL8A 1TS5A 5E1FA 1HR0L 1Y69U 5ELEA 2EXZA 2FMCA 4XXEA 5IT9c 1PH1A 4RCNA 2QDLA 4R4TA 4K8IA 1KDCA 1G8ZD 1H9KA 4HCEA 1JJGA 1RF2D 1KNAA 5E7NA 1VF5C 1G51A 3U50C 2UUBL 3SEBA 4LF5Q 1LTRD 3CCLA 1HH2P 4A3KG 1B70B 3PUYA 4NW2A 3G7LA 2AWOA 4I65A 2AMCB 4L5TA 4LFBQ 2GN5A 2D0OA 4PMBA 1A8VA 1DYQA 2CCZA 1WTQA 2KOLA 2ZXOA 4IPGA 2BH8A 4FXGC 2JA7H 1K8MA 5BR8Q 1N9WA 1NR4A 3BZCA 1PZJD 5C44G 2LFNA 2TSSA 4IFDI 3ND9A 3HOWG 1YJNA 5M3MG 1GM5A 2K4KA 2DN8A 3ZYYX 3JAMc 1H9JA 4HAEA 3SK5A 4JBKA 2JA8G 3T1HL 3A8IE 3K0YA 3OIPA 1JQYD 5C4JH 1N36L 3SE0A 1TWCH 2DUDA 1F2ZA 4TQUS 3U9SA 1JB7A 2WACA 4OEMB 4UHVA 4GOPB 1KDAA 3NTKA 5A2QL 2BH2A 1VQPA 1VQJA 1KDBA 2ICIA 3UI2A 2MJ8A 5M3MH 2ZJQA 4IPHA 1UE6A 1HZ9A 3GTGB 4H0LC 5C6AA 4P75A 3SK8A 3S1QB 2PO4A 1CKMA 2VUMG 3K8AA 3AYHB 3NQTA 3HOYG 4QB4A 4IALA 4LFBL 4KHZA 1EZ8A 3I3CA 3OMGA 2Y0SG 4GKKL 3S1RH 4DN4M 1X56A 4BA2I 3BVMA 1TIID 2JQOA 1EFWA 1RJTA 4O0AA 4YHHL 5FKAC 3GP7A 2GVBA 1F9SA 3K7AH 4K14A 4GN5A 2WB1G 3G6EA 1ENAA 3I2ZA 2KBNA 2NN6I 4ODGA 1PH9A 4O2DA 4A3KH 2A1AA 2ZT9C 3P20A 2KHIA 2D2CC 3F2UA 2IW3A 4RHRA 3RN5A 3T13A 5IGGA 4P2CB 4LWCA 1S40A 3RR5A 4OIKA 3HKSA 2FMMA 1B7YB 1IL8A 4GLVB 4BY7B 4XTCS 1D6EC 1EFID 5I4DA 1HPCA 3I56A 3S1MH 1ZEQX 5IYBG 4OGQC 1PFSA 5M5WH 1HTLD 1G291 5IP7G 4DUZL 2VNUD 3R93A 3HGBA 1I94L 4IOCA 1W6KA 4EQ5A 3J81j 3CPWA 4LUZA 4LF6L 2R92H 4EQPA 1VQ5A 3CCEA 3HOXB 1WVLA 3OPOA 1NR2A 3BYYB 1XWEA 1PHJA 3I7FA 1YI2A 1VQCA 3SR1A 2H4OA 4HIMA 1PRTB 2QKIC 3NTIA 2RHQB 5LMNL 1PA6A 5J39A 1FGUA 1XMQQ 1SMXA 3S9WA 4O42A 1STBA 1YNNC 1I5FA 1CHPD 3I4NB 1PFNA 3RZDH 1I4RA 2BA0A 4CDEC 2IY5B 1E0BA 5K36G 4DR5L 2J7ZA 3EQLC 5IGEA 3RZDB 5DNFA 5I9PA 1TWGH 1NBWA 1QCBD 2EYFA 2EY1A 5M5XH 1CSQA 1TWAB 5C3EG 4B3RQ 3CAMA 4APVA 1IBKL 1R4QB 2K5WA 1JB3A 1CT1D 3FVQA 1NMFA 1FR3A 3M3YB 5C4XB 3GTQH 1JWMD 2XSCA 1B3AA 2NVTH 4KKSA 1KABA 2BDNA 3B6YA 2ZJRA 2NZOA 3GV3A 3M4OH 3PO2G 1KL9A 1VQFA 4L5RC 2KEEA 2SNMA 1M4VA 4GLXA 4JV5L 1Q81C 1WTPA 3P1HA 2WINB 2I0QA 1GUNA 4JBJA 2HUGA 5IYCG 5KGUA 1B9MA 4JI8Q 1Y1VG 2NUCA 1ILQA 3BDCA 1IKLA 4OO1H 2MO1A 1SYBA 2UXDL 1RTNA 1TS3A 1BBWA 3S1QH 4A3LH 1RD9D 1S4ZA 2UXBL 2K04A 2JSOA 5DEHA 2EYMA 2F4IA 4A3MB 5IYCH 1I6HH 5M3MB 2NVYB 1CKOA 1F2MA 1XYIA 3PO3G 3A8KE 1U4PA 3HOUG 2G9HD 2K32A 4JI5L 3D3RA 1VQMA 4RGOS 2CH4A 4B3TQ 1ZYRD 3ULJA 1CA6A 2X6GA 3KF6B 3VR3A 3NBIA 4LW1A 5EGTA 2EIFA 4KJOA 3T1YL 3TS0A 1ICFB 3W5OA 1GKHA 4X3KA 3HKZB 5JEAG 1XXGA 4DUZQ 3L7ZC 3X3NA 1WTWA 2NBFA 4WJ3M 2KJXA 2KHJA 3CKIB 4KHPL 3LX0A 3NWSA 1D5MC 4RFBA 2IX1A 1F9RA 5FJ8G 1TVXA 3GTPH 4CKBA 4A3KB 1LTBD 2WV6D 2R7ZH 2UUCL 1SAPA 5JEAH 3J81c 2X69A 2L12A 1OXSC 1JICA 1JJ2A 2CWAA 2JA7G 5CV4A 4KI0A 4X62Q 3U4ZA 1Y1VB 2OQKA 2BA1A 1TWAH 1F77A 1J6QA 4C3JB 3A5UA 1PH3A 1GHKA 1X9NA 2MP1A 1YHAA 1FNVA 4A3GG 3FRPB 3RLNA 1VQ7A 4JI5Q 4X3TA 4DV5L 5EKKA 1V1QA 1X32A 3EIVA 2EYPA 1Q8IA 4CJ0B 2KECA 1D8LA 3A55A 4TVAB 3QO2A 2EOTA 5EJWA 1NSNS 1Q1BA 3W1GA 3D8GA 4M1UB 4OX9Q 1FJGQ 4JV5Q 1QNUA 3DWQA 3BDLA 3X3MA 3QOJA 5CV8A 3J81L 4IUUA 3F2CA 2PW7A 2RA4A 1JORA 1EL0A 1GHJA 2LXJA 5IT9E 1LTGD 4WRDA 4C3IG 2QEXA 2RVLA 2D9UA 5D3DA 1ASYA 4A3JB 1QJOA 5IGDA 2F3VA 1RHPA 1Q86C 3BU2A 3HOYB 3NBHB 1S3OA 1PH2A 1UEAB 5KRUA 4DR1L 3QWNA 4IURA 4HJAA 3D0FA 3L2PA 3D31A 2BCOA 3D6CA 1LLRD 1KRSA 1BO0A 1UWVA 4N8FA 3NUCA 3ULPA 2WKCA 3MEHA 1VQ4A 1Q1EA 4WJ4A 2RDHA 2K05A 3H09A 5EBCA 5C4HA 1IXRA 3FKIB 3CF5A 4A76A 2F0VA 3DEPA 2F0SA 1FVIA 3BZKA 2CKZB 4HIOA 3K6OA 3WDNA 1W2BA 2L4NA 4WORA 1DOKA 4FP5D 4POFA 1L1OC 2MHVA 4NXML 5C4ZA 3J80L 4K5VA 2UU9L 2GVAA 1Z6HA 1Y14B 1PH8A 4UP9A 1AP0A 4FXDA 2NZHA 4H02A 1AN8A 1EQRA 2K7VA 2Q2TA 1VQHA 3HKZE 3NSWA 2CW0D 3GTOH 4JI1L 3EA6A 3HOWH 1JT8A 3TZUA 3OW7A 5FOBB 1Y8NB 3M4PA 2B8GA 3CRLC 2JA6H 5IY0A 1NAPA 3EVQA 2NN6G 1HFNA 2M00A 1JC7A 4OO1I 4K8JA 5JPMC 5DLQE 5ELNA 1I6VC 1XMOQ 2JA6B 2L1BA 5C0XI 2IX3A 5KNCA 2Y0SB 1QG7A 3TREA 2R92B 4KHPQ 2E5LQ 4BA1I 4OWTB 1TWGB 1SYEA 2E74C 4Y7NH 2F4VL 2K33A 3F1ZA 4C3HH 4OONA 2PZTA 3HS0C 4FF1A 1UEBA 3S16H 2VQEL 2RHSB 2NYZD 4J6HA 1Q7YC 4DAVA 4P74A 3JAMi 1JE4A 1WTOA 1HTPA 3SK4A 1ICWA 1EY9A 3I4OA 3M4YA 1DD2A 1O78A
chains in the Genus database with same CATH topology
4YY3Q 5IYDG 3CMAA 2AMCB 3PUVA 2B63H 2ASBA 4L5TA 3LGJA 4LFBQ 2GN5A 1YZ6A 2IHFA 1EUJA 2K14A 3RLOA 4JI3L 2D0OA 4LF5L 4JOIA 4B3SL 1LUZA 1A8VA 2CCZA 1B8AA 4P73A 4IPGA 4R1JA 4A3CG 2BH8A 2JA7H 3E9HA 4AH6A 1K0RA 4GLAC 1N9WA 4NB3A 3BZCA 5BR8Q 1Q46A 1X3EA 3U4VA 5C44G 1U0LA 2F52A 5EAYA 1VQ9A 4IFDI 1MKHA 1YJNA 3HOWG 4UP8A 5M3MG 2R6GA 1GM5A 4JCVE 2ATWA 4HJ5A 1CKNA 2K4KA 3JAMc 4LF6L 2LSSA 4YWMA 4MTNA 4JBKA 2Z6KC 4JI7L 1PH5A 4LFAQ 2JA8G 4BY7H 3T1HL 4RG1A 5FJ8H 4AYBG 5C4JH 1K83H 1N36L 4OWWB 2L15A 1TWCH 2DUDA 1L1OB 3JC66 4IPCA 5FLMG 3UDGA 3GD7A 4NPSA 1PV4A 1HZCA 2A19A 4TQUS 2UUCQ 1K3RA 4QY7A 1JB7A 3U58A 2R7ZG 1AE3A 4A3BH 3MEFA 4DV3Q 1V43A 4GOPB 2EQSA 1YIJA 3IRBA 1N32L 2LXKA 2V1CC 1HZAA 5GADC 1D7QA 4HJ8A 2BH2A 1VQPA 2DGYA 1Q8KA 1VQJA 3MXNB 3M7NA 1QUQB 2I5HA 2F3IA 5M3MH 2ZJQA 4P71A 4IPHA 1L1OA 3HOUH 2JJQA 1UE6A 1HZ9A 3CC2A 3J80i 4PZ6A 2ZM6Q 5HY6A 1I3QH 2MQHA 2Q2UA 3A74A 4P75A 2OCEA 1CKMA 2VUMG 4BBSH 3K8AA 4DV6L 4LF6Q 3AYHB 1MIUA 3H0GG 1ASZA 3PO3H 3HOYG 4X62L 4LFBL 1HNXL 4YHHQ 2K5VA 4AQYQ 4KHZA 4A3JG 2N8NA 5IP7H 2JK8A 3KF6A 1E3PA 4YY3L 1HNZL 4X65Q 2AKWB 2UXBQ 2Y0SG 3PUWA 4GKKL 1WI5A 5JJKA 3S1RH 1X56A 3CXCA 1EQQA 4MZ9A 4BA2I 2CWPA 3G48A 4JI0Q 1L2FA 5H1SE 1K9MC 4JC0A 2YU9H 4AIMA 1YITA 4DV7L 1E22A 2JQOA 1EFWA 2R92H 4A3DH 2N3SA 4O0AA 4QGUA 3ULLA 3Q8DA 4GN3B 4YHHL 4JYAL 4DV2Q 1NJIC 2YV5A 1Y1WH 2GVBA 3WWVA 3EN2A 3A5ZB 4IJLA 1KIXA 1XNRQ 2UXCQ 5IWAL 3K7AH 1E1TA 1QVGA 4GN5A 2WB1G 4IJHA 4NXNL 3G6EA 1M1KC 2UXDQ 3K80C 3I2ZA 3M85A 5LMUQ 1E7ZA 3A0JA 3HOZH 2KBNA 2NN6I 3PUZA 3S2DH 1PH9A 4O2DA 1SROA 2A1AA 5C0XG 4A3KH 3CP0A 4DV2L 1J5EQ 5HGQA 4JYAQ 2KHIA 1IZ6A 3S2HH 3CCSA 1PYSB 1X3FA 4DR1Q 2VY3A 3HOXH 2PQAA 3RN5A 2AWNA 1S72A 1C9OA 2JA5H 4LNQA 3H0GH 3H15A 3S15H 3ER0A 4LWCA 3TQYA 3RR5A 1S40A 4DKAC 3HKSA 1N34L 2E2IH 4B3MQ 4GKKQ 1B7YB 4GLVB 4UP7A 1P16A 4XTCS 4JI0L 1HNXQ 4ME3A 4DK3C 3I56A 3TS2A 1KQSA 3S1MH 5J3BA 1Z9FA 4YCWA 5IYBG 3T1HQ 2VUMH 4B3RL 1VS0A 1PFSA 2PNHA 2C35B 5M5WH 5IP7G 1G291 1SLJA 4DUZL 3KDFB 2I5LX 2VNUD 2YYZA 3CCRA 1I94L 1G6PA 4JG2A 4IOCA 3J81j 4EQ5A 3CQZH 2MNAA 4LUZA 3CPWA 4DV6Q 1R9TH 1IBKQ 1VQ5A 3CCEA 2JEAI 3PIPA 3HOVH 2N78A 4DV1L 5BR8L 2VW9A 3M4QA 2B3GA 1PHJA 4A3MH 2PMZE 3I7FA 1YI2A 1TWHH 1VQCA 1NY4A 3OTOQ 3HKZG 4HIMA 4JI8L 1BBUA 4JI6L 3CCJA 2Z6KA 1CUKA 1KHIA 2IT1A 1YHBA 2RHQB 4A4IA 4AYBE 5LMNL 4A3IG 1A0IA 1YJ9A 1UE1A 1PA6A 4BY1H 1FGUA 1RL2A 1N8RC 1XMQQ 1SMXA 3TEHB 3ICEA 2N49A 3CCUA 3AFQA 2QA4A 4X64Q 1I5FA 1PVOA 5C4XG 2I5MX 3RZDH 4POGA 2JA8H 2BA0A 1YVCA 4IFDG 4A3FG 2IY5B 1N33Q 5LMNQ 2ZTDA 1OXUA 3CPFA 2E2HH 5K36G 2VQEQ 4DR5L 2VQFQ 2HIVA 4A3BG 1TWGH 2HQLA 1NBWA 5M5XH 5FLMH 1HNWL 1H95A 1O7IA 3KLWA 1CSQA 5C3EG 4B3RQ 2K75A 3CAMA 1WOCA 2JEBI 1VQAA 4APVA 1VQDA 1GVPA 4DV4L 2R92G 1IBKL 3PUXA 1PH7A 3K81C 1SFOH 4A75A 3K0XA 5IE8A 4A3LG 1HNWQ 2D0PA 4IO9A 1NMFA 4K0KL 2HHHL 3GTQH 4HJ7A 3STBC 1LTLA 1KXLA 3E0EA 3VDYA 1JMCA 1UE7A 2NVTH 3CCMA 1P8LA 4LF7L 1TXYA 4DUYQ 3B6YA 2ZJRA 3HOZG 2NZOA 1EWIA 1A62A 3AEVA 4DAMA 3M4OH 3PO2G 4J15A 3PGZA 1KL9A 2HHHQ 1VQFA 4NXMQ 5IYDH 2OTJA 4L5RC 2D62A 3OW2A 1BVSA 4GLXA 4JV5L 1Q12A 4RMFA 1Q81C 1XMQL 3KF8B 1VQGA 2I0QA 4A3EH 1PH6A 4JBJA 5IYCG 3HOXG 1EYGA 5M3FG 5GAGC 4JBMA 1XNQQ 2IHEA 4DK6C 1EIYB 3PO2H 4JI8Q 1Y1VG 1OXVA 2K52A 1A63A 4YWLA 4A3DG 4C3JH 2MO1A 3UDXA 2XTIA 2UXDL 2MFIA 4DV7Q 4JI2Q 2JE6I 1K8GA 2OWOA 1BBWA 5GROA 4GOPC 1X3GA 1XNRL 3UDIA 3S1QH 4A3LH 4JBWA 3M9BA 5AJ3Q 1I94Q 2QGQA 1N36Q 1WCMG 4X64L 1XMOL 2B29A 2UXBL 3CCVA 4GNXA 1NTGA 3STBD 5IYCH 4DR3Q 1I6HH 1XTDA 1CKOA 4LF7Q 1QVFA 1PYBA 4GKJQ 2JA6G 3PO3G 3T1YQ 1MJEA 1VQOA 1W3SA 4GN4B 2YTYA 4L5QA 3HOUG 4JI5L 1I50H 1VQMA 4YCUA 1BKBA 3NEMA 1QUQA 1IL2A 4B3TQ 4HJ9A 4R4CA 3ULJA 2R93H 4GNXB 2PQAB 3KF6B 1WYDA 1E24A 4LW1A 4X66L 3GTJH 2FXQA 2EIFA 2Q2IA 3J81i 3T1YL 3RN2A 3W5OA 1GKHA 3TS0A 4LF9Q 5JEAG 4LF4L 3I4MH 2WAQE 3CC7A 1QZHA 4DUZQ 4BY1G 3L7ZC 3CCQA 4UY8C 5IP9H 4OX9L 1SRUA 1FJGL 3F8TA 1HJPA 2WAQG 1IBML 3KYHC 4WJ3M 4PZ7A 4BBSG 2KHJA 2VL6A 1EIFA 1XPRA 4PZ8A 4KHPL 3CMEA 3HFZB 2Q2HA 2IX1A 4BBRH 2AHOB 1OXXK 4BXXG 4HIKA 2Z0SA 5FJ8G 5JJLA 3GTPH 2R93G 5GQOA 4JI7Q 5ELOA 2R7ZH 2CQOA 3GTGH 1VCIA 2UUCL 2NVQH 3J81c 3KJPA 2NVYH 1OXSC 3OTOL 3ERSX 4YCVA 2F4VQ 4DR6Q 2WFWA 4OWXB 4BXXH 4QQBX 3PCOB 5C44H 4R4QA 2E2JH 3J7ZC 1JJ2A 2CWAA 2ID0A 2JA7G 3CW2C 4KI0A 4QIWE 3S24A 4NXNQ 4X62Q 1OTCA 2E5LL 1AE2A 3U4ZA 4DR5Q 1QVCA 3GDEA 4P72A 5C0XJ 2OQKA 2BA1A 4DUYL 4DR4Q 2EXDA 1TWAH 3S17H 4BY7G 1J6QA 5GAHC 3DM3A 3A5UA 4DV0L 1PH3A 4QL5A 4B3TL 1X9NA 3GTLH 1VQBA 3FKIG 3BJUA 5JJIA 1X6OA 1YHAA 4C2MH 1LYLA 4LFCQ 2MO0A 4A3GG 3RLNA 1VQ7A 4JI5Q 3I55A 2R7FA 4JOIC 4DV5L 2VZAA 3KDFA 1EOVA 1V1QA 3H3VH 1VQIA 3S1NH 2PI2E 3EIVA 5M5YH 3F2DA 4DR3L 1Y1VH 4JI1Q 1OXTA 4LFCL 3DLLA 1VQNA 2KENA 1HR0W 4PMWA 1D8LA 3H3VI 1J5EL 2VQFL 4TVAB 3RLFA 4YWKA 1XPOA 4GOPA 2UUBQ 1K8AC 4XIGS 3GTKH 1Q1BA 3W1GA 2R7DA 3W1BA 2ES2A 2UU9Q 3UDFA 1YJWA 4QJFA 2JA5G 4OX9Q 1FJGQ 4JV5Q 1WJJA 3AQQA 3AFPA 1IBLL 3UE1A 3F2CA 1HR0Q 3RZOH 2LXJA 4IFDJ 2KCMA 1JJCB 4JI6Q 2QEXA 4DR6L 1ASYA 3G71A 1C0AA 2YTXA 3F2BA 4K0KQ 1X55A 1JE5A 4X65L 1HNZQ 4B3SQ 3KJOA 5M3FH 1YHQA 1VQLA 1VQ6A 1AH9A 1RIPA 3K7UC 1NE3A 4HIDA 4A3EG 1Q86C 1X65A 1CSPA 3BU2A 3NBHB 3HOYH 1S3OA 1PH2A 4OXPA 3SGIA 2ZJPA 1YNXA 4DR1L 1IBMQ 1HZBA 1TWFH 1YBYA 4HJAA 4A3JH 3D0FA 3L2PA 3D31A 3PF4A 2ZM6L 3GO5A 4DV0Q 4LF9L 4DR7L 5JEAJ 2PI2A 1KRSA 4DR2L 3TRZA 5LMUL 1UWVA 4DAYB 4DV4Q 4A3GH 2KCTA 3OYYA 3ULPA 5C3EH 1UE5A 2CFMA 4BBRG 3FKIH 1VQ4A 4A93H 2UXCL 1Q1EA 2A8VA 1KRTA 4WJ4A 4JI4L 5C4XH 3M3YH 2ALYB 1X54A 1M90C 3G4SA 3J7A5 3FHWA 1IXRA 1CKNB 1IYJB 5LMNW 3NELA 3CF5A 1VQ8A 1N32Q 4LUVA 4A76A 4UPAA 1N33L 4A3FH 1FVIA 3BZKA 2CKZB 2VS1A 3KOJA 4HIOA 1W2BA 2OTLA 2HT1A 2ZTCA 4DNIA 3I4MG 2YTVA 4LF8Q 2UUAL 1V9PA 4POFA 1L1OC 1FL0A 5AJ3L 2K5NA 4JI4Q 4NXML 1QZGA 1XPUA 4LFAL 2UU9L 4AQYL 3RNUA 1K73C 2RF4A 4EX5A 2GVAA 1Y14B 1PH8A 4DR4L 1VQEA 4UP9A 5IWAQ 2NZHA 1GO3E 1EQRA 1Z47A 4H02A 4LUOA 1LM0A 5IP9G 4DPGA 4MNOA 5FLXc 2Q2TA 1Q82C 1GD7A 3GTMH 1SE8A 4LF4Q 4GNXC 4A3CH 1VQHA 3HKZE 4DV1Q 4A3IH 1SN8A 1KD1C 3HOVG 1U5KA 3GTOH 1YEZA 4JI1L 4PG3A 4X66Q 4L5SA 3HOWH 1JT8A 2WB1E 4IPDA 2ZTEA 4DR2Q 4C3IH 3CC4A 3M4PA 3E9IA 4A3MG 2JA6H 5IY0A 3PIOA 1SR3A 4DR7Q 3L0OA 2NN6G 3FP9A 4DV5Q 4A93G 3PV0A 1DGSA 4OO1I 3NENA 1KAWA 3J80c 2OQ0A 5DLQE 5ELNA 1N34Q 4B3ML 1MJCA 2E8GA 2NVXH 1WCMH 4Y52H 1XMOQ 4KLKA 2H5XA 5GAEC 1L0WA 3UE0A 4DV3L 4GKJL 5C0XI 4X6AH 3CD6A 1E1OA 2WP8J 3TREA 3KFUA 4KHPQ 2E5LQ 4BA1I 4ALPA 1IBLQ 2UUAQ 5IYBH 4GS3A 4OWTB 1XJVA 1WFQA 4R4IA 3I4NG 3ZJYC 1Y1WG 4Y7NH 1C7YA 2F4VL 4R4OA 2B63G 1HR0L 3F1ZA 4JI2L 3S14H 4C3HH 1KC8C 3PF5A 2RCNA 4OONA 5IT9c 1PH1A 3PSIA 2IX0A 4R4TA 3S16H 3I4NH 1UEBA 2VQEL 2RHSB 4FDBA 1JJGA 1Q7YC 1PH4A 3EBEA 4P74A 1T9HA 2XGTA 5E7NA 1G51A 2JA9A 2K50A 2K5HA 3U50C 3JAMi 2UUBL 1XNQL 2Y0SE 4OO1G 4LF5Q 3CCLA 1HH2P 4JI3Q 1NMGA 3I4OA 4A3KG 1B70B 2HIXA 3PUYA 4IOAA 2AWOA 4LF8L 1VQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 Q;  5IYD G;  3CMA A;  2AMC B;  3PUV A;  2B63 H;  2ASB A;  4L5T A;  3LGJ A;  4LFB Q;  2GN5 A;  1YZ6 A;  2IHF A;  1EUJ A;  2K14 A;  3RLO A;  4JI3 L;  2D0O A;  4LF5 L;  4JOI A;  4B3S L;  1LUZ A;  1A8V A;  2CCZ A;  1B8A A;  4P73 A;  4IPG A;  4R1J A;  4A3C G;  2BH8 A;  2JA7 H;  3E9H A;  4AH6 A;  1K0R A;  4GLA C;  1N9W A;  4NB3 A;  3BZC A;  5BR8 Q;  1Q46 A;  1X3E A;  3U4V A;  5C44 G;  1U0L A;  2F52 A;  5EAY A;  1VQ9 A;  4IFD I;  1MKH A;  1YJN A;  3HOW G;  4UP8 A;  5M3M G;  2R6G A;  1GM5 A;  4JCV E;  2ATW A;  4HJ5 A;  1CKN A;  2K4K A;  3JAM c;  4LF6 L;  2LSS A;  4YWM A;  4MTN A;  4JBK A;  2Z6K C;  4JI7 L;  1PH5 A;  4LFA Q;  2JA8 G;  4BY7 H;  3T1H L;  4RG1 A;  5FJ8 H;  4AYB G;  5C4J H;  1K83 H;  1N36 L;  4OWW B;  2L15 A;  1TWC H;  2DUD A;  1L1O B;  3JC6 6;  4IPC A;  5FLM G;  3UDG A;  3GD7 A;  4NPS A;  1PV4 A;  1HZC A;  2A19 A;  4TQU S;  2UUC Q;  1K3R A;  4QY7 A;  1JB7 A;  3U58 A;  2R7Z G;  1AE3 A;  4A3B H;  3MEF A;  4DV3 Q;  1V43 A;  4GOP B;  2EQS A;  1YIJ A;  3IRB A;  1N32 L;  2LXK A;  2V1C C;  1HZA A;  5GAD C;  1D7Q A;  4HJ8 A;  2BH2 A;  1VQP A;  2DGY A;  1Q8K A;  1VQJ A;  3MXN B;  3M7N A;  1QUQ B;  2I5H A;  2F3I A;  5M3M H;  2ZJQ A;  4P71 A;  4IPH A;  1L1O A;  3HOU H;  2JJQ A;  1UE6 A;  1HZ9 A;  3CC2 A;  3J80 i;  4PZ6 A;  2ZM6 Q;  5HY6 A;  1I3Q H;  2MQH A;  2Q2U A;  3A74 A;  4P75 A;  2OCE A;  1CKM A;  2VUM G;  4BBS H;  3K8A A;  4DV6 L;  4LF6 Q;  3AYH B;  1MIU A;  3H0G G;  1ASZ A;  3PO3 H;  3HOY G;  4X62 L;  4LFB L;  1HNX L;  4YHH Q;  2K5V A;  4AQY Q;  4KHZ A;  4A3J G;  2N8N A;  5IP7 H;  2JK8 A;  3KF6 A;  1E3P A;  4YY3 L;  1HNZ L;  4X65 Q;  2AKW B;  2UXB Q;  2Y0S G;  3PUW A;  4GKK L;  1WI5 A;  5JJK A;  3S1R H;  1X56 A;  3CXC A;  1EQQ A;  4MZ9 A;  4BA2 I;  2CWP A;  3G48 A;  4JI0 Q;  1L2F A;  5H1S E;  1K9M C;  4JC0 A;  2YU9 H;  4AIM A;  1YIT A;  4DV7 L;  1E22 A;  2JQO A;  1EFW A;  2R92 H;  4A3D H;  2N3S A;  4O0A A;  4QGU A;  3ULL A;  3Q8D A;  4GN3 B;  4YHH L;  4JYA L;  4DV2 Q;  1NJI C;  2YV5 A;  1Y1W H;  2GVB A;  3WWV A;  3EN2 A;  3A5Z B;  4IJL A;  1KIX A;  1XNR Q;  2UXC Q;  5IWA L;  3K7A H;  1E1T A;  1QVG A;  4GN5 A;  2WB1 G;  4IJH A;  4NXN L;  3G6E A;  1M1K C;  2UXD Q;  3K80 C;  3I2Z A;  3M85 A;  5LMU Q;  1E7Z A;  3A0J A;  3HOZ H;  2KBN A;  2NN6 I;  3PUZ A;  3S2D H;  1PH9 A;  4O2D A;  1SRO A;  2A1A A;  5C0X G;  4A3K H;  3CP0 A;  4DV2 L;  1J5E Q;  5HGQ A;  4JYA Q;  2KHI A;  1IZ6 A;  3S2H H;  3CCS A;  1PYS B;  1X3F A;  4DR1 Q;  2VY3 A;  3HOX H;  2PQA A;  3RN5 A;  2AWN A;  1S72 A;  1C9O A;  2JA5 H;  4LNQ A;  3H0G H;  3H15 A;  3S15 H;  3ER0 A;  4LWC A;  3TQY A;  3RR5 A;  1S40 A;  4DKA C;  3HKS A;  1N34 L;  2E2I H;  4B3M Q;  4GKK Q;  1B7Y B;  4GLV B;  4UP7 A;  1P16 A;  4XTC S;  4JI0 L;  1HNX Q;  4ME3 A;  4DK3 C;  3I56 A;  3TS2 A;  1KQS A;  3S1M H;  5J3B A;  1Z9F A;  4YCW A;  5IYB G;  3T1H Q;  2VUM H;  4B3R L;  1VS0 A;  1PFS A;  2PNH A;  2C35 B;  5M5W H;  5IP7 G;  1G29 1;  1SLJ A;  4DUZ L;  3KDF B;  2I5L X;  2VNU D;  2YYZ A;  3CCR A;  1I94 L;  1G6P A;  4JG2 A;  4IOC A;  3J81 j;  4EQ5 A;  3CQZ H;  2MNA A;  4LUZ A;  3CPW A;  4DV6 Q;  1R9T H;  1IBK Q;  1VQ5 A;  3CCE A;  2JEA I;  3PIP A;  3HOV H;  2N78 A;  4DV1 L;  5BR8 L;  2VW9 A;  3M4Q A;  2B3G A;  1PHJ A;  4A3M H;  2PMZ E;  3I7F A;  1YI2 A;  1TWH H;  1VQC A;  1NY4 A;  3OTO Q;  3HKZ G;  4HIM A;  4JI8 L;  1BBU A;  4JI6 L;  3CCJ A;  2Z6K A;  1CUK A;  1KHI A;  2IT1 A;  1YHB A;  2RHQ B;  4A4I A;  4AYB E;  5LMN L;  4A3I G;  1A0I A;  1YJ9 A;  1UE1 A;  1PA6 A;  4BY1 H;  1FGU A;  1RL2 A;  1N8R C;  1XMQ Q;  1SMX A;  3TEH B;  3ICE A;  2N49 A;  3CCU A;  3AFQ A;  2QA4 A;  4X64 Q;  1I5F A;  1PVO A;  5C4X G;  2I5M X;  3RZD H;  4POG A;  2JA8 H;  2BA0 A;  1YVC A;  4IFD G;  4A3F G;  2IY5 B;  1N33 Q;  5LMN Q;  2ZTD A;  1OXU A;  3CPF A;  2E2H H;  5K36 G;  2VQE Q;  4DR5 L;  2VQF Q;  2HIV A;  4A3B G;  1TWG H;  2HQL A;  1NBW A;  5M5X H;  5FLM H;  1HNW L;  1H95 A;  1O7I A;  3KLW A;  1CSQ A;  5C3E G;  4B3R Q;  2K75 A;  3CAM A;  1WOC A;  2JEB I;  1VQA A;  4APV A;  1VQD A;  1GVP A;  4DV4 L;  2R92 G;  1IBK L;  3PUX A;  1PH7 A;  3K81 C;  1SFO H;  4A75 A;  3K0X A;  5IE8 A;  4A3L G;  1HNW Q;  2D0P A;  4IO9 A;  1NMF A;  4K0K L;  2HHH L;  3GTQ H;  4HJ7 A;  3STB C;  1LTL A;  1KXL A;  3E0E A;  3VDY A;  1JMC A;  1UE7 A;  2NVT H;  3CCM A;  1P8L A;  4LF7 L;  1TXY A;  4DUY Q;  3B6Y A;  2ZJR A;  3HOZ G;  2NZO A;  1EWI A;  1A62 A;  3AEV A;  4DAM A;  3M4O H;  3PO2 G;  4J15 A;  3PGZ A;  1KL9 A;  2HHH Q;  1VQF A;  4NXM Q;  5IYD H;  2OTJ A;  4L5R C;  2D62 A;  3OW2 A;  1BVS A;  4GLX A;  4JV5 L;  1Q12 A;  4RMF A;  1Q81 C;  1XMQ L;  3KF8 B;  1VQG A;  2I0Q A;  4A3E H;  1PH6 A;  4JBJ A;  5IYC G;  3HOX G;  1EYG A;  5M3F G;  5GAG C;  4JBM A;  1XNQ Q;  2IHE A;  4DK6 C;  1EIY B;  3PO2 H;  4JI8 Q;  1Y1V G;  1OXV A;  2K52 A;  1A63 A;  4YWL A;  4A3D G;  4C3J H;  2MO1 A;  3UDX A;  2XTI A;  2UXD L;  2MFI A;  4DV7 Q;  4JI2 Q;  2JE6 I;  1K8G A;  2OWO A;  1BBW A;  5GRO A;  4GOP C;  1X3G A;  1XNR L;  3UDI A;  3S1Q H;  4A3L H;  4JBW A;  3M9B A;  5AJ3 Q;  1I94 Q;  2QGQ A;  1N36 Q;  1WCM G;  4X64 L;  1XMO L;  2B29 A;  2UXB L;  3CCV A;  4GNX A;  1NTG A;  3STB D;  5IYC H;  4DR3 Q;  1I6H H;  1XTD A;  1CKO A;  4LF7 Q;  1QVF A;  1PYB A;  4GKJ Q;  2JA6 G;  3PO3 G;  3T1Y Q;  1MJE A;  1VQO A;  1W3S A;  4GN4 B;  2YTY A;  4L5Q A;  3HOU G;  4JI5 L;  1I50 H;  1VQM A;  4YCU A;  1BKB A;  3NEM A;  1QUQ A;  1IL2 A;  4B3T Q;  4HJ9 A;  4R4C A;  3ULJ A;  2R93 H;  4GNX B;  2PQA B;  3KF6 B;  1WYD A;  1E24 A;  4LW1 A;  4X66 L;  3GTJ H;  2FXQ A;  2EIF A;  2Q2I A;  3J81 i;  3T1Y L;  3RN2 A;  3W5O A;  1GKH A;  3TS0 A;  4LF9 Q;  5JEA G;  4LF4 L;  3I4M H;  2WAQ E;  3CC7 A;  1QZH A;  4DUZ Q;  4BY1 G;  3L7Z C;  3CCQ A;  4UY8 C;  5IP9 H;  4OX9 L;  1SRU A;  1FJG L;  3F8T A;  1HJP A;  2WAQ G;  1IBM L;  3KYH C;  4WJ3 M;  4PZ7 A;  4BBS G;  2KHJ A;  2VL6 A;  1EIF A;  1XPR A;  4PZ8 A;  4KHP L;  3CME A;  3HFZ B;  2Q2H A;  2IX1 A;  4BBR H;  2AHO B;  1OXX K;  4BXX G;  4HIK A;  2Z0S A;  5FJ8 G;  5JJL A;  3GTP H;  2R93 G;  5GQO A;  4JI7 Q;  5ELO A;  2R7Z H;  2CQO A;  3GTG H;  1VCI A;  2UUC L;  2NVQ H;  3J81 c;  3KJP A;  2NVY H;  1OXS C;  3OTO L;  3ERS X;  4YCV A;  2F4V Q;  4DR6 Q;  2WFW A;  4OWX B;  4BXX H;  4QQB X;  3PCO B;  5C44 H;  4R4Q A;  2E2J H;  3J7Z C;  1JJ2 A;  2CWA A;  2ID0 A;  2JA7 G;  3CW2 C;  4KI0 A;  4QIW E;  3S24 A;  4NXN Q;  4X62 Q;  1OTC A;  2E5L L;  1AE2 A;  3U4Z A;  4DR5 Q;  1QVC A;  3GDE A;  4P72 A;  5C0X J;  2OQK A;  2BA1 A;  4DUY L;  4DR4 Q;  2EXD A;  1TWA H;  3S17 H;  4BY7 G;  1J6Q A;  5GAH C;  3DM3 A;  3A5U A;  4DV0 L;  1PH3 A;  4QL5 A;  4B3T L;  1X9N A;  3GTL H;  1VQB A;  3FKI G;  3BJU A;  5JJI A;  1X6O A;  1YHA A;  4C2M H;  1LYL A;  4LFC Q;  2MO0 A;  4A3G G;  3RLN A;  1VQ7 A;  4JI5 Q;  3I55 A;  2R7F A;  4JOI C;  4DV5 L;  2VZA A;  3KDF A;  1EOV A;  1V1Q A;  3H3V H;  1VQI A;  3S1N H;  2PI2 E;  3EIV A;  5M5Y H;  3F2D A;  4DR3 L;  1Y1V H;  4JI1 Q;  1OXT A;  4LFC L;  3DLL A;  1VQN A;  2KEN A;  1HR0 W;  4PMW A;  1D8L A;  3H3V I;  1J5E L;  2VQF L;  4TVA B;  3RLF A;  4YWK A;  1XPO A;  4GOP A;  2UUB Q;  1K8A C;  4XIG S;  3GTK H;  1Q1B A;  3W1G A;  2R7D A;  3W1B A;  2ES2 A;  2UU9 Q;  3UDF A;  1YJW A;  4QJF A;  2JA5 G;  4OX9 Q;  1FJG Q;  4JV5 Q;  1WJJ A;  3AQQ A;  3AFP A;  1IBL L;  3UE1 A;  3F2C A;  1HR0 Q;  3RZO H;  2LXJ A;  4IFD J;  2KCM A;  1JJC B;  4JI6 Q;  2QEX A;  4DR6 L;  1ASY A;  3G71 A;  1C0A A;  2YTX A;  3F2B A;  4K0K Q;  1X55 A;  1JE5 A;  4X65 L;  1HNZ Q;  4B3S Q;  3KJO A;  5M3F H;  1YHQ A;  1VQL A;  1VQ6 A;  1AH9 A;  1RIP A;  3K7U C;  1NE3 A;  4HID A;  4A3E G;  1Q86 C;  1X65 A;  1CSP A;  3BU2 A;  3NBH B;  3HOY H;  1S3O A;  1PH2 A;  4OXP A;  3SGI A;  2ZJP A;  1YNX A;  4DR1 L;  1IBM Q;  1HZB A;  1TWF H;  1YBY A;  4HJA A;  4A3J H;  3D0F A;  3L2P A;  3D31 A;  3PF4 A;  2ZM6 L;  3GO5 A;  4DV0 Q;  4LF9 L;  4DR7 L;  5JEA J;  2PI2 A;  1KRS A;  4DR2 L;  3TRZ A;  5LMU L;  1UWV A;  4DAY B;  4DV4 Q;  4A3G H;  2KCT A;  3OYY A;  3ULP A;  5C3E H;  1UE5 A;  2CFM A;  4BBR G;  3FKI H;  1VQ4 A;  4A93 H;  2UXC L;  1Q1E A;  2A8V A;  1KRT A;  4WJ4 A;  4JI4 L;  5C4X H;  3M3Y H;  2ALY B;  1X54 A;  1M90 C;  3G4S A;  3J7A 5;  3FHW A;  1IXR A;  1CKN B;  1IYJ B;  5LMN W;  3NEL A;  3CF5 A;  1VQ8 A;  1N32 Q;  4LUV A;  4A76 A;  4UPA A;  1N33 L;  4A3F H;  1FVI A;  3BZK A;  2CKZ B;  2VS1 A;  3KOJ A;  4HIO A;  1W2B A;  2OTL A;  2HT1 A;  2ZTC A;  4DNI A;  3I4M G;  2YTV A;  4LF8 Q;  2UUA L;  1V9P A;  4POF A;  1L1O C;  1FL0 A;  5AJ3 L;  2K5N A;  4JI4 Q;  4NXM L;  1QZG A;  1XPU A;  4LFA L;  2UU9 L;  4AQY L;  3RNU A;  1K73 C;  2RF4 A;  4EX5 A;  2GVA A;  1Y14 B;  1PH8 A;  4DR4 L;  1VQE A;  4UP9 A;  5IWA Q;  2NZH A;  1GO3 E;  1EQR A;  1Z47 A;  4H02 A;  4LUO A;  1LM0 A;  5IP9 G;  4DPG A;  4MNO A;  5FLX c;  2Q2T A;  1Q82 C;  1GD7 A;  3GTM H;  1SE8 A;  4LF4 Q;  4GNX C;  4A3C H;  1VQH A;  3HKZ E;  4DV1 Q;  4A3I H;  1SN8 A;  1KD1 C;  3HOV G;  1U5K A;  3GTO H;  1YEZ A;  4JI1 L;  4PG3 A;  4X66 Q;  4L5S A;  3HOW H;  1JT8 A;  2WB1 E;  4IPD A;  2ZTE A;  4DR2 Q;  4C3I H;  3CC4 A;  3M4P A;  3E9I A;  4A3M G;  2JA6 H;  5IY0 A;  3PIO A;  1SR3 A;  4DR7 Q;  3L0O A;  2NN6 G;  3FP9 A;  4DV5 Q;  4A93 G;  3PV0 A;  1DGS A;  4OO1 I;  3NEN A;  1KAW A;  3J80 c;  2OQ0 A;  5DLQ E;  5ELN A;  1N34 Q;  4B3M L;  1MJC A;  2E8G A;  2NVX H;  1WCM H;  4Y52 H;  1XMO Q;  4KLK A;  2H5X A;  5GAE C;  1L0W A;  3UE0 A;  4DV3 L;  4GKJ L;  5C0X I;  4X6A H;  3CD6 A;  1E1O A;  2WP8 J;  3TRE A;  3KFU A;  4KHP Q;  2E5L Q;  4BA1 I;  4ALP A;  1IBL Q;  2UUA Q;  5IYB H;  4GS3 A;  4OWT B;  1XJV A;  1WFQ A;  4R4I A;  3I4N G;  3ZJY C;  1Y1W G;  4Y7N H;  1C7Y A;  2F4V L;  4R4O A;  2B63 G;  1HR0 L;  3F1Z A;  4JI2 L;  3S14 H;  4C3H H;  1KC8 C;  3PF5 A;  2RCN A;  4OON A;  5IT9 c;  1PH1 A;  3PSI A;  2IX0 A;  4R4T A;  3S16 H;  3I4N H;  1UEB A;  2VQE L;  2RHS B;  4FDB A;  1JJG A;  1Q7Y C;  1PH4 A;  3EBE A;  4P74 A;  1T9H A;  2XGT A;  5E7N A;  1G51 A;  2JA9 A;  2K50 A;  2K5H A;  3U50 C;  3JAM i;  2UUB L;  1XNQ L;  2Y0S E;  4OO1 G;  4LF5 Q;  3CCL A;  1HH2 P;  4JI3 Q;  1NMG A;  3I4O A;  4A3K G;  1B70 B;  2HIX A;  3PUY A;  4IOA A;  2AWO A;  4LF8 L;  1VQK A; 
#chains in the Genus database with same CATH topology
 3PUV A;  3LGJ A;  2Q8T A;  3VR4 A;  4EVO A;  5I2Y A;  3O13 A;  4JI3 L;  5EPL A;  2B63 B;  4R1J A;  4A3C G;  3OIQ A;  3BDO A;  3U4V A;  4KK7 A;  5K36 H;  1S5C D;  3DWA A;  4UP8 A;  4JCV E;  1CKN A;  2HCI A;  1RKN A;  5IGB A;  1U4M A;  1PH5 A;  4LFA Q;  4ZKC B;  1C4Q A;  3AMU A;  5FJ8 H;  4AYB G;  3I4M B;  2L15 A;  4CJ1 B;  4IPC A;  4BXX H;  1GJX A;  3UDG A;  1WD1 A;  2R7Z G;  3I90 A;  4JW0 A;  2KHS A;  4A3B H;  1PTO B;  5IOC A;  3MEF A;  4DV3 Q;  4FF4 A;  2EQS A;  1YIJ A;  2LXK A;  4KY6 A;  5CC4 A;  1HZA A;  1D7Q A;  2Z6B A;  2DGY A;  1EY4 A;  2OXP A;  1JWU D;  5KYI A;  3HOU H;  2NVX B;  3CC2 A;  3VYS A;  1EYA A;  5K5P A;  2F1M A;  5IT9 L;  3IL8 A;  5HY6 A;  1I3Q H;  2F0I A;  3NHH A;  3A74 A;  2OCE A;  4N9P A;  4BBS H;  1BOS A;  4FF3 A;  4LF6 Q;  1PFB A;  4X62 L;  2VB2 X;  4YHH Q;  4AQY Q;  2EDG A;  2QF7 A;  1HNZ L;  2SOB A;  4X65 Q;  2UXB Q;  3PUW A;  1H9M A;  3CXC A;  2B2T A;  3R8B A;  1IW7 D;  4JI0 Q;  1L2F A;  1K9M C;  1D5X C;  1E2Z A;  2RDF A;  4CJ2 C;  1O7Y A;  3IKJ A;  4A3D H;  3Q8D A;  3QB3 A;  3E0J A;  4NDX A;  2LKV A;  2YV5 A;  5D3I B;  3A5Z B;  1XNR Q;  1KIX A;  2UXC Q;  4U67 3;  5I6Y A;  4R9W A;  1M1K C;  1EEF D;  3MTS A;  3V96 A;  3PUZ A;  1J5E Q;  5HGQ A;  1IZ6 A;  1SDF A;  1CZW A;  2AQ1 B;  3RUZ A;  4GZY C;  3HOX H;  4EQO A;  1D5Z C;  4JVZ A;  2D5D A;  1D1I A;  2B2V C;  3H15 A;  3S15 H;  3TQY A;  2KVM A;  3E5S A;  4DKA C;  1IW7 C;  1N34 L;  2WAQ B;  1KAA A;  2TMP A;  1DJR D;  1ILP A;  2FIN B;  2KA7 A;  3NQI A;  2A6E C;  2VUM H;  4B3R L;  1A3T A;  5KEE A;  2I5L X;  2YYZ A;  3CCR A;  4H7B A;  4E6I A;  4N8X 1;  1R9T H;  5ELF A;  2MNA A;  3RZO B;  1GUO A;  2JEA I;  3HOV H;  4DV1 L;  5BR8 L;  5CYU A;  4ZKB B;  4QUF A;  4X3S A;  4G7Z C;  1SMY C;  3MFG A;  1TWH H;  3OTO Q;  3HKZ G;  1PZK D;  1BBU A;  1F9P A;  3CCJ A;  1C0A A;  1KHI A;  2IT1 A;  1KD1 C;  3DWP A;  1RL2 A;  1N8R C;  1EEI D;  1MSH A;  3AFQ A;  4X64 Q;  1E2V A;  2F0P A;  4LJZ C;  5C4X G;  3NXW A;  3PO2 B;  1PMR A;  3S1N B;  1OXU A;  2BDO A;  2VQE Q;  5M3F B;  3FEW X;  1GXD C;  4XQJ A;  3KF8 A;  3MZ5 A;  1U9R A;  4RGM A;  1H95 A;  1HNW L;  3H0G B;  3I70 A;  1O7I A;  3S17 B;  1V1P A;  1SND A;  1WOC A;  2DY7 A;  1VQA A;  1PRT D;  2F0K A;  2R92 G;  3PUX A;  1M8A A;  3S2H B;  1HNW Q;  4IO9 A;  1S5B D;  3DM1 A;  5C44 B;  4K0K L;  3KLS A;  2HHH L;  4C3J G;  4HJ7 A;  3VDY A;  1JMC A;  1UE7 A;  1IHZ A;  2LMC B;  4A93 B;  4LF7 L;  1TXY A;  4BWG B;  4A3G B;  4DAM A;  2CH4 W;  3CQZ B;  5FLX L;  4ZAI A;  2D62 A;  2B2U C;  1XMQ L;  2E2D C;  2K6A A;  3VYU A;  1R4P B;  1PH6 A;  2AUK A;  4KKT A;  5GAG C;  4IUP A;  2IHE A;  5C4J B;  1B44 D;  1OXV A;  1DON A;  5D65 A;  2K52 A;  3GTL B;  1HUM A;  4PMC A;  4C3J H;  4FF2 A;  4IN3 A;  2XTI A;  3SHL A;  2JE6 I;  4PQX A;  1XNR L;  1LO5 D;  4JBW A;  5AJ3 Q;  2QGQ A;  1WCM G;  1XMO L;  2B29 A;  1CFM A;  1FGB D;  1NTG A;  1NUC A;  2A73 B;  3STB D;  5DM6 3;  2L5T A;  4DR3 Q;  1XTD A;  4LF7 Q;  3J7Y W;  3HOV B;  4ID6 A;  4QUC A;  3T1Y Q;  3V05 A;  1VQO A;  1W3S A;  1MSG A;  2DNC A;  1HA6 A;  3JAM E;  2IJ0 A;  1I50 H;  1ENF A;  1NNX A;  4YCU A;  1BKB A;  4TKO B;  5C5L A;  4A3B B;  1TWF B;  2R93 H;  2PQA B;  1WYD A;  2KCN A;  4X66 L;  4XT1 B;  2Q2I A;  1DOM A;  3J81 i;  4YIJ A;  4IQZ A;  2GA4 B;  5IP9 H;  1TR5 A;  3SK6 A;  1JR0 D;  1HJP A;  1IBM L;  1Y8O B;  1O7L A;  4PZ7 A;  4BBS G;  1JOQ A;  1XPR A;  4ME5 A;  2L11 A;  3HFZ B;  4Y7N B;  5CMD A;  4BBR H;  4HIK A;  3MXG A;  3OSO A;  3AU7 A;  5JJL A;  2R93 G;  4OEL B;  5ELO A;  1SSO A;  3U9O A;  3GTG H;  1SJH D;  2J0T D;  4G57 A;  2WB1 B;  3ERS X;  1VDZ A;  1QIL A;  2WFW A;  4QQB X;  3PCO B;  5C44 H;  4R4Q A;  2E2J H;  2F0M A;  3S24 A;  1SNO A;  2E5L L;  2KCC A;  4HSP A;  2CQA A;  3ONA B;  4CDF C;  5C0X J;  3S17 H;  1F2Y A;  5GAH C;  3BS1 A;  4UDU C;  5FO9 B;  4QL5 A;  3T4A C;  3S1R B;  3VA7 A;  4C2M H;  4LFC Q;  3C46 A;  2MO0 A;  2DNE A;  4JOI C;  2F0T A;  5NUC A;  3KDF A;  4L6T B;  1O7Z A;  4A3E B;  3F2D A;  1Y1V H;  4AYB B;  2BOS A;  5CV5 A;  1EU4 A;  3DLL A;  1VQN A;  2AUJ D;  4OL7 A;  4I7Z C;  1Q3L A;  2VQF L;  4YWK A;  2A68 D;  4KD4 A;  3RMH A;  2I07 B;  2NVQ B;  3GTK H;  4LMQ D;  3DMU A;  3T51 B;  3LWE A;  3W1B A;  1YJW A;  4QJF A;  1BBX C;  1WJJ A;  1HRJ A;  3AFP A;  1IBL L;  3HRZ C;  3MA2 B;  4O1N A;  4ILW A;  3A7A B;  4K2K A;  5ISR A;  4LAA A;  2YTX A;  3F2B A;  1SBB B;  1RDP D;  1VQ6 A;  1YHQ A;  1RIP A;  1X65 A;  1CSP A;  4OXP A;  5A2Q E;  3GTJ B;  3BVZ A;  1YNX A;  4PV1 C;  2R93 B;  4ZRZ A;  1YBY A;  3MXU A;  4BS9 A;  4IUT A;  3PF4 A;  2ZM6 L;  4LF9 L;  5JEA J;  3VR2 A;  2PI2 A;  3QG1 A;  4DR2 L;  5DAU A;  4DAY B;  4A3G H;  2KCT A;  4DU9 A;  1IYU A;  2B2Y C;  3FKI H;  1MI2 A;  2NVT B;  1JWS D;  3IFT A;  1SE4 A;  1M90 C;  3J7A 5;  3FHW A;  5LMN W;  3NEL A;  4LUV A;  3BVG A;  2HT1 A;  2EJM A;  3I4M G;  4G7H C;  2F0U A;  1A3V A;  5EKI A;  1XPU A;  4IUV A;  3PIP 3;  4AQY L;  5M5Y B;  1STA A;  4DR4 L;  2NWG A;  1GO3 E;  2HDM A;  5CV6 A;  1I4Q A;  5L37 A;  4KY7 A;  5IP9 G;  4B08 A;  1GD7 A;  4IUQ A;  4HMI A;  4A3C H;  2JA5 B;  1SN8 A;  4B9X A;  3PO3 B;  1YEZ A;  1Y8P B;  5LL6 S;  4PG3 A;  4L5S A;  4IPD A;  1HXY D;  4CBV A;  4DR2 Q;  4A3F B;  3FP9 A;  5EQ0 A;  1HFG A;  2QEJ C;  2F0F A;  1DGS A;  1AFP A;  3NEN A;  3TP7 A;  4KD3 A;  3ERQ A;  4B3M L;  2E8G A;  1B9N A;  5J1Z A;  1B1Z A;  4KLK A;  3UE0 A;  4GKJ L;  3M7G A;  1E1O A;  2WP8 J;  3BG3 A;  3K58 A;  2M9V A;  4ALP A;  2N55 A;  2UUA Q;  4GS3 A;  1ENC A;  1MBY A;  5FO7 B;  2F0N A;  3GTM B;  4R4O A;  2B63 G;  3K5N A;  3KUP A;  1I4P A;  3PF5 A;  2RCN A;  4U68 A;  3PSI A;  2IX0 A;  3I4N H;  4F87 A;  4CDD C;  1PH4 A;  3EBE A;  2XNA C;  4FO2 A;  2JA9 A;  1XNQ L;  2K5H A;  4OO1 G;  2PZW A;  1NMG A;  4JI3 Q;  4KV6 A;  2HIX A;  5E4W C;  4IOA A;  4LF8 L;  4YY3 Q;  3CMA A;  1A6X A;  1PTO F;  2OEO A;  2B63 H;  3C3L A;  1JOK A;  4KKU A;  1VMP A;  1YZ6 A;  2IHF A;  3RLO A;  2R7Z B;  3K7A B;  4FVM A;  1SXT A;  4JOI A;  2O4X A;  1WTR A;  2EPB A;  1B8A A;  3J7A V;  1VMC A;  4GLA C;  4NB3 A;  1EIG A;  1EQT A;  1X3E A;  3W3A A;  1U0L A;  5T1G A;  2F52 A;  5EAY A;  1MKH A;  2HDL A;  1TWC B;  1LAB A;  2R6G A;  5FLX E;  1BR9 A;  3BYT B;  4CGY B;  1SNM A;  4YWM A;  1LT6 D;  4BY7 H;  1XTC D;  1K83 H;  4OWW B;  3S15 B;  4H44 C;  3QJY A;  3JC6 6;  1L1O B;  5BN4 A;  5FLM G;  1PV4 A;  4NPS A;  1K3R A;  4QY7 A;  3U58 A;  4DF7 A;  1N32 L;  5GAD C;  1HHV A;  2K03 A;  4HJ8 A;  3Q24 A;  3NWT A;  3M7N A;  1LV9 A;  2B2W C;  2Z9H A;  1STY A;  4F88 A;  2RDG A;  3A8J E;  2JJQ A;  3N6R A;  2F0E A;  2HCC A;  2L9H A;  1AZQ A;  4PZ6 A;  2Q2U A;  4HED A;  4KN4 C;  1V8Q A;  2O2L D;  1WD0 A;  3KBG A;  1VF7 A;  1SMY D;  3H0G G;  3PO3 H;  1LTS D;  1HNX L;  4A3J G;  5IP7 H;  1TT2 A;  1E3P A;  1EY8 A;  1STG A;  3EFX D;  5JJK A;  4NP5 A;  2MUY A;  5FO8 B;  2V4D A;  1G2S A;  2CWP A;  3G48 A;  2SDF A;  3QOL A;  5H1S E;  1K28 A;  1UUP A;  4BBS B;  1YNJ D;  2YU9 H;  4AIM A;  1YIT A;  1E22 A;  4MIU A;  4G4K A;  2XRS D;  2N3S A;  2M2L A;  4GN3 B;  1NJI C;  1Y1W H;  3WWV A;  4IJL A;  2IWH A;  5IWA L;  1A2T A;  1STN A;  4NXN L;  3K80 C;  3M85 A;  3A0J A;  3HOZ H;  2NZ1 D;  3R2T A;  1SRO A;  5C0X G;  4JYA Q;  3S2H H;  1LAC A;  1PYS B;  3K5O A;  4DK0 A;  4DR1 Q;  2VY3 A;  2PQA A;  2NN6 H;  2AWN A;  3PMF A;  4RHS A;  4LNQ A;  3FPU B;  2E2I H;  4GKK Q;  4UP7 A;  5LL6 X;  3P75 A;  5BN3 A;  4FNF A;  4ME3 A;  4HR7 B;  3GQB A;  4C3H B;  1KQS A;  3TS2 A;  1Z9F A;  4YCW A;  3T1H Q;  4RCO A;  1B50 A;  1ROD A;  1SLJ A;  4QF4 A;  3NP8 A;  2PQE A;  3J81 E;  3MXP A;  5COY A;  4DV6 Q;  4DR6 L;  1IBK Q;  3PIP A;  2N78 A;  3R3O A;  2VW9 A;  3M4Q A;  2QCP X;  4ULL A;  3KBX A;  4A3M H;  1NY4 A;  3MVV A;  4JI8 L;  4JI6 L;  2Z6K A;  1CUK A;  4A4I A;  1YJ9 A;  1YHB A;  2ICE C;  4BY1 H;  1UE1 A;  2FHT A;  1X3P A;  1R9T B;  2N49 A;  3CCU A;  4ZUJ A;  4XQQ A;  1KNE A;  2SNS A;  4V0B A;  3K5L A;  1PVO A;  4RKB A;  4RA8 A;  2I5M X;  2JA8 H;  1FNW A;  1YVC A;  3MC0 B;  4IFD G;  4A3F G;  1N33 Q;  3S14 B;  2E2H H;  3H91 A;  2DJF C;  1WTX A;  2JA8 B;  1S5F D;  2HQL A;  4WJW A;  5FLM H;  1U4R A;  3KLW A;  3QR8 A;  1GVP A;  4DV4 L;  1H9R A;  2X6L A;  4A75 A;  3K0X A;  3TP8 A;  5IE8 A;  3K5M A;  3T16 A;  4V19 0;  1CZG A;  3SDZ A;  1A3U A;  4G7O C;  2RSO A;  1SNC A;  3NTH A;  4IZ8 A;  2NTT A;  3STB C;  1LTL A;  3Q22 A;  3E0E A;  3D4W A;  3CCM A;  1L0Y B;  1P8L A;  1YNN D;  4DUY Q;  1EWH A;  1EWI A;  1A62 A;  3AEV A;  4JPB W;  1Y1W B;  1D1K A;  4J15 A;  2OTJ A;  2PPB C;  3OW2 A;  1BCP D;  1E2W A;  4HMJ A;  1Q12 A;  5M5W B;  1PTO H;  1BUV T;  1VQG A;  2B2V A;  4A3E H;  2VUM B;  3HOX G;  1EYG A;  2E2H B;  4JBM A;  5M3F G;  1BCP F;  1XNQ Q;  4ZQ3 A;  3CRK C;  1EIY B;  1U4L A;  4YWL A;  5HUR A;  3UDX A;  4F8M A;  3Q0A A;  1S5E D;  4DV7 Q;  4JI2 Q;  2OWO A;  4DAP A;  1ZXT A;  4GOP C;  4HCS A;  3UDI A;  1J8I A;  3HP3 A;  3FPP A;  1HA5 A;  1I94 Q;  1N36 Q;  4K6L A;  2FJ2 A;  4X64 L;  3CCV A;  4GNX A;  3TBI B;  5JPN C;  1PYB A;  1ONL A;  1T5X D;  4M8A A;  3OWF A;  1BCP C;  4GKJ Q;  2F3W A;  4GN4 B;  3MXN A;  4L5Q A;  2LS0 1;  1DXM A;  1QUQ A;  1IL2 A;  2EY5 A;  4R4C A;  2XWB B;  1E24 A;  3GTJ H;  2FXQ A;  3RN2 A;  2PNR C;  4LF4 L;  2WAQ E;  3CHB D;  4BY1 G;  1SRU A;  2G5D A;  3F8T A;  3URY A;  2PYK A;  2Z4H A;  3C2P A;  3MWY W;  4PZ8 A;  2Q2H A;  2F0D A;  4BXX G;  2O5I C;  4FYD A;  4DK1 A;  3QIA A;  5I9O A;  5GQO A;  4ABN A;  1VCI A;  2EE1 A;  1SNP A;  2F0W A;  4K6D A;  2RSN A;  3KJP A;  2NVY H;  3OTO L;  3WOF A;  4YCV A;  2F4V Q;  4DR6 Q;  3SXH A;  5COR A;  2Z8L A;  2ID0 A;  5KYL A;  1DM0 B;  4C1N I;  1I4X A;  4NXN Q;  3J80 E;  1OTC A;  4OIJ A;  4FXK C;  1AE2 A;  3IFD A;  1QVC A;  4P72 A;  1GUG A;  2EXD A;  4DV0 L;  1KLG D;  3DM3 A;  5A35 A;  2I46 A;  2A6E D;  1NCV A;  3FKI G;  2K5D A;  3BJU A;  1X6O A;  5JJZ A;  5JJI A;  1B53 A;  1LYL A;  2JXM B;  1CK1 A;  3H3V H;  1EOV A;  3S1N H;  3EJI A;  1JCK B;  5J22 A;  2CHB D;  4JI1 Q;  1OXT A;  1S5D D;  1A15 A;  4PMW A;  3H3V I;  1DOL A;  2E2J B;  4RWS C;  2LY7 A;  4BY1 B;  3RLF A;  3TP6 A;  4GOP A;  3MHB A;  2IPK D;  4XIG S;  3K57 A;  2R7D A;  2UU9 Q;  4ZYS A;  3H3V C;  5FK9 C;  5ELB A;  2B8F A;  2P5Z X;  4QMG A;  1MD2 D;  3UE1 A;  4R8I A;  2KUM A;  1HR0 Q;  3N52 A;  3RZO H;  4IFD J;  4JI6 Q;  1LTI D;  1UNS A;  4K0K Q;  2JYO A;  1HNZ Q;  3KJO A;  5M3F H;  1VQL A;  3K7U C;  4A3E G;  1HQM C;  3HOY H;  1BF4 A;  3SGI A;  5HGT A;  2ZJP A;  5TSS A;  4CKE A;  4EQN A;  1HZB A;  2BE5 C;  4TRD A;  2JA7 B;  4IFD H;  3V2T A;  4DV0 Q;  2AQ3 B;  1FNU A;  1SEB D;  3TRZ A;  2B2T C;  4DV4 Q;  2PCF B;  2K01 A;  3OYY A;  3LWU A;  5C3E H;  1UE5 A;  4BBR G;  4A93 H;  2UXC L;  1JOO A;  1LTT D;  3L3O C;  4MHE A;  1SYG A;  1KRT A;  2A8V A;  4JI4 L;  1CQF A;  5C4X H;  3M3Y H;  2ALY B;  1N32 Q;  3FDT A;  1VQ8 A;  1LT4 D;  4UPA A;  1FD7 D;  1B4O A;  4A3F H;  1N33 L;  2VS1 A;  1BDO A;  1CI3 M;  2YTV A;  4LF8 Q;  1SNQ A;  1FL0 A;  2K5N A;  3PQI A;  1FYC A;  4C56 C;  4LFA L;  1G91 A;  4ZK9 B;  2NB0 A;  5T1I A;  3RNU A;  1K73 C;  4EX5 A;  5CV7 A;  1O80 A;  4KY5 A;  1B3Q A;  5IWA Q;  3R2I A;  1V1O A;  1Z47 A;  1LM0 A;  1ESR A;  4WFN 3;  1HCZ A;  4MNO A;  4DXF A;  5FLX c;  3GV6 A;  1Q82 C;  3GTM H;  4LF4 Q;  4GNX C;  4DV1 Q;  2R61 A;  5JVH 3;  3HOV G;  1U5K A;  4X66 Q;  4RAU C;  2MPM A;  1EZ6 A;  2ZTE A;  3CC4 A;  3E9I A;  3C1F A;  4XDX A;  4DR7 Q;  3TZD A;  4DV5 Q;  1WCM B;  2A6H C;  1KAW A;  1ZYR C;  3GTK B;  4Y52 H;  4K5W A;  2H5X A;  4DV3 L;  4X6A H;  4ZLT F;  3CD6 A;  2KQ3 A;  2BE5 D;  2QDB A;  3DUZ A;  1PRT F;  2SEB D;  5IYB H;  1K8O A;  5ELC A;  3I4N G;  5C0X H;  3ZJY C;  3VA5 A;  4BBR B;  3J7A F;  1EYC A;  1AW7 A;  2Q8R E;  4JI2 L;  1TS2 A;  3S14 H;  2Q8I B;  1KC8 C;  3NBH A;  1L0X B;  1SE3 A;  3KK7 A;  2F0G A;  1QNK A;  1TQO A;  3A56 A;  3HEJ A;  4FDB A;  1T9H A;  2XGT A;  4K5X A;  2K50 A;  5EPJ A;  2Y0S E;  2A6H D;  5BN5 A;  2R3Z A;  3H6M A;  2PZU A;  3D4R A;  1EIH A;  4JK1 C;  1VQK A;  3NE5 B;  5IYD G;  3WOE A;  5CGK A;  2ASB A;  1IYV A;  2K14 A;  1EUJ A;  3VR5 A;  5C3E B;  4LF5 L;  2A74 C;  2NTS A;  4B3S L;  1LUZ A;  5F2D A;  2PMZ B;  1BQQ T;  4P73 A;  1IKM A;  3I8Z A;  1II3 A;  3E9H A;  1ZKO A;  1K0R A;  4AH6 A;  3CCS A;  1QZG A;  1G2T A;  1EQV A;  1EY6 A;  1Q46 A;  1TU2 B;  1EU3 A;  5M9O A;  1VQ9 A;  3S1M B;  3CU7 A;  3ITP A;  2ATW A;  4HJ5 A;  2LSS A;  4MTN A;  2Z6K C;  4JI7 L;  1QE6 A;  1PTO C;  2EY2 A;  4RG1 A;  2A5H A;  4DNR B;  3GD7 A;  5KND A;  1HZC A;  2A19 A;  4EGV A;  2UUC Q;  2EJG C;  4RH6 A;  1AE3 A;  2B2W A;  3KLS X;  1V43 A;  4KHV A;  3IRB A;  2JN4 A;  5JOB A;  5IGF A;  2V1C C;  4J8Q A;  3MXN B;  1Q8K A;  3H94 A;  2C5C A;  1Z7T A;  2B39 A;  4N9T A;  5G3L D;  3DXJ C;  1QUQ B;  2I5H A;  2F3I A;  1GUS A;  4P71 A;  1L1O A;  3TN2 A;  3J80 i;  4MTK A;  1GOZ A;  5IIF A;  2ZM6 Q;  2MQH A;  1CTM A;  2ENB A;  1OO9 B;  4DV6 L;  1LT3 D;  1MIU A;  1Q90 A;  1ASZ A;  1SE2 A;  2K5V A;  3S16 B;  2N8N A;  3ERO A;  2JK8 A;  3KF6 A;  4YY3 L;  2AKW B;  1WI5 A;  4CDC C;  1EQQ A;  4MZ9 A;  4QCL A;  2RBM A;  3SVM A;  4JC0 A;  1YNJ C;  3I72 A;  3VR6 A;  4CKC A;  4DV7 L;  3JAM L;  4QGU A;  3ULL A;  4JYA L;  4DV2 Q;  3FMC A;  3EN2 A;  3I4L A;  2EJF C;  2EVB A;  4KTA A;  1E1T A;  4XYQ A;  2QIL A;  4C3H G;  1QVG A;  4IJH A;  2UXD Q;  4Z9C B;  5LMU Q;  3MFY A;  1CA5 A;  1E7Z A;  1TWH B;  1PRT C;  3S2D H;  3CP0 A;  4DV2 L;  4S3S A;  2EZV A;  1PDQ A;  4HN7 A;  4C3I B;  1X3F A;  1D2B A;  2WII B;  3ND8 A;  1S72 A;  1C9O A;  2JA5 H;  3H0G H;  3ER0 A;  2VB3 X;  4B3M Q;  2A68 C;  1BCP B;  1P16 A;  1H9S B;  4C1N K;  4JI0 L;  1HNX Q;  3NPP A;  3D6W A;  3OMC A;  4DK3 C;  1HQR D;  3AB9 A;  4L63 B;  3VYR A;  5J3B A;  1VS0 A;  2DY8 A;  2PNH A;  2C35 B;  3KDF B;  5C3W A;  1G6P A;  4JG2 A;  1STE A;  2EYO A;  1LT5 D;  4DXG A;  3CQZ H;  1H9S A;  1TS4 A;  1W6J A;  4KJN A;  1QB5 D;  1I6H B;  3C1E A;  2B3G A;  5IOD A;  2PMZ E;  2CVR A;  1TY0 A;  1F2L A;  4A3I G;  4AYB E;  1A0I A;  2OF1 A;  1I4G A;  4R8N A;  3ICE A;  3TEH B;  2G9D A;  2QA4 A;  2RQX A;  1CQV A;  1EY0 A;  4LK1 C;  5EBD A;  3E3X A;  2F0J A;  1PYW D;  4POG A;  4ZCK A;  3P7J A;  1B2T A;  1EY5 A;  3A7L A;  1RCV D;  4OHJ A;  5LMN Q;  2ZTD A;  3CPF A;  1DZ1 A;  1WTV A;  2VQF Q;  3D4D A;  2XIW A;  2HIV A;  4A3B G;  1HUN A;  4PNY A;  2K75 A;  2JEB I;  2RKS A;  1VQD A;  1PH7 A;  3K81 C;  1SFO H;  1EOT A;  4A3L G;  4DA2 A;  2D0P A;  4KN7 C;  4DFA A;  3T56 B;  3HZX A;  3LNN A;  1KXL A;  1SFO B;  3HOZ G;  3HOW B;  2J4X A;  2HHH Q;  1SYD A;  3PGZ A;  4NXM Q;  2KED A;  5IYD H;  2EY6 A;  4DGZ A;  2EYJ A;  1BVS A;  1GUT A;  4RMF A;  1K3B C;  3KF8 B;  2F0O A;  1QWY A;  4DK6 C;  1K83 B;  2O5J C;  3PO2 H;  5G3L F;  2XN9 C;  1RTO A;  1A63 A;  5CBA E;  4A3D G;  2MFI A;  3TME A;  1K8G A;  4K2L A;  5CR3 A;  5GRO A;  1X3G A;  4F7X A;  1C48 A;  2DJG C;  3M9B A;  5KNB A;  5CV9 A;  5D14 A;  1KTK A;  3HG9 A;  3Q23 A;  1I50 B;  2H1E A;  3TP5 A;  3NK9 A;  3KLR A;  3S2D B;  5KIX A;  1QVF A;  2HD3 A;  2JA6 G;  1EYD A;  1BXT A;  1PTO D;  5DM7 3;  1MJE A;  2YTY A;  4B9W A;  3VYT A;  4DAY A;  3NEM A;  4J1M A;  4XYO A;  4HJ9 A;  1LTA D;  4GNX B;  1SJE D;  3I4M H;  4LF9 Q;  3CC7 A;  1QZH A;  4IUN A;  3CCQ A;  4UY8 C;  2VXW A;  4OX9 L;  1FJG L;  2WAQ G;  3KYH C;  2VL6 A;  1A2U A;  2L55 A;  1EIF A;  3CME A;  3OHX C;  1C8C A;  2B2Y A;  2AHO B;  1OXX K;  4DNT B;  3T53 B;  2Z0S A;  3BZD B;  1AEX A;  5AFW A;  5I2X A;  2AQ2 B;  1EY7 A;  3M4O B;  4JI7 Q;  3HOZ B;  2CQO A;  1BNZ A;  5E4X A;  2NVQ H;  5ELD A;  4X3U A;  5JAV A;  4OWX B;  2K5Q A;  3J7Z C;  1GUW A;  3CW2 C;  4QIW E;  3W2D A;  1SYF A;  3RD4 A;  2MGS A;  2N88 A;  4DR5 Q;  2YU9 B;  3GDE A;  4ZUI A;  4DUY L;  4XT3 B;  5EKL A;  4XQN A;  4DR4 Q;  4BY7 G;  4B3T L;  2A69 C;  5CBE E;  3GTL H;  1VQB A;  2L0C A;  2QW7 A;  4HSV A;  4C2M B;  4NKL A;  1DCZ A;  3I55 A;  2R7F A;  2OT2 A;  1I4H A;  2VZA A;  1UAP A;  1VQI A;  2PI2 E;  4KMU C;  5M5Y H;  4DR3 L;  4H13 C;  4LFC L;  3PIO 3;  2KEN A;  1WTH A;  1HR0 W;  1I3Q B;  1J5E L;  4I7A A;  4RGN A;  3OWE B;  1SYC A;  4CHT B;  1XPO A;  3IAY A;  2UUB Q;  2F0Q A;  5I6W A;  1K8A C;  4HTH A;  2ES2 A;  3GTQ B;  3UDF A;  2E75 C;  1PXU A;  1CM9 A;  2E76 C;  2JA5 G;  5LHY 1;  3AQQ A;  3GTP B;  5JVG 3;  1T5E A;  5C5M A;  1MGS A;  4TSS A;  2JP1 A;  1ET9 A;  1K0S A;  4NMZ A;  4Q5V A;  3GTO B;  2KCM A;  1QOH A;  5M5X B;  1JJC B;  3G71 A;  1X3Q A;  1XX8 A;  2WKD A;  1X55 A;  1JE5 A;  4X65 L;  4RKL A;  4B3S Q;  1PLF A;  1AH9 A;  4HID A;  1NE3 A;  2PW5 A;  2XRQ D;  1PZI D;  1IBM Q;  1TWF H;  4L8J A;  5E3F A;  4A3J H;  3GO5 A;  4DR7 L;  1J9O A;  2CW0 C;  5LMU L;  2CFM A;  2K28 A;  4QIW B;  1V1P B;  1TKW B;  3OOC A;  2EYL A;  2C9O A;  1X54 A;  3G6J B;  3G4S A;  3TSS A;  3Q6S A;  1CKN B;  1IYJ B;  3TDQ A;  2F0H A;  5IGC A;  3KOJ A;  2OTL A;  2ZTC A;  1STH A;  2Z1C A;  4DNI A;  2ZXP A;  3K59 A;  2UUA L;  1V9P A;  5AJ3 L;  4JI4 Q;  3L9A X;  2FFK B;  3MAQ A;  1MHW C;  1AZP A;  2RF4 A;  2EYH A;  3DHQ A;  2K1B A;  1VQE A;  3I73 A;  2A69 D;  4Q0F A;  4LUO A;  2XWJ B;  2XVS A;  4DPG A;  2E2I B;  1G6Z A;  1SE8 A;  4A3I H;  3DEO A;  2Z4I A;  2WB1 E;  2F0L A;  4C3I H;  4UAI A;  4A3M G;  1PFM A;  4RGT A;  1CHQ D;  1SR3 A;  3PIO A;  3L0O A;  1ET6 A;  4MN3 A;  4A93 G;  3PV0 A;  1KLU D;  1ML0 D;  2HQE A;  3J80 c;  1EWC A;  2OQ0 A;  2RCF A;  1N34 Q;  2F03 A;  1MJC A;  2NVX H;  3HOU B;  1WCM H;  2ZXR A;  5GAE C;  1L0W A;  3E6Z X;  1ESF A;  5C3X A;  3A54 A;  3KFU A;  1TY2 A;  4A3I B;  1IBL Q;  5EPK A;  4A3D B;  1XJV A;  1WFQ A;  3I91 A;  4R4I A;  2B2U A;  1Y1W G;  1C7Y A;  1F9Q A;  2IL8 A;  1TS5 A;  5E1F A;  1HR0 L;  1Y69 U;  5ELE A;  2EXZ A;  2FMC A;  4XXE A;  5IT9 c;  1PH1 A;  4RCN A;  2QDL A;  4R4T A;  4K8I A;  1KDC A;  1G8Z D;  1H9K A;  4HCE A;  1JJG A;  1RF2 D;  1KNA A;  5E7N A;  1VF5 C;  1G51 A;  3U50 C;  2UUB L;  3SEB A;  4LF5 Q;  1LTR D;  3CCL A;  1HH2 P;  4A3K G;  1B70 B;  3PUY A;  4NW2 A;  3G7L A;  2AWO A;  4I65 A;  2AMC B;  4L5T A;  4LFB Q;  2GN5 A;  2D0O A;  4PMB A;  1A8V A;  1DYQ A;  2CCZ A;  1WTQ A;  2KOL A;  2ZXO A;  4IPG A;  2BH8 A;  4FXG C;  2JA7 H;  1K8M A;  5BR8 Q;  1N9W A;  1NR4 A;  3BZC A;  1PZJ D;  5C44 G;  2LFN A;  2TSS A;  4IFD I;  3ND9 A;  3HOW G;  1YJN A;  5M3M G;  1GM5 A;  2K4K A;  2DN8 A;  3ZYY X;  3JAM c;  1H9J A;  4HAE A;  3SK5 A;  4JBK A;  2JA8 G;  3T1H L;  3A8I E;  3K0Y A;  3OIP A;  1JQY D;  5C4J H;  1N36 L;  3SE0 A;  1TWC H;  2DUD A;  1F2Z A;  4TQU S;  3U9S A;  1JB7 A;  2WAC A;  4OEM B;  4UHV A;  4GOP B;  1KDA A;  3NTK A;  5A2Q L;  2BH2 A;  1VQP A;  1VQJ A;  1KDB A;  2ICI A;  3UI2 A;  2MJ8 A;  5M3M H;  2ZJQ A;  4IPH A;  1UE6 A;  1HZ9 A;  3GTG B;  4H0L C;  5C6A A;  4P75 A;  3SK8 A;  3S1Q B;  2PO4 A;  1CKM A;  2VUM G;  3K8A A;  3AYH B;  3NQT A;  3HOY G;  4QB4 A;  4IAL A;  4LFB L;  4KHZ A;  1EZ8 A;  3I3C A;  3OMG A;  2Y0S G;  4GKK L;  3S1R H;  4DN4 M;  1X56 A;  4BA2 I;  3BVM A;  1TII D;  2JQO A;  1EFW A;  1RJT A;  4O0A A;  4YHH L;  5FKA C;  3GP7 A;  2GVB A;  1F9S A;  3K7A H;  4K14 A;  4GN5 A;  2WB1 G;  3G6E A;  1ENA A;  3I2Z A;  2KBN A;  2NN6 I;  4ODG A;  1PH9 A;  4O2D A;  4A3K H;  2A1A A;  2ZT9 C;  3P20 A;  2KHI A;  2D2C C;  3F2U A;  2IW3 A;  4RHR A;  3RN5 A;  3T13 A;  5IGG A;  4P2C B;  4LWC A;  1S40 A;  3RR5 A;  4OIK A;  3HKS A;  2FMM A;  1B7Y B;  1IL8 A;  4GLV B;  4BY7 B;  4XTC S;  1D6E C;  1EFI D;  5I4D A;  1HPC A;  3I56 A;  3S1M H;  1ZEQ X;  5IYB G;  4OGQ C;  1PFS A;  5M5W H;  1HTL D;  1G29 1;  5IP7 G;  4DUZ L;  2VNU D;  3R93 A;  3HGB A;  1I94 L;  4IOC A;  1W6K A;  4EQ5 A;  3J81 j;  3CPW A;  4LUZ A;  4LF6 L;  2R92 H;  4EQP A;  1VQ5 A;  3CCE A;  3HOX B;  1WVL A;  3OPO A;  1NR2 A;  3BYY B;  1XWE A;  1PHJ A;  3I7F A;  1YI2 A;  1VQC A;  3SR1 A;  2H4O A;  4HIM A;  1PRT B;  2QKI C;  3NTI A;  2RHQ B;  5LMN L;  1PA6 A;  5J39 A;  1FGU A;  1XMQ Q;  1SMX A;  3S9W A;  4O42 A;  1STB A;  1YNN C;  1I5F A;  1CHP D;  3I4N B;  1PFN A;  3RZD H;  1I4R A;  2BA0 A;  4CDE C;  2IY5 B;  1E0B A;  5K36 G;  4DR5 L;  2J7Z A;  3EQL C;  5IGE A;  3RZD B;  5DNF A;  5I9P A;  1TWG H;  1NBW A;  1QCB D;  2EYF A;  2EY1 A;  5M5X H;  1CSQ A;  1TWA B;  5C3E G;  4B3R Q;  3CAM A;  4APV A;  1IBK L;  1R4Q B;  2K5W A;  1JB3 A;  1CT1 D;  3FVQ A;  1NMF A;  1FR3 A;  3M3Y B;  5C4X B;  3GTQ H;  1JWM D;  2XSC A;  1B3A A;  2NVT H;  4KKS A;  1KAB A;  2BDN A;  3B6Y A;  2ZJR A;  2NZO A;  3GV3 A;  3M4O H;  3PO2 G;  1KL9 A;  1VQF A;  4L5R C;  2KEE A;  2SNM A;  1M4V A;  4GLX A;  4JV5 L;  1Q81 C;  1WTP A;  3P1H A;  2WIN B;  2I0Q A;  1GUN A;  4JBJ A;  2HUG A;  5IYC G;  5KGU A;  1B9M A;  4JI8 Q;  1Y1V G;  2NUC A;  1ILQ A;  3BDC A;  1IKL A;  4OO1 H;  2MO1 A;  1SYB A;  2UXD L;  1RTN A;  1TS3 A;  1BBW A;  3S1Q H;  4A3L H;  1RD9 D;  1S4Z A;  2UXB L;  2K04 A;  2JSO A;  5DEH A;  2EYM A;  2F4I A;  4A3M B;  5IYC H;  1I6H H;  5M3M B;  2NVY B;  1CKO A;  1F2M A;  1XYI A;  3PO3 G;  3A8K E;  1U4P A;  3HOU G;  2G9H D;  2K32 A;  4JI5 L;  3D3R A;  1VQM A;  4RGO S;  2CH4 A;  4B3T Q;  1ZYR D;  3ULJ A;  1CA6 A;  2X6G A;  3KF6 B;  3VR3 A;  3NBI A;  4LW1 A;  5EGT A;  2EIF A;  4KJO A;  3T1Y L;  3TS0 A;  1ICF B;  3W5O A;  1GKH A;  4X3K A;  3HKZ B;  5JEA G;  1XXG A;  4DUZ Q;  3L7Z C;  3X3N A;  1WTW A;  2NBF A;  4WJ3 M;  2KJX A;  2KHJ A;  3CKI B;  4KHP L;  3LX0 A;  3NWS A;  1D5M C;  4RFB A;  2IX1 A;  1F9R A;  5FJ8 G;  1TVX A;  3GTP H;  4CKB A;  4A3K B;  1LTB D;  2WV6 D;  2R7Z H;  2UUC L;  1SAP A;  5JEA H;  3J81 c;  2X69 A;  2L12 A;  1OXS C;  1JIC A;  1JJ2 A;  2CWA A;  2JA7 G;  5CV4 A;  4KI0 A;  4X62 Q;  3U4Z A;  1Y1V B;  2OQK A;  2BA1 A;  1TWA H;  1F77 A;  1J6Q A;  4C3J B;  3A5U A;  1PH3 A;  1GHK A;  1X9N A;  2MP1 A;  1YHA A;  1FNV A;  4A3G G;  3FRP B;  3RLN A;  1VQ7 A;  4JI5 Q;  4X3T A;  4DV5 L;  5EKK A;  1V1Q A;  1X32 A;  3EIV A;  2EYP A;  1Q8I A;  4CJ0 B;  2KEC A;  1D8L A;  3A55 A;  4TVA B;  3QO2 A;  2EOT A;  5EJW A;  1NSN S;  1Q1B A;  3W1G A;  3D8G A;  4M1U B;  4OX9 Q;  1FJG Q;  4JV5 Q;  1QNU A;  3DWQ A;  3BDL A;  3X3M A;  3QOJ A;  5CV8 A;  3J81 L;  4IUU A;  3F2C A;  2PW7 A;  2RA4 A;  1JOR A;  1EL0 A;  1GHJ A;  2LXJ A;  5IT9 E;  1LTG D;  4WRD A;  4C3I G;  2QEX A;  2RVL A;  2D9U A;  5D3D A;  1ASY A;  4A3J B;  1QJO A;  5IGD A;  2F3V A;  1RHP A;  1Q86 C;  3BU2 A;  3HOY B;  3NBH B;  1S3O A;  1PH2 A;  1UEA B;  5KRU A;  4DR1 L;  3QWN A;  4IUR A;  4HJA A;  3D0F A;  3L2P A;  3D31 A;  2BCO A;  3D6C A;  1LLR D;  1KRS A;  1BO0 A;  1UWV A;  4N8F A;  3NUC A;  3ULP A;  2WKC A;  3MEH A;  1VQ4 A;  1Q1E A;  4WJ4 A;  2RDH A;  2K05 A;  3H09 A;  5EBC A;  5C4H A;  1IXR A;  3FKI B;  3CF5 A;  4A76 A;  2F0V A;  3DEP A;  2F0S A;  1FVI A;  3BZK A;  2CKZ B;  4HIO A;  3K6O A;  3WDN A;  1W2B A;  2L4N A;  4WOR A;  1DOK A;  4FP5 D;  4POF A;  1L1O C;  2MHV A;  4NXM L;  5C4Z A;  3J80 L;  4K5V A;  2UU9 L;  2GVA A;  1Z6H A;  1Y14 B;  1PH8 A;  4UP9 A;  1AP0 A;  4FXD A;  2NZH A;  4H02 A;  1AN8 A;  1EQR A;  2K7V A;  2Q2T A;  1VQH A;  3HKZ E;  3NSW A;  2CW0 D;  3GTO H;  4JI1 L;  3EA6 A;  3HOW H;  1JT8 A;  3TZU A;  3OW7 A;  5FOB B;  1Y8N B;  3M4P A;  2B8G A;  3CRL C;  2JA6 H;  5IY0 A;  1NAP A;  3EVQ A;  2NN6 G;  1HFN A;  2M00 A;  1JC7 A;  4OO1 I;  4K8J A;  5JPM C;  5DLQ E;  5ELN A;  1I6V C;  1XMO Q;  2JA6 B;  2L1B A;  5C0X I;  2IX3 A;  5KNC A;  2Y0S B;  1QG7 A;  3TRE A;  2R92 B;  4KHP Q;  2E5L Q;  4BA1 I;  4OWT B;  1TWG B;  1SYE A;  2E74 C;  4Y7N H;  2F4V L;  2K33 A;  3F1Z A;  4C3H H;  4OON A;  2PZT A;  3HS0 C;  4FF1 A;  1UEB A;  3S16 H;  2VQE L;  2RHS B;  2NYZ D;  4J6H A;  1Q7Y C;  4DAV A;  4P74 A;  3JAM i;  1JE4 A;  1WTO A;  1HTP A;  3SK4 A;  1ICW A;  1EY9 A;  3I4O A;  3M4Y A;  1DD2 A;  1O78 A; 
#chains in the Genus database with same CATH homology
 4YY3 Q;  5IYD G;  3CMA A;  2AMC B;  3PUV A;  2B63 H;  2ASB A;  4L5T A;  3LGJ A;  4LFB Q;  2GN5 A;  1YZ6 A;  2IHF A;  1EUJ A;  2K14 A;  3RLO A;  4JI3 L;  2D0O A;  4LF5 L;  4JOI A;  4B3S L;  1LUZ A;  1A8V A;  2CCZ A;  1B8A A;  4P73 A;  4IPG A;  4R1J A;  4A3C G;  2BH8 A;  2JA7 H;  3E9H A;  4AH6 A;  1K0R A;  4GLA C;  1N9W A;  4NB3 A;  3BZC A;  5BR8 Q;  1Q46 A;  1X3E A;  3U4V A;  5C44 G;  1U0L A;  2F52 A;  5EAY A;  1VQ9 A;  4IFD I;  1MKH A;  1YJN A;  3HOW G;  4UP8 A;  5M3M G;  2R6G A;  1GM5 A;  4JCV E;  2ATW A;  4HJ5 A;  1CKN A;  2K4K A;  3JAM c;  4LF6 L;  2LSS A;  4YWM A;  4MTN A;  4JBK A;  2Z6K C;  4JI7 L;  1PH5 A;  4LFA Q;  2JA8 G;  4BY7 H;  3T1H L;  4RG1 A;  5FJ8 H;  4AYB G;  5C4J H;  1K83 H;  1N36 L;  4OWW B;  2L15 A;  1TWC H;  2DUD A;  1L1O B;  3JC6 6;  4IPC A;  5FLM G;  3UDG A;  3GD7 A;  4NPS A;  1PV4 A;  1HZC A;  2A19 A;  4TQU S;  2UUC Q;  1K3R A;  4QY7 A;  1JB7 A;  3U58 A;  2R7Z G;  1AE3 A;  4A3B H;  3MEF A;  4DV3 Q;  1V43 A;  4GOP B;  2EQS A;  1YIJ A;  3IRB A;  1N32 L;  2LXK A;  2V1C C;  1HZA A;  5GAD C;  1D7Q A;  4HJ8 A;  2BH2 A;  1VQP A;  2DGY A;  1Q8K A;  1VQJ A;  3MXN B;  3M7N A;  1QUQ B;  2I5H A;  2F3I A;  5M3M H;  2ZJQ A;  4P71 A;  4IPH A;  1L1O A;  3HOU H;  2JJQ A;  1UE6 A;  1HZ9 A;  3CC2 A;  3J80 i;  4PZ6 A;  2ZM6 Q;  5HY6 A;  1I3Q H;  2MQH A;  2Q2U A;  3A74 A;  4P75 A;  2OCE A;  1CKM A;  2VUM G;  4BBS H;  3K8A A;  4DV6 L;  4LF6 Q;  3AYH B;  1MIU A;  3H0G G;  1ASZ A;  3PO3 H;  3HOY G;  4X62 L;  4LFB L;  1HNX L;  4YHH Q;  2K5V A;  4AQY Q;  4KHZ A;  4A3J G;  2N8N A;  5IP7 H;  2JK8 A;  3KF6 A;  1E3P A;  4YY3 L;  1HNZ L;  4X65 Q;  2AKW B;  2UXB Q;  2Y0S G;  3PUW A;  4GKK L;  1WI5 A;  5JJK A;  3S1R H;  1X56 A;  3CXC A;  1EQQ A;  4MZ9 A;  4BA2 I;  2CWP A;  3G48 A;  4JI0 Q;  1L2F A;  5H1S E;  1K9M C;  4JC0 A;  2YU9 H;  4AIM A;  1YIT A;  4DV7 L;  1E22 A;  2JQO A;  1EFW A;  2R92 H;  4A3D H;  2N3S A;  4O0A A;  4QGU A;  3ULL A;  3Q8D A;  4GN3 B;  4YHH L;  4JYA L;  4DV2 Q;  1NJI C;  2YV5 A;  1Y1W H;  2GVB A;  3WWV A;  3EN2 A;  3A5Z B;  4IJL A;  1KIX A;  1XNR Q;  2UXC Q;  5IWA L;  3K7A H;  1E1T A;  1QVG A;  4GN5 A;  2WB1 G;  4IJH A;  4NXN L;  3G6E A;  1M1K C;  2UXD Q;  3K80 C;  3I2Z A;  3M85 A;  5LMU Q;  1E7Z A;  3A0J A;  3HOZ H;  2KBN A;  2NN6 I;  3PUZ A;  3S2D H;  1PH9 A;  4O2D A;  1SRO A;  2A1A A;  5C0X G;  4A3K H;  3CP0 A;  4DV2 L;  1J5E Q;  5HGQ A;  4JYA Q;  2KHI A;  1IZ6 A;  3S2H H;  3CCS A;  1PYS B;  1X3F A;  4DR1 Q;  2VY3 A;  3HOX H;  2PQA A;  3RN5 A;  2AWN A;  1S72 A;  1C9O A;  2JA5 H;  4LNQ A;  3H0G H;  3H15 A;  3S15 H;  3ER0 A;  4LWC A;  3TQY A;  3RR5 A;  1S40 A;  4DKA C;  3HKS A;  1N34 L;  2E2I H;  4B3M Q;  4GKK Q;  1B7Y B;  4GLV B;  4UP7 A;  1P16 A;  4XTC S;  4JI0 L;  1HNX Q;  4ME3 A;  4DK3 C;  3I56 A;  3TS2 A;  1KQS A;  3S1M H;  5J3B A;  1Z9F A;  4YCW A;  5IYB G;  3T1H Q;  2VUM H;  4B3R L;  1VS0 A;  1PFS A;  2PNH A;  2C35 B;  5M5W H;  5IP7 G;  1G29 1;  1SLJ A;  4DUZ L;  3KDF B;  2I5L X;  2VNU D;  2YYZ A;  3CCR A;  1I94 L;  1G6P A;  4JG2 A;  4IOC A;  3J81 j;  4EQ5 A;  3CQZ H;  2MNA A;  4LUZ A;  3CPW A;  4DV6 Q;  1R9T H;  1IBK Q;  1VQ5 A;  3CCE A;  2JEA I;  3PIP A;  3HOV H;  2N78 A;  4DV1 L;  5BR8 L;  2VW9 A;  3M4Q A;  2B3G A;  1PHJ A;  4A3M H;  2PMZ E;  3I7F A;  1YI2 A;  1TWH H;  1VQC A;  1NY4 A;  3OTO Q;  3HKZ G;  4HIM A;  4JI8 L;  1BBU A;  4JI6 L;  3CCJ A;  2Z6K A;  1CUK A;  1KHI A;  2IT1 A;  1YHB A;  2RHQ B;  4A4I A;  4AYB E;  5LMN L;  4A3I G;  1A0I A;  1YJ9 A;  1UE1 A;  1PA6 A;  4BY1 H;  1FGU A;  1RL2 A;  1N8R C;  1XMQ Q;  1SMX A;  3TEH B;  3ICE A;  2N49 A;  3CCU A;  3AFQ A;  2QA4 A;  4X64 Q;  1I5F A;  1PVO A;  5C4X G;  2I5M X;  3RZD H;  4POG A;  2JA8 H;  2BA0 A;  1YVC A;  4IFD G;  4A3F G;  2IY5 B;  1N33 Q;  5LMN Q;  2ZTD A;  1OXU A;  3CPF A;  2E2H H;  5K36 G;  2VQE Q;  4DR5 L;  2VQF Q;  2HIV A;  4A3B G;  1TWG H;  2HQL A;  1NBW A;  5M5X H;  5FLM H;  1HNW L;  1H95 A;  1O7I A;  3KLW A;  1CSQ A;  5C3E G;  4B3R Q;  2K75 A;  3CAM A;  1WOC A;  2JEB I;  1VQA A;  4APV A;  1VQD A;  1GVP A;  4DV4 L;  2R92 G;  1IBK L;  3PUX A;  1PH7 A;  3K81 C;  1SFO H;  4A75 A;  3K0X A;  5IE8 A;  4A3L G;  1HNW Q;  2D0P A;  4IO9 A;  1NMF A;  4K0K L;  2HHH L;  3GTQ H;  4HJ7 A;  3STB C;  1LTL A;  1KXL A;  3E0E A;  3VDY A;  1JMC A;  1UE7 A;  2NVT H;  3CCM A;  1P8L A;  4LF7 L;  1TXY A;  4DUY Q;  3B6Y A;  2ZJR A;  3HOZ G;  2NZO A;  1EWI A;  1A62 A;  3AEV A;  4DAM A;  3M4O H;  3PO2 G;  4J15 A;  3PGZ A;  1KL9 A;  2HHH Q;  1VQF A;  4NXM Q;  5IYD H;  2OTJ A;  4L5R C;  2D62 A;  3OW2 A;  1BVS A;  4GLX A;  4JV5 L;  1Q12 A;  4RMF A;  1Q81 C;  1XMQ L;  3KF8 B;  1VQG A;  2I0Q A;  4A3E H;  1PH6 A;  4JBJ A;  5IYC G;  3HOX G;  1EYG A;  5M3F G;  5GAG C;  4JBM A;  1XNQ Q;  2IHE A;  4DK6 C;  1EIY B;  3PO2 H;  4JI8 Q;  1Y1V G;  1OXV A;  2K52 A;  1A63 A;  4YWL A;  4A3D G;  4C3J H;  2MO1 A;  3UDX A;  2XTI A;  2UXD L;  2MFI A;  4DV7 Q;  4JI2 Q;  2JE6 I;  1K8G A;  2OWO A;  1BBW A;  5GRO A;  4GOP C;  1X3G A;  1XNR L;  3UDI A;  3S1Q H;  4A3L H;  4JBW A;  3M9B A;  5AJ3 Q;  1I94 Q;  2QGQ A;  1N36 Q;  1WCM G;  4X64 L;  1XMO L;  2B29 A;  2UXB L;  3CCV A;  4GNX A;  1NTG A;  3STB D;  5IYC H;  4DR3 Q;  1I6H H;  1XTD A;  1CKO A;  4LF7 Q;  1QVF A;  1PYB A;  4GKJ Q;  2JA6 G;  3PO3 G;  3T1Y Q;  1MJE A;  1VQO A;  1W3S A;  4GN4 B;  2YTY A;  4L5Q A;  3HOU G;  4JI5 L;  1I50 H;  1VQM A;  4YCU A;  1BKB A;  3NEM A;  1QUQ A;  1IL2 A;  4B3T Q;  4HJ9 A;  4R4C A;  3ULJ A;  2R93 H;  4GNX B;  2PQA B;  3KF6 B;  1WYD A;  1E24 A;  4LW1 A;  4X66 L;  3GTJ H;  2FXQ A;  2EIF A;  2Q2I A;  3J81 i;  3T1Y L;  3RN2 A;  3W5O A;  1GKH A;  3TS0 A;  4LF9 Q;  5JEA G;  4LF4 L;  3I4M H;  2WAQ E;  3CC7 A;  1QZH A;  4DUZ Q;  4BY1 G;  3L7Z C;  3CCQ A;  4UY8 C;  5IP9 H;  4OX9 L;  1SRU A;  1FJG L;  3F8T A;  1HJP A;  2WAQ G;  1IBM L;  3KYH C;  4WJ3 M;  4PZ7 A;  4BBS G;  2KHJ A;  2VL6 A;  1EIF A;  1XPR A;  4PZ8 A;  4KHP L;  3CME A;  3HFZ B;  2Q2H A;  2IX1 A;  4BBR H;  2AHO B;  1OXX K;  4BXX G;  4HIK A;  2Z0S A;  5FJ8 G;  5JJL A;  3GTP H;  2R93 G;  5GQO A;  4JI7 Q;  5ELO A;  2R7Z H;  2CQO A;  3GTG H;  1VCI A;  2UUC L;  2NVQ H;  3J81 c;  3KJP A;  2NVY H;  1OXS C;  3OTO L;  3ERS X;  4YCV A;  2F4V Q;  4DR6 Q;  2WFW A;  4OWX B;  4BXX H;  4QQB X;  3PCO B;  5C44 H;  4R4Q A;  2E2J H;  3J7Z C;  1JJ2 A;  2CWA A;  2ID0 A;  2JA7 G;  3CW2 C;  4KI0 A;  4QIW E;  3S24 A;  4NXN Q;  4X62 Q;  1OTC A;  2E5L L;  1AE2 A;  3U4Z A;  4DR5 Q;  1QVC A;  3GDE A;  4P72 A;  5C0X J;  2OQK A;  2BA1 A;  4DUY L;  4DR4 Q;  2EXD A;  1TWA H;  3S17 H;  4BY7 G;  1J6Q A;  5GAH C;  3DM3 A;  3A5U A;  4DV0 L;  1PH3 A;  4QL5 A;  4B3T L;  1X9N A;  3GTL H;  1VQB A;  3FKI G;  3BJU A;  5JJI A;  1X6O A;  1YHA A;  4C2M H;  1LYL A;  4LFC Q;  2MO0 A;  4A3G G;  3RLN A;  1VQ7 A;  4JI5 Q;  3I55 A;  2R7F A;  4JOI C;  4DV5 L;  2VZA A;  3KDF A;  1EOV A;  1V1Q A;  3H3V H;  1VQI A;  3S1N H;  2PI2 E;  3EIV A;  5M5Y H;  3F2D A;  4DR3 L;  1Y1V H;  4JI1 Q;  1OXT A;  4LFC L;  3DLL A;  1VQN A;  2KEN A;  1HR0 W;  4PMW A;  1D8L A;  3H3V I;  1J5E L;  2VQF L;  4TVA B;  3RLF A;  4YWK A;  1XPO A;  4GOP A;  2UUB Q;  1K8A C;  4XIG S;  3GTK H;  1Q1B A;  3W1G A;  2R7D A;  3W1B A;  2ES2 A;  2UU9 Q;  3UDF A;  1YJW A;  4QJF A;  2JA5 G;  4OX9 Q;  1FJG Q;  4JV5 Q;  1WJJ A;  3AQQ A;  3AFP A;  1IBL L;  3UE1 A;  3F2C A;  1HR0 Q;  3RZO H;  2LXJ A;  4IFD J;  2KCM A;  1JJC B;  4JI6 Q;  2QEX A;  4DR6 L;  1ASY A;  3G71 A;  1C0A A;  2YTX A;  3F2B A;  4K0K Q;  1X55 A;  1JE5 A;  4X65 L;  1HNZ Q;  4B3S Q;  3KJO A;  5M3F H;  1YHQ A;  1VQL A;  1VQ6 A;  1AH9 A;  1RIP A;  3K7U C;  1NE3 A;  4HID A;  4A3E G;  1Q86 C;  1X65 A;  1CSP A;  3BU2 A;  3NBH B;  3HOY H;  1S3O A;  1PH2 A;  4OXP A;  3SGI A;  2ZJP A;  1YNX A;  4DR1 L;  1IBM Q;  1HZB A;  1TWF H;  1YBY A;  4HJA A;  4A3J H;  3D0F A;  3L2P A;  3D31 A;  3PF4 A;  2ZM6 L;  3GO5 A;  4DV0 Q;  4LF9 L;  4DR7 L;  5JEA J;  2PI2 A;  1KRS A;  4DR2 L;  3TRZ A;  5LMU L;  1UWV A;  4DAY B;  4DV4 Q;  4A3G H;  2KCT A;  3OYY A;  3ULP A;  5C3E H;  1UE5 A;  2CFM A;  4BBR G;  3FKI H;  1VQ4 A;  4A93 H;  2UXC L;  1Q1E A;  2A8V A;  1KRT A;  4WJ4 A;  4JI4 L;  5C4X H;  3M3Y H;  2ALY B;  1X54 A;  1M90 C;  3G4S A;  3J7A 5;  3FHW A;  1IXR A;  1CKN B;  1IYJ B;  5LMN W;  3NEL A;  3CF5 A;  1VQ8 A;  1N32 Q;  4LUV A;  4A76 A;  4UPA A;  1N33 L;  4A3F H;  1FVI A;  3BZK A;  2CKZ B;  2VS1 A;  3KOJ A;  4HIO A;  1W2B A;  2OTL A;  2HT1 A;  2ZTC A;  4DNI A;  3I4M G;  2YTV A;  4LF8 Q;  2UUA L;  1V9P A;  4POF A;  1L1O C;  1FL0 A;  5AJ3 L;  2K5N A;  4JI4 Q;  4NXM L;  1QZG A;  1XPU A;  4LFA L;  2UU9 L;  4AQY L;  3RNU A;  1K73 C;  2RF4 A;  4EX5 A;  2GVA A;  1Y14 B;  1PH8 A;  4DR4 L;  1VQE A;  4UP9 A;  5IWA Q;  2NZH A;  1GO3 E;  1EQR A;  1Z47 A;  4H02 A;  4LUO A;  1LM0 A;  5IP9 G;  4DPG A;  4MNO A;  5FLX c;  2Q2T A;  1Q82 C;  1GD7 A;  3GTM H;  1SE8 A;  4LF4 Q;  4GNX C;  4A3C H;  1VQH A;  3HKZ E;  4DV1 Q;  4A3I H;  1SN8 A;  1KD1 C;  3HOV G;  1U5K A;  3GTO H;  1YEZ A;  4JI1 L;  4PG3 A;  4X66 Q;  4L5S A;  3HOW H;  1JT8 A;  2WB1 E;  4IPD A;  2ZTE A;  4DR2 Q;  4C3I H;  3CC4 A;  3M4P A;  3E9I A;  4A3M G;  2JA6 H;  5IY0 A;  3PIO A;  1SR3 A;  4DR7 Q;  3L0O A;  2NN6 G;  3FP9 A;  4DV5 Q;  4A93 G;  3PV0 A;  1DGS A;  4OO1 I;  3NEN A;  1KAW A;  3J80 c;  2OQ0 A;  5DLQ E;  5ELN A;  1N34 Q;  4B3M L;  1MJC A;  2E8G A;  2NVX H;  1WCM H;  4Y52 H;  1XMO Q;  4KLK A;  2H5X A;  5GAE C;  1L0W A;  3UE0 A;  4DV3 L;  4GKJ L;  5C0X I;  4X6A H;  3CD6 A;  1E1O A;  2WP8 J;  3TRE A;  3KFU A;  4KHP Q;  2E5L Q;  4BA1 I;  4ALP A;  1IBL Q;  2UUA Q;  5IYB H;  4GS3 A;  4OWT B;  1XJV A;  1WFQ A;  4R4I A;  3I4N G;  3ZJY C;  1Y1W G;  4Y7N H;  1C7Y A;  2F4V L;  4R4O A;  2B63 G;  1HR0 L;  3F1Z A;  4JI2 L;  3S14 H;  4C3H H;  1KC8 C;  3PF5 A;  2RCN A;  4OON A;  5IT9 c;  1PH1 A;  3PSI A;  2IX0 A;  4R4T A;  3S16 H;  3I4N H;  1UEB A;  2VQE L;  2RHS B;  4FDB A;  1JJG A;  1Q7Y C;  1PH4 A;  3EBE A;  4P74 A;  1T9H A;  2XGT A;  5E7N A;  1G51 A;  2JA9 A;  2K50 A;  2K5H A;  3U50 C;  3JAM i;  2UUB L;  1XNQ L;  2Y0S E;  4OO1 G;  4LF5 Q;  3CCL A;  1HH2 P;  4JI3 Q;  1NMG A;  3I4O A;  4A3K G;  1B70 B;  2HIX A;  3PUY A;  4IOA A;  2AWO A;  4LF8 L;  1VQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...