3HOZH

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
146
structure length
136
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 19
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hozH00
3HOZG 5HY6A 5IP7H 1V1QA 4A93H 1N8RC 4GLXA 4R1JA 5IY0A 1VQ9A 4LWCA 3ZJYC 2Z0SA 4DV4Q 3HOZH 4IFDJ 4IPDA 2JEBI 2ZJPA 1UE1A 4DR6L 2F52A 3G48A 1Q1EA 4DV6L 1NTGA 5IYCG 1Q81C 2N49A 3TS2A 1TWFH 2I5MX 1M90C 1EFWA 2D0PA 2PI2E 5IP9G 4DR1Q 5JJKA 4JI4Q 5M3MH 4GLAC 3EIVA 5IYCH 3T1HQ 2UUAQ 1X56A 4OXPA 1PH5A 2V1CC 1XTDA 1M1KC 4JBKA 5IP9H 2JQOA 5LMNL 1KIXA 4HJ7A 1IBLL 3PIPA 5IYDG 4X66Q 2K14A 5LMUQ 3ULPA 1HZCA 3S17H 1VQAA 5GAHC 1OXSC 3BJUA 3FHWA 4PG3A 4NXMQ 4Y52H 1VQ4A 4UP9A 3CCEA 5BR8Q 5JJLA 3M85A 3K7UC 4NPSA 4DK6C 4A3FG 4LF7L 2XTIA 4A3JG 2F3IA 2AHOB 2D62A 2YTVA 2ZJRA 4DR2Q 4AQYQ 1PH6A 1VQOA 4JOIC 4A3FH 4OWWB 3RZOH 5C4XG 1IXRA 5GADC 1CKNB 2R7DA 4OWTB 2K4KA 4AH6A 2VZAA 4A3JH 2E8GA 3L0OA 4OO1I 4B3TL 4DK3C 1HH2P 1SROA 2B3GA 4C3HH 1IBML 5C4XH 4DV5Q 3CD6A 3H3VI 4P73A 2RHSB 1SR3A 4LF8L 5C3EG 3KDFB 2QEXA 3J81j 4GNXA 4FDBA 2Y0SE 4GKJQ 1QVFA 3T1YQ 2I5HA 1S40A 3D31A 1XPUA 3K7AH 1KAWA 1X54A 4PMWA 1PH2A 4JBMA 4A3DG 5C3EH 4JV5L 2UXBL 1BVSA 1GM5A 3HOYG 1DGSA 1XNQL 1L1OB 1AE2A 1QVCA 2VW9A 1PHJA 4C2MH 1XMQL 3CCSA 2BH2A 5K36G 4DKAC 2IY5B 2UXCQ 2NZOA 4TVAB 1MJEA 2HHHL 3HOYH 4A3CG 2JK8A 3PSIA 1Q82C 1PVOA 1E22A 1OXUA 3CF5A 5ELNA 1YHQA 1N34Q 1LYLA 1NMFA 1YIJA 4A3CH 2HIVA 3HFZB 4JYAQ 1K73C 4LFCL 1IYJB 1Q7YC 4LFBL 1KL9A 3S16H 3TS0A 4L5RC 2IT1A 4YWMA 1VQ7A 1YJ9A 4KHZA 3UE0A 1LUZA 1WJJA 3S24A 2MFIA 2JE6I 1VQCA 1KC8C 4DV1Q 3H0GG 4L5SA 4LUVA 4QIWE 4JBWA 3CCUA 2EXDA 2LSSA 3ER0A 3L2PA 1HNZL 1EIYB 5IT9c 3H0GH 4JI3Q 1FJGL 3I4OA 4QL5A 4A3EG 2L15A 2OCEA 5IWAQ 3BZCA 4POGA 4JI1L 1B7YB 1PA6A 4K0KL 3AYHB 2MNAA 4LNQA 4A3KG 5AJ3Q 4X64Q 4A3EH 2B29A 2VQEL 4DV7L 1JJGA 4B3RL 1YNXA 3I56A 1OXXK 3F1ZA 1WFQA 4A3KH 4GKKQ 1K83H 1EOVA 1VQGA 4B3ML 1EUJA 1G51A 4DNIA 2RHQB 2FXQA 2CQOA 2KCMA 2HT1A 2NN6G 1C0AA 2ZTCA 4IO9A 4OX9Q 4X62Q 2KCTA 1NJIC 1C9OA 5M5XH 4OWXB 5IE8A 1FGUA 4B3SL 1NY4A 1VS0A 3KJPA 4DR5Q 1I94L 2YU9H 4IFDI 3RLOA 4NXNL 2KHIA 1HZAA 3NBHB 1VQ8A 2WFWA 4DUZL 1JJCB 2N3SA 1YHBA 4H02A 5DLQE 1WOCA 4ME3A 3H15A 4DV0L 1YI2A 2UU9Q 1EQRA 3PUXA 3CC4A 2UUBQ 2VL6A 2PQAB 4LFAL 1B70B 4YHHQ 4JOIA 3W5OA 1JT8A 1BKBA 3JAMi 2JEAI 1GVPA 2LXJA 3HKZE 2R92G 2QA4A 4UY8C 4GLVB 1VQFA 4JI6Q 3ULJA 5LMNW 1EIFA 4DR4Q 4YCUA 3SGIA 1OXVA 2VS1A 3AFPA 2R92H 2WB1G 4JI2L 1YJNA 2K5NA 4DV2L 2MO1A 4PZ8A 4LF9L 4BA2I 2VNUD 1VQIA 2K50A 1I50H 3RLNA 4JBJA 1RIPA 3FKIG 2UUCQ 1I5FA 4NB3A 4DR6Q 2NVYH 3L7ZC 1VQBA 1X9NA 1E24A 3KOJA 1VQEA 5IYBG 1BBWA 2AWOA 3FKIH 2I5LX 3I7FA 3ERSX 1PH9A 4YY3Q 3S14H 1VQDA 3PGZA 4XIGS 1WI5A 1JJ2A 4OONA 5IYBH 3K8AA 1KRTA 4HJ5A 3GTLH 4IPCA 5LMNQ 3S1RH 1SE8A 5C44G 4JI7Q 4GN3B 2AWNA 3AEVA 1UE7A 3KYHC 4XTCS 1IBKL 2OQKA 5C44H 1GD7A 4IPGA 2OTLA 3GTQH 1A63A 1RL2A 2OTJA 5FJ8G 1D8LA 4DR7L 1X3GA 3CC7A 3CMEA 1YBYA 5JEAG 4LF7Q 2QGQA 5C0XJ 4KLKA 4GOPC 5IYDH 5FJ8H 2PI2A 3OW2A 3ICEA 2ZM6Q 1KRSA 1Y14B 4L5TA 3Q8DA 4C3IH 4Y7NH 4O2DA 4DV4L 3RR5A 3CCVA 4P72A 3ULLA 1E7ZA 1P16A 1ASZA 4B3TQ 3GTGH 5H1SE 3J80c 2WB1E 3S2HH 4MNOA 1IBMQ 4A3DH 3RNUA 1N32L 4JC0A 1HZ9A 2YTYA 1S3OA 3RN2A 3M9BA 4MTNA 1X55A 4DV3L 4DR1L 2UXBQ 4JI4L 4L5QA 1MIUA 1Q46A 2XGTA 3T1HL 2UUAL 2JA5G 1XNQQ 2CWAA 2R7FA 3TRZA 1TWGH 3BZKA 4HIDA 3J80i 4IOCA 1XMQQ 3STBC 3G6EA 4GN4B 1IL2A 1HR0L 1A0IA 1X65A 4YCVA 2HHHQ 4LF6Q 3A5ZB 2RCNA 3RLFA 4X66L 3NELA 5LMUL 1PH1A 2JA5H 4A3IG 4X6AH 3AQQA 4JI8Q 3F2CA 3OYYA 4IPHA 4LUOA 1XPOA 2NVXH 4LF5Q 4NXML 1G6PA 4A3IH 3RZDH 3KF6A 1PYSB 3LGJA 3TREA 4YWLA 5BR8L 2LXKA 3KFUA 2CFMA 1VQPA 4UP7A 1K0RA 1HNWL 1HZBA 1V43A 3NEMA 1XNRQ 1UE5A 1CSQA 4HIKA 4DR3L 1P8LA 4KI0A 1HNZQ 4LF4Q 2F4VL 4GNXB 1T9HA 3D0FA 1VQNA 2ZJQA 1FJGQ 4DV5L 5C0XG 1Z47A 4AYBG 2NVQH 1OXTA 2BA1A 2ATWA 5E7NA 4GKJL 3T1YL 4K0KQ 2UXDL 2N8NA 1WCMG 3CW2C 4JI5L 1Q1BA 2VQEQ 2ZTDA 1CKMA 4A4IA 4DUYL 1WCMH 4HJAA 3U58A 1VQ5A 4B3MQ 3S1QH 4LUZA 5M3FG 1XMOQ 2GN5A 3M4QA 3BU2A 1QUQA 3J7ZC 1VQHA 2ALYB 1N34L 5GAGC 4POFA 3KJOA 3CCQA 2R6GA 3OTOQ 5M3FH 1Q86C 1PH8A 2VQFL 1PH4A 3HOVG 3AFQA 4JYAL 4B3SQ 3E0EA 3HOXG 4JI0Q 4APVA 2KBNA 2DGYA 3PUYA 4BY7G 1N36L 3HOVH 1JE5A 2C35B 1X3EA 4QGUA 4A3LG 3F8TA 4TQUS 3HOXH 4DV1L 2K5HA 3J7A5 2AKWB 4BY7H 2K75A 1L1OC 3JAMc 4DV0Q 3GTOH 1UEBA 3U4ZA 4BXXG 4GOPA 4A3BG 4KHPL 4A3LH 2VUMG 4LFAQ 4JI3L 1HJPA 4UP8A 5EAYA 5IWAL 3E9HA 1SN8A 2VY3A 3PCOB 5JEAJ 4ALPA 4BXXH 4A3BH 3GTMH 5GAEC 2VUMH 1HNXQ 2IHEA 3HOWG 2JA6G 5AJ3L 1J5EL 4A3GG 1R9TH 2I0QA 4GN5A 4R4OA 4QY7A 4A3MG 4X65Q 3HOUG 4LF9Q 2JA6H 1N33L 1AE3A 4RG1A 4YWKA 4A3GH 2E5LL 3PUWA 4IJHA 4A3MH 2OWOA 1CUKA 1GO3E 3DM3A 3HOUH 3CCMA 4YCWA 4OX9L 1B8AA 1YEZA 5GQOA 4X62L 5C0XI 5FLXc 1KXLA 1LM0A 3G4SA 2JA7G 2EQSA 1PFSA 4DV6Q 4PZ7A 2Q2HA 2RF4A 2JA7H 1VQLA 2R93G 1SLJA 1SRUA 2BH8A 3A74A 1UE6A 2IHFA 4RMFA 5J3BA 1W3SA 3I4NG 3M4PA 4HIOA 2UU9L 1I6HH 2R93H 4R4QA 5M5WH 2CKZB 3EN2A 1W2BA 2UUBL 2NZHA 1TWAH 1UWVA 3E9IA 1EYGA 1IBLQ 3I4NH 4YHHL 1Y1WG 4QQBX 1O7IA 3H3VH 4JI6L 2YTXA 2NN6I 3PUVA 3VDYA 4DR4L 4WJ4A 4UPAA 1NMGA 1HR0W 4IJLA 1CSPA 1L2FA 2HQLA 1XJVA 1OTCA 1L0WA 3CQZH 4P75A 3PF4A 2Z6KC 2DUDA 1YVCA 2Y0SG 2UUCL 4HIMA 1E1TA 1J6QA 3CCRA 1VQJA 5M3MG 1N32Q 3WWVA 4O0AA 1K3RA 3S1NH 1PV4A 1PH7A 3KLWA 4YY3L 3UDFA 5M5YH 4DV3Q 2JJQA 4JCVE 4WJ3M 1K8AC 2HIXA 1CKNA 4C3JH 3M3YH 4LF8Q 2Q2UA 2A19A 3G71A 1X3FA 1Z9FA 2E2IH 3CPFA 1FVIA 3JC66 2D0OA 2B63G 1HR0Q 2WP8J 3MXNB 1AH9A 4JV5Q 4JI7L 4PZ6A 3KDFA 3KF8B 1KD1C 3GDEA 3W1GA 2B63H 1PYBA 2ID0A 4MZ9A 2AMCB 1IZ6A 1FL0A 1L1OA 3IRBA 1MKHA 5GROA 4HJ8A 5C4JH 2H5XA 1YJWA 5HGQA 1HNWQ 1SMXA 1A8VA 1VCIA 5JJIA 4LFCQ 2ZM6L 1E3PA 4LFBQ 3A5UA 4DR3Q 4AQYL 2EIFA 3MEFA 4P74A 2F4VQ 2N78A 1BBUA 1XPRA 3B6YA 4HJ9A 3PO2G 4DR2L 4A75A 1EQQA 1A62A 2PNHA 4BA1I 1JMCA 4AIMA 1VQMA 2GVBA 2ZTEA 2UXDQ 3PO2H 3GO5A 3CPWA 4JI5Q 1V9PA 3PV0A 1KHIA 4IFDG 2IX0A 3UDXA 4JI1Q 2A1AA 4DUYQ 1X6OA 5FLMG 3PUZA 3U50C 2WAQG 4R4CA 4DV7Q 4LF6L 1ASYA 4B3RQ 3KF6B 3GD7A 2E2JH 3STBD 5FLMH 4JI8L 3PF5A 1TXYA 3I2ZA 1VQ6A 4GS3A 2CCZA 1QZGA 5ELOA 2UXCL 4LF5L 1C7YA 2ES2A 2VQFQ 1S72A 4R4IA 1SFOH 3TEHB 4EQ5A 1E1OA 1N36Q 3RN5A 3I4MG 1Q12A 2YV5A 4LW1A 1K9MC 3CXCA 2R7ZG 1K8GA 3CMAA 3S15H 1XNRL 1I94Q 3I4MH 3HKZG 1WYDA 4DAYB 3CCJA 4LF4L 4NXNQ 4IOAA 1TWHH 2R7ZH 4KHPQ 3PO3G 4BBSG 3M4OH 4DUZQ 3GTPH 2K5VA 3K81C 1JB7A 3EBEA 2Z6KA 3UDIA 3I55A 3S1MH 3GTKH 3PO3H 1N9WA 2IX1A 4BBSH 2Q2TA 1J5EQ 4P71A 1I3QH 2JA9A 1QUQB 3M7NA 3A0JA 4J15A 1N33Q 2PMZE 1Y1VG 2PQAA 4JG2A 2E5LQ 4X64L 2CWPA 3CAMA 1PH3A 4AYBE 2ASBA 2NVTH 1YHAA 2MO0A 4JI2Q 1XMOL 1TWCH 1QVGA 3HOWH 4DV2Q 1Y1VH 3J81c 4GKKL 1GKHA 2WAQE 4GNXC 3K0XA 1YZ6A 3OTOL 1NBWA 4BBRG 2OQ0A 1LTLA 2BA0A 2KHJA 4JI0L 3DLLA 3PIOA 3FP9A 1U0LA 3CC2A 1YITA 1Q8KA 3CP0A 4QJFA 3GTJH 3F2DA 4GOPB 1U5KA 4BBRH 2A8VA 1VQKA 3CCLA 4EX5A 3J81i 4DR5L 3UDGA 1QZHA 2Q2IA 2YYZA 2JA8G 3TQYA 4DAMA 2E2HH 3F2BA 1MJCA 3K80C 3W1BA 1D7QA 2K52A 2JA8H 4OO1G 1HNXL 1IBKQ 2MQHA 1CKOA 1G291 4BY1G 1KQSA 1H95A 4DPGA 2GVAA 3UE1A 1EWIA 5IP7G 4X65L 3U4VA 3S2DH 4DR7Q 4A76A 2KENA 4A93G 3NENA 4R4TA 4BY1H 3HKSA 1NE3A 1Y1WH
chains in the Genus database with same CATH superfamily
3J80L 1CA5A 1V1QA 3I73A 1BBXC 1VQ9A 4R1JA 2EYHA 4LWCA 1O7YA 4RHSA 3HKZB 5LL6X 2EY2A 4Q5VA 2OXPA 2NTSA 3OMCA 4G7OC 4FF1A 1KNEA 1M90C 2PI2E 4J6HA 1E2WA 3X3MA 4JI4Q 1VF7A 3BDCA 4O42A 1X56A 4JBKA 3SR1A 1IBLL 2OF1A 2Z4IA 4F87A 3U9SA 1SMYC 3NPPA 1HZCA 2A5HA 1BCPD 5GAHC 1OXSC 1PRTC 4XYOA 1Y8PB 5J22A 2K6AA 4UP9A 3CCEA 1ESFA 3K7UC 2EVBA 4NPSA 4DK6C 3VYSA 2SNMA 2VB3X 2XTIA 2YTVA 1RKNA 1WTWA 4DR2Q 1PH6A 1VQOA 3RZOH 4OWWB 5C4XG 4ZKBB 5GADC 1D5ZC 2VZAA 2E8GA 3L0OA 4CDDC 4OO1I 2F0GA 3TZDA 1SROA 3CRLC 1LTBD 3HGBA 4C3HH 2JA8B 4DV5Q 3CD6A 2NTTA 1Z6HA 2QEXA 2R92B 3W3AA 4FDBA 3T4AC 3D31A 2F1MA 1PH2A 4JBMA 4JV5L 1GM5A 1DJRD 2WB1B 1E2ZA 1PHJA 4C2MH 2BH2A 1H9KA 4A93B 2J4XA 2QW7A 2A6EC 1STGA 1Q82C 1E22A 3CF5A 1NNXA 5ELNA 1AEXA 5IGFA 2HIVA 5CYUA 4IUVA 4LFBL 1RJTA 4E6IA 3T56B 4L5RC 1LT6D 2EYJA 4YWMA 1D6EC 1YJ9A 3C3LA 1VQCA 4S3SA 2E2DC 4QIWE 3CCUA 2EXDA 3ER0A 1HNZL 3KK7A 4G7ZC 1S5CD 1C4QA 3I4OA 2N88A 1RD9D 5L37A 2G9DA 3BZCA 3K5OA 4JI1L 1V8QA 4RWSC 1PA6A 3AYHB 4A3KG 4Q0FA 4A3EH 2B29A 1JJGA 1YNXA 3I56A 3S2HB 3MEHA 5C6AA 1WFQA 4GKKQ 5FLXL 1PZJD 2FXQA 1PTOF 4NW2A 2KCMA 2HT1A 4EGVA 2R3ZA 4X62Q 4OWXB 1B9NA 4CJ1B 1NY4A 1VS0A 2L9HA 4DR5Q 2EYFA 4NXNL 5DAUA 2KHIA 3NBHB 1XX8A 1MBYA 5E4XA 4H02A 3KBXA 1S5BD 1WOCA 4ME3A 3RZDB 2UUBQ 4CKBA 2BDOA 4LFAL 2PQAB 5ISRA 3VR2A 3ZYYX 3A7AB 2QA4A 1O7LA 2F0DA 1VQFA 1ILPA 1QNUA 1EQVA 4KTAA 1VF5C 3AFPA 3KLSA 1YJNA 2QILA 4RKBA 2MO1A 4KHVA 3MZ5A 2O2LD 2K50A 3CHBD 2UUCQ 3NK9A 1PTOB 1O7ZA 4KY7A 1BBWA 3I7FA 3ERSX 3MA2B 3S14H 2JP1A 4XIGS 1WI5A 4OONA 1JICA 3EQLC 2WV6D 4ZAIA 4L63B 2K7VA 2AWNA 1LTSD 3KYHC 3J7AV 4FO2A 5C44H 3CRKC 2JYOA 3GTQH 5C4ZA 3KF8A 3HOVB 5EKIA 5C0XJ 4C3IG 2M9VA 1U4LA 3GQBA 3K5MA 4L5TA 4A3DG 4Y7NH 3RR5A 5IGCA 4B3TQ 3J80c 3GTMB 1HQMC 1IBMQ 2VUMB 3TMEA 3RNUA 3NTIA 2O5JC 4ZKCB 2F0UA 1X55A 3H6MA 4DV3L 4DR1L 3FDTA 4QF4A 2BOSA 2JA5G 1XNQQ 1JWSD 3BZKA 2KCCA 3J80i 3STBC 2E76C 1X65A 2HHHQ 4LF6Q 3A5ZB 5A35A 5IIFA 4A3IG 3AQQA 3F2CA 1TR5A 5D65A 3KF6A 5FO8B 3ITPA 5DEHA 2LXKA 3KLSX 2CFMA 4DGZA 2Z8LA 1K0RA 1HNWL 5FO7B 2PCFB 2H4OA 1XNRQ 5C4HA 4HIKA 4LF4Q 1LV9A 2JXMB 3URYA 3EA6A 1FNWA 3K0YA 5C0XG 1SXTA 1OXTA 2NVQH 4GKJL 3CQZB 3T1YL 2N8NA 2VQEQ 4G7HC 4WORA 1CKMA 3V05A 3U58A 4F7XA 4LUZA 5TSSA 2Y0SB 1G2SA 1XMOQ 1F9SA 1PRTF 3J7ZC 3FRPB 2I46A 1N34L 5GAGC 2XVSA 3SE0A 4A3DB 1RCVD 1Q86C 3AFQA 1SYGA 2ICIA 4JI0Q 4APVA 4BY7G 3LWEA 4H7BA 3BS1A 4QGUA 1CA6A 2B63B 4L8JA 3X3NA 3J7A5 2AKWB 2IJ0A 4DV0Q 3GTOH 1UEBA 4BXXG 2JA5B 5EBDA 4A3BG 4KHPL 2NBFA 1L0XB 5EAYA 2F0OA 5C4JB 1KTKA 5IWAL 1QILA 1SN8A 3MVVA 3PCOB 4ALPA 4X3TA 1PYWD 5GAEC 4A3IB 1HNXQ 2CVRA 5IGEA 5BN4A 5FK9C 1SSOA 4R4OA 2HDLA 3HOUG 1CT1D 2JA6H 4FP5D 2FJ2A 3BDOA 4IUUA 3FPPA 4HR7B 3V2TA 1YEZA 5FLXc 3I8ZA 3G4SA 1PRTB 2JA7G 4EQNA 3WOEA 4PZ7A 2RF4A 1YNND 1VQLA 1SLJA 1FGBD 2BH8A 3A74A 1QOHA 2A68C 3M4PA 5KNBA 2UU9L 2B2TC 1I6HH 4R4QA 2R93H 5M5WH 2CKZB 1SEBD 3OIQA 1TWAH 1IBLQ 3I4NH 1Y1WG 2N55A 1SNQA 5DM63 3W2DA 1EZ8A 2V4DA 1LTGD 4ZUJA 4WJ4A 1HR0W 1ESRA 4FF3A 1L2FA 3DWPA 3VA7A 5FO9B 1AZQA 1LTTD 2EXZA 1NUCA 3O13A 1J8IA 1Y8OB 4BY7B 5ELDA 1JB3A 4BBSB 4U68A 4ZQ3A 2B2WC 3WWVA 1FNVA 4RA8A 3NWTA 3J7AF 5M5YH 2JJQA 3MAQA 2HD3A 2HIXA 4C3JH 4CKEA 2Q2UA 2A19A 1R9TB 2E2IH 1FVIA 1HR0Q 3I3CA 2WP8J 3MXNB 4JV5Q 4PZ6A 1TY0A 3GDEA 2MJ8A 3HOUB 3VR3A 1XWEA 2ID0A 2PPBC 3EFXD 4BBRB 4HJ8A 1JOOA 5C3WA 4IURA 4KY6A 3V96A 3PQIA 1A8VA 5KIXA 2JA7B 2Z4HA 4LFBQ 5KNCA 2EIFA 4RGOS 2HCCA 2F4VQ 1EL0A 1BBUA 3B6YA 4HJ9A 2LMCB 4DR2L 1EQQA 1A62A 2PNHA 4AIMA 3SXHA 1EU3A 1S5ED 4JI5Q 3PV0A 2VXWA 1KHIA 4IFDG 2Z9HA 1Y1WB 3UDXA 4JI1Q 4DUYQ 2LKVA 1B2TA 3PUZA 3U50C 2WAQG 2IPKD 4DK0A 4ZYSA 1T5EA 3AB9A 4JI8L 3PF5A 4GS3A 4OELB 1B3AA 5KYIA 1C7YA 2VQFQ 1E0BA 4KV6A 1S72A 2DNCA 4EQ5A 1E1OA 1N36Q 2EY6A 2K28A 5ELCA 4K5XA 3M3YB 4LW1A 1K9MC 1GJXA 3S15H 3QJYA 3EVQA 1WYDA 4DAYB 4NXNQ 4ID6A 3GTPH 2F0QA 3I55A 1AZPA 3GTKH 1D1KA 1J5EQ 4KN7C 4N9TA 1D2BA 5CBEE 2F0MA 2PMZE 2PQAA 3I90A 4QIWB 4FF2A 2E5LQ 4X3SA 2MO0A 4G4KA 4GKKL 2DJGC 3OTOL 4JPBW 1JCKB 1ET9A 1LTLA 2J7ZA 2KHJA 3DLLA 3K7AB 1T5XD 4FYDA 3CP0A 1U4RA 3NHHA 4DR5L 1QZHA 2Q2IA 2YYZA 4DAMA 3A55A 1BDOA 3F2BA 1SJED 3W1BA 1D7QA 2JA8H 4OO1G 4OHJA 1VMCA 5C5LA 1G291 3S16B 4PQXA 4EQOA 2GVAA 4CDFC 1R4PB 3U4VA 2Z1CA 2KENA 3NENA 4JK1C 4NMZA 3HKSA 3NBIA 3HOZG 5HY6A 3OMGA 5HGTA 5EPJA 4IQZA 4A93H 1N8RC 3H0GB 3FVQA 4EVOA 3ZJYC 5IY0A 3VYRA 2JEBI 2F52A 4DV6L 1F2YA 1NTGA 1Q81C 2N49A 1HTPA 3NXWA 3TS2A 1TWFH 1EFWA 4DR1Q 5IP9G 5M3MH 2EJFC 3EIVA 4K8IA 1DD2A 2FHTA 1KIXA 4HJ7A 3PIPA 2C9OA 3RD4A 5M5XB 1ICFB 2IW3A 4PG3A 1SNPA 4Y52H 2JN4A 2K04A 1EY9A 5JJLA 3M85A 4A3FG 4A3JG 1XXGA 4MHEA 2AHOB 2ZJRA 5G3LD 4JOIC 2MGSA 1IXRA 2EY5A 4B3TL 1IBML 5C4XH 4P73A 3J81j 2Y0SE 4GKJQ 4DNTB 3T1YQ 3HEJA 2RDGA 1X54A 1BVSA 1DGSA 1XNQL 3MXGA 2VW9A 2XRQD 3AU7A 3CCSA 2NVYB 2IY5B 2NZOA 4TVAB 5I4DA 1B4OA 2HHHL 3HOZB 4A3CG 1WD1A 1N34Q 1LYLA 4KJOA 1NMFA 1YIJA 4ULLA 1HRJA 3HFZB 3GTLB 3QOLA 4LFCL 1Q7YC 1KL9A 3LNNA 2F0TA 4KHZA 2SDFA 3S24A 1KC8C 4C1NK 1ZEQX 1IKLA 4PMCA 1ZYRC 1EIYB 5I6YA 4QL5A 5IWAQ 2OCEA 4POGA 2B2VC 1B7YB 5IT9E 1I4HA 1NCVA 2VQEL 5CV4A 4B3RL 1OXXK 3HP3A 1STYA 4A3KH 1K83H 4DNIA 1SJHD 1LTID 2NN6G 1EY8A 4CBVA 3R3OA 1TWGB 4K5WA 3KJPA 1I94L 4X3KA 2YU9H 3IAYA 4IFDI 1H9JA 4KK7A 1VQ8A 1PLFA 3TP7A 1CM9A 2EOTA 3NP8A 3JAME 5DLQE 3SEBA 3H15A 2UU9Q 4DV0L 3CC4A 3PUXA 2XIWA 2VL6A 1ONLA 1JOQA 1GVPA 2R92G 4J1MA 4UY8C 3K5LA 5LMNW 1EIFA 4YCUA 1HFNA 3SGIA 2WB1G 3HS0C 3RMHA 2K5NA 2SNSA 4DV2L 2VNUD 4DNRB 1RIPA 1I5FA 4NB3A 4DR6Q 4QUCA 4XQNA 1E24A 1I4RA 1JC7A 1GUNA 1VQDA 1WCMB 2IL8A 4IPCA 5LMNQ 1PZID 5K5PA 4RGTA 5M3FB 2R61A 2D9UA 2CW0C 1GD7A 3MXNA 2Z6BA 4KD3A 1D8LA 1FNUA 1X3GA 3HOXB 5JEAG 2A6HC 4LF7Q 2MUYA 5IYDH 2PI2A 4FVMA 3BVMA 5EJWA 3Q8DA 4C3IH 3CCVA 1ASZA 1E7ZA 1STBA 4ILWA 4A3DH 2H1EA 1A2UA 2YTYA 1S3OA 5BN5A 4KKSA 4TKOB 4IUNA 4L5QA 4A3GB 3T1HL 2UUAL 4B9XA 1PXUA 3G6EA 2BE5C 1HR0L 4YCVA 2RCNA 2JA5H 1I50B 2TSSA 4JI8Q 2Q8TA 3NQTA 1RODA 1U4MA 1K28A 2EYMA 4I65A 1CQFA 4A3IH 1PYSB 4UAIA 2AUKA 5BR8L 3KFUA 4CKCA 1UE5A 3S1RB 1CSQA 2F4VL 1T9HA 2B39A 1VQNA 2KEEA 1HFGA 1Z47A 2F0FA 4DAYA 4ME5A 2RSOA 1BNZA 2ATWA 4JI5L 2L55A 1Q1BA 5C0XH 4N8FA 2ZTDA 3J81L 2XWJB 4DUYL 1IW7C 2QEJC 1WD0A 1VQ5A 1ICWA 1YNJC 3WOFA 2HCIA 2GN5A 3M4QA 3BU2A 1TY2A 2ALYB 1QB5D 2A6ED 3CCQA 3OTOQ 3HOVG 2VQFL 4JYAL 3C1EA 2F0EA 1IHZA 2KBNA 3PUYA 1N36L 4XT3B 4A3LG 2G5DA 2K5HA 4BY7H 1L1OC 2VUMG 5JAVA 4IUTA 1GOZA 5JVH3 2VY3A 4BXXH 1B53A 4A3BH 2LS01 1JWUD 5IOCA 5AJ3L 1J5EL 4KKTA 1R9TH 4GN5A 3SK5A 4QY7A 4FF4A 3RUZA 4LF9Q 1TU2B 1AE3A 2E5LL 2OWOA 3DM3A 3PO2B 3HOUH 3CCMA 5J39A 1F2ZA 1LM0A 3QOJA 4CHTB 1ENFA 1RHPA 1SYFA 2EQSA 1QE6A 2PMZB 3T51B 2D5DA 4DV6Q 2Q2HA 1EWHA 1EY0A 2JA7H 2L5TA 3K57A 5EGTA 3K6OA 3EN2A 3G7LA 2NZHA 1UWVA 1V1PB 1WTPA 2RKSA 4JI6L 3VDYA 2NN6I 5T1IA 4MIUA 4DA2A 2R7ZB 1HHVA 3PF4A 2Z6KC 2DUDA 1YVCA 2Y0SG 1D5MC 4HIMA 3ONAB 4TRDA 3CCRA 5AFWA 1N32Q 2PZTA 3NUCA 3UI2A 1K3RA 3S1NH 4YY3L 4LAAA 4WJ3M 2K32A 1RTNA 3M3YH 1X3FA 2NVTB 1SNMA 3JC66 1TWCB 2B63G 2F0IA 1H9RA 2CH4W 4DN4M 2WKDA 4JI7L 1PFNA 1G2TA 1HUMA 1A6XA 4MZ9A 1F9PA 3L9AX 2XSCA 5C5MA 1YJWA 1X32A 5JJIA 4LFCQ 2X6LA 1HCZA 3OHXC 3A5UA 4P74A 2N78A 2K5WA 5IT9L 4A75A 1JORA 3GO5A 3S2DB 2ICEC 1BCPF 1EIGA 1SE3A 3G6JB 1XTCD 4IFDH 4B3RQ 2ZXOA 2E2JH 1EWCA 3STBD 1TQOA 1TXYA 3I2ZA 1QZGA 2ES2A 2B2TA 4OGQC 1SFOH 3TEHB 3JAML 1XYIA 1WTHA 3GV6A 1I94Q 5DM73 1TWHH 3C2PA 1LT3D 4BBSG 3M4OH 1JB7A 1GXDC 3EBEA 4WJWA 3UDIA 4CJ2C 3S1MH 2IX1A 2Q2TA 1JQYD 3LWUA 4P71A 2LFNA 2XNAC 4OIJA 2B2WA 4XDXA 1I3QH 1U4PA 2JA9A 1QUQB 1Y1VG 4YIJA 1JR0D 3K58A 3RZOB 2F3VA 4RH6A 1YHAA 3MC0B 4HN7A 4DV2Q 3HOWH 1UNSA 3J81c 2KA7A 4GNXC 1YNNC 2B8GA 4IN3A 4BBRG 2OQ0A 2KHSA 3TSSA 3PIOA 1U0LA 2B2UC 4XQQA 3GTJH 3J81i 2CH4A 5JOBA 1RTOA 1EY4A 4BS9A 5IGDA 4CDCC 1ET6A 3K80C 5EKKA 3E5SA 3D4RA 4BY1G 1H95A 4OO1H 3BDLA 5IP7G 3H09A 4X65L 3M4YA 2DNEA 4GLXA 4K2LA 4IFDJ 2Z0SA 3HOZH 3NQIA 2ZJPA 4DR6L 4KY5A 3G48A 1JE4A 3I91A 1WTRA 2F03A 2WINB 2CHBD 5IYCG 2ZT9C 1HXYD 2F4IA 2I5MX 1LACA 2D0PA 3T1HQ 2UUAQ 4CDEC 4R9WA 1PH5A 3MXUA 1XTDA 5IP9H 1E2VA 2JQOA 4LMQD 5LMNL 1Y1VB 2A68D 4I7ZC 2K05A 1II3A 3IL8A 1BOSA 3FHWA 5EKLA 3ND9A 2PW7A 5BR8Q 1SE2A 4LF7L 2F3IA 1CFMA 4A3FH 4OWTB 2K4KA 4AH6A 4A3JH 1DOLA 1UEAB 1HH2P 4K2KA 3H3VI 1K8OA 1SR3A 5C3EG 1GUGA 1QVFA 2I5HA 1S40A 1XPUA 1KAWA 4BY1B 1BQQT 1Q90A 5JPNC 1WTXA 3HOYG 1L1OB 1QVCA 5K36G 1CHQD 3LX0A 4DKAC 2KVMA 3I70A 3P1HA 1OXUA 1YHQA 4K6DA 4A3CH 4JYAQ 3SDZA 2MP1A 1K73C 3TS0A 2IT1A 1VQ7A 2O4XA 1LUZA 5KEEA 3SVMA 2JE6I 4RKLA 1PZKD 3VYUA 3H0GG 4L5SA 5C44B 3GTQB 2LSSA 5IT9c 1DOKA 2PZWA 3S17B 4I7AA 3I72A 2L15A 1QCBD 2AUJD 1PFBA 2EY1A 3BVGA 3A56A 4LNQA 4HSVA 4RGNA 5AJ3Q 1M8AA 1TVXA 4IALA 4GZYC 4Y7NB 1Y8NB 3F1ZA 1ILQA 3DXJC 1EOVA 1VQGA 1TKWB 1JWMD 4FXDA 3SK4A 2ZTCA 2K5DA 4IO9A 2QCPX 5D14A 1B50A 1C9OA 1DM0B 3ERQA 1KDBA 1KNAA 2NN6H 4TSSA 3DEOA 3RLOA 3E0JA 5C3EB 1HZAA 2WFWA 2N3SA 1YHBA 1FYCA 1YI2A 3D6CA 1EQRA 3HOYB 5I6WA 4JOIA 1JT8A 3JAMi 2JEAI 2LXJA 3NTKA 4GLVB 4JI6Q 1V1PA 1OXVA 2VS1A 2EYOA 2R92H 2KUMA 4F88A 1OO9B 2A69C 4P2CB 3K59A 4ZK9B 4LF9L 3OIPA 4BA2I 1VQIA 1I50H 1J9OA 3RLNA 4JBJA 5IGBA 3FKIG 1CI3M 4R8NA 1ENCA 1VQBA 1X9NA 4AYBB 3IFTA 1VQEA 5IYBG 2AWOA 1PH9A 4YY3Q 3E6ZX 3D6WA 4IUPA 2PNRC 1IL8A 1KRTA 1IKMA 3S1RH 2QKIC 4JI7Q 3AEVA 4XTCS 3BZDB 4IPGA 2OTLA 5FJ8G 2XRSD 3CMEA 4PV1C 4KLKA 4RGMA 4GOPC 1HTLD 2F0JA 3ICEA 2B2VA 1KRSA 5JEAH 4DV4L 3SHLA 3ULLA 2SEBD 3S2HH 5H1SE 4MNOA 4K14A 2DY8A 1N32L 3R2IA 1HZ9A 1EZ6A 1LTAD 3F2UA 1QNKA 3BG3A 4IZ8A 4OIKA 1LO5D 3KLRA 2JA6B 2UXBQ 1Q46A 2XGTA 1FR3A 1BO0A 2CWAA 2R7FA 1XMQQ 4RFBA 4GN4B 1A0IA 4X66L 5A2QE 4X6AH 2K03A 5LMUL 1X3QA 3OYYA 4LUOA 1XPOA 5I9OA 4NXML 1G6PA 3RZDH 3TREA 5CORA 3FKIB 4YWLA 1WTOA 2R93B 1HZBA 4O1NA 3NEMA 1C48A 1PTOD 1TWAB 4GNXB 3D0FA 3T53B 1FJGQ 2AQ1B 5I2XA 2MHVA 1HA5A 5LL6S 5E7NA 4K0KQ 2GA4B 1WCMG 5IODA 2NZ1D 1PTOH 2K33A 1DOMA 1KABA 4B3MQ 3EJIA 2TMPA 2EJMA 5M3FG 2PO4A 4RHRA 3GTGB 1QUQA 1KAAA 1VQHA 5M5YB 1GHKA 4POFA 2R6GA 4B3SQ 2E2IB 3E0EA 3HOXG 4V190 4JW0A 5CR3A 3HOVH 1JE5A 2C35B 1X3EA 2KECA 3HG9A 2B2YC 3F8TA 4TQUS 4HTHA 4DV1L 2F0KA 2K75A 5T1GA 5ELEA 3U4ZA 4A3LH 3NSWA 2EPBA 3NTHA 4JI3L 1TS3A 1JOKA 3E9HA 1S4ZA 5JEAJ 1ZYRD 2NVXB 3GTMH 2RSNA 2VUMH 1I4QA 3R8BA 4DXGA 3A8JE 4A3GG 2I0QA 1F2LA 4A3MG 4X65Q 3A54A 3MHBA 5HURA 5ELFA 2PZUA 3PUWA 4IJHA 1CUKA 3I4LA 4YCWA 4OX9L 1B8AA 5GQOA 1KXLA 1GUOA 1KDCA 1F77A 1D1IA 1PFSA 1CZWA 3GP7A 1Q8IA 4DXFA 1W6JA 3DWQA 5CC4A 1A2TA 2IHFA 2FINB 1W3SA 3S1QB 3OWEB 1MD2D 1QG7A 3E9IA 1BCPC 2EJGC 1EYGA 4G57A 4YHHL 4QQBX 4KKUA 5IGGA 3H3VH 2YTXA 3PUVA 4DR4L 4UPAA 1NMGA 3PIO3 1CSPA 2ENBA 5D3IB 3QR8A 5NUCA 1XJVA 1LABA 3CQZH 3GTPB 1STHA 2P5ZX 5KYLA 4N9PA 1SDFA 1UUPA 3GTKB 1NAPA 5M3MG 1TT2A 1TIID 1PV4A 3KLWA 3UDFA 1H9SB 2SOBA 1I4PA 4JCVE 3BVZA 1K8AC 1CHPD 3G71A 2LY7A 1CZGA 4A3MB 2FMCA 2B63H 4NDXA 3T13A 4H13C 4ZRZA 4QUFA 2AMCB 1IZ6A 5E1FA 1L1OA 3IRBA 2CW0D 4CJ0B 2BDNA 5C4JH 5HGQA 1SMYD 1SMXA 5J1ZA 4NKLA 3TBIB 1L0YB 2XWBB 1VCIA 2ZM6L 1Y69U 2A6HD 4DR3Q 4AQYL 3MEFA 1PRTD 5COYA 1BF4A 3PO2G 3BYYB 1JMCA 5JPMC 1VQMA 2ZTEA 2UXDQ 1GUTA 5KRUA 3CPWA 2DJFC 2KQ3A 1O80A 2DY7A 2IX0A 2OT2A 2Q8RE 4HCEA 1MSGA 3QG1A 1STNA 3OPOA 1X6OA 5FLMG 2FMMA 4B9WA 1X3PA 4R4CA 1I4XA 1ASYA 1WVLA 2DN8A 2BE5D 3A7LA 3VR4A 1EIHA 1VQ6A 2CCZA 2K01A 4LF5L 5G3LF 3MWYW 3MTSA 1VMPA 1TWFB 2EZVA 1EYDA 2K1BA 4KD4A 5M9OA 5M3MB 3PMFA 3RN5A 3I4MG 1K8MA 3CXCA 3OWFA 1K8GA 3CMAA 2R7ZG 4UHVA 1BUVT 3PO3G 5F2DA 2HQEA 4K5VA 2K5VA 1TS2A 3Q22A 3K81C 1W6KA 2Z6KA 4RAUC 5FOBB 4BBSH 2AQ2B 1BXTA 3M7NA 1N33Q 4J15A 4M1UB 4AYBE 1IW7D 1G91A 1YNJD 1Y1VH 5C4XB 3VR5A 2WAQE 2F0WA 5CV7A 3ND8A 1YZ6A 1NBWA 4LK1C 2NUCA 3C1FA 4F8MA 2BA0A 1WTQA 2M00A 3FP9A 2EYLA 3CC2A 1Q8KA 4GOPB 5I9PA 4BBRH 1STAA 2A8VA 5JJZA 2F0NA 3CCLA 3K5NA 3L3OC 5KGUA 1EYAA 3OSOA 1G6ZA 2B8FA 1DCZA 3U9OA 1MJCA 1UAPA 2K52A 3DUZA 4DAPA 2MQHA 1CKOA 1CQVA 3TP5A 4DPGA 1AFPA 3UE1A 1MHWC 1MGSA 4PNYA 4BY1H 1Y1WH 3I4MB 5IP7H 1AN8A 3IKJA 4DV4Q 2RDFA 2L1BA 4IPDA 3D3RA 1UE1A 3DM1A 3PO3B 1Q1EA 1LT5D 5A2QL 1AP0A 1M4VA 1DYQA 4FNFA 1B3QA 1U9RA 2KEDA 2QF7A 4ZLTF 5JJKA 4A3KB 1K83B 4XT1B 4GLAC 5IYCH 4OXPA 2V1CC 1I4GA 4HSPA 1G8ZD 3Q0AA 1M1KC 4L6TB 4KN4C 4ZCKA 2KCNA 5IYDG 4X66Q 2K14A 1SYDA 5LMUQ 3ULPA 3H91A 3J7YW 3S17H 1VQAA 2YU9B 3BJUA 4NXMQ 4UDUC 1VQ4A 2QDBA 1SE4A 5CV8A 3SK8A 2D62A 2VB2X 4C3HG 2E2HB 1DZ1A 1CKNB 2L12A 2R7DA 4MN3A 4DK3C 2B3GA 2F0VA 1R4QB 2RDHA 1NSNS 2RHSB 1V1OA 4LF8L 3KDFB 3PIP3 4GNXA 2G9HD 3QB3A 3K7AH 4PMWA 2UXBL 2D2CC 5C3EH 2B2UA 1VDZA 1AE2A 2NYZD 1XMQL 4R8IA 2UXCQ 4CGYB 3E3XA 1MJEA 3HOYH 3S9WA 2JK8A 4ZUIA 3PSIA 2O5IC 5K36H 4KMUC 1PVOA 5FKAC 1IYJB 3S16H 2E75C 4XYQA 1CTMA 3UE0A 2ZXPA 1WJJA 2MFIA 1A3UA 4DV1Q 4LUVA 5EQ0A 3D8GA 4JBWA 4C56C 3L2PA 4HAEA 3H0GH 4JI3Q 1FJGL 4A3EG 3KBGA 4K0KL 2MNAA 4X64Q 4DV7L 4C3IB 4DF7A 2RQXA 2F0LA 4BWGB 4B3ML 2K5QA 1EUJA 1G51A 1ENAA 1BCPB 2RHQB 3WDNA 2CQOA 2BCOA 1K0SA 2HDMA 1C0AA 4C3HB 1F2MA 4OX9Q 1SAPA 2KCTA 1NJIC 5M5XH 2X69A 4RCNA 5IE8A 5ELBA 1FGUA 4K6LA 4RCOA 4B3SL 2RVLA 1EQTA 2NB0A 3GV3A 2IX3A 2L11A 4DUZL 1JJCB 3VYTA 4C2MB 1GUWA 1DONA 1B70B 1TS5A 4YHHQ 3W5OA 1BKBA 3HKZE 2A74C 3ULJA 4DR4Q 3H94A 4K8JA 4JI2L 4PZ8A 2CQAA 3TDQA 2PQEA 3IFDA 1Q3LA 2NVYH 3L7ZC 3KOJA 2WACA 3FKIH 2I5LX 2L0CA 4H44C 3PGZA 1D5XC 1JJ2A 4A3EB 5IYBH 3K8AA 3NE5B 4M8AA 3QO2A 4HJ5A 3GTLH 5EPLA 1H9SA 1SE8A 5C44G 4QMGA 4GN3B 1UE7A 1IBKL 5BN3A 2OQKA 1A63A 1RL2A 3TP6A 2OTJA 4DR7L 3CC7A 4OL7A 1YBYA 3P75A 4IUQA 2QGQA 2WIIB 1SNOA 3R93A 5FJ8H 3OW2A 2ZM6Q 2KJXA 1Y14B 4AQYQ 4O2DA 1GUSA 4P72A 1P16A 5EPKA 3GTGH 4A3BB 2WB1E 3QIAA 1NR2A 5EBCA 4JC0A 3RN2A 2IWHA 3J80E 1QWYA 3M9BA 4MTNA 5E3FA 2EYPA 4JI4L 1MIUA 4X3UA 1SYBA 1B44D 3TRZA 1TWGH 1MSHA 4HIDA 4IOCA 1IL2A 3SK6A 1FD7D 3VA5A 3RLFA 1PH1A 3NELA 1HUNA 2XN9C 3QWNA 3A8KE 4IPHA 4WRDA 2RA4A 2NVXH 4LF5Q 3LGJA 1SYCA 3S14B 1IYVA 2F3WA 1IYUA 1DXMA 5D3DA 1RDPD 1VQPA 4UP7A 5CV6A 1EEID 1V43A 2RBMA 3CKIB 3DWAA 4WFN3 4DR3L 1P8LA 3Q6SA 1S5FD 4KI0A 1HNZQ 1EFID 2ZJQA 4Z9CB 4DV5L 1EU4A 4AYBG 4DAVA 2BA1A 2UXDL 3FPUB 3CW2C 4U673 3CU7A 4A4IA 2JSOA 1WCMH 4HJAA 5JVG3 3KUPA 4DK1A 3S1QH 4J8QA 1SBBB 3C46A 3S1NB 2A73B 2J0TD 2M2LA 3KJOA 5M3FH 5CBAE 3D4DA 1PH8A 1PH4A 1WTVA 4HMIA 2DGYA 1B9MA 2QDLA 3HOXH 3VR6A 3BYTB 3JAMc 1CK1A 3NBHA 4EQPA 4GOPA 1H9MA 1STEA 4LFAQ 1HJPA 4UP8A 1SNDA 1PDQA 4JVZA 4KJNA 2IHEA 3HOWG 2JA6G 1EY5A 2E74C 3OW7A 4HCSA 1BR9A 1N33L 4RG1A 4YWKA 1EEFD 4A3GH 3TZUA 4A3MH 1GO3E 2F0PA 3J81E 3DMUA 5CMDA 5E4WC 4X62L 5C0XI 2NVQB 1KLUD 2RCFA 4XXEA 2F0HA 5FLXE 4N8X1 4ODGA 2R93G 1SRUA 2E2JB 1UE6A 4RMFA 2WAQB 1Z7TA 5J3BA 3Q24A 3T16A 3I4NG 4HIOA 1W2BA 2UUBL 4FXKC 1SFOB 2Q8IB 1PMRA 1O7IA 5I2YA 4IJLA 1AW7A 2HQLA 1OTCA 1L0WA 1TWHB 2EE1A 5CV9A 3M7GA 4P75A 3M4OB 1F9RA 1A3TA 2MPMA 3S1MB 1MI2A 1GHJA 2A69D 3Q23A 1E1TA 2UUCL 3GTOB 1ZXTA 1J6QA 1TS4A 1VQJA 3FEWX 4C3JG 3EROA 4O0AA 1PH7A 1I3QB 4DV3Q 4V0BA 4C1NI 1CKNA 4LF8Q 2PW5A 1Z9FA 3CPFA 2D0OA 3HOWB 2AQ3B 1O78A 3TP8A 1AH9A 5CV5A 3KDFA 3KF8B 1ZKOA 3W1GA 1KLGD 3N6RA 1EY7A 2B2YA 1PYBA 5CGKA 1FL0A 3GTJB 1MKHA 5GROA 1ML0D 1PTOC 2H5XA 3MFGA 4DFAA 1LTRD 1HNWQ 2HUGA 1E3PA 5C3XA 1K3BC 4QCLA 3R2TA 2WKCA 5KNDA 1XPRA 2X6GA 5M5WB 1I6HB 1I6VC 3NWSA 4B08A 5DNFA 1S5DD 4BA1I 4HEDA 3I4NB 2GVBA 3PO2H 2ZXRA 1V9PA 3A8IE 2FFKB 3MFYA 1C8CA 1LLRD 2A1AA 3HZXA 4DU9A 1KDAA 4DV7Q 1PFMA 4LF6L 3KF6B 3GD7A 5FLMH 1A3VA 5ELOA 2UXCL 2PYKA 1EY6A 4FXGC 4R4IA 1LT4D 4NP5A 2NWGA 4ABNA 1Q12A 2YV5A 4C3JB 1XNRL 2EDGA 3OOCA 4LJZC 2L4NA 3I4MH 3HKZG 3CCJA 4LF4L 3AMUA 4IOAA 2R7ZH 4KHPQ 4DUZQ 3HRZC 4XQJA 3TN2A 1HPCA 3PO3H 1N9WA 1SNCA 3N52A 4PMBA 1A15A 1HA6A 1QJOA 3DEPA 1EOTA 3A0JA 3P7JA 2I07B 4JG2A 4A3FB 1B1ZA 4X64L 4HMJA 2CWPA 3CAMA 1PH3A 2ASBA 2NVTH 4A3JB 1XMOL 4JI2Q 1TWCH 1QVGA 3MXPA 1GKHA 4OEMB 1EYCA 3K0XA 3H3VC 3FMCA 2KOLA 5LHY1 4JI0L 2F0SA 1YITA 4QJFA 3F2DA 4MTKA 1SYEA 1U5KA 1VQKA 4EX5A 3UDGA 4H0LC 3DHQA 2JA8G 3TQYA 2E2HH 3P20A 1RF2D 2C5CA 4QB4A 1HNXL 1IBKQ 1HQRD 3D4WA 1F9QA 1KQSA 1EWIA 3S2DH 1NR4A 4DR7Q 4A76A 4A93G 4R4TA 3S15B 2OEOA 1NE3A 1KD1C
chains in the Genus database with same CATH topology
3HOZG 5HY6A 5IP7H 1V1QA 4A93H 1N8RC 4GLXA 4R1JA 5IY0A 1VQ9A 4LWCA 3ZJYC 2Z0SA 4DV4Q 3HOZH 4IFDJ 4IPDA 2JEBI 2ZJPA 1UE1A 4DR6L 2F52A 3G48A 1Q1EA 4DV6L 1NTGA 5IYCG 1Q81C 2N49A 3TS2A 1TWFH 2I5MX 1M90C 1EFWA 2D0PA 2PI2E 5IP9G 4DR1Q 5JJKA 4JI4Q 5M3MH 4GLAC 3EIVA 5IYCH 3T1HQ 2UUAQ 1X56A 4OXPA 1PH5A 2V1CC 1XTDA 1M1KC 4JBKA 5IP9H 2JQOA 5LMNL 1KIXA 4HJ7A 1IBLL 3PIPA 5IYDG 4X66Q 2K14A 5LMUQ 3ULPA 1HZCA 3S17H 1VQAA 5GAHC 1OXSC 3BJUA 3FHWA 4PG3A 4NXMQ 4Y52H 1VQ4A 4UP9A 3CCEA 5BR8Q 5JJLA 3M85A 3K7UC 4NPSA 4DK6C 4A3FG 4LF7L 2XTIA 4A3JG 2F3IA 2AHOB 2D62A 2YTVA 2ZJRA 4DR2Q 4AQYQ 1PH6A 1VQOA 4JOIC 4A3FH 4OWWB 3RZOH 5C4XG 1IXRA 5GADC 1CKNB 2R7DA 4OWTB 2K4KA 4AH6A 2VZAA 4A3JH 2E8GA 3L0OA 4OO1I 4B3TL 4DK3C 1HH2P 1SROA 2B3GA 4C3HH 1IBML 5C4XH 4DV5Q 3CD6A 3H3VI 4P73A 2RHSB 1SR3A 4LF8L 5C3EG 3KDFB 2QEXA 3J81j 4GNXA 4FDBA 2Y0SE 4GKJQ 1QVFA 3T1YQ 2I5HA 1S40A 3D31A 1XPUA 3K7AH 1KAWA 1X54A 4PMWA 1PH2A 4JBMA 4A3DG 5C3EH 4JV5L 2UXBL 1BVSA 1GM5A 3HOYG 1DGSA 1XNQL 1L1OB 1AE2A 1QVCA 2VW9A 1PHJA 4C2MH 1XMQL 3CCSA 2BH2A 5K36G 4DKAC 2IY5B 2UXCQ 2NZOA 4TVAB 1MJEA 2HHHL 3HOYH 4A3CG 2JK8A 3PSIA 1Q82C 1PVOA 1E22A 1OXUA 3CF5A 5ELNA 1YHQA 1N34Q 1LYLA 1NMFA 1YIJA 4A3CH 2HIVA 3HFZB 4JYAQ 1K73C 4LFCL 1IYJB 1Q7YC 4LFBL 1KL9A 3S16H 3TS0A 4L5RC 2IT1A 4YWMA 1VQ7A 1YJ9A 4KHZA 3UE0A 1LUZA 1WJJA 3S24A 2MFIA 2JE6I 1VQCA 1KC8C 4DV1Q 3H0GG 4L5SA 4LUVA 4QIWE 4JBWA 3CCUA 2EXDA 2LSSA 3ER0A 3L2PA 1HNZL 1EIYB 5IT9c 3H0GH 4JI3Q 1FJGL 3I4OA 4QL5A 4A3EG 2L15A 2OCEA 5IWAQ 3BZCA 4POGA 4JI1L 1B7YB 1PA6A 4K0KL 3AYHB 2MNAA 4LNQA 4A3KG 5AJ3Q 4X64Q 4A3EH 2B29A 2VQEL 4DV7L 1JJGA 4B3RL 1YNXA 3I56A 1OXXK 3F1ZA 1WFQA 4A3KH 4GKKQ 1K83H 1EOVA 1VQGA 4B3ML 1EUJA 1G51A 4DNIA 2RHQB 2FXQA 2CQOA 2KCMA 2HT1A 2NN6G 1C0AA 2ZTCA 4IO9A 4OX9Q 4X62Q 2KCTA 1NJIC 1C9OA 5M5XH 4OWXB 5IE8A 1FGUA 4B3SL 1NY4A 1VS0A 3KJPA 4DR5Q 1I94L 2YU9H 4IFDI 3RLOA 4NXNL 2KHIA 1HZAA 3NBHB 1VQ8A 2WFWA 4DUZL 1JJCB 2N3SA 1YHBA 4H02A 5DLQE 1WOCA 4ME3A 3H15A 4DV0L 1YI2A 2UU9Q 1EQRA 3PUXA 3CC4A 2UUBQ 2VL6A 2PQAB 4LFAL 1B70B 4YHHQ 4JOIA 3W5OA 1JT8A 1BKBA 3JAMi 2JEAI 1GVPA 2LXJA 3HKZE 2R92G 2QA4A 4UY8C 4GLVB 1VQFA 4JI6Q 3ULJA 5LMNW 1EIFA 4DR4Q 4YCUA 3SGIA 1OXVA 2VS1A 3AFPA 2R92H 2WB1G 4JI2L 1YJNA 2K5NA 4DV2L 2MO1A 4PZ8A 4LF9L 4BA2I 2VNUD 1VQIA 2K50A 1I50H 3RLNA 4JBJA 1RIPA 3FKIG 2UUCQ 1I5FA 4NB3A 4DR6Q 2NVYH 3L7ZC 1VQBA 1X9NA 1E24A 3KOJA 1VQEA 5IYBG 1BBWA 2AWOA 3FKIH 2I5LX 3I7FA 3ERSX 1PH9A 4YY3Q 3S14H 1VQDA 3PGZA 4XIGS 1WI5A 1JJ2A 4OONA 5IYBH 3K8AA 1KRTA 4HJ5A 3GTLH 4IPCA 5LMNQ 3S1RH 1SE8A 5C44G 4JI7Q 4GN3B 2AWNA 3AEVA 1UE7A 3KYHC 4XTCS 1IBKL 2OQKA 5C44H 1GD7A 4IPGA 2OTLA 3GTQH 1A63A 1RL2A 2OTJA 5FJ8G 1D8LA 4DR7L 1X3GA 3CC7A 3CMEA 1YBYA 5JEAG 4LF7Q 2QGQA 5C0XJ 4KLKA 4GOPC 5IYDH 5FJ8H 2PI2A 3OW2A 3ICEA 2ZM6Q 1KRSA 1Y14B 4L5TA 3Q8DA 4C3IH 4Y7NH 4O2DA 4DV4L 3RR5A 3CCVA 4P72A 3ULLA 1E7ZA 1P16A 1ASZA 4B3TQ 3GTGH 5H1SE 3J80c 2WB1E 3S2HH 4MNOA 1IBMQ 4A3DH 3RNUA 1N32L 4JC0A 1HZ9A 2YTYA 1S3OA 3RN2A 3M9BA 4MTNA 1X55A 4DV3L 4DR1L 2UXBQ 4JI4L 4L5QA 1MIUA 1Q46A 2XGTA 3T1HL 2UUAL 2JA5G 1XNQQ 2CWAA 2R7FA 3TRZA 1TWGH 3BZKA 4HIDA 3J80i 4IOCA 1XMQQ 3STBC 3G6EA 4GN4B 1IL2A 1HR0L 1A0IA 1X65A 4YCVA 2HHHQ 4LF6Q 3A5ZB 2RCNA 3RLFA 4X66L 3NELA 5LMUL 1PH1A 2JA5H 4A3IG 4X6AH 3AQQA 4JI8Q 3F2CA 3OYYA 4IPHA 4LUOA 1XPOA 2NVXH 4LF5Q 4NXML 1G6PA 4A3IH 3RZDH 3KF6A 1PYSB 3LGJA 3TREA 4YWLA 5BR8L 2LXKA 3KFUA 2CFMA 1VQPA 4UP7A 1K0RA 1HNWL 1HZBA 1V43A 3NEMA 1XNRQ 1UE5A 1CSQA 4HIKA 4DR3L 1P8LA 4KI0A 1HNZQ 4LF4Q 2F4VL 4GNXB 1T9HA 3D0FA 1VQNA 2ZJQA 1FJGQ 4DV5L 5C0XG 1Z47A 4AYBG 2NVQH 1OXTA 2BA1A 2ATWA 5E7NA 4GKJL 3T1YL 4K0KQ 2UXDL 2N8NA 1WCMG 3CW2C 4JI5L 1Q1BA 2VQEQ 2ZTDA 1CKMA 4A4IA 4DUYL 1WCMH 4HJAA 3U58A 1VQ5A 4B3MQ 3S1QH 4LUZA 5M3FG 1XMOQ 2GN5A 3M4QA 3BU2A 1QUQA 3J7ZC 1VQHA 2ALYB 1N34L 5GAGC 4POFA 3KJOA 3CCQA 2R6GA 3OTOQ 5M3FH 1Q86C 1PH8A 2VQFL 1PH4A 3HOVG 3AFQA 4JYAL 4B3SQ 3E0EA 3HOXG 4JI0Q 4APVA 2KBNA 2DGYA 3PUYA 4BY7G 1N36L 3HOVH 1JE5A 2C35B 1X3EA 4QGUA 4A3LG 3F8TA 4TQUS 3HOXH 4DV1L 2K5HA 3J7A5 2AKWB 4BY7H 2K75A 1L1OC 3JAMc 4DV0Q 3GTOH 1UEBA 3U4ZA 4BXXG 4GOPA 4A3BG 4KHPL 4A3LH 2VUMG 4LFAQ 4JI3L 1HJPA 4UP8A 5EAYA 5IWAL 3E9HA 1SN8A 2VY3A 3PCOB 5JEAJ 4ALPA 4BXXH 4A3BH 3GTMH 5GAEC 2VUMH 1HNXQ 2IHEA 3HOWG 2JA6G 5AJ3L 1J5EL 4A3GG 1R9TH 2I0QA 4GN5A 4R4OA 4QY7A 4A3MG 4X65Q 3HOUG 4LF9Q 2JA6H 1N33L 1AE3A 4RG1A 4YWKA 4A3GH 2E5LL 3PUWA 4IJHA 4A3MH 2OWOA 1CUKA 1GO3E 3DM3A 3HOUH 3CCMA 4YCWA 4OX9L 1B8AA 1YEZA 5GQOA 4X62L 5C0XI 5FLXc 1KXLA 1LM0A 3G4SA 2JA7G 2EQSA 1PFSA 4DV6Q 4PZ7A 2Q2HA 2RF4A 2JA7H 1VQLA 2R93G 1SLJA 1SRUA 2BH8A 3A74A 1UE6A 2IHFA 4RMFA 5J3BA 1W3SA 3I4NG 3M4PA 4HIOA 2UU9L 1I6HH 2R93H 4R4QA 5M5WH 2CKZB 3EN2A 1W2BA 2UUBL 2NZHA 1TWAH 1UWVA 3E9IA 1EYGA 1IBLQ 3I4NH 4YHHL 1Y1WG 4QQBX 1O7IA 3H3VH 4JI6L 2YTXA 2NN6I 3PUVA 3VDYA 4DR4L 4WJ4A 4UPAA 1NMGA 1HR0W 4IJLA 1CSPA 1L2FA 2HQLA 1XJVA 1OTCA 1L0WA 3CQZH 4P75A 3PF4A 2Z6KC 2DUDA 1YVCA 2Y0SG 2UUCL 4HIMA 1E1TA 1J6QA 3CCRA 1VQJA 5M3MG 1N32Q 3WWVA 4O0AA 1K3RA 3S1NH 1PV4A 1PH7A 3KLWA 4YY3L 3UDFA 5M5YH 4DV3Q 2JJQA 4JCVE 4WJ3M 1K8AC 2HIXA 1CKNA 4C3JH 3M3YH 4LF8Q 2Q2UA 2A19A 3G71A 1X3FA 1Z9FA 2E2IH 3CPFA 1FVIA 3JC66 2D0OA 2B63G 1HR0Q 2WP8J 3MXNB 1AH9A 4JV5Q 4JI7L 4PZ6A 3KDFA 3KF8B 1KD1C 3GDEA 3W1GA 2B63H 1PYBA 2ID0A 4MZ9A 2AMCB 1IZ6A 1FL0A 1L1OA 3IRBA 1MKHA 5GROA 4HJ8A 5C4JH 2H5XA 1YJWA 5HGQA 1HNWQ 1SMXA 1A8VA 1VCIA 5JJIA 4LFCQ 2ZM6L 1E3PA 4LFBQ 3A5UA 4DR3Q 4AQYL 2EIFA 3MEFA 4P74A 2F4VQ 2N78A 1BBUA 1XPRA 3B6YA 4HJ9A 3PO2G 4DR2L 4A75A 1EQQA 1A62A 2PNHA 4BA1I 1JMCA 4AIMA 1VQMA 2GVBA 2ZTEA 2UXDQ 3PO2H 3GO5A 3CPWA 4JI5Q 1V9PA 3PV0A 1KHIA 4IFDG 2IX0A 3UDXA 4JI1Q 2A1AA 4DUYQ 1X6OA 5FLMG 3PUZA 3U50C 2WAQG 4R4CA 4DV7Q 4LF6L 1ASYA 4B3RQ 3KF6B 3GD7A 2E2JH 3STBD 5FLMH 4JI8L 3PF5A 1TXYA 3I2ZA 1VQ6A 4GS3A 2CCZA 1QZGA 5ELOA 2UXCL 4LF5L 1C7YA 2ES2A 2VQFQ 1S72A 4R4IA 1SFOH 3TEHB 4EQ5A 1E1OA 1N36Q 3RN5A 3I4MG 1Q12A 2YV5A 4LW1A 1K9MC 3CXCA 2R7ZG 1K8GA 3CMAA 3S15H 1XNRL 1I94Q 3I4MH 3HKZG 1WYDA 4DAYB 3CCJA 4LF4L 4NXNQ 4IOAA 1TWHH 2R7ZH 4KHPQ 3PO3G 4BBSG 3M4OH 4DUZQ 3GTPH 2K5VA 3K81C 1JB7A 3EBEA 2Z6KA 3UDIA 3I55A 3S1MH 3GTKH 3PO3H 1N9WA 2IX1A 4BBSH 2Q2TA 1J5EQ 4P71A 1I3QH 2JA9A 1QUQB 3M7NA 3A0JA 4J15A 1N33Q 2PMZE 1Y1VG 2PQAA 4JG2A 2E5LQ 4X64L 2CWPA 3CAMA 1PH3A 4AYBE 2ASBA 2NVTH 1YHAA 2MO0A 4JI2Q 1XMOL 1TWCH 1QVGA 3HOWH 4DV2Q 1Y1VH 3J81c 4GKKL 1GKHA 2WAQE 4GNXC 3K0XA 1YZ6A 3OTOL 1NBWA 4BBRG 2OQ0A 1LTLA 2BA0A 2KHJA 4JI0L 3DLLA 3PIOA 3FP9A 1U0LA 3CC2A 1YITA 1Q8KA 3CP0A 4QJFA 3GTJH 3F2DA 4GOPB 1U5KA 4BBRH 2A8VA 1VQKA 3CCLA 4EX5A 3J81i 4DR5L 3UDGA 1QZHA 2Q2IA 2YYZA 2JA8G 3TQYA 4DAMA 2E2HH 3F2BA 1MJCA 3K80C 3W1BA 1D7QA 2K52A 2JA8H 4OO1G 1HNXL 1IBKQ 2MQHA 1CKOA 1G291 4BY1G 1KQSA 1H95A 4DPGA 2GVAA 3UE1A 1EWIA 5IP7G 4X65L 3U4VA 3S2DH 4DR7Q 4A76A 2KENA 4A93G 3NENA 4R4TA 4BY1H 3HKSA 1NE3A 1Y1WH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ G;  5HY6 A;  5IP7 H;  1V1Q A;  4A93 H;  1N8R C;  4GLX A;  4R1J A;  5IY0 A;  1VQ9 A;  4LWC A;  3ZJY C;  2Z0S A;  4DV4 Q;  3HOZ H;  4IFD J;  4IPD A;  2JEB I;  2ZJP A;  1UE1 A;  4DR6 L;  2F52 A;  3G48 A;  1Q1E A;  4DV6 L;  1NTG A;  5IYC G;  1Q81 C;  2N49 A;  3TS2 A;  1TWF H;  2I5M X;  1M90 C;  1EFW A;  2D0P A;  2PI2 E;  5IP9 G;  4DR1 Q;  5JJK A;  4JI4 Q;  5M3M H;  4GLA C;  3EIV A;  5IYC H;  3T1H Q;  2UUA Q;  1X56 A;  4OXP A;  1PH5 A;  2V1C C;  1XTD A;  1M1K C;  4JBK A;  5IP9 H;  2JQO A;  5LMN L;  1KIX A;  4HJ7 A;  1IBL L;  3PIP A;  5IYD G;  4X66 Q;  2K14 A;  5LMU Q;  3ULP A;  1HZC A;  3S17 H;  1VQA A;  5GAH C;  1OXS C;  3BJU A;  3FHW A;  4PG3 A;  4NXM Q;  4Y52 H;  1VQ4 A;  4UP9 A;  3CCE A;  5BR8 Q;  5JJL A;  3M85 A;  3K7U C;  4NPS A;  4DK6 C;  4A3F G;  4LF7 L;  2XTI A;  4A3J G;  2F3I A;  2AHO B;  2D62 A;  2YTV A;  2ZJR A;  4DR2 Q;  4AQY Q;  1PH6 A;  1VQO A;  4JOI C;  4A3F H;  4OWW B;  3RZO H;  5C4X G;  1IXR A;  5GAD C;  1CKN B;  2R7D A;  4OWT B;  2K4K A;  4AH6 A;  2VZA A;  4A3J H;  2E8G A;  3L0O A;  4OO1 I;  4B3T L;  4DK3 C;  1HH2 P;  1SRO A;  2B3G A;  4C3H H;  1IBM L;  5C4X H;  4DV5 Q;  3CD6 A;  3H3V I;  4P73 A;  2RHS B;  1SR3 A;  4LF8 L;  5C3E G;  3KDF B;  2QEX A;  3J81 j;  4GNX A;  4FDB A;  2Y0S E;  4GKJ Q;  1QVF A;  3T1Y Q;  2I5H A;  1S40 A;  3D31 A;  1XPU A;  3K7A H;  1KAW A;  1X54 A;  4PMW A;  1PH2 A;  4JBM A;  4A3D G;  5C3E H;  4JV5 L;  2UXB L;  1BVS A;  1GM5 A;  3HOY G;  1DGS A;  1XNQ L;  1L1O B;  1AE2 A;  1QVC A;  2VW9 A;  1PHJ A;  4C2M H;  1XMQ L;  3CCS A;  2BH2 A;  5K36 G;  4DKA C;  2IY5 B;  2UXC Q;  2NZO A;  4TVA B;  1MJE A;  2HHH L;  3HOY H;  4A3C G;  2JK8 A;  3PSI A;  1Q82 C;  1PVO A;  1E22 A;  1OXU A;  3CF5 A;  5ELN A;  1YHQ A;  1N34 Q;  1LYL A;  1NMF A;  1YIJ A;  4A3C H;  2HIV A;  3HFZ B;  4JYA Q;  1K73 C;  4LFC L;  1IYJ B;  1Q7Y C;  4LFB L;  1KL9 A;  3S16 H;  3TS0 A;  4L5R C;  2IT1 A;  4YWM A;  1VQ7 A;  1YJ9 A;  4KHZ A;  3UE0 A;  1LUZ A;  1WJJ A;  3S24 A;  2MFI A;  2JE6 I;  1VQC A;  1KC8 C;  4DV1 Q;  3H0G G;  4L5S A;  4LUV A;  4QIW E;  4JBW A;  3CCU A;  2EXD A;  2LSS A;  3ER0 A;  3L2P A;  1HNZ L;  1EIY B;  5IT9 c;  3H0G H;  4JI3 Q;  1FJG L;  3I4O A;  4QL5 A;  4A3E G;  2L15 A;  2OCE A;  5IWA Q;  3BZC A;  4POG A;  4JI1 L;  1B7Y B;  1PA6 A;  4K0K L;  3AYH B;  2MNA A;  4LNQ A;  4A3K G;  5AJ3 Q;  4X64 Q;  4A3E H;  2B29 A;  2VQE L;  4DV7 L;  1JJG A;  4B3R L;  1YNX A;  3I56 A;  1OXX K;  3F1Z A;  1WFQ A;  4A3K H;  4GKK Q;  1K83 H;  1EOV A;  1VQG A;  4B3M L;  1EUJ A;  1G51 A;  4DNI A;  2RHQ B;  2FXQ A;  2CQO A;  2KCM A;  2HT1 A;  2NN6 G;  1C0A A;  2ZTC A;  4IO9 A;  4OX9 Q;  4X62 Q;  2KCT A;  1NJI C;  1C9O A;  5M5X H;  4OWX B;  5IE8 A;  1FGU A;  4B3S L;  1NY4 A;  1VS0 A;  3KJP A;  4DR5 Q;  1I94 L;  2YU9 H;  4IFD I;  3RLO A;  4NXN L;  2KHI A;  1HZA A;  3NBH B;  1VQ8 A;  2WFW A;  4DUZ L;  1JJC B;  2N3S A;  1YHB A;  4H02 A;  5DLQ E;  1WOC A;  4ME3 A;  3H15 A;  4DV0 L;  1YI2 A;  2UU9 Q;  1EQR A;  3PUX A;  3CC4 A;  2UUB Q;  2VL6 A;  2PQA B;  4LFA L;  1B70 B;  4YHH Q;  4JOI A;  3W5O A;  1JT8 A;  1BKB A;  3JAM i;  2JEA I;  1GVP A;  2LXJ A;  3HKZ E;  2R92 G;  2QA4 A;  4UY8 C;  4GLV B;  1VQF A;  4JI6 Q;  3ULJ A;  5LMN W;  1EIF A;  4DR4 Q;  4YCU A;  3SGI A;  1OXV A;  2VS1 A;  3AFP A;  2R92 H;  2WB1 G;  4JI2 L;  1YJN A;  2K5N A;  4DV2 L;  2MO1 A;  4PZ8 A;  4LF9 L;  4BA2 I;  2VNU D;  1VQI A;  2K50 A;  1I50 H;  3RLN A;  4JBJ A;  1RIP A;  3FKI G;  2UUC Q;  1I5F A;  4NB3 A;  4DR6 Q;  2NVY H;  3L7Z C;  1VQB A;  1X9N A;  1E24 A;  3KOJ A;  1VQE A;  5IYB G;  1BBW A;  2AWO A;  3FKI H;  2I5L X;  3I7F A;  3ERS X;  1PH9 A;  4YY3 Q;  3S14 H;  1VQD A;  3PGZ A;  4XIG S;  1WI5 A;  1JJ2 A;  4OON A;  5IYB H;  3K8A A;  1KRT A;  4HJ5 A;  3GTL H;  4IPC A;  5LMN Q;  3S1R H;  1SE8 A;  5C44 G;  4JI7 Q;  4GN3 B;  2AWN A;  3AEV A;  1UE7 A;  3KYH C;  4XTC S;  1IBK L;  2OQK A;  5C44 H;  1GD7 A;  4IPG A;  2OTL A;  3GTQ H;  1A63 A;  1RL2 A;  2OTJ A;  5FJ8 G;  1D8L A;  4DR7 L;  1X3G A;  3CC7 A;  3CME A;  1YBY A;  5JEA G;  4LF7 Q;  2QGQ A;  5C0X J;  4KLK A;  4GOP C;  5IYD H;  5FJ8 H;  2PI2 A;  3OW2 A;  3ICE A;  2ZM6 Q;  1KRS A;  1Y14 B;  4L5T A;  3Q8D A;  4C3I H;  4Y7N H;  4O2D A;  4DV4 L;  3RR5 A;  3CCV A;  4P72 A;  3ULL A;  1E7Z A;  1P16 A;  1ASZ A;  4B3T Q;  3GTG H;  5H1S E;  3J80 c;  2WB1 E;  3S2H H;  4MNO A;  1IBM Q;  4A3D H;  3RNU A;  1N32 L;  4JC0 A;  1HZ9 A;  2YTY A;  1S3O A;  3RN2 A;  3M9B A;  4MTN A;  1X55 A;  4DV3 L;  4DR1 L;  2UXB Q;  4JI4 L;  4L5Q A;  1MIU A;  1Q46 A;  2XGT A;  3T1H L;  2UUA L;  2JA5 G;  1XNQ Q;  2CWA A;  2R7F A;  3TRZ A;  1TWG H;  3BZK A;  4HID A;  3J80 i;  4IOC A;  1XMQ Q;  3STB C;  3G6E A;  4GN4 B;  1IL2 A;  1HR0 L;  1A0I A;  1X65 A;  4YCV A;  2HHH Q;  4LF6 Q;  3A5Z B;  2RCN A;  3RLF A;  4X66 L;  3NEL A;  5LMU L;  1PH1 A;  2JA5 H;  4A3I G;  4X6A H;  3AQQ A;  4JI8 Q;  3F2C A;  3OYY A;  4IPH A;  4LUO A;  1XPO A;  2NVX H;  4LF5 Q;  4NXM L;  1G6P A;  4A3I H;  3RZD H;  3KF6 A;  1PYS B;  3LGJ A;  3TRE A;  4YWL A;  5BR8 L;  2LXK A;  3KFU A;  2CFM A;  1VQP A;  4UP7 A;  1K0R A;  1HNW L;  1HZB A;  1V43 A;  3NEM A;  1XNR Q;  1UE5 A;  1CSQ A;  4HIK A;  4DR3 L;  1P8L A;  4KI0 A;  1HNZ Q;  4LF4 Q;  2F4V L;  4GNX B;  1T9H A;  3D0F A;  1VQN A;  2ZJQ A;  1FJG Q;  4DV5 L;  5C0X G;  1Z47 A;  4AYB G;  2NVQ H;  1OXT A;  2BA1 A;  2ATW A;  5E7N A;  4GKJ L;  3T1Y L;  4K0K Q;  2UXD L;  2N8N A;  1WCM G;  3CW2 C;  4JI5 L;  1Q1B A;  2VQE Q;  2ZTD A;  1CKM A;  4A4I A;  4DUY L;  1WCM H;  4HJA A;  3U58 A;  1VQ5 A;  4B3M Q;  3S1Q H;  4LUZ A;  5M3F G;  1XMO Q;  2GN5 A;  3M4Q A;  3BU2 A;  1QUQ A;  3J7Z C;  1VQH A;  2ALY B;  1N34 L;  5GAG C;  4POF A;  3KJO A;  3CCQ A;  2R6G A;  3OTO Q;  5M3F H;  1Q86 C;  1PH8 A;  2VQF L;  1PH4 A;  3HOV G;  3AFQ A;  4JYA L;  4B3S Q;  3E0E A;  3HOX G;  4JI0 Q;  4APV A;  2KBN A;  2DGY A;  3PUY A;  4BY7 G;  1N36 L;  3HOV H;  1JE5 A;  2C35 B;  1X3E A;  4QGU A;  4A3L G;  3F8T A;  4TQU S;  3HOX H;  4DV1 L;  2K5H A;  3J7A 5;  2AKW B;  4BY7 H;  2K75 A;  1L1O C;  3JAM c;  4DV0 Q;  3GTO H;  1UEB A;  3U4Z A;  4BXX G;  4GOP A;  4A3B G;  4KHP L;  4A3L H;  2VUM G;  4LFA Q;  4JI3 L;  1HJP A;  4UP8 A;  5EAY A;  5IWA L;  3E9H A;  1SN8 A;  2VY3 A;  3PCO B;  5JEA J;  4ALP A;  4BXX H;  4A3B H;  3GTM H;  5GAE C;  2VUM H;  1HNX Q;  2IHE A;  3HOW G;  2JA6 G;  5AJ3 L;  1J5E L;  4A3G G;  1R9T H;  2I0Q A;  4GN5 A;  4R4O A;  4QY7 A;  4A3M G;  4X65 Q;  3HOU G;  4LF9 Q;  2JA6 H;  1N33 L;  1AE3 A;  4RG1 A;  4YWK A;  4A3G H;  2E5L L;  3PUW A;  4IJH A;  4A3M H;  2OWO A;  1CUK A;  1GO3 E;  3DM3 A;  3HOU H;  3CCM A;  4YCW A;  4OX9 L;  1B8A A;  1YEZ A;  5GQO A;  4X62 L;  5C0X I;  5FLX c;  1KXL A;  1LM0 A;  3G4S A;  2JA7 G;  2EQS A;  1PFS A;  4DV6 Q;  4PZ7 A;  2Q2H A;  2RF4 A;  2JA7 H;  1VQL A;  2R93 G;  1SLJ A;  1SRU A;  2BH8 A;  3A74 A;  1UE6 A;  2IHF A;  4RMF A;  5J3B A;  1W3S A;  3I4N G;  3M4P A;  4HIO A;  2UU9 L;  1I6H H;  2R93 H;  4R4Q A;  5M5W H;  2CKZ B;  3EN2 A;  1W2B A;  2UUB L;  2NZH A;  1TWA H;  1UWV A;  3E9I A;  1EYG A;  1IBL Q;  3I4N H;  4YHH L;  1Y1W G;  4QQB X;  1O7I A;  3H3V H;  4JI6 L;  2YTX A;  2NN6 I;  3PUV A;  3VDY A;  4DR4 L;  4WJ4 A;  4UPA A;  1NMG A;  1HR0 W;  4IJL A;  1CSP A;  1L2F A;  2HQL A;  1XJV A;  1OTC A;  1L0W A;  3CQZ H;  4P75 A;  3PF4 A;  2Z6K C;  2DUD A;  1YVC A;  2Y0S G;  2UUC L;  4HIM A;  1E1T A;  1J6Q A;  3CCR A;  1VQJ A;  5M3M G;  1N32 Q;  3WWV A;  4O0A A;  1K3R A;  3S1N H;  1PV4 A;  1PH7 A;  3KLW A;  4YY3 L;  3UDF A;  5M5Y H;  4DV3 Q;  2JJQ A;  4JCV E;  4WJ3 M;  1K8A C;  2HIX A;  1CKN A;  4C3J H;  3M3Y H;  4LF8 Q;  2Q2U A;  2A19 A;  3G71 A;  1X3F A;  1Z9F A;  2E2I H;  3CPF A;  1FVI A;  3JC6 6;  2D0O A;  2B63 G;  1HR0 Q;  2WP8 J;  3MXN B;  1AH9 A;  4JV5 Q;  4JI7 L;  4PZ6 A;  3KDF A;  3KF8 B;  1KD1 C;  3GDE A;  3W1G A;  2B63 H;  1PYB A;  2ID0 A;  4MZ9 A;  2AMC B;  1IZ6 A;  1FL0 A;  1L1O A;  3IRB A;  1MKH A;  5GRO A;  4HJ8 A;  5C4J H;  2H5X A;  1YJW A;  5HGQ A;  1HNW Q;  1SMX A;  1A8V A;  1VCI A;  5JJI A;  4LFC Q;  2ZM6 L;  1E3P A;  4LFB Q;  3A5U A;  4DR3 Q;  4AQY L;  2EIF A;  3MEF A;  4P74 A;  2F4V Q;  2N78 A;  1BBU A;  1XPR A;  3B6Y A;  4HJ9 A;  3PO2 G;  4DR2 L;  4A75 A;  1EQQ A;  1A62 A;  2PNH A;  4BA1 I;  1JMC A;  4AIM A;  1VQM A;  2GVB A;  2ZTE A;  2UXD Q;  3PO2 H;  3GO5 A;  3CPW A;  4JI5 Q;  1V9P A;  3PV0 A;  1KHI A;  4IFD G;  2IX0 A;  3UDX A;  4JI1 Q;  2A1A A;  4DUY Q;  1X6O A;  5FLM G;  3PUZ A;  3U50 C;  2WAQ G;  4R4C A;  4DV7 Q;  4LF6 L;  1ASY A;  4B3R Q;  3KF6 B;  3GD7 A;  2E2J H;  3STB D;  5FLM H;  4JI8 L;  3PF5 A;  1TXY A;  3I2Z A;  1VQ6 A;  4GS3 A;  2CCZ A;  1QZG A;  5ELO A;  2UXC L;  4LF5 L;  1C7Y A;  2ES2 A;  2VQF Q;  1S72 A;  4R4I A;  1SFO H;  3TEH B;  4EQ5 A;  1E1O A;  1N36 Q;  3RN5 A;  3I4M G;  1Q12 A;  2YV5 A;  4LW1 A;  1K9M C;  3CXC A;  2R7Z G;  1K8G A;  3CMA A;  3S15 H;  1XNR L;  1I94 Q;  3I4M H;  3HKZ G;  1WYD A;  4DAY B;  3CCJ A;  4LF4 L;  4NXN Q;  4IOA A;  1TWH H;  2R7Z H;  4KHP Q;  3PO3 G;  4BBS G;  3M4O H;  4DUZ Q;  3GTP H;  2K5V A;  3K81 C;  1JB7 A;  3EBE A;  2Z6K A;  3UDI A;  3I55 A;  3S1M H;  3GTK H;  3PO3 H;  1N9W A;  2IX1 A;  4BBS H;  2Q2T A;  1J5E Q;  4P71 A;  1I3Q H;  2JA9 A;  1QUQ B;  3M7N A;  3A0J A;  4J15 A;  1N33 Q;  2PMZ E;  1Y1V G;  2PQA A;  4JG2 A;  2E5L Q;  4X64 L;  2CWP A;  3CAM A;  1PH3 A;  4AYB E;  2ASB A;  2NVT H;  1YHA A;  2MO0 A;  4JI2 Q;  1XMO L;  1TWC H;  1QVG A;  3HOW H;  4DV2 Q;  1Y1V H;  3J81 c;  4GKK L;  1GKH A;  2WAQ E;  4GNX C;  3K0X A;  1YZ6 A;  3OTO L;  1NBW A;  4BBR G;  2OQ0 A;  1LTL A;  2BA0 A;  2KHJ A;  4JI0 L;  3DLL A;  3PIO A;  3FP9 A;  1U0L A;  3CC2 A;  1YIT A;  1Q8K A;  3CP0 A;  4QJF A;  3GTJ H;  3F2D A;  4GOP B;  1U5K A;  4BBR H;  2A8V A;  1VQK A;  3CCL A;  4EX5 A;  3J81 i;  4DR5 L;  3UDG A;  1QZH A;  2Q2I A;  2YYZ A;  2JA8 G;  3TQY A;  4DAM A;  2E2H H;  3F2B A;  1MJC A;  3K80 C;  3W1B A;  1D7Q A;  2K52 A;  2JA8 H;  4OO1 G;  1HNX L;  1IBK Q;  2MQH A;  1CKO A;  1G29 1;  4BY1 G;  1KQS A;  1H95 A;  4DPG A;  2GVA A;  3UE1 A;  1EWI A;  5IP7 G;  4X65 L;  3U4V A;  3S2D H;  4DR7 Q;  4A76 A;  2KEN A;  4A93 G;  3NEN A;  4R4T A;  4BY1 H;  3HKS A;  1NE3 A;  1Y1W H; 
#chains in the Genus database with same CATH topology
 3J80 L;  1CA5 A;  1V1Q A;  3I73 A;  1BBX C;  1VQ9 A;  4R1J A;  2EYH A;  4LWC A;  1O7Y A;  4RHS A;  3HKZ B;  5LL6 X;  2EY2 A;  4Q5V A;  2OXP A;  2NTS A;  3OMC A;  4G7O C;  4FF1 A;  1KNE A;  1M90 C;  2PI2 E;  4J6H A;  1E2W A;  3X3M A;  4JI4 Q;  1VF7 A;  3BDC A;  4O42 A;  1X56 A;  4JBK A;  3SR1 A;  1IBL L;  2OF1 A;  2Z4I A;  4F87 A;  3U9S A;  1SMY C;  3NPP A;  1HZC A;  2A5H A;  1BCP D;  5GAH C;  1OXS C;  1PRT C;  4XYO A;  1Y8P B;  5J22 A;  2K6A A;  4UP9 A;  3CCE A;  1ESF A;  3K7U C;  2EVB A;  4NPS A;  4DK6 C;  3VYS A;  2SNM A;  2VB3 X;  2XTI A;  2YTV A;  1RKN A;  1WTW A;  4DR2 Q;  1PH6 A;  1VQO A;  3RZO H;  4OWW B;  5C4X G;  4ZKB B;  5GAD C;  1D5Z C;  2VZA A;  2E8G A;  3L0O A;  4CDD C;  4OO1 I;  2F0G A;  3TZD A;  1SRO A;  3CRL C;  1LTB D;  3HGB A;  4C3H H;  2JA8 B;  4DV5 Q;  3CD6 A;  2NTT A;  1Z6H A;  2QEX A;  2R92 B;  3W3A A;  4FDB A;  3T4A C;  3D31 A;  2F1M A;  1PH2 A;  4JBM A;  4JV5 L;  1GM5 A;  1DJR D;  2WB1 B;  1E2Z A;  1PHJ A;  4C2M H;  2BH2 A;  1H9K A;  4A93 B;  2J4X A;  2QW7 A;  2A6E C;  1STG A;  1Q82 C;  1E22 A;  3CF5 A;  1NNX A;  5ELN A;  1AEX A;  5IGF A;  2HIV A;  5CYU A;  4IUV A;  4LFB L;  1RJT A;  4E6I A;  3T56 B;  4L5R C;  1LT6 D;  2EYJ A;  4YWM A;  1D6E C;  1YJ9 A;  3C3L A;  1VQC A;  4S3S A;  2E2D C;  4QIW E;  3CCU A;  2EXD A;  3ER0 A;  1HNZ L;  3KK7 A;  4G7Z C;  1S5C D;  1C4Q A;  3I4O A;  2N88 A;  1RD9 D;  5L37 A;  2G9D A;  3BZC A;  3K5O A;  4JI1 L;  1V8Q A;  4RWS C;  1PA6 A;  3AYH B;  4A3K G;  4Q0F A;  4A3E H;  2B29 A;  1JJG A;  1YNX A;  3I56 A;  3S2H B;  3MEH A;  5C6A A;  1WFQ A;  4GKK Q;  5FLX L;  1PZJ D;  2FXQ A;  1PTO F;  4NW2 A;  2KCM A;  2HT1 A;  4EGV A;  2R3Z A;  4X62 Q;  4OWX B;  1B9N A;  4CJ1 B;  1NY4 A;  1VS0 A;  2L9H A;  4DR5 Q;  2EYF A;  4NXN L;  5DAU A;  2KHI A;  3NBH B;  1XX8 A;  1MBY A;  5E4X A;  4H02 A;  3KBX A;  1S5B D;  1WOC A;  4ME3 A;  3RZD B;  2UUB Q;  4CKB A;  2BDO A;  4LFA L;  2PQA B;  5ISR A;  3VR2 A;  3ZYY X;  3A7A B;  2QA4 A;  1O7L A;  2F0D A;  1VQF A;  1ILP A;  1QNU A;  1EQV A;  4KTA A;  1VF5 C;  3AFP A;  3KLS A;  1YJN A;  2QIL A;  4RKB A;  2MO1 A;  4KHV A;  3MZ5 A;  2O2L D;  2K50 A;  3CHB D;  2UUC Q;  3NK9 A;  1PTO B;  1O7Z A;  4KY7 A;  1BBW A;  3I7F A;  3ERS X;  3MA2 B;  3S14 H;  2JP1 A;  4XIG S;  1WI5 A;  4OON A;  1JIC A;  3EQL C;  2WV6 D;  4ZAI A;  4L63 B;  2K7V A;  2AWN A;  1LTS D;  3KYH C;  3J7A V;  4FO2 A;  5C44 H;  3CRK C;  2JYO A;  3GTQ H;  5C4Z A;  3KF8 A;  3HOV B;  5EKI A;  5C0X J;  4C3I G;  2M9V A;  1U4L A;  3GQB A;  3K5M A;  4L5T A;  4A3D G;  4Y7N H;  3RR5 A;  5IGC A;  4B3T Q;  3J80 c;  3GTM B;  1HQM C;  1IBM Q;  2VUM B;  3TME A;  3RNU A;  3NTI A;  2O5J C;  4ZKC B;  2F0U A;  1X55 A;  3H6M A;  4DV3 L;  4DR1 L;  3FDT A;  4QF4 A;  2BOS A;  2JA5 G;  1XNQ Q;  1JWS D;  3BZK A;  2KCC A;  3J80 i;  3STB C;  2E76 C;  1X65 A;  2HHH Q;  4LF6 Q;  3A5Z B;  5A35 A;  5IIF A;  4A3I G;  3AQQ A;  3F2C A;  1TR5 A;  5D65 A;  3KF6 A;  5FO8 B;  3ITP A;  5DEH A;  2LXK A;  3KLS X;  2CFM A;  4DGZ A;  2Z8L A;  1K0R A;  1HNW L;  5FO7 B;  2PCF B;  2H4O A;  1XNR Q;  5C4H A;  4HIK A;  4LF4 Q;  1LV9 A;  2JXM B;  3URY A;  3EA6 A;  1FNW A;  3K0Y A;  5C0X G;  1SXT A;  1OXT A;  2NVQ H;  4GKJ L;  3CQZ B;  3T1Y L;  2N8N A;  2VQE Q;  4G7H C;  4WOR A;  1CKM A;  3V05 A;  3U58 A;  4F7X A;  4LUZ A;  5TSS A;  2Y0S B;  1G2S A;  1XMO Q;  1F9S A;  1PRT F;  3J7Z C;  3FRP B;  2I46 A;  1N34 L;  5GAG C;  2XVS A;  3SE0 A;  4A3D B;  1RCV D;  1Q86 C;  3AFQ A;  1SYG A;  2ICI A;  4JI0 Q;  4APV A;  4BY7 G;  3LWE A;  4H7B A;  3BS1 A;  4QGU A;  1CA6 A;  2B63 B;  4L8J A;  3X3N A;  3J7A 5;  2AKW B;  2IJ0 A;  4DV0 Q;  3GTO H;  1UEB A;  4BXX G;  2JA5 B;  5EBD A;  4A3B G;  4KHP L;  2NBF A;  1L0X B;  5EAY A;  2F0O A;  5C4J B;  1KTK A;  5IWA L;  1QIL A;  1SN8 A;  3MVV A;  3PCO B;  4ALP A;  4X3T A;  1PYW D;  5GAE C;  4A3I B;  1HNX Q;  2CVR A;  5IGE A;  5BN4 A;  5FK9 C;  1SSO A;  4R4O A;  2HDL A;  3HOU G;  1CT1 D;  2JA6 H;  4FP5 D;  2FJ2 A;  3BDO A;  4IUU A;  3FPP A;  4HR7 B;  3V2T A;  1YEZ A;  5FLX c;  3I8Z A;  3G4S A;  1PRT B;  2JA7 G;  4EQN A;  3WOE A;  4PZ7 A;  2RF4 A;  1YNN D;  1VQL A;  1SLJ A;  1FGB D;  2BH8 A;  3A74 A;  1QOH A;  2A68 C;  3M4P A;  5KNB A;  2UU9 L;  2B2T C;  1I6H H;  4R4Q A;  2R93 H;  5M5W H;  2CKZ B;  1SEB D;  3OIQ A;  1TWA H;  1IBL Q;  3I4N H;  1Y1W G;  2N55 A;  1SNQ A;  5DM6 3;  3W2D A;  1EZ8 A;  2V4D A;  1LTG D;  4ZUJ A;  4WJ4 A;  1HR0 W;  1ESR A;  4FF3 A;  1L2F A;  3DWP A;  3VA7 A;  5FO9 B;  1AZQ A;  1LTT D;  2EXZ A;  1NUC A;  3O13 A;  1J8I A;  1Y8O B;  4BY7 B;  5ELD A;  1JB3 A;  4BBS B;  4U68 A;  4ZQ3 A;  2B2W C;  3WWV A;  1FNV A;  4RA8 A;  3NWT A;  3J7A F;  5M5Y H;  2JJQ A;  3MAQ A;  2HD3 A;  2HIX A;  4C3J H;  4CKE A;  2Q2U A;  2A19 A;  1R9T B;  2E2I H;  1FVI A;  1HR0 Q;  3I3C A;  2WP8 J;  3MXN B;  4JV5 Q;  4PZ6 A;  1TY0 A;  3GDE A;  2MJ8 A;  3HOU B;  3VR3 A;  1XWE A;  2ID0 A;  2PPB C;  3EFX D;  4BBR B;  4HJ8 A;  1JOO A;  5C3W A;  4IUR A;  4KY6 A;  3V96 A;  3PQI A;  1A8V A;  5KIX A;  2JA7 B;  2Z4H A;  4LFB Q;  5KNC A;  2EIF A;  4RGO S;  2HCC A;  2F4V Q;  1EL0 A;  1BBU A;  3B6Y A;  4HJ9 A;  2LMC B;  4DR2 L;  1EQQ A;  1A62 A;  2PNH A;  4AIM A;  3SXH A;  1EU3 A;  1S5E D;  4JI5 Q;  3PV0 A;  2VXW A;  1KHI A;  4IFD G;  2Z9H A;  1Y1W B;  3UDX A;  4JI1 Q;  4DUY Q;  2LKV A;  1B2T A;  3PUZ A;  3U50 C;  2WAQ G;  2IPK D;  4DK0 A;  4ZYS A;  1T5E A;  3AB9 A;  4JI8 L;  3PF5 A;  4GS3 A;  4OEL B;  1B3A A;  5KYI A;  1C7Y A;  2VQF Q;  1E0B A;  4KV6 A;  1S72 A;  2DNC A;  4EQ5 A;  1E1O A;  1N36 Q;  2EY6 A;  2K28 A;  5ELC A;  4K5X A;  3M3Y B;  4LW1 A;  1K9M C;  1GJX A;  3S15 H;  3QJY A;  3EVQ A;  1WYD A;  4DAY B;  4NXN Q;  4ID6 A;  3GTP H;  2F0Q A;  3I55 A;  1AZP A;  3GTK H;  1D1K A;  1J5E Q;  4KN7 C;  4N9T A;  1D2B A;  5CBE E;  2F0M A;  2PMZ E;  2PQA A;  3I90 A;  4QIW B;  4FF2 A;  2E5L Q;  4X3S A;  2MO0 A;  4G4K A;  4GKK L;  2DJG C;  3OTO L;  4JPB W;  1JCK B;  1ET9 A;  1LTL A;  2J7Z A;  2KHJ A;  3DLL A;  3K7A B;  1T5X D;  4FYD A;  3CP0 A;  1U4R A;  3NHH A;  4DR5 L;  1QZH A;  2Q2I A;  2YYZ A;  4DAM A;  3A55 A;  1BDO A;  3F2B A;  1SJE D;  3W1B A;  1D7Q A;  2JA8 H;  4OO1 G;  4OHJ A;  1VMC A;  5C5L A;  1G29 1;  3S16 B;  4PQX A;  4EQO A;  2GVA A;  4CDF C;  1R4P B;  3U4V A;  2Z1C A;  2KEN A;  3NEN A;  4JK1 C;  4NMZ A;  3HKS A;  3NBI A;  3HOZ G;  5HY6 A;  3OMG A;  5HGT A;  5EPJ A;  4IQZ A;  4A93 H;  1N8R C;  3H0G B;  3FVQ A;  4EVO A;  3ZJY C;  5IY0 A;  3VYR A;  2JEB I;  2F52 A;  4DV6 L;  1F2Y A;  1NTG A;  1Q81 C;  2N49 A;  1HTP A;  3NXW A;  3TS2 A;  1TWF H;  1EFW A;  4DR1 Q;  5IP9 G;  5M3M H;  2EJF C;  3EIV A;  4K8I A;  1DD2 A;  2FHT A;  1KIX A;  4HJ7 A;  3PIP A;  2C9O A;  3RD4 A;  5M5X B;  1ICF B;  2IW3 A;  4PG3 A;  1SNP A;  4Y52 H;  2JN4 A;  2K04 A;  1EY9 A;  5JJL A;  3M85 A;  4A3F G;  4A3J G;  1XXG A;  4MHE A;  2AHO B;  2ZJR A;  5G3L D;  4JOI C;  2MGS A;  1IXR A;  2EY5 A;  4B3T L;  1IBM L;  5C4X H;  4P73 A;  3J81 j;  2Y0S E;  4GKJ Q;  4DNT B;  3T1Y Q;  3HEJ A;  2RDG A;  1X54 A;  1BVS A;  1DGS A;  1XNQ L;  3MXG A;  2VW9 A;  2XRQ D;  3AU7 A;  3CCS A;  2NVY B;  2IY5 B;  2NZO A;  4TVA B;  5I4D A;  1B4O A;  2HHH L;  3HOZ B;  4A3C G;  1WD1 A;  1N34 Q;  1LYL A;  4KJO A;  1NMF A;  1YIJ A;  4ULL A;  1HRJ A;  3HFZ B;  3GTL B;  3QOL A;  4LFC L;  1Q7Y C;  1KL9 A;  3LNN A;  2F0T A;  4KHZ A;  2SDF A;  3S24 A;  1KC8 C;  4C1N K;  1ZEQ X;  1IKL A;  4PMC A;  1ZYR C;  1EIY B;  5I6Y A;  4QL5 A;  5IWA Q;  2OCE A;  4POG A;  2B2V C;  1B7Y B;  5IT9 E;  1I4H A;  1NCV A;  2VQE L;  5CV4 A;  4B3R L;  1OXX K;  3HP3 A;  1STY A;  4A3K H;  1K83 H;  4DNI A;  1SJH D;  1LTI D;  2NN6 G;  1EY8 A;  4CBV A;  3R3O A;  1TWG B;  4K5W A;  3KJP A;  1I94 L;  4X3K A;  2YU9 H;  3IAY A;  4IFD I;  1H9J A;  4KK7 A;  1VQ8 A;  1PLF A;  3TP7 A;  1CM9 A;  2EOT A;  3NP8 A;  3JAM E;  5DLQ E;  3SEB A;  3H15 A;  2UU9 Q;  4DV0 L;  3CC4 A;  3PUX A;  2XIW A;  2VL6 A;  1ONL A;  1JOQ A;  1GVP A;  2R92 G;  4J1M A;  4UY8 C;  3K5L A;  5LMN W;  1EIF A;  4YCU A;  1HFN A;  3SGI A;  2WB1 G;  3HS0 C;  3RMH A;  2K5N A;  2SNS A;  4DV2 L;  2VNU D;  4DNR B;  1RIP A;  1I5F A;  4NB3 A;  4DR6 Q;  4QUC A;  4XQN A;  1E24 A;  1I4R A;  1JC7 A;  1GUN A;  1VQD A;  1WCM B;  2IL8 A;  4IPC A;  5LMN Q;  1PZI D;  5K5P A;  4RGT A;  5M3F B;  2R61 A;  2D9U A;  2CW0 C;  1GD7 A;  3MXN A;  2Z6B A;  4KD3 A;  1D8L A;  1FNU A;  1X3G A;  3HOX B;  5JEA G;  2A6H C;  4LF7 Q;  2MUY A;  5IYD H;  2PI2 A;  4FVM A;  3BVM A;  5EJW A;  3Q8D A;  4C3I H;  3CCV A;  1ASZ A;  1E7Z A;  1STB A;  4ILW A;  4A3D H;  2H1E A;  1A2U A;  2YTY A;  1S3O A;  5BN5 A;  4KKS A;  4TKO B;  4IUN A;  4L5Q A;  4A3G B;  3T1H L;  2UUA L;  4B9X A;  1PXU A;  3G6E A;  2BE5 C;  1HR0 L;  4YCV A;  2RCN A;  2JA5 H;  1I50 B;  2TSS A;  4JI8 Q;  2Q8T A;  3NQT A;  1ROD A;  1U4M A;  1K28 A;  2EYM A;  4I65 A;  1CQF A;  4A3I H;  1PYS B;  4UAI A;  2AUK A;  5BR8 L;  3KFU A;  4CKC A;  1UE5 A;  3S1R B;  1CSQ A;  2F4V L;  1T9H A;  2B39 A;  1VQN A;  2KEE A;  1HFG A;  1Z47 A;  2F0F A;  4DAY A;  4ME5 A;  2RSO A;  1BNZ A;  2ATW A;  4JI5 L;  2L55 A;  1Q1B A;  5C0X H;  4N8F A;  2ZTD A;  3J81 L;  2XWJ B;  4DUY L;  1IW7 C;  2QEJ C;  1WD0 A;  1VQ5 A;  1ICW A;  1YNJ C;  3WOF A;  2HCI A;  2GN5 A;  3M4Q A;  3BU2 A;  1TY2 A;  2ALY B;  1QB5 D;  2A6E D;  3CCQ A;  3OTO Q;  3HOV G;  2VQF L;  4JYA L;  3C1E A;  2F0E A;  1IHZ A;  2KBN A;  3PUY A;  1N36 L;  4XT3 B;  4A3L G;  2G5D A;  2K5H A;  4BY7 H;  1L1O C;  2VUM G;  5JAV A;  4IUT A;  1GOZ A;  5JVH 3;  2VY3 A;  4BXX H;  1B53 A;  4A3B H;  2LS0 1;  1JWU D;  5IOC A;  5AJ3 L;  1J5E L;  4KKT A;  1R9T H;  4GN5 A;  3SK5 A;  4QY7 A;  4FF4 A;  3RUZ A;  4LF9 Q;  1TU2 B;  1AE3 A;  2E5L L;  2OWO A;  3DM3 A;  3PO2 B;  3HOU H;  3CCM A;  5J39 A;  1F2Z A;  1LM0 A;  3QOJ A;  4CHT B;  1ENF A;  1RHP A;  1SYF A;  2EQS A;  1QE6 A;  2PMZ B;  3T51 B;  2D5D A;  4DV6 Q;  2Q2H A;  1EWH A;  1EY0 A;  2JA7 H;  2L5T A;  3K57 A;  5EGT A;  3K6O A;  3EN2 A;  3G7L A;  2NZH A;  1UWV A;  1V1P B;  1WTP A;  2RKS A;  4JI6 L;  3VDY A;  2NN6 I;  5T1I A;  4MIU A;  4DA2 A;  2R7Z B;  1HHV A;  3PF4 A;  2Z6K C;  2DUD A;  1YVC A;  2Y0S G;  1D5M C;  4HIM A;  3ONA B;  4TRD A;  3CCR A;  5AFW A;  1N32 Q;  2PZT A;  3NUC A;  3UI2 A;  1K3R A;  3S1N H;  4YY3 L;  4LAA A;  4WJ3 M;  2K32 A;  1RTN A;  3M3Y H;  1X3F A;  2NVT B;  1SNM A;  3JC6 6;  1TWC B;  2B63 G;  2F0I A;  1H9R A;  2CH4 W;  4DN4 M;  2WKD A;  4JI7 L;  1PFN A;  1G2T A;  1HUM A;  1A6X A;  4MZ9 A;  1F9P A;  3L9A X;  2XSC A;  5C5M A;  1YJW A;  1X32 A;  5JJI A;  4LFC Q;  2X6L A;  1HCZ A;  3OHX C;  3A5U A;  4P74 A;  2N78 A;  2K5W A;  5IT9 L;  4A75 A;  1JOR A;  3GO5 A;  3S2D B;  2ICE C;  1BCP F;  1EIG A;  1SE3 A;  3G6J B;  1XTC D;  4IFD H;  4B3R Q;  2ZXO A;  2E2J H;  1EWC A;  3STB D;  1TQO A;  1TXY A;  3I2Z A;  1QZG A;  2ES2 A;  2B2T A;  4OGQ C;  1SFO H;  3TEH B;  3JAM L;  1XYI A;  1WTH A;  3GV6 A;  1I94 Q;  5DM7 3;  1TWH H;  3C2P A;  1LT3 D;  4BBS G;  3M4O H;  1JB7 A;  1GXD C;  3EBE A;  4WJW A;  3UDI A;  4CJ2 C;  3S1M H;  2IX1 A;  2Q2T A;  1JQY D;  3LWU A;  4P71 A;  2LFN A;  2XNA C;  4OIJ A;  2B2W A;  4XDX A;  1I3Q H;  1U4P A;  2JA9 A;  1QUQ B;  1Y1V G;  4YIJ A;  1JR0 D;  3K58 A;  3RZO B;  2F3V A;  4RH6 A;  1YHA A;  3MC0 B;  4HN7 A;  4DV2 Q;  3HOW H;  1UNS A;  3J81 c;  2KA7 A;  4GNX C;  1YNN C;  2B8G A;  4IN3 A;  4BBR G;  2OQ0 A;  2KHS A;  3TSS A;  3PIO A;  1U0L A;  2B2U C;  4XQQ A;  3GTJ H;  3J81 i;  2CH4 A;  5JOB A;  1RTO A;  1EY4 A;  4BS9 A;  5IGD A;  4CDC C;  1ET6 A;  3K80 C;  5EKK A;  3E5S A;  3D4R A;  4BY1 G;  1H95 A;  4OO1 H;  3BDL A;  5IP7 G;  3H09 A;  4X65 L;  3M4Y A;  2DNE A;  4GLX A;  4K2L A;  4IFD J;  2Z0S A;  3HOZ H;  3NQI A;  2ZJP A;  4DR6 L;  4KY5 A;  3G48 A;  1JE4 A;  3I91 A;  1WTR A;  2F03 A;  2WIN B;  2CHB D;  5IYC G;  2ZT9 C;  1HXY D;  2F4I A;  2I5M X;  1LAC A;  2D0P A;  3T1H Q;  2UUA Q;  4CDE C;  4R9W A;  1PH5 A;  3MXU A;  1XTD A;  5IP9 H;  1E2V A;  2JQO A;  4LMQ D;  5LMN L;  1Y1V B;  2A68 D;  4I7Z C;  2K05 A;  1II3 A;  3IL8 A;  1BOS A;  3FHW A;  5EKL A;  3ND9 A;  2PW7 A;  5BR8 Q;  1SE2 A;  4LF7 L;  2F3I A;  1CFM A;  4A3F H;  4OWT B;  2K4K A;  4AH6 A;  4A3J H;  1DOL A;  1UEA B;  1HH2 P;  4K2K A;  3H3V I;  1K8O A;  1SR3 A;  5C3E G;  1GUG A;  1QVF A;  2I5H A;  1S40 A;  1XPU A;  1KAW A;  4BY1 B;  1BQQ T;  1Q90 A;  5JPN C;  1WTX A;  3HOY G;  1L1O B;  1QVC A;  5K36 G;  1CHQ D;  3LX0 A;  4DKA C;  2KVM A;  3I70 A;  3P1H A;  1OXU A;  1YHQ A;  4K6D A;  4A3C H;  4JYA Q;  3SDZ A;  2MP1 A;  1K73 C;  3TS0 A;  2IT1 A;  1VQ7 A;  2O4X A;  1LUZ A;  5KEE A;  3SVM A;  2JE6 I;  4RKL A;  1PZK D;  3VYU A;  3H0G G;  4L5S A;  5C44 B;  3GTQ B;  2LSS A;  5IT9 c;  1DOK A;  2PZW A;  3S17 B;  4I7A A;  3I72 A;  2L15 A;  1QCB D;  2AUJ D;  1PFB A;  2EY1 A;  3BVG A;  3A56 A;  4LNQ A;  4HSV A;  4RGN A;  5AJ3 Q;  1M8A A;  1TVX A;  4IAL A;  4GZY C;  4Y7N B;  1Y8N B;  3F1Z A;  1ILQ A;  3DXJ C;  1EOV A;  1VQG A;  1TKW B;  1JWM D;  4FXD A;  3SK4 A;  2ZTC A;  2K5D A;  4IO9 A;  2QCP X;  5D14 A;  1B50 A;  1C9O A;  1DM0 B;  3ERQ A;  1KDB A;  1KNA A;  2NN6 H;  4TSS A;  3DEO A;  3RLO A;  3E0J A;  5C3E B;  1HZA A;  2WFW A;  2N3S A;  1YHB A;  1FYC A;  1YI2 A;  3D6C A;  1EQR A;  3HOY B;  5I6W A;  4JOI A;  1JT8 A;  3JAM i;  2JEA I;  2LXJ A;  3NTK A;  4GLV B;  4JI6 Q;  1V1P A;  1OXV A;  2VS1 A;  2EYO A;  2R92 H;  2KUM A;  4F88 A;  1OO9 B;  2A69 C;  4P2C B;  3K59 A;  4ZK9 B;  4LF9 L;  3OIP A;  4BA2 I;  1VQI A;  1I50 H;  1J9O A;  3RLN A;  4JBJ A;  5IGB A;  3FKI G;  1CI3 M;  4R8N A;  1ENC A;  1VQB A;  1X9N A;  4AYB B;  3IFT A;  1VQE A;  5IYB G;  2AWO A;  1PH9 A;  4YY3 Q;  3E6Z X;  3D6W A;  4IUP A;  2PNR C;  1IL8 A;  1KRT A;  1IKM A;  3S1R H;  2QKI C;  4JI7 Q;  3AEV A;  4XTC S;  3BZD B;  4IPG A;  2OTL A;  5FJ8 G;  2XRS D;  3CME A;  4PV1 C;  4KLK A;  4RGM A;  4GOP C;  1HTL D;  2F0J A;  3ICE A;  2B2V A;  1KRS A;  5JEA H;  4DV4 L;  3SHL A;  3ULL A;  2SEB D;  3S2H H;  5H1S E;  4MNO A;  4K14 A;  2DY8 A;  1N32 L;  3R2I A;  1HZ9 A;  1EZ6 A;  1LTA D;  3F2U A;  1QNK A;  3BG3 A;  4IZ8 A;  4OIK A;  1LO5 D;  3KLR A;  2JA6 B;  2UXB Q;  1Q46 A;  2XGT A;  1FR3 A;  1BO0 A;  2CWA A;  2R7F A;  1XMQ Q;  4RFB A;  4GN4 B;  1A0I A;  4X66 L;  5A2Q E;  4X6A H;  2K03 A;  5LMU L;  1X3Q A;  3OYY A;  4LUO A;  1XPO A;  5I9O A;  4NXM L;  1G6P A;  3RZD H;  3TRE A;  5COR A;  3FKI B;  4YWL A;  1WTO A;  2R93 B;  1HZB A;  4O1N A;  3NEM A;  1C48 A;  1PTO D;  1TWA B;  4GNX B;  3D0F A;  3T53 B;  1FJG Q;  2AQ1 B;  5I2X A;  2MHV A;  1HA5 A;  5LL6 S;  5E7N A;  4K0K Q;  2GA4 B;  1WCM G;  5IOD A;  2NZ1 D;  1PTO H;  2K33 A;  1DOM A;  1KAB A;  4B3M Q;  3EJI A;  2TMP A;  2EJM A;  5M3F G;  2PO4 A;  4RHR A;  3GTG B;  1QUQ A;  1KAA A;  1VQH A;  5M5Y B;  1GHK A;  4POF A;  2R6G A;  4B3S Q;  2E2I B;  3E0E A;  3HOX G;  4V19 0;  4JW0 A;  5CR3 A;  3HOV H;  1JE5 A;  2C35 B;  1X3E A;  2KEC A;  3HG9 A;  2B2Y C;  3F8T A;  4TQU S;  4HTH A;  4DV1 L;  2F0K A;  2K75 A;  5T1G A;  5ELE A;  3U4Z A;  4A3L H;  3NSW A;  2EPB A;  3NTH A;  4JI3 L;  1TS3 A;  1JOK A;  3E9H A;  1S4Z A;  5JEA J;  1ZYR D;  2NVX B;  3GTM H;  2RSN A;  2VUM H;  1I4Q A;  3R8B A;  4DXG A;  3A8J E;  4A3G G;  2I0Q A;  1F2L A;  4A3M G;  4X65 Q;  3A54 A;  3MHB A;  5HUR A;  5ELF A;  2PZU A;  3PUW A;  4IJH A;  1CUK A;  3I4L A;  4YCW A;  4OX9 L;  1B8A A;  5GQO A;  1KXL A;  1GUO A;  1KDC A;  1F77 A;  1D1I A;  1PFS A;  1CZW A;  3GP7 A;  1Q8I A;  4DXF A;  1W6J A;  3DWQ A;  5CC4 A;  1A2T A;  2IHF A;  2FIN B;  1W3S A;  3S1Q B;  3OWE B;  1MD2 D;  1QG7 A;  3E9I A;  1BCP C;  2EJG C;  1EYG A;  4G57 A;  4YHH L;  4QQB X;  4KKU A;  5IGG A;  3H3V H;  2YTX A;  3PUV A;  4DR4 L;  4UPA A;  1NMG A;  3PIO 3;  1CSP A;  2ENB A;  5D3I B;  3QR8 A;  5NUC A;  1XJV A;  1LAB A;  3CQZ H;  3GTP B;  1STH A;  2P5Z X;  5KYL A;  4N9P A;  1SDF A;  1UUP A;  3GTK B;  1NAP A;  5M3M G;  1TT2 A;  1TII D;  1PV4 A;  3KLW A;  3UDF A;  1H9S B;  2SOB A;  1I4P A;  4JCV E;  3BVZ A;  1K8A C;  1CHP D;  3G71 A;  2LY7 A;  1CZG A;  4A3M B;  2FMC A;  2B63 H;  4NDX A;  3T13 A;  4H13 C;  4ZRZ A;  4QUF A;  2AMC B;  1IZ6 A;  5E1F A;  1L1O A;  3IRB A;  2CW0 D;  4CJ0 B;  2BDN A;  5C4J H;  5HGQ A;  1SMY D;  1SMX A;  5J1Z A;  4NKL A;  3TBI B;  1L0Y B;  2XWB B;  1VCI A;  2ZM6 L;  1Y69 U;  2A6H D;  4DR3 Q;  4AQY L;  3MEF A;  1PRT D;  5COY A;  1BF4 A;  3PO2 G;  3BYY B;  1JMC A;  5JPM C;  1VQM A;  2ZTE A;  2UXD Q;  1GUT A;  5KRU A;  3CPW A;  2DJF C;  2KQ3 A;  1O80 A;  2DY7 A;  2IX0 A;  2OT2 A;  2Q8R E;  4HCE A;  1MSG A;  3QG1 A;  1STN A;  3OPO A;  1X6O A;  5FLM G;  2FMM A;  4B9W A;  1X3P A;  4R4C A;  1I4X A;  1ASY A;  1WVL A;  2DN8 A;  2BE5 D;  3A7L A;  3VR4 A;  1EIH A;  1VQ6 A;  2CCZ A;  2K01 A;  4LF5 L;  5G3L F;  3MWY W;  3MTS A;  1VMP A;  1TWF B;  2EZV A;  1EYD A;  2K1B A;  4KD4 A;  5M9O A;  5M3M B;  3PMF A;  3RN5 A;  3I4M G;  1K8M A;  3CXC A;  3OWF A;  1K8G A;  3CMA A;  2R7Z G;  4UHV A;  1BUV T;  3PO3 G;  5F2D A;  2HQE A;  4K5V A;  2K5V A;  1TS2 A;  3Q22 A;  3K81 C;  1W6K A;  2Z6K A;  4RAU C;  5FOB B;  4BBS H;  2AQ2 B;  1BXT A;  3M7N A;  1N33 Q;  4J15 A;  4M1U B;  4AYB E;  1IW7 D;  1G91 A;  1YNJ D;  1Y1V H;  5C4X B;  3VR5 A;  2WAQ E;  2F0W A;  5CV7 A;  3ND8 A;  1YZ6 A;  1NBW A;  4LK1 C;  2NUC A;  3C1F A;  4F8M A;  2BA0 A;  1WTQ A;  2M00 A;  3FP9 A;  2EYL A;  3CC2 A;  1Q8K A;  4GOP B;  5I9P A;  4BBR H;  1STA A;  2A8V A;  5JJZ A;  2F0N A;  3CCL A;  3K5N A;  3L3O C;  5KGU A;  1EYA A;  3OSO A;  1G6Z A;  2B8F A;  1DCZ A;  3U9O A;  1MJC A;  1UAP A;  2K52 A;  3DUZ A;  4DAP A;  2MQH A;  1CKO A;  1CQV A;  3TP5 A;  4DPG A;  1AFP A;  3UE1 A;  1MHW C;  1MGS A;  4PNY A;  4BY1 H;  1Y1W H;  3I4M B;  5IP7 H;  1AN8 A;  3IKJ A;  4DV4 Q;  2RDF A;  2L1B A;  4IPD A;  3D3R A;  1UE1 A;  3DM1 A;  3PO3 B;  1Q1E A;  1LT5 D;  5A2Q L;  1AP0 A;  1M4V A;  1DYQ A;  4FNF A;  1B3Q A;  1U9R A;  2KED A;  2QF7 A;  4ZLT F;  5JJK A;  4A3K B;  1K83 B;  4XT1 B;  4GLA C;  5IYC H;  4OXP A;  2V1C C;  1I4G A;  4HSP A;  1G8Z D;  3Q0A A;  1M1K C;  4L6T B;  4KN4 C;  4ZCK A;  2KCN A;  5IYD G;  4X66 Q;  2K14 A;  1SYD A;  5LMU Q;  3ULP A;  3H91 A;  3J7Y W;  3S17 H;  1VQA A;  2YU9 B;  3BJU A;  4NXM Q;  4UDU C;  1VQ4 A;  2QDB A;  1SE4 A;  5CV8 A;  3SK8 A;  2D62 A;  2VB2 X;  4C3H G;  2E2H B;  1DZ1 A;  1CKN B;  2L12 A;  2R7D A;  4MN3 A;  4DK3 C;  2B3G A;  2F0V A;  1R4Q B;  2RDH A;  1NSN S;  2RHS B;  1V1O A;  4LF8 L;  3KDF B;  3PIP 3;  4GNX A;  2G9H D;  3QB3 A;  3K7A H;  4PMW A;  2UXB L;  2D2C C;  5C3E H;  2B2U A;  1VDZ A;  1AE2 A;  2NYZ D;  1XMQ L;  4R8I A;  2UXC Q;  4CGY B;  3E3X A;  1MJE A;  3HOY H;  3S9W A;  2JK8 A;  4ZUI A;  3PSI A;  2O5I C;  5K36 H;  4KMU C;  1PVO A;  5FKA C;  1IYJ B;  3S16 H;  2E75 C;  4XYQ A;  1CTM A;  3UE0 A;  2ZXP A;  1WJJ A;  2MFI A;  1A3U A;  4DV1 Q;  4LUV A;  5EQ0 A;  3D8G A;  4JBW A;  4C56 C;  3L2P A;  4HAE A;  3H0G H;  4JI3 Q;  1FJG L;  4A3E G;  3KBG A;  4K0K L;  2MNA A;  4X64 Q;  4DV7 L;  4C3I B;  4DF7 A;  2RQX A;  2F0L A;  4BWG B;  4B3M L;  2K5Q A;  1EUJ A;  1G51 A;  1ENA A;  1BCP B;  2RHQ B;  3WDN A;  2CQO A;  2BCO A;  1K0S A;  2HDM A;  1C0A A;  4C3H B;  1F2M A;  4OX9 Q;  1SAP A;  2KCT A;  1NJI C;  5M5X H;  2X69 A;  4RCN A;  5IE8 A;  5ELB A;  1FGU A;  4K6L A;  4RCO A;  4B3S L;  2RVL A;  1EQT A;  2NB0 A;  3GV3 A;  2IX3 A;  2L11 A;  4DUZ L;  1JJC B;  3VYT A;  4C2M B;  1GUW A;  1DON A;  1B70 B;  1TS5 A;  4YHH Q;  3W5O A;  1BKB A;  3HKZ E;  2A74 C;  3ULJ A;  4DR4 Q;  3H94 A;  4K8J A;  4JI2 L;  4PZ8 A;  2CQA A;  3TDQ A;  2PQE A;  3IFD A;  1Q3L A;  2NVY H;  3L7Z C;  3KOJ A;  2WAC A;  3FKI H;  2I5L X;  2L0C A;  4H44 C;  3PGZ A;  1D5X C;  1JJ2 A;  4A3E B;  5IYB H;  3K8A A;  3NE5 B;  4M8A A;  3QO2 A;  4HJ5 A;  3GTL H;  5EPL A;  1H9S A;  1SE8 A;  5C44 G;  4QMG A;  4GN3 B;  1UE7 A;  1IBK L;  5BN3 A;  2OQK A;  1A63 A;  1RL2 A;  3TP6 A;  2OTJ A;  4DR7 L;  3CC7 A;  4OL7 A;  1YBY A;  3P75 A;  4IUQ A;  2QGQ A;  2WII B;  1SNO A;  3R93 A;  5FJ8 H;  3OW2 A;  2ZM6 Q;  2KJX A;  1Y14 B;  4AQY Q;  4O2D A;  1GUS A;  4P72 A;  1P16 A;  5EPK A;  3GTG H;  4A3B B;  2WB1 E;  3QIA A;  1NR2 A;  5EBC A;  4JC0 A;  3RN2 A;  2IWH A;  3J80 E;  1QWY A;  3M9B A;  4MTN A;  5E3F A;  2EYP A;  4JI4 L;  1MIU A;  4X3U A;  1SYB A;  1B44 D;  3TRZ A;  1TWG H;  1MSH A;  4HID A;  4IOC A;  1IL2 A;  3SK6 A;  1FD7 D;  3VA5 A;  3RLF A;  1PH1 A;  3NEL A;  1HUN A;  2XN9 C;  3QWN A;  3A8K E;  4IPH A;  4WRD A;  2RA4 A;  2NVX H;  4LF5 Q;  3LGJ A;  1SYC A;  3S14 B;  1IYV A;  2F3W A;  1IYU A;  1DXM A;  5D3D A;  1RDP D;  1VQP A;  4UP7 A;  5CV6 A;  1EEI D;  1V43 A;  2RBM A;  3CKI B;  3DWA A;  4WFN 3;  4DR3 L;  1P8L A;  3Q6S A;  1S5F D;  4KI0 A;  1HNZ Q;  1EFI D;  2ZJQ A;  4Z9C B;  4DV5 L;  1EU4 A;  4AYB G;  4DAV A;  2BA1 A;  2UXD L;  3FPU B;  3CW2 C;  4U67 3;  3CU7 A;  4A4I A;  2JSO A;  1WCM H;  4HJA A;  5JVG 3;  3KUP A;  4DK1 A;  3S1Q H;  4J8Q A;  1SBB B;  3C46 A;  3S1N B;  2A73 B;  2J0T D;  2M2L A;  3KJO A;  5M3F H;  5CBA E;  3D4D A;  1PH8 A;  1PH4 A;  1WTV A;  4HMI A;  2DGY A;  1B9M A;  2QDL A;  3HOX H;  3VR6 A;  3BYT B;  3JAM c;  1CK1 A;  3NBH A;  4EQP A;  4GOP A;  1H9M A;  1STE A;  4LFA Q;  1HJP A;  4UP8 A;  1SND A;  1PDQ A;  4JVZ A;  4KJN A;  2IHE A;  3HOW G;  2JA6 G;  1EY5 A;  2E74 C;  3OW7 A;  4HCS A;  1BR9 A;  1N33 L;  4RG1 A;  4YWK A;  1EEF D;  4A3G H;  3TZU A;  4A3M H;  1GO3 E;  2F0P A;  3J81 E;  3DMU A;  5CMD A;  5E4W C;  4X62 L;  5C0X I;  2NVQ B;  1KLU D;  2RCF A;  4XXE A;  2F0H A;  5FLX E;  4N8X 1;  4ODG A;  2R93 G;  1SRU A;  2E2J B;  1UE6 A;  4RMF A;  2WAQ B;  1Z7T A;  5J3B A;  3Q24 A;  3T16 A;  3I4N G;  4HIO A;  1W2B A;  2UUB L;  4FXK C;  1SFO B;  2Q8I B;  1PMR A;  1O7I A;  5I2Y A;  4IJL A;  1AW7 A;  2HQL A;  1OTC A;  1L0W A;  1TWH B;  2EE1 A;  5CV9 A;  3M7G A;  4P75 A;  3M4O B;  1F9R A;  1A3T A;  2MPM A;  3S1M B;  1MI2 A;  1GHJ A;  2A69 D;  3Q23 A;  1E1T A;  2UUC L;  3GTO B;  1ZXT A;  1J6Q A;  1TS4 A;  1VQJ A;  3FEW X;  4C3J G;  3ERO A;  4O0A A;  1PH7 A;  1I3Q B;  4DV3 Q;  4V0B A;  4C1N I;  1CKN A;  4LF8 Q;  2PW5 A;  1Z9F A;  3CPF A;  2D0O A;  3HOW B;  2AQ3 B;  1O78 A;  3TP8 A;  1AH9 A;  5CV5 A;  3KDF A;  3KF8 B;  1ZKO A;  3W1G A;  1KLG D;  3N6R A;  1EY7 A;  2B2Y A;  1PYB A;  5CGK A;  1FL0 A;  3GTJ B;  1MKH A;  5GRO A;  1ML0 D;  1PTO C;  2H5X A;  3MFG A;  4DFA A;  1LTR D;  1HNW Q;  2HUG A;  1E3P A;  5C3X A;  1K3B C;  4QCL A;  3R2T A;  2WKC A;  5KND A;  1XPR A;  2X6G A;  5M5W B;  1I6H B;  1I6V C;  3NWS A;  4B08 A;  5DNF A;  1S5D D;  4BA1 I;  4HED A;  3I4N B;  2GVB A;  3PO2 H;  2ZXR A;  1V9P A;  3A8I E;  2FFK B;  3MFY A;  1C8C A;  1LLR D;  2A1A A;  3HZX A;  4DU9 A;  1KDA A;  4DV7 Q;  1PFM A;  4LF6 L;  3KF6 B;  3GD7 A;  5FLM H;  1A3V A;  5ELO A;  2UXC L;  2PYK A;  1EY6 A;  4FXG C;  4R4I A;  1LT4 D;  4NP5 A;  2NWG A;  4ABN A;  1Q12 A;  2YV5 A;  4C3J B;  1XNR L;  2EDG A;  3OOC A;  4LJZ C;  2L4N A;  3I4M H;  3HKZ G;  3CCJ A;  4LF4 L;  3AMU A;  4IOA A;  2R7Z H;  4KHP Q;  4DUZ Q;  3HRZ C;  4XQJ A;  3TN2 A;  1HPC A;  3PO3 H;  1N9W A;  1SNC A;  3N52 A;  4PMB A;  1A15 A;  1HA6 A;  1QJO A;  3DEP A;  1EOT A;  3A0J A;  3P7J A;  2I07 B;  4JG2 A;  4A3F B;  1B1Z A;  4X64 L;  4HMJ A;  2CWP A;  3CAM A;  1PH3 A;  2ASB A;  2NVT H;  4A3J B;  1XMO L;  4JI2 Q;  1TWC H;  1QVG A;  3MXP A;  1GKH A;  4OEM B;  1EYC A;  3K0X A;  3H3V C;  3FMC A;  2KOL A;  5LHY 1;  4JI0 L;  2F0S A;  1YIT A;  4QJF A;  3F2D A;  4MTK A;  1SYE A;  1U5K A;  1VQK A;  4EX5 A;  3UDG A;  4H0L C;  3DHQ A;  2JA8 G;  3TQY A;  2E2H H;  3P20 A;  1RF2 D;  2C5C A;  4QB4 A;  1HNX L;  1IBK Q;  1HQR D;  3D4W A;  1F9Q A;  1KQS A;  1EWI A;  3S2D H;  1NR4 A;  4DR7 Q;  4A76 A;  4A93 G;  4R4T A;  3S15 B;  2OEO A;  1NE3 A;  1KD1 C; 
#chains in the Genus database with same CATH homology
 3HOZ G;  5HY6 A;  5IP7 H;  1V1Q A;  4A93 H;  1N8R C;  4GLX A;  4R1J A;  5IY0 A;  1VQ9 A;  4LWC A;  3ZJY C;  2Z0S A;  4DV4 Q;  3HOZ H;  4IFD J;  4IPD A;  2JEB I;  2ZJP A;  1UE1 A;  4DR6 L;  2F52 A;  3G48 A;  1Q1E A;  4DV6 L;  1NTG A;  5IYC G;  1Q81 C;  2N49 A;  3TS2 A;  1TWF H;  2I5M X;  1M90 C;  1EFW A;  2D0P A;  2PI2 E;  5IP9 G;  4DR1 Q;  5JJK A;  4JI4 Q;  5M3M H;  4GLA C;  3EIV A;  5IYC H;  3T1H Q;  2UUA Q;  1X56 A;  4OXP A;  1PH5 A;  2V1C C;  1XTD A;  1M1K C;  4JBK A;  5IP9 H;  2JQO A;  5LMN L;  1KIX A;  4HJ7 A;  1IBL L;  3PIP A;  5IYD G;  4X66 Q;  2K14 A;  5LMU Q;  3ULP A;  1HZC A;  3S17 H;  1VQA A;  5GAH C;  1OXS C;  3BJU A;  3FHW A;  4PG3 A;  4NXM Q;  4Y52 H;  1VQ4 A;  4UP9 A;  3CCE A;  5BR8 Q;  5JJL A;  3M85 A;  3K7U C;  4NPS A;  4DK6 C;  4A3F G;  4LF7 L;  2XTI A;  4A3J G;  2F3I A;  2AHO B;  2D62 A;  2YTV A;  2ZJR A;  4DR2 Q;  4AQY Q;  1PH6 A;  1VQO A;  4JOI C;  4A3F H;  4OWW B;  3RZO H;  5C4X G;  1IXR A;  5GAD C;  1CKN B;  2R7D A;  4OWT B;  2K4K A;  4AH6 A;  2VZA A;  4A3J H;  2E8G A;  3L0O A;  4OO1 I;  4B3T L;  4DK3 C;  1HH2 P;  1SRO A;  2B3G A;  4C3H H;  1IBM L;  5C4X H;  4DV5 Q;  3CD6 A;  3H3V I;  4P73 A;  2RHS B;  1SR3 A;  4LF8 L;  5C3E G;  3KDF B;  2QEX A;  3J81 j;  4GNX A;  4FDB A;  2Y0S E;  4GKJ Q;  1QVF A;  3T1Y Q;  2I5H A;  1S40 A;  3D31 A;  1XPU A;  3K7A H;  1KAW A;  1X54 A;  4PMW A;  1PH2 A;  4JBM A;  4A3D G;  5C3E H;  4JV5 L;  2UXB L;  1BVS A;  1GM5 A;  3HOY G;  1DGS A;  1XNQ L;  1L1O B;  1AE2 A;  1QVC A;  2VW9 A;  1PHJ A;  4C2M H;  1XMQ L;  3CCS A;  2BH2 A;  5K36 G;  4DKA C;  2IY5 B;  2UXC Q;  2NZO A;  4TVA B;  1MJE A;  2HHH L;  3HOY H;  4A3C G;  2JK8 A;  3PSI A;  1Q82 C;  1PVO A;  1E22 A;  1OXU A;  3CF5 A;  5ELN A;  1YHQ A;  1N34 Q;  1LYL A;  1NMF A;  1YIJ A;  4A3C H;  2HIV A;  3HFZ B;  4JYA Q;  1K73 C;  4LFC L;  1IYJ B;  1Q7Y C;  4LFB L;  1KL9 A;  3S16 H;  3TS0 A;  4L5R C;  2IT1 A;  4YWM A;  1VQ7 A;  1YJ9 A;  4KHZ A;  3UE0 A;  1LUZ A;  1WJJ A;  3S24 A;  2MFI A;  2JE6 I;  1VQC A;  1KC8 C;  4DV1 Q;  3H0G G;  4L5S A;  4LUV A;  4QIW E;  4JBW A;  3CCU A;  2EXD A;  2LSS A;  3ER0 A;  3L2P A;  1HNZ L;  1EIY B;  5IT9 c;  3H0G H;  4JI3 Q;  1FJG L;  3I4O A;  4QL5 A;  4A3E G;  2L15 A;  2OCE A;  5IWA Q;  3BZC A;  4POG A;  4JI1 L;  1B7Y B;  1PA6 A;  4K0K L;  3AYH B;  2MNA A;  4LNQ A;  4A3K G;  5AJ3 Q;  4X64 Q;  4A3E H;  2B29 A;  2VQE L;  4DV7 L;  1JJG A;  4B3R L;  1YNX A;  3I56 A;  1OXX K;  3F1Z A;  1WFQ A;  4A3K H;  4GKK Q;  1K83 H;  1EOV A;  1VQG A;  4B3M L;  1EUJ A;  1G51 A;  4DNI A;  2RHQ B;  2FXQ A;  2CQO A;  2KCM A;  2HT1 A;  2NN6 G;  1C0A A;  2ZTC A;  4IO9 A;  4OX9 Q;  4X62 Q;  2KCT A;  1NJI C;  1C9O A;  5M5X H;  4OWX B;  5IE8 A;  1FGU A;  4B3S L;  1NY4 A;  1VS0 A;  3KJP A;  4DR5 Q;  1I94 L;  2YU9 H;  4IFD I;  3RLO A;  4NXN L;  2KHI A;  1HZA A;  3NBH B;  1VQ8 A;  2WFW A;  4DUZ L;  1JJC B;  2N3S A;  1YHB A;  4H02 A;  5DLQ E;  1WOC A;  4ME3 A;  3H15 A;  4DV0 L;  1YI2 A;  2UU9 Q;  1EQR A;  3PUX A;  3CC4 A;  2UUB Q;  2VL6 A;  2PQA B;  4LFA L;  1B70 B;  4YHH Q;  4JOI A;  3W5O A;  1JT8 A;  1BKB A;  3JAM i;  2JEA I;  1GVP A;  2LXJ A;  3HKZ E;  2R92 G;  2QA4 A;  4UY8 C;  4GLV B;  1VQF A;  4JI6 Q;  3ULJ A;  5LMN W;  1EIF A;  4DR4 Q;  4YCU A;  3SGI A;  1OXV A;  2VS1 A;  3AFP A;  2R92 H;  2WB1 G;  4JI2 L;  1YJN A;  2K5N A;  4DV2 L;  2MO1 A;  4PZ8 A;  4LF9 L;  4BA2 I;  2VNU D;  1VQI A;  2K50 A;  1I50 H;  3RLN A;  4JBJ A;  1RIP A;  3FKI G;  2UUC Q;  1I5F A;  4NB3 A;  4DR6 Q;  2NVY H;  3L7Z C;  1VQB A;  1X9N A;  1E24 A;  3KOJ A;  1VQE A;  5IYB G;  1BBW A;  2AWO A;  3FKI H;  2I5L X;  3I7F A;  3ERS X;  1PH9 A;  4YY3 Q;  3S14 H;  1VQD A;  3PGZ A;  4XIG S;  1WI5 A;  1JJ2 A;  4OON A;  5IYB H;  3K8A A;  1KRT A;  4HJ5 A;  3GTL H;  4IPC A;  5LMN Q;  3S1R H;  1SE8 A;  5C44 G;  4JI7 Q;  4GN3 B;  2AWN A;  3AEV A;  1UE7 A;  3KYH C;  4XTC S;  1IBK L;  2OQK A;  5C44 H;  1GD7 A;  4IPG A;  2OTL A;  3GTQ H;  1A63 A;  1RL2 A;  2OTJ A;  5FJ8 G;  1D8L A;  4DR7 L;  1X3G A;  3CC7 A;  3CME A;  1YBY A;  5JEA G;  4LF7 Q;  2QGQ A;  5C0X J;  4KLK A;  4GOP C;  5IYD H;  5FJ8 H;  2PI2 A;  3OW2 A;  3ICE A;  2ZM6 Q;  1KRS A;  1Y14 B;  4L5T A;  3Q8D A;  4C3I H;  4Y7N H;  4O2D A;  4DV4 L;  3RR5 A;  3CCV A;  4P72 A;  3ULL A;  1E7Z A;  1P16 A;  1ASZ A;  4B3T Q;  3GTG H;  5H1S E;  3J80 c;  2WB1 E;  3S2H H;  4MNO A;  1IBM Q;  4A3D H;  3RNU A;  1N32 L;  4JC0 A;  1HZ9 A;  2YTY A;  1S3O A;  3RN2 A;  3M9B A;  4MTN A;  1X55 A;  4DV3 L;  4DR1 L;  2UXB Q;  4JI4 L;  4L5Q A;  1MIU A;  1Q46 A;  2XGT A;  3T1H L;  2UUA L;  2JA5 G;  1XNQ Q;  2CWA A;  2R7F A;  3TRZ A;  1TWG H;  3BZK A;  4HID A;  3J80 i;  4IOC A;  1XMQ Q;  3STB C;  3G6E A;  4GN4 B;  1IL2 A;  1HR0 L;  1A0I A;  1X65 A;  4YCV A;  2HHH Q;  4LF6 Q;  3A5Z B;  2RCN A;  3RLF A;  4X66 L;  3NEL A;  5LMU L;  1PH1 A;  2JA5 H;  4A3I G;  4X6A H;  3AQQ A;  4JI8 Q;  3F2C A;  3OYY A;  4IPH A;  4LUO A;  1XPO A;  2NVX H;  4LF5 Q;  4NXM L;  1G6P A;  4A3I H;  3RZD H;  3KF6 A;  1PYS B;  3LGJ A;  3TRE A;  4YWL A;  5BR8 L;  2LXK A;  3KFU A;  2CFM A;  1VQP A;  4UP7 A;  1K0R A;  1HNW L;  1HZB A;  1V43 A;  3NEM A;  1XNR Q;  1UE5 A;  1CSQ A;  4HIK A;  4DR3 L;  1P8L A;  4KI0 A;  1HNZ Q;  4LF4 Q;  2F4V L;  4GNX B;  1T9H A;  3D0F A;  1VQN A;  2ZJQ A;  1FJG Q;  4DV5 L;  5C0X G;  1Z47 A;  4AYB G;  2NVQ H;  1OXT A;  2BA1 A;  2ATW A;  5E7N A;  4GKJ L;  3T1Y L;  4K0K Q;  2UXD L;  2N8N A;  1WCM G;  3CW2 C;  4JI5 L;  1Q1B A;  2VQE Q;  2ZTD A;  1CKM A;  4A4I A;  4DUY L;  1WCM H;  4HJA A;  3U58 A;  1VQ5 A;  4B3M Q;  3S1Q H;  4LUZ A;  5M3F G;  1XMO Q;  2GN5 A;  3M4Q A;  3BU2 A;  1QUQ A;  3J7Z C;  1VQH A;  2ALY B;  1N34 L;  5GAG C;  4POF A;  3KJO A;  3CCQ A;  2R6G A;  3OTO Q;  5M3F H;  1Q86 C;  1PH8 A;  2VQF L;  1PH4 A;  3HOV G;  3AFQ A;  4JYA L;  4B3S Q;  3E0E A;  3HOX G;  4JI0 Q;  4APV A;  2KBN A;  2DGY A;  3PUY A;  4BY7 G;  1N36 L;  3HOV H;  1JE5 A;  2C35 B;  1X3E A;  4QGU A;  4A3L G;  3F8T A;  4TQU S;  3HOX H;  4DV1 L;  2K5H A;  3J7A 5;  2AKW B;  4BY7 H;  2K75 A;  1L1O C;  3JAM c;  4DV0 Q;  3GTO H;  1UEB A;  3U4Z A;  4BXX G;  4GOP A;  4A3B G;  4KHP L;  4A3L H;  2VUM G;  4LFA Q;  4JI3 L;  1HJP A;  4UP8 A;  5EAY A;  5IWA L;  3E9H A;  1SN8 A;  2VY3 A;  3PCO B;  5JEA J;  4ALP A;  4BXX H;  4A3B H;  3GTM H;  5GAE C;  2VUM H;  1HNX Q;  2IHE A;  3HOW G;  2JA6 G;  5AJ3 L;  1J5E L;  4A3G G;  1R9T H;  2I0Q A;  4GN5 A;  4R4O A;  4QY7 A;  4A3M G;  4X65 Q;  3HOU G;  4LF9 Q;  2JA6 H;  1N33 L;  1AE3 A;  4RG1 A;  4YWK A;  4A3G H;  2E5L L;  3PUW A;  4IJH A;  4A3M H;  2OWO A;  1CUK A;  1GO3 E;  3DM3 A;  3HOU H;  3CCM A;  4YCW A;  4OX9 L;  1B8A A;  1YEZ A;  5GQO A;  4X62 L;  5C0X I;  5FLX c;  1KXL A;  1LM0 A;  3G4S A;  2JA7 G;  2EQS A;  1PFS A;  4DV6 Q;  4PZ7 A;  2Q2H A;  2RF4 A;  2JA7 H;  1VQL A;  2R93 G;  1SLJ A;  1SRU A;  2BH8 A;  3A74 A;  1UE6 A;  2IHF A;  4RMF A;  5J3B A;  1W3S A;  3I4N G;  3M4P A;  4HIO A;  2UU9 L;  1I6H H;  2R93 H;  4R4Q A;  5M5W H;  2CKZ B;  3EN2 A;  1W2B A;  2UUB L;  2NZH A;  1TWA H;  1UWV A;  3E9I A;  1EYG A;  1IBL Q;  3I4N H;  4YHH L;  1Y1W G;  4QQB X;  1O7I A;  3H3V H;  4JI6 L;  2YTX A;  2NN6 I;  3PUV A;  3VDY A;  4DR4 L;  4WJ4 A;  4UPA A;  1NMG A;  1HR0 W;  4IJL A;  1CSP A;  1L2F A;  2HQL A;  1XJV A;  1OTC A;  1L0W A;  3CQZ H;  4P75 A;  3PF4 A;  2Z6K C;  2DUD A;  1YVC A;  2Y0S G;  2UUC L;  4HIM A;  1E1T A;  1J6Q A;  3CCR A;  1VQJ A;  5M3M G;  1N32 Q;  3WWV A;  4O0A A;  1K3R A;  3S1N H;  1PV4 A;  1PH7 A;  3KLW A;  4YY3 L;  3UDF A;  5M5Y H;  4DV3 Q;  2JJQ A;  4JCV E;  4WJ3 M;  1K8A C;  2HIX A;  1CKN A;  4C3J H;  3M3Y H;  4LF8 Q;  2Q2U A;  2A19 A;  3G71 A;  1X3F A;  1Z9F A;  2E2I H;  3CPF A;  1FVI A;  3JC6 6;  2D0O A;  2B63 G;  1HR0 Q;  2WP8 J;  3MXN B;  1AH9 A;  4JV5 Q;  4JI7 L;  4PZ6 A;  3KDF A;  3KF8 B;  1KD1 C;  3GDE A;  3W1G A;  2B63 H;  1PYB A;  2ID0 A;  4MZ9 A;  2AMC B;  1IZ6 A;  1FL0 A;  1L1O A;  3IRB A;  1MKH A;  5GRO A;  4HJ8 A;  5C4J H;  2H5X A;  1YJW A;  5HGQ A;  1HNW Q;  1SMX A;  1A8V A;  1VCI A;  5JJI A;  4LFC Q;  2ZM6 L;  1E3P A;  4LFB Q;  3A5U A;  4DR3 Q;  4AQY L;  2EIF A;  3MEF A;  4P74 A;  2F4V Q;  2N78 A;  1BBU A;  1XPR A;  3B6Y A;  4HJ9 A;  3PO2 G;  4DR2 L;  4A75 A;  1EQQ A;  1A62 A;  2PNH A;  4BA1 I;  1JMC A;  4AIM A;  1VQM A;  2GVB A;  2ZTE A;  2UXD Q;  3PO2 H;  3GO5 A;  3CPW A;  4JI5 Q;  1V9P A;  3PV0 A;  1KHI A;  4IFD G;  2IX0 A;  3UDX A;  4JI1 Q;  2A1A A;  4DUY Q;  1X6O A;  5FLM G;  3PUZ A;  3U50 C;  2WAQ G;  4R4C A;  4DV7 Q;  4LF6 L;  1ASY A;  4B3R Q;  3KF6 B;  3GD7 A;  2E2J H;  3STB D;  5FLM H;  4JI8 L;  3PF5 A;  1TXY A;  3I2Z A;  1VQ6 A;  4GS3 A;  2CCZ A;  1QZG A;  5ELO A;  2UXC L;  4LF5 L;  1C7Y A;  2ES2 A;  2VQF Q;  1S72 A;  4R4I A;  1SFO H;  3TEH B;  4EQ5 A;  1E1O A;  1N36 Q;  3RN5 A;  3I4M G;  1Q12 A;  2YV5 A;  4LW1 A;  1K9M C;  3CXC A;  2R7Z G;  1K8G A;  3CMA A;  3S15 H;  1XNR L;  1I94 Q;  3I4M H;  3HKZ G;  1WYD A;  4DAY B;  3CCJ A;  4LF4 L;  4NXN Q;  4IOA A;  1TWH H;  2R7Z H;  4KHP Q;  3PO3 G;  4BBS G;  3M4O H;  4DUZ Q;  3GTP H;  2K5V A;  3K81 C;  1JB7 A;  3EBE A;  2Z6K A;  3UDI A;  3I55 A;  3S1M H;  3GTK H;  3PO3 H;  1N9W A;  2IX1 A;  4BBS H;  2Q2T A;  1J5E Q;  4P71 A;  1I3Q H;  2JA9 A;  1QUQ B;  3M7N A;  3A0J A;  4J15 A;  1N33 Q;  2PMZ E;  1Y1V G;  2PQA A;  4JG2 A;  2E5L Q;  4X64 L;  2CWP A;  3CAM A;  1PH3 A;  4AYB E;  2ASB A;  2NVT H;  1YHA A;  2MO0 A;  4JI2 Q;  1XMO L;  1TWC H;  1QVG A;  3HOW H;  4DV2 Q;  1Y1V H;  3J81 c;  4GKK L;  1GKH A;  2WAQ E;  4GNX C;  3K0X A;  1YZ6 A;  3OTO L;  1NBW A;  4BBR G;  2OQ0 A;  1LTL A;  2BA0 A;  2KHJ A;  4JI0 L;  3DLL A;  3PIO A;  3FP9 A;  1U0L A;  3CC2 A;  1YIT A;  1Q8K A;  3CP0 A;  4QJF A;  3GTJ H;  3F2D A;  4GOP B;  1U5K A;  4BBR H;  2A8V A;  1VQK A;  3CCL A;  4EX5 A;  3J81 i;  4DR5 L;  3UDG A;  1QZH A;  2Q2I A;  2YYZ A;  2JA8 G;  3TQY A;  4DAM A;  2E2H H;  3F2B A;  1MJC A;  3K80 C;  3W1B A;  1D7Q A;  2K52 A;  2JA8 H;  4OO1 G;  1HNX L;  1IBK Q;  2MQH A;  1CKO A;  1G29 1;  4BY1 G;  1KQS A;  1H95 A;  4DPG A;  2GVA A;  3UE1 A;  1EWI A;  5IP7 G;  4X65 L;  3U4V A;  3S2D H;  4DR7 Q;  4A76 A;  2KEN A;  4A93 G;  3NEN A;  4R4T A;  4BY1 H;  3HKS A;  1NE3 A;  1Y1W H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...