3HOZH

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
146
structure length
136
Chain Sequence
b'MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 19
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hozH00
4NXNL 4C2MH 4AQYQ 4DR2L 1SMXA 3T1YL 1JJ2A 1KRSA 1VQHA 1VQ5A 3I7FA 1VQKA 2IHEA 4YHHQ 1QVGA 3ER0A 5C4XH 3MXNB 1N36L 3FKIG 4LF8Q 4X65Q 2HHHQ 3JAMi 2UU9L 2JA9A 4LUVA 4DR5L 1M1KC 1Y14B 3MEFA 3PUXA 2YTVA 4A3BH 3HFZB 3CCQA 4L5TA 4L5SA 2EQSA 2N3SA 1TWGH 4X6AH 4DR4Q 3CD6A 4EQ5A 5C44H 1HJPA 3CAMA 4LUOA 3JAMc 4YWLA 1H95A 1NMFA 4LF6Q 1UE6A 5LMNW 4JI6L 1VQFA 4A3KG 1HNXL 3STBD 5M3FG 3PUZA 2RHSB 1IBKQ 1PYSB 1S3OA 2ZJPA 2E2JH 3K7AH 1FVIA 2LXJA 2E2HH 2IX1A 1UEBA 1C7YA 4JI4Q 4A3MH 4BBRH 4OWXB 3GDEA 1YVCA 1HNWQ 3OW2A 4APVA 3GTLH 4LFBQ 1VQPA 5GQOA 3BU2A 4GKJL 2PI2E 4JI0L 3LGJA 4A3IH 4DR6L 2IY5B 5FJ8G 4A93G 1G291 4LW1A 2B63H 2R7FA 5IYBG 4GKKL 2WAQG 2XTIA 3PO2G 1D8LA 4IFDG 5IWAL 4DUYQ 3RR5A 4DV7Q 4LF7Q 1MJEA 1SLJA 2KCMA 4BY1G 1I94L 1X3FA 4A3LG 2UXCL 3E9IA 1NJIC 4AYBE 4B3SQ 1AE2A 4A3DH 3HOYH 4FDBA 1Y1WG 1L1OB 2Q2HA 2ZM6L 3H0GH 4JI1L 2NVXH 4JI7L 1B8AA 4DR2Q 3T1YQ 3D31A 2K4KA 4DV3Q 3CQZH 2Q2UA 1HH2P 2Y0SE 3HOVH 2R93G 2IT1A 4IPDA 1N36Q 5HGQA 1KAWA 3VDYA 4P71A 1PH5A 3I4NG 3J7A5 4IOAA 2NVYH 4XTCS 2UU9Q 3AQQA 4AIMA 3D0FA 1EFWA 1PHJA 4AH6A 5IT9c 2VW9A 2D0OA 4P72A 5LMNL 2K14A 2MQHA 2JA5H 2JA7H 3NELA 1CSPA 3CCEA 4DNIA 2Q2IA 3T1HQ 2HQLA 1V43A 2ZJQA 4UY8C 1C0AA 4LF4Q 4TVAB 3STBC 1MJCA 3CMEA 3EN2A 2UUBL 2MNAA 2C35B 4GN4B 2E5LL 2FXQA 3PO3H 4DV5Q 1Q1BA 1YBYA 4GOPA 1PH8A 4YWMA 4HJ9A 1TWFH 1DGSA 3F8TA 1N34Q 1VS0A 4BBSH 4QJFA 1PVOA 1K0RA 1XMOQ 5C4XG 1EYGA 2JA6H 3I2ZA 1EUJA 2HIVA 3S2DH 4YY3L 3BZCA 2HIXA 4KHPQ 5LMUL 1UE7A 1VCIA 3F1ZA 1KC8C 4JI0Q 2HT1A 4QY7A 4L5RC 2F4VQ 3K80C 4GNXC 4JI5L 2R7DA 4GKKQ 2EXDA 2RCNA 3TQYA 3EBEA 5IWAQ 5C0XJ 5JEAG 1U5KA 1WJJA 2A1AA 1XMQL 3NEMA 2BA1A 3HOZH 4B3RL 2CCZA 2A8VA 5HY6A 3TREA 4JI2Q 1Q86C 1HNZQ 3NBHB 4P74A 3I55A 4PZ8A 4HJAA 4R4QA 1PH1A 4JI3L 1ASZA 4WJ3M 4JYAL 4DKAC 1Q8KA 1W3SA 2ID0A 3F2DA 2CKZB 3TS0A 1YITA 3PSIA 4GN3B 3OTOQ 5M5XH 3Q8DA 4KLKA 4A3FG 4AYBG 3G4SA 3S16H 1K8AC 2WFWA 4A3IG 3CPFA 3U58A 1NMGA 2GN5A 2I0QA 2Y0SG 3L7ZC 1TWHH 1PA6A 2B63G 4DV4Q 3KLWA 3GTKH 3GTPH 3RNUA 2OTLA 4HJ5A 5M5WH 3A5UA 2E5LQ 1BBWA 5IP7G 4MZ9A 4IPCA 4JCVE 5C0XI 3HOYG 3S1RH 3H0GG 1J6QA 4A75A 3HOVG 1CKNB 3J80i 4HIOA 5GADC 4GNXA 1XJVA 1N33L 1OXUA 4X62L 3RN2A 3KF6A 3DLLA 3K81C 1V9PA 1VQGA 1XNRQ 2VQEL 5IE8A 1P8LA 2K5NA 1PV4A 4A3JH 1LM0A 4YCUA 2JA5G 4DR3L 3KOJA 4A4IA 2JEBI 3RN5A 2NN6G 3ZJYC 3UDGA 1ASYA 4JI5Q 1K83H 2JA7G 1XPRA 3J80c 4QGUA 3TEHB 3CCMA 1NTGA 4DV2L 2B29A 1VQIA 3UDXA 1W2BA 3W5OA 3KDFB 3PO3G 2K50A 1YJ9A 5K36G 2Z6KC 4XIGS 1VQ7A 4OX9L 3TS2A 2NZOA 1JJGA 3J81c 2UUAL 5J3BA 3F2CA 4BBSG 2OCEA 4QIWE 1VQEA 3U4ZA 1A62A 5GAHC 4LFCL 3ICEA 1FJGL 1HZBA 4C3HH 1TWCH 4HJ8A 4OO1I 1WOCA 4POFA 4PZ6A 4DPGA 3S15H 1Q82C 4HIDA 1G51A 3PGZA 3HOUH 1M90C 1SROA 2IX0A 1HR0Q 1VQ8A 4GOPC 4KI0A 3M4QA 1EQRA 5M3MH 3H3VH 4B3ML 3CF5A 3A0JA 3KJOA 5FLMH 1MKHA 1VQMA 1A0IA 1IYJB 2Q2TA 4P75A 4R1JA 3HKSA 3M85A 2K5VA 3GTMH 3HOZG 3S1NH 2R6GA 1CKNA 2AHOB 4OWTB 1L2FA 3W1BA 4DV6L 4JI8L 1CKMA 4DR1L 1N33Q 1A8VA 5H1SE 1Y1VH 2LXKA 5BR8L 2K52A 2KHJA 4BA1I 4NXNQ 5GAEC 1JE5A 1SR3A 2VQEQ 1N32L 1LYLA 3CCVA 2E2IH 3GTQH 2Z6KA 2PI2A 3UDIA 1BBUA 2BA0A 4UP9A 4DR5Q 3AFQA 4IJHA 4DV2Q 3GTOH 1UWVA 1X54A 2K75A 2ZTCA 3AYHB 4JBJA 2QA4A 5IYDH 2YTYA 4O2DA 2UXBL 3ERSX 5JJLA 2JA8H 1GD7A 1QZGA 3HOXH 3UE1A 2KCTA 3TRZA 2UUAQ 4A3GH 1O7IA 2PQAB 4ALPA 1QUQB 4X64L 3HOWH 1L0WA 1JT8A 4JI6Q 1BKBA 2R92H 3PF4A 4Y52H 1HNXQ 1VQJA 2VQFL 1A63A 1VQ4A 3AEVA 1VQLA 1X3GA 4GLVB 1I50H 4YCVA 3CCUA 1OXXK 1VQAA 2H5XA 3PUWA 3J7ZC 3AFPA 2NVQH 1NE3A 4DAMA 3M4OH 3IRBA 1S72A 3SGIA 4LFAL 3CW2C 2I5HA 2QGQA 5C3EH 2VUMH 3F2BA 1OXSC 1YEZA 4DUZL 4H02A 4GKJQ 2PMZE 2AMCB 1QZHA 1Q1EA 2K5HA 4ME3A 1IBML 4DR6Q 1EIYB 1UE1A 3S24A 4YCWA 2YTXA 4JG2A 4DV6Q 4DV0L 5C44G 1WFQA 4DV1L 3OYYA 4B3TL 4NXML 4BY7H 5JJKA 1L1OA 2UUCL 4K0KL 2UXCQ 1T9HA 3CC7A 1YIJA 1I94Q 1QVFA 2ZTDA 1EIFA 4PG3A 3CCLA 4L5QA 4JI7Q 2ZM6Q 1IBLL 4JI1Q 2WB1E 3G71A 1X65A 2N8NA 5IY0A 4POGA 3HOUG 4QQBX 1J5EL 1N32Q 4AQYL 4A3MG 3KYHC 4Y7NH 1EOVA 4BBRG 2DUDA 4KHZA 1NY4A 5FLMG 4X65L 4LF8L 1VQOA 3PUVA 5LMNQ 2AWNA 3J81j 4HJ7A 2OQ0A 1E22A 4JOIC 2F52A 2HHHL 4QL5A 3CCRA 4IPGA 1NBWA 1FGUA 3FHWA 1SRUA 3I4MH 1XTDA 3BZKA 3PV0A 2NVTH 4WJ4A 3K8AA 4GN5A 1YNXA 2QEXA 1YHAA 4UPAA 2UUBQ 3E9HA 4DAYB 3H15A 1Y1VG 4A3DG 4RG1A 1IZ6A 3ULPA 3I56A 3GD7A 2I5MX 1Z9FA 2VQFQ 1PH9A 3DM3A 2JE6I 2ALYB 1WI5A 3CP0A 3K0XA 5C0XG 2ASBA 1Y1WH 2R7ZH 1IBKL 4R4TA 1TXYA 1B7YB 4LUZA 1EWIA 2KENA 4YY3Q 5LMUQ 3RLOA 4DUZQ 4R4OA 5M5YH 5IYDG 3GTJH 1OTCA 1HNWL 2JJQA 3J81i 1XPUA 2JA8G 2BH8A 3S2HH 2VZAA 1I6HH 3HOXG 1D7QA 1X55A 1Q81C 1YI2A 3KFUA 3HKZE 4B3RQ 3CCSA 2CWPA 4RMFA 4DV1Q 3M7NA 1P16A 4R4IA 4A3GG 1XMQQ 3HOWG 1CKOA 1U0LA 1HZAA 2YV5A 1GM5A 2GVBA 4DUYL 3CC2A 1K73C 3GTGH 3M3YH 4BXXH 4LF7L 1QVCA 1WCMH 4P73A 2OTJA 2L15A 1IBLQ 4LF5L 4JBMA 3CCJA 2OQKA 4LWCA 4B3SL 4JI3Q 4C3JH 1YHQA 1K8GA 4JYAQ 4JBWA 1UE5A 4JOIA 1J5EQ 3S1MH 3FP9A 2NN6I 2JA6G 4DV3L 1I5FA 5C3EG 2VUMG 2RHQB 3RZDH 1IL2A 1KIXA 2WP8J 4IFDJ 3PCOB 2WB1G 4OO1G 2ES2A 3NENA 5IYCH 1GVPA 4IPHA 4BY7G 2Z0SA 3L0OA 5FLXc 3KF8B 3T1HL 3PUYA 2OWOA 4LF4L 4LF9L 3EIVA 4GS3A 2BH2A 1X3EA 1RIPA 4DV5L 1XNRL 1YJWA 3A5ZB 2JQOA 3L2PA 1N34L 5DLQE 4A3EH 4A76A 4X62Q 1V1QA 4GOPB 3CPWA 2E8GA 3S1QH 1XMOL 4A3CH 1E3PA 1JB7A 1KL9A 1L1OC 2RF4A 4DR3Q 1R9TH 3G48A 4KHPL 4A3FH 2MFIA 3KDFA 2DGYA 1TWAH 3M9BA 3I4MG 4IFDI 1Q46A 2F4VL 1MIUA 5E7NA 5ELOA 1GO3E 3RZOH 1VQ9A 4JBKA 1YHBA 4LNQA 1XNQL 1Q7YC 4OX9Q 1SN8A 3BJUA 4DR7L 1PYBA 4DK3C 3U50C 4JC0A 1JMCA 2UXDL 2I5LX 3RLFA 5IP7H 4LF5Q 2AWOA 1HNZL 4JI2L 5C4JH 2D0PA 3WWVA 3G6EA 3HKZG 2EIFA 5IP9H 2F3IA 4LFCQ 2R7ZG 1FJGQ 1KRTA 1AH9A 1PFSA 1E1OA 1EQQA 3KJPA 4A3JG 3OTOL 3ULJA 4JV5L 1LTLA 1SE8A 2YU9H 5JEAJ 3K7UC 1WYDA 1G6PA 1VQDA 1VQCA 1SFOH 3W1GA 4B3MQ 3FKIH 1HZCA 1FL0A 4MTNA 4DV4L 1VQ6A 2XGTA 4A3BG 1E1TA 1N8RC 1K9MC 1JJCB 4LF9Q 1YJNA 4BXXG 5JJIA 4GLAC 1WCMG 1PH2A 3CMAA 1LUZA 2LSSA 3CXCA 4JI8Q 1KQSA 2CQOA 4IJLA 4OXPA 4IO9A 4DR1Q 1HR0W 5EAYA 1XPOA 2VL6A 5BR8Q 4X66L 3ULLA 1B70B 1OXVA 1C9OA 5ELNA 2KHIA 5AJ3L 4YWKA 4OWWB 1IXRA 4A3KH 1BVSA 2CFMA 4NPSA 2PNHA 1CSQA 2N49A 3E0EA 4DK6C 4EX5A 1VQBA 5M3FH 3A74A 4GNXB 2KBNA 1S40A 1GKHA 1OXTA 2CWAA 4R4CA 2YYZA 3GO5A 3KF6B 2VY3A 5M3MG 5IYCG 4YHHL 1YZ6A 1KHIA 4UP7A 4IOCA 2UXBQ 1CUKA 3I4OA 3PIOA 1XNQQ 4DR7Q 3UDFA 2UXDQ 2PQAA 1QUQA 4TQUS 4HIKA 2MO1A 3UE0A 1AE3A 5FJ8H 1PH6A 4A93H 4MNOA 5IYBH 2ATWA 4X64Q 3PO2H 4DR4L 2ZJRA 4C3IH 1Q12A 4O0AA 4GLXA 4A3EG 4BY1H 3H3VI 4LF6L 2N78A 2JEAI 2AKWB 4A3CG 4A3LH 2MO0A 2GVAA 2V1CC 3RLNA 1VQNA 1PH4A 4JV5Q 2ZTEA 2VS1A 1E24A 3JC66 1KD1C 4OONA 1Z47A 4LFAQ 2R93H 4JI4L 2WAQE 4NB3A 4HIMA 3B6YA 3CC4A 3I4NH 1X9NA 2A19A 1PH7A 1PH3A 1HR0L 1X6OA 1IBMQ 4LFBL 4UP8A 1E7ZA 4PMWA 1K3RA 4BA2I 2JK8A 1RL2A 4DV0Q 3S14H 4B3TQ 4NXMQ 5GROA 2VNUD 2UUCQ 4PZ7A 4K0KQ 2NZHA 5IP9G 1I3QH 2D62A 3PIPA 3M4PA 1HZ9A 4DV7L 2R92G 1X56A 4X66Q 5GAGC 3S17H 4J15A 3U4VA 1KXLA 3PF5A 2B3GA 5AJ3Q 1N9WA 2IHFA
chains in the Genus database with same CATH superfamily
5DEHA 5J39A 2DNEA 3T53B 4AQYQ 1PTOH 3T1YL 1KRSA 2NUCA 1STBA 1SEBD 2IHEA 1VQKA 1DOMA 5FK9C 3ER0A 3MXNB 4IUVA 2UU9L 3JAMi 3G6JB 1YNJC 1KDBA 1M1KC 3L3OC 2D2CC 4L5SA 2N3SA 4DR4Q 2A6EC 4EQ5A 3TP7A 3NSWA 1LTBD 3DWPA 4AYBB 5LMNW 4JI6L 2F1MA 2F0WA 1TWAB 4K8IA 1PYSB 1S3OA 2E2JH 3K7AH 2H4OA 1UEBA 2L0CA 4JI4Q 4A3MH 2B8GA 3OW2A 3SVMA 1EZ6A 3HOYB 1O7ZA 1EEID 1ZKOA 1TVXA 1SYGA 4A93G 4LW1A 1AN8A 2WAQG 2Q8TA 5IWAL 4K8JA 1RTOA 1EY6A 4AYBE 4A3DH 1LT3D 3H0GH 4JI1L 4DR2Q 3CQZH 3FDTA 1HH2P 4K2KA 1DM0B 2IT1A 2K04A 1PH5A 1KAWA 3DMUA 3MHBA 4P71A 5I9PA 3J7A5 4TRDA 4XTCS 3AQQA 4AIMA 1XWEA 1ET6A 5IT9c 2JA5H 2MQHA 3I90A 4HN7A 4KHVA 5BN4A 4BBSB 4DNIA 3K59A 2HQLA 3T1HQ 2ZJQA 1C0AA 4TVAB 3SXHA 1MJCA 3CMEA 2MNAA 4GN4B 2X6GA 3PO3H 5ELBA 3TMEA 4YWMA 1N34Q 2B2TA 1TY0A 1XMOQ 2JA6H 4HCSA 3QO2A 1EUJA 4KY6A 2HIXA 3HOZB 1VCIA 2HT1A 2E76C 3C46A 2F4VQ 4ZRZA 4JI5L 3UI2A 2BDOA 1U4LA 4GKKQ 2EXDA 2RCNA 5CV7A 1Z6HA 1XMQL 4QUCA 2BA1A 1DD2A 2CCZA 1F2YA 4JI3L 1ASZA 5ELCA 2NB0A 3F2DA 2IJ0A 2KUMA 4GN3B 2CHBD 3IAYA 4AYBG 3S16H 1B3AA 1BXTA 3L7ZC 1TWHH 3GTKH 1O78A 1SE3A 2OTLA 2RCFA 1IKMA 4N8X1 2E5LQ 1BBWA 2D9UA 4MZ9A 4IPCA 4JCVE 3HOYG 4CDFC 5FOBB 2EYOA 2X6LA 1AW7A 1K83B 3QG1A 4HIOA 3H09A 3RMHA 1OXUA 1T5XD 2XN9C 4N9TA 1XX8A 4X62L 3DLLA 1TS3A 3K81C 4HSPA 4HR7B 2VQEL 5IE8A 2K5NA 4YCUA 1JWSD 2EXZA 5C44B 3ZJYC 1ASYA 1E2WA 4QGUA 1S5FD 1VQIA 3KDFB 1TWCB 4KKUA 5K36G 1E2VA 3TS2A 4OX9L 2NZOA 1JJGA 5E4XA 3J81c 4BBRB 5J3BA 4IUPA 4BBSG 2OCEA 3A7AB 3U4ZA 4LFCL 1HZBA 4HJ8A 1WOCA 2F0MA 4POFA 1GHKA 4LMQD 4HIDA 3PGZA 2WACA 3P75A 1M90C 1SROA 1T5EA 1H9JA 1EQRA 1NAPA 4B3ML 5FLMH 4F8MA 2B2WC 4P75A 3GTMH 3HOZG 3OSOA 1DXMA 3S1NH 3T16A 4DV6L 1L2FA 2R61A 3NTKA 4JI8L 1H9SB 1CKMA 2NVYB 5C5LA 1I6VC 3M4YA 1NNXA 1EYCA 3NTIA 5C0XH 1N32L 1JCKB 2Z6KA 3HOWB 3GTOH 3V05A 3AYHB 4HAEA 1RDPD 2QA4A 2YTYA 2UXBL 1FNVA 4RHRA 1KDAA 3PMFA 5CMDA 3HOXH 2NBFA 1AEXA 4XQNA 4ALPA 1HFGA 3KLSX 4I7ZC 5C3EB 2VUMB 5CORA 1A3UA 4JI6Q 1JT8A 5CR3A 3AEVA 1VQLA 3CCUA 1OXXK 2N55A 3J7ZC 2NVQH 2TMPA 4X3SA 1NE3A 3M4OH 2I5HA 1QCBD 1OXSC 2L4NA 2AMCB 1QZHA 2RSNA 1B1ZA 1SDFA 2AQ2B 1X32A 2SNMA 1BUVT 5C44G 4BY7H 1Y8PB 1MSGA 3NWTA 1T9HA 1F77A 3CC7A 1YIJA 1QVFA 1EIFA 4L5QA 1IBLL 4JI1Q 1ENAA 5IY0A 1Z7TA 2H1EA 5DM63 4BBRG 1FD7D 2OEOA 3EROA 3J7AV 1RJTA 4NP5A 3PUVA 2AWNA 2OQ0A 2F52A 4QL5A 4ZYSA 1EOTA 4IPGA 3CCRA 1FGUA 3FHWA 3I8ZA 3PV0A 3BZKA 3DEPA 2NVTH 4WJ4A 1YNXA 2QEXA 2F0VA 2C9OA 1NR4A 4BS9A 5D14A 3NWSA 3I56A 4A3JB 1Z9FA 1PH9A 2AUKA 4K14A 3S2HB 4Q0FA 1B4OA 4FF3A 1I6HB 2R7ZH 4RKLA 5I2XA 2B8FA 2KENA 4P2CB 4A3BB 3K5LA 4R4OA 1TQOA 1VMCA 1HNWL 2JJQA 5I9OA 1JWMD 2RSOA 3C1EA 4U673 1X55A 1PRTF 4DV1Q 1XMQQ 1I4XA 5IGFA 3HOWG 2YV5A 4KD3A 1GM5A 2BCOA 3RZDB 3M3YH 4BXXH 4LF7L 1KNEA 2L15A 4ILWA 3QR8A 4JBMA 2OQKA 4JI3Q 4CDCC 1EFID 2MHVA 4JBWA 4G7ZC 2O5IC 1B2TA 5C3EG 3H3VC 5EPKA 3K5NA 2VUMG 2EYFA 1QE6A 2EY6A 4C56C 1ZXTA 3NENA 4A3EB 3PIO3 1ICWA 5ISRA 3VR6A 2OWOA 1FYCA 1X3EA 3MFGA 1NUCA 4DV5L 1R9TB 3A5ZB 1CQFA 5DLQE 1VDZA 5C3XA 4X62Q 3E5SA 2E8GA 3S1QH 4A3CH 1E3PA 3OMCA 1L1OC 1GUNA 4KHPL 1IKLA 2MFIA 2DGYA 4H13C 5KYIA 1TWAH 5C4JB 4ZKBB 1W6KA 4IZ8A 2PMZB 2PW7A 3HRZC 4LNQA 1XNQL 4O42A 4K5XA 4OX9Q 1II3A 1PZID 4JC0A 2AWOA 4EQOA 4H7BA 4LFCQ 1KRTA 1AH9A 1PFSA 1EQQA 2HUGA 3TP6A 4A3JG 3OTOL 3ULJA 4JV5L 1B9MA 2I07B 3K7UC 1VQCA 4B3MQ 3QOLA 3FKIH 4MTNA 1LTTD 3TBIB 1XYIA 4A3BG 1BQQT 1N8RC 2RQXA 2JXMB 1LV9A 2DN8A 3P7JA 5KNBA 4KMUC 1SYEA 4NDXA 4JI8Q 1KQSA 4IJLA 1XPOA 2VL6A 4X66L 1D2BA 1C9OA 1U9RA 5ELNA 1G2TA 5AJ3L 4KKSA 4A3KH 1BVSA 4ID6A 5M3FH 1L0YB 1VQBA 3A74A 4XXEA 3MZ5A 4R4CA 2YYZA 2VY3A 5IYCG 4BY1B 2UXBQ 1EY9A 1FR3A 1Q90A 5D3DA 2UXDQ 1QUQA 5CV4A 1CM9A 4ZUJA 2A73B 2F0IA 1EU4A 1PH6A 4MNOA 5IYBH 1B53A 1PFBA 2G9DA 3PQIA 2ZJRA 5TSSA 4DR4L 4A3EG 5CV5A 2MO0A 2V1CC 3RLNA 2QILA 2ZTEA 1SYCA 2VS1A 1A3VA 1BCPF 4JI4L 2PO4A 4HIMA 3B6YA 1PH7A 2WKCA 3TZDA 1MD2D 2L11A 1E7ZA 1HTLD 1IYUA 4PMWA 4M1UB 4BA2I 1RL2A 4C2MB 5GROA 4EGVA 2WKDA 3K58A 2VNUD 2OXPA 5C4XB 3M4PA 1X56A 4CJ2C 4J15A 1SE4A 3URYA 2K33A 2J4XA 1N9WA 1F9PA 1UNSA 4DR2L 1SMXA 1CA5A 5I6YA 2MJ8A 2RDGA 1TWGB 4RGTA 2CQAA 2FINB 3X3NA 2G5DA 5T1IA 4IUNA 3PUXA 4DAYA 1AZQA 3BS1A 2E2HB 1IW7D 1S5ED 5C44H 1HJPA 3ZYYX 5JEAH 3T51B 4YWLA 3GTLB 2IW3A 1VQFA 3BDLA 4G57A 3PUZA 1EIGA 4FF2A 2ZJPA 1SE2A 3Q0AA 1FVIA 2LXJA 3BVGA 2A6HD 4OWXB 2ZXRA 2FMMA 3GDEA 4BBRH 1HNWQ 1RD9D 4LFBQ 4APVA 2ENBA 1Q3LA 2EVBA 4DXGA 5GQOA 3BU2A 1VQPA 1EIHA 3LGJA 4A3IH 2NVXB 2G9HD 1G291 2B63H 4GKKL 1K0SA 1D8LA 4IFDG 4LF7Q 3EFXD 2HDLA 4BY1G 2UXCL 1I94L 2YU9B 2B2YC 2K5DA 3VA5A 2ZM6L 1B8AA 2K4KA 3NK9A 4JPBW 4OGQC 3AMUA 3HOVH 2E74C 3OHXC 4IPDA 1ENFA 5HGQA 2NVYH 1HFNA 1VMPA 4L8JA 1IW7C 3D0FA 5CC4A 4Z9CB 2M2LA 1ET9A 1AP0A 4AH6A 4P72A 2K14A 2JA7H 3CCEA 4UY8C 1V43A 4RHSA 1ILPA 3L9AX 3OWEB 2UUBL 2E5LL 2C35B 3S2DB 4DV5Q 3AU7A 1PLFA 2HD3A 2A6HC 1A15A 1TWFH 3CKIB 3N52A 3F8TA 2LMCB 4LAAA 1YNND 1K0RA 5C4XG 2HIVA 2L1BA 4KHPQ 5LMUL 1EQTA 3VR4A 1DONA 1KC8C 4XDXA 1PMRA 2L55A 2M00A 3FRPB 2R7DA 2M9VA 3MEHA 2RA4A 1U5KA 1WJJA 2ZT9C 2F0NA 1EYDA 2OT2A 4P74A 1I4HA 4HJAA 3GTPB 4WJ3M 5KNCA 2XWJB 2ID0A 2E75C 1YITA 5G3LF 3OTOQ 5M5XH 3G4SA 1M8AA 2FFKB 3U58A 3A56A 3S1RB 1GJXA 2I0QA 2SNSA 1QNUA 4HJ5A 4KJOA 5M5WH 1YNNC 4WJWA 5J22A 5C0XI 1SXTA 2B39A 1MGSA 2DNCA 3J80i 1XJVA 3A55A 4V190 3FMCA 4RCOA 4OEMB 4ZAIA 4OIJA 4N9PA 1PV4A 4J1MA 1SNOA 2ICEC 2K01A 4A3JH 1B50A 3KOJA 3UDGA 1MSHA 2EYLA 3TEHB 3CCMA 1NTGA 2VXWA 3UDXA 2JN4A 3W5OA 1W2BA 2O5JC 2NYZD 1LTRD 1YJ9A 2Z6KC 2IL8A 4PNYA 3S15B 3LNNA 3HOUB 2EJGC 3F2CA 4PQXA 1KABA 5IODA 5GAHC 4C3HH 2XNAC 5C4ZA 2HQEA 4DPGA 3MXPA 4CGYB 3CHBD 2Z4IA 5JPMC 4GOPC 3M4QA 1H9KA 1A3TA 3WOEA 1A0IA 1IYJB 1SNCA 3M85A 3HKSA 1TS2A 2K5VA 3AB9A 4ODGA 5EQ0A 2R6GA 1TS4A 4DGZA 1CKNA 4OWTB 3W1BA 1O7LA 3IFTA 1CHQD 5C5MA 1N33Q 5H1SE 1Y1VH 2K52A 2KHJA 1STAA 5GAEC 4RCNA 2E2IH 3R8BA 2K05A 2PI2A 4CJ1B 1BBUA 5E1FA 4WRDA 1GHJA 3D8GA 1X54A 2QEJC 1ESFA 5IYDH 3ERSX 3TSSA 3VYSA 2L9HA 2JA8H 2J0TD 1QZGA 3SK6A 4MHEA 3I91A 3SHLA 1ZEQX 3TRZA 5IGEA 2UUAQ 4A3GH 1QUQB 1L0WA 3PF4A 1VQJA 2WB1B 2QDLA 2ZXOA 1I50H 2H5XA 5J1ZA 5IT9E 3CW2C 4KY5A 1OO9B 3E6ZX 1YEZA 3BG3A 1Q1EA 3NBIA 1JB3A 4OO1H 4BWGB 1GUOA 1B3QA 3IKJA 5KGUA 4YCWA 2YTXA 4DV1L 4Y7NB 1BF4A 3OYYA 5JJKA 3FPPA 2UXCQ 1I94Q 2E2DC 2ZTDA 5C3WA 1G6ZA 4NW2A 3CCLA 2IWHA 2ZM6Q 2WB1E 3KUPA 4UHVA 1X65A 4POGA 3HOUG 3KYHC 1EOVA 1NY4A 2QDBA 4LF8L 4G7OC 3J81j 4HJ7A 2HHHL 3MWYW 4IQZA 3SE0A 1WTRA 1SRUA 4KJNA 3I4MH 1XTDA 4KD4A 4UPAA 2UUBQ 5T1GA 1UUPA 2KA7A 4DAYB 4GZYC 1IZ6A 2VQFQ 3DM3A 2ALYB 2Z4HA 3CP0A 2EE1A 3SEBA 3T4AC 2ASBA 3BYYB 1IBKL 1D1IA 4EVOA 4R4TA 1TXYA 1JWUD 5LMUQ 4DUZQ 5M5YH 3GTJH 3MFYA 1WCMB 1L0XB 4TKOB 4DU9A 4QB4A 4C3JB 1YI2A 3S1MB 3JAML 1H9MA 4RMFA 3M7NA 1JR0D 1SJED 1GXDC 1HZAA 1U0LA 5EGTA 2GVBA 3TDQA 3GTGH 1K73C 4P73A 3ITPA 4LWCA 3W2DA 2XSCA 1K8GA 5M3MB 1UE5A 4JOIA 3FP9A 4DV3L 3HZXA 1I5FA 4C1NK 1ZYRD 2RHQB 3SR1A 1LT6D 1STHA 4IFDJ 2WB1G 1A6XA 4ME5A 1GVPA 3L0OA 4K2LA 2EDGA 1RTNA 4LF4L 4GS3A 2BH2A 1RIPA 1YJWA 3T56B 3Q22A 2JQOA 5EPLA 2QF7A 3A54A 2JYOA 3K0YA 3CPWA 5FO7B 2Z1CA 1STEA 3G48A 1EQVA 5EKKA 1QNKA 3M9BA 1Q46A 5ELOA 4S3SA 1VQ9A 4JBKA 2R92B 1DZ1A 2KHSA 3BJUA 4DK3C 2UXDL 4ZCKA 2Z6BA 4OHJA 4UAIA 1HNZL 1KTKA 4JI2L 5FO8B 1ZYRC 2D0PA 4X3UA 3WWVA 1V1PA 2EIFA 2F3IA 3ONAB 3KJPA 2YU9H 4LK1C 4XT3B 1G6PA 3KF8A 1BOSA 1G2SA 1FL0A 2IPKD 2NTTA 2XGTA 3W3AA 1E1TA 5JJIA 1X3QA 1PH2A 1WCMG 1LUZA 3VA7A 3CXCA 4C3JG 1GUGA 2CQOA 5EAYA 2QW7A 3ULLA 5CV9A 2EYMA 1IXRA 3HP3A 4NPSA 2CFMA 1LTAD 3E0EA 2N49A 1XNRL 4MTKA 5A35A 1GKHA 1IYVA 5M3MG 3PO2B 3GQBA 4EQNA 4UP7A 2F0LA 4IOCA 3I72A 5NUCA 3UDFA 2PQAA 1Y1WB 4FXDA 4A93H 2R93B 2ZXPA 4QF4A 5IGDA 2Z9HA 2LY7A 3I4NB 3BVMA 3H3VI 2JEAI 1ONLA 4FVMA 3DWQA 3S14B 4NB3A 3CC4A 2A19A 2DJGC 2JSOA 1X6OA 4LFBL 3S17B 4UP8A 1D5XC 2B2VA 3MXGA 3MTSA 1PTOB 2NZHA 4OL7A 1I3QH 5IP9G 3PIPA 3BDOA 1WTWA 2R92G 4IUTA 5FKAC 3BYTB 2KEEA 4NXNL 4KK7A 3LWEA 1JJ2A 2MUYA 1VQHA 3I7FA 2EYJA 2FHTA 3J80E 1SAPA 2K32A 4LF8Q 2HHHQ 2JA9A 2D5DA 1Y14B 1HUNA 3HFZB 3CCQA 2E2JB 4L5TA 3K7AB 3VYUA 4X6AH 3WOFA 3CD6A 3CAMA 4UDUC 3OIQA 4LUOA 3JAMc 1H95A 1PFMA 4LF6Q 1UE6A 4A3FB 4HSVA 1D1KA 3STBD 1EY4A 1IBKQ 2LS01 4R9WA 5F2DA 4CBVA 1D5ZC 2IX1A 2EPBA 3K5MA 1EY0A 5EKIA 5LL6X 5JPNC 4NKLA 1LT4D 4B08A 2PI2E 3C1FA 3H0GB 3BDCA 2EZVA 5FJ8G 2BOSA 3I3CA 3PO2G 1TU2B 2MGSA 1BR9A 4DV7Q 5K5PA 1MJEA 1X3FA 4A3LG 3DEOA 1LTID 1AE2A 3HOYH 4FDBA 1Y1WG 1SFOB 2JA5B 1EU3A 1U4RA 4DV3Q 5DAUA 2Q2UA 3P20A 4EQPA 2R93G 1R4PB 5EBDA 1N36Q 3I4NG 4IOAA 3PO3B 1HTPA 1PZKD 1PHJA 2D0OA 3BVZA 3O13A 2PPBC 1CSPA 4LF4Q 3STBC 1I4QA 1S5BD 5EKLA 1ICFB 3MXUA 2FXQA 3V2TA 4G7HC 5K36H 5COYA 1E0BA 1Q1BA 1YBYA 1F9RA 1TS5A 2A68D 2Q8IB 1VS0A 4XQJA 4BBSH 1K3BC 1PVOA 1WD0A 1EYGA 1QG7A 1PTOD 4H0LC 3BZCA 3A8JE 1UE7A 4JI0Q 4QY7A 1SMYD 5IGGA 4L5RC 4C3IB 1PDQA 4DAVA 3G7LA 3TQYA 3GV3A 3NEMA 4B3RL 1SJHD 3HOZH 2A8VA 2EJMA 3TREA 4JI2Q 4CKEA 1HNZQ 3S16B 5A2QE 3I55A 3OMGA 4PZ8A 2QCPX 4R4QA 1U4PA 1PH1A 3GTKB 1TWHB 4JYAL 4DKAC 1Q8KA 2K28A 1GUWA 2CKZB 1K8MA 5E3FA 2PYKA 3PSIA 3Q8DA 4KLKA 4X3TA 4A3FG 1K8AC 2WFWA 1NMGA 2GN5A 3C3LA 1PA6A 3KLWA 4C1NI 1A2TA 3F2UA 2A68C 4FXGC 2L12A 1O7YA 3U9SA 4KN4C 3DWAA 1CTMA 2FJ2A 3H0GG 1PTOC 2F0QA 4A75A 4QIWB 1N33L 4GNXA 1SMYC 1SNQA 3RN2A 3KF6A 1Y69U 1XNRQ 1P8LA 1TR5A 1LM0A 2PZWA 3ERQA 4M8AA 2JA5G 3RN5A 2NN6G 1K83H 5IIFA 2F03A 2F0OA 3HEJA 2B29A 2PCFB 3PO3G 3E0JA 1SYDA 1VQ7A 4ZLTF 1FGBD 5IOCA 2KCCA 1C8CA 1FNUA 4QUFA 1WTOA 2UUAL 1KLUD 4QIWE 1VQEA 3TP8A 3ICEA 1FJGL 1TWCH 1TT2A 4OO1I 5BN3A 3GTMB 1FNWA 1I4GA 1K28A 1Q82C 3HG9A 1VQ8A 4KI0A 2F0GA 3D4WA 3D6WA 5FLXE 5M3MH 3H3VH 2B2TC 1HPCA 3A0JA 3KJOA 1LACA 1MKHA 4K6DA 2Q2TA 1AZPA 4DFAA 1XTCD 4WORA 4R8IA 4XYQA 4C3IG 4RWSC 1PFNA 5IGBA 1F9QA 3FPUB 3KBGA 3TN2A 3GTOB 2LXKA 2DY8A 4FNFA 5BR8L 4BA1I 4NXNQ 1Y8OB 1TKWB 1CQVA 3NHHA 3HOXB 3CCVA 1CI3M 2EY2A 4RGNA 3UDIA 1KLGD 2BA0A 3BZDB 3AFQA 4IJHA 1NCVA 4DV2Q 2LFNA 2ZTCA 4O2DA 5JJLA 1KAAA 3UE1A 2KCTA 3M4OB 1O7IA 2PQAB 3SK4A 1CFMA 2BDNA 3HOWH 1BKBA 2A69D 3D4RA 3U9OA 2R92H 2I46A 2VQFL 1X3GA 4GLVB 5FO9B 4YCVA 1VQAA 1HQMC 3AFPA 4L6TB 5I2YA 4DAMA 1PXUA 1JE4A 4BY7B 4LFAL 5C3EH 2QGQA 2SDFA 4DUZL 2VUMH 4ME3A 1IBML 1RODA 4HEDA 1EIYB 3OIPA 3QWNA 1F9SA 3DHQA 4DV0L 1WFQA 2V4DA 2CW0D 4NXML 1L1OA 2UUCL 4K0KL 3IL8A 4TSSA 5JAVA 1WTQA 3G71A 1M4VA 1EY5A 2WINB 1LTSD 2N8NA 5IGCA 4QQBX 2NVTB 4V0BA 2F0UA 2DUDA 3QOJA 4FF1A 4I7AA 4HMJA 4X65L 5FLMG 1VQOA 4FF4A 2RKSA 4MIUA 1E22A 1RKNA 3OWFA 4JOIC 4XT1B 1NBWA 4PMBA 3OPOA 3HKZB 2A69C 3K8AA 2R7ZB 1YHAA 3E9HA 3J7AF 3Q24A 3VYTA 1UAPA 4RG1A 4XQQA 3GD7A 2I5MX 4ULLA 2JE6I 3K0XA 2KOLA 2KQ3A 5C0XG 5ELDA 1Y1WH 4CKBA 5CGKA 2VB3X 4LUZA 1EY8A 3VR3A 1F2MA 3RLOA 3M3YB 4KV6A 1KNAA 2CW0C 3S2HH 2K1BA 2BH8A 3VYRA 2VZAA 1I6HH 3KK7A 3HOXG 1C48A 1Q81C 2TSSA 3HKZE 3TZUA 1S5DD 2DY7A 3NBHA 2B2UA 4A3BH 1CKOA 4B3RQ 2HCCA 4DUYL 1JICA 1QVCA 5M9OA 2EY5A 3CCJA 4B3SL 3NQIA 4JYAQ 1J5EQ 1HA5A 3J7YW 3OOCA 1R4QB 4F7XA 3RZDH 2WP8J 4B9WA 2ES2A 5C4HA 2EJFC 5CV8A 5IYCH 4BY7G 2L5TA 3R93A 3S1QB 1SYBA 1VF5C 3EIVA 1WTHA 4RGMA 4E6IA 5KIXA 3GTQB 5C6AA 3A8IE 3L2PA 4A3EH 2RVLA 2KJXA 2XVSA 1JB7A 1R9TH 1RCVD 3GP7A 4A3FH 4DN4M 2PQEA 3A8KE 5LL6S 2P5ZX 4IALA 1GO3E 2F0HA 1YHBA 3DXJC 3Q6SA 1B44D 2HDMA 1MI2A 3H94A 1PYBA 3NPPA 4K5VA 3RLFA 4LF5Q 5C4JH 3HKZG 2R7ZG 1G91A 1FJGQ 3FKIB 4IURA 2RBMA 4RH6A 3DM1A 5EPJA 1SE8A 4JW0A 1SFOH 3W1GA 2NN6H 4DV4L 1VQ6A 3EA6A 4LF9Q 1JJCB 1YJNA 4BXXG 4A3KB 1CZWA 5M3FB 1EZ8A 2XRQD 2OF1A 2B2VC 4ZK9B 5BR8Q 5I6WA 1BDOA 4OWWB 2AUJD 3MC0B 2PNHA 1S72A 4GNXB 1QVGA 2KBNA 2CWAA 3KF6B 3GO5A 3X3MA 3P1HA 1YZ6A 2B2YA 1PRTB 2RDFA 2XWBB 4K5WA 3N6RA 5ELEA 3I4OA 3PIOA 4DR7Q 4TQUS 4HIKA 3UE0A 1AE3A 1CK1A 1KDCA 4ZQ3A 1DOLA 1EWCA 1SBBB 4IFDH 4C3IH 5CYUA 4GLXA 4O0AA 4BY1H 4LF6L 2F3VA 2LKVA 4A3CG 1PH4A 1KD1C 1E24A 4MN3A 3J80L 4OONA 1Z47A 4LFAQ 4KY7A 5EJWA 2WV6D 1HR0L 1IBMQ 3MA2B 3FVQA 2JK8A 4DV0Q 4HTHA 4B9XA 4I65A 3E3XA 4NXMQ 2UUCQ 4PZ7A 4K0KQ 4DV7L 2N88A 3U4VA 3PF5A 2B3GA 2IHFA 1NR2A 4KTAA 4C2MH 1JOQA 1VQ5A 3NE5B 4LJZC 4YHHQ 5C4XH 1QB5D 1N36L 3FKIG 1LTGD 4X65Q 1WD1A 4LUVA 4DR5L 1QWYA 3I70A 3MEFA 3I73A 1JQYD 2YTVA 5E4WC 3J81E 2EQSA 1TWGH 1HRJA 2NZ1D 3VR5A 3A7LA 4OIKA 1NMFA 5CV6A 4A3KG 4A3IB 1HNXL 5M3FG 2RHSB 3RZOB 2ICIA 1PZJD 2K5QA 2Y0SB 2B63B 2E2HH 4X3KA 1C7YA 1YVCA 4JVZA 3GTLH 1SNMA 4GKJL 4JI0L 1J9OA 4DR6L 2IY5B 4H44C 1XXGA 1BBXC 1ESRA 2R7FA 5IYBG 3HOVB 2XTIA 4DUYQ 4CHTB 3RR5A 1SLJA 2KCMA 2SEBD 3E9IA 1NJIC 1RHPA 4B3SQ 1S5CD 4JI7L 1L1OB 2Q2HA 2NVXH 1PRTD 5ELFA 3T1YQ 3D31A 2BE5D 2Y0SE 2JA7B 3CRKC 4CDEC 3VDYA 3GV6A 2UU9Q 3NP8A 2K03A 1EFWA 1EEFD 2VW9A 5LMNL 1TWFB 4DK1A 3CRLC 3NELA 3D4DA 2Q2IA 3I4LA 1WTPA 3EN2A 4PMCA 1IHZA 3SDZA 5A2QL 3MVVA 3KLSA 1GOZA 4GOPA 1PH8A 4HJ9A 1WTVA 2MP1A 1DGSA 1DOKA 1BCPB 4QJFA 5I4DA 3WDNA 2PZTA 3I2ZA 1CA6A 3S2DH 4YY3L 4CKCA 4O1NA 3F1ZA 5BN5A 3K80C 4QMGA 4RGOS 4GNXC 3QJYA 1U4MA 1Y8NB 4K6LA 3EBEA 1PRTC 5IWAQ 5C0XJ 1WTXA 2C5CA 3D6CA 2A1AA 5JEAG 2AQ1B 2BE5C 5M5XB 2AQ3B 5HY6A 1Q86C 3NBHB 4OELB 2FMCA 1EL0A 4DAPA 1W3SA 3TS0A 5M5WB 1HQRD 1RF2D 3EQLC 4A3IG 3CPFA 2A5HA 2Y0SG 3CU7A 3GTPH 1D6EC 2B63G 4DV4Q 3RNUA 4DF7A 3A5UA 4PV1C 5KNDA 5IP7G 4RFBA 3SK5A 1BNZA 3S1RH 1J6QA 3HOVG 1CKNB 1F2LA 2QKIC 5GADC 3R3OA 3Q23A 4F87A 1V9PA 1VQGA 2K5WA 4DR3L 1LABA 2F0SA 5FLXL 4A4IA 2JEBI 1JORA 1G8ZD 4JI5Q 2JA7G 1A2UA 1GUSA 1XPRA 3J80c 4DNRB 4DV2L 4C3HB 4KN7C 2K50A 2KVMA 4XIGS 1H9RA 3OW7A 4A3MB 4HCEA 4FXKC 3C2PA 1K8OA 1A62A 1LO5D 1HXYD 3EJIA 4PZ6A 1HUMA 3S15H 1O80A 1CZGA 1G51A 3HOUH 2KEDA 2EYPA 2IX0A 1HR0Q 1J8IA 4IUUA 3CF5A 1Y1VB 1VQMA 4A3DB 4R1JA 3LWUA 3JAME 1BCPD 2A74C 3DUZA 3CQZB 3D3RA 2AHOB 2F0EA 2E2IB 2F0PA 2EY1A 4DR1L 1GUTA 1A8VA 1MHWC 2CH4W 1HHVA 3QB3A 3MXNA 1STGA 1JE5A 1SR3A 2VQEQ 2JA8B 1LYLA 3GTQH 5L37A 3V96A 4A3GB 4UP9A 4DR5Q 2SOBA 1UWVA 1W6JA 2K75A 4JBJA 2PW5A 3NTHA 1GD7A 1I50B 3NXWA 1SNPA 2RDHA 1QILA 2J7ZA 2JA6B 1E2ZA 5JVG3 4X64L 3LX0A 4Y52H 1A63A 5CBAE 1HNXQ 1VQ4A 2F3WA 4CDDC 2B2WA 3PUWA 1DCZA 1D5MC 4RKBA 3SK8A 3IRBA 3SGIA 1BCPC 1DJRD 1ILQA 1QOHA 2NTSA 5JJZA 3F2BA 5EBCA 3EVQA 4H02A 4GKJQ 1BO0A 2PMZE 2K5HA 4DR6Q 1UE1A 3S24A 4JG2A 4DV6Q 4B3TL 1UEAB 1HA6A 2K6AA 4DK0A 4C3HG 4PG3A 5HURA 4JI7Q 4FYDA 1STNA 2IX3A 4Q5VA 4DXFA 2B2UC 3I4MB 1J5EL 1N32Q 4AQYL 4A3MG 4Y7NH 1QJOA 4KHZA 2NWGA 5KEEA 2XIWA 5LMNQ 3K5OA 2F0DA 4GN5A 3H91A 3H15A 1Y1VG 4A3DG 3ULPA 5M5YB 3GTJB 3ND8A 2HCIA 2X69A 1WI5A 2F0JA 5JVH3 2K7VA 4ZUIA 1B7YB 5D3IB 1EWIA 4NMZA 4YY3Q 4J6HA 3GTGB 1TY2A 2CH4A 2XRSD 5IYDG 1OTCA 1I4PA 3H6MA 3RD4A 1V8QA 3J81i 1XPUA 2JA8G 4FO2A 1ENCA 1EWHA 2VB2X 1D7QA 3KFUA 3CCSA 2CWPA 1DYQA 4A3GG 1P16A 4R4IA 3HS0C 3CC2A 4QCLA 1WCMH 2OTJA 1IBLQ 4LF5L 4C3JH 1YHQA 3S1MH 4ABNA 1LLRD 2NN6I 2JA6G 1V1PB 3KLRA 1EY7A 2F0TA 3S1NB 1IL2A 2F4IA 1KIXA 3PCOB 2Q8RE 4OO1G 3VR2A 1X3PA 1TIID 1SYFA 4IPHA 5G3LD 2Z0SA 5FLXc 3KF8B 3T1HL 4ZKCB 3PUYA 4LF9L 1AFPA 1PTOF 2MPMA 4N8FA 1SSOA 1CHPD 1N34L 4A76A 1V1QA 4GOPB 5IT9L 1XMOL 4JK1C 1KL9A 2RF4A 4DR3Q 4IN3A 1Q8IA 4J8QA 2F0KA 2R3ZA 3KDFA 2KCNA 4HMIA 3I4MG 4IFDI 2PZUA 2F4VL 1MIUA 5E7NA 4IUQA 3RZOH 3QIAA 1Q7YC 1LT5D 4DR7L 1SN8A 5JOBA 3U50C 1JMCA 4RA8A 2NVQB 2I5LX 5IP7H 4KKTA 2PNRC 1WVLA 1B9NA 3G6EA 3PIP3 5IP9H 2KECA 5KRUA 4DA2A 1E1OA 3S9WA 3R2TA 1MBYA 1LTLA 5JEAJ 1WYDA 5CBEE 1SNDA 1VQDA 1IL8A 2Z8LA 1HZCA 4FP5D 4WFN3 3IFDA 3MAQA 3NQTA 1K9MC 5D65A 4YIJA 1H9SA 4GLAC 3TP5A 4U68A 3T13A 3CMAA 1EYAA 3RUZA 2LSSA 4OXPA 4IO9A 1HR0W 4DR1Q 3ND9A 1ML0D 1B70B 1I4RA 1OXVA 3FEWX 4RAUC 2KHIA 4YWKA 1JOKA 2WIIB 4DK6C 1CSQA 4EX5A 1S40A 2F0FA 5KYLA 4A93B 1OXTA 2O2LD 4YHHL 1C4QA 2WAQB 3K6OA 5DM73 1JOOA 4G4KA 4CJ0B 1KHIA 3KBXA 1HCZA 1CUKA 2CVRA 1XNQQ 5LHY1 3M7GA 3K57A 2MO1A 5DNFA 1PYWD 5FJ8H 1F2ZA 1STYA 1YNJD 2DJFC 2ATWA 1S4ZA 4X64Q 3PO2H 1Q12A 3HGBA 4R8NA 5HGTA 2O4XA 2N78A 4A3LH 2AKWB 3NUCA 2EOTA 2GVAA 1VQNA 2A6ED 4JV5Q 3JC66 4XYOA 2R93H 2GA4B 2WAQE 1I3QB 3I4NH 1X9NA 1PH3A 3J81L 3R2IA 1K3RA 4DNTB 1NSNS 1VF7A 1CT1D 3S14H 4B3TQ 1V1OA 1JC7A 5AFWA 2D62A 1HZ9A 4X66Q 2EYHA 2JP1A 4L63B 5GAGC 3S17H 4F88A 1KXLA 5AJ3Q
chains in the Genus database with same CATH topology
4NXNL 4C2MH 4AQYQ 4DR2L 1SMXA 3T1YL 1JJ2A 1KRSA 1VQHA 1VQ5A 3I7FA 1VQKA 2IHEA 4YHHQ 1QVGA 3ER0A 5C4XH 3MXNB 1N36L 3FKIG 4LF8Q 4X65Q 2HHHQ 3JAMi 2UU9L 2JA9A 4LUVA 4DR5L 1M1KC 1Y14B 3MEFA 3PUXA 2YTVA 4A3BH 3HFZB 3CCQA 4L5TA 4L5SA 2EQSA 2N3SA 1TWGH 4X6AH 4DR4Q 3CD6A 4EQ5A 5C44H 1HJPA 3CAMA 4LUOA 3JAMc 4YWLA 1H95A 1NMFA 4LF6Q 1UE6A 5LMNW 4JI6L 1VQFA 4A3KG 1HNXL 3STBD 5M3FG 3PUZA 2RHSB 1IBKQ 1PYSB 1S3OA 2ZJPA 2E2JH 3K7AH 1FVIA 2LXJA 2E2HH 2IX1A 1UEBA 1C7YA 4JI4Q 4A3MH 4BBRH 4OWXB 3GDEA 1YVCA 1HNWQ 3OW2A 4APVA 3GTLH 4LFBQ 1VQPA 5GQOA 3BU2A 4GKJL 2PI2E 4JI0L 3LGJA 4A3IH 4DR6L 2IY5B 5FJ8G 4A93G 1G291 4LW1A 2B63H 2R7FA 5IYBG 4GKKL 2WAQG 2XTIA 3PO2G 1D8LA 4IFDG 5IWAL 4DUYQ 3RR5A 4DV7Q 4LF7Q 1MJEA 1SLJA 2KCMA 4BY1G 1I94L 1X3FA 4A3LG 2UXCL 3E9IA 1NJIC 4AYBE 4B3SQ 1AE2A 4A3DH 3HOYH 4FDBA 1Y1WG 1L1OB 2Q2HA 2ZM6L 3H0GH 4JI1L 2NVXH 4JI7L 1B8AA 4DR2Q 3T1YQ 3D31A 2K4KA 4DV3Q 3CQZH 2Q2UA 1HH2P 2Y0SE 3HOVH 2R93G 2IT1A 4IPDA 1N36Q 5HGQA 1KAWA 3VDYA 4P71A 1PH5A 3I4NG 3J7A5 4IOAA 2NVYH 4XTCS 2UU9Q 3AQQA 4AIMA 3D0FA 1EFWA 1PHJA 4AH6A 5IT9c 2VW9A 2D0OA 4P72A 5LMNL 2K14A 2MQHA 2JA5H 2JA7H 3NELA 1CSPA 3CCEA 4DNIA 2Q2IA 3T1HQ 2HQLA 1V43A 2ZJQA 4UY8C 1C0AA 4LF4Q 4TVAB 3STBC 1MJCA 3CMEA 3EN2A 2UUBL 2MNAA 2C35B 4GN4B 2E5LL 2FXQA 3PO3H 4DV5Q 1Q1BA 1YBYA 4GOPA 1PH8A 4YWMA 4HJ9A 1TWFH 1DGSA 3F8TA 1N34Q 1VS0A 4BBSH 4QJFA 1PVOA 1K0RA 1XMOQ 5C4XG 1EYGA 2JA6H 3I2ZA 1EUJA 2HIVA 3S2DH 4YY3L 3BZCA 2HIXA 4KHPQ 5LMUL 1UE7A 1VCIA 3F1ZA 1KC8C 4JI0Q 2HT1A 4QY7A 4L5RC 2F4VQ 3K80C 4GNXC 4JI5L 2R7DA 4GKKQ 2EXDA 2RCNA 3TQYA 3EBEA 5IWAQ 5C0XJ 5JEAG 1U5KA 1WJJA 2A1AA 1XMQL 3NEMA 2BA1A 3HOZH 4B3RL 2CCZA 2A8VA 5HY6A 3TREA 4JI2Q 1Q86C 1HNZQ 3NBHB 4P74A 3I55A 4PZ8A 4HJAA 4R4QA 1PH1A 4JI3L 1ASZA 4WJ3M 4JYAL 4DKAC 1Q8KA 1W3SA 2ID0A 3F2DA 2CKZB 3TS0A 1YITA 3PSIA 4GN3B 3OTOQ 5M5XH 3Q8DA 4KLKA 4A3FG 4AYBG 3G4SA 3S16H 1K8AC 2WFWA 4A3IG 3CPFA 3U58A 1NMGA 2GN5A 2I0QA 2Y0SG 3L7ZC 1TWHH 1PA6A 2B63G 4DV4Q 3KLWA 3GTKH 3GTPH 3RNUA 2OTLA 4HJ5A 5M5WH 3A5UA 2E5LQ 1BBWA 5IP7G 4MZ9A 4IPCA 4JCVE 5C0XI 3HOYG 3S1RH 3H0GG 1J6QA 4A75A 3HOVG 1CKNB 3J80i 4HIOA 5GADC 4GNXA 1XJVA 1N33L 1OXUA 4X62L 3RN2A 3KF6A 3DLLA 3K81C 1V9PA 1VQGA 1XNRQ 2VQEL 5IE8A 1P8LA 2K5NA 1PV4A 4A3JH 1LM0A 4YCUA 2JA5G 4DR3L 3KOJA 4A4IA 2JEBI 3RN5A 2NN6G 3ZJYC 3UDGA 1ASYA 4JI5Q 1K83H 2JA7G 1XPRA 3J80c 4QGUA 3TEHB 3CCMA 1NTGA 4DV2L 2B29A 1VQIA 3UDXA 1W2BA 3W5OA 3KDFB 3PO3G 2K50A 1YJ9A 5K36G 2Z6KC 4XIGS 1VQ7A 4OX9L 3TS2A 2NZOA 1JJGA 3J81c 2UUAL 5J3BA 3F2CA 4BBSG 2OCEA 4QIWE 1VQEA 3U4ZA 1A62A 5GAHC 4LFCL 3ICEA 1FJGL 1HZBA 4C3HH 1TWCH 4HJ8A 4OO1I 1WOCA 4POFA 4PZ6A 4DPGA 3S15H 1Q82C 4HIDA 1G51A 3PGZA 3HOUH 1M90C 1SROA 2IX0A 1HR0Q 1VQ8A 4GOPC 4KI0A 3M4QA 1EQRA 5M3MH 3H3VH 4B3ML 3CF5A 3A0JA 3KJOA 5FLMH 1MKHA 1VQMA 1A0IA 1IYJB 2Q2TA 4P75A 4R1JA 3HKSA 3M85A 2K5VA 3GTMH 3HOZG 3S1NH 2R6GA 1CKNA 2AHOB 4OWTB 1L2FA 3W1BA 4DV6L 4JI8L 1CKMA 4DR1L 1N33Q 1A8VA 5H1SE 1Y1VH 2LXKA 5BR8L 2K52A 2KHJA 4BA1I 4NXNQ 5GAEC 1JE5A 1SR3A 2VQEQ 1N32L 1LYLA 3CCVA 2E2IH 3GTQH 2Z6KA 2PI2A 3UDIA 1BBUA 2BA0A 4UP9A 4DR5Q 3AFQA 4IJHA 4DV2Q 3GTOH 1UWVA 1X54A 2K75A 2ZTCA 3AYHB 4JBJA 2QA4A 5IYDH 2YTYA 4O2DA 2UXBL 3ERSX 5JJLA 2JA8H 1GD7A 1QZGA 3HOXH 3UE1A 2KCTA 3TRZA 2UUAQ 4A3GH 1O7IA 2PQAB 4ALPA 1QUQB 4X64L 3HOWH 1L0WA 1JT8A 4JI6Q 1BKBA 2R92H 3PF4A 4Y52H 1HNXQ 1VQJA 2VQFL 1A63A 1VQ4A 3AEVA 1VQLA 1X3GA 4GLVB 1I50H 4YCVA 3CCUA 1OXXK 1VQAA 2H5XA 3PUWA 3J7ZC 3AFPA 2NVQH 1NE3A 4DAMA 3M4OH 3IRBA 1S72A 3SGIA 4LFAL 3CW2C 2I5HA 2QGQA 5C3EH 2VUMH 3F2BA 1OXSC 1YEZA 4DUZL 4H02A 4GKJQ 2PMZE 2AMCB 1QZHA 1Q1EA 2K5HA 4ME3A 1IBML 4DR6Q 1EIYB 1UE1A 3S24A 4YCWA 2YTXA 4JG2A 4DV6Q 4DV0L 5C44G 1WFQA 4DV1L 3OYYA 4B3TL 4NXML 4BY7H 5JJKA 1L1OA 2UUCL 4K0KL 2UXCQ 1T9HA 3CC7A 1YIJA 1I94Q 1QVFA 2ZTDA 1EIFA 4PG3A 3CCLA 4L5QA 4JI7Q 2ZM6Q 1IBLL 4JI1Q 2WB1E 3G71A 1X65A 2N8NA 5IY0A 4POGA 3HOUG 4QQBX 1J5EL 1N32Q 4AQYL 4A3MG 3KYHC 4Y7NH 1EOVA 4BBRG 2DUDA 4KHZA 1NY4A 5FLMG 4X65L 4LF8L 1VQOA 3PUVA 5LMNQ 2AWNA 3J81j 4HJ7A 2OQ0A 1E22A 4JOIC 2F52A 2HHHL 4QL5A 3CCRA 4IPGA 1NBWA 1FGUA 3FHWA 1SRUA 3I4MH 1XTDA 3BZKA 3PV0A 2NVTH 4WJ4A 3K8AA 4GN5A 1YNXA 2QEXA 1YHAA 4UPAA 2UUBQ 3E9HA 4DAYB 3H15A 1Y1VG 4A3DG 4RG1A 1IZ6A 3ULPA 3I56A 3GD7A 2I5MX 1Z9FA 2VQFQ 1PH9A 3DM3A 2JE6I 2ALYB 1WI5A 3CP0A 3K0XA 5C0XG 2ASBA 1Y1WH 2R7ZH 1IBKL 4R4TA 1TXYA 1B7YB 4LUZA 1EWIA 2KENA 4YY3Q 5LMUQ 3RLOA 4DUZQ 4R4OA 5M5YH 5IYDG 3GTJH 1OTCA 1HNWL 2JJQA 3J81i 1XPUA 2JA8G 2BH8A 3S2HH 2VZAA 1I6HH 3HOXG 1D7QA 1X55A 1Q81C 1YI2A 3KFUA 3HKZE 4B3RQ 3CCSA 2CWPA 4RMFA 4DV1Q 3M7NA 1P16A 4R4IA 4A3GG 1XMQQ 3HOWG 1CKOA 1U0LA 1HZAA 2YV5A 1GM5A 2GVBA 4DUYL 3CC2A 1K73C 3GTGH 3M3YH 4BXXH 4LF7L 1QVCA 1WCMH 4P73A 2OTJA 2L15A 1IBLQ 4LF5L 4JBMA 3CCJA 2OQKA 4LWCA 4B3SL 4JI3Q 4C3JH 1YHQA 1K8GA 4JYAQ 4JBWA 1UE5A 4JOIA 1J5EQ 3S1MH 3FP9A 2NN6I 2JA6G 4DV3L 1I5FA 5C3EG 2VUMG 2RHQB 3RZDH 1IL2A 1KIXA 2WP8J 4IFDJ 3PCOB 2WB1G 4OO1G 2ES2A 3NENA 5IYCH 1GVPA 4IPHA 4BY7G 2Z0SA 3L0OA 5FLXc 3KF8B 3T1HL 3PUYA 2OWOA 4LF4L 4LF9L 3EIVA 4GS3A 2BH2A 1X3EA 1RIPA 4DV5L 1XNRL 1YJWA 3A5ZB 2JQOA 3L2PA 1N34L 5DLQE 4A3EH 4A76A 4X62Q 1V1QA 4GOPB 3CPWA 2E8GA 3S1QH 1XMOL 4A3CH 1E3PA 1JB7A 1KL9A 1L1OC 2RF4A 4DR3Q 1R9TH 3G48A 4KHPL 4A3FH 2MFIA 3KDFA 2DGYA 1TWAH 3M9BA 3I4MG 4IFDI 1Q46A 2F4VL 1MIUA 5E7NA 5ELOA 1GO3E 3RZOH 1VQ9A 4JBKA 1YHBA 4LNQA 1XNQL 1Q7YC 4OX9Q 1SN8A 3BJUA 4DR7L 1PYBA 4DK3C 3U50C 4JC0A 1JMCA 2UXDL 2I5LX 3RLFA 5IP7H 4LF5Q 2AWOA 1HNZL 4JI2L 5C4JH 2D0PA 3WWVA 3G6EA 3HKZG 2EIFA 5IP9H 2F3IA 4LFCQ 2R7ZG 1FJGQ 1KRTA 1AH9A 1PFSA 1E1OA 1EQQA 3KJPA 4A3JG 3OTOL 3ULJA 4JV5L 1LTLA 1SE8A 2YU9H 5JEAJ 3K7UC 1WYDA 1G6PA 1VQDA 1VQCA 1SFOH 3W1GA 4B3MQ 3FKIH 1HZCA 1FL0A 4MTNA 4DV4L 1VQ6A 2XGTA 4A3BG 1E1TA 1N8RC 1K9MC 1JJCB 4LF9Q 1YJNA 4BXXG 5JJIA 4GLAC 1WCMG 1PH2A 3CMAA 1LUZA 2LSSA 3CXCA 4JI8Q 1KQSA 2CQOA 4IJLA 4OXPA 4IO9A 4DR1Q 1HR0W 5EAYA 1XPOA 2VL6A 5BR8Q 4X66L 3ULLA 1B70B 1OXVA 1C9OA 5ELNA 2KHIA 5AJ3L 4YWKA 4OWWB 1IXRA 4A3KH 1BVSA 2CFMA 4NPSA 2PNHA 1CSQA 2N49A 3E0EA 4DK6C 4EX5A 1VQBA 5M3FH 3A74A 4GNXB 2KBNA 1S40A 1GKHA 1OXTA 2CWAA 4R4CA 2YYZA 3GO5A 3KF6B 2VY3A 5M3MG 5IYCG 4YHHL 1YZ6A 1KHIA 4UP7A 4IOCA 2UXBQ 1CUKA 3I4OA 3PIOA 1XNQQ 4DR7Q 3UDFA 2UXDQ 2PQAA 1QUQA 4TQUS 4HIKA 2MO1A 3UE0A 1AE3A 5FJ8H 1PH6A 4A93H 4MNOA 5IYBH 2ATWA 4X64Q 3PO2H 4DR4L 2ZJRA 4C3IH 1Q12A 4O0AA 4GLXA 4A3EG 4BY1H 3H3VI 4LF6L 2N78A 2JEAI 2AKWB 4A3CG 4A3LH 2MO0A 2GVAA 2V1CC 3RLNA 1VQNA 1PH4A 4JV5Q 2ZTEA 2VS1A 1E24A 3JC66 1KD1C 4OONA 1Z47A 4LFAQ 2R93H 4JI4L 2WAQE 4NB3A 4HIMA 3B6YA 3CC4A 3I4NH 1X9NA 2A19A 1PH7A 1PH3A 1HR0L 1X6OA 1IBMQ 4LFBL 4UP8A 1E7ZA 4PMWA 1K3RA 4BA2I 2JK8A 1RL2A 4DV0Q 3S14H 4B3TQ 4NXMQ 5GROA 2VNUD 2UUCQ 4PZ7A 4K0KQ 2NZHA 5IP9G 1I3QH 2D62A 3PIPA 3M4PA 1HZ9A 4DV7L 2R92G 1X56A 4X66Q 5GAGC 3S17H 4J15A 3U4VA 1KXLA 3PF5A 2B3GA 5AJ3Q 1N9WA 2IHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN L;  4C2M H;  4AQY Q;  4DR2 L;  1SMX A;  3T1Y L;  1JJ2 A;  1KRS A;  1VQH A;  1VQ5 A;  3I7F A;  1VQK A;  2IHE A;  4YHH Q;  1QVG A;  3ER0 A;  5C4X H;  3MXN B;  1N36 L;  3FKI G;  4LF8 Q;  4X65 Q;  2HHH Q;  3JAM i;  2UU9 L;  2JA9 A;  4LUV A;  4DR5 L;  1M1K C;  1Y14 B;  3MEF A;  3PUX A;  2YTV A;  4A3B H;  3HFZ B;  3CCQ A;  4L5T A;  4L5S A;  2EQS A;  2N3S A;  1TWG H;  4X6A H;  4DR4 Q;  3CD6 A;  4EQ5 A;  5C44 H;  1HJP A;  3CAM A;  4LUO A;  3JAM c;  4YWL A;  1H95 A;  1NMF A;  4LF6 Q;  1UE6 A;  5LMN W;  4JI6 L;  1VQF A;  4A3K G;  1HNX L;  3STB D;  5M3F G;  3PUZ A;  2RHS B;  1IBK Q;  1PYS B;  1S3O A;  2ZJP A;  2E2J H;  3K7A H;  1FVI A;  2LXJ A;  2E2H H;  2IX1 A;  1UEB A;  1C7Y A;  4JI4 Q;  4A3M H;  4BBR H;  4OWX B;  3GDE A;  1YVC A;  1HNW Q;  3OW2 A;  4APV A;  3GTL H;  4LFB Q;  1VQP A;  5GQO A;  3BU2 A;  4GKJ L;  2PI2 E;  4JI0 L;  3LGJ A;  4A3I H;  4DR6 L;  2IY5 B;  5FJ8 G;  4A93 G;  1G29 1;  4LW1 A;  2B63 H;  2R7F A;  5IYB G;  4GKK L;  2WAQ G;  2XTI A;  3PO2 G;  1D8L A;  4IFD G;  5IWA L;  4DUY Q;  3RR5 A;  4DV7 Q;  4LF7 Q;  1MJE A;  1SLJ A;  2KCM A;  4BY1 G;  1I94 L;  1X3F A;  4A3L G;  2UXC L;  3E9I A;  1NJI C;  4AYB E;  4B3S Q;  1AE2 A;  4A3D H;  3HOY H;  4FDB A;  1Y1W G;  1L1O B;  2Q2H A;  2ZM6 L;  3H0G H;  4JI1 L;  2NVX H;  4JI7 L;  1B8A A;  4DR2 Q;  3T1Y Q;  3D31 A;  2K4K A;  4DV3 Q;  3CQZ H;  2Q2U A;  1HH2 P;  2Y0S E;  3HOV H;  2R93 G;  2IT1 A;  4IPD A;  1N36 Q;  5HGQ A;  1KAW A;  3VDY A;  4P71 A;  1PH5 A;  3I4N G;  3J7A 5;  4IOA A;  2NVY H;  4XTC S;  2UU9 Q;  3AQQ A;  4AIM A;  3D0F A;  1EFW A;  1PHJ A;  4AH6 A;  5IT9 c;  2VW9 A;  2D0O A;  4P72 A;  5LMN L;  2K14 A;  2MQH A;  2JA5 H;  2JA7 H;  3NEL A;  1CSP A;  3CCE A;  4DNI A;  2Q2I A;  3T1H Q;  2HQL A;  1V43 A;  2ZJQ A;  4UY8 C;  1C0A A;  4LF4 Q;  4TVA B;  3STB C;  1MJC A;  3CME A;  3EN2 A;  2UUB L;  2MNA A;  2C35 B;  4GN4 B;  2E5L L;  2FXQ A;  3PO3 H;  4DV5 Q;  1Q1B A;  1YBY A;  4GOP A;  1PH8 A;  4YWM A;  4HJ9 A;  1TWF H;  1DGS A;  3F8T A;  1N34 Q;  1VS0 A;  4BBS H;  4QJF A;  1PVO A;  1K0R A;  1XMO Q;  5C4X G;  1EYG A;  2JA6 H;  3I2Z A;  1EUJ A;  2HIV A;  3S2D H;  4YY3 L;  3BZC A;  2HIX A;  4KHP Q;  5LMU L;  1UE7 A;  1VCI A;  3F1Z A;  1KC8 C;  4JI0 Q;  2HT1 A;  4QY7 A;  4L5R C;  2F4V Q;  3K80 C;  4GNX C;  4JI5 L;  2R7D A;  4GKK Q;  2EXD A;  2RCN A;  3TQY A;  3EBE A;  5IWA Q;  5C0X J;  5JEA G;  1U5K A;  1WJJ A;  2A1A A;  1XMQ L;  3NEM A;  2BA1 A;  3HOZ H;  4B3R L;  2CCZ A;  2A8V A;  5HY6 A;  3TRE A;  4JI2 Q;  1Q86 C;  1HNZ Q;  3NBH B;  4P74 A;  3I55 A;  4PZ8 A;  4HJA A;  4R4Q A;  1PH1 A;  4JI3 L;  1ASZ A;  4WJ3 M;  4JYA L;  4DKA C;  1Q8K A;  1W3S A;  2ID0 A;  3F2D A;  2CKZ B;  3TS0 A;  1YIT A;  3PSI A;  4GN3 B;  3OTO Q;  5M5X H;  3Q8D A;  4KLK A;  4A3F G;  4AYB G;  3G4S A;  3S16 H;  1K8A C;  2WFW A;  4A3I G;  3CPF A;  3U58 A;  1NMG A;  2GN5 A;  2I0Q A;  2Y0S G;  3L7Z C;  1TWH H;  1PA6 A;  2B63 G;  4DV4 Q;  3KLW A;  3GTK H;  3GTP H;  3RNU A;  2OTL A;  4HJ5 A;  5M5W H;  3A5U A;  2E5L Q;  1BBW A;  5IP7 G;  4MZ9 A;  4IPC A;  4JCV E;  5C0X I;  3HOY G;  3S1R H;  3H0G G;  1J6Q A;  4A75 A;  3HOV G;  1CKN B;  3J80 i;  4HIO A;  5GAD C;  4GNX A;  1XJV A;  1N33 L;  1OXU A;  4X62 L;  3RN2 A;  3KF6 A;  3DLL A;  3K81 C;  1V9P A;  1VQG A;  1XNR Q;  2VQE L;  5IE8 A;  1P8L A;  2K5N A;  1PV4 A;  4A3J H;  1LM0 A;  4YCU A;  2JA5 G;  4DR3 L;  3KOJ A;  4A4I A;  2JEB I;  3RN5 A;  2NN6 G;  3ZJY C;  3UDG A;  1ASY A;  4JI5 Q;  1K83 H;  2JA7 G;  1XPR A;  3J80 c;  4QGU A;  3TEH B;  3CCM A;  1NTG A;  4DV2 L;  2B29 A;  1VQI A;  3UDX A;  1W2B A;  3W5O A;  3KDF B;  3PO3 G;  2K50 A;  1YJ9 A;  5K36 G;  2Z6K C;  4XIG S;  1VQ7 A;  4OX9 L;  3TS2 A;  2NZO A;  1JJG A;  3J81 c;  2UUA L;  5J3B A;  3F2C A;  4BBS G;  2OCE A;  4QIW E;  1VQE A;  3U4Z A;  1A62 A;  5GAH C;  4LFC L;  3ICE A;  1FJG L;  1HZB A;  4C3H H;  1TWC H;  4HJ8 A;  4OO1 I;  1WOC A;  4POF A;  4PZ6 A;  4DPG A;  3S15 H;  1Q82 C;  4HID A;  1G51 A;  3PGZ A;  3HOU H;  1M90 C;  1SRO A;  2IX0 A;  1HR0 Q;  1VQ8 A;  4GOP C;  4KI0 A;  3M4Q A;  1EQR A;  5M3M H;  3H3V H;  4B3M L;  3CF5 A;  3A0J A;  3KJO A;  5FLM H;  1MKH A;  1VQM A;  1A0I A;  1IYJ B;  2Q2T A;  4P75 A;  4R1J A;  3HKS A;  3M85 A;  2K5V A;  3GTM H;  3HOZ G;  3S1N H;  2R6G A;  1CKN A;  2AHO B;  4OWT B;  1L2F A;  3W1B A;  4DV6 L;  4JI8 L;  1CKM A;  4DR1 L;  1N33 Q;  1A8V A;  5H1S E;  1Y1V H;  2LXK A;  5BR8 L;  2K52 A;  2KHJ A;  4BA1 I;  4NXN Q;  5GAE C;  1JE5 A;  1SR3 A;  2VQE Q;  1N32 L;  1LYL A;  3CCV A;  2E2I H;  3GTQ H;  2Z6K A;  2PI2 A;  3UDI A;  1BBU A;  2BA0 A;  4UP9 A;  4DR5 Q;  3AFQ A;  4IJH A;  4DV2 Q;  3GTO H;  1UWV A;  1X54 A;  2K75 A;  2ZTC A;  3AYH B;  4JBJ A;  2QA4 A;  5IYD H;  2YTY A;  4O2D A;  2UXB L;  3ERS X;  5JJL A;  2JA8 H;  1GD7 A;  1QZG A;  3HOX H;  3UE1 A;  2KCT A;  3TRZ A;  2UUA Q;  4A3G H;  1O7I A;  2PQA B;  4ALP A;  1QUQ B;  4X64 L;  3HOW H;  1L0W A;  1JT8 A;  4JI6 Q;  1BKB A;  2R92 H;  3PF4 A;  4Y52 H;  1HNX Q;  1VQJ A;  2VQF L;  1A63 A;  1VQ4 A;  3AEV A;  1VQL A;  1X3G A;  4GLV B;  1I50 H;  4YCV A;  3CCU A;  1OXX K;  1VQA A;  2H5X A;  3PUW A;  3J7Z C;  3AFP A;  2NVQ H;  1NE3 A;  4DAM A;  3M4O H;  3IRB A;  1S72 A;  3SGI A;  4LFA L;  3CW2 C;  2I5H A;  2QGQ A;  5C3E H;  2VUM H;  3F2B A;  1OXS C;  1YEZ A;  4DUZ L;  4H02 A;  4GKJ Q;  2PMZ E;  2AMC B;  1QZH A;  1Q1E A;  2K5H A;  4ME3 A;  1IBM L;  4DR6 Q;  1EIY B;  1UE1 A;  3S24 A;  4YCW A;  2YTX A;  4JG2 A;  4DV6 Q;  4DV0 L;  5C44 G;  1WFQ A;  4DV1 L;  3OYY A;  4B3T L;  4NXM L;  4BY7 H;  5JJK A;  1L1O A;  2UUC L;  4K0K L;  2UXC Q;  1T9H A;  3CC7 A;  1YIJ A;  1I94 Q;  1QVF A;  2ZTD A;  1EIF A;  4PG3 A;  3CCL A;  4L5Q A;  4JI7 Q;  2ZM6 Q;  1IBL L;  4JI1 Q;  2WB1 E;  3G71 A;  1X65 A;  2N8N A;  5IY0 A;  4POG A;  3HOU G;  4QQB X;  1J5E L;  1N32 Q;  4AQY L;  4A3M G;  3KYH C;  4Y7N H;  1EOV A;  4BBR G;  2DUD A;  4KHZ A;  1NY4 A;  5FLM G;  4X65 L;  4LF8 L;  1VQO A;  3PUV A;  5LMN Q;  2AWN A;  3J81 j;  4HJ7 A;  2OQ0 A;  1E22 A;  4JOI C;  2F52 A;  2HHH L;  4QL5 A;  3CCR A;  4IPG A;  1NBW A;  1FGU A;  3FHW A;  1SRU A;  3I4M H;  1XTD A;  3BZK A;  3PV0 A;  2NVT H;  4WJ4 A;  3K8A A;  4GN5 A;  1YNX A;  2QEX A;  1YHA A;  4UPA A;  2UUB Q;  3E9H A;  4DAY B;  3H15 A;  1Y1V G;  4A3D G;  4RG1 A;  1IZ6 A;  3ULP A;  3I56 A;  3GD7 A;  2I5M X;  1Z9F A;  2VQF Q;  1PH9 A;  3DM3 A;  2JE6 I;  2ALY B;  1WI5 A;  3CP0 A;  3K0X A;  5C0X G;  2ASB A;  1Y1W H;  2R7Z H;  1IBK L;  4R4T A;  1TXY A;  1B7Y B;  4LUZ A;  1EWI A;  2KEN A;  4YY3 Q;  5LMU Q;  3RLO A;  4DUZ Q;  4R4O A;  5M5Y H;  5IYD G;  3GTJ H;  1OTC A;  1HNW L;  2JJQ A;  3J81 i;  1XPU A;  2JA8 G;  2BH8 A;  3S2H H;  2VZA A;  1I6H H;  3HOX G;  1D7Q A;  1X55 A;  1Q81 C;  1YI2 A;  3KFU A;  3HKZ E;  4B3R Q;  3CCS A;  2CWP A;  4RMF A;  4DV1 Q;  3M7N A;  1P16 A;  4R4I A;  4A3G G;  1XMQ Q;  3HOW G;  1CKO A;  1U0L A;  1HZA A;  2YV5 A;  1GM5 A;  2GVB A;  4DUY L;  3CC2 A;  1K73 C;  3GTG H;  3M3Y H;  4BXX H;  4LF7 L;  1QVC A;  1WCM H;  4P73 A;  2OTJ A;  2L15 A;  1IBL Q;  4LF5 L;  4JBM A;  3CCJ A;  2OQK A;  4LWC A;  4B3S L;  4JI3 Q;  4C3J H;  1YHQ A;  1K8G A;  4JYA Q;  4JBW A;  1UE5 A;  4JOI A;  1J5E Q;  3S1M H;  3FP9 A;  2NN6 I;  2JA6 G;  4DV3 L;  1I5F A;  5C3E G;  2VUM G;  2RHQ B;  3RZD H;  1IL2 A;  1KIX A;  2WP8 J;  4IFD J;  3PCO B;  2WB1 G;  4OO1 G;  2ES2 A;  3NEN A;  5IYC H;  1GVP A;  4IPH A;  4BY7 G;  2Z0S A;  3L0O A;  5FLX c;  3KF8 B;  3T1H L;  3PUY A;  2OWO A;  4LF4 L;  4LF9 L;  3EIV A;  4GS3 A;  2BH2 A;  1X3E A;  1RIP A;  4DV5 L;  1XNR L;  1YJW A;  3A5Z B;  2JQO A;  3L2P A;  1N34 L;  5DLQ E;  4A3E H;  4A76 A;  4X62 Q;  1V1Q A;  4GOP B;  3CPW A;  2E8G A;  3S1Q H;  1XMO L;  4A3C H;  1E3P A;  1JB7 A;  1KL9 A;  1L1O C;  2RF4 A;  4DR3 Q;  1R9T H;  3G48 A;  4KHP L;  4A3F H;  2MFI A;  3KDF A;  2DGY A;  1TWA H;  3M9B A;  3I4M G;  4IFD I;  1Q46 A;  2F4V L;  1MIU A;  5E7N A;  5ELO A;  1GO3 E;  3RZO H;  1VQ9 A;  4JBK A;  1YHB A;  4LNQ A;  1XNQ L;  1Q7Y C;  4OX9 Q;  1SN8 A;  3BJU A;  4DR7 L;  1PYB A;  4DK3 C;  3U50 C;  4JC0 A;  1JMC A;  2UXD L;  2I5L X;  3RLF A;  5IP7 H;  4LF5 Q;  2AWO A;  1HNZ L;  4JI2 L;  5C4J H;  2D0P A;  3WWV A;  3G6E A;  3HKZ G;  2EIF A;  5IP9 H;  2F3I A;  4LFC Q;  2R7Z G;  1FJG Q;  1KRT A;  1AH9 A;  1PFS A;  1E1O A;  1EQQ A;  3KJP A;  4A3J G;  3OTO L;  3ULJ A;  4JV5 L;  1LTL A;  1SE8 A;  2YU9 H;  5JEA J;  3K7U C;  1WYD A;  1G6P A;  1VQD A;  1VQC A;  1SFO H;  3W1G A;  4B3M Q;  3FKI H;  1HZC A;  1FL0 A;  4MTN A;  4DV4 L;  1VQ6 A;  2XGT A;  4A3B G;  1E1T A;  1N8R C;  1K9M C;  1JJC B;  4LF9 Q;  1YJN A;  4BXX G;  5JJI A;  4GLA C;  1WCM G;  1PH2 A;  3CMA A;  1LUZ A;  2LSS A;  3CXC A;  4JI8 Q;  1KQS A;  2CQO A;  4IJL A;  4OXP A;  4IO9 A;  4DR1 Q;  1HR0 W;  5EAY A;  1XPO A;  2VL6 A;  5BR8 Q;  4X66 L;  3ULL A;  1B70 B;  1OXV A;  1C9O A;  5ELN A;  2KHI A;  5AJ3 L;  4YWK A;  4OWW B;  1IXR A;  4A3K H;  1BVS A;  2CFM A;  4NPS A;  2PNH A;  1CSQ A;  2N49 A;  3E0E A;  4DK6 C;  4EX5 A;  1VQB A;  5M3F H;  3A74 A;  4GNX B;  2KBN A;  1S40 A;  1GKH A;  1OXT A;  2CWA A;  4R4C A;  2YYZ A;  3GO5 A;  3KF6 B;  2VY3 A;  5M3M G;  5IYC G;  4YHH L;  1YZ6 A;  1KHI A;  4UP7 A;  4IOC A;  2UXB Q;  1CUK A;  3I4O A;  3PIO A;  1XNQ Q;  4DR7 Q;  3UDF A;  2UXD Q;  2PQA A;  1QUQ A;  4TQU S;  4HIK A;  2MO1 A;  3UE0 A;  1AE3 A;  5FJ8 H;  1PH6 A;  4A93 H;  4MNO A;  5IYB H;  2ATW A;  4X64 Q;  3PO2 H;  4DR4 L;  2ZJR A;  4C3I H;  1Q12 A;  4O0A A;  4GLX A;  4A3E G;  4BY1 H;  3H3V I;  4LF6 L;  2N78 A;  2JEA I;  2AKW B;  4A3C G;  4A3L H;  2MO0 A;  2GVA A;  2V1C C;  3RLN A;  1VQN A;  1PH4 A;  4JV5 Q;  2ZTE A;  2VS1 A;  1E24 A;  3JC6 6;  1KD1 C;  4OON A;  1Z47 A;  4LFA Q;  2R93 H;  4JI4 L;  2WAQ E;  4NB3 A;  4HIM A;  3B6Y A;  3CC4 A;  3I4N H;  1X9N A;  2A19 A;  1PH7 A;  1PH3 A;  1HR0 L;  1X6O A;  1IBM Q;  4LFB L;  4UP8 A;  1E7Z A;  4PMW A;  1K3R A;  4BA2 I;  2JK8 A;  1RL2 A;  4DV0 Q;  3S14 H;  4B3T Q;  4NXM Q;  5GRO A;  2VNU D;  2UUC Q;  4PZ7 A;  4K0K Q;  2NZH A;  5IP9 G;  1I3Q H;  2D62 A;  3PIP A;  3M4P A;  1HZ9 A;  4DV7 L;  2R92 G;  1X56 A;  4X66 Q;  5GAG C;  3S17 H;  4J15 A;  3U4V A;  1KXL A;  3PF5 A;  2B3G A;  5AJ3 Q;  1N9W A;  2IHF A; 
#chains in the Genus database with same CATH topology
 5DEH A;  5J39 A;  2DNE A;  3T53 B;  4AQY Q;  1PTO H;  3T1Y L;  1KRS A;  2NUC A;  1STB A;  1SEB D;  2IHE A;  1VQK A;  1DOM A;  5FK9 C;  3ER0 A;  3MXN B;  4IUV A;  2UU9 L;  3JAM i;  3G6J B;  1YNJ C;  1KDB A;  1M1K C;  3L3O C;  2D2C C;  4L5S A;  2N3S A;  4DR4 Q;  2A6E C;  4EQ5 A;  3TP7 A;  3NSW A;  1LTB D;  3DWP A;  4AYB B;  5LMN W;  4JI6 L;  2F1M A;  2F0W A;  1TWA B;  4K8I A;  1PYS B;  1S3O A;  2E2J H;  3K7A H;  2H4O A;  1UEB A;  2L0C A;  4JI4 Q;  4A3M H;  2B8G A;  3OW2 A;  3SVM A;  1EZ6 A;  3HOY B;  1O7Z A;  1EEI D;  1ZKO A;  1TVX A;  1SYG A;  4A93 G;  4LW1 A;  1AN8 A;  2WAQ G;  2Q8T A;  5IWA L;  4K8J A;  1RTO A;  1EY6 A;  4AYB E;  4A3D H;  1LT3 D;  3H0G H;  4JI1 L;  4DR2 Q;  3CQZ H;  3FDT A;  1HH2 P;  4K2K A;  1DM0 B;  2IT1 A;  2K04 A;  1PH5 A;  1KAW A;  3DMU A;  3MHB A;  4P71 A;  5I9P A;  3J7A 5;  4TRD A;  4XTC S;  3AQQ A;  4AIM A;  1XWE A;  1ET6 A;  5IT9 c;  2JA5 H;  2MQH A;  3I90 A;  4HN7 A;  4KHV A;  5BN4 A;  4BBS B;  4DNI A;  3K59 A;  2HQL A;  3T1H Q;  2ZJQ A;  1C0A A;  4TVA B;  3SXH A;  1MJC A;  3CME A;  2MNA A;  4GN4 B;  2X6G A;  3PO3 H;  5ELB A;  3TME A;  4YWM A;  1N34 Q;  2B2T A;  1TY0 A;  1XMO Q;  2JA6 H;  4HCS A;  3QO2 A;  1EUJ A;  4KY6 A;  2HIX A;  3HOZ B;  1VCI A;  2HT1 A;  2E76 C;  3C46 A;  2F4V Q;  4ZRZ A;  4JI5 L;  3UI2 A;  2BDO A;  1U4L A;  4GKK Q;  2EXD A;  2RCN A;  5CV7 A;  1Z6H A;  1XMQ L;  4QUC A;  2BA1 A;  1DD2 A;  2CCZ A;  1F2Y A;  4JI3 L;  1ASZ A;  5ELC A;  2NB0 A;  3F2D A;  2IJ0 A;  2KUM A;  4GN3 B;  2CHB D;  3IAY A;  4AYB G;  3S16 H;  1B3A A;  1BXT A;  3L7Z C;  1TWH H;  3GTK H;  1O78 A;  1SE3 A;  2OTL A;  2RCF A;  1IKM A;  4N8X 1;  2E5L Q;  1BBW A;  2D9U A;  4MZ9 A;  4IPC A;  4JCV E;  3HOY G;  4CDF C;  5FOB B;  2EYO A;  2X6L A;  1AW7 A;  1K83 B;  3QG1 A;  4HIO A;  3H09 A;  3RMH A;  1OXU A;  1T5X D;  2XN9 C;  4N9T A;  1XX8 A;  4X62 L;  3DLL A;  1TS3 A;  3K81 C;  4HSP A;  4HR7 B;  2VQE L;  5IE8 A;  2K5N A;  4YCU A;  1JWS D;  2EXZ A;  5C44 B;  3ZJY C;  1ASY A;  1E2W A;  4QGU A;  1S5F D;  1VQI A;  3KDF B;  1TWC B;  4KKU A;  5K36 G;  1E2V A;  3TS2 A;  4OX9 L;  2NZO A;  1JJG A;  5E4X A;  3J81 c;  4BBR B;  5J3B A;  4IUP A;  4BBS G;  2OCE A;  3A7A B;  3U4Z A;  4LFC L;  1HZB A;  4HJ8 A;  1WOC A;  2F0M A;  4POF A;  1GHK A;  4LMQ D;  4HID A;  3PGZ A;  2WAC A;  3P75 A;  1M90 C;  1SRO A;  1T5E A;  1H9J A;  1EQR A;  1NAP A;  4B3M L;  5FLM H;  4F8M A;  2B2W C;  4P75 A;  3GTM H;  3HOZ G;  3OSO A;  1DXM A;  3S1N H;  3T16 A;  4DV6 L;  1L2F A;  2R61 A;  3NTK A;  4JI8 L;  1H9S B;  1CKM A;  2NVY B;  5C5L A;  1I6V C;  3M4Y A;  1NNX A;  1EYC A;  3NTI A;  5C0X H;  1N32 L;  1JCK B;  2Z6K A;  3HOW B;  3GTO H;  3V05 A;  3AYH B;  4HAE A;  1RDP D;  2QA4 A;  2YTY A;  2UXB L;  1FNV A;  4RHR A;  1KDA A;  3PMF A;  5CMD A;  3HOX H;  2NBF A;  1AEX A;  4XQN A;  4ALP A;  1HFG A;  3KLS X;  4I7Z C;  5C3E B;  2VUM B;  5COR A;  1A3U A;  4JI6 Q;  1JT8 A;  5CR3 A;  3AEV A;  1VQL A;  3CCU A;  1OXX K;  2N55 A;  3J7Z C;  2NVQ H;  2TMP A;  4X3S A;  1NE3 A;  3M4O H;  2I5H A;  1QCB D;  1OXS C;  2L4N A;  2AMC B;  1QZH A;  2RSN A;  1B1Z A;  1SDF A;  2AQ2 B;  1X32 A;  2SNM A;  1BUV T;  5C44 G;  4BY7 H;  1Y8P B;  1MSG A;  3NWT A;  1T9H A;  1F77 A;  3CC7 A;  1YIJ A;  1QVF A;  1EIF A;  4L5Q A;  1IBL L;  4JI1 Q;  1ENA A;  5IY0 A;  1Z7T A;  2H1E A;  5DM6 3;  4BBR G;  1FD7 D;  2OEO A;  3ERO A;  3J7A V;  1RJT A;  4NP5 A;  3PUV A;  2AWN A;  2OQ0 A;  2F52 A;  4QL5 A;  4ZYS A;  1EOT A;  4IPG A;  3CCR A;  1FGU A;  3FHW A;  3I8Z A;  3PV0 A;  3BZK A;  3DEP A;  2NVT H;  4WJ4 A;  1YNX A;  2QEX A;  2F0V A;  2C9O A;  1NR4 A;  4BS9 A;  5D14 A;  3NWS A;  3I56 A;  4A3J B;  1Z9F A;  1PH9 A;  2AUK A;  4K14 A;  3S2H B;  4Q0F A;  1B4O A;  4FF3 A;  1I6H B;  2R7Z H;  4RKL A;  5I2X A;  2B8F A;  2KEN A;  4P2C B;  4A3B B;  3K5L A;  4R4O A;  1TQO A;  1VMC A;  1HNW L;  2JJQ A;  5I9O A;  1JWM D;  2RSO A;  3C1E A;  4U67 3;  1X55 A;  1PRT F;  4DV1 Q;  1XMQ Q;  1I4X A;  5IGF A;  3HOW G;  2YV5 A;  4KD3 A;  1GM5 A;  2BCO A;  3RZD B;  3M3Y H;  4BXX H;  4LF7 L;  1KNE A;  2L15 A;  4ILW A;  3QR8 A;  4JBM A;  2OQK A;  4JI3 Q;  4CDC C;  1EFI D;  2MHV A;  4JBW A;  4G7Z C;  2O5I C;  1B2T A;  5C3E G;  3H3V C;  5EPK A;  3K5N A;  2VUM G;  2EYF A;  1QE6 A;  2EY6 A;  4C56 C;  1ZXT A;  3NEN A;  4A3E B;  3PIO 3;  1ICW A;  5ISR A;  3VR6 A;  2OWO A;  1FYC A;  1X3E A;  3MFG A;  1NUC A;  4DV5 L;  1R9T B;  3A5Z B;  1CQF A;  5DLQ E;  1VDZ A;  5C3X A;  4X62 Q;  3E5S A;  2E8G A;  3S1Q H;  4A3C H;  1E3P A;  3OMC A;  1L1O C;  1GUN A;  4KHP L;  1IKL A;  2MFI A;  2DGY A;  4H13 C;  5KYI A;  1TWA H;  5C4J B;  4ZKB B;  1W6K A;  4IZ8 A;  2PMZ B;  2PW7 A;  3HRZ C;  4LNQ A;  1XNQ L;  4O42 A;  4K5X A;  4OX9 Q;  1II3 A;  1PZI D;  4JC0 A;  2AWO A;  4EQO A;  4H7B A;  4LFC Q;  1KRT A;  1AH9 A;  1PFS A;  1EQQ A;  2HUG A;  3TP6 A;  4A3J G;  3OTO L;  3ULJ A;  4JV5 L;  1B9M A;  2I07 B;  3K7U C;  1VQC A;  4B3M Q;  3QOL A;  3FKI H;  4MTN A;  1LTT D;  3TBI B;  1XYI A;  4A3B G;  1BQQ T;  1N8R C;  2RQX A;  2JXM B;  1LV9 A;  2DN8 A;  3P7J A;  5KNB A;  4KMU C;  1SYE A;  4NDX A;  4JI8 Q;  1KQS A;  4IJL A;  1XPO A;  2VL6 A;  4X66 L;  1D2B A;  1C9O A;  1U9R A;  5ELN A;  1G2T A;  5AJ3 L;  4KKS A;  4A3K H;  1BVS A;  4ID6 A;  5M3F H;  1L0Y B;  1VQB A;  3A74 A;  4XXE A;  3MZ5 A;  4R4C A;  2YYZ A;  2VY3 A;  5IYC G;  4BY1 B;  2UXB Q;  1EY9 A;  1FR3 A;  1Q90 A;  5D3D A;  2UXD Q;  1QUQ A;  5CV4 A;  1CM9 A;  4ZUJ A;  2A73 B;  2F0I A;  1EU4 A;  1PH6 A;  4MNO A;  5IYB H;  1B53 A;  1PFB A;  2G9D A;  3PQI A;  2ZJR A;  5TSS A;  4DR4 L;  4A3E G;  5CV5 A;  2MO0 A;  2V1C C;  3RLN A;  2QIL A;  2ZTE A;  1SYC A;  2VS1 A;  1A3V A;  1BCP F;  4JI4 L;  2PO4 A;  4HIM A;  3B6Y A;  1PH7 A;  2WKC A;  3TZD A;  1MD2 D;  2L11 A;  1E7Z A;  1HTL D;  1IYU A;  4PMW A;  4M1U B;  4BA2 I;  1RL2 A;  4C2M B;  5GRO A;  4EGV A;  2WKD A;  3K58 A;  2VNU D;  2OXP A;  5C4X B;  3M4P A;  1X56 A;  4CJ2 C;  4J15 A;  1SE4 A;  3URY A;  2K33 A;  2J4X A;  1N9W A;  1F9P A;  1UNS A;  4DR2 L;  1SMX A;  1CA5 A;  5I6Y A;  2MJ8 A;  2RDG A;  1TWG B;  4RGT A;  2CQA A;  2FIN B;  3X3N A;  2G5D A;  5T1I A;  4IUN A;  3PUX A;  4DAY A;  1AZQ A;  3BS1 A;  2E2H B;  1IW7 D;  1S5E D;  5C44 H;  1HJP A;  3ZYY X;  5JEA H;  3T51 B;  4YWL A;  3GTL B;  2IW3 A;  1VQF A;  3BDL A;  4G57 A;  3PUZ A;  1EIG A;  4FF2 A;  2ZJP A;  1SE2 A;  3Q0A A;  1FVI A;  2LXJ A;  3BVG A;  2A6H D;  4OWX B;  2ZXR A;  2FMM A;  3GDE A;  4BBR H;  1HNW Q;  1RD9 D;  4LFB Q;  4APV A;  2ENB A;  1Q3L A;  2EVB A;  4DXG A;  5GQO A;  3BU2 A;  1VQP A;  1EIH A;  3LGJ A;  4A3I H;  2NVX B;  2G9H D;  1G29 1;  2B63 H;  4GKK L;  1K0S A;  1D8L A;  4IFD G;  4LF7 Q;  3EFX D;  2HDL A;  4BY1 G;  2UXC L;  1I94 L;  2YU9 B;  2B2Y C;  2K5D A;  3VA5 A;  2ZM6 L;  1B8A A;  2K4K A;  3NK9 A;  4JPB W;  4OGQ C;  3AMU A;  3HOV H;  2E74 C;  3OHX C;  4IPD A;  1ENF A;  5HGQ A;  2NVY H;  1HFN A;  1VMP A;  4L8J A;  1IW7 C;  3D0F A;  5CC4 A;  4Z9C B;  2M2L A;  1ET9 A;  1AP0 A;  4AH6 A;  4P72 A;  2K14 A;  2JA7 H;  3CCE A;  4UY8 C;  1V43 A;  4RHS A;  1ILP A;  3L9A X;  3OWE B;  2UUB L;  2E5L L;  2C35 B;  3S2D B;  4DV5 Q;  3AU7 A;  1PLF A;  2HD3 A;  2A6H C;  1A15 A;  1TWF H;  3CKI B;  3N52 A;  3F8T A;  2LMC B;  4LAA A;  1YNN D;  1K0R A;  5C4X G;  2HIV A;  2L1B A;  4KHP Q;  5LMU L;  1EQT A;  3VR4 A;  1DON A;  1KC8 C;  4XDX A;  1PMR A;  2L55 A;  2M00 A;  3FRP B;  2R7D A;  2M9V A;  3MEH A;  2RA4 A;  1U5K A;  1WJJ A;  2ZT9 C;  2F0N A;  1EYD A;  2OT2 A;  4P74 A;  1I4H A;  4HJA A;  3GTP B;  4WJ3 M;  5KNC A;  2XWJ B;  2ID0 A;  2E75 C;  1YIT A;  5G3L F;  3OTO Q;  5M5X H;  3G4S A;  1M8A A;  2FFK B;  3U58 A;  3A56 A;  3S1R B;  1GJX A;  2I0Q A;  2SNS A;  1QNU A;  4HJ5 A;  4KJO A;  5M5W H;  1YNN C;  4WJW A;  5J22 A;  5C0X I;  1SXT A;  2B39 A;  1MGS A;  2DNC A;  3J80 i;  1XJV A;  3A55 A;  4V19 0;  3FMC A;  4RCO A;  4OEM B;  4ZAI A;  4OIJ A;  4N9P A;  1PV4 A;  4J1M A;  1SNO A;  2ICE C;  2K01 A;  4A3J H;  1B50 A;  3KOJ A;  3UDG A;  1MSH A;  2EYL A;  3TEH B;  3CCM A;  1NTG A;  2VXW A;  3UDX A;  2JN4 A;  3W5O A;  1W2B A;  2O5J C;  2NYZ D;  1LTR D;  1YJ9 A;  2Z6K C;  2IL8 A;  4PNY A;  3S15 B;  3LNN A;  3HOU B;  2EJG C;  3F2C A;  4PQX A;  1KAB A;  5IOD A;  5GAH C;  4C3H H;  2XNA C;  5C4Z A;  2HQE A;  4DPG A;  3MXP A;  4CGY B;  3CHB D;  2Z4I A;  5JPM C;  4GOP C;  3M4Q A;  1H9K A;  1A3T A;  3WOE A;  1A0I A;  1IYJ B;  1SNC A;  3M85 A;  3HKS A;  1TS2 A;  2K5V A;  3AB9 A;  4ODG A;  5EQ0 A;  2R6G A;  1TS4 A;  4DGZ A;  1CKN A;  4OWT B;  3W1B A;  1O7L A;  3IFT A;  1CHQ D;  5C5M A;  1N33 Q;  5H1S E;  1Y1V H;  2K52 A;  2KHJ A;  1STA A;  5GAE C;  4RCN A;  2E2I H;  3R8B A;  2K05 A;  2PI2 A;  4CJ1 B;  1BBU A;  5E1F A;  4WRD A;  1GHJ A;  3D8G A;  1X54 A;  2QEJ C;  1ESF A;  5IYD H;  3ERS X;  3TSS A;  3VYS A;  2L9H A;  2JA8 H;  2J0T D;  1QZG A;  3SK6 A;  4MHE A;  3I91 A;  3SHL A;  1ZEQ X;  3TRZ A;  5IGE A;  2UUA Q;  4A3G H;  1QUQ B;  1L0W A;  3PF4 A;  1VQJ A;  2WB1 B;  2QDL A;  2ZXO A;  1I50 H;  2H5X A;  5J1Z A;  5IT9 E;  3CW2 C;  4KY5 A;  1OO9 B;  3E6Z X;  1YEZ A;  3BG3 A;  1Q1E A;  3NBI A;  1JB3 A;  4OO1 H;  4BWG B;  1GUO A;  1B3Q A;  3IKJ A;  5KGU A;  4YCW A;  2YTX A;  4DV1 L;  4Y7N B;  1BF4 A;  3OYY A;  5JJK A;  3FPP A;  2UXC Q;  1I94 Q;  2E2D C;  2ZTD A;  5C3W A;  1G6Z A;  4NW2 A;  3CCL A;  2IWH A;  2ZM6 Q;  2WB1 E;  3KUP A;  4UHV A;  1X65 A;  4POG A;  3HOU G;  3KYH C;  1EOV A;  1NY4 A;  2QDB A;  4LF8 L;  4G7O C;  3J81 j;  4HJ7 A;  2HHH L;  3MWY W;  4IQZ A;  3SE0 A;  1WTR A;  1SRU A;  4KJN A;  3I4M H;  1XTD A;  4KD4 A;  4UPA A;  2UUB Q;  5T1G A;  1UUP A;  2KA7 A;  4DAY B;  4GZY C;  1IZ6 A;  2VQF Q;  3DM3 A;  2ALY B;  2Z4H A;  3CP0 A;  2EE1 A;  3SEB A;  3T4A C;  2ASB A;  3BYY B;  1IBK L;  1D1I A;  4EVO A;  4R4T A;  1TXY A;  1JWU D;  5LMU Q;  4DUZ Q;  5M5Y H;  3GTJ H;  3MFY A;  1WCM B;  1L0X B;  4TKO B;  4DU9 A;  4QB4 A;  4C3J B;  1YI2 A;  3S1M B;  3JAM L;  1H9M A;  4RMF A;  3M7N A;  1JR0 D;  1SJE D;  1GXD C;  1HZA A;  1U0L A;  5EGT A;  2GVB A;  3TDQ A;  3GTG H;  1K73 C;  4P73 A;  3ITP A;  4LWC A;  3W2D A;  2XSC A;  1K8G A;  5M3M B;  1UE5 A;  4JOI A;  3FP9 A;  4DV3 L;  3HZX A;  1I5F A;  4C1N K;  1ZYR D;  2RHQ B;  3SR1 A;  1LT6 D;  1STH A;  4IFD J;  2WB1 G;  1A6X A;  4ME5 A;  1GVP A;  3L0O A;  4K2L A;  2EDG A;  1RTN A;  4LF4 L;  4GS3 A;  2BH2 A;  1RIP A;  1YJW A;  3T56 B;  3Q22 A;  2JQO A;  5EPL A;  2QF7 A;  3A54 A;  2JYO A;  3K0Y A;  3CPW A;  5FO7 B;  2Z1C A;  1STE A;  3G48 A;  1EQV A;  5EKK A;  1QNK A;  3M9B A;  1Q46 A;  5ELO A;  4S3S A;  1VQ9 A;  4JBK A;  2R92 B;  1DZ1 A;  2KHS A;  3BJU A;  4DK3 C;  2UXD L;  4ZCK A;  2Z6B A;  4OHJ A;  4UAI A;  1HNZ L;  1KTK A;  4JI2 L;  5FO8 B;  1ZYR C;  2D0P A;  4X3U A;  3WWV A;  1V1P A;  2EIF A;  2F3I A;  3ONA B;  3KJP A;  2YU9 H;  4LK1 C;  4XT3 B;  1G6P A;  3KF8 A;  1BOS A;  1G2S A;  1FL0 A;  2IPK D;  2NTT A;  2XGT A;  3W3A A;  1E1T A;  5JJI A;  1X3Q A;  1PH2 A;  1WCM G;  1LUZ A;  3VA7 A;  3CXC A;  4C3J G;  1GUG A;  2CQO A;  5EAY A;  2QW7 A;  3ULL A;  5CV9 A;  2EYM A;  1IXR A;  3HP3 A;  4NPS A;  2CFM A;  1LTA D;  3E0E A;  2N49 A;  1XNR L;  4MTK A;  5A35 A;  1GKH A;  1IYV A;  5M3M G;  3PO2 B;  3GQB A;  4EQN A;  4UP7 A;  2F0L A;  4IOC A;  3I72 A;  5NUC A;  3UDF A;  2PQA A;  1Y1W B;  4FXD A;  4A93 H;  2R93 B;  2ZXP A;  4QF4 A;  5IGD A;  2Z9H A;  2LY7 A;  3I4N B;  3BVM A;  3H3V I;  2JEA I;  1ONL A;  4FVM A;  3DWQ A;  3S14 B;  4NB3 A;  3CC4 A;  2A19 A;  2DJG C;  2JSO A;  1X6O A;  4LFB L;  3S17 B;  4UP8 A;  1D5X C;  2B2V A;  3MXG A;  3MTS A;  1PTO B;  2NZH A;  4OL7 A;  1I3Q H;  5IP9 G;  3PIP A;  3BDO A;  1WTW A;  2R92 G;  4IUT A;  5FKA C;  3BYT B;  2KEE A;  4NXN L;  4KK7 A;  3LWE A;  1JJ2 A;  2MUY A;  1VQH A;  3I7F A;  2EYJ A;  2FHT A;  3J80 E;  1SAP A;  2K32 A;  4LF8 Q;  2HHH Q;  2JA9 A;  2D5D A;  1Y14 B;  1HUN A;  3HFZ B;  3CCQ A;  2E2J B;  4L5T A;  3K7A B;  3VYU A;  4X6A H;  3WOF A;  3CD6 A;  3CAM A;  4UDU C;  3OIQ A;  4LUO A;  3JAM c;  1H95 A;  1PFM A;  4LF6 Q;  1UE6 A;  4A3F B;  4HSV A;  1D1K A;  3STB D;  1EY4 A;  1IBK Q;  2LS0 1;  4R9W A;  5F2D A;  4CBV A;  1D5Z C;  2IX1 A;  2EPB A;  3K5M A;  1EY0 A;  5EKI A;  5LL6 X;  5JPN C;  4NKL A;  1LT4 D;  4B08 A;  2PI2 E;  3C1F A;  3H0G B;  3BDC A;  2EZV A;  5FJ8 G;  2BOS A;  3I3C A;  3PO2 G;  1TU2 B;  2MGS A;  1BR9 A;  4DV7 Q;  5K5P A;  1MJE A;  1X3F A;  4A3L G;  3DEO A;  1LTI D;  1AE2 A;  3HOY H;  4FDB A;  1Y1W G;  1SFO B;  2JA5 B;  1EU3 A;  1U4R A;  4DV3 Q;  5DAU A;  2Q2U A;  3P20 A;  4EQP A;  2R93 G;  1R4P B;  5EBD A;  1N36 Q;  3I4N G;  4IOA A;  3PO3 B;  1HTP A;  1PZK D;  1PHJ A;  2D0O A;  3BVZ A;  3O13 A;  2PPB C;  1CSP A;  4LF4 Q;  3STB C;  1I4Q A;  1S5B D;  5EKL A;  1ICF B;  3MXU A;  2FXQ A;  3V2T A;  4G7H C;  5K36 H;  5COY A;  1E0B A;  1Q1B A;  1YBY A;  1F9R A;  1TS5 A;  2A68 D;  2Q8I B;  1VS0 A;  4XQJ A;  4BBS H;  1K3B C;  1PVO A;  1WD0 A;  1EYG A;  1QG7 A;  1PTO D;  4H0L C;  3BZC A;  3A8J E;  1UE7 A;  4JI0 Q;  4QY7 A;  1SMY D;  5IGG A;  4L5R C;  4C3I B;  1PDQ A;  4DAV A;  3G7L A;  3TQY A;  3GV3 A;  3NEM A;  4B3R L;  1SJH D;  3HOZ H;  2A8V A;  2EJM A;  3TRE A;  4JI2 Q;  4CKE A;  1HNZ Q;  3S16 B;  5A2Q E;  3I55 A;  3OMG A;  4PZ8 A;  2QCP X;  4R4Q A;  1U4P A;  1PH1 A;  3GTK B;  1TWH B;  4JYA L;  4DKA C;  1Q8K A;  2K28 A;  1GUW A;  2CKZ B;  1K8M A;  5E3F A;  2PYK A;  3PSI A;  3Q8D A;  4KLK A;  4X3T A;  4A3F G;  1K8A C;  2WFW A;  1NMG A;  2GN5 A;  3C3L A;  1PA6 A;  3KLW A;  4C1N I;  1A2T A;  3F2U A;  2A68 C;  4FXG C;  2L12 A;  1O7Y A;  3U9S A;  4KN4 C;  3DWA A;  1CTM A;  2FJ2 A;  3H0G G;  1PTO C;  2F0Q A;  4A75 A;  4QIW B;  1N33 L;  4GNX A;  1SMY C;  1SNQ A;  3RN2 A;  3KF6 A;  1Y69 U;  1XNR Q;  1P8L A;  1TR5 A;  1LM0 A;  2PZW A;  3ERQ A;  4M8A A;  2JA5 G;  3RN5 A;  2NN6 G;  1K83 H;  5IIF A;  2F03 A;  2F0O A;  3HEJ A;  2B29 A;  2PCF B;  3PO3 G;  3E0J A;  1SYD A;  1VQ7 A;  4ZLT F;  1FGB D;  5IOC A;  2KCC A;  1C8C A;  1FNU A;  4QUF A;  1WTO A;  2UUA L;  1KLU D;  4QIW E;  1VQE A;  3TP8 A;  3ICE A;  1FJG L;  1TWC H;  1TT2 A;  4OO1 I;  5BN3 A;  3GTM B;  1FNW A;  1I4G A;  1K28 A;  1Q82 C;  3HG9 A;  1VQ8 A;  4KI0 A;  2F0G A;  3D4W A;  3D6W A;  5FLX E;  5M3M H;  3H3V H;  2B2T C;  1HPC A;  3A0J A;  3KJO A;  1LAC A;  1MKH A;  4K6D A;  2Q2T A;  1AZP A;  4DFA A;  1XTC D;  4WOR A;  4R8I A;  4XYQ A;  4C3I G;  4RWS C;  1PFN A;  5IGB A;  1F9Q A;  3FPU B;  3KBG A;  3TN2 A;  3GTO B;  2LXK A;  2DY8 A;  4FNF A;  5BR8 L;  4BA1 I;  4NXN Q;  1Y8O B;  1TKW B;  1CQV A;  3NHH A;  3HOX B;  3CCV A;  1CI3 M;  2EY2 A;  4RGN A;  3UDI A;  1KLG D;  2BA0 A;  3BZD B;  3AFQ A;  4IJH A;  1NCV A;  4DV2 Q;  2LFN A;  2ZTC A;  4O2D A;  5JJL A;  1KAA A;  3UE1 A;  2KCT A;  3M4O B;  1O7I A;  2PQA B;  3SK4 A;  1CFM A;  2BDN A;  3HOW H;  1BKB A;  2A69 D;  3D4R A;  3U9O A;  2R92 H;  2I46 A;  2VQF L;  1X3G A;  4GLV B;  5FO9 B;  4YCV A;  1VQA A;  1HQM C;  3AFP A;  4L6T B;  5I2Y A;  4DAM A;  1PXU A;  1JE4 A;  4BY7 B;  4LFA L;  5C3E H;  2QGQ A;  2SDF A;  4DUZ L;  2VUM H;  4ME3 A;  1IBM L;  1ROD A;  4HED A;  1EIY B;  3OIP A;  3QWN A;  1F9S A;  3DHQ A;  4DV0 L;  1WFQ A;  2V4D A;  2CW0 D;  4NXM L;  1L1O A;  2UUC L;  4K0K L;  3IL8 A;  4TSS A;  5JAV A;  1WTQ A;  3G71 A;  1M4V A;  1EY5 A;  2WIN B;  1LTS D;  2N8N A;  5IGC A;  4QQB X;  2NVT B;  4V0B A;  2F0U A;  2DUD A;  3QOJ A;  4FF1 A;  4I7A A;  4HMJ A;  4X65 L;  5FLM G;  1VQO A;  4FF4 A;  2RKS A;  4MIU A;  1E22 A;  1RKN A;  3OWF A;  4JOI C;  4XT1 B;  1NBW A;  4PMB A;  3OPO A;  3HKZ B;  2A69 C;  3K8A A;  2R7Z B;  1YHA A;  3E9H A;  3J7A F;  3Q24 A;  3VYT A;  1UAP A;  4RG1 A;  4XQQ A;  3GD7 A;  2I5M X;  4ULL A;  2JE6 I;  3K0X A;  2KOL A;  2KQ3 A;  5C0X G;  5ELD A;  1Y1W H;  4CKB A;  5CGK A;  2VB3 X;  4LUZ A;  1EY8 A;  3VR3 A;  1F2M A;  3RLO A;  3M3Y B;  4KV6 A;  1KNA A;  2CW0 C;  3S2H H;  2K1B A;  2BH8 A;  3VYR A;  2VZA A;  1I6H H;  3KK7 A;  3HOX G;  1C48 A;  1Q81 C;  2TSS A;  3HKZ E;  3TZU A;  1S5D D;  2DY7 A;  3NBH A;  2B2U A;  4A3B H;  1CKO A;  4B3R Q;  2HCC A;  4DUY L;  1JIC A;  1QVC A;  5M9O A;  2EY5 A;  3CCJ A;  4B3S L;  3NQI A;  4JYA Q;  1J5E Q;  1HA5 A;  3J7Y W;  3OOC A;  1R4Q B;  4F7X A;  3RZD H;  2WP8 J;  4B9W A;  2ES2 A;  5C4H A;  2EJF C;  5CV8 A;  5IYC H;  4BY7 G;  2L5T A;  3R93 A;  3S1Q B;  1SYB A;  1VF5 C;  3EIV A;  1WTH A;  4RGM A;  4E6I A;  5KIX A;  3GTQ B;  5C6A A;  3A8I E;  3L2P A;  4A3E H;  2RVL A;  2KJX A;  2XVS A;  1JB7 A;  1R9T H;  1RCV D;  3GP7 A;  4A3F H;  4DN4 M;  2PQE A;  3A8K E;  5LL6 S;  2P5Z X;  4IAL A;  1GO3 E;  2F0H A;  1YHB A;  3DXJ C;  3Q6S A;  1B44 D;  2HDM A;  1MI2 A;  3H94 A;  1PYB A;  3NPP A;  4K5V A;  3RLF A;  4LF5 Q;  5C4J H;  3HKZ G;  2R7Z G;  1G91 A;  1FJG Q;  3FKI B;  4IUR A;  2RBM A;  4RH6 A;  3DM1 A;  5EPJ A;  1SE8 A;  4JW0 A;  1SFO H;  3W1G A;  2NN6 H;  4DV4 L;  1VQ6 A;  3EA6 A;  4LF9 Q;  1JJC B;  1YJN A;  4BXX G;  4A3K B;  1CZW A;  5M3F B;  1EZ8 A;  2XRQ D;  2OF1 A;  2B2V C;  4ZK9 B;  5BR8 Q;  5I6W A;  1BDO A;  4OWW B;  2AUJ D;  3MC0 B;  2PNH A;  1S72 A;  4GNX B;  1QVG A;  2KBN A;  2CWA A;  3KF6 B;  3GO5 A;  3X3M A;  3P1H A;  1YZ6 A;  2B2Y A;  1PRT B;  2RDF A;  2XWB B;  4K5W A;  3N6R A;  5ELE A;  3I4O A;  3PIO A;  4DR7 Q;  4TQU S;  4HIK A;  3UE0 A;  1AE3 A;  1CK1 A;  1KDC A;  4ZQ3 A;  1DOL A;  1EWC A;  1SBB B;  4IFD H;  4C3I H;  5CYU A;  4GLX A;  4O0A A;  4BY1 H;  4LF6 L;  2F3V A;  2LKV A;  4A3C G;  1PH4 A;  1KD1 C;  1E24 A;  4MN3 A;  3J80 L;  4OON A;  1Z47 A;  4LFA Q;  4KY7 A;  5EJW A;  2WV6 D;  1HR0 L;  1IBM Q;  3MA2 B;  3FVQ A;  2JK8 A;  4DV0 Q;  4HTH A;  4B9X A;  4I65 A;  3E3X A;  4NXM Q;  2UUC Q;  4PZ7 A;  4K0K Q;  4DV7 L;  2N88 A;  3U4V A;  3PF5 A;  2B3G A;  2IHF A;  1NR2 A;  4KTA A;  4C2M H;  1JOQ A;  1VQ5 A;  3NE5 B;  4LJZ C;  4YHH Q;  5C4X H;  1QB5 D;  1N36 L;  3FKI G;  1LTG D;  4X65 Q;  1WD1 A;  4LUV A;  4DR5 L;  1QWY A;  3I70 A;  3MEF A;  3I73 A;  1JQY D;  2YTV A;  5E4W C;  3J81 E;  2EQS A;  1TWG H;  1HRJ A;  2NZ1 D;  3VR5 A;  3A7L A;  4OIK A;  1NMF A;  5CV6 A;  4A3K G;  4A3I B;  1HNX L;  5M3F G;  2RHS B;  3RZO B;  2ICI A;  1PZJ D;  2K5Q A;  2Y0S B;  2B63 B;  2E2H H;  4X3K A;  1C7Y A;  1YVC A;  4JVZ A;  3GTL H;  1SNM A;  4GKJ L;  4JI0 L;  1J9O A;  4DR6 L;  2IY5 B;  4H44 C;  1XXG A;  1BBX C;  1ESR A;  2R7F A;  5IYB G;  3HOV B;  2XTI A;  4DUY Q;  4CHT B;  3RR5 A;  1SLJ A;  2KCM A;  2SEB D;  3E9I A;  1NJI C;  1RHP A;  4B3S Q;  1S5C D;  4JI7 L;  1L1O B;  2Q2H A;  2NVX H;  1PRT D;  5ELF A;  3T1Y Q;  3D31 A;  2BE5 D;  2Y0S E;  2JA7 B;  3CRK C;  4CDE C;  3VDY A;  3GV6 A;  2UU9 Q;  3NP8 A;  2K03 A;  1EFW A;  1EEF D;  2VW9 A;  5LMN L;  1TWF B;  4DK1 A;  3CRL C;  3NEL A;  3D4D A;  2Q2I A;  3I4L A;  1WTP A;  3EN2 A;  4PMC A;  1IHZ A;  3SDZ A;  5A2Q L;  3MVV A;  3KLS A;  1GOZ A;  4GOP A;  1PH8 A;  4HJ9 A;  1WTV A;  2MP1 A;  1DGS A;  1DOK A;  1BCP B;  4QJF A;  5I4D A;  3WDN A;  2PZT A;  3I2Z A;  1CA6 A;  3S2D H;  4YY3 L;  4CKC A;  4O1N A;  3F1Z A;  5BN5 A;  3K80 C;  4QMG A;  4RGO S;  4GNX C;  3QJY A;  1U4M A;  1Y8N B;  4K6L A;  3EBE A;  1PRT C;  5IWA Q;  5C0X J;  1WTX A;  2C5C A;  3D6C A;  2A1A A;  5JEA G;  2AQ1 B;  2BE5 C;  5M5X B;  2AQ3 B;  5HY6 A;  1Q86 C;  3NBH B;  4OEL B;  2FMC A;  1EL0 A;  4DAP A;  1W3S A;  3TS0 A;  5M5W B;  1HQR D;  1RF2 D;  3EQL C;  4A3I G;  3CPF A;  2A5H A;  2Y0S G;  3CU7 A;  3GTP H;  1D6E C;  2B63 G;  4DV4 Q;  3RNU A;  4DF7 A;  3A5U A;  4PV1 C;  5KND A;  5IP7 G;  4RFB A;  3SK5 A;  1BNZ A;  3S1R H;  1J6Q A;  3HOV G;  1CKN B;  1F2L A;  2QKI C;  5GAD C;  3R3O A;  3Q23 A;  4F87 A;  1V9P A;  1VQG A;  2K5W A;  4DR3 L;  1LAB A;  2F0S A;  5FLX L;  4A4I A;  2JEB I;  1JOR A;  1G8Z D;  4JI5 Q;  2JA7 G;  1A2U A;  1GUS A;  1XPR A;  3J80 c;  4DNR B;  4DV2 L;  4C3H B;  4KN7 C;  2K50 A;  2KVM A;  4XIG S;  1H9R A;  3OW7 A;  4A3M B;  4HCE A;  4FXK C;  3C2P A;  1K8O A;  1A62 A;  1LO5 D;  1HXY D;  3EJI A;  4PZ6 A;  1HUM A;  3S15 H;  1O80 A;  1CZG A;  1G51 A;  3HOU H;  2KED A;  2EYP A;  2IX0 A;  1HR0 Q;  1J8I A;  4IUU A;  3CF5 A;  1Y1V B;  1VQM A;  4A3D B;  4R1J A;  3LWU A;  3JAM E;  1BCP D;  2A74 C;  3DUZ A;  3CQZ B;  3D3R A;  2AHO B;  2F0E A;  2E2I B;  2F0P A;  2EY1 A;  4DR1 L;  1GUT A;  1A8V A;  1MHW C;  2CH4 W;  1HHV A;  3QB3 A;  3MXN A;  1STG A;  1JE5 A;  1SR3 A;  2VQE Q;  2JA8 B;  1LYL A;  3GTQ H;  5L37 A;  3V96 A;  4A3G B;  4UP9 A;  4DR5 Q;  2SOB A;  1UWV A;  1W6J A;  2K75 A;  4JBJ A;  2PW5 A;  3NTH A;  1GD7 A;  1I50 B;  3NXW A;  1SNP A;  2RDH A;  1QIL A;  2J7Z A;  2JA6 B;  1E2Z A;  5JVG 3;  4X64 L;  3LX0 A;  4Y52 H;  1A63 A;  5CBA E;  1HNX Q;  1VQ4 A;  2F3W A;  4CDD C;  2B2W A;  3PUW A;  1DCZ A;  1D5M C;  4RKB A;  3SK8 A;  3IRB A;  3SGI A;  1BCP C;  1DJR D;  1ILQ A;  1QOH A;  2NTS A;  5JJZ A;  3F2B A;  5EBC A;  3EVQ A;  4H02 A;  4GKJ Q;  1BO0 A;  2PMZ E;  2K5H A;  4DR6 Q;  1UE1 A;  3S24 A;  4JG2 A;  4DV6 Q;  4B3T L;  1UEA B;  1HA6 A;  2K6A A;  4DK0 A;  4C3H G;  4PG3 A;  5HUR A;  4JI7 Q;  4FYD A;  1STN A;  2IX3 A;  4Q5V A;  4DXF A;  2B2U C;  3I4M B;  1J5E L;  1N32 Q;  4AQY L;  4A3M G;  4Y7N H;  1QJO A;  4KHZ A;  2NWG A;  5KEE A;  2XIW A;  5LMN Q;  3K5O A;  2F0D A;  4GN5 A;  3H91 A;  3H15 A;  1Y1V G;  4A3D G;  3ULP A;  5M5Y B;  3GTJ B;  3ND8 A;  2HCI A;  2X69 A;  1WI5 A;  2F0J A;  5JVH 3;  2K7V A;  4ZUI A;  1B7Y B;  5D3I B;  1EWI A;  4NMZ A;  4YY3 Q;  4J6H A;  3GTG B;  1TY2 A;  2CH4 A;  2XRS D;  5IYD G;  1OTC A;  1I4P A;  3H6M A;  3RD4 A;  1V8Q A;  3J81 i;  1XPU A;  2JA8 G;  4FO2 A;  1ENC A;  1EWH A;  2VB2 X;  1D7Q A;  3KFU A;  3CCS A;  2CWP A;  1DYQ A;  4A3G G;  1P16 A;  4R4I A;  3HS0 C;  3CC2 A;  4QCL A;  1WCM H;  2OTJ A;  1IBL Q;  4LF5 L;  4C3J H;  1YHQ A;  3S1M H;  4ABN A;  1LLR D;  2NN6 I;  2JA6 G;  1V1P B;  3KLR A;  1EY7 A;  2F0T A;  3S1N B;  1IL2 A;  2F4I A;  1KIX A;  3PCO B;  2Q8R E;  4OO1 G;  3VR2 A;  1X3P A;  1TII D;  1SYF A;  4IPH A;  5G3L D;  2Z0S A;  5FLX c;  3KF8 B;  3T1H L;  4ZKC B;  3PUY A;  4LF9 L;  1AFP A;  1PTO F;  2MPM A;  4N8F A;  1SSO A;  1CHP D;  1N34 L;  4A76 A;  1V1Q A;  4GOP B;  5IT9 L;  1XMO L;  4JK1 C;  1KL9 A;  2RF4 A;  4DR3 Q;  4IN3 A;  1Q8I A;  4J8Q A;  2F0K A;  2R3Z A;  3KDF A;  2KCN A;  4HMI A;  3I4M G;  4IFD I;  2PZU A;  2F4V L;  1MIU A;  5E7N A;  4IUQ A;  3RZO H;  3QIA A;  1Q7Y C;  1LT5 D;  4DR7 L;  1SN8 A;  5JOB A;  3U50 C;  1JMC A;  4RA8 A;  2NVQ B;  2I5L X;  5IP7 H;  4KKT A;  2PNR C;  1WVL A;  1B9N A;  3G6E A;  3PIP 3;  5IP9 H;  2KEC A;  5KRU A;  4DA2 A;  1E1O A;  3S9W A;  3R2T A;  1MBY A;  1LTL A;  5JEA J;  1WYD A;  5CBE E;  1SND A;  1VQD A;  1IL8 A;  2Z8L A;  1HZC A;  4FP5 D;  4WFN 3;  3IFD A;  3MAQ A;  3NQT A;  1K9M C;  5D65 A;  4YIJ A;  1H9S A;  4GLA C;  3TP5 A;  4U68 A;  3T13 A;  3CMA A;  1EYA A;  3RUZ A;  2LSS A;  4OXP A;  4IO9 A;  1HR0 W;  4DR1 Q;  3ND9 A;  1ML0 D;  1B70 B;  1I4R A;  1OXV A;  3FEW X;  4RAU C;  2KHI A;  4YWK A;  1JOK A;  2WII B;  4DK6 C;  1CSQ A;  4EX5 A;  1S40 A;  2F0F A;  5KYL A;  4A93 B;  1OXT A;  2O2L D;  4YHH L;  1C4Q A;  2WAQ B;  3K6O A;  5DM7 3;  1JOO A;  4G4K A;  4CJ0 B;  1KHI A;  3KBX A;  1HCZ A;  1CUK A;  2CVR A;  1XNQ Q;  5LHY 1;  3M7G A;  3K57 A;  2MO1 A;  5DNF A;  1PYW D;  5FJ8 H;  1F2Z A;  1STY A;  1YNJ D;  2DJF C;  2ATW A;  1S4Z A;  4X64 Q;  3PO2 H;  1Q12 A;  3HGB A;  4R8N A;  5HGT A;  2O4X A;  2N78 A;  4A3L H;  2AKW B;  3NUC A;  2EOT A;  2GVA A;  1VQN A;  2A6E D;  4JV5 Q;  3JC6 6;  4XYO A;  2R93 H;  2GA4 B;  2WAQ E;  1I3Q B;  3I4N H;  1X9N A;  1PH3 A;  3J81 L;  3R2I A;  1K3R A;  4DNT B;  1NSN S;  1VF7 A;  1CT1 D;  3S14 H;  4B3T Q;  1V1O A;  1JC7 A;  5AFW A;  2D62 A;  1HZ9 A;  4X66 Q;  2EYH A;  2JP1 A;  4L63 B;  5GAG C;  3S17 H;  4F88 A;  1KXL A;  5AJ3 Q; 
#chains in the Genus database with same CATH homology
 4NXN L;  4C2M H;  4AQY Q;  4DR2 L;  1SMX A;  3T1Y L;  1JJ2 A;  1KRS A;  1VQH A;  1VQ5 A;  3I7F A;  1VQK A;  2IHE A;  4YHH Q;  1QVG A;  3ER0 A;  5C4X H;  3MXN B;  1N36 L;  3FKI G;  4LF8 Q;  4X65 Q;  2HHH Q;  3JAM i;  2UU9 L;  2JA9 A;  4LUV A;  4DR5 L;  1M1K C;  1Y14 B;  3MEF A;  3PUX A;  2YTV A;  4A3B H;  3HFZ B;  3CCQ A;  4L5T A;  4L5S A;  2EQS A;  2N3S A;  1TWG H;  4X6A H;  4DR4 Q;  3CD6 A;  4EQ5 A;  5C44 H;  1HJP A;  3CAM A;  4LUO A;  3JAM c;  4YWL A;  1H95 A;  1NMF A;  4LF6 Q;  1UE6 A;  5LMN W;  4JI6 L;  1VQF A;  4A3K G;  1HNX L;  3STB D;  5M3F G;  3PUZ A;  2RHS B;  1IBK Q;  1PYS B;  1S3O A;  2ZJP A;  2E2J H;  3K7A H;  1FVI A;  2LXJ A;  2E2H H;  2IX1 A;  1UEB A;  1C7Y A;  4JI4 Q;  4A3M H;  4BBR H;  4OWX B;  3GDE A;  1YVC A;  1HNW Q;  3OW2 A;  4APV A;  3GTL H;  4LFB Q;  1VQP A;  5GQO A;  3BU2 A;  4GKJ L;  2PI2 E;  4JI0 L;  3LGJ A;  4A3I H;  4DR6 L;  2IY5 B;  5FJ8 G;  4A93 G;  1G29 1;  4LW1 A;  2B63 H;  2R7F A;  5IYB G;  4GKK L;  2WAQ G;  2XTI A;  3PO2 G;  1D8L A;  4IFD G;  5IWA L;  4DUY Q;  3RR5 A;  4DV7 Q;  4LF7 Q;  1MJE A;  1SLJ A;  2KCM A;  4BY1 G;  1I94 L;  1X3F A;  4A3L G;  2UXC L;  3E9I A;  1NJI C;  4AYB E;  4B3S Q;  1AE2 A;  4A3D H;  3HOY H;  4FDB A;  1Y1W G;  1L1O B;  2Q2H A;  2ZM6 L;  3H0G H;  4JI1 L;  2NVX H;  4JI7 L;  1B8A A;  4DR2 Q;  3T1Y Q;  3D31 A;  2K4K A;  4DV3 Q;  3CQZ H;  2Q2U A;  1HH2 P;  2Y0S E;  3HOV H;  2R93 G;  2IT1 A;  4IPD A;  1N36 Q;  5HGQ A;  1KAW A;  3VDY A;  4P71 A;  1PH5 A;  3I4N G;  3J7A 5;  4IOA A;  2NVY H;  4XTC S;  2UU9 Q;  3AQQ A;  4AIM A;  3D0F A;  1EFW A;  1PHJ A;  4AH6 A;  5IT9 c;  2VW9 A;  2D0O A;  4P72 A;  5LMN L;  2K14 A;  2MQH A;  2JA5 H;  2JA7 H;  3NEL A;  1CSP A;  3CCE A;  4DNI A;  2Q2I A;  3T1H Q;  2HQL A;  1V43 A;  2ZJQ A;  4UY8 C;  1C0A A;  4LF4 Q;  4TVA B;  3STB C;  1MJC A;  3CME A;  3EN2 A;  2UUB L;  2MNA A;  2C35 B;  4GN4 B;  2E5L L;  2FXQ A;  3PO3 H;  4DV5 Q;  1Q1B A;  1YBY A;  4GOP A;  1PH8 A;  4YWM A;  4HJ9 A;  1TWF H;  1DGS A;  3F8T A;  1N34 Q;  1VS0 A;  4BBS H;  4QJF A;  1PVO A;  1K0R A;  1XMO Q;  5C4X G;  1EYG A;  2JA6 H;  3I2Z A;  1EUJ A;  2HIV A;  3S2D H;  4YY3 L;  3BZC A;  2HIX A;  4KHP Q;  5LMU L;  1UE7 A;  1VCI A;  3F1Z A;  1KC8 C;  4JI0 Q;  2HT1 A;  4QY7 A;  4L5R C;  2F4V Q;  3K80 C;  4GNX C;  4JI5 L;  2R7D A;  4GKK Q;  2EXD A;  2RCN A;  3TQY A;  3EBE A;  5IWA Q;  5C0X J;  5JEA G;  1U5K A;  1WJJ A;  2A1A A;  1XMQ L;  3NEM A;  2BA1 A;  3HOZ H;  4B3R L;  2CCZ A;  2A8V A;  5HY6 A;  3TRE A;  4JI2 Q;  1Q86 C;  1HNZ Q;  3NBH B;  4P74 A;  3I55 A;  4PZ8 A;  4HJA A;  4R4Q A;  1PH1 A;  4JI3 L;  1ASZ A;  4WJ3 M;  4JYA L;  4DKA C;  1Q8K A;  1W3S A;  2ID0 A;  3F2D A;  2CKZ B;  3TS0 A;  1YIT A;  3PSI A;  4GN3 B;  3OTO Q;  5M5X H;  3Q8D A;  4KLK A;  4A3F G;  4AYB G;  3G4S A;  3S16 H;  1K8A C;  2WFW A;  4A3I G;  3CPF A;  3U58 A;  1NMG A;  2GN5 A;  2I0Q A;  2Y0S G;  3L7Z C;  1TWH H;  1PA6 A;  2B63 G;  4DV4 Q;  3KLW A;  3GTK H;  3GTP H;  3RNU A;  2OTL A;  4HJ5 A;  5M5W H;  3A5U A;  2E5L Q;  1BBW A;  5IP7 G;  4MZ9 A;  4IPC A;  4JCV E;  5C0X I;  3HOY G;  3S1R H;  3H0G G;  1J6Q A;  4A75 A;  3HOV G;  1CKN B;  3J80 i;  4HIO A;  5GAD C;  4GNX A;  1XJV A;  1N33 L;  1OXU A;  4X62 L;  3RN2 A;  3KF6 A;  3DLL A;  3K81 C;  1V9P A;  1VQG A;  1XNR Q;  2VQE L;  5IE8 A;  1P8L A;  2K5N A;  1PV4 A;  4A3J H;  1LM0 A;  4YCU A;  2JA5 G;  4DR3 L;  3KOJ A;  4A4I A;  2JEB I;  3RN5 A;  2NN6 G;  3ZJY C;  3UDG A;  1ASY A;  4JI5 Q;  1K83 H;  2JA7 G;  1XPR A;  3J80 c;  4QGU A;  3TEH B;  3CCM A;  1NTG A;  4DV2 L;  2B29 A;  1VQI A;  3UDX A;  1W2B A;  3W5O A;  3KDF B;  3PO3 G;  2K50 A;  1YJ9 A;  5K36 G;  2Z6K C;  4XIG S;  1VQ7 A;  4OX9 L;  3TS2 A;  2NZO A;  1JJG A;  3J81 c;  2UUA L;  5J3B A;  3F2C A;  4BBS G;  2OCE A;  4QIW E;  1VQE A;  3U4Z A;  1A62 A;  5GAH C;  4LFC L;  3ICE A;  1FJG L;  1HZB A;  4C3H H;  1TWC H;  4HJ8 A;  4OO1 I;  1WOC A;  4POF A;  4PZ6 A;  4DPG A;  3S15 H;  1Q82 C;  4HID A;  1G51 A;  3PGZ A;  3HOU H;  1M90 C;  1SRO A;  2IX0 A;  1HR0 Q;  1VQ8 A;  4GOP C;  4KI0 A;  3M4Q A;  1EQR A;  5M3M H;  3H3V H;  4B3M L;  3CF5 A;  3A0J A;  3KJO A;  5FLM H;  1MKH A;  1VQM A;  1A0I A;  1IYJ B;  2Q2T A;  4P75 A;  4R1J A;  3HKS A;  3M85 A;  2K5V A;  3GTM H;  3HOZ G;  3S1N H;  2R6G A;  1CKN A;  2AHO B;  4OWT B;  1L2F A;  3W1B A;  4DV6 L;  4JI8 L;  1CKM A;  4DR1 L;  1N33 Q;  1A8V A;  5H1S E;  1Y1V H;  2LXK A;  5BR8 L;  2K52 A;  2KHJ A;  4BA1 I;  4NXN Q;  5GAE C;  1JE5 A;  1SR3 A;  2VQE Q;  1N32 L;  1LYL A;  3CCV A;  2E2I H;  3GTQ H;  2Z6K A;  2PI2 A;  3UDI A;  1BBU A;  2BA0 A;  4UP9 A;  4DR5 Q;  3AFQ A;  4IJH A;  4DV2 Q;  3GTO H;  1UWV A;  1X54 A;  2K75 A;  2ZTC A;  3AYH B;  4JBJ A;  2QA4 A;  5IYD H;  2YTY A;  4O2D A;  2UXB L;  3ERS X;  5JJL A;  2JA8 H;  1GD7 A;  1QZG A;  3HOX H;  3UE1 A;  2KCT A;  3TRZ A;  2UUA Q;  4A3G H;  1O7I A;  2PQA B;  4ALP A;  1QUQ B;  4X64 L;  3HOW H;  1L0W A;  1JT8 A;  4JI6 Q;  1BKB A;  2R92 H;  3PF4 A;  4Y52 H;  1HNX Q;  1VQJ A;  2VQF L;  1A63 A;  1VQ4 A;  3AEV A;  1VQL A;  1X3G A;  4GLV B;  1I50 H;  4YCV A;  3CCU A;  1OXX K;  1VQA A;  2H5X A;  3PUW A;  3J7Z C;  3AFP A;  2NVQ H;  1NE3 A;  4DAM A;  3M4O H;  3IRB A;  1S72 A;  3SGI A;  4LFA L;  3CW2 C;  2I5H A;  2QGQ A;  5C3E H;  2VUM H;  3F2B A;  1OXS C;  1YEZ A;  4DUZ L;  4H02 A;  4GKJ Q;  2PMZ E;  2AMC B;  1QZH A;  1Q1E A;  2K5H A;  4ME3 A;  1IBM L;  4DR6 Q;  1EIY B;  1UE1 A;  3S24 A;  4YCW A;  2YTX A;  4JG2 A;  4DV6 Q;  4DV0 L;  5C44 G;  1WFQ A;  4DV1 L;  3OYY A;  4B3T L;  4NXM L;  4BY7 H;  5JJK A;  1L1O A;  2UUC L;  4K0K L;  2UXC Q;  1T9H A;  3CC7 A;  1YIJ A;  1I94 Q;  1QVF A;  2ZTD A;  1EIF A;  4PG3 A;  3CCL A;  4L5Q A;  4JI7 Q;  2ZM6 Q;  1IBL L;  4JI1 Q;  2WB1 E;  3G71 A;  1X65 A;  2N8N A;  5IY0 A;  4POG A;  3HOU G;  4QQB X;  1J5E L;  1N32 Q;  4AQY L;  4A3M G;  3KYH C;  4Y7N H;  1EOV A;  4BBR G;  2DUD A;  4KHZ A;  1NY4 A;  5FLM G;  4X65 L;  4LF8 L;  1VQO A;  3PUV A;  5LMN Q;  2AWN A;  3J81 j;  4HJ7 A;  2OQ0 A;  1E22 A;  4JOI C;  2F52 A;  2HHH L;  4QL5 A;  3CCR A;  4IPG A;  1NBW A;  1FGU A;  3FHW A;  1SRU A;  3I4M H;  1XTD A;  3BZK A;  3PV0 A;  2NVT H;  4WJ4 A;  3K8A A;  4GN5 A;  1YNX A;  2QEX A;  1YHA A;  4UPA A;  2UUB Q;  3E9H A;  4DAY B;  3H15 A;  1Y1V G;  4A3D G;  4RG1 A;  1IZ6 A;  3ULP A;  3I56 A;  3GD7 A;  2I5M X;  1Z9F A;  2VQF Q;  1PH9 A;  3DM3 A;  2JE6 I;  2ALY B;  1WI5 A;  3CP0 A;  3K0X A;  5C0X G;  2ASB A;  1Y1W H;  2R7Z H;  1IBK L;  4R4T A;  1TXY A;  1B7Y B;  4LUZ A;  1EWI A;  2KEN A;  4YY3 Q;  5LMU Q;  3RLO A;  4DUZ Q;  4R4O A;  5M5Y H;  5IYD G;  3GTJ H;  1OTC A;  1HNW L;  2JJQ A;  3J81 i;  1XPU A;  2JA8 G;  2BH8 A;  3S2H H;  2VZA A;  1I6H H;  3HOX G;  1D7Q A;  1X55 A;  1Q81 C;  1YI2 A;  3KFU A;  3HKZ E;  4B3R Q;  3CCS A;  2CWP A;  4RMF A;  4DV1 Q;  3M7N A;  1P16 A;  4R4I A;  4A3G G;  1XMQ Q;  3HOW G;  1CKO A;  1U0L A;  1HZA A;  2YV5 A;  1GM5 A;  2GVB A;  4DUY L;  3CC2 A;  1K73 C;  3GTG H;  3M3Y H;  4BXX H;  4LF7 L;  1QVC A;  1WCM H;  4P73 A;  2OTJ A;  2L15 A;  1IBL Q;  4LF5 L;  4JBM A;  3CCJ A;  2OQK A;  4LWC A;  4B3S L;  4JI3 Q;  4C3J H;  1YHQ A;  1K8G A;  4JYA Q;  4JBW A;  1UE5 A;  4JOI A;  1J5E Q;  3S1M H;  3FP9 A;  2NN6 I;  2JA6 G;  4DV3 L;  1I5F A;  5C3E G;  2VUM G;  2RHQ B;  3RZD H;  1IL2 A;  1KIX A;  2WP8 J;  4IFD J;  3PCO B;  2WB1 G;  4OO1 G;  2ES2 A;  3NEN A;  5IYC H;  1GVP A;  4IPH A;  4BY7 G;  2Z0S A;  3L0O A;  5FLX c;  3KF8 B;  3T1H L;  3PUY A;  2OWO A;  4LF4 L;  4LF9 L;  3EIV A;  4GS3 A;  2BH2 A;  1X3E A;  1RIP A;  4DV5 L;  1XNR L;  1YJW A;  3A5Z B;  2JQO A;  3L2P A;  1N34 L;  5DLQ E;  4A3E H;  4A76 A;  4X62 Q;  1V1Q A;  4GOP B;  3CPW A;  2E8G A;  3S1Q H;  1XMO L;  4A3C H;  1E3P A;  1JB7 A;  1KL9 A;  1L1O C;  2RF4 A;  4DR3 Q;  1R9T H;  3G48 A;  4KHP L;  4A3F H;  2MFI A;  3KDF A;  2DGY A;  1TWA H;  3M9B A;  3I4M G;  4IFD I;  1Q46 A;  2F4V L;  1MIU A;  5E7N A;  5ELO A;  1GO3 E;  3RZO H;  1VQ9 A;  4JBK A;  1YHB A;  4LNQ A;  1XNQ L;  1Q7Y C;  4OX9 Q;  1SN8 A;  3BJU A;  4DR7 L;  1PYB A;  4DK3 C;  3U50 C;  4JC0 A;  1JMC A;  2UXD L;  2I5L X;  3RLF A;  5IP7 H;  4LF5 Q;  2AWO A;  1HNZ L;  4JI2 L;  5C4J H;  2D0P A;  3WWV A;  3G6E A;  3HKZ G;  2EIF A;  5IP9 H;  2F3I A;  4LFC Q;  2R7Z G;  1FJG Q;  1KRT A;  1AH9 A;  1PFS A;  1E1O A;  1EQQ A;  3KJP A;  4A3J G;  3OTO L;  3ULJ A;  4JV5 L;  1LTL A;  1SE8 A;  2YU9 H;  5JEA J;  3K7U C;  1WYD A;  1G6P A;  1VQD A;  1VQC A;  1SFO H;  3W1G A;  4B3M Q;  3FKI H;  1HZC A;  1FL0 A;  4MTN A;  4DV4 L;  1VQ6 A;  2XGT A;  4A3B G;  1E1T A;  1N8R C;  1K9M C;  1JJC B;  4LF9 Q;  1YJN A;  4BXX G;  5JJI A;  4GLA C;  1WCM G;  1PH2 A;  3CMA A;  1LUZ A;  2LSS A;  3CXC A;  4JI8 Q;  1KQS A;  2CQO A;  4IJL A;  4OXP A;  4IO9 A;  4DR1 Q;  1HR0 W;  5EAY A;  1XPO A;  2VL6 A;  5BR8 Q;  4X66 L;  3ULL A;  1B70 B;  1OXV A;  1C9O A;  5ELN A;  2KHI A;  5AJ3 L;  4YWK A;  4OWW B;  1IXR A;  4A3K H;  1BVS A;  2CFM A;  4NPS A;  2PNH A;  1CSQ A;  2N49 A;  3E0E A;  4DK6 C;  4EX5 A;  1VQB A;  5M3F H;  3A74 A;  4GNX B;  2KBN A;  1S40 A;  1GKH A;  1OXT A;  2CWA A;  4R4C A;  2YYZ A;  3GO5 A;  3KF6 B;  2VY3 A;  5M3M G;  5IYC G;  4YHH L;  1YZ6 A;  1KHI A;  4UP7 A;  4IOC A;  2UXB Q;  1CUK A;  3I4O A;  3PIO A;  1XNQ Q;  4DR7 Q;  3UDF A;  2UXD Q;  2PQA A;  1QUQ A;  4TQU S;  4HIK A;  2MO1 A;  3UE0 A;  1AE3 A;  5FJ8 H;  1PH6 A;  4A93 H;  4MNO A;  5IYB H;  2ATW A;  4X64 Q;  3PO2 H;  4DR4 L;  2ZJR A;  4C3I H;  1Q12 A;  4O0A A;  4GLX A;  4A3E G;  4BY1 H;  3H3V I;  4LF6 L;  2N78 A;  2JEA I;  2AKW B;  4A3C G;  4A3L H;  2MO0 A;  2GVA A;  2V1C C;  3RLN A;  1VQN A;  1PH4 A;  4JV5 Q;  2ZTE A;  2VS1 A;  1E24 A;  3JC6 6;  1KD1 C;  4OON A;  1Z47 A;  4LFA Q;  2R93 H;  4JI4 L;  2WAQ E;  4NB3 A;  4HIM A;  3B6Y A;  3CC4 A;  3I4N H;  1X9N A;  2A19 A;  1PH7 A;  1PH3 A;  1HR0 L;  1X6O A;  1IBM Q;  4LFB L;  4UP8 A;  1E7Z A;  4PMW A;  1K3R A;  4BA2 I;  2JK8 A;  1RL2 A;  4DV0 Q;  3S14 H;  4B3T Q;  4NXM Q;  5GRO A;  2VNU D;  2UUC Q;  4PZ7 A;  4K0K Q;  2NZH A;  5IP9 G;  1I3Q H;  2D62 A;  3PIP A;  3M4P A;  1HZ9 A;  4DV7 L;  2R92 G;  1X56 A;  4X66 Q;  5GAG C;  3S17 H;  4J15 A;  3U4V A;  1KXL A;  3PF5 A;  2B3G A;  5AJ3 Q;  1N9W A;  2IHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...