3HOZH

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
146
structure length
136
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 19
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hozH00
1P16A 4DR3L 3M4QA 4QL5A 1KRSA 2WAQE 1HNZQ 4DV7Q 4APVA 4L5SA 4DNIA 3M85A 1N9WA 1HZ9A 1NMGA 3CCRA 3E9IA 2ALYB 2K5NA 1TWHH 2CWAA 3PGZA 1L1OB 4DPGA 2EIFA 4LFCL 1YHQA 4QJFA 1V43A 2CKZB 1C0AA 1Y1VG 4YWLA 4JI7Q 1W3SA 3J80i 3I4MG 3PO2G 4OWXB 3PUWA 1UE1A 2E5LL 2UUAQ 3PSIA 4A3CG 2LXKA 3J7A5 4DR5Q 1VQIA 2KENA 4GS3A 4DV1Q 4QIWE 3J81i 3T1HQ 1XMQL 3M4PA 4JI3Q 2QA4A 1BBUA 1S72A 4HJAA 4B3SL 1VQGA 1CUKA 4ME3A 3K7AH 4OO1G 3I7FA 4DR2L 2UUBL 3G71A 3UDXA 3I56A 1ASZA 4JYAL 5ELOA 1L2FA 1C7YA 2VNUD 3BZCA 1JE5A 1YBYA 2UXBL 2CQOA 3EIVA 3ERSX 2Q2IA 1MKHA 1XMOL 4L5RC 3A5UA 2QGQA 4YY3Q 5FJ8H 3HOYH 3A74A 3RN5A 4R4IA 4LFAQ 1CSQA 2KBNA 1PHJA 3UE1A 4OXPA 1D8LA 4PZ6A 1PH4A 2GVAA 4AQYL 4Y52H 5C4XG 1G291 2LSSA 3PUZA 3ULPA 1J5EL 1JJ2A 1FJGL 4LF7Q 1Q1EA 1PA6A 3RNUA 2E2IH 3PF4A 2R93G 4UP9A 4IPCA 5AJ3Q 1VQ8A 1IZ6A 4AIMA 5M5YH 1RL2A 1C9OA 3AFPA 2BH2A 2HHHL 1HH2P 1KRTA 4DR1L 2B63G 4A3KG 3PO3H 2ZTDA 3AFQA 3RLOA 4JI5Q 1XNRQ 2NN6I 1S3OA 2VQFQ 5IP7G 4BBSG 1NY4A 4HJ5A 1K8GA 1HNXQ 1FL0A 4WJ3M 2B29A 5M5XH 4BA1I 3JAMc 4YHHQ 1L1OA 4DAMA 4JI8Q 3RLNA 3HKZG 1MJEA 4JI1Q 1M1KC 3HOWG 3W5OA 1Y1WG 2MFIA 2PMZE 2AMCB 3GO5A 3SGIA 4C3IH 5LMUQ 1J6QA 1OXXK 3TS0A 2WB1G 1A8VA 3OTOL 1VQDA 1Y1VH 4MZ9A 1OTCA 1XPUA 2F3IA 3I4MH 3S14H 3PO2H 1JT8A 1Q7YC 2L15A 4IOCA 1CKOA 2UU9L 1HNWL 4LFCQ 3K81C 1PH5A 4DR6Q 4LUZA 2ZJQA 1GO3E 3I2ZA 5C0XI 1Q86C 2ZM6Q 4DK3C 2XTIA 1YHBA 1U0LA 1VCIA 3L0OA 4PG3A 4P72A 3EBEA 4WJ4A 2UXCL 1VQ9A 4LF8Q 1YNXA 3J81j 2JA8G 4JI0L 1SN8A 3K8AA 4MNOA 4LF5Q 4A4IA 1KIXA 4B3SQ 4A3IG 2WAQG 1N34Q 3GD7A 1L1OC 1N33L 5C0XJ 2EQSA 1HR0L 2HIXA 3HKSA 4DR2Q 1PH2A 2JE6I 3KF8B 4LF9L 1QZHA 4JYAQ 1X6OA 1JJCB 3CC4A 4GN4B 1FGUA 3HOZG 2UXBQ 5M3MG 2KCTA 1XMOQ 1JJGA 2K50A 5C4XH 2K14A 3HOXG 5GQOA 3GTKH 2R93H 3F1ZA 2N49A 3NBHB 3F2DA 1K3RA 4IPGA 5FLMG 4PZ8A 4K0KL 1D7QA 3H0GG 3I4NH 5K36G 3FHWA 3U50C 5C3EG 4AQYQ 1I94L 3S1NH 1J5EQ 4JV5L 1LUZA 3Q8DA 4OONA 1VQKA 1G6PA 2B63H 1O7IA 2IX1A 4A3KH 1XPRA 2PNHA 5M5WH 1KL9A 3I55A 1Q82C 5IP7H 1IYJB 4GOPB 4NXML 1U5KA 1PYSB 4P74A 5FLXc 4BBSH 3TREA 4DV0Q 2VZAA 2MNAA 1VQ7A 2IX0A 3CAMA 3MEFA 5IYDG 4DR1Q 5M3FG 1YJNA 1IBKL 2LXJA 1IBLL 1SLJA 1P8LA 5GAEC 4P73A 1Y1WH 2F4VQ 1VQCA 4Y7NH 4UP8A 4A3FG 1X65A 5EAYA 1OXVA 4YCWA 2JA9A 2RCNA 4FDBA 4B3RQ 5JJLA 4OO1I 4OX9L 4JOIA 1UE6A 3CD6A 4BA2I 3BJUA 2DGYA 3CCQA 1VQFA 1WCMG 3CQZH 4POFA 2NVQH 2AHOB 3S24A 4IO9A 1SR3A 4DV3Q 3KDFB 4XIGS 3RR5A 4J15A 5BR8L 2VQEL 4X66L 1X9NA 1TWGH 1K0RA 2ZJPA 2VL6A 3CPFA 2KHIA 2VS1A 4LF6L 3D0FA 4YWKA 4C2MH 1PH9A 4JI4L 2UU9Q 5IYCG 2R92G 1QUQB 3BU2A 4B3MQ 3CPWA 4UY8C 2JA8H 1X3EA 3PIPA 1VQ4A 1X55A 1VQOA 4GKKQ 2VW9A 1YVCA 3PF5A 4NXNQ 1UE5A 3W1BA 4KI0A 4R1JA 3JC66 4A3IH 1N36L 2WFWA 4HIOA 2UXCQ 1E1TA 4X6AH 1YZ6A 3G6EA 2Y0SE 2E2HH 4A3JG 4JI0Q 1VQPA 4JG2A 4DV2L 1KHIA 1Q12A 4JI2L 4JBWA 3PV0A 1IL2A 2OTJA 1MIUA 4JBJA 3S16H 4POGA 4DV4Q 2RHSB 4JOIC 2B3GA 3HOZH 5M3MH 4DV6L 4PMWA 3PUXA 4HIKA 4GKJL 1N32L 3NELA 1UE7A 1YEZA 3CCVA 3K7UC 4GN3B 2NVXH 3RLFA 3HOXH 4A93G 4HIMA 2OWOA 1E3PA 1Z47A 2NZHA 1NTGA 5FLMH 2YYZA 1CSPA 3M9BA 1EYGA 2BH8A 1E22A 1PVOA 3F2BA 2JA5G 3B6YA 4A3MH 5IT9c 2EXDA 2CCZA 4BBRG 2QEXA 1VQNA 2Q2TA 1K9MC 5J3BA 1VQMA 4JBKA 4X65Q 2YTYA 1B7YB 5C44G 4HJ8A 4K0KQ 1W2BA 4R4CA 4JI6Q 1I94Q 2OQ0A 4NB3A 4DV5Q 1HR0W 4KHPQ 5H1SE 2ZTCA 1S40A 4IPDA 5M3FH 2AWNA 4NXMQ 4H02A 2N78A 3A5ZB 1MJCA 2N3SA 3KYHC 1XTDA 3NENA 2UUCL 3S1RH 2JEBI 3KDFA 1WCMH 4DR3Q 1I6HH 3K0XA 2K4KA 3GTJH 1XPOA 1K8AC 4OX9Q 1E7ZA 3F2CA 5DLQE 3T1YL 4A3BG 1QUQA 3RN2A 4JI6L 2YTVA 1TXYA 4AYBE 4LUOA 3H15A 2Z6KA 3M7NA 5IYCH 1LM0A 5JJKA 4QY7A 1SE8A 1OXSC 2NVYH 3CCLA 2VQEQ 2VUMG 4DR7L 4X64L 3NEMA 1KQSA 3K80C 1OXTA 4YCUA 1QVCA 1B8AA 3FP9A 4EX5A 4DV7L 2E5LQ 3CCEA 2ZTEA 4UPAA 1KC8C 2D0PA 2CWPA 1CKNB 1XMQQ 1Z9FA 4A3JH 2JJQA 1VQ6A 4YWMA 4DUYL 2ATWA 1JB7A 2FXQA 1A0IA 3CXCA 1N36Q 3GTQH 1AE2A 4JI7L 2V1CC 4LF4L 2H5XA 3HOUG 3GDEA 4DUZL 2UUBQ 4DV2Q 3J7ZC 4DR4L 1V9PA 3CP0A 4R4OA 4JI2Q 3HOVG 3S1QH 4DV1L 4LFBL 4A93H 1TWCH 5GROA 4A3GG 2K75A 2OCEA 2R6GA 4LF8L 5GAGC 3S2HH 4IOAA 2K5HA 3RZOH 3DM3A 1G51A 1T9HA 4BBRH 1EIYB 2ES2A 1H95A 3CW2C 1PV4A 2PQAB 3GTGH 2K5VA 5IP9G 5C44H 3BZKA 3J80c 3JAMi 2Q2UA 4L5QA 1FJGQ 1IXRA 2I5HA 1XJVA 4BXXG 2OTLA 3PIOA 4YY3L 4R4TA 1FVIA 3J81c 5IYBG 2Y0SG 1PH6A 3H3VI 1VS0A 2R7FA 3GTOH 2R7ZG 3TS2A 5HY6A 4O2DA 2HHHQ 3HKZE 3G4SA 1K73C 2I0QA 1VQEA 2NZOA 2A8VA 1NE3A 4GNXB 3HOYG 1V1QA 4GLXA 1WJJA 4O0AA 3HOWH 4P75A 4BY1G 1WI5A 1RIPA 3CMEA 5AJ3L 4A75A 3E9HA 1IBML 3CCMA 1YHAA 1UEBA 3U4VA 2AKWB 4A3BH 3W1GA 4OWWB 4IFDG 2BA1A 5IWAL 3ULJA 1PH7A 1M90C 1X56A 3UDGA 1HJPA 1VQJA 1Y14B 3ICEA 3OTOQ 2VQFL 2VUMH 4L5TA 1JMCA 1KXLA 4GLVB 1CKNA 1VQHA 4TVAB 3UDFA 1HNXL 2YU9H 1E24A 4YHHL 1HNWQ 4JI8L 2RHQB 1Q81C 3VDYA 4DR7Q 2MQHA 4X64Q 4B3TL 1BKBA 4IJLA 1I3QH 1AE3A 2HIVA 2AWOA 3AYHB 5LMUL 1SRUA 2E8GA 1BVSA 5HGQA 1QVGA 1VQ5A 3EN2A 3HOUH 4X62L 3CCJA 3HOVH 1L0WA 4DUYQ 3FKIG 4DR6L 1B70B 2UXDL 3G48A 2IHFA 1N33Q 4UP7A 4HJ7A 1YITA 2ZM6L 1XNQL 2JA7G 1HR0Q 4DKAC 4A3GH 3LGJA 4LF4Q 2R7DA 4DUZQ 4DAYB 4DR4Q 3I4OA 2PQAA 4LF9Q 5ELNA 1PH8A 4AYBG 4C3JH 4LFBQ 3KF6B 4EQ5A 4LF5L 4XTCS 3TQYA 1QVFA 3CC2A 3UE0A 5IP9H 3H0GH 3KJPA 3OW2A 4A3EG 1VQBA 1Q1BA 5E7NA 5C3EH 1N34L 4JBMA 2HT1A 2WP8J 3S1MH 3U4ZA 4KLKA 2D62A 5LMNL 4GOPA 1I5FA 4RMFA 4BY7G 4BXXH 2JEAI 4P71A 4A3DG 1TWAH 2CFMA 1R9TH 5IYBH 1GD7A 1PYBA 1TWFH 2KHJA 1EQRA 3STBC 3DLLA 4GNXA 2R7ZH 4A3LG 2DUDA 3ULLA 2KCMA 3KJOA 3CMAA 4JV5Q 3ER0A 5JJIA 4HIDA 1PH1A 5IYDH 2I5MX 4C3HH 3GTPH 3D31A 2F52A 2OQKA 3STBD 3CC7A 2NVTH 4ALPA 4A3FH 1KD1C 5GAHC 4IJHA 4PZ7A 4BY1H 1EWIA 3UDIA 2YTXA 1IBKQ 1IBLQ 1WOCA 3PCOB 1AH9A 2MO1A 4LNQA 2N8NA 2MO0A 3TEHB 2IY5B 4LW1A 4DK6C 5GADC 1BBWA 2IHEA 3M4OH 3S2DH 1IBMQ 1HZAA 3I4NG 1EUJA 4OWTB 4YCVA 1WYDA 4DV0L 1EIFA 5IWAQ 3H3VH 4GOPC 3L7ZC 1A62A 4MTNA 1SFOH 1HZBA 1YIJA 2R92H 5BR8Q 2F4VL 4X66Q 3U58A 2JA6G 4GNXC 3KLWA 4B3RL 1HNZL 4LF6Q 3AQQA 3PUVA 1EQQA 4JI4Q 2GN5A 1GVPA 2Q2HA 1NJIC 1VQLA 4TQUS 2XGTA 4B3TQ 1KAWA 4DV3L 2PI2A 1YJWA 3F8TA 3FKIH 1GKHA 4HJ9A 4LUVA 2YV5A 1X3GA 2JA7H 1SROA 4JC0A 2IT1A 3KF6A 1CKMA 1UWVA 4X62Q 4A76A 2E2JH 2UUAL 1YJ9A 4DR5L 3IRBA 4B3ML 2UXDQ 4RG1A 1PH3A 4JI3L 4AH6A 3T1HL 1XNQQ 2JK8A 4NXNL 3KFUA 2VY3A 4DV6Q 4GKKL 2NN6G 1Q8KA 2GVBA 4A3EH 1N8RC 4A3CH 2JQOA 4GKJQ 1N32Q 2JA5H 1NMFA 2Z6KC 1Q46A 3L2PA 4QQBX 4BY7H 4IFDI 4A3DH 2ID0A 2C35B 2PI2E 4KHZA 4DV4L 5IY0A 2ZJRA 2A1AA 5LMNQ 1DGSA 3RZDH 1ASYA 3S17H 4A3LH 2ASBA 3HFZB 3A0JA 1EOVA 1VQAA 3M3YH 1PFSA 3GTLH 4LWCA 3KOJA 2I5LX 4LFAL 1EFWA 3MXNB 4IFDJ 1NBWA 2A19A 5C0XG 4NPSA 3CF5A 3TRZA 5FJ8G 3OYYA 1HZCA 3S15H 1A63A 2Z0SA 5JEAJ 1X54A 4JCVE 1QZGA 1GM5A 2WB1E 4LF7L 3PUYA 1SMXA 4X65L 2UUCQ 1LTLA 1I50H 1OXUA 5C4JH 4GLAC 1X3FA 1E1OA 4QGUA 5LMNW 4A3MG 1LYLA 2D0OA 2HQLA 4R4QA 4IPHA 5IE8A 5JEAG 4DV5L 3GTMH 2RF4A 4KHPL 3E0EA 1XNRL 4JI5L 3WWVA 3AEVA 3T1YQ 2BA0A 2JA6H 1WFQA 3ZJYC 1YI2A 3CCUA 3PO3G 4GN5A 4JI1L 3CCSA 1K83H 2K52A
chains in the Genus database with same CATH superfamily
4DR3L 3M4QA 3UI2A 2WAQE 4ZRZA 2EE1A 2M2LA 4APVA 4DV7Q 3S2HB 3M85A 2JA5B 3K58A 3RZOB 2FFKB 3E9IA 1TWHH 5BN5A 2EJFC 1JWMD 3M3YB 4B9WA 3PSIA 4BS9A 3KK7A 3NXWA 1EY7A 2PCFB 1VQIA 4DR5Q 3T1HQ 2QA4A 3V96A 5LHY1 1H9MA 4FXDA 3K59A 3ZYYX 1CK1A 2K5WA 1CUKA 3EJIA 3MXNA 5I6YA 2HCIA 3NE5B 5C4JB 1AEXA 3MEHA 1YBYA 1XMOL 5C0XH 3HOYH 4TRDA 3Q22A 2F0MA 4RGTA 1CSQA 2KBNA 3T16A 4C1NK 1D8LA 4IFDH 2GVAA 4F8MA 1WTXA 3PUZA 3ULPA 1FJGL 5C4XG 3MAQA 2A74C 5JEAH 1Q1EA 1PA6A 2E2IH 1SYDA 4IPCA 5CGKA 1BO0A 1IZ6A 1RL2A 2JYOA 3AFPA 1JORA 1WD0A 4DR1L 2ZTDA 2HCCA 3AFQA 4ZKCB 3OMGA 4U68A 5CR3A 1J9OA 1K8GA 4A3GB 1HNXQ 1FL0A 1PFNA 4WJ3M 5M5XH 4YHHQ 1QNKA 2O5IC 4DAMA 1MJEA 3HOWG 1M1KC 1SAPA 2PMZE 3GO5A 3SGIA 4XYQA 4RHSA 1U4PA 4MZ9A 1XPUA 1PRTB 3IKJA 2UU9L 2R7ZB 1I4HA 2ZM6Q 2EOTA 5JOBA 2XTIA 3C46A 1VCIA 3EBEA 2UXCL 1VQ9A 2JA8G 3J81j 1BUVT 4LF5Q 3K8AA 3IFDA 1SE2A 1N33L 1S5CD 5C0XJ 2EQSA 4C56C 3IL8A 1S5BD 3S2DB 1QZHA 1SXTA 1I4QA 1KNAA 1LO5D 1XMOQ 1EEFD 1DM0B 4HMIA 1OO9B 5CV7A 3GTKH 2PW5A 2N49A 3NBHB 1H9SA 2A6EC 1WTHA 3F1ZA 2OXPA 3F2DA 3N6RA 3FHWA 2DNEA 1LUZA 4OONA 2IX1A 4ILWA 3I55A 2JA7B 4L63B 1LT6D 2VZAA 1NNXA 4DR1Q 3MEFA 5IYDG 3MXPA 1EY9A 1CZWA 4UP8A 4A3FG 1X65A 4YCWA 2JA9A 4B3RQ 4FDBA 4A3EB 4OO1I 2BDOA 2DGYA 1WCMG 3S24A 5KYIA 1SR3A 4ZCKA 4DV3Q 3D6WA 4K5VA 1ESFA 4KKUA 2J4XA 5M9OA 1K0RA 3CPFA 2FINB 2VS1A 4YWKA 1PH9A 4JI4L 2UU9Q 3GTLB 1K0SA 3BU2A 1VQ4A 1VQOA 1VF5C 3PF5A 1XTCD 4A3IH 2WFWA 4HIOA 2UXCQ 3LWEA 1E1TA 4CDEC 1KHIA 2DJGC 4JI2L 2F0HA 1IL2A 1MIUA 1PFMA 4M1UB 2F0DA 3HOZH 1SE3A 4PMWA 1I6VC 1RHPA 3CCVA 2NVXH 4A93G 1M8AA 4PQXA 1Z47A 1EYGA 3HKZB 1E22A 3MZ5A 3F2BA 2ICEC 3B6YA 4A3MH 4BBRG 1GHJA 1K9MC 4X65Q 2YTYA 1B7YB 4HJ8A 2WKDA 3DEPA 4NB3A 1STBA 4KHPQ 4CKEA 1DXMA 5H1SE 2ZTCA 5M3FH 3OOCA 1HTPA 1DD2A 2N78A 2K03A 1TS2A 2J0TD 3P1HA 4UHVA 4C2MB 2UUCL 3L9AX 1PFBA 3QWNA 3KDFA 2KEDA 3Q0AA 2K4KA 1XPOA 1CTMA 1V1PA 5DLQE 4A3BG 1QUQA 1ET6A 4RGMA 4WORA 1WD1A 3M7NA 3H15A 5JJKA 3QG1A 3NEMA 1QVCA 2H4OA 1IYUA 1STNA 2D0PA 2CWPA 1CKNB 5ELDA 1XMQQ 4A3JH 1VQ6A 4YWMA 4DUYL 2ATWA 1G91A 1JB7A 3CU7A 3QR8A 1B9NA 4LF4L 1GUGA 3GDEA 1O7YA 4DUZL 2UUBQ 1MSHA 3CP0A 4R4OA 4JI2Q 4KJOA 2Q8IB 1ICWA 3I73A 4WRDA 1BF4A 1SMYD 2K5HA 4HCEA 4C3JG 2ES2A 1H95A 1KDCA 2IW3A 3S1RB 5C44H 3JAMi 4OIKA 1SYBA 2I5HA 1EZ6A 4YY3L 1FVIA 5IYBG 2Y0SG 5CYUA 3H3VI 3HKZE 1SJHD 3G4SA 2F3WA 3I3CA 2NZOA 4C3HG 3RD4A 3HOYG 1GUSA 4JW0A 4XT1B 4EQPA 4G7ZC 4ID6A 1RIPA 2AUJD 2F4IA 3U4VA 4IFDG 5FK9C 1SYEA 4KY5A 1IKMA 3ULJA 4ZLTF 1VQJA 3ICEA 3OTOQ 2VUMH 3GTQB 1JMCA 3W2DA 2YU9H 2RDHA 1E24A 1GJXA 1CA6A 1RCVD 3T53B 4RKLA 1S5DD 3BDLA 4B3TL 1TWCB 1I3QH 1AE3A 5LMUL 1SRUA 5C4XB 1VDZA 1HQMC 2F0LA 2F0PA 1QVGA 3M7GA 1VQ5A 3HG9A 4X62L 2XRQD 3CRKC 4DUYQ 3HOVH 1YITA 4DKAC 2K04A 4LF4Q 4DUZQ 4LF9Q 5ELNA 2A6HC 3KF6B 3TQYA 1EY0A 4RWSC 3HOWB 1NSNS 2WV6D 3U4ZA 4BWGB 3QJYA 4GOPA 1RTOA 4BXXH 3MA2B 1TWAH 2Z1CA 4IUUA 3V05A 1R9TH 1LTID 1PYBA 2KHJA 3DLLA 4GNXA 4KY6A 1CA5A 3ER0A 5JJIA 4IUVA 1JB3A 2IJ0A 2F52A 4ZYSA 2NVTH 1F77A 2EYJA 2K6AA 2QKIC 4BY1H 1SYCA 4KK7A 4R8IA 2H1EA 4XT3B 2YTXA 2JA8B 3PCOB 1FR3A 5GADC 1HZAA 1BOSA 1EUJA 4YCVA 1WYDA 1GUTA 2CW0C 3AU7A 4QUCA 3HOUB 4GOPC 4MTNA 1SFOH 2IWHA 4S3SA 4OIJA 4X66Q 2JA6G 3URYA 2B2YA 4GNXC 1HFNA 1F2LA 1ZKOA 4KJNA 1ZEQX 2KA7A 3A55A 5J1ZA 1X3PA 4TQUS 4B3TQ 4QIWB 1HA6A 4DAYA 4HJ9A 1JR0D 3BYYB 2YV5A 3S1MB 3TP6A 4MTKA 1PDQA 1CKMA 4X62Q 4A76A 1J8IA 2DY7A 2LMCB 3IRBA 1PH3A 3QIAA 4JI3L 4AH6A 4GKKL 4G57A 4NXNL 4DV6Q 5C3XA 2F0TA 3R8BA 3GTPB 1N32Q 2Z6KC 4KN4C 5K5PA 2V4DA 4A3FB 4QQBX 1ML0D 4BY7H 1EU3A 4A3DH 2DY8A 2ID0A 1SYGA 2C35B 2PI2E 5KNDA 1WCMB 4DV4L 2A1AA 4A3LH 2L0CA 3S17H 1TT2A 1SYFA 3HFZB 2ASBA 1JOKA 4LWCA 1HHVA 2I5LX 3FMCA 3VA5A 2A19A 3TRZA 3OYYA 4NW2A 1ILQA 4JCVE 1FD7D 3BG3A 5D3IB 2K28A 1SMXA 1U9RA 1HUNA 2ENBA 2E76C 4QGUA 4A3MG 4JI6L 2D0OA 4KY7A 4IPHA 5IE8A 4OHJA 2F0NA 1YNND 4DV5L 3GTMH 1XNRL 2B2UC 1EY5A 2AQ3B 1STAA 1WFQA 3ZJYC 1YI2A 2QILA 2E2JB 3OWEB 3PO3G 4GN5A 3S1QB 4JI1L 1IL8A 1K83H 2EPBA 5JAVA 2SDFA 4MN3A 1KRSA 5EJWA 1B44D 2O2LD 1N9WA 1HZ9A 3CCRA 4BBRB 1A6XA 2CWAA 3PGZA 3F2UA 3GTGB 2EIFA 4LFCL 1LT5D 4IURA 1V43A 4QJFA 1Y1VG 1STHA 4YWLA 4JI7Q 3J80i 3I4MG 4ZAIA 2E5LL 2KCNA 3SDZA 1A15A 2F0EA 3J7A5 3NTHA 3H94A 4GS3A 4QIWE 3J81i 5IGFA 4JI3Q 1NR2A 3T56B 1UNSA 4ULLA 1BBUA 1S72A 2ZXRA 3A8IE 1LTSD 1SBBB 1TIID 3MC0B 4ZUJA 4ME3A 4QF4A 3OMCA 4DR2L 1F2YA 2A69D 2LY7A 3G71A 1I50B 3I56A 3D4DA 3SEBA 4A3BB 1L2FA 2RDGA 2CQOA 1LTTD 3EIVA 3ERSX 3MXGA 5DM63 4OL7A 3OWFA 3A74A 4R4IA 3Q6SA 2F0JA 1PHJA 1PH4A 4AQYL 2LSSA 2M00A 4K6DA 4N9TA 3RNUA 5AJ3Q 4IUQA 4AIMA 4FYDA 3A7AB 2HHHL 1KRTA 2B63G 4A3KG 1B1ZA 2MUYA 1XNRQ 1S3OA 2VQFQ 4BBSG 3HEJA 1NY4A 2WKCA 4DK0A 3VYUA 2EY1A 5CV4A 3HKZG 4JI1Q 5CC4A 4C3JB 2RQXA 1J6QA 1OXXK 3T51B 2HQEA 3PO2H 1Y8OB 2E74C 3G7LA 4ME5A 4CDCC 1HNWL 4LFCQ 2Y0SB 1PH5A 4DR6Q 1TWFB 1GO3E 3I2ZA 3QOJA 4C3HB 3L0OA 1U4RA 3HOYB 3J7YW 3P20A 4RKBA 3JAML 1LT3D 1STGA 1KIXA 4I65A 1HR0L 1XYIA 4HCSA 2HIXA 3BYTB 4HMJA 5CV5A 4HN7A 4DR2Q 2E2IB 3M4OB 3KLSX 4G7HC 1HPCA 3CC4A 4GN4B 4KN7C 4V0BA 1PTOD 1IKLA 4LAAA 2EY2A 2K50A 1PYWD 2PW7A 4O1NA 5JVG3 3I90A 2R93H 1I4XA 4NMZA 4JVZA 4IPGA 5FLMG 2XNAC 4PZ8A 3K5MA 1D7QA 3I4NH 5K36G 4RA8A 4AQYQ 5J22A 2A6ED 4DU9A 3Q8DA 4G4KA 1O7IA 1Q82C 5IP7H 4J1MA 4P74A 2MNAA 2K01A 1VQ7A 1B53A 1IBKL 2FMMA 5E4WC 4F87A 1SLJA 1P8LA 1Y1WH 1VQCA 4Y7NH 2QDLA 1OXVA 2RCNA 5JJLA 4OX9L 3CD6A 3CQZH 1BR9A 2NVQH 1K8OA 4IO9A 1KAAA 1C48A 3RR5A 1C8CA 4J15A 1X9NA 1JC7A 2VL6A 5EGTA 2NN6H 1MHWC 4LF6L 2LFNA 5IYCG 2ZT9C 3WDNA 3D8GA 4B3MQ 2ZXOA 2VW9A 1I4PA 4NKLA 1YNJC 2F1MA 4CJ0B 2K5QA 3A7LA 4I7ZC 2Y0SE 2E2HH 4JG2A 4DV2L 2KUMA 3PV0A 3S16H 4KTAA 2FJ2A 5M3MH 3NBHA 3VR3A 1UE7A 1YEZA 1JOOA 3JAME 2QEJC 3K7UC 4GN3B 3MVVA 3HOXH 2JA6B 3ITPA 1E3PA 2F0QA 1ICFB 1CSPA 5JVH3 2BH8A 2NTSA 5DAUA 3T4AC 1PVOA 2CCZA 5IT9c 2EXDA 5ELBA 2Q2TA 1BDOA 1W2BA 5I9OA 3TZDA 1V1OA 1HR0W 4RGNA 1S40A 4IPDA 2AWNA 1JCKB 1TKWB 3TDQA 1MJCA 1GUWA 2N3SA 3KYHC 4CBVA 1XTDA 3NENA 1GHKA 4Q5VA 2PZWA 2L1BA 4DR3Q 1K8MA 1D1KA 3GTJH 4OX9Q 1O7ZA 1E7ZA 3T1YL 3K7AB 1KDBA 5E1FA 1JWSD 1Q3LA 5I2XA 1LM0A 2JXMB 3DWQA 4H7BA 4DR7L 4X64L 1OXTA 2WINB 1B8AA 3MFGA 4H0LC 3CCEA 2ZTEA 4UPAA 3Q24A 1KC8C 3PQIA 3BDOA 3SVMA 1W6KA 1LACA 2JJQA 1VMCA 4KKSA 2G9DA 4A3MB 2LS01 5ISRA 2PPBC 1FNWA 4DGZA 3HOUG 1I4RA 4DV2Q 2DJFC 4WFN3 4DV1L 2KCCA 1C4QA 2F0IA 1IW7C 4J6HA 3PO3B 1S5ED 3S2HH 2OT2A 3RZOH 1T9HA 2CH4W 2QF7A 2F0WA 2PQAB 5IP9G 3BZKA 4L5QA 1FJGQ 1IXRA 3PIOA 1Q90A 3VYTA 3NTKA 1Y1VB 1PH6A 3S14B 5C4HA 3I4MB 1VS0A 1ET9A 2R7FA 1RTNA 5ELEA 1B9MA 4GZYC 2I0QA 4B9XA 2A8VA 4EQNA 4RGOS 1V1QA 3MWYW 1XXGA 4P75A 3J7AF 2KVMA 4HSVA 5IWAL 4A3JB 1AP0A 1PH7A 2ZXPA 3J80L 2Z4HA 1G2TA 4GLVB 1CKNA 1G8ZD 4TVAB 1SNOA 4NP5A 5DM73 1BCPC 1H9KA 3J81L 1JWUD 4JI8L 1Q81C 3KLRA 4DR7Q 1DOKA 4X64Q 5I2YA 1EQTA 3AYHB 3FPUB 3NSWA 1MGSA 4LMQD 1H9JA 1TVXA 3PIO3 3WOEA 4DK1A 5E4XA 3EN2A 1TS4A 3CCJA 3FKIG 3DUZA 2UXDL 3G48A 1N33Q 1XNQL 3S1NB 1PTOB 2Z8LA 4A3GH 3X3NA 2B63B 3SK8A 4A3KB 5M5WB 4BBSB 5FO7B 3PMFA 4AYBG 4XTCS 4CKBA 1ONLA 2Z6BA 3DM1A 5JPNC 3KJPA 1N34L 2L12A 4UAIA 5LMNL 4RMFA 4R9WA 4P71A 2CFMA 1GD7A 2R7ZH 3KJOA 4HIDA 1ILPA 2I46A 3D31A 4ALPA 2YU9B 2NTTA 4IJHA 4PZ7A 3UDIA 1KDAA 3GP7A 1WOCA 2N8NA 2MO0A 1DCZA 4LW1A 1ZXTA 3S2DH 3NTIA 2XWJB 1QJOA 5IT9L 3I4NG 4OWTB 4DFAA 4DV0L 5IWAQ 3L7ZC 1HZBA 4IQZA 4IUPA 2F4VL 1AW7A 2CW0D 3MFYA 3KLWA 1HNZL 5FO8B 4JI4Q 3MHBA 2SOBA 3J80E 4RH6A 3K5LA 3VYRA 1B50A 1YJWA 1A2UA 2PI2A 4ODGA 3HP3A 3LWUA 4KV6A 4PNYA 2JA7H 1X3GA 3J81E 3KF6A 1TWAB 4OELB 5EPKA 2UXDQ 3K0YA 4RG1A 1XNQQ 1NAPA 2JK8A 2VY3A 2NN6G 4A3EH 4A3CH 1Z6HA 3RMHA 2NVTB 4FF1A 3L2PA 1QNUA 2SEBD 4BY1B 4IFDI 5KRUA 1HFGA 3VR5A 4CHTB 2FMCA 4N8X1 5CMDA 5IY0A 5LMNQ 1DGSA 1ASYA 1EOVA 1LTAD 4KMUC 3GTLH 4N8FA 1FNVA 3KOJA 1B2TA 2A68C 5C0XG 1SFOB 4NPSA 1EWCA 2NVYB 1QZGA 1Z7TA 4HTHA 2UUCQ 1ZYRC 2XRSD 1X3FA 5LMNW 4FO2A 5JEAG 3E0EA 3NUCA 5CV8A 4JI5L 3WWVA 3O13A 1WTVA 2BA0A 5EKIA 1QE6A 5IT9E 3R2IA 1HNZQ 4L5SA 2B2VA 4DNIA 1NMGA 3R3OA 2EJMA 2K5NA 1IHZA 2QW7A 1L1OB 2XWBB 1Y8NB 3A54A 1W3SA 3S17B 5IGEA 5CORA 4OWXB 3PUWA 1SNCA 1EFID 2KENA 1CHQD 3M4PA 1BCPF 2AQ2B 2B8GA 2EYFA 1H9RA 1SNQA 3I7FA 5KYLA 1CM9A 2DN8A 3K5NA 1ASZA 4JYAL 2EYPA 1C7YA 2B2VC 4XYOA 2Q2IA 1MKHA 3GTMB 2QGQA 4K14A 3SK6A 4C1NI 5I6WA 4YY3Q 5FJ8H 1WTQA 1WTRA 2I07B 3RN5A 1I4GA 2EXZA 2RBMA 2GA4B 4OXPA 1DONA 1K83B 5KIXA 1JJ2A 4WJWA 2NWGA 2MJ8A 3PF4A 1VQ8A 2QCPX 2BE5C 5M5YH 5EKKA 1C9OA 5D3DA 1HH2P 2EVBA 1QB5D 3LX0A 4JI5Q 2XN9C 3K5OA 2K05A 3GV6A 2B29A 3JAMc 5C3WA 3RLNA 1LLRD 1AZPA 3W5OA 2MFIA 1A3TA 1F2ZA 2HD3A 4XQQA 2AMCB 4C3IH 3HRZC 5LMUQ 1EQVA 2B2TA 1KLUD 5KGUA 1JT8A 2L15A 5HURA 4IOCA 1CKOA 1JICA 3VR4A 2ZJQA 1RODA 2C9OA 2EDGA 4DK3C 4H44C 4PG3A 4P72A 4N9PA 1YNXA 2Q8RE 1SN8A 4MNOA 2B2YC 2PQEA 4A4IA 4A3IG 3K57A 3ND9A 3QB3A 3HKSA 4CJ2C 1PH2A 2SNMA 3KF8B 4JYAQ 1X6OA 1JJCB 3NK9A 1EIGA 1SMYC 1FGUA 2B2TC 3I91A 2IX3A 3HOZG 1L0YB 3HGBA 4XDXA 3CHBD 1T5EA 5C4XH 2K14A 5GQOA 4EQOA 1EIHA 3U50C 1F9PA 1I94L 5IGBA 1QG7A 2BOSA 4JV5L 4FXKC 3FKIB 4HR7B 1XPRA 2PNHA 1CFMA 1IYJB 4GOPB 1PYSB 3CAMA 5M3FG 1IBLL 4F7XA 2LXJA 5CBAE 3HOWH 5E3FA 4AYBB 5GAEC 3BVZA 5EAYA 2N55A 1UE6A 3BJUA 2F3VA 3SXHA 4POFA 2R3ZA 2AHOB 3ONAB 4XIGS 5IOCA 4MHEA 2KECA 2BCOA 3NWSA 5BR8L 2VQEL 3RZDB 1TWGH 2ZJPA 5COYA 3H6MA 3D0FA 3A8JE 3TP8A 2F0OA 4KHVA 3CPWA 2JA8H 1ESRA 1X3EA 4HSPA 1X55A 4KKTA 3PIPA 4GKKQ 1YVCA 4NXNQ 1UE5A 1K3BC 2PZTA 4K2LA 3W1BA 4KI0A 3S15B 3JC66 4L6TB 1N36L 4X6AH 3KLSA 2R93B 4A3JG 1VQPA 4JBWA 1YNJD 3E5SA 3I4NB 4JBJA 3DMUA 1B3AA 5I4DA 4DV4Q 4POGA 1F9RA 1NUCA 2NB0A 4GKJL 3NELA 3RLFA 3T13A 1EZ8A 5L37A 2O4XA 1NTGA 1W6JA 2YYZA 3M9BA 1RF2D 2JSOA 1VQNA 1EYDA 1EEID 4B08A 3NP8A 1VQMA 4JBKA 1EL0A 5C44G 2NVQB 1TWHB 2K1BA 1I94Q 2OQ0A 2Q8TA 4JI6Q 4DV5Q 3PIP3 1RKNA 3H3VC 2L11A 5C5MA 1SSOA 4K6LA 2CQAA 1DZ1A 2JEBI 2K32A 2VB3X 3D4RA 3OPOA 1CQVA 1JE4A 1WCMH 1I6HH 3K0XA 3H09A 1K8AC 4QB4A 3VA7A 3F2CA 2TSSA 3RN2A 1CQFA 2CH4A 2E2HB 3GQBA 4AYBE 4LUOA 5A35A 3S16B 4QY7A 1SE8A 1OXSC 3CCLA 2VUMG 2VQEQ 1KQSA 3K80C 2E5LQ 4DV7L 5D14A 1E2ZA 1AZQA 4K8IA 3HOXB 4OO1H 1Z9FA 1SNDA 3J7AV 3CXCA 1N36Q 3OW7A 5EPJA 2H5XA 4DR4L 1ENFA 1V9PA 3HOVG 3S1QH 2EYOA 4LFBL 4A93H 5EBCA 3RUZA 1BXTA 2OCEA 2R6GA 2IL8A 5GAGC 2B8FA 4IOAA 3ND8A 4FF3A 1IW7D 3KBGA 4BBRH 1EIYB 4V190 3CW2C 1TY2A 5EBDA 5M5XB 2ICIA 3GTGH 3J80c 2Q2UA 2N88A 4EVOA 4DXGA 3EROA 1XJVA 4BXXG 2KQ3A 3FRPB 3GTJB 4R4TA 3J81c 3SK5A 3GTOH 3TS2A 5HY6A 4O2DA 2HHHQ 1HCZA 1VQEA 3FVQA 1NE3A 5T1GA 2NUCA 5KEEA 1K28A 4HAEA 1WJJA 4DAVA 4U673 2EJGC 1WI5A 4BY1G 5IIFA 1YNNC 2AKWB 4A3BH 1E2WA 1CI3M 4O42A 4IALA 3U9SA 2PMZB 1HJPA 5G3LF 4DF7A 4L5TA 3UDFA 1HNXL 3E3XA 5A2QL 4YHHL 1STYA 2B39A 1HNWQ 2RHQB 5C4ZA 3VDYA 1G2SA 4PV1C 1HTLD 1BKBA 3U9OA 1BCPD 2HUGA 2SNSA 2AWOA 1AFPA 1D5ZC 4QUFA 1BVSA 4I7AA 1O7LA 5HGQA 4PMCA 1BBXC 1R4QB 3GTKB 2K5DA 2OF1A 4C3IG 4TKOB 1PRTC 1L0WA 1PMRA 2L5TA 3FPPA 2C5CA 4RFBA 2ZM6L 1HR0Q 1D2BA 3LGJA 5FO9B 3BVMA 1Q8IA 4DR4Q 3I4OA 2PQAA 4C3JH 4LFBQ 4LF5L 5F2DA 1QVFA 2RCFA 4XXEA 3UE0A 3OW2A 3H0GH 2A69C 3CC2A 1Q1BA 5E7NA 5C3EH 1U4LA 4WJ4A 3X3MA 1I5FA 4BY7G 3WOFA 2JEAI 4A3DG 1XWEA 5IYBH 2RDFA 3STBC 1TWFH 3FDTA 4A3LG 1R4PB 3CMAA 1SDFA 1FGBD 1PH1A 4C3HH 5JJZA 3CRLC 3A8KE 1KD1C 5GAHC 3D3RA 4E6IA 3AMUA 1IBKQ 3NWTA 2MO1A 5KNCA 4LNQA 2VXWA 1FNUA 4DK6C 3M4OH 2A5HA 4A3IB 3TSSA 2G9HD 1F2MA 3R93A 1QWYA 1EIFA 1HXYD 3H3VH 1A62A 2R92H 4CKCA 5KNBA 3U58A 3HOZB 2F0VA 4B3RL 2RSOA 4LF6Q 2RVLA 1DJRD 1EQQA 3I70A 2GN5A 3Q23A 2NVXB 1GVPA 4NDXA 2Q2HA 1NJIC 1VQLA 2XGTA 3SE0A 1KAWA 4DV3L 3F8TA 1GKHA 5A2QE 4LUVA 4PMBA 1SROA 2IT1A 1GXDC 2E75C 1LTGD 2UUAL 5LL6S 1LV9A 4CDFC 1RDPD 3G6JB 1LTBD 1XX8A 4QMGA 3KFUA 1Q8KA 2GVBA 5M3FB 1N8RC 2JQOA 2JA5H 1GOZA 3NQTA 1DYQA 1X32A 3NBIA 1TS3A 4DN4M 4KHZA 2ZJRA 1VQAA 3M3YH 1U4MA 1PTOC 1PFSA 2X69A 5IGCA 3HZXA 3GV3A 4LK1C 3C3LA 4LFAL 3MXNB 3NQIA 4IFDJ 1NBWA 1LABA 1RD9D 4Q0FA 1SNPA 5C5LA 3D6CA 2Z0SA 5JEAJ 1X54A 1GM5A 3FEWX 3BS1A 4LF7L 4FXGC 2A68D 1II3A 1D5MC 3PUYA 4X65L 2HDMA 5C4JH 3P75A 1LYLA 2HQLA 1HRJA 2QDBA 4KHPL 2RF4A 4ZK9B 1ZYRD 2F0GA 3T1YQ 5IGDA 2JA6H 5DEHA 2D9UA 3CCUA 3I72A 3CCSA 4G7OC 3SK4A 1P16A 3V2TA 5IGGA 3DEOA 4QL5A 4JK1C 1EY8A 2ALYB 2F0UA 5ELCA 1WTWA 4DPGA 2XSCA 5HGTA 1YHQA 5C44B 1LT4D 1EYAA 2CKZB 1CHPD 1C0AA 2AQ1B 2FHTA 3PO2G 1UE1A 2UUAQ 2KHSA 1GUNA 2LXKA 4DV1Q 4IN3A 1A3VA 1XMQL 1BQQT 2A6HD 4HJAA 4B3SL 1VQGA 3K7AH 4OO1G 2UUBL 4IUTA 3UDXA 5ELOA 3VYSA 5T1IA 2VNUD 3BZCA 1JE5A 4DNRB 2UXBL 1RJTA 4L5RC 3A5UA 1PRTF 2RA4A 2VUMB 1KABA 3HS0C 4LFAQ 2L9HA 3UE1A 4PZ6A 3BDCA 2O5JC 4Y52H 1G291 1J5EL 1A3UA 1I3QB 1PZJD 4LF7Q 2R93G 1TY0A 3DXJC 4UP9A 2D2CC 1MI2A 4IZ8A 2KJXA 2BH2A 1H9SB 3D4WA 2OEOA 5EKLA 1B3QA 2BE5D 3PO3H 3EA6A 2HDLA 3RLOA 3HOVB 2NN6I 1SE4A 5IP7G 2EY6A 1BCPB 4HJ5A 1SEBD 4BA1I 1L1OA 2XIWA 4JI8Q 1Y1WG 3E6ZX 4X3KA 3TS0A 5I9PA 2WB1G 4J8QA 1Y69U 1A8VA 3OTOL 1VQDA 1Y1VH 1OTCA 3S14H 2F3IA 3I4MH 1Q7YC 2PYKA 4LJZC 2E2DC 4CDDC 1R9TB 1ENCA 3K81C 1CT1D 4LUZA 5C0XI 1Q86C 2L55A 1YHBA 1U0LA 4F88A 3IAYA 4JI0L 1DOMA 1EYCA 1S4ZA 2B2WA 4B3SQ 2WAQG 1N34Q 3GD7A 1L1OC 2D5DA 4K8JA 4XQJA 2JE6I 4LF9L 5M5YB 2UXBQ 5M3MG 2KCTA 3W3AA 1JJGA 5EQ0A 4Z9CB 3HOXG 1B4OA 1K3RA 4K0KL 3H0GG 5C3EG 3S1NH 1J5EQ 1PTOH 4C3IB 4X3SA 1VQKA 1G6PA 2B63H 4A3KH 5M5WH 5G3LD 1KL9A 4NXML 4BBSH 3KUPA 4FF2A 1U5KA 1TQOA 2B2WC 3IFTA 3H91A 5FLXc 3S9WA 3TREA 4DV0Q 4ZKBB 2J7ZA 2IX0A 1PTOF 1YJNA 2CHBD 2F4VQ 4P73A 3OIPA 5CBEE 2TMPA 4JOIA 3BZDB 4X3UA 4BA2I 3CCQA 1VQFA 4BY7B 1EWHA 1KTKA 4A3DB 4RCOA 3KDFB 4X66L 2KHIA 1UAPA 4QCLA 4C2MH 3DWPA 1V1PB 4XQNA 3A56A 1QUQB 2R92G 4UY8C 2WACA 4EGVA 3DWAA 3EQLC 4TSSA 4OGQC 4R1JA 2M9VA 1CZGA 1F9SA 3KF8A 4OEMB 1YZ6A 3G6EA 3TN2A 4FVMA 2Z9HA 4JI0Q 5ELFA 1Q12A 3K6OA 1HQRD 2OTJA 2RHSB 4JOIC 2B3GA 4DV6L 3TMEA 3PUXA 4X3TA 1EY4A 4HIKA 1N32L 1UEAB 3BVGA 3TZUA 4HIMA 2OWOA 2NZHA 5FLMH 1EU4A 2EY5A 5K36H 2JA5G 2F03A 2RKSA 3ERQA 2QEXA 5J3BA 4IUNA 2K33A 1KNEA 4K0KQ 3C2PA 4R4CA 1L0XB 1QILA 2PZUA 1D5XC 3EVQA 4NXMQ 5TSSA 1TWGB 2F0KA 4H02A 2K7VA 3A5ZB 2JP1A 3S1RH 4K2KA 2R61A 1D1IA 4R8NA 2EYMA 3CKIB 3MTSA 2BDNA 5FKAC 3C1EA 2YTVA 2A73B 1TXYA 2Z6KA 5IYCH 1PXUA 4ABNA 2NVYH 1TU2B 2MPMA 1F9QA 4YCUA 5CV9A 3FP9A 4EX5A 1E2VA 4RAUC 3M4YA 4ZQ3A 1PZKD 1HUMA 2KEEA 2PNRC 1UUPA 2VB2X 1BNZA 2FXQA 1A0IA 3GTQH 3VR2A 1AE2A 4JI7L 4H13C 3NPPA 2V1CC 1GUOA 2X6LA 3TBIB 3J7ZC 4K5XA 3MXUA 1MD2D 4P2CB 1JQYD 3NHHA 1TWCH 5GROA 4A3GG 2K75A 3QO2A 1WTOA 4LF8L 4DA2A 5NUCA 3DM3A 1G51A 1PV4A 1Y8PB 2K5VA 1S5FD 2B2UA 3TP7A 1JOQA 4K5WA 1T5XD 1VF7A 1I6HB 2OTLA 2R7ZG 3PO2B 3L3OC 1QCBD 5LL6X 1K73C 1HA5A 4GNXB 2LKVA 2Z4IA 4CGYB 3C1FA 4GLXA 4O0AA 1ENAA 3I8ZA 3CMEA 1V8QA 5AJ3L 5D65A 3E9HA 4A75A 1IBML 3CCMA 5CV6A 1YHAA 1UEBA 3W1GA 4OWWB 1LTRD 2BA1A 1M4VA 3LNNA 5AFWA 1M90C 1X56A 4YIJA 3UDGA 4DNTB 1Y14B 2VQFL 1KXLA 3DHQA 1VQHA 3TP5A 2DNCA 1STEA 5FLXL 4A93B 2MQHA 4IJLA 3EFXD 2HIVA 2CVRA 2E8GA 5EPLA 2F0FA 2JN4A 3HOUH 2EYHA 4DR6L 1B70B 3R2TA 2IHFA 4UP7A 1E0BA 4HJ7A 2JA7G 1WTPA 1TR5A 2R7DA 1PRTD 4DAYB 1TS5A 1PH8A 3GTOB 2IPKD 4EQ5A 2KOLA 5FOBB 5IP9H 4A3EG 4LF8Q 2HT1A 1VQBA 4A3CG 1Y1WB 4JBMA 2WP8J 3S1MH 4KLKA 2D62A 4Y7NB 2NZ1D 1A2TA 2L4NA 2WB1B 1DOLA 4FNFA 4JPBW 1FYCA 4L8JA 2EZVA 1EQRA 3CQZB 3OIQA 2DUDA 3ULLA 2KCMA 4JV5Q 3KBXA 2NBFA 5IYDH 2I5MX 2MHVA 1MBYA 3GTPH 4CJ1B 3STBD 2OQKA 3CC7A 2G5DA 4A3FH 3AB9A 1EY6A 1EWIA 5JPMC 3E0JA 4MIUA 2RSNA 1IBLQ 1AH9A 1G6ZA 3I4LA 4ZUIA 3TEHB 2IY5B 4M8AA 1BBWA 1SJED 2IHEA 2PO4A 1IBMQ 2WAQB 2WIIB 3OSOA 1NR4A 1MSGA 3SR1A 5C6AA 1YIJA 1WVLA 5BR8Q 4KD4A 5M3MB 2AUKA 3AQQA 3PUVA 5DNFA 1X3QA 4FP5D 4DAPA 5J39A 3H0GB 3FKIH 5C3EB 1PLFA 2F0SA 4HEDA 4JC0A 4FF4A 5FLXE 2E2JH 1UWVA 5IODA 1YJ9A 4DR5L 4B3ML 3T1HL 3SHLA 1AN8A 4KD3A 4GKJQ 1NMFA 1Q46A 2X6GA 1IYVA 1PZID 1SNMA 4UDUC 3QOLA 4RCNA 3RZDH 5BN4A 3VR6A 1VMPA 3A0JA 3N52A 1NCVA 1O80A 4DXFA 1EFWA 3P7JA 1EOTA 3CF5A 5FJ8G 2R92B 1HZCA 1QOHA 3S15H 1A63A 2WB1E 2P5ZX 5BN3A 1LTLA 1I50H 1OXUA 1KLGD 4GLAC 1E1OA 4RHRA 4R4QA 1D6EC 3AEVA 2MP1A 2NYZD 2MGSA 3OHXC 1O78A 2EYLA 2XVSA 2K52A
chains in the Genus database with same CATH topology
1P16A 4DR3L 3M4QA 4QL5A 1KRSA 2WAQE 1HNZQ 4DV7Q 4APVA 4L5SA 4DNIA 3M85A 1N9WA 1HZ9A 1NMGA 3CCRA 3E9IA 2ALYB 2K5NA 1TWHH 2CWAA 3PGZA 1L1OB 4DPGA 2EIFA 4LFCL 1YHQA 4QJFA 1V43A 2CKZB 1C0AA 1Y1VG 4YWLA 4JI7Q 1W3SA 3J80i 3I4MG 3PO2G 4OWXB 3PUWA 1UE1A 2E5LL 2UUAQ 3PSIA 4A3CG 2LXKA 3J7A5 4DR5Q 1VQIA 2KENA 4GS3A 4DV1Q 4QIWE 3J81i 3T1HQ 1XMQL 3M4PA 4JI3Q 2QA4A 1BBUA 1S72A 4HJAA 4B3SL 1VQGA 1CUKA 4ME3A 3K7AH 4OO1G 3I7FA 4DR2L 2UUBL 3G71A 3UDXA 3I56A 1ASZA 4JYAL 5ELOA 1L2FA 1C7YA 2VNUD 3BZCA 1JE5A 1YBYA 2UXBL 2CQOA 3EIVA 3ERSX 2Q2IA 1MKHA 1XMOL 4L5RC 3A5UA 2QGQA 4YY3Q 5FJ8H 3HOYH 3A74A 3RN5A 4R4IA 4LFAQ 1CSQA 2KBNA 1PHJA 3UE1A 4OXPA 1D8LA 4PZ6A 1PH4A 2GVAA 4AQYL 4Y52H 5C4XG 1G291 2LSSA 3PUZA 3ULPA 1J5EL 1JJ2A 1FJGL 4LF7Q 1Q1EA 1PA6A 3RNUA 2E2IH 3PF4A 2R93G 4UP9A 4IPCA 5AJ3Q 1VQ8A 1IZ6A 4AIMA 5M5YH 1RL2A 1C9OA 3AFPA 2BH2A 2HHHL 1HH2P 1KRTA 4DR1L 2B63G 4A3KG 3PO3H 2ZTDA 3AFQA 3RLOA 4JI5Q 1XNRQ 2NN6I 1S3OA 2VQFQ 5IP7G 4BBSG 1NY4A 4HJ5A 1K8GA 1HNXQ 1FL0A 4WJ3M 2B29A 5M5XH 4BA1I 3JAMc 4YHHQ 1L1OA 4DAMA 4JI8Q 3RLNA 3HKZG 1MJEA 4JI1Q 1M1KC 3HOWG 3W5OA 1Y1WG 2MFIA 2PMZE 2AMCB 3GO5A 3SGIA 4C3IH 5LMUQ 1J6QA 1OXXK 3TS0A 2WB1G 1A8VA 3OTOL 1VQDA 1Y1VH 4MZ9A 1OTCA 1XPUA 2F3IA 3I4MH 3S14H 3PO2H 1JT8A 1Q7YC 2L15A 4IOCA 1CKOA 2UU9L 1HNWL 4LFCQ 3K81C 1PH5A 4DR6Q 4LUZA 2ZJQA 1GO3E 3I2ZA 5C0XI 1Q86C 2ZM6Q 4DK3C 2XTIA 1YHBA 1U0LA 1VCIA 3L0OA 4PG3A 4P72A 3EBEA 4WJ4A 2UXCL 1VQ9A 4LF8Q 1YNXA 3J81j 2JA8G 4JI0L 1SN8A 3K8AA 4MNOA 4LF5Q 4A4IA 1KIXA 4B3SQ 4A3IG 2WAQG 1N34Q 3GD7A 1L1OC 1N33L 5C0XJ 2EQSA 1HR0L 2HIXA 3HKSA 4DR2Q 1PH2A 2JE6I 3KF8B 4LF9L 1QZHA 4JYAQ 1X6OA 1JJCB 3CC4A 4GN4B 1FGUA 3HOZG 2UXBQ 5M3MG 2KCTA 1XMOQ 1JJGA 2K50A 5C4XH 2K14A 3HOXG 5GQOA 3GTKH 2R93H 3F1ZA 2N49A 3NBHB 3F2DA 1K3RA 4IPGA 5FLMG 4PZ8A 4K0KL 1D7QA 3H0GG 3I4NH 5K36G 3FHWA 3U50C 5C3EG 4AQYQ 1I94L 3S1NH 1J5EQ 4JV5L 1LUZA 3Q8DA 4OONA 1VQKA 1G6PA 2B63H 1O7IA 2IX1A 4A3KH 1XPRA 2PNHA 5M5WH 1KL9A 3I55A 1Q82C 5IP7H 1IYJB 4GOPB 4NXML 1U5KA 1PYSB 4P74A 5FLXc 4BBSH 3TREA 4DV0Q 2VZAA 2MNAA 1VQ7A 2IX0A 3CAMA 3MEFA 5IYDG 4DR1Q 5M3FG 1YJNA 1IBKL 2LXJA 1IBLL 1SLJA 1P8LA 5GAEC 4P73A 1Y1WH 2F4VQ 1VQCA 4Y7NH 4UP8A 4A3FG 1X65A 5EAYA 1OXVA 4YCWA 2JA9A 2RCNA 4FDBA 4B3RQ 5JJLA 4OO1I 4OX9L 4JOIA 1UE6A 3CD6A 4BA2I 3BJUA 2DGYA 3CCQA 1VQFA 1WCMG 3CQZH 4POFA 2NVQH 2AHOB 3S24A 4IO9A 1SR3A 4DV3Q 3KDFB 4XIGS 3RR5A 4J15A 5BR8L 2VQEL 4X66L 1X9NA 1TWGH 1K0RA 2ZJPA 2VL6A 3CPFA 2KHIA 2VS1A 4LF6L 3D0FA 4YWKA 4C2MH 1PH9A 4JI4L 2UU9Q 5IYCG 2R92G 1QUQB 3BU2A 4B3MQ 3CPWA 4UY8C 2JA8H 1X3EA 3PIPA 1VQ4A 1X55A 1VQOA 4GKKQ 2VW9A 1YVCA 3PF5A 4NXNQ 1UE5A 3W1BA 4KI0A 4R1JA 3JC66 4A3IH 1N36L 2WFWA 4HIOA 2UXCQ 1E1TA 4X6AH 1YZ6A 3G6EA 2Y0SE 2E2HH 4A3JG 4JI0Q 1VQPA 4JG2A 4DV2L 1KHIA 1Q12A 4JI2L 4JBWA 3PV0A 1IL2A 2OTJA 1MIUA 4JBJA 3S16H 4POGA 4DV4Q 2RHSB 4JOIC 2B3GA 3HOZH 5M3MH 4DV6L 4PMWA 3PUXA 4HIKA 4GKJL 1N32L 3NELA 1UE7A 1YEZA 3CCVA 3K7UC 4GN3B 2NVXH 3RLFA 3HOXH 4A93G 4HIMA 2OWOA 1E3PA 1Z47A 2NZHA 1NTGA 5FLMH 2YYZA 1CSPA 3M9BA 1EYGA 2BH8A 1E22A 1PVOA 3F2BA 2JA5G 3B6YA 4A3MH 5IT9c 2EXDA 2CCZA 4BBRG 2QEXA 1VQNA 2Q2TA 1K9MC 5J3BA 1VQMA 4JBKA 4X65Q 2YTYA 1B7YB 5C44G 4HJ8A 4K0KQ 1W2BA 4R4CA 4JI6Q 1I94Q 2OQ0A 4NB3A 4DV5Q 1HR0W 4KHPQ 5H1SE 2ZTCA 1S40A 4IPDA 5M3FH 2AWNA 4NXMQ 4H02A 2N78A 3A5ZB 1MJCA 2N3SA 3KYHC 1XTDA 3NENA 2UUCL 3S1RH 2JEBI 3KDFA 1WCMH 4DR3Q 1I6HH 3K0XA 2K4KA 3GTJH 1XPOA 1K8AC 4OX9Q 1E7ZA 3F2CA 5DLQE 3T1YL 4A3BG 1QUQA 3RN2A 4JI6L 2YTVA 1TXYA 4AYBE 4LUOA 3H15A 2Z6KA 3M7NA 5IYCH 1LM0A 5JJKA 4QY7A 1SE8A 1OXSC 2NVYH 3CCLA 2VQEQ 2VUMG 4DR7L 4X64L 3NEMA 1KQSA 3K80C 1OXTA 4YCUA 1QVCA 1B8AA 3FP9A 4EX5A 4DV7L 2E5LQ 3CCEA 2ZTEA 4UPAA 1KC8C 2D0PA 2CWPA 1CKNB 1XMQQ 1Z9FA 4A3JH 2JJQA 1VQ6A 4YWMA 4DUYL 2ATWA 1JB7A 2FXQA 1A0IA 3CXCA 1N36Q 3GTQH 1AE2A 4JI7L 2V1CC 4LF4L 2H5XA 3HOUG 3GDEA 4DUZL 2UUBQ 4DV2Q 3J7ZC 4DR4L 1V9PA 3CP0A 4R4OA 4JI2Q 3HOVG 3S1QH 4DV1L 4LFBL 4A93H 1TWCH 5GROA 4A3GG 2K75A 2OCEA 2R6GA 4LF8L 5GAGC 3S2HH 4IOAA 2K5HA 3RZOH 3DM3A 1G51A 1T9HA 4BBRH 1EIYB 2ES2A 1H95A 3CW2C 1PV4A 2PQAB 3GTGH 2K5VA 5IP9G 5C44H 3BZKA 3J80c 3JAMi 2Q2UA 4L5QA 1FJGQ 1IXRA 2I5HA 1XJVA 4BXXG 2OTLA 3PIOA 4YY3L 4R4TA 1FVIA 3J81c 5IYBG 2Y0SG 1PH6A 3H3VI 1VS0A 2R7FA 3GTOH 2R7ZG 3TS2A 5HY6A 4O2DA 2HHHQ 3HKZE 3G4SA 1K73C 2I0QA 1VQEA 2NZOA 2A8VA 1NE3A 4GNXB 3HOYG 1V1QA 4GLXA 1WJJA 4O0AA 3HOWH 4P75A 4BY1G 1WI5A 1RIPA 3CMEA 5AJ3L 4A75A 3E9HA 1IBML 3CCMA 1YHAA 1UEBA 3U4VA 2AKWB 4A3BH 3W1GA 4OWWB 4IFDG 2BA1A 5IWAL 3ULJA 1PH7A 1M90C 1X56A 3UDGA 1HJPA 1VQJA 1Y14B 3ICEA 3OTOQ 2VQFL 2VUMH 4L5TA 1JMCA 1KXLA 4GLVB 1CKNA 1VQHA 4TVAB 3UDFA 1HNXL 2YU9H 1E24A 4YHHL 1HNWQ 4JI8L 2RHQB 1Q81C 3VDYA 4DR7Q 2MQHA 4X64Q 4B3TL 1BKBA 4IJLA 1I3QH 1AE3A 2HIVA 2AWOA 3AYHB 5LMUL 1SRUA 2E8GA 1BVSA 5HGQA 1QVGA 1VQ5A 3EN2A 3HOUH 4X62L 3CCJA 3HOVH 1L0WA 4DUYQ 3FKIG 4DR6L 1B70B 2UXDL 3G48A 2IHFA 1N33Q 4UP7A 4HJ7A 1YITA 2ZM6L 1XNQL 2JA7G 1HR0Q 4DKAC 4A3GH 3LGJA 4LF4Q 2R7DA 4DUZQ 4DAYB 4DR4Q 3I4OA 2PQAA 4LF9Q 5ELNA 1PH8A 4AYBG 4C3JH 4LFBQ 3KF6B 4EQ5A 4LF5L 4XTCS 3TQYA 1QVFA 3CC2A 3UE0A 5IP9H 3H0GH 3KJPA 3OW2A 4A3EG 1VQBA 1Q1BA 5E7NA 5C3EH 1N34L 4JBMA 2HT1A 2WP8J 3S1MH 3U4ZA 4KLKA 2D62A 5LMNL 4GOPA 1I5FA 4RMFA 4BY7G 4BXXH 2JEAI 4P71A 4A3DG 1TWAH 2CFMA 1R9TH 5IYBH 1GD7A 1PYBA 1TWFH 2KHJA 1EQRA 3STBC 3DLLA 4GNXA 2R7ZH 4A3LG 2DUDA 3ULLA 2KCMA 3KJOA 3CMAA 4JV5Q 3ER0A 5JJIA 4HIDA 1PH1A 5IYDH 2I5MX 4C3HH 3GTPH 3D31A 2F52A 2OQKA 3STBD 3CC7A 2NVTH 4ALPA 4A3FH 1KD1C 5GAHC 4IJHA 4PZ7A 4BY1H 1EWIA 3UDIA 2YTXA 1IBKQ 1IBLQ 1WOCA 3PCOB 1AH9A 2MO1A 4LNQA 2N8NA 2MO0A 3TEHB 2IY5B 4LW1A 4DK6C 5GADC 1BBWA 2IHEA 3M4OH 3S2DH 1IBMQ 1HZAA 3I4NG 1EUJA 4OWTB 4YCVA 1WYDA 4DV0L 1EIFA 5IWAQ 3H3VH 4GOPC 3L7ZC 1A62A 4MTNA 1SFOH 1HZBA 1YIJA 2R92H 5BR8Q 2F4VL 4X66Q 3U58A 2JA6G 4GNXC 3KLWA 4B3RL 1HNZL 4LF6Q 3AQQA 3PUVA 1EQQA 4JI4Q 2GN5A 1GVPA 2Q2HA 1NJIC 1VQLA 4TQUS 2XGTA 4B3TQ 1KAWA 4DV3L 2PI2A 1YJWA 3F8TA 3FKIH 1GKHA 4HJ9A 4LUVA 2YV5A 1X3GA 2JA7H 1SROA 4JC0A 2IT1A 3KF6A 1CKMA 1UWVA 4X62Q 4A76A 2E2JH 2UUAL 1YJ9A 4DR5L 3IRBA 4B3ML 2UXDQ 4RG1A 1PH3A 4JI3L 4AH6A 3T1HL 1XNQQ 2JK8A 4NXNL 3KFUA 2VY3A 4DV6Q 4GKKL 2NN6G 1Q8KA 2GVBA 4A3EH 1N8RC 4A3CH 2JQOA 4GKJQ 1N32Q 2JA5H 1NMFA 2Z6KC 1Q46A 3L2PA 4QQBX 4BY7H 4IFDI 4A3DH 2ID0A 2C35B 2PI2E 4KHZA 4DV4L 5IY0A 2ZJRA 2A1AA 5LMNQ 1DGSA 3RZDH 1ASYA 3S17H 4A3LH 2ASBA 3HFZB 3A0JA 1EOVA 1VQAA 3M3YH 1PFSA 3GTLH 4LWCA 3KOJA 2I5LX 4LFAL 1EFWA 3MXNB 4IFDJ 1NBWA 2A19A 5C0XG 4NPSA 3CF5A 3TRZA 5FJ8G 3OYYA 1HZCA 3S15H 1A63A 2Z0SA 5JEAJ 1X54A 4JCVE 1QZGA 1GM5A 2WB1E 4LF7L 3PUYA 1SMXA 4X65L 2UUCQ 1LTLA 1I50H 1OXUA 5C4JH 4GLAC 1X3FA 1E1OA 4QGUA 5LMNW 4A3MG 1LYLA 2D0OA 2HQLA 4R4QA 4IPHA 5IE8A 5JEAG 4DV5L 3GTMH 2RF4A 4KHPL 3E0EA 1XNRL 4JI5L 3WWVA 3AEVA 3T1YQ 2BA0A 2JA6H 1WFQA 3ZJYC 1YI2A 3CCUA 3PO3G 4GN5A 4JI1L 3CCSA 1K83H 2K52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P16 A;  4DR3 L;  3M4Q A;  4QL5 A;  1KRS A;  2WAQ E;  1HNZ Q;  4DV7 Q;  4APV A;  4L5S A;  4DNI A;  3M85 A;  1N9W A;  1HZ9 A;  1NMG A;  3CCR A;  3E9I A;  2ALY B;  2K5N A;  1TWH H;  2CWA A;  3PGZ A;  1L1O B;  4DPG A;  2EIF A;  4LFC L;  1YHQ A;  4QJF A;  1V43 A;  2CKZ B;  1C0A A;  1Y1V G;  4YWL A;  4JI7 Q;  1W3S A;  3J80 i;  3I4M G;  3PO2 G;  4OWX B;  3PUW A;  1UE1 A;  2E5L L;  2UUA Q;  3PSI A;  4A3C G;  2LXK A;  3J7A 5;  4DR5 Q;  1VQI A;  2KEN A;  4GS3 A;  4DV1 Q;  4QIW E;  3J81 i;  3T1H Q;  1XMQ L;  3M4P A;  4JI3 Q;  2QA4 A;  1BBU A;  1S72 A;  4HJA A;  4B3S L;  1VQG A;  1CUK A;  4ME3 A;  3K7A H;  4OO1 G;  3I7F A;  4DR2 L;  2UUB L;  3G71 A;  3UDX A;  3I56 A;  1ASZ A;  4JYA L;  5ELO A;  1L2F A;  1C7Y A;  2VNU D;  3BZC A;  1JE5 A;  1YBY A;  2UXB L;  2CQO A;  3EIV A;  3ERS X;  2Q2I A;  1MKH A;  1XMO L;  4L5R C;  3A5U A;  2QGQ A;  4YY3 Q;  5FJ8 H;  3HOY H;  3A74 A;  3RN5 A;  4R4I A;  4LFA Q;  1CSQ A;  2KBN A;  1PHJ A;  3UE1 A;  4OXP A;  1D8L A;  4PZ6 A;  1PH4 A;  2GVA A;  4AQY L;  4Y52 H;  5C4X G;  1G29 1;  2LSS A;  3PUZ A;  3ULP A;  1J5E L;  1JJ2 A;  1FJG L;  4LF7 Q;  1Q1E A;  1PA6 A;  3RNU A;  2E2I H;  3PF4 A;  2R93 G;  4UP9 A;  4IPC A;  5AJ3 Q;  1VQ8 A;  1IZ6 A;  4AIM A;  5M5Y H;  1RL2 A;  1C9O A;  3AFP A;  2BH2 A;  2HHH L;  1HH2 P;  1KRT A;  4DR1 L;  2B63 G;  4A3K G;  3PO3 H;  2ZTD A;  3AFQ A;  3RLO A;  4JI5 Q;  1XNR Q;  2NN6 I;  1S3O A;  2VQF Q;  5IP7 G;  4BBS G;  1NY4 A;  4HJ5 A;  1K8G A;  1HNX Q;  1FL0 A;  4WJ3 M;  2B29 A;  5M5X H;  4BA1 I;  3JAM c;  4YHH Q;  1L1O A;  4DAM A;  4JI8 Q;  3RLN A;  3HKZ G;  1MJE A;  4JI1 Q;  1M1K C;  3HOW G;  3W5O A;  1Y1W G;  2MFI A;  2PMZ E;  2AMC B;  3GO5 A;  3SGI A;  4C3I H;  5LMU Q;  1J6Q A;  1OXX K;  3TS0 A;  2WB1 G;  1A8V A;  3OTO L;  1VQD A;  1Y1V H;  4MZ9 A;  1OTC A;  1XPU A;  2F3I A;  3I4M H;  3S14 H;  3PO2 H;  1JT8 A;  1Q7Y C;  2L15 A;  4IOC A;  1CKO A;  2UU9 L;  1HNW L;  4LFC Q;  3K81 C;  1PH5 A;  4DR6 Q;  4LUZ A;  2ZJQ A;  1GO3 E;  3I2Z A;  5C0X I;  1Q86 C;  2ZM6 Q;  4DK3 C;  2XTI A;  1YHB A;  1U0L A;  1VCI A;  3L0O A;  4PG3 A;  4P72 A;  3EBE A;  4WJ4 A;  2UXC L;  1VQ9 A;  4LF8 Q;  1YNX A;  3J81 j;  2JA8 G;  4JI0 L;  1SN8 A;  3K8A A;  4MNO A;  4LF5 Q;  4A4I A;  1KIX A;  4B3S Q;  4A3I G;  2WAQ G;  1N34 Q;  3GD7 A;  1L1O C;  1N33 L;  5C0X J;  2EQS A;  1HR0 L;  2HIX A;  3HKS A;  4DR2 Q;  1PH2 A;  2JE6 I;  3KF8 B;  4LF9 L;  1QZH A;  4JYA Q;  1X6O A;  1JJC B;  3CC4 A;  4GN4 B;  1FGU A;  3HOZ G;  2UXB Q;  5M3M G;  2KCT A;  1XMO Q;  1JJG A;  2K50 A;  5C4X H;  2K14 A;  3HOX G;  5GQO A;  3GTK H;  2R93 H;  3F1Z A;  2N49 A;  3NBH B;  3F2D A;  1K3R A;  4IPG A;  5FLM G;  4PZ8 A;  4K0K L;  1D7Q A;  3H0G G;  3I4N H;  5K36 G;  3FHW A;  3U50 C;  5C3E G;  4AQY Q;  1I94 L;  3S1N H;  1J5E Q;  4JV5 L;  1LUZ A;  3Q8D A;  4OON A;  1VQK A;  1G6P A;  2B63 H;  1O7I A;  2IX1 A;  4A3K H;  1XPR A;  2PNH A;  5M5W H;  1KL9 A;  3I55 A;  1Q82 C;  5IP7 H;  1IYJ B;  4GOP B;  4NXM L;  1U5K A;  1PYS B;  4P74 A;  5FLX c;  4BBS H;  3TRE A;  4DV0 Q;  2VZA A;  2MNA A;  1VQ7 A;  2IX0 A;  3CAM A;  3MEF A;  5IYD G;  4DR1 Q;  5M3F G;  1YJN A;  1IBK L;  2LXJ A;  1IBL L;  1SLJ A;  1P8L A;  5GAE C;  4P73 A;  1Y1W H;  2F4V Q;  1VQC A;  4Y7N H;  4UP8 A;  4A3F G;  1X65 A;  5EAY A;  1OXV A;  4YCW A;  2JA9 A;  2RCN A;  4FDB A;  4B3R Q;  5JJL A;  4OO1 I;  4OX9 L;  4JOI A;  1UE6 A;  3CD6 A;  4BA2 I;  3BJU A;  2DGY A;  3CCQ A;  1VQF A;  1WCM G;  3CQZ H;  4POF A;  2NVQ H;  2AHO B;  3S24 A;  4IO9 A;  1SR3 A;  4DV3 Q;  3KDF B;  4XIG S;  3RR5 A;  4J15 A;  5BR8 L;  2VQE L;  4X66 L;  1X9N A;  1TWG H;  1K0R A;  2ZJP A;  2VL6 A;  3CPF A;  2KHI A;  2VS1 A;  4LF6 L;  3D0F A;  4YWK A;  4C2M H;  1PH9 A;  4JI4 L;  2UU9 Q;  5IYC G;  2R92 G;  1QUQ B;  3BU2 A;  4B3M Q;  3CPW A;  4UY8 C;  2JA8 H;  1X3E A;  3PIP A;  1VQ4 A;  1X55 A;  1VQO A;  4GKK Q;  2VW9 A;  1YVC A;  3PF5 A;  4NXN Q;  1UE5 A;  3W1B A;  4KI0 A;  4R1J A;  3JC6 6;  4A3I H;  1N36 L;  2WFW A;  4HIO A;  2UXC Q;  1E1T A;  4X6A H;  1YZ6 A;  3G6E A;  2Y0S E;  2E2H H;  4A3J G;  4JI0 Q;  1VQP A;  4JG2 A;  4DV2 L;  1KHI A;  1Q12 A;  4JI2 L;  4JBW A;  3PV0 A;  1IL2 A;  2OTJ A;  1MIU A;  4JBJ A;  3S16 H;  4POG A;  4DV4 Q;  2RHS B;  4JOI C;  2B3G A;  3HOZ H;  5M3M H;  4DV6 L;  4PMW A;  3PUX A;  4HIK A;  4GKJ L;  1N32 L;  3NEL A;  1UE7 A;  1YEZ A;  3CCV A;  3K7U C;  4GN3 B;  2NVX H;  3RLF A;  3HOX H;  4A93 G;  4HIM A;  2OWO A;  1E3P A;  1Z47 A;  2NZH A;  1NTG A;  5FLM H;  2YYZ A;  1CSP A;  3M9B A;  1EYG A;  2BH8 A;  1E22 A;  1PVO A;  3F2B A;  2JA5 G;  3B6Y A;  4A3M H;  5IT9 c;  2EXD A;  2CCZ A;  4BBR G;  2QEX A;  1VQN A;  2Q2T A;  1K9M C;  5J3B A;  1VQM A;  4JBK A;  4X65 Q;  2YTY A;  1B7Y B;  5C44 G;  4HJ8 A;  4K0K Q;  1W2B A;  4R4C A;  4JI6 Q;  1I94 Q;  2OQ0 A;  4NB3 A;  4DV5 Q;  1HR0 W;  4KHP Q;  5H1S E;  2ZTC A;  1S40 A;  4IPD A;  5M3F H;  2AWN A;  4NXM Q;  4H02 A;  2N78 A;  3A5Z B;  1MJC A;  2N3S A;  3KYH C;  1XTD A;  3NEN A;  2UUC L;  3S1R H;  2JEB I;  3KDF A;  1WCM H;  4DR3 Q;  1I6H H;  3K0X A;  2K4K A;  3GTJ H;  1XPO A;  1K8A C;  4OX9 Q;  1E7Z A;  3F2C A;  5DLQ E;  3T1Y L;  4A3B G;  1QUQ A;  3RN2 A;  4JI6 L;  2YTV A;  1TXY A;  4AYB E;  4LUO A;  3H15 A;  2Z6K A;  3M7N A;  5IYC H;  1LM0 A;  5JJK A;  4QY7 A;  1SE8 A;  1OXS C;  2NVY H;  3CCL A;  2VQE Q;  2VUM G;  4DR7 L;  4X64 L;  3NEM A;  1KQS A;  3K80 C;  1OXT A;  4YCU A;  1QVC A;  1B8A A;  3FP9 A;  4EX5 A;  4DV7 L;  2E5L Q;  3CCE A;  2ZTE A;  4UPA A;  1KC8 C;  2D0P A;  2CWP A;  1CKN B;  1XMQ Q;  1Z9F A;  4A3J H;  2JJQ A;  1VQ6 A;  4YWM A;  4DUY L;  2ATW A;  1JB7 A;  2FXQ A;  1A0I A;  3CXC A;  1N36 Q;  3GTQ H;  1AE2 A;  4JI7 L;  2V1C C;  4LF4 L;  2H5X A;  3HOU G;  3GDE A;  4DUZ L;  2UUB Q;  4DV2 Q;  3J7Z C;  4DR4 L;  1V9P A;  3CP0 A;  4R4O A;  4JI2 Q;  3HOV G;  3S1Q H;  4DV1 L;  4LFB L;  4A93 H;  1TWC H;  5GRO A;  4A3G G;  2K75 A;  2OCE A;  2R6G A;  4LF8 L;  5GAG C;  3S2H H;  4IOA A;  2K5H A;  3RZO H;  3DM3 A;  1G51 A;  1T9H A;  4BBR H;  1EIY B;  2ES2 A;  1H95 A;  3CW2 C;  1PV4 A;  2PQA B;  3GTG H;  2K5V A;  5IP9 G;  5C44 H;  3BZK A;  3J80 c;  3JAM i;  2Q2U A;  4L5Q A;  1FJG Q;  1IXR A;  2I5H A;  1XJV A;  4BXX G;  2OTL A;  3PIO A;  4YY3 L;  4R4T A;  1FVI A;  3J81 c;  5IYB G;  2Y0S G;  1PH6 A;  3H3V I;  1VS0 A;  2R7F A;  3GTO H;  2R7Z G;  3TS2 A;  5HY6 A;  4O2D A;  2HHH Q;  3HKZ E;  3G4S A;  1K73 C;  2I0Q A;  1VQE A;  2NZO A;  2A8V A;  1NE3 A;  4GNX B;  3HOY G;  1V1Q A;  4GLX A;  1WJJ A;  4O0A A;  3HOW H;  4P75 A;  4BY1 G;  1WI5 A;  1RIP A;  3CME A;  5AJ3 L;  4A75 A;  3E9H A;  1IBM L;  3CCM A;  1YHA A;  1UEB A;  3U4V A;  2AKW B;  4A3B H;  3W1G A;  4OWW B;  4IFD G;  2BA1 A;  5IWA L;  3ULJ A;  1PH7 A;  1M90 C;  1X56 A;  3UDG A;  1HJP A;  1VQJ A;  1Y14 B;  3ICE A;  3OTO Q;  2VQF L;  2VUM H;  4L5T A;  1JMC A;  1KXL A;  4GLV B;  1CKN A;  1VQH A;  4TVA B;  3UDF A;  1HNX L;  2YU9 H;  1E24 A;  4YHH L;  1HNW Q;  4JI8 L;  2RHQ B;  1Q81 C;  3VDY A;  4DR7 Q;  2MQH A;  4X64 Q;  4B3T L;  1BKB A;  4IJL A;  1I3Q H;  1AE3 A;  2HIV A;  2AWO A;  3AYH B;  5LMU L;  1SRU A;  2E8G A;  1BVS A;  5HGQ A;  1QVG A;  1VQ5 A;  3EN2 A;  3HOU H;  4X62 L;  3CCJ A;  3HOV H;  1L0W A;  4DUY Q;  3FKI G;  4DR6 L;  1B70 B;  2UXD L;  3G48 A;  2IHF A;  1N33 Q;  4UP7 A;  4HJ7 A;  1YIT A;  2ZM6 L;  1XNQ L;  2JA7 G;  1HR0 Q;  4DKA C;  4A3G H;  3LGJ A;  4LF4 Q;  2R7D A;  4DUZ Q;  4DAY B;  4DR4 Q;  3I4O A;  2PQA A;  4LF9 Q;  5ELN A;  1PH8 A;  4AYB G;  4C3J H;  4LFB Q;  3KF6 B;  4EQ5 A;  4LF5 L;  4XTC S;  3TQY A;  1QVF A;  3CC2 A;  3UE0 A;  5IP9 H;  3H0G H;  3KJP A;  3OW2 A;  4A3E G;  1VQB A;  1Q1B A;  5E7N A;  5C3E H;  1N34 L;  4JBM A;  2HT1 A;  2WP8 J;  3S1M H;  3U4Z A;  4KLK A;  2D62 A;  5LMN L;  4GOP A;  1I5F A;  4RMF A;  4BY7 G;  4BXX H;  2JEA I;  4P71 A;  4A3D G;  1TWA H;  2CFM A;  1R9T H;  5IYB H;  1GD7 A;  1PYB A;  1TWF H;  2KHJ A;  1EQR A;  3STB C;  3DLL A;  4GNX A;  2R7Z H;  4A3L G;  2DUD A;  3ULL A;  2KCM A;  3KJO A;  3CMA A;  4JV5 Q;  3ER0 A;  5JJI A;  4HID A;  1PH1 A;  5IYD H;  2I5M X;  4C3H H;  3GTP H;  3D31 A;  2F52 A;  2OQK A;  3STB D;  3CC7 A;  2NVT H;  4ALP A;  4A3F H;  1KD1 C;  5GAH C;  4IJH A;  4PZ7 A;  4BY1 H;  1EWI A;  3UDI A;  2YTX A;  1IBK Q;  1IBL Q;  1WOC A;  3PCO B;  1AH9 A;  2MO1 A;  4LNQ A;  2N8N A;  2MO0 A;  3TEH B;  2IY5 B;  4LW1 A;  4DK6 C;  5GAD C;  1BBW A;  2IHE A;  3M4O H;  3S2D H;  1IBM Q;  1HZA A;  3I4N G;  1EUJ A;  4OWT B;  4YCV A;  1WYD A;  4DV0 L;  1EIF A;  5IWA Q;  3H3V H;  4GOP C;  3L7Z C;  1A62 A;  4MTN A;  1SFO H;  1HZB A;  1YIJ A;  2R92 H;  5BR8 Q;  2F4V L;  4X66 Q;  3U58 A;  2JA6 G;  4GNX C;  3KLW A;  4B3R L;  1HNZ L;  4LF6 Q;  3AQQ A;  3PUV A;  1EQQ A;  4JI4 Q;  2GN5 A;  1GVP A;  2Q2H A;  1NJI C;  1VQL A;  4TQU S;  2XGT A;  4B3T Q;  1KAW A;  4DV3 L;  2PI2 A;  1YJW A;  3F8T A;  3FKI H;  1GKH A;  4HJ9 A;  4LUV A;  2YV5 A;  1X3G A;  2JA7 H;  1SRO A;  4JC0 A;  2IT1 A;  3KF6 A;  1CKM A;  1UWV A;  4X62 Q;  4A76 A;  2E2J H;  2UUA L;  1YJ9 A;  4DR5 L;  3IRB A;  4B3M L;  2UXD Q;  4RG1 A;  1PH3 A;  4JI3 L;  4AH6 A;  3T1H L;  1XNQ Q;  2JK8 A;  4NXN L;  3KFU A;  2VY3 A;  4DV6 Q;  4GKK L;  2NN6 G;  1Q8K A;  2GVB A;  4A3E H;  1N8R C;  4A3C H;  2JQO A;  4GKJ Q;  1N32 Q;  2JA5 H;  1NMF A;  2Z6K C;  1Q46 A;  3L2P A;  4QQB X;  4BY7 H;  4IFD I;  4A3D H;  2ID0 A;  2C35 B;  2PI2 E;  4KHZ A;  4DV4 L;  5IY0 A;  2ZJR A;  2A1A A;  5LMN Q;  1DGS A;  3RZD H;  1ASY A;  3S17 H;  4A3L H;  2ASB A;  3HFZ B;  3A0J A;  1EOV A;  1VQA A;  3M3Y H;  1PFS A;  3GTL H;  4LWC A;  3KOJ A;  2I5L X;  4LFA L;  1EFW A;  3MXN B;  4IFD J;  1NBW A;  2A19 A;  5C0X G;  4NPS A;  3CF5 A;  3TRZ A;  5FJ8 G;  3OYY A;  1HZC A;  3S15 H;  1A63 A;  2Z0S A;  5JEA J;  1X54 A;  4JCV E;  1QZG A;  1GM5 A;  2WB1 E;  4LF7 L;  3PUY A;  1SMX A;  4X65 L;  2UUC Q;  1LTL A;  1I50 H;  1OXU A;  5C4J H;  4GLA C;  1X3F A;  1E1O A;  4QGU A;  5LMN W;  4A3M G;  1LYL A;  2D0O A;  2HQL A;  4R4Q A;  4IPH A;  5IE8 A;  5JEA G;  4DV5 L;  3GTM H;  2RF4 A;  4KHP L;  3E0E A;  1XNR L;  4JI5 L;  3WWV A;  3AEV A;  3T1Y Q;  2BA0 A;  2JA6 H;  1WFQ A;  3ZJY C;  1YI2 A;  3CCU A;  3PO3 G;  4GN5 A;  4JI1 L;  3CCS A;  1K83 H;  2K52 A; 
#chains in the Genus database with same CATH topology
 4DR3 L;  3M4Q A;  3UI2 A;  2WAQ E;  4ZRZ A;  2EE1 A;  2M2L A;  4APV A;  4DV7 Q;  3S2H B;  3M85 A;  2JA5 B;  3K58 A;  3RZO B;  2FFK B;  3E9I A;  1TWH H;  5BN5 A;  2EJF C;  1JWM D;  3M3Y B;  4B9W A;  3PSI A;  4BS9 A;  3KK7 A;  3NXW A;  1EY7 A;  2PCF B;  1VQI A;  4DR5 Q;  3T1H Q;  2QA4 A;  3V96 A;  5LHY 1;  1H9M A;  4FXD A;  3K59 A;  3ZYY X;  1CK1 A;  2K5W A;  1CUK A;  3EJI A;  3MXN A;  5I6Y A;  2HCI A;  3NE5 B;  5C4J B;  1AEX A;  3MEH A;  1YBY A;  1XMO L;  5C0X H;  3HOY H;  4TRD A;  3Q22 A;  2F0M A;  4RGT A;  1CSQ A;  2KBN A;  3T16 A;  4C1N K;  1D8L A;  4IFD H;  2GVA A;  4F8M A;  1WTX A;  3PUZ A;  3ULP A;  1FJG L;  5C4X G;  3MAQ A;  2A74 C;  5JEA H;  1Q1E A;  1PA6 A;  2E2I H;  1SYD A;  4IPC A;  5CGK A;  1BO0 A;  1IZ6 A;  1RL2 A;  2JYO A;  3AFP A;  1JOR A;  1WD0 A;  4DR1 L;  2ZTD A;  2HCC A;  3AFQ A;  4ZKC B;  3OMG A;  4U68 A;  5CR3 A;  1J9O A;  1K8G A;  4A3G B;  1HNX Q;  1FL0 A;  1PFN A;  4WJ3 M;  5M5X H;  4YHH Q;  1QNK A;  2O5I C;  4DAM A;  1MJE A;  3HOW G;  1M1K C;  1SAP A;  2PMZ E;  3GO5 A;  3SGI A;  4XYQ A;  4RHS A;  1U4P A;  4MZ9 A;  1XPU A;  1PRT B;  3IKJ A;  2UU9 L;  2R7Z B;  1I4H A;  2ZM6 Q;  2EOT A;  5JOB A;  2XTI A;  3C46 A;  1VCI A;  3EBE A;  2UXC L;  1VQ9 A;  2JA8 G;  3J81 j;  1BUV T;  4LF5 Q;  3K8A A;  3IFD A;  1SE2 A;  1N33 L;  1S5C D;  5C0X J;  2EQS A;  4C56 C;  3IL8 A;  1S5B D;  3S2D B;  1QZH A;  1SXT A;  1I4Q A;  1KNA A;  1LO5 D;  1XMO Q;  1EEF D;  1DM0 B;  4HMI A;  1OO9 B;  5CV7 A;  3GTK H;  2PW5 A;  2N49 A;  3NBH B;  1H9S A;  2A6E C;  1WTH A;  3F1Z A;  2OXP A;  3F2D A;  3N6R A;  3FHW A;  2DNE A;  1LUZ A;  4OON A;  2IX1 A;  4ILW A;  3I55 A;  2JA7 B;  4L63 B;  1LT6 D;  2VZA A;  1NNX A;  4DR1 Q;  3MEF A;  5IYD G;  3MXP A;  1EY9 A;  1CZW A;  4UP8 A;  4A3F G;  1X65 A;  4YCW A;  2JA9 A;  4B3R Q;  4FDB A;  4A3E B;  4OO1 I;  2BDO A;  2DGY A;  1WCM G;  3S24 A;  5KYI A;  1SR3 A;  4ZCK A;  4DV3 Q;  3D6W A;  4K5V A;  1ESF A;  4KKU A;  2J4X A;  5M9O A;  1K0R A;  3CPF A;  2FIN B;  2VS1 A;  4YWK A;  1PH9 A;  4JI4 L;  2UU9 Q;  3GTL B;  1K0S A;  3BU2 A;  1VQ4 A;  1VQO A;  1VF5 C;  3PF5 A;  1XTC D;  4A3I H;  2WFW A;  4HIO A;  2UXC Q;  3LWE A;  1E1T A;  4CDE C;  1KHI A;  2DJG C;  4JI2 L;  2F0H A;  1IL2 A;  1MIU A;  1PFM A;  4M1U B;  2F0D A;  3HOZ H;  1SE3 A;  4PMW A;  1I6V C;  1RHP A;  3CCV A;  2NVX H;  4A93 G;  1M8A A;  4PQX A;  1Z47 A;  1EYG A;  3HKZ B;  1E22 A;  3MZ5 A;  3F2B A;  2ICE C;  3B6Y A;  4A3M H;  4BBR G;  1GHJ A;  1K9M C;  4X65 Q;  2YTY A;  1B7Y B;  4HJ8 A;  2WKD A;  3DEP A;  4NB3 A;  1STB A;  4KHP Q;  4CKE A;  1DXM A;  5H1S E;  2ZTC A;  5M3F H;  3OOC A;  1HTP A;  1DD2 A;  2N78 A;  2K03 A;  1TS2 A;  2J0T D;  3P1H A;  4UHV A;  4C2M B;  2UUC L;  3L9A X;  1PFB A;  3QWN A;  3KDF A;  2KED A;  3Q0A A;  2K4K A;  1XPO A;  1CTM A;  1V1P A;  5DLQ E;  4A3B G;  1QUQ A;  1ET6 A;  4RGM A;  4WOR A;  1WD1 A;  3M7N A;  3H15 A;  5JJK A;  3QG1 A;  3NEM A;  1QVC A;  2H4O A;  1IYU A;  1STN A;  2D0P A;  2CWP A;  1CKN B;  5ELD A;  1XMQ Q;  4A3J H;  1VQ6 A;  4YWM A;  4DUY L;  2ATW A;  1G91 A;  1JB7 A;  3CU7 A;  3QR8 A;  1B9N A;  4LF4 L;  1GUG A;  3GDE A;  1O7Y A;  4DUZ L;  2UUB Q;  1MSH A;  3CP0 A;  4R4O A;  4JI2 Q;  4KJO A;  2Q8I B;  1ICW A;  3I73 A;  4WRD A;  1BF4 A;  1SMY D;  2K5H A;  4HCE A;  4C3J G;  2ES2 A;  1H95 A;  1KDC A;  2IW3 A;  3S1R B;  5C44 H;  3JAM i;  4OIK A;  1SYB A;  2I5H A;  1EZ6 A;  4YY3 L;  1FVI A;  5IYB G;  2Y0S G;  5CYU A;  3H3V I;  3HKZ E;  1SJH D;  3G4S A;  2F3W A;  3I3C A;  2NZO A;  4C3H G;  3RD4 A;  3HOY G;  1GUS A;  4JW0 A;  4XT1 B;  4EQP A;  4G7Z C;  4ID6 A;  1RIP A;  2AUJ D;  2F4I A;  3U4V A;  4IFD G;  5FK9 C;  1SYE A;  4KY5 A;  1IKM A;  3ULJ A;  4ZLT F;  1VQJ A;  3ICE A;  3OTO Q;  2VUM H;  3GTQ B;  1JMC A;  3W2D A;  2YU9 H;  2RDH A;  1E24 A;  1GJX A;  1CA6 A;  1RCV D;  3T53 B;  4RKL A;  1S5D D;  3BDL A;  4B3T L;  1TWC B;  1I3Q H;  1AE3 A;  5LMU L;  1SRU A;  5C4X B;  1VDZ A;  1HQM C;  2F0L A;  2F0P A;  1QVG A;  3M7G A;  1VQ5 A;  3HG9 A;  4X62 L;  2XRQ D;  3CRK C;  4DUY Q;  3HOV H;  1YIT A;  4DKA C;  2K04 A;  4LF4 Q;  4DUZ Q;  4LF9 Q;  5ELN A;  2A6H C;  3KF6 B;  3TQY A;  1EY0 A;  4RWS C;  3HOW B;  1NSN S;  2WV6 D;  3U4Z A;  4BWG B;  3QJY A;  4GOP A;  1RTO A;  4BXX H;  3MA2 B;  1TWA H;  2Z1C A;  4IUU A;  3V05 A;  1R9T H;  1LTI D;  1PYB A;  2KHJ A;  3DLL A;  4GNX A;  4KY6 A;  1CA5 A;  3ER0 A;  5JJI A;  4IUV A;  1JB3 A;  2IJ0 A;  2F52 A;  4ZYS A;  2NVT H;  1F77 A;  2EYJ A;  2K6A A;  2QKI C;  4BY1 H;  1SYC A;  4KK7 A;  4R8I A;  2H1E A;  4XT3 B;  2YTX A;  2JA8 B;  3PCO B;  1FR3 A;  5GAD C;  1HZA A;  1BOS A;  1EUJ A;  4YCV A;  1WYD A;  1GUT A;  2CW0 C;  3AU7 A;  4QUC A;  3HOU B;  4GOP C;  4MTN A;  1SFO H;  2IWH A;  4S3S A;  4OIJ A;  4X66 Q;  2JA6 G;  3URY A;  2B2Y A;  4GNX C;  1HFN A;  1F2L A;  1ZKO A;  4KJN A;  1ZEQ X;  2KA7 A;  3A55 A;  5J1Z A;  1X3P A;  4TQU S;  4B3T Q;  4QIW B;  1HA6 A;  4DAY A;  4HJ9 A;  1JR0 D;  3BYY B;  2YV5 A;  3S1M B;  3TP6 A;  4MTK A;  1PDQ A;  1CKM A;  4X62 Q;  4A76 A;  1J8I A;  2DY7 A;  2LMC B;  3IRB A;  1PH3 A;  3QIA A;  4JI3 L;  4AH6 A;  4GKK L;  4G57 A;  4NXN L;  4DV6 Q;  5C3X A;  2F0T A;  3R8B A;  3GTP B;  1N32 Q;  2Z6K C;  4KN4 C;  5K5P A;  2V4D A;  4A3F B;  4QQB X;  1ML0 D;  4BY7 H;  1EU3 A;  4A3D H;  2DY8 A;  2ID0 A;  1SYG A;  2C35 B;  2PI2 E;  5KND A;  1WCM B;  4DV4 L;  2A1A A;  4A3L H;  2L0C A;  3S17 H;  1TT2 A;  1SYF A;  3HFZ B;  2ASB A;  1JOK A;  4LWC A;  1HHV A;  2I5L X;  3FMC A;  3VA5 A;  2A19 A;  3TRZ A;  3OYY A;  4NW2 A;  1ILQ A;  4JCV E;  1FD7 D;  3BG3 A;  5D3I B;  2K28 A;  1SMX A;  1U9R A;  1HUN A;  2ENB A;  2E76 C;  4QGU A;  4A3M G;  4JI6 L;  2D0O A;  4KY7 A;  4IPH A;  5IE8 A;  4OHJ A;  2F0N A;  1YNN D;  4DV5 L;  3GTM H;  1XNR L;  2B2U C;  1EY5 A;  2AQ3 B;  1STA A;  1WFQ A;  3ZJY C;  1YI2 A;  2QIL A;  2E2J B;  3OWE B;  3PO3 G;  4GN5 A;  3S1Q B;  4JI1 L;  1IL8 A;  1K83 H;  2EPB A;  5JAV A;  2SDF A;  4MN3 A;  1KRS A;  5EJW A;  1B44 D;  2O2L D;  1N9W A;  1HZ9 A;  3CCR A;  4BBR B;  1A6X A;  2CWA A;  3PGZ A;  3F2U A;  3GTG B;  2EIF A;  4LFC L;  1LT5 D;  4IUR A;  1V43 A;  4QJF A;  1Y1V G;  1STH A;  4YWL A;  4JI7 Q;  3J80 i;  3I4M G;  4ZAI A;  2E5L L;  2KCN A;  3SDZ A;  1A15 A;  2F0E A;  3J7A 5;  3NTH A;  3H94 A;  4GS3 A;  4QIW E;  3J81 i;  5IGF A;  4JI3 Q;  1NR2 A;  3T56 B;  1UNS A;  4ULL A;  1BBU A;  1S72 A;  2ZXR A;  3A8I E;  1LTS D;  1SBB B;  1TII D;  3MC0 B;  4ZUJ A;  4ME3 A;  4QF4 A;  3OMC A;  4DR2 L;  1F2Y A;  2A69 D;  2LY7 A;  3G71 A;  1I50 B;  3I56 A;  3D4D A;  3SEB A;  4A3B B;  1L2F A;  2RDG A;  2CQO A;  1LTT D;  3EIV A;  3ERS X;  3MXG A;  5DM6 3;  4OL7 A;  3OWF A;  3A74 A;  4R4I A;  3Q6S A;  2F0J A;  1PHJ A;  1PH4 A;  4AQY L;  2LSS A;  2M00 A;  4K6D A;  4N9T A;  3RNU A;  5AJ3 Q;  4IUQ A;  4AIM A;  4FYD A;  3A7A B;  2HHH L;  1KRT A;  2B63 G;  4A3K G;  1B1Z A;  2MUY A;  1XNR Q;  1S3O A;  2VQF Q;  4BBS G;  3HEJ A;  1NY4 A;  2WKC A;  4DK0 A;  3VYU A;  2EY1 A;  5CV4 A;  3HKZ G;  4JI1 Q;  5CC4 A;  4C3J B;  2RQX A;  1J6Q A;  1OXX K;  3T51 B;  2HQE A;  3PO2 H;  1Y8O B;  2E74 C;  3G7L A;  4ME5 A;  4CDC C;  1HNW L;  4LFC Q;  2Y0S B;  1PH5 A;  4DR6 Q;  1TWF B;  1GO3 E;  3I2Z A;  3QOJ A;  4C3H B;  3L0O A;  1U4R A;  3HOY B;  3J7Y W;  3P20 A;  4RKB A;  3JAM L;  1LT3 D;  1STG A;  1KIX A;  4I65 A;  1HR0 L;  1XYI A;  4HCS A;  2HIX A;  3BYT B;  4HMJ A;  5CV5 A;  4HN7 A;  4DR2 Q;  2E2I B;  3M4O B;  3KLS X;  4G7H C;  1HPC A;  3CC4 A;  4GN4 B;  4KN7 C;  4V0B A;  1PTO D;  1IKL A;  4LAA A;  2EY2 A;  2K50 A;  1PYW D;  2PW7 A;  4O1N A;  5JVG 3;  3I90 A;  2R93 H;  1I4X A;  4NMZ A;  4JVZ A;  4IPG A;  5FLM G;  2XNA C;  4PZ8 A;  3K5M A;  1D7Q A;  3I4N H;  5K36 G;  4RA8 A;  4AQY Q;  5J22 A;  2A6E D;  4DU9 A;  3Q8D A;  4G4K A;  1O7I A;  1Q82 C;  5IP7 H;  4J1M A;  4P74 A;  2MNA A;  2K01 A;  1VQ7 A;  1B53 A;  1IBK L;  2FMM A;  5E4W C;  4F87 A;  1SLJ A;  1P8L A;  1Y1W H;  1VQC A;  4Y7N H;  2QDL A;  1OXV A;  2RCN A;  5JJL A;  4OX9 L;  3CD6 A;  3CQZ H;  1BR9 A;  2NVQ H;  1K8O A;  4IO9 A;  1KAA A;  1C48 A;  3RR5 A;  1C8C A;  4J15 A;  1X9N A;  1JC7 A;  2VL6 A;  5EGT A;  2NN6 H;  1MHW C;  4LF6 L;  2LFN A;  5IYC G;  2ZT9 C;  3WDN A;  3D8G A;  4B3M Q;  2ZXO A;  2VW9 A;  1I4P A;  4NKL A;  1YNJ C;  2F1M A;  4CJ0 B;  2K5Q A;  3A7L A;  4I7Z C;  2Y0S E;  2E2H H;  4JG2 A;  4DV2 L;  2KUM A;  3PV0 A;  3S16 H;  4KTA A;  2FJ2 A;  5M3M H;  3NBH A;  3VR3 A;  1UE7 A;  1YEZ A;  1JOO A;  3JAM E;  2QEJ C;  3K7U C;  4GN3 B;  3MVV A;  3HOX H;  2JA6 B;  3ITP A;  1E3P A;  2F0Q A;  1ICF B;  1CSP A;  5JVH 3;  2BH8 A;  2NTS A;  5DAU A;  3T4A C;  1PVO A;  2CCZ A;  5IT9 c;  2EXD A;  5ELB A;  2Q2T A;  1BDO A;  1W2B A;  5I9O A;  3TZD A;  1V1O A;  1HR0 W;  4RGN A;  1S40 A;  4IPD A;  2AWN A;  1JCK B;  1TKW B;  3TDQ A;  1MJC A;  1GUW A;  2N3S A;  3KYH C;  4CBV A;  1XTD A;  3NEN A;  1GHK A;  4Q5V A;  2PZW A;  2L1B A;  4DR3 Q;  1K8M A;  1D1K A;  3GTJ H;  4OX9 Q;  1O7Z A;  1E7Z A;  3T1Y L;  3K7A B;  1KDB A;  5E1F A;  1JWS D;  1Q3L A;  5I2X A;  1LM0 A;  2JXM B;  3DWQ A;  4H7B A;  4DR7 L;  4X64 L;  1OXT A;  2WIN B;  1B8A A;  3MFG A;  4H0L C;  3CCE A;  2ZTE A;  4UPA A;  3Q24 A;  1KC8 C;  3PQI A;  3BDO A;  3SVM A;  1W6K A;  1LAC A;  2JJQ A;  1VMC A;  4KKS A;  2G9D A;  4A3M B;  2LS0 1;  5ISR A;  2PPB C;  1FNW A;  4DGZ A;  3HOU G;  1I4R A;  4DV2 Q;  2DJF C;  4WFN 3;  4DV1 L;  2KCC A;  1C4Q A;  2F0I A;  1IW7 C;  4J6H A;  3PO3 B;  1S5E D;  3S2H H;  2OT2 A;  3RZO H;  1T9H A;  2CH4 W;  2QF7 A;  2F0W A;  2PQA B;  5IP9 G;  3BZK A;  4L5Q A;  1FJG Q;  1IXR A;  3PIO A;  1Q90 A;  3VYT A;  3NTK A;  1Y1V B;  1PH6 A;  3S14 B;  5C4H A;  3I4M B;  1VS0 A;  1ET9 A;  2R7F A;  1RTN A;  5ELE A;  1B9M A;  4GZY C;  2I0Q A;  4B9X A;  2A8V A;  4EQN A;  4RGO S;  1V1Q A;  3MWY W;  1XXG A;  4P75 A;  3J7A F;  2KVM A;  4HSV A;  5IWA L;  4A3J B;  1AP0 A;  1PH7 A;  2ZXP A;  3J80 L;  2Z4H A;  1G2T A;  4GLV B;  1CKN A;  1G8Z D;  4TVA B;  1SNO A;  4NP5 A;  5DM7 3;  1BCP C;  1H9K A;  3J81 L;  1JWU D;  4JI8 L;  1Q81 C;  3KLR A;  4DR7 Q;  1DOK A;  4X64 Q;  5I2Y A;  1EQT A;  3AYH B;  3FPU B;  3NSW A;  1MGS A;  4LMQ D;  1H9J A;  1TVX A;  3PIO 3;  3WOE A;  4DK1 A;  5E4X A;  3EN2 A;  1TS4 A;  3CCJ A;  3FKI G;  3DUZ A;  2UXD L;  3G48 A;  1N33 Q;  1XNQ L;  3S1N B;  1PTO B;  2Z8L A;  4A3G H;  3X3N A;  2B63 B;  3SK8 A;  4A3K B;  5M5W B;  4BBS B;  5FO7 B;  3PMF A;  4AYB G;  4XTC S;  4CKB A;  1ONL A;  2Z6B A;  3DM1 A;  5JPN C;  3KJP A;  1N34 L;  2L12 A;  4UAI A;  5LMN L;  4RMF A;  4R9W A;  4P71 A;  2CFM A;  1GD7 A;  2R7Z H;  3KJO A;  4HID A;  1ILP A;  2I46 A;  3D31 A;  4ALP A;  2YU9 B;  2NTT A;  4IJH A;  4PZ7 A;  3UDI A;  1KDA A;  3GP7 A;  1WOC A;  2N8N A;  2MO0 A;  1DCZ A;  4LW1 A;  1ZXT A;  3S2D H;  3NTI A;  2XWJ B;  1QJO A;  5IT9 L;  3I4N G;  4OWT B;  4DFA A;  4DV0 L;  5IWA Q;  3L7Z C;  1HZB A;  4IQZ A;  4IUP A;  2F4V L;  1AW7 A;  2CW0 D;  3MFY A;  3KLW A;  1HNZ L;  5FO8 B;  4JI4 Q;  3MHB A;  2SOB A;  3J80 E;  4RH6 A;  3K5L A;  3VYR A;  1B50 A;  1YJW A;  1A2U A;  2PI2 A;  4ODG A;  3HP3 A;  3LWU A;  4KV6 A;  4PNY A;  2JA7 H;  1X3G A;  3J81 E;  3KF6 A;  1TWA B;  4OEL B;  5EPK A;  2UXD Q;  3K0Y A;  4RG1 A;  1XNQ Q;  1NAP A;  2JK8 A;  2VY3 A;  2NN6 G;  4A3E H;  4A3C H;  1Z6H A;  3RMH A;  2NVT B;  4FF1 A;  3L2P A;  1QNU A;  2SEB D;  4BY1 B;  4IFD I;  5KRU A;  1HFG A;  3VR5 A;  4CHT B;  2FMC A;  4N8X 1;  5CMD A;  5IY0 A;  5LMN Q;  1DGS A;  1ASY A;  1EOV A;  1LTA D;  4KMU C;  3GTL H;  4N8F A;  1FNV A;  3KOJ A;  1B2T A;  2A68 C;  5C0X G;  1SFO B;  4NPS A;  1EWC A;  2NVY B;  1QZG A;  1Z7T A;  4HTH A;  2UUC Q;  1ZYR C;  2XRS D;  1X3F A;  5LMN W;  4FO2 A;  5JEA G;  3E0E A;  3NUC A;  5CV8 A;  4JI5 L;  3WWV A;  3O13 A;  1WTV A;  2BA0 A;  5EKI A;  1QE6 A;  5IT9 E;  3R2I A;  1HNZ Q;  4L5S A;  2B2V A;  4DNI A;  1NMG A;  3R3O A;  2EJM A;  2K5N A;  1IHZ A;  2QW7 A;  1L1O B;  2XWB B;  1Y8N B;  3A54 A;  1W3S A;  3S17 B;  5IGE A;  5COR A;  4OWX B;  3PUW A;  1SNC A;  1EFI D;  2KEN A;  1CHQ D;  3M4P A;  1BCP F;  2AQ2 B;  2B8G A;  2EYF A;  1H9R A;  1SNQ A;  3I7F A;  5KYL A;  1CM9 A;  2DN8 A;  3K5N A;  1ASZ A;  4JYA L;  2EYP A;  1C7Y A;  2B2V C;  4XYO A;  2Q2I A;  1MKH A;  3GTM B;  2QGQ A;  4K14 A;  3SK6 A;  4C1N I;  5I6W A;  4YY3 Q;  5FJ8 H;  1WTQ A;  1WTR A;  2I07 B;  3RN5 A;  1I4G A;  2EXZ A;  2RBM A;  2GA4 B;  4OXP A;  1DON A;  1K83 B;  5KIX A;  1JJ2 A;  4WJW A;  2NWG A;  2MJ8 A;  3PF4 A;  1VQ8 A;  2QCP X;  2BE5 C;  5M5Y H;  5EKK A;  1C9O A;  5D3D A;  1HH2 P;  2EVB A;  1QB5 D;  3LX0 A;  4JI5 Q;  2XN9 C;  3K5O A;  2K05 A;  3GV6 A;  2B29 A;  3JAM c;  5C3W A;  3RLN A;  1LLR D;  1AZP A;  3W5O A;  2MFI A;  1A3T A;  1F2Z A;  2HD3 A;  4XQQ A;  2AMC B;  4C3I H;  3HRZ C;  5LMU Q;  1EQV A;  2B2T A;  1KLU D;  5KGU A;  1JT8 A;  2L15 A;  5HUR A;  4IOC A;  1CKO A;  1JIC A;  3VR4 A;  2ZJQ A;  1ROD A;  2C9O A;  2EDG A;  4DK3 C;  4H44 C;  4PG3 A;  4P72 A;  4N9P A;  1YNX A;  2Q8R E;  1SN8 A;  4MNO A;  2B2Y C;  2PQE A;  4A4I A;  4A3I G;  3K57 A;  3ND9 A;  3QB3 A;  3HKS A;  4CJ2 C;  1PH2 A;  2SNM A;  3KF8 B;  4JYA Q;  1X6O A;  1JJC B;  3NK9 A;  1EIG A;  1SMY C;  1FGU A;  2B2T C;  3I91 A;  2IX3 A;  3HOZ G;  1L0Y B;  3HGB A;  4XDX A;  3CHB D;  1T5E A;  5C4X H;  2K14 A;  5GQO A;  4EQO A;  1EIH A;  3U50 C;  1F9P A;  1I94 L;  5IGB A;  1QG7 A;  2BOS A;  4JV5 L;  4FXK C;  3FKI B;  4HR7 B;  1XPR A;  2PNH A;  1CFM A;  1IYJ B;  4GOP B;  1PYS B;  3CAM A;  5M3F G;  1IBL L;  4F7X A;  2LXJ A;  5CBA E;  3HOW H;  5E3F A;  4AYB B;  5GAE C;  3BVZ A;  5EAY A;  2N55 A;  1UE6 A;  3BJU A;  2F3V A;  3SXH A;  4POF A;  2R3Z A;  2AHO B;  3ONA B;  4XIG S;  5IOC A;  4MHE A;  2KEC A;  2BCO A;  3NWS A;  5BR8 L;  2VQE L;  3RZD B;  1TWG H;  2ZJP A;  5COY A;  3H6M A;  3D0F A;  3A8J E;  3TP8 A;  2F0O A;  4KHV A;  3CPW A;  2JA8 H;  1ESR A;  1X3E A;  4HSP A;  1X55 A;  4KKT A;  3PIP A;  4GKK Q;  1YVC A;  4NXN Q;  1UE5 A;  1K3B C;  2PZT A;  4K2L A;  3W1B A;  4KI0 A;  3S15 B;  3JC6 6;  4L6T B;  1N36 L;  4X6A H;  3KLS A;  2R93 B;  4A3J G;  1VQP A;  4JBW A;  1YNJ D;  3E5S A;  3I4N B;  4JBJ A;  3DMU A;  1B3A A;  5I4D A;  4DV4 Q;  4POG A;  1F9R A;  1NUC A;  2NB0 A;  4GKJ L;  3NEL A;  3RLF A;  3T13 A;  1EZ8 A;  5L37 A;  2O4X A;  1NTG A;  1W6J A;  2YYZ A;  3M9B A;  1RF2 D;  2JSO A;  1VQN A;  1EYD A;  1EEI D;  4B08 A;  3NP8 A;  1VQM A;  4JBK A;  1EL0 A;  5C44 G;  2NVQ B;  1TWH B;  2K1B A;  1I94 Q;  2OQ0 A;  2Q8T A;  4JI6 Q;  4DV5 Q;  3PIP 3;  1RKN A;  3H3V C;  2L11 A;  5C5M A;  1SSO A;  4K6L A;  2CQA A;  1DZ1 A;  2JEB I;  2K32 A;  2VB3 X;  3D4R A;  3OPO A;  1CQV A;  1JE4 A;  1WCM H;  1I6H H;  3K0X A;  3H09 A;  1K8A C;  4QB4 A;  3VA7 A;  3F2C A;  2TSS A;  3RN2 A;  1CQF A;  2CH4 A;  2E2H B;  3GQB A;  4AYB E;  4LUO A;  5A35 A;  3S16 B;  4QY7 A;  1SE8 A;  1OXS C;  3CCL A;  2VUM G;  2VQE Q;  1KQS A;  3K80 C;  2E5L Q;  4DV7 L;  5D14 A;  1E2Z A;  1AZQ A;  4K8I A;  3HOX B;  4OO1 H;  1Z9F A;  1SND A;  3J7A V;  3CXC A;  1N36 Q;  3OW7 A;  5EPJ A;  2H5X A;  4DR4 L;  1ENF A;  1V9P A;  3HOV G;  3S1Q H;  2EYO A;  4LFB L;  4A93 H;  5EBC A;  3RUZ A;  1BXT A;  2OCE A;  2R6G A;  2IL8 A;  5GAG C;  2B8F A;  4IOA A;  3ND8 A;  4FF3 A;  1IW7 D;  3KBG A;  4BBR H;  1EIY B;  4V19 0;  3CW2 C;  1TY2 A;  5EBD A;  5M5X B;  2ICI A;  3GTG H;  3J80 c;  2Q2U A;  2N88 A;  4EVO A;  4DXG A;  3ERO A;  1XJV A;  4BXX G;  2KQ3 A;  3FRP B;  3GTJ B;  4R4T A;  3J81 c;  3SK5 A;  3GTO H;  3TS2 A;  5HY6 A;  4O2D A;  2HHH Q;  1HCZ A;  1VQE A;  3FVQ A;  1NE3 A;  5T1G A;  2NUC A;  5KEE A;  1K28 A;  4HAE A;  1WJJ A;  4DAV A;  4U67 3;  2EJG C;  1WI5 A;  4BY1 G;  5IIF A;  1YNN C;  2AKW B;  4A3B H;  1E2W A;  1CI3 M;  4O42 A;  4IAL A;  3U9S A;  2PMZ B;  1HJP A;  5G3L F;  4DF7 A;  4L5T A;  3UDF A;  1HNX L;  3E3X A;  5A2Q L;  4YHH L;  1STY A;  2B39 A;  1HNW Q;  2RHQ B;  5C4Z A;  3VDY A;  1G2S A;  4PV1 C;  1HTL D;  1BKB A;  3U9O A;  1BCP D;  2HUG A;  2SNS A;  2AWO A;  1AFP A;  1D5Z C;  4QUF A;  1BVS A;  4I7A A;  1O7L A;  5HGQ A;  4PMC A;  1BBX C;  1R4Q B;  3GTK B;  2K5D A;  2OF1 A;  4C3I G;  4TKO B;  1PRT C;  1L0W A;  1PMR A;  2L5T A;  3FPP A;  2C5C A;  4RFB A;  2ZM6 L;  1HR0 Q;  1D2B A;  3LGJ A;  5FO9 B;  3BVM A;  1Q8I A;  4DR4 Q;  3I4O A;  2PQA A;  4C3J H;  4LFB Q;  4LF5 L;  5F2D A;  1QVF A;  2RCF A;  4XXE A;  3UE0 A;  3OW2 A;  3H0G H;  2A69 C;  3CC2 A;  1Q1B A;  5E7N A;  5C3E H;  1U4L A;  4WJ4 A;  3X3M A;  1I5F A;  4BY7 G;  3WOF A;  2JEA I;  4A3D G;  1XWE A;  5IYB H;  2RDF A;  3STB C;  1TWF H;  3FDT A;  4A3L G;  1R4P B;  3CMA A;  1SDF A;  1FGB D;  1PH1 A;  4C3H H;  5JJZ A;  3CRL C;  3A8K E;  1KD1 C;  5GAH C;  3D3R A;  4E6I A;  3AMU A;  1IBK Q;  3NWT A;  2MO1 A;  5KNC A;  4LNQ A;  2VXW A;  1FNU A;  4DK6 C;  3M4O H;  2A5H A;  4A3I B;  3TSS A;  2G9H D;  1F2M A;  3R93 A;  1QWY A;  1EIF A;  1HXY D;  3H3V H;  1A62 A;  2R92 H;  4CKC A;  5KNB A;  3U58 A;  3HOZ B;  2F0V A;  4B3R L;  2RSO A;  4LF6 Q;  2RVL A;  1DJR D;  1EQQ A;  3I70 A;  2GN5 A;  3Q23 A;  2NVX B;  1GVP A;  4NDX A;  2Q2H A;  1NJI C;  1VQL A;  2XGT A;  3SE0 A;  1KAW A;  4DV3 L;  3F8T A;  1GKH A;  5A2Q E;  4LUV A;  4PMB A;  1SRO A;  2IT1 A;  1GXD C;  2E75 C;  1LTG D;  2UUA L;  5LL6 S;  1LV9 A;  4CDF C;  1RDP D;  3G6J B;  1LTB D;  1XX8 A;  4QMG A;  3KFU A;  1Q8K A;  2GVB A;  5M3F B;  1N8R C;  2JQO A;  2JA5 H;  1GOZ A;  3NQT A;  1DYQ A;  1X32 A;  3NBI A;  1TS3 A;  4DN4 M;  4KHZ A;  2ZJR A;  1VQA A;  3M3Y H;  1U4M A;  1PTO C;  1PFS A;  2X69 A;  5IGC A;  3HZX A;  3GV3 A;  4LK1 C;  3C3L A;  4LFA L;  3MXN B;  3NQI A;  4IFD J;  1NBW A;  1LAB A;  1RD9 D;  4Q0F A;  1SNP A;  5C5L A;  3D6C A;  2Z0S A;  5JEA J;  1X54 A;  1GM5 A;  3FEW X;  3BS1 A;  4LF7 L;  4FXG C;  2A68 D;  1II3 A;  1D5M C;  3PUY A;  4X65 L;  2HDM A;  5C4J H;  3P75 A;  1LYL A;  2HQL A;  1HRJ A;  2QDB A;  4KHP L;  2RF4 A;  4ZK9 B;  1ZYR D;  2F0G A;  3T1Y Q;  5IGD A;  2JA6 H;  5DEH A;  2D9U A;  3CCU A;  3I72 A;  3CCS A;  4G7O C;  3SK4 A;  1P16 A;  3V2T A;  5IGG A;  3DEO A;  4QL5 A;  4JK1 C;  1EY8 A;  2ALY B;  2F0U A;  5ELC A;  1WTW A;  4DPG A;  2XSC A;  5HGT A;  1YHQ A;  5C44 B;  1LT4 D;  1EYA A;  2CKZ B;  1CHP D;  1C0A A;  2AQ1 B;  2FHT A;  3PO2 G;  1UE1 A;  2UUA Q;  2KHS A;  1GUN A;  2LXK A;  4DV1 Q;  4IN3 A;  1A3V A;  1XMQ L;  1BQQ T;  2A6H D;  4HJA A;  4B3S L;  1VQG A;  3K7A H;  4OO1 G;  2UUB L;  4IUT A;  3UDX A;  5ELO A;  3VYS A;  5T1I A;  2VNU D;  3BZC A;  1JE5 A;  4DNR B;  2UXB L;  1RJT A;  4L5R C;  3A5U A;  1PRT F;  2RA4 A;  2VUM B;  1KAB A;  3HS0 C;  4LFA Q;  2L9H A;  3UE1 A;  4PZ6 A;  3BDC A;  2O5J C;  4Y52 H;  1G29 1;  1J5E L;  1A3U A;  1I3Q B;  1PZJ D;  4LF7 Q;  2R93 G;  1TY0 A;  3DXJ C;  4UP9 A;  2D2C C;  1MI2 A;  4IZ8 A;  2KJX A;  2BH2 A;  1H9S B;  3D4W A;  2OEO A;  5EKL A;  1B3Q A;  2BE5 D;  3PO3 H;  3EA6 A;  2HDL A;  3RLO A;  3HOV B;  2NN6 I;  1SE4 A;  5IP7 G;  2EY6 A;  1BCP B;  4HJ5 A;  1SEB D;  4BA1 I;  1L1O A;  2XIW A;  4JI8 Q;  1Y1W G;  3E6Z X;  4X3K A;  3TS0 A;  5I9P A;  2WB1 G;  4J8Q A;  1Y69 U;  1A8V A;  3OTO L;  1VQD A;  1Y1V H;  1OTC A;  3S14 H;  2F3I A;  3I4M H;  1Q7Y C;  2PYK A;  4LJZ C;  2E2D C;  4CDD C;  1R9T B;  1ENC A;  3K81 C;  1CT1 D;  4LUZ A;  5C0X I;  1Q86 C;  2L55 A;  1YHB A;  1U0L A;  4F88 A;  3IAY A;  4JI0 L;  1DOM A;  1EYC A;  1S4Z A;  2B2W A;  4B3S Q;  2WAQ G;  1N34 Q;  3GD7 A;  1L1O C;  2D5D A;  4K8J A;  4XQJ A;  2JE6 I;  4LF9 L;  5M5Y B;  2UXB Q;  5M3M G;  2KCT A;  3W3A A;  1JJG A;  5EQ0 A;  4Z9C B;  3HOX G;  1B4O A;  1K3R A;  4K0K L;  3H0G G;  5C3E G;  3S1N H;  1J5E Q;  1PTO H;  4C3I B;  4X3S A;  1VQK A;  1G6P A;  2B63 H;  4A3K H;  5M5W H;  5G3L D;  1KL9 A;  4NXM L;  4BBS H;  3KUP A;  4FF2 A;  1U5K A;  1TQO A;  2B2W C;  3IFT A;  3H91 A;  5FLX c;  3S9W A;  3TRE A;  4DV0 Q;  4ZKB B;  2J7Z A;  2IX0 A;  1PTO F;  1YJN A;  2CHB D;  2F4V Q;  4P73 A;  3OIP A;  5CBE E;  2TMP A;  4JOI A;  3BZD B;  4X3U A;  4BA2 I;  3CCQ A;  1VQF A;  4BY7 B;  1EWH A;  1KTK A;  4A3D B;  4RCO A;  3KDF B;  4X66 L;  2KHI A;  1UAP A;  4QCL A;  4C2M H;  3DWP A;  1V1P B;  4XQN A;  3A56 A;  1QUQ B;  2R92 G;  4UY8 C;  2WAC A;  4EGV A;  3DWA A;  3EQL C;  4TSS A;  4OGQ C;  4R1J A;  2M9V A;  1CZG A;  1F9S A;  3KF8 A;  4OEM B;  1YZ6 A;  3G6E A;  3TN2 A;  4FVM A;  2Z9H A;  4JI0 Q;  5ELF A;  1Q12 A;  3K6O A;  1HQR D;  2OTJ A;  2RHS B;  4JOI C;  2B3G A;  4DV6 L;  3TME A;  3PUX A;  4X3T A;  1EY4 A;  4HIK A;  1N32 L;  1UEA B;  3BVG A;  3TZU A;  4HIM A;  2OWO A;  2NZH A;  5FLM H;  1EU4 A;  2EY5 A;  5K36 H;  2JA5 G;  2F03 A;  2RKS A;  3ERQ A;  2QEX A;  5J3B A;  4IUN A;  2K33 A;  1KNE A;  4K0K Q;  3C2P A;  4R4C A;  1L0X B;  1QIL A;  2PZU A;  1D5X C;  3EVQ A;  4NXM Q;  5TSS A;  1TWG B;  2F0K A;  4H02 A;  2K7V A;  3A5Z B;  2JP1 A;  3S1R H;  4K2K A;  2R61 A;  1D1I A;  4R8N A;  2EYM A;  3CKI B;  3MTS A;  2BDN A;  5FKA C;  3C1E A;  2YTV A;  2A73 B;  1TXY A;  2Z6K A;  5IYC H;  1PXU A;  4ABN A;  2NVY H;  1TU2 B;  2MPM A;  1F9Q A;  4YCU A;  5CV9 A;  3FP9 A;  4EX5 A;  1E2V A;  4RAU C;  3M4Y A;  4ZQ3 A;  1PZK D;  1HUM A;  2KEE A;  2PNR C;  1UUP A;  2VB2 X;  1BNZ A;  2FXQ A;  1A0I A;  3GTQ H;  3VR2 A;  1AE2 A;  4JI7 L;  4H13 C;  3NPP A;  2V1C C;  1GUO A;  2X6L A;  3TBI B;  3J7Z C;  4K5X A;  3MXU A;  1MD2 D;  4P2C B;  1JQY D;  3NHH A;  1TWC H;  5GRO A;  4A3G G;  2K75 A;  3QO2 A;  1WTO A;  4LF8 L;  4DA2 A;  5NUC A;  3DM3 A;  1G51 A;  1PV4 A;  1Y8P B;  2K5V A;  1S5F D;  2B2U A;  3TP7 A;  1JOQ A;  4K5W A;  1T5X D;  1VF7 A;  1I6H B;  2OTL A;  2R7Z G;  3PO2 B;  3L3O C;  1QCB D;  5LL6 X;  1K73 C;  1HA5 A;  4GNX B;  2LKV A;  2Z4I A;  4CGY B;  3C1F A;  4GLX A;  4O0A A;  1ENA A;  3I8Z A;  3CME A;  1V8Q A;  5AJ3 L;  5D65 A;  3E9H A;  4A75 A;  1IBM L;  3CCM A;  5CV6 A;  1YHA A;  1UEB A;  3W1G A;  4OWW B;  1LTR D;  2BA1 A;  1M4V A;  3LNN A;  5AFW A;  1M90 C;  1X56 A;  4YIJ A;  3UDG A;  4DNT B;  1Y14 B;  2VQF L;  1KXL A;  3DHQ A;  1VQH A;  3TP5 A;  2DNC A;  1STE A;  5FLX L;  4A93 B;  2MQH A;  4IJL A;  3EFX D;  2HIV A;  2CVR A;  2E8G A;  5EPL A;  2F0F A;  2JN4 A;  3HOU H;  2EYH A;  4DR6 L;  1B70 B;  3R2T A;  2IHF A;  4UP7 A;  1E0B A;  4HJ7 A;  2JA7 G;  1WTP A;  1TR5 A;  2R7D A;  1PRT D;  4DAY B;  1TS5 A;  1PH8 A;  3GTO B;  2IPK D;  4EQ5 A;  2KOL A;  5FOB B;  5IP9 H;  4A3E G;  4LF8 Q;  2HT1 A;  1VQB A;  4A3C G;  1Y1W B;  4JBM A;  2WP8 J;  3S1M H;  4KLK A;  2D62 A;  4Y7N B;  2NZ1 D;  1A2T A;  2L4N A;  2WB1 B;  1DOL A;  4FNF A;  4JPB W;  1FYC A;  4L8J A;  2EZV A;  1EQR A;  3CQZ B;  3OIQ A;  2DUD A;  3ULL A;  2KCM A;  4JV5 Q;  3KBX A;  2NBF A;  5IYD H;  2I5M X;  2MHV A;  1MBY A;  3GTP H;  4CJ1 B;  3STB D;  2OQK A;  3CC7 A;  2G5D A;  4A3F H;  3AB9 A;  1EY6 A;  1EWI A;  5JPM C;  3E0J A;  4MIU A;  2RSN A;  1IBL Q;  1AH9 A;  1G6Z A;  3I4L A;  4ZUI A;  3TEH B;  2IY5 B;  4M8A A;  1BBW A;  1SJE D;  2IHE A;  2PO4 A;  1IBM Q;  2WAQ B;  2WII B;  3OSO A;  1NR4 A;  1MSG A;  3SR1 A;  5C6A A;  1YIJ A;  1WVL A;  5BR8 Q;  4KD4 A;  5M3M B;  2AUK A;  3AQQ A;  3PUV A;  5DNF A;  1X3Q A;  4FP5 D;  4DAP A;  5J39 A;  3H0G B;  3FKI H;  5C3E B;  1PLF A;  2F0S A;  4HED A;  4JC0 A;  4FF4 A;  5FLX E;  2E2J H;  1UWV A;  5IOD A;  1YJ9 A;  4DR5 L;  4B3M L;  3T1H L;  3SHL A;  1AN8 A;  4KD3 A;  4GKJ Q;  1NMF A;  1Q46 A;  2X6G A;  1IYV A;  1PZI D;  1SNM A;  4UDU C;  3QOL A;  4RCN A;  3RZD H;  5BN4 A;  3VR6 A;  1VMP A;  3A0J A;  3N52 A;  1NCV A;  1O80 A;  4DXF A;  1EFW A;  3P7J A;  1EOT A;  3CF5 A;  5FJ8 G;  2R92 B;  1HZC A;  1QOH A;  3S15 H;  1A63 A;  2WB1 E;  2P5Z X;  5BN3 A;  1LTL A;  1I50 H;  1OXU A;  1KLG D;  4GLA C;  1E1O A;  4RHR A;  4R4Q A;  1D6E C;  3AEV A;  2MP1 A;  2NYZ D;  2MGS A;  3OHX C;  1O78 A;  2EYL A;  2XVS A;  2K52 A; 
#chains in the Genus database with same CATH homology
 1P16 A;  4DR3 L;  3M4Q A;  4QL5 A;  1KRS A;  2WAQ E;  1HNZ Q;  4DV7 Q;  4APV A;  4L5S A;  4DNI A;  3M85 A;  1N9W A;  1HZ9 A;  1NMG A;  3CCR A;  3E9I A;  2ALY B;  2K5N A;  1TWH H;  2CWA A;  3PGZ A;  1L1O B;  4DPG A;  2EIF A;  4LFC L;  1YHQ A;  4QJF A;  1V43 A;  2CKZ B;  1C0A A;  1Y1V G;  4YWL A;  4JI7 Q;  1W3S A;  3J80 i;  3I4M G;  3PO2 G;  4OWX B;  3PUW A;  1UE1 A;  2E5L L;  2UUA Q;  3PSI A;  4A3C G;  2LXK A;  3J7A 5;  4DR5 Q;  1VQI A;  2KEN A;  4GS3 A;  4DV1 Q;  4QIW E;  3J81 i;  3T1H Q;  1XMQ L;  3M4P A;  4JI3 Q;  2QA4 A;  1BBU A;  1S72 A;  4HJA A;  4B3S L;  1VQG A;  1CUK A;  4ME3 A;  3K7A H;  4OO1 G;  3I7F A;  4DR2 L;  2UUB L;  3G71 A;  3UDX A;  3I56 A;  1ASZ A;  4JYA L;  5ELO A;  1L2F A;  1C7Y A;  2VNU D;  3BZC A;  1JE5 A;  1YBY A;  2UXB L;  2CQO A;  3EIV A;  3ERS X;  2Q2I A;  1MKH A;  1XMO L;  4L5R C;  3A5U A;  2QGQ A;  4YY3 Q;  5FJ8 H;  3HOY H;  3A74 A;  3RN5 A;  4R4I A;  4LFA Q;  1CSQ A;  2KBN A;  1PHJ A;  3UE1 A;  4OXP A;  1D8L A;  4PZ6 A;  1PH4 A;  2GVA A;  4AQY L;  4Y52 H;  5C4X G;  1G29 1;  2LSS A;  3PUZ A;  3ULP A;  1J5E L;  1JJ2 A;  1FJG L;  4LF7 Q;  1Q1E A;  1PA6 A;  3RNU A;  2E2I H;  3PF4 A;  2R93 G;  4UP9 A;  4IPC A;  5AJ3 Q;  1VQ8 A;  1IZ6 A;  4AIM A;  5M5Y H;  1RL2 A;  1C9O A;  3AFP A;  2BH2 A;  2HHH L;  1HH2 P;  1KRT A;  4DR1 L;  2B63 G;  4A3K G;  3PO3 H;  2ZTD A;  3AFQ A;  3RLO A;  4JI5 Q;  1XNR Q;  2NN6 I;  1S3O A;  2VQF Q;  5IP7 G;  4BBS G;  1NY4 A;  4HJ5 A;  1K8G A;  1HNX Q;  1FL0 A;  4WJ3 M;  2B29 A;  5M5X H;  4BA1 I;  3JAM c;  4YHH Q;  1L1O A;  4DAM A;  4JI8 Q;  3RLN A;  3HKZ G;  1MJE A;  4JI1 Q;  1M1K C;  3HOW G;  3W5O A;  1Y1W G;  2MFI A;  2PMZ E;  2AMC B;  3GO5 A;  3SGI A;  4C3I H;  5LMU Q;  1J6Q A;  1OXX K;  3TS0 A;  2WB1 G;  1A8V A;  3OTO L;  1VQD A;  1Y1V H;  4MZ9 A;  1OTC A;  1XPU A;  2F3I A;  3I4M H;  3S14 H;  3PO2 H;  1JT8 A;  1Q7Y C;  2L15 A;  4IOC A;  1CKO A;  2UU9 L;  1HNW L;  4LFC Q;  3K81 C;  1PH5 A;  4DR6 Q;  4LUZ A;  2ZJQ A;  1GO3 E;  3I2Z A;  5C0X I;  1Q86 C;  2ZM6 Q;  4DK3 C;  2XTI A;  1YHB A;  1U0L A;  1VCI A;  3L0O A;  4PG3 A;  4P72 A;  3EBE A;  4WJ4 A;  2UXC L;  1VQ9 A;  4LF8 Q;  1YNX A;  3J81 j;  2JA8 G;  4JI0 L;  1SN8 A;  3K8A A;  4MNO A;  4LF5 Q;  4A4I A;  1KIX A;  4B3S Q;  4A3I G;  2WAQ G;  1N34 Q;  3GD7 A;  1L1O C;  1N33 L;  5C0X J;  2EQS A;  1HR0 L;  2HIX A;  3HKS A;  4DR2 Q;  1PH2 A;  2JE6 I;  3KF8 B;  4LF9 L;  1QZH A;  4JYA Q;  1X6O A;  1JJC B;  3CC4 A;  4GN4 B;  1FGU A;  3HOZ G;  2UXB Q;  5M3M G;  2KCT A;  1XMO Q;  1JJG A;  2K50 A;  5C4X H;  2K14 A;  3HOX G;  5GQO A;  3GTK H;  2R93 H;  3F1Z A;  2N49 A;  3NBH B;  3F2D A;  1K3R A;  4IPG A;  5FLM G;  4PZ8 A;  4K0K L;  1D7Q A;  3H0G G;  3I4N H;  5K36 G;  3FHW A;  3U50 C;  5C3E G;  4AQY Q;  1I94 L;  3S1N H;  1J5E Q;  4JV5 L;  1LUZ A;  3Q8D A;  4OON A;  1VQK A;  1G6P A;  2B63 H;  1O7I A;  2IX1 A;  4A3K H;  1XPR A;  2PNH A;  5M5W H;  1KL9 A;  3I55 A;  1Q82 C;  5IP7 H;  1IYJ B;  4GOP B;  4NXM L;  1U5K A;  1PYS B;  4P74 A;  5FLX c;  4BBS H;  3TRE A;  4DV0 Q;  2VZA A;  2MNA A;  1VQ7 A;  2IX0 A;  3CAM A;  3MEF A;  5IYD G;  4DR1 Q;  5M3F G;  1YJN A;  1IBK L;  2LXJ A;  1IBL L;  1SLJ A;  1P8L A;  5GAE C;  4P73 A;  1Y1W H;  2F4V Q;  1VQC A;  4Y7N H;  4UP8 A;  4A3F G;  1X65 A;  5EAY A;  1OXV A;  4YCW A;  2JA9 A;  2RCN A;  4FDB A;  4B3R Q;  5JJL A;  4OO1 I;  4OX9 L;  4JOI A;  1UE6 A;  3CD6 A;  4BA2 I;  3BJU A;  2DGY A;  3CCQ A;  1VQF A;  1WCM G;  3CQZ H;  4POF A;  2NVQ H;  2AHO B;  3S24 A;  4IO9 A;  1SR3 A;  4DV3 Q;  3KDF B;  4XIG S;  3RR5 A;  4J15 A;  5BR8 L;  2VQE L;  4X66 L;  1X9N A;  1TWG H;  1K0R A;  2ZJP A;  2VL6 A;  3CPF A;  2KHI A;  2VS1 A;  4LF6 L;  3D0F A;  4YWK A;  4C2M H;  1PH9 A;  4JI4 L;  2UU9 Q;  5IYC G;  2R92 G;  1QUQ B;  3BU2 A;  4B3M Q;  3CPW A;  4UY8 C;  2JA8 H;  1X3E A;  3PIP A;  1VQ4 A;  1X55 A;  1VQO A;  4GKK Q;  2VW9 A;  1YVC A;  3PF5 A;  4NXN Q;  1UE5 A;  3W1B A;  4KI0 A;  4R1J A;  3JC6 6;  4A3I H;  1N36 L;  2WFW A;  4HIO A;  2UXC Q;  1E1T A;  4X6A H;  1YZ6 A;  3G6E A;  2Y0S E;  2E2H H;  4A3J G;  4JI0 Q;  1VQP A;  4JG2 A;  4DV2 L;  1KHI A;  1Q12 A;  4JI2 L;  4JBW A;  3PV0 A;  1IL2 A;  2OTJ A;  1MIU A;  4JBJ A;  3S16 H;  4POG A;  4DV4 Q;  2RHS B;  4JOI C;  2B3G A;  3HOZ H;  5M3M H;  4DV6 L;  4PMW A;  3PUX A;  4HIK A;  4GKJ L;  1N32 L;  3NEL A;  1UE7 A;  1YEZ A;  3CCV A;  3K7U C;  4GN3 B;  2NVX H;  3RLF A;  3HOX H;  4A93 G;  4HIM A;  2OWO A;  1E3P A;  1Z47 A;  2NZH A;  1NTG A;  5FLM H;  2YYZ A;  1CSP A;  3M9B A;  1EYG A;  2BH8 A;  1E22 A;  1PVO A;  3F2B A;  2JA5 G;  3B6Y A;  4A3M H;  5IT9 c;  2EXD A;  2CCZ A;  4BBR G;  2QEX A;  1VQN A;  2Q2T A;  1K9M C;  5J3B A;  1VQM A;  4JBK A;  4X65 Q;  2YTY A;  1B7Y B;  5C44 G;  4HJ8 A;  4K0K Q;  1W2B A;  4R4C A;  4JI6 Q;  1I94 Q;  2OQ0 A;  4NB3 A;  4DV5 Q;  1HR0 W;  4KHP Q;  5H1S E;  2ZTC A;  1S40 A;  4IPD A;  5M3F H;  2AWN A;  4NXM Q;  4H02 A;  2N78 A;  3A5Z B;  1MJC A;  2N3S A;  3KYH C;  1XTD A;  3NEN A;  2UUC L;  3S1R H;  2JEB I;  3KDF A;  1WCM H;  4DR3 Q;  1I6H H;  3K0X A;  2K4K A;  3GTJ H;  1XPO A;  1K8A C;  4OX9 Q;  1E7Z A;  3F2C A;  5DLQ E;  3T1Y L;  4A3B G;  1QUQ A;  3RN2 A;  4JI6 L;  2YTV A;  1TXY A;  4AYB E;  4LUO A;  3H15 A;  2Z6K A;  3M7N A;  5IYC H;  1LM0 A;  5JJK A;  4QY7 A;  1SE8 A;  1OXS C;  2NVY H;  3CCL A;  2VQE Q;  2VUM G;  4DR7 L;  4X64 L;  3NEM A;  1KQS A;  3K80 C;  1OXT A;  4YCU A;  1QVC A;  1B8A A;  3FP9 A;  4EX5 A;  4DV7 L;  2E5L Q;  3CCE A;  2ZTE A;  4UPA A;  1KC8 C;  2D0P A;  2CWP A;  1CKN B;  1XMQ Q;  1Z9F A;  4A3J H;  2JJQ A;  1VQ6 A;  4YWM A;  4DUY L;  2ATW A;  1JB7 A;  2FXQ A;  1A0I A;  3CXC A;  1N36 Q;  3GTQ H;  1AE2 A;  4JI7 L;  2V1C C;  4LF4 L;  2H5X A;  3HOU G;  3GDE A;  4DUZ L;  2UUB Q;  4DV2 Q;  3J7Z C;  4DR4 L;  1V9P A;  3CP0 A;  4R4O A;  4JI2 Q;  3HOV G;  3S1Q H;  4DV1 L;  4LFB L;  4A93 H;  1TWC H;  5GRO A;  4A3G G;  2K75 A;  2OCE A;  2R6G A;  4LF8 L;  5GAG C;  3S2H H;  4IOA A;  2K5H A;  3RZO H;  3DM3 A;  1G51 A;  1T9H A;  4BBR H;  1EIY B;  2ES2 A;  1H95 A;  3CW2 C;  1PV4 A;  2PQA B;  3GTG H;  2K5V A;  5IP9 G;  5C44 H;  3BZK A;  3J80 c;  3JAM i;  2Q2U A;  4L5Q A;  1FJG Q;  1IXR A;  2I5H A;  1XJV A;  4BXX G;  2OTL A;  3PIO A;  4YY3 L;  4R4T A;  1FVI A;  3J81 c;  5IYB G;  2Y0S G;  1PH6 A;  3H3V I;  1VS0 A;  2R7F A;  3GTO H;  2R7Z G;  3TS2 A;  5HY6 A;  4O2D A;  2HHH Q;  3HKZ E;  3G4S A;  1K73 C;  2I0Q A;  1VQE A;  2NZO A;  2A8V A;  1NE3 A;  4GNX B;  3HOY G;  1V1Q A;  4GLX A;  1WJJ A;  4O0A A;  3HOW H;  4P75 A;  4BY1 G;  1WI5 A;  1RIP A;  3CME A;  5AJ3 L;  4A75 A;  3E9H A;  1IBM L;  3CCM A;  1YHA A;  1UEB A;  3U4V A;  2AKW B;  4A3B H;  3W1G A;  4OWW B;  4IFD G;  2BA1 A;  5IWA L;  3ULJ A;  1PH7 A;  1M90 C;  1X56 A;  3UDG A;  1HJP A;  1VQJ A;  1Y14 B;  3ICE A;  3OTO Q;  2VQF L;  2VUM H;  4L5T A;  1JMC A;  1KXL A;  4GLV B;  1CKN A;  1VQH A;  4TVA B;  3UDF A;  1HNX L;  2YU9 H;  1E24 A;  4YHH L;  1HNW Q;  4JI8 L;  2RHQ B;  1Q81 C;  3VDY A;  4DR7 Q;  2MQH A;  4X64 Q;  4B3T L;  1BKB A;  4IJL A;  1I3Q H;  1AE3 A;  2HIV A;  2AWO A;  3AYH B;  5LMU L;  1SRU A;  2E8G A;  1BVS A;  5HGQ A;  1QVG A;  1VQ5 A;  3EN2 A;  3HOU H;  4X62 L;  3CCJ A;  3HOV H;  1L0W A;  4DUY Q;  3FKI G;  4DR6 L;  1B70 B;  2UXD L;  3G48 A;  2IHF A;  1N33 Q;  4UP7 A;  4HJ7 A;  1YIT A;  2ZM6 L;  1XNQ L;  2JA7 G;  1HR0 Q;  4DKA C;  4A3G H;  3LGJ A;  4LF4 Q;  2R7D A;  4DUZ Q;  4DAY B;  4DR4 Q;  3I4O A;  2PQA A;  4LF9 Q;  5ELN A;  1PH8 A;  4AYB G;  4C3J H;  4LFB Q;  3KF6 B;  4EQ5 A;  4LF5 L;  4XTC S;  3TQY A;  1QVF A;  3CC2 A;  3UE0 A;  5IP9 H;  3H0G H;  3KJP A;  3OW2 A;  4A3E G;  1VQB A;  1Q1B A;  5E7N A;  5C3E H;  1N34 L;  4JBM A;  2HT1 A;  2WP8 J;  3S1M H;  3U4Z A;  4KLK A;  2D62 A;  5LMN L;  4GOP A;  1I5F A;  4RMF A;  4BY7 G;  4BXX H;  2JEA I;  4P71 A;  4A3D G;  1TWA H;  2CFM A;  1R9T H;  5IYB H;  1GD7 A;  1PYB A;  1TWF H;  2KHJ A;  1EQR A;  3STB C;  3DLL A;  4GNX A;  2R7Z H;  4A3L G;  2DUD A;  3ULL A;  2KCM A;  3KJO A;  3CMA A;  4JV5 Q;  3ER0 A;  5JJI A;  4HID A;  1PH1 A;  5IYD H;  2I5M X;  4C3H H;  3GTP H;  3D31 A;  2F52 A;  2OQK A;  3STB D;  3CC7 A;  2NVT H;  4ALP A;  4A3F H;  1KD1 C;  5GAH C;  4IJH A;  4PZ7 A;  4BY1 H;  1EWI A;  3UDI A;  2YTX A;  1IBK Q;  1IBL Q;  1WOC A;  3PCO B;  1AH9 A;  2MO1 A;  4LNQ A;  2N8N A;  2MO0 A;  3TEH B;  2IY5 B;  4LW1 A;  4DK6 C;  5GAD C;  1BBW A;  2IHE A;  3M4O H;  3S2D H;  1IBM Q;  1HZA A;  3I4N G;  1EUJ A;  4OWT B;  4YCV A;  1WYD A;  4DV0 L;  1EIF A;  5IWA Q;  3H3V H;  4GOP C;  3L7Z C;  1A62 A;  4MTN A;  1SFO H;  1HZB A;  1YIJ A;  2R92 H;  5BR8 Q;  2F4V L;  4X66 Q;  3U58 A;  2JA6 G;  4GNX C;  3KLW A;  4B3R L;  1HNZ L;  4LF6 Q;  3AQQ A;  3PUV A;  1EQQ A;  4JI4 Q;  2GN5 A;  1GVP A;  2Q2H A;  1NJI C;  1VQL A;  4TQU S;  2XGT A;  4B3T Q;  1KAW A;  4DV3 L;  2PI2 A;  1YJW A;  3F8T A;  3FKI H;  1GKH A;  4HJ9 A;  4LUV A;  2YV5 A;  1X3G A;  2JA7 H;  1SRO A;  4JC0 A;  2IT1 A;  3KF6 A;  1CKM A;  1UWV A;  4X62 Q;  4A76 A;  2E2J H;  2UUA L;  1YJ9 A;  4DR5 L;  3IRB A;  4B3M L;  2UXD Q;  4RG1 A;  1PH3 A;  4JI3 L;  4AH6 A;  3T1H L;  1XNQ Q;  2JK8 A;  4NXN L;  3KFU A;  2VY3 A;  4DV6 Q;  4GKK L;  2NN6 G;  1Q8K A;  2GVB A;  4A3E H;  1N8R C;  4A3C H;  2JQO A;  4GKJ Q;  1N32 Q;  2JA5 H;  1NMF A;  2Z6K C;  1Q46 A;  3L2P A;  4QQB X;  4BY7 H;  4IFD I;  4A3D H;  2ID0 A;  2C35 B;  2PI2 E;  4KHZ A;  4DV4 L;  5IY0 A;  2ZJR A;  2A1A A;  5LMN Q;  1DGS A;  3RZD H;  1ASY A;  3S17 H;  4A3L H;  2ASB A;  3HFZ B;  3A0J A;  1EOV A;  1VQA A;  3M3Y H;  1PFS A;  3GTL H;  4LWC A;  3KOJ A;  2I5L X;  4LFA L;  1EFW A;  3MXN B;  4IFD J;  1NBW A;  2A19 A;  5C0X G;  4NPS A;  3CF5 A;  3TRZ A;  5FJ8 G;  3OYY A;  1HZC A;  3S15 H;  1A63 A;  2Z0S A;  5JEA J;  1X54 A;  4JCV E;  1QZG A;  1GM5 A;  2WB1 E;  4LF7 L;  3PUY A;  1SMX A;  4X65 L;  2UUC Q;  1LTL A;  1I50 H;  1OXU A;  5C4J H;  4GLA C;  1X3F A;  1E1O A;  4QGU A;  5LMN W;  4A3M G;  1LYL A;  2D0O A;  2HQL A;  4R4Q A;  4IPH A;  5IE8 A;  5JEA G;  4DV5 L;  3GTM H;  2RF4 A;  4KHP L;  3E0E A;  1XNR L;  4JI5 L;  3WWV A;  3AEV A;  3T1Y Q;  2BA0 A;  2JA6 H;  1WFQ A;  3ZJY C;  1YI2 A;  3CCU A;  3PO3 G;  4GN5 A;  4JI1 L;  3CCS A;  1K83 H;  2K52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...