3HOZH

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
146
structure length
136
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 19
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hozH00
1TWGH 2WP8J 2E2IH 3KFUA 3CMAA 4LFBL 1B7YB 2GVBA 4DR2Q 1VQ8A 3K7UC 1KIXA 2OQ0A 2R92H 5GAHC 2OWOA 3I4NG 3SGIA 2B3GA 1GVPA 1XJVA 3I4MH 1PH3A 3CC4A 4DV3L 4DR4L 1CKOA 1T9HA 2VQFQ 1NMGA 4JC0A 1XTDA 4UPAA 4DV5L 4LFAL 4A3LG 1UWVA 4A4IA 4AYBE 2UUBQ 4HIDA 1YJNA 3BJUA 3EIVA 3BU2A 2OTLA 3GTOH 2UXCQ 5FLMH 3GO5A 5HGQA 1IBML 3PO2G 3H0GG 1QVGA 4LF8L 1EYGA 2D62A 3J7A5 2NVQH 4A3CH 3CCSA 1MJEA 1IL2A 5IYCG 1NMFA 1C9OA 1IXRA 1A62A 2HQLA 1X65A 2B63G 1HR0L 1FJGL 4DUZL 1ASZA 5C4XG 4BA1I 2HHHL 2VW9A 2E5LL 4JCVE 1RIPA 4DV2Q 4L5SA 4WJ4A 1YIJA 2BA1A 4PZ7A 1WI5A 5IYCH 2CCZA 4MTNA 4YCWA 3W1GA 1X3FA 4DV1L 1GKHA 5IWAL 1XMOL 1A8VA 3AQQA 3PUZA 1I6HH 1N8RC 4QL5A 5E7NA 3J7ZC 2A8VA 3AFPA 2I5MX 3T1YQ 3F1ZA 4XTCS 4DNIA 5GAEC 4DV0Q 4DV7Q 1EQRA 3HOZH 4BY7H 4GN4B 4WJ3M 4C3IH 1OXUA 4NXNQ 4PG3A 4YWKA 4LF5Q 2ZTEA 1CSQA 2A19A 2N8NA 3CQZH 1PV4A 3S1QH 1S40A 4A3CG 3ERSX 4O0AA 3I4MG 1VQOA 1CUKA 4K0KL 2R92G 1UEBA 2LXJA 2ZJQA 4EX5A 4OXPA 3GTLH 1PH6A 4HJ8A 3CPFA 3PIPA 1J5EL 2JEAI 2VL6A 1I5FA 4B3SQ 4GOPA 2F4VQ 1YNXA 1N36Q 4Y7NH 4A3MH 5FJ8H 1N33Q 4JYAL 3HOWH 1N9WA 1VQCA 1WCMG 4NB3A 4HIKA 1PA6A 1E22A 1XMQQ 3GTJH 1LYLA 1UE1A 2IX1A 1JJGA 1KXLA 1Q1BA 5C3EH 1G51A 4GLVB 1KD1C 1WJJA 4JI1Q 2NZOA 5C44G 1X56A 2K5VA 3DM3A 3NEMA 1KAWA 1L1OA 1E24A 1Q1EA 1WFQA 3CCMA 2CWPA 1L1OB 1QZHA 2R93H 2Q2TA 1MIUA 1Z47A 1JT8A 4R4TA 4P74A 5FLXc 3W1BA 3AFQA 1VQEA 4AYBG 3HOXG 4POGA 1GO3E 1TWCH 3OTOQ 3B6YA 1E3PA 4A3FG 2IY5B 3UDFA 2HIXA 5LMUL 3I55A 1AE3A 4GNXB 4A75A 2VUMG 3L0OA 1CKNA 4B3TL 2UUCL 4JI3L 4JBMA 4DR1Q 4DUYQ 1W3SA 2UXDL 4DV4L 1N34L 3PGZA 3KJOA 2OTJA 3K80C 5BR8Q 3RZOH 4QJFA 3H0GH 1BVSA 4BXXH 1UE6A 2CWAA 2FXQA 2NN6I 5IE8A 5IYBH 3KOJA 1Y14B 2MQHA 5FLMG 2RF4A 2LXKA 4APVA 3EBEA 3RNUA 1PH4A 3FHWA 4JI4L 2JA6H 1XPUA 4IPCA 5LMNQ 4JI6Q 2K50A 1QUQB 1WOCA 3CC7A 2JA5G 1NBWA 3S24A 1HNWQ 2MFIA 4A3GH 4JI5Q 4P73A 2WAQE 3PSIA 3RR5A 4YY3L 1GM5A 3J80i 4LF9L 1X6OA 1G291 1HZBA 3I4NH 1OXSC 3KF6A 2MNAA 1PH2A 3KDFA 3HOVG 1VCIA 3G48A 2JA8G 4DK6C 3CD6A 2EXDA 4IJHA 4JI0L 4LF4Q 2HT1A 1FGUA 1IBLL 4LFCQ 1PYBA 3ICEA 4JI8L 1X3EA 3CCVA 4HJ7A 4AQYQ 3A74A 3JAMi 2UUAQ 3HOUG 1M90C 4A3DH 4JV5L 4GKJL 3M9BA 1VQFA 2YTYA 1KRSA 3NENA 2PNHA 4YHHQ 2E2HH 5JJKA 4OX9Q 1I94L 1QVCA 4HIMA 1W2BA 2GN5A 5C0XG 5IP7G 3M85A 4DKAC 2D0PA 3E9IA 1YHAA 2AWOA 4QGUA 1HNZL 1E1TA 2Y0SE 2VQEL 2AWNA 2JE6I 4X65L 3I56A 1MKHA 4JI2L 4LF7Q 3S1MH 1Q86C 1KC8C 1YHQA 1U5KA 3IRBA 4JOIC 1HZ9A 1YBYA 2MO0A 4LUOA 3D31A 3W5OA 5IP9G 1CSPA 5IT9c 2QA4A 4PZ8A 3K8AA 3RN5A 4JI7Q 2F3IA 1XNQL 4X64L 1VQ4A 4BA2I 3KJPA 4MZ9A 4XIGS 4EQ5A 2IX0A 2ZM6Q 1PH5A 2NN6G 3PUVA 3J80c 2MO1A 3J81i 3DLLA 4X62L 2ZJRA 1KL9A 3F2CA 3CP0A 4HJ9A 3T1HL 3K0XA 5M3FG 2UU9L 4LF6L 3RLNA 1QZGA 2NVTH 1HNXQ 4GKKL 4B3RQ 1SFOH 4QY7A 4YWMA 3NBHB 4BBRG 3TS0A 2XTIA 3GTKH 1YEZA 3HOVH 4BXXG 4OWTB 2YTVA 4A3IG 2VNUD 3ULPA 1VQNA 1PH9A 4DV3Q 1VQAA 1EIYB 4DR4Q 4B3ML 2OCEA 2VQFL 4RG1A 1HZAA 4BY1H 1VQ9A 2UUBL 1UE7A 1CKMA 4IPGA 1QUQA 3GTQH 1AE2A 1EUJA 1V1QA 1J6QA 1Q7YC 1NJIC 4LF8Q 4GOPC 1B70B 5ELOA 2CFMA 3CAMA 2QGQA 3F2DA 2IHFA 1IYJB 2NVYH 1SLJA 4GNXC 1DGSA 3UE0A 1SRUA 5C0XI 4LWCA 2JA7G 4L5RC 4GN3B 4IOAA 4DAYB 3PO3G 3CCUA 3S1RH 2E5LQ 3OYYA 1XNRQ 4DV2L 3TEHB 1VQDA 1Y1VH 2K5HA 3GD7A 1OXXK 1JMCA 5AJ3Q 5DLQE 2LSSA 4DAMA 4KHPL 1K9MC 4AH6A 3U4VA 4IJLA 4DV1Q 1WCMH 1XMOQ 2WB1G 2Z6KC 2KBNA 4A3MG 1EOVA 1HZCA 4DR6Q 2QEXA 3CMEA 1I50H 1LTLA 3T1YL 3H3VH 1L0WA 4DV0L 4DV7L 1E1OA 4GN5A 3G71A 3G6EA 1K3RA 2YYZA 3GTGH 4DPGA 4ALPA 3ER0A 3HKZE 5IY0A 4UP7A 1X3GA 4DV6Q 4KLKA 4TVAB 3STBD 2Y0SG 1C0AA 4UY8C 4AIMA 4K0KQ 1XPRA 2RCNA 4IPHA 1NE3A 3G4SA 1VQMA 2V1CC 1J5EQ 2JA6G 2HIVA 3M7NA 4A3JG 2BH2A 2RHQB 2ZTCA 3H15A 5IYBG 1NTGA 4X6AH 1JE5A 1BBUA 3HKSA 3KF8B 4DR5Q 1N33L 1VQ6A 3PUXA 4A3EH 4JYAQ 2VZAA 3PF4A 4OO1I 1XMQL 3CPWA 1OXTA 4NPSA 3D0FA 3A5UA 4HIOA 2IHEA 4POFA 2UXDQ 1SR3A 4A3KG 4H02A 4X66Q 1A0IA 3FKIG 1PH8A 3K81C 4OWXB 2VUMH 4DR7L 3UE1A 5C4XH 5ELNA 4JI1L 1HNXL 1VQ7A 2Z6KA 1N32L 5GADC 1VQLA 2K14A 1MJCA 3KYHC 1IBKL 3PV0A 4NXMQ 2ES2A 2DGYA 4IFDJ 2BA0A 2UXBQ 1VS0A 3GDEA 4GS3A 4A3EG 4C2MH 1VQPA 4DR3Q 1UE5A 1Y1WG 1AH9A 3PO2H 3Q8DA 4PZ6A 2WAQG 3CCJA 1I3QH 4R4CA 2D0OA 4A3LH 4LFBQ 1HH2P 3FKIH 4DR2L 2N78A 5HY6A 4B3TQ 2R7FA 1KRTA 1CKNB 2UUCQ 4YCVA 1K0RA 2PI2E 2K4KA 2ZJPA 4UP8A 3JC66 4HJAA 1TWFH 3UDGA 1N34Q 2N49A 2PQAB 5M3MG 1PYSB 2R6GA 3WWVA 5FJ8G 1WYDA 3TRZA 1D7QA 4L5QA 4JI4Q 5M5YH 4LFAQ 3E0EA 4DV5Q 4IFDG 4A3JH 2JJQA 3BZKA 1Q82C 5LMNL 2R93G 1A63A 1Q81C 1IBMQ 1HNWL 4RMFA 1PVOA 1FL0A 2JA9A 1NY4A 2YU9H 2KCTA 4P72A 5M3MH 5IYDG 3CXCA 1S3OA 1TWHH 3U4ZA 4YY3Q 4HJ5A 4LF9Q 3S15H 1YITA 1JJCB 4BBSG 2C35B 2AMCB 1Z9FA 1HR0Q 4DUZQ 1FJGQ 4A3BH 2E8GA 2HHHQ 3M4PA 1O7IA 4JI0Q 3HOZG 1RL2A 4BY7G 2PMZE 2EIFA 1YJ9A 4JOIA 3CCQA 2R7DA 4AQYL 4GOPB 2E2JH 2UUAL 5GAGC 4GKJQ 5IWAQ 2ASBA 2KCMA 2IT1A 2Z0SA 1BBWA 4UP9A 3U50C 4OX9L 3TQYA 4R4IA 1Y1VG 4A3DG 3HOUH 1GD7A 5C4JH 4O2DA 2NZHA 4PMWA 3S2HH 2EQSA 4LUVA 1M1KC 2B63H 1HNZQ 2UXCL 4GNXA 3S1NH 2CQOA 4NXNL 3RN2A 4JI2Q 4A3KH 2B29A 4LW1A 4LF5L 3L2PA 4R4OA 1L2FA 1YJWA 3BZCA 2WFWA 3MEFA 3S16H 2K5NA 3CCLA 1XNQQ 2ZTDA 2K75A 1VQJA 5JEAJ 4OO1G 3TS2A 3RLFA 5K36G 4J15A 2A1AA 5M5XH 1B8AA 1TXYA 4P71A 4R1JA 3J81c 3CF5A 2ZM6L 3UDIA 5GROA 4X62Q 4LUZA 5M5WH 3T1HQ 1PH7A 4LF6Q 1VQGA 4B3SL 1D8LA 3PUYA 2F4VL 1JB7A 4GKKQ 1N36L 4B3RL 1KQSA 1V43A 1U0LA 1SROA 1EQQA 3ULLA 1X9NA 3PF5A 1C7YA 1YVCA 3F8TA 4C3JH 1VQBA 3M3YH 2PQAA 1EWIA 5H1SE 1Q8KA 3RZDH 4QIWE 1SN8A 2ALYB 2JEBI 3PUWA 4JBJA 5EAYA 4B3MQ 1LUZA 4JBKA 4KHZA 3S17H 3E9HA 4BBSH 3A5ZB 2I0QA 3LGJA 2WB1E 4A93H 2ATWA 1TWAH 3EN2A 1YI2A 3L7ZC 3OW2A 1QVFA 3H3VI 1H95A 4TQUS 5LMNW 2JA5H 4L5TA 1SE8A 2JQOA 2YV5A 3PCOB 3OTOL 1EIFA 2L15A 1PFSA 5J3BA 3HKZG 3UDXA 1X55A 2CKZB 3KDFB 3FP9A 5LMUQ 1JJ2A 5JEAG 2AHOB 3HOYH 3PO3H 1LM0A 2K52A 5C0XJ 1OXVA 5C44H 2JA7H 3VDYA 1VQKA 4JI3Q 3HOYG 2Q2UA 2DUDA 4DR1L 2JA8H 2VS1A 5IP7H 1XNRL 4DUYL 2Q2HA 2GVAA 2RHSB 5AJ3L 4R4QA 4DV4Q 1SMXA 1X54A 3M4QA 3U58A 1K83H 1PH1A 4KHPQ 2OQKA 4P75A 5BR8L 3TREA 2JK8A 1R9TH 1K73C 3CC2A 4QQBX 1K8GA 3HOWG 4ME3A 4A3GG 1VQHA 2KHIA 4KI0A 1V9PA 4MNOA 1G6PA 4DR6L 4A93G 4IOCA 1VQIA 4BY1G 4JI6L 4DK3C 1ASYA 2NVXH 3A0JA 1YHBA 2H5XA 2XGTA 5JJIA 4JI5L 4FDBA 4GLXA 2R7ZG 3GTMH 1OTCA 2AKWB 4JBWA 3F2BA 4DV6L 3KF6B 4A3IH 3PIOA 1HR0W 3HFZB 2R7ZH 4GLAC 4BBRH 3CW2C 1L1OC 3I7FA 3STBC 1VQ5A 2ID0A 4LF4L 3I4OA 1XPOA 2F52A 4YCUA 5M3FH 3RLOA 4LFCL 1FVIA 2BH8A 1IBLQ 4JI8Q 3ZJYC 2PI2A 4IPDA 4JV5Q 3KLWA 1S72A 1KHIA 4LNQA 4DR5L 1Y1WH 3AEVA 3S2DH 1K8AC 4YHHL 2VY3A 1I94Q 4IO9A 5IP9H 4OWWB 4JG2A 3AYHB 1PHJA 1IZ6A 1Q12A 5GQOA 2KHJA 4X66L 5JJLA 3MXNB 2VQEQ 4LF7L 4DR7Q 4X65Q 4A3BG 1YZ6A 3I2ZA 4OONA 3J81j 1Q46A 1P8LA 5C3EG 4A3FH 3K7AH 4C3HH 1N32Q 3JAMc 4JI7L 1IBKQ 3CCEA 2N3SA 4X64Q 4A76A 4NXML 3HOXH 3CCRA 4YWLA 3M4OH 2UXBL 5IYDH 1E7ZA 4IFDI 1EFWA 1HJPA 2YTXA 4DR3L 3NELA 3S14H 4Y52H 2Q2IA 1P16A 3ULJA 2UU9Q 1BKBA 3GTPH 2KENA 2I5HA 2I5LX
chains in the Genus database with same CATH superfamily
4X3KA 3CMAA 4LFBL 1B7YB 2NTSA 4DR2Q 1LTAD 2A68D 3K7UC 1KIXA 1Z7TA 4G7OC 3A8KE 2X69A 4M8AA 4FP5D 1XJVA 1PH3A 1RTNA 3M7GA 3CC4A 4P2CB 4BWGB 1AP0A 1T9HA 1XTDA 2XRQD 4IZ8A 4A4IA 2UUBQ 3EIVA 1GOZA 1EU4A 2B8FA 3GO5A 2RVLA 3H0GG 3EROA 4LF8L 1PTOH 4C3JB 2D62A 1SJHD 2XWBB 1D5MC 2KUMA 3DUZA 4FF2A 1LT3D 1IXRA 1A62A 1NR2A 5J22A 4BA1I 2HHHL 2E5LL 3C3LA 1MBYA 5BN4A 2BA1A 1B50A 4MTNA 3VYTA 3W1GA 3S1NB 3AMUA 4DV1L 1GKHA 1II3A 4A3KB 2WINB 4FF4A 4QL5A 3J7ZC 2I5MX 4M1UB 3HOZH 3I73A 4C3IH 2WIIB 1H9KA 1WCMB 4RGTA 1IW7D 2VXWA 3S1QH 2F0MA 3ERSX 3N52A 3I4MG 3P20A 2LXJA 2ZJQA 4OXPA 4KV6A 3RZDB 4BY1B 4GOPA 1CT1D 4Y7NH 4QCLA 1B3AA 1VQCA 2R7ZB 1UE1A 4NP5A 1T5XD 4MN3A 5C3EH 1G51A 1WJJA 4JI1Q 1X56A 3DM3A 1L1OA 1WFQA 1Q1EA 4A3EB 3A54A 4OIKA 3K6OA 2FMCA 2Q2TA 1MIUA 3D6WA 1WTWA 3BYYB 1B9MA 3HOXG 1VQEA 4AYBG 1PLFA 5JPMC 1K83B 1BDOA 1ZYRD 4F87A 3I55A 4A3FB 1AN8A 1CKNA 5C3XA 4JI3L 3H6MA 3NQTA 1ZXTA 2K03A 3SK5A 1W3SA 2UXDL 1N34L 5DM73 3K80C 5BR8Q 4BXXH 2FXQA 2PZTA 1EYAA 3MZ5A 2RF4A 3MFYA 5J39A 4CDEC 1QUQB 1HNWQ 4A3GH 1HFGA 1W6KA 1GM5A 4S3SA 1G291 2BDOA 2MNAA 2DN8A 1JR0D 4RGNA 3G48A 4KN4C 2JA8G 4DK6C 3R3OA 4LFCQ 1DJRD 3ICEA 5C0XH 4AQYQ 2UUAQ 2E76C 3A74A 2JN4A 4IUNA 4GKJL 1EL0A 1MI2A 4C3HB 4HMJA 1I94L 4HIMA 1W2BA 1ET9A 1PZKD 5C0XG 1DOLA 1LTRD 3K5OA 5ELFA 1MKHA 3S1MH 1JB7A 1U5KA 3FKIB 1SE2A 4PQXA 5IP9G 1WD1A 1LTID 4JI7Q 1CSPA 2QA4A 2FHTA 2F0SA 3KJPA 4MZ9A 4EQ5A 4F88A 2R92B 2ZM6Q 1OO9B 3J81i 4HJ9A 3T1HL 1KL9A 4DGZA 4LF6L 2JEAI 5M3FG 3MXPA 4A3JB 1SFOH 1TU2B 4HSPA 3GTKH 4BXXG 2L9HA 3ULPA 5I2YA 4IALA 5TSSA 4B3ML 2EYPA 2B2TC 4OL7A 2VQFL 1HZAA 5J1ZA 4IPGA 1EUJA 3M3YB 1V1QA 2WB1B 4CKCA 2ZXPA 3TDQA 1LABA 3ND8A 1SSOA 3MC0B 5ELOA 3F2DA 5FLXE 2NVYH 4GNXC 4C1NK 4QMGA 1CA6A 4LWCA 2EE1A 4N9PA 3S1RH 3FPPA 1XNRQ 1VQDA 1TR5A 5ELBA 4BY7B 5DLQE 2F0FA 3SK6A 2AQ1B 1FNUA 1WCMH 4RGMA 2WB1G 4A3MG 2PZWA 3P75A 2QEXA 3T4AC 3CMEA 4DV0L 1E1OA 4GN5A 3J81E 3G71A 2C5CA 1LTGD 1R9TB 3HKZE 4UP7A 1X3GA 4H13C 1I6VC 1JCKB 2F0WA 2Y0SG 5CV4A 4K0KQ 1JOQA 2G5DA 4X3TA 2NBFA 3FRPB 3OIQA 1J5EQ 4F8MA 3TZUA 5A2QL 3VR6A 2KJXA 2RHQB 5C4ZA 3H15A 1BBUA 1VQ6A 4JYAQ 3PF4A 2D9UA 3R2IA 4H02A 4X66Q 1A0IA 3FKIG 2HCIA 4J6HA 3UE1A 1PMRA 3ONAB 3I3CA 5DM63 1MJCA 4XQQA 5CV7A 5FOBB 4NXMQ 2ES2A 2DGYA 5EKIA 4V0BA 4A3EG 1EZ8A 1Y1WG 5ELDA 3Q8DA 3Q0AA 2K32A 3PIP3 5CYUA 4PZ6A 1I3QH 3RZOB 2D0OA 4LFBQ 4KKTA 4DR2L 2N55A 5HY6A 1KRTA 3SDZA 3A8JE 3UDGA 2R6GA 3WWVA 1D7QA 1TWGB 2I07B 2PMZB 2R93B 5M5YH 2LMCB 4IFDG 3MHBA 2K6AA 2F0LA 5LMNL 5DEHA 1HQRD 4C56C 3I4MB 1Q81C 1B9NA 5A35A 2KCTA 4P72A 3CXCA 5IYDG 2JSOA 4YY3Q 3U4ZA 3H94A 4N8FA 1JJCB 1K0SA 1FGBD 1XTCD 1ZYRC 4RHRA 4A3BH 2E8GA 2HHHQ 4BY7G 1O7IA 1SJED 1YJ9A 4JOIA 1WTPA 1QCBD 1BBWA 2FFKB 4OX9L 4R4IA 5C4JH 3I72A 3S2HH 4PMWA 2F0HA 2M00A 4LUVA 2B63H 1TVXA 4BBSG 3MEHA 4XQJA 3R8BA 3MEFA 3S16H 1SFOB 1HQMC 2SDFA 2K75A 1VQJA 5JEAJ 4J15A 1X3PA 5M5XH 1RKNA 2TMPA 1I50B 5ELCA 1RF2D 2PW5A 1G8ZD 3PUYA 5C5LA 1KQSA 1SEBD 1XXGA 2J4XA 1K28A 1C7YA 3F8TA 1PTOB 1VQBA 1SYDA 4C3JH 3M3YH 2PQAA 1KTKA 1IYVA 1DYQA 2CQAA 1Q8KA 5EAYA 3S17H 3E9HA 4ABNA 4A93H 2VB3X 4XT1B 3GTJB 4XYQA 1W6JA 1CHPD 3L7ZC 3NTHA 2Z4IA 2F0TA 2KA7A 3PCOB 4WORA 3KDFB 4IUQA 5C4XB 5JEAG 2AHOB 3PO3H 3HOZB 2L4NA 4JI3Q 2Q2UA 1E0BA 2VS1A 2UXDQ 2PQEA 5T1GA 4G57A 3M4QA 3S1QB 2OQKA 5BR8L 3U9SA 2JK8A 4QQBX 1BCPF 1PXUA 2CHBD 2WACA 4I7AA 3DEOA 1VQIA 4BY1G 1GUWA 5EPLA 3HRZC 2AQ3B 2H5XA 1TIID 3H0GB 4FDBA 3D4RA 2A68C 4DV6L 4A3IH 1HR0W 3PIOA 3GV6A 1Q8IA 2R7ZH 2E75C 2K5QA 3STBC 3I4OA 1V1OA 2F0EA 4LFCL 3RLOA 2L55A 2PI2A 3KLWA 3C2PA 5M3MB 4LNQA 3EVQA 1LTSD 4CDFC 1IKMA 1BBXC 1STGA 1I94Q 2XIWA 4K5XA 4ZUIA 1FNVA 1O80A 5JJLA 4DR7Q 3I2ZA 3J81j 5I6YA 1P8LA 5C3EG 3K7AH 4RHSA 4JI7L 1ESRA 1AFPA 3HOXH 3M4OH 2UXBL 2Z8LA 4IFDI 1HJPA 4X3UA 4DR3L 2VB2X 1ENFA 1P16A 3ULJA 1BKBA 1C8CA 2I5HA 1A3TA 3LX0A 1QB5D 1SMYC 4XXEA 3C1FA 3KFUA 1CFMA 3R93A 5CV8A 4KKUA 1HCZA 1U4LA 2A74C 5GAHC 2B3GA 3I4MH 1C4QA 1MD2D 1STNA 1CKOA 1J9OA 3OPOA 5EQ0A 2VQFQ 3BDLA 1NMGA 3HGBA 4DV5L 4O42A 3BJUA 1IBML 5HGQA 1EYGA 2FMMA 2NVQH 3HP3A 3CCSA 1MJEA 1IL2A 5IYCG 1S5ED 2LY7A 1ENAA 1C9OA 1X65A 3H91A 2B63G 4DUZL 5C4XG 3NWSA 4JCVE 3S9WA 4DXGA 4KY5A 1YIJA 3S1MB 1PFNA 3S2HB 5IYCH 4YCWA 4KD3A 5IWAL 1I6HH 2A8VA 2DJFC 3AFPA 4XTCS 4DV0Q 5GAEC 4ZCKA 2AQ2B 1GUNA 4NXNQ 4YWKA 2ZTEA 1CSQA 5FO9B 2N8NA 3DWQA 2O5JC 5KEEA 4K0KL 1UEBA 1GHJA 1IYUA 4JW0A 4EX5A 1PH6A 3IAYA 4Q5VA 4HJ8A 3CPFA 2V4DA 1J5EL 1A2TA 1I5FA 3K59A 2F4VQ 4A3MH 2ZXRA 4JYAL 1F9RA 1N9WA 1E22A 3I91A 3MVVA 4XDXA 3Q22A 1Q1BA 1ZEQX 1KXLA 1CK1A 3SVMA 2NVYB 1KD1C 4GNXB 1KAWA 1E24A 2CWPA 3PMFA 1KABA 4H7BA 5FO8B 2FJ2A 1Y1VB 5FLXc 3ND9A 3SEBA 3AFQA 5DAUA 4POGA 5CV9A 1GO3E 1Q3LA 3JAML 2XRSD 4A3FG 3UDFA 1I4QA 5LMUL 1IKLA 4KHVA 4A75A 2XVSA 3MAQA 1KNAA 4ZKCB 1B2TA 3SXHA 4DR1Q 1BOSA 4DUYQ 5KNBA 3KJOA 2OTJA 1CQVA 3H0GH 1BVSA 4NMZA 5FLMG 5IYBH 2MQHA 4XYOA 3FHWA 1EFID 4IPCA 5LMNQ 4JI6Q 1ILPA 3LWUA 3S24A 2JA5G 4OGQC 4CKBA 4P73A 3PSIA 4YY3L 1H9RA 3I4NH 3HOVG 5FO7B 4IJHA 1SNMA 4LF4Q 2HT1A 1FGUA 5KGUA 4JI8L 3CCVA 4HJ7A 3S15B 4A3DH 4JV5L 1M90C 2PPBC 1F9QA 4UDUC 3O13A 1R4QB 1KRSA 3K7AB 3NENA 3J7AF 4YHHQ 4OX9Q 4C2MB 3FMCA 2GN5A 5IP7G 5LL6S 4DKAC 2D0PA 2EYMA 1SE4A 2VQEL 3I56A 5ISRA 1NJIC 3MA2B 3W5OA 1S5CD 3K8AA 1EWHA 4X64L 1VQ4A 3IFDA 1KNEA 4XIGS 2AUKA 2IX0A 1PH5A 1RHPA 3J80c 3PUVA 2HQEA 4WFN3 5ELEA 2UU9L 3TBIB 2R93H 2NVTH 3RLNA 1FYCA 3SK4A 1QZGA 3OMCA 3NBHB 4KJNA 4BBRG 3TS0A 2XTIA 3NP8A 3TN2A 3IL8A 5K36H 1A3VA 1ML0D 4A3IG 3A7AB 1AW7A 2PO4A 4DV3Q 1EIYB 4DR4Q 5I2XA 2JYOA 1V1PB 4ZRZA 4A3BB 1FR3A 1CKMA 1AE2A 1XX8A 1MGSA 3BVZA 1Q7YC 2KECA 4GOPC 1B70B 1CZWA 1CTMA 3V2TA 2QGQA 5HGTA 2IHFA 1DGSA 1TWAB 1U4MA 5FLXL 3AU7A 4FF1A 4GN3B 4IOAA 4DAYB 4G4KA 5JEAH 3CCUA 4DAYA 3PO3G 2KOLA 1GJXA 3TEHB 2DJGC 2K5HA 3BDOA 1OXXK 5IGFA 2LSSA 1K9MC 4AH6A 4KMUC 3U4VA 2PW7A 4KN7C 5IGGA 3X3NA 3VR4A 1F2YA 5G3LF 3G6EA 4DPGA 4ALPA 5K5PA 4DNRB 4DV6Q 4C3JG 3EQLC 2F3WA 3STBD 4IPHA 2O4XA 3G4SA 1VQMA 2V1CC 3NTKA 4A3JG 2ZTCA 5IYBG 1WTHA 3PUXA 1D5XC 2Z6BA 4OO1I 3CPWA 4NPSA 4HIOA 1EY8A 2Z4HA 4POFA 3W3AA 3AB9A 1ICFB 1PH8A 4DR7L 5C4XH 4C3IG 1HNXL 1VQ7A 2Z6KA 5GADC 2F0IA 5C6AA 2B8GA 1NCVA 2K14A 2MP1A 4B9XA 2BA0A 2UXBQ 1VS0A 1HUMA 2F0UA 2HCCA 3GDEA 3TP7A 2E2HB 4DR3Q 1PFMA 4DU9A 5BN3A 3K0YA 4GZYC 2EYHA 2WAQG 4DK0A 1MHWC 2MHVA 3KK7A 1HH2P 3FKIH 2N78A 4B3TQ 4FXGC 2R7FA 2UUCQ 1VDZA 2KVMA 2PI2E 1H9JA 2K4KA 2PQAB 2RDGA 3GTPB 4CDDC 1STBA 1K8MA 5FJ8G 1K3BC 2AUJD 1JWSD 2XNAC 4JI4Q 4DV5Q 1NUCA 2B2VC 2KEEA 2JJQA 3BZKA 1BR9A 5EJWA 1IBMQ 3FEWX 4RMFA 3SE0A 1CQFA 3MTSA 2JA9A 4X3SA 2LFNA 5NUCA 1RCVD 4HJ5A 1E2WA 4LF9Q 3S15H 1YITA 1TQOA 4DUZQ 4JI0Q 3HOZG 1IW7C 2B2TA 5I4DA 1HHVA 2E2JH 3HS0C 5GAGC 3OW7A 5L37A 5IWAQ 2QCPX 4IQZA 5DNFA 2NTTA 2Z0SA 3QWNA 1SYCA 4FXDA 2Q8TA 3U50C 4EGVA 1S5BD 1GD7A 4O2DA 3MXUA 1ONLA 4IURA 1M1KC 2UXCL 4GNXA 4NXNL 1LTTD 2EYLA 5I9OA 4LW1A 2G9HD 4A3KH 3L2PA 2N88A 3BZCA 4R8IA 1KDBA 2WFWA 3A55A 1XNQQ 3I4LA 2A6HC 4V190 5D3DA 5K36G 1A6XA 2A1AA 2F0GA 4P71A 1M4VA 2B2YC 5GROA 4X62Q 3TSSA 1UEAB 1MSHA 3QOJA 2CH4W 2F4VL 5C5MA 4GKKQ 4B3RL 1QWYA 2K7VA 4FYDA 1JB3A 1SNPA 1YVCA 3GTQB 3NPPA 2QDLA 1NAPA 1EOTA 4OO1H 2NVQB 1EWIA 3RZDH 4QIWE 4JBJA 4QUCA 4JBKA 2L1BA 2BDNA 2WB1E 3NK9A 5JAVA 2ATWA 3K5MA 1TWAH 2Q8RE 3EN2A 3K5LA 1A3UA 3OW2A 3V05A 3TP5A 1H95A 1YNND 4TQUS 1RTOA 3NXWA 5J3BA 3HKZG 3UDXA 1SYGA 3D6CA 5LMUQ 1JJ2A 3LWEA 2Z9HA 2K52A 1CA5A 2MPMA 2XN9C 1VQKA 3HOYG 2DUDA 4DR1L 5IP7H 4DUYL 4DF7A 2GVAA 5AJ3L 3CQZB 5EKLA 1K83H 1J8IA 4P75A 3TREA 1K73C 1EQVA 3HOWG 5E3FA 1JWUD 4KI0A 1G6PA 1JOKA 4MNOA 4RFBA 4DR6L 4JI6L 1ASYA 5IOCA 2QEJC 4ZKBB 4I7ZC 2MUYA 5JJIA 4ODGA 2A5HA 5CV5A 1S5DD 4GLXA 2BE5C 2AKWB 4JBWA 3EJIA 3KF6B 4J1MA 4BBRH 3NBIA 3J7YW 1VQ5A 5M5YB 4DAVA 4LF4L 1XPOA 4PMBA 2IPKD 1FVIA 4JI8Q 3ZJYC 1B44D 4JV5Q 3J81L 4LMQD 2KQ3A 1JORA 3OIPA 3AEVA 1K8AC 4QF4A 4RGOS 4YHHL 2QDBA 4IO9A 1LT4D 4OWWB 4QUFA 1QILA 1Q12A 2KHJA 5I6WA 3MXNB 2VQEQ 1XWEA 3MXNA 3KBXA 1A15A 1I4XA 1Q46A 2DY7A 1N32Q 4C3HH 1RDPD 2N3SA 1RD9D 4X64Q 3CCRA 3K58A 5A2QE 2Q2IA 1TWFB 2UU9Q 4R8NA 3GTPH 3NBHA 2LKVA 2E2IH 1YNJC 4ZYSA 1B1ZA 2A6EC 2R92H 2OWOA 1MSGA 1PFBA 1GVPA 3A56A 3SGIA 4DV3L 3I4NB 4DR4L 1LT5D 3SK8A 1V1PA 2L12A 2B2UC 3E5SA 5M5WB 4LFAL 4UPAA 4A3LG 3KLSX 1WD0A 1PZID 1UWVA 4AYBE 3G7LA 1YJNA 2OTLA 3BU2A 3PO2G 2H1EA 2LS01 1DXMA 1V8QA 3C46A 1I4GA 2E2JB 3WOFA 1NMFA 3QOLA 1SNOA 1HA6A 5IGDA 1JC7A 1PRTC 2HQLA 2O2LD 5CR3A 2VW9A 4WJ4A 4ZLTF 1WI5A 4CDCC 1DM0B 2CW0C 1X3FA 4WRDA 1WTRA 1S5FD 3PUZA 5CV6A 1N8RC 4UHVA 1E2VA 3HOYB 3F1ZA 1PZJD 1EQRA 2K33A 4BY7H 4GN4B 4WJ3M 1R4PB 1HRJA 1OXUA 3J80E 3FPUB 4LF5Q 2A19A 4A3CG 4O0AA 1VQOA 1LLRD 2R92G 3BS1A 5F2DA 3DEPA 5EGTA 1NNXA 1YNXA 2ICEC 3G6JB 1N36Q 3D8GA 3GTMB 4CJ0B 3HOWH 3VYRA 2IX3A 1F9PA 1WCMG 2WKCA 3FDTA 4NB3A 2F0QA 1PA6A 1LYLA 2IX1A 2A69C 1BCPC 1SDFA 2NZOA 1HNXQ 2K5VA 3X3MA 4XQNA 4R4TA 2QF7A 5E4XA 4OIJA 3JAME 1EY0A 1TWCH 4XT3B 1X3QA 1PTOF 2IY5B 1GHKA 2L5TA 1AE3A 2VUMG 4B3TL 2UUCL 3BDCA 1EIGA 1JOOA 1KAAA 5M9OA 1BCPD 2K01A 1BO0A 3RZOH 4QJFA 1AH9A 2CWAA 3N6RA 3RNUA 1Y14B 2XSCA 4JI4L 4J8QA 4APVA 2IL8A 1SYFA 1U4PA 1XPUA 3T53B 1Q90A 2K50A 3CC7A 4CGYB 4Z9CB 4ULLA 2Y0SB 3J80i 4LF9L 1X6OA 1HZBA 1PYWD 2A73B 4MIUA 1OXSC 3KF6A 1PH2A 3KDFA 4ME5A 1VCIA 2SOBA 3CD6A 4EQOA 4JI0L 1I4HA 1LTBD 4RCOA 1PYBA 2I46A 5IGBA 3HOUG 3JAMi 2ICIA 4CKEA 1GUTA 2RDHA 1VQFA 4NDXA 2PNHA 2E2HH 4IN3A 1F9SA 2EOTA 3E9IA 1NR4A 1YHAA 1VQNA 2UXCQ 4LF7Q 2JE6I 4X65L 1Q86C 1F2ZA 1KC8C 4JOIC 3IRBA 3A8IE 1HZ9A 1YBYA 2MO0A 4LUOA 3D31A 2F3VA 5IT9c 1XNQL 1PRTD 4PZ8A 4FVMA 1D1KA 3HOUB 3TMEA 4BA2I 2B63B 2KHSA 2NN6G 2MO1A 2JA5H 1UAPA 4X62L 3DLLA 3F2CA 2IJ0A 1D1IA 3S16B 4GKKL 4B3RQ 4QY7A 4YWMA 3BYTB 1YEZA 2HDMA 3HOVH 4OWTB 2YTVA 3CRKC 2YU9B 1QE6A 3CRLC 3TP8A 2A6ED 3GP7A 1UE7A 2WAQB 2EZVA 1J6QA 5JOBA 3PQIA 3CAMA 4QIWB 1SRUA 3QB3A 2QKIC 2P5ZX 3OYYA 2EDGA 4DV2L 4MHEA 3D4DA 1Y1VH 1EY7A 5AJ3Q 3SHLA 1O7ZA 4DAMA 3OWFA 2EJMA 3CKIB 3QG1A 1XMOQ 2Z6KC 2HUGA 1EIHA 2KBNA 2SEBD 5C44B 2JA7B 1EOVA 4E6IA 4DR6Q 1Z6HA 3T1YL 1VF5C 1L0WA 1TT2A 3WDNA 4DV7L 3MFGA 2EYOA 1H9MA 2EY6A 3DMUA 1EZ6A 5KYIA 5IY0A 1EYDA 4U673 4TVAB 1C0AA 2X6LA 4AIMA 5KNCA 1D5ZC 4G7ZC 1SMYD 2RCNA 1WVLA 1B3QA 4B08A 2BE5D 1PRTB 2WV6D 2JA6G 2HIVA 3M7NA 4FXKC 2DNEA 3VYUA 5IODA 4X6AH 1RODA 3KF8B 4HMIA 1N33L 4A3EH 4N9TA 3I90A 1EQTA 1XMQL 1OXTA 2IHEA 1IL8A 1SR3A 3R2TA 3Q24A 4MTKA 3K81C 4OWXB 2VUMH 1CZGA 5CBAE 1N32L 2F03A 2L11A 3KYHC 4HAEA 4L8JA 3PV0A 1BXTA 1B4OA 4ZK9B 3VR3A 4C2MH 3PIO3 1UE5A 3PO2H 5D14A 4H44C 2K1BA 1BNZA 3CCJA 1AZQA 3I8ZA 3HOXB 3M4OB 2NVXB 2L0CA 1CKNB 4YCVA 1K0RA 1LO5D 2ZJPA 4UP8A 4HJAA 2PCFB 1C48A 3I70A 4L5QA 1UUPA 4LFAQ 4PMCA 1Q82C 3H09A 2PZUA 3OHXC 1PVOA 1NY4A 4TSSA 1Y1WB 1M8AA 3OSOA 2JXMB 3OOCA 3Q6SA 1WTXA 2KCCA 3GTOB 3E3XA 3NHHA 1GUOA 2PMZE 1SYBA 2R7DA 3MWYW 4GOPB 2K05A 5LHY1 3KF8A 3K57A 2PNRC 3TQYA 4TKOB 3S14B 1SNCA 4A3DG 3HOUH 3C1EA 5C3WA 2NZHA 1EY6A 2QILA 1HNZQ 2OEOA 2CQOA 3CU7A 3U9OA 4JI2Q 4LF5L 2JA5B 5KIXA 2E2IB 4R4OA 1A2UA 1I4RA 2K5NA 3VA7A 2F0VA 2ZTDA 3TS2A 3RLFA 5AFWA 1HUNA 3HOVB 1CM9A 1TXYA 4R1JA 3CF5A 1TS3A 1B53A 2SNMA 1NSNS 4LUZA 5M5WH 1VQGA 2EY1A 2JP1A 1N36L 1V43A 1U0LA 1FD7D 3Q23A 1X9NA 4ZUJA 3PF5A 3W2DA 3BZDB 5H1SE 2F1MA 1JE4A 4N8X1 1F2LA 3A5ZB 3LGJA 1LT6D 4LAAA 2CW0D 1YI2A 1GXDC 3H3VI 2TSSA 3HKZB 5LMNW 4L5TA 1SE8A 2JQOA 2KEDA 2YV5A 1PFSA 1EU3A 2CKZB 1HXYD 3FP9A 3HOYH 2R3ZA 3LNNA 5C44H 2JA7H 4C3IB 2D5DA 1G2SA 2Q2HA 1SBBB 1SMXA 2RBMA 4KHPQ 1R9TH 5CGKA 1O78A 4K6DA 1SYEA 3EA6A 3V96A 1CI3M 4L63B 4CJ1B 3A0JA 4QB4A 2B2WA 2O5IC 2X6GA 4Y7NB 4DNTB 2MGSA 3GTMH 2R7ZG 1SNDA 3HOWB 1HFNA 1YNJD 4GLAC 4JPBW 3I7FA 1L1OC 1PTOC 2ID0A 3CHBD 1FNWA 5C3EB 2F52A 2ZXOA 4HN7A 5M3FH 2NYZD 4Q0FA 5C4HA 2NN6H 4IPDA 3RD4A 2VUMB 2HD3A 4KTAA 4DR5L 3S2DH 2EY5A 1PDQA 1JWMD 3BVMA 5D3IB 3AYHB 4DK1A 1PHJA 1IZ6A 4ILWA 4A3DB 4LK1C 2GA4B 4RA8A 4LF7L 4X65Q 4A3FH 1I3QB 3H3VC 3JAMc 1IBKQ 1K8OA 4A76A 4IUUA 4YWLA 5IYDH 5IGEA 1E7ZA 1EFWA 2YTXA 3T56B 1H9SB 5I9PA 4Y52H 1DD2A 2KENA 1F77A 2I5LX 1TWGH 2WP8J 3BVGA 1EYCA 1QNKA 2GVBA 3NTIA 4HEDA 1VQ8A 5JVH3 2OQ0A 3I4NG 5T1IA 3TZDA 1STYA 1Y69U 4JC0A 4I65A 3A7LA 3T51B 4HIDA 4K6LA 4EQPA 3GTOH 2M9VA 5FLMH 1QVGA 1JQYD 4KKSA 2OT2A 4TRDA 2K28A 4JK1C 4AYBB 3J7A5 4A3CH 1HR0L 5E4WC 1FJGL 1ASZA 1SXTA 1RIPA 4DV2Q 4L5SA 4H0LC 4PZ7A 2CCZA 1EWCA 1AZPA 5KNDA 4HSVA 3QO2A 1XMOL 1A8VA 3AQQA 4LJZC 1EEID 3MXGA 5E7NA 2K5WA 1ICWA 4FNFA 3T1YQ 4DNIA 4RAUC 4DV7Q 5M5XB 3FVQA 2JA8B 1G2TA 1EEFD 3UI2A 3IFTA 4PG3A 4DN4M 3IKJA 3CQZH 3NQIA 1PV4A 3GTKB 1S40A 1SE3A 1CUKA 4CHTB 3QR8A 4O1NA 3GTLH 2KCNA 4BS9A 3GTGB 3PIPA 3GQBA 2RSNA 3DWAA 4K2KA 3VA5A 2VL6A 1G91A 1WTOA 4B3SQ 1L0YB 5FJ8H 1N33Q 3QJYA 5CC4A 4A93B 4HIKA 2NUCA 1XMQQ 3GTJH 1WTQA 4BBRB 2RCFA 3NSWA 1JJGA 4OEMB 5EPKA 2F0DA 4GLVB 5C44G 3P7JA 3NEMA 3CCMA 1QZHA 1L1OB 3S1RB 5KYLA 1Z47A 1RJTA 3PO3B 1JT8A 4P74A 3W1BA 2EJGC 2K5DA 1TY0A 3OTOQ 2RKSA 3B6YA 2EPBA 1E3PA 4U68A 2HIXA 3L0OA 1G6ZA 4JBMA 4IUVA 3GV3A 1I4PA 3RMHA 4DV4L 3PGZA 4JVZA 1T5EA 2EXZA 1UE6A 2NN6I 5IE8A 3KOJA 3NWTA 2LXKA 2Z1CA 3EBEA 1PH4A 4F7XA 2JA6H 4YIJA 1DCZA 4NKLA 1WOCA 1NBWA 5JPNC 2MFIA 4JI5Q 2WAQE 3RR5A 4K8JA 5JVG3 1STAA 3S2DB 1ESFA 1U9RA 3ERQA 5EBDA 2EXDA 1IBLL 1TWHB 1X3EA 1XYIA 5COYA 3M9BA 2YTYA 4KK7A 5JJKA 1HTLD 1QVCA 4C3HG 3M85A 3PO2B 3NUCA 2AWOA 4QGUA 1HNZL 1E1TA 2Y0SE 1DZ1A 2AWNA 2SNSA 2RA4A 4JI2L 1UNSA 1ET6A 4DFAA 1YHQA 3RN5A 2F3IA 3F2UA 1TS4A 4HCSA 3P1HA 1KLGD 3D3RA 2Q8IB 2F4IA 3L9AX 2NWGA 2ZJRA 2EYFA 3CP0A 3K0XA 1STEA 1BF4A 3KLSA 5CORA 3J7AV 2VNUD 2CH4A 2EY2A 4UAIA 2EJFC 2D2CC 1PH9A 1VQAA 2E2DC 2OCEA 2QW7A 2B2YA 4RG1A 5JJZA 2B2WC 3D4WA 4BY1H 2F0NA 1VQ9A 3ZYYX 2UUBL 3GTQH 1QUQA 4EVOA 4PNYA 2NB0A 4LF8Q 1GUGA 2CFMA 2MJ8A 4BBSB 4L6TB 1KDCA 1IYJB 1SLJA 2NZ1D 5EKKA 3UE0A 5C0XI 2JA7G 3VYSA 4L5RC 5E1FA 1BCPB 5C4JB 3QIAA 2IWHA 2CVRA 3VR2A 2E5LQ 1LACA 1JMCA 3GD7A 5FKAC 2PYKA 1E2ZA 4KHPL 2J0TD 4ZAIA 4IJLA 4DV1Q 1JICA 1HPCA 3HZXA 1HZCA 1I50H 1LTLA 3OWEB 3RUZA 3H3VH 3GTLB 1DOMA 3HG9A 5G3LD 1K3RA 2YYZA 3E0JA 3GTGH 3ER0A 3L3OC 3T16A 4C1NI 3KUPA 4RWSC 2RDFA 4KLKA 4UY8C 4A3MB 1TS5A 3K5NA 1XPRA 3DHQA 3OMGA 4DA2A 1NE3A 2DY8A 3S17B 4NW2A 5CMDA 1Y8NB 1BQQT 2BH2A 4PV1C 5CBEE 1NTGA 2F0PA 1JE5A 4RH6A 3HKSA 4DR5Q 2WKDA 2VZAA 4DXFA 2E74C 3D0FA 3A5UA 2OXPA 4KY7A 2R61A 4A3KG 5KRUA 2F0JA 2M2LA 1KLUD 5ELNA 4JI1L 4K5WA 1EY4A 1VQLA 1IBKL 5LL6X 3DXJC 2F0KA 3T13A 5BN5A 1S4ZA 4IFDJ 4GS3A 3VR5A 1VQPA 4R4CA 2DNCA 4A3LH 4IUPA 3WOEA 4KY6A 5EPJA 1VF7A 4K5VA 3JC66 4RKBA 1TWFH 1N34Q 2N49A 5M3MG 1PYSB 4K8IA 4A3IB 2A69D 3TRZA 1WYDA 4CBVA 3E0EA 4A3JH 4IFDH 2R93G 5M3FB 1A63A 1WTVA 1HNWL 1IHZA 1FL0A 1TKWB 3HEJA 4RCNA 2YU9H 1SAPA 5M3MH 1S3OA 1TWHH 1QJOA 3DM1A 4K2LA 2J7ZA 2G9DA 2C35B 2B2UA 2AMCB 1Z9FA 1HR0Q 1FJGQ 1ZKOA 3M4PA 1RL2A 3DWPA 2EIFA 3BG3A 2OF1A 4RKLA 3CCQA 1AEXA 1EY9A 4AQYL 2ZT9C 2UUAL 5IGCA 4GKJQ 1QOHA 2ASBA 2KCMA 2IT1A 4UP9A 1L0XB 1Y1VG 2FINB 2EQSA 2HDLA 3S1NH 3RN2A 2B29A 1D2BA 1L2FA 4IUTA 1YJWA 1TS2A 2NVTB 1F2MA 3CCLA 4CJ2C 4OO1G 5D65A 1O7LA 1B8AA 3J81c 2RSOA 2EYJA 4ID6A 3UDIA 2ZM6L 3T1HQ 1PH7A 4OHJA 4LF6Q 1DONA 4B3SL 1D8LA 3KLRA 1DOKA 1STHA 1HA5A 3EFXD 2A6HD 1SROA 2IW3A 1EQQA 3ULLA 1VMCA 2BCOA 3J80L 3E6ZX 1CHQD 2F0OA 1KDAA 2RQXA 4HTHA 1TY2A 1SN8A 2ALYB 2JEBI 3PUWA 4G7HC 4R9WA 4B3MQ 1LUZA 4KHZA 4BBSH 2BOSA 2I0QA 1GUSA 1QVFA 1SNQA 4ZQ3A 3OTOL 1EIFA 1I6HB 2L15A 1X55A 1ILQA 2C9OA 1LM0A 1Y8PB 1OXVA 5C0XJ 5IIFA 3VDYA 2JA8H 1XNRL 4K14A 1HTPA 1TWCB 2RHSB 4DV4Q 4R4QA 1X54A 1PRTF 3U58A 5IT9E 1PH1A 2ENBA 3CC2A 1K8GA 4ME3A 4A3GG 1U4RA 1VQHA 2KHIA 1V9PA 4DAPA 4A93G 4IOCA 4DK3C 2NVXH 4WJWA 3ITPA 1YHBA 2XGTA 1Y8OB 4JI5L 1QNUA 1ENCA 4HCEA 1OTCA 3F2BA 1LV9A 4FF3A 1D6EC 3HFZB 3CW2C 2XWJB 4A3GB 4EQNA 4YCUA 1IBLQ 2BH8A 3NE5B 2H4OA 5FK9C 1S72A 1BUVT 4HR7B 2K04A 1KHIA 3SR1A 1O7YA 1VMPA 1Y1WH 2B39A 2VY3A 4FO2A 5IT9L 5IP9H 4JG2A 5HURA 3TP6A 3URYA 5GQOA 4X66L 4A3BG 1YZ6A 4KD4A 4OONA 4KJOA 5EBCA 3CCEA 4OELB 4NXML 1EY5A 4B9WA 1QG7A 2EVBA 3S14H 3KBGA 3NELA 1H9SA 1YNNC 2B2VA 1X32A 1PTOD 2JA6B 3M4YA
chains in the Genus database with same CATH topology
1TWGH 2WP8J 2E2IH 3KFUA 3CMAA 4LFBL 1B7YB 2GVBA 4DR2Q 1VQ8A 3K7UC 1KIXA 2OQ0A 2R92H 5GAHC 2OWOA 3I4NG 3SGIA 2B3GA 1GVPA 1XJVA 3I4MH 1PH3A 3CC4A 4DV3L 4DR4L 1CKOA 1T9HA 2VQFQ 1NMGA 4JC0A 1XTDA 4UPAA 4DV5L 4LFAL 4A3LG 1UWVA 4A4IA 4AYBE 2UUBQ 4HIDA 1YJNA 3BJUA 3EIVA 3BU2A 2OTLA 3GTOH 2UXCQ 5FLMH 3GO5A 5HGQA 1IBML 3PO2G 3H0GG 1QVGA 4LF8L 1EYGA 2D62A 3J7A5 2NVQH 4A3CH 3CCSA 1MJEA 1IL2A 5IYCG 1NMFA 1C9OA 1IXRA 1A62A 2HQLA 1X65A 2B63G 1HR0L 1FJGL 4DUZL 1ASZA 5C4XG 4BA1I 2HHHL 2VW9A 2E5LL 4JCVE 1RIPA 4DV2Q 4L5SA 4WJ4A 1YIJA 2BA1A 4PZ7A 1WI5A 5IYCH 2CCZA 4MTNA 4YCWA 3W1GA 1X3FA 4DV1L 1GKHA 5IWAL 1XMOL 1A8VA 3AQQA 3PUZA 1I6HH 1N8RC 4QL5A 5E7NA 3J7ZC 2A8VA 3AFPA 2I5MX 3T1YQ 3F1ZA 4XTCS 4DNIA 5GAEC 4DV0Q 4DV7Q 1EQRA 3HOZH 4BY7H 4GN4B 4WJ3M 4C3IH 1OXUA 4NXNQ 4PG3A 4YWKA 4LF5Q 2ZTEA 1CSQA 2A19A 2N8NA 3CQZH 1PV4A 3S1QH 1S40A 4A3CG 3ERSX 4O0AA 3I4MG 1VQOA 1CUKA 4K0KL 2R92G 1UEBA 2LXJA 2ZJQA 4EX5A 4OXPA 3GTLH 1PH6A 4HJ8A 3CPFA 3PIPA 1J5EL 2JEAI 2VL6A 1I5FA 4B3SQ 4GOPA 2F4VQ 1YNXA 1N36Q 4Y7NH 4A3MH 5FJ8H 1N33Q 4JYAL 3HOWH 1N9WA 1VQCA 1WCMG 4NB3A 4HIKA 1PA6A 1E22A 1XMQQ 3GTJH 1LYLA 1UE1A 2IX1A 1JJGA 1KXLA 1Q1BA 5C3EH 1G51A 4GLVB 1KD1C 1WJJA 4JI1Q 2NZOA 5C44G 1X56A 2K5VA 3DM3A 3NEMA 1KAWA 1L1OA 1E24A 1Q1EA 1WFQA 3CCMA 2CWPA 1L1OB 1QZHA 2R93H 2Q2TA 1MIUA 1Z47A 1JT8A 4R4TA 4P74A 5FLXc 3W1BA 3AFQA 1VQEA 4AYBG 3HOXG 4POGA 1GO3E 1TWCH 3OTOQ 3B6YA 1E3PA 4A3FG 2IY5B 3UDFA 2HIXA 5LMUL 3I55A 1AE3A 4GNXB 4A75A 2VUMG 3L0OA 1CKNA 4B3TL 2UUCL 4JI3L 4JBMA 4DR1Q 4DUYQ 1W3SA 2UXDL 4DV4L 1N34L 3PGZA 3KJOA 2OTJA 3K80C 5BR8Q 3RZOH 4QJFA 3H0GH 1BVSA 4BXXH 1UE6A 2CWAA 2FXQA 2NN6I 5IE8A 5IYBH 3KOJA 1Y14B 2MQHA 5FLMG 2RF4A 2LXKA 4APVA 3EBEA 3RNUA 1PH4A 3FHWA 4JI4L 2JA6H 1XPUA 4IPCA 5LMNQ 4JI6Q 2K50A 1QUQB 1WOCA 3CC7A 2JA5G 1NBWA 3S24A 1HNWQ 2MFIA 4A3GH 4JI5Q 4P73A 2WAQE 3PSIA 3RR5A 4YY3L 1GM5A 3J80i 4LF9L 1X6OA 1G291 1HZBA 3I4NH 1OXSC 3KF6A 2MNAA 1PH2A 3KDFA 3HOVG 1VCIA 3G48A 2JA8G 4DK6C 3CD6A 2EXDA 4IJHA 4JI0L 4LF4Q 2HT1A 1FGUA 1IBLL 4LFCQ 1PYBA 3ICEA 4JI8L 1X3EA 3CCVA 4HJ7A 4AQYQ 3A74A 3JAMi 2UUAQ 3HOUG 1M90C 4A3DH 4JV5L 4GKJL 3M9BA 1VQFA 2YTYA 1KRSA 3NENA 2PNHA 4YHHQ 2E2HH 5JJKA 4OX9Q 1I94L 1QVCA 4HIMA 1W2BA 2GN5A 5C0XG 5IP7G 3M85A 4DKAC 2D0PA 3E9IA 1YHAA 2AWOA 4QGUA 1HNZL 1E1TA 2Y0SE 2VQEL 2AWNA 2JE6I 4X65L 3I56A 1MKHA 4JI2L 4LF7Q 3S1MH 1Q86C 1KC8C 1YHQA 1U5KA 3IRBA 4JOIC 1HZ9A 1YBYA 2MO0A 4LUOA 3D31A 3W5OA 5IP9G 1CSPA 5IT9c 2QA4A 4PZ8A 3K8AA 3RN5A 4JI7Q 2F3IA 1XNQL 4X64L 1VQ4A 4BA2I 3KJPA 4MZ9A 4XIGS 4EQ5A 2IX0A 2ZM6Q 1PH5A 2NN6G 3PUVA 3J80c 2MO1A 3J81i 3DLLA 4X62L 2ZJRA 1KL9A 3F2CA 3CP0A 4HJ9A 3T1HL 3K0XA 5M3FG 2UU9L 4LF6L 3RLNA 1QZGA 2NVTH 1HNXQ 4GKKL 4B3RQ 1SFOH 4QY7A 4YWMA 3NBHB 4BBRG 3TS0A 2XTIA 3GTKH 1YEZA 3HOVH 4BXXG 4OWTB 2YTVA 4A3IG 2VNUD 3ULPA 1VQNA 1PH9A 4DV3Q 1VQAA 1EIYB 4DR4Q 4B3ML 2OCEA 2VQFL 4RG1A 1HZAA 4BY1H 1VQ9A 2UUBL 1UE7A 1CKMA 4IPGA 1QUQA 3GTQH 1AE2A 1EUJA 1V1QA 1J6QA 1Q7YC 1NJIC 4LF8Q 4GOPC 1B70B 5ELOA 2CFMA 3CAMA 2QGQA 3F2DA 2IHFA 1IYJB 2NVYH 1SLJA 4GNXC 1DGSA 3UE0A 1SRUA 5C0XI 4LWCA 2JA7G 4L5RC 4GN3B 4IOAA 4DAYB 3PO3G 3CCUA 3S1RH 2E5LQ 3OYYA 1XNRQ 4DV2L 3TEHB 1VQDA 1Y1VH 2K5HA 3GD7A 1OXXK 1JMCA 5AJ3Q 5DLQE 2LSSA 4DAMA 4KHPL 1K9MC 4AH6A 3U4VA 4IJLA 4DV1Q 1WCMH 1XMOQ 2WB1G 2Z6KC 2KBNA 4A3MG 1EOVA 1HZCA 4DR6Q 2QEXA 3CMEA 1I50H 1LTLA 3T1YL 3H3VH 1L0WA 4DV0L 4DV7L 1E1OA 4GN5A 3G71A 3G6EA 1K3RA 2YYZA 3GTGH 4DPGA 4ALPA 3ER0A 3HKZE 5IY0A 4UP7A 1X3GA 4DV6Q 4KLKA 4TVAB 3STBD 2Y0SG 1C0AA 4UY8C 4AIMA 4K0KQ 1XPRA 2RCNA 4IPHA 1NE3A 3G4SA 1VQMA 2V1CC 1J5EQ 2JA6G 2HIVA 3M7NA 4A3JG 2BH2A 2RHQB 2ZTCA 3H15A 5IYBG 1NTGA 4X6AH 1JE5A 1BBUA 3HKSA 3KF8B 4DR5Q 1N33L 1VQ6A 3PUXA 4A3EH 4JYAQ 2VZAA 3PF4A 4OO1I 1XMQL 3CPWA 1OXTA 4NPSA 3D0FA 3A5UA 4HIOA 2IHEA 4POFA 2UXDQ 1SR3A 4A3KG 4H02A 4X66Q 1A0IA 3FKIG 1PH8A 3K81C 4OWXB 2VUMH 4DR7L 3UE1A 5C4XH 5ELNA 4JI1L 1HNXL 1VQ7A 2Z6KA 1N32L 5GADC 1VQLA 2K14A 1MJCA 3KYHC 1IBKL 3PV0A 4NXMQ 2ES2A 2DGYA 4IFDJ 2BA0A 2UXBQ 1VS0A 3GDEA 4GS3A 4A3EG 4C2MH 1VQPA 4DR3Q 1UE5A 1Y1WG 1AH9A 3PO2H 3Q8DA 4PZ6A 2WAQG 3CCJA 1I3QH 4R4CA 2D0OA 4A3LH 4LFBQ 1HH2P 3FKIH 4DR2L 2N78A 5HY6A 4B3TQ 2R7FA 1KRTA 1CKNB 2UUCQ 4YCVA 1K0RA 2PI2E 2K4KA 2ZJPA 4UP8A 3JC66 4HJAA 1TWFH 3UDGA 1N34Q 2N49A 2PQAB 5M3MG 1PYSB 2R6GA 3WWVA 5FJ8G 1WYDA 3TRZA 1D7QA 4L5QA 4JI4Q 5M5YH 4LFAQ 3E0EA 4DV5Q 4IFDG 4A3JH 2JJQA 3BZKA 1Q82C 5LMNL 2R93G 1A63A 1Q81C 1IBMQ 1HNWL 4RMFA 1PVOA 1FL0A 2JA9A 1NY4A 2YU9H 2KCTA 4P72A 5M3MH 5IYDG 3CXCA 1S3OA 1TWHH 3U4ZA 4YY3Q 4HJ5A 4LF9Q 3S15H 1YITA 1JJCB 4BBSG 2C35B 2AMCB 1Z9FA 1HR0Q 4DUZQ 1FJGQ 4A3BH 2E8GA 2HHHQ 3M4PA 1O7IA 4JI0Q 3HOZG 1RL2A 4BY7G 2PMZE 2EIFA 1YJ9A 4JOIA 3CCQA 2R7DA 4AQYL 4GOPB 2E2JH 2UUAL 5GAGC 4GKJQ 5IWAQ 2ASBA 2KCMA 2IT1A 2Z0SA 1BBWA 4UP9A 3U50C 4OX9L 3TQYA 4R4IA 1Y1VG 4A3DG 3HOUH 1GD7A 5C4JH 4O2DA 2NZHA 4PMWA 3S2HH 2EQSA 4LUVA 1M1KC 2B63H 1HNZQ 2UXCL 4GNXA 3S1NH 2CQOA 4NXNL 3RN2A 4JI2Q 4A3KH 2B29A 4LW1A 4LF5L 3L2PA 4R4OA 1L2FA 1YJWA 3BZCA 2WFWA 3MEFA 3S16H 2K5NA 3CCLA 1XNQQ 2ZTDA 2K75A 1VQJA 5JEAJ 4OO1G 3TS2A 3RLFA 5K36G 4J15A 2A1AA 5M5XH 1B8AA 1TXYA 4P71A 4R1JA 3J81c 3CF5A 2ZM6L 3UDIA 5GROA 4X62Q 4LUZA 5M5WH 3T1HQ 1PH7A 4LF6Q 1VQGA 4B3SL 1D8LA 3PUYA 2F4VL 1JB7A 4GKKQ 1N36L 4B3RL 1KQSA 1V43A 1U0LA 1SROA 1EQQA 3ULLA 1X9NA 3PF5A 1C7YA 1YVCA 3F8TA 4C3JH 1VQBA 3M3YH 2PQAA 1EWIA 5H1SE 1Q8KA 3RZDH 4QIWE 1SN8A 2ALYB 2JEBI 3PUWA 4JBJA 5EAYA 4B3MQ 1LUZA 4JBKA 4KHZA 3S17H 3E9HA 4BBSH 3A5ZB 2I0QA 3LGJA 2WB1E 4A93H 2ATWA 1TWAH 3EN2A 1YI2A 3L7ZC 3OW2A 1QVFA 3H3VI 1H95A 4TQUS 5LMNW 2JA5H 4L5TA 1SE8A 2JQOA 2YV5A 3PCOB 3OTOL 1EIFA 2L15A 1PFSA 5J3BA 3HKZG 3UDXA 1X55A 2CKZB 3KDFB 3FP9A 5LMUQ 1JJ2A 5JEAG 2AHOB 3HOYH 3PO3H 1LM0A 2K52A 5C0XJ 1OXVA 5C44H 2JA7H 3VDYA 1VQKA 4JI3Q 3HOYG 2Q2UA 2DUDA 4DR1L 2JA8H 2VS1A 5IP7H 1XNRL 4DUYL 2Q2HA 2GVAA 2RHSB 5AJ3L 4R4QA 4DV4Q 1SMXA 1X54A 3M4QA 3U58A 1K83H 1PH1A 4KHPQ 2OQKA 4P75A 5BR8L 3TREA 2JK8A 1R9TH 1K73C 3CC2A 4QQBX 1K8GA 3HOWG 4ME3A 4A3GG 1VQHA 2KHIA 4KI0A 1V9PA 4MNOA 1G6PA 4DR6L 4A93G 4IOCA 1VQIA 4BY1G 4JI6L 4DK3C 1ASYA 2NVXH 3A0JA 1YHBA 2H5XA 2XGTA 5JJIA 4JI5L 4FDBA 4GLXA 2R7ZG 3GTMH 1OTCA 2AKWB 4JBWA 3F2BA 4DV6L 3KF6B 4A3IH 3PIOA 1HR0W 3HFZB 2R7ZH 4GLAC 4BBRH 3CW2C 1L1OC 3I7FA 3STBC 1VQ5A 2ID0A 4LF4L 3I4OA 1XPOA 2F52A 4YCUA 5M3FH 3RLOA 4LFCL 1FVIA 2BH8A 1IBLQ 4JI8Q 3ZJYC 2PI2A 4IPDA 4JV5Q 3KLWA 1S72A 1KHIA 4LNQA 4DR5L 1Y1WH 3AEVA 3S2DH 1K8AC 4YHHL 2VY3A 1I94Q 4IO9A 5IP9H 4OWWB 4JG2A 3AYHB 1PHJA 1IZ6A 1Q12A 5GQOA 2KHJA 4X66L 5JJLA 3MXNB 2VQEQ 4LF7L 4DR7Q 4X65Q 4A3BG 1YZ6A 3I2ZA 4OONA 3J81j 1Q46A 1P8LA 5C3EG 4A3FH 3K7AH 4C3HH 1N32Q 3JAMc 4JI7L 1IBKQ 3CCEA 2N3SA 4X64Q 4A76A 4NXML 3HOXH 3CCRA 4YWLA 3M4OH 2UXBL 5IYDH 1E7ZA 4IFDI 1EFWA 1HJPA 2YTXA 4DR3L 3NELA 3S14H 4Y52H 2Q2IA 1P16A 3ULJA 2UU9Q 1BKBA 3GTPH 2KENA 2I5HA 2I5LX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWG H;  2WP8 J;  2E2I H;  3KFU A;  3CMA A;  4LFB L;  1B7Y B;  2GVB A;  4DR2 Q;  1VQ8 A;  3K7U C;  1KIX A;  2OQ0 A;  2R92 H;  5GAH C;  2OWO A;  3I4N G;  3SGI A;  2B3G A;  1GVP A;  1XJV A;  3I4M H;  1PH3 A;  3CC4 A;  4DV3 L;  4DR4 L;  1CKO A;  1T9H A;  2VQF Q;  1NMG A;  4JC0 A;  1XTD A;  4UPA A;  4DV5 L;  4LFA L;  4A3L G;  1UWV A;  4A4I A;  4AYB E;  2UUB Q;  4HID A;  1YJN A;  3BJU A;  3EIV A;  3BU2 A;  2OTL A;  3GTO H;  2UXC Q;  5FLM H;  3GO5 A;  5HGQ A;  1IBM L;  3PO2 G;  3H0G G;  1QVG A;  4LF8 L;  1EYG A;  2D62 A;  3J7A 5;  2NVQ H;  4A3C H;  3CCS A;  1MJE A;  1IL2 A;  5IYC G;  1NMF A;  1C9O A;  1IXR A;  1A62 A;  2HQL A;  1X65 A;  2B63 G;  1HR0 L;  1FJG L;  4DUZ L;  1ASZ A;  5C4X G;  4BA1 I;  2HHH L;  2VW9 A;  2E5L L;  4JCV E;  1RIP A;  4DV2 Q;  4L5S A;  4WJ4 A;  1YIJ A;  2BA1 A;  4PZ7 A;  1WI5 A;  5IYC H;  2CCZ A;  4MTN A;  4YCW A;  3W1G A;  1X3F A;  4DV1 L;  1GKH A;  5IWA L;  1XMO L;  1A8V A;  3AQQ A;  3PUZ A;  1I6H H;  1N8R C;  4QL5 A;  5E7N A;  3J7Z C;  2A8V A;  3AFP A;  2I5M X;  3T1Y Q;  3F1Z A;  4XTC S;  4DNI A;  5GAE C;  4DV0 Q;  4DV7 Q;  1EQR A;  3HOZ H;  4BY7 H;  4GN4 B;  4WJ3 M;  4C3I H;  1OXU A;  4NXN Q;  4PG3 A;  4YWK A;  4LF5 Q;  2ZTE A;  1CSQ A;  2A19 A;  2N8N A;  3CQZ H;  1PV4 A;  3S1Q H;  1S40 A;  4A3C G;  3ERS X;  4O0A A;  3I4M G;  1VQO A;  1CUK A;  4K0K L;  2R92 G;  1UEB A;  2LXJ A;  2ZJQ A;  4EX5 A;  4OXP A;  3GTL H;  1PH6 A;  4HJ8 A;  3CPF A;  3PIP A;  1J5E L;  2JEA I;  2VL6 A;  1I5F A;  4B3S Q;  4GOP A;  2F4V Q;  1YNX A;  1N36 Q;  4Y7N H;  4A3M H;  5FJ8 H;  1N33 Q;  4JYA L;  3HOW H;  1N9W A;  1VQC A;  1WCM G;  4NB3 A;  4HIK A;  1PA6 A;  1E22 A;  1XMQ Q;  3GTJ H;  1LYL A;  1UE1 A;  2IX1 A;  1JJG A;  1KXL A;  1Q1B A;  5C3E H;  1G51 A;  4GLV B;  1KD1 C;  1WJJ A;  4JI1 Q;  2NZO A;  5C44 G;  1X56 A;  2K5V A;  3DM3 A;  3NEM A;  1KAW A;  1L1O A;  1E24 A;  1Q1E A;  1WFQ A;  3CCM A;  2CWP A;  1L1O B;  1QZH A;  2R93 H;  2Q2T A;  1MIU A;  1Z47 A;  1JT8 A;  4R4T A;  4P74 A;  5FLX c;  3W1B A;  3AFQ A;  1VQE A;  4AYB G;  3HOX G;  4POG A;  1GO3 E;  1TWC H;  3OTO Q;  3B6Y A;  1E3P A;  4A3F G;  2IY5 B;  3UDF A;  2HIX A;  5LMU L;  3I55 A;  1AE3 A;  4GNX B;  4A75 A;  2VUM G;  3L0O A;  1CKN A;  4B3T L;  2UUC L;  4JI3 L;  4JBM A;  4DR1 Q;  4DUY Q;  1W3S A;  2UXD L;  4DV4 L;  1N34 L;  3PGZ A;  3KJO A;  2OTJ A;  3K80 C;  5BR8 Q;  3RZO H;  4QJF A;  3H0G H;  1BVS A;  4BXX H;  1UE6 A;  2CWA A;  2FXQ A;  2NN6 I;  5IE8 A;  5IYB H;  3KOJ A;  1Y14 B;  2MQH A;  5FLM G;  2RF4 A;  2LXK A;  4APV A;  3EBE A;  3RNU A;  1PH4 A;  3FHW A;  4JI4 L;  2JA6 H;  1XPU A;  4IPC A;  5LMN Q;  4JI6 Q;  2K50 A;  1QUQ B;  1WOC A;  3CC7 A;  2JA5 G;  1NBW A;  3S24 A;  1HNW Q;  2MFI A;  4A3G H;  4JI5 Q;  4P73 A;  2WAQ E;  3PSI A;  3RR5 A;  4YY3 L;  1GM5 A;  3J80 i;  4LF9 L;  1X6O A;  1G29 1;  1HZB A;  3I4N H;  1OXS C;  3KF6 A;  2MNA A;  1PH2 A;  3KDF A;  3HOV G;  1VCI A;  3G48 A;  2JA8 G;  4DK6 C;  3CD6 A;  2EXD A;  4IJH A;  4JI0 L;  4LF4 Q;  2HT1 A;  1FGU A;  1IBL L;  4LFC Q;  1PYB A;  3ICE A;  4JI8 L;  1X3E A;  3CCV A;  4HJ7 A;  4AQY Q;  3A74 A;  3JAM i;  2UUA Q;  3HOU G;  1M90 C;  4A3D H;  4JV5 L;  4GKJ L;  3M9B A;  1VQF A;  2YTY A;  1KRS A;  3NEN A;  2PNH A;  4YHH Q;  2E2H H;  5JJK A;  4OX9 Q;  1I94 L;  1QVC A;  4HIM A;  1W2B A;  2GN5 A;  5C0X G;  5IP7 G;  3M85 A;  4DKA C;  2D0P A;  3E9I A;  1YHA A;  2AWO A;  4QGU A;  1HNZ L;  1E1T A;  2Y0S E;  2VQE L;  2AWN A;  2JE6 I;  4X65 L;  3I56 A;  1MKH A;  4JI2 L;  4LF7 Q;  3S1M H;  1Q86 C;  1KC8 C;  1YHQ A;  1U5K A;  3IRB A;  4JOI C;  1HZ9 A;  1YBY A;  2MO0 A;  4LUO A;  3D31 A;  3W5O A;  5IP9 G;  1CSP A;  5IT9 c;  2QA4 A;  4PZ8 A;  3K8A A;  3RN5 A;  4JI7 Q;  2F3I A;  1XNQ L;  4X64 L;  1VQ4 A;  4BA2 I;  3KJP A;  4MZ9 A;  4XIG S;  4EQ5 A;  2IX0 A;  2ZM6 Q;  1PH5 A;  2NN6 G;  3PUV A;  3J80 c;  2MO1 A;  3J81 i;  3DLL A;  4X62 L;  2ZJR A;  1KL9 A;  3F2C A;  3CP0 A;  4HJ9 A;  3T1H L;  3K0X A;  5M3F G;  2UU9 L;  4LF6 L;  3RLN A;  1QZG A;  2NVT H;  1HNX Q;  4GKK L;  4B3R Q;  1SFO H;  4QY7 A;  4YWM A;  3NBH B;  4BBR G;  3TS0 A;  2XTI A;  3GTK H;  1YEZ A;  3HOV H;  4BXX G;  4OWT B;  2YTV A;  4A3I G;  2VNU D;  3ULP A;  1VQN A;  1PH9 A;  4DV3 Q;  1VQA A;  1EIY B;  4DR4 Q;  4B3M L;  2OCE A;  2VQF L;  4RG1 A;  1HZA A;  4BY1 H;  1VQ9 A;  2UUB L;  1UE7 A;  1CKM A;  4IPG A;  1QUQ A;  3GTQ H;  1AE2 A;  1EUJ A;  1V1Q A;  1J6Q A;  1Q7Y C;  1NJI C;  4LF8 Q;  4GOP C;  1B70 B;  5ELO A;  2CFM A;  3CAM A;  2QGQ A;  3F2D A;  2IHF A;  1IYJ B;  2NVY H;  1SLJ A;  4GNX C;  1DGS A;  3UE0 A;  1SRU A;  5C0X I;  4LWC A;  2JA7 G;  4L5R C;  4GN3 B;  4IOA A;  4DAY B;  3PO3 G;  3CCU A;  3S1R H;  2E5L Q;  3OYY A;  1XNR Q;  4DV2 L;  3TEH B;  1VQD A;  1Y1V H;  2K5H A;  3GD7 A;  1OXX K;  1JMC A;  5AJ3 Q;  5DLQ E;  2LSS A;  4DAM A;  4KHP L;  1K9M C;  4AH6 A;  3U4V A;  4IJL A;  4DV1 Q;  1WCM H;  1XMO Q;  2WB1 G;  2Z6K C;  2KBN A;  4A3M G;  1EOV A;  1HZC A;  4DR6 Q;  2QEX A;  3CME A;  1I50 H;  1LTL A;  3T1Y L;  3H3V H;  1L0W A;  4DV0 L;  4DV7 L;  1E1O A;  4GN5 A;  3G71 A;  3G6E A;  1K3R A;  2YYZ A;  3GTG H;  4DPG A;  4ALP A;  3ER0 A;  3HKZ E;  5IY0 A;  4UP7 A;  1X3G A;  4DV6 Q;  4KLK A;  4TVA B;  3STB D;  2Y0S G;  1C0A A;  4UY8 C;  4AIM A;  4K0K Q;  1XPR A;  2RCN A;  4IPH A;  1NE3 A;  3G4S A;  1VQM A;  2V1C C;  1J5E Q;  2JA6 G;  2HIV A;  3M7N A;  4A3J G;  2BH2 A;  2RHQ B;  2ZTC A;  3H15 A;  5IYB G;  1NTG A;  4X6A H;  1JE5 A;  1BBU A;  3HKS A;  3KF8 B;  4DR5 Q;  1N33 L;  1VQ6 A;  3PUX A;  4A3E H;  4JYA Q;  2VZA A;  3PF4 A;  4OO1 I;  1XMQ L;  3CPW A;  1OXT A;  4NPS A;  3D0F A;  3A5U A;  4HIO A;  2IHE A;  4POF A;  2UXD Q;  1SR3 A;  4A3K G;  4H02 A;  4X66 Q;  1A0I A;  3FKI G;  1PH8 A;  3K81 C;  4OWX B;  2VUM H;  4DR7 L;  3UE1 A;  5C4X H;  5ELN A;  4JI1 L;  1HNX L;  1VQ7 A;  2Z6K A;  1N32 L;  5GAD C;  1VQL A;  2K14 A;  1MJC A;  3KYH C;  1IBK L;  3PV0 A;  4NXM Q;  2ES2 A;  2DGY A;  4IFD J;  2BA0 A;  2UXB Q;  1VS0 A;  3GDE A;  4GS3 A;  4A3E G;  4C2M H;  1VQP A;  4DR3 Q;  1UE5 A;  1Y1W G;  1AH9 A;  3PO2 H;  3Q8D A;  4PZ6 A;  2WAQ G;  3CCJ A;  1I3Q H;  4R4C A;  2D0O A;  4A3L H;  4LFB Q;  1HH2 P;  3FKI H;  4DR2 L;  2N78 A;  5HY6 A;  4B3T Q;  2R7F A;  1KRT A;  1CKN B;  2UUC Q;  4YCV A;  1K0R A;  2PI2 E;  2K4K A;  2ZJP A;  4UP8 A;  3JC6 6;  4HJA A;  1TWF H;  3UDG A;  1N34 Q;  2N49 A;  2PQA B;  5M3M G;  1PYS B;  2R6G A;  3WWV A;  5FJ8 G;  1WYD A;  3TRZ A;  1D7Q A;  4L5Q A;  4JI4 Q;  5M5Y H;  4LFA Q;  3E0E A;  4DV5 Q;  4IFD G;  4A3J H;  2JJQ A;  3BZK A;  1Q82 C;  5LMN L;  2R93 G;  1A63 A;  1Q81 C;  1IBM Q;  1HNW L;  4RMF A;  1PVO A;  1FL0 A;  2JA9 A;  1NY4 A;  2YU9 H;  2KCT A;  4P72 A;  5M3M H;  5IYD G;  3CXC A;  1S3O A;  1TWH H;  3U4Z A;  4YY3 Q;  4HJ5 A;  4LF9 Q;  3S15 H;  1YIT A;  1JJC B;  4BBS G;  2C35 B;  2AMC B;  1Z9F A;  1HR0 Q;  4DUZ Q;  1FJG Q;  4A3B H;  2E8G A;  2HHH Q;  3M4P A;  1O7I A;  4JI0 Q;  3HOZ G;  1RL2 A;  4BY7 G;  2PMZ E;  2EIF A;  1YJ9 A;  4JOI A;  3CCQ A;  2R7D A;  4AQY L;  4GOP B;  2E2J H;  2UUA L;  5GAG C;  4GKJ Q;  5IWA Q;  2ASB A;  2KCM A;  2IT1 A;  2Z0S A;  1BBW A;  4UP9 A;  3U50 C;  4OX9 L;  3TQY A;  4R4I A;  1Y1V G;  4A3D G;  3HOU H;  1GD7 A;  5C4J H;  4O2D A;  2NZH A;  4PMW A;  3S2H H;  2EQS A;  4LUV A;  1M1K C;  2B63 H;  1HNZ Q;  2UXC L;  4GNX A;  3S1N H;  2CQO A;  4NXN L;  3RN2 A;  4JI2 Q;  4A3K H;  2B29 A;  4LW1 A;  4LF5 L;  3L2P A;  4R4O A;  1L2F A;  1YJW A;  3BZC A;  2WFW A;  3MEF A;  3S16 H;  2K5N A;  3CCL A;  1XNQ Q;  2ZTD A;  2K75 A;  1VQJ A;  5JEA J;  4OO1 G;  3TS2 A;  3RLF A;  5K36 G;  4J15 A;  2A1A A;  5M5X H;  1B8A A;  1TXY A;  4P71 A;  4R1J A;  3J81 c;  3CF5 A;  2ZM6 L;  3UDI A;  5GRO A;  4X62 Q;  4LUZ A;  5M5W H;  3T1H Q;  1PH7 A;  4LF6 Q;  1VQG A;  4B3S L;  1D8L A;  3PUY A;  2F4V L;  1JB7 A;  4GKK Q;  1N36 L;  4B3R L;  1KQS A;  1V43 A;  1U0L A;  1SRO A;  1EQQ A;  3ULL A;  1X9N A;  3PF5 A;  1C7Y A;  1YVC A;  3F8T A;  4C3J H;  1VQB A;  3M3Y H;  2PQA A;  1EWI A;  5H1S E;  1Q8K A;  3RZD H;  4QIW E;  1SN8 A;  2ALY B;  2JEB I;  3PUW A;  4JBJ A;  5EAY A;  4B3M Q;  1LUZ A;  4JBK A;  4KHZ A;  3S17 H;  3E9H A;  4BBS H;  3A5Z B;  2I0Q A;  3LGJ A;  2WB1 E;  4A93 H;  2ATW A;  1TWA H;  3EN2 A;  1YI2 A;  3L7Z C;  3OW2 A;  1QVF A;  3H3V I;  1H95 A;  4TQU S;  5LMN W;  2JA5 H;  4L5T A;  1SE8 A;  2JQO A;  2YV5 A;  3PCO B;  3OTO L;  1EIF A;  2L15 A;  1PFS A;  5J3B A;  3HKZ G;  3UDX A;  1X55 A;  2CKZ B;  3KDF B;  3FP9 A;  5LMU Q;  1JJ2 A;  5JEA G;  2AHO B;  3HOY H;  3PO3 H;  1LM0 A;  2K52 A;  5C0X J;  1OXV A;  5C44 H;  2JA7 H;  3VDY A;  1VQK A;  4JI3 Q;  3HOY G;  2Q2U A;  2DUD A;  4DR1 L;  2JA8 H;  2VS1 A;  5IP7 H;  1XNR L;  4DUY L;  2Q2H A;  2GVA A;  2RHS B;  5AJ3 L;  4R4Q A;  4DV4 Q;  1SMX A;  1X54 A;  3M4Q A;  3U58 A;  1K83 H;  1PH1 A;  4KHP Q;  2OQK A;  4P75 A;  5BR8 L;  3TRE A;  2JK8 A;  1R9T H;  1K73 C;  3CC2 A;  4QQB X;  1K8G A;  3HOW G;  4ME3 A;  4A3G G;  1VQH A;  2KHI A;  4KI0 A;  1V9P A;  4MNO A;  1G6P A;  4DR6 L;  4A93 G;  4IOC A;  1VQI A;  4BY1 G;  4JI6 L;  4DK3 C;  1ASY A;  2NVX H;  3A0J A;  1YHB A;  2H5X A;  2XGT A;  5JJI A;  4JI5 L;  4FDB A;  4GLX A;  2R7Z G;  3GTM H;  1OTC A;  2AKW B;  4JBW A;  3F2B A;  4DV6 L;  3KF6 B;  4A3I H;  3PIO A;  1HR0 W;  3HFZ B;  2R7Z H;  4GLA C;  4BBR H;  3CW2 C;  1L1O C;  3I7F A;  3STB C;  1VQ5 A;  2ID0 A;  4LF4 L;  3I4O A;  1XPO A;  2F52 A;  4YCU A;  5M3F H;  3RLO A;  4LFC L;  1FVI A;  2BH8 A;  1IBL Q;  4JI8 Q;  3ZJY C;  2PI2 A;  4IPD A;  4JV5 Q;  3KLW A;  1S72 A;  1KHI A;  4LNQ A;  4DR5 L;  1Y1W H;  3AEV A;  3S2D H;  1K8A C;  4YHH L;  2VY3 A;  1I94 Q;  4IO9 A;  5IP9 H;  4OWW B;  4JG2 A;  3AYH B;  1PHJ A;  1IZ6 A;  1Q12 A;  5GQO A;  2KHJ A;  4X66 L;  5JJL A;  3MXN B;  2VQE Q;  4LF7 L;  4DR7 Q;  4X65 Q;  4A3B G;  1YZ6 A;  3I2Z A;  4OON A;  3J81 j;  1Q46 A;  1P8L A;  5C3E G;  4A3F H;  3K7A H;  4C3H H;  1N32 Q;  3JAM c;  4JI7 L;  1IBK Q;  3CCE A;  2N3S A;  4X64 Q;  4A76 A;  4NXM L;  3HOX H;  3CCR A;  4YWL A;  3M4O H;  2UXB L;  5IYD H;  1E7Z A;  4IFD I;  1EFW A;  1HJP A;  2YTX A;  4DR3 L;  3NEL A;  3S14 H;  4Y52 H;  2Q2I A;  1P16 A;  3ULJ A;  2UU9 Q;  1BKB A;  3GTP H;  2KEN A;  2I5H A;  2I5L X; 
#chains in the Genus database with same CATH topology
 4X3K A;  3CMA A;  4LFB L;  1B7Y B;  2NTS A;  4DR2 Q;  1LTA D;  2A68 D;  3K7U C;  1KIX A;  1Z7T A;  4G7O C;  3A8K E;  2X69 A;  4M8A A;  4FP5 D;  1XJV A;  1PH3 A;  1RTN A;  3M7G A;  3CC4 A;  4P2C B;  4BWG B;  1AP0 A;  1T9H A;  1XTD A;  2XRQ D;  4IZ8 A;  4A4I A;  2UUB Q;  3EIV A;  1GOZ A;  1EU4 A;  2B8F A;  3GO5 A;  2RVL A;  3H0G G;  3ERO A;  4LF8 L;  1PTO H;  4C3J B;  2D62 A;  1SJH D;  2XWB B;  1D5M C;  2KUM A;  3DUZ A;  4FF2 A;  1LT3 D;  1IXR A;  1A62 A;  1NR2 A;  5J22 A;  4BA1 I;  2HHH L;  2E5L L;  3C3L A;  1MBY A;  5BN4 A;  2BA1 A;  1B50 A;  4MTN A;  3VYT A;  3W1G A;  3S1N B;  3AMU A;  4DV1 L;  1GKH A;  1II3 A;  4A3K B;  2WIN B;  4FF4 A;  4QL5 A;  3J7Z C;  2I5M X;  4M1U B;  3HOZ H;  3I73 A;  4C3I H;  2WII B;  1H9K A;  1WCM B;  4RGT A;  1IW7 D;  2VXW A;  3S1Q H;  2F0M A;  3ERS X;  3N52 A;  3I4M G;  3P20 A;  2LXJ A;  2ZJQ A;  4OXP A;  4KV6 A;  3RZD B;  4BY1 B;  4GOP A;  1CT1 D;  4Y7N H;  4QCL A;  1B3A A;  1VQC A;  2R7Z B;  1UE1 A;  4NP5 A;  1T5X D;  4MN3 A;  5C3E H;  1G51 A;  1WJJ A;  4JI1 Q;  1X56 A;  3DM3 A;  1L1O A;  1WFQ A;  1Q1E A;  4A3E B;  3A54 A;  4OIK A;  3K6O A;  2FMC A;  2Q2T A;  1MIU A;  3D6W A;  1WTW A;  3BYY B;  1B9M A;  3HOX G;  1VQE A;  4AYB G;  1PLF A;  5JPM C;  1K83 B;  1BDO A;  1ZYR D;  4F87 A;  3I55 A;  4A3F B;  1AN8 A;  1CKN A;  5C3X A;  4JI3 L;  3H6M A;  3NQT A;  1ZXT A;  2K03 A;  3SK5 A;  1W3S A;  2UXD L;  1N34 L;  5DM7 3;  3K80 C;  5BR8 Q;  4BXX H;  2FXQ A;  2PZT A;  1EYA A;  3MZ5 A;  2RF4 A;  3MFY A;  5J39 A;  4CDE C;  1QUQ B;  1HNW Q;  4A3G H;  1HFG A;  1W6K A;  1GM5 A;  4S3S A;  1G29 1;  2BDO A;  2MNA A;  2DN8 A;  1JR0 D;  4RGN A;  3G48 A;  4KN4 C;  2JA8 G;  4DK6 C;  3R3O A;  4LFC Q;  1DJR D;  3ICE A;  5C0X H;  4AQY Q;  2UUA Q;  2E76 C;  3A74 A;  2JN4 A;  4IUN A;  4GKJ L;  1EL0 A;  1MI2 A;  4C3H B;  4HMJ A;  1I94 L;  4HIM A;  1W2B A;  1ET9 A;  1PZK D;  5C0X G;  1DOL A;  1LTR D;  3K5O A;  5ELF A;  1MKH A;  3S1M H;  1JB7 A;  1U5K A;  3FKI B;  1SE2 A;  4PQX A;  5IP9 G;  1WD1 A;  1LTI D;  4JI7 Q;  1CSP A;  2QA4 A;  2FHT A;  2F0S A;  3KJP A;  4MZ9 A;  4EQ5 A;  4F88 A;  2R92 B;  2ZM6 Q;  1OO9 B;  3J81 i;  4HJ9 A;  3T1H L;  1KL9 A;  4DGZ A;  4LF6 L;  2JEA I;  5M3F G;  3MXP A;  4A3J B;  1SFO H;  1TU2 B;  4HSP A;  3GTK H;  4BXX G;  2L9H A;  3ULP A;  5I2Y A;  4IAL A;  5TSS A;  4B3M L;  2EYP A;  2B2T C;  4OL7 A;  2VQF L;  1HZA A;  5J1Z A;  4IPG A;  1EUJ A;  3M3Y B;  1V1Q A;  2WB1 B;  4CKC A;  2ZXP A;  3TDQ A;  1LAB A;  3ND8 A;  1SSO A;  3MC0 B;  5ELO A;  3F2D A;  5FLX E;  2NVY H;  4GNX C;  4C1N K;  4QMG A;  1CA6 A;  4LWC A;  2EE1 A;  4N9P A;  3S1R H;  3FPP A;  1XNR Q;  1VQD A;  1TR5 A;  5ELB A;  4BY7 B;  5DLQ E;  2F0F A;  3SK6 A;  2AQ1 B;  1FNU A;  1WCM H;  4RGM A;  2WB1 G;  4A3M G;  2PZW A;  3P75 A;  2QEX A;  3T4A C;  3CME A;  4DV0 L;  1E1O A;  4GN5 A;  3J81 E;  3G71 A;  2C5C A;  1LTG D;  1R9T B;  3HKZ E;  4UP7 A;  1X3G A;  4H13 C;  1I6V C;  1JCK B;  2F0W A;  2Y0S G;  5CV4 A;  4K0K Q;  1JOQ A;  2G5D A;  4X3T A;  2NBF A;  3FRP B;  3OIQ A;  1J5E Q;  4F8M A;  3TZU A;  5A2Q L;  3VR6 A;  2KJX A;  2RHQ B;  5C4Z A;  3H15 A;  1BBU A;  1VQ6 A;  4JYA Q;  3PF4 A;  2D9U A;  3R2I A;  4H02 A;  4X66 Q;  1A0I A;  3FKI G;  2HCI A;  4J6H A;  3UE1 A;  1PMR A;  3ONA B;  3I3C A;  5DM6 3;  1MJC A;  4XQQ A;  5CV7 A;  5FOB B;  4NXM Q;  2ES2 A;  2DGY A;  5EKI A;  4V0B A;  4A3E G;  1EZ8 A;  1Y1W G;  5ELD A;  3Q8D A;  3Q0A A;  2K32 A;  3PIP 3;  5CYU A;  4PZ6 A;  1I3Q H;  3RZO B;  2D0O A;  4LFB Q;  4KKT A;  4DR2 L;  2N55 A;  5HY6 A;  1KRT A;  3SDZ A;  3A8J E;  3UDG A;  2R6G A;  3WWV A;  1D7Q A;  1TWG B;  2I07 B;  2PMZ B;  2R93 B;  5M5Y H;  2LMC B;  4IFD G;  3MHB A;  2K6A A;  2F0L A;  5LMN L;  5DEH A;  1HQR D;  4C56 C;  3I4M B;  1Q81 C;  1B9N A;  5A35 A;  2KCT A;  4P72 A;  3CXC A;  5IYD G;  2JSO A;  4YY3 Q;  3U4Z A;  3H94 A;  4N8F A;  1JJC B;  1K0S A;  1FGB D;  1XTC D;  1ZYR C;  4RHR A;  4A3B H;  2E8G A;  2HHH Q;  4BY7 G;  1O7I A;  1SJE D;  1YJ9 A;  4JOI A;  1WTP A;  1QCB D;  1BBW A;  2FFK B;  4OX9 L;  4R4I A;  5C4J H;  3I72 A;  3S2H H;  4PMW A;  2F0H A;  2M00 A;  4LUV A;  2B63 H;  1TVX A;  4BBS G;  3MEH A;  4XQJ A;  3R8B A;  3MEF A;  3S16 H;  1SFO B;  1HQM C;  2SDF A;  2K75 A;  1VQJ A;  5JEA J;  4J15 A;  1X3P A;  5M5X H;  1RKN A;  2TMP A;  1I50 B;  5ELC A;  1RF2 D;  2PW5 A;  1G8Z D;  3PUY A;  5C5L A;  1KQS A;  1SEB D;  1XXG A;  2J4X A;  1K28 A;  1C7Y A;  3F8T A;  1PTO B;  1VQB A;  1SYD A;  4C3J H;  3M3Y H;  2PQA A;  1KTK A;  1IYV A;  1DYQ A;  2CQA A;  1Q8K A;  5EAY A;  3S17 H;  3E9H A;  4ABN A;  4A93 H;  2VB3 X;  4XT1 B;  3GTJ B;  4XYQ A;  1W6J A;  1CHP D;  3L7Z C;  3NTH A;  2Z4I A;  2F0T A;  2KA7 A;  3PCO B;  4WOR A;  3KDF B;  4IUQ A;  5C4X B;  5JEA G;  2AHO B;  3PO3 H;  3HOZ B;  2L4N A;  4JI3 Q;  2Q2U A;  1E0B A;  2VS1 A;  2UXD Q;  2PQE A;  5T1G A;  4G57 A;  3M4Q A;  3S1Q B;  2OQK A;  5BR8 L;  3U9S A;  2JK8 A;  4QQB X;  1BCP F;  1PXU A;  2CHB D;  2WAC A;  4I7A A;  3DEO A;  1VQI A;  4BY1 G;  1GUW A;  5EPL A;  3HRZ C;  2AQ3 B;  2H5X A;  1TII D;  3H0G B;  4FDB A;  3D4R A;  2A68 C;  4DV6 L;  4A3I H;  1HR0 W;  3PIO A;  3GV6 A;  1Q8I A;  2R7Z H;  2E75 C;  2K5Q A;  3STB C;  3I4O A;  1V1O A;  2F0E A;  4LFC L;  3RLO A;  2L55 A;  2PI2 A;  3KLW A;  3C2P A;  5M3M B;  4LNQ A;  3EVQ A;  1LTS D;  4CDF C;  1IKM A;  1BBX C;  1STG A;  1I94 Q;  2XIW A;  4K5X A;  4ZUI A;  1FNV A;  1O80 A;  5JJL A;  4DR7 Q;  3I2Z A;  3J81 j;  5I6Y A;  1P8L A;  5C3E G;  3K7A H;  4RHS A;  4JI7 L;  1ESR A;  1AFP A;  3HOX H;  3M4O H;  2UXB L;  2Z8L A;  4IFD I;  1HJP A;  4X3U A;  4DR3 L;  2VB2 X;  1ENF A;  1P16 A;  3ULJ A;  1BKB A;  1C8C A;  2I5H A;  1A3T A;  3LX0 A;  1QB5 D;  1SMY C;  4XXE A;  3C1F A;  3KFU A;  1CFM A;  3R93 A;  5CV8 A;  4KKU A;  1HCZ A;  1U4L A;  2A74 C;  5GAH C;  2B3G A;  3I4M H;  1C4Q A;  1MD2 D;  1STN A;  1CKO A;  1J9O A;  3OPO A;  5EQ0 A;  2VQF Q;  3BDL A;  1NMG A;  3HGB A;  4DV5 L;  4O42 A;  3BJU A;  1IBM L;  5HGQ A;  1EYG A;  2FMM A;  2NVQ H;  3HP3 A;  3CCS A;  1MJE A;  1IL2 A;  5IYC G;  1S5E D;  2LY7 A;  1ENA A;  1C9O A;  1X65 A;  3H91 A;  2B63 G;  4DUZ L;  5C4X G;  3NWS A;  4JCV E;  3S9W A;  4DXG A;  4KY5 A;  1YIJ A;  3S1M B;  1PFN A;  3S2H B;  5IYC H;  4YCW A;  4KD3 A;  5IWA L;  1I6H H;  2A8V A;  2DJF C;  3AFP A;  4XTC S;  4DV0 Q;  5GAE C;  4ZCK A;  2AQ2 B;  1GUN A;  4NXN Q;  4YWK A;  2ZTE A;  1CSQ A;  5FO9 B;  2N8N A;  3DWQ A;  2O5J C;  5KEE A;  4K0K L;  1UEB A;  1GHJ A;  1IYU A;  4JW0 A;  4EX5 A;  1PH6 A;  3IAY A;  4Q5V A;  4HJ8 A;  3CPF A;  2V4D A;  1J5E L;  1A2T A;  1I5F A;  3K59 A;  2F4V Q;  4A3M H;  2ZXR A;  4JYA L;  1F9R A;  1N9W A;  1E22 A;  3I91 A;  3MVV A;  4XDX A;  3Q22 A;  1Q1B A;  1ZEQ X;  1KXL A;  1CK1 A;  3SVM A;  2NVY B;  1KD1 C;  4GNX B;  1KAW A;  1E24 A;  2CWP A;  3PMF A;  1KAB A;  4H7B A;  5FO8 B;  2FJ2 A;  1Y1V B;  5FLX c;  3ND9 A;  3SEB A;  3AFQ A;  5DAU A;  4POG A;  5CV9 A;  1GO3 E;  1Q3L A;  3JAM L;  2XRS D;  4A3F G;  3UDF A;  1I4Q A;  5LMU L;  1IKL A;  4KHV A;  4A75 A;  2XVS A;  3MAQ A;  1KNA A;  4ZKC B;  1B2T A;  3SXH A;  4DR1 Q;  1BOS A;  4DUY Q;  5KNB A;  3KJO A;  2OTJ A;  1CQV A;  3H0G H;  1BVS A;  4NMZ A;  5FLM G;  5IYB H;  2MQH A;  4XYO A;  3FHW A;  1EFI D;  4IPC A;  5LMN Q;  4JI6 Q;  1ILP A;  3LWU A;  3S24 A;  2JA5 G;  4OGQ C;  4CKB A;  4P73 A;  3PSI A;  4YY3 L;  1H9R A;  3I4N H;  3HOV G;  5FO7 B;  4IJH A;  1SNM A;  4LF4 Q;  2HT1 A;  1FGU A;  5KGU A;  4JI8 L;  3CCV A;  4HJ7 A;  3S15 B;  4A3D H;  4JV5 L;  1M90 C;  2PPB C;  1F9Q A;  4UDU C;  3O13 A;  1R4Q B;  1KRS A;  3K7A B;  3NEN A;  3J7A F;  4YHH Q;  4OX9 Q;  4C2M B;  3FMC A;  2GN5 A;  5IP7 G;  5LL6 S;  4DKA C;  2D0P A;  2EYM A;  1SE4 A;  2VQE L;  3I56 A;  5ISR A;  1NJI C;  3MA2 B;  3W5O A;  1S5C D;  3K8A A;  1EWH A;  4X64 L;  1VQ4 A;  3IFD A;  1KNE A;  4XIG S;  2AUK A;  2IX0 A;  1PH5 A;  1RHP A;  3J80 c;  3PUV A;  2HQE A;  4WFN 3;  5ELE A;  2UU9 L;  3TBI B;  2R93 H;  2NVT H;  3RLN A;  1FYC A;  3SK4 A;  1QZG A;  3OMC A;  3NBH B;  4KJN A;  4BBR G;  3TS0 A;  2XTI A;  3NP8 A;  3TN2 A;  3IL8 A;  5K36 H;  1A3V A;  1ML0 D;  4A3I G;  3A7A B;  1AW7 A;  2PO4 A;  4DV3 Q;  1EIY B;  4DR4 Q;  5I2X A;  2JYO A;  1V1P B;  4ZRZ A;  4A3B B;  1FR3 A;  1CKM A;  1AE2 A;  1XX8 A;  1MGS A;  3BVZ A;  1Q7Y C;  2KEC A;  4GOP C;  1B70 B;  1CZW A;  1CTM A;  3V2T A;  2QGQ A;  5HGT A;  2IHF A;  1DGS A;  1TWA B;  1U4M A;  5FLX L;  3AU7 A;  4FF1 A;  4GN3 B;  4IOA A;  4DAY B;  4G4K A;  5JEA H;  3CCU A;  4DAY A;  3PO3 G;  2KOL A;  1GJX A;  3TEH B;  2DJG C;  2K5H A;  3BDO A;  1OXX K;  5IGF A;  2LSS A;  1K9M C;  4AH6 A;  4KMU C;  3U4V A;  2PW7 A;  4KN7 C;  5IGG A;  3X3N A;  3VR4 A;  1F2Y A;  5G3L F;  3G6E A;  4DPG A;  4ALP A;  5K5P A;  4DNR B;  4DV6 Q;  4C3J G;  3EQL C;  2F3W A;  3STB D;  4IPH A;  2O4X A;  3G4S A;  1VQM A;  2V1C C;  3NTK A;  4A3J G;  2ZTC A;  5IYB G;  1WTH A;  3PUX A;  1D5X C;  2Z6B A;  4OO1 I;  3CPW A;  4NPS A;  4HIO A;  1EY8 A;  2Z4H A;  4POF A;  3W3A A;  3AB9 A;  1ICF B;  1PH8 A;  4DR7 L;  5C4X H;  4C3I G;  1HNX L;  1VQ7 A;  2Z6K A;  5GAD C;  2F0I A;  5C6A A;  2B8G A;  1NCV A;  2K14 A;  2MP1 A;  4B9X A;  2BA0 A;  2UXB Q;  1VS0 A;  1HUM A;  2F0U A;  2HCC A;  3GDE A;  3TP7 A;  2E2H B;  4DR3 Q;  1PFM A;  4DU9 A;  5BN3 A;  3K0Y A;  4GZY C;  2EYH A;  2WAQ G;  4DK0 A;  1MHW C;  2MHV A;  3KK7 A;  1HH2 P;  3FKI H;  2N78 A;  4B3T Q;  4FXG C;  2R7F A;  2UUC Q;  1VDZ A;  2KVM A;  2PI2 E;  1H9J A;  2K4K A;  2PQA B;  2RDG A;  3GTP B;  4CDD C;  1STB A;  1K8M A;  5FJ8 G;  1K3B C;  2AUJ D;  1JWS D;  2XNA C;  4JI4 Q;  4DV5 Q;  1NUC A;  2B2V C;  2KEE A;  2JJQ A;  3BZK A;  1BR9 A;  5EJW A;  1IBM Q;  3FEW X;  4RMF A;  3SE0 A;  1CQF A;  3MTS A;  2JA9 A;  4X3S A;  2LFN A;  5NUC A;  1RCV D;  4HJ5 A;  1E2W A;  4LF9 Q;  3S15 H;  1YIT A;  1TQO A;  4DUZ Q;  4JI0 Q;  3HOZ G;  1IW7 C;  2B2T A;  5I4D A;  1HHV A;  2E2J H;  3HS0 C;  5GAG C;  3OW7 A;  5L37 A;  5IWA Q;  2QCP X;  4IQZ A;  5DNF A;  2NTT A;  2Z0S A;  3QWN A;  1SYC A;  4FXD A;  2Q8T A;  3U50 C;  4EGV A;  1S5B D;  1GD7 A;  4O2D A;  3MXU A;  1ONL A;  4IUR A;  1M1K C;  2UXC L;  4GNX A;  4NXN L;  1LTT D;  2EYL A;  5I9O A;  4LW1 A;  2G9H D;  4A3K H;  3L2P A;  2N88 A;  3BZC A;  4R8I A;  1KDB A;  2WFW A;  3A55 A;  1XNQ Q;  3I4L A;  2A6H C;  4V19 0;  5D3D A;  5K36 G;  1A6X A;  2A1A A;  2F0G A;  4P71 A;  1M4V A;  2B2Y C;  5GRO A;  4X62 Q;  3TSS A;  1UEA B;  1MSH A;  3QOJ A;  2CH4 W;  2F4V L;  5C5M A;  4GKK Q;  4B3R L;  1QWY A;  2K7V A;  4FYD A;  1JB3 A;  1SNP A;  1YVC A;  3GTQ B;  3NPP A;  2QDL A;  1NAP A;  1EOT A;  4OO1 H;  2NVQ B;  1EWI A;  3RZD H;  4QIW E;  4JBJ A;  4QUC A;  4JBK A;  2L1B A;  2BDN A;  2WB1 E;  3NK9 A;  5JAV A;  2ATW A;  3K5M A;  1TWA H;  2Q8R E;  3EN2 A;  3K5L A;  1A3U A;  3OW2 A;  3V05 A;  3TP5 A;  1H95 A;  1YNN D;  4TQU S;  1RTO A;  3NXW A;  5J3B A;  3HKZ G;  3UDX A;  1SYG A;  3D6C A;  5LMU Q;  1JJ2 A;  3LWE A;  2Z9H A;  2K52 A;  1CA5 A;  2MPM A;  2XN9 C;  1VQK A;  3HOY G;  2DUD A;  4DR1 L;  5IP7 H;  4DUY L;  4DF7 A;  2GVA A;  5AJ3 L;  3CQZ B;  5EKL A;  1K83 H;  1J8I A;  4P75 A;  3TRE A;  1K73 C;  1EQV A;  3HOW G;  5E3F A;  1JWU D;  4KI0 A;  1G6P A;  1JOK A;  4MNO A;  4RFB A;  4DR6 L;  4JI6 L;  1ASY A;  5IOC A;  2QEJ C;  4ZKB B;  4I7Z C;  2MUY A;  5JJI A;  4ODG A;  2A5H A;  5CV5 A;  1S5D D;  4GLX A;  2BE5 C;  2AKW B;  4JBW A;  3EJI A;  3KF6 B;  4J1M A;  4BBR H;  3NBI A;  3J7Y W;  1VQ5 A;  5M5Y B;  4DAV A;  4LF4 L;  1XPO A;  4PMB A;  2IPK D;  1FVI A;  4JI8 Q;  3ZJY C;  1B44 D;  4JV5 Q;  3J81 L;  4LMQ D;  2KQ3 A;  1JOR A;  3OIP A;  3AEV A;  1K8A C;  4QF4 A;  4RGO S;  4YHH L;  2QDB A;  4IO9 A;  1LT4 D;  4OWW B;  4QUF A;  1QIL A;  1Q12 A;  2KHJ A;  5I6W A;  3MXN B;  2VQE Q;  1XWE A;  3MXN A;  3KBX A;  1A15 A;  1I4X A;  1Q46 A;  2DY7 A;  1N32 Q;  4C3H H;  1RDP D;  2N3S A;  1RD9 D;  4X64 Q;  3CCR A;  3K58 A;  5A2Q E;  2Q2I A;  1TWF B;  2UU9 Q;  4R8N A;  3GTP H;  3NBH A;  2LKV A;  2E2I H;  1YNJ C;  4ZYS A;  1B1Z A;  2A6E C;  2R92 H;  2OWO A;  1MSG A;  1PFB A;  1GVP A;  3A56 A;  3SGI A;  4DV3 L;  3I4N B;  4DR4 L;  1LT5 D;  3SK8 A;  1V1P A;  2L12 A;  2B2U C;  3E5S A;  5M5W B;  4LFA L;  4UPA A;  4A3L G;  3KLS X;  1WD0 A;  1PZI D;  1UWV A;  4AYB E;  3G7L A;  1YJN A;  2OTL A;  3BU2 A;  3PO2 G;  2H1E A;  2LS0 1;  1DXM A;  1V8Q A;  3C46 A;  1I4G A;  2E2J B;  3WOF A;  1NMF A;  3QOL A;  1SNO A;  1HA6 A;  5IGD A;  1JC7 A;  1PRT C;  2HQL A;  2O2L D;  5CR3 A;  2VW9 A;  4WJ4 A;  4ZLT F;  1WI5 A;  4CDC C;  1DM0 B;  2CW0 C;  1X3F A;  4WRD A;  1WTR A;  1S5F D;  3PUZ A;  5CV6 A;  1N8R C;  4UHV A;  1E2V A;  3HOY B;  3F1Z A;  1PZJ D;  1EQR A;  2K33 A;  4BY7 H;  4GN4 B;  4WJ3 M;  1R4P B;  1HRJ A;  1OXU A;  3J80 E;  3FPU B;  4LF5 Q;  2A19 A;  4A3C G;  4O0A A;  1VQO A;  1LLR D;  2R92 G;  3BS1 A;  5F2D A;  3DEP A;  5EGT A;  1NNX A;  1YNX A;  2ICE C;  3G6J B;  1N36 Q;  3D8G A;  3GTM B;  4CJ0 B;  3HOW H;  3VYR A;  2IX3 A;  1F9P A;  1WCM G;  2WKC A;  3FDT A;  4NB3 A;  2F0Q A;  1PA6 A;  1LYL A;  2IX1 A;  2A69 C;  1BCP C;  1SDF A;  2NZO A;  1HNX Q;  2K5V A;  3X3M A;  4XQN A;  4R4T A;  2QF7 A;  5E4X A;  4OIJ A;  3JAM E;  1EY0 A;  1TWC H;  4XT3 B;  1X3Q A;  1PTO F;  2IY5 B;  1GHK A;  2L5T A;  1AE3 A;  2VUM G;  4B3T L;  2UUC L;  3BDC A;  1EIG A;  1JOO A;  1KAA A;  5M9O A;  1BCP D;  2K01 A;  1BO0 A;  3RZO H;  4QJF A;  1AH9 A;  2CWA A;  3N6R A;  3RNU A;  1Y14 B;  2XSC A;  4JI4 L;  4J8Q A;  4APV A;  2IL8 A;  1SYF A;  1U4P A;  1XPU A;  3T53 B;  1Q90 A;  2K50 A;  3CC7 A;  4CGY B;  4Z9C B;  4ULL A;  2Y0S B;  3J80 i;  4LF9 L;  1X6O A;  1HZB A;  1PYW D;  2A73 B;  4MIU A;  1OXS C;  3KF6 A;  1PH2 A;  3KDF A;  4ME5 A;  1VCI A;  2SOB A;  3CD6 A;  4EQO A;  4JI0 L;  1I4H A;  1LTB D;  4RCO A;  1PYB A;  2I46 A;  5IGB A;  3HOU G;  3JAM i;  2ICI A;  4CKE A;  1GUT A;  2RDH A;  1VQF A;  4NDX A;  2PNH A;  2E2H H;  4IN3 A;  1F9S A;  2EOT A;  3E9I A;  1NR4 A;  1YHA A;  1VQN A;  2UXC Q;  4LF7 Q;  2JE6 I;  4X65 L;  1Q86 C;  1F2Z A;  1KC8 C;  4JOI C;  3IRB A;  3A8I E;  1HZ9 A;  1YBY A;  2MO0 A;  4LUO A;  3D31 A;  2F3V A;  5IT9 c;  1XNQ L;  1PRT D;  4PZ8 A;  4FVM A;  1D1K A;  3HOU B;  3TME A;  4BA2 I;  2B63 B;  2KHS A;  2NN6 G;  2MO1 A;  2JA5 H;  1UAP A;  4X62 L;  3DLL A;  3F2C A;  2IJ0 A;  1D1I A;  3S16 B;  4GKK L;  4B3R Q;  4QY7 A;  4YWM A;  3BYT B;  1YEZ A;  2HDM A;  3HOV H;  4OWT B;  2YTV A;  3CRK C;  2YU9 B;  1QE6 A;  3CRL C;  3TP8 A;  2A6E D;  3GP7 A;  1UE7 A;  2WAQ B;  2EZV A;  1J6Q A;  5JOB A;  3PQI A;  3CAM A;  4QIW B;  1SRU A;  3QB3 A;  2QKI C;  2P5Z X;  3OYY A;  2EDG A;  4DV2 L;  4MHE A;  3D4D A;  1Y1V H;  1EY7 A;  5AJ3 Q;  3SHL A;  1O7Z A;  4DAM A;  3OWF A;  2EJM A;  3CKI B;  3QG1 A;  1XMO Q;  2Z6K C;  2HUG A;  1EIH A;  2KBN A;  2SEB D;  5C44 B;  2JA7 B;  1EOV A;  4E6I A;  4DR6 Q;  1Z6H A;  3T1Y L;  1VF5 C;  1L0W A;  1TT2 A;  3WDN A;  4DV7 L;  3MFG A;  2EYO A;  1H9M A;  2EY6 A;  3DMU A;  1EZ6 A;  5KYI A;  5IY0 A;  1EYD A;  4U67 3;  4TVA B;  1C0A A;  2X6L A;  4AIM A;  5KNC A;  1D5Z C;  4G7Z C;  1SMY D;  2RCN A;  1WVL A;  1B3Q A;  4B08 A;  2BE5 D;  1PRT B;  2WV6 D;  2JA6 G;  2HIV A;  3M7N A;  4FXK C;  2DNE A;  3VYU A;  5IOD A;  4X6A H;  1ROD A;  3KF8 B;  4HMI A;  1N33 L;  4A3E H;  4N9T A;  3I90 A;  1EQT A;  1XMQ L;  1OXT A;  2IHE A;  1IL8 A;  1SR3 A;  3R2T A;  3Q24 A;  4MTK A;  3K81 C;  4OWX B;  2VUM H;  1CZG A;  5CBA E;  1N32 L;  2F03 A;  2L11 A;  3KYH C;  4HAE A;  4L8J A;  3PV0 A;  1BXT A;  1B4O A;  4ZK9 B;  3VR3 A;  4C2M H;  3PIO 3;  1UE5 A;  3PO2 H;  5D14 A;  4H44 C;  2K1B A;  1BNZ A;  3CCJ A;  1AZQ A;  3I8Z A;  3HOX B;  3M4O B;  2NVX B;  2L0C A;  1CKN B;  4YCV A;  1K0R A;  1LO5 D;  2ZJP A;  4UP8 A;  4HJA A;  2PCF B;  1C48 A;  3I70 A;  4L5Q A;  1UUP A;  4LFA Q;  4PMC A;  1Q82 C;  3H09 A;  2PZU A;  3OHX C;  1PVO A;  1NY4 A;  4TSS A;  1Y1W B;  1M8A A;  3OSO A;  2JXM B;  3OOC A;  3Q6S A;  1WTX A;  2KCC A;  3GTO B;  3E3X A;  3NHH A;  1GUO A;  2PMZ E;  1SYB A;  2R7D A;  3MWY W;  4GOP B;  2K05 A;  5LHY 1;  3KF8 A;  3K57 A;  2PNR C;  3TQY A;  4TKO B;  3S14 B;  1SNC A;  4A3D G;  3HOU H;  3C1E A;  5C3W A;  2NZH A;  1EY6 A;  2QIL A;  1HNZ Q;  2OEO A;  2CQO A;  3CU7 A;  3U9O A;  4JI2 Q;  4LF5 L;  2JA5 B;  5KIX A;  2E2I B;  4R4O A;  1A2U A;  1I4R A;  2K5N A;  3VA7 A;  2F0V A;  2ZTD A;  3TS2 A;  3RLF A;  5AFW A;  1HUN A;  3HOV B;  1CM9 A;  1TXY A;  4R1J A;  3CF5 A;  1TS3 A;  1B53 A;  2SNM A;  1NSN S;  4LUZ A;  5M5W H;  1VQG A;  2EY1 A;  2JP1 A;  1N36 L;  1V43 A;  1U0L A;  1FD7 D;  3Q23 A;  1X9N A;  4ZUJ A;  3PF5 A;  3W2D A;  3BZD B;  5H1S E;  2F1M A;  1JE4 A;  4N8X 1;  1F2L A;  3A5Z B;  3LGJ A;  1LT6 D;  4LAA A;  2CW0 D;  1YI2 A;  1GXD C;  3H3V I;  2TSS A;  3HKZ B;  5LMN W;  4L5T A;  1SE8 A;  2JQO A;  2KED A;  2YV5 A;  1PFS A;  1EU3 A;  2CKZ B;  1HXY D;  3FP9 A;  3HOY H;  2R3Z A;  3LNN A;  5C44 H;  2JA7 H;  4C3I B;  2D5D A;  1G2S A;  2Q2H A;  1SBB B;  1SMX A;  2RBM A;  4KHP Q;  1R9T H;  5CGK A;  1O78 A;  4K6D A;  1SYE A;  3EA6 A;  3V96 A;  1CI3 M;  4L63 B;  4CJ1 B;  3A0J A;  4QB4 A;  2B2W A;  2O5I C;  2X6G A;  4Y7N B;  4DNT B;  2MGS A;  3GTM H;  2R7Z G;  1SND A;  3HOW B;  1HFN A;  1YNJ D;  4GLA C;  4JPB W;  3I7F A;  1L1O C;  1PTO C;  2ID0 A;  3CHB D;  1FNW A;  5C3E B;  2F52 A;  2ZXO A;  4HN7 A;  5M3F H;  2NYZ D;  4Q0F A;  5C4H A;  2NN6 H;  4IPD A;  3RD4 A;  2VUM B;  2HD3 A;  4KTA A;  4DR5 L;  3S2D H;  2EY5 A;  1PDQ A;  1JWM D;  3BVM A;  5D3I B;  3AYH B;  4DK1 A;  1PHJ A;  1IZ6 A;  4ILW A;  4A3D B;  4LK1 C;  2GA4 B;  4RA8 A;  4LF7 L;  4X65 Q;  4A3F H;  1I3Q B;  3H3V C;  3JAM c;  1IBK Q;  1K8O A;  4A76 A;  4IUU A;  4YWL A;  5IYD H;  5IGE A;  1E7Z A;  1EFW A;  2YTX A;  3T56 B;  1H9S B;  5I9P A;  4Y52 H;  1DD2 A;  2KEN A;  1F77 A;  2I5L X;  1TWG H;  2WP8 J;  3BVG A;  1EYC A;  1QNK A;  2GVB A;  3NTI A;  4HED A;  1VQ8 A;  5JVH 3;  2OQ0 A;  3I4N G;  5T1I A;  3TZD A;  1STY A;  1Y69 U;  4JC0 A;  4I65 A;  3A7L A;  3T51 B;  4HID A;  4K6L A;  4EQP A;  3GTO H;  2M9V A;  5FLM H;  1QVG A;  1JQY D;  4KKS A;  2OT2 A;  4TRD A;  2K28 A;  4JK1 C;  4AYB B;  3J7A 5;  4A3C H;  1HR0 L;  5E4W C;  1FJG L;  1ASZ A;  1SXT A;  1RIP A;  4DV2 Q;  4L5S A;  4H0L C;  4PZ7 A;  2CCZ A;  1EWC A;  1AZP A;  5KND A;  4HSV A;  3QO2 A;  1XMO L;  1A8V A;  3AQQ A;  4LJZ C;  1EEI D;  3MXG A;  5E7N A;  2K5W A;  1ICW A;  4FNF A;  3T1Y Q;  4DNI A;  4RAU C;  4DV7 Q;  5M5X B;  3FVQ A;  2JA8 B;  1G2T A;  1EEF D;  3UI2 A;  3IFT A;  4PG3 A;  4DN4 M;  3IKJ A;  3CQZ H;  3NQI A;  1PV4 A;  3GTK B;  1S40 A;  1SE3 A;  1CUK A;  4CHT B;  3QR8 A;  4O1N A;  3GTL H;  2KCN A;  4BS9 A;  3GTG B;  3PIP A;  3GQB A;  2RSN A;  3DWA A;  4K2K A;  3VA5 A;  2VL6 A;  1G91 A;  1WTO A;  4B3S Q;  1L0Y B;  5FJ8 H;  1N33 Q;  3QJY A;  5CC4 A;  4A93 B;  4HIK A;  2NUC A;  1XMQ Q;  3GTJ H;  1WTQ A;  4BBR B;  2RCF A;  3NSW A;  1JJG A;  4OEM B;  5EPK A;  2F0D A;  4GLV B;  5C44 G;  3P7J A;  3NEM A;  3CCM A;  1QZH A;  1L1O B;  3S1R B;  5KYL A;  1Z47 A;  1RJT A;  3PO3 B;  1JT8 A;  4P74 A;  3W1B A;  2EJG C;  2K5D A;  1TY0 A;  3OTO Q;  2RKS A;  3B6Y A;  2EPB A;  1E3P A;  4U68 A;  2HIX A;  3L0O A;  1G6Z A;  4JBM A;  4IUV A;  3GV3 A;  1I4P A;  3RMH A;  4DV4 L;  3PGZ A;  4JVZ A;  1T5E A;  2EXZ A;  1UE6 A;  2NN6 I;  5IE8 A;  3KOJ A;  3NWT A;  2LXK A;  2Z1C A;  3EBE A;  1PH4 A;  4F7X A;  2JA6 H;  4YIJ A;  1DCZ A;  4NKL A;  1WOC A;  1NBW A;  5JPN C;  2MFI A;  4JI5 Q;  2WAQ E;  3RR5 A;  4K8J A;  5JVG 3;  1STA A;  3S2D B;  1ESF A;  1U9R A;  3ERQ A;  5EBD A;  2EXD A;  1IBL L;  1TWH B;  1X3E A;  1XYI A;  5COY A;  3M9B A;  2YTY A;  4KK7 A;  5JJK A;  1HTL D;  1QVC A;  4C3H G;  3M85 A;  3PO2 B;  3NUC A;  2AWO A;  4QGU A;  1HNZ L;  1E1T A;  2Y0S E;  1DZ1 A;  2AWN A;  2SNS A;  2RA4 A;  4JI2 L;  1UNS A;  1ET6 A;  4DFA A;  1YHQ A;  3RN5 A;  2F3I A;  3F2U A;  1TS4 A;  4HCS A;  3P1H A;  1KLG D;  3D3R A;  2Q8I B;  2F4I A;  3L9A X;  2NWG A;  2ZJR A;  2EYF A;  3CP0 A;  3K0X A;  1STE A;  1BF4 A;  3KLS A;  5COR A;  3J7A V;  2VNU D;  2CH4 A;  2EY2 A;  4UAI A;  2EJF C;  2D2C C;  1PH9 A;  1VQA A;  2E2D C;  2OCE A;  2QW7 A;  2B2Y A;  4RG1 A;  5JJZ A;  2B2W C;  3D4W A;  4BY1 H;  2F0N A;  1VQ9 A;  3ZYY X;  2UUB L;  3GTQ H;  1QUQ A;  4EVO A;  4PNY A;  2NB0 A;  4LF8 Q;  1GUG A;  2CFM A;  2MJ8 A;  4BBS B;  4L6T B;  1KDC A;  1IYJ B;  1SLJ A;  2NZ1 D;  5EKK A;  3UE0 A;  5C0X I;  2JA7 G;  3VYS A;  4L5R C;  5E1F A;  1BCP B;  5C4J B;  3QIA A;  2IWH A;  2CVR A;  3VR2 A;  2E5L Q;  1LAC A;  1JMC A;  3GD7 A;  5FKA C;  2PYK A;  1E2Z A;  4KHP L;  2J0T D;  4ZAI A;  4IJL A;  4DV1 Q;  1JIC A;  1HPC A;  3HZX A;  1HZC A;  1I50 H;  1LTL A;  3OWE B;  3RUZ A;  3H3V H;  3GTL B;  1DOM A;  3HG9 A;  5G3L D;  1K3R A;  2YYZ A;  3E0J A;  3GTG H;  3ER0 A;  3L3O C;  3T16 A;  4C1N I;  3KUP A;  4RWS C;  2RDF A;  4KLK A;  4UY8 C;  4A3M B;  1TS5 A;  3K5N A;  1XPR A;  3DHQ A;  3OMG A;  4DA2 A;  1NE3 A;  2DY8 A;  3S17 B;  4NW2 A;  5CMD A;  1Y8N B;  1BQQ T;  2BH2 A;  4PV1 C;  5CBE E;  1NTG A;  2F0P A;  1JE5 A;  4RH6 A;  3HKS A;  4DR5 Q;  2WKD A;  2VZA A;  4DXF A;  2E74 C;  3D0F A;  3A5U A;  2OXP A;  4KY7 A;  2R61 A;  4A3K G;  5KRU A;  2F0J A;  2M2L A;  1KLU D;  5ELN A;  4JI1 L;  4K5W A;  1EY4 A;  1VQL A;  1IBK L;  5LL6 X;  3DXJ C;  2F0K A;  3T13 A;  5BN5 A;  1S4Z A;  4IFD J;  4GS3 A;  3VR5 A;  1VQP A;  4R4C A;  2DNC A;  4A3L H;  4IUP A;  3WOE A;  4KY6 A;  5EPJ A;  1VF7 A;  4K5V A;  3JC6 6;  4RKB A;  1TWF H;  1N34 Q;  2N49 A;  5M3M G;  1PYS B;  4K8I A;  4A3I B;  2A69 D;  3TRZ A;  1WYD A;  4CBV A;  3E0E A;  4A3J H;  4IFD H;  2R93 G;  5M3F B;  1A63 A;  1WTV A;  1HNW L;  1IHZ A;  1FL0 A;  1TKW B;  3HEJ A;  4RCN A;  2YU9 H;  1SAP A;  5M3M H;  1S3O A;  1TWH H;  1QJO A;  3DM1 A;  4K2L A;  2J7Z A;  2G9D A;  2C35 B;  2B2U A;  2AMC B;  1Z9F A;  1HR0 Q;  1FJG Q;  1ZKO A;  3M4P A;  1RL2 A;  3DWP A;  2EIF A;  3BG3 A;  2OF1 A;  4RKL A;  3CCQ A;  1AEX A;  1EY9 A;  4AQY L;  2ZT9 C;  2UUA L;  5IGC A;  4GKJ Q;  1QOH A;  2ASB A;  2KCM A;  2IT1 A;  4UP9 A;  1L0X B;  1Y1V G;  2FIN B;  2EQS A;  2HDL A;  3S1N H;  3RN2 A;  2B29 A;  1D2B A;  1L2F A;  4IUT A;  1YJW A;  1TS2 A;  2NVT B;  1F2M A;  3CCL A;  4CJ2 C;  4OO1 G;  5D65 A;  1O7L A;  1B8A A;  3J81 c;  2RSO A;  2EYJ A;  4ID6 A;  3UDI A;  2ZM6 L;  3T1H Q;  1PH7 A;  4OHJ A;  4LF6 Q;  1DON A;  4B3S L;  1D8L A;  3KLR A;  1DOK A;  1STH A;  1HA5 A;  3EFX D;  2A6H D;  1SRO A;  2IW3 A;  1EQQ A;  3ULL A;  1VMC A;  2BCO A;  3J80 L;  3E6Z X;  1CHQ D;  2F0O A;  1KDA A;  2RQX A;  4HTH A;  1TY2 A;  1SN8 A;  2ALY B;  2JEB I;  3PUW A;  4G7H C;  4R9W A;  4B3M Q;  1LUZ A;  4KHZ A;  4BBS H;  2BOS A;  2I0Q A;  1GUS A;  1QVF A;  1SNQ A;  4ZQ3 A;  3OTO L;  1EIF A;  1I6H B;  2L15 A;  1X55 A;  1ILQ A;  2C9O A;  1LM0 A;  1Y8P B;  1OXV A;  5C0X J;  5IIF A;  3VDY A;  2JA8 H;  1XNR L;  4K14 A;  1HTP A;  1TWC B;  2RHS B;  4DV4 Q;  4R4Q A;  1X54 A;  1PRT F;  3U58 A;  5IT9 E;  1PH1 A;  2ENB A;  3CC2 A;  1K8G A;  4ME3 A;  4A3G G;  1U4R A;  1VQH A;  2KHI A;  1V9P A;  4DAP A;  4A93 G;  4IOC A;  4DK3 C;  2NVX H;  4WJW A;  3ITP A;  1YHB A;  2XGT A;  1Y8O B;  4JI5 L;  1QNU A;  1ENC A;  4HCE A;  1OTC A;  3F2B A;  1LV9 A;  4FF3 A;  1D6E C;  3HFZ B;  3CW2 C;  2XWJ B;  4A3G B;  4EQN A;  4YCU A;  1IBL Q;  2BH8 A;  3NE5 B;  2H4O A;  5FK9 C;  1S72 A;  1BUV T;  4HR7 B;  2K04 A;  1KHI A;  3SR1 A;  1O7Y A;  1VMP A;  1Y1W H;  2B39 A;  2VY3 A;  4FO2 A;  5IT9 L;  5IP9 H;  4JG2 A;  5HUR A;  3TP6 A;  3URY A;  5GQO A;  4X66 L;  4A3B G;  1YZ6 A;  4KD4 A;  4OON A;  4KJO A;  5EBC A;  3CCE A;  4OEL B;  4NXM L;  1EY5 A;  4B9W A;  1QG7 A;  2EVB A;  3S14 H;  3KBG A;  3NEL A;  1H9S A;  1YNN C;  2B2V A;  1X32 A;  1PTO D;  2JA6 B;  3M4Y A; 
#chains in the Genus database with same CATH homology
 1TWG H;  2WP8 J;  2E2I H;  3KFU A;  3CMA A;  4LFB L;  1B7Y B;  2GVB A;  4DR2 Q;  1VQ8 A;  3K7U C;  1KIX A;  2OQ0 A;  2R92 H;  5GAH C;  2OWO A;  3I4N G;  3SGI A;  2B3G A;  1GVP A;  1XJV A;  3I4M H;  1PH3 A;  3CC4 A;  4DV3 L;  4DR4 L;  1CKO A;  1T9H A;  2VQF Q;  1NMG A;  4JC0 A;  1XTD A;  4UPA A;  4DV5 L;  4LFA L;  4A3L G;  1UWV A;  4A4I A;  4AYB E;  2UUB Q;  4HID A;  1YJN A;  3BJU A;  3EIV A;  3BU2 A;  2OTL A;  3GTO H;  2UXC Q;  5FLM H;  3GO5 A;  5HGQ A;  1IBM L;  3PO2 G;  3H0G G;  1QVG A;  4LF8 L;  1EYG A;  2D62 A;  3J7A 5;  2NVQ H;  4A3C H;  3CCS A;  1MJE A;  1IL2 A;  5IYC G;  1NMF A;  1C9O A;  1IXR A;  1A62 A;  2HQL A;  1X65 A;  2B63 G;  1HR0 L;  1FJG L;  4DUZ L;  1ASZ A;  5C4X G;  4BA1 I;  2HHH L;  2VW9 A;  2E5L L;  4JCV E;  1RIP A;  4DV2 Q;  4L5S A;  4WJ4 A;  1YIJ A;  2BA1 A;  4PZ7 A;  1WI5 A;  5IYC H;  2CCZ A;  4MTN A;  4YCW A;  3W1G A;  1X3F A;  4DV1 L;  1GKH A;  5IWA L;  1XMO L;  1A8V A;  3AQQ A;  3PUZ A;  1I6H H;  1N8R C;  4QL5 A;  5E7N A;  3J7Z C;  2A8V A;  3AFP A;  2I5M X;  3T1Y Q;  3F1Z A;  4XTC S;  4DNI A;  5GAE C;  4DV0 Q;  4DV7 Q;  1EQR A;  3HOZ H;  4BY7 H;  4GN4 B;  4WJ3 M;  4C3I H;  1OXU A;  4NXN Q;  4PG3 A;  4YWK A;  4LF5 Q;  2ZTE A;  1CSQ A;  2A19 A;  2N8N A;  3CQZ H;  1PV4 A;  3S1Q H;  1S40 A;  4A3C G;  3ERS X;  4O0A A;  3I4M G;  1VQO A;  1CUK A;  4K0K L;  2R92 G;  1UEB A;  2LXJ A;  2ZJQ A;  4EX5 A;  4OXP A;  3GTL H;  1PH6 A;  4HJ8 A;  3CPF A;  3PIP A;  1J5E L;  2JEA I;  2VL6 A;  1I5F A;  4B3S Q;  4GOP A;  2F4V Q;  1YNX A;  1N36 Q;  4Y7N H;  4A3M H;  5FJ8 H;  1N33 Q;  4JYA L;  3HOW H;  1N9W A;  1VQC A;  1WCM G;  4NB3 A;  4HIK A;  1PA6 A;  1E22 A;  1XMQ Q;  3GTJ H;  1LYL A;  1UE1 A;  2IX1 A;  1JJG A;  1KXL A;  1Q1B A;  5C3E H;  1G51 A;  4GLV B;  1KD1 C;  1WJJ A;  4JI1 Q;  2NZO A;  5C44 G;  1X56 A;  2K5V A;  3DM3 A;  3NEM A;  1KAW A;  1L1O A;  1E24 A;  1Q1E A;  1WFQ A;  3CCM A;  2CWP A;  1L1O B;  1QZH A;  2R93 H;  2Q2T A;  1MIU A;  1Z47 A;  1JT8 A;  4R4T A;  4P74 A;  5FLX c;  3W1B A;  3AFQ A;  1VQE A;  4AYB G;  3HOX G;  4POG A;  1GO3 E;  1TWC H;  3OTO Q;  3B6Y A;  1E3P A;  4A3F G;  2IY5 B;  3UDF A;  2HIX A;  5LMU L;  3I55 A;  1AE3 A;  4GNX B;  4A75 A;  2VUM G;  3L0O A;  1CKN A;  4B3T L;  2UUC L;  4JI3 L;  4JBM A;  4DR1 Q;  4DUY Q;  1W3S A;  2UXD L;  4DV4 L;  1N34 L;  3PGZ A;  3KJO A;  2OTJ A;  3K80 C;  5BR8 Q;  3RZO H;  4QJF A;  3H0G H;  1BVS A;  4BXX H;  1UE6 A;  2CWA A;  2FXQ A;  2NN6 I;  5IE8 A;  5IYB H;  3KOJ A;  1Y14 B;  2MQH A;  5FLM G;  2RF4 A;  2LXK A;  4APV A;  3EBE A;  3RNU A;  1PH4 A;  3FHW A;  4JI4 L;  2JA6 H;  1XPU A;  4IPC A;  5LMN Q;  4JI6 Q;  2K50 A;  1QUQ B;  1WOC A;  3CC7 A;  2JA5 G;  1NBW A;  3S24 A;  1HNW Q;  2MFI A;  4A3G H;  4JI5 Q;  4P73 A;  2WAQ E;  3PSI A;  3RR5 A;  4YY3 L;  1GM5 A;  3J80 i;  4LF9 L;  1X6O A;  1G29 1;  1HZB A;  3I4N H;  1OXS C;  3KF6 A;  2MNA A;  1PH2 A;  3KDF A;  3HOV G;  1VCI A;  3G48 A;  2JA8 G;  4DK6 C;  3CD6 A;  2EXD A;  4IJH A;  4JI0 L;  4LF4 Q;  2HT1 A;  1FGU A;  1IBL L;  4LFC Q;  1PYB A;  3ICE A;  4JI8 L;  1X3E A;  3CCV A;  4HJ7 A;  4AQY Q;  3A74 A;  3JAM i;  2UUA Q;  3HOU G;  1M90 C;  4A3D H;  4JV5 L;  4GKJ L;  3M9B A;  1VQF A;  2YTY A;  1KRS A;  3NEN A;  2PNH A;  4YHH Q;  2E2H H;  5JJK A;  4OX9 Q;  1I94 L;  1QVC A;  4HIM A;  1W2B A;  2GN5 A;  5C0X G;  5IP7 G;  3M85 A;  4DKA C;  2D0P A;  3E9I A;  1YHA A;  2AWO A;  4QGU A;  1HNZ L;  1E1T A;  2Y0S E;  2VQE L;  2AWN A;  2JE6 I;  4X65 L;  3I56 A;  1MKH A;  4JI2 L;  4LF7 Q;  3S1M H;  1Q86 C;  1KC8 C;  1YHQ A;  1U5K A;  3IRB A;  4JOI C;  1HZ9 A;  1YBY A;  2MO0 A;  4LUO A;  3D31 A;  3W5O A;  5IP9 G;  1CSP A;  5IT9 c;  2QA4 A;  4PZ8 A;  3K8A A;  3RN5 A;  4JI7 Q;  2F3I A;  1XNQ L;  4X64 L;  1VQ4 A;  4BA2 I;  3KJP A;  4MZ9 A;  4XIG S;  4EQ5 A;  2IX0 A;  2ZM6 Q;  1PH5 A;  2NN6 G;  3PUV A;  3J80 c;  2MO1 A;  3J81 i;  3DLL A;  4X62 L;  2ZJR A;  1KL9 A;  3F2C A;  3CP0 A;  4HJ9 A;  3T1H L;  3K0X A;  5M3F G;  2UU9 L;  4LF6 L;  3RLN A;  1QZG A;  2NVT H;  1HNX Q;  4GKK L;  4B3R Q;  1SFO H;  4QY7 A;  4YWM A;  3NBH B;  4BBR G;  3TS0 A;  2XTI A;  3GTK H;  1YEZ A;  3HOV H;  4BXX G;  4OWT B;  2YTV A;  4A3I G;  2VNU D;  3ULP A;  1VQN A;  1PH9 A;  4DV3 Q;  1VQA A;  1EIY B;  4DR4 Q;  4B3M L;  2OCE A;  2VQF L;  4RG1 A;  1HZA A;  4BY1 H;  1VQ9 A;  2UUB L;  1UE7 A;  1CKM A;  4IPG A;  1QUQ A;  3GTQ H;  1AE2 A;  1EUJ A;  1V1Q A;  1J6Q A;  1Q7Y C;  1NJI C;  4LF8 Q;  4GOP C;  1B70 B;  5ELO A;  2CFM A;  3CAM A;  2QGQ A;  3F2D A;  2IHF A;  1IYJ B;  2NVY H;  1SLJ A;  4GNX C;  1DGS A;  3UE0 A;  1SRU A;  5C0X I;  4LWC A;  2JA7 G;  4L5R C;  4GN3 B;  4IOA A;  4DAY B;  3PO3 G;  3CCU A;  3S1R H;  2E5L Q;  3OYY A;  1XNR Q;  4DV2 L;  3TEH B;  1VQD A;  1Y1V H;  2K5H A;  3GD7 A;  1OXX K;  1JMC A;  5AJ3 Q;  5DLQ E;  2LSS A;  4DAM A;  4KHP L;  1K9M C;  4AH6 A;  3U4V A;  4IJL A;  4DV1 Q;  1WCM H;  1XMO Q;  2WB1 G;  2Z6K C;  2KBN A;  4A3M G;  1EOV A;  1HZC A;  4DR6 Q;  2QEX A;  3CME A;  1I50 H;  1LTL A;  3T1Y L;  3H3V H;  1L0W A;  4DV0 L;  4DV7 L;  1E1O A;  4GN5 A;  3G71 A;  3G6E A;  1K3R A;  2YYZ A;  3GTG H;  4DPG A;  4ALP A;  3ER0 A;  3HKZ E;  5IY0 A;  4UP7 A;  1X3G A;  4DV6 Q;  4KLK A;  4TVA B;  3STB D;  2Y0S G;  1C0A A;  4UY8 C;  4AIM A;  4K0K Q;  1XPR A;  2RCN A;  4IPH A;  1NE3 A;  3G4S A;  1VQM A;  2V1C C;  1J5E Q;  2JA6 G;  2HIV A;  3M7N A;  4A3J G;  2BH2 A;  2RHQ B;  2ZTC A;  3H15 A;  5IYB G;  1NTG A;  4X6A H;  1JE5 A;  1BBU A;  3HKS A;  3KF8 B;  4DR5 Q;  1N33 L;  1VQ6 A;  3PUX A;  4A3E H;  4JYA Q;  2VZA A;  3PF4 A;  4OO1 I;  1XMQ L;  3CPW A;  1OXT A;  4NPS A;  3D0F A;  3A5U A;  4HIO A;  2IHE A;  4POF A;  2UXD Q;  1SR3 A;  4A3K G;  4H02 A;  4X66 Q;  1A0I A;  3FKI G;  1PH8 A;  3K81 C;  4OWX B;  2VUM H;  4DR7 L;  3UE1 A;  5C4X H;  5ELN A;  4JI1 L;  1HNX L;  1VQ7 A;  2Z6K A;  1N32 L;  5GAD C;  1VQL A;  2K14 A;  1MJC A;  3KYH C;  1IBK L;  3PV0 A;  4NXM Q;  2ES2 A;  2DGY A;  4IFD J;  2BA0 A;  2UXB Q;  1VS0 A;  3GDE A;  4GS3 A;  4A3E G;  4C2M H;  1VQP A;  4DR3 Q;  1UE5 A;  1Y1W G;  1AH9 A;  3PO2 H;  3Q8D A;  4PZ6 A;  2WAQ G;  3CCJ A;  1I3Q H;  4R4C A;  2D0O A;  4A3L H;  4LFB Q;  1HH2 P;  3FKI H;  4DR2 L;  2N78 A;  5HY6 A;  4B3T Q;  2R7F A;  1KRT A;  1CKN B;  2UUC Q;  4YCV A;  1K0R A;  2PI2 E;  2K4K A;  2ZJP A;  4UP8 A;  3JC6 6;  4HJA A;  1TWF H;  3UDG A;  1N34 Q;  2N49 A;  2PQA B;  5M3M G;  1PYS B;  2R6G A;  3WWV A;  5FJ8 G;  1WYD A;  3TRZ A;  1D7Q A;  4L5Q A;  4JI4 Q;  5M5Y H;  4LFA Q;  3E0E A;  4DV5 Q;  4IFD G;  4A3J H;  2JJQ A;  3BZK A;  1Q82 C;  5LMN L;  2R93 G;  1A63 A;  1Q81 C;  1IBM Q;  1HNW L;  4RMF A;  1PVO A;  1FL0 A;  2JA9 A;  1NY4 A;  2YU9 H;  2KCT A;  4P72 A;  5M3M H;  5IYD G;  3CXC A;  1S3O A;  1TWH H;  3U4Z A;  4YY3 Q;  4HJ5 A;  4LF9 Q;  3S15 H;  1YIT A;  1JJC B;  4BBS G;  2C35 B;  2AMC B;  1Z9F A;  1HR0 Q;  4DUZ Q;  1FJG Q;  4A3B H;  2E8G A;  2HHH Q;  3M4P A;  1O7I A;  4JI0 Q;  3HOZ G;  1RL2 A;  4BY7 G;  2PMZ E;  2EIF A;  1YJ9 A;  4JOI A;  3CCQ A;  2R7D A;  4AQY L;  4GOP B;  2E2J H;  2UUA L;  5GAG C;  4GKJ Q;  5IWA Q;  2ASB A;  2KCM A;  2IT1 A;  2Z0S A;  1BBW A;  4UP9 A;  3U50 C;  4OX9 L;  3TQY A;  4R4I A;  1Y1V G;  4A3D G;  3HOU H;  1GD7 A;  5C4J H;  4O2D A;  2NZH A;  4PMW A;  3S2H H;  2EQS A;  4LUV A;  1M1K C;  2B63 H;  1HNZ Q;  2UXC L;  4GNX A;  3S1N H;  2CQO A;  4NXN L;  3RN2 A;  4JI2 Q;  4A3K H;  2B29 A;  4LW1 A;  4LF5 L;  3L2P A;  4R4O A;  1L2F A;  1YJW A;  3BZC A;  2WFW A;  3MEF A;  3S16 H;  2K5N A;  3CCL A;  1XNQ Q;  2ZTD A;  2K75 A;  1VQJ A;  5JEA J;  4OO1 G;  3TS2 A;  3RLF A;  5K36 G;  4J15 A;  2A1A A;  5M5X H;  1B8A A;  1TXY A;  4P71 A;  4R1J A;  3J81 c;  3CF5 A;  2ZM6 L;  3UDI A;  5GRO A;  4X62 Q;  4LUZ A;  5M5W H;  3T1H Q;  1PH7 A;  4LF6 Q;  1VQG A;  4B3S L;  1D8L A;  3PUY A;  2F4V L;  1JB7 A;  4GKK Q;  1N36 L;  4B3R L;  1KQS A;  1V43 A;  1U0L A;  1SRO A;  1EQQ A;  3ULL A;  1X9N A;  3PF5 A;  1C7Y A;  1YVC A;  3F8T A;  4C3J H;  1VQB A;  3M3Y H;  2PQA A;  1EWI A;  5H1S E;  1Q8K A;  3RZD H;  4QIW E;  1SN8 A;  2ALY B;  2JEB I;  3PUW A;  4JBJ A;  5EAY A;  4B3M Q;  1LUZ A;  4JBK A;  4KHZ A;  3S17 H;  3E9H A;  4BBS H;  3A5Z B;  2I0Q A;  3LGJ A;  2WB1 E;  4A93 H;  2ATW A;  1TWA H;  3EN2 A;  1YI2 A;  3L7Z C;  3OW2 A;  1QVF A;  3H3V I;  1H95 A;  4TQU S;  5LMN W;  2JA5 H;  4L5T A;  1SE8 A;  2JQO A;  2YV5 A;  3PCO B;  3OTO L;  1EIF A;  2L15 A;  1PFS A;  5J3B A;  3HKZ G;  3UDX A;  1X55 A;  2CKZ B;  3KDF B;  3FP9 A;  5LMU Q;  1JJ2 A;  5JEA G;  2AHO B;  3HOY H;  3PO3 H;  1LM0 A;  2K52 A;  5C0X J;  1OXV A;  5C44 H;  2JA7 H;  3VDY A;  1VQK A;  4JI3 Q;  3HOY G;  2Q2U A;  2DUD A;  4DR1 L;  2JA8 H;  2VS1 A;  5IP7 H;  1XNR L;  4DUY L;  2Q2H A;  2GVA A;  2RHS B;  5AJ3 L;  4R4Q A;  4DV4 Q;  1SMX A;  1X54 A;  3M4Q A;  3U58 A;  1K83 H;  1PH1 A;  4KHP Q;  2OQK A;  4P75 A;  5BR8 L;  3TRE A;  2JK8 A;  1R9T H;  1K73 C;  3CC2 A;  4QQB X;  1K8G A;  3HOW G;  4ME3 A;  4A3G G;  1VQH A;  2KHI A;  4KI0 A;  1V9P A;  4MNO A;  1G6P A;  4DR6 L;  4A93 G;  4IOC A;  1VQI A;  4BY1 G;  4JI6 L;  4DK3 C;  1ASY A;  2NVX H;  3A0J A;  1YHB A;  2H5X A;  2XGT A;  5JJI A;  4JI5 L;  4FDB A;  4GLX A;  2R7Z G;  3GTM H;  1OTC A;  2AKW B;  4JBW A;  3F2B A;  4DV6 L;  3KF6 B;  4A3I H;  3PIO A;  1HR0 W;  3HFZ B;  2R7Z H;  4GLA C;  4BBR H;  3CW2 C;  1L1O C;  3I7F A;  3STB C;  1VQ5 A;  2ID0 A;  4LF4 L;  3I4O A;  1XPO A;  2F52 A;  4YCU A;  5M3F H;  3RLO A;  4LFC L;  1FVI A;  2BH8 A;  1IBL Q;  4JI8 Q;  3ZJY C;  2PI2 A;  4IPD A;  4JV5 Q;  3KLW A;  1S72 A;  1KHI A;  4LNQ A;  4DR5 L;  1Y1W H;  3AEV A;  3S2D H;  1K8A C;  4YHH L;  2VY3 A;  1I94 Q;  4IO9 A;  5IP9 H;  4OWW B;  4JG2 A;  3AYH B;  1PHJ A;  1IZ6 A;  1Q12 A;  5GQO A;  2KHJ A;  4X66 L;  5JJL A;  3MXN B;  2VQE Q;  4LF7 L;  4DR7 Q;  4X65 Q;  4A3B G;  1YZ6 A;  3I2Z A;  4OON A;  3J81 j;  1Q46 A;  1P8L A;  5C3E G;  4A3F H;  3K7A H;  4C3H H;  1N32 Q;  3JAM c;  4JI7 L;  1IBK Q;  3CCE A;  2N3S A;  4X64 Q;  4A76 A;  4NXM L;  3HOX H;  3CCR A;  4YWL A;  3M4O H;  2UXB L;  5IYD H;  1E7Z A;  4IFD I;  1EFW A;  1HJP A;  2YTX A;  4DR3 L;  3NEL A;  3S14 H;  4Y52 H;  2Q2I A;  1P16 A;  3ULJ A;  2UU9 Q;  1BKB A;  3GTP H;  2KEN A;  2I5H A;  2I5L X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...