5M5XH

Rna polymerase i elongation complex 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
134
Chain Sequence
b'NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
molecule tags Transcription
publication title Molecular Structures of Transcribing RNA Polymerase I.
pubmed doi rcsb
total genus 17
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m5xH00
4HIKA 3TS0A 1C9OA 5ELNA 4A3IG 1PH6A 4UPAA 4BBRG 2ATWA 4JI7L 4GKJQ 3CQZH 2KCMA 2UUBQ 4KLKA 1JJGA 1VQPA 2JA5G 2JA9A 2OCEA 4GS3A 3CXCA 3F2DA 3W1GA 5FLXc 3RZOH 3TS2A 2A19A 2DGYA 3S14H 1Y1WG 4IPHA 3FP9A 4JC0A 1X55A 2WB1E 5C44G 1VQAA 1VQNA 4HJ5A 5M3MH 3J7ZC 1NJIC 3CCJA 1CKMA 1D7QA 2PMZE 5IWAL 1I5FA 3Q8DA 4P75A 4DPGA 4C2MH 3FKIG 3GTKH 1G6PA 1EQRA 1T9HA 2D0PA 2I5MX 4GLXA 1XMQQ 3UDGA 2Y0SG 5LMNL 1GM5A 1K8GA 1IBKL 2R7ZH 1KRTA 3HKZG 3PO2G 3PO3H 1I94Q 1KRSA 4BBSG 4JI0Q 4AYBE 1E1OA 3KYHC 4J15A 4MZ9A 1PFSA 5GAEC 4QJFA 1MJEA 2AWNA 4A3LH 4LF4Q 1W3SA 3HOYH 3S16H 3SGIA 3ERSX 2UXBQ 3D31A 3PSIA 3U58A 1S3OA 2Z0SA 3M4QA 1VQ8A 3S1QH 4DV5L 1VQ9A 2UXDQ 4LUOA 2OWOA 3I4MH 1XJVA 1OXXK 1YEZA 5C0XG 1VQCA 1PH4A 1HNZQ 1HR0W 4JYAQ 1A63A 4IFDJ 1XMOL 4BY7G 3OW2A 1VQJA 4L5SA 4A3BH 4LNQA 1VQGA 5IYBG 4OXPA 4OWWB 4LF7Q 2RF4A 1UE7A 4LFAQ 4JI1L 4DNIA 4P71A 2BA0A 2WAQG 3BZCA 2R92G 3JC66 1YIJA 1E3PA 5JJLA 3ER0A 4BA1I 4A3JG 1XMQL 2ASBA 2JA8G 5IP7G 4EQ5A 5C0XI 1EQQA 2UUCQ 2VQFL 1M1KC 2F4VL 4HIMA 2E5LQ 2JA5H 5C4XH 5BR8L 1OTCA 4C3HH 2N3SA 2ZTCA 2KENA 5IT9c 2K75A 3ICEA 4APVA 5JEAG 5FJ8G 4LF6L 5HGQA 1OXUA 4OWXB 2R7ZG 1A62A 1LUZA 5EAYA 4JCVE 4DV0Q 4DR3L 4GNXC 4YWKA 1VQ6A 1M90C 3PUVA 2XGTA 1V43A 3I4OA 1LM0A 5AJ3Q 1D8LA 2K4KA 3MEFA 3JAMc 5IP9G 4GKKQ 3PUYA 5IY0A 2Q2HA 3F1ZA 1J5EL 3D0FA 3KLWA 4JOIA 1E22A 4NXMQ 1PH2A 3HOVG 2EXDA 1N34L 4IJLA 4YCWA 4B3RQ 3J81i 1P8LA 4LWCA 4A3MG 2I0QA 1QUQB 4DR4Q 2JQOA 3RR5A 1X3GA 2UU9L 3KFUA 1PV4A 5M3MG 1SROA 2ZJQA 1TWCH 1EYGA 1NBWA 4UP7A 4IPGA 4DR7L 1K0RA 3G71A 1G291 3W1BA 3CCEA 2ES2A 3U50C 5IYCH 1IL2A 5C3EH 3K0XA 1Q81C 4B3SQ 4DV3L 4A3MH 3CMAA 4NXML 2R93H 1RIPA 3A74A 4JBJA 4AH6A 1WJJA 3UE1A 2OQKA 4B3SL 2UXBL 4GNXA 1PH5A 3CCQA 1YHBA 2WFWA 2JA7H 1JT8A 3GD7A 1K83H 1J6QA 1IBML 2K52A 3RLNA 4JI0L 5GROA 4LUVA 3H0GG 1YJWA 1YHAA 1YHQA 1X6OA 2IHEA 3CW2C 5DLQE 4DAMA 3H3VI 3UDIA 4PMWA 4DR4L 1GO3E 1N33L 1HZ9A 2E5LL 5IYBH 4A3IH 4A76A 1SFOH 2B3GA 3PF4A 4LF8L 2NN6G 3NENA 1KAWA 1Y14B 3NBHB 3FKIH 1IXRA 4YY3Q 2IY5B 4IOCA 1AE3A 4GKJL 1IBMQ 4JV5Q 4YHHL 1SR3A 4A3FH 2R92H 1KC8C 2NVYH 5ELOA 1UE1A 4L5RC 3G6EA 4IPCA 1FGUA 2AHOB 5J3BA 5C4XG 4AQYL 1X3EA 3E9HA 4DV0L 1HJPA 1LYLA 3G48A 3PO3G 3PO2H 2VUMG 1VQOA 3M9BA 1VQHA 4Y7NH 3RN2A 1Q46A 3GO5A 2UXDL 1WYDA 2HHHQ 2JEAI 3AQQA 1AE2A 4DR5Q 4OONA 1IYJB 1OXVA 1G51A 2R6GA 4P73A 1VQMA 1X9NA 4JI4L 4LF5Q 2GVAA 4GLVB 1Y1WH 1SLJA 4IPDA 1Q7YC 1I3QH 4BA2I 3J7A5 4B3RL 5K36G 1P16A 2CWPA 4QY7A 4YCUA 4KHPQ 4LFCL 1K73C 2LXJA 3RNUA 2BA1A 2HHHL 2JA8H 1RL2A 3M4OH 4A3GG 3I56A 1EIYB 4A3EH 3HOZG 2NVXH 1SN8A 2Q2TA 2CQOA 4R4QA 3KF8B 4P72A 4A3JH 1XNQQ 2OTJA 3KF6A 1WCMH 4YWMA 5FJ8H 3HKZE 1I50H 1N9WA 4GNXB 1GVPA 1S72A 4POGA 1NTGA 4BBSH 1N8RC 4LF9Q 2IT1A 2YTXA 3HFZB 4A3DH 4JV5L 1SMXA 4XIGS 5HY6A 4POFA 1E24A 3KDFA 2YYZA 3K81C 3TQYA 4LF4L 1TXYA 1VCIA 4X64Q 4K0KL 2GN5A 1L1OC 5LMNQ 1JJCB 2NZOA 3CCMA 5C44H 2V1CC 1IBKQ 2VY3A 1VQFA 4DV6Q 4DV7Q 1TWHH 2LSSA 3BZKA 3PUZA 2QA4A 3U4VA 4NXNL 5FLMH 4GN5A 2ZM6Q 1N32L 3AYHB 4WJ3M 1XNRL 3J81c 3GTLH 1X54A 3STBC 3CAMA 1C0AA 4X65L 1JMCA 3F2CA 3GTJH 2ZM6L 2K50A 3PUWA 1XMOQ 4PG3A 1HNXQ 1PYBA 4NXNQ 2NVQH 4JYAL 3S1NH 4JI6L 4X66L 4DV6L 5LMUL 1BVSA 4DV7L 3PIPA 2KBNA 1PA6A 1VQ7A 1VQDA 2VZAA 3TEHB 4R4OA 4YCVA 4A3EG 4DR6Q 2N49A 4C3IH 2EIFA 4B3MQ 1FJGQ 1PVOA 2VQEQ 3VDYA 4JBMA 3KJPA 2ZJRA 1NE3A 2Z6KA 3ZJYC 4DV2Q 3S1RH 3CPFA 3TREA 1NMFA 1I94L 2R93G 3RZDH 4JI3Q 4OX9Q 4JI5L 1SRUA 4NPSA 3JAMi 3HOUG 4LF5L 4LF7L 2AKWB 1XPRA 4DAYB 2H5XA 3UDXA 4B3TL 2PI2A 2QEXA 3PV0A 1Q12A 1HNZL 4JI8L 4EX5A 1VQIA 4DR6L 1WOCA 1KIXA 5C0XJ 4OWTB 1VQBA 4IFDG 5GQOA 1X65A 3A0JA 4GOPA 2MO0A 3S15H 4P74A 1HZBA 2KHIA 4GOPC 1E7ZA 3CF5A 4GOPB 1K8AC 1A8VA 2BH8A 5IYDG 4Y52H 3T1YQ 2ZTEA 3KJOA 3S17H 4UP9A 3I4NG 4AIMA 2A8VA 4YY3L 4JBWA 1XNRQ 3K7UC 3ULPA 4LUZA 4LF6Q 4JI8Q 1BBWA 4LW1A 4TVAB 3EN2A 4A93H 2VW9A 2XTIA 5C4JH 3HOWG 5IWAQ 2YTYA 3FHWA 3EBEA 3RLFA 2B63H 5IYDH 3BJUA 4LFBL 4DUZQ 2Z6KC 4BY1H 2PI2E 3W5OA 2MQHA 4A3BG 2A1AA 1WCMG 3STBD 1MKHA 4A3CH 2AMCB 3T1YL 4LF9L 2JJQA 3NEMA 3CPWA 1L2FA 2Q2UA 1IZ6A 3A5UA 3PCOB 1CKOA 1UE5A 1XPUA 3H15A 1XNQL 2D0OA 4DR1Q 1EUJA 4DV4Q 2YTVA 4JI2L 1MJCA 3CMEA 2WP8J 1CSPA 3M85A 4UY8C 1EIFA 1PH3A 2RHQB 4X62L 3CCRA 4ALPA 4DV5Q 2UUCL 2IHFA 2AWOA 2DUDA 1QVGA 1HZAA 1XTDA 1CKNB 2CCZA 1VS0A 1V1QA 3HOZH 2VQEL 4X62Q 4DV2L 2I5HA 2VUMH 4HJ7A 4PZ7A 1E1TA 3OTOQ 3LGJA 4DUYQ 4DR2Q 3J80i 4NB3A 1TWAH 1YNXA 2HQLA 1KQSA 5JJIA 2Q2IA 4GN3B 1O7IA 1VQEA 2Y0SE 2K5VA 1V9PA 5GAGC 1UEBA 2I5LX 4YWLA 5AJ3L 1Q8KA 1DGSA 1WI5A 4FDBA 3AFPA 1C7YA 3HOXG 4KHZA 4X65Q 2ZJPA 1BKBA 2HIXA 1U5KA 2ALYB 2MO1A 3GTPH 4A93G 3UDFA 2GVBA 4KI0A 1FVIA 2R7DA 3EIVA 1HR0L 2UUBL 5GAHC 4JI5Q 3K7AH 1LTLA 4OO1I 1PYSB 1U0LA 1Y1VH 1N32Q 4BY1G 1PH7A 1A0IA 1FL0A 3HOXH 2PNHA 4KHPL 1N34Q 3M3YH 4LF8Q 1SE8A 2WAQE 3T1HL 1K3RA 2YV5A 2F4VQ 2NVTH 2JE6I 2PQAA 4A3KH 3A5ZB 3AEVA 2RCNA 1Q82C 3K8AA 2IX1A 4K0KQ 4TQUS 1Y1VG 1HH2P 2R7FA 4XTCS 1HR0Q 1KXLA 1EFWA 2N78A 3MXNB 5GADC 1CKNA 1XPOA 1S40A 3WWVA 3CC7A 4JI1Q 4LFAL 3I4NH 1Q86C 3CP0A 4DR3Q 4A4IA 4JI7Q 1L1OB 3E0EA 1Q1BA 4MNOA 1QVCA 1N36L 4A3KG 1X56A 4R4TA 1R9TH 4LFBQ 4PZ8A 4IO9A 4AQYQ 5IE8A 2YU9H 4GN4B 5IP7H 4B3TQ 2KCTA 2L15A 1IBLL 5E7NA 5JJKA 2N8NA 3PIOA 4HJ8A 2OTLA 4GLAC 2K5HA 2VQFQ 3KF6B 4OO1G 4LFCQ 4AYBG 4JG2A 3CCVA 4X6AH 1QZHA 3I4MG 4WJ4A 4H02A 2UUAQ 3AFQA 4A3LG 4QGUA 3J81j 3CD6A 2K14A 2E8GA 4O2DA 5M5WH 4X64L 1VQ5A 1YVCA 1PH8A 2QGQA 3DM3A 3TRZA 4IJHA 4DKAC 2MFIA 4UP8A 1ASZA 3ULJA 2UXCL 3T1HQ 3S2DH 1L1OA 3CCSA 2E2HH 4DUZL 1PH9A 3GTMH 4DR5L 3OYYA 4A75A 1EOVA 3L0OA 5M3FG 2OQ0A 3H3VH 1JE5A 1Z9FA 5IP9H 3PGZA 3HOVH 2VNUD 4DV1L 1NY4A 1X3FA 5M5YH 1VQ4A 2HIVA 2KHJA 2MNAA 2JEBI 1TWFH 3HOWH 1UWVA 3CC2A 4BXXH 3L7ZC 1J5EQ 4L5TA 2B29A 1Z47A 5H1SE 3L2PA 3J80c 1GKHA 3S2HH 4ME3A 3I55A 1CUKA 4L5QA 2RHSB 2VS1A 3G4SA 1Q1EA 1HZCA 1WFQA 2CFMA 2F3IA 4MTNA 4C3JH 3CCUA 2BH2A 4A3CG 3U4ZA 3HOUH 1BBUA 3F2BA 3GDEA 2B63G 3KDFB 5C3EG 1B70B 3GTQH 1KD1C 1W2BA 2ZTDA 4JBKA 3E9IA 2WB1G 3KOJA 2EQSA 2CKZB 4HJAA 4JOIC 2JK8A 3F8TA 1L0WA 3S24A 4R4IA 2E2IH 3RLOA 2HT1A 4DR7Q 2JA6H 1KHIA 1N33Q 1KL9A 1TWGH 2NZHA 2E2JH 3M4PA 2UXCQ 4A3DG 3I2ZA 2ID0A 1NMGA 1YZ6A 4R4CA 4RG1A 4HJ9A 3S1MH 3CCLA 1EWIA 2C35B 2F52A 4B3ML 2NN6I 3B6YA 1AH9A 4YHHQ 3BU2A 4RMFA 2FXQA 3H0GH 4JI2Q 2IX0A 4DV4L 3GTGH 3GTOH 4IOAA 5LMUQ 4GKKL 4DV3Q 4R1JA 4JI6Q 1JJ2A 1K9MC 2CWAA 2D62A 2JA6G 3HOYG 4DV1Q 3OTOL 4DUYL 3IRBA 4QL5A 1CSQA 2PQAB 5LMNW 1OXSC 4DR2L 1JB7A 4DK3C 3ULLA 1N36Q 1QVFA 3M7NA 4A3GH 1PH1A 1YJ9A 1YJNA 4QQBX 1VQLA 1MIUA 3NELA 4BBRH 1HNWL 4QIWE 1QZGA 5M3FH 1QUQA 3HKSA 4JI4Q 4JI3L 5FLMG 4OX9L 1I6HH 4BY7H 3PF5A 1YBYA 1H95A 5IYCG 2UU9Q 1VQKA 1HNWQ 2K5NA 5BR8Q 1UE6A 4BXXG 4HIOA 5JEAJ 3K80C 3I7FA 4A3FG 2UUAL 1FJGL 4IFDI 3DLLA 1B8AA 4DK6C 1B7YB 1OXTA 2VL6A 3CC4A 4DR1L 1YI2A 4PZ6A 4HIDA 3PUXA 1GD7A 3UE0A 1YITA 5M5XH 4O0AA 4X66Q 3RN5A 1IBLQ 2JA7G 2LXKA 1ASYA 1HNXL 1PHJA
chains in the Genus database with same CATH superfamily
4HIKA 1C9OA 4A3IG 1PH6A 4GKJQ 1M4VA 3MAQA 3NP8A 2JA9A 2OCEA 3FP9A 4XQJA 4HJ5A 3Q8DA 1G6PA 3C1EA 2J0TD 4UHVA 1GUWA 3A8JE 3PO2G 3DWPA 4Z9CB 1I94Q 4BBSG 4AYBE 2XVSA 3FVQA 3J81E 1TWAB 5E3FA 3PSIA 1S3OA 2H4OA 2Z0SA 3M4QA 1VQ8A 3U9SA 4O1NA 3H91A 1XJVA 1YEZA 2M9VA 5M3MB 1IHZA 3W2DA 4OXPA 4H7BA 4LF7Q 1UE7A 4DNIA 1GUNA 3J80E 1EYCA 1KAAA 3T16A 2BA0A 4K8JA 3DM1A 1F9RA 2K5DA 3M7GA 4EQ5A 1LT3D 3DUZA 4DK1A 1M1KC 4JK1C 4TKOB 4HIMA 2E5LQ 5JOBA 1SMYD 4G57A 2F0NA 1TT2A 1FD7D 2KENA 1LTBD 1HFGA 4BY1B 4OWXB 1Q3LA 4FYDA 1LUZA 5DNFA 4RHRA 3SEBA 2VXWA 5AFWA 5ELEA 2A68C 2EJGC 3I4OA 1LM0A 3MEFA 3MXUA 5IP9G 1SNQA 5EPKA 4DA2A 4GZYC 3KLWA 1SNMA 4JOIA 3HOVG 1B4OA 3K5OA 1N34L 4A3MG 2PYKA 4IZ8A 2JQOA 4UP7A 4DR7L 1K0RA 1G291 5IYCH 3K0XA 4S3SA 1T5EA 2R3ZA 3FDTA 2MUYA 5KNCA 1WJJA 5K5PA 5L37A 1LTRD 1F9SA 1YHBA 5KNDA 2JA7H 1JT8A 3GTQB 1K83H 1IBML 2JA7B 2C5CA 1PRTD 4ZKCB 5GROA 1C4QA 4K6DA 1A6XA 1KDAA 2PO4A 3C1FA 3OSOA 1GO3E 1HZ9A 2E5LL 1V1OA 4A76A 5BN5A 4QCLA 2NN6G 4L6TB 1IXRA 2CW0C 1A3UA 1A3TA 2NUCA 4IOCA 4JV5Q 2O5JC 5ELCA 2A6ED 5FOBB 4XDXA 4IPCA 4AQYL 1HJPA 2DNCA 1LYLA 3PO2H 1QOHA 1BO0A 4LK1C 1VQOA 1STYA 2PZWA 1O7LA 2JEAI 2WIIB 4LF5Q 2K05A 4JVZA 3S2HB 2K5WA 4GLVB 1Y1WH 2IL8A 1SLJA 1PZJD 4PMCA 3J7A5 5K36G 2CWPA 1HUMA 4LFCL 3M4OH 5M5YB 1EIYB 5C4ZA 1TS5A 1S5ED 2IWHA 4A3JH 1CT1D 1ZYRD 1DM0B 1GVPA 3FPUB 1N8RC 1RHPA 2NTSA 2IT1A 4C3HG 1SMXA 4POFA 1TS4A 3TQYA 2YYZA 3K81C 1K0SA 3QIAA 1H9JA 2KEDA 4X64Q 3MHBA 2GN5A 2NVYB 2QF7A 1L1OC 1JJCB 3S1QB 1AFPA 5EBDA 5C44H 3L3OC 2KEEA 4DV6Q 1MHWC 2Z6BA 1TWHH 5LL6S 1QJOA 2SOBA 4KK7A 5G3LF 1XTCD 4ZQ3A 4KJOA 3GTLH 3KUPA 1AZQA 3EA6A 2JYOA 1AW7A 5KYIA 4X65L 2MJ8A 2QKIC 2NVTB 4NXNQ 1AZPA 1HNXQ 4JYAL 2NVQH 4JI6L 4DV7L 2FHTA 1BVSA 3OMCA 3R2IA 1VQ7A 1ILQA 1Y1VB 3TEHB 3MEHA 1D1KA 4A3EG 3VR2A 2VQEQ 3J7YW 4FF4A 3ERQA 1NE3A 3ZJYC 3S1RH 5E4WC 3TREA 4WFN3 1I94L 4NPSA 1AEXA 3TN2A 2AKWB 2FMMA 2EYFA 4DAYB 2H5XA 1K3BC 3UDXA 4K5WA 1LTTD 1D5ZC 1MI2A 1CZWA 2BCOA 5I6YA 5C0XJ 4OO1H 4QMGA 5CYUA 2KCCA 2MO0A 3H09A 3N52A 4XYOA 3R8BA 4P74A 4X3SA 1WVLA 3S15H 2EY6A 2X69A 4EQOA 4GOPC 4GOPB 5KGUA 1EIHA 2K6AA 1EEID 3AU7A 5IGGA 4AIMA 5CBEE 1XNRQ 1HA6A 3GTGB 3MWYW 1BR9A 2QDLA 4A93H 3QO2A 1JICA 5C4JH 1HUNA 5IWAQ 5IYDH 3BJUA 4ZAIA 4K2KA 1I4HA 5KEEA 4A3BG 1DYQA 1MKHA 2A68D 2ZXPA 2B2TA 2F3WA 3VA7A 2CH4A 2JJQA 2JP1A 1L2FA 1BF4A 1XX8A 1JOKA 4DV4Q 4JI2L 1U4RA 2WP8J 4UY8C 5D3IB 1ESRA 3QWNA 3S17B 2IHFA 2DUDA 3KLRA 1HZAA 3CRLC 1CKNB 2CHBD 4WRDA 3HOZH 4X62Q 1SE3A 2HQEA 3NPPA 4DR2Q 3LGJA 3J80i 4NB3A 3HOYB 1YNXA 4CGYB 1SNDA 5IGFA 5JJIA 2Q2IA 4GN3B 2K5VA 1HRJA 1DGSA 1YNJC 2JA6B 2H1EA 2MO1A 4EQPA 2RDFA 4F8MA 3FEWX 2ZXRA 1B50A 3K7AH 1LTLA 2VB2X 5IT9L 1FL0A 1QCBD 3MXPA 3S1NB 1SE8A 2PQAA 2JA8B 3AEVA 5T1IA 4X3UA 2A6EC 4XTCS 1HR0Q 1Y1WB 1KXLA 1EFWA 3HP3A 3MXNB 2PQEA 4JI1Q 2IPKD 1WTRA 1L1OB 4R4TA 4LFBQ 2A73B 4V190 3WOEA 4HAEA 4AQYQ 5C44B 2QDBA 1SYBA 3PIOA 2KVMA 2K5HA 2EE1A 2OF1A 3EVQA 3KF6B 3VR4A 2VQFQ 4OO1G 4X6AH 1HQRD 1QZHA 4FF1A 3I4MG 4H02A 4WJ4A 4PMBA 3J81j 1D5XC 3D3RA 3T4AC 1A2UA 4X64L 3CD6A 3CU7A 1YVCA 3MVVA 1ET9A 2M2LA 2MFIA 3TZDA 1S4ZA 3T1HQ 2NVXB 1L1OA 3GTMH 3HGBA 3OYYA 4A75A 3L0OA 2SNMA 4TRDA 1JE5A 2VNUD 5IP9H 3NTHA 2HIVA 1XWEA 3SK8A 1MSGA 5DM63 4TSSA 3I3CA 2B29A 1Z47A 4FVMA 3J80c 1GKHA 4OL7A 3NXWA 4M1UB 1Q1EA 2F3IA 4EVOA 4C3JH 2BH2A 4A3CG 3U4ZA 2B63G 5F2DA 3I90A 5EJWA 1IW7C 1GHJA 5LHY1 1PMRA 4HJAA 2JK8A 2E2IH 3P7JA 2JA6H 2NZHA 2WKDA 1JB3A 1NR4A 1XYIA 3S1MH 1EY9A 1X32A 1ILPA 1EWIA 2C35B 4F7XA 2F52A 1ZYRC 5CV8A 4B3ML 1AH9A 4YHHQ 3H0GH 3GTGH 4DXFA 3NQTA 4R1JA 4JI6Q 1TWGB 2K01A 2D62A 3NBHA 3HOYG 1OXSC 2TMPA 1JB7A 1QVFA 4CJ2C 3AB9A 3M7NA 1PH1A 1YJNA 4QQBX 3BDLA 5C3WA 2B2YC 1ZKOA 4JI4Q 1HA5A 2EJMA 1I6HH 1EIGA 3Q0AA 4ZUIA 4CDFC 1VQKA 1UE6A 1RD9D 4HIOA 2A69D 2SNSA 4HCSA 5EPJA 2F0MA 2VL6A 2KCNA 1YI2A 4PZ6A 4HIDA 3PUXA 4O0AA 1TWFB 2LXKA 4KHVA 1HNXL 2B39A 2A69C 4BBRG 2QEJC 1HXYD 2KCMA 4J8QA 4RFBA 2EPBA 4MN3A 1PRTC 2F03A 4GS3A 2XIWA 1Y1WG 2Z9HA 1X55A 1I4XA 5M3MH 1F2YA 1NUCA 1CKMA 4KY7A 4YIJA 5IWAL 2K1BA 4C2MH 1T9HA 2D0PA 5JJZA 2I5MX 1GM5A 1XMQQ 1IBKL 2R7ZH 2PZUA 1KRTA 3PO3H 1O7YA 3MTSA 4JI0Q 4RCNA 3KYHC 1PFSA 2F4IA 2KOLA 2AWNA 4LF4Q 1FNWA 2K7VA 3SGIA 4MTKA 1KDCA 2VB3X 1EY8A 2K32A 5FO8B 2ICEC 4LUOA 2OWOA 3I4MH 1OXXK 2J7ZA 1O78A 4KD3A 1PH4A 2F0OA 1U4PA 2NN6H 1WTQA 5IYBG 4OWWB 4LFAQ 1O7ZA 3Q22A 4ZK9B 1CHPD 1SYGA 1XXGA 5EBCA 2R92G 3K7AB 3ER0A 5CV4A 4BA1I 2JA8G 2F4VL 2UUCQ 3GTPB 1U4LA 5C4XH 1OTCA 4RGMA 4C3HH 2N3SA 4APVA 3ONAB 1OXUA 2BE5C 4HEDA 1PTOC 1A62A 4JCVE 4DV0Q 3I70A 5KYLA 4IUQA 2XGTA 1V43A 1EYDA 3URYA 4QUFA 4Q5VA 5IY0A 3C3LA 1VF5C 4NXMQ 5NUCA 2EXDA 3BG3A 3S14B 3OHXC 4YCWA 4B3RQ 5D3DA 2K33A 1BCPC 1SE4A 1PLFA 1EQVA 5M3MG 1EYAA 2FMCA 3U50C 2OEOA 2PNRC 5C3EH 1Q81C 2PW7A 4B3SQ 4HCEA 4DV3L 4FF3A 2R93H 1RIPA 3OIPA 4AH6A 4JBJA 3UE1A 2E2IB 4GNXA 2B63B 1PRTF 2WFWA 3GD7A 3WDNA 3RLNA 2OT2A 4L63B 3V2TA 1H9SA 4LUVA 4C3JB 4BBRB 1YHAA 2CH4W 1X6OA 2IHEA 3CW2C 4LAAA 4J6HA 5J1ZA 3UDIA 5ELFA 3H3VI 4PMWA 1RJTA 4G7HC 3M4YA 3DMUA 2B3GA 1ICFB 1KAWA 4NKLA 3NBHB 3FKIH 1ML0D 4XYQA 3FKIB 4GKJL 1IBMQ 3SVMA 4YHHL 1UE1A 4L5RC 1PFMA 2AHOB 5C4XG 4DNRB 4DV0L 3J7AF 3SK6A 1CK1A 4Y7NH 1Q46A 2UXDL 3AQQA 2B2YA 2R6GA 4XT1B 4JI4L 2F0EA 4IPDA 1Q7YC 4B3RL 1EEFD 4YCUA 1LLRD 4KHPQ 3PQIA 2HHHL 2JA8H 1RL2A 1STNA 3BDOA 4A3GG 1C8CA 4A3EH 4J1MA 1SN8A 1TKWB 1TWHB 4R4QA 1BXTA 3FPPA 4P72A 4QUCA 4UAIA 2EJFC 1NSNS 4LF9Q 2YTXA 4A3DH 1HTPA 4JV5L 5HY6A 4FXDA 1BNZA 3KDFA 3MXNA 1TXYA 4M8AA 2BDOA 3DWQA 4F87A 1A2TA 1JORA 4KKSA 3CCMA 2ICIA 1IBKQ 3D4DA 2TSSA 3SXHA 3LWUA 4NXNL 1I4QA 4GN5A 1FNUA 3AYHB 1XNRL 1X54A 3STBC 1PTOH 3CAMA 1JMCA 5D65A 1HQMC 2CW0D 1PYBA 2RCFA 4X66L 1VDZA 2A6HC 2DNEA 3PIPA 2KBNA 2XWBB 1PA6A 1VQDA 2RBMA 1TS3A 4KV6A 4R4OA 5I9OA 4DR6Q 1SSOA 4C3IH 1PVOA 3VDYA 4JBMA 1OO9B 1A3VA 3CPFA 1NMFA 2B2WA 3I72A 4OX9Q 1FNVA 1SRUA 4JI5L 3HOUG 3H3VC 4LF7L 1XPRA 5CV7A 3NTIA 2ZXOA 3MXGA 1F9PA 4B3TL 1TWCB 1PZID 2PI2A 3BYTB 2QEXA 2B2UA 1WOCA 4CJ1B 4X3KA 2MPMA 3A0JA 1WTPA 3ND9A 4IURA 4DU9A 2BH8A 4JPBW 5IYDG 2F0WA 4E6IA 4XT3B 3KJOA 3T1YQ 3P20A 3I4NG 1GJXA 4YY3L 4JBWA 4B08A 4IUVA 4LUZA 4JI8Q 4LW1A 1VMPA 4QIWB 4RGTA 2Q8TA 5CC4A 3HOWG 2Z6KC 3VR5A 3SK5A 2PMZB 4WJWA 2LKVA 4IN3A 2A1AA 1WCMG 3STBD 5M5XB 1B2TA 2AMCB 2B2TC 4C3IB 1IZ6A 3VA5A 1QNKA 3SHLA 1XNQL 2D0OA 3TDQA 3NE5B 1EUJA 3VYRA 1MJCA 1S5BD 3M85A 1PH3A 3TP7A 4X62L 4ALPA 2WB1B 3H6MA 4DV5Q 2UUCL 1PTOB 1QVGA 1DOLA 1KNEA 5EKIA 2DY7A 1QWYA 1XTDA 2L5TA 3KBXA 1HCZA 2JSOA 1ENFA 1Z6HA 1BCPD 4KN4C 2VUMH 3VYTA 1B1ZA 2LMCB 1TWAH 1JWSD 2HQLA 1K8OA 1KQSA 5GAGC 2Y0SE 4R8NA 3NQIA 4KN7C 1B44D 1ESFA 3HOXG 1BCPB 4KHZA 2HUGA 5C4XB 2L12A 2JA5B 3HRZC 2HIXA 1MGSA 1T5XD 4A93G 1SE2A 3C46A 3G6JB 1FVIA 1PTOD 3EIVA 3TP6A 4CBVA 1PYSB 1Y1VH 2XWJB 3X3MA 1N32Q 4BY1G 1PH7A 1EZ8A 2EDGA 3T51B 3M3YH 4K14A 2WAQE 2NVTH 4N9PA 1JC7A 2RCNA 4KKTA 2IX1A 4K0KQ 5CMDA 1H9KA 3D6CA 2N78A 3J7AV 2F0UA 4DR3Q 3HOXB 1LTID 4R9WA 1R9TH 3VR3A 4BY7B 2F0QA 5ELDA 3Q6SA 5IP7H 2L15A 3MC0B 1IBLL 1GUOA 1LABA 1SYCA 4HJ8A 2XN9C 4LFCQ 4JG2A 2UUAQ 2K5QA 5FO7B 2XRSD 4O2DA 4A3JB 3TRZA 2XNAC 4BBSB 2L1BA 1ASZA 2PPBC 5FK9C 2UXCL 4G7OC 2E2HH 4DUZL 1YNJD 2KHSA 3F2UA 3I4NB 1STEA 3H3VH 1S5FD 5I6WA 3HOVH 4IUNA 1GUSA 2D2CC 4DV1L 2HCIA 3HOWH 1LTGD 1YNND 3E3XA 3L2PA 3I55A 4LMQD 4MTNA 3ND8A 3A8IE 3CCUA 3EJIA 4DNTB 3RUZA 4KKUA 3GTQH 4H13C 4JBKA 3KOJA 1RKNA 3S24A 3HS0C 1NR2A 2A74C 1IW7D 1X3QA 4RGOS 2DN8A 3RLOA 3VYSA 1WTWA 1N33Q 4DR7Q 1TWGH 1SYFA 4A3FB 3K5NA 3M4PA 1U4MA 1G91A 2B2WC 1K28A 4A3DG 4RG1A 3Q23A 4G4KA 5CBAE 3B6YA 4ZLTF 3ZYYX 1EFID 4RMFA 3L9AX 3I4LA 3QOJA 2Z8LA 5IOCA 4DV3Q 1PDQA 4N8X1 1JJ2A 1K9MC 1R4QB 4DUYL 4QL5A 2EY5A 5I2YA 1HNWL 4OX9L 2B2VA 3PF5A 2EYLA 4ZCKA 4P2CB 1R9TB 5IYCG 2AQ3B 2K5NA 3HKZB 4A3FG 3K80C 3I7FA 2UUAL 4IFDI 2L9HA 3DLLA 2XRQD 4OHJA 1B7YB 1OXTA 3HZXA 1IBLQ 1GD7A 2A5HA 2JA7G 3RMHA 4X66Q 4ULLA 3AMUA 4B9XA 2QCPX 1EWCA 4JI7L 4ODGA 5EKLA 2I07B 3CXCA 3F2DA 3RZOH 3W1GA 3V05A 3TS2A 3S14H 2DGYA 1WD1A 4IPHA 4JC0A 4CHTB 1VQNA 4K8IA 1VQAA 1NJIC 3CCJA 1D7QA 4DK0A 3GTKH 4P75A 1EQRA 4GLXA 1CQFA 3UDGA 1SAPA 3HKZG 1KRSA 3CHBD 1RODA 4QJFA 2Z1CA 3S16H 1IKMA 3ERSX 2UXBQ 2VUMB 1B3QA 2R7ZB 2SDFA 4MHEA 1DOMA 3HOZB 2HCCA 4G7ZC 2KQ3A 4I65A 1EY0A 4ZYSA 1VQCA 1HNZQ 1A63A 4JYAQ 1GOZA 2K03A 3CKIB 3OW2A 4L5SA 4LNQA 1B9NA 1SEBD 1CM9A 2JXMB 4RCOA 5E1FA 2L11A 1PYWD 4RWSC 1PRTB 1EZ6A 1YIJA 1E3PA 3IKJA 4H0LC 1XMQL 1TIID 1EQQA 3I73A 5COYA 2F0IA 5BR8L 1STHA 1I3QB 1QE6A 2K75A 3P75A 3ICEA 5JEAG 3SR1A 4LF6L 5HGQA 2R7ZG 4DR3L 4N8FA 1VQ6A 3GP7A 1M90C 3PUVA 5CGKA 2K4KA 5JEAH 1CA6A 1STBA 3PUYA 3F1ZA 3VYUA 3D0FA 1J5EL 5K36H 4C2MB 2EYOA 1QILA 5C4HA 1MBYA 4IJLA 1P8LA 5T1GA 1DCZA 1LACA 1CZGA 3RR5A 2UU9L 3KFUA 4JW0A 5G3LD 4XXEA 1PV4A 3IFDA 1SROA 3TP5A 1EYGA 1NBWA 1JWUD 4K2LA 1I6VC 3CCEA 3W1BA 2ES2A 2G9DA 3BVGA 3CMAA 3A74A 3ITPA 2UXBL 1EY7A 1G2TA 2EYPA 4CKEA 3A56A 3KF8A 1B53A 1D5MC 2EVBA 1NNXA 1II3A 3EROA 4A3GB 1CQVA 1EY4A 4HSVA 3H0GG 1YHQA 1QG7A 5DLQE 4A3MB 1SJED 1HFNA 1N33L 1KDBA 3RD4A 4XQQA 4C1NK 3NWSA 4A3IH 1WD0A 4LF8L 3NENA 1S5DD 1Y14B 5IIFA 4YY3Q 2IY5B 1AE3A 1PFBA 1SR3A 1BUVT 1BOSA 3OWEB 1EY6A 4IQZA 2R92H 1KC8C 2NVYH 5ELOA 3G6EA 5J3BA 1FGUA 4RH6A 2BE5D 1X3EA 3E9HA 1NAPA 2VUMG 3M9BA 1VQHA 1U9RA 4Q0FA 1CA5A 4IUTA 4WORA 1K83B 1AE2A 2Q8IB 1OXVA 1VQMA 1X3PA 1X9NA 2DY8A 1SBBB 3NHHA 1IYVA 3HOVB 1K73C 5BN4A 2LFNA 1BBXC 1G8ZD 3KF8B 1XNQQ 2OTJA 3KF6A 1ENAA 1TU2B 1WCMH 3A7LA 2F0FA 2B8GA 4YWMA 1S72A 1I50H 3HKZE 4BBSH 3V96A 4POGA 1NTGA 3GV3A 3HFZB 4LF4L 1E24A 4NMZA 1PXUA 3I4MB 1VCIA 4CKBA 2CVRA 2NZOA 2V1CC 1D6EC 4DV7Q 3UI2A 1FGBD 2V4DA 1Z7TA 4NW2A 3U4VA 1N32L 1SNOA 1BDOA 2F0LA 2NBFA 2X6LA 2K04A 1FYCA 2QW7A 2RQXA 3GTJH 1SXTA 2ZM6L 3PUWA 3F2CA 2AUJD 2EZVA 3S1NH 2NZ1D 4DV6L 5LMUL 2F0HA 3I8ZA 3KK7A 5IGCA 4YCVA 2A6HD 3QB3A 2EIFA 3KLSX 2J4XA 3T56B 2ZJRA 3RZDH 1PTOF 4JI3Q 2WV6D 4PQXA 3PIP3 1I4PA 2P5ZX 2D5DA 4L8JA 1Q12A 1HNZL 4EX5A 1VQIA 1KIXA 4BS9A 4OWTB 4IFDG 1X65A 3NSWA 1HZBA 2E74C 2KHIA 1E2VA 3CF5A 1K8AC 3WOFA 4RKBA 3R2TA 4KTAA 2A8VA 5C3XA 2Q8RE 3ULPA 1BBWA 2XSCA 3D8GA 2VW9A 2XTIA 2YTYA 2F0GA 3EBEA 3RLFA 2B63H 4DUZQ 3K58A 1D1IA 4BY1H 1CFMA 1F77A 1WTHA 2HDMA 4NDXA 3W5OA 3E6ZX 1KTKA 2E2JB 5CV6A 3TSSA 4A3CH 2RSNA 1GHKA 3T1YL 3NEMA 3DEPA 1CKOA 1GUTA 4CDDC 1UE5A 4HTHA 1KLGD 5I9PA 3H15A 4KD4A 4DR1Q 2YTVA 3HOUB 3CMEA 4I7ZC 1EY5A 1B9MA 1CSPA 2NVQB 4C56C 1UEAB 3CCRA 2L0CA 3E0JA 3JAME 4DAPA 1J9OA 1JWMD 4DAVA 2CCZA 1VS0A 1V1QA 4R8IA 3J81L 4DV2L 2I5HA 4HJ7A 4PZ7A 1E1TA 4AYBB 4DUYQ 2F0TA 4LJZC 1V1PA 4U673 1Q90A 1V9PA 2I5LX 4YWLA 1Q8KA 3OWFA 3AFPA 3A54A 5CORA 3TMEA 3RZDB 1BKBA 1U5KA 1LV9A 2LS01 3GTPH 1TQOA 2FINB 2GVBA 4HMJA 1HR0L 3S1RB 2YU9B 3BDCA 1U0LA 5CV9A 1A0IA 3K5LA 1PFNA 3HOXH 4A3EB 2PNHA 4KHPL 4X3TA 1TR5A 3TBIB 4LF8Q 3SK4A 2EXZA 1K3RA 2F4VQ 1M8AA 2JE6I 2FFKB 3KBGA 2SEBD 4TQUS 1Y1VG 5DEHA 1HH2P 2PZTA 2R7FA 2RDGA 3GTLB 1XPOA 1S40A 3M3YB 4LFAL 3I4NH 3NUCA 4K5XA 1WTVA 4A4IA 4JI7Q 1N36L 4MNOA 2F0SA 1QVCA 3MZ5A 4A3KG 3D4WA 4PZ8A 2E2DC 4GN4B 2YU9H 2KCTA 3DEOA 5JJKA 2OTLA 4GLAC 1EWHA 4CKCA 3K57A 3CCVA 2K28A 2F1MA 3FMCA 3AFQA 4A3LG 1I50B 1VMCA 2K14A 2E8GA 1SNCA 5M5WH 1VQ5A 2QGQA 3DM3A 2F3VA 5IT9E 4UP8A 4QB4A 3S2DH 4DR5L 3M4OB 1JOQA 2F0DA 2B2UC 2OQ0A 3LNNA 3OOCA 5EQ0A 3PGZA 3D4RA 2WKCA 1NY4A 2KHJA 2MNAA 2JEBI 1UWVA 5ELBA 4BXXH 3BZDB 3L7ZC 4L5TA 5H1SE 1O80A 3S2HH 2KUMA 4ME3A 1V8QA 4L5QA 3G4SA 2VS1A 2CFMA 1BBUA 5C3EG 2NB0A 1B70B 1KD1C 1W2BA 4HMIA 4JOIC 4Y7NB 2GA4B 1L0WA 3NBIA 1KHIA 4K6LA 1F2ZA 2UXCQ 1EU3A 1ET6A 2ID0A 1NMGA 4K5VA 1D2BA 3CCLA 2IX3A 4NP5A 3KLSA 4OIJA 2IX0A 4IALA 4C3IG 5LMUQ 1BCPF 1BQQT 1TVXA 2CWAA 2JA6G 4DV1Q 3OTOL 1CSQA 1IL8A 4HN7A 1N36Q 4HR7B 4BBRH 4QIWE 5M3FH 3HKSA 4JI3L 5FLMG 2HD3A 4EQNA 5A35A 1EL0A 4MIUA 4EGVA 2UU9Q 5E4XA 5BR8Q 1E2WA 1FJGL 5C5MA 3S9WA 1B8AA 3IFTA 5KNBA 2R61A 1Y8OB 3I91A 1YITA 2RA4A 3DWAA 1H9RA 5M9OA 4FF2A 5IGEA 3TS0A 2ATWA 5ELNA 4UPAA 4IUUA 3CQZH 2UUBQ 1MD2D 4KLKA 1JJGA 1VQPA 2JA5G 2AQ2B 1GXDC 3GV6A 5FLXc 1CTMA 2A19A 5DAUA 5C5LA 5C44G 4A3BB 2WB1E 3OMGA 1UUPA 3J7ZC 2D9UA 2PMZE 1JE4A 1I5FA 1DOKA 4ZRZA 4DPGA 5J39A 3FKIG 3BYYB 1K8GA 2Y0SG 5LMNL 5J22A 4ABNA 1AN8A 1F2MA 1E1OA 4J15A 4MZ9A 5GAEC 1MJEA 4A3LH 5JVG3 3HOYH 1W3SA 3Q24A 3PO3B 2F0PA 3D31A 3U58A 3S1QH 4DV5L 1VQ9A 1GUGA 5EGTA 2UXDQ 5C0XG 1HR0W 4IFDJ 1XMOL 4BY7G 1VQJA 4A3BH 1VQGA 1SYEA 2EYHA 2RF4A 1RTNA 1KABA 1SDFA 4JI1L 3RZOB 4IFDH 4P71A 2OXPA 2WAQG 5C0XH 3BZCA 2B8FA 4V0BA 3JC66 2ZT9C 4ZKBB 5JJLA 2Y0SB 4A3JG 2ASBA 5IP7G 2QILA 5C0XI 2VQFL 1R4PB 4DXGA 1RF2D 1SYDA 1DONA 3K5MA 2JA5H 2RKSA 4CJ0B 1ENCA 2ZTCA 4FXKC 5IT9c 1UNSA 5FJ8G 1KLUD 2IJ0A 5EAYA 3C2PA 1HTLD 1IYUA 4GNXC 4YWKA 4BWGB 3A8KE 1D8LA 2AQ1B 5AJ3Q 4ZUJA 3JAMc 3PO2B 4GKKQ 2Q2HA 1IKLA 1EU4A 1LO5D 1E22A 1PH2A 2R92B 3J80L 2WACA 3J81i 4LWCA 2I0QA 1QUQB 4RAUC 3CQZB 5EPLA 4DR4Q 1X3GA 4FNFA 2I46A 2ZJQA 1F2LA 1TWCH 2NTTA 4IPGA 1YNNC 1SFOB 3G71A 4DAYA 3VR6A 1IL2A 1WTOA 4NXML 3K6OA 4A3MH 1ZXTA 2KJXA 2E75C 4CDEC 2E76C 1SNPA 1TS2A 2OQKA 5BN3A 4B3SL 1PH5A 5IODA 4B9WA 3CCQA 1EQTA 1J6QA 2K52A 5KIXA 2BDNA 4JI0L 2B2VC 1I6HB 3QOLA 1YJWA 4DAMA 4PNYA 4DR4L 5ISRA 5IYBH 2DJFC 1SFOH 3PF4A 3D6WA 5FO9B 3QR8A 2EOTA 4OELB 4A3FH 4A3IB 1VF7A 2CQAA 2MHVA 1STGA 5D14A 1AP0A 3G48A 3PO3G 3RN2A 2RVLA 3GO5A 1WYDA 1WCMB 2HHHQ 2IW3A 4U68A 1MSHA 2G5DA 4DR5Q 4OONA 1EOTA 5IGDA 1IYJB 1G51A 4P73A 5FLXL 2GVAA 1I3QH 4DN4M 4BA2I 3DHQA 1L0XB 1JCKB 1Y8PB 2G9HD 1P16A 4QY7A 1Q8IA 4HSPA 1CI3M 2LXJA 3RNUA 2BA1A 1SMYC 3I56A 3HG9A 2NVXH 3HOZG 2Q2TA 2CQOA 1DXMA 1RTOA 4FP5D 4OEMB 2E2HB 2NWGA 3NK9A 5FJ8H 4GNXB 1N9WA 4ID6A 1LT5D 5M5WB 4XIGS 5KRUA 3DXJC 3T13A 4K0KL 4FXGC 3BS1A 5LMNQ 3SE0A 2EYJA 4F88A 2VY3A 1VQFA 3T53B 2LSSA 3NTKA 3NWTA 3BZKA 3CRKC 3PUZA 2QA4A 5FLMH 2F0VA 2ZM6Q 4C3JG 2O2LD 1C48A 4FO2A 4DGZA 4DFAA 1I4GA 4WJ3M 3J81c 1I4RA 2BOSA 5FLXE 2AUKA 1C0AA 4A3KB 1G2SA 2K50A 1XMOQ 4PG3A 4RHSA 4KJNA 5I4DA 3BVZA 2VZAA 3QJYA 2KA7A 5A2QL 2N49A 1FJGQ 4B3MQ 3KJPA 1ONLA 4DV2Q 2Z6KA 3JAML 1RDPD 1E2ZA 2R93G 3JAMi 1DZ1A 5CR3A 1W6JA 1K8MA 4LF5L 5EKKA 3MFYA 4OIKA 3O13A 5FKAC 3P1HA 5HGTA 1LT4D 3N6RA 3PV0A 4JI8L 5JVH3 4DR6L 3LWEA 1VQBA 3OW7A 5GQOA 4GOPA 1E7ZA 3GQBA 1SJHD 1A8VA 4N9TA 4Y52H 2LY7A 2ZTEA 3S17H 4UP9A 1TY2A 4PV1C 3K0YA 3E5SA 1KNAA 3K7UC 4LF6Q 3H0GB 4TVAB 1JQYD 3EN2A 1WTXA 1DD2A 4IUPA 3FHWA 2PI2E 4C1NI 1Y69U 2O4XA 2MQHA 1A15A 2RSOA 4RGNA 2FJ2A 4LF9L 3CPWA 4KMUC 1S5CD 3EFXD 2Q2UA 3A5UA 3PCOB 5I2XA 5IGBA 1XPUA 1E0BA 3A7AB 4A93B 2NYZD 4KY6A 1TY0A 5M3FB 1EIFA 2RHQB 1STAA 4H44C 1JR0D 2AWOA 3IAYA 1HPCA 1H9SB 2Z4IA 1G6ZA 3HOWB 2VQEL 1ZEQX 3EQLC 3OTOQ 3GTMB 3S16B 1PZKD 2F0KA 2N55A 2L55A 1O7IA 1VQEA 1UEBA 3S1MB 5AJ3L 1WI5A 3IL8A 4FDBA 3PIO3 1C7YA 3FRPB 4KY5A 1LTAD 4X65Q 1NCVA 2ZJPA 4O42A 2ALYB 2F0JA 3GTKB 3UDFA 4KI0A 2UUBL 2R7DA 5JPMC 4A3DB 2EY2A 5GAHC 3X3NA 4JI5Q 4OO1I 3R93A 2O5IC 5HURA 2RDHA 1H9MA 1N34Q 2DJGC 2M00A 3W3AA 3GTJB 3T1HL 2YV5A 4A3KH 3A5ZB 2ENBA 1Q82C 3K8AA 2EYMA 2N88A 5CV5A 5GADC 3OPOA 1CKNA 3WWVA 3CC7A 5C6AA 1Q86C 3CP0A 5DM73 3E0EA 1Q1BA 3S2DB 1X56A 4IO9A 3QG1A 1V1PB 3R3OA 5IE8A 4B3TQ 4QF4A 5E7NA 3TP8A 2N8NA 5JAVA 3SDZA 3HEJA 4AYBG 4RA8A 2EY1A 4QGUA 1PH8A 1LT6D 3GTOB 4IJHA 4DKAC 1F9QA 4UDUC 3ULJA 4OGQC 3OIQA 3CCSA 1Y8NB 1PH9A 1EOVA 5M3FG 1CHQD 1Z9FA 1X3FA 5M5YH 1VQ4A 4I7AA 1TWFH 5JPNC 3CC2A 2PW5A 1DJRD 1J5EQ 2WINB 2KECA 5A2QE 1LTSD 1QNUA 1CUKA 1JOOA 2RHSB 1HZCA 1WFQA 1HHVA 3HOUH 3F2BA 3GDEA 3KDFB 5LL6X 1B3AA 2ZTDA 3E9IA 2MGSA 2WB1G 4ME5A 2EQSA 2CKZB 2L4NA 1RCVD 2HT1A 3F8TA 2X6GA 3BVMA 3A55A 4R4IA 2R93B 1W6KA 1KL9A 3G7LA 2E2JH 3MFGA 3I2ZA 4R4CA 1YZ6A 4XQNA 4HJ9A 2Z4HA 3MA2B 2NN6I 5C4JB 2PCFB 3BU2A 2FXQA 4JI2Q 3U9OA 4DV4L 3H94A 3GTOH 2HDLA 3K59A 1QB5D 4IOAA 4CDCC 4GKKL 4RKLA 2C9OA 4DR2L 3IRBA 4LFBL 1J8IA 2PQAB 5LMNW 4DK3C 3ULLA 4A3GH 1YJ9A 1VQLA 1MIUA 3NELA 2MP1A 3S15B 1QZGA 1QUQA 4BY7H 1H95A 1YBYA 4ILWA 5TSSA 1UAPA 1HNWQ 3PMFA 3TZUA 4BXXG 1ICWA 5JEAJ 1L0YB 4DK6C 3CC4A 2WAQB 4DR1L 1FR3A 3UE0A 2JN4A 4C3HB 5M5XH 3RN5A 1ASYA 5C3EB 1PHJA 4DF7A 3LX0A
chains in the Genus database with same CATH topology
4HIKA 3TS0A 1C9OA 5ELNA 4A3IG 1PH6A 4UPAA 4BBRG 2ATWA 4JI7L 4GKJQ 3CQZH 2KCMA 2UUBQ 4KLKA 1JJGA 1VQPA 2JA5G 2JA9A 2OCEA 4GS3A 3CXCA 3F2DA 3W1GA 5FLXc 3RZOH 3TS2A 2A19A 2DGYA 3S14H 1Y1WG 4IPHA 3FP9A 4JC0A 1X55A 2WB1E 5C44G 1VQAA 1VQNA 4HJ5A 5M3MH 3J7ZC 1NJIC 3CCJA 1CKMA 1D7QA 2PMZE 5IWAL 1I5FA 3Q8DA 4P75A 4DPGA 4C2MH 3FKIG 3GTKH 1G6PA 1EQRA 1T9HA 2D0PA 2I5MX 4GLXA 1XMQQ 3UDGA 2Y0SG 5LMNL 1GM5A 1K8GA 1IBKL 2R7ZH 1KRTA 3HKZG 3PO2G 3PO3H 1I94Q 1KRSA 4BBSG 4JI0Q 4AYBE 1E1OA 3KYHC 4J15A 4MZ9A 1PFSA 5GAEC 4QJFA 1MJEA 2AWNA 4A3LH 4LF4Q 1W3SA 3HOYH 3S16H 3SGIA 3ERSX 2UXBQ 3D31A 3PSIA 3U58A 1S3OA 2Z0SA 3M4QA 1VQ8A 3S1QH 4DV5L 1VQ9A 2UXDQ 4LUOA 2OWOA 3I4MH 1XJVA 1OXXK 1YEZA 5C0XG 1VQCA 1PH4A 1HNZQ 1HR0W 4JYAQ 1A63A 4IFDJ 1XMOL 4BY7G 3OW2A 1VQJA 4L5SA 4A3BH 4LNQA 1VQGA 5IYBG 4OXPA 4OWWB 4LF7Q 2RF4A 1UE7A 4LFAQ 4JI1L 4DNIA 4P71A 2BA0A 2WAQG 3BZCA 2R92G 3JC66 1YIJA 1E3PA 5JJLA 3ER0A 4BA1I 4A3JG 1XMQL 2ASBA 2JA8G 5IP7G 4EQ5A 5C0XI 1EQQA 2UUCQ 2VQFL 1M1KC 2F4VL 4HIMA 2E5LQ 2JA5H 5C4XH 5BR8L 1OTCA 4C3HH 2N3SA 2ZTCA 2KENA 5IT9c 2K75A 3ICEA 4APVA 5JEAG 5FJ8G 4LF6L 5HGQA 1OXUA 4OWXB 2R7ZG 1A62A 1LUZA 5EAYA 4JCVE 4DV0Q 4DR3L 4GNXC 4YWKA 1VQ6A 1M90C 3PUVA 2XGTA 1V43A 3I4OA 1LM0A 5AJ3Q 1D8LA 2K4KA 3MEFA 3JAMc 5IP9G 4GKKQ 3PUYA 5IY0A 2Q2HA 3F1ZA 1J5EL 3D0FA 3KLWA 4JOIA 1E22A 4NXMQ 1PH2A 3HOVG 2EXDA 1N34L 4IJLA 4YCWA 4B3RQ 3J81i 1P8LA 4LWCA 4A3MG 2I0QA 1QUQB 4DR4Q 2JQOA 3RR5A 1X3GA 2UU9L 3KFUA 1PV4A 5M3MG 1SROA 2ZJQA 1TWCH 1EYGA 1NBWA 4UP7A 4IPGA 4DR7L 1K0RA 3G71A 1G291 3W1BA 3CCEA 2ES2A 3U50C 5IYCH 1IL2A 5C3EH 3K0XA 1Q81C 4B3SQ 4DV3L 4A3MH 3CMAA 4NXML 2R93H 1RIPA 3A74A 4JBJA 4AH6A 1WJJA 3UE1A 2OQKA 4B3SL 2UXBL 4GNXA 1PH5A 3CCQA 1YHBA 2WFWA 2JA7H 1JT8A 3GD7A 1K83H 1J6QA 1IBML 2K52A 3RLNA 4JI0L 5GROA 4LUVA 3H0GG 1YJWA 1YHAA 1YHQA 1X6OA 2IHEA 3CW2C 5DLQE 4DAMA 3H3VI 3UDIA 4PMWA 4DR4L 1GO3E 1N33L 1HZ9A 2E5LL 5IYBH 4A3IH 4A76A 1SFOH 2B3GA 3PF4A 4LF8L 2NN6G 3NENA 1KAWA 1Y14B 3NBHB 3FKIH 1IXRA 4YY3Q 2IY5B 4IOCA 1AE3A 4GKJL 1IBMQ 4JV5Q 4YHHL 1SR3A 4A3FH 2R92H 1KC8C 2NVYH 5ELOA 1UE1A 4L5RC 3G6EA 4IPCA 1FGUA 2AHOB 5J3BA 5C4XG 4AQYL 1X3EA 3E9HA 4DV0L 1HJPA 1LYLA 3G48A 3PO3G 3PO2H 2VUMG 1VQOA 3M9BA 1VQHA 4Y7NH 3RN2A 1Q46A 3GO5A 2UXDL 1WYDA 2HHHQ 2JEAI 3AQQA 1AE2A 4DR5Q 4OONA 1IYJB 1OXVA 1G51A 2R6GA 4P73A 1VQMA 1X9NA 4JI4L 4LF5Q 2GVAA 4GLVB 1Y1WH 1SLJA 4IPDA 1Q7YC 1I3QH 4BA2I 3J7A5 4B3RL 5K36G 1P16A 2CWPA 4QY7A 4YCUA 4KHPQ 4LFCL 1K73C 2LXJA 3RNUA 2BA1A 2HHHL 2JA8H 1RL2A 3M4OH 4A3GG 3I56A 1EIYB 4A3EH 3HOZG 2NVXH 1SN8A 2Q2TA 2CQOA 4R4QA 3KF8B 4P72A 4A3JH 1XNQQ 2OTJA 3KF6A 1WCMH 4YWMA 5FJ8H 3HKZE 1I50H 1N9WA 4GNXB 1GVPA 1S72A 4POGA 1NTGA 4BBSH 1N8RC 4LF9Q 2IT1A 2YTXA 3HFZB 4A3DH 4JV5L 1SMXA 4XIGS 5HY6A 4POFA 1E24A 3KDFA 2YYZA 3K81C 3TQYA 4LF4L 1TXYA 1VCIA 4X64Q 4K0KL 2GN5A 1L1OC 5LMNQ 1JJCB 2NZOA 3CCMA 5C44H 2V1CC 1IBKQ 2VY3A 1VQFA 4DV6Q 4DV7Q 1TWHH 2LSSA 3BZKA 3PUZA 2QA4A 3U4VA 4NXNL 5FLMH 4GN5A 2ZM6Q 1N32L 3AYHB 4WJ3M 1XNRL 3J81c 3GTLH 1X54A 3STBC 3CAMA 1C0AA 4X65L 1JMCA 3F2CA 3GTJH 2ZM6L 2K50A 3PUWA 1XMOQ 4PG3A 1HNXQ 1PYBA 4NXNQ 2NVQH 4JYAL 3S1NH 4JI6L 4X66L 4DV6L 5LMUL 1BVSA 4DV7L 3PIPA 2KBNA 1PA6A 1VQ7A 1VQDA 2VZAA 3TEHB 4R4OA 4YCVA 4A3EG 4DR6Q 2N49A 4C3IH 2EIFA 4B3MQ 1FJGQ 1PVOA 2VQEQ 3VDYA 4JBMA 3KJPA 2ZJRA 1NE3A 2Z6KA 3ZJYC 4DV2Q 3S1RH 3CPFA 3TREA 1NMFA 1I94L 2R93G 3RZDH 4JI3Q 4OX9Q 4JI5L 1SRUA 4NPSA 3JAMi 3HOUG 4LF5L 4LF7L 2AKWB 1XPRA 4DAYB 2H5XA 3UDXA 4B3TL 2PI2A 2QEXA 3PV0A 1Q12A 1HNZL 4JI8L 4EX5A 1VQIA 4DR6L 1WOCA 1KIXA 5C0XJ 4OWTB 1VQBA 4IFDG 5GQOA 1X65A 3A0JA 4GOPA 2MO0A 3S15H 4P74A 1HZBA 2KHIA 4GOPC 1E7ZA 3CF5A 4GOPB 1K8AC 1A8VA 2BH8A 5IYDG 4Y52H 3T1YQ 2ZTEA 3KJOA 3S17H 4UP9A 3I4NG 4AIMA 2A8VA 4YY3L 4JBWA 1XNRQ 3K7UC 3ULPA 4LUZA 4LF6Q 4JI8Q 1BBWA 4LW1A 4TVAB 3EN2A 4A93H 2VW9A 2XTIA 5C4JH 3HOWG 5IWAQ 2YTYA 3FHWA 3EBEA 3RLFA 2B63H 5IYDH 3BJUA 4LFBL 4DUZQ 2Z6KC 4BY1H 2PI2E 3W5OA 2MQHA 4A3BG 2A1AA 1WCMG 3STBD 1MKHA 4A3CH 2AMCB 3T1YL 4LF9L 2JJQA 3NEMA 3CPWA 1L2FA 2Q2UA 1IZ6A 3A5UA 3PCOB 1CKOA 1UE5A 1XPUA 3H15A 1XNQL 2D0OA 4DR1Q 1EUJA 4DV4Q 2YTVA 4JI2L 1MJCA 3CMEA 2WP8J 1CSPA 3M85A 4UY8C 1EIFA 1PH3A 2RHQB 4X62L 3CCRA 4ALPA 4DV5Q 2UUCL 2IHFA 2AWOA 2DUDA 1QVGA 1HZAA 1XTDA 1CKNB 2CCZA 1VS0A 1V1QA 3HOZH 2VQEL 4X62Q 4DV2L 2I5HA 2VUMH 4HJ7A 4PZ7A 1E1TA 3OTOQ 3LGJA 4DUYQ 4DR2Q 3J80i 4NB3A 1TWAH 1YNXA 2HQLA 1KQSA 5JJIA 2Q2IA 4GN3B 1O7IA 1VQEA 2Y0SE 2K5VA 1V9PA 5GAGC 1UEBA 2I5LX 4YWLA 5AJ3L 1Q8KA 1DGSA 1WI5A 4FDBA 3AFPA 1C7YA 3HOXG 4KHZA 4X65Q 2ZJPA 1BKBA 2HIXA 1U5KA 2ALYB 2MO1A 3GTPH 4A93G 3UDFA 2GVBA 4KI0A 1FVIA 2R7DA 3EIVA 1HR0L 2UUBL 5GAHC 4JI5Q 3K7AH 1LTLA 4OO1I 1PYSB 1U0LA 1Y1VH 1N32Q 4BY1G 1PH7A 1A0IA 1FL0A 3HOXH 2PNHA 4KHPL 1N34Q 3M3YH 4LF8Q 1SE8A 2WAQE 3T1HL 1K3RA 2YV5A 2F4VQ 2NVTH 2JE6I 2PQAA 4A3KH 3A5ZB 3AEVA 2RCNA 1Q82C 3K8AA 2IX1A 4K0KQ 4TQUS 1Y1VG 1HH2P 2R7FA 4XTCS 1HR0Q 1KXLA 1EFWA 2N78A 3MXNB 5GADC 1CKNA 1XPOA 1S40A 3WWVA 3CC7A 4JI1Q 4LFAL 3I4NH 1Q86C 3CP0A 4DR3Q 4A4IA 4JI7Q 1L1OB 3E0EA 1Q1BA 4MNOA 1QVCA 1N36L 4A3KG 1X56A 4R4TA 1R9TH 4LFBQ 4PZ8A 4IO9A 4AQYQ 5IE8A 2YU9H 4GN4B 5IP7H 4B3TQ 2KCTA 2L15A 1IBLL 5E7NA 5JJKA 2N8NA 3PIOA 4HJ8A 2OTLA 4GLAC 2K5HA 2VQFQ 3KF6B 4OO1G 4LFCQ 4AYBG 4JG2A 3CCVA 4X6AH 1QZHA 3I4MG 4WJ4A 4H02A 2UUAQ 3AFQA 4A3LG 4QGUA 3J81j 3CD6A 2K14A 2E8GA 4O2DA 5M5WH 4X64L 1VQ5A 1YVCA 1PH8A 2QGQA 3DM3A 3TRZA 4IJHA 4DKAC 2MFIA 4UP8A 1ASZA 3ULJA 2UXCL 3T1HQ 3S2DH 1L1OA 3CCSA 2E2HH 4DUZL 1PH9A 3GTMH 4DR5L 3OYYA 4A75A 1EOVA 3L0OA 5M3FG 2OQ0A 3H3VH 1JE5A 1Z9FA 5IP9H 3PGZA 3HOVH 2VNUD 4DV1L 1NY4A 1X3FA 5M5YH 1VQ4A 2HIVA 2KHJA 2MNAA 2JEBI 1TWFH 3HOWH 1UWVA 3CC2A 4BXXH 3L7ZC 1J5EQ 4L5TA 2B29A 1Z47A 5H1SE 3L2PA 3J80c 1GKHA 3S2HH 4ME3A 3I55A 1CUKA 4L5QA 2RHSB 2VS1A 3G4SA 1Q1EA 1HZCA 1WFQA 2CFMA 2F3IA 4MTNA 4C3JH 3CCUA 2BH2A 4A3CG 3U4ZA 3HOUH 1BBUA 3F2BA 3GDEA 2B63G 3KDFB 5C3EG 1B70B 3GTQH 1KD1C 1W2BA 2ZTDA 4JBKA 3E9IA 2WB1G 3KOJA 2EQSA 2CKZB 4HJAA 4JOIC 2JK8A 3F8TA 1L0WA 3S24A 4R4IA 2E2IH 3RLOA 2HT1A 4DR7Q 2JA6H 1KHIA 1N33Q 1KL9A 1TWGH 2NZHA 2E2JH 3M4PA 2UXCQ 4A3DG 3I2ZA 2ID0A 1NMGA 1YZ6A 4R4CA 4RG1A 4HJ9A 3S1MH 3CCLA 1EWIA 2C35B 2F52A 4B3ML 2NN6I 3B6YA 1AH9A 4YHHQ 3BU2A 4RMFA 2FXQA 3H0GH 4JI2Q 2IX0A 4DV4L 3GTGH 3GTOH 4IOAA 5LMUQ 4GKKL 4DV3Q 4R1JA 4JI6Q 1JJ2A 1K9MC 2CWAA 2D62A 2JA6G 3HOYG 4DV1Q 3OTOL 4DUYL 3IRBA 4QL5A 1CSQA 2PQAB 5LMNW 1OXSC 4DR2L 1JB7A 4DK3C 3ULLA 1N36Q 1QVFA 3M7NA 4A3GH 1PH1A 1YJ9A 1YJNA 4QQBX 1VQLA 1MIUA 3NELA 4BBRH 1HNWL 4QIWE 1QZGA 5M3FH 1QUQA 3HKSA 4JI4Q 4JI3L 5FLMG 4OX9L 1I6HH 4BY7H 3PF5A 1YBYA 1H95A 5IYCG 2UU9Q 1VQKA 1HNWQ 2K5NA 5BR8Q 1UE6A 4BXXG 4HIOA 5JEAJ 3K80C 3I7FA 4A3FG 2UUAL 1FJGL 4IFDI 3DLLA 1B8AA 4DK6C 1B7YB 1OXTA 2VL6A 3CC4A 4DR1L 1YI2A 4PZ6A 4HIDA 3PUXA 1GD7A 3UE0A 1YITA 5M5XH 4O0AA 4X66Q 3RN5A 1IBLQ 2JA7G 2LXKA 1ASYA 1HNXL 1PHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HIK A;  3TS0 A;  1C9O A;  5ELN A;  4A3I G;  1PH6 A;  4UPA A;  4BBR G;  2ATW A;  4JI7 L;  4GKJ Q;  3CQZ H;  2KCM A;  2UUB Q;  4KLK A;  1JJG A;  1VQP A;  2JA5 G;  2JA9 A;  2OCE A;  4GS3 A;  3CXC A;  3F2D A;  3W1G A;  5FLX c;  3RZO H;  3TS2 A;  2A19 A;  2DGY A;  3S14 H;  1Y1W G;  4IPH A;  3FP9 A;  4JC0 A;  1X55 A;  2WB1 E;  5C44 G;  1VQA A;  1VQN A;  4HJ5 A;  5M3M H;  3J7Z C;  1NJI C;  3CCJ A;  1CKM A;  1D7Q A;  2PMZ E;  5IWA L;  1I5F A;  3Q8D A;  4P75 A;  4DPG A;  4C2M H;  3FKI G;  3GTK H;  1G6P A;  1EQR A;  1T9H A;  2D0P A;  2I5M X;  4GLX A;  1XMQ Q;  3UDG A;  2Y0S G;  5LMN L;  1GM5 A;  1K8G A;  1IBK L;  2R7Z H;  1KRT A;  3HKZ G;  3PO2 G;  3PO3 H;  1I94 Q;  1KRS A;  4BBS G;  4JI0 Q;  4AYB E;  1E1O A;  3KYH C;  4J15 A;  4MZ9 A;  1PFS A;  5GAE C;  4QJF A;  1MJE A;  2AWN A;  4A3L H;  4LF4 Q;  1W3S A;  3HOY H;  3S16 H;  3SGI A;  3ERS X;  2UXB Q;  3D31 A;  3PSI A;  3U58 A;  1S3O A;  2Z0S A;  3M4Q A;  1VQ8 A;  3S1Q H;  4DV5 L;  1VQ9 A;  2UXD Q;  4LUO A;  2OWO A;  3I4M H;  1XJV A;  1OXX K;  1YEZ A;  5C0X G;  1VQC A;  1PH4 A;  1HNZ Q;  1HR0 W;  4JYA Q;  1A63 A;  4IFD J;  1XMO L;  4BY7 G;  3OW2 A;  1VQJ A;  4L5S A;  4A3B H;  4LNQ A;  1VQG A;  5IYB G;  4OXP A;  4OWW B;  4LF7 Q;  2RF4 A;  1UE7 A;  4LFA Q;  4JI1 L;  4DNI A;  4P71 A;  2BA0 A;  2WAQ G;  3BZC A;  2R92 G;  3JC6 6;  1YIJ A;  1E3P A;  5JJL A;  3ER0 A;  4BA1 I;  4A3J G;  1XMQ L;  2ASB A;  2JA8 G;  5IP7 G;  4EQ5 A;  5C0X I;  1EQQ A;  2UUC Q;  2VQF L;  1M1K C;  2F4V L;  4HIM A;  2E5L Q;  2JA5 H;  5C4X H;  5BR8 L;  1OTC A;  4C3H H;  2N3S A;  2ZTC A;  2KEN A;  5IT9 c;  2K75 A;  3ICE A;  4APV A;  5JEA G;  5FJ8 G;  4LF6 L;  5HGQ A;  1OXU A;  4OWX B;  2R7Z G;  1A62 A;  1LUZ A;  5EAY A;  4JCV E;  4DV0 Q;  4DR3 L;  4GNX C;  4YWK A;  1VQ6 A;  1M90 C;  3PUV A;  2XGT A;  1V43 A;  3I4O A;  1LM0 A;  5AJ3 Q;  1D8L A;  2K4K A;  3MEF A;  3JAM c;  5IP9 G;  4GKK Q;  3PUY A;  5IY0 A;  2Q2H A;  3F1Z A;  1J5E L;  3D0F A;  3KLW A;  4JOI A;  1E22 A;  4NXM Q;  1PH2 A;  3HOV G;  2EXD A;  1N34 L;  4IJL A;  4YCW A;  4B3R Q;  3J81 i;  1P8L A;  4LWC A;  4A3M G;  2I0Q A;  1QUQ B;  4DR4 Q;  2JQO A;  3RR5 A;  1X3G A;  2UU9 L;  3KFU A;  1PV4 A;  5M3M G;  1SRO A;  2ZJQ A;  1TWC H;  1EYG A;  1NBW A;  4UP7 A;  4IPG A;  4DR7 L;  1K0R A;  3G71 A;  1G29 1;  3W1B A;  3CCE A;  2ES2 A;  3U50 C;  5IYC H;  1IL2 A;  5C3E H;  3K0X A;  1Q81 C;  4B3S Q;  4DV3 L;  4A3M H;  3CMA A;  4NXM L;  2R93 H;  1RIP A;  3A74 A;  4JBJ A;  4AH6 A;  1WJJ A;  3UE1 A;  2OQK A;  4B3S L;  2UXB L;  4GNX A;  1PH5 A;  3CCQ A;  1YHB A;  2WFW A;  2JA7 H;  1JT8 A;  3GD7 A;  1K83 H;  1J6Q A;  1IBM L;  2K52 A;  3RLN A;  4JI0 L;  5GRO A;  4LUV A;  3H0G G;  1YJW A;  1YHA A;  1YHQ A;  1X6O A;  2IHE A;  3CW2 C;  5DLQ E;  4DAM A;  3H3V I;  3UDI A;  4PMW A;  4DR4 L;  1GO3 E;  1N33 L;  1HZ9 A;  2E5L L;  5IYB H;  4A3I H;  4A76 A;  1SFO H;  2B3G A;  3PF4 A;  4LF8 L;  2NN6 G;  3NEN A;  1KAW A;  1Y14 B;  3NBH B;  3FKI H;  1IXR A;  4YY3 Q;  2IY5 B;  4IOC A;  1AE3 A;  4GKJ L;  1IBM Q;  4JV5 Q;  4YHH L;  1SR3 A;  4A3F H;  2R92 H;  1KC8 C;  2NVY H;  5ELO A;  1UE1 A;  4L5R C;  3G6E A;  4IPC A;  1FGU A;  2AHO B;  5J3B A;  5C4X G;  4AQY L;  1X3E A;  3E9H A;  4DV0 L;  1HJP A;  1LYL A;  3G48 A;  3PO3 G;  3PO2 H;  2VUM G;  1VQO A;  3M9B A;  1VQH A;  4Y7N H;  3RN2 A;  1Q46 A;  3GO5 A;  2UXD L;  1WYD A;  2HHH Q;  2JEA I;  3AQQ A;  1AE2 A;  4DR5 Q;  4OON A;  1IYJ B;  1OXV A;  1G51 A;  2R6G A;  4P73 A;  1VQM A;  1X9N A;  4JI4 L;  4LF5 Q;  2GVA A;  4GLV B;  1Y1W H;  1SLJ A;  4IPD A;  1Q7Y C;  1I3Q H;  4BA2 I;  3J7A 5;  4B3R L;  5K36 G;  1P16 A;  2CWP A;  4QY7 A;  4YCU A;  4KHP Q;  4LFC L;  1K73 C;  2LXJ A;  3RNU A;  2BA1 A;  2HHH L;  2JA8 H;  1RL2 A;  3M4O H;  4A3G G;  3I56 A;  1EIY B;  4A3E H;  3HOZ G;  2NVX H;  1SN8 A;  2Q2T A;  2CQO A;  4R4Q A;  3KF8 B;  4P72 A;  4A3J H;  1XNQ Q;  2OTJ A;  3KF6 A;  1WCM H;  4YWM A;  5FJ8 H;  3HKZ E;  1I50 H;  1N9W A;  4GNX B;  1GVP A;  1S72 A;  4POG A;  1NTG A;  4BBS H;  1N8R C;  4LF9 Q;  2IT1 A;  2YTX A;  3HFZ B;  4A3D H;  4JV5 L;  1SMX A;  4XIG S;  5HY6 A;  4POF A;  1E24 A;  3KDF A;  2YYZ A;  3K81 C;  3TQY A;  4LF4 L;  1TXY A;  1VCI A;  4X64 Q;  4K0K L;  2GN5 A;  1L1O C;  5LMN Q;  1JJC B;  2NZO A;  3CCM A;  5C44 H;  2V1C C;  1IBK Q;  2VY3 A;  1VQF A;  4DV6 Q;  4DV7 Q;  1TWH H;  2LSS A;  3BZK A;  3PUZ A;  2QA4 A;  3U4V A;  4NXN L;  5FLM H;  4GN5 A;  2ZM6 Q;  1N32 L;  3AYH B;  4WJ3 M;  1XNR L;  3J81 c;  3GTL H;  1X54 A;  3STB C;  3CAM A;  1C0A A;  4X65 L;  1JMC A;  3F2C A;  3GTJ H;  2ZM6 L;  2K50 A;  3PUW A;  1XMO Q;  4PG3 A;  1HNX Q;  1PYB A;  4NXN Q;  2NVQ H;  4JYA L;  3S1N H;  4JI6 L;  4X66 L;  4DV6 L;  5LMU L;  1BVS A;  4DV7 L;  3PIP A;  2KBN A;  1PA6 A;  1VQ7 A;  1VQD A;  2VZA A;  3TEH B;  4R4O A;  4YCV A;  4A3E G;  4DR6 Q;  2N49 A;  4C3I H;  2EIF A;  4B3M Q;  1FJG Q;  1PVO A;  2VQE Q;  3VDY A;  4JBM A;  3KJP A;  2ZJR A;  1NE3 A;  2Z6K A;  3ZJY C;  4DV2 Q;  3S1R H;  3CPF A;  3TRE A;  1NMF A;  1I94 L;  2R93 G;  3RZD H;  4JI3 Q;  4OX9 Q;  4JI5 L;  1SRU A;  4NPS A;  3JAM i;  3HOU G;  4LF5 L;  4LF7 L;  2AKW B;  1XPR A;  4DAY B;  2H5X A;  3UDX A;  4B3T L;  2PI2 A;  2QEX A;  3PV0 A;  1Q12 A;  1HNZ L;  4JI8 L;  4EX5 A;  1VQI A;  4DR6 L;  1WOC A;  1KIX A;  5C0X J;  4OWT B;  1VQB A;  4IFD G;  5GQO A;  1X65 A;  3A0J A;  4GOP A;  2MO0 A;  3S15 H;  4P74 A;  1HZB A;  2KHI A;  4GOP C;  1E7Z A;  3CF5 A;  4GOP B;  1K8A C;  1A8V A;  2BH8 A;  5IYD G;  4Y52 H;  3T1Y Q;  2ZTE A;  3KJO A;  3S17 H;  4UP9 A;  3I4N G;  4AIM A;  2A8V A;  4YY3 L;  4JBW A;  1XNR Q;  3K7U C;  3ULP A;  4LUZ A;  4LF6 Q;  4JI8 Q;  1BBW A;  4LW1 A;  4TVA B;  3EN2 A;  4A93 H;  2VW9 A;  2XTI A;  5C4J H;  3HOW G;  5IWA Q;  2YTY A;  3FHW A;  3EBE A;  3RLF A;  2B63 H;  5IYD H;  3BJU A;  4LFB L;  4DUZ Q;  2Z6K C;  4BY1 H;  2PI2 E;  3W5O A;  2MQH A;  4A3B G;  2A1A A;  1WCM G;  3STB D;  1MKH A;  4A3C H;  2AMC B;  3T1Y L;  4LF9 L;  2JJQ A;  3NEM A;  3CPW A;  1L2F A;  2Q2U A;  1IZ6 A;  3A5U A;  3PCO B;  1CKO A;  1UE5 A;  1XPU A;  3H15 A;  1XNQ L;  2D0O A;  4DR1 Q;  1EUJ A;  4DV4 Q;  2YTV A;  4JI2 L;  1MJC A;  3CME A;  2WP8 J;  1CSP A;  3M85 A;  4UY8 C;  1EIF A;  1PH3 A;  2RHQ B;  4X62 L;  3CCR A;  4ALP A;  4DV5 Q;  2UUC L;  2IHF A;  2AWO A;  2DUD A;  1QVG A;  1HZA A;  1XTD A;  1CKN B;  2CCZ A;  1VS0 A;  1V1Q A;  3HOZ H;  2VQE L;  4X62 Q;  4DV2 L;  2I5H A;  2VUM H;  4HJ7 A;  4PZ7 A;  1E1T A;  3OTO Q;  3LGJ A;  4DUY Q;  4DR2 Q;  3J80 i;  4NB3 A;  1TWA H;  1YNX A;  2HQL A;  1KQS A;  5JJI A;  2Q2I A;  4GN3 B;  1O7I A;  1VQE A;  2Y0S E;  2K5V A;  1V9P A;  5GAG C;  1UEB A;  2I5L X;  4YWL A;  5AJ3 L;  1Q8K A;  1DGS A;  1WI5 A;  4FDB A;  3AFP A;  1C7Y A;  3HOX G;  4KHZ A;  4X65 Q;  2ZJP A;  1BKB A;  2HIX A;  1U5K A;  2ALY B;  2MO1 A;  3GTP H;  4A93 G;  3UDF A;  2GVB A;  4KI0 A;  1FVI A;  2R7D A;  3EIV A;  1HR0 L;  2UUB L;  5GAH C;  4JI5 Q;  3K7A H;  1LTL A;  4OO1 I;  1PYS B;  1U0L A;  1Y1V H;  1N32 Q;  4BY1 G;  1PH7 A;  1A0I A;  1FL0 A;  3HOX H;  2PNH A;  4KHP L;  1N34 Q;  3M3Y H;  4LF8 Q;  1SE8 A;  2WAQ E;  3T1H L;  1K3R A;  2YV5 A;  2F4V Q;  2NVT H;  2JE6 I;  2PQA A;  4A3K H;  3A5Z B;  3AEV A;  2RCN A;  1Q82 C;  3K8A A;  2IX1 A;  4K0K Q;  4TQU S;  1Y1V G;  1HH2 P;  2R7F A;  4XTC S;  1HR0 Q;  1KXL A;  1EFW A;  2N78 A;  3MXN B;  5GAD C;  1CKN A;  1XPO A;  1S40 A;  3WWV A;  3CC7 A;  4JI1 Q;  4LFA L;  3I4N H;  1Q86 C;  3CP0 A;  4DR3 Q;  4A4I A;  4JI7 Q;  1L1O B;  3E0E A;  1Q1B A;  4MNO A;  1QVC A;  1N36 L;  4A3K G;  1X56 A;  4R4T A;  1R9T H;  4LFB Q;  4PZ8 A;  4IO9 A;  4AQY Q;  5IE8 A;  2YU9 H;  4GN4 B;  5IP7 H;  4B3T Q;  2KCT A;  2L15 A;  1IBL L;  5E7N A;  5JJK A;  2N8N A;  3PIO A;  4HJ8 A;  2OTL A;  4GLA C;  2K5H A;  2VQF Q;  3KF6 B;  4OO1 G;  4LFC Q;  4AYB G;  4JG2 A;  3CCV A;  4X6A H;  1QZH A;  3I4M G;  4WJ4 A;  4H02 A;  2UUA Q;  3AFQ A;  4A3L G;  4QGU A;  3J81 j;  3CD6 A;  2K14 A;  2E8G A;  4O2D A;  5M5W H;  4X64 L;  1VQ5 A;  1YVC A;  1PH8 A;  2QGQ A;  3DM3 A;  3TRZ A;  4IJH A;  4DKA C;  2MFI A;  4UP8 A;  1ASZ A;  3ULJ A;  2UXC L;  3T1H Q;  3S2D H;  1L1O A;  3CCS A;  2E2H H;  4DUZ L;  1PH9 A;  3GTM H;  4DR5 L;  3OYY A;  4A75 A;  1EOV A;  3L0O A;  5M3F G;  2OQ0 A;  3H3V H;  1JE5 A;  1Z9F A;  5IP9 H;  3PGZ A;  3HOV H;  2VNU D;  4DV1 L;  1NY4 A;  1X3F A;  5M5Y H;  1VQ4 A;  2HIV A;  2KHJ A;  2MNA A;  2JEB I;  1TWF H;  3HOW H;  1UWV A;  3CC2 A;  4BXX H;  3L7Z C;  1J5E Q;  4L5T A;  2B29 A;  1Z47 A;  5H1S E;  3L2P A;  3J80 c;  1GKH A;  3S2H H;  4ME3 A;  3I55 A;  1CUK A;  4L5Q A;  2RHS B;  2VS1 A;  3G4S A;  1Q1E A;  1HZC A;  1WFQ A;  2CFM A;  2F3I A;  4MTN A;  4C3J H;  3CCU A;  2BH2 A;  4A3C G;  3U4Z A;  3HOU H;  1BBU A;  3F2B A;  3GDE A;  2B63 G;  3KDF B;  5C3E G;  1B70 B;  3GTQ H;  1KD1 C;  1W2B A;  2ZTD A;  4JBK A;  3E9I A;  2WB1 G;  3KOJ A;  2EQS A;  2CKZ B;  4HJA A;  4JOI C;  2JK8 A;  3F8T A;  1L0W A;  3S24 A;  4R4I A;  2E2I H;  3RLO A;  2HT1 A;  4DR7 Q;  2JA6 H;  1KHI A;  1N33 Q;  1KL9 A;  1TWG H;  2NZH A;  2E2J H;  3M4P A;  2UXC Q;  4A3D G;  3I2Z A;  2ID0 A;  1NMG A;  1YZ6 A;  4R4C A;  4RG1 A;  4HJ9 A;  3S1M H;  3CCL A;  1EWI A;  2C35 B;  2F52 A;  4B3M L;  2NN6 I;  3B6Y A;  1AH9 A;  4YHH Q;  3BU2 A;  4RMF A;  2FXQ A;  3H0G H;  4JI2 Q;  2IX0 A;  4DV4 L;  3GTG H;  3GTO H;  4IOA A;  5LMU Q;  4GKK L;  4DV3 Q;  4R1J A;  4JI6 Q;  1JJ2 A;  1K9M C;  2CWA A;  2D62 A;  2JA6 G;  3HOY G;  4DV1 Q;  3OTO L;  4DUY L;  3IRB A;  4QL5 A;  1CSQ A;  2PQA B;  5LMN W;  1OXS C;  4DR2 L;  1JB7 A;  4DK3 C;  3ULL A;  1N36 Q;  1QVF A;  3M7N A;  4A3G H;  1PH1 A;  1YJ9 A;  1YJN A;  4QQB X;  1VQL A;  1MIU A;  3NEL A;  4BBR H;  1HNW L;  4QIW E;  1QZG A;  5M3F H;  1QUQ A;  3HKS A;  4JI4 Q;  4JI3 L;  5FLM G;  4OX9 L;  1I6H H;  4BY7 H;  3PF5 A;  1YBY A;  1H95 A;  5IYC G;  2UU9 Q;  1VQK A;  1HNW Q;  2K5N A;  5BR8 Q;  1UE6 A;  4BXX G;  4HIO A;  5JEA J;  3K80 C;  3I7F A;  4A3F G;  2UUA L;  1FJG L;  4IFD I;  3DLL A;  1B8A A;  4DK6 C;  1B7Y B;  1OXT A;  2VL6 A;  3CC4 A;  4DR1 L;  1YI2 A;  4PZ6 A;  4HID A;  3PUX A;  1GD7 A;  3UE0 A;  1YIT A;  5M5X H;  4O0A A;  4X66 Q;  3RN5 A;  1IBL Q;  2JA7 G;  2LXK A;  1ASY A;  1HNX L;  1PHJ A; 
#chains in the Genus database with same CATH topology
 4HIK A;  1C9O A;  4A3I G;  1PH6 A;  4GKJ Q;  1M4V A;  3MAQ A;  3NP8 A;  2JA9 A;  2OCE A;  3FP9 A;  4XQJ A;  4HJ5 A;  3Q8D A;  1G6P A;  3C1E A;  2J0T D;  4UHV A;  1GUW A;  3A8J E;  3PO2 G;  3DWP A;  4Z9C B;  1I94 Q;  4BBS G;  4AYB E;  2XVS A;  3FVQ A;  3J81 E;  1TWA B;  5E3F A;  3PSI A;  1S3O A;  2H4O A;  2Z0S A;  3M4Q A;  1VQ8 A;  3U9S A;  4O1N A;  3H91 A;  1XJV A;  1YEZ A;  2M9V A;  5M3M B;  1IHZ A;  3W2D A;  4OXP A;  4H7B A;  4LF7 Q;  1UE7 A;  4DNI A;  1GUN A;  3J80 E;  1EYC A;  1KAA A;  3T16 A;  2BA0 A;  4K8J A;  3DM1 A;  1F9R A;  2K5D A;  3M7G A;  4EQ5 A;  1LT3 D;  3DUZ A;  4DK1 A;  1M1K C;  4JK1 C;  4TKO B;  4HIM A;  2E5L Q;  5JOB A;  1SMY D;  4G57 A;  2F0N A;  1TT2 A;  1FD7 D;  2KEN A;  1LTB D;  1HFG A;  4BY1 B;  4OWX B;  1Q3L A;  4FYD A;  1LUZ A;  5DNF A;  4RHR A;  3SEB A;  2VXW A;  5AFW A;  5ELE A;  2A68 C;  2EJG C;  3I4O A;  1LM0 A;  3MEF A;  3MXU A;  5IP9 G;  1SNQ A;  5EPK A;  4DA2 A;  4GZY C;  3KLW A;  1SNM A;  4JOI A;  3HOV G;  1B4O A;  3K5O A;  1N34 L;  4A3M G;  2PYK A;  4IZ8 A;  2JQO A;  4UP7 A;  4DR7 L;  1K0R A;  1G29 1;  5IYC H;  3K0X A;  4S3S A;  1T5E A;  2R3Z A;  3FDT A;  2MUY A;  5KNC A;  1WJJ A;  5K5P A;  5L37 A;  1LTR D;  1F9S A;  1YHB A;  5KND A;  2JA7 H;  1JT8 A;  3GTQ B;  1K83 H;  1IBM L;  2JA7 B;  2C5C A;  1PRT D;  4ZKC B;  5GRO A;  1C4Q A;  4K6D A;  1A6X A;  1KDA A;  2PO4 A;  3C1F A;  3OSO A;  1GO3 E;  1HZ9 A;  2E5L L;  1V1O A;  4A76 A;  5BN5 A;  4QCL A;  2NN6 G;  4L6T B;  1IXR A;  2CW0 C;  1A3U A;  1A3T A;  2NUC A;  4IOC A;  4JV5 Q;  2O5J C;  5ELC A;  2A6E D;  5FOB B;  4XDX A;  4IPC A;  4AQY L;  1HJP A;  2DNC A;  1LYL A;  3PO2 H;  1QOH A;  1BO0 A;  4LK1 C;  1VQO A;  1STY A;  2PZW A;  1O7L A;  2JEA I;  2WII B;  4LF5 Q;  2K05 A;  4JVZ A;  3S2H B;  2K5W A;  4GLV B;  1Y1W H;  2IL8 A;  1SLJ A;  1PZJ D;  4PMC A;  3J7A 5;  5K36 G;  2CWP A;  1HUM A;  4LFC L;  3M4O H;  5M5Y B;  1EIY B;  5C4Z A;  1TS5 A;  1S5E D;  2IWH A;  4A3J H;  1CT1 D;  1ZYR D;  1DM0 B;  1GVP A;  3FPU B;  1N8R C;  1RHP A;  2NTS A;  2IT1 A;  4C3H G;  1SMX A;  4POF A;  1TS4 A;  3TQY A;  2YYZ A;  3K81 C;  1K0S A;  3QIA A;  1H9J A;  2KED A;  4X64 Q;  3MHB A;  2GN5 A;  2NVY B;  2QF7 A;  1L1O C;  1JJC B;  3S1Q B;  1AFP A;  5EBD A;  5C44 H;  3L3O C;  2KEE A;  4DV6 Q;  1MHW C;  2Z6B A;  1TWH H;  5LL6 S;  1QJO A;  2SOB A;  4KK7 A;  5G3L F;  1XTC D;  4ZQ3 A;  4KJO A;  3GTL H;  3KUP A;  1AZQ A;  3EA6 A;  2JYO A;  1AW7 A;  5KYI A;  4X65 L;  2MJ8 A;  2QKI C;  2NVT B;  4NXN Q;  1AZP A;  1HNX Q;  4JYA L;  2NVQ H;  4JI6 L;  4DV7 L;  2FHT A;  1BVS A;  3OMC A;  3R2I A;  1VQ7 A;  1ILQ A;  1Y1V B;  3TEH B;  3MEH A;  1D1K A;  4A3E G;  3VR2 A;  2VQE Q;  3J7Y W;  4FF4 A;  3ERQ A;  1NE3 A;  3ZJY C;  3S1R H;  5E4W C;  3TRE A;  4WFN 3;  1I94 L;  4NPS A;  1AEX A;  3TN2 A;  2AKW B;  2FMM A;  2EYF A;  4DAY B;  2H5X A;  1K3B C;  3UDX A;  4K5W A;  1LTT D;  1D5Z C;  1MI2 A;  1CZW A;  2BCO A;  5I6Y A;  5C0X J;  4OO1 H;  4QMG A;  5CYU A;  2KCC A;  2MO0 A;  3H09 A;  3N52 A;  4XYO A;  3R8B A;  4P74 A;  4X3S A;  1WVL A;  3S15 H;  2EY6 A;  2X69 A;  4EQO A;  4GOP C;  4GOP B;  5KGU A;  1EIH A;  2K6A A;  1EEI D;  3AU7 A;  5IGG A;  4AIM A;  5CBE E;  1XNR Q;  1HA6 A;  3GTG B;  3MWY W;  1BR9 A;  2QDL A;  4A93 H;  3QO2 A;  1JIC A;  5C4J H;  1HUN A;  5IWA Q;  5IYD H;  3BJU A;  4ZAI A;  4K2K A;  1I4H A;  5KEE A;  4A3B G;  1DYQ A;  1MKH A;  2A68 D;  2ZXP A;  2B2T A;  2F3W A;  3VA7 A;  2CH4 A;  2JJQ A;  2JP1 A;  1L2F A;  1BF4 A;  1XX8 A;  1JOK A;  4DV4 Q;  4JI2 L;  1U4R A;  2WP8 J;  4UY8 C;  5D3I B;  1ESR A;  3QWN A;  3S17 B;  2IHF A;  2DUD A;  3KLR A;  1HZA A;  3CRL C;  1CKN B;  2CHB D;  4WRD A;  3HOZ H;  4X62 Q;  1SE3 A;  2HQE A;  3NPP A;  4DR2 Q;  3LGJ A;  3J80 i;  4NB3 A;  3HOY B;  1YNX A;  4CGY B;  1SND A;  5IGF A;  5JJI A;  2Q2I A;  4GN3 B;  2K5V A;  1HRJ A;  1DGS A;  1YNJ C;  2JA6 B;  2H1E A;  2MO1 A;  4EQP A;  2RDF A;  4F8M A;  3FEW X;  2ZXR A;  1B50 A;  3K7A H;  1LTL A;  2VB2 X;  5IT9 L;  1FL0 A;  1QCB D;  3MXP A;  3S1N B;  1SE8 A;  2PQA A;  2JA8 B;  3AEV A;  5T1I A;  4X3U A;  2A6E C;  4XTC S;  1HR0 Q;  1Y1W B;  1KXL A;  1EFW A;  3HP3 A;  3MXN B;  2PQE A;  4JI1 Q;  2IPK D;  1WTR A;  1L1O B;  4R4T A;  4LFB Q;  2A73 B;  4V19 0;  3WOE A;  4HAE A;  4AQY Q;  5C44 B;  2QDB A;  1SYB A;  3PIO A;  2KVM A;  2K5H A;  2EE1 A;  2OF1 A;  3EVQ A;  3KF6 B;  3VR4 A;  2VQF Q;  4OO1 G;  4X6A H;  1HQR D;  1QZH A;  4FF1 A;  3I4M G;  4H02 A;  4WJ4 A;  4PMB A;  3J81 j;  1D5X C;  3D3R A;  3T4A C;  1A2U A;  4X64 L;  3CD6 A;  3CU7 A;  1YVC A;  3MVV A;  1ET9 A;  2M2L A;  2MFI A;  3TZD A;  1S4Z A;  3T1H Q;  2NVX B;  1L1O A;  3GTM H;  3HGB A;  3OYY A;  4A75 A;  3L0O A;  2SNM A;  4TRD A;  1JE5 A;  2VNU D;  5IP9 H;  3NTH A;  2HIV A;  1XWE A;  3SK8 A;  1MSG A;  5DM6 3;  4TSS A;  3I3C A;  2B29 A;  1Z47 A;  4FVM A;  3J80 c;  1GKH A;  4OL7 A;  3NXW A;  4M1U B;  1Q1E A;  2F3I A;  4EVO A;  4C3J H;  2BH2 A;  4A3C G;  3U4Z A;  2B63 G;  5F2D A;  3I90 A;  5EJW A;  1IW7 C;  1GHJ A;  5LHY 1;  1PMR A;  4HJA A;  2JK8 A;  2E2I H;  3P7J A;  2JA6 H;  2NZH A;  2WKD A;  1JB3 A;  1NR4 A;  1XYI A;  3S1M H;  1EY9 A;  1X32 A;  1ILP A;  1EWI A;  2C35 B;  4F7X A;  2F52 A;  1ZYR C;  5CV8 A;  4B3M L;  1AH9 A;  4YHH Q;  3H0G H;  3GTG H;  4DXF A;  3NQT A;  4R1J A;  4JI6 Q;  1TWG B;  2K01 A;  2D62 A;  3NBH A;  3HOY G;  1OXS C;  2TMP A;  1JB7 A;  1QVF A;  4CJ2 C;  3AB9 A;  3M7N A;  1PH1 A;  1YJN A;  4QQB X;  3BDL A;  5C3W A;  2B2Y C;  1ZKO A;  4JI4 Q;  1HA5 A;  2EJM A;  1I6H H;  1EIG A;  3Q0A A;  4ZUI A;  4CDF C;  1VQK A;  1UE6 A;  1RD9 D;  4HIO A;  2A69 D;  2SNS A;  4HCS A;  5EPJ A;  2F0M A;  2VL6 A;  2KCN A;  1YI2 A;  4PZ6 A;  4HID A;  3PUX A;  4O0A A;  1TWF B;  2LXK A;  4KHV A;  1HNX L;  2B39 A;  2A69 C;  4BBR G;  2QEJ C;  1HXY D;  2KCM A;  4J8Q A;  4RFB A;  2EPB A;  4MN3 A;  1PRT C;  2F03 A;  4GS3 A;  2XIW A;  1Y1W G;  2Z9H A;  1X55 A;  1I4X A;  5M3M H;  1F2Y A;  1NUC A;  1CKM A;  4KY7 A;  4YIJ A;  5IWA L;  2K1B A;  4C2M H;  1T9H A;  2D0P A;  5JJZ A;  2I5M X;  1GM5 A;  1XMQ Q;  1IBK L;  2R7Z H;  2PZU A;  1KRT A;  3PO3 H;  1O7Y A;  3MTS A;  4JI0 Q;  4RCN A;  3KYH C;  1PFS A;  2F4I A;  2KOL A;  2AWN A;  4LF4 Q;  1FNW A;  2K7V A;  3SGI A;  4MTK A;  1KDC A;  2VB3 X;  1EY8 A;  2K32 A;  5FO8 B;  2ICE C;  4LUO A;  2OWO A;  3I4M H;  1OXX K;  2J7Z A;  1O78 A;  4KD3 A;  1PH4 A;  2F0O A;  1U4P A;  2NN6 H;  1WTQ A;  5IYB G;  4OWW B;  4LFA Q;  1O7Z A;  3Q22 A;  4ZK9 B;  1CHP D;  1SYG A;  1XXG A;  5EBC A;  2R92 G;  3K7A B;  3ER0 A;  5CV4 A;  4BA1 I;  2JA8 G;  2F4V L;  2UUC Q;  3GTP B;  1U4L A;  5C4X H;  1OTC A;  4RGM A;  4C3H H;  2N3S A;  4APV A;  3ONA B;  1OXU A;  2BE5 C;  4HED A;  1PTO C;  1A62 A;  4JCV E;  4DV0 Q;  3I70 A;  5KYL A;  4IUQ A;  2XGT A;  1V43 A;  1EYD A;  3URY A;  4QUF A;  4Q5V A;  5IY0 A;  3C3L A;  1VF5 C;  4NXM Q;  5NUC A;  2EXD A;  3BG3 A;  3S14 B;  3OHX C;  4YCW A;  4B3R Q;  5D3D A;  2K33 A;  1BCP C;  1SE4 A;  1PLF A;  1EQV A;  5M3M G;  1EYA A;  2FMC A;  3U50 C;  2OEO A;  2PNR C;  5C3E H;  1Q81 C;  2PW7 A;  4B3S Q;  4HCE A;  4DV3 L;  4FF3 A;  2R93 H;  1RIP A;  3OIP A;  4AH6 A;  4JBJ A;  3UE1 A;  2E2I B;  4GNX A;  2B63 B;  1PRT F;  2WFW A;  3GD7 A;  3WDN A;  3RLN A;  2OT2 A;  4L63 B;  3V2T A;  1H9S A;  4LUV A;  4C3J B;  4BBR B;  1YHA A;  2CH4 W;  1X6O A;  2IHE A;  3CW2 C;  4LAA A;  4J6H A;  5J1Z A;  3UDI A;  5ELF A;  3H3V I;  4PMW A;  1RJT A;  4G7H C;  3M4Y A;  3DMU A;  2B3G A;  1ICF B;  1KAW A;  4NKL A;  3NBH B;  3FKI H;  1ML0 D;  4XYQ A;  3FKI B;  4GKJ L;  1IBM Q;  3SVM A;  4YHH L;  1UE1 A;  4L5R C;  1PFM A;  2AHO B;  5C4X G;  4DNR B;  4DV0 L;  3J7A F;  3SK6 A;  1CK1 A;  4Y7N H;  1Q46 A;  2UXD L;  3AQQ A;  2B2Y A;  2R6G A;  4XT1 B;  4JI4 L;  2F0E A;  4IPD A;  1Q7Y C;  4B3R L;  1EEF D;  4YCU A;  1LLR D;  4KHP Q;  3PQI A;  2HHH L;  2JA8 H;  1RL2 A;  1STN A;  3BDO A;  4A3G G;  1C8C A;  4A3E H;  4J1M A;  1SN8 A;  1TKW B;  1TWH B;  4R4Q A;  1BXT A;  3FPP A;  4P72 A;  4QUC A;  4UAI A;  2EJF C;  1NSN S;  4LF9 Q;  2YTX A;  4A3D H;  1HTP A;  4JV5 L;  5HY6 A;  4FXD A;  1BNZ A;  3KDF A;  3MXN A;  1TXY A;  4M8A A;  2BDO A;  3DWQ A;  4F87 A;  1A2T A;  1JOR A;  4KKS A;  3CCM A;  2ICI A;  1IBK Q;  3D4D A;  2TSS A;  3SXH A;  3LWU A;  4NXN L;  1I4Q A;  4GN5 A;  1FNU A;  3AYH B;  1XNR L;  1X54 A;  3STB C;  1PTO H;  3CAM A;  1JMC A;  5D65 A;  1HQM C;  2CW0 D;  1PYB A;  2RCF A;  4X66 L;  1VDZ A;  2A6H C;  2DNE A;  3PIP A;  2KBN A;  2XWB B;  1PA6 A;  1VQD A;  2RBM A;  1TS3 A;  4KV6 A;  4R4O A;  5I9O A;  4DR6 Q;  1SSO A;  4C3I H;  1PVO A;  3VDY A;  4JBM A;  1OO9 B;  1A3V A;  3CPF A;  1NMF A;  2B2W A;  3I72 A;  4OX9 Q;  1FNV A;  1SRU A;  4JI5 L;  3HOU G;  3H3V C;  4LF7 L;  1XPR A;  5CV7 A;  3NTI A;  2ZXO A;  3MXG A;  1F9P A;  4B3T L;  1TWC B;  1PZI D;  2PI2 A;  3BYT B;  2QEX A;  2B2U A;  1WOC A;  4CJ1 B;  4X3K A;  2MPM A;  3A0J A;  1WTP A;  3ND9 A;  4IUR A;  4DU9 A;  2BH8 A;  4JPB W;  5IYD G;  2F0W A;  4E6I A;  4XT3 B;  3KJO A;  3T1Y Q;  3P20 A;  3I4N G;  1GJX A;  4YY3 L;  4JBW A;  4B08 A;  4IUV A;  4LUZ A;  4JI8 Q;  4LW1 A;  1VMP A;  4QIW B;  4RGT A;  2Q8T A;  5CC4 A;  3HOW G;  2Z6K C;  3VR5 A;  3SK5 A;  2PMZ B;  4WJW A;  2LKV A;  4IN3 A;  2A1A A;  1WCM G;  3STB D;  5M5X B;  1B2T A;  2AMC B;  2B2T C;  4C3I B;  1IZ6 A;  3VA5 A;  1QNK A;  3SHL A;  1XNQ L;  2D0O A;  3TDQ A;  3NE5 B;  1EUJ A;  3VYR A;  1MJC A;  1S5B D;  3M85 A;  1PH3 A;  3TP7 A;  4X62 L;  4ALP A;  2WB1 B;  3H6M A;  4DV5 Q;  2UUC L;  1PTO B;  1QVG A;  1DOL A;  1KNE A;  5EKI A;  2DY7 A;  1QWY A;  1XTD A;  2L5T A;  3KBX A;  1HCZ A;  2JSO A;  1ENF A;  1Z6H A;  1BCP D;  4KN4 C;  2VUM H;  3VYT A;  1B1Z A;  2LMC B;  1TWA H;  1JWS D;  2HQL A;  1K8O A;  1KQS A;  5GAG C;  2Y0S E;  4R8N A;  3NQI A;  4KN7 C;  1B44 D;  1ESF A;  3HOX G;  1BCP B;  4KHZ A;  2HUG A;  5C4X B;  2L12 A;  2JA5 B;  3HRZ C;  2HIX A;  1MGS A;  1T5X D;  4A93 G;  1SE2 A;  3C46 A;  3G6J B;  1FVI A;  1PTO D;  3EIV A;  3TP6 A;  4CBV A;  1PYS B;  1Y1V H;  2XWJ B;  3X3M A;  1N32 Q;  4BY1 G;  1PH7 A;  1EZ8 A;  2EDG A;  3T51 B;  3M3Y H;  4K14 A;  2WAQ E;  2NVT H;  4N9P A;  1JC7 A;  2RCN A;  4KKT A;  2IX1 A;  4K0K Q;  5CMD A;  1H9K A;  3D6C A;  2N78 A;  3J7A V;  2F0U A;  4DR3 Q;  3HOX B;  1LTI D;  4R9W A;  1R9T H;  3VR3 A;  4BY7 B;  2F0Q A;  5ELD A;  3Q6S A;  5IP7 H;  2L15 A;  3MC0 B;  1IBL L;  1GUO A;  1LAB A;  1SYC A;  4HJ8 A;  2XN9 C;  4LFC Q;  4JG2 A;  2UUA Q;  2K5Q A;  5FO7 B;  2XRS D;  4O2D A;  4A3J B;  3TRZ A;  2XNA C;  4BBS B;  2L1B A;  1ASZ A;  2PPB C;  5FK9 C;  2UXC L;  4G7O C;  2E2H H;  4DUZ L;  1YNJ D;  2KHS A;  3F2U A;  3I4N B;  1STE A;  3H3V H;  1S5F D;  5I6W A;  3HOV H;  4IUN A;  1GUS A;  2D2C C;  4DV1 L;  2HCI A;  3HOW H;  1LTG D;  1YNN D;  3E3X A;  3L2P A;  3I55 A;  4LMQ D;  4MTN A;  3ND8 A;  3A8I E;  3CCU A;  3EJI A;  4DNT B;  3RUZ A;  4KKU A;  3GTQ H;  4H13 C;  4JBK A;  3KOJ A;  1RKN A;  3S24 A;  3HS0 C;  1NR2 A;  2A74 C;  1IW7 D;  1X3Q A;  4RGO S;  2DN8 A;  3RLO A;  3VYS A;  1WTW A;  1N33 Q;  4DR7 Q;  1TWG H;  1SYF A;  4A3F B;  3K5N A;  3M4P A;  1U4M A;  1G91 A;  2B2W C;  1K28 A;  4A3D G;  4RG1 A;  3Q23 A;  4G4K A;  5CBA E;  3B6Y A;  4ZLT F;  3ZYY X;  1EFI D;  4RMF A;  3L9A X;  3I4L A;  3QOJ A;  2Z8L A;  5IOC A;  4DV3 Q;  1PDQ A;  4N8X 1;  1JJ2 A;  1K9M C;  1R4Q B;  4DUY L;  4QL5 A;  2EY5 A;  5I2Y A;  1HNW L;  4OX9 L;  2B2V A;  3PF5 A;  2EYL A;  4ZCK A;  4P2C B;  1R9T B;  5IYC G;  2AQ3 B;  2K5N A;  3HKZ B;  4A3F G;  3K80 C;  3I7F A;  2UUA L;  4IFD I;  2L9H A;  3DLL A;  2XRQ D;  4OHJ A;  1B7Y B;  1OXT A;  3HZX A;  1IBL Q;  1GD7 A;  2A5H A;  2JA7 G;  3RMH A;  4X66 Q;  4ULL A;  3AMU A;  4B9X A;  2QCP X;  1EWC A;  4JI7 L;  4ODG A;  5EKL A;  2I07 B;  3CXC A;  3F2D A;  3RZO H;  3W1G A;  3V05 A;  3TS2 A;  3S14 H;  2DGY A;  1WD1 A;  4IPH A;  4JC0 A;  4CHT B;  1VQN A;  4K8I A;  1VQA A;  1NJI C;  3CCJ A;  1D7Q A;  4DK0 A;  3GTK H;  4P75 A;  1EQR A;  4GLX A;  1CQF A;  3UDG A;  1SAP A;  3HKZ G;  1KRS A;  3CHB D;  1ROD A;  4QJF A;  2Z1C A;  3S16 H;  1IKM A;  3ERS X;  2UXB Q;  2VUM B;  1B3Q A;  2R7Z B;  2SDF A;  4MHE A;  1DOM A;  3HOZ B;  2HCC A;  4G7Z C;  2KQ3 A;  4I65 A;  1EY0 A;  4ZYS A;  1VQC A;  1HNZ Q;  1A63 A;  4JYA Q;  1GOZ A;  2K03 A;  3CKI B;  3OW2 A;  4L5S A;  4LNQ A;  1B9N A;  1SEB D;  1CM9 A;  2JXM B;  4RCO A;  5E1F A;  2L11 A;  1PYW D;  4RWS C;  1PRT B;  1EZ6 A;  1YIJ A;  1E3P A;  3IKJ A;  4H0L C;  1XMQ L;  1TII D;  1EQQ A;  3I73 A;  5COY A;  2F0I A;  5BR8 L;  1STH A;  1I3Q B;  1QE6 A;  2K75 A;  3P75 A;  3ICE A;  5JEA G;  3SR1 A;  4LF6 L;  5HGQ A;  2R7Z G;  4DR3 L;  4N8F A;  1VQ6 A;  3GP7 A;  1M90 C;  3PUV A;  5CGK A;  2K4K A;  5JEA H;  1CA6 A;  1STB A;  3PUY A;  3F1Z A;  3VYU A;  3D0F A;  1J5E L;  5K36 H;  4C2M B;  2EYO A;  1QIL A;  5C4H A;  1MBY A;  4IJL A;  1P8L A;  5T1G A;  1DCZ A;  1LAC A;  1CZG A;  3RR5 A;  2UU9 L;  3KFU A;  4JW0 A;  5G3L D;  4XXE A;  1PV4 A;  3IFD A;  1SRO A;  3TP5 A;  1EYG A;  1NBW A;  1JWU D;  4K2L A;  1I6V C;  3CCE A;  3W1B A;  2ES2 A;  2G9D A;  3BVG A;  3CMA A;  3A74 A;  3ITP A;  2UXB L;  1EY7 A;  1G2T A;  2EYP A;  4CKE A;  3A56 A;  3KF8 A;  1B53 A;  1D5M C;  2EVB A;  1NNX A;  1II3 A;  3ERO A;  4A3G B;  1CQV A;  1EY4 A;  4HSV A;  3H0G G;  1YHQ A;  1QG7 A;  5DLQ E;  4A3M B;  1SJE D;  1HFN A;  1N33 L;  1KDB A;  3RD4 A;  4XQQ A;  4C1N K;  3NWS A;  4A3I H;  1WD0 A;  4LF8 L;  3NEN A;  1S5D D;  1Y14 B;  5IIF A;  4YY3 Q;  2IY5 B;  1AE3 A;  1PFB A;  1SR3 A;  1BUV T;  1BOS A;  3OWE B;  1EY6 A;  4IQZ A;  2R92 H;  1KC8 C;  2NVY H;  5ELO A;  3G6E A;  5J3B A;  1FGU A;  4RH6 A;  2BE5 D;  1X3E A;  3E9H A;  1NAP A;  2VUM G;  3M9B A;  1VQH A;  1U9R A;  4Q0F A;  1CA5 A;  4IUT A;  4WOR A;  1K83 B;  1AE2 A;  2Q8I B;  1OXV A;  1VQM A;  1X3P A;  1X9N A;  2DY8 A;  1SBB B;  3NHH A;  1IYV A;  3HOV B;  1K73 C;  5BN4 A;  2LFN A;  1BBX C;  1G8Z D;  3KF8 B;  1XNQ Q;  2OTJ A;  3KF6 A;  1ENA A;  1TU2 B;  1WCM H;  3A7L A;  2F0F A;  2B8G A;  4YWM A;  1S72 A;  1I50 H;  3HKZ E;  4BBS H;  3V96 A;  4POG A;  1NTG A;  3GV3 A;  3HFZ B;  4LF4 L;  1E24 A;  4NMZ A;  1PXU A;  3I4M B;  1VCI A;  4CKB A;  2CVR A;  2NZO A;  2V1C C;  1D6E C;  4DV7 Q;  3UI2 A;  1FGB D;  2V4D A;  1Z7T A;  4NW2 A;  3U4V A;  1N32 L;  1SNO A;  1BDO A;  2F0L A;  2NBF A;  2X6L A;  2K04 A;  1FYC A;  2QW7 A;  2RQX A;  3GTJ H;  1SXT A;  2ZM6 L;  3PUW A;  3F2C A;  2AUJ D;  2EZV A;  3S1N H;  2NZ1 D;  4DV6 L;  5LMU L;  2F0H A;  3I8Z A;  3KK7 A;  5IGC A;  4YCV A;  2A6H D;  3QB3 A;  2EIF A;  3KLS X;  2J4X A;  3T56 B;  2ZJR A;  3RZD H;  1PTO F;  4JI3 Q;  2WV6 D;  4PQX A;  3PIP 3;  1I4P A;  2P5Z X;  2D5D A;  4L8J A;  1Q12 A;  1HNZ L;  4EX5 A;  1VQI A;  1KIX A;  4BS9 A;  4OWT B;  4IFD G;  1X65 A;  3NSW A;  1HZB A;  2E74 C;  2KHI A;  1E2V A;  3CF5 A;  1K8A C;  3WOF A;  4RKB A;  3R2T A;  4KTA A;  2A8V A;  5C3X A;  2Q8R E;  3ULP A;  1BBW A;  2XSC A;  3D8G A;  2VW9 A;  2XTI A;  2YTY A;  2F0G A;  3EBE A;  3RLF A;  2B63 H;  4DUZ Q;  3K58 A;  1D1I A;  4BY1 H;  1CFM A;  1F77 A;  1WTH A;  2HDM A;  4NDX A;  3W5O A;  3E6Z X;  1KTK A;  2E2J B;  5CV6 A;  3TSS A;  4A3C H;  2RSN A;  1GHK A;  3T1Y L;  3NEM A;  3DEP A;  1CKO A;  1GUT A;  4CDD C;  1UE5 A;  4HTH A;  1KLG D;  5I9P A;  3H15 A;  4KD4 A;  4DR1 Q;  2YTV A;  3HOU B;  3CME A;  4I7Z C;  1EY5 A;  1B9M A;  1CSP A;  2NVQ B;  4C56 C;  1UEA B;  3CCR A;  2L0C A;  3E0J A;  3JAM E;  4DAP A;  1J9O A;  1JWM D;  4DAV A;  2CCZ A;  1VS0 A;  1V1Q A;  4R8I A;  3J81 L;  4DV2 L;  2I5H A;  4HJ7 A;  4PZ7 A;  1E1T A;  4AYB B;  4DUY Q;  2F0T A;  4LJZ C;  1V1P A;  4U67 3;  1Q90 A;  1V9P A;  2I5L X;  4YWL A;  1Q8K A;  3OWF A;  3AFP A;  3A54 A;  5COR A;  3TME A;  3RZD B;  1BKB A;  1U5K A;  1LV9 A;  2LS0 1;  3GTP H;  1TQO A;  2FIN B;  2GVB A;  4HMJ A;  1HR0 L;  3S1R B;  2YU9 B;  3BDC A;  1U0L A;  5CV9 A;  1A0I A;  3K5L A;  1PFN A;  3HOX H;  4A3E B;  2PNH A;  4KHP L;  4X3T A;  1TR5 A;  3TBI B;  4LF8 Q;  3SK4 A;  2EXZ A;  1K3R A;  2F4V Q;  1M8A A;  2JE6 I;  2FFK B;  3KBG A;  2SEB D;  4TQU S;  1Y1V G;  5DEH A;  1HH2 P;  2PZT A;  2R7F A;  2RDG A;  3GTL B;  1XPO A;  1S40 A;  3M3Y B;  4LFA L;  3I4N H;  3NUC A;  4K5X A;  1WTV A;  4A4I A;  4JI7 Q;  1N36 L;  4MNO A;  2F0S A;  1QVC A;  3MZ5 A;  4A3K G;  3D4W A;  4PZ8 A;  2E2D C;  4GN4 B;  2YU9 H;  2KCT A;  3DEO A;  5JJK A;  2OTL A;  4GLA C;  1EWH A;  4CKC A;  3K57 A;  3CCV A;  2K28 A;  2F1M A;  3FMC A;  3AFQ A;  4A3L G;  1I50 B;  1VMC A;  2K14 A;  2E8G A;  1SNC A;  5M5W H;  1VQ5 A;  2QGQ A;  3DM3 A;  2F3V A;  5IT9 E;  4UP8 A;  4QB4 A;  3S2D H;  4DR5 L;  3M4O B;  1JOQ A;  2F0D A;  2B2U C;  2OQ0 A;  3LNN A;  3OOC A;  5EQ0 A;  3PGZ A;  3D4R A;  2WKC A;  1NY4 A;  2KHJ A;  2MNA A;  2JEB I;  1UWV A;  5ELB A;  4BXX H;  3BZD B;  3L7Z C;  4L5T A;  5H1S E;  1O80 A;  3S2H H;  2KUM A;  4ME3 A;  1V8Q A;  4L5Q A;  3G4S A;  2VS1 A;  2CFM A;  1BBU A;  5C3E G;  2NB0 A;  1B70 B;  1KD1 C;  1W2B A;  4HMI A;  4JOI C;  4Y7N B;  2GA4 B;  1L0W A;  3NBI A;  1KHI A;  4K6L A;  1F2Z A;  2UXC Q;  1EU3 A;  1ET6 A;  2ID0 A;  1NMG A;  4K5V A;  1D2B A;  3CCL A;  2IX3 A;  4NP5 A;  3KLS A;  4OIJ A;  2IX0 A;  4IAL A;  4C3I G;  5LMU Q;  1BCP F;  1BQQ T;  1TVX A;  2CWA A;  2JA6 G;  4DV1 Q;  3OTO L;  1CSQ A;  1IL8 A;  4HN7 A;  1N36 Q;  4HR7 B;  4BBR H;  4QIW E;  5M3F H;  3HKS A;  4JI3 L;  5FLM G;  2HD3 A;  4EQN A;  5A35 A;  1EL0 A;  4MIU A;  4EGV A;  2UU9 Q;  5E4X A;  5BR8 Q;  1E2W A;  1FJG L;  5C5M A;  3S9W A;  1B8A A;  3IFT A;  5KNB A;  2R61 A;  1Y8O B;  3I91 A;  1YIT A;  2RA4 A;  3DWA A;  1H9R A;  5M9O A;  4FF2 A;  5IGE A;  3TS0 A;  2ATW A;  5ELN A;  4UPA A;  4IUU A;  3CQZ H;  2UUB Q;  1MD2 D;  4KLK A;  1JJG A;  1VQP A;  2JA5 G;  2AQ2 B;  1GXD C;  3GV6 A;  5FLX c;  1CTM A;  2A19 A;  5DAU A;  5C5L A;  5C44 G;  4A3B B;  2WB1 E;  3OMG A;  1UUP A;  3J7Z C;  2D9U A;  2PMZ E;  1JE4 A;  1I5F A;  1DOK A;  4ZRZ A;  4DPG A;  5J39 A;  3FKI G;  3BYY B;  1K8G A;  2Y0S G;  5LMN L;  5J22 A;  4ABN A;  1AN8 A;  1F2M A;  1E1O A;  4J15 A;  4MZ9 A;  5GAE C;  1MJE A;  4A3L H;  5JVG 3;  3HOY H;  1W3S A;  3Q24 A;  3PO3 B;  2F0P A;  3D31 A;  3U58 A;  3S1Q H;  4DV5 L;  1VQ9 A;  1GUG A;  5EGT A;  2UXD Q;  5C0X G;  1HR0 W;  4IFD J;  1XMO L;  4BY7 G;  1VQJ A;  4A3B H;  1VQG A;  1SYE A;  2EYH A;  2RF4 A;  1RTN A;  1KAB A;  1SDF A;  4JI1 L;  3RZO B;  4IFD H;  4P71 A;  2OXP A;  2WAQ G;  5C0X H;  3BZC A;  2B8F A;  4V0B A;  3JC6 6;  2ZT9 C;  4ZKB B;  5JJL A;  2Y0S B;  4A3J G;  2ASB A;  5IP7 G;  2QIL A;  5C0X I;  2VQF L;  1R4P B;  4DXG A;  1RF2 D;  1SYD A;  1DON A;  3K5M A;  2JA5 H;  2RKS A;  4CJ0 B;  1ENC A;  2ZTC A;  4FXK C;  5IT9 c;  1UNS A;  5FJ8 G;  1KLU D;  2IJ0 A;  5EAY A;  3C2P A;  1HTL D;  1IYU A;  4GNX C;  4YWK A;  4BWG B;  3A8K E;  1D8L A;  2AQ1 B;  5AJ3 Q;  4ZUJ A;  3JAM c;  3PO2 B;  4GKK Q;  2Q2H A;  1IKL A;  1EU4 A;  1LO5 D;  1E22 A;  1PH2 A;  2R92 B;  3J80 L;  2WAC A;  3J81 i;  4LWC A;  2I0Q A;  1QUQ B;  4RAU C;  3CQZ B;  5EPL A;  4DR4 Q;  1X3G A;  4FNF A;  2I46 A;  2ZJQ A;  1F2L A;  1TWC H;  2NTT A;  4IPG A;  1YNN C;  1SFO B;  3G71 A;  4DAY A;  3VR6 A;  1IL2 A;  1WTO A;  4NXM L;  3K6O A;  4A3M H;  1ZXT A;  2KJX A;  2E75 C;  4CDE C;  2E76 C;  1SNP A;  1TS2 A;  2OQK A;  5BN3 A;  4B3S L;  1PH5 A;  5IOD A;  4B9W A;  3CCQ A;  1EQT A;  1J6Q A;  2K52 A;  5KIX A;  2BDN A;  4JI0 L;  2B2V C;  1I6H B;  3QOL A;  1YJW A;  4DAM A;  4PNY A;  4DR4 L;  5ISR A;  5IYB H;  2DJF C;  1SFO H;  3PF4 A;  3D6W A;  5FO9 B;  3QR8 A;  2EOT A;  4OEL B;  4A3F H;  4A3I B;  1VF7 A;  2CQA A;  2MHV A;  1STG A;  5D14 A;  1AP0 A;  3G48 A;  3PO3 G;  3RN2 A;  2RVL A;  3GO5 A;  1WYD A;  1WCM B;  2HHH Q;  2IW3 A;  4U68 A;  1MSH A;  2G5D A;  4DR5 Q;  4OON A;  1EOT A;  5IGD A;  1IYJ B;  1G51 A;  4P73 A;  5FLX L;  2GVA A;  1I3Q H;  4DN4 M;  4BA2 I;  3DHQ A;  1L0X B;  1JCK B;  1Y8P B;  2G9H D;  1P16 A;  4QY7 A;  1Q8I A;  4HSP A;  1CI3 M;  2LXJ A;  3RNU A;  2BA1 A;  1SMY C;  3I56 A;  3HG9 A;  2NVX H;  3HOZ G;  2Q2T A;  2CQO A;  1DXM A;  1RTO A;  4FP5 D;  4OEM B;  2E2H B;  2NWG A;  3NK9 A;  5FJ8 H;  4GNX B;  1N9W A;  4ID6 A;  1LT5 D;  5M5W B;  4XIG S;  5KRU A;  3DXJ C;  3T13 A;  4K0K L;  4FXG C;  3BS1 A;  5LMN Q;  3SE0 A;  2EYJ A;  4F88 A;  2VY3 A;  1VQF A;  3T53 B;  2LSS A;  3NTK A;  3NWT A;  3BZK A;  3CRK C;  3PUZ A;  2QA4 A;  5FLM H;  2F0V A;  2ZM6 Q;  4C3J G;  2O2L D;  1C48 A;  4FO2 A;  4DGZ A;  4DFA A;  1I4G A;  4WJ3 M;  3J81 c;  1I4R A;  2BOS A;  5FLX E;  2AUK A;  1C0A A;  4A3K B;  1G2S A;  2K50 A;  1XMO Q;  4PG3 A;  4RHS A;  4KJN A;  5I4D A;  3BVZ A;  2VZA A;  3QJY A;  2KA7 A;  5A2Q L;  2N49 A;  1FJG Q;  4B3M Q;  3KJP A;  1ONL A;  4DV2 Q;  2Z6K A;  3JAM L;  1RDP D;  1E2Z A;  2R93 G;  3JAM i;  1DZ1 A;  5CR3 A;  1W6J A;  1K8M A;  4LF5 L;  5EKK A;  3MFY A;  4OIK A;  3O13 A;  5FKA C;  3P1H A;  5HGT A;  1LT4 D;  3N6R A;  3PV0 A;  4JI8 L;  5JVH 3;  4DR6 L;  3LWE A;  1VQB A;  3OW7 A;  5GQO A;  4GOP A;  1E7Z A;  3GQB A;  1SJH D;  1A8V A;  4N9T A;  4Y52 H;  2LY7 A;  2ZTE A;  3S17 H;  4UP9 A;  1TY2 A;  4PV1 C;  3K0Y A;  3E5S A;  1KNA A;  3K7U C;  4LF6 Q;  3H0G B;  4TVA B;  1JQY D;  3EN2 A;  1WTX A;  1DD2 A;  4IUP A;  3FHW A;  2PI2 E;  4C1N I;  1Y69 U;  2O4X A;  2MQH A;  1A15 A;  2RSO A;  4RGN A;  2FJ2 A;  4LF9 L;  3CPW A;  4KMU C;  1S5C D;  3EFX D;  2Q2U A;  3A5U A;  3PCO B;  5I2X A;  5IGB A;  1XPU A;  1E0B A;  3A7A B;  4A93 B;  2NYZ D;  4KY6 A;  1TY0 A;  5M3F B;  1EIF A;  2RHQ B;  1STA A;  4H44 C;  1JR0 D;  2AWO A;  3IAY A;  1HPC A;  1H9S B;  2Z4I A;  1G6Z A;  3HOW B;  2VQE L;  1ZEQ X;  3EQL C;  3OTO Q;  3GTM B;  3S16 B;  1PZK D;  2F0K A;  2N55 A;  2L55 A;  1O7I A;  1VQE A;  1UEB A;  3S1M B;  5AJ3 L;  1WI5 A;  3IL8 A;  4FDB A;  3PIO 3;  1C7Y A;  3FRP B;  4KY5 A;  1LTA D;  4X65 Q;  1NCV A;  2ZJP A;  4O42 A;  2ALY B;  2F0J A;  3GTK B;  3UDF A;  4KI0 A;  2UUB L;  2R7D A;  5JPM C;  4A3D B;  2EY2 A;  5GAH C;  3X3N A;  4JI5 Q;  4OO1 I;  3R93 A;  2O5I C;  5HUR A;  2RDH A;  1H9M A;  1N34 Q;  2DJG C;  2M00 A;  3W3A A;  3GTJ B;  3T1H L;  2YV5 A;  4A3K H;  3A5Z B;  2ENB A;  1Q82 C;  3K8A A;  2EYM A;  2N88 A;  5CV5 A;  5GAD C;  3OPO A;  1CKN A;  3WWV A;  3CC7 A;  5C6A A;  1Q86 C;  3CP0 A;  5DM7 3;  3E0E A;  1Q1B A;  3S2D B;  1X56 A;  4IO9 A;  3QG1 A;  1V1P B;  3R3O A;  5IE8 A;  4B3T Q;  4QF4 A;  5E7N A;  3TP8 A;  2N8N A;  5JAV A;  3SDZ A;  3HEJ A;  4AYB G;  4RA8 A;  2EY1 A;  4QGU A;  1PH8 A;  1LT6 D;  3GTO B;  4IJH A;  4DKA C;  1F9Q A;  4UDU C;  3ULJ A;  4OGQ C;  3OIQ A;  3CCS A;  1Y8N B;  1PH9 A;  1EOV A;  5M3F G;  1CHQ D;  1Z9F A;  1X3F A;  5M5Y H;  1VQ4 A;  4I7A A;  1TWF H;  5JPN C;  3CC2 A;  2PW5 A;  1DJR D;  1J5E Q;  2WIN B;  2KEC A;  5A2Q E;  1LTS D;  1QNU A;  1CUK A;  1JOO A;  2RHS B;  1HZC A;  1WFQ A;  1HHV A;  3HOU H;  3F2B A;  3GDE A;  3KDF B;  5LL6 X;  1B3A A;  2ZTD A;  3E9I A;  2MGS A;  2WB1 G;  4ME5 A;  2EQS A;  2CKZ B;  2L4N A;  1RCV D;  2HT1 A;  3F8T A;  2X6G A;  3BVM A;  3A55 A;  4R4I A;  2R93 B;  1W6K A;  1KL9 A;  3G7L A;  2E2J H;  3MFG A;  3I2Z A;  4R4C A;  1YZ6 A;  4XQN A;  4HJ9 A;  2Z4H A;  3MA2 B;  2NN6 I;  5C4J B;  2PCF B;  3BU2 A;  2FXQ A;  4JI2 Q;  3U9O A;  4DV4 L;  3H94 A;  3GTO H;  2HDL A;  3K59 A;  1QB5 D;  4IOA A;  4CDC C;  4GKK L;  4RKL A;  2C9O A;  4DR2 L;  3IRB A;  4LFB L;  1J8I A;  2PQA B;  5LMN W;  4DK3 C;  3ULL A;  4A3G H;  1YJ9 A;  1VQL A;  1MIU A;  3NEL A;  2MP1 A;  3S15 B;  1QZG A;  1QUQ A;  4BY7 H;  1H95 A;  1YBY A;  4ILW A;  5TSS A;  1UAP A;  1HNW Q;  3PMF A;  3TZU A;  4BXX G;  1ICW A;  5JEA J;  1L0Y B;  4DK6 C;  3CC4 A;  2WAQ B;  4DR1 L;  1FR3 A;  3UE0 A;  2JN4 A;  4C3H B;  5M5X H;  3RN5 A;  1ASY A;  5C3E B;  1PHJ A;  4DF7 A;  3LX0 A; 
#chains in the Genus database with same CATH homology
 4HIK A;  3TS0 A;  1C9O A;  5ELN A;  4A3I G;  1PH6 A;  4UPA A;  4BBR G;  2ATW A;  4JI7 L;  4GKJ Q;  3CQZ H;  2KCM A;  2UUB Q;  4KLK A;  1JJG A;  1VQP A;  2JA5 G;  2JA9 A;  2OCE A;  4GS3 A;  3CXC A;  3F2D A;  3W1G A;  5FLX c;  3RZO H;  3TS2 A;  2A19 A;  2DGY A;  3S14 H;  1Y1W G;  4IPH A;  3FP9 A;  4JC0 A;  1X55 A;  2WB1 E;  5C44 G;  1VQA A;  1VQN A;  4HJ5 A;  5M3M H;  3J7Z C;  1NJI C;  3CCJ A;  1CKM A;  1D7Q A;  2PMZ E;  5IWA L;  1I5F A;  3Q8D A;  4P75 A;  4DPG A;  4C2M H;  3FKI G;  3GTK H;  1G6P A;  1EQR A;  1T9H A;  2D0P A;  2I5M X;  4GLX A;  1XMQ Q;  3UDG A;  2Y0S G;  5LMN L;  1GM5 A;  1K8G A;  1IBK L;  2R7Z H;  1KRT A;  3HKZ G;  3PO2 G;  3PO3 H;  1I94 Q;  1KRS A;  4BBS G;  4JI0 Q;  4AYB E;  1E1O A;  3KYH C;  4J15 A;  4MZ9 A;  1PFS A;  5GAE C;  4QJF A;  1MJE A;  2AWN A;  4A3L H;  4LF4 Q;  1W3S A;  3HOY H;  3S16 H;  3SGI A;  3ERS X;  2UXB Q;  3D31 A;  3PSI A;  3U58 A;  1S3O A;  2Z0S A;  3M4Q A;  1VQ8 A;  3S1Q H;  4DV5 L;  1VQ9 A;  2UXD Q;  4LUO A;  2OWO A;  3I4M H;  1XJV A;  1OXX K;  1YEZ A;  5C0X G;  1VQC A;  1PH4 A;  1HNZ Q;  1HR0 W;  4JYA Q;  1A63 A;  4IFD J;  1XMO L;  4BY7 G;  3OW2 A;  1VQJ A;  4L5S A;  4A3B H;  4LNQ A;  1VQG A;  5IYB G;  4OXP A;  4OWW B;  4LF7 Q;  2RF4 A;  1UE7 A;  4LFA Q;  4JI1 L;  4DNI A;  4P71 A;  2BA0 A;  2WAQ G;  3BZC A;  2R92 G;  3JC6 6;  1YIJ A;  1E3P A;  5JJL A;  3ER0 A;  4BA1 I;  4A3J G;  1XMQ L;  2ASB A;  2JA8 G;  5IP7 G;  4EQ5 A;  5C0X I;  1EQQ A;  2UUC Q;  2VQF L;  1M1K C;  2F4V L;  4HIM A;  2E5L Q;  2JA5 H;  5C4X H;  5BR8 L;  1OTC A;  4C3H H;  2N3S A;  2ZTC A;  2KEN A;  5IT9 c;  2K75 A;  3ICE A;  4APV A;  5JEA G;  5FJ8 G;  4LF6 L;  5HGQ A;  1OXU A;  4OWX B;  2R7Z G;  1A62 A;  1LUZ A;  5EAY A;  4JCV E;  4DV0 Q;  4DR3 L;  4GNX C;  4YWK A;  1VQ6 A;  1M90 C;  3PUV A;  2XGT A;  1V43 A;  3I4O A;  1LM0 A;  5AJ3 Q;  1D8L A;  2K4K A;  3MEF A;  3JAM c;  5IP9 G;  4GKK Q;  3PUY A;  5IY0 A;  2Q2H A;  3F1Z A;  1J5E L;  3D0F A;  3KLW A;  4JOI A;  1E22 A;  4NXM Q;  1PH2 A;  3HOV G;  2EXD A;  1N34 L;  4IJL A;  4YCW A;  4B3R Q;  3J81 i;  1P8L A;  4LWC A;  4A3M G;  2I0Q A;  1QUQ B;  4DR4 Q;  2JQO A;  3RR5 A;  1X3G A;  2UU9 L;  3KFU A;  1PV4 A;  5M3M G;  1SRO A;  2ZJQ A;  1TWC H;  1EYG A;  1NBW A;  4UP7 A;  4IPG A;  4DR7 L;  1K0R A;  3G71 A;  1G29 1;  3W1B A;  3CCE A;  2ES2 A;  3U50 C;  5IYC H;  1IL2 A;  5C3E H;  3K0X A;  1Q81 C;  4B3S Q;  4DV3 L;  4A3M H;  3CMA A;  4NXM L;  2R93 H;  1RIP A;  3A74 A;  4JBJ A;  4AH6 A;  1WJJ A;  3UE1 A;  2OQK A;  4B3S L;  2UXB L;  4GNX A;  1PH5 A;  3CCQ A;  1YHB A;  2WFW A;  2JA7 H;  1JT8 A;  3GD7 A;  1K83 H;  1J6Q A;  1IBM L;  2K52 A;  3RLN A;  4JI0 L;  5GRO A;  4LUV A;  3H0G G;  1YJW A;  1YHA A;  1YHQ A;  1X6O A;  2IHE A;  3CW2 C;  5DLQ E;  4DAM A;  3H3V I;  3UDI A;  4PMW A;  4DR4 L;  1GO3 E;  1N33 L;  1HZ9 A;  2E5L L;  5IYB H;  4A3I H;  4A76 A;  1SFO H;  2B3G A;  3PF4 A;  4LF8 L;  2NN6 G;  3NEN A;  1KAW A;  1Y14 B;  3NBH B;  3FKI H;  1IXR A;  4YY3 Q;  2IY5 B;  4IOC A;  1AE3 A;  4GKJ L;  1IBM Q;  4JV5 Q;  4YHH L;  1SR3 A;  4A3F H;  2R92 H;  1KC8 C;  2NVY H;  5ELO A;  1UE1 A;  4L5R C;  3G6E A;  4IPC A;  1FGU A;  2AHO B;  5J3B A;  5C4X G;  4AQY L;  1X3E A;  3E9H A;  4DV0 L;  1HJP A;  1LYL A;  3G48 A;  3PO3 G;  3PO2 H;  2VUM G;  1VQO A;  3M9B A;  1VQH A;  4Y7N H;  3RN2 A;  1Q46 A;  3GO5 A;  2UXD L;  1WYD A;  2HHH Q;  2JEA I;  3AQQ A;  1AE2 A;  4DR5 Q;  4OON A;  1IYJ B;  1OXV A;  1G51 A;  2R6G A;  4P73 A;  1VQM A;  1X9N A;  4JI4 L;  4LF5 Q;  2GVA A;  4GLV B;  1Y1W H;  1SLJ A;  4IPD A;  1Q7Y C;  1I3Q H;  4BA2 I;  3J7A 5;  4B3R L;  5K36 G;  1P16 A;  2CWP A;  4QY7 A;  4YCU A;  4KHP Q;  4LFC L;  1K73 C;  2LXJ A;  3RNU A;  2BA1 A;  2HHH L;  2JA8 H;  1RL2 A;  3M4O H;  4A3G G;  3I56 A;  1EIY B;  4A3E H;  3HOZ G;  2NVX H;  1SN8 A;  2Q2T A;  2CQO A;  4R4Q A;  3KF8 B;  4P72 A;  4A3J H;  1XNQ Q;  2OTJ A;  3KF6 A;  1WCM H;  4YWM A;  5FJ8 H;  3HKZ E;  1I50 H;  1N9W A;  4GNX B;  1GVP A;  1S72 A;  4POG A;  1NTG A;  4BBS H;  1N8R C;  4LF9 Q;  2IT1 A;  2YTX A;  3HFZ B;  4A3D H;  4JV5 L;  1SMX A;  4XIG S;  5HY6 A;  4POF A;  1E24 A;  3KDF A;  2YYZ A;  3K81 C;  3TQY A;  4LF4 L;  1TXY A;  1VCI A;  4X64 Q;  4K0K L;  2GN5 A;  1L1O C;  5LMN Q;  1JJC B;  2NZO A;  3CCM A;  5C44 H;  2V1C C;  1IBK Q;  2VY3 A;  1VQF A;  4DV6 Q;  4DV7 Q;  1TWH H;  2LSS A;  3BZK A;  3PUZ A;  2QA4 A;  3U4V A;  4NXN L;  5FLM H;  4GN5 A;  2ZM6 Q;  1N32 L;  3AYH B;  4WJ3 M;  1XNR L;  3J81 c;  3GTL H;  1X54 A;  3STB C;  3CAM A;  1C0A A;  4X65 L;  1JMC A;  3F2C A;  3GTJ H;  2ZM6 L;  2K50 A;  3PUW A;  1XMO Q;  4PG3 A;  1HNX Q;  1PYB A;  4NXN Q;  2NVQ H;  4JYA L;  3S1N H;  4JI6 L;  4X66 L;  4DV6 L;  5LMU L;  1BVS A;  4DV7 L;  3PIP A;  2KBN A;  1PA6 A;  1VQ7 A;  1VQD A;  2VZA A;  3TEH B;  4R4O A;  4YCV A;  4A3E G;  4DR6 Q;  2N49 A;  4C3I H;  2EIF A;  4B3M Q;  1FJG Q;  1PVO A;  2VQE Q;  3VDY A;  4JBM A;  3KJP A;  2ZJR A;  1NE3 A;  2Z6K A;  3ZJY C;  4DV2 Q;  3S1R H;  3CPF A;  3TRE A;  1NMF A;  1I94 L;  2R93 G;  3RZD H;  4JI3 Q;  4OX9 Q;  4JI5 L;  1SRU A;  4NPS A;  3JAM i;  3HOU G;  4LF5 L;  4LF7 L;  2AKW B;  1XPR A;  4DAY B;  2H5X A;  3UDX A;  4B3T L;  2PI2 A;  2QEX A;  3PV0 A;  1Q12 A;  1HNZ L;  4JI8 L;  4EX5 A;  1VQI A;  4DR6 L;  1WOC A;  1KIX A;  5C0X J;  4OWT B;  1VQB A;  4IFD G;  5GQO A;  1X65 A;  3A0J A;  4GOP A;  2MO0 A;  3S15 H;  4P74 A;  1HZB A;  2KHI A;  4GOP C;  1E7Z A;  3CF5 A;  4GOP B;  1K8A C;  1A8V A;  2BH8 A;  5IYD G;  4Y52 H;  3T1Y Q;  2ZTE A;  3KJO A;  3S17 H;  4UP9 A;  3I4N G;  4AIM A;  2A8V A;  4YY3 L;  4JBW A;  1XNR Q;  3K7U C;  3ULP A;  4LUZ A;  4LF6 Q;  4JI8 Q;  1BBW A;  4LW1 A;  4TVA B;  3EN2 A;  4A93 H;  2VW9 A;  2XTI A;  5C4J H;  3HOW G;  5IWA Q;  2YTY A;  3FHW A;  3EBE A;  3RLF A;  2B63 H;  5IYD H;  3BJU A;  4LFB L;  4DUZ Q;  2Z6K C;  4BY1 H;  2PI2 E;  3W5O A;  2MQH A;  4A3B G;  2A1A A;  1WCM G;  3STB D;  1MKH A;  4A3C H;  2AMC B;  3T1Y L;  4LF9 L;  2JJQ A;  3NEM A;  3CPW A;  1L2F A;  2Q2U A;  1IZ6 A;  3A5U A;  3PCO B;  1CKO A;  1UE5 A;  1XPU A;  3H15 A;  1XNQ L;  2D0O A;  4DR1 Q;  1EUJ A;  4DV4 Q;  2YTV A;  4JI2 L;  1MJC A;  3CME A;  2WP8 J;  1CSP A;  3M85 A;  4UY8 C;  1EIF A;  1PH3 A;  2RHQ B;  4X62 L;  3CCR A;  4ALP A;  4DV5 Q;  2UUC L;  2IHF A;  2AWO A;  2DUD A;  1QVG A;  1HZA A;  1XTD A;  1CKN B;  2CCZ A;  1VS0 A;  1V1Q A;  3HOZ H;  2VQE L;  4X62 Q;  4DV2 L;  2I5H A;  2VUM H;  4HJ7 A;  4PZ7 A;  1E1T A;  3OTO Q;  3LGJ A;  4DUY Q;  4DR2 Q;  3J80 i;  4NB3 A;  1TWA H;  1YNX A;  2HQL A;  1KQS A;  5JJI A;  2Q2I A;  4GN3 B;  1O7I A;  1VQE A;  2Y0S E;  2K5V A;  1V9P A;  5GAG C;  1UEB A;  2I5L X;  4YWL A;  5AJ3 L;  1Q8K A;  1DGS A;  1WI5 A;  4FDB A;  3AFP A;  1C7Y A;  3HOX G;  4KHZ A;  4X65 Q;  2ZJP A;  1BKB A;  2HIX A;  1U5K A;  2ALY B;  2MO1 A;  3GTP H;  4A93 G;  3UDF A;  2GVB A;  4KI0 A;  1FVI A;  2R7D A;  3EIV A;  1HR0 L;  2UUB L;  5GAH C;  4JI5 Q;  3K7A H;  1LTL A;  4OO1 I;  1PYS B;  1U0L A;  1Y1V H;  1N32 Q;  4BY1 G;  1PH7 A;  1A0I A;  1FL0 A;  3HOX H;  2PNH A;  4KHP L;  1N34 Q;  3M3Y H;  4LF8 Q;  1SE8 A;  2WAQ E;  3T1H L;  1K3R A;  2YV5 A;  2F4V Q;  2NVT H;  2JE6 I;  2PQA A;  4A3K H;  3A5Z B;  3AEV A;  2RCN A;  1Q82 C;  3K8A A;  2IX1 A;  4K0K Q;  4TQU S;  1Y1V G;  1HH2 P;  2R7F A;  4XTC S;  1HR0 Q;  1KXL A;  1EFW A;  2N78 A;  3MXN B;  5GAD C;  1CKN A;  1XPO A;  1S40 A;  3WWV A;  3CC7 A;  4JI1 Q;  4LFA L;  3I4N H;  1Q86 C;  3CP0 A;  4DR3 Q;  4A4I A;  4JI7 Q;  1L1O B;  3E0E A;  1Q1B A;  4MNO A;  1QVC A;  1N36 L;  4A3K G;  1X56 A;  4R4T A;  1R9T H;  4LFB Q;  4PZ8 A;  4IO9 A;  4AQY Q;  5IE8 A;  2YU9 H;  4GN4 B;  5IP7 H;  4B3T Q;  2KCT A;  2L15 A;  1IBL L;  5E7N A;  5JJK A;  2N8N A;  3PIO A;  4HJ8 A;  2OTL A;  4GLA C;  2K5H A;  2VQF Q;  3KF6 B;  4OO1 G;  4LFC Q;  4AYB G;  4JG2 A;  3CCV A;  4X6A H;  1QZH A;  3I4M G;  4WJ4 A;  4H02 A;  2UUA Q;  3AFQ A;  4A3L G;  4QGU A;  3J81 j;  3CD6 A;  2K14 A;  2E8G A;  4O2D A;  5M5W H;  4X64 L;  1VQ5 A;  1YVC A;  1PH8 A;  2QGQ A;  3DM3 A;  3TRZ A;  4IJH A;  4DKA C;  2MFI A;  4UP8 A;  1ASZ A;  3ULJ A;  2UXC L;  3T1H Q;  3S2D H;  1L1O A;  3CCS A;  2E2H H;  4DUZ L;  1PH9 A;  3GTM H;  4DR5 L;  3OYY A;  4A75 A;  1EOV A;  3L0O A;  5M3F G;  2OQ0 A;  3H3V H;  1JE5 A;  1Z9F A;  5IP9 H;  3PGZ A;  3HOV H;  2VNU D;  4DV1 L;  1NY4 A;  1X3F A;  5M5Y H;  1VQ4 A;  2HIV A;  2KHJ A;  2MNA A;  2JEB I;  1TWF H;  3HOW H;  1UWV A;  3CC2 A;  4BXX H;  3L7Z C;  1J5E Q;  4L5T A;  2B29 A;  1Z47 A;  5H1S E;  3L2P A;  3J80 c;  1GKH A;  3S2H H;  4ME3 A;  3I55 A;  1CUK A;  4L5Q A;  2RHS B;  2VS1 A;  3G4S A;  1Q1E A;  1HZC A;  1WFQ A;  2CFM A;  2F3I A;  4MTN A;  4C3J H;  3CCU A;  2BH2 A;  4A3C G;  3U4Z A;  3HOU H;  1BBU A;  3F2B A;  3GDE A;  2B63 G;  3KDF B;  5C3E G;  1B70 B;  3GTQ H;  1KD1 C;  1W2B A;  2ZTD A;  4JBK A;  3E9I A;  2WB1 G;  3KOJ A;  2EQS A;  2CKZ B;  4HJA A;  4JOI C;  2JK8 A;  3F8T A;  1L0W A;  3S24 A;  4R4I A;  2E2I H;  3RLO A;  2HT1 A;  4DR7 Q;  2JA6 H;  1KHI A;  1N33 Q;  1KL9 A;  1TWG H;  2NZH A;  2E2J H;  3M4P A;  2UXC Q;  4A3D G;  3I2Z A;  2ID0 A;  1NMG A;  1YZ6 A;  4R4C A;  4RG1 A;  4HJ9 A;  3S1M H;  3CCL A;  1EWI A;  2C35 B;  2F52 A;  4B3M L;  2NN6 I;  3B6Y A;  1AH9 A;  4YHH Q;  3BU2 A;  4RMF A;  2FXQ A;  3H0G H;  4JI2 Q;  2IX0 A;  4DV4 L;  3GTG H;  3GTO H;  4IOA A;  5LMU Q;  4GKK L;  4DV3 Q;  4R1J A;  4JI6 Q;  1JJ2 A;  1K9M C;  2CWA A;  2D62 A;  2JA6 G;  3HOY G;  4DV1 Q;  3OTO L;  4DUY L;  3IRB A;  4QL5 A;  1CSQ A;  2PQA B;  5LMN W;  1OXS C;  4DR2 L;  1JB7 A;  4DK3 C;  3ULL A;  1N36 Q;  1QVF A;  3M7N A;  4A3G H;  1PH1 A;  1YJ9 A;  1YJN A;  4QQB X;  1VQL A;  1MIU A;  3NEL A;  4BBR H;  1HNW L;  4QIW E;  1QZG A;  5M3F H;  1QUQ A;  3HKS A;  4JI4 Q;  4JI3 L;  5FLM G;  4OX9 L;  1I6H H;  4BY7 H;  3PF5 A;  1YBY A;  1H95 A;  5IYC G;  2UU9 Q;  1VQK A;  1HNW Q;  2K5N A;  5BR8 Q;  1UE6 A;  4BXX G;  4HIO A;  5JEA J;  3K80 C;  3I7F A;  4A3F G;  2UUA L;  1FJG L;  4IFD I;  3DLL A;  1B8A A;  4DK6 C;  1B7Y B;  1OXT A;  2VL6 A;  3CC4 A;  4DR1 L;  1YI2 A;  4PZ6 A;  4HID A;  3PUX A;  1GD7 A;  3UE0 A;  1YIT A;  5M5X H;  4O0A A;  4X66 Q;  3RN5 A;  1IBL Q;  2JA7 G;  2LXK A;  1ASY A;  1HNX L;  1PHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...