5M5XH

Rna polymerase i elongation complex 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Molecular Structures of Transcribing RNA Polymerase I.
pubmed doi rcsb
total genus 17
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m5xH00
1NY4A 3UDXA 1P16A 1J5EL 2E5LL 2JA6G 4ALPA 2NVYH 1CKMA 1SMXA 2UXCL 3KF6A 4YHHQ 2MQHA 2AWOA 3GTKH 2NZOA 1EOVA 1IL2A 3J81c 2E2JH 1SR3A 1QVCA 2JA6H 4IPCA 4BY7H 1D8LA 4BXXG 2RHQB 1A8VA 4NXNL 1KRTA 2AHOB 3F8TA 3FKIG 5JJIA 1HJPA 1BBWA 1GM5A 4A3GG 1Y1VG 1MJEA 2V1CC 4DR3Q 1N33Q 5M3MG 5M5WH 3NELA 1XNQQ 3I4OA 3FKIH 4PG3A 4MZ9A 1YHBA 4HIOA 1HNXL 1FJGL 3GTPH 4DV3L 1N32L 2UXDL 4DUYQ 3HOZH 5JJLA 1E1TA 5M3MH 5JJKA 2YV5A 4A3FH 1K8GA 2UU9Q 4R4OA 4A3CG 4HJ7A 1DGSA 1LM0A 2WAQE 3UE1A 3BZCA 3NENA 3L2PA 3KJOA 4AIMA 1XPOA 1Q81C 4DR2Q 2C35B 1E3PA 1LUZA 2OCEA 1VQPA 4JI7L 4JI1L 1W3SA 1KXLA 4DUZL 1PH4A 1N36Q 4JG2A 3RZDH 3TS2A 4R4QA 4OONA 4UPAA 1U0LA 4RG1A 2F52A 4B3ML 1NJIC 4LF6L 3LGJA 4LNQA 2QA4A 3CW2C 4C3JH 3OW2A 2JA5H 4P72A 2OWOA 4JI5Q 1PA6A 4FDBA 4UP7A 2R93G 3HKZE 1VQFA 1PH1A 4JI4Q 2NVQH 4YCVA 3K7UC 4IOCA 1MJCA 3L7ZC 1R9TH 2XGTA 2R93H 4WJ3M 1Y1WH 1XMQQ 2Y0SE 2MO1A 2ZTDA 2ZTCA 1KHIA 3K0XA 1BVSA 1BKBA 1UEBA 4JCVE 4Y52H 1D7QA 4A3KG 1N9WA 1IBML 3K8AA 2VQEL 3L0OA 2DGYA 1SROA 1VQ6A 1K73C 2WB1G 1S3OA 4JI2L 4PZ6A 4JBJA 4A3MH 3T1HL 2Q2UA 1I6HH 1YNXA 1XPRA 3CPWA 5C4XG 5M5YH 3CC4A 1P8LA 5IP7G 1YJ9A 4A3IG 1L1OA 3S2HH 4GKKQ 1OTCA 1PH2A 4DV0L 3PF4A 3UDFA 1NMFA 4TQUS 1I5FA 3GO5A 3KLWA 3DLLA 1J5EQ 2R92H 3M4OH 3GDEA 2E5LQ 4A3IH 2ZTEA 2UXCQ 2IT1A 2K52A 3GTJH 4LF4L 3BZKA 2UXBL 3W1BA 1AE3A 1NE3A 2E2IH 3JAMc 3KFUA 4JI8Q 3CP0A 1VQGA 1RL2A 2JA8G 4NXNQ 4B3RL 4JYAL 4OWXB 2YTYA 3CCQA 1JE5A 4IPDA 5AJ3L 2JA8H 2HIVA 4GN3B 4R1JA 1HZAA 2A19A 3S1RH 1QVGA 1HNXQ 1NTGA 4LF9L 4DAMA 1FJGQ 1N32Q 2JQOA 4DV3Q 3OTOL 2UXDQ 4LFBL 3JC66 1VQ7A 4Y7NH 2VUMG 1JJGA 1PVOA 2QEXA 4EX5A 5FLXc 2I5HA 2VZAA 4JI0L 4POFA 4BBRG 2CWAA 3G71A 4GOPA 1OXSC 1VQ8A 3HOWG 2K5HA 4XIGS 4JI1Q 4JI7Q 2VUMH 3HOYG 3CXCA 4DUZQ 1QUQA 1WCMG 1QUQB 3F2CA 1EYGA 1LYLA 2N49A 4H02A 3HOWH 4LFAL 5GAGC 1AE2A 3I4NG 4B3MQ 4LF6Q 1JJCB 3J7A5 3HOYH 1RIPA 2MFIA 3CCEA 4DR6L 1WCMH 5FJ8G 1PFSA 3PF5A 5FLMH 2F4VL 2ID0A 1Q1BA 2R7ZH 3I4NH 2K75A 1LTLA 5C4JH 2E8GA 1IYJB 5FJ8H 2GVBA 3HOXG 1YJNA 2VW9A 1X56A 4X65L 2WAQG 5E7NA 4LF8L 4YCWA 2VQFL 3HOXH 4A3LG 1PYBA 1V1QA 4EQ5A 1VQ9A 3VDYA 5IY0A 3RN2A 1IBMQ 1XPUA 3HOUG 2VQEQ 2VY3A 3CPFA 4X62L 3OYYA 3F2BA 2EIFA 1BBUA 4IO9A 1PHJA 4A3DH 1VQNA 1K0RA 3GTGH 4JI3L 1HNWL 4JI2Q 4DR4L 2HHHL 1YHAA 3HOUH 3T1HQ 1IBKL 2UUAL 1Q7YC 3EBEA 3UE0A 1JT8A 2N8NA 2PI2A 5IP9H 4R4IA 3MEFA 4BY7G 1L0WA 4OX9L 3KF6B 4DV0Q 1HH2P 3CCJA 4GLXA 1HR0L 2IX1A 3S14H 4DR7L 4JI8L 1XNRL 4PZ7A 2Y0SG 1VQEA 2JJQA 1EQRA 3D31A 4KI0A 4X66Q 3KJPA 4LF4Q 2GVAA 4IPHA 3KDFA 3S15H 2UXBQ 3PV0A 1HR0W 3CD6A 3M7NA 4OWTB 3AEVA 3HOZG 3BU2A 1CSPA 1VQLA 4B3RQ 4JYAQ 4NXML 4A3FG 3UDGA 1M90C 3CCLA 3M3YH 4A4IA 4ME3A 5AJ3Q 2L15A 2QGQA 4GLVB 2K14A 4LF9Q 3U50C 3PUXA 1K8AC 3OTOQ 4P74A 4O0AA 4LFBQ 3K81C 2HT1A 1PH7A 1PV4A 1IXRA 4QGUA 1JJ2A 4JI0Q 1VQAA 4JBKA 2N3SA 2PQAA 2NVXH 4DV1L 2JA5G 4LF7L 3ULLA 4JI6L 4PMWA 1W2BA 2ATWA 1C7YA 3J81i 3AYHB 3KF8B 4GLAC 2E2HH 4BA2I 4A75A 1HZ9A 1Y14B 4HIDA 1L1OC 4LFAQ 3J81j 1CKNA 3S1QH 3KYHC 3PIPA 3U58A 3PSIA 5DLQE 3AQQA 4DR6Q 3TEHB 1Y1WG 4LWCA 4MNOA 2F4VQ 1HZCA 3GTQH 1GKHA 4LUVA 2MO0A 1EIFA 1KRSA 3EN2A 2K5NA 1GD7A 3WWVA 3GTMH 3RR5A 5GROA 4DNIA 2Q2HA 4X65Q 1JMCA 3GTOH 1VQKA 5ELNA 4A3MG 4A3BG 4BY1G 4LF8Q 2AMCB 5C0XI 2KCMA 3H0GH 2Z0SA 2VQFQ 2NVTH 2BH8A 1N34L 3CC2A 1G291 2EQSA 4B3TL 4BY1H 4A3BH 1PH9A 4X62Q 1HNWQ 3U4VA 2R92G 1UE6A 1VQJA 4UP8A 4JI3Q 4DR4Q 2HHHQ 5C0XG 1L1OB 1TWAH 2PNHA 3U4ZA 1QZGA 1IBKQ 2UUAQ 1Q82C 4YCUA 4GOPC 1K3RA 4AH6A 2JA9A 3GTLH 4X6AH 1OXTA 5IT9c 4OX9Q 2K5VA 3I2ZA 2DUDA 3PIOA 1HR0Q 3I4MG 3S17H 4DR7Q 2IHEA 1YEZA 2MNAA 1XNRQ 1GVPA 2ES2A 4K0KL 4LUOA 3FHWA 3I4MH 4BBSG 1OXUA 2YTVA 3CC7A 1ASYA 3HKSA 3M4PA 4DK3C 3RLOA 4NXMQ 5IYDH 4BBSH 1FVIA 4QY7A 3CCSA 2NN6G 4C3HH 5LMUL 1OXXK 2CFMA 1AH9A 1SLJA 4YWKA 3CF5A 1GO3E 2Q2TA 3J7ZC 3ERSX 2RCNA 3PUVA 4GOPB 1E7ZA 3IRBA 4GKJL 1CSQA 4JOIA 2B29A 4IJHA 4DKAC 1UE7A 1B70B 1L2FA 2A8VA 1FGUA 1TXYA 3W1GA 4C2MH 4DV4L 2B63G 5FLMG 3RZOH 1E22A 4LFCL 3W5OA 4DV1Q 4LF7Q 4JI6Q 4OWWB 2R7ZG 3TREA 1V9PA 4YY3L 4KLKA 2B63H 5GAHC 2JEBI 1G51A 1MKHA 1NMGA 2B3GA 3GD7A 3A5ZB 3K7AH 4TVAB 5BR8L 1YHQA 2I5MX 3T1YL 3AFQA 3ICEA 1XJVA 3E9HA 4IOAA 1SRUA 1N8RC 1KL9A 2LXJA 2KHIA 2PI2E 5IYCH 2Q2IA 2UUBL 3PUZA 1YBYA 4DR5L 1K9MC 2VL6A 3S1MH 3M4QA 1X6OA 4APVA 1X3GA 2N78A 4A3DG 4XTCS 3HOVG 2OTJA 3J80i 4GS3A 1PH3A 4GN4B 1PH5A 4JV5L 5IP9G 2IX0A 3HOVH 5IE8A 3CMEA 1FL0A 1WOCA 4IFDI 3A74A 2BA0A 1YIJA 2R6GA 5JEAG 1N34Q 4B3TQ 4A93G 3H3VH 4QJFA 4B3SL 4O2DA 1JB7A 1PYSB 1EQQA 1E24A 3RLNA 3BJUA 3ER0A 1CKOA 3HKZG 1VQ4A 4A93H 1XMOL 1WYDA 4GNXA 1VQMA 1A63A 4IFDG 5IWAL 4L5SA 4R4CA 1VQBA 4QL5A 3F1ZA 1K83H 5LMNL 2D62A 3B6YA 3CMAA 3KDFB 1X3FA 4NPSA 2VNUD 1EFWA 3G6EA 4DV7L 1C0AA 1XTDA 4K0KQ 2HIXA 4DK6C 1M1KC 1SFOH 4DV6L 1I94L 4A76A 2PMZE 1X3EA 4DR1L 4YWLA 2VS1A 1KC8C 1MIUA 3FP9A 3M9BA 3RN5A 5HY6A 2ZJQA 1G6PA 5ELOA 4HIKA 5LMUQ 4MTNA 3NBHB 3D0FA 1EUJA 4DAYB 1TWGH 1YITA 4DV2L 1O7IA 3S24A 2OTLA 1IBLL 1YI2A 5EAYA 2JEAI 1KIXA 2YTXA 2LSSA 4RMFA 2ZJRA 4L5TA 2PQAB 3E0EA 3CAMA 3SGIA 2Z6KA 4GKJQ 5C0XJ 4L5RC 4BXXH 1HZBA 2KBNA 1WFQA 2GN5A 4KHZA 3I7FA 4YWMA 4DV4Q 3UDIA 2A1AA 4OO1I 4LFCQ 1U5KA 4KHPL 1CKNB 4HJ9A 3I55A 4A3GH 1C9OA 1Y1VH 4YY3Q 5K36G 3I56A 2KCTA 1A62A 2RHSB 4IPGA 3CCRA 2UUCL 2FXQA 4GN5A 1Q46A 5BR8Q 3M85A 2ZM6L 4OXPA 4OO1G 2KENA 1VCIA 3T1YQ 1PH6A 2D0PA 3H0GG 1TWFH 5C3EG 4A3CH 1TWHH 2YYZA 4UP9A 3H15A 4DR5Q 2UUBQ 3A5UA 2RF4A 1SE8A 4HJ5A 5GADC 1VQOA 1UWVA 4AYBE 5C3EH 4JC0A 3S1NH 1HNZL 3PO2G 1UE1A 4JV5Q 2K50A 3G48A 4DV5L 1VS0A 2XTIA 2WFWA 1S40A 3PO2H 4AQYL 4B3SQ 3ULPA 3DM3A 4JOIC 4LF5L 2JA7G 2JE6I 1XMOQ 1EWIA 1PH8A 1VQ5A 3STBC 5IWAQ 1CUKA 1EIYB 3ULJA 2HQLA 3EIVA 1I3QH 2R7DA 1VQHA 5GQOA 4X64L 3F2DA 4HJAA 2JA7H 5LMNQ 2AKWB 2NN6I 1VQIA 4P73A 5IYDG 1QVFA 4A3KH 5M3FG 1VQDA 4DV7Q 2JK8A 5M5XH 1VQCA 2KHJA 1YVCA 4IJLA 1X54A 1Q1EA 4DV6Q 3TS0A 2ALYB 4X66L 1I94Q 3G4SA 5M3FH 4DR1Q 2LXKA 2ASBA 1V43A 4YHHL 4QIWE 1ASZA 1WJJA 3RLFA 5C4XH 3CQZH 3PO3G 3RNUA 3PUWA 1I50H 1X55A 2BA1A 4L5QA 3HFZB 5IP7H 4J15A 2OQ0A 2ZJPA 3A0JA 3K80C 1X9NA 4LW1A 4BA1I 4DV2Q 2R7FA 3PO3H 1IBLQ 4QQBX 1B7YB 2IY5B 5JEAJ 1IZ6A 5J3BA 5GAEC 4DR3L 1SN8A 1Q86C 1N33L 2OQKA 1J6QA 2YU9H 1XNQL 5HGQA 3S2DH 3JAMi 1Z9FA 4DUYL 3NEMA 4IFDJ 4NB3A 2UU9L 4KHPQ 2AWNA 3PGZA 4WJ4A 4GNXC 5IYCG 4JBMA 3TRZA 4DR2L 1WI5A 4P75A 1NBWA 3TQYA 2UUCQ 2CKZB 2H5XA 3J80c 4A3JG 4PZ8A 3H3VI 4JBWA 1N36L 2ZM6Q 5IYBG 4P71A 3S16H 1YZ6A 3ZJYC 3Q8DA 1KQSA 2WB1E 4A3JH 2BH2A 5IYBH 4A3EG 4BBRH 2I5LX 3KOJA 1YJWA 1KAWA 3MXNB 2CQOA 1A0IA 4JI5L 1UE5A 1HNZQ 1Q8KA 4JI4L 3CCUA 2CWPA 4A3EH 1B8AA 4POGA 4LUZA 4DV5Q 4HJ8A 1QZHA 1KD1C 2I0QA 1XMQL 2K4KA 4C3IH 4AQYQ 5H1SE 2NZHA 3PUYA 3CCMA 4GNXB 4UY8C 1TWCH 2D0OA 4DPGA 2Z6KC 4LF5Q 3AFPA 4R4TA 4HIMA 1OXVA 1T9HA 1Z47A 2IHFA 4X64Q 2F3IA 3PCOB 5C44G 1Q12A 2EXDA 4AYBG 4A3LH 5LMNW 3STBD 1S72A 4GKKL 1H95A 5C44H 2CCZA 1E1OA 3CCVA 1X65A 2WP8J 3E9IA
chains in the Genus database with same CATH superfamily
2JA6G 2F0QA 2E5LL 2MJ8A 4ALPA 1CKMA 2JA8B 2CW0D 3AMUA 5IGBA 2BDNA 3LX0A 1D8LA 1A8VA 4NXNL 4MIUA 1ENCA 1HJPA 4A3GG 1KNEA 4DAVA 1B1ZA 4JW0A 4KK7A 1EQVA 2RDGA 1N32L 1DONA 5JJKA 3JAME 3BYTB 4A3FH 2UU9Q 1K28A 2HDLA 3HOYB 4A3CG 1LM0A 1WCMB 3LNNA 3NENA 2EOTA 2IPKD 4TKOB 2R7ZB 4JI7L 1W3SA 4HTHA 2A6EC 4XYOA 3TS2A 2B2YC 4UPAA 4RG1A 1NJIC 5A2QL 4C3JH 3SK4A 3PMFA 3D3RA 1PA6A 4UP7A 4YCVA 4IOCA 3NXWA 2LMCB 3PIP3 3A56A 3HOUB 3DM1A 5CV7A 2ZTCA 3V2TA 1UEBA 1BKBA 3H91A 2RDHA 5ELCA 1A3VA 2XNAC 1K73C 2A69D 3P75A 2B8GA 2CQAA 2E2DC 4JI2L 2Q2UA 1I6HH 3FPUB 4WJWA 3T1HL 1LTBD 3MXPA 4MHEA 1GUSA 3CC4A 2L4NA 4KY5A 5IIFA 1EL0A 4DV0L 3UDFA 3M3YB 3GO5A 1J5EQ 2EYPA 3GTJH 2N55A 2UXBL 3W1BA 4A3FB 2E2IH 2JN4A 2JA8G 2YTYA 3EQLC 1A3UA 1HCZA 4PMBA 5AJ3L 2B8FA 1H9JA 5CV4A 4S3SA 2A19A 1H9RA 3S1RH 1QVGA 1KDBA 2J4XA 4X3SA 2L55A 1PZKD 3OTOL 4DV3Q 2UXDQ 1JJGA 4RHRA 1XXGA 2I5HA 4JI0L 4BBRG 3GTQB 2CWAA 5ELEA 3G71A 1OXSC 4N9TA 2K5HA 2L5TA 4XIGS 2VUMH 2AUJD 3HOYG 4OHJA 1QCBD 1WCMG 5CC4A 4UDUC 2ICIA 4LFAL 4IN3A 3GTOB 4TRDA 4DR6L 3I4NH 2XN9C 3NTIA 1EZ8A 3FPPA 2NB0A 1U4PA 4ZK9B 4M1UB 4RGMA 3MFYA 1YJNA 4XQQA 3HOXH 3VYSA 4A3LG 2BCOA 3VDYA 1XPUA 3HOUG 2VQEQ 3CPFA 1TY2A 4FVMA 4DK1A 3BG3A 5IP9H 1NR2A 4R4IA 4DXFA 1L0WA 2HCIA 3KF6B 3NQIA 2HCCA 1BCPF 1CFMA 3QOJA 3D31A 4H44C 1BCPD 3SK5A 4IFDH 5I9PA 4OWTB 4KJOA 2X6GA 1VQLA 4A3FG 2PQEA 1PXUA 4HAEA 4A4IA 5IT9E 2QGQA 3N6RA 5CYUA 4LJZC 2JSOA 3C1FA 2P5ZX 1GUTA 2A73B 2RSNA 2C9OA 4P74A 5KYIA 1JOKA 4LFBQ 4IURA 4C3JG 1VQAA 4JBKA 2N3SA 2NVXH 1SJHD 1X3QA 2ATWA 1C7YA 3S1MB 4K8JA 1HZ9A 4HIDA 1L1OC 1VF7A 1CKNA 1DJRD 1I4PA 4XQJA 4MNOA 2EJGC 1GKHA 1JE4A 1KRSA 3EN2A 2O5JC 2B2TC 3OWEB 3PQIA 2Q2HA 1NNXA 1G6ZA 4X65Q 1VQKA 4DU9A 4OO1H 5EGTA 2VQFQ 2K04A 2Z0SA 3H0GH 4KN7C 4EVOA 4ID6A 1G291 2EQSA 1K83B 5A35A 2WACA 1UE6A 1BR9A 4JI3Q 2HHHQ 3U4ZA 1SFOB 1JCKB 4AH6A 2JA9A 3S17H 2KECA 4LUOA 1TT2A 3PIO3 1SNOA 4ZQ3A 4KKUA 2CHBD 3HKSA 2PZTA 3RLOA 4NXMQ 1FYCA 2QILA 5LMUL 3TZDA 5T1GA 3CF5A 4IZ8A 2RCNA 4O1NA 2FMCA 4GOPB 1E7ZA 3IRBA 1S5ED 5JJZA 3ERQA 4JOIA 4RAUC 2A8VA 3QO2A 1FGUA 1TXYA 1HFNA 3RZOH 4B08A 4LFCL 3W5OA 1QE6A 1TWHB 4JI6Q 4OWWB 4KLKA 2B63H 5GAHC 1RCVD 1G51A 1MKHA 5FOBB 4TVAB 3S1NB 2I5MX 1WTWA 3GQBA 4IOAA 3PO2B 1K9MC 3M4QA 3LWUA 4APVA 1STEA 2OTJA 3QB3A 2KOLA 5BN4A 5IP9G 2BA0A 1JB7A 4A3KB 3TMEA 1EQQA 3HKZG 5JEAH 1C4QA 1XMOL 3DXJC 4GNXA 4IFDG 5IWAL 4QL5A 5C4XB 3CQZB 2FMMA 1CT1D 1DCZA 3B6YA 3KDFB 1X3FA 2VNUD 1EFWA 3G6EA 1BDOA 4DK6C 2F0SA 2AQ1B 3FMCA 4JK1C 4NMZA 4A76A 4DR1L 4YWLA 3P7JA 3H3VC 1JR0D 3FP9A 3S2DB 1YNJC 3W2DA 1G6PA 1SNDA 3KBGA 3NBHA 4DNRB 4DAYB 1O7IA 4WORA 2Z9HA 5LL6S 1B2TA 2A6HD 2LSSA 2YTXA 5AFWA 2KEDA 4GKJQ 2Z6KA 1PTOH 5C0XJ 3S16B 4BXXH 1WFQA 2GN5A 4DV4Q 4YWMA 3BYYB 5I6YA 4KHPL 4CKEA 1B3QA 4YY3Q 2KCTA 4IPGA 3NTKA 1Q46A 3M85A 4OO1G 1A15A 1A2UA 3T1YQ 3H0GG 4KN4C 1YNNC 1X3PA 2UUBQ 3KLSX 2F0PA 1SE8A 1MSGA 1VQOA 1UWVA 1LV9A 4AYBE 4F7XA 1IYUA 1TWCB 3PO2G 1M4VA 1LACA 2EXZA 1UE1A 2B2VC 5KIXA 1HUNA 1VS0A 5FO7B 3IL8A 3J7AV 1OO9B 4FYDA 4L63B 2B39A 3DM3A 1L0XB 2JE6I 1TQOA 1FR3A 1CUKA 2NVYB 1EIYB 3KLRA 3ULJA 4G7OC 1I3QH 5C6AA 3GTKB 2JA7H 5DM63 3T16A 2KHJA 1Q1EA 1GJXA 5CMDA 1KDAA 1ASZA 1WJJA 3RLFA 2RVLA 2DJFC 1XYIA 1I50H 1X55A 5IP7H 4J15A 2ZJPA 4FF4A 3A0JA 3K80C 5M3MB 4LW1A 4BA1I 4DV2Q 3PO3H 2F0TA 1IBLQ 1QNKA 5LL6X 5J3BA 4XXEA 1SN8A 2WINB 2YU9H 2A74C 1Z9FA 3RZDB 1SNQA 2UU9L 3PGZA 4QUCA 3OHXC 3TRZA 2L1BA 1CQVA 2LS01 3AU7A 3I8ZA 4P75A 2UUCQ 3EA6A 3J80c 4KMUC 2NVQB 5ELBA 5DM73 1JOOA 2KCCA 3NPPA 4P71A 5IYBG 1NCVA 3K5MA 1KQSA 1R9TB 4ZKCB 2VB3X 1MHWC 2X6LA 1YJWA 4QB4A 3IAYA 1HQMC 2V4DA 1B8AA 1G2SA 3SR1A 1KD1C 4A3MB 2I0QA 2K4KA 4C3IH 5M5YB 4RGTA 4B9XA 2MPMA 4DPGA 3AFPA 3D6CA 4HIMA 2R92B 2RSOA 4A3IB 4X64Q 2F3IA 1A6XA 3DWQA 3VR5A 1ILQA 5EPKA 4DN4M 5LMNW 1EY0A 5EKIA 2B2WC 4U673 2CCZA 3CCVA 1ILPA 1PDQA 3E9IA 1TS5A 1J5EL 1CA5A 4R8IA 1JWMD 1SMXA 3KF6A 4N8X1 1EOVA 1BNZA 1IL2A 3GV3A 2PZWA 1SR3A 1QVCA 2LKVA 3GP7A 3NK9A 3OSOA 3U9OA 2JA6H 2PW7A 2RHQB 4BXXG 5TSSA 3F8TA 3EFXD 2DY7A 4YIJA 1N33Q 3NWTA 5M3MG 4IUTA 1XNQQ 3I4OA 3BDCA 1YHBA 4HIOA 3IKJA 4HCSA 3GTPH 4DV3L 3HOWB 2UXDL 1LTTD 3NQTA 1HA6A 1K8GA 2L12A 4HJ7A 1DGSA 2WAQE 3KJOA 4DR2Q 3A7AB 2OCEA 3MFGA 5D3IB 5HGTA 3Q24A 1PH4A 4R4QA 2F4IA 1PRTF 2QA4A 4RGOS 5E1FA 3NSWA 5FLXE 3E6ZX 1RODA 2R61A 4P72A 4PMCA 3HKZE 1PH1A 4JI4Q 3DUZA 5NUCA 3GTGB 1TS3A 2ENBA 2XGTA 3TDQA 4WJ3M 1XMQQ 2SNSA 4Y52H 1KHIA 1BVSA 4JCVE 1D7QA 3D8GA 1WTPA 1NSNS 3K8AA 2VQEL 4CDFC 2DGYA 3S14B 1UAPA 2WB1G 4CGYB 3CU7A 1A2TA 1CQFA 1YNXA 1XPRA 2HD3A 4FNFA 4DXGA 3A54A 1MGSA 4HSPA 1NAPA 4CHTB 5IP7G 2Y0SB 4A3IG 1YJ9A 3S2HH 2TMPA 4E6IA 1NMFA 4TQUS 1I5FA 3KLWA 3SE0A 3K57A 3DLLA 3BZKA 4MN3A 1WTRA 1B44D 3JAMc 1IW7D 4JI8Q 3CP0A 1IYVA 1ZEQX 1PZID 1JE5A 5C3WA 5I4DA 2JA8H 5EBCA 1DM0B 2HIVA 4GN3B 4R1JA 1HZAA 1HNXQ 4RFBA 1NTGA 5JPMC 4DAMA 2E2HB 1FJGQ 1XX8A 1V1OA 4FO2A 1SE2A 1VQ7A 4LFBL 1O7ZA 4EX5A 2VZAA 2OF1A 3HOWG 4GOPA 1EZ6A 1TU2B 4JI1Q 4DUZQ 1QUQB 3GTMB 4LF6Q 1E0BA 1JJCB 5ISRA 3HOYH 4K5VA 3J7A5 3CCEA 1WCMH 1PFSA 5FLMH 4X3UA 2K5WA 1I4GA 1II3A 2ID0A 2R7ZH 2NVTB 1F77A 1PTOF 4BY1B 1LTGD 2GVBA 2RDFA 4FF1A 1X56A 4C1NK 4X65L 1LT4D 5E7NA 1TWAB 4EQNA 4YCWA 4GZYC 1B4OA 2VQFL 4EQ5A 3GTLB 1VQ9A 3RN2A 2QEJC 3EROA 1ONLA 2K1BA 4IO9A 4A3DH 4LAAA 2JXMB 2Q8TA 4JI3L 2HHHL 1YHAA 3HOUH 3ONAB 1Q7YC 3EBEA 1JT8A 2N8NA 2PI2A 2FJ2A 5M9OA 1SYEA 4ILWA 1WD0A 3CCJA 4BBSB 4C3HB 4PZ7A 2Y0SG 1VQEA 1EQRA 4LF4Q 3KDFA 3K59A 1PFBA 1SMYC 3BU2A 1CSPA 3G7LA 4JYAQ 4NXML 3MXUA 1M90C 2JYOA 3M3YH 4ME3A 1MI2A 2DNEA 2SDFA 2K14A 3I3CA 3PUXA 1K8AC 3VR4A 1GHKA 1PV4A 2F0VA 1QWYA 4QGUA 1JJ2A 5BN5A 1RTOA 4JI6L 4PMWA 1QJOA 3KF8A 3K6OA 4GLAC 3MTSA 4BA2I 1WTQA 3ND9A 4QUFA 5DLQE 3C46A 3TEHB 1HZCA 1AW7A 1VMPA 3D4RA 1VDZA 3GTQH 1QILA 3HOVB 4LUVA 1GXDC 4A3DB 2RQXA 4EQPA 2R3ZA 2KHSA 5CGKA 1LO5D 5J1ZA 1JMCA 3GTOH 3L9AX 4A93B 1SDFA 4BY1G 4LF8Q 2AMCB 5C0XI 3ZYYX 2DY8A 2L0CA 3OW7A 2BH8A 2SNMA 4RGNA 1PH9A 4X62Q 4KD4A 1EEID 2F0KA 3QWNA 1HNWQ 4DR4Q 3VYRA 1IBKQ 1QZGA 4HCEA 1KDCA 5JVG3 4YCUA 2QDBA 2IX3A 3J7YW 1K3RA 4X3KA 1B3AA 1OXTA 5IT9c 2K5VA 3I2ZA 4AYBB 2DUDA 3PIOA 1HR0Q 4ODGA 2NBFA 2F0OA 3HGBA 1GVPA 1XNRQ 2PW5A 3FHWA 4BBSG 4KY7A 1AN8A 2CW0C 3M4PA 2L9HA 5T1IA 3DWAA 1LTSD 4QY7A 2E74C 4YWKA 2PZUA 3V05A 1Y1VB 5DEHA 5FKAC 3PUVA 2XIWA 3URYA 3H09A 2ZXOA 2HDMA 4IUPA 4GKJL 1D5XC 4MTKA 4ULLA 4IJHA 1UE7A 1B53A 4C2MH 4DV4L 5D14A 5FLMG 1SNMA 2R7ZG 3SXHA 3TREA 1V9PA 4YY3L 5G3LD 2EVBA 4RA8A 3MEHA 1AP0A 3T1YL 5FK9C 3E5SA 5IGCA 4OEMB 1SSOA 2RBMA 5IYCH 3S1MH 2UUBL 3PUZA 2VL6A 1X3GA 3R3OA 4A3DG 3HOVG 3MXGA 3J80i 4Z9CB 2LY7A 2EJMA 1N34Q 2R6GA 4A93G 1BUVT 3GV6A 3SK6A 4O2DA 2EZVA 1C8CA 3BJUA 1S4ZA 3NWSA 5EJWA 1VQMA 5M3FB 4R4CA 1VQBA 1K83H 4RKLA 1JQYD 4IUUA 1C0AA 1F2ZA 1SFOH 1F9RA 4C2MB 4U68A 5IGFA 2VS1A 1KC8C 2K32A 3A8IE 2ZT9C 3M9BA 3CHBD 3RN5A 2ZJQA 4MTNA 4DAPA 4DV2L 1ML0D 1IBLL 2EY1A 4J1MA 3X3NA 1H9SB 4DFAA 1HTPA 4G57A 4L5TA 2PMZB 2PQAB 3E0EA 3J80L 1O7LA 1Y8OB 2KBNA 4KHZA 3I7FA 2A1AA 1U5KA 4HJ9A 5K36G 3IFDA 1A62A 2UUCL 4V190 1AZPA 4GN5A 5BR8Q 4A3EB 4OXPA 1VCIA 1PYWD 2D0PA 1TWHH 1CTMA 4UP9A 1V1PB 1D1IA 5KEEA 3E0JA 1ZYRC 3S1NH 3BDOA 5KNCA 4JV5Q 2E75C 1KLUD 2XTIA 2EJFC 1CZGA 3PO2H 2QW7A 4QMGA 3A7LA 5C44B 4JOIC 2QCPX 1EWIA 3WOFA 1VQ5A 4G4KA 3STBC 1AZQA 4X64L 2HQLA 5D3DA 3F2DA 3CRLC 5LMNQ 3C1EA 1LTID 1VQIA 2E2JB 4NKLA 4BY7B 4A3KH 5M3FG 2JK8A 1SNPA 1X54A 2F03A 1I94Q 2ALYB 3VYTA 3G4SA 5M5WB 3WOEA 4QIWE 5C4XH 3CQZH 3FKIB 5D65A 2BA1A 3HFZB 4JPBW 3HOZB 1K8MA 1ET6A 1B7YB 1M8AA 1YNJD 4K6DA 1IZ6A 5JEAJ 4FF2A 5GAEC 1N33L 1Q86C 2OQKA 1J6QA 1XNQL 1VMCA 3S2DH 3JAMi 1STBA 3J81E 4NB3A 1LABA 1U4LA 4KY6A 4GNXC 5IYCG 4DR2L 1GUNA 1WI5A 3DWPA 2H5XA 3H3VI 4PZ8A 2EYMA 2KVMA 4JBWA 2ZM6Q 3S16H 4BWGB 1F2LA 2DN8A 2R93B 1U4MA 1Y1WB 1T5XD 5IYBH 4A3EG 2EY2A 2I5LX 2EYHA 1G2TA 1KAWA 1TR5A 3MXNB 3V96A 1K0SA 1HNZQ 1YNND 1IKMA 1Q8KA 4JI4L 1HHVA 1Z7TA 4LUZA 1XMQL 5H1SE 3PUYA 3CCMA 3UI2A 2X69A 3Q23A 5C4HA 2M9VA 1TWCH 2Z6KC 4LF5Q 3MAQA 4CJ2C 1UNSA 2IHFA 3M4OB 5COYA 2K5QA 1TKWB 1BQQT 3PCOB 5C44G 1Q12A 2N88A 3OMGA 2EXDA 3JAML 2OEOA 4IUNA 2CH4A 3BDLA 3K0YA 1E1OA 3X3MA 1X65A 2G9DA 1NY4A 1P16A 3VR3A 2NVYH 4XDXA 3VYUA 4YHHQ 2EYLA 3GTKH 2NZOA 4HEDA 4IPCA 4G7HC 2AHOB 3FKIG 3H94A 1SE3A 1WTOA 2V1CC 3I72A 1MJEA 3NELA 4K14A 5E4WC 4MZ9A 1HNXL 3NTHA 1FJGL 4DUYQ 5JJLA 1E1TA 5C5MA 5M3MH 2YV5A 4R4OA 4K6LA 3L2PA 2EY6A 1WTHA 3BZCA 4AIMA 2C35B 1E3PA 1VQPA 4JI1L 3SHLA 1CZWA 3H6MA 5C4JB 4DUZL 3RZDH 1U0LA 4LF6L 2F52A 4LNQA 1O7YA 4PQXA 1ENFA 1JWUD 5CBEE 3OW2A 4OL7A 3I4LA 2QDLA 5IGDA 2JA5H 3WDNA 3OIPA 2AUKA 2MUYA 2WKDA 2R93G 2PPBC 2NVQH 1EFID 3K7UC 1E2WA 2Z1CA 1R9TH 4Q5VA 2MO1A 4A3KG 2IW3A 1TVXA 2RCFA 3L0OA 1SROA 3DMUA 1VQ6A 2HUGA 1S3OA 4PZ6A 4A3MH 3QJYA 3S15B 5C4XG 5A2QE 5M5YH 2A68C 2L11A 1P8LA 4HN7A 5KRUA 2HQEA 1GOZA 1CHPD 3K5LA 2R92H 4F8MA 4A3IH 5J39A 5C0XH 2UXCQ 2IT1A 2K52A 4LF4L 1AE3A 1NE3A 3KFUA 4KHVA 3QG1A 1EIGA 4K8IA 1J9OA 1DXMA 2AQ3B 1ICWA 4JYAL 4OWXB 1V8QA 5E3FA 1D5ZC 2B2VA 2BOSA 2JQOA 1K8OA 4G7ZC 2JA5B 3S1QB 3JC66 1ZXTA 1PVOA 5FLXc 2CH4W 1SBBB 4POFA 1F2YA 1EU4A 3CXCA 3R8BA 1QB5D 1JC7A 1EYGA 2N49A 3HOWH 1TIID 3RD4A 4B3MQ 1B9MA 1RIPA 2G9HD 2K33A 4FP5D 5FJ8G 2K75A 1LTLA 5HURA 4A3BB 5EPJA 2F0DA 2EYJA 4RH6A 2VW9A 1Q90A 3ITPA 4LF8L 2BDOA 4H7BA 2D9UA 1BO0A 1IBMQ 5IT9L 4CKBA 4X62L 3OYYA 3F2BA 1BBUA 3U9SA 1HNWL 1VQNA 3GTGH 4DR4L 4Q0FA 3MWYW 1IBKL 3UE0A 3I4MB 1HR0L 4IUQA 3S14H 1XNRL 2QKIC 2JJQA 2MHVA 3TP6A 3KJPA 4IPHA 3CD6A 4L6TB 3NE5B 2FINB 3M7NA 3MC0B 3AEVA 1HUMA 4B3RQ 1KLGD 3CCLA 1BXTA 1JORA 5JPNC 4GLVB 5KNBA 4LF9Q 3U50C 4KD3A 2XVSA 1HFGA 4O0AA 2HT1A 3K7AB 2H1EA 3F2UA 1IXRA 1H9SA 5LHY1 3C2PA 1O80A 2PQAA 2JA5G 4XYQA 1FGBD 1DOLA 3J81i 2WV6D 2E2HH 4A75A 3D4DA 4WRDA 3U58A 5KYLA 3PIPA 3TP7A 3AQQA 4LWCA 3BS1A 2F4VQ 4L8JA 2K03A 2B2WA 2MO0A 2KUMA 1Z6HA 2NZ1D 3FEWX 1GD7A 4ZLTF 2SEBD 3WWVA 3GTMH 3RR5A 2Q8IB 4DNIA 1JB3A 1EY5A 5CV5A 2F0GA 5ELNA 4A3MG 1V1PA 4A3BG 2NVTH 1N34L 4BY1H 2R92G 4UP8A 4IUVA 1EY7A 5C0XG 1L1OB 1TWAH 2PNHA 3A8JE 2UUAQ 4GOPC 3GTLH 4X6AH 4OX9Q 3TSSA 1G91A 3I4MG 2IL8A 3M7GA 4DR7Q 2ES2A 1TWGB 4DA2A 2BE5C 1I4RA 1VF5C 3J81L 1OXUA 3SK8A 1IHZA 4DK3C 2F0WA 3MHBA 3BVMA 5IYDH 4BBSH 1D1KA 2NN6G 4C3HH 1OXXK 2CFMA 1SMYD 5DAUA 1AH9A 2PO4A 1GO3E 4A3GB 4ZUIA 2Q2TA 4C1NI 3TN2A 3S9WA 1EYCA 1CSQA 4DKAC 2EDGA 5CV6A 3W1GA 5JVH3 3OOCA 1SYBA 1WTXA 3Q22A 4DV1Q 1TWFB 4LF7Q 4QIWB 1S5CD 1CK1A 2A6ED 2DNCA 1ESFA 2JEBI 2F0NA 5C3EB 3GD7A 1YHQA 1NMGA 3A5ZB 4I7ZC 4LK1C 5BR8L 1WD1A 3AFQA 3ICEA 1A3TA 4PNYA 4R9WA 3E9HA 2KHIA 2PI2E 1LTAD 1PRTC 1YBYA 1JWSD 2B2UA 4DF7A 2NUCA 5K5PA 4B9WA 4WFN3 1SYCA 4KKSA 1ET9A 1PH3A 3MXNA 4JV5L 3HOVH 3CMEA 1FL0A 3A74A 4B3TQ 3H3VH 1SXTA 1PYSB 3RLNA 1STHA 1CKOA 5M5XB 1VQ4A 4A93H 1R4PB 3I73A 4L5SA 1PFNA 1GUWA 3R93A 5LMNL 3SDZA 4NPSA 4K0KQ 2HIXA 1X32A 4F87A 1M1KC 1I94L 1X3EA 1RD9D 3QIAA 1WVLA 1Q3LA 1F9QA 5C5LA 3VA7A 2NTTA 4CDDC 3NBHB 4DAYA 1EUJA 1YITA 3TP5A 1FNUA 2JEAI 5IGGA 4RMFA 2ZJRA 2XWJB 5EPLA 3SGIA 1HZBA 5J22A 3UDIA 5L37A 4A3JB 1UEAB 3I55A 4BBRB 1Y1VH 1SYFA 3CCRA 2PNRC 2FXQA 1BBXC 1EQTA 2ZM6L 5EKKA 5K36H 2KENA 2ICEC 5C3EG 2YYZA 3T53B 4ZKBB 3H15A 4DR5Q 2RF4A 4HJ5A 5GADC 1Y8NB 1O78A 4JC0A 1HNZL 1PTOC 3G48A 3HRZC 2EYOA 1S40A 2FHTA 4C56C 4B3SQ 1LT3D 3ULPA 2EY5A 4LF5L 1PH8A 3O13A 3KLSA 2R7DA 1VQHA 4HJAA 1U4RA 2AKWB 2NN6I 5IYDG 1QVFA 2B2YA 4DV7Q 5JOBA 4C3HG 4IJLA 3TS0A 4DV6Q 2MGSA 5M3FH 1E2VA 2LXKA 2ASBA 1V43A 4YHHL 4DGZA 4NW2A 1AFPA 1X9NA 1EEFD 2KQ3A 4NDXA 3KBXA 2R7FA 2G5DA 5KNDA 2O4XA 3OMCA 2IY5B 3HP3A 4K2LA 5G3LF 3R2IA 4DUYL 3MZ5A 1B9NA 4IFDJ 4N8FA 1HPCA 2AWNA 5F2DA 4CDEC 2I07B 4C3JB 1STAA 2D5DA 2PCFB 1WTVA 2LFNA 1NBWA 4UHVA 2CKZB 4A3JG 1I4HA 5JAVA 2NTSA 1YZ6A 3ZJYC 2K28A 4OELB 2WB1E 3QOLA 1DZ1A 3TZUA 3W3AA 3KOJA 2CQOA 1A0IA 1EYAA 1NUCA 4H0LC 2EPBA 3RMHA 3CCUA 4A3EH 3SVMA 4POGA 1IKLA 4DV5Q 1W6KA 1I6HB 1ZYRD 4AQYQ 2A69C 2NZHA 5DNFA 4UY8C 2O2LD 1EYDA 2D0OA 1FD7D 4ZCKA 1OXVA 1EWCA 1T9HA 1RDPD 1ZKOA 3GTJB 2E2IB 2FFKB 4AYBG 2F0FA 3STBD 5EKLA 1S72A 1H95A 5C44H 3SEBA 2WP8J 4X66Q 3UDXA 3FRPB 4N9PA 3KK7A 2UXCL 3A55A 5C3XA 2MQHA 2AWOA 3S1RB 3J81c 2E2JH 2MP1A 3MVVA 4BY7H 1ICFB 3MA2B 4ZRZA 4K5WA 1KRTA 5JJIA 1LLRD 5FLXL 1BBWA 1SAPA 1GM5A 1Y1VG 4DR3Q 4R8NA 4OIKA 2F0HA 5FO8B 5IGEA 5M5WH 2VUMB 1PLFA 3NHHA 3FKIH 4PG3A 3HOZH 3ND8A 2OT2A 3UE1A 1XPOA 1Q81C 2K01A 3I4NB 1LUZA 1QNUA 3KUPA 1KXLA 1N36Q 4KTAA 4JG2A 4OONA 2SOBA 4B3ML 1R4QB 3K5OA 3LGJA 1UUPA 1KTKA 3CW2C 2KA7A 1G8ZD 1HQRD 4EQOA 1MSHA 3HZXA 3HOXB 4V0BA 2WAQB 2OWOA 4JI5Q 1FNWA 3LWEA 4FDBA 4X3TA 3T51B 1VQFA 1SYGA 1BOSA 1MJCA 3L7ZC 2R93H 1Y1WH 2Y0SE 2ZTDA 3K0XA 2KJXA 1JICA 3IFTA 1C48A 1N9WA 1IBML 3Q6SA 4KJNA 5I6WA 3BZDB 3HKZB 4FF3A 4JBJA 4CBVA 3CPWA 2CVRA 1SEBD 2A5HA 1F9SA 4GKKQ 1L1OA 1OTCA 1BCPC 1PH2A 4CJ1B 3PF4A 3L3OC 2Z8LA 5C4ZA 2F0MA 3M4OH 3GDEA 2E5LQ 2ZTEA 3CRKC 1QG7A 5CV8A 4K2KA 2WIIB 2B2TA 1DYQA 1RL2A 1VQGA 2XWBB 4O42A 4NXNQ 4B3RL 5EBDA 2VXWA 3CCQA 4M8AA 1H9KA 4IPDA 2NVXB 2NYZD 3E3XA 2C5CA 1EY4A 4LF9L 1N32Q 4F88A 3HS0C 4Y7NH 2VUMG 4RKBA 2QEXA 2EYFA 3FDTA 1Y8PB 1VQ8A 4JI7Q 3P1HA 1QUQA 3F2CA 1LYLA 4H02A 4ME5A 4BS9A 1JOQA 5GAGC 1AE2A 3I4NG 2F0EA 1DOMA 2KCNA 4HR7B 2MFIA 3PF5A 2F4VL 1IL8A 4P2CB 3H0GB 1Q1BA 1TS2A 4FXKC 5C4JH 2E8GA 1IYJB 5FJ8H 3D4WA 3OWFA 1STGA 1GUOA 3HG9A 3HOXG 5IOCA 2WAQG 4RCNA 1HXYD 1PYBA 1V1QA 5CORA 1CA6A 5IY0A 2F3WA 2VB2X 2VY3A 2K5DA 3S17B 2EIFA 1PHJA 1K0RA 5CBAE 4JI2Q 3A8KE 3T1HQ 2UUAL 3K5NA 1CI3M 4XQNA 3MEFA 4BY7G 1DD2A 5BN3A 4OX9L 4DV0Q 1HH2P 4GLXA 2IX1A 4DR7L 2A68D 4JI8L 3C3LA 1L0YB 4KI0A 3VR2A 5IODA 4Y7NB 1XWEA 3S15H 2GVAA 2UXBQ 1D5MC 1PMRA 1PRTB 3M4YA 3PV0A 2Q8RE 1HR0W 1LT6D 3J7AF 3R2TA 4HMJA 3HOZG 2M2LA 3UDGA 3RZOB 5AJ3Q 2L15A 1STNA 1NR4A 2B63B 3OTOQ 1SE4A 3K81C 1AEXA 1RHPA 1PH7A 1F2MA 4JI0Q 2RA4A 1DOKA 3N52A 4DV1L 1EY9A 4LF7L 3ULLA 1W2BA 2I46A 3AYHB 3KF8B 2XRQD 1XTCD 5E4XA 1J8IA 1Y14B 4LFAQ 3J81j 3S1QH 3KYHC 1HRJA 3PSIA 4DR6Q 1Y1WG 1BF4A 1RKNA 4CKCA 3VR6A 1EIFA 3TBIB 4NP5A 2RKSA 2K5NA 4KKTA 5GROA 4I7AA 1SJED 4ZYSA 1EU3A 2KCMA 4UAIA 2F0IA 4J8QA 2ZXPA 3CC2A 4B3TL 4A3BH 3U4VA 1VQJA 3BVGA 3DEOA 1Q82C 4I65A 3NP8A 3EJIA 2IHEA 1YEZA 2PYKA 2MNAA 4K0KL 3T4AC 2F1MA 4OGQC 3I4MH 1Q8IA 4XT1B 2YTVA 3CC7A 1ASYA 3EVQA 5I2YA 1LTRD 3DHQA 1PTOB 1FVIA 2A6HC 3CCSA 2XRSD 1SLJA 1GUGA 3J7ZC 5CR3A 3ERSX 2NN6H 3BVZA 2J0TD 3T13A 4LMQD 2B29A 2IWHA 1B70B 1EY8A 1L2FA 5ELFA 3Q0AA 2B63G 1I4XA 1E22A 4RHSA 2J7ZA 5I9OA 3K58A 1Y69U 3TP8A 1SYDA 2EE1A 3RUZA 2B3GA 3K7AH 1SNCA 4QCLA 3T56B 2D2CC 1XJVA 2WKCA 1SRUA 1N8RC 1KL9A 2LXJA 2GA4B 2Q2IA 4DR5L 1X6OA 3FVQA 2N78A 4XT3B 4XTCS 1PFMA 1CHQD 4GS3A 4RCOA 1PH5A 4GN4B 2Z4IA 2IX0A 5IE8A 1I3QB 4IALA 1WOCA 4IFDI 2M00A 1YIJA 2JA7B 5JEAG 2F0LA 1T5EA 4QJFA 4B3SL 1E24A 1S5FD 3ER0A 2WB1B 1KAAA 1K3BC 1RTNA 1WYDA 1A63A 3CKIB 2TSSA 3AB9A 1TY0A 3F1ZA 1I50B 2D62A 1S5DD 2F3VA 4QF4A 3CMAA 4DV7L 1XTDA 3PO3B 1E2ZA 4DV6L 2PMZE 2K7VA 2YU9B 1MIUA 2BE5D 2QF7A 5HY6A 5ELOA 4HIKA 5LMUQ 3D0FA 1TWGH 4OIJA 3S24A 2OTLA 1YI2A 5EAYA 3NBIA 4HSVA 1KIXA 2IJ0A 1KABA 1ESRA 3CAMA 2DJGC 4L5RC 4CDCC 4OO1I 4ABNA 4LFCQ 1CKNB 5ELDA 1U9RA 1C9OA 4A3GH 3I56A 2RHSB 1D6EC 1GHJA 4PV1C 1QOHA 4DK0A 5CV9A 5FO9B 1PH6A 4JVZA 1TWFH 3I91A 4A3CH 4C3IB 3A5UA 4CJ0B 1W6JA 5C3EH 1EWHA 1EY6A 2Z6BA 1PRTD 3J80E 2K50A 4DV5L 2K05A 2JP1A 2WFWA 4AQYL 4FXDA 2JA7G 1XMOQ 1CM9A 2K6AA 5IWAQ 3P20A 3EIVA 1I6VC 1STYA 5GQOA 4P73A 2XSCA 2JA6B 1VQDA 4FXGC 4H13C 5I2XA 4EGVA 4K5XA 5M5XH 1H9MA 1VQCA 1YVCA 1MD2D 4X66L 4DR1Q 2O5IC 5KGUA 3OPOA 3PO3G 1EIHA 3RNUA 3PUWA 2B2UC 3GTPB 4L5QA 2OQ0A 1F9PA 3HEJA 1RJTA 2H4OA 2Z4HA 4KV6A 3DEPA 3QR8A 4QQBX 1PZJD 4DR3L 3G6JB 4HMIA 2ZXRA 2F0UA 4IQZA 5HGQA 3I70A 3NUCA 5EQ0A 3NEMA 4WJ4A 4KHPQ 2NWGA 1FNVA 1ENAA 4JBMA 1S5BD 1I4QA 4J6HA 3TQYA 4TSSA 1BCPB 1N36L 4ZUJA 2AQ2B 3Q8DA 4RWSC 4A3JH 1HA5A 2BH2A 1EOTA 4BBRH 1MBYA 4ZAIA 1RF2D 4JI5L 1UE5A 3I90A 2CWPA 4C3IG 1TS4A 2F0JA 2E76C 4HJ8A 1QZHA 1PTOD 1B50A 3OIQA 4GNXB 3S2HB 4DNTB 4R4TA 3D6WA 1Z47A 1HTLD 1KNAA 1D2BA 1LT5D 4A3LH 4GKKL 3VA5A 2OXPA 2KEEA 1IW7C
chains in the Genus database with same CATH topology
1NY4A 3UDXA 1P16A 1J5EL 2E5LL 2JA6G 4ALPA 2NVYH 1CKMA 1SMXA 2UXCL 3KF6A 4YHHQ 2MQHA 2AWOA 3GTKH 2NZOA 1EOVA 1IL2A 3J81c 2E2JH 1SR3A 1QVCA 2JA6H 4IPCA 4BY7H 1D8LA 4BXXG 2RHQB 1A8VA 4NXNL 1KRTA 2AHOB 3F8TA 3FKIG 5JJIA 1HJPA 1BBWA 1GM5A 4A3GG 1Y1VG 1MJEA 2V1CC 4DR3Q 1N33Q 5M3MG 5M5WH 3NELA 1XNQQ 3I4OA 3FKIH 4PG3A 4MZ9A 1YHBA 4HIOA 1HNXL 1FJGL 3GTPH 4DV3L 1N32L 2UXDL 4DUYQ 3HOZH 5JJLA 1E1TA 5M3MH 5JJKA 2YV5A 4A3FH 1K8GA 2UU9Q 4R4OA 4A3CG 4HJ7A 1DGSA 1LM0A 2WAQE 3UE1A 3BZCA 3NENA 3L2PA 3KJOA 4AIMA 1XPOA 1Q81C 4DR2Q 2C35B 1E3PA 1LUZA 2OCEA 1VQPA 4JI7L 4JI1L 1W3SA 1KXLA 4DUZL 1PH4A 1N36Q 4JG2A 3RZDH 3TS2A 4R4QA 4OONA 4UPAA 1U0LA 4RG1A 2F52A 4B3ML 1NJIC 4LF6L 3LGJA 4LNQA 2QA4A 3CW2C 4C3JH 3OW2A 2JA5H 4P72A 2OWOA 4JI5Q 1PA6A 4FDBA 4UP7A 2R93G 3HKZE 1VQFA 1PH1A 4JI4Q 2NVQH 4YCVA 3K7UC 4IOCA 1MJCA 3L7ZC 1R9TH 2XGTA 2R93H 4WJ3M 1Y1WH 1XMQQ 2Y0SE 2MO1A 2ZTDA 2ZTCA 1KHIA 3K0XA 1BVSA 1BKBA 1UEBA 4JCVE 4Y52H 1D7QA 4A3KG 1N9WA 1IBML 3K8AA 2VQEL 3L0OA 2DGYA 1SROA 1VQ6A 1K73C 2WB1G 1S3OA 4JI2L 4PZ6A 4JBJA 4A3MH 3T1HL 2Q2UA 1I6HH 1YNXA 1XPRA 3CPWA 5C4XG 5M5YH 3CC4A 1P8LA 5IP7G 1YJ9A 4A3IG 1L1OA 3S2HH 4GKKQ 1OTCA 1PH2A 4DV0L 3PF4A 3UDFA 1NMFA 4TQUS 1I5FA 3GO5A 3KLWA 3DLLA 1J5EQ 2R92H 3M4OH 3GDEA 2E5LQ 4A3IH 2ZTEA 2UXCQ 2IT1A 2K52A 3GTJH 4LF4L 3BZKA 2UXBL 3W1BA 1AE3A 1NE3A 2E2IH 3JAMc 3KFUA 4JI8Q 3CP0A 1VQGA 1RL2A 2JA8G 4NXNQ 4B3RL 4JYAL 4OWXB 2YTYA 3CCQA 1JE5A 4IPDA 5AJ3L 2JA8H 2HIVA 4GN3B 4R1JA 1HZAA 2A19A 3S1RH 1QVGA 1HNXQ 1NTGA 4LF9L 4DAMA 1FJGQ 1N32Q 2JQOA 4DV3Q 3OTOL 2UXDQ 4LFBL 3JC66 1VQ7A 4Y7NH 2VUMG 1JJGA 1PVOA 2QEXA 4EX5A 5FLXc 2I5HA 2VZAA 4JI0L 4POFA 4BBRG 2CWAA 3G71A 4GOPA 1OXSC 1VQ8A 3HOWG 2K5HA 4XIGS 4JI1Q 4JI7Q 2VUMH 3HOYG 3CXCA 4DUZQ 1QUQA 1WCMG 1QUQB 3F2CA 1EYGA 1LYLA 2N49A 4H02A 3HOWH 4LFAL 5GAGC 1AE2A 3I4NG 4B3MQ 4LF6Q 1JJCB 3J7A5 3HOYH 1RIPA 2MFIA 3CCEA 4DR6L 1WCMH 5FJ8G 1PFSA 3PF5A 5FLMH 2F4VL 2ID0A 1Q1BA 2R7ZH 3I4NH 2K75A 1LTLA 5C4JH 2E8GA 1IYJB 5FJ8H 2GVBA 3HOXG 1YJNA 2VW9A 1X56A 4X65L 2WAQG 5E7NA 4LF8L 4YCWA 2VQFL 3HOXH 4A3LG 1PYBA 1V1QA 4EQ5A 1VQ9A 3VDYA 5IY0A 3RN2A 1IBMQ 1XPUA 3HOUG 2VQEQ 2VY3A 3CPFA 4X62L 3OYYA 3F2BA 2EIFA 1BBUA 4IO9A 1PHJA 4A3DH 1VQNA 1K0RA 3GTGH 4JI3L 1HNWL 4JI2Q 4DR4L 2HHHL 1YHAA 3HOUH 3T1HQ 1IBKL 2UUAL 1Q7YC 3EBEA 3UE0A 1JT8A 2N8NA 2PI2A 5IP9H 4R4IA 3MEFA 4BY7G 1L0WA 4OX9L 3KF6B 4DV0Q 1HH2P 3CCJA 4GLXA 1HR0L 2IX1A 3S14H 4DR7L 4JI8L 1XNRL 4PZ7A 2Y0SG 1VQEA 2JJQA 1EQRA 3D31A 4KI0A 4X66Q 3KJPA 4LF4Q 2GVAA 4IPHA 3KDFA 3S15H 2UXBQ 3PV0A 1HR0W 3CD6A 3M7NA 4OWTB 3AEVA 3HOZG 3BU2A 1CSPA 1VQLA 4B3RQ 4JYAQ 4NXML 4A3FG 3UDGA 1M90C 3CCLA 3M3YH 4A4IA 4ME3A 5AJ3Q 2L15A 2QGQA 4GLVB 2K14A 4LF9Q 3U50C 3PUXA 1K8AC 3OTOQ 4P74A 4O0AA 4LFBQ 3K81C 2HT1A 1PH7A 1PV4A 1IXRA 4QGUA 1JJ2A 4JI0Q 1VQAA 4JBKA 2N3SA 2PQAA 2NVXH 4DV1L 2JA5G 4LF7L 3ULLA 4JI6L 4PMWA 1W2BA 2ATWA 1C7YA 3J81i 3AYHB 3KF8B 4GLAC 2E2HH 4BA2I 4A75A 1HZ9A 1Y14B 4HIDA 1L1OC 4LFAQ 3J81j 1CKNA 3S1QH 3KYHC 3PIPA 3U58A 3PSIA 5DLQE 3AQQA 4DR6Q 3TEHB 1Y1WG 4LWCA 4MNOA 2F4VQ 1HZCA 3GTQH 1GKHA 4LUVA 2MO0A 1EIFA 1KRSA 3EN2A 2K5NA 1GD7A 3WWVA 3GTMH 3RR5A 5GROA 4DNIA 2Q2HA 4X65Q 1JMCA 3GTOH 1VQKA 5ELNA 4A3MG 4A3BG 4BY1G 4LF8Q 2AMCB 5C0XI 2KCMA 3H0GH 2Z0SA 2VQFQ 2NVTH 2BH8A 1N34L 3CC2A 1G291 2EQSA 4B3TL 4BY1H 4A3BH 1PH9A 4X62Q 1HNWQ 3U4VA 2R92G 1UE6A 1VQJA 4UP8A 4JI3Q 4DR4Q 2HHHQ 5C0XG 1L1OB 1TWAH 2PNHA 3U4ZA 1QZGA 1IBKQ 2UUAQ 1Q82C 4YCUA 4GOPC 1K3RA 4AH6A 2JA9A 3GTLH 4X6AH 1OXTA 5IT9c 4OX9Q 2K5VA 3I2ZA 2DUDA 3PIOA 1HR0Q 3I4MG 3S17H 4DR7Q 2IHEA 1YEZA 2MNAA 1XNRQ 1GVPA 2ES2A 4K0KL 4LUOA 3FHWA 3I4MH 4BBSG 1OXUA 2YTVA 3CC7A 1ASYA 3HKSA 3M4PA 4DK3C 3RLOA 4NXMQ 5IYDH 4BBSH 1FVIA 4QY7A 3CCSA 2NN6G 4C3HH 5LMUL 1OXXK 2CFMA 1AH9A 1SLJA 4YWKA 3CF5A 1GO3E 2Q2TA 3J7ZC 3ERSX 2RCNA 3PUVA 4GOPB 1E7ZA 3IRBA 4GKJL 1CSQA 4JOIA 2B29A 4IJHA 4DKAC 1UE7A 1B70B 1L2FA 2A8VA 1FGUA 1TXYA 3W1GA 4C2MH 4DV4L 2B63G 5FLMG 3RZOH 1E22A 4LFCL 3W5OA 4DV1Q 4LF7Q 4JI6Q 4OWWB 2R7ZG 3TREA 1V9PA 4YY3L 4KLKA 2B63H 5GAHC 2JEBI 1G51A 1MKHA 1NMGA 2B3GA 3GD7A 3A5ZB 3K7AH 4TVAB 5BR8L 1YHQA 2I5MX 3T1YL 3AFQA 3ICEA 1XJVA 3E9HA 4IOAA 1SRUA 1N8RC 1KL9A 2LXJA 2KHIA 2PI2E 5IYCH 2Q2IA 2UUBL 3PUZA 1YBYA 4DR5L 1K9MC 2VL6A 3S1MH 3M4QA 1X6OA 4APVA 1X3GA 2N78A 4A3DG 4XTCS 3HOVG 2OTJA 3J80i 4GS3A 1PH3A 4GN4B 1PH5A 4JV5L 5IP9G 2IX0A 3HOVH 5IE8A 3CMEA 1FL0A 1WOCA 4IFDI 3A74A 2BA0A 1YIJA 2R6GA 5JEAG 1N34Q 4B3TQ 4A93G 3H3VH 4QJFA 4B3SL 4O2DA 1JB7A 1PYSB 1EQQA 1E24A 3RLNA 3BJUA 3ER0A 1CKOA 3HKZG 1VQ4A 4A93H 1XMOL 1WYDA 4GNXA 1VQMA 1A63A 4IFDG 5IWAL 4L5SA 4R4CA 1VQBA 4QL5A 3F1ZA 1K83H 5LMNL 2D62A 3B6YA 3CMAA 3KDFB 1X3FA 4NPSA 2VNUD 1EFWA 3G6EA 4DV7L 1C0AA 1XTDA 4K0KQ 2HIXA 4DK6C 1M1KC 1SFOH 4DV6L 1I94L 4A76A 2PMZE 1X3EA 4DR1L 4YWLA 2VS1A 1KC8C 1MIUA 3FP9A 3M9BA 3RN5A 5HY6A 2ZJQA 1G6PA 5ELOA 4HIKA 5LMUQ 4MTNA 3NBHB 3D0FA 1EUJA 4DAYB 1TWGH 1YITA 4DV2L 1O7IA 3S24A 2OTLA 1IBLL 1YI2A 5EAYA 2JEAI 1KIXA 2YTXA 2LSSA 4RMFA 2ZJRA 4L5TA 2PQAB 3E0EA 3CAMA 3SGIA 2Z6KA 4GKJQ 5C0XJ 4L5RC 4BXXH 1HZBA 2KBNA 1WFQA 2GN5A 4KHZA 3I7FA 4YWMA 4DV4Q 3UDIA 2A1AA 4OO1I 4LFCQ 1U5KA 4KHPL 1CKNB 4HJ9A 3I55A 4A3GH 1C9OA 1Y1VH 4YY3Q 5K36G 3I56A 2KCTA 1A62A 2RHSB 4IPGA 3CCRA 2UUCL 2FXQA 4GN5A 1Q46A 5BR8Q 3M85A 2ZM6L 4OXPA 4OO1G 2KENA 1VCIA 3T1YQ 1PH6A 2D0PA 3H0GG 1TWFH 5C3EG 4A3CH 1TWHH 2YYZA 4UP9A 3H15A 4DR5Q 2UUBQ 3A5UA 2RF4A 1SE8A 4HJ5A 5GADC 1VQOA 1UWVA 4AYBE 5C3EH 4JC0A 3S1NH 1HNZL 3PO2G 1UE1A 4JV5Q 2K50A 3G48A 4DV5L 1VS0A 2XTIA 2WFWA 1S40A 3PO2H 4AQYL 4B3SQ 3ULPA 3DM3A 4JOIC 4LF5L 2JA7G 2JE6I 1XMOQ 1EWIA 1PH8A 1VQ5A 3STBC 5IWAQ 1CUKA 1EIYB 3ULJA 2HQLA 3EIVA 1I3QH 2R7DA 1VQHA 5GQOA 4X64L 3F2DA 4HJAA 2JA7H 5LMNQ 2AKWB 2NN6I 1VQIA 4P73A 5IYDG 1QVFA 4A3KH 5M3FG 1VQDA 4DV7Q 2JK8A 5M5XH 1VQCA 2KHJA 1YVCA 4IJLA 1X54A 1Q1EA 4DV6Q 3TS0A 2ALYB 4X66L 1I94Q 3G4SA 5M3FH 4DR1Q 2LXKA 2ASBA 1V43A 4YHHL 4QIWE 1ASZA 1WJJA 3RLFA 5C4XH 3CQZH 3PO3G 3RNUA 3PUWA 1I50H 1X55A 2BA1A 4L5QA 3HFZB 5IP7H 4J15A 2OQ0A 2ZJPA 3A0JA 3K80C 1X9NA 4LW1A 4BA1I 4DV2Q 2R7FA 3PO3H 1IBLQ 4QQBX 1B7YB 2IY5B 5JEAJ 1IZ6A 5J3BA 5GAEC 4DR3L 1SN8A 1Q86C 1N33L 2OQKA 1J6QA 2YU9H 1XNQL 5HGQA 3S2DH 3JAMi 1Z9FA 4DUYL 3NEMA 4IFDJ 4NB3A 2UU9L 4KHPQ 2AWNA 3PGZA 4WJ4A 4GNXC 5IYCG 4JBMA 3TRZA 4DR2L 1WI5A 4P75A 1NBWA 3TQYA 2UUCQ 2CKZB 2H5XA 3J80c 4A3JG 4PZ8A 3H3VI 4JBWA 1N36L 2ZM6Q 5IYBG 4P71A 3S16H 1YZ6A 3ZJYC 3Q8DA 1KQSA 2WB1E 4A3JH 2BH2A 5IYBH 4A3EG 4BBRH 2I5LX 3KOJA 1YJWA 1KAWA 3MXNB 2CQOA 1A0IA 4JI5L 1UE5A 1HNZQ 1Q8KA 4JI4L 3CCUA 2CWPA 4A3EH 1B8AA 4POGA 4LUZA 4DV5Q 4HJ8A 1QZHA 1KD1C 2I0QA 1XMQL 2K4KA 4C3IH 4AQYQ 5H1SE 2NZHA 3PUYA 3CCMA 4GNXB 4UY8C 1TWCH 2D0OA 4DPGA 2Z6KC 4LF5Q 3AFPA 4R4TA 4HIMA 1OXVA 1T9HA 1Z47A 2IHFA 4X64Q 2F3IA 3PCOB 5C44G 1Q12A 2EXDA 4AYBG 4A3LH 5LMNW 3STBD 1S72A 4GKKL 1H95A 5C44H 2CCZA 1E1OA 3CCVA 1X65A 2WP8J 3E9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NY4 A;  3UDX A;  1P16 A;  1J5E L;  2E5L L;  2JA6 G;  4ALP A;  2NVY H;  1CKM A;  1SMX A;  2UXC L;  3KF6 A;  4YHH Q;  2MQH A;  2AWO A;  3GTK H;  2NZO A;  1EOV A;  1IL2 A;  3J81 c;  2E2J H;  1SR3 A;  1QVC A;  2JA6 H;  4IPC A;  4BY7 H;  1D8L A;  4BXX G;  2RHQ B;  1A8V A;  4NXN L;  1KRT A;  2AHO B;  3F8T A;  3FKI G;  5JJI A;  1HJP A;  1BBW A;  1GM5 A;  4A3G G;  1Y1V G;  1MJE A;  2V1C C;  4DR3 Q;  1N33 Q;  5M3M G;  5M5W H;  3NEL A;  1XNQ Q;  3I4O A;  3FKI H;  4PG3 A;  4MZ9 A;  1YHB A;  4HIO A;  1HNX L;  1FJG L;  3GTP H;  4DV3 L;  1N32 L;  2UXD L;  4DUY Q;  3HOZ H;  5JJL A;  1E1T A;  5M3M H;  5JJK A;  2YV5 A;  4A3F H;  1K8G A;  2UU9 Q;  4R4O A;  4A3C G;  4HJ7 A;  1DGS A;  1LM0 A;  2WAQ E;  3UE1 A;  3BZC A;  3NEN A;  3L2P A;  3KJO A;  4AIM A;  1XPO A;  1Q81 C;  4DR2 Q;  2C35 B;  1E3P A;  1LUZ A;  2OCE A;  1VQP A;  4JI7 L;  4JI1 L;  1W3S A;  1KXL A;  4DUZ L;  1PH4 A;  1N36 Q;  4JG2 A;  3RZD H;  3TS2 A;  4R4Q A;  4OON A;  4UPA A;  1U0L A;  4RG1 A;  2F52 A;  4B3M L;  1NJI C;  4LF6 L;  3LGJ A;  4LNQ A;  2QA4 A;  3CW2 C;  4C3J H;  3OW2 A;  2JA5 H;  4P72 A;  2OWO A;  4JI5 Q;  1PA6 A;  4FDB A;  4UP7 A;  2R93 G;  3HKZ E;  1VQF A;  1PH1 A;  4JI4 Q;  2NVQ H;  4YCV A;  3K7U C;  4IOC A;  1MJC A;  3L7Z C;  1R9T H;  2XGT A;  2R93 H;  4WJ3 M;  1Y1W H;  1XMQ Q;  2Y0S E;  2MO1 A;  2ZTD A;  2ZTC A;  1KHI A;  3K0X A;  1BVS A;  1BKB A;  1UEB A;  4JCV E;  4Y52 H;  1D7Q A;  4A3K G;  1N9W A;  1IBM L;  3K8A A;  2VQE L;  3L0O A;  2DGY A;  1SRO A;  1VQ6 A;  1K73 C;  2WB1 G;  1S3O A;  4JI2 L;  4PZ6 A;  4JBJ A;  4A3M H;  3T1H L;  2Q2U A;  1I6H H;  1YNX A;  1XPR A;  3CPW A;  5C4X G;  5M5Y H;  3CC4 A;  1P8L A;  5IP7 G;  1YJ9 A;  4A3I G;  1L1O A;  3S2H H;  4GKK Q;  1OTC A;  1PH2 A;  4DV0 L;  3PF4 A;  3UDF A;  1NMF A;  4TQU S;  1I5F A;  3GO5 A;  3KLW A;  3DLL A;  1J5E Q;  2R92 H;  3M4O H;  3GDE A;  2E5L Q;  4A3I H;  2ZTE A;  2UXC Q;  2IT1 A;  2K52 A;  3GTJ H;  4LF4 L;  3BZK A;  2UXB L;  3W1B A;  1AE3 A;  1NE3 A;  2E2I H;  3JAM c;  3KFU A;  4JI8 Q;  3CP0 A;  1VQG A;  1RL2 A;  2JA8 G;  4NXN Q;  4B3R L;  4JYA L;  4OWX B;  2YTY A;  3CCQ A;  1JE5 A;  4IPD A;  5AJ3 L;  2JA8 H;  2HIV A;  4GN3 B;  4R1J A;  1HZA A;  2A19 A;  3S1R H;  1QVG A;  1HNX Q;  1NTG A;  4LF9 L;  4DAM A;  1FJG Q;  1N32 Q;  2JQO A;  4DV3 Q;  3OTO L;  2UXD Q;  4LFB L;  3JC6 6;  1VQ7 A;  4Y7N H;  2VUM G;  1JJG A;  1PVO A;  2QEX A;  4EX5 A;  5FLX c;  2I5H A;  2VZA A;  4JI0 L;  4POF A;  4BBR G;  2CWA A;  3G71 A;  4GOP A;  1OXS C;  1VQ8 A;  3HOW G;  2K5H A;  4XIG S;  4JI1 Q;  4JI7 Q;  2VUM H;  3HOY G;  3CXC A;  4DUZ Q;  1QUQ A;  1WCM G;  1QUQ B;  3F2C A;  1EYG A;  1LYL A;  2N49 A;  4H02 A;  3HOW H;  4LFA L;  5GAG C;  1AE2 A;  3I4N G;  4B3M Q;  4LF6 Q;  1JJC B;  3J7A 5;  3HOY H;  1RIP A;  2MFI A;  3CCE A;  4DR6 L;  1WCM H;  5FJ8 G;  1PFS A;  3PF5 A;  5FLM H;  2F4V L;  2ID0 A;  1Q1B A;  2R7Z H;  3I4N H;  2K75 A;  1LTL A;  5C4J H;  2E8G A;  1IYJ B;  5FJ8 H;  2GVB A;  3HOX G;  1YJN A;  2VW9 A;  1X56 A;  4X65 L;  2WAQ G;  5E7N A;  4LF8 L;  4YCW A;  2VQF L;  3HOX H;  4A3L G;  1PYB A;  1V1Q A;  4EQ5 A;  1VQ9 A;  3VDY A;  5IY0 A;  3RN2 A;  1IBM Q;  1XPU A;  3HOU G;  2VQE Q;  2VY3 A;  3CPF A;  4X62 L;  3OYY A;  3F2B A;  2EIF A;  1BBU A;  4IO9 A;  1PHJ A;  4A3D H;  1VQN A;  1K0R A;  3GTG H;  4JI3 L;  1HNW L;  4JI2 Q;  4DR4 L;  2HHH L;  1YHA A;  3HOU H;  3T1H Q;  1IBK L;  2UUA L;  1Q7Y C;  3EBE A;  3UE0 A;  1JT8 A;  2N8N A;  2PI2 A;  5IP9 H;  4R4I A;  3MEF A;  4BY7 G;  1L0W A;  4OX9 L;  3KF6 B;  4DV0 Q;  1HH2 P;  3CCJ A;  4GLX A;  1HR0 L;  2IX1 A;  3S14 H;  4DR7 L;  4JI8 L;  1XNR L;  4PZ7 A;  2Y0S G;  1VQE A;  2JJQ A;  1EQR A;  3D31 A;  4KI0 A;  4X66 Q;  3KJP A;  4LF4 Q;  2GVA A;  4IPH A;  3KDF A;  3S15 H;  2UXB Q;  3PV0 A;  1HR0 W;  3CD6 A;  3M7N A;  4OWT B;  3AEV A;  3HOZ G;  3BU2 A;  1CSP A;  1VQL A;  4B3R Q;  4JYA Q;  4NXM L;  4A3F G;  3UDG A;  1M90 C;  3CCL A;  3M3Y H;  4A4I A;  4ME3 A;  5AJ3 Q;  2L15 A;  2QGQ A;  4GLV B;  2K14 A;  4LF9 Q;  3U50 C;  3PUX A;  1K8A C;  3OTO Q;  4P74 A;  4O0A A;  4LFB Q;  3K81 C;  2HT1 A;  1PH7 A;  1PV4 A;  1IXR A;  4QGU A;  1JJ2 A;  4JI0 Q;  1VQA A;  4JBK A;  2N3S A;  2PQA A;  2NVX H;  4DV1 L;  2JA5 G;  4LF7 L;  3ULL A;  4JI6 L;  4PMW A;  1W2B A;  2ATW A;  1C7Y A;  3J81 i;  3AYH B;  3KF8 B;  4GLA C;  2E2H H;  4BA2 I;  4A75 A;  1HZ9 A;  1Y14 B;  4HID A;  1L1O C;  4LFA Q;  3J81 j;  1CKN A;  3S1Q H;  3KYH C;  3PIP A;  3U58 A;  3PSI A;  5DLQ E;  3AQQ A;  4DR6 Q;  3TEH B;  1Y1W G;  4LWC A;  4MNO A;  2F4V Q;  1HZC A;  3GTQ H;  1GKH A;  4LUV A;  2MO0 A;  1EIF A;  1KRS A;  3EN2 A;  2K5N A;  1GD7 A;  3WWV A;  3GTM H;  3RR5 A;  5GRO A;  4DNI A;  2Q2H A;  4X65 Q;  1JMC A;  3GTO H;  1VQK A;  5ELN A;  4A3M G;  4A3B G;  4BY1 G;  4LF8 Q;  2AMC B;  5C0X I;  2KCM A;  3H0G H;  2Z0S A;  2VQF Q;  2NVT H;  2BH8 A;  1N34 L;  3CC2 A;  1G29 1;  2EQS A;  4B3T L;  4BY1 H;  4A3B H;  1PH9 A;  4X62 Q;  1HNW Q;  3U4V A;  2R92 G;  1UE6 A;  1VQJ A;  4UP8 A;  4JI3 Q;  4DR4 Q;  2HHH Q;  5C0X G;  1L1O B;  1TWA H;  2PNH A;  3U4Z A;  1QZG A;  1IBK Q;  2UUA Q;  1Q82 C;  4YCU A;  4GOP C;  1K3R A;  4AH6 A;  2JA9 A;  3GTL H;  4X6A H;  1OXT A;  5IT9 c;  4OX9 Q;  2K5V A;  3I2Z A;  2DUD A;  3PIO A;  1HR0 Q;  3I4M G;  3S17 H;  4DR7 Q;  2IHE A;  1YEZ A;  2MNA A;  1XNR Q;  1GVP A;  2ES2 A;  4K0K L;  4LUO A;  3FHW A;  3I4M H;  4BBS G;  1OXU A;  2YTV A;  3CC7 A;  1ASY A;  3HKS A;  3M4P A;  4DK3 C;  3RLO A;  4NXM Q;  5IYD H;  4BBS H;  1FVI A;  4QY7 A;  3CCS A;  2NN6 G;  4C3H H;  5LMU L;  1OXX K;  2CFM A;  1AH9 A;  1SLJ A;  4YWK A;  3CF5 A;  1GO3 E;  2Q2T A;  3J7Z C;  3ERS X;  2RCN A;  3PUV A;  4GOP B;  1E7Z A;  3IRB A;  4GKJ L;  1CSQ A;  4JOI A;  2B29 A;  4IJH A;  4DKA C;  1UE7 A;  1B70 B;  1L2F A;  2A8V A;  1FGU A;  1TXY A;  3W1G A;  4C2M H;  4DV4 L;  2B63 G;  5FLM G;  3RZO H;  1E22 A;  4LFC L;  3W5O A;  4DV1 Q;  4LF7 Q;  4JI6 Q;  4OWW B;  2R7Z G;  3TRE A;  1V9P A;  4YY3 L;  4KLK A;  2B63 H;  5GAH C;  2JEB I;  1G51 A;  1MKH A;  1NMG A;  2B3G A;  3GD7 A;  3A5Z B;  3K7A H;  4TVA B;  5BR8 L;  1YHQ A;  2I5M X;  3T1Y L;  3AFQ A;  3ICE A;  1XJV A;  3E9H A;  4IOA A;  1SRU A;  1N8R C;  1KL9 A;  2LXJ A;  2KHI A;  2PI2 E;  5IYC H;  2Q2I A;  2UUB L;  3PUZ A;  1YBY A;  4DR5 L;  1K9M C;  2VL6 A;  3S1M H;  3M4Q A;  1X6O A;  4APV A;  1X3G A;  2N78 A;  4A3D G;  4XTC S;  3HOV G;  2OTJ A;  3J80 i;  4GS3 A;  1PH3 A;  4GN4 B;  1PH5 A;  4JV5 L;  5IP9 G;  2IX0 A;  3HOV H;  5IE8 A;  3CME A;  1FL0 A;  1WOC A;  4IFD I;  3A74 A;  2BA0 A;  1YIJ A;  2R6G A;  5JEA G;  1N34 Q;  4B3T Q;  4A93 G;  3H3V H;  4QJF A;  4B3S L;  4O2D A;  1JB7 A;  1PYS B;  1EQQ A;  1E24 A;  3RLN A;  3BJU A;  3ER0 A;  1CKO A;  3HKZ G;  1VQ4 A;  4A93 H;  1XMO L;  1WYD A;  4GNX A;  1VQM A;  1A63 A;  4IFD G;  5IWA L;  4L5S A;  4R4C A;  1VQB A;  4QL5 A;  3F1Z A;  1K83 H;  5LMN L;  2D62 A;  3B6Y A;  3CMA A;  3KDF B;  1X3F A;  4NPS A;  2VNU D;  1EFW A;  3G6E A;  4DV7 L;  1C0A A;  1XTD A;  4K0K Q;  2HIX A;  4DK6 C;  1M1K C;  1SFO H;  4DV6 L;  1I94 L;  4A76 A;  2PMZ E;  1X3E A;  4DR1 L;  4YWL A;  2VS1 A;  1KC8 C;  1MIU A;  3FP9 A;  3M9B A;  3RN5 A;  5HY6 A;  2ZJQ A;  1G6P A;  5ELO A;  4HIK A;  5LMU Q;  4MTN A;  3NBH B;  3D0F A;  1EUJ A;  4DAY B;  1TWG H;  1YIT A;  4DV2 L;  1O7I A;  3S24 A;  2OTL A;  1IBL L;  1YI2 A;  5EAY A;  2JEA I;  1KIX A;  2YTX A;  2LSS A;  4RMF A;  2ZJR A;  4L5T A;  2PQA B;  3E0E A;  3CAM A;  3SGI A;  2Z6K A;  4GKJ Q;  5C0X J;  4L5R C;  4BXX H;  1HZB A;  2KBN A;  1WFQ A;  2GN5 A;  4KHZ A;  3I7F A;  4YWM A;  4DV4 Q;  3UDI A;  2A1A A;  4OO1 I;  4LFC Q;  1U5K A;  4KHP L;  1CKN B;  4HJ9 A;  3I55 A;  4A3G H;  1C9O A;  1Y1V H;  4YY3 Q;  5K36 G;  3I56 A;  2KCT A;  1A62 A;  2RHS B;  4IPG A;  3CCR A;  2UUC L;  2FXQ A;  4GN5 A;  1Q46 A;  5BR8 Q;  3M85 A;  2ZM6 L;  4OXP A;  4OO1 G;  2KEN A;  1VCI A;  3T1Y Q;  1PH6 A;  2D0P A;  3H0G G;  1TWF H;  5C3E G;  4A3C H;  1TWH H;  2YYZ A;  4UP9 A;  3H15 A;  4DR5 Q;  2UUB Q;  3A5U A;  2RF4 A;  1SE8 A;  4HJ5 A;  5GAD C;  1VQO A;  1UWV A;  4AYB E;  5C3E H;  4JC0 A;  3S1N H;  1HNZ L;  3PO2 G;  1UE1 A;  4JV5 Q;  2K50 A;  3G48 A;  4DV5 L;  1VS0 A;  2XTI A;  2WFW A;  1S40 A;  3PO2 H;  4AQY L;  4B3S Q;  3ULP A;  3DM3 A;  4JOI C;  4LF5 L;  2JA7 G;  2JE6 I;  1XMO Q;  1EWI A;  1PH8 A;  1VQ5 A;  3STB C;  5IWA Q;  1CUK A;  1EIY B;  3ULJ A;  2HQL A;  3EIV A;  1I3Q H;  2R7D A;  1VQH A;  5GQO A;  4X64 L;  3F2D A;  4HJA A;  2JA7 H;  5LMN Q;  2AKW B;  2NN6 I;  1VQI A;  4P73 A;  5IYD G;  1QVF A;  4A3K H;  5M3F G;  1VQD A;  4DV7 Q;  2JK8 A;  5M5X H;  1VQC A;  2KHJ A;  1YVC A;  4IJL A;  1X54 A;  1Q1E A;  4DV6 Q;  3TS0 A;  2ALY B;  4X66 L;  1I94 Q;  3G4S A;  5M3F H;  4DR1 Q;  2LXK A;  2ASB A;  1V43 A;  4YHH L;  4QIW E;  1ASZ A;  1WJJ A;  3RLF A;  5C4X H;  3CQZ H;  3PO3 G;  3RNU A;  3PUW A;  1I50 H;  1X55 A;  2BA1 A;  4L5Q A;  3HFZ B;  5IP7 H;  4J15 A;  2OQ0 A;  2ZJP A;  3A0J A;  3K80 C;  1X9N A;  4LW1 A;  4BA1 I;  4DV2 Q;  2R7F A;  3PO3 H;  1IBL Q;  4QQB X;  1B7Y B;  2IY5 B;  5JEA J;  1IZ6 A;  5J3B A;  5GAE C;  4DR3 L;  1SN8 A;  1Q86 C;  1N33 L;  2OQK A;  1J6Q A;  2YU9 H;  1XNQ L;  5HGQ A;  3S2D H;  3JAM i;  1Z9F A;  4DUY L;  3NEM A;  4IFD J;  4NB3 A;  2UU9 L;  4KHP Q;  2AWN A;  3PGZ A;  4WJ4 A;  4GNX C;  5IYC G;  4JBM A;  3TRZ A;  4DR2 L;  1WI5 A;  4P75 A;  1NBW A;  3TQY A;  2UUC Q;  2CKZ B;  2H5X A;  3J80 c;  4A3J G;  4PZ8 A;  3H3V I;  4JBW A;  1N36 L;  2ZM6 Q;  5IYB G;  4P71 A;  3S16 H;  1YZ6 A;  3ZJY C;  3Q8D A;  1KQS A;  2WB1 E;  4A3J H;  2BH2 A;  5IYB H;  4A3E G;  4BBR H;  2I5L X;  3KOJ A;  1YJW A;  1KAW A;  3MXN B;  2CQO A;  1A0I A;  4JI5 L;  1UE5 A;  1HNZ Q;  1Q8K A;  4JI4 L;  3CCU A;  2CWP A;  4A3E H;  1B8A A;  4POG A;  4LUZ A;  4DV5 Q;  4HJ8 A;  1QZH A;  1KD1 C;  2I0Q A;  1XMQ L;  2K4K A;  4C3I H;  4AQY Q;  5H1S E;  2NZH A;  3PUY A;  3CCM A;  4GNX B;  4UY8 C;  1TWC H;  2D0O A;  4DPG A;  2Z6K C;  4LF5 Q;  3AFP A;  4R4T A;  4HIM A;  1OXV A;  1T9H A;  1Z47 A;  2IHF A;  4X64 Q;  2F3I A;  3PCO B;  5C44 G;  1Q12 A;  2EXD A;  4AYB G;  4A3L H;  5LMN W;  3STB D;  1S72 A;  4GKK L;  1H95 A;  5C44 H;  2CCZ A;  1E1O A;  3CCV A;  1X65 A;  2WP8 J;  3E9I A; 
#chains in the Genus database with same CATH topology
 2JA6 G;  2F0Q A;  2E5L L;  2MJ8 A;  4ALP A;  1CKM A;  2JA8 B;  2CW0 D;  3AMU A;  5IGB A;  2BDN A;  3LX0 A;  1D8L A;  1A8V A;  4NXN L;  4MIU A;  1ENC A;  1HJP A;  4A3G G;  1KNE A;  4DAV A;  1B1Z A;  4JW0 A;  4KK7 A;  1EQV A;  2RDG A;  1N32 L;  1DON A;  5JJK A;  3JAM E;  3BYT B;  4A3F H;  2UU9 Q;  1K28 A;  2HDL A;  3HOY B;  4A3C G;  1LM0 A;  1WCM B;  3LNN A;  3NEN A;  2EOT A;  2IPK D;  4TKO B;  2R7Z B;  4JI7 L;  1W3S A;  4HTH A;  2A6E C;  4XYO A;  3TS2 A;  2B2Y C;  4UPA A;  4RG1 A;  1NJI C;  5A2Q L;  4C3J H;  3SK4 A;  3PMF A;  3D3R A;  1PA6 A;  4UP7 A;  4YCV A;  4IOC A;  3NXW A;  2LMC B;  3PIP 3;  3A56 A;  3HOU B;  3DM1 A;  5CV7 A;  2ZTC A;  3V2T A;  1UEB A;  1BKB A;  3H91 A;  2RDH A;  5ELC A;  1A3V A;  2XNA C;  1K73 C;  2A69 D;  3P75 A;  2B8G A;  2CQA A;  2E2D C;  4JI2 L;  2Q2U A;  1I6H H;  3FPU B;  4WJW A;  3T1H L;  1LTB D;  3MXP A;  4MHE A;  1GUS A;  3CC4 A;  2L4N A;  4KY5 A;  5IIF A;  1EL0 A;  4DV0 L;  3UDF A;  3M3Y B;  3GO5 A;  1J5E Q;  2EYP A;  3GTJ H;  2N55 A;  2UXB L;  3W1B A;  4A3F B;  2E2I H;  2JN4 A;  2JA8 G;  2YTY A;  3EQL C;  1A3U A;  1HCZ A;  4PMB A;  5AJ3 L;  2B8F A;  1H9J A;  5CV4 A;  4S3S A;  2A19 A;  1H9R A;  3S1R H;  1QVG A;  1KDB A;  2J4X A;  4X3S A;  2L55 A;  1PZK D;  3OTO L;  4DV3 Q;  2UXD Q;  1JJG A;  4RHR A;  1XXG A;  2I5H A;  4JI0 L;  4BBR G;  3GTQ B;  2CWA A;  5ELE A;  3G71 A;  1OXS C;  4N9T A;  2K5H A;  2L5T A;  4XIG S;  2VUM H;  2AUJ D;  3HOY G;  4OHJ A;  1QCB D;  1WCM G;  5CC4 A;  4UDU C;  2ICI A;  4LFA L;  4IN3 A;  3GTO B;  4TRD A;  4DR6 L;  3I4N H;  2XN9 C;  3NTI A;  1EZ8 A;  3FPP A;  2NB0 A;  1U4P A;  4ZK9 B;  4M1U B;  4RGM A;  3MFY A;  1YJN A;  4XQQ A;  3HOX H;  3VYS A;  4A3L G;  2BCO A;  3VDY A;  1XPU A;  3HOU G;  2VQE Q;  3CPF A;  1TY2 A;  4FVM A;  4DK1 A;  3BG3 A;  5IP9 H;  1NR2 A;  4R4I A;  4DXF A;  1L0W A;  2HCI A;  3KF6 B;  3NQI A;  2HCC A;  1BCP F;  1CFM A;  3QOJ A;  3D31 A;  4H44 C;  1BCP D;  3SK5 A;  4IFD H;  5I9P A;  4OWT B;  4KJO A;  2X6G A;  1VQL A;  4A3F G;  2PQE A;  1PXU A;  4HAE A;  4A4I A;  5IT9 E;  2QGQ A;  3N6R A;  5CYU A;  4LJZ C;  2JSO A;  3C1F A;  2P5Z X;  1GUT A;  2A73 B;  2RSN A;  2C9O A;  4P74 A;  5KYI A;  1JOK A;  4LFB Q;  4IUR A;  4C3J G;  1VQA A;  4JBK A;  2N3S A;  2NVX H;  1SJH D;  1X3Q A;  2ATW A;  1C7Y A;  3S1M B;  4K8J A;  1HZ9 A;  4HID A;  1L1O C;  1VF7 A;  1CKN A;  1DJR D;  1I4P A;  4XQJ A;  4MNO A;  2EJG C;  1GKH A;  1JE4 A;  1KRS A;  3EN2 A;  2O5J C;  2B2T C;  3OWE B;  3PQI A;  2Q2H A;  1NNX A;  1G6Z A;  4X65 Q;  1VQK A;  4DU9 A;  4OO1 H;  5EGT A;  2VQF Q;  2K04 A;  2Z0S A;  3H0G H;  4KN7 C;  4EVO A;  4ID6 A;  1G29 1;  2EQS A;  1K83 B;  5A35 A;  2WAC A;  1UE6 A;  1BR9 A;  4JI3 Q;  2HHH Q;  3U4Z A;  1SFO B;  1JCK B;  4AH6 A;  2JA9 A;  3S17 H;  2KEC A;  4LUO A;  1TT2 A;  3PIO 3;  1SNO A;  4ZQ3 A;  4KKU A;  2CHB D;  3HKS A;  2PZT A;  3RLO A;  4NXM Q;  1FYC A;  2QIL A;  5LMU L;  3TZD A;  5T1G A;  3CF5 A;  4IZ8 A;  2RCN A;  4O1N A;  2FMC A;  4GOP B;  1E7Z A;  3IRB A;  1S5E D;  5JJZ A;  3ERQ A;  4JOI A;  4RAU C;  2A8V A;  3QO2 A;  1FGU A;  1TXY A;  1HFN A;  3RZO H;  4B08 A;  4LFC L;  3W5O A;  1QE6 A;  1TWH B;  4JI6 Q;  4OWW B;  4KLK A;  2B63 H;  5GAH C;  1RCV D;  1G51 A;  1MKH A;  5FOB B;  4TVA B;  3S1N B;  2I5M X;  1WTW A;  3GQB A;  4IOA A;  3PO2 B;  1K9M C;  3M4Q A;  3LWU A;  4APV A;  1STE A;  2OTJ A;  3QB3 A;  2KOL A;  5BN4 A;  5IP9 G;  2BA0 A;  1JB7 A;  4A3K B;  3TME A;  1EQQ A;  3HKZ G;  5JEA H;  1C4Q A;  1XMO L;  3DXJ C;  4GNX A;  4IFD G;  5IWA L;  4QL5 A;  5C4X B;  3CQZ B;  2FMM A;  1CT1 D;  1DCZ A;  3B6Y A;  3KDF B;  1X3F A;  2VNU D;  1EFW A;  3G6E A;  1BDO A;  4DK6 C;  2F0S A;  2AQ1 B;  3FMC A;  4JK1 C;  4NMZ A;  4A76 A;  4DR1 L;  4YWL A;  3P7J A;  3H3V C;  1JR0 D;  3FP9 A;  3S2D B;  1YNJ C;  3W2D A;  1G6P A;  1SND A;  3KBG A;  3NBH A;  4DNR B;  4DAY B;  1O7I A;  4WOR A;  2Z9H A;  5LL6 S;  1B2T A;  2A6H D;  2LSS A;  2YTX A;  5AFW A;  2KED A;  4GKJ Q;  2Z6K A;  1PTO H;  5C0X J;  3S16 B;  4BXX H;  1WFQ A;  2GN5 A;  4DV4 Q;  4YWM A;  3BYY B;  5I6Y A;  4KHP L;  4CKE A;  1B3Q A;  4YY3 Q;  2KCT A;  4IPG A;  3NTK A;  1Q46 A;  3M85 A;  4OO1 G;  1A15 A;  1A2U A;  3T1Y Q;  3H0G G;  4KN4 C;  1YNN C;  1X3P A;  2UUB Q;  3KLS X;  2F0P A;  1SE8 A;  1MSG A;  1VQO A;  1UWV A;  1LV9 A;  4AYB E;  4F7X A;  1IYU A;  1TWC B;  3PO2 G;  1M4V A;  1LAC A;  2EXZ A;  1UE1 A;  2B2V C;  5KIX A;  1HUN A;  1VS0 A;  5FO7 B;  3IL8 A;  3J7A V;  1OO9 B;  4FYD A;  4L63 B;  2B39 A;  3DM3 A;  1L0X B;  2JE6 I;  1TQO A;  1FR3 A;  1CUK A;  2NVY B;  1EIY B;  3KLR A;  3ULJ A;  4G7O C;  1I3Q H;  5C6A A;  3GTK B;  2JA7 H;  5DM6 3;  3T16 A;  2KHJ A;  1Q1E A;  1GJX A;  5CMD A;  1KDA A;  1ASZ A;  1WJJ A;  3RLF A;  2RVL A;  2DJF C;  1XYI A;  1I50 H;  1X55 A;  5IP7 H;  4J15 A;  2ZJP A;  4FF4 A;  3A0J A;  3K80 C;  5M3M B;  4LW1 A;  4BA1 I;  4DV2 Q;  3PO3 H;  2F0T A;  1IBL Q;  1QNK A;  5LL6 X;  5J3B A;  4XXE A;  1SN8 A;  2WIN B;  2YU9 H;  2A74 C;  1Z9F A;  3RZD B;  1SNQ A;  2UU9 L;  3PGZ A;  4QUC A;  3OHX C;  3TRZ A;  2L1B A;  1CQV A;  2LS0 1;  3AU7 A;  3I8Z A;  4P75 A;  2UUC Q;  3EA6 A;  3J80 c;  4KMU C;  2NVQ B;  5ELB A;  5DM7 3;  1JOO A;  2KCC A;  3NPP A;  4P71 A;  5IYB G;  1NCV A;  3K5M A;  1KQS A;  1R9T B;  4ZKC B;  2VB3 X;  1MHW C;  2X6L A;  1YJW A;  4QB4 A;  3IAY A;  1HQM C;  2V4D A;  1B8A A;  1G2S A;  3SR1 A;  1KD1 C;  4A3M B;  2I0Q A;  2K4K A;  4C3I H;  5M5Y B;  4RGT A;  4B9X A;  2MPM A;  4DPG A;  3AFP A;  3D6C A;  4HIM A;  2R92 B;  2RSO A;  4A3I B;  4X64 Q;  2F3I A;  1A6X A;  3DWQ A;  3VR5 A;  1ILQ A;  5EPK A;  4DN4 M;  5LMN W;  1EY0 A;  5EKI A;  2B2W C;  4U67 3;  2CCZ A;  3CCV A;  1ILP A;  1PDQ A;  3E9I A;  1TS5 A;  1J5E L;  1CA5 A;  4R8I A;  1JWM D;  1SMX A;  3KF6 A;  4N8X 1;  1EOV A;  1BNZ A;  1IL2 A;  3GV3 A;  2PZW A;  1SR3 A;  1QVC A;  2LKV A;  3GP7 A;  3NK9 A;  3OSO A;  3U9O A;  2JA6 H;  2PW7 A;  2RHQ B;  4BXX G;  5TSS A;  3F8T A;  3EFX D;  2DY7 A;  4YIJ A;  1N33 Q;  3NWT A;  5M3M G;  4IUT A;  1XNQ Q;  3I4O A;  3BDC A;  1YHB A;  4HIO A;  3IKJ A;  4HCS A;  3GTP H;  4DV3 L;  3HOW B;  2UXD L;  1LTT D;  3NQT A;  1HA6 A;  1K8G A;  2L12 A;  4HJ7 A;  1DGS A;  2WAQ E;  3KJO A;  4DR2 Q;  3A7A B;  2OCE A;  3MFG A;  5D3I B;  5HGT A;  3Q24 A;  1PH4 A;  4R4Q A;  2F4I A;  1PRT F;  2QA4 A;  4RGO S;  5E1F A;  3NSW A;  5FLX E;  3E6Z X;  1ROD A;  2R61 A;  4P72 A;  4PMC A;  3HKZ E;  1PH1 A;  4JI4 Q;  3DUZ A;  5NUC A;  3GTG B;  1TS3 A;  2ENB A;  2XGT A;  3TDQ A;  4WJ3 M;  1XMQ Q;  2SNS A;  4Y52 H;  1KHI A;  1BVS A;  4JCV E;  1D7Q A;  3D8G A;  1WTP A;  1NSN S;  3K8A A;  2VQE L;  4CDF C;  2DGY A;  3S14 B;  1UAP A;  2WB1 G;  4CGY B;  3CU7 A;  1A2T A;  1CQF A;  1YNX A;  1XPR A;  2HD3 A;  4FNF A;  4DXG A;  3A54 A;  1MGS A;  4HSP A;  1NAP A;  4CHT B;  5IP7 G;  2Y0S B;  4A3I G;  1YJ9 A;  3S2H H;  2TMP A;  4E6I A;  1NMF A;  4TQU S;  1I5F A;  3KLW A;  3SE0 A;  3K57 A;  3DLL A;  3BZK A;  4MN3 A;  1WTR A;  1B44 D;  3JAM c;  1IW7 D;  4JI8 Q;  3CP0 A;  1IYV A;  1ZEQ X;  1PZI D;  1JE5 A;  5C3W A;  5I4D A;  2JA8 H;  5EBC A;  1DM0 B;  2HIV A;  4GN3 B;  4R1J A;  1HZA A;  1HNX Q;  4RFB A;  1NTG A;  5JPM C;  4DAM A;  2E2H B;  1FJG Q;  1XX8 A;  1V1O A;  4FO2 A;  1SE2 A;  1VQ7 A;  4LFB L;  1O7Z A;  4EX5 A;  2VZA A;  2OF1 A;  3HOW G;  4GOP A;  1EZ6 A;  1TU2 B;  4JI1 Q;  4DUZ Q;  1QUQ B;  3GTM B;  4LF6 Q;  1E0B A;  1JJC B;  5ISR A;  3HOY H;  4K5V A;  3J7A 5;  3CCE A;  1WCM H;  1PFS A;  5FLM H;  4X3U A;  2K5W A;  1I4G A;  1II3 A;  2ID0 A;  2R7Z H;  2NVT B;  1F77 A;  1PTO F;  4BY1 B;  1LTG D;  2GVB A;  2RDF A;  4FF1 A;  1X56 A;  4C1N K;  4X65 L;  1LT4 D;  5E7N A;  1TWA B;  4EQN A;  4YCW A;  4GZY C;  1B4O A;  2VQF L;  4EQ5 A;  3GTL B;  1VQ9 A;  3RN2 A;  2QEJ C;  3ERO A;  1ONL A;  2K1B A;  4IO9 A;  4A3D H;  4LAA A;  2JXM B;  2Q8T A;  4JI3 L;  2HHH L;  1YHA A;  3HOU H;  3ONA B;  1Q7Y C;  3EBE A;  1JT8 A;  2N8N A;  2PI2 A;  2FJ2 A;  5M9O A;  1SYE A;  4ILW A;  1WD0 A;  3CCJ A;  4BBS B;  4C3H B;  4PZ7 A;  2Y0S G;  1VQE A;  1EQR A;  4LF4 Q;  3KDF A;  3K59 A;  1PFB A;  1SMY C;  3BU2 A;  1CSP A;  3G7L A;  4JYA Q;  4NXM L;  3MXU A;  1M90 C;  2JYO A;  3M3Y H;  4ME3 A;  1MI2 A;  2DNE A;  2SDF A;  2K14 A;  3I3C A;  3PUX A;  1K8A C;  3VR4 A;  1GHK A;  1PV4 A;  2F0V A;  1QWY A;  4QGU A;  1JJ2 A;  5BN5 A;  1RTO A;  4JI6 L;  4PMW A;  1QJO A;  3KF8 A;  3K6O A;  4GLA C;  3MTS A;  4BA2 I;  1WTQ A;  3ND9 A;  4QUF A;  5DLQ E;  3C46 A;  3TEH B;  1HZC A;  1AW7 A;  1VMP A;  3D4R A;  1VDZ A;  3GTQ H;  1QIL A;  3HOV B;  4LUV A;  1GXD C;  4A3D B;  2RQX A;  4EQP A;  2R3Z A;  2KHS A;  5CGK A;  1LO5 D;  5J1Z A;  1JMC A;  3GTO H;  3L9A X;  4A93 B;  1SDF A;  4BY1 G;  4LF8 Q;  2AMC B;  5C0X I;  3ZYY X;  2DY8 A;  2L0C A;  3OW7 A;  2BH8 A;  2SNM A;  4RGN A;  1PH9 A;  4X62 Q;  4KD4 A;  1EEI D;  2F0K A;  3QWN A;  1HNW Q;  4DR4 Q;  3VYR A;  1IBK Q;  1QZG A;  4HCE A;  1KDC A;  5JVG 3;  4YCU A;  2QDB A;  2IX3 A;  3J7Y W;  1K3R A;  4X3K A;  1B3A A;  1OXT A;  5IT9 c;  2K5V A;  3I2Z A;  4AYB B;  2DUD A;  3PIO A;  1HR0 Q;  4ODG A;  2NBF A;  2F0O A;  3HGB A;  1GVP A;  1XNR Q;  2PW5 A;  3FHW A;  4BBS G;  4KY7 A;  1AN8 A;  2CW0 C;  3M4P A;  2L9H A;  5T1I A;  3DWA A;  1LTS D;  4QY7 A;  2E74 C;  4YWK A;  2PZU A;  3V05 A;  1Y1V B;  5DEH A;  5FKA C;  3PUV A;  2XIW A;  3URY A;  3H09 A;  2ZXO A;  2HDM A;  4IUP A;  4GKJ L;  1D5X C;  4MTK A;  4ULL A;  4IJH A;  1UE7 A;  1B53 A;  4C2M H;  4DV4 L;  5D14 A;  5FLM G;  1SNM A;  2R7Z G;  3SXH A;  3TRE A;  1V9P A;  4YY3 L;  5G3L D;  2EVB A;  4RA8 A;  3MEH A;  1AP0 A;  3T1Y L;  5FK9 C;  3E5S A;  5IGC A;  4OEM B;  1SSO A;  2RBM A;  5IYC H;  3S1M H;  2UUB L;  3PUZ A;  2VL6 A;  1X3G A;  3R3O A;  4A3D G;  3HOV G;  3MXG A;  3J80 i;  4Z9C B;  2LY7 A;  2EJM A;  1N34 Q;  2R6G A;  4A93 G;  1BUV T;  3GV6 A;  3SK6 A;  4O2D A;  2EZV A;  1C8C A;  3BJU A;  1S4Z A;  3NWS A;  5EJW A;  1VQM A;  5M3F B;  4R4C A;  1VQB A;  1K83 H;  4RKL A;  1JQY D;  4IUU A;  1C0A A;  1F2Z A;  1SFO H;  1F9R A;  4C2M B;  4U68 A;  5IGF A;  2VS1 A;  1KC8 C;  2K32 A;  3A8I E;  2ZT9 C;  3M9B A;  3CHB D;  3RN5 A;  2ZJQ A;  4MTN A;  4DAP A;  4DV2 L;  1ML0 D;  1IBL L;  2EY1 A;  4J1M A;  3X3N A;  1H9S B;  4DFA A;  1HTP A;  4G57 A;  4L5T A;  2PMZ B;  2PQA B;  3E0E A;  3J80 L;  1O7L A;  1Y8O B;  2KBN A;  4KHZ A;  3I7F A;  2A1A A;  1U5K A;  4HJ9 A;  5K36 G;  3IFD A;  1A62 A;  2UUC L;  4V19 0;  1AZP A;  4GN5 A;  5BR8 Q;  4A3E B;  4OXP A;  1VCI A;  1PYW D;  2D0P A;  1TWH H;  1CTM A;  4UP9 A;  1V1P B;  1D1I A;  5KEE A;  3E0J A;  1ZYR C;  3S1N H;  3BDO A;  5KNC A;  4JV5 Q;  2E75 C;  1KLU D;  2XTI A;  2EJF C;  1CZG A;  3PO2 H;  2QW7 A;  4QMG A;  3A7L A;  5C44 B;  4JOI C;  2QCP X;  1EWI A;  3WOF A;  1VQ5 A;  4G4K A;  3STB C;  1AZQ A;  4X64 L;  2HQL A;  5D3D A;  3F2D A;  3CRL C;  5LMN Q;  3C1E A;  1LTI D;  1VQI A;  2E2J B;  4NKL A;  4BY7 B;  4A3K H;  5M3F G;  2JK8 A;  1SNP A;  1X54 A;  2F03 A;  1I94 Q;  2ALY B;  3VYT A;  3G4S A;  5M5W B;  3WOE A;  4QIW E;  5C4X H;  3CQZ H;  3FKI B;  5D65 A;  2BA1 A;  3HFZ B;  4JPB W;  3HOZ B;  1K8M A;  1ET6 A;  1B7Y B;  1M8A A;  1YNJ D;  4K6D A;  1IZ6 A;  5JEA J;  4FF2 A;  5GAE C;  1N33 L;  1Q86 C;  2OQK A;  1J6Q A;  1XNQ L;  1VMC A;  3S2D H;  3JAM i;  1STB A;  3J81 E;  4NB3 A;  1LAB A;  1U4L A;  4KY6 A;  4GNX C;  5IYC G;  4DR2 L;  1GUN A;  1WI5 A;  3DWP A;  2H5X A;  3H3V I;  4PZ8 A;  2EYM A;  2KVM A;  4JBW A;  2ZM6 Q;  3S16 H;  4BWG B;  1F2L A;  2DN8 A;  2R93 B;  1U4M A;  1Y1W B;  1T5X D;  5IYB H;  4A3E G;  2EY2 A;  2I5L X;  2EYH A;  1G2T A;  1KAW A;  1TR5 A;  3MXN B;  3V96 A;  1K0S A;  1HNZ Q;  1YNN D;  1IKM A;  1Q8K A;  4JI4 L;  1HHV A;  1Z7T A;  4LUZ A;  1XMQ L;  5H1S E;  3PUY A;  3CCM A;  3UI2 A;  2X69 A;  3Q23 A;  5C4H A;  2M9V A;  1TWC H;  2Z6K C;  4LF5 Q;  3MAQ A;  4CJ2 C;  1UNS A;  2IHF A;  3M4O B;  5COY A;  2K5Q A;  1TKW B;  1BQQ T;  3PCO B;  5C44 G;  1Q12 A;  2N88 A;  3OMG A;  2EXD A;  3JAM L;  2OEO A;  4IUN A;  2CH4 A;  3BDL A;  3K0Y A;  1E1O A;  3X3M A;  1X65 A;  2G9D A;  1NY4 A;  1P16 A;  3VR3 A;  2NVY H;  4XDX A;  3VYU A;  4YHH Q;  2EYL A;  3GTK H;  2NZO A;  4HED A;  4IPC A;  4G7H C;  2AHO B;  3FKI G;  3H94 A;  1SE3 A;  1WTO A;  2V1C C;  3I72 A;  1MJE A;  3NEL A;  4K14 A;  5E4W C;  4MZ9 A;  1HNX L;  3NTH A;  1FJG L;  4DUY Q;  5JJL A;  1E1T A;  5C5M A;  5M3M H;  2YV5 A;  4R4O A;  4K6L A;  3L2P A;  2EY6 A;  1WTH A;  3BZC A;  4AIM A;  2C35 B;  1E3P A;  1VQP A;  4JI1 L;  3SHL A;  1CZW A;  3H6M A;  5C4J B;  4DUZ L;  3RZD H;  1U0L A;  4LF6 L;  2F52 A;  4LNQ A;  1O7Y A;  4PQX A;  1ENF A;  1JWU D;  5CBE E;  3OW2 A;  4OL7 A;  3I4L A;  2QDL A;  5IGD A;  2JA5 H;  3WDN A;  3OIP A;  2AUK A;  2MUY A;  2WKD A;  2R93 G;  2PPB C;  2NVQ H;  1EFI D;  3K7U C;  1E2W A;  2Z1C A;  1R9T H;  4Q5V A;  2MO1 A;  4A3K G;  2IW3 A;  1TVX A;  2RCF A;  3L0O A;  1SRO A;  3DMU A;  1VQ6 A;  2HUG A;  1S3O A;  4PZ6 A;  4A3M H;  3QJY A;  3S15 B;  5C4X G;  5A2Q E;  5M5Y H;  2A68 C;  2L11 A;  1P8L A;  4HN7 A;  5KRU A;  2HQE A;  1GOZ A;  1CHP D;  3K5L A;  2R92 H;  4F8M A;  4A3I H;  5J39 A;  5C0X H;  2UXC Q;  2IT1 A;  2K52 A;  4LF4 L;  1AE3 A;  1NE3 A;  3KFU A;  4KHV A;  3QG1 A;  1EIG A;  4K8I A;  1J9O A;  1DXM A;  2AQ3 B;  1ICW A;  4JYA L;  4OWX B;  1V8Q A;  5E3F A;  1D5Z C;  2B2V A;  2BOS A;  2JQO A;  1K8O A;  4G7Z C;  2JA5 B;  3S1Q B;  3JC6 6;  1ZXT A;  1PVO A;  5FLX c;  2CH4 W;  1SBB B;  4POF A;  1F2Y A;  1EU4 A;  3CXC A;  3R8B A;  1QB5 D;  1JC7 A;  1EYG A;  2N49 A;  3HOW H;  1TII D;  3RD4 A;  4B3M Q;  1B9M A;  1RIP A;  2G9H D;  2K33 A;  4FP5 D;  5FJ8 G;  2K75 A;  1LTL A;  5HUR A;  4A3B B;  5EPJ A;  2F0D A;  2EYJ A;  4RH6 A;  2VW9 A;  1Q90 A;  3ITP A;  4LF8 L;  2BDO A;  4H7B A;  2D9U A;  1BO0 A;  1IBM Q;  5IT9 L;  4CKB A;  4X62 L;  3OYY A;  3F2B A;  1BBU A;  3U9S A;  1HNW L;  1VQN A;  3GTG H;  4DR4 L;  4Q0F A;  3MWY W;  1IBK L;  3UE0 A;  3I4M B;  1HR0 L;  4IUQ A;  3S14 H;  1XNR L;  2QKI C;  2JJQ A;  2MHV A;  3TP6 A;  3KJP A;  4IPH A;  3CD6 A;  4L6T B;  3NE5 B;  2FIN B;  3M7N A;  3MC0 B;  3AEV A;  1HUM A;  4B3R Q;  1KLG D;  3CCL A;  1BXT A;  1JOR A;  5JPN C;  4GLV B;  5KNB A;  4LF9 Q;  3U50 C;  4KD3 A;  2XVS A;  1HFG A;  4O0A A;  2HT1 A;  3K7A B;  2H1E A;  3F2U A;  1IXR A;  1H9S A;  5LHY 1;  3C2P A;  1O80 A;  2PQA A;  2JA5 G;  4XYQ A;  1FGB D;  1DOL A;  3J81 i;  2WV6 D;  2E2H H;  4A75 A;  3D4D A;  4WRD A;  3U58 A;  5KYL A;  3PIP A;  3TP7 A;  3AQQ A;  4LWC A;  3BS1 A;  2F4V Q;  4L8J A;  2K03 A;  2B2W A;  2MO0 A;  2KUM A;  1Z6H A;  2NZ1 D;  3FEW X;  1GD7 A;  4ZLT F;  2SEB D;  3WWV A;  3GTM H;  3RR5 A;  2Q8I B;  4DNI A;  1JB3 A;  1EY5 A;  5CV5 A;  2F0G A;  5ELN A;  4A3M G;  1V1P A;  4A3B G;  2NVT H;  1N34 L;  4BY1 H;  2R92 G;  4UP8 A;  4IUV A;  1EY7 A;  5C0X G;  1L1O B;  1TWA H;  2PNH A;  3A8J E;  2UUA Q;  4GOP C;  3GTL H;  4X6A H;  4OX9 Q;  3TSS A;  1G91 A;  3I4M G;  2IL8 A;  3M7G A;  4DR7 Q;  2ES2 A;  1TWG B;  4DA2 A;  2BE5 C;  1I4R A;  1VF5 C;  3J81 L;  1OXU A;  3SK8 A;  1IHZ A;  4DK3 C;  2F0W A;  3MHB A;  3BVM A;  5IYD H;  4BBS H;  1D1K A;  2NN6 G;  4C3H H;  1OXX K;  2CFM A;  1SMY D;  5DAU A;  1AH9 A;  2PO4 A;  1GO3 E;  4A3G B;  4ZUI A;  2Q2T A;  4C1N I;  3TN2 A;  3S9W A;  1EYC A;  1CSQ A;  4DKA C;  2EDG A;  5CV6 A;  3W1G A;  5JVH 3;  3OOC A;  1SYB A;  1WTX A;  3Q22 A;  4DV1 Q;  1TWF B;  4LF7 Q;  4QIW B;  1S5C D;  1CK1 A;  2A6E D;  2DNC A;  1ESF A;  2JEB I;  2F0N A;  5C3E B;  3GD7 A;  1YHQ A;  1NMG A;  3A5Z B;  4I7Z C;  4LK1 C;  5BR8 L;  1WD1 A;  3AFQ A;  3ICE A;  1A3T A;  4PNY A;  4R9W A;  3E9H A;  2KHI A;  2PI2 E;  1LTA D;  1PRT C;  1YBY A;  1JWS D;  2B2U A;  4DF7 A;  2NUC A;  5K5P A;  4B9W A;  4WFN 3;  1SYC A;  4KKS A;  1ET9 A;  1PH3 A;  3MXN A;  4JV5 L;  3HOV H;  3CME A;  1FL0 A;  3A74 A;  4B3T Q;  3H3V H;  1SXT A;  1PYS B;  3RLN A;  1STH A;  1CKO A;  5M5X B;  1VQ4 A;  4A93 H;  1R4P B;  3I73 A;  4L5S A;  1PFN A;  1GUW A;  3R93 A;  5LMN L;  3SDZ A;  4NPS A;  4K0K Q;  2HIX A;  1X32 A;  4F87 A;  1M1K C;  1I94 L;  1X3E A;  1RD9 D;  3QIA A;  1WVL A;  1Q3L A;  1F9Q A;  5C5L A;  3VA7 A;  2NTT A;  4CDD C;  3NBH B;  4DAY A;  1EUJ A;  1YIT A;  3TP5 A;  1FNU A;  2JEA I;  5IGG A;  4RMF A;  2ZJR A;  2XWJ B;  5EPL A;  3SGI A;  1HZB A;  5J22 A;  3UDI A;  5L37 A;  4A3J B;  1UEA B;  3I55 A;  4BBR B;  1Y1V H;  1SYF A;  3CCR A;  2PNR C;  2FXQ A;  1BBX C;  1EQT A;  2ZM6 L;  5EKK A;  5K36 H;  2KEN A;  2ICE C;  5C3E G;  2YYZ A;  3T53 B;  4ZKB B;  3H15 A;  4DR5 Q;  2RF4 A;  4HJ5 A;  5GAD C;  1Y8N B;  1O78 A;  4JC0 A;  1HNZ L;  1PTO C;  3G48 A;  3HRZ C;  2EYO A;  1S40 A;  2FHT A;  4C56 C;  4B3S Q;  1LT3 D;  3ULP A;  2EY5 A;  4LF5 L;  1PH8 A;  3O13 A;  3KLS A;  2R7D A;  1VQH A;  4HJA A;  1U4R A;  2AKW B;  2NN6 I;  5IYD G;  1QVF A;  2B2Y A;  4DV7 Q;  5JOB A;  4C3H G;  4IJL A;  3TS0 A;  4DV6 Q;  2MGS A;  5M3F H;  1E2V A;  2LXK A;  2ASB A;  1V43 A;  4YHH L;  4DGZ A;  4NW2 A;  1AFP A;  1X9N A;  1EEF D;  2KQ3 A;  4NDX A;  3KBX A;  2R7F A;  2G5D A;  5KND A;  2O4X A;  3OMC A;  2IY5 B;  3HP3 A;  4K2L A;  5G3L F;  3R2I A;  4DUY L;  3MZ5 A;  1B9N A;  4IFD J;  4N8F A;  1HPC A;  2AWN A;  5F2D A;  4CDE C;  2I07 B;  4C3J B;  1STA A;  2D5D A;  2PCF B;  1WTV A;  2LFN A;  1NBW A;  4UHV A;  2CKZ B;  4A3J G;  1I4H A;  5JAV A;  2NTS A;  1YZ6 A;  3ZJY C;  2K28 A;  4OEL B;  2WB1 E;  3QOL A;  1DZ1 A;  3TZU A;  3W3A A;  3KOJ A;  2CQO A;  1A0I A;  1EYA A;  1NUC A;  4H0L C;  2EPB A;  3RMH A;  3CCU A;  4A3E H;  3SVM A;  4POG A;  1IKL A;  4DV5 Q;  1W6K A;  1I6H B;  1ZYR D;  4AQY Q;  2A69 C;  2NZH A;  5DNF A;  4UY8 C;  2O2L D;  1EYD A;  2D0O A;  1FD7 D;  4ZCK A;  1OXV A;  1EWC A;  1T9H A;  1RDP D;  1ZKO A;  3GTJ B;  2E2I B;  2FFK B;  4AYB G;  2F0F A;  3STB D;  5EKL A;  1S72 A;  1H95 A;  5C44 H;  3SEB A;  2WP8 J;  4X66 Q;  3UDX A;  3FRP B;  4N9P A;  3KK7 A;  2UXC L;  3A55 A;  5C3X A;  2MQH A;  2AWO A;  3S1R B;  3J81 c;  2E2J H;  2MP1 A;  3MVV A;  4BY7 H;  1ICF B;  3MA2 B;  4ZRZ A;  4K5W A;  1KRT A;  5JJI A;  1LLR D;  5FLX L;  1BBW A;  1SAP A;  1GM5 A;  1Y1V G;  4DR3 Q;  4R8N A;  4OIK A;  2F0H A;  5FO8 B;  5IGE A;  5M5W H;  2VUM B;  1PLF A;  3NHH A;  3FKI H;  4PG3 A;  3HOZ H;  3ND8 A;  2OT2 A;  3UE1 A;  1XPO A;  1Q81 C;  2K01 A;  3I4N B;  1LUZ A;  1QNU A;  3KUP A;  1KXL A;  1N36 Q;  4KTA A;  4JG2 A;  4OON A;  2SOB A;  4B3M L;  1R4Q B;  3K5O A;  3LGJ A;  1UUP A;  1KTK A;  3CW2 C;  2KA7 A;  1G8Z D;  1HQR D;  4EQO A;  1MSH A;  3HZX A;  3HOX B;  4V0B A;  2WAQ B;  2OWO A;  4JI5 Q;  1FNW A;  3LWE A;  4FDB A;  4X3T A;  3T51 B;  1VQF A;  1SYG A;  1BOS A;  1MJC A;  3L7Z C;  2R93 H;  1Y1W H;  2Y0S E;  2ZTD A;  3K0X A;  2KJX A;  1JIC A;  3IFT A;  1C48 A;  1N9W A;  1IBM L;  3Q6S A;  4KJN A;  5I6W A;  3BZD B;  3HKZ B;  4FF3 A;  4JBJ A;  4CBV A;  3CPW A;  2CVR A;  1SEB D;  2A5H A;  1F9S A;  4GKK Q;  1L1O A;  1OTC A;  1BCP C;  1PH2 A;  4CJ1 B;  3PF4 A;  3L3O C;  2Z8L A;  5C4Z A;  2F0M A;  3M4O H;  3GDE A;  2E5L Q;  2ZTE A;  3CRK C;  1QG7 A;  5CV8 A;  4K2K A;  2WII B;  2B2T A;  1DYQ A;  1RL2 A;  1VQG A;  2XWB B;  4O42 A;  4NXN Q;  4B3R L;  5EBD A;  2VXW A;  3CCQ A;  4M8A A;  1H9K A;  4IPD A;  2NVX B;  2NYZ D;  3E3X A;  2C5C A;  1EY4 A;  4LF9 L;  1N32 Q;  4F88 A;  3HS0 C;  4Y7N H;  2VUM G;  4RKB A;  2QEX A;  2EYF A;  3FDT A;  1Y8P B;  1VQ8 A;  4JI7 Q;  3P1H A;  1QUQ A;  3F2C A;  1LYL A;  4H02 A;  4ME5 A;  4BS9 A;  1JOQ A;  5GAG C;  1AE2 A;  3I4N G;  2F0E A;  1DOM A;  2KCN A;  4HR7 B;  2MFI A;  3PF5 A;  2F4V L;  1IL8 A;  4P2C B;  3H0G B;  1Q1B A;  1TS2 A;  4FXK C;  5C4J H;  2E8G A;  1IYJ B;  5FJ8 H;  3D4W A;  3OWF A;  1STG A;  1GUO A;  3HG9 A;  3HOX G;  5IOC A;  2WAQ G;  4RCN A;  1HXY D;  1PYB A;  1V1Q A;  5COR A;  1CA6 A;  5IY0 A;  2F3W A;  2VB2 X;  2VY3 A;  2K5D A;  3S17 B;  2EIF A;  1PHJ A;  1K0R A;  5CBA E;  4JI2 Q;  3A8K E;  3T1H Q;  2UUA L;  3K5N A;  1CI3 M;  4XQN A;  3MEF A;  4BY7 G;  1DD2 A;  5BN3 A;  4OX9 L;  4DV0 Q;  1HH2 P;  4GLX A;  2IX1 A;  4DR7 L;  2A68 D;  4JI8 L;  3C3L A;  1L0Y B;  4KI0 A;  3VR2 A;  5IOD A;  4Y7N B;  1XWE A;  3S15 H;  2GVA A;  2UXB Q;  1D5M C;  1PMR A;  1PRT B;  3M4Y A;  3PV0 A;  2Q8R E;  1HR0 W;  1LT6 D;  3J7A F;  3R2T A;  4HMJ A;  3HOZ G;  2M2L A;  3UDG A;  3RZO B;  5AJ3 Q;  2L15 A;  1STN A;  1NR4 A;  2B63 B;  3OTO Q;  1SE4 A;  3K81 C;  1AEX A;  1RHP A;  1PH7 A;  1F2M A;  4JI0 Q;  2RA4 A;  1DOK A;  3N52 A;  4DV1 L;  1EY9 A;  4LF7 L;  3ULL A;  1W2B A;  2I46 A;  3AYH B;  3KF8 B;  2XRQ D;  1XTC D;  5E4X A;  1J8I A;  1Y14 B;  4LFA Q;  3J81 j;  3S1Q H;  3KYH C;  1HRJ A;  3PSI A;  4DR6 Q;  1Y1W G;  1BF4 A;  1RKN A;  4CKC A;  3VR6 A;  1EIF A;  3TBI B;  4NP5 A;  2RKS A;  2K5N A;  4KKT A;  5GRO A;  4I7A A;  1SJE D;  4ZYS A;  1EU3 A;  2KCM A;  4UAI A;  2F0I A;  4J8Q A;  2ZXP A;  3CC2 A;  4B3T L;  4A3B H;  3U4V A;  1VQJ A;  3BVG A;  3DEO A;  1Q82 C;  4I65 A;  3NP8 A;  3EJI A;  2IHE A;  1YEZ A;  2PYK A;  2MNA A;  4K0K L;  3T4A C;  2F1M A;  4OGQ C;  3I4M H;  1Q8I A;  4XT1 B;  2YTV A;  3CC7 A;  1ASY A;  3EVQ A;  5I2Y A;  1LTR D;  3DHQ A;  1PTO B;  1FVI A;  2A6H C;  3CCS A;  2XRS D;  1SLJ A;  1GUG A;  3J7Z C;  5CR3 A;  3ERS X;  2NN6 H;  3BVZ A;  2J0T D;  3T13 A;  4LMQ D;  2B29 A;  2IWH A;  1B70 B;  1EY8 A;  1L2F A;  5ELF A;  3Q0A A;  2B63 G;  1I4X A;  1E22 A;  4RHS A;  2J7Z A;  5I9O A;  3K58 A;  1Y69 U;  3TP8 A;  1SYD A;  2EE1 A;  3RUZ A;  2B3G A;  3K7A H;  1SNC A;  4QCL A;  3T56 B;  2D2C C;  1XJV A;  2WKC A;  1SRU A;  1N8R C;  1KL9 A;  2LXJ A;  2GA4 B;  2Q2I A;  4DR5 L;  1X6O A;  3FVQ A;  2N78 A;  4XT3 B;  4XTC S;  1PFM A;  1CHQ D;  4GS3 A;  4RCO A;  1PH5 A;  4GN4 B;  2Z4I A;  2IX0 A;  5IE8 A;  1I3Q B;  4IAL A;  1WOC A;  4IFD I;  2M00 A;  1YIJ A;  2JA7 B;  5JEA G;  2F0L A;  1T5E A;  4QJF A;  4B3S L;  1E24 A;  1S5F D;  3ER0 A;  2WB1 B;  1KAA A;  1K3B C;  1RTN A;  1WYD A;  1A63 A;  3CKI B;  2TSS A;  3AB9 A;  1TY0 A;  3F1Z A;  1I50 B;  2D62 A;  1S5D D;  2F3V A;  4QF4 A;  3CMA A;  4DV7 L;  1XTD A;  3PO3 B;  1E2Z A;  4DV6 L;  2PMZ E;  2K7V A;  2YU9 B;  1MIU A;  2BE5 D;  2QF7 A;  5HY6 A;  5ELO A;  4HIK A;  5LMU Q;  3D0F A;  1TWG H;  4OIJ A;  3S24 A;  2OTL A;  1YI2 A;  5EAY A;  3NBI A;  4HSV A;  1KIX A;  2IJ0 A;  1KAB A;  1ESR A;  3CAM A;  2DJG C;  4L5R C;  4CDC C;  4OO1 I;  4ABN A;  4LFC Q;  1CKN B;  5ELD A;  1U9R A;  1C9O A;  4A3G H;  3I56 A;  2RHS B;  1D6E C;  1GHJ A;  4PV1 C;  1QOH A;  4DK0 A;  5CV9 A;  5FO9 B;  1PH6 A;  4JVZ A;  1TWF H;  3I91 A;  4A3C H;  4C3I B;  3A5U A;  4CJ0 B;  1W6J A;  5C3E H;  1EWH A;  1EY6 A;  2Z6B A;  1PRT D;  3J80 E;  2K50 A;  4DV5 L;  2K05 A;  2JP1 A;  2WFW A;  4AQY L;  4FXD A;  2JA7 G;  1XMO Q;  1CM9 A;  2K6A A;  5IWA Q;  3P20 A;  3EIV A;  1I6V C;  1STY A;  5GQO A;  4P73 A;  2XSC A;  2JA6 B;  1VQD A;  4FXG C;  4H13 C;  5I2X A;  4EGV A;  4K5X A;  5M5X H;  1H9M A;  1VQC A;  1YVC A;  1MD2 D;  4X66 L;  4DR1 Q;  2O5I C;  5KGU A;  3OPO A;  3PO3 G;  1EIH A;  3RNU A;  3PUW A;  2B2U C;  3GTP B;  4L5Q A;  2OQ0 A;  1F9P A;  3HEJ A;  1RJT A;  2H4O A;  2Z4H A;  4KV6 A;  3DEP A;  3QR8 A;  4QQB X;  1PZJ D;  4DR3 L;  3G6J B;  4HMI A;  2ZXR A;  2F0U A;  4IQZ A;  5HGQ A;  3I70 A;  3NUC A;  5EQ0 A;  3NEM A;  4WJ4 A;  4KHP Q;  2NWG A;  1FNV A;  1ENA A;  4JBM A;  1S5B D;  1I4Q A;  4J6H A;  3TQY A;  4TSS A;  1BCP B;  1N36 L;  4ZUJ A;  2AQ2 B;  3Q8D A;  4RWS C;  4A3J H;  1HA5 A;  2BH2 A;  1EOT A;  4BBR H;  1MBY A;  4ZAI A;  1RF2 D;  4JI5 L;  1UE5 A;  3I90 A;  2CWP A;  4C3I G;  1TS4 A;  2F0J A;  2E76 C;  4HJ8 A;  1QZH A;  1PTO D;  1B50 A;  3OIQ A;  4GNX B;  3S2H B;  4DNT B;  4R4T A;  3D6W A;  1Z47 A;  1HTL D;  1KNA A;  1D2B A;  1LT5 D;  4A3L H;  4GKK L;  3VA5 A;  2OXP A;  2KEE A;  1IW7 C; 
#chains in the Genus database with same CATH homology
 1NY4 A;  3UDX A;  1P16 A;  1J5E L;  2E5L L;  2JA6 G;  4ALP A;  2NVY H;  1CKM A;  1SMX A;  2UXC L;  3KF6 A;  4YHH Q;  2MQH A;  2AWO A;  3GTK H;  2NZO A;  1EOV A;  1IL2 A;  3J81 c;  2E2J H;  1SR3 A;  1QVC A;  2JA6 H;  4IPC A;  4BY7 H;  1D8L A;  4BXX G;  2RHQ B;  1A8V A;  4NXN L;  1KRT A;  2AHO B;  3F8T A;  3FKI G;  5JJI A;  1HJP A;  1BBW A;  1GM5 A;  4A3G G;  1Y1V G;  1MJE A;  2V1C C;  4DR3 Q;  1N33 Q;  5M3M G;  5M5W H;  3NEL A;  1XNQ Q;  3I4O A;  3FKI H;  4PG3 A;  4MZ9 A;  1YHB A;  4HIO A;  1HNX L;  1FJG L;  3GTP H;  4DV3 L;  1N32 L;  2UXD L;  4DUY Q;  3HOZ H;  5JJL A;  1E1T A;  5M3M H;  5JJK A;  2YV5 A;  4A3F H;  1K8G A;  2UU9 Q;  4R4O A;  4A3C G;  4HJ7 A;  1DGS A;  1LM0 A;  2WAQ E;  3UE1 A;  3BZC A;  3NEN A;  3L2P A;  3KJO A;  4AIM A;  1XPO A;  1Q81 C;  4DR2 Q;  2C35 B;  1E3P A;  1LUZ A;  2OCE A;  1VQP A;  4JI7 L;  4JI1 L;  1W3S A;  1KXL A;  4DUZ L;  1PH4 A;  1N36 Q;  4JG2 A;  3RZD H;  3TS2 A;  4R4Q A;  4OON A;  4UPA A;  1U0L A;  4RG1 A;  2F52 A;  4B3M L;  1NJI C;  4LF6 L;  3LGJ A;  4LNQ A;  2QA4 A;  3CW2 C;  4C3J H;  3OW2 A;  2JA5 H;  4P72 A;  2OWO A;  4JI5 Q;  1PA6 A;  4FDB A;  4UP7 A;  2R93 G;  3HKZ E;  1VQF A;  1PH1 A;  4JI4 Q;  2NVQ H;  4YCV A;  3K7U C;  4IOC A;  1MJC A;  3L7Z C;  1R9T H;  2XGT A;  2R93 H;  4WJ3 M;  1Y1W H;  1XMQ Q;  2Y0S E;  2MO1 A;  2ZTD A;  2ZTC A;  1KHI A;  3K0X A;  1BVS A;  1BKB A;  1UEB A;  4JCV E;  4Y52 H;  1D7Q A;  4A3K G;  1N9W A;  1IBM L;  3K8A A;  2VQE L;  3L0O A;  2DGY A;  1SRO A;  1VQ6 A;  1K73 C;  2WB1 G;  1S3O A;  4JI2 L;  4PZ6 A;  4JBJ A;  4A3M H;  3T1H L;  2Q2U A;  1I6H H;  1YNX A;  1XPR A;  3CPW A;  5C4X G;  5M5Y H;  3CC4 A;  1P8L A;  5IP7 G;  1YJ9 A;  4A3I G;  1L1O A;  3S2H H;  4GKK Q;  1OTC A;  1PH2 A;  4DV0 L;  3PF4 A;  3UDF A;  1NMF A;  4TQU S;  1I5F A;  3GO5 A;  3KLW A;  3DLL A;  1J5E Q;  2R92 H;  3M4O H;  3GDE A;  2E5L Q;  4A3I H;  2ZTE A;  2UXC Q;  2IT1 A;  2K52 A;  3GTJ H;  4LF4 L;  3BZK A;  2UXB L;  3W1B A;  1AE3 A;  1NE3 A;  2E2I H;  3JAM c;  3KFU A;  4JI8 Q;  3CP0 A;  1VQG A;  1RL2 A;  2JA8 G;  4NXN Q;  4B3R L;  4JYA L;  4OWX B;  2YTY A;  3CCQ A;  1JE5 A;  4IPD A;  5AJ3 L;  2JA8 H;  2HIV A;  4GN3 B;  4R1J A;  1HZA A;  2A19 A;  3S1R H;  1QVG A;  1HNX Q;  1NTG A;  4LF9 L;  4DAM A;  1FJG Q;  1N32 Q;  2JQO A;  4DV3 Q;  3OTO L;  2UXD Q;  4LFB L;  3JC6 6;  1VQ7 A;  4Y7N H;  2VUM G;  1JJG A;  1PVO A;  2QEX A;  4EX5 A;  5FLX c;  2I5H A;  2VZA A;  4JI0 L;  4POF A;  4BBR G;  2CWA A;  3G71 A;  4GOP A;  1OXS C;  1VQ8 A;  3HOW G;  2K5H A;  4XIG S;  4JI1 Q;  4JI7 Q;  2VUM H;  3HOY G;  3CXC A;  4DUZ Q;  1QUQ A;  1WCM G;  1QUQ B;  3F2C A;  1EYG A;  1LYL A;  2N49 A;  4H02 A;  3HOW H;  4LFA L;  5GAG C;  1AE2 A;  3I4N G;  4B3M Q;  4LF6 Q;  1JJC B;  3J7A 5;  3HOY H;  1RIP A;  2MFI A;  3CCE A;  4DR6 L;  1WCM H;  5FJ8 G;  1PFS A;  3PF5 A;  5FLM H;  2F4V L;  2ID0 A;  1Q1B A;  2R7Z H;  3I4N H;  2K75 A;  1LTL A;  5C4J H;  2E8G A;  1IYJ B;  5FJ8 H;  2GVB A;  3HOX G;  1YJN A;  2VW9 A;  1X56 A;  4X65 L;  2WAQ G;  5E7N A;  4LF8 L;  4YCW A;  2VQF L;  3HOX H;  4A3L G;  1PYB A;  1V1Q A;  4EQ5 A;  1VQ9 A;  3VDY A;  5IY0 A;  3RN2 A;  1IBM Q;  1XPU A;  3HOU G;  2VQE Q;  2VY3 A;  3CPF A;  4X62 L;  3OYY A;  3F2B A;  2EIF A;  1BBU A;  4IO9 A;  1PHJ A;  4A3D H;  1VQN A;  1K0R A;  3GTG H;  4JI3 L;  1HNW L;  4JI2 Q;  4DR4 L;  2HHH L;  1YHA A;  3HOU H;  3T1H Q;  1IBK L;  2UUA L;  1Q7Y C;  3EBE A;  3UE0 A;  1JT8 A;  2N8N A;  2PI2 A;  5IP9 H;  4R4I A;  3MEF A;  4BY7 G;  1L0W A;  4OX9 L;  3KF6 B;  4DV0 Q;  1HH2 P;  3CCJ A;  4GLX A;  1HR0 L;  2IX1 A;  3S14 H;  4DR7 L;  4JI8 L;  1XNR L;  4PZ7 A;  2Y0S G;  1VQE A;  2JJQ A;  1EQR A;  3D31 A;  4KI0 A;  4X66 Q;  3KJP A;  4LF4 Q;  2GVA A;  4IPH A;  3KDF A;  3S15 H;  2UXB Q;  3PV0 A;  1HR0 W;  3CD6 A;  3M7N A;  4OWT B;  3AEV A;  3HOZ G;  3BU2 A;  1CSP A;  1VQL A;  4B3R Q;  4JYA Q;  4NXM L;  4A3F G;  3UDG A;  1M90 C;  3CCL A;  3M3Y H;  4A4I A;  4ME3 A;  5AJ3 Q;  2L15 A;  2QGQ A;  4GLV B;  2K14 A;  4LF9 Q;  3U50 C;  3PUX A;  1K8A C;  3OTO Q;  4P74 A;  4O0A A;  4LFB Q;  3K81 C;  2HT1 A;  1PH7 A;  1PV4 A;  1IXR A;  4QGU A;  1JJ2 A;  4JI0 Q;  1VQA A;  4JBK A;  2N3S A;  2PQA A;  2NVX H;  4DV1 L;  2JA5 G;  4LF7 L;  3ULL A;  4JI6 L;  4PMW A;  1W2B A;  2ATW A;  1C7Y A;  3J81 i;  3AYH B;  3KF8 B;  4GLA C;  2E2H H;  4BA2 I;  4A75 A;  1HZ9 A;  1Y14 B;  4HID A;  1L1O C;  4LFA Q;  3J81 j;  1CKN A;  3S1Q H;  3KYH C;  3PIP A;  3U58 A;  3PSI A;  5DLQ E;  3AQQ A;  4DR6 Q;  3TEH B;  1Y1W G;  4LWC A;  4MNO A;  2F4V Q;  1HZC A;  3GTQ H;  1GKH A;  4LUV A;  2MO0 A;  1EIF A;  1KRS A;  3EN2 A;  2K5N A;  1GD7 A;  3WWV A;  3GTM H;  3RR5 A;  5GRO A;  4DNI A;  2Q2H A;  4X65 Q;  1JMC A;  3GTO H;  1VQK A;  5ELN A;  4A3M G;  4A3B G;  4BY1 G;  4LF8 Q;  2AMC B;  5C0X I;  2KCM A;  3H0G H;  2Z0S A;  2VQF Q;  2NVT H;  2BH8 A;  1N34 L;  3CC2 A;  1G29 1;  2EQS A;  4B3T L;  4BY1 H;  4A3B H;  1PH9 A;  4X62 Q;  1HNW Q;  3U4V A;  2R92 G;  1UE6 A;  1VQJ A;  4UP8 A;  4JI3 Q;  4DR4 Q;  2HHH Q;  5C0X G;  1L1O B;  1TWA H;  2PNH A;  3U4Z A;  1QZG A;  1IBK Q;  2UUA Q;  1Q82 C;  4YCU A;  4GOP C;  1K3R A;  4AH6 A;  2JA9 A;  3GTL H;  4X6A H;  1OXT A;  5IT9 c;  4OX9 Q;  2K5V A;  3I2Z A;  2DUD A;  3PIO A;  1HR0 Q;  3I4M G;  3S17 H;  4DR7 Q;  2IHE A;  1YEZ A;  2MNA A;  1XNR Q;  1GVP A;  2ES2 A;  4K0K L;  4LUO A;  3FHW A;  3I4M H;  4BBS G;  1OXU A;  2YTV A;  3CC7 A;  1ASY A;  3HKS A;  3M4P A;  4DK3 C;  3RLO A;  4NXM Q;  5IYD H;  4BBS H;  1FVI A;  4QY7 A;  3CCS A;  2NN6 G;  4C3H H;  5LMU L;  1OXX K;  2CFM A;  1AH9 A;  1SLJ A;  4YWK A;  3CF5 A;  1GO3 E;  2Q2T A;  3J7Z C;  3ERS X;  2RCN A;  3PUV A;  4GOP B;  1E7Z A;  3IRB A;  4GKJ L;  1CSQ A;  4JOI A;  2B29 A;  4IJH A;  4DKA C;  1UE7 A;  1B70 B;  1L2F A;  2A8V A;  1FGU A;  1TXY A;  3W1G A;  4C2M H;  4DV4 L;  2B63 G;  5FLM G;  3RZO H;  1E22 A;  4LFC L;  3W5O A;  4DV1 Q;  4LF7 Q;  4JI6 Q;  4OWW B;  2R7Z G;  3TRE A;  1V9P A;  4YY3 L;  4KLK A;  2B63 H;  5GAH C;  2JEB I;  1G51 A;  1MKH A;  1NMG A;  2B3G A;  3GD7 A;  3A5Z B;  3K7A H;  4TVA B;  5BR8 L;  1YHQ A;  2I5M X;  3T1Y L;  3AFQ A;  3ICE A;  1XJV A;  3E9H A;  4IOA A;  1SRU A;  1N8R C;  1KL9 A;  2LXJ A;  2KHI A;  2PI2 E;  5IYC H;  2Q2I A;  2UUB L;  3PUZ A;  1YBY A;  4DR5 L;  1K9M C;  2VL6 A;  3S1M H;  3M4Q A;  1X6O A;  4APV A;  1X3G A;  2N78 A;  4A3D G;  4XTC S;  3HOV G;  2OTJ A;  3J80 i;  4GS3 A;  1PH3 A;  4GN4 B;  1PH5 A;  4JV5 L;  5IP9 G;  2IX0 A;  3HOV H;  5IE8 A;  3CME A;  1FL0 A;  1WOC A;  4IFD I;  3A74 A;  2BA0 A;  1YIJ A;  2R6G A;  5JEA G;  1N34 Q;  4B3T Q;  4A93 G;  3H3V H;  4QJF A;  4B3S L;  4O2D A;  1JB7 A;  1PYS B;  1EQQ A;  1E24 A;  3RLN A;  3BJU A;  3ER0 A;  1CKO A;  3HKZ G;  1VQ4 A;  4A93 H;  1XMO L;  1WYD A;  4GNX A;  1VQM A;  1A63 A;  4IFD G;  5IWA L;  4L5S A;  4R4C A;  1VQB A;  4QL5 A;  3F1Z A;  1K83 H;  5LMN L;  2D62 A;  3B6Y A;  3CMA A;  3KDF B;  1X3F A;  4NPS A;  2VNU D;  1EFW A;  3G6E A;  4DV7 L;  1C0A A;  1XTD A;  4K0K Q;  2HIX A;  4DK6 C;  1M1K C;  1SFO H;  4DV6 L;  1I94 L;  4A76 A;  2PMZ E;  1X3E A;  4DR1 L;  4YWL A;  2VS1 A;  1KC8 C;  1MIU A;  3FP9 A;  3M9B A;  3RN5 A;  5HY6 A;  2ZJQ A;  1G6P A;  5ELO A;  4HIK A;  5LMU Q;  4MTN A;  3NBH B;  3D0F A;  1EUJ A;  4DAY B;  1TWG H;  1YIT A;  4DV2 L;  1O7I A;  3S24 A;  2OTL A;  1IBL L;  1YI2 A;  5EAY A;  2JEA I;  1KIX A;  2YTX A;  2LSS A;  4RMF A;  2ZJR A;  4L5T A;  2PQA B;  3E0E A;  3CAM A;  3SGI A;  2Z6K A;  4GKJ Q;  5C0X J;  4L5R C;  4BXX H;  1HZB A;  2KBN A;  1WFQ A;  2GN5 A;  4KHZ A;  3I7F A;  4YWM A;  4DV4 Q;  3UDI A;  2A1A A;  4OO1 I;  4LFC Q;  1U5K A;  4KHP L;  1CKN B;  4HJ9 A;  3I55 A;  4A3G H;  1C9O A;  1Y1V H;  4YY3 Q;  5K36 G;  3I56 A;  2KCT A;  1A62 A;  2RHS B;  4IPG A;  3CCR A;  2UUC L;  2FXQ A;  4GN5 A;  1Q46 A;  5BR8 Q;  3M85 A;  2ZM6 L;  4OXP A;  4OO1 G;  2KEN A;  1VCI A;  3T1Y Q;  1PH6 A;  2D0P A;  3H0G G;  1TWF H;  5C3E G;  4A3C H;  1TWH H;  2YYZ A;  4UP9 A;  3H15 A;  4DR5 Q;  2UUB Q;  3A5U A;  2RF4 A;  1SE8 A;  4HJ5 A;  5GAD C;  1VQO A;  1UWV A;  4AYB E;  5C3E H;  4JC0 A;  3S1N H;  1HNZ L;  3PO2 G;  1UE1 A;  4JV5 Q;  2K50 A;  3G48 A;  4DV5 L;  1VS0 A;  2XTI A;  2WFW A;  1S40 A;  3PO2 H;  4AQY L;  4B3S Q;  3ULP A;  3DM3 A;  4JOI C;  4LF5 L;  2JA7 G;  2JE6 I;  1XMO Q;  1EWI A;  1PH8 A;  1VQ5 A;  3STB C;  5IWA Q;  1CUK A;  1EIY B;  3ULJ A;  2HQL A;  3EIV A;  1I3Q H;  2R7D A;  1VQH A;  5GQO A;  4X64 L;  3F2D A;  4HJA A;  2JA7 H;  5LMN Q;  2AKW B;  2NN6 I;  1VQI A;  4P73 A;  5IYD G;  1QVF A;  4A3K H;  5M3F G;  1VQD A;  4DV7 Q;  2JK8 A;  5M5X H;  1VQC A;  2KHJ A;  1YVC A;  4IJL A;  1X54 A;  1Q1E A;  4DV6 Q;  3TS0 A;  2ALY B;  4X66 L;  1I94 Q;  3G4S A;  5M3F H;  4DR1 Q;  2LXK A;  2ASB A;  1V43 A;  4YHH L;  4QIW E;  1ASZ A;  1WJJ A;  3RLF A;  5C4X H;  3CQZ H;  3PO3 G;  3RNU A;  3PUW A;  1I50 H;  1X55 A;  2BA1 A;  4L5Q A;  3HFZ B;  5IP7 H;  4J15 A;  2OQ0 A;  2ZJP A;  3A0J A;  3K80 C;  1X9N A;  4LW1 A;  4BA1 I;  4DV2 Q;  2R7F A;  3PO3 H;  1IBL Q;  4QQB X;  1B7Y B;  2IY5 B;  5JEA J;  1IZ6 A;  5J3B A;  5GAE C;  4DR3 L;  1SN8 A;  1Q86 C;  1N33 L;  2OQK A;  1J6Q A;  2YU9 H;  1XNQ L;  5HGQ A;  3S2D H;  3JAM i;  1Z9F A;  4DUY L;  3NEM A;  4IFD J;  4NB3 A;  2UU9 L;  4KHP Q;  2AWN A;  3PGZ A;  4WJ4 A;  4GNX C;  5IYC G;  4JBM A;  3TRZ A;  4DR2 L;  1WI5 A;  4P75 A;  1NBW A;  3TQY A;  2UUC Q;  2CKZ B;  2H5X A;  3J80 c;  4A3J G;  4PZ8 A;  3H3V I;  4JBW A;  1N36 L;  2ZM6 Q;  5IYB G;  4P71 A;  3S16 H;  1YZ6 A;  3ZJY C;  3Q8D A;  1KQS A;  2WB1 E;  4A3J H;  2BH2 A;  5IYB H;  4A3E G;  4BBR H;  2I5L X;  3KOJ A;  1YJW A;  1KAW A;  3MXN B;  2CQO A;  1A0I A;  4JI5 L;  1UE5 A;  1HNZ Q;  1Q8K A;  4JI4 L;  3CCU A;  2CWP A;  4A3E H;  1B8A A;  4POG A;  4LUZ A;  4DV5 Q;  4HJ8 A;  1QZH A;  1KD1 C;  2I0Q A;  1XMQ L;  2K4K A;  4C3I H;  4AQY Q;  5H1S E;  2NZH A;  3PUY A;  3CCM A;  4GNX B;  4UY8 C;  1TWC H;  2D0O A;  4DPG A;  2Z6K C;  4LF5 Q;  3AFP A;  4R4T A;  4HIM A;  1OXV A;  1T9H A;  1Z47 A;  2IHF A;  4X64 Q;  2F3I A;  3PCO B;  5C44 G;  1Q12 A;  2EXD A;  4AYB G;  4A3L H;  5LMN W;  3STB D;  1S72 A;  4GKK L;  1H95 A;  5C44 H;  2CCZ A;  1E1O A;  3CCV A;  1X65 A;  2WP8 J;  3E9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...