5M5XH

Rna polymerase i elongation complex 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Structures of Transcribing RNA Polymerase I.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
total genus 17
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m5xH00
3J7A5 3CC2A 2E5LQ 1GO3E 1VQKA 2BA0A 4DV7L 1PH2A 1PH4A 4OO1G 5HGQA 2JA8H 5JEAG 5LMNL 1VQ8A 3CC4A 1C7YA 2UXBL 1NE3A 1L1OA 4RG1A 4X64Q 1VQGA 4GN4B 4A3FG 3G71A 1X65A 4OX9L 3AYHB 2JQOA 2WP8J 4LF4Q 4L5QA 4DV1Q 4DV5Q 5C4XH 3HKZE 2N3SA 1OTCA 2OCEA 3RLOA 3PO3G 3I56A 2UUAL 1TWGH 4R4OA 1IBML 2JA6G 2WB1E 3IRBA 1PA6A 4BA2I 3SGIA 2C35B 3BU2A 4OWXB 4BY1H 2UXCQ 2MFIA 4A3LH 3M4PA 3GO5A 1VQBA 4YWMA 4B3SL 1VQEA 2WB1G 2HHHQ 4K0KQ 5IT9c 3W5OA 2VY3A 5M5WH 3CCMA 2GVAA 3T1YQ 1JMCA 1Y1WG 4JI7L 5IYDH 3L0OA 4C3HH 1XNRL 2PQAB 4OWWB 3GD7A 1G6PA 1VQDA 4UP9A 4XIGS 3CCSA 3S2HH 1A0IA 2GN5A 2N78A 1Y14B 4JI2L 1WFQA 2RHSB 4DR2L 4GOPB 1XPOA 3T1HQ 2ATWA 5M3FH 3GTGH 5FJ8H 2VQEL 2A19A 1PV4A 3HOWH 1I50H 1H95A 2RHQB 2HT1A 1Y1WH 3GTMH 2HQLA 1CSQA 1J5EL 5C44H 1FVIA 1D7QA 4C2MH 1WCMG 3ULPA 3E9IA 1J6QA 4JI7Q 4R4TA 2JE6I 1TXYA 1SN8A 1TWFH 1X3FA 1JJ2A 4IFDJ 4Y52H 4IPCA 1CUKA 4C3JH 5M3FG 4A93G 3KYHC 4X64L 2I5HA 3B6YA 4RMFA 3RLNA 2WAQG 1I94Q 1VQPA 1HNZL 3TS0A 2R93G 3T1HL 3CD6A 1IZ6A 3OW2A 2K14A 1SLJA 5M3MG 2VQEQ 4YCVA 4IFDG 3GTJH 4X62L 3HOZG 4P75A 3CPFA 2CKZB 2K4KA 4X65L 4XTCS 1VQIA 3I4NG 3RR5A 4DPGA 1GVPA 4LUVA 1XMOL 1N8RC 1UEBA 2Y0SE 3G6EA 4OXPA 3M4OH 4GN3B 2NVYH 3K0XA 2VW9A 4KI0A 3H0GG 3A74A 1YHQA 2GVBA 1LM0A 2HHHL 1Q1BA 3PF5A 3TREA 4JI6L 3BZKA 1L1OC 1YI2A 4GS3A 1S72A 4DR3Q 3S2DH 4X66Q 3PUWA 2K5HA 4BY7G 1N9WA 4DV4Q 3RZDH 1XMOQ 2KHIA 1K8GA 3CCLA 4DAMA 3CCVA 2KCTA 3S1QH 5M5YH 2K52A 2PI2E 2ALYB 4AIMA 4LFAQ 2QGQA 3KF8B 3CC7A 4JI5Q 3G48A 3F2DA 1KC8C 1OXTA 3HOYH 1AE2A 3J81c 1X55A 3NBHB 4JG2A 1ASZA 4A3MG 1XNQQ 4R4IA 1O7IA 1V43A 2IX0A 2IT1A 1HNWQ 3H15A 5AJ3Q 3NEMA 4UP8A 3EN2A 3KOJA 2H5XA 5GROA 2UUCL 1B8AA 4LF8L 3HOUH 4L5SA 1FJGL 4B3RQ 1FL0A 1YZ6A 4R4CA 4POGA 1Y1VG 4JI5L 2E2JH 4LFAL 2R7ZH 1NJIC 1YHAA 5GAEC 3PIPA 3GTOH 1HZBA 2I5LX 4H02A 2B29A 4UY8C 4NPSA 5IP9G 3KF6A 2YV5A 1C9OA 2B63G 2R7ZG 1EOVA 2MO1A 4HJAA 1YVCA 2VNUD 4R1JA 1DGSA 4GKJL 3PUZA 1KIXA 4LF4L 4LWCA 1RIPA 3PSIA 5C3EH 3J80c 3CPWA 5IWAL 4LNQA 1QVFA 2R92G 1KRTA 4HIKA 2I5MX 1Q7YC 4JV5Q 1KRSA 3E0EA 4UPAA 4DV4L 4B3ML 3EIVA 2F52A 1L1OB 3FHWA 3U50C 1QUQB 4JI8L 5C4XG 4GNXA 4DV6L 3HOWG 3PIOA 4IFDI 1HJPA 2E2IH 4JBKA 2VS1A 3K7AH 4LF5L 1Q86C 2JA6H 5C3EG 4ME3A 4KLKA 1HZAA 1Q1EA 4B3TQ 3K80C 1YJWA 4OWTB 3CCJA 4AQYQ 1BBUA 1Z9FA 1B70B 1VQHA 4R4QA 4NB3A 1VQNA 1XTDA 4JI0L 2EQSA 5GQOA 3ULJA 4PZ8A 3S14H 1BKBA 1E1TA 2JEAI 1VQ9A 3JAMi 2UUCQ 1JE5A 5IYCH 4BBRH 3RN2A 4YHHQ 5JJKA 4GLXA 4LF8Q 2ZTEA 2MNAA 3J7ZC 4LFCL 5M3MH 1MJEA 2ZJPA 3KDFA 3W1BA 2KHJA 5BR8Q 4DR1L 1K0RA 1SMXA 2UUBL 1I3QH 2B3GA 1Q46A 2NN6I 1K73C 1PH9A 3DM3A 4AQYL 4A3DG 4PG3A 1UWVA 5C0XG 1X6OA 4JBMA 4BBRG 1YJNA 1NMFA 1X3EA 2LXJA 4X6AH 3CP0A 3I55A 3M85A 4JI0Q 1XPUA 4GOPA 1C0AA 1XPRA 1SE8A 2OQ0A 3PCOB 5ELOA 1X3GA 3F2BA 1I94L 1S40A 4P72A 2IHFA 2QEXA 1JB7A 4GKJQ 1P8LA 2F3IA 2MQHA 2FXQA 3MXNB 1QZHA 1JT8A 3D0FA 4BA1I 1EQRA 3CF5A 4AYBG 3PV0A 3M9BA 3J81j 3U58A 1KD1C 1VQAA 2BH8A 3BZCA 2K5NA 4PZ6A 4JI8Q 1EWIA 1HH2P 3STBC 4LF5Q 4HJ9A 3HKZG 2JJQA 1Q8KA 2D62A 5C0XJ 1NBWA 3H3VI 4DR5L 4A3EH 1PYSB 1WI5A 4DR3L 2VZAA 5FLXc 4A3MH 3W1GA 2E2HH 2Z0SA 1CKOA 3STBD 4DAYB 4DV1L 4A3IG 1YJ9A 2K5VA 4IOAA 1V1QA 1Z47A 1SFOH 4C3IH 4QGUA 1NMGA 1OXUA 4QQBX 2I0QA 2UUAQ 5JJIA 2ZJRA 1MIUA 5J3BA 4YHHL 5JJLA 3GDEA 2ZM6Q 3UDXA 5LMUL 4DV0L 1Y1VH 4PMWA 1FGUA 1GM5A 3CMEA 2RCNA 2CWAA 5BR8L 4MZ9A 2L15A 1E24A 4LUZA 1XJVA 2KBNA 3M3YH 3S16H 4LUOA 2WAQE 3FKIG 3CXCA 3PUXA 4QL5A 1XNRQ 3GTQH 1HNWL 3KLWA 4QJFA 5AJ3L 1UE1A 3OYYA 2Q2TA 1N34Q 1MKHA 2JA9A 3ULLA 1EYGA 4DR2Q 4IOCA 1EIYB 4B3RL 2ZM6L 2AKWB 2MO0A 4WJ4A 2JA7G 4TVAB 4JI1Q 3K8AA 3TS2A 1OXSC 4ALPA 2YYZA 2NVTH 5ELNA 3A5UA 4IPGA 3CCUA 1WYDA 3RNUA 1CKNA 1QUQA 3HFZB 4DKAC 3G4SA 1IYJB 3I4OA 1CKNB 2V1CC 2Z6KC 5IYDG 1YITA 3PGZA 4LF6Q 2JA7H 1AH9A 3CMAA 2KENA 2R7FA 1HNZQ 1SR3A 4HJ8A 1MJCA 5FLMH 1IL2A 5HY6A 2B63H 2OTJA 4A3GH 4JI1L 2N49A 3S17H 1N33L 4HIOA 2RF4A 3A5ZB 3HOVG 1QZGA 2AMCB 4DUYQ 1HR0L 3KF6B 1HNXQ 5IYCG 1WOCA 2VL6A 2R92H 1E3PA 3UE1A 1LUZA 3A0JA 1CKMA 1PH6A 1N36L 1YNXA 5LMUQ 4DV0Q 1WCMH 2ASBA 2VUMH 1VS0A 4TQUS 1QVGA 4GN5A 4DV7Q 3PO2G 1HR0W 3E9HA 1PVOA 2WFWA 3BJUA 1Q12A 4A93H 4OONA 2XGTA 4JOIA 4IPDA 4X66L 4NXMQ 4BBSG 1VQ7A 1JJCB 4DR4Q 2NZOA 1KXLA 3S1MH 1YIJA 2ZTCA 1N34L 4DUYL 1HR0Q 1E22A 1HNXL 1VQLA 4DV2Q 4HJ7A 3F2CA 1N36Q 4IJHA 3AFQA 1SRUA 3AFPA 4EX5A 2ZTDA 3PUYA 1VQCA 1G51A 2UXCL 5E7NA 1PH1A 3F8TA 3HKSA 4QY7A 5IYBH 2PI2A 3Q8DA 4YY3L 5C4JH 4NXNQ 1SROA 2N8NA 4L5TA 4P74A 4DUZL 1PH8A 3GTLH 2XTIA 2Q2IA 3NELA 5GADC 4YWKA 2VQFL 2UXDL 4A4IA 1E1OA 4A3CH 1N32L 5EAYA 1PHJA 4EQ5A 5DLQE 1VQOA 2IY5B 4A3BG 1EIFA 4BY7H 3M4QA 2R93H 4J15A 4DR6Q 1UE5A 2YTYA 5IYBG 4GKKL 4A3IH 4HIDA 2QA4A 1IBLL 4JI3Q 3I4NH 4MTNA 5IY0A 2NN6G 5IP7G 1BVSA 3UDGA 1Q81C 1PH3A 1XMQL 4DV3L 2F4VQ 4A3BH 1J5EQ 3S1NH 2CFMA 2LXKA 4DK6C 3UE0A 4JCVE 2VQFQ 2UXDQ 3CW2C 3TRZA 1UE7A 3UDFA 4DK3C 4LF9Q 1ASYA 3CAMA 2Y0SG 2Q2HA 2HIVA 2Q2UA 2IHEA 1L0WA 3JC66 3H3VH 1VQJA 3L7ZC 5IP7H 3U4ZA 5K36G 3FKIH 1NTGA 4DR4L 1P16A 2D0PA 4P73A 1I5FA 4BXXH 4A3EG 4JI3L 1IXRA 4APVA 5GAGC 1YHBA 2KCMA 5LMNW 4JV5L 4B3MQ 2OQKA 4X62Q 3KJPA 2YTVA 1XMQQ 2F4VL 4A3KH 3KDFB 4DV6Q 2CQOA 1K83H 2CCZA 4WJ3M 3EBEA 1WJJA 1B7YB 1CSPA 3I7FA 1BBWA 4B3TL 1L2FA 5LMNQ 2UXBQ 1G291 1QVCA 4YY3Q 3DLLA 4NXNL 4HJ5A 1PH7A 4JI6Q 2PNHA 1TWCH 5IE8A 4A3KG 1KQSA 4IJLA 1VQMA 2DGYA 3AQQA 1N32Q 1VQFA 4PZ7A 1TWHH 4L5RC 1KAWA 1Q82C 4DV5L 2JA5G 1A63A 1RL2A 4KHZA 1X56A 4BY1G 3GTPH 3HOUG 4DR6L 4A3LG 4LFCQ 1X9NA 3WWVA 1VQ4A 1YEZA 3JAMc 3TEHB 1IBKL 3J81i 4JYAL 3CCQA 1U5KA 4LW1A 1HZ9A 4GKKQ 4LFBL 3UDIA 1K3RA 1GD7A 4DNIA 4YWLA 5IP9H 5C0XI 4DR7Q 1EUJA 2R6GA 1T9HA 2UU9Q 2PMZE 2VUMG 3PO2H 1TWAH 4UP7A 4JI4Q 1EFWA 5H1SE 5FJ8G 3PO3H 3S24A 4BBSH 1AE3A 2EIFA 3ERSX 4MNOA 4JI2Q 1S3OA 4GNXC 3PF4A 3F1ZA 3GTKH 4JYAQ 4LFBQ 1LYLA 2CWPA 3PUVA 4JBJA 5FLMG 1M1KC 4KHPQ 3M7NA 1JJGA 4A3GG 4DR7L 2LSSA 1LTLA 3NENA 2UU9L 4A3DH 3HOVH 1I6HH 3CCRA 2E8GA 1PH5A 4Y7NH 1W3SA 5GAHC 4JI4L 2IX1A 1KL9A 4JOIC 4DR5Q 2ES2A 4OO1I 3D31A 4NXML 3J80i 3HOZH 3LGJA 1A62A 1R9TH 2OWOA 3S15H 3OTOQ 2BA1A 1NY4A 2R7DA 4A3CG 3AEVA 4YCWA 2A8VA 3ICEA 2K75A 3FP9A 5IWAQ 3L2PA 3K7UC 1K9MC 4X65Q 2HIXA 2AWNA 5C44G 4DV2L 2NVXH 2E5LL 2BH2A 3VDYA 3S1RH 2DUDA 1IBKQ 1D8LA 2NZHA 3RZOH 2OTLA 3KJOA 4DUZQ 4O0AA 3KFUA 3OTOL 1KHIA 4LF7L 1PFSA 1VQ6A 3I4MG 1V9PA 2ZJQA 3RLFA 4IO9A 1VCIA 2AHOB 2D0OA 1EQQA 2ID0A 2PQAA 5JEAJ 1HZCA 3ZJYC 4HIMA 4GLAC 1M90C 4JC0A 1IBMQ 4GLVB 1U0LA 4GNXB 4A3JH 3RN5A 1IBLQ 4POFA 2AWOA 4O2DA 1UE6A 3H0GH 3I4MH 1OXXK 4AYBE 4KHPL 4QIWE 4B3SQ 4K0KL 3HOXG 1W2BA 2YTXA 3CCEA 4DV3Q 4DR1Q 2UUBQ 2YU9H 2Z6KA 1YBYA 4LF7Q 3K81C 1XNQL 4A75A 3T1YL 4LF6L 4IPHA 2K50A 2JK8A 4LF9L 1X54A 3TQYA 4AH6A 4A3JG 2NVQH 1A8VA 1K8AC 1PYBA 1OXVA 1VQ5A 4FDBA 1E7ZA 3ER0A 2EXDA 3HOXH 4GOPC 4A76A 4OX9Q 3I2ZA 1FJGQ 2JA8G 1N33Q 5M5XH 2JEBI 2A1AA 1GKHA 3CQZH 4A3FH 3MEFA 4YCUA 2JA5H 3HOYG 4JBWA 4P71A 3U4VA 4BXXG
chains in the Genus database with same CATH superfamily
4FP5D 3S1NB 2IPKD 4OO1G 1LV9A 4C1NI 5HGQA 2BE5D 2XIWA 4RG1A 1VQGA 1X65A 1UUPA 3AYHB 4KY7A 2JQOA 5HURA 4RWSC 2JN4A 1F9SA 4KK7A 1CM9A 1JCKB 4K5XA 2UUAL 1TWGH 1CTMA 2WB1E 1GUGA 4BA2I 1KDAA 4WJWA 4OWXB 4BY1H 5JPNC 2WB1G 2QCPX 4ZKBB 5LL6S 1LTTD 3T1YQ 5IYDH 1HFNA 2GVAA 4K8IA 4OWWB 4ZQ3A 1W6KA 4JI2L 2KCCA 1V8QA 3DHQA 1I50H 1QNUA 3A54A 5KRUA 4JI7Q 3OSOA 1Y8OB 1PZKD 2NZ1D 2MPMA 1CUKA 2EDGA 3A7AB 3KYHC 4F88A 1IKMA 2R93B 2WAQG 3HS0C 1HNZL 3T1HL 3PIO3 5M3MG 1QB5D 2VQEQ 1QWYA 3CPFA 3NP8A 5FO9B 1VQIA 1ML0D 3RR5A 4DPGA 1UEBA 1E2WA 3H0GG 3A74A 2O5IC 3TREA 1L1OC 4HCEA 2A6HC 4MHEA 1MBYA 4X66Q 4NDXA 1WTRA 1D6EC 4BY7G 1KTKA 3GTQB 3CCLA 2KHIA 1AP0A 4G7OC 3CCVA 2RQXA 2ALYB 4LFAQ 2WV6D 3G48A 1PFMA 2XRSD 5F2DA 3X3MA 3J81c 4JG2A 4ZRZA 3I90A 4A3MG 1XNQQ 3FKIB 2ICIA 2F0GA 2X69A 2IT1A 1DYQA 4UP8A 2H5XA 5J1ZA 3S2HB 1RDPD 2R7ZH 1Y1VG 1EWCA 1TKWB 1HZBA 2QILA 4NPSA 2FFKB 4RA8A 2L4NA 3KF6A 1XTCD 2MO1A 3QR8A 4HJAA 2VNUD 1WTVA 4QCLA 3R8BA 4LF4L 1DOLA 1RD9D 5CV4A 4LWCA 3A8IE 1AZPA 2R92G 4FF1A 2IWHA 1KRTA 2Z4HA 4JV5Q 1EY6A 3E0EA 4DV4L 2KEEA 2PW7A 4CKCA 2B2TA 4DV6L 2WKDA 5I2YA 2E2IH 3J7AV 1ILPA 2JA6H 1HTLD 3M4YA 4I65A 1BBUA 5E4WC 1VQNA 1XTDA 3TZUA 3S14H 5EBDA 2JEAI 3FPUB 1JE5A 1U4LA 1JORA 4YHHQ 5CV7A 2ZTEA 2MNAA 3J7ZC 2K5DA 3T16A 4IFDH 1JOQA 3EA6A 3S15B 3W1BA 4DR1L 2CH4W 5IGGA 1XX8A 1UWVA 5C44B 4A3GB 4BBRG 4KD3A 3I55A 3M85A 1XPUA 1XPRA 1FD7D 5C3EB 1X3PA 5ELOA 1I94L 2MQHA 2MUYA 1CA6A 2XWBB 1O7LA 5EKLA 2D9UA 4EQOA 2WINB 1TT2A 1EWIA 2OT2A 3STBC 1C48A 2JJQA 2F0PA 5C0XJ 3H3VI 3JAML 3U9SA 4A3EH 1PYSB 4DR3L 2E76C 2VZAA 4A3MH 2E2HH 1CKOA 2KVMA 5I9PA 4ID6A 4DV1L 3RUZA 4IOAA 1SFOH 4C3IH 2JXMB 4QGUA 4ZAIA 2I0QA 1SNDA 5DEHA 1G6ZA 1PZID 5JJLA 3GDEA 2IJ0A 1JR0D 1Y1VH 4HSPA 1II3A 2RCNA 2CWAA 3DUZA 3NK9A 3TBIB 2KBNA 3TP5A 3VA5A 1SJED 2HD3A 3T53B 4O1NA 2XNAC 3GTQH 3KLWA 3BG3A 1UE1A 5J22A 1EY0A 2Q2TA 1MKHA 4TRDA 1B44D 4WRDA 2ZM6L 4KN4C 2AKWB 4WJ4A 2JA7G 1LACA 3TS2A 1OXSC 5IGEA 4ALPA 3V96A 3A5UA 1EQVA 4IPGA 3RNUA 4KN7C 4DKAC 1Y1WB 4C3IB 1CQFA 3W2DA 1YITA 4IUPA 3FMCA 2FINB 3CMAA 2KENA 1NAPA 4FF4A 1JC7A 1IL2A 2OTJA 1EY5A 4RCOA 3FRPB 3TMEA 4F87A 4QUFA 3S17H 3VR3A 4HIOA 3A5ZB 3ND8A 3HOVG 2AMCB 3UI2A 1HR0L 1CZWA 3KF6B 2DNCA 1PRTB 1E3PA 4K2LA 4DV0Q 1HQMC 2HCCA 3PO2G 1HR0W 1PVOA 3S16B 4ZCKA 3GTGB 4A93H 3GV3A 4X66L 4DR4Q 4KKUA 2NZOA 1KXLA 3S1MH 2ZTCA 3BVMA 5EPKA 1K8MA 1TY0A 2CHBD 1N34L 1HR0Q 1HNXL 4HJ7A 1H9JA 1EY8A 1G51A 2BDNA 4H7BA 2R3ZA 4QY7A 5IYBH 3M3YH 1SROA 4P74A 4ULLA 3EJIA 1TWGB 3I4LA 2Q2IA 3NELA 4AYBB 5BN4A 4A4IA 1DONA 2BOSA 2CH4A 1BO0A 1VQOA 4KD4A 1TU2B 4J15A 1UE5A 2M9VA 4A3IH 1R4QB 2K28A 2QA4A 3I4NH 1VF7A 5A2QE 2F4VQ 2B2UA 3TP7A 2UXDQ 1V1PA 3CQZB 1UE7A 2JA7B 2Q2HA 2IHEA 4I7AA 4DFAA 3H3VH 1A15A 4P73A 4BXXH 4C3JB 5GAGC 5LMNW 1WTWA 4A3KH 4DV6Q 2CQOA 2E2DC 4WJ3M 1O80A 3BVZA 5T1IA 1WJJA 2QEJC 1GUSA 1L2FA 1NCVA 5C4XB 3DLLA 4HJ5A 3A8KE 3NUCA 1PH7A 3A55A 5IGBA 1TWCH 5IE8A 1KQSA 4IUNA 1BUVT 1N32Q 1TWHH 1EOTA 5ISRA 1HA5A 4DV5L 1JE4A 1HQRD 1X56A 4DR6L 1DCZA 3JAMc 3TEHB 1IBKL 4JYAL 3CCQA 1U5KA 2F3VA 2JA5B 3R2IA 4DNIA 5C0XI 3NBIA 2KQ3A 1T9HA 2B39A 2VUMG 2FJ2A 1IHZA 3BZDB 5H1SE 4X3UA 1RCVD 3PO3H 1FYCA 4GNXC 4JI2Q 3RMHA 4ZLTF 4JYAQ 4LFBQ 1LTRD 3PUVA 1M1KC 4WORA 3D3RA 4A3GG 3FVQA 4DR7L 2LSSA 1TS2A 1LTLA 3CCRA 1EU3A 3LWEA 1F9RA 1W3SA 2E74C 3NBHA 2EYMA 2Y0SB 2ES2A 4NXML 1J8IA 3J80i 3FDTA 1R9TH 3PMFA 2F4IA 2NVQB 1NY4A 3AEVA 4YCWA 3E0JA 3L2PA 4X65Q 5C44G 4FO2A 3GV6A 3S1RH 2DUDA 2KJXA 1SNMA 2NZHA 3KJOA 3MTSA 4O0AA 5IT9L 1O7ZA 4EVOA 1PFSA 3I4MG 2AHOB 5JEAJ 1MGSA 4GLAC 1CI3M 2EPBA 4XQQA 4YIJA 4JC0A 1IBMQ 5C4HA 1EYCA 4A3JH 2DN8A 4IN3A 4POFA 2AWOA 4KHPL 3G6JB 4DV3Q 4DR1Q 3E6ZX 3K81C 2EYPA 4A75A 3T1YL 4LF6L 3QO2A 2YU9B 4HEDA 1K8AC 5HGTA 1WD1A 1E7ZA 3ER0A 4GOPC 3HOXH 4KKTA 2JEBI 1G8ZD 4K5VA 2K5WA 5D65A 2KCNA 3HOYG 2G5DA 1VQKA 2BA0A 4DV7L 3T56B 1D1IA 3CC4A 5LMNL 1TIID 1NE3A 4X64Q 2KUMA 1HA6A 4LF4Q 4DAYA 2EYOA 4J8QA 1OTCA 2OCEA 3RLOA 3PO3G 2E2HB 4R4OA 3IRBA 4HMJA 3SGIA 2UXCQ 3BU2A 4DXFA 4B08A 3M4PA 1T5EA 4K0KQ 4G4KA 4NP5A 2Z4IA 1D1KA 1JMCA 4JI7L 1Y1WG 1XXGA 2PQAB 4M8AA 2RDHA 1VQDA 2EOTA 2N78A 1Y14B 2F0WA 2RHSB 1XYIA 4DR2L 2ZXPA 2EY2A 3HOWH 5FJ8H 5ELCA 3P75A 3TSSA 1NUCA 4C2MH 5D14A 4HSVA 4RGOS 4K8JA 4C3JH 4A93G 2I5HA 3TDQA 4RMFA 1DOMA 3RLNA 2WAQB 5I4DA 2R93G 1VQPA 3TS0A 1EQTA 1IZ6A 3KUPA 4P75A 3MWYW 2K4KA 1I6HB 4XTCS 1ILQA 2BDOA 3M4OH 5K5PA 5NUCA 3URYA 1YHQA 4DNRB 1YNJD 1WD0A 1Q1BA 5DNFA 3PF5A 4JI6L 1S72A 3PUWA 2F0JA 3SK6A 1H9SA 3NSWA 3T4AC 2EE1A 1B50A 4DAMA 2WB1B 2K52A 4JI5Q 2QGQA 4NKLA 1ET9A 3HOYH 1AE2A 1H9RA 2F0HA 1Y8NB 1ASZA 5JVG3 2DJGC 2IX0A 1HNWQ 1BOSA 4IQZA 5EPJA 2F0IA 3SR1A 5AJ3Q 5GROA 4ZK9B 3FPPA 4POGA 4JI5L 1JWUD 1JB3A 1SBBB 3MC0B 2JYOA 3HGBA 2I5LX 4UY8C 3HOXB 5IP9G 2WKCA 4K14A 1Q3LA 3K5MA 3EVQA 2R7ZG 1GUWA 2K33A 4R1JA 1Q8IA 4OO1H 1LO5D 5JOBA 4KV6A 3K6OA 1BCPD 1SNOA 4LNQA 3CPWA 3J80c 2E75C 5IWAL 1BF4A 4HIKA 1ET6A 1D5MC 4B3ML 2F52A 1QUQB 1SJHD 4JI8L 4GNXA 2PZWA 3PIOA 4IFDI 3LWUA 1X32A 1G91A 4KLKA 1HZAA 1Q1EA 2F0OA 4B3TQ 3MHBA 2XVSA 4BY1B 1WTOA 3ULJA 2K03A 4J6HA 1STEA 3RN2A 3IL8A 4LF8Q 2NTSA 2ZJPA 1STBA 5BR8Q 2UUBL 3GQBA 5FLXE 2L1BA 3LX0A 1BCPB 1K73C 2PZTA 3J81L 4AQYL 3I70A 5C0XG 3GTOB 1NMFA 1X3EA 3CP0A 4JI0Q 2I07B 3OIQA 3C1EA 3HRZC 2OQ0A 3PCOB 1IW7D 1S40A 1V1PB 1JB7A 3MXNB 4F8MA 4A3BB 1QZHA 2DY8A 3D0FA 1EQRA 1I6VC 2RBMA 2O5JC 1F77A 5EJWA 1HXYD 2D62A 2CVRA 1NBWA 2B63B 1PYWD 5C4JB 3HOUB 4X3KA 5FLXc 3H0GB 3MXNA 5IT9E 4DAYB 5ELBA 1YJ9A 2RDGA 3OW7A 3VYUA 2H4OA 1EY9A 1OXUA 4QQBX 2K04A 1EEFD 2ZJRA 5J3BA 4YHHL 5IGCA 4B9XA 1B9NA 1FGUA 1SYDA 3PQIA 1BCPF 1E24A 3DWAA 2A74C 4LUOA 2WAQE 4KMUC 4QL5A 1XNRQ 5AJ3L 2A68C 1LABA 4R9WA 1EEID 4N8X1 3ULLA 1EIYB 4IOCA 2F0DA 1A2TA 2HDLA 2B2WC 3K8AA 4JI1Q 4OEMB 3OIPA 5ELNA 3K57A 1FGBD 1QUQA 3E3XA 3GTMB 5JJZA 2V1CC 5IYDG 1AH9A 2J7ZA 2JA7H 2SOBA 1WTPA 1G2TA 4BS9A 5HY6A 3PIP3 4QIWB 5CR3A 5IGFA 1V1OA 1E0BA 5M5WB 4DUYQ 2K32A 1WOCA 2VL6A 2ZXRA 3MA2B 2R92H 2D5DA 1HUMA 4M1UB 1TWAB 1U9RA 2YU9H 1VS0A 4RCNA 3BJUA 1S5CD 2RSOA 2E2JB 2F0QA 4OHJA 5M3FB 4XQJA 4JOIA 4BBSG 1ICFB 1JJCB 4P2CB 1KABA 1YIJA 2OEOA 1RJTA 3P1HA 1E22A 4K5WA 3K59A 3AB9A 4DV2Q 1N36Q 3AFQA 5L37A 2MHVA 1D5ZC 1LT3D 3F8TA 4NXNQ 4L5TA 4DUZL 4KY6A 1PH8A 1KDCA 1GUNA 2VQFL 1E1OA 3M7GA 4OGQC 2IY5B 1EIFA 4BY7H 3M4QA 4A3IB 2R93H 4DR6Q 5IYBG 4GKKL 4ZUIA 4FNFA 4GZYC 5IY0A 1Z6HA 5IP7G 3UDGA 5JVH3 1PH3A 1XMQL 4A3BH 2F0VA 1J5EQ 2TSSA 1BCPC 3UE0A 1S5FD 4JCVE 2VQFQ 1IYVA 2EYLA 3CW2C 4A3FB 3UDFA 4H44C 1BBXC 1ASYA 2Y0SG 3CAMA 2HIVA 2NN6H 3U4ZA 3FKIH 4RAUC 4LAAA 4A3EG 4JI3L 3PO3B 1RODA 2OQKA 2Q8IB 3KDFB 2EY1A 1K83H 3EBEA 1CSPA 2TMPA 3BS1A 5LMNQ 4U68A 2O2LD 3BYYB 3R93A 1PZJD 2PNHA 4A3KG 4IZ8A 4PZ7A 4N9TA 4L5RC 1KAWA 2JA5G 1A63A 2EJFC 3GTPH 4A3LG 3O13A 1X9NA 2EY5A 1VQ4A 3HKZB 1HZ9A 4DK0A 4RH6A 2IL8A 3D4DA 1K3RA 5KNBA 3SE0A 4YWLA 5IP9H 3U9OA 1K83B 1LTID 3MXUA 2PMZE 3QOLA 1CZGA 1TWAH 5C4ZA 1SYCA 1MSGA 2QKIC 4BBSH 4MNOA 2EIFA 1Q90A 1SSOA 3F1ZA 1LYLA 4JBJA 5FLMG 4KHPQ 3D4WA 4CJ0B 4CKEA 2UU9L 4A3DH 1I6HH 3I4MB 1HCZA 2E8GA 4CDCC 1KL9A 4JOIC 4DR5Q 1EY7A 3HOZH 3LGJA 2A69D 1A62A 1AN8A 2OWOA 3S15H 3OTOQ 1ESRA 5ELEA 4N9PA 5KNDA 4A3CG 4JPBW 2A8VA 3ICEA 4MIUA 5IWAQ 3K7UC 3NTHA 1K9MC 2F0NA 3ONAB 2BH2A 3VDYA 3D6WA 2MJ8A 3NXWA 1SYGA 2OTLA 4OIJA 3VA7A 1V9PA 2B2TC 3RLFA 3MVVA 2D0OA 3K58A 2ID0A 1I4PA 1HZCA 2E2IB 2HCIA 2Q8RE 4GLVB 1DOKA 4AYBE 4QIWE 4B3SQ 4JK1C 1W2BA 2B8FA 1UEAB 2MGSA 3I3CA 4A3KB 2X6LA 3I4NB 1STYA 4XYQA 5IODA 1UNSA 1EWHA 1VQ5A 5CYUA 4K6LA 4A76A 3I2ZA 1CA5A 1GKHA 2DNEA 2F3WA 3CQZH 2JA5H 4P71A 3U4VA 3J7A5 1GO3E 5IOCA 4CJ1B 4BWGB 1RF2D 5JEAG 3SEBA 2XN9C 2KA7A 5C5LA 1C7YA 1L1OA 2AQ3B 4S3SA 3IFDA 4A3FG 4X3SA 4OX9L 4RHSA 4L5QA 3OPOA 3MXGA 5C4XH 3HKZE 2N3SA 5LHY1 2B2VA 3I56A 1LTGD 1SYFA 2AUKA 5CMDA 5D3IB 1PA6A 1M8AA 2MFIA 4DNTB 2WACA 1D5XC 1VF5C 2VB3X 1VQBA 3BDOA 4YWMA 3SK8A 2L11A 4B3SL 1EYAA 2F0UA 4RGMA 1PMRA 2K7VA 5COYA 2VY3A 3CCMA 4DGZA 3HOZB 3L0OA 1TQOA 4FXDA 3S2HH 2GN5A 5C3WA 1WFQA 3OHXC 4GOPB 1CQVA 3T1HQ 1FNUA 3TN2A 2ATWA 3GTGH 1H95A 2A19A 1PV4A 4L8JA 1Y1WH 2A68D 1CSQA 1A6XA 1J5EL 1H9KA 1D7QA 1SMYC 1PTOH 4RHRA 3ULPA 1QCBD 2JE6I 3H91A 4EQNA 1X3FA 5M3FG 5CBAE 3B6YA 2SNSA 1D2BA 4UAIA 3I72A 3CD6A 5BN3A 2K14A 1SLJA 4IFDG 2LFNA 3GTJH 2SDFA 3M3YB 3I4NG 2H1EA 1NR2A 3R3OA 3S2DB 4LUVA 3SK4A 4UDUC 1N8RC 3H3VC 2Y0SE 1FNWA 4OXPA 2A6HD 3DWPA 1CFMA 3K0XA 2VW9A 4KI0A 5AFWA 2GVBA 1LM0A 2HHHL 4DXGA 1YI2A 4DR3Q 3NHHA 2M2LA 3S2DH 1LLRD 2K5HA 4ILWA 3ITPA 2VB2X 3KLRA 5FO7B 3RZDH 1XMOQ 3SDZA 1B3AA 3C46A 2KCTA 3QWNA 3S1QH 5M5YH 2NVXB 3KF8B 4CBVA 3F2DA 4V0BA 2JA6B 1X55A 2CQAA 1O7IA 3H15A 3EN2A 3AMUA 2UUCL 1B8AA 1HHVA 4CJ2C 3F2UA 4L5SA 4B3RQ 2AQ2B 1FL0A 2E2JH 4LFAL 2PW5A 2CW0C 5GAEC 1EL0A 1VDZA 3HEJA 3T13A 2O4XA 4CKBA 4Q0FA 2YV5A 1C9OA 2B63G 1GHJA 1EOVA 3ERQA 2XWJB 4GKJL 4G7ZC 1KIXA 3HOWB 2PCFB 3LNNA 5C3EH 1RIPA 3P20A 3PSIA 1Q7YC 3QIAA 1KRSA 4UPAA 3FHWA 3V05A 1NR4A 1Y1VB 2B2WA 3W3AA 4ZUJA 1HJPA 2JP1A 2VS1A 3K7AH 1Q86C 1PTOF 4ME3A 1SFOB 4OWTB 3CCJA 1K28A 1B70B 3RZOB 1HTPA 4R4QA 4NB3A 4A3MB 3NTIA 1SE3A 2EQSA 5GQOA 4A3EB 5KNCA 2UUCQ 5IYCH 1F2LA 3GTLB 4GLXA 4XDXA 1EYDA 4LFCL 5M3MH 3KDFA 3EFXD 1QJOA 3K5OA 1X3QA 1K0RA 1I3QH 4A3DG 3DM3A 4PG3A 2ENBA 1X6OA 3MZ5A 3C2PA 3OMGA 2G9DA 4OELB 4X6AH 3ZYYX 1SE2A 4GOPA 1C0AA 2RSNA 4EGVA 3R2TA 3HP3A 1VMCA 2ZXOA 2F0TA 2IHFA 4P72A 2QEXA 4EQPA 2K1BA 3DXJC 5E4XA 3CF5A 1AEXA 2BCOA 4HN7A 1VQAA 2BH8A 3DMUA 4PZ6A 2KOLA 1CT1D 4HCSA 5K36H 1PTOB 4HJ9A 3NE5B 1KAAA 2R7ZB 4DR5L 1LT5D 3S14B 5CV5A 3QOJA 4UHVA 2EZVA 2Z0SA 4A3IG 1S5DD 1IL8A 2K5VA 4R8IA 1Z47A 1NMGA 5JJIA 5FKAC 3UDXA 4DV0L 3GTPB 2D2CC 1GM5A 3CMEA 3IAYA 5BR8L 1TS3A 5CV9A 4CDEC 2L15A 1DM0B 4ZYSA 2QF7A 3S16H 3E5SA 5E3FA 3CXCA 4N8FA 1XWEA 3S1RB 5EBCA 1LTSD 1WCMB 2EY6A 2C5CA 2JA9A 5KYIA 1EYGA 3TP6A 4B3RL 1PTOD 2WIIB 1GHKA 2MO0A 1FNVA 1ENCA 2YYZA 3SVMA 3QG1A 2F0FA 3CCUA 1WYDA 4RGTA 3HFZB 1IYJB 3I4OA 1CKNB 2Z6KC 2MP1A 4LF6Q 4OIKA 3GTJB 1MHWC 4FYDA 1MJCA 1AW7A 5FLMH 1I4RA 1EZ6A 1KNAA 1RTNA 1YNJC 1QZGA 2KHSA 2PO4A 1HNXQ 5IYCG 5I2XA 2RKSA 4BY7B 1NSNS 1LUZA 2NWGA 1CKMA 3VR5A 1YNXA 2EJMA 3X3NA 1WCMH 2VUMH 4TQUS 1QVGA 1BQQT 1Q12A 4H0LC 4A3JB 1A3VA 2XGTA 1VQ7A 4X3TA 1YNND 3HG9A 1VQLA 3F2CA 2A69C 4IJHA 1SRUA 3AFPA 2ZTDA 1VQCA 2UXCL 3D6CA 1QOHA 5E7NA 1IW7C 1PH1A 3HKSA 4E6IA 2A73B 2PI2A 3Q8DA 3GTLH 2N8NA 3MXPA 2XTIA 2EYFA 4IALA 2UXDL 5KEEA 5EAYA 2HDMA 1UAPA 4RKLA 2Z9HA 3VR4A 4EQ5A 4KY5A 1PHJA 4A3BG 1RHPA 1SNPA 1EIHA 2B2YA 1IYUA 4ABNA 2YTYA 4XT3B 3I91A 1HUNA 3A8JE 3AU7A 1A2UA 1IBLL 4MTNA 2NN6G 1BVSA 1Q81C 1S5ED 4DV3L 4MTKA 3S1NH 1O7YA 2LXKA 4DK6C 1I4GA 1PDQA 4DK3C 4Q5VA 2Q2UA 1L0WA 1MD2D 2EJGC 3Q0AA 1SMYD 5IP7H 3GTKB 4DR4L 1P16A 2D0PA 1I5FA 5G3LD 3Q6SA 4JV5L 1SXTA 3HOYB 4B3MQ 2KECA 5I6YA 3KJPA 4FXKC 1XMQQ 4KKSA 1ZYRD 3GP7A 2CCZA 1HPCA 1B7YB 3A7LA 3I7FA 1BBWA 4HR7B 3J81E 4PQXA 2RA4A 4JI6Q 3T51B 4IJLA 1VQMA 2DGYA 2NBFA 3AQQA 2JSOA 5EKKA 4QMGA 5JAVA 1RL2A 4BY1G 4L63B 2JA8B 2F03A 5G3LF 3J81i 4LW1A 2LY7A 5M5YB 3UDIA 4XYOA 4RFBA 4DR7Q 2R6GA 2UU9Q 4DU9A 2K01A 3PO2H 1B4OA 1GUTA 4UP7A 4JI4Q 4DAVA 3S24A 1Y8PB 3ERSX 2EVBA 5E1FA 2CWPA 1JJGA 3TP8A 1AZQA 3M7NA 4TKOB 3VR2A 2Z6BA 4A3DB 1WTQA 4JI4L 2IX1A 2Z8LA 2RCFA 2HUGA 1TY2A 4QUCA 3D31A 5IIFA 3P7JA 2F1MA 2IW3A 1WVLA 3CU7A 1I4QA 1E2ZA 4IUUA 2K75A 1ZKOA 1J9OA 2AWNA 2QW7A 2Z1CA 2NVXH 1JICA 4QB4A 2B8GA 1K8OA 1LTAD 4NW2A 2PNRC 4FF3A 1H9SB 4WFN3 2FMCA 3OTOL 1KHIA 1VQ6A 4IO9A 1EQQA 2F0KA 2PQAA 3ZJYC 1KDBA 3BDCA 3N52A 2G9HD 4ODGA 4A93B 3RN5A 1IBLQ 1VMPA 1PTOC 4O2DA 1UE6A 1OXXK 4K0KL 4XT1B 3CCEA 2AUJD 5I9OA 5M5XB 4LF7Q 1XNQL 2F0LA 4IPHA 3IKJA 4F7XA 2NVQH 1DZ1A 1OXVA 4DAPA 2EXDA 5CV6A 3IFTA 4OX9Q 1FJGQ 1N33Q 1I50B 4J1MA 5M5XH 1SNQA 2A1AA 3A56A 4A3FH 3MEFA 3WDNA 1CHPD 1PFBA 3CC2A 2E5LQ 1TS4A 1PH4A 1PH2A 2JA8H 1VQ8A 2UXBL 4GN4B 5FK9C 3G71A 3KF8A 1KNEA 1PXUA 2WP8J 4JVZA 4DV1Q 4DV5Q 2LS01 4KJNA 5BN5A 3NWSA 1I4HA 1IBML 2JA6G 2F0SA 1OO9B 5DM63 3L3OC 2C35B 3DM1A 2XRQD 4A3LH 1DD2A 3I8ZA 1DXMA 3CKIB 3GO5A 1VQEA 2HHHQ 4O42A 5IT9c 4V190 3W5OA 5M5WH 3C1FA 1ONLA 4C3HH 3VYSA 1XNRL 3GD7A 1G6PA 4XIGS 4UP9A 3OWFA 3CCSA 4GKKQ 1A0IA 1XPOA 5LL6X 5M3FH 2AQ1B 2VQEL 4PMBA 2RHQB 2HT1A 3GTMH 2HQLA 4DN4M 5FOBB 3KBGA 1FVIA 4FXGC 1NNXA 5FO8B 5C44H 1WCMG 3ND9A 1JQYD 4DK1A 3E9IA 1J6QA 4R4TA 1TXYA 1SN8A 1TWFH 1JJ2A 1AFPA 4IFDJ 4Y52H 4IPCA 2A6EC 2L5TA 4X64L 1TWFB 1JOOA 1S4ZA 3PO2B 4FVMA 1GJXA 1I94Q 5ELFA 2X6GA 3OW2A 1STGA 4YCVA 5EKIA 4X62L 3HOZG 1U4RA 2CKZB 4X65L 3NQIA 1GVPA 1XMOL 2B2YC 3G6EA 4HMIA 1GOZA 1ICWA 4GN3B 2NVYH 3K7AB 3JAME 4KTAA 4C56C 2N88A 2QDLA 1LT6D 2NVYB 1QG7A 3BZKA 4PMCA 4C3IG 4GS3A 1T5XD 3RZDB 1N9WA 4DV4Q 1K8GA 5A2QL 2F0EA 2CW0D 1PFNA 3CC7A 2PI2E 4AIMA 2M00A 1SEBD 1KC8C 1OXTA 5EQ0A 3WOEA 2SEBD 3NBHB 1KLUD 1U4PA 3CHBD 5IGDA 1TVXA 4R4IA 1GUOA 4QF4A 1V43A 4Y7NB 5KIXA 1K0SA 5KYLA 1EFID 1LTBD 3NEMA 3QB3A 3KOJA 4LF8L 3HOUH 1FJGL 1QNKA 2VXWA 1YZ6A 1LT4D 4R4CA 3J7AF 3OWEB 1STAA 1NJIC 1YHAA 3PIPA 3GTOH 4I7ZC 1STNA 2VUMB 2FMMA 1F2MA 1BDOA 3SHLA 4H02A 2NB0A 2B29A 1RTOA 3S17B 1YVCA 2EYHA 1DGSA 3Q22A 2RVLA 4HAEA 5JEAH 3K5LA 3PUZA 2L9HA 1B1ZA 1PLFA 4K2KA 1QVFA 3D8GA 2DJFC 3MAQA 2I5MX 3H6MA 5C3XA 3EIVA 5EPLA 1L1OB 3U50C 5C4XG 1ZYRC 4G57A 3HOWG 4LF5L 4JBKA 5C3EG 3K80C 1YJWA 4AQYQ 1Z9FA 2V4DA 3NPPA 1VQHA 3NQTA 2B2VC 5KGUA 5M9OA 3KK7A 4JI0L 4PZ8A 4C3JG 1BKBA 1E1TA 1VQ9A 2PZUA 1JWMD 3I73A 4KHVA 3JAMi 4BBRH 5JJKA 3TZDA 1MJEA 1SNCA 2KHJA 5T1GA 1SMXA 3WOFA 2B3GA 1Q46A 2NN6I 1PH9A 1E2VA 1R9TB 4JBMA 1YJNA 1ENFA 2LXJA 5A35A 1R4PB 1SE8A 4U673 4G7HC 3F2BA 2L0CA 1X3GA 2RDFA 5C6AA 4GKJQ 3DEPA 1P8LA 2F3IA 2FXQA 1MI2A 1RKNA 2BE5C 1JT8A 2OXPA 1CHQD 4BA1I 3KLSA 5CORA 4AYBG 3PV0A 3M9BA 1B53A 3J81j 3U58A 1KD1C 2R92B 3MEHA 3BZCA 2K5NA 3BYTB 1ZEQX 4JI8Q 3BVGA 1HH2P 4LF5Q 1ENAA 3HKZG 1Q8KA 4C1NK 4OL7A 2GA4B 2EYJA 4IURA 2QDBA 1WI5A 4HTHA 3W1GA 4H13C 5D3DA 3STBD 3C3LA 3CRKC 1V1QA 2I46A 1EU4A 3J80L 3VYRA 1DJRD 4XQNA 2UUAQ 1K3BC 1MIUA 2ZM6Q 5LMUL 4MN3A 4PMWA 1B2TA 3V2TA 2J4XA 4MZ9A 4LUZA 1XJVA 1TWCB 5CV8A 1A3TA 3FKIG 3PUXA 1HNWL 4FF2A 4QJFA 3OYYA 1N34Q 4CDDC 2A5HA 4DR2Q 1QILA 1FR3A 4TVAB 1F9PA 1A3UA 4Z9CB 2NVTH 1CKNA 4B9WA 3G4SA 4IUQA 3HOVB 3PGZA 2PQEA 3K0YA 2R7FA 1HNZQ 1B3QA 1SR3A 4HJ8A 2B63H 2NVTB 4A3GH 4JI1L 2LKVA 2N49A 1N33L 2RF4A 1TWHB 4CGYB 3OMCA 2XSCA 3H09A 5M3MB 3UE1A 3A0JA 1PH6A 1N36L 5LMUQ 2B2UC 3G7LA 2ASBA 4GN5A 4DV7Q 3E9HA 2WFWA 5ELDA 2K05A 3Q24A 4OONA 4NXMQ 4IPDA 5FLXL 5C0XH 3K5NA 2SNMA 5JPMC 4DUYL 1KLGD 4LK1C 2P5ZX 4K6DA 3H94A 3M4OB 4EX5A 2NTTA 4IUTA 1YNNC 3PUYA 2ICEC 1TR5A 1Z7TA 5C4JH 2NYZD 4YY3L 3Q23A 5GADC 4IUVA 4YWKA 4DF7A 4PNYA 1N32L 4A3CH 1W6JA 5DLQE 2J0TD 2PYKA 3J7YW 4BBSB 1F2ZA 3DWQA 1EIGA 4C2MB 4HIDA 4JI3Q 3J80E 4LJZC 1G2SA 1PRTF 3EQLC 4NMZA 1C4QA 3NTKA 2CFMA 2A6ED 3HZXA 3TRZA 4LF9Q 3S9WA 1ESFA 1SE4A 3JC66 4RGNA 1VQJA 2C9OA 3L7ZC 2PMZB 3MFYA 5K36G 1NTGA 1IXRA 4APVA 1YHBA 2KCMA 4X62Q 2YTVA 3DEOA 2F4VL 4BBRB 3S1QB 2PPBC 2IX3A 4XXEA 1U4MA 4B3TL 5DM73 1PRTD 4LMQD 1B9MA 2UXBQ 1G291 1QVCA 4YY3Q 1JWSD 1L0XB 4NXNL 3SK5A 4DA2A 5EGTA 1VQFA 1Q82C 1HFGA 4KHZA 3HOUG 4LFCQ 1ZXTA 3WWVA 1YEZA 1JOKA 3N6RA 1MSHA 3MFGA 4LFBL 1GXDC 1SYBA 1GD7A 2LMCB 1EUJA 2R61A 3EROA 3BDLA 4C3HG 2NUCA 2EXZA 2K5QA 4RKBA 1EFWA 3OOCA 4TSSA 3QJYA 5FJ8G 1L0YB 1AE3A 2FHTA 5DAUA 3RD4A 3PF4A 1S3OA 3GTKH 2K6AA 1SYEA 3NENA 3HOVH 1PH5A 4Y7NH 5GAHC 4CDFC 5CGKA 1EY4A 1I3QB 4OO1I 1BXTA 1SDFA 1Y69U 5C5MA 2L12A 2BA1A 2R7DA 3L9AX 1I4XA 4PV1C 3FP9A 2HIXA 4DV2L 3CRLC 2E5LL 1BR9A 5TSSA 2Q8TA 4ZKCB 1SAPA 1IBKQ 1S5BD 1D8LA 1EZ8A 4KJOA 5CC4A 3RZOH 1WTXA 1HRJA 2HQEA 4DUZQ 3KFUA 4LF7L 2F0MA 2OF1A 2ZJQA 4R8NA 1VCIA 4C3HB 1F9QA 1C8CA 2L55A 1QE6A 5J39A 4HIMA 3KLSX 1M90C 3S1MB 1M4VA 4JW0A 3SXHA 1U0LA 1F2YA 4GNXB 1H9MA 2DY7A 4L6TB 1BNZA 3H0GH 5I6WA 3I4MH 4CHTB 3HOXG 2YTXA 1IKLA 5CBEE 2UUBQ 2Z6KA 1O78A 1YBYA 1WTHA 2K50A 2JK8A 4LF9L 1CK1A 1X54A 3TQYA 3VR6A 4AH6A 4A3JG 1A8VA 1PYBA 2ZT9C 2KEDA 4FDBA 4ME5A 1TS5A 3FEWX 3NWTA 3VYTA 2JA8G 3KBXA 2N55A 1STHA 1PRTC 4YCUA 3D4RA 4JBWA 4BXXG
chains in the Genus database with same CATH topology
3J7A5 3CC2A 2E5LQ 1GO3E 1VQKA 2BA0A 4DV7L 1PH2A 1PH4A 4OO1G 5HGQA 2JA8H 5JEAG 5LMNL 1VQ8A 3CC4A 1C7YA 2UXBL 1NE3A 1L1OA 4RG1A 4X64Q 1VQGA 4GN4B 4A3FG 3G71A 1X65A 4OX9L 3AYHB 2JQOA 2WP8J 4LF4Q 4L5QA 4DV1Q 4DV5Q 5C4XH 3HKZE 2N3SA 1OTCA 2OCEA 3RLOA 3PO3G 3I56A 2UUAL 1TWGH 4R4OA 1IBML 2JA6G 2WB1E 3IRBA 1PA6A 4BA2I 3SGIA 2C35B 3BU2A 4OWXB 4BY1H 2UXCQ 2MFIA 4A3LH 3M4PA 3GO5A 1VQBA 4YWMA 4B3SL 1VQEA 2WB1G 2HHHQ 4K0KQ 5IT9c 3W5OA 2VY3A 5M5WH 3CCMA 2GVAA 3T1YQ 1JMCA 1Y1WG 4JI7L 5IYDH 3L0OA 4C3HH 1XNRL 2PQAB 4OWWB 3GD7A 1G6PA 1VQDA 4UP9A 4XIGS 3CCSA 3S2HH 1A0IA 2GN5A 2N78A 1Y14B 4JI2L 1WFQA 2RHSB 4DR2L 4GOPB 1XPOA 3T1HQ 2ATWA 5M3FH 3GTGH 5FJ8H 2VQEL 2A19A 1PV4A 3HOWH 1I50H 1H95A 2RHQB 2HT1A 1Y1WH 3GTMH 2HQLA 1CSQA 1J5EL 5C44H 1FVIA 1D7QA 4C2MH 1WCMG 3ULPA 3E9IA 1J6QA 4JI7Q 4R4TA 2JE6I 1TXYA 1SN8A 1TWFH 1X3FA 1JJ2A 4IFDJ 4Y52H 4IPCA 1CUKA 4C3JH 5M3FG 4A93G 3KYHC 4X64L 2I5HA 3B6YA 4RMFA 3RLNA 2WAQG 1I94Q 1VQPA 1HNZL 3TS0A 2R93G 3T1HL 3CD6A 1IZ6A 3OW2A 2K14A 1SLJA 5M3MG 2VQEQ 4YCVA 4IFDG 3GTJH 4X62L 3HOZG 4P75A 3CPFA 2CKZB 2K4KA 4X65L 4XTCS 1VQIA 3I4NG 3RR5A 4DPGA 1GVPA 4LUVA 1XMOL 1N8RC 1UEBA 2Y0SE 3G6EA 4OXPA 3M4OH 4GN3B 2NVYH 3K0XA 2VW9A 4KI0A 3H0GG 3A74A 1YHQA 2GVBA 1LM0A 2HHHL 1Q1BA 3PF5A 3TREA 4JI6L 3BZKA 1L1OC 1YI2A 4GS3A 1S72A 4DR3Q 3S2DH 4X66Q 3PUWA 2K5HA 4BY7G 1N9WA 4DV4Q 3RZDH 1XMOQ 2KHIA 1K8GA 3CCLA 4DAMA 3CCVA 2KCTA 3S1QH 5M5YH 2K52A 2PI2E 2ALYB 4AIMA 4LFAQ 2QGQA 3KF8B 3CC7A 4JI5Q 3G48A 3F2DA 1KC8C 1OXTA 3HOYH 1AE2A 3J81c 1X55A 3NBHB 4JG2A 1ASZA 4A3MG 1XNQQ 4R4IA 1O7IA 1V43A 2IX0A 2IT1A 1HNWQ 3H15A 5AJ3Q 3NEMA 4UP8A 3EN2A 3KOJA 2H5XA 5GROA 2UUCL 1B8AA 4LF8L 3HOUH 4L5SA 1FJGL 4B3RQ 1FL0A 1YZ6A 4R4CA 4POGA 1Y1VG 4JI5L 2E2JH 4LFAL 2R7ZH 1NJIC 1YHAA 5GAEC 3PIPA 3GTOH 1HZBA 2I5LX 4H02A 2B29A 4UY8C 4NPSA 5IP9G 3KF6A 2YV5A 1C9OA 2B63G 2R7ZG 1EOVA 2MO1A 4HJAA 1YVCA 2VNUD 4R1JA 1DGSA 4GKJL 3PUZA 1KIXA 4LF4L 4LWCA 1RIPA 3PSIA 5C3EH 3J80c 3CPWA 5IWAL 4LNQA 1QVFA 2R92G 1KRTA 4HIKA 2I5MX 1Q7YC 4JV5Q 1KRSA 3E0EA 4UPAA 4DV4L 4B3ML 3EIVA 2F52A 1L1OB 3FHWA 3U50C 1QUQB 4JI8L 5C4XG 4GNXA 4DV6L 3HOWG 3PIOA 4IFDI 1HJPA 2E2IH 4JBKA 2VS1A 3K7AH 4LF5L 1Q86C 2JA6H 5C3EG 4ME3A 4KLKA 1HZAA 1Q1EA 4B3TQ 3K80C 1YJWA 4OWTB 3CCJA 4AQYQ 1BBUA 1Z9FA 1B70B 1VQHA 4R4QA 4NB3A 1VQNA 1XTDA 4JI0L 2EQSA 5GQOA 3ULJA 4PZ8A 3S14H 1BKBA 1E1TA 2JEAI 1VQ9A 3JAMi 2UUCQ 1JE5A 5IYCH 4BBRH 3RN2A 4YHHQ 5JJKA 4GLXA 4LF8Q 2ZTEA 2MNAA 3J7ZC 4LFCL 5M3MH 1MJEA 2ZJPA 3KDFA 3W1BA 2KHJA 5BR8Q 4DR1L 1K0RA 1SMXA 2UUBL 1I3QH 2B3GA 1Q46A 2NN6I 1K73C 1PH9A 3DM3A 4AQYL 4A3DG 4PG3A 1UWVA 5C0XG 1X6OA 4JBMA 4BBRG 1YJNA 1NMFA 1X3EA 2LXJA 4X6AH 3CP0A 3I55A 3M85A 4JI0Q 1XPUA 4GOPA 1C0AA 1XPRA 1SE8A 2OQ0A 3PCOB 5ELOA 1X3GA 3F2BA 1I94L 1S40A 4P72A 2IHFA 2QEXA 1JB7A 4GKJQ 1P8LA 2F3IA 2MQHA 2FXQA 3MXNB 1QZHA 1JT8A 3D0FA 4BA1I 1EQRA 3CF5A 4AYBG 3PV0A 3M9BA 3J81j 3U58A 1KD1C 1VQAA 2BH8A 3BZCA 2K5NA 4PZ6A 4JI8Q 1EWIA 1HH2P 3STBC 4LF5Q 4HJ9A 3HKZG 2JJQA 1Q8KA 2D62A 5C0XJ 1NBWA 3H3VI 4DR5L 4A3EH 1PYSB 1WI5A 4DR3L 2VZAA 5FLXc 4A3MH 3W1GA 2E2HH 2Z0SA 1CKOA 3STBD 4DAYB 4DV1L 4A3IG 1YJ9A 2K5VA 4IOAA 1V1QA 1Z47A 1SFOH 4C3IH 4QGUA 1NMGA 1OXUA 4QQBX 2I0QA 2UUAQ 5JJIA 2ZJRA 1MIUA 5J3BA 4YHHL 5JJLA 3GDEA 2ZM6Q 3UDXA 5LMUL 4DV0L 1Y1VH 4PMWA 1FGUA 1GM5A 3CMEA 2RCNA 2CWAA 5BR8L 4MZ9A 2L15A 1E24A 4LUZA 1XJVA 2KBNA 3M3YH 3S16H 4LUOA 2WAQE 3FKIG 3CXCA 3PUXA 4QL5A 1XNRQ 3GTQH 1HNWL 3KLWA 4QJFA 5AJ3L 1UE1A 3OYYA 2Q2TA 1N34Q 1MKHA 2JA9A 3ULLA 1EYGA 4DR2Q 4IOCA 1EIYB 4B3RL 2ZM6L 2AKWB 2MO0A 4WJ4A 2JA7G 4TVAB 4JI1Q 3K8AA 3TS2A 1OXSC 4ALPA 2YYZA 2NVTH 5ELNA 3A5UA 4IPGA 3CCUA 1WYDA 3RNUA 1CKNA 1QUQA 3HFZB 4DKAC 3G4SA 1IYJB 3I4OA 1CKNB 2V1CC 2Z6KC 5IYDG 1YITA 3PGZA 4LF6Q 2JA7H 1AH9A 3CMAA 2KENA 2R7FA 1HNZQ 1SR3A 4HJ8A 1MJCA 5FLMH 1IL2A 5HY6A 2B63H 2OTJA 4A3GH 4JI1L 2N49A 3S17H 1N33L 4HIOA 2RF4A 3A5ZB 3HOVG 1QZGA 2AMCB 4DUYQ 1HR0L 3KF6B 1HNXQ 5IYCG 1WOCA 2VL6A 2R92H 1E3PA 3UE1A 1LUZA 3A0JA 1CKMA 1PH6A 1N36L 1YNXA 5LMUQ 4DV0Q 1WCMH 2ASBA 2VUMH 1VS0A 4TQUS 1QVGA 4GN5A 4DV7Q 3PO2G 1HR0W 3E9HA 1PVOA 2WFWA 3BJUA 1Q12A 4A93H 4OONA 2XGTA 4JOIA 4IPDA 4X66L 4NXMQ 4BBSG 1VQ7A 1JJCB 4DR4Q 2NZOA 1KXLA 3S1MH 1YIJA 2ZTCA 1N34L 4DUYL 1HR0Q 1E22A 1HNXL 1VQLA 4DV2Q 4HJ7A 3F2CA 1N36Q 4IJHA 3AFQA 1SRUA 3AFPA 4EX5A 2ZTDA 3PUYA 1VQCA 1G51A 2UXCL 5E7NA 1PH1A 3F8TA 3HKSA 4QY7A 5IYBH 2PI2A 3Q8DA 4YY3L 5C4JH 4NXNQ 1SROA 2N8NA 4L5TA 4P74A 4DUZL 1PH8A 3GTLH 2XTIA 2Q2IA 3NELA 5GADC 4YWKA 2VQFL 2UXDL 4A4IA 1E1OA 4A3CH 1N32L 5EAYA 1PHJA 4EQ5A 5DLQE 1VQOA 2IY5B 4A3BG 1EIFA 4BY7H 3M4QA 2R93H 4J15A 4DR6Q 1UE5A 2YTYA 5IYBG 4GKKL 4A3IH 4HIDA 2QA4A 1IBLL 4JI3Q 3I4NH 4MTNA 5IY0A 2NN6G 5IP7G 1BVSA 3UDGA 1Q81C 1PH3A 1XMQL 4DV3L 2F4VQ 4A3BH 1J5EQ 3S1NH 2CFMA 2LXKA 4DK6C 3UE0A 4JCVE 2VQFQ 2UXDQ 3CW2C 3TRZA 1UE7A 3UDFA 4DK3C 4LF9Q 1ASYA 3CAMA 2Y0SG 2Q2HA 2HIVA 2Q2UA 2IHEA 1L0WA 3JC66 3H3VH 1VQJA 3L7ZC 5IP7H 3U4ZA 5K36G 3FKIH 1NTGA 4DR4L 1P16A 2D0PA 4P73A 1I5FA 4BXXH 4A3EG 4JI3L 1IXRA 4APVA 5GAGC 1YHBA 2KCMA 5LMNW 4JV5L 4B3MQ 2OQKA 4X62Q 3KJPA 2YTVA 1XMQQ 2F4VL 4A3KH 3KDFB 4DV6Q 2CQOA 1K83H 2CCZA 4WJ3M 3EBEA 1WJJA 1B7YB 1CSPA 3I7FA 1BBWA 4B3TL 1L2FA 5LMNQ 2UXBQ 1G291 1QVCA 4YY3Q 3DLLA 4NXNL 4HJ5A 1PH7A 4JI6Q 2PNHA 1TWCH 5IE8A 4A3KG 1KQSA 4IJLA 1VQMA 2DGYA 3AQQA 1N32Q 1VQFA 4PZ7A 1TWHH 4L5RC 1KAWA 1Q82C 4DV5L 2JA5G 1A63A 1RL2A 4KHZA 1X56A 4BY1G 3GTPH 3HOUG 4DR6L 4A3LG 4LFCQ 1X9NA 3WWVA 1VQ4A 1YEZA 3JAMc 3TEHB 1IBKL 3J81i 4JYAL 3CCQA 1U5KA 4LW1A 1HZ9A 4GKKQ 4LFBL 3UDIA 1K3RA 1GD7A 4DNIA 4YWLA 5IP9H 5C0XI 4DR7Q 1EUJA 2R6GA 1T9HA 2UU9Q 2PMZE 2VUMG 3PO2H 1TWAH 4UP7A 4JI4Q 1EFWA 5H1SE 5FJ8G 3PO3H 3S24A 4BBSH 1AE3A 2EIFA 3ERSX 4MNOA 4JI2Q 1S3OA 4GNXC 3PF4A 3F1ZA 3GTKH 4JYAQ 4LFBQ 1LYLA 2CWPA 3PUVA 4JBJA 5FLMG 1M1KC 4KHPQ 3M7NA 1JJGA 4A3GG 4DR7L 2LSSA 1LTLA 3NENA 2UU9L 4A3DH 3HOVH 1I6HH 3CCRA 2E8GA 1PH5A 4Y7NH 1W3SA 5GAHC 4JI4L 2IX1A 1KL9A 4JOIC 4DR5Q 2ES2A 4OO1I 3D31A 4NXML 3J80i 3HOZH 3LGJA 1A62A 1R9TH 2OWOA 3S15H 3OTOQ 2BA1A 1NY4A 2R7DA 4A3CG 3AEVA 4YCWA 2A8VA 3ICEA 2K75A 3FP9A 5IWAQ 3L2PA 3K7UC 1K9MC 4X65Q 2HIXA 2AWNA 5C44G 4DV2L 2NVXH 2E5LL 2BH2A 3VDYA 3S1RH 2DUDA 1IBKQ 1D8LA 2NZHA 3RZOH 2OTLA 3KJOA 4DUZQ 4O0AA 3KFUA 3OTOL 1KHIA 4LF7L 1PFSA 1VQ6A 3I4MG 1V9PA 2ZJQA 3RLFA 4IO9A 1VCIA 2AHOB 2D0OA 1EQQA 2ID0A 2PQAA 5JEAJ 1HZCA 3ZJYC 4HIMA 4GLAC 1M90C 4JC0A 1IBMQ 4GLVB 1U0LA 4GNXB 4A3JH 3RN5A 1IBLQ 4POFA 2AWOA 4O2DA 1UE6A 3H0GH 3I4MH 1OXXK 4AYBE 4KHPL 4QIWE 4B3SQ 4K0KL 3HOXG 1W2BA 2YTXA 3CCEA 4DV3Q 4DR1Q 2UUBQ 2YU9H 2Z6KA 1YBYA 4LF7Q 3K81C 1XNQL 4A75A 3T1YL 4LF6L 4IPHA 2K50A 2JK8A 4LF9L 1X54A 3TQYA 4AH6A 4A3JG 2NVQH 1A8VA 1K8AC 1PYBA 1OXVA 1VQ5A 4FDBA 1E7ZA 3ER0A 2EXDA 3HOXH 4GOPC 4A76A 4OX9Q 3I2ZA 1FJGQ 2JA8G 1N33Q 5M5XH 2JEBI 2A1AA 1GKHA 3CQZH 4A3FH 3MEFA 4YCUA 2JA5H 3HOYG 4JBWA 4P71A 3U4VA 4BXXG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A 5;  3CC2 A;  2E5L Q;  1GO3 E;  1VQK A;  2BA0 A;  4DV7 L;  1PH2 A;  1PH4 A;  4OO1 G;  5HGQ A;  2JA8 H;  5JEA G;  5LMN L;  1VQ8 A;  3CC4 A;  1C7Y A;  2UXB L;  1NE3 A;  1L1O A;  4RG1 A;  4X64 Q;  1VQG A;  4GN4 B;  4A3F G;  3G71 A;  1X65 A;  4OX9 L;  3AYH B;  2JQO A;  2WP8 J;  4LF4 Q;  4L5Q A;  4DV1 Q;  4DV5 Q;  5C4X H;  3HKZ E;  2N3S A;  1OTC A;  2OCE A;  3RLO A;  3PO3 G;  3I56 A;  2UUA L;  1TWG H;  4R4O A;  1IBM L;  2JA6 G;  2WB1 E;  3IRB A;  1PA6 A;  4BA2 I;  3SGI A;  2C35 B;  3BU2 A;  4OWX B;  4BY1 H;  2UXC Q;  2MFI A;  4A3L H;  3M4P A;  3GO5 A;  1VQB A;  4YWM A;  4B3S L;  1VQE A;  2WB1 G;  2HHH Q;  4K0K Q;  5IT9 c;  3W5O A;  2VY3 A;  5M5W H;  3CCM A;  2GVA A;  3T1Y Q;  1JMC A;  1Y1W G;  4JI7 L;  5IYD H;  3L0O A;  4C3H H;  1XNR L;  2PQA B;  4OWW B;  3GD7 A;  1G6P A;  1VQD A;  4UP9 A;  4XIG S;  3CCS A;  3S2H H;  1A0I A;  2GN5 A;  2N78 A;  1Y14 B;  4JI2 L;  1WFQ A;  2RHS B;  4DR2 L;  4GOP B;  1XPO A;  3T1H Q;  2ATW A;  5M3F H;  3GTG H;  5FJ8 H;  2VQE L;  2A19 A;  1PV4 A;  3HOW H;  1I50 H;  1H95 A;  2RHQ B;  2HT1 A;  1Y1W H;  3GTM H;  2HQL A;  1CSQ A;  1J5E L;  5C44 H;  1FVI A;  1D7Q A;  4C2M H;  1WCM G;  3ULP A;  3E9I A;  1J6Q A;  4JI7 Q;  4R4T A;  2JE6 I;  1TXY A;  1SN8 A;  1TWF H;  1X3F A;  1JJ2 A;  4IFD J;  4Y52 H;  4IPC A;  1CUK A;  4C3J H;  5M3F G;  4A93 G;  3KYH C;  4X64 L;  2I5H A;  3B6Y A;  4RMF A;  3RLN A;  2WAQ G;  1I94 Q;  1VQP A;  1HNZ L;  3TS0 A;  2R93 G;  3T1H L;  3CD6 A;  1IZ6 A;  3OW2 A;  2K14 A;  1SLJ A;  5M3M G;  2VQE Q;  4YCV A;  4IFD G;  3GTJ H;  4X62 L;  3HOZ G;  4P75 A;  3CPF A;  2CKZ B;  2K4K A;  4X65 L;  4XTC S;  1VQI A;  3I4N G;  3RR5 A;  4DPG A;  1GVP A;  4LUV A;  1XMO L;  1N8R C;  1UEB A;  2Y0S E;  3G6E A;  4OXP A;  3M4O H;  4GN3 B;  2NVY H;  3K0X A;  2VW9 A;  4KI0 A;  3H0G G;  3A74 A;  1YHQ A;  2GVB A;  1LM0 A;  2HHH L;  1Q1B A;  3PF5 A;  3TRE A;  4JI6 L;  3BZK A;  1L1O C;  1YI2 A;  4GS3 A;  1S72 A;  4DR3 Q;  3S2D H;  4X66 Q;  3PUW A;  2K5H A;  4BY7 G;  1N9W A;  4DV4 Q;  3RZD H;  1XMO Q;  2KHI A;  1K8G A;  3CCL A;  4DAM A;  3CCV A;  2KCT A;  3S1Q H;  5M5Y H;  2K52 A;  2PI2 E;  2ALY B;  4AIM A;  4LFA Q;  2QGQ A;  3KF8 B;  3CC7 A;  4JI5 Q;  3G48 A;  3F2D A;  1KC8 C;  1OXT A;  3HOY H;  1AE2 A;  3J81 c;  1X55 A;  3NBH B;  4JG2 A;  1ASZ A;  4A3M G;  1XNQ Q;  4R4I A;  1O7I A;  1V43 A;  2IX0 A;  2IT1 A;  1HNW Q;  3H15 A;  5AJ3 Q;  3NEM A;  4UP8 A;  3EN2 A;  3KOJ A;  2H5X A;  5GRO A;  2UUC L;  1B8A A;  4LF8 L;  3HOU H;  4L5S A;  1FJG L;  4B3R Q;  1FL0 A;  1YZ6 A;  4R4C A;  4POG A;  1Y1V G;  4JI5 L;  2E2J H;  4LFA L;  2R7Z H;  1NJI C;  1YHA A;  5GAE C;  3PIP A;  3GTO H;  1HZB A;  2I5L X;  4H02 A;  2B29 A;  4UY8 C;  4NPS A;  5IP9 G;  3KF6 A;  2YV5 A;  1C9O A;  2B63 G;  2R7Z G;  1EOV A;  2MO1 A;  4HJA A;  1YVC A;  2VNU D;  4R1J A;  1DGS A;  4GKJ L;  3PUZ A;  1KIX A;  4LF4 L;  4LWC A;  1RIP A;  3PSI A;  5C3E H;  3J80 c;  3CPW A;  5IWA L;  4LNQ A;  1QVF A;  2R92 G;  1KRT A;  4HIK A;  2I5M X;  1Q7Y C;  4JV5 Q;  1KRS A;  3E0E A;  4UPA A;  4DV4 L;  4B3M L;  3EIV A;  2F52 A;  1L1O B;  3FHW A;  3U50 C;  1QUQ B;  4JI8 L;  5C4X G;  4GNX A;  4DV6 L;  3HOW G;  3PIO A;  4IFD I;  1HJP A;  2E2I H;  4JBK A;  2VS1 A;  3K7A H;  4LF5 L;  1Q86 C;  2JA6 H;  5C3E G;  4ME3 A;  4KLK A;  1HZA A;  1Q1E A;  4B3T Q;  3K80 C;  1YJW A;  4OWT B;  3CCJ A;  4AQY Q;  1BBU A;  1Z9F A;  1B70 B;  1VQH A;  4R4Q A;  4NB3 A;  1VQN A;  1XTD A;  4JI0 L;  2EQS A;  5GQO A;  3ULJ A;  4PZ8 A;  3S14 H;  1BKB A;  1E1T A;  2JEA I;  1VQ9 A;  3JAM i;  2UUC Q;  1JE5 A;  5IYC H;  4BBR H;  3RN2 A;  4YHH Q;  5JJK A;  4GLX A;  4LF8 Q;  2ZTE A;  2MNA A;  3J7Z C;  4LFC L;  5M3M H;  1MJE A;  2ZJP A;  3KDF A;  3W1B A;  2KHJ A;  5BR8 Q;  4DR1 L;  1K0R A;  1SMX A;  2UUB L;  1I3Q H;  2B3G A;  1Q46 A;  2NN6 I;  1K73 C;  1PH9 A;  3DM3 A;  4AQY L;  4A3D G;  4PG3 A;  1UWV A;  5C0X G;  1X6O A;  4JBM A;  4BBR G;  1YJN A;  1NMF A;  1X3E A;  2LXJ A;  4X6A H;  3CP0 A;  3I55 A;  3M85 A;  4JI0 Q;  1XPU A;  4GOP A;  1C0A A;  1XPR A;  1SE8 A;  2OQ0 A;  3PCO B;  5ELO A;  1X3G A;  3F2B A;  1I94 L;  1S40 A;  4P72 A;  2IHF A;  2QEX A;  1JB7 A;  4GKJ Q;  1P8L A;  2F3I A;  2MQH A;  2FXQ A;  3MXN B;  1QZH A;  1JT8 A;  3D0F A;  4BA1 I;  1EQR A;  3CF5 A;  4AYB G;  3PV0 A;  3M9B A;  3J81 j;  3U58 A;  1KD1 C;  1VQA A;  2BH8 A;  3BZC A;  2K5N A;  4PZ6 A;  4JI8 Q;  1EWI A;  1HH2 P;  3STB C;  4LF5 Q;  4HJ9 A;  3HKZ G;  2JJQ A;  1Q8K A;  2D62 A;  5C0X J;  1NBW A;  3H3V I;  4DR5 L;  4A3E H;  1PYS B;  1WI5 A;  4DR3 L;  2VZA A;  5FLX c;  4A3M H;  3W1G A;  2E2H H;  2Z0S A;  1CKO A;  3STB D;  4DAY B;  4DV1 L;  4A3I G;  1YJ9 A;  2K5V A;  4IOA A;  1V1Q A;  1Z47 A;  1SFO H;  4C3I H;  4QGU A;  1NMG A;  1OXU A;  4QQB X;  2I0Q A;  2UUA Q;  5JJI A;  2ZJR A;  1MIU A;  5J3B A;  4YHH L;  5JJL A;  3GDE A;  2ZM6 Q;  3UDX A;  5LMU L;  4DV0 L;  1Y1V H;  4PMW A;  1FGU A;  1GM5 A;  3CME A;  2RCN A;  2CWA A;  5BR8 L;  4MZ9 A;  2L15 A;  1E24 A;  4LUZ A;  1XJV A;  2KBN A;  3M3Y H;  3S16 H;  4LUO A;  2WAQ E;  3FKI G;  3CXC A;  3PUX A;  4QL5 A;  1XNR Q;  3GTQ H;  1HNW L;  3KLW A;  4QJF A;  5AJ3 L;  1UE1 A;  3OYY A;  2Q2T A;  1N34 Q;  1MKH A;  2JA9 A;  3ULL A;  1EYG A;  4DR2 Q;  4IOC A;  1EIY B;  4B3R L;  2ZM6 L;  2AKW B;  2MO0 A;  4WJ4 A;  2JA7 G;  4TVA B;  4JI1 Q;  3K8A A;  3TS2 A;  1OXS C;  4ALP A;  2YYZ A;  2NVT H;  5ELN A;  3A5U A;  4IPG A;  3CCU A;  1WYD A;  3RNU A;  1CKN A;  1QUQ A;  3HFZ B;  4DKA C;  3G4S A;  1IYJ B;  3I4O A;  1CKN B;  2V1C C;  2Z6K C;  5IYD G;  1YIT A;  3PGZ A;  4LF6 Q;  2JA7 H;  1AH9 A;  3CMA A;  2KEN A;  2R7F A;  1HNZ Q;  1SR3 A;  4HJ8 A;  1MJC A;  5FLM H;  1IL2 A;  5HY6 A;  2B63 H;  2OTJ A;  4A3G H;  4JI1 L;  2N49 A;  3S17 H;  1N33 L;  4HIO A;  2RF4 A;  3A5Z B;  3HOV G;  1QZG A;  2AMC B;  4DUY Q;  1HR0 L;  3KF6 B;  1HNX Q;  5IYC G;  1WOC A;  2VL6 A;  2R92 H;  1E3P A;  3UE1 A;  1LUZ A;  3A0J A;  1CKM A;  1PH6 A;  1N36 L;  1YNX A;  5LMU Q;  4DV0 Q;  1WCM H;  2ASB A;  2VUM H;  1VS0 A;  4TQU S;  1QVG A;  4GN5 A;  4DV7 Q;  3PO2 G;  1HR0 W;  3E9H A;  1PVO A;  2WFW A;  3BJU A;  1Q12 A;  4A93 H;  4OON A;  2XGT A;  4JOI A;  4IPD A;  4X66 L;  4NXM Q;  4BBS G;  1VQ7 A;  1JJC B;  4DR4 Q;  2NZO A;  1KXL A;  3S1M H;  1YIJ A;  2ZTC A;  1N34 L;  4DUY L;  1HR0 Q;  1E22 A;  1HNX L;  1VQL A;  4DV2 Q;  4HJ7 A;  3F2C A;  1N36 Q;  4IJH A;  3AFQ A;  1SRU A;  3AFP A;  4EX5 A;  2ZTD A;  3PUY A;  1VQC A;  1G51 A;  2UXC L;  5E7N A;  1PH1 A;  3F8T A;  3HKS A;  4QY7 A;  5IYB H;  2PI2 A;  3Q8D A;  4YY3 L;  5C4J H;  4NXN Q;  1SRO A;  2N8N A;  4L5T A;  4P74 A;  4DUZ L;  1PH8 A;  3GTL H;  2XTI A;  2Q2I A;  3NEL A;  5GAD C;  4YWK A;  2VQF L;  2UXD L;  4A4I A;  1E1O A;  4A3C H;  1N32 L;  5EAY A;  1PHJ A;  4EQ5 A;  5DLQ E;  1VQO A;  2IY5 B;  4A3B G;  1EIF A;  4BY7 H;  3M4Q A;  2R93 H;  4J15 A;  4DR6 Q;  1UE5 A;  2YTY A;  5IYB G;  4GKK L;  4A3I H;  4HID A;  2QA4 A;  1IBL L;  4JI3 Q;  3I4N H;  4MTN A;  5IY0 A;  2NN6 G;  5IP7 G;  1BVS A;  3UDG A;  1Q81 C;  1PH3 A;  1XMQ L;  4DV3 L;  2F4V Q;  4A3B H;  1J5E Q;  3S1N H;  2CFM A;  2LXK A;  4DK6 C;  3UE0 A;  4JCV E;  2VQF Q;  2UXD Q;  3CW2 C;  3TRZ A;  1UE7 A;  3UDF A;  4DK3 C;  4LF9 Q;  1ASY A;  3CAM A;  2Y0S G;  2Q2H A;  2HIV A;  2Q2U A;  2IHE A;  1L0W A;  3JC6 6;  3H3V H;  1VQJ A;  3L7Z C;  5IP7 H;  3U4Z A;  5K36 G;  3FKI H;  1NTG A;  4DR4 L;  1P16 A;  2D0P A;  4P73 A;  1I5F A;  4BXX H;  4A3E G;  4JI3 L;  1IXR A;  4APV A;  5GAG C;  1YHB A;  2KCM A;  5LMN W;  4JV5 L;  4B3M Q;  2OQK A;  4X62 Q;  3KJP A;  2YTV A;  1XMQ Q;  2F4V L;  4A3K H;  3KDF B;  4DV6 Q;  2CQO A;  1K83 H;  2CCZ A;  4WJ3 M;  3EBE A;  1WJJ A;  1B7Y B;  1CSP A;  3I7F A;  1BBW A;  4B3T L;  1L2F A;  5LMN Q;  2UXB Q;  1G29 1;  1QVC A;  4YY3 Q;  3DLL A;  4NXN L;  4HJ5 A;  1PH7 A;  4JI6 Q;  2PNH A;  1TWC H;  5IE8 A;  4A3K G;  1KQS A;  4IJL A;  1VQM A;  2DGY A;  3AQQ A;  1N32 Q;  1VQF A;  4PZ7 A;  1TWH H;  4L5R C;  1KAW A;  1Q82 C;  4DV5 L;  2JA5 G;  1A63 A;  1RL2 A;  4KHZ A;  1X56 A;  4BY1 G;  3GTP H;  3HOU G;  4DR6 L;  4A3L G;  4LFC Q;  1X9N A;  3WWV A;  1VQ4 A;  1YEZ A;  3JAM c;  3TEH B;  1IBK L;  3J81 i;  4JYA L;  3CCQ A;  1U5K A;  4LW1 A;  1HZ9 A;  4GKK Q;  4LFB L;  3UDI A;  1K3R A;  1GD7 A;  4DNI A;  4YWL A;  5IP9 H;  5C0X I;  4DR7 Q;  1EUJ A;  2R6G A;  1T9H A;  2UU9 Q;  2PMZ E;  2VUM G;  3PO2 H;  1TWA H;  4UP7 A;  4JI4 Q;  1EFW A;  5H1S E;  5FJ8 G;  3PO3 H;  3S24 A;  4BBS H;  1AE3 A;  2EIF A;  3ERS X;  4MNO A;  4JI2 Q;  1S3O A;  4GNX C;  3PF4 A;  3F1Z A;  3GTK H;  4JYA Q;  4LFB Q;  1LYL A;  2CWP A;  3PUV A;  4JBJ A;  5FLM G;  1M1K C;  4KHP Q;  3M7N A;  1JJG A;  4A3G G;  4DR7 L;  2LSS A;  1LTL A;  3NEN A;  2UU9 L;  4A3D H;  3HOV H;  1I6H H;  3CCR A;  2E8G A;  1PH5 A;  4Y7N H;  1W3S A;  5GAH C;  4JI4 L;  2IX1 A;  1KL9 A;  4JOI C;  4DR5 Q;  2ES2 A;  4OO1 I;  3D31 A;  4NXM L;  3J80 i;  3HOZ H;  3LGJ A;  1A62 A;  1R9T H;  2OWO A;  3S15 H;  3OTO Q;  2BA1 A;  1NY4 A;  2R7D A;  4A3C G;  3AEV A;  4YCW A;  2A8V A;  3ICE A;  2K75 A;  3FP9 A;  5IWA Q;  3L2P A;  3K7U C;  1K9M C;  4X65 Q;  2HIX A;  2AWN A;  5C44 G;  4DV2 L;  2NVX H;  2E5L L;  2BH2 A;  3VDY A;  3S1R H;  2DUD A;  1IBK Q;  1D8L A;  2NZH A;  3RZO H;  2OTL A;  3KJO A;  4DUZ Q;  4O0A A;  3KFU A;  3OTO L;  1KHI A;  4LF7 L;  1PFS A;  1VQ6 A;  3I4M G;  1V9P A;  2ZJQ A;  3RLF A;  4IO9 A;  1VCI A;  2AHO B;  2D0O A;  1EQQ A;  2ID0 A;  2PQA A;  5JEA J;  1HZC A;  3ZJY C;  4HIM A;  4GLA C;  1M90 C;  4JC0 A;  1IBM Q;  4GLV B;  1U0L A;  4GNX B;  4A3J H;  3RN5 A;  1IBL Q;  4POF A;  2AWO A;  4O2D A;  1UE6 A;  3H0G H;  3I4M H;  1OXX K;  4AYB E;  4KHP L;  4QIW E;  4B3S Q;  4K0K L;  3HOX G;  1W2B A;  2YTX A;  3CCE A;  4DV3 Q;  4DR1 Q;  2UUB Q;  2YU9 H;  2Z6K A;  1YBY A;  4LF7 Q;  3K81 C;  1XNQ L;  4A75 A;  3T1Y L;  4LF6 L;  4IPH A;  2K50 A;  2JK8 A;  4LF9 L;  1X54 A;  3TQY A;  4AH6 A;  4A3J G;  2NVQ H;  1A8V A;  1K8A C;  1PYB A;  1OXV A;  1VQ5 A;  4FDB A;  1E7Z A;  3ER0 A;  2EXD A;  3HOX H;  4GOP C;  4A76 A;  4OX9 Q;  3I2Z A;  1FJG Q;  2JA8 G;  1N33 Q;  5M5X H;  2JEB I;  2A1A A;  1GKH A;  3CQZ H;  4A3F H;  3MEF A;  4YCU A;  2JA5 H;  3HOY G;  4JBW A;  4P71 A;  3U4V A;  4BXX G; 
#chains in the Genus database with same CATH topology
 4FP5 D;  3S1N B;  2IPK D;  4OO1 G;  1LV9 A;  4C1N I;  5HGQ A;  2BE5 D;  2XIW A;  4RG1 A;  1VQG A;  1X65 A;  1UUP A;  3AYH B;  4KY7 A;  2JQO A;  5HUR A;  4RWS C;  2JN4 A;  1F9S A;  4KK7 A;  1CM9 A;  1JCK B;  4K5X A;  2UUA L;  1TWG H;  1CTM A;  2WB1 E;  1GUG A;  4BA2 I;  1KDA A;  4WJW A;  4OWX B;  4BY1 H;  5JPN C;  2WB1 G;  2QCP X;  4ZKB B;  5LL6 S;  1LTT D;  3T1Y Q;  5IYD H;  1HFN A;  2GVA A;  4K8I A;  4OWW B;  4ZQ3 A;  1W6K A;  4JI2 L;  2KCC A;  1V8Q A;  3DHQ A;  1I50 H;  1QNU A;  3A54 A;  5KRU A;  4JI7 Q;  3OSO A;  1Y8O B;  1PZK D;  2NZ1 D;  2MPM A;  1CUK A;  2EDG A;  3A7A B;  3KYH C;  4F88 A;  1IKM A;  2R93 B;  2WAQ G;  3HS0 C;  1HNZ L;  3T1H L;  3PIO 3;  5M3M G;  1QB5 D;  2VQE Q;  1QWY A;  3CPF A;  3NP8 A;  5FO9 B;  1VQI A;  1ML0 D;  3RR5 A;  4DPG A;  1UEB A;  1E2W A;  3H0G G;  3A74 A;  2O5I C;  3TRE A;  1L1O C;  4HCE A;  2A6H C;  4MHE A;  1MBY A;  4X66 Q;  4NDX A;  1WTR A;  1D6E C;  4BY7 G;  1KTK A;  3GTQ B;  3CCL A;  2KHI A;  1AP0 A;  4G7O C;  3CCV A;  2RQX A;  2ALY B;  4LFA Q;  2WV6 D;  3G48 A;  1PFM A;  2XRS D;  5F2D A;  3X3M A;  3J81 c;  4JG2 A;  4ZRZ A;  3I90 A;  4A3M G;  1XNQ Q;  3FKI B;  2ICI A;  2F0G A;  2X69 A;  2IT1 A;  1DYQ A;  4UP8 A;  2H5X A;  5J1Z A;  3S2H B;  1RDP D;  2R7Z H;  1Y1V G;  1EWC A;  1TKW B;  1HZB A;  2QIL A;  4NPS A;  2FFK B;  4RA8 A;  2L4N A;  3KF6 A;  1XTC D;  2MO1 A;  3QR8 A;  4HJA A;  2VNU D;  1WTV A;  4QCL A;  3R8B A;  4LF4 L;  1DOL A;  1RD9 D;  5CV4 A;  4LWC A;  3A8I E;  1AZP A;  2R92 G;  4FF1 A;  2IWH A;  1KRT A;  2Z4H A;  4JV5 Q;  1EY6 A;  3E0E A;  4DV4 L;  2KEE A;  2PW7 A;  4CKC A;  2B2T A;  4DV6 L;  2WKD A;  5I2Y A;  2E2I H;  3J7A V;  1ILP A;  2JA6 H;  1HTL D;  3M4Y A;  4I65 A;  1BBU A;  5E4W C;  1VQN A;  1XTD A;  3TZU A;  3S14 H;  5EBD A;  2JEA I;  3FPU B;  1JE5 A;  1U4L A;  1JOR A;  4YHH Q;  5CV7 A;  2ZTE A;  2MNA A;  3J7Z C;  2K5D A;  3T16 A;  4IFD H;  1JOQ A;  3EA6 A;  3S15 B;  3W1B A;  4DR1 L;  2CH4 W;  5IGG A;  1XX8 A;  1UWV A;  5C44 B;  4A3G B;  4BBR G;  4KD3 A;  3I55 A;  3M85 A;  1XPU A;  1XPR A;  1FD7 D;  5C3E B;  1X3P A;  5ELO A;  1I94 L;  2MQH A;  2MUY A;  1CA6 A;  2XWB B;  1O7L A;  5EKL A;  2D9U A;  4EQO A;  2WIN B;  1TT2 A;  1EWI A;  2OT2 A;  3STB C;  1C48 A;  2JJQ A;  2F0P A;  5C0X J;  3H3V I;  3JAM L;  3U9S A;  4A3E H;  1PYS B;  4DR3 L;  2E76 C;  2VZA A;  4A3M H;  2E2H H;  1CKO A;  2KVM A;  5I9P A;  4ID6 A;  4DV1 L;  3RUZ A;  4IOA A;  1SFO H;  4C3I H;  2JXM B;  4QGU A;  4ZAI A;  2I0Q A;  1SND A;  5DEH A;  1G6Z A;  1PZI D;  5JJL A;  3GDE A;  2IJ0 A;  1JR0 D;  1Y1V H;  4HSP A;  1II3 A;  2RCN A;  2CWA A;  3DUZ A;  3NK9 A;  3TBI B;  2KBN A;  3TP5 A;  3VA5 A;  1SJE D;  2HD3 A;  3T53 B;  4O1N A;  2XNA C;  3GTQ H;  3KLW A;  3BG3 A;  1UE1 A;  5J22 A;  1EY0 A;  2Q2T A;  1MKH A;  4TRD A;  1B44 D;  4WRD A;  2ZM6 L;  4KN4 C;  2AKW B;  4WJ4 A;  2JA7 G;  1LAC A;  3TS2 A;  1OXS C;  5IGE A;  4ALP A;  3V96 A;  3A5U A;  1EQV A;  4IPG A;  3RNU A;  4KN7 C;  4DKA C;  1Y1W B;  4C3I B;  1CQF A;  3W2D A;  1YIT A;  4IUP A;  3FMC A;  2FIN B;  3CMA A;  2KEN A;  1NAP A;  4FF4 A;  1JC7 A;  1IL2 A;  2OTJ A;  1EY5 A;  4RCO A;  3FRP B;  3TME A;  4F87 A;  4QUF A;  3S17 H;  3VR3 A;  4HIO A;  3A5Z B;  3ND8 A;  3HOV G;  2AMC B;  3UI2 A;  1HR0 L;  1CZW A;  3KF6 B;  2DNC A;  1PRT B;  1E3P A;  4K2L A;  4DV0 Q;  1HQM C;  2HCC A;  3PO2 G;  1HR0 W;  1PVO A;  3S16 B;  4ZCK A;  3GTG B;  4A93 H;  3GV3 A;  4X66 L;  4DR4 Q;  4KKU A;  2NZO A;  1KXL A;  3S1M H;  2ZTC A;  3BVM A;  5EPK A;  1K8M A;  1TY0 A;  2CHB D;  1N34 L;  1HR0 Q;  1HNX L;  4HJ7 A;  1H9J A;  1EY8 A;  1G51 A;  2BDN A;  4H7B A;  2R3Z A;  4QY7 A;  5IYB H;  3M3Y H;  1SRO A;  4P74 A;  4ULL A;  3EJI A;  1TWG B;  3I4L A;  2Q2I A;  3NEL A;  4AYB B;  5BN4 A;  4A4I A;  1DON A;  2BOS A;  2CH4 A;  1BO0 A;  1VQO A;  4KD4 A;  1TU2 B;  4J15 A;  1UE5 A;  2M9V A;  4A3I H;  1R4Q B;  2K28 A;  2QA4 A;  3I4N H;  1VF7 A;  5A2Q E;  2F4V Q;  2B2U A;  3TP7 A;  2UXD Q;  1V1P A;  3CQZ B;  1UE7 A;  2JA7 B;  2Q2H A;  2IHE A;  4I7A A;  4DFA A;  3H3V H;  1A15 A;  4P73 A;  4BXX H;  4C3J B;  5GAG C;  5LMN W;  1WTW A;  4A3K H;  4DV6 Q;  2CQO A;  2E2D C;  4WJ3 M;  1O80 A;  3BVZ A;  5T1I A;  1WJJ A;  2QEJ C;  1GUS A;  1L2F A;  1NCV A;  5C4X B;  3DLL A;  4HJ5 A;  3A8K E;  3NUC A;  1PH7 A;  3A55 A;  5IGB A;  1TWC H;  5IE8 A;  1KQS A;  4IUN A;  1BUV T;  1N32 Q;  1TWH H;  1EOT A;  5ISR A;  1HA5 A;  4DV5 L;  1JE4 A;  1HQR D;  1X56 A;  4DR6 L;  1DCZ A;  3JAM c;  3TEH B;  1IBK L;  4JYA L;  3CCQ A;  1U5K A;  2F3V A;  2JA5 B;  3R2I A;  4DNI A;  5C0X I;  3NBI A;  2KQ3 A;  1T9H A;  2B39 A;  2VUM G;  2FJ2 A;  1IHZ A;  3BZD B;  5H1S E;  4X3U A;  1RCV D;  3PO3 H;  1FYC A;  4GNX C;  4JI2 Q;  3RMH A;  4ZLT F;  4JYA Q;  4LFB Q;  1LTR D;  3PUV A;  1M1K C;  4WOR A;  3D3R A;  4A3G G;  3FVQ A;  4DR7 L;  2LSS A;  1TS2 A;  1LTL A;  3CCR A;  1EU3 A;  3LWE A;  1F9R A;  1W3S A;  2E74 C;  3NBH A;  2EYM A;  2Y0S B;  2ES2 A;  4NXM L;  1J8I A;  3J80 i;  3FDT A;  1R9T H;  3PMF A;  2F4I A;  2NVQ B;  1NY4 A;  3AEV A;  4YCW A;  3E0J A;  3L2P A;  4X65 Q;  5C44 G;  4FO2 A;  3GV6 A;  3S1R H;  2DUD A;  2KJX A;  1SNM A;  2NZH A;  3KJO A;  3MTS A;  4O0A A;  5IT9 L;  1O7Z A;  4EVO A;  1PFS A;  3I4M G;  2AHO B;  5JEA J;  1MGS A;  4GLA C;  1CI3 M;  2EPB A;  4XQQ A;  4YIJ A;  4JC0 A;  1IBM Q;  5C4H A;  1EYC A;  4A3J H;  2DN8 A;  4IN3 A;  4POF A;  2AWO A;  4KHP L;  3G6J B;  4DV3 Q;  4DR1 Q;  3E6Z X;  3K81 C;  2EYP A;  4A75 A;  3T1Y L;  4LF6 L;  3QO2 A;  2YU9 B;  4HED A;  1K8A C;  5HGT A;  1WD1 A;  1E7Z A;  3ER0 A;  4GOP C;  3HOX H;  4KKT A;  2JEB I;  1G8Z D;  4K5V A;  2K5W A;  5D65 A;  2KCN A;  3HOY G;  2G5D A;  1VQK A;  2BA0 A;  4DV7 L;  3T56 B;  1D1I A;  3CC4 A;  5LMN L;  1TII D;  1NE3 A;  4X64 Q;  2KUM A;  1HA6 A;  4LF4 Q;  4DAY A;  2EYO A;  4J8Q A;  1OTC A;  2OCE A;  3RLO A;  3PO3 G;  2E2H B;  4R4O A;  3IRB A;  4HMJ A;  3SGI A;  2UXC Q;  3BU2 A;  4DXF A;  4B08 A;  3M4P A;  1T5E A;  4K0K Q;  4G4K A;  4NP5 A;  2Z4I A;  1D1K A;  1JMC A;  4JI7 L;  1Y1W G;  1XXG A;  2PQA B;  4M8A A;  2RDH A;  1VQD A;  2EOT A;  2N78 A;  1Y14 B;  2F0W A;  2RHS B;  1XYI A;  4DR2 L;  2ZXP A;  2EY2 A;  3HOW H;  5FJ8 H;  5ELC A;  3P75 A;  3TSS A;  1NUC A;  4C2M H;  5D14 A;  4HSV A;  4RGO S;  4K8J A;  4C3J H;  4A93 G;  2I5H A;  3TDQ A;  4RMF A;  1DOM A;  3RLN A;  2WAQ B;  5I4D A;  2R93 G;  1VQP A;  3TS0 A;  1EQT A;  1IZ6 A;  3KUP A;  4P75 A;  3MWY W;  2K4K A;  1I6H B;  4XTC S;  1ILQ A;  2BDO A;  3M4O H;  5K5P A;  5NUC A;  3URY A;  1YHQ A;  4DNR B;  1YNJ D;  1WD0 A;  1Q1B A;  5DNF A;  3PF5 A;  4JI6 L;  1S72 A;  3PUW A;  2F0J A;  3SK6 A;  1H9S A;  3NSW A;  3T4A C;  2EE1 A;  1B50 A;  4DAM A;  2WB1 B;  2K52 A;  4JI5 Q;  2QGQ A;  4NKL A;  1ET9 A;  3HOY H;  1AE2 A;  1H9R A;  2F0H A;  1Y8N B;  1ASZ A;  5JVG 3;  2DJG C;  2IX0 A;  1HNW Q;  1BOS A;  4IQZ A;  5EPJ A;  2F0I A;  3SR1 A;  5AJ3 Q;  5GRO A;  4ZK9 B;  3FPP A;  4POG A;  4JI5 L;  1JWU D;  1JB3 A;  1SBB B;  3MC0 B;  2JYO A;  3HGB A;  2I5L X;  4UY8 C;  3HOX B;  5IP9 G;  2WKC A;  4K14 A;  1Q3L A;  3K5M A;  3EVQ A;  2R7Z G;  1GUW A;  2K33 A;  4R1J A;  1Q8I A;  4OO1 H;  1LO5 D;  5JOB A;  4KV6 A;  3K6O A;  1BCP D;  1SNO A;  4LNQ A;  3CPW A;  3J80 c;  2E75 C;  5IWA L;  1BF4 A;  4HIK A;  1ET6 A;  1D5M C;  4B3M L;  2F52 A;  1QUQ B;  1SJH D;  4JI8 L;  4GNX A;  2PZW A;  3PIO A;  4IFD I;  3LWU A;  1X32 A;  1G91 A;  4KLK A;  1HZA A;  1Q1E A;  2F0O A;  4B3T Q;  3MHB A;  2XVS A;  4BY1 B;  1WTO A;  3ULJ A;  2K03 A;  4J6H A;  1STE A;  3RN2 A;  3IL8 A;  4LF8 Q;  2NTS A;  2ZJP A;  1STB A;  5BR8 Q;  2UUB L;  3GQB A;  5FLX E;  2L1B A;  3LX0 A;  1BCP B;  1K73 C;  2PZT A;  3J81 L;  4AQY L;  3I70 A;  5C0X G;  3GTO B;  1NMF A;  1X3E A;  3CP0 A;  4JI0 Q;  2I07 B;  3OIQ A;  3C1E A;  3HRZ C;  2OQ0 A;  3PCO B;  1IW7 D;  1S40 A;  1V1P B;  1JB7 A;  3MXN B;  4F8M A;  4A3B B;  1QZH A;  2DY8 A;  3D0F A;  1EQR A;  1I6V C;  2RBM A;  2O5J C;  1F77 A;  5EJW A;  1HXY D;  2D62 A;  2CVR A;  1NBW A;  2B63 B;  1PYW D;  5C4J B;  3HOU B;  4X3K A;  5FLX c;  3H0G B;  3MXN A;  5IT9 E;  4DAY B;  5ELB A;  1YJ9 A;  2RDG A;  3OW7 A;  3VYU A;  2H4O A;  1EY9 A;  1OXU A;  4QQB X;  2K04 A;  1EEF D;  2ZJR A;  5J3B A;  4YHH L;  5IGC A;  4B9X A;  1B9N A;  1FGU A;  1SYD A;  3PQI A;  1BCP F;  1E24 A;  3DWA A;  2A74 C;  4LUO A;  2WAQ E;  4KMU C;  4QL5 A;  1XNR Q;  5AJ3 L;  2A68 C;  1LAB A;  4R9W A;  1EEI D;  4N8X 1;  3ULL A;  1EIY B;  4IOC A;  2F0D A;  1A2T A;  2HDL A;  2B2W C;  3K8A A;  4JI1 Q;  4OEM B;  3OIP A;  5ELN A;  3K57 A;  1FGB D;  1QUQ A;  3E3X A;  3GTM B;  5JJZ A;  2V1C C;  5IYD G;  1AH9 A;  2J7Z A;  2JA7 H;  2SOB A;  1WTP A;  1G2T A;  4BS9 A;  5HY6 A;  3PIP 3;  4QIW B;  5CR3 A;  5IGF A;  1V1O A;  1E0B A;  5M5W B;  4DUY Q;  2K32 A;  1WOC A;  2VL6 A;  2ZXR A;  3MA2 B;  2R92 H;  2D5D A;  1HUM A;  4M1U B;  1TWA B;  1U9R A;  2YU9 H;  1VS0 A;  4RCN A;  3BJU A;  1S5C D;  2RSO A;  2E2J B;  2F0Q A;  4OHJ A;  5M3F B;  4XQJ A;  4JOI A;  4BBS G;  1ICF B;  1JJC B;  4P2C B;  1KAB A;  1YIJ A;  2OEO A;  1RJT A;  3P1H A;  1E22 A;  4K5W A;  3K59 A;  3AB9 A;  4DV2 Q;  1N36 Q;  3AFQ A;  5L37 A;  2MHV A;  1D5Z C;  1LT3 D;  3F8T A;  4NXN Q;  4L5T A;  4DUZ L;  4KY6 A;  1PH8 A;  1KDC A;  1GUN A;  2VQF L;  1E1O A;  3M7G A;  4OGQ C;  2IY5 B;  1EIF A;  4BY7 H;  3M4Q A;  4A3I B;  2R93 H;  4DR6 Q;  5IYB G;  4GKK L;  4ZUI A;  4FNF A;  4GZY C;  5IY0 A;  1Z6H A;  5IP7 G;  3UDG A;  5JVH 3;  1PH3 A;  1XMQ L;  4A3B H;  2F0V A;  1J5E Q;  2TSS A;  1BCP C;  3UE0 A;  1S5F D;  4JCV E;  2VQF Q;  1IYV A;  2EYL A;  3CW2 C;  4A3F B;  3UDF A;  4H44 C;  1BBX C;  1ASY A;  2Y0S G;  3CAM A;  2HIV A;  2NN6 H;  3U4Z A;  3FKI H;  4RAU C;  4LAA A;  4A3E G;  4JI3 L;  3PO3 B;  1ROD A;  2OQK A;  2Q8I B;  3KDF B;  2EY1 A;  1K83 H;  3EBE A;  1CSP A;  2TMP A;  3BS1 A;  5LMN Q;  4U68 A;  2O2L D;  3BYY B;  3R93 A;  1PZJ D;  2PNH A;  4A3K G;  4IZ8 A;  4PZ7 A;  4N9T A;  4L5R C;  1KAW A;  2JA5 G;  1A63 A;  2EJF C;  3GTP H;  4A3L G;  3O13 A;  1X9N A;  2EY5 A;  1VQ4 A;  3HKZ B;  1HZ9 A;  4DK0 A;  4RH6 A;  2IL8 A;  3D4D A;  1K3R A;  5KNB A;  3SE0 A;  4YWL A;  5IP9 H;  3U9O A;  1K83 B;  1LTI D;  3MXU A;  2PMZ E;  3QOL A;  1CZG A;  1TWA H;  5C4Z A;  1SYC A;  1MSG A;  2QKI C;  4BBS H;  4MNO A;  2EIF A;  1Q90 A;  1SSO A;  3F1Z A;  1LYL A;  4JBJ A;  5FLM G;  4KHP Q;  3D4W A;  4CJ0 B;  4CKE A;  2UU9 L;  4A3D H;  1I6H H;  3I4M B;  1HCZ A;  2E8G A;  4CDC C;  1KL9 A;  4JOI C;  4DR5 Q;  1EY7 A;  3HOZ H;  3LGJ A;  2A69 D;  1A62 A;  1AN8 A;  2OWO A;  3S15 H;  3OTO Q;  1ESR A;  5ELE A;  4N9P A;  5KND A;  4A3C G;  4JPB W;  2A8V A;  3ICE A;  4MIU A;  5IWA Q;  3K7U C;  3NTH A;  1K9M C;  2F0N A;  3ONA B;  2BH2 A;  3VDY A;  3D6W A;  2MJ8 A;  3NXW A;  1SYG A;  2OTL A;  4OIJ A;  3VA7 A;  1V9P A;  2B2T C;  3RLF A;  3MVV A;  2D0O A;  3K58 A;  2ID0 A;  1I4P A;  1HZC A;  2E2I B;  2HCI A;  2Q8R E;  4GLV B;  1DOK A;  4AYB E;  4QIW E;  4B3S Q;  4JK1 C;  1W2B A;  2B8F A;  1UEA B;  2MGS A;  3I3C A;  4A3K B;  2X6L A;  3I4N B;  1STY A;  4XYQ A;  5IOD A;  1UNS A;  1EWH A;  1VQ5 A;  5CYU A;  4K6L A;  4A76 A;  3I2Z A;  1CA5 A;  1GKH A;  2DNE A;  2F3W A;  3CQZ H;  2JA5 H;  4P71 A;  3U4V A;  3J7A 5;  1GO3 E;  5IOC A;  4CJ1 B;  4BWG B;  1RF2 D;  5JEA G;  3SEB A;  2XN9 C;  2KA7 A;  5C5L A;  1C7Y A;  1L1O A;  2AQ3 B;  4S3S A;  3IFD A;  4A3F G;  4X3S A;  4OX9 L;  4RHS A;  4L5Q A;  3OPO A;  3MXG A;  5C4X H;  3HKZ E;  2N3S A;  5LHY 1;  2B2V A;  3I56 A;  1LTG D;  1SYF A;  2AUK A;  5CMD A;  5D3I B;  1PA6 A;  1M8A A;  2MFI A;  4DNT B;  2WAC A;  1D5X C;  1VF5 C;  2VB3 X;  1VQB A;  3BDO A;  4YWM A;  3SK8 A;  2L11 A;  4B3S L;  1EYA A;  2F0U A;  4RGM A;  1PMR A;  2K7V A;  5COY A;  2VY3 A;  3CCM A;  4DGZ A;  3HOZ B;  3L0O A;  1TQO A;  4FXD A;  3S2H H;  2GN5 A;  5C3W A;  1WFQ A;  3OHX C;  4GOP B;  1CQV A;  3T1H Q;  1FNU A;  3TN2 A;  2ATW A;  3GTG H;  1H95 A;  2A19 A;  1PV4 A;  4L8J A;  1Y1W H;  2A68 D;  1CSQ A;  1A6X A;  1J5E L;  1H9K A;  1D7Q A;  1SMY C;  1PTO H;  4RHR A;  3ULP A;  1QCB D;  2JE6 I;  3H91 A;  4EQN A;  1X3F A;  5M3F G;  5CBA E;  3B6Y A;  2SNS A;  1D2B A;  4UAI A;  3I72 A;  3CD6 A;  5BN3 A;  2K14 A;  1SLJ A;  4IFD G;  2LFN A;  3GTJ H;  2SDF A;  3M3Y B;  3I4N G;  2H1E A;  1NR2 A;  3R3O A;  3S2D B;  4LUV A;  3SK4 A;  4UDU C;  1N8R C;  3H3V C;  2Y0S E;  1FNW A;  4OXP A;  2A6H D;  3DWP A;  1CFM A;  3K0X A;  2VW9 A;  4KI0 A;  5AFW A;  2GVB A;  1LM0 A;  2HHH L;  4DXG A;  1YI2 A;  4DR3 Q;  3NHH A;  2M2L A;  3S2D H;  1LLR D;  2K5H A;  4ILW A;  3ITP A;  2VB2 X;  3KLR A;  5FO7 B;  3RZD H;  1XMO Q;  3SDZ A;  1B3A A;  3C46 A;  2KCT A;  3QWN A;  3S1Q H;  5M5Y H;  2NVX B;  3KF8 B;  4CBV A;  3F2D A;  4V0B A;  2JA6 B;  1X55 A;  2CQA A;  1O7I A;  3H15 A;  3EN2 A;  3AMU A;  2UUC L;  1B8A A;  1HHV A;  4CJ2 C;  3F2U A;  4L5S A;  4B3R Q;  2AQ2 B;  1FL0 A;  2E2J H;  4LFA L;  2PW5 A;  2CW0 C;  5GAE C;  1EL0 A;  1VDZ A;  3HEJ A;  3T13 A;  2O4X A;  4CKB A;  4Q0F A;  2YV5 A;  1C9O A;  2B63 G;  1GHJ A;  1EOV A;  3ERQ A;  2XWJ B;  4GKJ L;  4G7Z C;  1KIX A;  3HOW B;  2PCF B;  3LNN A;  5C3E H;  1RIP A;  3P20 A;  3PSI A;  1Q7Y C;  3QIA A;  1KRS A;  4UPA A;  3FHW A;  3V05 A;  1NR4 A;  1Y1V B;  2B2W A;  3W3A A;  4ZUJ A;  1HJP A;  2JP1 A;  2VS1 A;  3K7A H;  1Q86 C;  1PTO F;  4ME3 A;  1SFO B;  4OWT B;  3CCJ A;  1K28 A;  1B70 B;  3RZO B;  1HTP A;  4R4Q A;  4NB3 A;  4A3M B;  3NTI A;  1SE3 A;  2EQS A;  5GQO A;  4A3E B;  5KNC A;  2UUC Q;  5IYC H;  1F2L A;  3GTL B;  4GLX A;  4XDX A;  1EYD A;  4LFC L;  5M3M H;  3KDF A;  3EFX D;  1QJO A;  3K5O A;  1X3Q A;  1K0R A;  1I3Q H;  4A3D G;  3DM3 A;  4PG3 A;  2ENB A;  1X6O A;  3MZ5 A;  3C2P A;  3OMG A;  2G9D A;  4OEL B;  4X6A H;  3ZYY X;  1SE2 A;  4GOP A;  1C0A A;  2RSN A;  4EGV A;  3R2T A;  3HP3 A;  1VMC A;  2ZXO A;  2F0T A;  2IHF A;  4P72 A;  2QEX A;  4EQP A;  2K1B A;  3DXJ C;  5E4X A;  3CF5 A;  1AEX A;  2BCO A;  4HN7 A;  1VQA A;  2BH8 A;  3DMU A;  4PZ6 A;  2KOL A;  1CT1 D;  4HCS A;  5K36 H;  1PTO B;  4HJ9 A;  3NE5 B;  1KAA A;  2R7Z B;  4DR5 L;  1LT5 D;  3S14 B;  5CV5 A;  3QOJ A;  4UHV A;  2EZV A;  2Z0S A;  4A3I G;  1S5D D;  1IL8 A;  2K5V A;  4R8I A;  1Z47 A;  1NMG A;  5JJI A;  5FKA C;  3UDX A;  4DV0 L;  3GTP B;  2D2C C;  1GM5 A;  3CME A;  3IAY A;  5BR8 L;  1TS3 A;  5CV9 A;  4CDE C;  2L15 A;  1DM0 B;  4ZYS A;  2QF7 A;  3S16 H;  3E5S A;  5E3F A;  3CXC A;  4N8F A;  1XWE A;  3S1R B;  5EBC A;  1LTS D;  1WCM B;  2EY6 A;  2C5C A;  2JA9 A;  5KYI A;  1EYG A;  3TP6 A;  4B3R L;  1PTO D;  2WII B;  1GHK A;  2MO0 A;  1FNV A;  1ENC A;  2YYZ A;  3SVM A;  3QG1 A;  2F0F A;  3CCU A;  1WYD A;  4RGT A;  3HFZ B;  1IYJ B;  3I4O A;  1CKN B;  2Z6K C;  2MP1 A;  4LF6 Q;  4OIK A;  3GTJ B;  1MHW C;  4FYD A;  1MJC A;  1AW7 A;  5FLM H;  1I4R A;  1EZ6 A;  1KNA A;  1RTN A;  1YNJ C;  1QZG A;  2KHS A;  2PO4 A;  1HNX Q;  5IYC G;  5I2X A;  2RKS A;  4BY7 B;  1NSN S;  1LUZ A;  2NWG A;  1CKM A;  3VR5 A;  1YNX A;  2EJM A;  3X3N A;  1WCM H;  2VUM H;  4TQU S;  1QVG A;  1BQQ T;  1Q12 A;  4H0L C;  4A3J B;  1A3V A;  2XGT A;  1VQ7 A;  4X3T A;  1YNN D;  3HG9 A;  1VQL A;  3F2C A;  2A69 C;  4IJH A;  1SRU A;  3AFP A;  2ZTD A;  1VQC A;  2UXC L;  3D6C A;  1QOH A;  5E7N A;  1IW7 C;  1PH1 A;  3HKS A;  4E6I A;  2A73 B;  2PI2 A;  3Q8D A;  3GTL H;  2N8N A;  3MXP A;  2XTI A;  2EYF A;  4IAL A;  2UXD L;  5KEE A;  5EAY A;  2HDM A;  1UAP A;  4RKL A;  2Z9H A;  3VR4 A;  4EQ5 A;  4KY5 A;  1PHJ A;  4A3B G;  1RHP A;  1SNP A;  1EIH A;  2B2Y A;  1IYU A;  4ABN A;  2YTY A;  4XT3 B;  3I91 A;  1HUN A;  3A8J E;  3AU7 A;  1A2U A;  1IBL L;  4MTN A;  2NN6 G;  1BVS A;  1Q81 C;  1S5E D;  4DV3 L;  4MTK A;  3S1N H;  1O7Y A;  2LXK A;  4DK6 C;  1I4G A;  1PDQ A;  4DK3 C;  4Q5V A;  2Q2U A;  1L0W A;  1MD2 D;  2EJG C;  3Q0A A;  1SMY D;  5IP7 H;  3GTK B;  4DR4 L;  1P16 A;  2D0P A;  1I5F A;  5G3L D;  3Q6S A;  4JV5 L;  1SXT A;  3HOY B;  4B3M Q;  2KEC A;  5I6Y A;  3KJP A;  4FXK C;  1XMQ Q;  4KKS A;  1ZYR D;  3GP7 A;  2CCZ A;  1HPC A;  1B7Y B;  3A7L A;  3I7F A;  1BBW A;  4HR7 B;  3J81 E;  4PQX A;  2RA4 A;  4JI6 Q;  3T51 B;  4IJL A;  1VQM A;  2DGY A;  2NBF A;  3AQQ A;  2JSO A;  5EKK A;  4QMG A;  5JAV A;  1RL2 A;  4BY1 G;  4L63 B;  2JA8 B;  2F03 A;  5G3L F;  3J81 i;  4LW1 A;  2LY7 A;  5M5Y B;  3UDI A;  4XYO A;  4RFB A;  4DR7 Q;  2R6G A;  2UU9 Q;  4DU9 A;  2K01 A;  3PO2 H;  1B4O A;  1GUT A;  4UP7 A;  4JI4 Q;  4DAV A;  3S24 A;  1Y8P B;  3ERS X;  2EVB A;  5E1F A;  2CWP A;  1JJG A;  3TP8 A;  1AZQ A;  3M7N A;  4TKO B;  3VR2 A;  2Z6B A;  4A3D B;  1WTQ A;  4JI4 L;  2IX1 A;  2Z8L A;  2RCF A;  2HUG A;  1TY2 A;  4QUC A;  3D31 A;  5IIF A;  3P7J A;  2F1M A;  2IW3 A;  1WVL A;  3CU7 A;  1I4Q A;  1E2Z A;  4IUU A;  2K75 A;  1ZKO A;  1J9O A;  2AWN A;  2QW7 A;  2Z1C A;  2NVX H;  1JIC A;  4QB4 A;  2B8G A;  1K8O A;  1LTA D;  4NW2 A;  2PNR C;  4FF3 A;  1H9S B;  4WFN 3;  2FMC A;  3OTO L;  1KHI A;  1VQ6 A;  4IO9 A;  1EQQ A;  2F0K A;  2PQA A;  3ZJY C;  1KDB A;  3BDC A;  3N52 A;  2G9H D;  4ODG A;  4A93 B;  3RN5 A;  1IBL Q;  1VMP A;  1PTO C;  4O2D A;  1UE6 A;  1OXX K;  4K0K L;  4XT1 B;  3CCE A;  2AUJ D;  5I9O A;  5M5X B;  4LF7 Q;  1XNQ L;  2F0L A;  4IPH A;  3IKJ A;  4F7X A;  2NVQ H;  1DZ1 A;  1OXV A;  4DAP A;  2EXD A;  5CV6 A;  3IFT A;  4OX9 Q;  1FJG Q;  1N33 Q;  1I50 B;  4J1M A;  5M5X H;  1SNQ A;  2A1A A;  3A56 A;  4A3F H;  3MEF A;  3WDN A;  1CHP D;  1PFB A;  3CC2 A;  2E5L Q;  1TS4 A;  1PH4 A;  1PH2 A;  2JA8 H;  1VQ8 A;  2UXB L;  4GN4 B;  5FK9 C;  3G71 A;  3KF8 A;  1KNE A;  1PXU A;  2WP8 J;  4JVZ A;  4DV1 Q;  4DV5 Q;  2LS0 1;  4KJN A;  5BN5 A;  3NWS A;  1I4H A;  1IBM L;  2JA6 G;  2F0S A;  1OO9 B;  5DM6 3;  3L3O C;  2C35 B;  3DM1 A;  2XRQ D;  4A3L H;  1DD2 A;  3I8Z A;  1DXM A;  3CKI B;  3GO5 A;  1VQE A;  2HHH Q;  4O42 A;  5IT9 c;  4V19 0;  3W5O A;  5M5W H;  3C1F A;  1ONL A;  4C3H H;  3VYS A;  1XNR L;  3GD7 A;  1G6P A;  4XIG S;  4UP9 A;  3OWF A;  3CCS A;  4GKK Q;  1A0I A;  1XPO A;  5LL6 X;  5M3F H;  2AQ1 B;  2VQE L;  4PMB A;  2RHQ B;  2HT1 A;  3GTM H;  2HQL A;  4DN4 M;  5FOB B;  3KBG A;  1FVI A;  4FXG C;  1NNX A;  5FO8 B;  5C44 H;  1WCM G;  3ND9 A;  1JQY D;  4DK1 A;  3E9I A;  1J6Q A;  4R4T A;  1TXY A;  1SN8 A;  1TWF H;  1JJ2 A;  1AFP A;  4IFD J;  4Y52 H;  4IPC A;  2A6E C;  2L5T A;  4X64 L;  1TWF B;  1JOO A;  1S4Z A;  3PO2 B;  4FVM A;  1GJX A;  1I94 Q;  5ELF A;  2X6G A;  3OW2 A;  1STG A;  4YCV A;  5EKI A;  4X62 L;  3HOZ G;  1U4R A;  2CKZ B;  4X65 L;  3NQI A;  1GVP A;  1XMO L;  2B2Y C;  3G6E A;  4HMI A;  1GOZ A;  1ICW A;  4GN3 B;  2NVY H;  3K7A B;  3JAM E;  4KTA A;  4C56 C;  2N88 A;  2QDL A;  1LT6 D;  2NVY B;  1QG7 A;  3BZK A;  4PMC A;  4C3I G;  4GS3 A;  1T5X D;  3RZD B;  1N9W A;  4DV4 Q;  1K8G A;  5A2Q L;  2F0E A;  2CW0 D;  1PFN A;  3CC7 A;  2PI2 E;  4AIM A;  2M00 A;  1SEB D;  1KC8 C;  1OXT A;  5EQ0 A;  3WOE A;  2SEB D;  3NBH B;  1KLU D;  1U4P A;  3CHB D;  5IGD A;  1TVX A;  4R4I A;  1GUO A;  4QF4 A;  1V43 A;  4Y7N B;  5KIX A;  1K0S A;  5KYL A;  1EFI D;  1LTB D;  3NEM A;  3QB3 A;  3KOJ A;  4LF8 L;  3HOU H;  1FJG L;  1QNK A;  2VXW A;  1YZ6 A;  1LT4 D;  4R4C A;  3J7A F;  3OWE B;  1STA A;  1NJI C;  1YHA A;  3PIP A;  3GTO H;  4I7Z C;  1STN A;  2VUM B;  2FMM A;  1F2M A;  1BDO A;  3SHL A;  4H02 A;  2NB0 A;  2B29 A;  1RTO A;  3S17 B;  1YVC A;  2EYH A;  1DGS A;  3Q22 A;  2RVL A;  4HAE A;  5JEA H;  3K5L A;  3PUZ A;  2L9H A;  1B1Z A;  1PLF A;  4K2K A;  1QVF A;  3D8G A;  2DJF C;  3MAQ A;  2I5M X;  3H6M A;  5C3X A;  3EIV A;  5EPL A;  1L1O B;  3U50 C;  5C4X G;  1ZYR C;  4G57 A;  3HOW G;  4LF5 L;  4JBK A;  5C3E G;  3K80 C;  1YJW A;  4AQY Q;  1Z9F A;  2V4D A;  3NPP A;  1VQH A;  3NQT A;  2B2V C;  5KGU A;  5M9O A;  3KK7 A;  4JI0 L;  4PZ8 A;  4C3J G;  1BKB A;  1E1T A;  1VQ9 A;  2PZU A;  1JWM D;  3I73 A;  4KHV A;  3JAM i;  4BBR H;  5JJK A;  3TZD A;  1MJE A;  1SNC A;  2KHJ A;  5T1G A;  1SMX A;  3WOF A;  2B3G A;  1Q46 A;  2NN6 I;  1PH9 A;  1E2V A;  1R9T B;  4JBM A;  1YJN A;  1ENF A;  2LXJ A;  5A35 A;  1R4P B;  1SE8 A;  4U67 3;  4G7H C;  3F2B A;  2L0C A;  1X3G A;  2RDF A;  5C6A A;  4GKJ Q;  3DEP A;  1P8L A;  2F3I A;  2FXQ A;  1MI2 A;  1RKN A;  2BE5 C;  1JT8 A;  2OXP A;  1CHQ D;  4BA1 I;  3KLS A;  5COR A;  4AYB G;  3PV0 A;  3M9B A;  1B53 A;  3J81 j;  3U58 A;  1KD1 C;  2R92 B;  3MEH A;  3BZC A;  2K5N A;  3BYT B;  1ZEQ X;  4JI8 Q;  3BVG A;  1HH2 P;  4LF5 Q;  1ENA A;  3HKZ G;  1Q8K A;  4C1N K;  4OL7 A;  2GA4 B;  2EYJ A;  4IUR A;  2QDB A;  1WI5 A;  4HTH A;  3W1G A;  4H13 C;  5D3D A;  3STB D;  3C3L A;  3CRK C;  1V1Q A;  2I46 A;  1EU4 A;  3J80 L;  3VYR A;  1DJR D;  4XQN A;  2UUA Q;  1K3B C;  1MIU A;  2ZM6 Q;  5LMU L;  4MN3 A;  4PMW A;  1B2T A;  3V2T A;  2J4X A;  4MZ9 A;  4LUZ A;  1XJV A;  1TWC B;  5CV8 A;  1A3T A;  3FKI G;  3PUX A;  1HNW L;  4FF2 A;  4QJF A;  3OYY A;  1N34 Q;  4CDD C;  2A5H A;  4DR2 Q;  1QIL A;  1FR3 A;  4TVA B;  1F9P A;  1A3U A;  4Z9C B;  2NVT H;  1CKN A;  4B9W A;  3G4S A;  4IUQ A;  3HOV B;  3PGZ A;  2PQE A;  3K0Y A;  2R7F A;  1HNZ Q;  1B3Q A;  1SR3 A;  4HJ8 A;  2B63 H;  2NVT B;  4A3G H;  4JI1 L;  2LKV A;  2N49 A;  1N33 L;  2RF4 A;  1TWH B;  4CGY B;  3OMC A;  2XSC A;  3H09 A;  5M3M B;  3UE1 A;  3A0J A;  1PH6 A;  1N36 L;  5LMU Q;  2B2U C;  3G7L A;  2ASB A;  4GN5 A;  4DV7 Q;  3E9H A;  2WFW A;  5ELD A;  2K05 A;  3Q24 A;  4OON A;  4NXM Q;  4IPD A;  5FLX L;  5C0X H;  3K5N A;  2SNM A;  5JPM C;  4DUY L;  1KLG D;  4LK1 C;  2P5Z X;  4K6D A;  3H94 A;  3M4O B;  4EX5 A;  2NTT A;  4IUT A;  1YNN C;  3PUY A;  2ICE C;  1TR5 A;  1Z7T A;  5C4J H;  2NYZ D;  4YY3 L;  3Q23 A;  5GAD C;  4IUV A;  4YWK A;  4DF7 A;  4PNY A;  1N32 L;  4A3C H;  1W6J A;  5DLQ E;  2J0T D;  2PYK A;  3J7Y W;  4BBS B;  1F2Z A;  3DWQ A;  1EIG A;  4C2M B;  4HID A;  4JI3 Q;  3J80 E;  4LJZ C;  1G2S A;  1PRT F;  3EQL C;  4NMZ A;  1C4Q A;  3NTK A;  2CFM A;  2A6E D;  3HZX A;  3TRZ A;  4LF9 Q;  3S9W A;  1ESF A;  1SE4 A;  3JC6 6;  4RGN A;  1VQJ A;  2C9O A;  3L7Z C;  2PMZ B;  3MFY A;  5K36 G;  1NTG A;  1IXR A;  4APV A;  1YHB A;  2KCM A;  4X62 Q;  2YTV A;  3DEO A;  2F4V L;  4BBR B;  3S1Q B;  2PPB C;  2IX3 A;  4XXE A;  1U4M A;  4B3T L;  5DM7 3;  1PRT D;  4LMQ D;  1B9M A;  2UXB Q;  1G29 1;  1QVC A;  4YY3 Q;  1JWS D;  1L0X B;  4NXN L;  3SK5 A;  4DA2 A;  5EGT A;  1VQF A;  1Q82 C;  1HFG A;  4KHZ A;  3HOU G;  4LFC Q;  1ZXT A;  3WWV A;  1YEZ A;  1JOK A;  3N6R A;  1MSH A;  3MFG A;  4LFB L;  1GXD C;  1SYB A;  1GD7 A;  2LMC B;  1EUJ A;  2R61 A;  3ERO A;  3BDL A;  4C3H G;  2NUC A;  2EXZ A;  2K5Q A;  4RKB A;  1EFW A;  3OOC A;  4TSS A;  3QJY A;  5FJ8 G;  1L0Y B;  1AE3 A;  2FHT A;  5DAU A;  3RD4 A;  3PF4 A;  1S3O A;  3GTK H;  2K6A A;  1SYE A;  3NEN A;  3HOV H;  1PH5 A;  4Y7N H;  5GAH C;  4CDF C;  5CGK A;  1EY4 A;  1I3Q B;  4OO1 I;  1BXT A;  1SDF A;  1Y69 U;  5C5M A;  2L12 A;  2BA1 A;  2R7D A;  3L9A X;  1I4X A;  4PV1 C;  3FP9 A;  2HIX A;  4DV2 L;  3CRL C;  2E5L L;  1BR9 A;  5TSS A;  2Q8T A;  4ZKC B;  1SAP A;  1IBK Q;  1S5B D;  1D8L A;  1EZ8 A;  4KJO A;  5CC4 A;  3RZO H;  1WTX A;  1HRJ A;  2HQE A;  4DUZ Q;  3KFU A;  4LF7 L;  2F0M A;  2OF1 A;  2ZJQ A;  4R8N A;  1VCI A;  4C3H B;  1F9Q A;  1C8C A;  2L55 A;  1QE6 A;  5J39 A;  4HIM A;  3KLS X;  1M90 C;  3S1M B;  1M4V A;  4JW0 A;  3SXH A;  1U0L A;  1F2Y A;  4GNX B;  1H9M A;  2DY7 A;  4L6T B;  1BNZ A;  3H0G H;  5I6W A;  3I4M H;  4CHT B;  3HOX G;  2YTX A;  1IKL A;  5CBE E;  2UUB Q;  2Z6K A;  1O78 A;  1YBY A;  1WTH A;  2K50 A;  2JK8 A;  4LF9 L;  1CK1 A;  1X54 A;  3TQY A;  3VR6 A;  4AH6 A;  4A3J G;  1A8V A;  1PYB A;  2ZT9 C;  2KED A;  4FDB A;  4ME5 A;  1TS5 A;  3FEW X;  3NWT A;  3VYT A;  2JA8 G;  3KBX A;  2N55 A;  1STH A;  1PRT C;  4YCU A;  3D4R A;  4JBW A;  4BXX G; 
#chains in the Genus database with same CATH homology
 3J7A 5;  3CC2 A;  2E5L Q;  1GO3 E;  1VQK A;  2BA0 A;  4DV7 L;  1PH2 A;  1PH4 A;  4OO1 G;  5HGQ A;  2JA8 H;  5JEA G;  5LMN L;  1VQ8 A;  3CC4 A;  1C7Y A;  2UXB L;  1NE3 A;  1L1O A;  4RG1 A;  4X64 Q;  1VQG A;  4GN4 B;  4A3F G;  3G71 A;  1X65 A;  4OX9 L;  3AYH B;  2JQO A;  2WP8 J;  4LF4 Q;  4L5Q A;  4DV1 Q;  4DV5 Q;  5C4X H;  3HKZ E;  2N3S A;  1OTC A;  2OCE A;  3RLO A;  3PO3 G;  3I56 A;  2UUA L;  1TWG H;  4R4O A;  1IBM L;  2JA6 G;  2WB1 E;  3IRB A;  1PA6 A;  4BA2 I;  3SGI A;  2C35 B;  3BU2 A;  4OWX B;  4BY1 H;  2UXC Q;  2MFI A;  4A3L H;  3M4P A;  3GO5 A;  1VQB A;  4YWM A;  4B3S L;  1VQE A;  2WB1 G;  2HHH Q;  4K0K Q;  5IT9 c;  3W5O A;  2VY3 A;  5M5W H;  3CCM A;  2GVA A;  3T1Y Q;  1JMC A;  1Y1W G;  4JI7 L;  5IYD H;  3L0O A;  4C3H H;  1XNR L;  2PQA B;  4OWW B;  3GD7 A;  1G6P A;  1VQD A;  4UP9 A;  4XIG S;  3CCS A;  3S2H H;  1A0I A;  2GN5 A;  2N78 A;  1Y14 B;  4JI2 L;  1WFQ A;  2RHS B;  4DR2 L;  4GOP B;  1XPO A;  3T1H Q;  2ATW A;  5M3F H;  3GTG H;  5FJ8 H;  2VQE L;  2A19 A;  1PV4 A;  3HOW H;  1I50 H;  1H95 A;  2RHQ B;  2HT1 A;  1Y1W H;  3GTM H;  2HQL A;  1CSQ A;  1J5E L;  5C44 H;  1FVI A;  1D7Q A;  4C2M H;  1WCM G;  3ULP A;  3E9I A;  1J6Q A;  4JI7 Q;  4R4T A;  2JE6 I;  1TXY A;  1SN8 A;  1TWF H;  1X3F A;  1JJ2 A;  4IFD J;  4Y52 H;  4IPC A;  1CUK A;  4C3J H;  5M3F G;  4A93 G;  3KYH C;  4X64 L;  2I5H A;  3B6Y A;  4RMF A;  3RLN A;  2WAQ G;  1I94 Q;  1VQP A;  1HNZ L;  3TS0 A;  2R93 G;  3T1H L;  3CD6 A;  1IZ6 A;  3OW2 A;  2K14 A;  1SLJ A;  5M3M G;  2VQE Q;  4YCV A;  4IFD G;  3GTJ H;  4X62 L;  3HOZ G;  4P75 A;  3CPF A;  2CKZ B;  2K4K A;  4X65 L;  4XTC S;  1VQI A;  3I4N G;  3RR5 A;  4DPG A;  1GVP A;  4LUV A;  1XMO L;  1N8R C;  1UEB A;  2Y0S E;  3G6E A;  4OXP A;  3M4O H;  4GN3 B;  2NVY H;  3K0X A;  2VW9 A;  4KI0 A;  3H0G G;  3A74 A;  1YHQ A;  2GVB A;  1LM0 A;  2HHH L;  1Q1B A;  3PF5 A;  3TRE A;  4JI6 L;  3BZK A;  1L1O C;  1YI2 A;  4GS3 A;  1S72 A;  4DR3 Q;  3S2D H;  4X66 Q;  3PUW A;  2K5H A;  4BY7 G;  1N9W A;  4DV4 Q;  3RZD H;  1XMO Q;  2KHI A;  1K8G A;  3CCL A;  4DAM A;  3CCV A;  2KCT A;  3S1Q H;  5M5Y H;  2K52 A;  2PI2 E;  2ALY B;  4AIM A;  4LFA Q;  2QGQ A;  3KF8 B;  3CC7 A;  4JI5 Q;  3G48 A;  3F2D A;  1KC8 C;  1OXT A;  3HOY H;  1AE2 A;  3J81 c;  1X55 A;  3NBH B;  4JG2 A;  1ASZ A;  4A3M G;  1XNQ Q;  4R4I A;  1O7I A;  1V43 A;  2IX0 A;  2IT1 A;  1HNW Q;  3H15 A;  5AJ3 Q;  3NEM A;  4UP8 A;  3EN2 A;  3KOJ A;  2H5X A;  5GRO A;  2UUC L;  1B8A A;  4LF8 L;  3HOU H;  4L5S A;  1FJG L;  4B3R Q;  1FL0 A;  1YZ6 A;  4R4C A;  4POG A;  1Y1V G;  4JI5 L;  2E2J H;  4LFA L;  2R7Z H;  1NJI C;  1YHA A;  5GAE C;  3PIP A;  3GTO H;  1HZB A;  2I5L X;  4H02 A;  2B29 A;  4UY8 C;  4NPS A;  5IP9 G;  3KF6 A;  2YV5 A;  1C9O A;  2B63 G;  2R7Z G;  1EOV A;  2MO1 A;  4HJA A;  1YVC A;  2VNU D;  4R1J A;  1DGS A;  4GKJ L;  3PUZ A;  1KIX A;  4LF4 L;  4LWC A;  1RIP A;  3PSI A;  5C3E H;  3J80 c;  3CPW A;  5IWA L;  4LNQ A;  1QVF A;  2R92 G;  1KRT A;  4HIK A;  2I5M X;  1Q7Y C;  4JV5 Q;  1KRS A;  3E0E A;  4UPA A;  4DV4 L;  4B3M L;  3EIV A;  2F52 A;  1L1O B;  3FHW A;  3U50 C;  1QUQ B;  4JI8 L;  5C4X G;  4GNX A;  4DV6 L;  3HOW G;  3PIO A;  4IFD I;  1HJP A;  2E2I H;  4JBK A;  2VS1 A;  3K7A H;  4LF5 L;  1Q86 C;  2JA6 H;  5C3E G;  4ME3 A;  4KLK A;  1HZA A;  1Q1E A;  4B3T Q;  3K80 C;  1YJW A;  4OWT B;  3CCJ A;  4AQY Q;  1BBU A;  1Z9F A;  1B70 B;  1VQH A;  4R4Q A;  4NB3 A;  1VQN A;  1XTD A;  4JI0 L;  2EQS A;  5GQO A;  3ULJ A;  4PZ8 A;  3S14 H;  1BKB A;  1E1T A;  2JEA I;  1VQ9 A;  3JAM i;  2UUC Q;  1JE5 A;  5IYC H;  4BBR H;  3RN2 A;  4YHH Q;  5JJK A;  4GLX A;  4LF8 Q;  2ZTE A;  2MNA A;  3J7Z C;  4LFC L;  5M3M H;  1MJE A;  2ZJP A;  3KDF A;  3W1B A;  2KHJ A;  5BR8 Q;  4DR1 L;  1K0R A;  1SMX A;  2UUB L;  1I3Q H;  2B3G A;  1Q46 A;  2NN6 I;  1K73 C;  1PH9 A;  3DM3 A;  4AQY L;  4A3D G;  4PG3 A;  1UWV A;  5C0X G;  1X6O A;  4JBM A;  4BBR G;  1YJN A;  1NMF A;  1X3E A;  2LXJ A;  4X6A H;  3CP0 A;  3I55 A;  3M85 A;  4JI0 Q;  1XPU A;  4GOP A;  1C0A A;  1XPR A;  1SE8 A;  2OQ0 A;  3PCO B;  5ELO A;  1X3G A;  3F2B A;  1I94 L;  1S40 A;  4P72 A;  2IHF A;  2QEX A;  1JB7 A;  4GKJ Q;  1P8L A;  2F3I A;  2MQH A;  2FXQ A;  3MXN B;  1QZH A;  1JT8 A;  3D0F A;  4BA1 I;  1EQR A;  3CF5 A;  4AYB G;  3PV0 A;  3M9B A;  3J81 j;  3U58 A;  1KD1 C;  1VQA A;  2BH8 A;  3BZC A;  2K5N A;  4PZ6 A;  4JI8 Q;  1EWI A;  1HH2 P;  3STB C;  4LF5 Q;  4HJ9 A;  3HKZ G;  2JJQ A;  1Q8K A;  2D62 A;  5C0X J;  1NBW A;  3H3V I;  4DR5 L;  4A3E H;  1PYS B;  1WI5 A;  4DR3 L;  2VZA A;  5FLX c;  4A3M H;  3W1G A;  2E2H H;  2Z0S A;  1CKO A;  3STB D;  4DAY B;  4DV1 L;  4A3I G;  1YJ9 A;  2K5V A;  4IOA A;  1V1Q A;  1Z47 A;  1SFO H;  4C3I H;  4QGU A;  1NMG A;  1OXU A;  4QQB X;  2I0Q A;  2UUA Q;  5JJI A;  2ZJR A;  1MIU A;  5J3B A;  4YHH L;  5JJL A;  3GDE A;  2ZM6 Q;  3UDX A;  5LMU L;  4DV0 L;  1Y1V H;  4PMW A;  1FGU A;  1GM5 A;  3CME A;  2RCN A;  2CWA A;  5BR8 L;  4MZ9 A;  2L15 A;  1E24 A;  4LUZ A;  1XJV A;  2KBN A;  3M3Y H;  3S16 H;  4LUO A;  2WAQ E;  3FKI G;  3CXC A;  3PUX A;  4QL5 A;  1XNR Q;  3GTQ H;  1HNW L;  3KLW A;  4QJF A;  5AJ3 L;  1UE1 A;  3OYY A;  2Q2T A;  1N34 Q;  1MKH A;  2JA9 A;  3ULL A;  1EYG A;  4DR2 Q;  4IOC A;  1EIY B;  4B3R L;  2ZM6 L;  2AKW B;  2MO0 A;  4WJ4 A;  2JA7 G;  4TVA B;  4JI1 Q;  3K8A A;  3TS2 A;  1OXS C;  4ALP A;  2YYZ A;  2NVT H;  5ELN A;  3A5U A;  4IPG A;  3CCU A;  1WYD A;  3RNU A;  1CKN A;  1QUQ A;  3HFZ B;  4DKA C;  3G4S A;  1IYJ B;  3I4O A;  1CKN B;  2V1C C;  2Z6K C;  5IYD G;  1YIT A;  3PGZ A;  4LF6 Q;  2JA7 H;  1AH9 A;  3CMA A;  2KEN A;  2R7F A;  1HNZ Q;  1SR3 A;  4HJ8 A;  1MJC A;  5FLM H;  1IL2 A;  5HY6 A;  2B63 H;  2OTJ A;  4A3G H;  4JI1 L;  2N49 A;  3S17 H;  1N33 L;  4HIO A;  2RF4 A;  3A5Z B;  3HOV G;  1QZG A;  2AMC B;  4DUY Q;  1HR0 L;  3KF6 B;  1HNX Q;  5IYC G;  1WOC A;  2VL6 A;  2R92 H;  1E3P A;  3UE1 A;  1LUZ A;  3A0J A;  1CKM A;  1PH6 A;  1N36 L;  1YNX A;  5LMU Q;  4DV0 Q;  1WCM H;  2ASB A;  2VUM H;  1VS0 A;  4TQU S;  1QVG A;  4GN5 A;  4DV7 Q;  3PO2 G;  1HR0 W;  3E9H A;  1PVO A;  2WFW A;  3BJU A;  1Q12 A;  4A93 H;  4OON A;  2XGT A;  4JOI A;  4IPD A;  4X66 L;  4NXM Q;  4BBS G;  1VQ7 A;  1JJC B;  4DR4 Q;  2NZO A;  1KXL A;  3S1M H;  1YIJ A;  2ZTC A;  1N34 L;  4DUY L;  1HR0 Q;  1E22 A;  1HNX L;  1VQL A;  4DV2 Q;  4HJ7 A;  3F2C A;  1N36 Q;  4IJH A;  3AFQ A;  1SRU A;  3AFP A;  4EX5 A;  2ZTD A;  3PUY A;  1VQC A;  1G51 A;  2UXC L;  5E7N A;  1PH1 A;  3F8T A;  3HKS A;  4QY7 A;  5IYB H;  2PI2 A;  3Q8D A;  4YY3 L;  5C4J H;  4NXN Q;  1SRO A;  2N8N A;  4L5T A;  4P74 A;  4DUZ L;  1PH8 A;  3GTL H;  2XTI A;  2Q2I A;  3NEL A;  5GAD C;  4YWK A;  2VQF L;  2UXD L;  4A4I A;  1E1O A;  4A3C H;  1N32 L;  5EAY A;  1PHJ A;  4EQ5 A;  5DLQ E;  1VQO A;  2IY5 B;  4A3B G;  1EIF A;  4BY7 H;  3M4Q A;  2R93 H;  4J15 A;  4DR6 Q;  1UE5 A;  2YTY A;  5IYB G;  4GKK L;  4A3I H;  4HID A;  2QA4 A;  1IBL L;  4JI3 Q;  3I4N H;  4MTN A;  5IY0 A;  2NN6 G;  5IP7 G;  1BVS A;  3UDG A;  1Q81 C;  1PH3 A;  1XMQ L;  4DV3 L;  2F4V Q;  4A3B H;  1J5E Q;  3S1N H;  2CFM A;  2LXK A;  4DK6 C;  3UE0 A;  4JCV E;  2VQF Q;  2UXD Q;  3CW2 C;  3TRZ A;  1UE7 A;  3UDF A;  4DK3 C;  4LF9 Q;  1ASY A;  3CAM A;  2Y0S G;  2Q2H A;  2HIV A;  2Q2U A;  2IHE A;  1L0W A;  3JC6 6;  3H3V H;  1VQJ A;  3L7Z C;  5IP7 H;  3U4Z A;  5K36 G;  3FKI H;  1NTG A;  4DR4 L;  1P16 A;  2D0P A;  4P73 A;  1I5F A;  4BXX H;  4A3E G;  4JI3 L;  1IXR A;  4APV A;  5GAG C;  1YHB A;  2KCM A;  5LMN W;  4JV5 L;  4B3M Q;  2OQK A;  4X62 Q;  3KJP A;  2YTV A;  1XMQ Q;  2F4V L;  4A3K H;  3KDF B;  4DV6 Q;  2CQO A;  1K83 H;  2CCZ A;  4WJ3 M;  3EBE A;  1WJJ A;  1B7Y B;  1CSP A;  3I7F A;  1BBW A;  4B3T L;  1L2F A;  5LMN Q;  2UXB Q;  1G29 1;  1QVC A;  4YY3 Q;  3DLL A;  4NXN L;  4HJ5 A;  1PH7 A;  4JI6 Q;  2PNH A;  1TWC H;  5IE8 A;  4A3K G;  1KQS A;  4IJL A;  1VQM A;  2DGY A;  3AQQ A;  1N32 Q;  1VQF A;  4PZ7 A;  1TWH H;  4L5R C;  1KAW A;  1Q82 C;  4DV5 L;  2JA5 G;  1A63 A;  1RL2 A;  4KHZ A;  1X56 A;  4BY1 G;  3GTP H;  3HOU G;  4DR6 L;  4A3L G;  4LFC Q;  1X9N A;  3WWV A;  1VQ4 A;  1YEZ A;  3JAM c;  3TEH B;  1IBK L;  3J81 i;  4JYA L;  3CCQ A;  1U5K A;  4LW1 A;  1HZ9 A;  4GKK Q;  4LFB L;  3UDI A;  1K3R A;  1GD7 A;  4DNI A;  4YWL A;  5IP9 H;  5C0X I;  4DR7 Q;  1EUJ A;  2R6G A;  1T9H A;  2UU9 Q;  2PMZ E;  2VUM G;  3PO2 H;  1TWA H;  4UP7 A;  4JI4 Q;  1EFW A;  5H1S E;  5FJ8 G;  3PO3 H;  3S24 A;  4BBS H;  1AE3 A;  2EIF A;  3ERS X;  4MNO A;  4JI2 Q;  1S3O A;  4GNX C;  3PF4 A;  3F1Z A;  3GTK H;  4JYA Q;  4LFB Q;  1LYL A;  2CWP A;  3PUV A;  4JBJ A;  5FLM G;  1M1K C;  4KHP Q;  3M7N A;  1JJG A;  4A3G G;  4DR7 L;  2LSS A;  1LTL A;  3NEN A;  2UU9 L;  4A3D H;  3HOV H;  1I6H H;  3CCR A;  2E8G A;  1PH5 A;  4Y7N H;  1W3S A;  5GAH C;  4JI4 L;  2IX1 A;  1KL9 A;  4JOI C;  4DR5 Q;  2ES2 A;  4OO1 I;  3D31 A;  4NXM L;  3J80 i;  3HOZ H;  3LGJ A;  1A62 A;  1R9T H;  2OWO A;  3S15 H;  3OTO Q;  2BA1 A;  1NY4 A;  2R7D A;  4A3C G;  3AEV A;  4YCW A;  2A8V A;  3ICE A;  2K75 A;  3FP9 A;  5IWA Q;  3L2P A;  3K7U C;  1K9M C;  4X65 Q;  2HIX A;  2AWN A;  5C44 G;  4DV2 L;  2NVX H;  2E5L L;  2BH2 A;  3VDY A;  3S1R H;  2DUD A;  1IBK Q;  1D8L A;  2NZH A;  3RZO H;  2OTL A;  3KJO A;  4DUZ Q;  4O0A A;  3KFU A;  3OTO L;  1KHI A;  4LF7 L;  1PFS A;  1VQ6 A;  3I4M G;  1V9P A;  2ZJQ A;  3RLF A;  4IO9 A;  1VCI A;  2AHO B;  2D0O A;  1EQQ A;  2ID0 A;  2PQA A;  5JEA J;  1HZC A;  3ZJY C;  4HIM A;  4GLA C;  1M90 C;  4JC0 A;  1IBM Q;  4GLV B;  1U0L A;  4GNX B;  4A3J H;  3RN5 A;  1IBL Q;  4POF A;  2AWO A;  4O2D A;  1UE6 A;  3H0G H;  3I4M H;  1OXX K;  4AYB E;  4KHP L;  4QIW E;  4B3S Q;  4K0K L;  3HOX G;  1W2B A;  2YTX A;  3CCE A;  4DV3 Q;  4DR1 Q;  2UUB Q;  2YU9 H;  2Z6K A;  1YBY A;  4LF7 Q;  3K81 C;  1XNQ L;  4A75 A;  3T1Y L;  4LF6 L;  4IPH A;  2K50 A;  2JK8 A;  4LF9 L;  1X54 A;  3TQY A;  4AH6 A;  4A3J G;  2NVQ H;  1A8V A;  1K8A C;  1PYB A;  1OXV A;  1VQ5 A;  4FDB A;  1E7Z A;  3ER0 A;  2EXD A;  3HOX H;  4GOP C;  4A76 A;  4OX9 Q;  3I2Z A;  1FJG Q;  2JA8 G;  1N33 Q;  5M5X H;  2JEB I;  2A1A A;  1GKH A;  3CQZ H;  4A3F H;  3MEF A;  4YCU A;  2JA5 H;  3HOY G;  4JBW A;  4P71 A;  3U4V A;  4BXX G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...