5M5XH

Rna polymerase i elongation complex 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
134
Chain Sequence
b'NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Molecular Structures of Transcribing RNA Polymerase I.
pubmed doi rcsb
molecule tags Transcription
total genus 17
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m5xH00
1UE6A 4ME3A 4AYBG 1PVOA 1HNZL 1VQ9A 1VQDA 5JJLA 1Q12A 3S24A 1D7QA 3BJUA 2JEBI 3OYYA 3WWVA 3H3VH 2JEAI 3ULJA 1LYLA 1N32Q 4HJ8A 3OW2A 1Q1EA 4QIWE 4TVAB 5M3FG 4DR7Q 2VQFL 4DV6L 3HOWG 1CKMA 2UU9L 1XNRL 1A0IA 2AWNA 1HZCA 2BH8A 2PQAA 5LMNQ 3JAMc 1VQLA 4Y7NH 3G6EA 3BU2A 1PA6A 1GO3E 4JBJA 1I5FA 1ASZA 3T1YQ 2JA6H 2IT1A 2YTYA 3AEVA 5H1SE 2R7ZG 2RHSB 1QUQB 4PG3A 3KYHC 2JA9A 5IWAL 2OCEA 1KRTA 4OWTB 4JI2Q 1KRSA 1BBUA 1I50H 4LF7L 1SROA 1N34Q 3CCSA 4B3RQ 2IHEA 3M4OH 4PZ6A 1M90C 4DK6C 2WB1E 4AQYL 2UXDQ 3KDFA 4B3TL 1VQIA 4DV2L 2CWPA 2OTJA 1X65A 1VQAA 2WB1G 3L2PA 2E2JH 1HR0Q 3F1ZA 4POGA 4GN5A 4R4CA 1AE3A 3GTQH 1Q7YC 1N9WA 5IYBG 5M3MG 2GN5A 2VUMG 1YHAA 1MJEA 2XTIA 1EFWA 4BBSH 1Y1VG 1YEZA 3OTOL 3KJPA 2ZJPA 1OTCA 2MO0A 3CCLA 1PYBA 3G71A 3RR5A 3CF5A 2F3IA 3T1HQ 4DR6L 1EIFA 1X56A 4LF5L 1Y1WH 3PIOA 3PUZA 5IP7H 3RLOA 1LM0A 1SN8A 3K7AH 4IPCA 4MNOA 3ERSX 1YHQA 1G51A 1PYSB 2N78A 2WFWA 1YITA 1PV4A 4LFCL 3UDGA 2Q2HA 2PNHA 3HOXG 2NZHA 5FJ8G 1OXTA 1NE3A 2BH2A 1SRUA 2VW9A 5IE8A 5FLMH 4A3MH 1U0LA 4GNXC 4R4QA 3J80c 1GKHA 5M5WH 4DR3Q 4IOAA 2CKZB 3FP9A 3S1RH 3KFUA 1VQBA 3FHWA 4HIOA 4L5SA 4P75A 5GAHC 2UXCQ 1XJVA 1IBKL 1XMQQ 1X3FA 1O7IA 4IJLA 1VQFA 5IYDH 4DAMA 4A3KH 4A3EH 4PZ7A 2Y0SE 2ASBA 4LFAL 4GNXA 1VQ5A 3CC4A 4DV3L 3G48A 2PQAB 3RNUA 1IZ6A 1CUKA 4IOCA 5BR8L 3CCVA 1TWAH 4HIMA 1VCIA 2RHQB 1PH5A 1HNZQ 4JV5L 2FXQA 5HY6A 4A3IG 1OXVA 4A3DH 2K52A 3CAMA 3CCJA 4DV0Q 4IPHA 1EIYB 1J5EQ 3L0OA 5C3EH 2VQEL 1UWVA 1E22A 4JI3L 3PUYA 4WJ3M 3GD7A 3GTMH 4QQBX 4LF6Q 3PO2H 3KDFB 1PH9A 4A3CG 2UUAL 2JA7H 3UE0A 4R1JA 2H5XA 4OWWB 3HOUG 1PFSA 5IWAQ 2AMCB 2JQOA 2IHFA 1FJGL 2KHJA 3HOVG 1BKBA 4BA1I 2KENA 1EQRA 2QEXA 1WOCA 4X62L 4L5RC 4DUZL 2VNUD 4A75A 1E3PA 1XPRA 1T9HA 4B3TQ 4DV2Q 1YJWA 4A3BG 4UP9A 4LF4Q 3CCQA 2N3SA 2K75A 3HKZE 2KCMA 4LWCA 2R7ZH 1I3QH 2ZM6Q 4A3LH 2F4VQ 1EUJA 1IBLQ 1ASYA 4JI4Q 2MO1A 5GQOA 3DLLA 5J3BA 3OTOQ 1VQHA 5C4XH 4K0KL 3S14H 2LSSA 2WAQE 1XNQQ 4DR6Q 1M1KC 1VQKA 1VQEA 5LMUL 2I0QA 4LF5Q 1B7YB 2D62A 4WJ4A 1TXYA 2WAQG 1K73C 3J81c 5M5XH 1K9MC 4HIKA 1C0AA 2LXKA 4BY1G 1R9TH 3FKIG 1Q86C 4LFCQ 1IBMQ 4Y52H 4GNXB 5IYBH 4QGUA 4KI0A 5M3MH 2UUBL 3S2DH 2VUMH 5C0XG 1E7ZA 1K3RA 4YWKA 1Y1VH 2ALYB 2A1AA 2QGQA 1JT8A 2ES2A 4DR2L 2CCZA 3HOZG 1K8GA 1YJ9A 5IYCH 4QJFA 2A19A 4LUOA 4OWXB 4HJ9A 3M9BA 3CD6A 3TEHB 4O2DA 2N8NA 1N33L 3I56A 4DR5L 4DV3Q 1HR0W 2KCTA 5ELOA 2R7FA 5BR8Q 2JA5H 1SE8A 2NZOA 3A0JA 3KJOA 4JV5Q 2DUDA 1L2FA 4YWLA 1XMOL 4LF9L 4LFBL 2NN6I 1MIUA 3JAMi 1XPOA 5IY0A 4BXXG 3GTLH 2E5LL 2HHHL 3S2HH 4JCVE 2JJQA 5FLXc 1E1OA 4JOIC 4X6AH 5EAYA 2KHIA 2VQEQ 3L7ZC 5GAEC 3NENA 1IXRA 4TQUS 4LF8Q 1GD7A 2K5HA 2UUAQ 3CPWA 1JB7A 2B29A 3UDIA 1EOVA 4JOIA 4A3IH 2YYZA 1FJGQ 2OQKA 2UXBL 1YVCA 2NVTH 3S1NH 4ALPA 1KC8C 2NVQH 3I55A 1A8VA 1CSPA 1K83H 1WJJA 1D8LA 1JJCB 1OXSC 2NVYH 3GTJH 4NXML 1YZ6A 2MFIA 4QY7A 4A3CH 2Z0SA 4PMWA 4GLXA 4JYAL 1C7YA 1I94L 5AJ3L 1PHJA 3CQZH 2C35B 1IYJB 1WCMG 3PIPA 1TWCH 1WYDA 4GN4B 4IPGA 1I6HH 3HOVH 4BA2I 4EX5A 2R6GA 5LMUQ 1A63A 2GVBA 1YJNA 2JK8A 1Z47A 2VS1A 1VQJA 4DPGA 3CCUA 2VY3A 3TS2A 1NJIC 1QVFA 2UUCL 4A3BH 3K7UC 3K0XA 3I4OA 4IPDA 1G291 3J80i 5IP9H 4YY3Q 2B63G 4JI6L 3ULLA 1CKOA 1Q82C 4DR1L 4J15A 3UDFA 3M7NA 2N49A 3AFQA 3STBC 4X65L 5C0XJ 1LTLA 2BA1A 1HNXL 2ZJRA 1HZBA 3CW2C 2UUBQ 1S40A 4IFDI 2R93G 3EBEA 3PO3G 3KOJA 4O0AA 3PF5A 3BZKA 4DV1L 4B3RL 2MQHA 1X3GA 3TREA 5GADC 3U4VA 2K5NA 4DR2Q 1CSQA 2PI2A 4DV5L 4GKJL 2AWOA 2NN6G 1EQQA 3GTPH 2LXJA 4NB3A 4R4IA 4IJHA 1X3EA 2MNAA 4A4IA 3AFPA 5K36G 4XTCS 1N33Q 3RN2A 2ZTEA 4YHHL 2IX0A 2VQFQ 4DV6Q 2K5VA 3M85A 4DV4L 4GOPC 2UU9Q 2E2HH 1XNRQ 3J7ZC 5C44G 4L5QA 1VQGA 3GTGH 4MZ9A 4JI1L 1XMOQ 2YU9H 4LF9Q 4LFBQ 2RF4A 2KBNA 1YNXA 4JBKA 3UE1A 1VQ7A 4AH6A 1HNWL 3F2CA 5HGQA 4OX9L 2ZTCA 4DR7L 1UE7A 3ICEA 3HOZH 1NMFA 4DR4L 2Z6KC 2R92G 1HH2P 4L5TA 3NBHB 4H02A 4LF7Q 3HOYG 1X6OA 1UEBA 1Z9FA 4AQYQ 5M3FH 3VDYA 4GS3A 4DUYL 3IRBA 3Q8DA 4DK3C 3HOWH 4HJ5A 3B6YA 2I5MX 1Q81C 1UE1A 1EWIA 3GTOH 2CWAA 2Z6KA 2UXBQ 1KXLA 2XGTA 3CCRA 1VQNA 4A93G 4BXXH 3D0FA 1S72A 2VL6A 4JI7L 2RCNA 2UXDL 5IP7G 4A3GG 1V43A 2YV5A 3SGIA 1KD1C 1E24A 4LNQA 1HR0L 1L1OC 1QUQA 4NXMQ 4JYAQ 4C3IH 3CP0A 1I94Q 3K80C 3PGZA 5AJ3Q 1KQSA 3CMEA 1V9PA 3BZCA 1UE5A 4IO9A 1TWFH 3J81i 2IX1A 3S17H 4OO1I 4LW1A 2F52A 1TWHH 4C3HH 4HJAA 2QA4A 3JC66 5LMNW 3RLFA 4IFDG 1PH1A 3HFZB 1VQ8A 2HQLA 3RLNA 2WP8J 1JMCA 1W2BA 1PH6A 1L1OA 1B8AA 4A3FG 1QZHA 4FDBA 2K50A 4PZ8A 1E1TA 5C4JH 5JJIA 3W1BA 4A3EG 2UUCQ 3CC7A 2Q2UA 1SLJA 4NXNL 4JI6Q 1FL0A 3E9HA 2OWOA 3F8TA 4EQ5A 3RZDH 2I5HA 1VQOA 1IBKQ 3I4MG 1C9OA 3PUXA 4GLAC 4X65Q 1HNXQ 3S1MH 1JE5A 1WFQA 3CCEA 1VQPA 4LFAQ 1QVGA 4DV1Q 1TWGH 3DM3A 4JBWA 4POFA 4DV7L 3HOXH 3E9IA 5FJ8H 3EN2A 4APVA 5ELNA 3GDEA 3H3VI 4UPAA 3STBD 4BY7G 4RG1A 3NELA 4HJ7A 3TS0A 3H0GG 3PUVA 1X9NA 4NPSA 2B63H 1QZGA 4YHHQ 3GO5A 2E8GA 4MTNA 2AHOB 4JI3Q 2BA0A 4JI5L 3ZJYC 2CFMA 2R93H 4JI1Q 3PO3H 3CPFA 1HZ9A 4X64L 4JC0A 1MKHA 4A3JG 4DV0L 1HNWQ 3AQQA 1S3OA 4OX9Q 4UY8C 1X55A 4B3SL 1AE2A 1J5EL 1CKNA 3CCMA 4DR4Q 3I4NG 3PF4A 3PUWA 1SR3A 4X62Q 4LF6L 4DUZQ 4KHPL 4P74A 2OQ0A 2I5LX 2ATWA 3M4QA 1SMXA 3MXNB 4KHZA 4DUYQ 4A3LG 1YBYA 1QVCA 3H15A 2PMZE 5C44H 4JBMA 4XIGS 5C4XG 1SFOH 2L15A 2JA8G 4OO1G 1A62A 3TRZA 3HOUH 4JI7Q 2D0OA 2EXDA 4UP8A 4JG2A 1Q1BA 2HIXA 1RIPA 4K0KQ 3UDXA 1L1OB 1GM5A 3GTKH 3KF6A 1X54A 2R92H 3TQYA 4LF4L 3HOYH 1JJGA 1NY4A 3F2BA 4B3ML 2ZM6L 3E0EA 1Q46A 2F4VL 3EIVA 4YCVA 1YI2A 1IBLL 4JI4L 4IFDJ 4HIDA 3U58A 4YCUA 3ULPA 4BBRG 4X66L 3CXCA 1N36L 3AYHB 1XNQL 3A74A 3U4ZA 5GROA 5JEAG 4A93H 2CQOA 4GN3B 2K4KA 5IYCG 1H95A 1FVIA 1Q8KA 3RN5A 4A3GH 3CC2A 4P73A 4NXNQ 3W5OA 5GAGC 3ER0A 1W3SA 1IBML 3RZOH 4JI0L 5IT9c 3S1QH 1LUZA 1OXUA 2JA5G 4GKKL 2D0PA 4AIMA 2YTVA 1HJPA 2IY5B 4JI8L 4BY1H 1XPUA 5IYDG 4DR5Q 4UP7A 3FKIH 4DV7Q 2JA6G 3KLWA 1EYGA 2K14A 5DLQE 4P72A 4C2MH 1N8RC 2DGYA 1VS0A 2EIFA 4RMFA 3CMAA 4A3FH 1RL2A 4OXPA 1HZAA 1KAWA 1KHIA 2B3GA 1CKNB 1DGSA 1NTGA 2NVXH 1N32L 2E5LQ 4LUZA 1K8AC 2HHHQ 2Q2TA 2JE6I 2Y0SG 5C0XI 2VZAA 2ID0A 2OTLA 3I4MH 3F2DA 4GOPA 4JI5Q 2ZJQA 4LUVA 5LMNL 1PH7A 2GVAA 4DNIA 1G6PA 4X64Q 1AH9A 3T1YL 3I7FA 1PH3A 3D31A 4B3SQ 4BBSG 2PI2E 1KL9A 4BY7H 4JI2L 2ZTDA 3M4PA 4A76A 2A8VA 4KHPQ 1N34L 4LF8L 3A5UA 3H0GH 1Y1WG 1PH2A 4P71A 4YWMA 3KF6B 3LGJA 3PCOB 2V1CC 3U50C 4GLVB 4R4TA 3NEMA 1K0RA 1P8LA 1XTDA 2AKWB 3PSIA 5E7NA 5M5YH 1VQMA 2EQSA 3K81C 2R7DA 1P16A 2E2IH 3PV0A 2Q2IA 1OXXK 5FLMG 1GVPA 4A3MG 3A5ZB 4A3JH 1FGUA 1IL2A 3S16H 3KF8B 3J81j 3MEFA 5IP9G 1PH8A 1BBWA 2HIVA 1BVSA 3I4NH 3T1HL 1VQ4A 1MJCA 1KIXA 1B70B 1YIJA 4B3MQ 4OONA 4A3KG 1VQCA 3HKZG 2HT1A 1JJ2A 5JEAJ 2YTXA 4X66Q 4DR1Q 1N36Q 1Y14B 2JA8H 1L0WA 3K8AA 4DAYB 4QL5A 4DKAC 4KLKA 4C3JH 4DR3L 4YCWA 4A3DG 4R4OA 1WCMH 1PH4A 1V1QA 3W1GA 1NBWA 3I2ZA 2UXCL 1NMGA 5JJKA 4YY3L 1U5KA 4DV5Q 4GKJQ 1XMQL 5C3EG 1VQ6A 4JI0Q 1WI5A 4GKKQ 3PO2G 4JI8Q 1YHBA 2JA7G 4AYBE 4GOPB 3HKSA 3G4SA 3J7A5 3M3YH 3S15H 4BBRH 1J6QA 4DV4Q
chains in the Genus database with same CATH superfamily
1B3QA 1EYDA 5JJLA 2IW3A 3WWVA 3H3VH 3H09A 4HJ8A 3OW2A 1Q1EA 5M3FG 2BE5C 2VQFL 4A3DB 3HOWG 1MSHA 1CKMA 2UU9L 3TSSA 2TSSA 2AWNA 2WACA 3FMCA 1I6HH 4IQZA 3A8IE 2IT1A 3AEVA 2A6EC 3SK8A 3VA5A 3VR6A 3PO2B 2JA7B 1KRTA 4OWTB 2LY7A 4DNTB 1I50H 1GUTA 3OW7A 1SNOA 1D1KA 3OWFA 5KNBA 3ERQA 2E2JH 3ITPA 5IGBA 1D5XC 5C5MA 1IW7D 1EFWA 3Q0AA 1Y1VG 2CQAA 2QKIC 2R7ZB 1OTCA 2MO0A 1EOTA 3T1HQ 1Y1WH 4QCLA 1EWCA 3V05A 1YHQA 3D4WA 2RKSA 4C3IB 1JWSD 1YITA 2BH2A 3BDCA 4N8FA 1F77A 3FDTA 3URYA 3J80L 5M5WH 1VQBA 4P75A 1XJVA 1VF5C 1H9MA 1X3FA 4XXEA 1TS2A 1PFBA 2LMCB 4HN7A 4RGOS 1F2MA 3BVZA 3G48A 3KK7A 4M8AA 4OIKA 3CCVA 1TWAH 1VCIA 2FXQA 3HOXB 1EY4A 1GXDC 2CH4A 2K52A 1TKWB 2CW0D 1EIYB 1U4LA 4CDFC 1EY7A 1TIID 4EQOA 3GTLB 4N9PA 4A3CG 3KDFB 1KDBA 3UE0A 1LT5D 1F9RA 4R1JA 2H5XA 1JR0D 1PFSA 1LTTD 1FJGL 3H91A 4O1NA 2F0VA 4H44C 2F3WA 2KENA 3MA2B 4L5RC 4A75A 1WD1A 1SNMA 3I72A 2B2WC 3C1EA 4DV2Q 1T5XD 4A3BG 3GP7A 2F0MA 3O13A 2K75A 2N3SA 5F2DA 1RTNA 4LAAA 3R8BA 3HZXA 1I3QH 3TZDA 4A3LH 1IBLQ 4ZUJA 3S9WA 2B2WA 3OTOQ 5J22A 3K58A 3HOUB 3VA7A 1VMPA 4Z9CB 3TN2A 4LF5Q 1CQFA 1TXYA 5M5XH 4ME5A 2KECA 2LXKA 4KY6A 4LFCQ 1PXUA 1Q86C 3SEBA 3H94A 5IYBH 5M3MH 3SE0A 2VUMH 1STEA 4YWKA 2ALYB 5G3LD 1STNA 1NNXA 1JT8A 4H13C 1SBBB 3MAQA 4QMGA 2WINB 2A19A 2IWHA 3M9BA 3TEHB 2L5TA 4PNYA 1B2TA 1J9OA 1HR0W 5CORA 3VYSA 5ELOA 1Y8NB 5BR8Q 4IUNA 2NZOA 4JV5Q 4YWLA 1E2VA 1L2FA 3VR3A 4CJ2C 3NK9A 1XMOL 4LFBL 2NN6I 4HCSA 5FLXL 5IY0A 1ESRA 3S2HH 4ZLTF 3NQTA 4JOIC 5KNDA 4K5XA 4IUPA 3FVQA 3NENA 1IXRA 4KTAA 1JB7A 5IOCA 2K5QA 3KLRA 4JOIA 1KLGD 4A3IH 3NQIA 4RWSC 4PMBA 4ALPA 2NVQH 4IUVA 1A8VA 2F0QA 2Z9HA 4FF1A 1WJJA 1D8LA 1YZ6A 4JYAL 2Z0SA 4PMWA 1PRTF 4C3JG 1WYDA 4GN4B 3CU7A 3HOVH 3S17B 4B9WA 4RKBA 5LMUQ 1TWHB 4C3HB 1YJNA 4ODGA 1Z47A 4DXGA 4L63B 2O2LD 1NJIC 3WDNA 2EY6A 1Q90A 1DOMA 3ULLA 1CKOA 2KOLA 3QIAA 5JJZA 5C4JB 3CW2C 2UUBQ 4IFDI 2BOSA 3PO3G 5C5LA 3RZDB 1B9MA 3S1MB 2ZXPA 2EYLA 1L0XB 2PI2A 4K2KA 4KY7A 2SOBA 4GKJL 1WCMB 1EU3A 2LXJA 1XWEA 4XTCS 3RN2A 4RCOA 2ZTEA 1QNKA 2K5VA 1PLFA 4CDEC 3C1FA 5C44G 4MZ9A 4PQXA 2YU9H 3BVGA 5ELDA 3F2CA 4OX9L 3HOZH 2R92G 4L5TA 4LF7Q 3MXUA 1UEBA 4AQYQ 3I70A 5M3FH 3VDYA 4DUYL 3HOWH 2CWAA 3T51B 1EY0A 1S72A 5A35A 5IP7G 1I50B 4A3GG 1ET9A 1V43A 2YV5A 3MXNA 4LNQA 2EYJA 3D3RA 4NXMQ 5IGCA 3MTSA 3DXJC 2V4DA 3K80C 2NTTA 5EKIA 4LW1A 4HJAA 2JP1A 4DAVA 1F2YA 3NUCA 2F0FA 2MJ8A 2VXWA 1W2BA 5IT9E 1B50A 2EZVA 4PZ8A 1ONLA 2PZUA 4A3EG 2UUCQ 4DXFA 4JI6Q 2EYHA 1D5MC 1IBKQ 4GLAC 1HNXQ 3MHBA 1WFQA 2PCFB 1QVGA 4CJ0B 3DM3A 4APVA 1QB5D 4UPAA 1D5ZC 1DONA 3NELA 2RQXA 1WD0A 1TU2B 2R3ZA 2EPBA 1QZGA 2E8GA 3NWTA 5FOBB 2KJXA 3ZJYC 3BZDB 2R93H 4JI1Q 1SMYC 1XX8A 3CPFA 1NR4A 2SNMA 3I4MB 3KBXA 4DR4Q 4RA8A 4G57A 4OHJA 4X62Q 2D2CC 4P74A 2I5LX 2ATWA 3M4QA 1SMXA 2E74C 4BY7B 1YBYA 2XRQD 1YNNC 4G7HC 4XIGS 1SFOH 4OO1G 5KIXA 2E2IB 1EL0A 4UP8A 3V96A 4DF7A 4LMQD 3U9OA 4A3JB 1CHPD 3TQYA 3HOYH 2L55A 1IBLL 3K5LA 4IFDJ 3P7JA 3U58A 5EPKA 4X66L 4QUFA 5EQ0A 2DY7A 1Q8KA 2JA8B 2D9UA 3I3CA 1JOKA 2X6LA 3EVQA 4GKKL 1LUZA 2JA5G 1G8ZD 4NP5A 4AIMA 1HJPA 1GUOA 1IYUA 4JI8L 3I8ZA 1SSOA 3EA6A 3K5OA 4DR5Q 1XPUA 4DV7Q 3P20A 3S15B 2DGYA 4RMFA 1ZYRC 4BBRB 4CJ1B 2EY2A 4OXPA 1KAWA 3JAME 1LABA 2B3GA 4I7ZC 4XQQA 1N32L 1W6JA 2E5LQ 2HHHQ 2B39A 5DM63 2Y0SG 1CA5A 3HEJA 4JI5Q 4ZUIA 4LUVA 5LMNL 1G6PA 1OO9B 4X64Q 1SYDA 2PI2E 1C4QA 2EJGC 2JA6B 2WIIB 2K03A 1PFNA 3DEOA 1EQTA 1Y1WG 3H0GH 5G3LF 4B3RL 4P71A 3PCOB 5J1ZA 4GLVB 1K0RA 2CHBD 3TP8A 4XQNA 1VQMA 4J1MA 2Q2IA 2HQEA 2K1BA 3KBGA 4CDDC 2L9HA 3S16H 3BDLA 3A8JE 4KD3A 2HIVA 1BVSA 3I4NH 3HGBA 2O4XA 1VQCA 3HKZG 2F4IA 1KLUD 2F0DA 1PTOB 1Y14B 4DAYB 5CYUA 4C3JH 3TBIB 1KDCA 1DJRD 1MHWC 1NMGA 4JK1C 3W2DA 4E6IA 5JPNC 4DV5Q 3KLSX 1XMQL 4JI0Q 3OHXC 1H9JA 3DWPA 3G4SA 3M3YH 3J7A5 2HUGA 1E2ZA 1UE6A 4AYBG 5IGGA 5LL6X 2LKVA 5CV5A 5DNFA 5JEAH 1VQDA 1EYAA 3G7LA 4OGQC 4PV1C 3TP6A 1MGSA 2JEBI 3A54A 3OYYA 3SK6A 4X3KA 4TVAB 1HQRD 2L12A 3T4AC 4DGZA 1VQLA 1HZCA 5C3EB 3BU2A 1PA6A 4JBJA 1I5FA 3T1YQ 2RHSB 4PG3A 1TS4A 1JB3A 5IWAL 1SE4A 3ND8A 2A69D 4JI2Q 2O5IC 1JC7A 3EJIA 4LF7L 1SROA 1N34Q 2IHEA 4FP5D 3SK5A 4PZ6A 1M90C 4AQYL 1RJTA 3KDFA 2NWGA 4B3TL 1VQIA 1VQAA 2WB1G 3L2PA 5M3FB 4POGA 3HOWB 2EOTA 1N9WA 5IYBG 2WV6D 5M3MG 3J81E 2VUMG 4OELB 5KNCA 5FO8B 4X3TA 2A6HC 3CCLA 1NR2A 3CF5A 4DR6L 1GHKA 2PW5A 2PPBC 4RHRA 1QJOA 5IP7H 1EIHA 4IZ8A 3K7AH 4IPCA 5LL6S 1PYSB 2N78A 2Q2HA 2PNHA 1OXTA 1SRUA 4IURA 2VW9A 1U0LA 4KN7C 1KTKA 2A74C 1T5EA 3FEWX 1GKHA 2KCCA 4DR3Q 3S1RH 5JOBA 2OEOA 2X6GA 1Y1VB 3N52A 1IBKL 1SYCA 1Z7TA 1LACA 4A3KH 4A3EH 1CM9A 4PZ7A 2ASBA 1JOQA 2NZ1D 1ET6A 3NE5B 5CV6A 1PH5A 1HNZQ 4A3IG 1OXVA 1QCBD 1SNDA 3T56B 4DV0Q 4IPHA 1F2LA 4XT3B 1J5EQ 1HA5A 1K3BC 3L0OA 1BUVT 1UWVA 3GTMH 2ZXRA 3HP3A 1PH9A 1JOOA 2UUAL 1SYBA 1HTLD 5I9PA 2BE5D 1I4RA 2JQOA 1WTXA 5JVH3 1LTGD 3HOVG 2EJMA 1WOCA 4X62L 2VNUD 2NUCA 3EQLC 3MC0B 1E3PA 2MP1A 1XPRA 2A6ED 1L0YB 2NVTB 4X3SA 2SEBD 4EVOA 4BS9A 4L6TB 1I4PA 2F3VA 4LWCA 5E3FA 2RDGA 4HMJA 2F4VQ 1EUJA 4JI4Q 2NVYB 1SFOB 3GTJB 2MO1A 3E0JA 5J3BA 1XNQQ 4OO1H 1IHZA 3HS0C 4J6HA 4WJ4A 3H6MA 2I0QA 2D62A 1TWCB 4R8NA 1K9MC 4PMCA 4BY1G 1S4ZA 3FKIG 2F0WA 1IBMQ 1IKLA 1SXTA 4A3BB 3S2DH 2BDNA 1K3RA 2QGQA 3OMCA 4ZQ3A 2F0TA 2CCZA 1BCPC 3HOZG 1K8GA 3MFYA 5DAUA 1NUCA 2KVMA 2DN8A 4N9TA 3NSWA 1TS5A 1N33L 4DR5L 4DV3Q 2R7FA 4K5WA 2JA5H 1SE8A 3A0JA 3KJOA 1HUNA 4V190 2DUDA 2KHSA 4LF9L 3T13A 3JAMi 3SK4A 3GTGB 2OXPA 2E5LL 2DNEA 2HHHL 1A3TA 1E1OA 4QB4A 2VQEQ 3L7ZC 1SYFA 3K0YA 2QF7A 4TQUS 4DN4M 4LF8Q 1GD7A 2K5HA 1UUPA 1ICWA 3CPWA 2B29A 1JICA 4CKBA 1ENAA 1SNPA 1EOVA 2YYZA 1DM0B 4HSVA 1YVCA 4CGYB 3S1NH 3RMHA 4OEMB 5ISRA 3I55A 3PIO3 4K6DA 1CSPA 1SYGA 1OXSC 3ND9A 1HCZA 4GLXA 1TS3A 4HTHA 1TQOA 5AJ3L 1V8QA 2EYPA 1IYJB 3PIPA 1B44D 1DOLA 4IPGA 1B53A 1TWFB 2R6GA 1A63A 3TS2A 2VS1A 2VY3A 3E6ZX 1QVFA 4IPDA 3I4OA 4Q0FA 4YY3Q 1TY2A 1TR5A 3M7NA 2N49A 3STBC 5C0XJ 2BA1A 2ZJRA 1HZBA 1S40A 2R93G 3EBEA 2SNSA 3BZKA 4ZAIA 2K5NA 4DR2Q 1CSQA 4C3JB 1TWGB 4DV5L 1EQQA 3GTPH 4A4IA 1FNUA 1J8IA 3I4LA 1IYVA 1SNQA 2IX0A 4DV6Q 3M85A 4RGTA 3J7ZC 1VQGA 1I4HA 3F2UA 4FF4A 4JBKA 1VQ7A 2K7VA 3BG3A 3PO3B 3ICEA 4L8JA 1NMFA 2Z6KC 3NBHB 1IL8A 3HOYG 3MVVA 3MXGA 3NWSA 1FGBD 4GS3A 1QWYA 3MZ5A 3Q8DA 4DK3C 4UHVA 4HJ5A 2I5MX 1UE1A 2ICEC 4RKLA 3A7LA 4C1NI 3GTOH 2Z6KA 2UXBQ 1STGA 4RFBA 4F7XA 2XGTA 5C44B 3CCRA 1VQNA 2RCNA 4K5VA 5FO7B 2M9VA 4KY5A 3NXWA 4UDUC 2LS01 2PW7A 1QUQA 1AN8A 4KJNA 4U673 4FF3A 1I94Q 3PGZA 2R92B 3QO2A 3CMEA 3BZCA 1UE5A 3J81i 4K8JA 2QA4A 3JC66 5LMNW 2Z4HA 1PH1A 1VQ8A 4G4KA 4H7BA 2F0LA 1LTID 2K50A 1NSNS 4LK1C 4KMUC 3SDZA 3W1BA 4OL7A 3CC7A 1SLJA 4NXNL 2M00A 4DNRB 1FL0A 1K28A 2OWOA 2I5HA 1VQOA 1CZWA 4A3GB 5EKKA 3PUXA 4FNFA 2EVBA 3CHBD 4X65Q 1JWUD 3CCEA 3C2PA 1G2SA 3SXHA 4DV1Q 3RZOB 4JBWA 1U4PA 4P2CB 1H9KA 2N55A 2E2DC 4FYDA 1O80A 2RA4A 2A68C 1QG7A 2F0SA 4C2MB 3H0GG 3PUVA 1BF4A 1X9NA 2B63H 2F0EA 5EJWA 4YHHQ 2FMMA 3GO5A 2QDBA 1CI3M 4MTNA 4A3EB 4KKUA 2NVXB 5E4WC 1R4PB 1I4XA 4NMZA 4Q5VA 5ELEA 1UEAB 1HZ9A 3I90A 4JC0A 1GUGA 2RBMA 1HNWQ 4DV0L 4BWGB 1V1PB 1J5EL 5EBDA 1QNUA 2NN6H 3I4NG 4J8QA 3PF4A 3PUWA 1PYWD 1SR3A 2HCIA 4KHPL 2H1EA 1TY0A 2OQ0A 3A7AB 5L37A 3FPPA 3GTMB 5IGFA 2Q8RE 1HXYD 4JBMA 5C4XG 4HAEA 4RAUC 1A62A 3TRZA 4JI7Q 5CV7A 2EXDA 1ENFA 1AP0A 2HIXA 1RIPA 2K6AA 4RGMA 1CHQD 4K0KQ 2IPKD 1FYCA 2OT2A 4TRDA 3F2BA 2MUYA 4B3ML 3E0EA 2F4VL 4YCVA 4JI4L 3CXCA 3AYHB 1XNQL 3A74A 5JEAG 4A93H 1PTOC 5IYCG 1MI2A 1BCPB 3RN5A 3KLSA 1SJED 3CC2A 2KA7A 1IBML 1S5FD 2XRSD 5IT9c 3S1QH 1OXUA 2D0PA 1ZXTA 1PRTB 4DAYA 4BY1H 4UP7A 3FKIH 3S2DB 4IFDH 5FKAC 4P72A 1BDOA 4A3FH 3CMAA 1YNJC 1Y8OB 4JW0A 2Q2TA 1EY6A 3F2DA 3EFXD 2A5HA 4DNIA 1PZKD 2JA5B 3Q23A 2B2YC 1ICFB 4B3SQ 1I6HB 1GUSA 1KL9A 1SMYD 3M4PA 2A8VA 4LF8L 3A5UA 4IOAA 1PH2A 3KF6B 2L4NA 2B2YA 2EQSA 3K81C 2R7DA 2Y0SB 3PV0A 5A2QL 1OXXK 2E2JB 4RHSA 3J7AF 1FGUA 1RF2D 3KF8B 4G7OC 1YNND 1PH8A 1BBWA 2RDFA 5JPMC 3T1HL 4MIUA 2B2VC 4GZYC 1GUNA 1B70B 1YIJA 3QOLA 3CKIB 4A3KG 3J80E 2HT1A 1Y1WB 1JJ2A 2YTXA 1N36Q 4WORA 2L0CA 1PZJD 2B2VA 3LNNA 4NKLA 1O7YA 3E3XA 4YCWA 4R4OA 1PH4A 1NBWA 3I2ZA 5JJKA 4YY3L 1U5KA 4V0BA 1AFPA 5M5WB 3R2TA 1VQ6A 1WI5A 1KNEA 4AYBE 1K0SA 1J6QA 3RNUA 4XT1B 3HKZB 4DV4Q 2ZXOA 4ME3A 1VQ9A 1D7QA 3S24A 3BJUA 1TWAB 2JEAI 4CHTB 3ULJA 1LYLA 2JYOA 5AFWA 2PZTA 4DV6L 1LLRD 1LO5D 1ZYRD 2BH8A 2BCOA 3JAMc 4Y7NH 2JSOA 1GO3E 1M4VA 2YTYA 1QUQB 2JA9A 1KRSA 1BBUA 3PIP3 2MHVA 4AYBB 4KKTA 5CBAE 4JVZA 3M4OH 5C3WA 2WB1E 3K57A 1DD2A 3MEHA 4DV2L 2CWPA 3PMFA 2OTJA 1X65A 4CDCC 3F1ZA 4R4CA 1FD7D 3GTQH 3Q6SA 1Q7YC 2GN5A 1BNZA 2XTIA 4M1UB 4BBSH 3KJPA 3OTOL 1I3QB 2ZJPA 1JCKB 1PYBA 3RR5A 1RHPA 5BN3A 4B08A 4LF5L 3PIOA 3PUZA 3RLOA 2F0HA 1II3A 1BXTA 2WFWA 1G91A 4LFCL 1WTWA 2NZHA 5FJ8G 5BN5A 5M5XB 4K8IA 4A3MH 2WB1B 1AW7A 4QUCA 4R4QA 3FP9A 3KFUA 5M3MB 2UXCQ 4L5SA 2VUMB 3KUPA 1O7IA 4IJLA 1I4QA 4DAMA 1EEID 1VQ5A 4X3UA 2PQAB 5FLXE 1CUKA 4IOCA 5BR8L 4HIMA 4RGNA 2RHQB 4JV5L 5HY6A 1H9SB 5HURA 4ULLA 2F0IA 4A3DH 3CCJA 3CAMA 5JAVA 1WTPA 4ILWA 2CH4W 2KEEA 3HRZC 5CV4A 3S2HB 4QQBX 4LF6Q 3PO2H 2JA7H 1ENCA 4OWWB 3OPOA 1FNWA 4ZK9B 2IJ0A 3J7YW 1A15A 2QEXA 1EY8A 4A3IB 4IUTA 1T9HA 1X32A 2K5WA 4UP9A 2NVQB 3D8GA 3CCQA 1PTOF 2KCMA 2R7ZH 5J39A 1X3QA 4WRDA 3WOFA 5C4HA 1SJHD 2K32A 3DLLA 1VQHA 5C4XH 4K0KL 2LSSA 1M1KC 2K33A 5LMUL 3IFTA 2WAQG 3HOVB 3J81c 4HIKA 1C0AA 2A6HD 2QW7A 4S3SA 4GNXB 1A2TA 1HFGA 4QGUA 3NPPA 4KI0A 1GHJA 2UUBL 4FXDA 1RD9D 2F0PA 1UAPA 2A1AA 1XTCD 1DYQA 2ES2A 1JQYD 1TT2A 2FJ2A 5M9OA 5IYCH 1AEXA 4LUOA 3QJYA 4OWXB 1STBA 4XQJA 3OWEB 3PQIA 4BY1B 2QEJC 3FKIB 4C1NK 5KRUA 5EKLA 1XPOA 2OF1A 3GTLH 2YU9B 4JCVE 4X6AH 5EAYA 2KHIA 2F0OA 3FPUB 5GAEC 1CT1D 3WOEA 3HOZB 1Q3LA 4IUUA 1V1OA 3NTHA 3LX0A 2RVLA 2R61A 1FJGQ 2OQKA 1LTBD 1KC8C 5A2QE 3C3LA 3NBHA 3RD4A 1MD2D 1JJCB 4NXML 1B4OA 2MFIA 4QY7A 1C7YA 1PHJA 2MPMA 1LT4D 2NYZD 2TMPA 2Z1CA 1KNAA 1HQMC 5IGEA 1LT3D 2GVBA 2JK8A 1VQJA 4DPGA 4F88A 1CK1A 2UUCL 3SR1A 3K0XA 3J80i 1G291 2B63G 4JI6L 3AFQA 4Y52H 1LTLA 1ILQA 2FHTA 2PYKA 1HNXL 3PF5A 2MQHA 5GADC 3U4VA 3HG9A 1JORA 2QCPX 4HMIA 2AWOA 2NN6G 4NB3A 4R4IA 1X3EA 2MNAA 1M8AA 1LTAD 3AB9A 1LT6D 1C8CA 2J4XA 3MWYW 4DV4L 4GOPC 1DXMA 1XNRQ 2E2HH 4L5QA 2PO4A 4NDXA 4JI1L 1XMOQ 5C0XH 4LFBQ 1JWMD 4ZKCB 1YNXA 3UE1A 2KCNA 2R93B 4ZCKA 3R3OA 2HD3A 4DR4L 1PFMA 2A69C 2PZWA 3I91A 4I65A 1B3AA 5HGTA 3IRBA 2G9DA 3GV6A 3B6YA 4CKEA 1KABA 4YIJA 1V1PA 1KXLA 3X3NA 4A93G 1NAPA 4BXXH 2VL6A 1RTOA 3SGIA 1KD1C 1B9NA 1E24A 2ZT9C 1K8OA 3DWAA 2B8FA 4RCNA 5EPLA 3TMEA 4JYAQ 3CP0A 3MFGA 4KHVA 1KQSA 3CRKC 2IX1A 3HOYB 3S17H 4OO1I 2F52A 1TWHH 4K6LA 4C3HH 1EEFD 1UNSA 5T1GA 3RLFA 4IFDG 3HFZB 2HQLA 3RLNA 2AQ1B 1JMCA 1PH6A 1B8AA 2HDLA 4A3FG 1WTQA 1EU4A 5C4JH 2Q2UA 2B2TC 2IX3A 3P75A 1EZ6A 3F8TA 4EQ5A 4DK1A 3RZDH 1C9OA 3S1MH 3VYRA 2B2UC 1VQPA 3A55A 4LFAQ 1PMRA 4IUQA 4CBVA 4POFA 4DV7L 3E9IA 1PRTC 5FJ8H 2B2TA 3EN2A 2HCCA 5ELNA 3EROA 3GDEA 3H3VI 3STBD 4HCEA 1Y69U 3QG1A 3GV3A 4RG1A 3TP7A 4HJ7A 3TS0A 2EDGA 3TP5A 3G6JB 3OIPA 3DMUA 4JI3Q 2BA0A 5FK9C 4JI5L 2CFMA 3H3VC 4X64L 1MKHA 1NCVA 1X3PA 1S3OA 4OX9Q 4UY8C 4OIJA 1AE2A 3QB3A 3CCMA 4ZRZA 1D2BA 3LWEA 5E1FA 5I4DA 4LF6L 4DUZQ 5K36H 1G6ZA 4EGVA 2HDMA 1I4GA 4KHZA 4DUYQ 3H15A 1QVCA 5I6WA 3H0GB 3BYTB 3NTIA 2L15A 1KDAA 3J7AV 1Q1BA 2L11A 1GM5A 1L1OB 3GTKH 3KF6A 3S16B 1JJGA 4NW2A 1IKMA 1NY4A 2Z6BA 3SHLA 3I4NB 2K28A 4O42A 1Q46A 3EIVA 1YI2A 2Z4IA 2J7ZA 3SVMA 3ULPA 3NP8A 3KF8A 3NHHA 4H0LC 4IALA 3Q22A 5C4XB 3M4YA 1STAA 3A8KE 3MXPA 1CQVA 4P73A 3ER0A 1W3SA 5IT9L 4ZKBB 4JI0L 1Q8IA 3L9AX 2IY5B 5FO9B 1VDZA 1WVLA 2C9OA 3VYTA 1EYGA 5DLQE 3T53B 1N8RC 3M3YB 2EIFA 1RL2A 2NB0A 1RCVD 1A3UA 1CKNB 1DGSA 1NTGA 1SE2A 2KQ3A 4LUZA 1E2WA 2JE6I 5KGUA 2OTLA 2RDHA 3I4MH 2F0GA 5ELCA 1PH7A 2AQ2B 1HA6A 2A68D 1STHA 1AH9A 3T1YL 4FVMA 3I7FA 1PH3A 3D31A 4BBSG 2ICIA 2RSNA 2EYMA 2JXMB 4BY7H 4JI2L 2KEDA 2NTSA 4A76A 3BYYB 1N34L 3LGJA 1IW7C 4R4TA 5M5YH 3PSIA 2GA4B 5E7NA 1HUMA 4FXGC 5I6YA 1P16A 1ESFA 2E2IH 1GVPA 4A3MG 3A5ZB 4A3JH 1IL2A 2RSOA 2XVSA 3J81j 2M2LA 5IP9G 1VQ4A 1MJCA 1BQQT 2CVRA 2E75C 5BN4A 5CC4A 1SYEA 3VR2A 4X66Q 4DR1Q 3K7AB 2JA8H 1L0WA 3K8AA 1LTSD 4DK0A 4QL5A 4DKAC 4KLKA 5CV9A 4DR3L 4A3DG 1A2UA 3W1GA 1R4QB 1A6XA 3OIQA 3S1RB 4GKKQ 1PTOD 2QILA 3PO2G 4JI8Q 1YHBA 2JA7G 4GOPB 1WTVA 3HKSA 3S15H 2CW0C 4BBRH 4A3KB 3C46A 1PVOA 1HNZL 3DWQA 1O7ZA 1Q12A 5T1IA 3VR5A 3DHQA 1N32Q 4CKCA 1RDPD 5COYA 4QIWE 4UAIA 1HRJA 4DR7Q 1GUWA 1EFID 3QWNA 1XNRL 3JAML 1YNJD 1A0IA 5LMNQ 2PQAA 3CRLC 1HTPA 2O5JC 3G6EA 1ASZA 1VMCA 2R7ZG 5IYDH 2JA6H 2E2HB 1H9SA 3NBIA 5I9OA 5H1SE 1MBYA 3KYHC 5CV8A 2OCEA 4R8IA 3CCSA 4B3RQ 1F9QA 4DK6C 4C3IG 2UXDQ 3DM1A 1HR0Q 4GN5A 1AE3A 3IL8A 4QIWB 1O78A 1YHAA 1MJEA 1YEZA 1BCPF 1DOKA 2B8GA 3U9SA 3G71A 2F3IA 1EIFA 1WTRA 1X56A 1Y8PB 1LM0A 1GOZA 1PTOH 1SN8A 4MNOA 3ERSX 2A73B 4FO2A 1G51A 1PV4A 2EXZA 3UDGA 3HOXG 3D6CA 1GJXA 1NE3A 1S5ED 5IE8A 5FLMH 4GNXC 4QF4A 3J80c 2K04A 2CKZB 1EIGA 3FHWA 4HIOA 5GAHC 1U4MA 2XNAC 4KN4C 1XMQQ 1PDQA 5C3XA 1VQFA 2Y0SE 4MHEA 4GNXA 4LFAL 3CC4A 4DV3L 1S5BD 1IZ6A 1ML0D 5E4XA 1EY5A 1SAPA 1EY9A 1STYA 5C3EH 2VQEL 1E22A 4JI3L 3PUYA 4WJ3M 3GD7A 3HOUG 1F9SA 5IWAQ 2AMCB 2IHFA 2E76C 2KHJA 3IKJA 1BKBA 2KUMA 4BA1I 1EQRA 1RODA 4DUZL 2F0UA 3S1NB 1CTMA 4B3TQ 1YJWA 4XYQA 4FF2A 4LF4Q 2XIWA 2PNRC 1D1IA 3HKZE 3D4DA 1EYCA 2QDLA 2ZM6Q 2EYOA 1ASYA 2EY1A 5GQOA 3S14H 2WAQE 4DR6Q 1SE3A 1VQKA 1VQEA 2WKCA 3J81L 1B7YB 3AU7A 2D5DA 1K73C 3GTKB 2FINB 2Q8TA 1PZID 2K05A 4LJZC 1F9PA 3Q24A 1R9TH 1RKNA 3IAYA 3A56A 2C5CA 1SEBD 5C0XG 1BOSA 1E7ZA 2F03A 1Y1VH 2XSCA 5D65A 4DR2L 4MN3A 3BS1A 1YJ9A 4QJFA 1EQVA 4HJ9A 3CD6A 3GTPB 4O2DA 2N8NA 2WAQB 3R93A 3I56A 2KCTA 1A3VA 3D4RA 4R9WA 4HSPA 1MIUA 4BXXG 3DEPA 2JJQA 5FLXc 3L3OC 2Z8LA 2UUAQ 1HPCA 1MSGA 3UDIA 3K5MA 1CZGA 4C3HG 3OOCA 2UXBL 2NVTH 3AMUA 2P5ZX 2VB3X 3GTOB 4KKSA 1K83H 2H4OA 2VB2X 2NVYH 3GTJH 3DUZA 4A3CH 1H9RA 5M5YB 1I94L 2AUKA 1XXGA 4KD4A 3CQZH 2C35B 5EPJA 1WCMG 1BO0A 1TWCH 2DY8A 2F0KA 4BA2I 4EX5A 3OMGA 3CCUA 4K14A 4A3BH 3K7UC 5IP9H 1XYIA 5IIFA 1Q82C 4DR1L 4J15A 1QE6A 3UDFA 4X65L 5EBCA 4C56C 3KOJA 2RCFA 4O0AA 2PQEA 4DV1L 1X3GA 3TREA 4DFAA 1Z6HA 4RH6A 2DNCA 5IGDA 3W3AA 4IJHA 3AFPA 5K36G 1N33Q 5D14A 4YHHL 2VQFQ 2F1MA 5D3IB 2UU9Q 2B63B 3GTGH 4XDXA 4EQPA 4LF9Q 2RF4A 2KBNA 1FNVA 2I07B 4AH6A 1HNWL 5HGQA 2ZTCA 4DR7L 1UE7A 4G7ZC 1KAAA 1SDFA 4B9XA 1HH2P 4H02A 1X6OA 1Z9FA 5D3DA 3M7GA 1Q81C 5IODA 4KJOA 1EWIA 2I46A 2AQ3B 1SNCA 1WTOA 2LFNA 4WJWA 3D0FA 3I73A 4JI7L 2UXDL 4TKOB 5JVG3 4EQNA 2EYFA 3E5SA 5I2XA 1HR0L 1L1OC 1QILA 4C3IH 2ENBA 5AJ3Q 1V9PA 2EJFC 4IO9A 1HHVA 1TWFH 4F87A 2NBFA 4FXKC 1TVXA 4IN3A 2WP8J 2DJGC 1CFMA 1L1OA 2XN9C 3ZYYX 1QZHA 2AUJD 2G5DA 4FDBA 1E1TA 5JJIA 1F2ZA 4A93B 3V2TA 3E9HA 5CBEE 1JE4A 1S5CD 3I4MG 2IL8A 3ONAB 4TSSA 1JE5A 4ABNA 1TWGH 3RUZA 3S1QB 2MGSA 3HOXH 4N8X1 1EZ8A 5DEHA 4BY7G 1D6EC 2WKDA 3T16A 5KYIA 4A3FB 1W6KA 2G9HD 4NPSA 4I7AA 2AHOB 5CMDA 5K5PA 3QOJA 1WTHA 3PO3H 5DM73 4A3JG 1C48A 3AQQA 1X55A 2N88A 4JPBW 4B3SL 1CKNA 4HR7B 1BR9A 3MXNB 4A3LG 1U4RA 1ZKOA 2PMZE 5C44H 1G2TA 1QOHA 2JA8G 3UI2A 3P1HA 1EWHA 4HEDA 3HOUH 2D0OA 2Q8IB 1B1ZA 1LV9A 4JG2A 3UDXA 1X54A 2R92H 4LF4L 4KV6A 1FR3A 4DA2A 5I2YA 2ZM6L 5CGKA 2K5DA 2X69A 2XWJB 4HIDA 4YCUA 4BBRG 1ILPA 3VR4A 1N36L 4KK7A 1I6VC 5ELBA 3U4ZA 5TSSA 3K59A 5GROA 2CQOA 2J0TD 2K4KA 4GN3B 1H95A 3S14B 1FVIA 2PMZB 4A3GH 4F8MA 2FMCA 4NXNQ 3W5OA 5CR3A 5GAGC 3N6RA 3RZOH 1O7LA 2FFKB 2EY5A 1R9TB 1BBXC 2YTVA 5IYDG 1CA6A 2JA6G 3TZUA 3KLWA 1BCPD 2K14A 2SDFA 5C6AA 4C2MH 2DJFC 5KYLA 1VS0A 3BDOA 1HZAA 3X3MA 4ZYSA 1KHIA 4DAPA 3LWUA 2NVXH 3D6WA 1K8AC 1PRTD 5C4ZA 5NUCA 2VZAA 2ID0A 5C0XI 4GOPA 2ZJQA 2GVAA 1ZEQX 4Y7NB 1HFNA 3TDQA 4MTKA 2JN4A 2ZTDA 5LHY1 4KHPQ 4YWMA 2V1CC 3U50C 3QR8A 3NEMA 1LTRD 1P8LA 1XTDA 2AKWB 3M4OB 3VYUA 4ID6A 1U9RA 5FLMG 2F0JA 4XYOA 1AZPA 4K2LA 2XWBB 1E0BA 2K01A 4WFN3 3GQBA 5EGTA 3GTQB 3MEFA 1DZ1A 3OSOA 3R2IA 1KIXA 4BBSB 3IFDA 1K83B 3BVMA 4B3MQ 4OONA 2BDOA 2EE1A 5JEAJ 5KEEA 3CQZB 5ELFA 1DCZA 1S5DD 1WCMH 4DU9A 2F0NA 3NTKA 4A3MB 1V1QA 2UXCL 1K8MA 3K5NA 2L1BA 4GKJQ 3FRPB 5C3EG 1VF7A 2B2UA 1AZQA 4U68A 3K6OA
chains in the Genus database with same CATH topology
1UE6A 4ME3A 4AYBG 1PVOA 1HNZL 1VQ9A 1VQDA 5JJLA 1Q12A 3S24A 1D7QA 3BJUA 2JEBI 3OYYA 3WWVA 3H3VH 2JEAI 3ULJA 1LYLA 1N32Q 4HJ8A 3OW2A 1Q1EA 4QIWE 4TVAB 5M3FG 4DR7Q 2VQFL 4DV6L 3HOWG 1CKMA 2UU9L 1XNRL 1A0IA 2AWNA 1HZCA 2BH8A 2PQAA 5LMNQ 3JAMc 1VQLA 4Y7NH 3G6EA 3BU2A 1PA6A 1GO3E 4JBJA 1I5FA 1ASZA 3T1YQ 2JA6H 2IT1A 2YTYA 3AEVA 5H1SE 2R7ZG 2RHSB 1QUQB 4PG3A 3KYHC 2JA9A 5IWAL 2OCEA 1KRTA 4OWTB 4JI2Q 1KRSA 1BBUA 1I50H 4LF7L 1SROA 1N34Q 3CCSA 4B3RQ 2IHEA 3M4OH 4PZ6A 1M90C 4DK6C 2WB1E 4AQYL 2UXDQ 3KDFA 4B3TL 1VQIA 4DV2L 2CWPA 2OTJA 1X65A 1VQAA 2WB1G 3L2PA 2E2JH 1HR0Q 3F1ZA 4POGA 4GN5A 4R4CA 1AE3A 3GTQH 1Q7YC 1N9WA 5IYBG 5M3MG 2GN5A 2VUMG 1YHAA 1MJEA 2XTIA 1EFWA 4BBSH 1Y1VG 1YEZA 3OTOL 3KJPA 2ZJPA 1OTCA 2MO0A 3CCLA 1PYBA 3G71A 3RR5A 3CF5A 2F3IA 3T1HQ 4DR6L 1EIFA 1X56A 4LF5L 1Y1WH 3PIOA 3PUZA 5IP7H 3RLOA 1LM0A 1SN8A 3K7AH 4IPCA 4MNOA 3ERSX 1YHQA 1G51A 1PYSB 2N78A 2WFWA 1YITA 1PV4A 4LFCL 3UDGA 2Q2HA 2PNHA 3HOXG 2NZHA 5FJ8G 1OXTA 1NE3A 2BH2A 1SRUA 2VW9A 5IE8A 5FLMH 4A3MH 1U0LA 4GNXC 4R4QA 3J80c 1GKHA 5M5WH 4DR3Q 4IOAA 2CKZB 3FP9A 3S1RH 3KFUA 1VQBA 3FHWA 4HIOA 4L5SA 4P75A 5GAHC 2UXCQ 1XJVA 1IBKL 1XMQQ 1X3FA 1O7IA 4IJLA 1VQFA 5IYDH 4DAMA 4A3KH 4A3EH 4PZ7A 2Y0SE 2ASBA 4LFAL 4GNXA 1VQ5A 3CC4A 4DV3L 3G48A 2PQAB 3RNUA 1IZ6A 1CUKA 4IOCA 5BR8L 3CCVA 1TWAH 4HIMA 1VCIA 2RHQB 1PH5A 1HNZQ 4JV5L 2FXQA 5HY6A 4A3IG 1OXVA 4A3DH 2K52A 3CAMA 3CCJA 4DV0Q 4IPHA 1EIYB 1J5EQ 3L0OA 5C3EH 2VQEL 1UWVA 1E22A 4JI3L 3PUYA 4WJ3M 3GD7A 3GTMH 4QQBX 4LF6Q 3PO2H 3KDFB 1PH9A 4A3CG 2UUAL 2JA7H 3UE0A 4R1JA 2H5XA 4OWWB 3HOUG 1PFSA 5IWAQ 2AMCB 2JQOA 2IHFA 1FJGL 2KHJA 3HOVG 1BKBA 4BA1I 2KENA 1EQRA 2QEXA 1WOCA 4X62L 4L5RC 4DUZL 2VNUD 4A75A 1E3PA 1XPRA 1T9HA 4B3TQ 4DV2Q 1YJWA 4A3BG 4UP9A 4LF4Q 3CCQA 2N3SA 2K75A 3HKZE 2KCMA 4LWCA 2R7ZH 1I3QH 2ZM6Q 4A3LH 2F4VQ 1EUJA 1IBLQ 1ASYA 4JI4Q 2MO1A 5GQOA 3DLLA 5J3BA 3OTOQ 1VQHA 5C4XH 4K0KL 3S14H 2LSSA 2WAQE 1XNQQ 4DR6Q 1M1KC 1VQKA 1VQEA 5LMUL 2I0QA 4LF5Q 1B7YB 2D62A 4WJ4A 1TXYA 2WAQG 1K73C 3J81c 5M5XH 1K9MC 4HIKA 1C0AA 2LXKA 4BY1G 1R9TH 3FKIG 1Q86C 4LFCQ 1IBMQ 4Y52H 4GNXB 5IYBH 4QGUA 4KI0A 5M3MH 2UUBL 3S2DH 2VUMH 5C0XG 1E7ZA 1K3RA 4YWKA 1Y1VH 2ALYB 2A1AA 2QGQA 1JT8A 2ES2A 4DR2L 2CCZA 3HOZG 1K8GA 1YJ9A 5IYCH 4QJFA 2A19A 4LUOA 4OWXB 4HJ9A 3M9BA 3CD6A 3TEHB 4O2DA 2N8NA 1N33L 3I56A 4DR5L 4DV3Q 1HR0W 2KCTA 5ELOA 2R7FA 5BR8Q 2JA5H 1SE8A 2NZOA 3A0JA 3KJOA 4JV5Q 2DUDA 1L2FA 4YWLA 1XMOL 4LF9L 4LFBL 2NN6I 1MIUA 3JAMi 1XPOA 5IY0A 4BXXG 3GTLH 2E5LL 2HHHL 3S2HH 4JCVE 2JJQA 5FLXc 1E1OA 4JOIC 4X6AH 5EAYA 2KHIA 2VQEQ 3L7ZC 5GAEC 3NENA 1IXRA 4TQUS 4LF8Q 1GD7A 2K5HA 2UUAQ 3CPWA 1JB7A 2B29A 3UDIA 1EOVA 4JOIA 4A3IH 2YYZA 1FJGQ 2OQKA 2UXBL 1YVCA 2NVTH 3S1NH 4ALPA 1KC8C 2NVQH 3I55A 1A8VA 1CSPA 1K83H 1WJJA 1D8LA 1JJCB 1OXSC 2NVYH 3GTJH 4NXML 1YZ6A 2MFIA 4QY7A 4A3CH 2Z0SA 4PMWA 4GLXA 4JYAL 1C7YA 1I94L 5AJ3L 1PHJA 3CQZH 2C35B 1IYJB 1WCMG 3PIPA 1TWCH 1WYDA 4GN4B 4IPGA 1I6HH 3HOVH 4BA2I 4EX5A 2R6GA 5LMUQ 1A63A 2GVBA 1YJNA 2JK8A 1Z47A 2VS1A 1VQJA 4DPGA 3CCUA 2VY3A 3TS2A 1NJIC 1QVFA 2UUCL 4A3BH 3K7UC 3K0XA 3I4OA 4IPDA 1G291 3J80i 5IP9H 4YY3Q 2B63G 4JI6L 3ULLA 1CKOA 1Q82C 4DR1L 4J15A 3UDFA 3M7NA 2N49A 3AFQA 3STBC 4X65L 5C0XJ 1LTLA 2BA1A 1HNXL 2ZJRA 1HZBA 3CW2C 2UUBQ 1S40A 4IFDI 2R93G 3EBEA 3PO3G 3KOJA 4O0AA 3PF5A 3BZKA 4DV1L 4B3RL 2MQHA 1X3GA 3TREA 5GADC 3U4VA 2K5NA 4DR2Q 1CSQA 2PI2A 4DV5L 4GKJL 2AWOA 2NN6G 1EQQA 3GTPH 2LXJA 4NB3A 4R4IA 4IJHA 1X3EA 2MNAA 4A4IA 3AFPA 5K36G 4XTCS 1N33Q 3RN2A 2ZTEA 4YHHL 2IX0A 2VQFQ 4DV6Q 2K5VA 3M85A 4DV4L 4GOPC 2UU9Q 2E2HH 1XNRQ 3J7ZC 5C44G 4L5QA 1VQGA 3GTGH 4MZ9A 4JI1L 1XMOQ 2YU9H 4LF9Q 4LFBQ 2RF4A 2KBNA 1YNXA 4JBKA 3UE1A 1VQ7A 4AH6A 1HNWL 3F2CA 5HGQA 4OX9L 2ZTCA 4DR7L 1UE7A 3ICEA 3HOZH 1NMFA 4DR4L 2Z6KC 2R92G 1HH2P 4L5TA 3NBHB 4H02A 4LF7Q 3HOYG 1X6OA 1UEBA 1Z9FA 4AQYQ 5M3FH 3VDYA 4GS3A 4DUYL 3IRBA 3Q8DA 4DK3C 3HOWH 4HJ5A 3B6YA 2I5MX 1Q81C 1UE1A 1EWIA 3GTOH 2CWAA 2Z6KA 2UXBQ 1KXLA 2XGTA 3CCRA 1VQNA 4A93G 4BXXH 3D0FA 1S72A 2VL6A 4JI7L 2RCNA 2UXDL 5IP7G 4A3GG 1V43A 2YV5A 3SGIA 1KD1C 1E24A 4LNQA 1HR0L 1L1OC 1QUQA 4NXMQ 4JYAQ 4C3IH 3CP0A 1I94Q 3K80C 3PGZA 5AJ3Q 1KQSA 3CMEA 1V9PA 3BZCA 1UE5A 4IO9A 1TWFH 3J81i 2IX1A 3S17H 4OO1I 4LW1A 2F52A 1TWHH 4C3HH 4HJAA 2QA4A 3JC66 5LMNW 3RLFA 4IFDG 1PH1A 3HFZB 1VQ8A 2HQLA 3RLNA 2WP8J 1JMCA 1W2BA 1PH6A 1L1OA 1B8AA 4A3FG 1QZHA 4FDBA 2K50A 4PZ8A 1E1TA 5C4JH 5JJIA 3W1BA 4A3EG 2UUCQ 3CC7A 2Q2UA 1SLJA 4NXNL 4JI6Q 1FL0A 3E9HA 2OWOA 3F8TA 4EQ5A 3RZDH 2I5HA 1VQOA 1IBKQ 3I4MG 1C9OA 3PUXA 4GLAC 4X65Q 1HNXQ 3S1MH 1JE5A 1WFQA 3CCEA 1VQPA 4LFAQ 1QVGA 4DV1Q 1TWGH 3DM3A 4JBWA 4POFA 4DV7L 3HOXH 3E9IA 5FJ8H 3EN2A 4APVA 5ELNA 3GDEA 3H3VI 4UPAA 3STBD 4BY7G 4RG1A 3NELA 4HJ7A 3TS0A 3H0GG 3PUVA 1X9NA 4NPSA 2B63H 1QZGA 4YHHQ 3GO5A 2E8GA 4MTNA 2AHOB 4JI3Q 2BA0A 4JI5L 3ZJYC 2CFMA 2R93H 4JI1Q 3PO3H 3CPFA 1HZ9A 4X64L 4JC0A 1MKHA 4A3JG 4DV0L 1HNWQ 3AQQA 1S3OA 4OX9Q 4UY8C 1X55A 4B3SL 1AE2A 1J5EL 1CKNA 3CCMA 4DR4Q 3I4NG 3PF4A 3PUWA 1SR3A 4X62Q 4LF6L 4DUZQ 4KHPL 4P74A 2OQ0A 2I5LX 2ATWA 3M4QA 1SMXA 3MXNB 4KHZA 4DUYQ 4A3LG 1YBYA 1QVCA 3H15A 2PMZE 5C44H 4JBMA 4XIGS 5C4XG 1SFOH 2L15A 2JA8G 4OO1G 1A62A 3TRZA 3HOUH 4JI7Q 2D0OA 2EXDA 4UP8A 4JG2A 1Q1BA 2HIXA 1RIPA 4K0KQ 3UDXA 1L1OB 1GM5A 3GTKH 3KF6A 1X54A 2R92H 3TQYA 4LF4L 3HOYH 1JJGA 1NY4A 3F2BA 4B3ML 2ZM6L 3E0EA 1Q46A 2F4VL 3EIVA 4YCVA 1YI2A 1IBLL 4JI4L 4IFDJ 4HIDA 3U58A 4YCUA 3ULPA 4BBRG 4X66L 3CXCA 1N36L 3AYHB 1XNQL 3A74A 3U4ZA 5GROA 5JEAG 4A93H 2CQOA 4GN3B 2K4KA 5IYCG 1H95A 1FVIA 1Q8KA 3RN5A 4A3GH 3CC2A 4P73A 4NXNQ 3W5OA 5GAGC 3ER0A 1W3SA 1IBML 3RZOH 4JI0L 5IT9c 3S1QH 1LUZA 1OXUA 2JA5G 4GKKL 2D0PA 4AIMA 2YTVA 1HJPA 2IY5B 4JI8L 4BY1H 1XPUA 5IYDG 4DR5Q 4UP7A 3FKIH 4DV7Q 2JA6G 3KLWA 1EYGA 2K14A 5DLQE 4P72A 4C2MH 1N8RC 2DGYA 1VS0A 2EIFA 4RMFA 3CMAA 4A3FH 1RL2A 4OXPA 1HZAA 1KAWA 1KHIA 2B3GA 1CKNB 1DGSA 1NTGA 2NVXH 1N32L 2E5LQ 4LUZA 1K8AC 2HHHQ 2Q2TA 2JE6I 2Y0SG 5C0XI 2VZAA 2ID0A 2OTLA 3I4MH 3F2DA 4GOPA 4JI5Q 2ZJQA 4LUVA 5LMNL 1PH7A 2GVAA 4DNIA 1G6PA 4X64Q 1AH9A 3T1YL 3I7FA 1PH3A 3D31A 4B3SQ 4BBSG 2PI2E 1KL9A 4BY7H 4JI2L 2ZTDA 3M4PA 4A76A 2A8VA 4KHPQ 1N34L 4LF8L 3A5UA 3H0GH 1Y1WG 1PH2A 4P71A 4YWMA 3KF6B 3LGJA 3PCOB 2V1CC 3U50C 4GLVB 4R4TA 3NEMA 1K0RA 1P8LA 1XTDA 2AKWB 3PSIA 5E7NA 5M5YH 1VQMA 2EQSA 3K81C 2R7DA 1P16A 2E2IH 3PV0A 2Q2IA 1OXXK 5FLMG 1GVPA 4A3MG 3A5ZB 4A3JH 1FGUA 1IL2A 3S16H 3KF8B 3J81j 3MEFA 5IP9G 1PH8A 1BBWA 2HIVA 1BVSA 3I4NH 3T1HL 1VQ4A 1MJCA 1KIXA 1B70B 1YIJA 4B3MQ 4OONA 4A3KG 1VQCA 3HKZG 2HT1A 1JJ2A 5JEAJ 2YTXA 4X66Q 4DR1Q 1N36Q 1Y14B 2JA8H 1L0WA 3K8AA 4DAYB 4QL5A 4DKAC 4KLKA 4C3JH 4DR3L 4YCWA 4A3DG 4R4OA 1WCMH 1PH4A 1V1QA 3W1GA 1NBWA 3I2ZA 2UXCL 1NMGA 5JJKA 4YY3L 1U5KA 4DV5Q 4GKJQ 1XMQL 5C3EG 1VQ6A 4JI0Q 1WI5A 4GKKQ 3PO2G 4JI8Q 1YHBA 2JA7G 4AYBE 4GOPB 3HKSA 3G4SA 3J7A5 3M3YH 3S15H 4BBRH 1J6QA 4DV4Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UE6 A;  4ME3 A;  4AYB G;  1PVO A;  1HNZ L;  1VQ9 A;  1VQD A;  5JJL A;  1Q12 A;  3S24 A;  1D7Q A;  3BJU A;  2JEB I;  3OYY A;  3WWV A;  3H3V H;  2JEA I;  3ULJ A;  1LYL A;  1N32 Q;  4HJ8 A;  3OW2 A;  1Q1E A;  4QIW E;  4TVA B;  5M3F G;  4DR7 Q;  2VQF L;  4DV6 L;  3HOW G;  1CKM A;  2UU9 L;  1XNR L;  1A0I A;  2AWN A;  1HZC A;  2BH8 A;  2PQA A;  5LMN Q;  3JAM c;  1VQL A;  4Y7N H;  3G6E A;  3BU2 A;  1PA6 A;  1GO3 E;  4JBJ A;  1I5F A;  1ASZ A;  3T1Y Q;  2JA6 H;  2IT1 A;  2YTY A;  3AEV A;  5H1S E;  2R7Z G;  2RHS B;  1QUQ B;  4PG3 A;  3KYH C;  2JA9 A;  5IWA L;  2OCE A;  1KRT A;  4OWT B;  4JI2 Q;  1KRS A;  1BBU A;  1I50 H;  4LF7 L;  1SRO A;  1N34 Q;  3CCS A;  4B3R Q;  2IHE A;  3M4O H;  4PZ6 A;  1M90 C;  4DK6 C;  2WB1 E;  4AQY L;  2UXD Q;  3KDF A;  4B3T L;  1VQI A;  4DV2 L;  2CWP A;  2OTJ A;  1X65 A;  1VQA A;  2WB1 G;  3L2P A;  2E2J H;  1HR0 Q;  3F1Z A;  4POG A;  4GN5 A;  4R4C A;  1AE3 A;  3GTQ H;  1Q7Y C;  1N9W A;  5IYB G;  5M3M G;  2GN5 A;  2VUM G;  1YHA A;  1MJE A;  2XTI A;  1EFW A;  4BBS H;  1Y1V G;  1YEZ A;  3OTO L;  3KJP A;  2ZJP A;  1OTC A;  2MO0 A;  3CCL A;  1PYB A;  3G71 A;  3RR5 A;  3CF5 A;  2F3I A;  3T1H Q;  4DR6 L;  1EIF A;  1X56 A;  4LF5 L;  1Y1W H;  3PIO A;  3PUZ A;  5IP7 H;  3RLO A;  1LM0 A;  1SN8 A;  3K7A H;  4IPC A;  4MNO A;  3ERS X;  1YHQ A;  1G51 A;  1PYS B;  2N78 A;  2WFW A;  1YIT A;  1PV4 A;  4LFC L;  3UDG A;  2Q2H A;  2PNH A;  3HOX G;  2NZH A;  5FJ8 G;  1OXT A;  1NE3 A;  2BH2 A;  1SRU A;  2VW9 A;  5IE8 A;  5FLM H;  4A3M H;  1U0L A;  4GNX C;  4R4Q A;  3J80 c;  1GKH A;  5M5W H;  4DR3 Q;  4IOA A;  2CKZ B;  3FP9 A;  3S1R H;  3KFU A;  1VQB A;  3FHW A;  4HIO A;  4L5S A;  4P75 A;  5GAH C;  2UXC Q;  1XJV A;  1IBK L;  1XMQ Q;  1X3F A;  1O7I A;  4IJL A;  1VQF A;  5IYD H;  4DAM A;  4A3K H;  4A3E H;  4PZ7 A;  2Y0S E;  2ASB A;  4LFA L;  4GNX A;  1VQ5 A;  3CC4 A;  4DV3 L;  3G48 A;  2PQA B;  3RNU A;  1IZ6 A;  1CUK A;  4IOC A;  5BR8 L;  3CCV A;  1TWA H;  4HIM A;  1VCI A;  2RHQ B;  1PH5 A;  1HNZ Q;  4JV5 L;  2FXQ A;  5HY6 A;  4A3I G;  1OXV A;  4A3D H;  2K52 A;  3CAM A;  3CCJ A;  4DV0 Q;  4IPH A;  1EIY B;  1J5E Q;  3L0O A;  5C3E H;  2VQE L;  1UWV A;  1E22 A;  4JI3 L;  3PUY A;  4WJ3 M;  3GD7 A;  3GTM H;  4QQB X;  4LF6 Q;  3PO2 H;  3KDF B;  1PH9 A;  4A3C G;  2UUA L;  2JA7 H;  3UE0 A;  4R1J A;  2H5X A;  4OWW B;  3HOU G;  1PFS A;  5IWA Q;  2AMC B;  2JQO A;  2IHF A;  1FJG L;  2KHJ A;  3HOV G;  1BKB A;  4BA1 I;  2KEN A;  1EQR A;  2QEX A;  1WOC A;  4X62 L;  4L5R C;  4DUZ L;  2VNU D;  4A75 A;  1E3P A;  1XPR A;  1T9H A;  4B3T Q;  4DV2 Q;  1YJW A;  4A3B G;  4UP9 A;  4LF4 Q;  3CCQ A;  2N3S A;  2K75 A;  3HKZ E;  2KCM A;  4LWC A;  2R7Z H;  1I3Q H;  2ZM6 Q;  4A3L H;  2F4V Q;  1EUJ A;  1IBL Q;  1ASY A;  4JI4 Q;  2MO1 A;  5GQO A;  3DLL A;  5J3B A;  3OTO Q;  1VQH A;  5C4X H;  4K0K L;  3S14 H;  2LSS A;  2WAQ E;  1XNQ Q;  4DR6 Q;  1M1K C;  1VQK A;  1VQE A;  5LMU L;  2I0Q A;  4LF5 Q;  1B7Y B;  2D62 A;  4WJ4 A;  1TXY A;  2WAQ G;  1K73 C;  3J81 c;  5M5X H;  1K9M C;  4HIK A;  1C0A A;  2LXK A;  4BY1 G;  1R9T H;  3FKI G;  1Q86 C;  4LFC Q;  1IBM Q;  4Y52 H;  4GNX B;  5IYB H;  4QGU A;  4KI0 A;  5M3M H;  2UUB L;  3S2D H;  2VUM H;  5C0X G;  1E7Z A;  1K3R A;  4YWK A;  1Y1V H;  2ALY B;  2A1A A;  2QGQ A;  1JT8 A;  2ES2 A;  4DR2 L;  2CCZ A;  3HOZ G;  1K8G A;  1YJ9 A;  5IYC H;  4QJF A;  2A19 A;  4LUO A;  4OWX B;  4HJ9 A;  3M9B A;  3CD6 A;  3TEH B;  4O2D A;  2N8N A;  1N33 L;  3I56 A;  4DR5 L;  4DV3 Q;  1HR0 W;  2KCT A;  5ELO A;  2R7F A;  5BR8 Q;  2JA5 H;  1SE8 A;  2NZO A;  3A0J A;  3KJO A;  4JV5 Q;  2DUD A;  1L2F A;  4YWL A;  1XMO L;  4LF9 L;  4LFB L;  2NN6 I;  1MIU A;  3JAM i;  1XPO A;  5IY0 A;  4BXX G;  3GTL H;  2E5L L;  2HHH L;  3S2H H;  4JCV E;  2JJQ A;  5FLX c;  1E1O A;  4JOI C;  4X6A H;  5EAY A;  2KHI A;  2VQE Q;  3L7Z C;  5GAE C;  3NEN A;  1IXR A;  4TQU S;  4LF8 Q;  1GD7 A;  2K5H A;  2UUA Q;  3CPW A;  1JB7 A;  2B29 A;  3UDI A;  1EOV A;  4JOI A;  4A3I H;  2YYZ A;  1FJG Q;  2OQK A;  2UXB L;  1YVC A;  2NVT H;  3S1N H;  4ALP A;  1KC8 C;  2NVQ H;  3I55 A;  1A8V A;  1CSP A;  1K83 H;  1WJJ A;  1D8L A;  1JJC B;  1OXS C;  2NVY H;  3GTJ H;  4NXM L;  1YZ6 A;  2MFI A;  4QY7 A;  4A3C H;  2Z0S A;  4PMW A;  4GLX A;  4JYA L;  1C7Y A;  1I94 L;  5AJ3 L;  1PHJ A;  3CQZ H;  2C35 B;  1IYJ B;  1WCM G;  3PIP A;  1TWC H;  1WYD A;  4GN4 B;  4IPG A;  1I6H H;  3HOV H;  4BA2 I;  4EX5 A;  2R6G A;  5LMU Q;  1A63 A;  2GVB A;  1YJN A;  2JK8 A;  1Z47 A;  2VS1 A;  1VQJ A;  4DPG A;  3CCU A;  2VY3 A;  3TS2 A;  1NJI C;  1QVF A;  2UUC L;  4A3B H;  3K7U C;  3K0X A;  3I4O A;  4IPD A;  1G29 1;  3J80 i;  5IP9 H;  4YY3 Q;  2B63 G;  4JI6 L;  3ULL A;  1CKO A;  1Q82 C;  4DR1 L;  4J15 A;  3UDF A;  3M7N A;  2N49 A;  3AFQ A;  3STB C;  4X65 L;  5C0X J;  1LTL A;  2BA1 A;  1HNX L;  2ZJR A;  1HZB A;  3CW2 C;  2UUB Q;  1S40 A;  4IFD I;  2R93 G;  3EBE A;  3PO3 G;  3KOJ A;  4O0A A;  3PF5 A;  3BZK A;  4DV1 L;  4B3R L;  2MQH A;  1X3G A;  3TRE A;  5GAD C;  3U4V A;  2K5N A;  4DR2 Q;  1CSQ A;  2PI2 A;  4DV5 L;  4GKJ L;  2AWO A;  2NN6 G;  1EQQ A;  3GTP H;  2LXJ A;  4NB3 A;  4R4I A;  4IJH A;  1X3E A;  2MNA A;  4A4I A;  3AFP A;  5K36 G;  4XTC S;  1N33 Q;  3RN2 A;  2ZTE A;  4YHH L;  2IX0 A;  2VQF Q;  4DV6 Q;  2K5V A;  3M85 A;  4DV4 L;  4GOP C;  2UU9 Q;  2E2H H;  1XNR Q;  3J7Z C;  5C44 G;  4L5Q A;  1VQG A;  3GTG H;  4MZ9 A;  4JI1 L;  1XMO Q;  2YU9 H;  4LF9 Q;  4LFB Q;  2RF4 A;  2KBN A;  1YNX A;  4JBK A;  3UE1 A;  1VQ7 A;  4AH6 A;  1HNW L;  3F2C A;  5HGQ A;  4OX9 L;  2ZTC A;  4DR7 L;  1UE7 A;  3ICE A;  3HOZ H;  1NMF A;  4DR4 L;  2Z6K C;  2R92 G;  1HH2 P;  4L5T A;  3NBH B;  4H02 A;  4LF7 Q;  3HOY G;  1X6O A;  1UEB A;  1Z9F A;  4AQY Q;  5M3F H;  3VDY A;  4GS3 A;  4DUY L;  3IRB A;  3Q8D A;  4DK3 C;  3HOW H;  4HJ5 A;  3B6Y A;  2I5M X;  1Q81 C;  1UE1 A;  1EWI A;  3GTO H;  2CWA A;  2Z6K A;  2UXB Q;  1KXL A;  2XGT A;  3CCR A;  1VQN A;  4A93 G;  4BXX H;  3D0F A;  1S72 A;  2VL6 A;  4JI7 L;  2RCN A;  2UXD L;  5IP7 G;  4A3G G;  1V43 A;  2YV5 A;  3SGI A;  1KD1 C;  1E24 A;  4LNQ A;  1HR0 L;  1L1O C;  1QUQ A;  4NXM Q;  4JYA Q;  4C3I H;  3CP0 A;  1I94 Q;  3K80 C;  3PGZ A;  5AJ3 Q;  1KQS A;  3CME A;  1V9P A;  3BZC A;  1UE5 A;  4IO9 A;  1TWF H;  3J81 i;  2IX1 A;  3S17 H;  4OO1 I;  4LW1 A;  2F52 A;  1TWH H;  4C3H H;  4HJA A;  2QA4 A;  3JC6 6;  5LMN W;  3RLF A;  4IFD G;  1PH1 A;  3HFZ B;  1VQ8 A;  2HQL A;  3RLN A;  2WP8 J;  1JMC A;  1W2B A;  1PH6 A;  1L1O A;  1B8A A;  4A3F G;  1QZH A;  4FDB A;  2K50 A;  4PZ8 A;  1E1T A;  5C4J H;  5JJI A;  3W1B A;  4A3E G;  2UUC Q;  3CC7 A;  2Q2U A;  1SLJ A;  4NXN L;  4JI6 Q;  1FL0 A;  3E9H A;  2OWO A;  3F8T A;  4EQ5 A;  3RZD H;  2I5H A;  1VQO A;  1IBK Q;  3I4M G;  1C9O A;  3PUX A;  4GLA C;  4X65 Q;  1HNX Q;  3S1M H;  1JE5 A;  1WFQ A;  3CCE A;  1VQP A;  4LFA Q;  1QVG A;  4DV1 Q;  1TWG H;  3DM3 A;  4JBW A;  4POF A;  4DV7 L;  3HOX H;  3E9I A;  5FJ8 H;  3EN2 A;  4APV A;  5ELN A;  3GDE A;  3H3V I;  4UPA A;  3STB D;  4BY7 G;  4RG1 A;  3NEL A;  4HJ7 A;  3TS0 A;  3H0G G;  3PUV A;  1X9N A;  4NPS A;  2B63 H;  1QZG A;  4YHH Q;  3GO5 A;  2E8G A;  4MTN A;  2AHO B;  4JI3 Q;  2BA0 A;  4JI5 L;  3ZJY C;  2CFM A;  2R93 H;  4JI1 Q;  3PO3 H;  3CPF A;  1HZ9 A;  4X64 L;  4JC0 A;  1MKH A;  4A3J G;  4DV0 L;  1HNW Q;  3AQQ A;  1S3O A;  4OX9 Q;  4UY8 C;  1X55 A;  4B3S L;  1AE2 A;  1J5E L;  1CKN A;  3CCM A;  4DR4 Q;  3I4N G;  3PF4 A;  3PUW A;  1SR3 A;  4X62 Q;  4LF6 L;  4DUZ Q;  4KHP L;  4P74 A;  2OQ0 A;  2I5L X;  2ATW A;  3M4Q A;  1SMX A;  3MXN B;  4KHZ A;  4DUY Q;  4A3L G;  1YBY A;  1QVC A;  3H15 A;  2PMZ E;  5C44 H;  4JBM A;  4XIG S;  5C4X G;  1SFO H;  2L15 A;  2JA8 G;  4OO1 G;  1A62 A;  3TRZ A;  3HOU H;  4JI7 Q;  2D0O A;  2EXD A;  4UP8 A;  4JG2 A;  1Q1B A;  2HIX A;  1RIP A;  4K0K Q;  3UDX A;  1L1O B;  1GM5 A;  3GTK H;  3KF6 A;  1X54 A;  2R92 H;  3TQY A;  4LF4 L;  3HOY H;  1JJG A;  1NY4 A;  3F2B A;  4B3M L;  2ZM6 L;  3E0E A;  1Q46 A;  2F4V L;  3EIV A;  4YCV A;  1YI2 A;  1IBL L;  4JI4 L;  4IFD J;  4HID A;  3U58 A;  4YCU A;  3ULP A;  4BBR G;  4X66 L;  3CXC A;  1N36 L;  3AYH B;  1XNQ L;  3A74 A;  3U4Z A;  5GRO A;  5JEA G;  4A93 H;  2CQO A;  4GN3 B;  2K4K A;  5IYC G;  1H95 A;  1FVI A;  1Q8K A;  3RN5 A;  4A3G H;  3CC2 A;  4P73 A;  4NXN Q;  3W5O A;  5GAG C;  3ER0 A;  1W3S A;  1IBM L;  3RZO H;  4JI0 L;  5IT9 c;  3S1Q H;  1LUZ A;  1OXU A;  2JA5 G;  4GKK L;  2D0P A;  4AIM A;  2YTV A;  1HJP A;  2IY5 B;  4JI8 L;  4BY1 H;  1XPU A;  5IYD G;  4DR5 Q;  4UP7 A;  3FKI H;  4DV7 Q;  2JA6 G;  3KLW A;  1EYG A;  2K14 A;  5DLQ E;  4P72 A;  4C2M H;  1N8R C;  2DGY A;  1VS0 A;  2EIF A;  4RMF A;  3CMA A;  4A3F H;  1RL2 A;  4OXP A;  1HZA A;  1KAW A;  1KHI A;  2B3G A;  1CKN B;  1DGS A;  1NTG A;  2NVX H;  1N32 L;  2E5L Q;  4LUZ A;  1K8A C;  2HHH Q;  2Q2T A;  2JE6 I;  2Y0S G;  5C0X I;  2VZA A;  2ID0 A;  2OTL A;  3I4M H;  3F2D A;  4GOP A;  4JI5 Q;  2ZJQ A;  4LUV A;  5LMN L;  1PH7 A;  2GVA A;  4DNI A;  1G6P A;  4X64 Q;  1AH9 A;  3T1Y L;  3I7F A;  1PH3 A;  3D31 A;  4B3S Q;  4BBS G;  2PI2 E;  1KL9 A;  4BY7 H;  4JI2 L;  2ZTD A;  3M4P A;  4A76 A;  2A8V A;  4KHP Q;  1N34 L;  4LF8 L;  3A5U A;  3H0G H;  1Y1W G;  1PH2 A;  4P71 A;  4YWM A;  3KF6 B;  3LGJ A;  3PCO B;  2V1C C;  3U50 C;  4GLV B;  4R4T A;  3NEM A;  1K0R A;  1P8L A;  1XTD A;  2AKW B;  3PSI A;  5E7N A;  5M5Y H;  1VQM A;  2EQS A;  3K81 C;  2R7D A;  1P16 A;  2E2I H;  3PV0 A;  2Q2I A;  1OXX K;  5FLM G;  1GVP A;  4A3M G;  3A5Z B;  4A3J H;  1FGU A;  1IL2 A;  3S16 H;  3KF8 B;  3J81 j;  3MEF A;  5IP9 G;  1PH8 A;  1BBW A;  2HIV A;  1BVS A;  3I4N H;  3T1H L;  1VQ4 A;  1MJC A;  1KIX A;  1B70 B;  1YIJ A;  4B3M Q;  4OON A;  4A3K G;  1VQC A;  3HKZ G;  2HT1 A;  1JJ2 A;  5JEA J;  2YTX A;  4X66 Q;  4DR1 Q;  1N36 Q;  1Y14 B;  2JA8 H;  1L0W A;  3K8A A;  4DAY B;  4QL5 A;  4DKA C;  4KLK A;  4C3J H;  4DR3 L;  4YCW A;  4A3D G;  4R4O A;  1WCM H;  1PH4 A;  1V1Q A;  3W1G A;  1NBW A;  3I2Z A;  2UXC L;  1NMG A;  5JJK A;  4YY3 L;  1U5K A;  4DV5 Q;  4GKJ Q;  1XMQ L;  5C3E G;  1VQ6 A;  4JI0 Q;  1WI5 A;  4GKK Q;  3PO2 G;  4JI8 Q;  1YHB A;  2JA7 G;  4AYB E;  4GOP B;  3HKS A;  3G4S A;  3J7A 5;  3M3Y H;  3S15 H;  4BBR H;  1J6Q A;  4DV4 Q; 
#chains in the Genus database with same CATH topology
 1B3Q A;  1EYD A;  5JJL A;  2IW3 A;  3WWV A;  3H3V H;  3H09 A;  4HJ8 A;  3OW2 A;  1Q1E A;  5M3F G;  2BE5 C;  2VQF L;  4A3D B;  3HOW G;  1MSH A;  1CKM A;  2UU9 L;  3TSS A;  2TSS A;  2AWN A;  2WAC A;  3FMC A;  1I6H H;  4IQZ A;  3A8I E;  2IT1 A;  3AEV A;  2A6E C;  3SK8 A;  3VA5 A;  3VR6 A;  3PO2 B;  2JA7 B;  1KRT A;  4OWT B;  2LY7 A;  4DNT B;  1I50 H;  1GUT A;  3OW7 A;  1SNO A;  1D1K A;  3OWF A;  5KNB A;  3ERQ A;  2E2J H;  3ITP A;  5IGB A;  1D5X C;  5C5M A;  1IW7 D;  1EFW A;  3Q0A A;  1Y1V G;  2CQA A;  2QKI C;  2R7Z B;  1OTC A;  2MO0 A;  1EOT A;  3T1H Q;  1Y1W H;  4QCL A;  1EWC A;  3V05 A;  1YHQ A;  3D4W A;  2RKS A;  4C3I B;  1JWS D;  1YIT A;  2BH2 A;  3BDC A;  4N8F A;  1F77 A;  3FDT A;  3URY A;  3J80 L;  5M5W H;  1VQB A;  4P75 A;  1XJV A;  1VF5 C;  1H9M A;  1X3F A;  4XXE A;  1TS2 A;  1PFB A;  2LMC B;  4HN7 A;  4RGO S;  1F2M A;  3BVZ A;  3G48 A;  3KK7 A;  4M8A A;  4OIK A;  3CCV A;  1TWA H;  1VCI A;  2FXQ A;  3HOX B;  1EY4 A;  1GXD C;  2CH4 A;  2K52 A;  1TKW B;  2CW0 D;  1EIY B;  1U4L A;  4CDF C;  1EY7 A;  1TII D;  4EQO A;  3GTL B;  4N9P A;  4A3C G;  3KDF B;  1KDB A;  3UE0 A;  1LT5 D;  1F9R A;  4R1J A;  2H5X A;  1JR0 D;  1PFS A;  1LTT D;  1FJG L;  3H91 A;  4O1N A;  2F0V A;  4H44 C;  2F3W A;  2KEN A;  3MA2 B;  4L5R C;  4A75 A;  1WD1 A;  1SNM A;  3I72 A;  2B2W C;  3C1E A;  4DV2 Q;  1T5X D;  4A3B G;  3GP7 A;  2F0M A;  3O13 A;  2K75 A;  2N3S A;  5F2D A;  1RTN A;  4LAA A;  3R8B A;  3HZX A;  1I3Q H;  3TZD A;  4A3L H;  1IBL Q;  4ZUJ A;  3S9W A;  2B2W A;  3OTO Q;  5J22 A;  3K58 A;  3HOU B;  3VA7 A;  1VMP A;  4Z9C B;  3TN2 A;  4LF5 Q;  1CQF A;  1TXY A;  5M5X H;  4ME5 A;  2KEC A;  2LXK A;  4KY6 A;  4LFC Q;  1PXU A;  1Q86 C;  3SEB A;  3H94 A;  5IYB H;  5M3M H;  3SE0 A;  2VUM H;  1STE A;  4YWK A;  2ALY B;  5G3L D;  1STN A;  1NNX A;  1JT8 A;  4H13 C;  1SBB B;  3MAQ A;  4QMG A;  2WIN B;  2A19 A;  2IWH A;  3M9B A;  3TEH B;  2L5T A;  4PNY A;  1B2T A;  1J9O A;  1HR0 W;  5COR A;  3VYS A;  5ELO A;  1Y8N B;  5BR8 Q;  4IUN A;  2NZO A;  4JV5 Q;  4YWL A;  1E2V A;  1L2F A;  3VR3 A;  4CJ2 C;  3NK9 A;  1XMO L;  4LFB L;  2NN6 I;  4HCS A;  5FLX L;  5IY0 A;  1ESR A;  3S2H H;  4ZLT F;  3NQT A;  4JOI C;  5KND A;  4K5X A;  4IUP A;  3FVQ A;  3NEN A;  1IXR A;  4KTA A;  1JB7 A;  5IOC A;  2K5Q A;  3KLR A;  4JOI A;  1KLG D;  4A3I H;  3NQI A;  4RWS C;  4PMB A;  4ALP A;  2NVQ H;  4IUV A;  1A8V A;  2F0Q A;  2Z9H A;  4FF1 A;  1WJJ A;  1D8L A;  1YZ6 A;  4JYA L;  2Z0S A;  4PMW A;  1PRT F;  4C3J G;  1WYD A;  4GN4 B;  3CU7 A;  3HOV H;  3S17 B;  4B9W A;  4RKB A;  5LMU Q;  1TWH B;  4C3H B;  1YJN A;  4ODG A;  1Z47 A;  4DXG A;  4L63 B;  2O2L D;  1NJI C;  3WDN A;  2EY6 A;  1Q90 A;  1DOM A;  3ULL A;  1CKO A;  2KOL A;  3QIA A;  5JJZ A;  5C4J B;  3CW2 C;  2UUB Q;  4IFD I;  2BOS A;  3PO3 G;  5C5L A;  3RZD B;  1B9M A;  3S1M B;  2ZXP A;  2EYL A;  1L0X B;  2PI2 A;  4K2K A;  4KY7 A;  2SOB A;  4GKJ L;  1WCM B;  1EU3 A;  2LXJ A;  1XWE A;  4XTC S;  3RN2 A;  4RCO A;  2ZTE A;  1QNK A;  2K5V A;  1PLF A;  4CDE C;  3C1F A;  5C44 G;  4MZ9 A;  4PQX A;  2YU9 H;  3BVG A;  5ELD A;  3F2C A;  4OX9 L;  3HOZ H;  2R92 G;  4L5T A;  4LF7 Q;  3MXU A;  1UEB A;  4AQY Q;  3I70 A;  5M3F H;  3VDY A;  4DUY L;  3HOW H;  2CWA A;  3T51 B;  1EY0 A;  1S72 A;  5A35 A;  5IP7 G;  1I50 B;  4A3G G;  1ET9 A;  1V43 A;  2YV5 A;  3MXN A;  4LNQ A;  2EYJ A;  3D3R A;  4NXM Q;  5IGC A;  3MTS A;  3DXJ C;  2V4D A;  3K80 C;  2NTT A;  5EKI A;  4LW1 A;  4HJA A;  2JP1 A;  4DAV A;  1F2Y A;  3NUC A;  2F0F A;  2MJ8 A;  2VXW A;  1W2B A;  5IT9 E;  1B50 A;  2EZV A;  4PZ8 A;  1ONL A;  2PZU A;  4A3E G;  2UUC Q;  4DXF A;  4JI6 Q;  2EYH A;  1D5M C;  1IBK Q;  4GLA C;  1HNX Q;  3MHB A;  1WFQ A;  2PCF B;  1QVG A;  4CJ0 B;  3DM3 A;  4APV A;  1QB5 D;  4UPA A;  1D5Z C;  1DON A;  3NEL A;  2RQX A;  1WD0 A;  1TU2 B;  2R3Z A;  2EPB A;  1QZG A;  2E8G A;  3NWT A;  5FOB B;  2KJX A;  3ZJY C;  3BZD B;  2R93 H;  4JI1 Q;  1SMY C;  1XX8 A;  3CPF A;  1NR4 A;  2SNM A;  3I4M B;  3KBX A;  4DR4 Q;  4RA8 A;  4G57 A;  4OHJ A;  4X62 Q;  2D2C C;  4P74 A;  2I5L X;  2ATW A;  3M4Q A;  1SMX A;  2E74 C;  4BY7 B;  1YBY A;  2XRQ D;  1YNN C;  4G7H C;  4XIG S;  1SFO H;  4OO1 G;  5KIX A;  2E2I B;  1EL0 A;  4UP8 A;  3V96 A;  4DF7 A;  4LMQ D;  3U9O A;  4A3J B;  1CHP D;  3TQY A;  3HOY H;  2L55 A;  1IBL L;  3K5L A;  4IFD J;  3P7J A;  3U58 A;  5EPK A;  4X66 L;  4QUF A;  5EQ0 A;  2DY7 A;  1Q8K A;  2JA8 B;  2D9U A;  3I3C A;  1JOK A;  2X6L A;  3EVQ A;  4GKK L;  1LUZ A;  2JA5 G;  1G8Z D;  4NP5 A;  4AIM A;  1HJP A;  1GUO A;  1IYU A;  4JI8 L;  3I8Z A;  1SSO A;  3EA6 A;  3K5O A;  4DR5 Q;  1XPU A;  4DV7 Q;  3P20 A;  3S15 B;  2DGY A;  4RMF A;  1ZYR C;  4BBR B;  4CJ1 B;  2EY2 A;  4OXP A;  1KAW A;  3JAM E;  1LAB A;  2B3G A;  4I7Z C;  4XQQ A;  1N32 L;  1W6J A;  2E5L Q;  2HHH Q;  2B39 A;  5DM6 3;  2Y0S G;  1CA5 A;  3HEJ A;  4JI5 Q;  4ZUI A;  4LUV A;  5LMN L;  1G6P A;  1OO9 B;  4X64 Q;  1SYD A;  2PI2 E;  1C4Q A;  2EJG C;  2JA6 B;  2WII B;  2K03 A;  1PFN A;  3DEO A;  1EQT A;  1Y1W G;  3H0G H;  5G3L F;  4B3R L;  4P71 A;  3PCO B;  5J1Z A;  4GLV B;  1K0R A;  2CHB D;  3TP8 A;  4XQN A;  1VQM A;  4J1M A;  2Q2I A;  2HQE A;  2K1B A;  3KBG A;  4CDD C;  2L9H A;  3S16 H;  3BDL A;  3A8J E;  4KD3 A;  2HIV A;  1BVS A;  3I4N H;  3HGB A;  2O4X A;  1VQC A;  3HKZ G;  2F4I A;  1KLU D;  2F0D A;  1PTO B;  1Y14 B;  4DAY B;  5CYU A;  4C3J H;  3TBI B;  1KDC A;  1DJR D;  1MHW C;  1NMG A;  4JK1 C;  3W2D A;  4E6I A;  5JPN C;  4DV5 Q;  3KLS X;  1XMQ L;  4JI0 Q;  3OHX C;  1H9J A;  3DWP A;  3G4S A;  3M3Y H;  3J7A 5;  2HUG A;  1E2Z A;  1UE6 A;  4AYB G;  5IGG A;  5LL6 X;  2LKV A;  5CV5 A;  5DNF A;  5JEA H;  1VQD A;  1EYA A;  3G7L A;  4OGQ C;  4PV1 C;  3TP6 A;  1MGS A;  2JEB I;  3A54 A;  3OYY A;  3SK6 A;  4X3K A;  4TVA B;  1HQR D;  2L12 A;  3T4A C;  4DGZ A;  1VQL A;  1HZC A;  5C3E B;  3BU2 A;  1PA6 A;  4JBJ A;  1I5F A;  3T1Y Q;  2RHS B;  4PG3 A;  1TS4 A;  1JB3 A;  5IWA L;  1SE4 A;  3ND8 A;  2A69 D;  4JI2 Q;  2O5I C;  1JC7 A;  3EJI A;  4LF7 L;  1SRO A;  1N34 Q;  2IHE A;  4FP5 D;  3SK5 A;  4PZ6 A;  1M90 C;  4AQY L;  1RJT A;  3KDF A;  2NWG A;  4B3T L;  1VQI A;  1VQA A;  2WB1 G;  3L2P A;  5M3F B;  4POG A;  3HOW B;  2EOT A;  1N9W A;  5IYB G;  2WV6 D;  5M3M G;  3J81 E;  2VUM G;  4OEL B;  5KNC A;  5FO8 B;  4X3T A;  2A6H C;  3CCL A;  1NR2 A;  3CF5 A;  4DR6 L;  1GHK A;  2PW5 A;  2PPB C;  4RHR A;  1QJO A;  5IP7 H;  1EIH A;  4IZ8 A;  3K7A H;  4IPC A;  5LL6 S;  1PYS B;  2N78 A;  2Q2H A;  2PNH A;  1OXT A;  1SRU A;  4IUR A;  2VW9 A;  1U0L A;  4KN7 C;  1KTK A;  2A74 C;  1T5E A;  3FEW X;  1GKH A;  2KCC A;  4DR3 Q;  3S1R H;  5JOB A;  2OEO A;  2X6G A;  1Y1V B;  3N52 A;  1IBK L;  1SYC A;  1Z7T A;  1LAC A;  4A3K H;  4A3E H;  1CM9 A;  4PZ7 A;  2ASB A;  1JOQ A;  2NZ1 D;  1ET6 A;  3NE5 B;  5CV6 A;  1PH5 A;  1HNZ Q;  4A3I G;  1OXV A;  1QCB D;  1SND A;  3T56 B;  4DV0 Q;  4IPH A;  1F2L A;  4XT3 B;  1J5E Q;  1HA5 A;  1K3B C;  3L0O A;  1BUV T;  1UWV A;  3GTM H;  2ZXR A;  3HP3 A;  1PH9 A;  1JOO A;  2UUA L;  1SYB A;  1HTL D;  5I9P A;  2BE5 D;  1I4R A;  2JQO A;  1WTX A;  5JVH 3;  1LTG D;  3HOV G;  2EJM A;  1WOC A;  4X62 L;  2VNU D;  2NUC A;  3EQL C;  3MC0 B;  1E3P A;  2MP1 A;  1XPR A;  2A6E D;  1L0Y B;  2NVT B;  4X3S A;  2SEB D;  4EVO A;  4BS9 A;  4L6T B;  1I4P A;  2F3V A;  4LWC A;  5E3F A;  2RDG A;  4HMJ A;  2F4V Q;  1EUJ A;  4JI4 Q;  2NVY B;  1SFO B;  3GTJ B;  2MO1 A;  3E0J A;  5J3B A;  1XNQ Q;  4OO1 H;  1IHZ A;  3HS0 C;  4J6H A;  4WJ4 A;  3H6M A;  2I0Q A;  2D62 A;  1TWC B;  4R8N A;  1K9M C;  4PMC A;  4BY1 G;  1S4Z A;  3FKI G;  2F0W A;  1IBM Q;  1IKL A;  1SXT A;  4A3B B;  3S2D H;  2BDN A;  1K3R A;  2QGQ A;  3OMC A;  4ZQ3 A;  2F0T A;  2CCZ A;  1BCP C;  3HOZ G;  1K8G A;  3MFY A;  5DAU A;  1NUC A;  2KVM A;  2DN8 A;  4N9T A;  3NSW A;  1TS5 A;  1N33 L;  4DR5 L;  4DV3 Q;  2R7F A;  4K5W A;  2JA5 H;  1SE8 A;  3A0J A;  3KJO A;  1HUN A;  4V19 0;  2DUD A;  2KHS A;  4LF9 L;  3T13 A;  3JAM i;  3SK4 A;  3GTG B;  2OXP A;  2E5L L;  2DNE A;  2HHH L;  1A3T A;  1E1O A;  4QB4 A;  2VQE Q;  3L7Z C;  1SYF A;  3K0Y A;  2QF7 A;  4TQU S;  4DN4 M;  4LF8 Q;  1GD7 A;  2K5H A;  1UUP A;  1ICW A;  3CPW A;  2B29 A;  1JIC A;  4CKB A;  1ENA A;  1SNP A;  1EOV A;  2YYZ A;  1DM0 B;  4HSV A;  1YVC A;  4CGY B;  3S1N H;  3RMH A;  4OEM B;  5ISR A;  3I55 A;  3PIO 3;  4K6D A;  1CSP A;  1SYG A;  1OXS C;  3ND9 A;  1HCZ A;  4GLX A;  1TS3 A;  4HTH A;  1TQO A;  5AJ3 L;  1V8Q A;  2EYP A;  1IYJ B;  3PIP A;  1B44 D;  1DOL A;  4IPG A;  1B53 A;  1TWF B;  2R6G A;  1A63 A;  3TS2 A;  2VS1 A;  2VY3 A;  3E6Z X;  1QVF A;  4IPD A;  3I4O A;  4Q0F A;  4YY3 Q;  1TY2 A;  1TR5 A;  3M7N A;  2N49 A;  3STB C;  5C0X J;  2BA1 A;  2ZJR A;  1HZB A;  1S40 A;  2R93 G;  3EBE A;  2SNS A;  3BZK A;  4ZAI A;  2K5N A;  4DR2 Q;  1CSQ A;  4C3J B;  1TWG B;  4DV5 L;  1EQQ A;  3GTP H;  4A4I A;  1FNU A;  1J8I A;  3I4L A;  1IYV A;  1SNQ A;  2IX0 A;  4DV6 Q;  3M85 A;  4RGT A;  3J7Z C;  1VQG A;  1I4H A;  3F2U A;  4FF4 A;  4JBK A;  1VQ7 A;  2K7V A;  3BG3 A;  3PO3 B;  3ICE A;  4L8J A;  1NMF A;  2Z6K C;  3NBH B;  1IL8 A;  3HOY G;  3MVV A;  3MXG A;  3NWS A;  1FGB D;  4GS3 A;  1QWY A;  3MZ5 A;  3Q8D A;  4DK3 C;  4UHV A;  4HJ5 A;  2I5M X;  1UE1 A;  2ICE C;  4RKL A;  3A7L A;  4C1N I;  3GTO H;  2Z6K A;  2UXB Q;  1STG A;  4RFB A;  4F7X A;  2XGT A;  5C44 B;  3CCR A;  1VQN A;  2RCN A;  4K5V A;  5FO7 B;  2M9V A;  4KY5 A;  3NXW A;  4UDU C;  2LS0 1;  2PW7 A;  1QUQ A;  1AN8 A;  4KJN A;  4U67 3;  4FF3 A;  1I94 Q;  3PGZ A;  2R92 B;  3QO2 A;  3CME A;  3BZC A;  1UE5 A;  3J81 i;  4K8J A;  2QA4 A;  3JC6 6;  5LMN W;  2Z4H A;  1PH1 A;  1VQ8 A;  4G4K A;  4H7B A;  2F0L A;  1LTI D;  2K50 A;  1NSN S;  4LK1 C;  4KMU C;  3SDZ A;  3W1B A;  4OL7 A;  3CC7 A;  1SLJ A;  4NXN L;  2M00 A;  4DNR B;  1FL0 A;  1K28 A;  2OWO A;  2I5H A;  1VQO A;  1CZW A;  4A3G B;  5EKK A;  3PUX A;  4FNF A;  2EVB A;  3CHB D;  4X65 Q;  1JWU D;  3CCE A;  3C2P A;  1G2S A;  3SXH A;  4DV1 Q;  3RZO B;  4JBW A;  1U4P A;  4P2C B;  1H9K A;  2N55 A;  2E2D C;  4FYD A;  1O80 A;  2RA4 A;  2A68 C;  1QG7 A;  2F0S A;  4C2M B;  3H0G G;  3PUV A;  1BF4 A;  1X9N A;  2B63 H;  2F0E A;  5EJW A;  4YHH Q;  2FMM A;  3GO5 A;  2QDB A;  1CI3 M;  4MTN A;  4A3E B;  4KKU A;  2NVX B;  5E4W C;  1R4P B;  1I4X A;  4NMZ A;  4Q5V A;  5ELE A;  1UEA B;  1HZ9 A;  3I90 A;  4JC0 A;  1GUG A;  2RBM A;  1HNW Q;  4DV0 L;  4BWG B;  1V1P B;  1J5E L;  5EBD A;  1QNU A;  2NN6 H;  3I4N G;  4J8Q A;  3PF4 A;  3PUW A;  1PYW D;  1SR3 A;  2HCI A;  4KHP L;  2H1E A;  1TY0 A;  2OQ0 A;  3A7A B;  5L37 A;  3FPP A;  3GTM B;  5IGF A;  2Q8R E;  1HXY D;  4JBM A;  5C4X G;  4HAE A;  4RAU C;  1A62 A;  3TRZ A;  4JI7 Q;  5CV7 A;  2EXD A;  1ENF A;  1AP0 A;  2HIX A;  1RIP A;  2K6A A;  4RGM A;  1CHQ D;  4K0K Q;  2IPK D;  1FYC A;  2OT2 A;  4TRD A;  3F2B A;  2MUY A;  4B3M L;  3E0E A;  2F4V L;  4YCV A;  4JI4 L;  3CXC A;  3AYH B;  1XNQ L;  3A74 A;  5JEA G;  4A93 H;  1PTO C;  5IYC G;  1MI2 A;  1BCP B;  3RN5 A;  3KLS A;  1SJE D;  3CC2 A;  2KA7 A;  1IBM L;  1S5F D;  2XRS D;  5IT9 c;  3S1Q H;  1OXU A;  2D0P A;  1ZXT A;  1PRT B;  4DAY A;  4BY1 H;  4UP7 A;  3FKI H;  3S2D B;  4IFD H;  5FKA C;  4P72 A;  1BDO A;  4A3F H;  3CMA A;  1YNJ C;  1Y8O B;  4JW0 A;  2Q2T A;  1EY6 A;  3F2D A;  3EFX D;  2A5H A;  4DNI A;  1PZK D;  2JA5 B;  3Q23 A;  2B2Y C;  1ICF B;  4B3S Q;  1I6H B;  1GUS A;  1KL9 A;  1SMY D;  3M4P A;  2A8V A;  4LF8 L;  3A5U A;  4IOA A;  1PH2 A;  3KF6 B;  2L4N A;  2B2Y A;  2EQS A;  3K81 C;  2R7D A;  2Y0S B;  3PV0 A;  5A2Q L;  1OXX K;  2E2J B;  4RHS A;  3J7A F;  1FGU A;  1RF2 D;  3KF8 B;  4G7O C;  1YNN D;  1PH8 A;  1BBW A;  2RDF A;  5JPM C;  3T1H L;  4MIU A;  2B2V C;  4GZY C;  1GUN A;  1B70 B;  1YIJ A;  3QOL A;  3CKI B;  4A3K G;  3J80 E;  2HT1 A;  1Y1W B;  1JJ2 A;  2YTX A;  1N36 Q;  4WOR A;  2L0C A;  1PZJ D;  2B2V A;  3LNN A;  4NKL A;  1O7Y A;  3E3X A;  4YCW A;  4R4O A;  1PH4 A;  1NBW A;  3I2Z A;  5JJK A;  4YY3 L;  1U5K A;  4V0B A;  1AFP A;  5M5W B;  3R2T A;  1VQ6 A;  1WI5 A;  1KNE A;  4AYB E;  1K0S A;  1J6Q A;  3RNU A;  4XT1 B;  3HKZ B;  4DV4 Q;  2ZXO A;  4ME3 A;  1VQ9 A;  1D7Q A;  3S24 A;  3BJU A;  1TWA B;  2JEA I;  4CHT B;  3ULJ A;  1LYL A;  2JYO A;  5AFW A;  2PZT A;  4DV6 L;  1LLR D;  1LO5 D;  1ZYR D;  2BH8 A;  2BCO A;  3JAM c;  4Y7N H;  2JSO A;  1GO3 E;  1M4V A;  2YTY A;  1QUQ B;  2JA9 A;  1KRS A;  1BBU A;  3PIP 3;  2MHV A;  4AYB B;  4KKT A;  5CBA E;  4JVZ A;  3M4O H;  5C3W A;  2WB1 E;  3K57 A;  1DD2 A;  3MEH A;  4DV2 L;  2CWP A;  3PMF A;  2OTJ A;  1X65 A;  4CDC C;  3F1Z A;  4R4C A;  1FD7 D;  3GTQ H;  3Q6S A;  1Q7Y C;  2GN5 A;  1BNZ A;  2XTI A;  4M1U B;  4BBS H;  3KJP A;  3OTO L;  1I3Q B;  2ZJP A;  1JCK B;  1PYB A;  3RR5 A;  1RHP A;  5BN3 A;  4B08 A;  4LF5 L;  3PIO A;  3PUZ A;  3RLO A;  2F0H A;  1II3 A;  1BXT A;  2WFW A;  1G91 A;  4LFC L;  1WTW A;  2NZH A;  5FJ8 G;  5BN5 A;  5M5X B;  4K8I A;  4A3M H;  2WB1 B;  1AW7 A;  4QUC A;  4R4Q A;  3FP9 A;  3KFU A;  5M3M B;  2UXC Q;  4L5S A;  2VUM B;  3KUP A;  1O7I A;  4IJL A;  1I4Q A;  4DAM A;  1EEI D;  1VQ5 A;  4X3U A;  2PQA B;  5FLX E;  1CUK A;  4IOC A;  5BR8 L;  4HIM A;  4RGN A;  2RHQ B;  4JV5 L;  5HY6 A;  1H9S B;  5HUR A;  4ULL A;  2F0I A;  4A3D H;  3CCJ A;  3CAM A;  5JAV A;  1WTP A;  4ILW A;  2CH4 W;  2KEE A;  3HRZ C;  5CV4 A;  3S2H B;  4QQB X;  4LF6 Q;  3PO2 H;  2JA7 H;  1ENC A;  4OWW B;  3OPO A;  1FNW A;  4ZK9 B;  2IJ0 A;  3J7Y W;  1A15 A;  2QEX A;  1EY8 A;  4A3I B;  4IUT A;  1T9H A;  1X32 A;  2K5W A;  4UP9 A;  2NVQ B;  3D8G A;  3CCQ A;  1PTO F;  2KCM A;  2R7Z H;  5J39 A;  1X3Q A;  4WRD A;  3WOF A;  5C4H A;  1SJH D;  2K32 A;  3DLL A;  1VQH A;  5C4X H;  4K0K L;  2LSS A;  1M1K C;  2K33 A;  5LMU L;  3IFT A;  2WAQ G;  3HOV B;  3J81 c;  4HIK A;  1C0A A;  2A6H D;  2QW7 A;  4S3S A;  4GNX B;  1A2T A;  1HFG A;  4QGU A;  3NPP A;  4KI0 A;  1GHJ A;  2UUB L;  4FXD A;  1RD9 D;  2F0P A;  1UAP A;  2A1A A;  1XTC D;  1DYQ A;  2ES2 A;  1JQY D;  1TT2 A;  2FJ2 A;  5M9O A;  5IYC H;  1AEX A;  4LUO A;  3QJY A;  4OWX B;  1STB A;  4XQJ A;  3OWE B;  3PQI A;  4BY1 B;  2QEJ C;  3FKI B;  4C1N K;  5KRU A;  5EKL A;  1XPO A;  2OF1 A;  3GTL H;  2YU9 B;  4JCV E;  4X6A H;  5EAY A;  2KHI A;  2F0O A;  3FPU B;  5GAE C;  1CT1 D;  3WOE A;  3HOZ B;  1Q3L A;  4IUU A;  1V1O A;  3NTH A;  3LX0 A;  2RVL A;  2R61 A;  1FJG Q;  2OQK A;  1LTB D;  1KC8 C;  5A2Q E;  3C3L A;  3NBH A;  3RD4 A;  1MD2 D;  1JJC B;  4NXM L;  1B4O A;  2MFI A;  4QY7 A;  1C7Y A;  1PHJ A;  2MPM A;  1LT4 D;  2NYZ D;  2TMP A;  2Z1C A;  1KNA A;  1HQM C;  5IGE A;  1LT3 D;  2GVB A;  2JK8 A;  1VQJ A;  4DPG A;  4F88 A;  1CK1 A;  2UUC L;  3SR1 A;  3K0X A;  3J80 i;  1G29 1;  2B63 G;  4JI6 L;  3AFQ A;  4Y52 H;  1LTL A;  1ILQ A;  2FHT A;  2PYK A;  1HNX L;  3PF5 A;  2MQH A;  5GAD C;  3U4V A;  3HG9 A;  1JOR A;  2QCP X;  4HMI A;  2AWO A;  2NN6 G;  4NB3 A;  4R4I A;  1X3E A;  2MNA A;  1M8A A;  1LTA D;  3AB9 A;  1LT6 D;  1C8C A;  2J4X A;  3MWY W;  4DV4 L;  4GOP C;  1DXM A;  1XNR Q;  2E2H H;  4L5Q A;  2PO4 A;  4NDX A;  4JI1 L;  1XMO Q;  5C0X H;  4LFB Q;  1JWM D;  4ZKC B;  1YNX A;  3UE1 A;  2KCN A;  2R93 B;  4ZCK A;  3R3O A;  2HD3 A;  4DR4 L;  1PFM A;  2A69 C;  2PZW A;  3I91 A;  4I65 A;  1B3A A;  5HGT A;  3IRB A;  2G9D A;  3GV6 A;  3B6Y A;  4CKE A;  1KAB A;  4YIJ A;  1V1P A;  1KXL A;  3X3N A;  4A93 G;  1NAP A;  4BXX H;  2VL6 A;  1RTO A;  3SGI A;  1KD1 C;  1B9N A;  1E24 A;  2ZT9 C;  1K8O A;  3DWA A;  2B8F A;  4RCN A;  5EPL A;  3TME A;  4JYA Q;  3CP0 A;  3MFG A;  4KHV A;  1KQS A;  3CRK C;  2IX1 A;  3HOY B;  3S17 H;  4OO1 I;  2F52 A;  1TWH H;  4K6L A;  4C3H H;  1EEF D;  1UNS A;  5T1G A;  3RLF A;  4IFD G;  3HFZ B;  2HQL A;  3RLN A;  2AQ1 B;  1JMC A;  1PH6 A;  1B8A A;  2HDL A;  4A3F G;  1WTQ A;  1EU4 A;  5C4J H;  2Q2U A;  2B2T C;  2IX3 A;  3P75 A;  1EZ6 A;  3F8T A;  4EQ5 A;  4DK1 A;  3RZD H;  1C9O A;  3S1M H;  3VYR A;  2B2U C;  1VQP A;  3A55 A;  4LFA Q;  1PMR A;  4IUQ A;  4CBV A;  4POF A;  4DV7 L;  3E9I A;  1PRT C;  5FJ8 H;  2B2T A;  3EN2 A;  2HCC A;  5ELN A;  3ERO A;  3GDE A;  3H3V I;  3STB D;  4HCE A;  1Y69 U;  3QG1 A;  3GV3 A;  4RG1 A;  3TP7 A;  4HJ7 A;  3TS0 A;  2EDG A;  3TP5 A;  3G6J B;  3OIP A;  3DMU A;  4JI3 Q;  2BA0 A;  5FK9 C;  4JI5 L;  2CFM A;  3H3V C;  4X64 L;  1MKH A;  1NCV A;  1X3P A;  1S3O A;  4OX9 Q;  4UY8 C;  4OIJ A;  1AE2 A;  3QB3 A;  3CCM A;  4ZRZ A;  1D2B A;  3LWE A;  5E1F A;  5I4D A;  4LF6 L;  4DUZ Q;  5K36 H;  1G6Z A;  4EGV A;  2HDM A;  1I4G A;  4KHZ A;  4DUY Q;  3H15 A;  1QVC A;  5I6W A;  3H0G B;  3BYT B;  3NTI A;  2L15 A;  1KDA A;  3J7A V;  1Q1B A;  2L11 A;  1GM5 A;  1L1O B;  3GTK H;  3KF6 A;  3S16 B;  1JJG A;  4NW2 A;  1IKM A;  1NY4 A;  2Z6B A;  3SHL A;  3I4N B;  2K28 A;  4O42 A;  1Q46 A;  3EIV A;  1YI2 A;  2Z4I A;  2J7Z A;  3SVM A;  3ULP A;  3NP8 A;  3KF8 A;  3NHH A;  4H0L C;  4IAL A;  3Q22 A;  5C4X B;  3M4Y A;  1STA A;  3A8K E;  3MXP A;  1CQV A;  4P73 A;  3ER0 A;  1W3S A;  5IT9 L;  4ZKB B;  4JI0 L;  1Q8I A;  3L9A X;  2IY5 B;  5FO9 B;  1VDZ A;  1WVL A;  2C9O A;  3VYT A;  1EYG A;  5DLQ E;  3T53 B;  1N8R C;  3M3Y B;  2EIF A;  1RL2 A;  2NB0 A;  1RCV D;  1A3U A;  1CKN B;  1DGS A;  1NTG A;  1SE2 A;  2KQ3 A;  4LUZ A;  1E2W A;  2JE6 I;  5KGU A;  2OTL A;  2RDH A;  3I4M H;  2F0G A;  5ELC A;  1PH7 A;  2AQ2 B;  1HA6 A;  2A68 D;  1STH A;  1AH9 A;  3T1Y L;  4FVM A;  3I7F A;  1PH3 A;  3D31 A;  4BBS G;  2ICI A;  2RSN A;  2EYM A;  2JXM B;  4BY7 H;  4JI2 L;  2KED A;  2NTS A;  4A76 A;  3BYY B;  1N34 L;  3LGJ A;  1IW7 C;  4R4T A;  5M5Y H;  3PSI A;  2GA4 B;  5E7N A;  1HUM A;  4FXG C;  5I6Y A;  1P16 A;  1ESF A;  2E2I H;  1GVP A;  4A3M G;  3A5Z B;  4A3J H;  1IL2 A;  2RSO A;  2XVS A;  3J81 j;  2M2L A;  5IP9 G;  1VQ4 A;  1MJC A;  1BQQ T;  2CVR A;  2E75 C;  5BN4 A;  5CC4 A;  1SYE A;  3VR2 A;  4X66 Q;  4DR1 Q;  3K7A B;  2JA8 H;  1L0W A;  3K8A A;  1LTS D;  4DK0 A;  4QL5 A;  4DKA C;  4KLK A;  5CV9 A;  4DR3 L;  4A3D G;  1A2U A;  3W1G A;  1R4Q B;  1A6X A;  3OIQ A;  3S1R B;  4GKK Q;  1PTO D;  2QIL A;  3PO2 G;  4JI8 Q;  1YHB A;  2JA7 G;  4GOP B;  1WTV A;  3HKS A;  3S15 H;  2CW0 C;  4BBR H;  4A3K B;  3C46 A;  1PVO A;  1HNZ L;  3DWQ A;  1O7Z A;  1Q12 A;  5T1I A;  3VR5 A;  3DHQ A;  1N32 Q;  4CKC A;  1RDP D;  5COY A;  4QIW E;  4UAI A;  1HRJ A;  4DR7 Q;  1GUW A;  1EFI D;  3QWN A;  1XNR L;  3JAM L;  1YNJ D;  1A0I A;  5LMN Q;  2PQA A;  3CRL C;  1HTP A;  2O5J C;  3G6E A;  1ASZ A;  1VMC A;  2R7Z G;  5IYD H;  2JA6 H;  2E2H B;  1H9S A;  3NBI A;  5I9O A;  5H1S E;  1MBY A;  3KYH C;  5CV8 A;  2OCE A;  4R8I A;  3CCS A;  4B3R Q;  1F9Q A;  4DK6 C;  4C3I G;  2UXD Q;  3DM1 A;  1HR0 Q;  4GN5 A;  1AE3 A;  3IL8 A;  4QIW B;  1O78 A;  1YHA A;  1MJE A;  1YEZ A;  1BCP F;  1DOK A;  2B8G A;  3U9S A;  3G71 A;  2F3I A;  1EIF A;  1WTR A;  1X56 A;  1Y8P B;  1LM0 A;  1GOZ A;  1PTO H;  1SN8 A;  4MNO A;  3ERS X;  2A73 B;  4FO2 A;  1G51 A;  1PV4 A;  2EXZ A;  3UDG A;  3HOX G;  3D6C A;  1GJX A;  1NE3 A;  1S5E D;  5IE8 A;  5FLM H;  4GNX C;  4QF4 A;  3J80 c;  2K04 A;  2CKZ B;  1EIG A;  3FHW A;  4HIO A;  5GAH C;  1U4M A;  2XNA C;  4KN4 C;  1XMQ Q;  1PDQ A;  5C3X A;  1VQF A;  2Y0S E;  4MHE A;  4GNX A;  4LFA L;  3CC4 A;  4DV3 L;  1S5B D;  1IZ6 A;  1ML0 D;  5E4X A;  1EY5 A;  1SAP A;  1EY9 A;  1STY A;  5C3E H;  2VQE L;  1E22 A;  4JI3 L;  3PUY A;  4WJ3 M;  3GD7 A;  3HOU G;  1F9S A;  5IWA Q;  2AMC B;  2IHF A;  2E76 C;  2KHJ A;  3IKJ A;  1BKB A;  2KUM A;  4BA1 I;  1EQR A;  1ROD A;  4DUZ L;  2F0U A;  3S1N B;  1CTM A;  4B3T Q;  1YJW A;  4XYQ A;  4FF2 A;  4LF4 Q;  2XIW A;  2PNR C;  1D1I A;  3HKZ E;  3D4D A;  1EYC A;  2QDL A;  2ZM6 Q;  2EYO A;  1ASY A;  2EY1 A;  5GQO A;  3S14 H;  2WAQ E;  4DR6 Q;  1SE3 A;  1VQK A;  1VQE A;  2WKC A;  3J81 L;  1B7Y B;  3AU7 A;  2D5D A;  1K73 C;  3GTK B;  2FIN B;  2Q8T A;  1PZI D;  2K05 A;  4LJZ C;  1F9P A;  3Q24 A;  1R9T H;  1RKN A;  3IAY A;  3A56 A;  2C5C A;  1SEB D;  5C0X G;  1BOS A;  1E7Z A;  2F03 A;  1Y1V H;  2XSC A;  5D65 A;  4DR2 L;  4MN3 A;  3BS1 A;  1YJ9 A;  4QJF A;  1EQV A;  4HJ9 A;  3CD6 A;  3GTP B;  4O2D A;  2N8N A;  2WAQ B;  3R93 A;  3I56 A;  2KCT A;  1A3V A;  3D4R A;  4R9W A;  4HSP A;  1MIU A;  4BXX G;  3DEP A;  2JJQ A;  5FLX c;  3L3O C;  2Z8L A;  2UUA Q;  1HPC A;  1MSG A;  3UDI A;  3K5M A;  1CZG A;  4C3H G;  3OOC A;  2UXB L;  2NVT H;  3AMU A;  2P5Z X;  2VB3 X;  3GTO B;  4KKS A;  1K83 H;  2H4O A;  2VB2 X;  2NVY H;  3GTJ H;  3DUZ A;  4A3C H;  1H9R A;  5M5Y B;  1I94 L;  2AUK A;  1XXG A;  4KD4 A;  3CQZ H;  2C35 B;  5EPJ A;  1WCM G;  1BO0 A;  1TWC H;  2DY8 A;  2F0K A;  4BA2 I;  4EX5 A;  3OMG A;  3CCU A;  4K14 A;  4A3B H;  3K7U C;  5IP9 H;  1XYI A;  5IIF A;  1Q82 C;  4DR1 L;  4J15 A;  1QE6 A;  3UDF A;  4X65 L;  5EBC A;  4C56 C;  3KOJ A;  2RCF A;  4O0A A;  2PQE A;  4DV1 L;  1X3G A;  3TRE A;  4DFA A;  1Z6H A;  4RH6 A;  2DNC A;  5IGD A;  3W3A A;  4IJH A;  3AFP A;  5K36 G;  1N33 Q;  5D14 A;  4YHH L;  2VQF Q;  2F1M A;  5D3I B;  2UU9 Q;  2B63 B;  3GTG H;  4XDX A;  4EQP A;  4LF9 Q;  2RF4 A;  2KBN A;  1FNV A;  2I07 B;  4AH6 A;  1HNW L;  5HGQ A;  2ZTC A;  4DR7 L;  1UE7 A;  4G7Z C;  1KAA A;  1SDF A;  4B9X A;  1HH2 P;  4H02 A;  1X6O A;  1Z9F A;  5D3D A;  3M7G A;  1Q81 C;  5IOD A;  4KJO A;  1EWI A;  2I46 A;  2AQ3 B;  1SNC A;  1WTO A;  2LFN A;  4WJW A;  3D0F A;  3I73 A;  4JI7 L;  2UXD L;  4TKO B;  5JVG 3;  4EQN A;  2EYF A;  3E5S A;  5I2X A;  1HR0 L;  1L1O C;  1QIL A;  4C3I H;  2ENB A;  5AJ3 Q;  1V9P A;  2EJF C;  4IO9 A;  1HHV A;  1TWF H;  4F87 A;  2NBF A;  4FXK C;  1TVX A;  4IN3 A;  2WP8 J;  2DJG C;  1CFM A;  1L1O A;  2XN9 C;  3ZYY X;  1QZH A;  2AUJ D;  2G5D A;  4FDB A;  1E1T A;  5JJI A;  1F2Z A;  4A93 B;  3V2T A;  3E9H A;  5CBE E;  1JE4 A;  1S5C D;  3I4M G;  2IL8 A;  3ONA B;  4TSS A;  1JE5 A;  4ABN A;  1TWG H;  3RUZ A;  3S1Q B;  2MGS A;  3HOX H;  4N8X 1;  1EZ8 A;  5DEH A;  4BY7 G;  1D6E C;  2WKD A;  3T16 A;  5KYI A;  4A3F B;  1W6K A;  2G9H D;  4NPS A;  4I7A A;  2AHO B;  5CMD A;  5K5P A;  3QOJ A;  1WTH A;  3PO3 H;  5DM7 3;  4A3J G;  1C48 A;  3AQQ A;  1X55 A;  2N88 A;  4JPB W;  4B3S L;  1CKN A;  4HR7 B;  1BR9 A;  3MXN B;  4A3L G;  1U4R A;  1ZKO A;  2PMZ E;  5C44 H;  1G2T A;  1QOH A;  2JA8 G;  3UI2 A;  3P1H A;  1EWH A;  4HED A;  3HOU H;  2D0O A;  2Q8I B;  1B1Z A;  1LV9 A;  4JG2 A;  3UDX A;  1X54 A;  2R92 H;  4LF4 L;  4KV6 A;  1FR3 A;  4DA2 A;  5I2Y A;  2ZM6 L;  5CGK A;  2K5D A;  2X69 A;  2XWJ B;  4HID A;  4YCU A;  4BBR G;  1ILP A;  3VR4 A;  1N36 L;  4KK7 A;  1I6V C;  5ELB A;  3U4Z A;  5TSS A;  3K59 A;  5GRO A;  2CQO A;  2J0T D;  2K4K A;  4GN3 B;  1H95 A;  3S14 B;  1FVI A;  2PMZ B;  4A3G H;  4F8M A;  2FMC A;  4NXN Q;  3W5O A;  5CR3 A;  5GAG C;  3N6R A;  3RZO H;  1O7L A;  2FFK B;  2EY5 A;  1R9T B;  1BBX C;  2YTV A;  5IYD G;  1CA6 A;  2JA6 G;  3TZU A;  3KLW A;  1BCP D;  2K14 A;  2SDF A;  5C6A A;  4C2M H;  2DJF C;  5KYL A;  1VS0 A;  3BDO A;  1HZA A;  3X3M A;  4ZYS A;  1KHI A;  4DAP A;  3LWU A;  2NVX H;  3D6W A;  1K8A C;  1PRT D;  5C4Z A;  5NUC A;  2VZA A;  2ID0 A;  5C0X I;  4GOP A;  2ZJQ A;  2GVA A;  1ZEQ X;  4Y7N B;  1HFN A;  3TDQ A;  4MTK A;  2JN4 A;  2ZTD A;  5LHY 1;  4KHP Q;  4YWM A;  2V1C C;  3U50 C;  3QR8 A;  3NEM A;  1LTR D;  1P8L A;  1XTD A;  2AKW B;  3M4O B;  3VYU A;  4ID6 A;  1U9R A;  5FLM G;  2F0J A;  4XYO A;  1AZP A;  4K2L A;  2XWB B;  1E0B A;  2K01 A;  4WFN 3;  3GQB A;  5EGT A;  3GTQ B;  3MEF A;  1DZ1 A;  3OSO A;  3R2I A;  1KIX A;  4BBS B;  3IFD A;  1K83 B;  3BVM A;  4B3M Q;  4OON A;  2BDO A;  2EE1 A;  5JEA J;  5KEE A;  3CQZ B;  5ELF A;  1DCZ A;  1S5D D;  1WCM H;  4DU9 A;  2F0N A;  3NTK A;  4A3M B;  1V1Q A;  2UXC L;  1K8M A;  3K5N A;  2L1B A;  4GKJ Q;  3FRP B;  5C3E G;  1VF7 A;  2B2U A;  1AZQ A;  4U68 A;  3K6O A; 
#chains in the Genus database with same CATH homology
 1UE6 A;  4ME3 A;  4AYB G;  1PVO A;  1HNZ L;  1VQ9 A;  1VQD A;  5JJL A;  1Q12 A;  3S24 A;  1D7Q A;  3BJU A;  2JEB I;  3OYY A;  3WWV A;  3H3V H;  2JEA I;  3ULJ A;  1LYL A;  1N32 Q;  4HJ8 A;  3OW2 A;  1Q1E A;  4QIW E;  4TVA B;  5M3F G;  4DR7 Q;  2VQF L;  4DV6 L;  3HOW G;  1CKM A;  2UU9 L;  1XNR L;  1A0I A;  2AWN A;  1HZC A;  2BH8 A;  2PQA A;  5LMN Q;  3JAM c;  1VQL A;  4Y7N H;  3G6E A;  3BU2 A;  1PA6 A;  1GO3 E;  4JBJ A;  1I5F A;  1ASZ A;  3T1Y Q;  2JA6 H;  2IT1 A;  2YTY A;  3AEV A;  5H1S E;  2R7Z G;  2RHS B;  1QUQ B;  4PG3 A;  3KYH C;  2JA9 A;  5IWA L;  2OCE A;  1KRT A;  4OWT B;  4JI2 Q;  1KRS A;  1BBU A;  1I50 H;  4LF7 L;  1SRO A;  1N34 Q;  3CCS A;  4B3R Q;  2IHE A;  3M4O H;  4PZ6 A;  1M90 C;  4DK6 C;  2WB1 E;  4AQY L;  2UXD Q;  3KDF A;  4B3T L;  1VQI A;  4DV2 L;  2CWP A;  2OTJ A;  1X65 A;  1VQA A;  2WB1 G;  3L2P A;  2E2J H;  1HR0 Q;  3F1Z A;  4POG A;  4GN5 A;  4R4C A;  1AE3 A;  3GTQ H;  1Q7Y C;  1N9W A;  5IYB G;  5M3M G;  2GN5 A;  2VUM G;  1YHA A;  1MJE A;  2XTI A;  1EFW A;  4BBS H;  1Y1V G;  1YEZ A;  3OTO L;  3KJP A;  2ZJP A;  1OTC A;  2MO0 A;  3CCL A;  1PYB A;  3G71 A;  3RR5 A;  3CF5 A;  2F3I A;  3T1H Q;  4DR6 L;  1EIF A;  1X56 A;  4LF5 L;  1Y1W H;  3PIO A;  3PUZ A;  5IP7 H;  3RLO A;  1LM0 A;  1SN8 A;  3K7A H;  4IPC A;  4MNO A;  3ERS X;  1YHQ A;  1G51 A;  1PYS B;  2N78 A;  2WFW A;  1YIT A;  1PV4 A;  4LFC L;  3UDG A;  2Q2H A;  2PNH A;  3HOX G;  2NZH A;  5FJ8 G;  1OXT A;  1NE3 A;  2BH2 A;  1SRU A;  2VW9 A;  5IE8 A;  5FLM H;  4A3M H;  1U0L A;  4GNX C;  4R4Q A;  3J80 c;  1GKH A;  5M5W H;  4DR3 Q;  4IOA A;  2CKZ B;  3FP9 A;  3S1R H;  3KFU A;  1VQB A;  3FHW A;  4HIO A;  4L5S A;  4P75 A;  5GAH C;  2UXC Q;  1XJV A;  1IBK L;  1XMQ Q;  1X3F A;  1O7I A;  4IJL A;  1VQF A;  5IYD H;  4DAM A;  4A3K H;  4A3E H;  4PZ7 A;  2Y0S E;  2ASB A;  4LFA L;  4GNX A;  1VQ5 A;  3CC4 A;  4DV3 L;  3G48 A;  2PQA B;  3RNU A;  1IZ6 A;  1CUK A;  4IOC A;  5BR8 L;  3CCV A;  1TWA H;  4HIM A;  1VCI A;  2RHQ B;  1PH5 A;  1HNZ Q;  4JV5 L;  2FXQ A;  5HY6 A;  4A3I G;  1OXV A;  4A3D H;  2K52 A;  3CAM A;  3CCJ A;  4DV0 Q;  4IPH A;  1EIY B;  1J5E Q;  3L0O A;  5C3E H;  2VQE L;  1UWV A;  1E22 A;  4JI3 L;  3PUY A;  4WJ3 M;  3GD7 A;  3GTM H;  4QQB X;  4LF6 Q;  3PO2 H;  3KDF B;  1PH9 A;  4A3C G;  2UUA L;  2JA7 H;  3UE0 A;  4R1J A;  2H5X A;  4OWW B;  3HOU G;  1PFS A;  5IWA Q;  2AMC B;  2JQO A;  2IHF A;  1FJG L;  2KHJ A;  3HOV G;  1BKB A;  4BA1 I;  2KEN A;  1EQR A;  2QEX A;  1WOC A;  4X62 L;  4L5R C;  4DUZ L;  2VNU D;  4A75 A;  1E3P A;  1XPR A;  1T9H A;  4B3T Q;  4DV2 Q;  1YJW A;  4A3B G;  4UP9 A;  4LF4 Q;  3CCQ A;  2N3S A;  2K75 A;  3HKZ E;  2KCM A;  4LWC A;  2R7Z H;  1I3Q H;  2ZM6 Q;  4A3L H;  2F4V Q;  1EUJ A;  1IBL Q;  1ASY A;  4JI4 Q;  2MO1 A;  5GQO A;  3DLL A;  5J3B A;  3OTO Q;  1VQH A;  5C4X H;  4K0K L;  3S14 H;  2LSS A;  2WAQ E;  1XNQ Q;  4DR6 Q;  1M1K C;  1VQK A;  1VQE A;  5LMU L;  2I0Q A;  4LF5 Q;  1B7Y B;  2D62 A;  4WJ4 A;  1TXY A;  2WAQ G;  1K73 C;  3J81 c;  5M5X H;  1K9M C;  4HIK A;  1C0A A;  2LXK A;  4BY1 G;  1R9T H;  3FKI G;  1Q86 C;  4LFC Q;  1IBM Q;  4Y52 H;  4GNX B;  5IYB H;  4QGU A;  4KI0 A;  5M3M H;  2UUB L;  3S2D H;  2VUM H;  5C0X G;  1E7Z A;  1K3R A;  4YWK A;  1Y1V H;  2ALY B;  2A1A A;  2QGQ A;  1JT8 A;  2ES2 A;  4DR2 L;  2CCZ A;  3HOZ G;  1K8G A;  1YJ9 A;  5IYC H;  4QJF A;  2A19 A;  4LUO A;  4OWX B;  4HJ9 A;  3M9B A;  3CD6 A;  3TEH B;  4O2D A;  2N8N A;  1N33 L;  3I56 A;  4DR5 L;  4DV3 Q;  1HR0 W;  2KCT A;  5ELO A;  2R7F A;  5BR8 Q;  2JA5 H;  1SE8 A;  2NZO A;  3A0J A;  3KJO A;  4JV5 Q;  2DUD A;  1L2F A;  4YWL A;  1XMO L;  4LF9 L;  4LFB L;  2NN6 I;  1MIU A;  3JAM i;  1XPO A;  5IY0 A;  4BXX G;  3GTL H;  2E5L L;  2HHH L;  3S2H H;  4JCV E;  2JJQ A;  5FLX c;  1E1O A;  4JOI C;  4X6A H;  5EAY A;  2KHI A;  2VQE Q;  3L7Z C;  5GAE C;  3NEN A;  1IXR A;  4TQU S;  4LF8 Q;  1GD7 A;  2K5H A;  2UUA Q;  3CPW A;  1JB7 A;  2B29 A;  3UDI A;  1EOV A;  4JOI A;  4A3I H;  2YYZ A;  1FJG Q;  2OQK A;  2UXB L;  1YVC A;  2NVT H;  3S1N H;  4ALP A;  1KC8 C;  2NVQ H;  3I55 A;  1A8V A;  1CSP A;  1K83 H;  1WJJ A;  1D8L A;  1JJC B;  1OXS C;  2NVY H;  3GTJ H;  4NXM L;  1YZ6 A;  2MFI A;  4QY7 A;  4A3C H;  2Z0S A;  4PMW A;  4GLX A;  4JYA L;  1C7Y A;  1I94 L;  5AJ3 L;  1PHJ A;  3CQZ H;  2C35 B;  1IYJ B;  1WCM G;  3PIP A;  1TWC H;  1WYD A;  4GN4 B;  4IPG A;  1I6H H;  3HOV H;  4BA2 I;  4EX5 A;  2R6G A;  5LMU Q;  1A63 A;  2GVB A;  1YJN A;  2JK8 A;  1Z47 A;  2VS1 A;  1VQJ A;  4DPG A;  3CCU A;  2VY3 A;  3TS2 A;  1NJI C;  1QVF A;  2UUC L;  4A3B H;  3K7U C;  3K0X A;  3I4O A;  4IPD A;  1G29 1;  3J80 i;  5IP9 H;  4YY3 Q;  2B63 G;  4JI6 L;  3ULL A;  1CKO A;  1Q82 C;  4DR1 L;  4J15 A;  3UDF A;  3M7N A;  2N49 A;  3AFQ A;  3STB C;  4X65 L;  5C0X J;  1LTL A;  2BA1 A;  1HNX L;  2ZJR A;  1HZB A;  3CW2 C;  2UUB Q;  1S40 A;  4IFD I;  2R93 G;  3EBE A;  3PO3 G;  3KOJ A;  4O0A A;  3PF5 A;  3BZK A;  4DV1 L;  4B3R L;  2MQH A;  1X3G A;  3TRE A;  5GAD C;  3U4V A;  2K5N A;  4DR2 Q;  1CSQ A;  2PI2 A;  4DV5 L;  4GKJ L;  2AWO A;  2NN6 G;  1EQQ A;  3GTP H;  2LXJ A;  4NB3 A;  4R4I A;  4IJH A;  1X3E A;  2MNA A;  4A4I A;  3AFP A;  5K36 G;  4XTC S;  1N33 Q;  3RN2 A;  2ZTE A;  4YHH L;  2IX0 A;  2VQF Q;  4DV6 Q;  2K5V A;  3M85 A;  4DV4 L;  4GOP C;  2UU9 Q;  2E2H H;  1XNR Q;  3J7Z C;  5C44 G;  4L5Q A;  1VQG A;  3GTG H;  4MZ9 A;  4JI1 L;  1XMO Q;  2YU9 H;  4LF9 Q;  4LFB Q;  2RF4 A;  2KBN A;  1YNX A;  4JBK A;  3UE1 A;  1VQ7 A;  4AH6 A;  1HNW L;  3F2C A;  5HGQ A;  4OX9 L;  2ZTC A;  4DR7 L;  1UE7 A;  3ICE A;  3HOZ H;  1NMF A;  4DR4 L;  2Z6K C;  2R92 G;  1HH2 P;  4L5T A;  3NBH B;  4H02 A;  4LF7 Q;  3HOY G;  1X6O A;  1UEB A;  1Z9F A;  4AQY Q;  5M3F H;  3VDY A;  4GS3 A;  4DUY L;  3IRB A;  3Q8D A;  4DK3 C;  3HOW H;  4HJ5 A;  3B6Y A;  2I5M X;  1Q81 C;  1UE1 A;  1EWI A;  3GTO H;  2CWA A;  2Z6K A;  2UXB Q;  1KXL A;  2XGT A;  3CCR A;  1VQN A;  4A93 G;  4BXX H;  3D0F A;  1S72 A;  2VL6 A;  4JI7 L;  2RCN A;  2UXD L;  5IP7 G;  4A3G G;  1V43 A;  2YV5 A;  3SGI A;  1KD1 C;  1E24 A;  4LNQ A;  1HR0 L;  1L1O C;  1QUQ A;  4NXM Q;  4JYA Q;  4C3I H;  3CP0 A;  1I94 Q;  3K80 C;  3PGZ A;  5AJ3 Q;  1KQS A;  3CME A;  1V9P A;  3BZC A;  1UE5 A;  4IO9 A;  1TWF H;  3J81 i;  2IX1 A;  3S17 H;  4OO1 I;  4LW1 A;  2F52 A;  1TWH H;  4C3H H;  4HJA A;  2QA4 A;  3JC6 6;  5LMN W;  3RLF A;  4IFD G;  1PH1 A;  3HFZ B;  1VQ8 A;  2HQL A;  3RLN A;  2WP8 J;  1JMC A;  1W2B A;  1PH6 A;  1L1O A;  1B8A A;  4A3F G;  1QZH A;  4FDB A;  2K50 A;  4PZ8 A;  1E1T A;  5C4J H;  5JJI A;  3W1B A;  4A3E G;  2UUC Q;  3CC7 A;  2Q2U A;  1SLJ A;  4NXN L;  4JI6 Q;  1FL0 A;  3E9H A;  2OWO A;  3F8T A;  4EQ5 A;  3RZD H;  2I5H A;  1VQO A;  1IBK Q;  3I4M G;  1C9O A;  3PUX A;  4GLA C;  4X65 Q;  1HNX Q;  3S1M H;  1JE5 A;  1WFQ A;  3CCE A;  1VQP A;  4LFA Q;  1QVG A;  4DV1 Q;  1TWG H;  3DM3 A;  4JBW A;  4POF A;  4DV7 L;  3HOX H;  3E9I A;  5FJ8 H;  3EN2 A;  4APV A;  5ELN A;  3GDE A;  3H3V I;  4UPA A;  3STB D;  4BY7 G;  4RG1 A;  3NEL A;  4HJ7 A;  3TS0 A;  3H0G G;  3PUV A;  1X9N A;  4NPS A;  2B63 H;  1QZG A;  4YHH Q;  3GO5 A;  2E8G A;  4MTN A;  2AHO B;  4JI3 Q;  2BA0 A;  4JI5 L;  3ZJY C;  2CFM A;  2R93 H;  4JI1 Q;  3PO3 H;  3CPF A;  1HZ9 A;  4X64 L;  4JC0 A;  1MKH A;  4A3J G;  4DV0 L;  1HNW Q;  3AQQ A;  1S3O A;  4OX9 Q;  4UY8 C;  1X55 A;  4B3S L;  1AE2 A;  1J5E L;  1CKN A;  3CCM A;  4DR4 Q;  3I4N G;  3PF4 A;  3PUW A;  1SR3 A;  4X62 Q;  4LF6 L;  4DUZ Q;  4KHP L;  4P74 A;  2OQ0 A;  2I5L X;  2ATW A;  3M4Q A;  1SMX A;  3MXN B;  4KHZ A;  4DUY Q;  4A3L G;  1YBY A;  1QVC A;  3H15 A;  2PMZ E;  5C44 H;  4JBM A;  4XIG S;  5C4X G;  1SFO H;  2L15 A;  2JA8 G;  4OO1 G;  1A62 A;  3TRZ A;  3HOU H;  4JI7 Q;  2D0O A;  2EXD A;  4UP8 A;  4JG2 A;  1Q1B A;  2HIX A;  1RIP A;  4K0K Q;  3UDX A;  1L1O B;  1GM5 A;  3GTK H;  3KF6 A;  1X54 A;  2R92 H;  3TQY A;  4LF4 L;  3HOY H;  1JJG A;  1NY4 A;  3F2B A;  4B3M L;  2ZM6 L;  3E0E A;  1Q46 A;  2F4V L;  3EIV A;  4YCV A;  1YI2 A;  1IBL L;  4JI4 L;  4IFD J;  4HID A;  3U58 A;  4YCU A;  3ULP A;  4BBR G;  4X66 L;  3CXC A;  1N36 L;  3AYH B;  1XNQ L;  3A74 A;  3U4Z A;  5GRO A;  5JEA G;  4A93 H;  2CQO A;  4GN3 B;  2K4K A;  5IYC G;  1H95 A;  1FVI A;  1Q8K A;  3RN5 A;  4A3G H;  3CC2 A;  4P73 A;  4NXN Q;  3W5O A;  5GAG C;  3ER0 A;  1W3S A;  1IBM L;  3RZO H;  4JI0 L;  5IT9 c;  3S1Q H;  1LUZ A;  1OXU A;  2JA5 G;  4GKK L;  2D0P A;  4AIM A;  2YTV A;  1HJP A;  2IY5 B;  4JI8 L;  4BY1 H;  1XPU A;  5IYD G;  4DR5 Q;  4UP7 A;  3FKI H;  4DV7 Q;  2JA6 G;  3KLW A;  1EYG A;  2K14 A;  5DLQ E;  4P72 A;  4C2M H;  1N8R C;  2DGY A;  1VS0 A;  2EIF A;  4RMF A;  3CMA A;  4A3F H;  1RL2 A;  4OXP A;  1HZA A;  1KAW A;  1KHI A;  2B3G A;  1CKN B;  1DGS A;  1NTG A;  2NVX H;  1N32 L;  2E5L Q;  4LUZ A;  1K8A C;  2HHH Q;  2Q2T A;  2JE6 I;  2Y0S G;  5C0X I;  2VZA A;  2ID0 A;  2OTL A;  3I4M H;  3F2D A;  4GOP A;  4JI5 Q;  2ZJQ A;  4LUV A;  5LMN L;  1PH7 A;  2GVA A;  4DNI A;  1G6P A;  4X64 Q;  1AH9 A;  3T1Y L;  3I7F A;  1PH3 A;  3D31 A;  4B3S Q;  4BBS G;  2PI2 E;  1KL9 A;  4BY7 H;  4JI2 L;  2ZTD A;  3M4P A;  4A76 A;  2A8V A;  4KHP Q;  1N34 L;  4LF8 L;  3A5U A;  3H0G H;  1Y1W G;  1PH2 A;  4P71 A;  4YWM A;  3KF6 B;  3LGJ A;  3PCO B;  2V1C C;  3U50 C;  4GLV B;  4R4T A;  3NEM A;  1K0R A;  1P8L A;  1XTD A;  2AKW B;  3PSI A;  5E7N A;  5M5Y H;  1VQM A;  2EQS A;  3K81 C;  2R7D A;  1P16 A;  2E2I H;  3PV0 A;  2Q2I A;  1OXX K;  5FLM G;  1GVP A;  4A3M G;  3A5Z B;  4A3J H;  1FGU A;  1IL2 A;  3S16 H;  3KF8 B;  3J81 j;  3MEF A;  5IP9 G;  1PH8 A;  1BBW A;  2HIV A;  1BVS A;  3I4N H;  3T1H L;  1VQ4 A;  1MJC A;  1KIX A;  1B70 B;  1YIJ A;  4B3M Q;  4OON A;  4A3K G;  1VQC A;  3HKZ G;  2HT1 A;  1JJ2 A;  5JEA J;  2YTX A;  4X66 Q;  4DR1 Q;  1N36 Q;  1Y14 B;  2JA8 H;  1L0W A;  3K8A A;  4DAY B;  4QL5 A;  4DKA C;  4KLK A;  4C3J H;  4DR3 L;  4YCW A;  4A3D G;  4R4O A;  1WCM H;  1PH4 A;  1V1Q A;  3W1G A;  1NBW A;  3I2Z A;  2UXC L;  1NMG A;  5JJK A;  4YY3 L;  1U5K A;  4DV5 Q;  4GKJ Q;  1XMQ L;  5C3E G;  1VQ6 A;  4JI0 Q;  1WI5 A;  4GKK Q;  3PO2 G;  4JI8 Q;  1YHB A;  2JA7 G;  4AYB E;  4GOP B;  3HKS A;  3G4S A;  3J7A 5;  3M3Y H;  3S15 H;  4BBR H;  1J6Q A;  4DV4 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...