5M5XH

Rna polymerase i elongation complex 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Molecular Structures of Transcribing RNA Polymerase I.
pubmed doi rcsb
molecule tags Transcription
total genus 17
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m5xH00
1KD1C 4AIMA 2IHEA 2B63H 2CCZA 4IOCA 1Z47A 1LTLA 3PO2H 5IYCH 2D0OA 3K8AA 2R7FA 1IBLL 3S1NH 5IP9H 3BJUA 1BBWA 4EQ5A 1VQFA 1WFQA 3M4QA 1VQIA 4IPGA 3DLLA 4YCVA 2MFIA 4O0AA 5FJ8H 4DNIA 2A1AA 1GM5A 2BA1A 2R7ZH 1IBKL 1YJWA 1WCMH 1B8AA 3S14H 1EUJA 5GAEC 3M7NA 4A3DG 4B3TQ 1SE8A 4NXNL 2Y0SG 4B3RQ 4XTCS 5HGQA 3CC4A 2QGQA 1H95A 2LSSA 3H3VI 2VUMG 1E22A 3B6YA 2RCNA 3CCRA 3AEVA 4BBSG 2HT1A 4AYBE 4DV7Q 4HIOA 4JI3L 1G51A 1HNXQ 3ULJA 3RLNA 2NZHA 4MTNA 4B3SQ 2K4KA 4JG2A 4LW1A 3CCUA 1PH8A 2UU9Q 3S16H 1FVIA 2KENA 5IE8A 1KQSA 4LFAQ 1KRTA 4HJ8A 1N36Q 1N8RC 1Q7YC 4A3LG 2LXJA 1YVCA 3L0OA 4PZ8A 1YJNA 4DKAC 3KOJA 4JBKA 4DR3L 4DR4Q 1X65A 2WAQG 4UP7A 5EAYA 2UUCQ 3HOWG 1AH9A 4QIWE 2YTVA 1TXYA 1KRSA 4A3MG 4DR5Q 1EQRA 3W1GA 2AMCB 2IX0A 2IT1A 4DUZQ 3I4MG 2JK8A 2BH2A 1J5EQ 1VQMA 1QZHA 1TWGH 4A3FG 4JI7Q 1SLJA 1KL9A 4YCUA 1XNQQ 3PUWA 2K52A 4DAMA 4POFA 1CSQA 1G6PA 1N34L 5IYDG 4GLVB 1JB7A 1K8GA 3FP9A 4P73A 2YTYA 2CFMA 1CSPA 3BZCA 2JA6G 2JA8G 1VQDA 2DUDA 4PMWA 4LF6L 2UXDL 4GN4B 2ZTDA 2XTIA 4A93G 4HIDA 3UDGA 2K50A 1N33Q 2L15A 1SRUA 4JI1L 4DR2L 5FLXc 2HIVA 4JCVE 5IYBG 4LFCQ 1JJ2A 1VQ8A 4JI5L 4GS3A 4IFDI 4LF5Q 4A3BH 1HZCA 3I7FA 2I0QA 1P16A 5C4XG 3F2DA 1YNXA 2ID0A 2F4VQ 4A3CG 4YWMA 1PH1A 2UXCQ 2E5LL 4GKKQ 3PUXA 5DLQE 2VQEL 2PI2E 4UP9A 1GD7A 3L7ZC 3KJOA 4H02A 5GAHC 1XTDA 4QGUA 4R4TA 3S2HH 1N32L 4OONA 2VZAA 4R1JA 3TREA 1MJEA 2UUAL 3I56A 1YHAA 1IZ6A 4PZ6A 4JV5L 1Z9FA 4OX9Q 3CPFA 4IJLA 4YCWA 2D0PA 3H3VH 3STBD 1D8LA 2K14A 3JC66 4JYAQ 3BZKA 1NTGA 5C0XI 4YHHQ 4A3IH 3ICEA 3S17H 4IO9A 3VDYA 1QZGA 3HOXH 3CC2A 4PZ7A 4JI6Q 3T1HQ 2MNAA 1QVFA 3H0GH 4C3JH 1E24A 5E7NA 1HNZL 5C3EG 2R92H 1FJGQ 1IBML 2YTXA 2R93H 2H5XA 2F52A 1JE5A 3M4PA 3HOUG 3W1BA 3G4SA 4JI4Q 1OXSC 3UE1A 3PIOA 1XNRL 3PF4A 4MZ9A 1DGSA 4R4QA 2A8VA 3GTMH 4BY1G 1EQQA 4JBWA 2VQFQ 4K0KL 4IPHA 4DV5L 1IBLQ 4IPDA 3TEHB 3U4ZA 1CKNA 2KCTA 3CMAA 1YHQA 1QVCA 4Y7NH 1K9MC 4DV6L 1KXLA 1MKHA 1PFSA 3KLWA 2ZTCA 5C44H 1SFOH 1IBKQ 4X64L 2JA7G 4C2MH 4A3EG 2R7DA 1TWHH 1NJIC 1JJCB 5IWAL 2E8GA 4NXNQ 1SROA 4GOPA 1EWIA 2Q2IA 4APVA 3ZJYC 1S3OA 4A3KH 4LF8L 3GTQH 4IFDJ 4JI3Q 3GDEA 3NEMA 5LMNW 1L1OA 4L5RC 1C0AA 5AJ3L 5FLMG 3CXCA 4L5TA 1E1OA 1HZAA 2B63G 2NN6G 3PO2G 4GN5A 1WYDA 3AFQA 2VL6A 3PGZA 2QA4A 1W2BA 2VY3A 5IP9G 1G291 1LM0A 3M9BA 2PQAA 4LUVA 4DR1L 4GOPC 4UPAA 5IP7H 1VQHA 4DR3Q 4QY7A 2Q2HA 1U5KA 3OYYA 1VQPA 3ERSX 1VQJA 5JJKA 3RLOA 1C9OA 1UE5A 5M3FH 1L1OC 2UXBL 2JA5H 2ASBA 3I4OA 3HKSA 1Y1WG 5LMUL 4HJ5A 3RN2A 2VS1A 3K0XA 4X65Q 1HR0Q 2UUBL 4JBJA 3M3YH 3KFUA 4WJ4A 2Z6KC 1VQOA 3CF5A 3LGJA 3J7A5 4JI8L 2JE6I 1N34Q 1YZ6A 3K7AH 3J81c 2E2HH 3JAMc 3TQYA 1R9TH 3D31A 4XIGS 3RLFA 4LF4Q 1X9NA 2F3IA 4DV3L 1L2FA 3RZOH 1VQ9A 1E7ZA 1K83H 2I5LX 3UDFA 5C4JH 3RNUA 4LF6Q 1XPUA 2UXDQ 1GVPA 5M5YH 4A3DH 2AWNA 4P75A 4DAYB 3AYHB 4DR2Q 1Q82C 4DR6L 4DR7L 1D7QA 1UE1A 3CCLA 1OXTA 1QUQA 1CKNB 2ALYB 4A4IA 4JI5Q 2QEXA 2NVXH 1Q1BA 3CP0A 1VQKA 4GLAC 4BBRH 4R4IA 4KHZA 1X56A 2OWOA 3CAMA 1SR3A 4AYBG 1I5FA 2E5LQ 3GO5A 4R4OA 2VQEQ 4DV2L 4HIMA 4GOPB 2WB1E 4A3LH 2LXKA 2Q2UA 3KDFA 3KYHC 1PYBA 2I5HA 3OTOL 4B3ML 4A75A 2VW9A 1LYLA 3J80c 1L1OB 3HOWH 4R4CA 2AKWB 1V43A 2CKZB 2JJQA 2UUAQ 2N3SA 1KHIA 1E3PA 4A3MH 3CD6A 4JV5Q 1YHBA 4B3RL 4X66L 3I4NG 3I4MH 1UE7A 1CUKA 2PQAB 2JA7H 1WJJA 1EIYB 2D62A 1EFWA 4X62L 2AWOA 5J3BA 3Q8DA 4DV7L 3FKIH 4RMFA 2PI2A 1VQ4A 2ES2A 1P8LA 2C35B 1HNZQ 1IBMQ 1JMCA 2MO1A 3DM3A 4DV0L 5IYDH 3U4VA 1VCIA 4DV1L 1SMXA 1PH5A 1HR0W 4LFAL 1XNRQ 2JEAI 3L2PA 2NVTH 5K36G 1K3RA 2R6GA 2JA8H 1VQ7A 2WB1G 1FGUA 1NMFA 2YV5A 4YWLA 4DR4L 4K0KQ 1W3SA 5H1SE 2NN6I 4DV5Q 3GD7A 1UE6A 2NVYH 1I94L 3HOVG 2GVBA 4A93H 4HJAA 4JOIA 1Q81C 3K81C 1AE2A 5IYBH 4HJ9A 3HOZG 1M1KC 4DR5L 3PF5A 3RN5A 1S72A 4TQUS 2JEBI 4DV6Q 1PHJA 1VS0A 4P72A 4X64Q 1VQCA 1N9WA 4AQYQ 5C4XH 3PO3G 3TRZA 5BR8L 3M85A 3E9IA 3MXNB 4DUYL 5IWAQ 4A3CH 1I50H 1GKHA 3J81i 1K0RA 3JAMi 1JJGA 2R92G 4OXPA 5GROA 1L0WA 1PH9A 1QUQB 4ME3A 1XPOA 4JOIC 3AQQA 2IX1A 4OWTB 4IPCA 2WP8J 2VNUD 3J7ZC 2EIFA 5AJ3Q 1ASZA 1Y1VG 1HJPA 1X55A 1EYGA 3UDIA 4L5SA 4PG3A 1WI5A 3RR5A 3K80C 1A0IA 3GTJH 4LF9L 2NVQH 3F1ZA 4A3JH 3CCMA 1N33L 4BXXG 4LWCA 4DR1Q 1XJVA 4UY8C 1WOCA 3KDFB 4P74A 4KHPL 1VQ5A 2B3GA 3HOYG 5C44G 5C0XJ 4A3GG 3HKZE 1AE3A 5C3EH 1PH3A 5LMNL 2UXBQ 5GQOA 4NB3A 2ATWA 3CMEA 2KCMA 1K73C 3HOUH 2CQOA 2OTLA 5LMUQ 2UUBQ 2HQLA 3ER0A 2PMZE 5M3MG 2RF4A 4O2DA 3CW2C 3J81j 3J80i 2NZOA 3CPWA 4IOAA 4LF7L 4A3KG 4QJFA 1XMQL 1YEZA 1RIPA 3A5ZB 4LNQA 4BY1H 1TWFH 3T1YL 1HNWQ 1BKBA 4JI8Q 3ULLA 4DK6C 1BBUA 1YBYA 2ZJPA 5IYCG 1KC8C 1UEBA 4TVAB 1B7YB 4DV3Q 2Z6KA 1NY4A 2A19A 4JYAL 4BY7H 3W5OA 3PCOB 1X6OA 3S24A 1VQBA 2IHFA 3NELA 4KI0A 5FJ8G 4YHHL 1MIUA 2Y0SE 3CCEA 4A3EH 4JI2L 2R7ZG 3GTPH 1WCMG 2HHHL 4DR6Q 4DR7Q 5JJLA 5M3FG 1JT8A 1NMGA 2HIXA 3PIPA 1KAWA 1LUZA 4FDBA 1J6QA 4RG1A 1YJ9A 1OXUA 4QL5A 3OW2A 3FHWA 4DPGA 5IY0A 5FLMH 4OO1G 4LUOA 2K5HA 3G6EA 2VQFL 2CWAA 3CC7A 4GLXA 4DV2Q 3F2CA 2ZTEA 3PUYA 2KHJA 2WAQE 1EIFA 2KHIA 3STBC 1Y14B 3OTOQ 4NPSA 3KJPA 2ZM6L 1X54A 1PH6A 1VQLA 4B3MQ 4NXML 3E9HA 3SGIA 5C0XG 1VQAA 1VQEA 4AH6A 4OWWB 1OTCA 2FXQA 1PH7A 2K75A 4LFBL 3IRBA 3G48A 3KF6A 1CKOA 4JI1Q 4X66Q 2IY5B 4J15A 1XMOL 2V1CC 1Y1WH 4DV4L 1A8VA 1XPRA 2E2JH 2VUMH 4X62Q 4X6AH 1Q86C 2OCEA 4LUZA 4YY3L 4BBSH 4WJ3M 3EBEA 3A0JA 4BBRG 2N49A 4JBMA 4JI0L 4GKJL 2B29A 4P71A 4C3IH 5JEAJ 4DV0Q 1C7YA 3NBHB 4DV1Q 2RHQB 4GN3B 5GADC 5ELNA 1QVGA 1YIJA 3H15A 1V1QA 1N32Q 3PUZA 1Q46A 1I94Q 3PV0A 3AFPA 5IT9c 2K5NA 3BU2A 2YYZA 3NENA 3PUVA 4B3TL 3TS2A 3EN2A 3CCSA 2XGTA 1HZ9A 4KLKA 3RZDH 4A3FH 1HR0L 1B70B 5ELOA 4X65L 1MJCA 3EIVA 3UDXA 5BR8Q 3I55A 3A74A 2EQSA 4DUYQ 3I2ZA 3S15H 4A3BG 3FKIG 1CKMA 1HNXL 4JC0A 3UE0A 2BH8A 1PA6A 4B3SL 4BA2I 2UU9L 1X3GA 4OWXB 1N36L 3GTKH 4LF4L 2E2IH 1PH4A 4GNXA 2JA6H 2WFWA 3CCVA 3GTGH 1I6HH 1I3QH 1T9HA 1U0LA 3GTOH 4LF9Q 2BA0A 4Y52H 2UUCL 4EX5A 2ZJQA 3I4NH 4YWKA 4ALPA 4KHPQ 3S2DH 4DUZL 2I5MX 1X3FA 1J5EL 3E0EA 4HIKA 1IL2A 5GAGC 5M5XH 1OXXK 4A3IG 1KIXA 2CWPA 1ASYA 4JI7L 1XNQL 3HOXG 5LMNQ 4L5QA 5JEAG 5M5WH 3CCJA 4GNXC 2OQKA 1IXRA 3H0GG 3KF6B 3WWVA 1A62A 1OXVA 1YI2A 2R93G 5JJIA 4QQBX 3U58A 2OTJA 3F2BA 4LF7Q 1XMQQ 4LF8Q 3G71A 1PYSB 1TWAH 4BA1I 3D0FA 2RHSB 4HJ7A 3T1YQ 2K5VA 2Q2TA 2PNHA 4OO1I 4A76A 1PVOA 4DK3C 3HOVH 3M4OH 2MQHA 3CCQA 1PV4A 3S1MH 1GO3E 3HOZH 3CQZH 1TWCH 4A3JG 1FL0A 3MEFA 2AHOB 1RL2A 1HH2P 4LFCL 1V9PA 1VQGA 1BVSA 3PO3H 1IYJB 2N8NA 4LF5L 4JI2Q 2N78A 1PH2A 2HHHQ 3PSIA 1M90C 2JA9A 1HZBA 2F4VL 1VQNA 2UXCL 4MNOA 1UWVA 4GKKL 2JQOA 2ZJRA 3KF8B 4IJHA 3HFZB 3S1QH 1Y1VH 2Z0SA 3U50C 2KBNA 3TS0A 4BXXH 1SN8A 4GKJQ 2GN5A 2ZM6Q 4NXMQ 1YITA 1X3EA 4OX9L 2YU9H 3F8TA 3HOYH 5HY6A 4BY7G 3S1RH 4GNXB 5IP7G 3GTLH 4IFDG 4A3GH 1HNWL 4AQYL 3A5UA 2GVAA 4JI6L 4LFBQ 3ULPA 3T1HL 1S40A 1NE3A 1Q1EA 1XMOQ 4UP8A 1Q12A 3HKZG 1K8AC 4DV4Q 1FJGL 3K7UC 2JA5G 4POGA 1O7IA 5M3MH 1VQ6A 2MO0A 4C3HH 1EOVA 4YY3Q 1Q8KA 2EXDA 1A63A 1E1TA 4JI4L 4JI0Q 2OQ0A 1NBWA 2DGYA
chains in the Genus database with same CATH superfamily
3GTQB 2IHEA 2B63H 1TWFB 1Z47A 2KQ3A 4MN3A 2G5DA 1KDBA 1IBLL 4KY7A 3BJUA 2Z6BA 4ILWA 1VQFA 1WFQA 2FJ2A 1VQIA 3DLLA 4O0AA 5C4ZA 1LT4D 2LKVA 2A1AA 4BY7B 2R7ZH 2JA7B 3HS0C 5KYIA 3M7NA 3BYTB 4A3DG 3SHLA 2Y0SG 5HGQA 3LWEA 4IUUA 3CC4A 2QGQA 1C4QA 1R4QB 2VUMG 4EVOA 2PYKA 1I4XA 1HQMC 5CV5A 4HIOA 3QOJA 4JI3L 1HNXQ 3ULJA 1PH8A 2UU9Q 1FVIA 3OW7A 1KRTA 2LXJA 2E2JB 3L0OA 4PZ8A 4DKAC 3P20A 3K5OA 1D1IA 1X65A 4UP7A 5EAYA 4K8IA 1EY6A 3QWNA 4ME5A 2EDGA 4A3MG 4LMQD 1EQRA 3W1GA 2IT1A 3MWYW 5EKKA 3BG3A 1SLJA 2K52A 4DAMA 1CI3M 4FVMA 4FF3A 1RTOA 5IYDG 1FR3A 5CC4A 4TRDA 1ENFA 2CFMA 2JA6G 3ONAB 5ISRA 1VQDA 4PMWA 4LF6L 4GN4B 2XTIA 3ND9A 4JI1L 4MTKA 4DR2L 2HIVA 3C1FA 1VQ8A 4IFDI 1MGSA 4LF5Q 2G9HD 4MHEA 4KY6A 1HZCA 2I0QA 1P16A 5C4XG 3F2DA 4DGZA 2ID0A 2F4VQ 1F9QA 5IGFA 1PTOD 1PH1A 2E75C 1K0SA 3ND8A 3PUXA 5DLQE 2VQEL 2RVLA 4UP9A 1KTKA 4H02A 3S9WA 3S2HH 1N32L 4OONA 1SSOA 1RODA 2D9UA 3I56A 4G4KA 1SYGA 1GOZA 2D0PA 3H3VH 1HNWQ 4YHHQ 3S17H 2F0KA 2A74C 2DNCA 1VDZA 3VDYA 3CC2A 3H0GH 1E24A 1B3QA 5M5WB 1JWSD 5D14A 1EU4A 2R93H 2H5XA 1JE5A 3F2UA 1BNZA 1HCZA 3G4SA 1XNRL 3PIOA 4LJZC 3PF4A 3L9AX 2VQFQ 4IPHA 1SDFA 4QCLA 2F0FA 3TZUA 5NUCA 3TEHB 3U4ZA 3HOZB 4DXGA 1IKLA 1QVCA 2XIWA 1K9MC 1KXLA 1XX8A 3N52A 1PFSA 5C44H 1IBKQ 1ONLA 4J8QA 4A3EG 1TWHH 2E8GA 4NXNQ 1SROA 5C3EB 2Z1CA 4K14A 1EEFD 2FHTA 2K1BA 1DZ1A 4ZKCB 2A6HD 1Q3LA 3S1QB 2A69D 5FLMG 1I6VC 1E1OA 1HZAA 4L5TA 2NTSA 3VR5A 1J9OA 1WYDA 1EFID 2QA4A 1PFBA 1U4RA 3M9BA 5CV4A 1JICA 4LUVA 4DR3Q 2CW0C 4QY7A 3LWUA 3S1RB 1TT2A 4A3GB 5I6WA 5JJKA 3RLOA 5M3FH 5DAUA 2F0SA 1EY5A 4RGTA 2UXBL 2L12A 2PQEA 3OMCA 1SAPA 5M3MB 4HJ5A 2CH4A 4C3HB 3RN2A 2UUBL 4HN7A 3KFUA 4WJ4A 4JI8L 2X6GA 1N34Q 3PO2B 4S3SA 2E2HH 3JAMc 5KEEA 3D31A 2F3IA 1L2FA 1K83H 1TVXA 2I5LX 2AUKA 4DAPA 3QOLA 4A3DH 2AWNA 4DAYB 3P1HA 1Q82C 3SK5A 2K5QA 1RD9D 4EGVA 5FLXL 4PV1C 1RDPD 2QEXA 2HD3A 3CRLC 2L9HA 1VQKA 3BDOA 2PO4A 5EGTA 2DY7A 1X56A 4KHZA 1V1PA 2A6ED 2D2CC 1HFGA 4DV2L 5CV8A 2Q2UA 1K8MA 1STGA 3KYHC 1STNA 3SK6A 4CKCA 4A75A 1PTOB 2LMCB 3ITPA 2C5CA 1HXYD 2JJQA 1SNCA 4A3MH 4JV5Q 2RDGA 1MSGA 1IHZA 4HTHA 4LK1C 5EPLA 1EFWA 4K8JA 2AWOA 5J3BA 3S14B 3FKIH 1P8LA 2B2WA 1IBMQ 2MO1A 5IYDH 2SDFA 1NCVA 4DV1L 4LFAL 3L2PA 3IAYA 1FGUA 1HHVA 4K0KQ 5H1SE 2LY7A 5JVH3 3GD7A 2F0PA 2M2LA 3GTOB 3EQLC 1WTOA 3D4RA 4G57A 4HJ9A 1S72A 4NW2A 5CGKA 4DV6Q 5ELFA 2Q8IB 2BOSA 4QIWB 3C2PA 1N9WA 5C4XH 3MXNB 5M5XB 5E1FA 1JJGA 3JAMi 2VB3X 5J1ZA 4EQPA 1F2YA 1L0WA 1PH9A 4JOIC 4ZAIA 2F0HA 3R93A 3TP8A 2IX1A 2WP8J 3QJYA 3JAME 1ASZA 2WB1B 1HJPA 1LTAD 1IW7C 1I4GA 1EYGA 2QCPX 4PG3A 3HOVB 3OIPA 3K80C 2NVQH 4N8X1 4A3JH 4BXXG 1S4ZA 3K5MA 4QB4A 4FNFA 4P74A 4ZKBB 4KHPL 3PO3B 1NAPA 3V05A 1AE3A 5LMNL 2R92B 1BR9A 3IL8A 2OTLA 2B2TC 2HQLA 4O2DA 4QUFA 4A3KG 1YEZA 3A5ZB 1SXTA 4RGOS 2RSOA 3ULLA 4DK6C 1BBUA 1H9JA 4F88A 5IYCG 4RKBA 1STAA 3J81L 1B7YB 1EY4A 5G3LF 1NY4A 2O5JC 1SE4A 5DEHA 3PCOB 1X6OA 4Y7NB 1VQBA 3R2IA 5FJ8G 4HMJA 4A3EH 1MIUA 1SFOB 3GTPH 4C2MB 1KAAA 2HHHL 2AQ3B 4DR7Q 1NMGA 3I72A 2PW5A 1KAWA 1D5MC 1QOHA 5FO9B 1PRTF 4DPGA 5FLMH 4OO1G 3G6EA 2KOLA 2ZM6L 2KHIA 3STBC 1VQLA 3SGIA 4AH6A 4N8FA 3IRBA 1LTBD 3G48A 5T1IA 1GUGA 1XMOL 4DV4L 1CQFA 5FKAC 3FMCA 3M3YB 1JCKB 2EY6A 1F9PA 4K6DA 4DV0Q 4V0BA 5C3WA 5F2DA 2RHQB 4GN3B 1H9RA 1R9TB 3VYUA 1V1QA 3PUZA 1A3TA 3AFPA 5IT9c 2YYZA 3CKIB 2DNEA 4B3TL 3WOEA 4HR7B 2XGTA 1HZ9A 3KF8A 1ICFB 3DM1A 1HR0L 3A74A 3S15H 3T4AC 4BBRB 4DNTB 3C46A 2XN9C 4B3SL 3DHQA 1PXUA 3RMHA 4OWXB 3HZXA 1GUNA 5JJZA 3GTKH 3A8JE 3GTGH 3WDNA 4U673 4LF9Q 2BA0A 1II3A 4EX5A 2ZJQA 2QEJC 4ALPA 3Q6SA 2I5MX 1X3FA 4IFDJ 2D5DA 4A3BB 3HOXG 4L5QA 3X3MA 4GNXC 2F03A 1BO0A 1IXRA 2A68C 2OQKA 5COYA 3WWVA 2OTJA 1TWAH 3D0FA 3T53B 4OEMB 3M4OH 2NVYB 3D4DA 1QJOA 1TWCH 3MVVA 2MUYA 3E3XA 3MXPA 1VQGA 2G9DA 4OGQC 3A56A 2JA9A 4EQOA 1I50B 3DEPA 4U68A 1VQNA 2UXCL 3A8KE 2JQOA 2OXPA 2PZUA 2Z0SA 1SNOA 3U50C 4CDCC 1HA6A 2IX3A 2KBNA 3TMEA 4BXXH 1SN8A 3J7AV 2EJMA 1UAPA 3NWTA 5IT9E 4NXMQ 2YU9H 4BY7G 3GTLH 4IFDG 5IP7G 4WRDA 4KJNA 4AQYL 1Z6HA 2GVAA 2NUCA 1AN8A 1HPCA 1UUPA 4JI6L 1S40A 1NE3A 3BVMA 4FP5D 1Q1EA 1K8AC 3HOUB 2MO0A 4YY3Q 1Q8KA 1E1TA 5C6AA 5IYCH 3C1EA 3S1NH 5IP9H 4EQ5A 3M4QA 3A7LA 4I7ZC 4DK0A 3UI2A 4YCVA 5FJ8H 2SNMA 2WIIB 5GAEC 4XTCS 1H95A 2LSSA 1E22A 3AEVA 5FOBB 3WOFA 4DV7Q 4OO1H 1D5XC 3MAQA 4RKLA 3RLNA 4MTNA 4JG2A 3BDCA 5CBAE 5BN3A 5IE8A 2KENA 5G3LD 1N36Q 4HJ8A 3SR1A 1Q7YC 4A3LG 2EYJA 1ILQA 3NP8A 2BDOA 1PDQA 1YJNA 4JBKA 4RHRA 3KOJA 2EZVA 1BQQT 3X3NA 4QIWE 4R8NA 1TXYA 5LL6S 2IX0A 3FDTA 2B2UA 1S5CD 3I4MG 2JK8A 1DYQA 1PRTD 4HCSA 4JI7Q 2NVXB 4BBSB 3VYRA 2FMCA 2XNAC 4FF2A 1XNQQ 4POFA 2K5WA 3QB3A 4X3UA 2CHBD 1PMRA 1JB7A 3FP9A 3MHBA 4P73A 3J7YW 5ELCA 2WAQB 4RCOA 1MHWC 3HOWB 1N33Q 2L4NA 4JCVE 1FYCA 1JJ2A 4JI5L 3PIP3 3RZDB 4A3FB 4P2CB 4A3CG 3EVQA 4AYBB 4GKKQ 5GAHC 1XYIA 2DJGC 2VZAA 3TREA 1MJEA 2ZXPA 1AW7A 2Z8LA 1AZQA 2QKIC 5EKIA 3CPFA 5DNFA 5D65A 4F87A 3FVQA 3STBD 5I9PA 2B2YA 3OPOA 3HOXH 4PZ7A 3T1HQ 1HNZL 5C3EG 5E4WC 2YTXA 3DXJC 3M4PA 4JI4Q 2DN8A 3UE1A 3GTMH 4BY1G 5C4HA 4JBWA 3T56B 4DAYA 1IBLQ 5CBEE 2F0OA 5D3DA 1BDOA 3GTJB 3CQZB 2KCTA 3SK8A 1I4HA 3KLWA 1ESRA 3QO2A 1NJIC 1B44D 1DJRD 1JJCB 4KK7A 2Q2IA 3GTQH 4JI3Q 5LMNW 3NTKA 3PO2G 1LLRD 4FXKC 4EQNA 4GN5A 2VL6A 4Z9CB 2K33A 4DR1L 4IFDH 5IP7H 2EJFC 1SYFA 2F0GA 3ERSX 1ML0D 1VQJA 1ESFA 3MFYA 4JVZA 2GA4B 4TSSA 1C9OA 1ZEQX 1XWEA 4L8JA 2IPKD 4CJ1B 1X3PA 3HKSA 3K0XA 4X65Q 2N55A 4G7HC 2EYLA 3LGJA 4C1NK 1EY0A 1O7ZA 1ZYRD 2B63B 2JE6I 1KLGD 3K7AH 1PRTB 1K28A 2L55A 1EIGA 3G7LA 1H9KA 3FPPA 4LF4Q 1X9NA 3IFDA 3Q23A 3RZOH 4ODGA 1E7ZA 1EY8A 4LF6Q 1W6KA 1XPUA 2KUMA 1EOTA 3MXNA 4JK1C 2R7ZB 2F0QA 5BN5A 5M5YH 1HFNA 4DR2Q 4DR6L 3CCLA 1OXTA 1G2TA 1QILA 1BCPC 2ALYB 1L0YB 1QCBD 5KNBA 1Y1WB 1Q1BA 3CP0A 1GJXA 3GV3A 2F0DA 4QF4A 1SR3A 4E6IA 4C3IB 1B2TA 4R4OA 2VQEQ 4GOPB 1GUOA 4A3LH 3CRKC 2F0TA 3OTOL 2X6LA 2RDHA 3J80c 1L1OB 4N9PA 2ZXOA 1V43A 5CYUA 5EJWA 1TU2B 1E3PA 3CU7A 1YHBA 4RA8A 2A5HA 4X66L 3I4MH 2HQEA 1CUKA 4F8MA 2D62A 3BS1A 4X62L 3Q8DA 2ES2A 2AQ1B 2C35B 1MBYA 2RSNA 3GP7A 3U4VA 2F0UA 1HR0W 3W2DA 1XNRQ 1KDAA 5K36G 4CKEA 2WB1G 2YV5A 1NMFA 4RAUC 1I94L 1UE6A 3HOVG 5CR3A 2B2WC 1C8CA 3PF5A 3RN5A 4TQUS 3A54A 1VS0A 1VQCA 3PO3G 3TRZA 2RQXA 3E9IA 4DUYL 4A3CH 1ET9A 1NR2A 4NMZA 2QF7A 4XT3B 5FO7B 2R92G 3A7AB 5GROA 4ME3A 4IPCA 2VNUD 1Y1VG 3S2HB 2F0LA 1WI5A 1A0IA 1YNNC 3S1MB 3CCMA 4LWCA 2K7VA 4RHSA 1CFMA 1WOCA 1VQ5A 1GHJA 1DONA 4IUPA 5C0XJ 3S17B 3V2TA 1S5ED 2PW7A 4RFBA 5C3EH 1PH3A 3KLSX 3H0GB 5GQOA 2UXBQ 3CMEA 2KCMA 2CQOA 5IGEA 5I6YA 2UUBQ 3ER0A 2PMZE 3CPWA 3J80i 2NZOA 4HAEA 4IOAA 4LF7L 4LNQA 4QJFA 1XMQL 4BY1H 3T1YL 1EZ6A 1LABA 4N9TA 4JI8Q 2AQ2B 3I73A 3MTSA 1HQRD 3URYA 1YBYA 2EYOA 2ZJPA 1KC8C 1STYA 2X69A 3J80E 4TVAB 1TY0A 4IURA 2A19A 1BOSA 1G8ZD 1V1OA 4YHHL 2IHFA 3NELA 1SJHD 5C44B 3CCEA 4JI2L 2EPBA 1WCMG 1TWHB 5DM73 1UNSA 3PIPA 2IW3A 1ZXTA 1J6QA 1YJ9A 1I4PA 4QL5A 3OW2A 1O7YA 3I70A 1CT1D 2VQFL 4KKSA 2CWAA 5HURA 3CC7A 4GLXA 4DV2Q 1H9SB 3K5LA 2WAQE 3E9HA 5C0XG 2Z4IA 1DOLA 2K75A 4LFBL 5M3FB 2NB0A 3HKZB 5KNCA 2LFNA 1EQTA 1WTXA 2VUMH 4XT1B 4X6AH 1Q86C 2OCEA 1E0BA 4LUZA 3TZDA 3EBEA 4BBRG 3MZ5A 4JI0L 4GKJL 4P71A 1LT5D 3NBHB 4DV1Q 5GADC 2E2HB 2QDLA 1YIJA 1A3UA 3H15A 3L3OC 1ICWA 1HTPA 1K83B 4K2LA 1D1KA 4A3DB 5LL6X 4CHTB 2I07B 3D3RA 3BVZA 1WVLA 1EYDA 5IOCA 5JAVA 4ZQ3A 5ELOA 3S14H 3EIVA 4IUTA 1A6XA 3I2ZA 4A3BG 2LS01 3UE0A 5BN4A 4DK1A 2KEEA 2E2IH 2JA6H 1E2WA 1U0LA 3GTOH 1YNJC 4FF1A 5EBDA 2UUCL 5L37A 4A3MB 4KTAA 4YWKA 4KHPQ 3S2DH 4DUZL 1DM0B 4PMBA 1AEXA 3E0EA 4HIKA 1J5EL 1IL2A 5GAGC 5M5XH 2NYZD 5LMNQ 3FKIB 5A2QE 4C3JG 1NSNS 2JSOA 3KF6B 2B39A 1A62A 1OXVA 3IFTA 1XXGA 1U9RA 3H94A 4CDDC 1FNWA 4LF8Q 2RHSB 1HA5A 4HJ7A 4A76A 3HOVH 2H4OA 1TQOA 5JVG3 1Y8NB 3MEFA 1HH2P 1LV9A 4RH6A 4LFCL 3PO3H 4DNRB 5AFWA 3BDLA 4A3IB 1AP0A 2HHHQ 2KHSA 3LNNA 1A2TA 5HGTA 4H0LC 3EA6A 3HFZB 5A35A 1Y1VH 2BCOA 2EYHA 5J22A 1JOOA 2GN5A 2ZM6Q 4A3JB 1X3EA 4OX9L 4K6LA 3HRZC 3A5UA 3ULPA 1XMOQ 4UP8A 1WD1A 4DV4Q 1FJGL 3K7UC 2ICIA 4C56C 1DOKA 4POGA 3U9OA 3OMGA 1EOVA 1A63A 2OQ0A 3AB9A 3QG1A 2CCZA 4IOCA 1LT3D 1LTLA 2F0NA 1DCZA 2D0OA 2R7FA 4ZK9B 4C1NI 1BBWA 4OELB 4DF7A 1GUSA 3O13A 2EYFA 2BDNA 2K03A 2MFIA 4DNIA 3OSOA 4A3EB 1WCMH 1PZID 1EUJA 5KGUA 4QMGA 3OOCA 4B3TQ 1SE8A 4B3RQ 4DAVA 3M7GA 2JA5B 3CHBD 2F4IA 1ENAA 3CCRA 2WACA 4BBSG 2HT1A 1IL8A 2EOTA 1G51A 2NZHA 1SMYC 4B3SQ 3S16H 2F1MA 5FK9C 3CCUA 1KQSA 1Y69U 1N8RC 2XSCA 1SNMA 1WTPA 4DR4Q 2WAQG 1RHPA 5C4JB 3HP3A 3HOWG 4KV6A 2EYMA 1S5BD 2A73B 4X3KA 1QB5D 1T5XD 4DR5Q 2AMCB 4DFAA 1VQMA 1QZHA 1TWGH 4A3FG 4GZYC 4YCUA 3PUWA 3RD4A 3SEBA 2J0TD 1CK1A 2JN4A 4GLVB 1K8GA 1JC7A 4UAIA 3K57A 4LAAA 4CJ0B 3HG9A 2YTYA 3BZCA 1D6EC 2B2UC 2JA8G 2DUDA 1U4LA 2UXDL 2ZTDA 2Z4HA 4Q0FA 3UDGA 5FLXc 4A3BH 2F0VA 2CW0D 3I7FA 3S15B 2EYPA 1YNXA 5EPKA 4YWMA 5KNDA 2UXCQ 2E5LL 3TDQA 4UHVA 1CZGA 2PZTA 4RWSC 3KJOA 3GTKB 2Z9HA 4O1NA 3I91A 4R1JA 4A93B 2UUAL 1EWCA 1YHAA 1IZ6A 4PZ6A 1Z9FA 3NXWA 1D8LA 2K14A 4JYAQ 3BZKA 1NTGA 5C0XI 3ICEA 4IO9A 4JI6Q 2DY8A 4C3JH 3H91A 1DOMA 2ENBA 4CDFC 2F52A 3VYTA 2F0EA 2N88A 3V96A 1TWAB 3MXUA 4R4QA 1LTRD 2B2YC 4DV5L 3M4OB 1WTQA 5ELBA 1SYDA 1TWCB 3CMAA 2C9OA 1VF7A 4J6HA 1B3AA 1MKHA 1BBXC 4X64L 2JA7G 2K04A 2MPMA 5IWAL 4XYQA 4GOPA 1AZPA 1S3OA 1CA5A 4A3KH 3GDEA 3NEMA 4L5RC 1L1OA 4HCEA 1C0AA 5AJ3L 2B63G 3AFQA 1FGBD 3PGZA 2VY3A 2NBFA 2YU9B 4UPAA 4YIJA 1VQHA 2KEDA 5FLXE 1U5KA 1VQPA 3NPPA 4PQXA 1D2BA 1PTOC 1UE5A 3NTIA 2Q8TA 2K6AA 2ASBA 2MHVA 1Y1WG 5LMUL 1M8AA 4JBJA 4RGMA 2Z6KC 1VQOA 1LT6D 3CF5A 3TP7A 2WKDA 4DA2A 4C3IG 2RA4A 1YZ6A 1F2ZA 4NDXA 3J81c 4HSPA 2IWHA 4XIGS 1TS5A 1HTLD 4DV3L 1STHA 1VQ9A 4CDEC 3UDFA 3J80L 1SE3A 1GVPA 1IW7D 4P75A 3KBGA 3AYHB 2CQAA 1D7QA 3KLRA 3TP5A 1BXTA 1CKNB 2FFKB 4JI5Q 4ZCKA 2NVXH 1EZ8A 4GLAC 4KD3A 2MP1A 2RBMA 4R4IA 4KY5A 4B9WA 1I5FA 2MJ8A 4HIMA 2WB1E 2OF1A 2LXKA 2WV6D 2I5HA 5C5MA 4B3ML 3HOWH 4R4CA 2CKZB 2N3SA 3CD6A 4XDXA 3FEWX 5E4XA 1UE7A 2PQAB 1EIYB 3K58A 2A6HC 2A69C 3D4WA 2AUJD 4DV7L 4RMFA 4BWGB 1VQ4A 1HNZQ 2B2VA 3VA5A 1PH5A 1VCIA 2NVTH 1K3RA 2JA8H 1S5DD 4YWLA 1W3SA 1VF5C 2NN6I 1I6HB 1I3QB 2EE1A 4HJAA 1ZKOA 2EVBA 3K81C 1AE2A 3HOZG 5EPJA 3I4NB 1PZKD 4IZ8A 5BR8L 2KCCA 5CV7A 3J81i 1K0RA 3K5NA 1WTWA 3GV6A 1H9SA 3TN2A 1QUQB 1XPOA 3AQQA 4OWTB 4H44C 1AFPA 3J81E 2EIFA 3Q0AA 1FNVA 1X55A 3UDIA 3RR5A 3GTJH 1N33L 2FINB 4DR1Q 3D6WA 4UY8C 1X3QA 3KDFB 1NR4A 1TY2A 2B3GA 5C44G 4ZRZA 4A3GG 3HOXB 2A6EC 2K28A 2J7ZA 1QNKA 2HDLA 2KCNA 1L0XB 5EBCA 3J81j 5M3MG 3CW2C 3KK7A 4C3HG 2H1EA 1WTVA 1RIPA 1IKMA 2K32A 1TWFH 4R9WA 3GTMB 1T5EA 3HGBA 5KRUA 1WD0A 3EFXD 2BE5C 1UEBA 3JAML 1S5FD 1RKNA 3SK4A 3NBIA 1EQVA 2Q8RE 2Z6KA 1CHPD 4BY7H 3W5OA 5IODA 2MGSA 3HEJA 2JA7H 3HOYB 1V8QA 4DR6Q 5JJLA 1JR0D 5M3FG 2I46A 2PPBC 2HIXA 4KD4A 5M9OA 3T16A 2XWJB 1B1ZA 3TP6A 2SEBD 1OXUA 3C3LA 4OL7A 3PQIA 3MEHA 3OWEB 1SBBB 1TS4A 2A68D 5C3XA 3DMUA 2ZTEA 2KHJA 1A3VA 1EIFA 2E2JH 3OTOQ 1R4PB 1SYBA 2RDFA 1G91A 2PZWA 1A15A 2XRQD 5I4DA 1VQAA 4OWWB 5JPNC 1PFNA 1PH7A 1FD7D 3KF6A 4JI1Q 1SYCA 4IUQA 4NKLA 3NQTA 1PZJD 3DWQA 4M8AA 4ZUJA 4X66Q 2V1CC 1Y1WH 1XPRA 1A8VA 2E74C 4X62Q 2HUGA 4WJ3M 1MI2A 4C3IH 5JEAJ 3K7AB 2JXMB 5ELNA 2CVRA 1N32Q 2E76C 1Q46A 3RZOB 1I94Q 1QWYA 3D6CA 3PV0A 2K5NA 5M5YB 3BYYB 1JWUD 3TS2A 3EN2A 4KLKA 4FYDA 2B8GA 2XWBB 4KN4C 5I9OA 4X65L 1MJCA 4DUYQ 4X3TA 3FKIG 1HNXL 3NWSA 3A8IE 2BH8A 1PA6A 5C5LA 1EYCA 4PNYA 2UU9L 1LTTD 1U4MA 1X3GA 2SOBA 4LF4L 1CQVA 2O2LD 1PH4A 1BCPF 3E0JA 1I4RA 3CCVA 4NP5A 1ENCA 5CV9A 3VR3A 2F0IA 4IQZA 2HDMA 3I4MB 2CH4W 1SEBD 2ICEC 1K8OA 1STEA 4I7AA 4A3IG 1KIXA 1ASYA 5I2YA 5JEAG 1SJED 5M5WH 1TS3A 3K6OA 2EJGC 4K5XA 3J7AF 1YI2A 2O4XA 4WORA 4QQBX 3F2BA 4LF7Q 3R8BA 2EY2A 1XMQQ 2EXZA 3T1YQ 2K5VA 2PNHA 2ZT9C 2MQHA 1I4QA 1GO3E 1M4VA 3S1MH 3HOZH 1WTHA 3U9SA 4A3JG 1FL0A 2AHOB 1RL2A 1CTMA 1V9PA 1IYJB 2N8NA 4LF5L 4JI2Q 2N78A 5E3FA 1EL0A 1VMCA 1M90C 1HZBA 2OT2A 2F4VL 3NUCA 4MNOA 2R93B 1UWVA 1Y8OB 2ZJRA 2VXWA 3S1QH 1NUCA 3DWPA 4ABNA 3MC0B 3E6ZX 1SNQA 4XXEA 2IY5B 1JORA 1YITA 3F8TA 3M4YA 5HY6A 3S1RH 4GNXB 4A3GH 1HNWL 1B4OA 4HMIA 4LFBQ 2QW7A 1JE4A 1Q12A 2JA5G 5M3MH 5LHY1 1EEID 4UDUC 4C3HH 1BUVT 4JI0Q 4GKJQ 1NBWA 2DGYA 1KD1C 2L0CA 4J1MA 4AIMA 4XQJA 4BY1B 3PO2H 2F3VA 3K8AA 3A55A 4IPGA 5EQ0A 1GM5A 2BA1A 4FXDA 1IBKL 1YJWA 3Q22A 4QUCA 1F9SA 1B8AA 3VR4A 3NQIA 5IT9L 4NXNL 4KKTA 3H3VI 3B6YA 2RCNA 1C48A 1IYUA 4AYBE 4K2KA 2K05A 3VR2A 2IJ0A 3OWFA 2K4KA 3MFGA 4LW1A 1EY7A 4LFAQ 1MSHA 5D3IB 3DEOA 4H7BA 4RGNA 1YVCA 1PTOH 1QG7A 5DM63 4MIUA 4DR3L 4ZUIA 4K5VA 2UUCQ 4ID6A 1AH9A 3KBXA 2YTVA 1KRSA 2Y0SB 3EJIA 4DUZQ 3I3CA 2BH2A 2XVSA 1J5EQ 2VUMB 3PMFA 1KL9A 3BZDB 1CSQA 1G6PA 1TKWB 1N34L 1GUTA 4TKOB 3H09A 1EU3A 1EWHA 4IUNA 1CSPA 2K01A 4H13C 4L63B 3GQBA 4FO2A 4HIDA 4A93G 1RF2D 2K50A 2KJXA 2L15A 1SRUA 5ELEA 2IL8A 5EKLA 5IYBG 2BE5D 4LFCQ 4GS3A 2R61A 3VYSA 3N6RA 4KMUC 1VMPA 2KECA 1JOQA 5K36H 2PI2E 1GD7A 3L7ZC 1KABA 2HCIA 1XTDA 4QGUA 4R4TA 2E2IB 2JA6B 5I2XA 3D8GA 4KJOA 3SXHA 4JV5L 4OX9Q 4IJLA 4YCWA 1B9MA 1D5ZC 3JC66 3S2DB 4A3IH 1F2LA 2L5TA 1CHQD 3SVMA 1QZGA 5JEAH 1QVFA 2MNAA 5C4XB 3FPUB 5E7NA 2R92H 1FJGQ 1IBML 3HOUG 1BCPD 3W1BA 1OXSC 3SE0A 1X32A 4MZ9A 1DGSA 2A8VA 1EQQA 3I4LA 2M9VA 4K0KL 1W6JA 1PLFA 2OEOA 4IPDA 1CKNA 2NVQB 2JYOA 1YHQA 1PRTC 1RTNA 4Y7NH 4DV6L 1SFOH 2ZTCA 4PMCA 3VR6A 4C2MH 2R7DA 2B8FA 3KUPA 3TSSA 1DXMA 3P75A 4M1UB 1EWIA 4APVA 3ZJYC 3NSWA 4LF8L 1Y1VB 2EY5A 4HEDA 3CXCA 1GXDC 1LTGD 2NN6G 2NZ1D 1QE6A 1J8IA 5IGDA 1W2BA 5IP9G 1G291 3BVGA 3H6MA 1LM0A 2PQAA 4GOPC 1BF4A 2K5DA 2Q2HA 5T1GA 3OYYA 3G6JB 1TS2A 1H9MA 3GTPB 1L1OC 5TSSA 2JA5H 2HCCA 3I4OA 1HR0Q 2VS1A 3QR8A 3M3YH 2M00A 4HSVA 4KKUA 1E2VA 3OHXC 3J7A5 2NWGA 4KN7C 1F77A 1STBA 3TQYA 1R9TH 3RLFA 5C0XH 2SNSA 2TSSA 5C4JH 3RNUA 2UXDQ 1F9RA 2PCFB 1WCMB 1EY9A 1EYAA 4IUVA 4DR7L 4CJ2C 1UE1A 1QUQA 1YNND 1O80A 4A4IA 4I65A 1B50A 4DXFA 3NHHA 5CORA 4BBRH 4RCNA 2OWOA 1KDCA 3CAMA 4AYBG 2E5LQ 3GO5A 3S16B 4X3SA 3KDFA 1PYBA 1A2UA 2FMMA 3SDZA 2VW9A 1LYLA 2E2DC 2JP1A 2AKWB 1U4PA 2WKCA 2UUAQ 1KHIA 4OIJA 4B3RL 3I4NG 3DUZA 1WJJA 4OHJA 3ERQA 1TWGB 3H3VC 2PI2A 3KLSA 2RKSA 1JMCA 1CM9A 3DM3A 4DV0L 3NE5B 2F3WA 1SMXA 2JEAI 1FNUA 2R6GA 2DJFC 5J39A 1VQ7A 4DR4L 4B08A 4DV5Q 2NVYH 3GTGB 4A93H 2GVBA 1BCPB 2V4DA 4JOIA 1Q81C 3T13A 1G2SA 5IYBH 1WTRA 1O7LA 1M1KC 4G7OC 2B2VC 4DR5L 2JEBI 1SE2A 1PHJA 4Q5VA 4P72A 4X64Q 4AQYQ 3M85A 1ZYRC 5IWAQ 1I50H 1GKHA 4R8IA 1QNUA 1ILPA 4OXPA 4CGYB 1K3BC 1PFMA 3J7ZC 1O78A 1SNDA 5AJ3Q 2VB2X 4L5SA 1V1PB 4LF9L 2B2TA 4CKBA 3F1ZA 4OIKA 4DU9A 1XJVA 4O42A 1TIID 3IKJA 3HOYG 3HKZE 3R3OA 1JOKA 1E2ZA 4NB3A 4C3JB 2ATWA 5KIXA 1K73C 3HOUH 5LMUQ 2RF4A 1Q90A 3K0YA 4BS9A 1JB3A 3W3AA 1EIHA 4IALA 1TR5A 1BKBA 2RCFA 1B9NA 1F2MA 3MXGA 4FF4A 4DV3Q 4JYAL 3S24A 5IGGA 4KI0A 4XYOA 2Y0SE 5K5PA 3GTLB 2R7ZG 4XQNA 5KYLA 1HUNA 1JT8A 1YNJD 1UEAB 5JOBA 1LUZA 1NNXA 4FDBA 4RG1A 3MA2B 3I8ZA 4A3KB 3FHWA 5IY0A 2WINB 2NN6H 4LUOA 2K5HA 1SNPA 3F2CA 3PUYA 3AU7A 4IN3A 4KHVA 5JPMC 2QILA 1Q8IA 3S1NB 1PH6A 1LTID 1Y14B 4NPSA 3KJPA 4B3MQ 1SYEA 1X54A 2XRSD 4NXML 1RCVD 1VQEA 1OTCA 2FXQA 5ELDA 1CKOA 4L6TB 4J15A 1GHKA 4BBSH 4YY3L 4ZYSA 3P7JA 1OO9B 3A0JA 2ZXRA 2N49A 3PIO3 2PMZB 4JBMA 2B29A 1C7YA 1RJTA 1PTOF 4CBVA 1QVGA 3ZYYX 4WJWA 2QDBA 1LO5D 2F0WA 3BU2A 3NENA 3PUVA 3CCSA 1G6ZA 3RZDH 4A3FH 1DD2A 1B70B 3Q24A 2P5ZX 3UDXA 5BR8Q 3I55A 2EQSA 1CKMA 4JC0A 4B9XA 4BA2I 5IGBA 1JQYD 1GUWA 1N36L 3LX0A 1JWMD 4GNXA 3RUZA 2WFWA 1I6HH 1I3QH 1T9HA 4DN4M 2R3ZA 1KLUD 5IIFA 4G7ZC 4Y52H 3T51B 3I4NH 2NTTA 1B53A 1PYWD 3EROA 3VA7A 1HRJA 3R2TA 4ZLTF 4JI7L 1OXXK 2CWPA 1XNQL 4XQQA 2L11A 3CCJA 3NTHA 3H0GG 1IYVA 3I90A 2R93G 5JJIA 3U58A 2NVTB 3G71A 1PYSB 4BA1I 2Q2TA 4ULLA 1PVOA 3AMUA 2JA8B 3QIAA 4OO1I 4DK3C 4JPBW 3CCQA 1PV4A 1SMYD 3CQZH 1KNEA 3K59A 3TBIB 2KVMA 4WFN3 1BVSA 1XTCD 3NK9A 4V190 1LACA 1PH2A 3PSIA 4K5WA 2F0MA 3NBHA 2EY1A 3E5SA 4FXGC 4GKKL 5CV6A 5CMDA 3KF8B 4IJHA 1LTSD 5A2QL 1Y8PB 2TMPA 1CZWA 3DWAA 3FRPB 5FO8B 3TS0A 3OIQA 2PNRC 2J4XA 3HOYH 4F7XA 2O5IC 1CA6A 2KA7A 4JW0A 3T1HL 2F0JA 1KNAA 1MD2D 3HKZG 1ET6A 1VQ6A 1Z7TA 5IGCA 1O7IA 1HUMA 2L1BA 2EXDA 4JI4L
chains in the Genus database with same CATH topology
1KD1C 4AIMA 2IHEA 2B63H 2CCZA 4IOCA 1Z47A 1LTLA 3PO2H 5IYCH 2D0OA 3K8AA 2R7FA 1IBLL 3S1NH 5IP9H 3BJUA 1BBWA 4EQ5A 1VQFA 1WFQA 3M4QA 1VQIA 4IPGA 3DLLA 4YCVA 2MFIA 4O0AA 5FJ8H 4DNIA 2A1AA 1GM5A 2BA1A 2R7ZH 1IBKL 1YJWA 1WCMH 1B8AA 3S14H 1EUJA 5GAEC 3M7NA 4A3DG 4B3TQ 1SE8A 4NXNL 2Y0SG 4B3RQ 4XTCS 5HGQA 3CC4A 2QGQA 1H95A 2LSSA 3H3VI 2VUMG 1E22A 3B6YA 2RCNA 3CCRA 3AEVA 4BBSG 2HT1A 4AYBE 4DV7Q 4HIOA 4JI3L 1G51A 1HNXQ 3ULJA 3RLNA 2NZHA 4MTNA 4B3SQ 2K4KA 4JG2A 4LW1A 3CCUA 1PH8A 2UU9Q 3S16H 1FVIA 2KENA 5IE8A 1KQSA 4LFAQ 1KRTA 4HJ8A 1N36Q 1N8RC 1Q7YC 4A3LG 2LXJA 1YVCA 3L0OA 4PZ8A 1YJNA 4DKAC 3KOJA 4JBKA 4DR3L 4DR4Q 1X65A 2WAQG 4UP7A 5EAYA 2UUCQ 3HOWG 1AH9A 4QIWE 2YTVA 1TXYA 1KRSA 4A3MG 4DR5Q 1EQRA 3W1GA 2AMCB 2IX0A 2IT1A 4DUZQ 3I4MG 2JK8A 2BH2A 1J5EQ 1VQMA 1QZHA 1TWGH 4A3FG 4JI7Q 1SLJA 1KL9A 4YCUA 1XNQQ 3PUWA 2K52A 4DAMA 4POFA 1CSQA 1G6PA 1N34L 5IYDG 4GLVB 1JB7A 1K8GA 3FP9A 4P73A 2YTYA 2CFMA 1CSPA 3BZCA 2JA6G 2JA8G 1VQDA 2DUDA 4PMWA 4LF6L 2UXDL 4GN4B 2ZTDA 2XTIA 4A93G 4HIDA 3UDGA 2K50A 1N33Q 2L15A 1SRUA 4JI1L 4DR2L 5FLXc 2HIVA 4JCVE 5IYBG 4LFCQ 1JJ2A 1VQ8A 4JI5L 4GS3A 4IFDI 4LF5Q 4A3BH 1HZCA 3I7FA 2I0QA 1P16A 5C4XG 3F2DA 1YNXA 2ID0A 2F4VQ 4A3CG 4YWMA 1PH1A 2UXCQ 2E5LL 4GKKQ 3PUXA 5DLQE 2VQEL 2PI2E 4UP9A 1GD7A 3L7ZC 3KJOA 4H02A 5GAHC 1XTDA 4QGUA 4R4TA 3S2HH 1N32L 4OONA 2VZAA 4R1JA 3TREA 1MJEA 2UUAL 3I56A 1YHAA 1IZ6A 4PZ6A 4JV5L 1Z9FA 4OX9Q 3CPFA 4IJLA 4YCWA 2D0PA 3H3VH 3STBD 1D8LA 2K14A 3JC66 4JYAQ 3BZKA 1NTGA 5C0XI 4YHHQ 4A3IH 3ICEA 3S17H 4IO9A 3VDYA 1QZGA 3HOXH 3CC2A 4PZ7A 4JI6Q 3T1HQ 2MNAA 1QVFA 3H0GH 4C3JH 1E24A 5E7NA 1HNZL 5C3EG 2R92H 1FJGQ 1IBML 2YTXA 2R93H 2H5XA 2F52A 1JE5A 3M4PA 3HOUG 3W1BA 3G4SA 4JI4Q 1OXSC 3UE1A 3PIOA 1XNRL 3PF4A 4MZ9A 1DGSA 4R4QA 2A8VA 3GTMH 4BY1G 1EQQA 4JBWA 2VQFQ 4K0KL 4IPHA 4DV5L 1IBLQ 4IPDA 3TEHB 3U4ZA 1CKNA 2KCTA 3CMAA 1YHQA 1QVCA 4Y7NH 1K9MC 4DV6L 1KXLA 1MKHA 1PFSA 3KLWA 2ZTCA 5C44H 1SFOH 1IBKQ 4X64L 2JA7G 4C2MH 4A3EG 2R7DA 1TWHH 1NJIC 1JJCB 5IWAL 2E8GA 4NXNQ 1SROA 4GOPA 1EWIA 2Q2IA 4APVA 3ZJYC 1S3OA 4A3KH 4LF8L 3GTQH 4IFDJ 4JI3Q 3GDEA 3NEMA 5LMNW 1L1OA 4L5RC 1C0AA 5AJ3L 5FLMG 3CXCA 4L5TA 1E1OA 1HZAA 2B63G 2NN6G 3PO2G 4GN5A 1WYDA 3AFQA 2VL6A 3PGZA 2QA4A 1W2BA 2VY3A 5IP9G 1G291 1LM0A 3M9BA 2PQAA 4LUVA 4DR1L 4GOPC 4UPAA 5IP7H 1VQHA 4DR3Q 4QY7A 2Q2HA 1U5KA 3OYYA 1VQPA 3ERSX 1VQJA 5JJKA 3RLOA 1C9OA 1UE5A 5M3FH 1L1OC 2UXBL 2JA5H 2ASBA 3I4OA 3HKSA 1Y1WG 5LMUL 4HJ5A 3RN2A 2VS1A 3K0XA 4X65Q 1HR0Q 2UUBL 4JBJA 3M3YH 3KFUA 4WJ4A 2Z6KC 1VQOA 3CF5A 3LGJA 3J7A5 4JI8L 2JE6I 1N34Q 1YZ6A 3K7AH 3J81c 2E2HH 3JAMc 3TQYA 1R9TH 3D31A 4XIGS 3RLFA 4LF4Q 1X9NA 2F3IA 4DV3L 1L2FA 3RZOH 1VQ9A 1E7ZA 1K83H 2I5LX 3UDFA 5C4JH 3RNUA 4LF6Q 1XPUA 2UXDQ 1GVPA 5M5YH 4A3DH 2AWNA 4P75A 4DAYB 3AYHB 4DR2Q 1Q82C 4DR6L 4DR7L 1D7QA 1UE1A 3CCLA 1OXTA 1QUQA 1CKNB 2ALYB 4A4IA 4JI5Q 2QEXA 2NVXH 1Q1BA 3CP0A 1VQKA 4GLAC 4BBRH 4R4IA 4KHZA 1X56A 2OWOA 3CAMA 1SR3A 4AYBG 1I5FA 2E5LQ 3GO5A 4R4OA 2VQEQ 4DV2L 4HIMA 4GOPB 2WB1E 4A3LH 2LXKA 2Q2UA 3KDFA 3KYHC 1PYBA 2I5HA 3OTOL 4B3ML 4A75A 2VW9A 1LYLA 3J80c 1L1OB 3HOWH 4R4CA 2AKWB 1V43A 2CKZB 2JJQA 2UUAQ 2N3SA 1KHIA 1E3PA 4A3MH 3CD6A 4JV5Q 1YHBA 4B3RL 4X66L 3I4NG 3I4MH 1UE7A 1CUKA 2PQAB 2JA7H 1WJJA 1EIYB 2D62A 1EFWA 4X62L 2AWOA 5J3BA 3Q8DA 4DV7L 3FKIH 4RMFA 2PI2A 1VQ4A 2ES2A 1P8LA 2C35B 1HNZQ 1IBMQ 1JMCA 2MO1A 3DM3A 4DV0L 5IYDH 3U4VA 1VCIA 4DV1L 1SMXA 1PH5A 1HR0W 4LFAL 1XNRQ 2JEAI 3L2PA 2NVTH 5K36G 1K3RA 2R6GA 2JA8H 1VQ7A 2WB1G 1FGUA 1NMFA 2YV5A 4YWLA 4DR4L 4K0KQ 1W3SA 5H1SE 2NN6I 4DV5Q 3GD7A 1UE6A 2NVYH 1I94L 3HOVG 2GVBA 4A93H 4HJAA 4JOIA 1Q81C 3K81C 1AE2A 5IYBH 4HJ9A 3HOZG 1M1KC 4DR5L 3PF5A 3RN5A 1S72A 4TQUS 2JEBI 4DV6Q 1PHJA 1VS0A 4P72A 4X64Q 1VQCA 1N9WA 4AQYQ 5C4XH 3PO3G 3TRZA 5BR8L 3M85A 3E9IA 3MXNB 4DUYL 5IWAQ 4A3CH 1I50H 1GKHA 3J81i 1K0RA 3JAMi 1JJGA 2R92G 4OXPA 5GROA 1L0WA 1PH9A 1QUQB 4ME3A 1XPOA 4JOIC 3AQQA 2IX1A 4OWTB 4IPCA 2WP8J 2VNUD 3J7ZC 2EIFA 5AJ3Q 1ASZA 1Y1VG 1HJPA 1X55A 1EYGA 3UDIA 4L5SA 4PG3A 1WI5A 3RR5A 3K80C 1A0IA 3GTJH 4LF9L 2NVQH 3F1ZA 4A3JH 3CCMA 1N33L 4BXXG 4LWCA 4DR1Q 1XJVA 4UY8C 1WOCA 3KDFB 4P74A 4KHPL 1VQ5A 2B3GA 3HOYG 5C44G 5C0XJ 4A3GG 3HKZE 1AE3A 5C3EH 1PH3A 5LMNL 2UXBQ 5GQOA 4NB3A 2ATWA 3CMEA 2KCMA 1K73C 3HOUH 2CQOA 2OTLA 5LMUQ 2UUBQ 2HQLA 3ER0A 2PMZE 5M3MG 2RF4A 4O2DA 3CW2C 3J81j 3J80i 2NZOA 3CPWA 4IOAA 4LF7L 4A3KG 4QJFA 1XMQL 1YEZA 1RIPA 3A5ZB 4LNQA 4BY1H 1TWFH 3T1YL 1HNWQ 1BKBA 4JI8Q 3ULLA 4DK6C 1BBUA 1YBYA 2ZJPA 5IYCG 1KC8C 1UEBA 4TVAB 1B7YB 4DV3Q 2Z6KA 1NY4A 2A19A 4JYAL 4BY7H 3W5OA 3PCOB 1X6OA 3S24A 1VQBA 2IHFA 3NELA 4KI0A 5FJ8G 4YHHL 1MIUA 2Y0SE 3CCEA 4A3EH 4JI2L 2R7ZG 3GTPH 1WCMG 2HHHL 4DR6Q 4DR7Q 5JJLA 5M3FG 1JT8A 1NMGA 2HIXA 3PIPA 1KAWA 1LUZA 4FDBA 1J6QA 4RG1A 1YJ9A 1OXUA 4QL5A 3OW2A 3FHWA 4DPGA 5IY0A 5FLMH 4OO1G 4LUOA 2K5HA 3G6EA 2VQFL 2CWAA 3CC7A 4GLXA 4DV2Q 3F2CA 2ZTEA 3PUYA 2KHJA 2WAQE 1EIFA 2KHIA 3STBC 1Y14B 3OTOQ 4NPSA 3KJPA 2ZM6L 1X54A 1PH6A 1VQLA 4B3MQ 4NXML 3E9HA 3SGIA 5C0XG 1VQAA 1VQEA 4AH6A 4OWWB 1OTCA 2FXQA 1PH7A 2K75A 4LFBL 3IRBA 3G48A 3KF6A 1CKOA 4JI1Q 4X66Q 2IY5B 4J15A 1XMOL 2V1CC 1Y1WH 4DV4L 1A8VA 1XPRA 2E2JH 2VUMH 4X62Q 4X6AH 1Q86C 2OCEA 4LUZA 4YY3L 4BBSH 4WJ3M 3EBEA 3A0JA 4BBRG 2N49A 4JBMA 4JI0L 4GKJL 2B29A 4P71A 4C3IH 5JEAJ 4DV0Q 1C7YA 3NBHB 4DV1Q 2RHQB 4GN3B 5GADC 5ELNA 1QVGA 1YIJA 3H15A 1V1QA 1N32Q 3PUZA 1Q46A 1I94Q 3PV0A 3AFPA 5IT9c 2K5NA 3BU2A 2YYZA 3NENA 3PUVA 4B3TL 3TS2A 3EN2A 3CCSA 2XGTA 1HZ9A 4KLKA 3RZDH 4A3FH 1HR0L 1B70B 5ELOA 4X65L 1MJCA 3EIVA 3UDXA 5BR8Q 3I55A 3A74A 2EQSA 4DUYQ 3I2ZA 3S15H 4A3BG 3FKIG 1CKMA 1HNXL 4JC0A 3UE0A 2BH8A 1PA6A 4B3SL 4BA2I 2UU9L 1X3GA 4OWXB 1N36L 3GTKH 4LF4L 2E2IH 1PH4A 4GNXA 2JA6H 2WFWA 3CCVA 3GTGH 1I6HH 1I3QH 1T9HA 1U0LA 3GTOH 4LF9Q 2BA0A 4Y52H 2UUCL 4EX5A 2ZJQA 3I4NH 4YWKA 4ALPA 4KHPQ 3S2DH 4DUZL 2I5MX 1X3FA 1J5EL 3E0EA 4HIKA 1IL2A 5GAGC 5M5XH 1OXXK 4A3IG 1KIXA 2CWPA 1ASYA 4JI7L 1XNQL 3HOXG 5LMNQ 4L5QA 5JEAG 5M5WH 3CCJA 4GNXC 2OQKA 1IXRA 3H0GG 3KF6B 3WWVA 1A62A 1OXVA 1YI2A 2R93G 5JJIA 4QQBX 3U58A 2OTJA 3F2BA 4LF7Q 1XMQQ 4LF8Q 3G71A 1PYSB 1TWAH 4BA1I 3D0FA 2RHSB 4HJ7A 3T1YQ 2K5VA 2Q2TA 2PNHA 4OO1I 4A76A 1PVOA 4DK3C 3HOVH 3M4OH 2MQHA 3CCQA 1PV4A 3S1MH 1GO3E 3HOZH 3CQZH 1TWCH 4A3JG 1FL0A 3MEFA 2AHOB 1RL2A 1HH2P 4LFCL 1V9PA 1VQGA 1BVSA 3PO3H 1IYJB 2N8NA 4LF5L 4JI2Q 2N78A 1PH2A 2HHHQ 3PSIA 1M90C 2JA9A 1HZBA 2F4VL 1VQNA 2UXCL 4MNOA 1UWVA 4GKKL 2JQOA 2ZJRA 3KF8B 4IJHA 3HFZB 3S1QH 1Y1VH 2Z0SA 3U50C 2KBNA 3TS0A 4BXXH 1SN8A 4GKJQ 2GN5A 2ZM6Q 4NXMQ 1YITA 1X3EA 4OX9L 2YU9H 3F8TA 3HOYH 5HY6A 4BY7G 3S1RH 4GNXB 5IP7G 3GTLH 4IFDG 4A3GH 1HNWL 4AQYL 3A5UA 2GVAA 4JI6L 4LFBQ 3ULPA 3T1HL 1S40A 1NE3A 1Q1EA 1XMOQ 4UP8A 1Q12A 3HKZG 1K8AC 4DV4Q 1FJGL 3K7UC 2JA5G 4POGA 1O7IA 5M3MH 1VQ6A 2MO0A 4C3HH 1EOVA 4YY3Q 1Q8KA 2EXDA 1A63A 1E1TA 4JI4L 4JI0Q 2OQ0A 1NBWA 2DGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 C;  4AIM A;  2IHE A;  2B63 H;  2CCZ A;  4IOC A;  1Z47 A;  1LTL A;  3PO2 H;  5IYC H;  2D0O A;  3K8A A;  2R7F A;  1IBL L;  3S1N H;  5IP9 H;  3BJU A;  1BBW A;  4EQ5 A;  1VQF A;  1WFQ A;  3M4Q A;  1VQI A;  4IPG A;  3DLL A;  4YCV A;  2MFI A;  4O0A A;  5FJ8 H;  4DNI A;  2A1A A;  1GM5 A;  2BA1 A;  2R7Z H;  1IBK L;  1YJW A;  1WCM H;  1B8A A;  3S14 H;  1EUJ A;  5GAE C;  3M7N A;  4A3D G;  4B3T Q;  1SE8 A;  4NXN L;  2Y0S G;  4B3R Q;  4XTC S;  5HGQ A;  3CC4 A;  2QGQ A;  1H95 A;  2LSS A;  3H3V I;  2VUM G;  1E22 A;  3B6Y A;  2RCN A;  3CCR A;  3AEV A;  4BBS G;  2HT1 A;  4AYB E;  4DV7 Q;  4HIO A;  4JI3 L;  1G51 A;  1HNX Q;  3ULJ A;  3RLN A;  2NZH A;  4MTN A;  4B3S Q;  2K4K A;  4JG2 A;  4LW1 A;  3CCU A;  1PH8 A;  2UU9 Q;  3S16 H;  1FVI A;  2KEN A;  5IE8 A;  1KQS A;  4LFA Q;  1KRT A;  4HJ8 A;  1N36 Q;  1N8R C;  1Q7Y C;  4A3L G;  2LXJ A;  1YVC A;  3L0O A;  4PZ8 A;  1YJN A;  4DKA C;  3KOJ A;  4JBK A;  4DR3 L;  4DR4 Q;  1X65 A;  2WAQ G;  4UP7 A;  5EAY A;  2UUC Q;  3HOW G;  1AH9 A;  4QIW E;  2YTV A;  1TXY A;  1KRS A;  4A3M G;  4DR5 Q;  1EQR A;  3W1G A;  2AMC B;  2IX0 A;  2IT1 A;  4DUZ Q;  3I4M G;  2JK8 A;  2BH2 A;  1J5E Q;  1VQM A;  1QZH A;  1TWG H;  4A3F G;  4JI7 Q;  1SLJ A;  1KL9 A;  4YCU A;  1XNQ Q;  3PUW A;  2K52 A;  4DAM A;  4POF A;  1CSQ A;  1G6P A;  1N34 L;  5IYD G;  4GLV B;  1JB7 A;  1K8G A;  3FP9 A;  4P73 A;  2YTY A;  2CFM A;  1CSP A;  3BZC A;  2JA6 G;  2JA8 G;  1VQD A;  2DUD A;  4PMW A;  4LF6 L;  2UXD L;  4GN4 B;  2ZTD A;  2XTI A;  4A93 G;  4HID A;  3UDG A;  2K50 A;  1N33 Q;  2L15 A;  1SRU A;  4JI1 L;  4DR2 L;  5FLX c;  2HIV A;  4JCV E;  5IYB G;  4LFC Q;  1JJ2 A;  1VQ8 A;  4JI5 L;  4GS3 A;  4IFD I;  4LF5 Q;  4A3B H;  1HZC A;  3I7F A;  2I0Q A;  1P16 A;  5C4X G;  3F2D A;  1YNX A;  2ID0 A;  2F4V Q;  4A3C G;  4YWM A;  1PH1 A;  2UXC Q;  2E5L L;  4GKK Q;  3PUX A;  5DLQ E;  2VQE L;  2PI2 E;  4UP9 A;  1GD7 A;  3L7Z C;  3KJO A;  4H02 A;  5GAH C;  1XTD A;  4QGU A;  4R4T A;  3S2H H;  1N32 L;  4OON A;  2VZA A;  4R1J A;  3TRE A;  1MJE A;  2UUA L;  3I56 A;  1YHA A;  1IZ6 A;  4PZ6 A;  4JV5 L;  1Z9F A;  4OX9 Q;  3CPF A;  4IJL A;  4YCW A;  2D0P A;  3H3V H;  3STB D;  1D8L A;  2K14 A;  3JC6 6;  4JYA Q;  3BZK A;  1NTG A;  5C0X I;  4YHH Q;  4A3I H;  3ICE A;  3S17 H;  4IO9 A;  3VDY A;  1QZG A;  3HOX H;  3CC2 A;  4PZ7 A;  4JI6 Q;  3T1H Q;  2MNA A;  1QVF A;  3H0G H;  4C3J H;  1E24 A;  5E7N A;  1HNZ L;  5C3E G;  2R92 H;  1FJG Q;  1IBM L;  2YTX A;  2R93 H;  2H5X A;  2F52 A;  1JE5 A;  3M4P A;  3HOU G;  3W1B A;  3G4S A;  4JI4 Q;  1OXS C;  3UE1 A;  3PIO A;  1XNR L;  3PF4 A;  4MZ9 A;  1DGS A;  4R4Q A;  2A8V A;  3GTM H;  4BY1 G;  1EQQ A;  4JBW A;  2VQF Q;  4K0K L;  4IPH A;  4DV5 L;  1IBL Q;  4IPD A;  3TEH B;  3U4Z A;  1CKN A;  2KCT A;  3CMA A;  1YHQ A;  1QVC A;  4Y7N H;  1K9M C;  4DV6 L;  1KXL A;  1MKH A;  1PFS A;  3KLW A;  2ZTC A;  5C44 H;  1SFO H;  1IBK Q;  4X64 L;  2JA7 G;  4C2M H;  4A3E G;  2R7D A;  1TWH H;  1NJI C;  1JJC B;  5IWA L;  2E8G A;  4NXN Q;  1SRO A;  4GOP A;  1EWI A;  2Q2I A;  4APV A;  3ZJY C;  1S3O A;  4A3K H;  4LF8 L;  3GTQ H;  4IFD J;  4JI3 Q;  3GDE A;  3NEM A;  5LMN W;  1L1O A;  4L5R C;  1C0A A;  5AJ3 L;  5FLM G;  3CXC A;  4L5T A;  1E1O A;  1HZA A;  2B63 G;  2NN6 G;  3PO2 G;  4GN5 A;  1WYD A;  3AFQ A;  2VL6 A;  3PGZ A;  2QA4 A;  1W2B A;  2VY3 A;  5IP9 G;  1G29 1;  1LM0 A;  3M9B A;  2PQA A;  4LUV A;  4DR1 L;  4GOP C;  4UPA A;  5IP7 H;  1VQH A;  4DR3 Q;  4QY7 A;  2Q2H A;  1U5K A;  3OYY A;  1VQP A;  3ERS X;  1VQJ A;  5JJK A;  3RLO A;  1C9O A;  1UE5 A;  5M3F H;  1L1O C;  2UXB L;  2JA5 H;  2ASB A;  3I4O A;  3HKS A;  1Y1W G;  5LMU L;  4HJ5 A;  3RN2 A;  2VS1 A;  3K0X A;  4X65 Q;  1HR0 Q;  2UUB L;  4JBJ A;  3M3Y H;  3KFU A;  4WJ4 A;  2Z6K C;  1VQO A;  3CF5 A;  3LGJ A;  3J7A 5;  4JI8 L;  2JE6 I;  1N34 Q;  1YZ6 A;  3K7A H;  3J81 c;  2E2H H;  3JAM c;  3TQY A;  1R9T H;  3D31 A;  4XIG S;  3RLF A;  4LF4 Q;  1X9N A;  2F3I A;  4DV3 L;  1L2F A;  3RZO H;  1VQ9 A;  1E7Z A;  1K83 H;  2I5L X;  3UDF A;  5C4J H;  3RNU A;  4LF6 Q;  1XPU A;  2UXD Q;  1GVP A;  5M5Y H;  4A3D H;  2AWN A;  4P75 A;  4DAY B;  3AYH B;  4DR2 Q;  1Q82 C;  4DR6 L;  4DR7 L;  1D7Q A;  1UE1 A;  3CCL A;  1OXT A;  1QUQ A;  1CKN B;  2ALY B;  4A4I A;  4JI5 Q;  2QEX A;  2NVX H;  1Q1B A;  3CP0 A;  1VQK A;  4GLA C;  4BBR H;  4R4I A;  4KHZ A;  1X56 A;  2OWO A;  3CAM A;  1SR3 A;  4AYB G;  1I5F A;  2E5L Q;  3GO5 A;  4R4O A;  2VQE Q;  4DV2 L;  4HIM A;  4GOP B;  2WB1 E;  4A3L H;  2LXK A;  2Q2U A;  3KDF A;  3KYH C;  1PYB A;  2I5H A;  3OTO L;  4B3M L;  4A75 A;  2VW9 A;  1LYL A;  3J80 c;  1L1O B;  3HOW H;  4R4C A;  2AKW B;  1V43 A;  2CKZ B;  2JJQ A;  2UUA Q;  2N3S A;  1KHI A;  1E3P A;  4A3M H;  3CD6 A;  4JV5 Q;  1YHB A;  4B3R L;  4X66 L;  3I4N G;  3I4M H;  1UE7 A;  1CUK A;  2PQA B;  2JA7 H;  1WJJ A;  1EIY B;  2D62 A;  1EFW A;  4X62 L;  2AWO A;  5J3B A;  3Q8D A;  4DV7 L;  3FKI H;  4RMF A;  2PI2 A;  1VQ4 A;  2ES2 A;  1P8L A;  2C35 B;  1HNZ Q;  1IBM Q;  1JMC A;  2MO1 A;  3DM3 A;  4DV0 L;  5IYD H;  3U4V A;  1VCI A;  4DV1 L;  1SMX A;  1PH5 A;  1HR0 W;  4LFA L;  1XNR Q;  2JEA I;  3L2P A;  2NVT H;  5K36 G;  1K3R A;  2R6G A;  2JA8 H;  1VQ7 A;  2WB1 G;  1FGU A;  1NMF A;  2YV5 A;  4YWL A;  4DR4 L;  4K0K Q;  1W3S A;  5H1S E;  2NN6 I;  4DV5 Q;  3GD7 A;  1UE6 A;  2NVY H;  1I94 L;  3HOV G;  2GVB A;  4A93 H;  4HJA A;  4JOI A;  1Q81 C;  3K81 C;  1AE2 A;  5IYB H;  4HJ9 A;  3HOZ G;  1M1K C;  4DR5 L;  3PF5 A;  3RN5 A;  1S72 A;  4TQU S;  2JEB I;  4DV6 Q;  1PHJ A;  1VS0 A;  4P72 A;  4X64 Q;  1VQC A;  1N9W A;  4AQY Q;  5C4X H;  3PO3 G;  3TRZ A;  5BR8 L;  3M85 A;  3E9I A;  3MXN B;  4DUY L;  5IWA Q;  4A3C H;  1I50 H;  1GKH A;  3J81 i;  1K0R A;  3JAM i;  1JJG A;  2R92 G;  4OXP A;  5GRO A;  1L0W A;  1PH9 A;  1QUQ B;  4ME3 A;  1XPO A;  4JOI C;  3AQQ A;  2IX1 A;  4OWT B;  4IPC A;  2WP8 J;  2VNU D;  3J7Z C;  2EIF A;  5AJ3 Q;  1ASZ A;  1Y1V G;  1HJP A;  1X55 A;  1EYG A;  3UDI A;  4L5S A;  4PG3 A;  1WI5 A;  3RR5 A;  3K80 C;  1A0I A;  3GTJ H;  4LF9 L;  2NVQ H;  3F1Z A;  4A3J H;  3CCM A;  1N33 L;  4BXX G;  4LWC A;  4DR1 Q;  1XJV A;  4UY8 C;  1WOC A;  3KDF B;  4P74 A;  4KHP L;  1VQ5 A;  2B3G A;  3HOY G;  5C44 G;  5C0X J;  4A3G G;  3HKZ E;  1AE3 A;  5C3E H;  1PH3 A;  5LMN L;  2UXB Q;  5GQO A;  4NB3 A;  2ATW A;  3CME A;  2KCM A;  1K73 C;  3HOU H;  2CQO A;  2OTL A;  5LMU Q;  2UUB Q;  2HQL A;  3ER0 A;  2PMZ E;  5M3M G;  2RF4 A;  4O2D A;  3CW2 C;  3J81 j;  3J80 i;  2NZO A;  3CPW A;  4IOA A;  4LF7 L;  4A3K G;  4QJF A;  1XMQ L;  1YEZ A;  1RIP A;  3A5Z B;  4LNQ A;  4BY1 H;  1TWF H;  3T1Y L;  1HNW Q;  1BKB A;  4JI8 Q;  3ULL A;  4DK6 C;  1BBU A;  1YBY A;  2ZJP A;  5IYC G;  1KC8 C;  1UEB A;  4TVA B;  1B7Y B;  4DV3 Q;  2Z6K A;  1NY4 A;  2A19 A;  4JYA L;  4BY7 H;  3W5O A;  3PCO B;  1X6O A;  3S24 A;  1VQB A;  2IHF A;  3NEL A;  4KI0 A;  5FJ8 G;  4YHH L;  1MIU A;  2Y0S E;  3CCE A;  4A3E H;  4JI2 L;  2R7Z G;  3GTP H;  1WCM G;  2HHH L;  4DR6 Q;  4DR7 Q;  5JJL A;  5M3F G;  1JT8 A;  1NMG A;  2HIX A;  3PIP A;  1KAW A;  1LUZ A;  4FDB A;  1J6Q A;  4RG1 A;  1YJ9 A;  1OXU A;  4QL5 A;  3OW2 A;  3FHW A;  4DPG A;  5IY0 A;  5FLM H;  4OO1 G;  4LUO A;  2K5H A;  3G6E A;  2VQF L;  2CWA A;  3CC7 A;  4GLX A;  4DV2 Q;  3F2C A;  2ZTE A;  3PUY A;  2KHJ A;  2WAQ E;  1EIF A;  2KHI A;  3STB C;  1Y14 B;  3OTO Q;  4NPS A;  3KJP A;  2ZM6 L;  1X54 A;  1PH6 A;  1VQL A;  4B3M Q;  4NXM L;  3E9H A;  3SGI A;  5C0X G;  1VQA A;  1VQE A;  4AH6 A;  4OWW B;  1OTC A;  2FXQ A;  1PH7 A;  2K75 A;  4LFB L;  3IRB A;  3G48 A;  3KF6 A;  1CKO A;  4JI1 Q;  4X66 Q;  2IY5 B;  4J15 A;  1XMO L;  2V1C C;  1Y1W H;  4DV4 L;  1A8V A;  1XPR A;  2E2J H;  2VUM H;  4X62 Q;  4X6A H;  1Q86 C;  2OCE A;  4LUZ A;  4YY3 L;  4BBS H;  4WJ3 M;  3EBE A;  3A0J A;  4BBR G;  2N49 A;  4JBM A;  4JI0 L;  4GKJ L;  2B29 A;  4P71 A;  4C3I H;  5JEA J;  4DV0 Q;  1C7Y A;  3NBH B;  4DV1 Q;  2RHQ B;  4GN3 B;  5GAD C;  5ELN A;  1QVG A;  1YIJ A;  3H15 A;  1V1Q A;  1N32 Q;  3PUZ A;  1Q46 A;  1I94 Q;  3PV0 A;  3AFP A;  5IT9 c;  2K5N A;  3BU2 A;  2YYZ A;  3NEN A;  3PUV A;  4B3T L;  3TS2 A;  3EN2 A;  3CCS A;  2XGT A;  1HZ9 A;  4KLK A;  3RZD H;  4A3F H;  1HR0 L;  1B70 B;  5ELO A;  4X65 L;  1MJC A;  3EIV A;  3UDX A;  5BR8 Q;  3I55 A;  3A74 A;  2EQS A;  4DUY Q;  3I2Z A;  3S15 H;  4A3B G;  3FKI G;  1CKM A;  1HNX L;  4JC0 A;  3UE0 A;  2BH8 A;  1PA6 A;  4B3S L;  4BA2 I;  2UU9 L;  1X3G A;  4OWX B;  1N36 L;  3GTK H;  4LF4 L;  2E2I H;  1PH4 A;  4GNX A;  2JA6 H;  2WFW A;  3CCV A;  3GTG H;  1I6H H;  1I3Q H;  1T9H A;  1U0L A;  3GTO H;  4LF9 Q;  2BA0 A;  4Y52 H;  2UUC L;  4EX5 A;  2ZJQ A;  3I4N H;  4YWK A;  4ALP A;  4KHP Q;  3S2D H;  4DUZ L;  2I5M X;  1X3F A;  1J5E L;  3E0E A;  4HIK A;  1IL2 A;  5GAG C;  5M5X H;  1OXX K;  4A3I G;  1KIX A;  2CWP A;  1ASY A;  4JI7 L;  1XNQ L;  3HOX G;  5LMN Q;  4L5Q A;  5JEA G;  5M5W H;  3CCJ A;  4GNX C;  2OQK A;  1IXR A;  3H0G G;  3KF6 B;  3WWV A;  1A62 A;  1OXV A;  1YI2 A;  2R93 G;  5JJI A;  4QQB X;  3U58 A;  2OTJ A;  3F2B A;  4LF7 Q;  1XMQ Q;  4LF8 Q;  3G71 A;  1PYS B;  1TWA H;  4BA1 I;  3D0F A;  2RHS B;  4HJ7 A;  3T1Y Q;  2K5V A;  2Q2T A;  2PNH A;  4OO1 I;  4A76 A;  1PVO A;  4DK3 C;  3HOV H;  3M4O H;  2MQH A;  3CCQ A;  1PV4 A;  3S1M H;  1GO3 E;  3HOZ H;  3CQZ H;  1TWC H;  4A3J G;  1FL0 A;  3MEF A;  2AHO B;  1RL2 A;  1HH2 P;  4LFC L;  1V9P A;  1VQG A;  1BVS A;  3PO3 H;  1IYJ B;  2N8N A;  4LF5 L;  4JI2 Q;  2N78 A;  1PH2 A;  2HHH Q;  3PSI A;  1M90 C;  2JA9 A;  1HZB A;  2F4V L;  1VQN A;  2UXC L;  4MNO A;  1UWV A;  4GKK L;  2JQO A;  2ZJR A;  3KF8 B;  4IJH A;  3HFZ B;  3S1Q H;  1Y1V H;  2Z0S A;  3U50 C;  2KBN A;  3TS0 A;  4BXX H;  1SN8 A;  4GKJ Q;  2GN5 A;  2ZM6 Q;  4NXM Q;  1YIT A;  1X3E A;  4OX9 L;  2YU9 H;  3F8T A;  3HOY H;  5HY6 A;  4BY7 G;  3S1R H;  4GNX B;  5IP7 G;  3GTL H;  4IFD G;  4A3G H;  1HNW L;  4AQY L;  3A5U A;  2GVA A;  4JI6 L;  4LFB Q;  3ULP A;  3T1H L;  1S40 A;  1NE3 A;  1Q1E A;  1XMO Q;  4UP8 A;  1Q12 A;  3HKZ G;  1K8A C;  4DV4 Q;  1FJG L;  3K7U C;  2JA5 G;  4POG A;  1O7I A;  5M3M H;  1VQ6 A;  2MO0 A;  4C3H H;  1EOV A;  4YY3 Q;  1Q8K A;  2EXD A;  1A63 A;  1E1T A;  4JI4 L;  4JI0 Q;  2OQ0 A;  1NBW A;  2DGY A; 
#chains in the Genus database with same CATH topology
 3GTQ B;  2IHE A;  2B63 H;  1TWF B;  1Z47 A;  2KQ3 A;  4MN3 A;  2G5D A;  1KDB A;  1IBL L;  4KY7 A;  3BJU A;  2Z6B A;  4ILW A;  1VQF A;  1WFQ A;  2FJ2 A;  1VQI A;  3DLL A;  4O0A A;  5C4Z A;  1LT4 D;  2LKV A;  2A1A A;  4BY7 B;  2R7Z H;  2JA7 B;  3HS0 C;  5KYI A;  3M7N A;  3BYT B;  4A3D G;  3SHL A;  2Y0S G;  5HGQ A;  3LWE A;  4IUU A;  3CC4 A;  2QGQ A;  1C4Q A;  1R4Q B;  2VUM G;  4EVO A;  2PYK A;  1I4X A;  1HQM C;  5CV5 A;  4HIO A;  3QOJ A;  4JI3 L;  1HNX Q;  3ULJ A;  1PH8 A;  2UU9 Q;  1FVI A;  3OW7 A;  1KRT A;  2LXJ A;  2E2J B;  3L0O A;  4PZ8 A;  4DKA C;  3P20 A;  3K5O A;  1D1I A;  1X65 A;  4UP7 A;  5EAY A;  4K8I A;  1EY6 A;  3QWN A;  4ME5 A;  2EDG A;  4A3M G;  4LMQ D;  1EQR A;  3W1G A;  2IT1 A;  3MWY W;  5EKK A;  3BG3 A;  1SLJ A;  2K52 A;  4DAM A;  1CI3 M;  4FVM A;  4FF3 A;  1RTO A;  5IYD G;  1FR3 A;  5CC4 A;  4TRD A;  1ENF A;  2CFM A;  2JA6 G;  3ONA B;  5ISR A;  1VQD A;  4PMW A;  4LF6 L;  4GN4 B;  2XTI A;  3ND9 A;  4JI1 L;  4MTK A;  4DR2 L;  2HIV A;  3C1F A;  1VQ8 A;  4IFD I;  1MGS A;  4LF5 Q;  2G9H D;  4MHE A;  4KY6 A;  1HZC A;  2I0Q A;  1P16 A;  5C4X G;  3F2D A;  4DGZ A;  2ID0 A;  2F4V Q;  1F9Q A;  5IGF A;  1PTO D;  1PH1 A;  2E75 C;  1K0S A;  3ND8 A;  3PUX A;  5DLQ E;  2VQE L;  2RVL A;  4UP9 A;  1KTK A;  4H02 A;  3S9W A;  3S2H H;  1N32 L;  4OON A;  1SSO A;  1ROD A;  2D9U A;  3I56 A;  4G4K A;  1SYG A;  1GOZ A;  2D0P A;  3H3V H;  1HNW Q;  4YHH Q;  3S17 H;  2F0K A;  2A74 C;  2DNC A;  1VDZ A;  3VDY A;  3CC2 A;  3H0G H;  1E24 A;  1B3Q A;  5M5W B;  1JWS D;  5D14 A;  1EU4 A;  2R93 H;  2H5X A;  1JE5 A;  3F2U A;  1BNZ A;  1HCZ A;  3G4S A;  1XNR L;  3PIO A;  4LJZ C;  3PF4 A;  3L9A X;  2VQF Q;  4IPH A;  1SDF A;  4QCL A;  2F0F A;  3TZU A;  5NUC A;  3TEH B;  3U4Z A;  3HOZ B;  4DXG A;  1IKL A;  1QVC A;  2XIW A;  1K9M C;  1KXL A;  1XX8 A;  3N52 A;  1PFS A;  5C44 H;  1IBK Q;  1ONL A;  4J8Q A;  4A3E G;  1TWH H;  2E8G A;  4NXN Q;  1SRO A;  5C3E B;  2Z1C A;  4K14 A;  1EEF D;  2FHT A;  2K1B A;  1DZ1 A;  4ZKC B;  2A6H D;  1Q3L A;  3S1Q B;  2A69 D;  5FLM G;  1I6V C;  1E1O A;  1HZA A;  4L5T A;  2NTS A;  3VR5 A;  1J9O A;  1WYD A;  1EFI D;  2QA4 A;  1PFB A;  1U4R A;  3M9B A;  5CV4 A;  1JIC A;  4LUV A;  4DR3 Q;  2CW0 C;  4QY7 A;  3LWU A;  3S1R B;  1TT2 A;  4A3G B;  5I6W A;  5JJK A;  3RLO A;  5M3F H;  5DAU A;  2F0S A;  1EY5 A;  4RGT A;  2UXB L;  2L12 A;  2PQE A;  3OMC A;  1SAP A;  5M3M B;  4HJ5 A;  2CH4 A;  4C3H B;  3RN2 A;  2UUB L;  4HN7 A;  3KFU A;  4WJ4 A;  4JI8 L;  2X6G A;  1N34 Q;  3PO2 B;  4S3S A;  2E2H H;  3JAM c;  5KEE A;  3D31 A;  2F3I A;  1L2F A;  1K83 H;  1TVX A;  2I5L X;  2AUK A;  4DAP A;  3QOL A;  4A3D H;  2AWN A;  4DAY B;  3P1H A;  1Q82 C;  3SK5 A;  2K5Q A;  1RD9 D;  4EGV A;  5FLX L;  4PV1 C;  1RDP D;  2QEX A;  2HD3 A;  3CRL C;  2L9H A;  1VQK A;  3BDO A;  2PO4 A;  5EGT A;  2DY7 A;  1X56 A;  4KHZ A;  1V1P A;  2A6E D;  2D2C C;  1HFG A;  4DV2 L;  5CV8 A;  2Q2U A;  1K8M A;  1STG A;  3KYH C;  1STN A;  3SK6 A;  4CKC A;  4A75 A;  1PTO B;  2LMC B;  3ITP A;  2C5C A;  1HXY D;  2JJQ A;  1SNC A;  4A3M H;  4JV5 Q;  2RDG A;  1MSG A;  1IHZ A;  4HTH A;  4LK1 C;  5EPL A;  1EFW A;  4K8J A;  2AWO A;  5J3B A;  3S14 B;  3FKI H;  1P8L A;  2B2W A;  1IBM Q;  2MO1 A;  5IYD H;  2SDF A;  1NCV A;  4DV1 L;  4LFA L;  3L2P A;  3IAY A;  1FGU A;  1HHV A;  4K0K Q;  5H1S E;  2LY7 A;  5JVH 3;  3GD7 A;  2F0P A;  2M2L A;  3GTO B;  3EQL C;  1WTO A;  3D4R A;  4G57 A;  4HJ9 A;  1S72 A;  4NW2 A;  5CGK A;  4DV6 Q;  5ELF A;  2Q8I B;  2BOS A;  4QIW B;  3C2P A;  1N9W A;  5C4X H;  3MXN B;  5M5X B;  5E1F A;  1JJG A;  3JAM i;  2VB3 X;  5J1Z A;  4EQP A;  1F2Y A;  1L0W A;  1PH9 A;  4JOI C;  4ZAI A;  2F0H A;  3R93 A;  3TP8 A;  2IX1 A;  2WP8 J;  3QJY A;  3JAM E;  1ASZ A;  2WB1 B;  1HJP A;  1LTA D;  1IW7 C;  1I4G A;  1EYG A;  2QCP X;  4PG3 A;  3HOV B;  3OIP A;  3K80 C;  2NVQ H;  4N8X 1;  4A3J H;  4BXX G;  1S4Z A;  3K5M A;  4QB4 A;  4FNF A;  4P74 A;  4ZKB B;  4KHP L;  3PO3 B;  1NAP A;  3V05 A;  1AE3 A;  5LMN L;  2R92 B;  1BR9 A;  3IL8 A;  2OTL A;  2B2T C;  2HQL A;  4O2D A;  4QUF A;  4A3K G;  1YEZ A;  3A5Z B;  1SXT A;  4RGO S;  2RSO A;  3ULL A;  4DK6 C;  1BBU A;  1H9J A;  4F88 A;  5IYC G;  4RKB A;  1STA A;  3J81 L;  1B7Y B;  1EY4 A;  5G3L F;  1NY4 A;  2O5J C;  1SE4 A;  5DEH A;  3PCO B;  1X6O A;  4Y7N B;  1VQB A;  3R2I A;  5FJ8 G;  4HMJ A;  4A3E H;  1MIU A;  1SFO B;  3GTP H;  4C2M B;  1KAA A;  2HHH L;  2AQ3 B;  4DR7 Q;  1NMG A;  3I72 A;  2PW5 A;  1KAW A;  1D5M C;  1QOH A;  5FO9 B;  1PRT F;  4DPG A;  5FLM H;  4OO1 G;  3G6E A;  2KOL A;  2ZM6 L;  2KHI A;  3STB C;  1VQL A;  3SGI A;  4AH6 A;  4N8F A;  3IRB A;  1LTB D;  3G48 A;  5T1I A;  1GUG A;  1XMO L;  4DV4 L;  1CQF A;  5FKA C;  3FMC A;  3M3Y B;  1JCK B;  2EY6 A;  1F9P A;  4K6D A;  4DV0 Q;  4V0B A;  5C3W A;  5F2D A;  2RHQ B;  4GN3 B;  1H9R A;  1R9T B;  3VYU A;  1V1Q A;  3PUZ A;  1A3T A;  3AFP A;  5IT9 c;  2YYZ A;  3CKI B;  2DNE A;  4B3T L;  3WOE A;  4HR7 B;  2XGT A;  1HZ9 A;  3KF8 A;  1ICF B;  3DM1 A;  1HR0 L;  3A74 A;  3S15 H;  3T4A C;  4BBR B;  4DNT B;  3C46 A;  2XN9 C;  4B3S L;  3DHQ A;  1PXU A;  3RMH A;  4OWX B;  3HZX A;  1GUN A;  5JJZ A;  3GTK H;  3A8J E;  3GTG H;  3WDN A;  4U67 3;  4LF9 Q;  2BA0 A;  1II3 A;  4EX5 A;  2ZJQ A;  2QEJ C;  4ALP A;  3Q6S A;  2I5M X;  1X3F A;  4IFD J;  2D5D A;  4A3B B;  3HOX G;  4L5Q A;  3X3M A;  4GNX C;  2F03 A;  1BO0 A;  1IXR A;  2A68 C;  2OQK A;  5COY A;  3WWV A;  2OTJ A;  1TWA H;  3D0F A;  3T53 B;  4OEM B;  3M4O H;  2NVY B;  3D4D A;  1QJO A;  1TWC H;  3MVV A;  2MUY A;  3E3X A;  3MXP A;  1VQG A;  2G9D A;  4OGQ C;  3A56 A;  2JA9 A;  4EQO A;  1I50 B;  3DEP A;  4U68 A;  1VQN A;  2UXC L;  3A8K E;  2JQO A;  2OXP A;  2PZU A;  2Z0S A;  1SNO A;  3U50 C;  4CDC C;  1HA6 A;  2IX3 A;  2KBN A;  3TME A;  4BXX H;  1SN8 A;  3J7A V;  2EJM A;  1UAP A;  3NWT A;  5IT9 E;  4NXM Q;  2YU9 H;  4BY7 G;  3GTL H;  4IFD G;  5IP7 G;  4WRD A;  4KJN A;  4AQY L;  1Z6H A;  2GVA A;  2NUC A;  1AN8 A;  1HPC A;  1UUP A;  4JI6 L;  1S40 A;  1NE3 A;  3BVM A;  4FP5 D;  1Q1E A;  1K8A C;  3HOU B;  2MO0 A;  4YY3 Q;  1Q8K A;  1E1T A;  5C6A A;  5IYC H;  3C1E A;  3S1N H;  5IP9 H;  4EQ5 A;  3M4Q A;  3A7L A;  4I7Z C;  4DK0 A;  3UI2 A;  4YCV A;  5FJ8 H;  2SNM A;  2WII B;  5GAE C;  4XTC S;  1H95 A;  2LSS A;  1E22 A;  3AEV A;  5FOB B;  3WOF A;  4DV7 Q;  4OO1 H;  1D5X C;  3MAQ A;  4RKL A;  3RLN A;  4MTN A;  4JG2 A;  3BDC A;  5CBA E;  5BN3 A;  5IE8 A;  2KEN A;  5G3L D;  1N36 Q;  4HJ8 A;  3SR1 A;  1Q7Y C;  4A3L G;  2EYJ A;  1ILQ A;  3NP8 A;  2BDO A;  1PDQ A;  1YJN A;  4JBK A;  4RHR A;  3KOJ A;  2EZV A;  1BQQ T;  3X3N A;  4QIW E;  4R8N A;  1TXY A;  5LL6 S;  2IX0 A;  3FDT A;  2B2U A;  1S5C D;  3I4M G;  2JK8 A;  1DYQ A;  1PRT D;  4HCS A;  4JI7 Q;  2NVX B;  4BBS B;  3VYR A;  2FMC A;  2XNA C;  4FF2 A;  1XNQ Q;  4POF A;  2K5W A;  3QB3 A;  4X3U A;  2CHB D;  1PMR A;  1JB7 A;  3FP9 A;  3MHB A;  4P73 A;  3J7Y W;  5ELC A;  2WAQ B;  4RCO A;  1MHW C;  3HOW B;  1N33 Q;  2L4N A;  4JCV E;  1FYC A;  1JJ2 A;  4JI5 L;  3PIP 3;  3RZD B;  4A3F B;  4P2C B;  4A3C G;  3EVQ A;  4AYB B;  4GKK Q;  5GAH C;  1XYI A;  2DJG C;  2VZA A;  3TRE A;  1MJE A;  2ZXP A;  1AW7 A;  2Z8L A;  1AZQ A;  2QKI C;  5EKI A;  3CPF A;  5DNF A;  5D65 A;  4F87 A;  3FVQ A;  3STB D;  5I9P A;  2B2Y A;  3OPO A;  3HOX H;  4PZ7 A;  3T1H Q;  1HNZ L;  5C3E G;  5E4W C;  2YTX A;  3DXJ C;  3M4P A;  4JI4 Q;  2DN8 A;  3UE1 A;  3GTM H;  4BY1 G;  5C4H A;  4JBW A;  3T56 B;  4DAY A;  1IBL Q;  5CBE E;  2F0O A;  5D3D A;  1BDO A;  3GTJ B;  3CQZ B;  2KCT A;  3SK8 A;  1I4H A;  3KLW A;  1ESR A;  3QO2 A;  1NJI C;  1B44 D;  1DJR D;  1JJC B;  4KK7 A;  2Q2I A;  3GTQ H;  4JI3 Q;  5LMN W;  3NTK A;  3PO2 G;  1LLR D;  4FXK C;  4EQN A;  4GN5 A;  2VL6 A;  4Z9C B;  2K33 A;  4DR1 L;  4IFD H;  5IP7 H;  2EJF C;  1SYF A;  2F0G A;  3ERS X;  1ML0 D;  1VQJ A;  1ESF A;  3MFY A;  4JVZ A;  2GA4 B;  4TSS A;  1C9O A;  1ZEQ X;  1XWE A;  4L8J A;  2IPK D;  4CJ1 B;  1X3P A;  3HKS A;  3K0X A;  4X65 Q;  2N55 A;  4G7H C;  2EYL A;  3LGJ A;  4C1N K;  1EY0 A;  1O7Z A;  1ZYR D;  2B63 B;  2JE6 I;  1KLG D;  3K7A H;  1PRT B;  1K28 A;  2L55 A;  1EIG A;  3G7L A;  1H9K A;  3FPP A;  4LF4 Q;  1X9N A;  3IFD A;  3Q23 A;  3RZO H;  4ODG A;  1E7Z A;  1EY8 A;  4LF6 Q;  1W6K A;  1XPU A;  2KUM A;  1EOT A;  3MXN A;  4JK1 C;  2R7Z B;  2F0Q A;  5BN5 A;  5M5Y H;  1HFN A;  4DR2 Q;  4DR6 L;  3CCL A;  1OXT A;  1G2T A;  1QIL A;  1BCP C;  2ALY B;  1L0Y B;  1QCB D;  5KNB A;  1Y1W B;  1Q1B A;  3CP0 A;  1GJX A;  3GV3 A;  2F0D A;  4QF4 A;  1SR3 A;  4E6I A;  4C3I B;  1B2T A;  4R4O A;  2VQE Q;  4GOP B;  1GUO A;  4A3L H;  3CRK C;  2F0T A;  3OTO L;  2X6L A;  2RDH A;  3J80 c;  1L1O B;  4N9P A;  2ZXO A;  1V43 A;  5CYU A;  5EJW A;  1TU2 B;  1E3P A;  3CU7 A;  1YHB A;  4RA8 A;  2A5H A;  4X66 L;  3I4M H;  2HQE A;  1CUK A;  4F8M A;  2D62 A;  3BS1 A;  4X62 L;  3Q8D A;  2ES2 A;  2AQ1 B;  2C35 B;  1MBY A;  2RSN A;  3GP7 A;  3U4V A;  2F0U A;  1HR0 W;  3W2D A;  1XNR Q;  1KDA A;  5K36 G;  4CKE A;  2WB1 G;  2YV5 A;  1NMF A;  4RAU C;  1I94 L;  1UE6 A;  3HOV G;  5CR3 A;  2B2W C;  1C8C A;  3PF5 A;  3RN5 A;  4TQU S;  3A54 A;  1VS0 A;  1VQC A;  3PO3 G;  3TRZ A;  2RQX A;  3E9I A;  4DUY L;  4A3C H;  1ET9 A;  1NR2 A;  4NMZ A;  2QF7 A;  4XT3 B;  5FO7 B;  2R92 G;  3A7A B;  5GRO A;  4ME3 A;  4IPC A;  2VNU D;  1Y1V G;  3S2H B;  2F0L A;  1WI5 A;  1A0I A;  1YNN C;  3S1M B;  3CCM A;  4LWC A;  2K7V A;  4RHS A;  1CFM A;  1WOC A;  1VQ5 A;  1GHJ A;  1DON A;  4IUP A;  5C0X J;  3S17 B;  3V2T A;  1S5E D;  2PW7 A;  4RFB A;  5C3E H;  1PH3 A;  3KLS X;  3H0G B;  5GQO A;  2UXB Q;  3CME A;  2KCM A;  2CQO A;  5IGE A;  5I6Y A;  2UUB Q;  3ER0 A;  2PMZ E;  3CPW A;  3J80 i;  2NZO A;  4HAE A;  4IOA A;  4LF7 L;  4LNQ A;  4QJF A;  1XMQ L;  4BY1 H;  3T1Y L;  1EZ6 A;  1LAB A;  4N9T A;  4JI8 Q;  2AQ2 B;  3I73 A;  3MTS A;  1HQR D;  3URY A;  1YBY A;  2EYO A;  2ZJP A;  1KC8 C;  1STY A;  2X69 A;  3J80 E;  4TVA B;  1TY0 A;  4IUR A;  2A19 A;  1BOS A;  1G8Z D;  1V1O A;  4YHH L;  2IHF A;  3NEL A;  1SJH D;  5C44 B;  3CCE A;  4JI2 L;  2EPB A;  1WCM G;  1TWH B;  5DM7 3;  1UNS A;  3PIP A;  2IW3 A;  1ZXT A;  1J6Q A;  1YJ9 A;  1I4P A;  4QL5 A;  3OW2 A;  1O7Y A;  3I70 A;  1CT1 D;  2VQF L;  4KKS A;  2CWA A;  5HUR A;  3CC7 A;  4GLX A;  4DV2 Q;  1H9S B;  3K5L A;  2WAQ E;  3E9H A;  5C0X G;  2Z4I A;  1DOL A;  2K75 A;  4LFB L;  5M3F B;  2NB0 A;  3HKZ B;  5KNC A;  2LFN A;  1EQT A;  1WTX A;  2VUM H;  4XT1 B;  4X6A H;  1Q86 C;  2OCE A;  1E0B A;  4LUZ A;  3TZD A;  3EBE A;  4BBR G;  3MZ5 A;  4JI0 L;  4GKJ L;  4P71 A;  1LT5 D;  3NBH B;  4DV1 Q;  5GAD C;  2E2H B;  2QDL A;  1YIJ A;  1A3U A;  3H15 A;  3L3O C;  1ICW A;  1HTP A;  1K83 B;  4K2L A;  1D1K A;  4A3D B;  5LL6 X;  4CHT B;  2I07 B;  3D3R A;  3BVZ A;  1WVL A;  1EYD A;  5IOC A;  5JAV A;  4ZQ3 A;  5ELO A;  3S14 H;  3EIV A;  4IUT A;  1A6X A;  3I2Z A;  4A3B G;  2LS0 1;  3UE0 A;  5BN4 A;  4DK1 A;  2KEE A;  2E2I H;  2JA6 H;  1E2W A;  1U0L A;  3GTO H;  1YNJ C;  4FF1 A;  5EBD A;  2UUC L;  5L37 A;  4A3M B;  4KTA A;  4YWK A;  4KHP Q;  3S2D H;  4DUZ L;  1DM0 B;  4PMB A;  1AEX A;  3E0E A;  4HIK A;  1J5E L;  1IL2 A;  5GAG C;  5M5X H;  2NYZ D;  5LMN Q;  3FKI B;  5A2Q E;  4C3J G;  1NSN S;  2JSO A;  3KF6 B;  2B39 A;  1A62 A;  1OXV A;  3IFT A;  1XXG A;  1U9R A;  3H94 A;  4CDD C;  1FNW A;  4LF8 Q;  2RHS B;  1HA5 A;  4HJ7 A;  4A76 A;  3HOV H;  2H4O A;  1TQO A;  5JVG 3;  1Y8N B;  3MEF A;  1HH2 P;  1LV9 A;  4RH6 A;  4LFC L;  3PO3 H;  4DNR B;  5AFW A;  3BDL A;  4A3I B;  1AP0 A;  2HHH Q;  2KHS A;  3LNN A;  1A2T A;  5HGT A;  4H0L C;  3EA6 A;  3HFZ B;  5A35 A;  1Y1V H;  2BCO A;  2EYH A;  5J22 A;  1JOO A;  2GN5 A;  2ZM6 Q;  4A3J B;  1X3E A;  4OX9 L;  4K6L A;  3HRZ C;  3A5U A;  3ULP A;  1XMO Q;  4UP8 A;  1WD1 A;  4DV4 Q;  1FJG L;  3K7U C;  2ICI A;  4C56 C;  1DOK A;  4POG A;  3U9O A;  3OMG A;  1EOV A;  1A63 A;  2OQ0 A;  3AB9 A;  3QG1 A;  2CCZ A;  4IOC A;  1LT3 D;  1LTL A;  2F0N A;  1DCZ A;  2D0O A;  2R7F A;  4ZK9 B;  4C1N I;  1BBW A;  4OEL B;  4DF7 A;  1GUS A;  3O13 A;  2EYF A;  2BDN A;  2K03 A;  2MFI A;  4DNI A;  3OSO A;  4A3E B;  1WCM H;  1PZI D;  1EUJ A;  5KGU A;  4QMG A;  3OOC A;  4B3T Q;  1SE8 A;  4B3R Q;  4DAV A;  3M7G A;  2JA5 B;  3CHB D;  2F4I A;  1ENA A;  3CCR A;  2WAC A;  4BBS G;  2HT1 A;  1IL8 A;  2EOT A;  1G51 A;  2NZH A;  1SMY C;  4B3S Q;  3S16 H;  2F1M A;  5FK9 C;  3CCU A;  1KQS A;  1Y69 U;  1N8R C;  2XSC A;  1SNM A;  1WTP A;  4DR4 Q;  2WAQ G;  1RHP A;  5C4J B;  3HP3 A;  3HOW G;  4KV6 A;  2EYM A;  1S5B D;  2A73 B;  4X3K A;  1QB5 D;  1T5X D;  4DR5 Q;  2AMC B;  4DFA A;  1VQM A;  1QZH A;  1TWG H;  4A3F G;  4GZY C;  4YCU A;  3PUW A;  3RD4 A;  3SEB A;  2J0T D;  1CK1 A;  2JN4 A;  4GLV B;  1K8G A;  1JC7 A;  4UAI A;  3K57 A;  4LAA A;  4CJ0 B;  3HG9 A;  2YTY A;  3BZC A;  1D6E C;  2B2U C;  2JA8 G;  2DUD A;  1U4L A;  2UXD L;  2ZTD A;  2Z4H A;  4Q0F A;  3UDG A;  5FLX c;  4A3B H;  2F0V A;  2CW0 D;  3I7F A;  3S15 B;  2EYP A;  1YNX A;  5EPK A;  4YWM A;  5KND A;  2UXC Q;  2E5L L;  3TDQ A;  4UHV A;  1CZG A;  2PZT A;  4RWS C;  3KJO A;  3GTK B;  2Z9H A;  4O1N A;  3I91 A;  4R1J A;  4A93 B;  2UUA L;  1EWC A;  1YHA A;  1IZ6 A;  4PZ6 A;  1Z9F A;  3NXW A;  1D8L A;  2K14 A;  4JYA Q;  3BZK A;  1NTG A;  5C0X I;  3ICE A;  4IO9 A;  4JI6 Q;  2DY8 A;  4C3J H;  3H91 A;  1DOM A;  2ENB A;  4CDF C;  2F52 A;  3VYT A;  2F0E A;  2N88 A;  3V96 A;  1TWA B;  3MXU A;  4R4Q A;  1LTR D;  2B2Y C;  4DV5 L;  3M4O B;  1WTQ A;  5ELB A;  1SYD A;  1TWC B;  3CMA A;  2C9O A;  1VF7 A;  4J6H A;  1B3A A;  1MKH A;  1BBX C;  4X64 L;  2JA7 G;  2K04 A;  2MPM A;  5IWA L;  4XYQ A;  4GOP A;  1AZP A;  1S3O A;  1CA5 A;  4A3K H;  3GDE A;  3NEM A;  4L5R C;  1L1O A;  4HCE A;  1C0A A;  5AJ3 L;  2B63 G;  3AFQ A;  1FGB D;  3PGZ A;  2VY3 A;  2NBF A;  2YU9 B;  4UPA A;  4YIJ A;  1VQH A;  2KED A;  5FLX E;  1U5K A;  1VQP A;  3NPP A;  4PQX A;  1D2B A;  1PTO C;  1UE5 A;  3NTI A;  2Q8T A;  2K6A A;  2ASB A;  2MHV A;  1Y1W G;  5LMU L;  1M8A A;  4JBJ A;  4RGM A;  2Z6K C;  1VQO A;  1LT6 D;  3CF5 A;  3TP7 A;  2WKD A;  4DA2 A;  4C3I G;  2RA4 A;  1YZ6 A;  1F2Z A;  4NDX A;  3J81 c;  4HSP A;  2IWH A;  4XIG S;  1TS5 A;  1HTL D;  4DV3 L;  1STH A;  1VQ9 A;  4CDE C;  3UDF A;  3J80 L;  1SE3 A;  1GVP A;  1IW7 D;  4P75 A;  3KBG A;  3AYH B;  2CQA A;  1D7Q A;  3KLR A;  3TP5 A;  1BXT A;  1CKN B;  2FFK B;  4JI5 Q;  4ZCK A;  2NVX H;  1EZ8 A;  4GLA C;  4KD3 A;  2MP1 A;  2RBM A;  4R4I A;  4KY5 A;  4B9W A;  1I5F A;  2MJ8 A;  4HIM A;  2WB1 E;  2OF1 A;  2LXK A;  2WV6 D;  2I5H A;  5C5M A;  4B3M L;  3HOW H;  4R4C A;  2CKZ B;  2N3S A;  3CD6 A;  4XDX A;  3FEW X;  5E4X A;  1UE7 A;  2PQA B;  1EIY B;  3K58 A;  2A6H C;  2A69 C;  3D4W A;  2AUJ D;  4DV7 L;  4RMF A;  4BWG B;  1VQ4 A;  1HNZ Q;  2B2V A;  3VA5 A;  1PH5 A;  1VCI A;  2NVT H;  1K3R A;  2JA8 H;  1S5D D;  4YWL A;  1W3S A;  1VF5 C;  2NN6 I;  1I6H B;  1I3Q B;  2EE1 A;  4HJA A;  1ZKO A;  2EVB A;  3K81 C;  1AE2 A;  3HOZ G;  5EPJ A;  3I4N B;  1PZK D;  4IZ8 A;  5BR8 L;  2KCC A;  5CV7 A;  3J81 i;  1K0R A;  3K5N A;  1WTW A;  3GV6 A;  1H9S A;  3TN2 A;  1QUQ B;  1XPO A;  3AQQ A;  4OWT B;  4H44 C;  1AFP A;  3J81 E;  2EIF A;  3Q0A A;  1FNV A;  1X55 A;  3UDI A;  3RR5 A;  3GTJ H;  1N33 L;  2FIN B;  4DR1 Q;  3D6W A;  4UY8 C;  1X3Q A;  3KDF B;  1NR4 A;  1TY2 A;  2B3G A;  5C44 G;  4ZRZ A;  4A3G G;  3HOX B;  2A6E C;  2K28 A;  2J7Z A;  1QNK A;  2HDL A;  2KCN A;  1L0X B;  5EBC A;  3J81 j;  5M3M G;  3CW2 C;  3KK7 A;  4C3H G;  2H1E A;  1WTV A;  1RIP A;  1IKM A;  2K32 A;  1TWF H;  4R9W A;  3GTM B;  1T5E A;  3HGB A;  5KRU A;  1WD0 A;  3EFX D;  2BE5 C;  1UEB A;  3JAM L;  1S5F D;  1RKN A;  3SK4 A;  3NBI A;  1EQV A;  2Q8R E;  2Z6K A;  1CHP D;  4BY7 H;  3W5O A;  5IOD A;  2MGS A;  3HEJ A;  2JA7 H;  3HOY B;  1V8Q A;  4DR6 Q;  5JJL A;  1JR0 D;  5M3F G;  2I46 A;  2PPB C;  2HIX A;  4KD4 A;  5M9O A;  3T16 A;  2XWJ B;  1B1Z A;  3TP6 A;  2SEB D;  1OXU A;  3C3L A;  4OL7 A;  3PQI A;  3MEH A;  3OWE B;  1SBB B;  1TS4 A;  2A68 D;  5C3X A;  3DMU A;  2ZTE A;  2KHJ A;  1A3V A;  1EIF A;  2E2J H;  3OTO Q;  1R4P B;  1SYB A;  2RDF A;  1G91 A;  2PZW A;  1A15 A;  2XRQ D;  5I4D A;  1VQA A;  4OWW B;  5JPN C;  1PFN A;  1PH7 A;  1FD7 D;  3KF6 A;  4JI1 Q;  1SYC A;  4IUQ A;  4NKL A;  3NQT A;  1PZJ D;  3DWQ A;  4M8A A;  4ZUJ A;  4X66 Q;  2V1C C;  1Y1W H;  1XPR A;  1A8V A;  2E74 C;  4X62 Q;  2HUG A;  4WJ3 M;  1MI2 A;  4C3I H;  5JEA J;  3K7A B;  2JXM B;  5ELN A;  2CVR A;  1N32 Q;  2E76 C;  1Q46 A;  3RZO B;  1I94 Q;  1QWY A;  3D6C A;  3PV0 A;  2K5N A;  5M5Y B;  3BYY B;  1JWU D;  3TS2 A;  3EN2 A;  4KLK A;  4FYD A;  2B8G A;  2XWB B;  4KN4 C;  5I9O A;  4X65 L;  1MJC A;  4DUY Q;  4X3T A;  3FKI G;  1HNX L;  3NWS A;  3A8I E;  2BH8 A;  1PA6 A;  5C5L A;  1EYC A;  4PNY A;  2UU9 L;  1LTT D;  1U4M A;  1X3G A;  2SOB A;  4LF4 L;  1CQV A;  2O2L D;  1PH4 A;  1BCP F;  3E0J A;  1I4R A;  3CCV A;  4NP5 A;  1ENC A;  5CV9 A;  3VR3 A;  2F0I A;  4IQZ A;  2HDM A;  3I4M B;  2CH4 W;  1SEB D;  2ICE C;  1K8O A;  1STE A;  4I7A A;  4A3I G;  1KIX A;  1ASY A;  5I2Y A;  5JEA G;  1SJE D;  5M5W H;  1TS3 A;  3K6O A;  2EJG C;  4K5X A;  3J7A F;  1YI2 A;  2O4X A;  4WOR A;  4QQB X;  3F2B A;  4LF7 Q;  3R8B A;  2EY2 A;  1XMQ Q;  2EXZ A;  3T1Y Q;  2K5V A;  2PNH A;  2ZT9 C;  2MQH A;  1I4Q A;  1GO3 E;  1M4V A;  3S1M H;  3HOZ H;  1WTH A;  3U9S A;  4A3J G;  1FL0 A;  2AHO B;  1RL2 A;  1CTM A;  1V9P A;  1IYJ B;  2N8N A;  4LF5 L;  4JI2 Q;  2N78 A;  5E3F A;  1EL0 A;  1VMC A;  1M90 C;  1HZB A;  2OT2 A;  2F4V L;  3NUC A;  4MNO A;  2R93 B;  1UWV A;  1Y8O B;  2ZJR A;  2VXW A;  3S1Q H;  1NUC A;  3DWP A;  4ABN A;  3MC0 B;  3E6Z X;  1SNQ A;  4XXE A;  2IY5 B;  1JOR A;  1YIT A;  3F8T A;  3M4Y A;  5HY6 A;  3S1R H;  4GNX B;  4A3G H;  1HNW L;  1B4O A;  4HMI A;  4LFB Q;  2QW7 A;  1JE4 A;  1Q12 A;  2JA5 G;  5M3M H;  5LHY 1;  1EEI D;  4UDU C;  4C3H H;  1BUV T;  4JI0 Q;  4GKJ Q;  1NBW A;  2DGY A;  1KD1 C;  2L0C A;  4J1M A;  4AIM A;  4XQJ A;  4BY1 B;  3PO2 H;  2F3V A;  3K8A A;  3A55 A;  4IPG A;  5EQ0 A;  1GM5 A;  2BA1 A;  4FXD A;  1IBK L;  1YJW A;  3Q22 A;  4QUC A;  1F9S A;  1B8A A;  3VR4 A;  3NQI A;  5IT9 L;  4NXN L;  4KKT A;  3H3V I;  3B6Y A;  2RCN A;  1C48 A;  1IYU A;  4AYB E;  4K2K A;  2K05 A;  3VR2 A;  2IJ0 A;  3OWF A;  2K4K A;  3MFG A;  4LW1 A;  1EY7 A;  4LFA Q;  1MSH A;  5D3I B;  3DEO A;  4H7B A;  4RGN A;  1YVC A;  1PTO H;  1QG7 A;  5DM6 3;  4MIU A;  4DR3 L;  4ZUI A;  4K5V A;  2UUC Q;  4ID6 A;  1AH9 A;  3KBX A;  2YTV A;  1KRS A;  2Y0S B;  3EJI A;  4DUZ Q;  3I3C A;  2BH2 A;  2XVS A;  1J5E Q;  2VUM B;  3PMF A;  1KL9 A;  3BZD B;  1CSQ A;  1G6P A;  1TKW B;  1N34 L;  1GUT A;  4TKO B;  3H09 A;  1EU3 A;  1EWH A;  4IUN A;  1CSP A;  2K01 A;  4H13 C;  4L63 B;  3GQB A;  4FO2 A;  4HID A;  4A93 G;  1RF2 D;  2K50 A;  2KJX A;  2L15 A;  1SRU A;  5ELE A;  2IL8 A;  5EKL A;  5IYB G;  2BE5 D;  4LFC Q;  4GS3 A;  2R61 A;  3VYS A;  3N6R A;  4KMU C;  1VMP A;  2KEC A;  1JOQ A;  5K36 H;  2PI2 E;  1GD7 A;  3L7Z C;  1KAB A;  2HCI A;  1XTD A;  4QGU A;  4R4T A;  2E2I B;  2JA6 B;  5I2X A;  3D8G A;  4KJO A;  3SXH A;  4JV5 L;  4OX9 Q;  4IJL A;  4YCW A;  1B9M A;  1D5Z C;  3JC6 6;  3S2D B;  4A3I H;  1F2L A;  2L5T A;  1CHQ D;  3SVM A;  1QZG A;  5JEA H;  1QVF A;  2MNA A;  5C4X B;  3FPU B;  5E7N A;  2R92 H;  1FJG Q;  1IBM L;  3HOU G;  1BCP D;  3W1B A;  1OXS C;  3SE0 A;  1X32 A;  4MZ9 A;  1DGS A;  2A8V A;  1EQQ A;  3I4L A;  2M9V A;  4K0K L;  1W6J A;  1PLF A;  2OEO A;  4IPD A;  1CKN A;  2NVQ B;  2JYO A;  1YHQ A;  1PRT C;  1RTN A;  4Y7N H;  4DV6 L;  1SFO H;  2ZTC A;  4PMC A;  3VR6 A;  4C2M H;  2R7D A;  2B8F A;  3KUP A;  3TSS A;  1DXM A;  3P75 A;  4M1U B;  1EWI A;  4APV A;  3ZJY C;  3NSW A;  4LF8 L;  1Y1V B;  2EY5 A;  4HED A;  3CXC A;  1GXD C;  1LTG D;  2NN6 G;  2NZ1 D;  1QE6 A;  1J8I A;  5IGD A;  1W2B A;  5IP9 G;  1G29 1;  3BVG A;  3H6M A;  1LM0 A;  2PQA A;  4GOP C;  1BF4 A;  2K5D A;  2Q2H A;  5T1G A;  3OYY A;  3G6J B;  1TS2 A;  1H9M A;  3GTP B;  1L1O C;  5TSS A;  2JA5 H;  2HCC A;  3I4O A;  1HR0 Q;  2VS1 A;  3QR8 A;  3M3Y H;  2M00 A;  4HSV A;  4KKU A;  1E2V A;  3OHX C;  3J7A 5;  2NWG A;  4KN7 C;  1F77 A;  1STB A;  3TQY A;  1R9T H;  3RLF A;  5C0X H;  2SNS A;  2TSS A;  5C4J H;  3RNU A;  2UXD Q;  1F9R A;  2PCF B;  1WCM B;  1EY9 A;  1EYA A;  4IUV A;  4DR7 L;  4CJ2 C;  1UE1 A;  1QUQ A;  1YNN D;  1O80 A;  4A4I A;  4I65 A;  1B50 A;  4DXF A;  3NHH A;  5COR A;  4BBR H;  4RCN A;  2OWO A;  1KDC A;  3CAM A;  4AYB G;  2E5L Q;  3GO5 A;  3S16 B;  4X3S A;  3KDF A;  1PYB A;  1A2U A;  2FMM A;  3SDZ A;  2VW9 A;  1LYL A;  2E2D C;  2JP1 A;  2AKW B;  1U4P A;  2WKC A;  2UUA Q;  1KHI A;  4OIJ A;  4B3R L;  3I4N G;  3DUZ A;  1WJJ A;  4OHJ A;  3ERQ A;  1TWG B;  3H3V C;  2PI2 A;  3KLS A;  2RKS A;  1JMC A;  1CM9 A;  3DM3 A;  4DV0 L;  3NE5 B;  2F3W A;  1SMX A;  2JEA I;  1FNU A;  2R6G A;  2DJF C;  5J39 A;  1VQ7 A;  4DR4 L;  4B08 A;  4DV5 Q;  2NVY H;  3GTG B;  4A93 H;  2GVB A;  1BCP B;  2V4D A;  4JOI A;  1Q81 C;  3T13 A;  1G2S A;  5IYB H;  1WTR A;  1O7L A;  1M1K C;  4G7O C;  2B2V C;  4DR5 L;  2JEB I;  1SE2 A;  1PHJ A;  4Q5V A;  4P72 A;  4X64 Q;  4AQY Q;  3M85 A;  1ZYR C;  5IWA Q;  1I50 H;  1GKH A;  4R8I A;  1QNU A;  1ILP A;  4OXP A;  4CGY B;  1K3B C;  1PFM A;  3J7Z C;  1O78 A;  1SND A;  5AJ3 Q;  2VB2 X;  4L5S A;  1V1P B;  4LF9 L;  2B2T A;  4CKB A;  3F1Z A;  4OIK A;  4DU9 A;  1XJV A;  4O42 A;  1TII D;  3IKJ A;  3HOY G;  3HKZ E;  3R3O A;  1JOK A;  1E2Z A;  4NB3 A;  4C3J B;  2ATW A;  5KIX A;  1K73 C;  3HOU H;  5LMU Q;  2RF4 A;  1Q90 A;  3K0Y A;  4BS9 A;  1JB3 A;  3W3A A;  1EIH A;  4IAL A;  1TR5 A;  1BKB A;  2RCF A;  1B9N A;  1F2M A;  3MXG A;  4FF4 A;  4DV3 Q;  4JYA L;  3S24 A;  5IGG A;  4KI0 A;  4XYO A;  2Y0S E;  5K5P A;  3GTL B;  2R7Z G;  4XQN A;  5KYL A;  1HUN A;  1JT8 A;  1YNJ D;  1UEA B;  5JOB A;  1LUZ A;  1NNX A;  4FDB A;  4RG1 A;  3MA2 B;  3I8Z A;  4A3K B;  3FHW A;  5IY0 A;  2WIN B;  2NN6 H;  4LUO A;  2K5H A;  1SNP A;  3F2C A;  3PUY A;  3AU7 A;  4IN3 A;  4KHV A;  5JPM C;  2QIL A;  1Q8I A;  3S1N B;  1PH6 A;  1LTI D;  1Y14 B;  4NPS A;  3KJP A;  4B3M Q;  1SYE A;  1X54 A;  2XRS D;  4NXM L;  1RCV D;  1VQE A;  1OTC A;  2FXQ A;  5ELD A;  1CKO A;  4L6T B;  4J15 A;  1GHK A;  4BBS H;  4YY3 L;  4ZYS A;  3P7J A;  1OO9 B;  3A0J A;  2ZXR A;  2N49 A;  3PIO 3;  2PMZ B;  4JBM A;  2B29 A;  1C7Y A;  1RJT A;  1PTO F;  4CBV A;  1QVG A;  3ZYY X;  4WJW A;  2QDB A;  1LO5 D;  2F0W A;  3BU2 A;  3NEN A;  3PUV A;  3CCS A;  1G6Z A;  3RZD H;  4A3F H;  1DD2 A;  1B70 B;  3Q24 A;  2P5Z X;  3UDX A;  5BR8 Q;  3I55 A;  2EQS A;  1CKM A;  4JC0 A;  4B9X A;  4BA2 I;  5IGB A;  1JQY D;  1GUW A;  1N36 L;  3LX0 A;  1JWM D;  4GNX A;  3RUZ A;  2WFW A;  1I6H H;  1I3Q H;  1T9H A;  4DN4 M;  2R3Z A;  1KLU D;  5IIF A;  4G7Z C;  4Y52 H;  3T51 B;  3I4N H;  2NTT A;  1B53 A;  1PYW D;  3ERO A;  3VA7 A;  1HRJ A;  3R2T A;  4ZLT F;  4JI7 L;  1OXX K;  2CWP A;  1XNQ L;  4XQQ A;  2L11 A;  3CCJ A;  3NTH A;  3H0G G;  1IYV A;  3I90 A;  2R93 G;  5JJI A;  3U58 A;  2NVT B;  3G71 A;  1PYS B;  4BA1 I;  2Q2T A;  4ULL A;  1PVO A;  3AMU A;  2JA8 B;  3QIA A;  4OO1 I;  4DK3 C;  4JPB W;  3CCQ A;  1PV4 A;  1SMY D;  3CQZ H;  1KNE A;  3K59 A;  3TBI B;  2KVM A;  4WFN 3;  1BVS A;  1XTC D;  3NK9 A;  4V19 0;  1LAC A;  1PH2 A;  3PSI A;  4K5W A;  2F0M A;  3NBH A;  2EY1 A;  3E5S A;  4FXG C;  4GKK L;  5CV6 A;  5CMD A;  3KF8 B;  4IJH A;  1LTS D;  5A2Q L;  1Y8P B;  2TMP A;  1CZW A;  3DWA A;  3FRP B;  5FO8 B;  3TS0 A;  3OIQ A;  2PNR C;  2J4X A;  3HOY H;  4F7X A;  2O5I C;  1CA6 A;  2KA7 A;  4JW0 A;  3T1H L;  2F0J A;  1KNA A;  1MD2 D;  3HKZ G;  1ET6 A;  1VQ6 A;  1Z7T A;  5IGC A;  1O7I A;  1HUM A;  2L1B A;  2EXD A;  4JI4 L; 
#chains in the Genus database with same CATH homology
 1KD1 C;  4AIM A;  2IHE A;  2B63 H;  2CCZ A;  4IOC A;  1Z47 A;  1LTL A;  3PO2 H;  5IYC H;  2D0O A;  3K8A A;  2R7F A;  1IBL L;  3S1N H;  5IP9 H;  3BJU A;  1BBW A;  4EQ5 A;  1VQF A;  1WFQ A;  3M4Q A;  1VQI A;  4IPG A;  3DLL A;  4YCV A;  2MFI A;  4O0A A;  5FJ8 H;  4DNI A;  2A1A A;  1GM5 A;  2BA1 A;  2R7Z H;  1IBK L;  1YJW A;  1WCM H;  1B8A A;  3S14 H;  1EUJ A;  5GAE C;  3M7N A;  4A3D G;  4B3T Q;  1SE8 A;  4NXN L;  2Y0S G;  4B3R Q;  4XTC S;  5HGQ A;  3CC4 A;  2QGQ A;  1H95 A;  2LSS A;  3H3V I;  2VUM G;  1E22 A;  3B6Y A;  2RCN A;  3CCR A;  3AEV A;  4BBS G;  2HT1 A;  4AYB E;  4DV7 Q;  4HIO A;  4JI3 L;  1G51 A;  1HNX Q;  3ULJ A;  3RLN A;  2NZH A;  4MTN A;  4B3S Q;  2K4K A;  4JG2 A;  4LW1 A;  3CCU A;  1PH8 A;  2UU9 Q;  3S16 H;  1FVI A;  2KEN A;  5IE8 A;  1KQS A;  4LFA Q;  1KRT A;  4HJ8 A;  1N36 Q;  1N8R C;  1Q7Y C;  4A3L G;  2LXJ A;  1YVC A;  3L0O A;  4PZ8 A;  1YJN A;  4DKA C;  3KOJ A;  4JBK A;  4DR3 L;  4DR4 Q;  1X65 A;  2WAQ G;  4UP7 A;  5EAY A;  2UUC Q;  3HOW G;  1AH9 A;  4QIW E;  2YTV A;  1TXY A;  1KRS A;  4A3M G;  4DR5 Q;  1EQR A;  3W1G A;  2AMC B;  2IX0 A;  2IT1 A;  4DUZ Q;  3I4M G;  2JK8 A;  2BH2 A;  1J5E Q;  1VQM A;  1QZH A;  1TWG H;  4A3F G;  4JI7 Q;  1SLJ A;  1KL9 A;  4YCU A;  1XNQ Q;  3PUW A;  2K52 A;  4DAM A;  4POF A;  1CSQ A;  1G6P A;  1N34 L;  5IYD G;  4GLV B;  1JB7 A;  1K8G A;  3FP9 A;  4P73 A;  2YTY A;  2CFM A;  1CSP A;  3BZC A;  2JA6 G;  2JA8 G;  1VQD A;  2DUD A;  4PMW A;  4LF6 L;  2UXD L;  4GN4 B;  2ZTD A;  2XTI A;  4A93 G;  4HID A;  3UDG A;  2K50 A;  1N33 Q;  2L15 A;  1SRU A;  4JI1 L;  4DR2 L;  5FLX c;  2HIV A;  4JCV E;  5IYB G;  4LFC Q;  1JJ2 A;  1VQ8 A;  4JI5 L;  4GS3 A;  4IFD I;  4LF5 Q;  4A3B H;  1HZC A;  3I7F A;  2I0Q A;  1P16 A;  5C4X G;  3F2D A;  1YNX A;  2ID0 A;  2F4V Q;  4A3C G;  4YWM A;  1PH1 A;  2UXC Q;  2E5L L;  4GKK Q;  3PUX A;  5DLQ E;  2VQE L;  2PI2 E;  4UP9 A;  1GD7 A;  3L7Z C;  3KJO A;  4H02 A;  5GAH C;  1XTD A;  4QGU A;  4R4T A;  3S2H H;  1N32 L;  4OON A;  2VZA A;  4R1J A;  3TRE A;  1MJE A;  2UUA L;  3I56 A;  1YHA A;  1IZ6 A;  4PZ6 A;  4JV5 L;  1Z9F A;  4OX9 Q;  3CPF A;  4IJL A;  4YCW A;  2D0P A;  3H3V H;  3STB D;  1D8L A;  2K14 A;  3JC6 6;  4JYA Q;  3BZK A;  1NTG A;  5C0X I;  4YHH Q;  4A3I H;  3ICE A;  3S17 H;  4IO9 A;  3VDY A;  1QZG A;  3HOX H;  3CC2 A;  4PZ7 A;  4JI6 Q;  3T1H Q;  2MNA A;  1QVF A;  3H0G H;  4C3J H;  1E24 A;  5E7N A;  1HNZ L;  5C3E G;  2R92 H;  1FJG Q;  1IBM L;  2YTX A;  2R93 H;  2H5X A;  2F52 A;  1JE5 A;  3M4P A;  3HOU G;  3W1B A;  3G4S A;  4JI4 Q;  1OXS C;  3UE1 A;  3PIO A;  1XNR L;  3PF4 A;  4MZ9 A;  1DGS A;  4R4Q A;  2A8V A;  3GTM H;  4BY1 G;  1EQQ A;  4JBW A;  2VQF Q;  4K0K L;  4IPH A;  4DV5 L;  1IBL Q;  4IPD A;  3TEH B;  3U4Z A;  1CKN A;  2KCT A;  3CMA A;  1YHQ A;  1QVC A;  4Y7N H;  1K9M C;  4DV6 L;  1KXL A;  1MKH A;  1PFS A;  3KLW A;  2ZTC A;  5C44 H;  1SFO H;  1IBK Q;  4X64 L;  2JA7 G;  4C2M H;  4A3E G;  2R7D A;  1TWH H;  1NJI C;  1JJC B;  5IWA L;  2E8G A;  4NXN Q;  1SRO A;  4GOP A;  1EWI A;  2Q2I A;  4APV A;  3ZJY C;  1S3O A;  4A3K H;  4LF8 L;  3GTQ H;  4IFD J;  4JI3 Q;  3GDE A;  3NEM A;  5LMN W;  1L1O A;  4L5R C;  1C0A A;  5AJ3 L;  5FLM G;  3CXC A;  4L5T A;  1E1O A;  1HZA A;  2B63 G;  2NN6 G;  3PO2 G;  4GN5 A;  1WYD A;  3AFQ A;  2VL6 A;  3PGZ A;  2QA4 A;  1W2B A;  2VY3 A;  5IP9 G;  1G29 1;  1LM0 A;  3M9B A;  2PQA A;  4LUV A;  4DR1 L;  4GOP C;  4UPA A;  5IP7 H;  1VQH A;  4DR3 Q;  4QY7 A;  2Q2H A;  1U5K A;  3OYY A;  1VQP A;  3ERS X;  1VQJ A;  5JJK A;  3RLO A;  1C9O A;  1UE5 A;  5M3F H;  1L1O C;  2UXB L;  2JA5 H;  2ASB A;  3I4O A;  3HKS A;  1Y1W G;  5LMU L;  4HJ5 A;  3RN2 A;  2VS1 A;  3K0X A;  4X65 Q;  1HR0 Q;  2UUB L;  4JBJ A;  3M3Y H;  3KFU A;  4WJ4 A;  2Z6K C;  1VQO A;  3CF5 A;  3LGJ A;  3J7A 5;  4JI8 L;  2JE6 I;  1N34 Q;  1YZ6 A;  3K7A H;  3J81 c;  2E2H H;  3JAM c;  3TQY A;  1R9T H;  3D31 A;  4XIG S;  3RLF A;  4LF4 Q;  1X9N A;  2F3I A;  4DV3 L;  1L2F A;  3RZO H;  1VQ9 A;  1E7Z A;  1K83 H;  2I5L X;  3UDF A;  5C4J H;  3RNU A;  4LF6 Q;  1XPU A;  2UXD Q;  1GVP A;  5M5Y H;  4A3D H;  2AWN A;  4P75 A;  4DAY B;  3AYH B;  4DR2 Q;  1Q82 C;  4DR6 L;  4DR7 L;  1D7Q A;  1UE1 A;  3CCL A;  1OXT A;  1QUQ A;  1CKN B;  2ALY B;  4A4I A;  4JI5 Q;  2QEX A;  2NVX H;  1Q1B A;  3CP0 A;  1VQK A;  4GLA C;  4BBR H;  4R4I A;  4KHZ A;  1X56 A;  2OWO A;  3CAM A;  1SR3 A;  4AYB G;  1I5F A;  2E5L Q;  3GO5 A;  4R4O A;  2VQE Q;  4DV2 L;  4HIM A;  4GOP B;  2WB1 E;  4A3L H;  2LXK A;  2Q2U A;  3KDF A;  3KYH C;  1PYB A;  2I5H A;  3OTO L;  4B3M L;  4A75 A;  2VW9 A;  1LYL A;  3J80 c;  1L1O B;  3HOW H;  4R4C A;  2AKW B;  1V43 A;  2CKZ B;  2JJQ A;  2UUA Q;  2N3S A;  1KHI A;  1E3P A;  4A3M H;  3CD6 A;  4JV5 Q;  1YHB A;  4B3R L;  4X66 L;  3I4N G;  3I4M H;  1UE7 A;  1CUK A;  2PQA B;  2JA7 H;  1WJJ A;  1EIY B;  2D62 A;  1EFW A;  4X62 L;  2AWO A;  5J3B A;  3Q8D A;  4DV7 L;  3FKI H;  4RMF A;  2PI2 A;  1VQ4 A;  2ES2 A;  1P8L A;  2C35 B;  1HNZ Q;  1IBM Q;  1JMC A;  2MO1 A;  3DM3 A;  4DV0 L;  5IYD H;  3U4V A;  1VCI A;  4DV1 L;  1SMX A;  1PH5 A;  1HR0 W;  4LFA L;  1XNR Q;  2JEA I;  3L2P A;  2NVT H;  5K36 G;  1K3R A;  2R6G A;  2JA8 H;  1VQ7 A;  2WB1 G;  1FGU A;  1NMF A;  2YV5 A;  4YWL A;  4DR4 L;  4K0K Q;  1W3S A;  5H1S E;  2NN6 I;  4DV5 Q;  3GD7 A;  1UE6 A;  2NVY H;  1I94 L;  3HOV G;  2GVB A;  4A93 H;  4HJA A;  4JOI A;  1Q81 C;  3K81 C;  1AE2 A;  5IYB H;  4HJ9 A;  3HOZ G;  1M1K C;  4DR5 L;  3PF5 A;  3RN5 A;  1S72 A;  4TQU S;  2JEB I;  4DV6 Q;  1PHJ A;  1VS0 A;  4P72 A;  4X64 Q;  1VQC A;  1N9W A;  4AQY Q;  5C4X H;  3PO3 G;  3TRZ A;  5BR8 L;  3M85 A;  3E9I A;  3MXN B;  4DUY L;  5IWA Q;  4A3C H;  1I50 H;  1GKH A;  3J81 i;  1K0R A;  3JAM i;  1JJG A;  2R92 G;  4OXP A;  5GRO A;  1L0W A;  1PH9 A;  1QUQ B;  4ME3 A;  1XPO A;  4JOI C;  3AQQ A;  2IX1 A;  4OWT B;  4IPC A;  2WP8 J;  2VNU D;  3J7Z C;  2EIF A;  5AJ3 Q;  1ASZ A;  1Y1V G;  1HJP A;  1X55 A;  1EYG A;  3UDI A;  4L5S A;  4PG3 A;  1WI5 A;  3RR5 A;  3K80 C;  1A0I A;  3GTJ H;  4LF9 L;  2NVQ H;  3F1Z A;  4A3J H;  3CCM A;  1N33 L;  4BXX G;  4LWC A;  4DR1 Q;  1XJV A;  4UY8 C;  1WOC A;  3KDF B;  4P74 A;  4KHP L;  1VQ5 A;  2B3G A;  3HOY G;  5C44 G;  5C0X J;  4A3G G;  3HKZ E;  1AE3 A;  5C3E H;  1PH3 A;  5LMN L;  2UXB Q;  5GQO A;  4NB3 A;  2ATW A;  3CME A;  2KCM A;  1K73 C;  3HOU H;  2CQO A;  2OTL A;  5LMU Q;  2UUB Q;  2HQL A;  3ER0 A;  2PMZ E;  5M3M G;  2RF4 A;  4O2D A;  3CW2 C;  3J81 j;  3J80 i;  2NZO A;  3CPW A;  4IOA A;  4LF7 L;  4A3K G;  4QJF A;  1XMQ L;  1YEZ A;  1RIP A;  3A5Z B;  4LNQ A;  4BY1 H;  1TWF H;  3T1Y L;  1HNW Q;  1BKB A;  4JI8 Q;  3ULL A;  4DK6 C;  1BBU A;  1YBY A;  2ZJP A;  5IYC G;  1KC8 C;  1UEB A;  4TVA B;  1B7Y B;  4DV3 Q;  2Z6K A;  1NY4 A;  2A19 A;  4JYA L;  4BY7 H;  3W5O A;  3PCO B;  1X6O A;  3S24 A;  1VQB A;  2IHF A;  3NEL A;  4KI0 A;  5FJ8 G;  4YHH L;  1MIU A;  2Y0S E;  3CCE A;  4A3E H;  4JI2 L;  2R7Z G;  3GTP H;  1WCM G;  2HHH L;  4DR6 Q;  4DR7 Q;  5JJL A;  5M3F G;  1JT8 A;  1NMG A;  2HIX A;  3PIP A;  1KAW A;  1LUZ A;  4FDB A;  1J6Q A;  4RG1 A;  1YJ9 A;  1OXU A;  4QL5 A;  3OW2 A;  3FHW A;  4DPG A;  5IY0 A;  5FLM H;  4OO1 G;  4LUO A;  2K5H A;  3G6E A;  2VQF L;  2CWA A;  3CC7 A;  4GLX A;  4DV2 Q;  3F2C A;  2ZTE A;  3PUY A;  2KHJ A;  2WAQ E;  1EIF A;  2KHI A;  3STB C;  1Y14 B;  3OTO Q;  4NPS A;  3KJP A;  2ZM6 L;  1X54 A;  1PH6 A;  1VQL A;  4B3M Q;  4NXM L;  3E9H A;  3SGI A;  5C0X G;  1VQA A;  1VQE A;  4AH6 A;  4OWW B;  1OTC A;  2FXQ A;  1PH7 A;  2K75 A;  4LFB L;  3IRB A;  3G48 A;  3KF6 A;  1CKO A;  4JI1 Q;  4X66 Q;  2IY5 B;  4J15 A;  1XMO L;  2V1C C;  1Y1W H;  4DV4 L;  1A8V A;  1XPR A;  2E2J H;  2VUM H;  4X62 Q;  4X6A H;  1Q86 C;  2OCE A;  4LUZ A;  4YY3 L;  4BBS H;  4WJ3 M;  3EBE A;  3A0J A;  4BBR G;  2N49 A;  4JBM A;  4JI0 L;  4GKJ L;  2B29 A;  4P71 A;  4C3I H;  5JEA J;  4DV0 Q;  1C7Y A;  3NBH B;  4DV1 Q;  2RHQ B;  4GN3 B;  5GAD C;  5ELN A;  1QVG A;  1YIJ A;  3H15 A;  1V1Q A;  1N32 Q;  3PUZ A;  1Q46 A;  1I94 Q;  3PV0 A;  3AFP A;  5IT9 c;  2K5N A;  3BU2 A;  2YYZ A;  3NEN A;  3PUV A;  4B3T L;  3TS2 A;  3EN2 A;  3CCS A;  2XGT A;  1HZ9 A;  4KLK A;  3RZD H;  4A3F H;  1HR0 L;  1B70 B;  5ELO A;  4X65 L;  1MJC A;  3EIV A;  3UDX A;  5BR8 Q;  3I55 A;  3A74 A;  2EQS A;  4DUY Q;  3I2Z A;  3S15 H;  4A3B G;  3FKI G;  1CKM A;  1HNX L;  4JC0 A;  3UE0 A;  2BH8 A;  1PA6 A;  4B3S L;  4BA2 I;  2UU9 L;  1X3G A;  4OWX B;  1N36 L;  3GTK H;  4LF4 L;  2E2I H;  1PH4 A;  4GNX A;  2JA6 H;  2WFW A;  3CCV A;  3GTG H;  1I6H H;  1I3Q H;  1T9H A;  1U0L A;  3GTO H;  4LF9 Q;  2BA0 A;  4Y52 H;  2UUC L;  4EX5 A;  2ZJQ A;  3I4N H;  4YWK A;  4ALP A;  4KHP Q;  3S2D H;  4DUZ L;  2I5M X;  1X3F A;  1J5E L;  3E0E A;  4HIK A;  1IL2 A;  5GAG C;  5M5X H;  1OXX K;  4A3I G;  1KIX A;  2CWP A;  1ASY A;  4JI7 L;  1XNQ L;  3HOX G;  5LMN Q;  4L5Q A;  5JEA G;  5M5W H;  3CCJ A;  4GNX C;  2OQK A;  1IXR A;  3H0G G;  3KF6 B;  3WWV A;  1A62 A;  1OXV A;  1YI2 A;  2R93 G;  5JJI A;  4QQB X;  3U58 A;  2OTJ A;  3F2B A;  4LF7 Q;  1XMQ Q;  4LF8 Q;  3G71 A;  1PYS B;  1TWA H;  4BA1 I;  3D0F A;  2RHS B;  4HJ7 A;  3T1Y Q;  2K5V A;  2Q2T A;  2PNH A;  4OO1 I;  4A76 A;  1PVO A;  4DK3 C;  3HOV H;  3M4O H;  2MQH A;  3CCQ A;  1PV4 A;  3S1M H;  1GO3 E;  3HOZ H;  3CQZ H;  1TWC H;  4A3J G;  1FL0 A;  3MEF A;  2AHO B;  1RL2 A;  1HH2 P;  4LFC L;  1V9P A;  1VQG A;  1BVS A;  3PO3 H;  1IYJ B;  2N8N A;  4LF5 L;  4JI2 Q;  2N78 A;  1PH2 A;  2HHH Q;  3PSI A;  1M90 C;  2JA9 A;  1HZB A;  2F4V L;  1VQN A;  2UXC L;  4MNO A;  1UWV A;  4GKK L;  2JQO A;  2ZJR A;  3KF8 B;  4IJH A;  3HFZ B;  3S1Q H;  1Y1V H;  2Z0S A;  3U50 C;  2KBN A;  3TS0 A;  4BXX H;  1SN8 A;  4GKJ Q;  2GN5 A;  2ZM6 Q;  4NXM Q;  1YIT A;  1X3E A;  4OX9 L;  2YU9 H;  3F8T A;  3HOY H;  5HY6 A;  4BY7 G;  3S1R H;  4GNX B;  5IP7 G;  3GTL H;  4IFD G;  4A3G H;  1HNW L;  4AQY L;  3A5U A;  2GVA A;  4JI6 L;  4LFB Q;  3ULP A;  3T1H L;  1S40 A;  1NE3 A;  1Q1E A;  1XMO Q;  4UP8 A;  1Q12 A;  3HKZ G;  1K8A C;  4DV4 Q;  1FJG L;  3K7U C;  2JA5 G;  4POG A;  1O7I A;  5M3M H;  1VQ6 A;  2MO0 A;  4C3H H;  1EOV A;  4YY3 Q;  1Q8K A;  2EXD A;  1A63 A;  1E1T A;  4JI4 L;  4JI0 Q;  2OQ0 A;  1NBW A;  2DGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...