5M5XH

Rna polymerase i elongation complex 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Structures of Transcribing RNA Polymerase I.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
total genus 17
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m5xH00
2AHOB 3GDEA 2JK8A 1S72A 3RN2A 5GAHC 4ALPA 4JI4Q 2ASBA 5LMNQ 3M4QA 1SE8A 2EQSA 3I7FA 4A3MG 1C9OA 1HNXL 4DR6L 4JV5Q 3CMEA 5FJ8G 2RHSB 4A3EH 3CD6A 1EWIA 3NBHB 2VQEL 4IPHA 1VQOA 2WB1G 2F52A 5ELNA 2K4KA 1P16A 1OXVA 3BU2A 4P74A 4DR4Q 4NXNL 2CFMA 1CUKA 5C4JH 1ASZA 3JAMc 1N33Q 3I4NH 1EQRA 4APVA 4AIMA 3L0OA 3PIOA 4DR1L 2KHIA 3TS2A 1VQDA 3KDFA 3S17H 2LXJA 2JA6H 4DUYQ 4B3MQ 2VNUD 3RLFA 2B3GA 4DV6L 4NXML 1FGUA 4DV2Q 3M4PA 1IBLQ 4DR7Q 1YI2A 5C44G 4GN5A 3HOYH 3HOYG 1Q12A 4GOPB 1JE5A 2QEXA 3HOWG 4A93G 4IO9A 4A76A 3S15H 2ATWA 1YIJA 3F2BA 3DM3A 2YTVA 1Z47A 1UE5A 2ZM6Q 1I94Q 4DV3L 3PO2H 2QGQA 1G51A 1J6QA 4JBKA 3KF8B 1U0LA 1EIFA 2JJQA 2GVAA 3W5OA 3H15A 4UY8C 4Y7NH 4DR5Q 1JJGA 1PV4A 1VQAA 3CP0A 3KDFB 3PO3G 3S16H 1N8RC 3IRBA 4A93H 2A19A 2JA5H 4PZ7A 4JI7L 1JJ2A 3KF6A 3PIPA 2PMZE 1K73C 1SFOH 5JJKA 2OQKA 4HJ7A 2UUAQ 3MEFA 2JA6G 2JA8H 4ME3A 4MNOA 4QGUA 5M3FH 1X54A 1QZGA 4OO1I 2I5LX 2JQOA 1LTLA 4GLAC 4IFDG 1WJJA 1XJVA 3M4OH 3STBC 5M5YH 1K8AC 1N33L 5M5WH 4FDBA 4LFBQ 2R7ZH 2K52A 3F1ZA 1CSPA 1YBYA 1CKOA 1BBWA 4LUOA 5AJ3L 1IBKQ 1I6HH 1RIPA 1PH6A 4DV6Q 3L2PA 4NXMQ 4YHHQ 1PH4A 1VQPA 1VQ4A 3HOUG 3K80C 1Q81C 4HIKA 1YHAA 3A0JA 1HNXQ 4DR6Q 4IFDI 3PO3H 4POGA 3S14H 2VL6A 1L1OA 2UUCL 1MKHA 2MFIA 2IY5B 1X3GA 1GD7A 1X9NA 4O2DA 1OXTA 4DR3Q 1XMOQ 1Q8KA 1XNQL 1Z9FA 2VQFQ 4K0KL 1VQ7A 3UDFA 1NJIC 5IWAQ 2PQAA 2KCMA 3U4VA 1TWGH 4LF9L 2OQ0A 2E2IH 2JEAI 3I4MG 4JI8L 3H3VH 1VQNA 4GKJQ 4LUVA 4Y52H 1UE6A 1BBUA 4BBSG 3HOXH 1HR0Q 4LF6Q 3GTGH 2RCNA 4B3ML 3VDYA 3HKSA 3I4NG 1LYLA 3L7ZC 3PUXA 3UE1A 5GAGC 4DV4Q 2XGTA 4DKAC 2R93G 3T1HQ 2WAQG 1PA6A 3CAMA 3HOVH 3G71A 1KIXA 4P73A 4DV7Q 2JEBI 4DR2Q 5JEAJ 4A3EG 4LF7L 1E22A 2ZJPA 4A3JH 4JBMA 4JBWA 1KL9A 3BZKA 3W1BA 4JI5L 3RR5A 4LF5Q 4A3BG 4B3SQ 4EQ5A 4DR5L 3FHWA 3S2DH 5IYBH 4A3KG 3KJPA 1EQQA 1PH7A 3GTPH 1E1OA 2JA9A 4R4QA 3J7ZC 4GNXA 3UE0A 3FP9A 1I50H 4YWLA 2HHHL 3TEHB 3CC2A 3KYHC 1N34Q 3CCRA 1H95A 5H1SE 2MO0A 3I4MH 1WCMH 3ER0A 2UU9L 1TWFH 2YYZA 3EIVA 1AE2A 3KLWA 4IOCA 4LFCQ 3CQZH 3KF6B 3RLNA 3J80c 3CCSA 4PZ6A 3T1HL 1WI5A 2E5LQ 4BY1G 3NENA 4OO1G 3H0GH 1PYSB 4A3DH 1WFQA 3ULLA 3BZCA 1QUQA 4JI0L 3T1YQ 3PUYA 4A3IH 3S1RH 4A3GG 1A63A 4YCVA 2KHJA 4HJ8A 2ZTDA 3S24A 1X3EA 1HNWL 2BH2A 4DUYL 3RNUA 2R92G 1E3PA 3PO2G 2UUBQ 2Q2UA 4DUZL 1UE7A 4B3RL 1N32L 3K81C 3CMAA 3KFUA 3CCQA 1JB7A 4X66L 4OXPA 1ASYA 2K5NA 1U5KA 4X66Q 3A5UA 1KQSA 2DUDA 4L5SA 1PVOA 4B3RQ 3STBD 2N49A 1N32Q 1VQFA 2VQEQ 1XNRQ 4HJAA 1L1OB 5HY6A 3M85A 2VUMG 1T9HA 2I0QA 1Q82C 1PH1A 4BY7G 1V43A 1OXUA 1JMCA 3GD7A 2GN5A 4A3CG 2KENA 1N9WA 4H02A 5LMUQ 3TS0A 1B70B 3AFPA 2JA8G 4XIGS 5M3MG 4A3CH 2OTLA 4L5QA 3M9BA 1IBKL 3D0FA 4LF4L 1TWAH 2F4VL 4RG1A 2PQAB 1S3OA 1IXRA 4BBRH 5FJ8H 4DNIA 1B8AA 4B3TQ 3S1NH 1K83H 1HNWQ 2PI2A 1IZ6A 1YVCA 2IX1A 5GADC 4OONA 2N8NA 3BJUA 4R4OA 4JI1L 4LWCA 4UP8A 1PH2A 4GKKL 2UXCQ 4OWTB 3T1YL 1IYJB 1YHQA 1BVSA 1Y14B 1Y1VH 2CKZB 3E9HA 4DV1Q 2B29A 2WB1E 1I3QH 3H3VI 1NMGA 3TQYA 1IBML 4LFCL 3CCJA 4JI6L 2UUAL 5IYDH 4DV0Q 3Q8DA 4LF8L 4R4IA 1MIUA 5IT9c 1VQ6A 4C3IH 3UDGA 3I55A 3U58A 3AYHB 2Q2TA 2ZJRA 1VQLA 3GTOH 3H0GG 1E1TA 2HHHQ 3S1MH 3K7UC 1MJEA 4R4TA 5LMNW 2KCTA 4LF5L 1YJWA 2NZHA 1HZCA 1EUJA 3DLLA 2K5VA 5JJIA 2R7FA 4AQYQ 1XPUA 2CWAA 2VZAA 4LF8Q 4GN4B 2YTYA 2IT1A 3JC66 3PUVA 2BA1A 3W1GA 5C0XI 2FXQA 1SR3A 3J81j 1K8GA 2BH8A 4JI5Q 2Y0SG 4MTNA 3GTKH 4YWKA 2HT1A 1YITA 2C35B 1Y1WH 4GOPC 2AWNA 4JI8Q 4DAMA 4DV7L 1NY4A 1E24A 1GO3E 1VQIA 4DR1Q 4DR2L 3A5ZB 4A3KH 4JI2L 1B7YB 1CKMA 3AFQA 4R4CA 4IPCA 5C0XJ 3CC7A 3PF4A 1OXSC 1VQMA 4OX9Q 2B63H 4KLKA 4YCWA 4YCUA 4DV4L 3CCLA 3GTMH 4DR4L 1X65A 2Z0SA 3RN5A 2YU9H 1V9PA 2CQOA 1QUQB 5HGQA 4IOAA 4B3TL 1QVFA 3PGZA 4LFBL 4GS3A 2VQFL 2K75A 1XNQQ 5ELOA 2D62A 2QA4A 2H5XA 3OW2A 1HR0W 2IHFA 4GLVB 5C4XH 4JBJA 4GNXB 1Q86C 1PYBA 1C7YA 1DGSA 4A3FH 2R7DA 1YJ9A 4YY3Q 5LMUL 1X55A 4C2MH 1SRUA 4A3IG 1M90C 5E7NA 1XMQL 3LGJA 3F8TA 1KRTA 4A3DG 2JA7G 4R1JA 3MXNB 4DUZQ 1XPOA 3J7A5 2OCEA 2MQHA 3FKIH 3PV0A 3KOJA 1RL2A 4PMWA 3CCVA 4JI6Q 1Q7YC 2NN6I 3CW2C 2UUCQ 2Z6KC 3I2ZA 1I5FA 2JE6I 3A74A 2A8VA 4AH6A 3E0EA 1A62A 2DGYA 2D0OA 4DV1L 3J81i 1PH3A 4HJ5A 4GLXA 4X64Q 3K0XA 3PF5A 1LUZA 1HJPA 4OWXB 3GTJH 2E2JH 4GKKQ 2UXCL 1VS0A 3UDIA 1VQJA 3EN2A 4KHZA 4YWMA 2WAQE 3CCEA 2ZTEA 3G6EA 5IP7H 5J3BA 4WJ3M 4JI7Q 4AQYL 4JI0Q 4A3BH 2LXKA 3NEMA 1G291 3ULJA 4X65Q 3CPWA 1PH9A 1EIYB 4HIDA 4O0AA 4OX9L 3GTQH 1JT8A 5IP9H 1Y1WG 4A3FG 2VY3A 2EXDA 3PUWA 1FJGQ 1KAWA 3CCUA 4IFDJ 1VQKA 3HKZG 2OWOA 2RHQB 5M3MH 3CC4A 4JCVE 2ZM6L 1YZ6A 3I4OA 2F3IA 1UE1A 2R7ZG 1VQHA 5C3EH 2WP8J 2R93H 3HOZG 1YNXA 1K0RA 1QZHA 4DAYB 5IE8A 4LFAL 5FLXc 1PH8A 4C3JH 2ID0A 1IBMQ 4BY7H 1I94L 3GO5A 2B63G 2EIFA 4DK3C 3EBEA 1BKBA 2LSSA 2VW9A 2I5MX 4TQUS 1P8LA 1J5EL 2WFWA 1HNZL 1SN8A 2E2HH 3CPFA 3D31A 2AMCB 1WYDA 4DR7L 2ALYB 5IYCG 2JA5G 2PNHA 4QL5A 1CSQA 4DK6C 3JAMi 4QY7A 4DV0L 1HZ9A 1CKNB 2HIVA 4X64L 4BXXH 1YHBA 3PSIA 2K5HA 1QVGA 1M1KC 1L0WA 2K14A 4JI2Q 4JYAL 1D8LA 1GM5A 3OTOQ 3CXCA 4DV5Q 2ZTCA 1KHIA 4GN3B 3NELA 2JA7H 2HIXA 2ZJQA 2N78A 2VS1A 2K50A 4P75A 4LF6L 4P72A 4POFA 4NB3A 4BBRG 5C44H 1XNRL 1W2BA 4GKJL 1C0AA 5JJLA 1N36Q 2F4VQ 1J5EQ 1XMQQ 1FJGL 1K9MC 1D7QA 4BXXG 1TWCH 4X62L 4KI0A 1HH2P 4JI4L 1CKNA 1XTDA 3ZJYC 4L5TA 3SGIA 1Y1VG 1KRSA 4JI3Q 1Q1EA 1X6OA 4NPSA 5JEAG 5LMNL 1MJCA 2UUBL 3AEVA 3CCMA 4QQBX 4LW1A 4YHHL 5M3FG 2OTJA 3TRZA 2E8GA 2R6GA 4A3LG 4A3LH 1AH9A 1AE3A 2PI2E 1SROA 3M7NA 4LUZA 4PG3A 4LF4Q 2N3SA 4JOIA 2HQLA 2I5HA 4A3MH 2MO1A 1FVIA 4JC0A 1IL2A 2NZOA 1G6PA 4HIOA 1OXXK 1VQBA 1EFWA 4GNXC 3HFZB 4JI1Q 3RZDH 4L5RC 1TXYA 2YV5A 3HOVG 1NTGA 4XTCS 2A1AA 2NVXH 4DPGA 2VUMH 1NBWA 1UWVA 1UEBA 5DLQE 1Q46A 4OWWB 1VCIA 2IHEA 5GAEC 1Q1BA 4LF9Q 3HOWH 3G48A 4BY1H 1WOCA 5GQOA 4KHPL 2UXBL 4YY3L 2BA0A 1PH5A 5IYDG 4JI3L 3HKZE 2NVQH 3F2DA 1VQEA 4B3SL 4DV3Q 1VQ8A 1TWHH 4IJHA 1VQCA 4UP7A 5IYCH 5M5XH 1X56A 4JG2A 3G4SA 1VQGA 4LF7Q 5EAYA 1PHJA 3K7AH 3OYYA 1KD1C 5FLMH 2AKWB 4X62Q 5BR8L 4JYAQ 4WJ4A 4MZ9A 4LNQA 3CF5A 1N36L 5IYBG 2MNAA 4C3HH 5C0XG 1L2FA 4GOPA 2XTIA 2UU9Q 2UXDL 4RMFA 5BR8Q 3HOZH 4X6AH 1EOVA 5C3EG 1HR0L 4JOIC 4A3JG 1OTCA 2AWOA 2L15A 2Z6KA 1L1OC 5AJ3Q 1KXLA 3OTOL 4DV5L 3E9IA 1HNZQ 3AQQA 1PFSA 5C4XG 3K8AA 2UXDQ 3GTLH 3ERSX 2V1CC 2NVYH 2R92H 2KBNA 5IP9G 1HZBA 1FL0A 5IWAL 3F2CA 1SMXA 1EYGA 4LFAQ 1A0IA 1NMFA 3RZOH 4TVAB 4BA2I 3PUZA 4QIWE 5IP7G 1R9TH 3S2HH 4AYBE 1W3SA 3RLOA 3HOXG 4BBSH 2UXBQ 1NE3A 4NXNQ 3U4ZA 1X3FA 4DR3L 1XMOL 2Q2IA 5IY0A 2D0PA 1QVCA 2Q2HA 3B6YA 1V1QA 1LM0A 2GVBA 1O7IA 1A8VA 4J15A 3M3YH 4BA1I 4JV5L 2IX0A 4A3GH 1YEZA 4HIMA 5FLMG 1S40A 1E7ZA 4AYBG 3I56A 2RF4A 4IPGA 4PZ8A 4UP9A 4K0KQ 4KHPQ 3U50C 1KC8C 4A4IA 4A75A 3FKIG 5GROA 4P71A 1JJCB 4X65L 3J81c 1YJNA 4IJLA 3S1QH 3PCOB 3KJOA 4UPAA 3J80i 1K3RA 4HJ9A 3WWVA 4IPDA 2ES2A 5K36G 2Y0SE 1IBLL 1XPRA 1HZAA 1WCMG 4DV2L 1SLJA 3TREA 1VQ9A 2CCZA 1VQ5A 2E5LL 2NN6G 3ULPA 3HOUH 4EX5A 2YTXA 2CWPA 3UDXA 3ICEA 1GVPA 4QJFA 1GKHA 1N34L 2NVTH
chains in the Genus database with same CATH superfamily
1A3TA 4L8JA 2JK8A 5KYLA 1S72A 3KUPA 5LMNQ 3CMEA 2RHSB 4A3EH 3DWQA 3NBHB 2VQEL 4IPHA 2WB1G 1RF2D 1T5XD 2F52A 2FJ2A 2K4KA 2CFMA 5TSSA 2FMCA 3JAMc 4AIMA 3L0OA 1E2WA 4DR1L 3S2HB 1MGSA 3TP7A 3MZ5A 4O42A 3RLFA 4B3MQ 2VNUD 1JE4A 3M4PA 1A3UA 1DOKA 1YI2A 3HOYG 1TS2A 4OGQC 3S15H 4M8AA 1Z47A 2ZM6Q 1I94Q 2NWGA 1VMPA 2DJFC 4K5WA 1JJGA 1VQAA 3P20A 4C3HB 3K58A 3PO3G 2F0TA 5IGFA 4PZ7A 4JI7L 2R7ZB 5M5WB 1MBYA 2WINB 5JJKA 1KDCA 2UUAQ 2F0OA 1PTOF 5M3FH 1VDZA 4GLAC 4CDCC 3W3AA 1K28A 1N33L 3NTHA 1K8AC 4LFBQ 5AJ3L 1CSPA 2KVMA 1R9TB 1BBWA 3L2PA 3FPPA 4UAIA 3HOUG 4ULLA 1YHAA 3A0JA 4DR6Q 3S14H 1BXTA 2VL6A 3OOCA 1Z6HA 2MFIA 1X3GA 5IT9E 4R8NA 4O2DA 2JYOA 3RUZA 1Q8KA 4KY7A 1H9KA 4XQQA 4A3KB 1VQ7A 3S17B 2KCMA 1FGBD 2MJ8A 4DAVA 2OQ0A 3MHBA 2E2IH 1JCKB 4IN3A 4JI8L 1TY2A 4Y52H 2E74C 4DNTB 2K05A 3HOXH 4N9PA 3UE1A 3PUXA 4DKAC 3T1HQ 4NKLA 5CV7A 4OELB 5I2YA 3J80E 2B2VA 3SK8A 1ZKOA 1DCZA 1H9MA 4N9TA 5ELCA 5FO9B 3BS1A 4JBWA 3GV6A 2NB0A 4LAAA 3KLRA 4HAEA 1CFMA 1Y1VB 1CA6A 4FF4A 4R4QA 3K0YA 4YWLA 3KF8A 4Q0FA 2HHHL 4DXGA 2KEEA 3TEHB 5I6WA 2MO0A 3H94A 2FFKB 1WCMH 1LT6D 1TWFH 1EYAA 2RBMA 1AE2A 3EIVA 3RLNA 1GUTA 4HR7B 1WI5A 4BY1G 3NENA 4WJWA 1PYSB 5FO8B 1WFQA 5JPNC 2HCCA 1U4RA 2P5ZX 4DUYL 2X6GA 2R92G 4DUZL 3Q24A 1HCZA 4N8X1 4B3RL 3CMAA 1JB7A 1STYA 1U5KA 3DWAA 4KHVA 1PVOA 4B3RQ 2N49A 1XNRQ 4FO2A 1L1OB 3M85A 4XXEA 1DONA 4BY7G 1V43A 2AQ2B 2A69D 3A8JE 1SNMA 4DK1A 1N9WA 2EJGC 4XIGS 4L5QA 3AB9A 2O5IC 5FJ8H 2PW5A 3S1NH 4KKUA 4XQNA 1IZ6A 1YVCA 2EJFC 3BJUA 4GKKL 2MUYA 1S5BD 2UXCQ 1DOMA 1BVSA 1Y14B 3E9HA 2B29A 2ICIA 1H9SB 2WB1E 4RKBA 2X6LA 3BZDB 3CCJA 4F8MA 1A3VA 1FD7D 1I6HB 1DYQA 3DUZA 5IT9c 1STEA 3I55A 3QG1A 4CJ1B 2ZJRA 3OIQA 5EQ0A 4IURA 4IUVA 1E1TA 2KECA 2KCTA 4LF5L 2OEOA 5CR3A 2R7FA 4AQYQ 3DHQA 2R3ZA 4TRDA 2LMCB 5HGTA 4LF8Q 2YTYA 3PUVA 1JOKA 1NR2A 1U4LA 3K7AB 2WV6D 1YITA 2C35B 1ILPA 4JI8Q 4DAMA 4DV7L 4DR2L 1GO3E 4R4CA 1RKNA 2EOTA 3PF4A 5BN4A 1I4QA 4KLKA 3CU7A 5KYIA 1I3QB 3CCLA 1B9MA 1F2ZA 1X32A 3SEBA 2YU9H 2EYHA 5HGQA 4OIJA 3OW2A 3HOWB 2IHFA 4A3FH 5CV8A 4A3IG 1KRTA 3HKZB 2DJGC 2KCCA 3IFTA 3L9AX 4LMQD 1EQVA 5BN5A 2F03A 4PMWA 4ZKCB 5K5PA 3CCVA 2Z6KC 1QNKA 2JE6I 2AUKA 4DV1L 2D0OA 5IGDA 3J81i 3MAQA 2EYLA 1KAAA 1LUZA 2XVSA 4KY5A 3D4DA 2L55A 2E2JH 5C6AA 3H3VC 3EN2A 2XIWA 3CCEA 1B3AA 5IP7H 4JI7Q 4KN4C 4AQYL 1WTRA 5KGUA 2LXKA 3NEMA 3GTQH 2A68D 1JT8A 5CBAE 2EYOA 2IX3A 1VQKA 5M3MH 3NWTA 3N6RA 2HCIA 2ZM6L 4BBRB 3I4OA 1VQHA 4HSVA 2C5CA 1D6EC 4EQPA 5FLXc 4DK3C 1BKBA 3K5OA 5CYUA 1BF4A 2WFWA 1I50B 1I4XA 1DM0B 2PZUA 1TWHB 2ZT9C 1HA6A 1HFGA 5IYCG 2PNHA 1RHPA 5D3IB 1CZWA 1GXDC 1CKNB 2MPMA 2EPBA 1L0WA 4FXGC 1Q8IA 3ERQA 3OTOQ 4DV5Q 1IYVA 1KHIA 1VF5C 1YNNC 4MTKA 2ZJQA 2N78A 2VS1A 3JAME 4P75A 3S1RB 1MD2D 1XNRL 1UNSA 5C44H 3I73A 2PQEA 1W2BA 4GKJL 1N36Q 5JJLA 1XMQQ 1LV9A 2F0IA 1K9MC 4ABNA 4HCSA 4KI0A 1LACA 4JI4L 3TZUA 1UAPA 3LX0A 3SGIA 1BCPF 4J6HA 3C1FA 5JEAG 4K14A 3AEVA 3T4AC 2OTJA 1SNOA 2E8GA 2R6GA 1AH9A 4E6IA 4KJNA 5CV4A 2WAQB 2N3SA 3T16A 4JC0A 1QOHA 1IL2A 2NZOA 4A3EB 3S14B 4GNXC 1F9RA 4V0BA 2PO4A 1NTGA 4XTCS 4A3JB 2NVXH 3R2TA 4HEDA 1C48A 3VYUA 5M9OA 5DLQE 4F87A 1PZJD 1VCIA 5GAEC 1Q1BA 1W6KA 3G48A 4KV6A 5GQOA 2B2YC 2PZWA 4R9WA 1GUWA 4JI3L 1FNVA 2NVQH 4DV3Q 2NYZD 4C56C 3L3OC 1I4GA 5M5XH 4CDDC 5EPKA 1R4QB 1QB5D 1VQGA 4LJZC 5EAYA 1PHJA 3OYYA 2B2TC 3TMEA 2CW0C 1KD1C 4JYAQ 2MNAA 4C3HH 1KLGD 4GOPA 3QWNA 5M5XB 1ZEQX 2UU9Q 4RMFA 5BR8Q 1JICA 4X6AH 1G91A 2ZXPA 2A73B 3E9IA 3AQQA 2O2LD 3GTLH 1PXUA 3KBXA 1SMYD 2KBNA 3F2CA 1EWCA 3RZOB 3S2HH 2AQ3B 4IFDH 1DD2A 2Z8LA 3OPOA 2VUMB 3EROA 5IY0A 2D0PA 1QVCA 5K36H 5LL6S 2K5WA 1V1QA 2GVBA 1O7IA 3M3YH 2Q8IB 1YEZA 4HIMA 5J39A 4IPGA 2RF4A 3E3XA 1TWAB 2WIIB 1KC8C 4A75A 1YJNA 4X65L 1TS3A 5E4WC 4IJLA 2KQ3A 5K36G 2V4DA 4RFBA 1WTWA 1HZAA 1IBLL 2CCZA 1VQ9A 1XXGA 2E5LL 2C9OA 5G3LD 2G5DA 4F88A 2CWPA 1SE2A 4DF7A 1II3A 3HOYB 1PRTF 3P1HA 3OSOA 3FVQA 3GDEA 4CDEC 5GAHC 4JI4Q 4C1NK 3SR1A 2ASBA 1SE8A 2XN9C 2F0HA 3DEPA 5FJ8G 1F2LA 5C3WA 3CD6A 1EWIA 4QIWB 4FVMA 1CA5A 1VQOA 1EU4A 5ELNA 4NXNL 3V05A 5C4JH 3TDQA 4JVZA 1HRJA 1U4PA 5JVG3 3OWEB 3PQIA 4HCEA 5T1IA 3TS2A 3H91A 3A55A 3KDFA 2LXJA 4ZYSA 5KNBA 4DV6L 4NXML 1IBLQ 4GN5A 1JE5A 4A93G 3NBHA 1BCPC 4IO9A 1AZQA 4A76A 2ATWA 3F2BA 3Q23A 2YTVA 1VMCA 1PZKD 3PO2H 1G51A 1J6QA 1GHJA 1KDBA 3GTQB 3FMCA 2JJQA 1EIFA 2GVAA 2XWBB 2CH4W 2DNCA 3CRKC 3S16H 1IKMA 1S5DD 1N8RC 3GTKB 3IRBA 4A93H 1JJ2A 2Q8RE 2WKCA 1PRTD 1K73C 4MNOA 4QGUA 1SAPA 1QZGA 2F0QA 2RSNA 1V8QA 2RDGA 2L12A 1XJVA 5M5YH 3M4OH 4G7OC 2SNMA 2OF1A 4FDBA 2NZ1D 2R7ZH 1B44D 2JA5B 1IBKQ 1CTMA 1PH6A 1HHVA 3CKIB 4DAPA 4YHHQ 1PH4A 1VQPA 1VQ4A 3K80C 1RODA 4Y7NB 1SEBD 1HNXQ 5C4HA 4IFDI 3PO3H 3F2UA 1EY5A 3QR8A 3C46A 2IY5B 1GD7A 1BCPD 4R8IA 1X9NA 1F2MA 1OXTA 2KOLA 1HXYD 3NTIA 1LLRD 1STBA 3A56A 2JA6B 3C2PA 2PQAA 1TWGH 3Q0AA 5M5YB 5CV9A 3HG9A 2DN8A 3H3VH 4IUQA 1B9NA 4GZYC 2K5DA 3T56B 1JORA 3GTGH 1TR5A 2RCNA 3HKSA 5IODA 1LYLA 1LTSD 3L7ZC 3OMCA 5GAGC 3S2DB 2R93G 2BOSA 3BVMA 1JWMD 2QDBA 5I2XA 1PA6A 3HOVH 3G71A 3S16B 2F0PA 2JEBI 4PNYA 4DV7Q 4DR2Q 1AFPA 3RR5A 4LF5Q 3NTKA 2R92B 4XYQA 1FNUA 1TY0A 3HS0C 4O1NA 3KJPA 3QOJA 4XDXA 2J7ZA 3X3MA 3UE0A 2B2UA 2B2WC 1NCVA 3S1NB 3CC2A 4PMCA 3I4MB 1X3QA 1TKWB 2EZVA 2YYZA 2QF7A 4BS9A 3KF6B 2M9VA 2KCNA 2R61A 3H0GH 3BZCA 4JI0L 1CM9A 1E2ZA 4ZUIA 3S1RH 4A3GG 2ZTDA 2L5TA 3I70A 2BH2A 1E3PA 2UUBQ 1SYCA 1B50A 3K81C 3KFUA 3D3RA 2Z6BA 1JWUD 1NUCA 1EOTA 3FEWX 1BR9A 1EWHA 1KQSA 2D9UA 5CV6A 3T53B 4L5SA 5T1GA 3MVVA 3OMGA 1VQFA 4CKEA 3HOXB 1I4HA 5KEEA 2HDMA 1Q82C 1MI2A 4RGTA 1HUMA 4QUCA 1OXUA 4HN7A 5D3DA 2GN5A 2KENA 4QCLA 4H02A 5LMUQ 2JA8G 1B70B 3AFPA 4K6LA 3M9BA 2EYFA 3D0FA 1SXTA 4BBRH 5I9PA 4CJ0B 4B3TQ 1O7YA 2PI2A 2OT2A 4XQJA 2IX1A 4FF1A 2N8NA 4JI1L 4IALA 1PH2A 4OWTB 3PO2B 3FRPB 1YHQA 1Y1VH 2CKZB 4RHSA 4DV1Q 2ZXOA 3Q6SA 2TSSA 3NBIA 2EVBA 1PTOD 1NNXA 3DWPA 1A2UA 3Q8DA 4R4IA 1MIUA 3RMHA 3AYHB 1VQLA 5FK9C 1K8OA 3H0GG 2HHHQ 2H1EA 4FXKC 1SYEA 1U4MA 5C5MA 2NZHA 1HZCA 4A3MB 1EUJA 4JPBW 5JJIA 1H9SA 3BVZA 4GNXA 4X3SA 5C0XI 2FXQA 1SR3A 2Y0SG 4MTNA 4YWKA 2Z1CA 2HT1A 1Y1WH 2AWNA 3ZYYX 1E24A 3A5ZB 3N52A 1EZ6A 2BCOA 4IPCA 1OXSC 4LK1C 4DR4L 2MHVA 5E3FA 3RN5A 2CQOA 1QUQB 4ZQ3A 3PGZA 5ELFA 4GS3A 2VQFL 5ELOA 2QA4A 4B3SQ 4ZCKA 1HR0W 1B1ZA 5C4XH 2R92H 4JBJA 1A6XA 1QJOA 1HTPA 2IJ0A 4IZ8A 1YJ9A 4YY3Q 2L9HA 1PTOC 2QCPX 1XPOA 5FO7B 3J7A5 3HEJA 3PV0A 3IFDA 3CW2C 4K5XA 3I2ZA 1I5FA 1SNPA 4AH6A 1PH3A 2DGYA 2L4NA 1H9JA 2BE5C 4I7ZC 4GKKQ 3GTJH 1SYBA 4QF4A 2UXCL 1VS0A 4CDFC 1Y8NB 2WAQE 1D1IA 1D5XC 4FP5D 2ZTEA 1B53A 3DMUA 3M4YA 3J7YW 1SYFA 4OL7A 3CPWA 1PH9A 5IP9H 2F0VA 5E4XA 1Y1WG 4H7BA 2J4XA 2CHBD 4A3FG 2EXDA 3PUWA 3PO3B 4IFDJ 2RHQB 1JWSD 2EYMA 4JCVE 2R7ZG 2Q8TA 1UE1A 1MHWC 3HOZG 1XWEA 1V1PB 4DAYB 4LFAL 1IBMQ 1I94L 5JJZA 2LSSA 3J80L 1EIHA 3TBIB 2NTTA 3QOLA 1HNZL 5IGEA 2E2HH 4DA2A 2F0MA 3CPFA 2M2LA 3G6JB 1CSQA 2QEJC 1HZ9A 4BBSB 4OHJA 1LABA 2F0EA 2HIVA 4BXXH 4KK7A 4C3JB 3PSIA 2XSCA 1QVGA 1M1KC 4KKSA 4JI2Q 1WTPA 3BYYB 1D5ZC 1VF7A 4KD4A 4CHTB 2JA7H 4ZKBB 2Z4HA 4OO1H 2K50A 1NAPA 1SMYC 4LF6L 3TP6A 5IT9L 5CC4A 1LT5D 1D7QA 4BXXG 1HH2P 1CKNA 1ILQA 1W6JA 1SYGA 4L5TA 1PFNA 1X6OA 4NPSA 5LMNL 3CCMA 4LW1A 4YHHL 5M3FG 3TRZA 4A3LG 3S1QB 1AE3A 2PI2E 3MXNA 1WD1A 1ZYRD 1SROA 3M7NA 1EEID 4PG3A 1TWCB 2OXPA 1LTID 4JOIA 4A3MH 2LFNA 2MO1A 1VQBA 1EFWA 3HFZB 4L5RC 1GUOA 1TXYA 2YV5A 1SE3A 1SJED 4DPGA 4C3IB 1Q46A 4OWWB 3HOWH 4KHPL 1WOCA 2L1BA 4H13C 4XT1B 1PH5A 5IYDG 3HKZE 3M4OB 1LO5D 1VQEA 3K6OA 3SHLA 4RCNA 1YNND 4UP7A 5IYCH 4JG2A 1AEXA 2CW0D 1D1KA 3CRLC 2K7VA 3K7AH 1STNA 1MSGA 4X62Q 2QDLA 4MZ9A 1WTVA 5IYBG 1LTTD 5C0XG 3K5LA 1L2FA 5M3MB 2XTIA 2UXDL 1BQQT 5BN3A 1O78A 1HR0L 5AJ3Q 1HNZQ 2TMPA 1PFSA 5IWAL 1HZBA 1EYGA 1SMXA 5EBDA 4K8JA 4LFAQ 4M1UB 3RZOH 5IP7G 4AYBE 1EU3A 5G3LF 4BBSH 2UXBQ 1NE3A 1H9RA 2ICEC 2Q2HA 5DEHA 4J15A 1SSOA 2MGSA 4JV5L 4A3GH 1S40A 3QJYA 4AYBG 3I56A 1BOSA 3K5NA 2JN4A 2EJMA 4P71A 5C3EB 5DAUA 3NSWA 1K0SA 3J80i 3WWVA 3U9SA 4HTHA 1SLJA 2RA4A 3ULPA 1AZPA 2NVQB 3UDXA 2AQ1B 2LS01 1GVPA 1MSHA 4LFBL 1JB3A 2NVTH 2EYPA 2B2UC 4ZK9B 4F7XA 2G9HD 1M4VA 1KLUD 3HP3A 3M4QA 4DU9A 4JV5Q 1GOZA 3D8GA 1HNXL 3RZDB 1PFBA 5CGKA 1S4ZA 2N88A 1F9QA 2HDLA 3I72A 4A3DB 3MTSA 3FKIB 1YNJC 4DR4Q 1P16A 1OXVA 3BU2A 1UEAB 1CUKA 3I4NH 1ICFB 1S5FD 4APVA 1WCMB 3PIOA 2KHIA 1TWGB 4RGMA 1VQDA 5J1ZA 2JA6H 4DUYQ 4TKOB 4EQOA 2NVTB 2I07B 5C44G 1Q12A 3GTLB 3HOWG 4NMZA 2FINB 1JR0D 5IOCA 4DV3L 2QGQA 3EQLC 4JBKA 3KF8B 4UY8C 2F0KA 4UDUC 3W5OA 1V1OA 4Y7NH 4DR5Q 1EFID 1PV4A 4XT3B 1QE6A 1EY8A 3KDFB 4OIKA 2A19A 2JA5H 3PIPA 3SK5A 4OEMB 1WTOA 2PMZE 3D4WA 1SFOH 2OQKA 2QILA 4HJ7A 2IL8A 3MEFA 2JA6G 3J81E 2RQXA 2JQOA 1LTLA 1WJJA 3MFYA 3EA6A 5DM73 4LUOA 3E6ZX 1DZ1A 3SXHA 2R93B 4C2MB 3HGBA 1Q81C 1PFMA 3D6WA 4POGA 1B2TA 1L1OA 4DR3Q 1XMOQ 1XNQL 4MHEA 1Z9FA 5FKAC 5JOBA 4FF2A 3AU7A 3A54A 3UDFA 3U4VA 5NUCA 3AMUA 4LF9L 4ZRZA 5J22A 2JEAI 3I4MG 1JOQA 1VQNA 4LUVA 1UE6A 1BBUA 1STHA 4LF6Q 2L0CA 1EY0A 4DV4Q 3BDOA 5LHY1 2XGTA 1KTKA 1KIXA 3T51B 4P73A 4RWSC 1JC7A 4B9XA 4LF7L 5JEAJ 1E22A 4HSPA 4JI5L 4RGNA 5KRUA 4A3BG 1PLFA 3QO2A 3FHWA 1Y69U 3LWUA 2HUGA 5I6YA 1KDAA 1EQQA 2JA9A 4DGZA 5F2DA 1LTRD 1CHQD 1I50H 3FP9A 4EQNA 2EY2A 3KYHC 3CCRA 4IQZA 5H1SE 2EY1A 3I4MH 1H95A 3ER0A 3GV3A 5KNDA 2UU9L 1KNAA 4I65A 3KLWA 4IOCA 4DK0A 4LFCQ 3CQZH 3I4NB 1AW7A 1X3PA 2E5LQ 2VB3X 1GUNA 4BWGB 2KJXA 4OO1G 3M3YB 4A3DH 3ULLA 3MWYW 3CHBD 1A63A 4YCVA 2KHJA 2RDFA 4JW0A 4I7AA 3S24A 1HNWL 3TSSA 3PO2G 2Q2UA 1UE7A 1N32L 1KNEA 4TSSA 4B9WA 4X66L 4OXPA 2LKVA 1ASYA 3A5UA 4X66Q 1G8ZD 2DUDA 1ESFA 1N32Q 2FMMA 2VQEQ 5ELBA 1SNCA 1PH1A 1J9OA 4YIJA 3SDZA 1JMCA 4CJ2C 3NPPA 1B4OA 2OTLA 4H44C 1IBKL 2F4VL 5ISRA 1S3OA 4DNIA 3E0JA 3MA2B 5DNFA 2Y0SB 2I46A 2EY6A 4R4OA 1D2BA 3T1YL 3GTPB 1I3QH 1NMGA 1G2TA 2D5DA 5EJWA 4CKCA 2KHSA 4DV0Q 1A2TA 3U58A 2Q2TA 1BDOA 1I4RA 4R4TA 3LNNA 1YJWA 2SDFA 3MXUA 1WD0A 2K5VA 1YNJD 3UI2A 1XPUA 2F0FA 3JC66 2WB1B 3J81j 2BA1A 2PNRC 3GTKH 3NHHA 1TVXA 2BH8A 2H4OA 2E75C 3VR5A 1QNUA 4OX9Q 2E2DC 5KNCA 1B7YB 1CKMA 1Y8PB 4JI2L 3CC7A 2F4IA 1VQMA 2B63H 2KA7A 4YCWA 2A6HC 4H0LC 4PQXA 4YCUA 3GTMH 1X65A 1V9PA 1C4QA 4IOAA 4B3TL 2K75A 1CHPD 1XNQQ 2D62A 4GLVB 3SE0A 4GNXB 1Q86C 2RKSA 1Y8OB 2R7DA 1PTOH 5LMUL 1Y1WB 4J8QA 5E7NA 1XMQL 1DXMA 3F8TA 3LGJA 1HQRD 2RCFA 4DUZQ 2OCEA 4C3HG 1IYUA 2MQHA 3KOJA 2A6EC 4JI6Q 1Q7YC 2NN6I 3OW7A 4XYOA 2UUCQ 5FLXE 3SVMA 2SEBD 1ENFA 2A8VA 1AN8A 1IKLA 2WACA 1A62A 3E0EA 4HJ5A 3K0XA 1HJPA 3R3OA 3UDIA 5IGCA 4WFN3 3W2DA 4KHZA 4YWMA 5C4ZA 4A93B 4ZUJA 2J0TD 2A5HA 4JI0Q 2F0DA 4X65Q 2BDOA 1WTQA 2K5QA 4HIDA 1EIYB 3HOUB 2VY3A 1FJGQ 3CCUA 4X3TA 4FF3A 2JA7B 1D5MC 2VXWA 1YZ6A 4NDXA 1WVLA 2JXMB 2WP8J 2R93H 2PPBC 1TWFB 1K0RA 1QZHA 1LT3D 1PH8A 3K59A 3NWSA 2ID0A 4C3JH 3GO5A 2EIFA 3EBEA 1PMRA 1TU2B 4NP5A 2ZXRA 4TQUS 1J5EL 1SN8A 3TZDA 5JVH3 5M3FB 2E2HB 4DR7L 2ALYB 3OWFA 3JAMi 4QL5A 4DK6C 2JA5G 5DM63 3JAML 2CH4A 2IWHA 2CVRA 1EZ8A 3VR4A 1F77A 1YHBA 4IUUA 2K5HA 1BUVT 2EE1A 1HPCA 2K14A 4DAYA 4JYAL 1HUNA 3CXCA 3D6CA 2ZTCA 5A2QE 4GN3B 1Q3LA 4POFA 4FYDA 1C0AA 4G7HC 1PYWD 3S15B 1FJGL 1TWCH 5E1FA 4X62L 1XTDA 3ZJYC 2B63B 4Q5VA 1Y1VG 2F0NA 5CMDA 4JI3Q 1Q1EA 4QQBX 3HRZC 3NXWA 4A3LH 2GA4B 1SDFA 2B2WA 1HQMC 2HQLA 2I5HA 2NBFA 1G6PA 2B8GA 1OXXK 1F9SA 1FYCA 4BY1B 4JI1Q 5D14A 3RZDH 3LWEA 3HOVG 1STAA 2VUMH 3MXGA 1NBWA 2XRQD 1UEBA 3NP8A 2UXBL 2SNSA 4BY1H 3ONAB 2B39A 3F2DA 4G4KA 1QCBD 1VQ8A 1TIID 1HA5A 1G2SA 3G4SA 3KLSX 4LF7Q 2WKDA 4BY7B 5FLMH 2AKWB 2EYJA 4WJ4A 4LNQA 1BO0A 2LY7A 2SOBA 1EY6A 4A3GB 3HOZH 1EOVA 5C3EG 5IGBA 1OTCA 2L15A 1L1OC 2K04A 1F9PA 1AP0A 2E76C 5IP9G 1FL0A 1CQVA 1A0IA 3WOEA 4DFAA 4U68A 3PUZA 4QIWE 3GTJB 1R4PB 1FR3A 1W3SA 3RLOA 3HOXG 4NXNQ 4V190 1X3FA 4DR3L 1XMOL 1RDPD 2Q2IA 5JPMC 4WRDA 2F3VA 3B6YA 1SJHD 1LM0A 5C0XH 2JA8B 3J7AV 1ET6A 1QWYA 2F0LA 2L11A 4K0KQ 4A4IA 3FKIG 3I4LA 3IL8A 4UPAA 3KLSA 1K3RA 3NK9A 4IPDA 3VYTA 2Y0SE 4HMJA 1XPRA 1WCMG 4DV2L 5C4XB 1JOOA 1VQ5A 2NN6G 2A6HD 3HOUH 2A6ED 1CT1D 4K2LA 2YTXA 4EVOA 2A74C 5C44B 3ICEA 2AHOB 5I9OA 4RH6A 4C1NI 4QMGA 3RN2A 4ALPA 3VR2A 1FNWA 2EQSA 3I7FA 4G7ZC 1C9OA 4A3MG 2X69A 3A8KE 4DR6L 4HMIA 4MN3A 1SNDA 4A3IB 3VYRA 2IPKD 5ELDA 4P74A 1O7LA 1ZXTA 3S1MB 1ASZA 2M00A 3MXPA 1N33Q 1EQRA 3S17H 1PTOB 3GP7A 2B3GA 4X3KA 1FGUA 4DV2Q 4DXFA 1QG7A 4DR7Q 1K8MA 4KKTA 3HOYH 5EPLA 4GOPB 2QEXA 1STGA 3V2TA 2ENBA 5KIXA 1G6ZA 4PMBA 1YIJA 4ODGA 3DM3A 3VR6A 4ZAIA 1UE5A 1BNZA 1U0LA 1QILA 3H15A 1ENCA 3CP0A 1UUPA 5EKLA 2K6AA 4P2CB 2F1MA 3KF6A 4DN4M 3R8BA 4Z9CB 2JA8H 4ME3A 2F0WA 1X54A 4OO1I 2I5LX 2F0UA 4IFDG 1TS4A 3I91A 3STBC 5M5WH 2K52A 1YBYA 3F1ZA 2B2TA 1CKOA 3URYA 3K5MA 5C5LA 1I6HH 1RIPA 1EIGA 4DV6Q 4NXMQ 2AUJD 2B2VC 4QB4A 4S3SA 4EGVA 1ESRA 1IHZA 4HIKA 4A3FB 1TS5A 5EKKA 3VA7A 4KMUC 5EPJA 1EYDA 2UUCL 1MKHA 1SYDA 5EBCA 5C3XA 1CZGA 2B2YA 3WOFA 2YU9B 3HOZB 4A3BB 5A35A 2VQFQ 4K0KL 1Q90A 1GUSA 2K03A 5A2QL 5COYA 3NQIA 2BE5D 1NR4A 1NJIC 2NN6H 5IWAQ 1U9RA 4FNFA 2IW3A 3A7AB 3ND9A 4GKJQ 4BBSG 2D2CC 1HR0Q 4C3JG 4B3ML 3VDYA 3I4NG 4IUTA 1LTAD 2N55A 2K1BA 4RCOA 1IL8A 1I6VC 2WAQG 4RKLA 3CAMA 3P75A 3H09A 3NUCA 3TP5A 4A3EG 4CKBA 3D4RA 3VR3A 2ZJPA 3C3LA 4A3JH 1PDQA 2NVXB 4JBMA 1KL9A 3BZKA 2F0JA 3W1BA 2PMZB 4EQ5A 2F0SA 4DR5L 2NTSA 3S2DH 2Z9HA 5IYBH 2B8FA 4A3KG 1PH7A 3GTPH 1E1OA 2HQEA 2K01A 3J7ZC 2EXZA 5JEAH 4CBVA 1SNQA 1XX8A 1N34Q 3IAYA 1B3QA 4ME5A 3Q22A 4KY6A 3T1HL 3J80c 5C4JB 3CCSA 4PZ6A 2EY5A 1GJXA 4KTAA 3R2IA 4N8FA 5FLXL 1QUQA 3T1YQ 3PUYA 4A3IH 3J7AF 3G7LA 4C3IG 2DNEA 2PW7A 1K3BC 4HJ8A 2BDNA 1X3EA 3IKJA 4NW2A 3RNUA 1CK1A 1E2VA 1GUGA 2K33A 3CCQA 2K5NA 3EVQA 3STBD 1PZID 3O13A 4HJAA 1ET9A 5HY6A 2VUMG 1T9HA 2CQAA 2I0QA 4MIUA 1K83B 3M7GA 1CI3M 3GD7A 1PRTC 4A3CG 4FXDA 2K32A 3BDLA 1ICWA 3TS0A 4A3CH 2KUMA 5M3MG 2RVLA 4K2KA 4LF4L 1TWAH 3DEOA 4RG1A 2PQAB 1IXRA 1RTNA 1B8AA 1K83H 1HNWQ 5GADC 4OONA 4LWCA 4UP8A 4DNRB 1IYJB 1TT2A 3H3VI 3TQYA 1IBML 3EJIA 4LFCL 4JI6L 4K5VA 1RJTA 2UUAL 5IYDH 5ELEA 1CQFA 4B08A 1IW7C 4LF8L 1VQ6A 4C3IH 3UDGA 1SBBB 3GTOH 3QIAA 4J1MA 3A8IE 3S1MH 4KD3A 3K7UC 4AYBB 1MJEA 5LMNW 2JP1A 2Z4IA 3DLLA 4L63B 1HTLD 2CWAA 2VZAA 4X3UA 4K8IA 4GN4B 2HD3A 2IT1A 1K8GA 2E2IB 2DY7A 3W1GA 4JI5Q 3GTOB 1XYIA 4GOPC 4DR1Q 1NY4A 1VQIA 4A3KH 5C0XJ 3AFQA 3GQBA 3H6MA 1S5CD 4DV4L 4ZLTF 3NQTA 5JAVA 2Z0SA 3GTMB 1DOLA 3KK7A 4IUPA 1QVFA 2FHTA 1A15A 2H5XA 2QKIC 3I8ZA 1C7YA 3C1EA 1PYBA 1DGSA 3BG3A 4RGOS 3X3NA 1X55A 4C2MH 3RD4A 1SRUA 1M90C 1M8AA 2JA7G 4A3DG 2A69C 4R1JA 3MXNB 3WDNA 1J8IA 3DXJC 5EKIA 4KN7C 1OO9B 5L37A 3FKIH 3BVGA 1RL2A 3HZXA 3A74A 3V96A 3R93A 1SFOB 2O5JC 5FOBB 4GLXA 4X64Q 3PF5A 2NUCA 1EYCA 4OWXB 1VQJA 1RD9D 4RHRA 5CBEE 3BYTB 3G6EA 4ILWA 5J3BA 4WJ3M 4JK1C 3I3CA 1EY7A 1JQYD 5IGGA 4A3BH 1G291 3ULJA 4O0AA 4OX9L 1ML0D 2A68C 4UHVA 1E0BA 1KAWA 3PIP3 3VYSA 3HKZG 2OWOA 3CC4A 4WORA 1EY9A 2F3IA 1F2YA 5C3EH 3P7JA 1YNXA 1LTBD 5I4DA 5IE8A 2XNAC 4BY7H 2G9DA 2B63G 2VW9A 2I5MX 1ENAA 1EL0A 1P8LA 3NE5B 4ID6A 1XTCD 5EGTA 4U673 2AMCB 3D31A 3DM1A 1WYDA 4PV1C 4DV0L 4QY7A 1O80A 3MC0B 3MFGA 1PRTB 3TN2A 4X64L 1EEFD 1D8LA 1GM5A 2K28A 1L0XB 3VA5A 3NELA 1LT4D 2HIXA 2PZTA 4QUFA 5IIFA 3HOVB 4P72A 4NB3A 4BBRG 2PCFB 1ONLA 2F4VQ 1J5EQ 3GTGB 4L6TB 3CQZB 3SK6A 1KRSA 1ZYRC 1TQOA 1MJCA 2UUBL 3K57A 3PIO3 2XWJB 4LUZA 5HURA 4LF4Q 1GHKA 3J81L 1FVIA 1HFNA 4CGYB 1SE4A 4HIOA 4RAUC 2A1AA 1EQTA 1UWVA 2KEDA 3MEHA 2MP1A 3PMFA 2IHEA 4LF9Q 2O4XA 4KJOA 1I4PA 1BBXC 4YY3L 2BA0A 2NVYB 1NSNS 5CV5A 4B3SL 2PYKA 1TWHH 4IJHA 1RCVD 1VQCA 1X56A 3FPUB 1IW7D 1V1PA 3EFXD 5BR8L 3CF5A 1N36L 1C8CA 2DY8A 2F0GA 4JOIC 4A3JG 2AWOA 3I90A 1EY4A 2Z6KA 1KXLA 3OTOL 4DV5L 3ITPA 3SK4A 5LL6X 5C4XG 3K8AA 2F3WA 2UXDQ 3ERSX 2V1CC 2NVYH 2XRSD 5AFWA 4G57A 1NMFA 3E5SA 4BA2I 4TVAB 2E2JB 1R9TH 3FDTA 3QB3A 4K6DA 3S9WA 1Z7TA 3U4ZA 2QW7A 1LTGD 3TP8A 1A8VA 3H0GB 1RTOA 4BA1I 1BCPB 2IX0A 3KBGA 5FLMG 3ND8A 1E7ZA 1L0YB 1DJRD 4PZ8A 1S5ED 4UP9A 2RDHA 1O7ZA 3U50C 4KHPQ 1T5EA 5GROA 3J81c 3S1QH 1JJCB 3PCOB 3KJOA 1KABA 2JSOA 3T13A 5D65A 4HJ9A 2ES2A 4RA8A 3TREA 2RSOA 3U9OA 3BDCA 3OIPA 4EX5A 4IUNA 3OHXC 2EDGA 2VB2X 3A7LA 1N34L 4QJFA 1GKHA 1WTHA 5CORA 1WTXA
chains in the Genus database with same CATH topology
2AHOB 3GDEA 2JK8A 1S72A 3RN2A 5GAHC 4ALPA 4JI4Q 2ASBA 5LMNQ 3M4QA 1SE8A 2EQSA 3I7FA 4A3MG 1C9OA 1HNXL 4DR6L 4JV5Q 3CMEA 5FJ8G 2RHSB 4A3EH 3CD6A 1EWIA 3NBHB 2VQEL 4IPHA 1VQOA 2WB1G 2F52A 5ELNA 2K4KA 1P16A 1OXVA 3BU2A 4P74A 4DR4Q 4NXNL 2CFMA 1CUKA 5C4JH 1ASZA 3JAMc 1N33Q 3I4NH 1EQRA 4APVA 4AIMA 3L0OA 3PIOA 4DR1L 2KHIA 3TS2A 1VQDA 3KDFA 3S17H 2LXJA 2JA6H 4DUYQ 4B3MQ 2VNUD 3RLFA 2B3GA 4DV6L 4NXML 1FGUA 4DV2Q 3M4PA 1IBLQ 4DR7Q 1YI2A 5C44G 4GN5A 3HOYH 3HOYG 1Q12A 4GOPB 1JE5A 2QEXA 3HOWG 4A93G 4IO9A 4A76A 3S15H 2ATWA 1YIJA 3F2BA 3DM3A 2YTVA 1Z47A 1UE5A 2ZM6Q 1I94Q 4DV3L 3PO2H 2QGQA 1G51A 1J6QA 4JBKA 3KF8B 1U0LA 1EIFA 2JJQA 2GVAA 3W5OA 3H15A 4UY8C 4Y7NH 4DR5Q 1JJGA 1PV4A 1VQAA 3CP0A 3KDFB 3PO3G 3S16H 1N8RC 3IRBA 4A93H 2A19A 2JA5H 4PZ7A 4JI7L 1JJ2A 3KF6A 3PIPA 2PMZE 1K73C 1SFOH 5JJKA 2OQKA 4HJ7A 2UUAQ 3MEFA 2JA6G 2JA8H 4ME3A 4MNOA 4QGUA 5M3FH 1X54A 1QZGA 4OO1I 2I5LX 2JQOA 1LTLA 4GLAC 4IFDG 1WJJA 1XJVA 3M4OH 3STBC 5M5YH 1K8AC 1N33L 5M5WH 4FDBA 4LFBQ 2R7ZH 2K52A 3F1ZA 1CSPA 1YBYA 1CKOA 1BBWA 4LUOA 5AJ3L 1IBKQ 1I6HH 1RIPA 1PH6A 4DV6Q 3L2PA 4NXMQ 4YHHQ 1PH4A 1VQPA 1VQ4A 3HOUG 3K80C 1Q81C 4HIKA 1YHAA 3A0JA 1HNXQ 4DR6Q 4IFDI 3PO3H 4POGA 3S14H 2VL6A 1L1OA 2UUCL 1MKHA 2MFIA 2IY5B 1X3GA 1GD7A 1X9NA 4O2DA 1OXTA 4DR3Q 1XMOQ 1Q8KA 1XNQL 1Z9FA 2VQFQ 4K0KL 1VQ7A 3UDFA 1NJIC 5IWAQ 2PQAA 2KCMA 3U4VA 1TWGH 4LF9L 2OQ0A 2E2IH 2JEAI 3I4MG 4JI8L 3H3VH 1VQNA 4GKJQ 4LUVA 4Y52H 1UE6A 1BBUA 4BBSG 3HOXH 1HR0Q 4LF6Q 3GTGH 2RCNA 4B3ML 3VDYA 3HKSA 3I4NG 1LYLA 3L7ZC 3PUXA 3UE1A 5GAGC 4DV4Q 2XGTA 4DKAC 2R93G 3T1HQ 2WAQG 1PA6A 3CAMA 3HOVH 3G71A 1KIXA 4P73A 4DV7Q 2JEBI 4DR2Q 5JEAJ 4A3EG 4LF7L 1E22A 2ZJPA 4A3JH 4JBMA 4JBWA 1KL9A 3BZKA 3W1BA 4JI5L 3RR5A 4LF5Q 4A3BG 4B3SQ 4EQ5A 4DR5L 3FHWA 3S2DH 5IYBH 4A3KG 3KJPA 1EQQA 1PH7A 3GTPH 1E1OA 2JA9A 4R4QA 3J7ZC 4GNXA 3UE0A 3FP9A 1I50H 4YWLA 2HHHL 3TEHB 3CC2A 3KYHC 1N34Q 3CCRA 1H95A 5H1SE 2MO0A 3I4MH 1WCMH 3ER0A 2UU9L 1TWFH 2YYZA 3EIVA 1AE2A 3KLWA 4IOCA 4LFCQ 3CQZH 3KF6B 3RLNA 3J80c 3CCSA 4PZ6A 3T1HL 1WI5A 2E5LQ 4BY1G 3NENA 4OO1G 3H0GH 1PYSB 4A3DH 1WFQA 3ULLA 3BZCA 1QUQA 4JI0L 3T1YQ 3PUYA 4A3IH 3S1RH 4A3GG 1A63A 4YCVA 2KHJA 4HJ8A 2ZTDA 3S24A 1X3EA 1HNWL 2BH2A 4DUYL 3RNUA 2R92G 1E3PA 3PO2G 2UUBQ 2Q2UA 4DUZL 1UE7A 4B3RL 1N32L 3K81C 3CMAA 3KFUA 3CCQA 1JB7A 4X66L 4OXPA 1ASYA 2K5NA 1U5KA 4X66Q 3A5UA 1KQSA 2DUDA 4L5SA 1PVOA 4B3RQ 3STBD 2N49A 1N32Q 1VQFA 2VQEQ 1XNRQ 4HJAA 1L1OB 5HY6A 3M85A 2VUMG 1T9HA 2I0QA 1Q82C 1PH1A 4BY7G 1V43A 1OXUA 1JMCA 3GD7A 2GN5A 4A3CG 2KENA 1N9WA 4H02A 5LMUQ 3TS0A 1B70B 3AFPA 2JA8G 4XIGS 5M3MG 4A3CH 2OTLA 4L5QA 3M9BA 1IBKL 3D0FA 4LF4L 1TWAH 2F4VL 4RG1A 2PQAB 1S3OA 1IXRA 4BBRH 5FJ8H 4DNIA 1B8AA 4B3TQ 3S1NH 1K83H 1HNWQ 2PI2A 1IZ6A 1YVCA 2IX1A 5GADC 4OONA 2N8NA 3BJUA 4R4OA 4JI1L 4LWCA 4UP8A 1PH2A 4GKKL 2UXCQ 4OWTB 3T1YL 1IYJB 1YHQA 1BVSA 1Y14B 1Y1VH 2CKZB 3E9HA 4DV1Q 2B29A 2WB1E 1I3QH 3H3VI 1NMGA 3TQYA 1IBML 4LFCL 3CCJA 4JI6L 2UUAL 5IYDH 4DV0Q 3Q8DA 4LF8L 4R4IA 1MIUA 5IT9c 1VQ6A 4C3IH 3UDGA 3I55A 3U58A 3AYHB 2Q2TA 2ZJRA 1VQLA 3GTOH 3H0GG 1E1TA 2HHHQ 3S1MH 3K7UC 1MJEA 4R4TA 5LMNW 2KCTA 4LF5L 1YJWA 2NZHA 1HZCA 1EUJA 3DLLA 2K5VA 5JJIA 2R7FA 4AQYQ 1XPUA 2CWAA 2VZAA 4LF8Q 4GN4B 2YTYA 2IT1A 3JC66 3PUVA 2BA1A 3W1GA 5C0XI 2FXQA 1SR3A 3J81j 1K8GA 2BH8A 4JI5Q 2Y0SG 4MTNA 3GTKH 4YWKA 2HT1A 1YITA 2C35B 1Y1WH 4GOPC 2AWNA 4JI8Q 4DAMA 4DV7L 1NY4A 1E24A 1GO3E 1VQIA 4DR1Q 4DR2L 3A5ZB 4A3KH 4JI2L 1B7YB 1CKMA 3AFQA 4R4CA 4IPCA 5C0XJ 3CC7A 3PF4A 1OXSC 1VQMA 4OX9Q 2B63H 4KLKA 4YCWA 4YCUA 4DV4L 3CCLA 3GTMH 4DR4L 1X65A 2Z0SA 3RN5A 2YU9H 1V9PA 2CQOA 1QUQB 5HGQA 4IOAA 4B3TL 1QVFA 3PGZA 4LFBL 4GS3A 2VQFL 2K75A 1XNQQ 5ELOA 2D62A 2QA4A 2H5XA 3OW2A 1HR0W 2IHFA 4GLVB 5C4XH 4JBJA 4GNXB 1Q86C 1PYBA 1C7YA 1DGSA 4A3FH 2R7DA 1YJ9A 4YY3Q 5LMUL 1X55A 4C2MH 1SRUA 4A3IG 1M90C 5E7NA 1XMQL 3LGJA 3F8TA 1KRTA 4A3DG 2JA7G 4R1JA 3MXNB 4DUZQ 1XPOA 3J7A5 2OCEA 2MQHA 3FKIH 3PV0A 3KOJA 1RL2A 4PMWA 3CCVA 4JI6Q 1Q7YC 2NN6I 3CW2C 2UUCQ 2Z6KC 3I2ZA 1I5FA 2JE6I 3A74A 2A8VA 4AH6A 3E0EA 1A62A 2DGYA 2D0OA 4DV1L 3J81i 1PH3A 4HJ5A 4GLXA 4X64Q 3K0XA 3PF5A 1LUZA 1HJPA 4OWXB 3GTJH 2E2JH 4GKKQ 2UXCL 1VS0A 3UDIA 1VQJA 3EN2A 4KHZA 4YWMA 2WAQE 3CCEA 2ZTEA 3G6EA 5IP7H 5J3BA 4WJ3M 4JI7Q 4AQYL 4JI0Q 4A3BH 2LXKA 3NEMA 1G291 3ULJA 4X65Q 3CPWA 1PH9A 1EIYB 4HIDA 4O0AA 4OX9L 3GTQH 1JT8A 5IP9H 1Y1WG 4A3FG 2VY3A 2EXDA 3PUWA 1FJGQ 1KAWA 3CCUA 4IFDJ 1VQKA 3HKZG 2OWOA 2RHQB 5M3MH 3CC4A 4JCVE 2ZM6L 1YZ6A 3I4OA 2F3IA 1UE1A 2R7ZG 1VQHA 5C3EH 2WP8J 2R93H 3HOZG 1YNXA 1K0RA 1QZHA 4DAYB 5IE8A 4LFAL 5FLXc 1PH8A 4C3JH 2ID0A 1IBMQ 4BY7H 1I94L 3GO5A 2B63G 2EIFA 4DK3C 3EBEA 1BKBA 2LSSA 2VW9A 2I5MX 4TQUS 1P8LA 1J5EL 2WFWA 1HNZL 1SN8A 2E2HH 3CPFA 3D31A 2AMCB 1WYDA 4DR7L 2ALYB 5IYCG 2JA5G 2PNHA 4QL5A 1CSQA 4DK6C 3JAMi 4QY7A 4DV0L 1HZ9A 1CKNB 2HIVA 4X64L 4BXXH 1YHBA 3PSIA 2K5HA 1QVGA 1M1KC 1L0WA 2K14A 4JI2Q 4JYAL 1D8LA 1GM5A 3OTOQ 3CXCA 4DV5Q 2ZTCA 1KHIA 4GN3B 3NELA 2JA7H 2HIXA 2ZJQA 2N78A 2VS1A 2K50A 4P75A 4LF6L 4P72A 4POFA 4NB3A 4BBRG 5C44H 1XNRL 1W2BA 4GKJL 1C0AA 5JJLA 1N36Q 2F4VQ 1J5EQ 1XMQQ 1FJGL 1K9MC 1D7QA 4BXXG 1TWCH 4X62L 4KI0A 1HH2P 4JI4L 1CKNA 1XTDA 3ZJYC 4L5TA 3SGIA 1Y1VG 1KRSA 4JI3Q 1Q1EA 1X6OA 4NPSA 5JEAG 5LMNL 1MJCA 2UUBL 3AEVA 3CCMA 4QQBX 4LW1A 4YHHL 5M3FG 2OTJA 3TRZA 2E8GA 2R6GA 4A3LG 4A3LH 1AH9A 1AE3A 2PI2E 1SROA 3M7NA 4LUZA 4PG3A 4LF4Q 2N3SA 4JOIA 2HQLA 2I5HA 4A3MH 2MO1A 1FVIA 4JC0A 1IL2A 2NZOA 1G6PA 4HIOA 1OXXK 1VQBA 1EFWA 4GNXC 3HFZB 4JI1Q 3RZDH 4L5RC 1TXYA 2YV5A 3HOVG 1NTGA 4XTCS 2A1AA 2NVXH 4DPGA 2VUMH 1NBWA 1UWVA 1UEBA 5DLQE 1Q46A 4OWWB 1VCIA 2IHEA 5GAEC 1Q1BA 4LF9Q 3HOWH 3G48A 4BY1H 1WOCA 5GQOA 4KHPL 2UXBL 4YY3L 2BA0A 1PH5A 5IYDG 4JI3L 3HKZE 2NVQH 3F2DA 1VQEA 4B3SL 4DV3Q 1VQ8A 1TWHH 4IJHA 1VQCA 4UP7A 5IYCH 5M5XH 1X56A 4JG2A 3G4SA 1VQGA 4LF7Q 5EAYA 1PHJA 3K7AH 3OYYA 1KD1C 5FLMH 2AKWB 4X62Q 5BR8L 4JYAQ 4WJ4A 4MZ9A 4LNQA 3CF5A 1N36L 5IYBG 2MNAA 4C3HH 5C0XG 1L2FA 4GOPA 2XTIA 2UU9Q 2UXDL 4RMFA 5BR8Q 3HOZH 4X6AH 1EOVA 5C3EG 1HR0L 4JOIC 4A3JG 1OTCA 2AWOA 2L15A 2Z6KA 1L1OC 5AJ3Q 1KXLA 3OTOL 4DV5L 3E9IA 1HNZQ 3AQQA 1PFSA 5C4XG 3K8AA 2UXDQ 3GTLH 3ERSX 2V1CC 2NVYH 2R92H 2KBNA 5IP9G 1HZBA 1FL0A 5IWAL 3F2CA 1SMXA 1EYGA 4LFAQ 1A0IA 1NMFA 3RZOH 4TVAB 4BA2I 3PUZA 4QIWE 5IP7G 1R9TH 3S2HH 4AYBE 1W3SA 3RLOA 3HOXG 4BBSH 2UXBQ 1NE3A 4NXNQ 3U4ZA 1X3FA 4DR3L 1XMOL 2Q2IA 5IY0A 2D0PA 1QVCA 2Q2HA 3B6YA 1V1QA 1LM0A 2GVBA 1O7IA 1A8VA 4J15A 3M3YH 4BA1I 4JV5L 2IX0A 4A3GH 1YEZA 4HIMA 5FLMG 1S40A 1E7ZA 4AYBG 3I56A 2RF4A 4IPGA 4PZ8A 4UP9A 4K0KQ 4KHPQ 3U50C 1KC8C 4A4IA 4A75A 3FKIG 5GROA 4P71A 1JJCB 4X65L 3J81c 1YJNA 4IJLA 3S1QH 3PCOB 3KJOA 4UPAA 3J80i 1K3RA 4HJ9A 3WWVA 4IPDA 2ES2A 5K36G 2Y0SE 1IBLL 1XPRA 1HZAA 1WCMG 4DV2L 1SLJA 3TREA 1VQ9A 2CCZA 1VQ5A 2E5LL 2NN6G 3ULPA 3HOUH 4EX5A 2YTXA 2CWPA 3UDXA 3ICEA 1GVPA 4QJFA 1GKHA 1N34L 2NVTH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHO B;  3GDE A;  2JK8 A;  1S72 A;  3RN2 A;  5GAH C;  4ALP A;  4JI4 Q;  2ASB A;  5LMN Q;  3M4Q A;  1SE8 A;  2EQS A;  3I7F A;  4A3M G;  1C9O A;  1HNX L;  4DR6 L;  4JV5 Q;  3CME A;  5FJ8 G;  2RHS B;  4A3E H;  3CD6 A;  1EWI A;  3NBH B;  2VQE L;  4IPH A;  1VQO A;  2WB1 G;  2F52 A;  5ELN A;  2K4K A;  1P16 A;  1OXV A;  3BU2 A;  4P74 A;  4DR4 Q;  4NXN L;  2CFM A;  1CUK A;  5C4J H;  1ASZ A;  3JAM c;  1N33 Q;  3I4N H;  1EQR A;  4APV A;  4AIM A;  3L0O A;  3PIO A;  4DR1 L;  2KHI A;  3TS2 A;  1VQD A;  3KDF A;  3S17 H;  2LXJ A;  2JA6 H;  4DUY Q;  4B3M Q;  2VNU D;  3RLF A;  2B3G A;  4DV6 L;  4NXM L;  1FGU A;  4DV2 Q;  3M4P A;  1IBL Q;  4DR7 Q;  1YI2 A;  5C44 G;  4GN5 A;  3HOY H;  3HOY G;  1Q12 A;  4GOP B;  1JE5 A;  2QEX A;  3HOW G;  4A93 G;  4IO9 A;  4A76 A;  3S15 H;  2ATW A;  1YIJ A;  3F2B A;  3DM3 A;  2YTV A;  1Z47 A;  1UE5 A;  2ZM6 Q;  1I94 Q;  4DV3 L;  3PO2 H;  2QGQ A;  1G51 A;  1J6Q A;  4JBK A;  3KF8 B;  1U0L A;  1EIF A;  2JJQ A;  2GVA A;  3W5O A;  3H15 A;  4UY8 C;  4Y7N H;  4DR5 Q;  1JJG A;  1PV4 A;  1VQA A;  3CP0 A;  3KDF B;  3PO3 G;  3S16 H;  1N8R C;  3IRB A;  4A93 H;  2A19 A;  2JA5 H;  4PZ7 A;  4JI7 L;  1JJ2 A;  3KF6 A;  3PIP A;  2PMZ E;  1K73 C;  1SFO H;  5JJK A;  2OQK A;  4HJ7 A;  2UUA Q;  3MEF A;  2JA6 G;  2JA8 H;  4ME3 A;  4MNO A;  4QGU A;  5M3F H;  1X54 A;  1QZG A;  4OO1 I;  2I5L X;  2JQO A;  1LTL A;  4GLA C;  4IFD G;  1WJJ A;  1XJV A;  3M4O H;  3STB C;  5M5Y H;  1K8A C;  1N33 L;  5M5W H;  4FDB A;  4LFB Q;  2R7Z H;  2K52 A;  3F1Z A;  1CSP A;  1YBY A;  1CKO A;  1BBW A;  4LUO A;  5AJ3 L;  1IBK Q;  1I6H H;  1RIP A;  1PH6 A;  4DV6 Q;  3L2P A;  4NXM Q;  4YHH Q;  1PH4 A;  1VQP A;  1VQ4 A;  3HOU G;  3K80 C;  1Q81 C;  4HIK A;  1YHA A;  3A0J A;  1HNX Q;  4DR6 Q;  4IFD I;  3PO3 H;  4POG A;  3S14 H;  2VL6 A;  1L1O A;  2UUC L;  1MKH A;  2MFI A;  2IY5 B;  1X3G A;  1GD7 A;  1X9N A;  4O2D A;  1OXT A;  4DR3 Q;  1XMO Q;  1Q8K A;  1XNQ L;  1Z9F A;  2VQF Q;  4K0K L;  1VQ7 A;  3UDF A;  1NJI C;  5IWA Q;  2PQA A;  2KCM A;  3U4V A;  1TWG H;  4LF9 L;  2OQ0 A;  2E2I H;  2JEA I;  3I4M G;  4JI8 L;  3H3V H;  1VQN A;  4GKJ Q;  4LUV A;  4Y52 H;  1UE6 A;  1BBU A;  4BBS G;  3HOX H;  1HR0 Q;  4LF6 Q;  3GTG H;  2RCN A;  4B3M L;  3VDY A;  3HKS A;  3I4N G;  1LYL A;  3L7Z C;  3PUX A;  3UE1 A;  5GAG C;  4DV4 Q;  2XGT A;  4DKA C;  2R93 G;  3T1H Q;  2WAQ G;  1PA6 A;  3CAM A;  3HOV H;  3G71 A;  1KIX A;  4P73 A;  4DV7 Q;  2JEB I;  4DR2 Q;  5JEA J;  4A3E G;  4LF7 L;  1E22 A;  2ZJP A;  4A3J H;  4JBM A;  4JBW A;  1KL9 A;  3BZK A;  3W1B A;  4JI5 L;  3RR5 A;  4LF5 Q;  4A3B G;  4B3S Q;  4EQ5 A;  4DR5 L;  3FHW A;  3S2D H;  5IYB H;  4A3K G;  3KJP A;  1EQQ A;  1PH7 A;  3GTP H;  1E1O A;  2JA9 A;  4R4Q A;  3J7Z C;  4GNX A;  3UE0 A;  3FP9 A;  1I50 H;  4YWL A;  2HHH L;  3TEH B;  3CC2 A;  3KYH C;  1N34 Q;  3CCR A;  1H95 A;  5H1S E;  2MO0 A;  3I4M H;  1WCM H;  3ER0 A;  2UU9 L;  1TWF H;  2YYZ A;  3EIV A;  1AE2 A;  3KLW A;  4IOC A;  4LFC Q;  3CQZ H;  3KF6 B;  3RLN A;  3J80 c;  3CCS A;  4PZ6 A;  3T1H L;  1WI5 A;  2E5L Q;  4BY1 G;  3NEN A;  4OO1 G;  3H0G H;  1PYS B;  4A3D H;  1WFQ A;  3ULL A;  3BZC A;  1QUQ A;  4JI0 L;  3T1Y Q;  3PUY A;  4A3I H;  3S1R H;  4A3G G;  1A63 A;  4YCV A;  2KHJ A;  4HJ8 A;  2ZTD A;  3S24 A;  1X3E A;  1HNW L;  2BH2 A;  4DUY L;  3RNU A;  2R92 G;  1E3P A;  3PO2 G;  2UUB Q;  2Q2U A;  4DUZ L;  1UE7 A;  4B3R L;  1N32 L;  3K81 C;  3CMA A;  3KFU A;  3CCQ A;  1JB7 A;  4X66 L;  4OXP A;  1ASY A;  2K5N A;  1U5K A;  4X66 Q;  3A5U A;  1KQS A;  2DUD A;  4L5S A;  1PVO A;  4B3R Q;  3STB D;  2N49 A;  1N32 Q;  1VQF A;  2VQE Q;  1XNR Q;  4HJA A;  1L1O B;  5HY6 A;  3M85 A;  2VUM G;  1T9H A;  2I0Q A;  1Q82 C;  1PH1 A;  4BY7 G;  1V43 A;  1OXU A;  1JMC A;  3GD7 A;  2GN5 A;  4A3C G;  2KEN A;  1N9W A;  4H02 A;  5LMU Q;  3TS0 A;  1B70 B;  3AFP A;  2JA8 G;  4XIG S;  5M3M G;  4A3C H;  2OTL A;  4L5Q A;  3M9B A;  1IBK L;  3D0F A;  4LF4 L;  1TWA H;  2F4V L;  4RG1 A;  2PQA B;  1S3O A;  1IXR A;  4BBR H;  5FJ8 H;  4DNI A;  1B8A A;  4B3T Q;  3S1N H;  1K83 H;  1HNW Q;  2PI2 A;  1IZ6 A;  1YVC A;  2IX1 A;  5GAD C;  4OON A;  2N8N A;  3BJU A;  4R4O A;  4JI1 L;  4LWC A;  4UP8 A;  1PH2 A;  4GKK L;  2UXC Q;  4OWT B;  3T1Y L;  1IYJ B;  1YHQ A;  1BVS A;  1Y14 B;  1Y1V H;  2CKZ B;  3E9H A;  4DV1 Q;  2B29 A;  2WB1 E;  1I3Q H;  3H3V I;  1NMG A;  3TQY A;  1IBM L;  4LFC L;  3CCJ A;  4JI6 L;  2UUA L;  5IYD H;  4DV0 Q;  3Q8D A;  4LF8 L;  4R4I A;  1MIU A;  5IT9 c;  1VQ6 A;  4C3I H;  3UDG A;  3I55 A;  3U58 A;  3AYH B;  2Q2T A;  2ZJR A;  1VQL A;  3GTO H;  3H0G G;  1E1T A;  2HHH Q;  3S1M H;  3K7U C;  1MJE A;  4R4T A;  5LMN W;  2KCT A;  4LF5 L;  1YJW A;  2NZH A;  1HZC A;  1EUJ A;  3DLL A;  2K5V A;  5JJI A;  2R7F A;  4AQY Q;  1XPU A;  2CWA A;  2VZA A;  4LF8 Q;  4GN4 B;  2YTY A;  2IT1 A;  3JC6 6;  3PUV A;  2BA1 A;  3W1G A;  5C0X I;  2FXQ A;  1SR3 A;  3J81 j;  1K8G A;  2BH8 A;  4JI5 Q;  2Y0S G;  4MTN A;  3GTK H;  4YWK A;  2HT1 A;  1YIT A;  2C35 B;  1Y1W H;  4GOP C;  2AWN A;  4JI8 Q;  4DAM A;  4DV7 L;  1NY4 A;  1E24 A;  1GO3 E;  1VQI A;  4DR1 Q;  4DR2 L;  3A5Z B;  4A3K H;  4JI2 L;  1B7Y B;  1CKM A;  3AFQ A;  4R4C A;  4IPC A;  5C0X J;  3CC7 A;  3PF4 A;  1OXS C;  1VQM A;  4OX9 Q;  2B63 H;  4KLK A;  4YCW A;  4YCU A;  4DV4 L;  3CCL A;  3GTM H;  4DR4 L;  1X65 A;  2Z0S A;  3RN5 A;  2YU9 H;  1V9P A;  2CQO A;  1QUQ B;  5HGQ A;  4IOA A;  4B3T L;  1QVF A;  3PGZ A;  4LFB L;  4GS3 A;  2VQF L;  2K75 A;  1XNQ Q;  5ELO A;  2D62 A;  2QA4 A;  2H5X A;  3OW2 A;  1HR0 W;  2IHF A;  4GLV B;  5C4X H;  4JBJ A;  4GNX B;  1Q86 C;  1PYB A;  1C7Y A;  1DGS A;  4A3F H;  2R7D A;  1YJ9 A;  4YY3 Q;  5LMU L;  1X55 A;  4C2M H;  1SRU A;  4A3I G;  1M90 C;  5E7N A;  1XMQ L;  3LGJ A;  3F8T A;  1KRT A;  4A3D G;  2JA7 G;  4R1J A;  3MXN B;  4DUZ Q;  1XPO A;  3J7A 5;  2OCE A;  2MQH A;  3FKI H;  3PV0 A;  3KOJ A;  1RL2 A;  4PMW A;  3CCV A;  4JI6 Q;  1Q7Y C;  2NN6 I;  3CW2 C;  2UUC Q;  2Z6K C;  3I2Z A;  1I5F A;  2JE6 I;  3A74 A;  2A8V A;  4AH6 A;  3E0E A;  1A62 A;  2DGY A;  2D0O A;  4DV1 L;  3J81 i;  1PH3 A;  4HJ5 A;  4GLX A;  4X64 Q;  3K0X A;  3PF5 A;  1LUZ A;  1HJP A;  4OWX B;  3GTJ H;  2E2J H;  4GKK Q;  2UXC L;  1VS0 A;  3UDI A;  1VQJ A;  3EN2 A;  4KHZ A;  4YWM A;  2WAQ E;  3CCE A;  2ZTE A;  3G6E A;  5IP7 H;  5J3B A;  4WJ3 M;  4JI7 Q;  4AQY L;  4JI0 Q;  4A3B H;  2LXK A;  3NEM A;  1G29 1;  3ULJ A;  4X65 Q;  3CPW A;  1PH9 A;  1EIY B;  4HID A;  4O0A A;  4OX9 L;  3GTQ H;  1JT8 A;  5IP9 H;  1Y1W G;  4A3F G;  2VY3 A;  2EXD A;  3PUW A;  1FJG Q;  1KAW A;  3CCU A;  4IFD J;  1VQK A;  3HKZ G;  2OWO A;  2RHQ B;  5M3M H;  3CC4 A;  4JCV E;  2ZM6 L;  1YZ6 A;  3I4O A;  2F3I A;  1UE1 A;  2R7Z G;  1VQH A;  5C3E H;  2WP8 J;  2R93 H;  3HOZ G;  1YNX A;  1K0R A;  1QZH A;  4DAY B;  5IE8 A;  4LFA L;  5FLX c;  1PH8 A;  4C3J H;  2ID0 A;  1IBM Q;  4BY7 H;  1I94 L;  3GO5 A;  2B63 G;  2EIF A;  4DK3 C;  3EBE A;  1BKB A;  2LSS A;  2VW9 A;  2I5M X;  4TQU S;  1P8L A;  1J5E L;  2WFW A;  1HNZ L;  1SN8 A;  2E2H H;  3CPF A;  3D31 A;  2AMC B;  1WYD A;  4DR7 L;  2ALY B;  5IYC G;  2JA5 G;  2PNH A;  4QL5 A;  1CSQ A;  4DK6 C;  3JAM i;  4QY7 A;  4DV0 L;  1HZ9 A;  1CKN B;  2HIV A;  4X64 L;  4BXX H;  1YHB A;  3PSI A;  2K5H A;  1QVG A;  1M1K C;  1L0W A;  2K14 A;  4JI2 Q;  4JYA L;  1D8L A;  1GM5 A;  3OTO Q;  3CXC A;  4DV5 Q;  2ZTC A;  1KHI A;  4GN3 B;  3NEL A;  2JA7 H;  2HIX A;  2ZJQ A;  2N78 A;  2VS1 A;  2K50 A;  4P75 A;  4LF6 L;  4P72 A;  4POF A;  4NB3 A;  4BBR G;  5C44 H;  1XNR L;  1W2B A;  4GKJ L;  1C0A A;  5JJL A;  1N36 Q;  2F4V Q;  1J5E Q;  1XMQ Q;  1FJG L;  1K9M C;  1D7Q A;  4BXX G;  1TWC H;  4X62 L;  4KI0 A;  1HH2 P;  4JI4 L;  1CKN A;  1XTD A;  3ZJY C;  4L5T A;  3SGI A;  1Y1V G;  1KRS A;  4JI3 Q;  1Q1E A;  1X6O A;  4NPS A;  5JEA G;  5LMN L;  1MJC A;  2UUB L;  3AEV A;  3CCM A;  4QQB X;  4LW1 A;  4YHH L;  5M3F G;  2OTJ A;  3TRZ A;  2E8G A;  2R6G A;  4A3L G;  4A3L H;  1AH9 A;  1AE3 A;  2PI2 E;  1SRO A;  3M7N A;  4LUZ A;  4PG3 A;  4LF4 Q;  2N3S A;  4JOI A;  2HQL A;  2I5H A;  4A3M H;  2MO1 A;  1FVI A;  4JC0 A;  1IL2 A;  2NZO A;  1G6P A;  4HIO A;  1OXX K;  1VQB A;  1EFW A;  4GNX C;  3HFZ B;  4JI1 Q;  3RZD H;  4L5R C;  1TXY A;  2YV5 A;  3HOV G;  1NTG A;  4XTC S;  2A1A A;  2NVX H;  4DPG A;  2VUM H;  1NBW A;  1UWV A;  1UEB A;  5DLQ E;  1Q46 A;  4OWW B;  1VCI A;  2IHE A;  5GAE C;  1Q1B A;  4LF9 Q;  3HOW H;  3G48 A;  4BY1 H;  1WOC A;  5GQO A;  4KHP L;  2UXB L;  4YY3 L;  2BA0 A;  1PH5 A;  5IYD G;  4JI3 L;  3HKZ E;  2NVQ H;  3F2D A;  1VQE A;  4B3S L;  4DV3 Q;  1VQ8 A;  1TWH H;  4IJH A;  1VQC A;  4UP7 A;  5IYC H;  5M5X H;  1X56 A;  4JG2 A;  3G4S A;  1VQG A;  4LF7 Q;  5EAY A;  1PHJ A;  3K7A H;  3OYY A;  1KD1 C;  5FLM H;  2AKW B;  4X62 Q;  5BR8 L;  4JYA Q;  4WJ4 A;  4MZ9 A;  4LNQ A;  3CF5 A;  1N36 L;  5IYB G;  2MNA A;  4C3H H;  5C0X G;  1L2F A;  4GOP A;  2XTI A;  2UU9 Q;  2UXD L;  4RMF A;  5BR8 Q;  3HOZ H;  4X6A H;  1EOV A;  5C3E G;  1HR0 L;  4JOI C;  4A3J G;  1OTC A;  2AWO A;  2L15 A;  2Z6K A;  1L1O C;  5AJ3 Q;  1KXL A;  3OTO L;  4DV5 L;  3E9I A;  1HNZ Q;  3AQQ A;  1PFS A;  5C4X G;  3K8A A;  2UXD Q;  3GTL H;  3ERS X;  2V1C C;  2NVY H;  2R92 H;  2KBN A;  5IP9 G;  1HZB A;  1FL0 A;  5IWA L;  3F2C A;  1SMX A;  1EYG A;  4LFA Q;  1A0I A;  1NMF A;  3RZO H;  4TVA B;  4BA2 I;  3PUZ A;  4QIW E;  5IP7 G;  1R9T H;  3S2H H;  4AYB E;  1W3S A;  3RLO A;  3HOX G;  4BBS H;  2UXB Q;  1NE3 A;  4NXN Q;  3U4Z A;  1X3F A;  4DR3 L;  1XMO L;  2Q2I A;  5IY0 A;  2D0P A;  1QVC A;  2Q2H A;  3B6Y A;  1V1Q A;  1LM0 A;  2GVB A;  1O7I A;  1A8V A;  4J15 A;  3M3Y H;  4BA1 I;  4JV5 L;  2IX0 A;  4A3G H;  1YEZ A;  4HIM A;  5FLM G;  1S40 A;  1E7Z A;  4AYB G;  3I56 A;  2RF4 A;  4IPG A;  4PZ8 A;  4UP9 A;  4K0K Q;  4KHP Q;  3U50 C;  1KC8 C;  4A4I A;  4A75 A;  3FKI G;  5GRO A;  4P71 A;  1JJC B;  4X65 L;  3J81 c;  1YJN A;  4IJL A;  3S1Q H;  3PCO B;  3KJO A;  4UPA A;  3J80 i;  1K3R A;  4HJ9 A;  3WWV A;  4IPD A;  2ES2 A;  5K36 G;  2Y0S E;  1IBL L;  1XPR A;  1HZA A;  1WCM G;  4DV2 L;  1SLJ A;  3TRE A;  1VQ9 A;  2CCZ A;  1VQ5 A;  2E5L L;  2NN6 G;  3ULP A;  3HOU H;  4EX5 A;  2YTX A;  2CWP A;  3UDX A;  3ICE A;  1GVP A;  4QJF A;  1GKH A;  1N34 L;  2NVT H; 
#chains in the Genus database with same CATH topology
 1A3T A;  4L8J A;  2JK8 A;  5KYL A;  1S72 A;  3KUP A;  5LMN Q;  3CME A;  2RHS B;  4A3E H;  3DWQ A;  3NBH B;  2VQE L;  4IPH A;  2WB1 G;  1RF2 D;  1T5X D;  2F52 A;  2FJ2 A;  2K4K A;  2CFM A;  5TSS A;  2FMC A;  3JAM c;  4AIM A;  3L0O A;  1E2W A;  4DR1 L;  3S2H B;  1MGS A;  3TP7 A;  3MZ5 A;  4O42 A;  3RLF A;  4B3M Q;  2VNU D;  1JE4 A;  3M4P A;  1A3U A;  1DOK A;  1YI2 A;  3HOY G;  1TS2 A;  4OGQ C;  3S15 H;  4M8A A;  1Z47 A;  2ZM6 Q;  1I94 Q;  2NWG A;  1VMP A;  2DJF C;  4K5W A;  1JJG A;  1VQA A;  3P20 A;  4C3H B;  3K58 A;  3PO3 G;  2F0T A;  5IGF A;  4PZ7 A;  4JI7 L;  2R7Z B;  5M5W B;  1MBY A;  2WIN B;  5JJK A;  1KDC A;  2UUA Q;  2F0O A;  1PTO F;  5M3F H;  1VDZ A;  4GLA C;  4CDC C;  3W3A A;  1K28 A;  1N33 L;  3NTH A;  1K8A C;  4LFB Q;  5AJ3 L;  1CSP A;  2KVM A;  1R9T B;  1BBW A;  3L2P A;  3FPP A;  4UAI A;  3HOU G;  4ULL A;  1YHA A;  3A0J A;  4DR6 Q;  3S14 H;  1BXT A;  2VL6 A;  3OOC A;  1Z6H A;  2MFI A;  1X3G A;  5IT9 E;  4R8N A;  4O2D A;  2JYO A;  3RUZ A;  1Q8K A;  4KY7 A;  1H9K A;  4XQQ A;  4A3K B;  1VQ7 A;  3S17 B;  2KCM A;  1FGB D;  2MJ8 A;  4DAV A;  2OQ0 A;  3MHB A;  2E2I H;  1JCK B;  4IN3 A;  4JI8 L;  1TY2 A;  4Y52 H;  2E74 C;  4DNT B;  2K05 A;  3HOX H;  4N9P A;  3UE1 A;  3PUX A;  4DKA C;  3T1H Q;  4NKL A;  5CV7 A;  4OEL B;  5I2Y A;  3J80 E;  2B2V A;  3SK8 A;  1ZKO A;  1DCZ A;  1H9M A;  4N9T A;  5ELC A;  5FO9 B;  3BS1 A;  4JBW A;  3GV6 A;  2NB0 A;  4LAA A;  3KLR A;  4HAE A;  1CFM A;  1Y1V B;  1CA6 A;  4FF4 A;  4R4Q A;  3K0Y A;  4YWL A;  3KF8 A;  4Q0F A;  2HHH L;  4DXG A;  2KEE A;  3TEH B;  5I6W A;  2MO0 A;  3H94 A;  2FFK B;  1WCM H;  1LT6 D;  1TWF H;  1EYA A;  2RBM A;  1AE2 A;  3EIV A;  3RLN A;  1GUT A;  4HR7 B;  1WI5 A;  4BY1 G;  3NEN A;  4WJW A;  1PYS B;  5FO8 B;  1WFQ A;  5JPN C;  2HCC A;  1U4R A;  2P5Z X;  4DUY L;  2X6G A;  2R92 G;  4DUZ L;  3Q24 A;  1HCZ A;  4N8X 1;  4B3R L;  3CMA A;  1JB7 A;  1STY A;  1U5K A;  3DWA A;  4KHV A;  1PVO A;  4B3R Q;  2N49 A;  1XNR Q;  4FO2 A;  1L1O B;  3M85 A;  4XXE A;  1DON A;  4BY7 G;  1V43 A;  2AQ2 B;  2A69 D;  3A8J E;  1SNM A;  4DK1 A;  1N9W A;  2EJG C;  4XIG S;  4L5Q A;  3AB9 A;  2O5I C;  5FJ8 H;  2PW5 A;  3S1N H;  4KKU A;  4XQN A;  1IZ6 A;  1YVC A;  2EJF C;  3BJU A;  4GKK L;  2MUY A;  1S5B D;  2UXC Q;  1DOM A;  1BVS A;  1Y14 B;  3E9H A;  2B29 A;  2ICI A;  1H9S B;  2WB1 E;  4RKB A;  2X6L A;  3BZD B;  3CCJ A;  4F8M A;  1A3V A;  1FD7 D;  1I6H B;  1DYQ A;  3DUZ A;  5IT9 c;  1STE A;  3I55 A;  3QG1 A;  4CJ1 B;  2ZJR A;  3OIQ A;  5EQ0 A;  4IUR A;  4IUV A;  1E1T A;  2KEC A;  2KCT A;  4LF5 L;  2OEO A;  5CR3 A;  2R7F A;  4AQY Q;  3DHQ A;  2R3Z A;  4TRD A;  2LMC B;  5HGT A;  4LF8 Q;  2YTY A;  3PUV A;  1JOK A;  1NR2 A;  1U4L A;  3K7A B;  2WV6 D;  1YIT A;  2C35 B;  1ILP A;  4JI8 Q;  4DAM A;  4DV7 L;  4DR2 L;  1GO3 E;  4R4C A;  1RKN A;  2EOT A;  3PF4 A;  5BN4 A;  1I4Q A;  4KLK A;  3CU7 A;  5KYI A;  1I3Q B;  3CCL A;  1B9M A;  1F2Z A;  1X32 A;  3SEB A;  2YU9 H;  2EYH A;  5HGQ A;  4OIJ A;  3OW2 A;  3HOW B;  2IHF A;  4A3F H;  5CV8 A;  4A3I G;  1KRT A;  3HKZ B;  2DJG C;  2KCC A;  3IFT A;  3L9A X;  4LMQ D;  1EQV A;  5BN5 A;  2F03 A;  4PMW A;  4ZKC B;  5K5P A;  3CCV A;  2Z6K C;  1QNK A;  2JE6 I;  2AUK A;  4DV1 L;  2D0O A;  5IGD A;  3J81 i;  3MAQ A;  2EYL A;  1KAA A;  1LUZ A;  2XVS A;  4KY5 A;  3D4D A;  2L55 A;  2E2J H;  5C6A A;  3H3V C;  3EN2 A;  2XIW A;  3CCE A;  1B3A A;  5IP7 H;  4JI7 Q;  4KN4 C;  4AQY L;  1WTR A;  5KGU A;  2LXK A;  3NEM A;  3GTQ H;  2A68 D;  1JT8 A;  5CBA E;  2EYO A;  2IX3 A;  1VQK A;  5M3M H;  3NWT A;  3N6R A;  2HCI A;  2ZM6 L;  4BBR B;  3I4O A;  1VQH A;  4HSV A;  2C5C A;  1D6E C;  4EQP A;  5FLX c;  4DK3 C;  1BKB A;  3K5O A;  5CYU A;  1BF4 A;  2WFW A;  1I50 B;  1I4X A;  1DM0 B;  2PZU A;  1TWH B;  2ZT9 C;  1HA6 A;  1HFG A;  5IYC G;  2PNH A;  1RHP A;  5D3I B;  1CZW A;  1GXD C;  1CKN B;  2MPM A;  2EPB A;  1L0W A;  4FXG C;  1Q8I A;  3ERQ A;  3OTO Q;  4DV5 Q;  1IYV A;  1KHI A;  1VF5 C;  1YNN C;  4MTK A;  2ZJQ A;  2N78 A;  2VS1 A;  3JAM E;  4P75 A;  3S1R B;  1MD2 D;  1XNR L;  1UNS A;  5C44 H;  3I73 A;  2PQE A;  1W2B A;  4GKJ L;  1N36 Q;  5JJL A;  1XMQ Q;  1LV9 A;  2F0I A;  1K9M C;  4ABN A;  4HCS A;  4KI0 A;  1LAC A;  4JI4 L;  3TZU A;  1UAP A;  3LX0 A;  3SGI A;  1BCP F;  4J6H A;  3C1F A;  5JEA G;  4K14 A;  3AEV A;  3T4A C;  2OTJ A;  1SNO A;  2E8G A;  2R6G A;  1AH9 A;  4E6I A;  4KJN A;  5CV4 A;  2WAQ B;  2N3S A;  3T16 A;  4JC0 A;  1QOH A;  1IL2 A;  2NZO A;  4A3E B;  3S14 B;  4GNX C;  1F9R A;  4V0B A;  2PO4 A;  1NTG A;  4XTC S;  4A3J B;  2NVX H;  3R2T A;  4HED A;  1C48 A;  3VYU A;  5M9O A;  5DLQ E;  4F87 A;  1PZJ D;  1VCI A;  5GAE C;  1Q1B A;  1W6K A;  3G48 A;  4KV6 A;  5GQO A;  2B2Y C;  2PZW A;  4R9W A;  1GUW A;  4JI3 L;  1FNV A;  2NVQ H;  4DV3 Q;  2NYZ D;  4C56 C;  3L3O C;  1I4G A;  5M5X H;  4CDD C;  5EPK A;  1R4Q B;  1QB5 D;  1VQG A;  4LJZ C;  5EAY A;  1PHJ A;  3OYY A;  2B2T C;  3TME A;  2CW0 C;  1KD1 C;  4JYA Q;  2MNA A;  4C3H H;  1KLG D;  4GOP A;  3QWN A;  5M5X B;  1ZEQ X;  2UU9 Q;  4RMF A;  5BR8 Q;  1JIC A;  4X6A H;  1G91 A;  2ZXP A;  2A73 B;  3E9I A;  3AQQ A;  2O2L D;  3GTL H;  1PXU A;  3KBX A;  1SMY D;  2KBN A;  3F2C A;  1EWC A;  3RZO B;  3S2H H;  2AQ3 B;  4IFD H;  1DD2 A;  2Z8L A;  3OPO A;  2VUM B;  3ERO A;  5IY0 A;  2D0P A;  1QVC A;  5K36 H;  5LL6 S;  2K5W A;  1V1Q A;  2GVB A;  1O7I A;  3M3Y H;  2Q8I B;  1YEZ A;  4HIM A;  5J39 A;  4IPG A;  2RF4 A;  3E3X A;  1TWA B;  2WII B;  1KC8 C;  4A75 A;  1YJN A;  4X65 L;  1TS3 A;  5E4W C;  4IJL A;  2KQ3 A;  5K36 G;  2V4D A;  4RFB A;  1WTW A;  1HZA A;  1IBL L;  2CCZ A;  1VQ9 A;  1XXG A;  2E5L L;  2C9O A;  5G3L D;  2G5D A;  4F88 A;  2CWP A;  1SE2 A;  4DF7 A;  1II3 A;  3HOY B;  1PRT F;  3P1H A;  3OSO A;  3FVQ A;  3GDE A;  4CDE C;  5GAH C;  4JI4 Q;  4C1N K;  3SR1 A;  2ASB A;  1SE8 A;  2XN9 C;  2F0H A;  3DEP A;  5FJ8 G;  1F2L A;  5C3W A;  3CD6 A;  1EWI A;  4QIW B;  4FVM A;  1CA5 A;  1VQO A;  1EU4 A;  5ELN A;  4NXN L;  3V05 A;  5C4J H;  3TDQ A;  4JVZ A;  1HRJ A;  1U4P A;  5JVG 3;  3OWE B;  3PQI A;  4HCE A;  5T1I A;  3TS2 A;  3H91 A;  3A55 A;  3KDF A;  2LXJ A;  4ZYS A;  5KNB A;  4DV6 L;  4NXM L;  1IBL Q;  4GN5 A;  1JE5 A;  4A93 G;  3NBH A;  1BCP C;  4IO9 A;  1AZQ A;  4A76 A;  2ATW A;  3F2B A;  3Q23 A;  2YTV A;  1VMC A;  1PZK D;  3PO2 H;  1G51 A;  1J6Q A;  1GHJ A;  1KDB A;  3GTQ B;  3FMC A;  2JJQ A;  1EIF A;  2GVA A;  2XWB B;  2CH4 W;  2DNC A;  3CRK C;  3S16 H;  1IKM A;  1S5D D;  1N8R C;  3GTK B;  3IRB A;  4A93 H;  1JJ2 A;  2Q8R E;  2WKC A;  1PRT D;  1K73 C;  4MNO A;  4QGU A;  1SAP A;  1QZG A;  2F0Q A;  2RSN A;  1V8Q A;  2RDG A;  2L12 A;  1XJV A;  5M5Y H;  3M4O H;  4G7O C;  2SNM A;  2OF1 A;  4FDB A;  2NZ1 D;  2R7Z H;  1B44 D;  2JA5 B;  1IBK Q;  1CTM A;  1PH6 A;  1HHV A;  3CKI B;  4DAP A;  4YHH Q;  1PH4 A;  1VQP A;  1VQ4 A;  3K80 C;  1ROD A;  4Y7N B;  1SEB D;  1HNX Q;  5C4H A;  4IFD I;  3PO3 H;  3F2U A;  1EY5 A;  3QR8 A;  3C46 A;  2IY5 B;  1GD7 A;  1BCP D;  4R8I A;  1X9N A;  1F2M A;  1OXT A;  2KOL A;  1HXY D;  3NTI A;  1LLR D;  1STB A;  3A56 A;  2JA6 B;  3C2P A;  2PQA A;  1TWG H;  3Q0A A;  5M5Y B;  5CV9 A;  3HG9 A;  2DN8 A;  3H3V H;  4IUQ A;  1B9N A;  4GZY C;  2K5D A;  3T56 B;  1JOR A;  3GTG H;  1TR5 A;  2RCN A;  3HKS A;  5IOD A;  1LYL A;  1LTS D;  3L7Z C;  3OMC A;  5GAG C;  3S2D B;  2R93 G;  2BOS A;  3BVM A;  1JWM D;  2QDB A;  5I2X A;  1PA6 A;  3HOV H;  3G71 A;  3S16 B;  2F0P A;  2JEB I;  4PNY A;  4DV7 Q;  4DR2 Q;  1AFP A;  3RR5 A;  4LF5 Q;  3NTK A;  2R92 B;  4XYQ A;  1FNU A;  1TY0 A;  3HS0 C;  4O1N A;  3KJP A;  3QOJ A;  4XDX A;  2J7Z A;  3X3M A;  3UE0 A;  2B2U A;  2B2W C;  1NCV A;  3S1N B;  3CC2 A;  4PMC A;  3I4M B;  1X3Q A;  1TKW B;  2EZV A;  2YYZ A;  2QF7 A;  4BS9 A;  3KF6 B;  2M9V A;  2KCN A;  2R61 A;  3H0G H;  3BZC A;  4JI0 L;  1CM9 A;  1E2Z A;  4ZUI A;  3S1R H;  4A3G G;  2ZTD A;  2L5T A;  3I70 A;  2BH2 A;  1E3P A;  2UUB Q;  1SYC A;  1B50 A;  3K81 C;  3KFU A;  3D3R A;  2Z6B A;  1JWU D;  1NUC A;  1EOT A;  3FEW X;  1BR9 A;  1EWH A;  1KQS A;  2D9U A;  5CV6 A;  3T53 B;  4L5S A;  5T1G A;  3MVV A;  3OMG A;  1VQF A;  4CKE A;  3HOX B;  1I4H A;  5KEE A;  2HDM A;  1Q82 C;  1MI2 A;  4RGT A;  1HUM A;  4QUC A;  1OXU A;  4HN7 A;  5D3D A;  2GN5 A;  2KEN A;  4QCL A;  4H02 A;  5LMU Q;  2JA8 G;  1B70 B;  3AFP A;  4K6L A;  3M9B A;  2EYF A;  3D0F A;  1SXT A;  4BBR H;  5I9P A;  4CJ0 B;  4B3T Q;  1O7Y A;  2PI2 A;  2OT2 A;  4XQJ A;  2IX1 A;  4FF1 A;  2N8N A;  4JI1 L;  4IAL A;  1PH2 A;  4OWT B;  3PO2 B;  3FRP B;  1YHQ A;  1Y1V H;  2CKZ B;  4RHS A;  4DV1 Q;  2ZXO A;  3Q6S A;  2TSS A;  3NBI A;  2EVB A;  1PTO D;  1NNX A;  3DWP A;  1A2U A;  3Q8D A;  4R4I A;  1MIU A;  3RMH A;  3AYH B;  1VQL A;  5FK9 C;  1K8O A;  3H0G G;  2HHH Q;  2H1E A;  4FXK C;  1SYE A;  1U4M A;  5C5M A;  2NZH A;  1HZC A;  4A3M B;  1EUJ A;  4JPB W;  5JJI A;  1H9S A;  3BVZ A;  4GNX A;  4X3S A;  5C0X I;  2FXQ A;  1SR3 A;  2Y0S G;  4MTN A;  4YWK A;  2Z1C A;  2HT1 A;  1Y1W H;  2AWN A;  3ZYY X;  1E24 A;  3A5Z B;  3N52 A;  1EZ6 A;  2BCO A;  4IPC A;  1OXS C;  4LK1 C;  4DR4 L;  2MHV A;  5E3F A;  3RN5 A;  2CQO A;  1QUQ B;  4ZQ3 A;  3PGZ A;  5ELF A;  4GS3 A;  2VQF L;  5ELO A;  2QA4 A;  4B3S Q;  4ZCK A;  1HR0 W;  1B1Z A;  5C4X H;  2R92 H;  4JBJ A;  1A6X A;  1QJO A;  1HTP A;  2IJ0 A;  4IZ8 A;  1YJ9 A;  4YY3 Q;  2L9H A;  1PTO C;  2QCP X;  1XPO A;  5FO7 B;  3J7A 5;  3HEJ A;  3PV0 A;  3IFD A;  3CW2 C;  4K5X A;  3I2Z A;  1I5F A;  1SNP A;  4AH6 A;  1PH3 A;  2DGY A;  2L4N A;  1H9J A;  2BE5 C;  4I7Z C;  4GKK Q;  3GTJ H;  1SYB A;  4QF4 A;  2UXC L;  1VS0 A;  4CDF C;  1Y8N B;  2WAQ E;  1D1I A;  1D5X C;  4FP5 D;  2ZTE A;  1B53 A;  3DMU A;  3M4Y A;  3J7Y W;  1SYF A;  4OL7 A;  3CPW A;  1PH9 A;  5IP9 H;  2F0V A;  5E4X A;  1Y1W G;  4H7B A;  2J4X A;  2CHB D;  4A3F G;  2EXD A;  3PUW A;  3PO3 B;  4IFD J;  2RHQ B;  1JWS D;  2EYM A;  4JCV E;  2R7Z G;  2Q8T A;  1UE1 A;  1MHW C;  3HOZ G;  1XWE A;  1V1P B;  4DAY B;  4LFA L;  1IBM Q;  1I94 L;  5JJZ A;  2LSS A;  3J80 L;  1EIH A;  3TBI B;  2NTT A;  3QOL A;  1HNZ L;  5IGE A;  2E2H H;  4DA2 A;  2F0M A;  3CPF A;  2M2L A;  3G6J B;  1CSQ A;  2QEJ C;  1HZ9 A;  4BBS B;  4OHJ A;  1LAB A;  2F0E A;  2HIV A;  4BXX H;  4KK7 A;  4C3J B;  3PSI A;  2XSC A;  1QVG A;  1M1K C;  4KKS A;  4JI2 Q;  1WTP A;  3BYY B;  1D5Z C;  1VF7 A;  4KD4 A;  4CHT B;  2JA7 H;  4ZKB B;  2Z4H A;  4OO1 H;  2K50 A;  1NAP A;  1SMY C;  4LF6 L;  3TP6 A;  5IT9 L;  5CC4 A;  1LT5 D;  1D7Q A;  4BXX G;  1HH2 P;  1CKN A;  1ILQ A;  1W6J A;  1SYG A;  4L5T A;  1PFN A;  1X6O A;  4NPS A;  5LMN L;  3CCM A;  4LW1 A;  4YHH L;  5M3F G;  3TRZ A;  4A3L G;  3S1Q B;  1AE3 A;  2PI2 E;  3MXN A;  1WD1 A;  1ZYR D;  1SRO A;  3M7N A;  1EEI D;  4PG3 A;  1TWC B;  2OXP A;  1LTI D;  4JOI A;  4A3M H;  2LFN A;  2MO1 A;  1VQB A;  1EFW A;  3HFZ B;  4L5R C;  1GUO A;  1TXY A;  2YV5 A;  1SE3 A;  1SJE D;  4DPG A;  4C3I B;  1Q46 A;  4OWW B;  3HOW H;  4KHP L;  1WOC A;  2L1B A;  4H13 C;  4XT1 B;  1PH5 A;  5IYD G;  3HKZ E;  3M4O B;  1LO5 D;  1VQE A;  3K6O A;  3SHL A;  4RCN A;  1YNN D;  4UP7 A;  5IYC H;  4JG2 A;  1AEX A;  2CW0 D;  1D1K A;  3CRL C;  2K7V A;  3K7A H;  1STN A;  1MSG A;  4X62 Q;  2QDL A;  4MZ9 A;  1WTV A;  5IYB G;  1LTT D;  5C0X G;  3K5L A;  1L2F A;  5M3M B;  2XTI A;  2UXD L;  1BQQ T;  5BN3 A;  1O78 A;  1HR0 L;  5AJ3 Q;  1HNZ Q;  2TMP A;  1PFS A;  5IWA L;  1HZB A;  1EYG A;  1SMX A;  5EBD A;  4K8J A;  4LFA Q;  4M1U B;  3RZO H;  5IP7 G;  4AYB E;  1EU3 A;  5G3L F;  4BBS H;  2UXB Q;  1NE3 A;  1H9R A;  2ICE C;  2Q2H A;  5DEH A;  4J15 A;  1SSO A;  2MGS A;  4JV5 L;  4A3G H;  1S40 A;  3QJY A;  4AYB G;  3I56 A;  1BOS A;  3K5N A;  2JN4 A;  2EJM A;  4P71 A;  5C3E B;  5DAU A;  3NSW A;  1K0S A;  3J80 i;  3WWV A;  3U9S A;  4HTH A;  1SLJ A;  2RA4 A;  3ULP A;  1AZP A;  2NVQ B;  3UDX A;  2AQ1 B;  2LS0 1;  1GVP A;  1MSH A;  4LFB L;  1JB3 A;  2NVT H;  2EYP A;  2B2U C;  4ZK9 B;  4F7X A;  2G9H D;  1M4V A;  1KLU D;  3HP3 A;  3M4Q A;  4DU9 A;  4JV5 Q;  1GOZ A;  3D8G A;  1HNX L;  3RZD B;  1PFB A;  5CGK A;  1S4Z A;  2N88 A;  1F9Q A;  2HDL A;  3I72 A;  4A3D B;  3MTS A;  3FKI B;  1YNJ C;  4DR4 Q;  1P16 A;  1OXV A;  3BU2 A;  1UEA B;  1CUK A;  3I4N H;  1ICF B;  1S5F D;  4APV A;  1WCM B;  3PIO A;  2KHI A;  1TWG B;  4RGM A;  1VQD A;  5J1Z A;  2JA6 H;  4DUY Q;  4TKO B;  4EQO A;  2NVT B;  2I07 B;  5C44 G;  1Q12 A;  3GTL B;  3HOW G;  4NMZ A;  2FIN B;  1JR0 D;  5IOC A;  4DV3 L;  2QGQ A;  3EQL C;  4JBK A;  3KF8 B;  4UY8 C;  2F0K A;  4UDU C;  3W5O A;  1V1O A;  4Y7N H;  4DR5 Q;  1EFI D;  1PV4 A;  4XT3 B;  1QE6 A;  1EY8 A;  3KDF B;  4OIK A;  2A19 A;  2JA5 H;  3PIP A;  3SK5 A;  4OEM B;  1WTO A;  2PMZ E;  3D4W A;  1SFO H;  2OQK A;  2QIL A;  4HJ7 A;  2IL8 A;  3MEF A;  2JA6 G;  3J81 E;  2RQX A;  2JQO A;  1LTL A;  1WJJ A;  3MFY A;  3EA6 A;  5DM7 3;  4LUO A;  3E6Z X;  1DZ1 A;  3SXH A;  2R93 B;  4C2M B;  3HGB A;  1Q81 C;  1PFM A;  3D6W A;  4POG A;  1B2T A;  1L1O A;  4DR3 Q;  1XMO Q;  1XNQ L;  4MHE A;  1Z9F A;  5FKA C;  5JOB A;  4FF2 A;  3AU7 A;  3A54 A;  3UDF A;  3U4V A;  5NUC A;  3AMU A;  4LF9 L;  4ZRZ A;  5J22 A;  2JEA I;  3I4M G;  1JOQ A;  1VQN A;  4LUV A;  1UE6 A;  1BBU A;  1STH A;  4LF6 Q;  2L0C A;  1EY0 A;  4DV4 Q;  3BDO A;  5LHY 1;  2XGT A;  1KTK A;  1KIX A;  3T51 B;  4P73 A;  4RWS C;  1JC7 A;  4B9X A;  4LF7 L;  5JEA J;  1E22 A;  4HSP A;  4JI5 L;  4RGN A;  5KRU A;  4A3B G;  1PLF A;  3QO2 A;  3FHW A;  1Y69 U;  3LWU A;  2HUG A;  5I6Y A;  1KDA A;  1EQQ A;  2JA9 A;  4DGZ A;  5F2D A;  1LTR D;  1CHQ D;  1I50 H;  3FP9 A;  4EQN A;  2EY2 A;  3KYH C;  3CCR A;  4IQZ A;  5H1S E;  2EY1 A;  3I4M H;  1H95 A;  3ER0 A;  3GV3 A;  5KND A;  2UU9 L;  1KNA A;  4I65 A;  3KLW A;  4IOC A;  4DK0 A;  4LFC Q;  3CQZ H;  3I4N B;  1AW7 A;  1X3P A;  2E5L Q;  2VB3 X;  1GUN A;  4BWG B;  2KJX A;  4OO1 G;  3M3Y B;  4A3D H;  3ULL A;  3MWY W;  3CHB D;  1A63 A;  4YCV A;  2KHJ A;  2RDF A;  4JW0 A;  4I7A A;  3S24 A;  1HNW L;  3TSS A;  3PO2 G;  2Q2U A;  1UE7 A;  1N32 L;  1KNE A;  4TSS A;  4B9W A;  4X66 L;  4OXP A;  2LKV A;  1ASY A;  3A5U A;  4X66 Q;  1G8Z D;  2DUD A;  1ESF A;  1N32 Q;  2FMM A;  2VQE Q;  5ELB A;  1SNC A;  1PH1 A;  1J9O A;  4YIJ A;  3SDZ A;  1JMC A;  4CJ2 C;  3NPP A;  1B4O A;  2OTL A;  4H44 C;  1IBK L;  2F4V L;  5ISR A;  1S3O A;  4DNI A;  3E0J A;  3MA2 B;  5DNF A;  2Y0S B;  2I46 A;  2EY6 A;  4R4O A;  1D2B A;  3T1Y L;  3GTP B;  1I3Q H;  1NMG A;  1G2T A;  2D5D A;  5EJW A;  4CKC A;  2KHS A;  4DV0 Q;  1A2T A;  3U58 A;  2Q2T A;  1BDO A;  1I4R A;  4R4T A;  3LNN A;  1YJW A;  2SDF A;  3MXU A;  1WD0 A;  2K5V A;  1YNJ D;  3UI2 A;  1XPU A;  2F0F A;  3JC6 6;  2WB1 B;  3J81 j;  2BA1 A;  2PNR C;  3GTK H;  3NHH A;  1TVX A;  2BH8 A;  2H4O A;  2E75 C;  3VR5 A;  1QNU A;  4OX9 Q;  2E2D C;  5KNC A;  1B7Y B;  1CKM A;  1Y8P B;  4JI2 L;  3CC7 A;  2F4I A;  1VQM A;  2B63 H;  2KA7 A;  4YCW A;  2A6H C;  4H0L C;  4PQX A;  4YCU A;  3GTM H;  1X65 A;  1V9P A;  1C4Q A;  4IOA A;  4B3T L;  2K75 A;  1CHP D;  1XNQ Q;  2D62 A;  4GLV B;  3SE0 A;  4GNX B;  1Q86 C;  2RKS A;  1Y8O B;  2R7D A;  1PTO H;  5LMU L;  1Y1W B;  4J8Q A;  5E7N A;  1XMQ L;  1DXM A;  3F8T A;  3LGJ A;  1HQR D;  2RCF A;  4DUZ Q;  2OCE A;  4C3H G;  1IYU A;  2MQH A;  3KOJ A;  2A6E C;  4JI6 Q;  1Q7Y C;  2NN6 I;  3OW7 A;  4XYO A;  2UUC Q;  5FLX E;  3SVM A;  2SEB D;  1ENF A;  2A8V A;  1AN8 A;  1IKL A;  2WAC A;  1A62 A;  3E0E A;  4HJ5 A;  3K0X A;  1HJP A;  3R3O A;  3UDI A;  5IGC A;  4WFN 3;  3W2D A;  4KHZ A;  4YWM A;  5C4Z A;  4A93 B;  4ZUJ A;  2J0T D;  2A5H A;  4JI0 Q;  2F0D A;  4X65 Q;  2BDO A;  1WTQ A;  2K5Q A;  4HID A;  1EIY B;  3HOU B;  2VY3 A;  1FJG Q;  3CCU A;  4X3T A;  4FF3 A;  2JA7 B;  1D5M C;  2VXW A;  1YZ6 A;  4NDX A;  1WVL A;  2JXM B;  2WP8 J;  2R93 H;  2PPB C;  1TWF B;  1K0R A;  1QZH A;  1LT3 D;  1PH8 A;  3K59 A;  3NWS A;  2ID0 A;  4C3J H;  3GO5 A;  2EIF A;  3EBE A;  1PMR A;  1TU2 B;  4NP5 A;  2ZXR A;  4TQU S;  1J5E L;  1SN8 A;  3TZD A;  5JVH 3;  5M3F B;  2E2H B;  4DR7 L;  2ALY B;  3OWF A;  3JAM i;  4QL5 A;  4DK6 C;  2JA5 G;  5DM6 3;  3JAM L;  2CH4 A;  2IWH A;  2CVR A;  1EZ8 A;  3VR4 A;  1F77 A;  1YHB A;  4IUU A;  2K5H A;  1BUV T;  2EE1 A;  1HPC A;  2K14 A;  4DAY A;  4JYA L;  1HUN A;  3CXC A;  3D6C A;  2ZTC A;  5A2Q E;  4GN3 B;  1Q3L A;  4POF A;  4FYD A;  1C0A A;  4G7H C;  1PYW D;  3S15 B;  1FJG L;  1TWC H;  5E1F A;  4X62 L;  1XTD A;  3ZJY C;  2B63 B;  4Q5V A;  1Y1V G;  2F0N A;  5CMD A;  4JI3 Q;  1Q1E A;  4QQB X;  3HRZ C;  3NXW A;  4A3L H;  2GA4 B;  1SDF A;  2B2W A;  1HQM C;  2HQL A;  2I5H A;  2NBF A;  1G6P A;  2B8G A;  1OXX K;  1F9S A;  1FYC A;  4BY1 B;  4JI1 Q;  5D14 A;  3RZD H;  3LWE A;  3HOV G;  1STA A;  2VUM H;  3MXG A;  1NBW A;  2XRQ D;  1UEB A;  3NP8 A;  2UXB L;  2SNS A;  4BY1 H;  3ONA B;  2B39 A;  3F2D A;  4G4K A;  1QCB D;  1VQ8 A;  1TII D;  1HA5 A;  1G2S A;  3G4S A;  3KLS X;  4LF7 Q;  2WKD A;  4BY7 B;  5FLM H;  2AKW B;  2EYJ A;  4WJ4 A;  4LNQ A;  1BO0 A;  2LY7 A;  2SOB A;  1EY6 A;  4A3G B;  3HOZ H;  1EOV A;  5C3E G;  5IGB A;  1OTC A;  2L15 A;  1L1O C;  2K04 A;  1F9P A;  1AP0 A;  2E76 C;  5IP9 G;  1FL0 A;  1CQV A;  1A0I A;  3WOE A;  4DFA A;  4U68 A;  3PUZ A;  4QIW E;  3GTJ B;  1R4P B;  1FR3 A;  1W3S A;  3RLO A;  3HOX G;  4NXN Q;  4V19 0;  1X3F A;  4DR3 L;  1XMO L;  1RDP D;  2Q2I A;  5JPM C;  4WRD A;  2F3V A;  3B6Y A;  1SJH D;  1LM0 A;  5C0X H;  2JA8 B;  3J7A V;  1ET6 A;  1QWY A;  2F0L A;  2L11 A;  4K0K Q;  4A4I A;  3FKI G;  3I4L A;  3IL8 A;  4UPA A;  3KLS A;  1K3R A;  3NK9 A;  4IPD A;  3VYT A;  2Y0S E;  4HMJ A;  1XPR A;  1WCM G;  4DV2 L;  5C4X B;  1JOO A;  1VQ5 A;  2NN6 G;  2A6H D;  3HOU H;  2A6E D;  1CT1 D;  4K2L A;  2YTX A;  4EVO A;  2A74 C;  5C44 B;  3ICE A;  2AHO B;  5I9O A;  4RH6 A;  4C1N I;  4QMG A;  3RN2 A;  4ALP A;  3VR2 A;  1FNW A;  2EQS A;  3I7F A;  4G7Z C;  1C9O A;  4A3M G;  2X69 A;  3A8K E;  4DR6 L;  4HMI A;  4MN3 A;  1SND A;  4A3I B;  3VYR A;  2IPK D;  5ELD A;  4P74 A;  1O7L A;  1ZXT A;  3S1M B;  1ASZ A;  2M00 A;  3MXP A;  1N33 Q;  1EQR A;  3S17 H;  1PTO B;  3GP7 A;  2B3G A;  4X3K A;  1FGU A;  4DV2 Q;  4DXF A;  1QG7 A;  4DR7 Q;  1K8M A;  4KKT A;  3HOY H;  5EPL A;  4GOP B;  2QEX A;  1STG A;  3V2T A;  2ENB A;  5KIX A;  1G6Z A;  4PMB A;  1YIJ A;  4ODG A;  3DM3 A;  3VR6 A;  4ZAI A;  1UE5 A;  1BNZ A;  1U0L A;  1QIL A;  3H15 A;  1ENC A;  3CP0 A;  1UUP A;  5EKL A;  2K6A A;  4P2C B;  2F1M A;  3KF6 A;  4DN4 M;  3R8B A;  4Z9C B;  2JA8 H;  4ME3 A;  2F0W A;  1X54 A;  4OO1 I;  2I5L X;  2F0U A;  4IFD G;  1TS4 A;  3I91 A;  3STB C;  5M5W H;  2K52 A;  1YBY A;  3F1Z A;  2B2T A;  1CKO A;  3URY A;  3K5M A;  5C5L A;  1I6H H;  1RIP A;  1EIG A;  4DV6 Q;  4NXM Q;  2AUJ D;  2B2V C;  4QB4 A;  4S3S A;  4EGV A;  1ESR A;  1IHZ A;  4HIK A;  4A3F B;  1TS5 A;  5EKK A;  3VA7 A;  4KMU C;  5EPJ A;  1EYD A;  2UUC L;  1MKH A;  1SYD A;  5EBC A;  5C3X A;  1CZG A;  2B2Y A;  3WOF A;  2YU9 B;  3HOZ B;  4A3B B;  5A35 A;  2VQF Q;  4K0K L;  1Q90 A;  1GUS A;  2K03 A;  5A2Q L;  5COY A;  3NQI A;  2BE5 D;  1NR4 A;  1NJI C;  2NN6 H;  5IWA Q;  1U9R A;  4FNF A;  2IW3 A;  3A7A B;  3ND9 A;  4GKJ Q;  4BBS G;  2D2C C;  1HR0 Q;  4C3J G;  4B3M L;  3VDY A;  3I4N G;  4IUT A;  1LTA D;  2N55 A;  2K1B A;  4RCO A;  1IL8 A;  1I6V C;  2WAQ G;  4RKL A;  3CAM A;  3P75 A;  3H09 A;  3NUC A;  3TP5 A;  4A3E G;  4CKB A;  3D4R A;  3VR3 A;  2ZJP A;  3C3L A;  4A3J H;  1PDQ A;  2NVX B;  4JBM A;  1KL9 A;  3BZK A;  2F0J A;  3W1B A;  2PMZ B;  4EQ5 A;  2F0S A;  4DR5 L;  2NTS A;  3S2D H;  2Z9H A;  5IYB H;  2B8F A;  4A3K G;  1PH7 A;  3GTP H;  1E1O A;  2HQE A;  2K01 A;  3J7Z C;  2EXZ A;  5JEA H;  4CBV A;  1SNQ A;  1XX8 A;  1N34 Q;  3IAY A;  1B3Q A;  4ME5 A;  3Q22 A;  4KY6 A;  3T1H L;  3J80 c;  5C4J B;  3CCS A;  4PZ6 A;  2EY5 A;  1GJX A;  4KTA A;  3R2I A;  4N8F A;  5FLX L;  1QUQ A;  3T1Y Q;  3PUY A;  4A3I H;  3J7A F;  3G7L A;  4C3I G;  2DNE A;  2PW7 A;  1K3B C;  4HJ8 A;  2BDN A;  1X3E A;  3IKJ A;  4NW2 A;  3RNU A;  1CK1 A;  1E2V A;  1GUG A;  2K33 A;  3CCQ A;  2K5N A;  3EVQ A;  3STB D;  1PZI D;  3O13 A;  4HJA A;  1ET9 A;  5HY6 A;  2VUM G;  1T9H A;  2CQA A;  2I0Q A;  4MIU A;  1K83 B;  3M7G A;  1CI3 M;  3GD7 A;  1PRT C;  4A3C G;  4FXD A;  2K32 A;  3BDL A;  1ICW A;  3TS0 A;  4A3C H;  2KUM A;  5M3M G;  2RVL A;  4K2K A;  4LF4 L;  1TWA H;  3DEO A;  4RG1 A;  2PQA B;  1IXR A;  1RTN A;  1B8A A;  1K83 H;  1HNW Q;  5GAD C;  4OON A;  4LWC A;  4UP8 A;  4DNR B;  1IYJ B;  1TT2 A;  3H3V I;  3TQY A;  1IBM L;  3EJI A;  4LFC L;  4JI6 L;  4K5V A;  1RJT A;  2UUA L;  5IYD H;  5ELE A;  1CQF A;  4B08 A;  1IW7 C;  4LF8 L;  1VQ6 A;  4C3I H;  3UDG A;  1SBB B;  3GTO H;  3QIA A;  4J1M A;  3A8I E;  3S1M H;  4KD3 A;  3K7U C;  4AYB B;  1MJE A;  5LMN W;  2JP1 A;  2Z4I A;  3DLL A;  4L63 B;  1HTL D;  2CWA A;  2VZA A;  4X3U A;  4K8I A;  4GN4 B;  2HD3 A;  2IT1 A;  1K8G A;  2E2I B;  2DY7 A;  3W1G A;  4JI5 Q;  3GTO B;  1XYI A;  4GOP C;  4DR1 Q;  1NY4 A;  1VQI A;  4A3K H;  5C0X J;  3AFQ A;  3GQB A;  3H6M A;  1S5C D;  4DV4 L;  4ZLT F;  3NQT A;  5JAV A;  2Z0S A;  3GTM B;  1DOL A;  3KK7 A;  4IUP A;  1QVF A;  2FHT A;  1A15 A;  2H5X A;  2QKI C;  3I8Z A;  1C7Y A;  3C1E A;  1PYB A;  1DGS A;  3BG3 A;  4RGO S;  3X3N A;  1X55 A;  4C2M H;  3RD4 A;  1SRU A;  1M90 C;  1M8A A;  2JA7 G;  4A3D G;  2A69 C;  4R1J A;  3MXN B;  3WDN A;  1J8I A;  3DXJ C;  5EKI A;  4KN7 C;  1OO9 B;  5L37 A;  3FKI H;  3BVG A;  1RL2 A;  3HZX A;  3A74 A;  3V96 A;  3R93 A;  1SFO B;  2O5J C;  5FOB B;  4GLX A;  4X64 Q;  3PF5 A;  2NUC A;  1EYC A;  4OWX B;  1VQJ A;  1RD9 D;  4RHR A;  5CBE E;  3BYT B;  3G6E A;  4ILW A;  5J3B A;  4WJ3 M;  4JK1 C;  3I3C A;  1EY7 A;  1JQY D;  5IGG A;  4A3B H;  1G29 1;  3ULJ A;  4O0A A;  4OX9 L;  1ML0 D;  2A68 C;  4UHV A;  1E0B A;  1KAW A;  3PIP 3;  3VYS A;  3HKZ G;  2OWO A;  3CC4 A;  4WOR A;  1EY9 A;  2F3I A;  1F2Y A;  5C3E H;  3P7J A;  1YNX A;  1LTB D;  5I4D A;  5IE8 A;  2XNA C;  4BY7 H;  2G9D A;  2B63 G;  2VW9 A;  2I5M X;  1ENA A;  1EL0 A;  1P8L A;  3NE5 B;  4ID6 A;  1XTC D;  5EGT A;  4U67 3;  2AMC B;  3D31 A;  3DM1 A;  1WYD A;  4PV1 C;  4DV0 L;  4QY7 A;  1O80 A;  3MC0 B;  3MFG A;  1PRT B;  3TN2 A;  4X64 L;  1EEF D;  1D8L A;  1GM5 A;  2K28 A;  1L0X B;  3VA5 A;  3NEL A;  1LT4 D;  2HIX A;  2PZT A;  4QUF A;  5IIF A;  3HOV B;  4P72 A;  4NB3 A;  4BBR G;  2PCF B;  1ONL A;  2F4V Q;  1J5E Q;  3GTG B;  4L6T B;  3CQZ B;  3SK6 A;  1KRS A;  1ZYR C;  1TQO A;  1MJC A;  2UUB L;  3K57 A;  3PIO 3;  2XWJ B;  4LUZ A;  5HUR A;  4LF4 Q;  1GHK A;  3J81 L;  1FVI A;  1HFN A;  4CGY B;  1SE4 A;  4HIO A;  4RAU C;  2A1A A;  1EQT A;  1UWV A;  2KED A;  3MEH A;  2MP1 A;  3PMF A;  2IHE A;  4LF9 Q;  2O4X A;  4KJO A;  1I4P A;  1BBX C;  4YY3 L;  2BA0 A;  2NVY B;  1NSN S;  5CV5 A;  4B3S L;  2PYK A;  1TWH H;  4IJH A;  1RCV D;  1VQC A;  1X56 A;  3FPU B;  1IW7 D;  1V1P A;  3EFX D;  5BR8 L;  3CF5 A;  1N36 L;  1C8C A;  2DY8 A;  2F0G A;  4JOI C;  4A3J G;  2AWO A;  3I90 A;  1EY4 A;  2Z6K A;  1KXL A;  3OTO L;  4DV5 L;  3ITP A;  3SK4 A;  5LL6 X;  5C4X G;  3K8A A;  2F3W A;  2UXD Q;  3ERS X;  2V1C C;  2NVY H;  2XRS D;  5AFW A;  4G57 A;  1NMF A;  3E5S A;  4BA2 I;  4TVA B;  2E2J B;  1R9T H;  3FDT A;  3QB3 A;  4K6D A;  3S9W A;  1Z7T A;  3U4Z A;  2QW7 A;  1LTG D;  3TP8 A;  1A8V A;  3H0G B;  1RTO A;  4BA1 I;  1BCP B;  2IX0 A;  3KBG A;  5FLM G;  3ND8 A;  1E7Z A;  1L0Y B;  1DJR D;  4PZ8 A;  1S5E D;  4UP9 A;  2RDH A;  1O7Z A;  3U50 C;  4KHP Q;  1T5E A;  5GRO A;  3J81 c;  3S1Q H;  1JJC B;  3PCO B;  3KJO A;  1KAB A;  2JSO A;  3T13 A;  5D65 A;  4HJ9 A;  2ES2 A;  4RA8 A;  3TRE A;  2RSO A;  3U9O A;  3BDC A;  3OIP A;  4EX5 A;  4IUN A;  3OHX C;  2EDG A;  2VB2 X;  3A7L A;  1N34 L;  4QJF A;  1GKH A;  1WTH A;  5COR A;  1WTX A; 
#chains in the Genus database with same CATH homology
 2AHO B;  3GDE A;  2JK8 A;  1S72 A;  3RN2 A;  5GAH C;  4ALP A;  4JI4 Q;  2ASB A;  5LMN Q;  3M4Q A;  1SE8 A;  2EQS A;  3I7F A;  4A3M G;  1C9O A;  1HNX L;  4DR6 L;  4JV5 Q;  3CME A;  5FJ8 G;  2RHS B;  4A3E H;  3CD6 A;  1EWI A;  3NBH B;  2VQE L;  4IPH A;  1VQO A;  2WB1 G;  2F52 A;  5ELN A;  2K4K A;  1P16 A;  1OXV A;  3BU2 A;  4P74 A;  4DR4 Q;  4NXN L;  2CFM A;  1CUK A;  5C4J H;  1ASZ A;  3JAM c;  1N33 Q;  3I4N H;  1EQR A;  4APV A;  4AIM A;  3L0O A;  3PIO A;  4DR1 L;  2KHI A;  3TS2 A;  1VQD A;  3KDF A;  3S17 H;  2LXJ A;  2JA6 H;  4DUY Q;  4B3M Q;  2VNU D;  3RLF A;  2B3G A;  4DV6 L;  4NXM L;  1FGU A;  4DV2 Q;  3M4P A;  1IBL Q;  4DR7 Q;  1YI2 A;  5C44 G;  4GN5 A;  3HOY H;  3HOY G;  1Q12 A;  4GOP B;  1JE5 A;  2QEX A;  3HOW G;  4A93 G;  4IO9 A;  4A76 A;  3S15 H;  2ATW A;  1YIJ A;  3F2B A;  3DM3 A;  2YTV A;  1Z47 A;  1UE5 A;  2ZM6 Q;  1I94 Q;  4DV3 L;  3PO2 H;  2QGQ A;  1G51 A;  1J6Q A;  4JBK A;  3KF8 B;  1U0L A;  1EIF A;  2JJQ A;  2GVA A;  3W5O A;  3H15 A;  4UY8 C;  4Y7N H;  4DR5 Q;  1JJG A;  1PV4 A;  1VQA A;  3CP0 A;  3KDF B;  3PO3 G;  3S16 H;  1N8R C;  3IRB A;  4A93 H;  2A19 A;  2JA5 H;  4PZ7 A;  4JI7 L;  1JJ2 A;  3KF6 A;  3PIP A;  2PMZ E;  1K73 C;  1SFO H;  5JJK A;  2OQK A;  4HJ7 A;  2UUA Q;  3MEF A;  2JA6 G;  2JA8 H;  4ME3 A;  4MNO A;  4QGU A;  5M3F H;  1X54 A;  1QZG A;  4OO1 I;  2I5L X;  2JQO A;  1LTL A;  4GLA C;  4IFD G;  1WJJ A;  1XJV A;  3M4O H;  3STB C;  5M5Y H;  1K8A C;  1N33 L;  5M5W H;  4FDB A;  4LFB Q;  2R7Z H;  2K52 A;  3F1Z A;  1CSP A;  1YBY A;  1CKO A;  1BBW A;  4LUO A;  5AJ3 L;  1IBK Q;  1I6H H;  1RIP A;  1PH6 A;  4DV6 Q;  3L2P A;  4NXM Q;  4YHH Q;  1PH4 A;  1VQP A;  1VQ4 A;  3HOU G;  3K80 C;  1Q81 C;  4HIK A;  1YHA A;  3A0J A;  1HNX Q;  4DR6 Q;  4IFD I;  3PO3 H;  4POG A;  3S14 H;  2VL6 A;  1L1O A;  2UUC L;  1MKH A;  2MFI A;  2IY5 B;  1X3G A;  1GD7 A;  1X9N A;  4O2D A;  1OXT A;  4DR3 Q;  1XMO Q;  1Q8K A;  1XNQ L;  1Z9F A;  2VQF Q;  4K0K L;  1VQ7 A;  3UDF A;  1NJI C;  5IWA Q;  2PQA A;  2KCM A;  3U4V A;  1TWG H;  4LF9 L;  2OQ0 A;  2E2I H;  2JEA I;  3I4M G;  4JI8 L;  3H3V H;  1VQN A;  4GKJ Q;  4LUV A;  4Y52 H;  1UE6 A;  1BBU A;  4BBS G;  3HOX H;  1HR0 Q;  4LF6 Q;  3GTG H;  2RCN A;  4B3M L;  3VDY A;  3HKS A;  3I4N G;  1LYL A;  3L7Z C;  3PUX A;  3UE1 A;  5GAG C;  4DV4 Q;  2XGT A;  4DKA C;  2R93 G;  3T1H Q;  2WAQ G;  1PA6 A;  3CAM A;  3HOV H;  3G71 A;  1KIX A;  4P73 A;  4DV7 Q;  2JEB I;  4DR2 Q;  5JEA J;  4A3E G;  4LF7 L;  1E22 A;  2ZJP A;  4A3J H;  4JBM A;  4JBW A;  1KL9 A;  3BZK A;  3W1B A;  4JI5 L;  3RR5 A;  4LF5 Q;  4A3B G;  4B3S Q;  4EQ5 A;  4DR5 L;  3FHW A;  3S2D H;  5IYB H;  4A3K G;  3KJP A;  1EQQ A;  1PH7 A;  3GTP H;  1E1O A;  2JA9 A;  4R4Q A;  3J7Z C;  4GNX A;  3UE0 A;  3FP9 A;  1I50 H;  4YWL A;  2HHH L;  3TEH B;  3CC2 A;  3KYH C;  1N34 Q;  3CCR A;  1H95 A;  5H1S E;  2MO0 A;  3I4M H;  1WCM H;  3ER0 A;  2UU9 L;  1TWF H;  2YYZ A;  3EIV A;  1AE2 A;  3KLW A;  4IOC A;  4LFC Q;  3CQZ H;  3KF6 B;  3RLN A;  3J80 c;  3CCS A;  4PZ6 A;  3T1H L;  1WI5 A;  2E5L Q;  4BY1 G;  3NEN A;  4OO1 G;  3H0G H;  1PYS B;  4A3D H;  1WFQ A;  3ULL A;  3BZC A;  1QUQ A;  4JI0 L;  3T1Y Q;  3PUY A;  4A3I H;  3S1R H;  4A3G G;  1A63 A;  4YCV A;  2KHJ A;  4HJ8 A;  2ZTD A;  3S24 A;  1X3E A;  1HNW L;  2BH2 A;  4DUY L;  3RNU A;  2R92 G;  1E3P A;  3PO2 G;  2UUB Q;  2Q2U A;  4DUZ L;  1UE7 A;  4B3R L;  1N32 L;  3K81 C;  3CMA A;  3KFU A;  3CCQ A;  1JB7 A;  4X66 L;  4OXP A;  1ASY A;  2K5N A;  1U5K A;  4X66 Q;  3A5U A;  1KQS A;  2DUD A;  4L5S A;  1PVO A;  4B3R Q;  3STB D;  2N49 A;  1N32 Q;  1VQF A;  2VQE Q;  1XNR Q;  4HJA A;  1L1O B;  5HY6 A;  3M85 A;  2VUM G;  1T9H A;  2I0Q A;  1Q82 C;  1PH1 A;  4BY7 G;  1V43 A;  1OXU A;  1JMC A;  3GD7 A;  2GN5 A;  4A3C G;  2KEN A;  1N9W A;  4H02 A;  5LMU Q;  3TS0 A;  1B70 B;  3AFP A;  2JA8 G;  4XIG S;  5M3M G;  4A3C H;  2OTL A;  4L5Q A;  3M9B A;  1IBK L;  3D0F A;  4LF4 L;  1TWA H;  2F4V L;  4RG1 A;  2PQA B;  1S3O A;  1IXR A;  4BBR H;  5FJ8 H;  4DNI A;  1B8A A;  4B3T Q;  3S1N H;  1K83 H;  1HNW Q;  2PI2 A;  1IZ6 A;  1YVC A;  2IX1 A;  5GAD C;  4OON A;  2N8N A;  3BJU A;  4R4O A;  4JI1 L;  4LWC A;  4UP8 A;  1PH2 A;  4GKK L;  2UXC Q;  4OWT B;  3T1Y L;  1IYJ B;  1YHQ A;  1BVS A;  1Y14 B;  1Y1V H;  2CKZ B;  3E9H A;  4DV1 Q;  2B29 A;  2WB1 E;  1I3Q H;  3H3V I;  1NMG A;  3TQY A;  1IBM L;  4LFC L;  3CCJ A;  4JI6 L;  2UUA L;  5IYD H;  4DV0 Q;  3Q8D A;  4LF8 L;  4R4I A;  1MIU A;  5IT9 c;  1VQ6 A;  4C3I H;  3UDG A;  3I55 A;  3U58 A;  3AYH B;  2Q2T A;  2ZJR A;  1VQL A;  3GTO H;  3H0G G;  1E1T A;  2HHH Q;  3S1M H;  3K7U C;  1MJE A;  4R4T A;  5LMN W;  2KCT A;  4LF5 L;  1YJW A;  2NZH A;  1HZC A;  1EUJ A;  3DLL A;  2K5V A;  5JJI A;  2R7F A;  4AQY Q;  1XPU A;  2CWA A;  2VZA A;  4LF8 Q;  4GN4 B;  2YTY A;  2IT1 A;  3JC6 6;  3PUV A;  2BA1 A;  3W1G A;  5C0X I;  2FXQ A;  1SR3 A;  3J81 j;  1K8G A;  2BH8 A;  4JI5 Q;  2Y0S G;  4MTN A;  3GTK H;  4YWK A;  2HT1 A;  1YIT A;  2C35 B;  1Y1W H;  4GOP C;  2AWN A;  4JI8 Q;  4DAM A;  4DV7 L;  1NY4 A;  1E24 A;  1GO3 E;  1VQI A;  4DR1 Q;  4DR2 L;  3A5Z B;  4A3K H;  4JI2 L;  1B7Y B;  1CKM A;  3AFQ A;  4R4C A;  4IPC A;  5C0X J;  3CC7 A;  3PF4 A;  1OXS C;  1VQM A;  4OX9 Q;  2B63 H;  4KLK A;  4YCW A;  4YCU A;  4DV4 L;  3CCL A;  3GTM H;  4DR4 L;  1X65 A;  2Z0S A;  3RN5 A;  2YU9 H;  1V9P A;  2CQO A;  1QUQ B;  5HGQ A;  4IOA A;  4B3T L;  1QVF A;  3PGZ A;  4LFB L;  4GS3 A;  2VQF L;  2K75 A;  1XNQ Q;  5ELO A;  2D62 A;  2QA4 A;  2H5X A;  3OW2 A;  1HR0 W;  2IHF A;  4GLV B;  5C4X H;  4JBJ A;  4GNX B;  1Q86 C;  1PYB A;  1C7Y A;  1DGS A;  4A3F H;  2R7D A;  1YJ9 A;  4YY3 Q;  5LMU L;  1X55 A;  4C2M H;  1SRU A;  4A3I G;  1M90 C;  5E7N A;  1XMQ L;  3LGJ A;  3F8T A;  1KRT A;  4A3D G;  2JA7 G;  4R1J A;  3MXN B;  4DUZ Q;  1XPO A;  3J7A 5;  2OCE A;  2MQH A;  3FKI H;  3PV0 A;  3KOJ A;  1RL2 A;  4PMW A;  3CCV A;  4JI6 Q;  1Q7Y C;  2NN6 I;  3CW2 C;  2UUC Q;  2Z6K C;  3I2Z A;  1I5F A;  2JE6 I;  3A74 A;  2A8V A;  4AH6 A;  3E0E A;  1A62 A;  2DGY A;  2D0O A;  4DV1 L;  3J81 i;  1PH3 A;  4HJ5 A;  4GLX A;  4X64 Q;  3K0X A;  3PF5 A;  1LUZ A;  1HJP A;  4OWX B;  3GTJ H;  2E2J H;  4GKK Q;  2UXC L;  1VS0 A;  3UDI A;  1VQJ A;  3EN2 A;  4KHZ A;  4YWM A;  2WAQ E;  3CCE A;  2ZTE A;  3G6E A;  5IP7 H;  5J3B A;  4WJ3 M;  4JI7 Q;  4AQY L;  4JI0 Q;  4A3B H;  2LXK A;  3NEM A;  1G29 1;  3ULJ A;  4X65 Q;  3CPW A;  1PH9 A;  1EIY B;  4HID A;  4O0A A;  4OX9 L;  3GTQ H;  1JT8 A;  5IP9 H;  1Y1W G;  4A3F G;  2VY3 A;  2EXD A;  3PUW A;  1FJG Q;  1KAW A;  3CCU A;  4IFD J;  1VQK A;  3HKZ G;  2OWO A;  2RHQ B;  5M3M H;  3CC4 A;  4JCV E;  2ZM6 L;  1YZ6 A;  3I4O A;  2F3I A;  1UE1 A;  2R7Z G;  1VQH A;  5C3E H;  2WP8 J;  2R93 H;  3HOZ G;  1YNX A;  1K0R A;  1QZH A;  4DAY B;  5IE8 A;  4LFA L;  5FLX c;  1PH8 A;  4C3J H;  2ID0 A;  1IBM Q;  4BY7 H;  1I94 L;  3GO5 A;  2B63 G;  2EIF A;  4DK3 C;  3EBE A;  1BKB A;  2LSS A;  2VW9 A;  2I5M X;  4TQU S;  1P8L A;  1J5E L;  2WFW A;  1HNZ L;  1SN8 A;  2E2H H;  3CPF A;  3D31 A;  2AMC B;  1WYD A;  4DR7 L;  2ALY B;  5IYC G;  2JA5 G;  2PNH A;  4QL5 A;  1CSQ A;  4DK6 C;  3JAM i;  4QY7 A;  4DV0 L;  1HZ9 A;  1CKN B;  2HIV A;  4X64 L;  4BXX H;  1YHB A;  3PSI A;  2K5H A;  1QVG A;  1M1K C;  1L0W A;  2K14 A;  4JI2 Q;  4JYA L;  1D8L A;  1GM5 A;  3OTO Q;  3CXC A;  4DV5 Q;  2ZTC A;  1KHI A;  4GN3 B;  3NEL A;  2JA7 H;  2HIX A;  2ZJQ A;  2N78 A;  2VS1 A;  2K50 A;  4P75 A;  4LF6 L;  4P72 A;  4POF A;  4NB3 A;  4BBR G;  5C44 H;  1XNR L;  1W2B A;  4GKJ L;  1C0A A;  5JJL A;  1N36 Q;  2F4V Q;  1J5E Q;  1XMQ Q;  1FJG L;  1K9M C;  1D7Q A;  4BXX G;  1TWC H;  4X62 L;  4KI0 A;  1HH2 P;  4JI4 L;  1CKN A;  1XTD A;  3ZJY C;  4L5T A;  3SGI A;  1Y1V G;  1KRS A;  4JI3 Q;  1Q1E A;  1X6O A;  4NPS A;  5JEA G;  5LMN L;  1MJC A;  2UUB L;  3AEV A;  3CCM A;  4QQB X;  4LW1 A;  4YHH L;  5M3F G;  2OTJ A;  3TRZ A;  2E8G A;  2R6G A;  4A3L G;  4A3L H;  1AH9 A;  1AE3 A;  2PI2 E;  1SRO A;  3M7N A;  4LUZ A;  4PG3 A;  4LF4 Q;  2N3S A;  4JOI A;  2HQL A;  2I5H A;  4A3M H;  2MO1 A;  1FVI A;  4JC0 A;  1IL2 A;  2NZO A;  1G6P A;  4HIO A;  1OXX K;  1VQB A;  1EFW A;  4GNX C;  3HFZ B;  4JI1 Q;  3RZD H;  4L5R C;  1TXY A;  2YV5 A;  3HOV G;  1NTG A;  4XTC S;  2A1A A;  2NVX H;  4DPG A;  2VUM H;  1NBW A;  1UWV A;  1UEB A;  5DLQ E;  1Q46 A;  4OWW B;  1VCI A;  2IHE A;  5GAE C;  1Q1B A;  4LF9 Q;  3HOW H;  3G48 A;  4BY1 H;  1WOC A;  5GQO A;  4KHP L;  2UXB L;  4YY3 L;  2BA0 A;  1PH5 A;  5IYD G;  4JI3 L;  3HKZ E;  2NVQ H;  3F2D A;  1VQE A;  4B3S L;  4DV3 Q;  1VQ8 A;  1TWH H;  4IJH A;  1VQC A;  4UP7 A;  5IYC H;  5M5X H;  1X56 A;  4JG2 A;  3G4S A;  1VQG A;  4LF7 Q;  5EAY A;  1PHJ A;  3K7A H;  3OYY A;  1KD1 C;  5FLM H;  2AKW B;  4X62 Q;  5BR8 L;  4JYA Q;  4WJ4 A;  4MZ9 A;  4LNQ A;  3CF5 A;  1N36 L;  5IYB G;  2MNA A;  4C3H H;  5C0X G;  1L2F A;  4GOP A;  2XTI A;  2UU9 Q;  2UXD L;  4RMF A;  5BR8 Q;  3HOZ H;  4X6A H;  1EOV A;  5C3E G;  1HR0 L;  4JOI C;  4A3J G;  1OTC A;  2AWO A;  2L15 A;  2Z6K A;  1L1O C;  5AJ3 Q;  1KXL A;  3OTO L;  4DV5 L;  3E9I A;  1HNZ Q;  3AQQ A;  1PFS A;  5C4X G;  3K8A A;  2UXD Q;  3GTL H;  3ERS X;  2V1C C;  2NVY H;  2R92 H;  2KBN A;  5IP9 G;  1HZB A;  1FL0 A;  5IWA L;  3F2C A;  1SMX A;  1EYG A;  4LFA Q;  1A0I A;  1NMF A;  3RZO H;  4TVA B;  4BA2 I;  3PUZ A;  4QIW E;  5IP7 G;  1R9T H;  3S2H H;  4AYB E;  1W3S A;  3RLO A;  3HOX G;  4BBS H;  2UXB Q;  1NE3 A;  4NXN Q;  3U4Z A;  1X3F A;  4DR3 L;  1XMO L;  2Q2I A;  5IY0 A;  2D0P A;  1QVC A;  2Q2H A;  3B6Y A;  1V1Q A;  1LM0 A;  2GVB A;  1O7I A;  1A8V A;  4J15 A;  3M3Y H;  4BA1 I;  4JV5 L;  2IX0 A;  4A3G H;  1YEZ A;  4HIM A;  5FLM G;  1S40 A;  1E7Z A;  4AYB G;  3I56 A;  2RF4 A;  4IPG A;  4PZ8 A;  4UP9 A;  4K0K Q;  4KHP Q;  3U50 C;  1KC8 C;  4A4I A;  4A75 A;  3FKI G;  5GRO A;  4P71 A;  1JJC B;  4X65 L;  3J81 c;  1YJN A;  4IJL A;  3S1Q H;  3PCO B;  3KJO A;  4UPA A;  3J80 i;  1K3R A;  4HJ9 A;  3WWV A;  4IPD A;  2ES2 A;  5K36 G;  2Y0S E;  1IBL L;  1XPR A;  1HZA A;  1WCM G;  4DV2 L;  1SLJ A;  3TRE A;  1VQ9 A;  2CCZ A;  1VQ5 A;  2E5L L;  2NN6 G;  3ULP A;  3HOU H;  4EX5 A;  2YTX A;  2CWP A;  3UDX A;  3ICE A;  1GVP A;  4QJF A;  1GKH A;  1N34 L;  2NVT H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...