4DV1Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv1Q00
4P75A 2GVAA 4JCVE 1XMQQ 2YTVA 1X54A 4X65Q 4GNXB 1NBWA 1Q8KA 1YEZA 1PH6A 4DR4Q 4LFBL 3NBHB 4JI4Q 1HZ9A 1PH9A 2AWNA 1RL2A 4BA1I 2F52A 3PIOA 3KJPA 4DUZQ 1PHJA 1VQNA 2VUMH 3L7ZC 1SN8A 2E2JH 1BBUA 4JI0L 1PH2A 3GD7A 3CAMA 4YY3Q 2HT1A 5FLMH 1VQCA 4RG1A 4DR5L 1KQSA 3A5ZB 4HIDA 1Q82C 1I6HH 3ERSX 2Q2TA 4LF8L 5C4JH 4QJFA 4Y52H 1NJIC 3K81C 3HOVH 1HZAA 2YTYA 1IBLL 1X56A 3PGZA 3HOXH 1YI2A 4HJ9A 1RIPA 5IT9c 3BZCA 2IHFA 1FGUA 1L1OC 1YHQA 5LMNL 1JJCB 4HJ5A 3RNUA 3I2ZA 1G6PA 4MNOA 4JI6L 3S1NH 3KLWA 1IBKL 3MXNB 1PH5A 1M90C 3UE1A 4IJHA 4NB3A 1WOCA 1AE3A 1SFOH 3CCUA 1XPOA 3KYHC 4GKJL 2VQEQ 1PH3A 3WWVA 4C2MH 3L2PA 1HNWQ 3IRBA 1M1KC 2NVYH 5FLXc 1B70B 1AE2A 1EQRA 4DV4L 1K3RA 2K52A 4R1JA 1ASYA 3RLFA 3CCQA 1VQ8A 4DV0L 2KBNA 3S2DH 1P16A 1TXYA 3JC66 4YCUA 1Q7YC 1KD1C 3I4NH 3GTGH 4X64Q 3BJUA 1L2FA 1N34L 5GADC 1OXUA 1JE5A 3J7ZC 2RF4A 2VQFQ 4HIKA 3HOWH 4PG3A 4C3IH 1V43A 2LXKA 5ELNA 3TREA 1PA6A 1NMGA 2VUMG 1I3QH 2JQOA 3FHWA 4GS3A 2NVTH 3TS2A 1S3OA 5C44H 3F2CA 4TVAB 4L5SA 1CSPA 1OXVA 5FJ8H 5LMUL 4LF5L 5FLMG 1N33L 3CF5A 2QA4A 3W5OA 2ATWA 3PO3H 4HJAA 1FVIA 4BBSH 1HR0L 5GQOA 4YCVA 4LNQA 1Y1VH 3F2BA 3HOXG 4DV2L 1CKNA 1HNXL 4NXNQ 3S1MH 3KDFA 3S2HH 4YHHL 1EWIA 3I4MH 2KCTA 4LW1A 4DV6L 4OX9Q 1E1TA 2RCNA 3T1YL 4OONA 4GOPC 5AJ3L 1YIJA 3GTMH 4BXXH 4LF9L 1NMFA 4DPGA 1IBMQ 1D8LA 3OW2A 3W1GA 4DUYQ 1UE5A 3TS0A 2F4VQ 1L1OB 1TWAH 3K7UC 3STBD 3U4ZA 1VQ7A 1Y14B 4A3LH 3UDFA 4AIMA 4DV1L 2UUCQ 2IT1A 2UUBL 3T1HQ 2CQOA 2ASBA 4JYAQ 3UDGA 1PFSA 4OWXB 2IX1A 3CC4A 4AH6A 1IYJB 1PH7A 4LFBQ 2ZJQA 1E1OA 4L5TA 4WJ4A 1XPRA 1CKMA 1PYBA 1KIXA 2R93H 3I4NG 4DR3L 1HNZL 5ELOA 3STBC 4YWKA 2QGQA 3CCSA 4JI0Q 4P73A 4BA2I 3E9IA 3HOWG 1TWCH 2PQAB 4DR5Q 3I4OA 5C4XH 4NXMQ 2RHQB 3CW2C 2NVQH 1YITA 1N36Q 1A0IA 1ASZA 1P8LA 3KJOA 3HOYH 1A62A 2IX0A 5GAEC 2RHSB 1B8AA 5C44G 1I50H 5HY6A 1PH1A 2JA5G 5FJ8G 4A3BG 1WCMH 4JOIA 4DR7L 1VS0A 2UUAL 3GDEA 4IFDJ 5LMNQ 2R92H 2OTJA 1QZGA 4UP9A 4RMFA 4UPAA 1XMOL 4JI6Q 3I7FA 1IBKQ 3FP9A 1YHBA 3K0XA 4POFA 3I4MG 1N9WA 2MFIA 4GKJQ 1HZBA 1JT8A 2L15A 2AMCB 2ALYB 3A74A 3E9HA 3CCVA 4BXXG 3PUWA 1EUJA 4LFCL 1K0RA 4DK6C 4DV4Q 4A93H 2I5LX 4JI1L 3ULJA 4DV0Q 3OYYA 2Z6KA 1YJNA 3J7A5 1YVCA 2HIVA 4A3LG 2C35B 3AFPA 1QUQB 4GOPB 5JJIA 3PF4A 4IPDA 5IY0A 3K7AH 3CC2A 1VQBA 1SE8A 2IHEA 3K8AA 4IOAA 4A3KH 4A3FG 4LF6L 3PUXA 3ULLA 1MKHA 1YJ9A 2UU9L 2JA8H 2R93G 2ID0A 2R7DA 3JAMi 2CWAA 1VQKA 4YCWA 3HKZE 1VQ5A 3CD6A 4OWWB 2UXBL 4R4OA 2NVXH 3PUVA 4LF5Q 2MNAA 1IXRA 1PH8A 1N33Q 5C4XG 1SROA 3M9BA 4UY8C 3HOYG 2Y0SG 2FXQA 4LF7L 1X6OA 1LYLA 1Z9FA 3MEFA 1GM5A 1HR0Q 1HNXQ 1WCMG 4DV2Q 2AKWB 2PNHA 1UE7A 3EN2A 3LGJA 1FL0A 1JB7A 4YHHQ 2VW9A 3M4OH 4L5RC 4DV6Q 4LF4Q 4X6AH 1GVPA 2R92G 3A5UA 4YWMA 3ULPA 3T1YQ 2E2HH 3J80c 1VQDA 4OXPA 3UDIA 2HQLA 4LF9Q 4OO1G 1JJ2A 3KF6A 1VQIA 3RR5A 3H3VH 1SRUA 4JI3L 2UXDL 1IZ6A 4A3EG 3S16H 1VQLA 4DV1Q 4DR6L 2D0OA 2WP8J 4DR2L 2D62A 5C0XJ 1WYDA 2UUBQ 4KI0A 2KENA 5IP9H 2JA7H 1VQHA 4A93G 4IPGA 4DR1L 1YNXA 1G51A 2WB1E 4R4QA 2BA0A 4A3DH 2R7FA 4IPHA 4C3HH 2K5HA 3OTOL 4DV5L 4HJ7A 3S17H 4DR3Q 3PSIA 4C3JH 4A3KG 3TQYA 1YJWA 1QVFA 1YHAA 5GAHC 3RN5A 4JI8Q 2ZM6L 1WI5A 2JA5H 2JA8G 4LUZA 4A3BH 1PYSB 2IY5B 2K14A 1MJEA 1FJGL 2UUAQ 1X9NA 3F8TA 4OO1I 1VQGA 4MTNA 5M5XH 5JEAJ 2WFWA 1OXTA 1S40A 3RLOA 1WFQA 3S24A 3AFQA 1PV4A 3CQZH 1UE1A 3PUYA 2OQ0A 1VQ4A 3M4PA 1XNQL 4DUZL 2B3GA 4IPCA 1L0WA 4HIOA 2VL6A 1X3EA 4O2DA 5GAGC 3FKIH 5IYCH 1K9MC 4GKKL 5IWAL 4EQ5A 3KOJA 1CUKA 4JI1Q 1TWGH 3GO5A 2OTLA 2N8NA 3ICEA 1U5KA 1EIFA 2MO0A 5J3BA 2D0PA 4KLKA 2CFMA 5IP9G 1WJJA 5BR8L 2JA7G 2VNUD 4A3FH 4FDBA 2LXJA 3AEVA 1KAWA 2VY3A 2AWOA 1VQ6A 4A3DG 4LF6Q 2ZTCA 3RN2A 4EX5A 4A3CH 2NN6G 1X55A 1HZCA 1QZHA 2ES2A 2UU9Q 3G71A 2Q2UA 1BKBA 5JJLA 1UWVA 2LSSA 2A19A 2WAQG 2BH8A 2NZOA 1Y1WG 1YZ6A 2HIXA 2MO1A 3CCMA 2HHHL 3L0OA 4LF8Q 2UXBQ 3M4QA 3G6EA 2DGYA 4X62L 4JI7L 4B3RL 3CCJA 1U0LA 1E3PA 4AYBG 1IBLQ 1VQFA 5K36G 4LF7Q 1YBYA 4BBRH 1KC8C 3B6YA 5IYBG 3EBEA 1EFWA 1LM0A 3DLLA 1GKHA 4ALPA 1XNRL 2KCMA 3H3VI 5C3EH 2E5LL 3AYHB 2PQAA 1NE3A 1VQ9A 1I5FA 4J15A 2JA9A 3NELA 2I0QA 4UP8A 4DAYB 3J81i 3PO2H 4A3EH 4JBKA 2R7ZG 3DM3A 4JBMA 2UXDQ 4A3IG 3PIPA 4LUOA 3CMAA 5M3FG 1Q86C 4DR6Q 4DR2Q 3FKIG 5IYCG 2XGTA 3CXCA 1K73C 3GTOH 3S15H 3CC7A 3VDYA 2E8GA 4A3MG 2I5HA 2Q2HA 4DR1Q 1H95A 3ER0A 1KRTA 1NTGA 5M5YH 1N8RC 3PUZA 4JBJA 1UE6A 4NXNL 1C7YA 1X3GA 2AHOB 4P72A 1N34Q 1EOVA 2K50A 3CCLA 2UXCL 4WJ3M 2Z0SA 2CKZB 1K83H 4R4IA 1PH4A 4B3ML 4LFAL 4APVA 2YV5A 3GTPH 4R4CA 1V1QA 3RLNA 3UE0A 4A3CG 4GN3B 5IE8A 1X3FA 3AQQA 4JI5L 2ZM6Q 1IBML 2GN5A 2N49A 1BBWA 5LMUQ 3EIVA 5IP7H 2F4VL 2ZJPA 1HH2P 1TWHH 1J5EL 4DV3L 1O7IA 1FJGQ 3Q8DA 4GOPA 3M7NA 4KHPL 2OCEA 4GNXA 1KXLA 1BVSA 4QGUA 3I56A 3CP0A 2CCZA 4DAMA 2ZTDA 1EQQA 5DLQE 4MZ9A 4BBRG 1KL9A 1Q1EA 1VQMA 4XIGS 4K0KL 1Q1BA 3M85A 1KHIA 2XTIA 1XNQQ 4QQBX 1VQAA 2GVBA 5AJ3Q 2B29A 1OXXK 3U58A 2WB1G 5C3EG 4B3SL 1EYGA 5EAYA 2ZJRA 1CSQA 2YU9H 3H0GH 4JBWA 3G4SA 4GKKQ 4NXML 5M3MG 5IWAQ 5IYDH 3KF6B 3PO2G 1N36L 1N32L 4QIWE 4IFDG 3GTJH 4A4IA 4HIMA 3ZJYC 5BR8Q 1JMCA 4DNIA 4L5QA 5LMNW 4PZ6A 4A75A 2BH2A 2B63H 4X66L 4DV7L 5JJKA 2JA6H 1KRSA 3S14H 4DKAC 2A1AA 1HNZQ 1VQEA 3HOUG 1Y1WH 3F1ZA 4JOIC 2JK8A 3PF5A 2A8VA 4TQUS 2N78A 2Y0SE 2N3SA 4JV5L 2HHHQ 1G291 4QL5A 4YWLA 4B3TL 4KHZA 4AQYL 1IL2A 3D31A 2VZAA 4GLVB 4X62Q 2YTXA 1I94L 4JI2L 4JI7Q 4B3RQ 4BY1H 4LWCA 1GO3E 4PZ8A 4JG2A 5IYBH 5IP7G 3UDXA 1V9PA 4GLXA 1UEBA 2I5MX 4DR7Q 1B7YB 3HFZB 2CWPA 4UP7A 4HJ8A 1E7ZA 1XMQL 1NY4A 1XMOQ 4X65L 4DR4L 1XPUA 1XNRQ 3BU2A 1CKOA 3F2DA 4JI4L 4GLAC 3K80C 2E5LQ 1C9OA 4PZ7A 1HJPA 1CKNB 2MQHA 3J81j 2R7ZH 3KDFB 4IFDI 1VCIA 4A3IH 5M3FH 1MJCA 2Z6KC 2NZHA 2Q2IA 4YY3L 1K8AC 3TRZA 4A3MH 4LFCQ 1K8GA 1S72A 4PMWA 1J6QA 3H0GG 1VQOA 1JJGA 2KHJA 2JEBI 3E0EA 1QVCA 5IYDG 3J81c 1Q81C 4POGA 1Q46A 4IJLA 3CCEA 4JC0A 1W3SA 3HOVG 3J80i 3KF8B 1EIYB 1X65A 1HR0W 2K5NA 1Q12A 3M3YH 4GN5A 1MIUA 1R9TH 4LF4L 2OWOA 4B3MQ 2UXCQ 2VS1A 2F3IA 4LFAQ 4GN4B 3HOZH 2B63G 4A3JH 4O0AA 2JA6G 1L1OA 4GNXC 1C0AA 3RZOH 1SLJA 4JI5Q 1PVOA 4A3GH 5M5WH 5C0XG 4Y7NH 2VQEL 4BY7H 3SGIA 2PMZE 5GROA 3BZKA 1AH9A 3NEMA 1HNWL 1E24A 4DV3Q 1J5EQ 3A0JA 3JAMc 4KHPQ 2JE6I 2BA1A 1D7QA 4JYAL 2H5XA 4BY1G 3GTKH 1DGSA 2E2IH 3CPFA 2EIFA 2EXDA 3HKSA 4LUVA 1T9HA 4X64L 1XJVA 4K0KQ 2K5VA 2OQKA 1E22A 4QY7A 2VQFL 3CMEA 1VQPA 2ZTEA 5HGQA 3CCRA 4NPSA 1XTDA 3S1RH 5M3MH 4OWTB 4B3SQ 2DUDA 1OXSC 4JI3Q 4JI8L 2K4KA 2V1CC 1Z47A 4DK3C 4H02A 3I55A 1LUZA 1SR3A 3GTLH 1N32Q 3D0FA 2NN6I 5JEAG 2JJQA 4IOCA 2PI2A 2KHIA 4XTCS 1W2BA 3HKZG 4ME3A 3PCOB 1GD7A 2EQSA 3U4VA 1A8VA 3G48A 2WAQE 5C0XI 3PO3G 4X66Q 4DV7Q 3OTOQ 3H15A 4DV5Q 4A76A 2JEAI 4IO9A 2YYZA 3HOUH 3KFUA 1Y1VG 4OX9L 4BBSG 3NENA 1VQJA 3U50C 4AYBE 1QVGA 2K75A 4P71A 3GTQH 1SMXA 1LTLA 3HOZG 3S1QH 4JV5Q 2R6GA 4P74A 3W1BA 4A3JG 4DUYL 4AQYQ 3RZDH 4B3TQ 3TEHB 3CPWA 1I94Q 4JI2Q 1OTCA 4A3GG 1A63A 2UUCL 4BY7G 2QEXA 1QUQA 1TWFH 3T1HL 2PI2E 3PV0A 4R4TA 5E7NA 5H1SE
chains in the Genus database with same CATH superfamily
4P75A 5I2XA 2YTVA 4X65Q 4CKBA 4EQPA 4JI4Q 1HZ9A 2AWNA 2J0TD 3TDQA 4DUZQ 2WV6D 1PHJA 2KCCA 1BBUA 4JI0L 2HT1A 3C2PA 3J80E 1QG7A 3ERSX 4IZ8A 1FGBD 1PZKD 5I6YA 5C4JH 1AZPA 1NJIC 4OIJA 1HZAA 3DEPA 3HOXH 2R3ZA 3R93A 1FGUA 1JJCB 4HJ5A 3BDOA 3S1NH 2FFKB 2Z9HA 3TSSA 1HCZA 3CCUA 1XPOA 3KYHC 4GKJL 2KVMA 5C4HA 2K01A 1M1KC 1D1KA 5FLXc 1K3RA 1CTMA 1TWFB 2A68C 1VQ8A 1P16A 1TXYA 2SNMA 1DOMA 1KD1C 3I4NH 2V4DA 1L2FA 1N34L 2PPBC 4OEMB 1F2ZA 2KCNA 2NUCA 5LL6X 1EY7A 4PG3A 1V43A 2E2JB 3TREA 1NMGA 1DOLA 2NVTH 3TS2A 1S3OA 1I6HB 4TVAB 1AW7A 4Z9CB 2HUGA 4FO2A 1AN8A 3CF5A 1IW7C 4ZKCB 5C6AA 4HSPA 5GQOA 2DY8A 4LNQA 1F9RA 5KIXA 1XTCD 2KCTA 4LW1A 5K5PA 3T1YL 4OONA 5I6WA 1Y69U 4QF4A 1S5FD 4KK7A 4BXXH 1QNUA 4ME5A 5IT9L 3TS0A 3STBD 2NYZD 2K5DA 5LHY1 4CKEA 4JYAQ 1DXMA 3UDGA 2IX1A 3CC4A 3OOCA 4AH6A 3MTSA 4IALA 1JB3A 1EWCA 1HQRD 1PH7A 2CHBD 4WJ4A 1CKMA 4RKBA 4C3IB 4DR3L 3N6RA 4DR5Q 3QOJA 2PQAB 2Q8TA 3VR6A 3FPUB 3IKJA 4NXMQ 2NVQH 1YITA 1N36Q 2E75C 1PH1A 1WCMH 4DR7L 4WJWA 2UUAL 4QB4A 1CHPD 4IFDJ 1F9QA 3K0YA 1NNXA 2R92H 4F88A 2OTJA 4UPAA 3I4MB 3SK4A 4H0LC 1YHBA 2D9UA 4POFA 3I4MG 1JT8A 2P5ZX 3A74A 2M2LA 3G6JB 4EGVA 1EUJA 2HCIA 4DV4Q 5IGBA 4JI1L 1EYDA 3EJIA 2C35B 3PF4A 3OIPA 3DWAA 1BO0A 4RAUC 1MKHA 1TWCB 1SYFA 2ID0A 3JAMi 4YCWA 1VQ5A 2UXBL 3HOYB 2NVXH 1V1PA 4U673 1PH8A 4ZUJA 1N33Q 2FMCA 1BDOA 3HOYG 3OWFA 3DXJC 3E0JA 3D6CA 3EN2A 2PNHA 1UE7A 3Q6SA 1FL0A 4YHHQ 5ELFA 4DV6Q 4LF4Q 3HRZC 1GVPA 3QOLA 2RSOA 3ULPA 2E2HH 1ONLA 4FP5D 1VMPA 1B3AA 4OO1G 2B39A 2VXWA 1LT3D 1QJOA 1HQMC 3S16H 1VQLA 2D0OA 5C0XJ 2UUBQ 2JA7H 2ZT9C 4KJNA 4IPGA 1EU4A 2BA0A 2ZXOA 2R7FA 4A3KB 5FOBB 3S17H 1KDBA 1D5ZC 4HR7B 5EPJA 2JA8B 4A3KG 4LK1C 1U9RA 5CV5A 3RN5A 5IGGA 4KD3A 2JA8G 4DNTB 2K14A 1FJGL 5EGTA 4OO1I 1VQGA 2KHSA 1DZ1A 2DN8A 5JEAJ 2WFWA 4KY7A 3DUZA 2C5CA 3AFQA 1UE1A 1RODA 4IPCA 1WTPA 1L0WA 3NTKA 2O5JC 1X3EA 4O2DA 1K9MC 5IYCH 4GKKL 3LWUA 5IWAL 3BG3A 4EQ5A 1PRTC 4XYQA 4XT1B 3GO5A 1STGA 2N8NA 4A3DB 4KLKA 1WJJA 4C3HB 4A3FH 4FDBA 1AZQA 4A3DG 1OO9B 4LF6Q 4DK1A 4C3HG 5FLXL 1X55A 4C3JB 1HZCA 1E2WA 3J7AV 4MN3A 1BKBA 4DA2A 1GJXA 3NTIA 4N8X1 2A19A 2BH8A 2NZOA 4C3JG 4AYBB 1YZ6A 1KDAA 4NW2A 4A3BB 4NMZA 3G6EA 1PTOH 3CCJA 1E3PA 4AYBG 1U4RA 3VYUA 2F0HA 5K36G 4LF7Q 2JN4A 5A35A 3EBEA 5IGEA 2B2VC 3CHBD 3CQZB 1GKHA 4ALPA 3SE0A 5C3EH 2F3VA 1QWYA 2A5HA 2PZUA 4NKLA 2PQAA 2IW3A 2JA9A 5C5LA 2I0QA 2F0EA 2DNCA 4UDUC 2QKIC 3DM3A 2UXDQ 1EFID 2B8FA 4LUOA 3PIPA 4A3MB 4CJ1B 4DR6Q 4DR2Q 1HA5A 1ICWA 4K6LA 5EJWA 3GTOH 2E8GA 4A3MG 1IHZA 2Q2HA 1HTPA 4DR1Q 1N8RC 1NCVA 4F8MA 4P72A 1N34Q 1RKNA 3D6WA 2Z0SA 4B3ML 1K83H 4WFN3 1PRTB 2YV5A 1E2VA 1V1QA 3RLNA 3UE0A 4A3CG 3VYSA 5IE8A 4FXGC 4JI5L 2ZM6Q 3C1FA 3NQIA 4ODGA 2N49A 2F4VL 5IP7H 1EOTA 3R8BA 1HTLD 3ZYYX 4BBRB 4GNXA 1KXLA 2A6ED 4IUQA 3OPOA 2CCZA 2ZTDA 5DLQE 4BBRG 4HN7A 3HZXA 1R4QB 3M4YA 1Q1BA 2BOSA 1XNQQ 5A2QE 2GVBA 3U58A 1RF2D 3PO2B 4B3SL 1HUMA 4YIJA 5EAYA 1F2MA 4JBWA 2PCFB 3Q0AA 3HS0C 3C1EA 5IYDH 3PO2G 4CJ0B 4QIWE 3WOFA 5HGTA 3GTJH 4IFDG 1IYUA 1JOKA 4HIMA 4K2KA 1LV9A 5BR8Q 1NR4A 2XRQD 1HFGA 5LMNW 3QR8A 4X66L 2B63H 1KRSA 4IUVA 3HOUG 4JOIC 2JK8A 1KTKA 4XT3B 3CU7A 5EQ0A 1SAPA 3D31A 2VZAA 2LFNA 3T51B 4JI7Q 4JI2L 4BS9A 4BY1H 2EY6A 3MWYW 4PZ8A 4GLXA 4DR7Q 2Q8IB 1V9PA 1KABA 3R2TA 2CWPA 4UP7A 4X65L 1XPUA 4JI4L 4GLAC 4DF7A 3OMGA 2E5LQ 1C9OA 4IFDI 1CKNB 2MQHA 3KDFB 4FVMA 5KYIA 4A3IH 2Z6KC 1S5ED 3SDZA 4FYDA 3P20A 3IL8A 1S72A 1J6QA 3TP7A 2O2LD 3KBGA 4OELB 4IJLA 3CCEA 3C46A 2E76C 3D4DA 1HR0W 3S14B 4K14A 4ZLTF 4LFAQ 1V8QA 1PMRA 4A3JH 1L1OA 4LMQD 5CV7A 4IN3A 1PVOA 5M5WH 3NP8A 5C0XG 5GROA 1AH9A 2X6GA 4K5XA 1U4MA 3A0JA 1F77A 1IL8A 3BS1A 2JE6I 1D7QA 3QWNA 2QDLA 1D1IA 2K33A 2EIFA 1H9JA 1T9HA 1XJVA 2OQKA 1E22A 3CMEA 2ZTEA 3BVMA 3CCRA 1XTDA 3S1RH 4JI8L 2K4KA 2F0MA 2V1CC 1Z47A 2NBFA 4H02A 3I55A 1SR3A 5I9PA 1BXTA 3D0FA 3LNNA 2NN6I 2A74C 5JEAG 1GHJA 3J7YW 2EYFA 2IX3A 1JWMD 3PCOB 2SOBA 5C0XI 1A8VA 3G48A 2WAQE 4I7AA 1J9OA 2KECA 3SK5A 4DV7Q 4BBSG 4IO9A 2IWHA 3NENA 5CV8A 3MVVA 1LTID 4OHJA 3BDLA 4BY7B 4MHEA 4AQYQ 5DM73 4B3TQ 3TEHB 3CRLC 1I94Q 1OTCA 4BY7G 5DNFA 1TWFH 3PV0A 4JYAL 3A55A 2E2IB 2GVAA 4JCVE 1X54A 1YEZA 1PH9A 2PNRC 4PQXA 3TN2A 2F52A 1KNEA 3VYRA 3I90A 3L7ZC 2E2JH 3GD7A 4YY3Q 4DR5L 1KQSA 1NUCA 3A5ZB 1I6HH 2ICIA 1I50B 5KRUA 4PMCA 3X3NA 3PGZA 5IT9c 3RNUA 2RKSA 1A2TA 1R4PB 2KUMA 4MNOA 1WTWA 3KLWA 1PYWD 4IJHA 4NB3A 4ULLA 1WOCA 3GTQB 2QDBA 1DM0B 2A6HD 2B2VA 3RZDB 2VQEQ 3T56B 3SK6A 3IRBA 2XN9C 1EQRA 4DV4L 3D3RA 4DAPA 3A7LA 3S2DH 3JC66 4YCUA 4EQOA 4HMIA 4HTHA 3GTGH 3R2IA 3G7LA 3NUCA 1JE5A 2VQFQ 1ENAA 4C3IH 5ELNA 1I3QH 3FHWA 1M4VA 3F2CA 1OXVA 3BDCA 2K7VA 1N33L 3MEHA 2PO4A 5EKKA 1K3BC 1FVIA 4YCVA 1Y1VH 3F2BA 4XYOA 1CKNA 4J6HA 3KDFA 4YHHL 1MD2D 1EWIA 4BWGB 4DV6L 1EY8A 4OX9Q 3I4MH 3D4RA 4FXDA 1EQTA 3GTMH 5AJ3L 1YIJA 1NMFA 5F2DA 4C2MB 1GHKA 3VA5A 2F4VQ 1C4QA 2NVYB 3U4ZA 5COYA 4CBVA 2UUBL 5KNDA 2ASBA 2F1MA 1EY4A 1PFSA 2A69D 1ZYRC 1B9NA 4QUCA 4LFBQ 2ZJQA 3HOWB 1KIXA 3WDNA 1K8OA 1HNZL 1DOKA 1TU2B 4P73A 1ESFA 3E9IA 3HOWG 1TWCH 2F0LA 3I4OA 5C44B 1PLFA 5E4WC 3CW2C 2CW0D 3HOYH 1A62A 5C44G 1B8AA 1MSGA 1STAA 1TY0A 1DD2A 5FJ8G 4JOIA 4WRDA 1DCZA 4OGQC 3PO3B 1KNAA 1ZXTA 1QZGA 4UP9A 4JI6Q 1XMOL 3I7FA 3SR1A 5IIFA 4OO1H 1SE4A 3PMFA 4HEDA 2J4XA 1N9WA 4KTAA 2L15A 2ALYB 2I07B 3CCVA 4RH6A 4LFCL 4DK6C 1O7LA 3OYYA 1SJED 2Z6KA 4FF2A 4QIWB 4ZQ3A 4KKUA 3J7A5 1QUQB 2OEOA 3M7GA 3CC2A 1X3QA 5IY0A 4IOAA 1MSHA 2K03A 1PZJD 4A3KH 2R93B 4LF6L 3PUXA 5C5MA 3ULLA 1YJ9A 4KHVA 4B9XA 2JA8H 2R93G 5C4XB 2CWAA 4HSVA 1VQKA 3DWPA 3A8JE 2RDFA 3PUVA 3P75A 1XXGA 2R61A 5C4XG 1UAPA 4OL7A 5KEEA 1HFNA 3H3VC 3EQLC 3Q23A 4LF7L 3EFXD 1GM5A 1Z9FA 1HNXQ 1F2YA 1JB7A 3I72A 1D5XC 1LTBD 3A5UA 2PW7A 5JVG3 5J39A 3J80c 4LF9Q 1Y8NB 2HQLA 4A3EB 1JJ2A 2IPKD 1GUSA 1VQIA 3BYTB 2UXDL 4JI3L 4A3EG 4A93B 4DR6L 4DV1Q 4G7OC 4DR2L 1WD0A 1WYDA 4M1UB 4KI0A 5D3DA 4P2CB 4A93G 4DR1L 4R4QA 3AU7A 4A3DH 1ILQA 3K7AB 4C3HH 4JVZA 2K5HA 4DV5L 4HJ7A 1JORA 1FNUA 4C3JH 1IYVA 1YJWA 1QVFA 4JI8Q 2ZM6L 1WI5A 2JA5H 1TWHB 4A3BH 1B53A 1RDPD 1HUNA 2Q8RE 3I70A 1X9NA 2B2WC 3J81E 1K8MA 1SMYD 1OXTA 3M4OB 1WFQA 3A54A 3S24A 4DNRB 3CQZH 1YNJD 3MXGA 4IUPA 1XNQL 5I9OA 1PTOD 2B3GA 3NWTA 4QUFA 1NAPA 3QJYA 2DY7A 3IFDA 4HIOA 2EPBA 4KMUC 4V190 1O7YA 1FR3A 1U5KA 1PXUA 1EIFA 5J3BA 2D0PA 1I6VC 5IP9G 5BR8L 3JAME 1TS5A 4X3KA 4A3CH 1TS3A 2ZTCA 2WAQB 1LT5D 1Y1WB 2LSSA 2WAQG 1B2TA 2MPMA 1Y1WG 2HIXA 4KY5A 4RA8A 1PFBA 4JI7L 1U0LA 2EZVA 5DM63 1VQFA 1YBYA 4BBRH 2O4XA 1KC8C 5IYBG 2MGSA 1PTOF 3DLLA 2EOTA 3H3VI 1YNND 2E5LL 2R7ZB 2FMMA 3AYHB 1H9RA 1NE3A 2EJMA 3U9SA 1I5FA 1TS4A 1VQ9A 4J15A 2EJGC 4UP8A 4DAYB 3J81i 3FKIB 3PO2H 2R7ZG 5D65A 5M3FG 3FKIG 3CXCA 2XGTA 2BDOA 2KQ3A 3OSOA 3CC7A 2EY1A 1ET6A 5I4DA 3VDYA 4LJZC 2I5HA 1LO5D 1H95A 1KRTA 3IFTA 3GV3A 1CHQD 4NXNL 5CBEE 1EOVA 1WTXA 2EYOA 1JOOA 4LFAL 1JR0D 3S9WA 1EEID 4GN3B 3MXUA 3V96A 1IBML 3KBXA 5ELEA 1BBWA 1J8IA 4G7ZC 3I91A 1O7IA 2B8GA 3Q8DA 2NWGA 2OCEA 1C8CA 4OIKA 1BVSA 4RHRA 3I56A 3CP0A 5J22A 4ZYSA 1KL9A 2NB0A 1VQMA 4K8JA 3M85A 1VQAA 5M3MB 5AJ3Q 1OXXK 1BF4A 4G57A 2Z4IA 2QEJC 1FYCA 1CSQA 3MXPA 5M3MG 2RDGA 3KF6B 3S15B 1B50A 3NTHA 1JMCA 4JK1C 4PNYA 2NN6H 3D8GA 2BH2A 4DV7L 4B9WA 3S14H 3N52A 1HNZQ 1VQEA 3EA6A 5DEHA 5C0XH 3ND8A 2N78A 2Y0SE 3RUZA 1SYGA 4YWLA 4B3TL 4KHZA 4AQYL 1IL2A 3I73A 2YTXA 1I94L 3I4LA 4LWCA 2O5IC 3NWSA 4KY6A 3R3OA 4HJ8A 1NY4A 1XMOQ 1RCVD 2L9HA 1HJPA 4PZ7A 2YU9B 3H0GB 4JW0A 4L8JA 4YY3L 1K8AC 1EQVA 5NUCA 5JEAH 5T1IA 5M9OA 5EBDA 4LFCQ 1G6ZA 1JE4A 3H0GG 1VQOA 1PFMA 5EKLA 5CR3A 2JEBI 3E0EA 1QVCA 1LACA 1Q81C 4WORA 1Q46A 5ELCA 4R8NA 3J80L 1JICA 4ABNA 4CDFC 4EVOA 3S1NB 3KF8B 2Z4HA 2K5NA 3QO2A 4GN5A 2G5DA 2VS1A 3SK8A 4O0AA 1GUGA 2VQEL 4Y7NH 4BY7H 3SGIA 1SYBA 1J5EQ 5E4XA 1I4RA 3VYTA 2BA1A 3MC0B 3RD4A 2FHTA 1UEAB 2E2IH 1W6JA 4Q0FA 1SE3A 2AUKA 2SDFA 4FXKC 3H91A 2K5VA 2VQFL 5BN3A 1KDCA 2BE5C 4JI3Q 3URYA 4C1NI 1N32Q 1Z6HA 3GTLH 1CT1D 2RQXA 2KHIA 4XTCS 4ME3A 4ZKBB 3M3YB 4DV5Q 3H15A 2JEAI 4A76A 3KFUA 2TMPA 4OX9L 1VQJA 2LY7A 2CW0C 3T53B 2B2WA 3TP5A 4TRDA 3GTQH 4HMJA 2K1BA 2R6GA 1ICFB 1CK1A 3GQBA 5TSSA 3RZDH 4RGMA 2F0FA 5G3LD 3GTKB 1T5EA 2JXMB 4IUTA 5H1SE 1XMQQ 1TQOA 1PH6A 2H4OA 1NBWA 4DR4Q 4LFBL 4XQNA 1ILPA 4BA1I 1BNZA 3PIOA 3KJPA 4DN4M 4PMBA 3CAMA 2F0QA 1A2UA 2XWJB 4K6DA 4HIDA 1Q82C 3K81C 3HOVH 1YI2A 4HJ9A 2XNAC 2B2UC 2BCOA 1RIPA 1SJHD 3BZCA 3E5SA 3I2ZA 2A68D 1G6PA 3HOUB 4JI6L 1LT6D 2B2YC 3MXNB 1PH5A 1M90C 3P1HA 1L0XB 4K5WA 3TMEA 3S1QB 5G3LF 3WWVA 4C2MH 1HNWQ 1WTOA 2NVYH 1B70B 1AE2A 1ASYA 2K52A 2F0JA 1A15A 3RLFA 1K0SA 4UHVA 1SNPA 1IKLA 1FNVA 1Q7YC 1O78A 2DNEA 2AQ3B 2F0SA 4X64Q 2KEDA 3BVGA 1LTSD 2MHVA 1OXUA 1Q90A 2VUMB 1IW7D 2RF4A 4RCOA 3HOWH 1Z7TA 1LTAD 1CA5A 3T16A 3W3AA 2VUMG 4RFBA 3NQTA 5C44H 4L5SA 1CSPA 4IUNA 5FJ8H 3CRKC 3K5OA 5FLMG 2QILA 1MGSA 4O1NA 2JP1A 2WKCA 1B3QA 5IGDA 3PO3H 1SNMA 4HJAA 2EYPA 4NXNQ 4X6AH 1HNXL 2K05A 5FO9B 4CHTB 2E2HB 5JPNC 2M9VA 3OWEB 4QMGA 5DAUA 1SFOB 4LF9L 5JPMC 5ELBA 4DPGA 1IBMQ 1QNKA 2K5WA 1TWAH 1VQ7A 4AIMA 4DV1L 1Q8IA 2UUCQ 3T4AC 2HQEA 1LTGD 2IT1A 3T1HQ 2CQOA 3KF8A 2HCCA 4HCSA 1IYJB 1STBA 5JVH3 3S17B 1XPRA 4IQZA 2R93H 5ELOA 2IL8A 3STBC 3CCSA 1ML0D 2KOLA 5C4XH 2NZ1D 1GUNA 1ESRA 2PQEA 5D3IB 1ASZA 2B2TC 5GAEC 1BCPD 4RGOS 1XYIA 1VS0A 1GUTA 4BBSB 5LMNQ 1ZEQX 5E3FA 3S1MB 1FD7D 4B08A 5HURA 3QB3A 4RMFA 3S2HB 1IBKQ 3FP9A 2I46A 2WINB 4K5VA 3TZDA 2MFIA 1EU3A 1EY6A 1HZBA 4X3TA 2EVBA 2AMCB 3IAYA 3PUWA 2F03A 1K0RA 4C56C 1ENFA 1B9MA 4A93H 3ULJA 4DV0Q 4A3LG 1YVCA 1YNNC 1FNWA 2F0IA 3AFPA 3EVQA 2PZWA 4A3FB 2VB2X 4IPDA 3K7AH 1VQBA 2IHEA 1L0YB 3A56A 4A3FG 3K6OA 2E2DC 2K5QA 1MHWC 5FO7B 1KLGD 4FF1A 2E74C 2XIWA 3CD6A 5CV6A 1D2BA 1BCPF 1EY0A 4LF5Q 2Y0SB 4PV1C 1TIID 1IXRA 2MNAA 4UY8C 3VR5A 1TVXA 2Y0SG 2FXQA 3PIP3 4K2LA 4KV6A 3ND9A 1HR0Q 4DV2Q 5IOCA 3LGJA 4KN7C 2VW9A 3M4OH 4L5RC 2RDHA 3W2DA 4YWMA 1I4XA 1WD1A 1VQDA 1WTQA 3MFGA 3A8IE 3RR5A 3H3VH 4RKLA 2WP8J 4NP5A 4X3UA 1S5DD 5IP9H 1VQHA 3O13A 1D5MC 1F2LA 2SEBD 3MXNA 5EBCA 4IPHA 1GUOA 1K83B 1F9PA 3NBIA 3TQYA 4KJOA 1YHAA 1AEXA 5EKIA 3K5MA 3AMUA 1EY5A 4LUZA 1EY9A 2IY5B 2L4NA 5KYLA 2EY5A 3HGBA 3F8TA 4MTNA 1PRTD 1S40A 3RLOA 1PV4A 2N55A 3PUYA 2WACA 3BVZA 2JYOA 1VQ4A 1GOZA 1S5CD 3M4PA 1GUWA 3DHQA 4L6TB 3FKIH 2AQ2B 1SYDA 5C4ZA 5A2QL 1CUKA 1SE2A 4JPBW 4G7HC 2MO0A 3H94A 1KAWA 1VQ6A 4EX5A 3OW7A 4V0BA 2CH4W 1TS2A 1RD9D 3HG9A 2UU9Q 3FRPB 5JJLA 1UWVA 2EYLA 3A8KE 5KGUA 2EE1A 2F3WA 4XQQA 3CCMA 2B2YA 3M4QA 2DGYA 4NDXA 1PRTF 4I65A 1JCKB 5M5XB 2L0CA 2Z8LA 1HA6A 1ZKOA 1LM0A 3V2TA 2KCMA 1X32A 4A3IB 5I2YA 3NELA 3Q24A 5J1ZA 4DAVA 1PZID 2XSCA 4JBKA 4A3IG 1TWGB 3S15H 4N9PA 1EYAA 5D14A 4F7XA 1DONA 3ER0A 1NTGA 3NK9A 1UE6A 2KA7A 1M8AA 2AHOB 1TR5A 2CKZB 3P7JA 4APVA 4K8IA 4R4CA 4X3SA 1STNA 1X3FA 5CORA 2GN5A 1U4PA 1SNOA 1J5EL 3DM1A 2G9HD 2HDMA 2EY2A 1X3PA 2Z6BA 4MIUA 4DAMA 1EQQA 5T1GA 4MZ9A 2WB1B 4XIGS 4ZRZA 3T13A 1KHIA 3S1RB 3DMUA 2WB1G 4CKCA 1EYGA 2YU9H 1AP0A 4DGZA 3H0GH 3G4SA 3Q22A 2A6EC 5C3XA 1N32L 4A4IA 5M5YB 5FLXE 2KEEA 2DJFC 3ZJYC 4DNIA 2RVLA 4PZ6A 2B2TA 3GTPB 2EYJA 1BOSA 3VA7A 4TQUS 1HPCA 2N3SA 2LMCB 2HHHQ 4QL5A 1G91A 4X62Q 5K36H 1RHPA 4B3RQ 1GO3E 2FJ2A 3UDXA 4ID6A 1SDFA 4EQNA 1B7YB 3HFZB 3OIQA 3OHXC 1XMQL 4LAAA 3NXWA 4DR4L 1XNRQ 3BU2A 5AFWA 1CKOA 1CZWA 1Y8OB 3K5LA 3F2DA 4ZK9B 3K59A 3J81j 3LWEA 1VCIA 2ICEC 1JQYD 1GXDC 4A3MH 4ZAIA 5JAVA 1JJGA 2KHJA 4FF3A 3J81c 4POGA 1ENCA 1LABA 1W3SA 3SEBA 1II3A 1BBXC 3J80i 2JA6B 3M3YH 2UXCQ 1MIUA 4E6IA 4GN4B 3AB9A 1DYQA 2JA6G 4GNXC 1MBYA 1SLJA 5JOBA 1VF5C 3I8ZA 3U9OA 2Z1CA 4FNFA 2PMZE 3BZKA 2K6AA 1HNWL 4DV3Q 2F0WA 3JAMc 4KHPQ 2A73B 5JJZA 3S2DB 2XWBB 2H5XA 4R9WA 3GTKH 1BQQT 4J1MA 1H9MA 1EWHA 3CPFA 5FO8B 2EXDA 3GTGB 2J7ZA 1QB5D 3HKSA 4LUVA 1NR2A 4X64L 4K0KQ 4CGYB 4H13C 1NSNS 2D5DA 5M3FB 1VMCA 4NPSA 4QCLA 4OWTB 5C3WA 1I3QB 5LL6S 2EXZA 4C3IG 2IJ0A 4IFDH 3KLSA 2H1EA 1LUZA 2JJQA 3FVQA 4IOCA 1JWUD 1G2SA 4XQJA 1Y1VB 1GD7A 2FINB 3U4VA 3TZUA 3HOUH 2QF7A 1R9TB 1A3TA 3ERQA 1WVLA 2YYZA 1Y1VG 2EJFC 2X6LA 3HOZB 1KAAA 3U50C 3GTMB 3NE5B 1B1ZA 2M00A 3RZOB 2K75A 4A3GB 1BCPC 1SMXA 1JC7A 3HOZG 3S1QH 4JV5Q 4DFAA 3CKIB 4P74A 1BR9A 3E3XA 4A3GG 1G2TA 1STYA 1CA6A 2UUCL 1QUQA 3T1HL 2D2CC 2PI2E 3MHBA 1AFPA 1SYEA 5E7NA 1K28A 4KN4C 4RGNA 4GNXB 1Q8KA 1EL0A 2F0TA 3NBHB 4CJ2C 1RL2A 1UUPA 1VQNA 2VUMH 5EPLA 1SN8A 1PH2A 3J7AF 2PYKA 5FLMH 1VQCA 4RG1A 1S4ZA 5KNBA 2Q2TA 4LF8L 5CYUA 1JOQA 4QJFA 4Y52H 4I7ZC 2YTYA 1IBLL 1X56A 1YHQA 2IHFA 1L1OC 2OXPA 3H6MA 4HAEA 5LMNL 1SNQA 1JWSD 4CDDC 1IBKL 1U4LA 1XX8A 2PW5A 3UE1A 3K58A 1HXYD 1AE3A 2LKVA 4N9TA 1SFOH 4S3SA 1PH3A 2F0DA 3L2PA 3KLRA 1UNSA 1CM9A 4Q5VA 4R1JA 5CBAE 3CCQA 4DV0L 1HHVA 1SSOA 2KBNA 1XWEA 1LLRD 2K28A 1BCPB 2A6HC 3BJUA 2G9DA 5GADC 3J7ZC 4HIKA 2K04A 1Y8PB 2TSSA 2LXKA 1SNDA 1PA6A 1I4PA 3A7AB 2JQOA 4GS3A 3NSWA 5LMUL 5C4JB 2CVRA 4LF5L 3V05A 2L55A 4XXEA 3HOXB 4ILWA 2QA4A 3TP8A 3W5OA 2ATWA 2F0NA 4BBSH 1HR0L 1LTTD 3HOXG 4DV2L 3S1MH 3S2HH 5CMDA 1E1TA 2RCNA 4RCNA 1ZYRD 4GOPC 1D8LA 3OW2A 3W1GA 4DUYQ 3C3LA 1UE5A 3K5NA 1L1OB 3K7UC 4A3LH 1Y14B 2ENBA 3UDFA 4H7BA 3X3MA 1I4QA 4OWXB 3I4NB 3ITPA 1E1OA 1H9SB 4L5TA 1PYBA 3I4NG 1SNCA 4YWKA 2QGQA 4JI0Q 1SXTA 4BA2I 2LS01 2OF1A 4L63B 2NVTB 2JA5B 2BDNA 2RHQB 1QCBD 2RCFA 3HP3A 2A69C 1F9SA 3SHLA 1A0IA 1P8LA 3KJOA 3VR2A 2IX0A 2RHSB 4KD4A 2JA5G 1I50H 5HY6A 5FKAC 4A3BG 1QE6A 4J8QA 1T5XD 2X69A 3GDEA 4RWSC 1WTHA 4DAYA 4XDXA 3K0XA 3J81L 4GKJQ 3OMCA 2EYHA 3E6ZX 4KKTA 4DK0A 4BXXG 3E9HA 1ET9A 1HRJA 4M8AA 2JSOA 2I5LX 2WIIB 1SEBD 1YJNA 2HIVA 4GOPB 5JJIA 3KK7A 1SE8A 3K8AA 3ONAB 1B4OA 5ISRA 3JAML 2UU9L 3MZ5A 2R7DA 2NVQB 3HKZE 2F0UA 3DWQA 4R4OA 4OWWB 2NTTA 2F0GA 1QILA 1SROA 1WCMB 3M9BA 1STHA 3KLSX 1X6OA 1LYLA 3MEFA 3NBHA 2R92B 3K57A 1WCMG 2AKWB 1RTOA 2R92G 3T1YQ 3D4WA 4OXPA 3UDIA 1CFMA 3KF6A 3SVMA 1SRUA 1IZ6A 2F4IA 1I4HA 1CQFA 2D62A 2KENA 3DEOA 5KNCA 3MA2B 3LX0A 1YNXA 1G51A 2WB1E 3RMHA 3GV6A 2K32A 3OTOL 1Q3LA 4DR3Q 1B44D 2VB3X 3PSIA 2RA4A 2MJ8A 1E0BA 2L1BA 5GAHC 5EPKA 1O7ZA 2F0VA 2NVXB 1O80A 3UI2A 1PYSB 2PMZB 1MJEA 2UUAQ 2CQAA 3VR4A 5M5XH 1PDQA 1E2ZA 4R8IA 2AUJD 2L5TA 2OQ0A 4DUZL 5E1FA 3I3CA 3KUPA 2L11A 2L12A 2VL6A 4IURA 5GAGC 3S16B 3KOJA 1SMYC 1IKMA 4UAIA 4JI1Q 1TWGH 2JA7B 4H44C 1TT2A 2OTLA 4FF4A 1YNJC 5BN4A 3ICEA 2RSNA 2CFMA 1PTOC 2JA7G 2VNUD 2LXJA 3AEVA 2VY3A 3NHHA 2AWOA 3RN2A 2NN6G 4HCEA 4RHSA 1QZHA 5ELDA 2ES2A 4TKOB 1EZ6A 3G71A 2Q2UA 2ZXRA 2UXBQ 2HHHL 2MO1A 3L0OA 4LF8Q 3BYYB 4X62L 4B3RL 1MI2A 1EZ8A 1IBLQ 4C1NK 1LTRD 1H9SA 5IGCA 3B6YA 1EFWA 3FEWX 1XNRL 1C48A 2F0KA 1S5BD 4A3EH 4JBMA 1STEA 1SYCA 3CMAA 1Q86C 3HEJA 1K73C 5IYCG 3QIAA 4G4KA 5M5YH 3QG1A 3PUZA 2AQ1B 4JBJA 1C7YA 1X3GA 1WTVA 1I4GA 2N88A 2K50A 3CCLA 1WTRA 2UXCL 4WJ3M 4R4IA 1PH4A 3GTPH 4N8FA 3AQQA 4Y7NB 5LMUQ 3EIVA 3H09A 1PTOB 2ZJPA 1HH2P 1TWHH 1QOHA 4DV3L 2HDLA 1FJGQ 3M7NA 4CDCC 5IGFA 4GOPA 4KHPL 1VDZA 2MUYA 3TP6A 2ZXPA 4QGUA 3FPPA 1Q1EA 1A3VA 5IT9E 5C3EB 4K0KL 2NTSA 2XTIA 5IODA 4QQBX 2B29A 5C3EG 2ZJRA 4GKKQ 5CV9A 4NXML 5IWAQ 3GTLB 2EYMA 1N36L 3GTOB 1EIHA 1CQVA 4TSSA 2PZTA 3L3OC 1CZGA 2F0OA 4L5QA 3L9AX 1W6KA 4A75A 1A3UA 5JJKA 2JA6H 4DKAC 1RTNA 2A1AA 1EYCA 5CC4A 1Y1WH 3F1ZA 2A8VA 3PF5A 4MTKA 4U68A 4JV5L 3FMCA 1G291 3PIO3 4GLVB 4JG2A 5IYBH 5IP7G 1UEBA 2I5MX 4ZUIA 1H9KA 2XVSA 3NPPA 1E7ZA 5BN5A 2DJGC 1CI3M 3K80C 4DXFA 3PQIA 1PFNA 3FDTA 2R7ZH 3SXHA 3VR3A 5M3FH 3EROA 1MJCA 2SNSA 3MFYA 2NZHA 4DXGA 2Q2IA 4RGTA 4ZCKA 3TRZA 1K8GA 4PMWA 2MP1A 3GTJB 3F2UA 3HOVB 5IYDG 4JC0A 3HOVG 1EIYB 1X65A 2B63B 1Q12A 1R9TH 4LF4L 2OWOA 4B3MQ 2EDGA 2F3IA 5L37A 3HOZH 2RBMA 2B63G 2B2UA 1C0AA 1KLUD 3RZOH 3MAQA 4JI5Q 1EEFD 4A3GH 5FK9C 2C9OA 1TKWB 1EIGA 3NEMA 4GZYC 4BY1B 1E24A 1SBBB 2BE5D 4DU9A 5CV4A 4F87A 3BZDB 1LT4D 1G8ZD 4BY1G 1DGSA 2KJXA 4KKSA 2OT2A 1A6XA 4QY7A 4CDEC 2WKDA 1VQPA 2QW7A 1D6EC 5HGQA 4B3SQ 5M3MH 2DUDA 1OXSC 1V1OA 1VF7A 4DK3C 1BUVT 3HKZB 1TY2A 3GP7A 5CGKA 3WOEA 2PI2A 2GA4B 4O42A 1W2BA 3HKZG 2F0PA 2EQSA 3TBIB 3PO3G 4X66Q 3OTOQ 4A3JB 1DJRD 4AYBE 4IUUA 1QVGA 4P71A 2HD3A 2XRSD 1LTLA 5M5WB 2QCPX 3W1BA 1TWAB 4DUYL 4A3JG 1RJTA 3CPWA 4JI2Q 1A63A 2QEXA 1V1PB 2CH4A 4R4TA
chains in the Genus database with same CATH topology
4P75A 2GVAA 4JCVE 1XMQQ 2YTVA 1X54A 4X65Q 4GNXB 1NBWA 1Q8KA 1YEZA 1PH6A 4DR4Q 4LFBL 3NBHB 4JI4Q 1HZ9A 1PH9A 2AWNA 1RL2A 4BA1I 2F52A 3PIOA 3KJPA 4DUZQ 1PHJA 1VQNA 2VUMH 3L7ZC 1SN8A 2E2JH 1BBUA 4JI0L 1PH2A 3GD7A 3CAMA 4YY3Q 2HT1A 5FLMH 1VQCA 4RG1A 4DR5L 1KQSA 3A5ZB 4HIDA 1Q82C 1I6HH 3ERSX 2Q2TA 4LF8L 5C4JH 4QJFA 4Y52H 1NJIC 3K81C 3HOVH 1HZAA 2YTYA 1IBLL 1X56A 3PGZA 3HOXH 1YI2A 4HJ9A 1RIPA 5IT9c 3BZCA 2IHFA 1FGUA 1L1OC 1YHQA 5LMNL 1JJCB 4HJ5A 3RNUA 3I2ZA 1G6PA 4MNOA 4JI6L 3S1NH 3KLWA 1IBKL 3MXNB 1PH5A 1M90C 3UE1A 4IJHA 4NB3A 1WOCA 1AE3A 1SFOH 3CCUA 1XPOA 3KYHC 4GKJL 2VQEQ 1PH3A 3WWVA 4C2MH 3L2PA 1HNWQ 3IRBA 1M1KC 2NVYH 5FLXc 1B70B 1AE2A 1EQRA 4DV4L 1K3RA 2K52A 4R1JA 1ASYA 3RLFA 3CCQA 1VQ8A 4DV0L 2KBNA 3S2DH 1P16A 1TXYA 3JC66 4YCUA 1Q7YC 1KD1C 3I4NH 3GTGH 4X64Q 3BJUA 1L2FA 1N34L 5GADC 1OXUA 1JE5A 3J7ZC 2RF4A 2VQFQ 4HIKA 3HOWH 4PG3A 4C3IH 1V43A 2LXKA 5ELNA 3TREA 1PA6A 1NMGA 2VUMG 1I3QH 2JQOA 3FHWA 4GS3A 2NVTH 3TS2A 1S3OA 5C44H 3F2CA 4TVAB 4L5SA 1CSPA 1OXVA 5FJ8H 5LMUL 4LF5L 5FLMG 1N33L 3CF5A 2QA4A 3W5OA 2ATWA 3PO3H 4HJAA 1FVIA 4BBSH 1HR0L 5GQOA 4YCVA 4LNQA 1Y1VH 3F2BA 3HOXG 4DV2L 1CKNA 1HNXL 4NXNQ 3S1MH 3KDFA 3S2HH 4YHHL 1EWIA 3I4MH 2KCTA 4LW1A 4DV6L 4OX9Q 1E1TA 2RCNA 3T1YL 4OONA 4GOPC 5AJ3L 1YIJA 3GTMH 4BXXH 4LF9L 1NMFA 4DPGA 1IBMQ 1D8LA 3OW2A 3W1GA 4DUYQ 1UE5A 3TS0A 2F4VQ 1L1OB 1TWAH 3K7UC 3STBD 3U4ZA 1VQ7A 1Y14B 4A3LH 3UDFA 4AIMA 4DV1L 2UUCQ 2IT1A 2UUBL 3T1HQ 2CQOA 2ASBA 4JYAQ 3UDGA 1PFSA 4OWXB 2IX1A 3CC4A 4AH6A 1IYJB 1PH7A 4LFBQ 2ZJQA 1E1OA 4L5TA 4WJ4A 1XPRA 1CKMA 1PYBA 1KIXA 2R93H 3I4NG 4DR3L 1HNZL 5ELOA 3STBC 4YWKA 2QGQA 3CCSA 4JI0Q 4P73A 4BA2I 3E9IA 3HOWG 1TWCH 2PQAB 4DR5Q 3I4OA 5C4XH 4NXMQ 2RHQB 3CW2C 2NVQH 1YITA 1N36Q 1A0IA 1ASZA 1P8LA 3KJOA 3HOYH 1A62A 2IX0A 5GAEC 2RHSB 1B8AA 5C44G 1I50H 5HY6A 1PH1A 2JA5G 5FJ8G 4A3BG 1WCMH 4JOIA 4DR7L 1VS0A 2UUAL 3GDEA 4IFDJ 5LMNQ 2R92H 2OTJA 1QZGA 4UP9A 4RMFA 4UPAA 1XMOL 4JI6Q 3I7FA 1IBKQ 3FP9A 1YHBA 3K0XA 4POFA 3I4MG 1N9WA 2MFIA 4GKJQ 1HZBA 1JT8A 2L15A 2AMCB 2ALYB 3A74A 3E9HA 3CCVA 4BXXG 3PUWA 1EUJA 4LFCL 1K0RA 4DK6C 4DV4Q 4A93H 2I5LX 4JI1L 3ULJA 4DV0Q 3OYYA 2Z6KA 1YJNA 3J7A5 1YVCA 2HIVA 4A3LG 2C35B 3AFPA 1QUQB 4GOPB 5JJIA 3PF4A 4IPDA 5IY0A 3K7AH 3CC2A 1VQBA 1SE8A 2IHEA 3K8AA 4IOAA 4A3KH 4A3FG 4LF6L 3PUXA 3ULLA 1MKHA 1YJ9A 2UU9L 2JA8H 2R93G 2ID0A 2R7DA 3JAMi 2CWAA 1VQKA 4YCWA 3HKZE 1VQ5A 3CD6A 4OWWB 2UXBL 4R4OA 2NVXH 3PUVA 4LF5Q 2MNAA 1IXRA 1PH8A 1N33Q 5C4XG 1SROA 3M9BA 4UY8C 3HOYG 2Y0SG 2FXQA 4LF7L 1X6OA 1LYLA 1Z9FA 3MEFA 1GM5A 1HR0Q 1HNXQ 1WCMG 4DV2Q 2AKWB 2PNHA 1UE7A 3EN2A 3LGJA 1FL0A 1JB7A 4YHHQ 2VW9A 3M4OH 4L5RC 4DV6Q 4LF4Q 4X6AH 1GVPA 2R92G 3A5UA 4YWMA 3ULPA 3T1YQ 2E2HH 3J80c 1VQDA 4OXPA 3UDIA 2HQLA 4LF9Q 4OO1G 1JJ2A 3KF6A 1VQIA 3RR5A 3H3VH 1SRUA 4JI3L 2UXDL 1IZ6A 4A3EG 3S16H 1VQLA 4DV1Q 4DR6L 2D0OA 2WP8J 4DR2L 2D62A 5C0XJ 1WYDA 2UUBQ 4KI0A 2KENA 5IP9H 2JA7H 1VQHA 4A93G 4IPGA 4DR1L 1YNXA 1G51A 2WB1E 4R4QA 2BA0A 4A3DH 2R7FA 4IPHA 4C3HH 2K5HA 3OTOL 4DV5L 4HJ7A 3S17H 4DR3Q 3PSIA 4C3JH 4A3KG 3TQYA 1YJWA 1QVFA 1YHAA 5GAHC 3RN5A 4JI8Q 2ZM6L 1WI5A 2JA5H 2JA8G 4LUZA 4A3BH 1PYSB 2IY5B 2K14A 1MJEA 1FJGL 2UUAQ 1X9NA 3F8TA 4OO1I 1VQGA 4MTNA 5M5XH 5JEAJ 2WFWA 1OXTA 1S40A 3RLOA 1WFQA 3S24A 3AFQA 1PV4A 3CQZH 1UE1A 3PUYA 2OQ0A 1VQ4A 3M4PA 1XNQL 4DUZL 2B3GA 4IPCA 1L0WA 4HIOA 2VL6A 1X3EA 4O2DA 5GAGC 3FKIH 5IYCH 1K9MC 4GKKL 5IWAL 4EQ5A 3KOJA 1CUKA 4JI1Q 1TWGH 3GO5A 2OTLA 2N8NA 3ICEA 1U5KA 1EIFA 2MO0A 5J3BA 2D0PA 4KLKA 2CFMA 5IP9G 1WJJA 5BR8L 2JA7G 2VNUD 4A3FH 4FDBA 2LXJA 3AEVA 1KAWA 2VY3A 2AWOA 1VQ6A 4A3DG 4LF6Q 2ZTCA 3RN2A 4EX5A 4A3CH 2NN6G 1X55A 1HZCA 1QZHA 2ES2A 2UU9Q 3G71A 2Q2UA 1BKBA 5JJLA 1UWVA 2LSSA 2A19A 2WAQG 2BH8A 2NZOA 1Y1WG 1YZ6A 2HIXA 2MO1A 3CCMA 2HHHL 3L0OA 4LF8Q 2UXBQ 3M4QA 3G6EA 2DGYA 4X62L 4JI7L 4B3RL 3CCJA 1U0LA 1E3PA 4AYBG 1IBLQ 1VQFA 5K36G 4LF7Q 1YBYA 4BBRH 1KC8C 3B6YA 5IYBG 3EBEA 1EFWA 1LM0A 3DLLA 1GKHA 4ALPA 1XNRL 2KCMA 3H3VI 5C3EH 2E5LL 3AYHB 2PQAA 1NE3A 1VQ9A 1I5FA 4J15A 2JA9A 3NELA 2I0QA 4UP8A 4DAYB 3J81i 3PO2H 4A3EH 4JBKA 2R7ZG 3DM3A 4JBMA 2UXDQ 4A3IG 3PIPA 4LUOA 3CMAA 5M3FG 1Q86C 4DR6Q 4DR2Q 3FKIG 5IYCG 2XGTA 3CXCA 1K73C 3GTOH 3S15H 3CC7A 3VDYA 2E8GA 4A3MG 2I5HA 2Q2HA 4DR1Q 1H95A 3ER0A 1KRTA 1NTGA 5M5YH 1N8RC 3PUZA 4JBJA 1UE6A 4NXNL 1C7YA 1X3GA 2AHOB 4P72A 1N34Q 1EOVA 2K50A 3CCLA 2UXCL 4WJ3M 2Z0SA 2CKZB 1K83H 4R4IA 1PH4A 4B3ML 4LFAL 4APVA 2YV5A 3GTPH 4R4CA 1V1QA 3RLNA 3UE0A 4A3CG 4GN3B 5IE8A 1X3FA 3AQQA 4JI5L 2ZM6Q 1IBML 2GN5A 2N49A 1BBWA 5LMUQ 3EIVA 5IP7H 2F4VL 2ZJPA 1HH2P 1TWHH 1J5EL 4DV3L 1O7IA 1FJGQ 3Q8DA 4GOPA 3M7NA 4KHPL 2OCEA 4GNXA 1KXLA 1BVSA 4QGUA 3I56A 3CP0A 2CCZA 4DAMA 2ZTDA 1EQQA 5DLQE 4MZ9A 4BBRG 1KL9A 1Q1EA 1VQMA 4XIGS 4K0KL 1Q1BA 3M85A 1KHIA 2XTIA 1XNQQ 4QQBX 1VQAA 2GVBA 5AJ3Q 2B29A 1OXXK 3U58A 2WB1G 5C3EG 4B3SL 1EYGA 5EAYA 2ZJRA 1CSQA 2YU9H 3H0GH 4JBWA 3G4SA 4GKKQ 4NXML 5M3MG 5IWAQ 5IYDH 3KF6B 3PO2G 1N36L 1N32L 4QIWE 4IFDG 3GTJH 4A4IA 4HIMA 3ZJYC 5BR8Q 1JMCA 4DNIA 4L5QA 5LMNW 4PZ6A 4A75A 2BH2A 2B63H 4X66L 4DV7L 5JJKA 2JA6H 1KRSA 3S14H 4DKAC 2A1AA 1HNZQ 1VQEA 3HOUG 1Y1WH 3F1ZA 4JOIC 2JK8A 3PF5A 2A8VA 4TQUS 2N78A 2Y0SE 2N3SA 4JV5L 2HHHQ 1G291 4QL5A 4YWLA 4B3TL 4KHZA 4AQYL 1IL2A 3D31A 2VZAA 4GLVB 4X62Q 2YTXA 1I94L 4JI2L 4JI7Q 4B3RQ 4BY1H 4LWCA 1GO3E 4PZ8A 4JG2A 5IYBH 5IP7G 3UDXA 1V9PA 4GLXA 1UEBA 2I5MX 4DR7Q 1B7YB 3HFZB 2CWPA 4UP7A 4HJ8A 1E7ZA 1XMQL 1NY4A 1XMOQ 4X65L 4DR4L 1XPUA 1XNRQ 3BU2A 1CKOA 3F2DA 4JI4L 4GLAC 3K80C 2E5LQ 1C9OA 4PZ7A 1HJPA 1CKNB 2MQHA 3J81j 2R7ZH 3KDFB 4IFDI 1VCIA 4A3IH 5M3FH 1MJCA 2Z6KC 2NZHA 2Q2IA 4YY3L 1K8AC 3TRZA 4A3MH 4LFCQ 1K8GA 1S72A 4PMWA 1J6QA 3H0GG 1VQOA 1JJGA 2KHJA 2JEBI 3E0EA 1QVCA 5IYDG 3J81c 1Q81C 4POGA 1Q46A 4IJLA 3CCEA 4JC0A 1W3SA 3HOVG 3J80i 3KF8B 1EIYB 1X65A 1HR0W 2K5NA 1Q12A 3M3YH 4GN5A 1MIUA 1R9TH 4LF4L 2OWOA 4B3MQ 2UXCQ 2VS1A 2F3IA 4LFAQ 4GN4B 3HOZH 2B63G 4A3JH 4O0AA 2JA6G 1L1OA 4GNXC 1C0AA 3RZOH 1SLJA 4JI5Q 1PVOA 4A3GH 5M5WH 5C0XG 4Y7NH 2VQEL 4BY7H 3SGIA 2PMZE 5GROA 3BZKA 1AH9A 3NEMA 1HNWL 1E24A 4DV3Q 1J5EQ 3A0JA 3JAMc 4KHPQ 2JE6I 2BA1A 1D7QA 4JYAL 2H5XA 4BY1G 3GTKH 1DGSA 2E2IH 3CPFA 2EIFA 2EXDA 3HKSA 4LUVA 1T9HA 4X64L 1XJVA 4K0KQ 2K5VA 2OQKA 1E22A 4QY7A 2VQFL 3CMEA 1VQPA 2ZTEA 5HGQA 3CCRA 4NPSA 1XTDA 3S1RH 5M3MH 4OWTB 4B3SQ 2DUDA 1OXSC 4JI3Q 4JI8L 2K4KA 2V1CC 1Z47A 4DK3C 4H02A 3I55A 1LUZA 1SR3A 3GTLH 1N32Q 3D0FA 2NN6I 5JEAG 2JJQA 4IOCA 2PI2A 2KHIA 4XTCS 1W2BA 3HKZG 4ME3A 3PCOB 1GD7A 2EQSA 3U4VA 1A8VA 3G48A 2WAQE 5C0XI 3PO3G 4X66Q 4DV7Q 3OTOQ 3H15A 4DV5Q 4A76A 2JEAI 4IO9A 2YYZA 3HOUH 3KFUA 1Y1VG 4OX9L 4BBSG 3NENA 1VQJA 3U50C 4AYBE 1QVGA 2K75A 4P71A 3GTQH 1SMXA 1LTLA 3HOZG 3S1QH 4JV5Q 2R6GA 4P74A 3W1BA 4A3JG 4DUYL 4AQYQ 3RZDH 4B3TQ 3TEHB 3CPWA 1I94Q 4JI2Q 1OTCA 4A3GG 1A63A 2UUCL 4BY7G 2QEXA 1QUQA 1TWFH 3T1HL 2PI2E 3PV0A 4R4TA 5E7NA 5H1SE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P75 A;  2GVA A;  4JCV E;  1XMQ Q;  2YTV A;  1X54 A;  4X65 Q;  4GNX B;  1NBW A;  1Q8K A;  1YEZ A;  1PH6 A;  4DR4 Q;  4LFB L;  3NBH B;  4JI4 Q;  1HZ9 A;  1PH9 A;  2AWN A;  1RL2 A;  4BA1 I;  2F52 A;  3PIO A;  3KJP A;  4DUZ Q;  1PHJ A;  1VQN A;  2VUM H;  3L7Z C;  1SN8 A;  2E2J H;  1BBU A;  4JI0 L;  1PH2 A;  3GD7 A;  3CAM A;  4YY3 Q;  2HT1 A;  5FLM H;  1VQC A;  4RG1 A;  4DR5 L;  1KQS A;  3A5Z B;  4HID A;  1Q82 C;  1I6H H;  3ERS X;  2Q2T A;  4LF8 L;  5C4J H;  4QJF A;  4Y52 H;  1NJI C;  3K81 C;  3HOV H;  1HZA A;  2YTY A;  1IBL L;  1X56 A;  3PGZ A;  3HOX H;  1YI2 A;  4HJ9 A;  1RIP A;  5IT9 c;  3BZC A;  2IHF A;  1FGU A;  1L1O C;  1YHQ A;  5LMN L;  1JJC B;  4HJ5 A;  3RNU A;  3I2Z A;  1G6P A;  4MNO A;  4JI6 L;  3S1N H;  3KLW A;  1IBK L;  3MXN B;  1PH5 A;  1M90 C;  3UE1 A;  4IJH A;  4NB3 A;  1WOC A;  1AE3 A;  1SFO H;  3CCU A;  1XPO A;  3KYH C;  4GKJ L;  2VQE Q;  1PH3 A;  3WWV A;  4C2M H;  3L2P A;  1HNW Q;  3IRB A;  1M1K C;  2NVY H;  5FLX c;  1B70 B;  1AE2 A;  1EQR A;  4DV4 L;  1K3R A;  2K52 A;  4R1J A;  1ASY A;  3RLF A;  3CCQ A;  1VQ8 A;  4DV0 L;  2KBN A;  3S2D H;  1P16 A;  1TXY A;  3JC6 6;  4YCU A;  1Q7Y C;  1KD1 C;  3I4N H;  3GTG H;  4X64 Q;  3BJU A;  1L2F A;  1N34 L;  5GAD C;  1OXU A;  1JE5 A;  3J7Z C;  2RF4 A;  2VQF Q;  4HIK A;  3HOW H;  4PG3 A;  4C3I H;  1V43 A;  2LXK A;  5ELN A;  3TRE A;  1PA6 A;  1NMG A;  2VUM G;  1I3Q H;  2JQO A;  3FHW A;  4GS3 A;  2NVT H;  3TS2 A;  1S3O A;  5C44 H;  3F2C A;  4TVA B;  4L5S A;  1CSP A;  1OXV A;  5FJ8 H;  5LMU L;  4LF5 L;  5FLM G;  1N33 L;  3CF5 A;  2QA4 A;  3W5O A;  2ATW A;  3PO3 H;  4HJA A;  1FVI A;  4BBS H;  1HR0 L;  5GQO A;  4YCV A;  4LNQ A;  1Y1V H;  3F2B A;  3HOX G;  4DV2 L;  1CKN A;  1HNX L;  4NXN Q;  3S1M H;  3KDF A;  3S2H H;  4YHH L;  1EWI A;  3I4M H;  2KCT A;  4LW1 A;  4DV6 L;  4OX9 Q;  1E1T A;  2RCN A;  3T1Y L;  4OON A;  4GOP C;  5AJ3 L;  1YIJ A;  3GTM H;  4BXX H;  4LF9 L;  1NMF A;  4DPG A;  1IBM Q;  1D8L A;  3OW2 A;  3W1G A;  4DUY Q;  1UE5 A;  3TS0 A;  2F4V Q;  1L1O B;  1TWA H;  3K7U C;  3STB D;  3U4Z A;  1VQ7 A;  1Y14 B;  4A3L H;  3UDF A;  4AIM A;  4DV1 L;  2UUC Q;  2IT1 A;  2UUB L;  3T1H Q;  2CQO A;  2ASB A;  4JYA Q;  3UDG A;  1PFS A;  4OWX B;  2IX1 A;  3CC4 A;  4AH6 A;  1IYJ B;  1PH7 A;  4LFB Q;  2ZJQ A;  1E1O A;  4L5T A;  4WJ4 A;  1XPR A;  1CKM A;  1PYB A;  1KIX A;  2R93 H;  3I4N G;  4DR3 L;  1HNZ L;  5ELO A;  3STB C;  4YWK A;  2QGQ A;  3CCS A;  4JI0 Q;  4P73 A;  4BA2 I;  3E9I A;  3HOW G;  1TWC H;  2PQA B;  4DR5 Q;  3I4O A;  5C4X H;  4NXM Q;  2RHQ B;  3CW2 C;  2NVQ H;  1YIT A;  1N36 Q;  1A0I A;  1ASZ A;  1P8L A;  3KJO A;  3HOY H;  1A62 A;  2IX0 A;  5GAE C;  2RHS B;  1B8A A;  5C44 G;  1I50 H;  5HY6 A;  1PH1 A;  2JA5 G;  5FJ8 G;  4A3B G;  1WCM H;  4JOI A;  4DR7 L;  1VS0 A;  2UUA L;  3GDE A;  4IFD J;  5LMN Q;  2R92 H;  2OTJ A;  1QZG A;  4UP9 A;  4RMF A;  4UPA A;  1XMO L;  4JI6 Q;  3I7F A;  1IBK Q;  3FP9 A;  1YHB A;  3K0X A;  4POF A;  3I4M G;  1N9W A;  2MFI A;  4GKJ Q;  1HZB A;  1JT8 A;  2L15 A;  2AMC B;  2ALY B;  3A74 A;  3E9H A;  3CCV A;  4BXX G;  3PUW A;  1EUJ A;  4LFC L;  1K0R A;  4DK6 C;  4DV4 Q;  4A93 H;  2I5L X;  4JI1 L;  3ULJ A;  4DV0 Q;  3OYY A;  2Z6K A;  1YJN A;  3J7A 5;  1YVC A;  2HIV A;  4A3L G;  2C35 B;  3AFP A;  1QUQ B;  4GOP B;  5JJI A;  3PF4 A;  4IPD A;  5IY0 A;  3K7A H;  3CC2 A;  1VQB A;  1SE8 A;  2IHE A;  3K8A A;  4IOA A;  4A3K H;  4A3F G;  4LF6 L;  3PUX A;  3ULL A;  1MKH A;  1YJ9 A;  2UU9 L;  2JA8 H;  2R93 G;  2ID0 A;  2R7D A;  3JAM i;  2CWA A;  1VQK A;  4YCW A;  3HKZ E;  1VQ5 A;  3CD6 A;  4OWW B;  2UXB L;  4R4O A;  2NVX H;  3PUV A;  4LF5 Q;  2MNA A;  1IXR A;  1PH8 A;  1N33 Q;  5C4X G;  1SRO A;  3M9B A;  4UY8 C;  3HOY G;  2Y0S G;  2FXQ A;  4LF7 L;  1X6O A;  1LYL A;  1Z9F A;  3MEF A;  1GM5 A;  1HR0 Q;  1HNX Q;  1WCM G;  4DV2 Q;  2AKW B;  2PNH A;  1UE7 A;  3EN2 A;  3LGJ A;  1FL0 A;  1JB7 A;  4YHH Q;  2VW9 A;  3M4O H;  4L5R C;  4DV6 Q;  4LF4 Q;  4X6A H;  1GVP A;  2R92 G;  3A5U A;  4YWM A;  3ULP A;  3T1Y Q;  2E2H H;  3J80 c;  1VQD A;  4OXP A;  3UDI A;  2HQL A;  4LF9 Q;  4OO1 G;  1JJ2 A;  3KF6 A;  1VQI A;  3RR5 A;  3H3V H;  1SRU A;  4JI3 L;  2UXD L;  1IZ6 A;  4A3E G;  3S16 H;  1VQL A;  4DV1 Q;  4DR6 L;  2D0O A;  2WP8 J;  4DR2 L;  2D62 A;  5C0X J;  1WYD A;  2UUB Q;  4KI0 A;  2KEN A;  5IP9 H;  2JA7 H;  1VQH A;  4A93 G;  4IPG A;  4DR1 L;  1YNX A;  1G51 A;  2WB1 E;  4R4Q A;  2BA0 A;  4A3D H;  2R7F A;  4IPH A;  4C3H H;  2K5H A;  3OTO L;  4DV5 L;  4HJ7 A;  3S17 H;  4DR3 Q;  3PSI A;  4C3J H;  4A3K G;  3TQY A;  1YJW A;  1QVF A;  1YHA A;  5GAH C;  3RN5 A;  4JI8 Q;  2ZM6 L;  1WI5 A;  2JA5 H;  2JA8 G;  4LUZ A;  4A3B H;  1PYS B;  2IY5 B;  2K14 A;  1MJE A;  1FJG L;  2UUA Q;  1X9N A;  3F8T A;  4OO1 I;  1VQG A;  4MTN A;  5M5X H;  5JEA J;  2WFW A;  1OXT A;  1S40 A;  3RLO A;  1WFQ A;  3S24 A;  3AFQ A;  1PV4 A;  3CQZ H;  1UE1 A;  3PUY A;  2OQ0 A;  1VQ4 A;  3M4P A;  1XNQ L;  4DUZ L;  2B3G A;  4IPC A;  1L0W A;  4HIO A;  2VL6 A;  1X3E A;  4O2D A;  5GAG C;  3FKI H;  5IYC H;  1K9M C;  4GKK L;  5IWA L;  4EQ5 A;  3KOJ A;  1CUK A;  4JI1 Q;  1TWG H;  3GO5 A;  2OTL A;  2N8N A;  3ICE A;  1U5K A;  1EIF A;  2MO0 A;  5J3B A;  2D0P A;  4KLK A;  2CFM A;  5IP9 G;  1WJJ A;  5BR8 L;  2JA7 G;  2VNU D;  4A3F H;  4FDB A;  2LXJ A;  3AEV A;  1KAW A;  2VY3 A;  2AWO A;  1VQ6 A;  4A3D G;  4LF6 Q;  2ZTC A;  3RN2 A;  4EX5 A;  4A3C H;  2NN6 G;  1X55 A;  1HZC A;  1QZH A;  2ES2 A;  2UU9 Q;  3G71 A;  2Q2U A;  1BKB A;  5JJL A;  1UWV A;  2LSS A;  2A19 A;  2WAQ G;  2BH8 A;  2NZO A;  1Y1W G;  1YZ6 A;  2HIX A;  2MO1 A;  3CCM A;  2HHH L;  3L0O A;  4LF8 Q;  2UXB Q;  3M4Q A;  3G6E A;  2DGY A;  4X62 L;  4JI7 L;  4B3R L;  3CCJ A;  1U0L A;  1E3P A;  4AYB G;  1IBL Q;  1VQF A;  5K36 G;  4LF7 Q;  1YBY A;  4BBR H;  1KC8 C;  3B6Y A;  5IYB G;  3EBE A;  1EFW A;  1LM0 A;  3DLL A;  1GKH A;  4ALP A;  1XNR L;  2KCM A;  3H3V I;  5C3E H;  2E5L L;  3AYH B;  2PQA A;  1NE3 A;  1VQ9 A;  1I5F A;  4J15 A;  2JA9 A;  3NEL A;  2I0Q A;  4UP8 A;  4DAY B;  3J81 i;  3PO2 H;  4A3E H;  4JBK A;  2R7Z G;  3DM3 A;  4JBM A;  2UXD Q;  4A3I G;  3PIP A;  4LUO A;  3CMA A;  5M3F G;  1Q86 C;  4DR6 Q;  4DR2 Q;  3FKI G;  5IYC G;  2XGT A;  3CXC A;  1K73 C;  3GTO H;  3S15 H;  3CC7 A;  3VDY A;  2E8G A;  4A3M G;  2I5H A;  2Q2H A;  4DR1 Q;  1H95 A;  3ER0 A;  1KRT A;  1NTG A;  5M5Y H;  1N8R C;  3PUZ A;  4JBJ A;  1UE6 A;  4NXN L;  1C7Y A;  1X3G A;  2AHO B;  4P72 A;  1N34 Q;  1EOV A;  2K50 A;  3CCL A;  2UXC L;  4WJ3 M;  2Z0S A;  2CKZ B;  1K83 H;  4R4I A;  1PH4 A;  4B3M L;  4LFA L;  4APV A;  2YV5 A;  3GTP H;  4R4C A;  1V1Q A;  3RLN A;  3UE0 A;  4A3C G;  4GN3 B;  5IE8 A;  1X3F A;  3AQQ A;  4JI5 L;  2ZM6 Q;  1IBM L;  2GN5 A;  2N49 A;  1BBW A;  5LMU Q;  3EIV A;  5IP7 H;  2F4V L;  2ZJP A;  1HH2 P;  1TWH H;  1J5E L;  4DV3 L;  1O7I A;  1FJG Q;  3Q8D A;  4GOP A;  3M7N A;  4KHP L;  2OCE A;  4GNX A;  1KXL A;  1BVS A;  4QGU A;  3I56 A;  3CP0 A;  2CCZ A;  4DAM A;  2ZTD A;  1EQQ A;  5DLQ E;  4MZ9 A;  4BBR G;  1KL9 A;  1Q1E A;  1VQM A;  4XIG S;  4K0K L;  1Q1B A;  3M85 A;  1KHI A;  2XTI A;  1XNQ Q;  4QQB X;  1VQA A;  2GVB A;  5AJ3 Q;  2B29 A;  1OXX K;  3U58 A;  2WB1 G;  5C3E G;  4B3S L;  1EYG A;  5EAY A;  2ZJR A;  1CSQ A;  2YU9 H;  3H0G H;  4JBW A;  3G4S A;  4GKK Q;  4NXM L;  5M3M G;  5IWA Q;  5IYD H;  3KF6 B;  3PO2 G;  1N36 L;  1N32 L;  4QIW E;  4IFD G;  3GTJ H;  4A4I A;  4HIM A;  3ZJY C;  5BR8 Q;  1JMC A;  4DNI A;  4L5Q A;  5LMN W;  4PZ6 A;  4A75 A;  2BH2 A;  2B63 H;  4X66 L;  4DV7 L;  5JJK A;  2JA6 H;  1KRS A;  3S14 H;  4DKA C;  2A1A A;  1HNZ Q;  1VQE A;  3HOU G;  1Y1W H;  3F1Z A;  4JOI C;  2JK8 A;  3PF5 A;  2A8V A;  4TQU S;  2N78 A;  2Y0S E;  2N3S A;  4JV5 L;  2HHH Q;  1G29 1;  4QL5 A;  4YWL A;  4B3T L;  4KHZ A;  4AQY L;  1IL2 A;  3D31 A;  2VZA A;  4GLV B;  4X62 Q;  2YTX A;  1I94 L;  4JI2 L;  4JI7 Q;  4B3R Q;  4BY1 H;  4LWC A;  1GO3 E;  4PZ8 A;  4JG2 A;  5IYB H;  5IP7 G;  3UDX A;  1V9P A;  4GLX A;  1UEB A;  2I5M X;  4DR7 Q;  1B7Y B;  3HFZ B;  2CWP A;  4UP7 A;  4HJ8 A;  1E7Z A;  1XMQ L;  1NY4 A;  1XMO Q;  4X65 L;  4DR4 L;  1XPU A;  1XNR Q;  3BU2 A;  1CKO A;  3F2D A;  4JI4 L;  4GLA C;  3K80 C;  2E5L Q;  1C9O A;  4PZ7 A;  1HJP A;  1CKN B;  2MQH A;  3J81 j;  2R7Z H;  3KDF B;  4IFD I;  1VCI A;  4A3I H;  5M3F H;  1MJC A;  2Z6K C;  2NZH A;  2Q2I A;  4YY3 L;  1K8A C;  3TRZ A;  4A3M H;  4LFC Q;  1K8G A;  1S72 A;  4PMW A;  1J6Q A;  3H0G G;  1VQO A;  1JJG A;  2KHJ A;  2JEB I;  3E0E A;  1QVC A;  5IYD G;  3J81 c;  1Q81 C;  4POG A;  1Q46 A;  4IJL A;  3CCE A;  4JC0 A;  1W3S A;  3HOV G;  3J80 i;  3KF8 B;  1EIY B;  1X65 A;  1HR0 W;  2K5N A;  1Q12 A;  3M3Y H;  4GN5 A;  1MIU A;  1R9T H;  4LF4 L;  2OWO A;  4B3M Q;  2UXC Q;  2VS1 A;  2F3I A;  4LFA Q;  4GN4 B;  3HOZ H;  2B63 G;  4A3J H;  4O0A A;  2JA6 G;  1L1O A;  4GNX C;  1C0A A;  3RZO H;  1SLJ A;  4JI5 Q;  1PVO A;  4A3G H;  5M5W H;  5C0X G;  4Y7N H;  2VQE L;  4BY7 H;  3SGI A;  2PMZ E;  5GRO A;  3BZK A;  1AH9 A;  3NEM A;  1HNW L;  1E24 A;  4DV3 Q;  1J5E Q;  3A0J A;  3JAM c;  4KHP Q;  2JE6 I;  2BA1 A;  1D7Q A;  4JYA L;  2H5X A;  4BY1 G;  3GTK H;  1DGS A;  2E2I H;  3CPF A;  2EIF A;  2EXD A;  3HKS A;  4LUV A;  1T9H A;  4X64 L;  1XJV A;  4K0K Q;  2K5V A;  2OQK A;  1E22 A;  4QY7 A;  2VQF L;  3CME A;  1VQP A;  2ZTE A;  5HGQ A;  3CCR A;  4NPS A;  1XTD A;  3S1R H;  5M3M H;  4OWT B;  4B3S Q;  2DUD A;  1OXS C;  4JI3 Q;  4JI8 L;  2K4K A;  2V1C C;  1Z47 A;  4DK3 C;  4H02 A;  3I55 A;  1LUZ A;  1SR3 A;  3GTL H;  1N32 Q;  3D0F A;  2NN6 I;  5JEA G;  2JJQ A;  4IOC A;  2PI2 A;  2KHI A;  4XTC S;  1W2B A;  3HKZ G;  4ME3 A;  3PCO B;  1GD7 A;  2EQS A;  3U4V A;  1A8V A;  3G48 A;  2WAQ E;  5C0X I;  3PO3 G;  4X66 Q;  4DV7 Q;  3OTO Q;  3H15 A;  4DV5 Q;  4A76 A;  2JEA I;  4IO9 A;  2YYZ A;  3HOU H;  3KFU A;  1Y1V G;  4OX9 L;  4BBS G;  3NEN A;  1VQJ A;  3U50 C;  4AYB E;  1QVG A;  2K75 A;  4P71 A;  3GTQ H;  1SMX A;  1LTL A;  3HOZ G;  3S1Q H;  4JV5 Q;  2R6G A;  4P74 A;  3W1B A;  4A3J G;  4DUY L;  4AQY Q;  3RZD H;  4B3T Q;  3TEH B;  3CPW A;  1I94 Q;  4JI2 Q;  1OTC A;  4A3G G;  1A63 A;  2UUC L;  4BY7 G;  2QEX A;  1QUQ A;  1TWF H;  3T1H L;  2PI2 E;  3PV0 A;  4R4T A;  5E7N A;  5H1S E; 
#chains in the Genus database with same CATH topology
 4P75 A;  5I2X A;  2YTV A;  4X65 Q;  4CKB A;  4EQP A;  4JI4 Q;  1HZ9 A;  2AWN A;  2J0T D;  3TDQ A;  4DUZ Q;  2WV6 D;  1PHJ A;  2KCC A;  1BBU A;  4JI0 L;  2HT1 A;  3C2P A;  3J80 E;  1QG7 A;  3ERS X;  4IZ8 A;  1FGB D;  1PZK D;  5I6Y A;  5C4J H;  1AZP A;  1NJI C;  4OIJ A;  1HZA A;  3DEP A;  3HOX H;  2R3Z A;  3R93 A;  1FGU A;  1JJC B;  4HJ5 A;  3BDO A;  3S1N H;  2FFK B;  2Z9H A;  3TSS A;  1HCZ A;  3CCU A;  1XPO A;  3KYH C;  4GKJ L;  2KVM A;  5C4H A;  2K01 A;  1M1K C;  1D1K A;  5FLX c;  1K3R A;  1CTM A;  1TWF B;  2A68 C;  1VQ8 A;  1P16 A;  1TXY A;  2SNM A;  1DOM A;  1KD1 C;  3I4N H;  2V4D A;  1L2F A;  1N34 L;  2PPB C;  4OEM B;  1F2Z A;  2KCN A;  2NUC A;  5LL6 X;  1EY7 A;  4PG3 A;  1V43 A;  2E2J B;  3TRE A;  1NMG A;  1DOL A;  2NVT H;  3TS2 A;  1S3O A;  1I6H B;  4TVA B;  1AW7 A;  4Z9C B;  2HUG A;  4FO2 A;  1AN8 A;  3CF5 A;  1IW7 C;  4ZKC B;  5C6A A;  4HSP A;  5GQO A;  2DY8 A;  4LNQ A;  1F9R A;  5KIX A;  1XTC D;  2KCT A;  4LW1 A;  5K5P A;  3T1Y L;  4OON A;  5I6W A;  1Y69 U;  4QF4 A;  1S5F D;  4KK7 A;  4BXX H;  1QNU A;  4ME5 A;  5IT9 L;  3TS0 A;  3STB D;  2NYZ D;  2K5D A;  5LHY 1;  4CKE A;  4JYA Q;  1DXM A;  3UDG A;  2IX1 A;  3CC4 A;  3OOC A;  4AH6 A;  3MTS A;  4IAL A;  1JB3 A;  1EWC A;  1HQR D;  1PH7 A;  2CHB D;  4WJ4 A;  1CKM A;  4RKB A;  4C3I B;  4DR3 L;  3N6R A;  4DR5 Q;  3QOJ A;  2PQA B;  2Q8T A;  3VR6 A;  3FPU B;  3IKJ A;  4NXM Q;  2NVQ H;  1YIT A;  1N36 Q;  2E75 C;  1PH1 A;  1WCM H;  4DR7 L;  4WJW A;  2UUA L;  4QB4 A;  1CHP D;  4IFD J;  1F9Q A;  3K0Y A;  1NNX A;  2R92 H;  4F88 A;  2OTJ A;  4UPA A;  3I4M B;  3SK4 A;  4H0L C;  1YHB A;  2D9U A;  4POF A;  3I4M G;  1JT8 A;  2P5Z X;  3A74 A;  2M2L A;  3G6J B;  4EGV A;  1EUJ A;  2HCI A;  4DV4 Q;  5IGB A;  4JI1 L;  1EYD A;  3EJI A;  2C35 B;  3PF4 A;  3OIP A;  3DWA A;  1BO0 A;  4RAU C;  1MKH A;  1TWC B;  1SYF A;  2ID0 A;  3JAM i;  4YCW A;  1VQ5 A;  2UXB L;  3HOY B;  2NVX H;  1V1P A;  4U67 3;  1PH8 A;  4ZUJ A;  1N33 Q;  2FMC A;  1BDO A;  3HOY G;  3OWF A;  3DXJ C;  3E0J A;  3D6C A;  3EN2 A;  2PNH A;  1UE7 A;  3Q6S A;  1FL0 A;  4YHH Q;  5ELF A;  4DV6 Q;  4LF4 Q;  3HRZ C;  1GVP A;  3QOL A;  2RSO A;  3ULP A;  2E2H H;  1ONL A;  4FP5 D;  1VMP A;  1B3A A;  4OO1 G;  2B39 A;  2VXW A;  1LT3 D;  1QJO A;  1HQM C;  3S16 H;  1VQL A;  2D0O A;  5C0X J;  2UUB Q;  2JA7 H;  2ZT9 C;  4KJN A;  4IPG A;  1EU4 A;  2BA0 A;  2ZXO A;  2R7F A;  4A3K B;  5FOB B;  3S17 H;  1KDB A;  1D5Z C;  4HR7 B;  5EPJ A;  2JA8 B;  4A3K G;  4LK1 C;  1U9R A;  5CV5 A;  3RN5 A;  5IGG A;  4KD3 A;  2JA8 G;  4DNT B;  2K14 A;  1FJG L;  5EGT A;  4OO1 I;  1VQG A;  2KHS A;  1DZ1 A;  2DN8 A;  5JEA J;  2WFW A;  4KY7 A;  3DUZ A;  2C5C A;  3AFQ A;  1UE1 A;  1ROD A;  4IPC A;  1WTP A;  1L0W A;  3NTK A;  2O5J C;  1X3E A;  4O2D A;  1K9M C;  5IYC H;  4GKK L;  3LWU A;  5IWA L;  3BG3 A;  4EQ5 A;  1PRT C;  4XYQ A;  4XT1 B;  3GO5 A;  1STG A;  2N8N A;  4A3D B;  4KLK A;  1WJJ A;  4C3H B;  4A3F H;  4FDB A;  1AZQ A;  4A3D G;  1OO9 B;  4LF6 Q;  4DK1 A;  4C3H G;  5FLX L;  1X55 A;  4C3J B;  1HZC A;  1E2W A;  3J7A V;  4MN3 A;  1BKB A;  4DA2 A;  1GJX A;  3NTI A;  4N8X 1;  2A19 A;  2BH8 A;  2NZO A;  4C3J G;  4AYB B;  1YZ6 A;  1KDA A;  4NW2 A;  4A3B B;  4NMZ A;  3G6E A;  1PTO H;  3CCJ A;  1E3P A;  4AYB G;  1U4R A;  3VYU A;  2F0H A;  5K36 G;  4LF7 Q;  2JN4 A;  5A35 A;  3EBE A;  5IGE A;  2B2V C;  3CHB D;  3CQZ B;  1GKH A;  4ALP A;  3SE0 A;  5C3E H;  2F3V A;  1QWY A;  2A5H A;  2PZU A;  4NKL A;  2PQA A;  2IW3 A;  2JA9 A;  5C5L A;  2I0Q A;  2F0E A;  2DNC A;  4UDU C;  2QKI C;  3DM3 A;  2UXD Q;  1EFI D;  2B8F A;  4LUO A;  3PIP A;  4A3M B;  4CJ1 B;  4DR6 Q;  4DR2 Q;  1HA5 A;  1ICW A;  4K6L A;  5EJW A;  3GTO H;  2E8G A;  4A3M G;  1IHZ A;  2Q2H A;  1HTP A;  4DR1 Q;  1N8R C;  1NCV A;  4F8M A;  4P72 A;  1N34 Q;  1RKN A;  3D6W A;  2Z0S A;  4B3M L;  1K83 H;  4WFN 3;  1PRT B;  2YV5 A;  1E2V A;  1V1Q A;  3RLN A;  3UE0 A;  4A3C G;  3VYS A;  5IE8 A;  4FXG C;  4JI5 L;  2ZM6 Q;  3C1F A;  3NQI A;  4ODG A;  2N49 A;  2F4V L;  5IP7 H;  1EOT A;  3R8B A;  1HTL D;  3ZYY X;  4BBR B;  4GNX A;  1KXL A;  2A6E D;  4IUQ A;  3OPO A;  2CCZ A;  2ZTD A;  5DLQ E;  4BBR G;  4HN7 A;  3HZX A;  1R4Q B;  3M4Y A;  1Q1B A;  2BOS A;  1XNQ Q;  5A2Q E;  2GVB A;  3U58 A;  1RF2 D;  3PO2 B;  4B3S L;  1HUM A;  4YIJ A;  5EAY A;  1F2M A;  4JBW A;  2PCF B;  3Q0A A;  3HS0 C;  3C1E A;  5IYD H;  3PO2 G;  4CJ0 B;  4QIW E;  3WOF A;  5HGT A;  3GTJ H;  4IFD G;  1IYU A;  1JOK A;  4HIM A;  4K2K A;  1LV9 A;  5BR8 Q;  1NR4 A;  2XRQ D;  1HFG A;  5LMN W;  3QR8 A;  4X66 L;  2B63 H;  1KRS A;  4IUV A;  3HOU G;  4JOI C;  2JK8 A;  1KTK A;  4XT3 B;  3CU7 A;  5EQ0 A;  1SAP A;  3D31 A;  2VZA A;  2LFN A;  3T51 B;  4JI7 Q;  4JI2 L;  4BS9 A;  4BY1 H;  2EY6 A;  3MWY W;  4PZ8 A;  4GLX A;  4DR7 Q;  2Q8I B;  1V9P A;  1KAB A;  3R2T A;  2CWP A;  4UP7 A;  4X65 L;  1XPU A;  4JI4 L;  4GLA C;  4DF7 A;  3OMG A;  2E5L Q;  1C9O A;  4IFD I;  1CKN B;  2MQH A;  3KDF B;  4FVM A;  5KYI A;  4A3I H;  2Z6K C;  1S5E D;  3SDZ A;  4FYD A;  3P20 A;  3IL8 A;  1S72 A;  1J6Q A;  3TP7 A;  2O2L D;  3KBG A;  4OEL B;  4IJL A;  3CCE A;  3C46 A;  2E76 C;  3D4D A;  1HR0 W;  3S14 B;  4K14 A;  4ZLT F;  4LFA Q;  1V8Q A;  1PMR A;  4A3J H;  1L1O A;  4LMQ D;  5CV7 A;  4IN3 A;  1PVO A;  5M5W H;  3NP8 A;  5C0X G;  5GRO A;  1AH9 A;  2X6G A;  4K5X A;  1U4M A;  3A0J A;  1F77 A;  1IL8 A;  3BS1 A;  2JE6 I;  1D7Q A;  3QWN A;  2QDL A;  1D1I A;  2K33 A;  2EIF A;  1H9J A;  1T9H A;  1XJV A;  2OQK A;  1E22 A;  3CME A;  2ZTE A;  3BVM A;  3CCR A;  1XTD A;  3S1R H;  4JI8 L;  2K4K A;  2F0M A;  2V1C C;  1Z47 A;  2NBF A;  4H02 A;  3I55 A;  1SR3 A;  5I9P A;  1BXT A;  3D0F A;  3LNN A;  2NN6 I;  2A74 C;  5JEA G;  1GHJ A;  3J7Y W;  2EYF A;  2IX3 A;  1JWM D;  3PCO B;  2SOB A;  5C0X I;  1A8V A;  3G48 A;  2WAQ E;  4I7A A;  1J9O A;  2KEC A;  3SK5 A;  4DV7 Q;  4BBS G;  4IO9 A;  2IWH A;  3NEN A;  5CV8 A;  3MVV A;  1LTI D;  4OHJ A;  3BDL A;  4BY7 B;  4MHE A;  4AQY Q;  5DM7 3;  4B3T Q;  3TEH B;  3CRL C;  1I94 Q;  1OTC A;  4BY7 G;  5DNF A;  1TWF H;  3PV0 A;  4JYA L;  3A55 A;  2E2I B;  2GVA A;  4JCV E;  1X54 A;  1YEZ A;  1PH9 A;  2PNR C;  4PQX A;  3TN2 A;  2F52 A;  1KNE A;  3VYR A;  3I90 A;  3L7Z C;  2E2J H;  3GD7 A;  4YY3 Q;  4DR5 L;  1KQS A;  1NUC A;  3A5Z B;  1I6H H;  2ICI A;  1I50 B;  5KRU A;  4PMC A;  3X3N A;  3PGZ A;  5IT9 c;  3RNU A;  2RKS A;  1A2T A;  1R4P B;  2KUM A;  4MNO A;  1WTW A;  3KLW A;  1PYW D;  4IJH A;  4NB3 A;  4ULL A;  1WOC A;  3GTQ B;  2QDB A;  1DM0 B;  2A6H D;  2B2V A;  3RZD B;  2VQE Q;  3T56 B;  3SK6 A;  3IRB A;  2XN9 C;  1EQR A;  4DV4 L;  3D3R A;  4DAP A;  3A7L A;  3S2D H;  3JC6 6;  4YCU A;  4EQO A;  4HMI A;  4HTH A;  3GTG H;  3R2I A;  3G7L A;  3NUC A;  1JE5 A;  2VQF Q;  1ENA A;  4C3I H;  5ELN A;  1I3Q H;  3FHW A;  1M4V A;  3F2C A;  1OXV A;  3BDC A;  2K7V A;  1N33 L;  3MEH A;  2PO4 A;  5EKK A;  1K3B C;  1FVI A;  4YCV A;  1Y1V H;  3F2B A;  4XYO A;  1CKN A;  4J6H A;  3KDF A;  4YHH L;  1MD2 D;  1EWI A;  4BWG B;  4DV6 L;  1EY8 A;  4OX9 Q;  3I4M H;  3D4R A;  4FXD A;  1EQT A;  3GTM H;  5AJ3 L;  1YIJ A;  1NMF A;  5F2D A;  4C2M B;  1GHK A;  3VA5 A;  2F4V Q;  1C4Q A;  2NVY B;  3U4Z A;  5COY A;  4CBV A;  2UUB L;  5KND A;  2ASB A;  2F1M A;  1EY4 A;  1PFS A;  2A69 D;  1ZYR C;  1B9N A;  4QUC A;  4LFB Q;  2ZJQ A;  3HOW B;  1KIX A;  3WDN A;  1K8O A;  1HNZ L;  1DOK A;  1TU2 B;  4P73 A;  1ESF A;  3E9I A;  3HOW G;  1TWC H;  2F0L A;  3I4O A;  5C44 B;  1PLF A;  5E4W C;  3CW2 C;  2CW0 D;  3HOY H;  1A62 A;  5C44 G;  1B8A A;  1MSG A;  1STA A;  1TY0 A;  1DD2 A;  5FJ8 G;  4JOI A;  4WRD A;  1DCZ A;  4OGQ C;  3PO3 B;  1KNA A;  1ZXT A;  1QZG A;  4UP9 A;  4JI6 Q;  1XMO L;  3I7F A;  3SR1 A;  5IIF A;  4OO1 H;  1SE4 A;  3PMF A;  4HED A;  2J4X A;  1N9W A;  4KTA A;  2L15 A;  2ALY B;  2I07 B;  3CCV A;  4RH6 A;  4LFC L;  4DK6 C;  1O7L A;  3OYY A;  1SJE D;  2Z6K A;  4FF2 A;  4QIW B;  4ZQ3 A;  4KKU A;  3J7A 5;  1QUQ B;  2OEO A;  3M7G A;  3CC2 A;  1X3Q A;  5IY0 A;  4IOA A;  1MSH A;  2K03 A;  1PZJ D;  4A3K H;  2R93 B;  4LF6 L;  3PUX A;  5C5M A;  3ULL A;  1YJ9 A;  4KHV A;  4B9X A;  2JA8 H;  2R93 G;  5C4X B;  2CWA A;  4HSV A;  1VQK A;  3DWP A;  3A8J E;  2RDF A;  3PUV A;  3P75 A;  1XXG A;  2R61 A;  5C4X G;  1UAP A;  4OL7 A;  5KEE A;  1HFN A;  3H3V C;  3EQL C;  3Q23 A;  4LF7 L;  3EFX D;  1GM5 A;  1Z9F A;  1HNX Q;  1F2Y A;  1JB7 A;  3I72 A;  1D5X C;  1LTB D;  3A5U A;  2PW7 A;  5JVG 3;  5J39 A;  3J80 c;  4LF9 Q;  1Y8N B;  2HQL A;  4A3E B;  1JJ2 A;  2IPK D;  1GUS A;  1VQI A;  3BYT B;  2UXD L;  4JI3 L;  4A3E G;  4A93 B;  4DR6 L;  4DV1 Q;  4G7O C;  4DR2 L;  1WD0 A;  1WYD A;  4M1U B;  4KI0 A;  5D3D A;  4P2C B;  4A93 G;  4DR1 L;  4R4Q A;  3AU7 A;  4A3D H;  1ILQ A;  3K7A B;  4C3H H;  4JVZ A;  2K5H A;  4DV5 L;  4HJ7 A;  1JOR A;  1FNU A;  4C3J H;  1IYV A;  1YJW A;  1QVF A;  4JI8 Q;  2ZM6 L;  1WI5 A;  2JA5 H;  1TWH B;  4A3B H;  1B53 A;  1RDP D;  1HUN A;  2Q8R E;  3I70 A;  1X9N A;  2B2W C;  3J81 E;  1K8M A;  1SMY D;  1OXT A;  3M4O B;  1WFQ A;  3A54 A;  3S24 A;  4DNR B;  3CQZ H;  1YNJ D;  3MXG A;  4IUP A;  1XNQ L;  5I9O A;  1PTO D;  2B3G A;  3NWT A;  4QUF A;  1NAP A;  3QJY A;  2DY7 A;  3IFD A;  4HIO A;  2EPB A;  4KMU C;  4V19 0;  1O7Y A;  1FR3 A;  1U5K A;  1PXU A;  1EIF A;  5J3B A;  2D0P A;  1I6V C;  5IP9 G;  5BR8 L;  3JAM E;  1TS5 A;  4X3K A;  4A3C H;  1TS3 A;  2ZTC A;  2WAQ B;  1LT5 D;  1Y1W B;  2LSS A;  2WAQ G;  1B2T A;  2MPM A;  1Y1W G;  2HIX A;  4KY5 A;  4RA8 A;  1PFB A;  4JI7 L;  1U0L A;  2EZV A;  5DM6 3;  1VQF A;  1YBY A;  4BBR H;  2O4X A;  1KC8 C;  5IYB G;  2MGS A;  1PTO F;  3DLL A;  2EOT A;  3H3V I;  1YNN D;  2E5L L;  2R7Z B;  2FMM A;  3AYH B;  1H9R A;  1NE3 A;  2EJM A;  3U9S A;  1I5F A;  1TS4 A;  1VQ9 A;  4J15 A;  2EJG C;  4UP8 A;  4DAY B;  3J81 i;  3FKI B;  3PO2 H;  2R7Z G;  5D65 A;  5M3F G;  3FKI G;  3CXC A;  2XGT A;  2BDO A;  2KQ3 A;  3OSO A;  3CC7 A;  2EY1 A;  1ET6 A;  5I4D A;  3VDY A;  4LJZ C;  2I5H A;  1LO5 D;  1H95 A;  1KRT A;  3IFT A;  3GV3 A;  1CHQ D;  4NXN L;  5CBE E;  1EOV A;  1WTX A;  2EYO A;  1JOO A;  4LFA L;  1JR0 D;  3S9W A;  1EEI D;  4GN3 B;  3MXU A;  3V96 A;  1IBM L;  3KBX A;  5ELE A;  1BBW A;  1J8I A;  4G7Z C;  3I91 A;  1O7I A;  2B8G A;  3Q8D A;  2NWG A;  2OCE A;  1C8C A;  4OIK A;  1BVS A;  4RHR A;  3I56 A;  3CP0 A;  5J22 A;  4ZYS A;  1KL9 A;  2NB0 A;  1VQM A;  4K8J A;  3M85 A;  1VQA A;  5M3M B;  5AJ3 Q;  1OXX K;  1BF4 A;  4G57 A;  2Z4I A;  2QEJ C;  1FYC A;  1CSQ A;  3MXP A;  5M3M G;  2RDG A;  3KF6 B;  3S15 B;  1B50 A;  3NTH A;  1JMC A;  4JK1 C;  4PNY A;  2NN6 H;  3D8G A;  2BH2 A;  4DV7 L;  4B9W A;  3S14 H;  3N52 A;  1HNZ Q;  1VQE A;  3EA6 A;  5DEH A;  5C0X H;  3ND8 A;  2N78 A;  2Y0S E;  3RUZ A;  1SYG A;  4YWL A;  4B3T L;  4KHZ A;  4AQY L;  1IL2 A;  3I73 A;  2YTX A;  1I94 L;  3I4L A;  4LWC A;  2O5I C;  3NWS A;  4KY6 A;  3R3O A;  4HJ8 A;  1NY4 A;  1XMO Q;  1RCV D;  2L9H A;  1HJP A;  4PZ7 A;  2YU9 B;  3H0G B;  4JW0 A;  4L8J A;  4YY3 L;  1K8A C;  1EQV A;  5NUC A;  5JEA H;  5T1I A;  5M9O A;  5EBD A;  4LFC Q;  1G6Z A;  1JE4 A;  3H0G G;  1VQO A;  1PFM A;  5EKL A;  5CR3 A;  2JEB I;  3E0E A;  1QVC A;  1LAC A;  1Q81 C;  4WOR A;  1Q46 A;  5ELC A;  4R8N A;  3J80 L;  1JIC A;  4ABN A;  4CDF C;  4EVO A;  3S1N B;  3KF8 B;  2Z4H A;  2K5N A;  3QO2 A;  4GN5 A;  2G5D A;  2VS1 A;  3SK8 A;  4O0A A;  1GUG A;  2VQE L;  4Y7N H;  4BY7 H;  3SGI A;  1SYB A;  1J5E Q;  5E4X A;  1I4R A;  3VYT A;  2BA1 A;  3MC0 B;  3RD4 A;  2FHT A;  1UEA B;  2E2I H;  1W6J A;  4Q0F A;  1SE3 A;  2AUK A;  2SDF A;  4FXK C;  3H91 A;  2K5V A;  2VQF L;  5BN3 A;  1KDC A;  2BE5 C;  4JI3 Q;  3URY A;  4C1N I;  1N32 Q;  1Z6H A;  3GTL H;  1CT1 D;  2RQX A;  2KHI A;  4XTC S;  4ME3 A;  4ZKB B;  3M3Y B;  4DV5 Q;  3H15 A;  2JEA I;  4A76 A;  3KFU A;  2TMP A;  4OX9 L;  1VQJ A;  2LY7 A;  2CW0 C;  3T53 B;  2B2W A;  3TP5 A;  4TRD A;  3GTQ H;  4HMJ A;  2K1B A;  2R6G A;  1ICF B;  1CK1 A;  3GQB A;  5TSS A;  3RZD H;  4RGM A;  2F0F A;  5G3L D;  3GTK B;  1T5E A;  2JXM B;  4IUT A;  5H1S E;  1XMQ Q;  1TQO A;  1PH6 A;  2H4O A;  1NBW A;  4DR4 Q;  4LFB L;  4XQN A;  1ILP A;  4BA1 I;  1BNZ A;  3PIO A;  3KJP A;  4DN4 M;  4PMB A;  3CAM A;  2F0Q A;  1A2U A;  2XWJ B;  4K6D A;  4HID A;  1Q82 C;  3K81 C;  3HOV H;  1YI2 A;  4HJ9 A;  2XNA C;  2B2U C;  2BCO A;  1RIP A;  1SJH D;  3BZC A;  3E5S A;  3I2Z A;  2A68 D;  1G6P A;  3HOU B;  4JI6 L;  1LT6 D;  2B2Y C;  3MXN B;  1PH5 A;  1M90 C;  3P1H A;  1L0X B;  4K5W A;  3TME A;  3S1Q B;  5G3L F;  3WWV A;  4C2M H;  1HNW Q;  1WTO A;  2NVY H;  1B70 B;  1AE2 A;  1ASY A;  2K52 A;  2F0J A;  1A15 A;  3RLF A;  1K0S A;  4UHV A;  1SNP A;  1IKL A;  1FNV A;  1Q7Y C;  1O78 A;  2DNE A;  2AQ3 B;  2F0S A;  4X64 Q;  2KED A;  3BVG A;  1LTS D;  2MHV A;  1OXU A;  1Q90 A;  2VUM B;  1IW7 D;  2RF4 A;  4RCO A;  3HOW H;  1Z7T A;  1LTA D;  1CA5 A;  3T16 A;  3W3A A;  2VUM G;  4RFB A;  3NQT A;  5C44 H;  4L5S A;  1CSP A;  4IUN A;  5FJ8 H;  3CRK C;  3K5O A;  5FLM G;  2QIL A;  1MGS A;  4O1N A;  2JP1 A;  2WKC A;  1B3Q A;  5IGD A;  3PO3 H;  1SNM A;  4HJA A;  2EYP A;  4NXN Q;  4X6A H;  1HNX L;  2K05 A;  5FO9 B;  4CHT B;  2E2H B;  5JPN C;  2M9V A;  3OWE B;  4QMG A;  5DAU A;  1SFO B;  4LF9 L;  5JPM C;  5ELB A;  4DPG A;  1IBM Q;  1QNK A;  2K5W A;  1TWA H;  1VQ7 A;  4AIM A;  4DV1 L;  1Q8I A;  2UUC Q;  3T4A C;  2HQE A;  1LTG D;  2IT1 A;  3T1H Q;  2CQO A;  3KF8 A;  2HCC A;  4HCS A;  1IYJ B;  1STB A;  5JVH 3;  3S17 B;  1XPR A;  4IQZ A;  2R93 H;  5ELO A;  2IL8 A;  3STB C;  3CCS A;  1ML0 D;  2KOL A;  5C4X H;  2NZ1 D;  1GUN A;  1ESR A;  2PQE A;  5D3I B;  1ASZ A;  2B2T C;  5GAE C;  1BCP D;  4RGO S;  1XYI A;  1VS0 A;  1GUT A;  4BBS B;  5LMN Q;  1ZEQ X;  5E3F A;  3S1M B;  1FD7 D;  4B08 A;  5HUR A;  3QB3 A;  4RMF A;  3S2H B;  1IBK Q;  3FP9 A;  2I46 A;  2WIN B;  4K5V A;  3TZD A;  2MFI A;  1EU3 A;  1EY6 A;  1HZB A;  4X3T A;  2EVB A;  2AMC B;  3IAY A;  3PUW A;  2F03 A;  1K0R A;  4C56 C;  1ENF A;  1B9M A;  4A93 H;  3ULJ A;  4DV0 Q;  4A3L G;  1YVC A;  1YNN C;  1FNW A;  2F0I A;  3AFP A;  3EVQ A;  2PZW A;  4A3F B;  2VB2 X;  4IPD A;  3K7A H;  1VQB A;  2IHE A;  1L0Y B;  3A56 A;  4A3F G;  3K6O A;  2E2D C;  2K5Q A;  1MHW C;  5FO7 B;  1KLG D;  4FF1 A;  2E74 C;  2XIW A;  3CD6 A;  5CV6 A;  1D2B A;  1BCP F;  1EY0 A;  4LF5 Q;  2Y0S B;  4PV1 C;  1TII D;  1IXR A;  2MNA A;  4UY8 C;  3VR5 A;  1TVX A;  2Y0S G;  2FXQ A;  3PIP 3;  4K2L A;  4KV6 A;  3ND9 A;  1HR0 Q;  4DV2 Q;  5IOC A;  3LGJ A;  4KN7 C;  2VW9 A;  3M4O H;  4L5R C;  2RDH A;  3W2D A;  4YWM A;  1I4X A;  1WD1 A;  1VQD A;  1WTQ A;  3MFG A;  3A8I E;  3RR5 A;  3H3V H;  4RKL A;  2WP8 J;  4NP5 A;  4X3U A;  1S5D D;  5IP9 H;  1VQH A;  3O13 A;  1D5M C;  1F2L A;  2SEB D;  3MXN A;  5EBC A;  4IPH A;  1GUO A;  1K83 B;  1F9P A;  3NBI A;  3TQY A;  4KJO A;  1YHA A;  1AEX A;  5EKI A;  3K5M A;  3AMU A;  1EY5 A;  4LUZ A;  1EY9 A;  2IY5 B;  2L4N A;  5KYL A;  2EY5 A;  3HGB A;  3F8T A;  4MTN A;  1PRT D;  1S40 A;  3RLO A;  1PV4 A;  2N55 A;  3PUY A;  2WAC A;  3BVZ A;  2JYO A;  1VQ4 A;  1GOZ A;  1S5C D;  3M4P A;  1GUW A;  3DHQ A;  4L6T B;  3FKI H;  2AQ2 B;  1SYD A;  5C4Z A;  5A2Q L;  1CUK A;  1SE2 A;  4JPB W;  4G7H C;  2MO0 A;  3H94 A;  1KAW A;  1VQ6 A;  4EX5 A;  3OW7 A;  4V0B A;  2CH4 W;  1TS2 A;  1RD9 D;  3HG9 A;  2UU9 Q;  3FRP B;  5JJL A;  1UWV A;  2EYL A;  3A8K E;  5KGU A;  2EE1 A;  2F3W A;  4XQQ A;  3CCM A;  2B2Y A;  3M4Q A;  2DGY A;  4NDX A;  1PRT F;  4I65 A;  1JCK B;  5M5X B;  2L0C A;  2Z8L A;  1HA6 A;  1ZKO A;  1LM0 A;  3V2T A;  2KCM A;  1X32 A;  4A3I B;  5I2Y A;  3NEL A;  3Q24 A;  5J1Z A;  4DAV A;  1PZI D;  2XSC A;  4JBK A;  4A3I G;  1TWG B;  3S15 H;  4N9P A;  1EYA A;  5D14 A;  4F7X A;  1DON A;  3ER0 A;  1NTG A;  3NK9 A;  1UE6 A;  2KA7 A;  1M8A A;  2AHO B;  1TR5 A;  2CKZ B;  3P7J A;  4APV A;  4K8I A;  4R4C A;  4X3S A;  1STN A;  1X3F A;  5COR A;  2GN5 A;  1U4P A;  1SNO A;  1J5E L;  3DM1 A;  2G9H D;  2HDM A;  2EY2 A;  1X3P A;  2Z6B A;  4MIU A;  4DAM A;  1EQQ A;  5T1G A;  4MZ9 A;  2WB1 B;  4XIG S;  4ZRZ A;  3T13 A;  1KHI A;  3S1R B;  3DMU A;  2WB1 G;  4CKC A;  1EYG A;  2YU9 H;  1AP0 A;  4DGZ A;  3H0G H;  3G4S A;  3Q22 A;  2A6E C;  5C3X A;  1N32 L;  4A4I A;  5M5Y B;  5FLX E;  2KEE A;  2DJF C;  3ZJY C;  4DNI A;  2RVL A;  4PZ6 A;  2B2T A;  3GTP B;  2EYJ A;  1BOS A;  3VA7 A;  4TQU S;  1HPC A;  2N3S A;  2LMC B;  2HHH Q;  4QL5 A;  1G91 A;  4X62 Q;  5K36 H;  1RHP A;  4B3R Q;  1GO3 E;  2FJ2 A;  3UDX A;  4ID6 A;  1SDF A;  4EQN A;  1B7Y B;  3HFZ B;  3OIQ A;  3OHX C;  1XMQ L;  4LAA A;  3NXW A;  4DR4 L;  1XNR Q;  3BU2 A;  5AFW A;  1CKO A;  1CZW A;  1Y8O B;  3K5L A;  3F2D A;  4ZK9 B;  3K59 A;  3J81 j;  3LWE A;  1VCI A;  2ICE C;  1JQY D;  1GXD C;  4A3M H;  4ZAI A;  5JAV A;  1JJG A;  2KHJ A;  4FF3 A;  3J81 c;  4POG A;  1ENC A;  1LAB A;  1W3S A;  3SEB A;  1II3 A;  1BBX C;  3J80 i;  2JA6 B;  3M3Y H;  2UXC Q;  1MIU A;  4E6I A;  4GN4 B;  3AB9 A;  1DYQ A;  2JA6 G;  4GNX C;  1MBY A;  1SLJ A;  5JOB A;  1VF5 C;  3I8Z A;  3U9O A;  2Z1C A;  4FNF A;  2PMZ E;  3BZK A;  2K6A A;  1HNW L;  4DV3 Q;  2F0W A;  3JAM c;  4KHP Q;  2A73 B;  5JJZ A;  3S2D B;  2XWB B;  2H5X A;  4R9W A;  3GTK H;  1BQQ T;  4J1M A;  1H9M A;  1EWH A;  3CPF A;  5FO8 B;  2EXD A;  3GTG B;  2J7Z A;  1QB5 D;  3HKS A;  4LUV A;  1NR2 A;  4X64 L;  4K0K Q;  4CGY B;  4H13 C;  1NSN S;  2D5D A;  5M3F B;  1VMC A;  4NPS A;  4QCL A;  4OWT B;  5C3W A;  1I3Q B;  5LL6 S;  2EXZ A;  4C3I G;  2IJ0 A;  4IFD H;  3KLS A;  2H1E A;  1LUZ A;  2JJQ A;  3FVQ A;  4IOC A;  1JWU D;  1G2S A;  4XQJ A;  1Y1V B;  1GD7 A;  2FIN B;  3U4V A;  3TZU A;  3HOU H;  2QF7 A;  1R9T B;  1A3T A;  3ERQ A;  1WVL A;  2YYZ A;  1Y1V G;  2EJF C;  2X6L A;  3HOZ B;  1KAA A;  3U50 C;  3GTM B;  3NE5 B;  1B1Z A;  2M00 A;  3RZO B;  2K75 A;  4A3G B;  1BCP C;  1SMX A;  1JC7 A;  3HOZ G;  3S1Q H;  4JV5 Q;  4DFA A;  3CKI B;  4P74 A;  1BR9 A;  3E3X A;  4A3G G;  1G2T A;  1STY A;  1CA6 A;  2UUC L;  1QUQ A;  3T1H L;  2D2C C;  2PI2 E;  3MHB A;  1AFP A;  1SYE A;  5E7N A;  1K28 A;  4KN4 C;  4RGN A;  4GNX B;  1Q8K A;  1EL0 A;  2F0T A;  3NBH B;  4CJ2 C;  1RL2 A;  1UUP A;  1VQN A;  2VUM H;  5EPL A;  1SN8 A;  1PH2 A;  3J7A F;  2PYK A;  5FLM H;  1VQC A;  4RG1 A;  1S4Z A;  5KNB A;  2Q2T A;  4LF8 L;  5CYU A;  1JOQ A;  4QJF A;  4Y52 H;  4I7Z C;  2YTY A;  1IBL L;  1X56 A;  1YHQ A;  2IHF A;  1L1O C;  2OXP A;  3H6M A;  4HAE A;  5LMN L;  1SNQ A;  1JWS D;  4CDD C;  1IBK L;  1U4L A;  1XX8 A;  2PW5 A;  3UE1 A;  3K58 A;  1HXY D;  1AE3 A;  2LKV A;  4N9T A;  1SFO H;  4S3S A;  1PH3 A;  2F0D A;  3L2P A;  3KLR A;  1UNS A;  1CM9 A;  4Q5V A;  4R1J A;  5CBA E;  3CCQ A;  4DV0 L;  1HHV A;  1SSO A;  2KBN A;  1XWE A;  1LLR D;  2K28 A;  1BCP B;  2A6H C;  3BJU A;  2G9D A;  5GAD C;  3J7Z C;  4HIK A;  2K04 A;  1Y8P B;  2TSS A;  2LXK A;  1SND A;  1PA6 A;  1I4P A;  3A7A B;  2JQO A;  4GS3 A;  3NSW A;  5LMU L;  5C4J B;  2CVR A;  4LF5 L;  3V05 A;  2L55 A;  4XXE A;  3HOX B;  4ILW A;  2QA4 A;  3TP8 A;  3W5O A;  2ATW A;  2F0N A;  4BBS H;  1HR0 L;  1LTT D;  3HOX G;  4DV2 L;  3S1M H;  3S2H H;  5CMD A;  1E1T A;  2RCN A;  4RCN A;  1ZYR D;  4GOP C;  1D8L A;  3OW2 A;  3W1G A;  4DUY Q;  3C3L A;  1UE5 A;  3K5N A;  1L1O B;  3K7U C;  4A3L H;  1Y14 B;  2ENB A;  3UDF A;  4H7B A;  3X3M A;  1I4Q A;  4OWX B;  3I4N B;  3ITP A;  1E1O A;  1H9S B;  4L5T A;  1PYB A;  3I4N G;  1SNC A;  4YWK A;  2QGQ A;  4JI0 Q;  1SXT A;  4BA2 I;  2LS0 1;  2OF1 A;  4L63 B;  2NVT B;  2JA5 B;  2BDN A;  2RHQ B;  1QCB D;  2RCF A;  3HP3 A;  2A69 C;  1F9S A;  3SHL A;  1A0I A;  1P8L A;  3KJO A;  3VR2 A;  2IX0 A;  2RHS B;  4KD4 A;  2JA5 G;  1I50 H;  5HY6 A;  5FKA C;  4A3B G;  1QE6 A;  4J8Q A;  1T5X D;  2X69 A;  3GDE A;  4RWS C;  1WTH A;  4DAY A;  4XDX A;  3K0X A;  3J81 L;  4GKJ Q;  3OMC A;  2EYH A;  3E6Z X;  4KKT A;  4DK0 A;  4BXX G;  3E9H A;  1ET9 A;  1HRJ A;  4M8A A;  2JSO A;  2I5L X;  2WII B;  1SEB D;  1YJN A;  2HIV A;  4GOP B;  5JJI A;  3KK7 A;  1SE8 A;  3K8A A;  3ONA B;  1B4O A;  5ISR A;  3JAM L;  2UU9 L;  3MZ5 A;  2R7D A;  2NVQ B;  3HKZ E;  2F0U A;  3DWQ A;  4R4O A;  4OWW B;  2NTT A;  2F0G A;  1QIL A;  1SRO A;  1WCM B;  3M9B A;  1STH A;  3KLS X;  1X6O A;  1LYL A;  3MEF A;  3NBH A;  2R92 B;  3K57 A;  1WCM G;  2AKW B;  1RTO A;  2R92 G;  3T1Y Q;  3D4W A;  4OXP A;  3UDI A;  1CFM A;  3KF6 A;  3SVM A;  1SRU A;  1IZ6 A;  2F4I A;  1I4H A;  1CQF A;  2D62 A;  2KEN A;  3DEO A;  5KNC A;  3MA2 B;  3LX0 A;  1YNX A;  1G51 A;  2WB1 E;  3RMH A;  3GV6 A;  2K32 A;  3OTO L;  1Q3L A;  4DR3 Q;  1B44 D;  2VB3 X;  3PSI A;  2RA4 A;  2MJ8 A;  1E0B A;  2L1B A;  5GAH C;  5EPK A;  1O7Z A;  2F0V A;  2NVX B;  1O80 A;  3UI2 A;  1PYS B;  2PMZ B;  1MJE A;  2UUA Q;  2CQA A;  3VR4 A;  5M5X H;  1PDQ A;  1E2Z A;  4R8I A;  2AUJ D;  2L5T A;  2OQ0 A;  4DUZ L;  5E1F A;  3I3C A;  3KUP A;  2L11 A;  2L12 A;  2VL6 A;  4IUR A;  5GAG C;  3S16 B;  3KOJ A;  1SMY C;  1IKM A;  4UAI A;  4JI1 Q;  1TWG H;  2JA7 B;  4H44 C;  1TT2 A;  2OTL A;  4FF4 A;  1YNJ C;  5BN4 A;  3ICE A;  2RSN A;  2CFM A;  1PTO C;  2JA7 G;  2VNU D;  2LXJ A;  3AEV A;  2VY3 A;  3NHH A;  2AWO A;  3RN2 A;  2NN6 G;  4HCE A;  4RHS A;  1QZH A;  5ELD A;  2ES2 A;  4TKO B;  1EZ6 A;  3G71 A;  2Q2U A;  2ZXR A;  2UXB Q;  2HHH L;  2MO1 A;  3L0O A;  4LF8 Q;  3BYY B;  4X62 L;  4B3R L;  1MI2 A;  1EZ8 A;  1IBL Q;  4C1N K;  1LTR D;  1H9S A;  5IGC A;  3B6Y A;  1EFW A;  3FEW X;  1XNR L;  1C48 A;  2F0K A;  1S5B D;  4A3E H;  4JBM A;  1STE A;  1SYC A;  3CMA A;  1Q86 C;  3HEJ A;  1K73 C;  5IYC G;  3QIA A;  4G4K A;  5M5Y H;  3QG1 A;  3PUZ A;  2AQ1 B;  4JBJ A;  1C7Y A;  1X3G A;  1WTV A;  1I4G A;  2N88 A;  2K50 A;  3CCL A;  1WTR A;  2UXC L;  4WJ3 M;  4R4I A;  1PH4 A;  3GTP H;  4N8F A;  3AQQ A;  4Y7N B;  5LMU Q;  3EIV A;  3H09 A;  1PTO B;  2ZJP A;  1HH2 P;  1TWH H;  1QOH A;  4DV3 L;  2HDL A;  1FJG Q;  3M7N A;  4CDC C;  5IGF A;  4GOP A;  4KHP L;  1VDZ A;  2MUY A;  3TP6 A;  2ZXP A;  4QGU A;  3FPP A;  1Q1E A;  1A3V A;  5IT9 E;  5C3E B;  4K0K L;  2NTS A;  2XTI A;  5IOD A;  4QQB X;  2B29 A;  5C3E G;  2ZJR A;  4GKK Q;  5CV9 A;  4NXM L;  5IWA Q;  3GTL B;  2EYM A;  1N36 L;  3GTO B;  1EIH A;  1CQV A;  4TSS A;  2PZT A;  3L3O C;  1CZG A;  2F0O A;  4L5Q A;  3L9A X;  1W6K A;  4A75 A;  1A3U A;  5JJK A;  2JA6 H;  4DKA C;  1RTN A;  2A1A A;  1EYC A;  5CC4 A;  1Y1W H;  3F1Z A;  2A8V A;  3PF5 A;  4MTK A;  4U68 A;  4JV5 L;  3FMC A;  1G29 1;  3PIO 3;  4GLV B;  4JG2 A;  5IYB H;  5IP7 G;  1UEB A;  2I5M X;  4ZUI A;  1H9K A;  2XVS A;  3NPP A;  1E7Z A;  5BN5 A;  2DJG C;  1CI3 M;  3K80 C;  4DXF A;  3PQI A;  1PFN A;  3FDT A;  2R7Z H;  3SXH A;  3VR3 A;  5M3F H;  3ERO A;  1MJC A;  2SNS A;  3MFY A;  2NZH A;  4DXG A;  2Q2I A;  4RGT A;  4ZCK A;  3TRZ A;  1K8G A;  4PMW A;  2MP1 A;  3GTJ B;  3F2U A;  3HOV B;  5IYD G;  4JC0 A;  3HOV G;  1EIY B;  1X65 A;  2B63 B;  1Q12 A;  1R9T H;  4LF4 L;  2OWO A;  4B3M Q;  2EDG A;  2F3I A;  5L37 A;  3HOZ H;  2RBM A;  2B63 G;  2B2U A;  1C0A A;  1KLU D;  3RZO H;  3MAQ A;  4JI5 Q;  1EEF D;  4A3G H;  5FK9 C;  2C9O A;  1TKW B;  1EIG A;  3NEM A;  4GZY C;  4BY1 B;  1E24 A;  1SBB B;  2BE5 D;  4DU9 A;  5CV4 A;  4F87 A;  3BZD B;  1LT4 D;  1G8Z D;  4BY1 G;  1DGS A;  2KJX A;  4KKS A;  2OT2 A;  1A6X A;  4QY7 A;  4CDE C;  2WKD A;  1VQP A;  2QW7 A;  1D6E C;  5HGQ A;  4B3S Q;  5M3M H;  2DUD A;  1OXS C;  1V1O A;  1VF7 A;  4DK3 C;  1BUV T;  3HKZ B;  1TY2 A;  3GP7 A;  5CGK A;  3WOE A;  2PI2 A;  2GA4 B;  4O42 A;  1W2B A;  3HKZ G;  2F0P A;  2EQS A;  3TBI B;  3PO3 G;  4X66 Q;  3OTO Q;  4A3J B;  1DJR D;  4AYB E;  4IUU A;  1QVG A;  4P71 A;  2HD3 A;  2XRS D;  1LTL A;  5M5W B;  2QCP X;  3W1B A;  1TWA B;  4DUY L;  4A3J G;  1RJT A;  3CPW A;  4JI2 Q;  1A63 A;  2QEX A;  1V1P B;  2CH4 A;  4R4T A; 
#chains in the Genus database with same CATH homology
 4P75 A;  2GVA A;  4JCV E;  1XMQ Q;  2YTV A;  1X54 A;  4X65 Q;  4GNX B;  1NBW A;  1Q8K A;  1YEZ A;  1PH6 A;  4DR4 Q;  4LFB L;  3NBH B;  4JI4 Q;  1HZ9 A;  1PH9 A;  2AWN A;  1RL2 A;  4BA1 I;  2F52 A;  3PIO A;  3KJP A;  4DUZ Q;  1PHJ A;  1VQN A;  2VUM H;  3L7Z C;  1SN8 A;  2E2J H;  1BBU A;  4JI0 L;  1PH2 A;  3GD7 A;  3CAM A;  4YY3 Q;  2HT1 A;  5FLM H;  1VQC A;  4RG1 A;  4DR5 L;  1KQS A;  3A5Z B;  4HID A;  1Q82 C;  1I6H H;  3ERS X;  2Q2T A;  4LF8 L;  5C4J H;  4QJF A;  4Y52 H;  1NJI C;  3K81 C;  3HOV H;  1HZA A;  2YTY A;  1IBL L;  1X56 A;  3PGZ A;  3HOX H;  1YI2 A;  4HJ9 A;  1RIP A;  5IT9 c;  3BZC A;  2IHF A;  1FGU A;  1L1O C;  1YHQ A;  5LMN L;  1JJC B;  4HJ5 A;  3RNU A;  3I2Z A;  1G6P A;  4MNO A;  4JI6 L;  3S1N H;  3KLW A;  1IBK L;  3MXN B;  1PH5 A;  1M90 C;  3UE1 A;  4IJH A;  4NB3 A;  1WOC A;  1AE3 A;  1SFO H;  3CCU A;  1XPO A;  3KYH C;  4GKJ L;  2VQE Q;  1PH3 A;  3WWV A;  4C2M H;  3L2P A;  1HNW Q;  3IRB A;  1M1K C;  2NVY H;  5FLX c;  1B70 B;  1AE2 A;  1EQR A;  4DV4 L;  1K3R A;  2K52 A;  4R1J A;  1ASY A;  3RLF A;  3CCQ A;  1VQ8 A;  4DV0 L;  2KBN A;  3S2D H;  1P16 A;  1TXY A;  3JC6 6;  4YCU A;  1Q7Y C;  1KD1 C;  3I4N H;  3GTG H;  4X64 Q;  3BJU A;  1L2F A;  1N34 L;  5GAD C;  1OXU A;  1JE5 A;  3J7Z C;  2RF4 A;  2VQF Q;  4HIK A;  3HOW H;  4PG3 A;  4C3I H;  1V43 A;  2LXK A;  5ELN A;  3TRE A;  1PA6 A;  1NMG A;  2VUM G;  1I3Q H;  2JQO A;  3FHW A;  4GS3 A;  2NVT H;  3TS2 A;  1S3O A;  5C44 H;  3F2C A;  4TVA B;  4L5S A;  1CSP A;  1OXV A;  5FJ8 H;  5LMU L;  4LF5 L;  5FLM G;  1N33 L;  3CF5 A;  2QA4 A;  3W5O A;  2ATW A;  3PO3 H;  4HJA A;  1FVI A;  4BBS H;  1HR0 L;  5GQO A;  4YCV A;  4LNQ A;  1Y1V H;  3F2B A;  3HOX G;  4DV2 L;  1CKN A;  1HNX L;  4NXN Q;  3S1M H;  3KDF A;  3S2H H;  4YHH L;  1EWI A;  3I4M H;  2KCT A;  4LW1 A;  4DV6 L;  4OX9 Q;  1E1T A;  2RCN A;  3T1Y L;  4OON A;  4GOP C;  5AJ3 L;  1YIJ A;  3GTM H;  4BXX H;  4LF9 L;  1NMF A;  4DPG A;  1IBM Q;  1D8L A;  3OW2 A;  3W1G A;  4DUY Q;  1UE5 A;  3TS0 A;  2F4V Q;  1L1O B;  1TWA H;  3K7U C;  3STB D;  3U4Z A;  1VQ7 A;  1Y14 B;  4A3L H;  3UDF A;  4AIM A;  4DV1 L;  2UUC Q;  2IT1 A;  2UUB L;  3T1H Q;  2CQO A;  2ASB A;  4JYA Q;  3UDG A;  1PFS A;  4OWX B;  2IX1 A;  3CC4 A;  4AH6 A;  1IYJ B;  1PH7 A;  4LFB Q;  2ZJQ A;  1E1O A;  4L5T A;  4WJ4 A;  1XPR A;  1CKM A;  1PYB A;  1KIX A;  2R93 H;  3I4N G;  4DR3 L;  1HNZ L;  5ELO A;  3STB C;  4YWK A;  2QGQ A;  3CCS A;  4JI0 Q;  4P73 A;  4BA2 I;  3E9I A;  3HOW G;  1TWC H;  2PQA B;  4DR5 Q;  3I4O A;  5C4X H;  4NXM Q;  2RHQ B;  3CW2 C;  2NVQ H;  1YIT A;  1N36 Q;  1A0I A;  1ASZ A;  1P8L A;  3KJO A;  3HOY H;  1A62 A;  2IX0 A;  5GAE C;  2RHS B;  1B8A A;  5C44 G;  1I50 H;  5HY6 A;  1PH1 A;  2JA5 G;  5FJ8 G;  4A3B G;  1WCM H;  4JOI A;  4DR7 L;  1VS0 A;  2UUA L;  3GDE A;  4IFD J;  5LMN Q;  2R92 H;  2OTJ A;  1QZG A;  4UP9 A;  4RMF A;  4UPA A;  1XMO L;  4JI6 Q;  3I7F A;  1IBK Q;  3FP9 A;  1YHB A;  3K0X A;  4POF A;  3I4M G;  1N9W A;  2MFI A;  4GKJ Q;  1HZB A;  1JT8 A;  2L15 A;  2AMC B;  2ALY B;  3A74 A;  3E9H A;  3CCV A;  4BXX G;  3PUW A;  1EUJ A;  4LFC L;  1K0R A;  4DK6 C;  4DV4 Q;  4A93 H;  2I5L X;  4JI1 L;  3ULJ A;  4DV0 Q;  3OYY A;  2Z6K A;  1YJN A;  3J7A 5;  1YVC A;  2HIV A;  4A3L G;  2C35 B;  3AFP A;  1QUQ B;  4GOP B;  5JJI A;  3PF4 A;  4IPD A;  5IY0 A;  3K7A H;  3CC2 A;  1VQB A;  1SE8 A;  2IHE A;  3K8A A;  4IOA A;  4A3K H;  4A3F G;  4LF6 L;  3PUX A;  3ULL A;  1MKH A;  1YJ9 A;  2UU9 L;  2JA8 H;  2R93 G;  2ID0 A;  2R7D A;  3JAM i;  2CWA A;  1VQK A;  4YCW A;  3HKZ E;  1VQ5 A;  3CD6 A;  4OWW B;  2UXB L;  4R4O A;  2NVX H;  3PUV A;  4LF5 Q;  2MNA A;  1IXR A;  1PH8 A;  1N33 Q;  5C4X G;  1SRO A;  3M9B A;  4UY8 C;  3HOY G;  2Y0S G;  2FXQ A;  4LF7 L;  1X6O A;  1LYL A;  1Z9F A;  3MEF A;  1GM5 A;  1HR0 Q;  1HNX Q;  1WCM G;  4DV2 Q;  2AKW B;  2PNH A;  1UE7 A;  3EN2 A;  3LGJ A;  1FL0 A;  1JB7 A;  4YHH Q;  2VW9 A;  3M4O H;  4L5R C;  4DV6 Q;  4LF4 Q;  4X6A H;  1GVP A;  2R92 G;  3A5U A;  4YWM A;  3ULP A;  3T1Y Q;  2E2H H;  3J80 c;  1VQD A;  4OXP A;  3UDI A;  2HQL A;  4LF9 Q;  4OO1 G;  1JJ2 A;  3KF6 A;  1VQI A;  3RR5 A;  3H3V H;  1SRU A;  4JI3 L;  2UXD L;  1IZ6 A;  4A3E G;  3S16 H;  1VQL A;  4DV1 Q;  4DR6 L;  2D0O A;  2WP8 J;  4DR2 L;  2D62 A;  5C0X J;  1WYD A;  2UUB Q;  4KI0 A;  2KEN A;  5IP9 H;  2JA7 H;  1VQH A;  4A93 G;  4IPG A;  4DR1 L;  1YNX A;  1G51 A;  2WB1 E;  4R4Q A;  2BA0 A;  4A3D H;  2R7F A;  4IPH A;  4C3H H;  2K5H A;  3OTO L;  4DV5 L;  4HJ7 A;  3S17 H;  4DR3 Q;  3PSI A;  4C3J H;  4A3K G;  3TQY A;  1YJW A;  1QVF A;  1YHA A;  5GAH C;  3RN5 A;  4JI8 Q;  2ZM6 L;  1WI5 A;  2JA5 H;  2JA8 G;  4LUZ A;  4A3B H;  1PYS B;  2IY5 B;  2K14 A;  1MJE A;  1FJG L;  2UUA Q;  1X9N A;  3F8T A;  4OO1 I;  1VQG A;  4MTN A;  5M5X H;  5JEA J;  2WFW A;  1OXT A;  1S40 A;  3RLO A;  1WFQ A;  3S24 A;  3AFQ A;  1PV4 A;  3CQZ H;  1UE1 A;  3PUY A;  2OQ0 A;  1VQ4 A;  3M4P A;  1XNQ L;  4DUZ L;  2B3G A;  4IPC A;  1L0W A;  4HIO A;  2VL6 A;  1X3E A;  4O2D A;  5GAG C;  3FKI H;  5IYC H;  1K9M C;  4GKK L;  5IWA L;  4EQ5 A;  3KOJ A;  1CUK A;  4JI1 Q;  1TWG H;  3GO5 A;  2OTL A;  2N8N A;  3ICE A;  1U5K A;  1EIF A;  2MO0 A;  5J3B A;  2D0P A;  4KLK A;  2CFM A;  5IP9 G;  1WJJ A;  5BR8 L;  2JA7 G;  2VNU D;  4A3F H;  4FDB A;  2LXJ A;  3AEV A;  1KAW A;  2VY3 A;  2AWO A;  1VQ6 A;  4A3D G;  4LF6 Q;  2ZTC A;  3RN2 A;  4EX5 A;  4A3C H;  2NN6 G;  1X55 A;  1HZC A;  1QZH A;  2ES2 A;  2UU9 Q;  3G71 A;  2Q2U A;  1BKB A;  5JJL A;  1UWV A;  2LSS A;  2A19 A;  2WAQ G;  2BH8 A;  2NZO A;  1Y1W G;  1YZ6 A;  2HIX A;  2MO1 A;  3CCM A;  2HHH L;  3L0O A;  4LF8 Q;  2UXB Q;  3M4Q A;  3G6E A;  2DGY A;  4X62 L;  4JI7 L;  4B3R L;  3CCJ A;  1U0L A;  1E3P A;  4AYB G;  1IBL Q;  1VQF A;  5K36 G;  4LF7 Q;  1YBY A;  4BBR H;  1KC8 C;  3B6Y A;  5IYB G;  3EBE A;  1EFW A;  1LM0 A;  3DLL A;  1GKH A;  4ALP A;  1XNR L;  2KCM A;  3H3V I;  5C3E H;  2E5L L;  3AYH B;  2PQA A;  1NE3 A;  1VQ9 A;  1I5F A;  4J15 A;  2JA9 A;  3NEL A;  2I0Q A;  4UP8 A;  4DAY B;  3J81 i;  3PO2 H;  4A3E H;  4JBK A;  2R7Z G;  3DM3 A;  4JBM A;  2UXD Q;  4A3I G;  3PIP A;  4LUO A;  3CMA A;  5M3F G;  1Q86 C;  4DR6 Q;  4DR2 Q;  3FKI G;  5IYC G;  2XGT A;  3CXC A;  1K73 C;  3GTO H;  3S15 H;  3CC7 A;  3VDY A;  2E8G A;  4A3M G;  2I5H A;  2Q2H A;  4DR1 Q;  1H95 A;  3ER0 A;  1KRT A;  1NTG A;  5M5Y H;  1N8R C;  3PUZ A;  4JBJ A;  1UE6 A;  4NXN L;  1C7Y A;  1X3G A;  2AHO B;  4P72 A;  1N34 Q;  1EOV A;  2K50 A;  3CCL A;  2UXC L;  4WJ3 M;  2Z0S A;  2CKZ B;  1K83 H;  4R4I A;  1PH4 A;  4B3M L;  4LFA L;  4APV A;  2YV5 A;  3GTP H;  4R4C A;  1V1Q A;  3RLN A;  3UE0 A;  4A3C G;  4GN3 B;  5IE8 A;  1X3F A;  3AQQ A;  4JI5 L;  2ZM6 Q;  1IBM L;  2GN5 A;  2N49 A;  1BBW A;  5LMU Q;  3EIV A;  5IP7 H;  2F4V L;  2ZJP A;  1HH2 P;  1TWH H;  1J5E L;  4DV3 L;  1O7I A;  1FJG Q;  3Q8D A;  4GOP A;  3M7N A;  4KHP L;  2OCE A;  4GNX A;  1KXL A;  1BVS A;  4QGU A;  3I56 A;  3CP0 A;  2CCZ A;  4DAM A;  2ZTD A;  1EQQ A;  5DLQ E;  4MZ9 A;  4BBR G;  1KL9 A;  1Q1E A;  1VQM A;  4XIG S;  4K0K L;  1Q1B A;  3M85 A;  1KHI A;  2XTI A;  1XNQ Q;  4QQB X;  1VQA A;  2GVB A;  5AJ3 Q;  2B29 A;  1OXX K;  3U58 A;  2WB1 G;  5C3E G;  4B3S L;  1EYG A;  5EAY A;  2ZJR A;  1CSQ A;  2YU9 H;  3H0G H;  4JBW A;  3G4S A;  4GKK Q;  4NXM L;  5M3M G;  5IWA Q;  5IYD H;  3KF6 B;  3PO2 G;  1N36 L;  1N32 L;  4QIW E;  4IFD G;  3GTJ H;  4A4I A;  4HIM A;  3ZJY C;  5BR8 Q;  1JMC A;  4DNI A;  4L5Q A;  5LMN W;  4PZ6 A;  4A75 A;  2BH2 A;  2B63 H;  4X66 L;  4DV7 L;  5JJK A;  2JA6 H;  1KRS A;  3S14 H;  4DKA C;  2A1A A;  1HNZ Q;  1VQE A;  3HOU G;  1Y1W H;  3F1Z A;  4JOI C;  2JK8 A;  3PF5 A;  2A8V A;  4TQU S;  2N78 A;  2Y0S E;  2N3S A;  4JV5 L;  2HHH Q;  1G29 1;  4QL5 A;  4YWL A;  4B3T L;  4KHZ A;  4AQY L;  1IL2 A;  3D31 A;  2VZA A;  4GLV B;  4X62 Q;  2YTX A;  1I94 L;  4JI2 L;  4JI7 Q;  4B3R Q;  4BY1 H;  4LWC A;  1GO3 E;  4PZ8 A;  4JG2 A;  5IYB H;  5IP7 G;  3UDX A;  1V9P A;  4GLX A;  1UEB A;  2I5M X;  4DR7 Q;  1B7Y B;  3HFZ B;  2CWP A;  4UP7 A;  4HJ8 A;  1E7Z A;  1XMQ L;  1NY4 A;  1XMO Q;  4X65 L;  4DR4 L;  1XPU A;  1XNR Q;  3BU2 A;  1CKO A;  3F2D A;  4JI4 L;  4GLA C;  3K80 C;  2E5L Q;  1C9O A;  4PZ7 A;  1HJP A;  1CKN B;  2MQH A;  3J81 j;  2R7Z H;  3KDF B;  4IFD I;  1VCI A;  4A3I H;  5M3F H;  1MJC A;  2Z6K C;  2NZH A;  2Q2I A;  4YY3 L;  1K8A C;  3TRZ A;  4A3M H;  4LFC Q;  1K8G A;  1S72 A;  4PMW A;  1J6Q A;  3H0G G;  1VQO A;  1JJG A;  2KHJ A;  2JEB I;  3E0E A;  1QVC A;  5IYD G;  3J81 c;  1Q81 C;  4POG A;  1Q46 A;  4IJL A;  3CCE A;  4JC0 A;  1W3S A;  3HOV G;  3J80 i;  3KF8 B;  1EIY B;  1X65 A;  1HR0 W;  2K5N A;  1Q12 A;  3M3Y H;  4GN5 A;  1MIU A;  1R9T H;  4LF4 L;  2OWO A;  4B3M Q;  2UXC Q;  2VS1 A;  2F3I A;  4LFA Q;  4GN4 B;  3HOZ H;  2B63 G;  4A3J H;  4O0A A;  2JA6 G;  1L1O A;  4GNX C;  1C0A A;  3RZO H;  1SLJ A;  4JI5 Q;  1PVO A;  4A3G H;  5M5W H;  5C0X G;  4Y7N H;  2VQE L;  4BY7 H;  3SGI A;  2PMZ E;  5GRO A;  3BZK A;  1AH9 A;  3NEM A;  1HNW L;  1E24 A;  4DV3 Q;  1J5E Q;  3A0J A;  3JAM c;  4KHP Q;  2JE6 I;  2BA1 A;  1D7Q A;  4JYA L;  2H5X A;  4BY1 G;  3GTK H;  1DGS A;  2E2I H;  3CPF A;  2EIF A;  2EXD A;  3HKS A;  4LUV A;  1T9H A;  4X64 L;  1XJV A;  4K0K Q;  2K5V A;  2OQK A;  1E22 A;  4QY7 A;  2VQF L;  3CME A;  1VQP A;  2ZTE A;  5HGQ A;  3CCR A;  4NPS A;  1XTD A;  3S1R H;  5M3M H;  4OWT B;  4B3S Q;  2DUD A;  1OXS C;  4JI3 Q;  4JI8 L;  2K4K A;  2V1C C;  1Z47 A;  4DK3 C;  4H02 A;  3I55 A;  1LUZ A;  1SR3 A;  3GTL H;  1N32 Q;  3D0F A;  2NN6 I;  5JEA G;  2JJQ A;  4IOC A;  2PI2 A;  2KHI A;  4XTC S;  1W2B A;  3HKZ G;  4ME3 A;  3PCO B;  1GD7 A;  2EQS A;  3U4V A;  1A8V A;  3G48 A;  2WAQ E;  5C0X I;  3PO3 G;  4X66 Q;  4DV7 Q;  3OTO Q;  3H15 A;  4DV5 Q;  4A76 A;  2JEA I;  4IO9 A;  2YYZ A;  3HOU H;  3KFU A;  1Y1V G;  4OX9 L;  4BBS G;  3NEN A;  1VQJ A;  3U50 C;  4AYB E;  1QVG A;  2K75 A;  4P71 A;  3GTQ H;  1SMX A;  1LTL A;  3HOZ G;  3S1Q H;  4JV5 Q;  2R6G A;  4P74 A;  3W1B A;  4A3J G;  4DUY L;  4AQY Q;  3RZD H;  4B3T Q;  3TEH B;  3CPW A;  1I94 Q;  4JI2 Q;  1OTC A;  4A3G G;  1A63 A;  2UUC L;  4BY7 G;  2QEX A;  1QUQ A;  1TWF H;  3T1H L;  2PI2 E;  3PV0 A;  4R4T A;  5E7N A;  5H1S E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...