4DV1Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv1Q00
4DV6L 5IP7G 1FGUA 4BA1I 1VQPA 1UEBA 1CKNB 1UWVA 4JI5Q 2IX0A 3M4PA 3RNUA 4IJHA 5IP9G 1WI5A 1MIUA 4HIDA 4NPSA 1GD7A 2EIFA 2C35B 4XTCS 2R92H 4C2MH 3HOVG 1YEZA 1WJJA 2KHIA 5GADC 3ULPA 1A8VA 1OXVA 4A3FH 1QVGA 4DR3Q 3GTKH 5IYDH 3PIOA 4DUYQ 4LFCL 4KI0A 3ZJYC 1K3RA 2YTXA 2K75A 1HNXL 2AWNA 1VQJA 3F2BA 2JEBI 2CFMA 1EIFA 2K50A 1SMXA 4DV2Q 1YHAA 4PG3A 4IOCA 3S16H 1L1OA 3A0JA 4A3BH 1K83H 4JOIA 4NB3A 1IBKQ 1W2BA 1Y1VH 4GNXB 4A3MH 5FLXc 4DV1L 4A3GH 4J15A 2R93G 4AH6A 1HNZQ 2H5XA 3M9BA 2F3IA 4DV4L 3I2ZA 5J3BA 3PCOB 4JI6Q 2BH8A 3K7UC 3TQYA 1A63A 3HKZG 1YJ9A 1XPOA 2ZM6L 4ALPA 3CCEA 3PF4A 2EXDA 3KFUA 2AKWB 3EN2A 4JYAL 4DR7L 4IPDA 3UDFA 5GAGC 5LMUL 2K52A 2RCNA 4HJ9A 4GOPB 3PSIA 3T1YQ 2CCZA 1YZ6A 1NMFA 4NXML 4LF9Q 4H02A 3LGJA 1B7YB 2NVYH 1U0LA 1EOVA 3HFZB 1FVIA 1KIXA 2OTLA 4LUZA 4X65L 1UE7A 5ELOA 2E2HH 3OW2A 5FJ8G 1LM0A 2K5HA 4POFA 4P72A 5IYCH 4HJAA 1Y1WH 1PH8A 1NTGA 5FLMH 1HH2P 2JA7H 3ERSX 1HZCA 3AFQA 4DUZQ 2UU9Q 4Y7NH 1YIJA 1Q12A 4QGUA 3HOZG 1HZAA 4LFAL 3I4MH 2HT1A 1HJPA 1XPUA 4P74A 1X56A 4DAMA 2NVXH 1N33L 4DUZL 1VQNA 4X6AH 1NE3A 5BR8Q 1G6PA 5M3MH 3BZCA 2OQKA 2VNUD 3HKSA 5AJ3L 2JA9A 1TWGH 1HZ9A 2E8GA 3CC7A 4C3IH 3MEFA 5C3EG 1V43A 1AE3A 1MJEA 1N32L 1TWHH 2UUCL 4LF4Q 1IYJB 5C0XJ 4IJLA 1I5FA 2Z6KA 2ASBA 4L5TA 1GO3E 3BZKA 1BBUA 4IOAA 2F52A 2IX1A 3I55A 1Q8KA 4A3DH 4JI8L 1B8AA 2AHOB 1EQQA 3HKZE 1VQ6A 2VUMH 2WAQE 3BU2A 2UXDQ 1YBYA 5IWAQ 2BH2A 4B3RL 3NEMA 3D31A 2ZM6Q 3KDFA 1E7ZA 1VQAA 1EQRA 1KRTA 1HNWL 1L2FA 1HR0Q 5C3EH 4O2DA 4GN4B 3A5ZB 1OXSC 5M3MG 1N36L 1I94Q 3UE0A 1CKNA 2CWAA 1YNXA 2UUAQ 1JT8A 4JI0Q 3CD6A 2OQ0A 1PYBA 1IBKL 1S3OA 2ID0A 1Q1BA 1EIYB 2UUAL 3FKIG 3M4OH 1VS0A 1D7QA 3CCSA 4A93G 3HOXG 2HIVA 1A62A 1BBWA 3W1GA 2ZJQA 4OO1I 2IHEA 2NN6G 1SN8A 4R4TA 1CUKA 4NXNL 5M3FG 3J81i 4DUYL 2JA7G 1XJVA 5E7NA 1VQCA 1XMOQ 2HHHQ 4DK6C 3HOZH 4YCVA 3S1RH 4LFBQ 3J81c 2F4VL 4BA2I 1E3PA 2XTIA 4QL5A 3CPWA 2UXDL 2Y0SG 4BY1H 2JA5G 1M90C 1LUZA 4UY8C 2YTVA 3CCRA 1X3FA 1V1QA 1B70B 2B3GA 2HIXA 2V1CC 1KC8C 4HIOA 5IP7H 1PH1A 1Q81C 1WYDA 2D62A 4JBJA 3K0XA 1S40A 1PVOA 4HIKA 4JI3L 1N32Q 1WCMG 1N8RC 1BKBA 1Z47A 4YWMA 3A74A 5FLMG 4HJ7A 3GTPH 1AH9A 1C9OA 1UE6A 5JEAJ 1VQDA 1PH5A 3OTOL 4GOPC 4DR2Q 3RN2A 1PHJA 1VQMA 4ME3A 4A3LG 4BY7H 4DR2L 2JJQA 2WB1E 2YYZA 4X62L 3CC2A 3S1QH 4OWWB 2LXKA 1E1OA 4KHPQ 4OWTB 4JI7Q 3PGZA 4AIMA 2R92G 1ASZA 2AWOA 3ER0A 1C7YA 1J6QA 1K0RA 4BBRG 2B63G 1Q1EA 4IO9A 2JEAI 1VQGA 2KCMA 3EBEA 2NVTH 1SR3A 1VQ4A 2B63H 3H15A 3S15H 2N78A 5LMNL 5GAEC 2EQSA 2RHQB 3F2DA 1L1OB 2KCTA 2PNHA 4IPCA 1G291 4A75A 2Q2IA 3RLFA 4DR5Q 3T1HQ 1N34L 4OX9Q 3G48A 4MNOA 5IT9c 3HOYG 4BBSH 1PH2A 2HQLA 1X3GA 1RIPA 2VQEL 4A3DG 1VQHA 4YHHL 4JV5L 4A3GG 2R93H 1W3SA 3PO2G 2MNAA 3U50C 4POGA 1JB7A 4DV7L 3S17H 2LSSA 4AQYL 2IT1A 3E9HA 4DAYB 2F4VQ 2MQHA 1ASYA 2NZOA 4JI0L 3AEVA 4LFBL 3RR5A 3SGIA 2JK8A 1I50H 1XMOL 4QQBX 4A3BG 4GLXA 2GVBA 4DNIA 1E1TA 1M1KC 4AYBE 3NENA 1BVSA 2NN6I 3TS0A 2UXBQ 3I7FA 4DV1Q 4QIWE 4IPHA 5C4XH 4DV3L 4A3KG 4GS3A 3GO5A 3J7ZC 1EUJA 3K81C 4HJ5A 2Q2HA 2JA6H 1VQ8A 3F8TA 3B6YA 4DV7Q 5M5XH 3I56A 3TEHB 1EFWA 1TXYA 1EWIA 2ES2A 2R7FA 2UXBL 1R9TH 3UDXA 1SE8A 4YHHQ 3VDYA 4JV5Q 4DR4Q 3CCQA 1NMGA 4LWCA 3KF8B 4UPAA 4BXXH 4A76A 1PFSA 1IL2A 2Z0SA 4JBWA 5GROA 4BY1G 4GLAC 3FHWA 3T1HL 1N34Q 3L2PA 1N9WA 4MTNA 3WWVA 3PUWA 2A8VA 3HOUG 2Z6KC 1T9HA 1GKHA 3F1ZA 4IPGA 4GOPA 1CKMA 1SFOH 4R4CA 1VCIA 1QVCA 5ELNA 5IYDG 4DV6Q 3I4NH 4IFDJ 4LFAQ 2R7ZH 4C3JH 4JI7L 2DGYA 4OX9L 4MZ9A 3GTOH 2UU9L 1K9MC 4BY7G 5JEAG 4GNXC 3D0FA 3CQZH 4LF5L 1CSPA 3J7A5 3M7NA 4LW1A 3GTGH 4Y52H 4O0AA 4A3JG 4YCWA 2E5LL 2D0OA 5C4JH 1N33Q 1RL2A 2RF4A 1P8LA 4GNXA 1KHIA 4YCUA 4B3SQ 1LYLA 4A3LH 3PIPA 1Q7YC 3RN5A 3NBHB 3T1YL 4JI1L 3CPFA 5HGQA 1OXXK 2QEXA 1G51A 1PH6A 1HR0W 4X66Q 2VQFQ 1XNRL 1PV4A 4X65Q 4PZ8A 1TWFH 4TQUS 1XMQL 1U5KA 1JMCA 4HIMA 4JI3Q 4DR4L 1WCMH 3H3VH 3ICEA 1OXUA 1VQBA 1PH9A 4LF9L 3U4ZA 1VQIA 3HOWH 3AFPA 3CCVA 1I6HH 3AQQA 1L1OC 2B29A 4YY3Q 4P75A 4C3HH 3OYYA 3J80c 1FJGQ 2UXCL 1V9PA 4DV3Q 1IBLQ 2VUMG 3J80i 4NXNQ 1QZGA 1X65A 4DV4Q 3M4QA 3K7AH 2I0QA 4TVAB 2Q2UA 1NJIC 1HNZL 4BBSG 1VQ5A 2VW9A 1HNWQ 4R4QA 1KL9A 3ULJA 3RLNA 4GN5A 1QUQB 2VZAA 3W5OA 3E9IA 2ZJPA 4GN3B 3TREA 2ALYB 1L0WA 4AQYQ 5C0XG 3CF5A 1VQFA 3HOYH 4L5QA 1N36Q 5IYBH 4A3IH 1I94L 1OTCA 3S14H 3CCMA 3GTLH 4R4IA 5HY6A 2ZTCA 4OONA 2I5MX 1JJGA 4PZ6A 1VQ9A 2UUCQ 4GLVB 2D0PA 2MO1A 1X6OA 3PF5A 1PH7A 2Q2TA 2UUBQ 3GD7A 3NELA 4DR5L 2UUBL 4B3TL 3S2DH 1VQKA 4UP7A 4B3RQ 5IWAL 1SLJA 4EX5A 2K4KA 4DKAC 5AJ3Q 3CMEA 4JI4L 4RG1A 1TWAH 4KHZA 1IBML 3A5UA 1KRSA 3RLOA 1TWCH 4KLKA 3E0EA 5M5YH 1KAWA 5JJLA 4LF4L 5C44H 2JA5H 3M85A 2K14A 1YVCA 3KF6B 2E2JH 1KXLA 1Z9FA 2BA0A 4QY7A 1PH3A 4LF8L 4KHPL 1Q82C 1E22A 5EAYA 1XNQQ 2ATWA 1FL0A 4DR6L 5K36G 3KLWA 3OTOQ 5BR8L 1X54A 1JJ2A 3CMAA 1IBLL 5GAHC 1KQSA 4QJFA 1O7IA 3H3VI 2CQOA 2UXCQ 1P16A 3ULLA 4DV5Q 2LXJA 3CXCA 3CC4A 3JAMc 4FDBA 2IY5B 3UE1A 4GKJQ 4NXMQ 3HOVH 3DLLA 2YTYA 3G71A 5LMUQ 4DV0Q 3S24A 3JAMi 4PZ7A 2N3SA 3K8AA 1K8AC 1K8GA 3RZDH 4WJ3M 2PI2A 3HOXH 3KOJA 2I5LX 5DLQE 2HHHL 3GTQH 4LF6L 1NY4A 1YHQA 4B3ML 2R6GA 3I4MG 3PUYA 2R7DA 3W1BA 1GM5A 3H0GH 4DV0L 3CW2C 1CSQA 3U58A 4A3CH 4LF8Q 4GKJL 2VY3A 3H0GG 5LMNW 4A3FG 3RZOH 2JQOA 2DUDA 1JJCB 3G4SA 1C0AA 1QUQA 3CCUA 2A19A 3HOUH 2MO0A 2PMZE 3STBC 2VS1A 3PV0A 2AMCB 2A1AA 2PI2E 1SROA 2GVAA 2WP8J 3PUZA 5C0XI 1IBMQ 1OXTA 2BA1A 3STBD 2E5LQ 4JI6L 4PMWA 1X3EA 2YU9H 1HR0L 1MJCA 4LUOA 4LF5Q 3S1NH 3L0OA 5H1SE 4P71A 1DGSA 1PYSB 1H95A 2I5HA 1EYGA 1K73C 2KENA 5M5WH 5M3FH 1Q46A 4A3CG 2L15A 3DM3A 3G6EA 3GDEA 5IY0A 4DV2L 5IYCG 3BJUA 1Y1WG 3PO2H 4JI8Q 1QZHA 1Q86C 1UE5A 1HNXQ 2OTJA 5C4XG 1J5EQ 1X9NA 4LFCQ 4R1JA 3KJPA 5IP9H 4JBMA 4BXXG 4A3IG 3Q8DA 4LUVA 4A3EG 1YITA 1GVPA 1X55A 4B3TQ 2N49A 3KF6A 4JC0A 4L5RC 2CWPA 2NZHA 1SRUA 4JG2A 2KHJA 2OWOA 3PO3G 3AYHB 4R4OA 1J5EL 2NVQH 4OO1G 3K80C 1Y14B 1XPRA 2YV5A 3JC66 1VQ7A 4JI5L 2PQAB 3EIVA 1VQEA 2JE6I 1FJGL 4OWXB 4AYBG 5FJ8H 1XTDA 1IZ6A 1NBWA 2ZTEA 3UDIA 1YI2A 4LF7Q 3PUXA 4OXPA 3CCJA 1MKHA 3KYHC 4JI2Q 4A3MG 5JJKA 3CCLA 4JOIC 3IRBA 4DR1L 3F2CA 1S72A 4XIGS 3S1MH 4X64L 4LF6Q 1JE5A 4YWKA 4HJ8A 1YJNA 2GN5A 4IFDI 5GQOA 4JCVE 3TS2A 2Y0SE 1UE1A 4X66L 5IE8A 4YY3L 1HZBA 1XNRQ 4A3EH 2JA8H 4GKKQ 4K0KL 2QGQA 2XGTA 2FXQA 1I3QH 2MFIA 4YWLA 3CAMA 2CKZB 2K5VA 2VL6A 2JA8G 3S2HH 4DR7Q 1QVFA 4JYAQ 4GKKL 3PUVA 4APVA 2VQEQ 1PH4A 3FP9A 4B3MQ 4JBKA 1YHBA 3UDGA 1VQLA 1KD1C 2PQAA 4IFDG 1Y1VG 1XMQQ 1E24A 3J81j 1VQOA 4WJ4A 1PA6A 2IHFA 2KBNA 4P73A 2WFWA 5C44G 4UP9A 2VQFL 4DR1Q 5LMNQ 5IYBG 2QA4A 4JI1Q 1WFQA 2ZJRA 1D8LA 4BBRH 2K5NA 4A3JH 1XNQL 3FKIH 3GTMH 3HOWG 3I4NG 2E2IH 4DPGA 1WOCA 2N8NA 2RHSB 3L7ZC 3KJOA 1CKOA 2WB1G 1YJWA 4K0KQ 5JJIA 4DV5L 4EQ5A 4B3SL 4A4IA 4A93H 3TRZA 3U4VA 4UP8A 4X64Q 4A3KH 3GTJH 1IXRA 3I4OA 4RMFA 4X62Q 4JI4Q 4LNQA 3PO3H 2JA6G 4JI2L 3KDFB 2R7ZG 1A0IA 2ZTDA 4DR6Q 2WAQG 4LF7L 1AE2A 2OCEA 4DK3C 3CP0A 4DR3L 4L5SA 1LTLA 3M3YH 3MXNB
chains in the Genus database with same CATH superfamily
1FGUA 5IP9G 1WI5A 5JAVA 2YU9B 5NUCA 1PTOH 3ITPA 4R8NA 1GUWA 4C2MH 4M1UB 1F2ZA 1WJJA 3ULPA 1OXVA 3M4OB 3E6ZX 3DMUA 2HD3A 2A6HD 1A6XA 2D9UA 2YTXA 3OHXC 1IW7C 5KYLA 3Q23A 4PG3A 1ICFB 4IOCA 1BCPF 1EFID 1F2LA 2IPKD 2NZ1D 3SHLA 1RCVD 3MFYA 5JEAH 1K8MA 1HNZQ 3PCOB 4JI6Q 1DYQA 1A63A 1HRJA 1YJ9A 3CCEA 4C3JB 2EXDA 3EN2A 4F88A 4JYAL 2F0NA 3QO2A 3URYA 3UDFA 5LMUL 3AEVA 2K52A 1STNA 4GOPB 5C4HA 3BDLA 1SJED 1YZ6A 4WFN3 4H02A 3LGJA 1ZYRC 4OO1H 1EOVA 1FVIA 2E2HH 3MFGA 3LX0A 3MZ5A 4P72A 4POFA 4HJAA 1PH8A 1NTGA 5FLMH 3FEWX 4UHVA 4K8JA 1HZCA 4EQOA 3NQIA 1Q12A 1HZAA 4LFAL 2HT1A 4P74A 1SJHD 2WV6D 1X56A 2F0IA 5EJWA 5KNDA 4ZKBB 5M3MH 1G6PA 2OQKA 4ILWA 2VNUD 1HZ9A 3EVQA 4C3IH 1EYCA 4LF4Q 1B9NA 1CT1D 2F0QA 1PXUA 2KECA 1GO3E 3BZKA 1BBUA 2XSCA 2IX1A 3I55A 4WORA 3L3OC 4A3DH 4IUNA 2V4DA 1ENCA 3C1EA 2EXZA 2BH2A 3MHBA 4B3RL 2ZXOA 4A3IB 1HR0Q 3QIAA 1B1ZA 2BOSA 1JT8A 3CD6A 1PYBA 1E0BA 3FKIG 1VS0A 5CV7A 2HIVA 1A62A 3VYTA 5C3WA 3W1GA 1EY0A 2ZJQA 2IHEA 1S5FD 4RH6A 4DUYL 5J1ZA 1XJVA 1H9JA 5E7NA 4YCVA 3S1RH 2JA5B 4LFBQ 3J81c 2JP1A 4QL5A 3CPWA 5ELBA 1SYDA 4BY1H 3IL8A 2F3VA 5COYA 1EIGA 1HUMA 2EYHA 1SYGA 2B3GA 1V1QA 1KC8C 1Q81C 1Q3LA 3EJIA 4HIKA 1N32Q 2F0UA 5FLMG 1F9PA 3CU7A 4HJ7A 3GTPH 1C9OA 4A3EB 1U4MA 3OTOL 4NW2A 3RN2A 1DJRD 1TY0A 4BY7H 1BXTA 2JJQA 2WB1E 4X3KA 3CC2A 5FOBB 2LS01 1J6QA 3E0JA 2B63G 4Q0FA 2F0DA 1HXYD 2KCMA 1DD2A 5E1FA 2BE5C 3S15H 4BBRB 4Y7NB 2Z4IA 3F2DA 3T1HQ 1N34L 4OX9Q 3I4MB 3VYRA 1GUGA 2VQEL 4A3DG 2B8GA 2NVXB 2A6EC 2F03A 2K03A 3K7AB 2MNAA 2LFNA 1JB7A 5L37A 4DV7L 3S17H 2F4VQ 2MQHA 1ASYA 2NZOA 3SGIA 2JK8A 4QQBX 2E75C 4A3BG 4PMBA 1YNJC 2GVBA 4QMGA 2PPBC 1EIHA 4IPHA 2R92B 4DV3L 4C2MB 1D5XC 3GO5A 2JA6H 3GTKB 3KLSX 1EFWA 3FPUB 1TXYA 3M7GA 3UDXA 1QNUA 4YHHQ 3DXJC 4BXXH 5M5YB 1IL2A 1DOLA 3A8KE 4BY1G 5EPKA 1LTGD 1CQFA 3PUWA 2A8VA 3ERQA 3BDCA 1CA5A 4IPGA 4H7BA 4CJ2C 3VR3A 4B9WA 4ABNA 2NUCA 4IFDJ 1A3UA 1PRTC 3GTOH 4C3JH 4OX9L 2BDOA 3FVQA 4CGYB 3ND8A 4BY7G 4JW0A 5JEAG 3CQZH 2EPBA 3DM1A 2SDFA 4N8FA 4O0AA 4A3JG 2D0OA 5C4JH 1JWUD 3H94A 3R2TA 3NBHB 2G9DA 3K57A 2QEXA 4TSSA 4X66Q 1XNRL 1HTPA 4TQUS 5T1IA 3VR4A 1VDZA 4JI3Q 1HCZA 1KDAA 1AW7A 2B63B 3HOWH 1I4GA 1NSNS 3AFPA 1I6HH 1L1OC 1BBXC 4P75A 4C3HH 1Y8PB 1D2BA 2XRSD 4HSPA 1FJGQ 4RKLA 1TWHB 1V9PA 4CKEA 2F0EA 2VUMG 1QZGA 3M4QA 4TVAB 2Q2UA 1D5MC 4QCLA 2AQ3B 1QUQB 3W5OA 2ZJPA 2ALYB 1FD7D 1L0WA 4AQYQ 5C0XG 4FXKC 1SNMA 1VQFA 2VXWA 5JPNC 3HKZB 3FMCA 3NBIA 4R4IA 2ZTCA 4RHSA 2Z4HA 2I5MX 1JJGA 4ODGA 4PZ6A 3AU7A 1CZWA 3SDZA 4IUPA 1X6OA 1PH7A 4A3BB 3GD7A 3NK9A 1I4HA 4EX5A 4FYDA 5M5XB 4X3SA 3SXHA 5AJ3Q 1PLFA 2A6HC 4KHZA 1IBML 1KRSA 3PMFA 1CK1A 1KAWA 3D4RA 3S1RB 2JA5H 1FNVA 2E2JH 4QY7A 2BA0A 1PH3A 4KHPL 1Q82C 1E22A 2K05A 5D65A 2ATWA 3KLWA 1WTWA 1ET6A 2KEDA 1IBLL 4QJFA 1O7IA 1SYCA 1WVLA 4U673 1P16A 4OEMB 4DV5Q 2LXJA 4XYOA 3CC4A 3I4LA 4FDBA 3UE1A 4DNTB 4GKJQ 3HOVH 2YTYA 3G71A 5LMUQ 3JAMi 4PZ7A 2F0HA 4RGMA 2I5LX 1B2TA 1YHQA 5IGCA 2R6GA 3I4MG 3W1BA 3H0GH 1TIID 1TWGB 2B8FA 3T51B 3QOLA 4GKJL 1EYDA 4G7HC 3RZOH 4EQNA 2JQOA 4I7ZC 2H4OA 2A19A 3STBC 2VS1A 2AMCB 2B2VC 5KGUA 2GVAA 2WP8J 5C0XI 3STBD 2E5LQ 2K5WA 3CKIB 1X3EA 2YU9H 1HR0L 3S17B 4LF5Q 3IKJA 5JVH3 1PYSB 5FO9B 2I5HA 1EYGA 2KENA 5M5WH 5M3FH 4RCOA 3K5OA 5IYCG 4BWGB 3OPOA 1PFMA 2K5QA 5LHY1 1Q86C 3EFXD 1HNXQ 5C4XG 1J5EQ 1ENAA 4R1JA 1PDQA 2JSOA 2L5TA 3Q8DA 5EKKA 4A3IG 1GVPA 1X55A 3SK5A 2N49A 4JC0A 4L5RC 2CWPA 1MHWC 1SRUA 4JG2A 2WINB 4LMQD 2B2YA 3DHQA 3K80C 1GOZA 1D1IA 3K59A 1FJGL 4UAIA 3S2DB 1NBWA 2ZTEA 3UDIA 4LJZC 3OSOA 4OXPA 4JI2Q 1PYWD 2K04A 1CQVA 3F2CA 1S72A 4XIGS 4GZYC 1KNEA 5FKAC 2EYMA 4J6HA 4KV6A 2GN5A 2OT2A 4IFDI 1I4QA 3DWPA 2JA8H 2OF1A 3CQZB 2FXQA 2NBFA 1G2TA 3CAMA 5C6AA 3S2HH 2EY5A 4DR7Q 2F0VA 1QVFA 1PH4A 3LWEA 4JBKA 1WTRA 1YHBA 4DXFA 1VQLA 4DAYA 2PQAA 1ZYRD 5JOBA 3OIQA 2IHFA 5C44G 2WFWA 4ULLA 2ZJRA 1XNQL 2K5NA 4A3JH 4XXEA 3F2UA 1KAAA 2NWGA 2Z8LA 2WB1G 3HOXB 5KNCA 1QILA 4EQ5A 1STBA 1GHKA 4ZKCB 4I7AA 3GTJH 2O4XA 1Z6HA 3PO3H 4LNQA 4A3DB 3MC0B 2F0WA 3NUCA 3KDFB 2R7ZG 2ZTDA 4RGTA 4DK3C 3CP0A 3M7NA 1SE3A 3M3YH 4DV6L 4BA1I 4OGQC 1VQPA 1UWVA 1CKNB 4DFAA 1CHQD 1MIUA 4HIDA 1GD7A 2L0CA 2C35B 4V0BA 1C48A 3HOVG 3Q24A 1SNCA 1EZ6A 1V1PB 2RDGA 4RGNA 3PIOA 2ZT9C 1QE6A 1K3RA 5CYUA 1YNJD 1VQJA 3F2BA 3J81E 1LACA 1EIFA 1X3QA 2OXPA 1JORA 1L1OA 4A3BH 3WOEA 2HCCA 1W2BA 4GNXB 5G3LD 2R93G 3KF8A 1MD2D 2H5XA 2FINB 1F2YA 2F3IA 3MXPA 1TWAB 2BH8A 1RTNA 3TQYA 3RMHA 3PF4A 1KDBA 2KHSA 1DXMA 1U4PA 2C9OA 1BR9A 3TZUA 2BDNA 2EJFC 2WKDA 4DR7L 1D5ZC 5GAGC 2CCZA 2WKCA 2X6GA 3GTGB 1SDFA 4NKLA 3GV3A 3TMEA 1JB3A 1UE7A 5AFWA 1O7ZA 3OW2A 5IT9E 5HGTA 5IYCH 2IW3A 3V2TA 5IT9L 1HH2P 2VB3X 4IFDH 4DUZQ 4KHVA 3RZDB 4Y7NH 4PNYA 2MP1A 4IUQA 1HJPA 1Q8IA 4BBSB 1DCZA 2NVXH 4IQZA 1WCMB 1D1KA 1VQNA 1NE3A 4RGOS 1R4QB 2M00A 2NYZD 1SNOA 5I4DA 1IYJB 4IJLA 1I5FA 3T13A 2ASBA 2F52A 1B8AA 2AHOB 2J0TD 1O80A 3SK6A 1JWMD 3LNNA 2WAQE 1WD1A 5IWAQ 2F0FA 1AZQA 3KBGA 3KDFA 1E7ZA 1VQAA 1L2FA 1C8CA 3PO2B 1ICWA 3GTLB 1F77A 3Q22A 1STYA 1HFNA 5LL6X 1RJTA 3CRLC 4G4KA 3UE0A 2FHTA 1HFGA 5EKLA 2OQ0A 1S3OA 2ID0A 2PW5A 1EIYB 2Q8RE 4A93G 4B9XA 4K8IA 3K58A 4K6DA 1SN8A 2JA7G 1CUKA 4NXNL 3TP5A 1VQCA 2C5CA 1XMOQ 2HHHQ 3HOZH 1BF4A 3GTOB 2XTIA 2F0TA 2RKSA 1TS5A 1ZKOA 3CCRA 1AN8A 1EU4A 3K0XA 4JI3L 1WCMG 2EOTA 1Z47A 4YWMA 1AH9A 2A69D 1PH5A 4DR2Q 4ZK9B 4ME3A 4DR2L 2YYZA 4X62L 4OWWB 1E1OA 4H0LC 1C7YA 1HA5A 1K0RA 1G8ZD 4BBRG 1WTXA 2JEAI 3EBEA 1K8OA 1DONA 1SR3A 3H15A 5FK9C 5LMNL 5GAEC 1STGA 4F7XA 1L1OB 2KCTA 4P2CB 1G291 4PQXA 1UEAB 2A68D 5IT9c 3D4WA 3MA2B 2HQLA 1IHZA 4JV5L 3GTJB 2R93H 2RA4A 3U50C 4RA8A 2LSSA 4N9PA 3E9HA 1XTCD 1ILPA 5HURA 4JI0L 4LFBL 4KJNA 1XMOL 2MUYA 1PZJD 4GLXA 5ELFA 1E1TA 3HG9A 4AYBE 3KLSA 2UXBQ 3SE0A 1G91A 2XWBB 1BCPC 5F2DA 3G7LA 4CKBA 1EUJA 4HJ5A 3F8TA 3B6YA 2X69A 3I56A 3TEHB 1DZ1A 1XX8A 4DNRB 2FMMA 1X32A 2L11A 3DEPA 1NMGA 4LWCA 4UPAA 2QKIC 2Z0SA 5C44B 3FHWA 1LV9A 3D6WA 1N9WA 1Y69U 4MTNA 2KVMA 2L1BA 4CJ0B 1LT4D 4YIJA 3DUZA 3HOUG 3F1ZA 1L0XB 2X6LA 4GOPA 1CKMA 2HCIA 1VCIA 2RSNA 3NE5B 5IYDG 3MVVA 4JI7L 2IL8A 4MZ9A 4FXGC 1K9MC 3HRZC 3D6CA 5CV9A 1LTRD 4FF2A 3T16A 3NWTA 2RF4A 1P8LA 1GUNA 1G6ZA 4B3SQ 3DWQA 2AUKA 3UI2A 4A3LH 3VA5A 1LT6D 1Q7YC 3T1YL 1A3TA 4ZUIA 3SEBA 5HGQA 1OXXK 1PH6A 1HR0W 1LTSD 3RZOB 1PV4A 1XMQL 5LL6S 1I4RA 1PH9A 3U4ZA 1LABA 3PIO3 4F8MA 2B2UA 1TU2B 3AQQA 1H9MA 5I6YA 4HCEA 1PFNA 3J80c 2WAQB 2UXCL 1EY6A 5I9PA 1QB5D 4IZ8A 4NXNQ 5TSSA 1U4LA 1VQ5A 1HNWQ 1KL9A 3MXNA 5A35A 3RLNA 4GN5A 2VZAA 3E9IA 3C46A 2EY1A 2F0JA 2PZWA 1UAPA 3CF5A 4L5QA 1N36Q 5IOCA 2F3WA 5IYBH 4A3IH 3S14H 2RDFA 1VQ9A 1II3A 3S16B 4GLVB 2UUBQ 4B3TL 4FP5D 3S2DH 2UUBL 3E5SA 2EDGA 4UP7A 3NP8A 4DKAC 4JI4L 4RG1A 1FYCA 1R9TB 4XQQA 1TWCH 5JPMC 1EQTA 1B44D 2ZXPA 1SE4A 1KXLA 2JA8B 4LF8L 4BY1B 3ONAB 5KEEA 1XXGA 1XNQQ 1KLUD 5BR8L 1W6JA 1X54A 1JJ2A 1SFOB 2P5ZX 2LY7A 2KCNA 2E2DC 3GTMB 1K8AC 4WJ3M 1B50A 1QG7A 3HOXH 3GTQH 2HHHL 4LF6L 1NY4A 3A55A 4B3ML 1SBBB 1HHVA 5EPJA 3PO3B 4DV0L 3CW2C 3U58A 4A3CH 2AQ1B 2PNRC 2VY3A 4A3FG 1NR2A 1JJCB 3G4SA 1C0AA 3HOUH 3CCUA 2MO0A 2PMZE 1SROA 3PUZA 4XDXA 1OXTA 2F0LA 4JI6L 1MSGA 5FO7B 3J7YW 2MPMA 1MJCA 4LUOA 3L0OA 4HMJA 2XVSA 1ML0D 4P71A 2DJFC 3K5NA 5I2XA 1Q46A 3MTSA 1SAPA 5IY0A 4JI8Q 3FDTA 1S4ZA 3KJPA 4HEDA 1EL0A 4BXXG 3J7A5 3X3NA 4B3TQ 3I91A 3KF6A 3BVZA 4IN3A 3HOYB 2KHJA 4MIUA 3AYHB 4NDXA 1Y14B 2YV5A 4XQJA 3CHBD 3RUZA 4A93B 4OWXB 5FJ8H 4K5VA 1IL8A 4C3JG 1VMCA 4EQPA 2PZUA 3PUXA 3CCJA 3KYHC 1TY2A 1YNNC 4TRDA 5JJKA 3BG3A 3CCLA 3S1MH 2B2TC 3VR5A 4LF6Q 4N9TA 4LAAA 5JVG3 1O7LA 1UE1A 4X66L 1XNRQ 1HZBA 3I3CA 2QGQA 2MFIA 5C5MA 1ESFA 2DNCA 3S1QB 1ESRA 1QWYA 4JYAQ 5C4JB 4GKKL 3NTIA 4MTKA 2MGSA 4KK7A 2A68C 1MSHA 1SYEA 3D8GA 3FP9A 3R8BA 2VQEQ 5FLXE 5M9OA 1KD1C 2DY8A 4XT3B 4IFDG 1E24A 4CBVA 1D6EC 4HSVA 4WJ4A 4P73A 2VQFL 3TP7A 3P7JA 4UP9A 4DR1Q 5IYBG 1WFQA 4HTHA 3HOWG 3I4NG 5IIFA 3C2PA 3C1FA 4K0KQ 5CGKA 3SVMA 5JJIA 3TSSA 1A3VA 3MEHA 4A4IA 1JC7A 2IWHA 4X64Q 3I4OA 4RMFA 3KUPA 2JA6G 2A69C 1I6HB 4LF7L 4DR3L 1CI3M 2QILA 1LTLA 2VB2X 4HR7B 1EOTA 1I50B 4C1NI 4ID6A 1HQMC 3D3RA 1JOKA 3I73A 1PTOD 1J8IA 1BDOA 3S1NB 1WD0A 4XTCS 1SYBA 5GADC 1QVGA 1A8VA 1RF2D 4DR3Q 4RCNA 3X3MA 4LFCL 1B3QA 1HNXL 2AWNA 2CFMA 3N52A 1PZKD 2M9VA 5DEHA 1YHAA 1G2SA 4K14A 3S16H 3A0JA 1IBKQ 4NB3A 4FF1A 4QUCA 2F0PA 1Y1VH 5E3FA 3I90A 2A5HA 3WDNA 4J15A 5FLXc 5A2QL 4DV1L 3M9BA 3I2ZA 5J3BA 4C56C 4ZUJA 1L0YB 3HKZG 4H44C 2ZM6L 3MXGA 2EYFA 3KFUA 2AKWB 3HEJA 4IPDA 1J9OA 4HJ9A 4BY7B 1NMFA 2E74C 4LF9Q 1M4VA 4QB4A 2NVYH 3L9AX 1U0LA 1EWHA 2HDMA 2OTLA 3VYSA 3H6MA 5ELOA 2EZVA 3ERSX 1RD9D 2UU9Q 1H9SB 4QGUA 1TWFB 3I4MH 1OO9B 1U9RA 2F0KA 1GUTA 1N33L 4X6AH 1W6KA 5BR8Q 1SSOA 3HKSA 5AJ3L 1TWGH 2E8GA 3FKIB 5K5PA 3CC7A 2E2IB 5C3EG 3QJYA 1AE3A 2UUCL 1X3PA 2Z6KA 5IGEA 1JCKB 4L5TA 4IOAA 1VQ6A 1EQQA 3HKZE 2SNSA 3BU2A 2UXDQ 1YBYA 3QB3A 3NEMA 3FRPB 2ZM6Q 1HNWL 2JA6B 1KRTA 1SYFA 3ZYYX 1Y8OB 4O2DA 1H9SA 4GN4B 1TS2A 3A5ZB 5D3DA 2B2WA 1PTOB 5C5LA 1N36L 1CKNA 2CWAA 1YNXA 4A3FB 1IBKL 1E2ZA 3VYUA 3M4OH 1BOSA 4KY5A 1D7QA 4U68A 1AFPA 5T1GA 3CRKC 1BBWA 2FMCA 4WJWA 2CHBD 4OO1I 2NN6G 1K3BC 5ELEA 3T53B 1K83B 2F4VL 4BA2I 1E3PA 2EYOA 4A3MB 3ND9A 1HPCA 1M90C 4UY8C 2EYLA 2YTVA 1PH1A 3G6JB 3OW7A 1WYDA 2D62A 2DN8A 1PVOA 2B2VA 5CV6A 4QIWB 2PQEA 1N8RC 1QNKA 2ICIA 3A74A 1UE6A 1LT3D 1VQDA 5JEAJ 4DA2A 1PHJA 3IAYA 2WIIB 1SE2A 4A3LG 1EWCA 3S1QH 1LO5D 4OWTB 1O78A 1TR5A 4AIMA 3ER0A 3H91A 3P20A 4CDDC 1CFMA 1Q1EA 4IO9A 1VQGA 1Y1WB 1VQ4A 2B63H 2JA7B 3VA7A 2N78A 2EQSA 2B39A 4CHTB 2RHQB 2PNHA 4IPCA 3RLFA 3HOYG 2H1EA 4MNOA 3EA6A 4FF4A 2RVLA 1S5ED 1MGSA 4KKSA 3OMCA 5M3MB 3IFDA 4POGA 2Z6BA 2MHVA 3OIPA 4DAYB 1GUSA 3N6RA 4ZRZA 2O5JC 2B2WC 1RDPD 1I50H 2NB0A 3TN2A 1S5CD 1JE4A 1NNXA 1M1KC 1EYAA 3NENA 1B4OA 4QIWE 4KN4C 4A3KG 3J7ZC 1V8QA 5CV4A 2Q2HA 3LWUA 1VQ8A 2R61A 1A2TA 3EROA 5M5XH 1YNND 1HTLD 3O13A 1R9TH 4JV5Q 2A74C 3CCQA 1TWCB 4A76A 4XT1B 5CV5A 2DJGC 4JBWA 5EGTA 1JICA 4GLAC 1Y1VB 4FO2A 4KMUC 3TP8A 2GA4B 2Z6KC 1T9HA 4OIJA 1SFOH 4Q5VA 4R4CA 1QVCA 2M2LA 3SR1A 5ELNA 2XIWA 4LFAQ 2R7ZH 4OIKA 3W3AA 4ZCKA 3T56B 2I07B 4GNXC 3D0FA 4LF5L 1CSPA 1I3QB 1PTOF 5DM63 3GTGH 4Y52H 1TVXA 4KY7A 4YCWA 1RL2A 2Y0SB 1FNUA 2F0SA 3BYTB 4GNXA 1CTMA 4YCUA 3GQBA 2BE5D 4Z9CB 5BN4A 4IUUA 3H0GB 3I70A 1MI2A 4K6LA 1RKNA 4JI1L 4KKUA 3CPFA 3SK4A 2KUMA 1G51A 3A8IE 3QR8A 2XWJB 2VQFQ 2AUJD 2L9HA 4X65Q 1U5KA 1JMCA 1E2VA 4HIMA 2Q8TA 4DR4L 1WCMH 3ICEA 1OXUA 4LF9L 1VQIA 3S15B 3PIP3 3K0YA 1PFBA 1TS4A 4YY3Q 3R3OA 3OOCA 2E76C 3SK8A 4V190 4DV3Q 1IBLQ 4IUTA 3J80i 5C4ZA 4DV4Q 2I0QA 1B9MA 4BBSG 3NXWA 3ULJA 3Q0AA 1RHPA 1NUCA 1H9RA 3QG1A 3V96A 3TREA 1I94L 1OTCA 3GTLH 5HY6A 1TQOA 1Y8NB 4OONA 2PCFB 2UUCQ 1SNQA 2D0PA 2MO1A 3PF5A 4A93H 3KK7A 4B3RQ 1I4PA 3DEOA 1VQKA 2D5DA 1SLJA 1V1OA 2EE1A 3OWFA 1EQVA 3RLOA 3K6OA 4KLKA 5M5YH 4LF4L 1IKLA 2B2YC 2IJ0A 3KF6B 5I9OA 4RAUC 1LTAD 4ZAIA 2QDLA 1CHPD 1FL0A 4DR6L 5K36G 5KRUA 4KTAA 5CR3A 3I8ZA 1KQSA 2UXCQ 2CQOA 3I4NB 4G7ZC 3ULLA 4CJ1B 3T4AC 3OWEB 2IY5B 3NSWA 2TSSA 3DLLA 3NPPA 3S24A 3BVGA 4A3JB 3K8AA 4HCSA 1LLRD 1UNSA 5DLQE 2NTSA 2KEEA 2WACA 2N55A 2KJXA 5FLXL 2R7DA 1GM5A 3K5LA 4LF8Q 2A73B 3H0GG 4O42A 1RODA 2DUDA 2QCPX 3NTHA 5IGBA 2HDLA 4TKOB 1Q90A 3J80E 2BA1A 3U9OA 4L63B 3PQIA 1JOQA 5H1SE 5EBDA 1K73C 4DK0A 1PZID 4A3CG 4IALA 3GDEA 1Y1WG 1QZHA 1K28A 3MWYW 3MAQA 1WTVA 1X9NA 1RTOA 1BCPB 4LFCQ 4JBMA 1T5EA 4LUVA 5G3LF 2NZHA 1TS3A 3PO3G 4S3SA 1QJOA 4R4OA 1J5EL 4OO1G 1XPRA 4F87A 4JI5L 1FGBD 2LKVA 2JE6I 4AYBG 3P1HA 4K2LA 4WRDA 4LF7Q 1MKHA 1HUNA 1SMYD 4A3MG 3Q6SA 1U4RA 2K7VA 3GP7A 3IRBA 4JOIC 4DR1L 2NVYB 4X64L 2JXMB 1JE5A 4YWKA 1YJNA 2Y0SE 4K0KL 5IE8A 4YY3L 4HN7A 4A3EH 5C3XA 4DN4M 5IGFA 2JA8G 2CKZB 2VL6A 1ONLA 1TKWB 2O2LD 4OL7A 3PUVA 4APVA 3QOJA 4M8AA 1XMQQ 1VQOA 1EEFD 3HOVB 4ZQ3A 5KIXA 2NVTB 1VMPA 5E4XA 1EZ8A 3C3LA 2E2IH 4DPGA 1WOCA 2N8NA 2RHSB 3L7ZC 4ZYSA 3KJOA 1YJWA 5JJZA 1H9KA 2EJMA 3V05A 2HUGA 3TRZA 3U4VA 1I4XA 3IFTA 2CVRA 5D14A 4OHJA 4X62Q 2N88A 3WOFA 4DR6Q 1AE2A 4L5SA 3MXNB 5CMDA 5IP7G 2CH4A 1UEBA 4JI5Q 3NBHA 2IX0A 3M4PA 3RNUA 4IJHA 3TBIB 4NPSA 2EIFA 4MN3A 4X3TA 2R92H 3HS0C 1YEZA 2KHIA 1PMRA 4A3FH 3M4YA 2XRQD 4KKTA 3GTKH 5IYDH 4DUYQ 4KI0A 3ZJYC 4IUVA 4DXGA 2K75A 5J39A 2JYOA 2JEBI 3BDOA 2K50A 1SMXA 3NHHA 2F4IA 5CORA 4DV2Q 1BCPD 3HOZB 1K83H 4JOIA 5A2QE 1BO0A 2LMCB 4A3MH 1TT2A 2BCOA 4A3GH 1AP0A 4AH6A 3A7AB 2CW0D 4DV4L 3K7UC 1ZEQX 1XPOA 4ALPA 1EY8A 2PO4A 4PMCA 5EBCA 3RD4A 3JAML 3S9WA 2KCCA 2RCNA 3T1YQ 2D2CC 3PSIA 1STEA 3JAME 4XYQA 1GHJA 3EQLC 4NXML 3QWNA 1B7YB 3HFZB 1BNZA 1KIXA 4LUZA 4X65L 1E2WA 5FJ8G 1F9SA 1LM0A 2K5HA 4G57A 5K36H 1Y1WH 1JWSD 5EKIA 2JA7H 2CQAA 3AFQA 1YIJA 3HOZG 1DM0B 1EY9A 1KDCA 3HZXA 3GTQB 4BS9A 1XPUA 1KABA 4DAMA 4X3UA 4DUZL 3BZCA 3HOWB 2JA9A 4CKCA 1QCBD 3I72A 3MEFA 1V43A 4RHRA 3HOUB 4C3HB 2KOLA 1MJEA 2DNEA 1N32L 1TWHH 5C0XJ 4A3KB 2SNMA 4FF3A 1EEID 3D4DA 5ELCA 1Q8KA 4JI8L 2PYKA 5IGDA 2VUMH 3M3YB 3D31A 4R8IA 4KD4A 5I2YA 4NP5A 1EQRA 2K5DA 2F1MA 1STAA 5C3EH 3J81L 2EVBA 1OXSC 5EPLA 5M3MG 1I94Q 1ENFA 3BVMA 2UUAQ 1EY5A 4L6TB 4JI0Q 1DOMA 1Q1BA 5C0XH 2UUAL 2IX3A 3CCSA 2WB1B 3HOXG 4RWSC 5CBAE 4CDCC 3BS1A 4E6IA 1IYUA 4R4TA 3TP6A 1F2MA 2RBMA 4J8QA 1ET9A 3J81i 5M3FG 4DK6C 4HMIA 2E2JB 2R7ZB 2EJGC 4DGZA 2UXDL 1STHA 2Y0SG 1KTKA 2JA5G 2PZTA 1SNDA 1SMYC 1LUZA 2K1BA 2RSOA 1X3FA 2HIXA 1B70B 2G5DA 2V1CC 1AZPA 1SNPA 2QEJC 5IP7H 4KD3A 4HIOA 3J7AF 3S1MB 1S40A 4JBJA 3NQTA 4KY6A 5DAUA 1BKBA 3MXUA 1A2UA 4GOPC 1VQMA 4FVMA 4KHPQ 2LXKA 1KNAA 4JI7Q 3PGZA 2R92G 2QF7A 5CV8A 1ASZA 2AWOA 3HP3A 1WTPA 2E2HB 3U9SA 2F0GA 4UDUC 4AYBB 1B3AA 4B08A 2NVTH 1BUVT 4KJOA 4ZLTF 4A75A 4DR5Q 3P75A 2Q2IA 3G48A 1LT5D 4BBSH 1PH2A 1X3GA 1RIPA 4OELB 1VQHA 3VR6A 4YHHL 4A3GG 1W3SA 5ISRA 3PO2G 3TDQA 1VF7A 5J22A 1XYIA 4C3IB 4AQYL 1JQYD 2IT1A 4K5XA 1VF5C 1O7YA 2SOBA 4LK1C 3RR5A 5M5WB 5M3FB 1EY4A 4I65A 1SEBD 1K0SA 3S14B 4DNIA 3J80L 1BVSA 2NN6I 3TS0A 5EQ0A 3I7FA 4JVZA 4DV1Q 5C4XH 1Z7TA 1XWEA 4GS3A 1NR4A 3DWAA 3K81C 4DV7Q 1BQQT 2ES2A 1EWIA 2UXBL 2R7FA 1HA6A 2K01A 1SE8A 2Z9HA 3VDYA 1WTOA 4DR4Q 3KF8B 4JK1C 1PFSA 5GROA 1R4PB 2F0OA 3T1HL 1N34Q 3L2PA 2QW7A 1EY7A 3WWVA 4A3GB 1CA6A 4RKBA 2CW0C 1FNWA 1GKHA 1S5BD 2FFKB 3A54A 4R9WA 2K33A 4DV6Q 3I4NH 2DGYA 1PRTF 2UU9L 1JR0D 2HQEA 2XN9C 3A56A 1WTQA 3S2HB 3K5MA 4LW1A 1LTID 2EY6A 2E5LL 1N33Q 5ELDA 1MBYA 2O5IC 1T5XD 4L8JA 1KHIA 1S5DD 4PV1C 4C3IG 5CC4A 1LYLA 2FJ2A 3PIPA 4G7OC 3RN5A 2PW7A 2R3ZA 2J4XA 4DAPA 2I46A 1EU3A 2JN4A 4PZ8A 1TWFH 2NTTA 2TMPA 2ENBA 3H3VH 1VQBA 2QDBA 2DY7A 1NCVA 4HAEA 5DNFA 3CCVA 4CDFC 3AB9A 2B29A 2OEOA 2NVQB 3BYYB 3OYYA 2ICEC 3OMGA 2B2UC 2R93B 1X65A 3K7AH 1C4QA 2VUMB 1NJIC 4RFBA 1HNZL 2VW9A 1M8AA 1AEXA 4R4QA 4GN3B 2Z1CA 3A7LA 3NTKA 3HOYH 5C3EB 3CCMA 1PTOC 1GUOA 5BN5A 2Q2TA 3NELA 4DR5L 1F9RA 5IWAL 2NN6H 2K4KA 3CMEA 1JOOA 1HQRD 3GV6A 1TWAH 2ZXRA 3A5UA 4XQNA 4DK1A 5JJLA 3E0EA 2CH4W 4EVOA 5C44H 3M85A 2F0MA 2K14A 4J1MA 1YVCA 5DM73 5I6WA 1Z9FA 2L4NA 5EAYA 4CDEC 3J7AV 3H09A 3OTOQ 1ZXTA 4N8X1 3E3XA 3CMAA 2A6ED 5GAHC 1PRTB 3H3VI 1IW7D 4DU9A 3CXCA 3JAMc 1F9QA 4MHEA 1LTBD 4NXMQ 4EGVA 2B2TA 1GXDC 2AQ2B 4DV0Q 2RCFA 2N3SA 1K8GA 3RZDH 2KQ3A 2PI2A 3KOJA 3A8JE 1UUPA 3PUYA 4K5WA 2EYJA 2RQXA 1CSQA 4DAVA 5LMNW 1IKMA 1IYVA 1CZGA 1QUQA 3NWSA 3PV0A 2A1AA 2L12A 2PI2E 1IBMQ 2KA7A 4PMWA 1I6VC 1V1PA 3S1NH 2Q8IB 1DGSA 4H13C 1H95A 2J7ZA 1B53A 1GJXA 2L15A 3DM3A 4K2KA 5IGGA 3G6EA 1A15A 4DV2L 3BJUA 3PO2H 1UE5A 2OTJA 1DOKA 3HGBA 5IP9H 5C4XB 2MJ8A 1YITA 4C1NK 4A3EG 5D3IB 5KYIA 5FO8B 2SEBD 2OWOA 2G9HD 4JPBW 3BZDB 3JC66 1VQ7A 2PQAB 3EIVA 1VQEA 5CBEE 1XTDA 1IZ6A 4FNFA 1QOHA 1YI2A 2K32A 1CM9A 4NMZA 4IURA 2PMZB 1KLGD 4DF7A 3TZDA 4HJ8A 3FPPA 5GQOA 5KNBA 4JCVE 3TS2A 4GKKQ 3GTPB 4ME5A 2XGTA 1I3QH 4YWLA 2K5VA 1FR3A 2RDHA 4B3MQ 5IODA 2L55A 3UDGA 3KLRA 1Y1VG 3J81j 2K6AA 1PRTD 2KBNA 3KBXA 4C3HG 3R93A 3W2DA 1PA6A 3H3VC 5LMNQ 2QA4A 2K28A 4JI1Q 3VR2A 1D8LA 4BBRH 4KN7C 3GTMH 3FKIH 4FXDA 4QF4A 5E4WC 1ILQA 1CKOA 4DV5L 1WTHA 4B3SL 3R2IA 4UP8A 4QUFA 4A3KH 1SXTA 1IXRA 2EY2A 2EYPA 4JI4Q 1NAPA 4O1NA 4JI2L 1A0IA 2WAQG 3AMUA 1LTTD 2OCEA 5BN3A 2NVQH 2XNAC
chains in the Genus database with same CATH topology
4DV6L 5IP7G 1FGUA 4BA1I 1VQPA 1UEBA 1CKNB 1UWVA 4JI5Q 2IX0A 3M4PA 3RNUA 4IJHA 5IP9G 1WI5A 1MIUA 4HIDA 4NPSA 1GD7A 2EIFA 2C35B 4XTCS 2R92H 4C2MH 3HOVG 1YEZA 1WJJA 2KHIA 5GADC 3ULPA 1A8VA 1OXVA 4A3FH 1QVGA 4DR3Q 3GTKH 5IYDH 3PIOA 4DUYQ 4LFCL 4KI0A 3ZJYC 1K3RA 2YTXA 2K75A 1HNXL 2AWNA 1VQJA 3F2BA 2JEBI 2CFMA 1EIFA 2K50A 1SMXA 4DV2Q 1YHAA 4PG3A 4IOCA 3S16H 1L1OA 3A0JA 4A3BH 1K83H 4JOIA 4NB3A 1IBKQ 1W2BA 1Y1VH 4GNXB 4A3MH 5FLXc 4DV1L 4A3GH 4J15A 2R93G 4AH6A 1HNZQ 2H5XA 3M9BA 2F3IA 4DV4L 3I2ZA 5J3BA 3PCOB 4JI6Q 2BH8A 3K7UC 3TQYA 1A63A 3HKZG 1YJ9A 1XPOA 2ZM6L 4ALPA 3CCEA 3PF4A 2EXDA 3KFUA 2AKWB 3EN2A 4JYAL 4DR7L 4IPDA 3UDFA 5GAGC 5LMUL 2K52A 2RCNA 4HJ9A 4GOPB 3PSIA 3T1YQ 2CCZA 1YZ6A 1NMFA 4NXML 4LF9Q 4H02A 3LGJA 1B7YB 2NVYH 1U0LA 1EOVA 3HFZB 1FVIA 1KIXA 2OTLA 4LUZA 4X65L 1UE7A 5ELOA 2E2HH 3OW2A 5FJ8G 1LM0A 2K5HA 4POFA 4P72A 5IYCH 4HJAA 1Y1WH 1PH8A 1NTGA 5FLMH 1HH2P 2JA7H 3ERSX 1HZCA 3AFQA 4DUZQ 2UU9Q 4Y7NH 1YIJA 1Q12A 4QGUA 3HOZG 1HZAA 4LFAL 3I4MH 2HT1A 1HJPA 1XPUA 4P74A 1X56A 4DAMA 2NVXH 1N33L 4DUZL 1VQNA 4X6AH 1NE3A 5BR8Q 1G6PA 5M3MH 3BZCA 2OQKA 2VNUD 3HKSA 5AJ3L 2JA9A 1TWGH 1HZ9A 2E8GA 3CC7A 4C3IH 3MEFA 5C3EG 1V43A 1AE3A 1MJEA 1N32L 1TWHH 2UUCL 4LF4Q 1IYJB 5C0XJ 4IJLA 1I5FA 2Z6KA 2ASBA 4L5TA 1GO3E 3BZKA 1BBUA 4IOAA 2F52A 2IX1A 3I55A 1Q8KA 4A3DH 4JI8L 1B8AA 2AHOB 1EQQA 3HKZE 1VQ6A 2VUMH 2WAQE 3BU2A 2UXDQ 1YBYA 5IWAQ 2BH2A 4B3RL 3NEMA 3D31A 2ZM6Q 3KDFA 1E7ZA 1VQAA 1EQRA 1KRTA 1HNWL 1L2FA 1HR0Q 5C3EH 4O2DA 4GN4B 3A5ZB 1OXSC 5M3MG 1N36L 1I94Q 3UE0A 1CKNA 2CWAA 1YNXA 2UUAQ 1JT8A 4JI0Q 3CD6A 2OQ0A 1PYBA 1IBKL 1S3OA 2ID0A 1Q1BA 1EIYB 2UUAL 3FKIG 3M4OH 1VS0A 1D7QA 3CCSA 4A93G 3HOXG 2HIVA 1A62A 1BBWA 3W1GA 2ZJQA 4OO1I 2IHEA 2NN6G 1SN8A 4R4TA 1CUKA 4NXNL 5M3FG 3J81i 4DUYL 2JA7G 1XJVA 5E7NA 1VQCA 1XMOQ 2HHHQ 4DK6C 3HOZH 4YCVA 3S1RH 4LFBQ 3J81c 2F4VL 4BA2I 1E3PA 2XTIA 4QL5A 3CPWA 2UXDL 2Y0SG 4BY1H 2JA5G 1M90C 1LUZA 4UY8C 2YTVA 3CCRA 1X3FA 1V1QA 1B70B 2B3GA 2HIXA 2V1CC 1KC8C 4HIOA 5IP7H 1PH1A 1Q81C 1WYDA 2D62A 4JBJA 3K0XA 1S40A 1PVOA 4HIKA 4JI3L 1N32Q 1WCMG 1N8RC 1BKBA 1Z47A 4YWMA 3A74A 5FLMG 4HJ7A 3GTPH 1AH9A 1C9OA 1UE6A 5JEAJ 1VQDA 1PH5A 3OTOL 4GOPC 4DR2Q 3RN2A 1PHJA 1VQMA 4ME3A 4A3LG 4BY7H 4DR2L 2JJQA 2WB1E 2YYZA 4X62L 3CC2A 3S1QH 4OWWB 2LXKA 1E1OA 4KHPQ 4OWTB 4JI7Q 3PGZA 4AIMA 2R92G 1ASZA 2AWOA 3ER0A 1C7YA 1J6QA 1K0RA 4BBRG 2B63G 1Q1EA 4IO9A 2JEAI 1VQGA 2KCMA 3EBEA 2NVTH 1SR3A 1VQ4A 2B63H 3H15A 3S15H 2N78A 5LMNL 5GAEC 2EQSA 2RHQB 3F2DA 1L1OB 2KCTA 2PNHA 4IPCA 1G291 4A75A 2Q2IA 3RLFA 4DR5Q 3T1HQ 1N34L 4OX9Q 3G48A 4MNOA 5IT9c 3HOYG 4BBSH 1PH2A 2HQLA 1X3GA 1RIPA 2VQEL 4A3DG 1VQHA 4YHHL 4JV5L 4A3GG 2R93H 1W3SA 3PO2G 2MNAA 3U50C 4POGA 1JB7A 4DV7L 3S17H 2LSSA 4AQYL 2IT1A 3E9HA 4DAYB 2F4VQ 2MQHA 1ASYA 2NZOA 4JI0L 3AEVA 4LFBL 3RR5A 3SGIA 2JK8A 1I50H 1XMOL 4QQBX 4A3BG 4GLXA 2GVBA 4DNIA 1E1TA 1M1KC 4AYBE 3NENA 1BVSA 2NN6I 3TS0A 2UXBQ 3I7FA 4DV1Q 4QIWE 4IPHA 5C4XH 4DV3L 4A3KG 4GS3A 3GO5A 3J7ZC 1EUJA 3K81C 4HJ5A 2Q2HA 2JA6H 1VQ8A 3F8TA 3B6YA 4DV7Q 5M5XH 3I56A 3TEHB 1EFWA 1TXYA 1EWIA 2ES2A 2R7FA 2UXBL 1R9TH 3UDXA 1SE8A 4YHHQ 3VDYA 4JV5Q 4DR4Q 3CCQA 1NMGA 4LWCA 3KF8B 4UPAA 4BXXH 4A76A 1PFSA 1IL2A 2Z0SA 4JBWA 5GROA 4BY1G 4GLAC 3FHWA 3T1HL 1N34Q 3L2PA 1N9WA 4MTNA 3WWVA 3PUWA 2A8VA 3HOUG 2Z6KC 1T9HA 1GKHA 3F1ZA 4IPGA 4GOPA 1CKMA 1SFOH 4R4CA 1VCIA 1QVCA 5ELNA 5IYDG 4DV6Q 3I4NH 4IFDJ 4LFAQ 2R7ZH 4C3JH 4JI7L 2DGYA 4OX9L 4MZ9A 3GTOH 2UU9L 1K9MC 4BY7G 5JEAG 4GNXC 3D0FA 3CQZH 4LF5L 1CSPA 3J7A5 3M7NA 4LW1A 3GTGH 4Y52H 4O0AA 4A3JG 4YCWA 2E5LL 2D0OA 5C4JH 1N33Q 1RL2A 2RF4A 1P8LA 4GNXA 1KHIA 4YCUA 4B3SQ 1LYLA 4A3LH 3PIPA 1Q7YC 3RN5A 3NBHB 3T1YL 4JI1L 3CPFA 5HGQA 1OXXK 2QEXA 1G51A 1PH6A 1HR0W 4X66Q 2VQFQ 1XNRL 1PV4A 4X65Q 4PZ8A 1TWFH 4TQUS 1XMQL 1U5KA 1JMCA 4HIMA 4JI3Q 4DR4L 1WCMH 3H3VH 3ICEA 1OXUA 1VQBA 1PH9A 4LF9L 3U4ZA 1VQIA 3HOWH 3AFPA 3CCVA 1I6HH 3AQQA 1L1OC 2B29A 4YY3Q 4P75A 4C3HH 3OYYA 3J80c 1FJGQ 2UXCL 1V9PA 4DV3Q 1IBLQ 2VUMG 3J80i 4NXNQ 1QZGA 1X65A 4DV4Q 3M4QA 3K7AH 2I0QA 4TVAB 2Q2UA 1NJIC 1HNZL 4BBSG 1VQ5A 2VW9A 1HNWQ 4R4QA 1KL9A 3ULJA 3RLNA 4GN5A 1QUQB 2VZAA 3W5OA 3E9IA 2ZJPA 4GN3B 3TREA 2ALYB 1L0WA 4AQYQ 5C0XG 3CF5A 1VQFA 3HOYH 4L5QA 1N36Q 5IYBH 4A3IH 1I94L 1OTCA 3S14H 3CCMA 3GTLH 4R4IA 5HY6A 2ZTCA 4OONA 2I5MX 1JJGA 4PZ6A 1VQ9A 2UUCQ 4GLVB 2D0PA 2MO1A 1X6OA 3PF5A 1PH7A 2Q2TA 2UUBQ 3GD7A 3NELA 4DR5L 2UUBL 4B3TL 3S2DH 1VQKA 4UP7A 4B3RQ 5IWAL 1SLJA 4EX5A 2K4KA 4DKAC 5AJ3Q 3CMEA 4JI4L 4RG1A 1TWAH 4KHZA 1IBML 3A5UA 1KRSA 3RLOA 1TWCH 4KLKA 3E0EA 5M5YH 1KAWA 5JJLA 4LF4L 5C44H 2JA5H 3M85A 2K14A 1YVCA 3KF6B 2E2JH 1KXLA 1Z9FA 2BA0A 4QY7A 1PH3A 4LF8L 4KHPL 1Q82C 1E22A 5EAYA 1XNQQ 2ATWA 1FL0A 4DR6L 5K36G 3KLWA 3OTOQ 5BR8L 1X54A 1JJ2A 3CMAA 1IBLL 5GAHC 1KQSA 4QJFA 1O7IA 3H3VI 2CQOA 2UXCQ 1P16A 3ULLA 4DV5Q 2LXJA 3CXCA 3CC4A 3JAMc 4FDBA 2IY5B 3UE1A 4GKJQ 4NXMQ 3HOVH 3DLLA 2YTYA 3G71A 5LMUQ 4DV0Q 3S24A 3JAMi 4PZ7A 2N3SA 3K8AA 1K8AC 1K8GA 3RZDH 4WJ3M 2PI2A 3HOXH 3KOJA 2I5LX 5DLQE 2HHHL 3GTQH 4LF6L 1NY4A 1YHQA 4B3ML 2R6GA 3I4MG 3PUYA 2R7DA 3W1BA 1GM5A 3H0GH 4DV0L 3CW2C 1CSQA 3U58A 4A3CH 4LF8Q 4GKJL 2VY3A 3H0GG 5LMNW 4A3FG 3RZOH 2JQOA 2DUDA 1JJCB 3G4SA 1C0AA 1QUQA 3CCUA 2A19A 3HOUH 2MO0A 2PMZE 3STBC 2VS1A 3PV0A 2AMCB 2A1AA 2PI2E 1SROA 2GVAA 2WP8J 3PUZA 5C0XI 1IBMQ 1OXTA 2BA1A 3STBD 2E5LQ 4JI6L 4PMWA 1X3EA 2YU9H 1HR0L 1MJCA 4LUOA 4LF5Q 3S1NH 3L0OA 5H1SE 4P71A 1DGSA 1PYSB 1H95A 2I5HA 1EYGA 1K73C 2KENA 5M5WH 5M3FH 1Q46A 4A3CG 2L15A 3DM3A 3G6EA 3GDEA 5IY0A 4DV2L 5IYCG 3BJUA 1Y1WG 3PO2H 4JI8Q 1QZHA 1Q86C 1UE5A 1HNXQ 2OTJA 5C4XG 1J5EQ 1X9NA 4LFCQ 4R1JA 3KJPA 5IP9H 4JBMA 4BXXG 4A3IG 3Q8DA 4LUVA 4A3EG 1YITA 1GVPA 1X55A 4B3TQ 2N49A 3KF6A 4JC0A 4L5RC 2CWPA 2NZHA 1SRUA 4JG2A 2KHJA 2OWOA 3PO3G 3AYHB 4R4OA 1J5EL 2NVQH 4OO1G 3K80C 1Y14B 1XPRA 2YV5A 3JC66 1VQ7A 4JI5L 2PQAB 3EIVA 1VQEA 2JE6I 1FJGL 4OWXB 4AYBG 5FJ8H 1XTDA 1IZ6A 1NBWA 2ZTEA 3UDIA 1YI2A 4LF7Q 3PUXA 4OXPA 3CCJA 1MKHA 3KYHC 4JI2Q 4A3MG 5JJKA 3CCLA 4JOIC 3IRBA 4DR1L 3F2CA 1S72A 4XIGS 3S1MH 4X64L 4LF6Q 1JE5A 4YWKA 4HJ8A 1YJNA 2GN5A 4IFDI 5GQOA 4JCVE 3TS2A 2Y0SE 1UE1A 4X66L 5IE8A 4YY3L 1HZBA 1XNRQ 4A3EH 2JA8H 4GKKQ 4K0KL 2QGQA 2XGTA 2FXQA 1I3QH 2MFIA 4YWLA 3CAMA 2CKZB 2K5VA 2VL6A 2JA8G 3S2HH 4DR7Q 1QVFA 4JYAQ 4GKKL 3PUVA 4APVA 2VQEQ 1PH4A 3FP9A 4B3MQ 4JBKA 1YHBA 3UDGA 1VQLA 1KD1C 2PQAA 4IFDG 1Y1VG 1XMQQ 1E24A 3J81j 1VQOA 4WJ4A 1PA6A 2IHFA 2KBNA 4P73A 2WFWA 5C44G 4UP9A 2VQFL 4DR1Q 5LMNQ 5IYBG 2QA4A 4JI1Q 1WFQA 2ZJRA 1D8LA 4BBRH 2K5NA 4A3JH 1XNQL 3FKIH 3GTMH 3HOWG 3I4NG 2E2IH 4DPGA 1WOCA 2N8NA 2RHSB 3L7ZC 3KJOA 1CKOA 2WB1G 1YJWA 4K0KQ 5JJIA 4DV5L 4EQ5A 4B3SL 4A4IA 4A93H 3TRZA 3U4VA 4UP8A 4X64Q 4A3KH 3GTJH 1IXRA 3I4OA 4RMFA 4X62Q 4JI4Q 4LNQA 3PO3H 2JA6G 4JI2L 3KDFB 2R7ZG 1A0IA 2ZTDA 4DR6Q 2WAQG 4LF7L 1AE2A 2OCEA 4DK3C 3CP0A 4DR3L 4L5SA 1LTLA 3M3YH 3MXNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 L;  5IP7 G;  1FGU A;  4BA1 I;  1VQP A;  1UEB A;  1CKN B;  1UWV A;  4JI5 Q;  2IX0 A;  3M4P A;  3RNU A;  4IJH A;  5IP9 G;  1WI5 A;  1MIU A;  4HID A;  4NPS A;  1GD7 A;  2EIF A;  2C35 B;  4XTC S;  2R92 H;  4C2M H;  3HOV G;  1YEZ A;  1WJJ A;  2KHI A;  5GAD C;  3ULP A;  1A8V A;  1OXV A;  4A3F H;  1QVG A;  4DR3 Q;  3GTK H;  5IYD H;  3PIO A;  4DUY Q;  4LFC L;  4KI0 A;  3ZJY C;  1K3R A;  2YTX A;  2K75 A;  1HNX L;  2AWN A;  1VQJ A;  3F2B A;  2JEB I;  2CFM A;  1EIF A;  2K50 A;  1SMX A;  4DV2 Q;  1YHA A;  4PG3 A;  4IOC A;  3S16 H;  1L1O A;  3A0J A;  4A3B H;  1K83 H;  4JOI A;  4NB3 A;  1IBK Q;  1W2B A;  1Y1V H;  4GNX B;  4A3M H;  5FLX c;  4DV1 L;  4A3G H;  4J15 A;  2R93 G;  4AH6 A;  1HNZ Q;  2H5X A;  3M9B A;  2F3I A;  4DV4 L;  3I2Z A;  5J3B A;  3PCO B;  4JI6 Q;  2BH8 A;  3K7U C;  3TQY A;  1A63 A;  3HKZ G;  1YJ9 A;  1XPO A;  2ZM6 L;  4ALP A;  3CCE A;  3PF4 A;  2EXD A;  3KFU A;  2AKW B;  3EN2 A;  4JYA L;  4DR7 L;  4IPD A;  3UDF A;  5GAG C;  5LMU L;  2K52 A;  2RCN A;  4HJ9 A;  4GOP B;  3PSI A;  3T1Y Q;  2CCZ A;  1YZ6 A;  1NMF A;  4NXM L;  4LF9 Q;  4H02 A;  3LGJ A;  1B7Y B;  2NVY H;  1U0L A;  1EOV A;  3HFZ B;  1FVI A;  1KIX A;  2OTL A;  4LUZ A;  4X65 L;  1UE7 A;  5ELO A;  2E2H H;  3OW2 A;  5FJ8 G;  1LM0 A;  2K5H A;  4POF A;  4P72 A;  5IYC H;  4HJA A;  1Y1W H;  1PH8 A;  1NTG A;  5FLM H;  1HH2 P;  2JA7 H;  3ERS X;  1HZC A;  3AFQ A;  4DUZ Q;  2UU9 Q;  4Y7N H;  1YIJ A;  1Q12 A;  4QGU A;  3HOZ G;  1HZA A;  4LFA L;  3I4M H;  2HT1 A;  1HJP A;  1XPU A;  4P74 A;  1X56 A;  4DAM A;  2NVX H;  1N33 L;  4DUZ L;  1VQN A;  4X6A H;  1NE3 A;  5BR8 Q;  1G6P A;  5M3M H;  3BZC A;  2OQK A;  2VNU D;  3HKS A;  5AJ3 L;  2JA9 A;  1TWG H;  1HZ9 A;  2E8G A;  3CC7 A;  4C3I H;  3MEF A;  5C3E G;  1V43 A;  1AE3 A;  1MJE A;  1N32 L;  1TWH H;  2UUC L;  4LF4 Q;  1IYJ B;  5C0X J;  4IJL A;  1I5F A;  2Z6K A;  2ASB A;  4L5T A;  1GO3 E;  3BZK A;  1BBU A;  4IOA A;  2F52 A;  2IX1 A;  3I55 A;  1Q8K A;  4A3D H;  4JI8 L;  1B8A A;  2AHO B;  1EQQ A;  3HKZ E;  1VQ6 A;  2VUM H;  2WAQ E;  3BU2 A;  2UXD Q;  1YBY A;  5IWA Q;  2BH2 A;  4B3R L;  3NEM A;  3D31 A;  2ZM6 Q;  3KDF A;  1E7Z A;  1VQA A;  1EQR A;  1KRT A;  1HNW L;  1L2F A;  1HR0 Q;  5C3E H;  4O2D A;  4GN4 B;  3A5Z B;  1OXS C;  5M3M G;  1N36 L;  1I94 Q;  3UE0 A;  1CKN A;  2CWA A;  1YNX A;  2UUA Q;  1JT8 A;  4JI0 Q;  3CD6 A;  2OQ0 A;  1PYB A;  1IBK L;  1S3O A;  2ID0 A;  1Q1B A;  1EIY B;  2UUA L;  3FKI G;  3M4O H;  1VS0 A;  1D7Q A;  3CCS A;  4A93 G;  3HOX G;  2HIV A;  1A62 A;  1BBW A;  3W1G A;  2ZJQ A;  4OO1 I;  2IHE A;  2NN6 G;  1SN8 A;  4R4T A;  1CUK A;  4NXN L;  5M3F G;  3J81 i;  4DUY L;  2JA7 G;  1XJV A;  5E7N A;  1VQC A;  1XMO Q;  2HHH Q;  4DK6 C;  3HOZ H;  4YCV A;  3S1R H;  4LFB Q;  3J81 c;  2F4V L;  4BA2 I;  1E3P A;  2XTI A;  4QL5 A;  3CPW A;  2UXD L;  2Y0S G;  4BY1 H;  2JA5 G;  1M90 C;  1LUZ A;  4UY8 C;  2YTV A;  3CCR A;  1X3F A;  1V1Q A;  1B70 B;  2B3G A;  2HIX A;  2V1C C;  1KC8 C;  4HIO A;  5IP7 H;  1PH1 A;  1Q81 C;  1WYD A;  2D62 A;  4JBJ A;  3K0X A;  1S40 A;  1PVO A;  4HIK A;  4JI3 L;  1N32 Q;  1WCM G;  1N8R C;  1BKB A;  1Z47 A;  4YWM A;  3A74 A;  5FLM G;  4HJ7 A;  3GTP H;  1AH9 A;  1C9O A;  1UE6 A;  5JEA J;  1VQD A;  1PH5 A;  3OTO L;  4GOP C;  4DR2 Q;  3RN2 A;  1PHJ A;  1VQM A;  4ME3 A;  4A3L G;  4BY7 H;  4DR2 L;  2JJQ A;  2WB1 E;  2YYZ A;  4X62 L;  3CC2 A;  3S1Q H;  4OWW B;  2LXK A;  1E1O A;  4KHP Q;  4OWT B;  4JI7 Q;  3PGZ A;  4AIM A;  2R92 G;  1ASZ A;  2AWO A;  3ER0 A;  1C7Y A;  1J6Q A;  1K0R A;  4BBR G;  2B63 G;  1Q1E A;  4IO9 A;  2JEA I;  1VQG A;  2KCM A;  3EBE A;  2NVT H;  1SR3 A;  1VQ4 A;  2B63 H;  3H15 A;  3S15 H;  2N78 A;  5LMN L;  5GAE C;  2EQS A;  2RHQ B;  3F2D A;  1L1O B;  2KCT A;  2PNH A;  4IPC A;  1G29 1;  4A75 A;  2Q2I A;  3RLF A;  4DR5 Q;  3T1H Q;  1N34 L;  4OX9 Q;  3G48 A;  4MNO A;  5IT9 c;  3HOY G;  4BBS H;  1PH2 A;  2HQL A;  1X3G A;  1RIP A;  2VQE L;  4A3D G;  1VQH A;  4YHH L;  4JV5 L;  4A3G G;  2R93 H;  1W3S A;  3PO2 G;  2MNA A;  3U50 C;  4POG A;  1JB7 A;  4DV7 L;  3S17 H;  2LSS A;  4AQY L;  2IT1 A;  3E9H A;  4DAY B;  2F4V Q;  2MQH A;  1ASY A;  2NZO A;  4JI0 L;  3AEV A;  4LFB L;  3RR5 A;  3SGI A;  2JK8 A;  1I50 H;  1XMO L;  4QQB X;  4A3B G;  4GLX A;  2GVB A;  4DNI A;  1E1T A;  1M1K C;  4AYB E;  3NEN A;  1BVS A;  2NN6 I;  3TS0 A;  2UXB Q;  3I7F A;  4DV1 Q;  4QIW E;  4IPH A;  5C4X H;  4DV3 L;  4A3K G;  4GS3 A;  3GO5 A;  3J7Z C;  1EUJ A;  3K81 C;  4HJ5 A;  2Q2H A;  2JA6 H;  1VQ8 A;  3F8T A;  3B6Y A;  4DV7 Q;  5M5X H;  3I56 A;  3TEH B;  1EFW A;  1TXY A;  1EWI A;  2ES2 A;  2R7F A;  2UXB L;  1R9T H;  3UDX A;  1SE8 A;  4YHH Q;  3VDY A;  4JV5 Q;  4DR4 Q;  3CCQ A;  1NMG A;  4LWC A;  3KF8 B;  4UPA A;  4BXX H;  4A76 A;  1PFS A;  1IL2 A;  2Z0S A;  4JBW A;  5GRO A;  4BY1 G;  4GLA C;  3FHW A;  3T1H L;  1N34 Q;  3L2P A;  1N9W A;  4MTN A;  3WWV A;  3PUW A;  2A8V A;  3HOU G;  2Z6K C;  1T9H A;  1GKH A;  3F1Z A;  4IPG A;  4GOP A;  1CKM A;  1SFO H;  4R4C A;  1VCI A;  1QVC A;  5ELN A;  5IYD G;  4DV6 Q;  3I4N H;  4IFD J;  4LFA Q;  2R7Z H;  4C3J H;  4JI7 L;  2DGY A;  4OX9 L;  4MZ9 A;  3GTO H;  2UU9 L;  1K9M C;  4BY7 G;  5JEA G;  4GNX C;  3D0F A;  3CQZ H;  4LF5 L;  1CSP A;  3J7A 5;  3M7N A;  4LW1 A;  3GTG H;  4Y52 H;  4O0A A;  4A3J G;  4YCW A;  2E5L L;  2D0O A;  5C4J H;  1N33 Q;  1RL2 A;  2RF4 A;  1P8L A;  4GNX A;  1KHI A;  4YCU A;  4B3S Q;  1LYL A;  4A3L H;  3PIP A;  1Q7Y C;  3RN5 A;  3NBH B;  3T1Y L;  4JI1 L;  3CPF A;  5HGQ A;  1OXX K;  2QEX A;  1G51 A;  1PH6 A;  1HR0 W;  4X66 Q;  2VQF Q;  1XNR L;  1PV4 A;  4X65 Q;  4PZ8 A;  1TWF H;  4TQU S;  1XMQ L;  1U5K A;  1JMC A;  4HIM A;  4JI3 Q;  4DR4 L;  1WCM H;  3H3V H;  3ICE A;  1OXU A;  1VQB A;  1PH9 A;  4LF9 L;  3U4Z A;  1VQI A;  3HOW H;  3AFP A;  3CCV A;  1I6H H;  3AQQ A;  1L1O C;  2B29 A;  4YY3 Q;  4P75 A;  4C3H H;  3OYY A;  3J80 c;  1FJG Q;  2UXC L;  1V9P A;  4DV3 Q;  1IBL Q;  2VUM G;  3J80 i;  4NXN Q;  1QZG A;  1X65 A;  4DV4 Q;  3M4Q A;  3K7A H;  2I0Q A;  4TVA B;  2Q2U A;  1NJI C;  1HNZ L;  4BBS G;  1VQ5 A;  2VW9 A;  1HNW Q;  4R4Q A;  1KL9 A;  3ULJ A;  3RLN A;  4GN5 A;  1QUQ B;  2VZA A;  3W5O A;  3E9I A;  2ZJP A;  4GN3 B;  3TRE A;  2ALY B;  1L0W A;  4AQY Q;  5C0X G;  3CF5 A;  1VQF A;  3HOY H;  4L5Q A;  1N36 Q;  5IYB H;  4A3I H;  1I94 L;  1OTC A;  3S14 H;  3CCM A;  3GTL H;  4R4I A;  5HY6 A;  2ZTC A;  4OON A;  2I5M X;  1JJG A;  4PZ6 A;  1VQ9 A;  2UUC Q;  4GLV B;  2D0P A;  2MO1 A;  1X6O A;  3PF5 A;  1PH7 A;  2Q2T A;  2UUB Q;  3GD7 A;  3NEL A;  4DR5 L;  2UUB L;  4B3T L;  3S2D H;  1VQK A;  4UP7 A;  4B3R Q;  5IWA L;  1SLJ A;  4EX5 A;  2K4K A;  4DKA C;  5AJ3 Q;  3CME A;  4JI4 L;  4RG1 A;  1TWA H;  4KHZ A;  1IBM L;  3A5U A;  1KRS A;  3RLO A;  1TWC H;  4KLK A;  3E0E A;  5M5Y H;  1KAW A;  5JJL A;  4LF4 L;  5C44 H;  2JA5 H;  3M85 A;  2K14 A;  1YVC A;  3KF6 B;  2E2J H;  1KXL A;  1Z9F A;  2BA0 A;  4QY7 A;  1PH3 A;  4LF8 L;  4KHP L;  1Q82 C;  1E22 A;  5EAY A;  1XNQ Q;  2ATW A;  1FL0 A;  4DR6 L;  5K36 G;  3KLW A;  3OTO Q;  5BR8 L;  1X54 A;  1JJ2 A;  3CMA A;  1IBL L;  5GAH C;  1KQS A;  4QJF A;  1O7I A;  3H3V I;  2CQO A;  2UXC Q;  1P16 A;  3ULL A;  4DV5 Q;  2LXJ A;  3CXC A;  3CC4 A;  3JAM c;  4FDB A;  2IY5 B;  3UE1 A;  4GKJ Q;  4NXM Q;  3HOV H;  3DLL A;  2YTY A;  3G71 A;  5LMU Q;  4DV0 Q;  3S24 A;  3JAM i;  4PZ7 A;  2N3S A;  3K8A A;  1K8A C;  1K8G A;  3RZD H;  4WJ3 M;  2PI2 A;  3HOX H;  3KOJ A;  2I5L X;  5DLQ E;  2HHH L;  3GTQ H;  4LF6 L;  1NY4 A;  1YHQ A;  4B3M L;  2R6G A;  3I4M G;  3PUY A;  2R7D A;  3W1B A;  1GM5 A;  3H0G H;  4DV0 L;  3CW2 C;  1CSQ A;  3U58 A;  4A3C H;  4LF8 Q;  4GKJ L;  2VY3 A;  3H0G G;  5LMN W;  4A3F G;  3RZO H;  2JQO A;  2DUD A;  1JJC B;  3G4S A;  1C0A A;  1QUQ A;  3CCU A;  2A19 A;  3HOU H;  2MO0 A;  2PMZ E;  3STB C;  2VS1 A;  3PV0 A;  2AMC B;  2A1A A;  2PI2 E;  1SRO A;  2GVA A;  2WP8 J;  3PUZ A;  5C0X I;  1IBM Q;  1OXT A;  2BA1 A;  3STB D;  2E5L Q;  4JI6 L;  4PMW A;  1X3E A;  2YU9 H;  1HR0 L;  1MJC A;  4LUO A;  4LF5 Q;  3S1N H;  3L0O A;  5H1S E;  4P71 A;  1DGS A;  1PYS B;  1H95 A;  2I5H A;  1EYG A;  1K73 C;  2KEN A;  5M5W H;  5M3F H;  1Q46 A;  4A3C G;  2L15 A;  3DM3 A;  3G6E A;  3GDE A;  5IY0 A;  4DV2 L;  5IYC G;  3BJU A;  1Y1W G;  3PO2 H;  4JI8 Q;  1QZH A;  1Q86 C;  1UE5 A;  1HNX Q;  2OTJ A;  5C4X G;  1J5E Q;  1X9N A;  4LFC Q;  4R1J A;  3KJP A;  5IP9 H;  4JBM A;  4BXX G;  4A3I G;  3Q8D A;  4LUV A;  4A3E G;  1YIT A;  1GVP A;  1X55 A;  4B3T Q;  2N49 A;  3KF6 A;  4JC0 A;  4L5R C;  2CWP A;  2NZH A;  1SRU A;  4JG2 A;  2KHJ A;  2OWO A;  3PO3 G;  3AYH B;  4R4O A;  1J5E L;  2NVQ H;  4OO1 G;  3K80 C;  1Y14 B;  1XPR A;  2YV5 A;  3JC6 6;  1VQ7 A;  4JI5 L;  2PQA B;  3EIV A;  1VQE A;  2JE6 I;  1FJG L;  4OWX B;  4AYB G;  5FJ8 H;  1XTD A;  1IZ6 A;  1NBW A;  2ZTE A;  3UDI A;  1YI2 A;  4LF7 Q;  3PUX A;  4OXP A;  3CCJ A;  1MKH A;  3KYH C;  4JI2 Q;  4A3M G;  5JJK A;  3CCL A;  4JOI C;  3IRB A;  4DR1 L;  3F2C A;  1S72 A;  4XIG S;  3S1M H;  4X64 L;  4LF6 Q;  1JE5 A;  4YWK A;  4HJ8 A;  1YJN A;  2GN5 A;  4IFD I;  5GQO A;  4JCV E;  3TS2 A;  2Y0S E;  1UE1 A;  4X66 L;  5IE8 A;  4YY3 L;  1HZB A;  1XNR Q;  4A3E H;  2JA8 H;  4GKK Q;  4K0K L;  2QGQ A;  2XGT A;  2FXQ A;  1I3Q H;  2MFI A;  4YWL A;  3CAM A;  2CKZ B;  2K5V A;  2VL6 A;  2JA8 G;  3S2H H;  4DR7 Q;  1QVF A;  4JYA Q;  4GKK L;  3PUV A;  4APV A;  2VQE Q;  1PH4 A;  3FP9 A;  4B3M Q;  4JBK A;  1YHB A;  3UDG A;  1VQL A;  1KD1 C;  2PQA A;  4IFD G;  1Y1V G;  1XMQ Q;  1E24 A;  3J81 j;  1VQO A;  4WJ4 A;  1PA6 A;  2IHF A;  2KBN A;  4P73 A;  2WFW A;  5C44 G;  4UP9 A;  2VQF L;  4DR1 Q;  5LMN Q;  5IYB G;  2QA4 A;  4JI1 Q;  1WFQ A;  2ZJR A;  1D8L A;  4BBR H;  2K5N A;  4A3J H;  1XNQ L;  3FKI H;  3GTM H;  3HOW G;  3I4N G;  2E2I H;  4DPG A;  1WOC A;  2N8N A;  2RHS B;  3L7Z C;  3KJO A;  1CKO A;  2WB1 G;  1YJW A;  4K0K Q;  5JJI A;  4DV5 L;  4EQ5 A;  4B3S L;  4A4I A;  4A93 H;  3TRZ A;  3U4V A;  4UP8 A;  4X64 Q;  4A3K H;  3GTJ H;  1IXR A;  3I4O A;  4RMF A;  4X62 Q;  4JI4 Q;  4LNQ A;  3PO3 H;  2JA6 G;  4JI2 L;  3KDF B;  2R7Z G;  1A0I A;  2ZTD A;  4DR6 Q;  2WAQ G;  4LF7 L;  1AE2 A;  2OCE A;  4DK3 C;  3CP0 A;  4DR3 L;  4L5S A;  1LTL A;  3M3Y H;  3MXN B; 
#chains in the Genus database with same CATH topology
 1FGU A;  5IP9 G;  1WI5 A;  5JAV A;  2YU9 B;  5NUC A;  1PTO H;  3ITP A;  4R8N A;  1GUW A;  4C2M H;  4M1U B;  1F2Z A;  1WJJ A;  3ULP A;  1OXV A;  3M4O B;  3E6Z X;  3DMU A;  2HD3 A;  2A6H D;  1A6X A;  2D9U A;  2YTX A;  3OHX C;  1IW7 C;  5KYL A;  3Q23 A;  4PG3 A;  1ICF B;  4IOC A;  1BCP F;  1EFI D;  1F2L A;  2IPK D;  2NZ1 D;  3SHL A;  1RCV D;  3MFY A;  5JEA H;  1K8M A;  1HNZ Q;  3PCO B;  4JI6 Q;  1DYQ A;  1A63 A;  1HRJ A;  1YJ9 A;  3CCE A;  4C3J B;  2EXD A;  3EN2 A;  4F88 A;  4JYA L;  2F0N A;  3QO2 A;  3URY A;  3UDF A;  5LMU L;  3AEV A;  2K52 A;  1STN A;  4GOP B;  5C4H A;  3BDL A;  1SJE D;  1YZ6 A;  4WFN 3;  4H02 A;  3LGJ A;  1ZYR C;  4OO1 H;  1EOV A;  1FVI A;  2E2H H;  3MFG A;  3LX0 A;  3MZ5 A;  4P72 A;  4POF A;  4HJA A;  1PH8 A;  1NTG A;  5FLM H;  3FEW X;  4UHV A;  4K8J A;  1HZC A;  4EQO A;  3NQI A;  1Q12 A;  1HZA A;  4LFA L;  2HT1 A;  4P74 A;  1SJH D;  2WV6 D;  1X56 A;  2F0I A;  5EJW A;  5KND A;  4ZKB B;  5M3M H;  1G6P A;  2OQK A;  4ILW A;  2VNU D;  1HZ9 A;  3EVQ A;  4C3I H;  1EYC A;  4LF4 Q;  1B9N A;  1CT1 D;  2F0Q A;  1PXU A;  2KEC A;  1GO3 E;  3BZK A;  1BBU A;  2XSC A;  2IX1 A;  3I55 A;  4WOR A;  3L3O C;  4A3D H;  4IUN A;  2V4D A;  1ENC A;  3C1E A;  2EXZ A;  2BH2 A;  3MHB A;  4B3R L;  2ZXO A;  4A3I B;  1HR0 Q;  3QIA A;  1B1Z A;  2BOS A;  1JT8 A;  3CD6 A;  1PYB A;  1E0B A;  3FKI G;  1VS0 A;  5CV7 A;  2HIV A;  1A62 A;  3VYT A;  5C3W A;  3W1G A;  1EY0 A;  2ZJQ A;  2IHE A;  1S5F D;  4RH6 A;  4DUY L;  5J1Z A;  1XJV A;  1H9J A;  5E7N A;  4YCV A;  3S1R H;  2JA5 B;  4LFB Q;  3J81 c;  2JP1 A;  4QL5 A;  3CPW A;  5ELB A;  1SYD A;  4BY1 H;  3IL8 A;  2F3V A;  5COY A;  1EIG A;  1HUM A;  2EYH A;  1SYG A;  2B3G A;  1V1Q A;  1KC8 C;  1Q81 C;  1Q3L A;  3EJI A;  4HIK A;  1N32 Q;  2F0U A;  5FLM G;  1F9P A;  3CU7 A;  4HJ7 A;  3GTP H;  1C9O A;  4A3E B;  1U4M A;  3OTO L;  4NW2 A;  3RN2 A;  1DJR D;  1TY0 A;  4BY7 H;  1BXT A;  2JJQ A;  2WB1 E;  4X3K A;  3CC2 A;  5FOB B;  2LS0 1;  1J6Q A;  3E0J A;  2B63 G;  4Q0F A;  2F0D A;  1HXY D;  2KCM A;  1DD2 A;  5E1F A;  2BE5 C;  3S15 H;  4BBR B;  4Y7N B;  2Z4I A;  3F2D A;  3T1H Q;  1N34 L;  4OX9 Q;  3I4M B;  3VYR A;  1GUG A;  2VQE L;  4A3D G;  2B8G A;  2NVX B;  2A6E C;  2F03 A;  2K03 A;  3K7A B;  2MNA A;  2LFN A;  1JB7 A;  5L37 A;  4DV7 L;  3S17 H;  2F4V Q;  2MQH A;  1ASY A;  2NZO A;  3SGI A;  2JK8 A;  4QQB X;  2E75 C;  4A3B G;  4PMB A;  1YNJ C;  2GVB A;  4QMG A;  2PPB C;  1EIH A;  4IPH A;  2R92 B;  4DV3 L;  4C2M B;  1D5X C;  3GO5 A;  2JA6 H;  3GTK B;  3KLS X;  1EFW A;  3FPU B;  1TXY A;  3M7G A;  3UDX A;  1QNU A;  4YHH Q;  3DXJ C;  4BXX H;  5M5Y B;  1IL2 A;  1DOL A;  3A8K E;  4BY1 G;  5EPK A;  1LTG D;  1CQF A;  3PUW A;  2A8V A;  3ERQ A;  3BDC A;  1CA5 A;  4IPG A;  4H7B A;  4CJ2 C;  3VR3 A;  4B9W A;  4ABN A;  2NUC A;  4IFD J;  1A3U A;  1PRT C;  3GTO H;  4C3J H;  4OX9 L;  2BDO A;  3FVQ A;  4CGY B;  3ND8 A;  4BY7 G;  4JW0 A;  5JEA G;  3CQZ H;  2EPB A;  3DM1 A;  2SDF A;  4N8F A;  4O0A A;  4A3J G;  2D0O A;  5C4J H;  1JWU D;  3H94 A;  3R2T A;  3NBH B;  2G9D A;  3K57 A;  2QEX A;  4TSS A;  4X66 Q;  1XNR L;  1HTP A;  4TQU S;  5T1I A;  3VR4 A;  1VDZ A;  4JI3 Q;  1HCZ A;  1KDA A;  1AW7 A;  2B63 B;  3HOW H;  1I4G A;  1NSN S;  3AFP A;  1I6H H;  1L1O C;  1BBX C;  4P75 A;  4C3H H;  1Y8P B;  1D2B A;  2XRS D;  4HSP A;  1FJG Q;  4RKL A;  1TWH B;  1V9P A;  4CKE A;  2F0E A;  2VUM G;  1QZG A;  3M4Q A;  4TVA B;  2Q2U A;  1D5M C;  4QCL A;  2AQ3 B;  1QUQ B;  3W5O A;  2ZJP A;  2ALY B;  1FD7 D;  1L0W A;  4AQY Q;  5C0X G;  4FXK C;  1SNM A;  1VQF A;  2VXW A;  5JPN C;  3HKZ B;  3FMC A;  3NBI A;  4R4I A;  2ZTC A;  4RHS A;  2Z4H A;  2I5M X;  1JJG A;  4ODG A;  4PZ6 A;  3AU7 A;  1CZW A;  3SDZ A;  4IUP A;  1X6O A;  1PH7 A;  4A3B B;  3GD7 A;  3NK9 A;  1I4H A;  4EX5 A;  4FYD A;  5M5X B;  4X3S A;  3SXH A;  5AJ3 Q;  1PLF A;  2A6H C;  4KHZ A;  1IBM L;  1KRS A;  3PMF A;  1CK1 A;  1KAW A;  3D4R A;  3S1R B;  2JA5 H;  1FNV A;  2E2J H;  4QY7 A;  2BA0 A;  1PH3 A;  4KHP L;  1Q82 C;  1E22 A;  2K05 A;  5D65 A;  2ATW A;  3KLW A;  1WTW A;  1ET6 A;  2KED A;  1IBL L;  4QJF A;  1O7I A;  1SYC A;  1WVL A;  4U67 3;  1P16 A;  4OEM B;  4DV5 Q;  2LXJ A;  4XYO A;  3CC4 A;  3I4L A;  4FDB A;  3UE1 A;  4DNT B;  4GKJ Q;  3HOV H;  2YTY A;  3G71 A;  5LMU Q;  3JAM i;  4PZ7 A;  2F0H A;  4RGM A;  2I5L X;  1B2T A;  1YHQ A;  5IGC A;  2R6G A;  3I4M G;  3W1B A;  3H0G H;  1TII D;  1TWG B;  2B8F A;  3T51 B;  3QOL A;  4GKJ L;  1EYD A;  4G7H C;  3RZO H;  4EQN A;  2JQO A;  4I7Z C;  2H4O A;  2A19 A;  3STB C;  2VS1 A;  2AMC B;  2B2V C;  5KGU A;  2GVA A;  2WP8 J;  5C0X I;  3STB D;  2E5L Q;  2K5W A;  3CKI B;  1X3E A;  2YU9 H;  1HR0 L;  3S17 B;  4LF5 Q;  3IKJ A;  5JVH 3;  1PYS B;  5FO9 B;  2I5H A;  1EYG A;  2KEN A;  5M5W H;  5M3F H;  4RCO A;  3K5O A;  5IYC G;  4BWG B;  3OPO A;  1PFM A;  2K5Q A;  5LHY 1;  1Q86 C;  3EFX D;  1HNX Q;  5C4X G;  1J5E Q;  1ENA A;  4R1J A;  1PDQ A;  2JSO A;  2L5T A;  3Q8D A;  5EKK A;  4A3I G;  1GVP A;  1X55 A;  3SK5 A;  2N49 A;  4JC0 A;  4L5R C;  2CWP A;  1MHW C;  1SRU A;  4JG2 A;  2WIN B;  4LMQ D;  2B2Y A;  3DHQ A;  3K80 C;  1GOZ A;  1D1I A;  3K59 A;  1FJG L;  4UAI A;  3S2D B;  1NBW A;  2ZTE A;  3UDI A;  4LJZ C;  3OSO A;  4OXP A;  4JI2 Q;  1PYW D;  2K04 A;  1CQV A;  3F2C A;  1S72 A;  4XIG S;  4GZY C;  1KNE A;  5FKA C;  2EYM A;  4J6H A;  4KV6 A;  2GN5 A;  2OT2 A;  4IFD I;  1I4Q A;  3DWP A;  2JA8 H;  2OF1 A;  3CQZ B;  2FXQ A;  2NBF A;  1G2T A;  3CAM A;  5C6A A;  3S2H H;  2EY5 A;  4DR7 Q;  2F0V A;  1QVF A;  1PH4 A;  3LWE A;  4JBK A;  1WTR A;  1YHB A;  4DXF A;  1VQL A;  4DAY A;  2PQA A;  1ZYR D;  5JOB A;  3OIQ A;  2IHF A;  5C44 G;  2WFW A;  4ULL A;  2ZJR A;  1XNQ L;  2K5N A;  4A3J H;  4XXE A;  3F2U A;  1KAA A;  2NWG A;  2Z8L A;  2WB1 G;  3HOX B;  5KNC A;  1QIL A;  4EQ5 A;  1STB A;  1GHK A;  4ZKC B;  4I7A A;  3GTJ H;  2O4X A;  1Z6H A;  3PO3 H;  4LNQ A;  4A3D B;  3MC0 B;  2F0W A;  3NUC A;  3KDF B;  2R7Z G;  2ZTD A;  4RGT A;  4DK3 C;  3CP0 A;  3M7N A;  1SE3 A;  3M3Y H;  4DV6 L;  4BA1 I;  4OGQ C;  1VQP A;  1UWV A;  1CKN B;  4DFA A;  1CHQ D;  1MIU A;  4HID A;  1GD7 A;  2L0C A;  2C35 B;  4V0B A;  1C48 A;  3HOV G;  3Q24 A;  1SNC A;  1EZ6 A;  1V1P B;  2RDG A;  4RGN A;  3PIO A;  2ZT9 C;  1QE6 A;  1K3R A;  5CYU A;  1YNJ D;  1VQJ A;  3F2B A;  3J81 E;  1LAC A;  1EIF A;  1X3Q A;  2OXP A;  1JOR A;  1L1O A;  4A3B H;  3WOE A;  2HCC A;  1W2B A;  4GNX B;  5G3L D;  2R93 G;  3KF8 A;  1MD2 D;  2H5X A;  2FIN B;  1F2Y A;  2F3I A;  3MXP A;  1TWA B;  2BH8 A;  1RTN A;  3TQY A;  3RMH A;  3PF4 A;  1KDB A;  2KHS A;  1DXM A;  1U4P A;  2C9O A;  1BR9 A;  3TZU A;  2BDN A;  2EJF C;  2WKD A;  4DR7 L;  1D5Z C;  5GAG C;  2CCZ A;  2WKC A;  2X6G A;  3GTG B;  1SDF A;  4NKL A;  3GV3 A;  3TME A;  1JB3 A;  1UE7 A;  5AFW A;  1O7Z A;  3OW2 A;  5IT9 E;  5HGT A;  5IYC H;  2IW3 A;  3V2T A;  5IT9 L;  1HH2 P;  2VB3 X;  4IFD H;  4DUZ Q;  4KHV A;  3RZD B;  4Y7N H;  4PNY A;  2MP1 A;  4IUQ A;  1HJP A;  1Q8I A;  4BBS B;  1DCZ A;  2NVX H;  4IQZ A;  1WCM B;  1D1K A;  1VQN A;  1NE3 A;  4RGO S;  1R4Q B;  2M00 A;  2NYZ D;  1SNO A;  5I4D A;  1IYJ B;  4IJL A;  1I5F A;  3T13 A;  2ASB A;  2F52 A;  1B8A A;  2AHO B;  2J0T D;  1O80 A;  3SK6 A;  1JWM D;  3LNN A;  2WAQ E;  1WD1 A;  5IWA Q;  2F0F A;  1AZQ A;  3KBG A;  3KDF A;  1E7Z A;  1VQA A;  1L2F A;  1C8C A;  3PO2 B;  1ICW A;  3GTL B;  1F77 A;  3Q22 A;  1STY A;  1HFN A;  5LL6 X;  1RJT A;  3CRL C;  4G4K A;  3UE0 A;  2FHT A;  1HFG A;  5EKL A;  2OQ0 A;  1S3O A;  2ID0 A;  2PW5 A;  1EIY B;  2Q8R E;  4A93 G;  4B9X A;  4K8I A;  3K58 A;  4K6D A;  1SN8 A;  2JA7 G;  1CUK A;  4NXN L;  3TP5 A;  1VQC A;  2C5C A;  1XMO Q;  2HHH Q;  3HOZ H;  1BF4 A;  3GTO B;  2XTI A;  2F0T A;  2RKS A;  1TS5 A;  1ZKO A;  3CCR A;  1AN8 A;  1EU4 A;  3K0X A;  4JI3 L;  1WCM G;  2EOT A;  1Z47 A;  4YWM A;  1AH9 A;  2A69 D;  1PH5 A;  4DR2 Q;  4ZK9 B;  4ME3 A;  4DR2 L;  2YYZ A;  4X62 L;  4OWW B;  1E1O A;  4H0L C;  1C7Y A;  1HA5 A;  1K0R A;  1G8Z D;  4BBR G;  1WTX A;  2JEA I;  3EBE A;  1K8O A;  1DON A;  1SR3 A;  3H15 A;  5FK9 C;  5LMN L;  5GAE C;  1STG A;  4F7X A;  1L1O B;  2KCT A;  4P2C B;  1G29 1;  4PQX A;  1UEA B;  2A68 D;  5IT9 c;  3D4W A;  3MA2 B;  2HQL A;  1IHZ A;  4JV5 L;  3GTJ B;  2R93 H;  2RA4 A;  3U50 C;  4RA8 A;  2LSS A;  4N9P A;  3E9H A;  1XTC D;  1ILP A;  5HUR A;  4JI0 L;  4LFB L;  4KJN A;  1XMO L;  2MUY A;  1PZJ D;  4GLX A;  5ELF A;  1E1T A;  3HG9 A;  4AYB E;  3KLS A;  2UXB Q;  3SE0 A;  1G91 A;  2XWB B;  1BCP C;  5F2D A;  3G7L A;  4CKB A;  1EUJ A;  4HJ5 A;  3F8T A;  3B6Y A;  2X69 A;  3I56 A;  3TEH B;  1DZ1 A;  1XX8 A;  4DNR B;  2FMM A;  1X32 A;  2L11 A;  3DEP A;  1NMG A;  4LWC A;  4UPA A;  2QKI C;  2Z0S A;  5C44 B;  3FHW A;  1LV9 A;  3D6W A;  1N9W A;  1Y69 U;  4MTN A;  2KVM A;  2L1B A;  4CJ0 B;  1LT4 D;  4YIJ A;  3DUZ A;  3HOU G;  3F1Z A;  1L0X B;  2X6L A;  4GOP A;  1CKM A;  2HCI A;  1VCI A;  2RSN A;  3NE5 B;  5IYD G;  3MVV A;  4JI7 L;  2IL8 A;  4MZ9 A;  4FXG C;  1K9M C;  3HRZ C;  3D6C A;  5CV9 A;  1LTR D;  4FF2 A;  3T16 A;  3NWT A;  2RF4 A;  1P8L A;  1GUN A;  1G6Z A;  4B3S Q;  3DWQ A;  2AUK A;  3UI2 A;  4A3L H;  3VA5 A;  1LT6 D;  1Q7Y C;  3T1Y L;  1A3T A;  4ZUI A;  3SEB A;  5HGQ A;  1OXX K;  1PH6 A;  1HR0 W;  1LTS D;  3RZO B;  1PV4 A;  1XMQ L;  5LL6 S;  1I4R A;  1PH9 A;  3U4Z A;  1LAB A;  3PIO 3;  4F8M A;  2B2U A;  1TU2 B;  3AQQ A;  1H9M A;  5I6Y A;  4HCE A;  1PFN A;  3J80 c;  2WAQ B;  2UXC L;  1EY6 A;  5I9P A;  1QB5 D;  4IZ8 A;  4NXN Q;  5TSS A;  1U4L A;  1VQ5 A;  1HNW Q;  1KL9 A;  3MXN A;  5A35 A;  3RLN A;  4GN5 A;  2VZA A;  3E9I A;  3C46 A;  2EY1 A;  2F0J A;  2PZW A;  1UAP A;  3CF5 A;  4L5Q A;  1N36 Q;  5IOC A;  2F3W A;  5IYB H;  4A3I H;  3S14 H;  2RDF A;  1VQ9 A;  1II3 A;  3S16 B;  4GLV B;  2UUB Q;  4B3T L;  4FP5 D;  3S2D H;  2UUB L;  3E5S A;  2EDG A;  4UP7 A;  3NP8 A;  4DKA C;  4JI4 L;  4RG1 A;  1FYC A;  1R9T B;  4XQQ A;  1TWC H;  5JPM C;  1EQT A;  1B44 D;  2ZXP A;  1SE4 A;  1KXL A;  2JA8 B;  4LF8 L;  4BY1 B;  3ONA B;  5KEE A;  1XXG A;  1XNQ Q;  1KLU D;  5BR8 L;  1W6J A;  1X54 A;  1JJ2 A;  1SFO B;  2P5Z X;  2LY7 A;  2KCN A;  2E2D C;  3GTM B;  1K8A C;  4WJ3 M;  1B50 A;  1QG7 A;  3HOX H;  3GTQ H;  2HHH L;  4LF6 L;  1NY4 A;  3A55 A;  4B3M L;  1SBB B;  1HHV A;  5EPJ A;  3PO3 B;  4DV0 L;  3CW2 C;  3U58 A;  4A3C H;  2AQ1 B;  2PNR C;  2VY3 A;  4A3F G;  1NR2 A;  1JJC B;  3G4S A;  1C0A A;  3HOU H;  3CCU A;  2MO0 A;  2PMZ E;  1SRO A;  3PUZ A;  4XDX A;  1OXT A;  2F0L A;  4JI6 L;  1MSG A;  5FO7 B;  3J7Y W;  2MPM A;  1MJC A;  4LUO A;  3L0O A;  4HMJ A;  2XVS A;  1ML0 D;  4P71 A;  2DJF C;  3K5N A;  5I2X A;  1Q46 A;  3MTS A;  1SAP A;  5IY0 A;  4JI8 Q;  3FDT A;  1S4Z A;  3KJP A;  4HED A;  1EL0 A;  4BXX G;  3J7A 5;  3X3N A;  4B3T Q;  3I91 A;  3KF6 A;  3BVZ A;  4IN3 A;  3HOY B;  2KHJ A;  4MIU A;  3AYH B;  4NDX A;  1Y14 B;  2YV5 A;  4XQJ A;  3CHB D;  3RUZ A;  4A93 B;  4OWX B;  5FJ8 H;  4K5V A;  1IL8 A;  4C3J G;  1VMC A;  4EQP A;  2PZU A;  3PUX A;  3CCJ A;  3KYH C;  1TY2 A;  1YNN C;  4TRD A;  5JJK A;  3BG3 A;  3CCL A;  3S1M H;  2B2T C;  3VR5 A;  4LF6 Q;  4N9T A;  4LAA A;  5JVG 3;  1O7L A;  1UE1 A;  4X66 L;  1XNR Q;  1HZB A;  3I3C A;  2QGQ A;  2MFI A;  5C5M A;  1ESF A;  2DNC A;  3S1Q B;  1ESR A;  1QWY A;  4JYA Q;  5C4J B;  4GKK L;  3NTI A;  4MTK A;  2MGS A;  4KK7 A;  2A68 C;  1MSH A;  1SYE A;  3D8G A;  3FP9 A;  3R8B A;  2VQE Q;  5FLX E;  5M9O A;  1KD1 C;  2DY8 A;  4XT3 B;  4IFD G;  1E24 A;  4CBV A;  1D6E C;  4HSV A;  4WJ4 A;  4P73 A;  2VQF L;  3TP7 A;  3P7J A;  4UP9 A;  4DR1 Q;  5IYB G;  1WFQ A;  4HTH A;  3HOW G;  3I4N G;  5IIF A;  3C2P A;  3C1F A;  4K0K Q;  5CGK A;  3SVM A;  5JJI A;  3TSS A;  1A3V A;  3MEH A;  4A4I A;  1JC7 A;  2IWH A;  4X64 Q;  3I4O A;  4RMF A;  3KUP A;  2JA6 G;  2A69 C;  1I6H B;  4LF7 L;  4DR3 L;  1CI3 M;  2QIL A;  1LTL A;  2VB2 X;  4HR7 B;  1EOT A;  1I50 B;  4C1N I;  4ID6 A;  1HQM C;  3D3R A;  1JOK A;  3I73 A;  1PTO D;  1J8I A;  1BDO A;  3S1N B;  1WD0 A;  4XTC S;  1SYB A;  5GAD C;  1QVG A;  1A8V A;  1RF2 D;  4DR3 Q;  4RCN A;  3X3M A;  4LFC L;  1B3Q A;  1HNX L;  2AWN A;  2CFM A;  3N52 A;  1PZK D;  2M9V A;  5DEH A;  1YHA A;  1G2S A;  4K14 A;  3S16 H;  3A0J A;  1IBK Q;  4NB3 A;  4FF1 A;  4QUC A;  2F0P A;  1Y1V H;  5E3F A;  3I90 A;  2A5H A;  3WDN A;  4J15 A;  5FLX c;  5A2Q L;  4DV1 L;  3M9B A;  3I2Z A;  5J3B A;  4C56 C;  4ZUJ A;  1L0Y B;  3HKZ G;  4H44 C;  2ZM6 L;  3MXG A;  2EYF A;  3KFU A;  2AKW B;  3HEJ A;  4IPD A;  1J9O A;  4HJ9 A;  4BY7 B;  1NMF A;  2E74 C;  4LF9 Q;  1M4V A;  4QB4 A;  2NVY H;  3L9A X;  1U0L A;  1EWH A;  2HDM A;  2OTL A;  3VYS A;  3H6M A;  5ELO A;  2EZV A;  3ERS X;  1RD9 D;  2UU9 Q;  1H9S B;  4QGU A;  1TWF B;  3I4M H;  1OO9 B;  1U9R A;  2F0K A;  1GUT A;  1N33 L;  4X6A H;  1W6K A;  5BR8 Q;  1SSO A;  3HKS A;  5AJ3 L;  1TWG H;  2E8G A;  3FKI B;  5K5P A;  3CC7 A;  2E2I B;  5C3E G;  3QJY A;  1AE3 A;  2UUC L;  1X3P A;  2Z6K A;  5IGE A;  1JCK B;  4L5T A;  4IOA A;  1VQ6 A;  1EQQ A;  3HKZ E;  2SNS A;  3BU2 A;  2UXD Q;  1YBY A;  3QB3 A;  3NEM A;  3FRP B;  2ZM6 Q;  1HNW L;  2JA6 B;  1KRT A;  1SYF A;  3ZYY X;  1Y8O B;  4O2D A;  1H9S A;  4GN4 B;  1TS2 A;  3A5Z B;  5D3D A;  2B2W A;  1PTO B;  5C5L A;  1N36 L;  1CKN A;  2CWA A;  1YNX A;  4A3F B;  1IBK L;  1E2Z A;  3VYU A;  3M4O H;  1BOS A;  4KY5 A;  1D7Q A;  4U68 A;  1AFP A;  5T1G A;  3CRK C;  1BBW A;  2FMC A;  4WJW A;  2CHB D;  4OO1 I;  2NN6 G;  1K3B C;  5ELE A;  3T53 B;  1K83 B;  2F4V L;  4BA2 I;  1E3P A;  2EYO A;  4A3M B;  3ND9 A;  1HPC A;  1M90 C;  4UY8 C;  2EYL A;  2YTV A;  1PH1 A;  3G6J B;  3OW7 A;  1WYD A;  2D62 A;  2DN8 A;  1PVO A;  2B2V A;  5CV6 A;  4QIW B;  2PQE A;  1N8R C;  1QNK A;  2ICI A;  3A74 A;  1UE6 A;  1LT3 D;  1VQD A;  5JEA J;  4DA2 A;  1PHJ A;  3IAY A;  2WII B;  1SE2 A;  4A3L G;  1EWC A;  3S1Q H;  1LO5 D;  4OWT B;  1O78 A;  1TR5 A;  4AIM A;  3ER0 A;  3H91 A;  3P20 A;  4CDD C;  1CFM A;  1Q1E A;  4IO9 A;  1VQG A;  1Y1W B;  1VQ4 A;  2B63 H;  2JA7 B;  3VA7 A;  2N78 A;  2EQS A;  2B39 A;  4CHT B;  2RHQ B;  2PNH A;  4IPC A;  3RLF A;  3HOY G;  2H1E A;  4MNO A;  3EA6 A;  4FF4 A;  2RVL A;  1S5E D;  1MGS A;  4KKS A;  3OMC A;  5M3M B;  3IFD A;  4POG A;  2Z6B A;  2MHV A;  3OIP A;  4DAY B;  1GUS A;  3N6R A;  4ZRZ A;  2O5J C;  2B2W C;  1RDP D;  1I50 H;  2NB0 A;  3TN2 A;  1S5C D;  1JE4 A;  1NNX A;  1M1K C;  1EYA A;  3NEN A;  1B4O A;  4QIW E;  4KN4 C;  4A3K G;  3J7Z C;  1V8Q A;  5CV4 A;  2Q2H A;  3LWU A;  1VQ8 A;  2R61 A;  1A2T A;  3ERO A;  5M5X H;  1YNN D;  1HTL D;  3O13 A;  1R9T H;  4JV5 Q;  2A74 C;  3CCQ A;  1TWC B;  4A76 A;  4XT1 B;  5CV5 A;  2DJG C;  4JBW A;  5EGT A;  1JIC A;  4GLA C;  1Y1V B;  4FO2 A;  4KMU C;  3TP8 A;  2GA4 B;  2Z6K C;  1T9H A;  4OIJ A;  1SFO H;  4Q5V A;  4R4C A;  1QVC A;  2M2L A;  3SR1 A;  5ELN A;  2XIW A;  4LFA Q;  2R7Z H;  4OIK A;  3W3A A;  4ZCK A;  3T56 B;  2I07 B;  4GNX C;  3D0F A;  4LF5 L;  1CSP A;  1I3Q B;  1PTO F;  5DM6 3;  3GTG H;  4Y52 H;  1TVX A;  4KY7 A;  4YCW A;  1RL2 A;  2Y0S B;  1FNU A;  2F0S A;  3BYT B;  4GNX A;  1CTM A;  4YCU A;  3GQB A;  2BE5 D;  4Z9C B;  5BN4 A;  4IUU A;  3H0G B;  3I70 A;  1MI2 A;  4K6L A;  1RKN A;  4JI1 L;  4KKU A;  3CPF A;  3SK4 A;  2KUM A;  1G51 A;  3A8I E;  3QR8 A;  2XWJ B;  2VQF Q;  2AUJ D;  2L9H A;  4X65 Q;  1U5K A;  1JMC A;  1E2V A;  4HIM A;  2Q8T A;  4DR4 L;  1WCM H;  3ICE A;  1OXU A;  4LF9 L;  1VQI A;  3S15 B;  3PIP 3;  3K0Y A;  1PFB A;  1TS4 A;  4YY3 Q;  3R3O A;  3OOC A;  2E76 C;  3SK8 A;  4V19 0;  4DV3 Q;  1IBL Q;  4IUT A;  3J80 i;  5C4Z A;  4DV4 Q;  2I0Q A;  1B9M A;  4BBS G;  3NXW A;  3ULJ A;  3Q0A A;  1RHP A;  1NUC A;  1H9R A;  3QG1 A;  3V96 A;  3TRE A;  1I94 L;  1OTC A;  3GTL H;  5HY6 A;  1TQO A;  1Y8N B;  4OON A;  2PCF B;  2UUC Q;  1SNQ A;  2D0P A;  2MO1 A;  3PF5 A;  4A93 H;  3KK7 A;  4B3R Q;  1I4P A;  3DEO A;  1VQK A;  2D5D A;  1SLJ A;  1V1O A;  2EE1 A;  3OWF A;  1EQV A;  3RLO A;  3K6O A;  4KLK A;  5M5Y H;  4LF4 L;  1IKL A;  2B2Y C;  2IJ0 A;  3KF6 B;  5I9O A;  4RAU C;  1LTA D;  4ZAI A;  2QDL A;  1CHP D;  1FL0 A;  4DR6 L;  5K36 G;  5KRU A;  4KTA A;  5CR3 A;  3I8Z A;  1KQS A;  2UXC Q;  2CQO A;  3I4N B;  4G7Z C;  3ULL A;  4CJ1 B;  3T4A C;  3OWE B;  2IY5 B;  3NSW A;  2TSS A;  3DLL A;  3NPP A;  3S24 A;  3BVG A;  4A3J B;  3K8A A;  4HCS A;  1LLR D;  1UNS A;  5DLQ E;  2NTS A;  2KEE A;  2WAC A;  2N55 A;  2KJX A;  5FLX L;  2R7D A;  1GM5 A;  3K5L A;  4LF8 Q;  2A73 B;  3H0G G;  4O42 A;  1ROD A;  2DUD A;  2QCP X;  3NTH A;  5IGB A;  2HDL A;  4TKO B;  1Q90 A;  3J80 E;  2BA1 A;  3U9O A;  4L63 B;  3PQI A;  1JOQ A;  5H1S E;  5EBD A;  1K73 C;  4DK0 A;  1PZI D;  4A3C G;  4IAL A;  3GDE A;  1Y1W G;  1QZH A;  1K28 A;  3MWY W;  3MAQ A;  1WTV A;  1X9N A;  1RTO A;  1BCP B;  4LFC Q;  4JBM A;  1T5E A;  4LUV A;  5G3L F;  2NZH A;  1TS3 A;  3PO3 G;  4S3S A;  1QJO A;  4R4O A;  1J5E L;  4OO1 G;  1XPR A;  4F87 A;  4JI5 L;  1FGB D;  2LKV A;  2JE6 I;  4AYB G;  3P1H A;  4K2L A;  4WRD A;  4LF7 Q;  1MKH A;  1HUN A;  1SMY D;  4A3M G;  3Q6S A;  1U4R A;  2K7V A;  3GP7 A;  3IRB A;  4JOI C;  4DR1 L;  2NVY B;  4X64 L;  2JXM B;  1JE5 A;  4YWK A;  1YJN A;  2Y0S E;  4K0K L;  5IE8 A;  4YY3 L;  4HN7 A;  4A3E H;  5C3X A;  4DN4 M;  5IGF A;  2JA8 G;  2CKZ B;  2VL6 A;  1ONL A;  1TKW B;  2O2L D;  4OL7 A;  3PUV A;  4APV A;  3QOJ A;  4M8A A;  1XMQ Q;  1VQO A;  1EEF D;  3HOV B;  4ZQ3 A;  5KIX A;  2NVT B;  1VMP A;  5E4X A;  1EZ8 A;  3C3L A;  2E2I H;  4DPG A;  1WOC A;  2N8N A;  2RHS B;  3L7Z C;  4ZYS A;  3KJO A;  1YJW A;  5JJZ A;  1H9K A;  2EJM A;  3V05 A;  2HUG A;  3TRZ A;  3U4V A;  1I4X A;  3IFT A;  2CVR A;  5D14 A;  4OHJ A;  4X62 Q;  2N88 A;  3WOF A;  4DR6 Q;  1AE2 A;  4L5S A;  3MXN B;  5CMD A;  5IP7 G;  2CH4 A;  1UEB A;  4JI5 Q;  3NBH A;  2IX0 A;  3M4P A;  3RNU A;  4IJH A;  3TBI B;  4NPS A;  2EIF A;  4MN3 A;  4X3T A;  2R92 H;  3HS0 C;  1YEZ A;  2KHI A;  1PMR A;  4A3F H;  3M4Y A;  2XRQ D;  4KKT A;  3GTK H;  5IYD H;  4DUY Q;  4KI0 A;  3ZJY C;  4IUV A;  4DXG A;  2K75 A;  5J39 A;  2JYO A;  2JEB I;  3BDO A;  2K50 A;  1SMX A;  3NHH A;  2F4I A;  5COR A;  4DV2 Q;  1BCP D;  3HOZ B;  1K83 H;  4JOI A;  5A2Q E;  1BO0 A;  2LMC B;  4A3M H;  1TT2 A;  2BCO A;  4A3G H;  1AP0 A;  4AH6 A;  3A7A B;  2CW0 D;  4DV4 L;  3K7U C;  1ZEQ X;  1XPO A;  4ALP A;  1EY8 A;  2PO4 A;  4PMC A;  5EBC A;  3RD4 A;  3JAM L;  3S9W A;  2KCC A;  2RCN A;  3T1Y Q;  2D2C C;  3PSI A;  1STE A;  3JAM E;  4XYQ A;  1GHJ A;  3EQL C;  4NXM L;  3QWN A;  1B7Y B;  3HFZ B;  1BNZ A;  1KIX A;  4LUZ A;  4X65 L;  1E2W A;  5FJ8 G;  1F9S A;  1LM0 A;  2K5H A;  4G57 A;  5K36 H;  1Y1W H;  1JWS D;  5EKI A;  2JA7 H;  2CQA A;  3AFQ A;  1YIJ A;  3HOZ G;  1DM0 B;  1EY9 A;  1KDC A;  3HZX A;  3GTQ B;  4BS9 A;  1XPU A;  1KAB A;  4DAM A;  4X3U A;  4DUZ L;  3BZC A;  3HOW B;  2JA9 A;  4CKC A;  1QCB D;  3I72 A;  3MEF A;  1V43 A;  4RHR A;  3HOU B;  4C3H B;  2KOL A;  1MJE A;  2DNE A;  1N32 L;  1TWH H;  5C0X J;  4A3K B;  2SNM A;  4FF3 A;  1EEI D;  3D4D A;  5ELC A;  1Q8K A;  4JI8 L;  2PYK A;  5IGD A;  2VUM H;  3M3Y B;  3D31 A;  4R8I A;  4KD4 A;  5I2Y A;  4NP5 A;  1EQR A;  2K5D A;  2F1M A;  1STA A;  5C3E H;  3J81 L;  2EVB A;  1OXS C;  5EPL A;  5M3M G;  1I94 Q;  1ENF A;  3BVM A;  2UUA Q;  1EY5 A;  4L6T B;  4JI0 Q;  1DOM A;  1Q1B A;  5C0X H;  2UUA L;  2IX3 A;  3CCS A;  2WB1 B;  3HOX G;  4RWS C;  5CBA E;  4CDC C;  3BS1 A;  4E6I A;  1IYU A;  4R4T A;  3TP6 A;  1F2M A;  2RBM A;  4J8Q A;  1ET9 A;  3J81 i;  5M3F G;  4DK6 C;  4HMI A;  2E2J B;  2R7Z B;  2EJG C;  4DGZ A;  2UXD L;  1STH A;  2Y0S G;  1KTK A;  2JA5 G;  2PZT A;  1SND A;  1SMY C;  1LUZ A;  2K1B A;  2RSO A;  1X3F A;  2HIX A;  1B70 B;  2G5D A;  2V1C C;  1AZP A;  1SNP A;  2QEJ C;  5IP7 H;  4KD3 A;  4HIO A;  3J7A F;  3S1M B;  1S40 A;  4JBJ A;  3NQT A;  4KY6 A;  5DAU A;  1BKB A;  3MXU A;  1A2U A;  4GOP C;  1VQM A;  4FVM A;  4KHP Q;  2LXK A;  1KNA A;  4JI7 Q;  3PGZ A;  2R92 G;  2QF7 A;  5CV8 A;  1ASZ A;  2AWO A;  3HP3 A;  1WTP A;  2E2H B;  3U9S A;  2F0G A;  4UDU C;  4AYB B;  1B3A A;  4B08 A;  2NVT H;  1BUV T;  4KJO A;  4ZLT F;  4A75 A;  4DR5 Q;  3P75 A;  2Q2I A;  3G48 A;  1LT5 D;  4BBS H;  1PH2 A;  1X3G A;  1RIP A;  4OEL B;  1VQH A;  3VR6 A;  4YHH L;  4A3G G;  1W3S A;  5ISR A;  3PO2 G;  3TDQ A;  1VF7 A;  5J22 A;  1XYI A;  4C3I B;  4AQY L;  1JQY D;  2IT1 A;  4K5X A;  1VF5 C;  1O7Y A;  2SOB A;  4LK1 C;  3RR5 A;  5M5W B;  5M3F B;  1EY4 A;  4I65 A;  1SEB D;  1K0S A;  3S14 B;  4DNI A;  3J80 L;  1BVS A;  2NN6 I;  3TS0 A;  5EQ0 A;  3I7F A;  4JVZ A;  4DV1 Q;  5C4X H;  1Z7T A;  1XWE A;  4GS3 A;  1NR4 A;  3DWA A;  3K81 C;  4DV7 Q;  1BQQ T;  2ES2 A;  1EWI A;  2UXB L;  2R7F A;  1HA6 A;  2K01 A;  1SE8 A;  2Z9H A;  3VDY A;  1WTO A;  4DR4 Q;  3KF8 B;  4JK1 C;  1PFS A;  5GRO A;  1R4P B;  2F0O A;  3T1H L;  1N34 Q;  3L2P A;  2QW7 A;  1EY7 A;  3WWV A;  4A3G B;  1CA6 A;  4RKB A;  2CW0 C;  1FNW A;  1GKH A;  1S5B D;  2FFK B;  3A54 A;  4R9W A;  2K33 A;  4DV6 Q;  3I4N H;  2DGY A;  1PRT F;  2UU9 L;  1JR0 D;  2HQE A;  2XN9 C;  3A56 A;  1WTQ A;  3S2H B;  3K5M A;  4LW1 A;  1LTI D;  2EY6 A;  2E5L L;  1N33 Q;  5ELD A;  1MBY A;  2O5I C;  1T5X D;  4L8J A;  1KHI A;  1S5D D;  4PV1 C;  4C3I G;  5CC4 A;  1LYL A;  2FJ2 A;  3PIP A;  4G7O C;  3RN5 A;  2PW7 A;  2R3Z A;  2J4X A;  4DAP A;  2I46 A;  1EU3 A;  2JN4 A;  4PZ8 A;  1TWF H;  2NTT A;  2TMP A;  2ENB A;  3H3V H;  1VQB A;  2QDB A;  2DY7 A;  1NCV A;  4HAE A;  5DNF A;  3CCV A;  4CDF C;  3AB9 A;  2B29 A;  2OEO A;  2NVQ B;  3BYY B;  3OYY A;  2ICE C;  3OMG A;  2B2U C;  2R93 B;  1X65 A;  3K7A H;  1C4Q A;  2VUM B;  1NJI C;  4RFB A;  1HNZ L;  2VW9 A;  1M8A A;  1AEX A;  4R4Q A;  4GN3 B;  2Z1C A;  3A7L A;  3NTK A;  3HOY H;  5C3E B;  3CCM A;  1PTO C;  1GUO A;  5BN5 A;  2Q2T A;  3NEL A;  4DR5 L;  1F9R A;  5IWA L;  2NN6 H;  2K4K A;  3CME A;  1JOO A;  1HQR D;  3GV6 A;  1TWA H;  2ZXR A;  3A5U A;  4XQN A;  4DK1 A;  5JJL A;  3E0E A;  2CH4 W;  4EVO A;  5C44 H;  3M85 A;  2F0M A;  2K14 A;  4J1M A;  1YVC A;  5DM7 3;  5I6W A;  1Z9F A;  2L4N A;  5EAY A;  4CDE C;  3J7A V;  3H09 A;  3OTO Q;  1ZXT A;  4N8X 1;  3E3X A;  3CMA A;  2A6E D;  5GAH C;  1PRT B;  3H3V I;  1IW7 D;  4DU9 A;  3CXC A;  3JAM c;  1F9Q A;  4MHE A;  1LTB D;  4NXM Q;  4EGV A;  2B2T A;  1GXD C;  2AQ2 B;  4DV0 Q;  2RCF A;  2N3S A;  1K8G A;  3RZD H;  2KQ3 A;  2PI2 A;  3KOJ A;  3A8J E;  1UUP A;  3PUY A;  4K5W A;  2EYJ A;  2RQX A;  1CSQ A;  4DAV A;  5LMN W;  1IKM A;  1IYV A;  1CZG A;  1QUQ A;  3NWS A;  3PV0 A;  2A1A A;  2L12 A;  2PI2 E;  1IBM Q;  2KA7 A;  4PMW A;  1I6V C;  1V1P A;  3S1N H;  2Q8I B;  1DGS A;  4H13 C;  1H95 A;  2J7Z A;  1B53 A;  1GJX A;  2L15 A;  3DM3 A;  4K2K A;  5IGG A;  3G6E A;  1A15 A;  4DV2 L;  3BJU A;  3PO2 H;  1UE5 A;  2OTJ A;  1DOK A;  3HGB A;  5IP9 H;  5C4X B;  2MJ8 A;  1YIT A;  4C1N K;  4A3E G;  5D3I B;  5KYI A;  5FO8 B;  2SEB D;  2OWO A;  2G9H D;  4JPB W;  3BZD B;  3JC6 6;  1VQ7 A;  2PQA B;  3EIV A;  1VQE A;  5CBE E;  1XTD A;  1IZ6 A;  4FNF A;  1QOH A;  1YI2 A;  2K32 A;  1CM9 A;  4NMZ A;  4IUR A;  2PMZ B;  1KLG D;  4DF7 A;  3TZD A;  4HJ8 A;  3FPP A;  5GQO A;  5KNB A;  4JCV E;  3TS2 A;  4GKK Q;  3GTP B;  4ME5 A;  2XGT A;  1I3Q H;  4YWL A;  2K5V A;  1FR3 A;  2RDH A;  4B3M Q;  5IOD A;  2L55 A;  3UDG A;  3KLR A;  1Y1V G;  3J81 j;  2K6A A;  1PRT D;  2KBN A;  3KBX A;  4C3H G;  3R93 A;  3W2D A;  1PA6 A;  3H3V C;  5LMN Q;  2QA4 A;  2K28 A;  4JI1 Q;  3VR2 A;  1D8L A;  4BBR H;  4KN7 C;  3GTM H;  3FKI H;  4FXD A;  4QF4 A;  5E4W C;  1ILQ A;  1CKO A;  4DV5 L;  1WTH A;  4B3S L;  3R2I A;  4UP8 A;  4QUF A;  4A3K H;  1SXT A;  1IXR A;  2EY2 A;  2EYP A;  4JI4 Q;  1NAP A;  4O1N A;  4JI2 L;  1A0I A;  2WAQ G;  3AMU A;  1LTT D;  2OCE A;  5BN3 A;  2NVQ H;  2XNA C; 
#chains in the Genus database with same CATH homology
 4DV6 L;  5IP7 G;  1FGU A;  4BA1 I;  1VQP A;  1UEB A;  1CKN B;  1UWV A;  4JI5 Q;  2IX0 A;  3M4P A;  3RNU A;  4IJH A;  5IP9 G;  1WI5 A;  1MIU A;  4HID A;  4NPS A;  1GD7 A;  2EIF A;  2C35 B;  4XTC S;  2R92 H;  4C2M H;  3HOV G;  1YEZ A;  1WJJ A;  2KHI A;  5GAD C;  3ULP A;  1A8V A;  1OXV A;  4A3F H;  1QVG A;  4DR3 Q;  3GTK H;  5IYD H;  3PIO A;  4DUY Q;  4LFC L;  4KI0 A;  3ZJY C;  1K3R A;  2YTX A;  2K75 A;  1HNX L;  2AWN A;  1VQJ A;  3F2B A;  2JEB I;  2CFM A;  1EIF A;  2K50 A;  1SMX A;  4DV2 Q;  1YHA A;  4PG3 A;  4IOC A;  3S16 H;  1L1O A;  3A0J A;  4A3B H;  1K83 H;  4JOI A;  4NB3 A;  1IBK Q;  1W2B A;  1Y1V H;  4GNX B;  4A3M H;  5FLX c;  4DV1 L;  4A3G H;  4J15 A;  2R93 G;  4AH6 A;  1HNZ Q;  2H5X A;  3M9B A;  2F3I A;  4DV4 L;  3I2Z A;  5J3B A;  3PCO B;  4JI6 Q;  2BH8 A;  3K7U C;  3TQY A;  1A63 A;  3HKZ G;  1YJ9 A;  1XPO A;  2ZM6 L;  4ALP A;  3CCE A;  3PF4 A;  2EXD A;  3KFU A;  2AKW B;  3EN2 A;  4JYA L;  4DR7 L;  4IPD A;  3UDF A;  5GAG C;  5LMU L;  2K52 A;  2RCN A;  4HJ9 A;  4GOP B;  3PSI A;  3T1Y Q;  2CCZ A;  1YZ6 A;  1NMF A;  4NXM L;  4LF9 Q;  4H02 A;  3LGJ A;  1B7Y B;  2NVY H;  1U0L A;  1EOV A;  3HFZ B;  1FVI A;  1KIX A;  2OTL A;  4LUZ A;  4X65 L;  1UE7 A;  5ELO A;  2E2H H;  3OW2 A;  5FJ8 G;  1LM0 A;  2K5H A;  4POF A;  4P72 A;  5IYC H;  4HJA A;  1Y1W H;  1PH8 A;  1NTG A;  5FLM H;  1HH2 P;  2JA7 H;  3ERS X;  1HZC A;  3AFQ A;  4DUZ Q;  2UU9 Q;  4Y7N H;  1YIJ A;  1Q12 A;  4QGU A;  3HOZ G;  1HZA A;  4LFA L;  3I4M H;  2HT1 A;  1HJP A;  1XPU A;  4P74 A;  1X56 A;  4DAM A;  2NVX H;  1N33 L;  4DUZ L;  1VQN A;  4X6A H;  1NE3 A;  5BR8 Q;  1G6P A;  5M3M H;  3BZC A;  2OQK A;  2VNU D;  3HKS A;  5AJ3 L;  2JA9 A;  1TWG H;  1HZ9 A;  2E8G A;  3CC7 A;  4C3I H;  3MEF A;  5C3E G;  1V43 A;  1AE3 A;  1MJE A;  1N32 L;  1TWH H;  2UUC L;  4LF4 Q;  1IYJ B;  5C0X J;  4IJL A;  1I5F A;  2Z6K A;  2ASB A;  4L5T A;  1GO3 E;  3BZK A;  1BBU A;  4IOA A;  2F52 A;  2IX1 A;  3I55 A;  1Q8K A;  4A3D H;  4JI8 L;  1B8A A;  2AHO B;  1EQQ A;  3HKZ E;  1VQ6 A;  2VUM H;  2WAQ E;  3BU2 A;  2UXD Q;  1YBY A;  5IWA Q;  2BH2 A;  4B3R L;  3NEM A;  3D31 A;  2ZM6 Q;  3KDF A;  1E7Z A;  1VQA A;  1EQR A;  1KRT A;  1HNW L;  1L2F A;  1HR0 Q;  5C3E H;  4O2D A;  4GN4 B;  3A5Z B;  1OXS C;  5M3M G;  1N36 L;  1I94 Q;  3UE0 A;  1CKN A;  2CWA A;  1YNX A;  2UUA Q;  1JT8 A;  4JI0 Q;  3CD6 A;  2OQ0 A;  1PYB A;  1IBK L;  1S3O A;  2ID0 A;  1Q1B A;  1EIY B;  2UUA L;  3FKI G;  3M4O H;  1VS0 A;  1D7Q A;  3CCS A;  4A93 G;  3HOX G;  2HIV A;  1A62 A;  1BBW A;  3W1G A;  2ZJQ A;  4OO1 I;  2IHE A;  2NN6 G;  1SN8 A;  4R4T A;  1CUK A;  4NXN L;  5M3F G;  3J81 i;  4DUY L;  2JA7 G;  1XJV A;  5E7N A;  1VQC A;  1XMO Q;  2HHH Q;  4DK6 C;  3HOZ H;  4YCV A;  3S1R H;  4LFB Q;  3J81 c;  2F4V L;  4BA2 I;  1E3P A;  2XTI A;  4QL5 A;  3CPW A;  2UXD L;  2Y0S G;  4BY1 H;  2JA5 G;  1M90 C;  1LUZ A;  4UY8 C;  2YTV A;  3CCR A;  1X3F A;  1V1Q A;  1B70 B;  2B3G A;  2HIX A;  2V1C C;  1KC8 C;  4HIO A;  5IP7 H;  1PH1 A;  1Q81 C;  1WYD A;  2D62 A;  4JBJ A;  3K0X A;  1S40 A;  1PVO A;  4HIK A;  4JI3 L;  1N32 Q;  1WCM G;  1N8R C;  1BKB A;  1Z47 A;  4YWM A;  3A74 A;  5FLM G;  4HJ7 A;  3GTP H;  1AH9 A;  1C9O A;  1UE6 A;  5JEA J;  1VQD A;  1PH5 A;  3OTO L;  4GOP C;  4DR2 Q;  3RN2 A;  1PHJ A;  1VQM A;  4ME3 A;  4A3L G;  4BY7 H;  4DR2 L;  2JJQ A;  2WB1 E;  2YYZ A;  4X62 L;  3CC2 A;  3S1Q H;  4OWW B;  2LXK A;  1E1O A;  4KHP Q;  4OWT B;  4JI7 Q;  3PGZ A;  4AIM A;  2R92 G;  1ASZ A;  2AWO A;  3ER0 A;  1C7Y A;  1J6Q A;  1K0R A;  4BBR G;  2B63 G;  1Q1E A;  4IO9 A;  2JEA I;  1VQG A;  2KCM A;  3EBE A;  2NVT H;  1SR3 A;  1VQ4 A;  2B63 H;  3H15 A;  3S15 H;  2N78 A;  5LMN L;  5GAE C;  2EQS A;  2RHQ B;  3F2D A;  1L1O B;  2KCT A;  2PNH A;  4IPC A;  1G29 1;  4A75 A;  2Q2I A;  3RLF A;  4DR5 Q;  3T1H Q;  1N34 L;  4OX9 Q;  3G48 A;  4MNO A;  5IT9 c;  3HOY G;  4BBS H;  1PH2 A;  2HQL A;  1X3G A;  1RIP A;  2VQE L;  4A3D G;  1VQH A;  4YHH L;  4JV5 L;  4A3G G;  2R93 H;  1W3S A;  3PO2 G;  2MNA A;  3U50 C;  4POG A;  1JB7 A;  4DV7 L;  3S17 H;  2LSS A;  4AQY L;  2IT1 A;  3E9H A;  4DAY B;  2F4V Q;  2MQH A;  1ASY A;  2NZO A;  4JI0 L;  3AEV A;  4LFB L;  3RR5 A;  3SGI A;  2JK8 A;  1I50 H;  1XMO L;  4QQB X;  4A3B G;  4GLX A;  2GVB A;  4DNI A;  1E1T A;  1M1K C;  4AYB E;  3NEN A;  1BVS A;  2NN6 I;  3TS0 A;  2UXB Q;  3I7F A;  4DV1 Q;  4QIW E;  4IPH A;  5C4X H;  4DV3 L;  4A3K G;  4GS3 A;  3GO5 A;  3J7Z C;  1EUJ A;  3K81 C;  4HJ5 A;  2Q2H A;  2JA6 H;  1VQ8 A;  3F8T A;  3B6Y A;  4DV7 Q;  5M5X H;  3I56 A;  3TEH B;  1EFW A;  1TXY A;  1EWI A;  2ES2 A;  2R7F A;  2UXB L;  1R9T H;  3UDX A;  1SE8 A;  4YHH Q;  3VDY A;  4JV5 Q;  4DR4 Q;  3CCQ A;  1NMG A;  4LWC A;  3KF8 B;  4UPA A;  4BXX H;  4A76 A;  1PFS A;  1IL2 A;  2Z0S A;  4JBW A;  5GRO A;  4BY1 G;  4GLA C;  3FHW A;  3T1H L;  1N34 Q;  3L2P A;  1N9W A;  4MTN A;  3WWV A;  3PUW A;  2A8V A;  3HOU G;  2Z6K C;  1T9H A;  1GKH A;  3F1Z A;  4IPG A;  4GOP A;  1CKM A;  1SFO H;  4R4C A;  1VCI A;  1QVC A;  5ELN A;  5IYD G;  4DV6 Q;  3I4N H;  4IFD J;  4LFA Q;  2R7Z H;  4C3J H;  4JI7 L;  2DGY A;  4OX9 L;  4MZ9 A;  3GTO H;  2UU9 L;  1K9M C;  4BY7 G;  5JEA G;  4GNX C;  3D0F A;  3CQZ H;  4LF5 L;  1CSP A;  3J7A 5;  3M7N A;  4LW1 A;  3GTG H;  4Y52 H;  4O0A A;  4A3J G;  4YCW A;  2E5L L;  2D0O A;  5C4J H;  1N33 Q;  1RL2 A;  2RF4 A;  1P8L A;  4GNX A;  1KHI A;  4YCU A;  4B3S Q;  1LYL A;  4A3L H;  3PIP A;  1Q7Y C;  3RN5 A;  3NBH B;  3T1Y L;  4JI1 L;  3CPF A;  5HGQ A;  1OXX K;  2QEX A;  1G51 A;  1PH6 A;  1HR0 W;  4X66 Q;  2VQF Q;  1XNR L;  1PV4 A;  4X65 Q;  4PZ8 A;  1TWF H;  4TQU S;  1XMQ L;  1U5K A;  1JMC A;  4HIM A;  4JI3 Q;  4DR4 L;  1WCM H;  3H3V H;  3ICE A;  1OXU A;  1VQB A;  1PH9 A;  4LF9 L;  3U4Z A;  1VQI A;  3HOW H;  3AFP A;  3CCV A;  1I6H H;  3AQQ A;  1L1O C;  2B29 A;  4YY3 Q;  4P75 A;  4C3H H;  3OYY A;  3J80 c;  1FJG Q;  2UXC L;  1V9P A;  4DV3 Q;  1IBL Q;  2VUM G;  3J80 i;  4NXN Q;  1QZG A;  1X65 A;  4DV4 Q;  3M4Q A;  3K7A H;  2I0Q A;  4TVA B;  2Q2U A;  1NJI C;  1HNZ L;  4BBS G;  1VQ5 A;  2VW9 A;  1HNW Q;  4R4Q A;  1KL9 A;  3ULJ A;  3RLN A;  4GN5 A;  1QUQ B;  2VZA A;  3W5O A;  3E9I A;  2ZJP A;  4GN3 B;  3TRE A;  2ALY B;  1L0W A;  4AQY Q;  5C0X G;  3CF5 A;  1VQF A;  3HOY H;  4L5Q A;  1N36 Q;  5IYB H;  4A3I H;  1I94 L;  1OTC A;  3S14 H;  3CCM A;  3GTL H;  4R4I A;  5HY6 A;  2ZTC A;  4OON A;  2I5M X;  1JJG A;  4PZ6 A;  1VQ9 A;  2UUC Q;  4GLV B;  2D0P A;  2MO1 A;  1X6O A;  3PF5 A;  1PH7 A;  2Q2T A;  2UUB Q;  3GD7 A;  3NEL A;  4DR5 L;  2UUB L;  4B3T L;  3S2D H;  1VQK A;  4UP7 A;  4B3R Q;  5IWA L;  1SLJ A;  4EX5 A;  2K4K A;  4DKA C;  5AJ3 Q;  3CME A;  4JI4 L;  4RG1 A;  1TWA H;  4KHZ A;  1IBM L;  3A5U A;  1KRS A;  3RLO A;  1TWC H;  4KLK A;  3E0E A;  5M5Y H;  1KAW A;  5JJL A;  4LF4 L;  5C44 H;  2JA5 H;  3M85 A;  2K14 A;  1YVC A;  3KF6 B;  2E2J H;  1KXL A;  1Z9F A;  2BA0 A;  4QY7 A;  1PH3 A;  4LF8 L;  4KHP L;  1Q82 C;  1E22 A;  5EAY A;  1XNQ Q;  2ATW A;  1FL0 A;  4DR6 L;  5K36 G;  3KLW A;  3OTO Q;  5BR8 L;  1X54 A;  1JJ2 A;  3CMA A;  1IBL L;  5GAH C;  1KQS A;  4QJF A;  1O7I A;  3H3V I;  2CQO A;  2UXC Q;  1P16 A;  3ULL A;  4DV5 Q;  2LXJ A;  3CXC A;  3CC4 A;  3JAM c;  4FDB A;  2IY5 B;  3UE1 A;  4GKJ Q;  4NXM Q;  3HOV H;  3DLL A;  2YTY A;  3G71 A;  5LMU Q;  4DV0 Q;  3S24 A;  3JAM i;  4PZ7 A;  2N3S A;  3K8A A;  1K8A C;  1K8G A;  3RZD H;  4WJ3 M;  2PI2 A;  3HOX H;  3KOJ A;  2I5L X;  5DLQ E;  2HHH L;  3GTQ H;  4LF6 L;  1NY4 A;  1YHQ A;  4B3M L;  2R6G A;  3I4M G;  3PUY A;  2R7D A;  3W1B A;  1GM5 A;  3H0G H;  4DV0 L;  3CW2 C;  1CSQ A;  3U58 A;  4A3C H;  4LF8 Q;  4GKJ L;  2VY3 A;  3H0G G;  5LMN W;  4A3F G;  3RZO H;  2JQO A;  2DUD A;  1JJC B;  3G4S A;  1C0A A;  1QUQ A;  3CCU A;  2A19 A;  3HOU H;  2MO0 A;  2PMZ E;  3STB C;  2VS1 A;  3PV0 A;  2AMC B;  2A1A A;  2PI2 E;  1SRO A;  2GVA A;  2WP8 J;  3PUZ A;  5C0X I;  1IBM Q;  1OXT A;  2BA1 A;  3STB D;  2E5L Q;  4JI6 L;  4PMW A;  1X3E A;  2YU9 H;  1HR0 L;  1MJC A;  4LUO A;  4LF5 Q;  3S1N H;  3L0O A;  5H1S E;  4P71 A;  1DGS A;  1PYS B;  1H95 A;  2I5H A;  1EYG A;  1K73 C;  2KEN A;  5M5W H;  5M3F H;  1Q46 A;  4A3C G;  2L15 A;  3DM3 A;  3G6E A;  3GDE A;  5IY0 A;  4DV2 L;  5IYC G;  3BJU A;  1Y1W G;  3PO2 H;  4JI8 Q;  1QZH A;  1Q86 C;  1UE5 A;  1HNX Q;  2OTJ A;  5C4X G;  1J5E Q;  1X9N A;  4LFC Q;  4R1J A;  3KJP A;  5IP9 H;  4JBM A;  4BXX G;  4A3I G;  3Q8D A;  4LUV A;  4A3E G;  1YIT A;  1GVP A;  1X55 A;  4B3T Q;  2N49 A;  3KF6 A;  4JC0 A;  4L5R C;  2CWP A;  2NZH A;  1SRU A;  4JG2 A;  2KHJ A;  2OWO A;  3PO3 G;  3AYH B;  4R4O A;  1J5E L;  2NVQ H;  4OO1 G;  3K80 C;  1Y14 B;  1XPR A;  2YV5 A;  3JC6 6;  1VQ7 A;  4JI5 L;  2PQA B;  3EIV A;  1VQE A;  2JE6 I;  1FJG L;  4OWX B;  4AYB G;  5FJ8 H;  1XTD A;  1IZ6 A;  1NBW A;  2ZTE A;  3UDI A;  1YI2 A;  4LF7 Q;  3PUX A;  4OXP A;  3CCJ A;  1MKH A;  3KYH C;  4JI2 Q;  4A3M G;  5JJK A;  3CCL A;  4JOI C;  3IRB A;  4DR1 L;  3F2C A;  1S72 A;  4XIG S;  3S1M H;  4X64 L;  4LF6 Q;  1JE5 A;  4YWK A;  4HJ8 A;  1YJN A;  2GN5 A;  4IFD I;  5GQO A;  4JCV E;  3TS2 A;  2Y0S E;  1UE1 A;  4X66 L;  5IE8 A;  4YY3 L;  1HZB A;  1XNR Q;  4A3E H;  2JA8 H;  4GKK Q;  4K0K L;  2QGQ A;  2XGT A;  2FXQ A;  1I3Q H;  2MFI A;  4YWL A;  3CAM A;  2CKZ B;  2K5V A;  2VL6 A;  2JA8 G;  3S2H H;  4DR7 Q;  1QVF A;  4JYA Q;  4GKK L;  3PUV A;  4APV A;  2VQE Q;  1PH4 A;  3FP9 A;  4B3M Q;  4JBK A;  1YHB A;  3UDG A;  1VQL A;  1KD1 C;  2PQA A;  4IFD G;  1Y1V G;  1XMQ Q;  1E24 A;  3J81 j;  1VQO A;  4WJ4 A;  1PA6 A;  2IHF A;  2KBN A;  4P73 A;  2WFW A;  5C44 G;  4UP9 A;  2VQF L;  4DR1 Q;  5LMN Q;  5IYB G;  2QA4 A;  4JI1 Q;  1WFQ A;  2ZJR A;  1D8L A;  4BBR H;  2K5N A;  4A3J H;  1XNQ L;  3FKI H;  3GTM H;  3HOW G;  3I4N G;  2E2I H;  4DPG A;  1WOC A;  2N8N A;  2RHS B;  3L7Z C;  3KJO A;  1CKO A;  2WB1 G;  1YJW A;  4K0K Q;  5JJI A;  4DV5 L;  4EQ5 A;  4B3S L;  4A4I A;  4A93 H;  3TRZ A;  3U4V A;  4UP8 A;  4X64 Q;  4A3K H;  3GTJ H;  1IXR A;  3I4O A;  4RMF A;  4X62 Q;  4JI4 Q;  4LNQ A;  3PO3 H;  2JA6 G;  4JI2 L;  3KDF B;  2R7Z G;  1A0I A;  2ZTD A;  4DR6 Q;  2WAQ G;  4LF7 L;  1AE2 A;  2OCE A;  4DK3 C;  3CP0 A;  4DR3 L;  4L5S A;  1LTL A;  3M3Y H;  3MXN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...