4DV1Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv1Q00
1NMFA 4C3IH 1VQ5A 2YV5A 3TS0A 2XGTA 1WI5A 2C35B 1JMCA 4LF5L 3GTPH 2HIXA 5AJ3Q 5GAGC 1N34L 1Y1VH 4A4IA 4LFBL 3GTMH 4MTNA 1PFSA 4IFDJ 1LYLA 3BJUA 1VQOA 1X6OA 2K75A 3S1RH 1VS0A 5LMNW 3KF6B 4PG3A 1X3GA 2JA6G 2WFWA 1GD7A 5C0XI 1YIJA 4DUZQ 3KYHC 4YHHQ 4JI7L 4LF8L 2R7ZG 3B6YA 3M4QA 4TQUS 4KHPL 3U58A 4DK6C 2UXCL 1X9NA 2A1AA 2OTJA 4OO1I 1VCIA 1SN8A 2OCEA 4IPHA 3RLFA 4LUVA 3GTJH 2OTLA 3M85A 3FP9A 2R7DA 4KI0A 5M3FG 4OX9Q 4IJHA 2MO1A 2WAQE 1UE5A 3ERSX 4OXPA 1VQ8A 4QY7A 2HHHL 2UUAL 4NXNQ 3PCOB 2D62A 3K7UC 5FLMG 1FGUA 4X65Q 2VW9A 4LFCQ 4R4QA 5IP7H 4A3GH 3F2DA 3PUXA 2PNHA 3S2DH 3ZJYC 1HR0Q 3PUZA 4LWCA 4APVA 1WCMH 4JBKA 1VQBA 3DM3A 2WB1G 1GO3E 1AH9A 4L5SA 2EIFA 1KAWA 4A3LG 1Q81C 1FL0A 1EYGA 2AKWB 2E5LQ 4B3MQ 1QUQB 1V9PA 3HOWG 4DV3Q 4JI8L 5IYBH 4BBRH 5FLMH 3U50C 1Q46A 3TQYA 2UUBQ 5JEAJ 4HJ8A 1CUKA 1TWCH 1IBLQ 2YYZA 3W1GA 4EQ5A 3T1YQ 4JI5Q 3LGJA 4DR6Q 2ZJRA 2UU9L 4LF7L 3S1MH 4LF4Q 2OQKA 1HNXQ 1CSPA 1NTGA 1OXUA 4C2MH 2VUMH 1L0WA 5C44G 1X56A 4DR2L 2JA7G 3L2PA 4A3IH 2RHSB 5FJ8G 2Q2HA 3TEHB 3KF8B 4GS3A 4LF9L 5JEAG 4QL5A 1YNXA 4Y52H 3KFUA 3GTGH 1TWFH 3HOYH 2E2JH 3S14H 5IWAL 3CCJA 2ZM6L 4DR5Q 1HZAA 5M5XH 4A3FG 3GO5A 1NMGA 1G291 1TWHH 5C44H 4C3HH 1QZGA 4GOPA 3PO3H 2QA4A 4GOPB 3HKZE 3I2ZA 3E9HA 2QGQA 2F4VL 2XTIA 1VQMA 1Q1EA 4GLXA 3ULPA 2ALYB 3CF5A 3PF4A 4J15A 3OTOL 3E0EA 1MKHA 4ME3A 1EFWA 5ELOA 5HGQA 4BY7H 1PHJA 5K36G 1OXSC 4A3CG 2AWOA 3KDFA 1IL2A 2L15A 1KHIA 2LXJA 4PZ7A 4YWMA 3RNUA 5BR8L 2NN6I 3E9IA 4GN5A 1XNQL 3L7ZC 2OWOA 1LTLA 1MIUA 3W5OA 1PYSB 1N9WA 1OTCA 4JI4Q 1VQHA 4A3BH 1MJEA 1X55A 4A76A 3RLOA 2VZAA 2NZHA 4NXML 1VQFA 4O2DA 4GNXC 1S40A 4EX5A 2H5XA 4IJLA 3J80c 2F3IA 2KBNA 2IT1A 4JI0Q 5C0XJ 4DV4L 1VQPA 1SFOH 3EN2A 4DV6L 2GVAA 1EUJA 2IX0A 1VQ9A 2FXQA 1KRTA 3PUVA 2K5HA 2KCTA 1PH1A 4DV3L 4POGA 4Y7NH 4KHZA 3H3VH 2N3SA 1UEBA 4YWLA 1B8AA 4LF6L 2QEXA 4ALPA 3EBEA 4KLKA 2JA5H 3H0GG 5AJ3L 4XTCS 1B7YB 4JBJA 1M1KC 2A19A 3CP0A 2IY5B 4OWTB 5JJLA 3GTLH 1EOVA 2KHIA 1Z47A 4A3KG 1UE7A 1S72A 3HFZB 1Y1VG 4YHHL 5LMUQ 1W2BA 2ZTCA 3M4PA 4A3JH 1PH8A 3HOXH 1K8GA 3CCQA 1E7ZA 1L2FA 3I4OA 1KRSA 1UE6A 3K7AH 2Z0SA 1YEZA 4DV2Q 5IYDH 3FHWA 5J3BA 1HZBA 5IP9G 1K83H 2R92G 2PQAA 4IPGA 1E1OA 2PQAB 4QQBX 4DV5Q 1YVCA 1L1OC 5EAYA 3BZKA 3PGZA 3CMAA 4A3KH 4GKKQ 4OWWB 3ER0A 4B3TL 3J7A5 3STBC 2AMCB 3M3YH 3AFQA 2MQHA 4PZ8A 2LSSA 1YBYA 4JOIA 4X65L 3CCLA 4A3DH 4RMFA 1VQNA 3M4OH 2ZJPA 1TWGH 1JT8A 5IP9H 1HR0L 2R92H 2DUDA 4L5TA 1HNWL 2ES2A 4IOCA 1X3FA 4LW1A 1EQQA 4JG2A 4UP9A 2JK8A 5IP7G 4JI1Q 4A3GG 2ZTEA 3NELA 3RN2A 4B3ML 3T1HL 4IFDG 1WCMG 1U5KA 3TREA 4YCUA 1N36L 1IBMQ 1TWAH 4OONA 3UE0A 1PVOA 1BVSA 3UDGA 1S3OA 1XMQQ 4X66Q 3T1YL 2Z6KC 4NB3A 3BZCA 5IYBG 4BBRG 1FJGL 4DR6L 2JQOA 3PO2G 1HNZQ 2UUCQ 3CCVA 1N32Q 2ID0A 5GAHC 3K81C 1NJIC 1VQ7A 1SROA 3KLWA 4UPAA 2CKZB 2B29A 3EIVA 2VQFL 1UWVA 5H1SE 1VQKA 3HOVH 4JYAQ 4AQYQ 1N33L 4WJ4A 3AFPA 4HJ7A 2MFIA 1CKOA 4O0AA 1XNRQ 2RF4A 2VUMG 3CW2C 4A93G 4BXXH 4GKJQ 4X64Q 1XJVA 5M3MH 3G6EA 4A3IG 4DR7L 4DR5L 4DR4Q 3A74A 1XPRA 4UY8C 3PO2H 1QVCA 1HR0W 3AQQA 2PI2A 1HZ9A 1OXXK 1UE1A 3HOUG 2NVTH 2WB1E 3HOYG 1PH4A 1P16A 4P71A 4DAMA 1K9MC 2VQEL 3CCUA 2YTVA 4DV7Q 1E1TA 2N49A 4A93H 1WJJA 4DR3Q 5IYCG 2CQOA 4GNXA 2JA8H 2EQSA 2R7FA 4AYBG 4JI7Q 3HOZG 3TS2A 3PO3G 3A5ZB 4LF8Q 2K5VA 3J81c 2NN6G 4KHPQ 5IT9c 2UXCQ 2K14A 3CMEA 2NVQH 3HOUH 1K8AC 2BA0A 4DUYL 2D0PA 2BH8A 4A3MH 2B63H 4BY7G 3STBD 5IYCH 1EIYB 3HOZH 2UUAQ 2D0OA 3CCSA 4HIOA 4LNQA 4DR1L 2UXDL 1A8VA 3JAMc 1PH5A 4LFAL 1YITA 5C3EG 3UDFA 1GM5A 4JI6L 1Q12A 2YU9H 4B3SL 2ATWA 3I4MH 3PSIA 3ULLA 4JBMA 4A3BG 4A75A 1IZ6A 1YHAA 3CPWA 4B3RL 2R93H 1NE3A 4IPCA 3UDXA 3KDFB 2UXBL 3S16H 1SRUA 2DGYA 4LUZA 4DV1L 2VY3A 3KJOA 3GTOH 3PIOA 4X62L 2IX1A 1BBUA 1B70B 1GKHA 5C3EH 3GTQH 3S17H 2AWNA 1VQ4A 1CKMA 2UU9Q 4LF7Q 1L1OA 1J5EL 4DV0Q 3F2BA 3CC2A 1IXRA 1SMXA 4K0KQ 2OQ0A 4DR2Q 4BA1I 1N8RC 3NENA 1OXVA 3CCRA 4HJ9A 1MJCA 2I5LX 3KOJA 2JA5G 4LF9Q 3TRZA 4UP7A 5GAEC 3L0OA 1PH3A 1NBWA 3I56A 4JI3L 4YY3Q 5C4XH 5LMUL 1VQGA 1AE2A 2I5HA 3I7FA 1PYBA 4P72A 3F1ZA 4PMWA 5IWAQ 3OW2A 1R9TH 1I94Q 1VQDA 4JV5Q 4JI2Q 2K5NA 4A3JG 3HOXG 2I5MX 1CSQA 2CWPA 2VS1A 5IYDG 1HH2P 4R1JA 4R4CA 2F4VQ 1K3RA 2A8VA 5C0XG 4IO9A 1PH7A 4GKKL 3SGIA 1PV4A 2Z6KA 3F2CA 1EWIA 3OTOQ 1SR3A 1I3QH 1V43A 4YCWA 3J81i 3K0XA 4OO1G 2KENA 5GQOA 4HJ5A 4QIWE 1Q86C 2E2IH 4BY1H 4MNOA 5M5YH 4DUZL 1PH2A 2HT1A 3NEMA 1JE5A 3I4NG 4BBSH 3S2HH 1JJ2A 1A62A 1K0RA 1VQIA 2R6GA 2CCZA 3CCMA 1XPOA 1VQ6A 3F8TA 1XMOQ 4A3DG 3UDIA 3K8AA 5JJIA 5FLXc 2CFMA 3NBHB 3W1BA 3CC4A 2VNUD 2KCMA 1KXLA 4OX9L 2PI2E 1IBML 2YTXA 3S24A 1ASZA 4AIMA 3PUWA 3JAMi 2Y0SG 1QZHA 1XMQL 4TVAB 3BU2A 4X66L 2RHQB 4NXNL 3I4NH 5IY0A 2JEAI 1I50H 1E22A 1Y14B 2WP8J 3CPFA 3GDEA 4LFCL 4RG1A 2MNAA 3A5UA 1HNZL 2UUCL 2PMZE 1XPUA 1N32L 3RN5A 1LUZA 1OXTA 1YHBA 3CAMA 2IHEA 4DV6Q 3WWVA 4AQYL 5JJKA 2IHFA 1A0IA 1FVIA 1KL9A 1TXYA 2GVBA 2K50A 5HY6A 1YHQA 4AH6A 1IBKQ 2E5LL 4LF6Q 4GKJL 5LMNQ 3AEVA 1V1QA 3HOVG 4DR4L 1VQJA 1W3SA 3G4SA 2N8NA 2UUBL 3S1QH 2F52A 2HQLA 1IBLL 4BXXG 1HZCA 5M3MG 4A3EH 4JI5L 3D0FA 3CCEA 4FDBA 3J80i 1LM0A 4LF4L 3KF6A 4DV7L 1HNXL 4C3JH 4QGUA 4DR3L 4DAYB 4JV5L 2WAQG 1SLJA 1YI2A 3AYHB 2YTYA 1E3PA 2GN5A 1KQSA 2JE6I 4P74A 4UP8A 1VQLA 4YCVA 2BA1A 4POFA 1Q8KA 3D31A 3KJPA 4LF5Q 2JA6H 1N34Q 1WOCA 4JC0A 1X65A 4B3TQ 2R7ZH 4LFBQ 1IYJB 4QJFA 2MO0A 4A3MG 4L5RC 2B63G 1C0AA 1P8LA 5GADC 4P73A 2Q2IA 3JC66 4GNXB 2E8GA 3RZDH 1HNWQ 5M3FH 4MZ9A 2CWAA 2ZJQA 4R4TA 1QUQA 3T1HQ 1PA6A 4GLVB 3I4MG 1X3EA 1M90C 4P75A 1Q82C 1N36Q 4AYBE 3IRBA 3RR5A 2HIVA 2R93G 1C7YA 2HHHQ 4JI4L 3G71A 4IFDI 1FJGQ 1HJPA 1SE8A 4JOIC 1YJWA 4DV0L 4DNIA 4A3LH 3Q8DA 1QVFA 4K0KL 1WYDA 3U4ZA 1RIPA 5E7NA 3HOWH 2VQFQ 1YJ9A 1PH6A 3I55A 1KD1C 1N33Q 1JJGA 1E24A 1VQCA 1O7IA 1D8LA 4PZ6A 5ELNA 4JI0L 3HKZG 1WFQA 2K52A 1XTDA 4YY3L 1ASYA 4JI8Q 2BH2A 4DR7Q 1AE3A 2V1CC 1I94L 1VQEA 3S1NH 2RCNA 4HIKA 4HIMA 2NVYH 1KIXA 4JI2L 1PH9A 5DLQE 2JA7H 5C4XG 4OWXB 1G6PA 3MXNB 5FJ8H 3M7NA 3OYYA 2VQEQ 4R4IA 1Q7YC 1L1OB 4HIDA 4HJAA 4JCVE 4DKAC 5C4JH 1YZ6A 3ULJA 3DLLA 2NVXH 1U0LA 2LXKA 4H02A 4A3FH 3J7ZC 4GN3B 4DPGA 1YJNA 1KC8C 4DUYQ 3PIPA 1T9HA 2JEBI 1J6QA 3J81j 2ZM6Q 1H95A 2KHJA 4IPDA 3RLNA 1XMOL 3VDYA 4DV2L 4JBWA 1K73C 1DGSA 1I6HH 4BY1G 3GTKH 4BBSG 2N78A 2VL6A 1Q1BA 3H15A 1Y1WG 4YWKA 2AHOB 2B3GA 1I5FA 4DV5L 2Q2TA 2ZTDA 4DR1Q 2UXDQ 3FKIG 4LFAQ 2EXDA 2E2HH 1Z9FA 2I0QA 3CD6A 4A3CH 3PV0A 3UE1A 4B3SQ 1VQAA 4JI6Q 4WJ3M 5IE8A 2ASBA 1RL2A 3CXCA 2JA9A 1EQRA 2JA8G 4B3RQ 3G48A 1X54A 3PUYA 1GVPA 1Y1WH 1JB7A 1BBWA 2Q2UA 3M9BA 2UXBQ 3CQZH 1CKNA 4DK3C 5BR8Q 4DV1Q 1CKNB 3FKIH 3HKSA 4JI1L 4NPSA 1BKBA 1IBKL 1XNQQ 4R4OA 4X62Q 1D7QA 5LMNL 4IOAA 4L5QA 4GOPC 3PF5A 1JJCB 1G51A 5M5WH 4GN4B 3GD7A 1J5EQ 1C9OA 4X6AH 1A63A 3A0JA 5GROA 3RZOH 4NXMQ 4GLAC 2NZOA 2JJQA 4BA2I 1EIFA 4LUOA 3CC7A 3U4VA 3ICEA 1QVGA 4XIGS 4DV4Q 3H3VI 4A3EG 4JI3Q 3MEFA 4JYAL 2K4KA 3S15H 2Y0SE 1NY4A 1XNRL 3K80C 3H0GH 4X64L
chains in the Genus database with same CATH superfamily
1CHQD 4X3TA 2C35B 4XT1B 5KYLA 3GTPH 1LTRD 2HIXA 5GAGC 1HPCA 4LFBL 1QG7A 1I3QB 3NK9A 1X3GA 2E2IB 2OF1A 2CHBD 2R7ZG 1QNUA 4G7HC 3B6YA 1STNA 3U58A 1X9NA 1WTVA 1GJXA 4RA8A 4OO1I 4IALA 3RLFA 1HUMA 1FD7D 3M85A 3ERSX 1QWYA 1BCPB 1VQ8A 4QY7A 4NXNQ 2EJMA 1LABA 3K7UC 5FLMG 1FGUA 3EJIA 2VW9A 1HHVA 4CJ0B 3MA2B 2F0MA 3VYSA 4RFBA 3DM3A 4ZRZA 4L5SA 1TQOA 1FL0A 2WV6D 4QUCA 4B3MQ 1M4VA 3U50C 3EA6A 3S1QB 4HJ8A 5AFWA 1CUKA 4KD3A 1TWCH 3QR8A 5A35A 4A3EB 4EQ5A 1RJTA 4JI5Q 4DR6Q 4C3JB 2FMCA 2VUMH 1L0WA 5C44G 2JA7G 1TS3A 2A69C 4UAIA 3KF8A 4GS3A 5BN5A 3NBIA 3KFUA 2X69A 2E2JH 3CCJA 2ZM6L 1HQMC 1AN8A 2EE1A 2JA6B 1STYA 4DK1A 1G291 4C3HH 4FXDA 1IKLA 1DONA 3HKZE 2CW0D 3QO2A 3E9HA 2XTIA 2EYOA 4OHJA 4GLXA 1G6ZA 2GA4B 3BVZA 3FVQA 5M3FB 5ELOA 1Z6HA 1A15A 2L15A 2LXJA 1DOKA 4IUVA 2A74C 4GN5A 3V2TA 1BNZA 1N9WA 4JI4Q 1GHKA 2WB1B 1X55A 1F77A 3LWEA 4K5WA 4NXML 1VQFA 3HOWB 1QJOA 4PNYA 4C1NI 2K1BA 4QB4A 2IT1A 1DM0B 4EQPA 4DV4L 1SFOH 4DV6L 2GVAA 1EUJA 2D9UA 2EYHA 3PUVA 2KCTA 3LX0A 2NVYB 4DV3L 4Y7NH 2N3SA 1B8AA 2QEXA 4ALPA 1GUWA 3EBEA 4KLKA 1H9JA 4JBJA 3CP0A 4OGQC 2DJFC 1ICFB 3ZYYX 4ZCKA 1XXGA 3HS0C 5LMUQ 4A3JH 1EEID 2Z1CA 1E7ZA 5IYDH 4DV2Q 5C0XH 3IL8A 3GTKB 5IP9G 2XWJB 2X6LA 2R92G 2PQAA 1EWHA 2F0TA 3PIO3 4QQBX 3VR5A 5EAYA 2E2HB 4A3KH 4QF4A 4B3TL 3ND9A 3STBC 2AMCB 3AFQA 2SNMA 3BDCA 2LSSA 5TSSA 2F0OA 4RMFA 1VQNA 3M4OH 1XWEA 1H9KA 2EY6A 2ES2A 3K6OA 2I46A 1E0BA 1KDBA 3QOLA 3RN2A 5E4WC 1WVLA 3K5OA 4B3ML 4IFDG 1U5KA 5M5WB 3LWUA 1N36L 1SE2A 3UE0A 3IAYA 1PVOA 4PMCA 1S3OA 4NB3A 3BZCA 4DR6L 2PW7A 1R4PB 2XVSA 2QDBA 1O78A 1IYVA 2CKZB 3RD4A 1U4RA 3S15B 1EZ8A 5E4XA 2MFIA 1MHWC 2PZWA 3GV3A 2MPMA 4BXXH 4GKJQ 4X64Q 3QB3A 5M3MH 4DR7L 1EQTA 1QVCA 1HR0W 2CH4W 3V05A 3GTPB 1UE1A 3HOUG 4DXGA 3HOYG 1K9MC 2EZVA 4DXFA 1EYCA 3CCUA 3DXJC 4DV7Q 2N49A 1B2TA 1LO5D 1F9PA 3TS2A 4LAAA 3A5ZB 5KYIA 2UXCQ 3CMEA 4RHSA 4N8X1 4G57A 3TBIB 2BH8A 4BY7G 1KLGD 1BOSA 1EIYB 2EPBA 2D0OA 1CM9A 2NN6H 1UNSA 1PH5A 1YITA 5C3EG 4JI6L 4B3SL 3BS1A 4JBMA 2LKVA 1WTQA 4FF3A 1IZ6A 4FF2A 5LL6X 2R93H 4IPCA 1SAPA 1TWCB 1VQ4A 2KECA 4IUQA 2VUMB 3F2BA 1IXRA 2RSOA 4DR2Q 4BA1I 4ZLTF 2JA5G 4KY5A 4UP7A 5GAEC 1PH3A 1D5MC 2RSNA 2E2JB 5LMUL 3FDTA 4KTAA 2I5HA 1JJ2A 1R9TH 4IUNA 3T4AC 1DZ1A 5HGTA 2A69D 2RKSA 3Q24A 2IX3A 1PV4A 1Q90A 5IGEA 1EWIA 3FEWX 1PTOD 4OO1G 4M8AA 1DCZA 1EIGA 1IL8A 2L12A 3NWSA 4BY1H 4DUZL 4BBSH 3S2HH 3I4NG 1A62A 2R6GA 4A3DG 1B50A 3F8TA 2QDLA 3AMUA 5FLXc 4OX9L 2PI2E 1EU4A 3PUWA 1IYUA 4F87A 3BU2A 1C8CA 3U9OA 2XRSD 3BYTB 1Y14B 3GDEA 3A5UA 1XPUA 4I7AA 1SFOB 1KDAA 1OXTA 1SNOA 4ME5A 4ZUIA 1Y8NB 1F2MA 4Y7NB 1FVIA 1TXYA 2F0QA 2GVBA 3PIP3 5E3FA 4GKJL 1VMPA 5LMNQ 1HXYD 3HOVG 1V1QA 1W3SA 2EY2A 5D3DA 5C4ZA 3G4SA 2F0HA 4K2LA 3OMGA 1F9QA 1IBLL 5KRUA 4QCLA 4G4KA 1RD9D 3I72A 4FDBA 1LM0A 4LF4L 2R3ZA 3KF6A 4DV7L 4DAYA 5I2YA 4A3JB 4WORA 2L4NA 1BBXC 1V8QA 5C3WA 2YTYA 3Q23A 2GN5A 1KQSA 4P74A 4POFA 1KABA 4LF5Q 1H9MA 1O7LA 4EGVA 4JC0A 4K2KA 1IYJB 2MO0A 4A3MG 4L5RC 5BN3A 3NXWA 3M4OB 4NKLA 4CKEA 3JC66 1DOLA 1F2LA 1HNWQ 1ZXTA 1JCKB 5IOCA 1GUTA 1ET9A 1CQVA 5KNCA 2PQEA 3MZ5A 2F3WA 3IRBA 1B9NA 1MI2A 2MP1A 1NR2A 3G71A 1FJGQ 1HJPA 1SE8A 4MIUA 5IGDA 2A6HC 4A3LH 3Q8DA 4L6TB 1QVFA 4V0BA 5E7NA 1L0YB 1QCBD 1PH6A 1KD1C 4NP5A 1E24A 4PZ6A 4JI0L 5M3MB 2F4IA 1AE3A 1EY6A 2NZ1D 2F03A 2KCCA 2JXMB 2WAQB 4OWXB 1G6PA 3A8JE 5FJ8H 4KV6A 4FNFA 1ILPA 2VQEQ 5JEAH 1L1OB 3M4YA 2NVXH 3J7ZC 4DPGA 1ENCA 1KC8C 4DUYQ 1VDZA 2NWGA 5FOBB 2L11A 4LMQD 2VL6A 1Q1BA 3R3OA 4DV5L 2UXDQ 5K36H 4RGMA 2I0QA 2ENBA 2BOSA 2QCPX 2ASBA 3C46A 1HCZA 2JA8G 2R93B 3CRKC 4B3RQ 1E2WA 3ITPA 1X54A 1GVPA 1ONLA 5EKLA 3M9BA 3CQZH 3HKSA 4NPSA 1XNQQ 4FO2A 2HUGA 5LMNL 1AZPA 2L55A 4GN4B 1DYQA 5GROA 4GLAC 4RHRA 1EL0A 2JJQA 2HQEA 1FR3A 1IW7D 1I6VC 1JICA 3U4VA 3ICEA 3ONAB 4XIGS 3H3VI 4JI3Q 1R9TB 1XNRL 1I6HB 3KBGA 3H0GH 2IPKD 3DEPA 3MFGA 4IUPA 4IZ8A 1VQ5A 4TKOB 2XGTA 4LF5L 5AJ3Q 1TS5A 4TSSA 2F0UA 1Y1VH 5ELFA 4A4IA 1DD2A 4N9TA 4K5VA 1GXDC 1K0SA 3BJUA 1X6OA 1VS0A 4K8JA 3D6CA 4PG3A 4BY1B 3H09A 4BBSB 3S2HB 2CW0C 4JI7L 1Y1WB 4KHPL 5CV7A 2F0KA 4OIJA 3K0YA 2N55A 2R7DA 4KI0A 1PTOF 4OXPA 4L63B 2UUAL 2KQ3A 2RBMA 3SDZA 4R4QA 4A3GH 1IHZA 3F2DA 1JQYD 2MJ8A 3S2DH 1WCMH 1VQBA 1FYCA 2EIFA 1KAWA 4NMZA 1Q81C 3I91A 2AKWB 1QUQB 4TRDA 5IYBH 4BBRH 2UUBQ 1F9SA 1GUSA 1TIID 3T1YQ 3MTSA 4FP5D 2ZJRA 4LF7L 2OQKA 1HNXQ 3BVGA 3DWPA 1D5XC 2BDOA 5EPJA 4C3HG 1X56A 5ELDA 4A3IH 2RHSB 2Q2HA 3KF8B 4LF9L 3NQIA 3H3VC 4Y52H 3S14H 1SYFA 5CC4A 4JPBW 1SEBD 3HZXA 4C56C 5M5XH 4HCSA 4A3FG 1ML0D 1QZGA 3G6JB 3E0JA 1BF4A 3PO3H 2VB2X 3SEBA 3OSOA 1I4RA 1Q1EA 1D6EC 1LTBD 3E0EA 3A56A 4CHTB 2F0EA 5HGQA 1LTTD 1OXSC 3TZUA 4A3CG 1IL2A 1KHIA 4PZ7A 5C3XA 5JPMC 4K6LA 1XNQL 3L7ZC 4CDFC 1JR0D 4Q5VA 5G3LD 3SK4A 1V1PA 2QILA 1VQHA 3I70A 4KKTA 1MJEA 1A3UA 3RLOA 2VZAA 2K33A 2O5JC 4O2DA 4GNXC 1I4HA 1E2ZA 4IJLA 2FFKB 1YNJC 2KBNA 5C0XJ 1O80A 3EN2A 4XT3B 2NB0A 1VQ9A 1KRTA 2K5HA 2D2CC 1TWHB 2A6HD 2O5IC 2O4XA 1FNWA 3ERQA 5AJ3L 4XTCS 1M1KC 2IY5B 1EYAA 3EROA 4OWTB 5JJLA 1A6XA 1B4OA 4A3KG 2C9OA 3HFZB 3M4PA 3HOXH 5EBDA 1L2FA 3K7AH 1KRSA 1UE6A 5J3BA 5DNFA 1HZBA 4IPGA 2PQAB 3NWTA 3PGZA 4OWWB 3M3YH 3BDOA 3CCLA 4JOIA 1YBYA 1I4PA 1JT8A 4ZAIA 1OO9B 3CQZB 4IOCA 2Z4HA 1X3FA 4LW1A 5IP7G 2PZTA 2ZTEA 1G2SA 3D4DA 1S5DD 2XSCA 1S5ED 1LT5D 4IN3A 4ZK9B 4OELB 3T1YL 2NTSA 2B8GA 4K14A 5IGFA 1HTLD 2UUCQ 3H94A 3CCVA 3QOJA 5GAHC 3Q6SA 5LHY1 1SYDA 1VQ7A 3KLWA 3NSWA 4UPAA 3EIVA 2B29A 4QIWB 4WJ4A 3H91A 3CW2C 3H0GB 5DAUA 1SMYC 3G6EA 5CMDA 3A74A 2G9DA 2PI2A 1T5EA 1Y1VB 4DAMA 4P71A 1SNDA 1F2ZA 1JOOA 2AQ3B 3MAQA 4DR3Q 3F2UA 4JK1C 5JAVA 4GNXA 2R7FA 4LF8Q 4ZUJA 1WTRA 2NN6G 1PTOC 2PYKA 2DNEA 2E2DC 3C2PA 5EPKA 2D0PA 3KLRA 1NR4A 4J8QA 2L0CA 4IQZA 3CCSA 3TP5A 4A3GB 1A8VA 4RGTA 4LFAL 2B2TC 3S2DB 1I4QA 1B3AA 1MD2D 3UDFA 1WCMB 3I4MH 4A3BG 3HP3A 1YHAA 5A2QE 5EKKA 3KDFB 4BBRB 3NPPA 4LUZA 2DGYA 2LFNA 3GQBA 5NUCA 1KNEA 4X62L 1GKHA 3CHBD 2QF7A 1SSOA 1CKMA 2UU9Q 3VR6A 1J5EL 5ISRA 4A3IB 2RDHA 1OXVA 3KOJA 1EQVA 3S14B 5C4XH 1VQGA 1AE2A 3I7FA 5IWAQ 1PYBA 4P72A 1PRTB 3F1ZA 5M5XB 1I94Q 4KJOA 5IODA 4AYBB 2K5NA 2Q8IB 3PO3B 5CORA 1HH2P 2F4VQ 3VA7A 5HURA 3SGIA 2WACA 2H1EA 3OTOQ 4RCOA 4YCWA 2KENA 5GQOA 1PH2A 4EVOA 3T16A 2HDMA 3CCMA 1XPOA 5JJIA 1XMOQ 3I90A 4UHVA 3NBHA 2B2YC 4YIJA 2VNUD 1MSGA 2PW5A 1Y8PB 2YTXA 2KUMA 1SNMA 2Y0SG 1QZHA 3Q0AA 4NXNL 1JC7A 4G7OC 2XNAC 4OL7A 2JEAI 2EYLA 2OXPA 2WP8J 2UUCL 3CPFA 1JB3A 2EYMA 2FINB 1LUZA 2PZUA 3RN5A 1YHBA 1II3A 2OT2A 1EY0A 5G3LF 2JN4A 1F2YA 2IHFA 3GV6A 5HY6A 1YHQA 4AH6A 4LF6Q 4H44C 1R4QB 1KDCA 4DF7A 2HQLA 2E76C 2K03A 1YNJD 1CT1D 4JI5L 3DHQA 4RGNA 2B2TA 2F0GA 4DR3L 4DAYB 5M5YB 1GHJA 2SDFA 3HOXB 1SLJA 3K7AB 1YI2A 3AYHB 1E3PA 2JE6I 3FPPA 4KJNA 2K28A 1Z7TA 1CA6A 1N34Q 1WOCA 4CDEC 1X65A 2R7ZH 3M3YB 4QJFA 4WFN3 2B63G 1C0AA 4P73A 1O7ZA 4G7ZC 3RZDH 2DJGC 4V190 1XTCD 4XQNA 3HEJA 2ZJQA 1SXTA 2A5HA 1WTPA 5EQ0A 2FJ2A 3T1HQ 1PA6A 2HIVA 1K8MA 3DEOA 3SK8A 4JI4L 4RKLA 1FNVA 4DNIA 1WYDA 1DOMA 4IUTA 2VQFQ 1YJ9A 3I55A 1JJGA 1HA5A 1N33Q 2PNRC 1JORA 1IW7C 2K52A 1ASYA 1I94L 1TS2A 1KIXA 1SYBA 2JA7H 1STEA 3TN2A 2B2YA 3IKJA 3MXNA 1SJED 1CTMA 1FGBD 4XXEA 1K8OA 3N6RA 4HIDA 4DKAC 5C4JH 1PZID 3S9WA 1EYDA 1HTPA 1A3VA 4H02A 2Q8TA 1SMYD 2L5TA 2LY7A 1J6QA 3J81j 5ELCA 2KHJA 2QKIC 2H4OA 1Q8IA 1XMOL 3VDYA 4DV2L 1I6HH 1DGSA 2AHOB 1I5FA 4DR1Q 1PXUA 2EXDA 2G5DA 3CD6A 1KAAA 3PV0A 3I4MB 4WJ3M 1D2BA 3VR4A 1TS4A 2JA9A 4S3SA 3SK5A 3PUYA 3K5LA 1WTOA 1Y1WH 2UXBQ 2Q2UA 3VR3A 4DV1Q 1CKNA 1ASZA 5BR8Q 3FKIH 2SEBD 5FO9B 2R61A 5IIFA 3HRZC 4GOPC 1TR5A 1GOZA 3A0JA 3HKZB 2NZOA 3MFYA 4A3EG 4ZQ3A 5C4XB 1BCPD 3R2TA 2Y0SE 3P1HA 4C3JG 4FXKC 1NNXA 5CV8A 4X64L 1ILQA 4CGYB 1EEFD 1WI5A 1AZQA 2JSOA 1JMCA 1N34L 4FYDA 3GTMH 1U9RA 4MTNA 2EVBA 2K75A 1GUGA 2JA6G 5C0XI 1YIJA 2PCFB 2K01A 5LL6S 2UXCL 1CK1A 5BN4A 3K57A 2I07B 3W3AA 5A2QL 1SN8A 2OTLA 2OTJA 4LUVA 3URYA 1CQFA 2QW7A 1GUOA 5M3FG 4GZYC 2RVLA 5DM73 2A68D 3PCOB 3UI2A 3E6ZX 4X65Q 4LFCQ 3JAME 4IUUA 2KHSA 3ZJYC 1HR0Q 2Z8LA 3PUZA 4LWCA 4IFDH 1U4PA 3DUZA 2WB1G 1JWSD 1AH9A 1EYGA 1EU3A 3L3OC 2E5LQ 1V9PA 2K04A 3HOWG 4C3IB 1KTKA 2F0DA 1QE6A 1Q46A 4XYOA 2YYZA 4X3UA 1B44D 3TDQA 1CSPA 1NTGA 1OXUA 4C2MH 3T51B 3QG1A 4DR2L 3QWNA 3L2PA 3TEHB 1YNXA 5K5PA 1SNPA 4F7XA 3HOYH 3SR1A 4JW0A 4DR5Q 1HZAA 2JP1A 3GO5A 4KKUA 1TWHH 4E6IA 4NDXA 4QUFA 2R7ZB 4GOPA 3FMCA 4KK7A 5FO8B 1STAA 2VB3X 3I2ZA 1EFID 3ULPA 1PRTD 2ALYB 4Z9CB 2MUYA 4J15A 3RZDB 2F0SA 1RDPD 3KK7A 4EQOA 4BY7H 4FXGC 1PHJA 4KN7C 2AWOA 1BDOA 3O13A 1XX8A 3RNUA 2IJ0A 4K5XA 5BR8L 2NN6I 3RMHA 1TKWB 2OWOA 1F9RA 2EJFC 1LTLA 1MIUA 3W5OA 1OTCA 4DA2A 1V1PB 4A76A 4OEMB 2NZHA 1UUPA 4EX5A 2H5XA 3R93A 2F3IA 4HCEA 5KGUA 3P75A 2IX0A 1E2VA 2FXQA 4POGA 4DU9A 1H9SB 5J39A 5C44B 1PTOH 1S5CD 4FF1A 2JA7B 4HEDA 1MGSA 5FO7B 2JA5H 1JWUD 5C4JB 1SJHD 4HMJA 3GTLH 1QNKA 3NTKA 2KHIA 3WOFA 1S72A 3AU7A 5CV4A 1X3QA 3I73A 1LACA 2B39A 2XWBB 1K8GA 2RDFA 1YEZA 3FHWA 3U9SA 4HR7B 3D8GA 1L1OC 4OO1H 4GKKQ 1WD1A 3TP6A 2G9HD 2MQHA 4PZ8A 4X65L 4BS9A 4A3DH 4J1MA 1SE3A 1HR0L 1HNWL 4L5TA 1QILA 3FKIB 1EQQA 4JG2A 2JK8A 4JI1Q 4U673 4O1NA 1HFGA 1HRJA 5EBCA 4U68A 3R8BA 1BVSA 3UDGA 4X66Q 3OHXC 1FJGL 2JQOA 5M9OA 1N32Q 1NJIC 4KY7A 3T56B 3HOVH 4JYAQ 3AFPA 4HJ7A 4O0AA 1CKOA 2RF4A 2VUMG 4UDUC 3PMFA 4DR5L 4DR4Q 3PO2H 1RCVD 1HZ9A 2KJXA 2RDGA 2WB1E 3GTMB 1P16A 2E75C 2F0WA 2RA4A 2Z9HA 1GUNA 1RHPA 2A6ED 2VQEL 1E1TA 1BCPF 1WJJA 3MXGA 4I65A 4A93H 3K59A 4JV5Q 2R92B 1ICWA 2K14A 3A8KE 1Y69U 2ZXOA 4DUYL 4DGZA 3J7AF 3BG3A 4A3MH 5IYCH 2EYFA 4QMGA 3HOZH 1B9MA 1D1IA 4N9PA 4LNQA 2UXDL 1I4XA 3FPUB 2ATWA 1Q12A 2YU9H 1PZKD 3ULLA 4A75A 3CU7A 3DWQA 4B3RL 5CYUA 2ICEC 1SNQA 1NE3A 3UDXA 2VY3A 3WOEA 3KJOA 4CKBA 4DK0A 3PIOA 1RODA 4CBVA 1BBUA 1B70B 4H7BA 4LJZC 2D5DA 2AWNA 3P7JA 2F0FA 1L1OA 4C2MB 3CC2A 2EY1A 1Q3LA 1SMXA 4K0KQ 2OQ0A 4L8JA 3CCRA 1MJCA 2I5LX 3TRZA 1JE4A 3OIPA 3HOYB 3RUZA 2AUJD 4JI3L 4HJ9A 4PMWA 1PDQA 1VQDA 4XYQA 3NTHA 4X3SA 4JI2Q 3J81L 4A3JG 1K28A 3CRLC 1LT3D 5IYDG 4R1JA 4ZYSA 2A8VA 5C0XG 4IO9A 1PH7A 2HD3A 4GKKL 3HG9A 3F2CA 3TZDA 5C4HA 4ABNA 4BY7B 3J81i 3K0XA 4HJ5A 2HT1A 5M5YH 3JAML 5CGKA 1LTSD 3K8AA 2RQXA 3E3XA 5C3EB 2EJGC 1WTXA 1PRTF 3NBHB 3W1BA 4XQJA 2KCMA 1KXLA 2M2LA 1BQQT 3S24A 2JA8H 3JAMi 2IL8A 3DM1A 4X66L 1CI3M 1QB5D 1I50H 1E22A 2ICIA 1N32L 2MNAA 1K3BC 3OMCA 3CAMA 5I9PA 4DV6Q 3WWVA 3OWFA 3N52A 1A0IA 1PTOB 1SYEA 4DR4L 2JA5B 3A7LA 2UUBL 2F52A 1X32A 3T53B 1BR9A 4BXXG 2EYPA 1HZCA 3TP7A 5M3MG 3D0FA 3GTLB 1HUNA 3CCEA 1EY5A 2K05A 1YNND 1HNXL 3T13A 4JV5L 1S5BD 2WAQG 2J7ZA 5T1GA 4B9XA 2NYZD 3OW7A 1VQLA 4UP8A 2HDLA 2KOLA 4MTKA 2N88A 1Q8KA 2TSSA 3NHHA 4XQQA 2PO4A 3I4NB 4B3TQ 1AFPA 1QOHA 4A3DB 5F2DA 3VYUA 1P8LA 3MEHA 2Q2IA 2PMZB 4DFAA 1ZYRD 5JOBA 2CWAA 1UAPA 2O2LD 1QUQA 4GLVB 5JVH3 1Q82C 1N36Q 1G2TA 3RR5A 5DM63 1JOKA 2R93G 1C7YA 3MC0B 2HHHQ 4K8IA 1U4LA 4LK1C 4IURA 1YJWA 2HCIA 1DJRD 3MVVA 1FNUA 4K0KL 3HOVB 2JYOA 2NBFA 1VQCA 1O7IA 4RCNA 2DN8A 1D8LA 2Q8RE 3OOCA 4JI8Q 2BH2A 4DR7Q 4H13C 3PO2B 2V1CC 1VQEA 1LTGD 2RCNA 4R8IA 4HIMA 1BCPC 4JI2L 1PH9A 3MXNB 3M7NA 3OYYA 2SOBA 4R4IA 4A93B 4HJAA 4JCVE 1ENFA 1YZ6A 1RKNA 3ULJA 3DLLA 1U0LA 4A3FH 2DY7A 4GN3B 3E5SA 1YJNA 3PIPA 1T9HA 3I8ZA 4A3MB 3RLNA 1K73C 4JBWA 3HOZB 4BY1G 1TY0A 4BBSG 1EIHA 4KN4C 3OIQA 3H15A 1Y1WG 2B3GA 2Q2TA 2BE5C 3FKIG 4A3CH 1B3QA 1Z9FA 2IW3A 2YU9B 3D4RA 4JI6Q 3D4WA 1BO0A 1VQAA 4B3SQ 3SK6A 5KNDA 4RKBA 2A68C 1CA5A 1EQRA 2V4DA 3G48A 2WINB 3BVMA 5L37A 1JB7A 3S1NB 1W6JA 1CKNB 3VYRA 1WD0A 1BKBA 4R4OA 2XN9C 1D7QA 5I6WA 5IGBA 4IOAA 5CBEE 1C4QA 1C9OA 4X6AH 1H9RA 3RZOH 1S5FD 3J7AV 4FF4A 4BA2I 1EIFA 1QVGA 3MEFA 2M9VA 2PPBC 3OWEB 5J22A 1NMFA 3BYYB 4C3IH 1MBYA 2YV5A 3TS0A 5I6YA 3NTIA 2F0VA 1PFSA 4IFDJ 1LYLA 1VQOA 3S1RH 4OIKA 5LMNW 3KF6B 2MHVA 2WFWA 1GD7A 4DUZQ 3KYHC 1SYGA 4YHHQ 4LF8L 1PRTC 3M4QA 4TQUS 4DK6C 1PMRA 5CV6A 2A1AA 3HGBA 1JWMD 1VCIA 2OCEA 4IPHA 5CR3A 3GTJH 3MXPA 3FP9A 3CKIB 4OX9Q 4RH6A 4HSVA 2E74C 2MO1A 1UE5A 2WAQE 4IJHA 2J4XA 3C1FA 2JA8B 1D5ZC 2HHHL 5KEEA 1ET6A 2D62A 1M8AA 1I50B 4NW2A 4O42A 2IWHA 4K6DA 5IP7H 1AP0A 3PUXA 2PNHA 2KEDA 2OEOA 3DMUA 1NSNS 2XRQD 4APVA 1B1ZA 4B9WA 1GO3E 2VXWA 4A3LG 4HN7A 5EGTA 4DV3Q 4JI8L 5FLMH 3TQYA 3MWYW 5JEAJ 1IBLQ 3W1GA 2XIWA 3LGJA 2UU9L 3S1MH 4LF4Q 1U4MA 5EKIA 3SHLA 5JPNC 5FJ8G 3J80E 1NUCA 5JEAG 2ZXRA 4QL5A 4M1UB 3GTGH 1TWFH 5IWAL 2QEJC 4RGOS 4DN4M 1PFBA 1NMGA 5C44H 3K5MA 1D1KA 2QA4A 5C5LA 2NTTA 5T1IA 4GOPB 2QGQA 2F4VL 1VQMA 1LT6D 3G7LA 3CF5A 3PF4A 5IGGA 3OTOL 1MKHA 2TMPA 4ME3A 1EFWA 5K36G 2CQAA 3KDFA 2MGSA 2KA7A 4YWMA 1AEXA 4JVZA 4KY6A 1VF7A 3E9IA 4XDXA 5FLXE 1PYSB 1SBBB 4A3BH 4DAPA 2B2UC 3A55A 4P2CB 3I3CA 1S40A 2WKCA 4KMUC 3J80c 4B08A 1NCVA 1B53A 2F1MA 3BDLA 4JI0Q 3QIAA 1X3PA 1VQPA 1PFMA 3VYTA 1PH1A 4KHZA 1AW7A 4YWLA 1UEBA 4C3HB 4LF6L 3H3VH 5KIXA 1W6KA 1WTWA 2DY8A 3H0GG 1B7YB 2A19A 4A3FB 1G8ZD 1EOVA 1Z47A 1UE7A 2A6EC 3SXHA 1Y1VG 4YHHL 1W2BA 2ZTCA 2B2WC 2B8FA 1PH8A 4R8NA 3CCQA 3I4OA 4RWSC 3BZDB 4X3KA 2Z0SA 5C5MA 5I2XA 1K83H 4H0LC 1E1OA 2AUKA 4DV5Q 2C5CA 1YVCA 2Z6BA 3BZKA 1CFMA 3CMAA 3ER0A 5CBAE 3L9AX 3J7A5 4EQNA 2LS01 5ELEA 2CVRA 2ZJPA 1TWGH 2LMCB 1EY7A 5IP9H 2R92H 2DUDA 3IFTA 5D14A 3TSSA 4UP9A 3J81E 4A3GG 5IT9E 5C6AA 3IFDA 3NELA 2BE5D 3T1HL 1WCMG 3TREA 2F0NA 4HSPA 2ZT9C 4YCUA 3TP8A 1S4ZA 1TWAH 4OONA 4ZKCB 1IBMQ 2A73B 3RZOB 3VR2A 1XMQQ 2P5ZX 2Z6KC 5IYBG 4BBRG 3MXUA 3PO2G 1HNZQ 1J9OA 2ID0A 3K81C 1SROA 2BDNA 2VQFL 1VQKA 1UWVA 3NE5B 5H1SE 4AQYQ 1N33L 1A3TA 1XNRQ 1RF2D 4A93G 3X3NA 1ESRA 2K5WA 1XJVA 4A3IG 1V1OA 1SYCA 1XPRA 4UY8C 1CZWA 1EY8A 3AQQA 1OXXK 4A3KB 2NVTH 1T5XD 1PH4A 1HFNA 4R9WA 1JOQA 3S1RB 2B2UA 2YTVA 2K6AA 1LV9A 2Z4IA 5IYCG 2CQOA 3HOZG 2EQSA 4AYBG 1BXTA 4JI7Q 3PO3G 2K5VA 3A8IE 4CJ2C 1BUVT 3J81c 4KHPQ 5IT9c 4KHVA 3C3LA 4DNRB 4BWGB 2NVQH 1K8AC 3GTJB 2BA0A 3HOUH 3I4LA 1STGA 2B63H 2DNCA 3STBD 1J8IA 2KVMA 2WKDA 2UUAQ 3SVMA 2EYJA 4HIOA 4DR1L 5CV9A 5KNBA 3JAMc 1EY9A 2EXZA 2F0LA 1GM5A 3PSIA 3CPWA 1VMCA 2B2WA 2UXBL 3S16H 1SRUA 4DV1L 4DNTB 1LTAD 2EOTA 3GTOH 2L1BA 3TMEA 2IX1A 1CHPD 3C1EA 5I9OA 5C3EH 3GTQH 3S17H 3A54A 3S1MB 2L9HA 4LF7Q 4DV0Q 1TY2A 1CZGA 1N8RC 2ZXPA 3NENA 4LF9Q 1EOTA 1TT2A 3NUCA 3L0OA 1NBWA 3I56A 1TWFB 3GTGB 1YNNC 4YY3Q 4JBKA 2B2VC 3OW2A 3M7GA 1LLRD 5D3IB 1UEAB 3HOXG 2I5MX 1CSQA 2CWPA 2VS1A 4PMBA 5COYA 4R4CA 1K3RA 4CJ1B 1ENAA 2Z6KA 1SR3A 3DWAA 1I3QH 1V43A 3NQTA 4QIWE 1Q86C 2E2IH 4MNOA 1SNCA 5I4DA 3NEMA 1JE5A 4CKCA 2CCZA 1K0RA 1VQIA 2K5QA 1VQ6A 1ZYRC 3UDIA 3KBXA 1ZKOA 2CFMA 4CDCC 3CC4A 4A3BB 1IBML 1STBA 4AIMA 1RTNA 1XMQL 3QJYA 2AQ2B 4TVAB 2RHQB 3I4NH 5IY0A 3K58A 4LFCL 4CDDC 1HNZL 4RG1A 2PMZE 3P20A 2M00A 4HTHA 3J7YW 3FRPB 4PV1C 2IHEA 3X3MA 4AQYL 5JJKA 1MSHA 1KNAA 3J80L 1KL9A 1IBKQ 2K50A 2E5LL 3VA5A 3AEVA 1LT4D 1VQJA 2N8NA 3S1QH 3LNNA 3NP8A 4MHEA 4A3EH 4HMIA 5JJZA 4ID6A 1TU2B 3J80i 3SE0A 5E1FA 1RTOA 3KLSA 2KCNA 3WDNA 4C3JH 4QGUA 4PQXA 1NAPA 2FMMA 1ESFA 1XYIA 3D6WA 5CV5A 1K83B 4YCVA 2BA1A 3D31A 4DAVA 3KJPA 4Q0FA 4ILWA 2JA6H 1PFNA 1O7YA 1L0XB 4ULLA 4LFBQ 3EQLC 2RCFA 5FLXL 4F88A 3AB9A 5GADC 1TWGB 3K5NA 1A2UA 4GNXB 2E8GA 1DXMA 3D3RA 1KLUD 5M3FH 4MZ9A 1TVXA 2Y0SB 4R4TA 3I4MG 1X3EA 2B2VA 1M90C 4P75A 1TWAB 2F3VA 4AYBE 4WJWA 4RAUC 4ODGA 4IFDI 3EVQA 3PQIA 5FKAC 3A7AB 4HAEA 1SE4A 4JOIC 4DV0L 4FVMA 4KD4A 3U4ZA 4MN3A 1RIPA 3HOWH 5EPLA 5ELNA 3HKZG 1WFQA 1XTDA 4YY3L 3S1NH 4N8FA 1Y8OB 2WIIB 4HIKA 5JVG3 2EDGA 2NVYH 2NVTB 5DLQE 5C4XG 3W2DA 1IKMA 1G91A 2J0TD 1Q7YC 1A2TA 3H6MA 2AQ1B 1EZ6A 2LXKA 3KUPA 2K7VA 4WRDA 2NVQB 3HOUB 1LTID 2JEBI 2ZM6Q 1H95A 5ELBA 2B63B 2FHTA 4IPDA 4I7ZC 5IGCA 2SNSA 1EWCA 4F8MA 3GTKH 5IT9L 2N78A 1HA6A 5D65A 3OPOA 4YWKA 2ZTDA 2K32A 3EFXD 1PZJD 4LFAQ 2E2HH 5DEHA 5EJWA 4KKSA 2CH4A 1STHA 3UE1A 1PYWD 3Q22A 5IE8A 1RL2A 3CXCA 2F0JA 1EY4A 3S16B 1BBWA 2KEEA 4J6HA 3KLSX 4DK3C 3GTOB 4JI1L 1H9SA 1IBKL 4X62Q 3GTQB 3S17B 1C48A 4L5QA 3PF5A 1JJCB 1G51A 2NUCA 5M5WH 3GD7A 4ZKBB 1J5EQ 1A63A 3MHBA 3V96A 4NXMQ 1WTHA 4C3IG 2K5DA 4LUOA 3ND8A 3CC7A 5J1ZA 1PLFA 2NVXB 2EY5A 5FK9C 1HQRD 4DV4Q 3GP7A 2X6GA 1ZEQX 4JYAL 2K4KA 3S15H 1VF5C 1SDFA 2F0IA 1NY4A 2HCCA 1I4GA 3K80C 2BCOA 3R2IA 4C1NK 2F0PA
chains in the Genus database with same CATH topology
1NMFA 4C3IH 1VQ5A 2YV5A 3TS0A 2XGTA 1WI5A 2C35B 1JMCA 4LF5L 3GTPH 2HIXA 5AJ3Q 5GAGC 1N34L 1Y1VH 4A4IA 4LFBL 3GTMH 4MTNA 1PFSA 4IFDJ 1LYLA 3BJUA 1VQOA 1X6OA 2K75A 3S1RH 1VS0A 5LMNW 3KF6B 4PG3A 1X3GA 2JA6G 2WFWA 1GD7A 5C0XI 1YIJA 4DUZQ 3KYHC 4YHHQ 4JI7L 4LF8L 2R7ZG 3B6YA 3M4QA 4TQUS 4KHPL 3U58A 4DK6C 2UXCL 1X9NA 2A1AA 2OTJA 4OO1I 1VCIA 1SN8A 2OCEA 4IPHA 3RLFA 4LUVA 3GTJH 2OTLA 3M85A 3FP9A 2R7DA 4KI0A 5M3FG 4OX9Q 4IJHA 2MO1A 2WAQE 1UE5A 3ERSX 4OXPA 1VQ8A 4QY7A 2HHHL 2UUAL 4NXNQ 3PCOB 2D62A 3K7UC 5FLMG 1FGUA 4X65Q 2VW9A 4LFCQ 4R4QA 5IP7H 4A3GH 3F2DA 3PUXA 2PNHA 3S2DH 3ZJYC 1HR0Q 3PUZA 4LWCA 4APVA 1WCMH 4JBKA 1VQBA 3DM3A 2WB1G 1GO3E 1AH9A 4L5SA 2EIFA 1KAWA 4A3LG 1Q81C 1FL0A 1EYGA 2AKWB 2E5LQ 4B3MQ 1QUQB 1V9PA 3HOWG 4DV3Q 4JI8L 5IYBH 4BBRH 5FLMH 3U50C 1Q46A 3TQYA 2UUBQ 5JEAJ 4HJ8A 1CUKA 1TWCH 1IBLQ 2YYZA 3W1GA 4EQ5A 3T1YQ 4JI5Q 3LGJA 4DR6Q 2ZJRA 2UU9L 4LF7L 3S1MH 4LF4Q 2OQKA 1HNXQ 1CSPA 1NTGA 1OXUA 4C2MH 2VUMH 1L0WA 5C44G 1X56A 4DR2L 2JA7G 3L2PA 4A3IH 2RHSB 5FJ8G 2Q2HA 3TEHB 3KF8B 4GS3A 4LF9L 5JEAG 4QL5A 1YNXA 4Y52H 3KFUA 3GTGH 1TWFH 3HOYH 2E2JH 3S14H 5IWAL 3CCJA 2ZM6L 4DR5Q 1HZAA 5M5XH 4A3FG 3GO5A 1NMGA 1G291 1TWHH 5C44H 4C3HH 1QZGA 4GOPA 3PO3H 2QA4A 4GOPB 3HKZE 3I2ZA 3E9HA 2QGQA 2F4VL 2XTIA 1VQMA 1Q1EA 4GLXA 3ULPA 2ALYB 3CF5A 3PF4A 4J15A 3OTOL 3E0EA 1MKHA 4ME3A 1EFWA 5ELOA 5HGQA 4BY7H 1PHJA 5K36G 1OXSC 4A3CG 2AWOA 3KDFA 1IL2A 2L15A 1KHIA 2LXJA 4PZ7A 4YWMA 3RNUA 5BR8L 2NN6I 3E9IA 4GN5A 1XNQL 3L7ZC 2OWOA 1LTLA 1MIUA 3W5OA 1PYSB 1N9WA 1OTCA 4JI4Q 1VQHA 4A3BH 1MJEA 1X55A 4A76A 3RLOA 2VZAA 2NZHA 4NXML 1VQFA 4O2DA 4GNXC 1S40A 4EX5A 2H5XA 4IJLA 3J80c 2F3IA 2KBNA 2IT1A 4JI0Q 5C0XJ 4DV4L 1VQPA 1SFOH 3EN2A 4DV6L 2GVAA 1EUJA 2IX0A 1VQ9A 2FXQA 1KRTA 3PUVA 2K5HA 2KCTA 1PH1A 4DV3L 4POGA 4Y7NH 4KHZA 3H3VH 2N3SA 1UEBA 4YWLA 1B8AA 4LF6L 2QEXA 4ALPA 3EBEA 4KLKA 2JA5H 3H0GG 5AJ3L 4XTCS 1B7YB 4JBJA 1M1KC 2A19A 3CP0A 2IY5B 4OWTB 5JJLA 3GTLH 1EOVA 2KHIA 1Z47A 4A3KG 1UE7A 1S72A 3HFZB 1Y1VG 4YHHL 5LMUQ 1W2BA 2ZTCA 3M4PA 4A3JH 1PH8A 3HOXH 1K8GA 3CCQA 1E7ZA 1L2FA 3I4OA 1KRSA 1UE6A 3K7AH 2Z0SA 1YEZA 4DV2Q 5IYDH 3FHWA 5J3BA 1HZBA 5IP9G 1K83H 2R92G 2PQAA 4IPGA 1E1OA 2PQAB 4QQBX 4DV5Q 1YVCA 1L1OC 5EAYA 3BZKA 3PGZA 3CMAA 4A3KH 4GKKQ 4OWWB 3ER0A 4B3TL 3J7A5 3STBC 2AMCB 3M3YH 3AFQA 2MQHA 4PZ8A 2LSSA 1YBYA 4JOIA 4X65L 3CCLA 4A3DH 4RMFA 1VQNA 3M4OH 2ZJPA 1TWGH 1JT8A 5IP9H 1HR0L 2R92H 2DUDA 4L5TA 1HNWL 2ES2A 4IOCA 1X3FA 4LW1A 1EQQA 4JG2A 4UP9A 2JK8A 5IP7G 4JI1Q 4A3GG 2ZTEA 3NELA 3RN2A 4B3ML 3T1HL 4IFDG 1WCMG 1U5KA 3TREA 4YCUA 1N36L 1IBMQ 1TWAH 4OONA 3UE0A 1PVOA 1BVSA 3UDGA 1S3OA 1XMQQ 4X66Q 3T1YL 2Z6KC 4NB3A 3BZCA 5IYBG 4BBRG 1FJGL 4DR6L 2JQOA 3PO2G 1HNZQ 2UUCQ 3CCVA 1N32Q 2ID0A 5GAHC 3K81C 1NJIC 1VQ7A 1SROA 3KLWA 4UPAA 2CKZB 2B29A 3EIVA 2VQFL 1UWVA 5H1SE 1VQKA 3HOVH 4JYAQ 4AQYQ 1N33L 4WJ4A 3AFPA 4HJ7A 2MFIA 1CKOA 4O0AA 1XNRQ 2RF4A 2VUMG 3CW2C 4A93G 4BXXH 4GKJQ 4X64Q 1XJVA 5M3MH 3G6EA 4A3IG 4DR7L 4DR5L 4DR4Q 3A74A 1XPRA 4UY8C 3PO2H 1QVCA 1HR0W 3AQQA 2PI2A 1HZ9A 1OXXK 1UE1A 3HOUG 2NVTH 2WB1E 3HOYG 1PH4A 1P16A 4P71A 4DAMA 1K9MC 2VQEL 3CCUA 2YTVA 4DV7Q 1E1TA 2N49A 4A93H 1WJJA 4DR3Q 5IYCG 2CQOA 4GNXA 2JA8H 2EQSA 2R7FA 4AYBG 4JI7Q 3HOZG 3TS2A 3PO3G 3A5ZB 4LF8Q 2K5VA 3J81c 2NN6G 4KHPQ 5IT9c 2UXCQ 2K14A 3CMEA 2NVQH 3HOUH 1K8AC 2BA0A 4DUYL 2D0PA 2BH8A 4A3MH 2B63H 4BY7G 3STBD 5IYCH 1EIYB 3HOZH 2UUAQ 2D0OA 3CCSA 4HIOA 4LNQA 4DR1L 2UXDL 1A8VA 3JAMc 1PH5A 4LFAL 1YITA 5C3EG 3UDFA 1GM5A 4JI6L 1Q12A 2YU9H 4B3SL 2ATWA 3I4MH 3PSIA 3ULLA 4JBMA 4A3BG 4A75A 1IZ6A 1YHAA 3CPWA 4B3RL 2R93H 1NE3A 4IPCA 3UDXA 3KDFB 2UXBL 3S16H 1SRUA 2DGYA 4LUZA 4DV1L 2VY3A 3KJOA 3GTOH 3PIOA 4X62L 2IX1A 1BBUA 1B70B 1GKHA 5C3EH 3GTQH 3S17H 2AWNA 1VQ4A 1CKMA 2UU9Q 4LF7Q 1L1OA 1J5EL 4DV0Q 3F2BA 3CC2A 1IXRA 1SMXA 4K0KQ 2OQ0A 4DR2Q 4BA1I 1N8RC 3NENA 1OXVA 3CCRA 4HJ9A 1MJCA 2I5LX 3KOJA 2JA5G 4LF9Q 3TRZA 4UP7A 5GAEC 3L0OA 1PH3A 1NBWA 3I56A 4JI3L 4YY3Q 5C4XH 5LMUL 1VQGA 1AE2A 2I5HA 3I7FA 1PYBA 4P72A 3F1ZA 4PMWA 5IWAQ 3OW2A 1R9TH 1I94Q 1VQDA 4JV5Q 4JI2Q 2K5NA 4A3JG 3HOXG 2I5MX 1CSQA 2CWPA 2VS1A 5IYDG 1HH2P 4R1JA 4R4CA 2F4VQ 1K3RA 2A8VA 5C0XG 4IO9A 1PH7A 4GKKL 3SGIA 1PV4A 2Z6KA 3F2CA 1EWIA 3OTOQ 1SR3A 1I3QH 1V43A 4YCWA 3J81i 3K0XA 4OO1G 2KENA 5GQOA 4HJ5A 4QIWE 1Q86C 2E2IH 4BY1H 4MNOA 5M5YH 4DUZL 1PH2A 2HT1A 3NEMA 1JE5A 3I4NG 4BBSH 3S2HH 1JJ2A 1A62A 1K0RA 1VQIA 2R6GA 2CCZA 3CCMA 1XPOA 1VQ6A 3F8TA 1XMOQ 4A3DG 3UDIA 3K8AA 5JJIA 5FLXc 2CFMA 3NBHB 3W1BA 3CC4A 2VNUD 2KCMA 1KXLA 4OX9L 2PI2E 1IBML 2YTXA 3S24A 1ASZA 4AIMA 3PUWA 3JAMi 2Y0SG 1QZHA 1XMQL 4TVAB 3BU2A 4X66L 2RHQB 4NXNL 3I4NH 5IY0A 2JEAI 1I50H 1E22A 1Y14B 2WP8J 3CPFA 3GDEA 4LFCL 4RG1A 2MNAA 3A5UA 1HNZL 2UUCL 2PMZE 1XPUA 1N32L 3RN5A 1LUZA 1OXTA 1YHBA 3CAMA 2IHEA 4DV6Q 3WWVA 4AQYL 5JJKA 2IHFA 1A0IA 1FVIA 1KL9A 1TXYA 2GVBA 2K50A 5HY6A 1YHQA 4AH6A 1IBKQ 2E5LL 4LF6Q 4GKJL 5LMNQ 3AEVA 1V1QA 3HOVG 4DR4L 1VQJA 1W3SA 3G4SA 2N8NA 2UUBL 3S1QH 2F52A 2HQLA 1IBLL 4BXXG 1HZCA 5M3MG 4A3EH 4JI5L 3D0FA 3CCEA 4FDBA 3J80i 1LM0A 4LF4L 3KF6A 4DV7L 1HNXL 4C3JH 4QGUA 4DR3L 4DAYB 4JV5L 2WAQG 1SLJA 1YI2A 3AYHB 2YTYA 1E3PA 2GN5A 1KQSA 2JE6I 4P74A 4UP8A 1VQLA 4YCVA 2BA1A 4POFA 1Q8KA 3D31A 3KJPA 4LF5Q 2JA6H 1N34Q 1WOCA 4JC0A 1X65A 4B3TQ 2R7ZH 4LFBQ 1IYJB 4QJFA 2MO0A 4A3MG 4L5RC 2B63G 1C0AA 1P8LA 5GADC 4P73A 2Q2IA 3JC66 4GNXB 2E8GA 3RZDH 1HNWQ 5M3FH 4MZ9A 2CWAA 2ZJQA 4R4TA 1QUQA 3T1HQ 1PA6A 4GLVB 3I4MG 1X3EA 1M90C 4P75A 1Q82C 1N36Q 4AYBE 3IRBA 3RR5A 2HIVA 2R93G 1C7YA 2HHHQ 4JI4L 3G71A 4IFDI 1FJGQ 1HJPA 1SE8A 4JOIC 1YJWA 4DV0L 4DNIA 4A3LH 3Q8DA 1QVFA 4K0KL 1WYDA 3U4ZA 1RIPA 5E7NA 3HOWH 2VQFQ 1YJ9A 1PH6A 3I55A 1KD1C 1N33Q 1JJGA 1E24A 1VQCA 1O7IA 1D8LA 4PZ6A 5ELNA 4JI0L 3HKZG 1WFQA 2K52A 1XTDA 4YY3L 1ASYA 4JI8Q 2BH2A 4DR7Q 1AE3A 2V1CC 1I94L 1VQEA 3S1NH 2RCNA 4HIKA 4HIMA 2NVYH 1KIXA 4JI2L 1PH9A 5DLQE 2JA7H 5C4XG 4OWXB 1G6PA 3MXNB 5FJ8H 3M7NA 3OYYA 2VQEQ 4R4IA 1Q7YC 1L1OB 4HIDA 4HJAA 4JCVE 4DKAC 5C4JH 1YZ6A 3ULJA 3DLLA 2NVXH 1U0LA 2LXKA 4H02A 4A3FH 3J7ZC 4GN3B 4DPGA 1YJNA 1KC8C 4DUYQ 3PIPA 1T9HA 2JEBI 1J6QA 3J81j 2ZM6Q 1H95A 2KHJA 4IPDA 3RLNA 1XMOL 3VDYA 4DV2L 4JBWA 1K73C 1DGSA 1I6HH 4BY1G 3GTKH 4BBSG 2N78A 2VL6A 1Q1BA 3H15A 1Y1WG 4YWKA 2AHOB 2B3GA 1I5FA 4DV5L 2Q2TA 2ZTDA 4DR1Q 2UXDQ 3FKIG 4LFAQ 2EXDA 2E2HH 1Z9FA 2I0QA 3CD6A 4A3CH 3PV0A 3UE1A 4B3SQ 1VQAA 4JI6Q 4WJ3M 5IE8A 2ASBA 1RL2A 3CXCA 2JA9A 1EQRA 2JA8G 4B3RQ 3G48A 1X54A 3PUYA 1GVPA 1Y1WH 1JB7A 1BBWA 2Q2UA 3M9BA 2UXBQ 3CQZH 1CKNA 4DK3C 5BR8Q 4DV1Q 1CKNB 3FKIH 3HKSA 4JI1L 4NPSA 1BKBA 1IBKL 1XNQQ 4R4OA 4X62Q 1D7QA 5LMNL 4IOAA 4L5QA 4GOPC 3PF5A 1JJCB 1G51A 5M5WH 4GN4B 3GD7A 1J5EQ 1C9OA 4X6AH 1A63A 3A0JA 5GROA 3RZOH 4NXMQ 4GLAC 2NZOA 2JJQA 4BA2I 1EIFA 4LUOA 3CC7A 3U4VA 3ICEA 1QVGA 4XIGS 4DV4Q 3H3VI 4A3EG 4JI3Q 3MEFA 4JYAL 2K4KA 3S15H 2Y0SE 1NY4A 1XNRL 3K80C 3H0GH 4X64L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NMF A;  4C3I H;  1VQ5 A;  2YV5 A;  3TS0 A;  2XGT A;  1WI5 A;  2C35 B;  1JMC A;  4LF5 L;  3GTP H;  2HIX A;  5AJ3 Q;  5GAG C;  1N34 L;  1Y1V H;  4A4I A;  4LFB L;  3GTM H;  4MTN A;  1PFS A;  4IFD J;  1LYL A;  3BJU A;  1VQO A;  1X6O A;  2K75 A;  3S1R H;  1VS0 A;  5LMN W;  3KF6 B;  4PG3 A;  1X3G A;  2JA6 G;  2WFW A;  1GD7 A;  5C0X I;  1YIJ A;  4DUZ Q;  3KYH C;  4YHH Q;  4JI7 L;  4LF8 L;  2R7Z G;  3B6Y A;  3M4Q A;  4TQU S;  4KHP L;  3U58 A;  4DK6 C;  2UXC L;  1X9N A;  2A1A A;  2OTJ A;  4OO1 I;  1VCI A;  1SN8 A;  2OCE A;  4IPH A;  3RLF A;  4LUV A;  3GTJ H;  2OTL A;  3M85 A;  3FP9 A;  2R7D A;  4KI0 A;  5M3F G;  4OX9 Q;  4IJH A;  2MO1 A;  2WAQ E;  1UE5 A;  3ERS X;  4OXP A;  1VQ8 A;  4QY7 A;  2HHH L;  2UUA L;  4NXN Q;  3PCO B;  2D62 A;  3K7U C;  5FLM G;  1FGU A;  4X65 Q;  2VW9 A;  4LFC Q;  4R4Q A;  5IP7 H;  4A3G H;  3F2D A;  3PUX A;  2PNH A;  3S2D H;  3ZJY C;  1HR0 Q;  3PUZ A;  4LWC A;  4APV A;  1WCM H;  4JBK A;  1VQB A;  3DM3 A;  2WB1 G;  1GO3 E;  1AH9 A;  4L5S A;  2EIF A;  1KAW A;  4A3L G;  1Q81 C;  1FL0 A;  1EYG A;  2AKW B;  2E5L Q;  4B3M Q;  1QUQ B;  1V9P A;  3HOW G;  4DV3 Q;  4JI8 L;  5IYB H;  4BBR H;  5FLM H;  3U50 C;  1Q46 A;  3TQY A;  2UUB Q;  5JEA J;  4HJ8 A;  1CUK A;  1TWC H;  1IBL Q;  2YYZ A;  3W1G A;  4EQ5 A;  3T1Y Q;  4JI5 Q;  3LGJ A;  4DR6 Q;  2ZJR A;  2UU9 L;  4LF7 L;  3S1M H;  4LF4 Q;  2OQK A;  1HNX Q;  1CSP A;  1NTG A;  1OXU A;  4C2M H;  2VUM H;  1L0W A;  5C44 G;  1X56 A;  4DR2 L;  2JA7 G;  3L2P A;  4A3I H;  2RHS B;  5FJ8 G;  2Q2H A;  3TEH B;  3KF8 B;  4GS3 A;  4LF9 L;  5JEA G;  4QL5 A;  1YNX A;  4Y52 H;  3KFU A;  3GTG H;  1TWF H;  3HOY H;  2E2J H;  3S14 H;  5IWA L;  3CCJ A;  2ZM6 L;  4DR5 Q;  1HZA A;  5M5X H;  4A3F G;  3GO5 A;  1NMG A;  1G29 1;  1TWH H;  5C44 H;  4C3H H;  1QZG A;  4GOP A;  3PO3 H;  2QA4 A;  4GOP B;  3HKZ E;  3I2Z A;  3E9H A;  2QGQ A;  2F4V L;  2XTI A;  1VQM A;  1Q1E A;  4GLX A;  3ULP A;  2ALY B;  3CF5 A;  3PF4 A;  4J15 A;  3OTO L;  3E0E A;  1MKH A;  4ME3 A;  1EFW A;  5ELO A;  5HGQ A;  4BY7 H;  1PHJ A;  5K36 G;  1OXS C;  4A3C G;  2AWO A;  3KDF A;  1IL2 A;  2L15 A;  1KHI A;  2LXJ A;  4PZ7 A;  4YWM A;  3RNU A;  5BR8 L;  2NN6 I;  3E9I A;  4GN5 A;  1XNQ L;  3L7Z C;  2OWO A;  1LTL A;  1MIU A;  3W5O A;  1PYS B;  1N9W A;  1OTC A;  4JI4 Q;  1VQH A;  4A3B H;  1MJE A;  1X55 A;  4A76 A;  3RLO A;  2VZA A;  2NZH A;  4NXM L;  1VQF A;  4O2D A;  4GNX C;  1S40 A;  4EX5 A;  2H5X A;  4IJL A;  3J80 c;  2F3I A;  2KBN A;  2IT1 A;  4JI0 Q;  5C0X J;  4DV4 L;  1VQP A;  1SFO H;  3EN2 A;  4DV6 L;  2GVA A;  1EUJ A;  2IX0 A;  1VQ9 A;  2FXQ A;  1KRT A;  3PUV A;  2K5H A;  2KCT A;  1PH1 A;  4DV3 L;  4POG A;  4Y7N H;  4KHZ A;  3H3V H;  2N3S A;  1UEB A;  4YWL A;  1B8A A;  4LF6 L;  2QEX A;  4ALP A;  3EBE A;  4KLK A;  2JA5 H;  3H0G G;  5AJ3 L;  4XTC S;  1B7Y B;  4JBJ A;  1M1K C;  2A19 A;  3CP0 A;  2IY5 B;  4OWT B;  5JJL A;  3GTL H;  1EOV A;  2KHI A;  1Z47 A;  4A3K G;  1UE7 A;  1S72 A;  3HFZ B;  1Y1V G;  4YHH L;  5LMU Q;  1W2B A;  2ZTC A;  3M4P A;  4A3J H;  1PH8 A;  3HOX H;  1K8G A;  3CCQ A;  1E7Z A;  1L2F A;  3I4O A;  1KRS A;  1UE6 A;  3K7A H;  2Z0S A;  1YEZ A;  4DV2 Q;  5IYD H;  3FHW A;  5J3B A;  1HZB A;  5IP9 G;  1K83 H;  2R92 G;  2PQA A;  4IPG A;  1E1O A;  2PQA B;  4QQB X;  4DV5 Q;  1YVC A;  1L1O C;  5EAY A;  3BZK A;  3PGZ A;  3CMA A;  4A3K H;  4GKK Q;  4OWW B;  3ER0 A;  4B3T L;  3J7A 5;  3STB C;  2AMC B;  3M3Y H;  3AFQ A;  2MQH A;  4PZ8 A;  2LSS A;  1YBY A;  4JOI A;  4X65 L;  3CCL A;  4A3D H;  4RMF A;  1VQN A;  3M4O H;  2ZJP A;  1TWG H;  1JT8 A;  5IP9 H;  1HR0 L;  2R92 H;  2DUD A;  4L5T A;  1HNW L;  2ES2 A;  4IOC A;  1X3F A;  4LW1 A;  1EQQ A;  4JG2 A;  4UP9 A;  2JK8 A;  5IP7 G;  4JI1 Q;  4A3G G;  2ZTE A;  3NEL A;  3RN2 A;  4B3M L;  3T1H L;  4IFD G;  1WCM G;  1U5K A;  3TRE A;  4YCU A;  1N36 L;  1IBM Q;  1TWA H;  4OON A;  3UE0 A;  1PVO A;  1BVS A;  3UDG A;  1S3O A;  1XMQ Q;  4X66 Q;  3T1Y L;  2Z6K C;  4NB3 A;  3BZC A;  5IYB G;  4BBR G;  1FJG L;  4DR6 L;  2JQO A;  3PO2 G;  1HNZ Q;  2UUC Q;  3CCV A;  1N32 Q;  2ID0 A;  5GAH C;  3K81 C;  1NJI C;  1VQ7 A;  1SRO A;  3KLW A;  4UPA A;  2CKZ B;  2B29 A;  3EIV A;  2VQF L;  1UWV A;  5H1S E;  1VQK A;  3HOV H;  4JYA Q;  4AQY Q;  1N33 L;  4WJ4 A;  3AFP A;  4HJ7 A;  2MFI A;  1CKO A;  4O0A A;  1XNR Q;  2RF4 A;  2VUM G;  3CW2 C;  4A93 G;  4BXX H;  4GKJ Q;  4X64 Q;  1XJV A;  5M3M H;  3G6E A;  4A3I G;  4DR7 L;  4DR5 L;  4DR4 Q;  3A74 A;  1XPR A;  4UY8 C;  3PO2 H;  1QVC A;  1HR0 W;  3AQQ A;  2PI2 A;  1HZ9 A;  1OXX K;  1UE1 A;  3HOU G;  2NVT H;  2WB1 E;  3HOY G;  1PH4 A;  1P16 A;  4P71 A;  4DAM A;  1K9M C;  2VQE L;  3CCU A;  2YTV A;  4DV7 Q;  1E1T A;  2N49 A;  4A93 H;  1WJJ A;  4DR3 Q;  5IYC G;  2CQO A;  4GNX A;  2JA8 H;  2EQS A;  2R7F A;  4AYB G;  4JI7 Q;  3HOZ G;  3TS2 A;  3PO3 G;  3A5Z B;  4LF8 Q;  2K5V A;  3J81 c;  2NN6 G;  4KHP Q;  5IT9 c;  2UXC Q;  2K14 A;  3CME A;  2NVQ H;  3HOU H;  1K8A C;  2BA0 A;  4DUY L;  2D0P A;  2BH8 A;  4A3M H;  2B63 H;  4BY7 G;  3STB D;  5IYC H;  1EIY B;  3HOZ H;  2UUA Q;  2D0O A;  3CCS A;  4HIO A;  4LNQ A;  4DR1 L;  2UXD L;  1A8V A;  3JAM c;  1PH5 A;  4LFA L;  1YIT A;  5C3E G;  3UDF A;  1GM5 A;  4JI6 L;  1Q12 A;  2YU9 H;  4B3S L;  2ATW A;  3I4M H;  3PSI A;  3ULL A;  4JBM A;  4A3B G;  4A75 A;  1IZ6 A;  1YHA A;  3CPW A;  4B3R L;  2R93 H;  1NE3 A;  4IPC A;  3UDX A;  3KDF B;  2UXB L;  3S16 H;  1SRU A;  2DGY A;  4LUZ A;  4DV1 L;  2VY3 A;  3KJO A;  3GTO H;  3PIO A;  4X62 L;  2IX1 A;  1BBU A;  1B70 B;  1GKH A;  5C3E H;  3GTQ H;  3S17 H;  2AWN A;  1VQ4 A;  1CKM A;  2UU9 Q;  4LF7 Q;  1L1O A;  1J5E L;  4DV0 Q;  3F2B A;  3CC2 A;  1IXR A;  1SMX A;  4K0K Q;  2OQ0 A;  4DR2 Q;  4BA1 I;  1N8R C;  3NEN A;  1OXV A;  3CCR A;  4HJ9 A;  1MJC A;  2I5L X;  3KOJ A;  2JA5 G;  4LF9 Q;  3TRZ A;  4UP7 A;  5GAE C;  3L0O A;  1PH3 A;  1NBW A;  3I56 A;  4JI3 L;  4YY3 Q;  5C4X H;  5LMU L;  1VQG A;  1AE2 A;  2I5H A;  3I7F A;  1PYB A;  4P72 A;  3F1Z A;  4PMW A;  5IWA Q;  3OW2 A;  1R9T H;  1I94 Q;  1VQD A;  4JV5 Q;  4JI2 Q;  2K5N A;  4A3J G;  3HOX G;  2I5M X;  1CSQ A;  2CWP A;  2VS1 A;  5IYD G;  1HH2 P;  4R1J A;  4R4C A;  2F4V Q;  1K3R A;  2A8V A;  5C0X G;  4IO9 A;  1PH7 A;  4GKK L;  3SGI A;  1PV4 A;  2Z6K A;  3F2C A;  1EWI A;  3OTO Q;  1SR3 A;  1I3Q H;  1V43 A;  4YCW A;  3J81 i;  3K0X A;  4OO1 G;  2KEN A;  5GQO A;  4HJ5 A;  4QIW E;  1Q86 C;  2E2I H;  4BY1 H;  4MNO A;  5M5Y H;  4DUZ L;  1PH2 A;  2HT1 A;  3NEM A;  1JE5 A;  3I4N G;  4BBS H;  3S2H H;  1JJ2 A;  1A62 A;  1K0R A;  1VQI A;  2R6G A;  2CCZ A;  3CCM A;  1XPO A;  1VQ6 A;  3F8T A;  1XMO Q;  4A3D G;  3UDI A;  3K8A A;  5JJI A;  5FLX c;  2CFM A;  3NBH B;  3W1B A;  3CC4 A;  2VNU D;  2KCM A;  1KXL A;  4OX9 L;  2PI2 E;  1IBM L;  2YTX A;  3S24 A;  1ASZ A;  4AIM A;  3PUW A;  3JAM i;  2Y0S G;  1QZH A;  1XMQ L;  4TVA B;  3BU2 A;  4X66 L;  2RHQ B;  4NXN L;  3I4N H;  5IY0 A;  2JEA I;  1I50 H;  1E22 A;  1Y14 B;  2WP8 J;  3CPF A;  3GDE A;  4LFC L;  4RG1 A;  2MNA A;  3A5U A;  1HNZ L;  2UUC L;  2PMZ E;  1XPU A;  1N32 L;  3RN5 A;  1LUZ A;  1OXT A;  1YHB A;  3CAM A;  2IHE A;  4DV6 Q;  3WWV A;  4AQY L;  5JJK A;  2IHF A;  1A0I A;  1FVI A;  1KL9 A;  1TXY A;  2GVB A;  2K50 A;  5HY6 A;  1YHQ A;  4AH6 A;  1IBK Q;  2E5L L;  4LF6 Q;  4GKJ L;  5LMN Q;  3AEV A;  1V1Q A;  3HOV G;  4DR4 L;  1VQJ A;  1W3S A;  3G4S A;  2N8N A;  2UUB L;  3S1Q H;  2F52 A;  2HQL A;  1IBL L;  4BXX G;  1HZC A;  5M3M G;  4A3E H;  4JI5 L;  3D0F A;  3CCE A;  4FDB A;  3J80 i;  1LM0 A;  4LF4 L;  3KF6 A;  4DV7 L;  1HNX L;  4C3J H;  4QGU A;  4DR3 L;  4DAY B;  4JV5 L;  2WAQ G;  1SLJ A;  1YI2 A;  3AYH B;  2YTY A;  1E3P A;  2GN5 A;  1KQS A;  2JE6 I;  4P74 A;  4UP8 A;  1VQL A;  4YCV A;  2BA1 A;  4POF A;  1Q8K A;  3D31 A;  3KJP A;  4LF5 Q;  2JA6 H;  1N34 Q;  1WOC A;  4JC0 A;  1X65 A;  4B3T Q;  2R7Z H;  4LFB Q;  1IYJ B;  4QJF A;  2MO0 A;  4A3M G;  4L5R C;  2B63 G;  1C0A A;  1P8L A;  5GAD C;  4P73 A;  2Q2I A;  3JC6 6;  4GNX B;  2E8G A;  3RZD H;  1HNW Q;  5M3F H;  4MZ9 A;  2CWA A;  2ZJQ A;  4R4T A;  1QUQ A;  3T1H Q;  1PA6 A;  4GLV B;  3I4M G;  1X3E A;  1M90 C;  4P75 A;  1Q82 C;  1N36 Q;  4AYB E;  3IRB A;  3RR5 A;  2HIV A;  2R93 G;  1C7Y A;  2HHH Q;  4JI4 L;  3G71 A;  4IFD I;  1FJG Q;  1HJP A;  1SE8 A;  4JOI C;  1YJW A;  4DV0 L;  4DNI A;  4A3L H;  3Q8D A;  1QVF A;  4K0K L;  1WYD A;  3U4Z A;  1RIP A;  5E7N A;  3HOW H;  2VQF Q;  1YJ9 A;  1PH6 A;  3I55 A;  1KD1 C;  1N33 Q;  1JJG A;  1E24 A;  1VQC A;  1O7I A;  1D8L A;  4PZ6 A;  5ELN A;  4JI0 L;  3HKZ G;  1WFQ A;  2K52 A;  1XTD A;  4YY3 L;  1ASY A;  4JI8 Q;  2BH2 A;  4DR7 Q;  1AE3 A;  2V1C C;  1I94 L;  1VQE A;  3S1N H;  2RCN A;  4HIK A;  4HIM A;  2NVY H;  1KIX A;  4JI2 L;  1PH9 A;  5DLQ E;  2JA7 H;  5C4X G;  4OWX B;  1G6P A;  3MXN B;  5FJ8 H;  3M7N A;  3OYY A;  2VQE Q;  4R4I A;  1Q7Y C;  1L1O B;  4HID A;  4HJA A;  4JCV E;  4DKA C;  5C4J H;  1YZ6 A;  3ULJ A;  3DLL A;  2NVX H;  1U0L A;  2LXK A;  4H02 A;  4A3F H;  3J7Z C;  4GN3 B;  4DPG A;  1YJN A;  1KC8 C;  4DUY Q;  3PIP A;  1T9H A;  2JEB I;  1J6Q A;  3J81 j;  2ZM6 Q;  1H95 A;  2KHJ A;  4IPD A;  3RLN A;  1XMO L;  3VDY A;  4DV2 L;  4JBW A;  1K73 C;  1DGS A;  1I6H H;  4BY1 G;  3GTK H;  4BBS G;  2N78 A;  2VL6 A;  1Q1B A;  3H15 A;  1Y1W G;  4YWK A;  2AHO B;  2B3G A;  1I5F A;  4DV5 L;  2Q2T A;  2ZTD A;  4DR1 Q;  2UXD Q;  3FKI G;  4LFA Q;  2EXD A;  2E2H H;  1Z9F A;  2I0Q A;  3CD6 A;  4A3C H;  3PV0 A;  3UE1 A;  4B3S Q;  1VQA A;  4JI6 Q;  4WJ3 M;  5IE8 A;  2ASB A;  1RL2 A;  3CXC A;  2JA9 A;  1EQR A;  2JA8 G;  4B3R Q;  3G48 A;  1X54 A;  3PUY A;  1GVP A;  1Y1W H;  1JB7 A;  1BBW A;  2Q2U A;  3M9B A;  2UXB Q;  3CQZ H;  1CKN A;  4DK3 C;  5BR8 Q;  4DV1 Q;  1CKN B;  3FKI H;  3HKS A;  4JI1 L;  4NPS A;  1BKB A;  1IBK L;  1XNQ Q;  4R4O A;  4X62 Q;  1D7Q A;  5LMN L;  4IOA A;  4L5Q A;  4GOP C;  3PF5 A;  1JJC B;  1G51 A;  5M5W H;  4GN4 B;  3GD7 A;  1J5E Q;  1C9O A;  4X6A H;  1A63 A;  3A0J A;  5GRO A;  3RZO H;  4NXM Q;  4GLA C;  2NZO A;  2JJQ A;  4BA2 I;  1EIF A;  4LUO A;  3CC7 A;  3U4V A;  3ICE A;  1QVG A;  4XIG S;  4DV4 Q;  3H3V I;  4A3E G;  4JI3 Q;  3MEF A;  4JYA L;  2K4K A;  3S15 H;  2Y0S E;  1NY4 A;  1XNR L;  3K80 C;  3H0G H;  4X64 L; 
#chains in the Genus database with same CATH topology
 1CHQ D;  4X3T A;  2C35 B;  4XT1 B;  5KYL A;  3GTP H;  1LTR D;  2HIX A;  5GAG C;  1HPC A;  4LFB L;  1QG7 A;  1I3Q B;  3NK9 A;  1X3G A;  2E2I B;  2OF1 A;  2CHB D;  2R7Z G;  1QNU A;  4G7H C;  3B6Y A;  1STN A;  3U58 A;  1X9N A;  1WTV A;  1GJX A;  4RA8 A;  4OO1 I;  4IAL A;  3RLF A;  1HUM A;  1FD7 D;  3M85 A;  3ERS X;  1QWY A;  1BCP B;  1VQ8 A;  4QY7 A;  4NXN Q;  2EJM A;  1LAB A;  3K7U C;  5FLM G;  1FGU A;  3EJI A;  2VW9 A;  1HHV A;  4CJ0 B;  3MA2 B;  2F0M A;  3VYS A;  4RFB A;  3DM3 A;  4ZRZ A;  4L5S A;  1TQO A;  1FL0 A;  2WV6 D;  4QUC A;  4B3M Q;  1M4V A;  3U50 C;  3EA6 A;  3S1Q B;  4HJ8 A;  5AFW A;  1CUK A;  4KD3 A;  1TWC H;  3QR8 A;  5A35 A;  4A3E B;  4EQ5 A;  1RJT A;  4JI5 Q;  4DR6 Q;  4C3J B;  2FMC A;  2VUM H;  1L0W A;  5C44 G;  2JA7 G;  1TS3 A;  2A69 C;  4UAI A;  3KF8 A;  4GS3 A;  5BN5 A;  3NBI A;  3KFU A;  2X69 A;  2E2J H;  3CCJ A;  2ZM6 L;  1HQM C;  1AN8 A;  2EE1 A;  2JA6 B;  1STY A;  4DK1 A;  1G29 1;  4C3H H;  4FXD A;  1IKL A;  1DON A;  3HKZ E;  2CW0 D;  3QO2 A;  3E9H A;  2XTI A;  2EYO A;  4OHJ A;  4GLX A;  1G6Z A;  2GA4 B;  3BVZ A;  3FVQ A;  5M3F B;  5ELO A;  1Z6H A;  1A15 A;  2L15 A;  2LXJ A;  1DOK A;  4IUV A;  2A74 C;  4GN5 A;  3V2T A;  1BNZ A;  1N9W A;  4JI4 Q;  1GHK A;  2WB1 B;  1X55 A;  1F77 A;  3LWE A;  4K5W A;  4NXM L;  1VQF A;  3HOW B;  1QJO A;  4PNY A;  4C1N I;  2K1B A;  4QB4 A;  2IT1 A;  1DM0 B;  4EQP A;  4DV4 L;  1SFO H;  4DV6 L;  2GVA A;  1EUJ A;  2D9U A;  2EYH A;  3PUV A;  2KCT A;  3LX0 A;  2NVY B;  4DV3 L;  4Y7N H;  2N3S A;  1B8A A;  2QEX A;  4ALP A;  1GUW A;  3EBE A;  4KLK A;  1H9J A;  4JBJ A;  3CP0 A;  4OGQ C;  2DJF C;  1ICF B;  3ZYY X;  4ZCK A;  1XXG A;  3HS0 C;  5LMU Q;  4A3J H;  1EEI D;  2Z1C A;  1E7Z A;  5IYD H;  4DV2 Q;  5C0X H;  3IL8 A;  3GTK B;  5IP9 G;  2XWJ B;  2X6L A;  2R92 G;  2PQA A;  1EWH A;  2F0T A;  3PIO 3;  4QQB X;  3VR5 A;  5EAY A;  2E2H B;  4A3K H;  4QF4 A;  4B3T L;  3ND9 A;  3STB C;  2AMC B;  3AFQ A;  2SNM A;  3BDC A;  2LSS A;  5TSS A;  2F0O A;  4RMF A;  1VQN A;  3M4O H;  1XWE A;  1H9K A;  2EY6 A;  2ES2 A;  3K6O A;  2I46 A;  1E0B A;  1KDB A;  3QOL A;  3RN2 A;  5E4W C;  1WVL A;  3K5O A;  4B3M L;  4IFD G;  1U5K A;  5M5W B;  3LWU A;  1N36 L;  1SE2 A;  3UE0 A;  3IAY A;  1PVO A;  4PMC A;  1S3O A;  4NB3 A;  3BZC A;  4DR6 L;  2PW7 A;  1R4P B;  2XVS A;  2QDB A;  1O78 A;  1IYV A;  2CKZ B;  3RD4 A;  1U4R A;  3S15 B;  1EZ8 A;  5E4X A;  2MFI A;  1MHW C;  2PZW A;  3GV3 A;  2MPM A;  4BXX H;  4GKJ Q;  4X64 Q;  3QB3 A;  5M3M H;  4DR7 L;  1EQT A;  1QVC A;  1HR0 W;  2CH4 W;  3V05 A;  3GTP B;  1UE1 A;  3HOU G;  4DXG A;  3HOY G;  1K9M C;  2EZV A;  4DXF A;  1EYC A;  3CCU A;  3DXJ C;  4DV7 Q;  2N49 A;  1B2T A;  1LO5 D;  1F9P A;  3TS2 A;  4LAA A;  3A5Z B;  5KYI A;  2UXC Q;  3CME A;  4RHS A;  4N8X 1;  4G57 A;  3TBI B;  2BH8 A;  4BY7 G;  1KLG D;  1BOS A;  1EIY B;  2EPB A;  2D0O A;  1CM9 A;  2NN6 H;  1UNS A;  1PH5 A;  1YIT A;  5C3E G;  4JI6 L;  4B3S L;  3BS1 A;  4JBM A;  2LKV A;  1WTQ A;  4FF3 A;  1IZ6 A;  4FF2 A;  5LL6 X;  2R93 H;  4IPC A;  1SAP A;  1TWC B;  1VQ4 A;  2KEC A;  4IUQ A;  2VUM B;  3F2B A;  1IXR A;  2RSO A;  4DR2 Q;  4BA1 I;  4ZLT F;  2JA5 G;  4KY5 A;  4UP7 A;  5GAE C;  1PH3 A;  1D5M C;  2RSN A;  2E2J B;  5LMU L;  3FDT A;  4KTA A;  2I5H A;  1JJ2 A;  1R9T H;  4IUN A;  3T4A C;  1DZ1 A;  5HGT A;  2A69 D;  2RKS A;  3Q24 A;  2IX3 A;  1PV4 A;  1Q90 A;  5IGE A;  1EWI A;  3FEW X;  1PTO D;  4OO1 G;  4M8A A;  1DCZ A;  1EIG A;  1IL8 A;  2L12 A;  3NWS A;  4BY1 H;  4DUZ L;  4BBS H;  3S2H H;  3I4N G;  1A62 A;  2R6G A;  4A3D G;  1B50 A;  3F8T A;  2QDL A;  3AMU A;  5FLX c;  4OX9 L;  2PI2 E;  1EU4 A;  3PUW A;  1IYU A;  4F87 A;  3BU2 A;  1C8C A;  3U9O A;  2XRS D;  3BYT B;  1Y14 B;  3GDE A;  3A5U A;  1XPU A;  4I7A A;  1SFO B;  1KDA A;  1OXT A;  1SNO A;  4ME5 A;  4ZUI A;  1Y8N B;  1F2M A;  4Y7N B;  1FVI A;  1TXY A;  2F0Q A;  2GVB A;  3PIP 3;  5E3F A;  4GKJ L;  1VMP A;  5LMN Q;  1HXY D;  3HOV G;  1V1Q A;  1W3S A;  2EY2 A;  5D3D A;  5C4Z A;  3G4S A;  2F0H A;  4K2L A;  3OMG A;  1F9Q A;  1IBL L;  5KRU A;  4QCL A;  4G4K A;  1RD9 D;  3I72 A;  4FDB A;  1LM0 A;  4LF4 L;  2R3Z A;  3KF6 A;  4DV7 L;  4DAY A;  5I2Y A;  4A3J B;  4WOR A;  2L4N A;  1BBX C;  1V8Q A;  5C3W A;  2YTY A;  3Q23 A;  2GN5 A;  1KQS A;  4P74 A;  4POF A;  1KAB A;  4LF5 Q;  1H9M A;  1O7L A;  4EGV A;  4JC0 A;  4K2K A;  1IYJ B;  2MO0 A;  4A3M G;  4L5R C;  5BN3 A;  3NXW A;  3M4O B;  4NKL A;  4CKE A;  3JC6 6;  1DOL A;  1F2L A;  1HNW Q;  1ZXT A;  1JCK B;  5IOC A;  1GUT A;  1ET9 A;  1CQV A;  5KNC A;  2PQE A;  3MZ5 A;  2F3W A;  3IRB A;  1B9N A;  1MI2 A;  2MP1 A;  1NR2 A;  3G71 A;  1FJG Q;  1HJP A;  1SE8 A;  4MIU A;  5IGD A;  2A6H C;  4A3L H;  3Q8D A;  4L6T B;  1QVF A;  4V0B A;  5E7N A;  1L0Y B;  1QCB D;  1PH6 A;  1KD1 C;  4NP5 A;  1E24 A;  4PZ6 A;  4JI0 L;  5M3M B;  2F4I A;  1AE3 A;  1EY6 A;  2NZ1 D;  2F03 A;  2KCC A;  2JXM B;  2WAQ B;  4OWX B;  1G6P A;  3A8J E;  5FJ8 H;  4KV6 A;  4FNF A;  1ILP A;  2VQE Q;  5JEA H;  1L1O B;  3M4Y A;  2NVX H;  3J7Z C;  4DPG A;  1ENC A;  1KC8 C;  4DUY Q;  1VDZ A;  2NWG A;  5FOB B;  2L11 A;  4LMQ D;  2VL6 A;  1Q1B A;  3R3O A;  4DV5 L;  2UXD Q;  5K36 H;  4RGM A;  2I0Q A;  2ENB A;  2BOS A;  2QCP X;  2ASB A;  3C46 A;  1HCZ A;  2JA8 G;  2R93 B;  3CRK C;  4B3R Q;  1E2W A;  3ITP A;  1X54 A;  1GVP A;  1ONL A;  5EKL A;  3M9B A;  3CQZ H;  3HKS A;  4NPS A;  1XNQ Q;  4FO2 A;  2HUG A;  5LMN L;  1AZP A;  2L55 A;  4GN4 B;  1DYQ A;  5GRO A;  4GLA C;  4RHR A;  1EL0 A;  2JJQ A;  2HQE A;  1FR3 A;  1IW7 D;  1I6V C;  1JIC A;  3U4V A;  3ICE A;  3ONA B;  4XIG S;  3H3V I;  4JI3 Q;  1R9T B;  1XNR L;  1I6H B;  3KBG A;  3H0G H;  2IPK D;  3DEP A;  3MFG A;  4IUP A;  4IZ8 A;  1VQ5 A;  4TKO B;  2XGT A;  4LF5 L;  5AJ3 Q;  1TS5 A;  4TSS A;  2F0U A;  1Y1V H;  5ELF A;  4A4I A;  1DD2 A;  4N9T A;  4K5V A;  1GXD C;  1K0S A;  3BJU A;  1X6O A;  1VS0 A;  4K8J A;  3D6C A;  4PG3 A;  4BY1 B;  3H09 A;  4BBS B;  3S2H B;  2CW0 C;  4JI7 L;  1Y1W B;  4KHP L;  5CV7 A;  2F0K A;  4OIJ A;  3K0Y A;  2N55 A;  2R7D A;  4KI0 A;  1PTO F;  4OXP A;  4L63 B;  2UUA L;  2KQ3 A;  2RBM A;  3SDZ A;  4R4Q A;  4A3G H;  1IHZ A;  3F2D A;  1JQY D;  2MJ8 A;  3S2D H;  1WCM H;  1VQB A;  1FYC A;  2EIF A;  1KAW A;  4NMZ A;  1Q81 C;  3I91 A;  2AKW B;  1QUQ B;  4TRD A;  5IYB H;  4BBR H;  2UUB Q;  1F9S A;  1GUS A;  1TII D;  3T1Y Q;  3MTS A;  4FP5 D;  2ZJR A;  4LF7 L;  2OQK A;  1HNX Q;  3BVG A;  3DWP A;  1D5X C;  2BDO A;  5EPJ A;  4C3H G;  1X56 A;  5ELD A;  4A3I H;  2RHS B;  2Q2H A;  3KF8 B;  4LF9 L;  3NQI A;  3H3V C;  4Y52 H;  3S14 H;  1SYF A;  5CC4 A;  4JPB W;  1SEB D;  3HZX A;  4C56 C;  5M5X H;  4HCS A;  4A3F G;  1ML0 D;  1QZG A;  3G6J B;  3E0J A;  1BF4 A;  3PO3 H;  2VB2 X;  3SEB A;  3OSO A;  1I4R A;  1Q1E A;  1D6E C;  1LTB D;  3E0E A;  3A56 A;  4CHT B;  2F0E A;  5HGQ A;  1LTT D;  1OXS C;  3TZU A;  4A3C G;  1IL2 A;  1KHI A;  4PZ7 A;  5C3X A;  5JPM C;  4K6L A;  1XNQ L;  3L7Z C;  4CDF C;  1JR0 D;  4Q5V A;  5G3L D;  3SK4 A;  1V1P A;  2QIL A;  1VQH A;  3I70 A;  4KKT A;  1MJE A;  1A3U A;  3RLO A;  2VZA A;  2K33 A;  2O5J C;  4O2D A;  4GNX C;  1I4H A;  1E2Z A;  4IJL A;  2FFK B;  1YNJ C;  2KBN A;  5C0X J;  1O80 A;  3EN2 A;  4XT3 B;  2NB0 A;  1VQ9 A;  1KRT A;  2K5H A;  2D2C C;  1TWH B;  2A6H D;  2O5I C;  2O4X A;  1FNW A;  3ERQ A;  5AJ3 L;  4XTC S;  1M1K C;  2IY5 B;  1EYA A;  3ERO A;  4OWT B;  5JJL A;  1A6X A;  1B4O A;  4A3K G;  2C9O A;  3HFZ B;  3M4P A;  3HOX H;  5EBD A;  1L2F A;  3K7A H;  1KRS A;  1UE6 A;  5J3B A;  5DNF A;  1HZB A;  4IPG A;  2PQA B;  3NWT A;  3PGZ A;  4OWW B;  3M3Y H;  3BDO A;  3CCL A;  4JOI A;  1YBY A;  1I4P A;  1JT8 A;  4ZAI A;  1OO9 B;  3CQZ B;  4IOC A;  2Z4H A;  1X3F A;  4LW1 A;  5IP7 G;  2PZT A;  2ZTE A;  1G2S A;  3D4D A;  1S5D D;  2XSC A;  1S5E D;  1LT5 D;  4IN3 A;  4ZK9 B;  4OEL B;  3T1Y L;  2NTS A;  2B8G A;  4K14 A;  5IGF A;  1HTL D;  2UUC Q;  3H94 A;  3CCV A;  3QOJ A;  5GAH C;  3Q6S A;  5LHY 1;  1SYD A;  1VQ7 A;  3KLW A;  3NSW A;  4UPA A;  3EIV A;  2B29 A;  4QIW B;  4WJ4 A;  3H91 A;  3CW2 C;  3H0G B;  5DAU A;  1SMY C;  3G6E A;  5CMD A;  3A74 A;  2G9D A;  2PI2 A;  1T5E A;  1Y1V B;  4DAM A;  4P71 A;  1SND A;  1F2Z A;  1JOO A;  2AQ3 B;  3MAQ A;  4DR3 Q;  3F2U A;  4JK1 C;  5JAV A;  4GNX A;  2R7F A;  4LF8 Q;  4ZUJ A;  1WTR A;  2NN6 G;  1PTO C;  2PYK A;  2DNE A;  2E2D C;  3C2P A;  5EPK A;  2D0P A;  3KLR A;  1NR4 A;  4J8Q A;  2L0C A;  4IQZ A;  3CCS A;  3TP5 A;  4A3G B;  1A8V A;  4RGT A;  4LFA L;  2B2T C;  3S2D B;  1I4Q A;  1B3A A;  1MD2 D;  3UDF A;  1WCM B;  3I4M H;  4A3B G;  3HP3 A;  1YHA A;  5A2Q E;  5EKK A;  3KDF B;  4BBR B;  3NPP A;  4LUZ A;  2DGY A;  2LFN A;  3GQB A;  5NUC A;  1KNE A;  4X62 L;  1GKH A;  3CHB D;  2QF7 A;  1SSO A;  1CKM A;  2UU9 Q;  3VR6 A;  1J5E L;  5ISR A;  4A3I B;  2RDH A;  1OXV A;  3KOJ A;  1EQV A;  3S14 B;  5C4X H;  1VQG A;  1AE2 A;  3I7F A;  5IWA Q;  1PYB A;  4P72 A;  1PRT B;  3F1Z A;  5M5X B;  1I94 Q;  4KJO A;  5IOD A;  4AYB B;  2K5N A;  2Q8I B;  3PO3 B;  5COR A;  1HH2 P;  2F4V Q;  3VA7 A;  5HUR A;  3SGI A;  2WAC A;  2H1E A;  3OTO Q;  4RCO A;  4YCW A;  2KEN A;  5GQO A;  1PH2 A;  4EVO A;  3T16 A;  2HDM A;  3CCM A;  1XPO A;  5JJI A;  1XMO Q;  3I90 A;  4UHV A;  3NBH A;  2B2Y C;  4YIJ A;  2VNU D;  1MSG A;  2PW5 A;  1Y8P B;  2YTX A;  2KUM A;  1SNM A;  2Y0S G;  1QZH A;  3Q0A A;  4NXN L;  1JC7 A;  4G7O C;  2XNA C;  4OL7 A;  2JEA I;  2EYL A;  2OXP A;  2WP8 J;  2UUC L;  3CPF A;  1JB3 A;  2EYM A;  2FIN B;  1LUZ A;  2PZU A;  3RN5 A;  1YHB A;  1II3 A;  2OT2 A;  1EY0 A;  5G3L F;  2JN4 A;  1F2Y A;  2IHF A;  3GV6 A;  5HY6 A;  1YHQ A;  4AH6 A;  4LF6 Q;  4H44 C;  1R4Q B;  1KDC A;  4DF7 A;  2HQL A;  2E76 C;  2K03 A;  1YNJ D;  1CT1 D;  4JI5 L;  3DHQ A;  4RGN A;  2B2T A;  2F0G A;  4DR3 L;  4DAY B;  5M5Y B;  1GHJ A;  2SDF A;  3HOX B;  1SLJ A;  3K7A B;  1YI2 A;  3AYH B;  1E3P A;  2JE6 I;  3FPP A;  4KJN A;  2K28 A;  1Z7T A;  1CA6 A;  1N34 Q;  1WOC A;  4CDE C;  1X65 A;  2R7Z H;  3M3Y B;  4QJF A;  4WFN 3;  2B63 G;  1C0A A;  4P73 A;  1O7Z A;  4G7Z C;  3RZD H;  2DJG C;  4V19 0;  1XTC D;  4XQN A;  3HEJ A;  2ZJQ A;  1SXT A;  2A5H A;  1WTP A;  5EQ0 A;  2FJ2 A;  3T1H Q;  1PA6 A;  2HIV A;  1K8M A;  3DEO A;  3SK8 A;  4JI4 L;  4RKL A;  1FNV A;  4DNI A;  1WYD A;  1DOM A;  4IUT A;  2VQF Q;  1YJ9 A;  3I55 A;  1JJG A;  1HA5 A;  1N33 Q;  2PNR C;  1JOR A;  1IW7 C;  2K52 A;  1ASY A;  1I94 L;  1TS2 A;  1KIX A;  1SYB A;  2JA7 H;  1STE A;  3TN2 A;  2B2Y A;  3IKJ A;  3MXN A;  1SJE D;  1CTM A;  1FGB D;  4XXE A;  1K8O A;  3N6R A;  4HID A;  4DKA C;  5C4J H;  1PZI D;  3S9W A;  1EYD A;  1HTP A;  1A3V A;  4H02 A;  2Q8T A;  1SMY D;  2L5T A;  2LY7 A;  1J6Q A;  3J81 j;  5ELC A;  2KHJ A;  2QKI C;  2H4O A;  1Q8I A;  1XMO L;  3VDY A;  4DV2 L;  1I6H H;  1DGS A;  2AHO B;  1I5F A;  4DR1 Q;  1PXU A;  2EXD A;  2G5D A;  3CD6 A;  1KAA A;  3PV0 A;  3I4M B;  4WJ3 M;  1D2B A;  3VR4 A;  1TS4 A;  2JA9 A;  4S3S A;  3SK5 A;  3PUY A;  3K5L A;  1WTO A;  1Y1W H;  2UXB Q;  2Q2U A;  3VR3 A;  4DV1 Q;  1CKN A;  1ASZ A;  5BR8 Q;  3FKI H;  2SEB D;  5FO9 B;  2R61 A;  5IIF A;  3HRZ C;  4GOP C;  1TR5 A;  1GOZ A;  3A0J A;  3HKZ B;  2NZO A;  3MFY A;  4A3E G;  4ZQ3 A;  5C4X B;  1BCP D;  3R2T A;  2Y0S E;  3P1H A;  4C3J G;  4FXK C;  1NNX A;  5CV8 A;  4X64 L;  1ILQ A;  4CGY B;  1EEF D;  1WI5 A;  1AZQ A;  2JSO A;  1JMC A;  1N34 L;  4FYD A;  3GTM H;  1U9R A;  4MTN A;  2EVB A;  2K75 A;  1GUG A;  2JA6 G;  5C0X I;  1YIJ A;  2PCF B;  2K01 A;  5LL6 S;  2UXC L;  1CK1 A;  5BN4 A;  3K57 A;  2I07 B;  3W3A A;  5A2Q L;  1SN8 A;  2OTL A;  2OTJ A;  4LUV A;  3URY A;  1CQF A;  2QW7 A;  1GUO A;  5M3F G;  4GZY C;  2RVL A;  5DM7 3;  2A68 D;  3PCO B;  3UI2 A;  3E6Z X;  4X65 Q;  4LFC Q;  3JAM E;  4IUU A;  2KHS A;  3ZJY C;  1HR0 Q;  2Z8L A;  3PUZ A;  4LWC A;  4IFD H;  1U4P A;  3DUZ A;  2WB1 G;  1JWS D;  1AH9 A;  1EYG A;  1EU3 A;  3L3O C;  2E5L Q;  1V9P A;  2K04 A;  3HOW G;  4C3I B;  1KTK A;  2F0D A;  1QE6 A;  1Q46 A;  4XYO A;  2YYZ A;  4X3U A;  1B44 D;  3TDQ A;  1CSP A;  1NTG A;  1OXU A;  4C2M H;  3T51 B;  3QG1 A;  4DR2 L;  3QWN A;  3L2P A;  3TEH B;  1YNX A;  5K5P A;  1SNP A;  4F7X A;  3HOY H;  3SR1 A;  4JW0 A;  4DR5 Q;  1HZA A;  2JP1 A;  3GO5 A;  4KKU A;  1TWH H;  4E6I A;  4NDX A;  4QUF A;  2R7Z B;  4GOP A;  3FMC A;  4KK7 A;  5FO8 B;  1STA A;  2VB3 X;  3I2Z A;  1EFI D;  3ULP A;  1PRT D;  2ALY B;  4Z9C B;  2MUY A;  4J15 A;  3RZD B;  2F0S A;  1RDP D;  3KK7 A;  4EQO A;  4BY7 H;  4FXG C;  1PHJ A;  4KN7 C;  2AWO A;  1BDO A;  3O13 A;  1XX8 A;  3RNU A;  2IJ0 A;  4K5X A;  5BR8 L;  2NN6 I;  3RMH A;  1TKW B;  2OWO A;  1F9R A;  2EJF C;  1LTL A;  1MIU A;  3W5O A;  1OTC A;  4DA2 A;  1V1P B;  4A76 A;  4OEM B;  2NZH A;  1UUP A;  4EX5 A;  2H5X A;  3R93 A;  2F3I A;  4HCE A;  5KGU A;  3P75 A;  2IX0 A;  1E2V A;  2FXQ A;  4POG A;  4DU9 A;  1H9S B;  5J39 A;  5C44 B;  1PTO H;  1S5C D;  4FF1 A;  2JA7 B;  4HED A;  1MGS A;  5FO7 B;  2JA5 H;  1JWU D;  5C4J B;  1SJH D;  4HMJ A;  3GTL H;  1QNK A;  3NTK A;  2KHI A;  3WOF A;  1S72 A;  3AU7 A;  5CV4 A;  1X3Q A;  3I73 A;  1LAC A;  2B39 A;  2XWB B;  1K8G A;  2RDF A;  1YEZ A;  3FHW A;  3U9S A;  4HR7 B;  3D8G A;  1L1O C;  4OO1 H;  4GKK Q;  1WD1 A;  3TP6 A;  2G9H D;  2MQH A;  4PZ8 A;  4X65 L;  4BS9 A;  4A3D H;  4J1M A;  1SE3 A;  1HR0 L;  1HNW L;  4L5T A;  1QIL A;  3FKI B;  1EQQ A;  4JG2 A;  2JK8 A;  4JI1 Q;  4U67 3;  4O1N A;  1HFG A;  1HRJ A;  5EBC A;  4U68 A;  3R8B A;  1BVS A;  3UDG A;  4X66 Q;  3OHX C;  1FJG L;  2JQO A;  5M9O A;  1N32 Q;  1NJI C;  4KY7 A;  3T56 B;  3HOV H;  4JYA Q;  3AFP A;  4HJ7 A;  4O0A A;  1CKO A;  2RF4 A;  2VUM G;  4UDU C;  3PMF A;  4DR5 L;  4DR4 Q;  3PO2 H;  1RCV D;  1HZ9 A;  2KJX A;  2RDG A;  2WB1 E;  3GTM B;  1P16 A;  2E75 C;  2F0W A;  2RA4 A;  2Z9H A;  1GUN A;  1RHP A;  2A6E D;  2VQE L;  1E1T A;  1BCP F;  1WJJ A;  3MXG A;  4I65 A;  4A93 H;  3K59 A;  4JV5 Q;  2R92 B;  1ICW A;  2K14 A;  3A8K E;  1Y69 U;  2ZXO A;  4DUY L;  4DGZ A;  3J7A F;  3BG3 A;  4A3M H;  5IYC H;  2EYF A;  4QMG A;  3HOZ H;  1B9M A;  1D1I A;  4N9P A;  4LNQ A;  2UXD L;  1I4X A;  3FPU B;  2ATW A;  1Q12 A;  2YU9 H;  1PZK D;  3ULL A;  4A75 A;  3CU7 A;  3DWQ A;  4B3R L;  5CYU A;  2ICE C;  1SNQ A;  1NE3 A;  3UDX A;  2VY3 A;  3WOE A;  3KJO A;  4CKB A;  4DK0 A;  3PIO A;  1ROD A;  4CBV A;  1BBU A;  1B70 B;  4H7B A;  4LJZ C;  2D5D A;  2AWN A;  3P7J A;  2F0F A;  1L1O A;  4C2M B;  3CC2 A;  2EY1 A;  1Q3L A;  1SMX A;  4K0K Q;  2OQ0 A;  4L8J A;  3CCR A;  1MJC A;  2I5L X;  3TRZ A;  1JE4 A;  3OIP A;  3HOY B;  3RUZ A;  2AUJ D;  4JI3 L;  4HJ9 A;  4PMW A;  1PDQ A;  1VQD A;  4XYQ A;  3NTH A;  4X3S A;  4JI2 Q;  3J81 L;  4A3J G;  1K28 A;  3CRL C;  1LT3 D;  5IYD G;  4R1J A;  4ZYS A;  2A8V A;  5C0X G;  4IO9 A;  1PH7 A;  2HD3 A;  4GKK L;  3HG9 A;  3F2C A;  3TZD A;  5C4H A;  4ABN A;  4BY7 B;  3J81 i;  3K0X A;  4HJ5 A;  2HT1 A;  5M5Y H;  3JAM L;  5CGK A;  1LTS D;  3K8A A;  2RQX A;  3E3X A;  5C3E B;  2EJG C;  1WTX A;  1PRT F;  3NBH B;  3W1B A;  4XQJ A;  2KCM A;  1KXL A;  2M2L A;  1BQQ T;  3S24 A;  2JA8 H;  3JAM i;  2IL8 A;  3DM1 A;  4X66 L;  1CI3 M;  1QB5 D;  1I50 H;  1E22 A;  2ICI A;  1N32 L;  2MNA A;  1K3B C;  3OMC A;  3CAM A;  5I9P A;  4DV6 Q;  3WWV A;  3OWF A;  3N52 A;  1A0I A;  1PTO B;  1SYE A;  4DR4 L;  2JA5 B;  3A7L A;  2UUB L;  2F52 A;  1X32 A;  3T53 B;  1BR9 A;  4BXX G;  2EYP A;  1HZC A;  3TP7 A;  5M3M G;  3D0F A;  3GTL B;  1HUN A;  3CCE A;  1EY5 A;  2K05 A;  1YNN D;  1HNX L;  3T13 A;  4JV5 L;  1S5B D;  2WAQ G;  2J7Z A;  5T1G A;  4B9X A;  2NYZ D;  3OW7 A;  1VQL A;  4UP8 A;  2HDL A;  2KOL A;  4MTK A;  2N88 A;  1Q8K A;  2TSS A;  3NHH A;  4XQQ A;  2PO4 A;  3I4N B;  4B3T Q;  1AFP A;  1QOH A;  4A3D B;  5F2D A;  3VYU A;  1P8L A;  3MEH A;  2Q2I A;  2PMZ B;  4DFA A;  1ZYR D;  5JOB A;  2CWA A;  1UAP A;  2O2L D;  1QUQ A;  4GLV B;  5JVH 3;  1Q82 C;  1N36 Q;  1G2T A;  3RR5 A;  5DM6 3;  1JOK A;  2R93 G;  1C7Y A;  3MC0 B;  2HHH Q;  4K8I A;  1U4L A;  4LK1 C;  4IUR A;  1YJW A;  2HCI A;  1DJR D;  3MVV A;  1FNU A;  4K0K L;  3HOV B;  2JYO A;  2NBF A;  1VQC A;  1O7I A;  4RCN A;  2DN8 A;  1D8L A;  2Q8R E;  3OOC A;  4JI8 Q;  2BH2 A;  4DR7 Q;  4H13 C;  3PO2 B;  2V1C C;  1VQE A;  1LTG D;  2RCN A;  4R8I A;  4HIM A;  1BCP C;  4JI2 L;  1PH9 A;  3MXN B;  3M7N A;  3OYY A;  2SOB A;  4R4I A;  4A93 B;  4HJA A;  4JCV E;  1ENF A;  1YZ6 A;  1RKN A;  3ULJ A;  3DLL A;  1U0L A;  4A3F H;  2DY7 A;  4GN3 B;  3E5S A;  1YJN A;  3PIP A;  1T9H A;  3I8Z A;  4A3M B;  3RLN A;  1K73 C;  4JBW A;  3HOZ B;  4BY1 G;  1TY0 A;  4BBS G;  1EIH A;  4KN4 C;  3OIQ A;  3H15 A;  1Y1W G;  2B3G A;  2Q2T A;  2BE5 C;  3FKI G;  4A3C H;  1B3Q A;  1Z9F A;  2IW3 A;  2YU9 B;  3D4R A;  4JI6 Q;  3D4W A;  1BO0 A;  1VQA A;  4B3S Q;  3SK6 A;  5KND A;  4RKB A;  2A68 C;  1CA5 A;  1EQR A;  2V4D A;  3G48 A;  2WIN B;  3BVM A;  5L37 A;  1JB7 A;  3S1N B;  1W6J A;  1CKN B;  3VYR A;  1WD0 A;  1BKB A;  4R4O A;  2XN9 C;  1D7Q A;  5I6W A;  5IGB A;  4IOA A;  5CBE E;  1C4Q A;  1C9O A;  4X6A H;  1H9R A;  3RZO H;  1S5F D;  3J7A V;  4FF4 A;  4BA2 I;  1EIF A;  1QVG A;  3MEF A;  2M9V A;  2PPB C;  3OWE B;  5J22 A;  1NMF A;  3BYY B;  4C3I H;  1MBY A;  2YV5 A;  3TS0 A;  5I6Y A;  3NTI A;  2F0V A;  1PFS A;  4IFD J;  1LYL A;  1VQO A;  3S1R H;  4OIK A;  5LMN W;  3KF6 B;  2MHV A;  2WFW A;  1GD7 A;  4DUZ Q;  3KYH C;  1SYG A;  4YHH Q;  4LF8 L;  1PRT C;  3M4Q A;  4TQU S;  4DK6 C;  1PMR A;  5CV6 A;  2A1A A;  3HGB A;  1JWM D;  1VCI A;  2OCE A;  4IPH A;  5CR3 A;  3GTJ H;  3MXP A;  3FP9 A;  3CKI B;  4OX9 Q;  4RH6 A;  4HSV A;  2E74 C;  2MO1 A;  1UE5 A;  2WAQ E;  4IJH A;  2J4X A;  3C1F A;  2JA8 B;  1D5Z C;  2HHH L;  5KEE A;  1ET6 A;  2D62 A;  1M8A A;  1I50 B;  4NW2 A;  4O42 A;  2IWH A;  4K6D A;  5IP7 H;  1AP0 A;  3PUX A;  2PNH A;  2KED A;  2OEO A;  3DMU A;  1NSN S;  2XRQ D;  4APV A;  1B1Z A;  4B9W A;  1GO3 E;  2VXW A;  4A3L G;  4HN7 A;  5EGT A;  4DV3 Q;  4JI8 L;  5FLM H;  3TQY A;  3MWY W;  5JEA J;  1IBL Q;  3W1G A;  2XIW A;  3LGJ A;  2UU9 L;  3S1M H;  4LF4 Q;  1U4M A;  5EKI A;  3SHL A;  5JPN C;  5FJ8 G;  3J80 E;  1NUC A;  5JEA G;  2ZXR A;  4QL5 A;  4M1U B;  3GTG H;  1TWF H;  5IWA L;  2QEJ C;  4RGO S;  4DN4 M;  1PFB A;  1NMG A;  5C44 H;  3K5M A;  1D1K A;  2QA4 A;  5C5L A;  2NTT A;  5T1I A;  4GOP B;  2QGQ A;  2F4V L;  1VQM A;  1LT6 D;  3G7L A;  3CF5 A;  3PF4 A;  5IGG A;  3OTO L;  1MKH A;  2TMP A;  4ME3 A;  1EFW A;  5K36 G;  2CQA A;  3KDF A;  2MGS A;  2KA7 A;  4YWM A;  1AEX A;  4JVZ A;  4KY6 A;  1VF7 A;  3E9I A;  4XDX A;  5FLX E;  1PYS B;  1SBB B;  4A3B H;  4DAP A;  2B2U C;  3A55 A;  4P2C B;  3I3C A;  1S40 A;  2WKC A;  4KMU C;  3J80 c;  4B08 A;  1NCV A;  1B53 A;  2F1M A;  3BDL A;  4JI0 Q;  3QIA A;  1X3P A;  1VQP A;  1PFM A;  3VYT A;  1PH1 A;  4KHZ A;  1AW7 A;  4YWL A;  1UEB A;  4C3H B;  4LF6 L;  3H3V H;  5KIX A;  1W6K A;  1WTW A;  2DY8 A;  3H0G G;  1B7Y B;  2A19 A;  4A3F B;  1G8Z D;  1EOV A;  1Z47 A;  1UE7 A;  2A6E C;  3SXH A;  1Y1V G;  4YHH L;  1W2B A;  2ZTC A;  2B2W C;  2B8F A;  1PH8 A;  4R8N A;  3CCQ A;  3I4O A;  4RWS C;  3BZD B;  4X3K A;  2Z0S A;  5C5M A;  5I2X A;  1K83 H;  4H0L C;  1E1O A;  2AUK A;  4DV5 Q;  2C5C A;  1YVC A;  2Z6B A;  3BZK A;  1CFM A;  3CMA A;  3ER0 A;  5CBA E;  3L9A X;  3J7A 5;  4EQN A;  2LS0 1;  5ELE A;  2CVR A;  2ZJP A;  1TWG H;  2LMC B;  1EY7 A;  5IP9 H;  2R92 H;  2DUD A;  3IFT A;  5D14 A;  3TSS A;  4UP9 A;  3J81 E;  4A3G G;  5IT9 E;  5C6A A;  3IFD A;  3NEL A;  2BE5 D;  3T1H L;  1WCM G;  3TRE A;  2F0N A;  4HSP A;  2ZT9 C;  4YCU A;  3TP8 A;  1S4Z A;  1TWA H;  4OON A;  4ZKC B;  1IBM Q;  2A73 B;  3RZO B;  3VR2 A;  1XMQ Q;  2P5Z X;  2Z6K C;  5IYB G;  4BBR G;  3MXU A;  3PO2 G;  1HNZ Q;  1J9O A;  2ID0 A;  3K81 C;  1SRO A;  2BDN A;  2VQF L;  1VQK A;  1UWV A;  3NE5 B;  5H1S E;  4AQY Q;  1N33 L;  1A3T A;  1XNR Q;  1RF2 D;  4A93 G;  3X3N A;  1ESR A;  2K5W A;  1XJV A;  4A3I G;  1V1O A;  1SYC A;  1XPR A;  4UY8 C;  1CZW A;  1EY8 A;  3AQQ A;  1OXX K;  4A3K B;  2NVT H;  1T5X D;  1PH4 A;  1HFN A;  4R9W A;  1JOQ A;  3S1R B;  2B2U A;  2YTV A;  2K6A A;  1LV9 A;  2Z4I A;  5IYC G;  2CQO A;  3HOZ G;  2EQS A;  4AYB G;  1BXT A;  4JI7 Q;  3PO3 G;  2K5V A;  3A8I E;  4CJ2 C;  1BUV T;  3J81 c;  4KHP Q;  5IT9 c;  4KHV A;  3C3L A;  4DNR B;  4BWG B;  2NVQ H;  1K8A C;  3GTJ B;  2BA0 A;  3HOU H;  3I4L A;  1STG A;  2B63 H;  2DNC A;  3STB D;  1J8I A;  2KVM A;  2WKD A;  2UUA Q;  3SVM A;  2EYJ A;  4HIO A;  4DR1 L;  5CV9 A;  5KNB A;  3JAM c;  1EY9 A;  2EXZ A;  2F0L A;  1GM5 A;  3PSI A;  3CPW A;  1VMC A;  2B2W A;  2UXB L;  3S16 H;  1SRU A;  4DV1 L;  4DNT B;  1LTA D;  2EOT A;  3GTO H;  2L1B A;  3TME A;  2IX1 A;  1CHP D;  3C1E A;  5I9O A;  5C3E H;  3GTQ H;  3S17 H;  3A54 A;  3S1M B;  2L9H A;  4LF7 Q;  4DV0 Q;  1TY2 A;  1CZG A;  1N8R C;  2ZXP A;  3NEN A;  4LF9 Q;  1EOT A;  1TT2 A;  3NUC A;  3L0O A;  1NBW A;  3I56 A;  1TWF B;  3GTG B;  1YNN C;  4YY3 Q;  4JBK A;  2B2V C;  3OW2 A;  3M7G A;  1LLR D;  5D3I B;  1UEA B;  3HOX G;  2I5M X;  1CSQ A;  2CWP A;  2VS1 A;  4PMB A;  5COY A;  4R4C A;  1K3R A;  4CJ1 B;  1ENA A;  2Z6K A;  1SR3 A;  3DWA A;  1I3Q H;  1V43 A;  3NQT A;  4QIW E;  1Q86 C;  2E2I H;  4MNO A;  1SNC A;  5I4D A;  3NEM A;  1JE5 A;  4CKC A;  2CCZ A;  1K0R A;  1VQI A;  2K5Q A;  1VQ6 A;  1ZYR C;  3UDI A;  3KBX A;  1ZKO A;  2CFM A;  4CDC C;  3CC4 A;  4A3B B;  1IBM L;  1STB A;  4AIM A;  1RTN A;  1XMQ L;  3QJY A;  2AQ2 B;  4TVA B;  2RHQ B;  3I4N H;  5IY0 A;  3K58 A;  4LFC L;  4CDD C;  1HNZ L;  4RG1 A;  2PMZ E;  3P20 A;  2M00 A;  4HTH A;  3J7Y W;  3FRP B;  4PV1 C;  2IHE A;  3X3M A;  4AQY L;  5JJK A;  1MSH A;  1KNA A;  3J80 L;  1KL9 A;  1IBK Q;  2K50 A;  2E5L L;  3VA5 A;  3AEV A;  1LT4 D;  1VQJ A;  2N8N A;  3S1Q H;  3LNN A;  3NP8 A;  4MHE A;  4A3E H;  4HMI A;  5JJZ A;  4ID6 A;  1TU2 B;  3J80 i;  3SE0 A;  5E1F A;  1RTO A;  3KLS A;  2KCN A;  3WDN A;  4C3J H;  4QGU A;  4PQX A;  1NAP A;  2FMM A;  1ESF A;  1XYI A;  3D6W A;  5CV5 A;  1K83 B;  4YCV A;  2BA1 A;  3D31 A;  4DAV A;  3KJP A;  4Q0F A;  4ILW A;  2JA6 H;  1PFN A;  1O7Y A;  1L0X B;  4ULL A;  4LFB Q;  3EQL C;  2RCF A;  5FLX L;  4F88 A;  3AB9 A;  5GAD C;  1TWG B;  3K5N A;  1A2U A;  4GNX B;  2E8G A;  1DXM A;  3D3R A;  1KLU D;  5M3F H;  4MZ9 A;  1TVX A;  2Y0S B;  4R4T A;  3I4M G;  1X3E A;  2B2V A;  1M90 C;  4P75 A;  1TWA B;  2F3V A;  4AYB E;  4WJW A;  4RAU C;  4ODG A;  4IFD I;  3EVQ A;  3PQI A;  5FKA C;  3A7A B;  4HAE A;  1SE4 A;  4JOI C;  4DV0 L;  4FVM A;  4KD4 A;  3U4Z A;  4MN3 A;  1RIP A;  3HOW H;  5EPL A;  5ELN A;  3HKZ G;  1WFQ A;  1XTD A;  4YY3 L;  3S1N H;  4N8F A;  1Y8O B;  2WII B;  4HIK A;  5JVG 3;  2EDG A;  2NVY H;  2NVT B;  5DLQ E;  5C4X G;  3W2D A;  1IKM A;  1G91 A;  2J0T D;  1Q7Y C;  1A2T A;  3H6M A;  2AQ1 B;  1EZ6 A;  2LXK A;  3KUP A;  2K7V A;  4WRD A;  2NVQ B;  3HOU B;  1LTI D;  2JEB I;  2ZM6 Q;  1H95 A;  5ELB A;  2B63 B;  2FHT A;  4IPD A;  4I7Z C;  5IGC A;  2SNS A;  1EWC A;  4F8M A;  3GTK H;  5IT9 L;  2N78 A;  1HA6 A;  5D65 A;  3OPO A;  4YWK A;  2ZTD A;  2K32 A;  3EFX D;  1PZJ D;  4LFA Q;  2E2H H;  5DEH A;  5EJW A;  4KKS A;  2CH4 A;  1STH A;  3UE1 A;  1PYW D;  3Q22 A;  5IE8 A;  1RL2 A;  3CXC A;  2F0J A;  1EY4 A;  3S16 B;  1BBW A;  2KEE A;  4J6H A;  3KLS X;  4DK3 C;  3GTO B;  4JI1 L;  1H9S A;  1IBK L;  4X62 Q;  3GTQ B;  3S17 B;  1C48 A;  4L5Q A;  3PF5 A;  1JJC B;  1G51 A;  2NUC A;  5M5W H;  3GD7 A;  4ZKB B;  1J5E Q;  1A63 A;  3MHB A;  3V96 A;  4NXM Q;  1WTH A;  4C3I G;  2K5D A;  4LUO A;  3ND8 A;  3CC7 A;  5J1Z A;  1PLF A;  2NVX B;  2EY5 A;  5FK9 C;  1HQR D;  4DV4 Q;  3GP7 A;  2X6G A;  1ZEQ X;  4JYA L;  2K4K A;  3S15 H;  1VF5 C;  1SDF A;  2F0I A;  1NY4 A;  2HCC A;  1I4G A;  3K80 C;  2BCO A;  3R2I A;  4C1N K;  2F0P A; 
#chains in the Genus database with same CATH homology
 1NMF A;  4C3I H;  1VQ5 A;  2YV5 A;  3TS0 A;  2XGT A;  1WI5 A;  2C35 B;  1JMC A;  4LF5 L;  3GTP H;  2HIX A;  5AJ3 Q;  5GAG C;  1N34 L;  1Y1V H;  4A4I A;  4LFB L;  3GTM H;  4MTN A;  1PFS A;  4IFD J;  1LYL A;  3BJU A;  1VQO A;  1X6O A;  2K75 A;  3S1R H;  1VS0 A;  5LMN W;  3KF6 B;  4PG3 A;  1X3G A;  2JA6 G;  2WFW A;  1GD7 A;  5C0X I;  1YIJ A;  4DUZ Q;  3KYH C;  4YHH Q;  4JI7 L;  4LF8 L;  2R7Z G;  3B6Y A;  3M4Q A;  4TQU S;  4KHP L;  3U58 A;  4DK6 C;  2UXC L;  1X9N A;  2A1A A;  2OTJ A;  4OO1 I;  1VCI A;  1SN8 A;  2OCE A;  4IPH A;  3RLF A;  4LUV A;  3GTJ H;  2OTL A;  3M85 A;  3FP9 A;  2R7D A;  4KI0 A;  5M3F G;  4OX9 Q;  4IJH A;  2MO1 A;  2WAQ E;  1UE5 A;  3ERS X;  4OXP A;  1VQ8 A;  4QY7 A;  2HHH L;  2UUA L;  4NXN Q;  3PCO B;  2D62 A;  3K7U C;  5FLM G;  1FGU A;  4X65 Q;  2VW9 A;  4LFC Q;  4R4Q A;  5IP7 H;  4A3G H;  3F2D A;  3PUX A;  2PNH A;  3S2D H;  3ZJY C;  1HR0 Q;  3PUZ A;  4LWC A;  4APV A;  1WCM H;  4JBK A;  1VQB A;  3DM3 A;  2WB1 G;  1GO3 E;  1AH9 A;  4L5S A;  2EIF A;  1KAW A;  4A3L G;  1Q81 C;  1FL0 A;  1EYG A;  2AKW B;  2E5L Q;  4B3M Q;  1QUQ B;  1V9P A;  3HOW G;  4DV3 Q;  4JI8 L;  5IYB H;  4BBR H;  5FLM H;  3U50 C;  1Q46 A;  3TQY A;  2UUB Q;  5JEA J;  4HJ8 A;  1CUK A;  1TWC H;  1IBL Q;  2YYZ A;  3W1G A;  4EQ5 A;  3T1Y Q;  4JI5 Q;  3LGJ A;  4DR6 Q;  2ZJR A;  2UU9 L;  4LF7 L;  3S1M H;  4LF4 Q;  2OQK A;  1HNX Q;  1CSP A;  1NTG A;  1OXU A;  4C2M H;  2VUM H;  1L0W A;  5C44 G;  1X56 A;  4DR2 L;  2JA7 G;  3L2P A;  4A3I H;  2RHS B;  5FJ8 G;  2Q2H A;  3TEH B;  3KF8 B;  4GS3 A;  4LF9 L;  5JEA G;  4QL5 A;  1YNX A;  4Y52 H;  3KFU A;  3GTG H;  1TWF H;  3HOY H;  2E2J H;  3S14 H;  5IWA L;  3CCJ A;  2ZM6 L;  4DR5 Q;  1HZA A;  5M5X H;  4A3F G;  3GO5 A;  1NMG A;  1G29 1;  1TWH H;  5C44 H;  4C3H H;  1QZG A;  4GOP A;  3PO3 H;  2QA4 A;  4GOP B;  3HKZ E;  3I2Z A;  3E9H A;  2QGQ A;  2F4V L;  2XTI A;  1VQM A;  1Q1E A;  4GLX A;  3ULP A;  2ALY B;  3CF5 A;  3PF4 A;  4J15 A;  3OTO L;  3E0E A;  1MKH A;  4ME3 A;  1EFW A;  5ELO A;  5HGQ A;  4BY7 H;  1PHJ A;  5K36 G;  1OXS C;  4A3C G;  2AWO A;  3KDF A;  1IL2 A;  2L15 A;  1KHI A;  2LXJ A;  4PZ7 A;  4YWM A;  3RNU A;  5BR8 L;  2NN6 I;  3E9I A;  4GN5 A;  1XNQ L;  3L7Z C;  2OWO A;  1LTL A;  1MIU A;  3W5O A;  1PYS B;  1N9W A;  1OTC A;  4JI4 Q;  1VQH A;  4A3B H;  1MJE A;  1X55 A;  4A76 A;  3RLO A;  2VZA A;  2NZH A;  4NXM L;  1VQF A;  4O2D A;  4GNX C;  1S40 A;  4EX5 A;  2H5X A;  4IJL A;  3J80 c;  2F3I A;  2KBN A;  2IT1 A;  4JI0 Q;  5C0X J;  4DV4 L;  1VQP A;  1SFO H;  3EN2 A;  4DV6 L;  2GVA A;  1EUJ A;  2IX0 A;  1VQ9 A;  2FXQ A;  1KRT A;  3PUV A;  2K5H A;  2KCT A;  1PH1 A;  4DV3 L;  4POG A;  4Y7N H;  4KHZ A;  3H3V H;  2N3S A;  1UEB A;  4YWL A;  1B8A A;  4LF6 L;  2QEX A;  4ALP A;  3EBE A;  4KLK A;  2JA5 H;  3H0G G;  5AJ3 L;  4XTC S;  1B7Y B;  4JBJ A;  1M1K C;  2A19 A;  3CP0 A;  2IY5 B;  4OWT B;  5JJL A;  3GTL H;  1EOV A;  2KHI A;  1Z47 A;  4A3K G;  1UE7 A;  1S72 A;  3HFZ B;  1Y1V G;  4YHH L;  5LMU Q;  1W2B A;  2ZTC A;  3M4P A;  4A3J H;  1PH8 A;  3HOX H;  1K8G A;  3CCQ A;  1E7Z A;  1L2F A;  3I4O A;  1KRS A;  1UE6 A;  3K7A H;  2Z0S A;  1YEZ A;  4DV2 Q;  5IYD H;  3FHW A;  5J3B A;  1HZB A;  5IP9 G;  1K83 H;  2R92 G;  2PQA A;  4IPG A;  1E1O A;  2PQA B;  4QQB X;  4DV5 Q;  1YVC A;  1L1O C;  5EAY A;  3BZK A;  3PGZ A;  3CMA A;  4A3K H;  4GKK Q;  4OWW B;  3ER0 A;  4B3T L;  3J7A 5;  3STB C;  2AMC B;  3M3Y H;  3AFQ A;  2MQH A;  4PZ8 A;  2LSS A;  1YBY A;  4JOI A;  4X65 L;  3CCL A;  4A3D H;  4RMF A;  1VQN A;  3M4O H;  2ZJP A;  1TWG H;  1JT8 A;  5IP9 H;  1HR0 L;  2R92 H;  2DUD A;  4L5T A;  1HNW L;  2ES2 A;  4IOC A;  1X3F A;  4LW1 A;  1EQQ A;  4JG2 A;  4UP9 A;  2JK8 A;  5IP7 G;  4JI1 Q;  4A3G G;  2ZTE A;  3NEL A;  3RN2 A;  4B3M L;  3T1H L;  4IFD G;  1WCM G;  1U5K A;  3TRE A;  4YCU A;  1N36 L;  1IBM Q;  1TWA H;  4OON A;  3UE0 A;  1PVO A;  1BVS A;  3UDG A;  1S3O A;  1XMQ Q;  4X66 Q;  3T1Y L;  2Z6K C;  4NB3 A;  3BZC A;  5IYB G;  4BBR G;  1FJG L;  4DR6 L;  2JQO A;  3PO2 G;  1HNZ Q;  2UUC Q;  3CCV A;  1N32 Q;  2ID0 A;  5GAH C;  3K81 C;  1NJI C;  1VQ7 A;  1SRO A;  3KLW A;  4UPA A;  2CKZ B;  2B29 A;  3EIV A;  2VQF L;  1UWV A;  5H1S E;  1VQK A;  3HOV H;  4JYA Q;  4AQY Q;  1N33 L;  4WJ4 A;  3AFP A;  4HJ7 A;  2MFI A;  1CKO A;  4O0A A;  1XNR Q;  2RF4 A;  2VUM G;  3CW2 C;  4A93 G;  4BXX H;  4GKJ Q;  4X64 Q;  1XJV A;  5M3M H;  3G6E A;  4A3I G;  4DR7 L;  4DR5 L;  4DR4 Q;  3A74 A;  1XPR A;  4UY8 C;  3PO2 H;  1QVC A;  1HR0 W;  3AQQ A;  2PI2 A;  1HZ9 A;  1OXX K;  1UE1 A;  3HOU G;  2NVT H;  2WB1 E;  3HOY G;  1PH4 A;  1P16 A;  4P71 A;  4DAM A;  1K9M C;  2VQE L;  3CCU A;  2YTV A;  4DV7 Q;  1E1T A;  2N49 A;  4A93 H;  1WJJ A;  4DR3 Q;  5IYC G;  2CQO A;  4GNX A;  2JA8 H;  2EQS A;  2R7F A;  4AYB G;  4JI7 Q;  3HOZ G;  3TS2 A;  3PO3 G;  3A5Z B;  4LF8 Q;  2K5V A;  3J81 c;  2NN6 G;  4KHP Q;  5IT9 c;  2UXC Q;  2K14 A;  3CME A;  2NVQ H;  3HOU H;  1K8A C;  2BA0 A;  4DUY L;  2D0P A;  2BH8 A;  4A3M H;  2B63 H;  4BY7 G;  3STB D;  5IYC H;  1EIY B;  3HOZ H;  2UUA Q;  2D0O A;  3CCS A;  4HIO A;  4LNQ A;  4DR1 L;  2UXD L;  1A8V A;  3JAM c;  1PH5 A;  4LFA L;  1YIT A;  5C3E G;  3UDF A;  1GM5 A;  4JI6 L;  1Q12 A;  2YU9 H;  4B3S L;  2ATW A;  3I4M H;  3PSI A;  3ULL A;  4JBM A;  4A3B G;  4A75 A;  1IZ6 A;  1YHA A;  3CPW A;  4B3R L;  2R93 H;  1NE3 A;  4IPC A;  3UDX A;  3KDF B;  2UXB L;  3S16 H;  1SRU A;  2DGY A;  4LUZ A;  4DV1 L;  2VY3 A;  3KJO A;  3GTO H;  3PIO A;  4X62 L;  2IX1 A;  1BBU A;  1B70 B;  1GKH A;  5C3E H;  3GTQ H;  3S17 H;  2AWN A;  1VQ4 A;  1CKM A;  2UU9 Q;  4LF7 Q;  1L1O A;  1J5E L;  4DV0 Q;  3F2B A;  3CC2 A;  1IXR A;  1SMX A;  4K0K Q;  2OQ0 A;  4DR2 Q;  4BA1 I;  1N8R C;  3NEN A;  1OXV A;  3CCR A;  4HJ9 A;  1MJC A;  2I5L X;  3KOJ A;  2JA5 G;  4LF9 Q;  3TRZ A;  4UP7 A;  5GAE C;  3L0O A;  1PH3 A;  1NBW A;  3I56 A;  4JI3 L;  4YY3 Q;  5C4X H;  5LMU L;  1VQG A;  1AE2 A;  2I5H A;  3I7F A;  1PYB A;  4P72 A;  3F1Z A;  4PMW A;  5IWA Q;  3OW2 A;  1R9T H;  1I94 Q;  1VQD A;  4JV5 Q;  4JI2 Q;  2K5N A;  4A3J G;  3HOX G;  2I5M X;  1CSQ A;  2CWP A;  2VS1 A;  5IYD G;  1HH2 P;  4R1J A;  4R4C A;  2F4V Q;  1K3R A;  2A8V A;  5C0X G;  4IO9 A;  1PH7 A;  4GKK L;  3SGI A;  1PV4 A;  2Z6K A;  3F2C A;  1EWI A;  3OTO Q;  1SR3 A;  1I3Q H;  1V43 A;  4YCW A;  3J81 i;  3K0X A;  4OO1 G;  2KEN A;  5GQO A;  4HJ5 A;  4QIW E;  1Q86 C;  2E2I H;  4BY1 H;  4MNO A;  5M5Y H;  4DUZ L;  1PH2 A;  2HT1 A;  3NEM A;  1JE5 A;  3I4N G;  4BBS H;  3S2H H;  1JJ2 A;  1A62 A;  1K0R A;  1VQI A;  2R6G A;  2CCZ A;  3CCM A;  1XPO A;  1VQ6 A;  3F8T A;  1XMO Q;  4A3D G;  3UDI A;  3K8A A;  5JJI A;  5FLX c;  2CFM A;  3NBH B;  3W1B A;  3CC4 A;  2VNU D;  2KCM A;  1KXL A;  4OX9 L;  2PI2 E;  1IBM L;  2YTX A;  3S24 A;  1ASZ A;  4AIM A;  3PUW A;  3JAM i;  2Y0S G;  1QZH A;  1XMQ L;  4TVA B;  3BU2 A;  4X66 L;  2RHQ B;  4NXN L;  3I4N H;  5IY0 A;  2JEA I;  1I50 H;  1E22 A;  1Y14 B;  2WP8 J;  3CPF A;  3GDE A;  4LFC L;  4RG1 A;  2MNA A;  3A5U A;  1HNZ L;  2UUC L;  2PMZ E;  1XPU A;  1N32 L;  3RN5 A;  1LUZ A;  1OXT A;  1YHB A;  3CAM A;  2IHE A;  4DV6 Q;  3WWV A;  4AQY L;  5JJK A;  2IHF A;  1A0I A;  1FVI A;  1KL9 A;  1TXY A;  2GVB A;  2K50 A;  5HY6 A;  1YHQ A;  4AH6 A;  1IBK Q;  2E5L L;  4LF6 Q;  4GKJ L;  5LMN Q;  3AEV A;  1V1Q A;  3HOV G;  4DR4 L;  1VQJ A;  1W3S A;  3G4S A;  2N8N A;  2UUB L;  3S1Q H;  2F52 A;  2HQL A;  1IBL L;  4BXX G;  1HZC A;  5M3M G;  4A3E H;  4JI5 L;  3D0F A;  3CCE A;  4FDB A;  3J80 i;  1LM0 A;  4LF4 L;  3KF6 A;  4DV7 L;  1HNX L;  4C3J H;  4QGU A;  4DR3 L;  4DAY B;  4JV5 L;  2WAQ G;  1SLJ A;  1YI2 A;  3AYH B;  2YTY A;  1E3P A;  2GN5 A;  1KQS A;  2JE6 I;  4P74 A;  4UP8 A;  1VQL A;  4YCV A;  2BA1 A;  4POF A;  1Q8K A;  3D31 A;  3KJP A;  4LF5 Q;  2JA6 H;  1N34 Q;  1WOC A;  4JC0 A;  1X65 A;  4B3T Q;  2R7Z H;  4LFB Q;  1IYJ B;  4QJF A;  2MO0 A;  4A3M G;  4L5R C;  2B63 G;  1C0A A;  1P8L A;  5GAD C;  4P73 A;  2Q2I A;  3JC6 6;  4GNX B;  2E8G A;  3RZD H;  1HNW Q;  5M3F H;  4MZ9 A;  2CWA A;  2ZJQ A;  4R4T A;  1QUQ A;  3T1H Q;  1PA6 A;  4GLV B;  3I4M G;  1X3E A;  1M90 C;  4P75 A;  1Q82 C;  1N36 Q;  4AYB E;  3IRB A;  3RR5 A;  2HIV A;  2R93 G;  1C7Y A;  2HHH Q;  4JI4 L;  3G71 A;  4IFD I;  1FJG Q;  1HJP A;  1SE8 A;  4JOI C;  1YJW A;  4DV0 L;  4DNI A;  4A3L H;  3Q8D A;  1QVF A;  4K0K L;  1WYD A;  3U4Z A;  1RIP A;  5E7N A;  3HOW H;  2VQF Q;  1YJ9 A;  1PH6 A;  3I55 A;  1KD1 C;  1N33 Q;  1JJG A;  1E24 A;  1VQC A;  1O7I A;  1D8L A;  4PZ6 A;  5ELN A;  4JI0 L;  3HKZ G;  1WFQ A;  2K52 A;  1XTD A;  4YY3 L;  1ASY A;  4JI8 Q;  2BH2 A;  4DR7 Q;  1AE3 A;  2V1C C;  1I94 L;  1VQE A;  3S1N H;  2RCN A;  4HIK A;  4HIM A;  2NVY H;  1KIX A;  4JI2 L;  1PH9 A;  5DLQ E;  2JA7 H;  5C4X G;  4OWX B;  1G6P A;  3MXN B;  5FJ8 H;  3M7N A;  3OYY A;  2VQE Q;  4R4I A;  1Q7Y C;  1L1O B;  4HID A;  4HJA A;  4JCV E;  4DKA C;  5C4J H;  1YZ6 A;  3ULJ A;  3DLL A;  2NVX H;  1U0L A;  2LXK A;  4H02 A;  4A3F H;  3J7Z C;  4GN3 B;  4DPG A;  1YJN A;  1KC8 C;  4DUY Q;  3PIP A;  1T9H A;  2JEB I;  1J6Q A;  3J81 j;  2ZM6 Q;  1H95 A;  2KHJ A;  4IPD A;  3RLN A;  1XMO L;  3VDY A;  4DV2 L;  4JBW A;  1K73 C;  1DGS A;  1I6H H;  4BY1 G;  3GTK H;  4BBS G;  2N78 A;  2VL6 A;  1Q1B A;  3H15 A;  1Y1W G;  4YWK A;  2AHO B;  2B3G A;  1I5F A;  4DV5 L;  2Q2T A;  2ZTD A;  4DR1 Q;  2UXD Q;  3FKI G;  4LFA Q;  2EXD A;  2E2H H;  1Z9F A;  2I0Q A;  3CD6 A;  4A3C H;  3PV0 A;  3UE1 A;  4B3S Q;  1VQA A;  4JI6 Q;  4WJ3 M;  5IE8 A;  2ASB A;  1RL2 A;  3CXC A;  2JA9 A;  1EQR A;  2JA8 G;  4B3R Q;  3G48 A;  1X54 A;  3PUY A;  1GVP A;  1Y1W H;  1JB7 A;  1BBW A;  2Q2U A;  3M9B A;  2UXB Q;  3CQZ H;  1CKN A;  4DK3 C;  5BR8 Q;  4DV1 Q;  1CKN B;  3FKI H;  3HKS A;  4JI1 L;  4NPS A;  1BKB A;  1IBK L;  1XNQ Q;  4R4O A;  4X62 Q;  1D7Q A;  5LMN L;  4IOA A;  4L5Q A;  4GOP C;  3PF5 A;  1JJC B;  1G51 A;  5M5W H;  4GN4 B;  3GD7 A;  1J5E Q;  1C9O A;  4X6A H;  1A63 A;  3A0J A;  5GRO A;  3RZO H;  4NXM Q;  4GLA C;  2NZO A;  2JJQ A;  4BA2 I;  1EIF A;  4LUO A;  3CC7 A;  3U4V A;  3ICE A;  1QVG A;  4XIG S;  4DV4 Q;  3H3V I;  4A3E G;  4JI3 Q;  3MEF A;  4JYA L;  2K4K A;  3S15 H;  2Y0S E;  1NY4 A;  1XNR L;  3K80 C;  3H0G H;  4X64 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...