4DV1Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv1Q00
4YY3L 5IYDH 4DK3C 3LGJA 5M3MH 1N9WA 1PH9A 3HOWH 5LMUL 1YIJA 1CKOA 4IJLA 3K7UC 1C9OA 2NVYH 4A3JG 1W2BA 2UU9L 1NE3A 1VQBA 4JBMA 5H1SE 1NTGA 5M3FH 3HFZB 4IOCA 3HOZG 2A1AA 2ASBA 1B70B 3GTQH 2UXCQ 5HGQA 1PH6A 4A3EH 3E0EA 4A3DG 4BBRH 5JEAJ 1HZAA 4YHHQ 4GLVB 4LF6Q 2AWNA 1MKHA 1S3OA 3AQQA 4PZ7A 2D62A 4DR2Q 1EOVA 2BA1A 1HZCA 2ALYB 4DR1Q 2E8GA 3K81C 4YCWA 2IHFA 3ZJYC 5C3EG 4GLAC 2Q2HA 1FVIA 3EBEA 3ULPA 4YWMA 2H5XA 3CCRA 1XPRA 2N78A 4C3JH 4DV1Q 1AH9A 3CF5A 4Y52H 3BZCA 3CCJA 1XMQQ 4GN5A 4PZ6A 5IWAQ 3PUVA 4O0AA 5AJ3Q 1WOCA 1XNQQ 1XJVA 2R7DA 1XPUA 4EX5A 2VQFL 4A3BG 1N34L 4DR5Q 1E3PA 4YWLA 1HNWL 1V43A 4L5TA 1WI5A 1G51A 5C4JH 2JEBI 1Q86C 4DPGA 4PMWA 1KC8C 3FKIG 5FJ8H 2CWPA 2L15A 2D0OA 1GO3E 3OYYA 2AHOB 4FDBA 4JI5L 3G71A 1PH5A 3RNUA 3PUZA 1TWAH 4DV0Q 3JAMc 2HIXA 3TRZA 1QZGA 3NENA 3CCUA 1TWFH 1YBYA 1UE7A 5GAHC 3HOYH 4A93G 2K50A 4JI8L 1XNRQ 3PIOA 4HIDA 1PV4A 4OWXB 1L1OA 4X65L 2K5VA 1KRTA 1Y1WH 4X6AH 2I5HA 1B7YB 4R4OA 3PUYA 1VQ7A 3PCOB 2ZTCA 1JJGA 1X3EA 3ULLA 1PVOA 3PIPA 1MIUA 3MXNB 3W1BA 4NXML 4B3TQ 3S1RH 4A3IH 3CMEA 1E7ZA 1Q46A 1VQKA 2VZAA 3HOXH 1A8VA 4JOIC 4LUOA 4IFDG 2VY3A 3AFPA 4AIMA 5JJLA 1YJNA 1IL2A 5FLMH 4LFCQ 3S14H 1IXRA 2A19A 1GM5A 4R1JA 3ER0A 5IP7G 2K5HA 1OXTA 1EQRA 1L2FA 1HNXL 4OX9L 1HNZQ 3F2BA 1X9NA 1NMFA 1QUQA 1EUJA 1YEZA 1VQLA 2UXBQ 1P8LA 3KLWA 4DV2L 2UU9Q 1Q1EA 1PH4A 4UY8C 5LMNQ 1LUZA 3RN5A 3KOJA 3M7NA 5LMNW 2NZHA 1OXVA 1SR3A 4DR3L 3RZDH 3PO2H 1E24A 1NMGA 4GKKQ 1PFSA 3TEHB 4L5RC 1K8GA 3ULJA 3HOUH 1I5FA 1UWVA 3TREA 4BA1I 4C3IH 3T1HL 4XIGS 1Q8KA 2WFWA 4IJHA 3S17H 3JC66 3J81i 1CSPA 5IYCG 4DV4L 1K9MC 1SN8A 4R4TA 2MQHA 3F1ZA 2ZTDA 2FXQA 1A62A 4ME3A 4BXXH 5IY0A 1S72A 4DV5L 4A3KH 2IX1A 3NELA 1VQ8A 1FJGQ 4LFAL 1VQ5A 2VQFQ 1KXLA 2UXDL 5BR8Q 2NVTH 4A3JH 2B29A 3FHWA 3K8AA 2VL6A 4JI7Q 4A3MG 2ZM6Q 4JBJA 5IYBG 3KDFA 3HOZH 2EXDA 3L2PA 4A3DH 4BY7G 1Y1VG 2IT1A 3CCVA 1X3FA 3UDXA 2CQOA 2GN5A 3CAMA 4LF8L 4YCVA 4AQYL 1X54A 3CC7A 3EIVA 5HY6A 4Y7NH 1EYGA 5GROA 3GTMH 5DLQE 2VNUD 2WB1E 1P16A 2V1CC 1J6QA 4P75A 3A5ZB 4GNXC 4JOIA 2YV5A 2EQSA 4P71A 4QY7A 5C3EH 2A8VA 3M85A 2K14A 2VS1A 1TWGH 3GO5A 3CC2A 1JJCB 1BBWA 1K0RA 2N8NA 3I4OA 2JA6G 1K83H 3J7ZC 3CPWA 3AYHB 2QA4A 3PUXA 1I94L 4JC0A 1HR0L 2F4VQ 3GTLH 1OXUA 1IBMQ 1CUKA 2VQEQ 1B8AA 1S40A 1KHIA 3M9BA 1VQNA 4A3BH 4B3MQ 4DR7L 4MNOA 4AYBG 5ELOA 3CCSA 1IBKL 4TVAB 2WP8J 4IPHA 3KF8B 5C4XG 4KI0A 4JI2L 1XTDA 4LF5Q 1AE2A 2BA0A 2PNHA 2ATWA 1FL0A 3FKIH 1Y14B 1IYJB 1RL2A 2R7FA 2MNAA 4OWTB 2E5LQ 2JA5G 2CWAA 2Y0SG 4L5SA 1I6HH 2Z0SA 3U50C 3U4ZA 4OO1I 4JYAL 2E2JH 2HHHL 2DGYA 1D7QA 4OX9Q 4YCUA 4OO1G 2NN6G 3ERSX 4MTNA 2RF4A 1JE5A 3W5OA 3UDGA 4HJ7A 2KCTA 4X66L 4A93H 3CPFA 1VQFA 4JI3Q 2XGTA 4JI4Q 3TS2A 1Q12A 2LSSA 3GTOH 1VQJA 3K80C 4RG1A 3JAMi 1CKNA 4B3SQ 4LFBQ 4JV5L 3CP0A 4YWKA 1K8AC 1OXSC 1E1TA 2PQAA 2CCZA 4DR6L 4IPCA 1ASYA 1Z9FA 2Q2TA 3Q8DA 3J80c 4QQBX 3K7AH 2WAQG 1X55A 2PI2E 4IFDJ 2UUAL 4JI6Q 1KAWA 5C0XG 5GQOA 3RLNA 3GDEA 4JI0L 3PGZA 1PHJA 4HJ9A 1IBLL 4A4IA 4ALPA 1VQ6A 1T9HA 2YTYA 1KQSA 3H3VH 1M90C 3ICEA 3I4NG 1YVCA 2YYZA 4LF4L 4X62L 5M5XH 5IP7H 2ZTEA 3GD7A 5GAEC 3U58A 2JE6I 2Q2IA 3HKZE 1PH1A 3GTGH 1YHAA 5M5YH 4A3CG 3DLLA 4GKJQ 4IPGA 4GNXA 1XMOL 2K4KA 5J3BA 4A3FG 1I3QH 2LXJA 2C35B 4DUZL 1KL9A 2LXKA 3KF6A 2IHEA 3S2HH 4K0KQ 2K5NA 5JEAG 4OXPA 3L7ZC 1VQDA 2N3SA 3T1YL 4OONA 1KIXA 4LF8Q 1SE8A 3CCLA 4LNQA 4IFDI 4AQYQ 3E9HA 1EIFA 1LYLA 1YHQA 5C44G 3H3VI 2YTXA 2Z6KC 4DV6Q 4X64L 4KHPL 2UUBL 1VQMA 4DR4Q 4DUYQ 2OQKA 1J5EQ 4LF7Q 5IYCH 1VQIA 4JI1Q 1OXXK 2JA7G 2IX0A 4YY3Q 3CC4A 3CD6A 2RHQB 1UE6A 2KHJA 3S1NH 1YZ6A 3CQZH 5LMUQ 4DAYB 1JJ2A 4J15A 1HR0W 2UXCL 2IY5B 1MJCA 4NPSA 4C3HH 2AWOA 1E22A 2MO1A 2I5MX 3B6YA 1Q81C 2YU9H 4YHHL 4A3MH 1PH8A 3M3YH 4QL5A 5IYBH 3H15A 1I50H 3CCQA 1L0WA 4BY7H 4DR2L 3SGIA 2R92G 1Y1VH 2YTVA 4A76A 3CCMA 4BY1G 3M4OH 4DR1L 3PF5A 1EFWA 2N49A 2NVXH 3OTOL 4GOPC 4LF9L 2HHHQ 3BJUA 3MEFA 4DV1L 2VUMG 1CKNB 3HOVG 1VQOA 1VQPA 1PH2A 2DUDA 2PQAB 5IWAL 1U0LA 4QIWE 2ID0A 4BBSG 4A3GG 4KLKA 4A3LG 4NXNL 4POFA 4DR5L 2JA6H 2OTJA 1N34Q 1HNWQ 3GTJH 2UUCL 4R4IA 1N33L 1WCMG 2B63G 3H0GG 1U5KA 2GVAA 4GN4B 2HT1A 2K75A 1N32L 4H02A 3RZOH 2QEXA 4LW1A 2UUAQ 5K36G 5C4XH 1UE1A 2BH8A 2JK8A 4A75A 4DV7L 1RIPA 4JI5Q 4DV0L 4HIKA 1L1OB 1HZBA 5IP9G 2MFIA 4GNXB 1QVGA 2JA5H 3M4QA 1PA6A 3G6EA 4IPDA 4JBWA 4JI8Q 4P72A 4PZ8A 2Z6KA 1SROA 3KF6B 4RMFA 4DAMA 4X65Q 2EIFA 1VQCA 1R9TH 3RR5A 1Q7YC 3F2DA 1YJWA 1Q82C 5M5WH 3TS0A 2JQOA 3NBHB 4B3RL 3D31A 4NXMQ 3L0OA 2CFMA 3J81j 4XTCS 5C0XJ 1EIYB 3I4MG 1QVFA 2PMZE 1WFQA 3RN2A 3STBD 4DV3L 1H95A 3I2ZA 1CSQA 1YNXA 2XTIA 3D0FA 4DK6C 3G48A 3A74A 1WYDA 1BBUA 3J80i 1PYSB 4X64Q 4HJ5A 3KJOA 2ZJPA 4GLXA 1QUQB 1JB7A 3CCEA 4JBKA 4KHPQ 3HKSA 2NN6I 4GS3A 3I4NH 1HNZL 1HNXQ 2JJQA 4GOPA 1OTCA 4C2MH 1C7YA 2OTLA 3UE0A 5IT9c 1SFOH 2QGQA 4QGUA 4A3CH 5JJKA 2UXBL 4DKAC 4UP7A 2R93G 3U4VA 4DV2Q 2ZJRA 3UDIA 5LMNL 3PV0A 4A3KG 4A3FH 1X3GA 2MO0A 1HH2P 4WJ3M 2ZJQA 1A0IA 5GAGC 1LM0A 4IOAA 2R6GA 4DR3Q 5C0XI 3RLFA 1VQEA 2HIVA 4JCVE 3G4SA 4GKKL 3F2CA 2JA8G 3PO3G 4O2DA 1PYBA 4LF9Q 3OTOQ 2E2HH 4R4CA 5C44H 3AEVA 3T1HQ 4HIOA 1K73C 2BH2A 1YI2A 1X56A 2RCNA 1GKHA 2R7ZG 5IYDG 4DV4Q 5E7NA 3W1GA 4JG2A 5M3MG 3HOWG 3BZKA 3I55A 3OW2A 2E2IH 3VDYA 1FJGL 4DV5Q 1G291 4JI7L 2JA7H 2RHSB 3KDFB 4LFAQ 5M3FG 4NXNQ 5BR8L 1QVCA 1VQ9A 1N36L 2UXDQ 1WJJA 1X65A 1SRUA 4A3EG 1MJEA 2NZOA 4NB3A 2UUCQ 4BBRG 1V9PA 2ZM6L 1N33Q 3S1QH 1E1OA 1N32Q 2WB1G 2D0PA 2AMCB 3S16H 1BKBA 1W3SA 1XPOA 1C0AA 4DV7Q 1N8RC 1YJ9A 3FP9A 2R92H 1QZHA 5IE8A 1YHBA 2NVQH 1VS0A 4BY1H 4IO9A 4GN3B 4POGA 2I0QA 4EQ5A 4LUVA 2VW9A 1A63A 1TWHH 3AFQA 2VUMH 3HOVH 3S2DH 2ES2A 3BU2A 2GVBA 5EAYA 3I56A 4BBSH 4A3GH 1I94Q 1HR0Q 2F4VL 1IBML 1KRSA 2VQEL 1DGSA 3GTKH 3RLOA 4A3LH 4B3ML 1UEBA 1SLJA 3S1MH 4DR7Q 4B3RQ 1NY4A 1WCMH 3UDFA 3H0GH 1SMXA 1IBKQ 5FJ8G 4OWWB 5GADC 2B63H 3M4PA 4LF6L 4LF5L 4JI2Q 1VQGA 2HQLA 4DV3Q 1KD1C 1FGUA 2OWOA 4UP8A 3PSIA 4UPAA 4BA2I 2E5LL 3CW2C 4GOPB 1YITA 3HOYG 1PH3A 4AYBE 3PF4A 4WJ4A 1Q1BA 4JYAQ 1UE5A 5IP9H 1Y1WG 1VQ4A 2OQ0A 4L5QA 3CXCA 4LUZA 1XMQL 4JI3L 3STBC 4X66Q 4JI4L 1V1QA 3DM3A 2AKWB 2Y0SE 5AJ3L 1XNQL 3GTPH 1O7IA 1HZ9A 1IZ6A 2KBNA 3A0JA 4APVA 4B3SL 4JV5Q 4LFBL 5JJIA 1G6PA 4AH6A 4MZ9A 4A3IG 2B3GA 4DR6Q 1VCIA 4HJ8A 1BVSA 3WWVA 3HOXG 1HJPA 1AE3A 1JMCA 3KFUA 4QJFA 1JT8A 3E9IA 2KHIA 4JI6L 3HKZG 1TWCH 1M1KC 5FLMG 4P73A 3I4MH 1TXYA 5ELNA 4JI0Q 4LWCA 1IBLQ 2JA9A 1Z47A 3K0XA 3S24A 1LTLA 1X6OA 2K52A 3KYHC 1NJIC 3TQYA 3EN2A 1VQHA 3A5UA 4LF4Q 2OCEA 1GD7A 2WAQE 4X62Q 3PUWA 1ASZA 2PI2A 1GVPA 1XNRL 4KHZA 4HIMA 4HJAA 4GKJL 1K3RA 2F52A 4PG3A 3UE1A 3IRBA 2Q2UA 1EWIA 4R4QA 1XMOQ 1N36Q 4TQUS 1D8LA 3KJPA 2R93H 4DUZQ 2JEAI 5FLXc 2I5LX 1VQAA 4K0KL 3J81c 4B3TL 2F3IA 3PO2G 3NEMA 3T1YQ 1CKMA 3F8TA 3HOUG 3I7FA 4DNIA 4P74A 4LFCL 1EQQA 2JA8H 4DV6L 3PO3H 1L1OC 4UP9A 1PH7A 3S15H 2CKZB 2KENA 4DUYL 4DR4L 2UUBQ 3J7A5 1J5EL 3CMAA 4BXXG 4LF7L 2KCMA 4JI1L 2R7ZH 1NBWA
chains in the Genus database with same CATH superfamily
1ET6A 2PYKA 1D5ZC 1PH9A 1YIJA 4A3JG 3RUZA 4JBMA 1VQBA 2A6ED 1NTGA 4IOCA 1EEID 4IUQA 3HOZG 3GTQH 4R8IA 1FYCA 3EQLC 5A2QE 1KDBA 1HZCA 5JPNC 1G8ZD 4FXDA 2A73B 2Q2HA 1FVIA 2ICEC 2XNAC 2B2TC 2H5XA 5C4JB 1XPRA 3HRZC 3K6OA 4GN5A 5IWAQ 3Q6SA 1XNQQ 1I4QA 1XPUA 2L1BA 3OWFA 1PFBA 1IW7D 4YWLA 1HNWL 4BS9A 3HOYB 3TP7A 4HTHA 2JEBI 1Q86C 3LNNA 1SNOA 1KC8C 3FKIG 5AFWA 2WV6D 2L15A 2D0OA 3OYYA 4JI5L 1O7YA 3G71A 5E1FA 5CC4A 3KLSA 3PUZA 1TWAH 4DV0Q 4UDUC 3TRZA 3NENA 4IUVA 5GAHC 3N6RA 1STYA 1C4QA 3PIOA 2B2VA 3MFYA 1V1PA 2TMPA 1HA5A 2NTSA 1EY4A 3NE5B 3FDTA 3VA7A 3SK5A 3NQIA 3DWAA 4B3TQ 4A3IH 2I07B 3WDNA 1HTPA 1Q46A 2A68C 4IFDG 3T56B 2SEBD 4NP5A 1YJNA 4LFCQ 1A3VA 3S14H 2B2UC 3ER0A 5IP7G 2K5HA 1GUTA 1RHPA 1PZID 2EJGC 1HNZQ 1Y8PB 1SNPA 2F4IA 3PO2B 1NMFA 2D2CC 1V1OA 1EUJA 1YEZA 4KKSA 2B2TA 1P8LA 3KLWA 1ENFA 1Q1EA 2SNSA 1LUZA 3TP6A 5LMNW 3KUPA 3PIP3 1OXVA 1TIID 4HCEA 2H4OA 3RZDH 1NMGA 2M00A 4KKTA 4U68A 3TEHB 4ZYSA 3ULJA 4A3JB 1K8GA 4L5RC 5K5PA 3TREA 3NTKA 1Q8KA 2WFWA 2Z9HA 2K32A 5IT9E 4LMQD 5JVH3 1RD9D 2A69C 3C46A 2FXQA 4ME3A 5FK9C 1LV9A 3NUCA 3NELA 4A3KH 1FJGQ 1EY5A 1FD7D 2VQFQ 4QIWB 5BR8Q 4ZRZA 2NVTH 3DUZA 4A3MG 4IUUA 3L2PA 2B39A 3R3OA 4A3DH 1X3PA 2OXPA 1D5MC 4AQYL 3ITPA 1X54A 4HR7B 5HY6A 4Y7NH 3GTQB 1P16A 1V1PB 2V1CC 4P75A 4DXFA 4QY7A 5C3EH 4MN3A 3M85A 1FNWA 2B2UA 4CKBA 5IODA 3CC2A 1JJCB 3FKIB 3SHLA 3J7ZC 2QA4A 4JC0A 4FXGC 4MNOA 3NBIA 5ELOA 2WP8J 2P5ZX 4IPHA 4K8IA 3E3XA 5C4XG 2RCFA 4JI2L 4LF5Q 1TS2A 2A5HA 2BA0A 1IYJB 2MNAA 4L5SA 2EVBA 2MHVA 3A7LA 2AUKA 5C6AA 3U4ZA 4JYAL 4FYDA 1D1KA 3K7AB 4OO1G 3ERSX 4MTNA 4RWSC 4K5VA 3W5OA 2FFKB 3CPFA 1VQFA 4JI3Q 2PW7A 1JWSD 1Q12A 2LSSA 4KN7C 3GTOH 3K80C 4PQXA 1B9NA 3L3OC 2CCZA 4DR6L 2Q2TA 3Q8DA 5T1GA 1KNEA 2MJ8A 2UUAL 4JI6Q 1SAPA 2NB0A 3RLNA 3VYSA 4JI0L 1I3QB 3BVZA 1TQOA 4N8FA 3EVQA 3EA6A 1KQSA 4DNRB 1QNUA 2LY7A 1STGA 2ZTEA 4A3IB 2BDOA 3MTSA 4ZCKA 3H09A 4A3CG 1EY6A 1JICA 3NPPA 5J3BA 1LTSD 3NTHA 3T13A 4V190 1JWMD 4K2LA 2DY8A 1SE4A 2K5NA 1BBXC 5JEAG 3L7ZC 2N3SA 4LNQA 4OONA 3DEPA 4LF8Q 3CCLA 3S1NB 5BN3A 1CT1D 1EIFA 1YNNC 3H3VI 1EU4A 4JVZA 3EFXD 4C1NI 3I91A 4A3MB 4CJ2C 2R61A 5JPMC 2RKSA 5IYCH 4X3KA 2JA7G 4IALA 5CORA 3M4OB 1YZ6A 5LMUQ 2TSSA 4J15A 1ZYRC 2F0OA 3OHXC 4I7AA 2MO1A 4Q0FA 3J7AF 1Q81C 1B9MA 5ELDA 5IYBH 2LKVA 3CCQA 2O5IC 4OELB 3SGIA 1Y1VH 1SXTA 2NVXH 2N49A 3OTOL 1A2UA 2HHHQ 3BJUA 3TP5A 5EKLA 3HOVG 1VQOA 4XDXA 1WTVA 1FR3A 5IWAL 5C4XB 1U0LA 4QIWE 4BBSG 3F2UA 4A3LG 4NXNL 4POFA 1HTLD 2B63G 1WCMG 1I4PA 1U5KA 2GVAA 4GN4B 2K75A 1B44D 2QEXA 1ZEQX 1CZGA 2BDNA 4KJOA 5K36G 1UE1A 2BH8A 1RDPD 1RIPA 1EWHA 1W6KA 5M5WB 3A8JE 3AMUA 4DV0L 4HIKA 1L1OB 2FINB 2PZWA 3G6EA 4LJZC 2OEOA 4JBWA 4P72A 4CJ1B 1F9QA 5D14A 2NN6H 4DAMA 2EIFA 1R9TH 3EROA 3VR2A 2PO4A 3NBHB 4B3RL 5I6YA 4NXMQ 4G4KA 3J81j 1WFQA 3RN2A 3VR6A 1V8QA 4RCNA 4DV3L 1XX8A 1YNXA 4DK6C 3JAML 1SNQA 4KHPQ 1JB7A 1UEAB 1S4ZA 3HKSA 3I4NH 1HNZL 1H9MA 1SYCA 3T51B 5I2XA 4C2MH 2QGQA 1B1ZA 4QGUA 5JJKA 1CA5A 2IW3A 4PMCA 4UP7A 2R93G 3U4VA 4DV2Q 3UDIA 5J39A 4WJ3M 1DOLA 1B53A 3M7GA 4DFAA 2E2IB 2AQ1B 4DR3Q 2JA7B 2ZT9C 3UI2A 4O2DA 1PYBA 1EZ6A 1Q8IA 3URYA 5JJZA 5EPLA 5C44H 2BH2A 2B2YC 1K8OA 4DV4Q 3W1GA 3BZKA 3OW2A 2EOTA 4TRDA 1FJGL 2NWGA 4LFAQ 1CK1A 1DCZA 5BR8L 1JORA 4X3SA 1MJEA 1V9PA 3U9OA 1NR4A 1SJHD 3HOVB 1W3SA 2FJ2A 5CV4A 1N8RC 4BBSB 4Z9CB 3SR1A 3OPOA 1QZHA 5IE8A 3GTKB 1YHBA 2NVQH 4BY1H 4IO9A 4C3JG 3QIAA 1WCMB 2B63B 2DN8A 3IKJA 4K5WA 4DGZA 4J1MA 2VUMH 3BU2A 2GVBA 3M4YA 1HR0Q 4CHTB 3BDCA 4K8JA 3ND9A 3S9WA 1NY4A 1IBKQ 1SMXA 3M4PA 2IWHA 1RJTA 4LF5L 4UP8A 1SMYC 3ONAB 3PF4A 1Q1BA 5IP9H 1Y1WG 4O42A 1VQ4A 2OQ0A 4LUZA 1XMQL 2JN4A 4JI3L 3STBC 4X66Q 2B2YA 1V1QA 2EDGA 1BR9A 3T53B 4WJWA 4K14A 4OL7A 1G6PA 1F2LA 2Y0SB 2K01A 1H9KA 3HOXG 2A74C 5LL6X 2QEJC 2L12A 1JWUD 3E9IA 4JI6L 3HKZG 1SEBD 4P73A 4XQNA 3I4MH 1MI2A 1IBLQ 3K5LA 1WTOA 3MA2B 2R93B 3S24A 3X3NA 1B3QA 1VQHA 5A35A 1AZQA 2OCEA 3PUWA 4EVOA 2PI2A 1GVPA 4ZK9B 3T4AC 1O7ZA 4PG3A 3IRBA 1ENAA 1ESRA 1LTGD 3J80L 2OF1A 1QOHA 4PNYA 2EY5A 3T1YQ 1S5CD 3F8TA 2F1MA 3HOUG 4P74A 4ZKBB 3PO3H 4UP9A 1EYCA 2VB2X 3BS1A 4H44C 2CKZB 3J7A5 1PRTC 4DU9A 4BXXG 2R7ZH 1NBWA 3DMUA 5M3MH 5LMUL 1STAA 4IJLA 2DNEA 2UU9L 5H1SE 5M3FH 5C44B 1JOOA 2ASBA 4C3JB 4BBRH 2PQEA 4GLVB 4LF6Q 2AWNA 3CHBD 2D62A 1EL0A 1EOVA 2BA1A 2IHFA 5KYIA 3OW7A 2Z8LA 2RDGA 4PV1C 3CCRA 2N78A 4DV1Q 3BZCA 3OMCA 3PUVA 3H94A 3D4DA 4G7ZC 1PLFA 4A3BG 1V43A 4L5TA 1X3QA 5C4JH 3OWEB 1Y1WB 2FHTA 2VUMB 4PMWA 1GO3E 2AHOB 1LTBD 1PH5A 4KY6A 3JAMc 3CCUA 3HOYH 1YBYA 1PDQA 2KEDA 2ENBA 1XNRQ 1GHKA 2KEEA 3HOXB 4X6AH 1B4OA 1B7YB 3HKZB 1VQ7A 4MTKA 3PCOB 3HP3A 1HXYD 1DXMA 1X3EA 1PVOA 1TS4A 5EBCA 2XRSD 4NXML 1RKNA 4IUPA 1E7ZA 1G2TA 4KHVA 4OEMB 2XWBB 5JJLA 1IL2A 3MAQA 1IXRA 3KF8A 3GQBA 4C56C 3BVGA 4I7ZC 4M8AA 3F2BA 1QUQA 1JE4A 3HOUB 2UXBQ 4DV2L 1PH4A 5FLXL 3S17B 2BCOA 5LMNQ 5CV8A 3M7NA 5I9PA 2DJGC 1NNXA 1SR3A 4DR3L 4S3SA 3PO2H 1E24A 4GKKQ 1U9RA 1C8CA 1UWVA 1TU2B 4IJHA 4DV4L 1GUGA 2MQHA 3F1ZA 2ZTDA 1A62A 4XYQA 1S72A 1EOTA 2IX1A 1DJRD 4LFAL 1PFNA 4K5XA 4XXEA 4A3JH 3KBGA 1IYVA 2NZ1D 4JI7Q 1SYDA 4WRDA 3HOZH 3KDFA 4P2CB 4BY7G 2R7ZB 3CCVA 1X3FA 3GTLB 3CC7A 4O1NA 1HQRD 4RH6A 4A3BB 5M3FB 3K57A 3A5ZB 4GNXC 2K05A 1PRTB 2YV5A 3U9SA 2SOBA 3P20A 1HFNA 1TWGH 3BG3A 2D9UA 3RMHA 3SK6A 2O2LD 1A6XA 1K0RA 2B2WC 2N8NA 3OSOA 2Q8IB 3TSSA 4K6LA 1K83H 1NUCA 4CDFC 1HR0L 2JA6G 2AUJD 3PUXA 1O80A 1OXUA 3K5NA 1VQNA 1KHIA 1IBKL 3KF8B 1XTDA 1AE2A 3WOEA 1G2SA 2ATWA 1HCZA 3FKIH 1Y14B 3LX0A 2R7FA 4OWTB 2B8FA 2JA5G 2Z0SA 5C4ZA 1D7QA 4OX9Q 1BQQT 1JB3A 1CHQD 3UDGA 3DHQA 4X66L 2CHBD 2XGTA 4JI4Q 5KGUA 5D3DA 5JVG3 3JAMi 1CKNA 4Q5VA 4B3SQ 4LFBQ 1EFID 2PQAA 2EJMA 4IPCA 1ASYA 2PZUA 1UUPA 3NWSA 3J80c 2CH4A 3GTGB 4QQBX 5M5YB 3K7AH 4IFDJ 1X55A 2G5DA 2PI2E 2IL8A 1KAWA 5C0XG 5GQOA 4KMUC 1PHJA 4HJ9A 1IBLL 4RCOA 4IFDH 4A4IA 5KIXA 1CFMA 1T9HA 3ICEA 2G9HD 3S2HB 1YVCA 2YYZA 5M5XH 5IP7H 3GD7A 3HKZE 4H13C 1YHAA 3DLLA 5CYUA 4IPGA 5CMDA 4GNXA 3P7JA 4GZYC 2K4KA 3D3RA 1I4XA 4A3FG 1I3QH 2EYMA 1KL9A 2LXKA 2EYFA 2VB3X 5KYLA 1QB5D 2B2WA 1R4QB 2H1EA 2F0VA 1VQDA 5ISRA 3T1YL 1KIXA 1SE8A 3CQZB 3E9HA 1YHQA 5IOCA 2YTXA 2Z6KC 3HZXA 2RQXA 2BOSA 4DUYQ 2OQKA 1I50B 1VQIA 4JI1Q 4BY7B 3CD6A 4DAVA 4YY3Q 2HDLA 3S1NH 1CQVA 1S5FD 3C1FA 2IY5B 4NPSA 2AWOA 1E22A 3J81L 2YU9H 4A3MH 4RFBA 3A7AB 2QKIC 2YTVA 4A76A 2JA6B 3CCMA 3M4OH 2WKCA 3HOZB 3MEFA 4DV1L 2K04A 1CKNB 1HFGA 3G7LA 5IGBA 3WOFA 1LLRD 2PQAB 2ID0A 4A3GG 1BF4A 4KLKA 4XYOA 5L37A 2OTJA 2JA5B 3NHHA 4CKEA 1PFMA 2EY6A 4RGOS 3AB9A 3T16A 5F2DA 1DM0B 1STNA 1TWGB 5C4XH 4RHRA 1K83B 3A56A 4GNXB 1QVGA 1F2MA 3VR3A 4ULLA 3M4QA 1L0YB 2F0IA 1MGSA 1QILA 4UHVA 2Z6KA 4RMFA 1E0BA 3FRPB 4L8JA 4OO1H 4X65Q 1VQCA 3IFTA 3RR5A 4QUFA 1Q7YC 1YJWA 5M5WH 2JQOA 4FF3A 1A3TA 2CFMA 1EIYB 4XTCS 2BE5C 1GUOA 1ILQA 3JAME 3A54A 3NXWA 1MHWC 3I72A 1TS5A 2XTIA 4A3FB 1Q3LA 3A74A 4HJ5A 3J80i 4X64Q 1Z6HA 2RDFA 3K58A 2NN6I 1PTOC 1HNXQ 4DK1A 3D6CA 2OTLA 1E2ZA 4A3CH 1KNAA 2UXBL 4DKAC 3IL8A 2E2HB 5LMNL 3PV0A 4QF4A 4RKLA 1X3GA 2MO0A 4G7OC 5M5XB 3K59A 2XN9C 5TSSA 4IOAA 2R6GA 4KTAA 5JEAH 5FOBB 5M9OA 1CQFA 1AEXA 1Z7TA 3RLFA 4GKKL 5A2QL 1WTPA 3E0JA 1EYAA 4LF9Q 1TY2A 3S1QB 3AEVA 2F0MA 3PQIA 4HIOA 3T1HQ 1K73C 5G3LF 2RCNA 5IGEA 1GKHA 5IYDG 3P75A 3HOWG 3I55A 2E2IH 1CA6A 2JA7H 3QWNA 1QVCA 5ELCA 4NDXA 1WJJA 4A3EG 2UUCQ 4JI7L 1N33Q 1YNJD 1N32Q 2WB1G 1PZKD 2D0PA 2CW0D 3I4LA 2X69A 4PMBA 2KUMA 1XPOA 4IZ8A 5CV6A 4DV7Q 2F0UA 4A3GB 2SNMA 3QR8A 1VS0A 1JQYD 3K5OA 4GN3B 4KV6A 2I0QA 2IX3A 2YU9B 4TSSA 1EY8A 1TWHH 3HOVH 1QWYA 4BBSH 1KRSA 4A3LH 3GTKH 5IGDA 4HMJA 1EU3A 4DR7Q 2MP1A 2B63H 1WCMH 5FJ8G 2Q8RE 5GADC 3J7YW 2HQLA 2LS01 1KD1C 1FGUA 3GTPB 5K36H 3PSIA 1GUSA 1YITA 1EIGA 1PH3A 4WJ4A 1GUWA 2DJFC 3R2IA 2M2LA 4JI4L 2MPMA 2WINB 1XNQL 1O7IA 1HZ9A 2KBNA 1AZPA 3KLRA 4B3SL 4JV5Q 4LFBL 1BCPC 1LACA 4MZ9A 1DD2A 3FPUB 1BVSA 1JMCA 4QJFA 2KHIA 1M1KC 5FLMG 1TXYA 3CU7A 1I4HA 2JA9A 1Z47A 1HQMC 1LTLA 2K52A 2I46A 2XWJB 3TQYA 1IKMA 2F03A 5IT9L 3ND8A 2E74C 4KHZA 1JC7A 2A68D 2F52A 2Q2UA 3MXPA 1N36Q 3P1HA 4TQUS 1D8LA 2R93H 4DUZQ 4H7BA 1U4LA 2JEAI 2I5LX 1VQAA 5I4DA 2KCCA 3J81c 1SNMA 4G7HC 4B3TL 4WFN3 2FMCA 5EJWA 1LTID 2NVYB 4HEDA 3I7FA 4C3IG 2A6HC 2N88A 4LFCL 4A3EB 4J6HA 4DUYL 1PTOB 2WB1B 2OT2A 2F3VA 4JI1L 4YY3L 4DK3C 3D6WA 3LGJA 2K33A 3K7UC 1C9OA 1W2BA 3HFZB 2UXCQ 2A1AA 1B70B 1SNCA 1QNKA 3E0EA 1HZAA 4YHHQ 2VXWA 1MKHA 2A69D 2F0DA 4R9WA 1BXTA 3MC0B 4YCWA 4GLAC 2F0PA 3ULPA 1FGBD 4C3JH 4N8X1 4Y52H 3CCJA 4PZ6A 4O0AA 2O4XA 5AJ3Q 1XJVA 2HD3A 1U4RA 1LTAD 2R7DA 5FO8B 4EX5A 2VQFL 2CH4W 1E3PA 3NTIA 3H3VC 1TWFB 1PRTF 3TP8A 1WI5A 1G51A 2FMMA 3H6MA 1TWHB 4DPGA 4FNFA 3BDLA 2NBFA 2F0KA 1K0SA 2HIXA 1XXGA 3S1RB 1UE7A 4A93G 2JP1A 4C1NK 2K50A 2M9VA 3E5SA 1PV4A 4OWXB 3IAYA 1HPCA 4X65L 2K5VA 1KRTA 1Y1WH 2EY2A 3PUYA 1KLGD 3TZDA 1JJGA 3NSWA 1F9SA 5HURA 3PIPA 1MIUA 3W1BA 2CVRA 2VZAA 3HOXH 3DEOA 3KK7A 1F2YA 4HN7A 3R2TA 1GM5A 2EYJA 4EGVA 3QB3A 1D6EC 2K5DA 3MXUA 1HNXL 3PIO3 1K8MA 3SDZA 3GV6A 2HCCA 4UY8C 1BCPB 1Y8NB 3RN5A 3GP7A 1A15A 1EQTA 1LT6D 1STBA 1WTWA 1DZ1A 2X6LA 2A6EC 1SE2A 4CKCA 3HOUH 1I5FA 3T1HL 4XIGS 3S17H 3J81i 5LHY1 1O78A 2RSNA 3KBXA 1K9MC 3DXJC 4R4TA 4LK1C 4BXXH 5IY0A 4C3HG 1MBYA 1YNND 3FHWA 5BN5A 4K6DA 2EXDA 4RAUC 1STEA 2GN5A 3CAMA 4LF8L 1ET9A 4YCVA 5JOBA 1IW7C 1EYGA 2VNUD 5J22A 2CQAA 3I90A 1ZYRD 2WB1E 4CDDC 1J6QA 1LT4D 4P71A 3X3MA 2QDBA 2K14A 4FF1A 2F0FA 3I4OA 3AYHB 4CDCC 3GTLH 4ME5A 2F4VQ 1IBMQ 1CUKA 4A3BH 1B8AA 1S40A 3M9BA 3MXGA 4DR7L 4AYBG 3CCSA 2K5QA 4TVAB 4A93B 4DAYA 4KI0A 1TKWB 3Q22A 2WKDA 2PNHA 3DM1A 1RL2A 1CHPD 1PXUA 1SYGA 2E5LQ 3LWUA 2XIWA 2HHHL 2DGYA 4ZAIA 4YCUA 3OIQA 1IKLA 3SK4A 1LO5D 5EGTA 4JW0A 3VA5A 1PYWD 4JV5L 1S5BD 3CP0A 3OOCA 1OXSC 4YWKA 1K8AC 4QCLA 2JXMB 1F9RA 1SNDA 1WTXA 3GDEA 4XT3B 2GA4B 1TR5A 5C4HA 3DWPA 2YTYA 2J0TD 5GAEC 2JE6I 2Q2IA 5G3LD 2KECA 3GTGH 5M5YH 4MIUA 4GKJQ 2Z6BA 4IUTA 1HHVA 2F0HA 2XRQD 4DUZL 3V2TA 5DM63 3S2HH 4K0KQ 2F0NA 4QUCA 4IFDI 2RBMA 4AQYQ 5C3XA 2NTTA 4C3HB 3MEHA 4KHPL 4DR4Q 3TMEA 2PCFB 4LF7Q 1OXXK 1RTNA 2IX0A 3DWQA 3CC4A 2RHQB 1UE6A 1T5EA 1HRJA 3CQZH 4DAYB 1XYIA 1JJ2A 1SYEA 3J81E 1HR0W 2UXCL 1MSHA 2I5MX 4YHHL 1H9SA 4QL5A 1LT5D 1KAAA 4NMZA 3H15A 1I50H 1L0WA 4BY7H 1LTTD 2R92G 3PF5A 3GTJB 5CBEE 1A2TA 1SE3A 1C48A 5DAUA 2F0SA 3RZOB 3HEJA 4AYBB 1VQPA 1PH2A 3HG9A 5E3FA 2JA6H 4HCSA 1N34Q 1FNUA 3H0GG 2NYZD 3MWYW 1ENCA 1QE6A 2UUAQ 5C3WA 5EPJA 3LWEA 3O13A 4A75A 2B8GA 1B50A 2ICIA 1NAPA 3HS0C 1HZBA 2JA5H 3GV3A 1PA6A 1ICFB 4IPDA 1AW7A 4JI8Q 1SROA 2EE1A 3F2DA 1SMYD 3TS0A 3V05A 4WORA 3D31A 4B9WA 1VF5C 5C0XJ 1WTRA 2PMZE 3N52A 2K5WA 1IYUA 3STBD 3I2ZA 5C0XH 4OIKA 3Q23A 3D0FA 1TT2A 4UAIA 3VYRA 1WYDA 3KJOA 4GLXA 4JBKA 1QUQB 4GS3A 2WIIB 2DNCA 3G6JB 2JJQA 3BDOA 1RF2D 3R93A 1EYDA 1H9SB 5E4WC 3SXHA 5DM73 4A3FH 3IFDA 2ZJQA 1A0IA 5GAGC 1LM0A 2KJXA 4ZUJA 4IN3A 1W6JA 1VQEA 3G4SA 2JA8G 3OTOQ 4CDEC 2E2HH 3FMCA 1EY9A 3MVVA 2ZXPA 1HA6A 1KLUD 3BYTB 3S16B 4KD3A 5E7NA 4KJNA 1G6ZA 3SK8A 4DV5Q 1G291 3KDFB 2HDMA 2R92B 4NXNQ 1VQ9A 2UXDQ 1A3UA 1SRUA 3I73A 3S1QH 2NZOA 4NB3A 1CI3M 1PTOF 1II3A 5FKAC 3CRKC 1PRTD 1L0XB 1BKBA 5E4XA 3S2DB 1C0AA 2Z4IA 2ZXRA 1U4PA 3BYYB 3S1MB 1J9OA 4FF2A 3H0GB 4LUVA 4EQ5A 4F88A 4F7XA 1A63A 2AQ2B 3AFQA 1XWEA 4JPBW 5EAYA 1RODA 3A8KE 5ELEA 3I56A 2EZVA 4A3GH 1I94Q 2F4VL 1IBML 3RLOA 1UEBA 1SLJA 1D2BA 4B3RQ 3UDFA 4M1UB 4FP5D 1EZ8A 4LF6L 3NP8A 4B08A 4DV3Q 2K28A 4BA2I 4E6IA 1RCVD 3CW2C 2E5LL 4AYBE 1EY7A 5T1IA 1IHZA 4ODGA 1UE5A 4IQZA 3CXCA 1TWCB 2AKWB 3GTPH 4TKOB 3A0JA 4ZQ3A 1WD0A 1X32A 2EJFC 5JJIA 4AH6A 4X3TA 4A3IG 2B3GA 1VCIA 3KFUA 1E2VA 1SYBA 4RA8A 1VMPA 2HUGA 5ELNA 2C5CA 1S5DD 2QF7A 4QB4A 5ELBA 3A5UA 4LF4Q 4X62Q 1QJOA 1UNSA 2NUCA 1ASZA 2MGSA 1XNRL 1VF7A 4GKJL 2L0CA 2PPBC 1EWIA 1F2ZA 1XMOQ 2JA8B 3KJPA 2EYOA 1ZKOA 1VMCA 3A55A 3S15B 3I8ZA 2ZXOA 5FLXc 4K0KL 4FF4A 3NEMA 5IGGA 4DNIA 3MXNA 3NQTA 1BCPF 2WACA 2XSCA 1L1OC 1T5XD 4EQNA 4DR4L 1STHA 2UUBQ 1I4GA 3TZUA 3OMGA 2KCMA 4A3KG 4LF7L 1LTRD 5IYDH 1N9WA 3AU7A 3HOWH 5CV9A 1CKOA 2NVYH 1NE3A 1JOKA 1WD1A 3MZ5A 5HGQA 4BWGB 1TS3A 4A3EH 1PH6A 4A3DG 5JEAJ 1PTOH 5EKKA 1S3OA 3AQQA 4PZ7A 2LMCB 4DR2Q 4N9PA 5CBAE 2J4XA 4DA2A 1GOZA 2ALYB 4DR1Q 2E8GA 3K81C 5ELFA 3ZJYC 5KNBA 5C3EG 5D65A 2E75C 3A8IE 3EBEA 4YWMA 2L9HA 1AH9A 3CF5A 3QO2A 1ICWA 1XMQQ 3L9AX 4L6TB 1WOCA 3ZYYX 2F0EA 1N34L 4DR5Q 1TWAB 5I2YA 3D4RA 3K5MA 2AQ3B 1O7LA 1Y69U 5FJ8H 2K03A 2CWPA 1CTMA 4EQOA 2F0QA 2HCIA 4ZLTF 4FDBA 5COYA 4DK0A 3RNUA 1KDCA 1QG7A 1QZGA 1TY0A 1TWFH 4CBVA 4JI8L 4HIDA 1L1OA 2I5HA 4R4OA 3S14B 2ZTCA 3ULLA 1VDZA 3NK9A 3SE0A 1EEFD 1R4PB 3MXNB 1E2WA 3S1RH 3CMEA 1VQKA 4JK1C 4IURA 1A8VA 4G57A 4JOIC 4LUOA 2VY3A 3NBHA 3AFPA 4AIMA 5FLMH 5CV7A 2Q8TA 2A19A 4R1JA 1NR2A 1OXTA 5I6WA 1EQRA 1L2FA 4OX9L 1PMRA 3RZDB 1X9NA 1G91A 2Z4HA 1VQLA 2UU9Q 3ERQA 5J1ZA 2PNRC 3KOJA 2NZHA 4A3KB 4X3UA 1PFSA 5IGCA 2NVTB 4C3IH 4BA1I 4I65A 3SEBA 3JC66 1CSPA 5IYCG 4A3DB 3C1EA 3QG1A 1SN8A 1BUVT 4DV5L 1J8IA 5BN4A 1VQ8A 5EBDA 1VQ5A 4Y7NB 1KXLA 2UXDL 5C5MA 2B29A 3K8AA 3J80E 2VL6A 1OO9B 3RD4A 2ZM6Q 4JBJA 5IYBG 5C3EB 4DXGA 4XQQA 5HGTA 1GHJA 1Y1VG 1GXDC 2IT1A 3UDXA 2CQOA 2F0WA 4OHJA 3HOWB 1F9PA 1I6VC 2QW7A 3EIVA 5GROA 3GTMH 5DLQE 4JOIA 1K3BC 2EQSA 2A8VA 3EJIA 5KRUA 2QILA 2VS1A 3GO5A 2K6AA 1BBWA 2V4DA 5JAVA 3CPWA 1I94L 3QJYA 2KCNA 5LL6S 2VQEQ 5EQ0A 4KY7A 4EQPA 4B3MQ 3CKIB 1ZXTA 4RKBA 2KVMA 3FVQA 5EPKA 3GTOB 1FL0A 2G9DA 1I6HH 2CWAA 2Y0SG 4OIJA 3U50C 2E2JH 1U4MA 2L4NA 1ONLA 2NN6G 2RF4A 1JE5A 4A93H 4HJ7A 2KCTA 3E6ZX 3TS2A 1M8AA 1VQJA 2EY1A 4RG1A 4DAPA 1E1TA 5IGFA 4RGMA 1Z9FA 3R8BA 4F8MA 2XVSA 1RTOA 3D8GA 3Q24A 2E76C 2WAQG 4XT1B 5CR3A 3PGZA 2RSOA 4B9XA 1EWCA 2DY7A 4HAEA 4ALPA 1VQ6A 1WTHA 4K2KA 4HMIA 3H3VH 1M90C 1B3AA 1MSGA 3I4NG 4LF4L 4X62L 1BDOA 1M4VA 3U58A 1PH1A 2EYHA 2D5DA 1PZJD 1HUMA 2KOLA 2BE5D 1XMOL 2LXJA 2C35B 3KF6A 2IHEA 5KNCA 1KDAA 4OXPA 3SVMA 1K28A 1PTOD 2EYPA 1LYLA 2IJ0A 5C44G 1TVXA 1AP0A 1DOKA 4KY5A 2JYOA 5D3IB 4DV6Q 3J7AV 1QCBD 1GJXA 4IUNA 4X64L 2UUBL 1VQMA 4FVMA 4RGTA 2L55A 1J5EQ 3KLSX 3QOJA 5FO7B 1Y1VB 3BVMA 2KHJA 5FLXE 2NVXB 5I9OA 4H0LC 4C3IB 1WTQA 2K7VA 1MJCA 2F0JA 2EYLA 4C3HH 1SBBB 5KNDA 3B6YA 3M3YH 1PH8A 1JCKB 5EKIA 3MFGA 4DR2L 1BO0A 1I4RA 2F0LA 3H91A 3I3CA 4BY1G 4DR1L 1EFWA 4LF9L 4GOPC 1SDFA 4FO2A 2VUMG 2DUDA 4NKLA 2RA4A 4YIJA 2PZTA 4OGQC 1ILPA 1GUNA 4DR5L 2KHSA 4U673 1F77A 3GTMB 1HNWQ 1LT3D 3GTJH 4R4IA 2UUCL 1N33L 2HT1A 1N32L 4H02A 2F0TA 2X6GA 3RZOH 1EIHA 1AFPA 4LW1A 1NSNS 4ID6A 2JK8A 1KTKA 1R9TB 4DV7L 2L11A 2QDLA 4JI5Q 5IP9G 2MFIA 4KD4A 4CGYB 3I70A 4KKUA 3VR4A 4PZ8A 3KF6B 2PW5A 2R3ZA 2WAQB 4KK7A 3QOLA 2C9OA 4L63B 1I6HB 1JOQA 1Q82C 2E2JB 3D4WA 3I4NB 3L0OA 2L5TA 4C2MB 1HUNA 3I4MG 2IPKD 1QVFA 3CRLC 4F87A 1H95A 1D1IA 1CSQA 1B2TA 2PMZB 3G48A 1BBUA 1PYSB 2F3WA 4KN4C 2ZJPA 1BCPD 1FNVA 3CCEA 1DOMA 2EPBA 4GOPA 1OTCA 1C7YA 3UE0A 5IT9c 1SFOH 1CM9A 2JSOA 1BOSA 1NCVA 2ZJRA 1SSOA 1HH2P 1SYFA 2K1BA 4FXKC 3MHBA 2F0GA 3NWTA 5C0XI 4JCVE 2HIVA 4R8NA 3F2CA 3PO3G 3TN2A 1LABA 1SJED 4R4CA 1YI2A 1X56A 2R7ZG 5M3MG 4JG2A 2E2DC 4HSVA 3VDYA 2RHSB 5M3FG 2NVQB 1N36L 4BY1B 5DNFA 1X65A 2A6HD 3FPPA 4HSPA 1BNZA 4BBRG 2ZM6L 1E1OA 4QMGA 2SDFA 2AMCB 3S16H 3BZDB 2J7ZA 3VYUA 1YJ9A 3FP9A 2R92H 4POGA 1Y8OB 3V96A 3M3YB 2N55A 2VW9A 1ESFA 2EXZA 3S2DH 3K0YA 1EY0A 2ES2A 4ZUIA 1DYQA 3TBIB 3C3LA 2VQEL 1DGSA 2RVLA 4B3ML 3S1MH 3H0GH 4N9TA 4RGNA 4OWWB 1H9JA 4ILWA 1JR0D 4JI2Q 4CJ0B 1VQGA 2OWOA 4UPAA 4NW2A 1UAPA 4GOPB 5FO9B 3HOYG 5KEEA 4JYAQ 3FEWX 3Q0AA 4L5QA 3I4MB 3DM3A 5AJ3L 2Y0SE 5C5LA 4J8QA 5NUCA 2O5JC 1D5XC 4APVA 1IZ6A 4XQJA 2QCPX 3HGBA 5IIFA 4DR6Q 4HJ8A 3OIPA 3PMFA 3WWVA 1HJPA 1EQVA 1AE3A 4DF7A 1H9RA 4V0BA 1JT8A 1S5ED 1TWCH 4ZKCB 3TDQA 4JI0Q 4ABNA 4LWCA 3W2DA 3K0XA 1X6OA 1NJIC 3KYHC 1KABA 1DONA 1WVLA 3VR5A 3EN2A 2Z1CA 1GD7A 2WAQE 1ML0D 4RHSA 5CGKA 1MD2D 4HJAA 4HIMA 1K3RA 3UE1A 1Q90A 4R4QA 3PO3B 3VYTA 1AN8A 5CV5A 3C2PA 5DEHA 1IL8A 4LAAA 2F3IA 3PO2G 5M3MB 4DNTB 4DN4M 1CZWA 1CKMA 2MUYA 1SFOB 2KQ3A 2LFNA 2RDHA 1YNJC 3W3AA 2B2VC 1EQQA 2JA8H 4DV6L 1XTCD 1PH7A 4BBRB 2CW0C 2KENA 2KA7A 3S15H 4MHEA 1J5EL 3CMAA 4OO1I 2HQEA
chains in the Genus database with same CATH topology
4YY3L 5IYDH 4DK3C 3LGJA 5M3MH 1N9WA 1PH9A 3HOWH 5LMUL 1YIJA 1CKOA 4IJLA 3K7UC 1C9OA 2NVYH 4A3JG 1W2BA 2UU9L 1NE3A 1VQBA 4JBMA 5H1SE 1NTGA 5M3FH 3HFZB 4IOCA 3HOZG 2A1AA 2ASBA 1B70B 3GTQH 2UXCQ 5HGQA 1PH6A 4A3EH 3E0EA 4A3DG 4BBRH 5JEAJ 1HZAA 4YHHQ 4GLVB 4LF6Q 2AWNA 1MKHA 1S3OA 3AQQA 4PZ7A 2D62A 4DR2Q 1EOVA 2BA1A 1HZCA 2ALYB 4DR1Q 2E8GA 3K81C 4YCWA 2IHFA 3ZJYC 5C3EG 4GLAC 2Q2HA 1FVIA 3EBEA 3ULPA 4YWMA 2H5XA 3CCRA 1XPRA 2N78A 4C3JH 4DV1Q 1AH9A 3CF5A 4Y52H 3BZCA 3CCJA 1XMQQ 4GN5A 4PZ6A 5IWAQ 3PUVA 4O0AA 5AJ3Q 1WOCA 1XNQQ 1XJVA 2R7DA 1XPUA 4EX5A 2VQFL 4A3BG 1N34L 4DR5Q 1E3PA 4YWLA 1HNWL 1V43A 4L5TA 1WI5A 1G51A 5C4JH 2JEBI 1Q86C 4DPGA 4PMWA 1KC8C 3FKIG 5FJ8H 2CWPA 2L15A 2D0OA 1GO3E 3OYYA 2AHOB 4FDBA 4JI5L 3G71A 1PH5A 3RNUA 3PUZA 1TWAH 4DV0Q 3JAMc 2HIXA 3TRZA 1QZGA 3NENA 3CCUA 1TWFH 1YBYA 1UE7A 5GAHC 3HOYH 4A93G 2K50A 4JI8L 1XNRQ 3PIOA 4HIDA 1PV4A 4OWXB 1L1OA 4X65L 2K5VA 1KRTA 1Y1WH 4X6AH 2I5HA 1B7YB 4R4OA 3PUYA 1VQ7A 3PCOB 2ZTCA 1JJGA 1X3EA 3ULLA 1PVOA 3PIPA 1MIUA 3MXNB 3W1BA 4NXML 4B3TQ 3S1RH 4A3IH 3CMEA 1E7ZA 1Q46A 1VQKA 2VZAA 3HOXH 1A8VA 4JOIC 4LUOA 4IFDG 2VY3A 3AFPA 4AIMA 5JJLA 1YJNA 1IL2A 5FLMH 4LFCQ 3S14H 1IXRA 2A19A 1GM5A 4R1JA 3ER0A 5IP7G 2K5HA 1OXTA 1EQRA 1L2FA 1HNXL 4OX9L 1HNZQ 3F2BA 1X9NA 1NMFA 1QUQA 1EUJA 1YEZA 1VQLA 2UXBQ 1P8LA 3KLWA 4DV2L 2UU9Q 1Q1EA 1PH4A 4UY8C 5LMNQ 1LUZA 3RN5A 3KOJA 3M7NA 5LMNW 2NZHA 1OXVA 1SR3A 4DR3L 3RZDH 3PO2H 1E24A 1NMGA 4GKKQ 1PFSA 3TEHB 4L5RC 1K8GA 3ULJA 3HOUH 1I5FA 1UWVA 3TREA 4BA1I 4C3IH 3T1HL 4XIGS 1Q8KA 2WFWA 4IJHA 3S17H 3JC66 3J81i 1CSPA 5IYCG 4DV4L 1K9MC 1SN8A 4R4TA 2MQHA 3F1ZA 2ZTDA 2FXQA 1A62A 4ME3A 4BXXH 5IY0A 1S72A 4DV5L 4A3KH 2IX1A 3NELA 1VQ8A 1FJGQ 4LFAL 1VQ5A 2VQFQ 1KXLA 2UXDL 5BR8Q 2NVTH 4A3JH 2B29A 3FHWA 3K8AA 2VL6A 4JI7Q 4A3MG 2ZM6Q 4JBJA 5IYBG 3KDFA 3HOZH 2EXDA 3L2PA 4A3DH 4BY7G 1Y1VG 2IT1A 3CCVA 1X3FA 3UDXA 2CQOA 2GN5A 3CAMA 4LF8L 4YCVA 4AQYL 1X54A 3CC7A 3EIVA 5HY6A 4Y7NH 1EYGA 5GROA 3GTMH 5DLQE 2VNUD 2WB1E 1P16A 2V1CC 1J6QA 4P75A 3A5ZB 4GNXC 4JOIA 2YV5A 2EQSA 4P71A 4QY7A 5C3EH 2A8VA 3M85A 2K14A 2VS1A 1TWGH 3GO5A 3CC2A 1JJCB 1BBWA 1K0RA 2N8NA 3I4OA 2JA6G 1K83H 3J7ZC 3CPWA 3AYHB 2QA4A 3PUXA 1I94L 4JC0A 1HR0L 2F4VQ 3GTLH 1OXUA 1IBMQ 1CUKA 2VQEQ 1B8AA 1S40A 1KHIA 3M9BA 1VQNA 4A3BH 4B3MQ 4DR7L 4MNOA 4AYBG 5ELOA 3CCSA 1IBKL 4TVAB 2WP8J 4IPHA 3KF8B 5C4XG 4KI0A 4JI2L 1XTDA 4LF5Q 1AE2A 2BA0A 2PNHA 2ATWA 1FL0A 3FKIH 1Y14B 1IYJB 1RL2A 2R7FA 2MNAA 4OWTB 2E5LQ 2JA5G 2CWAA 2Y0SG 4L5SA 1I6HH 2Z0SA 3U50C 3U4ZA 4OO1I 4JYAL 2E2JH 2HHHL 2DGYA 1D7QA 4OX9Q 4YCUA 4OO1G 2NN6G 3ERSX 4MTNA 2RF4A 1JE5A 3W5OA 3UDGA 4HJ7A 2KCTA 4X66L 4A93H 3CPFA 1VQFA 4JI3Q 2XGTA 4JI4Q 3TS2A 1Q12A 2LSSA 3GTOH 1VQJA 3K80C 4RG1A 3JAMi 1CKNA 4B3SQ 4LFBQ 4JV5L 3CP0A 4YWKA 1K8AC 1OXSC 1E1TA 2PQAA 2CCZA 4DR6L 4IPCA 1ASYA 1Z9FA 2Q2TA 3Q8DA 3J80c 4QQBX 3K7AH 2WAQG 1X55A 2PI2E 4IFDJ 2UUAL 4JI6Q 1KAWA 5C0XG 5GQOA 3RLNA 3GDEA 4JI0L 3PGZA 1PHJA 4HJ9A 1IBLL 4A4IA 4ALPA 1VQ6A 1T9HA 2YTYA 1KQSA 3H3VH 1M90C 3ICEA 3I4NG 1YVCA 2YYZA 4LF4L 4X62L 5M5XH 5IP7H 2ZTEA 3GD7A 5GAEC 3U58A 2JE6I 2Q2IA 3HKZE 1PH1A 3GTGH 1YHAA 5M5YH 4A3CG 3DLLA 4GKJQ 4IPGA 4GNXA 1XMOL 2K4KA 5J3BA 4A3FG 1I3QH 2LXJA 2C35B 4DUZL 1KL9A 2LXKA 3KF6A 2IHEA 3S2HH 4K0KQ 2K5NA 5JEAG 4OXPA 3L7ZC 1VQDA 2N3SA 3T1YL 4OONA 1KIXA 4LF8Q 1SE8A 3CCLA 4LNQA 4IFDI 4AQYQ 3E9HA 1EIFA 1LYLA 1YHQA 5C44G 3H3VI 2YTXA 2Z6KC 4DV6Q 4X64L 4KHPL 2UUBL 1VQMA 4DR4Q 4DUYQ 2OQKA 1J5EQ 4LF7Q 5IYCH 1VQIA 4JI1Q 1OXXK 2JA7G 2IX0A 4YY3Q 3CC4A 3CD6A 2RHQB 1UE6A 2KHJA 3S1NH 1YZ6A 3CQZH 5LMUQ 4DAYB 1JJ2A 4J15A 1HR0W 2UXCL 2IY5B 1MJCA 4NPSA 4C3HH 2AWOA 1E22A 2MO1A 2I5MX 3B6YA 1Q81C 2YU9H 4YHHL 4A3MH 1PH8A 3M3YH 4QL5A 5IYBH 3H15A 1I50H 3CCQA 1L0WA 4BY7H 4DR2L 3SGIA 2R92G 1Y1VH 2YTVA 4A76A 3CCMA 4BY1G 3M4OH 4DR1L 3PF5A 1EFWA 2N49A 2NVXH 3OTOL 4GOPC 4LF9L 2HHHQ 3BJUA 3MEFA 4DV1L 2VUMG 1CKNB 3HOVG 1VQOA 1VQPA 1PH2A 2DUDA 2PQAB 5IWAL 1U0LA 4QIWE 2ID0A 4BBSG 4A3GG 4KLKA 4A3LG 4NXNL 4POFA 4DR5L 2JA6H 2OTJA 1N34Q 1HNWQ 3GTJH 2UUCL 4R4IA 1N33L 1WCMG 2B63G 3H0GG 1U5KA 2GVAA 4GN4B 2HT1A 2K75A 1N32L 4H02A 3RZOH 2QEXA 4LW1A 2UUAQ 5K36G 5C4XH 1UE1A 2BH8A 2JK8A 4A75A 4DV7L 1RIPA 4JI5Q 4DV0L 4HIKA 1L1OB 1HZBA 5IP9G 2MFIA 4GNXB 1QVGA 2JA5H 3M4QA 1PA6A 3G6EA 4IPDA 4JBWA 4JI8Q 4P72A 4PZ8A 2Z6KA 1SROA 3KF6B 4RMFA 4DAMA 4X65Q 2EIFA 1VQCA 1R9TH 3RR5A 1Q7YC 3F2DA 1YJWA 1Q82C 5M5WH 3TS0A 2JQOA 3NBHB 4B3RL 3D31A 4NXMQ 3L0OA 2CFMA 3J81j 4XTCS 5C0XJ 1EIYB 3I4MG 1QVFA 2PMZE 1WFQA 3RN2A 3STBD 4DV3L 1H95A 3I2ZA 1CSQA 1YNXA 2XTIA 3D0FA 4DK6C 3G48A 3A74A 1WYDA 1BBUA 3J80i 1PYSB 4X64Q 4HJ5A 3KJOA 2ZJPA 4GLXA 1QUQB 1JB7A 3CCEA 4JBKA 4KHPQ 3HKSA 2NN6I 4GS3A 3I4NH 1HNZL 1HNXQ 2JJQA 4GOPA 1OTCA 4C2MH 1C7YA 2OTLA 3UE0A 5IT9c 1SFOH 2QGQA 4QGUA 4A3CH 5JJKA 2UXBL 4DKAC 4UP7A 2R93G 3U4VA 4DV2Q 2ZJRA 3UDIA 5LMNL 3PV0A 4A3KG 4A3FH 1X3GA 2MO0A 1HH2P 4WJ3M 2ZJQA 1A0IA 5GAGC 1LM0A 4IOAA 2R6GA 4DR3Q 5C0XI 3RLFA 1VQEA 2HIVA 4JCVE 3G4SA 4GKKL 3F2CA 2JA8G 3PO3G 4O2DA 1PYBA 4LF9Q 3OTOQ 2E2HH 4R4CA 5C44H 3AEVA 3T1HQ 4HIOA 1K73C 2BH2A 1YI2A 1X56A 2RCNA 1GKHA 2R7ZG 5IYDG 4DV4Q 5E7NA 3W1GA 4JG2A 5M3MG 3HOWG 3BZKA 3I55A 3OW2A 2E2IH 3VDYA 1FJGL 4DV5Q 1G291 4JI7L 2JA7H 2RHSB 3KDFB 4LFAQ 5M3FG 4NXNQ 5BR8L 1QVCA 1VQ9A 1N36L 2UXDQ 1WJJA 1X65A 1SRUA 4A3EG 1MJEA 2NZOA 4NB3A 2UUCQ 4BBRG 1V9PA 2ZM6L 1N33Q 3S1QH 1E1OA 1N32Q 2WB1G 2D0PA 2AMCB 3S16H 1BKBA 1W3SA 1XPOA 1C0AA 4DV7Q 1N8RC 1YJ9A 3FP9A 2R92H 1QZHA 5IE8A 1YHBA 2NVQH 1VS0A 4BY1H 4IO9A 4GN3B 4POGA 2I0QA 4EQ5A 4LUVA 2VW9A 1A63A 1TWHH 3AFQA 2VUMH 3HOVH 3S2DH 2ES2A 3BU2A 2GVBA 5EAYA 3I56A 4BBSH 4A3GH 1I94Q 1HR0Q 2F4VL 1IBML 1KRSA 2VQEL 1DGSA 3GTKH 3RLOA 4A3LH 4B3ML 1UEBA 1SLJA 3S1MH 4DR7Q 4B3RQ 1NY4A 1WCMH 3UDFA 3H0GH 1SMXA 1IBKQ 5FJ8G 4OWWB 5GADC 2B63H 3M4PA 4LF6L 4LF5L 4JI2Q 1VQGA 2HQLA 4DV3Q 1KD1C 1FGUA 2OWOA 4UP8A 3PSIA 4UPAA 4BA2I 2E5LL 3CW2C 4GOPB 1YITA 3HOYG 1PH3A 4AYBE 3PF4A 4WJ4A 1Q1BA 4JYAQ 1UE5A 5IP9H 1Y1WG 1VQ4A 2OQ0A 4L5QA 3CXCA 4LUZA 1XMQL 4JI3L 3STBC 4X66Q 4JI4L 1V1QA 3DM3A 2AKWB 2Y0SE 5AJ3L 1XNQL 3GTPH 1O7IA 1HZ9A 1IZ6A 2KBNA 3A0JA 4APVA 4B3SL 4JV5Q 4LFBL 5JJIA 1G6PA 4AH6A 4MZ9A 4A3IG 2B3GA 4DR6Q 1VCIA 4HJ8A 1BVSA 3WWVA 3HOXG 1HJPA 1AE3A 1JMCA 3KFUA 4QJFA 1JT8A 3E9IA 2KHIA 4JI6L 3HKZG 1TWCH 1M1KC 5FLMG 4P73A 3I4MH 1TXYA 5ELNA 4JI0Q 4LWCA 1IBLQ 2JA9A 1Z47A 3K0XA 3S24A 1LTLA 1X6OA 2K52A 3KYHC 1NJIC 3TQYA 3EN2A 1VQHA 3A5UA 4LF4Q 2OCEA 1GD7A 2WAQE 4X62Q 3PUWA 1ASZA 2PI2A 1GVPA 1XNRL 4KHZA 4HIMA 4HJAA 4GKJL 1K3RA 2F52A 4PG3A 3UE1A 3IRBA 2Q2UA 1EWIA 4R4QA 1XMOQ 1N36Q 4TQUS 1D8LA 3KJPA 2R93H 4DUZQ 2JEAI 5FLXc 2I5LX 1VQAA 4K0KL 3J81c 4B3TL 2F3IA 3PO2G 3NEMA 3T1YQ 1CKMA 3F8TA 3HOUG 3I7FA 4DNIA 4P74A 4LFCL 1EQQA 2JA8H 4DV6L 3PO3H 1L1OC 4UP9A 1PH7A 3S15H 2CKZB 2KENA 4DUYL 4DR4L 2UUBQ 3J7A5 1J5EL 3CMAA 4BXXG 4LF7L 2KCMA 4JI1L 2R7ZH 1NBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 L;  5IYD H;  4DK3 C;  3LGJ A;  5M3M H;  1N9W A;  1PH9 A;  3HOW H;  5LMU L;  1YIJ A;  1CKO A;  4IJL A;  3K7U C;  1C9O A;  2NVY H;  4A3J G;  1W2B A;  2UU9 L;  1NE3 A;  1VQB A;  4JBM A;  5H1S E;  1NTG A;  5M3F H;  3HFZ B;  4IOC A;  3HOZ G;  2A1A A;  2ASB A;  1B70 B;  3GTQ H;  2UXC Q;  5HGQ A;  1PH6 A;  4A3E H;  3E0E A;  4A3D G;  4BBR H;  5JEA J;  1HZA A;  4YHH Q;  4GLV B;  4LF6 Q;  2AWN A;  1MKH A;  1S3O A;  3AQQ A;  4PZ7 A;  2D62 A;  4DR2 Q;  1EOV A;  2BA1 A;  1HZC A;  2ALY B;  4DR1 Q;  2E8G A;  3K81 C;  4YCW A;  2IHF A;  3ZJY C;  5C3E G;  4GLA C;  2Q2H A;  1FVI A;  3EBE A;  3ULP A;  4YWM A;  2H5X A;  3CCR A;  1XPR A;  2N78 A;  4C3J H;  4DV1 Q;  1AH9 A;  3CF5 A;  4Y52 H;  3BZC A;  3CCJ A;  1XMQ Q;  4GN5 A;  4PZ6 A;  5IWA Q;  3PUV A;  4O0A A;  5AJ3 Q;  1WOC A;  1XNQ Q;  1XJV A;  2R7D A;  1XPU A;  4EX5 A;  2VQF L;  4A3B G;  1N34 L;  4DR5 Q;  1E3P A;  4YWL A;  1HNW L;  1V43 A;  4L5T A;  1WI5 A;  1G51 A;  5C4J H;  2JEB I;  1Q86 C;  4DPG A;  4PMW A;  1KC8 C;  3FKI G;  5FJ8 H;  2CWP A;  2L15 A;  2D0O A;  1GO3 E;  3OYY A;  2AHO B;  4FDB A;  4JI5 L;  3G71 A;  1PH5 A;  3RNU A;  3PUZ A;  1TWA H;  4DV0 Q;  3JAM c;  2HIX A;  3TRZ A;  1QZG A;  3NEN A;  3CCU A;  1TWF H;  1YBY A;  1UE7 A;  5GAH C;  3HOY H;  4A93 G;  2K50 A;  4JI8 L;  1XNR Q;  3PIO A;  4HID A;  1PV4 A;  4OWX B;  1L1O A;  4X65 L;  2K5V A;  1KRT A;  1Y1W H;  4X6A H;  2I5H A;  1B7Y B;  4R4O A;  3PUY A;  1VQ7 A;  3PCO B;  2ZTC A;  1JJG A;  1X3E A;  3ULL A;  1PVO A;  3PIP A;  1MIU A;  3MXN B;  3W1B A;  4NXM L;  4B3T Q;  3S1R H;  4A3I H;  3CME A;  1E7Z A;  1Q46 A;  1VQK A;  2VZA A;  3HOX H;  1A8V A;  4JOI C;  4LUO A;  4IFD G;  2VY3 A;  3AFP A;  4AIM A;  5JJL A;  1YJN A;  1IL2 A;  5FLM H;  4LFC Q;  3S14 H;  1IXR A;  2A19 A;  1GM5 A;  4R1J A;  3ER0 A;  5IP7 G;  2K5H A;  1OXT A;  1EQR A;  1L2F A;  1HNX L;  4OX9 L;  1HNZ Q;  3F2B A;  1X9N A;  1NMF A;  1QUQ A;  1EUJ A;  1YEZ A;  1VQL A;  2UXB Q;  1P8L A;  3KLW A;  4DV2 L;  2UU9 Q;  1Q1E A;  1PH4 A;  4UY8 C;  5LMN Q;  1LUZ A;  3RN5 A;  3KOJ A;  3M7N A;  5LMN W;  2NZH A;  1OXV A;  1SR3 A;  4DR3 L;  3RZD H;  3PO2 H;  1E24 A;  1NMG A;  4GKK Q;  1PFS A;  3TEH B;  4L5R C;  1K8G A;  3ULJ A;  3HOU H;  1I5F A;  1UWV A;  3TRE A;  4BA1 I;  4C3I H;  3T1H L;  4XIG S;  1Q8K A;  2WFW A;  4IJH A;  3S17 H;  3JC6 6;  3J81 i;  1CSP A;  5IYC G;  4DV4 L;  1K9M C;  1SN8 A;  4R4T A;  2MQH A;  3F1Z A;  2ZTD A;  2FXQ A;  1A62 A;  4ME3 A;  4BXX H;  5IY0 A;  1S72 A;  4DV5 L;  4A3K H;  2IX1 A;  3NEL A;  1VQ8 A;  1FJG Q;  4LFA L;  1VQ5 A;  2VQF Q;  1KXL A;  2UXD L;  5BR8 Q;  2NVT H;  4A3J H;  2B29 A;  3FHW A;  3K8A A;  2VL6 A;  4JI7 Q;  4A3M G;  2ZM6 Q;  4JBJ A;  5IYB G;  3KDF A;  3HOZ H;  2EXD A;  3L2P A;  4A3D H;  4BY7 G;  1Y1V G;  2IT1 A;  3CCV A;  1X3F A;  3UDX A;  2CQO A;  2GN5 A;  3CAM A;  4LF8 L;  4YCV A;  4AQY L;  1X54 A;  3CC7 A;  3EIV A;  5HY6 A;  4Y7N H;  1EYG A;  5GRO A;  3GTM H;  5DLQ E;  2VNU D;  2WB1 E;  1P16 A;  2V1C C;  1J6Q A;  4P75 A;  3A5Z B;  4GNX C;  4JOI A;  2YV5 A;  2EQS A;  4P71 A;  4QY7 A;  5C3E H;  2A8V A;  3M85 A;  2K14 A;  2VS1 A;  1TWG H;  3GO5 A;  3CC2 A;  1JJC B;  1BBW A;  1K0R A;  2N8N A;  3I4O A;  2JA6 G;  1K83 H;  3J7Z C;  3CPW A;  3AYH B;  2QA4 A;  3PUX A;  1I94 L;  4JC0 A;  1HR0 L;  2F4V Q;  3GTL H;  1OXU A;  1IBM Q;  1CUK A;  2VQE Q;  1B8A A;  1S40 A;  1KHI A;  3M9B A;  1VQN A;  4A3B H;  4B3M Q;  4DR7 L;  4MNO A;  4AYB G;  5ELO A;  3CCS A;  1IBK L;  4TVA B;  2WP8 J;  4IPH A;  3KF8 B;  5C4X G;  4KI0 A;  4JI2 L;  1XTD A;  4LF5 Q;  1AE2 A;  2BA0 A;  2PNH A;  2ATW A;  1FL0 A;  3FKI H;  1Y14 B;  1IYJ B;  1RL2 A;  2R7F A;  2MNA A;  4OWT B;  2E5L Q;  2JA5 G;  2CWA A;  2Y0S G;  4L5S A;  1I6H H;  2Z0S A;  3U50 C;  3U4Z A;  4OO1 I;  4JYA L;  2E2J H;  2HHH L;  2DGY A;  1D7Q A;  4OX9 Q;  4YCU A;  4OO1 G;  2NN6 G;  3ERS X;  4MTN A;  2RF4 A;  1JE5 A;  3W5O A;  3UDG A;  4HJ7 A;  2KCT A;  4X66 L;  4A93 H;  3CPF A;  1VQF A;  4JI3 Q;  2XGT A;  4JI4 Q;  3TS2 A;  1Q12 A;  2LSS A;  3GTO H;  1VQJ A;  3K80 C;  4RG1 A;  3JAM i;  1CKN A;  4B3S Q;  4LFB Q;  4JV5 L;  3CP0 A;  4YWK A;  1K8A C;  1OXS C;  1E1T A;  2PQA A;  2CCZ A;  4DR6 L;  4IPC A;  1ASY A;  1Z9F A;  2Q2T A;  3Q8D A;  3J80 c;  4QQB X;  3K7A H;  2WAQ G;  1X55 A;  2PI2 E;  4IFD J;  2UUA L;  4JI6 Q;  1KAW A;  5C0X G;  5GQO A;  3RLN A;  3GDE A;  4JI0 L;  3PGZ A;  1PHJ A;  4HJ9 A;  1IBL L;  4A4I A;  4ALP A;  1VQ6 A;  1T9H A;  2YTY A;  1KQS A;  3H3V H;  1M90 C;  3ICE A;  3I4N G;  1YVC A;  2YYZ A;  4LF4 L;  4X62 L;  5M5X H;  5IP7 H;  2ZTE A;  3GD7 A;  5GAE C;  3U58 A;  2JE6 I;  2Q2I A;  3HKZ E;  1PH1 A;  3GTG H;  1YHA A;  5M5Y H;  4A3C G;  3DLL A;  4GKJ Q;  4IPG A;  4GNX A;  1XMO L;  2K4K A;  5J3B A;  4A3F G;  1I3Q H;  2LXJ A;  2C35 B;  4DUZ L;  1KL9 A;  2LXK A;  3KF6 A;  2IHE A;  3S2H H;  4K0K Q;  2K5N A;  5JEA G;  4OXP A;  3L7Z C;  1VQD A;  2N3S A;  3T1Y L;  4OON A;  1KIX A;  4LF8 Q;  1SE8 A;  3CCL A;  4LNQ A;  4IFD I;  4AQY Q;  3E9H A;  1EIF A;  1LYL A;  1YHQ A;  5C44 G;  3H3V I;  2YTX A;  2Z6K C;  4DV6 Q;  4X64 L;  4KHP L;  2UUB L;  1VQM A;  4DR4 Q;  4DUY Q;  2OQK A;  1J5E Q;  4LF7 Q;  5IYC H;  1VQI A;  4JI1 Q;  1OXX K;  2JA7 G;  2IX0 A;  4YY3 Q;  3CC4 A;  3CD6 A;  2RHQ B;  1UE6 A;  2KHJ A;  3S1N H;  1YZ6 A;  3CQZ H;  5LMU Q;  4DAY B;  1JJ2 A;  4J15 A;  1HR0 W;  2UXC L;  2IY5 B;  1MJC A;  4NPS A;  4C3H H;  2AWO A;  1E22 A;  2MO1 A;  2I5M X;  3B6Y A;  1Q81 C;  2YU9 H;  4YHH L;  4A3M H;  1PH8 A;  3M3Y H;  4QL5 A;  5IYB H;  3H15 A;  1I50 H;  3CCQ A;  1L0W A;  4BY7 H;  4DR2 L;  3SGI A;  2R92 G;  1Y1V H;  2YTV A;  4A76 A;  3CCM A;  4BY1 G;  3M4O H;  4DR1 L;  3PF5 A;  1EFW A;  2N49 A;  2NVX H;  3OTO L;  4GOP C;  4LF9 L;  2HHH Q;  3BJU A;  3MEF A;  4DV1 L;  2VUM G;  1CKN B;  3HOV G;  1VQO A;  1VQP A;  1PH2 A;  2DUD A;  2PQA B;  5IWA L;  1U0L A;  4QIW E;  2ID0 A;  4BBS G;  4A3G G;  4KLK A;  4A3L G;  4NXN L;  4POF A;  4DR5 L;  2JA6 H;  2OTJ A;  1N34 Q;  1HNW Q;  3GTJ H;  2UUC L;  4R4I A;  1N33 L;  1WCM G;  2B63 G;  3H0G G;  1U5K A;  2GVA A;  4GN4 B;  2HT1 A;  2K75 A;  1N32 L;  4H02 A;  3RZO H;  2QEX A;  4LW1 A;  2UUA Q;  5K36 G;  5C4X H;  1UE1 A;  2BH8 A;  2JK8 A;  4A75 A;  4DV7 L;  1RIP A;  4JI5 Q;  4DV0 L;  4HIK A;  1L1O B;  1HZB A;  5IP9 G;  2MFI A;  4GNX B;  1QVG A;  2JA5 H;  3M4Q A;  1PA6 A;  3G6E A;  4IPD A;  4JBW A;  4JI8 Q;  4P72 A;  4PZ8 A;  2Z6K A;  1SRO A;  3KF6 B;  4RMF A;  4DAM A;  4X65 Q;  2EIF A;  1VQC A;  1R9T H;  3RR5 A;  1Q7Y C;  3F2D A;  1YJW A;  1Q82 C;  5M5W H;  3TS0 A;  2JQO A;  3NBH B;  4B3R L;  3D31 A;  4NXM Q;  3L0O A;  2CFM A;  3J81 j;  4XTC S;  5C0X J;  1EIY B;  3I4M G;  1QVF A;  2PMZ E;  1WFQ A;  3RN2 A;  3STB D;  4DV3 L;  1H95 A;  3I2Z A;  1CSQ A;  1YNX A;  2XTI A;  3D0F A;  4DK6 C;  3G48 A;  3A74 A;  1WYD A;  1BBU A;  3J80 i;  1PYS B;  4X64 Q;  4HJ5 A;  3KJO A;  2ZJP A;  4GLX A;  1QUQ B;  1JB7 A;  3CCE A;  4JBK A;  4KHP Q;  3HKS A;  2NN6 I;  4GS3 A;  3I4N H;  1HNZ L;  1HNX Q;  2JJQ A;  4GOP A;  1OTC A;  4C2M H;  1C7Y A;  2OTL A;  3UE0 A;  5IT9 c;  1SFO H;  2QGQ A;  4QGU A;  4A3C H;  5JJK A;  2UXB L;  4DKA C;  4UP7 A;  2R93 G;  3U4V A;  4DV2 Q;  2ZJR A;  3UDI A;  5LMN L;  3PV0 A;  4A3K G;  4A3F H;  1X3G A;  2MO0 A;  1HH2 P;  4WJ3 M;  2ZJQ A;  1A0I A;  5GAG C;  1LM0 A;  4IOA A;  2R6G A;  4DR3 Q;  5C0X I;  3RLF A;  1VQE A;  2HIV A;  4JCV E;  3G4S A;  4GKK L;  3F2C A;  2JA8 G;  3PO3 G;  4O2D A;  1PYB A;  4LF9 Q;  3OTO Q;  2E2H H;  4R4C A;  5C44 H;  3AEV A;  3T1H Q;  4HIO A;  1K73 C;  2BH2 A;  1YI2 A;  1X56 A;  2RCN A;  1GKH A;  2R7Z G;  5IYD G;  4DV4 Q;  5E7N A;  3W1G A;  4JG2 A;  5M3M G;  3HOW G;  3BZK A;  3I55 A;  3OW2 A;  2E2I H;  3VDY A;  1FJG L;  4DV5 Q;  1G29 1;  4JI7 L;  2JA7 H;  2RHS B;  3KDF B;  4LFA Q;  5M3F G;  4NXN Q;  5BR8 L;  1QVC A;  1VQ9 A;  1N36 L;  2UXD Q;  1WJJ A;  1X65 A;  1SRU A;  4A3E G;  1MJE A;  2NZO A;  4NB3 A;  2UUC Q;  4BBR G;  1V9P A;  2ZM6 L;  1N33 Q;  3S1Q H;  1E1O A;  1N32 Q;  2WB1 G;  2D0P A;  2AMC B;  3S16 H;  1BKB A;  1W3S A;  1XPO A;  1C0A A;  4DV7 Q;  1N8R C;  1YJ9 A;  3FP9 A;  2R92 H;  1QZH A;  5IE8 A;  1YHB A;  2NVQ H;  1VS0 A;  4BY1 H;  4IO9 A;  4GN3 B;  4POG A;  2I0Q A;  4EQ5 A;  4LUV A;  2VW9 A;  1A63 A;  1TWH H;  3AFQ A;  2VUM H;  3HOV H;  3S2D H;  2ES2 A;  3BU2 A;  2GVB A;  5EAY A;  3I56 A;  4BBS H;  4A3G H;  1I94 Q;  1HR0 Q;  2F4V L;  1IBM L;  1KRS A;  2VQE L;  1DGS A;  3GTK H;  3RLO A;  4A3L H;  4B3M L;  1UEB A;  1SLJ A;  3S1M H;  4DR7 Q;  4B3R Q;  1NY4 A;  1WCM H;  3UDF A;  3H0G H;  1SMX A;  1IBK Q;  5FJ8 G;  4OWW B;  5GAD C;  2B63 H;  3M4P A;  4LF6 L;  4LF5 L;  4JI2 Q;  1VQG A;  2HQL A;  4DV3 Q;  1KD1 C;  1FGU A;  2OWO A;  4UP8 A;  3PSI A;  4UPA A;  4BA2 I;  2E5L L;  3CW2 C;  4GOP B;  1YIT A;  3HOY G;  1PH3 A;  4AYB E;  3PF4 A;  4WJ4 A;  1Q1B A;  4JYA Q;  1UE5 A;  5IP9 H;  1Y1W G;  1VQ4 A;  2OQ0 A;  4L5Q A;  3CXC A;  4LUZ A;  1XMQ L;  4JI3 L;  3STB C;  4X66 Q;  4JI4 L;  1V1Q A;  3DM3 A;  2AKW B;  2Y0S E;  5AJ3 L;  1XNQ L;  3GTP H;  1O7I A;  1HZ9 A;  1IZ6 A;  2KBN A;  3A0J A;  4APV A;  4B3S L;  4JV5 Q;  4LFB L;  5JJI A;  1G6P A;  4AH6 A;  4MZ9 A;  4A3I G;  2B3G A;  4DR6 Q;  1VCI A;  4HJ8 A;  1BVS A;  3WWV A;  3HOX G;  1HJP A;  1AE3 A;  1JMC A;  3KFU A;  4QJF A;  1JT8 A;  3E9I A;  2KHI A;  4JI6 L;  3HKZ G;  1TWC H;  1M1K C;  5FLM G;  4P73 A;  3I4M H;  1TXY A;  5ELN A;  4JI0 Q;  4LWC A;  1IBL Q;  2JA9 A;  1Z47 A;  3K0X A;  3S24 A;  1LTL A;  1X6O A;  2K52 A;  3KYH C;  1NJI C;  3TQY A;  3EN2 A;  1VQH A;  3A5U A;  4LF4 Q;  2OCE A;  1GD7 A;  2WAQ E;  4X62 Q;  3PUW A;  1ASZ A;  2PI2 A;  1GVP A;  1XNR L;  4KHZ A;  4HIM A;  4HJA A;  4GKJ L;  1K3R A;  2F52 A;  4PG3 A;  3UE1 A;  3IRB A;  2Q2U A;  1EWI A;  4R4Q A;  1XMO Q;  1N36 Q;  4TQU S;  1D8L A;  3KJP A;  2R93 H;  4DUZ Q;  2JEA I;  5FLX c;  2I5L X;  1VQA A;  4K0K L;  3J81 c;  4B3T L;  2F3I A;  3PO2 G;  3NEM A;  3T1Y Q;  1CKM A;  3F8T A;  3HOU G;  3I7F A;  4DNI A;  4P74 A;  4LFC L;  1EQQ A;  2JA8 H;  4DV6 L;  3PO3 H;  1L1O C;  4UP9 A;  1PH7 A;  3S15 H;  2CKZ B;  2KEN A;  4DUY L;  4DR4 L;  2UUB Q;  3J7A 5;  1J5E L;  3CMA A;  4BXX G;  4LF7 L;  2KCM A;  4JI1 L;  2R7Z H;  1NBW A; 
#chains in the Genus database with same CATH topology
 1ET6 A;  2PYK A;  1D5Z C;  1PH9 A;  1YIJ A;  4A3J G;  3RUZ A;  4JBM A;  1VQB A;  2A6E D;  1NTG A;  4IOC A;  1EEI D;  4IUQ A;  3HOZ G;  3GTQ H;  4R8I A;  1FYC A;  3EQL C;  5A2Q E;  1KDB A;  1HZC A;  5JPN C;  1G8Z D;  4FXD A;  2A73 B;  2Q2H A;  1FVI A;  2ICE C;  2XNA C;  2B2T C;  2H5X A;  5C4J B;  1XPR A;  3HRZ C;  3K6O A;  4GN5 A;  5IWA Q;  3Q6S A;  1XNQ Q;  1I4Q A;  1XPU A;  2L1B A;  3OWF A;  1PFB A;  1IW7 D;  4YWL A;  1HNW L;  4BS9 A;  3HOY B;  3TP7 A;  4HTH A;  2JEB I;  1Q86 C;  3LNN A;  1SNO A;  1KC8 C;  3FKI G;  5AFW A;  2WV6 D;  2L15 A;  2D0O A;  3OYY A;  4JI5 L;  1O7Y A;  3G71 A;  5E1F A;  5CC4 A;  3KLS A;  3PUZ A;  1TWA H;  4DV0 Q;  4UDU C;  3TRZ A;  3NEN A;  4IUV A;  5GAH C;  3N6R A;  1STY A;  1C4Q A;  3PIO A;  2B2V A;  3MFY A;  1V1P A;  2TMP A;  1HA5 A;  2NTS A;  1EY4 A;  3NE5 B;  3FDT A;  3VA7 A;  3SK5 A;  3NQI A;  3DWA A;  4B3T Q;  4A3I H;  2I07 B;  3WDN A;  1HTP A;  1Q46 A;  2A68 C;  4IFD G;  3T56 B;  2SEB D;  4NP5 A;  1YJN A;  4LFC Q;  1A3V A;  3S14 H;  2B2U C;  3ER0 A;  5IP7 G;  2K5H A;  1GUT A;  1RHP A;  1PZI D;  2EJG C;  1HNZ Q;  1Y8P B;  1SNP A;  2F4I A;  3PO2 B;  1NMF A;  2D2C C;  1V1O A;  1EUJ A;  1YEZ A;  4KKS A;  2B2T A;  1P8L A;  3KLW A;  1ENF A;  1Q1E A;  2SNS A;  1LUZ A;  3TP6 A;  5LMN W;  3KUP A;  3PIP 3;  1OXV A;  1TII D;  4HCE A;  2H4O A;  3RZD H;  1NMG A;  2M00 A;  4KKT A;  4U68 A;  3TEH B;  4ZYS A;  3ULJ A;  4A3J B;  1K8G A;  4L5R C;  5K5P A;  3TRE A;  3NTK A;  1Q8K A;  2WFW A;  2Z9H A;  2K32 A;  5IT9 E;  4LMQ D;  5JVH 3;  1RD9 D;  2A69 C;  3C46 A;  2FXQ A;  4ME3 A;  5FK9 C;  1LV9 A;  3NUC A;  3NEL A;  4A3K H;  1FJG Q;  1EY5 A;  1FD7 D;  2VQF Q;  4QIW B;  5BR8 Q;  4ZRZ A;  2NVT H;  3DUZ A;  4A3M G;  4IUU A;  3L2P A;  2B39 A;  3R3O A;  4A3D H;  1X3P A;  2OXP A;  1D5M C;  4AQY L;  3ITP A;  1X54 A;  4HR7 B;  5HY6 A;  4Y7N H;  3GTQ B;  1P16 A;  1V1P B;  2V1C C;  4P75 A;  4DXF A;  4QY7 A;  5C3E H;  4MN3 A;  3M85 A;  1FNW A;  2B2U A;  4CKB A;  5IOD A;  3CC2 A;  1JJC B;  3FKI B;  3SHL A;  3J7Z C;  2QA4 A;  4JC0 A;  4FXG C;  4MNO A;  3NBI A;  5ELO A;  2WP8 J;  2P5Z X;  4IPH A;  4K8I A;  3E3X A;  5C4X G;  2RCF A;  4JI2 L;  4LF5 Q;  1TS2 A;  2A5H A;  2BA0 A;  1IYJ B;  2MNA A;  4L5S A;  2EVB A;  2MHV A;  3A7L A;  2AUK A;  5C6A A;  3U4Z A;  4JYA L;  4FYD A;  1D1K A;  3K7A B;  4OO1 G;  3ERS X;  4MTN A;  4RWS C;  4K5V A;  3W5O A;  2FFK B;  3CPF A;  1VQF A;  4JI3 Q;  2PW7 A;  1JWS D;  1Q12 A;  2LSS A;  4KN7 C;  3GTO H;  3K80 C;  4PQX A;  1B9N A;  3L3O C;  2CCZ A;  4DR6 L;  2Q2T A;  3Q8D A;  5T1G A;  1KNE A;  2MJ8 A;  2UUA L;  4JI6 Q;  1SAP A;  2NB0 A;  3RLN A;  3VYS A;  4JI0 L;  1I3Q B;  3BVZ A;  1TQO A;  4N8F A;  3EVQ A;  3EA6 A;  1KQS A;  4DNR B;  1QNU A;  2LY7 A;  1STG A;  2ZTE A;  4A3I B;  2BDO A;  3MTS A;  4ZCK A;  3H09 A;  4A3C G;  1EY6 A;  1JIC A;  3NPP A;  5J3B A;  1LTS D;  3NTH A;  3T13 A;  4V19 0;  1JWM D;  4K2L A;  2DY8 A;  1SE4 A;  2K5N A;  1BBX C;  5JEA G;  3L7Z C;  2N3S A;  4LNQ A;  4OON A;  3DEP A;  4LF8 Q;  3CCL A;  3S1N B;  5BN3 A;  1CT1 D;  1EIF A;  1YNN C;  3H3V I;  1EU4 A;  4JVZ A;  3EFX D;  4C1N I;  3I91 A;  4A3M B;  4CJ2 C;  2R61 A;  5JPM C;  2RKS A;  5IYC H;  4X3K A;  2JA7 G;  4IAL A;  5COR A;  3M4O B;  1YZ6 A;  5LMU Q;  2TSS A;  4J15 A;  1ZYR C;  2F0O A;  3OHX C;  4I7A A;  2MO1 A;  4Q0F A;  3J7A F;  1Q81 C;  1B9M A;  5ELD A;  5IYB H;  2LKV A;  3CCQ A;  2O5I C;  4OEL B;  3SGI A;  1Y1V H;  1SXT A;  2NVX H;  2N49 A;  3OTO L;  1A2U A;  2HHH Q;  3BJU A;  3TP5 A;  5EKL A;  3HOV G;  1VQO A;  4XDX A;  1WTV A;  1FR3 A;  5IWA L;  5C4X B;  1U0L A;  4QIW E;  4BBS G;  3F2U A;  4A3L G;  4NXN L;  4POF A;  1HTL D;  2B63 G;  1WCM G;  1I4P A;  1U5K A;  2GVA A;  4GN4 B;  2K75 A;  1B44 D;  2QEX A;  1ZEQ X;  1CZG A;  2BDN A;  4KJO A;  5K36 G;  1UE1 A;  2BH8 A;  1RDP D;  1RIP A;  1EWH A;  1W6K A;  5M5W B;  3A8J E;  3AMU A;  4DV0 L;  4HIK A;  1L1O B;  2FIN B;  2PZW A;  3G6E A;  4LJZ C;  2OEO A;  4JBW A;  4P72 A;  4CJ1 B;  1F9Q A;  5D14 A;  2NN6 H;  4DAM A;  2EIF A;  1R9T H;  3ERO A;  3VR2 A;  2PO4 A;  3NBH B;  4B3R L;  5I6Y A;  4NXM Q;  4G4K A;  3J81 j;  1WFQ A;  3RN2 A;  3VR6 A;  1V8Q A;  4RCN A;  4DV3 L;  1XX8 A;  1YNX A;  4DK6 C;  3JAM L;  1SNQ A;  4KHP Q;  1JB7 A;  1UEA B;  1S4Z A;  3HKS A;  3I4N H;  1HNZ L;  1H9M A;  1SYC A;  3T51 B;  5I2X A;  4C2M H;  2QGQ A;  1B1Z A;  4QGU A;  5JJK A;  1CA5 A;  2IW3 A;  4PMC A;  4UP7 A;  2R93 G;  3U4V A;  4DV2 Q;  3UDI A;  5J39 A;  4WJ3 M;  1DOL A;  1B53 A;  3M7G A;  4DFA A;  2E2I B;  2AQ1 B;  4DR3 Q;  2JA7 B;  2ZT9 C;  3UI2 A;  4O2D A;  1PYB A;  1EZ6 A;  1Q8I A;  3URY A;  5JJZ A;  5EPL A;  5C44 H;  2BH2 A;  2B2Y C;  1K8O A;  4DV4 Q;  3W1G A;  3BZK A;  3OW2 A;  2EOT A;  4TRD A;  1FJG L;  2NWG A;  4LFA Q;  1CK1 A;  1DCZ A;  5BR8 L;  1JOR A;  4X3S A;  1MJE A;  1V9P A;  3U9O A;  1NR4 A;  1SJH D;  3HOV B;  1W3S A;  2FJ2 A;  5CV4 A;  1N8R C;  4BBS B;  4Z9C B;  3SR1 A;  3OPO A;  1QZH A;  5IE8 A;  3GTK B;  1YHB A;  2NVQ H;  4BY1 H;  4IO9 A;  4C3J G;  3QIA A;  1WCM B;  2B63 B;  2DN8 A;  3IKJ A;  4K5W A;  4DGZ A;  4J1M A;  2VUM H;  3BU2 A;  2GVB A;  3M4Y A;  1HR0 Q;  4CHT B;  3BDC A;  4K8J A;  3ND9 A;  3S9W A;  1NY4 A;  1IBK Q;  1SMX A;  3M4P A;  2IWH A;  1RJT A;  4LF5 L;  4UP8 A;  1SMY C;  3ONA B;  3PF4 A;  1Q1B A;  5IP9 H;  1Y1W G;  4O42 A;  1VQ4 A;  2OQ0 A;  4LUZ A;  1XMQ L;  2JN4 A;  4JI3 L;  3STB C;  4X66 Q;  2B2Y A;  1V1Q A;  2EDG A;  1BR9 A;  3T53 B;  4WJW A;  4K14 A;  4OL7 A;  1G6P A;  1F2L A;  2Y0S B;  2K01 A;  1H9K A;  3HOX G;  2A74 C;  5LL6 X;  2QEJ C;  2L12 A;  1JWU D;  3E9I A;  4JI6 L;  3HKZ G;  1SEB D;  4P73 A;  4XQN A;  3I4M H;  1MI2 A;  1IBL Q;  3K5L A;  1WTO A;  3MA2 B;  2R93 B;  3S24 A;  3X3N A;  1B3Q A;  1VQH A;  5A35 A;  1AZQ A;  2OCE A;  3PUW A;  4EVO A;  2PI2 A;  1GVP A;  4ZK9 B;  3T4A C;  1O7Z A;  4PG3 A;  3IRB A;  1ENA A;  1ESR A;  1LTG D;  3J80 L;  2OF1 A;  1QOH A;  4PNY A;  2EY5 A;  3T1Y Q;  1S5C D;  3F8T A;  2F1M A;  3HOU G;  4P74 A;  4ZKB B;  3PO3 H;  4UP9 A;  1EYC A;  2VB2 X;  3BS1 A;  4H44 C;  2CKZ B;  3J7A 5;  1PRT C;  4DU9 A;  4BXX G;  2R7Z H;  1NBW A;  3DMU A;  5M3M H;  5LMU L;  1STA A;  4IJL A;  2DNE A;  2UU9 L;  5H1S E;  5M3F H;  5C44 B;  1JOO A;  2ASB A;  4C3J B;  4BBR H;  2PQE A;  4GLV B;  4LF6 Q;  2AWN A;  3CHB D;  2D62 A;  1EL0 A;  1EOV A;  2BA1 A;  2IHF A;  5KYI A;  3OW7 A;  2Z8L A;  2RDG A;  4PV1 C;  3CCR A;  2N78 A;  4DV1 Q;  3BZC A;  3OMC A;  3PUV A;  3H94 A;  3D4D A;  4G7Z C;  1PLF A;  4A3B G;  1V43 A;  4L5T A;  1X3Q A;  5C4J H;  3OWE B;  1Y1W B;  2FHT A;  2VUM B;  4PMW A;  1GO3 E;  2AHO B;  1LTB D;  1PH5 A;  4KY6 A;  3JAM c;  3CCU A;  3HOY H;  1YBY A;  1PDQ A;  2KED A;  2ENB A;  1XNR Q;  1GHK A;  2KEE A;  3HOX B;  4X6A H;  1B4O A;  1B7Y B;  3HKZ B;  1VQ7 A;  4MTK A;  3PCO B;  3HP3 A;  1HXY D;  1DXM A;  1X3E A;  1PVO A;  1TS4 A;  5EBC A;  2XRS D;  4NXM L;  1RKN A;  4IUP A;  1E7Z A;  1G2T A;  4KHV A;  4OEM B;  2XWB B;  5JJL A;  1IL2 A;  3MAQ A;  1IXR A;  3KF8 A;  3GQB A;  4C56 C;  3BVG A;  4I7Z C;  4M8A A;  3F2B A;  1QUQ A;  1JE4 A;  3HOU B;  2UXB Q;  4DV2 L;  1PH4 A;  5FLX L;  3S17 B;  2BCO A;  5LMN Q;  5CV8 A;  3M7N A;  5I9P A;  2DJG C;  1NNX A;  1SR3 A;  4DR3 L;  4S3S A;  3PO2 H;  1E24 A;  4GKK Q;  1U9R A;  1C8C A;  1UWV A;  1TU2 B;  4IJH A;  4DV4 L;  1GUG A;  2MQH A;  3F1Z A;  2ZTD A;  1A62 A;  4XYQ A;  1S72 A;  1EOT A;  2IX1 A;  1DJR D;  4LFA L;  1PFN A;  4K5X A;  4XXE A;  4A3J H;  3KBG A;  1IYV A;  2NZ1 D;  4JI7 Q;  1SYD A;  4WRD A;  3HOZ H;  3KDF A;  4P2C B;  4BY7 G;  2R7Z B;  3CCV A;  1X3F A;  3GTL B;  3CC7 A;  4O1N A;  1HQR D;  4RH6 A;  4A3B B;  5M3F B;  3K57 A;  3A5Z B;  4GNX C;  2K05 A;  1PRT B;  2YV5 A;  3U9S A;  2SOB A;  3P20 A;  1HFN A;  1TWG H;  3BG3 A;  2D9U A;  3RMH A;  3SK6 A;  2O2L D;  1A6X A;  1K0R A;  2B2W C;  2N8N A;  3OSO A;  2Q8I B;  3TSS A;  4K6L A;  1K83 H;  1NUC A;  4CDF C;  1HR0 L;  2JA6 G;  2AUJ D;  3PUX A;  1O80 A;  1OXU A;  3K5N A;  1VQN A;  1KHI A;  1IBK L;  3KF8 B;  1XTD A;  1AE2 A;  3WOE A;  1G2S A;  2ATW A;  1HCZ A;  3FKI H;  1Y14 B;  3LX0 A;  2R7F A;  4OWT B;  2B8F A;  2JA5 G;  2Z0S A;  5C4Z A;  1D7Q A;  4OX9 Q;  1BQQ T;  1JB3 A;  1CHQ D;  3UDG A;  3DHQ A;  4X66 L;  2CHB D;  2XGT A;  4JI4 Q;  5KGU A;  5D3D A;  5JVG 3;  3JAM i;  1CKN A;  4Q5V A;  4B3S Q;  4LFB Q;  1EFI D;  2PQA A;  2EJM A;  4IPC A;  1ASY A;  2PZU A;  1UUP A;  3NWS A;  3J80 c;  2CH4 A;  3GTG B;  4QQB X;  5M5Y B;  3K7A H;  4IFD J;  1X55 A;  2G5D A;  2PI2 E;  2IL8 A;  1KAW A;  5C0X G;  5GQO A;  4KMU C;  1PHJ A;  4HJ9 A;  1IBL L;  4RCO A;  4IFD H;  4A4I A;  5KIX A;  1CFM A;  1T9H A;  3ICE A;  2G9H D;  3S2H B;  1YVC A;  2YYZ A;  5M5X H;  5IP7 H;  3GD7 A;  3HKZ E;  4H13 C;  1YHA A;  3DLL A;  5CYU A;  4IPG A;  5CMD A;  4GNX A;  3P7J A;  4GZY C;  2K4K A;  3D3R A;  1I4X A;  4A3F G;  1I3Q H;  2EYM A;  1KL9 A;  2LXK A;  2EYF A;  2VB3 X;  5KYL A;  1QB5 D;  2B2W A;  1R4Q B;  2H1E A;  2F0V A;  1VQD A;  5ISR A;  3T1Y L;  1KIX A;  1SE8 A;  3CQZ B;  3E9H A;  1YHQ A;  5IOC A;  2YTX A;  2Z6K C;  3HZX A;  2RQX A;  2BOS A;  4DUY Q;  2OQK A;  1I50 B;  1VQI A;  4JI1 Q;  4BY7 B;  3CD6 A;  4DAV A;  4YY3 Q;  2HDL A;  3S1N H;  1CQV A;  1S5F D;  3C1F A;  2IY5 B;  4NPS A;  2AWO A;  1E22 A;  3J81 L;  2YU9 H;  4A3M H;  4RFB A;  3A7A B;  2QKI C;  2YTV A;  4A76 A;  2JA6 B;  3CCM A;  3M4O H;  2WKC A;  3HOZ B;  3MEF A;  4DV1 L;  2K04 A;  1CKN B;  1HFG A;  3G7L A;  5IGB A;  3WOF A;  1LLR D;  2PQA B;  2ID0 A;  4A3G G;  1BF4 A;  4KLK A;  4XYO A;  5L37 A;  2OTJ A;  2JA5 B;  3NHH A;  4CKE A;  1PFM A;  2EY6 A;  4RGO S;  3AB9 A;  3T16 A;  5F2D A;  1DM0 B;  1STN A;  1TWG B;  5C4X H;  4RHR A;  1K83 B;  3A56 A;  4GNX B;  1QVG A;  1F2M A;  3VR3 A;  4ULL A;  3M4Q A;  1L0Y B;  2F0I A;  1MGS A;  1QIL A;  4UHV A;  2Z6K A;  4RMF A;  1E0B A;  3FRP B;  4L8J A;  4OO1 H;  4X65 Q;  1VQC A;  3IFT A;  3RR5 A;  4QUF A;  1Q7Y C;  1YJW A;  5M5W H;  2JQO A;  4FF3 A;  1A3T A;  2CFM A;  1EIY B;  4XTC S;  2BE5 C;  1GUO A;  1ILQ A;  3JAM E;  3A54 A;  3NXW A;  1MHW C;  3I72 A;  1TS5 A;  2XTI A;  4A3F B;  1Q3L A;  3A74 A;  4HJ5 A;  3J80 i;  4X64 Q;  1Z6H A;  2RDF A;  3K58 A;  2NN6 I;  1PTO C;  1HNX Q;  4DK1 A;  3D6C A;  2OTL A;  1E2Z A;  4A3C H;  1KNA A;  2UXB L;  4DKA C;  3IL8 A;  2E2H B;  5LMN L;  3PV0 A;  4QF4 A;  4RKL A;  1X3G A;  2MO0 A;  4G7O C;  5M5X B;  3K59 A;  2XN9 C;  5TSS A;  4IOA A;  2R6G A;  4KTA A;  5JEA H;  5FOB B;  5M9O A;  1CQF A;  1AEX A;  1Z7T A;  3RLF A;  4GKK L;  5A2Q L;  1WTP A;  3E0J A;  1EYA A;  4LF9 Q;  1TY2 A;  3S1Q B;  3AEV A;  2F0M A;  3PQI A;  4HIO A;  3T1H Q;  1K73 C;  5G3L F;  2RCN A;  5IGE A;  1GKH A;  5IYD G;  3P75 A;  3HOW G;  3I55 A;  2E2I H;  1CA6 A;  2JA7 H;  3QWN A;  1QVC A;  5ELC A;  4NDX A;  1WJJ A;  4A3E G;  2UUC Q;  4JI7 L;  1N33 Q;  1YNJ D;  1N32 Q;  2WB1 G;  1PZK D;  2D0P A;  2CW0 D;  3I4L A;  2X69 A;  4PMB A;  2KUM A;  1XPO A;  4IZ8 A;  5CV6 A;  4DV7 Q;  2F0U A;  4A3G B;  2SNM A;  3QR8 A;  1VS0 A;  1JQY D;  3K5O A;  4GN3 B;  4KV6 A;  2I0Q A;  2IX3 A;  2YU9 B;  4TSS A;  1EY8 A;  1TWH H;  3HOV H;  1QWY A;  4BBS H;  1KRS A;  4A3L H;  3GTK H;  5IGD A;  4HMJ A;  1EU3 A;  4DR7 Q;  2MP1 A;  2B63 H;  1WCM H;  5FJ8 G;  2Q8R E;  5GAD C;  3J7Y W;  2HQL A;  2LS0 1;  1KD1 C;  1FGU A;  3GTP B;  5K36 H;  3PSI A;  1GUS A;  1YIT A;  1EIG A;  1PH3 A;  4WJ4 A;  1GUW A;  2DJF C;  3R2I A;  2M2L A;  4JI4 L;  2MPM A;  2WIN B;  1XNQ L;  1O7I A;  1HZ9 A;  2KBN A;  1AZP A;  3KLR A;  4B3S L;  4JV5 Q;  4LFB L;  1BCP C;  1LAC A;  4MZ9 A;  1DD2 A;  3FPU B;  1BVS A;  1JMC A;  4QJF A;  2KHI A;  1M1K C;  5FLM G;  1TXY A;  3CU7 A;  1I4H A;  2JA9 A;  1Z47 A;  1HQM C;  1LTL A;  2K52 A;  2I46 A;  2XWJ B;  3TQY A;  1IKM A;  2F03 A;  5IT9 L;  3ND8 A;  2E74 C;  4KHZ A;  1JC7 A;  2A68 D;  2F52 A;  2Q2U A;  3MXP A;  1N36 Q;  3P1H A;  4TQU S;  1D8L A;  2R93 H;  4DUZ Q;  4H7B A;  1U4L A;  2JEA I;  2I5L X;  1VQA A;  5I4D A;  2KCC A;  3J81 c;  1SNM A;  4G7H C;  4B3T L;  4WFN 3;  2FMC A;  5EJW A;  1LTI D;  2NVY B;  4HED A;  3I7F A;  4C3I G;  2A6H C;  2N88 A;  4LFC L;  4A3E B;  4J6H A;  4DUY L;  1PTO B;  2WB1 B;  2OT2 A;  2F3V A;  4JI1 L;  4YY3 L;  4DK3 C;  3D6W A;  3LGJ A;  2K33 A;  3K7U C;  1C9O A;  1W2B A;  3HFZ B;  2UXC Q;  2A1A A;  1B70 B;  1SNC A;  1QNK A;  3E0E A;  1HZA A;  4YHH Q;  2VXW A;  1MKH A;  2A69 D;  2F0D A;  4R9W A;  1BXT A;  3MC0 B;  4YCW A;  4GLA C;  2F0P A;  3ULP A;  1FGB D;  4C3J H;  4N8X 1;  4Y52 H;  3CCJ A;  4PZ6 A;  4O0A A;  2O4X A;  5AJ3 Q;  1XJV A;  2HD3 A;  1U4R A;  1LTA D;  2R7D A;  5FO8 B;  4EX5 A;  2VQF L;  2CH4 W;  1E3P A;  3NTI A;  3H3V C;  1TWF B;  1PRT F;  3TP8 A;  1WI5 A;  1G51 A;  2FMM A;  3H6M A;  1TWH B;  4DPG A;  4FNF A;  3BDL A;  2NBF A;  2F0K A;  1K0S A;  2HIX A;  1XXG A;  3S1R B;  1UE7 A;  4A93 G;  2JP1 A;  4C1N K;  2K50 A;  2M9V A;  3E5S A;  1PV4 A;  4OWX B;  3IAY A;  1HPC A;  4X65 L;  2K5V A;  1KRT A;  1Y1W H;  2EY2 A;  3PUY A;  1KLG D;  3TZD A;  1JJG A;  3NSW A;  1F9S A;  5HUR A;  3PIP A;  1MIU A;  3W1B A;  2CVR A;  2VZA A;  3HOX H;  3DEO A;  3KK7 A;  1F2Y A;  4HN7 A;  3R2T A;  1GM5 A;  2EYJ A;  4EGV A;  3QB3 A;  1D6E C;  2K5D A;  3MXU A;  1HNX L;  3PIO 3;  1K8M A;  3SDZ A;  3GV6 A;  2HCC A;  4UY8 C;  1BCP B;  1Y8N B;  3RN5 A;  3GP7 A;  1A15 A;  1EQT A;  1LT6 D;  1STB A;  1WTW A;  1DZ1 A;  2X6L A;  2A6E C;  1SE2 A;  4CKC A;  3HOU H;  1I5F A;  3T1H L;  4XIG S;  3S17 H;  3J81 i;  5LHY 1;  1O78 A;  2RSN A;  3KBX A;  1K9M C;  3DXJ C;  4R4T A;  4LK1 C;  4BXX H;  5IY0 A;  4C3H G;  1MBY A;  1YNN D;  3FHW A;  5BN5 A;  4K6D A;  2EXD A;  4RAU C;  1STE A;  2GN5 A;  3CAM A;  4LF8 L;  1ET9 A;  4YCV A;  5JOB A;  1IW7 C;  1EYG A;  2VNU D;  5J22 A;  2CQA A;  3I90 A;  1ZYR D;  2WB1 E;  4CDD C;  1J6Q A;  1LT4 D;  4P71 A;  3X3M A;  2QDB A;  2K14 A;  4FF1 A;  2F0F A;  3I4O A;  3AYH B;  4CDC C;  3GTL H;  4ME5 A;  2F4V Q;  1IBM Q;  1CUK A;  4A3B H;  1B8A A;  1S40 A;  3M9B A;  3MXG A;  4DR7 L;  4AYB G;  3CCS A;  2K5Q A;  4TVA B;  4A93 B;  4DAY A;  4KI0 A;  1TKW B;  3Q22 A;  2WKD A;  2PNH A;  3DM1 A;  1RL2 A;  1CHP D;  1PXU A;  1SYG A;  2E5L Q;  3LWU A;  2XIW A;  2HHH L;  2DGY A;  4ZAI A;  4YCU A;  3OIQ A;  1IKL A;  3SK4 A;  1LO5 D;  5EGT A;  4JW0 A;  3VA5 A;  1PYW D;  4JV5 L;  1S5B D;  3CP0 A;  3OOC A;  1OXS C;  4YWK A;  1K8A C;  4QCL A;  2JXM B;  1F9R A;  1SND A;  1WTX A;  3GDE A;  4XT3 B;  2GA4 B;  1TR5 A;  5C4H A;  3DWP A;  2YTY A;  2J0T D;  5GAE C;  2JE6 I;  2Q2I A;  5G3L D;  2KEC A;  3GTG H;  5M5Y H;  4MIU A;  4GKJ Q;  2Z6B A;  4IUT A;  1HHV A;  2F0H A;  2XRQ D;  4DUZ L;  3V2T A;  5DM6 3;  3S2H H;  4K0K Q;  2F0N A;  4QUC A;  4IFD I;  2RBM A;  4AQY Q;  5C3X A;  2NTT A;  4C3H B;  3MEH A;  4KHP L;  4DR4 Q;  3TME A;  2PCF B;  4LF7 Q;  1OXX K;  1RTN A;  2IX0 A;  3DWQ A;  3CC4 A;  2RHQ B;  1UE6 A;  1T5E A;  1HRJ A;  3CQZ H;  4DAY B;  1XYI A;  1JJ2 A;  1SYE A;  3J81 E;  1HR0 W;  2UXC L;  1MSH A;  2I5M X;  4YHH L;  1H9S A;  4QL5 A;  1LT5 D;  1KAA A;  4NMZ A;  3H15 A;  1I50 H;  1L0W A;  4BY7 H;  1LTT D;  2R92 G;  3PF5 A;  3GTJ B;  5CBE E;  1A2T A;  1SE3 A;  1C48 A;  5DAU A;  2F0S A;  3RZO B;  3HEJ A;  4AYB B;  1VQP A;  1PH2 A;  3HG9 A;  5E3F A;  2JA6 H;  4HCS A;  1N34 Q;  1FNU A;  3H0G G;  2NYZ D;  3MWY W;  1ENC A;  1QE6 A;  2UUA Q;  5C3W A;  5EPJ A;  3LWE A;  3O13 A;  4A75 A;  2B8G A;  1B50 A;  2ICI A;  1NAP A;  3HS0 C;  1HZB A;  2JA5 H;  3GV3 A;  1PA6 A;  1ICF B;  4IPD A;  1AW7 A;  4JI8 Q;  1SRO A;  2EE1 A;  3F2D A;  1SMY D;  3TS0 A;  3V05 A;  4WOR A;  3D31 A;  4B9W A;  1VF5 C;  5C0X J;  1WTR A;  2PMZ E;  3N52 A;  2K5W A;  1IYU A;  3STB D;  3I2Z A;  5C0X H;  4OIK A;  3Q23 A;  3D0F A;  1TT2 A;  4UAI A;  3VYR A;  1WYD A;  3KJO A;  4GLX A;  4JBK A;  1QUQ B;  4GS3 A;  2WII B;  2DNC A;  3G6J B;  2JJQ A;  3BDO A;  1RF2 D;  3R93 A;  1EYD A;  1H9S B;  5E4W C;  3SXH A;  5DM7 3;  4A3F H;  3IFD A;  2ZJQ A;  1A0I A;  5GAG C;  1LM0 A;  2KJX A;  4ZUJ A;  4IN3 A;  1W6J A;  1VQE A;  3G4S A;  2JA8 G;  3OTO Q;  4CDE C;  2E2H H;  3FMC A;  1EY9 A;  3MVV A;  2ZXP A;  1HA6 A;  1KLU D;  3BYT B;  3S16 B;  4KD3 A;  5E7N A;  4KJN A;  1G6Z A;  3SK8 A;  4DV5 Q;  1G29 1;  3KDF B;  2HDM A;  2R92 B;  4NXN Q;  1VQ9 A;  2UXD Q;  1A3U A;  1SRU A;  3I73 A;  3S1Q H;  2NZO A;  4NB3 A;  1CI3 M;  1PTO F;  1II3 A;  5FKA C;  3CRK C;  1PRT D;  1L0X B;  1BKB A;  5E4X A;  3S2D B;  1C0A A;  2Z4I A;  2ZXR A;  1U4P A;  3BYY B;  3S1M B;  1J9O A;  4FF2 A;  3H0G B;  4LUV A;  4EQ5 A;  4F88 A;  4F7X A;  1A63 A;  2AQ2 B;  3AFQ A;  1XWE A;  4JPB W;  5EAY A;  1ROD A;  3A8K E;  5ELE A;  3I56 A;  2EZV A;  4A3G H;  1I94 Q;  2F4V L;  1IBM L;  3RLO A;  1UEB A;  1SLJ A;  1D2B A;  4B3R Q;  3UDF A;  4M1U B;  4FP5 D;  1EZ8 A;  4LF6 L;  3NP8 A;  4B08 A;  4DV3 Q;  2K28 A;  4BA2 I;  4E6I A;  1RCV D;  3CW2 C;  2E5L L;  4AYB E;  1EY7 A;  5T1I A;  1IHZ A;  4ODG A;  1UE5 A;  4IQZ A;  3CXC A;  1TWC B;  2AKW B;  3GTP H;  4TKO B;  3A0J A;  4ZQ3 A;  1WD0 A;  1X32 A;  2EJF C;  5JJI A;  4AH6 A;  4X3T A;  4A3I G;  2B3G A;  1VCI A;  3KFU A;  1E2V A;  1SYB A;  4RA8 A;  1VMP A;  2HUG A;  5ELN A;  2C5C A;  1S5D D;  2QF7 A;  4QB4 A;  5ELB A;  3A5U A;  4LF4 Q;  4X62 Q;  1QJO A;  1UNS A;  2NUC A;  1ASZ A;  2MGS A;  1XNR L;  1VF7 A;  4GKJ L;  2L0C A;  2PPB C;  1EWI A;  1F2Z A;  1XMO Q;  2JA8 B;  3KJP A;  2EYO A;  1ZKO A;  1VMC A;  3A55 A;  3S15 B;  3I8Z A;  2ZXO A;  5FLX c;  4K0K L;  4FF4 A;  3NEM A;  5IGG A;  4DNI A;  3MXN A;  3NQT A;  1BCP F;  2WAC A;  2XSC A;  1L1O C;  1T5X D;  4EQN A;  4DR4 L;  1STH A;  2UUB Q;  1I4G A;  3TZU A;  3OMG A;  2KCM A;  4A3K G;  4LF7 L;  1LTR D;  5IYD H;  1N9W A;  3AU7 A;  3HOW H;  5CV9 A;  1CKO A;  2NVY H;  1NE3 A;  1JOK A;  1WD1 A;  3MZ5 A;  5HGQ A;  4BWG B;  1TS3 A;  4A3E H;  1PH6 A;  4A3D G;  5JEA J;  1PTO H;  5EKK A;  1S3O A;  3AQQ A;  4PZ7 A;  2LMC B;  4DR2 Q;  4N9P A;  5CBA E;  2J4X A;  4DA2 A;  1GOZ A;  2ALY B;  4DR1 Q;  2E8G A;  3K81 C;  5ELF A;  3ZJY C;  5KNB A;  5C3E G;  5D65 A;  2E75 C;  3A8I E;  3EBE A;  4YWM A;  2L9H A;  1AH9 A;  3CF5 A;  3QO2 A;  1ICW A;  1XMQ Q;  3L9A X;  4L6T B;  1WOC A;  3ZYY X;  2F0E A;  1N34 L;  4DR5 Q;  1TWA B;  5I2Y A;  3D4R A;  3K5M A;  2AQ3 B;  1O7L A;  1Y69 U;  5FJ8 H;  2K03 A;  2CWP A;  1CTM A;  4EQO A;  2F0Q A;  2HCI A;  4ZLT F;  4FDB A;  5COY A;  4DK0 A;  3RNU A;  1KDC A;  1QG7 A;  1QZG A;  1TY0 A;  1TWF H;  4CBV A;  4JI8 L;  4HID A;  1L1O A;  2I5H A;  4R4O A;  3S14 B;  2ZTC A;  3ULL A;  1VDZ A;  3NK9 A;  3SE0 A;  1EEF D;  1R4P B;  3MXN B;  1E2W A;  3S1R H;  3CME A;  1VQK A;  4JK1 C;  4IUR A;  1A8V A;  4G57 A;  4JOI C;  4LUO A;  2VY3 A;  3NBH A;  3AFP A;  4AIM A;  5FLM H;  5CV7 A;  2Q8T A;  2A19 A;  4R1J A;  1NR2 A;  1OXT A;  5I6W A;  1EQR A;  1L2F A;  4OX9 L;  1PMR A;  3RZD B;  1X9N A;  1G91 A;  2Z4H A;  1VQL A;  2UU9 Q;  3ERQ A;  5J1Z A;  2PNR C;  3KOJ A;  2NZH A;  4A3K B;  4X3U A;  1PFS A;  5IGC A;  2NVT B;  4C3I H;  4BA1 I;  4I65 A;  3SEB A;  3JC6 6;  1CSP A;  5IYC G;  4A3D B;  3C1E A;  3QG1 A;  1SN8 A;  1BUV T;  4DV5 L;  1J8I A;  5BN4 A;  1VQ8 A;  5EBD A;  1VQ5 A;  4Y7N B;  1KXL A;  2UXD L;  5C5M A;  2B29 A;  3K8A A;  3J80 E;  2VL6 A;  1OO9 B;  3RD4 A;  2ZM6 Q;  4JBJ A;  5IYB G;  5C3E B;  4DXG A;  4XQQ A;  5HGT A;  1GHJ A;  1Y1V G;  1GXD C;  2IT1 A;  3UDX A;  2CQO A;  2F0W A;  4OHJ A;  3HOW B;  1F9P A;  1I6V C;  2QW7 A;  3EIV A;  5GRO A;  3GTM H;  5DLQ E;  4JOI A;  1K3B C;  2EQS A;  2A8V A;  3EJI A;  5KRU A;  2QIL A;  2VS1 A;  3GO5 A;  2K6A A;  1BBW A;  2V4D A;  5JAV A;  3CPW A;  1I94 L;  3QJY A;  2KCN A;  5LL6 S;  2VQE Q;  5EQ0 A;  4KY7 A;  4EQP A;  4B3M Q;  3CKI B;  1ZXT A;  4RKB A;  2KVM A;  3FVQ A;  5EPK A;  3GTO B;  1FL0 A;  2G9D A;  1I6H H;  2CWA A;  2Y0S G;  4OIJ A;  3U50 C;  2E2J H;  1U4M A;  2L4N A;  1ONL A;  2NN6 G;  2RF4 A;  1JE5 A;  4A93 H;  4HJ7 A;  2KCT A;  3E6Z X;  3TS2 A;  1M8A A;  1VQJ A;  2EY1 A;  4RG1 A;  4DAP A;  1E1T A;  5IGF A;  4RGM A;  1Z9F A;  3R8B A;  4F8M A;  2XVS A;  1RTO A;  3D8G A;  3Q24 A;  2E76 C;  2WAQ G;  4XT1 B;  5CR3 A;  3PGZ A;  2RSO A;  4B9X A;  1EWC A;  2DY7 A;  4HAE A;  4ALP A;  1VQ6 A;  1WTH A;  4K2K A;  4HMI A;  3H3V H;  1M90 C;  1B3A A;  1MSG A;  3I4N G;  4LF4 L;  4X62 L;  1BDO A;  1M4V A;  3U58 A;  1PH1 A;  2EYH A;  2D5D A;  1PZJ D;  1HUM A;  2KOL A;  2BE5 D;  1XMO L;  2LXJ A;  2C35 B;  3KF6 A;  2IHE A;  5KNC A;  1KDA A;  4OXP A;  3SVM A;  1K28 A;  1PTO D;  2EYP A;  1LYL A;  2IJ0 A;  5C44 G;  1TVX A;  1AP0 A;  1DOK A;  4KY5 A;  2JYO A;  5D3I B;  4DV6 Q;  3J7A V;  1QCB D;  1GJX A;  4IUN A;  4X64 L;  2UUB L;  1VQM A;  4FVM A;  4RGT A;  2L55 A;  1J5E Q;  3KLS X;  3QOJ A;  5FO7 B;  1Y1V B;  3BVM A;  2KHJ A;  5FLX E;  2NVX B;  5I9O A;  4H0L C;  4C3I B;  1WTQ A;  2K7V A;  1MJC A;  2F0J A;  2EYL A;  4C3H H;  1SBB B;  5KND A;  3B6Y A;  3M3Y H;  1PH8 A;  1JCK B;  5EKI A;  3MFG A;  4DR2 L;  1BO0 A;  1I4R A;  2F0L A;  3H91 A;  3I3C A;  4BY1 G;  4DR1 L;  1EFW A;  4LF9 L;  4GOP C;  1SDF A;  4FO2 A;  2VUM G;  2DUD A;  4NKL A;  2RA4 A;  4YIJ A;  2PZT A;  4OGQ C;  1ILP A;  1GUN A;  4DR5 L;  2KHS A;  4U67 3;  1F77 A;  3GTM B;  1HNW Q;  1LT3 D;  3GTJ H;  4R4I A;  2UUC L;  1N33 L;  2HT1 A;  1N32 L;  4H02 A;  2F0T A;  2X6G A;  3RZO H;  1EIH A;  1AFP A;  4LW1 A;  1NSN S;  4ID6 A;  2JK8 A;  1KTK A;  1R9T B;  4DV7 L;  2L11 A;  2QDL A;  4JI5 Q;  5IP9 G;  2MFI A;  4KD4 A;  4CGY B;  3I70 A;  4KKU A;  3VR4 A;  4PZ8 A;  3KF6 B;  2PW5 A;  2R3Z A;  2WAQ B;  4KK7 A;  3QOL A;  2C9O A;  4L63 B;  1I6H B;  1JOQ A;  1Q82 C;  2E2J B;  3D4W A;  3I4N B;  3L0O A;  2L5T A;  4C2M B;  1HUN A;  3I4M G;  2IPK D;  1QVF A;  3CRL C;  4F87 A;  1H95 A;  1D1I A;  1CSQ A;  1B2T A;  2PMZ B;  3G48 A;  1BBU A;  1PYS B;  2F3W A;  4KN4 C;  2ZJP A;  1BCP D;  1FNV A;  3CCE A;  1DOM A;  2EPB A;  4GOP A;  1OTC A;  1C7Y A;  3UE0 A;  5IT9 c;  1SFO H;  1CM9 A;  2JSO A;  1BOS A;  1NCV A;  2ZJR A;  1SSO A;  1HH2 P;  1SYF A;  2K1B A;  4FXK C;  3MHB A;  2F0G A;  3NWT A;  5C0X I;  4JCV E;  2HIV A;  4R8N A;  3F2C A;  3PO3 G;  3TN2 A;  1LAB A;  1SJE D;  4R4C A;  1YI2 A;  1X56 A;  2R7Z G;  5M3M G;  4JG2 A;  2E2D C;  4HSV A;  3VDY A;  2RHS B;  5M3F G;  2NVQ B;  1N36 L;  4BY1 B;  5DNF A;  1X65 A;  2A6H D;  3FPP A;  4HSP A;  1BNZ A;  4BBR G;  2ZM6 L;  1E1O A;  4QMG A;  2SDF A;  2AMC B;  3S16 H;  3BZD B;  2J7Z A;  3VYU A;  1YJ9 A;  3FP9 A;  2R92 H;  4POG A;  1Y8O B;  3V96 A;  3M3Y B;  2N55 A;  2VW9 A;  1ESF A;  2EXZ A;  3S2D H;  3K0Y A;  1EY0 A;  2ES2 A;  4ZUI A;  1DYQ A;  3TBI B;  3C3L A;  2VQE L;  1DGS A;  2RVL A;  4B3M L;  3S1M H;  3H0G H;  4N9T A;  4RGN A;  4OWW B;  1H9J A;  4ILW A;  1JR0 D;  4JI2 Q;  4CJ0 B;  1VQG A;  2OWO A;  4UPA A;  4NW2 A;  1UAP A;  4GOP B;  5FO9 B;  3HOY G;  5KEE A;  4JYA Q;  3FEW X;  3Q0A A;  4L5Q A;  3I4M B;  3DM3 A;  5AJ3 L;  2Y0S E;  5C5L A;  4J8Q A;  5NUC A;  2O5J C;  1D5X C;  4APV A;  1IZ6 A;  4XQJ A;  2QCP X;  3HGB A;  5IIF A;  4DR6 Q;  4HJ8 A;  3OIP A;  3PMF A;  3WWV A;  1HJP A;  1EQV A;  1AE3 A;  4DF7 A;  1H9R A;  4V0B A;  1JT8 A;  1S5E D;  1TWC H;  4ZKC B;  3TDQ A;  4JI0 Q;  4ABN A;  4LWC A;  3W2D A;  3K0X A;  1X6O A;  1NJI C;  3KYH C;  1KAB A;  1DON A;  1WVL A;  3VR5 A;  3EN2 A;  2Z1C A;  1GD7 A;  2WAQ E;  1ML0 D;  4RHS A;  5CGK A;  1MD2 D;  4HJA A;  4HIM A;  1K3R A;  3UE1 A;  1Q90 A;  4R4Q A;  3PO3 B;  3VYT A;  1AN8 A;  5CV5 A;  3C2P A;  5DEH A;  1IL8 A;  4LAA A;  2F3I A;  3PO2 G;  5M3M B;  4DNT B;  4DN4 M;  1CZW A;  1CKM A;  2MUY A;  1SFO B;  2KQ3 A;  2LFN A;  2RDH A;  1YNJ C;  3W3A A;  2B2V C;  1EQQ A;  2JA8 H;  4DV6 L;  1XTC D;  1PH7 A;  4BBR B;  2CW0 C;  2KEN A;  2KA7 A;  3S15 H;  4MHE A;  1J5E L;  3CMA A;  4OO1 I;  2HQE A; 
#chains in the Genus database with same CATH homology
 4YY3 L;  5IYD H;  4DK3 C;  3LGJ A;  5M3M H;  1N9W A;  1PH9 A;  3HOW H;  5LMU L;  1YIJ A;  1CKO A;  4IJL A;  3K7U C;  1C9O A;  2NVY H;  4A3J G;  1W2B A;  2UU9 L;  1NE3 A;  1VQB A;  4JBM A;  5H1S E;  1NTG A;  5M3F H;  3HFZ B;  4IOC A;  3HOZ G;  2A1A A;  2ASB A;  1B70 B;  3GTQ H;  2UXC Q;  5HGQ A;  1PH6 A;  4A3E H;  3E0E A;  4A3D G;  4BBR H;  5JEA J;  1HZA A;  4YHH Q;  4GLV B;  4LF6 Q;  2AWN A;  1MKH A;  1S3O A;  3AQQ A;  4PZ7 A;  2D62 A;  4DR2 Q;  1EOV A;  2BA1 A;  1HZC A;  2ALY B;  4DR1 Q;  2E8G A;  3K81 C;  4YCW A;  2IHF A;  3ZJY C;  5C3E G;  4GLA C;  2Q2H A;  1FVI A;  3EBE A;  3ULP A;  4YWM A;  2H5X A;  3CCR A;  1XPR A;  2N78 A;  4C3J H;  4DV1 Q;  1AH9 A;  3CF5 A;  4Y52 H;  3BZC A;  3CCJ A;  1XMQ Q;  4GN5 A;  4PZ6 A;  5IWA Q;  3PUV A;  4O0A A;  5AJ3 Q;  1WOC A;  1XNQ Q;  1XJV A;  2R7D A;  1XPU A;  4EX5 A;  2VQF L;  4A3B G;  1N34 L;  4DR5 Q;  1E3P A;  4YWL A;  1HNW L;  1V43 A;  4L5T A;  1WI5 A;  1G51 A;  5C4J H;  2JEB I;  1Q86 C;  4DPG A;  4PMW A;  1KC8 C;  3FKI G;  5FJ8 H;  2CWP A;  2L15 A;  2D0O A;  1GO3 E;  3OYY A;  2AHO B;  4FDB A;  4JI5 L;  3G71 A;  1PH5 A;  3RNU A;  3PUZ A;  1TWA H;  4DV0 Q;  3JAM c;  2HIX A;  3TRZ A;  1QZG A;  3NEN A;  3CCU A;  1TWF H;  1YBY A;  1UE7 A;  5GAH C;  3HOY H;  4A93 G;  2K50 A;  4JI8 L;  1XNR Q;  3PIO A;  4HID A;  1PV4 A;  4OWX B;  1L1O A;  4X65 L;  2K5V A;  1KRT A;  1Y1W H;  4X6A H;  2I5H A;  1B7Y B;  4R4O A;  3PUY A;  1VQ7 A;  3PCO B;  2ZTC A;  1JJG A;  1X3E A;  3ULL A;  1PVO A;  3PIP A;  1MIU A;  3MXN B;  3W1B A;  4NXM L;  4B3T Q;  3S1R H;  4A3I H;  3CME A;  1E7Z A;  1Q46 A;  1VQK A;  2VZA A;  3HOX H;  1A8V A;  4JOI C;  4LUO A;  4IFD G;  2VY3 A;  3AFP A;  4AIM A;  5JJL A;  1YJN A;  1IL2 A;  5FLM H;  4LFC Q;  3S14 H;  1IXR A;  2A19 A;  1GM5 A;  4R1J A;  3ER0 A;  5IP7 G;  2K5H A;  1OXT A;  1EQR A;  1L2F A;  1HNX L;  4OX9 L;  1HNZ Q;  3F2B A;  1X9N A;  1NMF A;  1QUQ A;  1EUJ A;  1YEZ A;  1VQL A;  2UXB Q;  1P8L A;  3KLW A;  4DV2 L;  2UU9 Q;  1Q1E A;  1PH4 A;  4UY8 C;  5LMN Q;  1LUZ A;  3RN5 A;  3KOJ A;  3M7N A;  5LMN W;  2NZH A;  1OXV A;  1SR3 A;  4DR3 L;  3RZD H;  3PO2 H;  1E24 A;  1NMG A;  4GKK Q;  1PFS A;  3TEH B;  4L5R C;  1K8G A;  3ULJ A;  3HOU H;  1I5F A;  1UWV A;  3TRE A;  4BA1 I;  4C3I H;  3T1H L;  4XIG S;  1Q8K A;  2WFW A;  4IJH A;  3S17 H;  3JC6 6;  3J81 i;  1CSP A;  5IYC G;  4DV4 L;  1K9M C;  1SN8 A;  4R4T A;  2MQH A;  3F1Z A;  2ZTD A;  2FXQ A;  1A62 A;  4ME3 A;  4BXX H;  5IY0 A;  1S72 A;  4DV5 L;  4A3K H;  2IX1 A;  3NEL A;  1VQ8 A;  1FJG Q;  4LFA L;  1VQ5 A;  2VQF Q;  1KXL A;  2UXD L;  5BR8 Q;  2NVT H;  4A3J H;  2B29 A;  3FHW A;  3K8A A;  2VL6 A;  4JI7 Q;  4A3M G;  2ZM6 Q;  4JBJ A;  5IYB G;  3KDF A;  3HOZ H;  2EXD A;  3L2P A;  4A3D H;  4BY7 G;  1Y1V G;  2IT1 A;  3CCV A;  1X3F A;  3UDX A;  2CQO A;  2GN5 A;  3CAM A;  4LF8 L;  4YCV A;  4AQY L;  1X54 A;  3CC7 A;  3EIV A;  5HY6 A;  4Y7N H;  1EYG A;  5GRO A;  3GTM H;  5DLQ E;  2VNU D;  2WB1 E;  1P16 A;  2V1C C;  1J6Q A;  4P75 A;  3A5Z B;  4GNX C;  4JOI A;  2YV5 A;  2EQS A;  4P71 A;  4QY7 A;  5C3E H;  2A8V A;  3M85 A;  2K14 A;  2VS1 A;  1TWG H;  3GO5 A;  3CC2 A;  1JJC B;  1BBW A;  1K0R A;  2N8N A;  3I4O A;  2JA6 G;  1K83 H;  3J7Z C;  3CPW A;  3AYH B;  2QA4 A;  3PUX A;  1I94 L;  4JC0 A;  1HR0 L;  2F4V Q;  3GTL H;  1OXU A;  1IBM Q;  1CUK A;  2VQE Q;  1B8A A;  1S40 A;  1KHI A;  3M9B A;  1VQN A;  4A3B H;  4B3M Q;  4DR7 L;  4MNO A;  4AYB G;  5ELO A;  3CCS A;  1IBK L;  4TVA B;  2WP8 J;  4IPH A;  3KF8 B;  5C4X G;  4KI0 A;  4JI2 L;  1XTD A;  4LF5 Q;  1AE2 A;  2BA0 A;  2PNH A;  2ATW A;  1FL0 A;  3FKI H;  1Y14 B;  1IYJ B;  1RL2 A;  2R7F A;  2MNA A;  4OWT B;  2E5L Q;  2JA5 G;  2CWA A;  2Y0S G;  4L5S A;  1I6H H;  2Z0S A;  3U50 C;  3U4Z A;  4OO1 I;  4JYA L;  2E2J H;  2HHH L;  2DGY A;  1D7Q A;  4OX9 Q;  4YCU A;  4OO1 G;  2NN6 G;  3ERS X;  4MTN A;  2RF4 A;  1JE5 A;  3W5O A;  3UDG A;  4HJ7 A;  2KCT A;  4X66 L;  4A93 H;  3CPF A;  1VQF A;  4JI3 Q;  2XGT A;  4JI4 Q;  3TS2 A;  1Q12 A;  2LSS A;  3GTO H;  1VQJ A;  3K80 C;  4RG1 A;  3JAM i;  1CKN A;  4B3S Q;  4LFB Q;  4JV5 L;  3CP0 A;  4YWK A;  1K8A C;  1OXS C;  1E1T A;  2PQA A;  2CCZ A;  4DR6 L;  4IPC A;  1ASY A;  1Z9F A;  2Q2T A;  3Q8D A;  3J80 c;  4QQB X;  3K7A H;  2WAQ G;  1X55 A;  2PI2 E;  4IFD J;  2UUA L;  4JI6 Q;  1KAW A;  5C0X G;  5GQO A;  3RLN A;  3GDE A;  4JI0 L;  3PGZ A;  1PHJ A;  4HJ9 A;  1IBL L;  4A4I A;  4ALP A;  1VQ6 A;  1T9H A;  2YTY A;  1KQS A;  3H3V H;  1M90 C;  3ICE A;  3I4N G;  1YVC A;  2YYZ A;  4LF4 L;  4X62 L;  5M5X H;  5IP7 H;  2ZTE A;  3GD7 A;  5GAE C;  3U58 A;  2JE6 I;  2Q2I A;  3HKZ E;  1PH1 A;  3GTG H;  1YHA A;  5M5Y H;  4A3C G;  3DLL A;  4GKJ Q;  4IPG A;  4GNX A;  1XMO L;  2K4K A;  5J3B A;  4A3F G;  1I3Q H;  2LXJ A;  2C35 B;  4DUZ L;  1KL9 A;  2LXK A;  3KF6 A;  2IHE A;  3S2H H;  4K0K Q;  2K5N A;  5JEA G;  4OXP A;  3L7Z C;  1VQD A;  2N3S A;  3T1Y L;  4OON A;  1KIX A;  4LF8 Q;  1SE8 A;  3CCL A;  4LNQ A;  4IFD I;  4AQY Q;  3E9H A;  1EIF A;  1LYL A;  1YHQ A;  5C44 G;  3H3V I;  2YTX A;  2Z6K C;  4DV6 Q;  4X64 L;  4KHP L;  2UUB L;  1VQM A;  4DR4 Q;  4DUY Q;  2OQK A;  1J5E Q;  4LF7 Q;  5IYC H;  1VQI A;  4JI1 Q;  1OXX K;  2JA7 G;  2IX0 A;  4YY3 Q;  3CC4 A;  3CD6 A;  2RHQ B;  1UE6 A;  2KHJ A;  3S1N H;  1YZ6 A;  3CQZ H;  5LMU Q;  4DAY B;  1JJ2 A;  4J15 A;  1HR0 W;  2UXC L;  2IY5 B;  1MJC A;  4NPS A;  4C3H H;  2AWO A;  1E22 A;  2MO1 A;  2I5M X;  3B6Y A;  1Q81 C;  2YU9 H;  4YHH L;  4A3M H;  1PH8 A;  3M3Y H;  4QL5 A;  5IYB H;  3H15 A;  1I50 H;  3CCQ A;  1L0W A;  4BY7 H;  4DR2 L;  3SGI A;  2R92 G;  1Y1V H;  2YTV A;  4A76 A;  3CCM A;  4BY1 G;  3M4O H;  4DR1 L;  3PF5 A;  1EFW A;  2N49 A;  2NVX H;  3OTO L;  4GOP C;  4LF9 L;  2HHH Q;  3BJU A;  3MEF A;  4DV1 L;  2VUM G;  1CKN B;  3HOV G;  1VQO A;  1VQP A;  1PH2 A;  2DUD A;  2PQA B;  5IWA L;  1U0L A;  4QIW E;  2ID0 A;  4BBS G;  4A3G G;  4KLK A;  4A3L G;  4NXN L;  4POF A;  4DR5 L;  2JA6 H;  2OTJ A;  1N34 Q;  1HNW Q;  3GTJ H;  2UUC L;  4R4I A;  1N33 L;  1WCM G;  2B63 G;  3H0G G;  1U5K A;  2GVA A;  4GN4 B;  2HT1 A;  2K75 A;  1N32 L;  4H02 A;  3RZO H;  2QEX A;  4LW1 A;  2UUA Q;  5K36 G;  5C4X H;  1UE1 A;  2BH8 A;  2JK8 A;  4A75 A;  4DV7 L;  1RIP A;  4JI5 Q;  4DV0 L;  4HIK A;  1L1O B;  1HZB A;  5IP9 G;  2MFI A;  4GNX B;  1QVG A;  2JA5 H;  3M4Q A;  1PA6 A;  3G6E A;  4IPD A;  4JBW A;  4JI8 Q;  4P72 A;  4PZ8 A;  2Z6K A;  1SRO A;  3KF6 B;  4RMF A;  4DAM A;  4X65 Q;  2EIF A;  1VQC A;  1R9T H;  3RR5 A;  1Q7Y C;  3F2D A;  1YJW A;  1Q82 C;  5M5W H;  3TS0 A;  2JQO A;  3NBH B;  4B3R L;  3D31 A;  4NXM Q;  3L0O A;  2CFM A;  3J81 j;  4XTC S;  5C0X J;  1EIY B;  3I4M G;  1QVF A;  2PMZ E;  1WFQ A;  3RN2 A;  3STB D;  4DV3 L;  1H95 A;  3I2Z A;  1CSQ A;  1YNX A;  2XTI A;  3D0F A;  4DK6 C;  3G48 A;  3A74 A;  1WYD A;  1BBU A;  3J80 i;  1PYS B;  4X64 Q;  4HJ5 A;  3KJO A;  2ZJP A;  4GLX A;  1QUQ B;  1JB7 A;  3CCE A;  4JBK A;  4KHP Q;  3HKS A;  2NN6 I;  4GS3 A;  3I4N H;  1HNZ L;  1HNX Q;  2JJQ A;  4GOP A;  1OTC A;  4C2M H;  1C7Y A;  2OTL A;  3UE0 A;  5IT9 c;  1SFO H;  2QGQ A;  4QGU A;  4A3C H;  5JJK A;  2UXB L;  4DKA C;  4UP7 A;  2R93 G;  3U4V A;  4DV2 Q;  2ZJR A;  3UDI A;  5LMN L;  3PV0 A;  4A3K G;  4A3F H;  1X3G A;  2MO0 A;  1HH2 P;  4WJ3 M;  2ZJQ A;  1A0I A;  5GAG C;  1LM0 A;  4IOA A;  2R6G A;  4DR3 Q;  5C0X I;  3RLF A;  1VQE A;  2HIV A;  4JCV E;  3G4S A;  4GKK L;  3F2C A;  2JA8 G;  3PO3 G;  4O2D A;  1PYB A;  4LF9 Q;  3OTO Q;  2E2H H;  4R4C A;  5C44 H;  3AEV A;  3T1H Q;  4HIO A;  1K73 C;  2BH2 A;  1YI2 A;  1X56 A;  2RCN A;  1GKH A;  2R7Z G;  5IYD G;  4DV4 Q;  5E7N A;  3W1G A;  4JG2 A;  5M3M G;  3HOW G;  3BZK A;  3I55 A;  3OW2 A;  2E2I H;  3VDY A;  1FJG L;  4DV5 Q;  1G29 1;  4JI7 L;  2JA7 H;  2RHS B;  3KDF B;  4LFA Q;  5M3F G;  4NXN Q;  5BR8 L;  1QVC A;  1VQ9 A;  1N36 L;  2UXD Q;  1WJJ A;  1X65 A;  1SRU A;  4A3E G;  1MJE A;  2NZO A;  4NB3 A;  2UUC Q;  4BBR G;  1V9P A;  2ZM6 L;  1N33 Q;  3S1Q H;  1E1O A;  1N32 Q;  2WB1 G;  2D0P A;  2AMC B;  3S16 H;  1BKB A;  1W3S A;  1XPO A;  1C0A A;  4DV7 Q;  1N8R C;  1YJ9 A;  3FP9 A;  2R92 H;  1QZH A;  5IE8 A;  1YHB A;  2NVQ H;  1VS0 A;  4BY1 H;  4IO9 A;  4GN3 B;  4POG A;  2I0Q A;  4EQ5 A;  4LUV A;  2VW9 A;  1A63 A;  1TWH H;  3AFQ A;  2VUM H;  3HOV H;  3S2D H;  2ES2 A;  3BU2 A;  2GVB A;  5EAY A;  3I56 A;  4BBS H;  4A3G H;  1I94 Q;  1HR0 Q;  2F4V L;  1IBM L;  1KRS A;  2VQE L;  1DGS A;  3GTK H;  3RLO A;  4A3L H;  4B3M L;  1UEB A;  1SLJ A;  3S1M H;  4DR7 Q;  4B3R Q;  1NY4 A;  1WCM H;  3UDF A;  3H0G H;  1SMX A;  1IBK Q;  5FJ8 G;  4OWW B;  5GAD C;  2B63 H;  3M4P A;  4LF6 L;  4LF5 L;  4JI2 Q;  1VQG A;  2HQL A;  4DV3 Q;  1KD1 C;  1FGU A;  2OWO A;  4UP8 A;  3PSI A;  4UPA A;  4BA2 I;  2E5L L;  3CW2 C;  4GOP B;  1YIT A;  3HOY G;  1PH3 A;  4AYB E;  3PF4 A;  4WJ4 A;  1Q1B A;  4JYA Q;  1UE5 A;  5IP9 H;  1Y1W G;  1VQ4 A;  2OQ0 A;  4L5Q A;  3CXC A;  4LUZ A;  1XMQ L;  4JI3 L;  3STB C;  4X66 Q;  4JI4 L;  1V1Q A;  3DM3 A;  2AKW B;  2Y0S E;  5AJ3 L;  1XNQ L;  3GTP H;  1O7I A;  1HZ9 A;  1IZ6 A;  2KBN A;  3A0J A;  4APV A;  4B3S L;  4JV5 Q;  4LFB L;  5JJI A;  1G6P A;  4AH6 A;  4MZ9 A;  4A3I G;  2B3G A;  4DR6 Q;  1VCI A;  4HJ8 A;  1BVS A;  3WWV A;  3HOX G;  1HJP A;  1AE3 A;  1JMC A;  3KFU A;  4QJF A;  1JT8 A;  3E9I A;  2KHI A;  4JI6 L;  3HKZ G;  1TWC H;  1M1K C;  5FLM G;  4P73 A;  3I4M H;  1TXY A;  5ELN A;  4JI0 Q;  4LWC A;  1IBL Q;  2JA9 A;  1Z47 A;  3K0X A;  3S24 A;  1LTL A;  1X6O A;  2K52 A;  3KYH C;  1NJI C;  3TQY A;  3EN2 A;  1VQH A;  3A5U A;  4LF4 Q;  2OCE A;  1GD7 A;  2WAQ E;  4X62 Q;  3PUW A;  1ASZ A;  2PI2 A;  1GVP A;  1XNR L;  4KHZ A;  4HIM A;  4HJA A;  4GKJ L;  1K3R A;  2F52 A;  4PG3 A;  3UE1 A;  3IRB A;  2Q2U A;  1EWI A;  4R4Q A;  1XMO Q;  1N36 Q;  4TQU S;  1D8L A;  3KJP A;  2R93 H;  4DUZ Q;  2JEA I;  5FLX c;  2I5L X;  1VQA A;  4K0K L;  3J81 c;  4B3T L;  2F3I A;  3PO2 G;  3NEM A;  3T1Y Q;  1CKM A;  3F8T A;  3HOU G;  3I7F A;  4DNI A;  4P74 A;  4LFC L;  1EQQ A;  2JA8 H;  4DV6 L;  3PO3 H;  1L1O C;  4UP9 A;  1PH7 A;  3S15 H;  2CKZ B;  2KEN A;  4DUY L;  4DR4 L;  2UUB Q;  3J7A 5;  1J5E L;  3CMA A;  4BXX G;  4LF7 L;  2KCM A;  4JI1 L;  2R7Z H;  1NBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...