4DV1Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv1Q00
1CSPA 3K81C 1M1KC 1L1OA 3S2DH 1VQAA 4DV1L 1Q1BA 1X3EA 4TVAB 4X64Q 3UDGA 3MXNB 2N49A 1SMXA 4R4QA 1MKHA 2HIVA 1Q8KA 4H02A 4BA1I 3FKIH 4P72A 1HZBA 4GN5A 5IYDG 4LF8L 4LF9L 1SRUA 1SR3A 1GVPA 2JJQA 4JI6L 5M3FG 3TREA 3RLOA 5FJ8H 1K83H 3F1ZA 3JAMi 3CCSA 4DK3C 4IO9A 2VUMH 1XNRQ 5IP7G 1BKBA 3F8TA 4JBKA 4MNOA 1LUZA 3U58A 1VQ6A 1VQPA 2HT1A 2YYZA 4JI3L 1ASYA 1K3RA 5IYDH 1X3FA 4A3GG 4R1JA 1GO3E 1P16A 2KENA 1QUQA 3HKZG 4C3IH 4HJ7A 4JI0Q 2JA7H 3S16H 2VS1A 3G71A 2D0OA 4B3TL 3I4NG 4A93G 2WB1G 3S15H 4JI8L 1K0RA 3UDXA 1VQOA 1XMOL 3CCMA 4B3TQ 3KJOA 3AQQA 2AMCB 1MIUA 1GD7A 3BZKA 3EIVA 4LUVA 4LFCQ 2IY5B 3K8AA 1XMQQ 3WWVA 4GLXA 4A3LG 2B63H 3CPFA 1IL2A 3KOJA 3TS2A 1JJGA 2RHSB 5C0XJ 3I7FA 3H3VH 2OCEA 4DR4L 4WJ4A 1PH4A 1FGUA 2PI2E 4BBRH 3DLLA 4GKKQ 3HOYH 2UXDL 4BY7G 3S17H 1UWVA 4C3JH 1SE8A 2K50A 2PQAB 4DR4Q 4X66L 3NENA 5GADC 3HOWH 5GAGC 3CCQA 1XJVA 2ID0A 3TRZA 1VQJA 1YEZA 4KHPQ 2YTYA 3I2ZA 4DK6C 5IWAL 1RL2A 4GN4B 4JI4L 2ZJPA 2K52A 4IPDA 2K75A 4DV4Q 2LSSA 4A3MG 5AJ3L 4DR2Q 4LFBQ 3M85A 2CCZA 5IYBH 1HNXL 2GN5A 4EX5A 3CCJA 4DR6L 4QIWE 1IBKL 2HQLA 3EBEA 1NY4A 2Z6KA 1QZGA 2E2JH 4QL5A 2UUAL 2JA8H 4DV7Q 1N33L 4YWLA 3ULLA 4KHZA 3TEHB 2KHIA 1YHBA 4A3FG 1JB7A 3HOVG 2MQHA 1PV4A 2E5LL 3OYYA 3MEFA 4BA2I 4DUYQ 1E3PA 1E1OA 1NMFA 3HOZG 1TWFH 1W3SA 4PZ6A 3S1MH 2K5VA 4P73A 4DR3Q 5IYCH 4QJFA 5LMNW 2OTJA 4ALPA 4YY3Q 3Q8DA 3F2DA 2B3GA 2I5LX 2HHHQ 1VQEA 2Q2UA 3FHWA 2CQOA 1LTLA 3RLFA 4LFAQ 5LMNQ 1PYBA 4NXML 2PQAA 3CF5A 3RR5A 4DR7Q 4IJHA 3KLWA 3ZJYC 4IFDJ 4LFCL 5M5WH 5FLMG 3A5ZB 3PV0A 4FDBA 3AFPA 2PI2A 4DV2Q 3G4SA 1EYGA 2YTVA 4PZ8A 4DUZL 4LF7Q 5K36G 1AH9A 3UE1A 4X64L 3PUVA 2Y0SG 1HZAA 4DR7L 4JV5Q 5JJLA 3PIOA 4GOPB 1Q82C 1UE5A 1AE3A 2QA4A 4HIMA 1NTGA 1N36L 4OWWB 2ATWA 2QGQA 4A3IH 3GTPH 3NELA 1I3QH 3J7A5 1HNWL 2DGYA 1HR0W 1I5FA 2RHQB 4K0KQ 2B63G 3TQYA 3KJPA 2EQSA 3STBC 4IOCA 4BBSH 4NXNL 2CWPA 2NN6I 1BBWA 1MJCA 4P74A 1IZ6A 2F52A 4AQYL 3BJUA 1X6OA 3KFUA 4JBJA 1TWAH 4YHHL 3S1QH 2WAQG 3PSIA 4JV5L 4L5TA 2AWOA 4IPHA 4GNXB 3K0XA 4GS3A 3L2PA 5IP9G 1GM5A 2R7ZG 4BXXH 3W5OA 2UU9Q 1VQ8A 1C9OA 4A3DH 1AE2A 4A3GH 2BA0A 4RMFA 3GD7A 3EN2A 3BZCA 1XPUA 1NMGA 3KDFB 3STBD 2E8GA 4B3MQ 1IBML 3CQZH 1V43A 1B8AA 1X54A 3I4NH 4DV0L 2OQKA 4PMWA 3S24A 1B7YB 1D7QA 2BA1A 4X62L 5ELNA 2JA6G 1VQHA 4J15A 1L2FA 5FJ8G 5C44G 1PFSA 2R7DA 2IHFA 3I56A 4HJ9A 4A3FH 1V9PA 2L15A 3HOVH 1IXRA 1PH7A 3D0FA 2VQEQ 4DR5Q 4HJ5A 5C4XG 4DV6L 2ALYB 4IOAA 2R7FA 4DV5L 1PHJA 3M4PA 2IX0A 2VQFL 1UE1A 1X65A 2BH8A 4LW1A 2ZTCA 3E0EA 3K7AH 2B29A 4YWKA 4HIKA 4A3EH 1VQ7A 2E2HH 4JI7L 2EIFA 1C7YA 1I6HH 2LXJA 2IHEA 1XMOQ 3ULPA 2R93G 1D8LA 1E24A 4UP7A 2UUBQ 1I94L 4PG3A 4JI1Q 4JI2Q 2XGTA 3RZOH 1Y1VH 1PH3A 4Y52H 4YCWA 2UUBL 3PO3G 4DR5L 1P8LA 4JCVE 2JA8G 3GTKH 4A3KH 1KD1C 2ES2A 3J81j 3FKIG 3G48A 2VQFQ 2NVTH 3OTOQ 3CC4A 3KDFA 4POGA 1S40A 1QZHA 3HOXG 2UXCL 4YCUA 4DAMA 3HOYG 3BU2A 3M4OH 3GTGH 4B3RL 4NXNQ 3NBHB 1XPRA 5IE8A 4TQUS 2CWAA 3CCRA 1H95A 2KHJA 4MZ9A 1VQKA 4LWCA 4JI5Q 2LXKA 4A3LH 3U50C 3H0GH 2Y0SE 2NZHA 4DV0Q 1HNZQ 4B3SQ 3D31A 1YNXA 1KQSA 1VCIA 1WJJA 5ELOA 4R4IA 1FJGL 1EIYB 4JOIC 1YHAA 3J80i 4LFBL 3JC66 2JA6H 3J81i 5DLQE 4GLVB 2UXCQ 4BY7H 2ZTDA 2MO1A 1TWGH 1IYJB 4BY1G 1JE5A 4GLAC 3UDIA 2YU9H 2OWOA 5IT9c 4AYBG 1SROA 4LF4Q 2F4VL 1K8GA 4A3JH 1Y14B 4C2MH 4JI8Q 4LUZA 3K80C 1KC8C 4JI7Q 3JAMc 2UUCL 1U0LA 3CXCA 4LFAL 3PO2G 1MJEA 1Z47A 5JJIA 2KCMA 5JEAJ 1Y1WH 1HNZL 4B3SL 2Q2HA 4A76A 3FP9A 1WI5A 2XTIA 4DR1L 4DR3L 4DV5Q 3HKSA 1SN8A 2CKZB 1PVOA 4PZ7A 3H3VI 4HJ8A 1RIPA 1IBLL 3U4ZA 2OQ0A 3GDEA 5M3MG 3J80c 3DM3A 1T9HA 3L0OA 4Y7NH 4A4IA 5M5XH 2ZJRA 3S2HH 2F3IA 1IBMQ 3KF6B 4OO1I 1KIXA 1VQFA 3A5UA 1KAWA 4AIMA 1Z9FA 4IJLA 3H15A 1XPOA 2OTLA 2UUCQ 2H5XA 1Q1EA 4DV3Q 4DV2L 4A3IG 4GOPC 4DPGA 3CPWA 4X62Q 1DGSA 3CMAA 2E2IH 2JA9A 3RNUA 1WOCA 2VUMG 3PF5A 4DV3L 3B6YA 4A75A 1YITA 1J5EL 1U5KA 5IYCG 1HNXQ 5C3EH 3TS0A 4LF5Q 3HOUG 3HFZB 4OWTB 1NE3A 1BVSA 4HIDA 4YY3L 1NBWA 2VL6A 4JI3Q 1HNWQ 2HHHL 1KRTA 4X65L 4JOIA 1W2BA 1Q7YC 1S3OA 4UPAA 1CSQA 2NVXH 1KXLA 3PUYA 1FL0A 4ME3A 1XNQL 3I4MG 5C0XI 3PUXA 4P75A 1Y1WG 1N32L 1EQRA 1G51A 1L0WA 2GVBA 1EIFA 4UY8C 5IYBG 3GTOH 3E9IA 4DAYB 5HY6A 4GNXA 3CC2A 2ASBA 1QVGA 4LF5L 4LF6L 1SFOH 1XMQL 3AEVA 4YCVA 5FLXc 5C44H 1G6PA 2R7ZH 4BXXG 4LF6Q 2DUDA 1E22A 2AHOB 2D0PA 2GVAA 2I5HA 5IY0A 2VW9A 3W1BA 3VDYA 3RLNA 4A3KG 2K5HA 3LGJA 1EQQA 1VQ5A 4JI4Q 4IFDG 4DUZQ 4R4TA 4QQBX 1N32Q 1SLJA 1YIJA 4O0AA 4A3DG 4IFDI 4IPGA 1TWHH 4A3CG 3W1GA 3T1YL 1VQLA 1VQ9A 2R93H 1A62A 1EFWA 2UXDQ 2D62A 3AFQA 3M9BA 2MFIA 1TWCH 4WJ3M 2UUAQ 1X3GA 2JEBI 2VZAA 1VQBA 1K73C 5BR8L 4L5QA 5H1SE 3CCUA 2PMZE 2N78A 3KYHC 4JI5L 2QEXA 1K8AC 1M90C 1C0AA 1VQIA 3ER0A 2JA5G 2E5LQ 1B70B 3PO3H 4X65Q 5C4XH 4QGUA 3RZDH 3KF8B 2K14A 2FXQA 2K4KA 3RN5A 4A3BH 1I94Q 1S72A 4A3BG 1HJPA 2WAQE 4OX9L 1V1QA 3F2CA 4HJAA 5GAHC 5AJ3Q 1CKMA 1KRSA 4DR2L 3S1RH 2JA5H 1YVCA 3AYHB 4OX9Q 1IBKQ 5LMUL 2NVQH 4DR6Q 4GNXC 4A3EG 4LNQA 4JI0L 1YJ9A 1FJGQ 4APVA 1G291 1WCMG 1YBYA 2CFMA 4L5RC 3CCLA 2ZTEA 2RCNA 4JG2A 1E7ZA 4DKAC 4A3MH 1A63A 3CC7A 3CP0A 2HIXA 4X66Q 1UEBA 1WYDA 4JBWA 1QUQB 1XTDA 3PGZA 1PYSB 4MTNA 1OXXK 2YTXA 1VQDA 2PNHA 3E9HA 1YZ6A 1K9MC 1XNRL 3ERSX 4UP9A 1X56A 3PCOB 2YV5A 2JE6I 1LM0A 5IWAQ 3PUWA 2VQEL 1Q86C 3CCVA 2I0QA 3GTQH 4JYAL 3PF4A 3A74A 1PH6A 1VS0A 4GKKL 4LF8Q 4LF9Q 4JBMA 5LMUQ 1JMCA 2NVYH 2KCTA 4A3CH 1N8RC 3S1NH 1CKNA 4BBRG 4HIOA 2UU9L 1OXVA 4P71A 2ZJQA 4DNIA 1JT8A 1EUJA 2K5NA 1HR0L 3CD6A 2VY3A 5LMNL 3GO5A 1OTCA 4L5SA 1CKOA 4A3JG 1NJIC 4B3ML 4NXMQ 3HOWG 2V1CC 1HR0Q 5GROA 2JQOA 1EWIA 2NN6G 4NB3A 1OXUA 1BBUA 2EXDA 4XTCS 4YWMA 5FLMH 3OW2A 4A93H 4JYAQ 4GN3B 3I55A 5HGQA 4AQYQ 2BH2A 4KLKA 1J6QA 4YHHQ 3HKZE 3U4VA 2A1AA 4X6AH 5BR8Q 2R6GA 1KL9A 1Q46A 1WCMH 2NZOA 1CKNB 1OXTA 4XIGS 5M5YH 1EOVA 5JJKA 1N33Q 1PA6A 2Z6KC 3HOUH 3CW2C 3KF6A 1O7IA 2VNUD 1I50H 5GQOA 3K7UC 1VQCA 3HOZH 3UDFA 1HZ9A 1X9NA 3PIPA 3J7ZC 1PH1A 4UP8A 4OO1G 2A8VA 1HH2P 4OXPA 1J5EQ 2IT1A 1PH9A 4LF7L 3GTJH 2N8NA 1QVFA 2ZM6Q 1Q81C 3I4OA 3IRBA 3RN2A 1Y1VG 4LF4L 4EQ5A 4DV1Q 4JI6Q 5C4JH 3ULJA 4KI0A 4POFA 3I4MH 2JEAI 3S14H 4KHPL 2AKWB 5M3FH 1WFQA 3M4QA 4O2DA 1PH8A 4AH6A 1XNQQ 2Z0SA 2R92H 2IX1A 2JA7G 1PH2A 4JC0A 1JJCB 1VQMA 3ICEA 2JK8A 2A19A 1QVCA 2N3SA 4GKJQ 4DR1Q 1A0IA 1FVIA 4DUYL 1HZCA 3PUZA 2WP8J 5C3EG 4C3HH 3J81c 2UXBQ 1KHIA 3M3YH 3CAMA 2Q2IA 3T1YQ 2MNAA 3T1HQ 1VQ4A 3GTLH 4DV7L 1R9TH 3M7NA 2F4VQ 5EAYA 2R92G 3OTOL 3PO2H 1GKHA 4NPSA 1N9WA 2WFWA 4OONA 1N34L 1VQNA 4LUOA 2C35B 1A8VA 3CMEA 5M3MH 1N34Q 3A0JA 3H0GG 4JI2L 3L7ZC 4DV4L 5IP9H 4GKJL 1LYLA 2KBNA 2UXBL 5C0XG 5J3BA 2WB1E 2I5MX 2AWNA 4IPCA 1L1OB 1E1TA 4R4OA 3G6EA 4GOPA 1YI2A 4RG1A 3NEMA 2Q2TA 1X55A 3GTMH 1CUKA 4QY7A 5GAEC 4BY1H 3SGIA 5E7NA 3T1HL 1N36Q 1L1OC 1UE7A 1IBLQ 1Q12A 1UE6A 2MO0A 5JEAG 1YJWA 4BBSG 1OXSC 4B3RQ 2RF4A 1YHQA 1ASZA 4K0KL 1VQGA 4AYBE 1JJ2A 3UE0A 1TXYA 4OWXB 3CCEA 1PH5A 5IP7H 3F2BA 3HOXH 4R4CA 1YJNA 2ZM6L 4JI1L 4DV6Q
chains in the Genus database with same CATH superfamily
1M1KC 2B2UC 1L1OA 2F3VA 2OXPA 2RVLA 1VQAA 1Q1BA 3SDZA 4X64Q 1XWEA 4U673 1K0SA 2EDGA 1SMXA 2XIWA 4FVMA 4LF9L 1SRUA 4FYDA 4K8IA 5EGTA 5FJ8H 3JAMi 3CCSA 2NBFA 3A54A 4P2CB 4RA8A 1PLFA 4KKSA 2N88A 1BKBA 3F8TA 4JBKA 4MNOA 1O7ZA 2HT1A 3C3LA 5EKIA 4A3GG 4ZAIA 4R1JA 3S2DB 4HJ7A 3HKZG 2JA7H 4JI0Q 4M8AA 2VS1A 1RDPD 2D0OA 4ULLA 1GXDC 2JA8B 2FMMA 1LT6D 2K04A 1XMOL 1TY2A 4BBRB 5KNCA 4LUVA 2JXMB 2HDLA 2JYOA 3K8AA 1UEAB 3WWVA 4GLXA 1G91A 1SBBB 3TS2A 3CPFA 3NSWA 2EYOA 3I7FA 3H3VH 1GUGA 5CBAE 1PH4A 4BBRH 1EWHA 4GKKQ 2UXDL 5I4DA 3S17H 3C2PA 2K50A 1BO0A 4X66L 3NENA 4QUFA 4C3HG 4CKCA 4KHPQ 2L9HA 2YTYA 1Z7TA 5D3DA 4GN4B 4MTKA 3JAML 5E1FA 2K52A 1GUNA 3ONAB 2F0UA 1I50B 2LSSA 5AJ3L 2CCZA 5ELFA 4DR6L 2LS01 3KBXA 4QIWE 2HQLA 3T56B 3V2TA 1T5EA 1QZGA 3PO3B 2UUAL 3SK4A 2MQHA 4OO1H 5EKLA 2PZUA 1PFNA 1KLGD 1NMFA 3HOZG 2D5DA 4PZ6A 3S1MH 1QNKA 5IODA 4L63B 3TZDA 1PTOB 3Q6SA 3F2DA 2HCIA 2I5LX 1VQEA 3D4WA 2CQOA 4K2LA 1PYBA 4F7XA 1ESFA 3TP5A 3CF5A 5M5WH 1BBXC 1OO9B 2YTVA 5JJLA 4X64L 1A3UA 4JV5Q 4KKUA 1GUTA 1SE2A 4HIMA 4K2KA 2QGQA 4K5VA 3GTPH 1ILPA 2B2WA 3KF8A 1LABA 4DAPA 1AFPA 2CWPA 4NMZA 2F52A 3FDTA 4AQYL 3KFUA 1RODA 3OIQA 4JV5L 2X6LA 4IPHA 5EJWA 3I4NB 1KNEA 3L2PA 5JVH3 1PZID 2UU9Q 1VQ8A 2BDNA 4RMFA 1XPUA 1ML0D 2E8GA 1KLUD 4PV1C 1X54A 3SHLA 4PMWA 3S24A 2B39A 1W6KA 2BA1A 5IGEA 5ELNA 1SXTA 1VQHA 2WINB 1QWYA 3NBIA 4EVOA 2R7DA 5C44G 1XYIA 4DR5Q 1WTOA 2R3ZA 4DV6L 4YIJA 1TQOA 4NP5A 5IGDA 1GUWA 4DV5L 1PHJA 3M4PA 1D6EC 1X65A 3NUCA 4A3EH 3K7AH 4YWKA 3VR5A 1F9RA 4X3KA 1PRTF 2LXJA 4A3MB 1XMOQ 4N9TA 4MHEA 2R93G 3AU7A 5A2QL 2UUBQ 2AQ2B 5FO7B 2EE1A 4A3EB 3LWEA 2NTSA 5I6YA 1BQQT 2UUBL 3PO3G 3MEHA 3S1QB 4RGMA 2VQFQ 3KDFA 2NWGA 1DOLA 2E2DC 4YCUA 2M2LA 4DAMA 2CH4A 1TVXA 3M4OH 2NVQB 5IE8A 1Y8NB 2CWAA 2KHJA 1VQKA 4A3LH 1G8ZD 2NZHA 5JPNC 4DK1A 4HAEA 4LFBL 2F0JA 3JC66 3URYA 4FO2A 4GLVB 2ZTDA 4H44C 3HEJA 1ZKOA 1JE5A 2YU9H 2F4VL 4I7AA 4N9PA 3DUZA 3VYSA 4AYBG 5IT9c 4LF4Q 4A3JH 4C2MH 4JI8Q 4C1NI 3TP6A 1GOZA 1U0LA 3HG9A 4NDXA 1BXTA 1MJEA 1Z47A 3K0YA 4TRDA 5COYA 5JEAJ 2SNSA 4EQPA 3GTPB 2WACA 2CW0D 2NVYB 3MFGA 5LL6S 2F0VA 4DR3L 4DV5Q 4M1UB 1PVOA 4PZ7A 3H3VI 1IBLL 3U4ZA 5M3MG 1RD9D 1LT4D 3L0OA 2ZJRA 2F3IA 1IBMQ 3KF6B 4OO1I 1KAWA 4HSPA 3HZXA 4AIMA 4CDCC 1Q1EA 1LTGD 4GOPC 4F88A 4X62Q 2JA9A 3RNUA 1WOCA 2VUMG 5CORA 5IT9L 4A75A 1U9RA 1JWSD 1LTSD 1S5DD 1U5KA 5IYCG 1HNXQ 2DN8A 5C3EH 3TS0A 4LF5Q 3HFZB 3I3CA 3T13A 5I2XA 4LJZC 2F0WA 3S16B 1K83B 4FXKC 1KRTA 5EQ0A 1W2BA 1RKNA 1KXLA 3GQBA 3PUYA 1HA6A 3A55A 1Y1WG 1JWMD 5CMDA 2I07B 1G51A 2HUGA 2Z6BA 3GTOH 1EWCA 5DM73 2BE5D 2C9OA 4LF5L 3BDLA 1SFOH 1F2YA 2R93B 1IW7D 4IUNA 3DXJC 3N6RA 3QIAA 3NQTA 5IY0A 2AHOB 4DK0A 4JI6L 4KD4A 3LGJA 4F8MA 3I72A 1JQYD 1N32Q 2EYMA 2H4OA 3A7AB 4ZQ3A 3HOXB 3FVQA 1Y8PB 1WD0A 1VQ9A 1FNVA 1K8MA 2D62A 3C46A 1Y69U 4WJ3M 1I4GA 2UUAQ 2L4NA 4X3UA 1K73C 5BR8L 4ZRZA 3VR6A 2WKDA 4QGUA 2K14A 1LT3D 1TU2B 1S72A 3EVQA 4OX9L 3W3AA 2Z1CA 2F4IA 4OX9Q 1U4LA 2B2VC 2X6GA 2NVQH 3J7AV 4DR6Q 3PO2B 2L0CA 4LNQA 4JI0L 1SJED 3T53B 5I2YA 1YJ9A 1WCMG 3CCLA 4A3MH 1WTVA 1A63A 3CC7A 1VMPA 1WYDA 1B4OA 1HQRD 3PGZA 4XXEA 1SNDA 2XWBB 1K9MC 4UP9A 3PCOB 4I7ZC 2JE6I 2I0QA 4JYAL 1EFID 3A74A 1V1PA 1VS0A 4GKKL 4LF8Q 1KAAA 5ELDA 2K7VA 3X3NA 1DM0B 4BBRG 5FLXE 2UU9L 4P71A 2A5HA 2K5NA 3R2IA 3TDQA 2VY3A 1OTCA 1CKOA 4A3JG 1NJIC 2V1CC 1HR0Q 4CHTB 2NN6G 1BBUA 1EY0A 3MXPA 4XYOA 5ELCA 1STNA 1SAPA 2HCCA 1J6QA 5CV8A 3U4VA 2X69A 4RGNA 5BR8Q 4XIGS 1OXTA 4DNRB 1JICA 3CW2C 3KBGA 5JPMC 3MC0B 3V96A 3K7UC 1K3BC 3UDFA 1HZ9A 1X9NA 2A8VA 2E76C 1IL8A 2CHBD 4LF7L 3IRBA 2F0OA 2I46A 3RN2A 1Y1VG 3ULJA 4KI0A 3I4MH 3S14H 1KDAA 2AUJD 3A7LA 3G6JB 1XNQQ 2IX1A 4JC0A 2JK8A 2A19A 4GKJQ 1A0IA 2MUYA 1LT5D 3J81c 3K57A 3A56A 3CAMA 2Z4HA 4C3IB 3T1HQ 1VQ4A 1R9TH 2R92G 1R4PB 3MZ5A 3S1MB 2EOTA 1HQMC 5C4ZA 4J8QA 4DU9A 2D9UA 4DAVA 1SYDA 1TS2A 1BR9A 5BN5A 2J4XA 4OL7A 4IPCA 4GOPA 2MHVA 3KLSX 1FNUA 3WOEA 1IBLQ 3QG1A 2EYHA 4RCOA 1VF7A 2M9VA 5C0XH 1I4XA 3OMCA 1YHQA 1ASZA 4K0KL 1I6VC 2FHTA 3UE0A 1TR5A 4OWXB 3CCEA 2ZXOA 1MGSA 2LY7A 2QCPX 4KY5A 4A3JB 1X3EA 2HQEA 3UDGA 4A3BB 3MXNB 2N49A 5FLXL 4R4QA 4H02A 4LF8L 3BVMA 1DJRD 4GN5A 4CDFC 5IYDG 5C44B 1SR3A 3CRKC 2KCCA 1BCPC 3RLOA 1H9RA 2RA4A 1LTAD 2A68D 2XRSD 2HD3A 5IP7G 1S5ED 4JI3L 1ASYA 1X3FA 5I6WA 1P16A 1QUQA 4FNFA 1SDFA 2R7ZB 3UDXA 2QEJC 3KJOA 2AMCB 1GD7A 1SYEA 2QKIC 5D65A 4ZUJA 5C5LA 4WJ4A 1J8IA 1FGUA 3EA6A 3S2HB 5D3IB 4LK1C 5M5WB 4BY7G 1UWVA 4DR4Q 2PQAB 4XYQA 3VA7A 1HUNA 3TRZA 1VQJA 2MGSA 1D5MC 1RL2A 1W6JA 4BY1B 4IZ8A 4IPDA 2K75A 4AYBB 3BS1A 4DR2Q 3K6OA 4LMQD 3WDNA 3BDOA 3NWTA 4OELB 1N33L 3ULLA 3FKIB 3DEPA 4FP5D 4KHZA 2Z4IA 3D8GA 1YHBA 4A3FG 3HOVG 1PV4A 1DXMA 4ZYSA 4BA2I 2F0LA 1W3SA 5C4HA 4ID6A 2K5VA 3N52A 5IYCH 4DGZA 5LMNW 2OTJA 1CQVA 2P5ZX 3MXNA 2B3GA 4HMIA 1AP0A 3IL8A 1JCKB 1SNMA 5I9OA 3FHWA 1EY6A 2RDHA 3OW7A 3RLFA 2PZWA 5LMNQ 2ICIA 2IPKD 2PQAA 4Z9CB 2CW0C 4R8NA 2L11A 4IJHA 3KLWA 3ZJYC 3A5ZB 3PV0A 3A8IE 4FDBA 5K36G 1AH9A 1I4RA 4LF7Q 3PUVA 4GOPB 1K8OA 1AE3A 2QA4A 1NTGA 2DNEA 1N36L 4A3IH 1Y1WB 3TP7A 3NELA 2DGYA 5IIFA 1HR0W 2B2TA 3R8BA 1PTOH 2RHQB 2R61A 2G9HD 3A8KE 2O5JC 2EQSA 3STBC 4IOCA 2NN6I 3PQIA 1MJCA 2E75C 4P74A 4IUUA 3BJUA 2K6AA 4BBSB 4ZK9B 1TWAH 5CV9A 4YHHL 4GNXB 3K0XA 4GS3A 4A93B 1YNJC 2R7ZG 1C9OA 4G7HC 4A3GH 3EN2A 3H3VC 1DYQA 1NR2A 3CQZH 2EYLA 2OF1A 2E2HB 1VDZA 1QB5D 2B2YC 1D7QA 4XQNA 4A3FH 3HOVH 1V9PA 1PH7A 1MBYA 4HJ5A 2FFKB 5M3FB 1H9MA 2ALYB 3SXHA 2R7FA 1ENFA 4RFBA 3Q0AA 5G3LF 2IX0A 2VQFL 4DV6Q 3GTQH 1A3TA 2E2HH 1VQ7A 2EIFA 2LKVA 2F0QA 3P7JA 2MJ8A 1D8LA 5FOBB 4UP7A 1I94L 3S14B 4HCEA 3RZDB 3RZOH 1PDQA 4RGTA 1PH3A 4YCWA 1P8LA 1KTKA 2JA8G 2ES2A 2GA4B 1SMYC 3J81j 1NR4A 2DY7A 4POGA 3GP7A 4B3RL 3Q22A 3NBHB 1XPRA 4CKBA 1H95A 2LXKA 3U50C 2FJ2A 3DHQA 3H0GH 1HNZQ 1U4RA 1S5CD 1F9PA 3D31A 2C5CA 2QILA 1VCIA 2F0NA 3CRLC 3VA5A 1FJGL 2ZT9C 1YHAA 3O13A 2JA6H 2D2CC 3EROA 2UXCQ 3UDIA 4XT1B 3VR2A 3I73A 4LUZA 3K80C 1KC8C 2NZ1D 3OWEB 4JI7Q 2A69D 3BYYB 1ET6A 1O80A 3UI2A 5T1GA 4B3SL 4KTAA 5CC4A 1WI5A 1K28A 3J80L 3RMHA 2L5TA 4KJOA 4DR1L 2B63B 2CKZB 3IKJA 1D2BA 3J80c 4KK7A 1T9HA 4Y7NH 3S2HH 1HFGA 1BNZA 2WAQB 4XT3B 4ME5A 2F3WA 5FO9B 2OTLA 1BDOA 4A3IG 5M5YB 3SE0A 1NNXA 3IAYA 4DPGA 3CPWA 3FRPB 3CMAA 2E2IH 1SNQA 3MXUA 2BDOA 4DV3L 1J5EL 2ZXRA 2EY2A 1RF2D 4GZYC 4OWTB 1NE3A 3K5NA 1EZ6A 4JI3Q 4UDUC 2HHHL 1Q3LA 1SYGA 2A6ED 4ME3A 4FF4A 3I4MG 4P75A 2KA7A 2R92B 1EQTA 5KGUA 2ASBA 5CGKA 1BCPB 3Q24A 5FLXc 5C44H 2R7ZH 1X3QA 1B3AA 4LF6Q 4WFN3 5IGGA 1ET9A 2SOBA 3IFDA 1E22A 2D0PA 2VW9A 1EY7A 5NUCA 4DUZQ 2F0IA 4KN4C 3HOYB 3RUZA 1SFOB 2R93H 4BWGB 4C56C 2RBMA 2UXDQ 3HGBA 5HGTA 1HCZA 5CV7A 1LTID 1PRTC 2B8FA 3CCUA 2PMZE 2QEXA 1K8AC 1TY0A 1M90C 5ELEA 1RCVD 1VQIA 3ER0A 2E5LQ 1B70B 2JA5G 4X65Q 3RZDH 3KF8B 4DAYA 1V8QA 3K58A 3RN5A 4A3BH 1HJPA 1V1QA 4J1MA 4HJAA 5GAHC 1CKMA 1KRSA 3E6ZX 3S1RH 2JA5H 5LL6X 3AYHB 4GNXC 1BCPF 4APVA 1G291 1IYVA 2RCNA 3KUPA 4IUTA 4JBWA 1FGBD 1PYSB 4FXDA 1PZKD 1YZ6A 1D5ZC 1XNRL 4DR5L 5IWAQ 1WTQA 1UNSA 3BZDB 3PUWA 1JOQA 3CCVA 1PH6A 1QG7A 4LF9Q 5LMUQ 2NVYH 2KCTA 1CKNA 4CJ0B 2ZJQA 4DNIA 5EPJA 2EY5A 2RDGA 5LMNL 1TWAB 4PMBA 3SR1A 4C3JG 3H94A 2YU9B 1GUOA 4DN4M 1X32A 1CZWA 2F0SA 2PQEA 3TN2A 4GN3B 2RDFA 3I55A 3AMUA 4AQYQ 4KLKA 2WKCA 3S1NB 1PTOF 3GTLB 2R6GA 1WCMH 2NZOA 4RAUC 1N33Q 4IFDH 3VYUA 1PA6A 3KF6A 3RD4A 1B50A 2A6EC 5GQOA 2AUKA 3J7ZC 1PH1A 2RSNA 4C1NK 4K5WA 1QOHA 1HH2P 2K1BA 2WV6D 4XQJA 2IT1A 1HTLD 3GTJH 2J7ZA 2ZM6Q 3BDCA 1Q81C 1QJOA 2NB0A 4B9XA 1NUCA 2F0PA 2KQ3A 1AW7A 3J7YW 4DV1Q 1EQVA 4LF4L 3Q23A 1WFQA 3M4QA 1IKLA 2QW7A 2CH4W 1WTRA 4DF7A 2B2UA 4ZCKA 5C3EG 2PMZB 2WP8J 3I4LA 3PUZA 4LAAA 2UXBQ 2JA5B 2Z8LA 5D14A 1QNUA 1E2VA 2MNAA 1F2LA 3M7NA 2F4VQ 2Q8IB 3ITPA 5CV5A 3PO2H 1TS4A 1GKHA 4NPSA 1N34L 5C3WA 1A8VA 2PCFB 5M3MH 2VXWA 3L7ZC 3TBIB 1S5FD 4DA2A 1ZYRD 2UXBL 1SJHD 3NBHA 2K5QA 2WB1E 5C0XG 2AWNA 4R4OA 1L1OB 1E1TA 3G6EA 1YI2A 1TS3A 2Q2TA 3GTMH 5KYLA 3PIP3 3SGIA 5E7NA 1O7LA 1L1OC 1JOKA 1D1IA 1EU3A 1YJWA 4BBSG 5AFWA 4AYBE 1KDBA 1TXYA 1PH5A 4RHRA 3HOXH 4QIWB 4IURA 1YJNA 4X3SA 2ZM6L 1EY9A 4FF2A 1Z6HA 1CHPD 3QOLA 4PMCA 1TWGB 4C3JB 2HIVA 4BA1I 4P72A 1HZBA 2Y0SB 1C8CA 2IL8A 1ONLA 1GVPA 1HXYD 4IQZA 2IW3A 4BS9A 5M3FG 3TREA 2F0MA 3F1ZA 3H6MA 4DK3C 1CI3M 1WCMB 4IO9A 1HRJA 3C1EA 4HSVA 1M4VA 2O5IC 1LUZA 3U58A 1AZQA 1VQ6A 3J80E 3G7LA 2YYZA 3VYTA 2XVSA 1K3RA 1Y8OB 2BOSA 1CA6A 4IALA 1IHZA 4QB4A 1O7YA 4DXGA 1GO3E 1F9QA 2KENA 4FXGC 3S16H 3DMUA 4B3TL 3I4NG 3K5MA 2WB1G 4WORA 4CJ2C 3MXGA 1I3QB 1SNCA 1K0RA 4G4KA 1VQOA 3CCMA 1TIID 3AQQA 3BZKA 2IY5B 1JWUD 4A3LG 3HOWB 2B63H 1IL2A 1JJGA 1S4ZA 2K01A 3BVGA 5C0XJ 2OCEA 2PI2E 5IGBA 2VB2X 2F0TA 1SE8A 3OHXC 1SYFA 3HOWH 3D4DA 3CCQA 1YEZA 4IN3A 1JOOA 4DK6C 5IWAL 2QDBA 1GJXA 1B9NA 4JI4L 4ZUIA 1EYCA 3DEOA 1SEBD 4A3MG 1R9TB 1HNXL 2GN5A 4EX5A 1IBKL 3H0GB 1F9SA 5KNDA 2JSOA 4QL5A 2JA8H 3NXWA 2LFNA 4DV7Q 4YWLA 1KNAA 1Y1VB 3TEHB 2KHIA 2WIIB 3U9SA 4CJ1B 3OMGA 1RTNA 1E1OA 3H91A 1TWFH 4DR3Q 1PMRA 4QJFA 2M00A 4QUCA 4ALPA 2Q2UA 5L37A 1JORA 1D5XC 1WTPA 1V1PB 4NXML 4IUVA 3RR5A 3GV6A 4DR7Q 4N8X1 3GTMB 3G4SA 2DJFC 4PZ8A 1PXUA 4DUZL 1R4QB 2Y0SG 2KVMA 1PRTB 1UE5A 2OT2A 4NW2A 1SNOA 4OWWB 5DNFA 5C4JB 1HNWL 1Q90A 1ZEQX 3TQYA 1BBWA 5M3MB 1A15A 3M7GA 1IZ6A 4A3GB 1HTPA 1U4PA 1V1OA 1X6OA 4JBJA 3S1QH 2DNCA 3PSIA 5EPLA 4L5TA 4K6DA 4KHVA 3MAQA 4FF3A 2WB1B 5IP9G 4BXXH 3W5OA 4A3DH 1ICFB 2BA0A 3GD7A 1CTMA 3BZCA 3KDFB 3STBD 2ENBA 4B3MQ 1V43A 1B8AA 3I4NH 3K7AB 2IWHA 4RKLA 2J0TD 4MIUA 1G2SA 4J15A 2V4DA 2SEBD 2IHFA 4HJ9A 2XWJB 2L15A 5C4XG 2VQEQ 3LNNA 5CV6A 2KOLA 3NK9A 4I65A 4C3HB 5LHY1 4IOAA 4N8FA 4RH6A 2CVRA 3T51B 2BH8A 4LW1A 2ZTCA 3CHBD 1CHQD 2B29A 3E0EA 4HIKA 4JI7L 1C7YA 1I6HH 4R8IA 2IHEA 3GV3A 2F0DA 2OEOA 3SK8A 3ULPA 1E24A 4IUPA 1LLRD 4PG3A 2DJGC 3NP8A 4JI2Q 1Y1VH 2B8GA 3FPUB 5CR3A 1WVLA 1PZJD 1WD1A 4JCVE 1EEFD 4ZKCB 1KD1C 1O78A 2L12A 2EY6A 1U4MA 3CC4A 2NVTH 2EYPA 1A3VA 2PZTA 3HOXG 2UXCL 2PNRC 5CV4A 4CKEA 4J6HA 3HOZB 2XN9C 1LTTD 3CCRA 4LWCA 4JI5Q 2Y0SE 1NSNS 2G9DA 4DV0Q 4B3SQ 2K28A 1YNXA 3P1HA 1YNNC 4HTHA 1WJJA 5ELOA 1VMCA 1EIYB 3J80i 3J81i 4NKLA 4BY7H 4BY1G 2MO1A 1J9OA 1HA5A 2OWOA 1SROA 1K8GA 2SNMA 3JAMc 2UUCL 2F0EA 4KD3A 3CXCA 3PO2G 1JR0D 3K5OA 1PTOC 3EQLC 5JJIA 2KCMA 3PMFA 1HNZL 2Q2HA 4A76A 4ZLTF 3FP9A 5J39A 3S1RB 2CQAA 2ZXPA 3HKSA 1SN8A 5J1ZA 4HJ8A 2OQ0A 1AN8A 2AQ1B 2PPBC 3DM3A 1SMYD 4A4IA 1IW7C 2IJ0A 4QMGA 3A5UA 1Z9FA 5DM63 1XPOA 1BF4A 2K5WA 5JJZA 4DV2L 1CT1D 1DGSA 1ENAA 1STHA 1A2UA 3PIO3 5G3LD 2F0KA 4H7BA 2JA7B 1BVSA 4HIDA 5KYIA 3D4RA 4YY3L 3J81L 1NBWA 1HNWQ 2A74C 4X65L 4JOIA 4OEMB 3M3YB 1S3OA 5C4XB 4U68A 2K32A 2NVXH 1MSGA 4R9WA 3SEBA 5C0XI 1EQRA 3SVMA 1L0WA 2GVBA 5IYBG 1TWCB 4DAYB 1STGA 4K8JA 2BCOA 2EYFA 5HY6A 4DNTB 3CC2A 4K14A 4LF6L 3NTHA 4YCVA 3AEVA 3W2DA 4BXXG 2F0FA 1LTRD 2DUDA 3CKIB 2I5HA 1EQQA 4A3KG 3RLNA 4IFDG 3BVZA 1WTXA 1SLJA 4O0AA 2A73B 4IPGA 1B2TA 4B08A 5T1IA 3W1GA 2EXZA 5FKAC 1X3GA 1DOMA 5H1SE 3KYHC 4JI5L 1C0AA 3OPOA 4PNYA 4C3IG 2FXQA 5BN3A 4KJNA 1BCPD 4ODGA 4DR2L 4WRDA 1RHPA 4Y7NB 1IBKQ 1F2MA 5LMUL 3SK6A 2K05A 2IX3A 1JB3A 1EZ8A 1FJGQ 1YBYA 2CFMA 1ENCA 2ZTEA 1AZPA 1E7ZA 3CP0A 1UEBA 3ERQA 2JP1A 4QCLA 1XTDA 4MTNA 1OXXK 2PNHA 3E9HA 1X56A 2YV5A 1QCBD 1LM0A 1H9SA 1ZYRC 5E4XA 4O1NA 2MPMA 3PF4A 3MA2B 3TSSA 3QWNA 1H9KA 1CK1A 4A3CH 1N8RC 3HRZC 3DM1A 4HIOA 3S1NH 1HR0L 1EU4A 2XNAC 1ESRA 5KIXA 4EQOA 4L5SA 4B3ML 3HOWG 1PFBA 2JQOA 2NUCA 5TSSA 4NB3A 1OXUA 4XTCS 2EXDA 4YWMA 3VYRA 5IGFA 5FLMH 3OW2A 5J22A 2G5DA 3OOCA 3HKZE 4X6AH 1EOVA 2K33A 5JJKA 3NHHA 2EYJA 2Z6KC 2F1MA 2VNUD 3ND9A 2F03A 1VQCA 3GTQB 1H9SB 3GTGB 2B2TC 4UP8A 5JVG3 2KECA 4OXPA 3TP8A 1PH9A 1QVFA 4A3KB 3I4OA 1XXGA 1JC7A 1STYA 4EQ5A 3M4YA 5C4JH 1E2ZA 2JEAI 4KHPL 5M3FH 2L1BA 1CZGA 4O2DA 1PH8A 2A6HC 4AH6A 2Z0SA 1JJCB 3ICEA 1E2WA 4JPBW 1QVCA 5CYUA 2FMCA 4DUYL 2NVXB 1HZCA 1KHIA 2RKSA 3M3YH 1H9JA 2Q2IA 2JN4A 2O4XA 1MD2D 2MP1A 2L55A 4HN7A 3OTOL 2XRQD 5IOCA 1VQNA 1B3QA 1N9WA 2C35B 1N34Q 3ND8A 3A0JA 2NVTB 4KY7A 4DV4L 1VF5C 5IP9H 4CBVA 5J3BA 2I5MX 4RG1A 5GAEC 3T1HL 1N36Q 1UE7A 1Q12A 2MO0A 1S5BD 5C3XA 5JEAG 1OXSC 1HHVA 1VQGA 4XQQA 1JJ2A 4RWSC 3D6CA 4QF4A 5IP7H 1TWHB 3F2BA 4JI1L 1CSPA 3K81C 3S2DH 4DV1L 1EY5A 4TVAB 5CBEE 1MKHA 1Q8KA 3FKIH 2EJGC 3IFTA 3S9WA 2TMPA 3A8JE 1BUVT 4K6LA 2JJQA 1K83H 3MFYA 2VUMH 4JK1C 1XNRQ 5EBCA 4O42A 1VQPA 5KRUA 3K59A 5IYDH 3QB3A 1EY4A 4C3IH 5ELBA 1SE3A 3G71A 4CDEC 4A93G 3I91A 3S15H 4JI8L 1HUMA 5IGCA 4B3TQ 1A2TA 1MIUA 3EIVA 1MI2A 4LFCQ 1EEID 1XMQQ 5EPKA 3KOJA 2RHSB 4DR4L 4X3TA 4KN7C 5M5XB 3DLLA 2TSSA 3HOYH 2JA6B 4C3JH 2EPBA 5GADC 5GAGC 1XJVA 2ID0A 4C2MB 3R3OA 3I2ZA 4UHVA 2Q8TA 2ZJPA 1IYUA 4FF1A 4DV4Q 2A69C 4LFBQ 3M85A 1DCZA 5IYBH 1IKMA 3CCJA 3K5LA 1EOTA 3EBEA 1B1ZA 5DEHA 1NY4A 2Z6KA 2RCFA 2E2JH 3M4OB 1ZXTA 5K36H 1JB7A 2E5LL 2PW5A 2F0GA 2VB3X 3OYYA 3MEFA 1WTWA 1TS5A 4DUYQ 1E3PA 5HURA 1TKWB 3U9OA 1CFMA 4P73A 4TSSA 4L8JA 4YY3Q 3Q8DA 2HHHQ 1LTLA 2VUMB 1SYBA 4LFAQ 2Q8RE 1D1KA 3F2UA 5IT9E 2Z9HA 4IFDJ 4KKTA 4LFCL 5FLMG 4DV2Q 4EQNA 3AFPA 2PI2A 1EYGA 4KY6A 3UE1A 4DR7L 1HZAA 5EBDA 3PIOA 1Q82C 2PW7A 1M8AA 2RSOA 2ATWA 4B9WA 3AB9A 2HDMA 1CA5A 1I3QH 3J7A5 5EKKA 1I5FA 4K0KQ 3NQIA 2B63G 3KJPA 4BBSH 1TWFB 3GTJB 4NXNL 3JAME 3L3OC 1QILA 1FYCA 5BN4A 2WAQG 1EY8A 2AWOA 4RCNA 2PO4A 2EY1A 3R93A 4ILWA 4A3IB 1GM5A 1B9MA 4DXFA 1AE2A 2BE5C 3VR3A 1NMGA 5FK9C 4S3SA 1IBML 4DV0L 1SE4A 2OQKA 1ILQA 1B7YB 4X62L 2JA6G 1L2FA 5FJ8G 3I56A 1PFSA 1IXRA 3QOJA 3D0FA 4DFAA 1I4QA 3D6WA 3I4MB 3OSOA 3MVVA 1UE1A 2B2YA 3TZUA 2KCNA 4KV6A 1EYDA 2B2WC 5A2QE 4JI1Q 2XGTA 3HKZB 1FD7D 4Y52H 3DWPA 3GTKH 4A3KH 3J7AF 4CGYB 2O2LD 3FKIG 3G48A 3OTOQ 4A3FB 4V0BA 1S40A 3HOVB 4G57A 3T4AC 5A35A 1QZHA 4A3DB 1LO5D 3HOYG 3BU2A 3R2TA 1PTOD 3GTGH 1XTCD 4NXNQ 3BG3A 4TQUS 1HFNA 5KNBA 3CQZB 4MZ9A 1JE4A 1MSHA 3MHBA 3NWSA 1WTHA 1PYWD 1KQSA 5K5PA 2NYZD 5JEAH 4JVZA 1C48A 4R4IA 4CDDC 4JOIC 1YNND 5DLQE 2E2JB 3TMEA 1TWGH 1IYJB 4H0LC 4GLAC 1PRTD 4OIJA 1Y14B 5F2DA 1BOSA 4XDXA 1B44D 4OGQC 4LFAL 3S17B 1Y1WH 1SYCA 2EVBA 4JW0A 2XTIA 1EL0A 1II3A 2XSCA 1RIPA 3GDEA 5FO8B 1UAPA 2PYKA 5M5XH 1KIXA 1VQFA 2FINB 4IJLA 3H15A 2UUCQ 3EFXD 1QE6A 2H5XA 4DV3Q 2EJMA 1G2TA 5M9OA 1L0XB 3EJIA 2QF7A 3PF5A 1KABA 3B6YA 1YITA 3S15B 3H09A 2F0HA 1B53A 3E3XA 3HOUG 1X3PA 3DWQA 2E2IB 2KEDA 1AEXA 2VL6A 3P20A 4G7ZC 4ZKBB 1KDCA 1Q7YC 1FNWA 1XX8A 1I4HA 4UPAA 1CSQA 4F87A 4HR7B 1FL0A 1XNQL 3PUXA 1N32L 1GHJA 1EIFA 4UY8C 1A6XA 3E9IA 3I8ZA 1DONA 3ZYYX 4GNXA 3P75A 4Q5VA 1QVGA 5C6AA 1EIGA 1TT2A 1XMQL 1G6PA 4TKOB 1EIHA 4OHJA 2GVAA 4UAIA 4E6IA 3W1BA 3VDYA 3OIPA 4JI4Q 2K5HA 3GTOB 1VQ5A 4R4TA 4QQBX 1YIJA 4A3DG 4IFDI 1TWHH 3NE5B 4A3CG 3T1YL 1VQLA 1A62A 2AQ3B 5ISRA 1EFWA 2H1EA 2K03A 2K5DA 3AFQA 3M9BA 2MFIA 1TWCH 5C5MA 1UUPA 2JEBI 1VQBA 2VZAA 4L5QA 5KEEA 3GTKB 2N78A 5C3EB 1DZ1A 3PO3H 1STAA 4L6TB 5C4XH 3FPPA 2K4KA 1SNPA 3QO2A 1I94Q 4A3BG 2WAQE 3F2CA 3NPPA 3KLRA 2LMCB 3FEWX 5JAVA 5AJ3Q 1YVCA 3SK5A 3J81E 4A3EG 1I4PA 3CU7A 4L5RC 1GHKA 1ICWA 4JG2A 4DKAC 1FR3A 3E5SA 1RTOA 4X66Q 2HIXA 1QUQB 1E0BA 2YTXA 2KHSA 1VQDA 2NN6H 5DAUA 3E0JA 1CQFA 3RZOB 3ERSX 2VQEL 4HCSA 1Q86C 1T5XD 4H13C 4JBMA 2SDFA 3QR8A 2EZVA 1JMCA 4IUQA 1NAPA 1OXVA 1L0YB 4Q0FA 1JT8A 1EUJA 3CD6A 3X3MA 3T16A 3GO5A 3BYTB 4NXMQ 3HOUB 1STEA 1DD2A 3FMCA 5GROA 2RQXA 1LTBD 1EWIA 5E3FA 3I90A 1YNJD 3VR4A 4BY7B 4HEDA 2E74C 4JYAQ 3I70A 4A93H 3V05A 5HGQA 2ICEC 2BH2A 4YHHQ 2A1AA 1KL9A 1Q46A 1CKNB 5M5YH 1LV9A 3HOUH 2B2VA 1O7IA 4KMUC 2N55A 1I50H 1G6ZA 3L9AX 3HOZH 2KUMA 3PIPA 4OO1G 3NTKA 1MHWC 1J5EQ 2N8NA 1CM9A 4G7OC 4V190 3D3RA 3KLSA 4OIKA 3LWUA 4EGVA 4JI6Q 5JOBA 2DY8A 4POFA 1LACA 2KEEA 3C1FA 2AKWB 1GUSA 1PFMA 4PQXA 1Q8IA 2R92H 2JA7G 1I6HB 1PH2A 1VQMA 2N3SA 4DR1Q 1FVIA 3HS0C 2NTTA 4C3HH 2KJXA 3T1YQ 4K5XA 3OWFA 4WJWA 4DV7L 3GTLH 5EAYA 1C4QA 2WFWA 4OONA 4LUOA 1HPCA 5E4WC 3CMEA 1SSOA 3H0GG 4JI2L 3KK7A 1RJTA 4GKJL 1LYLA 2KBNA 1F2ZA 2A6HD 3NEMA 4MN3A 1X55A 1F77A 2QDLA 1CUKA 4QY7A 4BY1H 3MTSA 4RGOS 2A68C 3QJYA 3WOFA 1NCVA 5I9PA 1UE6A 1DOKA 4B3RQ 2RF4A 4ABNA 3MWYW 3HP3A 4RKBA 3NTIA 4RHSA 1STBA 4HMJA 2EJFC 4R4CA 1EYAA 3DWAA 3LX0A
chains in the Genus database with same CATH topology
1CSPA 3K81C 1M1KC 1L1OA 3S2DH 1VQAA 4DV1L 1Q1BA 1X3EA 4TVAB 4X64Q 3UDGA 3MXNB 2N49A 1SMXA 4R4QA 1MKHA 2HIVA 1Q8KA 4H02A 4BA1I 3FKIH 4P72A 1HZBA 4GN5A 5IYDG 4LF8L 4LF9L 1SRUA 1SR3A 1GVPA 2JJQA 4JI6L 5M3FG 3TREA 3RLOA 5FJ8H 1K83H 3F1ZA 3JAMi 3CCSA 4DK3C 4IO9A 2VUMH 1XNRQ 5IP7G 1BKBA 3F8TA 4JBKA 4MNOA 1LUZA 3U58A 1VQ6A 1VQPA 2HT1A 2YYZA 4JI3L 1ASYA 1K3RA 5IYDH 1X3FA 4A3GG 4R1JA 1GO3E 1P16A 2KENA 1QUQA 3HKZG 4C3IH 4HJ7A 4JI0Q 2JA7H 3S16H 2VS1A 3G71A 2D0OA 4B3TL 3I4NG 4A93G 2WB1G 3S15H 4JI8L 1K0RA 3UDXA 1VQOA 1XMOL 3CCMA 4B3TQ 3KJOA 3AQQA 2AMCB 1MIUA 1GD7A 3BZKA 3EIVA 4LUVA 4LFCQ 2IY5B 3K8AA 1XMQQ 3WWVA 4GLXA 4A3LG 2B63H 3CPFA 1IL2A 3KOJA 3TS2A 1JJGA 2RHSB 5C0XJ 3I7FA 3H3VH 2OCEA 4DR4L 4WJ4A 1PH4A 1FGUA 2PI2E 4BBRH 3DLLA 4GKKQ 3HOYH 2UXDL 4BY7G 3S17H 1UWVA 4C3JH 1SE8A 2K50A 2PQAB 4DR4Q 4X66L 3NENA 5GADC 3HOWH 5GAGC 3CCQA 1XJVA 2ID0A 3TRZA 1VQJA 1YEZA 4KHPQ 2YTYA 3I2ZA 4DK6C 5IWAL 1RL2A 4GN4B 4JI4L 2ZJPA 2K52A 4IPDA 2K75A 4DV4Q 2LSSA 4A3MG 5AJ3L 4DR2Q 4LFBQ 3M85A 2CCZA 5IYBH 1HNXL 2GN5A 4EX5A 3CCJA 4DR6L 4QIWE 1IBKL 2HQLA 3EBEA 1NY4A 2Z6KA 1QZGA 2E2JH 4QL5A 2UUAL 2JA8H 4DV7Q 1N33L 4YWLA 3ULLA 4KHZA 3TEHB 2KHIA 1YHBA 4A3FG 1JB7A 3HOVG 2MQHA 1PV4A 2E5LL 3OYYA 3MEFA 4BA2I 4DUYQ 1E3PA 1E1OA 1NMFA 3HOZG 1TWFH 1W3SA 4PZ6A 3S1MH 2K5VA 4P73A 4DR3Q 5IYCH 4QJFA 5LMNW 2OTJA 4ALPA 4YY3Q 3Q8DA 3F2DA 2B3GA 2I5LX 2HHHQ 1VQEA 2Q2UA 3FHWA 2CQOA 1LTLA 3RLFA 4LFAQ 5LMNQ 1PYBA 4NXML 2PQAA 3CF5A 3RR5A 4DR7Q 4IJHA 3KLWA 3ZJYC 4IFDJ 4LFCL 5M5WH 5FLMG 3A5ZB 3PV0A 4FDBA 3AFPA 2PI2A 4DV2Q 3G4SA 1EYGA 2YTVA 4PZ8A 4DUZL 4LF7Q 5K36G 1AH9A 3UE1A 4X64L 3PUVA 2Y0SG 1HZAA 4DR7L 4JV5Q 5JJLA 3PIOA 4GOPB 1Q82C 1UE5A 1AE3A 2QA4A 4HIMA 1NTGA 1N36L 4OWWB 2ATWA 2QGQA 4A3IH 3GTPH 3NELA 1I3QH 3J7A5 1HNWL 2DGYA 1HR0W 1I5FA 2RHQB 4K0KQ 2B63G 3TQYA 3KJPA 2EQSA 3STBC 4IOCA 4BBSH 4NXNL 2CWPA 2NN6I 1BBWA 1MJCA 4P74A 1IZ6A 2F52A 4AQYL 3BJUA 1X6OA 3KFUA 4JBJA 1TWAH 4YHHL 3S1QH 2WAQG 3PSIA 4JV5L 4L5TA 2AWOA 4IPHA 4GNXB 3K0XA 4GS3A 3L2PA 5IP9G 1GM5A 2R7ZG 4BXXH 3W5OA 2UU9Q 1VQ8A 1C9OA 4A3DH 1AE2A 4A3GH 2BA0A 4RMFA 3GD7A 3EN2A 3BZCA 1XPUA 1NMGA 3KDFB 3STBD 2E8GA 4B3MQ 1IBML 3CQZH 1V43A 1B8AA 1X54A 3I4NH 4DV0L 2OQKA 4PMWA 3S24A 1B7YB 1D7QA 2BA1A 4X62L 5ELNA 2JA6G 1VQHA 4J15A 1L2FA 5FJ8G 5C44G 1PFSA 2R7DA 2IHFA 3I56A 4HJ9A 4A3FH 1V9PA 2L15A 3HOVH 1IXRA 1PH7A 3D0FA 2VQEQ 4DR5Q 4HJ5A 5C4XG 4DV6L 2ALYB 4IOAA 2R7FA 4DV5L 1PHJA 3M4PA 2IX0A 2VQFL 1UE1A 1X65A 2BH8A 4LW1A 2ZTCA 3E0EA 3K7AH 2B29A 4YWKA 4HIKA 4A3EH 1VQ7A 2E2HH 4JI7L 2EIFA 1C7YA 1I6HH 2LXJA 2IHEA 1XMOQ 3ULPA 2R93G 1D8LA 1E24A 4UP7A 2UUBQ 1I94L 4PG3A 4JI1Q 4JI2Q 2XGTA 3RZOH 1Y1VH 1PH3A 4Y52H 4YCWA 2UUBL 3PO3G 4DR5L 1P8LA 4JCVE 2JA8G 3GTKH 4A3KH 1KD1C 2ES2A 3J81j 3FKIG 3G48A 2VQFQ 2NVTH 3OTOQ 3CC4A 3KDFA 4POGA 1S40A 1QZHA 3HOXG 2UXCL 4YCUA 4DAMA 3HOYG 3BU2A 3M4OH 3GTGH 4B3RL 4NXNQ 3NBHB 1XPRA 5IE8A 4TQUS 2CWAA 3CCRA 1H95A 2KHJA 4MZ9A 1VQKA 4LWCA 4JI5Q 2LXKA 4A3LH 3U50C 3H0GH 2Y0SE 2NZHA 4DV0Q 1HNZQ 4B3SQ 3D31A 1YNXA 1KQSA 1VCIA 1WJJA 5ELOA 4R4IA 1FJGL 1EIYB 4JOIC 1YHAA 3J80i 4LFBL 3JC66 2JA6H 3J81i 5DLQE 4GLVB 2UXCQ 4BY7H 2ZTDA 2MO1A 1TWGH 1IYJB 4BY1G 1JE5A 4GLAC 3UDIA 2YU9H 2OWOA 5IT9c 4AYBG 1SROA 4LF4Q 2F4VL 1K8GA 4A3JH 1Y14B 4C2MH 4JI8Q 4LUZA 3K80C 1KC8C 4JI7Q 3JAMc 2UUCL 1U0LA 3CXCA 4LFAL 3PO2G 1MJEA 1Z47A 5JJIA 2KCMA 5JEAJ 1Y1WH 1HNZL 4B3SL 2Q2HA 4A76A 3FP9A 1WI5A 2XTIA 4DR1L 4DR3L 4DV5Q 3HKSA 1SN8A 2CKZB 1PVOA 4PZ7A 3H3VI 4HJ8A 1RIPA 1IBLL 3U4ZA 2OQ0A 3GDEA 5M3MG 3J80c 3DM3A 1T9HA 3L0OA 4Y7NH 4A4IA 5M5XH 2ZJRA 3S2HH 2F3IA 1IBMQ 3KF6B 4OO1I 1KIXA 1VQFA 3A5UA 1KAWA 4AIMA 1Z9FA 4IJLA 3H15A 1XPOA 2OTLA 2UUCQ 2H5XA 1Q1EA 4DV3Q 4DV2L 4A3IG 4GOPC 4DPGA 3CPWA 4X62Q 1DGSA 3CMAA 2E2IH 2JA9A 3RNUA 1WOCA 2VUMG 3PF5A 4DV3L 3B6YA 4A75A 1YITA 1J5EL 1U5KA 5IYCG 1HNXQ 5C3EH 3TS0A 4LF5Q 3HOUG 3HFZB 4OWTB 1NE3A 1BVSA 4HIDA 4YY3L 1NBWA 2VL6A 4JI3Q 1HNWQ 2HHHL 1KRTA 4X65L 4JOIA 1W2BA 1Q7YC 1S3OA 4UPAA 1CSQA 2NVXH 1KXLA 3PUYA 1FL0A 4ME3A 1XNQL 3I4MG 5C0XI 3PUXA 4P75A 1Y1WG 1N32L 1EQRA 1G51A 1L0WA 2GVBA 1EIFA 4UY8C 5IYBG 3GTOH 3E9IA 4DAYB 5HY6A 4GNXA 3CC2A 2ASBA 1QVGA 4LF5L 4LF6L 1SFOH 1XMQL 3AEVA 4YCVA 5FLXc 5C44H 1G6PA 2R7ZH 4BXXG 4LF6Q 2DUDA 1E22A 2AHOB 2D0PA 2GVAA 2I5HA 5IY0A 2VW9A 3W1BA 3VDYA 3RLNA 4A3KG 2K5HA 3LGJA 1EQQA 1VQ5A 4JI4Q 4IFDG 4DUZQ 4R4TA 4QQBX 1N32Q 1SLJA 1YIJA 4O0AA 4A3DG 4IFDI 4IPGA 1TWHH 4A3CG 3W1GA 3T1YL 1VQLA 1VQ9A 2R93H 1A62A 1EFWA 2UXDQ 2D62A 3AFQA 3M9BA 2MFIA 1TWCH 4WJ3M 2UUAQ 1X3GA 2JEBI 2VZAA 1VQBA 1K73C 5BR8L 4L5QA 5H1SE 3CCUA 2PMZE 2N78A 3KYHC 4JI5L 2QEXA 1K8AC 1M90C 1C0AA 1VQIA 3ER0A 2JA5G 2E5LQ 1B70B 3PO3H 4X65Q 5C4XH 4QGUA 3RZDH 3KF8B 2K14A 2FXQA 2K4KA 3RN5A 4A3BH 1I94Q 1S72A 4A3BG 1HJPA 2WAQE 4OX9L 1V1QA 3F2CA 4HJAA 5GAHC 5AJ3Q 1CKMA 1KRSA 4DR2L 3S1RH 2JA5H 1YVCA 3AYHB 4OX9Q 1IBKQ 5LMUL 2NVQH 4DR6Q 4GNXC 4A3EG 4LNQA 4JI0L 1YJ9A 1FJGQ 4APVA 1G291 1WCMG 1YBYA 2CFMA 4L5RC 3CCLA 2ZTEA 2RCNA 4JG2A 1E7ZA 4DKAC 4A3MH 1A63A 3CC7A 3CP0A 2HIXA 4X66Q 1UEBA 1WYDA 4JBWA 1QUQB 1XTDA 3PGZA 1PYSB 4MTNA 1OXXK 2YTXA 1VQDA 2PNHA 3E9HA 1YZ6A 1K9MC 1XNRL 3ERSX 4UP9A 1X56A 3PCOB 2YV5A 2JE6I 1LM0A 5IWAQ 3PUWA 2VQEL 1Q86C 3CCVA 2I0QA 3GTQH 4JYAL 3PF4A 3A74A 1PH6A 1VS0A 4GKKL 4LF8Q 4LF9Q 4JBMA 5LMUQ 1JMCA 2NVYH 2KCTA 4A3CH 1N8RC 3S1NH 1CKNA 4BBRG 4HIOA 2UU9L 1OXVA 4P71A 2ZJQA 4DNIA 1JT8A 1EUJA 2K5NA 1HR0L 3CD6A 2VY3A 5LMNL 3GO5A 1OTCA 4L5SA 1CKOA 4A3JG 1NJIC 4B3ML 4NXMQ 3HOWG 2V1CC 1HR0Q 5GROA 2JQOA 1EWIA 2NN6G 4NB3A 1OXUA 1BBUA 2EXDA 4XTCS 4YWMA 5FLMH 3OW2A 4A93H 4JYAQ 4GN3B 3I55A 5HGQA 4AQYQ 2BH2A 4KLKA 1J6QA 4YHHQ 3HKZE 3U4VA 2A1AA 4X6AH 5BR8Q 2R6GA 1KL9A 1Q46A 1WCMH 2NZOA 1CKNB 1OXTA 4XIGS 5M5YH 1EOVA 5JJKA 1N33Q 1PA6A 2Z6KC 3HOUH 3CW2C 3KF6A 1O7IA 2VNUD 1I50H 5GQOA 3K7UC 1VQCA 3HOZH 3UDFA 1HZ9A 1X9NA 3PIPA 3J7ZC 1PH1A 4UP8A 4OO1G 2A8VA 1HH2P 4OXPA 1J5EQ 2IT1A 1PH9A 4LF7L 3GTJH 2N8NA 1QVFA 2ZM6Q 1Q81C 3I4OA 3IRBA 3RN2A 1Y1VG 4LF4L 4EQ5A 4DV1Q 4JI6Q 5C4JH 3ULJA 4KI0A 4POFA 3I4MH 2JEAI 3S14H 4KHPL 2AKWB 5M3FH 1WFQA 3M4QA 4O2DA 1PH8A 4AH6A 1XNQQ 2Z0SA 2R92H 2IX1A 2JA7G 1PH2A 4JC0A 1JJCB 1VQMA 3ICEA 2JK8A 2A19A 1QVCA 2N3SA 4GKJQ 4DR1Q 1A0IA 1FVIA 4DUYL 1HZCA 3PUZA 2WP8J 5C3EG 4C3HH 3J81c 2UXBQ 1KHIA 3M3YH 3CAMA 2Q2IA 3T1YQ 2MNAA 3T1HQ 1VQ4A 3GTLH 4DV7L 1R9TH 3M7NA 2F4VQ 5EAYA 2R92G 3OTOL 3PO2H 1GKHA 4NPSA 1N9WA 2WFWA 4OONA 1N34L 1VQNA 4LUOA 2C35B 1A8VA 3CMEA 5M3MH 1N34Q 3A0JA 3H0GG 4JI2L 3L7ZC 4DV4L 5IP9H 4GKJL 1LYLA 2KBNA 2UXBL 5C0XG 5J3BA 2WB1E 2I5MX 2AWNA 4IPCA 1L1OB 1E1TA 4R4OA 3G6EA 4GOPA 1YI2A 4RG1A 3NEMA 2Q2TA 1X55A 3GTMH 1CUKA 4QY7A 5GAEC 4BY1H 3SGIA 5E7NA 3T1HL 1N36Q 1L1OC 1UE7A 1IBLQ 1Q12A 1UE6A 2MO0A 5JEAG 1YJWA 4BBSG 1OXSC 4B3RQ 2RF4A 1YHQA 1ASZA 4K0KL 1VQGA 4AYBE 1JJ2A 3UE0A 1TXYA 4OWXB 3CCEA 1PH5A 5IP7H 3F2BA 3HOXH 4R4CA 1YJNA 2ZM6L 4JI1L 4DV6Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSP A;  3K81 C;  1M1K C;  1L1O A;  3S2D H;  1VQA A;  4DV1 L;  1Q1B A;  1X3E A;  4TVA B;  4X64 Q;  3UDG A;  3MXN B;  2N49 A;  1SMX A;  4R4Q A;  1MKH A;  2HIV A;  1Q8K A;  4H02 A;  4BA1 I;  3FKI H;  4P72 A;  1HZB A;  4GN5 A;  5IYD G;  4LF8 L;  4LF9 L;  1SRU A;  1SR3 A;  1GVP A;  2JJQ A;  4JI6 L;  5M3F G;  3TRE A;  3RLO A;  5FJ8 H;  1K83 H;  3F1Z A;  3JAM i;  3CCS A;  4DK3 C;  4IO9 A;  2VUM H;  1XNR Q;  5IP7 G;  1BKB A;  3F8T A;  4JBK A;  4MNO A;  1LUZ A;  3U58 A;  1VQ6 A;  1VQP A;  2HT1 A;  2YYZ A;  4JI3 L;  1ASY A;  1K3R A;  5IYD H;  1X3F A;  4A3G G;  4R1J A;  1GO3 E;  1P16 A;  2KEN A;  1QUQ A;  3HKZ G;  4C3I H;  4HJ7 A;  4JI0 Q;  2JA7 H;  3S16 H;  2VS1 A;  3G71 A;  2D0O A;  4B3T L;  3I4N G;  4A93 G;  2WB1 G;  3S15 H;  4JI8 L;  1K0R A;  3UDX A;  1VQO A;  1XMO L;  3CCM A;  4B3T Q;  3KJO A;  3AQQ A;  2AMC B;  1MIU A;  1GD7 A;  3BZK A;  3EIV A;  4LUV A;  4LFC Q;  2IY5 B;  3K8A A;  1XMQ Q;  3WWV A;  4GLX A;  4A3L G;  2B63 H;  3CPF A;  1IL2 A;  3KOJ A;  3TS2 A;  1JJG A;  2RHS B;  5C0X J;  3I7F A;  3H3V H;  2OCE A;  4DR4 L;  4WJ4 A;  1PH4 A;  1FGU A;  2PI2 E;  4BBR H;  3DLL A;  4GKK Q;  3HOY H;  2UXD L;  4BY7 G;  3S17 H;  1UWV A;  4C3J H;  1SE8 A;  2K50 A;  2PQA B;  4DR4 Q;  4X66 L;  3NEN A;  5GAD C;  3HOW H;  5GAG C;  3CCQ A;  1XJV A;  2ID0 A;  3TRZ A;  1VQJ A;  1YEZ A;  4KHP Q;  2YTY A;  3I2Z A;  4DK6 C;  5IWA L;  1RL2 A;  4GN4 B;  4JI4 L;  2ZJP A;  2K52 A;  4IPD A;  2K75 A;  4DV4 Q;  2LSS A;  4A3M G;  5AJ3 L;  4DR2 Q;  4LFB Q;  3M85 A;  2CCZ A;  5IYB H;  1HNX L;  2GN5 A;  4EX5 A;  3CCJ A;  4DR6 L;  4QIW E;  1IBK L;  2HQL A;  3EBE A;  1NY4 A;  2Z6K A;  1QZG A;  2E2J H;  4QL5 A;  2UUA L;  2JA8 H;  4DV7 Q;  1N33 L;  4YWL A;  3ULL A;  4KHZ A;  3TEH B;  2KHI A;  1YHB A;  4A3F G;  1JB7 A;  3HOV G;  2MQH A;  1PV4 A;  2E5L L;  3OYY A;  3MEF A;  4BA2 I;  4DUY Q;  1E3P A;  1E1O A;  1NMF A;  3HOZ G;  1TWF H;  1W3S A;  4PZ6 A;  3S1M H;  2K5V A;  4P73 A;  4DR3 Q;  5IYC H;  4QJF A;  5LMN W;  2OTJ A;  4ALP A;  4YY3 Q;  3Q8D A;  3F2D A;  2B3G A;  2I5L X;  2HHH Q;  1VQE A;  2Q2U A;  3FHW A;  2CQO A;  1LTL A;  3RLF A;  4LFA Q;  5LMN Q;  1PYB A;  4NXM L;  2PQA A;  3CF5 A;  3RR5 A;  4DR7 Q;  4IJH A;  3KLW A;  3ZJY C;  4IFD J;  4LFC L;  5M5W H;  5FLM G;  3A5Z B;  3PV0 A;  4FDB A;  3AFP A;  2PI2 A;  4DV2 Q;  3G4S A;  1EYG A;  2YTV A;  4PZ8 A;  4DUZ L;  4LF7 Q;  5K36 G;  1AH9 A;  3UE1 A;  4X64 L;  3PUV A;  2Y0S G;  1HZA A;  4DR7 L;  4JV5 Q;  5JJL A;  3PIO A;  4GOP B;  1Q82 C;  1UE5 A;  1AE3 A;  2QA4 A;  4HIM A;  1NTG A;  1N36 L;  4OWW B;  2ATW A;  2QGQ A;  4A3I H;  3GTP H;  3NEL A;  1I3Q H;  3J7A 5;  1HNW L;  2DGY A;  1HR0 W;  1I5F A;  2RHQ B;  4K0K Q;  2B63 G;  3TQY A;  3KJP A;  2EQS A;  3STB C;  4IOC A;  4BBS H;  4NXN L;  2CWP A;  2NN6 I;  1BBW A;  1MJC A;  4P74 A;  1IZ6 A;  2F52 A;  4AQY L;  3BJU A;  1X6O A;  3KFU A;  4JBJ A;  1TWA H;  4YHH L;  3S1Q H;  2WAQ G;  3PSI A;  4JV5 L;  4L5T A;  2AWO A;  4IPH A;  4GNX B;  3K0X A;  4GS3 A;  3L2P A;  5IP9 G;  1GM5 A;  2R7Z G;  4BXX H;  3W5O A;  2UU9 Q;  1VQ8 A;  1C9O A;  4A3D H;  1AE2 A;  4A3G H;  2BA0 A;  4RMF A;  3GD7 A;  3EN2 A;  3BZC A;  1XPU A;  1NMG A;  3KDF B;  3STB D;  2E8G A;  4B3M Q;  1IBM L;  3CQZ H;  1V43 A;  1B8A A;  1X54 A;  3I4N H;  4DV0 L;  2OQK A;  4PMW A;  3S24 A;  1B7Y B;  1D7Q A;  2BA1 A;  4X62 L;  5ELN A;  2JA6 G;  1VQH A;  4J15 A;  1L2F A;  5FJ8 G;  5C44 G;  1PFS A;  2R7D A;  2IHF A;  3I56 A;  4HJ9 A;  4A3F H;  1V9P A;  2L15 A;  3HOV H;  1IXR A;  1PH7 A;  3D0F A;  2VQE Q;  4DR5 Q;  4HJ5 A;  5C4X G;  4DV6 L;  2ALY B;  4IOA A;  2R7F A;  4DV5 L;  1PHJ A;  3M4P A;  2IX0 A;  2VQF L;  1UE1 A;  1X65 A;  2BH8 A;  4LW1 A;  2ZTC A;  3E0E A;  3K7A H;  2B29 A;  4YWK A;  4HIK A;  4A3E H;  1VQ7 A;  2E2H H;  4JI7 L;  2EIF A;  1C7Y A;  1I6H H;  2LXJ A;  2IHE A;  1XMO Q;  3ULP A;  2R93 G;  1D8L A;  1E24 A;  4UP7 A;  2UUB Q;  1I94 L;  4PG3 A;  4JI1 Q;  4JI2 Q;  2XGT A;  3RZO H;  1Y1V H;  1PH3 A;  4Y52 H;  4YCW A;  2UUB L;  3PO3 G;  4DR5 L;  1P8L A;  4JCV E;  2JA8 G;  3GTK H;  4A3K H;  1KD1 C;  2ES2 A;  3J81 j;  3FKI G;  3G48 A;  2VQF Q;  2NVT H;  3OTO Q;  3CC4 A;  3KDF A;  4POG A;  1S40 A;  1QZH A;  3HOX G;  2UXC L;  4YCU A;  4DAM A;  3HOY G;  3BU2 A;  3M4O H;  3GTG H;  4B3R L;  4NXN Q;  3NBH B;  1XPR A;  5IE8 A;  4TQU S;  2CWA A;  3CCR A;  1H95 A;  2KHJ A;  4MZ9 A;  1VQK A;  4LWC A;  4JI5 Q;  2LXK A;  4A3L H;  3U50 C;  3H0G H;  2Y0S E;  2NZH A;  4DV0 Q;  1HNZ Q;  4B3S Q;  3D31 A;  1YNX A;  1KQS A;  1VCI A;  1WJJ A;  5ELO A;  4R4I A;  1FJG L;  1EIY B;  4JOI C;  1YHA A;  3J80 i;  4LFB L;  3JC6 6;  2JA6 H;  3J81 i;  5DLQ E;  4GLV B;  2UXC Q;  4BY7 H;  2ZTD A;  2MO1 A;  1TWG H;  1IYJ B;  4BY1 G;  1JE5 A;  4GLA C;  3UDI A;  2YU9 H;  2OWO A;  5IT9 c;  4AYB G;  1SRO A;  4LF4 Q;  2F4V L;  1K8G A;  4A3J H;  1Y14 B;  4C2M H;  4JI8 Q;  4LUZ A;  3K80 C;  1KC8 C;  4JI7 Q;  3JAM c;  2UUC L;  1U0L A;  3CXC A;  4LFA L;  3PO2 G;  1MJE A;  1Z47 A;  5JJI A;  2KCM A;  5JEA J;  1Y1W H;  1HNZ L;  4B3S L;  2Q2H A;  4A76 A;  3FP9 A;  1WI5 A;  2XTI A;  4DR1 L;  4DR3 L;  4DV5 Q;  3HKS A;  1SN8 A;  2CKZ B;  1PVO A;  4PZ7 A;  3H3V I;  4HJ8 A;  1RIP A;  1IBL L;  3U4Z A;  2OQ0 A;  3GDE A;  5M3M G;  3J80 c;  3DM3 A;  1T9H A;  3L0O A;  4Y7N H;  4A4I A;  5M5X H;  2ZJR A;  3S2H H;  2F3I A;  1IBM Q;  3KF6 B;  4OO1 I;  1KIX A;  1VQF A;  3A5U A;  1KAW A;  4AIM A;  1Z9F A;  4IJL A;  3H15 A;  1XPO A;  2OTL A;  2UUC Q;  2H5X A;  1Q1E A;  4DV3 Q;  4DV2 L;  4A3I G;  4GOP C;  4DPG A;  3CPW A;  4X62 Q;  1DGS A;  3CMA A;  2E2I H;  2JA9 A;  3RNU A;  1WOC A;  2VUM G;  3PF5 A;  4DV3 L;  3B6Y A;  4A75 A;  1YIT A;  1J5E L;  1U5K A;  5IYC G;  1HNX Q;  5C3E H;  3TS0 A;  4LF5 Q;  3HOU G;  3HFZ B;  4OWT B;  1NE3 A;  1BVS A;  4HID A;  4YY3 L;  1NBW A;  2VL6 A;  4JI3 Q;  1HNW Q;  2HHH L;  1KRT A;  4X65 L;  4JOI A;  1W2B A;  1Q7Y C;  1S3O A;  4UPA A;  1CSQ A;  2NVX H;  1KXL A;  3PUY A;  1FL0 A;  4ME3 A;  1XNQ L;  3I4M G;  5C0X I;  3PUX A;  4P75 A;  1Y1W G;  1N32 L;  1EQR A;  1G51 A;  1L0W A;  2GVB A;  1EIF A;  4UY8 C;  5IYB G;  3GTO H;  3E9I A;  4DAY B;  5HY6 A;  4GNX A;  3CC2 A;  2ASB A;  1QVG A;  4LF5 L;  4LF6 L;  1SFO H;  1XMQ L;  3AEV A;  4YCV A;  5FLX c;  5C44 H;  1G6P A;  2R7Z H;  4BXX G;  4LF6 Q;  2DUD A;  1E22 A;  2AHO B;  2D0P A;  2GVA A;  2I5H A;  5IY0 A;  2VW9 A;  3W1B A;  3VDY A;  3RLN A;  4A3K G;  2K5H A;  3LGJ A;  1EQQ A;  1VQ5 A;  4JI4 Q;  4IFD G;  4DUZ Q;  4R4T A;  4QQB X;  1N32 Q;  1SLJ A;  1YIJ A;  4O0A A;  4A3D G;  4IFD I;  4IPG A;  1TWH H;  4A3C G;  3W1G A;  3T1Y L;  1VQL A;  1VQ9 A;  2R93 H;  1A62 A;  1EFW A;  2UXD Q;  2D62 A;  3AFQ A;  3M9B A;  2MFI A;  1TWC H;  4WJ3 M;  2UUA Q;  1X3G A;  2JEB I;  2VZA A;  1VQB A;  1K73 C;  5BR8 L;  4L5Q A;  5H1S E;  3CCU A;  2PMZ E;  2N78 A;  3KYH C;  4JI5 L;  2QEX A;  1K8A C;  1M90 C;  1C0A A;  1VQI A;  3ER0 A;  2JA5 G;  2E5L Q;  1B70 B;  3PO3 H;  4X65 Q;  5C4X H;  4QGU A;  3RZD H;  3KF8 B;  2K14 A;  2FXQ A;  2K4K A;  3RN5 A;  4A3B H;  1I94 Q;  1S72 A;  4A3B G;  1HJP A;  2WAQ E;  4OX9 L;  1V1Q A;  3F2C A;  4HJA A;  5GAH C;  5AJ3 Q;  1CKM A;  1KRS A;  4DR2 L;  3S1R H;  2JA5 H;  1YVC A;  3AYH B;  4OX9 Q;  1IBK Q;  5LMU L;  2NVQ H;  4DR6 Q;  4GNX C;  4A3E G;  4LNQ A;  4JI0 L;  1YJ9 A;  1FJG Q;  4APV A;  1G29 1;  1WCM G;  1YBY A;  2CFM A;  4L5R C;  3CCL A;  2ZTE A;  2RCN A;  4JG2 A;  1E7Z A;  4DKA C;  4A3M H;  1A63 A;  3CC7 A;  3CP0 A;  2HIX A;  4X66 Q;  1UEB A;  1WYD A;  4JBW A;  1QUQ B;  1XTD A;  3PGZ A;  1PYS B;  4MTN A;  1OXX K;  2YTX A;  1VQD A;  2PNH A;  3E9H A;  1YZ6 A;  1K9M C;  1XNR L;  3ERS X;  4UP9 A;  1X56 A;  3PCO B;  2YV5 A;  2JE6 I;  1LM0 A;  5IWA Q;  3PUW A;  2VQE L;  1Q86 C;  3CCV A;  2I0Q A;  3GTQ H;  4JYA L;  3PF4 A;  3A74 A;  1PH6 A;  1VS0 A;  4GKK L;  4LF8 Q;  4LF9 Q;  4JBM A;  5LMU Q;  1JMC A;  2NVY H;  2KCT A;  4A3C H;  1N8R C;  3S1N H;  1CKN A;  4BBR G;  4HIO A;  2UU9 L;  1OXV A;  4P71 A;  2ZJQ A;  4DNI A;  1JT8 A;  1EUJ A;  2K5N A;  1HR0 L;  3CD6 A;  2VY3 A;  5LMN L;  3GO5 A;  1OTC A;  4L5S A;  1CKO A;  4A3J G;  1NJI C;  4B3M L;  4NXM Q;  3HOW G;  2V1C C;  1HR0 Q;  5GRO A;  2JQO A;  1EWI A;  2NN6 G;  4NB3 A;  1OXU A;  1BBU A;  2EXD A;  4XTC S;  4YWM A;  5FLM H;  3OW2 A;  4A93 H;  4JYA Q;  4GN3 B;  3I55 A;  5HGQ A;  4AQY Q;  2BH2 A;  4KLK A;  1J6Q A;  4YHH Q;  3HKZ E;  3U4V A;  2A1A A;  4X6A H;  5BR8 Q;  2R6G A;  1KL9 A;  1Q46 A;  1WCM H;  2NZO A;  1CKN B;  1OXT A;  4XIG S;  5M5Y H;  1EOV A;  5JJK A;  1N33 Q;  1PA6 A;  2Z6K C;  3HOU H;  3CW2 C;  3KF6 A;  1O7I A;  2VNU D;  1I50 H;  5GQO A;  3K7U C;  1VQC A;  3HOZ H;  3UDF A;  1HZ9 A;  1X9N A;  3PIP A;  3J7Z C;  1PH1 A;  4UP8 A;  4OO1 G;  2A8V A;  1HH2 P;  4OXP A;  1J5E Q;  2IT1 A;  1PH9 A;  4LF7 L;  3GTJ H;  2N8N A;  1QVF A;  2ZM6 Q;  1Q81 C;  3I4O A;  3IRB A;  3RN2 A;  1Y1V G;  4LF4 L;  4EQ5 A;  4DV1 Q;  4JI6 Q;  5C4J H;  3ULJ A;  4KI0 A;  4POF A;  3I4M H;  2JEA I;  3S14 H;  4KHP L;  2AKW B;  5M3F H;  1WFQ A;  3M4Q A;  4O2D A;  1PH8 A;  4AH6 A;  1XNQ Q;  2Z0S A;  2R92 H;  2IX1 A;  2JA7 G;  1PH2 A;  4JC0 A;  1JJC B;  1VQM A;  3ICE A;  2JK8 A;  2A19 A;  1QVC A;  2N3S A;  4GKJ Q;  4DR1 Q;  1A0I A;  1FVI A;  4DUY L;  1HZC A;  3PUZ A;  2WP8 J;  5C3E G;  4C3H H;  3J81 c;  2UXB Q;  1KHI A;  3M3Y H;  3CAM A;  2Q2I A;  3T1Y Q;  2MNA A;  3T1H Q;  1VQ4 A;  3GTL H;  4DV7 L;  1R9T H;  3M7N A;  2F4V Q;  5EAY A;  2R92 G;  3OTO L;  3PO2 H;  1GKH A;  4NPS A;  1N9W A;  2WFW A;  4OON A;  1N34 L;  1VQN A;  4LUO A;  2C35 B;  1A8V A;  3CME A;  5M3M H;  1N34 Q;  3A0J A;  3H0G G;  4JI2 L;  3L7Z C;  4DV4 L;  5IP9 H;  4GKJ L;  1LYL A;  2KBN A;  2UXB L;  5C0X G;  5J3B A;  2WB1 E;  2I5M X;  2AWN A;  4IPC A;  1L1O B;  1E1T A;  4R4O A;  3G6E A;  4GOP A;  1YI2 A;  4RG1 A;  3NEM A;  2Q2T A;  1X55 A;  3GTM H;  1CUK A;  4QY7 A;  5GAE C;  4BY1 H;  3SGI A;  5E7N A;  3T1H L;  1N36 Q;  1L1O C;  1UE7 A;  1IBL Q;  1Q12 A;  1UE6 A;  2MO0 A;  5JEA G;  1YJW A;  4BBS G;  1OXS C;  4B3R Q;  2RF4 A;  1YHQ A;  1ASZ A;  4K0K L;  1VQG A;  4AYB E;  1JJ2 A;  3UE0 A;  1TXY A;  4OWX B;  3CCE A;  1PH5 A;  5IP7 H;  3F2B A;  3HOX H;  4R4C A;  1YJN A;  2ZM6 L;  4JI1 L;  4DV6 Q; 
#chains in the Genus database with same CATH topology
 1M1K C;  2B2U C;  1L1O A;  2F3V A;  2OXP A;  2RVL A;  1VQA A;  1Q1B A;  3SDZ A;  4X64 Q;  1XWE A;  4U67 3;  1K0S A;  2EDG A;  1SMX A;  2XIW A;  4FVM A;  4LF9 L;  1SRU A;  4FYD A;  4K8I A;  5EGT A;  5FJ8 H;  3JAM i;  3CCS A;  2NBF A;  3A54 A;  4P2C B;  4RA8 A;  1PLF A;  4KKS A;  2N88 A;  1BKB A;  3F8T A;  4JBK A;  4MNO A;  1O7Z A;  2HT1 A;  3C3L A;  5EKI A;  4A3G G;  4ZAI A;  4R1J A;  3S2D B;  4HJ7 A;  3HKZ G;  2JA7 H;  4JI0 Q;  4M8A A;  2VS1 A;  1RDP D;  2D0O A;  4ULL A;  1GXD C;  2JA8 B;  2FMM A;  1LT6 D;  2K04 A;  1XMO L;  1TY2 A;  4BBR B;  5KNC A;  4LUV A;  2JXM B;  2HDL A;  2JYO A;  3K8A A;  1UEA B;  3WWV A;  4GLX A;  1G91 A;  1SBB B;  3TS2 A;  3CPF A;  3NSW A;  2EYO A;  3I7F A;  3H3V H;  1GUG A;  5CBA E;  1PH4 A;  4BBR H;  1EWH A;  4GKK Q;  2UXD L;  5I4D A;  3S17 H;  3C2P A;  2K50 A;  1BO0 A;  4X66 L;  3NEN A;  4QUF A;  4C3H G;  4CKC A;  4KHP Q;  2L9H A;  2YTY A;  1Z7T A;  5D3D A;  4GN4 B;  4MTK A;  3JAM L;  5E1F A;  2K52 A;  1GUN A;  3ONA B;  2F0U A;  1I50 B;  2LSS A;  5AJ3 L;  2CCZ A;  5ELF A;  4DR6 L;  2LS0 1;  3KBX A;  4QIW E;  2HQL A;  3T56 B;  3V2T A;  1T5E A;  1QZG A;  3PO3 B;  2UUA L;  3SK4 A;  2MQH A;  4OO1 H;  5EKL A;  2PZU A;  1PFN A;  1KLG D;  1NMF A;  3HOZ G;  2D5D A;  4PZ6 A;  3S1M H;  1QNK A;  5IOD A;  4L63 B;  3TZD A;  1PTO B;  3Q6S A;  3F2D A;  2HCI A;  2I5L X;  1VQE A;  3D4W A;  2CQO A;  4K2L A;  1PYB A;  4F7X A;  1ESF A;  3TP5 A;  3CF5 A;  5M5W H;  1BBX C;  1OO9 B;  2YTV A;  5JJL A;  4X64 L;  1A3U A;  4JV5 Q;  4KKU A;  1GUT A;  1SE2 A;  4HIM A;  4K2K A;  2QGQ A;  4K5V A;  3GTP H;  1ILP A;  2B2W A;  3KF8 A;  1LAB A;  4DAP A;  1AFP A;  2CWP A;  4NMZ A;  2F52 A;  3FDT A;  4AQY L;  3KFU A;  1ROD A;  3OIQ A;  4JV5 L;  2X6L A;  4IPH A;  5EJW A;  3I4N B;  1KNE A;  3L2P A;  5JVH 3;  1PZI D;  2UU9 Q;  1VQ8 A;  2BDN A;  4RMF A;  1XPU A;  1ML0 D;  2E8G A;  1KLU D;  4PV1 C;  1X54 A;  3SHL A;  4PMW A;  3S24 A;  2B39 A;  1W6K A;  2BA1 A;  5IGE A;  5ELN A;  1SXT A;  1VQH A;  2WIN B;  1QWY A;  3NBI A;  4EVO A;  2R7D A;  5C44 G;  1XYI A;  4DR5 Q;  1WTO A;  2R3Z A;  4DV6 L;  4YIJ A;  1TQO A;  4NP5 A;  5IGD A;  1GUW A;  4DV5 L;  1PHJ A;  3M4P A;  1D6E C;  1X65 A;  3NUC A;  4A3E H;  3K7A H;  4YWK A;  3VR5 A;  1F9R A;  4X3K A;  1PRT F;  2LXJ A;  4A3M B;  1XMO Q;  4N9T A;  4MHE A;  2R93 G;  3AU7 A;  5A2Q L;  2UUB Q;  2AQ2 B;  5FO7 B;  2EE1 A;  4A3E B;  3LWE A;  2NTS A;  5I6Y A;  1BQQ T;  2UUB L;  3PO3 G;  3MEH A;  3S1Q B;  4RGM A;  2VQF Q;  3KDF A;  2NWG A;  1DOL A;  2E2D C;  4YCU A;  2M2L A;  4DAM A;  2CH4 A;  1TVX A;  3M4O H;  2NVQ B;  5IE8 A;  1Y8N B;  2CWA A;  2KHJ A;  1VQK A;  4A3L H;  1G8Z D;  2NZH A;  5JPN C;  4DK1 A;  4HAE A;  4LFB L;  2F0J A;  3JC6 6;  3URY A;  4FO2 A;  4GLV B;  2ZTD A;  4H44 C;  3HEJ A;  1ZKO A;  1JE5 A;  2YU9 H;  2F4V L;  4I7A A;  4N9P A;  3DUZ A;  3VYS A;  4AYB G;  5IT9 c;  4LF4 Q;  4A3J H;  4C2M H;  4JI8 Q;  4C1N I;  3TP6 A;  1GOZ A;  1U0L A;  3HG9 A;  4NDX A;  1BXT A;  1MJE A;  1Z47 A;  3K0Y A;  4TRD A;  5COY A;  5JEA J;  2SNS A;  4EQP A;  3GTP B;  2WAC A;  2CW0 D;  2NVY B;  3MFG A;  5LL6 S;  2F0V A;  4DR3 L;  4DV5 Q;  4M1U B;  1PVO A;  4PZ7 A;  3H3V I;  1IBL L;  3U4Z A;  5M3M G;  1RD9 D;  1LT4 D;  3L0O A;  2ZJR A;  2F3I A;  1IBM Q;  3KF6 B;  4OO1 I;  1KAW A;  4HSP A;  3HZX A;  4AIM A;  4CDC C;  1Q1E A;  1LTG D;  4GOP C;  4F88 A;  4X62 Q;  2JA9 A;  3RNU A;  1WOC A;  2VUM G;  5COR A;  5IT9 L;  4A75 A;  1U9R A;  1JWS D;  1LTS D;  1S5D D;  1U5K A;  5IYC G;  1HNX Q;  2DN8 A;  5C3E H;  3TS0 A;  4LF5 Q;  3HFZ B;  3I3C A;  3T13 A;  5I2X A;  4LJZ C;  2F0W A;  3S16 B;  1K83 B;  4FXK C;  1KRT A;  5EQ0 A;  1W2B A;  1RKN A;  1KXL A;  3GQB A;  3PUY A;  1HA6 A;  3A55 A;  1Y1W G;  1JWM D;  5CMD A;  2I07 B;  1G51 A;  2HUG A;  2Z6B A;  3GTO H;  1EWC A;  5DM7 3;  2BE5 D;  2C9O A;  4LF5 L;  3BDL A;  1SFO H;  1F2Y A;  2R93 B;  1IW7 D;  4IUN A;  3DXJ C;  3N6R A;  3QIA A;  3NQT A;  5IY0 A;  2AHO B;  4DK0 A;  4JI6 L;  4KD4 A;  3LGJ A;  4F8M A;  3I72 A;  1JQY D;  1N32 Q;  2EYM A;  2H4O A;  3A7A B;  4ZQ3 A;  3HOX B;  3FVQ A;  1Y8P B;  1WD0 A;  1VQ9 A;  1FNV A;  1K8M A;  2D62 A;  3C46 A;  1Y69 U;  4WJ3 M;  1I4G A;  2UUA Q;  2L4N A;  4X3U A;  1K73 C;  5BR8 L;  4ZRZ A;  3VR6 A;  2WKD A;  4QGU A;  2K14 A;  1LT3 D;  1TU2 B;  1S72 A;  3EVQ A;  4OX9 L;  3W3A A;  2Z1C A;  2F4I A;  4OX9 Q;  1U4L A;  2B2V C;  2X6G A;  2NVQ H;  3J7A V;  4DR6 Q;  3PO2 B;  2L0C A;  4LNQ A;  4JI0 L;  1SJE D;  3T53 B;  5I2Y A;  1YJ9 A;  1WCM G;  3CCL A;  4A3M H;  1WTV A;  1A63 A;  3CC7 A;  1VMP A;  1WYD A;  1B4O A;  1HQR D;  3PGZ A;  4XXE A;  1SND A;  2XWB B;  1K9M C;  4UP9 A;  3PCO B;  4I7Z C;  2JE6 I;  2I0Q A;  4JYA L;  1EFI D;  3A74 A;  1V1P A;  1VS0 A;  4GKK L;  4LF8 Q;  1KAA A;  5ELD A;  2K7V A;  3X3N A;  1DM0 B;  4BBR G;  5FLX E;  2UU9 L;  4P71 A;  2A5H A;  2K5N A;  3R2I A;  3TDQ A;  2VY3 A;  1OTC A;  1CKO A;  4A3J G;  1NJI C;  2V1C C;  1HR0 Q;  4CHT B;  2NN6 G;  1BBU A;  1EY0 A;  3MXP A;  4XYO A;  5ELC A;  1STN A;  1SAP A;  2HCC A;  1J6Q A;  5CV8 A;  3U4V A;  2X69 A;  4RGN A;  5BR8 Q;  4XIG S;  1OXT A;  4DNR B;  1JIC A;  3CW2 C;  3KBG A;  5JPM C;  3MC0 B;  3V96 A;  3K7U C;  1K3B C;  3UDF A;  1HZ9 A;  1X9N A;  2A8V A;  2E76 C;  1IL8 A;  2CHB D;  4LF7 L;  3IRB A;  2F0O A;  2I46 A;  3RN2 A;  1Y1V G;  3ULJ A;  4KI0 A;  3I4M H;  3S14 H;  1KDA A;  2AUJ D;  3A7L A;  3G6J B;  1XNQ Q;  2IX1 A;  4JC0 A;  2JK8 A;  2A19 A;  4GKJ Q;  1A0I A;  2MUY A;  1LT5 D;  3J81 c;  3K57 A;  3A56 A;  3CAM A;  2Z4H A;  4C3I B;  3T1H Q;  1VQ4 A;  1R9T H;  2R92 G;  1R4P B;  3MZ5 A;  3S1M B;  2EOT A;  1HQM C;  5C4Z A;  4J8Q A;  4DU9 A;  2D9U A;  4DAV A;  1SYD A;  1TS2 A;  1BR9 A;  5BN5 A;  2J4X A;  4OL7 A;  4IPC A;  4GOP A;  2MHV A;  3KLS X;  1FNU A;  3WOE A;  1IBL Q;  3QG1 A;  2EYH A;  4RCO A;  1VF7 A;  2M9V A;  5C0X H;  1I4X A;  3OMC A;  1YHQ A;  1ASZ A;  4K0K L;  1I6V C;  2FHT A;  3UE0 A;  1TR5 A;  4OWX B;  3CCE A;  2ZXO A;  1MGS A;  2LY7 A;  2QCP X;  4KY5 A;  4A3J B;  1X3E A;  2HQE A;  3UDG A;  4A3B B;  3MXN B;  2N49 A;  5FLX L;  4R4Q A;  4H02 A;  4LF8 L;  3BVM A;  1DJR D;  4GN5 A;  4CDF C;  5IYD G;  5C44 B;  1SR3 A;  3CRK C;  2KCC A;  1BCP C;  3RLO A;  1H9R A;  2RA4 A;  1LTA D;  2A68 D;  2XRS D;  2HD3 A;  5IP7 G;  1S5E D;  4JI3 L;  1ASY A;  1X3F A;  5I6W A;  1P16 A;  1QUQ A;  4FNF A;  1SDF A;  2R7Z B;  3UDX A;  2QEJ C;  3KJO A;  2AMC B;  1GD7 A;  1SYE A;  2QKI C;  5D65 A;  4ZUJ A;  5C5L A;  4WJ4 A;  1J8I A;  1FGU A;  3EA6 A;  3S2H B;  5D3I B;  4LK1 C;  5M5W B;  4BY7 G;  1UWV A;  4DR4 Q;  2PQA B;  4XYQ A;  3VA7 A;  1HUN A;  3TRZ A;  1VQJ A;  2MGS A;  1D5M C;  1RL2 A;  1W6J A;  4BY1 B;  4IZ8 A;  4IPD A;  2K75 A;  4AYB B;  3BS1 A;  4DR2 Q;  3K6O A;  4LMQ D;  3WDN A;  3BDO A;  3NWT A;  4OEL B;  1N33 L;  3ULL A;  3FKI B;  3DEP A;  4FP5 D;  4KHZ A;  2Z4I A;  3D8G A;  1YHB A;  4A3F G;  3HOV G;  1PV4 A;  1DXM A;  4ZYS A;  4BA2 I;  2F0L A;  1W3S A;  5C4H A;  4ID6 A;  2K5V A;  3N52 A;  5IYC H;  4DGZ A;  5LMN W;  2OTJ A;  1CQV A;  2P5Z X;  3MXN A;  2B3G A;  4HMI A;  1AP0 A;  3IL8 A;  1JCK B;  1SNM A;  5I9O A;  3FHW A;  1EY6 A;  2RDH A;  3OW7 A;  3RLF A;  2PZW A;  5LMN Q;  2ICI A;  2IPK D;  2PQA A;  4Z9C B;  2CW0 C;  4R8N A;  2L11 A;  4IJH A;  3KLW A;  3ZJY C;  3A5Z B;  3PV0 A;  3A8I E;  4FDB A;  5K36 G;  1AH9 A;  1I4R A;  4LF7 Q;  3PUV A;  4GOP B;  1K8O A;  1AE3 A;  2QA4 A;  1NTG A;  2DNE A;  1N36 L;  4A3I H;  1Y1W B;  3TP7 A;  3NEL A;  2DGY A;  5IIF A;  1HR0 W;  2B2T A;  3R8B A;  1PTO H;  2RHQ B;  2R61 A;  2G9H D;  3A8K E;  2O5J C;  2EQS A;  3STB C;  4IOC A;  2NN6 I;  3PQI A;  1MJC A;  2E75 C;  4P74 A;  4IUU A;  3BJU A;  2K6A A;  4BBS B;  4ZK9 B;  1TWA H;  5CV9 A;  4YHH L;  4GNX B;  3K0X A;  4GS3 A;  4A93 B;  1YNJ C;  2R7Z G;  1C9O A;  4G7H C;  4A3G H;  3EN2 A;  3H3V C;  1DYQ A;  1NR2 A;  3CQZ H;  2EYL A;  2OF1 A;  2E2H B;  1VDZ A;  1QB5 D;  2B2Y C;  1D7Q A;  4XQN A;  4A3F H;  3HOV H;  1V9P A;  1PH7 A;  1MBY A;  4HJ5 A;  2FFK B;  5M3F B;  1H9M A;  2ALY B;  3SXH A;  2R7F A;  1ENF A;  4RFB A;  3Q0A A;  5G3L F;  2IX0 A;  2VQF L;  4DV6 Q;  3GTQ H;  1A3T A;  2E2H H;  1VQ7 A;  2EIF A;  2LKV A;  2F0Q A;  3P7J A;  2MJ8 A;  1D8L A;  5FOB B;  4UP7 A;  1I94 L;  3S14 B;  4HCE A;  3RZD B;  3RZO H;  1PDQ A;  4RGT A;  1PH3 A;  4YCW A;  1P8L A;  1KTK A;  2JA8 G;  2ES2 A;  2GA4 B;  1SMY C;  3J81 j;  1NR4 A;  2DY7 A;  4POG A;  3GP7 A;  4B3R L;  3Q22 A;  3NBH B;  1XPR A;  4CKB A;  1H95 A;  2LXK A;  3U50 C;  2FJ2 A;  3DHQ A;  3H0G H;  1HNZ Q;  1U4R A;  1S5C D;  1F9P A;  3D31 A;  2C5C A;  2QIL A;  1VCI A;  2F0N A;  3CRL C;  3VA5 A;  1FJG L;  2ZT9 C;  1YHA A;  3O13 A;  2JA6 H;  2D2C C;  3ERO A;  2UXC Q;  3UDI A;  4XT1 B;  3VR2 A;  3I73 A;  4LUZ A;  3K80 C;  1KC8 C;  2NZ1 D;  3OWE B;  4JI7 Q;  2A69 D;  3BYY B;  1ET6 A;  1O80 A;  3UI2 A;  5T1G A;  4B3S L;  4KTA A;  5CC4 A;  1WI5 A;  1K28 A;  3J80 L;  3RMH A;  2L5T A;  4KJO A;  4DR1 L;  2B63 B;  2CKZ B;  3IKJ A;  1D2B A;  3J80 c;  4KK7 A;  1T9H A;  4Y7N H;  3S2H H;  1HFG A;  1BNZ A;  2WAQ B;  4XT3 B;  4ME5 A;  2F3W A;  5FO9 B;  2OTL A;  1BDO A;  4A3I G;  5M5Y B;  3SE0 A;  1NNX A;  3IAY A;  4DPG A;  3CPW A;  3FRP B;  3CMA A;  2E2I H;  1SNQ A;  3MXU A;  2BDO A;  4DV3 L;  1J5E L;  2ZXR A;  2EY2 A;  1RF2 D;  4GZY C;  4OWT B;  1NE3 A;  3K5N A;  1EZ6 A;  4JI3 Q;  4UDU C;  2HHH L;  1Q3L A;  1SYG A;  2A6E D;  4ME3 A;  4FF4 A;  3I4M G;  4P75 A;  2KA7 A;  2R92 B;  1EQT A;  5KGU A;  2ASB A;  5CGK A;  1BCP B;  3Q24 A;  5FLX c;  5C44 H;  2R7Z H;  1X3Q A;  1B3A A;  4LF6 Q;  4WFN 3;  5IGG A;  1ET9 A;  2SOB A;  3IFD A;  1E22 A;  2D0P A;  2VW9 A;  1EY7 A;  5NUC A;  4DUZ Q;  2F0I A;  4KN4 C;  3HOY B;  3RUZ A;  1SFO B;  2R93 H;  4BWG B;  4C56 C;  2RBM A;  2UXD Q;  3HGB A;  5HGT A;  1HCZ A;  5CV7 A;  1LTI D;  1PRT C;  2B8F A;  3CCU A;  2PMZ E;  2QEX A;  1K8A C;  1TY0 A;  1M90 C;  5ELE A;  1RCV D;  1VQI A;  3ER0 A;  2E5L Q;  1B70 B;  2JA5 G;  4X65 Q;  3RZD H;  3KF8 B;  4DAY A;  1V8Q A;  3K58 A;  3RN5 A;  4A3B H;  1HJP A;  1V1Q A;  4J1M A;  4HJA A;  5GAH C;  1CKM A;  1KRS A;  3E6Z X;  3S1R H;  2JA5 H;  5LL6 X;  3AYH B;  4GNX C;  1BCP F;  4APV A;  1G29 1;  1IYV A;  2RCN A;  3KUP A;  4IUT A;  4JBW A;  1FGB D;  1PYS B;  4FXD A;  1PZK D;  1YZ6 A;  1D5Z C;  1XNR L;  4DR5 L;  5IWA Q;  1WTQ A;  1UNS A;  3BZD B;  3PUW A;  1JOQ A;  3CCV A;  1PH6 A;  1QG7 A;  4LF9 Q;  5LMU Q;  2NVY H;  2KCT A;  1CKN A;  4CJ0 B;  2ZJQ A;  4DNI A;  5EPJ A;  2EY5 A;  2RDG A;  5LMN L;  1TWA B;  4PMB A;  3SR1 A;  4C3J G;  3H94 A;  2YU9 B;  1GUO A;  4DN4 M;  1X32 A;  1CZW A;  2F0S A;  2PQE A;  3TN2 A;  4GN3 B;  2RDF A;  3I55 A;  3AMU A;  4AQY Q;  4KLK A;  2WKC A;  3S1N B;  1PTO F;  3GTL B;  2R6G A;  1WCM H;  2NZO A;  4RAU C;  1N33 Q;  4IFD H;  3VYU A;  1PA6 A;  3KF6 A;  3RD4 A;  1B50 A;  2A6E C;  5GQO A;  2AUK A;  3J7Z C;  1PH1 A;  2RSN A;  4C1N K;  4K5W A;  1QOH A;  1HH2 P;  2K1B A;  2WV6 D;  4XQJ A;  2IT1 A;  1HTL D;  3GTJ H;  2J7Z A;  2ZM6 Q;  3BDC A;  1Q81 C;  1QJO A;  2NB0 A;  4B9X A;  1NUC A;  2F0P A;  2KQ3 A;  1AW7 A;  3J7Y W;  4DV1 Q;  1EQV A;  4LF4 L;  3Q23 A;  1WFQ A;  3M4Q A;  1IKL A;  2QW7 A;  2CH4 W;  1WTR A;  4DF7 A;  2B2U A;  4ZCK A;  5C3E G;  2PMZ B;  2WP8 J;  3I4L A;  3PUZ A;  4LAA A;  2UXB Q;  2JA5 B;  2Z8L A;  5D14 A;  1QNU A;  1E2V A;  2MNA A;  1F2L A;  3M7N A;  2F4V Q;  2Q8I B;  3ITP A;  5CV5 A;  3PO2 H;  1TS4 A;  1GKH A;  4NPS A;  1N34 L;  5C3W A;  1A8V A;  2PCF B;  5M3M H;  2VXW A;  3L7Z C;  3TBI B;  1S5F D;  4DA2 A;  1ZYR D;  2UXB L;  1SJH D;  3NBH A;  2K5Q A;  2WB1 E;  5C0X G;  2AWN A;  4R4O A;  1L1O B;  1E1T A;  3G6E A;  1YI2 A;  1TS3 A;  2Q2T A;  3GTM H;  5KYL A;  3PIP 3;  3SGI A;  5E7N A;  1O7L A;  1L1O C;  1JOK A;  1D1I A;  1EU3 A;  1YJW A;  4BBS G;  5AFW A;  4AYB E;  1KDB A;  1TXY A;  1PH5 A;  4RHR A;  3HOX H;  4QIW B;  4IUR A;  1YJN A;  4X3S A;  2ZM6 L;  1EY9 A;  4FF2 A;  1Z6H A;  1CHP D;  3QOL A;  4PMC A;  1TWG B;  4C3J B;  2HIV A;  4BA1 I;  4P72 A;  1HZB A;  2Y0S B;  1C8C A;  2IL8 A;  1ONL A;  1GVP A;  1HXY D;  4IQZ A;  2IW3 A;  4BS9 A;  5M3F G;  3TRE A;  2F0M A;  3F1Z A;  3H6M A;  4DK3 C;  1CI3 M;  1WCM B;  4IO9 A;  1HRJ A;  3C1E A;  4HSV A;  1M4V A;  2O5I C;  1LUZ A;  3U58 A;  1AZQ A;  1VQ6 A;  3J80 E;  3G7L A;  2YYZ A;  3VYT A;  2XVS A;  1K3R A;  1Y8O B;  2BOS A;  1CA6 A;  4IAL A;  1IHZ A;  4QB4 A;  1O7Y A;  4DXG A;  1GO3 E;  1F9Q A;  2KEN A;  4FXG C;  3S16 H;  3DMU A;  4B3T L;  3I4N G;  3K5M A;  2WB1 G;  4WOR A;  4CJ2 C;  3MXG A;  1I3Q B;  1SNC A;  1K0R A;  4G4K A;  1VQO A;  3CCM A;  1TII D;  3AQQ A;  3BZK A;  2IY5 B;  1JWU D;  4A3L G;  3HOW B;  2B63 H;  1IL2 A;  1JJG A;  1S4Z A;  2K01 A;  3BVG A;  5C0X J;  2OCE A;  2PI2 E;  5IGB A;  2VB2 X;  2F0T A;  1SE8 A;  3OHX C;  1SYF A;  3HOW H;  3D4D A;  3CCQ A;  1YEZ A;  4IN3 A;  1JOO A;  4DK6 C;  5IWA L;  2QDB A;  1GJX A;  1B9N A;  4JI4 L;  4ZUI A;  1EYC A;  3DEO A;  1SEB D;  4A3M G;  1R9T B;  1HNX L;  2GN5 A;  4EX5 A;  1IBK L;  3H0G B;  1F9S A;  5KND A;  2JSO A;  4QL5 A;  2JA8 H;  3NXW A;  2LFN A;  4DV7 Q;  4YWL A;  1KNA A;  1Y1V B;  3TEH B;  2KHI A;  2WII B;  3U9S A;  4CJ1 B;  3OMG A;  1RTN A;  1E1O A;  3H91 A;  1TWF H;  4DR3 Q;  1PMR A;  4QJF A;  2M00 A;  4QUC A;  4ALP A;  2Q2U A;  5L37 A;  1JOR A;  1D5X C;  1WTP A;  1V1P B;  4NXM L;  4IUV A;  3RR5 A;  3GV6 A;  4DR7 Q;  4N8X 1;  3GTM B;  3G4S A;  2DJF C;  4PZ8 A;  1PXU A;  4DUZ L;  1R4Q B;  2Y0S G;  2KVM A;  1PRT B;  1UE5 A;  2OT2 A;  4NW2 A;  1SNO A;  4OWW B;  5DNF A;  5C4J B;  1HNW L;  1Q90 A;  1ZEQ X;  3TQY A;  1BBW A;  5M3M B;  1A15 A;  3M7G A;  1IZ6 A;  4A3G B;  1HTP A;  1U4P A;  1V1O A;  1X6O A;  4JBJ A;  3S1Q H;  2DNC A;  3PSI A;  5EPL A;  4L5T A;  4K6D A;  4KHV A;  3MAQ A;  4FF3 A;  2WB1 B;  5IP9 G;  4BXX H;  3W5O A;  4A3D H;  1ICF B;  2BA0 A;  3GD7 A;  1CTM A;  3BZC A;  3KDF B;  3STB D;  2ENB A;  4B3M Q;  1V43 A;  1B8A A;  3I4N H;  3K7A B;  2IWH A;  4RKL A;  2J0T D;  4MIU A;  1G2S A;  4J15 A;  2V4D A;  2SEB D;  2IHF A;  4HJ9 A;  2XWJ B;  2L15 A;  5C4X G;  2VQE Q;  3LNN A;  5CV6 A;  2KOL A;  3NK9 A;  4I65 A;  4C3H B;  5LHY 1;  4IOA A;  4N8F A;  4RH6 A;  2CVR A;  3T51 B;  2BH8 A;  4LW1 A;  2ZTC A;  3CHB D;  1CHQ D;  2B29 A;  3E0E A;  4HIK A;  4JI7 L;  1C7Y A;  1I6H H;  4R8I A;  2IHE A;  3GV3 A;  2F0D A;  2OEO A;  3SK8 A;  3ULP A;  1E24 A;  4IUP A;  1LLR D;  4PG3 A;  2DJG C;  3NP8 A;  4JI2 Q;  1Y1V H;  2B8G A;  3FPU B;  5CR3 A;  1WVL A;  1PZJ D;  1WD1 A;  4JCV E;  1EEF D;  4ZKC B;  1KD1 C;  1O78 A;  2L12 A;  2EY6 A;  1U4M A;  3CC4 A;  2NVT H;  2EYP A;  1A3V A;  2PZT A;  3HOX G;  2UXC L;  2PNR C;  5CV4 A;  4CKE A;  4J6H A;  3HOZ B;  2XN9 C;  1LTT D;  3CCR A;  4LWC A;  4JI5 Q;  2Y0S E;  1NSN S;  2G9D A;  4DV0 Q;  4B3S Q;  2K28 A;  1YNX A;  3P1H A;  1YNN C;  4HTH A;  1WJJ A;  5ELO A;  1VMC A;  1EIY B;  3J80 i;  3J81 i;  4NKL A;  4BY7 H;  4BY1 G;  2MO1 A;  1J9O A;  1HA5 A;  2OWO A;  1SRO A;  1K8G A;  2SNM A;  3JAM c;  2UUC L;  2F0E A;  4KD3 A;  3CXC A;  3PO2 G;  1JR0 D;  3K5O A;  1PTO C;  3EQL C;  5JJI A;  2KCM A;  3PMF A;  1HNZ L;  2Q2H A;  4A76 A;  4ZLT F;  3FP9 A;  5J39 A;  3S1R B;  2CQA A;  2ZXP A;  3HKS A;  1SN8 A;  5J1Z A;  4HJ8 A;  2OQ0 A;  1AN8 A;  2AQ1 B;  2PPB C;  3DM3 A;  1SMY D;  4A4I A;  1IW7 C;  2IJ0 A;  4QMG A;  3A5U A;  1Z9F A;  5DM6 3;  1XPO A;  1BF4 A;  2K5W A;  5JJZ A;  4DV2 L;  1CT1 D;  1DGS A;  1ENA A;  1STH A;  1A2U A;  3PIO 3;  5G3L D;  2F0K A;  4H7B A;  2JA7 B;  1BVS A;  4HID A;  5KYI A;  3D4R A;  4YY3 L;  3J81 L;  1NBW A;  1HNW Q;  2A74 C;  4X65 L;  4JOI A;  4OEM B;  3M3Y B;  1S3O A;  5C4X B;  4U68 A;  2K32 A;  2NVX H;  1MSG A;  4R9W A;  3SEB A;  5C0X I;  1EQR A;  3SVM A;  1L0W A;  2GVB A;  5IYB G;  1TWC B;  4DAY B;  1STG A;  4K8J A;  2BCO A;  2EYF A;  5HY6 A;  4DNT B;  3CC2 A;  4K14 A;  4LF6 L;  3NTH A;  4YCV A;  3AEV A;  3W2D A;  4BXX G;  2F0F A;  1LTR D;  2DUD A;  3CKI B;  2I5H A;  1EQQ A;  4A3K G;  3RLN A;  4IFD G;  3BVZ A;  1WTX A;  1SLJ A;  4O0A A;  2A73 B;  4IPG A;  1B2T A;  4B08 A;  5T1I A;  3W1G A;  2EXZ A;  5FKA C;  1X3G A;  1DOM A;  5H1S E;  3KYH C;  4JI5 L;  1C0A A;  3OPO A;  4PNY A;  4C3I G;  2FXQ A;  5BN3 A;  4KJN A;  1BCP D;  4ODG A;  4DR2 L;  4WRD A;  1RHP A;  4Y7N B;  1IBK Q;  1F2M A;  5LMU L;  3SK6 A;  2K05 A;  2IX3 A;  1JB3 A;  1EZ8 A;  1FJG Q;  1YBY A;  2CFM A;  1ENC A;  2ZTE A;  1AZP A;  1E7Z A;  3CP0 A;  1UEB A;  3ERQ A;  2JP1 A;  4QCL A;  1XTD A;  4MTN A;  1OXX K;  2PNH A;  3E9H A;  1X56 A;  2YV5 A;  1QCB D;  1LM0 A;  1H9S A;  1ZYR C;  5E4X A;  4O1N A;  2MPM A;  3PF4 A;  3MA2 B;  3TSS A;  3QWN A;  1H9K A;  1CK1 A;  4A3C H;  1N8R C;  3HRZ C;  3DM1 A;  4HIO A;  3S1N H;  1HR0 L;  1EU4 A;  2XNA C;  1ESR A;  5KIX A;  4EQO A;  4L5S A;  4B3M L;  3HOW G;  1PFB A;  2JQO A;  2NUC A;  5TSS A;  4NB3 A;  1OXU A;  4XTC S;  2EXD A;  4YWM A;  3VYR A;  5IGF A;  5FLM H;  3OW2 A;  5J22 A;  2G5D A;  3OOC A;  3HKZ E;  4X6A H;  1EOV A;  2K33 A;  5JJK A;  3NHH A;  2EYJ A;  2Z6K C;  2F1M A;  2VNU D;  3ND9 A;  2F03 A;  1VQC A;  3GTQ B;  1H9S B;  3GTG B;  2B2T C;  4UP8 A;  5JVG 3;  2KEC A;  4OXP A;  3TP8 A;  1PH9 A;  1QVF A;  4A3K B;  3I4O A;  1XXG A;  1JC7 A;  1STY A;  4EQ5 A;  3M4Y A;  5C4J H;  1E2Z A;  2JEA I;  4KHP L;  5M3F H;  2L1B A;  1CZG A;  4O2D A;  1PH8 A;  2A6H C;  4AH6 A;  2Z0S A;  1JJC B;  3ICE A;  1E2W A;  4JPB W;  1QVC A;  5CYU A;  2FMC A;  4DUY L;  2NVX B;  1HZC A;  1KHI A;  2RKS A;  3M3Y H;  1H9J A;  2Q2I A;  2JN4 A;  2O4X A;  1MD2 D;  2MP1 A;  2L55 A;  4HN7 A;  3OTO L;  2XRQ D;  5IOC A;  1VQN A;  1B3Q A;  1N9W A;  2C35 B;  1N34 Q;  3ND8 A;  3A0J A;  2NVT B;  4KY7 A;  4DV4 L;  1VF5 C;  5IP9 H;  4CBV A;  5J3B A;  2I5M X;  4RG1 A;  5GAE C;  3T1H L;  1N36 Q;  1UE7 A;  1Q12 A;  2MO0 A;  1S5B D;  5C3X A;  5JEA G;  1OXS C;  1HHV A;  1VQG A;  4XQQ A;  1JJ2 A;  4RWS C;  3D6C A;  4QF4 A;  5IP7 H;  1TWH B;  3F2B A;  4JI1 L;  1CSP A;  3K81 C;  3S2D H;  4DV1 L;  1EY5 A;  4TVA B;  5CBE E;  1MKH A;  1Q8K A;  3FKI H;  2EJG C;  3IFT A;  3S9W A;  2TMP A;  3A8J E;  1BUV T;  4K6L A;  2JJQ A;  1K83 H;  3MFY A;  2VUM H;  4JK1 C;  1XNR Q;  5EBC A;  4O42 A;  1VQP A;  5KRU A;  3K59 A;  5IYD H;  3QB3 A;  1EY4 A;  4C3I H;  5ELB A;  1SE3 A;  3G71 A;  4CDE C;  4A93 G;  3I91 A;  3S15 H;  4JI8 L;  1HUM A;  5IGC A;  4B3T Q;  1A2T A;  1MIU A;  3EIV A;  1MI2 A;  4LFC Q;  1EEI D;  1XMQ Q;  5EPK A;  3KOJ A;  2RHS B;  4DR4 L;  4X3T A;  4KN7 C;  5M5X B;  3DLL A;  2TSS A;  3HOY H;  2JA6 B;  4C3J H;  2EPB A;  5GAD C;  5GAG C;  1XJV A;  2ID0 A;  4C2M B;  3R3O A;  3I2Z A;  4UHV A;  2Q8T A;  2ZJP A;  1IYU A;  4FF1 A;  4DV4 Q;  2A69 C;  4LFB Q;  3M85 A;  1DCZ A;  5IYB H;  1IKM A;  3CCJ A;  3K5L A;  1EOT A;  3EBE A;  1B1Z A;  5DEH A;  1NY4 A;  2Z6K A;  2RCF A;  2E2J H;  3M4O B;  1ZXT A;  5K36 H;  1JB7 A;  2E5L L;  2PW5 A;  2F0G A;  2VB3 X;  3OYY A;  3MEF A;  1WTW A;  1TS5 A;  4DUY Q;  1E3P A;  5HUR A;  1TKW B;  3U9O A;  1CFM A;  4P73 A;  4TSS A;  4L8J A;  4YY3 Q;  3Q8D A;  2HHH Q;  1LTL A;  2VUM B;  1SYB A;  4LFA Q;  2Q8R E;  1D1K A;  3F2U A;  5IT9 E;  2Z9H A;  4IFD J;  4KKT A;  4LFC L;  5FLM G;  4DV2 Q;  4EQN A;  3AFP A;  2PI2 A;  1EYG A;  4KY6 A;  3UE1 A;  4DR7 L;  1HZA A;  5EBD A;  3PIO A;  1Q82 C;  2PW7 A;  1M8A A;  2RSO A;  2ATW A;  4B9W A;  3AB9 A;  2HDM A;  1CA5 A;  1I3Q H;  3J7A 5;  5EKK A;  1I5F A;  4K0K Q;  3NQI A;  2B63 G;  3KJP A;  4BBS H;  1TWF B;  3GTJ B;  4NXN L;  3JAM E;  3L3O C;  1QIL A;  1FYC A;  5BN4 A;  2WAQ G;  1EY8 A;  2AWO A;  4RCN A;  2PO4 A;  2EY1 A;  3R93 A;  4ILW A;  4A3I B;  1GM5 A;  1B9M A;  4DXF A;  1AE2 A;  2BE5 C;  3VR3 A;  1NMG A;  5FK9 C;  4S3S A;  1IBM L;  4DV0 L;  1SE4 A;  2OQK A;  1ILQ A;  1B7Y B;  4X62 L;  2JA6 G;  1L2F A;  5FJ8 G;  3I56 A;  1PFS A;  1IXR A;  3QOJ A;  3D0F A;  4DFA A;  1I4Q A;  3D6W A;  3I4M B;  3OSO A;  3MVV A;  1UE1 A;  2B2Y A;  3TZU A;  2KCN A;  4KV6 A;  1EYD A;  2B2W C;  5A2Q E;  4JI1 Q;  2XGT A;  3HKZ B;  1FD7 D;  4Y52 H;  3DWP A;  3GTK H;  4A3K H;  3J7A F;  4CGY B;  2O2L D;  3FKI G;  3G48 A;  3OTO Q;  4A3F B;  4V0B A;  1S40 A;  3HOV B;  4G57 A;  3T4A C;  5A35 A;  1QZH A;  4A3D B;  1LO5 D;  3HOY G;  3BU2 A;  3R2T A;  1PTO D;  3GTG H;  1XTC D;  4NXN Q;  3BG3 A;  4TQU S;  1HFN A;  5KNB A;  3CQZ B;  4MZ9 A;  1JE4 A;  1MSH A;  3MHB A;  3NWS A;  1WTH A;  1PYW D;  1KQS A;  5K5P A;  2NYZ D;  5JEA H;  4JVZ A;  1C48 A;  4R4I A;  4CDD C;  4JOI C;  1YNN D;  5DLQ E;  2E2J B;  3TME A;  1TWG H;  1IYJ B;  4H0L C;  4GLA C;  1PRT D;  4OIJ A;  1Y14 B;  5F2D A;  1BOS A;  4XDX A;  1B44 D;  4OGQ C;  4LFA L;  3S17 B;  1Y1W H;  1SYC A;  2EVB A;  4JW0 A;  2XTI A;  1EL0 A;  1II3 A;  2XSC A;  1RIP A;  3GDE A;  5FO8 B;  1UAP A;  2PYK A;  5M5X H;  1KIX A;  1VQF A;  2FIN B;  4IJL A;  3H15 A;  2UUC Q;  3EFX D;  1QE6 A;  2H5X A;  4DV3 Q;  2EJM A;  1G2T A;  5M9O A;  1L0X B;  3EJI A;  2QF7 A;  3PF5 A;  1KAB A;  3B6Y A;  1YIT A;  3S15 B;  3H09 A;  2F0H A;  1B53 A;  3E3X A;  3HOU G;  1X3P A;  3DWQ A;  2E2I B;  2KED A;  1AEX A;  2VL6 A;  3P20 A;  4G7Z C;  4ZKB B;  1KDC A;  1Q7Y C;  1FNW A;  1XX8 A;  1I4H A;  4UPA A;  1CSQ A;  4F87 A;  4HR7 B;  1FL0 A;  1XNQ L;  3PUX A;  1N32 L;  1GHJ A;  1EIF A;  4UY8 C;  1A6X A;  3E9I A;  3I8Z A;  1DON A;  3ZYY X;  4GNX A;  3P75 A;  4Q5V A;  1QVG A;  5C6A A;  1EIG A;  1TT2 A;  1XMQ L;  1G6P A;  4TKO B;  1EIH A;  4OHJ A;  2GVA A;  4UAI A;  4E6I A;  3W1B A;  3VDY A;  3OIP A;  4JI4 Q;  2K5H A;  3GTO B;  1VQ5 A;  4R4T A;  4QQB X;  1YIJ A;  4A3D G;  4IFD I;  1TWH H;  3NE5 B;  4A3C G;  3T1Y L;  1VQL A;  1A62 A;  2AQ3 B;  5ISR A;  1EFW A;  2H1E A;  2K03 A;  2K5D A;  3AFQ A;  3M9B A;  2MFI A;  1TWC H;  5C5M A;  1UUP A;  2JEB I;  1VQB A;  2VZA A;  4L5Q A;  5KEE A;  3GTK B;  2N78 A;  5C3E B;  1DZ1 A;  3PO3 H;  1STA A;  4L6T B;  5C4X H;  3FPP A;  2K4K A;  1SNP A;  3QO2 A;  1I94 Q;  4A3B G;  2WAQ E;  3F2C A;  3NPP A;  3KLR A;  2LMC B;  3FEW X;  5JAV A;  5AJ3 Q;  1YVC A;  3SK5 A;  3J81 E;  4A3E G;  1I4P A;  3CU7 A;  4L5R C;  1GHK A;  1ICW A;  4JG2 A;  4DKA C;  1FR3 A;  3E5S A;  1RTO A;  4X66 Q;  2HIX A;  1QUQ B;  1E0B A;  2YTX A;  2KHS A;  1VQD A;  2NN6 H;  5DAU A;  3E0J A;  1CQF A;  3RZO B;  3ERS X;  2VQE L;  4HCS A;  1Q86 C;  1T5X D;  4H13 C;  4JBM A;  2SDF A;  3QR8 A;  2EZV A;  1JMC A;  4IUQ A;  1NAP A;  1OXV A;  1L0Y B;  4Q0F A;  1JT8 A;  1EUJ A;  3CD6 A;  3X3M A;  3T16 A;  3GO5 A;  3BYT B;  4NXM Q;  3HOU B;  1STE A;  1DD2 A;  3FMC A;  5GRO A;  2RQX A;  1LTB D;  1EWI A;  5E3F A;  3I90 A;  1YNJ D;  3VR4 A;  4BY7 B;  4HED A;  2E74 C;  4JYA Q;  3I70 A;  4A93 H;  3V05 A;  5HGQ A;  2ICE C;  2BH2 A;  4YHH Q;  2A1A A;  1KL9 A;  1Q46 A;  1CKN B;  5M5Y H;  1LV9 A;  3HOU H;  2B2V A;  1O7I A;  4KMU C;  2N55 A;  1I50 H;  1G6Z A;  3L9A X;  3HOZ H;  2KUM A;  3PIP A;  4OO1 G;  3NTK A;  1MHW C;  1J5E Q;  2N8N A;  1CM9 A;  4G7O C;  4V19 0;  3D3R A;  3KLS A;  4OIK A;  3LWU A;  4EGV A;  4JI6 Q;  5JOB A;  2DY8 A;  4POF A;  1LAC A;  2KEE A;  3C1F A;  2AKW B;  1GUS A;  1PFM A;  4PQX A;  1Q8I A;  2R92 H;  2JA7 G;  1I6H B;  1PH2 A;  1VQM A;  2N3S A;  4DR1 Q;  1FVI A;  3HS0 C;  2NTT A;  4C3H H;  2KJX A;  3T1Y Q;  4K5X A;  3OWF A;  4WJW A;  4DV7 L;  3GTL H;  5EAY A;  1C4Q A;  2WFW A;  4OON A;  4LUO A;  1HPC A;  5E4W C;  3CME A;  1SSO A;  3H0G G;  4JI2 L;  3KK7 A;  1RJT A;  4GKJ L;  1LYL A;  2KBN A;  1F2Z A;  2A6H D;  3NEM A;  4MN3 A;  1X55 A;  1F77 A;  2QDL A;  1CUK A;  4QY7 A;  4BY1 H;  3MTS A;  4RGO S;  2A68 C;  3QJY A;  3WOF A;  1NCV A;  5I9P A;  1UE6 A;  1DOK A;  4B3R Q;  2RF4 A;  4ABN A;  3MWY W;  3HP3 A;  4RKB A;  3NTI A;  4RHS A;  1STB A;  4HMJ A;  2EJF C;  4R4C A;  1EYA A;  3DWA A;  3LX0 A; 
#chains in the Genus database with same CATH homology
 1CSP A;  3K81 C;  1M1K C;  1L1O A;  3S2D H;  1VQA A;  4DV1 L;  1Q1B A;  1X3E A;  4TVA B;  4X64 Q;  3UDG A;  3MXN B;  2N49 A;  1SMX A;  4R4Q A;  1MKH A;  2HIV A;  1Q8K A;  4H02 A;  4BA1 I;  3FKI H;  4P72 A;  1HZB A;  4GN5 A;  5IYD G;  4LF8 L;  4LF9 L;  1SRU A;  1SR3 A;  1GVP A;  2JJQ A;  4JI6 L;  5M3F G;  3TRE A;  3RLO A;  5FJ8 H;  1K83 H;  3F1Z A;  3JAM i;  3CCS A;  4DK3 C;  4IO9 A;  2VUM H;  1XNR Q;  5IP7 G;  1BKB A;  3F8T A;  4JBK A;  4MNO A;  1LUZ A;  3U58 A;  1VQ6 A;  1VQP A;  2HT1 A;  2YYZ A;  4JI3 L;  1ASY A;  1K3R A;  5IYD H;  1X3F A;  4A3G G;  4R1J A;  1GO3 E;  1P16 A;  2KEN A;  1QUQ A;  3HKZ G;  4C3I H;  4HJ7 A;  4JI0 Q;  2JA7 H;  3S16 H;  2VS1 A;  3G71 A;  2D0O A;  4B3T L;  3I4N G;  4A93 G;  2WB1 G;  3S15 H;  4JI8 L;  1K0R A;  3UDX A;  1VQO A;  1XMO L;  3CCM A;  4B3T Q;  3KJO A;  3AQQ A;  2AMC B;  1MIU A;  1GD7 A;  3BZK A;  3EIV A;  4LUV A;  4LFC Q;  2IY5 B;  3K8A A;  1XMQ Q;  3WWV A;  4GLX A;  4A3L G;  2B63 H;  3CPF A;  1IL2 A;  3KOJ A;  3TS2 A;  1JJG A;  2RHS B;  5C0X J;  3I7F A;  3H3V H;  2OCE A;  4DR4 L;  4WJ4 A;  1PH4 A;  1FGU A;  2PI2 E;  4BBR H;  3DLL A;  4GKK Q;  3HOY H;  2UXD L;  4BY7 G;  3S17 H;  1UWV A;  4C3J H;  1SE8 A;  2K50 A;  2PQA B;  4DR4 Q;  4X66 L;  3NEN A;  5GAD C;  3HOW H;  5GAG C;  3CCQ A;  1XJV A;  2ID0 A;  3TRZ A;  1VQJ A;  1YEZ A;  4KHP Q;  2YTY A;  3I2Z A;  4DK6 C;  5IWA L;  1RL2 A;  4GN4 B;  4JI4 L;  2ZJP A;  2K52 A;  4IPD A;  2K75 A;  4DV4 Q;  2LSS A;  4A3M G;  5AJ3 L;  4DR2 Q;  4LFB Q;  3M85 A;  2CCZ A;  5IYB H;  1HNX L;  2GN5 A;  4EX5 A;  3CCJ A;  4DR6 L;  4QIW E;  1IBK L;  2HQL A;  3EBE A;  1NY4 A;  2Z6K A;  1QZG A;  2E2J H;  4QL5 A;  2UUA L;  2JA8 H;  4DV7 Q;  1N33 L;  4YWL A;  3ULL A;  4KHZ A;  3TEH B;  2KHI A;  1YHB A;  4A3F G;  1JB7 A;  3HOV G;  2MQH A;  1PV4 A;  2E5L L;  3OYY A;  3MEF A;  4BA2 I;  4DUY Q;  1E3P A;  1E1O A;  1NMF A;  3HOZ G;  1TWF H;  1W3S A;  4PZ6 A;  3S1M H;  2K5V A;  4P73 A;  4DR3 Q;  5IYC H;  4QJF A;  5LMN W;  2OTJ A;  4ALP A;  4YY3 Q;  3Q8D A;  3F2D A;  2B3G A;  2I5L X;  2HHH Q;  1VQE A;  2Q2U A;  3FHW A;  2CQO A;  1LTL A;  3RLF A;  4LFA Q;  5LMN Q;  1PYB A;  4NXM L;  2PQA A;  3CF5 A;  3RR5 A;  4DR7 Q;  4IJH A;  3KLW A;  3ZJY C;  4IFD J;  4LFC L;  5M5W H;  5FLM G;  3A5Z B;  3PV0 A;  4FDB A;  3AFP A;  2PI2 A;  4DV2 Q;  3G4S A;  1EYG A;  2YTV A;  4PZ8 A;  4DUZ L;  4LF7 Q;  5K36 G;  1AH9 A;  3UE1 A;  4X64 L;  3PUV A;  2Y0S G;  1HZA A;  4DR7 L;  4JV5 Q;  5JJL A;  3PIO A;  4GOP B;  1Q82 C;  1UE5 A;  1AE3 A;  2QA4 A;  4HIM A;  1NTG A;  1N36 L;  4OWW B;  2ATW A;  2QGQ A;  4A3I H;  3GTP H;  3NEL A;  1I3Q H;  3J7A 5;  1HNW L;  2DGY A;  1HR0 W;  1I5F A;  2RHQ B;  4K0K Q;  2B63 G;  3TQY A;  3KJP A;  2EQS A;  3STB C;  4IOC A;  4BBS H;  4NXN L;  2CWP A;  2NN6 I;  1BBW A;  1MJC A;  4P74 A;  1IZ6 A;  2F52 A;  4AQY L;  3BJU A;  1X6O A;  3KFU A;  4JBJ A;  1TWA H;  4YHH L;  3S1Q H;  2WAQ G;  3PSI A;  4JV5 L;  4L5T A;  2AWO A;  4IPH A;  4GNX B;  3K0X A;  4GS3 A;  3L2P A;  5IP9 G;  1GM5 A;  2R7Z G;  4BXX H;  3W5O A;  2UU9 Q;  1VQ8 A;  1C9O A;  4A3D H;  1AE2 A;  4A3G H;  2BA0 A;  4RMF A;  3GD7 A;  3EN2 A;  3BZC A;  1XPU A;  1NMG A;  3KDF B;  3STB D;  2E8G A;  4B3M Q;  1IBM L;  3CQZ H;  1V43 A;  1B8A A;  1X54 A;  3I4N H;  4DV0 L;  2OQK A;  4PMW A;  3S24 A;  1B7Y B;  1D7Q A;  2BA1 A;  4X62 L;  5ELN A;  2JA6 G;  1VQH A;  4J15 A;  1L2F A;  5FJ8 G;  5C44 G;  1PFS A;  2R7D A;  2IHF A;  3I56 A;  4HJ9 A;  4A3F H;  1V9P A;  2L15 A;  3HOV H;  1IXR A;  1PH7 A;  3D0F A;  2VQE Q;  4DR5 Q;  4HJ5 A;  5C4X G;  4DV6 L;  2ALY B;  4IOA A;  2R7F A;  4DV5 L;  1PHJ A;  3M4P A;  2IX0 A;  2VQF L;  1UE1 A;  1X65 A;  2BH8 A;  4LW1 A;  2ZTC A;  3E0E A;  3K7A H;  2B29 A;  4YWK A;  4HIK A;  4A3E H;  1VQ7 A;  2E2H H;  4JI7 L;  2EIF A;  1C7Y A;  1I6H H;  2LXJ A;  2IHE A;  1XMO Q;  3ULP A;  2R93 G;  1D8L A;  1E24 A;  4UP7 A;  2UUB Q;  1I94 L;  4PG3 A;  4JI1 Q;  4JI2 Q;  2XGT A;  3RZO H;  1Y1V H;  1PH3 A;  4Y52 H;  4YCW A;  2UUB L;  3PO3 G;  4DR5 L;  1P8L A;  4JCV E;  2JA8 G;  3GTK H;  4A3K H;  1KD1 C;  2ES2 A;  3J81 j;  3FKI G;  3G48 A;  2VQF Q;  2NVT H;  3OTO Q;  3CC4 A;  3KDF A;  4POG A;  1S40 A;  1QZH A;  3HOX G;  2UXC L;  4YCU A;  4DAM A;  3HOY G;  3BU2 A;  3M4O H;  3GTG H;  4B3R L;  4NXN Q;  3NBH B;  1XPR A;  5IE8 A;  4TQU S;  2CWA A;  3CCR A;  1H95 A;  2KHJ A;  4MZ9 A;  1VQK A;  4LWC A;  4JI5 Q;  2LXK A;  4A3L H;  3U50 C;  3H0G H;  2Y0S E;  2NZH A;  4DV0 Q;  1HNZ Q;  4B3S Q;  3D31 A;  1YNX A;  1KQS A;  1VCI A;  1WJJ A;  5ELO A;  4R4I A;  1FJG L;  1EIY B;  4JOI C;  1YHA A;  3J80 i;  4LFB L;  3JC6 6;  2JA6 H;  3J81 i;  5DLQ E;  4GLV B;  2UXC Q;  4BY7 H;  2ZTD A;  2MO1 A;  1TWG H;  1IYJ B;  4BY1 G;  1JE5 A;  4GLA C;  3UDI A;  2YU9 H;  2OWO A;  5IT9 c;  4AYB G;  1SRO A;  4LF4 Q;  2F4V L;  1K8G A;  4A3J H;  1Y14 B;  4C2M H;  4JI8 Q;  4LUZ A;  3K80 C;  1KC8 C;  4JI7 Q;  3JAM c;  2UUC L;  1U0L A;  3CXC A;  4LFA L;  3PO2 G;  1MJE A;  1Z47 A;  5JJI A;  2KCM A;  5JEA J;  1Y1W H;  1HNZ L;  4B3S L;  2Q2H A;  4A76 A;  3FP9 A;  1WI5 A;  2XTI A;  4DR1 L;  4DR3 L;  4DV5 Q;  3HKS A;  1SN8 A;  2CKZ B;  1PVO A;  4PZ7 A;  3H3V I;  4HJ8 A;  1RIP A;  1IBL L;  3U4Z A;  2OQ0 A;  3GDE A;  5M3M G;  3J80 c;  3DM3 A;  1T9H A;  3L0O A;  4Y7N H;  4A4I A;  5M5X H;  2ZJR A;  3S2H H;  2F3I A;  1IBM Q;  3KF6 B;  4OO1 I;  1KIX A;  1VQF A;  3A5U A;  1KAW A;  4AIM A;  1Z9F A;  4IJL A;  3H15 A;  1XPO A;  2OTL A;  2UUC Q;  2H5X A;  1Q1E A;  4DV3 Q;  4DV2 L;  4A3I G;  4GOP C;  4DPG A;  3CPW A;  4X62 Q;  1DGS A;  3CMA A;  2E2I H;  2JA9 A;  3RNU A;  1WOC A;  2VUM G;  3PF5 A;  4DV3 L;  3B6Y A;  4A75 A;  1YIT A;  1J5E L;  1U5K A;  5IYC G;  1HNX Q;  5C3E H;  3TS0 A;  4LF5 Q;  3HOU G;  3HFZ B;  4OWT B;  1NE3 A;  1BVS A;  4HID A;  4YY3 L;  1NBW A;  2VL6 A;  4JI3 Q;  1HNW Q;  2HHH L;  1KRT A;  4X65 L;  4JOI A;  1W2B A;  1Q7Y C;  1S3O A;  4UPA A;  1CSQ A;  2NVX H;  1KXL A;  3PUY A;  1FL0 A;  4ME3 A;  1XNQ L;  3I4M G;  5C0X I;  3PUX A;  4P75 A;  1Y1W G;  1N32 L;  1EQR A;  1G51 A;  1L0W A;  2GVB A;  1EIF A;  4UY8 C;  5IYB G;  3GTO H;  3E9I A;  4DAY B;  5HY6 A;  4GNX A;  3CC2 A;  2ASB A;  1QVG A;  4LF5 L;  4LF6 L;  1SFO H;  1XMQ L;  3AEV A;  4YCV A;  5FLX c;  5C44 H;  1G6P A;  2R7Z H;  4BXX G;  4LF6 Q;  2DUD A;  1E22 A;  2AHO B;  2D0P A;  2GVA A;  2I5H A;  5IY0 A;  2VW9 A;  3W1B A;  3VDY A;  3RLN A;  4A3K G;  2K5H A;  3LGJ A;  1EQQ A;  1VQ5 A;  4JI4 Q;  4IFD G;  4DUZ Q;  4R4T A;  4QQB X;  1N32 Q;  1SLJ A;  1YIJ A;  4O0A A;  4A3D G;  4IFD I;  4IPG A;  1TWH H;  4A3C G;  3W1G A;  3T1Y L;  1VQL A;  1VQ9 A;  2R93 H;  1A62 A;  1EFW A;  2UXD Q;  2D62 A;  3AFQ A;  3M9B A;  2MFI A;  1TWC H;  4WJ3 M;  2UUA Q;  1X3G A;  2JEB I;  2VZA A;  1VQB A;  1K73 C;  5BR8 L;  4L5Q A;  5H1S E;  3CCU A;  2PMZ E;  2N78 A;  3KYH C;  4JI5 L;  2QEX A;  1K8A C;  1M90 C;  1C0A A;  1VQI A;  3ER0 A;  2JA5 G;  2E5L Q;  1B70 B;  3PO3 H;  4X65 Q;  5C4X H;  4QGU A;  3RZD H;  3KF8 B;  2K14 A;  2FXQ A;  2K4K A;  3RN5 A;  4A3B H;  1I94 Q;  1S72 A;  4A3B G;  1HJP A;  2WAQ E;  4OX9 L;  1V1Q A;  3F2C A;  4HJA A;  5GAH C;  5AJ3 Q;  1CKM A;  1KRS A;  4DR2 L;  3S1R H;  2JA5 H;  1YVC A;  3AYH B;  4OX9 Q;  1IBK Q;  5LMU L;  2NVQ H;  4DR6 Q;  4GNX C;  4A3E G;  4LNQ A;  4JI0 L;  1YJ9 A;  1FJG Q;  4APV A;  1G29 1;  1WCM G;  1YBY A;  2CFM A;  4L5R C;  3CCL A;  2ZTE A;  2RCN A;  4JG2 A;  1E7Z A;  4DKA C;  4A3M H;  1A63 A;  3CC7 A;  3CP0 A;  2HIX A;  4X66 Q;  1UEB A;  1WYD A;  4JBW A;  1QUQ B;  1XTD A;  3PGZ A;  1PYS B;  4MTN A;  1OXX K;  2YTX A;  1VQD A;  2PNH A;  3E9H A;  1YZ6 A;  1K9M C;  1XNR L;  3ERS X;  4UP9 A;  1X56 A;  3PCO B;  2YV5 A;  2JE6 I;  1LM0 A;  5IWA Q;  3PUW A;  2VQE L;  1Q86 C;  3CCV A;  2I0Q A;  3GTQ H;  4JYA L;  3PF4 A;  3A74 A;  1PH6 A;  1VS0 A;  4GKK L;  4LF8 Q;  4LF9 Q;  4JBM A;  5LMU Q;  1JMC A;  2NVY H;  2KCT A;  4A3C H;  1N8R C;  3S1N H;  1CKN A;  4BBR G;  4HIO A;  2UU9 L;  1OXV A;  4P71 A;  2ZJQ A;  4DNI A;  1JT8 A;  1EUJ A;  2K5N A;  1HR0 L;  3CD6 A;  2VY3 A;  5LMN L;  3GO5 A;  1OTC A;  4L5S A;  1CKO A;  4A3J G;  1NJI C;  4B3M L;  4NXM Q;  3HOW G;  2V1C C;  1HR0 Q;  5GRO A;  2JQO A;  1EWI A;  2NN6 G;  4NB3 A;  1OXU A;  1BBU A;  2EXD A;  4XTC S;  4YWM A;  5FLM H;  3OW2 A;  4A93 H;  4JYA Q;  4GN3 B;  3I55 A;  5HGQ A;  4AQY Q;  2BH2 A;  4KLK A;  1J6Q A;  4YHH Q;  3HKZ E;  3U4V A;  2A1A A;  4X6A H;  5BR8 Q;  2R6G A;  1KL9 A;  1Q46 A;  1WCM H;  2NZO A;  1CKN B;  1OXT A;  4XIG S;  5M5Y H;  1EOV A;  5JJK A;  1N33 Q;  1PA6 A;  2Z6K C;  3HOU H;  3CW2 C;  3KF6 A;  1O7I A;  2VNU D;  1I50 H;  5GQO A;  3K7U C;  1VQC A;  3HOZ H;  3UDF A;  1HZ9 A;  1X9N A;  3PIP A;  3J7Z C;  1PH1 A;  4UP8 A;  4OO1 G;  2A8V A;  1HH2 P;  4OXP A;  1J5E Q;  2IT1 A;  1PH9 A;  4LF7 L;  3GTJ H;  2N8N A;  1QVF A;  2ZM6 Q;  1Q81 C;  3I4O A;  3IRB A;  3RN2 A;  1Y1V G;  4LF4 L;  4EQ5 A;  4DV1 Q;  4JI6 Q;  5C4J H;  3ULJ A;  4KI0 A;  4POF A;  3I4M H;  2JEA I;  3S14 H;  4KHP L;  2AKW B;  5M3F H;  1WFQ A;  3M4Q A;  4O2D A;  1PH8 A;  4AH6 A;  1XNQ Q;  2Z0S A;  2R92 H;  2IX1 A;  2JA7 G;  1PH2 A;  4JC0 A;  1JJC B;  1VQM A;  3ICE A;  2JK8 A;  2A19 A;  1QVC A;  2N3S A;  4GKJ Q;  4DR1 Q;  1A0I A;  1FVI A;  4DUY L;  1HZC A;  3PUZ A;  2WP8 J;  5C3E G;  4C3H H;  3J81 c;  2UXB Q;  1KHI A;  3M3Y H;  3CAM A;  2Q2I A;  3T1Y Q;  2MNA A;  3T1H Q;  1VQ4 A;  3GTL H;  4DV7 L;  1R9T H;  3M7N A;  2F4V Q;  5EAY A;  2R92 G;  3OTO L;  3PO2 H;  1GKH A;  4NPS A;  1N9W A;  2WFW A;  4OON A;  1N34 L;  1VQN A;  4LUO A;  2C35 B;  1A8V A;  3CME A;  5M3M H;  1N34 Q;  3A0J A;  3H0G G;  4JI2 L;  3L7Z C;  4DV4 L;  5IP9 H;  4GKJ L;  1LYL A;  2KBN A;  2UXB L;  5C0X G;  5J3B A;  2WB1 E;  2I5M X;  2AWN A;  4IPC A;  1L1O B;  1E1T A;  4R4O A;  3G6E A;  4GOP A;  1YI2 A;  4RG1 A;  3NEM A;  2Q2T A;  1X55 A;  3GTM H;  1CUK A;  4QY7 A;  5GAE C;  4BY1 H;  3SGI A;  5E7N A;  3T1H L;  1N36 Q;  1L1O C;  1UE7 A;  1IBL Q;  1Q12 A;  1UE6 A;  2MO0 A;  5JEA G;  1YJW A;  4BBS G;  1OXS C;  4B3R Q;  2RF4 A;  1YHQ A;  1ASZ A;  4K0K L;  1VQG A;  4AYB E;  1JJ2 A;  3UE0 A;  1TXY A;  4OWX B;  3CCE A;  1PH5 A;  5IP7 H;  3F2B A;  3HOX H;  4R4C A;  1YJN A;  2ZM6 L;  4JI1 L;  4DV6 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...