3GTQH

Backtracked rna polymerase ii complex induced by damage
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtqH00
4DR4L 4A3FG 5JEAJ 3Q8DA 4DUYL 4OX9Q 4JV5Q 2RHSB 2ZJPA 1PYSB 2VY3A 4A3IH 2GVAA 3NELA 4HIMA 5M5YH 1KRSA 1Y1VH 3M3YH 3PUWA 3FP9A 1IBLL 2D62A 4ME3A 4GLVB 4DV0L 3AFQA 2Q2UA 1Y1WG 2A8VA 2R7FA 1TWCH 3CCMA 3HOYH 2VUMG 4OWTB 1PH1A 1I6HH 4B3TQ 4OO1I 5K36G 4YCUA 1MIUA 2NVYH 1U5KA 2VS1A 2WAQG 2RF4A 4J15A 5FLMG 5IWAQ 1SMXA 2JA5H 4O2DA 2E2IH 3HOZH 3PSIA 2ZJRA 4A93G 1BVSA 1NJIC 4DNIA 1Z47A 2AHOB 4POGA 4JCVE 2ES2A 1LTLA 3J81c 4BXXH 1N36Q 2KENA 1FJGQ 3CCEA 4OX9L 2CFMA 3G6EA 1PH5A 2ATWA 4JV5L 3D0FA 2PQAA 2ZJQA 3HOWG 1O7IA 1EUJA 2VL6A 1N34Q 4A3BH 1V9PA 1SR3A 1PFSA 4A3LG 3AQQA 4K0KQ 5JJKA 1X56A 1QUQA 1VCIA 4HJ5A 1OXUA 2CCZA 3PO3G 4BBSH 4WJ3M 3ER0A 4QQBX 4A75A 1PV4A 3KF6B 1UE6A 4L5RC 1SROA 4B3TL 3STBD 1L1OA 1P16A 2ZTCA 1AH9A 2HIXA 2D0OA 3HFZB 4AYBE 4DPGA 2CQOA 4BBRH 1B8AA 3H15A 2HQLA 1EQQA 3UDFA 4Y7NH 1HH2P 1YHQA 4IFDI 1N36L 2LSSA 1SE8A 4L5TA 3EIVA 3HKSA 4JOIA 4DR1L 2N8NA 1S72A 2WFWA 1TWAH 4PZ6A 4LF5Q 3I7FA 1N34L 3CMAA 2JQOA 2E5LQ 4K0KL 3KDFA 4DR3Q 1X65A 1YBYA 3PGZA 3M85A 1PH9A 3HOVG 1YITA 1K8AC 3PIPA 1VQOA 3D31A 1C9OA 4JI2Q 4JI3Q 2JJQA 4P75A 5AJ3Q 4A3KG 1EYGA 4X6AH 1K0RA 3RLOA 1YJNA 2WB1E 3UDXA 1LYLA 4JBKA 4BY7H 4C3JH 4X64L 4LF4Q 1VQ5A 1CKMA 3T1YL 2B29A 2PMZE 2Q2IA 3CMEA 3NENA 1X55A 3J81i 5C3EG 4B3ML 3CCVA 1V43A 3PIOA 4O0AA 5GROA 4GOPC 2KHJA 4LF5L 3G48A 2RCNA 1CKNA 1XPUA 4R4QA 2E5LL 1Q82C 2F3IA 1LM0A 5C4JH 1X3EA 1JJ2A 4HIDA 4DR3L 2ZTEA 1VQ6A 1D7QA 2LXKA 1PH7A 4JBWA 2F4VL 5GQOA 4LF7Q 4A3CH 4JI2L 4JI3L 4JG2A 3M4QA 1WCMH 4OXPA 2KCTA 5AJ3L 1Q86C 3CCQA 4A3FH 2C35B 4H02A 2R93G 2V1CC 1HR0Q 1XMQQ 1HZBA 1GM5A 2GVBA 4AYBG 3BZKA 3PUZA 1PA6A 5IYCG 1YI2A 4LF4L 3I4MH 4A3DG 4LW1A 2BH8A 3F2DA 4OO1G 1EIFA 2I5HA 4PZ8A 1VQEA 3UE0A 3CCJA 1UWVA 3CC4A 1JMCA 3GTQH 1T9HA 3E0EA 4JC0A 5IY0A 1X3GA 2VUMH 1DGSA 2B3GA 2NN6I 3PO2G 4NB3A 4IJHA 4UP9A 5FJ8G 1AE2A 5JJIA 3G71A 1D8LA 2XTIA 5IYDG 3F2BA 1PH3A 1PHJA 1WOCA 3S1NH 3KYHC 4XTCS 1RIPA 3I56A 1N9WA 5ELNA 1ASYA 4YWLA 1EIYB 4LF7L 3PV0A 4YWKA 4A3JG 1I50H 3GDEA 2Q2TA 5BR8Q 3K8AA 3KJPA 3BJUA 3CC2A 2JA8H 2PQAB 2WB1G 4DV2Q 1HR0L 3FKIG 1XMQL 3HOWH 1YJ9A 5C4XG 2YTYA 1CKOA 2YYZA 3B6YA 1E24A 5M5XH 3CD6A 3HKZG 1M1KC 3H0GH 3U58A 4LUVA 1XPOA 4DAMA 1NY4A 1QUQB 1WJJA 2ZTDA 3I2ZA 2JA6G 2UXBQ 5C0XI 4UPAA 1QVFA 5M3MG 4QGUA 1EFWA 3PO3H 3E9HA 2UUBL 4DK6C 1JB7A 5IYBG 3NEMA 3DM3A 1VQ7A 4LF9Q 4GNXC 2NVXH 1L1OB 5IP7G 4GKKQ 4IFDG 3PF4A 2JK8A 4UP7A 5GAGC 4JI4Q 2OQ0A 1OTCA 4A4IA 2VQEQ 5M3FH 1IBMQ 2VNUD 3KJOA 3I4NH 1V1QA 1XTDA 1JJGA 2VQFQ 1CSPA 1VQBA 5IE8A 3RNUA 5BR8L 3T1HQ 5IP9G 1JJCB 1PVOA 4B3RQ 5LMNQ 1GD7A 4DR7Q 2K5VA 2PNHA 5ELOA 4TQUS 4DV2L 1XNRQ 3A74A 1KHIA 4EX5A 4DR1Q 4GNXA 1B70B 3A5ZB 4AH6A 3KDFB 1X9NA 1IL2A 1WI5A 2B63H 3S24A 4IO9A 2UXBL 4KHZA 3L2PA 1X6OA 4A3MG 5C44G 3H3VH 3MEFA 1KL9A 1EQRA 2KBNA 4POFA 2ID0A 3AFPA 3KLWA 4LF9L 3K80C 4GKKL 3RLNA 1N32Q 3CF5A 2JE6I 4YWMA 4A3KH 3WWVA 3CCRA 1GVPA 4JI4L 1TWFH 2HIVA 4LUZA 1Q8KA 2VQEL 2ZM6Q 1IBML 2F52A 1CUKA 1FVIA 1UE7A 3PUYA 2UU9Q 3CCLA 3BZCA 2I5LX 3ULLA 1S3OA 4MZ9A 4UY8C 2VQFL 4DR6L 3RLFA 2GN5A 4BA2I 4X64Q 3T1HL 1S40A 1U0LA 3L7ZC 3T1YQ 1K83H 1W3SA 3STBC 2A1AA 2R7DA 5LMNL 1MJEA 4DR7L 4B3RL 4HJ8A 2K5NA 4A3IG 1XNRL 1P8LA 1CKNB 2IY5B 4DV6Q 1GO3E 1Y1VG 2AMCB 4IJLA 3ULJA 4HJ9A 1IXRA 1HNZQ 2IHFA 4GKJQ 4A3GH 2Q2HA 4EQ5A 4PZ7A 2Y0SE 4QIWE 1Y14B 1G291 2DUDA 3S16H 2R92G 4C3HH 3HOYG 2K4KA 2F4VQ 1WCMG 1R9TH 4HIKA 1N32L 2NZHA 2K14A 1YEZA 3HOZG 2ZM6L 3BU2A 2UU9L 2R6GA 3UDIA 4X62Q 2XGTA 4DV4Q 4A3EG 1IZ6A 1QZHA 2NN6G 3HOUH 4NXMQ 1XJVA 1Q1EA 2DGYA 2OQKA 3K0XA 4A3DH 1HNWL 4Y52H 1MKHA 3GTKH 1HJPA 2WP8J 4BXXG 2BH2A 1E1OA 1X3FA 2L15A 4DR2Q 4JI0L 2CWPA 1I5FA 1QVGA 1J5EQ 3F8TA 2OTLA 3M9BA 4UP8A 3OTOQ 3KFUA 2NVTH 2FXQA 3PO2H 4DV6L 3S15H 2JEBI 1XMOQ 1E7ZA 1QZGA 4JI7Q 1HNZL 1VQCA 4GKJL 2UXCQ 3I4OA 1Z9FA 1VQLA 3M7NA 4P71A 4A3JH 4OWXB 1KRTA 4P73A 1HNXQ 4LFBQ 1E3PA 2YV5A 5C0XG 1A8VA 4OWWB 4IPCA 4DK3C 4NXNQ 2PI2E 3FKIH 4X62L 4JI8Q 4DV4L 5GADC 1XPRA 3M4OH 1NMFA 4NXML 1NBWA 4GOPA 5HGQA 1LUZA 3M4PA 4P72A 4DV1Q 3IRBA 3SGIA 4DR2L 1YHAA 2QGQA 1HZ9A 4FDBA 1J6QA 1KC8C 2PI2A 5IYBH 1Y1WH 1J5EL 2JA7G 3OTOL 2UUBQ 3CC7A 3F1ZA 1Q81C 1YVCA 1HZAA 1OXVA 1XMOL 1PYBA 4JI7L 4GN5A 3CW2C 3UDGA 4JI5Q 2UXCL 3OYYA 1Q7YC 5FLMH 1OXXK 4DV5Q 2R7ZG 2Y0SG 1NMGA 1KIXA 2IHEA 4A93H 3A0JA 5GAHC 2LXJA 4QY7A 1HNXL 4LFBL 2E2HH 5IP9H 1VQNA 1YZ6A 4GN3B 4R4IA 2VW9A 1GKHA 2CWAA 3RZDH 1HR0W 4P74A 2JA9A 4QL5A 2NZOA 5E7NA 3CP0A 1VQDA 4NXNL 4JI1Q 1VQ9A 4XIGS 4IFDJ 4JI8L 1Q12A 3S2HH 4ALPA 4RG1A 4LFAQ 1VQ4A 4DV1L 3CQZH 4A3MH 4A3LH 5C44H 2EQSA 4R4CA 2Z0SA 4MTNA 2IX1A 4IPHA 3S17H 3KF8B 1VQ8A 1YJWA 1JT8A 2OTJA 3W1BA 2RHQB 5EAYA 1E1TA 1UEBA 4JI5L 2BA0A 5IT9c 4BY1G 5LMUQ 1AE3A 4DV5L 4HJ7A 4LF6Q 1WYDA 2HT1A 1TXYA 2HHHQ 3TQYA 1N8RC 4A3CG 4DKAC 1RL2A 4IPGA 4DR6Q 4YHHQ 3K7UC 2BA1A 1B7YB 1QVCA 1PH4A 3K7AH 2MFIA 3HOXG 5H1SE 3PF5A 1FL0A 4JI1L 1EWIA 4DV7Q 4YY3L 4JBMA 3J7ZC 3GTOH 2EXDA 4X66Q 3GTGH 3PUVA 2AWNA 3I4MG 3RZOH 1BBWA 2QEXA 2N78A 3AYHB 4LFAL 4LUOA 1N33Q 2NVQH 1VQJA 4R1JA 3JC66 4LWCA 1YIJA 1BBUA 2K52A 3CPFA 3TS0A 2R92H 3J7A5 1MJCA 2K50A 3HOVH 1K9MC 4PG3A 1VQAA 5JEAG 1OXTA 1X54A 1WFQA 4RMFA 1SN8A 3RN2A 3ULPA 4JYAQ 3J80c 1YHBA 5LMUL 1I94Q 1VQIA 2IX0A 3GTJH 3CPWA 4A3EH 1Q1BA 4LF6L 2HHHL 3GD7A 4QJFA 4YHHL 1L1OC 3FHWA 5LMNW 1HNWQ 1H95A 5GAEC 2JA8G 4LNQA 3UE1A 3KOJA 1Q46A 5C3EH 4DV7L 4KHPQ 4KLKA 4JI0Q 4X66L 1NE3A 1C7YA 1K3RA 3H0GG 2UUCQ 3CAMA 3JAMc 1N33L 4MNOA 3RN5A 4LFCQ 1JE5A 2AKWB 4B3SQ 4YCVA 5M5WH 3GTLH 4JOIC 2CKZB 1OXSC 1VQKA 1CSQA 2K75A 4YCWA 2H5XA 4A76A 1W2BA 2ASBA 1UE1A 1G51A 1TWHH 4JBJA 2QA4A 4IOCA 5IWAL 1A63A 4DAYB 1FGUA 4JYAL 5M3FG 2UXDQ 1I94L 3ZJYC 2JA5G 3TRZA 3I4NG 2R93H 4GOPB 1PH2A 3TEHB 2YTVA 3L0OA 2UUAQ 1A62A 5IYCH 3GTMH 1SLJA 1C0AA 3LGJA 1FJGL 1IBKQ 4JI6Q 2ALYB 3PUXA 1E22A 1VQGA 2I5MX 3ICEA 1TWGH 2JA7H 1K8GA 1PH8A 3TS2A 2MO0A 5C0XJ 4LF8L 4KHPL 2E2JH 2MO1A 2B63G 4X65Q 2UUCL 1EOVA 1NTGA 5J3BA 3GTPH 4GS3A 3K81C 4LFCL 5FJ8H 4A3BG 3OW2A 3U50C 4B3SL 2JEAI 3MXNB 2R7ZH 4PMWA 4GN4B 3EBEA 2EIFA 2AWOA 4OONA 3J81j 3S1QH 5IYDH 2I0QA 4GLAC 4BBSG 5JJLA 3A5UA 1VQPA 3W1GA 2MQHA 4L5SA 3E9IA 3KF6A 4TVAB 3S14H 2OCEA 4C2MH 2UXDL 3I55A 3GO5A 3J80i 4HJAA 1A0IA 3HKZE 4NPSA 3NBHB 2UUAL 5C4XH 4BBRG 1IBKL 3TREA 4DV3Q 4JI6L 1G6PA 4WJ4A 1L0WA 4AQYQ 2JA6H 1L2FA 1IYJB 3ERSX 4HIOA 1XNQQ 1VS0A 2KCMA 1VQHA 5M3MH 4DUZQ 3S2DH 1M90C 1HZCA 3CCSA 4X65L 3JAMi 5IP7H 4IOAA 2WAQE 4A3GG 4BY1H 1SRUA 4DR5Q 1KAWA 4GLXA 5FLXc 1KQSA 3G4SA 1BKBA 5HY6A 2Z6KC 4R4OA 2VZAA 4BA1I 1VQMA 4B3MQ 4LF8Q 3HOXH 4AIMA 2A19A 3DLLA 2N3SA 3S1MH 2D0PA 3CCUA 3U4VA 1PH6A 4DUYQ 3EN2A 4DR4Q 3H3VI 3HOUG 2K5HA 4YY3Q 4BY7G 4GNXB 3W5OA 3U4ZA 4L5QA 3S1RH 1KD1C 4KI0A 3PCOB 4APVA 3F2CA 4DV3L 1UE5A 5DLQE 3RR5A 4AQYL 1IBLQ 1XNQL 4DV0Q 1VQFA 4DUZL 2OWOA 3VDYA 1K73C 1ASZA 2Z6KA 2KHIA 1SFOH 2IT1A 3AEVA 2YTXA 4DR5L 1YNXA 2YU9H 4R4TA 4C3IH 3CXCA 2MNAA 1I3QH 2N49A 2E8GA 4IPDA 1KXLA
chains in the Genus database with same CATH superfamily
3J80L 4DR4L 2EYMA 2RHSB 2VY3A 3T51B 3SK5A 1PRTD 3NELA 3QOLA 1UUPA 4HIMA 1STBA 4IZ8A 3M3YH 4DK1A 4U68A 2QCPX 1K0SA 2XWBB 4XYQA 4O1NA 2A8VA 3K5LA 2R7FA 1PTOH 1JWMD 1TWCH 2IJ0A 4TKOB 5K36G 4OO1I 4YCUA 1LTSD 1QCBD 4DFAA 3S16B 3NP8A 3VR3A 4O2DA 3D3RA 3PSIA 4A93G 4FF2A 1UNSA 4DNIA 5CBAE 2A6HD 3OHXC 2L4NA 5G3LF 1LTLA 4BXXH 1N36Q 2KENA 3G6EA 4JV5L 2EZVA 3HOWG 1AZPA 1DD2A 1V9PA 2MJ8A 1QUQA 2CCZA 4HJ5A 3PO3G 1FNUA 2SOBA 4DK0A 2K1BA 2B8FA 1PV4A 1JCKB 1UE6A 1HPCA 2F0VA 1L1OA 1AH9A 2HIXA 3WOFA 2NUCA 1YNJD 1B8AA 1BQQT 3IFTA 5C5MA 4Y7NH 3DXJC 1PTOF 2LSSA 3PMFA 1A3VA 1K28A 4LF5Q 3I7FA 5FKAC 3OW7A 3CMAA 1N34L 3IL8A 3SR1A 3KDFA 1SYDA 3M85A 2IWHA 1LTTD 1C9OA 4JI2Q 4P75A 1EYGA 4X6AH 1K0RA 1G91A 2KEDA 4E6IA 3VYTA 3E0JA 3FRPB 4HSVA 2E2HB 1CKMA 2PPBC 4FNFA 1IW7D 2CW0C 4LMQD 3K0YA 4O0AA 2MPMA 2RCNA 2E5LL 1Q82C 5C4JH 1X3EA 1JJ2A 4DR3L 5ELEA 2ZXPA 2EOTA 2NBFA 4OXPA 5EBCA 1AW7A 2LKVA 1Q86C 3CCQA 4A3FH 1EY9A 2I46A 1HZBA 1GM5A 1PA6A 1EIFA 3FMCA 1OO9B 1BCPB 4IQZA 3CCJA 1UWVA 3NXWA 3E0EA 1D2BA 4KN7C 4K6DA 4NB3A 5FJ8G 4KK7A 1HFGA 3F2BA 1PH3A 3S1NH 3KYHC 1RIPA 3I56A 4LF7L 2ICIA 4RWSC 4K8IA 1DOMA 1TWFB 3KJPA 3GTJB 3CC2A 2TMPA 2NTTA 1HR0L 3FKIG 2YTYA 4H0LC 3CD6A 1PZKD 2Z4HA 5JAVA 1M1KC 3U58A 5ELBA 3I2ZA 2JA6G 5C0XI 2A69D 3A8KE 1QVFA 1E0BA 5IYBG 3NEMA 3DM3A 4ODGA 1QNUA 1CQFA 2NVXH 1IHZA 4GKKQ 1QG7A 4IFDG 2ZXRA 3E5SA 3NWSA 3JAML 4JI4Q 1OTCA 4FYDA 2RBMA 5M3FH 2VNUD 3KJOA 4XXEA 3QJYA 3K57A 4UAIA 1SNQA 4RH6A 1VQBA 2Q8IB 4QCLA 3CHBD 2R93B 1CTMA 5ELOA 1JE4A 4TQUS 3I4LA 2PQEA 4AYBB 3AB9A 4EX5A 4DR1Q 4GNXA 3GTKB 2JXMB 1WI5A 3S24A 1RODA 1TWGB 1X6OA 4WRDA 4A3MG 4H7BA 1SYEA 3MEFA 1XYIA 2E2JB 2KBNA 3GTPB 5EKIA 1A2UA 4LF9L 3CF5A 4YWMA 5J22A 3WWVA 3CCRA 3DUZA 1GVPA 1IBML 1FVIA 1UE7A 4ZKCB 3DWAA 2VQFL 2DNEA 4X64Q 1S40A 2ZXOA 1U0LA 1GUWA 2KJXA 1MJEA 1W3SA 4B3RL 4A3IG 1GHJA 3M4OB 1P8LA 3H6MA 2G5DA 2IY5B 1EU4A 1GO3E 2AQ1B 2AMCB 1HNZQ 1B9NA 2IHFA 4FXGC 1H9JA 5M3MB 2Y0SE 2XWJB 3ZYYX 1G291 4ULLA 3S16H 2K4KA 1N32L 2NZHA 2ZM6L 5M9OA 3UDIA 4X62Q 4A3EG 1EYCA 1IZ6A 5FLXL 3K0XA 1SYBA 4Y52H 1UEAB 3SK6A 1HJPA 2WP8J 2BH2A 5ELDA 2F0FA 2L15A 4DR2Q 4DGZA 4JI0L 5LL6X 2Z1CA 1I5FA 1EEFD 1QVGA 3F8TA 3KFUA 3OTOQ 4HMIA 2F0GA 1JR0D 2JEBI 1PZID 1E7ZA 4I7ZC 5EKKA 3OWEB 1U4LA 3I4OA 4FVMA 4P71A 2F0IA 3I3CA 5JPNC 4IUQA 4LJZC 2RA4A 1LTGD 4C3IB 3FPUB 1EQTA 3VA5A 5CBEE 4C56C 1CFMA 5GADC 4L8JA 1NMFA 1NBWA 2GA4B 1G2SA 1TS2A 1LUZA 5HGQA 4P72A 3NK9A 3IRBA 3D6CA 5KIXA 5C4ZA 1HZ9A 4FDBA 5IGFA 2PI2A 2JA7G 1Y1VB 2NZ1D 3N6RA 1Q81C 1XMOL 1Y69U 1Q7YC 4QUFA 2Y0SG 3MA2B 2D2CC 3OMGA 2LXJA 1QE6A 5IGBA 2E2HH 2JA5B 2WKDA 5IP9H 1MBYA 4JI1Q 2JA9A 2Z9HA 5BN5A 1PFNA 1SYCA 3HZXA 1DJRD 5T1GA 5I6YA 3X3MA 4DV1L 2F1MA 2Z0SA 4IPHA 1LLRD 2OTJA 3W1BA 2F0QA 2CHBD 4PQXA 4OIKA 5EAYA 1BOSA 5M5WB 5CC4A 4HJ7A 2M2LA 1TXYA 5LHY1 1N8RC 1WD1A 5IT9E 4DR6Q 3K7UC 1B7YB 4HN7A 1EWIA 4JBMA 2EXDA 4X66Q 3I4MG 1AZQA 2DJFC 2XVSA 4LUOA 2NVQH 1VQJA 3JC66 4LWCA 1BBUA 1STEA 3CPFA 3J7A5 2KVMA 2R61A 4PG3A 1NCVA 5JEAG 1WFQA 3LWUA 2Z6BA 2R7ZB 1LTBD 3J80c 2IX0A 3GTJH 3CPWA 2B2WA 4QJFA 2PZUA 4LNQA 3KOJA 1Q46A 1SE3A 2F3WA 4IUVA 4K2LA 3J81E 1Z6HA 3QO2A 2XRSD 2HCCA 1SJHD 1VQKA 1OXSC 3I8ZA 1CSQA 5KYIA 2HUGA 3PIP3 1EY0A 1W2BA 2ASBA 1G51A 4JBJA 1Y8PB 2QA4A 2J4XA 3I73A 4BY1B 4DAYB 4EVOA 2EY5A 2CH4W 3VR4A 4ZKBB 2R93H 3TEHB 5IYCH 3GTMH 1SLJA 2Z4IA 2X6LA 3N52A 2EY2A 1TWGH 3PIO3 1PH8A 1K8GA 2MO0A 5C0XJ 2C5CA 2E2JH 3S1RB 1TS3A 3L3OC 3GTPH 1NTGA 4A3BG 3SDZA 1IKLA 1PMRA 3OW2A 2L1BA 4GN4B 3EBEA 2EIFA 3S1QH 3J81j 3DEPA 2B2TA 1IW7C 5ELCA 1Q8IA 1DONA 4ZYSA 2CW0D 4L5SA 3KF6A 1BR9A 4TVAB 4MN3A 4C2MH 2UXDL 3I55A 3J80i 2YU9B 1O78A 2K05A 3HKZE 4RKBA 4NPSA 2RSOA 2UUAL 4PMBA 1I3QB 1BUVT 1M4VA 3TREA 4JI6L 5KNCA 4WJ4A 1L0WA 3HOWB 5KGUA 1IYJB 4HIOA 1VQHA 5M3MH 4DUZQ 2XSCA 1M90C 3DWPA 1HZCA 1SNPA 3BVMA 4X65L 1KLUD 3Q24A 1C8CA 2WAQE 4A3GG 1SRUA 4KKTA 1KAWA 4DR5Q 4C3HG 2PW7A 1TWCB 4BA1I 1S5BD 4AIMA 2A19A 3I4NB 4DR4Q 3C1FA 3CCUA 3U4VA 1LO5D 2X69A 1PRTB 1RDPD 1VMCA 4KI0A 1EQVA 3PCOB 3F2CA 2A73B 1DCZA 4M8AA 1VQFA 1U4MA 2OWOA 2B63B 1K73C 2XNAC 2KHIA 2F0KA 3C3LA 5J1ZA 4G57A 4C3IH 2MNAA 1B44D 1EY5A 2N49A 3U9OA 1ZYRD 3Q8DA 4DUYL 4JV5Q 2WACA 3EROA 3UI2A 1KDCA 2F0WA 4Y7NB 1Y1VH 3PUWA 5JJZA 1D5MC 1H9MA 4ZCKA 4KY7A 5KNDA 1IBLL 2V4DA 2L55A 1Y1WG 1BF4A 2Q2UA 4JVZA 2EYLA 3CCMA 2VUMG 1YNNC 1WTXA 2WAQG 2JA5H 1HQRD 5IWAQ 4QIWB 2ZJRA 1SBBB 1Z47A 5I6WA 2AHOB 3CKIB 1NR2A 1FJGQ 4OX9L 1PH5A 2ATWA 5KEEA 2ZJQA 1WD0A 2B2VC 1EUJA 1N34Q 1LABA 1SR3A 4A3LG 5JJKA 3VA7A 1OXUA 2EVBA 4OHJA 4QQBX 4KKSA 4B3TL 5C4JB 1ILQA 5C0XH 4OEMB 2ZTCA 5DNFA 1K3BC 4BBRH 3KBGA 3H15A 2HQLA 5AFWA 3UDFA 1YHQA 1HH2P 4A3FB 1H9KA 3TBIB 3HKSA 3FEWX 2N8NA 1SSOA 1S72A 2WFWA 4PZ6A 2EJGC 4V190 2E5LQ 3R93A 5JOBA 4K0KL 4DR3Q 1JORA 1YBYA 4YIJA 4UDUC 3NUCA 1YITA 1K8AC 3D31A 4CKBA 2RCFA 2OXPA 4A3KG 1YJNA 3S1NB 1LYLA 3EFXD 4JBKA 4C3JH 1AP0A 1VQ5A 3T1YL 3CRKC 5ISRA 2RKSA 3CCVA 1B53A 4K5VA 5GROA 3I72A 1CKNA 2ZTEA 1D7QA 4JBWA 2F4VL 5GQOA 4LF7Q 4A3CH 2NVXB 1WCMH 3P1HA 5AJ3L 2EYFA 3MZ5A 2H4OA 4XDXA 4H02A 2F03A 1NAPA 1HR0Q 2A68C 2N55A 1WTHA 3BZKA 3PUZA 5CR3A 4A3DG 1YI2A 1C48A 3TP6A 1PFMA 4FF4A 5EQ0A 4PZ8A 4L63B 1QWYA 1EZ6A 5NUCA 3RZOB 5LL6S 3I90A 1A6XA 5IY0A 2EYJA 3S9WA 3VYSA 4RHRA 3PO2G 1AE2A 5JJIA 2HCIA 3HOVB 2KCNA 4Q5VA 3E3XA 2SNSA 1N9WA 5ELNA 1ASYA 1B3AA 4A3JG 2Q2TA 4V0BA 3A7LA 2K32A 3W3AA 4OELB 3HOWH 4XT3B 5C4XG 3B6YA 4F7XA 1I4QA 4LUVA 2R3ZA 5C3EB 1BDOA 1QUQB 1WJJA 3SK4A 3PO3H 2X6GA 2UUBL 1JB7A 4LF9Q 4GNXC 1L1OB 2JK8A 5GAGC 2OQ0A 1ZXTA 2LMCB 4NMZA 3A54A 1TIID 1IBMQ 3QWNA 4FXDA 2L0CA 3I4NH 5I4DA 2VQFQ 3BVZA 4RA8A 5ELFA 4B3RQ 4CDCC 2AUKA 4J8QA 4DV2L 2CVRA 1GHKA 4KN4C 3A74A 1KHIA 2BDNA 1X9NA 2B63H 3KDFB 4IO9A 2F0LA 5C44G 3EJIA 2ID0A 3KF8A 1N32Q 1SDFA 2ZM6Q 2EPBA 3CCLA 1V1PA 1U9RA 3P20A 4MIUA 3ULLA 4UY8C 2B2VA 4L6TB 1HXYD 1K83H 2WB1B 2JSOA 4DR7L 2EXZA 4IN3A 4HJ8A 4R8NA 1JWUD 5L37A 2PMZB 4IJLA 3ULJA 4HJ9A 2CQAA 3TDQA 2Q2HA 3JAME 4KKUA 4QIWE 1PRTF 2DUDA 2R92G 1S5ED 2E8GA 1STAA 3D4DA 3QG1A 1RJTA 2BE5C 3BU2A 1RKNA 2R6GA 2XGTA 1F9SA 2NN6G 1XJVA 2DGYA 4KMUC 1HNWL 1EIGA 3S1MB 4BXXG 2PZTA 1E1OA 1AEXA 1PYWD 2NWGA 3E6ZX 2CWPA 4CJ1B 5IGDA 1Q3LA 4DV6L 3HS0C 1IL8A 2XRQD 1XMOQ 1QZGA 1VQCA 2E76C 3BS1A 4GKJL 2IW3A 2PNRC 3D6WA 1MGSA 2VXWA 4IUPA 4P73A 1SFOB 5E4XA 3MXGA 4R8IA 4QMGA 3BG3A 3W2DA 4DK3C 3FKIH 1CHQD 4DV4L 4NXML 1STYA 1EY6A 4DV1Q 1T5EA 3SGIA 1J5EL 1KC8C 5IYBH 5M5YB 1EWCA 3GP7A 3KUPA 1YVCA 4JI7L 2NVQB 1PYBA 2OEOA 4GN5A 3CW2C 2UXCL 5FLMH 1ICWA 1KIXA 1NMGA 3HOYB 1I6HB 3A0JA 2F0JA 4QY7A 5EBDA 4LFBL 5FLXE 5JVG3 1YZ6A 4DA2A 3HOZB 4ZRZA 4P2CB 4P74A 1KDBA 1VQ9A 4JI8L 1Q12A 2G9HD 3S2HH 2I07B 3AMUA 4RG1A 1VQ4A 1CK1A 4A3MH 5C3WA 1CA5A 2EQSA 1DXMA 2IX1A 1TY2A 1YJWA 1ZYRC 1EWHA 2RHQB 3ITPA 4TRDA 1E1TA 1MSHA 2WIIB 5IT9c 1A3TA 2KA7A 2LS01 4B9XA 1JOOA 2BA1A 1QVCA 3HOXG 2XN9C 3J7ZC 1SJED 3U9SA 1EY8A 1FYCA 2AWNA 1YNND 2B2WC 3PUVA 3QB3A 3RZOH 3GTMB 3TP8A 3QOJA 2ICEC 5KRUA 5HGTA 1EOTA 3T56B 1TWAB 3TS0A 4EQOA 2WV6D 3HOVH 1W6KA 1VQAA 1OXTA 1X54A 4RMFA 1SN8A 2K7VA 3S1QB 5LMUL 5FK9C 1VQIA 4LF6L 4A3EH 1Q1BA 2HHHL 2E2DC 2MGSA 5LMNW 4YHHL 3FHWA 4C2MB 3ND8A 2EY6A 1LTID 5C3EH 2N88A 1C7YA 1K3RA 3CAMA 1N33L 3RN5A 1ET9A 2AKWB 2QEJC 3OIQA 4JOIC 2CKZB 1EU3A 3I91A 4YCWA 1PDQA 1UE1A 2D9UA 1A63A 4CJ0B 3V2TA 4JYAL 5M3FG 2UXDQ 4B9WA 4UHVA 2B2TC 2YTVA 2UUAQ 2E75C 2SDFA 1A62A 4QF4A 3RMHA 1B3QA 1C0AA 4JI6Q 2ALYB 3PUXA 1E22A 1VQGA 2I5MX 4N8X1 4N9TA 4XT1B 3T13A 2JA7H 4KHPL 3HP3A 1T5XD 3LWEA 4RGNA 3O13A 1ET6A 2MO1A 4X65Q 2UUCL 4GS3A 2PZWA 3R8BA 3U50C 3NTIA 1HQMC 4PMWA 3GTQB 5IYDH 4OONA 4NDXA 1ENFA 3T53B 4BBSG 2FJ2A 5JJLA 3FDTA 1I4XA 1G6ZA 3E9IA 2QDLA 2RDFA 1V1OA 4RGTA 1SNOA 3GO5A 1B4OA 1I50B 1HA5A 4PV1C 4WORA 3DHQA 2JA8B 1IBKL 3Q22A 4RFBA 5EGTA 1L2FA 1HUMA 2KCMA 4ZK9B 4JPBW 3BVGA 3H0GB 4ZUIA 4ID6A 2KOLA 5IP7H 1GOZA 3TZDA 4K6LA 2A68D 3L9AX 5I9OA 1BKBA 3D4WA 3S1MH 3DLLA 1PH6A 4DUYQ 2BDOA 1F2MA 2K5HA 1B9MA 4YY3Q 4BY7G 1STGA 4L5QA 2EY1A 3MFYA 4B08A 2ZT9C 1F9PA 4DV3L 4HEDA 1IBLQ 4G7OC 1II3A 2Z8LA 2NYZD 1PLFA 1ASZA 1STNA 3TMEA 1SFOH 1GUTA 2IT1A 4OL7A 2HDMA 2FMCA 3DEOA 3ERQA 3C1EA 1R4QB 4CGYB 5CMDA 5D3DA 4OX9Q 3MAQA 1PTOC 2ZJPA 2K03A 5E3FA 1KNAA 4BBRB 2GVAA 3ONAB 5M5YH 1KRSA 3NE5B 3FP9A 2D62A 4KV6A 1HUNA 3AFQA 3TN2A 3HOYH 1I6HH 1PH1A 4B3TQ 1F2YA 1Q90A 2NVYH 1EEID 4J15A 4ZLTF 4KTAA 1G2TA 3HOZH 3KBXA 3AU7A 1R9TB 4XQQA 4POGA 4JCVE 2M00A 3OSOA 1D5ZC 4OGQC 2PW5A 3GV3A 3CCEA 3HOUB 4A3DB 2CFMA 2K28A 1QJOA 1STHA 2PQAA 4C3JB 1O7IA 3K5OA 4A3BH 2LY7A 1WTWA 1U4RA 2B39A 4JW0A 3AQQA 4K0KQ 1CT1D 1FD7D 3MC0B 1WVLA 1EY7A 5KYLA 4WJ3M 3KF6B 4L5RC 1SROA 1P16A 3VYUA 3HFZB 2D0OA 3T4AC 4AYBE 1KNEA 2HDLA 2CQOA 2WINB 1WCMB 2FFKB 1EQQA 2JYOA 2F0NA 4IFDI 1LTAD 1SE8A 1D1IA 1WTPA 1MI2A 4JOIA 4DR1L 1TWAH 2PYKA 1NUCA 2HQEA 2QF7A 2JQOA 2BE5D 1SAPA 1X65A 3PGZA 4CDEC 1A3UA 1QOHA 5AJ3Q 3RLOA 4A93B 3H94A 1BNZA 4X64L 5J39A 3RZDB 2B29A 2BOSA 2Q2IA 1X55A 4G7ZC 1LTRD 1V43A 2IX3A 4GOPC 1SNMA 4KJNA 2KHJA 3CQZB 1XPUA 4R4QA 2F3IA 1LM0A 3PO3B 2LXKA 1PH7A 2F4IA 5IGEA 2RVLA 1E2VA 1L0XB 3M4QA 4JG2A 4JI3L 4R9WA 3K58A 2KCTA 4HSPA 3NTHA 2R93G 3SXHA 4G7HC 5IT9L 1HA6A 2GVBA 4AYBG 4BS9A 4LF4L 1R4PB 5IYCG 4OO1G 2F0MA 4LW1A 2BH8A 3F2DA 1J8IA 3GTOB 3I70A 3GTGB 4DF7A 3GTQH 1T9HA 2VUMH 1X3GA 1ESFA 4UP9A 3G71A 3VR2A 3EVQA 4LK1C 1O80A 4XTCS 3HGBA 1HTPA 1KTKA 4MHEA 4YWLA 3SHLA 1I50H 3GDEA 3QR8A 4J6HA 3K8AA 4CHTB 2JA8H 1TT2A 4DV2Q 1XMQL 3GV6A 5M5XH 1E24A 5EPLA 3HKZG 3H0GH 1K83B 2ZTDA 4DAMA 1LACA 2EYHA 4UPAA 5M3MG 4QGUA 1EFWA 2O5JC 4CKEA 2FINB 3BYYB 3GTLB 3PF4A 4A4IA 3A8IE 3K5MA 1GXDC 1JJGA 1C4QA 1CSPA 5IE8A 5BR8L 1PVOA 1GD7A 4DR7Q 1CZGA 4KY5A 5IIFA 4ABNA 1IL2A 2UXBL 1TQOA 4KHZA 1KABA 1K8MA 5IOCA 1KL9A 1S5FD 5IODA 1EYAA 1XX8A 2J0TD 2JE6I 4A3KH 1EL0A 3TZUA 2HIVA 2VQEL 2F52A 1CUKA 4C3IG 3BZCA 3J80E 2A5HA 2FHTA 2I5LX 4RGOS 4MZ9A 4DR6L 3MVVA 3RLFA 2GN5A 3T1HL 3L7ZC 3STBC 2A1AA 5LMNL 4K5WA 4XYOA 3FKIB 3A55A 4ZUJA 4FO2A 4CKCA 1XNRL 1CKNB 2HD3A 4DV6Q 1Y1VG 5COYA 2JA6B 2JN4A 4GKJQ 5EPKA 3S2DB 4EQ5A 1FR3A 1E2ZA 2C9OA 1R9TH 1ILPA 1X3QA 5DAUA 4EQNA 5KNBA 2UU9L 1SMYD 1TY0A 2FMMA 1H9SB 5JVH3 4DV4Q 1QZHA 3HOUH 4A3DH 2NTSA 4NXMQ 2OQKA 1XXGA 1MKHA 1Y8OB 2SNMA 4I7AA 1IYVA 2PO4A 5A2QL 1J5EQ 2OTLA 3S2HB 4UP8A 2FXQA 3PO2H 3S15H 4JI7Q 4IUNA 4A3MB 2UXCQ 1Z9FA 1VQLA 3M7NA 4A3JH 1DZ1A 1LT6D 4LFBQ 4K14A 2YV5A 4WJWA 5C0XG 4NW2A 1A8VA 4OWWB 1M8AA 4IPCA 4N9PA 2DY8A 4JI8Q 5E1FA 1XPRA 2L11A 4IURA 4GOPA 4HCSA 3A56A 4KY6A 4X3SA 2QW7A 3FVQA 4A3IB 3KLRA 2QGQA 1J6QA 3Q0AA 1JC7A 3F1ZA 2F0SA 5K36H 1HZAA 1B50A 5G3LD 5DEHA 1IYUA 1OXXK 2R7ZG 2RDHA 2K5QA 3MXNA 4QUCA 4A93H 1HNXL 4RHSA 1UAPA 4GN3B 3G7LA 4ZQ3A 2VW9A 2E2IB 2CWAA 3RZDH 5E7NA 2NZOA 4NXNL 3CP0A 4A3EB 4XIGS 1WTRA 4IFDJ 4ALPA 1QNKA 2P5ZX 3NBHA 4NP5A 3CQZH 5C44H 4MTNA 2EYPA 3KF8B 1VQ8A 4H13C 1UEBA 1X3PA 4JI5L 4TSSA 1V1PB 4BY1G 5LMUQ 1PTOD 4DV5L 2HT1A 1BCPC 1WYDA 4LF6Q 2HHHQ 4X3UA 5CV6A 1F77A 3TQYA 4A3CG 4DKAC 4RCOA 1RL2A 5C4HA 1I6VC 3SE0A 4YHHQ 5CV7A 2MFIA 3PF5A 2K5WA 5TSSA 3H3VC 1FL0A 1HFNA 2SEBD 2TSSA 3GTOH 3GTGH 1BBWA 1VF7A 2N78A 1N33Q 4LFAL 1SYFA 1ZKOA 4R1JA 1D1KA 5CV9A 4F87A 2JA7B 1Z7TA 2R92H 1MJCA 1CZWA 2AUJD 1SXTA 1GUSA 4JYAQ 3NHHA 2Y0SB 4F8MA 5JPMC 2NN6H 3GD7A 3RUZA 1H95A 2EE1A 4BY7B 4DV7L 2F0TA 4KHPQ 4JI0Q 1NE3A 2UUCQ 4MNOA 2L12A 4YCVA 4CJ2C 3GTLH 3CU7A 2PCFB 4S3SA 1PZJD 1XTCD 1NNXA 2K6AA 5DM73 2H5XA 4IOCA 4FF3A 5IWAL 4IALA 5T1IA 2B2YC 1I94L 1FNWA 1JWSD 3TRZA 3I4NG 5A35A 1PH2A 1JB3A 3LGJA 1FJGL 1IBKQ 4IUTA 3ICEA 1CHPD 3I4MB 1HTLD 3TS2A 2B63G 3NSWA 1EOVA 4LFCL 3K81C 5FJ8H 3R2TA 4B3SL 5D65A 1EYDA 1O7YA 2OF1A 4DNRB 1TU2B 2DJGC 4GLAC 1VQPA 2MQHA 5I2XA 2WKCA 3S14H 4HJAA 2DY7A 2IL8A 2B2UC 3J7AV 1BBXC 5E4WC 3HEJA 3D8GA 4DV3Q 1G6PA 2JA6H 3ERSX 3S2DH 2EYOA 2EJFC 5CV5A 4KD4A 3CCSA 1ENAA 4IFDH 2AQ3B 3HRZC 4GLXA 1FNVA 1JOQA 4R4OA 2VZAA 3NWTA 2NVYB 5CORA 4CDFC 3HOXH 1MD2D 1TS4A 2N3SA 3H09A 3EN2A 3ND9A 4GNXB 3U4ZA 1JICA 3P7JA 4CBVA 4IUUA 3RR5A 1U4PA 4AQYL 4DN4M 1XNQL 4DU9A 3BDCA 1RD9D 2K33A 4A3BB 2Z6KA 3OMCA 1AFPA 1VMPA 2MHVA 5EJWA 4RKLA 1B1ZA 3IAYA 4B3ML 4LF8L 1KXLA 2F0UA 4A3FG 5FOBB 5JEAJ 5I9PA 1PYSB 4A3IH 5C6AA 5FO9B 1FGBD 3K59A 4DAPA 3G6JB 4ME3A 1PFBA 4GLVB 4H44C 4DV0L 1O7ZA 1D5XC 4OWTB 4A3GB 1GUGA 4M1UB 1MIUA 1TKWB 1U5KA 2VS1A 2RF4A 5FLMG 1SMXA 3Q23A 4C3HB 4K2KA 2E2IH 1HRJA 1BVSA 1NJIC 3R3OA 1F9QA 3P75A 1GJXA 2ES2A 5C3XA 1KLGD 2F3VA 3J81c 3D0FA 1G8ZD 3OPOA 2DNCA 2VL6A 1PFSA 4RAUC 5K5PA 3V96A 4NKLA 1X56A 1VCIA 1J9OA 4K5XA 4BBSH 2NVTB 3ER0A 4A75A 1MSGA 1NR4A 3STBD 1BXTA 3TP5A 4DPGA 1I4PA 2L9HA 5BN4A 1EFID 4FF1A 1N36L 4L5TA 3EIVA 2J7ZA 1JQYD 1VF5C 3HKZB 4QB4A 2F0DA 1SMYC 2B8GA 2MUYA 1Y1WB 1PH9A 2B2YA 3HOVG 1EIHA 3DWQA 3PIPA 1VQOA 2VUMB 4JI3Q 2JJQA 5F2DA 5CGKA 2WAQB 4F88A 3NPPA 5D3IB 2WB1E 3UDXA 2O2LD 1D6EC 1SE4A 1SYGA 4BY7H 4WFN3 4LF4Q 2M9VA 4I65A 3CMEA 2PMZE 3NENA 3J81i 5C3EG 1I4GA 3PIOA 5M5XB 4LF5L 3G48A 3V05A 3X3NA 3S17B 4HIDA 1VQ6A 2KHSA 4EQPA 3BDOA 4FXKC 3R2IA 4JI2L 2B2UA 3DMUA 3PQIA 1RTNA 1MHWC 4X3TA 2C35B 1NSNS 2V1CC 1XMQQ 3LNNA 1PXUA 5CYUA 3I4MH 3K7AB 2BCOA 2I5HA 3RD4A 1VQEA 1KAAA 3UE0A 3CC4A 1ZEQX 1WTOA 4JC0A 1JMCA 1DGSA 2B3GA 2NN6I 2O5IC 4IJHA 5JEAH 1SEBD 1D8LA 1S4ZA 2XTIA 3OOCA 4DXFA 5IYDG 1WTQA 1F2LA 1WOCA 1PHJA 2A6EC 1EIYB 3PV0A 4YWKA 2KEEA 3MXPA 3WOEA 4A3KB 5BR8Q 3OIPA 3NQIA 3BJUA 2PQAB 2WB1G 1LT5D 1YJ9A 1CKOA 2YYZA 1QB5D 5CV4A 1Y8NB 2E74C 2F0OA 3K5NA 3C2PA 1XPOA 1NY4A 2UXBQ 3KLSX 1BCPD 3GQBA 1CQVA 3OWFA 4KHVA 3E9HA 3FPPA 4DK6C 2EDGA 1VQ7A 2A74C 1PRTC 5IP7G 2RQXA 3IKJA 3A7AB 4UP7A 1F2ZA 2VQEQ 3BZDB 1TVXA 1V1QA 1XTDA 1TWHB 1W6JA 1ESRA 3RNUA 3T1HQ 5IP9G 1JJCB 5LMNQ 2F0EA 2K5VA 2PNHA 1XNRQ 1B70B 2A6HC 3A5ZB 4HMJA 4AH6A 1RHPA 1RF2D 3MFGA 3H3VH 3L2PA 2D5DA 3LX0A 1H9RA 1EQRA 3MTSA 4HTHA 4O42A 4POFA 3S15B 3KLWA 3AFPA 3PO2B 3BYTB 3NTKA 3K80C 1V8QA 4GKKL 3RLNA 4CDDC 4JI4L 1TWFH 4LUZA 1Q8KA 4PNYA 4OIJA 3PUYA 2UU9Q 4A3JB 1I4HA 1S3OA 2XIWA 4BA2I 3T1YQ 3URYA 2R7DA 2K5NA 5C4XB 2KCCA 1YNJC 1SNCA 1IXRA 3QIAA 4A3GH 4PZ7A 1TR5A 1Y14B 2VB2X 4C3HH 1DOLA 3HOYG 5DM63 1LT4D 5FO7B 2F4VQ 3J7AF 1BCPF 1S5DD 4HIKA 1ENCA 4HR7B 2K14A 1YEZA 3HOZG 3C46A 3EA6A 4OO1H 1Q1EA 3MHBA 4RGMA 3GTKH 3F2UA 1X3FA 3MWYW 4JK1C 4PMCA 1XWEA 3M9BA 2NVTH 4DXGA 4XQNA 3VYRA 1KDAA 1HNZL 5C44B 1CA6A 4OWXB 1KRTA 4BWGB 1HNXQ 1E3PA 1QILA 4N8FA 3KLSA 1BO0A 1SNDA 1IKMA 4NXNQ 2PI2E 4DAYA 1DOKA 4X62L 1JOKA 5IGGA 3M4OH 2H1EA 3M4PA 4G4KA 4DR2L 1YHAA 1LV9A 1Y1WH 3OTOL 3M3YB 2UUBQ 3NQTA 3CC7A 1OXVA 1A2TA 4XQJA 3UDGA 4JI5Q 3OYYA 5BN3A 4DV5Q 2R92B 1PTOB 2IHEA 3BDLA 4KJOA 1X32A 3EQLC 5GAHC 4RCNA 1VQNA 4R4IA 1GKHA 1HR0W 4QL5A 1VQDA 5A2QE 3J7YW 3SK8A 2CH4A 4LFAQ 4A3LH 2QKIC 1LT3D 4HAEA 4R4CA 5HURA 1RCVD 3J81L 2DN8A 3TP7A 4ILWA 2MP1A 3S17H 3K6OA 1JT8A 2JP1A 4ME5A 3NBIA 2K5DA 2BA0A 2Q8TA 2RSNA 1AE3A 4KD3A 2A69C 4IPGA 1EZ8A 1PH4A 3K7AH 5H1SE 5D14A 4JI1L 4DV7Q 1L0YB 4YY3L 2QEXA 3AYHB 3WDNA 2ENBA 4J1MA 2K04A 1YIJA 1AN8A 2K52A 5I2YA 2K50A 1K9MC 1HCZA 3RN2A 3ULPA 4MTKA 5CV8A 1YHBA 1I94Q 3VR6A 4EGVA 1L1OC 3S14B 4C1NI 1HNWQ 2O4XA 5GAEC 2JA8G 1ONLA 3UE1A 3HG9A 1DM0B 3T16A 4KLKA 3A8JE 4X66L 3H0GG 3JAMc 4LFCQ 2F0PA 1JE5A 4B3SQ 3SVMA 5M5WH 4Q0FA 1EY4A 2K75A 1A15A 2VB3X 4A76A 1WTVA 1TWHH 2QDBA 1FGUA 1ICFB 2AQ2B 2JA5G 3ZJYC 2QILA 4GOPB 3D4RA 3L0OA 1ML0D 3M4YA 4LAAA 3HOXB 1GUNA 5C5LA 2KUMA 4FP5D 1CM9A 1TS5A 2KQ3A 5EPJA 1HHVA 2G9DA 5J3BA 3MEHA 2JEAI 3MXNB 2R7ZH 4DNTB 2AWOA 1SE2A 3CRLC 2I0QA 3H91A 3A5UA 3W1GA 4K8JA 4U673 2F0HA 2OCEA 1B2TA 1A0IA 3VR5A 2KECA 4GZYC 1RTOA 3NBHB 5C4XH 4BBRG 1VDZA 4ZAIA 4DAVA 2EJMA 4AQYQ 1XNQQ 1VS0A 3M7GA 1E2WA 1GUOA 3JAMi 4IOAA 3SEBA 1I4RA 4BY1H 1F9RA 2IPKD 1S5CD 2Q8RE 5FLXc 1KQSA 3G4SA 5HY6A 4X3KA 2Z6KC 3Q6SA 1VQMA 4B3MQ 3TSSA 5M3FB 4LF8Q 2K01A 2D0PA 2NB0A 1O7LA 4C1NK 2LFNA 3H3VI 3HOUG 1H9SA 2RDGA 3IFDA 3W5OA 4C3JG 1CI3M 4HCEA 5FO8B 5IGCA 3S1RH 1KD1C 4Z9CB 4APVA 1K8OA 1UE5A 5DLQE 2A6ED 4DV0Q 4DUZL 3VDYA 3AEVA 2L5TA 2YTXA 4DR5L 4BBSB 1DYQA 1YNXA 2YU9H 3MXUA 4R4TA 3CXCA 5EKLA 1I3QH 2OT2A 1WCMG 3KK7A 3DM1A 4IPDA
chains in the Genus database with same CATH topology
4DR4L 4A3FG 5JEAJ 3Q8DA 4DUYL 4OX9Q 4JV5Q 2RHSB 2ZJPA 1PYSB 2VY3A 4A3IH 2GVAA 3NELA 4HIMA 5M5YH 1KRSA 1Y1VH 3M3YH 3PUWA 3FP9A 1IBLL 2D62A 4ME3A 4GLVB 4DV0L 3AFQA 2Q2UA 1Y1WG 2A8VA 2R7FA 1TWCH 3CCMA 3HOYH 2VUMG 4OWTB 1PH1A 1I6HH 4B3TQ 4OO1I 5K36G 4YCUA 1MIUA 2NVYH 1U5KA 2VS1A 2WAQG 2RF4A 4J15A 5FLMG 5IWAQ 1SMXA 2JA5H 4O2DA 2E2IH 3HOZH 3PSIA 2ZJRA 4A93G 1BVSA 1NJIC 4DNIA 1Z47A 2AHOB 4POGA 4JCVE 2ES2A 1LTLA 3J81c 4BXXH 1N36Q 2KENA 1FJGQ 3CCEA 4OX9L 2CFMA 3G6EA 1PH5A 2ATWA 4JV5L 3D0FA 2PQAA 2ZJQA 3HOWG 1O7IA 1EUJA 2VL6A 1N34Q 4A3BH 1V9PA 1SR3A 1PFSA 4A3LG 3AQQA 4K0KQ 5JJKA 1X56A 1QUQA 1VCIA 4HJ5A 1OXUA 2CCZA 3PO3G 4BBSH 4WJ3M 3ER0A 4QQBX 4A75A 1PV4A 3KF6B 1UE6A 4L5RC 1SROA 4B3TL 3STBD 1L1OA 1P16A 2ZTCA 1AH9A 2HIXA 2D0OA 3HFZB 4AYBE 4DPGA 2CQOA 4BBRH 1B8AA 3H15A 2HQLA 1EQQA 3UDFA 4Y7NH 1HH2P 1YHQA 4IFDI 1N36L 2LSSA 1SE8A 4L5TA 3EIVA 3HKSA 4JOIA 4DR1L 2N8NA 1S72A 2WFWA 1TWAH 4PZ6A 4LF5Q 3I7FA 1N34L 3CMAA 2JQOA 2E5LQ 4K0KL 3KDFA 4DR3Q 1X65A 1YBYA 3PGZA 3M85A 1PH9A 3HOVG 1YITA 1K8AC 3PIPA 1VQOA 3D31A 1C9OA 4JI2Q 4JI3Q 2JJQA 4P75A 5AJ3Q 4A3KG 1EYGA 4X6AH 1K0RA 3RLOA 1YJNA 2WB1E 3UDXA 1LYLA 4JBKA 4BY7H 4C3JH 4X64L 4LF4Q 1VQ5A 1CKMA 3T1YL 2B29A 2PMZE 2Q2IA 3CMEA 3NENA 1X55A 3J81i 5C3EG 4B3ML 3CCVA 1V43A 3PIOA 4O0AA 5GROA 4GOPC 2KHJA 4LF5L 3G48A 2RCNA 1CKNA 1XPUA 4R4QA 2E5LL 1Q82C 2F3IA 1LM0A 5C4JH 1X3EA 1JJ2A 4HIDA 4DR3L 2ZTEA 1VQ6A 1D7QA 2LXKA 1PH7A 4JBWA 2F4VL 5GQOA 4LF7Q 4A3CH 4JI2L 4JI3L 4JG2A 3M4QA 1WCMH 4OXPA 2KCTA 5AJ3L 1Q86C 3CCQA 4A3FH 2C35B 4H02A 2R93G 2V1CC 1HR0Q 1XMQQ 1HZBA 1GM5A 2GVBA 4AYBG 3BZKA 3PUZA 1PA6A 5IYCG 1YI2A 4LF4L 3I4MH 4A3DG 4LW1A 2BH8A 3F2DA 4OO1G 1EIFA 2I5HA 4PZ8A 1VQEA 3UE0A 3CCJA 1UWVA 3CC4A 1JMCA 3GTQH 1T9HA 3E0EA 4JC0A 5IY0A 1X3GA 2VUMH 1DGSA 2B3GA 2NN6I 3PO2G 4NB3A 4IJHA 4UP9A 5FJ8G 1AE2A 5JJIA 3G71A 1D8LA 2XTIA 5IYDG 3F2BA 1PH3A 1PHJA 1WOCA 3S1NH 3KYHC 4XTCS 1RIPA 3I56A 1N9WA 5ELNA 1ASYA 4YWLA 1EIYB 4LF7L 3PV0A 4YWKA 4A3JG 1I50H 3GDEA 2Q2TA 5BR8Q 3K8AA 3KJPA 3BJUA 3CC2A 2JA8H 2PQAB 2WB1G 4DV2Q 1HR0L 3FKIG 1XMQL 3HOWH 1YJ9A 5C4XG 2YTYA 1CKOA 2YYZA 3B6YA 1E24A 5M5XH 3CD6A 3HKZG 1M1KC 3H0GH 3U58A 4LUVA 1XPOA 4DAMA 1NY4A 1QUQB 1WJJA 2ZTDA 3I2ZA 2JA6G 2UXBQ 5C0XI 4UPAA 1QVFA 5M3MG 4QGUA 1EFWA 3PO3H 3E9HA 2UUBL 4DK6C 1JB7A 5IYBG 3NEMA 3DM3A 1VQ7A 4LF9Q 4GNXC 2NVXH 1L1OB 5IP7G 4GKKQ 4IFDG 3PF4A 2JK8A 4UP7A 5GAGC 4JI4Q 2OQ0A 1OTCA 4A4IA 2VQEQ 5M3FH 1IBMQ 2VNUD 3KJOA 3I4NH 1V1QA 1XTDA 1JJGA 2VQFQ 1CSPA 1VQBA 5IE8A 3RNUA 5BR8L 3T1HQ 5IP9G 1JJCB 1PVOA 4B3RQ 5LMNQ 1GD7A 4DR7Q 2K5VA 2PNHA 5ELOA 4TQUS 4DV2L 1XNRQ 3A74A 1KHIA 4EX5A 4DR1Q 4GNXA 1B70B 3A5ZB 4AH6A 3KDFB 1X9NA 1IL2A 1WI5A 2B63H 3S24A 4IO9A 2UXBL 4KHZA 3L2PA 1X6OA 4A3MG 5C44G 3H3VH 3MEFA 1KL9A 1EQRA 2KBNA 4POFA 2ID0A 3AFPA 3KLWA 4LF9L 3K80C 4GKKL 3RLNA 1N32Q 3CF5A 2JE6I 4YWMA 4A3KH 3WWVA 3CCRA 1GVPA 4JI4L 1TWFH 2HIVA 4LUZA 1Q8KA 2VQEL 2ZM6Q 1IBML 2F52A 1CUKA 1FVIA 1UE7A 3PUYA 2UU9Q 3CCLA 3BZCA 2I5LX 3ULLA 1S3OA 4MZ9A 4UY8C 2VQFL 4DR6L 3RLFA 2GN5A 4BA2I 4X64Q 3T1HL 1S40A 1U0LA 3L7ZC 3T1YQ 1K83H 1W3SA 3STBC 2A1AA 2R7DA 5LMNL 1MJEA 4DR7L 4B3RL 4HJ8A 2K5NA 4A3IG 1XNRL 1P8LA 1CKNB 2IY5B 4DV6Q 1GO3E 1Y1VG 2AMCB 4IJLA 3ULJA 4HJ9A 1IXRA 1HNZQ 2IHFA 4GKJQ 4A3GH 2Q2HA 4EQ5A 4PZ7A 2Y0SE 4QIWE 1Y14B 1G291 2DUDA 3S16H 2R92G 4C3HH 3HOYG 2K4KA 2F4VQ 1WCMG 1R9TH 4HIKA 1N32L 2NZHA 2K14A 1YEZA 3HOZG 2ZM6L 3BU2A 2UU9L 2R6GA 3UDIA 4X62Q 2XGTA 4DV4Q 4A3EG 1IZ6A 1QZHA 2NN6G 3HOUH 4NXMQ 1XJVA 1Q1EA 2DGYA 2OQKA 3K0XA 4A3DH 1HNWL 4Y52H 1MKHA 3GTKH 1HJPA 2WP8J 4BXXG 2BH2A 1E1OA 1X3FA 2L15A 4DR2Q 4JI0L 2CWPA 1I5FA 1QVGA 1J5EQ 3F8TA 2OTLA 3M9BA 4UP8A 3OTOQ 3KFUA 2NVTH 2FXQA 3PO2H 4DV6L 3S15H 2JEBI 1XMOQ 1E7ZA 1QZGA 4JI7Q 1HNZL 1VQCA 4GKJL 2UXCQ 3I4OA 1Z9FA 1VQLA 3M7NA 4P71A 4A3JH 4OWXB 1KRTA 4P73A 1HNXQ 4LFBQ 1E3PA 2YV5A 5C0XG 1A8VA 4OWWB 4IPCA 4DK3C 4NXNQ 2PI2E 3FKIH 4X62L 4JI8Q 4DV4L 5GADC 1XPRA 3M4OH 1NMFA 4NXML 1NBWA 4GOPA 5HGQA 1LUZA 3M4PA 4P72A 4DV1Q 3IRBA 3SGIA 4DR2L 1YHAA 2QGQA 1HZ9A 4FDBA 1J6QA 1KC8C 2PI2A 5IYBH 1Y1WH 1J5EL 2JA7G 3OTOL 2UUBQ 3CC7A 3F1ZA 1Q81C 1YVCA 1HZAA 1OXVA 1XMOL 1PYBA 4JI7L 4GN5A 3CW2C 3UDGA 4JI5Q 2UXCL 3OYYA 1Q7YC 5FLMH 1OXXK 4DV5Q 2R7ZG 2Y0SG 1NMGA 1KIXA 2IHEA 4A93H 3A0JA 5GAHC 2LXJA 4QY7A 1HNXL 4LFBL 2E2HH 5IP9H 1VQNA 1YZ6A 4GN3B 4R4IA 2VW9A 1GKHA 2CWAA 3RZDH 1HR0W 4P74A 2JA9A 4QL5A 2NZOA 5E7NA 3CP0A 1VQDA 4NXNL 4JI1Q 1VQ9A 4XIGS 4IFDJ 4JI8L 1Q12A 3S2HH 4ALPA 4RG1A 4LFAQ 1VQ4A 4DV1L 3CQZH 4A3MH 4A3LH 5C44H 2EQSA 4R4CA 2Z0SA 4MTNA 2IX1A 4IPHA 3S17H 3KF8B 1VQ8A 1YJWA 1JT8A 2OTJA 3W1BA 2RHQB 5EAYA 1E1TA 1UEBA 4JI5L 2BA0A 5IT9c 4BY1G 5LMUQ 1AE3A 4DV5L 4HJ7A 4LF6Q 1WYDA 2HT1A 1TXYA 2HHHQ 3TQYA 1N8RC 4A3CG 4DKAC 1RL2A 4IPGA 4DR6Q 4YHHQ 3K7UC 2BA1A 1B7YB 1QVCA 1PH4A 3K7AH 2MFIA 3HOXG 5H1SE 3PF5A 1FL0A 4JI1L 1EWIA 4DV7Q 4YY3L 4JBMA 3J7ZC 3GTOH 2EXDA 4X66Q 3GTGH 3PUVA 2AWNA 3I4MG 3RZOH 1BBWA 2QEXA 2N78A 3AYHB 4LFAL 4LUOA 1N33Q 2NVQH 1VQJA 4R1JA 3JC66 4LWCA 1YIJA 1BBUA 2K52A 3CPFA 3TS0A 2R92H 3J7A5 1MJCA 2K50A 3HOVH 1K9MC 4PG3A 1VQAA 5JEAG 1OXTA 1X54A 1WFQA 4RMFA 1SN8A 3RN2A 3ULPA 4JYAQ 3J80c 1YHBA 5LMUL 1I94Q 1VQIA 2IX0A 3GTJH 3CPWA 4A3EH 1Q1BA 4LF6L 2HHHL 3GD7A 4QJFA 4YHHL 1L1OC 3FHWA 5LMNW 1HNWQ 1H95A 5GAEC 2JA8G 4LNQA 3UE1A 3KOJA 1Q46A 5C3EH 4DV7L 4KHPQ 4KLKA 4JI0Q 4X66L 1NE3A 1C7YA 1K3RA 3H0GG 2UUCQ 3CAMA 3JAMc 1N33L 4MNOA 3RN5A 4LFCQ 1JE5A 2AKWB 4B3SQ 4YCVA 5M5WH 3GTLH 4JOIC 2CKZB 1OXSC 1VQKA 1CSQA 2K75A 4YCWA 2H5XA 4A76A 1W2BA 2ASBA 1UE1A 1G51A 1TWHH 4JBJA 2QA4A 4IOCA 5IWAL 1A63A 4DAYB 1FGUA 4JYAL 5M3FG 2UXDQ 1I94L 3ZJYC 2JA5G 3TRZA 3I4NG 2R93H 4GOPB 1PH2A 3TEHB 2YTVA 3L0OA 2UUAQ 1A62A 5IYCH 3GTMH 1SLJA 1C0AA 3LGJA 1FJGL 1IBKQ 4JI6Q 2ALYB 3PUXA 1E22A 1VQGA 2I5MX 3ICEA 1TWGH 2JA7H 1K8GA 1PH8A 3TS2A 2MO0A 5C0XJ 4LF8L 4KHPL 2E2JH 2MO1A 2B63G 4X65Q 2UUCL 1EOVA 1NTGA 5J3BA 3GTPH 4GS3A 3K81C 4LFCL 5FJ8H 4A3BG 3OW2A 3U50C 4B3SL 2JEAI 3MXNB 2R7ZH 4PMWA 4GN4B 3EBEA 2EIFA 2AWOA 4OONA 3J81j 3S1QH 5IYDH 2I0QA 4GLAC 4BBSG 5JJLA 3A5UA 1VQPA 3W1GA 2MQHA 4L5SA 3E9IA 3KF6A 4TVAB 3S14H 2OCEA 4C2MH 2UXDL 3I55A 3GO5A 3J80i 4HJAA 1A0IA 3HKZE 4NPSA 3NBHB 2UUAL 5C4XH 4BBRG 1IBKL 3TREA 4DV3Q 4JI6L 1G6PA 4WJ4A 1L0WA 4AQYQ 2JA6H 1L2FA 1IYJB 3ERSX 4HIOA 1XNQQ 1VS0A 2KCMA 1VQHA 5M3MH 4DUZQ 3S2DH 1M90C 1HZCA 3CCSA 4X65L 3JAMi 5IP7H 4IOAA 2WAQE 4A3GG 4BY1H 1SRUA 4DR5Q 1KAWA 4GLXA 5FLXc 1KQSA 3G4SA 1BKBA 5HY6A 2Z6KC 4R4OA 2VZAA 4BA1I 1VQMA 4B3MQ 4LF8Q 3HOXH 4AIMA 2A19A 3DLLA 2N3SA 3S1MH 2D0PA 3CCUA 3U4VA 1PH6A 4DUYQ 3EN2A 4DR4Q 3H3VI 3HOUG 2K5HA 4YY3Q 4BY7G 4GNXB 3W5OA 3U4ZA 4L5QA 3S1RH 1KD1C 4KI0A 3PCOB 4APVA 3F2CA 4DV3L 1UE5A 5DLQE 3RR5A 4AQYL 1IBLQ 1XNQL 4DV0Q 1VQFA 4DUZL 2OWOA 3VDYA 1K73C 1ASZA 2Z6KA 2KHIA 1SFOH 2IT1A 3AEVA 2YTXA 4DR5L 1YNXA 2YU9H 4R4TA 4C3IH 3CXCA 2MNAA 1I3QH 2N49A 2E8GA 4IPDA 1KXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 L;  4A3F G;  5JEA J;  3Q8D A;  4DUY L;  4OX9 Q;  4JV5 Q;  2RHS B;  2ZJP A;  1PYS B;  2VY3 A;  4A3I H;  2GVA A;  3NEL A;  4HIM A;  5M5Y H;  1KRS A;  1Y1V H;  3M3Y H;  3PUW A;  3FP9 A;  1IBL L;  2D62 A;  4ME3 A;  4GLV B;  4DV0 L;  3AFQ A;  2Q2U A;  1Y1W G;  2A8V A;  2R7F A;  1TWC H;  3CCM A;  3HOY H;  2VUM G;  4OWT B;  1PH1 A;  1I6H H;  4B3T Q;  4OO1 I;  5K36 G;  4YCU A;  1MIU A;  2NVY H;  1U5K A;  2VS1 A;  2WAQ G;  2RF4 A;  4J15 A;  5FLM G;  5IWA Q;  1SMX A;  2JA5 H;  4O2D A;  2E2I H;  3HOZ H;  3PSI A;  2ZJR A;  4A93 G;  1BVS A;  1NJI C;  4DNI A;  1Z47 A;  2AHO B;  4POG A;  4JCV E;  2ES2 A;  1LTL A;  3J81 c;  4BXX H;  1N36 Q;  2KEN A;  1FJG Q;  3CCE A;  4OX9 L;  2CFM A;  3G6E A;  1PH5 A;  2ATW A;  4JV5 L;  3D0F A;  2PQA A;  2ZJQ A;  3HOW G;  1O7I A;  1EUJ A;  2VL6 A;  1N34 Q;  4A3B H;  1V9P A;  1SR3 A;  1PFS A;  4A3L G;  3AQQ A;  4K0K Q;  5JJK A;  1X56 A;  1QUQ A;  1VCI A;  4HJ5 A;  1OXU A;  2CCZ A;  3PO3 G;  4BBS H;  4WJ3 M;  3ER0 A;  4QQB X;  4A75 A;  1PV4 A;  3KF6 B;  1UE6 A;  4L5R C;  1SRO A;  4B3T L;  3STB D;  1L1O A;  1P16 A;  2ZTC A;  1AH9 A;  2HIX A;  2D0O A;  3HFZ B;  4AYB E;  4DPG A;  2CQO A;  4BBR H;  1B8A A;  3H15 A;  2HQL A;  1EQQ A;  3UDF A;  4Y7N H;  1HH2 P;  1YHQ A;  4IFD I;  1N36 L;  2LSS A;  1SE8 A;  4L5T A;  3EIV A;  3HKS A;  4JOI A;  4DR1 L;  2N8N A;  1S72 A;  2WFW A;  1TWA H;  4PZ6 A;  4LF5 Q;  3I7F A;  1N34 L;  3CMA A;  2JQO A;  2E5L Q;  4K0K L;  3KDF A;  4DR3 Q;  1X65 A;  1YBY A;  3PGZ A;  3M85 A;  1PH9 A;  3HOV G;  1YIT A;  1K8A C;  3PIP A;  1VQO A;  3D31 A;  1C9O A;  4JI2 Q;  4JI3 Q;  2JJQ A;  4P75 A;  5AJ3 Q;  4A3K G;  1EYG A;  4X6A H;  1K0R A;  3RLO A;  1YJN A;  2WB1 E;  3UDX A;  1LYL A;  4JBK A;  4BY7 H;  4C3J H;  4X64 L;  4LF4 Q;  1VQ5 A;  1CKM A;  3T1Y L;  2B29 A;  2PMZ E;  2Q2I A;  3CME A;  3NEN A;  1X55 A;  3J81 i;  5C3E G;  4B3M L;  3CCV A;  1V43 A;  3PIO A;  4O0A A;  5GRO A;  4GOP C;  2KHJ A;  4LF5 L;  3G48 A;  2RCN A;  1CKN A;  1XPU A;  4R4Q A;  2E5L L;  1Q82 C;  2F3I A;  1LM0 A;  5C4J H;  1X3E A;  1JJ2 A;  4HID A;  4DR3 L;  2ZTE A;  1VQ6 A;  1D7Q A;  2LXK A;  1PH7 A;  4JBW A;  2F4V L;  5GQO A;  4LF7 Q;  4A3C H;  4JI2 L;  4JI3 L;  4JG2 A;  3M4Q A;  1WCM H;  4OXP A;  2KCT A;  5AJ3 L;  1Q86 C;  3CCQ A;  4A3F H;  2C35 B;  4H02 A;  2R93 G;  2V1C C;  1HR0 Q;  1XMQ Q;  1HZB A;  1GM5 A;  2GVB A;  4AYB G;  3BZK A;  3PUZ A;  1PA6 A;  5IYC G;  1YI2 A;  4LF4 L;  3I4M H;  4A3D G;  4LW1 A;  2BH8 A;  3F2D A;  4OO1 G;  1EIF A;  2I5H A;  4PZ8 A;  1VQE A;  3UE0 A;  3CCJ A;  1UWV A;  3CC4 A;  1JMC A;  3GTQ H;  1T9H A;  3E0E A;  4JC0 A;  5IY0 A;  1X3G A;  2VUM H;  1DGS A;  2B3G A;  2NN6 I;  3PO2 G;  4NB3 A;  4IJH A;  4UP9 A;  5FJ8 G;  1AE2 A;  5JJI A;  3G71 A;  1D8L A;  2XTI A;  5IYD G;  3F2B A;  1PH3 A;  1PHJ A;  1WOC A;  3S1N H;  3KYH C;  4XTC S;  1RIP A;  3I56 A;  1N9W A;  5ELN A;  1ASY A;  4YWL A;  1EIY B;  4LF7 L;  3PV0 A;  4YWK A;  4A3J G;  1I50 H;  3GDE A;  2Q2T A;  5BR8 Q;  3K8A A;  3KJP A;  3BJU A;  3CC2 A;  2JA8 H;  2PQA B;  2WB1 G;  4DV2 Q;  1HR0 L;  3FKI G;  1XMQ L;  3HOW H;  1YJ9 A;  5C4X G;  2YTY A;  1CKO A;  2YYZ A;  3B6Y A;  1E24 A;  5M5X H;  3CD6 A;  3HKZ G;  1M1K C;  3H0G H;  3U58 A;  4LUV A;  1XPO A;  4DAM A;  1NY4 A;  1QUQ B;  1WJJ A;  2ZTD A;  3I2Z A;  2JA6 G;  2UXB Q;  5C0X I;  4UPA A;  1QVF A;  5M3M G;  4QGU A;  1EFW A;  3PO3 H;  3E9H A;  2UUB L;  4DK6 C;  1JB7 A;  5IYB G;  3NEM A;  3DM3 A;  1VQ7 A;  4LF9 Q;  4GNX C;  2NVX H;  1L1O B;  5IP7 G;  4GKK Q;  4IFD G;  3PF4 A;  2JK8 A;  4UP7 A;  5GAG C;  4JI4 Q;  2OQ0 A;  1OTC A;  4A4I A;  2VQE Q;  5M3F H;  1IBM Q;  2VNU D;  3KJO A;  3I4N H;  1V1Q A;  1XTD A;  1JJG A;  2VQF Q;  1CSP A;  1VQB A;  5IE8 A;  3RNU A;  5BR8 L;  3T1H Q;  5IP9 G;  1JJC B;  1PVO A;  4B3R Q;  5LMN Q;  1GD7 A;  4DR7 Q;  2K5V A;  2PNH A;  5ELO A;  4TQU S;  4DV2 L;  1XNR Q;  3A74 A;  1KHI A;  4EX5 A;  4DR1 Q;  4GNX A;  1B70 B;  3A5Z B;  4AH6 A;  3KDF B;  1X9N A;  1IL2 A;  1WI5 A;  2B63 H;  3S24 A;  4IO9 A;  2UXB L;  4KHZ A;  3L2P A;  1X6O A;  4A3M G;  5C44 G;  3H3V H;  3MEF A;  1KL9 A;  1EQR A;  2KBN A;  4POF A;  2ID0 A;  3AFP A;  3KLW A;  4LF9 L;  3K80 C;  4GKK L;  3RLN A;  1N32 Q;  3CF5 A;  2JE6 I;  4YWM A;  4A3K H;  3WWV A;  3CCR A;  1GVP A;  4JI4 L;  1TWF H;  2HIV A;  4LUZ A;  1Q8K A;  2VQE L;  2ZM6 Q;  1IBM L;  2F52 A;  1CUK A;  1FVI A;  1UE7 A;  3PUY A;  2UU9 Q;  3CCL A;  3BZC A;  2I5L X;  3ULL A;  1S3O A;  4MZ9 A;  4UY8 C;  2VQF L;  4DR6 L;  3RLF A;  2GN5 A;  4BA2 I;  4X64 Q;  3T1H L;  1S40 A;  1U0L A;  3L7Z C;  3T1Y Q;  1K83 H;  1W3S A;  3STB C;  2A1A A;  2R7D A;  5LMN L;  1MJE A;  4DR7 L;  4B3R L;  4HJ8 A;  2K5N A;  4A3I G;  1XNR L;  1P8L A;  1CKN B;  2IY5 B;  4DV6 Q;  1GO3 E;  1Y1V G;  2AMC B;  4IJL A;  3ULJ A;  4HJ9 A;  1IXR A;  1HNZ Q;  2IHF A;  4GKJ Q;  4A3G H;  2Q2H A;  4EQ5 A;  4PZ7 A;  2Y0S E;  4QIW E;  1Y14 B;  1G29 1;  2DUD A;  3S16 H;  2R92 G;  4C3H H;  3HOY G;  2K4K A;  2F4V Q;  1WCM G;  1R9T H;  4HIK A;  1N32 L;  2NZH A;  2K14 A;  1YEZ A;  3HOZ G;  2ZM6 L;  3BU2 A;  2UU9 L;  2R6G A;  3UDI A;  4X62 Q;  2XGT A;  4DV4 Q;  4A3E G;  1IZ6 A;  1QZH A;  2NN6 G;  3HOU H;  4NXM Q;  1XJV A;  1Q1E A;  2DGY A;  2OQK A;  3K0X A;  4A3D H;  1HNW L;  4Y52 H;  1MKH A;  3GTK H;  1HJP A;  2WP8 J;  4BXX G;  2BH2 A;  1E1O A;  1X3F A;  2L15 A;  4DR2 Q;  4JI0 L;  2CWP A;  1I5F A;  1QVG A;  1J5E Q;  3F8T A;  2OTL A;  3M9B A;  4UP8 A;  3OTO Q;  3KFU A;  2NVT H;  2FXQ A;  3PO2 H;  4DV6 L;  3S15 H;  2JEB I;  1XMO Q;  1E7Z A;  1QZG A;  4JI7 Q;  1HNZ L;  1VQC A;  4GKJ L;  2UXC Q;  3I4O A;  1Z9F A;  1VQL A;  3M7N A;  4P71 A;  4A3J H;  4OWX B;  1KRT A;  4P73 A;  1HNX Q;  4LFB Q;  1E3P A;  2YV5 A;  5C0X G;  1A8V A;  4OWW B;  4IPC A;  4DK3 C;  4NXN Q;  2PI2 E;  3FKI H;  4X62 L;  4JI8 Q;  4DV4 L;  5GAD C;  1XPR A;  3M4O H;  1NMF A;  4NXM L;  1NBW A;  4GOP A;  5HGQ A;  1LUZ A;  3M4P A;  4P72 A;  4DV1 Q;  3IRB A;  3SGI A;  4DR2 L;  1YHA A;  2QGQ A;  1HZ9 A;  4FDB A;  1J6Q A;  1KC8 C;  2PI2 A;  5IYB H;  1Y1W H;  1J5E L;  2JA7 G;  3OTO L;  2UUB Q;  3CC7 A;  3F1Z A;  1Q81 C;  1YVC A;  1HZA A;  1OXV A;  1XMO L;  1PYB A;  4JI7 L;  4GN5 A;  3CW2 C;  3UDG A;  4JI5 Q;  2UXC L;  3OYY A;  1Q7Y C;  5FLM H;  1OXX K;  4DV5 Q;  2R7Z G;  2Y0S G;  1NMG A;  1KIX A;  2IHE A;  4A93 H;  3A0J A;  5GAH C;  2LXJ A;  4QY7 A;  1HNX L;  4LFB L;  2E2H H;  5IP9 H;  1VQN A;  1YZ6 A;  4GN3 B;  4R4I A;  2VW9 A;  1GKH A;  2CWA A;  3RZD H;  1HR0 W;  4P74 A;  2JA9 A;  4QL5 A;  2NZO A;  5E7N A;  3CP0 A;  1VQD A;  4NXN L;  4JI1 Q;  1VQ9 A;  4XIG S;  4IFD J;  4JI8 L;  1Q12 A;  3S2H H;  4ALP A;  4RG1 A;  4LFA Q;  1VQ4 A;  4DV1 L;  3CQZ H;  4A3M H;  4A3L H;  5C44 H;  2EQS A;  4R4C A;  2Z0S A;  4MTN A;  2IX1 A;  4IPH A;  3S17 H;  3KF8 B;  1VQ8 A;  1YJW A;  1JT8 A;  2OTJ A;  3W1B A;  2RHQ B;  5EAY A;  1E1T A;  1UEB A;  4JI5 L;  2BA0 A;  5IT9 c;  4BY1 G;  5LMU Q;  1AE3 A;  4DV5 L;  4HJ7 A;  4LF6 Q;  1WYD A;  2HT1 A;  1TXY A;  2HHH Q;  3TQY A;  1N8R C;  4A3C G;  4DKA C;  1RL2 A;  4IPG A;  4DR6 Q;  4YHH Q;  3K7U C;  2BA1 A;  1B7Y B;  1QVC A;  1PH4 A;  3K7A H;  2MFI A;  3HOX G;  5H1S E;  3PF5 A;  1FL0 A;  4JI1 L;  1EWI A;  4DV7 Q;  4YY3 L;  4JBM A;  3J7Z C;  3GTO H;  2EXD A;  4X66 Q;  3GTG H;  3PUV A;  2AWN A;  3I4M G;  3RZO H;  1BBW A;  2QEX A;  2N78 A;  3AYH B;  4LFA L;  4LUO A;  1N33 Q;  2NVQ H;  1VQJ A;  4R1J A;  3JC6 6;  4LWC A;  1YIJ A;  1BBU A;  2K52 A;  3CPF A;  3TS0 A;  2R92 H;  3J7A 5;  1MJC A;  2K50 A;  3HOV H;  1K9M C;  4PG3 A;  1VQA A;  5JEA G;  1OXT A;  1X54 A;  1WFQ A;  4RMF A;  1SN8 A;  3RN2 A;  3ULP A;  4JYA Q;  3J80 c;  1YHB A;  5LMU L;  1I94 Q;  1VQI A;  2IX0 A;  3GTJ H;  3CPW A;  4A3E H;  1Q1B A;  4LF6 L;  2HHH L;  3GD7 A;  4QJF A;  4YHH L;  1L1O C;  3FHW A;  5LMN W;  1HNW Q;  1H95 A;  5GAE C;  2JA8 G;  4LNQ A;  3UE1 A;  3KOJ A;  1Q46 A;  5C3E H;  4DV7 L;  4KHP Q;  4KLK A;  4JI0 Q;  4X66 L;  1NE3 A;  1C7Y A;  1K3R A;  3H0G G;  2UUC Q;  3CAM A;  3JAM c;  1N33 L;  4MNO A;  3RN5 A;  4LFC Q;  1JE5 A;  2AKW B;  4B3S Q;  4YCV A;  5M5W H;  3GTL H;  4JOI C;  2CKZ B;  1OXS C;  1VQK A;  1CSQ A;  2K75 A;  4YCW A;  2H5X A;  4A76 A;  1W2B A;  2ASB A;  1UE1 A;  1G51 A;  1TWH H;  4JBJ A;  2QA4 A;  4IOC A;  5IWA L;  1A63 A;  4DAY B;  1FGU A;  4JYA L;  5M3F G;  2UXD Q;  1I94 L;  3ZJY C;  2JA5 G;  3TRZ A;  3I4N G;  2R93 H;  4GOP B;  1PH2 A;  3TEH B;  2YTV A;  3L0O A;  2UUA Q;  1A62 A;  5IYC H;  3GTM H;  1SLJ A;  1C0A A;  3LGJ A;  1FJG L;  1IBK Q;  4JI6 Q;  2ALY B;  3PUX A;  1E22 A;  1VQG A;  2I5M X;  3ICE A;  1TWG H;  2JA7 H;  1K8G A;  1PH8 A;  3TS2 A;  2MO0 A;  5C0X J;  4LF8 L;  4KHP L;  2E2J H;  2MO1 A;  2B63 G;  4X65 Q;  2UUC L;  1EOV A;  1NTG A;  5J3B A;  3GTP H;  4GS3 A;  3K81 C;  4LFC L;  5FJ8 H;  4A3B G;  3OW2 A;  3U50 C;  4B3S L;  2JEA I;  3MXN B;  2R7Z H;  4PMW A;  4GN4 B;  3EBE A;  2EIF A;  2AWO A;  4OON A;  3J81 j;  3S1Q H;  5IYD H;  2I0Q A;  4GLA C;  4BBS G;  5JJL A;  3A5U A;  1VQP A;  3W1G A;  2MQH A;  4L5S A;  3E9I A;  3KF6 A;  4TVA B;  3S14 H;  2OCE A;  4C2M H;  2UXD L;  3I55 A;  3GO5 A;  3J80 i;  4HJA A;  1A0I A;  3HKZ E;  4NPS A;  3NBH B;  2UUA L;  5C4X H;  4BBR G;  1IBK L;  3TRE A;  4DV3 Q;  4JI6 L;  1G6P A;  4WJ4 A;  1L0W A;  4AQY Q;  2JA6 H;  1L2F A;  1IYJ B;  3ERS X;  4HIO A;  1XNQ Q;  1VS0 A;  2KCM A;  1VQH A;  5M3M H;  4DUZ Q;  3S2D H;  1M90 C;  1HZC A;  3CCS A;  4X65 L;  3JAM i;  5IP7 H;  4IOA A;  2WAQ E;  4A3G G;  4BY1 H;  1SRU A;  4DR5 Q;  1KAW A;  4GLX A;  5FLX c;  1KQS A;  3G4S A;  1BKB A;  5HY6 A;  2Z6K C;  4R4O A;  2VZA A;  4BA1 I;  1VQM A;  4B3M Q;  4LF8 Q;  3HOX H;  4AIM A;  2A19 A;  3DLL A;  2N3S A;  3S1M H;  2D0P A;  3CCU A;  3U4V A;  1PH6 A;  4DUY Q;  3EN2 A;  4DR4 Q;  3H3V I;  3HOU G;  2K5H A;  4YY3 Q;  4BY7 G;  4GNX B;  3W5O A;  3U4Z A;  4L5Q A;  3S1R H;  1KD1 C;  4KI0 A;  3PCO B;  4APV A;  3F2C A;  4DV3 L;  1UE5 A;  5DLQ E;  3RR5 A;  4AQY L;  1IBL Q;  1XNQ L;  4DV0 Q;  1VQF A;  4DUZ L;  2OWO A;  3VDY A;  1K73 C;  1ASZ A;  2Z6K A;  2KHI A;  1SFO H;  2IT1 A;  3AEV A;  2YTX A;  4DR5 L;  1YNX A;  2YU9 H;  4R4T A;  4C3I H;  3CXC A;  2MNA A;  1I3Q H;  2N49 A;  2E8G A;  4IPD A;  1KXL A; 
#chains in the Genus database with same CATH topology
 3J80 L;  4DR4 L;  2EYM A;  2RHS B;  2VY3 A;  3T51 B;  3SK5 A;  1PRT D;  3NEL A;  3QOL A;  1UUP A;  4HIM A;  1STB A;  4IZ8 A;  3M3Y H;  4DK1 A;  4U68 A;  2QCP X;  1K0S A;  2XWB B;  4XYQ A;  4O1N A;  2A8V A;  3K5L A;  2R7F A;  1PTO H;  1JWM D;  1TWC H;  2IJ0 A;  4TKO B;  5K36 G;  4OO1 I;  4YCU A;  1LTS D;  1QCB D;  4DFA A;  3S16 B;  3NP8 A;  3VR3 A;  4O2D A;  3D3R A;  3PSI A;  4A93 G;  4FF2 A;  1UNS A;  4DNI A;  5CBA E;  2A6H D;  3OHX C;  2L4N A;  5G3L F;  1LTL A;  4BXX H;  1N36 Q;  2KEN A;  3G6E A;  4JV5 L;  2EZV A;  3HOW G;  1AZP A;  1DD2 A;  1V9P A;  2MJ8 A;  1QUQ A;  2CCZ A;  4HJ5 A;  3PO3 G;  1FNU A;  2SOB A;  4DK0 A;  2K1B A;  2B8F A;  1PV4 A;  1JCK B;  1UE6 A;  1HPC A;  2F0V A;  1L1O A;  1AH9 A;  2HIX A;  3WOF A;  2NUC A;  1YNJ D;  1B8A A;  1BQQ T;  3IFT A;  5C5M A;  4Y7N H;  3DXJ C;  1PTO F;  2LSS A;  3PMF A;  1A3V A;  1K28 A;  4LF5 Q;  3I7F A;  5FKA C;  3OW7 A;  3CMA A;  1N34 L;  3IL8 A;  3SR1 A;  3KDF A;  1SYD A;  3M85 A;  2IWH A;  1LTT D;  1C9O A;  4JI2 Q;  4P75 A;  1EYG A;  4X6A H;  1K0R A;  1G91 A;  2KED A;  4E6I A;  3VYT A;  3E0J A;  3FRP B;  4HSV A;  2E2H B;  1CKM A;  2PPB C;  4FNF A;  1IW7 D;  2CW0 C;  4LMQ D;  3K0Y A;  4O0A A;  2MPM A;  2RCN A;  2E5L L;  1Q82 C;  5C4J H;  1X3E A;  1JJ2 A;  4DR3 L;  5ELE A;  2ZXP A;  2EOT A;  2NBF A;  4OXP A;  5EBC A;  1AW7 A;  2LKV A;  1Q86 C;  3CCQ A;  4A3F H;  1EY9 A;  2I46 A;  1HZB A;  1GM5 A;  1PA6 A;  1EIF A;  3FMC A;  1OO9 B;  1BCP B;  4IQZ A;  3CCJ A;  1UWV A;  3NXW A;  3E0E A;  1D2B A;  4KN7 C;  4K6D A;  4NB3 A;  5FJ8 G;  4KK7 A;  1HFG A;  3F2B A;  1PH3 A;  3S1N H;  3KYH C;  1RIP A;  3I56 A;  4LF7 L;  2ICI A;  4RWS C;  4K8I A;  1DOM A;  1TWF B;  3KJP A;  3GTJ B;  3CC2 A;  2TMP A;  2NTT A;  1HR0 L;  3FKI G;  2YTY A;  4H0L C;  3CD6 A;  1PZK D;  2Z4H A;  5JAV A;  1M1K C;  3U58 A;  5ELB A;  3I2Z A;  2JA6 G;  5C0X I;  2A69 D;  3A8K E;  1QVF A;  1E0B A;  5IYB G;  3NEM A;  3DM3 A;  4ODG A;  1QNU A;  1CQF A;  2NVX H;  1IHZ A;  4GKK Q;  1QG7 A;  4IFD G;  2ZXR A;  3E5S A;  3NWS A;  3JAM L;  4JI4 Q;  1OTC A;  4FYD A;  2RBM A;  5M3F H;  2VNU D;  3KJO A;  4XXE A;  3QJY A;  3K57 A;  4UAI A;  1SNQ A;  4RH6 A;  1VQB A;  2Q8I B;  4QCL A;  3CHB D;  2R93 B;  1CTM A;  5ELO A;  1JE4 A;  4TQU S;  3I4L A;  2PQE A;  4AYB B;  3AB9 A;  4EX5 A;  4DR1 Q;  4GNX A;  3GTK B;  2JXM B;  1WI5 A;  3S24 A;  1ROD A;  1TWG B;  1X6O A;  4WRD A;  4A3M G;  4H7B A;  1SYE A;  3MEF A;  1XYI A;  2E2J B;  2KBN A;  3GTP B;  5EKI A;  1A2U A;  4LF9 L;  3CF5 A;  4YWM A;  5J22 A;  3WWV A;  3CCR A;  3DUZ A;  1GVP A;  1IBM L;  1FVI A;  1UE7 A;  4ZKC B;  3DWA A;  2VQF L;  2DNE A;  4X64 Q;  1S40 A;  2ZXO A;  1U0L A;  1GUW A;  2KJX A;  1MJE A;  1W3S A;  4B3R L;  4A3I G;  1GHJ A;  3M4O B;  1P8L A;  3H6M A;  2G5D A;  2IY5 B;  1EU4 A;  1GO3 E;  2AQ1 B;  2AMC B;  1HNZ Q;  1B9N A;  2IHF A;  4FXG C;  1H9J A;  5M3M B;  2Y0S E;  2XWJ B;  3ZYY X;  1G29 1;  4ULL A;  3S16 H;  2K4K A;  1N32 L;  2NZH A;  2ZM6 L;  5M9O A;  3UDI A;  4X62 Q;  4A3E G;  1EYC A;  1IZ6 A;  5FLX L;  3K0X A;  1SYB A;  4Y52 H;  1UEA B;  3SK6 A;  1HJP A;  2WP8 J;  2BH2 A;  5ELD A;  2F0F A;  2L15 A;  4DR2 Q;  4DGZ A;  4JI0 L;  5LL6 X;  2Z1C A;  1I5F A;  1EEF D;  1QVG A;  3F8T A;  3KFU A;  3OTO Q;  4HMI A;  2F0G A;  1JR0 D;  2JEB I;  1PZI D;  1E7Z A;  4I7Z C;  5EKK A;  3OWE B;  1U4L A;  3I4O A;  4FVM A;  4P71 A;  2F0I A;  3I3C A;  5JPN C;  4IUQ A;  4LJZ C;  2RA4 A;  1LTG D;  4C3I B;  3FPU B;  1EQT A;  3VA5 A;  5CBE E;  4C56 C;  1CFM A;  5GAD C;  4L8J A;  1NMF A;  1NBW A;  2GA4 B;  1G2S A;  1TS2 A;  1LUZ A;  5HGQ A;  4P72 A;  3NK9 A;  3IRB A;  3D6C A;  5KIX A;  5C4Z A;  1HZ9 A;  4FDB A;  5IGF A;  2PI2 A;  2JA7 G;  1Y1V B;  2NZ1 D;  3N6R A;  1Q81 C;  1XMO L;  1Y69 U;  1Q7Y C;  4QUF A;  2Y0S G;  3MA2 B;  2D2C C;  3OMG A;  2LXJ A;  1QE6 A;  5IGB A;  2E2H H;  2JA5 B;  2WKD A;  5IP9 H;  1MBY A;  4JI1 Q;  2JA9 A;  2Z9H A;  5BN5 A;  1PFN A;  1SYC A;  3HZX A;  1DJR D;  5T1G A;  5I6Y A;  3X3M A;  4DV1 L;  2F1M A;  2Z0S A;  4IPH A;  1LLR D;  2OTJ A;  3W1B A;  2F0Q A;  2CHB D;  4PQX A;  4OIK A;  5EAY A;  1BOS A;  5M5W B;  5CC4 A;  4HJ7 A;  2M2L A;  1TXY A;  5LHY 1;  1N8R C;  1WD1 A;  5IT9 E;  4DR6 Q;  3K7U C;  1B7Y B;  4HN7 A;  1EWI A;  4JBM A;  2EXD A;  4X66 Q;  3I4M G;  1AZQ A;  2DJF C;  2XVS A;  4LUO A;  2NVQ H;  1VQJ A;  3JC6 6;  4LWC A;  1BBU A;  1STE A;  3CPF A;  3J7A 5;  2KVM A;  2R61 A;  4PG3 A;  1NCV A;  5JEA G;  1WFQ A;  3LWU A;  2Z6B A;  2R7Z B;  1LTB D;  3J80 c;  2IX0 A;  3GTJ H;  3CPW A;  2B2W A;  4QJF A;  2PZU A;  4LNQ A;  3KOJ A;  1Q46 A;  1SE3 A;  2F3W A;  4IUV A;  4K2L A;  3J81 E;  1Z6H A;  3QO2 A;  2XRS D;  2HCC A;  1SJH D;  1VQK A;  1OXS C;  3I8Z A;  1CSQ A;  5KYI A;  2HUG A;  3PIP 3;  1EY0 A;  1W2B A;  2ASB A;  1G51 A;  4JBJ A;  1Y8P B;  2QA4 A;  2J4X A;  3I73 A;  4BY1 B;  4DAY B;  4EVO A;  2EY5 A;  2CH4 W;  3VR4 A;  4ZKB B;  2R93 H;  3TEH B;  5IYC H;  3GTM H;  1SLJ A;  2Z4I A;  2X6L A;  3N52 A;  2EY2 A;  1TWG H;  3PIO 3;  1PH8 A;  1K8G A;  2MO0 A;  5C0X J;  2C5C A;  2E2J H;  3S1R B;  1TS3 A;  3L3O C;  3GTP H;  1NTG A;  4A3B G;  3SDZ A;  1IKL A;  1PMR A;  3OW2 A;  2L1B A;  4GN4 B;  3EBE A;  2EIF A;  3S1Q H;  3J81 j;  3DEP A;  2B2T A;  1IW7 C;  5ELC A;  1Q8I A;  1DON A;  4ZYS A;  2CW0 D;  4L5S A;  3KF6 A;  1BR9 A;  4TVA B;  4MN3 A;  4C2M H;  2UXD L;  3I55 A;  3J80 i;  2YU9 B;  1O78 A;  2K05 A;  3HKZ E;  4RKB A;  4NPS A;  2RSO A;  2UUA L;  4PMB A;  1I3Q B;  1BUV T;  1M4V A;  3TRE A;  4JI6 L;  5KNC A;  4WJ4 A;  1L0W A;  3HOW B;  5KGU A;  1IYJ B;  4HIO A;  1VQH A;  5M3M H;  4DUZ Q;  2XSC A;  1M90 C;  3DWP A;  1HZC A;  1SNP A;  3BVM A;  4X65 L;  1KLU D;  3Q24 A;  1C8C A;  2WAQ E;  4A3G G;  1SRU A;  4KKT A;  1KAW A;  4DR5 Q;  4C3H G;  2PW7 A;  1TWC B;  4BA1 I;  1S5B D;  4AIM A;  2A19 A;  3I4N B;  4DR4 Q;  3C1F A;  3CCU A;  3U4V A;  1LO5 D;  2X69 A;  1PRT B;  1RDP D;  1VMC A;  4KI0 A;  1EQV A;  3PCO B;  3F2C A;  2A73 B;  1DCZ A;  4M8A A;  1VQF A;  1U4M A;  2OWO A;  2B63 B;  1K73 C;  2XNA C;  2KHI A;  2F0K A;  3C3L A;  5J1Z A;  4G57 A;  4C3I H;  2MNA A;  1B44 D;  1EY5 A;  2N49 A;  3U9O A;  1ZYR D;  3Q8D A;  4DUY L;  4JV5 Q;  2WAC A;  3ERO A;  3UI2 A;  1KDC A;  2F0W A;  4Y7N B;  1Y1V H;  3PUW A;  5JJZ A;  1D5M C;  1H9M A;  4ZCK A;  4KY7 A;  5KND A;  1IBL L;  2V4D A;  2L55 A;  1Y1W G;  1BF4 A;  2Q2U A;  4JVZ A;  2EYL A;  3CCM A;  2VUM G;  1YNN C;  1WTX A;  2WAQ G;  2JA5 H;  1HQR D;  5IWA Q;  4QIW B;  2ZJR A;  1SBB B;  1Z47 A;  5I6W A;  2AHO B;  3CKI B;  1NR2 A;  1FJG Q;  4OX9 L;  1PH5 A;  2ATW A;  5KEE A;  2ZJQ A;  1WD0 A;  2B2V C;  1EUJ A;  1N34 Q;  1LAB A;  1SR3 A;  4A3L G;  5JJK A;  3VA7 A;  1OXU A;  2EVB A;  4OHJ A;  4QQB X;  4KKS A;  4B3T L;  5C4J B;  1ILQ A;  5C0X H;  4OEM B;  2ZTC A;  5DNF A;  1K3B C;  4BBR H;  3KBG A;  3H15 A;  2HQL A;  5AFW A;  3UDF A;  1YHQ A;  1HH2 P;  4A3F B;  1H9K A;  3TBI B;  3HKS A;  3FEW X;  2N8N A;  1SSO A;  1S72 A;  2WFW A;  4PZ6 A;  2EJG C;  4V19 0;  2E5L Q;  3R93 A;  5JOB A;  4K0K L;  4DR3 Q;  1JOR A;  1YBY A;  4YIJ A;  4UDU C;  3NUC A;  1YIT A;  1K8A C;  3D31 A;  4CKB A;  2RCF A;  2OXP A;  4A3K G;  1YJN A;  3S1N B;  1LYL A;  3EFX D;  4JBK A;  4C3J H;  1AP0 A;  1VQ5 A;  3T1Y L;  3CRK C;  5ISR A;  2RKS A;  3CCV A;  1B53 A;  4K5V A;  5GRO A;  3I72 A;  1CKN A;  2ZTE A;  1D7Q A;  4JBW A;  2F4V L;  5GQO A;  4LF7 Q;  4A3C H;  2NVX B;  1WCM H;  3P1H A;  5AJ3 L;  2EYF A;  3MZ5 A;  2H4O A;  4XDX A;  4H02 A;  2F03 A;  1NAP A;  1HR0 Q;  2A68 C;  2N55 A;  1WTH A;  3BZK A;  3PUZ A;  5CR3 A;  4A3D G;  1YI2 A;  1C48 A;  3TP6 A;  1PFM A;  4FF4 A;  5EQ0 A;  4PZ8 A;  4L63 B;  1QWY A;  1EZ6 A;  5NUC A;  3RZO B;  5LL6 S;  3I90 A;  1A6X A;  5IY0 A;  2EYJ A;  3S9W A;  3VYS A;  4RHR A;  3PO2 G;  1AE2 A;  5JJI A;  2HCI A;  3HOV B;  2KCN A;  4Q5V A;  3E3X A;  2SNS A;  1N9W A;  5ELN A;  1ASY A;  1B3A A;  4A3J G;  2Q2T A;  4V0B A;  3A7L A;  2K32 A;  3W3A A;  4OEL B;  3HOW H;  4XT3 B;  5C4X G;  3B6Y A;  4F7X A;  1I4Q A;  4LUV A;  2R3Z A;  5C3E B;  1BDO A;  1QUQ B;  1WJJ A;  3SK4 A;  3PO3 H;  2X6G A;  2UUB L;  1JB7 A;  4LF9 Q;  4GNX C;  1L1O B;  2JK8 A;  5GAG C;  2OQ0 A;  1ZXT A;  2LMC B;  4NMZ A;  3A54 A;  1TII D;  1IBM Q;  3QWN A;  4FXD A;  2L0C A;  3I4N H;  5I4D A;  2VQF Q;  3BVZ A;  4RA8 A;  5ELF A;  4B3R Q;  4CDC C;  2AUK A;  4J8Q A;  4DV2 L;  2CVR A;  1GHK A;  4KN4 C;  3A74 A;  1KHI A;  2BDN A;  1X9N A;  2B63 H;  3KDF B;  4IO9 A;  2F0L A;  5C44 G;  3EJI A;  2ID0 A;  3KF8 A;  1N32 Q;  1SDF A;  2ZM6 Q;  2EPB A;  3CCL A;  1V1P A;  1U9R A;  3P20 A;  4MIU A;  3ULL A;  4UY8 C;  2B2V A;  4L6T B;  1HXY D;  1K83 H;  2WB1 B;  2JSO A;  4DR7 L;  2EXZ A;  4IN3 A;  4HJ8 A;  4R8N A;  1JWU D;  5L37 A;  2PMZ B;  4IJL A;  3ULJ A;  4HJ9 A;  2CQA A;  3TDQ A;  2Q2H A;  3JAM E;  4KKU A;  4QIW E;  1PRT F;  2DUD A;  2R92 G;  1S5E D;  2E8G A;  1STA A;  3D4D A;  3QG1 A;  1RJT A;  2BE5 C;  3BU2 A;  1RKN A;  2R6G A;  2XGT A;  1F9S A;  2NN6 G;  1XJV A;  2DGY A;  4KMU C;  1HNW L;  1EIG A;  3S1M B;  4BXX G;  2PZT A;  1E1O A;  1AEX A;  1PYW D;  2NWG A;  3E6Z X;  2CWP A;  4CJ1 B;  5IGD A;  1Q3L A;  4DV6 L;  3HS0 C;  1IL8 A;  2XRQ D;  1XMO Q;  1QZG A;  1VQC A;  2E76 C;  3BS1 A;  4GKJ L;  2IW3 A;  2PNR C;  3D6W A;  1MGS A;  2VXW A;  4IUP A;  4P73 A;  1SFO B;  5E4X A;  3MXG A;  4R8I A;  4QMG A;  3BG3 A;  3W2D A;  4DK3 C;  3FKI H;  1CHQ D;  4DV4 L;  4NXM L;  1STY A;  1EY6 A;  4DV1 Q;  1T5E A;  3SGI A;  1J5E L;  1KC8 C;  5IYB H;  5M5Y B;  1EWC A;  3GP7 A;  3KUP A;  1YVC A;  4JI7 L;  2NVQ B;  1PYB A;  2OEO A;  4GN5 A;  3CW2 C;  2UXC L;  5FLM H;  1ICW A;  1KIX A;  1NMG A;  3HOY B;  1I6H B;  3A0J A;  2F0J A;  4QY7 A;  5EBD A;  4LFB L;  5FLX E;  5JVG 3;  1YZ6 A;  4DA2 A;  3HOZ B;  4ZRZ A;  4P2C B;  4P74 A;  1KDB A;  1VQ9 A;  4JI8 L;  1Q12 A;  2G9H D;  3S2H H;  2I07 B;  3AMU A;  4RG1 A;  1VQ4 A;  1CK1 A;  4A3M H;  5C3W A;  1CA5 A;  2EQS A;  1DXM A;  2IX1 A;  1TY2 A;  1YJW A;  1ZYR C;  1EWH A;  2RHQ B;  3ITP A;  4TRD A;  1E1T A;  1MSH A;  2WII B;  5IT9 c;  1A3T A;  2KA7 A;  2LS0 1;  4B9X A;  1JOO A;  2BA1 A;  1QVC A;  3HOX G;  2XN9 C;  3J7Z C;  1SJE D;  3U9S A;  1EY8 A;  1FYC A;  2AWN A;  1YNN D;  2B2W C;  3PUV A;  3QB3 A;  3RZO H;  3GTM B;  3TP8 A;  3QOJ A;  2ICE C;  5KRU A;  5HGT A;  1EOT A;  3T56 B;  1TWA B;  3TS0 A;  4EQO A;  2WV6 D;  3HOV H;  1W6K A;  1VQA A;  1OXT A;  1X54 A;  4RMF A;  1SN8 A;  2K7V A;  3S1Q B;  5LMU L;  5FK9 C;  1VQI A;  4LF6 L;  4A3E H;  1Q1B A;  2HHH L;  2E2D C;  2MGS A;  5LMN W;  4YHH L;  3FHW A;  4C2M B;  3ND8 A;  2EY6 A;  1LTI D;  5C3E H;  2N88 A;  1C7Y A;  1K3R A;  3CAM A;  1N33 L;  3RN5 A;  1ET9 A;  2AKW B;  2QEJ C;  3OIQ A;  4JOI C;  2CKZ B;  1EU3 A;  3I91 A;  4YCW A;  1PDQ A;  1UE1 A;  2D9U A;  1A63 A;  4CJ0 B;  3V2T A;  4JYA L;  5M3F G;  2UXD Q;  4B9W A;  4UHV A;  2B2T C;  2YTV A;  2UUA Q;  2E75 C;  2SDF A;  1A62 A;  4QF4 A;  3RMH A;  1B3Q A;  1C0A A;  4JI6 Q;  2ALY B;  3PUX A;  1E22 A;  1VQG A;  2I5M X;  4N8X 1;  4N9T A;  4XT1 B;  3T13 A;  2JA7 H;  4KHP L;  3HP3 A;  1T5X D;  3LWE A;  4RGN A;  3O13 A;  1ET6 A;  2MO1 A;  4X65 Q;  2UUC L;  4GS3 A;  2PZW A;  3R8B A;  3U50 C;  3NTI A;  1HQM C;  4PMW A;  3GTQ B;  5IYD H;  4OON A;  4NDX A;  1ENF A;  3T53 B;  4BBS G;  2FJ2 A;  5JJL A;  3FDT A;  1I4X A;  1G6Z A;  3E9I A;  2QDL A;  2RDF A;  1V1O A;  4RGT A;  1SNO A;  3GO5 A;  1B4O A;  1I50 B;  1HA5 A;  4PV1 C;  4WOR A;  3DHQ A;  2JA8 B;  1IBK L;  3Q22 A;  4RFB A;  5EGT A;  1L2F A;  1HUM A;  2KCM A;  4ZK9 B;  4JPB W;  3BVG A;  3H0G B;  4ZUI A;  4ID6 A;  2KOL A;  5IP7 H;  1GOZ A;  3TZD A;  4K6L A;  2A68 D;  3L9A X;  5I9O A;  1BKB A;  3D4W A;  3S1M H;  3DLL A;  1PH6 A;  4DUY Q;  2BDO A;  1F2M A;  2K5H A;  1B9M A;  4YY3 Q;  4BY7 G;  1STG A;  4L5Q A;  2EY1 A;  3MFY A;  4B08 A;  2ZT9 C;  1F9P A;  4DV3 L;  4HED A;  1IBL Q;  4G7O C;  1II3 A;  2Z8L A;  2NYZ D;  1PLF A;  1ASZ A;  1STN A;  3TME A;  1SFO H;  1GUT A;  2IT1 A;  4OL7 A;  2HDM A;  2FMC A;  3DEO A;  3ERQ A;  3C1E A;  1R4Q B;  4CGY B;  5CMD A;  5D3D A;  4OX9 Q;  3MAQ A;  1PTO C;  2ZJP A;  2K03 A;  5E3F A;  1KNA A;  4BBR B;  2GVA A;  3ONA B;  5M5Y H;  1KRS A;  3NE5 B;  3FP9 A;  2D62 A;  4KV6 A;  1HUN A;  3AFQ A;  3TN2 A;  3HOY H;  1I6H H;  1PH1 A;  4B3T Q;  1F2Y A;  1Q90 A;  2NVY H;  1EEI D;  4J15 A;  4ZLT F;  4KTA A;  1G2T A;  3HOZ H;  3KBX A;  3AU7 A;  1R9T B;  4XQQ A;  4POG A;  4JCV E;  2M00 A;  3OSO A;  1D5Z C;  4OGQ C;  2PW5 A;  3GV3 A;  3CCE A;  3HOU B;  4A3D B;  2CFM A;  2K28 A;  1QJO A;  1STH A;  2PQA A;  4C3J B;  1O7I A;  3K5O A;  4A3B H;  2LY7 A;  1WTW A;  1U4R A;  2B39 A;  4JW0 A;  3AQQ A;  4K0K Q;  1CT1 D;  1FD7 D;  3MC0 B;  1WVL A;  1EY7 A;  5KYL A;  4WJ3 M;  3KF6 B;  4L5R C;  1SRO A;  1P16 A;  3VYU A;  3HFZ B;  2D0O A;  3T4A C;  4AYB E;  1KNE A;  2HDL A;  2CQO A;  2WIN B;  1WCM B;  2FFK B;  1EQQ A;  2JYO A;  2F0N A;  4IFD I;  1LTA D;  1SE8 A;  1D1I A;  1WTP A;  1MI2 A;  4JOI A;  4DR1 L;  1TWA H;  2PYK A;  1NUC A;  2HQE A;  2QF7 A;  2JQO A;  2BE5 D;  1SAP A;  1X65 A;  3PGZ A;  4CDE C;  1A3U A;  1QOH A;  5AJ3 Q;  3RLO A;  4A93 B;  3H94 A;  1BNZ A;  4X64 L;  5J39 A;  3RZD B;  2B29 A;  2BOS A;  2Q2I A;  1X55 A;  4G7Z C;  1LTR D;  1V43 A;  2IX3 A;  4GOP C;  1SNM A;  4KJN A;  2KHJ A;  3CQZ B;  1XPU A;  4R4Q A;  2F3I A;  1LM0 A;  3PO3 B;  2LXK A;  1PH7 A;  2F4I A;  5IGE A;  2RVL A;  1E2V A;  1L0X B;  3M4Q A;  4JG2 A;  4JI3 L;  4R9W A;  3K58 A;  2KCT A;  4HSP A;  3NTH A;  2R93 G;  3SXH A;  4G7H C;  5IT9 L;  1HA6 A;  2GVB A;  4AYB G;  4BS9 A;  4LF4 L;  1R4P B;  5IYC G;  4OO1 G;  2F0M A;  4LW1 A;  2BH8 A;  3F2D A;  1J8I A;  3GTO B;  3I70 A;  3GTG B;  4DF7 A;  3GTQ H;  1T9H A;  2VUM H;  1X3G A;  1ESF A;  4UP9 A;  3G71 A;  3VR2 A;  3EVQ A;  4LK1 C;  1O80 A;  4XTC S;  3HGB A;  1HTP A;  1KTK A;  4MHE A;  4YWL A;  3SHL A;  1I50 H;  3GDE A;  3QR8 A;  4J6H A;  3K8A A;  4CHT B;  2JA8 H;  1TT2 A;  4DV2 Q;  1XMQ L;  3GV6 A;  5M5X H;  1E24 A;  5EPL A;  3HKZ G;  3H0G H;  1K83 B;  2ZTD A;  4DAM A;  1LAC A;  2EYH A;  4UPA A;  5M3M G;  4QGU A;  1EFW A;  2O5J C;  4CKE A;  2FIN B;  3BYY B;  3GTL B;  3PF4 A;  4A4I A;  3A8I E;  3K5M A;  1GXD C;  1JJG A;  1C4Q A;  1CSP A;  5IE8 A;  5BR8 L;  1PVO A;  1GD7 A;  4DR7 Q;  1CZG A;  4KY5 A;  5IIF A;  4ABN A;  1IL2 A;  2UXB L;  1TQO A;  4KHZ A;  1KAB A;  1K8M A;  5IOC A;  1KL9 A;  1S5F D;  5IOD A;  1EYA A;  1XX8 A;  2J0T D;  2JE6 I;  4A3K H;  1EL0 A;  3TZU A;  2HIV A;  2VQE L;  2F52 A;  1CUK A;  4C3I G;  3BZC A;  3J80 E;  2A5H A;  2FHT A;  2I5L X;  4RGO S;  4MZ9 A;  4DR6 L;  3MVV A;  3RLF A;  2GN5 A;  3T1H L;  3L7Z C;  3STB C;  2A1A A;  5LMN L;  4K5W A;  4XYO A;  3FKI B;  3A55 A;  4ZUJ A;  4FO2 A;  4CKC A;  1XNR L;  1CKN B;  2HD3 A;  4DV6 Q;  1Y1V G;  5COY A;  2JA6 B;  2JN4 A;  4GKJ Q;  5EPK A;  3S2D B;  4EQ5 A;  1FR3 A;  1E2Z A;  2C9O A;  1R9T H;  1ILP A;  1X3Q A;  5DAU A;  4EQN A;  5KNB A;  2UU9 L;  1SMY D;  1TY0 A;  2FMM A;  1H9S B;  5JVH 3;  4DV4 Q;  1QZH A;  3HOU H;  4A3D H;  2NTS A;  4NXM Q;  2OQK A;  1XXG A;  1MKH A;  1Y8O B;  2SNM A;  4I7A A;  1IYV A;  2PO4 A;  5A2Q L;  1J5E Q;  2OTL A;  3S2H B;  4UP8 A;  2FXQ A;  3PO2 H;  3S15 H;  4JI7 Q;  4IUN A;  4A3M B;  2UXC Q;  1Z9F A;  1VQL A;  3M7N A;  4A3J H;  1DZ1 A;  1LT6 D;  4LFB Q;  4K14 A;  2YV5 A;  4WJW A;  5C0X G;  4NW2 A;  1A8V A;  4OWW B;  1M8A A;  4IPC A;  4N9P A;  2DY8 A;  4JI8 Q;  5E1F A;  1XPR A;  2L11 A;  4IUR A;  4GOP A;  4HCS A;  3A56 A;  4KY6 A;  4X3S A;  2QW7 A;  3FVQ A;  4A3I B;  3KLR A;  2QGQ A;  1J6Q A;  3Q0A A;  1JC7 A;  3F1Z A;  2F0S A;  5K36 H;  1HZA A;  1B50 A;  5G3L D;  5DEH A;  1IYU A;  1OXX K;  2R7Z G;  2RDH A;  2K5Q A;  3MXN A;  4QUC A;  4A93 H;  1HNX L;  4RHS A;  1UAP A;  4GN3 B;  3G7L A;  4ZQ3 A;  2VW9 A;  2E2I B;  2CWA A;  3RZD H;  5E7N A;  2NZO A;  4NXN L;  3CP0 A;  4A3E B;  4XIG S;  1WTR A;  4IFD J;  4ALP A;  1QNK A;  2P5Z X;  3NBH A;  4NP5 A;  3CQZ H;  5C44 H;  4MTN A;  2EYP A;  3KF8 B;  1VQ8 A;  4H13 C;  1UEB A;  1X3P A;  4JI5 L;  4TSS A;  1V1P B;  4BY1 G;  5LMU Q;  1PTO D;  4DV5 L;  2HT1 A;  1BCP C;  1WYD A;  4LF6 Q;  2HHH Q;  4X3U A;  5CV6 A;  1F77 A;  3TQY A;  4A3C G;  4DKA C;  4RCO A;  1RL2 A;  5C4H A;  1I6V C;  3SE0 A;  4YHH Q;  5CV7 A;  2MFI A;  3PF5 A;  2K5W A;  5TSS A;  3H3V C;  1FL0 A;  1HFN A;  2SEB D;  2TSS A;  3GTO H;  3GTG H;  1BBW A;  1VF7 A;  2N78 A;  1N33 Q;  4LFA L;  1SYF A;  1ZKO A;  4R1J A;  1D1K A;  5CV9 A;  4F87 A;  2JA7 B;  1Z7T A;  2R92 H;  1MJC A;  1CZW A;  2AUJ D;  1SXT A;  1GUS A;  4JYA Q;  3NHH A;  2Y0S B;  4F8M A;  5JPM C;  2NN6 H;  3GD7 A;  3RUZ A;  1H95 A;  2EE1 A;  4BY7 B;  4DV7 L;  2F0T A;  4KHP Q;  4JI0 Q;  1NE3 A;  2UUC Q;  4MNO A;  2L12 A;  4YCV A;  4CJ2 C;  3GTL H;  3CU7 A;  2PCF B;  4S3S A;  1PZJ D;  1XTC D;  1NNX A;  2K6A A;  5DM7 3;  2H5X A;  4IOC A;  4FF3 A;  5IWA L;  4IAL A;  5T1I A;  2B2Y C;  1I94 L;  1FNW A;  1JWS D;  3TRZ A;  3I4N G;  5A35 A;  1PH2 A;  1JB3 A;  3LGJ A;  1FJG L;  1IBK Q;  4IUT A;  3ICE A;  1CHP D;  3I4M B;  1HTL D;  3TS2 A;  2B63 G;  3NSW A;  1EOV A;  4LFC L;  3K81 C;  5FJ8 H;  3R2T A;  4B3S L;  5D65 A;  1EYD A;  1O7Y A;  2OF1 A;  4DNR B;  1TU2 B;  2DJG C;  4GLA C;  1VQP A;  2MQH A;  5I2X A;  2WKC A;  3S14 H;  4HJA A;  2DY7 A;  2IL8 A;  2B2U C;  3J7A V;  1BBX C;  5E4W C;  3HEJ A;  3D8G A;  4DV3 Q;  1G6P A;  2JA6 H;  3ERS X;  3S2D H;  2EYO A;  2EJF C;  5CV5 A;  4KD4 A;  3CCS A;  1ENA A;  4IFD H;  2AQ3 B;  3HRZ C;  4GLX A;  1FNV A;  1JOQ A;  4R4O A;  2VZA A;  3NWT A;  2NVY B;  5COR A;  4CDF C;  3HOX H;  1MD2 D;  1TS4 A;  2N3S A;  3H09 A;  3EN2 A;  3ND9 A;  4GNX B;  3U4Z A;  1JIC A;  3P7J A;  4CBV A;  4IUU A;  3RR5 A;  1U4P A;  4AQY L;  4DN4 M;  1XNQ L;  4DU9 A;  3BDC A;  1RD9 D;  2K33 A;  4A3B B;  2Z6K A;  3OMC A;  1AFP A;  1VMP A;  2MHV A;  5EJW A;  4RKL A;  1B1Z A;  3IAY A;  4B3M L;  4LF8 L;  1KXL A;  2F0U A;  4A3F G;  5FOB B;  5JEA J;  5I9P A;  1PYS B;  4A3I H;  5C6A A;  5FO9 B;  1FGB D;  3K59 A;  4DAP A;  3G6J B;  4ME3 A;  1PFB A;  4GLV B;  4H44 C;  4DV0 L;  1O7Z A;  1D5X C;  4OWT B;  4A3G B;  1GUG A;  4M1U B;  1MIU A;  1TKW B;  1U5K A;  2VS1 A;  2RF4 A;  5FLM G;  1SMX A;  3Q23 A;  4C3H B;  4K2K A;  2E2I H;  1HRJ A;  1BVS A;  1NJI C;  3R3O A;  1F9Q A;  3P75 A;  1GJX A;  2ES2 A;  5C3X A;  1KLG D;  2F3V A;  3J81 c;  3D0F A;  1G8Z D;  3OPO A;  2DNC A;  2VL6 A;  1PFS A;  4RAU C;  5K5P A;  3V96 A;  4NKL A;  1X56 A;  1VCI A;  1J9O A;  4K5X A;  4BBS H;  2NVT B;  3ER0 A;  4A75 A;  1MSG A;  1NR4 A;  3STB D;  1BXT A;  3TP5 A;  4DPG A;  1I4P A;  2L9H A;  5BN4 A;  1EFI D;  4FF1 A;  1N36 L;  4L5T A;  3EIV A;  2J7Z A;  1JQY D;  1VF5 C;  3HKZ B;  4QB4 A;  2F0D A;  1SMY C;  2B8G A;  2MUY A;  1Y1W B;  1PH9 A;  2B2Y A;  3HOV G;  1EIH A;  3DWQ A;  3PIP A;  1VQO A;  2VUM B;  4JI3 Q;  2JJQ A;  5F2D A;  5CGK A;  2WAQ B;  4F88 A;  3NPP A;  5D3I B;  2WB1 E;  3UDX A;  2O2L D;  1D6E C;  1SE4 A;  1SYG A;  4BY7 H;  4WFN 3;  4LF4 Q;  2M9V A;  4I65 A;  3CME A;  2PMZ E;  3NEN A;  3J81 i;  5C3E G;  1I4G A;  3PIO A;  5M5X B;  4LF5 L;  3G48 A;  3V05 A;  3X3N A;  3S17 B;  4HID A;  1VQ6 A;  2KHS A;  4EQP A;  3BDO A;  4FXK C;  3R2I A;  4JI2 L;  2B2U A;  3DMU A;  3PQI A;  1RTN A;  1MHW C;  4X3T A;  2C35 B;  1NSN S;  2V1C C;  1XMQ Q;  3LNN A;  1PXU A;  5CYU A;  3I4M H;  3K7A B;  2BCO A;  2I5H A;  3RD4 A;  1VQE A;  1KAA A;  3UE0 A;  3CC4 A;  1ZEQ X;  1WTO A;  4JC0 A;  1JMC A;  1DGS A;  2B3G A;  2NN6 I;  2O5I C;  4IJH A;  5JEA H;  1SEB D;  1D8L A;  1S4Z A;  2XTI A;  3OOC A;  4DXF A;  5IYD G;  1WTQ A;  1F2L A;  1WOC A;  1PHJ A;  2A6E C;  1EIY B;  3PV0 A;  4YWK A;  2KEE A;  3MXP A;  3WOE A;  4A3K B;  5BR8 Q;  3OIP A;  3NQI A;  3BJU A;  2PQA B;  2WB1 G;  1LT5 D;  1YJ9 A;  1CKO A;  2YYZ A;  1QB5 D;  5CV4 A;  1Y8N B;  2E74 C;  2F0O A;  3K5N A;  3C2P A;  1XPO A;  1NY4 A;  2UXB Q;  3KLS X;  1BCP D;  3GQB A;  1CQV A;  3OWF A;  4KHV A;  3E9H A;  3FPP A;  4DK6 C;  2EDG A;  1VQ7 A;  2A74 C;  1PRT C;  5IP7 G;  2RQX A;  3IKJ A;  3A7A B;  4UP7 A;  1F2Z A;  2VQE Q;  3BZD B;  1TVX A;  1V1Q A;  1XTD A;  1TWH B;  1W6J A;  1ESR A;  3RNU A;  3T1H Q;  5IP9 G;  1JJC B;  5LMN Q;  2F0E A;  2K5V A;  2PNH A;  1XNR Q;  1B70 B;  2A6H C;  3A5Z B;  4HMJ A;  4AH6 A;  1RHP A;  1RF2 D;  3MFG A;  3H3V H;  3L2P A;  2D5D A;  3LX0 A;  1H9R A;  1EQR A;  3MTS A;  4HTH A;  4O42 A;  4POF A;  3S15 B;  3KLW A;  3AFP A;  3PO2 B;  3BYT B;  3NTK A;  3K80 C;  1V8Q A;  4GKK L;  3RLN A;  4CDD C;  4JI4 L;  1TWF H;  4LUZ A;  1Q8K A;  4PNY A;  4OIJ A;  3PUY A;  2UU9 Q;  4A3J B;  1I4H A;  1S3O A;  2XIW A;  4BA2 I;  3T1Y Q;  3URY A;  2R7D A;  2K5N A;  5C4X B;  2KCC A;  1YNJ C;  1SNC A;  1IXR A;  3QIA A;  4A3G H;  4PZ7 A;  1TR5 A;  1Y14 B;  2VB2 X;  4C3H H;  1DOL A;  3HOY G;  5DM6 3;  1LT4 D;  5FO7 B;  2F4V Q;  3J7A F;  1BCP F;  1S5D D;  4HIK A;  1ENC A;  4HR7 B;  2K14 A;  1YEZ A;  3HOZ G;  3C46 A;  3EA6 A;  4OO1 H;  1Q1E A;  3MHB A;  4RGM A;  3GTK H;  3F2U A;  1X3F A;  3MWY W;  4JK1 C;  4PMC A;  1XWE A;  3M9B A;  2NVT H;  4DXG A;  4XQN A;  3VYR A;  1KDA A;  1HNZ L;  5C44 B;  1CA6 A;  4OWX B;  1KRT A;  4BWG B;  1HNX Q;  1E3P A;  1QIL A;  4N8F A;  3KLS A;  1BO0 A;  1SND A;  1IKM A;  4NXN Q;  2PI2 E;  4DAY A;  1DOK A;  4X62 L;  1JOK A;  5IGG A;  3M4O H;  2H1E A;  3M4P A;  4G4K A;  4DR2 L;  1YHA A;  1LV9 A;  1Y1W H;  3OTO L;  3M3Y B;  2UUB Q;  3NQT A;  3CC7 A;  1OXV A;  1A2T A;  4XQJ A;  3UDG A;  4JI5 Q;  3OYY A;  5BN3 A;  4DV5 Q;  2R92 B;  1PTO B;  2IHE A;  3BDL A;  4KJO A;  1X32 A;  3EQL C;  5GAH C;  4RCN A;  1VQN A;  4R4I A;  1GKH A;  1HR0 W;  4QL5 A;  1VQD A;  5A2Q E;  3J7Y W;  3SK8 A;  2CH4 A;  4LFA Q;  4A3L H;  2QKI C;  1LT3 D;  4HAE A;  4R4C A;  5HUR A;  1RCV D;  3J81 L;  2DN8 A;  3TP7 A;  4ILW A;  2MP1 A;  3S17 H;  3K6O A;  1JT8 A;  2JP1 A;  4ME5 A;  3NBI A;  2K5D A;  2BA0 A;  2Q8T A;  2RSN A;  1AE3 A;  4KD3 A;  2A69 C;  4IPG A;  1EZ8 A;  1PH4 A;  3K7A H;  5H1S E;  5D14 A;  4JI1 L;  4DV7 Q;  1L0Y B;  4YY3 L;  2QEX A;  3AYH B;  3WDN A;  2ENB A;  4J1M A;  2K04 A;  1YIJ A;  1AN8 A;  2K52 A;  5I2Y A;  2K50 A;  1K9M C;  1HCZ A;  3RN2 A;  3ULP A;  4MTK A;  5CV8 A;  1YHB A;  1I94 Q;  3VR6 A;  4EGV A;  1L1O C;  3S14 B;  4C1N I;  1HNW Q;  2O4X A;  5GAE C;  2JA8 G;  1ONL A;  3UE1 A;  3HG9 A;  1DM0 B;  3T16 A;  4KLK A;  3A8J E;  4X66 L;  3H0G G;  3JAM c;  4LFC Q;  2F0P A;  1JE5 A;  4B3S Q;  3SVM A;  5M5W H;  4Q0F A;  1EY4 A;  2K75 A;  1A15 A;  2VB3 X;  4A76 A;  1WTV A;  1TWH H;  2QDB A;  1FGU A;  1ICF B;  2AQ2 B;  2JA5 G;  3ZJY C;  2QIL A;  4GOP B;  3D4R A;  3L0O A;  1ML0 D;  3M4Y A;  4LAA A;  3HOX B;  1GUN A;  5C5L A;  2KUM A;  4FP5 D;  1CM9 A;  1TS5 A;  2KQ3 A;  5EPJ A;  1HHV A;  2G9D A;  5J3B A;  3MEH A;  2JEA I;  3MXN B;  2R7Z H;  4DNT B;  2AWO A;  1SE2 A;  3CRL C;  2I0Q A;  3H91 A;  3A5U A;  3W1G A;  4K8J A;  4U67 3;  2F0H A;  2OCE A;  1B2T A;  1A0I A;  3VR5 A;  2KEC A;  4GZY C;  1RTO A;  3NBH B;  5C4X H;  4BBR G;  1VDZ A;  4ZAI A;  4DAV A;  2EJM A;  4AQY Q;  1XNQ Q;  1VS0 A;  3M7G A;  1E2W A;  1GUO A;  3JAM i;  4IOA A;  3SEB A;  1I4R A;  4BY1 H;  1F9R A;  2IPK D;  1S5C D;  2Q8R E;  5FLX c;  1KQS A;  3G4S A;  5HY6 A;  4X3K A;  2Z6K C;  3Q6S A;  1VQM A;  4B3M Q;  3TSS A;  5M3F B;  4LF8 Q;  2K01 A;  2D0P A;  2NB0 A;  1O7L A;  4C1N K;  2LFN A;  3H3V I;  3HOU G;  1H9S A;  2RDG A;  3IFD A;  3W5O A;  4C3J G;  1CI3 M;  4HCE A;  5FO8 B;  5IGC A;  3S1R H;  1KD1 C;  4Z9C B;  4APV A;  1K8O A;  1UE5 A;  5DLQ E;  2A6E D;  4DV0 Q;  4DUZ L;  3VDY A;  3AEV A;  2L5T A;  2YTX A;  4DR5 L;  4BBS B;  1DYQ A;  1YNX A;  2YU9 H;  3MXU A;  4R4T A;  3CXC A;  5EKL A;  1I3Q H;  2OT2 A;  1WCM G;  3KK7 A;  3DM1 A;  4IPD A; 
#chains in the Genus database with same CATH homology
 4DR4 L;  4A3F G;  5JEA J;  3Q8D A;  4DUY L;  4OX9 Q;  4JV5 Q;  2RHS B;  2ZJP A;  1PYS B;  2VY3 A;  4A3I H;  2GVA A;  3NEL A;  4HIM A;  5M5Y H;  1KRS A;  1Y1V H;  3M3Y H;  3PUW A;  3FP9 A;  1IBL L;  2D62 A;  4ME3 A;  4GLV B;  4DV0 L;  3AFQ A;  2Q2U A;  1Y1W G;  2A8V A;  2R7F A;  1TWC H;  3CCM A;  3HOY H;  2VUM G;  4OWT B;  1PH1 A;  1I6H H;  4B3T Q;  4OO1 I;  5K36 G;  4YCU A;  1MIU A;  2NVY H;  1U5K A;  2VS1 A;  2WAQ G;  2RF4 A;  4J15 A;  5FLM G;  5IWA Q;  1SMX A;  2JA5 H;  4O2D A;  2E2I H;  3HOZ H;  3PSI A;  2ZJR A;  4A93 G;  1BVS A;  1NJI C;  4DNI A;  1Z47 A;  2AHO B;  4POG A;  4JCV E;  2ES2 A;  1LTL A;  3J81 c;  4BXX H;  1N36 Q;  2KEN A;  1FJG Q;  3CCE A;  4OX9 L;  2CFM A;  3G6E A;  1PH5 A;  2ATW A;  4JV5 L;  3D0F A;  2PQA A;  2ZJQ A;  3HOW G;  1O7I A;  1EUJ A;  2VL6 A;  1N34 Q;  4A3B H;  1V9P A;  1SR3 A;  1PFS A;  4A3L G;  3AQQ A;  4K0K Q;  5JJK A;  1X56 A;  1QUQ A;  1VCI A;  4HJ5 A;  1OXU A;  2CCZ A;  3PO3 G;  4BBS H;  4WJ3 M;  3ER0 A;  4QQB X;  4A75 A;  1PV4 A;  3KF6 B;  1UE6 A;  4L5R C;  1SRO A;  4B3T L;  3STB D;  1L1O A;  1P16 A;  2ZTC A;  1AH9 A;  2HIX A;  2D0O A;  3HFZ B;  4AYB E;  4DPG A;  2CQO A;  4BBR H;  1B8A A;  3H15 A;  2HQL A;  1EQQ A;  3UDF A;  4Y7N H;  1HH2 P;  1YHQ A;  4IFD I;  1N36 L;  2LSS A;  1SE8 A;  4L5T A;  3EIV A;  3HKS A;  4JOI A;  4DR1 L;  2N8N A;  1S72 A;  2WFW A;  1TWA H;  4PZ6 A;  4LF5 Q;  3I7F A;  1N34 L;  3CMA A;  2JQO A;  2E5L Q;  4K0K L;  3KDF A;  4DR3 Q;  1X65 A;  1YBY A;  3PGZ A;  3M85 A;  1PH9 A;  3HOV G;  1YIT A;  1K8A C;  3PIP A;  1VQO A;  3D31 A;  1C9O A;  4JI2 Q;  4JI3 Q;  2JJQ A;  4P75 A;  5AJ3 Q;  4A3K G;  1EYG A;  4X6A H;  1K0R A;  3RLO A;  1YJN A;  2WB1 E;  3UDX A;  1LYL A;  4JBK A;  4BY7 H;  4C3J H;  4X64 L;  4LF4 Q;  1VQ5 A;  1CKM A;  3T1Y L;  2B29 A;  2PMZ E;  2Q2I A;  3CME A;  3NEN A;  1X55 A;  3J81 i;  5C3E G;  4B3M L;  3CCV A;  1V43 A;  3PIO A;  4O0A A;  5GRO A;  4GOP C;  2KHJ A;  4LF5 L;  3G48 A;  2RCN A;  1CKN A;  1XPU A;  4R4Q A;  2E5L L;  1Q82 C;  2F3I A;  1LM0 A;  5C4J H;  1X3E A;  1JJ2 A;  4HID A;  4DR3 L;  2ZTE A;  1VQ6 A;  1D7Q A;  2LXK A;  1PH7 A;  4JBW A;  2F4V L;  5GQO A;  4LF7 Q;  4A3C H;  4JI2 L;  4JI3 L;  4JG2 A;  3M4Q A;  1WCM H;  4OXP A;  2KCT A;  5AJ3 L;  1Q86 C;  3CCQ A;  4A3F H;  2C35 B;  4H02 A;  2R93 G;  2V1C C;  1HR0 Q;  1XMQ Q;  1HZB A;  1GM5 A;  2GVB A;  4AYB G;  3BZK A;  3PUZ A;  1PA6 A;  5IYC G;  1YI2 A;  4LF4 L;  3I4M H;  4A3D G;  4LW1 A;  2BH8 A;  3F2D A;  4OO1 G;  1EIF A;  2I5H A;  4PZ8 A;  1VQE A;  3UE0 A;  3CCJ A;  1UWV A;  3CC4 A;  1JMC A;  3GTQ H;  1T9H A;  3E0E A;  4JC0 A;  5IY0 A;  1X3G A;  2VUM H;  1DGS A;  2B3G A;  2NN6 I;  3PO2 G;  4NB3 A;  4IJH A;  4UP9 A;  5FJ8 G;  1AE2 A;  5JJI A;  3G71 A;  1D8L A;  2XTI A;  5IYD G;  3F2B A;  1PH3 A;  1PHJ A;  1WOC A;  3S1N H;  3KYH C;  4XTC S;  1RIP A;  3I56 A;  1N9W A;  5ELN A;  1ASY A;  4YWL A;  1EIY B;  4LF7 L;  3PV0 A;  4YWK A;  4A3J G;  1I50 H;  3GDE A;  2Q2T A;  5BR8 Q;  3K8A A;  3KJP A;  3BJU A;  3CC2 A;  2JA8 H;  2PQA B;  2WB1 G;  4DV2 Q;  1HR0 L;  3FKI G;  1XMQ L;  3HOW H;  1YJ9 A;  5C4X G;  2YTY A;  1CKO A;  2YYZ A;  3B6Y A;  1E24 A;  5M5X H;  3CD6 A;  3HKZ G;  1M1K C;  3H0G H;  3U58 A;  4LUV A;  1XPO A;  4DAM A;  1NY4 A;  1QUQ B;  1WJJ A;  2ZTD A;  3I2Z A;  2JA6 G;  2UXB Q;  5C0X I;  4UPA A;  1QVF A;  5M3M G;  4QGU A;  1EFW A;  3PO3 H;  3E9H A;  2UUB L;  4DK6 C;  1JB7 A;  5IYB G;  3NEM A;  3DM3 A;  1VQ7 A;  4LF9 Q;  4GNX C;  2NVX H;  1L1O B;  5IP7 G;  4GKK Q;  4IFD G;  3PF4 A;  2JK8 A;  4UP7 A;  5GAG C;  4JI4 Q;  2OQ0 A;  1OTC A;  4A4I A;  2VQE Q;  5M3F H;  1IBM Q;  2VNU D;  3KJO A;  3I4N H;  1V1Q A;  1XTD A;  1JJG A;  2VQF Q;  1CSP A;  1VQB A;  5IE8 A;  3RNU A;  5BR8 L;  3T1H Q;  5IP9 G;  1JJC B;  1PVO A;  4B3R Q;  5LMN Q;  1GD7 A;  4DR7 Q;  2K5V A;  2PNH A;  5ELO A;  4TQU S;  4DV2 L;  1XNR Q;  3A74 A;  1KHI A;  4EX5 A;  4DR1 Q;  4GNX A;  1B70 B;  3A5Z B;  4AH6 A;  3KDF B;  1X9N A;  1IL2 A;  1WI5 A;  2B63 H;  3S24 A;  4IO9 A;  2UXB L;  4KHZ A;  3L2P A;  1X6O A;  4A3M G;  5C44 G;  3H3V H;  3MEF A;  1KL9 A;  1EQR A;  2KBN A;  4POF A;  2ID0 A;  3AFP A;  3KLW A;  4LF9 L;  3K80 C;  4GKK L;  3RLN A;  1N32 Q;  3CF5 A;  2JE6 I;  4YWM A;  4A3K H;  3WWV A;  3CCR A;  1GVP A;  4JI4 L;  1TWF H;  2HIV A;  4LUZ A;  1Q8K A;  2VQE L;  2ZM6 Q;  1IBM L;  2F52 A;  1CUK A;  1FVI A;  1UE7 A;  3PUY A;  2UU9 Q;  3CCL A;  3BZC A;  2I5L X;  3ULL A;  1S3O A;  4MZ9 A;  4UY8 C;  2VQF L;  4DR6 L;  3RLF A;  2GN5 A;  4BA2 I;  4X64 Q;  3T1H L;  1S40 A;  1U0L A;  3L7Z C;  3T1Y Q;  1K83 H;  1W3S A;  3STB C;  2A1A A;  2R7D A;  5LMN L;  1MJE A;  4DR7 L;  4B3R L;  4HJ8 A;  2K5N A;  4A3I G;  1XNR L;  1P8L A;  1CKN B;  2IY5 B;  4DV6 Q;  1GO3 E;  1Y1V G;  2AMC B;  4IJL A;  3ULJ A;  4HJ9 A;  1IXR A;  1HNZ Q;  2IHF A;  4GKJ Q;  4A3G H;  2Q2H A;  4EQ5 A;  4PZ7 A;  2Y0S E;  4QIW E;  1Y14 B;  1G29 1;  2DUD A;  3S16 H;  2R92 G;  4C3H H;  3HOY G;  2K4K A;  2F4V Q;  1WCM G;  1R9T H;  4HIK A;  1N32 L;  2NZH A;  2K14 A;  1YEZ A;  3HOZ G;  2ZM6 L;  3BU2 A;  2UU9 L;  2R6G A;  3UDI A;  4X62 Q;  2XGT A;  4DV4 Q;  4A3E G;  1IZ6 A;  1QZH A;  2NN6 G;  3HOU H;  4NXM Q;  1XJV A;  1Q1E A;  2DGY A;  2OQK A;  3K0X A;  4A3D H;  1HNW L;  4Y52 H;  1MKH A;  3GTK H;  1HJP A;  2WP8 J;  4BXX G;  2BH2 A;  1E1O A;  1X3F A;  2L15 A;  4DR2 Q;  4JI0 L;  2CWP A;  1I5F A;  1QVG A;  1J5E Q;  3F8T A;  2OTL A;  3M9B A;  4UP8 A;  3OTO Q;  3KFU A;  2NVT H;  2FXQ A;  3PO2 H;  4DV6 L;  3S15 H;  2JEB I;  1XMO Q;  1E7Z A;  1QZG A;  4JI7 Q;  1HNZ L;  1VQC A;  4GKJ L;  2UXC Q;  3I4O A;  1Z9F A;  1VQL A;  3M7N A;  4P71 A;  4A3J H;  4OWX B;  1KRT A;  4P73 A;  1HNX Q;  4LFB Q;  1E3P A;  2YV5 A;  5C0X G;  1A8V A;  4OWW B;  4IPC A;  4DK3 C;  4NXN Q;  2PI2 E;  3FKI H;  4X62 L;  4JI8 Q;  4DV4 L;  5GAD C;  1XPR A;  3M4O H;  1NMF A;  4NXM L;  1NBW A;  4GOP A;  5HGQ A;  1LUZ A;  3M4P A;  4P72 A;  4DV1 Q;  3IRB A;  3SGI A;  4DR2 L;  1YHA A;  2QGQ A;  1HZ9 A;  4FDB A;  1J6Q A;  1KC8 C;  2PI2 A;  5IYB H;  1Y1W H;  1J5E L;  2JA7 G;  3OTO L;  2UUB Q;  3CC7 A;  3F1Z A;  1Q81 C;  1YVC A;  1HZA A;  1OXV A;  1XMO L;  1PYB A;  4JI7 L;  4GN5 A;  3CW2 C;  3UDG A;  4JI5 Q;  2UXC L;  3OYY A;  1Q7Y C;  5FLM H;  1OXX K;  4DV5 Q;  2R7Z G;  2Y0S G;  1NMG A;  1KIX A;  2IHE A;  4A93 H;  3A0J A;  5GAH C;  2LXJ A;  4QY7 A;  1HNX L;  4LFB L;  2E2H H;  5IP9 H;  1VQN A;  1YZ6 A;  4GN3 B;  4R4I A;  2VW9 A;  1GKH A;  2CWA A;  3RZD H;  1HR0 W;  4P74 A;  2JA9 A;  4QL5 A;  2NZO A;  5E7N A;  3CP0 A;  1VQD A;  4NXN L;  4JI1 Q;  1VQ9 A;  4XIG S;  4IFD J;  4JI8 L;  1Q12 A;  3S2H H;  4ALP A;  4RG1 A;  4LFA Q;  1VQ4 A;  4DV1 L;  3CQZ H;  4A3M H;  4A3L H;  5C44 H;  2EQS A;  4R4C A;  2Z0S A;  4MTN A;  2IX1 A;  4IPH A;  3S17 H;  3KF8 B;  1VQ8 A;  1YJW A;  1JT8 A;  2OTJ A;  3W1B A;  2RHQ B;  5EAY A;  1E1T A;  1UEB A;  4JI5 L;  2BA0 A;  5IT9 c;  4BY1 G;  5LMU Q;  1AE3 A;  4DV5 L;  4HJ7 A;  4LF6 Q;  1WYD A;  2HT1 A;  1TXY A;  2HHH Q;  3TQY A;  1N8R C;  4A3C G;  4DKA C;  1RL2 A;  4IPG A;  4DR6 Q;  4YHH Q;  3K7U C;  2BA1 A;  1B7Y B;  1QVC A;  1PH4 A;  3K7A H;  2MFI A;  3HOX G;  5H1S E;  3PF5 A;  1FL0 A;  4JI1 L;  1EWI A;  4DV7 Q;  4YY3 L;  4JBM A;  3J7Z C;  3GTO H;  2EXD A;  4X66 Q;  3GTG H;  3PUV A;  2AWN A;  3I4M G;  3RZO H;  1BBW A;  2QEX A;  2N78 A;  3AYH B;  4LFA L;  4LUO A;  1N33 Q;  2NVQ H;  1VQJ A;  4R1J A;  3JC6 6;  4LWC A;  1YIJ A;  1BBU A;  2K52 A;  3CPF A;  3TS0 A;  2R92 H;  3J7A 5;  1MJC A;  2K50 A;  3HOV H;  1K9M C;  4PG3 A;  1VQA A;  5JEA G;  1OXT A;  1X54 A;  1WFQ A;  4RMF A;  1SN8 A;  3RN2 A;  3ULP A;  4JYA Q;  3J80 c;  1YHB A;  5LMU L;  1I94 Q;  1VQI A;  2IX0 A;  3GTJ H;  3CPW A;  4A3E H;  1Q1B A;  4LF6 L;  2HHH L;  3GD7 A;  4QJF A;  4YHH L;  1L1O C;  3FHW A;  5LMN W;  1HNW Q;  1H95 A;  5GAE C;  2JA8 G;  4LNQ A;  3UE1 A;  3KOJ A;  1Q46 A;  5C3E H;  4DV7 L;  4KHP Q;  4KLK A;  4JI0 Q;  4X66 L;  1NE3 A;  1C7Y A;  1K3R A;  3H0G G;  2UUC Q;  3CAM A;  3JAM c;  1N33 L;  4MNO A;  3RN5 A;  4LFC Q;  1JE5 A;  2AKW B;  4B3S Q;  4YCV A;  5M5W H;  3GTL H;  4JOI C;  2CKZ B;  1OXS C;  1VQK A;  1CSQ A;  2K75 A;  4YCW A;  2H5X A;  4A76 A;  1W2B A;  2ASB A;  1UE1 A;  1G51 A;  1TWH H;  4JBJ A;  2QA4 A;  4IOC A;  5IWA L;  1A63 A;  4DAY B;  1FGU A;  4JYA L;  5M3F G;  2UXD Q;  1I94 L;  3ZJY C;  2JA5 G;  3TRZ A;  3I4N G;  2R93 H;  4GOP B;  1PH2 A;  3TEH B;  2YTV A;  3L0O A;  2UUA Q;  1A62 A;  5IYC H;  3GTM H;  1SLJ A;  1C0A A;  3LGJ A;  1FJG L;  1IBK Q;  4JI6 Q;  2ALY B;  3PUX A;  1E22 A;  1VQG A;  2I5M X;  3ICE A;  1TWG H;  2JA7 H;  1K8G A;  1PH8 A;  3TS2 A;  2MO0 A;  5C0X J;  4LF8 L;  4KHP L;  2E2J H;  2MO1 A;  2B63 G;  4X65 Q;  2UUC L;  1EOV A;  1NTG A;  5J3B A;  3GTP H;  4GS3 A;  3K81 C;  4LFC L;  5FJ8 H;  4A3B G;  3OW2 A;  3U50 C;  4B3S L;  2JEA I;  3MXN B;  2R7Z H;  4PMW A;  4GN4 B;  3EBE A;  2EIF A;  2AWO A;  4OON A;  3J81 j;  3S1Q H;  5IYD H;  2I0Q A;  4GLA C;  4BBS G;  5JJL A;  3A5U A;  1VQP A;  3W1G A;  2MQH A;  4L5S A;  3E9I A;  3KF6 A;  4TVA B;  3S14 H;  2OCE A;  4C2M H;  2UXD L;  3I55 A;  3GO5 A;  3J80 i;  4HJA A;  1A0I A;  3HKZ E;  4NPS A;  3NBH B;  2UUA L;  5C4X H;  4BBR G;  1IBK L;  3TRE A;  4DV3 Q;  4JI6 L;  1G6P A;  4WJ4 A;  1L0W A;  4AQY Q;  2JA6 H;  1L2F A;  1IYJ B;  3ERS X;  4HIO A;  1XNQ Q;  1VS0 A;  2KCM A;  1VQH A;  5M3M H;  4DUZ Q;  3S2D H;  1M90 C;  1HZC A;  3CCS A;  4X65 L;  3JAM i;  5IP7 H;  4IOA A;  2WAQ E;  4A3G G;  4BY1 H;  1SRU A;  4DR5 Q;  1KAW A;  4GLX A;  5FLX c;  1KQS A;  3G4S A;  1BKB A;  5HY6 A;  2Z6K C;  4R4O A;  2VZA A;  4BA1 I;  1VQM A;  4B3M Q;  4LF8 Q;  3HOX H;  4AIM A;  2A19 A;  3DLL A;  2N3S A;  3S1M H;  2D0P A;  3CCU A;  3U4V A;  1PH6 A;  4DUY Q;  3EN2 A;  4DR4 Q;  3H3V I;  3HOU G;  2K5H A;  4YY3 Q;  4BY7 G;  4GNX B;  3W5O A;  3U4Z A;  4L5Q A;  3S1R H;  1KD1 C;  4KI0 A;  3PCO B;  4APV A;  3F2C A;  4DV3 L;  1UE5 A;  5DLQ E;  3RR5 A;  4AQY L;  1IBL Q;  1XNQ L;  4DV0 Q;  1VQF A;  4DUZ L;  2OWO A;  3VDY A;  1K73 C;  1ASZ A;  2Z6K A;  2KHI A;  1SFO H;  2IT1 A;  3AEV A;  2YTX A;  4DR5 L;  1YNX A;  2YU9 H;  4R4T A;  4C3I H;  3CXC A;  2MNA A;  1I3Q H;  2N49 A;  2E8G A;  4IPD A;  1KXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...