3GTQH

Backtracked rna polymerase ii complex induced by damage
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtqH00
4P74A 1WOCA 4A3BH 3RLNA 4DUZL 3KDFB 4APVA 1QVCA 1L0WA 3I56A 2ZJRA 4GNXB 3VDYA 4BY1G 4JOIC 4NXML 4R4CA 3SGIA 5FLMH 1TWGH 1X3FA 5LMUL 2R6GA 3RN5A 1PH2A 1IBML 4LNQA 1X55A 4Y52H 3H3VH 1MJEA 3PSIA 2PMZE 2CQOA 5LMNL 1S40A 2VQEL 4X64Q 1JT8A 1KQSA 2E2HH 1N8RC 1YHQA 3A5UA 1IL2A 1Z9FA 4DR3L 3WWVA 2OQ0A 4DR4Q 2HIXA 4JI5Q 1JJCB 3PV0A 4JV5L 2UXBQ 1IBLL 4GOPC 1Q12A 3H15A 3CMAA 4A3FG 1EQQA 4P71A 1KAWA 3J7ZC 5C44G 4LF9L 3GTOH 4GKJL 2JA9A 5LMUQ 4UP8A 4BY7G 1PH4A 1UEBA 3RZDH 4DV7Q 4POGA 4DR7L 3F1ZA 2VQEQ 4HJ8A 2UU9Q 3GD7A 3S17H 1R9TH 1EIFA 2UUBQ 3CCRA 3S16H 5ELNA 4YWLA 2CFMA 1MKHA 2GVBA 4OXPA 2GN5A 4DV2Q 1KHIA 4JBMA 4LFCQ 2UXDQ 2K5HA 2ASBA 4A3BG 1E3PA 1E22A 3PF4A 1VQ9A 5JJLA 5IP9H 3HOVG 1OXXK 3GTKH 4IFDJ 1O7IA 4DR5Q 4JOIA 3STBD 3GTMH 1P8LA 1KRTA 4DV6Q 1L1OA 2KHJA 2AMCB 1YVCA 3GO5A 4OONA 2ZM6L 5ELOA 4JI4Q 2AWOA 2IX1A 4GN5A 1LYLA 1A0IA 1VQ7A 2ATWA 3TREA 1S3OA 5IYBH 1C0AA 1IYJB 4HIMA 2EQSA 1HH2P 1L2FA 5BR8L 4LFCL 4BBRG 1QVGA 4LWCA 2OTLA 3A5ZB 1C9OA 4A3FH 2VL6A 1IBMQ 4RMFA 4BA1I 2EIFA 2I5HA 1K8GA 4BY7H 4PZ6A 2WP8J 2ZM6Q 4LF8Q 4R1JA 1VQ6A 2R92G 4AYBE 1AE2A 2JA6H 2PQAB 3S2DH 3DLLA 2I0QA 1FVIA 4DV3L 3RLFA 1EUJA 3JAMi 1JE5A 3U50C 4BBSG 1NTGA 1I5FA 2K50A 1CSQA 3NBHB 2VQFQ 4P75A 1PH5A 4NB3A 3D0FA 1V1QA 5C0XG 1HNXQ 4BXXG 1W3SA 4DR2L 3A0JA 3PUVA 5JJIA 1GM5A 1CKNB 3L2PA 3KF6B 4LF4Q 4A3IH 3PUYA 1X3GA 1EOVA 4DK3C 2N78A 1Q8KA 3HKSA 4BY1H 1YEZA 1OXTA 3NENA 3CCSA 4O2DA 4DNIA 2ALYB 1YHBA 5E7NA 4L5RC 1OXSC 1AH9A 2Z6KA 4XIGS 4AQYL 4BBRH 4QJFA 4ALPA 4HIKA 1N9WA 5J3BA 2LXKA 3T1YQ 3S14H 4BA2I 2YU9H 2D0PA 5M3MG 3HKZE 4JI7L 3E0EA 3ERSX 5C0XI 4DR2Q 1VQBA 4JBWA 4A3DH 3I2ZA 1PH1A 4NXNL 1FJGQ 4DV1L 1CKMA 5FLXc 3PO3G 1VQGA 2QEXA 3H0GG 2Q2TA 2R92H 1QZGA 3CCLA 1N36Q 4DR4L 3S1QH 1LUZA 2BH8A 3U4ZA 1KIXA 2ZTEA 4LFBQ 4IOAA 5IE8A 4X64L 1VQAA 3K81C 1J6QA 1HR0Q 3KYHC 4JG2A 3G6EA 3KDFA 4GNXA 3T1YL 1ASZA 4JBKA 1XNQL 4A3MH 3JAMc 1VQOA 2IY5B 2IHEA 1NJIC 4Y7NH 1TWAH 3CPFA 4A3IG 2UU9L 2VS1A 1VQMA 1IZ6A 1SN8A 3FKIG 4H02A 4JBJA 2VW9A 2Y0SE 1CUKA 1V43A 4LF8L 4AIMA 2LXJA 3HOWG 4A3MG 3ICEA 1X3EA 4JI3L 2AKWB 3G48A 4A3GG 4A3LH 4PMWA 5C0XJ 2OCEA 4B3TQ 4GOPB 1NE3A 4A75A 3S1NH 1U5KA 3KOJA 3BU2A 4HIDA 4LFBL 3J80i 1HR0L 4LFAQ 4YCVA 3HOWH 3HKZG 2KENA 2E2JH 5C4XH 2XTIA 3RZOH 1K0RA 4DR5L 1VQHA 4A3DG 3KFUA 1VS0A 2QGQA 2UXCQ 3HOZH 1QUQA 2IHFA 4DV6L 1M1KC 2JA7H 4YCUA 1Q7YC 2UXDL 4P72A 2NVYH 4LUOA 4OWTB 3EIVA 3RNUA 2E2IH 2UUAQ 2KHIA 3AFQA 5IWAL 1X6OA 5AJ3L 4MTNA 4B3MQ 2VUMH 5IP7H 3KF8B 1WCMH 1QZHA 1VQ5A 1NMFA 4AH6A 1VQLA 2OQKA 1SROA 4GLVB 4A3LG 2UUAL 4L5SA 1RL2A 3CC7A 3KJOA 2NN6G 4K0KL 4DV4Q 2MO0A 3DM3A 1E24A 2OTJA 4YHHL 1TWHH 4QL5A 4R4TA 4EX5A 1YIJA 5JEAJ 4A3CH 1PH7A 1YNXA 3CCEA 4GKKQ 2K52A 2UXBL 2NVTH 1PHJA 2UUCL 1KL9A 1XJVA 1L1OB 2B3GA 4TVAB 3OTOL 1VQFA 1XPOA 1PA6A 2AHOB 2JA5G 4OWWB 1GO3E 1XNRQ 3CAMA 4C3HH 4DPGA 1Y1VH 4X66Q 1K83H 4YWMA 3PIOA 1PH6A 2PI2E 2E8GA 3TS0A 1X54A 2R7FA 5C4JH 1VQEA 2WAQE 2LSSA 3F2BA 3J7A5 5GROA 3S2HH 2NZHA 1IBKL 1I3QH 5M5YH 2JA5H 2YYZA 2MFIA 5GQOA 1TXYA 2WB1E 1EQRA 2AWNA 4UPAA 3RLOA 3ULLA 3I55A 3CMEA 1YHAA 4A3JG 1J5EQ 1I94Q 1LTLA 1HNXL 3HOUH 1VQJA 2Y0SG 4DKAC 2UUCQ 1CKOA 4GKKL 3OTOQ 1WFQA 5IYDH 3EN2A 1HJPA 3CPWA 4DR6Q 4A93H 2BA1A 2HHHQ 3TQYA 2F4VL 1MJCA 3M9BA 4B3RL 2N8NA 4AYBG 3I4MG 5M5WH 4GOPA 3S24A 2VUMG 4JI1L 2K5VA 4AQYQ 2ZJQA 2Q2IA 1WCMG 2BA0A 4IPDA 1XMQL 3CP0A 3JC66 4LF4L 4KHPL 4JI4L 1WYDA 1K8AC 4JI8Q 1SLJA 1I94L 3K7UC 3J81j 5JJKA 2N49A 3K7AH 2JE6I 4DV1Q 3BZKA 1YJWA 4JI0L 4C3IH 1VQCA 4JI2Q 3PF5A 2JA8G 2R93H 1XTDA 4JI7Q 3PCOB 4JCVE 1E1OA 5FJ8H 1UE6A 1XMQQ 1NBWA 2NN6I 5GADC 1N34Q 2DUDA 3J81i 3CD6A 4DR6L 3K80C 3CQZH 2GVAA 3AYHB 3CW2C 1XNQQ 3NELA 1N32Q 5C3EG 3RN2A 2NVXH 3W1GA 5FJ8G 3HOYH 2MQHA 4DV2L 2B63H 2E5LL 1YZ6A 2K75A 4IJLA 1IXRA 4UP9A 3U58A 1JMCA 3I7FA 4LUZA 3I4MH 5GAGC 2YV5A 1EYGA 1W2BA 4JYAL 5IY0A 4JI2L 1QVFA 2L15A 5C4XG 1AE3A 1NMGA 4OX9L 3UDGA 1VCIA 3STBC 1EWIA 4A3KH 1N34L 4HJ9A 1VQDA 2VZAA 3M4OH 2Z6KC 2PI2A 3LGJA 1XPRA 4R4IA 1VQPA 3W1BA 3KF6A 1S72A 4LF7Q 1P16A 4JI5L 4DR3Q 1KD1C 3NEMA 2ES2A 4B3TL 4MNOA 1IBLQ 1XMOQ 3MEFA 4GN4B 5H1SE 3MXNB 4UP7A 3EBEA 4X65L 5FLMG 2HIVA 2Q2UA 2JA8H 2R93G 3GTQH 2PNHA 4YWKA 2F4VQ 1BVSA 4YY3L 4JYAQ 2MO1A 5GAHC 2WFWA 4GN3B 3RR5A 4X6AH 4JI1Q 3U4VA 3ZJYC 5IYBG 2YTXA 4DV7L 2DGYA 1MIUA 1EFWA 4PZ8A 1Q46A 4QGUA 1SMXA 3HOXG 4HJ5A 1Q1EA 4DAYB 2V1CC 1QUQB 3GTPH 4GLAC 2UUBL 4DV4L 5IWAQ 4GNXC 5IP9G 1YJNA 3GTGH 4YHHQ 4LF7L 4JI6Q 1B8AA 1LM0A 3HOXH 4OO1G 2VQFL 2RHQB 2VY3A 4IO9A 1ASYA 4JI0Q 2I5LX 2K5NA 4LF5Q 3GDEA 1Z47A 1K73C 5C44H 1UWVA 4A3KG 1N33Q 5DLQE 3AEVA 4B3SQ 2RF4A 3L7ZC 1BKBA 3M4PA 1X56A 3UDFA 1FL0A 2JQOA 3H3VI 1JB7A 3E9HA 3AQQA 1OXVA 3UE0A 2IX0A 1XNRL 4A93G 4IOCA 3D31A 3I4NG 1V9PA 4DK6C 2R7DA 1PYSB 1N32L 2HT1A 2R7ZH 4JI6L 1G291 4IPHA 1L1OC 4DAMA 2HQLA 1PH3A 4LF6L 5BR8Q 4NPSA 4IPCA 4DV0Q 2CWAA 4J15A 4PZ7A 1CKNA 1YI2A 4A76A 2ZJPA 2H5XA 3L0OA 3K0XA 4QY7A 1JJGA 4FDBA 1YBYA 4DV5L 2R7ZG 3FKIH 1HNZQ 2OWOA 2D0OA 4OWXB 4BBSH 5HY6A 2WAQG 3IRBA 4PG3A 4B3ML 2ZTCA 4DUYL 5AJ3Q 1B70B 4HJ7A 2XGTA 3ULJA 4BXXH 2CKZB 3F8TA 5M3MH 1K3RA 1SE8A 3CF5A 4DV3Q 2PQAA 3KLWA 2ZTDA 4HIOA 1A8VA 3G71A 1B7YB 4R4QA 1SRUA 1SFOH 2CCZA 3T1HQ 1TWCH 2D62A 2CWPA 3TRZA 3M85A 4JI8L 2B29A 4HJAA 3PO3H 2MNAA 3CCVA 3FP9A 4R4OA 2JK8A 3CCUA 1A63A 4DV5Q 3HOYG 3OW2A 1HNZL 1HZ9A 4C3JH 1GD7A 2K4KA 4XTCS 4NXMQ 2F52A 2QA4A 4IPGA 1SR3A 4JI3Q 1D8LA 3GTJH 2JEAI 3S15H 4OO1I 4UY8C 3PUWA 1Y14B 2A1AA 3CC2A 3Q8DA 2E5LQ 3CCMA 4JV5Q 2EXDA 3M3YH 2FXQA 4IFDI 1PH9A 2KBNA 1Q86C 1TWFH 4QIWE 4ME3A 1NY4A 2A8VA 1J5EL 4GKJQ 3OYYA 4POFA 1N33L 3W5OA 3TS2A 4DR7Q 4B3SL 1OTCA 1Q82C 1Y1WG 1VQNA 3PO2H 4NXNQ 1FJGL 4KLKA 3M4QA 2ID0A 3UDIA 1Y1VG 1RIPA 2IT1A 2N3SA 5M3FH 1BBUA 3FHWA 4LF9Q 1N36L 1OXUA 2HHHL 1VQKA 1YJ9A 4O0AA 4OX9Q 4QQBX 1Q1BA 3KJPA 1M90C 4JC0A 3CCQA 2KCTA 2JA7G 2NZOA 2KCMA 4KHPQ 1T9HA 1GKHA 2JEBI 1VQ8A 2JJQA 5M3FG 1UE7A 4YY3Q 3B6YA 3K8AA 4GLXA 3UDXA 1YITA 1I50H 1K9MC 5EAYA 1E1TA 5IT9c 3ER0A 1A62A 5IYCG 4DUZQ 3BJUA 1G51A 4KI0A 3F2CA 1XMOL 4A4IA 4EQ5A 1VQIA 1BBWA 1HZAA 4KHZA 2I5MX 5HGQA 1WI5A 1XPUA 3G4SA 3HOZG 1HZBA 3H0GH 1H95A 4LUVA 1CSPA 2YTVA 3I4OA 3PUZA 1C7YA 1IBKQ 1UE5A 4LFAL 1PV4A 3T1HL 2YTYA 5GAEC 4YCWA 5IP7G 5JEAG 4X62L 4LF5L 3UE1A 3PGZA 2JA6G 2Z0SA 3HOVH 5K36G 1Y1WH 2F3IA 3HFZB 3A74A 4L5QA 2UXCL 3CC4A 3S1MH 1X9NA 1HNWQ 3PO2G 3M7NA 3AFPA 3PIPA 4MZ9A 1HR0W 3CXCA 4B3RQ 1PVOA 4A3JH 3J81c 3PUXA 4IFDG 4A3GH 4LF6Q 2RCNA 4P73A 3F2DA 4DV0L 1PYBA 1KC8C 3GTLH 2C35B 4K0KQ 4X62Q 1VQ4A 2B63G 1KRSA 4DR1Q 4A3CG 1UE1A 3CCJA 5M5XH 3J80c 1PH8A 5C3EH 3BZCA 2Q2HA 1GVPA 4A3EH 4L5TA 4X65Q 1JJ2A 5IYCH 2NVQH 1HNWL 2VNUD 2BH2A 2RHSB 2WB1G 3I4NH 1X65A 3ULPA 4X66L 1PFSA 1HZCA 3HOUG 4GS3A 1U0LA 3TEHB 1Q81C 4WJ4A 1D7QA 1EIYB 4A3EG 4LW1A 4IJHA 5IYDG 5LMNQ 4RG1A 1E7ZA 5LMNW 3S1RH 4WJ3M 4C2MH 1KXLA 4DUYQ 1DGSA 1FGUA 2A19A 4DR1L 1G6PA 4TQUS 1WJJA 2K14A 1I6HH 3E9IA
chains in the Genus database with same CATH superfamily
4P74A 4DUZL 2ZJRA 1AZPA 2F3VA 1MBYA 3K59A 4R4CA 1E2ZA 3RN5A 1IBML 1SNOA 1MJEA 3PSIA 1ONLA 5LMNL 2C9OA 1KQSA 4EQNA 1YHQA 2B2UA 1CT1D 1Q12A 1EQQA 4KMUC 1NNXA 1KDAA 2KQ3A 2B2VA 3SVMA 1PH4A 4R8NA 3S17H 4C1NK 1R9TH 4OL7A 4I7AA 3CCRA 5ELNA 1CK1A 2RDHA 2MP1A 2B8FA 3TP7A 4LAAA 2UXDQ 3O13A 1E22A 3PF4A 3EJIA 4KJOA 3S1QB 1JOKA 2OEOA 5IP9H 1O7IA 5E3FA 2AMCB 3GO5A 2PPBC 2F0SA 1A2UA 1G2SA 2AWOA 2NZ1D 1LYLA 2R7ZB 1KNAA 2R92B 3Q0AA 4A3BB 4XDXA 5BR8L 1IKMA 2HD3A 2LS01 5I2YA 2OTLA 1B44D 4QUCA 4UHVA 3NUCA 2B2YA 4OO1H 1HA5A 3MAQA 5M5WB 4XYQA 4LF8Q 4XQNA 2Z8LA 1BDOA 2E76C 2JA6H 3S2DH 2F0DA 2RDGA 1II3A 2BCOA 2AQ3B 3DLLA 5A35A 2WKDA 1JQYD 1V8QA 1NTGA 1I5FA 1CSQA 1PH5A 3D0FA 4FO2A 1AP0A 3TDQA 1GHJA 1Y8OB 1GM5A 3L2PA 2D2CC 3CHBD 2DY8A 1BCPD 1EEID 4L5RC 1YHBA 1B2TA 4BS9A 1DYQA 4PNYA 4XIGS 2XWJB 2IPKD 5EKKA 4HIKA 2L55A 2LXKA 3T1YQ 2F0UA 2XVSA 3ERSX 1LLRD 3IFDA 5E4WC 1CKMA 2L9HA 4ILWA 4DK0A 4CKCA 2QEXA 1QZGA 2CH4W 2Z4HA 1LUZA 1LT4D 1KIXA 4YIJA 3L3OC 4IOAA 1VQAA 1ENAA 3BG3A 3KDFA 4GNXA 3T1YL 3NK9A 4ZYSA 3JAMc 4Y7NH 2Z6BA 2AUKA 2DN8A 1DJRD 1AW7A 2UU9L 2VS1A 1IYUA 1B3QA 4JBJA 2EE1A 1CUKA 1V43A 5M9OA 3HOWG 1Z7TA 5C0XJ 4B3TQ 1BCPB 1NE3A 5D65A 1UUPA 4HCSA 4LFAQ 4YCVA 1GUGA 1K0RA 2A69C 4QMGA 5J39A 1ZEQX 2B2WC 4G7OC 3HOZH 2IHFA 4NDXA 5BN5A 3P75A 4P72A 4OWTB 2KHSA 3RNUA 1X6OA 4CDFC 1TWGB 2K05A 1WTQA 3DXJC 2OQKA 1SROA 4GLVB 5JJZA 1DXMA 1GUTA 4ZRZA 3DM3A 5C4ZA 1TWHH 4QL5A 4A3JB 4HSPA 1YNXA 4XQJA 3CCEA 4GKKQ 1IW7D 2NVTH 1KL9A 2D9UA 1L1OB 1XPOA 5C3WA 1XNRQ 1PA6A 2AHOB 1GO3E 3CAMA 1DM0B 4C3HH 5C4HA 4YWMA 2PI2E 1X54A 1TQOA 2R7FA 1TU2B 1Y1VB 3F2BA 3S2HH 1I3QH 2JA5H 2EYHA 4A3EB 5CYUA 2WB1E 3RLOA 1EFWA 1LT3D 3CMEA 2ZT9C 2UUCQ 2Y0SG 4GKKL 3NHHA 1WFQA 4H13C 5KEEA 1CZWA 1PFMA 3TQYA 2F4VL 1MJCA 4B3RL 4UDUC 2F0PA 2RSOA 3A8KE 4JI1L 3QOJA 5IGDA 5IGEA 3MHBA 4AQYQ 4IPDA 3LX0A 3GTMB 5C44B 4JI4L 1PTOH 1WYDA 1SLJA 1DONA 5K36H 1I94L 4UAIA 4C3IB 2JE6I 1F2MA 1CQFA 3OIQA 3BYTB 5IT9L 2JA6B 3RD4A 1EYDA 5EBDA 2E2HB 2NWGA 4JI7Q 5COYA 1XXGA 1UE6A 4CDDC 1NBWA 3J81i 1PTOC 3RN2A 2NVXH 2MQHA 4DV2L 2B63H 2E5LL 2KCNA 4IJLA 3U58A 5EQ0A 3EVQA 3I4MH 1QVFA 2F0GA 3Q24A 1EWIA 1ILQA 1VQDA 1BF4A 2Z6KC 2WB1B 3LGJA 4R4IA 1VQPA 3W1BA 1XPRA 3GTOB 3KF6A 4HTHA 4R8IA 3D3RA 5FO7B 4DR3Q 2F0HA 1KD1C 2ES2A 4A3GB 1RODA 1KABA 4RGOS 3MA2B 5GAHC 2WFWA 4X6AH 5CBAE 4QGUA 3HOXG 1B9NA 3VYUA 1B1ZA 4NKLA 5JOBA 4GLAC 3KBXA 1HXYD 2L12A 4A93B 2B8GA 1B8AA 3BVZA 1XX8A 2VQFL 1QOHA 1KLGD 2K5NA 4LF5Q 1N33Q 2K5DA 1UWVA 4A3KG 2RF4A 2L0CA 1LTAD 3H3VI 2F4IA 1K0SA 2KJXA 1OXVA 5FO8B 4MIUA 1HFNA 3D31A 4K5WA 3I4NG 1PYSB 4CBVA 2DY7A 1TR5A 2HT1A 1SE2A 3TMEA 1XYIA 1L1OC 4QF4A 4DAMA 4RA8A 4NPSA 2WINB 4DV0Q 3S1NB 2ZXRA 3FKIB 5EPKA 1T5EA 4NMZA 3Q23A 2H5XA 1GHKA 3K0XA 3HOWB 4DV5L 2A5HA 5FLXL 3IRBA 1B70B 4BXXH 4QCLA 1WD1A 4PQXA 1SE8A 1IL8A 3HG9A 2ZTDA 1B7YB 3IFTA 4IZ8A 3TRZA 3LWEA 5ELEA 3M85A 1STEA 3CCVA 2JK8A 3CCUA 1A63A 4DV5Q 3OW2A 1HZ9A 5CR3A 1SMYD 5JPNC 3GTJH 2JEAI 5C3XA 4EGVA 3S15H 1GUNA 3RUZA 3CCMA 2EXDA 3M3YH 3A7LA 1LO5D 1MHWC 4LK1C 1EWCA 3T56B 1TWFH 1RCVD 3W5OA 3TS2A 4B3SL 1C48A 3RMHA 1F9RA 4A3DB 1PTOB 3UDIA 3H3VC 1NSNS 5M3FH 1H9RA 4ABNA 2A6EC 2HCIA 1OXUA 1JR0D 2KA7A 4QQBX 1Q1BA 3FRPB 2QKIC 4JC0A 3KJPA 3DEPA 3CCQA 1GKHA 3T51B 2JJQA 5M3FG 2EYFA 1YITA 4GLXA 2SEBD 3KLRA 1M4VA 2F03A 2AQ1B 1ESFA 3ZYYX 1A62A 4DUZQ 1XMOL 4EQ5A 1CHQD 1BBWA 1HZAA 4KY5A 4FXGC 1WI5A 2JA7B 5I9PA 2A6HD 3HOZG 2R93B 1HZBA 3P7JA 1HRJA 3PUZA 3HOVB 4NW2A 1UE5A 4LFAL 1SNDA 1PV4A 3T1HL 3S2DB 4CKBA 3VR4A 5CC4A 2JA6G 5FO9B 1Y1WH 5JAVA 4L5QA 2LFNA 2UXCL 1V1PB 4RH6A 1OO9B 1UNSA 3A7AB 1JWMD 3PUXA 4ODGA 4WRDA 4A3GH 1WVLA 1Q90A 1X3PA 1VQ4A 3GV6A 3PO2B 5C3EH 3GTLB 4RHSA 1JJ2A 4R9WA 2NVQH 3I4NH 2RVLA 4KHVA 4ME5A 2A73B 3ITPA 3HOUG 1GXDC 3TEHB 4KKTA 1Q8IA 1EIYB 4A3EG 5LMNQ 4WJ3M 2A19A 2NVXB 3K57A 5NUCA 2K14A 1I4GA 1QJOA 1SYGA 3KDFB 4GNXB 3I56A 1F9PA 1F77A 3VDYA 4JOIC 1SYEA 4LNQA 1PH2A 3E3XA 1ZYRC 2WIIB 2A6HC 1WTWA 1SNCA 2IJ0A 1S40A 3DM1A 1SSOA 5CV7A 5FK9C 3R8BA 1N8RC 1S5CD 3MXUA 2Z9HA 5BN3A 4JI5Q 3PO3B 1V1PA 1UEAB 4JV5L 2UXBQ 4PV1C 4DXGA 3H15A 4A3FG 4P71A 3J7ZC 3I91A 5I2XA 1Z6HA 5A2QE 1Y69U 1SMYC 4CJ2C 2M9VA 3H91A 3GD7A 3NQIA 4FVMA 4K14A 1EIFA 4DF7A 4BY1B 4KY7A 2GVBA 1U4MA 2GN5A 4DV2Q 5CV5A 4JBMA 1MGSA 1PLFA 1F9SA 4A3BG 5JJLA 3HOVG 1OXXK 3GTKH 4IUNA 4JOIA 4RFBA 2DNCA 4IURA 4ZAIA 1SAPA 1L1OA 4A3KB 1YVCA 1EY9A 2HUGA 1D6EC 4GN5A 1A0IA 3BDCA 1CA5A 2R3ZA 4KN7C 3S2HB 5IYBH 2EQSA 1L2FA 4BBRG 4LWCA 3A5ZB 3DHQA 2EJFC 4K2KA 3HOXB 2HCCA 4IALA 2EIFA 2I5HA 4RMFA 1K8GA 4A3FB 4F7XA 2WP8J 2F0VA 4R1JA 1VQ6A 2R92G 4BY7B 5C0XH 1D2BA 2I0QA 4FF1A 1EUJA 3JAMi 3A8JE 3U50C 4F8MA 3DUZA 3RZOB 1V1QA 5C0XG 1HNXQ 1W3SA 3A0JA 3PUVA 5JJIA 2IX3A 4A3IH 1PYWD 3PUYA 1EOVA 1TWHB 1A15A 3HKSA 1Q8KA 3S16B 3K5MA 1WTOA 4O2DA 3TSSA 1JB3A 1OXSC 2Z6KA 2AUJD 2JYOA 3QWNA 3M3YB 4BBRH 4QJFA 1A2TA 2Z4IA 4DNRB 1N9WA 2X6LA 4JI7L 4FNFA 4Z9CB 4A3DH 3I2ZA 2EDGA 3VA5A 1FJGQ 1KNEA 3PO3G 3H0GG 2Q2TA 2F0EA 1N36Q 4DR4L 1LTRD 2BE5D 2MUYA 4LFBQ 1A3TA 4X64L 3K81C 1HR0Q 1J6QA 1JOQA 2KEDA 4A3MH 5IODA 1UAPA 1VQOA 2IY5B 2J4XA 1NJIC 3MZ5A 3KBGA 3KLSA 1VQMA 1PMRA 1ICWA 3OMGA 4A3MG 3SHLA 2DJFC 2EYOA 2PZWA 3P1HA 4PMWA 4JVZA 3D4RA 4QUFA 1U5KA 2A69D 3D4WA 3BU2A 3V05A 4LFBL 1HR0L 1JWSD 2E2JH 3NWSA 5HGTA 4DR5L 1VQHA 4RGMA 4DV6L 4YCUA 2NVYH 2E2IH 1FD7D 4B3MQ 5M3MB 2KHIA 5E4XA 2UUAQ 2B63B 3KF8B 1WCMH 1VQ5A 4J1MA 4CJ1B 1TVXA 1SFOB 4G7ZC 5J1ZA 3C46A 2A6ED 1RL2A 3CC7A 2NTSA 3KJOA 3NSWA 3R2TA 1EFID 1EYCA 1F2LA 2BE5C 2NVTB 4YHHL 3KUPA 4C3JB 1J8IA 2K52A 2UUCL 1FNWA 2F0MA 1PFBA 2UUAL 4HAEA 2C5CA 1Y1VH 4DPGA 1K83H 2MPMA 4A3LG 3TS0A 5C4JH 1VQEA 4N9TA 2WAQE 2F0WA 3T53B 1PRTC 5I6WA 1KDBA 5GROA 2NZHA 1IBKL 5M5YH 3GTKB 5FOBB 2MFIA 1TXYA 4A3JG 1I94Q 4K5XA 2WAQB 2A74C 3M4YA 1S5FD 1EY7A 2MJ8A 1D5XC 1SJED 4OIKA 4DR6Q 1BOSA 4A93H 1RTNA 3M9BA 2N8NA 3KK7A 4AYBG 4GOPA 3FPUB 3HS0C 2BA0A 1I4QA 3HZXA 4XT1B 3GTJB 3JC66 1A6XA 1HA6A 1D5ZC 1K8AC 1EQVA 4KJNA 3K7UC 2A68C 4CHTB 5JJKA 3K7AH 5G3LF 3QOLA 4DV1Q 1L0YB 4JI0L 3PF5A 4RHRA 1WTHA 4FF3A 2LY7A 3PCOB 1XMQQ 5C4XB 5CORA 1JORA 3CW2C 1XNQQ 3NELA 3W1GA 2VUMB 3NXWA 5ELFA 3SEBA 4B08A 3I7FA 2YV5A 1R9TB 4JYAL 2TMPA 5IY0A 2AQ2B 1L0XB 1XWEA 4DN4M 1B3AA 4A3KH 1I4XA 1H9SA 1GUSA 2PI2A 1R4PB 4FXDA 3C1FA 4LJZC 5LL6S 2BDOA 2G9DA 3EA6A 4HN7A 4JI5L 4LF7Q 5G3LD 2H1EA 3NEMA 1XMOQ 3MEFA 4GN4B 3MXNB 4UP7A 3SK6A 5FLMG 2HIVA 1HUNA 4X3TA 1BVSA 4JYAQ 4FP5D 1DCZA 4MTKA 4DV7L 2YTXA 5F2DA 1Q46A 1TWFB 4HJ5A 1Q1EA 2FJ2A 4DAYB 1QUQB 2UUBL 4DV4L 4GNXC 2CH4A 1YJNA 4LF7L 3K0YA 4KKSA 3K6OA 1BCPF 1LM0A 1PDQA 2B2VC 2RHQB 2VY3A 5IGBA 1IW7C 1ASYA 3MFYA 4B3SQ 3M4PA 3UDFA 3OHXC 1H9KA 1X56A 2K1BA 1I6HB 3TZDA 2JQOA 3SXHA 4C3JG 3UE0A 4A93G 1EQTA 1AEXA 5KIXA 1CA6A 1V9PA 1VMPA 4I7ZC 2RDFA 1AN8A 2K5QA 2HQLA 3EFXD 1SYDA 1PH3A 4LF6L 4KY6A 4IPCA 4AYBB 1YI2A 3HGBA 2M2LA 4QY7A 2R7ZG 4QB4A 1HUMA 1O7YA 4BBSH 2WAQG 4PG3A 4HJ7A 5AJ3Q 2XGTA 1K3RA 3KLWA 3CKIB 4HIOA 3H0GB 1EZ8A 2CCZA 3T1HQ 1TWCH 2CWPA 5L37A 1K83B 2XN9C 4JI8L 1EIGA 4A3MB 4V0BA 4FXKC 3PO3H 3DEOA 2F0TA 1O7ZA 4KD4A 1GD7A 2K4KA 4XTCS 4HCEA 3DMUA 3S15B 1RJTA 3NTIA 1D8LA 2F1MA 1F2YA 1FR3A 1MI2A 3C2PA 4UY8C 3PUWA 3CC2A 1LACA 4JV5Q 4Y7NB 3N6RA 4WFN3 1Q86C 4QIWE 4ME3A 1H9JA 4RGTA 1J5EL 2JN4A 5FKAC 2RQXA 1ILPA 1Q82C 1Y1WG 1VQNA 1FJGL 2NUCA 4C3HG 2ID0A 1ZXTA 3IAYA 1BBUA 3C1EA 3FHWA 5LHY1 4J6HA 1N36L 1SNPA 3E6ZX 4O0AA 3UI2A 4OX9Q 2KCMA 4KHPQ 5JVG3 2NB0A 4YY3Q 1K9MC 3BDLA 4K6DA 1E1TA 4EQPA 1DOKA 4IUPA 3F2CA 3FEWX 4A4IA 1HFGA 1VQIA 1JC7A 4KHZA 5HGQA 3Q22A 1SYFA 4PMCA 1XPUA 1IYVA 4U68A 4LUVA 1CSPA 1E2VA 4OGQC 2YU9B 2E2DC 5JEAG 3UE1A 3PGZA 2Z0SA 5K36G 3F2UA 2F3IA 3HFZB 3A74A 3E5SA 1U4RA 3PIPA 1HR0W 3OIPA 4B3RQ 1A3UA 4ZKCB 2EY2A 3S14B 1VDZA 3GTPB 2LKVA 4IFDG 4A3IB 1EOTA 5CGKA 2KECA 1MSGA 4P73A 3F2DA 1CZGA 4DFAA 1KC8C 3GTLH 4K0KQ 2RSNA 5DM73 2PZUA 2DNEA 1PH8A 3BZCA 2Q2HA 3I4NB 2EYJA 2JXMB 4X65Q 2L5TA 2WB1G 4X66L 2JSOA 2J7ZA 4GS3A 1U0LA 3A54A 4F88A 3PIP3 1EY0A 1LTGD 1T5XD 3SK4A 1RHPA 4LW1A 5IYDG 4IUQA 3TBIB 4HMJA 2Q8TA 3X3MA 3OMCA 1I6HH 3V2TA 4A3BH 2A68D 4NXML 3T4AC 2F0LA 5FLMH 2R6GA 1X55A 4Y52H 4NP5A 3H3VH 2GA4B 2K04A 2PMZE 3OOCA 3VR2A 4X64Q 1JT8A 1H9SB 1SBBB 2FFKB 1ML0D 1IL2A 1Z9FA 4DR3L 1I4RA 3WWVA 1SNQA 2OQ0A 2HIXA 3NE5B 4U673 3PV0A 1IBLL 4GOPC 5C44G 4LF9L 1ET6A 3GTOH 4XT3B 2JA9A 1UEBA 4POGA 3F1ZA 2VQEQ 2PW7A 4HJ8A 2UU9Q 4G57A 3RZDB 1GJXA 4YWLA 2CFMA 2WKCA 4QIWB 2CQAA 5DAUA 2K5HA 4I65A 2ASBA 2PW5A 4ZLTF 2G5DA 3SK5A 4IFDJ 1HHVA 3HP3A 5KNDA 2KHJA 5C6AA 1CI3M 4OONA 2ZM6L 5ELOA 4JI4Q 2WACA 4CDCC 2RBMA 3TREA 3J81E 1IYJB 3R2IA 1HH2P 2HQEA 1LTTD 3IKJA 4A3FH 2VL6A 5LL6X 5J22A 4DGZA 4OIJA 3AMUA 2RKSA 4BY7H 1D1IA 3J81L 2ZM6Q 1Y8NB 2EXZA 5JPMC 1AE2A 2Y0SB 4H7BA 2PQAB 5CV6A 2XRSD 3J7YW 1TWCB 1YNJC 3NBHB 4NB3A 4K6LA 1VMCA 3CRLC 4CGYB 5DNFA 1CKNB 1YEZA 1OXTA 3NENA 3CCSA 4DNIA 3ND9A 5EJWA 4AQYL 3VYSA 3S14H 2D0PA 3HKZE 3QG1A 3E0EA 5C0XI 4JBWA 1PH1A 1K3BC 4N8FA 4EVOA 4RGNA 3HKZB 4C3HB 2EY6A 2PZTA 5I9OA 5KYIA 2R92H 4JK1C 5I6YA 2OT2A 2L11A 5EBCA 3U4ZA 2ZTEA 3HEJA 1GUWA 1HCZA 2SOBA 3KYHC 4JG2A 1ASZA 1IKLA 1HTPA 1YNJD 2IWHA 2IHEA 3CPFA 3GV3A 4A3IG 4XYOA 3J7AF 1SN8A 2VW9A 2Y0SE 4AIMA 1B53A 1X3EA 2F0JA 3G48A 4JI3L 4A3LH 1G8ZD 4GOPB 3W2DA 1LTBD 1TIID 2KENA 5C4XH 4GZYC 4A3DG 2QGQA 2UXCQ 2MHVA 1QUQA 1FNUA 2JA7H 3BVGA 3I4LA 4LUOA 1BBXC 4JI0Q 2VUMH 2KUMA 3GQBA 5CV9A 3Q6SA 4AH6A 4DU9A 3MEHA 1Y1WB 4L5SA 1RDPD 3P20A 4R4TA 4EX5A 1YIJA 5KYLA 5JEAJ 4A3CH 1TT2A 1PH7A 5JVH3 1SYBA 1XJVA 1BR9A 1VQFA 5KNBA 1ENFA 3D4DA 4DR6L 3H09A 2E8GA 3WOEA 4BBSB 1BCPC 3J7AV 4K2LA 2LSSA 4H44C 2ZXOA 1DOMA 1SXTA 2YYZA 5GQOA 3I55A 4FF2A 2K03A 1YHAA 3TP5A 2L1BA 3R3OA 4DKAC 1CKOA 2EVBA 2WV6D 3OTOQ 5IYDH 3EN2A 1HJPA 1O78A 3CPWA 2HHHQ 3W3AA 3I4MG 2VUMG 1KDCA 4O42A 1DOLA 1WCMG 1XMQL 4LF4L 2N88A 4JI8Q 2B2TA 2N55A 5K5PA 5ELCA 1WTVA 1FGBD 1QWYA 2VB3X 2N49A 3N52A 1STNA 4KV6A 3BZKA 3J80E 1YJWA 1VQCA 4K5VA 2F0NA 2EOTA 2XNAC 2JA8G 1KLUD 2K32A 1E1OA 5FJ8H 5BN4A 1HPCA 3IL8A 3AU7A 2NN6I 3SDZA 3CD6A 2RA4A 3CQZH 2B2TC 1NAPA 2GVAA 2O2LD 1SYCA 2L4NA 3HOYH 2K75A 4UP9A 3WDNA 4LUZA 1QNUA 4JPBW 5DEHA 4OX9L 1NMGA 2EYMA 4N8X1 3STBC 3UDGA 1TKWB 1XTCD 1N34L 4HJ9A 3M4OH 2O5JC 5E1FA 1QCBD 4FYDA 1P16A 3S17B 3C3LA 2TSSA 1WTXA 1R4QB 1IBLQ 1ICFB 3CU7A 5H1SE 2B39A 3A55A 3EBEA 2Q8IB 1NCVA 2R93G 2PNHA 4YWKA 3S9WA 4C3IG 5KRUA 2EY1A 3RR5A 2QEJC 1QNKA 1MIUA 2DGYA 3MWYW 1SMXA 4IUUA 3GTPH 5IWAQ 1ENCA 3GTGH 3K5NA 2Q8RE 3HOXH 1PZJD 4OO1G 2NYZD 1I6VC 2I5LX 3K5OA 1Z47A 4RKLA 3AEVA 4PMBA 3L7ZC 1FL0A 4B9WA 1SE3A 3E9HA 3ERQA 2NN6H 2IX0A 4IOCA 1YNNC 5ELDA 3OWEB 1N32L 2KOLA 1ESRA 1G291 1SJHD 5CV4A 5BR8Q 4HSVA 1CKNA 4IUVA 4FDBA 1YBYA 1HNZQ 2QDBA 2LMCB 2OWOA 5HY6A 4BBRB 1I4PA 2ZTCA 5C5LA 3ULJA 5M3MH 4FF4A 2VB2X 2PQAA 2EJGC 1PTOD 1SNMA 1JCKB 5IIFA 1A8VA 2JP1A 3H6MA 3VA7A 1SRUA 1SFOH 3HOUB 2D62A 1FNVA 2B29A 2M00A 3FP9A 1LT6D 1LV9A 1GOZA 1HNZL 3MVVA 4C3JH 2F0FA 3G7LA 4J8QA 2QA4A 4IPGA 1SDFA 3QB3A 4C56C 1Y14B 2A1AA 3GTQB 2E5LQ 3BYYB 3K5LA 1KTKA 4K8IA 2X6GA 2F3WA 1NY4A 4POFA 3DWQA 4TRDA 2OF1A 1OTCA 3MTSA 4B9XA 3PO2H 4KLKA 1RIPA 1TS5A 2N3SA 3U9OA 3MFGA 3MC0B 1VQKA 1RTOA 4ID6A 5IGCA 1HTLD 5CV8A 1LABA 2XIWA 1T9HA 4L8JA 2JEBI 1VQ8A 1EY8A 2NVYB 3V96A 2MGSA 2E2IB 3B6YA 3K8AA 4ZUJA 1I50H 1U9RA 1H9MA 2QF7A 3ER0A 5IYCG 1TWAB 1G51A 3I8ZA 4G7HC 4KKUA 1CM9A 4TSSA 2KVMA 2I5MX 3HOYB 3G4SA 4HMIA 1H95A 2K01A 4KN4C 5T1GA 1IBKQ 5AFWA 3VR6A 2BDNA 2YTYA 4LF5L 4YCWA 4X62L 2IW3A 1JOOA 2JA8B 4BWGB 3CC4A 3S1MH 1X9NA 1HNWQ 3PO2G 3M7NA 3CXCA 1PVOA 4A3JH 1D5MC 2K6AA 1EY5A 4DV0L 1O80A 1G2TA 1STAA 1STYA 1I4HA 2C35B 4X62Q 1UE1A 3CCJA 3T13A 3J80c 1I3QB 1EY4A 2JA5B 1GVPA 4A3EH 2H4OA 3OW7A 3I90A 4X3KA 1HNWL 4Q5VA 2BH2A 2RHSB 3GTGB 1X65A 1J9OA 3VR3A 1PFSA 3JAME 1HZCA 1MSHA 5TSSA 1W6KA 1Q81C 4RG1A 5EPJA 1KXLA 4DUYQ 1G6PA 4DR1L 3HOZB 1PRTB 3LNNA 1NUCA 1WJJA 4A3CG 1WOCA 2FINB 3RLNA 2SNSA 4APVA 1QVCA 1L0WA 4BY1G 1HQRD 3SGIA 1TWGH 1X3FA 5LMUL 2HDMA 2CQOA 1S5ED 4P2CB 2VQEL 3TZUA 2K7VA 2E2HH 3DWPA 3A5UA 4DR4Q 1JJCB 5FLXE 3CMAA 4H0LC 1KAWA 3D6WA 2G9HD 4GKJL 5LMUQ 4UP8A 4BY7G 3RZDH 1AFPA 4DV7Q 4DR7L 1S5DD 1QB5D 2F0QA 4RAUC 2PO4A 2F0IA 3T16A 3URYA 2UUBQ 4DAVA 3S16H 2E74C 1MKHA 3TP8A 5EGTA 4OXPA 1KHIA 2SDFA 4IQZA 4CDEC 4LFCQ 1E3PA 1BQQT 1VQ9A 5JEAH 4N9PA 1TS3A 4DR5Q 3A56A 1STHA 3D8GA 3STBD 3GTMH 1P8LA 1KRTA 3NBIA 5CMDA 4DV6Q 1BUVT 1C8CA 1RF2D 2K33A 2IX1A 4E6IA 3A8IE 1VQ7A 2ATWA 1S3OA 3BS1A 1C0AA 3D6CA 4MHEA 3BDOA 4HIMA 4M8AA 4LFCL 1QVGA 1C9OA 3TP6A 1K8OA 4C1NI 2PMZB 1IBMQ 3I73A 1DZ1A 4BA1I 4DAYA 4KK7A 4PZ6A 1GUOA 2EY5A 2EJMA 4AYBE 1RD9D 2CW0D 1FVIA 4DV3L 3RLFA 5D3DA 1JE5A 4BBSG 2K50A 2VQFQ 4P75A 3R93A 5IOCA 4BXXG 4DR2L 1LTID 1PRTF 3I70A 1NR2A 1PZID 1E0BA 3KF6B 4LF4Q 1X3GA 4DK3C 2N78A 5I4DA 4BY1H 1K8MA 1AH9A 1VF5C 2ALYB 5E7NA 2XWBB 3OPOA 2EYPA 5D3IB 4ALPA 5M5XB 5J3BA 4BA2I 2YU9H 5M3MG 1TS4A 3DWAA 4KD3A 4DR2Q 1VQBA 5IT9E 2PNRC 2E75C 4NXNL 4DV1L 2O4XA 5FLXc 1VQGA 1S4ZA 3ONAB 3CCLA 3PQIA 3S1QH 1KAAA 2BH8A 5C4JB 3HRZC 1CHPD 2EPBA 5IE8A 3G6EA 4JBKA 1WTPA 1XNQL 3K58A 1PZKD 1TWAH 1IZ6A 4H02A 3FKIG 5HURA 4LF8L 2LXJA 3ICEA 2AKWB 1X3QA 4A3GG 4DNTB 3WOFA 2OCEA 4A75A 3S1NH 4KTAA 3KOJA 4ZCKA 4HIDA 3J80i 3HOWH 3HKZG 2XRQD 3RZOH 2QW7A 2XTIA 4RCOA 3CRKC 3NWTA 4DXFA 2B2YC 4Q0FA 1VS0A 5CBEE 3KFUA 1M1KC 3CQZB 1Q7YC 2UXDL 2R61A 3EIVA 3AFQA 5IWAL 5AJ3L 4MTNA 5IP7H 2NTTA 1QZHA 1NMFA 4ZUIA 1F2ZA 1VQLA 2NN6G 4K0KL 4DV4Q 1BNZA 2MO0A 1E24A 2OTJA 3VR5A 4IFDH 2UXBL 1PHJA 2B3GA 4TVAB 3OTOL 2JA5G 4OWWB 3KF8A 4X66Q 4OHJA 3PIOA 1PH6A 2HHHL 1AZQA 1STGA 2PYKA 2ICEC 2ENBA 3J7A5 1K28A 4S3SA 3JAML 1BO0A 1F9QA 1HNXL 3ULLA 1EQRA 2AWNA 4UPAA 1J5EQ 1PFNA 3HOUH 1LTLA 1EL0A 1VQJA 5M3FB 3NTKA 2BA1A 2I07B 4ULLA 1B50A 1LTSD 5C3EB 5M5WH 1E2WA 2ICIA 3S24A 2K5VA 3GP7A 2ZJQA 2Q2IA 2NVQB 3PIO3 4WORA 3CP0A 4DAPA 2B2UC 4KHPL 3FVQA 3G6JB 2EZVA 3J81j 1C4QA 3OSOA 3NTHA 2D5DA 1PTOF 3EROA 1ET9A 2NBFA 5C5MA 4C3IH 4JI2Q 2R93H 1WCMB 1XTDA 2V4DA 4JCVE 4V190 3NBHA 5GADC 1N34Q 2DUDA 3K80C 5IGFA 3AYHB 4XQQA 1N32Q 5C3EG 3NPPA 5FJ8G 1SEBD 1YZ6A 2BOSA 4RWSC 1IXRA 1JMCA 3MXNA 4L6TB 1V1OA 1EEFD 4WJWA 3SK8A 5GAGC 1EYGA 1W2BA 1MD2D 4JI2L 5C4XG 2L15A 3M4OB 1AE3A 1VCIA 2VZAA 1EYAA 1S72A 5ISRA 2PCFB 4B3TL 2EYLA 4MNOA 4X65L 1RKNA 3QIAA 2Q2UA 1JICA 4EQOA 2JA8H 3GTQH 2F4VQ 4YY3L 2MO1A 4GN3B 4JI1Q 3U4VA 1JWUD 3ZJYC 5IYBG 4PZ8A 3U9SA 2K28A 2V1CC 1YNND 4ZK9B 5IP9G 4YHHQ 2OXPA 4JI6Q 4CKEA 3K7AB 2O5IC 1CFMA 1JE4A 1Q3LA 4IO9A 2P5ZX 3S1RB 3GDEA 3PMFA 4C2MB 1K73C 2IL8A 5C44H 5DLQE 1DD2A 1BKBA 3J80L 1JB7A 2RCFA 2QILA 3AQQA 3ND8A 1B4OA 1XNRL 3EQLC 4DK1A 4MN3A 4DK6C 2R7DA 1HQMC 3QJYA 3VYTA 4JI6L 4IPHA 2R7ZH 1S5BD 4RKBA 4X3UA 2CWAA 4J15A 4IUTA 4PZ7A 4A76A 4DA2A 3H94A 2ZJPA 5EKLA 3L0OA 1JJGA 3FKIH 2KEEA 2D0OA 4XXEA 4OWXB 1D1KA 3NP8A 1LT5D 5EPLA 3I3CA 4B3ML 4G4KA 4DUYL 4TKOB 2CKZB 3F8TA 5T1IA 3L9AX 3QO2A 3CF5A 4DV3Q 4X3SA 1EZ6A 3G71A 4R4QA 1CQVA 4OEMB 2I46A 4HJAA 2MNAA 4R4OA 3I72A 5D14A 3X3NA 3NQTA 4HR7B 4ZKBB 4O1NA 3HOYG 1A3VA 2B2WA 4NXMQ 2F52A 1G6ZA 1EIHA 2F0KA 1FYCA 1SR3A 3BZDB 3KLSX 4JI3Q 1WD0A 2KCCA 1STBA 2QDLA 3SR1A 4OO1I 3BVMA 2HDLA 3Q8DA 4IFDI 2FXQA 1CTMA 1PH9A 2KBNA 4JW0A 3M7GA 2A8VA 4GKJQ 3OYYA 1N33L 5EKIA 4DR7Q 3LWUA 2CHBD 4NXNQ 1O7LA 3M4QA 1Y1VG 2IT1A 5DM63 4LF9Q 2XSCA 1EWHA 1VF7A 2Z1CA 1U4LA 3AB9A 1YJ9A 3VYRA 5IGGA 1M90C 2CW0C 1X32A 2KCTA 2JA7G 1M8AA 2FHTA 2FMMA 2NZOA 1I50B 1B9MA 4L63B 3FDTA 1IHZA 1UE7A 3UDXA 4F87A 1WTRA 5EAYA 2CVRA 5IT9c 3I4MB 2X69A 1ZYRD 5ELBA 3MXGA 3BJUA 5A2QL 4KI0A 4IN3A 4HEDA 2E2JB 3MXPA 1G91A 1U4PA 1BXTA 2J0TD 2SNMA 5KGUA 1PRTD 3QR8A 4RCNA 3H0GH 1EY6A 1QG7A 2F0OA 2YTVA 3I4OA 2FMCA 1C7YA 4OELB 3SE0A 1TY0A 5GAEC 5IP7G 3HOVH 3S1MB 4LMQD 1W6JA 2QCPX 1EU4A 3TN2A 1TS2A 3OWFA 3AFPA 4MZ9A 1EU3A 3J81c 4K8JA 1PXUA 4LF6Q 1QE6A 1SE4A 1Y8PB 2RCNA 4M1UB 1PYBA 2ZXPA 5KNCA 2B63G 1KRSA 1ZKOA 4DR1Q 3FMCA 5M5XH 2K5WA 5M5YB 3FPPA 4L5TA 5IYCH 2VNUD 2PQEA 4CJ0B 3ULPA 4WJ4A 1D7QA 3E0JA 2VXWA 1TY2A 4IJHA 1E7ZA 5LMNW 3S1RH 4C2MH 1DGSA 1FGUA 2DJGC 4ZQ3A 4TQUS 1NR4A 1QILA 3E9IA
chains in the Genus database with same CATH topology
4P74A 1WOCA 4A3BH 3RLNA 4DUZL 3KDFB 4APVA 1QVCA 1L0WA 3I56A 2ZJRA 4GNXB 3VDYA 4BY1G 4JOIC 4NXML 4R4CA 3SGIA 5FLMH 1TWGH 1X3FA 5LMUL 2R6GA 3RN5A 1PH2A 1IBML 4LNQA 1X55A 4Y52H 3H3VH 1MJEA 3PSIA 2PMZE 2CQOA 5LMNL 1S40A 2VQEL 4X64Q 1JT8A 1KQSA 2E2HH 1N8RC 1YHQA 3A5UA 1IL2A 1Z9FA 4DR3L 3WWVA 2OQ0A 4DR4Q 2HIXA 4JI5Q 1JJCB 3PV0A 4JV5L 2UXBQ 1IBLL 4GOPC 1Q12A 3H15A 3CMAA 4A3FG 1EQQA 4P71A 1KAWA 3J7ZC 5C44G 4LF9L 3GTOH 4GKJL 2JA9A 5LMUQ 4UP8A 4BY7G 1PH4A 1UEBA 3RZDH 4DV7Q 4POGA 4DR7L 3F1ZA 2VQEQ 4HJ8A 2UU9Q 3GD7A 3S17H 1R9TH 1EIFA 2UUBQ 3CCRA 3S16H 5ELNA 4YWLA 2CFMA 1MKHA 2GVBA 4OXPA 2GN5A 4DV2Q 1KHIA 4JBMA 4LFCQ 2UXDQ 2K5HA 2ASBA 4A3BG 1E3PA 1E22A 3PF4A 1VQ9A 5JJLA 5IP9H 3HOVG 1OXXK 3GTKH 4IFDJ 1O7IA 4DR5Q 4JOIA 3STBD 3GTMH 1P8LA 1KRTA 4DV6Q 1L1OA 2KHJA 2AMCB 1YVCA 3GO5A 4OONA 2ZM6L 5ELOA 4JI4Q 2AWOA 2IX1A 4GN5A 1LYLA 1A0IA 1VQ7A 2ATWA 3TREA 1S3OA 5IYBH 1C0AA 1IYJB 4HIMA 2EQSA 1HH2P 1L2FA 5BR8L 4LFCL 4BBRG 1QVGA 4LWCA 2OTLA 3A5ZB 1C9OA 4A3FH 2VL6A 1IBMQ 4RMFA 4BA1I 2EIFA 2I5HA 1K8GA 4BY7H 4PZ6A 2WP8J 2ZM6Q 4LF8Q 4R1JA 1VQ6A 2R92G 4AYBE 1AE2A 2JA6H 2PQAB 3S2DH 3DLLA 2I0QA 1FVIA 4DV3L 3RLFA 1EUJA 3JAMi 1JE5A 3U50C 4BBSG 1NTGA 1I5FA 2K50A 1CSQA 3NBHB 2VQFQ 4P75A 1PH5A 4NB3A 3D0FA 1V1QA 5C0XG 1HNXQ 4BXXG 1W3SA 4DR2L 3A0JA 3PUVA 5JJIA 1GM5A 1CKNB 3L2PA 3KF6B 4LF4Q 4A3IH 3PUYA 1X3GA 1EOVA 4DK3C 2N78A 1Q8KA 3HKSA 4BY1H 1YEZA 1OXTA 3NENA 3CCSA 4O2DA 4DNIA 2ALYB 1YHBA 5E7NA 4L5RC 1OXSC 1AH9A 2Z6KA 4XIGS 4AQYL 4BBRH 4QJFA 4ALPA 4HIKA 1N9WA 5J3BA 2LXKA 3T1YQ 3S14H 4BA2I 2YU9H 2D0PA 5M3MG 3HKZE 4JI7L 3E0EA 3ERSX 5C0XI 4DR2Q 1VQBA 4JBWA 4A3DH 3I2ZA 1PH1A 4NXNL 1FJGQ 4DV1L 1CKMA 5FLXc 3PO3G 1VQGA 2QEXA 3H0GG 2Q2TA 2R92H 1QZGA 3CCLA 1N36Q 4DR4L 3S1QH 1LUZA 2BH8A 3U4ZA 1KIXA 2ZTEA 4LFBQ 4IOAA 5IE8A 4X64L 1VQAA 3K81C 1J6QA 1HR0Q 3KYHC 4JG2A 3G6EA 3KDFA 4GNXA 3T1YL 1ASZA 4JBKA 1XNQL 4A3MH 3JAMc 1VQOA 2IY5B 2IHEA 1NJIC 4Y7NH 1TWAH 3CPFA 4A3IG 2UU9L 2VS1A 1VQMA 1IZ6A 1SN8A 3FKIG 4H02A 4JBJA 2VW9A 2Y0SE 1CUKA 1V43A 4LF8L 4AIMA 2LXJA 3HOWG 4A3MG 3ICEA 1X3EA 4JI3L 2AKWB 3G48A 4A3GG 4A3LH 4PMWA 5C0XJ 2OCEA 4B3TQ 4GOPB 1NE3A 4A75A 3S1NH 1U5KA 3KOJA 3BU2A 4HIDA 4LFBL 3J80i 1HR0L 4LFAQ 4YCVA 3HOWH 3HKZG 2KENA 2E2JH 5C4XH 2XTIA 3RZOH 1K0RA 4DR5L 1VQHA 4A3DG 3KFUA 1VS0A 2QGQA 2UXCQ 3HOZH 1QUQA 2IHFA 4DV6L 1M1KC 2JA7H 4YCUA 1Q7YC 2UXDL 4P72A 2NVYH 4LUOA 4OWTB 3EIVA 3RNUA 2E2IH 2UUAQ 2KHIA 3AFQA 5IWAL 1X6OA 5AJ3L 4MTNA 4B3MQ 2VUMH 5IP7H 3KF8B 1WCMH 1QZHA 1VQ5A 1NMFA 4AH6A 1VQLA 2OQKA 1SROA 4GLVB 4A3LG 2UUAL 4L5SA 1RL2A 3CC7A 3KJOA 2NN6G 4K0KL 4DV4Q 2MO0A 3DM3A 1E24A 2OTJA 4YHHL 1TWHH 4QL5A 4R4TA 4EX5A 1YIJA 5JEAJ 4A3CH 1PH7A 1YNXA 3CCEA 4GKKQ 2K52A 2UXBL 2NVTH 1PHJA 2UUCL 1KL9A 1XJVA 1L1OB 2B3GA 4TVAB 3OTOL 1VQFA 1XPOA 1PA6A 2AHOB 2JA5G 4OWWB 1GO3E 1XNRQ 3CAMA 4C3HH 4DPGA 1Y1VH 4X66Q 1K83H 4YWMA 3PIOA 1PH6A 2PI2E 2E8GA 3TS0A 1X54A 2R7FA 5C4JH 1VQEA 2WAQE 2LSSA 3F2BA 3J7A5 5GROA 3S2HH 2NZHA 1IBKL 1I3QH 5M5YH 2JA5H 2YYZA 2MFIA 5GQOA 1TXYA 2WB1E 1EQRA 2AWNA 4UPAA 3RLOA 3ULLA 3I55A 3CMEA 1YHAA 4A3JG 1J5EQ 1I94Q 1LTLA 1HNXL 3HOUH 1VQJA 2Y0SG 4DKAC 2UUCQ 1CKOA 4GKKL 3OTOQ 1WFQA 5IYDH 3EN2A 1HJPA 3CPWA 4DR6Q 4A93H 2BA1A 2HHHQ 3TQYA 2F4VL 1MJCA 3M9BA 4B3RL 2N8NA 4AYBG 3I4MG 5M5WH 4GOPA 3S24A 2VUMG 4JI1L 2K5VA 4AQYQ 2ZJQA 2Q2IA 1WCMG 2BA0A 4IPDA 1XMQL 3CP0A 3JC66 4LF4L 4KHPL 4JI4L 1WYDA 1K8AC 4JI8Q 1SLJA 1I94L 3K7UC 3J81j 5JJKA 2N49A 3K7AH 2JE6I 4DV1Q 3BZKA 1YJWA 4JI0L 4C3IH 1VQCA 4JI2Q 3PF5A 2JA8G 2R93H 1XTDA 4JI7Q 3PCOB 4JCVE 1E1OA 5FJ8H 1UE6A 1XMQQ 1NBWA 2NN6I 5GADC 1N34Q 2DUDA 3J81i 3CD6A 4DR6L 3K80C 3CQZH 2GVAA 3AYHB 3CW2C 1XNQQ 3NELA 1N32Q 5C3EG 3RN2A 2NVXH 3W1GA 5FJ8G 3HOYH 2MQHA 4DV2L 2B63H 2E5LL 1YZ6A 2K75A 4IJLA 1IXRA 4UP9A 3U58A 1JMCA 3I7FA 4LUZA 3I4MH 5GAGC 2YV5A 1EYGA 1W2BA 4JYAL 5IY0A 4JI2L 1QVFA 2L15A 5C4XG 1AE3A 1NMGA 4OX9L 3UDGA 1VCIA 3STBC 1EWIA 4A3KH 1N34L 4HJ9A 1VQDA 2VZAA 3M4OH 2Z6KC 2PI2A 3LGJA 1XPRA 4R4IA 1VQPA 3W1BA 3KF6A 1S72A 4LF7Q 1P16A 4JI5L 4DR3Q 1KD1C 3NEMA 2ES2A 4B3TL 4MNOA 1IBLQ 1XMOQ 3MEFA 4GN4B 5H1SE 3MXNB 4UP7A 3EBEA 4X65L 5FLMG 2HIVA 2Q2UA 2JA8H 2R93G 3GTQH 2PNHA 4YWKA 2F4VQ 1BVSA 4YY3L 4JYAQ 2MO1A 5GAHC 2WFWA 4GN3B 3RR5A 4X6AH 4JI1Q 3U4VA 3ZJYC 5IYBG 2YTXA 4DV7L 2DGYA 1MIUA 1EFWA 4PZ8A 1Q46A 4QGUA 1SMXA 3HOXG 4HJ5A 1Q1EA 4DAYB 2V1CC 1QUQB 3GTPH 4GLAC 2UUBL 4DV4L 5IWAQ 4GNXC 5IP9G 1YJNA 3GTGH 4YHHQ 4LF7L 4JI6Q 1B8AA 1LM0A 3HOXH 4OO1G 2VQFL 2RHQB 2VY3A 4IO9A 1ASYA 4JI0Q 2I5LX 2K5NA 4LF5Q 3GDEA 1Z47A 1K73C 5C44H 1UWVA 4A3KG 1N33Q 5DLQE 3AEVA 4B3SQ 2RF4A 3L7ZC 1BKBA 3M4PA 1X56A 3UDFA 1FL0A 2JQOA 3H3VI 1JB7A 3E9HA 3AQQA 1OXVA 3UE0A 2IX0A 1XNRL 4A93G 4IOCA 3D31A 3I4NG 1V9PA 4DK6C 2R7DA 1PYSB 1N32L 2HT1A 2R7ZH 4JI6L 1G291 4IPHA 1L1OC 4DAMA 2HQLA 1PH3A 4LF6L 5BR8Q 4NPSA 4IPCA 4DV0Q 2CWAA 4J15A 4PZ7A 1CKNA 1YI2A 4A76A 2ZJPA 2H5XA 3L0OA 3K0XA 4QY7A 1JJGA 4FDBA 1YBYA 4DV5L 2R7ZG 3FKIH 1HNZQ 2OWOA 2D0OA 4OWXB 4BBSH 5HY6A 2WAQG 3IRBA 4PG3A 4B3ML 2ZTCA 4DUYL 5AJ3Q 1B70B 4HJ7A 2XGTA 3ULJA 4BXXH 2CKZB 3F8TA 5M3MH 1K3RA 1SE8A 3CF5A 4DV3Q 2PQAA 3KLWA 2ZTDA 4HIOA 1A8VA 3G71A 1B7YB 4R4QA 1SRUA 1SFOH 2CCZA 3T1HQ 1TWCH 2D62A 2CWPA 3TRZA 3M85A 4JI8L 2B29A 4HJAA 3PO3H 2MNAA 3CCVA 3FP9A 4R4OA 2JK8A 3CCUA 1A63A 4DV5Q 3HOYG 3OW2A 1HNZL 1HZ9A 4C3JH 1GD7A 2K4KA 4XTCS 4NXMQ 2F52A 2QA4A 4IPGA 1SR3A 4JI3Q 1D8LA 3GTJH 2JEAI 3S15H 4OO1I 4UY8C 3PUWA 1Y14B 2A1AA 3CC2A 3Q8DA 2E5LQ 3CCMA 4JV5Q 2EXDA 3M3YH 2FXQA 4IFDI 1PH9A 2KBNA 1Q86C 1TWFH 4QIWE 4ME3A 1NY4A 2A8VA 1J5EL 4GKJQ 3OYYA 4POFA 1N33L 3W5OA 3TS2A 4DR7Q 4B3SL 1OTCA 1Q82C 1Y1WG 1VQNA 3PO2H 4NXNQ 1FJGL 4KLKA 3M4QA 2ID0A 3UDIA 1Y1VG 1RIPA 2IT1A 2N3SA 5M3FH 1BBUA 3FHWA 4LF9Q 1N36L 1OXUA 2HHHL 1VQKA 1YJ9A 4O0AA 4OX9Q 4QQBX 1Q1BA 3KJPA 1M90C 4JC0A 3CCQA 2KCTA 2JA7G 2NZOA 2KCMA 4KHPQ 1T9HA 1GKHA 2JEBI 1VQ8A 2JJQA 5M3FG 1UE7A 4YY3Q 3B6YA 3K8AA 4GLXA 3UDXA 1YITA 1I50H 1K9MC 5EAYA 1E1TA 5IT9c 3ER0A 1A62A 5IYCG 4DUZQ 3BJUA 1G51A 4KI0A 3F2CA 1XMOL 4A4IA 4EQ5A 1VQIA 1BBWA 1HZAA 4KHZA 2I5MX 5HGQA 1WI5A 1XPUA 3G4SA 3HOZG 1HZBA 3H0GH 1H95A 4LUVA 1CSPA 2YTVA 3I4OA 3PUZA 1C7YA 1IBKQ 1UE5A 4LFAL 1PV4A 3T1HL 2YTYA 5GAEC 4YCWA 5IP7G 5JEAG 4X62L 4LF5L 3UE1A 3PGZA 2JA6G 2Z0SA 3HOVH 5K36G 1Y1WH 2F3IA 3HFZB 3A74A 4L5QA 2UXCL 3CC4A 3S1MH 1X9NA 1HNWQ 3PO2G 3M7NA 3AFPA 3PIPA 4MZ9A 1HR0W 3CXCA 4B3RQ 1PVOA 4A3JH 3J81c 3PUXA 4IFDG 4A3GH 4LF6Q 2RCNA 4P73A 3F2DA 4DV0L 1PYBA 1KC8C 3GTLH 2C35B 4K0KQ 4X62Q 1VQ4A 2B63G 1KRSA 4DR1Q 4A3CG 1UE1A 3CCJA 5M5XH 3J80c 1PH8A 5C3EH 3BZCA 2Q2HA 1GVPA 4A3EH 4L5TA 4X65Q 1JJ2A 5IYCH 2NVQH 1HNWL 2VNUD 2BH2A 2RHSB 2WB1G 3I4NH 1X65A 3ULPA 4X66L 1PFSA 1HZCA 3HOUG 4GS3A 1U0LA 3TEHB 1Q81C 4WJ4A 1D7QA 1EIYB 4A3EG 4LW1A 4IJHA 5IYDG 5LMNQ 4RG1A 1E7ZA 5LMNW 3S1RH 4WJ3M 4C2MH 1KXLA 4DUYQ 1DGSA 1FGUA 2A19A 4DR1L 1G6PA 4TQUS 1WJJA 2K14A 1I6HH 3E9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P74 A;  1WOC A;  4A3B H;  3RLN A;  4DUZ L;  3KDF B;  4APV A;  1QVC A;  1L0W A;  3I56 A;  2ZJR A;  4GNX B;  3VDY A;  4BY1 G;  4JOI C;  4NXM L;  4R4C A;  3SGI A;  5FLM H;  1TWG H;  1X3F A;  5LMU L;  2R6G A;  3RN5 A;  1PH2 A;  1IBM L;  4LNQ A;  1X55 A;  4Y52 H;  3H3V H;  1MJE A;  3PSI A;  2PMZ E;  2CQO A;  5LMN L;  1S40 A;  2VQE L;  4X64 Q;  1JT8 A;  1KQS A;  2E2H H;  1N8R C;  1YHQ A;  3A5U A;  1IL2 A;  1Z9F A;  4DR3 L;  3WWV A;  2OQ0 A;  4DR4 Q;  2HIX A;  4JI5 Q;  1JJC B;  3PV0 A;  4JV5 L;  2UXB Q;  1IBL L;  4GOP C;  1Q12 A;  3H15 A;  3CMA A;  4A3F G;  1EQQ A;  4P71 A;  1KAW A;  3J7Z C;  5C44 G;  4LF9 L;  3GTO H;  4GKJ L;  2JA9 A;  5LMU Q;  4UP8 A;  4BY7 G;  1PH4 A;  1UEB A;  3RZD H;  4DV7 Q;  4POG A;  4DR7 L;  3F1Z A;  2VQE Q;  4HJ8 A;  2UU9 Q;  3GD7 A;  3S17 H;  1R9T H;  1EIF A;  2UUB Q;  3CCR A;  3S16 H;  5ELN A;  4YWL A;  2CFM A;  1MKH A;  2GVB A;  4OXP A;  2GN5 A;  4DV2 Q;  1KHI A;  4JBM A;  4LFC Q;  2UXD Q;  2K5H A;  2ASB A;  4A3B G;  1E3P A;  1E22 A;  3PF4 A;  1VQ9 A;  5JJL A;  5IP9 H;  3HOV G;  1OXX K;  3GTK H;  4IFD J;  1O7I A;  4DR5 Q;  4JOI A;  3STB D;  3GTM H;  1P8L A;  1KRT A;  4DV6 Q;  1L1O A;  2KHJ A;  2AMC B;  1YVC A;  3GO5 A;  4OON A;  2ZM6 L;  5ELO A;  4JI4 Q;  2AWO A;  2IX1 A;  4GN5 A;  1LYL A;  1A0I A;  1VQ7 A;  2ATW A;  3TRE A;  1S3O A;  5IYB H;  1C0A A;  1IYJ B;  4HIM A;  2EQS A;  1HH2 P;  1L2F A;  5BR8 L;  4LFC L;  4BBR G;  1QVG A;  4LWC A;  2OTL A;  3A5Z B;  1C9O A;  4A3F H;  2VL6 A;  1IBM Q;  4RMF A;  4BA1 I;  2EIF A;  2I5H A;  1K8G A;  4BY7 H;  4PZ6 A;  2WP8 J;  2ZM6 Q;  4LF8 Q;  4R1J A;  1VQ6 A;  2R92 G;  4AYB E;  1AE2 A;  2JA6 H;  2PQA B;  3S2D H;  3DLL A;  2I0Q A;  1FVI A;  4DV3 L;  3RLF A;  1EUJ A;  3JAM i;  1JE5 A;  3U50 C;  4BBS G;  1NTG A;  1I5F A;  2K50 A;  1CSQ A;  3NBH B;  2VQF Q;  4P75 A;  1PH5 A;  4NB3 A;  3D0F A;  1V1Q A;  5C0X G;  1HNX Q;  4BXX G;  1W3S A;  4DR2 L;  3A0J A;  3PUV A;  5JJI A;  1GM5 A;  1CKN B;  3L2P A;  3KF6 B;  4LF4 Q;  4A3I H;  3PUY A;  1X3G A;  1EOV A;  4DK3 C;  2N78 A;  1Q8K A;  3HKS A;  4BY1 H;  1YEZ A;  1OXT A;  3NEN A;  3CCS A;  4O2D A;  4DNI A;  2ALY B;  1YHB A;  5E7N A;  4L5R C;  1OXS C;  1AH9 A;  2Z6K A;  4XIG S;  4AQY L;  4BBR H;  4QJF A;  4ALP A;  4HIK A;  1N9W A;  5J3B A;  2LXK A;  3T1Y Q;  3S14 H;  4BA2 I;  2YU9 H;  2D0P A;  5M3M G;  3HKZ E;  4JI7 L;  3E0E A;  3ERS X;  5C0X I;  4DR2 Q;  1VQB A;  4JBW A;  4A3D H;  3I2Z A;  1PH1 A;  4NXN L;  1FJG Q;  4DV1 L;  1CKM A;  5FLX c;  3PO3 G;  1VQG A;  2QEX A;  3H0G G;  2Q2T A;  2R92 H;  1QZG A;  3CCL A;  1N36 Q;  4DR4 L;  3S1Q H;  1LUZ A;  2BH8 A;  3U4Z A;  1KIX A;  2ZTE A;  4LFB Q;  4IOA A;  5IE8 A;  4X64 L;  1VQA A;  3K81 C;  1J6Q A;  1HR0 Q;  3KYH C;  4JG2 A;  3G6E A;  3KDF A;  4GNX A;  3T1Y L;  1ASZ A;  4JBK A;  1XNQ L;  4A3M H;  3JAM c;  1VQO A;  2IY5 B;  2IHE A;  1NJI C;  4Y7N H;  1TWA H;  3CPF A;  4A3I G;  2UU9 L;  2VS1 A;  1VQM A;  1IZ6 A;  1SN8 A;  3FKI G;  4H02 A;  4JBJ A;  2VW9 A;  2Y0S E;  1CUK A;  1V43 A;  4LF8 L;  4AIM A;  2LXJ A;  3HOW G;  4A3M G;  3ICE A;  1X3E A;  4JI3 L;  2AKW B;  3G48 A;  4A3G G;  4A3L H;  4PMW A;  5C0X J;  2OCE A;  4B3T Q;  4GOP B;  1NE3 A;  4A75 A;  3S1N H;  1U5K A;  3KOJ A;  3BU2 A;  4HID A;  4LFB L;  3J80 i;  1HR0 L;  4LFA Q;  4YCV A;  3HOW H;  3HKZ G;  2KEN A;  2E2J H;  5C4X H;  2XTI A;  3RZO H;  1K0R A;  4DR5 L;  1VQH A;  4A3D G;  3KFU A;  1VS0 A;  2QGQ A;  2UXC Q;  3HOZ H;  1QUQ A;  2IHF A;  4DV6 L;  1M1K C;  2JA7 H;  4YCU A;  1Q7Y C;  2UXD L;  4P72 A;  2NVY H;  4LUO A;  4OWT B;  3EIV A;  3RNU A;  2E2I H;  2UUA Q;  2KHI A;  3AFQ A;  5IWA L;  1X6O A;  5AJ3 L;  4MTN A;  4B3M Q;  2VUM H;  5IP7 H;  3KF8 B;  1WCM H;  1QZH A;  1VQ5 A;  1NMF A;  4AH6 A;  1VQL A;  2OQK A;  1SRO A;  4GLV B;  4A3L G;  2UUA L;  4L5S A;  1RL2 A;  3CC7 A;  3KJO A;  2NN6 G;  4K0K L;  4DV4 Q;  2MO0 A;  3DM3 A;  1E24 A;  2OTJ A;  4YHH L;  1TWH H;  4QL5 A;  4R4T A;  4EX5 A;  1YIJ A;  5JEA J;  4A3C H;  1PH7 A;  1YNX A;  3CCE A;  4GKK Q;  2K52 A;  2UXB L;  2NVT H;  1PHJ A;  2UUC L;  1KL9 A;  1XJV A;  1L1O B;  2B3G A;  4TVA B;  3OTO L;  1VQF A;  1XPO A;  1PA6 A;  2AHO B;  2JA5 G;  4OWW B;  1GO3 E;  1XNR Q;  3CAM A;  4C3H H;  4DPG A;  1Y1V H;  4X66 Q;  1K83 H;  4YWM A;  3PIO A;  1PH6 A;  2PI2 E;  2E8G A;  3TS0 A;  1X54 A;  2R7F A;  5C4J H;  1VQE A;  2WAQ E;  2LSS A;  3F2B A;  3J7A 5;  5GRO A;  3S2H H;  2NZH A;  1IBK L;  1I3Q H;  5M5Y H;  2JA5 H;  2YYZ A;  2MFI A;  5GQO A;  1TXY A;  2WB1 E;  1EQR A;  2AWN A;  4UPA A;  3RLO A;  3ULL A;  3I55 A;  3CME A;  1YHA A;  4A3J G;  1J5E Q;  1I94 Q;  1LTL A;  1HNX L;  3HOU H;  1VQJ A;  2Y0S G;  4DKA C;  2UUC Q;  1CKO A;  4GKK L;  3OTO Q;  1WFQ A;  5IYD H;  3EN2 A;  1HJP A;  3CPW A;  4DR6 Q;  4A93 H;  2BA1 A;  2HHH Q;  3TQY A;  2F4V L;  1MJC A;  3M9B A;  4B3R L;  2N8N A;  4AYB G;  3I4M G;  5M5W H;  4GOP A;  3S24 A;  2VUM G;  4JI1 L;  2K5V A;  4AQY Q;  2ZJQ A;  2Q2I A;  1WCM G;  2BA0 A;  4IPD A;  1XMQ L;  3CP0 A;  3JC6 6;  4LF4 L;  4KHP L;  4JI4 L;  1WYD A;  1K8A C;  4JI8 Q;  1SLJ A;  1I94 L;  3K7U C;  3J81 j;  5JJK A;  2N49 A;  3K7A H;  2JE6 I;  4DV1 Q;  3BZK A;  1YJW A;  4JI0 L;  4C3I H;  1VQC A;  4JI2 Q;  3PF5 A;  2JA8 G;  2R93 H;  1XTD A;  4JI7 Q;  3PCO B;  4JCV E;  1E1O A;  5FJ8 H;  1UE6 A;  1XMQ Q;  1NBW A;  2NN6 I;  5GAD C;  1N34 Q;  2DUD A;  3J81 i;  3CD6 A;  4DR6 L;  3K80 C;  3CQZ H;  2GVA A;  3AYH B;  3CW2 C;  1XNQ Q;  3NEL A;  1N32 Q;  5C3E G;  3RN2 A;  2NVX H;  3W1G A;  5FJ8 G;  3HOY H;  2MQH A;  4DV2 L;  2B63 H;  2E5L L;  1YZ6 A;  2K75 A;  4IJL A;  1IXR A;  4UP9 A;  3U58 A;  1JMC A;  3I7F A;  4LUZ A;  3I4M H;  5GAG C;  2YV5 A;  1EYG A;  1W2B A;  4JYA L;  5IY0 A;  4JI2 L;  1QVF A;  2L15 A;  5C4X G;  1AE3 A;  1NMG A;  4OX9 L;  3UDG A;  1VCI A;  3STB C;  1EWI A;  4A3K H;  1N34 L;  4HJ9 A;  1VQD A;  2VZA A;  3M4O H;  2Z6K C;  2PI2 A;  3LGJ A;  1XPR A;  4R4I A;  1VQP A;  3W1B A;  3KF6 A;  1S72 A;  4LF7 Q;  1P16 A;  4JI5 L;  4DR3 Q;  1KD1 C;  3NEM A;  2ES2 A;  4B3T L;  4MNO A;  1IBL Q;  1XMO Q;  3MEF A;  4GN4 B;  5H1S E;  3MXN B;  4UP7 A;  3EBE A;  4X65 L;  5FLM G;  2HIV A;  2Q2U A;  2JA8 H;  2R93 G;  3GTQ H;  2PNH A;  4YWK A;  2F4V Q;  1BVS A;  4YY3 L;  4JYA Q;  2MO1 A;  5GAH C;  2WFW A;  4GN3 B;  3RR5 A;  4X6A H;  4JI1 Q;  3U4V A;  3ZJY C;  5IYB G;  2YTX A;  4DV7 L;  2DGY A;  1MIU A;  1EFW A;  4PZ8 A;  1Q46 A;  4QGU A;  1SMX A;  3HOX G;  4HJ5 A;  1Q1E A;  4DAY B;  2V1C C;  1QUQ B;  3GTP H;  4GLA C;  2UUB L;  4DV4 L;  5IWA Q;  4GNX C;  5IP9 G;  1YJN A;  3GTG H;  4YHH Q;  4LF7 L;  4JI6 Q;  1B8A A;  1LM0 A;  3HOX H;  4OO1 G;  2VQF L;  2RHQ B;  2VY3 A;  4IO9 A;  1ASY A;  4JI0 Q;  2I5L X;  2K5N A;  4LF5 Q;  3GDE A;  1Z47 A;  1K73 C;  5C44 H;  1UWV A;  4A3K G;  1N33 Q;  5DLQ E;  3AEV A;  4B3S Q;  2RF4 A;  3L7Z C;  1BKB A;  3M4P A;  1X56 A;  3UDF A;  1FL0 A;  2JQO A;  3H3V I;  1JB7 A;  3E9H A;  3AQQ A;  1OXV A;  3UE0 A;  2IX0 A;  1XNR L;  4A93 G;  4IOC A;  3D31 A;  3I4N G;  1V9P A;  4DK6 C;  2R7D A;  1PYS B;  1N32 L;  2HT1 A;  2R7Z H;  4JI6 L;  1G29 1;  4IPH A;  1L1O C;  4DAM A;  2HQL A;  1PH3 A;  4LF6 L;  5BR8 Q;  4NPS A;  4IPC A;  4DV0 Q;  2CWA A;  4J15 A;  4PZ7 A;  1CKN A;  1YI2 A;  4A76 A;  2ZJP A;  2H5X A;  3L0O A;  3K0X A;  4QY7 A;  1JJG A;  4FDB A;  1YBY A;  4DV5 L;  2R7Z G;  3FKI H;  1HNZ Q;  2OWO A;  2D0O A;  4OWX B;  4BBS H;  5HY6 A;  2WAQ G;  3IRB A;  4PG3 A;  4B3M L;  2ZTC A;  4DUY L;  5AJ3 Q;  1B70 B;  4HJ7 A;  2XGT A;  3ULJ A;  4BXX H;  2CKZ B;  3F8T A;  5M3M H;  1K3R A;  1SE8 A;  3CF5 A;  4DV3 Q;  2PQA A;  3KLW A;  2ZTD A;  4HIO A;  1A8V A;  3G71 A;  1B7Y B;  4R4Q A;  1SRU A;  1SFO H;  2CCZ A;  3T1H Q;  1TWC H;  2D62 A;  2CWP A;  3TRZ A;  3M85 A;  4JI8 L;  2B29 A;  4HJA A;  3PO3 H;  2MNA A;  3CCV A;  3FP9 A;  4R4O A;  2JK8 A;  3CCU A;  1A63 A;  4DV5 Q;  3HOY G;  3OW2 A;  1HNZ L;  1HZ9 A;  4C3J H;  1GD7 A;  2K4K A;  4XTC S;  4NXM Q;  2F52 A;  2QA4 A;  4IPG A;  1SR3 A;  4JI3 Q;  1D8L A;  3GTJ H;  2JEA I;  3S15 H;  4OO1 I;  4UY8 C;  3PUW A;  1Y14 B;  2A1A A;  3CC2 A;  3Q8D A;  2E5L Q;  3CCM A;  4JV5 Q;  2EXD A;  3M3Y H;  2FXQ A;  4IFD I;  1PH9 A;  2KBN A;  1Q86 C;  1TWF H;  4QIW E;  4ME3 A;  1NY4 A;  2A8V A;  1J5E L;  4GKJ Q;  3OYY A;  4POF A;  1N33 L;  3W5O A;  3TS2 A;  4DR7 Q;  4B3S L;  1OTC A;  1Q82 C;  1Y1W G;  1VQN A;  3PO2 H;  4NXN Q;  1FJG L;  4KLK A;  3M4Q A;  2ID0 A;  3UDI A;  1Y1V G;  1RIP A;  2IT1 A;  2N3S A;  5M3F H;  1BBU A;  3FHW A;  4LF9 Q;  1N36 L;  1OXU A;  2HHH L;  1VQK A;  1YJ9 A;  4O0A A;  4OX9 Q;  4QQB X;  1Q1B A;  3KJP A;  1M90 C;  4JC0 A;  3CCQ A;  2KCT A;  2JA7 G;  2NZO A;  2KCM A;  4KHP Q;  1T9H A;  1GKH A;  2JEB I;  1VQ8 A;  2JJQ A;  5M3F G;  1UE7 A;  4YY3 Q;  3B6Y A;  3K8A A;  4GLX A;  3UDX A;  1YIT A;  1I50 H;  1K9M C;  5EAY A;  1E1T A;  5IT9 c;  3ER0 A;  1A62 A;  5IYC G;  4DUZ Q;  3BJU A;  1G51 A;  4KI0 A;  3F2C A;  1XMO L;  4A4I A;  4EQ5 A;  1VQI A;  1BBW A;  1HZA A;  4KHZ A;  2I5M X;  5HGQ A;  1WI5 A;  1XPU A;  3G4S A;  3HOZ G;  1HZB A;  3H0G H;  1H95 A;  4LUV A;  1CSP A;  2YTV A;  3I4O A;  3PUZ A;  1C7Y A;  1IBK Q;  1UE5 A;  4LFA L;  1PV4 A;  3T1H L;  2YTY A;  5GAE C;  4YCW A;  5IP7 G;  5JEA G;  4X62 L;  4LF5 L;  3UE1 A;  3PGZ A;  2JA6 G;  2Z0S A;  3HOV H;  5K36 G;  1Y1W H;  2F3I A;  3HFZ B;  3A74 A;  4L5Q A;  2UXC L;  3CC4 A;  3S1M H;  1X9N A;  1HNW Q;  3PO2 G;  3M7N A;  3AFP A;  3PIP A;  4MZ9 A;  1HR0 W;  3CXC A;  4B3R Q;  1PVO A;  4A3J H;  3J81 c;  3PUX A;  4IFD G;  4A3G H;  4LF6 Q;  2RCN A;  4P73 A;  3F2D A;  4DV0 L;  1PYB A;  1KC8 C;  3GTL H;  2C35 B;  4K0K Q;  4X62 Q;  1VQ4 A;  2B63 G;  1KRS A;  4DR1 Q;  4A3C G;  1UE1 A;  3CCJ A;  5M5X H;  3J80 c;  1PH8 A;  5C3E H;  3BZC A;  2Q2H A;  1GVP A;  4A3E H;  4L5T A;  4X65 Q;  1JJ2 A;  5IYC H;  2NVQ H;  1HNW L;  2VNU D;  2BH2 A;  2RHS B;  2WB1 G;  3I4N H;  1X65 A;  3ULP A;  4X66 L;  1PFS A;  1HZC A;  3HOU G;  4GS3 A;  1U0L A;  3TEH B;  1Q81 C;  4WJ4 A;  1D7Q A;  1EIY B;  4A3E G;  4LW1 A;  4IJH A;  5IYD G;  5LMN Q;  4RG1 A;  1E7Z A;  5LMN W;  3S1R H;  4WJ3 M;  4C2M H;  1KXL A;  4DUY Q;  1DGS A;  1FGU A;  2A19 A;  4DR1 L;  1G6P A;  4TQU S;  1WJJ A;  2K14 A;  1I6H H;  3E9I A; 
#chains in the Genus database with same CATH topology
 4P74 A;  4DUZ L;  2ZJR A;  1AZP A;  2F3V A;  1MBY A;  3K59 A;  4R4C A;  1E2Z A;  3RN5 A;  1IBM L;  1SNO A;  1MJE A;  3PSI A;  1ONL A;  5LMN L;  2C9O A;  1KQS A;  4EQN A;  1YHQ A;  2B2U A;  1CT1 D;  1Q12 A;  1EQQ A;  4KMU C;  1NNX A;  1KDA A;  2KQ3 A;  2B2V A;  3SVM A;  1PH4 A;  4R8N A;  3S17 H;  4C1N K;  1R9T H;  4OL7 A;  4I7A A;  3CCR A;  5ELN A;  1CK1 A;  2RDH A;  2MP1 A;  2B8F A;  3TP7 A;  4LAA A;  2UXD Q;  3O13 A;  1E22 A;  3PF4 A;  3EJI A;  4KJO A;  3S1Q B;  1JOK A;  2OEO A;  5IP9 H;  1O7I A;  5E3F A;  2AMC B;  3GO5 A;  2PPB C;  2F0S A;  1A2U A;  1G2S A;  2AWO A;  2NZ1 D;  1LYL A;  2R7Z B;  1KNA A;  2R92 B;  3Q0A A;  4A3B B;  4XDX A;  5BR8 L;  1IKM A;  2HD3 A;  2LS0 1;  5I2Y A;  2OTL A;  1B44 D;  4QUC A;  4UHV A;  3NUC A;  2B2Y A;  4OO1 H;  1HA5 A;  3MAQ A;  5M5W B;  4XYQ A;  4LF8 Q;  4XQN A;  2Z8L A;  1BDO A;  2E76 C;  2JA6 H;  3S2D H;  2F0D A;  2RDG A;  1II3 A;  2BCO A;  2AQ3 B;  3DLL A;  5A35 A;  2WKD A;  1JQY D;  1V8Q A;  1NTG A;  1I5F A;  1CSQ A;  1PH5 A;  3D0F A;  4FO2 A;  1AP0 A;  3TDQ A;  1GHJ A;  1Y8O B;  1GM5 A;  3L2P A;  2D2C C;  3CHB D;  2DY8 A;  1BCP D;  1EEI D;  4L5R C;  1YHB A;  1B2T A;  4BS9 A;  1DYQ A;  4PNY A;  4XIG S;  2XWJ B;  2IPK D;  5EKK A;  4HIK A;  2L55 A;  2LXK A;  3T1Y Q;  2F0U A;  2XVS A;  3ERS X;  1LLR D;  3IFD A;  5E4W C;  1CKM A;  2L9H A;  4ILW A;  4DK0 A;  4CKC A;  2QEX A;  1QZG A;  2CH4 W;  2Z4H A;  1LUZ A;  1LT4 D;  1KIX A;  4YIJ A;  3L3O C;  4IOA A;  1VQA A;  1ENA A;  3BG3 A;  3KDF A;  4GNX A;  3T1Y L;  3NK9 A;  4ZYS A;  3JAM c;  4Y7N H;  2Z6B A;  2AUK A;  2DN8 A;  1DJR D;  1AW7 A;  2UU9 L;  2VS1 A;  1IYU A;  1B3Q A;  4JBJ A;  2EE1 A;  1CUK A;  1V43 A;  5M9O A;  3HOW G;  1Z7T A;  5C0X J;  4B3T Q;  1BCP B;  1NE3 A;  5D65 A;  1UUP A;  4HCS A;  4LFA Q;  4YCV A;  1GUG A;  1K0R A;  2A69 C;  4QMG A;  5J39 A;  1ZEQ X;  2B2W C;  4G7O C;  3HOZ H;  2IHF A;  4NDX A;  5BN5 A;  3P75 A;  4P72 A;  4OWT B;  2KHS A;  3RNU A;  1X6O A;  4CDF C;  1TWG B;  2K05 A;  1WTQ A;  3DXJ C;  2OQK A;  1SRO A;  4GLV B;  5JJZ A;  1DXM A;  1GUT A;  4ZRZ A;  3DM3 A;  5C4Z A;  1TWH H;  4QL5 A;  4A3J B;  4HSP A;  1YNX A;  4XQJ A;  3CCE A;  4GKK Q;  1IW7 D;  2NVT H;  1KL9 A;  2D9U A;  1L1O B;  1XPO A;  5C3W A;  1XNR Q;  1PA6 A;  2AHO B;  1GO3 E;  3CAM A;  1DM0 B;  4C3H H;  5C4H A;  4YWM A;  2PI2 E;  1X54 A;  1TQO A;  2R7F A;  1TU2 B;  1Y1V B;  3F2B A;  3S2H H;  1I3Q H;  2JA5 H;  2EYH A;  4A3E B;  5CYU A;  2WB1 E;  3RLO A;  1EFW A;  1LT3 D;  3CME A;  2ZT9 C;  2UUC Q;  2Y0S G;  4GKK L;  3NHH A;  1WFQ A;  4H13 C;  5KEE A;  1CZW A;  1PFM A;  3TQY A;  2F4V L;  1MJC A;  4B3R L;  4UDU C;  2F0P A;  2RSO A;  3A8K E;  4JI1 L;  3QOJ A;  5IGD A;  5IGE A;  3MHB A;  4AQY Q;  4IPD A;  3LX0 A;  3GTM B;  5C44 B;  4JI4 L;  1PTO H;  1WYD A;  1SLJ A;  1DON A;  5K36 H;  1I94 L;  4UAI A;  4C3I B;  2JE6 I;  1F2M A;  1CQF A;  3OIQ A;  3BYT B;  5IT9 L;  2JA6 B;  3RD4 A;  1EYD A;  5EBD A;  2E2H B;  2NWG A;  4JI7 Q;  5COY A;  1XXG A;  1UE6 A;  4CDD C;  1NBW A;  3J81 i;  1PTO C;  3RN2 A;  2NVX H;  2MQH A;  4DV2 L;  2B63 H;  2E5L L;  2KCN A;  4IJL A;  3U58 A;  5EQ0 A;  3EVQ A;  3I4M H;  1QVF A;  2F0G A;  3Q24 A;  1EWI A;  1ILQ A;  1VQD A;  1BF4 A;  2Z6K C;  2WB1 B;  3LGJ A;  4R4I A;  1VQP A;  3W1B A;  1XPR A;  3GTO B;  3KF6 A;  4HTH A;  4R8I A;  3D3R A;  5FO7 B;  4DR3 Q;  2F0H A;  1KD1 C;  2ES2 A;  4A3G B;  1ROD A;  1KAB A;  4RGO S;  3MA2 B;  5GAH C;  2WFW A;  4X6A H;  5CBA E;  4QGU A;  3HOX G;  1B9N A;  3VYU A;  1B1Z A;  4NKL A;  5JOB A;  4GLA C;  3KBX A;  1HXY D;  2L12 A;  4A93 B;  2B8G A;  1B8A A;  3BVZ A;  1XX8 A;  2VQF L;  1QOH A;  1KLG D;  2K5N A;  4LF5 Q;  1N33 Q;  2K5D A;  1UWV A;  4A3K G;  2RF4 A;  2L0C A;  1LTA D;  3H3V I;  2F4I A;  1K0S A;  2KJX A;  1OXV A;  5FO8 B;  4MIU A;  1HFN A;  3D31 A;  4K5W A;  3I4N G;  1PYS B;  4CBV A;  2DY7 A;  1TR5 A;  2HT1 A;  1SE2 A;  3TME A;  1XYI A;  1L1O C;  4QF4 A;  4DAM A;  4RA8 A;  4NPS A;  2WIN B;  4DV0 Q;  3S1N B;  2ZXR A;  3FKI B;  5EPK A;  1T5E A;  4NMZ A;  3Q23 A;  2H5X A;  1GHK A;  3K0X A;  3HOW B;  4DV5 L;  2A5H A;  5FLX L;  3IRB A;  1B70 B;  4BXX H;  4QCL A;  1WD1 A;  4PQX A;  1SE8 A;  1IL8 A;  3HG9 A;  2ZTD A;  1B7Y B;  3IFT A;  4IZ8 A;  3TRZ A;  3LWE A;  5ELE A;  3M85 A;  1STE A;  3CCV A;  2JK8 A;  3CCU A;  1A63 A;  4DV5 Q;  3OW2 A;  1HZ9 A;  5CR3 A;  1SMY D;  5JPN C;  3GTJ H;  2JEA I;  5C3X A;  4EGV A;  3S15 H;  1GUN A;  3RUZ A;  3CCM A;  2EXD A;  3M3Y H;  3A7L A;  1LO5 D;  1MHW C;  4LK1 C;  1EWC A;  3T56 B;  1TWF H;  1RCV D;  3W5O A;  3TS2 A;  4B3S L;  1C48 A;  3RMH A;  1F9R A;  4A3D B;  1PTO B;  3UDI A;  3H3V C;  1NSN S;  5M3F H;  1H9R A;  4ABN A;  2A6E C;  2HCI A;  1OXU A;  1JR0 D;  2KA7 A;  4QQB X;  1Q1B A;  3FRP B;  2QKI C;  4JC0 A;  3KJP A;  3DEP A;  3CCQ A;  1GKH A;  3T51 B;  2JJQ A;  5M3F G;  2EYF A;  1YIT A;  4GLX A;  2SEB D;  3KLR A;  1M4V A;  2F03 A;  2AQ1 B;  1ESF A;  3ZYY X;  1A62 A;  4DUZ Q;  1XMO L;  4EQ5 A;  1CHQ D;  1BBW A;  1HZA A;  4KY5 A;  4FXG C;  1WI5 A;  2JA7 B;  5I9P A;  2A6H D;  3HOZ G;  2R93 B;  1HZB A;  3P7J A;  1HRJ A;  3PUZ A;  3HOV B;  4NW2 A;  1UE5 A;  4LFA L;  1SND A;  1PV4 A;  3T1H L;  3S2D B;  4CKB A;  3VR4 A;  5CC4 A;  2JA6 G;  5FO9 B;  1Y1W H;  5JAV A;  4L5Q A;  2LFN A;  2UXC L;  1V1P B;  4RH6 A;  1OO9 B;  1UNS A;  3A7A B;  1JWM D;  3PUX A;  4ODG A;  4WRD A;  4A3G H;  1WVL A;  1Q90 A;  1X3P A;  1VQ4 A;  3GV6 A;  3PO2 B;  5C3E H;  3GTL B;  4RHS A;  1JJ2 A;  4R9W A;  2NVQ H;  3I4N H;  2RVL A;  4KHV A;  4ME5 A;  2A73 B;  3ITP A;  3HOU G;  1GXD C;  3TEH B;  4KKT A;  1Q8I A;  1EIY B;  4A3E G;  5LMN Q;  4WJ3 M;  2A19 A;  2NVX B;  3K57 A;  5NUC A;  2K14 A;  1I4G A;  1QJO A;  1SYG A;  3KDF B;  4GNX B;  3I56 A;  1F9P A;  1F77 A;  3VDY A;  4JOI C;  1SYE A;  4LNQ A;  1PH2 A;  3E3X A;  1ZYR C;  2WII B;  2A6H C;  1WTW A;  1SNC A;  2IJ0 A;  1S40 A;  3DM1 A;  1SSO A;  5CV7 A;  5FK9 C;  3R8B A;  1N8R C;  1S5C D;  3MXU A;  2Z9H A;  5BN3 A;  4JI5 Q;  3PO3 B;  1V1P A;  1UEA B;  4JV5 L;  2UXB Q;  4PV1 C;  4DXG A;  3H15 A;  4A3F G;  4P71 A;  3J7Z C;  3I91 A;  5I2X A;  1Z6H A;  5A2Q E;  1Y69 U;  1SMY C;  4CJ2 C;  2M9V A;  3H91 A;  3GD7 A;  3NQI A;  4FVM A;  4K14 A;  1EIF A;  4DF7 A;  4BY1 B;  4KY7 A;  2GVB A;  1U4M A;  2GN5 A;  4DV2 Q;  5CV5 A;  4JBM A;  1MGS A;  1PLF A;  1F9S A;  4A3B G;  5JJL A;  3HOV G;  1OXX K;  3GTK H;  4IUN A;  4JOI A;  4RFB A;  2DNC A;  4IUR A;  4ZAI A;  1SAP A;  1L1O A;  4A3K B;  1YVC A;  1EY9 A;  2HUG A;  1D6E C;  4GN5 A;  1A0I A;  3BDC A;  1CA5 A;  2R3Z A;  4KN7 C;  3S2H B;  5IYB H;  2EQS A;  1L2F A;  4BBR G;  4LWC A;  3A5Z B;  3DHQ A;  2EJF C;  4K2K A;  3HOX B;  2HCC A;  4IAL A;  2EIF A;  2I5H A;  4RMF A;  1K8G A;  4A3F B;  4F7X A;  2WP8 J;  2F0V A;  4R1J A;  1VQ6 A;  2R92 G;  4BY7 B;  5C0X H;  1D2B A;  2I0Q A;  4FF1 A;  1EUJ A;  3JAM i;  3A8J E;  3U50 C;  4F8M A;  3DUZ A;  3RZO B;  1V1Q A;  5C0X G;  1HNX Q;  1W3S A;  3A0J A;  3PUV A;  5JJI A;  2IX3 A;  4A3I H;  1PYW D;  3PUY A;  1EOV A;  1TWH B;  1A15 A;  3HKS A;  1Q8K A;  3S16 B;  3K5M A;  1WTO A;  4O2D A;  3TSS A;  1JB3 A;  1OXS C;  2Z6K A;  2AUJ D;  2JYO A;  3QWN A;  3M3Y B;  4BBR H;  4QJF A;  1A2T A;  2Z4I A;  4DNR B;  1N9W A;  2X6L A;  4JI7 L;  4FNF A;  4Z9C B;  4A3D H;  3I2Z A;  2EDG A;  3VA5 A;  1FJG Q;  1KNE A;  3PO3 G;  3H0G G;  2Q2T A;  2F0E A;  1N36 Q;  4DR4 L;  1LTR D;  2BE5 D;  2MUY A;  4LFB Q;  1A3T A;  4X64 L;  3K81 C;  1HR0 Q;  1J6Q A;  1JOQ A;  2KED A;  4A3M H;  5IOD A;  1UAP A;  1VQO A;  2IY5 B;  2J4X A;  1NJI C;  3MZ5 A;  3KBG A;  3KLS A;  1VQM A;  1PMR A;  1ICW A;  3OMG A;  4A3M G;  3SHL A;  2DJF C;  2EYO A;  2PZW A;  3P1H A;  4PMW A;  4JVZ A;  3D4R A;  4QUF A;  1U5K A;  2A69 D;  3D4W A;  3BU2 A;  3V05 A;  4LFB L;  1HR0 L;  1JWS D;  2E2J H;  3NWS A;  5HGT A;  4DR5 L;  1VQH A;  4RGM A;  4DV6 L;  4YCU A;  2NVY H;  2E2I H;  1FD7 D;  4B3M Q;  5M3M B;  2KHI A;  5E4X A;  2UUA Q;  2B63 B;  3KF8 B;  1WCM H;  1VQ5 A;  4J1M A;  4CJ1 B;  1TVX A;  1SFO B;  4G7Z C;  5J1Z A;  3C46 A;  2A6E D;  1RL2 A;  3CC7 A;  2NTS A;  3KJO A;  3NSW A;  3R2T A;  1EFI D;  1EYC A;  1F2L A;  2BE5 C;  2NVT B;  4YHH L;  3KUP A;  4C3J B;  1J8I A;  2K52 A;  2UUC L;  1FNW A;  2F0M A;  1PFB A;  2UUA L;  4HAE A;  2C5C A;  1Y1V H;  4DPG A;  1K83 H;  2MPM A;  4A3L G;  3TS0 A;  5C4J H;  1VQE A;  4N9T A;  2WAQ E;  2F0W A;  3T53 B;  1PRT C;  5I6W A;  1KDB A;  5GRO A;  2NZH A;  1IBK L;  5M5Y H;  3GTK B;  5FOB B;  2MFI A;  1TXY A;  4A3J G;  1I94 Q;  4K5X A;  2WAQ B;  2A74 C;  3M4Y A;  1S5F D;  1EY7 A;  2MJ8 A;  1D5X C;  1SJE D;  4OIK A;  4DR6 Q;  1BOS A;  4A93 H;  1RTN A;  3M9B A;  2N8N A;  3KK7 A;  4AYB G;  4GOP A;  3FPU B;  3HS0 C;  2BA0 A;  1I4Q A;  3HZX A;  4XT1 B;  3GTJ B;  3JC6 6;  1A6X A;  1HA6 A;  1D5Z C;  1K8A C;  1EQV A;  4KJN A;  3K7U C;  2A68 C;  4CHT B;  5JJK A;  3K7A H;  5G3L F;  3QOL A;  4DV1 Q;  1L0Y B;  4JI0 L;  3PF5 A;  4RHR A;  1WTH A;  4FF3 A;  2LY7 A;  3PCO B;  1XMQ Q;  5C4X B;  5COR A;  1JOR A;  3CW2 C;  1XNQ Q;  3NEL A;  3W1G A;  2VUM B;  3NXW A;  5ELF A;  3SEB A;  4B08 A;  3I7F A;  2YV5 A;  1R9T B;  4JYA L;  2TMP A;  5IY0 A;  2AQ2 B;  1L0X B;  1XWE A;  4DN4 M;  1B3A A;  4A3K H;  1I4X A;  1H9S A;  1GUS A;  2PI2 A;  1R4P B;  4FXD A;  3C1F A;  4LJZ C;  5LL6 S;  2BDO A;  2G9D A;  3EA6 A;  4HN7 A;  4JI5 L;  4LF7 Q;  5G3L D;  2H1E A;  3NEM A;  1XMO Q;  3MEF A;  4GN4 B;  3MXN B;  4UP7 A;  3SK6 A;  5FLM G;  2HIV A;  1HUN A;  4X3T A;  1BVS A;  4JYA Q;  4FP5 D;  1DCZ A;  4MTK A;  4DV7 L;  2YTX A;  5F2D A;  1Q46 A;  1TWF B;  4HJ5 A;  1Q1E A;  2FJ2 A;  4DAY B;  1QUQ B;  2UUB L;  4DV4 L;  4GNX C;  2CH4 A;  1YJN A;  4LF7 L;  3K0Y A;  4KKS A;  3K6O A;  1BCP F;  1LM0 A;  1PDQ A;  2B2V C;  2RHQ B;  2VY3 A;  5IGB A;  1IW7 C;  1ASY A;  3MFY A;  4B3S Q;  3M4P A;  3UDF A;  3OHX C;  1H9K A;  1X56 A;  2K1B A;  1I6H B;  3TZD A;  2JQO A;  3SXH A;  4C3J G;  3UE0 A;  4A93 G;  1EQT A;  1AEX A;  5KIX A;  1CA6 A;  1V9P A;  1VMP A;  4I7Z C;  2RDF A;  1AN8 A;  2K5Q A;  2HQL A;  3EFX D;  1SYD A;  1PH3 A;  4LF6 L;  4KY6 A;  4IPC A;  4AYB B;  1YI2 A;  3HGB A;  2M2L A;  4QY7 A;  2R7Z G;  4QB4 A;  1HUM A;  1O7Y A;  4BBS H;  2WAQ G;  4PG3 A;  4HJ7 A;  5AJ3 Q;  2XGT A;  1K3R A;  3KLW A;  3CKI B;  4HIO A;  3H0G B;  1EZ8 A;  2CCZ A;  3T1H Q;  1TWC H;  2CWP A;  5L37 A;  1K83 B;  2XN9 C;  4JI8 L;  1EIG A;  4A3M B;  4V0B A;  4FXK C;  3PO3 H;  3DEO A;  2F0T A;  1O7Z A;  4KD4 A;  1GD7 A;  2K4K A;  4XTC S;  4HCE A;  3DMU A;  3S15 B;  1RJT A;  3NTI A;  1D8L A;  2F1M A;  1F2Y A;  1FR3 A;  1MI2 A;  3C2P A;  4UY8 C;  3PUW A;  3CC2 A;  1LAC A;  4JV5 Q;  4Y7N B;  3N6R A;  4WFN 3;  1Q86 C;  4QIW E;  4ME3 A;  1H9J A;  4RGT A;  1J5E L;  2JN4 A;  5FKA C;  2RQX A;  1ILP A;  1Q82 C;  1Y1W G;  1VQN A;  1FJG L;  2NUC A;  4C3H G;  2ID0 A;  1ZXT A;  3IAY A;  1BBU A;  3C1E A;  3FHW A;  5LHY 1;  4J6H A;  1N36 L;  1SNP A;  3E6Z X;  4O0A A;  3UI2 A;  4OX9 Q;  2KCM A;  4KHP Q;  5JVG 3;  2NB0 A;  4YY3 Q;  1K9M C;  3BDL A;  4K6D A;  1E1T A;  4EQP A;  1DOK A;  4IUP A;  3F2C A;  3FEW X;  4A4I A;  1HFG A;  1VQI A;  1JC7 A;  4KHZ A;  5HGQ A;  3Q22 A;  1SYF A;  4PMC A;  1XPU A;  1IYV A;  4U68 A;  4LUV A;  1CSP A;  1E2V A;  4OGQ C;  2YU9 B;  2E2D C;  5JEA G;  3UE1 A;  3PGZ A;  2Z0S A;  5K36 G;  3F2U A;  2F3I A;  3HFZ B;  3A74 A;  3E5S A;  1U4R A;  3PIP A;  1HR0 W;  3OIP A;  4B3R Q;  1A3U A;  4ZKC B;  2EY2 A;  3S14 B;  1VDZ A;  3GTP B;  2LKV A;  4IFD G;  4A3I B;  1EOT A;  5CGK A;  2KEC A;  1MSG A;  4P73 A;  3F2D A;  1CZG A;  4DFA A;  1KC8 C;  3GTL H;  4K0K Q;  2RSN A;  5DM7 3;  2PZU A;  2DNE A;  1PH8 A;  3BZC A;  2Q2H A;  3I4N B;  2EYJ A;  2JXM B;  4X65 Q;  2L5T A;  2WB1 G;  4X66 L;  2JSO A;  2J7Z A;  4GS3 A;  1U0L A;  3A54 A;  4F88 A;  3PIP 3;  1EY0 A;  1LTG D;  1T5X D;  3SK4 A;  1RHP A;  4LW1 A;  5IYD G;  4IUQ A;  3TBI B;  4HMJ A;  2Q8T A;  3X3M A;  3OMC A;  1I6H H;  3V2T A;  4A3B H;  2A68 D;  4NXM L;  3T4A C;  2F0L A;  5FLM H;  2R6G A;  1X55 A;  4Y52 H;  4NP5 A;  3H3V H;  2GA4 B;  2K04 A;  2PMZ E;  3OOC A;  3VR2 A;  4X64 Q;  1JT8 A;  1H9S B;  1SBB B;  2FFK B;  1ML0 D;  1IL2 A;  1Z9F A;  4DR3 L;  1I4R A;  3WWV A;  1SNQ A;  2OQ0 A;  2HIX A;  3NE5 B;  4U67 3;  3PV0 A;  1IBL L;  4GOP C;  5C44 G;  4LF9 L;  1ET6 A;  3GTO H;  4XT3 B;  2JA9 A;  1UEB A;  4POG A;  3F1Z A;  2VQE Q;  2PW7 A;  4HJ8 A;  2UU9 Q;  4G57 A;  3RZD B;  1GJX A;  4YWL A;  2CFM A;  2WKC A;  4QIW B;  2CQA A;  5DAU A;  2K5H A;  4I65 A;  2ASB A;  2PW5 A;  4ZLT F;  2G5D A;  3SK5 A;  4IFD J;  1HHV A;  3HP3 A;  5KND A;  2KHJ A;  5C6A A;  1CI3 M;  4OON A;  2ZM6 L;  5ELO A;  4JI4 Q;  2WAC A;  4CDC C;  2RBM A;  3TRE A;  3J81 E;  1IYJ B;  3R2I A;  1HH2 P;  2HQE A;  1LTT D;  3IKJ A;  4A3F H;  2VL6 A;  5LL6 X;  5J22 A;  4DGZ A;  4OIJ A;  3AMU A;  2RKS A;  4BY7 H;  1D1I A;  3J81 L;  2ZM6 Q;  1Y8N B;  2EXZ A;  5JPM C;  1AE2 A;  2Y0S B;  4H7B A;  2PQA B;  5CV6 A;  2XRS D;  3J7Y W;  1TWC B;  1YNJ C;  3NBH B;  4NB3 A;  4K6L A;  1VMC A;  3CRL C;  4CGY B;  5DNF A;  1CKN B;  1YEZ A;  1OXT A;  3NEN A;  3CCS A;  4DNI A;  3ND9 A;  5EJW A;  4AQY L;  3VYS A;  3S14 H;  2D0P A;  3HKZ E;  3QG1 A;  3E0E A;  5C0X I;  4JBW A;  1PH1 A;  1K3B C;  4N8F A;  4EVO A;  4RGN A;  3HKZ B;  4C3H B;  2EY6 A;  2PZT A;  5I9O A;  5KYI A;  2R92 H;  4JK1 C;  5I6Y A;  2OT2 A;  2L11 A;  5EBC A;  3U4Z A;  2ZTE A;  3HEJ A;  1GUW A;  1HCZ A;  2SOB A;  3KYH C;  4JG2 A;  1ASZ A;  1IKL A;  1HTP A;  1YNJ D;  2IWH A;  2IHE A;  3CPF A;  3GV3 A;  4A3I G;  4XYO A;  3J7A F;  1SN8 A;  2VW9 A;  2Y0S E;  4AIM A;  1B53 A;  1X3E A;  2F0J A;  3G48 A;  4JI3 L;  4A3L H;  1G8Z D;  4GOP B;  3W2D A;  1LTB D;  1TII D;  2KEN A;  5C4X H;  4GZY C;  4A3D G;  2QGQ A;  2UXC Q;  2MHV A;  1QUQ A;  1FNU A;  2JA7 H;  3BVG A;  3I4L A;  4LUO A;  1BBX C;  4JI0 Q;  2VUM H;  2KUM A;  3GQB A;  5CV9 A;  3Q6S A;  4AH6 A;  4DU9 A;  3MEH A;  1Y1W B;  4L5S A;  1RDP D;  3P20 A;  4R4T A;  4EX5 A;  1YIJ A;  5KYL A;  5JEA J;  4A3C H;  1TT2 A;  1PH7 A;  5JVH 3;  1SYB A;  1XJV A;  1BR9 A;  1VQF A;  5KNB A;  1ENF A;  3D4D A;  4DR6 L;  3H09 A;  2E8G A;  3WOE A;  4BBS B;  1BCP C;  3J7A V;  4K2L A;  2LSS A;  4H44 C;  2ZXO A;  1DOM A;  1SXT A;  2YYZ A;  5GQO A;  3I55 A;  4FF2 A;  2K03 A;  1YHA A;  3TP5 A;  2L1B A;  3R3O A;  4DKA C;  1CKO A;  2EVB A;  2WV6 D;  3OTO Q;  5IYD H;  3EN2 A;  1HJP A;  1O78 A;  3CPW A;  2HHH Q;  3W3A A;  3I4M G;  2VUM G;  1KDC A;  4O42 A;  1DOL A;  1WCM G;  1XMQ L;  4LF4 L;  2N88 A;  4JI8 Q;  2B2T A;  2N55 A;  5K5P A;  5ELC A;  1WTV A;  1FGB D;  1QWY A;  2VB3 X;  2N49 A;  3N52 A;  1STN A;  4KV6 A;  3BZK A;  3J80 E;  1YJW A;  1VQC A;  4K5V A;  2F0N A;  2EOT A;  2XNA C;  2JA8 G;  1KLU D;  2K32 A;  1E1O A;  5FJ8 H;  5BN4 A;  1HPC A;  3IL8 A;  3AU7 A;  2NN6 I;  3SDZ A;  3CD6 A;  2RA4 A;  3CQZ H;  2B2T C;  1NAP A;  2GVA A;  2O2L D;  1SYC A;  2L4N A;  3HOY H;  2K75 A;  4UP9 A;  3WDN A;  4LUZ A;  1QNU A;  4JPB W;  5DEH A;  4OX9 L;  1NMG A;  2EYM A;  4N8X 1;  3STB C;  3UDG A;  1TKW B;  1XTC D;  1N34 L;  4HJ9 A;  3M4O H;  2O5J C;  5E1F A;  1QCB D;  4FYD A;  1P16 A;  3S17 B;  3C3L A;  2TSS A;  1WTX A;  1R4Q B;  1IBL Q;  1ICF B;  3CU7 A;  5H1S E;  2B39 A;  3A55 A;  3EBE A;  2Q8I B;  1NCV A;  2R93 G;  2PNH A;  4YWK A;  3S9W A;  4C3I G;  5KRU A;  2EY1 A;  3RR5 A;  2QEJ C;  1QNK A;  1MIU A;  2DGY A;  3MWY W;  1SMX A;  4IUU A;  3GTP H;  5IWA Q;  1ENC A;  3GTG H;  3K5N A;  2Q8R E;  3HOX H;  1PZJ D;  4OO1 G;  2NYZ D;  1I6V C;  2I5L X;  3K5O A;  1Z47 A;  4RKL A;  3AEV A;  4PMB A;  3L7Z C;  1FL0 A;  4B9W A;  1SE3 A;  3E9H A;  3ERQ A;  2NN6 H;  2IX0 A;  4IOC A;  1YNN C;  5ELD A;  3OWE B;  1N32 L;  2KOL A;  1ESR A;  1G29 1;  1SJH D;  5CV4 A;  5BR8 Q;  4HSV A;  1CKN A;  4IUV A;  4FDB A;  1YBY A;  1HNZ Q;  2QDB A;  2LMC B;  2OWO A;  5HY6 A;  4BBR B;  1I4P A;  2ZTC A;  5C5L A;  3ULJ A;  5M3M H;  4FF4 A;  2VB2 X;  2PQA A;  2EJG C;  1PTO D;  1SNM A;  1JCK B;  5IIF A;  1A8V A;  2JP1 A;  3H6M A;  3VA7 A;  1SRU A;  1SFO H;  3HOU B;  2D62 A;  1FNV A;  2B29 A;  2M00 A;  3FP9 A;  1LT6 D;  1LV9 A;  1GOZ A;  1HNZ L;  3MVV A;  4C3J H;  2F0F A;  3G7L A;  4J8Q A;  2QA4 A;  4IPG A;  1SDF A;  3QB3 A;  4C56 C;  1Y14 B;  2A1A A;  3GTQ B;  2E5L Q;  3BYY B;  3K5L A;  1KTK A;  4K8I A;  2X6G A;  2F3W A;  1NY4 A;  4POF A;  3DWQ A;  4TRD A;  2OF1 A;  1OTC A;  3MTS A;  4B9X A;  3PO2 H;  4KLK A;  1RIP A;  1TS5 A;  2N3S A;  3U9O A;  3MFG A;  3MC0 B;  1VQK A;  1RTO A;  4ID6 A;  5IGC A;  1HTL D;  5CV8 A;  1LAB A;  2XIW A;  1T9H A;  4L8J A;  2JEB I;  1VQ8 A;  1EY8 A;  2NVY B;  3V96 A;  2MGS A;  2E2I B;  3B6Y A;  3K8A A;  4ZUJ A;  1I50 H;  1U9R A;  1H9M A;  2QF7 A;  3ER0 A;  5IYC G;  1TWA B;  1G51 A;  3I8Z A;  4G7H C;  4KKU A;  1CM9 A;  4TSS A;  2KVM A;  2I5M X;  3HOY B;  3G4S A;  4HMI A;  1H95 A;  2K01 A;  4KN4 C;  5T1G A;  1IBK Q;  5AFW A;  3VR6 A;  2BDN A;  2YTY A;  4LF5 L;  4YCW A;  4X62 L;  2IW3 A;  1JOO A;  2JA8 B;  4BWG B;  3CC4 A;  3S1M H;  1X9N A;  1HNW Q;  3PO2 G;  3M7N A;  3CXC A;  1PVO A;  4A3J H;  1D5M C;  2K6A A;  1EY5 A;  4DV0 L;  1O80 A;  1G2T A;  1STA A;  1STY A;  1I4H A;  2C35 B;  4X62 Q;  1UE1 A;  3CCJ A;  3T13 A;  3J80 c;  1I3Q B;  1EY4 A;  2JA5 B;  1GVP A;  4A3E H;  2H4O A;  3OW7 A;  3I90 A;  4X3K A;  1HNW L;  4Q5V A;  2BH2 A;  2RHS B;  3GTG B;  1X65 A;  1J9O A;  3VR3 A;  1PFS A;  3JAM E;  1HZC A;  1MSH A;  5TSS A;  1W6K A;  1Q81 C;  4RG1 A;  5EPJ A;  1KXL A;  4DUY Q;  1G6P A;  4DR1 L;  3HOZ B;  1PRT B;  3LNN A;  1NUC A;  1WJJ A;  4A3C G;  1WOC A;  2FIN B;  3RLN A;  2SNS A;  4APV A;  1QVC A;  1L0W A;  4BY1 G;  1HQR D;  3SGI A;  1TWG H;  1X3F A;  5LMU L;  2HDM A;  2CQO A;  1S5E D;  4P2C B;  2VQE L;  3TZU A;  2K7V A;  2E2H H;  3DWP A;  3A5U A;  4DR4 Q;  1JJC B;  5FLX E;  3CMA A;  4H0L C;  1KAW A;  3D6W A;  2G9H D;  4GKJ L;  5LMU Q;  4UP8 A;  4BY7 G;  3RZD H;  1AFP A;  4DV7 Q;  4DR7 L;  1S5D D;  1QB5 D;  2F0Q A;  4RAU C;  2PO4 A;  2F0I A;  3T16 A;  3URY A;  2UUB Q;  4DAV A;  3S16 H;  2E74 C;  1MKH A;  3TP8 A;  5EGT A;  4OXP A;  1KHI A;  2SDF A;  4IQZ A;  4CDE C;  4LFC Q;  1E3P A;  1BQQ T;  1VQ9 A;  5JEA H;  4N9P A;  1TS3 A;  4DR5 Q;  3A56 A;  1STH A;  3D8G A;  3STB D;  3GTM H;  1P8L A;  1KRT A;  3NBI A;  5CMD A;  4DV6 Q;  1BUV T;  1C8C A;  1RF2 D;  2K33 A;  2IX1 A;  4E6I A;  3A8I E;  1VQ7 A;  2ATW A;  1S3O A;  3BS1 A;  1C0A A;  3D6C A;  4MHE A;  3BDO A;  4HIM A;  4M8A A;  4LFC L;  1QVG A;  1C9O A;  3TP6 A;  1K8O A;  4C1N I;  2PMZ B;  1IBM Q;  3I73 A;  1DZ1 A;  4BA1 I;  4DAY A;  4KK7 A;  4PZ6 A;  1GUO A;  2EY5 A;  2EJM A;  4AYB E;  1RD9 D;  2CW0 D;  1FVI A;  4DV3 L;  3RLF A;  5D3D A;  1JE5 A;  4BBS G;  2K50 A;  2VQF Q;  4P75 A;  3R93 A;  5IOC A;  4BXX G;  4DR2 L;  1LTI D;  1PRT F;  3I70 A;  1NR2 A;  1PZI D;  1E0B A;  3KF6 B;  4LF4 Q;  1X3G A;  4DK3 C;  2N78 A;  5I4D A;  4BY1 H;  1K8M A;  1AH9 A;  1VF5 C;  2ALY B;  5E7N A;  2XWB B;  3OPO A;  2EYP A;  5D3I B;  4ALP A;  5M5X B;  5J3B A;  4BA2 I;  2YU9 H;  5M3M G;  1TS4 A;  3DWA A;  4KD3 A;  4DR2 Q;  1VQB A;  5IT9 E;  2PNR C;  2E75 C;  4NXN L;  4DV1 L;  2O4X A;  5FLX c;  1VQG A;  1S4Z A;  3ONA B;  3CCL A;  3PQI A;  3S1Q H;  1KAA A;  2BH8 A;  5C4J B;  3HRZ C;  1CHP D;  2EPB A;  5IE8 A;  3G6E A;  4JBK A;  1WTP A;  1XNQ L;  3K58 A;  1PZK D;  1TWA H;  1IZ6 A;  4H02 A;  3FKI G;  5HUR A;  4LF8 L;  2LXJ A;  3ICE A;  2AKW B;  1X3Q A;  4A3G G;  4DNT B;  3WOF A;  2OCE A;  4A75 A;  3S1N H;  4KTA A;  3KOJ A;  4ZCK A;  4HID A;  3J80 i;  3HOW H;  3HKZ G;  2XRQ D;  3RZO H;  2QW7 A;  2XTI A;  4RCO A;  3CRK C;  3NWT A;  4DXF A;  2B2Y C;  4Q0F A;  1VS0 A;  5CBE E;  3KFU A;  1M1K C;  3CQZ B;  1Q7Y C;  2UXD L;  2R61 A;  3EIV A;  3AFQ A;  5IWA L;  5AJ3 L;  4MTN A;  5IP7 H;  2NTT A;  1QZH A;  1NMF A;  4ZUI A;  1F2Z A;  1VQL A;  2NN6 G;  4K0K L;  4DV4 Q;  1BNZ A;  2MO0 A;  1E24 A;  2OTJ A;  3VR5 A;  4IFD H;  2UXB L;  1PHJ A;  2B3G A;  4TVA B;  3OTO L;  2JA5 G;  4OWW B;  3KF8 A;  4X66 Q;  4OHJ A;  3PIO A;  1PH6 A;  2HHH L;  1AZQ A;  1STG A;  2PYK A;  2ICE C;  2ENB A;  3J7A 5;  1K28 A;  4S3S A;  3JAM L;  1BO0 A;  1F9Q A;  1HNX L;  3ULL A;  1EQR A;  2AWN A;  4UPA A;  1J5E Q;  1PFN A;  3HOU H;  1LTL A;  1EL0 A;  1VQJ A;  5M3F B;  3NTK A;  2BA1 A;  2I07 B;  4ULL A;  1B50 A;  1LTS D;  5C3E B;  5M5W H;  1E2W A;  2ICI A;  3S24 A;  2K5V A;  3GP7 A;  2ZJQ A;  2Q2I A;  2NVQ B;  3PIO 3;  4WOR A;  3CP0 A;  4DAP A;  2B2U C;  4KHP L;  3FVQ A;  3G6J B;  2EZV A;  3J81 j;  1C4Q A;  3OSO A;  3NTH A;  2D5D A;  1PTO F;  3ERO A;  1ET9 A;  2NBF A;  5C5M A;  4C3I H;  4JI2 Q;  2R93 H;  1WCM B;  1XTD A;  2V4D A;  4JCV E;  4V19 0;  3NBH A;  5GAD C;  1N34 Q;  2DUD A;  3K80 C;  5IGF A;  3AYH B;  4XQQ A;  1N32 Q;  5C3E G;  3NPP A;  5FJ8 G;  1SEB D;  1YZ6 A;  2BOS A;  4RWS C;  1IXR A;  1JMC A;  3MXN A;  4L6T B;  1V1O A;  1EEF D;  4WJW A;  3SK8 A;  5GAG C;  1EYG A;  1W2B A;  1MD2 D;  4JI2 L;  5C4X G;  2L15 A;  3M4O B;  1AE3 A;  1VCI A;  2VZA A;  1EYA A;  1S72 A;  5ISR A;  2PCF B;  4B3T L;  2EYL A;  4MNO A;  4X65 L;  1RKN A;  3QIA A;  2Q2U A;  1JIC A;  4EQO A;  2JA8 H;  3GTQ H;  2F4V Q;  4YY3 L;  2MO1 A;  4GN3 B;  4JI1 Q;  3U4V A;  1JWU D;  3ZJY C;  5IYB G;  4PZ8 A;  3U9S A;  2K28 A;  2V1C C;  1YNN D;  4ZK9 B;  5IP9 G;  4YHH Q;  2OXP A;  4JI6 Q;  4CKE A;  3K7A B;  2O5I C;  1CFM A;  1JE4 A;  1Q3L A;  4IO9 A;  2P5Z X;  3S1R B;  3GDE A;  3PMF A;  4C2M B;  1K73 C;  2IL8 A;  5C44 H;  5DLQ E;  1DD2 A;  1BKB A;  3J80 L;  1JB7 A;  2RCF A;  2QIL A;  3AQQ A;  3ND8 A;  1B4O A;  1XNR L;  3EQL C;  4DK1 A;  4MN3 A;  4DK6 C;  2R7D A;  1HQM C;  3QJY A;  3VYT A;  4JI6 L;  4IPH A;  2R7Z H;  1S5B D;  4RKB A;  4X3U A;  2CWA A;  4J15 A;  4IUT A;  4PZ7 A;  4A76 A;  4DA2 A;  3H94 A;  2ZJP A;  5EKL A;  3L0O A;  1JJG A;  3FKI H;  2KEE A;  2D0O A;  4XXE A;  4OWX B;  1D1K A;  3NP8 A;  1LT5 D;  5EPL A;  3I3C A;  4B3M L;  4G4K A;  4DUY L;  4TKO B;  2CKZ B;  3F8T A;  5T1I A;  3L9A X;  3QO2 A;  3CF5 A;  4DV3 Q;  4X3S A;  1EZ6 A;  3G71 A;  4R4Q A;  1CQV A;  4OEM B;  2I46 A;  4HJA A;  2MNA A;  4R4O A;  3I72 A;  5D14 A;  3X3N A;  3NQT A;  4HR7 B;  4ZKB B;  4O1N A;  3HOY G;  1A3V A;  2B2W A;  4NXM Q;  2F52 A;  1G6Z A;  1EIH A;  2F0K A;  1FYC A;  1SR3 A;  3BZD B;  3KLS X;  4JI3 Q;  1WD0 A;  2KCC A;  1STB A;  2QDL A;  3SR1 A;  4OO1 I;  3BVM A;  2HDL A;  3Q8D A;  4IFD I;  2FXQ A;  1CTM A;  1PH9 A;  2KBN A;  4JW0 A;  3M7G A;  2A8V A;  4GKJ Q;  3OYY A;  1N33 L;  5EKI A;  4DR7 Q;  3LWU A;  2CHB D;  4NXN Q;  1O7L A;  3M4Q A;  1Y1V G;  2IT1 A;  5DM6 3;  4LF9 Q;  2XSC A;  1EWH A;  1VF7 A;  2Z1C A;  1U4L A;  3AB9 A;  1YJ9 A;  3VYR A;  5IGG A;  1M90 C;  2CW0 C;  1X32 A;  2KCT A;  2JA7 G;  1M8A A;  2FHT A;  2FMM A;  2NZO A;  1I50 B;  1B9M A;  4L63 B;  3FDT A;  1IHZ A;  1UE7 A;  3UDX A;  4F87 A;  1WTR A;  5EAY A;  2CVR A;  5IT9 c;  3I4M B;  2X69 A;  1ZYR D;  5ELB A;  3MXG A;  3BJU A;  5A2Q L;  4KI0 A;  4IN3 A;  4HED A;  2E2J B;  3MXP A;  1G91 A;  1U4P A;  1BXT A;  2J0T D;  2SNM A;  5KGU A;  1PRT D;  3QR8 A;  4RCN A;  3H0G H;  1EY6 A;  1QG7 A;  2F0O A;  2YTV A;  3I4O A;  2FMC A;  1C7Y A;  4OEL B;  3SE0 A;  1TY0 A;  5GAE C;  5IP7 G;  3HOV H;  3S1M B;  4LMQ D;  1W6J A;  2QCP X;  1EU4 A;  3TN2 A;  1TS2 A;  3OWF A;  3AFP A;  4MZ9 A;  1EU3 A;  3J81 c;  4K8J A;  1PXU A;  4LF6 Q;  1QE6 A;  1SE4 A;  1Y8P B;  2RCN A;  4M1U B;  1PYB A;  2ZXP A;  5KNC A;  2B63 G;  1KRS A;  1ZKO A;  4DR1 Q;  3FMC A;  5M5X H;  2K5W A;  5M5Y B;  3FPP A;  4L5T A;  5IYC H;  2VNU D;  2PQE A;  4CJ0 B;  3ULP A;  4WJ4 A;  1D7Q A;  3E0J A;  2VXW A;  1TY2 A;  4IJH A;  1E7Z A;  5LMN W;  3S1R H;  4C2M H;  1DGS A;  1FGU A;  2DJG C;  4ZQ3 A;  4TQU S;  1NR4 A;  1QIL A;  3E9I A; 
#chains in the Genus database with same CATH homology
 4P74 A;  1WOC A;  4A3B H;  3RLN A;  4DUZ L;  3KDF B;  4APV A;  1QVC A;  1L0W A;  3I56 A;  2ZJR A;  4GNX B;  3VDY A;  4BY1 G;  4JOI C;  4NXM L;  4R4C A;  3SGI A;  5FLM H;  1TWG H;  1X3F A;  5LMU L;  2R6G A;  3RN5 A;  1PH2 A;  1IBM L;  4LNQ A;  1X55 A;  4Y52 H;  3H3V H;  1MJE A;  3PSI A;  2PMZ E;  2CQO A;  5LMN L;  1S40 A;  2VQE L;  4X64 Q;  1JT8 A;  1KQS A;  2E2H H;  1N8R C;  1YHQ A;  3A5U A;  1IL2 A;  1Z9F A;  4DR3 L;  3WWV A;  2OQ0 A;  4DR4 Q;  2HIX A;  4JI5 Q;  1JJC B;  3PV0 A;  4JV5 L;  2UXB Q;  1IBL L;  4GOP C;  1Q12 A;  3H15 A;  3CMA A;  4A3F G;  1EQQ A;  4P71 A;  1KAW A;  3J7Z C;  5C44 G;  4LF9 L;  3GTO H;  4GKJ L;  2JA9 A;  5LMU Q;  4UP8 A;  4BY7 G;  1PH4 A;  1UEB A;  3RZD H;  4DV7 Q;  4POG A;  4DR7 L;  3F1Z A;  2VQE Q;  4HJ8 A;  2UU9 Q;  3GD7 A;  3S17 H;  1R9T H;  1EIF A;  2UUB Q;  3CCR A;  3S16 H;  5ELN A;  4YWL A;  2CFM A;  1MKH A;  2GVB A;  4OXP A;  2GN5 A;  4DV2 Q;  1KHI A;  4JBM A;  4LFC Q;  2UXD Q;  2K5H A;  2ASB A;  4A3B G;  1E3P A;  1E22 A;  3PF4 A;  1VQ9 A;  5JJL A;  5IP9 H;  3HOV G;  1OXX K;  3GTK H;  4IFD J;  1O7I A;  4DR5 Q;  4JOI A;  3STB D;  3GTM H;  1P8L A;  1KRT A;  4DV6 Q;  1L1O A;  2KHJ A;  2AMC B;  1YVC A;  3GO5 A;  4OON A;  2ZM6 L;  5ELO A;  4JI4 Q;  2AWO A;  2IX1 A;  4GN5 A;  1LYL A;  1A0I A;  1VQ7 A;  2ATW A;  3TRE A;  1S3O A;  5IYB H;  1C0A A;  1IYJ B;  4HIM A;  2EQS A;  1HH2 P;  1L2F A;  5BR8 L;  4LFC L;  4BBR G;  1QVG A;  4LWC A;  2OTL A;  3A5Z B;  1C9O A;  4A3F H;  2VL6 A;  1IBM Q;  4RMF A;  4BA1 I;  2EIF A;  2I5H A;  1K8G A;  4BY7 H;  4PZ6 A;  2WP8 J;  2ZM6 Q;  4LF8 Q;  4R1J A;  1VQ6 A;  2R92 G;  4AYB E;  1AE2 A;  2JA6 H;  2PQA B;  3S2D H;  3DLL A;  2I0Q A;  1FVI A;  4DV3 L;  3RLF A;  1EUJ A;  3JAM i;  1JE5 A;  3U50 C;  4BBS G;  1NTG A;  1I5F A;  2K50 A;  1CSQ A;  3NBH B;  2VQF Q;  4P75 A;  1PH5 A;  4NB3 A;  3D0F A;  1V1Q A;  5C0X G;  1HNX Q;  4BXX G;  1W3S A;  4DR2 L;  3A0J A;  3PUV A;  5JJI A;  1GM5 A;  1CKN B;  3L2P A;  3KF6 B;  4LF4 Q;  4A3I H;  3PUY A;  1X3G A;  1EOV A;  4DK3 C;  2N78 A;  1Q8K A;  3HKS A;  4BY1 H;  1YEZ A;  1OXT A;  3NEN A;  3CCS A;  4O2D A;  4DNI A;  2ALY B;  1YHB A;  5E7N A;  4L5R C;  1OXS C;  1AH9 A;  2Z6K A;  4XIG S;  4AQY L;  4BBR H;  4QJF A;  4ALP A;  4HIK A;  1N9W A;  5J3B A;  2LXK A;  3T1Y Q;  3S14 H;  4BA2 I;  2YU9 H;  2D0P A;  5M3M G;  3HKZ E;  4JI7 L;  3E0E A;  3ERS X;  5C0X I;  4DR2 Q;  1VQB A;  4JBW A;  4A3D H;  3I2Z A;  1PH1 A;  4NXN L;  1FJG Q;  4DV1 L;  1CKM A;  5FLX c;  3PO3 G;  1VQG A;  2QEX A;  3H0G G;  2Q2T A;  2R92 H;  1QZG A;  3CCL A;  1N36 Q;  4DR4 L;  3S1Q H;  1LUZ A;  2BH8 A;  3U4Z A;  1KIX A;  2ZTE A;  4LFB Q;  4IOA A;  5IE8 A;  4X64 L;  1VQA A;  3K81 C;  1J6Q A;  1HR0 Q;  3KYH C;  4JG2 A;  3G6E A;  3KDF A;  4GNX A;  3T1Y L;  1ASZ A;  4JBK A;  1XNQ L;  4A3M H;  3JAM c;  1VQO A;  2IY5 B;  2IHE A;  1NJI C;  4Y7N H;  1TWA H;  3CPF A;  4A3I G;  2UU9 L;  2VS1 A;  1VQM A;  1IZ6 A;  1SN8 A;  3FKI G;  4H02 A;  4JBJ A;  2VW9 A;  2Y0S E;  1CUK A;  1V43 A;  4LF8 L;  4AIM A;  2LXJ A;  3HOW G;  4A3M G;  3ICE A;  1X3E A;  4JI3 L;  2AKW B;  3G48 A;  4A3G G;  4A3L H;  4PMW A;  5C0X J;  2OCE A;  4B3T Q;  4GOP B;  1NE3 A;  4A75 A;  3S1N H;  1U5K A;  3KOJ A;  3BU2 A;  4HID A;  4LFB L;  3J80 i;  1HR0 L;  4LFA Q;  4YCV A;  3HOW H;  3HKZ G;  2KEN A;  2E2J H;  5C4X H;  2XTI A;  3RZO H;  1K0R A;  4DR5 L;  1VQH A;  4A3D G;  3KFU A;  1VS0 A;  2QGQ A;  2UXC Q;  3HOZ H;  1QUQ A;  2IHF A;  4DV6 L;  1M1K C;  2JA7 H;  4YCU A;  1Q7Y C;  2UXD L;  4P72 A;  2NVY H;  4LUO A;  4OWT B;  3EIV A;  3RNU A;  2E2I H;  2UUA Q;  2KHI A;  3AFQ A;  5IWA L;  1X6O A;  5AJ3 L;  4MTN A;  4B3M Q;  2VUM H;  5IP7 H;  3KF8 B;  1WCM H;  1QZH A;  1VQ5 A;  1NMF A;  4AH6 A;  1VQL A;  2OQK A;  1SRO A;  4GLV B;  4A3L G;  2UUA L;  4L5S A;  1RL2 A;  3CC7 A;  3KJO A;  2NN6 G;  4K0K L;  4DV4 Q;  2MO0 A;  3DM3 A;  1E24 A;  2OTJ A;  4YHH L;  1TWH H;  4QL5 A;  4R4T A;  4EX5 A;  1YIJ A;  5JEA J;  4A3C H;  1PH7 A;  1YNX A;  3CCE A;  4GKK Q;  2K52 A;  2UXB L;  2NVT H;  1PHJ A;  2UUC L;  1KL9 A;  1XJV A;  1L1O B;  2B3G A;  4TVA B;  3OTO L;  1VQF A;  1XPO A;  1PA6 A;  2AHO B;  2JA5 G;  4OWW B;  1GO3 E;  1XNR Q;  3CAM A;  4C3H H;  4DPG A;  1Y1V H;  4X66 Q;  1K83 H;  4YWM A;  3PIO A;  1PH6 A;  2PI2 E;  2E8G A;  3TS0 A;  1X54 A;  2R7F A;  5C4J H;  1VQE A;  2WAQ E;  2LSS A;  3F2B A;  3J7A 5;  5GRO A;  3S2H H;  2NZH A;  1IBK L;  1I3Q H;  5M5Y H;  2JA5 H;  2YYZ A;  2MFI A;  5GQO A;  1TXY A;  2WB1 E;  1EQR A;  2AWN A;  4UPA A;  3RLO A;  3ULL A;  3I55 A;  3CME A;  1YHA A;  4A3J G;  1J5E Q;  1I94 Q;  1LTL A;  1HNX L;  3HOU H;  1VQJ A;  2Y0S G;  4DKA C;  2UUC Q;  1CKO A;  4GKK L;  3OTO Q;  1WFQ A;  5IYD H;  3EN2 A;  1HJP A;  3CPW A;  4DR6 Q;  4A93 H;  2BA1 A;  2HHH Q;  3TQY A;  2F4V L;  1MJC A;  3M9B A;  4B3R L;  2N8N A;  4AYB G;  3I4M G;  5M5W H;  4GOP A;  3S24 A;  2VUM G;  4JI1 L;  2K5V A;  4AQY Q;  2ZJQ A;  2Q2I A;  1WCM G;  2BA0 A;  4IPD A;  1XMQ L;  3CP0 A;  3JC6 6;  4LF4 L;  4KHP L;  4JI4 L;  1WYD A;  1K8A C;  4JI8 Q;  1SLJ A;  1I94 L;  3K7U C;  3J81 j;  5JJK A;  2N49 A;  3K7A H;  2JE6 I;  4DV1 Q;  3BZK A;  1YJW A;  4JI0 L;  4C3I H;  1VQC A;  4JI2 Q;  3PF5 A;  2JA8 G;  2R93 H;  1XTD A;  4JI7 Q;  3PCO B;  4JCV E;  1E1O A;  5FJ8 H;  1UE6 A;  1XMQ Q;  1NBW A;  2NN6 I;  5GAD C;  1N34 Q;  2DUD A;  3J81 i;  3CD6 A;  4DR6 L;  3K80 C;  3CQZ H;  2GVA A;  3AYH B;  3CW2 C;  1XNQ Q;  3NEL A;  1N32 Q;  5C3E G;  3RN2 A;  2NVX H;  3W1G A;  5FJ8 G;  3HOY H;  2MQH A;  4DV2 L;  2B63 H;  2E5L L;  1YZ6 A;  2K75 A;  4IJL A;  1IXR A;  4UP9 A;  3U58 A;  1JMC A;  3I7F A;  4LUZ A;  3I4M H;  5GAG C;  2YV5 A;  1EYG A;  1W2B A;  4JYA L;  5IY0 A;  4JI2 L;  1QVF A;  2L15 A;  5C4X G;  1AE3 A;  1NMG A;  4OX9 L;  3UDG A;  1VCI A;  3STB C;  1EWI A;  4A3K H;  1N34 L;  4HJ9 A;  1VQD A;  2VZA A;  3M4O H;  2Z6K C;  2PI2 A;  3LGJ A;  1XPR A;  4R4I A;  1VQP A;  3W1B A;  3KF6 A;  1S72 A;  4LF7 Q;  1P16 A;  4JI5 L;  4DR3 Q;  1KD1 C;  3NEM A;  2ES2 A;  4B3T L;  4MNO A;  1IBL Q;  1XMO Q;  3MEF A;  4GN4 B;  5H1S E;  3MXN B;  4UP7 A;  3EBE A;  4X65 L;  5FLM G;  2HIV A;  2Q2U A;  2JA8 H;  2R93 G;  3GTQ H;  2PNH A;  4YWK A;  2F4V Q;  1BVS A;  4YY3 L;  4JYA Q;  2MO1 A;  5GAH C;  2WFW A;  4GN3 B;  3RR5 A;  4X6A H;  4JI1 Q;  3U4V A;  3ZJY C;  5IYB G;  2YTX A;  4DV7 L;  2DGY A;  1MIU A;  1EFW A;  4PZ8 A;  1Q46 A;  4QGU A;  1SMX A;  3HOX G;  4HJ5 A;  1Q1E A;  4DAY B;  2V1C C;  1QUQ B;  3GTP H;  4GLA C;  2UUB L;  4DV4 L;  5IWA Q;  4GNX C;  5IP9 G;  1YJN A;  3GTG H;  4YHH Q;  4LF7 L;  4JI6 Q;  1B8A A;  1LM0 A;  3HOX H;  4OO1 G;  2VQF L;  2RHQ B;  2VY3 A;  4IO9 A;  1ASY A;  4JI0 Q;  2I5L X;  2K5N A;  4LF5 Q;  3GDE A;  1Z47 A;  1K73 C;  5C44 H;  1UWV A;  4A3K G;  1N33 Q;  5DLQ E;  3AEV A;  4B3S Q;  2RF4 A;  3L7Z C;  1BKB A;  3M4P A;  1X56 A;  3UDF A;  1FL0 A;  2JQO A;  3H3V I;  1JB7 A;  3E9H A;  3AQQ A;  1OXV A;  3UE0 A;  2IX0 A;  1XNR L;  4A93 G;  4IOC A;  3D31 A;  3I4N G;  1V9P A;  4DK6 C;  2R7D A;  1PYS B;  1N32 L;  2HT1 A;  2R7Z H;  4JI6 L;  1G29 1;  4IPH A;  1L1O C;  4DAM A;  2HQL A;  1PH3 A;  4LF6 L;  5BR8 Q;  4NPS A;  4IPC A;  4DV0 Q;  2CWA A;  4J15 A;  4PZ7 A;  1CKN A;  1YI2 A;  4A76 A;  2ZJP A;  2H5X A;  3L0O A;  3K0X A;  4QY7 A;  1JJG A;  4FDB A;  1YBY A;  4DV5 L;  2R7Z G;  3FKI H;  1HNZ Q;  2OWO A;  2D0O A;  4OWX B;  4BBS H;  5HY6 A;  2WAQ G;  3IRB A;  4PG3 A;  4B3M L;  2ZTC A;  4DUY L;  5AJ3 Q;  1B70 B;  4HJ7 A;  2XGT A;  3ULJ A;  4BXX H;  2CKZ B;  3F8T A;  5M3M H;  1K3R A;  1SE8 A;  3CF5 A;  4DV3 Q;  2PQA A;  3KLW A;  2ZTD A;  4HIO A;  1A8V A;  3G71 A;  1B7Y B;  4R4Q A;  1SRU A;  1SFO H;  2CCZ A;  3T1H Q;  1TWC H;  2D62 A;  2CWP A;  3TRZ A;  3M85 A;  4JI8 L;  2B29 A;  4HJA A;  3PO3 H;  2MNA A;  3CCV A;  3FP9 A;  4R4O A;  2JK8 A;  3CCU A;  1A63 A;  4DV5 Q;  3HOY G;  3OW2 A;  1HNZ L;  1HZ9 A;  4C3J H;  1GD7 A;  2K4K A;  4XTC S;  4NXM Q;  2F52 A;  2QA4 A;  4IPG A;  1SR3 A;  4JI3 Q;  1D8L A;  3GTJ H;  2JEA I;  3S15 H;  4OO1 I;  4UY8 C;  3PUW A;  1Y14 B;  2A1A A;  3CC2 A;  3Q8D A;  2E5L Q;  3CCM A;  4JV5 Q;  2EXD A;  3M3Y H;  2FXQ A;  4IFD I;  1PH9 A;  2KBN A;  1Q86 C;  1TWF H;  4QIW E;  4ME3 A;  1NY4 A;  2A8V A;  1J5E L;  4GKJ Q;  3OYY A;  4POF A;  1N33 L;  3W5O A;  3TS2 A;  4DR7 Q;  4B3S L;  1OTC A;  1Q82 C;  1Y1W G;  1VQN A;  3PO2 H;  4NXN Q;  1FJG L;  4KLK A;  3M4Q A;  2ID0 A;  3UDI A;  1Y1V G;  1RIP A;  2IT1 A;  2N3S A;  5M3F H;  1BBU A;  3FHW A;  4LF9 Q;  1N36 L;  1OXU A;  2HHH L;  1VQK A;  1YJ9 A;  4O0A A;  4OX9 Q;  4QQB X;  1Q1B A;  3KJP A;  1M90 C;  4JC0 A;  3CCQ A;  2KCT A;  2JA7 G;  2NZO A;  2KCM A;  4KHP Q;  1T9H A;  1GKH A;  2JEB I;  1VQ8 A;  2JJQ A;  5M3F G;  1UE7 A;  4YY3 Q;  3B6Y A;  3K8A A;  4GLX A;  3UDX A;  1YIT A;  1I50 H;  1K9M C;  5EAY A;  1E1T A;  5IT9 c;  3ER0 A;  1A62 A;  5IYC G;  4DUZ Q;  3BJU A;  1G51 A;  4KI0 A;  3F2C A;  1XMO L;  4A4I A;  4EQ5 A;  1VQI A;  1BBW A;  1HZA A;  4KHZ A;  2I5M X;  5HGQ A;  1WI5 A;  1XPU A;  3G4S A;  3HOZ G;  1HZB A;  3H0G H;  1H95 A;  4LUV A;  1CSP A;  2YTV A;  3I4O A;  3PUZ A;  1C7Y A;  1IBK Q;  1UE5 A;  4LFA L;  1PV4 A;  3T1H L;  2YTY A;  5GAE C;  4YCW A;  5IP7 G;  5JEA G;  4X62 L;  4LF5 L;  3UE1 A;  3PGZ A;  2JA6 G;  2Z0S A;  3HOV H;  5K36 G;  1Y1W H;  2F3I A;  3HFZ B;  3A74 A;  4L5Q A;  2UXC L;  3CC4 A;  3S1M H;  1X9N A;  1HNW Q;  3PO2 G;  3M7N A;  3AFP A;  3PIP A;  4MZ9 A;  1HR0 W;  3CXC A;  4B3R Q;  1PVO A;  4A3J H;  3J81 c;  3PUX A;  4IFD G;  4A3G H;  4LF6 Q;  2RCN A;  4P73 A;  3F2D A;  4DV0 L;  1PYB A;  1KC8 C;  3GTL H;  2C35 B;  4K0K Q;  4X62 Q;  1VQ4 A;  2B63 G;  1KRS A;  4DR1 Q;  4A3C G;  1UE1 A;  3CCJ A;  5M5X H;  3J80 c;  1PH8 A;  5C3E H;  3BZC A;  2Q2H A;  1GVP A;  4A3E H;  4L5T A;  4X65 Q;  1JJ2 A;  5IYC H;  2NVQ H;  1HNW L;  2VNU D;  2BH2 A;  2RHS B;  2WB1 G;  3I4N H;  1X65 A;  3ULP A;  4X66 L;  1PFS A;  1HZC A;  3HOU G;  4GS3 A;  1U0L A;  3TEH B;  1Q81 C;  4WJ4 A;  1D7Q A;  1EIY B;  4A3E G;  4LW1 A;  4IJH A;  5IYD G;  5LMN Q;  4RG1 A;  1E7Z A;  5LMN W;  3S1R H;  4WJ3 M;  4C2M H;  1KXL A;  4DUY Q;  1DGS A;  1FGU A;  2A19 A;  4DR1 L;  1G6P A;  4TQU S;  1WJJ A;  2K14 A;  1I6H H;  3E9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...