3GTQH

Backtracked rna polymerase ii complex induced by damage
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtqH00
1L0WA 1Q46A 4UPAA 3S17H 2IHFA 4R4CA 4PZ7A 2AWNA 2YTXA 5IWAQ 3HOUH 4DAYB 2JA6H 2IX1A 3CCQA 4BBSG 1Q8KA 3RNUA 3HOZH 1CKMA 1WYDA 4B3SQ 2JA8H 4KHPQ 3LGJA 1B8AA 2K4KA 1GO3E 2N78A 1PH4A 1N36L 1N36Q 4Y52H 4JBMA 1E22A 1Z9FA 1YJWA 4DR2Q 4JI0L 3J7ZC 4UY8C 3HOVG 1GD7A 3CCSA 3CC2A 1Y1WH 1KAWA 4GS3A 4X64L 1YVCA 2JA9A 4X64Q 3T1HQ 3JC66 3T1HL 4LF7L 1JT8A 3PSIA 1VQFA 3AQQA 4A3KG 1VQAA 4GOPB 3M4PA 4A3MH 4A3FG 4JI6Q 4JI6L 3G6EA 2F4VQ 5IE8A 4LFBQ 2NZOA 2EXDA 3IRBA 1A63A 3HFZB 3CMEA 3BJUA 1TWFH 4A3DG 1XTDA 2N49A 4OO1I 2IX0A 4GOPC 4HIKA 4IFDI 1FL0A 1XPRA 1CKNA 1A8VA 1WI5A 2NN6G 1EYGA 2AWOA 4EQ5A 1D8LA 2ZM6Q 3H3VI 5IYDG 4JI2Q 5GAGC 2JA7G 2VQFL 4C3HH 3PIPA 1IBLL 1IBLQ 5GAEC 4BBRH 1G6PA 1P8LA 1IXRA 3CQZH 4HIOA 4A3GH 3GTPH 1IBML 5H1SE 1IBMQ 3KF6A 4BXXH 4GKJQ 1DGSA 5M5XH 5DLQE 4GNXB 3RZDH 4JV5Q 1UWVA 3BZKA 2XGTA 1TWCH 1FJGQ 2R7ZH 1X65A 4DAMA 3PUWA 3I4MG 2ZTDA 4HJAA 1HNZL 1A62A 4QIWE 4DV2L 2WAQG 1KL9A 1SN8A 4BA1I 4A3BG 4JYAQ 2R6GA 3MEFA 2VZAA 2NVYH 1VS0A 4DNIA 1Q81C 1JJ2A 3NELA 4DV3L 2VUMH 1MKHA 1UEBA 2JE6I 3ERSX 2FXQA 1PH5A 2Q2HA 1PH7A 1EFWA 1CUKA 4KLKA 4LF6Q 2KCMA 3TS0A 1YJNA 1LM0A 5IYCH 5C4JH 2D62A 3TS2A 3UDXA 3HOXH 1W3SA 5M3FH 1Y14B 1IZ6A 5JEAJ 1HR0Q 2KBNA 1A0IA 2PQAB 5JEAG 4QY7A 2ZJPA 3STBD 1X3FA 4P72A 4A3JH 2B63H 2ZTCA 4DR5Q 2AMCB 1U5KA 3D0FA 2UU9L 1VQ7A 1EWIA 5BR8Q 4IPHA 4HIDA 3SGIA 4A75A 1AE3A 4YHHQ 4AQYL 4AQYQ 4NXML 4A3CH 3E9IA 1YZ6A 4L5TA 2H5XA 4OX9L 2LXJA 3HOUG 1EIFA 5GADC 4LF9L 3EN2A 2BH8A 4DV4L 1VQEA 1VQPA 2JA6G 5M3MH 3HOZG 1WOCA 1E1TA 1EOVA 2BA0A 4DV1Q 2JA8G 3GTGH 3UDGA 4BY7H 2D0OA 2F52A 4JOIA 4L5SA 4P73A 2UXCQ 4LF8L 4NPSA 4DV0L 1PHJA 1XMQL 5M5WH 3S15H 1V1QA 1Y1WG 2L15A 4GNXA 4DR6L 2JA7H 1TWHH 2I5MX 1KQSA 3HKZE 2ASBA 4R4TA 2GVBA 4NXNL 1HH2P 1QUQA 3G71A 2YTYA 4YCVA 1GKHA 3GTMH 2UUAQ 4GN3B 4H02A 1KRTA 4LF4Q 4LF4L 4B3RL 4OONA 1SLJA 4JG2A 4LWCA 3ULLA 1IBKQ 2CCZA 3S1QH 2UXBL 1PH1A 2MNAA 3S1MH 3JAMc 3UE1A 3RLFA 2Q2UA 3GTQH 2LSSA 4JI3L 3RN2A 4JI3Q 4KI0A 3K0XA 5GAHC 3W5OA 1QZHA 3H3VH 4QL5A 1YBYA 1CKNB 3BZCA 4BBRG 3F2CA 4A3GG 4DR1Q 1WCMH 1OTCA 2BH2A 1SMXA 3W1GA 2ALYB 4GKKQ 4GKKL 4DV5L 4DV5Q 1NMGA 2K75A 1YJ9A 1N32Q 4GLVB 5ELNA 3CCEA 2E2HH 1NBWA 1V9PA 1OXSC 4DUZQ 1Q82C 2YU9H 4LNQA 1XNQQ 1HZCA 3CCRA 4DV7L 1N34Q 5LMUL 1B7YB 4DPGA 4APVA 5FJ8H 2B29A 1QVCA 2E2JH 3M7NA 3K7AH 2D0PA 3BU2A 1G291 1PFSA 3PUXA 2VUMG 4K0KQ 4QQBX 3L2PA 5FLMH 2YYZA 3DLLA 2UUBL 2R93H 1Z47A 5ELOA 4JI1L 4JI1Q 2YV5A 2UXDL 2CWAA 3PCOB 1QVFA 1LTLA 2IHEA 5IYCG 3DM3A 3HOXG 5M3FG 3U4ZA 2RHSB 1I94L 3HOWH 4POFA 4C3JH 1VQ8A 3F1ZA 4JI0Q 3L0OA 2ZJQA 5IT9c 3U4VA 1Q86C 1PH9A 2B63G 4A3JG 3W1BA 2K52A 4L5RC 1L1OB 2LXKA 1K3RA 3J81c 4LF7Q 1XMOL 1XMOQ 1VQKA 3J7A5 1VQLA 2Z6KA 4AYBG 4Y7NH 4XIGS 5IP7H 1CSPA 3KDFB 4A3CG 1VQBA 3CP0A 1S3OA 3PF4A 1X3EA 4DV6L 5AJ3L 1VQIA 2JQOA 1KHIA 2Q2IA 2WB1G 5M3MG 1PH8A 1KIXA 4FDBA 3S14H 4JI4L 1VQ6A 4BY7G 4MZ9A 1LYLA 1JB7A 1E24A 4ME3A 3T1YL 5IP9H 4XTCS 1PYSB 4JI8L 2VS1A 1RL2A 3F2DA 3AYHB 2VQFQ 2PI2A 2ZTEA 2Y0SG 3M4QA 4LW1A 2WFWA 5E7NA 2K50A 4PZ8A 3UDFA 1NJIC 1MJCA 4DUYL 3CC4A 1QZGA 3CW2C 1PH3A 3JAMi 2C35B 1VCIA 1NY4A 1HNZQ 4DV2Q 1K83H 4JOIC 1JE5A 1K73C 3CCMA 2OWOA 3CCUA 1QUQB 1MIUA 4GLXA 4IFDJ 1C0AA 1VQHA 2F3IA 4WJ4A 4GNXC 3K8AA 4DV3Q 3PGZA 4X65L 5HY6A 4X65Q 3VDYA 3KJPA 1BBUA 1V43A 1SROA 2R92H 2OQ0A 1EQRA 3I55A 1SE8A 4C3IH 3TREA 1YIJA 1Q12A 1VQCA 4GN5A 1L1OA 1WCMG 3U50C 3H15A 1EQQA 4O0AA 2MO1A 4ALPA 1L2FA 4TQUS 1HNXL 2RCNA 3KDFA 2ATWA 4LFAL 1N9WA 2UU9Q 5FJ8G 2Q2TA 2HHHL 1YNXA 1FVIA 3FHWA 1K9MC 4IOCA 5HGQA 3Q8DA 1JJGA 5FLMG 4NXMQ 2CQOA 4X62L 4X62Q 1I6HH 1SRUA 4OX9Q 1VQOA 2R93G 2EIFA 4R1JA 4LF9Q 3AFQA 1HZ9A 4DV4Q 1XPUA 1LUZA 4YY3L 5M5YH 3GTKH 2VL6A 5JJKA 2IT1A 1PA6A 2EQSA 1XNRL 3HOYG 2VNUD 4AIMA 1H95A 3RR5A 2DUDA 4LFCL 3J81i 4LFCQ 3CD6A 3HOWG 2B3GA 1GVPA 4P74A 1S72A 4LF8Q 1G51A 4DV0Q 1XMQQ 2KHJA 1S40A 1ASYA 4A4IA 1HNWL 4DR6Q 4YWLA 3I4OA 2K5NA 3K7UC 2K14A 5IYBH 2VQEL 4JBJA 5IP7G 4NXNQ 1YI2A 4POGA 5JJLA 4P75A 2PNHA 2XTIA 3A74A 3L7ZC 3F2BA 1PV4A 4IOAA 3CF5A 3J81j 4B3RQ 2QA4A 3GTLH 2UXBQ 2KHIA 1I5FA 1Q1EA 1X6OA 2OCEA 2OQKA 1HZBA 2A1AA 3AEVA 1BBWA 2IY5B 4OWXB 3ULPA 5IP9G 2UUCL 2Z6KC 2NZHA 4YWKA 1OXVA 1VQDA 1Y1VH 4DR3L 5GQOA 3F8TA 2AKWB 4BA2I 2MFIA 3H0GH 3I2ZA 4YWMA 3U58A 1I3QH 3GD7A 4PZ6A 4LF5Q 4LF5L 3RZOH 3AFPA 4JBKA 2QGQA 1JMCA 3ICEA 1HJPA 4C2MH 4DV7Q 4OWTB 5C0XI 3RN5A 1Q1BA 3A0JA 2DGYA 3B6YA 4IPDA 2QEXA 5LMUQ 3UDIA 1VQ9A 1WFQA 3K81C 1MJEA 4HIMA 4B3TL 4DR7L 4HJ7A 2UUBQ 4BY1H 4DR4L 4DR4Q 4DK3C 2UXDQ 1HZAA 1U0LA 2R92G 3HKZG 4MNOA 1VQ4A 4JYAL 3PIOA 4YCWA 1SR3A 3HOYH 4DK6C 4OWWB 5C44H 3OTOL 1I94Q 3EBEA 1ASZA 1IYJB 3FP9A 3CPFA 3M4OH 3FKIH 2E8GA 1E7ZA 3PUYA 1M90C 4QGUA 1C7YA 2OTJA 4JI7L 4JI7Q 1OXUA 4EX5A 2YTVA 3RLNA 3ULJA 1EUJA 3CXCA 1Q7YC 2JK8A 4LUZA 4A3IH 2JA5H 1YHAA 4DV6Q 2E5LL 5AJ3Q 1L1OC 2N8NA 5IWAL 2E5LQ 3PUZA 1KXLA 2HIXA 2PMZE 1R9TH 2NVXH 2I5HA 4B3SL 3PO3H 2NN6I 4KHPL 1PYBA 4JI4Q 2CFMA 2K5HA 2WAQE 2GVAA 3T1YQ 3M85A 3S24A 1E1OA 4DR2L 4TVAB 2JEAI 4JI8Q 5C3EH 2R7ZG 5IYBG 1TWAH 1GM5A 3MXNB 4X6AH 1RIPA 1FGUA 1AE2A 1YITA 3KOJA 4DKAC 3GDEA 2HQLA 4A76A 1BVSA 2F4VL 2A19A 4DUYQ 3PO2H 4LFBL 1X54A 1O7IA 2JJQA 3GTOH 3STBC 3S16H 4HJ5A 5C4XH 2KCTA 1OXXK 1WJJA 4JBWA 2R7FA 4YCUA 4OO1G 3ZJYC 4A93H 4IFDG 1YEZA 3CCVA 3A5ZB 1BKBA 1VQMA 2RF4A 4LUVA 2ZM6L 3PUVA 2I5LX 3K80C 4A3EH 4J15A 4JI2L 3A5UA 5FLXc 5GROA 2RHQB 2R7DA 4IPGA 1M1KC 1Y1VG 3I4NH 3CCLA 3GO5A 1NTGA 3PF5A 3H0GG 2WP8J 4GKJL 3CCJA 3S1RH 5K36G 4RG1A 1P16A 2ES2A 3S2DH 4JV5L 3J80c 4PG3A 4IPCA 1HNXQ 1FJGL 4RMFA 1VQJA 4LFAQ 3GTJH 4P71A 5IY0A 4L5QA 2HHHQ 4A3LH 3PV0A 3D31A 3CC7A 1K8GA 1PVOA 1D7QA 1W2BA 4BY1G 1VQNA 4AH6A 1AH9A 4GN4B 4LF6L 1B70B 2PI2E 3G48A 4YY3Q 1J6QA 3CMAA 4BBSH 4NB3A 1XNRQ 3TEHB 5C44G 2E2IH 4KHZA 1CSQA 3FKIG 4R4QA 1SFOH 3I7FA 2CKZB 3TQYA 4GOPA 1HR0L 1EIYB 3HOVH 1J5EL 1J5EQ 4IO9A 1HNWQ 1PH6A 4DR5L 3NEMA 4HJ9A 3TRZA 2N3SA 5BR8L 1VQ5A 2VQEQ 4A3KH 2MQHA 2A8VA 2KENA 1TWGH 4UP9A 4YHHL 4A3IG 4A3FH 1HR0W 1CKOA 2JA5G 3OYYA 5J3BA 1IL2A 3KJOA 1K0RA 5EAYA 3OW2A 4A3DH 2ZJRA 4DV1L 2I0QA 3PO3G 1UE5A 1OXTA 1T9HA 2Z0SA 2UXCL 1N33L 1N33Q 2HIVA 1QVGA 2UUCQ 2GN5A 5C3EG 5IYDH 5LMNL 5LMNQ 1KD1C 1JJCB 2AHOB 3KFUA 3M3YH 1I50H 1UE1A 4LUOA 4UP7A 4DR3Q 3E9HA 1X9NA 1UE7A 3KLWA 2MO0A 4A3MG 1PH2A 4IJLA 3EIVA 2NVTH 4MTNA 3PO2G 4QJFA 4JC0A 2UUAL 5LMNW 5C4XG 4UP8A 4WJ3M 3UE0A 3I4MH 4HJ8A 1KC8C 4A3BH 1NE3A 1IBKL 2ID0A 2VY3A 4B3ML 4B3TQ 4B3MQ 4A93G 4O2DA 4DR7Q 3NENA 4AYBE 3CPWA 2K5VA 3CAMA 4A3EG 1X3GA 3ER0A 1X56A 4JCVE 3S1NH 1XJVA 2PQAA 1X55A 1E3PA 1UE6A 2HT1A 3I4NG 4R4IA 2V1CC 3J80i 1VQGA 2OTLA 1K8AC 2BA1A 1YHBA 2WB1E 4DR1L 4JI5L 4JI5Q 4BXXG 3OTOQ 4X66L 3NBHB 2JEBI 4X66Q 1XPOA 5JJIA 3KF8B 2CWPA 1N8RC 3HKSA 1N32L 4R4OA 1TXYA 4DUZL 1YHQA 1XNQL 4GLAC 1C9OA 4IJHA 3WWVA 1N34L 1KRSA 3M9BA 5C0XJ 3I56A 3KF6B 3S2HH 4PMWA 5C0XG 3E0EA 3G4SA 4A3LG 3KYHC 3RLOA 1NMFA 2NVQH 2Y0SE 4OXPA 4K0KL 2VW9A
chains in the Genus database with same CATH superfamily
1Q46A 5IWAQ 4R4CA 2C5CA 3VR3A 1D6EC 3I73A 4WJWA 5EGTA 2JA6H 1CKMA 1WYDA 4V0BA 3LGJA 1N36Q 3MTSA 1PH4A 4JI0L 3J7ZC 2QCPX 5EKIA 3RMHA 1F9PA 4HCSA 4X64Q 2JA9A 4LF7L 3T16A 3PSIA 3R2IA 4K8JA 5CV9A 2B2TC 2J0TD 2Z4HA 4GOPB 4A3MH 3G6EA 1EY0A 1A63A 2HD3A 1LTBD 3CMEA 1LTID 3BJUA 4RGNA 1SXTA 2N49A 4IUPA 4BBSB 1XPRA 2NN6G 2ZM6Q 1SFOB 3H3VI 3I90A 4F7XA 1PTOD 2VQFL 4O1NA 3T13A 1IBLQ 1IXRA 5K5PA 5JAVA 3WOEA 2L55A 1QB5D 2WACA 2E74C 3MAQA 1UWVA 3BZKA 1FJGQ 3TN2A 3I4MG 4DV2L 4BA1I 1KL9A 1E2VA 3GTLB 2RSNA 2R6GA 1T5XD 4ZCKA 2NVYH 3VYRA 2JE6I 1PH5A 2Q2HA 4KJOA 5LL6S 2ENBA 2KCMA 4DGZA 2H1EA 1F77A 5C4JH 1B2TA 1Y69U 3TS2A 3J81E 2ZXRA 1Y14B 1CTMA 1IZ6A 2OXPA 2KBNA 1A0IA 2NVTB 1EU3A 2B63H 4P72A 3HGBA 2AMCB 2UU9L 3D0FA 1CK1A 1WTHA 4HIDA 2WAQB 3SGIA 4A75A 4YHHQ 4NXML 4QB4A 4A3CH 4OX9L 3HOUG 1HPCA 2NBFA 5M3MH 1PFMA 4DV1Q 3HOZG 3D4RA 4BY7H 3NPPA 5CYUA 3SK5A 2UXCQ 5EBDA 1V1QA 3UI2A 1Y1WG 2BE5C 3X3NA 4GNXA 1FYCA 1KQSA 3HKZE 2O5JC 1LTTD 1QE6A 1QUQA 5DAUA 2YTYA 4ID6A 1DCZA 4LF4L 4B3RL 2JN4A 4OONA 1R9TB 1SYEA 4L8JA 4B9WA 2JA8B 3UE1A 2Q2UA 5CBEE 1CI3M 4K8IA 4JI3L 1PZID 3K0XA 3W5OA 4C3HG 4CJ2C 2F3VA 1YBYA 1CKNB 3BZCA 5JPNC 3F2CA 3QIAA 2A74C 1WCMH 1LTRD 4G57A 1B50A 4DV5Q 2X69A 2E2HH 2R7ZG 1V9PA 1OXSC 3MEHA 4DUZQ 3A54A 5FJ8H 1GUWA 1SEBD 3SK6A 3DLLA 2A6ED 3IKJA 4ABNA 4JI1L 2EZVA 2YV5A 1PTOB 3BYYB 2IHEA 4JPBW 5A2QL 2RDHA 4BBRB 3VR5A 3HOWH 1VQ8A 4JI0Q 3L0OA 2K5DA 2WV6D 2K52A 4KKSA 3A7LA 4X3SA 4LF7Q 2DNCA 3PMFA 3J7A5 4Y7NH 1HQMC 4XIGS 1CSPA 2VUMB 3CP0A 1S3OA 3PF4A 1D2BA 1X3EA 1TS3A 5AJ3L 2LKVA 4CDEC 2R3ZA 1BCPF 1VQ6A 4MZ9A 2RBMA 3T1YL 1LACA 2D9UA 1PYSB 2VS1A 1RL2A 3AYHB 2VQFQ 1GHJA 4LK1C 4A3JB 2PI2A 2ZTEA 4LW1A 4A3KB 1NJIC 1MJCA 3CC4A 1RD9D 3JAMi 4DV2Q 1JE5A 2WB1B 2D2CC 4RWSC 1GXDC 4GNXC 2F0KA 3K8AA 4X65L 1I4PA 5M5WB 1XX8A 3LX0A 5E4WC 2JA7B 1TWHB 3GV6A 1QNKA 3K5MA 1L2FA 1KAAA 3K5LA 1BNZA 3NQTA 2EJMA 2UU9Q 2Q2TA 2HHHL 4C56C 1YNXA 3MC0B 4IOCA 1TT2A 3S1QB 3Q8DA 4NXMQ 4X62L 3VR6A 4OX9Q 3AFQA 2F0SA 3GTKH 5CC4A 1PA6A 4AIMA 3AU7A 3MZ5A 3RR5A 3I72A 4TKOB 4LFCL 1GVPA 1XWEA 4C3JG 4P74A 2YU9B 2K5NA 3K7UC 3A7AB 5JJLA 4P75A 3A74A 3L7ZC 3IFDA 3J81j 4B3RQ 3GTLH 1SNDA 3QWNA 5J39A 2KHIA 1EZ6A 3ONAB 4OO1H 1IW7C 2F0FA 2IY5B 4OWXB 3AMUA 2UUCL 4QIWB 4N8X1 1JICA 1RJTA 4RHSA 4LF5Q 1RHPA 2O5IC 1JMCA 1HJPA 4LJZC 4OWTB 1VQ9A 2QEXA 1JOOA 1MJEA 4B3TL 5T1GA 5IT9L 3CRKC 4HAEA 3FEWX 1D1IA 1U0LA 3HKZG 1SDFA 1SR3A 4OWWB 3EBEA 3FP9A 1NR2A 2AUKA 3E3XA 3RZDB 1M90C 1C7YA 3K57A 1OXUA 3HP3A 2IW3A 2KUMA 1Q7YC 1CHQD 4LUZA 5D14A 4A3IH 2JA5H 5DEHA 2E5LQ 5AJ3Q 1IL8A 2HIXA 1R9TH 2I5HA 2R92B 3A55A 2NN6I 1PYBA 3TP6A 3SDZA 3T1YQ 3M85A 3S24A 4ODGA 2FINB 5CV5A 2JEAI 5C3EH 2KCNA 1EY5A 5IYBG 1FGUA 1AE2A 1QNUA 1YITA 4RKBA 4MN3A 3GDEA 2HQLA 4DKAC 2F4VL 4LFBL 4RCNA 3PIO3 5EKLA 1VF5C 1JQYD 1ET6A 1WJJA 2CHBD 3D6WA 4TRDA 3CCVA 1BCPD 1MGSA 2RF4A 4M8AA 2I5LX 1M4VA 5GROA 4IPGA 1Y1VG 5JOBA 3H94A 1NTGA 3PF5A 2KVMA 5C5MA 3J80c 4PG3A 4IPCA 2NTTA 2SNMA 4KN7C 1DZ1A 1LABA 1HA6A 1VQJA 4P71A 2HHHQ 5C0XH 4PV1C 4PMBA 4HEDA 5EPJA 2F3WA 4LF6L 1B70B 2PI2E 2HDLA 1PDQA 2NWGA 3CMAA 5FO8B 4NB3A 4BWGB 5C44G 4XXEA 4N9TA 2E2IH 4QMGA 4KHZA 1EU4A 1CSQA 1EIYB 3H0GB 2V4DA 2CKZB 4GOPA 3RZOB 1J5EQ 2XWJB 4IO9A 3NEMA 1ONLA 1U4LA 2N3SA 4A3KH 2MQHA 1JOKA 3TDQA 4UP9A 1I4GA 3OYYA 1K0RA 5EAYA 4DK0A 2ZJRA 3PO3G 3HOYB 4KHVA 1DONA 4OGQC 3C1EA 4B08A 1N33Q 2EPBA 2UUCQ 4NP5A 1RF2D 1KD1C 5ELDA 3OIPA 4LUOA 4FXDA 3NE5B 1X9NA 2MO0A 2F0PA 4IJLA 3EIVA 3PO2G 1II3A 1EEID 1EFID 1MSHA 1XTCD 2F0WA 5LMNW 2RA4A 5E3FA 5E1FA 1SMYD 3TP5A 1NE3A 3IAYA 3FMCA 4B3TQ 2TSSA 4IQZA 1HHVA 3MWYW 3NENA 3V2TA 3J81L 2K5VA 2LMCB 3CAMA 1X3GA 4LAAA 1UE6A 3I4NG 1G2TA 1VQGA 4JI5Q 4BXXG 1TY0A 1JB3A 4X66Q 1XPOA 3KF8B 1I4QA 1N32L 5JEAH 1XNQL 5BN4A 3GTOB 3WWVA 3FRPB 1N34L 1SBBB 4U673 5C4XB 4A3LG 3G4SA 3RLOA 4EQNA 1LV9A 4OXPA 2F0IA 4A93B 1BCPB 3S17H 2AWNA 1A3TA 2YTXA 4A3EB 4DAYB 5T1IA 1EYDA 3RNUA 4X3KA 3T56B 1N36L 1B8AA 2K4KA 1GO3E 2N78A 4Y52H 2VB2X 4UY8C 1KNEA 3HOVG 1JOQA 3S2DB 3CC2A 2F0JA 4X64L 4KY6A 3T1HQ 1JT8A 1SE3A 3AQQA 4CDFC 3M4PA 1ENAA 5BN5A 4A3FG 2F4VQ 4LFBQ 1L0YB 3HFZB 4OIJA 4A3DG 4OO1I 4IUVA 2I07B 4IUTA 2IX0A 4GOPC 4ZKCB 1FL0A 1CKNA 1WI5A 2PW7A 4G7HC 1EYGA 1ZYRC 4EQ5A 1D8LA 1B9MA 3NBHA 5IYDG 1B3QA 2K5WA 1F9QA 1IBLL 1G6PA 1EQTA 3CQZH 4A3GH 3GTPH 1IBMQ 4RCOA 4BXXH 1DGSA 5IGEA 5M5XH 5DLQE 3RZDH 1DOKA 2AQ2B 2XGTA 3BDOA 1X65A 1BDOA 5C3WA 4HJAA 1A3VA 1A62A 2NTSA 1HNZL 4A3BG 5FK9C 2QKIC 3MEFA 4DV3L 1QILA 1MKHA 3ERSX 1EFWA 2F0LA 4LF6Q 1FGBD 1IYUA 5IT9E 4KK7A 5IODA 3HOXH 5M3FH 5COYA 2A5HA 2PQAB 1UUPA 2PZTA 2LS01 3OIQA 2F0DA 3D6CA 1VQ7A 3I4MB 4IPHA 1SYDA 1AE3A 1S5CD 1D5ZC 4AQYQ 3E9IA 1IKLA 4J8QA 2H5XA 1LLRD 4DV4L 2JA6G 2BA0A 1EOVA 1V1OA 3K58A 3TBIB 3GTGH 3UDGA 1O78A 1ESRA 2EJGC 4KV6A 4LF8L 4NPSA 1DXMA 1PHJA 3S15H 2MPMA 2VB3X 2F0EA 3CHBD 2BCOA 2L4NA 3S2HB 3SHLA 3LWEA 2NVQB 4IUUA 3GTMH 4RGOS 2EYLA 5I6YA 5ELCA 3HOUB 2KEDA 1EYAA 3QO2A 1SLJA 3ULLA 3HOZB 3S1MH 3JAMc 1IKMA 2E75C 4IALA 2LSSA 3RN2A 1Z6HA 5GAHC 1WTVA 1QZHA 2GA4B 1D5MC 5D65A 2L5TA 1TR5A 2QDLA 4K2KA 2BH2A 4DV5L 1N32Q 4N8FA 1NBWA 1Q82C 1XNQQ 3EVQA 1N34Q 5LMUL 1B7YB 1TWFB 4J6HA 1PXUA 4IURA 2AQ3B 3HRZC 2D0PA 3BU2A 1G291 3N6RA 3L2PA 2YYZA 4ZUJA 4XT1B 2R93H 2DJFC 5KNBA 5ELOA 2CWAA 3PCOB 3HS0C 5HURA 1QVFA 3URYA 5I9PA 1EOTA 2RHSB 3P20A 4HTHA 3S1RB 2B63G 3W1BA 2IJ0A 1TWCB 3P7JA 3A8IE 1HFNA 1JWMD 1GUSA 2EYJA 3Q24A 1XMOQ 3QOJA 1VQLA 2Z6KA 2EYOA 5HGTA 5EQ0A 4A3CG 1VQBA 3FVQA 2HCCA 2JQOA 5M3MG 1EIHA 5LHY1 4J1MA 4JI4L 4BY7G 2F0OA 1E24A 1NSNS 1TQOA 1KLUD 5IP9H 3AB9A 3BDCA 2F03A 1UNSA 2WFWA 1CQVA 5E7NA 2K50A 4PZ8A 4XT3B 1PH3A 1HNZQ 1K83H 4FVMA 3CCMA 2EOTA 4RA8A 4IFDJ 1C0AA 4DV3Q 5HY6A 4UDUC 3VDYA 2F0UA 1BBUA 3KJPA 3QJYA 1K3BC 1EQRA 4C3IH 1RDPD 1STAA 1L1OA 1WCMG 1EQQA 1BQQT 1YNNC 2EY5A 1WTWA 2Z9HA 2MO1A 1Q3LA 3EFXD 3BG3A 3KDFA 2ATWA 1CT1D 4LFAL 3KBGA 5FJ8G 3BZDB 1ZKOA 1GUNA 1I6HH 4FP5D 3GTQB 1VQOA 4R1JA 1AZPA 4DV4Q 1LUZA 4YY3L 5M5YH 1CZWA 1XNRL 2E2DC 2DUDA 2KCCA 2QEJC 3TP7A 3J81i 3HOWG 3NTKA 4LF8Q 4FF1A 2KHJA 4QUFA 1S40A 1H9RA 2K14A 4XQNA 2E2JB 3K7AB 1ILQA 1HUMA 1D1KA 1PV4A 2VXWA 3OMCA 5FLXE 3A8JE 1H9SB 3AEVA 1HZBA 3D4WA 2EYMA 4IFDH 2A6EC 3TZUA 4C3JB 2Z6KC 1OXVA 5GQOA 3WDNA 2MFIA 4R8IA 3GD7A 4LF5L 2B2YA 4K5XA 3ICEA 1STYA 4C2MH 3RN5A 1LTSD 2DGYA 3A0JA 5LMUQ 5AFWA 5KNDA 4G7ZC 4FF3A 1HTPA 2E76C 3C2PA 3S14B 4HMJA 4HJ7A 2SNSA 4BY1H 4DR4Q 2FJ2A 1PFBA 2BE5D 1W6KA 5CV7A 1VQ4A 1S5BD 3OTOL 1IYJB 2M2LA 3FKIH 3PQIA 3PUYA 3SXHA 5CR3A 4QGUA 4JI7Q 5EPKA 3RUZA 2RKSA 3ULJA 2E5LL 1L1OC 1KXLA 3PUZA 5FOBB 3KBXA 3HKZB 1ENFA 5IOCA 2O4XA 2K28A 4JI4Q 1X3QA 2K5HA 3LNNA 1V1PB 1SAPA 4DR2L 1BBXC 3R3OA 2XVSA 3FDTA 1FD7D 1TWAH 1GM5A 5IGGA 2JP1A 5CBAE 1S5FD 3KOJA 2B39A 1BVSA 2F0MA 2QF7A 5C4ZA 3STBC 4HJ5A 3MXUA 4ZKBB 4OO1G 4XQJA 3NP8A 3A5ZB 1VQMA 1UEAB 3K80C 3KF8A 2WKCA 4H13C 2R7DA 2F0NA 1Q90A 2WIIB 1B4OA 3Q22A 2WP8J 4GKJL 3CCJA 3S1RH 4JV5L 2AQ1B 5I6WA 4LFAQ 5JVH3 5IY0A 4L5QA 4DAYA 3S9WA 3MA2B 5I2YA 1PVOA 1SJHD 3SEBA 1Y8OB 4AH6A 1AH9A 4GN4B 2PCFB 4YY3Q 1J6QA 4BBSH 1SNOA 1XNRQ 2B2YC 3TEHB 1Y1VB 3MXNA 3NBIA 5KGUA 4R4QA 1SFOH 1I3QB 1J5EL 3K0YA 1PH6A 4HJ9A 2L0CA 3I3CA 2J7ZA 1EYCA 2L9HA 4ZYSA 4A3IG 1CKOA 2JA5G 2HUGA 3NTHA 3KJOA 2MJ8A 5FO9B 1L0XB 1OXTA 4L63B 1NAPA 1FNUA 4CJ1B 5C44B 1STGA 2RQXA 1N33L 2GN5A 3MHBA 5C3EG 1JJCB 2AHOB 2CW0C 4Q5VA 4UP7A 5NUCA 3E9HA 4Z9CB 3KLWA 2Z6BA 2K7VA 3VR4A 1B3AA 4KY7A 2NVTH 4K6DA 3O13A 4RKLA 4UP8A 3EJIA 3G6JB 4HJ8A 4FNFA 1KC8C 5KRUA 2NVXB 2VY3A 4K6LA 5ELBA 4B3MQ 3PO3B 3N52A 3X3MA 4OHJA 1PRTF 4AYBE 3CPWA 1RCVD 1X56A 2PQAA 1K28A 1E3PA 4CDDC 5IGBA 1TS2A 2OTLA 1K8AC 1YHBA 4JI5L 2ICIA 1QOHA 3BDLA 3E0JA 3KK7A 3OTOQ 4X66L 5JJIA 1C8CA 4RAUC 1PYWD 1N8RC 1JCKB 3PO2B 4I7ZC 4GLAC 1C9OA 4IJHA 1IHZA 1KRSA 4DFAA 5C0XJ 3S16B 5C0XG 1SNQA 3KYHC 5FO7B 2Y0SE 5KYIA 1L0WA 1WTPA 4UPAA 2IHFA 1QG7A 4C1NK 3CCQA 2DNEA 1Q8KA 4DAPA 1O7ZA 1MHWC 2JA8H 3I4NB 5I2XA 3DM1A 3VA7A 1TY2A 4DR2Q 1T5EA 1BCPC 5CV4A 1K8OA 1GD7A 2B8GA 3CCSA 2CH4W 1G91A 1KAWA 4F8MA 3MXPA 3T1HL 2B2UA 1C4QA 3JC66 4A3KG 1VQAA 4JI6Q 2EXDA 1ZXTA 2DJGC 3I4LA 1H9MA 2L11A 5CV8A 4HIKA 3J80L 4IFDI 1A8VA 4C1NI 3C3LA 4RFBA 2AWOA 2SDFA 1MBYA 4X3UA 2BDOA 1B1ZA 3K6OA 2LY7A 3HOVB 1PTOH 2JA7G 3PIPA 4BBRH 4HIOA 1IBML 5H1SE 3KF6A 4GKJQ 1ML0D 1TWGB 2D5DA 4GNXB 4A3FB 4U68A 4JV5Q 2X6LA 1AZQA 1SNMA 2DY7A 5I9OA 4DAMA 3PUWA 2ZTDA 3ERQA 4A3DB 2VZAA 4DNIA 4CHTB 4CJ0B 1Q81C 5BN3A 3NELA 2VUMH 1F2YA 1UEBA 2FXQA 2G9DA 3R2TA 1JWUD 4RGTA 4KLKA 4PMCA 5D3DA 5A35A 1YJNA 2FFKB 3M3YB 1I50B 5IYCH 3K5NA 1G2SA 2D62A 3UDXA 4FF4A 1W3SA 2Q8TA 4BS9A 5JEAJ 5EJWA 5JEAG 1SYFA 1LT3D 2ZJPA 1G6ZA 1X3FA 4A3JH 1WTXA 3H09A 1U5KA 3A56A 4A3BB 4AQYL 2HCIA 3BVGA 4L5TA 1FNWA 5GADC 1VQPA 2RSOA 3S1NB 1E1TA 1ESFA 1QCBD 4NMZA 5IGDA 2BDNA 5DNFA 2D0OA 1HUNA 4P73A 3D3RA 2A68D 5M5WH 5G3LF 5IGCA 2L15A 1VDZA 2JA7H 1TWHH 2I5MX 2B2VA 2XWBB 2ASBA 4R4TA 4ZUIA 4NXNL 3G71A 3DXJC 1GKHA 4YCVA 3L3OC 3NTIA 1KRTA 1A2TA 2JA6B 4JG2A 2UXBL 2CCZA 4DA2A 3S1QH 1PH1A 3GQBA 2EXZA 3RLFA 2B2UC 2A6HD 1QWYA 3H3VH 1SYBA 4QL5A 1MSGA 4A3GG 4KY5A 4EGVA 2KA7A 1OTCA 3W1GA 2ALYB 4A3MB 4GKKQ 1EQVA 2K75A 2C9OA 4OEMB 5ELNA 3CCEA 1DD2A 2YU9H 4LNQA 3CCRA 4ZK9B 2WINB 4APVA 1CA5A 2B29A 3M7NA 1TS5A 4QQBX 3PUXA 1PFSA 3T4AC 5FLMH 2UUBL 4QCLA 1Z47A 2UXDL 3OWFA 4WRDA 5M9OA 3DM3A 1ET9A 1PRTD 5KEEA 3HOXG 5M3FG 3U4ZA 1SJED 2ZT9C 3F1ZA 2NZ1D 1PH9A 1Q86C 2LFNA 4NKLA 4L5RC 2LXKA 3J81c 1S5DD 1GUTA 3GTJB 1XMOL 4AYBG 1BXTA 2NVYB 3HG9A 3OW7A 3VYSA 5IP7H 2IX3A 5FLXL 1VQIA 1ICFB 2Q2IA 1KIXA 1PH8A 1K0SA 4Q0FA 3VR2A 3I8ZA 4R9WA 1R4PB 1E2WA 4HR7B 5C4JB 1GUGA 1TS4A 2QDBA 1FR3A 1STHA 4XTCS 4JI8L 2B63B 1EY9A 3M4QA 2Y0SG 4UAIA 3UDFA 1BF4A 5J1ZA 1EY8A 4DUYL 5JPMC 1EY7A 4HMIA 3NUCA 1NY4A 1K73C 1F2MA 5M3MB 2OWOA 2KHSA 3CCUA 4GLXA 5D3IB 4RHRA 2F3IA 4WJ4A 3PGZA 1B53A 2B2VC 2JSOA 2MUYA 2A73B 2R92H 2OQ0A 3I55A 4KJNA 3TREA 1Q12A 1VQCA 3U50C 1U9RA 4O0AA 4UHVA 3D8GA 4KKUA 1HNXL 2RCNA 2PMZB 1N9WA 1I4HA 1S5ED 3NQIA 1FVIA 3FHWA 1QJOA 5HGQA 1JJGA 2CQOA 2R93G 3HZXA 2EIFA 1KABA 1V1PA 2F0QA 3OMGA 4KN4C 1HZ9A 1XPUA 5JJKA 3HOYG 1H95A 2EQSA 4K5WA 3WOFA 2B3GA 1WCMB 2Z1CA 4A4IA 2E2HB 4YWLA 3SK8A 1U4RA 2OT2A 4JBJA 2A69D 4NXNQ 4HN7A 3F2BA 3CF5A 4H7BA 2QA4A 1HCZA 1GJXA 2UXBQ 3BVZA 1I5FA 1PRTB 1Q1EA 3HOWB 4EVOA 2KQ3A 5IP9G 2NZHA 4N9PA 4YWKA 3J80E 1Y1WB 4DR3L 3F8TA 4R8NA 2AKWB 5G3LD 4BA2I 3H0GH 3I2ZA 3U58A 4Y7NB 1PLFA 3RZOH 5K36H 4JBKA 2QGQA 1Y8NB 2N55A 2CVRA 5C0XI 1Q1BA 1NUCA 3UDIA 1PMRA 1WFQA 3I91A 4HIMA 3DUZA 1GUOA 4DR7L 2UUBQ 1SNPA 4DR4L 2UXDQ 4MNOA 4JYAL 4C3IG 3ITPA 3SE0A 2ZXPA 3HOYH 4C3HB 5ELEA 2RVLA 4L6TB 3OWEB 2WKDA 1WD1A 3CRLC 1HRJA 5C3XA 1YNJD 1PTOC 2OTJA 1STEA 2R7ZB 4JI7L 1Q8IA 2YTVA 3RLNA 3CXCA 1EUJA 4KMUC 4FO2A 1YHAA 2N8NA 4B9XA 1RKNA 4B3SL 4KHPL 2WAQE 4I65A 1KDCA 2GVAA 3DEOA 2EY6A 3DEPA 3C1FA 4NDXA 4JI8Q 2XRSD 4KKTA 1S4ZA 4IUQA 1RIPA 1KDBA 2SEBD 1SE2A 1ICWA 4A76A 1WD0A 2A19A 4DUYQ 2AUJD 3GTOH 1O7IA 2HQEA 5C4XH 4H44C 3GTKB 1OXXK 5LL6X 2FMMA 2R7FA 1I4XA 4HSPA 4YCUA 3ZJYC 1AN8A 4A93H 1YEZA 4IFDG 1ENCA 1UAPA 3QG1A 5TSSA 4A3EH 4J15A 4JI2L 3A5UA 1HTLD 1M1KC 3GO5A 3ND8A 4RG1A 4XYQA 3S2DH 4LMQD 1HNXQ 2JXMB 4RMFA 3GTJH 1HFGA 4RGMA 2PYKA 3PV0A 3D31A 1K8GA 1D7QA 1W2BA 4BY1G 1E0BA 1DOLA 1WTQA 3FKIG 1HR0L 3I7FA 3TQYA 2EJFC 4EQPA 4DR5L 3H3VC 3TRZA 3TMEA 5BR8L 2F0VA 2A8VA 1HA5A 4G7OC 3OHXC 4CKBA 5EKKA 4TSSA 2MHVA 5J3BA 3NSWA 3OW2A 2XIWA 1T9HA 2Z0SA 1YNND 2NN6H 1CQFA 2XSCA 2HIVA 2RDGA 5LMNQ 1O80A 4ILWA 1F2ZA 4DR3Q 3TP8A 1PH2A 4K2LA 3MFYA 4MTNA 2M00A 4QJFA 1VMCA 2M9VA 4A3IB 4JC0A 2JA5B 2UUAL 2IL8A 3I4MH 1JORA 3L9AX 1IBKL 1M8AA 4JK1C 4B3ML 4DR7Q 5C4HA 3OOCA 3ER0A 1RTNA 4JCVE 4JYAQ 3MVVA 5C3EB 4R4IA 2V1CC 4XDXA 1A15A 2WB1E 3NWTA 4DR1L 2K32A 3NBHB 2JEBI 1RTOA 2CWPA 4IN3A 3HKSA 2G5DA 4R4OA 1YHQA 1AW7A 1LT4D 3I56A 3VA5A 3S2HH 5IIFA 1NMFA 2NVQH 4K0KL 3QR8A 1V8QA 4QUCA 2EYFA 4PZ7A 3HOUH 4BBSG 2IX1A 1CFMA 3HOZH 4B3SQ 4WORA 4KHPQ 1BOSA 3SK4A 4DXFA 3J7YW 4JBMA 1E22A 1Z9FA 1YJWA 4HSVA 1SYGA 1Y1WH 4GS3A 1YVCA 1VQFA 3NHHA 3Q6SA 5CMDA 4G4KA 4JI6L 1DM0B 5IE8A 1F9SA 2NZOA 3IRBA 4E6IA 3E5SA 3JAME 5JVG3 1TWFH 1XTDA 4ZLTF 4ULLA 4HCEA 3BVMA 2E2IB 1ILPA 3KLSX 3CKIB 5EPLA 1HXYD 1I4RA 4JI2Q 3V05A 5GAGC 3VYTA 1RODA 4IUNA 2J4XA 4C3HH 1MD2D 2L12A 5GAEC 1P8LA 4H0LC 1EL0A 4DF7A 4CGYB 1BUVT 3DWPA 2R7ZH 1TWCH 5L37A 4QIWE 2WAQG 1SN8A 2EDGA 1VS0A 2NYZD 4CKCA 1JJ2A 4O42A 1SE4A 1PH7A 1CUKA 2K5QA 3TS0A 1LM0A 3Q0AA 3D4DA 4ZAIA 1JR0D 2FMCA 4M1UB 1HR0Q 3M7GA 4QY7A 3STBD 2PQEA 1H9JA 2ZTCA 4DR5Q 1AP0A 1EWIA 5BR8Q 1DYQA 2F0HA 1YZ6A 2LXJA 1EIFA 4LF9L 3PIP3 1I6VC 2BH8A 2Z4IA 1VQEA 3EN2A 1WOCA 2F1MA 3OSOA 2JA8G 2F52A 1GOZA 4JOIA 4L5SA 4DV0L 4FXKC 1XMQL 3M4OB 1DOMA 4DR6L 4GZYC 5CV6A 2GVBA 2Q8IB 1HH2P 4OIKA 2KOLA 4YIJA 2UUAQ 4GN3B 3S17B 4H02A 4LF4Q 1E2ZA 3K5OA 4LWCA 1IBKQ 3R93A 2PPBC 2Q8RE 2MNAA 3BYTB 2EE1A 3GTQH 2K1BA 4JI3Q 4KI0A 5ISRA 4BBRG 3KLSA 5KIXA 4DR1Q 3W3AA 1SMXA 2BOSA 1HQRD 4GKKL 1NMGA 2IPKD 1YJ9A 4GLVB 2MGSA 2XRQD 1HZCA 4DV7L 2B2WA 3DMUA 4DPGA 4ZRZA 1O7LA 1QVCA 2DY8A 2E2JH 3K7AH 3M4YA 2VUMG 1LO5D 4K0KQ 1IW7D 1WTRA 1K8MA 2DN8A 1ZEQX 4JI1Q 4CKEA 4IZ8A 2CW0D 1LTLA 5IYCG 3CQZB 1O7YA 4A3GB 1I94L 3GTPB 4POFA 4C3JH 5M5XB 2ZJQA 4K5VA 3U4VA 1F2LA 5IT9c 4A3JG 1L1OB 1H9KA 1K3RA 3ND9A 3SVMA 2MP1A 1VQKA 1EZ8A 1PFNA 4JW0A 4DAVA 3KDFB 1TIID 2ICEC 4DV6L 2R61A 1EWCA 1KHIA 2WB1G 3NK9A 3C46A 1CM9A 2PW5A 4FDBA 4ZQ3A 1A3UA 3S14H 1LYLA 1JB7A 3HOXB 4ME3A 3R8BA 5M3FB 1EWHA 1Y8PB 1U4PA 3F2DA 1CHPD 2PO4A 1EY4A 3KLRA 3F2UA 3EQLC 3P75A 4XQQA 1D5XC 4AYBB 4WFN3 1QZGA 3CW2C 1FNVA 2C35B 1VCIA 4JOIC 3HEJA 1STNA 5DM73 1JWSD 1QUQB 1MIUA 4DXGA 3GTGB 1VQHA 1BO0A 1X32A 2XN9C 1X3PA 4X65Q 4FXGC 3DWQA 5KYLA 4MTKA 1V43A 4DNTB 3S15B 1SROA 5F2DA 4NW2A 1SE8A 1YIJA 2B8FA 4GN5A 1JE4A 3H15A 2PZWA 2Y0SB 4JVZA 1VMPA 4ALPA 2A68C 4TQUS 5CGKA 3W2DA 3GTMB 2F0TA 4CBVA 5IGFA 4PQXA 2F0GA 1K9MC 4DK1A 3J7AF 5FLMG 3S1MB 4X62Q 1SRUA 1WVLA 4LF9Q 1SMYC 2VL6A 2OEOA 2IT1A 3Q23A 2VNUD 4LFCQ 3CD6A 1J8IA 1S72A 2B2WC 1G51A 4DV0Q 1XMQQ 2A6HC 5KNCA 5A2QE 1ASYA 1HNWL 1STBA 5J22A 2K04A 4XYOA 3I4OA 4DR6Q 5IYBH 2VQEL 1F9RA 1NNXA 2NB0A 5IP7G 1YI2A 4POGA 2H4OA 2SOBA 2PNHA 1G8ZD 2XTIA 3G7LA 4IOAA 2R93B 4KTAA 3QOLA 1DJRD 3RD4A 3EROA 4S3SA 1WTOA 1EEFD 4X3TA 1X6OA 1KDAA 2OCEA 2PNRC 2OQKA 2A1AA 3OPOA 1BBWA 2K05A 3GP7A 3ULPA 3IFTA 2QILA 3I70A 1KLGD 5I4DA 3TZDA 1VQDA 1Y1VH 1PRTC 2F4IA 1SNCA 2O2LD 2KEEA 2CQAA 4YWMA 1I3QH 1TKWB 4PZ6A 1LTAD 3AFPA 1PZJD 1B44D 1TU2B 4V190 4DV7Q 4F87A 3B6YA 2K03A 4IPDA 2IWHA 3K81C 4MIUA 1AEXA 4DN4M 3NXWA 1XYIA 2EY2A 2Z8LA 2K33A 4DK3C 1HZAA 2EYHA 2R92G 4DU9A 3SR1A 3PIOA 3TSSA 4YCWA 1A2UA 3IL8A 4DK6C 5C44H 3LWUA 1I94Q 3E6ZX 1ASZA 3CPFA 3M4OH 2E8GA 2PZUA 1MI2A 1E7ZA 3QB3A 2EY1A 2G9HD 2RDFA 3A8KE 1OO9B 2OF1A 3H6MA 1K83B 4EX5A 2JK8A 4RH6A 1EY6A 4QF4A 5EBCA 4DV6Q 1H9SA 5IWAL 1LT6D 2PMZE 2NVXH 1XXGA 5C6AA 4C3IB 3PO3H 2CFMA 1PTOF 1EIGA 1E1OA 1IYVA 4K14A 2NUCA 4TVAB 3EA6A 3V96A 5E4XA 3MXNB 4FYDA 4X6AH 1TVXA 4KD4A 2ZXOA 2EYPA 1JC7A 3PO2H 1X54A 2JJQA 3MXGA 1I6HB 3S16H 1CZGA 3T53B 1J9OA 2KCTA 5C5LA 5M5YB 4JBWA 2JYOA 4BY7B 3J7AV 2EVBA 1BKBA 2N88A 4LUVA 2ZM6L 3PUVA 5FLXc 2RHQB 3P1HA 3I4NH 3CCLA 1B9NA 3H0GG 1KTKA 2I46A 5JJZA 1GHKA 1W6JA 5K36G 1P16A 3KUPA 4OL7A 2ES2A 5CORA 2CH4A 1FJGL 2RCFA 1NCVA 3K59A 3CU7A 5DM63 4A3LH 3U9SA 4MHEA 4DNRB 3CC7A 2A69C 1ZYRD 2B2TA 1VQNA 2P5ZX 3BS1A 2KECA 3G48A 3GV3A 1LT5D 4EQOA 3HOVH 1HNWQ 2K6AA 1NR4A 4C2MB 2X6GA 2K01A 4P2CB 3JAML 1VQ5A 2VQEQ 3VYUA 3MFGA 4OELB 2KENA 1VF7A 5FKAC 1TWGH 3H91A 4YHHL 2HDMA 4A3FH 1HR0W 3FPPA 1IL2A 4BY1B 1BR9A 4A3DH 1Z7TA 4DV1L 2I0QA 3DWAA 1UE5A 2XNAC 3ZYYX 4ME5A 1U4MA 2UXCL 4I7AA 1QVGA 3FKIB 4FF2A 3T51B 5IYDH 4KD3A 5LMNL 2KJXA 3M3YH 1SSOA 3KFUA 1I50H 1UE1A 1A6XA 1UE7A 2QW7A 4A3MG 2TMPA 2L1BA 1KNAA 1YNJC 1R4QB 5C4XG 1SYCA 4WJ3M 3DHQA 3UE0A 4A3BH 2ID0A 3FPUB 5ELFA 4A93G 4O2DA 4A3EG 3S1NH 1XJVA 1X55A 2HT1A 3J80i 1LTGD 3U9OA 1TWAB 2BA1A 1CA6A 1AFPA 3NWSA 4PNYA 4CDCC 1TXYA 4DUZL 3M9BA 2FHTA 3KF6B 4PMWA 4F88A 3E0EA 1PZKD 1C48A 2VW9A
chains in the Genus database with same CATH topology
1L0WA 1Q46A 4UPAA 3S17H 2IHFA 4R4CA 4PZ7A 2AWNA 2YTXA 5IWAQ 3HOUH 4DAYB 2JA6H 2IX1A 3CCQA 4BBSG 1Q8KA 3RNUA 3HOZH 1CKMA 1WYDA 4B3SQ 2JA8H 4KHPQ 3LGJA 1B8AA 2K4KA 1GO3E 2N78A 1PH4A 1N36L 1N36Q 4Y52H 4JBMA 1E22A 1Z9FA 1YJWA 4DR2Q 4JI0L 3J7ZC 4UY8C 3HOVG 1GD7A 3CCSA 3CC2A 1Y1WH 1KAWA 4GS3A 4X64L 1YVCA 2JA9A 4X64Q 3T1HQ 3JC66 3T1HL 4LF7L 1JT8A 3PSIA 1VQFA 3AQQA 4A3KG 1VQAA 4GOPB 3M4PA 4A3MH 4A3FG 4JI6Q 4JI6L 3G6EA 2F4VQ 5IE8A 4LFBQ 2NZOA 2EXDA 3IRBA 1A63A 3HFZB 3CMEA 3BJUA 1TWFH 4A3DG 1XTDA 2N49A 4OO1I 2IX0A 4GOPC 4HIKA 4IFDI 1FL0A 1XPRA 1CKNA 1A8VA 1WI5A 2NN6G 1EYGA 2AWOA 4EQ5A 1D8LA 2ZM6Q 3H3VI 5IYDG 4JI2Q 5GAGC 2JA7G 2VQFL 4C3HH 3PIPA 1IBLL 1IBLQ 5GAEC 4BBRH 1G6PA 1P8LA 1IXRA 3CQZH 4HIOA 4A3GH 3GTPH 1IBML 5H1SE 1IBMQ 3KF6A 4BXXH 4GKJQ 1DGSA 5M5XH 5DLQE 4GNXB 3RZDH 4JV5Q 1UWVA 3BZKA 2XGTA 1TWCH 1FJGQ 2R7ZH 1X65A 4DAMA 3PUWA 3I4MG 2ZTDA 4HJAA 1HNZL 1A62A 4QIWE 4DV2L 2WAQG 1KL9A 1SN8A 4BA1I 4A3BG 4JYAQ 2R6GA 3MEFA 2VZAA 2NVYH 1VS0A 4DNIA 1Q81C 1JJ2A 3NELA 4DV3L 2VUMH 1MKHA 1UEBA 2JE6I 3ERSX 2FXQA 1PH5A 2Q2HA 1PH7A 1EFWA 1CUKA 4KLKA 4LF6Q 2KCMA 3TS0A 1YJNA 1LM0A 5IYCH 5C4JH 2D62A 3TS2A 3UDXA 3HOXH 1W3SA 5M3FH 1Y14B 1IZ6A 5JEAJ 1HR0Q 2KBNA 1A0IA 2PQAB 5JEAG 4QY7A 2ZJPA 3STBD 1X3FA 4P72A 4A3JH 2B63H 2ZTCA 4DR5Q 2AMCB 1U5KA 3D0FA 2UU9L 1VQ7A 1EWIA 5BR8Q 4IPHA 4HIDA 3SGIA 4A75A 1AE3A 4YHHQ 4AQYL 4AQYQ 4NXML 4A3CH 3E9IA 1YZ6A 4L5TA 2H5XA 4OX9L 2LXJA 3HOUG 1EIFA 5GADC 4LF9L 3EN2A 2BH8A 4DV4L 1VQEA 1VQPA 2JA6G 5M3MH 3HOZG 1WOCA 1E1TA 1EOVA 2BA0A 4DV1Q 2JA8G 3GTGH 3UDGA 4BY7H 2D0OA 2F52A 4JOIA 4L5SA 4P73A 2UXCQ 4LF8L 4NPSA 4DV0L 1PHJA 1XMQL 5M5WH 3S15H 1V1QA 1Y1WG 2L15A 4GNXA 4DR6L 2JA7H 1TWHH 2I5MX 1KQSA 3HKZE 2ASBA 4R4TA 2GVBA 4NXNL 1HH2P 1QUQA 3G71A 2YTYA 4YCVA 1GKHA 3GTMH 2UUAQ 4GN3B 4H02A 1KRTA 4LF4Q 4LF4L 4B3RL 4OONA 1SLJA 4JG2A 4LWCA 3ULLA 1IBKQ 2CCZA 3S1QH 2UXBL 1PH1A 2MNAA 3S1MH 3JAMc 3UE1A 3RLFA 2Q2UA 3GTQH 2LSSA 4JI3L 3RN2A 4JI3Q 4KI0A 3K0XA 5GAHC 3W5OA 1QZHA 3H3VH 4QL5A 1YBYA 1CKNB 3BZCA 4BBRG 3F2CA 4A3GG 4DR1Q 1WCMH 1OTCA 2BH2A 1SMXA 3W1GA 2ALYB 4GKKQ 4GKKL 4DV5L 4DV5Q 1NMGA 2K75A 1YJ9A 1N32Q 4GLVB 5ELNA 3CCEA 2E2HH 1NBWA 1V9PA 1OXSC 4DUZQ 1Q82C 2YU9H 4LNQA 1XNQQ 1HZCA 3CCRA 4DV7L 1N34Q 5LMUL 1B7YB 4DPGA 4APVA 5FJ8H 2B29A 1QVCA 2E2JH 3M7NA 3K7AH 2D0PA 3BU2A 1G291 1PFSA 3PUXA 2VUMG 4K0KQ 4QQBX 3L2PA 5FLMH 2YYZA 3DLLA 2UUBL 2R93H 1Z47A 5ELOA 4JI1L 4JI1Q 2YV5A 2UXDL 2CWAA 3PCOB 1QVFA 1LTLA 2IHEA 5IYCG 3DM3A 3HOXG 5M3FG 3U4ZA 2RHSB 1I94L 3HOWH 4POFA 4C3JH 1VQ8A 3F1ZA 4JI0Q 3L0OA 2ZJQA 5IT9c 3U4VA 1Q86C 1PH9A 2B63G 4A3JG 3W1BA 2K52A 4L5RC 1L1OB 2LXKA 1K3RA 3J81c 4LF7Q 1XMOL 1XMOQ 1VQKA 3J7A5 1VQLA 2Z6KA 4AYBG 4Y7NH 4XIGS 5IP7H 1CSPA 3KDFB 4A3CG 1VQBA 3CP0A 1S3OA 3PF4A 1X3EA 4DV6L 5AJ3L 1VQIA 2JQOA 1KHIA 2Q2IA 2WB1G 5M3MG 1PH8A 1KIXA 4FDBA 3S14H 4JI4L 1VQ6A 4BY7G 4MZ9A 1LYLA 1JB7A 1E24A 4ME3A 3T1YL 5IP9H 4XTCS 1PYSB 4JI8L 2VS1A 1RL2A 3F2DA 3AYHB 2VQFQ 2PI2A 2ZTEA 2Y0SG 3M4QA 4LW1A 2WFWA 5E7NA 2K50A 4PZ8A 3UDFA 1NJIC 1MJCA 4DUYL 3CC4A 1QZGA 3CW2C 1PH3A 3JAMi 2C35B 1VCIA 1NY4A 1HNZQ 4DV2Q 1K83H 4JOIC 1JE5A 1K73C 3CCMA 2OWOA 3CCUA 1QUQB 1MIUA 4GLXA 4IFDJ 1C0AA 1VQHA 2F3IA 4WJ4A 4GNXC 3K8AA 4DV3Q 3PGZA 4X65L 5HY6A 4X65Q 3VDYA 3KJPA 1BBUA 1V43A 1SROA 2R92H 2OQ0A 1EQRA 3I55A 1SE8A 4C3IH 3TREA 1YIJA 1Q12A 1VQCA 4GN5A 1L1OA 1WCMG 3U50C 3H15A 1EQQA 4O0AA 2MO1A 4ALPA 1L2FA 4TQUS 1HNXL 2RCNA 3KDFA 2ATWA 4LFAL 1N9WA 2UU9Q 5FJ8G 2Q2TA 2HHHL 1YNXA 1FVIA 3FHWA 1K9MC 4IOCA 5HGQA 3Q8DA 1JJGA 5FLMG 4NXMQ 2CQOA 4X62L 4X62Q 1I6HH 1SRUA 4OX9Q 1VQOA 2R93G 2EIFA 4R1JA 4LF9Q 3AFQA 1HZ9A 4DV4Q 1XPUA 1LUZA 4YY3L 5M5YH 3GTKH 2VL6A 5JJKA 2IT1A 1PA6A 2EQSA 1XNRL 3HOYG 2VNUD 4AIMA 1H95A 3RR5A 2DUDA 4LFCL 3J81i 4LFCQ 3CD6A 3HOWG 2B3GA 1GVPA 4P74A 1S72A 4LF8Q 1G51A 4DV0Q 1XMQQ 2KHJA 1S40A 1ASYA 4A4IA 1HNWL 4DR6Q 4YWLA 3I4OA 2K5NA 3K7UC 2K14A 5IYBH 2VQEL 4JBJA 5IP7G 4NXNQ 1YI2A 4POGA 5JJLA 4P75A 2PNHA 2XTIA 3A74A 3L7ZC 3F2BA 1PV4A 4IOAA 3CF5A 3J81j 4B3RQ 2QA4A 3GTLH 2UXBQ 2KHIA 1I5FA 1Q1EA 1X6OA 2OCEA 2OQKA 1HZBA 2A1AA 3AEVA 1BBWA 2IY5B 4OWXB 3ULPA 5IP9G 2UUCL 2Z6KC 2NZHA 4YWKA 1OXVA 1VQDA 1Y1VH 4DR3L 5GQOA 3F8TA 2AKWB 4BA2I 2MFIA 3H0GH 3I2ZA 4YWMA 3U58A 1I3QH 3GD7A 4PZ6A 4LF5Q 4LF5L 3RZOH 3AFPA 4JBKA 2QGQA 1JMCA 3ICEA 1HJPA 4C2MH 4DV7Q 4OWTB 5C0XI 3RN5A 1Q1BA 3A0JA 2DGYA 3B6YA 4IPDA 2QEXA 5LMUQ 3UDIA 1VQ9A 1WFQA 3K81C 1MJEA 4HIMA 4B3TL 4DR7L 4HJ7A 2UUBQ 4BY1H 4DR4L 4DR4Q 4DK3C 2UXDQ 1HZAA 1U0LA 2R92G 3HKZG 4MNOA 1VQ4A 4JYAL 3PIOA 4YCWA 1SR3A 3HOYH 4DK6C 4OWWB 5C44H 3OTOL 1I94Q 3EBEA 1ASZA 1IYJB 3FP9A 3CPFA 3M4OH 3FKIH 2E8GA 1E7ZA 3PUYA 1M90C 4QGUA 1C7YA 2OTJA 4JI7L 4JI7Q 1OXUA 4EX5A 2YTVA 3RLNA 3ULJA 1EUJA 3CXCA 1Q7YC 2JK8A 4LUZA 4A3IH 2JA5H 1YHAA 4DV6Q 2E5LL 5AJ3Q 1L1OC 2N8NA 5IWAL 2E5LQ 3PUZA 1KXLA 2HIXA 2PMZE 1R9TH 2NVXH 2I5HA 4B3SL 3PO3H 2NN6I 4KHPL 1PYBA 4JI4Q 2CFMA 2K5HA 2WAQE 2GVAA 3T1YQ 3M85A 3S24A 1E1OA 4DR2L 4TVAB 2JEAI 4JI8Q 5C3EH 2R7ZG 5IYBG 1TWAH 1GM5A 3MXNB 4X6AH 1RIPA 1FGUA 1AE2A 1YITA 3KOJA 4DKAC 3GDEA 2HQLA 4A76A 1BVSA 2F4VL 2A19A 4DUYQ 3PO2H 4LFBL 1X54A 1O7IA 2JJQA 3GTOH 3STBC 3S16H 4HJ5A 5C4XH 2KCTA 1OXXK 1WJJA 4JBWA 2R7FA 4YCUA 4OO1G 3ZJYC 4A93H 4IFDG 1YEZA 3CCVA 3A5ZB 1BKBA 1VQMA 2RF4A 4LUVA 2ZM6L 3PUVA 2I5LX 3K80C 4A3EH 4J15A 4JI2L 3A5UA 5FLXc 5GROA 2RHQB 2R7DA 4IPGA 1M1KC 1Y1VG 3I4NH 3CCLA 3GO5A 1NTGA 3PF5A 3H0GG 2WP8J 4GKJL 3CCJA 3S1RH 5K36G 4RG1A 1P16A 2ES2A 3S2DH 4JV5L 3J80c 4PG3A 4IPCA 1HNXQ 1FJGL 4RMFA 1VQJA 4LFAQ 3GTJH 4P71A 5IY0A 4L5QA 2HHHQ 4A3LH 3PV0A 3D31A 3CC7A 1K8GA 1PVOA 1D7QA 1W2BA 4BY1G 1VQNA 4AH6A 1AH9A 4GN4B 4LF6L 1B70B 2PI2E 3G48A 4YY3Q 1J6QA 3CMAA 4BBSH 4NB3A 1XNRQ 3TEHB 5C44G 2E2IH 4KHZA 1CSQA 3FKIG 4R4QA 1SFOH 3I7FA 2CKZB 3TQYA 4GOPA 1HR0L 1EIYB 3HOVH 1J5EL 1J5EQ 4IO9A 1HNWQ 1PH6A 4DR5L 3NEMA 4HJ9A 3TRZA 2N3SA 5BR8L 1VQ5A 2VQEQ 4A3KH 2MQHA 2A8VA 2KENA 1TWGH 4UP9A 4YHHL 4A3IG 4A3FH 1HR0W 1CKOA 2JA5G 3OYYA 5J3BA 1IL2A 3KJOA 1K0RA 5EAYA 3OW2A 4A3DH 2ZJRA 4DV1L 2I0QA 3PO3G 1UE5A 1OXTA 1T9HA 2Z0SA 2UXCL 1N33L 1N33Q 2HIVA 1QVGA 2UUCQ 2GN5A 5C3EG 5IYDH 5LMNL 5LMNQ 1KD1C 1JJCB 2AHOB 3KFUA 3M3YH 1I50H 1UE1A 4LUOA 4UP7A 4DR3Q 3E9HA 1X9NA 1UE7A 3KLWA 2MO0A 4A3MG 1PH2A 4IJLA 3EIVA 2NVTH 4MTNA 3PO2G 4QJFA 4JC0A 2UUAL 5LMNW 5C4XG 4UP8A 4WJ3M 3UE0A 3I4MH 4HJ8A 1KC8C 4A3BH 1NE3A 1IBKL 2ID0A 2VY3A 4B3ML 4B3TQ 4B3MQ 4A93G 4O2DA 4DR7Q 3NENA 4AYBE 3CPWA 2K5VA 3CAMA 4A3EG 1X3GA 3ER0A 1X56A 4JCVE 3S1NH 1XJVA 2PQAA 1X55A 1E3PA 1UE6A 2HT1A 3I4NG 4R4IA 2V1CC 3J80i 1VQGA 2OTLA 1K8AC 2BA1A 1YHBA 2WB1E 4DR1L 4JI5L 4JI5Q 4BXXG 3OTOQ 4X66L 3NBHB 2JEBI 4X66Q 1XPOA 5JJIA 3KF8B 2CWPA 1N8RC 3HKSA 1N32L 4R4OA 1TXYA 4DUZL 1YHQA 1XNQL 4GLAC 1C9OA 4IJHA 3WWVA 1N34L 1KRSA 3M9BA 5C0XJ 3I56A 3KF6B 3S2HH 4PMWA 5C0XG 3E0EA 3G4SA 4A3LG 3KYHC 3RLOA 1NMFA 2NVQH 2Y0SE 4OXPA 4K0KL 2VW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0W A;  1Q46 A;  4UPA A;  3S17 H;  2IHF A;  4R4C A;  4PZ7 A;  2AWN A;  2YTX A;  5IWA Q;  3HOU H;  4DAY B;  2JA6 H;  2IX1 A;  3CCQ A;  4BBS G;  1Q8K A;  3RNU A;  3HOZ H;  1CKM A;  1WYD A;  4B3S Q;  2JA8 H;  4KHP Q;  3LGJ A;  1B8A A;  2K4K A;  1GO3 E;  2N78 A;  1PH4 A;  1N36 L;  1N36 Q;  4Y52 H;  4JBM A;  1E22 A;  1Z9F A;  1YJW A;  4DR2 Q;  4JI0 L;  3J7Z C;  4UY8 C;  3HOV G;  1GD7 A;  3CCS A;  3CC2 A;  1Y1W H;  1KAW A;  4GS3 A;  4X64 L;  1YVC A;  2JA9 A;  4X64 Q;  3T1H Q;  3JC6 6;  3T1H L;  4LF7 L;  1JT8 A;  3PSI A;  1VQF A;  3AQQ A;  4A3K G;  1VQA A;  4GOP B;  3M4P A;  4A3M H;  4A3F G;  4JI6 Q;  4JI6 L;  3G6E A;  2F4V Q;  5IE8 A;  4LFB Q;  2NZO A;  2EXD A;  3IRB A;  1A63 A;  3HFZ B;  3CME A;  3BJU A;  1TWF H;  4A3D G;  1XTD A;  2N49 A;  4OO1 I;  2IX0 A;  4GOP C;  4HIK A;  4IFD I;  1FL0 A;  1XPR A;  1CKN A;  1A8V A;  1WI5 A;  2NN6 G;  1EYG A;  2AWO A;  4EQ5 A;  1D8L A;  2ZM6 Q;  3H3V I;  5IYD G;  4JI2 Q;  5GAG C;  2JA7 G;  2VQF L;  4C3H H;  3PIP A;  1IBL L;  1IBL Q;  5GAE C;  4BBR H;  1G6P A;  1P8L A;  1IXR A;  3CQZ H;  4HIO A;  4A3G H;  3GTP H;  1IBM L;  5H1S E;  1IBM Q;  3KF6 A;  4BXX H;  4GKJ Q;  1DGS A;  5M5X H;  5DLQ E;  4GNX B;  3RZD H;  4JV5 Q;  1UWV A;  3BZK A;  2XGT A;  1TWC H;  1FJG Q;  2R7Z H;  1X65 A;  4DAM A;  3PUW A;  3I4M G;  2ZTD A;  4HJA A;  1HNZ L;  1A62 A;  4QIW E;  4DV2 L;  2WAQ G;  1KL9 A;  1SN8 A;  4BA1 I;  4A3B G;  4JYA Q;  2R6G A;  3MEF A;  2VZA A;  2NVY H;  1VS0 A;  4DNI A;  1Q81 C;  1JJ2 A;  3NEL A;  4DV3 L;  2VUM H;  1MKH A;  1UEB A;  2JE6 I;  3ERS X;  2FXQ A;  1PH5 A;  2Q2H A;  1PH7 A;  1EFW A;  1CUK A;  4KLK A;  4LF6 Q;  2KCM A;  3TS0 A;  1YJN A;  1LM0 A;  5IYC H;  5C4J H;  2D62 A;  3TS2 A;  3UDX A;  3HOX H;  1W3S A;  5M3F H;  1Y14 B;  1IZ6 A;  5JEA J;  1HR0 Q;  2KBN A;  1A0I A;  2PQA B;  5JEA G;  4QY7 A;  2ZJP A;  3STB D;  1X3F A;  4P72 A;  4A3J H;  2B63 H;  2ZTC A;  4DR5 Q;  2AMC B;  1U5K A;  3D0F A;  2UU9 L;  1VQ7 A;  1EWI A;  5BR8 Q;  4IPH A;  4HID A;  3SGI A;  4A75 A;  1AE3 A;  4YHH Q;  4AQY L;  4AQY Q;  4NXM L;  4A3C H;  3E9I A;  1YZ6 A;  4L5T A;  2H5X A;  4OX9 L;  2LXJ A;  3HOU G;  1EIF A;  5GAD C;  4LF9 L;  3EN2 A;  2BH8 A;  4DV4 L;  1VQE A;  1VQP A;  2JA6 G;  5M3M H;  3HOZ G;  1WOC A;  1E1T A;  1EOV A;  2BA0 A;  4DV1 Q;  2JA8 G;  3GTG H;  3UDG A;  4BY7 H;  2D0O A;  2F52 A;  4JOI A;  4L5S A;  4P73 A;  2UXC Q;  4LF8 L;  4NPS A;  4DV0 L;  1PHJ A;  1XMQ L;  5M5W H;  3S15 H;  1V1Q A;  1Y1W G;  2L15 A;  4GNX A;  4DR6 L;  2JA7 H;  1TWH H;  2I5M X;  1KQS A;  3HKZ E;  2ASB A;  4R4T A;  2GVB A;  4NXN L;  1HH2 P;  1QUQ A;  3G71 A;  2YTY A;  4YCV A;  1GKH A;  3GTM H;  2UUA Q;  4GN3 B;  4H02 A;  1KRT A;  4LF4 Q;  4LF4 L;  4B3R L;  4OON A;  1SLJ A;  4JG2 A;  4LWC A;  3ULL A;  1IBK Q;  2CCZ A;  3S1Q H;  2UXB L;  1PH1 A;  2MNA A;  3S1M H;  3JAM c;  3UE1 A;  3RLF A;  2Q2U A;  3GTQ H;  2LSS A;  4JI3 L;  3RN2 A;  4JI3 Q;  4KI0 A;  3K0X A;  5GAH C;  3W5O A;  1QZH A;  3H3V H;  4QL5 A;  1YBY A;  1CKN B;  3BZC A;  4BBR G;  3F2C A;  4A3G G;  4DR1 Q;  1WCM H;  1OTC A;  2BH2 A;  1SMX A;  3W1G A;  2ALY B;  4GKK Q;  4GKK L;  4DV5 L;  4DV5 Q;  1NMG A;  2K75 A;  1YJ9 A;  1N32 Q;  4GLV B;  5ELN A;  3CCE A;  2E2H H;  1NBW A;  1V9P A;  1OXS C;  4DUZ Q;  1Q82 C;  2YU9 H;  4LNQ A;  1XNQ Q;  1HZC A;  3CCR A;  4DV7 L;  1N34 Q;  5LMU L;  1B7Y B;  4DPG A;  4APV A;  5FJ8 H;  2B29 A;  1QVC A;  2E2J H;  3M7N A;  3K7A H;  2D0P A;  3BU2 A;  1G29 1;  1PFS A;  3PUX A;  2VUM G;  4K0K Q;  4QQB X;  3L2P A;  5FLM H;  2YYZ A;  3DLL A;  2UUB L;  2R93 H;  1Z47 A;  5ELO A;  4JI1 L;  4JI1 Q;  2YV5 A;  2UXD L;  2CWA A;  3PCO B;  1QVF A;  1LTL A;  2IHE A;  5IYC G;  3DM3 A;  3HOX G;  5M3F G;  3U4Z A;  2RHS B;  1I94 L;  3HOW H;  4POF A;  4C3J H;  1VQ8 A;  3F1Z A;  4JI0 Q;  3L0O A;  2ZJQ A;  5IT9 c;  3U4V A;  1Q86 C;  1PH9 A;  2B63 G;  4A3J G;  3W1B A;  2K52 A;  4L5R C;  1L1O B;  2LXK A;  1K3R A;  3J81 c;  4LF7 Q;  1XMO L;  1XMO Q;  1VQK A;  3J7A 5;  1VQL A;  2Z6K A;  4AYB G;  4Y7N H;  4XIG S;  5IP7 H;  1CSP A;  3KDF B;  4A3C G;  1VQB A;  3CP0 A;  1S3O A;  3PF4 A;  1X3E A;  4DV6 L;  5AJ3 L;  1VQI A;  2JQO A;  1KHI A;  2Q2I A;  2WB1 G;  5M3M G;  1PH8 A;  1KIX A;  4FDB A;  3S14 H;  4JI4 L;  1VQ6 A;  4BY7 G;  4MZ9 A;  1LYL A;  1JB7 A;  1E24 A;  4ME3 A;  3T1Y L;  5IP9 H;  4XTC S;  1PYS B;  4JI8 L;  2VS1 A;  1RL2 A;  3F2D A;  3AYH B;  2VQF Q;  2PI2 A;  2ZTE A;  2Y0S G;  3M4Q A;  4LW1 A;  2WFW A;  5E7N A;  2K50 A;  4PZ8 A;  3UDF A;  1NJI C;  1MJC A;  4DUY L;  3CC4 A;  1QZG A;  3CW2 C;  1PH3 A;  3JAM i;  2C35 B;  1VCI A;  1NY4 A;  1HNZ Q;  4DV2 Q;  1K83 H;  4JOI C;  1JE5 A;  1K73 C;  3CCM A;  2OWO A;  3CCU A;  1QUQ B;  1MIU A;  4GLX A;  4IFD J;  1C0A A;  1VQH A;  2F3I A;  4WJ4 A;  4GNX C;  3K8A A;  4DV3 Q;  3PGZ A;  4X65 L;  5HY6 A;  4X65 Q;  3VDY A;  3KJP A;  1BBU A;  1V43 A;  1SRO A;  2R92 H;  2OQ0 A;  1EQR A;  3I55 A;  1SE8 A;  4C3I H;  3TRE A;  1YIJ A;  1Q12 A;  1VQC A;  4GN5 A;  1L1O A;  1WCM G;  3U50 C;  3H15 A;  1EQQ A;  4O0A A;  2MO1 A;  4ALP A;  1L2F A;  4TQU S;  1HNX L;  2RCN A;  3KDF A;  2ATW A;  4LFA L;  1N9W A;  2UU9 Q;  5FJ8 G;  2Q2T A;  2HHH L;  1YNX A;  1FVI A;  3FHW A;  1K9M C;  4IOC A;  5HGQ A;  3Q8D A;  1JJG A;  5FLM G;  4NXM Q;  2CQO A;  4X62 L;  4X62 Q;  1I6H H;  1SRU A;  4OX9 Q;  1VQO A;  2R93 G;  2EIF A;  4R1J A;  4LF9 Q;  3AFQ A;  1HZ9 A;  4DV4 Q;  1XPU A;  1LUZ A;  4YY3 L;  5M5Y H;  3GTK H;  2VL6 A;  5JJK A;  2IT1 A;  1PA6 A;  2EQS A;  1XNR L;  3HOY G;  2VNU D;  4AIM A;  1H95 A;  3RR5 A;  2DUD A;  4LFC L;  3J81 i;  4LFC Q;  3CD6 A;  3HOW G;  2B3G A;  1GVP A;  4P74 A;  1S72 A;  4LF8 Q;  1G51 A;  4DV0 Q;  1XMQ Q;  2KHJ A;  1S40 A;  1ASY A;  4A4I A;  1HNW L;  4DR6 Q;  4YWL A;  3I4O A;  2K5N A;  3K7U C;  2K14 A;  5IYB H;  2VQE L;  4JBJ A;  5IP7 G;  4NXN Q;  1YI2 A;  4POG A;  5JJL A;  4P75 A;  2PNH A;  2XTI A;  3A74 A;  3L7Z C;  3F2B A;  1PV4 A;  4IOA A;  3CF5 A;  3J81 j;  4B3R Q;  2QA4 A;  3GTL H;  2UXB Q;  2KHI A;  1I5F A;  1Q1E A;  1X6O A;  2OCE A;  2OQK A;  1HZB A;  2A1A A;  3AEV A;  1BBW A;  2IY5 B;  4OWX B;  3ULP A;  5IP9 G;  2UUC L;  2Z6K C;  2NZH A;  4YWK A;  1OXV A;  1VQD A;  1Y1V H;  4DR3 L;  5GQO A;  3F8T A;  2AKW B;  4BA2 I;  2MFI A;  3H0G H;  3I2Z A;  4YWM A;  3U58 A;  1I3Q H;  3GD7 A;  4PZ6 A;  4LF5 Q;  4LF5 L;  3RZO H;  3AFP A;  4JBK A;  2QGQ A;  1JMC A;  3ICE A;  1HJP A;  4C2M H;  4DV7 Q;  4OWT B;  5C0X I;  3RN5 A;  1Q1B A;  3A0J A;  2DGY A;  3B6Y A;  4IPD A;  2QEX A;  5LMU Q;  3UDI A;  1VQ9 A;  1WFQ A;  3K81 C;  1MJE A;  4HIM A;  4B3T L;  4DR7 L;  4HJ7 A;  2UUB Q;  4BY1 H;  4DR4 L;  4DR4 Q;  4DK3 C;  2UXD Q;  1HZA A;  1U0L A;  2R92 G;  3HKZ G;  4MNO A;  1VQ4 A;  4JYA L;  3PIO A;  4YCW A;  1SR3 A;  3HOY H;  4DK6 C;  4OWW B;  5C44 H;  3OTO L;  1I94 Q;  3EBE A;  1ASZ A;  1IYJ B;  3FP9 A;  3CPF A;  3M4O H;  3FKI H;  2E8G A;  1E7Z A;  3PUY A;  1M90 C;  4QGU A;  1C7Y A;  2OTJ A;  4JI7 L;  4JI7 Q;  1OXU A;  4EX5 A;  2YTV A;  3RLN A;  3ULJ A;  1EUJ A;  3CXC A;  1Q7Y C;  2JK8 A;  4LUZ A;  4A3I H;  2JA5 H;  1YHA A;  4DV6 Q;  2E5L L;  5AJ3 Q;  1L1O C;  2N8N A;  5IWA L;  2E5L Q;  3PUZ A;  1KXL A;  2HIX A;  2PMZ E;  1R9T H;  2NVX H;  2I5H A;  4B3S L;  3PO3 H;  2NN6 I;  4KHP L;  1PYB A;  4JI4 Q;  2CFM A;  2K5H A;  2WAQ E;  2GVA A;  3T1Y Q;  3M85 A;  3S24 A;  1E1O A;  4DR2 L;  4TVA B;  2JEA I;  4JI8 Q;  5C3E H;  2R7Z G;  5IYB G;  1TWA H;  1GM5 A;  3MXN B;  4X6A H;  1RIP A;  1FGU A;  1AE2 A;  1YIT A;  3KOJ A;  4DKA C;  3GDE A;  2HQL A;  4A76 A;  1BVS A;  2F4V L;  2A19 A;  4DUY Q;  3PO2 H;  4LFB L;  1X54 A;  1O7I A;  2JJQ A;  3GTO H;  3STB C;  3S16 H;  4HJ5 A;  5C4X H;  2KCT A;  1OXX K;  1WJJ A;  4JBW A;  2R7F A;  4YCU A;  4OO1 G;  3ZJY C;  4A93 H;  4IFD G;  1YEZ A;  3CCV A;  3A5Z B;  1BKB A;  1VQM A;  2RF4 A;  4LUV A;  2ZM6 L;  3PUV A;  2I5L X;  3K80 C;  4A3E H;  4J15 A;  4JI2 L;  3A5U A;  5FLX c;  5GRO A;  2RHQ B;  2R7D A;  4IPG A;  1M1K C;  1Y1V G;  3I4N H;  3CCL A;  3GO5 A;  1NTG A;  3PF5 A;  3H0G G;  2WP8 J;  4GKJ L;  3CCJ A;  3S1R H;  5K36 G;  4RG1 A;  1P16 A;  2ES2 A;  3S2D H;  4JV5 L;  3J80 c;  4PG3 A;  4IPC A;  1HNX Q;  1FJG L;  4RMF A;  1VQJ A;  4LFA Q;  3GTJ H;  4P71 A;  5IY0 A;  4L5Q A;  2HHH Q;  4A3L H;  3PV0 A;  3D31 A;  3CC7 A;  1K8G A;  1PVO A;  1D7Q A;  1W2B A;  4BY1 G;  1VQN A;  4AH6 A;  1AH9 A;  4GN4 B;  4LF6 L;  1B70 B;  2PI2 E;  3G48 A;  4YY3 Q;  1J6Q A;  3CMA A;  4BBS H;  4NB3 A;  1XNR Q;  3TEH B;  5C44 G;  2E2I H;  4KHZ A;  1CSQ A;  3FKI G;  4R4Q A;  1SFO H;  3I7F A;  2CKZ B;  3TQY A;  4GOP A;  1HR0 L;  1EIY B;  3HOV H;  1J5E L;  1J5E Q;  4IO9 A;  1HNW Q;  1PH6 A;  4DR5 L;  3NEM A;  4HJ9 A;  3TRZ A;  2N3S A;  5BR8 L;  1VQ5 A;  2VQE Q;  4A3K H;  2MQH A;  2A8V A;  2KEN A;  1TWG H;  4UP9 A;  4YHH L;  4A3I G;  4A3F H;  1HR0 W;  1CKO A;  2JA5 G;  3OYY A;  5J3B A;  1IL2 A;  3KJO A;  1K0R A;  5EAY A;  3OW2 A;  4A3D H;  2ZJR A;  4DV1 L;  2I0Q A;  3PO3 G;  1UE5 A;  1OXT A;  1T9H A;  2Z0S A;  2UXC L;  1N33 L;  1N33 Q;  2HIV A;  1QVG A;  2UUC Q;  2GN5 A;  5C3E G;  5IYD H;  5LMN L;  5LMN Q;  1KD1 C;  1JJC B;  2AHO B;  3KFU A;  3M3Y H;  1I50 H;  1UE1 A;  4LUO A;  4UP7 A;  4DR3 Q;  3E9H A;  1X9N A;  1UE7 A;  3KLW A;  2MO0 A;  4A3M G;  1PH2 A;  4IJL A;  3EIV A;  2NVT H;  4MTN A;  3PO2 G;  4QJF A;  4JC0 A;  2UUA L;  5LMN W;  5C4X G;  4UP8 A;  4WJ3 M;  3UE0 A;  3I4M H;  4HJ8 A;  1KC8 C;  4A3B H;  1NE3 A;  1IBK L;  2ID0 A;  2VY3 A;  4B3M L;  4B3T Q;  4B3M Q;  4A93 G;  4O2D A;  4DR7 Q;  3NEN A;  4AYB E;  3CPW A;  2K5V A;  3CAM A;  4A3E G;  1X3G A;  3ER0 A;  1X56 A;  4JCV E;  3S1N H;  1XJV A;  2PQA A;  1X55 A;  1E3P A;  1UE6 A;  2HT1 A;  3I4N G;  4R4I A;  2V1C C;  3J80 i;  1VQG A;  2OTL A;  1K8A C;  2BA1 A;  1YHB A;  2WB1 E;  4DR1 L;  4JI5 L;  4JI5 Q;  4BXX G;  3OTO Q;  4X66 L;  3NBH B;  2JEB I;  4X66 Q;  1XPO A;  5JJI A;  3KF8 B;  2CWP A;  1N8R C;  3HKS A;  1N32 L;  4R4O A;  1TXY A;  4DUZ L;  1YHQ A;  1XNQ L;  4GLA C;  1C9O A;  4IJH A;  3WWV A;  1N34 L;  1KRS A;  3M9B A;  5C0X J;  3I56 A;  3KF6 B;  3S2H H;  4PMW A;  5C0X G;  3E0E A;  3G4S A;  4A3L G;  3KYH C;  3RLO A;  1NMF A;  2NVQ H;  2Y0S E;  4OXP A;  4K0K L;  2VW9 A; 
#chains in the Genus database with same CATH topology
 1Q46 A;  5IWA Q;  4R4C A;  2C5C A;  3VR3 A;  1D6E C;  3I73 A;  4WJW A;  5EGT A;  2JA6 H;  1CKM A;  1WYD A;  4V0B A;  3LGJ A;  1N36 Q;  3MTS A;  1PH4 A;  4JI0 L;  3J7Z C;  2QCP X;  5EKI A;  3RMH A;  1F9P A;  4HCS A;  4X64 Q;  2JA9 A;  4LF7 L;  3T16 A;  3PSI A;  3R2I A;  4K8J A;  5CV9 A;  2B2T C;  2J0T D;  2Z4H A;  4GOP B;  4A3M H;  3G6E A;  1EY0 A;  1A63 A;  2HD3 A;  1LTB D;  3CME A;  1LTI D;  3BJU A;  4RGN A;  1SXT A;  2N49 A;  4IUP A;  4BBS B;  1XPR A;  2NN6 G;  2ZM6 Q;  1SFO B;  3H3V I;  3I90 A;  4F7X A;  1PTO D;  2VQF L;  4O1N A;  3T13 A;  1IBL Q;  1IXR A;  5K5P A;  5JAV A;  3WOE A;  2L55 A;  1QB5 D;  2WAC A;  2E74 C;  3MAQ A;  1UWV A;  3BZK A;  1FJG Q;  3TN2 A;  3I4M G;  4DV2 L;  4BA1 I;  1KL9 A;  1E2V A;  3GTL B;  2RSN A;  2R6G A;  1T5X D;  4ZCK A;  2NVY H;  3VYR A;  2JE6 I;  1PH5 A;  2Q2H A;  4KJO A;  5LL6 S;  2ENB A;  2KCM A;  4DGZ A;  2H1E A;  1F77 A;  5C4J H;  1B2T A;  1Y69 U;  3TS2 A;  3J81 E;  2ZXR A;  1Y14 B;  1CTM A;  1IZ6 A;  2OXP A;  2KBN A;  1A0I A;  2NVT B;  1EU3 A;  2B63 H;  4P72 A;  3HGB A;  2AMC B;  2UU9 L;  3D0F A;  1CK1 A;  1WTH A;  4HID A;  2WAQ B;  3SGI A;  4A75 A;  4YHH Q;  4NXM L;  4QB4 A;  4A3C H;  4OX9 L;  3HOU G;  1HPC A;  2NBF A;  5M3M H;  1PFM A;  4DV1 Q;  3HOZ G;  3D4R A;  4BY7 H;  3NPP A;  5CYU A;  3SK5 A;  2UXC Q;  5EBD A;  1V1Q A;  3UI2 A;  1Y1W G;  2BE5 C;  3X3N A;  4GNX A;  1FYC A;  1KQS A;  3HKZ E;  2O5J C;  1LTT D;  1QE6 A;  1QUQ A;  5DAU A;  2YTY A;  4ID6 A;  1DCZ A;  4LF4 L;  4B3R L;  2JN4 A;  4OON A;  1R9T B;  1SYE A;  4L8J A;  4B9W A;  2JA8 B;  3UE1 A;  2Q2U A;  5CBE E;  1CI3 M;  4K8I A;  4JI3 L;  1PZI D;  3K0X A;  3W5O A;  4C3H G;  4CJ2 C;  2F3V A;  1YBY A;  1CKN B;  3BZC A;  5JPN C;  3F2C A;  3QIA A;  2A74 C;  1WCM H;  1LTR D;  4G57 A;  1B50 A;  4DV5 Q;  2X69 A;  2E2H H;  2R7Z G;  1V9P A;  1OXS C;  3MEH A;  4DUZ Q;  3A54 A;  5FJ8 H;  1GUW A;  1SEB D;  3SK6 A;  3DLL A;  2A6E D;  3IKJ A;  4ABN A;  4JI1 L;  2EZV A;  2YV5 A;  1PTO B;  3BYY B;  2IHE A;  4JPB W;  5A2Q L;  2RDH A;  4BBR B;  3VR5 A;  3HOW H;  1VQ8 A;  4JI0 Q;  3L0O A;  2K5D A;  2WV6 D;  2K52 A;  4KKS A;  3A7L A;  4X3S A;  4LF7 Q;  2DNC A;  3PMF A;  3J7A 5;  4Y7N H;  1HQM C;  4XIG S;  1CSP A;  2VUM B;  3CP0 A;  1S3O A;  3PF4 A;  1D2B A;  1X3E A;  1TS3 A;  5AJ3 L;  2LKV A;  4CDE C;  2R3Z A;  1BCP F;  1VQ6 A;  4MZ9 A;  2RBM A;  3T1Y L;  1LAC A;  2D9U A;  1PYS B;  2VS1 A;  1RL2 A;  3AYH B;  2VQF Q;  1GHJ A;  4LK1 C;  4A3J B;  2PI2 A;  2ZTE A;  4LW1 A;  4A3K B;  1NJI C;  1MJC A;  3CC4 A;  1RD9 D;  3JAM i;  4DV2 Q;  1JE5 A;  2WB1 B;  2D2C C;  4RWS C;  1GXD C;  4GNX C;  2F0K A;  3K8A A;  4X65 L;  1I4P A;  5M5W B;  1XX8 A;  3LX0 A;  5E4W C;  2JA7 B;  1TWH B;  3GV6 A;  1QNK A;  3K5M A;  1L2F A;  1KAA A;  3K5L A;  1BNZ A;  3NQT A;  2EJM A;  2UU9 Q;  2Q2T A;  2HHH L;  4C56 C;  1YNX A;  3MC0 B;  4IOC A;  1TT2 A;  3S1Q B;  3Q8D A;  4NXM Q;  4X62 L;  3VR6 A;  4OX9 Q;  3AFQ A;  2F0S A;  3GTK H;  5CC4 A;  1PA6 A;  4AIM A;  3AU7 A;  3MZ5 A;  3RR5 A;  3I72 A;  4TKO B;  4LFC L;  1GVP A;  1XWE A;  4C3J G;  4P74 A;  2YU9 B;  2K5N A;  3K7U C;  3A7A B;  5JJL A;  4P75 A;  3A74 A;  3L7Z C;  3IFD A;  3J81 j;  4B3R Q;  3GTL H;  1SND A;  3QWN A;  5J39 A;  2KHI A;  1EZ6 A;  3ONA B;  4OO1 H;  1IW7 C;  2F0F A;  2IY5 B;  4OWX B;  3AMU A;  2UUC L;  4QIW B;  4N8X 1;  1JIC A;  1RJT A;  4RHS A;  4LF5 Q;  1RHP A;  2O5I C;  1JMC A;  1HJP A;  4LJZ C;  4OWT B;  1VQ9 A;  2QEX A;  1JOO A;  1MJE A;  4B3T L;  5T1G A;  5IT9 L;  3CRK C;  4HAE A;  3FEW X;  1D1I A;  1U0L A;  3HKZ G;  1SDF A;  1SR3 A;  4OWW B;  3EBE A;  3FP9 A;  1NR2 A;  2AUK A;  3E3X A;  3RZD B;  1M90 C;  1C7Y A;  3K57 A;  1OXU A;  3HP3 A;  2IW3 A;  2KUM A;  1Q7Y C;  1CHQ D;  4LUZ A;  5D14 A;  4A3I H;  2JA5 H;  5DEH A;  2E5L Q;  5AJ3 Q;  1IL8 A;  2HIX A;  1R9T H;  2I5H A;  2R92 B;  3A55 A;  2NN6 I;  1PYB A;  3TP6 A;  3SDZ A;  3T1Y Q;  3M85 A;  3S24 A;  4ODG A;  2FIN B;  5CV5 A;  2JEA I;  5C3E H;  2KCN A;  1EY5 A;  5IYB G;  1FGU A;  1AE2 A;  1QNU A;  1YIT A;  4RKB A;  4MN3 A;  3GDE A;  2HQL A;  4DKA C;  2F4V L;  4LFB L;  4RCN A;  3PIO 3;  5EKL A;  1VF5 C;  1JQY D;  1ET6 A;  1WJJ A;  2CHB D;  3D6W A;  4TRD A;  3CCV A;  1BCP D;  1MGS A;  2RF4 A;  4M8A A;  2I5L X;  1M4V A;  5GRO A;  4IPG A;  1Y1V G;  5JOB A;  3H94 A;  1NTG A;  3PF5 A;  2KVM A;  5C5M A;  3J80 c;  4PG3 A;  4IPC A;  2NTT A;  2SNM A;  4KN7 C;  1DZ1 A;  1LAB A;  1HA6 A;  1VQJ A;  4P71 A;  2HHH Q;  5C0X H;  4PV1 C;  4PMB A;  4HED A;  5EPJ A;  2F3W A;  4LF6 L;  1B70 B;  2PI2 E;  2HDL A;  1PDQ A;  2NWG A;  3CMA A;  5FO8 B;  4NB3 A;  4BWG B;  5C44 G;  4XXE A;  4N9T A;  2E2I H;  4QMG A;  4KHZ A;  1EU4 A;  1CSQ A;  1EIY B;  3H0G B;  2V4D A;  2CKZ B;  4GOP A;  3RZO B;  1J5E Q;  2XWJ B;  4IO9 A;  3NEM A;  1ONL A;  1U4L A;  2N3S A;  4A3K H;  2MQH A;  1JOK A;  3TDQ A;  4UP9 A;  1I4G A;  3OYY A;  1K0R A;  5EAY A;  4DK0 A;  2ZJR A;  3PO3 G;  3HOY B;  4KHV A;  1DON A;  4OGQ C;  3C1E A;  4B08 A;  1N33 Q;  2EPB A;  2UUC Q;  4NP5 A;  1RF2 D;  1KD1 C;  5ELD A;  3OIP A;  4LUO A;  4FXD A;  3NE5 B;  1X9N A;  2MO0 A;  2F0P A;  4IJL A;  3EIV A;  3PO2 G;  1II3 A;  1EEI D;  1EFI D;  1MSH A;  1XTC D;  2F0W A;  5LMN W;  2RA4 A;  5E3F A;  5E1F A;  1SMY D;  3TP5 A;  1NE3 A;  3IAY A;  3FMC A;  4B3T Q;  2TSS A;  4IQZ A;  1HHV A;  3MWY W;  3NEN A;  3V2T A;  3J81 L;  2K5V A;  2LMC B;  3CAM A;  1X3G A;  4LAA A;  1UE6 A;  3I4N G;  1G2T A;  1VQG A;  4JI5 Q;  4BXX G;  1TY0 A;  1JB3 A;  4X66 Q;  1XPO A;  3KF8 B;  1I4Q A;  1N32 L;  5JEA H;  1XNQ L;  5BN4 A;  3GTO B;  3WWV A;  3FRP B;  1N34 L;  1SBB B;  4U67 3;  5C4X B;  4A3L G;  3G4S A;  3RLO A;  4EQN A;  1LV9 A;  4OXP A;  2F0I A;  4A93 B;  1BCP B;  3S17 H;  2AWN A;  1A3T A;  2YTX A;  4A3E B;  4DAY B;  5T1I A;  1EYD A;  3RNU A;  4X3K A;  3T56 B;  1N36 L;  1B8A A;  2K4K A;  1GO3 E;  2N78 A;  4Y52 H;  2VB2 X;  4UY8 C;  1KNE A;  3HOV G;  1JOQ A;  3S2D B;  3CC2 A;  2F0J A;  4X64 L;  4KY6 A;  3T1H Q;  1JT8 A;  1SE3 A;  3AQQ A;  4CDF C;  3M4P A;  1ENA A;  5BN5 A;  4A3F G;  2F4V Q;  4LFB Q;  1L0Y B;  3HFZ B;  4OIJ A;  4A3D G;  4OO1 I;  4IUV A;  2I07 B;  4IUT A;  2IX0 A;  4GOP C;  4ZKC B;  1FL0 A;  1CKN A;  1WI5 A;  2PW7 A;  4G7H C;  1EYG A;  1ZYR C;  4EQ5 A;  1D8L A;  1B9M A;  3NBH A;  5IYD G;  1B3Q A;  2K5W A;  1F9Q A;  1IBL L;  1G6P A;  1EQT A;  3CQZ H;  4A3G H;  3GTP H;  1IBM Q;  4RCO A;  4BXX H;  1DGS A;  5IGE A;  5M5X H;  5DLQ E;  3RZD H;  1DOK A;  2AQ2 B;  2XGT A;  3BDO A;  1X65 A;  1BDO A;  5C3W A;  4HJA A;  1A3V A;  1A62 A;  2NTS A;  1HNZ L;  4A3B G;  5FK9 C;  2QKI C;  3MEF A;  4DV3 L;  1QIL A;  1MKH A;  3ERS X;  1EFW A;  2F0L A;  4LF6 Q;  1FGB D;  1IYU A;  5IT9 E;  4KK7 A;  5IOD A;  3HOX H;  5M3F H;  5COY A;  2A5H A;  2PQA B;  1UUP A;  2PZT A;  2LS0 1;  3OIQ A;  2F0D A;  3D6C A;  1VQ7 A;  3I4M B;  4IPH A;  1SYD A;  1AE3 A;  1S5C D;  1D5Z C;  4AQY Q;  3E9I A;  1IKL A;  4J8Q A;  2H5X A;  1LLR D;  4DV4 L;  2JA6 G;  2BA0 A;  1EOV A;  1V1O A;  3K58 A;  3TBI B;  3GTG H;  3UDG A;  1O78 A;  1ESR A;  2EJG C;  4KV6 A;  4LF8 L;  4NPS A;  1DXM A;  1PHJ A;  3S15 H;  2MPM A;  2VB3 X;  2F0E A;  3CHB D;  2BCO A;  2L4N A;  3S2H B;  3SHL A;  3LWE A;  2NVQ B;  4IUU A;  3GTM H;  4RGO S;  2EYL A;  5I6Y A;  5ELC A;  3HOU B;  2KED A;  1EYA A;  3QO2 A;  1SLJ A;  3ULL A;  3HOZ B;  3S1M H;  3JAM c;  1IKM A;  2E75 C;  4IAL A;  2LSS A;  3RN2 A;  1Z6H A;  5GAH C;  1WTV A;  1QZH A;  2GA4 B;  1D5M C;  5D65 A;  2L5T A;  1TR5 A;  2QDL A;  4K2K A;  2BH2 A;  4DV5 L;  1N32 Q;  4N8F A;  1NBW A;  1Q82 C;  1XNQ Q;  3EVQ A;  1N34 Q;  5LMU L;  1B7Y B;  1TWF B;  4J6H A;  1PXU A;  4IUR A;  2AQ3 B;  3HRZ C;  2D0P A;  3BU2 A;  1G29 1;  3N6R A;  3L2P A;  2YYZ A;  4ZUJ A;  4XT1 B;  2R93 H;  2DJF C;  5KNB A;  5ELO A;  2CWA A;  3PCO B;  3HS0 C;  5HUR A;  1QVF A;  3URY A;  5I9P A;  1EOT A;  2RHS B;  3P20 A;  4HTH A;  3S1R B;  2B63 G;  3W1B A;  2IJ0 A;  1TWC B;  3P7J A;  3A8I E;  1HFN A;  1JWM D;  1GUS A;  2EYJ A;  3Q24 A;  1XMO Q;  3QOJ A;  1VQL A;  2Z6K A;  2EYO A;  5HGT A;  5EQ0 A;  4A3C G;  1VQB A;  3FVQ A;  2HCC A;  2JQO A;  5M3M G;  1EIH A;  5LHY 1;  4J1M A;  4JI4 L;  4BY7 G;  2F0O A;  1E24 A;  1NSN S;  1TQO A;  1KLU D;  5IP9 H;  3AB9 A;  3BDC A;  2F03 A;  1UNS A;  2WFW A;  1CQV A;  5E7N A;  2K50 A;  4PZ8 A;  4XT3 B;  1PH3 A;  1HNZ Q;  1K83 H;  4FVM A;  3CCM A;  2EOT A;  4RA8 A;  4IFD J;  1C0A A;  4DV3 Q;  5HY6 A;  4UDU C;  3VDY A;  2F0U A;  1BBU A;  3KJP A;  3QJY A;  1K3B C;  1EQR A;  4C3I H;  1RDP D;  1STA A;  1L1O A;  1WCM G;  1EQQ A;  1BQQ T;  1YNN C;  2EY5 A;  1WTW A;  2Z9H A;  2MO1 A;  1Q3L A;  3EFX D;  3BG3 A;  3KDF A;  2ATW A;  1CT1 D;  4LFA L;  3KBG A;  5FJ8 G;  3BZD B;  1ZKO A;  1GUN A;  1I6H H;  4FP5 D;  3GTQ B;  1VQO A;  4R1J A;  1AZP A;  4DV4 Q;  1LUZ A;  4YY3 L;  5M5Y H;  1CZW A;  1XNR L;  2E2D C;  2DUD A;  2KCC A;  2QEJ C;  3TP7 A;  3J81 i;  3HOW G;  3NTK A;  4LF8 Q;  4FF1 A;  2KHJ A;  4QUF A;  1S40 A;  1H9R A;  2K14 A;  4XQN A;  2E2J B;  3K7A B;  1ILQ A;  1HUM A;  1D1K A;  1PV4 A;  2VXW A;  3OMC A;  5FLX E;  3A8J E;  1H9S B;  3AEV A;  1HZB A;  3D4W A;  2EYM A;  4IFD H;  2A6E C;  3TZU A;  4C3J B;  2Z6K C;  1OXV A;  5GQO A;  3WDN A;  2MFI A;  4R8I A;  3GD7 A;  4LF5 L;  2B2Y A;  4K5X A;  3ICE A;  1STY A;  4C2M H;  3RN5 A;  1LTS D;  2DGY A;  3A0J A;  5LMU Q;  5AFW A;  5KND A;  4G7Z C;  4FF3 A;  1HTP A;  2E76 C;  3C2P A;  3S14 B;  4HMJ A;  4HJ7 A;  2SNS A;  4BY1 H;  4DR4 Q;  2FJ2 A;  1PFB A;  2BE5 D;  1W6K A;  5CV7 A;  1VQ4 A;  1S5B D;  3OTO L;  1IYJ B;  2M2L A;  3FKI H;  3PQI A;  3PUY A;  3SXH A;  5CR3 A;  4QGU A;  4JI7 Q;  5EPK A;  3RUZ A;  2RKS A;  3ULJ A;  2E5L L;  1L1O C;  1KXL A;  3PUZ A;  5FOB B;  3KBX A;  3HKZ B;  1ENF A;  5IOC A;  2O4X A;  2K28 A;  4JI4 Q;  1X3Q A;  2K5H A;  3LNN A;  1V1P B;  1SAP A;  4DR2 L;  1BBX C;  3R3O A;  2XVS A;  3FDT A;  1FD7 D;  1TWA H;  1GM5 A;  5IGG A;  2JP1 A;  5CBA E;  1S5F D;  3KOJ A;  2B39 A;  1BVS A;  2F0M A;  2QF7 A;  5C4Z A;  3STB C;  4HJ5 A;  3MXU A;  4ZKB B;  4OO1 G;  4XQJ A;  3NP8 A;  3A5Z B;  1VQM A;  1UEA B;  3K80 C;  3KF8 A;  2WKC A;  4H13 C;  2R7D A;  2F0N A;  1Q90 A;  2WII B;  1B4O A;  3Q22 A;  2WP8 J;  4GKJ L;  3CCJ A;  3S1R H;  4JV5 L;  2AQ1 B;  5I6W A;  4LFA Q;  5JVH 3;  5IY0 A;  4L5Q A;  4DAY A;  3S9W A;  3MA2 B;  5I2Y A;  1PVO A;  1SJH D;  3SEB A;  1Y8O B;  4AH6 A;  1AH9 A;  4GN4 B;  2PCF B;  4YY3 Q;  1J6Q A;  4BBS H;  1SNO A;  1XNR Q;  2B2Y C;  3TEH B;  1Y1V B;  3MXN A;  3NBI A;  5KGU A;  4R4Q A;  1SFO H;  1I3Q B;  1J5E L;  3K0Y A;  1PH6 A;  4HJ9 A;  2L0C A;  3I3C A;  2J7Z A;  1EYC A;  2L9H A;  4ZYS A;  4A3I G;  1CKO A;  2JA5 G;  2HUG A;  3NTH A;  3KJO A;  2MJ8 A;  5FO9 B;  1L0X B;  1OXT A;  4L63 B;  1NAP A;  1FNU A;  4CJ1 B;  5C44 B;  1STG A;  2RQX A;  1N33 L;  2GN5 A;  3MHB A;  5C3E G;  1JJC B;  2AHO B;  2CW0 C;  4Q5V A;  4UP7 A;  5NUC A;  3E9H A;  4Z9C B;  3KLW A;  2Z6B A;  2K7V A;  3VR4 A;  1B3A A;  4KY7 A;  2NVT H;  4K6D A;  3O13 A;  4RKL A;  4UP8 A;  3EJI A;  3G6J B;  4HJ8 A;  4FNF A;  1KC8 C;  5KRU A;  2NVX B;  2VY3 A;  4K6L A;  5ELB A;  4B3M Q;  3PO3 B;  3N52 A;  3X3M A;  4OHJ A;  1PRT F;  4AYB E;  3CPW A;  1RCV D;  1X56 A;  2PQA A;  1K28 A;  1E3P A;  4CDD C;  5IGB A;  1TS2 A;  2OTL A;  1K8A C;  1YHB A;  4JI5 L;  2ICI A;  1QOH A;  3BDL A;  3E0J A;  3KK7 A;  3OTO Q;  4X66 L;  5JJI A;  1C8C A;  4RAU C;  1PYW D;  1N8R C;  1JCK B;  3PO2 B;  4I7Z C;  4GLA C;  1C9O A;  4IJH A;  1IHZ A;  1KRS A;  4DFA A;  5C0X J;  3S16 B;  5C0X G;  1SNQ A;  3KYH C;  5FO7 B;  2Y0S E;  5KYI A;  1L0W A;  1WTP A;  4UPA A;  2IHF A;  1QG7 A;  4C1N K;  3CCQ A;  2DNE A;  1Q8K A;  4DAP A;  1O7Z A;  1MHW C;  2JA8 H;  3I4N B;  5I2X A;  3DM1 A;  3VA7 A;  1TY2 A;  4DR2 Q;  1T5E A;  1BCP C;  5CV4 A;  1K8O A;  1GD7 A;  2B8G A;  3CCS A;  2CH4 W;  1G91 A;  1KAW A;  4F8M A;  3MXP A;  3T1H L;  2B2U A;  1C4Q A;  3JC6 6;  4A3K G;  1VQA A;  4JI6 Q;  2EXD A;  1ZXT A;  2DJG C;  3I4L A;  1H9M A;  2L11 A;  5CV8 A;  4HIK A;  3J80 L;  4IFD I;  1A8V A;  4C1N I;  3C3L A;  4RFB A;  2AWO A;  2SDF A;  1MBY A;  4X3U A;  2BDO A;  1B1Z A;  3K6O A;  2LY7 A;  3HOV B;  1PTO H;  2JA7 G;  3PIP A;  4BBR H;  4HIO A;  1IBM L;  5H1S E;  3KF6 A;  4GKJ Q;  1ML0 D;  1TWG B;  2D5D A;  4GNX B;  4A3F B;  4U68 A;  4JV5 Q;  2X6L A;  1AZQ A;  1SNM A;  2DY7 A;  5I9O A;  4DAM A;  3PUW A;  2ZTD A;  3ERQ A;  4A3D B;  2VZA A;  4DNI A;  4CHT B;  4CJ0 B;  1Q81 C;  5BN3 A;  3NEL A;  2VUM H;  1F2Y A;  1UEB A;  2FXQ A;  2G9D A;  3R2T A;  1JWU D;  4RGT A;  4KLK A;  4PMC A;  5D3D A;  5A35 A;  1YJN A;  2FFK B;  3M3Y B;  1I50 B;  5IYC H;  3K5N A;  1G2S A;  2D62 A;  3UDX A;  4FF4 A;  1W3S A;  2Q8T A;  4BS9 A;  5JEA J;  5EJW A;  5JEA G;  1SYF A;  1LT3 D;  2ZJP A;  1G6Z A;  1X3F A;  4A3J H;  1WTX A;  3H09 A;  1U5K A;  3A56 A;  4A3B B;  4AQY L;  2HCI A;  3BVG A;  4L5T A;  1FNW A;  5GAD C;  1VQP A;  2RSO A;  3S1N B;  1E1T A;  1ESF A;  1QCB D;  4NMZ A;  5IGD A;  2BDN A;  5DNF A;  2D0O A;  1HUN A;  4P73 A;  3D3R A;  2A68 D;  5M5W H;  5G3L F;  5IGC A;  2L15 A;  1VDZ A;  2JA7 H;  1TWH H;  2I5M X;  2B2V A;  2XWB B;  2ASB A;  4R4T A;  4ZUI A;  4NXN L;  3G71 A;  3DXJ C;  1GKH A;  4YCV A;  3L3O C;  3NTI A;  1KRT A;  1A2T A;  2JA6 B;  4JG2 A;  2UXB L;  2CCZ A;  4DA2 A;  3S1Q H;  1PH1 A;  3GQB A;  2EXZ A;  3RLF A;  2B2U C;  2A6H D;  1QWY A;  3H3V H;  1SYB A;  4QL5 A;  1MSG A;  4A3G G;  4KY5 A;  4EGV A;  2KA7 A;  1OTC A;  3W1G A;  2ALY B;  4A3M B;  4GKK Q;  1EQV A;  2K75 A;  2C9O A;  4OEM B;  5ELN A;  3CCE A;  1DD2 A;  2YU9 H;  4LNQ A;  3CCR A;  4ZK9 B;  2WIN B;  4APV A;  1CA5 A;  2B29 A;  3M7N A;  1TS5 A;  4QQB X;  3PUX A;  1PFS A;  3T4A C;  5FLM H;  2UUB L;  4QCL A;  1Z47 A;  2UXD L;  3OWF A;  4WRD A;  5M9O A;  3DM3 A;  1ET9 A;  1PRT D;  5KEE A;  3HOX G;  5M3F G;  3U4Z A;  1SJE D;  2ZT9 C;  3F1Z A;  2NZ1 D;  1PH9 A;  1Q86 C;  2LFN A;  4NKL A;  4L5R C;  2LXK A;  3J81 c;  1S5D D;  1GUT A;  3GTJ B;  1XMO L;  4AYB G;  1BXT A;  2NVY B;  3HG9 A;  3OW7 A;  3VYS A;  5IP7 H;  2IX3 A;  5FLX L;  1VQI A;  1ICF B;  2Q2I A;  1KIX A;  1PH8 A;  1K0S A;  4Q0F A;  3VR2 A;  3I8Z A;  4R9W A;  1R4P B;  1E2W A;  4HR7 B;  5C4J B;  1GUG A;  1TS4 A;  2QDB A;  1FR3 A;  1STH A;  4XTC S;  4JI8 L;  2B63 B;  1EY9 A;  3M4Q A;  2Y0S G;  4UAI A;  3UDF A;  1BF4 A;  5J1Z A;  1EY8 A;  4DUY L;  5JPM C;  1EY7 A;  4HMI A;  3NUC A;  1NY4 A;  1K73 C;  1F2M A;  5M3M B;  2OWO A;  2KHS A;  3CCU A;  4GLX A;  5D3I B;  4RHR A;  2F3I A;  4WJ4 A;  3PGZ A;  1B53 A;  2B2V C;  2JSO A;  2MUY A;  2A73 B;  2R92 H;  2OQ0 A;  3I55 A;  4KJN A;  3TRE A;  1Q12 A;  1VQC A;  3U50 C;  1U9R A;  4O0A A;  4UHV A;  3D8G A;  4KKU A;  1HNX L;  2RCN A;  2PMZ B;  1N9W A;  1I4H A;  1S5E D;  3NQI A;  1FVI A;  3FHW A;  1QJO A;  5HGQ A;  1JJG A;  2CQO A;  2R93 G;  3HZX A;  2EIF A;  1KAB A;  1V1P A;  2F0Q A;  3OMG A;  4KN4 C;  1HZ9 A;  1XPU A;  5JJK A;  3HOY G;  1H95 A;  2EQS A;  4K5W A;  3WOF A;  2B3G A;  1WCM B;  2Z1C A;  4A4I A;  2E2H B;  4YWL A;  3SK8 A;  1U4R A;  2OT2 A;  4JBJ A;  2A69 D;  4NXN Q;  4HN7 A;  3F2B A;  3CF5 A;  4H7B A;  2QA4 A;  1HCZ A;  1GJX A;  2UXB Q;  3BVZ A;  1I5F A;  1PRT B;  1Q1E A;  3HOW B;  4EVO A;  2KQ3 A;  5IP9 G;  2NZH A;  4N9P A;  4YWK A;  3J80 E;  1Y1W B;  4DR3 L;  3F8T A;  4R8N A;  2AKW B;  5G3L D;  4BA2 I;  3H0G H;  3I2Z A;  3U58 A;  4Y7N B;  1PLF A;  3RZO H;  5K36 H;  4JBK A;  2QGQ A;  1Y8N B;  2N55 A;  2CVR A;  5C0X I;  1Q1B A;  1NUC A;  3UDI A;  1PMR A;  1WFQ A;  3I91 A;  4HIM A;  3DUZ A;  1GUO A;  4DR7 L;  2UUB Q;  1SNP A;  4DR4 L;  2UXD Q;  4MNO A;  4JYA L;  4C3I G;  3ITP A;  3SE0 A;  2ZXP A;  3HOY H;  4C3H B;  5ELE A;  2RVL A;  4L6T B;  3OWE B;  2WKD A;  1WD1 A;  3CRL C;  1HRJ A;  5C3X A;  1YNJ D;  1PTO C;  2OTJ A;  1STE A;  2R7Z B;  4JI7 L;  1Q8I A;  2YTV A;  3RLN A;  3CXC A;  1EUJ A;  4KMU C;  4FO2 A;  1YHA A;  2N8N A;  4B9X A;  1RKN A;  4B3S L;  4KHP L;  2WAQ E;  4I65 A;  1KDC A;  2GVA A;  3DEO A;  2EY6 A;  3DEP A;  3C1F A;  4NDX A;  4JI8 Q;  2XRS D;  4KKT A;  1S4Z A;  4IUQ A;  1RIP A;  1KDB A;  2SEB D;  1SE2 A;  1ICW A;  4A76 A;  1WD0 A;  2A19 A;  4DUY Q;  2AUJ D;  3GTO H;  1O7I A;  2HQE A;  5C4X H;  4H44 C;  3GTK B;  1OXX K;  5LL6 X;  2FMM A;  2R7F A;  1I4X A;  4HSP A;  4YCU A;  3ZJY C;  1AN8 A;  4A93 H;  1YEZ A;  4IFD G;  1ENC A;  1UAP A;  3QG1 A;  5TSS A;  4A3E H;  4J15 A;  4JI2 L;  3A5U A;  1HTL D;  1M1K C;  3GO5 A;  3ND8 A;  4RG1 A;  4XYQ A;  3S2D H;  4LMQ D;  1HNX Q;  2JXM B;  4RMF A;  3GTJ H;  1HFG A;  4RGM A;  2PYK A;  3PV0 A;  3D31 A;  1K8G A;  1D7Q A;  1W2B A;  4BY1 G;  1E0B A;  1DOL A;  1WTQ A;  3FKI G;  1HR0 L;  3I7F A;  3TQY A;  2EJF C;  4EQP A;  4DR5 L;  3H3V C;  3TRZ A;  3TME A;  5BR8 L;  2F0V A;  2A8V A;  1HA5 A;  4G7O C;  3OHX C;  4CKB A;  5EKK A;  4TSS A;  2MHV A;  5J3B A;  3NSW A;  3OW2 A;  2XIW A;  1T9H A;  2Z0S A;  1YNN D;  2NN6 H;  1CQF A;  2XSC A;  2HIV A;  2RDG A;  5LMN Q;  1O80 A;  4ILW A;  1F2Z A;  4DR3 Q;  3TP8 A;  1PH2 A;  4K2L A;  3MFY A;  4MTN A;  2M00 A;  4QJF A;  1VMC A;  2M9V A;  4A3I B;  4JC0 A;  2JA5 B;  2UUA L;  2IL8 A;  3I4M H;  1JOR A;  3L9A X;  1IBK L;  1M8A A;  4JK1 C;  4B3M L;  4DR7 Q;  5C4H A;  3OOC A;  3ER0 A;  1RTN A;  4JCV E;  4JYA Q;  3MVV A;  5C3E B;  4R4I A;  2V1C C;  4XDX A;  1A15 A;  2WB1 E;  3NWT A;  4DR1 L;  2K32 A;  3NBH B;  2JEB I;  1RTO A;  2CWP A;  4IN3 A;  3HKS A;  2G5D A;  4R4O A;  1YHQ A;  1AW7 A;  1LT4 D;  3I56 A;  3VA5 A;  3S2H H;  5IIF A;  1NMF A;  2NVQ H;  4K0K L;  3QR8 A;  1V8Q A;  4QUC A;  2EYF A;  4PZ7 A;  3HOU H;  4BBS G;  2IX1 A;  1CFM A;  3HOZ H;  4B3S Q;  4WOR A;  4KHP Q;  1BOS A;  3SK4 A;  4DXF A;  3J7Y W;  4JBM A;  1E22 A;  1Z9F A;  1YJW A;  4HSV A;  1SYG A;  1Y1W H;  4GS3 A;  1YVC A;  1VQF A;  3NHH A;  3Q6S A;  5CMD A;  4G4K A;  4JI6 L;  1DM0 B;  5IE8 A;  1F9S A;  2NZO A;  3IRB A;  4E6I A;  3E5S A;  3JAM E;  5JVG 3;  1TWF H;  1XTD A;  4ZLT F;  4ULL A;  4HCE A;  3BVM A;  2E2I B;  1ILP A;  3KLS X;  3CKI B;  5EPL A;  1HXY D;  1I4R A;  4JI2 Q;  3V05 A;  5GAG C;  3VYT A;  1ROD A;  4IUN A;  2J4X A;  4C3H H;  1MD2 D;  2L12 A;  5GAE C;  1P8L A;  4H0L C;  1EL0 A;  4DF7 A;  4CGY B;  1BUV T;  3DWP A;  2R7Z H;  1TWC H;  5L37 A;  4QIW E;  2WAQ G;  1SN8 A;  2EDG A;  1VS0 A;  2NYZ D;  4CKC A;  1JJ2 A;  4O42 A;  1SE4 A;  1PH7 A;  1CUK A;  2K5Q A;  3TS0 A;  1LM0 A;  3Q0A A;  3D4D A;  4ZAI A;  1JR0 D;  2FMC A;  4M1U B;  1HR0 Q;  3M7G A;  4QY7 A;  3STB D;  2PQE A;  1H9J A;  2ZTC A;  4DR5 Q;  1AP0 A;  1EWI A;  5BR8 Q;  1DYQ A;  2F0H A;  1YZ6 A;  2LXJ A;  1EIF A;  4LF9 L;  3PIP 3;  1I6V C;  2BH8 A;  2Z4I A;  1VQE A;  3EN2 A;  1WOC A;  2F1M A;  3OSO A;  2JA8 G;  2F52 A;  1GOZ A;  4JOI A;  4L5S A;  4DV0 L;  4FXK C;  1XMQ L;  3M4O B;  1DOM A;  4DR6 L;  4GZY C;  5CV6 A;  2GVB A;  2Q8I B;  1HH2 P;  4OIK A;  2KOL A;  4YIJ A;  2UUA Q;  4GN3 B;  3S17 B;  4H02 A;  4LF4 Q;  1E2Z A;  3K5O A;  4LWC A;  1IBK Q;  3R93 A;  2PPB C;  2Q8R E;  2MNA A;  3BYT B;  2EE1 A;  3GTQ H;  2K1B A;  4JI3 Q;  4KI0 A;  5ISR A;  4BBR G;  3KLS A;  5KIX A;  4DR1 Q;  3W3A A;  1SMX A;  2BOS A;  1HQR D;  4GKK L;  1NMG A;  2IPK D;  1YJ9 A;  4GLV B;  2MGS A;  2XRQ D;  1HZC A;  4DV7 L;  2B2W A;  3DMU A;  4DPG A;  4ZRZ A;  1O7L A;  1QVC A;  2DY8 A;  2E2J H;  3K7A H;  3M4Y A;  2VUM G;  1LO5 D;  4K0K Q;  1IW7 D;  1WTR A;  1K8M A;  2DN8 A;  1ZEQ X;  4JI1 Q;  4CKE A;  4IZ8 A;  2CW0 D;  1LTL A;  5IYC G;  3CQZ B;  1O7Y A;  4A3G B;  1I94 L;  3GTP B;  4POF A;  4C3J H;  5M5X B;  2ZJQ A;  4K5V A;  3U4V A;  1F2L A;  5IT9 c;  4A3J G;  1L1O B;  1H9K A;  1K3R A;  3ND9 A;  3SVM A;  2MP1 A;  1VQK A;  1EZ8 A;  1PFN A;  4JW0 A;  4DAV A;  3KDF B;  1TII D;  2ICE C;  4DV6 L;  2R61 A;  1EWC A;  1KHI A;  2WB1 G;  3NK9 A;  3C46 A;  1CM9 A;  2PW5 A;  4FDB A;  4ZQ3 A;  1A3U A;  3S14 H;  1LYL A;  1JB7 A;  3HOX B;  4ME3 A;  3R8B A;  5M3F B;  1EWH A;  1Y8P B;  1U4P A;  3F2D A;  1CHP D;  2PO4 A;  1EY4 A;  3KLR A;  3F2U A;  3EQL C;  3P75 A;  4XQQ A;  1D5X C;  4AYB B;  4WFN 3;  1QZG A;  3CW2 C;  1FNV A;  2C35 B;  1VCI A;  4JOI C;  3HEJ A;  1STN A;  5DM7 3;  1JWS D;  1QUQ B;  1MIU A;  4DXG A;  3GTG B;  1VQH A;  1BO0 A;  1X32 A;  2XN9 C;  1X3P A;  4X65 Q;  4FXG C;  3DWQ A;  5KYL A;  4MTK A;  1V43 A;  4DNT B;  3S15 B;  1SRO A;  5F2D A;  4NW2 A;  1SE8 A;  1YIJ A;  2B8F A;  4GN5 A;  1JE4 A;  3H15 A;  2PZW A;  2Y0S B;  4JVZ A;  1VMP A;  4ALP A;  2A68 C;  4TQU S;  5CGK A;  3W2D A;  3GTM B;  2F0T A;  4CBV A;  5IGF A;  4PQX A;  2F0G A;  1K9M C;  4DK1 A;  3J7A F;  5FLM G;  3S1M B;  4X62 Q;  1SRU A;  1WVL A;  4LF9 Q;  1SMY C;  2VL6 A;  2OEO A;  2IT1 A;  3Q23 A;  2VNU D;  4LFC Q;  3CD6 A;  1J8I A;  1S72 A;  2B2W C;  1G51 A;  4DV0 Q;  1XMQ Q;  2A6H C;  5KNC A;  5A2Q E;  1ASY A;  1HNW L;  1STB A;  5J22 A;  2K04 A;  4XYO A;  3I4O A;  4DR6 Q;  5IYB H;  2VQE L;  1F9R A;  1NNX A;  2NB0 A;  5IP7 G;  1YI2 A;  4POG A;  2H4O A;  2SOB A;  2PNH A;  1G8Z D;  2XTI A;  3G7L A;  4IOA A;  2R93 B;  4KTA A;  3QOL A;  1DJR D;  3RD4 A;  3ERO A;  4S3S A;  1WTO A;  1EEF D;  4X3T A;  1X6O A;  1KDA A;  2OCE A;  2PNR C;  2OQK A;  2A1A A;  3OPO A;  1BBW A;  2K05 A;  3GP7 A;  3ULP A;  3IFT A;  2QIL A;  3I70 A;  1KLG D;  5I4D A;  3TZD A;  1VQD A;  1Y1V H;  1PRT C;  2F4I A;  1SNC A;  2O2L D;  2KEE A;  2CQA A;  4YWM A;  1I3Q H;  1TKW B;  4PZ6 A;  1LTA D;  3AFP A;  1PZJ D;  1B44 D;  1TU2 B;  4V19 0;  4DV7 Q;  4F87 A;  3B6Y A;  2K03 A;  4IPD A;  2IWH A;  3K81 C;  4MIU A;  1AEX A;  4DN4 M;  3NXW A;  1XYI A;  2EY2 A;  2Z8L A;  2K33 A;  4DK3 C;  1HZA A;  2EYH A;  2R92 G;  4DU9 A;  3SR1 A;  3PIO A;  3TSS A;  4YCW A;  1A2U A;  3IL8 A;  4DK6 C;  5C44 H;  3LWU A;  1I94 Q;  3E6Z X;  1ASZ A;  3CPF A;  3M4O H;  2E8G A;  2PZU A;  1MI2 A;  1E7Z A;  3QB3 A;  2EY1 A;  2G9H D;  2RDF A;  3A8K E;  1OO9 B;  2OF1 A;  3H6M A;  1K83 B;  4EX5 A;  2JK8 A;  4RH6 A;  1EY6 A;  4QF4 A;  5EBC A;  4DV6 Q;  1H9S A;  5IWA L;  1LT6 D;  2PMZ E;  2NVX H;  1XXG A;  5C6A A;  4C3I B;  3PO3 H;  2CFM A;  1PTO F;  1EIG A;  1E1O A;  1IYV A;  4K14 A;  2NUC A;  4TVA B;  3EA6 A;  3V96 A;  5E4X A;  3MXN B;  4FYD A;  4X6A H;  1TVX A;  4KD4 A;  2ZXO A;  2EYP A;  1JC7 A;  3PO2 H;  1X54 A;  2JJQ A;  3MXG A;  1I6H B;  3S16 H;  1CZG A;  3T53 B;  1J9O A;  2KCT A;  5C5L A;  5M5Y B;  4JBW A;  2JYO A;  4BY7 B;  3J7A V;  2EVB A;  1BKB A;  2N88 A;  4LUV A;  2ZM6 L;  3PUV A;  5FLX c;  2RHQ B;  3P1H A;  3I4N H;  3CCL A;  1B9N A;  3H0G G;  1KTK A;  2I46 A;  5JJZ A;  1GHK A;  1W6J A;  5K36 G;  1P16 A;  3KUP A;  4OL7 A;  2ES2 A;  5COR A;  2CH4 A;  1FJG L;  2RCF A;  1NCV A;  3K59 A;  3CU7 A;  5DM6 3;  4A3L H;  3U9S A;  4MHE A;  4DNR B;  3CC7 A;  2A69 C;  1ZYR D;  2B2T A;  1VQN A;  2P5Z X;  3BS1 A;  2KEC A;  3G48 A;  3GV3 A;  1LT5 D;  4EQO A;  3HOV H;  1HNW Q;  2K6A A;  1NR4 A;  4C2M B;  2X6G A;  2K01 A;  4P2C B;  3JAM L;  1VQ5 A;  2VQE Q;  3VYU A;  3MFG A;  4OEL B;  2KEN A;  1VF7 A;  5FKA C;  1TWG H;  3H91 A;  4YHH L;  2HDM A;  4A3F H;  1HR0 W;  3FPP A;  1IL2 A;  4BY1 B;  1BR9 A;  4A3D H;  1Z7T A;  4DV1 L;  2I0Q A;  3DWA A;  1UE5 A;  2XNA C;  3ZYY X;  4ME5 A;  1U4M A;  2UXC L;  4I7A A;  1QVG A;  3FKI B;  4FF2 A;  3T51 B;  5IYD H;  4KD3 A;  5LMN L;  2KJX A;  3M3Y H;  1SSO A;  3KFU A;  1I50 H;  1UE1 A;  1A6X A;  1UE7 A;  2QW7 A;  4A3M G;  2TMP A;  2L1B A;  1KNA A;  1YNJ C;  1R4Q B;  5C4X G;  1SYC A;  4WJ3 M;  3DHQ A;  3UE0 A;  4A3B H;  2ID0 A;  3FPU B;  5ELF A;  4A93 G;  4O2D A;  4A3E G;  3S1N H;  1XJV A;  1X55 A;  2HT1 A;  3J80 i;  1LTG D;  3U9O A;  1TWA B;  2BA1 A;  1CA6 A;  1AFP A;  3NWS A;  4PNY A;  4CDC C;  1TXY A;  4DUZ L;  3M9B A;  2FHT A;  3KF6 B;  4PMW A;  4F88 A;  3E0E A;  1PZK D;  1C48 A;  2VW9 A; 
#chains in the Genus database with same CATH homology
 1L0W A;  1Q46 A;  4UPA A;  3S17 H;  2IHF A;  4R4C A;  4PZ7 A;  2AWN A;  2YTX A;  5IWA Q;  3HOU H;  4DAY B;  2JA6 H;  2IX1 A;  3CCQ A;  4BBS G;  1Q8K A;  3RNU A;  3HOZ H;  1CKM A;  1WYD A;  4B3S Q;  2JA8 H;  4KHP Q;  3LGJ A;  1B8A A;  2K4K A;  1GO3 E;  2N78 A;  1PH4 A;  1N36 L;  1N36 Q;  4Y52 H;  4JBM A;  1E22 A;  1Z9F A;  1YJW A;  4DR2 Q;  4JI0 L;  3J7Z C;  4UY8 C;  3HOV G;  1GD7 A;  3CCS A;  3CC2 A;  1Y1W H;  1KAW A;  4GS3 A;  4X64 L;  1YVC A;  2JA9 A;  4X64 Q;  3T1H Q;  3JC6 6;  3T1H L;  4LF7 L;  1JT8 A;  3PSI A;  1VQF A;  3AQQ A;  4A3K G;  1VQA A;  4GOP B;  3M4P A;  4A3M H;  4A3F G;  4JI6 Q;  4JI6 L;  3G6E A;  2F4V Q;  5IE8 A;  4LFB Q;  2NZO A;  2EXD A;  3IRB A;  1A63 A;  3HFZ B;  3CME A;  3BJU A;  1TWF H;  4A3D G;  1XTD A;  2N49 A;  4OO1 I;  2IX0 A;  4GOP C;  4HIK A;  4IFD I;  1FL0 A;  1XPR A;  1CKN A;  1A8V A;  1WI5 A;  2NN6 G;  1EYG A;  2AWO A;  4EQ5 A;  1D8L A;  2ZM6 Q;  3H3V I;  5IYD G;  4JI2 Q;  5GAG C;  2JA7 G;  2VQF L;  4C3H H;  3PIP A;  1IBL L;  1IBL Q;  5GAE C;  4BBR H;  1G6P A;  1P8L A;  1IXR A;  3CQZ H;  4HIO A;  4A3G H;  3GTP H;  1IBM L;  5H1S E;  1IBM Q;  3KF6 A;  4BXX H;  4GKJ Q;  1DGS A;  5M5X H;  5DLQ E;  4GNX B;  3RZD H;  4JV5 Q;  1UWV A;  3BZK A;  2XGT A;  1TWC H;  1FJG Q;  2R7Z H;  1X65 A;  4DAM A;  3PUW A;  3I4M G;  2ZTD A;  4HJA A;  1HNZ L;  1A62 A;  4QIW E;  4DV2 L;  2WAQ G;  1KL9 A;  1SN8 A;  4BA1 I;  4A3B G;  4JYA Q;  2R6G A;  3MEF A;  2VZA A;  2NVY H;  1VS0 A;  4DNI A;  1Q81 C;  1JJ2 A;  3NEL A;  4DV3 L;  2VUM H;  1MKH A;  1UEB A;  2JE6 I;  3ERS X;  2FXQ A;  1PH5 A;  2Q2H A;  1PH7 A;  1EFW A;  1CUK A;  4KLK A;  4LF6 Q;  2KCM A;  3TS0 A;  1YJN A;  1LM0 A;  5IYC H;  5C4J H;  2D62 A;  3TS2 A;  3UDX A;  3HOX H;  1W3S A;  5M3F H;  1Y14 B;  1IZ6 A;  5JEA J;  1HR0 Q;  2KBN A;  1A0I A;  2PQA B;  5JEA G;  4QY7 A;  2ZJP A;  3STB D;  1X3F A;  4P72 A;  4A3J H;  2B63 H;  2ZTC A;  4DR5 Q;  2AMC B;  1U5K A;  3D0F A;  2UU9 L;  1VQ7 A;  1EWI A;  5BR8 Q;  4IPH A;  4HID A;  3SGI A;  4A75 A;  1AE3 A;  4YHH Q;  4AQY L;  4AQY Q;  4NXM L;  4A3C H;  3E9I A;  1YZ6 A;  4L5T A;  2H5X A;  4OX9 L;  2LXJ A;  3HOU G;  1EIF A;  5GAD C;  4LF9 L;  3EN2 A;  2BH8 A;  4DV4 L;  1VQE A;  1VQP A;  2JA6 G;  5M3M H;  3HOZ G;  1WOC A;  1E1T A;  1EOV A;  2BA0 A;  4DV1 Q;  2JA8 G;  3GTG H;  3UDG A;  4BY7 H;  2D0O A;  2F52 A;  4JOI A;  4L5S A;  4P73 A;  2UXC Q;  4LF8 L;  4NPS A;  4DV0 L;  1PHJ A;  1XMQ L;  5M5W H;  3S15 H;  1V1Q A;  1Y1W G;  2L15 A;  4GNX A;  4DR6 L;  2JA7 H;  1TWH H;  2I5M X;  1KQS A;  3HKZ E;  2ASB A;  4R4T A;  2GVB A;  4NXN L;  1HH2 P;  1QUQ A;  3G71 A;  2YTY A;  4YCV A;  1GKH A;  3GTM H;  2UUA Q;  4GN3 B;  4H02 A;  1KRT A;  4LF4 Q;  4LF4 L;  4B3R L;  4OON A;  1SLJ A;  4JG2 A;  4LWC A;  3ULL A;  1IBK Q;  2CCZ A;  3S1Q H;  2UXB L;  1PH1 A;  2MNA A;  3S1M H;  3JAM c;  3UE1 A;  3RLF A;  2Q2U A;  3GTQ H;  2LSS A;  4JI3 L;  3RN2 A;  4JI3 Q;  4KI0 A;  3K0X A;  5GAH C;  3W5O A;  1QZH A;  3H3V H;  4QL5 A;  1YBY A;  1CKN B;  3BZC A;  4BBR G;  3F2C A;  4A3G G;  4DR1 Q;  1WCM H;  1OTC A;  2BH2 A;  1SMX A;  3W1G A;  2ALY B;  4GKK Q;  4GKK L;  4DV5 L;  4DV5 Q;  1NMG A;  2K75 A;  1YJ9 A;  1N32 Q;  4GLV B;  5ELN A;  3CCE A;  2E2H H;  1NBW A;  1V9P A;  1OXS C;  4DUZ Q;  1Q82 C;  2YU9 H;  4LNQ A;  1XNQ Q;  1HZC A;  3CCR A;  4DV7 L;  1N34 Q;  5LMU L;  1B7Y B;  4DPG A;  4APV A;  5FJ8 H;  2B29 A;  1QVC A;  2E2J H;  3M7N A;  3K7A H;  2D0P A;  3BU2 A;  1G29 1;  1PFS A;  3PUX A;  2VUM G;  4K0K Q;  4QQB X;  3L2P A;  5FLM H;  2YYZ A;  3DLL A;  2UUB L;  2R93 H;  1Z47 A;  5ELO A;  4JI1 L;  4JI1 Q;  2YV5 A;  2UXD L;  2CWA A;  3PCO B;  1QVF A;  1LTL A;  2IHE A;  5IYC G;  3DM3 A;  3HOX G;  5M3F G;  3U4Z A;  2RHS B;  1I94 L;  3HOW H;  4POF A;  4C3J H;  1VQ8 A;  3F1Z A;  4JI0 Q;  3L0O A;  2ZJQ A;  5IT9 c;  3U4V A;  1Q86 C;  1PH9 A;  2B63 G;  4A3J G;  3W1B A;  2K52 A;  4L5R C;  1L1O B;  2LXK A;  1K3R A;  3J81 c;  4LF7 Q;  1XMO L;  1XMO Q;  1VQK A;  3J7A 5;  1VQL A;  2Z6K A;  4AYB G;  4Y7N H;  4XIG S;  5IP7 H;  1CSP A;  3KDF B;  4A3C G;  1VQB A;  3CP0 A;  1S3O A;  3PF4 A;  1X3E A;  4DV6 L;  5AJ3 L;  1VQI A;  2JQO A;  1KHI A;  2Q2I A;  2WB1 G;  5M3M G;  1PH8 A;  1KIX A;  4FDB A;  3S14 H;  4JI4 L;  1VQ6 A;  4BY7 G;  4MZ9 A;  1LYL A;  1JB7 A;  1E24 A;  4ME3 A;  3T1Y L;  5IP9 H;  4XTC S;  1PYS B;  4JI8 L;  2VS1 A;  1RL2 A;  3F2D A;  3AYH B;  2VQF Q;  2PI2 A;  2ZTE A;  2Y0S G;  3M4Q A;  4LW1 A;  2WFW A;  5E7N A;  2K50 A;  4PZ8 A;  3UDF A;  1NJI C;  1MJC A;  4DUY L;  3CC4 A;  1QZG A;  3CW2 C;  1PH3 A;  3JAM i;  2C35 B;  1VCI A;  1NY4 A;  1HNZ Q;  4DV2 Q;  1K83 H;  4JOI C;  1JE5 A;  1K73 C;  3CCM A;  2OWO A;  3CCU A;  1QUQ B;  1MIU A;  4GLX A;  4IFD J;  1C0A A;  1VQH A;  2F3I A;  4WJ4 A;  4GNX C;  3K8A A;  4DV3 Q;  3PGZ A;  4X65 L;  5HY6 A;  4X65 Q;  3VDY A;  3KJP A;  1BBU A;  1V43 A;  1SRO A;  2R92 H;  2OQ0 A;  1EQR A;  3I55 A;  1SE8 A;  4C3I H;  3TRE A;  1YIJ A;  1Q12 A;  1VQC A;  4GN5 A;  1L1O A;  1WCM G;  3U50 C;  3H15 A;  1EQQ A;  4O0A A;  2MO1 A;  4ALP A;  1L2F A;  4TQU S;  1HNX L;  2RCN A;  3KDF A;  2ATW A;  4LFA L;  1N9W A;  2UU9 Q;  5FJ8 G;  2Q2T A;  2HHH L;  1YNX A;  1FVI A;  3FHW A;  1K9M C;  4IOC A;  5HGQ A;  3Q8D A;  1JJG A;  5FLM G;  4NXM Q;  2CQO A;  4X62 L;  4X62 Q;  1I6H H;  1SRU A;  4OX9 Q;  1VQO A;  2R93 G;  2EIF A;  4R1J A;  4LF9 Q;  3AFQ A;  1HZ9 A;  4DV4 Q;  1XPU A;  1LUZ A;  4YY3 L;  5M5Y H;  3GTK H;  2VL6 A;  5JJK A;  2IT1 A;  1PA6 A;  2EQS A;  1XNR L;  3HOY G;  2VNU D;  4AIM A;  1H95 A;  3RR5 A;  2DUD A;  4LFC L;  3J81 i;  4LFC Q;  3CD6 A;  3HOW G;  2B3G A;  1GVP A;  4P74 A;  1S72 A;  4LF8 Q;  1G51 A;  4DV0 Q;  1XMQ Q;  2KHJ A;  1S40 A;  1ASY A;  4A4I A;  1HNW L;  4DR6 Q;  4YWL A;  3I4O A;  2K5N A;  3K7U C;  2K14 A;  5IYB H;  2VQE L;  4JBJ A;  5IP7 G;  4NXN Q;  1YI2 A;  4POG A;  5JJL A;  4P75 A;  2PNH A;  2XTI A;  3A74 A;  3L7Z C;  3F2B A;  1PV4 A;  4IOA A;  3CF5 A;  3J81 j;  4B3R Q;  2QA4 A;  3GTL H;  2UXB Q;  2KHI A;  1I5F A;  1Q1E A;  1X6O A;  2OCE A;  2OQK A;  1HZB A;  2A1A A;  3AEV A;  1BBW A;  2IY5 B;  4OWX B;  3ULP A;  5IP9 G;  2UUC L;  2Z6K C;  2NZH A;  4YWK A;  1OXV A;  1VQD A;  1Y1V H;  4DR3 L;  5GQO A;  3F8T A;  2AKW B;  4BA2 I;  2MFI A;  3H0G H;  3I2Z A;  4YWM A;  3U58 A;  1I3Q H;  3GD7 A;  4PZ6 A;  4LF5 Q;  4LF5 L;  3RZO H;  3AFP A;  4JBK A;  2QGQ A;  1JMC A;  3ICE A;  1HJP A;  4C2M H;  4DV7 Q;  4OWT B;  5C0X I;  3RN5 A;  1Q1B A;  3A0J A;  2DGY A;  3B6Y A;  4IPD A;  2QEX A;  5LMU Q;  3UDI A;  1VQ9 A;  1WFQ A;  3K81 C;  1MJE A;  4HIM A;  4B3T L;  4DR7 L;  4HJ7 A;  2UUB Q;  4BY1 H;  4DR4 L;  4DR4 Q;  4DK3 C;  2UXD Q;  1HZA A;  1U0L A;  2R92 G;  3HKZ G;  4MNO A;  1VQ4 A;  4JYA L;  3PIO A;  4YCW A;  1SR3 A;  3HOY H;  4DK6 C;  4OWW B;  5C44 H;  3OTO L;  1I94 Q;  3EBE A;  1ASZ A;  1IYJ B;  3FP9 A;  3CPF A;  3M4O H;  3FKI H;  2E8G A;  1E7Z A;  3PUY A;  1M90 C;  4QGU A;  1C7Y A;  2OTJ A;  4JI7 L;  4JI7 Q;  1OXU A;  4EX5 A;  2YTV A;  3RLN A;  3ULJ A;  1EUJ A;  3CXC A;  1Q7Y C;  2JK8 A;  4LUZ A;  4A3I H;  2JA5 H;  1YHA A;  4DV6 Q;  2E5L L;  5AJ3 Q;  1L1O C;  2N8N A;  5IWA L;  2E5L Q;  3PUZ A;  1KXL A;  2HIX A;  2PMZ E;  1R9T H;  2NVX H;  2I5H A;  4B3S L;  3PO3 H;  2NN6 I;  4KHP L;  1PYB A;  4JI4 Q;  2CFM A;  2K5H A;  2WAQ E;  2GVA A;  3T1Y Q;  3M85 A;  3S24 A;  1E1O A;  4DR2 L;  4TVA B;  2JEA I;  4JI8 Q;  5C3E H;  2R7Z G;  5IYB G;  1TWA H;  1GM5 A;  3MXN B;  4X6A H;  1RIP A;  1FGU A;  1AE2 A;  1YIT A;  3KOJ A;  4DKA C;  3GDE A;  2HQL A;  4A76 A;  1BVS A;  2F4V L;  2A19 A;  4DUY Q;  3PO2 H;  4LFB L;  1X54 A;  1O7I A;  2JJQ A;  3GTO H;  3STB C;  3S16 H;  4HJ5 A;  5C4X H;  2KCT A;  1OXX K;  1WJJ A;  4JBW A;  2R7F A;  4YCU A;  4OO1 G;  3ZJY C;  4A93 H;  4IFD G;  1YEZ A;  3CCV A;  3A5Z B;  1BKB A;  1VQM A;  2RF4 A;  4LUV A;  2ZM6 L;  3PUV A;  2I5L X;  3K80 C;  4A3E H;  4J15 A;  4JI2 L;  3A5U A;  5FLX c;  5GRO A;  2RHQ B;  2R7D A;  4IPG A;  1M1K C;  1Y1V G;  3I4N H;  3CCL A;  3GO5 A;  1NTG A;  3PF5 A;  3H0G G;  2WP8 J;  4GKJ L;  3CCJ A;  3S1R H;  5K36 G;  4RG1 A;  1P16 A;  2ES2 A;  3S2D H;  4JV5 L;  3J80 c;  4PG3 A;  4IPC A;  1HNX Q;  1FJG L;  4RMF A;  1VQJ A;  4LFA Q;  3GTJ H;  4P71 A;  5IY0 A;  4L5Q A;  2HHH Q;  4A3L H;  3PV0 A;  3D31 A;  3CC7 A;  1K8G A;  1PVO A;  1D7Q A;  1W2B A;  4BY1 G;  1VQN A;  4AH6 A;  1AH9 A;  4GN4 B;  4LF6 L;  1B70 B;  2PI2 E;  3G48 A;  4YY3 Q;  1J6Q A;  3CMA A;  4BBS H;  4NB3 A;  1XNR Q;  3TEH B;  5C44 G;  2E2I H;  4KHZ A;  1CSQ A;  3FKI G;  4R4Q A;  1SFO H;  3I7F A;  2CKZ B;  3TQY A;  4GOP A;  1HR0 L;  1EIY B;  3HOV H;  1J5E L;  1J5E Q;  4IO9 A;  1HNW Q;  1PH6 A;  4DR5 L;  3NEM A;  4HJ9 A;  3TRZ A;  2N3S A;  5BR8 L;  1VQ5 A;  2VQE Q;  4A3K H;  2MQH A;  2A8V A;  2KEN A;  1TWG H;  4UP9 A;  4YHH L;  4A3I G;  4A3F H;  1HR0 W;  1CKO A;  2JA5 G;  3OYY A;  5J3B A;  1IL2 A;  3KJO A;  1K0R A;  5EAY A;  3OW2 A;  4A3D H;  2ZJR A;  4DV1 L;  2I0Q A;  3PO3 G;  1UE5 A;  1OXT A;  1T9H A;  2Z0S A;  2UXC L;  1N33 L;  1N33 Q;  2HIV A;  1QVG A;  2UUC Q;  2GN5 A;  5C3E G;  5IYD H;  5LMN L;  5LMN Q;  1KD1 C;  1JJC B;  2AHO B;  3KFU A;  3M3Y H;  1I50 H;  1UE1 A;  4LUO A;  4UP7 A;  4DR3 Q;  3E9H A;  1X9N A;  1UE7 A;  3KLW A;  2MO0 A;  4A3M G;  1PH2 A;  4IJL A;  3EIV A;  2NVT H;  4MTN A;  3PO2 G;  4QJF A;  4JC0 A;  2UUA L;  5LMN W;  5C4X G;  4UP8 A;  4WJ3 M;  3UE0 A;  3I4M H;  4HJ8 A;  1KC8 C;  4A3B H;  1NE3 A;  1IBK L;  2ID0 A;  2VY3 A;  4B3M L;  4B3T Q;  4B3M Q;  4A93 G;  4O2D A;  4DR7 Q;  3NEN A;  4AYB E;  3CPW A;  2K5V A;  3CAM A;  4A3E G;  1X3G A;  3ER0 A;  1X56 A;  4JCV E;  3S1N H;  1XJV A;  2PQA A;  1X55 A;  1E3P A;  1UE6 A;  2HT1 A;  3I4N G;  4R4I A;  2V1C C;  3J80 i;  1VQG A;  2OTL A;  1K8A C;  2BA1 A;  1YHB A;  2WB1 E;  4DR1 L;  4JI5 L;  4JI5 Q;  4BXX G;  3OTO Q;  4X66 L;  3NBH B;  2JEB I;  4X66 Q;  1XPO A;  5JJI A;  3KF8 B;  2CWP A;  1N8R C;  3HKS A;  1N32 L;  4R4O A;  1TXY A;  4DUZ L;  1YHQ A;  1XNQ L;  4GLA C;  1C9O A;  4IJH A;  3WWV A;  1N34 L;  1KRS A;  3M9B A;  5C0X J;  3I56 A;  3KF6 B;  3S2H H;  4PMW A;  5C0X G;  3E0E A;  3G4S A;  4A3L G;  3KYH C;  3RLO A;  1NMF A;  2NVQ H;  2Y0S E;  4OXP A;  4K0K L;  2VW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...