3GTQH

Backtracked rna polymerase ii complex induced by damage
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtqH00
4AH6A 4X62L 4YY3Q 1V1QA 1XNQQ 2EQSA 1PVOA 3T1YQ 2CQOA 2LXKA 4KHPQ 4YWLA 5JJLA 2KHJA 1J6QA 2Q2HA 5JEAJ 4X64Q 2K5HA 4DK3C 3BZCA 2E5LQ 2B63G 1BVSA 1IYJB 3TS0A 1PH4A 4DV2L 1IBKL 4B3RQ 3J81j 3PO3G 4X6AH 1GM5A 1MKHA 4NXML 4A3BG 1XTDA 2ZJPA 1OTCA 2D62A 1VQ6A 4LFCL 5C44G 2JA6H 3J7ZC 4DUZQ 1HR0L 3KYHC 2JEAI 1G6PA 3VDYA 4C3HH 4P74A 4H02A 3S1NH 3D0FA 2YTXA 4X66Q 2ALYB 4LWCA 5LMNQ 1B8AA 3UDFA 1UE6A 4GKJQ 4IPHA 5DLQE 2ZTCA 1XPOA 3PSIA 1LYLA 1LUZA 2PI2A 1NBWA 3F1ZA 4JI5L 5M3FH 4B3SL 3CQZH 3RN5A 2IHEA 4JI0L 3K81C 1YITA 1N32Q 1D8LA 4A3FG 4JBMA 1X55A 2WB1G 3F8TA 4LF8Q 1YJWA 1HZCA 3PUXA 2ZTEA 2OWOA 4DR1Q 2VQFQ 1CSQA 4A3FH 4YHHL 3CCJA 2A1AA 4OO1G 2GN5A 5IYBG 5FJ8H 3RNUA 2JQOA 4LFCQ 2F4VL 2HIXA 4FDBA 4P72A 4JI8Q 4GOPA 2N49A 1K3RA 3GO5A 2JA8H 5JJIA 3F2DA 2GVAA 5H1SE 1P16A 5GAHC 2ZJRA 1PH5A 1I94L 1ASYA 2V1CC 4JOIA 2R7ZH 4WJ4A 4DR5L 1YNXA 3L0OA 5IYCG 2CKZB 4R1JA 3U58A 3GTLH 3STBD 4A3CG 4DV7Q 1X56A 4LUZA 2N78A 4JOIC 2UUBQ 1L0WA 1L2FA 5AJ3L 4GKKQ 1QVGA 1E24A 1YHQA 2R7FA 1XPRA 2PNHA 1IBLQ 2JA6G 1N36L 3GD7A 1KAWA 4LF5Q 1PH3A 3KFUA 2R93H 2R92H 3BZKA 1YJNA 3HOVH 3S2HH 2AWOA 1XNRQ 3PIPA 5GROA 4R4CA 4GNXA 4HJ8A 2LSSA 1EFWA 2CFMA 1RIPA 4XIGS 3CCSA 3ERSX 1PA6A 3CW2C 3KDFA 4A3DH 1C0AA 4ALPA 4GLVB 1NTGA 3TREA 1FVIA 3KJOA 4DR3Q 2BH2A 1BBUA 3ZJYC 1X3GA 2F52A 3S1MH 2UUBL 1K8AC 1VQGA 1XMQL 3KJPA 4A3EG 4C2MH 4B3SQ 3HOZG 2Z0SA 3HOYH 5FLMG 1CUKA 4JYAQ 3K7AH 3HOUH 3I4NH 2UXCL 2AWNA 4DR5Q 5FLMH 3CCRA 4IPGA 1GD7A 3W1BA 2EIFA 1I94Q 2R7ZG 1HH2P 1QVCA 4EQ5A 2YV5A 1QZHA 2H5XA 3PO3H 4EX5A 4NPSA 3KF6A 2VUMH 3CD6A 2KBNA 1Q12A 4LFAL 4DV6L 1YBYA 4DR3L 4BBSG 1QUQB 5AJ3Q 4GKKL 2MO1A 1D7QA 3UE0A 4A3MH 4BBRH 3PO2H 4IFDG 3GTPH 5JJKA 3OYYA 1PFSA 4HIOA 2VL6A 1SN8A 2UXDL 1CKOA 1X65A 1EUJA 3IRBA 1WCMG 4BBRG 3J81i 4DV7L 1PHJA 2I5MX 2I0QA 3ULLA 2R92G 3T1HQ 4JG2A 3L2PA 3F2BA 2FXQA 3GTJH 1EIYB 1EOVA 1VQEA 2PQAA 2WFWA 3A74A 2VUMG 4UP8A 3MEFA 1A8VA 3EIVA 3PUYA 2PMZE 1Y1VH 1A0IA 4C3JH 2GVBA 3H15A 3TEHB 3CCMA 1C9OA 4L5QA 4ME3A 4GNXC 2IX0A 5GAEC 4JI6L 3HKZE 4DAMA 3CCLA 3S16H 4AQYL 3S1RH 3KLWA 4DV6Q 1X54A 4UPAA 5M3MH 1TWHH 3I2ZA 2Q2TA 1VQNA 1HZAA 1X6OA 3L7ZC 1TWFH 1VQMA 1A63A 5GAGC 5JEAG 4RMFA 1VQ9A 4QGUA 4IO9A 2E2IH 1NJIC 1Q8KA 2CWAA 4DV3Q 1UE7A 2Z6KA 3G6EA 4NB3A 2IT1A 2C35B 4PG3A 1N8RC 4POFA 1G51A 4JBWA 1NMGA 1MIUA 3HOWH 2DGYA 2OQKA 5M3MG 1JE5A 2IX1A 4YWKA 1AE2A 1PV4A 4DR4Q 3TRZA 2YTVA 3J81c 2UU9Q 2PI2E 3CCEA 5IWAL 1HNZL 4APVA 4NXMQ 5IYDH 3HKZG 3I7FA 2CCZA 3EBEA 4B3RL 1JJGA 1YVCA 4IJHA 1PH1A 2E8GA 1IBMQ 2NZOA 2R7DA 1IL2A 2UUAL 3RZOH 4HIMA 1BBWA 4DR7Q 4YHHQ 3M7NA 4A3GH 3LGJA 2JE6I 4AQYQ 2RF4A 2ASBA 2WP8J 1YEZA 4J15A 1JMCA 1W3SA 3HOXG 1O7IA 1JB7A 4JI6Q 1L1OC 2JK8A 5IP9H 1VQDA 1VQ4A 4LUVA 4TQUS 4DUYQ 1VQFA 3UDIA 2KHIA 3H0GG 3RLNA 1E22A 1HNWQ 2AKWB 3F2CA 2K52A 4A3LH 3I4MH 1MJCA 3G4SA 3M9BA 4A3JH 4RG1A 1W2BA 1IXRA 1FL0A 4DR2L 2JA5G 4GN3B 1FJGQ 1TWGH 1YZ6A 4AYBE 4LF5L 2UXBL 2HT1A 3Q8DA 1E1TA 3GDEA 3UE1A 4POGA 4P75A 3SGIA 3ER0A 1QVFA 1Q81C 2BA0A 1YHAA 1Z47A 2YU9H 1HJPA 4JI7L 2JA7G 1L1OB 1CKMA 1UE1A 1Z9FA 4QIWE 4DAYB 4R4TA 4QY7A 5C0XI 2F3IA 2HHHL 3I4MG 2UUAQ 2VS1A 2VNUD 3K8AA 1WCMH 1SLJA 3A5UA 2VW9A 3CP0A 1UE5A 1WOCA 4YCVA 3M85A 3CAMA 1KXLA 2YTYA 4YWMA 4GOPB 5IT9c 2R6GA 3J80i 2UUCQ 3CMAA 4OWWB 2HIVA 2RHSB 1PH2A 1UWVA 3CC7A 4HJ7A 3DM3A 1PH7A 4A93G 4PZ7A 3PGZA 2JEBI 4O2DA 1ASZA 4R4OA 2KENA 5FLXc 4K0KL 5C0XG 3NEMA 2QA4A 4P71A 5M5XH 2ZM6Q 2AHOB 2CWPA 4DV2Q 3UDGA 2JA9A 1IBKQ 1XNRL 1EQQA 2E5LL 3OW2A 3E9IA 1Q1EA 1PH9A 3I4NG 1S3OA 3S15H 2WAQE 4A3IH 4MTNA 1JT8A 5IYCH 4B3TL 4JI1L 4OXPA 1XMQQ 1PH6A 1XMOL 1I3QH 4DR6L 3UDXA 3KOJA 1U5KA 4OWXB 3CF5A 2JA5H 1I6HH 3W5OA 5C44H 4PZ6A 2EXDA 2VY3A 3RR5A 2Y0SE 3CCQA 2UXBQ 2I5LX 1V9PA 2NZHA 4A3MG 3H3VH 1HZBA 3CMEA 1FJGL 3KF8B 3GTOH 2IHFA 4WJ3M 4DV0Q 2E2HH 2VZAA 3W1GA 4JBJA 3E0EA 4A3KG 2XGTA 1G291 4KI0A 1KRTA 3S2DH 4LF4Q 1AE3A 2LXJA 4DV3L 3RZDH 4A4IA 3JAMc 1XNQL 4JI2Q 4BXXG 4DV4L 4GKJL 3G71A 3M4OH 4C3IH 3J7A5 1IBLL 3CXCA 3K7UC 2VQFL 3S14H 4JI4L 4PMWA 2WAQG 5HY6A 1J5EL 2ATWA 3I55A 2XTIA 1H95A 3H3VI 4OX9Q 1CKNB 3A0JA 2QEXA 2K4KA 4DV1L 3FP9A 3AYHB 1XPUA 1E7ZA 3HOZH 4XTCS 1Q46A 4GLAC 1WI5A 2KCMA 4GNXB 4YCWA 5IP7G 5FJ8G 1OXXK 2K5VA 4Y7NH 1NE3A 4A3LG 4BXXH 4R4QA 3AFQA 1XMOQ 1T9HA 4B3MQ 4A3KH 4JI8L 1JJ2A 4B3TQ 2JA8G 5C4XG 2B63H 4LNQA 1E1OA 1KD1C 2K14A 1Q1BA 1RL2A 2ZM6L 4A93H 2NVXH 3HOXH 4GS3A 2UU9L 1N36Q 4A76A 4DR4L 4OWTB 3JC66 4L5RC 4LFBL 4DPGA 1YIJA 3CC4A 1N33Q 4JI4Q 1X3EA 2B29A 2R93G 4DR6Q 3B6YA 3BU2A 4JI3Q 4LF9Q 1X3FA 5C4JH 1VQ5A 5ELNA 2KCTA 1EQRA 1OXUA 1SFOH 1JJCB 5GADC 4JV5L 4A3CH 3M4QA 4A3IG 1VQIA 1X9NA 4BY7G 3EN2A 3HOUG 1VQJA 3S17H 1K83H 1OXSC 4BA1I 1K0RA 5M5WH 1K9MC 3PUVA 4UP9A 3AEVA 4A3DG 4DUYL 4DV5L 5M5YH 1N34Q 1Q82C 1C7YA 3ICEA 1AH9A 3CCUA 1YHBA 4JCVE 5LMNW 4HIKA 1V43A 2A8VA 3JAMi 5IYBH 2MFIA 4LUOA 1EWIA 2RCNA 3CPWA 4DR7L 2Q2IA 4DNIA 2Z6KC 4DR2Q 3GTGH 5BR8Q 3OTOQ 1VQOA 3HOVG 4GOPC 3AFPA 3AQQA 1VQHA 2OCEA 4YY3L 5EAYA 2VQEL 4NXNQ 4P73A 1KL9A 4BY1H 4JBKA 1VQKA 4JYAL 2BH8A 1U0LA 1VQAA 1Q7YC 3FKIG 1CKNA 5C0XJ 1B70B 2ID0A 4L5TA 4MZ9A 1MJEA 5GQOA 3I56A 3HOYG 1TXYA 1VQBA 4MNOA 4IOAA 1KIXA 1SR3A 3ULPA 1KC8C 4KLKA 3S24A 4JI0Q 4A3EH 4TVAB 3U50C 2MNAA 4JV5Q 3TS2A 5IY0A 2PQAB 1EYGA 1S72A 3M3YH 2MQHA 1NY4A 3NELA 1Y14B 4DK6C 5LMNL 3PUWA 4HIDA 4HJAA 3GTQH 4BBSH 1R9TH 4X65L 1WJJA 3HFZB 2WB1E 2ES2A 4A75A 3RN2A 1VQ7A 5M3FG 1HNXL 3A5ZB 3NBHB 2YYZA 4DUZL 1QUQA 4GLXA 1I50H 5LMUQ 1LM0A 1HR0Q 1N32L 1P8LA 2L15A 3E9HA 4LF6L 4HJ9A 2JA7H 2D0OA 3KF6B 1M1KC 1CSPA 1IBML 3U4ZA 1VS0A 2NN6G 2UUCL 1HZ9A 2D0PA 1TWAH 1XJVA 2IY5B 2RHQB 2DUDA 5BR8L 3OTOL 4AIMA 1M90C 4LF4L 1WFQA 3PV0A 2NVQH 4AYBG 3GTMH 1VCIA 1DGSA 1KHIA 4IFDI 3I4OA 4BY1G 1TWCH 5E7NA 5HGQA 3NENA 1GKHA 4LF8L 1J5EQ 4DR1L 3BJUA 4OX9L 1VQCA 3HOWG 2N3SA 1SRUA 3KDFB 2QGQA 1QZGA 2ZTDA 2NN6I 1HNXQ 2A19A 4DV4Q 4OONA 2K50A 4IFDJ 4JI1Q 3U4VA 1EIFA 4IJLA 4QJFA 4JI2L 1OXTA 5K36G 4B3ML 2NVTH 3WWVA 1WYDA 4UY8C 1FGUA 2HQLA 1OXVA 4GN5A 3G48A 1L1OA 3GTKH 3T1YL 4KHPL 5C4XH 3STBC 4R4IA 5IWAQ 1YJ9A 2MO0A 4DV0L 3RLFA 1HNZQ 3CCVA 3PF5A 2JJQA 4A3GG 1GVPA 4DV1Q 5J3BA 2K75A 1UEBA 1S40A 4LF6Q 3PUZA 2B3GA 5IE8A 1PYSB 4LFBQ 4QQBX 4LF7Q 1PH8A 3PF4A 5IYDG 1LTLA 4LFAQ 3K80C 4DKAC 1A62A 3PCOB 2K5NA 4OO1I 4X65Q 4HJ5A 1VQPA 5C3EG 1GO3E 1Y1WH 4A3JG 1SE8A 1K8GA 4X64L 4BA2I 4X62Q 3H0GH 2UXCQ 1N9WA 3T1HL 3TQYA 1VQ8A 2E2JH 2UXDQ 1NMFA 4X66L 4JI3L 5LMUL 1SMXA 4UP7A 3MXNB 4JI7Q 1PYBA 4DV5Q 1Q86C 1N34L 4O0AA 3PO2G 2NVYH 4KHZA 4LW1A 5IP9G 4GN4B 1Y1WG 4JI5Q 4JC0A 4IPCA 2BA1A 1BKBA 2Q2UA 2Y0SG 3ULJA 3D31A 3PIOA 5IP7H 3CC2A 4QL5A 3S1QH 1HR0W 5C3EH 3K0XA 1YI2A 1K73C 4PZ8A 4L5SA 2N8NA 4BY7H 1Y1VG 2OQ0A 1VQLA 3CPFA 1HNWL 4LF9L 3FKIH 1E3PA 1IZ6A 3FHWA 3HKSA 3J80c 3DLLA 4IOCA 1KQSA 2HHHQ 2F4VQ 1N33L 3RLOA 2ZJQA 1SROA 2AMCB 3M4PA 4K0KQ 2OTJA 4IPDA 2I5HA 1KRSA 4YCUA 1I5FA 4A3BH 2OTLA 4LF7L 5ELOA 4NXNL 2VQEQ 4Y52H 1B7YB
chains in the Genus database with same CATH superfamily
4AH6A 4RAUC 5JPNC 1XNQQ 2EQSA 3T1YQ 2K7VA 4ID6A 2Q2HA 4K8IA 3SK8A 4DK3C 1BVSA 2NUCA 2R7ZB 3PO3G 4X6AH 2KVMA 1CT1D 4IZ8A 4RCNA 5CYUA 1VQ6A 2RCFA 4U68A 1GUOA 1Y1WB 2PQEA 5FLXE 2L4NA 3D0FA 2FHTA 1PZID 2L0CA 1JOQA 1B8AA 4IPHA 5DLQE 3PSIA 1LYLA 3OWFA 3ZYYX 4O1NA 2PI2A 3F1ZA 5C5LA 1DM0B 1O80A 3CQZH 2IHEA 3BDCA 1YITA 2PO4A 4JBMA 1X55A 2WB1G 1PDQA 3F8TA 3SDZA 3PUXA 4Q0FA 4C1NI 4DR1Q 4A3FH 1ET9A 4YHHL 2A1AA 5FJ8H 2JQOA 4QB4A 4P72A 2QEJC 3GO5A 2EY6A 2KCCA 2WKDA 4C3IB 3F2DA 1MSHA 1G6ZA 1TS4A 3L0OA 4K5VA 4KD4A 2MHVA 4ZRZA 5TSSA 3NXWA 4LUZA 2N78A 2H4OA 4C3IG 1GUNA 1L2FA 1W6KA 1E24A 1JWMD 1N36L 1AN8A 3GD7A 1LT4D 4KHVA 2BCOA 1HRJA 2WAQB 4Y7NB 3BZKA 4QCLA 4FF4A 2QILA 2AWOA 1QJOA 4H0LC 1XNRQ 3NQTA 1AZPA 4GNXA 4HJ8A 3I72A 4KJOA 5HGTA 3CW2C 1HUNA 2L9HA 3TREA 1NTGA 3KJOA 1V1OA 1SSOA 1BBUA 2NTSA 1X3GA 5IGGA 2EYPA 4DXFA 1WTOA 2UUBL 3S1MH 1JC7A 3K7AB 2AUKA 2RQXA 5LL6S 4A3EG 4E6IA 1XMQL 4JYAQ 3VR2A 3K7AH 3QOLA 4ZUJA 2IL8A 4R8NA 1WTXA 2EIFA 2EJMA 4DAPA 1QVCA 1KDCA 2DNCA 3CD6A 2BE5D 1Q12A 2KBNA 4DV6L 4WJWA 3NTIA 3MXPA 1GXDC 2A6HD 1PFSA 4HIOA 1ENFA 2I5MX 4IUUA 1ILPA 1E2WA 4JG2A 5CV6A 3TBIB 3L2PA 4R9WA 3G7LA 2HDLA 1O7LA 1E2ZA 1TWFB 1A8VA 2I46A 3EIVA 2PMZE 3OIPA 4ME3A 4RGOS 3KLRA 3CCLA 3S16H 5JPMC 1VQNA 1TWHH 2EYMA 1WVLA 2B39A 4V190 1A63A 5JEAG 4LJZC 3E5SA 4RMFA 1VQ9A 4FYDA 1Q8KA 1QE6A 1UE7A 2Z6KA 2C35B 1N8RC 1ICWA 3QIAA 1G51A 4JBWA 1NMGA 2B2VA 5IGFA 5M3MG 1BBXC 4YWKA 1AE2A 3OSOA 3TRZA 2VUMB 2UU9Q 3CCEA 5IWAL 1DONA 3I7FA 3EBEA 5EPJA 3GV3A 3V96A 3QO2A 2E8GA 1IL2A 2LY7A 1BBWA 4YHHQ 4A3GH 3BVZA 4FXGC 2JE6I 5CR3A 5JJZA 3C1FA 1JMCA 1O7IA 4JI6Q 3TN2A 2PW7A 1VQDA 2Z9HA 3MXNA 5D3IB 3S1MB 4TQUS 1PMRA 3UDIA 4CDEC 2OXPA 1MBYA 1WTVA 3RLNA 1T5XD 3EJIA 4BY1B 2YU9B 4A3LH 1PFNA 5EPKA 3S2HB 4KY7A 1FL0A 4DR2L 1UNSA 3PO2B 4EVOA 3GTGB 2UXBL 4KV6A 4P75A 1SNPA 1YHAA 2OT2A 1Z47A 1HCZA 4RH6A 3NUCA 4XQQA 1HJPA 1HTLD 5M5XB 1L1OB 1UE1A 1Z9FA 1WTPA 3S15H 4QY7A 1IW7D 2RDGA 2VS1A 5AFWA 1S5DD 2IX3A 3A5UA 3M4OB 5IT9c 1LTID 1UWVA 3W2DA 3DM3A 2AQ3B 4DXGA 3J7AV 1U4LA 5FKAC 1WCMB 2K5QA 4H13C 3T16A 2F0GA 2RBMA 2FMMA 1A2TA 4RKLA 4DNRB 2AHOB 3HG9A 4DV2Q 2JA9A 1EWCA 1EQQA 3FEWX 3X3MA 1EU4A 5CV4A 3I4NG 2KCNA 2WAQE 1ESFA 4MTNA 1TWGB 1HA6A 3SEBA 1XWEA 3H6MA 2JA5H 3LWEA 2HDMA 2VY3A 3NHHA 3I4MB 3MVVA 3NK9A 4FP5D 1V9PA 2NZHA 3SVMA 3S17B 1HZBA 1FJGL 4XT1B 1PTOF 3J7AF 2PZWA 4A3KG 1G291 4KI0A 5LHY1 3S2DH 1K8OA 2KA7A 3JAMc 5F2DA 1XNQL 4BXXG 4DV4L 4GKJL 3S2DB 3G71A 3J7A5 4L6TB 1IBLL 5KNBA 1J9OA 1J8IA 3RZOB 5HY6A 3I55A 2B2YC 1RJTA 1H95A 4OX9Q 1CKNB 2K4KA 3MFGA 2B63B 4RCOA 3NSWA 1Q46A 2I07B 3HOXB 3NWSA 2R92B 2CHBD 3CQZB 5FJ8G 1NE3A 3LNNA 3A56A 1I4GA 4B3TQ 4LNQA 1E1OA 1STYA 3D8GA 4CGYB 3K5OA 1N36Q 4LMQD 4DR4L 2XRSD 4L5RC 1PRTD 3ERQA 3CHBD 4DR6Q 3B6YA 2A68D 4LF9Q 5M3MB 2KCTA 1D5ZC 1KLGD 1KAAA 1X9NA 1VQIA 1IL8A 5EQ0A 1VQJA 4BA1I 1K0RA 1K9MC 2BE5C 4A3DG 1CQVA 4IN3A 1C7YA 3ICEA 5I4DA 5LMNW 4EQPA 3TP8A 3ONAB 4A3IB 2JYOA 3DUZA 3ND8A 3PIP3 1NUCA 3CPWA 5JEAH 2BDNA 2Q2IA 3QR8A 4EGVA 1VQOA 2AQ2B 3DMUA 1VQHA 4YY3L 1MHWC 4P73A 3QOJA 4JBKA 4RGTA 5JAVA 5E1FA 3HGBA 1STAA 2F0HA 3HOYG 1VQBA 4JVZA 3I3CA 3ULPA 4KLKA 4CKEA 2JA8B 1DYQA 3S24A 4A3EH 2NVQB 4I65A 1O7YA 3TS2A 1CM9A 1EYGA 1Y1VB 1S72A 2SNMA 1NY4A 4HIDA 5C3XA 1KTKA 1IYVA 3A7LA 2WB1E 1BCPC 3HEJA 4DUZL 1HR0Q 1I50H 1LM0A 2O5IC 3E9HA 2RKSA 3CRKC 1I50B 3S1QB 2D9UA 2UUCL 2NN6G 1HZ9A 2D0PA 2DUDA 2F0KA 2F0WA 4AIMA 1WFQA 3PV0A 2NVQH 4AYBG 3GTMH 3I4OA 4BY1G 1TWCH 1SMYC 4LF8L 3BJUA 4C2MB 4EQOA 1HNXQ 3FPPA 3OW7A 4KY5A 1JOOA 2D5DA 4JI2L 2F4IA 2E76C 2DY8A 2NWGA 4TSSA 3WWVA 2NVXB 1L1OA 3T1YL 5C4XH 4R4IA 2CH4W 3RLFA 4A3GG 4C56C 4RGMA 4QQBX 2B3GA 1PYSB 4DKAC 4OO1I 1ML0D 1SE8A 1A3VA 5J1ZA 3D3RA 1N9WA 1ZYRD 2DJFC 2V4DA 2ZXOA 3MXNB 2F0JA 1PYBA 5KGUA 1B53A 1Y1WG 1H9SA 1V1PA 1BKBA 4OIJA 3Q23A 3CC2A 1CZGA 2QF7A 1AZQA 1UAPA 5C3EH 1ICFB 1K73C 2N8NA 3Q6SA 3CPFA 3HKSA 5A35A 2L55A 4J8QA 2OTJA 2I5HA 3TDQA 1KRSA 1X3QA 3R2IA 4UHVA 1WD1A 5ELOA 2R61A 3OWEB 4ULLA 2O2LD 1D6EC 1V1QA 3M3YB 1PXUA 4YWLA 5EJWA 1J6QA 5JEAJ 4X64Q 2E5LQ 1II3A 3NTKA 4NDXA 3J81j 1LABA 4RWSC 4A3BG 2EYHA 1A3TA 2ENBA 4LFCL 4F88A 2JA6H 4DUZQ 1HR0L 3KYHC 1UEAB 5EPLA 4P74A 2KUMA 4OHJA 2SOBA 4LWCA 1U4PA 4DK0A 1BQQT 1KNEA 4GKJQ 2JN4A 2QCPX 4K6LA 1NBWA 4BY7B 4PNYA 3K81C 3DWQA 5EKKA 4N8FA 4RHSA 4S3SA 4A3FG 1GOZA 1YJWA 3C2PA 2OWOA 3MTSA 5D14A 3GTLB 1E2VA 3RNUA 3I4NB 2HIXA 1LTAD 1EFID 2GVAA 2ZJRA 2R7ZH 1BUVT 3U58A 3STBD 1B3QA 4A3CG 1I4QA 3TMEA 2UUBQ 4A93B 5AJ3L 4GKKQ 1QVGA 1IBLQ 2R7FA 2PNHA 1VF7A 1KAWA 4LF5Q 3HZXA 3KFUA 2R92H 5FO9B 2Q8IB 4WFN3 3S2HH 1LTBD 3HOZB 3BYTB 2BOSA 3R2TA 3ERSX 4A3DH 4GLVB 5C5MA 1K8MA 3ZJYC 5EBCA 1VQGA 2Z0SA 1CUKA 4DR5Q 3CCRA 4N9TA 1GD7A 5CC4A 3WDNA 1QZHA 1X32A 3PO3H 4EX5A 4NPSA 3KF8A 2VUMH 5I6WA 2B2UA 1YBYA 2A69D 1D7QA 1GUWA 3UE0A 3PO2H 2A6ED 4IFDG 2NTTA 5EKLA 1F9QA 3BZDB 5FLXL 3I73A 1NR4A 1B50A 1CKOA 1X65A 3IRBA 1JOKA 1WCMG 3T1HQ 1JICA 1RD9D 2PQAA 1JB3A 3CRLC 3MEFA 1F2YA 4CKCA 5K5PA 3PUYA 3T53B 1PZKD 1SMYD 2F1MA 4FVMA 3H15A 3K5LA 2J0TD 1PFMA 5GAEC 5I6YA 4DAMA 3P1HA 3KLWA 3GV6A 3I2ZA 3L7ZC 1X6OA 1CA5A 3D4DA 1VQMA 5GAGC 3RUZA 2E2IH 2J7ZA 4A3DB 1HXYD 1TS2A 1NJIC 2CWAA 2IW3A 5A2QE 3EROA 4PG3A 5C44B 1Y8NB 4ZCKA 1YNJC 3HOWH 2EJFC 1WTHA 2K1BA 2DGYA 1JE5A 1ENAA 5ELFA 3QWNA 4B9WA 4DR4Q 2YTVA 1SYFA 2QKIC 5IYDH 2SNSA 3E3XA 1XXGA 4B3RL 1PH1A 2NZOA 2R7DA 3JAME 1D2BA 1LTSD 2F0SA 4IQZA 4Z9CB 5T1GA 2RDHA 2WP8J 3J7YW 2ASBA 5KRUA 1TWHB 3HOXG 1L1OC 5L37A 2JK8A 5KNCA 2RSNA 4DUYQ 3R3OA 2K5DA 3MHBA 2A6EC 2KHIA 4NW2A 5IGDA 3TP7A 3I4MH 3G4SA 3M9BA 1EU3A 3PQIA 1F9RA 3U9SA 3BDLA 3F2UA 4RG1A 1IXRA 1C4QA 1I6HB 2KECA 4GN3B 1FJGQ 3DWPA 5CORA 5COYA 1TT2A 2HT1A 3Q8DA 1E1TA 5IGBA 2L5TA 3ER0A 4HCSA 1QVFA 1Q81C 2BA0A 2EYFA 4JI7L 4DAYB 2LFNA 1K0SA 2UUAQ 2VNUD 3AB9A 3K8AA 2VW9A 3CP0A 3M85A 1WOCA 3CAMA 1KXLA 2UUCQ 3J80i 3CC7A 4HJ7A 4A93G 3URYA 1EY4A 4QIWB 4PZ7A 3PGZA 1ZYRC 1S5FD 2JEBI 2K01A 1NSNS 2KHSA 3CU7A 4K0KL 3NEMA 2EYOA 2CWPA 4OELB 3OW2A 3E9IA 2K28A 1Y8PB 1PRTC 3IFTA 3H94A 4A3IH 3A8KE 4B3TL 1XMQQ 1PH6A 4KMUC 2X6GA 4MIUA 4DR6L 3KOJA 1PTOC 4HSVA 1H9RA 5C44H 3RR5A 2Y0SE 3CCQA 2UXBQ 1B9MA 4K5WA 4OO1H 2PZUA 3T4AC 3CMEA 1WTWA 3GTOH 4DV0Q 2E2HH 2VZAA 3W1GA 3ITPA 2PNRC 1KRTA 1AE3A 1STGA 4JI2Q 2L1BA 3K7UC 4F7XA 4C3HG 3H3VI 2QEXA 3FP9A 1E7ZA 1G2TA 4GLAC 3WOFA 1WI5A 1CTMA 4Q5VA 5IP7G 4A3LG 2K5VA 5G3LF 4BXXH 4R4QA 1T9HA 2EDGA 4BBRB 4JI8L 4B3MQ 2B63H 2BDOA 1NNXA 2Q8TA 3HOXH 2UU9L 4DPGA 5M5WB 3K5MA 2EY2A 3CC4A 4JI4Q 1X3EA 2R93G 4CDCC 5C4JH 5CV8A 1JJCB 2E2DC 5GADC 3M4QA 4RHRA 4BY7G 4KKUA 2F0DA 5KEEA 4LK1C 5D3DA 4DUYL 3GTOB 3BDOA 5J22A 3MWYW 4DV5L 1N34Q 2JA5B 4HR7B 2MGSA 1ZEQX 1TR5A 4HIKA 1V43A 2A8VA 3TP5A 4G7HC 2WINB 1LV9A 2MFIA 1EWIA 5C3EB 2F0QA 3C1EA 4DNIA 4DR2Q 3GTGH 2L11A 4GOPC 3I4LA 2MP1A 3DWAA 3C3LA 3AQQA 2OCEA 5I2YA 3M4YA 2BH8A 1Q7YC 3FKIG 5C3WA 5C0XJ 2ID0A 4G4KA 4MZ9A 4V0BA 4IOAA 1KIXA 1SR3A 3NQIA 5KYIA 3QJYA 3IAYA 4TVAB 2E2HB 3U50C 2ZXRA 1EZ8A 2AQ1B 2DJGC 2NZ1D 3GTQH 1Y14B 1L0YB 4BBSH 1WJJA 3D4RA 3HFZB 4A75A 5M3FG 5FOBB 3NBHB 2YYZA 1QUQA 5ELCA 1B4OA 4K5XA 2D0OA 1CHQD 1M1KC 4RGNA 2F0EA 1VS0A 1WTRA 1SDFA 1TWAH 4CKBA 2WACA 1W6JA 5M5YB 5BR8L 5CV5A 3OTOL 1M90C 3U9OA 1FD7D 1HQMC 3NBIA 1EYCA 5E7NA 5HGQA 2F0NA 5E4WC 4OX9L 3HOWG 1U9RA 2N55A 2ZTDA 3FMCA 4ZQ3A 1SEBD 4DV4Q 2EYJA 5ELDA 4IFDJ 3ND9A 3U4VA 2Z4HA 3BVMA 4DU9A 1OXTA 1SYDA 1SE4A 3D4WA 5CBEE 3V2TA 3GTKH 1OXVA 4GN5A 3G48A 4DAYA 1TY2A 1HNZQ 1DOMA 2MO0A 2R3ZA 3CCVA 1HA5A 1SE2A 3PF5A 1GVPA 4DV1Q 5J3BA 4LF6Q 1UEBA 1S40A 3NE5B 4LF7Q 1PH8A 1LTLA 4LFAQ 4G57A 3GTQB 1A62A 2DNEA 4PQXA 5ELBA 4C3HB 2F0FA 2O5JC 2XIWA 4HJ5A 1VQPA 3HRZC 2FMCA 1BOSA 1GO3E 4A3JG 1K8GA 1JWSD 4A3EB 1H9JA 1A6XA 4WRDA 1SE3A 3T1HL 2E2JH 1VQ8A 4X66L 5LMUL 1EYDA 2E2JB 3OHXC 4FO2A 4JI7Q 4C3JB 3IKJA 2F0LA 2DN8A 2NVYH 5I9OA 4KHZA 4LW1A 5IGCA 4JI5Q 2BA1A 3PIOA 5IP7H 4A3BB 3S1QH 1HR0W 3K0XA 4ME5A 4PZ8A 4L5SA 1Y1VG 4LF9L 3FKIH 3FHWA 1KQSA 1N33L 1A3UA 2ZJQA 1SROA 5EBDA 2ZXPA 2F0PA 4IPDA 1LACA 2NVTB 3DXJC 3NBHA 2OTLA 4KJNA 3P7JA 1L0XB 1MI2A 4ZLTF 1B7YB 2XN9C 3J81L 4X62L 4YY3Q 1PVOA 4DGZA 1FYCA 4KHPQ 5JJLA 1GUGA 2KHJA 2K5HA 2B63G 1AFPA 4G7OC 1PH4A 1IBKL 4B3RQ 1MKHA 4NXML 1OTCA 5C44G 4HCEA 4X3KA 4CJ1B 3OMCA 3VDYA 4H02A 2F0VA 2YTXA 4X66Q 5LMNQ 3UDFA 1XPOA 2ZTCA 1EEFD 3K57A 4KKTA 1PZJD 1AW7A 3DM1A 4JI5L 5M3FH 4B3SL 2KEEA 1D8LA 1N32Q 4LF8Q 1HZCA 3N52A 2ZTEA 2VQFQ 1CSQA 1CI3M 4OO1G 2GN5A 4H7BA 2PMZB 4JI8Q 4GOPA 2N49A 2JA8H 1P16A 1PH5A 1I94L 1ASYA 2V1CC 1Q8IA 2EZVA 4WJ4A 4DR5L 1YNXA 2K03A 5IYCG 2CKZB 2B2UC 4L63B 4R1JA 3GTLH 3GP7A 2OF1A 3H09A 3HKZB 4CBVA 3S15B 1XPRA 1SNCA 2EXZA 1PH3A 2R93H 2HCIA 1EOTA 5KIXA 3PIPA 3OIQA 5GROA 1EFWA 2LSSA 2CFMA 2B2TA 4XIGS 1PA6A 5DNFA 3LX0A 4DR3Q 2BH2A 4RKBA 5IT9L 2F52A 5G3LD 2HQEA 2EVBA 5ELEA 3HOUB 3TSSA 4C2MH 4B3SQ 3HOYH 1X3PA 2LS01 5C4JB 2A68C 3HOUH 2AWNA 5FLMH 2PW5A 1KDAA 3R93A 3W1BA 1MD2D 1HH2P 2F3WA 2YV5A 4KKSA 5IOCA 2P5ZX 1TS3A 1SNDA 4N8X1 3KF6A 4LFAL 3AU7A 2XSCA 2KOLA 1G91A 1PTOB 2K5WA 4DR3L 1QUQB 5AJ3Q 4GKKL 1F77A 4A3MH 3SK5A 2DY7A 2VL6A 1JWUD 4DK1A 1BXTA 4DV7L 1HQRD 3T13A 4BBRG 1PHJA 3MZ5A 3ULLA 4LAAA 3SE0A 5JOBA 3GTJH 3UI2A 1EOVA 1VQEA 2G9HD 3A74A 2E2IB 2VUMG 1SJHD 1YNJD 4C3JH 2GVBA 1C9OA 4L5QA 1V8QA 4GNXC 2IX0A 1GUSA 3S1RH 4YIJA 3SK6A 1X54A 4UPAA 2Q2TA 3NP8A 5NUCA 5I2XA 1HZAA 2B8FA 3S1RB 1TWFH 1BCPB 4KK7A 1LT5D 4JPBW 1FGBD 2EY5A 4I7ZC 2IT1A 1Y8OB 2N88A 1TIID 1MSGA 1E0BA 1MIUA 3AMUA 2IX1A 1PV4A 2HCCA 3J81c 1GHJA 5T1IA 3DEOA 4APVA 1EIGA 3HKZG 1IKLA 1YVCA 4IJHA 4CHTB 1EIHA 1GHKA 2UUAL 1ZKOA 4DR7Q 3M7NA 1PRTB 3LGJA 1IYUA 1H9MA 5C4ZA 2RF4A 4AQYQ 1S4ZA 1YEZA 1CHPD 1TU2B 1W3SA 4J15A 4P2CB 4DN4M 1JB7A 1STBA 1VQ4A 5IP9H 4IFDH 3GQBA 1TS5A 2Z6BA 3K58A 4K14A 3VR4A 2M9VA 1HTPA 1VQFA 3TP6A 4A3FB 2FJ2A 1EY7A 2WIIB 4CJ0B 3H0GG 2AKWB 3F2CA 1F2MA 1DOKA 1KDBA 4A3JH 2XWBB 2JA5G 2MUYA 3J80E 3GDEA 4POGA 4KTAA 4QUCA 3VR3A 4A3MB 4BWGB 2YU9H 1HUMA 1T5EA 1CKMA 1PYWD 4QIWE 2HHHL 3I4MG 2F3IA 4HSPA 1SLJA 3VA5A 1UE5A 1XYIA 1K83B 3SHLA 2YTYA 4J1MA 1Z6HA 5JVH3 2R6GA 4GOPB 4OWWB 3CMAA 1RTNA 2HIVA 2RHSB 1PH2A 1PH7A 2B2YA 4A3GB 2J4XA 2ICIA 2KENA 5FLXc 4P71A 1EY5A 2E5LL 4X3UA 3L3OC 5IYCH 2CVRA 1AEXA 2XWJB 2JSOA 3W5OA 2EXDA 1EEID 2MPMA 5IGEA 1I4RA 1B2TA 3H3VH 2F0MA 2JXMB 1BO0A 1CZWA 2M2LA 3WOEA 2Q8RE 2LXJA 3RZDH 4LF4Q 4NKLA 3M4OH 2XVSA 3CXCA 3H0GB 3S14H 4PMWA 2WAQG 1J5EL 1EY0A 5FO7B 4J6HA 2NN6H 4DV1L 3AYHB 1XPUA 4XQJA 2K05A 4YCWA 1ILQA 1XMOQ 1Q90A 2JA8G 4A3KH 1UUPA 1KD1C 1KNAA 1O7ZA 1Q1BA 1RL2A 2ZM6L 4A93H 2NVXH 2PZTA 4A76A 1GUTA 4LFBL 2RA4A 1YIJA 1N33Q 3K5NA 4JI3Q 1X3FA 1C48A 3PMFA 4ZAIA 1VQ5A 1YNNC 1OXUA 2Y0SB 1SFOH 1U4MA 4A3IG 3EN2A 3E0JA 3BS1A 1EY6A 1I4HA 3N6RA 1K83H 1OXSC 1SYEA 1AP0A 4C3JG 4UP9A 5KYLA 3H91A 3AEVA 3P75A 3P20A 1B1ZA 1G2SA 5M5YH 2HUGA 1F9SA 2B8GA 4B9XA 4R8IA 1Q82C 1GJXA 3CCUA 1YHBA 1PRTF 2KEDA 3JAMi 5IYBH 4LUOA 2RCNA 3VA7A 2TMPA 5DM73 4DR7L 1I3QB 1B3AA 3E6ZX 1LTRD 4IUNA 4NXNQ 5EAYA 2JA6B 4NMZA 1KL9A 1QNUA 4BY1H 1VQKA 4JYAL 1U0LA 1CKNA 4O42A 1B70B 3M7GA 1TY0A 1MJEA 1QILA 1KC8C 3IFDA 3HOYB 4JI0Q 3T56B 1FNVA 2MNAA 4JV5Q 5IY0A 2PQAB 2F3VA 3M3YH 2MQHA 3NELA 4DK6C 4HJAA 3PUWA 4UAIA 3SK4A 1XTCD 4DFAA 1CK1A 3TZUA 3RN2A 1NR2A 2F0OA 1HNXL 1JORA 2ICEC 1D5XC 2JP1A 1N32L 2L15A 1A15A 4F87A 1I4PA 1IBML 5DAUA 1EQVA 1XJVA 2B2WA 2G9DA 4LF4L 4PV1C 2NVYB 1DGSA 2VB3X 1VMPA 4IFDI 3H3VC 3FPUB 2B2WC 3NENA 4ZKBB 4DR1L 1VQCA 4ABNA 3KDFB 2QGQA 4UDUC 1QZGA 1RCVD 2OEOA 1RTOA 4IUPA 1EIFA 4IJLA 4QJFA 3DEPA 2O4XA 4B3ML 1S5CD 4DA2A 2NVTH 2LKVA 1PFBA 4UY8C 2HQLA 1S5ED 4KHPL 5IWAQ 1QWYA 4N9PA 3VR5A 4DV0L 1K28A 4HAEA 1NCVA 1QCBD 3MC0B 5IE8A 4OL7A 4LFBQ 3TZDA 3NPPA 4ODGA 4IURA 1MGSA 3K80C 3I91A 3HOWB 3VYRA 1IKMA 5C3EG 2TSSA 1SYGA 1LT3D 2A73B 4X62Q 3EVQA 1M8AA 3H0GH 2UXCQ 3EA6A 3TQYA 2UXDQ 2C9OA 1NMFA 4UP7A 3MA2B 3FDTA 1SFOB 1TWCB 4L8JA 1STHA 4DV5Q 1Q86C 4JW0A 1N34L 4XXEA 5IIFA 1QB5D 1EY8A 4WORA 5IP9G 4DNTB 1TWAB 2D2CC 2Q2UA 2Y0SG 3ULJA 1RHPA 1JR0D 1EQTA 1RKNA 4H44C 1CA6A 2KJXA 1YI2A 3RD4A 1JCKB 4BY7H 2R93B 2EYLA 1BR9A 1VQLA 1AH9A 3DLLA 1IZ6A 3K0YA 4CDFC 4X3TA 3MFYA 4K0KQ 2AMCB 2WKCA 1XX8A 5C0XH 4FXKC 4HMIA 3HS0C 4YCUA 2ZT9C 3MEHA 4LF7L 4KY6A 1EZ6A 1CFMA 4NXNL 4XYQA 2PCFB 5CV7A 2CQOA 2LXKA 3I70A 4U673 3BZCA 3A54A 1IYJB 3TS0A 4DV2L 2A74C 3CKIB 1GM5A 1XTDA 2VB2X 3VR6A 2ZJPA 2D62A 4KN7C 1Q3LA 3J7ZC 2JEAI 1G6PA 5BN4A 2CW0C 3OMGA 4C3HH 3OPOA 1U4RA 3S1NH 1VDZA 2ALYB 2K33A 4FNFA 1UE6A 4HEDA 1ESRA 2K6AA 3I90A 1LUZA 3C46A 1WD0A 2EY1A 4JI0L 3RN5A 3FVQA 3CCJA 3FRPB 5IYBG 4LFCQ 4HTHA 2F4VL 4CJ2C 4FDBA 5JJIA 2SDFA 1K3RA 1KLUD 4HN7A 2VXWA 2LMCB 5H1SE 5GAHC 1OO9B 3Q24A 4JOIA 5HURA 4IALA 4DV7Q 1X56A 1F2ZA 4JOIC 1L0WA 3EQLC 1YHQA 3GTJB 2JA6G 4XQNA 3NTHA 1DJRD 1FNWA 3HOVB 2WB1B 3NWTA 1YJNA 3HOVH 2GA4B 3I8ZA 3MXGA 3X3NA 2RVLA 2E75C 2K32A 2C5CA 4R4CA 5J39A 5IT9E 1VMCA 3HP3A 1RIPA 3CCSA 1ZXTA 3O13A 3KDFA 1C0AA 4QUFA 4ALPA 1FVIA 3QB3A 3Q22A 2MJ8A 1K8AC 3KJPA 1BF4A 3HOZG 5FLMG 4OGQC 4BS9A 3I4NH 2UXCL 1I4XA 2NYZD 4IPGA 2R7ZG 1I94Q 4EQ5A 2XNAC 2H5XA 2Z4IA 5D65A 4BBSG 2MO1A 2SEBD 4BBRH 3KBXA 1QNKA 3OYYA 3GTPH 5JJKA 3SR1A 1SN8A 2UXDL 5C4XB 4K8JA 1EUJA 3J81i 2I0QA 1EYAA 3FKIB 2R92G 1SXTA 3F2BA 5KNDA 1K3BC 4MHEA 2FXQA 1C8CA 1EIYB 3A8IE 2WFWA 4MTKA 4UP8A 1PLFA 2F0TA 2K04A 2G5DA 5JVG3 3CCMA 1Y1VH 1A0IA 3TEHB 1F9PA 4XT3B 1BDOA 3LWUA 3HKZE 4JI6L 4AQYL 1YNND 4DV6Q 2F0IA 5M3MH 1EWHA 4OIKA 1SNQA 4XDXA 1ONLA 4QGUA 3KK7A 4IO9A 2CQAA 4DV3Q 3G6EA 4NB3A 3VYTA 4K6DA 4POFA 2OQKA 1Y69U 1DXMA 1ET6A 2PI2E 5DEHA 1HNZL 4NXMQ 1DOLA 2CCZA 1CQFA 2Z1CA 3GTKB 1JJGA 3RZOH 1IBMQ 3IL8A 4HIMA 2QDBA 1BCPF 1DZ1A 4KD3A 3RZDB 1D5MC 1RODA 2A5HA 1M4VA 1S5BD 4CDDC 4LUVA 3L9AX 5LL6X 1E22A 1HNWQ 2K52A 1HPCA 1MJCA 5E4XA 1BCPD 1B44D 1W2BA 2RSOA 4B08A 1DD2A 4A3KB 1TWGH 1YZ6A 3BYYB 5CV9A 4AYBE 4LF5L 2PPBC 3BVGA 3UE1A 3SGIA 1JQYD 1FR3A 4TRDA 2B2VC 2JA7G 1RF2D 1SJED 5C0XI 1IHZA 1QOHA 1D1IA 4R4TA 1EL0A 2FFKB 1WCMH 3PO3B 1TQOA 1HHVA 5K36H 3D6CA 4YCVA 4TKOB 4YWMA 2EOTA 2NB0A 3S16B 3JAML 3DHQA 4QMGA 4O2DA 1TVXA 1ASZA 4R4OA 2PYKA 3D6WA 5I9PA 5C0XG 5CMDA 2QA4A 1QG7A 5M5XH 2ZM6Q 5E3FA 3UDGA 1IBKQ 3G6JB 1XNRL 1Q1EA 1PH9A 3QG1A 1S3OA 3R8BA 3W3AA 1SBBB 2EE1A 1JT8A 3GTPB 4JI1L 4OXPA 1TKWB 1XMOL 1I3QH 3UDXA 4OWXB 1U5KA 3S1NB 3CF5A 1I6HH 4PZ6A 4MN3A 2I5LX 1KABA 1JE4A 1H9KA 4AYBB 4A3MG 5EGTA 2KQ3A 4WJ3M 3KF8B 2IHFA 4IUQA 4K2KA 1STNA 2M00A 4JBJA 3E0EA 4G7ZC 2IPKD 2XGTA 1SYBA 2A69C 2H1EA 4DV3L 4A4IA 2QW7A 3A55A 3KBGA 3VYUA 4C3IH 3VYSA 2VQFL 4JI4L 2ATWA 1IW7C 2XTIA 3A0JA 3HOZH 4XTCS 1G8ZD 2X6LA 4GZYC 2KCMA 1B9NA 4M1UB 4GNXB 4Y7NH 1OXXK 4RA8A 2CW0D 2A6HC 3AFQA 1D1KA 1JJ2A 2XRQD 5C4XG 2X69A 1H9SB 1V1PB 2K14A 4GS3A 1R4PB 4OWTB 3JC66 1LTTD 2B29A 2EPBA 1DCZA 1O78A 2HD3A 3BU2A 1F2LA 5ELNA 1EQRA 2E74C 4PMCA 4ZYSA 5BN5A 4JV5L 4A3CH 3HOUG 3RMHA 3S17H 1LTGD 5M5WH 4ZK9B 3PUVA 4FF2A 4RFBA 2EJGC 3A7AB 4IUTA 1HFGA 3V05A 2B2TC 2NBFA 4JCVE 2F0UA 4A3JB 5M3FB 4I7AA 2Z6KC 5BR8Q 3OTOQ 2WV6D 3HOVG 3AFPA 3T51B 1ENCA 2VQEL 3S14B 4IUVA 1I6VC 1VQAA 3K6OA 4L5TA 5FO8B 2L12A 5GQOA 3I56A 1TXYA 1EY9A 4MNOA 4JK1C 1STEA 4C1NK 2F03A 5LMNL 4KN4C 4ZUIA 1R9TH 4X65L 5ISRA 2ES2A 1VQ7A 3A5ZB 4GLXA 5LMUQ 2JA7B 1P8LA 5M9OA 4LF6L 5BN3A 4HJ9A 2JA7H 3KF6B 3OOCA 1CSPA 1Z7TA 3U4ZA 5A2QL 1RDPD 5C6AA 3EFXD 2Z8LA 4OEMB 2IY5B 2RHQB 4QF4A 5CBAE 1BNZA 2QDLA 1VCIA 1KHIA 3SXHA 1GKHA 1J5EQ 2RDFA 4X3SA 1SNOA 2N3SA 1SRUA 2NN6I 2A19A 4OONA 4ILWA 2IJ0A 5EKIA 2IWHA 2K50A 4JI1Q 4DAVA 5FK9C 4Y52H 1SNMA 5K36G 4FF3A 1WYDA 1FGUA 4EQNA 1SAPA 3STBC 1YJ9A 1A2UA 3A8JE 2JJQA 2FINB 3KLSX 2CH4A 2K75A 4FXDA 4PMBA 3PUZA 3KUPA 3PF4A 5IYDG 3J81E 3PCOB 2K5NA 4F8MA 4M8AA 4X65Q 4ZKCB 1R9TB 1Y1WH 4X64L 4BA2I 4NP5A 1NAPA 3PIO3 1FNUA 4JI3L 3Q0AA 1SMXA 1HFNA 1SYCA 3PO2G 4O0AA 2AUJD 3GTMB 3J80L 3KLSA 4GN4B 4JC0A 4IPCA 5IODA 3D31A 4QL5A 4XYOA 1WTQA 3BG3A 4FF1A 1PTOD 2OQ0A 1HNWL 1E3PA 1LO5D 3J80c 3MAQA 4IOCA 2HHHQ 2F4VQ 3K59A 3RLOA 3MXUA 5C4HA 3M4PA 4DF7A 4HMJA 3S9WA 1I5FA 5DM63 4A3BH 1PTOH 1VF5C 5CGKA 4K2LA 1LLRD 2VQEQ 1R4QB 1LT6D 4BBSB
chains in the Genus database with same CATH topology
4AH6A 4X62L 4YY3Q 1V1QA 1XNQQ 2EQSA 1PVOA 3T1YQ 2CQOA 2LXKA 4KHPQ 4YWLA 5JJLA 2KHJA 1J6QA 2Q2HA 5JEAJ 4X64Q 2K5HA 4DK3C 3BZCA 2E5LQ 2B63G 1BVSA 1IYJB 3TS0A 1PH4A 4DV2L 1IBKL 4B3RQ 3J81j 3PO3G 4X6AH 1GM5A 1MKHA 4NXML 4A3BG 1XTDA 2ZJPA 1OTCA 2D62A 1VQ6A 4LFCL 5C44G 2JA6H 3J7ZC 4DUZQ 1HR0L 3KYHC 2JEAI 1G6PA 3VDYA 4C3HH 4P74A 4H02A 3S1NH 3D0FA 2YTXA 4X66Q 2ALYB 4LWCA 5LMNQ 1B8AA 3UDFA 1UE6A 4GKJQ 4IPHA 5DLQE 2ZTCA 1XPOA 3PSIA 1LYLA 1LUZA 2PI2A 1NBWA 3F1ZA 4JI5L 5M3FH 4B3SL 3CQZH 3RN5A 2IHEA 4JI0L 3K81C 1YITA 1N32Q 1D8LA 4A3FG 4JBMA 1X55A 2WB1G 3F8TA 4LF8Q 1YJWA 1HZCA 3PUXA 2ZTEA 2OWOA 4DR1Q 2VQFQ 1CSQA 4A3FH 4YHHL 3CCJA 2A1AA 4OO1G 2GN5A 5IYBG 5FJ8H 3RNUA 2JQOA 4LFCQ 2F4VL 2HIXA 4FDBA 4P72A 4JI8Q 4GOPA 2N49A 1K3RA 3GO5A 2JA8H 5JJIA 3F2DA 2GVAA 5H1SE 1P16A 5GAHC 2ZJRA 1PH5A 1I94L 1ASYA 2V1CC 4JOIA 2R7ZH 4WJ4A 4DR5L 1YNXA 3L0OA 5IYCG 2CKZB 4R1JA 3U58A 3GTLH 3STBD 4A3CG 4DV7Q 1X56A 4LUZA 2N78A 4JOIC 2UUBQ 1L0WA 1L2FA 5AJ3L 4GKKQ 1QVGA 1E24A 1YHQA 2R7FA 1XPRA 2PNHA 1IBLQ 2JA6G 1N36L 3GD7A 1KAWA 4LF5Q 1PH3A 3KFUA 2R93H 2R92H 3BZKA 1YJNA 3HOVH 3S2HH 2AWOA 1XNRQ 3PIPA 5GROA 4R4CA 4GNXA 4HJ8A 2LSSA 1EFWA 2CFMA 1RIPA 4XIGS 3CCSA 3ERSX 1PA6A 3CW2C 3KDFA 4A3DH 1C0AA 4ALPA 4GLVB 1NTGA 3TREA 1FVIA 3KJOA 4DR3Q 2BH2A 1BBUA 3ZJYC 1X3GA 2F52A 3S1MH 2UUBL 1K8AC 1VQGA 1XMQL 3KJPA 4A3EG 4C2MH 4B3SQ 3HOZG 2Z0SA 3HOYH 5FLMG 1CUKA 4JYAQ 3K7AH 3HOUH 3I4NH 2UXCL 2AWNA 4DR5Q 5FLMH 3CCRA 4IPGA 1GD7A 3W1BA 2EIFA 1I94Q 2R7ZG 1HH2P 1QVCA 4EQ5A 2YV5A 1QZHA 2H5XA 3PO3H 4EX5A 4NPSA 3KF6A 2VUMH 3CD6A 2KBNA 1Q12A 4LFAL 4DV6L 1YBYA 4DR3L 4BBSG 1QUQB 5AJ3Q 4GKKL 2MO1A 1D7QA 3UE0A 4A3MH 4BBRH 3PO2H 4IFDG 3GTPH 5JJKA 3OYYA 1PFSA 4HIOA 2VL6A 1SN8A 2UXDL 1CKOA 1X65A 1EUJA 3IRBA 1WCMG 4BBRG 3J81i 4DV7L 1PHJA 2I5MX 2I0QA 3ULLA 2R92G 3T1HQ 4JG2A 3L2PA 3F2BA 2FXQA 3GTJH 1EIYB 1EOVA 1VQEA 2PQAA 2WFWA 3A74A 2VUMG 4UP8A 3MEFA 1A8VA 3EIVA 3PUYA 2PMZE 1Y1VH 1A0IA 4C3JH 2GVBA 3H15A 3TEHB 3CCMA 1C9OA 4L5QA 4ME3A 4GNXC 2IX0A 5GAEC 4JI6L 3HKZE 4DAMA 3CCLA 3S16H 4AQYL 3S1RH 3KLWA 4DV6Q 1X54A 4UPAA 5M3MH 1TWHH 3I2ZA 2Q2TA 1VQNA 1HZAA 1X6OA 3L7ZC 1TWFH 1VQMA 1A63A 5GAGC 5JEAG 4RMFA 1VQ9A 4QGUA 4IO9A 2E2IH 1NJIC 1Q8KA 2CWAA 4DV3Q 1UE7A 2Z6KA 3G6EA 4NB3A 2IT1A 2C35B 4PG3A 1N8RC 4POFA 1G51A 4JBWA 1NMGA 1MIUA 3HOWH 2DGYA 2OQKA 5M3MG 1JE5A 2IX1A 4YWKA 1AE2A 1PV4A 4DR4Q 3TRZA 2YTVA 3J81c 2UU9Q 2PI2E 3CCEA 5IWAL 1HNZL 4APVA 4NXMQ 5IYDH 3HKZG 3I7FA 2CCZA 3EBEA 4B3RL 1JJGA 1YVCA 4IJHA 1PH1A 2E8GA 1IBMQ 2NZOA 2R7DA 1IL2A 2UUAL 3RZOH 4HIMA 1BBWA 4DR7Q 4YHHQ 3M7NA 4A3GH 3LGJA 2JE6I 4AQYQ 2RF4A 2ASBA 2WP8J 1YEZA 4J15A 1JMCA 1W3SA 3HOXG 1O7IA 1JB7A 4JI6Q 1L1OC 2JK8A 5IP9H 1VQDA 1VQ4A 4LUVA 4TQUS 4DUYQ 1VQFA 3UDIA 2KHIA 3H0GG 3RLNA 1E22A 1HNWQ 2AKWB 3F2CA 2K52A 4A3LH 3I4MH 1MJCA 3G4SA 3M9BA 4A3JH 4RG1A 1W2BA 1IXRA 1FL0A 4DR2L 2JA5G 4GN3B 1FJGQ 1TWGH 1YZ6A 4AYBE 4LF5L 2UXBL 2HT1A 3Q8DA 1E1TA 3GDEA 3UE1A 4POGA 4P75A 3SGIA 3ER0A 1QVFA 1Q81C 2BA0A 1YHAA 1Z47A 2YU9H 1HJPA 4JI7L 2JA7G 1L1OB 1CKMA 1UE1A 1Z9FA 4QIWE 4DAYB 4R4TA 4QY7A 5C0XI 2F3IA 2HHHL 3I4MG 2UUAQ 2VS1A 2VNUD 3K8AA 1WCMH 1SLJA 3A5UA 2VW9A 3CP0A 1UE5A 1WOCA 4YCVA 3M85A 3CAMA 1KXLA 2YTYA 4YWMA 4GOPB 5IT9c 2R6GA 3J80i 2UUCQ 3CMAA 4OWWB 2HIVA 2RHSB 1PH2A 1UWVA 3CC7A 4HJ7A 3DM3A 1PH7A 4A93G 4PZ7A 3PGZA 2JEBI 4O2DA 1ASZA 4R4OA 2KENA 5FLXc 4K0KL 5C0XG 3NEMA 2QA4A 4P71A 5M5XH 2ZM6Q 2AHOB 2CWPA 4DV2Q 3UDGA 2JA9A 1IBKQ 1XNRL 1EQQA 2E5LL 3OW2A 3E9IA 1Q1EA 1PH9A 3I4NG 1S3OA 3S15H 2WAQE 4A3IH 4MTNA 1JT8A 5IYCH 4B3TL 4JI1L 4OXPA 1XMQQ 1PH6A 1XMOL 1I3QH 4DR6L 3UDXA 3KOJA 1U5KA 4OWXB 3CF5A 2JA5H 1I6HH 3W5OA 5C44H 4PZ6A 2EXDA 2VY3A 3RR5A 2Y0SE 3CCQA 2UXBQ 2I5LX 1V9PA 2NZHA 4A3MG 3H3VH 1HZBA 3CMEA 1FJGL 3KF8B 3GTOH 2IHFA 4WJ3M 4DV0Q 2E2HH 2VZAA 3W1GA 4JBJA 3E0EA 4A3KG 2XGTA 1G291 4KI0A 1KRTA 3S2DH 4LF4Q 1AE3A 2LXJA 4DV3L 3RZDH 4A4IA 3JAMc 1XNQL 4JI2Q 4BXXG 4DV4L 4GKJL 3G71A 3M4OH 4C3IH 3J7A5 1IBLL 3CXCA 3K7UC 2VQFL 3S14H 4JI4L 4PMWA 2WAQG 5HY6A 1J5EL 2ATWA 3I55A 2XTIA 1H95A 3H3VI 4OX9Q 1CKNB 3A0JA 2QEXA 2K4KA 4DV1L 3FP9A 3AYHB 1XPUA 1E7ZA 3HOZH 4XTCS 1Q46A 4GLAC 1WI5A 2KCMA 4GNXB 4YCWA 5IP7G 5FJ8G 1OXXK 2K5VA 4Y7NH 1NE3A 4A3LG 4BXXH 4R4QA 3AFQA 1XMOQ 1T9HA 4B3MQ 4A3KH 4JI8L 1JJ2A 4B3TQ 2JA8G 5C4XG 2B63H 4LNQA 1E1OA 1KD1C 2K14A 1Q1BA 1RL2A 2ZM6L 4A93H 2NVXH 3HOXH 4GS3A 2UU9L 1N36Q 4A76A 4DR4L 4OWTB 3JC66 4L5RC 4LFBL 4DPGA 1YIJA 3CC4A 1N33Q 4JI4Q 1X3EA 2B29A 2R93G 4DR6Q 3B6YA 3BU2A 4JI3Q 4LF9Q 1X3FA 5C4JH 1VQ5A 5ELNA 2KCTA 1EQRA 1OXUA 1SFOH 1JJCB 5GADC 4JV5L 4A3CH 3M4QA 4A3IG 1VQIA 1X9NA 4BY7G 3EN2A 3HOUG 1VQJA 3S17H 1K83H 1OXSC 4BA1I 1K0RA 5M5WH 1K9MC 3PUVA 4UP9A 3AEVA 4A3DG 4DUYL 4DV5L 5M5YH 1N34Q 1Q82C 1C7YA 3ICEA 1AH9A 3CCUA 1YHBA 4JCVE 5LMNW 4HIKA 1V43A 2A8VA 3JAMi 5IYBH 2MFIA 4LUOA 1EWIA 2RCNA 3CPWA 4DR7L 2Q2IA 4DNIA 2Z6KC 4DR2Q 3GTGH 5BR8Q 3OTOQ 1VQOA 3HOVG 4GOPC 3AFPA 3AQQA 1VQHA 2OCEA 4YY3L 5EAYA 2VQEL 4NXNQ 4P73A 1KL9A 4BY1H 4JBKA 1VQKA 4JYAL 2BH8A 1U0LA 1VQAA 1Q7YC 3FKIG 1CKNA 5C0XJ 1B70B 2ID0A 4L5TA 4MZ9A 1MJEA 5GQOA 3I56A 3HOYG 1TXYA 1VQBA 4MNOA 4IOAA 1KIXA 1SR3A 3ULPA 1KC8C 4KLKA 3S24A 4JI0Q 4A3EH 4TVAB 3U50C 2MNAA 4JV5Q 3TS2A 5IY0A 2PQAB 1EYGA 1S72A 3M3YH 2MQHA 1NY4A 3NELA 1Y14B 4DK6C 5LMNL 3PUWA 4HIDA 4HJAA 3GTQH 4BBSH 1R9TH 4X65L 1WJJA 3HFZB 2WB1E 2ES2A 4A75A 3RN2A 1VQ7A 5M3FG 1HNXL 3A5ZB 3NBHB 2YYZA 4DUZL 1QUQA 4GLXA 1I50H 5LMUQ 1LM0A 1HR0Q 1N32L 1P8LA 2L15A 3E9HA 4LF6L 4HJ9A 2JA7H 2D0OA 3KF6B 1M1KC 1CSPA 1IBML 3U4ZA 1VS0A 2NN6G 2UUCL 1HZ9A 2D0PA 1TWAH 1XJVA 2IY5B 2RHQB 2DUDA 5BR8L 3OTOL 4AIMA 1M90C 4LF4L 1WFQA 3PV0A 2NVQH 4AYBG 3GTMH 1VCIA 1DGSA 1KHIA 4IFDI 3I4OA 4BY1G 1TWCH 5E7NA 5HGQA 3NENA 1GKHA 4LF8L 1J5EQ 4DR1L 3BJUA 4OX9L 1VQCA 3HOWG 2N3SA 1SRUA 3KDFB 2QGQA 1QZGA 2ZTDA 2NN6I 1HNXQ 2A19A 4DV4Q 4OONA 2K50A 4IFDJ 4JI1Q 3U4VA 1EIFA 4IJLA 4QJFA 4JI2L 1OXTA 5K36G 4B3ML 2NVTH 3WWVA 1WYDA 4UY8C 1FGUA 2HQLA 1OXVA 4GN5A 3G48A 1L1OA 3GTKH 3T1YL 4KHPL 5C4XH 3STBC 4R4IA 5IWAQ 1YJ9A 2MO0A 4DV0L 3RLFA 1HNZQ 3CCVA 3PF5A 2JJQA 4A3GG 1GVPA 4DV1Q 5J3BA 2K75A 1UEBA 1S40A 4LF6Q 3PUZA 2B3GA 5IE8A 1PYSB 4LFBQ 4QQBX 4LF7Q 1PH8A 3PF4A 5IYDG 1LTLA 4LFAQ 3K80C 4DKAC 1A62A 3PCOB 2K5NA 4OO1I 4X65Q 4HJ5A 1VQPA 5C3EG 1GO3E 1Y1WH 4A3JG 1SE8A 1K8GA 4X64L 4BA2I 4X62Q 3H0GH 2UXCQ 1N9WA 3T1HL 3TQYA 1VQ8A 2E2JH 2UXDQ 1NMFA 4X66L 4JI3L 5LMUL 1SMXA 4UP7A 3MXNB 4JI7Q 1PYBA 4DV5Q 1Q86C 1N34L 4O0AA 3PO2G 2NVYH 4KHZA 4LW1A 5IP9G 4GN4B 1Y1WG 4JI5Q 4JC0A 4IPCA 2BA1A 1BKBA 2Q2UA 2Y0SG 3ULJA 3D31A 3PIOA 5IP7H 3CC2A 4QL5A 3S1QH 1HR0W 5C3EH 3K0XA 1YI2A 1K73C 4PZ8A 4L5SA 2N8NA 4BY7H 1Y1VG 2OQ0A 1VQLA 3CPFA 1HNWL 4LF9L 3FKIH 1E3PA 1IZ6A 3FHWA 3HKSA 3J80c 3DLLA 4IOCA 1KQSA 2HHHQ 2F4VQ 1N33L 3RLOA 2ZJQA 1SROA 2AMCB 3M4PA 4K0KQ 2OTJA 4IPDA 2I5HA 1KRSA 4YCUA 1I5FA 4A3BH 2OTLA 4LF7L 5ELOA 4NXNL 2VQEQ 4Y52H 1B7YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AH6 A;  4X62 L;  4YY3 Q;  1V1Q A;  1XNQ Q;  2EQS A;  1PVO A;  3T1Y Q;  2CQO A;  2LXK A;  4KHP Q;  4YWL A;  5JJL A;  2KHJ A;  1J6Q A;  2Q2H A;  5JEA J;  4X64 Q;  2K5H A;  4DK3 C;  3BZC A;  2E5L Q;  2B63 G;  1BVS A;  1IYJ B;  3TS0 A;  1PH4 A;  4DV2 L;  1IBK L;  4B3R Q;  3J81 j;  3PO3 G;  4X6A H;  1GM5 A;  1MKH A;  4NXM L;  4A3B G;  1XTD A;  2ZJP A;  1OTC A;  2D62 A;  1VQ6 A;  4LFC L;  5C44 G;  2JA6 H;  3J7Z C;  4DUZ Q;  1HR0 L;  3KYH C;  2JEA I;  1G6P A;  3VDY A;  4C3H H;  4P74 A;  4H02 A;  3S1N H;  3D0F A;  2YTX A;  4X66 Q;  2ALY B;  4LWC A;  5LMN Q;  1B8A A;  3UDF A;  1UE6 A;  4GKJ Q;  4IPH A;  5DLQ E;  2ZTC A;  1XPO A;  3PSI A;  1LYL A;  1LUZ A;  2PI2 A;  1NBW A;  3F1Z A;  4JI5 L;  5M3F H;  4B3S L;  3CQZ H;  3RN5 A;  2IHE A;  4JI0 L;  3K81 C;  1YIT A;  1N32 Q;  1D8L A;  4A3F G;  4JBM A;  1X55 A;  2WB1 G;  3F8T A;  4LF8 Q;  1YJW A;  1HZC A;  3PUX A;  2ZTE A;  2OWO A;  4DR1 Q;  2VQF Q;  1CSQ A;  4A3F H;  4YHH L;  3CCJ A;  2A1A A;  4OO1 G;  2GN5 A;  5IYB G;  5FJ8 H;  3RNU A;  2JQO A;  4LFC Q;  2F4V L;  2HIX A;  4FDB A;  4P72 A;  4JI8 Q;  4GOP A;  2N49 A;  1K3R A;  3GO5 A;  2JA8 H;  5JJI A;  3F2D A;  2GVA A;  5H1S E;  1P16 A;  5GAH C;  2ZJR A;  1PH5 A;  1I94 L;  1ASY A;  2V1C C;  4JOI A;  2R7Z H;  4WJ4 A;  4DR5 L;  1YNX A;  3L0O A;  5IYC G;  2CKZ B;  4R1J A;  3U58 A;  3GTL H;  3STB D;  4A3C G;  4DV7 Q;  1X56 A;  4LUZ A;  2N78 A;  4JOI C;  2UUB Q;  1L0W A;  1L2F A;  5AJ3 L;  4GKK Q;  1QVG A;  1E24 A;  1YHQ A;  2R7F A;  1XPR A;  2PNH A;  1IBL Q;  2JA6 G;  1N36 L;  3GD7 A;  1KAW A;  4LF5 Q;  1PH3 A;  3KFU A;  2R93 H;  2R92 H;  3BZK A;  1YJN A;  3HOV H;  3S2H H;  2AWO A;  1XNR Q;  3PIP A;  5GRO A;  4R4C A;  4GNX A;  4HJ8 A;  2LSS A;  1EFW A;  2CFM A;  1RIP A;  4XIG S;  3CCS A;  3ERS X;  1PA6 A;  3CW2 C;  3KDF A;  4A3D H;  1C0A A;  4ALP A;  4GLV B;  1NTG A;  3TRE A;  1FVI A;  3KJO A;  4DR3 Q;  2BH2 A;  1BBU A;  3ZJY C;  1X3G A;  2F52 A;  3S1M H;  2UUB L;  1K8A C;  1VQG A;  1XMQ L;  3KJP A;  4A3E G;  4C2M H;  4B3S Q;  3HOZ G;  2Z0S A;  3HOY H;  5FLM G;  1CUK A;  4JYA Q;  3K7A H;  3HOU H;  3I4N H;  2UXC L;  2AWN A;  4DR5 Q;  5FLM H;  3CCR A;  4IPG A;  1GD7 A;  3W1B A;  2EIF A;  1I94 Q;  2R7Z G;  1HH2 P;  1QVC A;  4EQ5 A;  2YV5 A;  1QZH A;  2H5X A;  3PO3 H;  4EX5 A;  4NPS A;  3KF6 A;  2VUM H;  3CD6 A;  2KBN A;  1Q12 A;  4LFA L;  4DV6 L;  1YBY A;  4DR3 L;  4BBS G;  1QUQ B;  5AJ3 Q;  4GKK L;  2MO1 A;  1D7Q A;  3UE0 A;  4A3M H;  4BBR H;  3PO2 H;  4IFD G;  3GTP H;  5JJK A;  3OYY A;  1PFS A;  4HIO A;  2VL6 A;  1SN8 A;  2UXD L;  1CKO A;  1X65 A;  1EUJ A;  3IRB A;  1WCM G;  4BBR G;  3J81 i;  4DV7 L;  1PHJ A;  2I5M X;  2I0Q A;  3ULL A;  2R92 G;  3T1H Q;  4JG2 A;  3L2P A;  3F2B A;  2FXQ A;  3GTJ H;  1EIY B;  1EOV A;  1VQE A;  2PQA A;  2WFW A;  3A74 A;  2VUM G;  4UP8 A;  3MEF A;  1A8V A;  3EIV A;  3PUY A;  2PMZ E;  1Y1V H;  1A0I A;  4C3J H;  2GVB A;  3H15 A;  3TEH B;  3CCM A;  1C9O A;  4L5Q A;  4ME3 A;  4GNX C;  2IX0 A;  5GAE C;  4JI6 L;  3HKZ E;  4DAM A;  3CCL A;  3S16 H;  4AQY L;  3S1R H;  3KLW A;  4DV6 Q;  1X54 A;  4UPA A;  5M3M H;  1TWH H;  3I2Z A;  2Q2T A;  1VQN A;  1HZA A;  1X6O A;  3L7Z C;  1TWF H;  1VQM A;  1A63 A;  5GAG C;  5JEA G;  4RMF A;  1VQ9 A;  4QGU A;  4IO9 A;  2E2I H;  1NJI C;  1Q8K A;  2CWA A;  4DV3 Q;  1UE7 A;  2Z6K A;  3G6E A;  4NB3 A;  2IT1 A;  2C35 B;  4PG3 A;  1N8R C;  4POF A;  1G51 A;  4JBW A;  1NMG A;  1MIU A;  3HOW H;  2DGY A;  2OQK A;  5M3M G;  1JE5 A;  2IX1 A;  4YWK A;  1AE2 A;  1PV4 A;  4DR4 Q;  3TRZ A;  2YTV A;  3J81 c;  2UU9 Q;  2PI2 E;  3CCE A;  5IWA L;  1HNZ L;  4APV A;  4NXM Q;  5IYD H;  3HKZ G;  3I7F A;  2CCZ A;  3EBE A;  4B3R L;  1JJG A;  1YVC A;  4IJH A;  1PH1 A;  2E8G A;  1IBM Q;  2NZO A;  2R7D A;  1IL2 A;  2UUA L;  3RZO H;  4HIM A;  1BBW A;  4DR7 Q;  4YHH Q;  3M7N A;  4A3G H;  3LGJ A;  2JE6 I;  4AQY Q;  2RF4 A;  2ASB A;  2WP8 J;  1YEZ A;  4J15 A;  1JMC A;  1W3S A;  3HOX G;  1O7I A;  1JB7 A;  4JI6 Q;  1L1O C;  2JK8 A;  5IP9 H;  1VQD A;  1VQ4 A;  4LUV A;  4TQU S;  4DUY Q;  1VQF A;  3UDI A;  2KHI A;  3H0G G;  3RLN A;  1E22 A;  1HNW Q;  2AKW B;  3F2C A;  2K52 A;  4A3L H;  3I4M H;  1MJC A;  3G4S A;  3M9B A;  4A3J H;  4RG1 A;  1W2B A;  1IXR A;  1FL0 A;  4DR2 L;  2JA5 G;  4GN3 B;  1FJG Q;  1TWG H;  1YZ6 A;  4AYB E;  4LF5 L;  2UXB L;  2HT1 A;  3Q8D A;  1E1T A;  3GDE A;  3UE1 A;  4POG A;  4P75 A;  3SGI A;  3ER0 A;  1QVF A;  1Q81 C;  2BA0 A;  1YHA A;  1Z47 A;  2YU9 H;  1HJP A;  4JI7 L;  2JA7 G;  1L1O B;  1CKM A;  1UE1 A;  1Z9F A;  4QIW E;  4DAY B;  4R4T A;  4QY7 A;  5C0X I;  2F3I A;  2HHH L;  3I4M G;  2UUA Q;  2VS1 A;  2VNU D;  3K8A A;  1WCM H;  1SLJ A;  3A5U A;  2VW9 A;  3CP0 A;  1UE5 A;  1WOC A;  4YCV A;  3M85 A;  3CAM A;  1KXL A;  2YTY A;  4YWM A;  4GOP B;  5IT9 c;  2R6G A;  3J80 i;  2UUC Q;  3CMA A;  4OWW B;  2HIV A;  2RHS B;  1PH2 A;  1UWV A;  3CC7 A;  4HJ7 A;  3DM3 A;  1PH7 A;  4A93 G;  4PZ7 A;  3PGZ A;  2JEB I;  4O2D A;  1ASZ A;  4R4O A;  2KEN A;  5FLX c;  4K0K L;  5C0X G;  3NEM A;  2QA4 A;  4P71 A;  5M5X H;  2ZM6 Q;  2AHO B;  2CWP A;  4DV2 Q;  3UDG A;  2JA9 A;  1IBK Q;  1XNR L;  1EQQ A;  2E5L L;  3OW2 A;  3E9I A;  1Q1E A;  1PH9 A;  3I4N G;  1S3O A;  3S15 H;  2WAQ E;  4A3I H;  4MTN A;  1JT8 A;  5IYC H;  4B3T L;  4JI1 L;  4OXP A;  1XMQ Q;  1PH6 A;  1XMO L;  1I3Q H;  4DR6 L;  3UDX A;  3KOJ A;  1U5K A;  4OWX B;  3CF5 A;  2JA5 H;  1I6H H;  3W5O A;  5C44 H;  4PZ6 A;  2EXD A;  2VY3 A;  3RR5 A;  2Y0S E;  3CCQ A;  2UXB Q;  2I5L X;  1V9P A;  2NZH A;  4A3M G;  3H3V H;  1HZB A;  3CME A;  1FJG L;  3KF8 B;  3GTO H;  2IHF A;  4WJ3 M;  4DV0 Q;  2E2H H;  2VZA A;  3W1G A;  4JBJ A;  3E0E A;  4A3K G;  2XGT A;  1G29 1;  4KI0 A;  1KRT A;  3S2D H;  4LF4 Q;  1AE3 A;  2LXJ A;  4DV3 L;  3RZD H;  4A4I A;  3JAM c;  1XNQ L;  4JI2 Q;  4BXX G;  4DV4 L;  4GKJ L;  3G71 A;  3M4O H;  4C3I H;  3J7A 5;  1IBL L;  3CXC A;  3K7U C;  2VQF L;  3S14 H;  4JI4 L;  4PMW A;  2WAQ G;  5HY6 A;  1J5E L;  2ATW A;  3I55 A;  2XTI A;  1H95 A;  3H3V I;  4OX9 Q;  1CKN B;  3A0J A;  2QEX A;  2K4K A;  4DV1 L;  3FP9 A;  3AYH B;  1XPU A;  1E7Z A;  3HOZ H;  4XTC S;  1Q46 A;  4GLA C;  1WI5 A;  2KCM A;  4GNX B;  4YCW A;  5IP7 G;  5FJ8 G;  1OXX K;  2K5V A;  4Y7N H;  1NE3 A;  4A3L G;  4BXX H;  4R4Q A;  3AFQ A;  1XMO Q;  1T9H A;  4B3M Q;  4A3K H;  4JI8 L;  1JJ2 A;  4B3T Q;  2JA8 G;  5C4X G;  2B63 H;  4LNQ A;  1E1O A;  1KD1 C;  2K14 A;  1Q1B A;  1RL2 A;  2ZM6 L;  4A93 H;  2NVX H;  3HOX H;  4GS3 A;  2UU9 L;  1N36 Q;  4A76 A;  4DR4 L;  4OWT B;  3JC6 6;  4L5R C;  4LFB L;  4DPG A;  1YIJ A;  3CC4 A;  1N33 Q;  4JI4 Q;  1X3E A;  2B29 A;  2R93 G;  4DR6 Q;  3B6Y A;  3BU2 A;  4JI3 Q;  4LF9 Q;  1X3F A;  5C4J H;  1VQ5 A;  5ELN A;  2KCT A;  1EQR A;  1OXU A;  1SFO H;  1JJC B;  5GAD C;  4JV5 L;  4A3C H;  3M4Q A;  4A3I G;  1VQI A;  1X9N A;  4BY7 G;  3EN2 A;  3HOU G;  1VQJ A;  3S17 H;  1K83 H;  1OXS C;  4BA1 I;  1K0R A;  5M5W H;  1K9M C;  3PUV A;  4UP9 A;  3AEV A;  4A3D G;  4DUY L;  4DV5 L;  5M5Y H;  1N34 Q;  1Q82 C;  1C7Y A;  3ICE A;  1AH9 A;  3CCU A;  1YHB A;  4JCV E;  5LMN W;  4HIK A;  1V43 A;  2A8V A;  3JAM i;  5IYB H;  2MFI A;  4LUO A;  1EWI A;  2RCN A;  3CPW A;  4DR7 L;  2Q2I A;  4DNI A;  2Z6K C;  4DR2 Q;  3GTG H;  5BR8 Q;  3OTO Q;  1VQO A;  3HOV G;  4GOP C;  3AFP A;  3AQQ A;  1VQH A;  2OCE A;  4YY3 L;  5EAY A;  2VQE L;  4NXN Q;  4P73 A;  1KL9 A;  4BY1 H;  4JBK A;  1VQK A;  4JYA L;  2BH8 A;  1U0L A;  1VQA A;  1Q7Y C;  3FKI G;  1CKN A;  5C0X J;  1B70 B;  2ID0 A;  4L5T A;  4MZ9 A;  1MJE A;  5GQO A;  3I56 A;  3HOY G;  1TXY A;  1VQB A;  4MNO A;  4IOA A;  1KIX A;  1SR3 A;  3ULP A;  1KC8 C;  4KLK A;  3S24 A;  4JI0 Q;  4A3E H;  4TVA B;  3U50 C;  2MNA A;  4JV5 Q;  3TS2 A;  5IY0 A;  2PQA B;  1EYG A;  1S72 A;  3M3Y H;  2MQH A;  1NY4 A;  3NEL A;  1Y14 B;  4DK6 C;  5LMN L;  3PUW A;  4HID A;  4HJA A;  3GTQ H;  4BBS H;  1R9T H;  4X65 L;  1WJJ A;  3HFZ B;  2WB1 E;  2ES2 A;  4A75 A;  3RN2 A;  1VQ7 A;  5M3F G;  1HNX L;  3A5Z B;  3NBH B;  2YYZ A;  4DUZ L;  1QUQ A;  4GLX A;  1I50 H;  5LMU Q;  1LM0 A;  1HR0 Q;  1N32 L;  1P8L A;  2L15 A;  3E9H A;  4LF6 L;  4HJ9 A;  2JA7 H;  2D0O A;  3KF6 B;  1M1K C;  1CSP A;  1IBM L;  3U4Z A;  1VS0 A;  2NN6 G;  2UUC L;  1HZ9 A;  2D0P A;  1TWA H;  1XJV A;  2IY5 B;  2RHQ B;  2DUD A;  5BR8 L;  3OTO L;  4AIM A;  1M90 C;  4LF4 L;  1WFQ A;  3PV0 A;  2NVQ H;  4AYB G;  3GTM H;  1VCI A;  1DGS A;  1KHI A;  4IFD I;  3I4O A;  4BY1 G;  1TWC H;  5E7N A;  5HGQ A;  3NEN A;  1GKH A;  4LF8 L;  1J5E Q;  4DR1 L;  3BJU A;  4OX9 L;  1VQC A;  3HOW G;  2N3S A;  1SRU A;  3KDF B;  2QGQ A;  1QZG A;  2ZTD A;  2NN6 I;  1HNX Q;  2A19 A;  4DV4 Q;  4OON A;  2K50 A;  4IFD J;  4JI1 Q;  3U4V A;  1EIF A;  4IJL A;  4QJF A;  4JI2 L;  1OXT A;  5K36 G;  4B3M L;  2NVT H;  3WWV A;  1WYD A;  4UY8 C;  1FGU A;  2HQL A;  1OXV A;  4GN5 A;  3G48 A;  1L1O A;  3GTK H;  3T1Y L;  4KHP L;  5C4X H;  3STB C;  4R4I A;  5IWA Q;  1YJ9 A;  2MO0 A;  4DV0 L;  3RLF A;  1HNZ Q;  3CCV A;  3PF5 A;  2JJQ A;  4A3G G;  1GVP A;  4DV1 Q;  5J3B A;  2K75 A;  1UEB A;  1S40 A;  4LF6 Q;  3PUZ A;  2B3G A;  5IE8 A;  1PYS B;  4LFB Q;  4QQB X;  4LF7 Q;  1PH8 A;  3PF4 A;  5IYD G;  1LTL A;  4LFA Q;  3K80 C;  4DKA C;  1A62 A;  3PCO B;  2K5N A;  4OO1 I;  4X65 Q;  4HJ5 A;  1VQP A;  5C3E G;  1GO3 E;  1Y1W H;  4A3J G;  1SE8 A;  1K8G A;  4X64 L;  4BA2 I;  4X62 Q;  3H0G H;  2UXC Q;  1N9W A;  3T1H L;  3TQY A;  1VQ8 A;  2E2J H;  2UXD Q;  1NMF A;  4X66 L;  4JI3 L;  5LMU L;  1SMX A;  4UP7 A;  3MXN B;  4JI7 Q;  1PYB A;  4DV5 Q;  1Q86 C;  1N34 L;  4O0A A;  3PO2 G;  2NVY H;  4KHZ A;  4LW1 A;  5IP9 G;  4GN4 B;  1Y1W G;  4JI5 Q;  4JC0 A;  4IPC A;  2BA1 A;  1BKB A;  2Q2U A;  2Y0S G;  3ULJ A;  3D31 A;  3PIO A;  5IP7 H;  3CC2 A;  4QL5 A;  3S1Q H;  1HR0 W;  5C3E H;  3K0X A;  1YI2 A;  1K73 C;  4PZ8 A;  4L5S A;  2N8N A;  4BY7 H;  1Y1V G;  2OQ0 A;  1VQL A;  3CPF A;  1HNW L;  4LF9 L;  3FKI H;  1E3P A;  1IZ6 A;  3FHW A;  3HKS A;  3J80 c;  3DLL A;  4IOC A;  1KQS A;  2HHH Q;  2F4V Q;  1N33 L;  3RLO A;  2ZJQ A;  1SRO A;  2AMC B;  3M4P A;  4K0K Q;  2OTJ A;  4IPD A;  2I5H A;  1KRS A;  4YCU A;  1I5F A;  4A3B H;  2OTL A;  4LF7 L;  5ELO A;  4NXN L;  2VQE Q;  4Y52 H;  1B7Y B; 
#chains in the Genus database with same CATH topology
 4AH6 A;  4RAU C;  5JPN C;  1XNQ Q;  2EQS A;  3T1Y Q;  2K7V A;  4ID6 A;  2Q2H A;  4K8I A;  3SK8 A;  4DK3 C;  1BVS A;  2NUC A;  2R7Z B;  3PO3 G;  4X6A H;  2KVM A;  1CT1 D;  4IZ8 A;  4RCN A;  5CYU A;  1VQ6 A;  2RCF A;  4U68 A;  1GUO A;  1Y1W B;  2PQE A;  5FLX E;  2L4N A;  3D0F A;  2FHT A;  1PZI D;  2L0C A;  1JOQ A;  1B8A A;  4IPH A;  5DLQ E;  3PSI A;  1LYL A;  3OWF A;  3ZYY X;  4O1N A;  2PI2 A;  3F1Z A;  5C5L A;  1DM0 B;  1O80 A;  3CQZ H;  2IHE A;  3BDC A;  1YIT A;  2PO4 A;  4JBM A;  1X55 A;  2WB1 G;  1PDQ A;  3F8T A;  3SDZ A;  3PUX A;  4Q0F A;  4C1N I;  4DR1 Q;  4A3F H;  1ET9 A;  4YHH L;  2A1A A;  5FJ8 H;  2JQO A;  4QB4 A;  4P72 A;  2QEJ C;  3GO5 A;  2EY6 A;  2KCC A;  2WKD A;  4C3I B;  3F2D A;  1MSH A;  1G6Z A;  1TS4 A;  3L0O A;  4K5V A;  4KD4 A;  2MHV A;  4ZRZ A;  5TSS A;  3NXW A;  4LUZ A;  2N78 A;  2H4O A;  4C3I G;  1GUN A;  1L2F A;  1W6K A;  1E24 A;  1JWM D;  1N36 L;  1AN8 A;  3GD7 A;  1LT4 D;  4KHV A;  2BCO A;  1HRJ A;  2WAQ B;  4Y7N B;  3BZK A;  4QCL A;  4FF4 A;  2QIL A;  2AWO A;  1QJO A;  4H0L C;  1XNR Q;  3NQT A;  1AZP A;  4GNX A;  4HJ8 A;  3I72 A;  4KJO A;  5HGT A;  3CW2 C;  1HUN A;  2L9H A;  3TRE A;  1NTG A;  3KJO A;  1V1O A;  1SSO A;  1BBU A;  2NTS A;  1X3G A;  5IGG A;  2EYP A;  4DXF A;  1WTO A;  2UUB L;  3S1M H;  1JC7 A;  3K7A B;  2AUK A;  2RQX A;  5LL6 S;  4A3E G;  4E6I A;  1XMQ L;  4JYA Q;  3VR2 A;  3K7A H;  3QOL A;  4ZUJ A;  2IL8 A;  4R8N A;  1WTX A;  2EIF A;  2EJM A;  4DAP A;  1QVC A;  1KDC A;  2DNC A;  3CD6 A;  2BE5 D;  1Q12 A;  2KBN A;  4DV6 L;  4WJW A;  3NTI A;  3MXP A;  1GXD C;  2A6H D;  1PFS A;  4HIO A;  1ENF A;  2I5M X;  4IUU A;  1ILP A;  1E2W A;  4JG2 A;  5CV6 A;  3TBI B;  3L2P A;  4R9W A;  3G7L A;  2HDL A;  1O7L A;  1E2Z A;  1TWF B;  1A8V A;  2I46 A;  3EIV A;  2PMZ E;  3OIP A;  4ME3 A;  4RGO S;  3KLR A;  3CCL A;  3S16 H;  5JPM C;  1VQN A;  1TWH H;  2EYM A;  1WVL A;  2B39 A;  4V19 0;  1A63 A;  5JEA G;  4LJZ C;  3E5S A;  4RMF A;  1VQ9 A;  4FYD A;  1Q8K A;  1QE6 A;  1UE7 A;  2Z6K A;  2C35 B;  1N8R C;  1ICW A;  3QIA A;  1G51 A;  4JBW A;  1NMG A;  2B2V A;  5IGF A;  5M3M G;  1BBX C;  4YWK A;  1AE2 A;  3OSO A;  3TRZ A;  2VUM B;  2UU9 Q;  3CCE A;  5IWA L;  1DON A;  3I7F A;  3EBE A;  5EPJ A;  3GV3 A;  3V96 A;  3QO2 A;  2E8G A;  1IL2 A;  2LY7 A;  1BBW A;  4YHH Q;  4A3G H;  3BVZ A;  4FXG C;  2JE6 I;  5CR3 A;  5JJZ A;  3C1F A;  1JMC A;  1O7I A;  4JI6 Q;  3TN2 A;  2PW7 A;  1VQD A;  2Z9H A;  3MXN A;  5D3I B;  3S1M B;  4TQU S;  1PMR A;  3UDI A;  4CDE C;  2OXP A;  1MBY A;  1WTV A;  3RLN A;  1T5X D;  3EJI A;  4BY1 B;  2YU9 B;  4A3L H;  1PFN A;  5EPK A;  3S2H B;  4KY7 A;  1FL0 A;  4DR2 L;  1UNS A;  3PO2 B;  4EVO A;  3GTG B;  2UXB L;  4KV6 A;  4P75 A;  1SNP A;  1YHA A;  2OT2 A;  1Z47 A;  1HCZ A;  4RH6 A;  3NUC A;  4XQQ A;  1HJP A;  1HTL D;  5M5X B;  1L1O B;  1UE1 A;  1Z9F A;  1WTP A;  3S15 H;  4QY7 A;  1IW7 D;  2RDG A;  2VS1 A;  5AFW A;  1S5D D;  2IX3 A;  3A5U A;  3M4O B;  5IT9 c;  1LTI D;  1UWV A;  3W2D A;  3DM3 A;  2AQ3 B;  4DXG A;  3J7A V;  1U4L A;  5FKA C;  1WCM B;  2K5Q A;  4H13 C;  3T16 A;  2F0G A;  2RBM A;  2FMM A;  1A2T A;  4RKL A;  4DNR B;  2AHO B;  3HG9 A;  4DV2 Q;  2JA9 A;  1EWC A;  1EQQ A;  3FEW X;  3X3M A;  1EU4 A;  5CV4 A;  3I4N G;  2KCN A;  2WAQ E;  1ESF A;  4MTN A;  1TWG B;  1HA6 A;  3SEB A;  1XWE A;  3H6M A;  2JA5 H;  3LWE A;  2HDM A;  2VY3 A;  3NHH A;  3I4M B;  3MVV A;  3NK9 A;  4FP5 D;  1V9P A;  2NZH A;  3SVM A;  3S17 B;  1HZB A;  1FJG L;  4XT1 B;  1PTO F;  3J7A F;  2PZW A;  4A3K G;  1G29 1;  4KI0 A;  5LHY 1;  3S2D H;  1K8O A;  2KA7 A;  3JAM c;  5F2D A;  1XNQ L;  4BXX G;  4DV4 L;  4GKJ L;  3S2D B;  3G71 A;  3J7A 5;  4L6T B;  1IBL L;  5KNB A;  1J9O A;  1J8I A;  3RZO B;  5HY6 A;  3I55 A;  2B2Y C;  1RJT A;  1H95 A;  4OX9 Q;  1CKN B;  2K4K A;  3MFG A;  2B63 B;  4RCO A;  3NSW A;  1Q46 A;  2I07 B;  3HOX B;  3NWS A;  2R92 B;  2CHB D;  3CQZ B;  5FJ8 G;  1NE3 A;  3LNN A;  3A56 A;  1I4G A;  4B3T Q;  4LNQ A;  1E1O A;  1STY A;  3D8G A;  4CGY B;  3K5O A;  1N36 Q;  4LMQ D;  4DR4 L;  2XRS D;  4L5R C;  1PRT D;  3ERQ A;  3CHB D;  4DR6 Q;  3B6Y A;  2A68 D;  4LF9 Q;  5M3M B;  2KCT A;  1D5Z C;  1KLG D;  1KAA A;  1X9N A;  1VQI A;  1IL8 A;  5EQ0 A;  1VQJ A;  4BA1 I;  1K0R A;  1K9M C;  2BE5 C;  4A3D G;  1CQV A;  4IN3 A;  1C7Y A;  3ICE A;  5I4D A;  5LMN W;  4EQP A;  3TP8 A;  3ONA B;  4A3I B;  2JYO A;  3DUZ A;  3ND8 A;  3PIP 3;  1NUC A;  3CPW A;  5JEA H;  2BDN A;  2Q2I A;  3QR8 A;  4EGV A;  1VQO A;  2AQ2 B;  3DMU A;  1VQH A;  4YY3 L;  1MHW C;  4P73 A;  3QOJ A;  4JBK A;  4RGT A;  5JAV A;  5E1F A;  3HGB A;  1STA A;  2F0H A;  3HOY G;  1VQB A;  4JVZ A;  3I3C A;  3ULP A;  4KLK A;  4CKE A;  2JA8 B;  1DYQ A;  3S24 A;  4A3E H;  2NVQ B;  4I65 A;  1O7Y A;  3TS2 A;  1CM9 A;  1EYG A;  1Y1V B;  1S72 A;  2SNM A;  1NY4 A;  4HID A;  5C3X A;  1KTK A;  1IYV A;  3A7L A;  2WB1 E;  1BCP C;  3HEJ A;  4DUZ L;  1HR0 Q;  1I50 H;  1LM0 A;  2O5I C;  3E9H A;  2RKS A;  3CRK C;  1I50 B;  3S1Q B;  2D9U A;  2UUC L;  2NN6 G;  1HZ9 A;  2D0P A;  2DUD A;  2F0K A;  2F0W A;  4AIM A;  1WFQ A;  3PV0 A;  2NVQ H;  4AYB G;  3GTM H;  3I4O A;  4BY1 G;  1TWC H;  1SMY C;  4LF8 L;  3BJU A;  4C2M B;  4EQO A;  1HNX Q;  3FPP A;  3OW7 A;  4KY5 A;  1JOO A;  2D5D A;  4JI2 L;  2F4I A;  2E76 C;  2DY8 A;  2NWG A;  4TSS A;  3WWV A;  2NVX B;  1L1O A;  3T1Y L;  5C4X H;  4R4I A;  2CH4 W;  3RLF A;  4A3G G;  4C56 C;  4RGM A;  4QQB X;  2B3G A;  1PYS B;  4DKA C;  4OO1 I;  1ML0 D;  1SE8 A;  1A3V A;  5J1Z A;  3D3R A;  1N9W A;  1ZYR D;  2DJF C;  2V4D A;  2ZXO A;  3MXN B;  2F0J A;  1PYB A;  5KGU A;  1B53 A;  1Y1W G;  1H9S A;  1V1P A;  1BKB A;  4OIJ A;  3Q23 A;  3CC2 A;  1CZG A;  2QF7 A;  1AZQ A;  1UAP A;  5C3E H;  1ICF B;  1K73 C;  2N8N A;  3Q6S A;  3CPF A;  3HKS A;  5A35 A;  2L55 A;  4J8Q A;  2OTJ A;  2I5H A;  3TDQ A;  1KRS A;  1X3Q A;  3R2I A;  4UHV A;  1WD1 A;  5ELO A;  2R61 A;  3OWE B;  4ULL A;  2O2L D;  1D6E C;  1V1Q A;  3M3Y B;  1PXU A;  4YWL A;  5EJW A;  1J6Q A;  5JEA J;  4X64 Q;  2E5L Q;  1II3 A;  3NTK A;  4NDX A;  3J81 j;  1LAB A;  4RWS C;  4A3B G;  2EYH A;  1A3T A;  2ENB A;  4LFC L;  4F88 A;  2JA6 H;  4DUZ Q;  1HR0 L;  3KYH C;  1UEA B;  5EPL A;  4P74 A;  2KUM A;  4OHJ A;  2SOB A;  4LWC A;  1U4P A;  4DK0 A;  1BQQ T;  1KNE A;  4GKJ Q;  2JN4 A;  2QCP X;  4K6L A;  1NBW A;  4BY7 B;  4PNY A;  3K81 C;  3DWQ A;  5EKK A;  4N8F A;  4RHS A;  4S3S A;  4A3F G;  1GOZ A;  1YJW A;  3C2P A;  2OWO A;  3MTS A;  5D14 A;  3GTL B;  1E2V A;  3RNU A;  3I4N B;  2HIX A;  1LTA D;  1EFI D;  2GVA A;  2ZJR A;  2R7Z H;  1BUV T;  3U58 A;  3STB D;  1B3Q A;  4A3C G;  1I4Q A;  3TME A;  2UUB Q;  4A93 B;  5AJ3 L;  4GKK Q;  1QVG A;  1IBL Q;  2R7F A;  2PNH A;  1VF7 A;  1KAW A;  4LF5 Q;  3HZX A;  3KFU A;  2R92 H;  5FO9 B;  2Q8I B;  4WFN 3;  3S2H H;  1LTB D;  3HOZ B;  3BYT B;  2BOS A;  3R2T A;  3ERS X;  4A3D H;  4GLV B;  5C5M A;  1K8M A;  3ZJY C;  5EBC A;  1VQG A;  2Z0S A;  1CUK A;  4DR5 Q;  3CCR A;  4N9T A;  1GD7 A;  5CC4 A;  3WDN A;  1QZH A;  1X32 A;  3PO3 H;  4EX5 A;  4NPS A;  3KF8 A;  2VUM H;  5I6W A;  2B2U A;  1YBY A;  2A69 D;  1D7Q A;  1GUW A;  3UE0 A;  3PO2 H;  2A6E D;  4IFD G;  2NTT A;  5EKL A;  1F9Q A;  3BZD B;  5FLX L;  3I73 A;  1NR4 A;  1B50 A;  1CKO A;  1X65 A;  3IRB A;  1JOK A;  1WCM G;  3T1H Q;  1JIC A;  1RD9 D;  2PQA A;  1JB3 A;  3CRL C;  3MEF A;  1F2Y A;  4CKC A;  5K5P A;  3PUY A;  3T53 B;  1PZK D;  1SMY D;  2F1M A;  4FVM A;  3H15 A;  3K5L A;  2J0T D;  1PFM A;  5GAE C;  5I6Y A;  4DAM A;  3P1H A;  3KLW A;  3GV6 A;  3I2Z A;  3L7Z C;  1X6O A;  1CA5 A;  3D4D A;  1VQM A;  5GAG C;  3RUZ A;  2E2I H;  2J7Z A;  4A3D B;  1HXY D;  1TS2 A;  1NJI C;  2CWA A;  2IW3 A;  5A2Q E;  3ERO A;  4PG3 A;  5C44 B;  1Y8N B;  4ZCK A;  1YNJ C;  3HOW H;  2EJF C;  1WTH A;  2K1B A;  2DGY A;  1JE5 A;  1ENA A;  5ELF A;  3QWN A;  4B9W A;  4DR4 Q;  2YTV A;  1SYF A;  2QKI C;  5IYD H;  2SNS A;  3E3X A;  1XXG A;  4B3R L;  1PH1 A;  2NZO A;  2R7D A;  3JAM E;  1D2B A;  1LTS D;  2F0S A;  4IQZ A;  4Z9C B;  5T1G A;  2RDH A;  2WP8 J;  3J7Y W;  2ASB A;  5KRU A;  1TWH B;  3HOX G;  1L1O C;  5L37 A;  2JK8 A;  5KNC A;  2RSN A;  4DUY Q;  3R3O A;  2K5D A;  3MHB A;  2A6E C;  2KHI A;  4NW2 A;  5IGD A;  3TP7 A;  3I4M H;  3G4S A;  3M9B A;  1EU3 A;  3PQI A;  1F9R A;  3U9S A;  3BDL A;  3F2U A;  4RG1 A;  1IXR A;  1C4Q A;  1I6H B;  2KEC A;  4GN3 B;  1FJG Q;  3DWP A;  5COR A;  5COY A;  1TT2 A;  2HT1 A;  3Q8D A;  1E1T A;  5IGB A;  2L5T A;  3ER0 A;  4HCS A;  1QVF A;  1Q81 C;  2BA0 A;  2EYF A;  4JI7 L;  4DAY B;  2LFN A;  1K0S A;  2UUA Q;  2VNU D;  3AB9 A;  3K8A A;  2VW9 A;  3CP0 A;  3M85 A;  1WOC A;  3CAM A;  1KXL A;  2UUC Q;  3J80 i;  3CC7 A;  4HJ7 A;  4A93 G;  3URY A;  1EY4 A;  4QIW B;  4PZ7 A;  3PGZ A;  1ZYR C;  1S5F D;  2JEB I;  2K01 A;  1NSN S;  2KHS A;  3CU7 A;  4K0K L;  3NEM A;  2EYO A;  2CWP A;  4OEL B;  3OW2 A;  3E9I A;  2K28 A;  1Y8P B;  1PRT C;  3IFT A;  3H94 A;  4A3I H;  3A8K E;  4B3T L;  1XMQ Q;  1PH6 A;  4KMU C;  2X6G A;  4MIU A;  4DR6 L;  3KOJ A;  1PTO C;  4HSV A;  1H9R A;  5C44 H;  3RR5 A;  2Y0S E;  3CCQ A;  2UXB Q;  1B9M A;  4K5W A;  4OO1 H;  2PZU A;  3T4A C;  3CME A;  1WTW A;  3GTO H;  4DV0 Q;  2E2H H;  2VZA A;  3W1G A;  3ITP A;  2PNR C;  1KRT A;  1AE3 A;  1STG A;  4JI2 Q;  2L1B A;  3K7U C;  4F7X A;  4C3H G;  3H3V I;  2QEX A;  3FP9 A;  1E7Z A;  1G2T A;  4GLA C;  3WOF A;  1WI5 A;  1CTM A;  4Q5V A;  5IP7 G;  4A3L G;  2K5V A;  5G3L F;  4BXX H;  4R4Q A;  1T9H A;  2EDG A;  4BBR B;  4JI8 L;  4B3M Q;  2B63 H;  2BDO A;  1NNX A;  2Q8T A;  3HOX H;  2UU9 L;  4DPG A;  5M5W B;  3K5M A;  2EY2 A;  3CC4 A;  4JI4 Q;  1X3E A;  2R93 G;  4CDC C;  5C4J H;  5CV8 A;  1JJC B;  2E2D C;  5GAD C;  3M4Q A;  4RHR A;  4BY7 G;  4KKU A;  2F0D A;  5KEE A;  4LK1 C;  5D3D A;  4DUY L;  3GTO B;  3BDO A;  5J22 A;  3MWY W;  4DV5 L;  1N34 Q;  2JA5 B;  4HR7 B;  2MGS A;  1ZEQ X;  1TR5 A;  4HIK A;  1V43 A;  2A8V A;  3TP5 A;  4G7H C;  2WIN B;  1LV9 A;  2MFI A;  1EWI A;  5C3E B;  2F0Q A;  3C1E A;  4DNI A;  4DR2 Q;  3GTG H;  2L11 A;  4GOP C;  3I4L A;  2MP1 A;  3DWA A;  3C3L A;  3AQQ A;  2OCE A;  5I2Y A;  3M4Y A;  2BH8 A;  1Q7Y C;  3FKI G;  5C3W A;  5C0X J;  2ID0 A;  4G4K A;  4MZ9 A;  4V0B A;  4IOA A;  1KIX A;  1SR3 A;  3NQI A;  5KYI A;  3QJY A;  3IAY A;  4TVA B;  2E2H B;  3U50 C;  2ZXR A;  1EZ8 A;  2AQ1 B;  2DJG C;  2NZ1 D;  3GTQ H;  1Y14 B;  1L0Y B;  4BBS H;  1WJJ A;  3D4R A;  3HFZ B;  4A75 A;  5M3F G;  5FOB B;  3NBH B;  2YYZ A;  1QUQ A;  5ELC A;  1B4O A;  4K5X A;  2D0O A;  1CHQ D;  1M1K C;  4RGN A;  2F0E A;  1VS0 A;  1WTR A;  1SDF A;  1TWA H;  4CKB A;  2WAC A;  1W6J A;  5M5Y B;  5BR8 L;  5CV5 A;  3OTO L;  1M90 C;  3U9O A;  1FD7 D;  1HQM C;  3NBI A;  1EYC A;  5E7N A;  5HGQ A;  2F0N A;  5E4W C;  4OX9 L;  3HOW G;  1U9R A;  2N55 A;  2ZTD A;  3FMC A;  4ZQ3 A;  1SEB D;  4DV4 Q;  2EYJ A;  5ELD A;  4IFD J;  3ND9 A;  3U4V A;  2Z4H A;  3BVM A;  4DU9 A;  1OXT A;  1SYD A;  1SE4 A;  3D4W A;  5CBE E;  3V2T A;  3GTK H;  1OXV A;  4GN5 A;  3G48 A;  4DAY A;  1TY2 A;  1HNZ Q;  1DOM A;  2MO0 A;  2R3Z A;  3CCV A;  1HA5 A;  1SE2 A;  3PF5 A;  1GVP A;  4DV1 Q;  5J3B A;  4LF6 Q;  1UEB A;  1S40 A;  3NE5 B;  4LF7 Q;  1PH8 A;  1LTL A;  4LFA Q;  4G57 A;  3GTQ B;  1A62 A;  2DNE A;  4PQX A;  5ELB A;  4C3H B;  2F0F A;  2O5J C;  2XIW A;  4HJ5 A;  1VQP A;  3HRZ C;  2FMC A;  1BOS A;  1GO3 E;  4A3J G;  1K8G A;  1JWS D;  4A3E B;  1H9J A;  1A6X A;  4WRD A;  1SE3 A;  3T1H L;  2E2J H;  1VQ8 A;  4X66 L;  5LMU L;  1EYD A;  2E2J B;  3OHX C;  4FO2 A;  4JI7 Q;  4C3J B;  3IKJ A;  2F0L A;  2DN8 A;  2NVY H;  5I9O A;  4KHZ A;  4LW1 A;  5IGC A;  4JI5 Q;  2BA1 A;  3PIO A;  5IP7 H;  4A3B B;  3S1Q H;  1HR0 W;  3K0X A;  4ME5 A;  4PZ8 A;  4L5S A;  1Y1V G;  4LF9 L;  3FKI H;  3FHW A;  1KQS A;  1N33 L;  1A3U A;  2ZJQ A;  1SRO A;  5EBD A;  2ZXP A;  2F0P A;  4IPD A;  1LAC A;  2NVT B;  3DXJ C;  3NBH A;  2OTL A;  4KJN A;  3P7J A;  1L0X B;  1MI2 A;  4ZLT F;  1B7Y B;  2XN9 C;  3J81 L;  4X62 L;  4YY3 Q;  1PVO A;  4DGZ A;  1FYC A;  4KHP Q;  5JJL A;  1GUG A;  2KHJ A;  2K5H A;  2B63 G;  1AFP A;  4G7O C;  1PH4 A;  1IBK L;  4B3R Q;  1MKH A;  4NXM L;  1OTC A;  5C44 G;  4HCE A;  4X3K A;  4CJ1 B;  3OMC A;  3VDY A;  4H02 A;  2F0V A;  2YTX A;  4X66 Q;  5LMN Q;  3UDF A;  1XPO A;  2ZTC A;  1EEF D;  3K57 A;  4KKT A;  1PZJ D;  1AW7 A;  3DM1 A;  4JI5 L;  5M3F H;  4B3S L;  2KEE A;  1D8L A;  1N32 Q;  4LF8 Q;  1HZC A;  3N52 A;  2ZTE A;  2VQF Q;  1CSQ A;  1CI3 M;  4OO1 G;  2GN5 A;  4H7B A;  2PMZ B;  4JI8 Q;  4GOP A;  2N49 A;  2JA8 H;  1P16 A;  1PH5 A;  1I94 L;  1ASY A;  2V1C C;  1Q8I A;  2EZV A;  4WJ4 A;  4DR5 L;  1YNX A;  2K03 A;  5IYC G;  2CKZ B;  2B2U C;  4L63 B;  4R1J A;  3GTL H;  3GP7 A;  2OF1 A;  3H09 A;  3HKZ B;  4CBV A;  3S15 B;  1XPR A;  1SNC A;  2EXZ A;  1PH3 A;  2R93 H;  2HCI A;  1EOT A;  5KIX A;  3PIP A;  3OIQ A;  5GRO A;  1EFW A;  2LSS A;  2CFM A;  2B2T A;  4XIG S;  1PA6 A;  5DNF A;  3LX0 A;  4DR3 Q;  2BH2 A;  4RKB A;  5IT9 L;  2F52 A;  5G3L D;  2HQE A;  2EVB A;  5ELE A;  3HOU B;  3TSS A;  4C2M H;  4B3S Q;  3HOY H;  1X3P A;  2LS0 1;  5C4J B;  2A68 C;  3HOU H;  2AWN A;  5FLM H;  2PW5 A;  1KDA A;  3R93 A;  3W1B A;  1MD2 D;  1HH2 P;  2F3W A;  2YV5 A;  4KKS A;  5IOC A;  2P5Z X;  1TS3 A;  1SND A;  4N8X 1;  3KF6 A;  4LFA L;  3AU7 A;  2XSC A;  2KOL A;  1G91 A;  1PTO B;  2K5W A;  4DR3 L;  1QUQ B;  5AJ3 Q;  4GKK L;  1F77 A;  4A3M H;  3SK5 A;  2DY7 A;  2VL6 A;  1JWU D;  4DK1 A;  1BXT A;  4DV7 L;  1HQR D;  3T13 A;  4BBR G;  1PHJ A;  3MZ5 A;  3ULL A;  4LAA A;  3SE0 A;  5JOB A;  3GTJ H;  3UI2 A;  1EOV A;  1VQE A;  2G9H D;  3A74 A;  2E2I B;  2VUM G;  1SJH D;  1YNJ D;  4C3J H;  2GVB A;  1C9O A;  4L5Q A;  1V8Q A;  4GNX C;  2IX0 A;  1GUS A;  3S1R H;  4YIJ A;  3SK6 A;  1X54 A;  4UPA A;  2Q2T A;  3NP8 A;  5NUC A;  5I2X A;  1HZA A;  2B8F A;  3S1R B;  1TWF H;  1BCP B;  4KK7 A;  1LT5 D;  4JPB W;  1FGB D;  2EY5 A;  4I7Z C;  2IT1 A;  1Y8O B;  2N88 A;  1TII D;  1MSG A;  1E0B A;  1MIU A;  3AMU A;  2IX1 A;  1PV4 A;  2HCC A;  3J81 c;  1GHJ A;  5T1I A;  3DEO A;  4APV A;  1EIG A;  3HKZ G;  1IKL A;  1YVC A;  4IJH A;  4CHT B;  1EIH A;  1GHK A;  2UUA L;  1ZKO A;  4DR7 Q;  3M7N A;  1PRT B;  3LGJ A;  1IYU A;  1H9M A;  5C4Z A;  2RF4 A;  4AQY Q;  1S4Z A;  1YEZ A;  1CHP D;  1TU2 B;  1W3S A;  4J15 A;  4P2C B;  4DN4 M;  1JB7 A;  1STB A;  1VQ4 A;  5IP9 H;  4IFD H;  3GQB A;  1TS5 A;  2Z6B A;  3K58 A;  4K14 A;  3VR4 A;  2M9V A;  1HTP A;  1VQF A;  3TP6 A;  4A3F B;  2FJ2 A;  1EY7 A;  2WII B;  4CJ0 B;  3H0G G;  2AKW B;  3F2C A;  1F2M A;  1DOK A;  1KDB A;  4A3J H;  2XWB B;  2JA5 G;  2MUY A;  3J80 E;  3GDE A;  4POG A;  4KTA A;  4QUC A;  3VR3 A;  4A3M B;  4BWG B;  2YU9 H;  1HUM A;  1T5E A;  1CKM A;  1PYW D;  4QIW E;  2HHH L;  3I4M G;  2F3I A;  4HSP A;  1SLJ A;  3VA5 A;  1UE5 A;  1XYI A;  1K83 B;  3SHL A;  2YTY A;  4J1M A;  1Z6H A;  5JVH 3;  2R6G A;  4GOP B;  4OWW B;  3CMA A;  1RTN A;  2HIV A;  2RHS B;  1PH2 A;  1PH7 A;  2B2Y A;  4A3G B;  2J4X A;  2ICI A;  2KEN A;  5FLX c;  4P71 A;  1EY5 A;  2E5L L;  4X3U A;  3L3O C;  5IYC H;  2CVR A;  1AEX A;  2XWJ B;  2JSO A;  3W5O A;  2EXD A;  1EEI D;  2MPM A;  5IGE A;  1I4R A;  1B2T A;  3H3V H;  2F0M A;  2JXM B;  1BO0 A;  1CZW A;  2M2L A;  3WOE A;  2Q8R E;  2LXJ A;  3RZD H;  4LF4 Q;  4NKL A;  3M4O H;  2XVS A;  3CXC A;  3H0G B;  3S14 H;  4PMW A;  2WAQ G;  1J5E L;  1EY0 A;  5FO7 B;  4J6H A;  2NN6 H;  4DV1 L;  3AYH B;  1XPU A;  4XQJ A;  2K05 A;  4YCW A;  1ILQ A;  1XMO Q;  1Q90 A;  2JA8 G;  4A3K H;  1UUP A;  1KD1 C;  1KNA A;  1O7Z A;  1Q1B A;  1RL2 A;  2ZM6 L;  4A93 H;  2NVX H;  2PZT A;  4A76 A;  1GUT A;  4LFB L;  2RA4 A;  1YIJ A;  1N33 Q;  3K5N A;  4JI3 Q;  1X3F A;  1C48 A;  3PMF A;  4ZAI A;  1VQ5 A;  1YNN C;  1OXU A;  2Y0S B;  1SFO H;  1U4M A;  4A3I G;  3EN2 A;  3E0J A;  3BS1 A;  1EY6 A;  1I4H A;  3N6R A;  1K83 H;  1OXS C;  1SYE A;  1AP0 A;  4C3J G;  4UP9 A;  5KYL A;  3H91 A;  3AEV A;  3P75 A;  3P20 A;  1B1Z A;  1G2S A;  5M5Y H;  2HUG A;  1F9S A;  2B8G A;  4B9X A;  4R8I A;  1Q82 C;  1GJX A;  3CCU A;  1YHB A;  1PRT F;  2KED A;  3JAM i;  5IYB H;  4LUO A;  2RCN A;  3VA7 A;  2TMP A;  5DM7 3;  4DR7 L;  1I3Q B;  1B3A A;  3E6Z X;  1LTR D;  4IUN A;  4NXN Q;  5EAY A;  2JA6 B;  4NMZ A;  1KL9 A;  1QNU A;  4BY1 H;  1VQK A;  4JYA L;  1U0L A;  1CKN A;  4O42 A;  1B70 B;  3M7G A;  1TY0 A;  1MJE A;  1QIL A;  1KC8 C;  3IFD A;  3HOY B;  4JI0 Q;  3T56 B;  1FNV A;  2MNA A;  4JV5 Q;  5IY0 A;  2PQA B;  2F3V A;  3M3Y H;  2MQH A;  3NEL A;  4DK6 C;  4HJA A;  3PUW A;  4UAI A;  3SK4 A;  1XTC D;  4DFA A;  1CK1 A;  3TZU A;  3RN2 A;  1NR2 A;  2F0O A;  1HNX L;  1JOR A;  2ICE C;  1D5X C;  2JP1 A;  1N32 L;  2L15 A;  1A15 A;  4F87 A;  1I4P A;  1IBM L;  5DAU A;  1EQV A;  1XJV A;  2B2W A;  2G9D A;  4LF4 L;  4PV1 C;  2NVY B;  1DGS A;  2VB3 X;  1VMP A;  4IFD I;  3H3V C;  3FPU B;  2B2W C;  3NEN A;  4ZKB B;  4DR1 L;  1VQC A;  4ABN A;  3KDF B;  2QGQ A;  4UDU C;  1QZG A;  1RCV D;  2OEO A;  1RTO A;  4IUP A;  1EIF A;  4IJL A;  4QJF A;  3DEP A;  2O4X A;  4B3M L;  1S5C D;  4DA2 A;  2NVT H;  2LKV A;  1PFB A;  4UY8 C;  2HQL A;  1S5E D;  4KHP L;  5IWA Q;  1QWY A;  4N9P A;  3VR5 A;  4DV0 L;  1K28 A;  4HAE A;  1NCV A;  1QCB D;  3MC0 B;  5IE8 A;  4OL7 A;  4LFB Q;  3TZD A;  3NPP A;  4ODG A;  4IUR A;  1MGS A;  3K80 C;  3I91 A;  3HOW B;  3VYR A;  1IKM A;  5C3E G;  2TSS A;  1SYG A;  1LT3 D;  2A73 B;  4X62 Q;  3EVQ A;  1M8A A;  3H0G H;  2UXC Q;  3EA6 A;  3TQY A;  2UXD Q;  2C9O A;  1NMF A;  4UP7 A;  3MA2 B;  3FDT A;  1SFO B;  1TWC B;  4L8J A;  1STH A;  4DV5 Q;  1Q86 C;  4JW0 A;  1N34 L;  4XXE A;  5IIF A;  1QB5 D;  1EY8 A;  4WOR A;  5IP9 G;  4DNT B;  1TWA B;  2D2C C;  2Q2U A;  2Y0S G;  3ULJ A;  1RHP A;  1JR0 D;  1EQT A;  1RKN A;  4H44 C;  1CA6 A;  2KJX A;  1YI2 A;  3RD4 A;  1JCK B;  4BY7 H;  2R93 B;  2EYL A;  1BR9 A;  1VQL A;  1AH9 A;  3DLL A;  1IZ6 A;  3K0Y A;  4CDF C;  4X3T A;  3MFY A;  4K0K Q;  2AMC B;  2WKC A;  1XX8 A;  5C0X H;  4FXK C;  4HMI A;  3HS0 C;  4YCU A;  2ZT9 C;  3MEH A;  4LF7 L;  4KY6 A;  1EZ6 A;  1CFM A;  4NXN L;  4XYQ A;  2PCF B;  5CV7 A;  2CQO A;  2LXK A;  3I70 A;  4U67 3;  3BZC A;  3A54 A;  1IYJ B;  3TS0 A;  4DV2 L;  2A74 C;  3CKI B;  1GM5 A;  1XTD A;  2VB2 X;  3VR6 A;  2ZJP A;  2D62 A;  4KN7 C;  1Q3L A;  3J7Z C;  2JEA I;  1G6P A;  5BN4 A;  2CW0 C;  3OMG A;  4C3H H;  3OPO A;  1U4R A;  3S1N H;  1VDZ A;  2ALY B;  2K33 A;  4FNF A;  1UE6 A;  4HED A;  1ESR A;  2K6A A;  3I90 A;  1LUZ A;  3C46 A;  1WD0 A;  2EY1 A;  4JI0 L;  3RN5 A;  3FVQ A;  3CCJ A;  3FRP B;  5IYB G;  4LFC Q;  4HTH A;  2F4V L;  4CJ2 C;  4FDB A;  5JJI A;  2SDF A;  1K3R A;  1KLU D;  4HN7 A;  2VXW A;  2LMC B;  5H1S E;  5GAH C;  1OO9 B;  3Q24 A;  4JOI A;  5HUR A;  4IAL A;  4DV7 Q;  1X56 A;  1F2Z A;  4JOI C;  1L0W A;  3EQL C;  1YHQ A;  3GTJ B;  2JA6 G;  4XQN A;  3NTH A;  1DJR D;  1FNW A;  3HOV B;  2WB1 B;  3NWT A;  1YJN A;  3HOV H;  2GA4 B;  3I8Z A;  3MXG A;  3X3N A;  2RVL A;  2E75 C;  2K32 A;  2C5C A;  4R4C A;  5J39 A;  5IT9 E;  1VMC A;  3HP3 A;  1RIP A;  3CCS A;  1ZXT A;  3O13 A;  3KDF A;  1C0A A;  4QUF A;  4ALP A;  1FVI A;  3QB3 A;  3Q22 A;  2MJ8 A;  1K8A C;  3KJP A;  1BF4 A;  3HOZ G;  5FLM G;  4OGQ C;  4BS9 A;  3I4N H;  2UXC L;  1I4X A;  2NYZ D;  4IPG A;  2R7Z G;  1I94 Q;  4EQ5 A;  2XNA C;  2H5X A;  2Z4I A;  5D65 A;  4BBS G;  2MO1 A;  2SEB D;  4BBR H;  3KBX A;  1QNK A;  3OYY A;  3GTP H;  5JJK A;  3SR1 A;  1SN8 A;  2UXD L;  5C4X B;  4K8J A;  1EUJ A;  3J81 i;  2I0Q A;  1EYA A;  3FKI B;  2R92 G;  1SXT A;  3F2B A;  5KND A;  1K3B C;  4MHE A;  2FXQ A;  1C8C A;  1EIY B;  3A8I E;  2WFW A;  4MTK A;  4UP8 A;  1PLF A;  2F0T A;  2K04 A;  2G5D A;  5JVG 3;  3CCM A;  1Y1V H;  1A0I A;  3TEH B;  1F9P A;  4XT3 B;  1BDO A;  3LWU A;  3HKZ E;  4JI6 L;  4AQY L;  1YNN D;  4DV6 Q;  2F0I A;  5M3M H;  1EWH A;  4OIK A;  1SNQ A;  4XDX A;  1ONL A;  4QGU A;  3KK7 A;  4IO9 A;  2CQA A;  4DV3 Q;  3G6E A;  4NB3 A;  3VYT A;  4K6D A;  4POF A;  2OQK A;  1Y69 U;  1DXM A;  1ET6 A;  2PI2 E;  5DEH A;  1HNZ L;  4NXM Q;  1DOL A;  2CCZ A;  1CQF A;  2Z1C A;  3GTK B;  1JJG A;  3RZO H;  1IBM Q;  3IL8 A;  4HIM A;  2QDB A;  1BCP F;  1DZ1 A;  4KD3 A;  3RZD B;  1D5M C;  1ROD A;  2A5H A;  1M4V A;  1S5B D;  4CDD C;  4LUV A;  3L9A X;  5LL6 X;  1E22 A;  1HNW Q;  2K52 A;  1HPC A;  1MJC A;  5E4X A;  1BCP D;  1B44 D;  1W2B A;  2RSO A;  4B08 A;  1DD2 A;  4A3K B;  1TWG H;  1YZ6 A;  3BYY B;  5CV9 A;  4AYB E;  4LF5 L;  2PPB C;  3BVG A;  3UE1 A;  3SGI A;  1JQY D;  1FR3 A;  4TRD A;  2B2V C;  2JA7 G;  1RF2 D;  1SJE D;  5C0X I;  1IHZ A;  1QOH A;  1D1I A;  4R4T A;  1EL0 A;  2FFK B;  1WCM H;  3PO3 B;  1TQO A;  1HHV A;  5K36 H;  3D6C A;  4YCV A;  4TKO B;  4YWM A;  2EOT A;  2NB0 A;  3S16 B;  3JAM L;  3DHQ A;  4QMG A;  4O2D A;  1TVX A;  1ASZ A;  4R4O A;  2PYK A;  3D6W A;  5I9P A;  5C0X G;  5CMD A;  2QA4 A;  1QG7 A;  5M5X H;  2ZM6 Q;  5E3F A;  3UDG A;  1IBK Q;  3G6J B;  1XNR L;  1Q1E A;  1PH9 A;  3QG1 A;  1S3O A;  3R8B A;  3W3A A;  1SBB B;  2EE1 A;  1JT8 A;  3GTP B;  4JI1 L;  4OXP A;  1TKW B;  1XMO L;  1I3Q H;  3UDX A;  4OWX B;  1U5K A;  3S1N B;  3CF5 A;  1I6H H;  4PZ6 A;  4MN3 A;  2I5L X;  1KAB A;  1JE4 A;  1H9K A;  4AYB B;  4A3M G;  5EGT A;  2KQ3 A;  4WJ3 M;  3KF8 B;  2IHF A;  4IUQ A;  4K2K A;  1STN A;  2M00 A;  4JBJ A;  3E0E A;  4G7Z C;  2IPK D;  2XGT A;  1SYB A;  2A69 C;  2H1E A;  4DV3 L;  4A4I A;  2QW7 A;  3A55 A;  3KBG A;  3VYU A;  4C3I H;  3VYS A;  2VQF L;  4JI4 L;  2ATW A;  1IW7 C;  2XTI A;  3A0J A;  3HOZ H;  4XTC S;  1G8Z D;  2X6L A;  4GZY C;  2KCM A;  1B9N A;  4M1U B;  4GNX B;  4Y7N H;  1OXX K;  4RA8 A;  2CW0 D;  2A6H C;  3AFQ A;  1D1K A;  1JJ2 A;  2XRQ D;  5C4X G;  2X69 A;  1H9S B;  1V1P B;  2K14 A;  4GS3 A;  1R4P B;  4OWT B;  3JC6 6;  1LTT D;  2B29 A;  2EPB A;  1DCZ A;  1O78 A;  2HD3 A;  3BU2 A;  1F2L A;  5ELN A;  1EQR A;  2E74 C;  4PMC A;  4ZYS A;  5BN5 A;  4JV5 L;  4A3C H;  3HOU G;  3RMH A;  3S17 H;  1LTG D;  5M5W H;  4ZK9 B;  3PUV A;  4FF2 A;  4RFB A;  2EJG C;  3A7A B;  4IUT A;  1HFG A;  3V05 A;  2B2T C;  2NBF A;  4JCV E;  2F0U A;  4A3J B;  5M3F B;  4I7A A;  2Z6K C;  5BR8 Q;  3OTO Q;  2WV6 D;  3HOV G;  3AFP A;  3T51 B;  1ENC A;  2VQE L;  3S14 B;  4IUV A;  1I6V C;  1VQA A;  3K6O A;  4L5T A;  5FO8 B;  2L12 A;  5GQO A;  3I56 A;  1TXY A;  1EY9 A;  4MNO A;  4JK1 C;  1STE A;  4C1N K;  2F03 A;  5LMN L;  4KN4 C;  4ZUI A;  1R9T H;  4X65 L;  5ISR A;  2ES2 A;  1VQ7 A;  3A5Z B;  4GLX A;  5LMU Q;  2JA7 B;  1P8L A;  5M9O A;  4LF6 L;  5BN3 A;  4HJ9 A;  2JA7 H;  3KF6 B;  3OOC A;  1CSP A;  1Z7T A;  3U4Z A;  5A2Q L;  1RDP D;  5C6A A;  3EFX D;  2Z8L A;  4OEM B;  2IY5 B;  2RHQ B;  4QF4 A;  5CBA E;  1BNZ A;  2QDL A;  1VCI A;  1KHI A;  3SXH A;  1GKH A;  1J5E Q;  2RDF A;  4X3S A;  1SNO A;  2N3S A;  1SRU A;  2NN6 I;  2A19 A;  4OON A;  4ILW A;  2IJ0 A;  5EKI A;  2IWH A;  2K50 A;  4JI1 Q;  4DAV A;  5FK9 C;  4Y52 H;  1SNM A;  5K36 G;  4FF3 A;  1WYD A;  1FGU A;  4EQN A;  1SAP A;  3STB C;  1YJ9 A;  1A2U A;  3A8J E;  2JJQ A;  2FIN B;  3KLS X;  2CH4 A;  2K75 A;  4FXD A;  4PMB A;  3PUZ A;  3KUP A;  3PF4 A;  5IYD G;  3J81 E;  3PCO B;  2K5N A;  4F8M A;  4M8A A;  4X65 Q;  4ZKC B;  1R9T B;  1Y1W H;  4X64 L;  4BA2 I;  4NP5 A;  1NAP A;  3PIO 3;  1FNU A;  4JI3 L;  3Q0A A;  1SMX A;  1HFN A;  1SYC A;  3PO2 G;  4O0A A;  2AUJ D;  3GTM B;  3J80 L;  3KLS A;  4GN4 B;  4JC0 A;  4IPC A;  5IOD A;  3D31 A;  4QL5 A;  4XYO A;  1WTQ A;  3BG3 A;  4FF1 A;  1PTO D;  2OQ0 A;  1HNW L;  1E3P A;  1LO5 D;  3J80 c;  3MAQ A;  4IOC A;  2HHH Q;  2F4V Q;  3K59 A;  3RLO A;  3MXU A;  5C4H A;  3M4P A;  4DF7 A;  4HMJ A;  3S9W A;  1I5F A;  5DM6 3;  4A3B H;  1PTO H;  1VF5 C;  5CGK A;  4K2L A;  1LLR D;  2VQE Q;  1R4Q B;  1LT6 D;  4BBS B; 
#chains in the Genus database with same CATH homology
 4AH6 A;  4X62 L;  4YY3 Q;  1V1Q A;  1XNQ Q;  2EQS A;  1PVO A;  3T1Y Q;  2CQO A;  2LXK A;  4KHP Q;  4YWL A;  5JJL A;  2KHJ A;  1J6Q A;  2Q2H A;  5JEA J;  4X64 Q;  2K5H A;  4DK3 C;  3BZC A;  2E5L Q;  2B63 G;  1BVS A;  1IYJ B;  3TS0 A;  1PH4 A;  4DV2 L;  1IBK L;  4B3R Q;  3J81 j;  3PO3 G;  4X6A H;  1GM5 A;  1MKH A;  4NXM L;  4A3B G;  1XTD A;  2ZJP A;  1OTC A;  2D62 A;  1VQ6 A;  4LFC L;  5C44 G;  2JA6 H;  3J7Z C;  4DUZ Q;  1HR0 L;  3KYH C;  2JEA I;  1G6P A;  3VDY A;  4C3H H;  4P74 A;  4H02 A;  3S1N H;  3D0F A;  2YTX A;  4X66 Q;  2ALY B;  4LWC A;  5LMN Q;  1B8A A;  3UDF A;  1UE6 A;  4GKJ Q;  4IPH A;  5DLQ E;  2ZTC A;  1XPO A;  3PSI A;  1LYL A;  1LUZ A;  2PI2 A;  1NBW A;  3F1Z A;  4JI5 L;  5M3F H;  4B3S L;  3CQZ H;  3RN5 A;  2IHE A;  4JI0 L;  3K81 C;  1YIT A;  1N32 Q;  1D8L A;  4A3F G;  4JBM A;  1X55 A;  2WB1 G;  3F8T A;  4LF8 Q;  1YJW A;  1HZC A;  3PUX A;  2ZTE A;  2OWO A;  4DR1 Q;  2VQF Q;  1CSQ A;  4A3F H;  4YHH L;  3CCJ A;  2A1A A;  4OO1 G;  2GN5 A;  5IYB G;  5FJ8 H;  3RNU A;  2JQO A;  4LFC Q;  2F4V L;  2HIX A;  4FDB A;  4P72 A;  4JI8 Q;  4GOP A;  2N49 A;  1K3R A;  3GO5 A;  2JA8 H;  5JJI A;  3F2D A;  2GVA A;  5H1S E;  1P16 A;  5GAH C;  2ZJR A;  1PH5 A;  1I94 L;  1ASY A;  2V1C C;  4JOI A;  2R7Z H;  4WJ4 A;  4DR5 L;  1YNX A;  3L0O A;  5IYC G;  2CKZ B;  4R1J A;  3U58 A;  3GTL H;  3STB D;  4A3C G;  4DV7 Q;  1X56 A;  4LUZ A;  2N78 A;  4JOI C;  2UUB Q;  1L0W A;  1L2F A;  5AJ3 L;  4GKK Q;  1QVG A;  1E24 A;  1YHQ A;  2R7F A;  1XPR A;  2PNH A;  1IBL Q;  2JA6 G;  1N36 L;  3GD7 A;  1KAW A;  4LF5 Q;  1PH3 A;  3KFU A;  2R93 H;  2R92 H;  3BZK A;  1YJN A;  3HOV H;  3S2H H;  2AWO A;  1XNR Q;  3PIP A;  5GRO A;  4R4C A;  4GNX A;  4HJ8 A;  2LSS A;  1EFW A;  2CFM A;  1RIP A;  4XIG S;  3CCS A;  3ERS X;  1PA6 A;  3CW2 C;  3KDF A;  4A3D H;  1C0A A;  4ALP A;  4GLV B;  1NTG A;  3TRE A;  1FVI A;  3KJO A;  4DR3 Q;  2BH2 A;  1BBU A;  3ZJY C;  1X3G A;  2F52 A;  3S1M H;  2UUB L;  1K8A C;  1VQG A;  1XMQ L;  3KJP A;  4A3E G;  4C2M H;  4B3S Q;  3HOZ G;  2Z0S A;  3HOY H;  5FLM G;  1CUK A;  4JYA Q;  3K7A H;  3HOU H;  3I4N H;  2UXC L;  2AWN A;  4DR5 Q;  5FLM H;  3CCR A;  4IPG A;  1GD7 A;  3W1B A;  2EIF A;  1I94 Q;  2R7Z G;  1HH2 P;  1QVC A;  4EQ5 A;  2YV5 A;  1QZH A;  2H5X A;  3PO3 H;  4EX5 A;  4NPS A;  3KF6 A;  2VUM H;  3CD6 A;  2KBN A;  1Q12 A;  4LFA L;  4DV6 L;  1YBY A;  4DR3 L;  4BBS G;  1QUQ B;  5AJ3 Q;  4GKK L;  2MO1 A;  1D7Q A;  3UE0 A;  4A3M H;  4BBR H;  3PO2 H;  4IFD G;  3GTP H;  5JJK A;  3OYY A;  1PFS A;  4HIO A;  2VL6 A;  1SN8 A;  2UXD L;  1CKO A;  1X65 A;  1EUJ A;  3IRB A;  1WCM G;  4BBR G;  3J81 i;  4DV7 L;  1PHJ A;  2I5M X;  2I0Q A;  3ULL A;  2R92 G;  3T1H Q;  4JG2 A;  3L2P A;  3F2B A;  2FXQ A;  3GTJ H;  1EIY B;  1EOV A;  1VQE A;  2PQA A;  2WFW A;  3A74 A;  2VUM G;  4UP8 A;  3MEF A;  1A8V A;  3EIV A;  3PUY A;  2PMZ E;  1Y1V H;  1A0I A;  4C3J H;  2GVB A;  3H15 A;  3TEH B;  3CCM A;  1C9O A;  4L5Q A;  4ME3 A;  4GNX C;  2IX0 A;  5GAE C;  4JI6 L;  3HKZ E;  4DAM A;  3CCL A;  3S16 H;  4AQY L;  3S1R H;  3KLW A;  4DV6 Q;  1X54 A;  4UPA A;  5M3M H;  1TWH H;  3I2Z A;  2Q2T A;  1VQN A;  1HZA A;  1X6O A;  3L7Z C;  1TWF H;  1VQM A;  1A63 A;  5GAG C;  5JEA G;  4RMF A;  1VQ9 A;  4QGU A;  4IO9 A;  2E2I H;  1NJI C;  1Q8K A;  2CWA A;  4DV3 Q;  1UE7 A;  2Z6K A;  3G6E A;  4NB3 A;  2IT1 A;  2C35 B;  4PG3 A;  1N8R C;  4POF A;  1G51 A;  4JBW A;  1NMG A;  1MIU A;  3HOW H;  2DGY A;  2OQK A;  5M3M G;  1JE5 A;  2IX1 A;  4YWK A;  1AE2 A;  1PV4 A;  4DR4 Q;  3TRZ A;  2YTV A;  3J81 c;  2UU9 Q;  2PI2 E;  3CCE A;  5IWA L;  1HNZ L;  4APV A;  4NXM Q;  5IYD H;  3HKZ G;  3I7F A;  2CCZ A;  3EBE A;  4B3R L;  1JJG A;  1YVC A;  4IJH A;  1PH1 A;  2E8G A;  1IBM Q;  2NZO A;  2R7D A;  1IL2 A;  2UUA L;  3RZO H;  4HIM A;  1BBW A;  4DR7 Q;  4YHH Q;  3M7N A;  4A3G H;  3LGJ A;  2JE6 I;  4AQY Q;  2RF4 A;  2ASB A;  2WP8 J;  1YEZ A;  4J15 A;  1JMC A;  1W3S A;  3HOX G;  1O7I A;  1JB7 A;  4JI6 Q;  1L1O C;  2JK8 A;  5IP9 H;  1VQD A;  1VQ4 A;  4LUV A;  4TQU S;  4DUY Q;  1VQF A;  3UDI A;  2KHI A;  3H0G G;  3RLN A;  1E22 A;  1HNW Q;  2AKW B;  3F2C A;  2K52 A;  4A3L H;  3I4M H;  1MJC A;  3G4S A;  3M9B A;  4A3J H;  4RG1 A;  1W2B A;  1IXR A;  1FL0 A;  4DR2 L;  2JA5 G;  4GN3 B;  1FJG Q;  1TWG H;  1YZ6 A;  4AYB E;  4LF5 L;  2UXB L;  2HT1 A;  3Q8D A;  1E1T A;  3GDE A;  3UE1 A;  4POG A;  4P75 A;  3SGI A;  3ER0 A;  1QVF A;  1Q81 C;  2BA0 A;  1YHA A;  1Z47 A;  2YU9 H;  1HJP A;  4JI7 L;  2JA7 G;  1L1O B;  1CKM A;  1UE1 A;  1Z9F A;  4QIW E;  4DAY B;  4R4T A;  4QY7 A;  5C0X I;  2F3I A;  2HHH L;  3I4M G;  2UUA Q;  2VS1 A;  2VNU D;  3K8A A;  1WCM H;  1SLJ A;  3A5U A;  2VW9 A;  3CP0 A;  1UE5 A;  1WOC A;  4YCV A;  3M85 A;  3CAM A;  1KXL A;  2YTY A;  4YWM A;  4GOP B;  5IT9 c;  2R6G A;  3J80 i;  2UUC Q;  3CMA A;  4OWW B;  2HIV A;  2RHS B;  1PH2 A;  1UWV A;  3CC7 A;  4HJ7 A;  3DM3 A;  1PH7 A;  4A93 G;  4PZ7 A;  3PGZ A;  2JEB I;  4O2D A;  1ASZ A;  4R4O A;  2KEN A;  5FLX c;  4K0K L;  5C0X G;  3NEM A;  2QA4 A;  4P71 A;  5M5X H;  2ZM6 Q;  2AHO B;  2CWP A;  4DV2 Q;  3UDG A;  2JA9 A;  1IBK Q;  1XNR L;  1EQQ A;  2E5L L;  3OW2 A;  3E9I A;  1Q1E A;  1PH9 A;  3I4N G;  1S3O A;  3S15 H;  2WAQ E;  4A3I H;  4MTN A;  1JT8 A;  5IYC H;  4B3T L;  4JI1 L;  4OXP A;  1XMQ Q;  1PH6 A;  1XMO L;  1I3Q H;  4DR6 L;  3UDX A;  3KOJ A;  1U5K A;  4OWX B;  3CF5 A;  2JA5 H;  1I6H H;  3W5O A;  5C44 H;  4PZ6 A;  2EXD A;  2VY3 A;  3RR5 A;  2Y0S E;  3CCQ A;  2UXB Q;  2I5L X;  1V9P A;  2NZH A;  4A3M G;  3H3V H;  1HZB A;  3CME A;  1FJG L;  3KF8 B;  3GTO H;  2IHF A;  4WJ3 M;  4DV0 Q;  2E2H H;  2VZA A;  3W1G A;  4JBJ A;  3E0E A;  4A3K G;  2XGT A;  1G29 1;  4KI0 A;  1KRT A;  3S2D H;  4LF4 Q;  1AE3 A;  2LXJ A;  4DV3 L;  3RZD H;  4A4I A;  3JAM c;  1XNQ L;  4JI2 Q;  4BXX G;  4DV4 L;  4GKJ L;  3G71 A;  3M4O H;  4C3I H;  3J7A 5;  1IBL L;  3CXC A;  3K7U C;  2VQF L;  3S14 H;  4JI4 L;  4PMW A;  2WAQ G;  5HY6 A;  1J5E L;  2ATW A;  3I55 A;  2XTI A;  1H95 A;  3H3V I;  4OX9 Q;  1CKN B;  3A0J A;  2QEX A;  2K4K A;  4DV1 L;  3FP9 A;  3AYH B;  1XPU A;  1E7Z A;  3HOZ H;  4XTC S;  1Q46 A;  4GLA C;  1WI5 A;  2KCM A;  4GNX B;  4YCW A;  5IP7 G;  5FJ8 G;  1OXX K;  2K5V A;  4Y7N H;  1NE3 A;  4A3L G;  4BXX H;  4R4Q A;  3AFQ A;  1XMO Q;  1T9H A;  4B3M Q;  4A3K H;  4JI8 L;  1JJ2 A;  4B3T Q;  2JA8 G;  5C4X G;  2B63 H;  4LNQ A;  1E1O A;  1KD1 C;  2K14 A;  1Q1B A;  1RL2 A;  2ZM6 L;  4A93 H;  2NVX H;  3HOX H;  4GS3 A;  2UU9 L;  1N36 Q;  4A76 A;  4DR4 L;  4OWT B;  3JC6 6;  4L5R C;  4LFB L;  4DPG A;  1YIJ A;  3CC4 A;  1N33 Q;  4JI4 Q;  1X3E A;  2B29 A;  2R93 G;  4DR6 Q;  3B6Y A;  3BU2 A;  4JI3 Q;  4LF9 Q;  1X3F A;  5C4J H;  1VQ5 A;  5ELN A;  2KCT A;  1EQR A;  1OXU A;  1SFO H;  1JJC B;  5GAD C;  4JV5 L;  4A3C H;  3M4Q A;  4A3I G;  1VQI A;  1X9N A;  4BY7 G;  3EN2 A;  3HOU G;  1VQJ A;  3S17 H;  1K83 H;  1OXS C;  4BA1 I;  1K0R A;  5M5W H;  1K9M C;  3PUV A;  4UP9 A;  3AEV A;  4A3D G;  4DUY L;  4DV5 L;  5M5Y H;  1N34 Q;  1Q82 C;  1C7Y A;  3ICE A;  1AH9 A;  3CCU A;  1YHB A;  4JCV E;  5LMN W;  4HIK A;  1V43 A;  2A8V A;  3JAM i;  5IYB H;  2MFI A;  4LUO A;  1EWI A;  2RCN A;  3CPW A;  4DR7 L;  2Q2I A;  4DNI A;  2Z6K C;  4DR2 Q;  3GTG H;  5BR8 Q;  3OTO Q;  1VQO A;  3HOV G;  4GOP C;  3AFP A;  3AQQ A;  1VQH A;  2OCE A;  4YY3 L;  5EAY A;  2VQE L;  4NXN Q;  4P73 A;  1KL9 A;  4BY1 H;  4JBK A;  1VQK A;  4JYA L;  2BH8 A;  1U0L A;  1VQA A;  1Q7Y C;  3FKI G;  1CKN A;  5C0X J;  1B70 B;  2ID0 A;  4L5T A;  4MZ9 A;  1MJE A;  5GQO A;  3I56 A;  3HOY G;  1TXY A;  1VQB A;  4MNO A;  4IOA A;  1KIX A;  1SR3 A;  3ULP A;  1KC8 C;  4KLK A;  3S24 A;  4JI0 Q;  4A3E H;  4TVA B;  3U50 C;  2MNA A;  4JV5 Q;  3TS2 A;  5IY0 A;  2PQA B;  1EYG A;  1S72 A;  3M3Y H;  2MQH A;  1NY4 A;  3NEL A;  1Y14 B;  4DK6 C;  5LMN L;  3PUW A;  4HID A;  4HJA A;  3GTQ H;  4BBS H;  1R9T H;  4X65 L;  1WJJ A;  3HFZ B;  2WB1 E;  2ES2 A;  4A75 A;  3RN2 A;  1VQ7 A;  5M3F G;  1HNX L;  3A5Z B;  3NBH B;  2YYZ A;  4DUZ L;  1QUQ A;  4GLX A;  1I50 H;  5LMU Q;  1LM0 A;  1HR0 Q;  1N32 L;  1P8L A;  2L15 A;  3E9H A;  4LF6 L;  4HJ9 A;  2JA7 H;  2D0O A;  3KF6 B;  1M1K C;  1CSP A;  1IBM L;  3U4Z A;  1VS0 A;  2NN6 G;  2UUC L;  1HZ9 A;  2D0P A;  1TWA H;  1XJV A;  2IY5 B;  2RHQ B;  2DUD A;  5BR8 L;  3OTO L;  4AIM A;  1M90 C;  4LF4 L;  1WFQ A;  3PV0 A;  2NVQ H;  4AYB G;  3GTM H;  1VCI A;  1DGS A;  1KHI A;  4IFD I;  3I4O A;  4BY1 G;  1TWC H;  5E7N A;  5HGQ A;  3NEN A;  1GKH A;  4LF8 L;  1J5E Q;  4DR1 L;  3BJU A;  4OX9 L;  1VQC A;  3HOW G;  2N3S A;  1SRU A;  3KDF B;  2QGQ A;  1QZG A;  2ZTD A;  2NN6 I;  1HNX Q;  2A19 A;  4DV4 Q;  4OON A;  2K50 A;  4IFD J;  4JI1 Q;  3U4V A;  1EIF A;  4IJL A;  4QJF A;  4JI2 L;  1OXT A;  5K36 G;  4B3M L;  2NVT H;  3WWV A;  1WYD A;  4UY8 C;  1FGU A;  2HQL A;  1OXV A;  4GN5 A;  3G48 A;  1L1O A;  3GTK H;  3T1Y L;  4KHP L;  5C4X H;  3STB C;  4R4I A;  5IWA Q;  1YJ9 A;  2MO0 A;  4DV0 L;  3RLF A;  1HNZ Q;  3CCV A;  3PF5 A;  2JJQ A;  4A3G G;  1GVP A;  4DV1 Q;  5J3B A;  2K75 A;  1UEB A;  1S40 A;  4LF6 Q;  3PUZ A;  2B3G A;  5IE8 A;  1PYS B;  4LFB Q;  4QQB X;  4LF7 Q;  1PH8 A;  3PF4 A;  5IYD G;  1LTL A;  4LFA Q;  3K80 C;  4DKA C;  1A62 A;  3PCO B;  2K5N A;  4OO1 I;  4X65 Q;  4HJ5 A;  1VQP A;  5C3E G;  1GO3 E;  1Y1W H;  4A3J G;  1SE8 A;  1K8G A;  4X64 L;  4BA2 I;  4X62 Q;  3H0G H;  2UXC Q;  1N9W A;  3T1H L;  3TQY A;  1VQ8 A;  2E2J H;  2UXD Q;  1NMF A;  4X66 L;  4JI3 L;  5LMU L;  1SMX A;  4UP7 A;  3MXN B;  4JI7 Q;  1PYB A;  4DV5 Q;  1Q86 C;  1N34 L;  4O0A A;  3PO2 G;  2NVY H;  4KHZ A;  4LW1 A;  5IP9 G;  4GN4 B;  1Y1W G;  4JI5 Q;  4JC0 A;  4IPC A;  2BA1 A;  1BKB A;  2Q2U A;  2Y0S G;  3ULJ A;  3D31 A;  3PIO A;  5IP7 H;  3CC2 A;  4QL5 A;  3S1Q H;  1HR0 W;  5C3E H;  3K0X A;  1YI2 A;  1K73 C;  4PZ8 A;  4L5S A;  2N8N A;  4BY7 H;  1Y1V G;  2OQ0 A;  1VQL A;  3CPF A;  1HNW L;  4LF9 L;  3FKI H;  1E3P A;  1IZ6 A;  3FHW A;  3HKS A;  3J80 c;  3DLL A;  4IOC A;  1KQS A;  2HHH Q;  2F4V Q;  1N33 L;  3RLO A;  2ZJQ A;  1SRO A;  2AMC B;  3M4P A;  4K0K Q;  2OTJ A;  4IPD A;  2I5H A;  1KRS A;  4YCU A;  1I5F A;  4A3B H;  2OTL A;  4LF7 L;  5ELO A;  4NXN L;  2VQE Q;  4Y52 H;  1B7Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...