3GTQH

Backtracked rna polymerase ii complex induced by damage
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtqH00
4PZ8A 2B63G 1X9NA 3BZKA 2NZOA 3PUZA 4X62Q 2OQKA 3E9HA 1SE8A 5GROA 4O0AA 5C44G 3RN2A 2R93G 1K83H 1IBML 4BY1H 5JJIA 3BZCA 3FKIH 4AQYL 4A76A 1Z47A 3W1BA 1NE3A 5M5YH 4JOIC 2VZAA 5JEAJ 1Y1VG 2ZM6L 4R4CA 3CCVA 3UDXA 1YHBA 3W1GA 1EQQA 1K73C 1VQKA 4B3MQ 4A3JH 1PH1A 4L5QA 1I3QH 2D62A 1C9OA 1K8GA 4BBRG 4PG3A 3CCRA 4A75A 1X3EA 4IPGA 4DPGA 3HKZG 4NPSA 2D0PA 3CCQA 5LMNW 1JB7A 1IBKQ 3CAMA 1YI2A 1S40A 4DNIA 4GKJL 1JT8A 1J5EQ 1VQJA 4DV1Q 2UUAL 4PZ7A 3T1YQ 2PQAA 1VQMA 5IE8A 1CSQA 1PA6A 4YHHL 3PO3H 3BJUA 4DR1Q 3M3YH 4LF6Q 3HOUG 1LYLA 2C35B 4OWXB 3EIVA 1YHQA 4JI3Q 1Q12A 3S2HH 3M7NA 1Q86C 1X6OA 3TRZA 2L15A 3I4OA 3J80i 4IPHA 1YIJA 1VQEA 3FP9A 4DR7L 4GKKL 1HNXL 2ZTCA 3F2BA 3KLWA 2UXCQ 3CMEA 1TWGH 1NY4A 4X65L 3F2DA 3M85A 3CPWA 3H15A 4GNXB 1XNRQ 1CKMA 3ICEA 2UXDL 2GVAA 2YTXA 4KHZA 4QGUA 1IZ6A 3UE1A 1VQOA 4YCWA 1P8LA 1SRUA 2H5XA 2YV5A 3PGZA 2VQFQ 2PI2A 3UDIA 5IP9G 3G6EA 3U58A 4A3DH 4JV5Q 1D8LA 4JYAL 3K7AH 1RL2A 2WFWA 3GD7A 3UE0A 4IO9A 2KENA 4DV3L 2VUMH 2YTYA 4C3HH 1L1OC 5IWAQ 4LWCA 5EAYA 4DKAC 3HOWG 4DUYQ 3CXCA 1B7YB 4JI2L 5DLQE 1A63A 2Y0SE 4X66Q 1YVCA 2Q2TA 1NMGA 3RLNA 2K52A 1SLJA 1OXXK 2JQOA 3HKSA 4QY7A 4TQUS 2OWOA 4XIGS 1VQLA 1XNQL 4BY1G 1VQGA 1LTLA 4AH6A 4KHPQ 1EQRA 1I50H 1YHAA 5E7NA 1WOCA 2BA1A 3ER0A 3RN5A 2PMZE 1WI5A 1N36L 2A8VA 4A3IH 2JE6I 3CCEA 3D0FA 1PH4A 4LF8Q 1FJGL 3DM3A 3F2CA 1K9MC 4LFCQ 1XMOL 2E2HH 1HNWQ 4A93H 3E9IA 1NJIC 4LFBQ 1FVIA 5C4XG 1VQDA 2JA7H 4BXXH 2DUDA 1A0IA 1SROA 2ZTEA 1E3PA 1VQ4A 1PH9A 1KRSA 4QJFA 2WAQE 5IP7H 1GM5A 1X56A 4A4IA 2KHIA 2HQLA 4MNOA 5C3EH 2NVQH 3U50C 4HIOA 3NELA 1TWAH 2PI2E 1KIXA 1I94L 1PYBA 4JI8Q 3PCOB 4APVA 3G71A 3L2PA 4LFAL 1U5KA 4DR3L 1VQAA 3FHWA 3TS0A 4GNXA 1CKOA 2JK8A 1V43A 3DLLA 4DV2L 1YEZA 1R9TH 2A1AA 4DV4L 1XTDA 4HJ5A 3S1MH 4A3BH 1KQSA 2AKWB 2K4KA 3KDFB 4IPDA 4K0KL 1NMFA 1TWFH 1MJCA 5IY0A 2CQOA 2JA5H 2I5LX 2I5HA 3GDEA 3M4QA 4X64L 3PUYA 5IYBH 2ALYB 3ULPA 2KCTA 3H0GH 3H3VI 4A3GH 5LMNQ 4A3DG 1EFWA 3K8AA 3PO2H 1IXRA 3AFQA 2MNAA 3OTOQ 3I4MH 1M1KC 2LXJA 1A62A 3CMAA 1XPRA 3RLFA 1NBWA 2Y0SG 4EQ5A 3T1HQ 2VUMG 1QUQB 4BY7H 1HH2P 3OYYA 1VQBA 2A19A 1N34Q 1HNZQ 4GOPA 4LF7Q 1B8AA 3K7UC 4JBJA 4RMFA 4OO1G 3J7A5 2UU9Q 1IBLL 4HJ8A 2IT1A 5FLXc 2ES2A 4JI7Q 1TXYA 3HOXH 1JJ2A 3GTPH 4P74A 2Z6KC 1UWVA 3CC4A 3J7ZC 2CFMA 2R6GA 1HR0W 1EYGA 3AYHB 5IYDH 3K80C 3Q8DA 1N32Q 2K5VA 3HOVH 4OWTB 5FJ8G 3I4NH 3ZJYC 2HHHQ 1H95A 5LMUQ 4BBSH 5BR8Q 2NVXH 4L5RC 1KXLA 2WAQG 2NN6G 4YCVA 1PYSB 1QVGA 3CC2A 1VQ6A 3GTKH 5ELNA 4C3IH 4NXNL 4PZ6A 3TEHB 5JEAG 1D7QA 3U4VA 4GN5A 5IP7G 3CCSA 1G291 1YJ9A 3HOYH 3S2DH 5C3EG 3CW2C 2EXDA 1O7IA 2I0QA 2YYZA 4KI0A 1PH8A 3RNUA 1E1TA 1IBKL 1CKNB 1W3SA 2Q2IA 2Z0SA 1VQIA 3HFZB 4JI0Q 4OX9Q 4WJ4A 4A3EH 3T1YL 3WWVA 1HZCA 2CWAA 3EN2A 1GVPA 1I6HH 4YWKA 1V1QA 2RHQB 4YWLA 1KC8C 1TWCH 4FDBA 1PH5A 4A3BG 1YNXA 5IYCH 4DR1L 4DR6L 1PH2A 4DR4L 4GLVB 4TVAB 2JA5G 3RR5A 4AQYQ 3EBEA 2JEBI 3H0GG 1JJCB 4HJAA 4A3GG 5ELOA 1VQ7A 5FLMG 2UXCL 1PV4A 4A3KH 3PO2G 4POGA 4ME3A 3CPFA 2VQEQ 1Z9FA 1OXVA 1XNRL 3S16H 5M5WH 4DV7Q 5HGQA 2ATWA 5C0XG 3I56A 5C0XJ 3ULLA 1X65A 1JE5A 2VS1A 1BKBA 2E8GA 1RIPA 2PNHA 2VL6A 2XGTA 3RZOH 4GKJQ 4JV5L 2UUAQ 1DGSA 4QL5A 1S3OA 1EOVA 4OONA 4DR2Q 2CKZB 3MEFA 4QIWE 3HOXG 4A3MH 5IWAL 4C2MH 4DUYL 2IHEA 2VY3A 5M3MH 1VQHA 2GN5A 3STBC 4X66L 3K0XA 5IYDG 5GADC 4LW1A 2VW9A 1L1OB 2E2JH 2R7ZH 2K5HA 1X3GA 1OXTA 5M3FH 3CCJA 3CC7A 3KF6B 1MJEA 3I4NG 1XMQL 2E2IH 4BBSG 3UDFA 1BVSA 5JJKA 4IOAA 4L5TA 1UE5A 2R7FA 3FKIG 2NVTH 5AJ3L 3CQZH 5GAHC 3K81C 4GLAC 4DK3C 3OW2A 4J15A 4P73A 1LUZA 2CWPA 4LFCL 3G4SA 4A3JG 1HNWL 1UE1A 1CUKA 4JI6Q 4B3SQ 2GVBA 4IOCA 1E24A 3PIPA 2UUBQ 1K0RA 4LF9L 4OO1I 4JI4Q 3ERSX 4YY3Q 4DV5L 2RCNA 4A3EG 4JI5L 3J81i 3S1RH 4DUZL 3M4OH 4JI8L 4GOPC 1HR0Q 1N9WA 4LUVA 5IYCG 4HJ7A 3PIOA 1IL2A 1SR3A 3SGIA 1XNQQ 3PO3G 1I5FA 1BBUA 1VQ8A 4GLXA 1HZ9A 2NN6I 3PV0A 2B63H 2VNUD 4XTCS 1OXSC 1C0AA 1AE3A 4ALPA 5C44H 3PF5A 1WFQA 4JCVE 4JI1Q 1MKHA 4DAYB 3AEVA 1XMOQ 1YBYA 1VQ9A 2DGYA 4DV6Q 3CP0A 1E22A 2F52A 4YWMA 2JEAI 1FL0A 2UUCQ 2BH2A 1KAWA 1UEBA 4IFDG 4LF5Q 4IFDJ 1AH9A 3HOZH 1Q1EA 1ASYA 2E5LQ 4JC0A 4NB3A 3PUXA 4GN3B 2IY5B 4A3MG 3KF6A 1SN8A 3TREA 3IRBA 2AWNA 1HNZL 4LF7L 4LFAQ 5M3MG 5GQOA 2IX0A 1MIUA 1P16A 2R7ZG 4NXMQ 2F4VL 2UXBL 1AE2A 3KF8B 1Q8KA 1Q81C 4AYBE 2N8NA 2ZJRA 1N33L 4K0KQ 2PQAB 1KL9A 2BA0A 2N3SA 4B3RQ 3NBHB 4X64Q 1ASZA 4A3IG 1Y1WH 2IX1A 4GS3A 4X62L 5BR8L 4IPCA 3E0EA 4LF4Q 5C0XI 1SMXA 4HIMA 3RZDH 3S1NH 1E7ZA 4EX5A 4A93G 2ZTDA 2JA8H 2JA7G 4BXXG 2OCEA 4MZ9A 4B3ML 1JMCA 4IJLA 4DV0Q 1Q7YC 1XPUA 3M4PA 2QA4A 3PUWA 1HZBA 1T9HA 5IP9H 4UP7A 1VQ5A 4IJHA 1KRTA 3W5OA 2IHFA 2AHOB 4JI0L 4LUZA 1BBWA 4JBWA 4JG2A 3U4ZA 2R92H 3CCUA 4AIMA 3GTJH 1XPOA 4B3TQ 2R7DA 3KDFA 4DV1L 3VDYA 1J5EL 3L0OA 3HOWH 4DR5Q 2KCMA 3MXNB 4Y52H 1VQPA 5K36G 1K3RA 4R1JA 3B6YA 5GAEC 4OWWB 3J81c 3GTGH 4QQBX 2OTJA 4UP9A 3RLOA 3S24A 2RF4A 3GTQH 3M9BA 4C3JH 4LF6L 1K8AC 4JI3L 1S72A 2ZJPA 1IBMQ 4UPAA 5IYBG 3BU2A 4NXNQ 2HIVA 1Y14B 3D31A 1QUQA 2ZM6Q 3CCLA 1LM0A 2EIFA 3JAMi 2VQEL 1YJWA 4DAMA 1Q46A 3HOZG 2XTIA 4O2DA 1SFOH 4OXPA 2JA6H 1WJJA 4DV7L 3GTOH 4L5SA 1GD7A 5C4XH 1Q82C 3I4MG 5C4JH 4A3LH 2QEXA 2K5NA 1EWIA 4BA2I 4BY7G 4A3CH 4AYBG 3TQYA 2VQFL 2ZJQA 1EIFA 1GO3E 2Z6KA 4R4QA 2KBNA 4DR2L 2MQHA 1NTGA 1KHIA 5J3BA 1L0WA 2YTVA 4X6AH 1JJGA 2F3IA 1PVOA 3GTLH 4DR6Q 3F8TA 1VCIA 2K14A 4P71A 4DK6C 4YHHQ 3G48A 3NENA 4HIKA 4DR4Q 1OXUA 4YCUA 1Y1WG 4KLKA 1VS0A 1QZGA 3KFUA 3HOVG 1XJVA 4GNXC 4KHPL 1X54A 3F1ZA 4R4IA 1GKHA 4JOIA 4DR7Q 1HNXQ 4GKKQ 1VQFA 2JA8G 4IFDI 3PUVA 3S14H 2WB1E 4X65Q 1CKNA 3CF5A 4LF8L 1VQNA 1J6QA 2Q2HA 2WP8J 3I7FA 3S17H 2UXDQ 4JI6L 1N8RC 4B3SL 3HOYG 2BH8A 2I5MX 3CD6A 2UUBL 2AMCB 4LFBL 2MFIA 4JI4L 2R92G 4YY3L 4JYAQ 1UE6A 1VQCA 1WCMH 1EUJA 2K50A 1TWHH 3GTMH 4DV3Q 4P72A 2N78A 1G6PA 4R4TA 2QGQA 3KOJA 4JI2Q 4A3FH 5GAGC 1HR0L 1YITA 2Q2UA 2KHJA 1XMQQ 4JBKA 1B70B 4JBMA 4GOPB 4R4OA 4HIDA 5AJ3Q 5JJLA 2AWOA 1N36Q 3I55A 5FJ8H 4JI1L 3STBD 4A3KG 2LXKA 1FJGQ 2JA6G 1C7YA 1L2FA 3NEMA 4HJ9A 2R93H 4DV6L 1UE7A 5HY6A 2ASBA 4A3LG 2LSSA 2RHSB 4LF9Q 2B29A 3A5ZB 3KJPA 1QZHA 3KJOA 1Y1VH 4DV5Q 1EIYB 2UUCL 5LMNL 4A3CG 4LF5L 4POFA 3J81j 3UDGA 2E5LL 4LNQA 3S1QH 3OTOL 1YZ6A 1PFSA 4JI5Q 3JAMc 3CCMA 4DUZQ 1L1OA 4BBRH 2CCZA 4BA1I 3T1HL 3GO5A 1M90C 4RG1A 3H3VH 3PF4A 3AFPA 3A5UA 4UY8C 1N34L 5M5XH 1I94Q 1G51A 1V9PA 3KYHC 3I2ZA 4DR3Q 2B3GA 4NXML 3PSIA 2YU9H 3HKZE 2JJQA 4MTNA 2UU9L 4DV2Q 1KD1C 5M3FG 2JA9A 2NZHA 2WB1G 4PMWA 5IT9c 4DV4Q 2OTLA 4JI7L 3TS2A 1PH3A 1HZAA 1WYDA 4B3RL 2V1CC 1X55A 2OQ0A 4UP8A 3HOUH 1QVFA 2NVYH 3L7ZC 1N32L 1CSPA 3J80c 1QVCA 5FLMH 1A8VA 4H02A 4LF4L 1OTCA 2HHHL 1IYJB 1X3FA 3JC66 5LMUL 1FGUA 3AQQA 1W2BA 2MO1A 1YJNA 3ULJA 2MO0A 1HJPA 4Y7NH 4DV0L 1WCMG 4P75A 3A74A 2FXQA 2D0OA 2HIXA 1PH7A 1E1OA 5H1SE 4A3FG 1PH6A 2ID0A 4WJ3M 2F4VQ 2UXBQ 3LGJA 4B3TL 3A0JA 2K75A 4OX9L 1IBLQ 3S15H 2N49A 1PHJA 1U0LA 4LUOA 4DR5L 2HT1A 1N33Q 1Q1BA 4GN4B 2EQSA
chains in the Genus database with same CATH superfamily
2B63G 2R3ZA 4DGZA 4X62Q 1Y8OB 4HMJA 3RN2A 2A6HD 2XNAC 4BY1H 5JJIA 4ZK9B 3W1BA 1NE3A 5JEAJ 1Y1VG 4R4CA 1EQQA 1I3QH 3S1MB 1EU4A 3MZ5A 1K8GA 4DPGA 4G4KA 1SYBA 1TWFB 1RKNA 4E6IA 3CAMA 4DNIA 1PTOD 4DV1Q 2B2WC 2MHVA 1PA6A 1QG7A 3OMCA 4TSSA 4LF6Q 3HOUG 4OWXB 1SSOA 5F2DA 3VA7A 3KLWA 1TWGH 3HOXB 4X65L 4FNFA 3F2DA 4GNXB 3TSSA 3GTPB 1G2SA 5J22A 4YCWA 2H5XA 1SRUA 3GV3A 2PI2A 3IFDA 1RDPD 5IP9G 3MXNA 3Q0AA 4JYAL 2NVXB 2WFWA 3EQLC 3GD7A 1K83B 4IO9A 3C2PA 2KENA 4DV3L 3GTKB 3FKIB 2MP1A 1L1OC 5EAYA 5M5YB 5DLQE 1SNOA 2FHTA 4IUUA 2VB2X 1NSNS 2K52A 2OWOA 4KHPQ 2C9OA 1IYUA 5E7NA 4A3EB 1WOCA 2BA1A 3ER0A 3RN5A 2PMZE 1PTOF 1PH4A 3DWQA 1I6HB 1K9MC 2E2HH 2F0SA 5C4XG 1VQDA 3SDZA 2JA7H 4BXXH 4IUNA 2RCFA 4PV1C 4QJFA 5IP7H 1X56A 4A4IA 2KHIA 3Q22A 2PI2E 2AUJD 3S16B 1LTSD 3G71A 1B2TA 2DN8A 1VQAA 1ML0D 3TS0A 1CKOA 2JK8A 2R61A 4EVOA 1RF2D 1R9TH 2A1AA 3R2TA 2AKWB 2CW0C 2K4KA 4ZUIA 1STYA 1MJCA 1PFBA 5CV5A 4C2MB 1QNKA 3PUYA 5M3MB 5IYBH 4JVZA 3H0GH 5IIFA 3H3VI 5EPKA 2E74C 3BYTB 4LJZC 4A3DG 1EFWA 3PO2H 1IXRA 1GHJA 3BDLA 4M1UB 1ENFA 2EYOA 4C3HG 1HH2P 3CQZB 5C0XH 1N34Q 3H6MA 1SYEA 4GOPA 2Q8IB 1B8AA 1J8IA 4L63B 4XXEA 1IBLL 3NE5B 2ES2A 1JR0D 4I65A 3KBXA 3Q24A 4P2CB 3OHXC 3KLSX 4CJ2C 3CC4A 2CFMA 2R6GA 3VR6A 1SE3A 3K5OA 3K58A 1TS4A 5I2YA 2SNMA 1PYSB 3BDCA 2CW0D 1VQ6A 4C3IH 4NXNL 5I6WA 3K0YA 4GN5A 1D1IA 2N55A 4K2LA 1JB3A 1WTWA 3A56A 1PH8A 3NBIA 2QDBA 1EY6A 1W3SA 2Q2IA 1VMCA 2B8GA 1GUSA 3WWVA 1HZCA 3GV6A 1GVPA 1V1QA 3H3VC 4A3BG 1TT2A 3I4MB 4DR6L 1PH2A 4DR4L 4KK7A 4AQYQ 4A3GG 1CI3M 1HPCA 1TR5A 5FLMG 1VQ7A 4POGA 3MWYW 3P7JA 2F0GA 2M00A 1X65A 4GKJQ 2VS1A 4KKTA 3LNNA 1PZID 1EOVA 2CKZB 4QIWE 3EROA 3H91A 2F0OA 1U9RA 3STBC 3K0XA 3MEHA 1X3GA 2NB0A 5M3FH 1MJEA 3I4NG 4DXFA 4BBSG 1XMQL 1DZ1A 1PFMA 1BO0A 2KUMA 4IOAA 2K28A 5AJ3L 1SNQA 5GAHC 3KLRA 1JCKB 1LUZA 3URYA 5FOBB 3GTGB 4RAUC 5A2QL 3H94A 4F87A 4IOCA 3GTQB 3W3AA 1K0RA 3D4RA 3QR8A 4LF9L 2B2WA 4JI4Q 3ERSX 4YY3Q 1QWYA 3JAME 2MUYA 2O4XA 1YNJD 1STNA 4JI5L 4R9WA 1VF5C 2JA6B 4LUVA 4HJ7A 1PFNA 1HRJA 2K32A 1HZ9A 4FF4A 2VNUD 1C0AA 3NUCA 4RKBA 4ALPA 1DJRD 4JI1Q 1MKHA 4DAYB 1BCPC 3AEVA 1XMOQ 3J80E 4CDFC 2DGYA 4DV6Q 1X32A 3CP0A 5G3LD 2F52A 1G91A 5KIXA 4LF5Q 4IFDJ 2WB1B 3A7LA 3TREA 3GQBA 3N6RA 4QMGA 2JP1A 5GQOA 4XYOA 3NP8A 3KF8B 1Q8KA 2B2UA 5EPLA 2E76C 1SEBD 5FK9C 1WCMB 3IAYA 1CHQD 5IGGA 1ASZA 2IX1A 4A3FB 4IPCA 1I4XA 5C0XI 3RZDH 1AZQA 4EX5A 1EL0A 1BCPD 4B3ML 1JMCA 1LV9A 1SNCA 4PNYA 5JAVA 3HZXA 4UP7A 3OIQA 4H0LC 3W5OA 2IHFA 3CU7A 4LUZA 4JBWA 3U4ZA 3U9OA 4J6HA 4AIMA 3GTJH 3HOWH 3TP6A 4HMIA 1Y1VB 1ILPA 1VQPA 5K36G 3B6YA 4QQBX 3MC0B 4G7ZC 5FLXL 2G9HD 3S24A 1EEID 5JPMC 5I6YA 1PZJD 4JI3L 3NK9A 4UPAA 2HIVA 2EIFA 3DM1A 3JAMi 4MN3A 3NWTA 4OXPA 1GD7A 1Q82C 4A3LH 1BUVT 2G9DA 3HOUB 4BY7G 2NVYB 4QUCA 2VQFL 1EIFA 1GO3E 4R4QA 2ENBA 2KBNA 2XRQD 1L0WA 1QE6A 1PVOA 2E75C 2EVBA 3CRLC 4HCSA 4P71A 5I9OA 4IN3A 3VR2A 1X3QA 3N52A 5E4WC 1X54A 1SYGA 4R4IA 4JOIA 1HNXQ 3S15B 2G5DA 1VQFA 2JA8G 5KYLA 2F0KA 3CF5A 1RHPA 2WP8J 3S17H 2A68D 1WTQA 2I5MX 2FMCA 3AB9A 3CD6A 3GP7A 2MFIA 4JI4L 1K8OA 4YY3L 1VQCA 1EUJA 2HDMA 4XYQA 3TZDA 4P72A 2N78A 3KOJA 4JI2Q 5JVH3 4HR7B 2NTTA 1LTID 2O5IC 3OOCA 1NR2A 2Q2UA 4C3JG 1T5EA 2EE1A 5DNFA 1HXYD 5IGCA 5JJLA 2AWOA 1N36Q 4JI1L 1GUNA 1FJGQ 3KBGA 4DV6L 5HY6A 2F4IA 2RHSB 2B29A 5JEAH 3KJPA 1SE2A 4A3CG 3VYSA 3S2HB 3R2IA 4LF5L 1BF4A 4POFA 3S1QH 3UDGA 4LNQA 4KHVA 3IL8A 1UAPA 2CCZA 5BN3A 3AFPA 1I94Q 1I4HA 5D3IB 2B3GA 4DR3Q 2PQEA 3QJYA 4A3DB 3TS2A 1KDBA 2OTLA 1G8ZD 1SJHD 1RCVD 1HZAA 4Z9CB 1X55A 4C3HB 5EJWA 1CSPA 4EQNA 3BVZA 3AMUA 1OTCA 5LMUL 2RDFA 4FXKC 5T1GA 1W2BA 1HJPA 3BG3A 3EA6A 4Y7NH 4P75A 1I50B 1H9RA 4A3IB 3F2UA 1S5FD 2ID0A 1DOKA 2F4VQ 5CYUA 4WJ3M 4OX9L 4A93B 2N49A 5ELFA 1QJOA 1Q1BA 4DAYA 4CGYB 2EQSA 4RFBA 1JWUD 4RGTA 3PUZA 1TWAB 3E9HA 5C44G 2R93G 1K83H 3BZCA 2L55A 3FKIH 4K5XA 4A76A 4PMBA 5M5YH 2VZAA 3CCVA 1JC7A 2YU9B 1K73C 1WD1A 3FDTA 1STBA 2F0QA 4A3BB 2PCFB 4IPGA 1JB7A 3KF8A 1QNUA 4NPSA 5LMNW 2RDHA 4G57A 1IBKQ 2CH4A 4ZYSA 1YI2A 2KECA 4OIKA 2QCPX 3T1YQ 4A3GB 1ICWA 1VQMA 3DEOA 5IE8A 4EQPA 4PMCA 3ZYYX 1NR4A 3PO3H 3BJUA 2PPBC 2C35B 4HEDA 3EIVA 1YHQA 1V8QA 3I4OA 1EYDA 3FP9A 5FO7B 3SVMA 1HNXL 2UXCQ 1EY7A 3E5SA 4RHSA 1EEFD 2SEBD 3I73A 2KVMA 3ICEA 4QGUA 4TRDA 2PW5A 1GHKA 2O2LD 3LWEA 1P8LA 2SNSA 2LS01 3PGZA 3HOVB 3I4NB 3K7AH 4BBSB 2F0JA 4ILWA 3R93A 2D9UA 1HQRD 1MD2D 2K5DA 3Q6SA 3D6CA 5IWAQ 4CKEA 1TY2A 4DUYQ 4JI2L 3S9WA 1NNXA 2LY7A 1SMYD 3HOYB 3S2DB 1YVCA 2Q2TA 1NMGA 3HKSA 1SLJA 3E6ZX 4XQNA 4BY1G 1VQGA 5CGKA 1YHAA 2EYPA 1WTRA 1ESFA 1FNVA 1N36L 3CCEA 2WACA 5I4DA 1FJGL 5IGEA 1TWCB 3P75A 4RKLA 1NJIC 1PYWD 1E3PA 1U4PA 1SXTA 5LHY1 2HQLA 5C3EH 4A3KB 1I94L 1PYBA 4JI8Q 5J39A 2B2YA 1U5KA 4DR3L 1O7ZA 4CHTB 3DLLA 3NQTA 1YEZA 1BNZA 1F9PA 2HDLA 1KQSA 4K0KL 5IY0A 2CQOA 2JA5H 2I5HA 5EKKA 1PMRA 2AQ2B 3ULPA 2KCTA 2E2JB 5LMNQ 3K8AA 1CA6A 1L0XB 3OTOQ 3I4MH 5IGBA 2LXJA 3CMAA 2NTSA 1U4MA 4EQ5A 1IL8A 3T1HQ 1GUGA 1XPRA 2NVTB 2L9HA 4LF7Q 4JBJA 3JAML 3K5MA 4RHRA 1XTCD 1CK1A 3D3RA 4HJ8A 4JI7Q 2GA4B 1TXYA 2HUGA 2Z6KC 4P74A 3J81E 2PYKA 5KNBA 3MHBA 1D5MC 2F0MA 1UNSA 5T1IA 3M4OB 4OWTB 4CDDC 5NUCA 2HHHQ 1H95A 3X3MA 5BR8Q 5E4XA 1A2UA 1K0SA 4KD4A 1S5BD 2HD3A 4IUPA 4KN4C 4HCEA 1CFMA 5ELNA 4IALA 4XT3B 1A15A 4N9PA 5CV9A 5IP7G 1YJ9A 2BE5C 5CORA 4ABNA 2YYZA 1E1TA 1IBKL 1ENCA 4WJ4A 1EQTA 1Z6HA 3T1YL 2LKVA 1LABA 2CWAA 3EN2A 5IGDA 1TY0A 2HQEA 3I4LA 4YWLA 1KC8C 1YNXA 5IYCH 3SR1A 1SYFA 3HKZB 1ET6A 4TVAB 4BY7B 2CH4W 2JEBI 3H0GG 2RSOA 2UXCL 1NAPA 1EZ6A 3PO2G 4X3UA 2KHSA 2VQEQ 1OXVA 3NXWA 4K14A 5M5WH 2ATWA 5C0XG 3I56A 1JE5A 2VL6A 3RZOH 2UUAQ 1UUPA 4IFDH 1S5DD 2M9VA 4K8IA 2L12A 1UEAB 3MEFA 4A3MH 5IWAL 2PZUA 4DUYL 2JA8B 2IHEA 5ELBA 1VQHA 2GN5A 2NYZD 3U9SA 5GADC 2VW9A 2R7ZH 1L1OB 1OXTA 3MVVA 2E2IH 1BVSA 1UE5A 3M4YA 2J7ZA 3RMHA 4LK1C 1HFGA 3OW2A 4J15A 3FPUB 5M9OA 4A3JG 1UE1A 1HA6A 1SE4A 4ZKCB 3PIPA 3K5NA 4C3JB 2QF7A 1PZKD 2B2TC 3QO2A 1GXDC 3J81i 3S1RH 4DUZL 2FINB 5L37A 2L1BA 1V1PB 4JI8L 1SFOB 3FEWX 3PIOA 4ZRZA 3K57A 1SR3A 5C4JB 1XNQQ 1BBUA 1BBXC 4GLXA 5IT9E 2B63H 2EYFA 1AE3A 1WTPA 1A3TA 2SDFA 1VQ9A 1E22A 4YWMA 3A8KE 1FL0A 1LTGD 2UUCQ 3CKIB 1HCZA 3HOZH 1Q1EA 1ASYA 1AH9A 3PUXA 4KY5A 1TS3A 3OWEB 3IRBA 3SE0A 1DCZA 2KA7A 4LFAQ 4LF7L 2IX0A 4NP5A 1MIUA 5C6AA 2UXBL 2JXMB 1Q81C 1IHZA 2N8NA 3TDQA 4G7OC 2ZT9C 2F0EA 3BS1A 4X64Q 1EQVA 4A3IG 1Y1WH 4GS3A 4X62L 5BR8L 2Z8LA 3S1NH 4A93G 3M7GA 2NBFA 2OCEA 4MZ9A 4DV0Q 3IFTA 1T9HA 5IP9H 1DD2A 5JPNC 4IURA 5C44B 2R92H 2WAQB 2R93B 1XPOA 4B3TQ 2BDOA 1LTRD 4DV1L 3L0OA 5E3FA 3PIP3 3NSWA 2K1BA 4C56C 4Y52H 4WFN3 3VYTA 3MFYA 4H7BA 4KY6A 2DJFC 4LF6L 1GJXA 1S72A 2ZJPA 5COYA 3SK5A 3HP3A 4B9XA 5I2XA 1HA5A 3HG9A 3PIO3 5M5XB 4JK1C 1VDZA 1Y14B 2ZM6Q 4RH6A 2VQEL 2F0VA 4DAMA 1TS2A 1Q46A 5IODA 1ZXTA 2XTIA 3GTOH 4HAEA 5C4XH 2DJGC 5HURA 2J0TD 3TQYA 4KD3A 2Z6KA 1JJGA 1NTGA 5J3BA 3T56B 2Q8TA 2F3IA 1ICFB 3GTLH 4IUVA 3F8TA 2K14A 3MTSA 4YHHQ 3NENA 1OXUA 4YCUA 1STEA 4R8NA 4WJWA 1QZGA 5JVG3 3HOVG 4KHPL 1V1OA 3F1ZA 4DR7Q 1ZKOA 4IFDI 3PUVA 3S14H 3J7YW 1B1ZA 1J6QA 3I7FA 2FMMA 4ZAIA 1MBYA 4L8JA 3T53B 3HOYG 4DXGA 2AMCB 1VMPA 4LMQD 4BY1B 4XDXA 1TWHH 2C5CA 2XIWA 3GTMH 2B2VC 1MSGA 4R4TA 5BN4A 3SXHA 3QIAA 2KHJA 4JBKA 4RCOA 2FFKB 5CV7A 4R4OA 4HIDA 2BOSA 2EXZA 1F9RA 2XN9C 3D6WA 3STBD 4A3KG 1C7YA 4OIJA 1U4LA 2IJ0A 4ODGA 1F2ZA 4A3LG 3C1FA 1BCPB 3A5ZB 1G6ZA 2UUCL 2WINB 4DV5Q 4FF2A 2F0LA 3J81j 1PFSA 1G2TA 3CCMA 1X3PA 1L1OA 4BBRH 1M90C 1TWGB 3P1HA 3A5UA 4UY8C 1N34L 4C1NI 1G51A 2H1EA 3KYHC 1JQYD 3I2ZA 4DFAA 2YU9H 3HKZE 2RSNA 4RGMA 2QW7A 4DV2Q 3FMCA 1KD1C 1ET9A 2CVRA 5IGFA 1IW7C 1PH3A 5KEEA 4ZCKA 1IKMA 4HSPA 3L7ZC 5FLMH 1A8VA 3JC66 1LT3D 1EY8A 4QCLA 2A69C 1YJNA 2MO0A 3OW7A 1V1PA 4DV0L 2NZ1D 4Q5VA 3A74A 5EBDA 4UDUC 2HIXA 1PH7A 2EYHA 1HUMA 1PDQA 4B3TL 3V2TA 2K75A 2E2HB 1EFID 3DXJC 4YIJA 1U0LA 4LUOA 2HT1A 1HTLD 2JA7B 3L3OC 1N33Q 4GN4B 3FRPB 5G3LF 4PZ8A 1X9NA 2NZOA 2OQKA 1SE8A 5CV4A 2P5ZX 1O78A 1KLGD 4AQYL 3I72A 3D4DA 2ZM6L 2NVQH 3UDXA 5ELCA 2F03A 4L6TB 2PZTA 2CHBD 2D62A 1C9OA 3CCRA 5J1ZA 2ZXOA 4A75A 4X3TA 1X3EA 3HKZG 2D0PA 1B4OA 2A69D 4RGNA 3CCQA 4GKJL 1J5EQ 3H0GB 4PZ7A 4CKCA 3PO2B 4WORA 1CSQA 4K6LA 1CQFA 4YHHL 1I4RA 4DR1Q 4N8X1 3M3YH 1BCPF 1Q12A 3M7NA 2OEOA 1Q86C 2L15A 1YIJA 3J80i 4IPHA 3J81L 1VQEA 4DR7L 1XYIA 3CMEA 3SK6A 3CPWA 1D1KA 3A7AB 3H15A 4K2KA 1CKMA 1F9SA 3BDOA 3KLSA 1RTNA 2YV5A 3U58A 3UDIA 1PRTC 4NKLA 2CQAA 4JV5Q 1D8LA 1A3UA 1RL2A 5DAUA 2RVLA 3UE0A 2VUMH 5EBCA 4C3IB 4LWCA 1KLUD 2F0IA 4DK0A 1HTPA 4OO1H 4A3JB 3RLNA 4TQUS 5ELDA 4QY7A 2H4OA 4XIGS 1JOQA 3NQIA 4N9TA 1Q8IA 1PTOH 2A8VA 3QB3A 2JE6I 2K01A 1EY9A 3D0FA 1LO5D 4LF8Q 1LTBD 3DM3A 4NMZA 3F2CA 1XMOL 4LFBQ 3SK4A 2NN6H 1FVIA 4FXGC 2DUDA 1A0IA 1E2VA 1SROA 2WV6D 2WAQE 1STGA 4ID6A 5EQ0A 1Z7TA 1KIXA 1PRTD 1DXMA 1CTMA 4APVA 2K03A 4O1NA 1TVXA 3FHWA 1V43A 5K36H 4DV2L 2WIIB 5C3XA 1F2MA 1SBBB 3S1MH 1E0BA 3KDFB 1TWFH 4K5VA 3GDEA 1B50A 2ALYB 2AQ1B 4BS9A 5M3FB 2MNAA 1M1KC 2JN4A 4DNRB 2B2VA 3E3XA 2V4DA 2EYLA 1QUQB 4BY7H 3OYYA 1VQBA 2JSOA 2QEJC 3K7UC 2UU9Q 5LL6S 5FLXc 5A35A 3HOXH 3GTPH 2L5TA 3J7ZC 3WDNA 3T16A 2PO4A 1EYGA 3KK7A 5IYDH 2K04A 3K80C 3Q8DA 2D5DA 2K5VA 1N32Q 4G7HC 5FJ8G 5IT9L 1S5CD 2O5JC 1O80A 2NVXH 1PLFA 2WAQG 3GTKH 3TEHB 1M8AA 3BZDB 1GUWA 3NPPA 2F0HA 5C3EG 1LT5D 4JW0A 4J1MA 2EXDA 1O7IA 4KI0A 2F0PA 2Z0SA 4CDCC 3HFZB 1BOSA 5ISRA 4A3EH 2F0WA 1I6HH 1K8MA 2RHQB 2F0DA 4FDBA 2LMCB 1PH5A 4DR1L 3W2DA 2Z9HA 4KY7A 2JA5G 3C46A 3RR5A 1SNDA 3EBEA 2F0TA 1SNPA 1FD7D 1KAAA 2K6AA 5ELOA 1PV4A 1Q3LA 1KDCA 3S16H 1C4QA 4DN4M 1CQVA 3ULLA 1F2LA 3D8GA 1RIPA 2PNHA 3HRZC 5JJZA 4JV5L 4QL5A 3RZDB 5DM73 2OF1A 3J7AV 4C2MH 1D2BA 1IYVA 1O7YA 4K6DA 5M3MH 1JWSD 2L11A 4LW1A 3NWSA 2K5HA 4KKSA 3CCJA 3CC7A 3TN2A 1AN8A 2IW3A 3UDFA 5BN5A 3TP7A 1D6EC 3V96A 3GTJB 1LTAD 3CQZH 1MHWC 3HOWB 4C1NK 1F77A 3E0JA 4GLAC 2Z4HA 3DWPA 2CWPA 4P73A 1CUKA 1SAPA 3BVMA 2GVBA 4OO1I 1XWEA 1H9SB 2PZWA 1RD9D 1NUCA 4UAIA 2RQXA 4MIUA 5ELEA 4DAPA 2JYOA 4GOPC 1I4GA 1N9WA 5IYCG 1AP0A 1IL2A 1I5FA 1VQ8A 2NN6I 3PV0A 4XTCS 3MXUA 4QUFA 5C44H 3QOLA 1WFQA 4JCVE 1H9MA 1A2TA 2Z4IA 5CR3A 1YBYA 2F1MA 3VYRA 3MAQA 1NCVA 2DY7A 2JEAI 2KJXA 1MGSA 2D2CC 1KAWA 1L0YB 1UEBA 4IFDG 1STAA 4CDEC 1J9OA 4JC0A 3NHHA 3FVQA 4A3MG 3KF6A 1SN8A 2AWNA 3LWUA 3VYUA 2R7ZG 2EY2A 3S17B 2A6HC 2EYMA 2F4VL 2AQ3B 2ZJRA 2EYJA 4X3SA 1JOKA 2PQAB 1KL9A 2BA0A 2N3SA 5KGUA 1QILA 4LF4Q 3I70A 4HIMA 3NTIA 1E7ZA 1Y69U 3TP5A 1PTOC 2JA7G 4BXXG 4F7XA 4ZUJA 2IWHA 1B3AA 4RCNA 3TMEA 3M4PA 1DM0B 2X69A 3J80L 1HZBA 1Y8NB 2EDGA 4IJHA 1VQ5A 1KRTA 1BBWA 3CCUA 3KDFA 3MA2B 3VDYA 3P20A 2B8FA 1K3RA 1FR3A 4R1JA 3S1QB 5GAEC 3GTGH 2PW7A 4UP9A 3C3LA 3GTQH 3M9BA 1WTHA 1ZYRC 1STHA 1IBMQ 5IYBG 4NXNQ 3D31A 1D5ZC 1QUQA 1YJWA 1C8CA 3HOZG 4O2DA 2JA6H 4L5SA 1PXUA 2QEXA 1EWIA 4J8QA 4BA2I 2ZJQA 1ESRA 3NBHA 4X6AH 2BE5D 1QCBD 1BDOA 4Y7NB 4DU9A 4DR6Q 4DR4Q 3G48A 3ONAB 3LX0A 1Y1WG 1LT6D 4KLKA 1VS0A 3KFUA 1MI2A 4GNXC 1XJVA 1GKHA 3WOFA 2Q8RE 4GKKQ 1I6VC 4KMUC 1ZYRD 4C3IG 2EY5A 1VQNA 2UXDQ 1FYCA 1ENAA 1EY4A 1DOLA 1EY0A 1SYDA 4CKBA 1B44D 1BXTA 2R92G 2KQ3A 3VA5A 1WCMH 4XQQA 3EFXD 4EQOA 2Z6BA 1U4RA 1G6PA 2QKIC 4A3FH 5GAGC 1FNWA 1I4PA 1YITA 2EJGC 1XMQQ 1B70B 2B2UC 4HSVA 1LT4D 1AEXA 5AJ3Q 5FO8B 3I55A 1XXGA 2LXKA 2F3VA 1UE7A 2ASBA 3PO3B 4TKOB 2LSSA 4LF9Q 1QZHA 3KJOA 1Y1VH 5LMNL 3OTOL 1YZ6A 4JI5Q 3JAMc 3RD4A 1TIID 3NTKA 4BA1I 3GO5A 3T1HL 4RG1A 2A5HA 3PSIA 5M3FG 4PMWA 4JI7L 3K7AB 4DV4Q 1WVLA 2F3WA 1WYDA 4I7AA 3A54A 5CBEE 4JPBW 2Z1CA 3HOUH 1KABA 2NVYH 1E2ZA 2L4NA 3J80c 4LF4L 4H02A 2HHHL 3VR5A 1H9SA 1X3FA 4IQZA 3AQQA 5KNCA 4ME5A 2MO1A 3T51B 2DNCA 1HFNA 2I07B 1QB5D 2FXQA 2K5WA 5H1SE 2WKCA 1PH6A 5C5LA 3LGJA 1EIHA 3K5LA 4U68A 3S15H 1PHJA 3PQIA 4QF4A 1YNNC 2EOTA 5C3EB 3BZKA 1CHPD 5GROA 4O0AA 1IBML 2J4XA 4EGVA 2RA4A 5KNDA 1H9JA 1Z47A 4MHEA 4JOIC 1WTXA 1VQKA 4B3MQ 1YHBA 3W1GA 4A3JH 1PH1A 4L5QA 4FO2A 2ICEC 4XQJA 1LACA 4BBRG 4PG3A 4K5WA 4MTKA 2KCCA 1A3VA 4FF1A 1S40A 2JA5B 1TQOA 1JT8A 1VQJA 3Q23A 1SJED 2UUAL 2PQAA 1B53A 2XWBB 1LYLA 4JI3Q 3S2HH 4AYBB 1X6OA 4BWGB 3TRZA 1RODA 2SOBA 3I3CA 4F8MA 1YNND 4H44C 2VXWA 4ZLTF 4GKKL 5CV6A 2ZTCA 3F2BA 1NY4A 2I46A 3R3OA 3M85A 2XSCA 1YNJC 1XNRQ 2UXDL 2GVAA 1KTKA 2YTXA 4KHZA 3A8IE 1IZ6A 3UE1A 1VQOA 4FYDA 1GOZA 2VQFQ 4A3DH 3G6EA 2TMPA 2B39A 3I91A 5CC4A 1I4QA 5D3DA 1EZ8A 1EYCA 2M2LA 2YTYA 4C3HH 3IKJA 2E2DC 4DKAC 3HOWG 2A73B 3CXCA 1B7YB 1RTOA 1A63A 2Y0SE 1S5ED 4X66Q 1I3QB 1D5XC 1OXXK 2JQOA 3MXGA 3HGBA 1VQLA 5TSSA 4AH6A 1LLRD 1LTLA 1XNQL 1EQRA 2WKDA 1I50H 3WOEA 4KJNA 1WI5A 2NWGA 3OWFA 1B9NA 4A3IH 1R4QB 4UHVA 4RGOS 1MSHA 4LFCQ 1HNWQ 4A93H 3E9IA 3T4AC 3PMFA 1FNUA 4PQXA 2ZTEA 1VQ4A 1PH9A 1KRSA 1GM5A 4MNOA 2TSSA 3I90A 2IL8A 3U50C 4HIOA 3NELA 1TWAH 1JE4A 3PCOB 3L2PA 2EY1A 5M5WB 4LFAL 4GNXA 1W6KA 1M4VA 4Q0FA 4IUQA 4RA8A 3RZOB 4DV4L 1XTDA 2EJFC 3DHQA 4HJ5A 1B9MA 4A3BH 4IPDA 2K7VA 1NMFA 4A3MB 3NTHA 2I5LX 1CZGA 3M4QA 4GZYC 2AUKA 4X64L 2KOLA 3D4WA 2R7ZB 4A3GH 3DWAA 3AFQA 2E2IB 2B2TA 2VB3X 1A62A 2VUMG 3RLFA 1NBWA 3HS0C 2Y0SG 2PNRC 2A19A 1HNZQ 4RMFA 4OO1G 3J7A5 1JICA 3EJIA 2IT1A 1JJ2A 3SEBA 1UWVA 3TP8A 1EWCA 2KEEA 1VF7A 1CT1D 1HR0W 3AYHB 3O13A 1FGBD 3S1RB 3HOVH 1EYAA 3ZJYC 3I4NH 5LMUQ 4BBSH 4L5RC 1KXLA 2NN6G 4YCVA 1TU2B 1QVGA 3CC2A 2RKSA 1IW7D 4PZ6A 2DY8A 1O7LA 4M8AA 5JEAG 1D7QA 3U4VA 4K8JA 3CCSA 1G291 2ICIA 2B63B 3HOYH 3DUZA 3S2DH 1R9TB 1TKWB 3CW2C 2I0QA 3RNUA 4XT1B 1CKNB 1VQIA 4JI0Q 4OX9Q 4OEMB 4CJ0B 1KNEA 1GUOA 2F0FA 4YWKA 1TWCH 3HOZB 5E1FA 5C4HA 3VR4A 1E2WA 2MGSA 4GLVB 1DONA 2A68C 2X6GA 1JJCB 4HJAA 4ULLA 4HTHA 4A3KH 1Q90A 3BYYB 4ME3A 3CPFA 5EKLA 2MPMA 1Z9FA 4FP5D 1XNRL 1B3QA 1SYCA 3I8ZA 4DV7Q 1ILQA 4IUTA 2XRSD 5HGQA 3A55A 5C0XJ 4KV6A 1BKBA 2E8GA 1Y1WB 2XGTA 1F9QA 1DGSA 1S3OA 5FO9B 4OONA 3S1NB 4DR2Q 1PRTB 3RUZA 3HOXG 2VY3A 4NDXA 4X66L 2E2JH 5IYDG 2B2YC 1CM9A 4HN7A 3A8JE 4OGQC 5KRUA 1W6JA 3KF6B 5LL6X 1DOMA 2R92B 2IPKD 5CV8A 5JJKA 2ZXRA 4L5TA 3FKIG 2R7FA 4X3KA 5I9PA 4U673 4V190 2EY6A 2NVTH 5KYIA 1R4PB 2HCIA 2K05A 3K81C 2KCNA 4DK3C 3G4SA 5DEHA 4LFCL 1HNWL 1CA5A 3OSOA 4B3SQ 4JI6Q 1EOTA 1HHVA 1E24A 1AFPA 2UUBQ 2KEDA 4OELB 4QB4A 3V05A 4A3EG 4DV5L 2RCNA 4CBVA 1A6XA 2EJMA 3M4OH 1WTOA 1BQQT 1HR0Q 3GTOB 5C4XB 3SGIA 3PO3G 4B9WA 5DM63 1SDFA 2NUCA 3ND8A 3R8BA 1OXSC 3H09A 3PF5A 2MJ8A 2RDGA 3GTLB 2ZXPA 1H9KA 3QWNA 5EGTA 2BH2A 2E5LQ 5CBAE 4NB3A 4GN3B 2IY5B 4CJ1B 1ZEQX 1TS5A 4KN7C 1HNZL 3CHBD 3S14B 3G7LA 5M3MG 1AZPA 4ZQ3A 2FJ2A 2N88A 1P16A 3ITPA 5AFWA 2A74C 4KJOA 4NXMQ 1AE2A 1C48A 2RBMA 4FXDA 2F0UA 2OXPA 4AYBE 1N33L 4K0KQ 1TWHB 3EVQA 3GTMB 4B3RQ 4H13C 3NBHB 3ERQA 4I7ZC 3E0EA 4N8FA 1SMXA 5HGTA 2PMZB 2BCOA 4B08A 1PRTF 1OO9B 4F88A 2ZTDA 2JA8H 4IJLA 1Q7YC 1XPUA 2QA4A 3PUWA 3SK8A 3T13A 2EPBA 2AHOB 4KTAA 4JI0L 4JG2A 4NW2A 4DA2A 2R7DA 1J5EL 1K28A 4OHJA 5EPJA 4DR5Q 2KCMA 3MXNB 3UI2A 2QDLA 4OWWB 1IKLA 3J81c 3OMGA 2OTJA 1EWHA 3RLOA 4BBRB 2RF4A 5FKAC 4C3JH 1K8AC 2EZVA 4DNTB 1K3BC 2IX3A 3BU2A 5A2QE 2A6EC 3VR3A 4IZ8A 3CCLA 1LM0A 1AW7A 3SHLA 3X3NA 1SFOH 3I4MG 1WJJA 4DV7L 2XVSA 1T5XD 5C4JH 1DYQA 1SMYC 2K5NA 1GUTA 3DMUA 4A3CH 4AYBG 1KNAA 2F0NA 2MQHA 4DR2L 1KHIA 3CRKC 2YTVA 2XWJB 1EY5A 1HQMC 3DEPA 1VCIA 4DK6C 5K5PA 4HIKA 3QG1A 2OT2A 3KUPA 3J7AF 4V0BA 4DAVA 1BR9A 2WB1E 1ONLA 4X65Q 1CKNA 5D65A 4LF8L 4LAAA 2Q2HA 4JI6L 1N8RC 4O42A 4B3SL 2BH8A 2A6ED 5IOCA 2UUBL 4LFBL 4JYAQ 1UE6A 2K50A 1EU3A 2HCCA 3TBIB 4DV3Q 2NVQB 2QGQA 3K59A 1HR0L 4FF3A 4ZKBB 4JBMA 4GOPB 4WRDA 1QOHA 5EKIA 5FJ8H 2L0CA 3MFGA 5C5MA 2JA6G 1L2FA 3NEMA 4HJ9A 2R93H 1RJTA 1S4ZA 3FPPA 3L9AX 1LTTD 5C3WA 4S3SA 3M3YB 1EIYB 1WD0A 5JOBA 2E5LL 3HEJA 4DUZQ 1WTVA 2QILA 3PF4A 3H3VH 3K6OA 5M5XH 1F2YA 3C1EA 1V9PA 4NXML 4FVMA 4R8IA 4QIWB 5FLXE 2JJQA 4MTNA 3AU7A 3QOJA 5CMDA 2UU9L 2DNEA 2JA9A 2NZHA 2WB1G 5IT9c 1JWMD 3G6JB 3MXPA 4B3RL 2VUMB 2V1CC 2OQ0A 2Y0SB 4UP8A 4DF7A 5C4ZA 1CZWA 1EIGA 1KDAA 5D14A 4KKUA 1QVFA 4OL7A 1JOOA 3ND9A 1JORA 1N32L 1QVCA 2LFNA 2BDNA 1IYJB 1FGUA 1XX8A 3ULJA 3BVGA 1WCMG 1II3A 2K33A 3TZUA 2K5QA 3OPOA 1PTOB 1SNMA 2X6LA 2D0OA 4RWSC 1E1OA 4A3FG 3OIPA 1HUNA 4DK1A 2UXBQ 3A0JA 1Y8PB 1IBLQ 4DR5L
chains in the Genus database with same CATH topology
4PZ8A 2B63G 1X9NA 3BZKA 2NZOA 3PUZA 4X62Q 2OQKA 3E9HA 1SE8A 5GROA 4O0AA 5C44G 3RN2A 2R93G 1K83H 1IBML 4BY1H 5JJIA 3BZCA 3FKIH 4AQYL 4A76A 1Z47A 3W1BA 1NE3A 5M5YH 4JOIC 2VZAA 5JEAJ 1Y1VG 2ZM6L 4R4CA 3CCVA 3UDXA 1YHBA 3W1GA 1EQQA 1K73C 1VQKA 4B3MQ 4A3JH 1PH1A 4L5QA 1I3QH 2D62A 1C9OA 1K8GA 4BBRG 4PG3A 3CCRA 4A75A 1X3EA 4IPGA 4DPGA 3HKZG 4NPSA 2D0PA 3CCQA 5LMNW 1JB7A 1IBKQ 3CAMA 1YI2A 1S40A 4DNIA 4GKJL 1JT8A 1J5EQ 1VQJA 4DV1Q 2UUAL 4PZ7A 3T1YQ 2PQAA 1VQMA 5IE8A 1CSQA 1PA6A 4YHHL 3PO3H 3BJUA 4DR1Q 3M3YH 4LF6Q 3HOUG 1LYLA 2C35B 4OWXB 3EIVA 1YHQA 4JI3Q 1Q12A 3S2HH 3M7NA 1Q86C 1X6OA 3TRZA 2L15A 3I4OA 3J80i 4IPHA 1YIJA 1VQEA 3FP9A 4DR7L 4GKKL 1HNXL 2ZTCA 3F2BA 3KLWA 2UXCQ 3CMEA 1TWGH 1NY4A 4X65L 3F2DA 3M85A 3CPWA 3H15A 4GNXB 1XNRQ 1CKMA 3ICEA 2UXDL 2GVAA 2YTXA 4KHZA 4QGUA 1IZ6A 3UE1A 1VQOA 4YCWA 1P8LA 1SRUA 2H5XA 2YV5A 3PGZA 2VQFQ 2PI2A 3UDIA 5IP9G 3G6EA 3U58A 4A3DH 4JV5Q 1D8LA 4JYAL 3K7AH 1RL2A 2WFWA 3GD7A 3UE0A 4IO9A 2KENA 4DV3L 2VUMH 2YTYA 4C3HH 1L1OC 5IWAQ 4LWCA 5EAYA 4DKAC 3HOWG 4DUYQ 3CXCA 1B7YB 4JI2L 5DLQE 1A63A 2Y0SE 4X66Q 1YVCA 2Q2TA 1NMGA 3RLNA 2K52A 1SLJA 1OXXK 2JQOA 3HKSA 4QY7A 4TQUS 2OWOA 4XIGS 1VQLA 1XNQL 4BY1G 1VQGA 1LTLA 4AH6A 4KHPQ 1EQRA 1I50H 1YHAA 5E7NA 1WOCA 2BA1A 3ER0A 3RN5A 2PMZE 1WI5A 1N36L 2A8VA 4A3IH 2JE6I 3CCEA 3D0FA 1PH4A 4LF8Q 1FJGL 3DM3A 3F2CA 1K9MC 4LFCQ 1XMOL 2E2HH 1HNWQ 4A93H 3E9IA 1NJIC 4LFBQ 1FVIA 5C4XG 1VQDA 2JA7H 4BXXH 2DUDA 1A0IA 1SROA 2ZTEA 1E3PA 1VQ4A 1PH9A 1KRSA 4QJFA 2WAQE 5IP7H 1GM5A 1X56A 4A4IA 2KHIA 2HQLA 4MNOA 5C3EH 2NVQH 3U50C 4HIOA 3NELA 1TWAH 2PI2E 1KIXA 1I94L 1PYBA 4JI8Q 3PCOB 4APVA 3G71A 3L2PA 4LFAL 1U5KA 4DR3L 1VQAA 3FHWA 3TS0A 4GNXA 1CKOA 2JK8A 1V43A 3DLLA 4DV2L 1YEZA 1R9TH 2A1AA 4DV4L 1XTDA 4HJ5A 3S1MH 4A3BH 1KQSA 2AKWB 2K4KA 3KDFB 4IPDA 4K0KL 1NMFA 1TWFH 1MJCA 5IY0A 2CQOA 2JA5H 2I5LX 2I5HA 3GDEA 3M4QA 4X64L 3PUYA 5IYBH 2ALYB 3ULPA 2KCTA 3H0GH 3H3VI 4A3GH 5LMNQ 4A3DG 1EFWA 3K8AA 3PO2H 1IXRA 3AFQA 2MNAA 3OTOQ 3I4MH 1M1KC 2LXJA 1A62A 3CMAA 1XPRA 3RLFA 1NBWA 2Y0SG 4EQ5A 3T1HQ 2VUMG 1QUQB 4BY7H 1HH2P 3OYYA 1VQBA 2A19A 1N34Q 1HNZQ 4GOPA 4LF7Q 1B8AA 3K7UC 4JBJA 4RMFA 4OO1G 3J7A5 2UU9Q 1IBLL 4HJ8A 2IT1A 5FLXc 2ES2A 4JI7Q 1TXYA 3HOXH 1JJ2A 3GTPH 4P74A 2Z6KC 1UWVA 3CC4A 3J7ZC 2CFMA 2R6GA 1HR0W 1EYGA 3AYHB 5IYDH 3K80C 3Q8DA 1N32Q 2K5VA 3HOVH 4OWTB 5FJ8G 3I4NH 3ZJYC 2HHHQ 1H95A 5LMUQ 4BBSH 5BR8Q 2NVXH 4L5RC 1KXLA 2WAQG 2NN6G 4YCVA 1PYSB 1QVGA 3CC2A 1VQ6A 3GTKH 5ELNA 4C3IH 4NXNL 4PZ6A 3TEHB 5JEAG 1D7QA 3U4VA 4GN5A 5IP7G 3CCSA 1G291 1YJ9A 3HOYH 3S2DH 5C3EG 3CW2C 2EXDA 1O7IA 2I0QA 2YYZA 4KI0A 1PH8A 3RNUA 1E1TA 1IBKL 1CKNB 1W3SA 2Q2IA 2Z0SA 1VQIA 3HFZB 4JI0Q 4OX9Q 4WJ4A 4A3EH 3T1YL 3WWVA 1HZCA 2CWAA 3EN2A 1GVPA 1I6HH 4YWKA 1V1QA 2RHQB 4YWLA 1KC8C 1TWCH 4FDBA 1PH5A 4A3BG 1YNXA 5IYCH 4DR1L 4DR6L 1PH2A 4DR4L 4GLVB 4TVAB 2JA5G 3RR5A 4AQYQ 3EBEA 2JEBI 3H0GG 1JJCB 4HJAA 4A3GG 5ELOA 1VQ7A 5FLMG 2UXCL 1PV4A 4A3KH 3PO2G 4POGA 4ME3A 3CPFA 2VQEQ 1Z9FA 1OXVA 1XNRL 3S16H 5M5WH 4DV7Q 5HGQA 2ATWA 5C0XG 3I56A 5C0XJ 3ULLA 1X65A 1JE5A 2VS1A 1BKBA 2E8GA 1RIPA 2PNHA 2VL6A 2XGTA 3RZOH 4GKJQ 4JV5L 2UUAQ 1DGSA 4QL5A 1S3OA 1EOVA 4OONA 4DR2Q 2CKZB 3MEFA 4QIWE 3HOXG 4A3MH 5IWAL 4C2MH 4DUYL 2IHEA 2VY3A 5M3MH 1VQHA 2GN5A 3STBC 4X66L 3K0XA 5IYDG 5GADC 4LW1A 2VW9A 1L1OB 2E2JH 2R7ZH 2K5HA 1X3GA 1OXTA 5M3FH 3CCJA 3CC7A 3KF6B 1MJEA 3I4NG 1XMQL 2E2IH 4BBSG 3UDFA 1BVSA 5JJKA 4IOAA 4L5TA 1UE5A 2R7FA 3FKIG 2NVTH 5AJ3L 3CQZH 5GAHC 3K81C 4GLAC 4DK3C 3OW2A 4J15A 4P73A 1LUZA 2CWPA 4LFCL 3G4SA 4A3JG 1HNWL 1UE1A 1CUKA 4JI6Q 4B3SQ 2GVBA 4IOCA 1E24A 3PIPA 2UUBQ 1K0RA 4LF9L 4OO1I 4JI4Q 3ERSX 4YY3Q 4DV5L 2RCNA 4A3EG 4JI5L 3J81i 3S1RH 4DUZL 3M4OH 4JI8L 4GOPC 1HR0Q 1N9WA 4LUVA 5IYCG 4HJ7A 3PIOA 1IL2A 1SR3A 3SGIA 1XNQQ 3PO3G 1I5FA 1BBUA 1VQ8A 4GLXA 1HZ9A 2NN6I 3PV0A 2B63H 2VNUD 4XTCS 1OXSC 1C0AA 1AE3A 4ALPA 5C44H 3PF5A 1WFQA 4JCVE 4JI1Q 1MKHA 4DAYB 3AEVA 1XMOQ 1YBYA 1VQ9A 2DGYA 4DV6Q 3CP0A 1E22A 2F52A 4YWMA 2JEAI 1FL0A 2UUCQ 2BH2A 1KAWA 1UEBA 4IFDG 4LF5Q 4IFDJ 1AH9A 3HOZH 1Q1EA 1ASYA 2E5LQ 4JC0A 4NB3A 3PUXA 4GN3B 2IY5B 4A3MG 3KF6A 1SN8A 3TREA 3IRBA 2AWNA 1HNZL 4LF7L 4LFAQ 5M3MG 5GQOA 2IX0A 1MIUA 1P16A 2R7ZG 4NXMQ 2F4VL 2UXBL 1AE2A 3KF8B 1Q8KA 1Q81C 4AYBE 2N8NA 2ZJRA 1N33L 4K0KQ 2PQAB 1KL9A 2BA0A 2N3SA 4B3RQ 3NBHB 4X64Q 1ASZA 4A3IG 1Y1WH 2IX1A 4GS3A 4X62L 5BR8L 4IPCA 3E0EA 4LF4Q 5C0XI 1SMXA 4HIMA 3RZDH 3S1NH 1E7ZA 4EX5A 4A93G 2ZTDA 2JA8H 2JA7G 4BXXG 2OCEA 4MZ9A 4B3ML 1JMCA 4IJLA 4DV0Q 1Q7YC 1XPUA 3M4PA 2QA4A 3PUWA 1HZBA 1T9HA 5IP9H 4UP7A 1VQ5A 4IJHA 1KRTA 3W5OA 2IHFA 2AHOB 4JI0L 4LUZA 1BBWA 4JBWA 4JG2A 3U4ZA 2R92H 3CCUA 4AIMA 3GTJH 1XPOA 4B3TQ 2R7DA 3KDFA 4DV1L 3VDYA 1J5EL 3L0OA 3HOWH 4DR5Q 2KCMA 3MXNB 4Y52H 1VQPA 5K36G 1K3RA 4R1JA 3B6YA 5GAEC 4OWWB 3J81c 3GTGH 4QQBX 2OTJA 4UP9A 3RLOA 3S24A 2RF4A 3GTQH 3M9BA 4C3JH 4LF6L 1K8AC 4JI3L 1S72A 2ZJPA 1IBMQ 4UPAA 5IYBG 3BU2A 4NXNQ 2HIVA 1Y14B 3D31A 1QUQA 2ZM6Q 3CCLA 1LM0A 2EIFA 3JAMi 2VQEL 1YJWA 4DAMA 1Q46A 3HOZG 2XTIA 4O2DA 1SFOH 4OXPA 2JA6H 1WJJA 4DV7L 3GTOH 4L5SA 1GD7A 5C4XH 1Q82C 3I4MG 5C4JH 4A3LH 2QEXA 2K5NA 1EWIA 4BA2I 4BY7G 4A3CH 4AYBG 3TQYA 2VQFL 2ZJQA 1EIFA 1GO3E 2Z6KA 4R4QA 2KBNA 4DR2L 2MQHA 1NTGA 1KHIA 5J3BA 1L0WA 2YTVA 4X6AH 1JJGA 2F3IA 1PVOA 3GTLH 4DR6Q 3F8TA 1VCIA 2K14A 4P71A 4DK6C 4YHHQ 3G48A 3NENA 4HIKA 4DR4Q 1OXUA 4YCUA 1Y1WG 4KLKA 1VS0A 1QZGA 3KFUA 3HOVG 1XJVA 4GNXC 4KHPL 1X54A 3F1ZA 4R4IA 1GKHA 4JOIA 4DR7Q 1HNXQ 4GKKQ 1VQFA 2JA8G 4IFDI 3PUVA 3S14H 2WB1E 4X65Q 1CKNA 3CF5A 4LF8L 1VQNA 1J6QA 2Q2HA 2WP8J 3I7FA 3S17H 2UXDQ 4JI6L 1N8RC 4B3SL 3HOYG 2BH8A 2I5MX 3CD6A 2UUBL 2AMCB 4LFBL 2MFIA 4JI4L 2R92G 4YY3L 4JYAQ 1UE6A 1VQCA 1WCMH 1EUJA 2K50A 1TWHH 3GTMH 4DV3Q 4P72A 2N78A 1G6PA 4R4TA 2QGQA 3KOJA 4JI2Q 4A3FH 5GAGC 1HR0L 1YITA 2Q2UA 2KHJA 1XMQQ 4JBKA 1B70B 4JBMA 4GOPB 4R4OA 4HIDA 5AJ3Q 5JJLA 2AWOA 1N36Q 3I55A 5FJ8H 4JI1L 3STBD 4A3KG 2LXKA 1FJGQ 2JA6G 1C7YA 1L2FA 3NEMA 4HJ9A 2R93H 4DV6L 1UE7A 5HY6A 2ASBA 4A3LG 2LSSA 2RHSB 4LF9Q 2B29A 3A5ZB 3KJPA 1QZHA 3KJOA 1Y1VH 4DV5Q 1EIYB 2UUCL 5LMNL 4A3CG 4LF5L 4POFA 3J81j 3UDGA 2E5LL 4LNQA 3S1QH 3OTOL 1YZ6A 1PFSA 4JI5Q 3JAMc 3CCMA 4DUZQ 1L1OA 4BBRH 2CCZA 4BA1I 3T1HL 3GO5A 1M90C 4RG1A 3H3VH 3PF4A 3AFPA 3A5UA 4UY8C 1N34L 5M5XH 1I94Q 1G51A 1V9PA 3KYHC 3I2ZA 4DR3Q 2B3GA 4NXML 3PSIA 2YU9H 3HKZE 2JJQA 4MTNA 2UU9L 4DV2Q 1KD1C 5M3FG 2JA9A 2NZHA 2WB1G 4PMWA 5IT9c 4DV4Q 2OTLA 4JI7L 3TS2A 1PH3A 1HZAA 1WYDA 4B3RL 2V1CC 1X55A 2OQ0A 4UP8A 3HOUH 1QVFA 2NVYH 3L7ZC 1N32L 1CSPA 3J80c 1QVCA 5FLMH 1A8VA 4H02A 4LF4L 1OTCA 2HHHL 1IYJB 1X3FA 3JC66 5LMUL 1FGUA 3AQQA 1W2BA 2MO1A 1YJNA 3ULJA 2MO0A 1HJPA 4Y7NH 4DV0L 1WCMG 4P75A 3A74A 2FXQA 2D0OA 2HIXA 1PH7A 1E1OA 5H1SE 4A3FG 1PH6A 2ID0A 4WJ3M 2F4VQ 2UXBQ 3LGJA 4B3TL 3A0JA 2K75A 4OX9L 1IBLQ 3S15H 2N49A 1PHJA 1U0LA 4LUOA 4DR5L 2HT1A 1N33Q 1Q1BA 4GN4B 2EQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZ8 A;  2B63 G;  1X9N A;  3BZK A;  2NZO A;  3PUZ A;  4X62 Q;  2OQK A;  3E9H A;  1SE8 A;  5GRO A;  4O0A A;  5C44 G;  3RN2 A;  2R93 G;  1K83 H;  1IBM L;  4BY1 H;  5JJI A;  3BZC A;  3FKI H;  4AQY L;  4A76 A;  1Z47 A;  3W1B A;  1NE3 A;  5M5Y H;  4JOI C;  2VZA A;  5JEA J;  1Y1V G;  2ZM6 L;  4R4C A;  3CCV A;  3UDX A;  1YHB A;  3W1G A;  1EQQ A;  1K73 C;  1VQK A;  4B3M Q;  4A3J H;  1PH1 A;  4L5Q A;  1I3Q H;  2D62 A;  1C9O A;  1K8G A;  4BBR G;  4PG3 A;  3CCR A;  4A75 A;  1X3E A;  4IPG A;  4DPG A;  3HKZ G;  4NPS A;  2D0P A;  3CCQ A;  5LMN W;  1JB7 A;  1IBK Q;  3CAM A;  1YI2 A;  1S40 A;  4DNI A;  4GKJ L;  1JT8 A;  1J5E Q;  1VQJ A;  4DV1 Q;  2UUA L;  4PZ7 A;  3T1Y Q;  2PQA A;  1VQM A;  5IE8 A;  1CSQ A;  1PA6 A;  4YHH L;  3PO3 H;  3BJU A;  4DR1 Q;  3M3Y H;  4LF6 Q;  3HOU G;  1LYL A;  2C35 B;  4OWX B;  3EIV A;  1YHQ A;  4JI3 Q;  1Q12 A;  3S2H H;  3M7N A;  1Q86 C;  1X6O A;  3TRZ A;  2L15 A;  3I4O A;  3J80 i;  4IPH A;  1YIJ A;  1VQE A;  3FP9 A;  4DR7 L;  4GKK L;  1HNX L;  2ZTC A;  3F2B A;  3KLW A;  2UXC Q;  3CME A;  1TWG H;  1NY4 A;  4X65 L;  3F2D A;  3M85 A;  3CPW A;  3H15 A;  4GNX B;  1XNR Q;  1CKM A;  3ICE A;  2UXD L;  2GVA A;  2YTX A;  4KHZ A;  4QGU A;  1IZ6 A;  3UE1 A;  1VQO A;  4YCW A;  1P8L A;  1SRU A;  2H5X A;  2YV5 A;  3PGZ A;  2VQF Q;  2PI2 A;  3UDI A;  5IP9 G;  3G6E A;  3U58 A;  4A3D H;  4JV5 Q;  1D8L A;  4JYA L;  3K7A H;  1RL2 A;  2WFW A;  3GD7 A;  3UE0 A;  4IO9 A;  2KEN A;  4DV3 L;  2VUM H;  2YTY A;  4C3H H;  1L1O C;  5IWA Q;  4LWC A;  5EAY A;  4DKA C;  3HOW G;  4DUY Q;  3CXC A;  1B7Y B;  4JI2 L;  5DLQ E;  1A63 A;  2Y0S E;  4X66 Q;  1YVC A;  2Q2T A;  1NMG A;  3RLN A;  2K52 A;  1SLJ A;  1OXX K;  2JQO A;  3HKS A;  4QY7 A;  4TQU S;  2OWO A;  4XIG S;  1VQL A;  1XNQ L;  4BY1 G;  1VQG A;  1LTL A;  4AH6 A;  4KHP Q;  1EQR A;  1I50 H;  1YHA A;  5E7N A;  1WOC A;  2BA1 A;  3ER0 A;  3RN5 A;  2PMZ E;  1WI5 A;  1N36 L;  2A8V A;  4A3I H;  2JE6 I;  3CCE A;  3D0F A;  1PH4 A;  4LF8 Q;  1FJG L;  3DM3 A;  3F2C A;  1K9M C;  4LFC Q;  1XMO L;  2E2H H;  1HNW Q;  4A93 H;  3E9I A;  1NJI C;  4LFB Q;  1FVI A;  5C4X G;  1VQD A;  2JA7 H;  4BXX H;  2DUD A;  1A0I A;  1SRO A;  2ZTE A;  1E3P A;  1VQ4 A;  1PH9 A;  1KRS A;  4QJF A;  2WAQ E;  5IP7 H;  1GM5 A;  1X56 A;  4A4I A;  2KHI A;  2HQL A;  4MNO A;  5C3E H;  2NVQ H;  3U50 C;  4HIO A;  3NEL A;  1TWA H;  2PI2 E;  1KIX A;  1I94 L;  1PYB A;  4JI8 Q;  3PCO B;  4APV A;  3G71 A;  3L2P A;  4LFA L;  1U5K A;  4DR3 L;  1VQA A;  3FHW A;  3TS0 A;  4GNX A;  1CKO A;  2JK8 A;  1V43 A;  3DLL A;  4DV2 L;  1YEZ A;  1R9T H;  2A1A A;  4DV4 L;  1XTD A;  4HJ5 A;  3S1M H;  4A3B H;  1KQS A;  2AKW B;  2K4K A;  3KDF B;  4IPD A;  4K0K L;  1NMF A;  1TWF H;  1MJC A;  5IY0 A;  2CQO A;  2JA5 H;  2I5L X;  2I5H A;  3GDE A;  3M4Q A;  4X64 L;  3PUY A;  5IYB H;  2ALY B;  3ULP A;  2KCT A;  3H0G H;  3H3V I;  4A3G H;  5LMN Q;  4A3D G;  1EFW A;  3K8A A;  3PO2 H;  1IXR A;  3AFQ A;  2MNA A;  3OTO Q;  3I4M H;  1M1K C;  2LXJ A;  1A62 A;  3CMA A;  1XPR A;  3RLF A;  1NBW A;  2Y0S G;  4EQ5 A;  3T1H Q;  2VUM G;  1QUQ B;  4BY7 H;  1HH2 P;  3OYY A;  1VQB A;  2A19 A;  1N34 Q;  1HNZ Q;  4GOP A;  4LF7 Q;  1B8A A;  3K7U C;  4JBJ A;  4RMF A;  4OO1 G;  3J7A 5;  2UU9 Q;  1IBL L;  4HJ8 A;  2IT1 A;  5FLX c;  2ES2 A;  4JI7 Q;  1TXY A;  3HOX H;  1JJ2 A;  3GTP H;  4P74 A;  2Z6K C;  1UWV A;  3CC4 A;  3J7Z C;  2CFM A;  2R6G A;  1HR0 W;  1EYG A;  3AYH B;  5IYD H;  3K80 C;  3Q8D A;  1N32 Q;  2K5V A;  3HOV H;  4OWT B;  5FJ8 G;  3I4N H;  3ZJY C;  2HHH Q;  1H95 A;  5LMU Q;  4BBS H;  5BR8 Q;  2NVX H;  4L5R C;  1KXL A;  2WAQ G;  2NN6 G;  4YCV A;  1PYS B;  1QVG A;  3CC2 A;  1VQ6 A;  3GTK H;  5ELN A;  4C3I H;  4NXN L;  4PZ6 A;  3TEH B;  5JEA G;  1D7Q A;  3U4V A;  4GN5 A;  5IP7 G;  3CCS A;  1G29 1;  1YJ9 A;  3HOY H;  3S2D H;  5C3E G;  3CW2 C;  2EXD A;  1O7I A;  2I0Q A;  2YYZ A;  4KI0 A;  1PH8 A;  3RNU A;  1E1T A;  1IBK L;  1CKN B;  1W3S A;  2Q2I A;  2Z0S A;  1VQI A;  3HFZ B;  4JI0 Q;  4OX9 Q;  4WJ4 A;  4A3E H;  3T1Y L;  3WWV A;  1HZC A;  2CWA A;  3EN2 A;  1GVP A;  1I6H H;  4YWK A;  1V1Q A;  2RHQ B;  4YWL A;  1KC8 C;  1TWC H;  4FDB A;  1PH5 A;  4A3B G;  1YNX A;  5IYC H;  4DR1 L;  4DR6 L;  1PH2 A;  4DR4 L;  4GLV B;  4TVA B;  2JA5 G;  3RR5 A;  4AQY Q;  3EBE A;  2JEB I;  3H0G G;  1JJC B;  4HJA A;  4A3G G;  5ELO A;  1VQ7 A;  5FLM G;  2UXC L;  1PV4 A;  4A3K H;  3PO2 G;  4POG A;  4ME3 A;  3CPF A;  2VQE Q;  1Z9F A;  1OXV A;  1XNR L;  3S16 H;  5M5W H;  4DV7 Q;  5HGQ A;  2ATW A;  5C0X G;  3I56 A;  5C0X J;  3ULL A;  1X65 A;  1JE5 A;  2VS1 A;  1BKB A;  2E8G A;  1RIP A;  2PNH A;  2VL6 A;  2XGT A;  3RZO H;  4GKJ Q;  4JV5 L;  2UUA Q;  1DGS A;  4QL5 A;  1S3O A;  1EOV A;  4OON A;  4DR2 Q;  2CKZ B;  3MEF A;  4QIW E;  3HOX G;  4A3M H;  5IWA L;  4C2M H;  4DUY L;  2IHE A;  2VY3 A;  5M3M H;  1VQH A;  2GN5 A;  3STB C;  4X66 L;  3K0X A;  5IYD G;  5GAD C;  4LW1 A;  2VW9 A;  1L1O B;  2E2J H;  2R7Z H;  2K5H A;  1X3G A;  1OXT A;  5M3F H;  3CCJ A;  3CC7 A;  3KF6 B;  1MJE A;  3I4N G;  1XMQ L;  2E2I H;  4BBS G;  3UDF A;  1BVS A;  5JJK A;  4IOA A;  4L5T A;  1UE5 A;  2R7F A;  3FKI G;  2NVT H;  5AJ3 L;  3CQZ H;  5GAH C;  3K81 C;  4GLA C;  4DK3 C;  3OW2 A;  4J15 A;  4P73 A;  1LUZ A;  2CWP A;  4LFC L;  3G4S A;  4A3J G;  1HNW L;  1UE1 A;  1CUK A;  4JI6 Q;  4B3S Q;  2GVB A;  4IOC A;  1E24 A;  3PIP A;  2UUB Q;  1K0R A;  4LF9 L;  4OO1 I;  4JI4 Q;  3ERS X;  4YY3 Q;  4DV5 L;  2RCN A;  4A3E G;  4JI5 L;  3J81 i;  3S1R H;  4DUZ L;  3M4O H;  4JI8 L;  4GOP C;  1HR0 Q;  1N9W A;  4LUV A;  5IYC G;  4HJ7 A;  3PIO A;  1IL2 A;  1SR3 A;  3SGI A;  1XNQ Q;  3PO3 G;  1I5F A;  1BBU A;  1VQ8 A;  4GLX A;  1HZ9 A;  2NN6 I;  3PV0 A;  2B63 H;  2VNU D;  4XTC S;  1OXS C;  1C0A A;  1AE3 A;  4ALP A;  5C44 H;  3PF5 A;  1WFQ A;  4JCV E;  4JI1 Q;  1MKH A;  4DAY B;  3AEV A;  1XMO Q;  1YBY A;  1VQ9 A;  2DGY A;  4DV6 Q;  3CP0 A;  1E22 A;  2F52 A;  4YWM A;  2JEA I;  1FL0 A;  2UUC Q;  2BH2 A;  1KAW A;  1UEB A;  4IFD G;  4LF5 Q;  4IFD J;  1AH9 A;  3HOZ H;  1Q1E A;  1ASY A;  2E5L Q;  4JC0 A;  4NB3 A;  3PUX A;  4GN3 B;  2IY5 B;  4A3M G;  3KF6 A;  1SN8 A;  3TRE A;  3IRB A;  2AWN A;  1HNZ L;  4LF7 L;  4LFA Q;  5M3M G;  5GQO A;  2IX0 A;  1MIU A;  1P16 A;  2R7Z G;  4NXM Q;  2F4V L;  2UXB L;  1AE2 A;  3KF8 B;  1Q8K A;  1Q81 C;  4AYB E;  2N8N A;  2ZJR A;  1N33 L;  4K0K Q;  2PQA B;  1KL9 A;  2BA0 A;  2N3S A;  4B3R Q;  3NBH B;  4X64 Q;  1ASZ A;  4A3I G;  1Y1W H;  2IX1 A;  4GS3 A;  4X62 L;  5BR8 L;  4IPC A;  3E0E A;  4LF4 Q;  5C0X I;  1SMX A;  4HIM A;  3RZD H;  3S1N H;  1E7Z A;  4EX5 A;  4A93 G;  2ZTD A;  2JA8 H;  2JA7 G;  4BXX G;  2OCE A;  4MZ9 A;  4B3M L;  1JMC A;  4IJL A;  4DV0 Q;  1Q7Y C;  1XPU A;  3M4P A;  2QA4 A;  3PUW A;  1HZB A;  1T9H A;  5IP9 H;  4UP7 A;  1VQ5 A;  4IJH A;  1KRT A;  3W5O A;  2IHF A;  2AHO B;  4JI0 L;  4LUZ A;  1BBW A;  4JBW A;  4JG2 A;  3U4Z A;  2R92 H;  3CCU A;  4AIM A;  3GTJ H;  1XPO A;  4B3T Q;  2R7D A;  3KDF A;  4DV1 L;  3VDY A;  1J5E L;  3L0O A;  3HOW H;  4DR5 Q;  2KCM A;  3MXN B;  4Y52 H;  1VQP A;  5K36 G;  1K3R A;  4R1J A;  3B6Y A;  5GAE C;  4OWW B;  3J81 c;  3GTG H;  4QQB X;  2OTJ A;  4UP9 A;  3RLO A;  3S24 A;  2RF4 A;  3GTQ H;  3M9B A;  4C3J H;  4LF6 L;  1K8A C;  4JI3 L;  1S72 A;  2ZJP A;  1IBM Q;  4UPA A;  5IYB G;  3BU2 A;  4NXN Q;  2HIV A;  1Y14 B;  3D31 A;  1QUQ A;  2ZM6 Q;  3CCL A;  1LM0 A;  2EIF A;  3JAM i;  2VQE L;  1YJW A;  4DAM A;  1Q46 A;  3HOZ G;  2XTI A;  4O2D A;  1SFO H;  4OXP A;  2JA6 H;  1WJJ A;  4DV7 L;  3GTO H;  4L5S A;  1GD7 A;  5C4X H;  1Q82 C;  3I4M G;  5C4J H;  4A3L H;  2QEX A;  2K5N A;  1EWI A;  4BA2 I;  4BY7 G;  4A3C H;  4AYB G;  3TQY A;  2VQF L;  2ZJQ A;  1EIF A;  1GO3 E;  2Z6K A;  4R4Q A;  2KBN A;  4DR2 L;  2MQH A;  1NTG A;  1KHI A;  5J3B A;  1L0W A;  2YTV A;  4X6A H;  1JJG A;  2F3I A;  1PVO A;  3GTL H;  4DR6 Q;  3F8T A;  1VCI A;  2K14 A;  4P71 A;  4DK6 C;  4YHH Q;  3G48 A;  3NEN A;  4HIK A;  4DR4 Q;  1OXU A;  4YCU A;  1Y1W G;  4KLK A;  1VS0 A;  1QZG A;  3KFU A;  3HOV G;  1XJV A;  4GNX C;  4KHP L;  1X54 A;  3F1Z A;  4R4I A;  1GKH A;  4JOI A;  4DR7 Q;  1HNX Q;  4GKK Q;  1VQF A;  2JA8 G;  4IFD I;  3PUV A;  3S14 H;  2WB1 E;  4X65 Q;  1CKN A;  3CF5 A;  4LF8 L;  1VQN A;  1J6Q A;  2Q2H A;  2WP8 J;  3I7F A;  3S17 H;  2UXD Q;  4JI6 L;  1N8R C;  4B3S L;  3HOY G;  2BH8 A;  2I5M X;  3CD6 A;  2UUB L;  2AMC B;  4LFB L;  2MFI A;  4JI4 L;  2R92 G;  4YY3 L;  4JYA Q;  1UE6 A;  1VQC A;  1WCM H;  1EUJ A;  2K50 A;  1TWH H;  3GTM H;  4DV3 Q;  4P72 A;  2N78 A;  1G6P A;  4R4T A;  2QGQ A;  3KOJ A;  4JI2 Q;  4A3F H;  5GAG C;  1HR0 L;  1YIT A;  2Q2U A;  2KHJ A;  1XMQ Q;  4JBK A;  1B70 B;  4JBM A;  4GOP B;  4R4O A;  4HID A;  5AJ3 Q;  5JJL A;  2AWO A;  1N36 Q;  3I55 A;  5FJ8 H;  4JI1 L;  3STB D;  4A3K G;  2LXK A;  1FJG Q;  2JA6 G;  1C7Y A;  1L2F A;  3NEM A;  4HJ9 A;  2R93 H;  4DV6 L;  1UE7 A;  5HY6 A;  2ASB A;  4A3L G;  2LSS A;  2RHS B;  4LF9 Q;  2B29 A;  3A5Z B;  3KJP A;  1QZH A;  3KJO A;  1Y1V H;  4DV5 Q;  1EIY B;  2UUC L;  5LMN L;  4A3C G;  4LF5 L;  4POF A;  3J81 j;  3UDG A;  2E5L L;  4LNQ A;  3S1Q H;  3OTO L;  1YZ6 A;  1PFS A;  4JI5 Q;  3JAM c;  3CCM A;  4DUZ Q;  1L1O A;  4BBR H;  2CCZ A;  4BA1 I;  3T1H L;  3GO5 A;  1M90 C;  4RG1 A;  3H3V H;  3PF4 A;  3AFP A;  3A5U A;  4UY8 C;  1N34 L;  5M5X H;  1I94 Q;  1G51 A;  1V9P A;  3KYH C;  3I2Z A;  4DR3 Q;  2B3G A;  4NXM L;  3PSI A;  2YU9 H;  3HKZ E;  2JJQ A;  4MTN A;  2UU9 L;  4DV2 Q;  1KD1 C;  5M3F G;  2JA9 A;  2NZH A;  2WB1 G;  4PMW A;  5IT9 c;  4DV4 Q;  2OTL A;  4JI7 L;  3TS2 A;  1PH3 A;  1HZA A;  1WYD A;  4B3R L;  2V1C C;  1X55 A;  2OQ0 A;  4UP8 A;  3HOU H;  1QVF A;  2NVY H;  3L7Z C;  1N32 L;  1CSP A;  3J80 c;  1QVC A;  5FLM H;  1A8V A;  4H02 A;  4LF4 L;  1OTC A;  2HHH L;  1IYJ B;  1X3F A;  3JC6 6;  5LMU L;  1FGU A;  3AQQ A;  1W2B A;  2MO1 A;  1YJN A;  3ULJ A;  2MO0 A;  1HJP A;  4Y7N H;  4DV0 L;  1WCM G;  4P75 A;  3A74 A;  2FXQ A;  2D0O A;  2HIX A;  1PH7 A;  1E1O A;  5H1S E;  4A3F G;  1PH6 A;  2ID0 A;  4WJ3 M;  2F4V Q;  2UXB Q;  3LGJ A;  4B3T L;  3A0J A;  2K75 A;  4OX9 L;  1IBL Q;  3S15 H;  2N49 A;  1PHJ A;  1U0L A;  4LUO A;  4DR5 L;  2HT1 A;  1N33 Q;  1Q1B A;  4GN4 B;  2EQS A; 
#chains in the Genus database with same CATH topology
 2B63 G;  2R3Z A;  4DGZ A;  4X62 Q;  1Y8O B;  4HMJ A;  3RN2 A;  2A6H D;  2XNA C;  4BY1 H;  5JJI A;  4ZK9 B;  3W1B A;  1NE3 A;  5JEA J;  1Y1V G;  4R4C A;  1EQQ A;  1I3Q H;  3S1M B;  1EU4 A;  3MZ5 A;  1K8G A;  4DPG A;  4G4K A;  1SYB A;  1TWF B;  1RKN A;  4E6I A;  3CAM A;  4DNI A;  1PTO D;  4DV1 Q;  2B2W C;  2MHV A;  1PA6 A;  1QG7 A;  3OMC A;  4TSS A;  4LF6 Q;  3HOU G;  4OWX B;  1SSO A;  5F2D A;  3VA7 A;  3KLW A;  1TWG H;  3HOX B;  4X65 L;  4FNF A;  3F2D A;  4GNX B;  3TSS A;  3GTP B;  1G2S A;  5J22 A;  4YCW A;  2H5X A;  1SRU A;  3GV3 A;  2PI2 A;  3IFD A;  1RDP D;  5IP9 G;  3MXN A;  3Q0A A;  4JYA L;  2NVX B;  2WFW A;  3EQL C;  3GD7 A;  1K83 B;  4IO9 A;  3C2P A;  2KEN A;  4DV3 L;  3GTK B;  3FKI B;  2MP1 A;  1L1O C;  5EAY A;  5M5Y B;  5DLQ E;  1SNO A;  2FHT A;  4IUU A;  2VB2 X;  1NSN S;  2K52 A;  2OWO A;  4KHP Q;  2C9O A;  1IYU A;  5E7N A;  4A3E B;  1WOC A;  2BA1 A;  3ER0 A;  3RN5 A;  2PMZ E;  1PTO F;  1PH4 A;  3DWQ A;  1I6H B;  1K9M C;  2E2H H;  2F0S A;  5C4X G;  1VQD A;  3SDZ A;  2JA7 H;  4BXX H;  4IUN A;  2RCF A;  4PV1 C;  4QJF A;  5IP7 H;  1X56 A;  4A4I A;  2KHI A;  3Q22 A;  2PI2 E;  2AUJ D;  3S16 B;  1LTS D;  3G71 A;  1B2T A;  2DN8 A;  1VQA A;  1ML0 D;  3TS0 A;  1CKO A;  2JK8 A;  2R61 A;  4EVO A;  1RF2 D;  1R9T H;  2A1A A;  3R2T A;  2AKW B;  2CW0 C;  2K4K A;  4ZUI A;  1STY A;  1MJC A;  1PFB A;  5CV5 A;  4C2M B;  1QNK A;  3PUY A;  5M3M B;  5IYB H;  4JVZ A;  3H0G H;  5IIF A;  3H3V I;  5EPK A;  2E74 C;  3BYT B;  4LJZ C;  4A3D G;  1EFW A;  3PO2 H;  1IXR A;  1GHJ A;  3BDL A;  4M1U B;  1ENF A;  2EYO A;  4C3H G;  1HH2 P;  3CQZ B;  5C0X H;  1N34 Q;  3H6M A;  1SYE A;  4GOP A;  2Q8I B;  1B8A A;  1J8I A;  4L63 B;  4XXE A;  1IBL L;  3NE5 B;  2ES2 A;  1JR0 D;  4I65 A;  3KBX A;  3Q24 A;  4P2C B;  3OHX C;  3KLS X;  4CJ2 C;  3CC4 A;  2CFM A;  2R6G A;  3VR6 A;  1SE3 A;  3K5O A;  3K58 A;  1TS4 A;  5I2Y A;  2SNM A;  1PYS B;  3BDC A;  2CW0 D;  1VQ6 A;  4C3I H;  4NXN L;  5I6W A;  3K0Y A;  4GN5 A;  1D1I A;  2N55 A;  4K2L A;  1JB3 A;  1WTW A;  3A56 A;  1PH8 A;  3NBI A;  2QDB A;  1EY6 A;  1W3S A;  2Q2I A;  1VMC A;  2B8G A;  1GUS A;  3WWV A;  1HZC A;  3GV6 A;  1GVP A;  1V1Q A;  3H3V C;  4A3B G;  1TT2 A;  3I4M B;  4DR6 L;  1PH2 A;  4DR4 L;  4KK7 A;  4AQY Q;  4A3G G;  1CI3 M;  1HPC A;  1TR5 A;  5FLM G;  1VQ7 A;  4POG A;  3MWY W;  3P7J A;  2F0G A;  2M00 A;  1X65 A;  4GKJ Q;  2VS1 A;  4KKT A;  3LNN A;  1PZI D;  1EOV A;  2CKZ B;  4QIW E;  3ERO A;  3H91 A;  2F0O A;  1U9R A;  3STB C;  3K0X A;  3MEH A;  1X3G A;  2NB0 A;  5M3F H;  1MJE A;  3I4N G;  4DXF A;  4BBS G;  1XMQ L;  1DZ1 A;  1PFM A;  1BO0 A;  2KUM A;  4IOA A;  2K28 A;  5AJ3 L;  1SNQ A;  5GAH C;  3KLR A;  1JCK B;  1LUZ A;  3URY A;  5FOB B;  3GTG B;  4RAU C;  5A2Q L;  3H94 A;  4F87 A;  4IOC A;  3GTQ B;  3W3A A;  1K0R A;  3D4R A;  3QR8 A;  4LF9 L;  2B2W A;  4JI4 Q;  3ERS X;  4YY3 Q;  1QWY A;  3JAM E;  2MUY A;  2O4X A;  1YNJ D;  1STN A;  4JI5 L;  4R9W A;  1VF5 C;  2JA6 B;  4LUV A;  4HJ7 A;  1PFN A;  1HRJ A;  2K32 A;  1HZ9 A;  4FF4 A;  2VNU D;  1C0A A;  3NUC A;  4RKB A;  4ALP A;  1DJR D;  4JI1 Q;  1MKH A;  4DAY B;  1BCP C;  3AEV A;  1XMO Q;  3J80 E;  4CDF C;  2DGY A;  4DV6 Q;  1X32 A;  3CP0 A;  5G3L D;  2F52 A;  1G91 A;  5KIX A;  4LF5 Q;  4IFD J;  2WB1 B;  3A7L A;  3TRE A;  3GQB A;  3N6R A;  4QMG A;  2JP1 A;  5GQO A;  4XYO A;  3NP8 A;  3KF8 B;  1Q8K A;  2B2U A;  5EPL A;  2E76 C;  1SEB D;  5FK9 C;  1WCM B;  3IAY A;  1CHQ D;  5IGG A;  1ASZ A;  2IX1 A;  4A3F B;  4IPC A;  1I4X A;  5C0X I;  3RZD H;  1AZQ A;  4EX5 A;  1EL0 A;  1BCP D;  4B3M L;  1JMC A;  1LV9 A;  1SNC A;  4PNY A;  5JAV A;  3HZX A;  4UP7 A;  3OIQ A;  4H0L C;  3W5O A;  2IHF A;  3CU7 A;  4LUZ A;  4JBW A;  3U4Z A;  3U9O A;  4J6H A;  4AIM A;  3GTJ H;  3HOW H;  3TP6 A;  4HMI A;  1Y1V B;  1ILP A;  1VQP A;  5K36 G;  3B6Y A;  4QQB X;  3MC0 B;  4G7Z C;  5FLX L;  2G9H D;  3S24 A;  1EEI D;  5JPM C;  5I6Y A;  1PZJ D;  4JI3 L;  3NK9 A;  4UPA A;  2HIV A;  2EIF A;  3DM1 A;  3JAM i;  4MN3 A;  3NWT A;  4OXP A;  1GD7 A;  1Q82 C;  4A3L H;  1BUV T;  2G9D A;  3HOU B;  4BY7 G;  2NVY B;  4QUC A;  2VQF L;  1EIF A;  1GO3 E;  4R4Q A;  2ENB A;  2KBN A;  2XRQ D;  1L0W A;  1QE6 A;  1PVO A;  2E75 C;  2EVB A;  3CRL C;  4HCS A;  4P71 A;  5I9O A;  4IN3 A;  3VR2 A;  1X3Q A;  3N52 A;  5E4W C;  1X54 A;  1SYG A;  4R4I A;  4JOI A;  1HNX Q;  3S15 B;  2G5D A;  1VQF A;  2JA8 G;  5KYL A;  2F0K A;  3CF5 A;  1RHP A;  2WP8 J;  3S17 H;  2A68 D;  1WTQ A;  2I5M X;  2FMC A;  3AB9 A;  3CD6 A;  3GP7 A;  2MFI A;  4JI4 L;  1K8O A;  4YY3 L;  1VQC A;  1EUJ A;  2HDM A;  4XYQ A;  3TZD A;  4P72 A;  2N78 A;  3KOJ A;  4JI2 Q;  5JVH 3;  4HR7 B;  2NTT A;  1LTI D;  2O5I C;  3OOC A;  1NR2 A;  2Q2U A;  4C3J G;  1T5E A;  2EE1 A;  5DNF A;  1HXY D;  5IGC A;  5JJL A;  2AWO A;  1N36 Q;  4JI1 L;  1GUN A;  1FJG Q;  3KBG A;  4DV6 L;  5HY6 A;  2F4I A;  2RHS B;  2B29 A;  5JEA H;  3KJP A;  1SE2 A;  4A3C G;  3VYS A;  3S2H B;  3R2I A;  4LF5 L;  1BF4 A;  4POF A;  3S1Q H;  3UDG A;  4LNQ A;  4KHV A;  3IL8 A;  1UAP A;  2CCZ A;  5BN3 A;  3AFP A;  1I94 Q;  1I4H A;  5D3I B;  2B3G A;  4DR3 Q;  2PQE A;  3QJY A;  4A3D B;  3TS2 A;  1KDB A;  2OTL A;  1G8Z D;  1SJH D;  1RCV D;  1HZA A;  4Z9C B;  1X55 A;  4C3H B;  5EJW A;  1CSP A;  4EQN A;  3BVZ A;  3AMU A;  1OTC A;  5LMU L;  2RDF A;  4FXK C;  5T1G A;  1W2B A;  1HJP A;  3BG3 A;  3EA6 A;  4Y7N H;  4P75 A;  1I50 B;  1H9R A;  4A3I B;  3F2U A;  1S5F D;  2ID0 A;  1DOK A;  2F4V Q;  5CYU A;  4WJ3 M;  4OX9 L;  4A93 B;  2N49 A;  5ELF A;  1QJO A;  1Q1B A;  4DAY A;  4CGY B;  2EQS A;  4RFB A;  1JWU D;  4RGT A;  3PUZ A;  1TWA B;  3E9H A;  5C44 G;  2R93 G;  1K83 H;  3BZC A;  2L55 A;  3FKI H;  4K5X A;  4A76 A;  4PMB A;  5M5Y H;  2VZA A;  3CCV A;  1JC7 A;  2YU9 B;  1K73 C;  1WD1 A;  3FDT A;  1STB A;  2F0Q A;  4A3B B;  2PCF B;  4IPG A;  1JB7 A;  3KF8 A;  1QNU A;  4NPS A;  5LMN W;  2RDH A;  4G57 A;  1IBK Q;  2CH4 A;  4ZYS A;  1YI2 A;  2KEC A;  4OIK A;  2QCP X;  3T1Y Q;  4A3G B;  1ICW A;  1VQM A;  3DEO A;  5IE8 A;  4EQP A;  4PMC A;  3ZYY X;  1NR4 A;  3PO3 H;  3BJU A;  2PPB C;  2C35 B;  4HED A;  3EIV A;  1YHQ A;  1V8Q A;  3I4O A;  1EYD A;  3FP9 A;  5FO7 B;  3SVM A;  1HNX L;  2UXC Q;  1EY7 A;  3E5S A;  4RHS A;  1EEF D;  2SEB D;  3I73 A;  2KVM A;  3ICE A;  4QGU A;  4TRD A;  2PW5 A;  1GHK A;  2O2L D;  3LWE A;  1P8L A;  2SNS A;  2LS0 1;  3PGZ A;  3HOV B;  3I4N B;  3K7A H;  4BBS B;  2F0J A;  4ILW A;  3R93 A;  2D9U A;  1HQR D;  1MD2 D;  2K5D A;  3Q6S A;  3D6C A;  5IWA Q;  4CKE A;  1TY2 A;  4DUY Q;  4JI2 L;  3S9W A;  1NNX A;  2LY7 A;  1SMY D;  3HOY B;  3S2D B;  1YVC A;  2Q2T A;  1NMG A;  3HKS A;  1SLJ A;  3E6Z X;  4XQN A;  4BY1 G;  1VQG A;  5CGK A;  1YHA A;  2EYP A;  1WTR A;  1ESF A;  1FNV A;  1N36 L;  3CCE A;  2WAC A;  5I4D A;  1FJG L;  5IGE A;  1TWC B;  3P75 A;  4RKL A;  1NJI C;  1PYW D;  1E3P A;  1U4P A;  1SXT A;  5LHY 1;  2HQL A;  5C3E H;  4A3K B;  1I94 L;  1PYB A;  4JI8 Q;  5J39 A;  2B2Y A;  1U5K A;  4DR3 L;  1O7Z A;  4CHT B;  3DLL A;  3NQT A;  1YEZ A;  1BNZ A;  1F9P A;  2HDL A;  1KQS A;  4K0K L;  5IY0 A;  2CQO A;  2JA5 H;  2I5H A;  5EKK A;  1PMR A;  2AQ2 B;  3ULP A;  2KCT A;  2E2J B;  5LMN Q;  3K8A A;  1CA6 A;  1L0X B;  3OTO Q;  3I4M H;  5IGB A;  2LXJ A;  3CMA A;  2NTS A;  1U4M A;  4EQ5 A;  1IL8 A;  3T1H Q;  1GUG A;  1XPR A;  2NVT B;  2L9H A;  4LF7 Q;  4JBJ A;  3JAM L;  3K5M A;  4RHR A;  1XTC D;  1CK1 A;  3D3R A;  4HJ8 A;  4JI7 Q;  2GA4 B;  1TXY A;  2HUG A;  2Z6K C;  4P74 A;  3J81 E;  2PYK A;  5KNB A;  3MHB A;  1D5M C;  2F0M A;  1UNS A;  5T1I A;  3M4O B;  4OWT B;  4CDD C;  5NUC A;  2HHH Q;  1H95 A;  3X3M A;  5BR8 Q;  5E4X A;  1A2U A;  1K0S A;  4KD4 A;  1S5B D;  2HD3 A;  4IUP A;  4KN4 C;  4HCE A;  1CFM A;  5ELN A;  4IAL A;  4XT3 B;  1A15 A;  4N9P A;  5CV9 A;  5IP7 G;  1YJ9 A;  2BE5 C;  5COR A;  4ABN A;  2YYZ A;  1E1T A;  1IBK L;  1ENC A;  4WJ4 A;  1EQT A;  1Z6H A;  3T1Y L;  2LKV A;  1LAB A;  2CWA A;  3EN2 A;  5IGD A;  1TY0 A;  2HQE A;  3I4L A;  4YWL A;  1KC8 C;  1YNX A;  5IYC H;  3SR1 A;  1SYF A;  3HKZ B;  1ET6 A;  4TVA B;  4BY7 B;  2CH4 W;  2JEB I;  3H0G G;  2RSO A;  2UXC L;  1NAP A;  1EZ6 A;  3PO2 G;  4X3U A;  2KHS A;  2VQE Q;  1OXV A;  3NXW A;  4K14 A;  5M5W H;  2ATW A;  5C0X G;  3I56 A;  1JE5 A;  2VL6 A;  3RZO H;  2UUA Q;  1UUP A;  4IFD H;  1S5D D;  2M9V A;  4K8I A;  2L12 A;  1UEA B;  3MEF A;  4A3M H;  5IWA L;  2PZU A;  4DUY L;  2JA8 B;  2IHE A;  5ELB A;  1VQH A;  2GN5 A;  2NYZ D;  3U9S A;  5GAD C;  2VW9 A;  2R7Z H;  1L1O B;  1OXT A;  3MVV A;  2E2I H;  1BVS A;  1UE5 A;  3M4Y A;  2J7Z A;  3RMH A;  4LK1 C;  1HFG A;  3OW2 A;  4J15 A;  3FPU B;  5M9O A;  4A3J G;  1UE1 A;  1HA6 A;  1SE4 A;  4ZKC B;  3PIP A;  3K5N A;  4C3J B;  2QF7 A;  1PZK D;  2B2T C;  3QO2 A;  1GXD C;  3J81 i;  3S1R H;  4DUZ L;  2FIN B;  5L37 A;  2L1B A;  1V1P B;  4JI8 L;  1SFO B;  3FEW X;  3PIO A;  4ZRZ A;  3K57 A;  1SR3 A;  5C4J B;  1XNQ Q;  1BBU A;  1BBX C;  4GLX A;  5IT9 E;  2B63 H;  2EYF A;  1AE3 A;  1WTP A;  1A3T A;  2SDF A;  1VQ9 A;  1E22 A;  4YWM A;  3A8K E;  1FL0 A;  1LTG D;  2UUC Q;  3CKI B;  1HCZ A;  3HOZ H;  1Q1E A;  1ASY A;  1AH9 A;  3PUX A;  4KY5 A;  1TS3 A;  3OWE B;  3IRB A;  3SE0 A;  1DCZ A;  2KA7 A;  4LFA Q;  4LF7 L;  2IX0 A;  4NP5 A;  1MIU A;  5C6A A;  2UXB L;  2JXM B;  1Q81 C;  1IHZ A;  2N8N A;  3TDQ A;  4G7O C;  2ZT9 C;  2F0E A;  3BS1 A;  4X64 Q;  1EQV A;  4A3I G;  1Y1W H;  4GS3 A;  4X62 L;  5BR8 L;  2Z8L A;  3S1N H;  4A93 G;  3M7G A;  2NBF A;  2OCE A;  4MZ9 A;  4DV0 Q;  3IFT A;  1T9H A;  5IP9 H;  1DD2 A;  5JPN C;  4IUR A;  5C44 B;  2R92 H;  2WAQ B;  2R93 B;  1XPO A;  4B3T Q;  2BDO A;  1LTR D;  4DV1 L;  3L0O A;  5E3F A;  3PIP 3;  3NSW A;  2K1B A;  4C56 C;  4Y52 H;  4WFN 3;  3VYT A;  3MFY A;  4H7B A;  4KY6 A;  2DJF C;  4LF6 L;  1GJX A;  1S72 A;  2ZJP A;  5COY A;  3SK5 A;  3HP3 A;  4B9X A;  5I2X A;  1HA5 A;  3HG9 A;  3PIO 3;  5M5X B;  4JK1 C;  1VDZ A;  1Y14 B;  2ZM6 Q;  4RH6 A;  2VQE L;  2F0V A;  4DAM A;  1TS2 A;  1Q46 A;  5IOD A;  1ZXT A;  2XTI A;  3GTO H;  4HAE A;  5C4X H;  2DJG C;  5HUR A;  2J0T D;  3TQY A;  4KD3 A;  2Z6K A;  1JJG A;  1NTG A;  5J3B A;  3T56 B;  2Q8T A;  2F3I A;  1ICF B;  3GTL H;  4IUV A;  3F8T A;  2K14 A;  3MTS A;  4YHH Q;  3NEN A;  1OXU A;  4YCU A;  1STE A;  4R8N A;  4WJW A;  1QZG A;  5JVG 3;  3HOV G;  4KHP L;  1V1O A;  3F1Z A;  4DR7 Q;  1ZKO A;  4IFD I;  3PUV A;  3S14 H;  3J7Y W;  1B1Z A;  1J6Q A;  3I7F A;  2FMM A;  4ZAI A;  1MBY A;  4L8J A;  3T53 B;  3HOY G;  4DXG A;  2AMC B;  1VMP A;  4LMQ D;  4BY1 B;  4XDX A;  1TWH H;  2C5C A;  2XIW A;  3GTM H;  2B2V C;  1MSG A;  4R4T A;  5BN4 A;  3SXH A;  3QIA A;  2KHJ A;  4JBK A;  4RCO A;  2FFK B;  5CV7 A;  4R4O A;  4HID A;  2BOS A;  2EXZ A;  1F9R A;  2XN9 C;  3D6W A;  3STB D;  4A3K G;  1C7Y A;  4OIJ A;  1U4L A;  2IJ0 A;  4ODG A;  1F2Z A;  4A3L G;  3C1F A;  1BCP B;  3A5Z B;  1G6Z A;  2UUC L;  2WIN B;  4DV5 Q;  4FF2 A;  2F0L A;  3J81 j;  1PFS A;  1G2T A;  3CCM A;  1X3P A;  1L1O A;  4BBR H;  1M90 C;  1TWG B;  3P1H A;  3A5U A;  4UY8 C;  1N34 L;  4C1N I;  1G51 A;  2H1E A;  3KYH C;  1JQY D;  3I2Z A;  4DFA A;  2YU9 H;  3HKZ E;  2RSN A;  4RGM A;  2QW7 A;  4DV2 Q;  3FMC A;  1KD1 C;  1ET9 A;  2CVR A;  5IGF A;  1IW7 C;  1PH3 A;  5KEE A;  4ZCK A;  1IKM A;  4HSP A;  3L7Z C;  5FLM H;  1A8V A;  3JC6 6;  1LT3 D;  1EY8 A;  4QCL A;  2A69 C;  1YJN A;  2MO0 A;  3OW7 A;  1V1P A;  4DV0 L;  2NZ1 D;  4Q5V A;  3A74 A;  5EBD A;  4UDU C;  2HIX A;  1PH7 A;  2EYH A;  1HUM A;  1PDQ A;  4B3T L;  3V2T A;  2K75 A;  2E2H B;  1EFI D;  3DXJ C;  4YIJ A;  1U0L A;  4LUO A;  2HT1 A;  1HTL D;  2JA7 B;  3L3O C;  1N33 Q;  4GN4 B;  3FRP B;  5G3L F;  4PZ8 A;  1X9N A;  2NZO A;  2OQK A;  1SE8 A;  5CV4 A;  2P5Z X;  1O78 A;  1KLG D;  4AQY L;  3I72 A;  3D4D A;  2ZM6 L;  2NVQ H;  3UDX A;  5ELC A;  2F03 A;  4L6T B;  2PZT A;  2CHB D;  2D62 A;  1C9O A;  3CCR A;  5J1Z A;  2ZXO A;  4A75 A;  4X3T A;  1X3E A;  3HKZ G;  2D0P A;  1B4O A;  2A69 D;  4RGN A;  3CCQ A;  4GKJ L;  1J5E Q;  3H0G B;  4PZ7 A;  4CKC A;  3PO2 B;  4WOR A;  1CSQ A;  4K6L A;  1CQF A;  4YHH L;  1I4R A;  4DR1 Q;  4N8X 1;  3M3Y H;  1BCP F;  1Q12 A;  3M7N A;  2OEO A;  1Q86 C;  2L15 A;  1YIJ A;  3J80 i;  4IPH A;  3J81 L;  1VQE A;  4DR7 L;  1XYI A;  3CME A;  3SK6 A;  3CPW A;  1D1K A;  3A7A B;  3H15 A;  4K2K A;  1CKM A;  1F9S A;  3BDO A;  3KLS A;  1RTN A;  2YV5 A;  3U58 A;  3UDI A;  1PRT C;  4NKL A;  2CQA A;  4JV5 Q;  1D8L A;  1A3U A;  1RL2 A;  5DAU A;  2RVL A;  3UE0 A;  2VUM H;  5EBC A;  4C3I B;  4LWC A;  1KLU D;  2F0I A;  4DK0 A;  1HTP A;  4OO1 H;  4A3J B;  3RLN A;  4TQU S;  5ELD A;  4QY7 A;  2H4O A;  4XIG S;  1JOQ A;  3NQI A;  4N9T A;  1Q8I A;  1PTO H;  2A8V A;  3QB3 A;  2JE6 I;  2K01 A;  1EY9 A;  3D0F A;  1LO5 D;  4LF8 Q;  1LTB D;  3DM3 A;  4NMZ A;  3F2C A;  1XMO L;  4LFB Q;  3SK4 A;  2NN6 H;  1FVI A;  4FXG C;  2DUD A;  1A0I A;  1E2V A;  1SRO A;  2WV6 D;  2WAQ E;  1STG A;  4ID6 A;  5EQ0 A;  1Z7T A;  1KIX A;  1PRT D;  1DXM A;  1CTM A;  4APV A;  2K03 A;  4O1N A;  1TVX A;  3FHW A;  1V43 A;  5K36 H;  4DV2 L;  2WII B;  5C3X A;  1F2M A;  1SBB B;  3S1M H;  1E0B A;  3KDF B;  1TWF H;  4K5V A;  3GDE A;  1B50 A;  2ALY B;  2AQ1 B;  4BS9 A;  5M3F B;  2MNA A;  1M1K C;  2JN4 A;  4DNR B;  2B2V A;  3E3X A;  2V4D A;  2EYL A;  1QUQ B;  4BY7 H;  3OYY A;  1VQB A;  2JSO A;  2QEJ C;  3K7U C;  2UU9 Q;  5LL6 S;  5FLX c;  5A35 A;  3HOX H;  3GTP H;  2L5T A;  3J7Z C;  3WDN A;  3T16 A;  2PO4 A;  1EYG A;  3KK7 A;  5IYD H;  2K04 A;  3K80 C;  3Q8D A;  2D5D A;  2K5V A;  1N32 Q;  4G7H C;  5FJ8 G;  5IT9 L;  1S5C D;  2O5J C;  1O80 A;  2NVX H;  1PLF A;  2WAQ G;  3GTK H;  3TEH B;  1M8A A;  3BZD B;  1GUW A;  3NPP A;  2F0H A;  5C3E G;  1LT5 D;  4JW0 A;  4J1M A;  2EXD A;  1O7I A;  4KI0 A;  2F0P A;  2Z0S A;  4CDC C;  3HFZ B;  1BOS A;  5ISR A;  4A3E H;  2F0W A;  1I6H H;  1K8M A;  2RHQ B;  2F0D A;  4FDB A;  2LMC B;  1PH5 A;  4DR1 L;  3W2D A;  2Z9H A;  4KY7 A;  2JA5 G;  3C46 A;  3RR5 A;  1SND A;  3EBE A;  2F0T A;  1SNP A;  1FD7 D;  1KAA A;  2K6A A;  5ELO A;  1PV4 A;  1Q3L A;  1KDC A;  3S16 H;  1C4Q A;  4DN4 M;  1CQV A;  3ULL A;  1F2L A;  3D8G A;  1RIP A;  2PNH A;  3HRZ C;  5JJZ A;  4JV5 L;  4QL5 A;  3RZD B;  5DM7 3;  2OF1 A;  3J7A V;  4C2M H;  1D2B A;  1IYV A;  1O7Y A;  4K6D A;  5M3M H;  1JWS D;  2L11 A;  4LW1 A;  3NWS A;  2K5H A;  4KKS A;  3CCJ A;  3CC7 A;  3TN2 A;  1AN8 A;  2IW3 A;  3UDF A;  5BN5 A;  3TP7 A;  1D6E C;  3V96 A;  3GTJ B;  1LTA D;  3CQZ H;  1MHW C;  3HOW B;  4C1N K;  1F77 A;  3E0J A;  4GLA C;  2Z4H A;  3DWP A;  2CWP A;  4P73 A;  1CUK A;  1SAP A;  3BVM A;  2GVB A;  4OO1 I;  1XWE A;  1H9S B;  2PZW A;  1RD9 D;  1NUC A;  4UAI A;  2RQX A;  4MIU A;  5ELE A;  4DAP A;  2JYO A;  4GOP C;  1I4G A;  1N9W A;  5IYC G;  1AP0 A;  1IL2 A;  1I5F A;  1VQ8 A;  2NN6 I;  3PV0 A;  4XTC S;  3MXU A;  4QUF A;  5C44 H;  3QOL A;  1WFQ A;  4JCV E;  1H9M A;  1A2T A;  2Z4I A;  5CR3 A;  1YBY A;  2F1M A;  3VYR A;  3MAQ A;  1NCV A;  2DY7 A;  2JEA I;  2KJX A;  1MGS A;  2D2C C;  1KAW A;  1L0Y B;  1UEB A;  4IFD G;  1STA A;  4CDE C;  1J9O A;  4JC0 A;  3NHH A;  3FVQ A;  4A3M G;  3KF6 A;  1SN8 A;  2AWN A;  3LWU A;  3VYU A;  2R7Z G;  2EY2 A;  3S17 B;  2A6H C;  2EYM A;  2F4V L;  2AQ3 B;  2ZJR A;  2EYJ A;  4X3S A;  1JOK A;  2PQA B;  1KL9 A;  2BA0 A;  2N3S A;  5KGU A;  1QIL A;  4LF4 Q;  3I70 A;  4HIM A;  3NTI A;  1E7Z A;  1Y69 U;  3TP5 A;  1PTO C;  2JA7 G;  4BXX G;  4F7X A;  4ZUJ A;  2IWH A;  1B3A A;  4RCN A;  3TME A;  3M4P A;  1DM0 B;  2X69 A;  3J80 L;  1HZB A;  1Y8N B;  2EDG A;  4IJH A;  1VQ5 A;  1KRT A;  1BBW A;  3CCU A;  3KDF A;  3MA2 B;  3VDY A;  3P20 A;  2B8F A;  1K3R A;  1FR3 A;  4R1J A;  3S1Q B;  5GAE C;  3GTG H;  2PW7 A;  4UP9 A;  3C3L A;  3GTQ H;  3M9B A;  1WTH A;  1ZYR C;  1STH A;  1IBM Q;  5IYB G;  4NXN Q;  3D31 A;  1D5Z C;  1QUQ A;  1YJW A;  1C8C A;  3HOZ G;  4O2D A;  2JA6 H;  4L5S A;  1PXU A;  2QEX A;  1EWI A;  4J8Q A;  4BA2 I;  2ZJQ A;  1ESR A;  3NBH A;  4X6A H;  2BE5 D;  1QCB D;  1BDO A;  4Y7N B;  4DU9 A;  4DR6 Q;  4DR4 Q;  3G48 A;  3ONA B;  3LX0 A;  1Y1W G;  1LT6 D;  4KLK A;  1VS0 A;  3KFU A;  1MI2 A;  4GNX C;  1XJV A;  1GKH A;  3WOF A;  2Q8R E;  4GKK Q;  1I6V C;  4KMU C;  1ZYR D;  4C3I G;  2EY5 A;  1VQN A;  2UXD Q;  1FYC A;  1ENA A;  1EY4 A;  1DOL A;  1EY0 A;  1SYD A;  4CKB A;  1B44 D;  1BXT A;  2R92 G;  2KQ3 A;  3VA5 A;  1WCM H;  4XQQ A;  3EFX D;  4EQO A;  2Z6B A;  1U4R A;  1G6P A;  2QKI C;  4A3F H;  5GAG C;  1FNW A;  1I4P A;  1YIT A;  2EJG C;  1XMQ Q;  1B70 B;  2B2U C;  4HSV A;  1LT4 D;  1AEX A;  5AJ3 Q;  5FO8 B;  3I55 A;  1XXG A;  2LXK A;  2F3V A;  1UE7 A;  2ASB A;  3PO3 B;  4TKO B;  2LSS A;  4LF9 Q;  1QZH A;  3KJO A;  1Y1V H;  5LMN L;  3OTO L;  1YZ6 A;  4JI5 Q;  3JAM c;  3RD4 A;  1TII D;  3NTK A;  4BA1 I;  3GO5 A;  3T1H L;  4RG1 A;  2A5H A;  3PSI A;  5M3F G;  4PMW A;  4JI7 L;  3K7A B;  4DV4 Q;  1WVL A;  2F3W A;  1WYD A;  4I7A A;  3A54 A;  5CBE E;  4JPB W;  2Z1C A;  3HOU H;  1KAB A;  2NVY H;  1E2Z A;  2L4N A;  3J80 c;  4LF4 L;  4H02 A;  2HHH L;  3VR5 A;  1H9S A;  1X3F A;  4IQZ A;  3AQQ A;  5KNC A;  4ME5 A;  2MO1 A;  3T51 B;  2DNC A;  1HFN A;  2I07 B;  1QB5 D;  2FXQ A;  2K5W A;  5H1S E;  2WKC A;  1PH6 A;  5C5L A;  3LGJ A;  1EIH A;  3K5L A;  4U68 A;  3S15 H;  1PHJ A;  3PQI A;  4QF4 A;  1YNN C;  2EOT A;  5C3E B;  3BZK A;  1CHP D;  5GRO A;  4O0A A;  1IBM L;  2J4X A;  4EGV A;  2RA4 A;  5KND A;  1H9J A;  1Z47 A;  4MHE A;  4JOI C;  1WTX A;  1VQK A;  4B3M Q;  1YHB A;  3W1G A;  4A3J H;  1PH1 A;  4L5Q A;  4FO2 A;  2ICE C;  4XQJ A;  1LAC A;  4BBR G;  4PG3 A;  4K5W A;  4MTK A;  2KCC A;  1A3V A;  4FF1 A;  1S40 A;  2JA5 B;  1TQO A;  1JT8 A;  1VQJ A;  3Q23 A;  1SJE D;  2UUA L;  2PQA A;  1B53 A;  2XWB B;  1LYL A;  4JI3 Q;  3S2H H;  4AYB B;  1X6O A;  4BWG B;  3TRZ A;  1ROD A;  2SOB A;  3I3C A;  4F8M A;  1YNN D;  4H44 C;  2VXW A;  4ZLT F;  4GKK L;  5CV6 A;  2ZTC A;  3F2B A;  1NY4 A;  2I46 A;  3R3O A;  3M85 A;  2XSC A;  1YNJ C;  1XNR Q;  2UXD L;  2GVA A;  1KTK A;  2YTX A;  4KHZ A;  3A8I E;  1IZ6 A;  3UE1 A;  1VQO A;  4FYD A;  1GOZ A;  2VQF Q;  4A3D H;  3G6E A;  2TMP A;  2B39 A;  3I91 A;  5CC4 A;  1I4Q A;  5D3D A;  1EZ8 A;  1EYC A;  2M2L A;  2YTY A;  4C3H H;  3IKJ A;  2E2D C;  4DKA C;  3HOW G;  2A73 B;  3CXC A;  1B7Y B;  1RTO A;  1A63 A;  2Y0S E;  1S5E D;  4X66 Q;  1I3Q B;  1D5X C;  1OXX K;  2JQO A;  3MXG A;  3HGB A;  1VQL A;  5TSS A;  4AH6 A;  1LLR D;  1LTL A;  1XNQ L;  1EQR A;  2WKD A;  1I50 H;  3WOE A;  4KJN A;  1WI5 A;  2NWG A;  3OWF A;  1B9N A;  4A3I H;  1R4Q B;  4UHV A;  4RGO S;  1MSH A;  4LFC Q;  1HNW Q;  4A93 H;  3E9I A;  3T4A C;  3PMF A;  1FNU A;  4PQX A;  2ZTE A;  1VQ4 A;  1PH9 A;  1KRS A;  1GM5 A;  4MNO A;  2TSS A;  3I90 A;  2IL8 A;  3U50 C;  4HIO A;  3NEL A;  1TWA H;  1JE4 A;  3PCO B;  3L2P A;  2EY1 A;  5M5W B;  4LFA L;  4GNX A;  1W6K A;  1M4V A;  4Q0F A;  4IUQ A;  4RA8 A;  3RZO B;  4DV4 L;  1XTD A;  2EJF C;  3DHQ A;  4HJ5 A;  1B9M A;  4A3B H;  4IPD A;  2K7V A;  1NMF A;  4A3M B;  3NTH A;  2I5L X;  1CZG A;  3M4Q A;  4GZY C;  2AUK A;  4X64 L;  2KOL A;  3D4W A;  2R7Z B;  4A3G H;  3DWA A;  3AFQ A;  2E2I B;  2B2T A;  2VB3 X;  1A62 A;  2VUM G;  3RLF A;  1NBW A;  3HS0 C;  2Y0S G;  2PNR C;  2A19 A;  1HNZ Q;  4RMF A;  4OO1 G;  3J7A 5;  1JIC A;  3EJI A;  2IT1 A;  1JJ2 A;  3SEB A;  1UWV A;  3TP8 A;  1EWC A;  2KEE A;  1VF7 A;  1CT1 D;  1HR0 W;  3AYH B;  3O13 A;  1FGB D;  3S1R B;  3HOV H;  1EYA A;  3ZJY C;  3I4N H;  5LMU Q;  4BBS H;  4L5R C;  1KXL A;  2NN6 G;  4YCV A;  1TU2 B;  1QVG A;  3CC2 A;  2RKS A;  1IW7 D;  4PZ6 A;  2DY8 A;  1O7L A;  4M8A A;  5JEA G;  1D7Q A;  3U4V A;  4K8J A;  3CCS A;  1G29 1;  2ICI A;  2B63 B;  3HOY H;  3DUZ A;  3S2D H;  1R9T B;  1TKW B;  3CW2 C;  2I0Q A;  3RNU A;  4XT1 B;  1CKN B;  1VQI A;  4JI0 Q;  4OX9 Q;  4OEM B;  4CJ0 B;  1KNE A;  1GUO A;  2F0F A;  4YWK A;  1TWC H;  3HOZ B;  5E1F A;  5C4H A;  3VR4 A;  1E2W A;  2MGS A;  4GLV B;  1DON A;  2A68 C;  2X6G A;  1JJC B;  4HJA A;  4ULL A;  4HTH A;  4A3K H;  1Q90 A;  3BYY B;  4ME3 A;  3CPF A;  5EKL A;  2MPM A;  1Z9F A;  4FP5 D;  1XNR L;  1B3Q A;  1SYC A;  3I8Z A;  4DV7 Q;  1ILQ A;  4IUT A;  2XRS D;  5HGQ A;  3A55 A;  5C0X J;  4KV6 A;  1BKB A;  2E8G A;  1Y1W B;  2XGT A;  1F9Q A;  1DGS A;  1S3O A;  5FO9 B;  4OON A;  3S1N B;  4DR2 Q;  1PRT B;  3RUZ A;  3HOX G;  2VY3 A;  4NDX A;  4X66 L;  2E2J H;  5IYD G;  2B2Y C;  1CM9 A;  4HN7 A;  3A8J E;  4OGQ C;  5KRU A;  1W6J A;  3KF6 B;  5LL6 X;  1DOM A;  2R92 B;  2IPK D;  5CV8 A;  5JJK A;  2ZXR A;  4L5T A;  3FKI G;  2R7F A;  4X3K A;  5I9P A;  4U67 3;  4V19 0;  2EY6 A;  2NVT H;  5KYI A;  1R4P B;  2HCI A;  2K05 A;  3K81 C;  2KCN A;  4DK3 C;  3G4S A;  5DEH A;  4LFC L;  1HNW L;  1CA5 A;  3OSO A;  4B3S Q;  4JI6 Q;  1EOT A;  1HHV A;  1E24 A;  1AFP A;  2UUB Q;  2KED A;  4OEL B;  4QB4 A;  3V05 A;  4A3E G;  4DV5 L;  2RCN A;  4CBV A;  1A6X A;  2EJM A;  3M4O H;  1WTO A;  1BQQ T;  1HR0 Q;  3GTO B;  5C4X B;  3SGI A;  3PO3 G;  4B9W A;  5DM6 3;  1SDF A;  2NUC A;  3ND8 A;  3R8B A;  1OXS C;  3H09 A;  3PF5 A;  2MJ8 A;  2RDG A;  3GTL B;  2ZXP A;  1H9K A;  3QWN A;  5EGT A;  2BH2 A;  2E5L Q;  5CBA E;  4NB3 A;  4GN3 B;  2IY5 B;  4CJ1 B;  1ZEQ X;  1TS5 A;  4KN7 C;  1HNZ L;  3CHB D;  3S14 B;  3G7L A;  5M3M G;  1AZP A;  4ZQ3 A;  2FJ2 A;  2N88 A;  1P16 A;  3ITP A;  5AFW A;  2A74 C;  4KJO A;  4NXM Q;  1AE2 A;  1C48 A;  2RBM A;  4FXD A;  2F0U A;  2OXP A;  4AYB E;  1N33 L;  4K0K Q;  1TWH B;  3EVQ A;  3GTM B;  4B3R Q;  4H13 C;  3NBH B;  3ERQ A;  4I7Z C;  3E0E A;  4N8F A;  1SMX A;  5HGT A;  2PMZ B;  2BCO A;  4B08 A;  1PRT F;  1OO9 B;  4F88 A;  2ZTD A;  2JA8 H;  4IJL A;  1Q7Y C;  1XPU A;  2QA4 A;  3PUW A;  3SK8 A;  3T13 A;  2EPB A;  2AHO B;  4KTA A;  4JI0 L;  4JG2 A;  4NW2 A;  4DA2 A;  2R7D A;  1J5E L;  1K28 A;  4OHJ A;  5EPJ A;  4DR5 Q;  2KCM A;  3MXN B;  3UI2 A;  2QDL A;  4OWW B;  1IKL A;  3J81 c;  3OMG A;  2OTJ A;  1EWH A;  3RLO A;  4BBR B;  2RF4 A;  5FKA C;  4C3J H;  1K8A C;  2EZV A;  4DNT B;  1K3B C;  2IX3 A;  3BU2 A;  5A2Q E;  2A6E C;  3VR3 A;  4IZ8 A;  3CCL A;  1LM0 A;  1AW7 A;  3SHL A;  3X3N A;  1SFO H;  3I4M G;  1WJJ A;  4DV7 L;  2XVS A;  1T5X D;  5C4J H;  1DYQ A;  1SMY C;  2K5N A;  1GUT A;  3DMU A;  4A3C H;  4AYB G;  1KNA A;  2F0N A;  2MQH A;  4DR2 L;  1KHI A;  3CRK C;  2YTV A;  2XWJ B;  1EY5 A;  1HQM C;  3DEP A;  1VCI A;  4DK6 C;  5K5P A;  4HIK A;  3QG1 A;  2OT2 A;  3KUP A;  3J7A F;  4V0B A;  4DAV A;  1BR9 A;  2WB1 E;  1ONL A;  4X65 Q;  1CKN A;  5D65 A;  4LF8 L;  4LAA A;  2Q2H A;  4JI6 L;  1N8R C;  4O42 A;  4B3S L;  2BH8 A;  2A6E D;  5IOC A;  2UUB L;  4LFB L;  4JYA Q;  1UE6 A;  2K50 A;  1EU3 A;  2HCC A;  3TBI B;  4DV3 Q;  2NVQ B;  2QGQ A;  3K59 A;  1HR0 L;  4FF3 A;  4ZKB B;  4JBM A;  4GOP B;  4WRD A;  1QOH A;  5EKI A;  5FJ8 H;  2L0C A;  3MFG A;  5C5M A;  2JA6 G;  1L2F A;  3NEM A;  4HJ9 A;  2R93 H;  1RJT A;  1S4Z A;  3FPP A;  3L9A X;  1LTT D;  5C3W A;  4S3S A;  3M3Y B;  1EIY B;  1WD0 A;  5JOB A;  2E5L L;  3HEJ A;  4DUZ Q;  1WTV A;  2QIL A;  3PF4 A;  3H3V H;  3K6O A;  5M5X H;  1F2Y A;  3C1E A;  1V9P A;  4NXM L;  4FVM A;  4R8I A;  4QIW B;  5FLX E;  2JJQ A;  4MTN A;  3AU7 A;  3QOJ A;  5CMD A;  2UU9 L;  2DNE A;  2JA9 A;  2NZH A;  2WB1 G;  5IT9 c;  1JWM D;  3G6J B;  3MXP A;  4B3R L;  2VUM B;  2V1C C;  2OQ0 A;  2Y0S B;  4UP8 A;  4DF7 A;  5C4Z A;  1CZW A;  1EIG A;  1KDA A;  5D14 A;  4KKU A;  1QVF A;  4OL7 A;  1JOO A;  3ND9 A;  1JOR A;  1N32 L;  1QVC A;  2LFN A;  2BDN A;  1IYJ B;  1FGU A;  1XX8 A;  3ULJ A;  3BVG A;  1WCM G;  1II3 A;  2K33 A;  3TZU A;  2K5Q A;  3OPO A;  1PTO B;  1SNM A;  2X6L A;  2D0O A;  4RWS C;  1E1O A;  4A3F G;  3OIP A;  1HUN A;  4DK1 A;  2UXB Q;  3A0J A;  1Y8P B;  1IBL Q;  4DR5 L; 
#chains in the Genus database with same CATH homology
 4PZ8 A;  2B63 G;  1X9N A;  3BZK A;  2NZO A;  3PUZ A;  4X62 Q;  2OQK A;  3E9H A;  1SE8 A;  5GRO A;  4O0A A;  5C44 G;  3RN2 A;  2R93 G;  1K83 H;  1IBM L;  4BY1 H;  5JJI A;  3BZC A;  3FKI H;  4AQY L;  4A76 A;  1Z47 A;  3W1B A;  1NE3 A;  5M5Y H;  4JOI C;  2VZA A;  5JEA J;  1Y1V G;  2ZM6 L;  4R4C A;  3CCV A;  3UDX A;  1YHB A;  3W1G A;  1EQQ A;  1K73 C;  1VQK A;  4B3M Q;  4A3J H;  1PH1 A;  4L5Q A;  1I3Q H;  2D62 A;  1C9O A;  1K8G A;  4BBR G;  4PG3 A;  3CCR A;  4A75 A;  1X3E A;  4IPG A;  4DPG A;  3HKZ G;  4NPS A;  2D0P A;  3CCQ A;  5LMN W;  1JB7 A;  1IBK Q;  3CAM A;  1YI2 A;  1S40 A;  4DNI A;  4GKJ L;  1JT8 A;  1J5E Q;  1VQJ A;  4DV1 Q;  2UUA L;  4PZ7 A;  3T1Y Q;  2PQA A;  1VQM A;  5IE8 A;  1CSQ A;  1PA6 A;  4YHH L;  3PO3 H;  3BJU A;  4DR1 Q;  3M3Y H;  4LF6 Q;  3HOU G;  1LYL A;  2C35 B;  4OWX B;  3EIV A;  1YHQ A;  4JI3 Q;  1Q12 A;  3S2H H;  3M7N A;  1Q86 C;  1X6O A;  3TRZ A;  2L15 A;  3I4O A;  3J80 i;  4IPH A;  1YIJ A;  1VQE A;  3FP9 A;  4DR7 L;  4GKK L;  1HNX L;  2ZTC A;  3F2B A;  3KLW A;  2UXC Q;  3CME A;  1TWG H;  1NY4 A;  4X65 L;  3F2D A;  3M85 A;  3CPW A;  3H15 A;  4GNX B;  1XNR Q;  1CKM A;  3ICE A;  2UXD L;  2GVA A;  2YTX A;  4KHZ A;  4QGU A;  1IZ6 A;  3UE1 A;  1VQO A;  4YCW A;  1P8L A;  1SRU A;  2H5X A;  2YV5 A;  3PGZ A;  2VQF Q;  2PI2 A;  3UDI A;  5IP9 G;  3G6E A;  3U58 A;  4A3D H;  4JV5 Q;  1D8L A;  4JYA L;  3K7A H;  1RL2 A;  2WFW A;  3GD7 A;  3UE0 A;  4IO9 A;  2KEN A;  4DV3 L;  2VUM H;  2YTY A;  4C3H H;  1L1O C;  5IWA Q;  4LWC A;  5EAY A;  4DKA C;  3HOW G;  4DUY Q;  3CXC A;  1B7Y B;  4JI2 L;  5DLQ E;  1A63 A;  2Y0S E;  4X66 Q;  1YVC A;  2Q2T A;  1NMG A;  3RLN A;  2K52 A;  1SLJ A;  1OXX K;  2JQO A;  3HKS A;  4QY7 A;  4TQU S;  2OWO A;  4XIG S;  1VQL A;  1XNQ L;  4BY1 G;  1VQG A;  1LTL A;  4AH6 A;  4KHP Q;  1EQR A;  1I50 H;  1YHA A;  5E7N A;  1WOC A;  2BA1 A;  3ER0 A;  3RN5 A;  2PMZ E;  1WI5 A;  1N36 L;  2A8V A;  4A3I H;  2JE6 I;  3CCE A;  3D0F A;  1PH4 A;  4LF8 Q;  1FJG L;  3DM3 A;  3F2C A;  1K9M C;  4LFC Q;  1XMO L;  2E2H H;  1HNW Q;  4A93 H;  3E9I A;  1NJI C;  4LFB Q;  1FVI A;  5C4X G;  1VQD A;  2JA7 H;  4BXX H;  2DUD A;  1A0I A;  1SRO A;  2ZTE A;  1E3P A;  1VQ4 A;  1PH9 A;  1KRS A;  4QJF A;  2WAQ E;  5IP7 H;  1GM5 A;  1X56 A;  4A4I A;  2KHI A;  2HQL A;  4MNO A;  5C3E H;  2NVQ H;  3U50 C;  4HIO A;  3NEL A;  1TWA H;  2PI2 E;  1KIX A;  1I94 L;  1PYB A;  4JI8 Q;  3PCO B;  4APV A;  3G71 A;  3L2P A;  4LFA L;  1U5K A;  4DR3 L;  1VQA A;  3FHW A;  3TS0 A;  4GNX A;  1CKO A;  2JK8 A;  1V43 A;  3DLL A;  4DV2 L;  1YEZ A;  1R9T H;  2A1A A;  4DV4 L;  1XTD A;  4HJ5 A;  3S1M H;  4A3B H;  1KQS A;  2AKW B;  2K4K A;  3KDF B;  4IPD A;  4K0K L;  1NMF A;  1TWF H;  1MJC A;  5IY0 A;  2CQO A;  2JA5 H;  2I5L X;  2I5H A;  3GDE A;  3M4Q A;  4X64 L;  3PUY A;  5IYB H;  2ALY B;  3ULP A;  2KCT A;  3H0G H;  3H3V I;  4A3G H;  5LMN Q;  4A3D G;  1EFW A;  3K8A A;  3PO2 H;  1IXR A;  3AFQ A;  2MNA A;  3OTO Q;  3I4M H;  1M1K C;  2LXJ A;  1A62 A;  3CMA A;  1XPR A;  3RLF A;  1NBW A;  2Y0S G;  4EQ5 A;  3T1H Q;  2VUM G;  1QUQ B;  4BY7 H;  1HH2 P;  3OYY A;  1VQB A;  2A19 A;  1N34 Q;  1HNZ Q;  4GOP A;  4LF7 Q;  1B8A A;  3K7U C;  4JBJ A;  4RMF A;  4OO1 G;  3J7A 5;  2UU9 Q;  1IBL L;  4HJ8 A;  2IT1 A;  5FLX c;  2ES2 A;  4JI7 Q;  1TXY A;  3HOX H;  1JJ2 A;  3GTP H;  4P74 A;  2Z6K C;  1UWV A;  3CC4 A;  3J7Z C;  2CFM A;  2R6G A;  1HR0 W;  1EYG A;  3AYH B;  5IYD H;  3K80 C;  3Q8D A;  1N32 Q;  2K5V A;  3HOV H;  4OWT B;  5FJ8 G;  3I4N H;  3ZJY C;  2HHH Q;  1H95 A;  5LMU Q;  4BBS H;  5BR8 Q;  2NVX H;  4L5R C;  1KXL A;  2WAQ G;  2NN6 G;  4YCV A;  1PYS B;  1QVG A;  3CC2 A;  1VQ6 A;  3GTK H;  5ELN A;  4C3I H;  4NXN L;  4PZ6 A;  3TEH B;  5JEA G;  1D7Q A;  3U4V A;  4GN5 A;  5IP7 G;  3CCS A;  1G29 1;  1YJ9 A;  3HOY H;  3S2D H;  5C3E G;  3CW2 C;  2EXD A;  1O7I A;  2I0Q A;  2YYZ A;  4KI0 A;  1PH8 A;  3RNU A;  1E1T A;  1IBK L;  1CKN B;  1W3S A;  2Q2I A;  2Z0S A;  1VQI A;  3HFZ B;  4JI0 Q;  4OX9 Q;  4WJ4 A;  4A3E H;  3T1Y L;  3WWV A;  1HZC A;  2CWA A;  3EN2 A;  1GVP A;  1I6H H;  4YWK A;  1V1Q A;  2RHQ B;  4YWL A;  1KC8 C;  1TWC H;  4FDB A;  1PH5 A;  4A3B G;  1YNX A;  5IYC H;  4DR1 L;  4DR6 L;  1PH2 A;  4DR4 L;  4GLV B;  4TVA B;  2JA5 G;  3RR5 A;  4AQY Q;  3EBE A;  2JEB I;  3H0G G;  1JJC B;  4HJA A;  4A3G G;  5ELO A;  1VQ7 A;  5FLM G;  2UXC L;  1PV4 A;  4A3K H;  3PO2 G;  4POG A;  4ME3 A;  3CPF A;  2VQE Q;  1Z9F A;  1OXV A;  1XNR L;  3S16 H;  5M5W H;  4DV7 Q;  5HGQ A;  2ATW A;  5C0X G;  3I56 A;  5C0X J;  3ULL A;  1X65 A;  1JE5 A;  2VS1 A;  1BKB A;  2E8G A;  1RIP A;  2PNH A;  2VL6 A;  2XGT A;  3RZO H;  4GKJ Q;  4JV5 L;  2UUA Q;  1DGS A;  4QL5 A;  1S3O A;  1EOV A;  4OON A;  4DR2 Q;  2CKZ B;  3MEF A;  4QIW E;  3HOX G;  4A3M H;  5IWA L;  4C2M H;  4DUY L;  2IHE A;  2VY3 A;  5M3M H;  1VQH A;  2GN5 A;  3STB C;  4X66 L;  3K0X A;  5IYD G;  5GAD C;  4LW1 A;  2VW9 A;  1L1O B;  2E2J H;  2R7Z H;  2K5H A;  1X3G A;  1OXT A;  5M3F H;  3CCJ A;  3CC7 A;  3KF6 B;  1MJE A;  3I4N G;  1XMQ L;  2E2I H;  4BBS G;  3UDF A;  1BVS A;  5JJK A;  4IOA A;  4L5T A;  1UE5 A;  2R7F A;  3FKI G;  2NVT H;  5AJ3 L;  3CQZ H;  5GAH C;  3K81 C;  4GLA C;  4DK3 C;  3OW2 A;  4J15 A;  4P73 A;  1LUZ A;  2CWP A;  4LFC L;  3G4S A;  4A3J G;  1HNW L;  1UE1 A;  1CUK A;  4JI6 Q;  4B3S Q;  2GVB A;  4IOC A;  1E24 A;  3PIP A;  2UUB Q;  1K0R A;  4LF9 L;  4OO1 I;  4JI4 Q;  3ERS X;  4YY3 Q;  4DV5 L;  2RCN A;  4A3E G;  4JI5 L;  3J81 i;  3S1R H;  4DUZ L;  3M4O H;  4JI8 L;  4GOP C;  1HR0 Q;  1N9W A;  4LUV A;  5IYC G;  4HJ7 A;  3PIO A;  1IL2 A;  1SR3 A;  3SGI A;  1XNQ Q;  3PO3 G;  1I5F A;  1BBU A;  1VQ8 A;  4GLX A;  1HZ9 A;  2NN6 I;  3PV0 A;  2B63 H;  2VNU D;  4XTC S;  1OXS C;  1C0A A;  1AE3 A;  4ALP A;  5C44 H;  3PF5 A;  1WFQ A;  4JCV E;  4JI1 Q;  1MKH A;  4DAY B;  3AEV A;  1XMO Q;  1YBY A;  1VQ9 A;  2DGY A;  4DV6 Q;  3CP0 A;  1E22 A;  2F52 A;  4YWM A;  2JEA I;  1FL0 A;  2UUC Q;  2BH2 A;  1KAW A;  1UEB A;  4IFD G;  4LF5 Q;  4IFD J;  1AH9 A;  3HOZ H;  1Q1E A;  1ASY A;  2E5L Q;  4JC0 A;  4NB3 A;  3PUX A;  4GN3 B;  2IY5 B;  4A3M G;  3KF6 A;  1SN8 A;  3TRE A;  3IRB A;  2AWN A;  1HNZ L;  4LF7 L;  4LFA Q;  5M3M G;  5GQO A;  2IX0 A;  1MIU A;  1P16 A;  2R7Z G;  4NXM Q;  2F4V L;  2UXB L;  1AE2 A;  3KF8 B;  1Q8K A;  1Q81 C;  4AYB E;  2N8N A;  2ZJR A;  1N33 L;  4K0K Q;  2PQA B;  1KL9 A;  2BA0 A;  2N3S A;  4B3R Q;  3NBH B;  4X64 Q;  1ASZ A;  4A3I G;  1Y1W H;  2IX1 A;  4GS3 A;  4X62 L;  5BR8 L;  4IPC A;  3E0E A;  4LF4 Q;  5C0X I;  1SMX A;  4HIM A;  3RZD H;  3S1N H;  1E7Z A;  4EX5 A;  4A93 G;  2ZTD A;  2JA8 H;  2JA7 G;  4BXX G;  2OCE A;  4MZ9 A;  4B3M L;  1JMC A;  4IJL A;  4DV0 Q;  1Q7Y C;  1XPU A;  3M4P A;  2QA4 A;  3PUW A;  1HZB A;  1T9H A;  5IP9 H;  4UP7 A;  1VQ5 A;  4IJH A;  1KRT A;  3W5O A;  2IHF A;  2AHO B;  4JI0 L;  4LUZ A;  1BBW A;  4JBW A;  4JG2 A;  3U4Z A;  2R92 H;  3CCU A;  4AIM A;  3GTJ H;  1XPO A;  4B3T Q;  2R7D A;  3KDF A;  4DV1 L;  3VDY A;  1J5E L;  3L0O A;  3HOW H;  4DR5 Q;  2KCM A;  3MXN B;  4Y52 H;  1VQP A;  5K36 G;  1K3R A;  4R1J A;  3B6Y A;  5GAE C;  4OWW B;  3J81 c;  3GTG H;  4QQB X;  2OTJ A;  4UP9 A;  3RLO A;  3S24 A;  2RF4 A;  3GTQ H;  3M9B A;  4C3J H;  4LF6 L;  1K8A C;  4JI3 L;  1S72 A;  2ZJP A;  1IBM Q;  4UPA A;  5IYB G;  3BU2 A;  4NXN Q;  2HIV A;  1Y14 B;  3D31 A;  1QUQ A;  2ZM6 Q;  3CCL A;  1LM0 A;  2EIF A;  3JAM i;  2VQE L;  1YJW A;  4DAM A;  1Q46 A;  3HOZ G;  2XTI A;  4O2D A;  1SFO H;  4OXP A;  2JA6 H;  1WJJ A;  4DV7 L;  3GTO H;  4L5S A;  1GD7 A;  5C4X H;  1Q82 C;  3I4M G;  5C4J H;  4A3L H;  2QEX A;  2K5N A;  1EWI A;  4BA2 I;  4BY7 G;  4A3C H;  4AYB G;  3TQY A;  2VQF L;  2ZJQ A;  1EIF A;  1GO3 E;  2Z6K A;  4R4Q A;  2KBN A;  4DR2 L;  2MQH A;  1NTG A;  1KHI A;  5J3B A;  1L0W A;  2YTV A;  4X6A H;  1JJG A;  2F3I A;  1PVO A;  3GTL H;  4DR6 Q;  3F8T A;  1VCI A;  2K14 A;  4P71 A;  4DK6 C;  4YHH Q;  3G48 A;  3NEN A;  4HIK A;  4DR4 Q;  1OXU A;  4YCU A;  1Y1W G;  4KLK A;  1VS0 A;  1QZG A;  3KFU A;  3HOV G;  1XJV A;  4GNX C;  4KHP L;  1X54 A;  3F1Z A;  4R4I A;  1GKH A;  4JOI A;  4DR7 Q;  1HNX Q;  4GKK Q;  1VQF A;  2JA8 G;  4IFD I;  3PUV A;  3S14 H;  2WB1 E;  4X65 Q;  1CKN A;  3CF5 A;  4LF8 L;  1VQN A;  1J6Q A;  2Q2H A;  2WP8 J;  3I7F A;  3S17 H;  2UXD Q;  4JI6 L;  1N8R C;  4B3S L;  3HOY G;  2BH8 A;  2I5M X;  3CD6 A;  2UUB L;  2AMC B;  4LFB L;  2MFI A;  4JI4 L;  2R92 G;  4YY3 L;  4JYA Q;  1UE6 A;  1VQC A;  1WCM H;  1EUJ A;  2K50 A;  1TWH H;  3GTM H;  4DV3 Q;  4P72 A;  2N78 A;  1G6P A;  4R4T A;  2QGQ A;  3KOJ A;  4JI2 Q;  4A3F H;  5GAG C;  1HR0 L;  1YIT A;  2Q2U A;  2KHJ A;  1XMQ Q;  4JBK A;  1B70 B;  4JBM A;  4GOP B;  4R4O A;  4HID A;  5AJ3 Q;  5JJL A;  2AWO A;  1N36 Q;  3I55 A;  5FJ8 H;  4JI1 L;  3STB D;  4A3K G;  2LXK A;  1FJG Q;  2JA6 G;  1C7Y A;  1L2F A;  3NEM A;  4HJ9 A;  2R93 H;  4DV6 L;  1UE7 A;  5HY6 A;  2ASB A;  4A3L G;  2LSS A;  2RHS B;  4LF9 Q;  2B29 A;  3A5Z B;  3KJP A;  1QZH A;  3KJO A;  1Y1V H;  4DV5 Q;  1EIY B;  2UUC L;  5LMN L;  4A3C G;  4LF5 L;  4POF A;  3J81 j;  3UDG A;  2E5L L;  4LNQ A;  3S1Q H;  3OTO L;  1YZ6 A;  1PFS A;  4JI5 Q;  3JAM c;  3CCM A;  4DUZ Q;  1L1O A;  4BBR H;  2CCZ A;  4BA1 I;  3T1H L;  3GO5 A;  1M90 C;  4RG1 A;  3H3V H;  3PF4 A;  3AFP A;  3A5U A;  4UY8 C;  1N34 L;  5M5X H;  1I94 Q;  1G51 A;  1V9P A;  3KYH C;  3I2Z A;  4DR3 Q;  2B3G A;  4NXM L;  3PSI A;  2YU9 H;  3HKZ E;  2JJQ A;  4MTN A;  2UU9 L;  4DV2 Q;  1KD1 C;  5M3F G;  2JA9 A;  2NZH A;  2WB1 G;  4PMW A;  5IT9 c;  4DV4 Q;  2OTL A;  4JI7 L;  3TS2 A;  1PH3 A;  1HZA A;  1WYD A;  4B3R L;  2V1C C;  1X55 A;  2OQ0 A;  4UP8 A;  3HOU H;  1QVF A;  2NVY H;  3L7Z C;  1N32 L;  1CSP A;  3J80 c;  1QVC A;  5FLM H;  1A8V A;  4H02 A;  4LF4 L;  1OTC A;  2HHH L;  1IYJ B;  1X3F A;  3JC6 6;  5LMU L;  1FGU A;  3AQQ A;  1W2B A;  2MO1 A;  1YJN A;  3ULJ A;  2MO0 A;  1HJP A;  4Y7N H;  4DV0 L;  1WCM G;  4P75 A;  3A74 A;  2FXQ A;  2D0O A;  2HIX A;  1PH7 A;  1E1O A;  5H1S E;  4A3F G;  1PH6 A;  2ID0 A;  4WJ3 M;  2F4V Q;  2UXB Q;  3LGJ A;  4B3T L;  3A0J A;  2K75 A;  4OX9 L;  1IBL Q;  3S15 H;  2N49 A;  1PHJ A;  1U0L A;  4LUO A;  4DR5 L;  2HT1 A;  1N33 Q;  1Q1B A;  4GN4 B;  2EQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...