1IYUA

Lipoyl domain of pyruvate dehydrogenase complex, nmr, minimized average structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
79
structure length
79
Chain Sequence
SEIIRVPDIGGDGEVIELLVKTGDLIEVEQGLVVLESAKASMEVPSPKAGVVKSVSVKLGDKLKEGDAIIELEPAAGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROLIPOAMIDE ACETYLTRANSFERASE COMPONENT OF PYRUVATE DEH
publication title Three-dimensional structure in solution of the N-terminal lipoyl domain of the pyruvate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
molecule tags Acyltransferase
total genus 5
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1996-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1iyuA00
2ZT9C 1GUSA 1H9JA 2K33A 1HPCA 2O5IC 1BDOA 3M85A 2A68D 3BG3A 2B8GA 1CFMA 1VCIA 1ZYRC 1K8MA 2JEBI 1TU2B 3QIAA 1DD2A 3IKJA 4BA1I 4OO1H 2R6GA 1HQMC 1GUOA 4OGQC 1B9NA 1OXTA 1O78A 1IYVA 5BN4A 2D5DA 3U9SA 1H9KA 3EQLC 2BE5C 3A8KE 4KN4C 3VR5A 4DNRB 5JEAH 3M7NA 3MFYA 3GD7A 1VF7A 2D62A 2PCFB 1QJOA 2AWOA 4KI0A 4G7ZC 2DN8A 5K36G 3SDZA 3PV0A 3PUZA 2A69C 3VR2A 2QF7A 4KHZA 4JK1C 1GUGA 2NN6I 3T53B 1Z7TA 4G7HC 5KNDA 2DNCA 3T51B 4I7ZC 1FYCA 4KKTA 1IYUA 3A8IE 2EDGA 3L7ZC 1H9SB 1GUTA 3OPOA 1Y8OB 4G7OC 2BA0A 2KCCA 3I73A 2A6ED 2PNRC 2A6HC 2K7VA 2JXMB 3FMCA 3QJYA 4DK1A 1E2WA 2V4DA 3NE5B 1OXVA 1Q1BA 4BA2I 5KNBA 1IW7C 3A7LA 3HGBA 1G291 1OXXK 1Y8PB 1V8QA 4PV1C 3RLFA 2JEAI 4DK0A 3H94A 1I6VC 1H9RA 2A68C 5KNCA 1EWHA 3VR3A 1CI3M 3CRLC 3TZUA 1E2VA 3PUWA 1HCZA 1OXUA 2NN6G 2PPBC 2E74C 4KN7C 2Q8IB 3N6RA 1YNNC 2A69D 1GHJA 4DNTB 2K32A 2DNEA 3CRKC 2O5JC 2IT1A 3I4LA 1O7LA 2AUJD 4TQUS 1B9MA 4LJZC 3LWUA 2EJFC 1GUNA 4H13C 4OO1G 3QG1A 1PMRA 2D2CC 2EJMA 2YYZA 4IQZA 3D31A 1VDZA 4KKSA 3IFTA 4TKOB 4KKUA 4HR7B 5C0XG 1K8OA 1OXSC 3T56B 3ND9A 1SMYC 4JBWA 3MXUA 3VR6A 4IFDG 1A6XA 2E76C 1YNJC 3VR4A 1HTPA 2F1MA 3FPPA 2BA1A 2BE5D 5BN3A 3I72A 4XIGS 2A6EC 3OW7A 5K36H 3A8JE 1TKWB 2KA7A 4H44C 3LNNA 5BN5A 2NN6H 2LMCB 4L8JA 3KLRA 1V43A 1Q12A 1H9MA 1ONLA 1Q1EA 1Z6HA 2E75C 3PUYA 3PUXA 3W3AA 1LABA 3A7AB 1Y8NB 4H0LC 5A35A 1DCZA 1Y69U 1GHKA 2AUKA 1H9SA 3SE0A 4XTCS 3WDNA 2EJGC 1E2ZA 2CW0C 3GQBA 5JEAG 3BDOA 3P20A 3VA7A 2B8FA 3ND8A 3PUVA 2A6HD 3DXJC 4GZYC 1DXMA 2JE6I 3OOCA 5C0XH 1ZKOA 2EVBA 4IFDH 1GJXA 2BDOA 2L5TA 4RCNA 1CTMA 1Q90A 3M4YA 1T5EA 4KMUC 1VF5C 3D4RA 1LACA 4LK1C 3AB9A 1IW7D 1FR3A
chains in the Genus database with same CATH superfamily
5J39A 1S72A 4CDCC 1XJVA 1HNWQ 5CV4A 1BDOA 1EY5A 5ELOA 3QO2A 3AMUA 5ELCA 5CC4A 2ZTCA 4DUYL 2IPKD 4JPBW 1HFNA 1S3OA 1ENCA 3HOXG 1AH9A 4LUOA 4ZRZA 2WB1B 4WRDA 4OONA 2KCNA 5H1SE 3KBGA 1PRTF 2BH2A 5IYCG 3CCQA 3T1HQ 2QKIC 4Q0FA 3L9AX 4BY1B 4NB3A 3S2DH 1EOVA 1LTGD 2Z6KC 1Y8OB 4C2MH 3CW2C 3E9IA 1O80A 3K58A 2RDFA 2HCCA 5T1IA 3J80i 1UWVA 3UE1A 5KIXA 4DV2L 1LT5D 3MTSA 1LTSD 3GTOH 1VQCA 5J1ZA 4XQNA 5M3FH 2F0DA 5JEAJ 4GKJQ 1VQDA 1HCZA 4HJ9A 1SNCA 4IUPA 2RA4A 4LFCL 2ZJRA 1VQOA 2NB0A 3GTLB 2NVQB 3R93A 4C3IH 1EQTA 1JE4A 5JJZA 4JOIC 3RMHA 1EQVA 2Q2IA 1OXSC 5ELFA 1G2TA 5D65A 3MXUA 1I94Q 1SRUA 4K6DA 5LMNL 1I4QA 1Y1WH 3VR4A 4L5TA 3T1HL 3D0FA 2JA8B 4DFAA 1SBBB 3T4AC 3K5NA 5HGQA 4U673 2EYPA 4PMWA 2SNSA 1O7ZA 1HNXQ 2F0IA 4PZ6A 1X3FA 3ULLA 2OQKA 1GO3E 1HXYD 5A35A 3I4MB 3S14B 4MIUA 2JQOA 4A3BB 3K0YA 3R2TA 4PQXA 3ND8A 4BBSB 3SGIA 2MGSA 2BDOA 1F77A 3TP7A 5GAEC 5JPMC 2F3VA 3S1QB 4DKAC 4GKJL 3RZDH 1A3TA 1U0LA 1PH6A 1AE3A 1U4MA 1ASYA 2F0SA 2DUDA 3S1RB 2R7ZB 1ZYRC 5I4DA 1R9TB 3QIAA 2E2IB 4BXXH 2KECA 5E7NA 3HKZG 1YITA 4A3KB 3ZYYX 3S16B 3HOYG 2ZTDA 3HKZE 3KOJA 3PV0A 4QQBX 2QEXA 3K7AB 4AYBB 2J7ZA 1D8LA 1PA6A 1VQFA 5IGDA 3SEBA 1YIJA 4WJ3M 3A54A 2X6LA 4JBJA 3J80c 2E2JH 2I5MX 1B1ZA 1HHVA 4GLXA 4JCVE 4IFDI 1CKOA 3L2PA 2R92G 5HURA 4JI3Q 1N36L 3AEVA 4F8MA 1SXTA 3TP5A 1SYFA 3H94A 2ZM6L 1Z9FA 2K5DA 4GLAC 5CORA 2SEBD 3K6OA 1Q8KA 4KN7C 4K0KL 1EY0A 2DJFC 1YHBA 3RLOA 1JORA 4WFN3 1B9MA 2EJFC 1MSHA 1PH5A 2B2UA 3D31A 2K4KA 3T56B 2Q2UA 1EY6A 3VR6A 4DPGA 2K1BA 2IX1A 2JA7B 2L55A 3PGZA 4FF1A 4IPDA 1N32Q 4EQ5A 2HQEA 1OTCA 2BA1A 4XIGS 3K57A 3GTQH 2B39A 3J80E 3HKSA 2KHSA 4H44C 2NTTA 1KDCA 4L8JA 2KEEA 2PMZB 2L15A 5C44G 4KHPL 4A3MH 1SJED 3PMFA 4X3TA 4X65L 1H9SA 5A2QE 1Y69U 2A5HA 3CXCA 4DV5L 4GOPB 3CQZB 2JE6I 3OOCA 4F87A 1K73C 4B3SQ 2E8GA 1BBWA 4K5VA 2QA4A 2DY8A 1G6PA 4YWKA 1RTNA 1M8AA 1H9JA 4EX5A 3F2CA 1WVLA 4QMGA 4LFAL 2AMCB 3WOEA 4XXEA 2G5DA 3CP0A 3SK4A 5IP9H 1HQRD 4IO9A 3KDFA 2IX3A 2L9HA 3PO3B 4OO1H 2ES2A 3S1MB 2F0LA 2VQEQ 1A3UA 4XQJA 2KOLA 2DN8A 2LXKA 3GP7A 4JK1C 1IBKL 2NN6I 2PZUA 3OIPA 4KKTA 2EYMA 2B2VC 3X3MA 1E0BA 2FHTA 1PTOF 2YTYA 3I73A 3WOFA 1E1OA 1M1KC 3C2PA 2UUCL 1F2MA 1F9RA 3MXGA 1F9PA 1WCMH 3I7FA 4DK1A 3NUCA 2H1EA 3MEHA 4JI4Q 1JOQA 1V1PB 3Q6SA 1I5FA 1F2LA 2JA5H 3S1NB 1EUJA 5M5YH 4HIDA 3KJOA 1EY8A 3R8BA 1GHJA 3NEMA 3TRZA 2R93H 2L1BA 2YV5A 2A73B 5LMUQ 3HOVH 1CKNB 1Q3LA 1PH9A 3H3VI 5FJ8G 1HR0L 1VDZA 2X69A 1K8GA 2FMCA 3UI2A 3EVQA 5IYDG 2B2WC 2EYLA 1EFWA 2BE5D 1EY7A 1BCPC 2K5NA 1BR9A 3FKIB 5C4JB 1A2UA 3KLRA 3E3XA 4NXNQ 4JI0Q 5DM73 1NR4A 3H09A 4RGNA 2CQOA 3NSWA 2NVXB 3GTOB 5GAHC 5JEAG 3P20A 3VA7A 3H0GB 4LF9Q 2BDNA 2RHSB 1HNZQ 3M4YA 4KMUC 2SNMA 1L0XB 1FR3A 1ENAA 1ZXTA 4HIMA 1SYGA 1SNOA 4DAMA 2OXPA 5LMUL 2H4OA 2C5CA 2CKZB 2JEBI 3NK9A 4MZ9A 5IGBA 2VUMH 2F4VL 1XMOQ 1SROA 4DR7Q 4DUZL 3I4NG 1O78A 2P5ZX 3R2IA 4PMCA 3U58A 3GDEA 1XTDA 1D2BA 1XNRQ 3STBC 1VQ7A 4L5SA 3BJUA 2H5XA 4UHVA 1KLGD 4UY8C 1WYDA 4NXML 1VQJA 5FOBB 2DNCA 4JI6Q 1JQYD 5BR8Q 5IT9E 3KF8B 3S2HB 4NXNL 3CCSA 4JI0L 1J9OA 1UEBA 2K7VA 3GTPH 1XPUA 1NMGA 3FMCA 5C0XI 1SNMA 2NWGA 5M5WB 1V9PA 3HOXH 3A7LA 1V8QA 3RZDB 1ENFA 3MXNA 2ICEC 1UE5A 4DR5L 3I90A 3PF4A 3OWFA 2Z4HA 4GNXB 1WFQA 2K5VA 1K83B 4X3KA 1EWHA 5IYCH 2E5LQ 3TZUA 1MKHA 3NWTA 4HEDA 1U4LA 1GXDC 4LNQA 1HTLD 2UXCL 2BOSA 1PXUA 3BVZA 3I4LA 4P75A 4H13C 1YZ6A 4HCEA 2Z6KA 2N55A 3NPPA 4HR7B 2B2TC 4DXFA 1HA5A 2N78A 3GTMH 4EQPA 1Y1VB 1YNJC 2C35B 4FO2A 4DR6Q 1HTPA 1JJ2A 1MIUA 2F1MA 3CCLA 3IAYA 1N9WA 4X66Q 3DWQA 3OMGA 4XT3B 5BN3A 1JWMD 5AJ3Q 2UU9Q 1W6JA 5C3EB 4UP7A 1EEFD 4DAYA 1TS2A 1F2ZA 4ALPA 3HOZB 2IW3A 3W3AA 5E4XA 1UEAB 2CHBD 2PW5A 4QCLA 4F88A 1VQLA 1UAPA 2VY3A 4C1NI 3TN2A 2SDFA 4NMZA 1E24A 4RGTA 1U9RA 3J7ZC 4JOIA 4O1NA 4LF8L 2K50A 4JI7L 1JOOA 5IIFA 3K5OA 3BS1A 2FINB 1GUSA 1S5DD 3EA6A 2L11A 2K33A 2LSSA 3ZJYC 2NVTH 3PO2B 2A68D 4IUNA 4C3HB 1CFMA 3VA5A 4K2KA 4DR1L 3ITPA 3TSSA 3Q22A 4OGQC 3W1GA 2RF4A 3VR5A 1XPRA 3J80L 1EZ6A 1FNUA 2B3GA 1L1OC 1BXTA 1NAPA 3VR2A 1ESRA 1TS4A 1GM5A 4WJ4A 2XNAC 5A2QL 4A3MB 1CA5A 4QGUA 4QUCA 1VQ5A 3Q8DA 3HFZB 1Q81C 2O4XA 5EBCA 4AQYQ 1XTCD 4P71A 2XVSA 3NE5B 4POFA 1AE2A 1D5ZC 1II3A 1YI2A 2K52A 1S4ZA 3T16A 3HOYH 4N9TA 2EIFA 2WKDA 1K8AC 1XMQQ 5DNFA 4LW1A 3SK5A 3CMAA 3CRLC 4H02A 3J81i 2E74C 3ONAB 2VQFQ 4DNTB 4DV6L 2K5HA 2HCIA 1AFPA 4TQUS 3LWUA 3U4VA 5IOCA 1KRTA 4POGA 1QB5D 4Y52H 5C3WA 4A3FG 1D1KA 4JI5L 3HOWB 2V1CC 4A3DB 1BO0A 3T13A 1IBLL 5HGTA 3KLWA 2R92H 4CDEC 4TRDA 1PH7A 5JVG3 4NP5A 1WTHA 3LWEA 1K28A 4DA2A 3CPFA 1DM0B 2I46A 3TZDA 1TWCH 2Q2HA 1KNEA 3M3YB 1EYAA 1EU3A 3NBHA 3HOUG 2B63G 1LABA 2MQHA 4DUYQ 4JV5L 4J8QA 4XDXA 4A3GB 2OTJA 5ELEA 5EQ0A 3K7UC 2A6HD 2N49A 1BBXC 3CCVA 1SYEA 2ZTEA 4RGMA 3GTKH 5LL6X 2E2DC 4K8IA 1ILQA 1HJPA 3EN2A 1T5EA 4QIWB 2KBNA 3F2BA 1TWHH 3HOVB 1X6OA 3QWNA 2MPMA 2DY7A 1QUQA 2NBFA 1MHWC 4KLKA 4CDFC 3CPWA 2UXDQ 4X64L 3A56A 5C44H 4OEMB 1YNND 3DUZA 4Z9CB 1OXTA 2WFWA 1IYVA 4DV0L 4DGZA 4DV2Q 2WB1G 4ZK9B 3V05A 2OF1A 1UE7A 3TP8A 4O42A 2QGQA 5DEHA 1I4RA 4A93B 3T51B 1LM0A 2QDBA 1PRTB 1STEA 4P72A 4LFCQ 4G7OC 4Y7NH 1RKNA 2WAQB 5C4HA 5T1GA 2AWNA 4PZ8A 1L2FA 1BCPF 2WKCA 3EJIA 4OX9L 5M3MB 5KNBA 1TQOA 3UDXA 3N52A 3MZ5A 3KLSX 3PSIA 4RWSC 1L0WA 5LMNQ 1YBYA 2J0TD 4L5RC 2FJ2A 4PMBA 3J81c 2A8VA 3PUWA 4IJHA 1BVSA 1K3BC 4NKLA 2VUMB 1PH4A 1O7LA 2AUJD 3NTKA 1C7YA 5C4XB 2UXDL 2B2VA 2M00A 2D2CC 3S15H 2YYZA 4YY3L 4V190 3NTIA 1SSOA 4N8FA 1S5ED 2O2LD 4P2CB 1SMYC 1I3QH 5IT9L 1VQIA 4UP8A 1X32A 4FF3A 5JVH3 2JA8G 4DV3L 3OW7A 2CWPA 1WTOA 2LMCB 5IGCA 1V1OA 2F0WA 4TVAB 3I4MG 1LTRD 4XYOA 3NELA 5IE8A 4XTCS 2VB2X 3GTJH 4LF5L 1X56A 3A5ZB 1X55A 4A3BG 1M4VA 5FJ8H 5CGKA 3DXJC 3CHBD 4C3JB 3J81E 4KD3A 1TWAB 4P73A 1FJGL 3MC0B 4OXPA 5EAYA 2TSSA 5IYDH 4YHHQ 3D4RA 4BY7G 1A63A 1LTID 4F7XA 4R8IA 2B2WA 3DHQA 2B8GA 4R4OA 1CSQA 1U5KA 1HUMA 1A15A 2R7ZG 3VYRA 3F2UA 4BA1I 1PRTD 5C4ZA 2E2HH 4ZLTF 4DNRB 1A62A 5JEAH 2LY7A 5FO7B 4A3KG 3GD7A 5TSSA 2D62A 4G7ZC 1SFOH 1N36Q 3NQTA 3A55A 2ZM6Q 2RBMA 1Z7TA 1LLRD 4AYBG 5IODA 1H9SB 3L3OC 1RL2A 3G71A 4K0KQ 1G8ZD 2A6ED 1HR0W 1OO9B 3NP8A 4ZUIA 5EBDA 3HP3A 2RSNA 3C1FA 1NMFA 1E2WA 1WD0A 2PI2E 1L0YB 1OXVA 2R7FA 3P75A 3I4NH 5G3LF 1K0SA 5IWAL 4FF2A 3RNUA 1QZHA 2CW0D 2WINB 1KAWA 3HS0C 4YHHL 3CCJA 2MP1A 1PYSB 2F0TA 3KDFB 2KUMA 2YTXA 1D6EC 2IHEA 1CUKA 5KRUA 3OTOL 4R4IA 2LFNA 2NZ1D 4KTAA 1VQBA 1GUNA 4IUVA 4KHPQ 2EJMA 4HJ8A 4ZKBB 4X6AH 4X65Q 3M4PA 3JAME 2VZAA 4DV5Q 1PFSA 2PW7A 4DF7A 2E76C 2JA7G 4R9WA 4DAVA 1W3SA 4FNFA 3T1YL 2F3IA 3A0JA 4QY7A 1DOMA 3MVVA 5K36H 5ISRA 2D0OA 1EWCA 2QDLA 1TY2A 4H0LC 4LFAQ 1QOHA 1EQRA 4R4QA 1IL2A 1B53A 3NQIA 2OTLA 3CU7A 3HKZB 1SN8A 2MUYA 1RTOA 4OWXB 4RKLA 3PUVA 3RZOH 5EJWA 1ZKOA 2KCTA 2B2TA 2YU9H 4ME3A 4RCNA 2ZXOA 1EZ8A 1LACA 2F0HA 1PH3A 1IW7D 1VQ6A 4DV1L 1IBKQ 3D8GA 1YJWA 1D1IA 2KQ3A 1MBYA 4ME5A 2HDMA 4YWMA 4LMQD 4IOAA 2EYJA 3E9HA 1K9MC 1LUZA 2UUCQ 1WTWA 2XTIA 3PO3G 4ZCKA 1PYBA 4J6HA 2GN5A 5EPLA 4OWTB 4TSSA 1QJOA 1JICA 1TWFB 1VMCA 2F0QA 4JG2A 4A3EB 2AQ1B 4JYAL 1RD9D 1GUGA 3E6ZX 3P1HA 5FLMG 1CZWA 3TDQA 3D3RA 1HZ9A 2LXJA 3G7LA 5DLQE 1FD7D 4L5QA 1VQKA 4X3SA 3M4OB 2EXZA 1S40A 1HR0Q 1PTOB 1JR0D 1VQ9A 4B3ML 1QE6A 4HSPA 3C1EA 3OSOA 2BCOA 3BYYB 4DR3L 1L1OA 2MJ8A 1TWGB 2UUBL 3N6RA 1I50B 2M9VA 4A3JG 1VQ4A 5LHY1 4OO1I 3URYA 1CM9A 3DEOA 4A3IB 3BVMA 3B6YA 3I56A 1X3QA 2JK8A 4QB4A 4TKOB 3MA2B 2PI2A 2ICIA 1QILA 4MTKA 5ELBA 3K5MA 5C6AA 4A3CG 1P16A 4DR4Q 1RF2D 4K14A 5CV9A 1EIFA 1I4GA 3FKIG 1O7YA 4AIMA 2N88A 4IURA 2QILA 3AU7A 1NY4A 1AP0A 1MD2D 3MXNB 2F4VQ 4DUZQ 4A3FH 4YIJA 3U9OA 3OYYA 4OELB 3KLSA 3H0GG 4ULLA 4PZ7A 2NYZD 3S2DB 1I6HH 5IYBH 3W5OA 3NHHA 4NXMQ 4C2MB 1B3QA 1EYGA 4LF7L 1YHAA 3R3OA 2K6AA 4G57A 3U4ZA 5CV8A 1G6ZA 3HOUH 1TU2B 1AZPA 5IT9c 2B63H 2ID0A 2F0VA 3TS2A 4IOCA 2VXWA 2PZWA 2D5DA 5ELNA 1JCKB 5M3FB 4DV7L 4HSVA 3C46A 2AWOA 3MFGA 3EROA 5CV5A 4JI1L 4DAYB 4DR5Q 4KHZA 2EE1A 4DR4L 1JT8A 1PTOD 5C0XJ 1F9QA 5IGEA 1R4PB 3K80C 1E3PA 3OPOA 1TS5A 4A76A 1LT4D 4C3IB 4RGOS 3GTJB 2UXCQ 1KAAA 1KL9A 2PZTA 2GA4B 3PCOB 3J81L 2VW9A 4H7BA 1CHPD 3FHWA 4RCOA 1Y1WB 1SNQA 1CK1A 2MO0A 3I70A 1EYCA 1DYQA 3TMEA 1A2TA 4DN4M 2NVYH 1WTQA 1XPOA 3DLLA 1ET6A 2ASBA 1B8AA 5KNCA 1F9SA 1UUPA 2GVAA 2ZXPA 2PPBC 1W2BA 3FEWX 1IL8A 2O5JC 4DK6C 2RCFA 4LF6L 3UDFA 3FVQA 2JA9A 2IHFA 1MGSA 1ICWA 4KJNA 4IFDG 1WD1A 2CWAA 5DAUA 1XYIA 4DNIA 1Y1VG 2F0OA 4LF8Q 3AFPA 3M9BA 2FMMA 3E5SA 1VS0A 1S5BD 1DOLA 3W2DA 2KJXA 3NBIA 4JI7Q 3S24A 3A8JE 2WACA 4EVOA 5C3EG 3SVMA 2L12A 1GD7A 1SEBD 1F2YA 1Q12A 3QOLA 3HOZG 2EQSA 1VQGA 4KJOA 4RAUC 2F0JA 2K28A 5E4WC 3GTLH 1BBUA 4DR1Q 4C56C 2KHIA 1BNZA 1GKHA 4RHSA 5I9OA 1STGA 2XRQD 1QNKA 1CTMA 1Q90A 1JMCA 1KXLA 2K5WA 3DMUA 3CD6A 2ZJPA 3BDCA 1M90C 1EY4A 3JAML 2E2JB 2JJQA 1HZBA 3PO2G 4C3HG 1N8RC 3CCEA 2J4XA 2MFIA 4RKBA 3G48A 1TT2A 5FO8B 1GUOA 3I4MH 1PVOA 1H9KA 3EQLC 4FXKC 1CZGA 4A3BH 1QWYA 3IL8A 4IALA 4OIKA 1JWSD 1CA6A 2RHQB 3L0OA 1J5EL 1YEZA 1PH8A 1Q8IA 3NBHB 3T53B 5KNDA 3CC2A 5GADC 4LUZA 3S1QH 4BY7H 3A74A 4A3MG 3UDIA 3BU2A 4BBRG 4E6IA 4DV6Q 5D3IB 2JYOA 2WIIB 2IWHA 1XWEA 3S1RH 2R7ZH 4RG1A 1SE2A 1HZAA 4O0AA 1R9TH 2YU9B 4JI5Q 1KRSA 3FPUB 4ILWA 2E2IH 4BA2I 2VS1A 2EYOA 1IBLQ 2Z1CA 4A3KH 4FP5D 3GTQB 2Y0SB 1QUQB 1QNUA 3H6MA 1Z47A 2NN6G 4C1NK 3K7AH 1EY9A 1UE1A 2IX0A 3CRKC 2R3ZA 1XNQL 4JI8L 2QEJC 2MO1A 4NW2A 4I65A 3PF5A 3KF6A 3HOWG 2JA6G 1YHQA 4JV5Q 1ZYRD 4GN4B 4FYDA 4A3DG 1HA6A 4DAPA 4MHEA 1WI5A 1N33L 3W1BA 3P7JA 1TS3A 1LV9A 5J3BA 1B70B 3EIVA 1IXRA 3RUZA 2WV6D 2RQXA 2CCZA 3NWSA 5CYUA 4L63B 4A3LG 3SXHA 2F0EA 1BQQT 3I8ZA 3QOJA 4IUUA 3CKIB 3SE0A 5IGFA 1IBML 4X64Q 1C8CA 4GZYC 4A3GG 1KHIA 4DV0Q 4DK3C 2XIWA 3SR1A 5I2YA 1NJIC 2L5TA 1DGSA 2JA7H 1VQAA 2SOBA 4ID6A 2I07B 4J15A 1KDBA 3OW2A 1BOSA 2B2YC 4KY5A 5JAVA 3HOVG 1EWIA 3CCMA 5KYIA 1LTLA 4B3RL 1PDQA 2HHHL 1WCMB 1NR2A 1K3RA 1K8MA 4HJAA 4HAEA 4ZQ3A 4Q5VA 1SMXA 2C9OA 3CCRA 2GVBA 1B9NA 1QVCA 2XSCA 5BN4A 4GOPC 2BE5C 4OX9Q 3HEJA 1U4RA 2KENA 3CQZH 1NBWA 2JA5B 5M5YB 2QF7A 1SE3A 2R93B 4GKKQ 2L4NA 4I7ZC 4A93G 1A0IA 5C5MA 1IYUA 4YCVA 1G2SA 4QL5A 1W6KA 3OWEB 3PIO3 1KC8C 1A3VA 2N8NA 4X62L 2WAQG 5EKKA 4KK7A 2JXMB 4DV4L 2UUAL 1MSGA 3VYTA 4B3TL 4DXGA 4YY3Q 4IN3A 2Z0SA 5M3MG 1YJNA 3PO3H 2F0NA 2RSOA 5JJKA 3RR5A 3S1MH 1I6HB 3CAMA 3VDYA 1E22A 1QCBD 4DK0A 1ICFB 3MXPA 2Z6BA 2RVLA 1BCPB 1UE6A 2WB1E 4IUTA 3JAMi 1BKBA 3NXWA 4DV3Q 4J1MA 2Q8IB 3G6JB 3KBXA 4BY1G 1VQMA 2DNEA 1E7ZA 3MHBA 3CC7A 2Q2TA 2F0MA 3J7AV 5C4XG 3RLNA 4EGVA 2EXDA 4KY6A 4KKSA 4QJFA 1UNSA 3J7A5 5C0XG 3BZCA 4YCWA 4LF5Q 1K8OA 4ZKCB 2XN9C 1JWUD 1SYBA 4M1UB 1FJGQ 2VNUD 1EU4A 1U4PA 3KJPA 2K05A 3I72A 4XYQA 2I0QA 4GKKL 4CJ1B 1JE5A 2EZVA 5BN5A 3S1NH 1KQSA 4IZ8A 2ENBA 1EFID 1Q86C 1JOKA 1H9MA 4A3JH 3PUXA 1QG7A 4FVMA 3LX0A 2NVYB 4R4TA 4O2DA 5JJIA 4C3JG 2EY2A 5GAGC 3J7YW 2XRSD 5KGUA 2JP1A 1LTBD 1IKLA 4ZAIA 1HH2P 1G51A 3MAQA 1MI2A 3AB9A 1AN8A 4A3CH 3AQQA 2PO4A 5FLXE 1XXGA 3M85A 3GTPB 4RA8A 3S17H 1DJRD 1SJHD 4B08A 1PLFA 4I7AA 3FKIH 4HJ7A 5C4JH 2CQAA 1MJCA 3IKJA 5AFWA 4N9PA 3DM1A 3HOXB 3BYTB 4GLVB 1SDFA 2NVXH 2D0PA 2R7DA 3ULPA 1CHQD 3A8KE 4LAAA 1EQQA 5F2DA 3PIOA 4BBSG 2XGTA 4JW0A 5IP7G 5IWAQ 1N34L 3H0GH 2A69C 4CKBA 2HUGA 1ZEQX 1HNWL 2EPBA 1WTVA 1FYCA 1B4OA 3HZXA 4ZYSA 2AQ2B 1GUTA 4XQQA 1ESFA 2EY5A 3M7GA 2KCCA 1B3AA 3OTOQ 1BCPD 1WTPA 1GUWA 5FKAC 3IFDA 3GTMB 5M5XH 2V4DA 2XWJB 3SK6A 1OXXK 2PQAA 3IRBA 2PNHA 2EY1A 3JAMc 2A68C 5D3DA 3QB3A 4L6TB 2OWOA 3T1YQ 1CI3M 4HN7A 2KCMA 4RMFA 4K8JA 4IFDJ 2K04A 4HMJA 2I5LX 3J7AF 1KLUD 4AYBE 1I4HA 1KDAA 2A19A 3S2HH 5CMDA 1CKMA 1QVFA 1TVXA 2HT1A 4IQZA 2YTVA 3F1ZA 4KKUA 1VQ8A 5KYLA 1PFNA 1KTKA 2NZOA 5M5WH 1SYDA 1LTTD 1FGUA 4BY7B 5JJLA 4GNXC 2NVTB 4A75A 3STBD 4JVZA 2KA7A 2PYKA 4DV1Q 3TQYA 4R8NA 1K83H 2WP8J 3ER0A 2TMPA 3D6CA 1Q1EA 5FO9B 3A7AB 2EJGC 1SNPA 1K0RA 1VQHA 2FFKB 1I94L 4R4CA 1X3PA 4WORA 3GO5A 1PHJA 1L1OB 2EVBA 4OIJA 4IFDH 1WJJA 1Y1VH 1AZQA 2BH8A 2M2LA 4JYAQ 3V96A 4JC0A 4IUQA 1S5FD 1HNXL 1JJGA 3BG3A 3JC66 5C3EH 1A8VA 2K03A 3HOZH 1JB7A 1IZ6A 1Q7YC 1PH1A 2PMZE 1J6QA 3U9SA 4YWLA 3HOYB 1CT1D 1HUNA 5C5LA 2K5QA 4B3MQ 2EOTA 3SDZA 4A3EG 3PUZA 1AW7A 4DR3Q 1YNJD 1R4QB 3KUPA 2UUBQ 3L7ZC 2EDGA 4R1JA 3UDGA 1IKMA 2A6HC 4OHJA 3PO2H 4C3HH 4UDUC 4X3UA 5G3LD 1IYJB 1TY0A 1SNDA 2R92B 5ELDA 2RKSA 3I4OA 4CGYB 4CJ0B 1PFBA 2NZHA 3HGBA 1G291 4PV1C 1Y8PB 5GROA 3RLFA 1X54A 4P74A 1DOKA 2B29A 1H9RA 2CFMA 4MN3A 3TP6A 1TWCB 2OCEA 5CBEE 5E3FA 1YNNC 3KYHC 1EIGA 1C0AA 4FXDA 2IT1A 4KY7A 5K5PA 4A3IG 4BBRH 4NPSA 3KFUA 1VMPA 3IFTA 3H15A 2EYHA 1STHA 5I9PA 3K5LA 4JI3L 3GTKB 3ND9A 2I5HA 2AQ3B 1ILPA 3MWYW 1D5MC 1I4XA 1KABA 2K14A 2KVMA 1PH2A 1TWHB 3GTGH 1SLJA 3FPPA 1VQEA 3CF5A 2R61A 1E1TA 3FRPB 4U68A 4IPHA 2NN6H 5EGTA 1X9NA 1V43A 5C44B 4ZUJA 4LF7Q 5DM63 1EEID 1Z6HA 1HRJA 1SYCA 2AUKA 4FDBA 1BF4A 3PIP3 4K5WA 1TR5A 3GQBA 4HIOA 3K59A 4EQOA 1LTAD 4IPGA 5CV7A 3HOWH 2JA6H 2OQ0A 3CCUA 2VL6A 5D14A 4A3DH 1N32L 3H91A 4DV7Q 4LFBQ 1IHZA 1KNAA 3X3NA 1VF5C 4JI1Q 1HFGA 4AH6A 1FL0A 1EOTA 4GN3B 4Y7NB 2D9UA 5HY6A 2IL8A 2A74C 1EIHA 4A3LH 3M3YH 1Y14B 5IY0A 3H3VC 1LT6D 2F0KA 2R6GA 3NENA 4IPCA 4K5XA 4UAIA 2K01A 1EL0A 3D4WA 3H3VH 4B3SL 4CJ2C 4KN4C 3RD4A 1XX8A 3MFYA 1NUCA 1EIYB 4A3GH 5M3FG 4UPAA 2KEDA 3BZKA 3HRZC 4A4IA 5I2XA 4OWWB 1FGBD 1DONA 3G6EA 4G7HC 4A3JB 1O7IA 2Q8TA 3S9WA 2F0PA 1I4PA 2ALYB 4KD4A 4C3IG 3S15B 2B2YA 3BDLA 4RHRA 1H95A 2MNAA 1I3QB 4LF6Q 3TEHB 2VQEL 1J8IA 1Q82C 1Y1WG 5LL6S 1G91A 1JJCB 1Q46A 2JEAI 2ATWA 4B9XA 5FLXL 4LFBL 4GOPA 1I6VC 1ET9A 3V2TA 3S17B 1JB3A 3HG9A 5E1FA 1WTXA 2N3SA 3GV3A 3NTHA 1RHPA 4A93H 1CQFA 1PRTC 4LJZC 4WJWA 1SR3A 4K6LA 1TXYA 4JI4L 2UXBQ 3I91A 3FP9A 3WWVA 4FF4A 1A6XA 5JPNC 3AYHB 3DWPA 4G4KA 5M3MH 3ERSX 3F2DA 3VYSA 5EKLA 1B7YB 1RDPD 2VB3X 1X65A 3O13A 3PIPA 2A6EC 2X6GA 3DEPA 1X3EA 4M8AA 3I55A 1YVCA 1AEXA 4CKEA 4BY1H 5M5XB 1GOZA 1NTGA 4BXXG 2E2HB 1Y8NB 3Q0AA 1PV4A 2CW0C 5C4XH 4ABNA 2B8FA 1SFOB 5C0XH 3EBEA 4UP9A 4EQNA 1KD1C 1J5EQ 1RIPA 4FXGC 4HCSA 2A1AA 1V1PA 3BZDB 1HPCA 3D4DA 4HIKA 2O5IC 3KF6B 3TBIB 1PZID 1VCIA 3C3LA 1LYLA 2K75A 2OEOA 3I4NB 4K2LA 1HQMC 5IGGA 1QZGA 2NVQH 2Q8RE 2UXBL 2QCPX 1RODA 1CKNA 1SE8A 4CDDC 3RN5A 3M7NA 4LF9L 1VF7A 1HNZL 1CSPA 2EY6A 4C3JH 5K36G 2G9DA 1TWAH 1RCVD 1SMYD 2F52A 2F3WA 2IY5B 1WTRA 5EPJA 2JA8H 3Q24A 3VYUA 4GS3A 5GQOA 2BA0A 2B2UC 1XNQQ 5COYA 4JI8Q 4LWCA 1XMOL 5FK9C 4DR7L 1ML0D 2HIXA 2ZXRA 3S14H 2F4IA 3KK7A 1XNRL 5CV6A 3M4QA 1Q1BA 1IW7C 1PZKD 2CVRA 3OMCA 4LUVA 1RJTA 3K8AA 5EPKA 1P8LA 3BVGA 1N33Q 4BBSH 5IP7H 4PNYA 3CC4A 4JI6L 1MJEA 3VR3A 5BR8L 2Y0SG 4N8X1 3K81C 4CHTB 1OXUA 3ICEA 2A69D 1S5CD 2K32A 3A5UA 2Y0SE 2Z9HA 3D6WA 4ODGA 4JI2Q 3QG1A 3RZOB 2MHVA 1FNVA 1IBMQ 1NCVA 4JBMA 2RDHA 1ASZA 1LT3D 3AFQA 4GN5A 4PG3A 2G9HD 2E5LL 3S16H 2HIVA 5EKIA 1DZ1A 1V1QA 2DJGC 1B2TA 1KIXA 1STNA 5IP9G 5L37A 1ONLA 2E75C 4B3RQ 4OO1G 1NSNS 3KF8A 2HHHQ 3MEFA 1C9OA 1D5XC 2RDGA 2AKWB 3I3CA 3WDNA 4BWGB 4NDXA 2F0GA 2CH4W 3BDOA 1SE4A 3SHLA 4DR6L 2ZJQA 1DXMA 3E0JA 2FXQA 5I6YA 4V0BA 4X66L 4DR2Q 1GJXA 2RCNA 4B9WA 3I2ZA 4APVA 4MNOA 5AJ3L 2UU9L 4IJLA 1TIID 4YCUA 2ZT9C 1NE3A 4BBRB 3SK8A 4GNXA 1FNWA 5C3XA 1C48A 4RH6A 4RFBA 1YJ9A 4LF4Q 1D7QA 1WCMG 4JI2L 3E0EA 1DD2A 4X62Q 4S3SA 1JC7A 5LMNW 4CKCA 2Z4IA 4DV4Q 2UUAQ 1T9HA 2LKVA 4B3TQ 3GTGB 1PZJD 4DU9A 1VQNA 4KV6A 1PYWD 2PCFB 2AHOB 2QW7A 4KI0A 2JA5G 4XT1B 2XWBB 2Z8LA 1WOCA 1FVIA 5NUCA 1STAA 2R93G 2CH4A 1B44D 2DGYA 3A8IE 3OHXC 1BUVT 5CR3A 3G4SA 2JN4A 4QIWE 5I6WA 2PNRC 4HTHA 3TREA 5CBAE 5JOBA 1CQVA 2JA6B 3QJYA 3DWAA 4HMIA 3GV6A 3TS0A 1VQPA 2NTSA 3FDTA 1X3GA 4DR2L 2EYFA 2LS01 5IYBG 2OT2A 2HQLA 2JSOA 3ULJA 1TWFH 2F0UA 4A3EH 1E2VA 3LGJA 3RN2A 3F8TA 4HJ5A 1EYDA 3QR8A 4BS9A 3DM3A 4LF4L 5J22A 4AQYL 1PFMA 1PMRA 1HZCA 4A3FB 1GVPA 1YNXA 3K0XA 4JBWA 2IJ0A 2WAQE 1PTOC 3ERQA 1LO5D 3M4OH 2L0CA 3Q23A 1XMQL 1PTOH 2HDLA 2KHJA 2F03A 1B50A 1C4QA 2VQFL 1SAPA 1STYA 3UE0A 2NUCA 1TKWB 3LNNA 1TWGH 3HOUB 2F0FA 5FLMH 2VUMG 2B63B 3CMEA 3PUYA 1I50H 3OIQA 4JBKA 1GHKA 1DCZA 2PQEA 4QF4A 4QUFA 2PQAB 4CBVA 1E2ZA 4A3IH 5FLXc 1QVGA 3PQIA 1T5XD 5KEEA 5M9OA 4MTNA 4OL7A 3EFXD 4KHVA 1STBA 3J81j 1N34Q 1NNXA 2HD3A 4LK1C 3U50C
chains in the Genus database with same CATH topology
5J39A 5CV4A 1BDOA 1EY5A 3AMUA 3QO2A 5ELCA 5CC4A 2IPKD 1HFNA 1ENCA 4ZRZA 2WB1B 4WRDA 2KCNA 3KBGA 1PRTF 2QKIC 4Q0FA 3L9AX 4BY1B 1LTGD 1Y8OB 1O80A 3K58A 2RDFA 2HCCA 5T1IA 5KIXA 1LT5D 3MTSA 1LTSD 5J1ZA 4XQNA 2F0DA 5JEAJ 1HCZA 1SNCA 4IUPA 2RA4A 2NB0A 3GTLB 2NVQB 3R93A 1EQTA 1JE4A 5JJZA 3RMHA 1EQVA 1OXSC 5ELFA 1G2TA 5D65A 3MXUA 4K6DA 1I4QA 3VR4A 2JA8B 4DFAA 1SBBB 3T4AC 3K5NA 4U673 2EYPA 4PMWA 2SNSA 1O7ZA 2F0IA 1HXYD 5A35A 3I4MB 3S14B 4MIUA 4A3BB 3K0YA 3R2TA 4PQXA 3ND8A 4BBSB 2MGSA 2BDOA 1F77A 3TP7A 5JPMC 2F3VA 3S1QB 1A3TA 1U4MA 2F0SA 3S1RB 2R7ZB 1ZYRC 5I4DA 1R9TB 3QIAA 2E2IB 2KECA 4A3KB 3ZYYX 3S16B 3PV0A 3K7AB 4AYBB 2J7ZA 5IGDA 3SEBA 3A54A 2X6LA 1B1ZA 1HHVA 4IFDI 5HURA 4F8MA 1SXTA 3TP5A 1SYFA 3H94A 2K5DA 5CORA 2SEBD 3K6OA 4KN7C 1EY0A 1JORA 4WFN3 1B9MA 2EJFC 1MSHA 2B2UA 3D31A 3T56B 1EY6A 3VR6A 2K1BA 2IX1A 2JA7B 2L55A 4FF1A 2HQEA 2BA1A 4XIGS 3K57A 2B39A 3J80E 2KHSA 4H44C 2NTTA 1KDCA 4L8JA 2KEEA 2PMZB 1SJED 3PMFA 4X3TA 1Y69U 1H9SA 5A2QE 2A5HA 3CQZB 2JE6I 3OOCA 4F87A 4K5VA 2DY8A 1RTNA 1M8AA 1H9JA 1WVLA 4QMGA 3WOEA 4XXEA 3SK4A 1HQRD 2IX3A 2L9HA 3PO3B 4OO1H 3S1MB 2F0LA 1A3UA 4XQJA 2KOLA 2DN8A 3GP7A 4JK1C 2NN6I 2PZUA 3OIPA 4KKTA 2EYMA 2B2VC 3X3MA 1E0BA 2FHTA 1PTOF 3I73A 3WOFA 3C2PA 1F2MA 1F9RA 3MXGA 1F9PA 4DK1A 3NUCA 2H1EA 3MEHA 1JOQA 1V1PB 3Q6SA 1F2LA 3S1NB 1EY8A 3R8BA 1GHJA 2L1BA 2A73B 1Q3LA 1VDZA 2X69A 2FMCA 3UI2A 3EVQA 2B2WC 2EYLA 2BE5D 1EY7A 1BCPC 1BR9A 3FKIB 5C4JB 1A2UA 3KLRA 5DM73 1NR4A 3H09A 4RGNA 3NSWA 2NVXB 3GTOB 5JEAG 3P20A 3VA7A 3H0GB 2BDNA 3M4YA 4KMUC 2SNMA 1L0XB 1FR3A 1ENAA 1ZXTA 1SYGA 1SNOA 2OXPA 2H4OA 2C5CA 2JEBI 3NK9A 5IGBA 1O78A 3R2IA 4PMCA 1D2BA 1KLGD 5FOBB 2DNCA 1JQYD 5IT9E 3S2HB 1J9OA 2K7VA 3FMCA 5C0XI 1SNMA 2NWGA 5M5WB 3A7LA 1V8QA 3RZDB 1ENFA 3MXNA 2ICEC 3I90A 3OWFA 2Z4HA 1K83B 4X3KA 1EWHA 3TZUA 4HEDA 3NWTA 1U4LA 1GXDC 1HTLD 2BOSA 1PXUA 3BVZA 3I4LA 4H13C 4HCEA 2N55A 3NPPA 4HR7B 2B2TC 4DXFA 1HA5A 4EQPA 1Y1VB 1YNJC 4FO2A 1HTPA 2F1MA 3IAYA 3DWQA 3OMGA 4XT3B 5BN3A 1JWMD 1W6JA 5C3EB 1EEFD 4DAYA 1TS2A 1F2ZA 3HOZB 2IW3A 3W3AA 5E4XA 1UEAB 2CHBD 2PW5A 4QCLA 4F88A 1UAPA 4C1NI 3TN2A 2SDFA 4NMZA 4RGTA 1U9RA 4O1NA 1JOOA 5IIFA 3K5OA 3BS1A 2FINB 1GUSA 1S5DD 3EA6A 2L11A 2K33A 3PO2B 2A68D 4IUNA 4C3HB 1CFMA 3VA5A 4K2KA 3ITPA 3TSSA 3Q22A 4OGQC 3VR5A 3J80L 1EZ6A 1FNUA 1BXTA 1NAPA 3VR2A 1ESRA 1TS4A 2XNAC 5A2QL 4A3MB 1CA5A 4QUCA 2O4XA 5EBCA 1XTCD 2XVSA 3NE5B 1D5ZC 1II3A 1S4ZA 3T16A 4N9TA 2WKDA 5DNFA 3SK5A 3CRLC 2E74C 3ONAB 4DNTB 2HCIA 1AFPA 4TQUS 3LWUA 5IOCA 1QB5D 5C3WA 1D1KA 3HOWB 4A3DB 1BO0A 3T13A 5HGTA 4TRDA 5JVG3 4NP5A 3LWEA 4DA2A 1DM0B 2I46A 3TZDA 1KNEA 3M3YB 1EYAA 1EU3A 3NBHA 1LABA 4J8QA 4XDXA 4A3GB 5ELEA 5EQ0A 2A6HD 1BBXC 1SYEA 4RGMA 5LL6X 2E2DC 4K8IA 1ILQA 1T5EA 4QIWB 3HOVB 3QWNA 2MPMA 2DY7A 2NBFA 3A56A 1YNND 3DUZA 4Z9CB 1OXTA 1IYVA 4DGZA 4ZK9B 3V05A 2OF1A 3TP8A 4O42A 5DEHA 1I4RA 4A93B 3T51B 2QDBA 1PRTB 1STEA 4G7OC 1RKNA 2WAQB 5C4HA 5T1GA 2AWNA 2WKCA 1BCPF 3EJIA 5M3MB 5KNBA 1TQOA 3N52A 3MZ5A 3KLSX 4RWSC 2J0TD 2FJ2A 4PMBA 3PUWA 4NKLA 2VUMB 1O7LA 2AUJD 3NTKA 5C4XB 2B2VA 2M00A 2D2CC 2YYZA 4V190 3NTIA 1SSOA 1S5ED 2O2LD 4P2CB 1SMYC 5IT9L 1X32A 4FF3A 5JVH3 3OW7A 1WTOA 2LMCB 5IGCA 1V1OA 2F0WA 1LTRD 4XYOA 4XTCS 2VB2X 1M4VA 5CGKA 3DXJC 3CHBD 4C3JB 3J81E 4KD3A 1TWAB 3MC0B 2TSSA 3D4RA 1LTID 4F7XA 4R8IA 2B2WA 3DHQA 2B8GA 1HUMA 1A15A 3VYRA 3F2UA 4BA1I 1PRTD 5C4ZA 4ZLTF 4DNRB 5JEAH 2LY7A 5FO7B 3GD7A 5TSSA 2D62A 4G7ZC 3NQTA 3A55A 2RBMA 1Z7TA 1LLRD 5IODA 1H9SB 3L3OC 1G8ZD 2A6ED 4ZUIA 1OO9B 3NP8A 5EBDA 3HP3A 2RSNA 3C1FA 1E2WA 1WD0A 1L0YB 1OXVA 3P75A 5G3LF 4FF2A 2CW0D 2WINB 3HS0C 2MP1A 2F0TA 2KUMA 1D6EC 5KRUA 2LFNA 2NZ1D 4KTAA 1GUNA 4IUVA 2EJMA 4ZKBB 3JAME 2PW7A 4DF7A 2E76C 4R9WA 4DAVA 4FNFA 1DOMA 3MVVA 5K36H 5ISRA 1EWCA 1TY2A 4H0LC 1QOHA 1B53A 3NQIA 3CU7A 3HKZB 2MUYA 1RTOA 4RKLA 3PUVA 5EJWA 1ZKOA 2B2TA 4RCNA 2ZXOA 1EZ8A 1LACA 2F0HA 1IW7D 3D8GA 1D1IA 2KQ3A 1MBYA 4ME5A 2HDMA 4LMQD 2EYJA 1WTWA 4J6HA 5EPLA 4TSSA 1QJOA 1JICA 1TWFB 1VMCA 2F0QA 4A3EB 2AQ1B 1RD9D 1GUGA 3E6ZX 3P1HA 1CZWA 3TDQA 3D3RA 3G7LA 1FD7D 4X3SA 3M4OB 2EXZA 1PTOB 1JR0D 1QE6A 4HSPA 3C1EA 3OSOA 2BCOA 3BYYB 2MJ8A 1TWGB 3N6RA 1I50B 2M9VA 5LHY1 4OO1I 3URYA 1CM9A 3DEOA 4A3IB 3BVMA 1X3QA 4QB4A 4TKOB 3MA2B 2ICIA 1QILA 5ELBA 3K5MA 5C6AA 1RF2D 4K14A 5CV9A 1I4GA 1O7YA 2N88A 4IURA 2QILA 3AU7A 1AP0A 1MD2D 4YIJA 3U9OA 3KLSA 4ULLA 2NYZD 3S2DB 3NHHA 4C2MB 3R3OA 2K6AA 4G57A 5CV8A 1G6ZA 1TU2B 1AZPA 2ID0A 2F0VA 2VXWA 2PZWA 2D5DA 1JCKB 5M3FB 4HSVA 3C46A 2AWOA 3MFGA 3EROA 5CV5A 4KHZA 2EE1A 1PTOD 5C0XJ 1F9QA 5IGEA 1R4PB 3OPOA 1TS5A 1LT4D 4C3IB 4RGOS 3GTJB 1KAAA 2PZTA 2GA4B 3J81L 4H7BA 1CHPD 4RCOA 1Y1WB 1SNQA 1CK1A 3I70A 1EYCA 1DYQA 3TMEA 1A2TA 4DN4M 1WTQA 1ET6A 5KNCA 1F9SA 1UUPA 2ZXPA 2PPBC 3FEWX 1IL8A 2O5JC 3FVQA 1MGSA 1ICWA 4KJNA 4IFDG 1WD1A 5DAUA 1XYIA 2F0OA 2FMMA 3E5SA 1S5BD 1DOLA 3W2DA 2KJXA 3NBIA 3A8JE 2WACA 4EVOA 3SVMA 2L12A 1SEBD 1F2YA 1Q12A 3QOLA 4KJOA 4RAUC 2F0JA 2K28A 5E4WC 4C56C 1BNZA 4RHSA 5I9OA 1STGA 2XRQD 1QNKA 1CTMA 1Q90A 2K5WA 3DMUA 3BDCA 1EY4A 3JAML 2E2JB 4C3HG 2J4XA 4RKBA 1TT2A 5FO8B 1GUOA 1H9KA 3EQLC 4FXKC 1CZGA 1QWYA 3IL8A 4IALA 4OIKA 1JWSD 1CA6A 1Q8IA 3T53B 5KNDA 4E6IA 5D3IB 2JYOA 2WIIB 2IWHA 1XWEA 1SE2A 2YU9B 3FPUB 4ILWA 4BA2I 2EYOA 2Z1CA 4FP5D 3GTQB 2Y0SB 1QNUA 3H6MA 1Z47A 2NN6G 4C1NK 1EY9A 2IX0A 3CRKC 2R3ZA 2QEJC 4NW2A 4I65A 1ZYRD 4FYDA 1HA6A 4DAPA 4MHEA 3P7JA 1TS3A 1LV9A 3RUZA 2WV6D 2RQXA 3NWSA 5CYUA 4L63B 3SXHA 2F0EA 1BQQT 3I8ZA 3QOJA 4IUUA 3CKIB 3SE0A 5IGFA 1C8CA 4GZYC 2XIWA 3SR1A 5I2YA 2L5TA 2SOBA 4ID6A 2I07B 1KDBA 1BOSA 2B2YC 4KY5A 5JAVA 5KYIA 1PDQA 1WCMB 1NR2A 1K8MA 4HAEA 4ZQ3A 4Q5VA 2C9OA 1B9NA 2XSCA 5BN4A 2BE5C 3HEJA 1U4RA 2JA5B 5M5YB 2QF7A 1SE3A 2R93B 2L4NA 4I7ZC 5C5MA 1IYUA 1G2SA 1W6KA 3OWEB 3PIO3 1A3VA 5EKKA 4KK7A 2JXMB 1MSGA 3VYTA 4DXGA 4IN3A 2F0NA 2RSOA 1I6HB 1QCBD 4DK0A 3MXPA 2RVLA 1BCPB 4IUTA 3NXWA 4J1MA 2Q8IB 3G6JB 3KBXA 2DNEA 3MHBA 2F0MA 3J7AV 4EGVA 4KY6A 4KKSA 1UNSA 5C0XG 1K8OA 4ZKCB 2XN9C 1JWUD 1SYBA 4M1UB 2VNUD 1EU4A 1U4PA 2K05A 3I72A 4XYQA 4CJ1B 2EZVA 5BN5A 4IZ8A 2ENBA 1EFID 1JOKA 1H9MA 3PUXA 1QG7A 4FVMA 3LX0A 2NVYB 4C3JG 2EY2A 3J7YW 2XRSD 5KGUA 2JP1A 1LTBD 1IKLA 4ZAIA 3MAQA 1MI2A 3AB9A 1AN8A 2PO4A 5FLXE 1XXGA 3M85A 3GTPB 4RA8A 1DJRD 1SJHD 4B08A 1PLFA 2CQAA 3IKJA 5AFWA 4N9PA 3DM1A 3HOXB 3BYTB 1SDFA 1CHQD 3A8KE 4LAAA 5F2DA 2A69C 4CKBA 2HUGA 1ZEQX 2EPBA 1WTVA 1FYCA 1B4OA 3HZXA 4ZYSA 2AQ2B 1GUTA 4XQQA 1ESFA 2EY5A 3M7GA 2KCCA 1B3AA 1BCPD 1WTPA 1GUWA 5FKAC 3IFDA 3GTMB 2V4DA 2XWJB 3SK6A 1OXXK 2EY1A 2A68C 5D3DA 3QB3A 4L6TB 1CI3M 4HN7A 4K8JA 4IFDJ 2K04A 4HMJA 3J7AF 1KLUD 1I4HA 1KDAA 5CMDA 1TVXA 4IQZA 4KKUA 5KYLA 1PFNA 1KTKA 1SYDA 1LTTD 4BY7B 2NVTB 2KA7A 2PYKA 4R8NA 2WP8J 2TMPA 3D6CA 1Q1EA 5FO9B 3A7AB 2EJGC 1SNPA 2FFKB 1X3PA 4WORA 3GO5A 2EVBA 4OIJA 4IFDH 1AZQA 2M2LA 3V96A 4IUQA 1S5FD 3BG3A 2K03A 3U9SA 3HOYB 1CT1D 1HUNA 5C5LA 2K5QA 2EOTA 3SDZA 3PUZA 1AW7A 1YNJD 1R4QB 3KUPA 3L7ZC 2EDGA 1IKMA 2A6HC 4OHJA 4UDUC 4X3UA 5G3LD 1TY0A 1SNDA 2R92B 5ELDA 2RKSA 4CGYB 4CJ0B 1PFBA 3HGBA 4PV1C 1G291 3RLFA 1Y8PB 1DOKA 1H9RA 4MN3A 3TP6A 1TWCB 5CBEE 5E3FA 1YNNC 1EIGA 4FXDA 2IT1A 4KY7A 5K5PA 1VMPA 3IFTA 2EYHA 1STHA 5I9PA 3K5LA 3GTKB 3ND9A 1ILPA 2AQ3B 3MWYW 1D5MC 1I4XA 1KABA 2KVMA 1TWHB 3FPPA 2R61A 3FRPB 4U68A 2NN6H 5EGTA 1V43A 5C44B 4ZUJA 5DM63 1EEID 1Z6HA 1HRJA 1SYCA 2AUKA 1BF4A 3PIP3 4K5WA 1TR5A 3GQBA 3K59A 4EQOA 1LTAD 5CV7A 5D14A 3H91A 1IHZA 1KNAA 3X3NA 1VF5C 1HFGA 1EOTA 4Y7NB 2D9UA 2IL8A 2A74C 1EIHA 3H3VC 1LT6D 2F0KA 2R6GA 4K5XA 4UAIA 2K01A 1EL0A 3D4WA 4CJ2C 4KN4C 3RD4A 1XX8A 3MFYA 1NUCA 2KEDA 3HRZC 5I2XA 1FGBD 1DONA 4G7HC 4A3JB 2Q8TA 3S9WA 2F0PA 1I4PA 3S15B 4KD4A 4C3IG 2B2YA 3BDLA 4RHRA 1I3QB 1J8IA 5LL6S 1G91A 2JEAI 4B9XA 5FLXL 1I6VC 1ET9A 3V2TA 3S17B 1JB3A 3HG9A 5E1FA 1WTXA 3GV3A 3NTHA 1RHPA 1CQFA 1PRTC 4LJZC 4WJWA 4K6LA 3I91A 4FF4A 1A6XA 5JPNC 3DWPA 4G4KA 3VYSA 5EKLA 1RDPD 2VB3X 3O13A 2A6EC 2X6GA 3DEPA 4M8AA 1AEXA 4CKEA 5M5XB 1GOZA 2E2HB 1Y8NB 3Q0AA 2CW0C 4ABNA 2B8FA 1SFOB 5C0XH 4EQNA 4FXGC 4HCSA 1V1PA 3BZDB 1HPCA 3D4DA 2O5IC 3TBIB 1PZID 1VCIA 3C3LA 2OEOA 3I4NB 4K2LA 1HQMC 5IGGA 2Q8RE 2QCPX 1RODA 3M7NA 1VF7A 2EY6A 5K36G 2G9DA 1RCVD 1SMYD 2F3WA 1WTRA 5EPJA 3Q24A 3VYUA 2BA0A 2B2UC 5COYA 5FK9C 1ML0D 2ZXRA 2F4IA 3KK7A 5CV6A 1Q1BA 1IW7C 1PZKD 2CVRA 3OMCA 1RJTA 5EPKA 3BVGA 4PNYA 3VR3A 4CHTB 1OXUA 2A69D 1S5CD 2K32A 3D6WA 4ODGA 3QG1A 3RZOB 2MHVA 1FNVA 1NCVA 2RDHA 1LT3D 2G9HD 5EKIA 1DZ1A 1B2TA 1STNA 1ONLA 2E75C 4OO1G 1NSNS 3KF8A 1D5XC 2RDGA 3I3CA 3WDNA 4BWGB 4NDXA 2F0GA 3BDOA 1SE4A 3SHLA 1DXMA 3E0JA 5I6YA 4V0BA 1GJXA 4B9WA 1TIID 2ZT9C 4BBRB 3SK8A 1FNWA 5C3XA 1C48A 4RH6A 4RFBA 1DD2A 4S3SA 1JC7A 4CKCA 2Z4IA 2LKVA 3GTGB 1PZJD 4DU9A 4KV6A 1PYWD 2PCFB 4KI0A 4XT1B 2XWBB 2Z8LA 5NUCA 1STAA 1B44D 3A8IE 3OHXC 1BUVT 5CR3A 5I6WA 2PNRC 4HTHA 5CBAE 5JOBA 1CQVA 2JA6B 3QJYA 3DWAA 4HMIA 3GV6A 2NTSA 3FDTA 2EYFA 2LS01 2OT2A 2JSOA 2F0UA 1E2VA 1EYDA 4BS9A 5J22A 1PFMA 1PMRA 4A3FB 4JBWA 2IJ0A 1PTOC 3ERQA 1LO5D 2L0CA 3Q23A 1PTOH 2HDLA 1B50A 2F03A 1C4QA 1SAPA 1STYA 2NUCA 1TKWB 3LNNA 3HOUB 2F0FA 2B63B 3PUYA 3OIQA 1GHKA 1DCZA 2PQEA 4QF4A 4QUFA 4CBVA 1E2ZA 1T5XD 5KEEA 5M9OA 4OL7A 3EFXD 4KHVA 1STBA 4LK1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZT9 C;  1GUS A;  1H9J A;  2K33 A;  1HPC A;  2O5I C;  1BDO A;  3M85 A;  2A68 D;  3BG3 A;  2B8G A;  1CFM A;  1VCI A;  1ZYR C;  1K8M A;  2JEB I;  1TU2 B;  3QIA A;  1DD2 A;  3IKJ A;  4BA1 I;  4OO1 H;  2R6G A;  1HQM C;  1GUO A;  4OGQ C;  1B9N A;  1OXT A;  1O78 A;  1IYV A;  5BN4 A;  2D5D A;  3U9S A;  1H9K A;  3EQL C;  2BE5 C;  3A8K E;  4KN4 C;  3VR5 A;  4DNR B;  5JEA H;  3M7N A;  3MFY A;  3GD7 A;  1VF7 A;  2D62 A;  2PCF B;  1QJO A;  2AWO A;  4KI0 A;  4G7Z C;  2DN8 A;  5K36 G;  3SDZ A;  3PV0 A;  3PUZ A;  2A69 C;  3VR2 A;  2QF7 A;  4KHZ A;  4JK1 C;  1GUG A;  2NN6 I;  3T53 B;  1Z7T A;  4G7H C;  5KND A;  2DNC A;  3T51 B;  4I7Z C;  1FYC A;  4KKT A;  1IYU A;  3A8I E;  2EDG A;  3L7Z C;  1H9S B;  1GUT A;  3OPO A;  1Y8O B;  4G7O C;  2BA0 A;  2KCC A;  3I73 A;  2A6E D;  2PNR C;  2A6H C;  2K7V A;  2JXM B;  3FMC A;  3QJY A;  4DK1 A;  1E2W A;  2V4D A;  3NE5 B;  1OXV A;  1Q1B A;  4BA2 I;  5KNB A;  1IW7 C;  3A7L A;  3HGB A;  1G29 1;  1OXX K;  1Y8P B;  1V8Q A;  4PV1 C;  3RLF A;  2JEA I;  4DK0 A;  3H94 A;  1I6V C;  1H9R A;  2A68 C;  5KNC A;  1EWH A;  3VR3 A;  1CI3 M;  3CRL C;  3TZU A;  1E2V A;  3PUW A;  1HCZ A;  1OXU A;  2NN6 G;  2PPB C;  2E74 C;  4KN7 C;  2Q8I B;  3N6R A;  1YNN C;  2A69 D;  1GHJ A;  4DNT B;  2K32 A;  2DNE A;  3CRK C;  2O5J C;  2IT1 A;  3I4L A;  1O7L A;  2AUJ D;  4TQU S;  1B9M A;  4LJZ C;  3LWU A;  2EJF C;  1GUN A;  4H13 C;  4OO1 G;  3QG1 A;  1PMR A;  2D2C C;  2EJM A;  2YYZ A;  4IQZ A;  3D31 A;  1VDZ A;  4KKS A;  3IFT A;  4TKO B;  4KKU A;  4HR7 B;  5C0X G;  1K8O A;  1OXS C;  3T56 B;  3ND9 A;  1SMY C;  4JBW A;  3MXU A;  3VR6 A;  4IFD G;  1A6X A;  2E76 C;  1YNJ C;  3VR4 A;  1HTP A;  2F1M A;  3FPP A;  2BA1 A;  2BE5 D;  5BN3 A;  3I72 A;  4XIG S;  2A6E C;  3OW7 A;  5K36 H;  3A8J E;  1TKW B;  2KA7 A;  4H44 C;  3LNN A;  5BN5 A;  2NN6 H;  2LMC B;  4L8J A;  3KLR A;  1V43 A;  1Q12 A;  1H9M A;  1ONL A;  1Q1E A;  1Z6H A;  2E75 C;  3PUY A;  3PUX A;  3W3A A;  1LAB A;  3A7A B;  1Y8N B;  4H0L C;  5A35 A;  1DCZ A;  1Y69 U;  1GHK A;  2AUK A;  1H9S A;  3SE0 A;  4XTC S;  3WDN A;  2EJG C;  1E2Z A;  2CW0 C;  3GQB A;  5JEA G;  3BDO A;  3P20 A;  3VA7 A;  2B8F A;  3ND8 A;  3PUV A;  2A6H D;  3DXJ C;  4GZY C;  1DXM A;  2JE6 I;  3OOC A;  5C0X H;  1ZKO A;  2EVB A;  4IFD H;  1GJX A;  2BDO A;  2L5T A;  4RCN A;  1CTM A;  1Q90 A;  3M4Y A;  1T5E A;  4KMU C;  1VF5 C;  3D4R A;  1LAC A;  4LK1 C;  3AB9 A;  1IW7 D;  1FR3 A; 
#chains in the Genus database with same CATH topology
 5J39 A;  1S72 A;  4CDC C;  1XJV A;  1HNW Q;  5CV4 A;  1BDO A;  1EY5 A;  5ELO A;  3QO2 A;  3AMU A;  5ELC A;  5CC4 A;  2ZTC A;  4DUY L;  2IPK D;  4JPB W;  1HFN A;  1S3O A;  1ENC A;  3HOX G;  1AH9 A;  4LUO A;  4ZRZ A;  2WB1 B;  4WRD A;  4OON A;  2KCN A;  5H1S E;  3KBG A;  1PRT F;  2BH2 A;  5IYC G;  3CCQ A;  3T1H Q;  2QKI C;  4Q0F A;  3L9A X;  4BY1 B;  4NB3 A;  3S2D H;  1EOV A;  1LTG D;  2Z6K C;  1Y8O B;  4C2M H;  3CW2 C;  3E9I A;  1O80 A;  3K58 A;  2RDF A;  2HCC A;  5T1I A;  3J80 i;  1UWV A;  3UE1 A;  5KIX A;  4DV2 L;  1LT5 D;  3MTS A;  1LTS D;  3GTO H;  1VQC A;  5J1Z A;  4XQN A;  5M3F H;  2F0D A;  5JEA J;  4GKJ Q;  1VQD A;  1HCZ A;  4HJ9 A;  1SNC A;  4IUP A;  2RA4 A;  4LFC L;  2ZJR A;  1VQO A;  2NB0 A;  3GTL B;  2NVQ B;  3R93 A;  4C3I H;  1EQT A;  1JE4 A;  5JJZ A;  4JOI C;  3RMH A;  1EQV A;  2Q2I A;  1OXS C;  5ELF A;  1G2T A;  5D65 A;  3MXU A;  1I94 Q;  1SRU A;  4K6D A;  5LMN L;  1I4Q A;  1Y1W H;  3VR4 A;  4L5T A;  3T1H L;  3D0F A;  2JA8 B;  4DFA A;  1SBB B;  3T4A C;  3K5N A;  5HGQ A;  4U67 3;  2EYP A;  4PMW A;  2SNS A;  1O7Z A;  1HNX Q;  2F0I A;  4PZ6 A;  1X3F A;  3ULL A;  2OQK A;  1GO3 E;  1HXY D;  5A35 A;  3I4M B;  3S14 B;  4MIU A;  2JQO A;  4A3B B;  3K0Y A;  3R2T A;  4PQX A;  3ND8 A;  4BBS B;  3SGI A;  2MGS A;  2BDO A;  1F77 A;  3TP7 A;  5GAE C;  5JPM C;  2F3V A;  3S1Q B;  4DKA C;  4GKJ L;  3RZD H;  1A3T A;  1U0L A;  1PH6 A;  1AE3 A;  1U4M A;  1ASY A;  2F0S A;  2DUD A;  3S1R B;  2R7Z B;  1ZYR C;  5I4D A;  1R9T B;  3QIA A;  2E2I B;  4BXX H;  2KEC A;  5E7N A;  3HKZ G;  1YIT A;  4A3K B;  3ZYY X;  3S16 B;  3HOY G;  2ZTD A;  3HKZ E;  3KOJ A;  3PV0 A;  4QQB X;  2QEX A;  3K7A B;  4AYB B;  2J7Z A;  1D8L A;  1PA6 A;  1VQF A;  5IGD A;  3SEB A;  1YIJ A;  4WJ3 M;  3A54 A;  2X6L A;  4JBJ A;  3J80 c;  2E2J H;  2I5M X;  1B1Z A;  1HHV A;  4GLX A;  4JCV E;  4IFD I;  1CKO A;  3L2P A;  2R92 G;  5HUR A;  4JI3 Q;  1N36 L;  3AEV A;  4F8M A;  1SXT A;  3TP5 A;  1SYF A;  3H94 A;  2ZM6 L;  1Z9F A;  2K5D A;  4GLA C;  5COR A;  2SEB D;  3K6O A;  1Q8K A;  4KN7 C;  4K0K L;  1EY0 A;  2DJF C;  1YHB A;  3RLO A;  1JOR A;  4WFN 3;  1B9M A;  2EJF C;  1MSH A;  1PH5 A;  2B2U A;  3D31 A;  2K4K A;  3T56 B;  2Q2U A;  1EY6 A;  3VR6 A;  4DPG A;  2K1B A;  2IX1 A;  2JA7 B;  2L55 A;  3PGZ A;  4FF1 A;  4IPD A;  1N32 Q;  4EQ5 A;  2HQE A;  1OTC A;  2BA1 A;  4XIG S;  3K57 A;  3GTQ H;  2B39 A;  3J80 E;  3HKS A;  2KHS A;  4H44 C;  2NTT A;  1KDC A;  4L8J A;  2KEE A;  2PMZ B;  2L15 A;  5C44 G;  4KHP L;  4A3M H;  1SJE D;  3PMF A;  4X3T A;  4X65 L;  1H9S A;  5A2Q E;  1Y69 U;  2A5H A;  3CXC A;  4DV5 L;  4GOP B;  3CQZ B;  2JE6 I;  3OOC A;  4F87 A;  1K73 C;  4B3S Q;  2E8G A;  1BBW A;  4K5V A;  2QA4 A;  2DY8 A;  1G6P A;  4YWK A;  1RTN A;  1M8A A;  1H9J A;  4EX5 A;  3F2C A;  1WVL A;  4QMG A;  4LFA L;  2AMC B;  3WOE A;  4XXE A;  2G5D A;  3CP0 A;  3SK4 A;  5IP9 H;  1HQR D;  4IO9 A;  3KDF A;  2IX3 A;  2L9H A;  3PO3 B;  4OO1 H;  2ES2 A;  3S1M B;  2F0L A;  2VQE Q;  1A3U A;  4XQJ A;  2KOL A;  2DN8 A;  2LXK A;  3GP7 A;  4JK1 C;  1IBK L;  2NN6 I;  2PZU A;  3OIP A;  4KKT A;  2EYM A;  2B2V C;  3X3M A;  1E0B A;  2FHT A;  1PTO F;  2YTY A;  3I73 A;  3WOF A;  1E1O A;  1M1K C;  3C2P A;  2UUC L;  1F2M A;  1F9R A;  3MXG A;  1F9P A;  1WCM H;  3I7F A;  4DK1 A;  3NUC A;  2H1E A;  3MEH A;  4JI4 Q;  1JOQ A;  1V1P B;  3Q6S A;  1I5F A;  1F2L A;  2JA5 H;  3S1N B;  1EUJ A;  5M5Y H;  4HID A;  3KJO A;  1EY8 A;  3R8B A;  1GHJ A;  3NEM A;  3TRZ A;  2R93 H;  2L1B A;  2YV5 A;  2A73 B;  5LMU Q;  3HOV H;  1CKN B;  1Q3L A;  1PH9 A;  3H3V I;  5FJ8 G;  1HR0 L;  1VDZ A;  2X69 A;  1K8G A;  2FMC A;  3UI2 A;  3EVQ A;  5IYD G;  2B2W C;  2EYL A;  1EFW A;  2BE5 D;  1EY7 A;  1BCP C;  2K5N A;  1BR9 A;  3FKI B;  5C4J B;  1A2U A;  3KLR A;  3E3X A;  4NXN Q;  4JI0 Q;  5DM7 3;  1NR4 A;  3H09 A;  4RGN A;  2CQO A;  3NSW A;  2NVX B;  3GTO B;  5GAH C;  5JEA G;  3P20 A;  3VA7 A;  3H0G B;  4LF9 Q;  2BDN A;  2RHS B;  1HNZ Q;  3M4Y A;  4KMU C;  2SNM A;  1L0X B;  1FR3 A;  1ENA A;  1ZXT A;  4HIM A;  1SYG A;  1SNO A;  4DAM A;  2OXP A;  5LMU L;  2H4O A;  2C5C A;  2CKZ B;  2JEB I;  3NK9 A;  4MZ9 A;  5IGB A;  2VUM H;  2F4V L;  1XMO Q;  1SRO A;  4DR7 Q;  4DUZ L;  3I4N G;  1O78 A;  2P5Z X;  3R2I A;  4PMC A;  3U58 A;  3GDE A;  1XTD A;  1D2B A;  1XNR Q;  3STB C;  1VQ7 A;  4L5S A;  3BJU A;  2H5X A;  4UHV A;  1KLG D;  4UY8 C;  1WYD A;  4NXM L;  1VQJ A;  5FOB B;  2DNC A;  4JI6 Q;  1JQY D;  5BR8 Q;  5IT9 E;  3KF8 B;  3S2H B;  4NXN L;  3CCS A;  4JI0 L;  1J9O A;  1UEB A;  2K7V A;  3GTP H;  1XPU A;  1NMG A;  3FMC A;  5C0X I;  1SNM A;  2NWG A;  5M5W B;  1V9P A;  3HOX H;  3A7L A;  1V8Q A;  3RZD B;  1ENF A;  3MXN A;  2ICE C;  1UE5 A;  4DR5 L;  3I90 A;  3PF4 A;  3OWF A;  2Z4H A;  4GNX B;  1WFQ A;  2K5V A;  1K83 B;  4X3K A;  1EWH A;  5IYC H;  2E5L Q;  3TZU A;  1MKH A;  3NWT A;  4HED A;  1U4L A;  1GXD C;  4LNQ A;  1HTL D;  2UXC L;  2BOS A;  1PXU A;  3BVZ A;  3I4L A;  4P75 A;  4H13 C;  1YZ6 A;  4HCE A;  2Z6K A;  2N55 A;  3NPP A;  4HR7 B;  2B2T C;  4DXF A;  1HA5 A;  2N78 A;  3GTM H;  4EQP A;  1Y1V B;  1YNJ C;  2C35 B;  4FO2 A;  4DR6 Q;  1HTP A;  1JJ2 A;  1MIU A;  2F1M A;  3CCL A;  3IAY A;  1N9W A;  4X66 Q;  3DWQ A;  3OMG A;  4XT3 B;  5BN3 A;  1JWM D;  5AJ3 Q;  2UU9 Q;  1W6J A;  5C3E B;  4UP7 A;  1EEF D;  4DAY A;  1TS2 A;  1F2Z A;  4ALP A;  3HOZ B;  2IW3 A;  3W3A A;  5E4X A;  1UEA B;  2CHB D;  2PW5 A;  4QCL A;  4F88 A;  1VQL A;  1UAP A;  2VY3 A;  4C1N I;  3TN2 A;  2SDF A;  4NMZ A;  1E24 A;  4RGT A;  1U9R A;  3J7Z C;  4JOI A;  4O1N A;  4LF8 L;  2K50 A;  4JI7 L;  1JOO A;  5IIF A;  3K5O A;  3BS1 A;  2FIN B;  1GUS A;  1S5D D;  3EA6 A;  2L11 A;  2K33 A;  2LSS A;  3ZJY C;  2NVT H;  3PO2 B;  2A68 D;  4IUN A;  4C3H B;  1CFM A;  3VA5 A;  4K2K A;  4DR1 L;  3ITP A;  3TSS A;  3Q22 A;  4OGQ C;  3W1G A;  2RF4 A;  3VR5 A;  1XPR A;  3J80 L;  1EZ6 A;  1FNU A;  2B3G A;  1L1O C;  1BXT A;  1NAP A;  3VR2 A;  1ESR A;  1TS4 A;  1GM5 A;  4WJ4 A;  2XNA C;  5A2Q L;  4A3M B;  1CA5 A;  4QGU A;  4QUC A;  1VQ5 A;  3Q8D A;  3HFZ B;  1Q81 C;  2O4X A;  5EBC A;  4AQY Q;  1XTC D;  4P71 A;  2XVS A;  3NE5 B;  4POF A;  1AE2 A;  1D5Z C;  1II3 A;  1YI2 A;  2K52 A;  1S4Z A;  3T16 A;  3HOY H;  4N9T A;  2EIF A;  2WKD A;  1K8A C;  1XMQ Q;  5DNF A;  4LW1 A;  3SK5 A;  3CMA A;  3CRL C;  4H02 A;  3J81 i;  2E74 C;  3ONA B;  2VQF Q;  4DNT B;  4DV6 L;  2K5H A;  2HCI A;  1AFP A;  4TQU S;  3LWU A;  3U4V A;  5IOC A;  1KRT A;  4POG A;  1QB5 D;  4Y52 H;  5C3W A;  4A3F G;  1D1K A;  4JI5 L;  3HOW B;  2V1C C;  4A3D B;  1BO0 A;  3T13 A;  1IBL L;  5HGT A;  3KLW A;  2R92 H;  4CDE C;  4TRD A;  1PH7 A;  5JVG 3;  4NP5 A;  1WTH A;  3LWE A;  1K28 A;  4DA2 A;  3CPF A;  1DM0 B;  2I46 A;  3TZD A;  1TWC H;  2Q2H A;  1KNE A;  3M3Y B;  1EYA A;  1EU3 A;  3NBH A;  3HOU G;  2B63 G;  1LAB A;  2MQH A;  4DUY Q;  4JV5 L;  4J8Q A;  4XDX A;  4A3G B;  2OTJ A;  5ELE A;  5EQ0 A;  3K7U C;  2A6H D;  2N49 A;  1BBX C;  3CCV A;  1SYE A;  2ZTE A;  4RGM A;  3GTK H;  5LL6 X;  2E2D C;  4K8I A;  1ILQ A;  1HJP A;  3EN2 A;  1T5E A;  4QIW B;  2KBN A;  3F2B A;  1TWH H;  3HOV B;  1X6O A;  3QWN A;  2MPM A;  2DY7 A;  1QUQ A;  2NBF A;  1MHW C;  4KLK A;  4CDF C;  3CPW A;  2UXD Q;  4X64 L;  3A56 A;  5C44 H;  4OEM B;  1YNN D;  3DUZ A;  4Z9C B;  1OXT A;  2WFW A;  1IYV A;  4DV0 L;  4DGZ A;  4DV2 Q;  2WB1 G;  4ZK9 B;  3V05 A;  2OF1 A;  1UE7 A;  3TP8 A;  4O42 A;  2QGQ A;  5DEH A;  1I4R A;  4A93 B;  3T51 B;  1LM0 A;  2QDB A;  1PRT B;  1STE A;  4P72 A;  4LFC Q;  4G7O C;  4Y7N H;  1RKN A;  2WAQ B;  5C4H A;  5T1G A;  2AWN A;  4PZ8 A;  1L2F A;  1BCP F;  2WKC A;  3EJI A;  4OX9 L;  5M3M B;  5KNB A;  1TQO A;  3UDX A;  3N52 A;  3MZ5 A;  3KLS X;  3PSI A;  4RWS C;  1L0W A;  5LMN Q;  1YBY A;  2J0T D;  4L5R C;  2FJ2 A;  4PMB A;  3J81 c;  2A8V A;  3PUW A;  4IJH A;  1BVS A;  1K3B C;  4NKL A;  2VUM B;  1PH4 A;  1O7L A;  2AUJ D;  3NTK A;  1C7Y A;  5C4X B;  2UXD L;  2B2V A;  2M00 A;  2D2C C;  3S15 H;  2YYZ A;  4YY3 L;  4V19 0;  3NTI A;  1SSO A;  4N8F A;  1S5E D;  2O2L D;  4P2C B;  1SMY C;  1I3Q H;  5IT9 L;  1VQI A;  4UP8 A;  1X32 A;  4FF3 A;  5JVH 3;  2JA8 G;  4DV3 L;  3OW7 A;  2CWP A;  1WTO A;  2LMC B;  5IGC A;  1V1O A;  2F0W A;  4TVA B;  3I4M G;  1LTR D;  4XYO A;  3NEL A;  5IE8 A;  4XTC S;  2VB2 X;  3GTJ H;  4LF5 L;  1X56 A;  3A5Z B;  1X55 A;  4A3B G;  1M4V A;  5FJ8 H;  5CGK A;  3DXJ C;  3CHB D;  4C3J B;  3J81 E;  4KD3 A;  1TWA B;  4P73 A;  1FJG L;  3MC0 B;  4OXP A;  5EAY A;  2TSS A;  5IYD H;  4YHH Q;  3D4R A;  4BY7 G;  1A63 A;  1LTI D;  4F7X A;  4R8I A;  2B2W A;  3DHQ A;  2B8G A;  4R4O A;  1CSQ A;  1U5K A;  1HUM A;  1A15 A;  2R7Z G;  3VYR A;  3F2U A;  4BA1 I;  1PRT D;  5C4Z A;  2E2H H;  4ZLT F;  4DNR B;  1A62 A;  5JEA H;  2LY7 A;  5FO7 B;  4A3K G;  3GD7 A;  5TSS A;  2D62 A;  4G7Z C;  1SFO H;  1N36 Q;  3NQT A;  3A55 A;  2ZM6 Q;  2RBM A;  1Z7T A;  1LLR D;  4AYB G;  5IOD A;  1H9S B;  3L3O C;  1RL2 A;  3G71 A;  4K0K Q;  1G8Z D;  2A6E D;  1HR0 W;  1OO9 B;  3NP8 A;  4ZUI A;  5EBD A;  3HP3 A;  2RSN A;  3C1F A;  1NMF A;  1E2W A;  1WD0 A;  2PI2 E;  1L0Y B;  1OXV A;  2R7F A;  3P75 A;  3I4N H;  5G3L F;  1K0S A;  5IWA L;  4FF2 A;  3RNU A;  1QZH A;  2CW0 D;  2WIN B;  1KAW A;  3HS0 C;  4YHH L;  3CCJ A;  2MP1 A;  1PYS B;  2F0T A;  3KDF B;  2KUM A;  2YTX A;  1D6E C;  2IHE A;  1CUK A;  5KRU A;  3OTO L;  4R4I A;  2LFN A;  2NZ1 D;  4KTA A;  1VQB A;  1GUN A;  4IUV A;  4KHP Q;  2EJM A;  4HJ8 A;  4ZKB B;  4X6A H;  4X65 Q;  3M4P A;  3JAM E;  2VZA A;  4DV5 Q;  1PFS A;  2PW7 A;  4DF7 A;  2E76 C;  2JA7 G;  4R9W A;  4DAV A;  1W3S A;  4FNF A;  3T1Y L;  2F3I A;  3A0J A;  4QY7 A;  1DOM A;  3MVV A;  5K36 H;  5ISR A;  2D0O A;  1EWC A;  2QDL A;  1TY2 A;  4H0L C;  4LFA Q;  1QOH A;  1EQR A;  4R4Q A;  1IL2 A;  1B53 A;  3NQI A;  2OTL A;  3CU7 A;  3HKZ B;  1SN8 A;  2MUY A;  1RTO A;  4OWX B;  4RKL A;  3PUV A;  3RZO H;  5EJW A;  1ZKO A;  2KCT A;  2B2T A;  2YU9 H;  4ME3 A;  4RCN A;  2ZXO A;  1EZ8 A;  1LAC A;  2F0H A;  1PH3 A;  1IW7 D;  1VQ6 A;  4DV1 L;  1IBK Q;  3D8G A;  1YJW A;  1D1I A;  2KQ3 A;  1MBY A;  4ME5 A;  2HDM A;  4YWM A;  4LMQ D;  4IOA A;  2EYJ A;  3E9H A;  1K9M C;  1LUZ A;  2UUC Q;  1WTW A;  2XTI A;  3PO3 G;  4ZCK A;  1PYB A;  4J6H A;  2GN5 A;  5EPL A;  4OWT B;  4TSS A;  1QJO A;  1JIC A;  1TWF B;  1VMC A;  2F0Q A;  4JG2 A;  4A3E B;  2AQ1 B;  4JYA L;  1RD9 D;  1GUG A;  3E6Z X;  3P1H A;  5FLM G;  1CZW A;  3TDQ A;  3D3R A;  1HZ9 A;  2LXJ A;  3G7L A;  5DLQ E;  1FD7 D;  4L5Q A;  1VQK A;  4X3S A;  3M4O B;  2EXZ A;  1S40 A;  1HR0 Q;  1PTO B;  1JR0 D;  1VQ9 A;  4B3M L;  1QE6 A;  4HSP A;  3C1E A;  3OSO A;  2BCO A;  3BYY B;  4DR3 L;  1L1O A;  2MJ8 A;  1TWG B;  2UUB L;  3N6R A;  1I50 B;  2M9V A;  4A3J G;  1VQ4 A;  5LHY 1;  4OO1 I;  3URY A;  1CM9 A;  3DEO A;  4A3I B;  3BVM A;  3B6Y A;  3I56 A;  1X3Q A;  2JK8 A;  4QB4 A;  4TKO B;  3MA2 B;  2PI2 A;  2ICI A;  1QIL A;  4MTK A;  5ELB A;  3K5M A;  5C6A A;  4A3C G;  1P16 A;  4DR4 Q;  1RF2 D;  4K14 A;  5CV9 A;  1EIF A;  1I4G A;  3FKI G;  1O7Y A;  4AIM A;  2N88 A;  4IUR A;  2QIL A;  3AU7 A;  1NY4 A;  1AP0 A;  1MD2 D;  3MXN B;  2F4V Q;  4DUZ Q;  4A3F H;  4YIJ A;  3U9O A;  3OYY A;  4OEL B;  3KLS A;  3H0G G;  4ULL A;  4PZ7 A;  2NYZ D;  3S2D B;  1I6H H;  5IYB H;  3W5O A;  3NHH A;  4NXM Q;  4C2M B;  1B3Q A;  1EYG A;  4LF7 L;  1YHA A;  3R3O A;  2K6A A;  4G57 A;  3U4Z A;  5CV8 A;  1G6Z A;  3HOU H;  1TU2 B;  1AZP A;  5IT9 c;  2B63 H;  2ID0 A;  2F0V A;  3TS2 A;  4IOC A;  2VXW A;  2PZW A;  2D5D A;  5ELN A;  1JCK B;  5M3F B;  4DV7 L;  4HSV A;  3C46 A;  2AWO A;  3MFG A;  3ERO A;  5CV5 A;  4JI1 L;  4DAY B;  4DR5 Q;  4KHZ A;  2EE1 A;  4DR4 L;  1JT8 A;  1PTO D;  5C0X J;  1F9Q A;  5IGE A;  1R4P B;  3K80 C;  1E3P A;  3OPO A;  1TS5 A;  4A76 A;  1LT4 D;  4C3I B;  4RGO S;  3GTJ B;  2UXC Q;  1KAA A;  1KL9 A;  2PZT A;  2GA4 B;  3PCO B;  3J81 L;  2VW9 A;  4H7B A;  1CHP D;  3FHW A;  4RCO A;  1Y1W B;  1SNQ A;  1CK1 A;  2MO0 A;  3I70 A;  1EYC A;  1DYQ A;  3TME A;  1A2T A;  4DN4 M;  2NVY H;  1WTQ A;  1XPO A;  3DLL A;  1ET6 A;  2ASB A;  1B8A A;  5KNC A;  1F9S A;  1UUP A;  2GVA A;  2ZXP A;  2PPB C;  1W2B A;  3FEW X;  1IL8 A;  2O5J C;  4DK6 C;  2RCF A;  4LF6 L;  3UDF A;  3FVQ A;  2JA9 A;  2IHF A;  1MGS A;  1ICW A;  4KJN A;  4IFD G;  1WD1 A;  2CWA A;  5DAU A;  1XYI A;  4DNI A;  1Y1V G;  2F0O A;  4LF8 Q;  3AFP A;  3M9B A;  2FMM A;  3E5S A;  1VS0 A;  1S5B D;  1DOL A;  3W2D A;  2KJX A;  3NBI A;  4JI7 Q;  3S24 A;  3A8J E;  2WAC A;  4EVO A;  5C3E G;  3SVM A;  2L12 A;  1GD7 A;  1SEB D;  1F2Y A;  1Q12 A;  3QOL A;  3HOZ G;  2EQS A;  1VQG A;  4KJO A;  4RAU C;  2F0J A;  2K28 A;  5E4W C;  3GTL H;  1BBU A;  4DR1 Q;  4C56 C;  2KHI A;  1BNZ A;  1GKH A;  4RHS A;  5I9O A;  1STG A;  2XRQ D;  1QNK A;  1CTM A;  1Q90 A;  1JMC A;  1KXL A;  2K5W A;  3DMU A;  3CD6 A;  2ZJP A;  3BDC A;  1M90 C;  1EY4 A;  3JAM L;  2E2J B;  2JJQ A;  1HZB A;  3PO2 G;  4C3H G;  1N8R C;  3CCE A;  2J4X A;  2MFI A;  4RKB A;  3G48 A;  1TT2 A;  5FO8 B;  1GUO A;  3I4M H;  1PVO A;  1H9K A;  3EQL C;  4FXK C;  1CZG A;  4A3B H;  1QWY A;  3IL8 A;  4IAL A;  4OIK A;  1JWS D;  1CA6 A;  2RHQ B;  3L0O A;  1J5E L;  1YEZ A;  1PH8 A;  1Q8I A;  3NBH B;  3T53 B;  5KND A;  3CC2 A;  5GAD C;  4LUZ A;  3S1Q H;  4BY7 H;  3A74 A;  4A3M G;  3UDI A;  3BU2 A;  4BBR G;  4E6I A;  4DV6 Q;  5D3I B;  2JYO A;  2WII B;  2IWH A;  1XWE A;  3S1R H;  2R7Z H;  4RG1 A;  1SE2 A;  1HZA A;  4O0A A;  1R9T H;  2YU9 B;  4JI5 Q;  1KRS A;  3FPU B;  4ILW A;  2E2I H;  4BA2 I;  2VS1 A;  2EYO A;  1IBL Q;  2Z1C A;  4A3K H;  4FP5 D;  3GTQ B;  2Y0S B;  1QUQ B;  1QNU A;  3H6M A;  1Z47 A;  2NN6 G;  4C1N K;  3K7A H;  1EY9 A;  1UE1 A;  2IX0 A;  3CRK C;  2R3Z A;  1XNQ L;  4JI8 L;  2QEJ C;  2MO1 A;  4NW2 A;  4I65 A;  3PF5 A;  3KF6 A;  3HOW G;  2JA6 G;  1YHQ A;  4JV5 Q;  1ZYR D;  4GN4 B;  4FYD A;  4A3D G;  1HA6 A;  4DAP A;  4MHE A;  1WI5 A;  1N33 L;  3W1B A;  3P7J A;  1TS3 A;  1LV9 A;  5J3B A;  1B70 B;  3EIV A;  1IXR A;  3RUZ A;  2WV6 D;  2RQX A;  2CCZ A;  3NWS A;  5CYU A;  4L63 B;  4A3L G;  3SXH A;  2F0E A;  1BQQ T;  3I8Z A;  3QOJ A;  4IUU A;  3CKI B;  3SE0 A;  5IGF A;  1IBM L;  4X64 Q;  1C8C A;  4GZY C;  4A3G G;  1KHI A;  4DV0 Q;  4DK3 C;  2XIW A;  3SR1 A;  5I2Y A;  1NJI C;  2L5T A;  1DGS A;  2JA7 H;  1VQA A;  2SOB A;  4ID6 A;  2I07 B;  4J15 A;  1KDB A;  3OW2 A;  1BOS A;  2B2Y C;  4KY5 A;  5JAV A;  3HOV G;  1EWI A;  3CCM A;  5KYI A;  1LTL A;  4B3R L;  1PDQ A;  2HHH L;  1WCM B;  1NR2 A;  1K3R A;  1K8M A;  4HJA A;  4HAE A;  4ZQ3 A;  4Q5V A;  1SMX A;  2C9O A;  3CCR A;  2GVB A;  1B9N A;  1QVC A;  2XSC A;  5BN4 A;  4GOP C;  2BE5 C;  4OX9 Q;  3HEJ A;  1U4R A;  2KEN A;  3CQZ H;  1NBW A;  2JA5 B;  5M5Y B;  2QF7 A;  1SE3 A;  2R93 B;  4GKK Q;  2L4N A;  4I7Z C;  4A93 G;  1A0I A;  5C5M A;  1IYU A;  4YCV A;  1G2S A;  4QL5 A;  1W6K A;  3OWE B;  3PIO 3;  1KC8 C;  1A3V A;  2N8N A;  4X62 L;  2WAQ G;  5EKK A;  4KK7 A;  2JXM B;  4DV4 L;  2UUA L;  1MSG A;  3VYT A;  4B3T L;  4DXG A;  4YY3 Q;  4IN3 A;  2Z0S A;  5M3M G;  1YJN A;  3PO3 H;  2F0N A;  2RSO A;  5JJK A;  3RR5 A;  3S1M H;  1I6H B;  3CAM A;  3VDY A;  1E22 A;  1QCB D;  4DK0 A;  1ICF B;  3MXP A;  2Z6B A;  2RVL A;  1BCP B;  1UE6 A;  2WB1 E;  4IUT A;  3JAM i;  1BKB A;  3NXW A;  4DV3 Q;  4J1M A;  2Q8I B;  3G6J B;  3KBX A;  4BY1 G;  1VQM A;  2DNE A;  1E7Z A;  3MHB A;  3CC7 A;  2Q2T A;  2F0M A;  3J7A V;  5C4X G;  3RLN A;  4EGV A;  2EXD A;  4KY6 A;  4KKS A;  4QJF A;  1UNS A;  3J7A 5;  5C0X G;  3BZC A;  4YCW A;  4LF5 Q;  1K8O A;  4ZKC B;  2XN9 C;  1JWU D;  1SYB A;  4M1U B;  1FJG Q;  2VNU D;  1EU4 A;  1U4P A;  3KJP A;  2K05 A;  3I72 A;  4XYQ A;  2I0Q A;  4GKK L;  4CJ1 B;  1JE5 A;  2EZV A;  5BN5 A;  3S1N H;  1KQS A;  4IZ8 A;  2ENB A;  1EFI D;  1Q86 C;  1JOK A;  1H9M A;  4A3J H;  3PUX A;  1QG7 A;  4FVM A;  3LX0 A;  2NVY B;  4R4T A;  4O2D A;  5JJI A;  4C3J G;  2EY2 A;  5GAG C;  3J7Y W;  2XRS D;  5KGU A;  2JP1 A;  1LTB D;  1IKL A;  4ZAI A;  1HH2 P;  1G51 A;  3MAQ A;  1MI2 A;  3AB9 A;  1AN8 A;  4A3C H;  3AQQ A;  2PO4 A;  5FLX E;  1XXG A;  3M85 A;  3GTP B;  4RA8 A;  3S17 H;  1DJR D;  1SJH D;  4B08 A;  1PLF A;  4I7A A;  3FKI H;  4HJ7 A;  5C4J H;  2CQA A;  1MJC A;  3IKJ A;  5AFW A;  4N9P A;  3DM1 A;  3HOX B;  3BYT B;  4GLV B;  1SDF A;  2NVX H;  2D0P A;  2R7D A;  3ULP A;  1CHQ D;  3A8K E;  4LAA A;  1EQQ A;  5F2D A;  3PIO A;  4BBS G;  2XGT A;  4JW0 A;  5IP7 G;  5IWA Q;  1N34 L;  3H0G H;  2A69 C;  4CKB A;  2HUG A;  1ZEQ X;  1HNW L;  2EPB A;  1WTV A;  1FYC A;  1B4O A;  3HZX A;  4ZYS A;  2AQ2 B;  1GUT A;  4XQQ A;  1ESF A;  2EY5 A;  3M7G A;  2KCC A;  1B3A A;  3OTO Q;  1BCP D;  1WTP A;  1GUW A;  5FKA C;  3IFD A;  3GTM B;  5M5X H;  2V4D A;  2XWJ B;  3SK6 A;  1OXX K;  2PQA A;  3IRB A;  2PNH A;  2EY1 A;  3JAM c;  2A68 C;  5D3D A;  3QB3 A;  4L6T B;  2OWO A;  3T1Y Q;  1CI3 M;  4HN7 A;  2KCM A;  4RMF A;  4K8J A;  4IFD J;  2K04 A;  4HMJ A;  2I5L X;  3J7A F;  1KLU D;  4AYB E;  1I4H A;  1KDA A;  2A19 A;  3S2H H;  5CMD A;  1CKM A;  1QVF A;  1TVX A;  2HT1 A;  4IQZ A;  2YTV A;  3F1Z A;  4KKU A;  1VQ8 A;  5KYL A;  1PFN A;  1KTK A;  2NZO A;  5M5W H;  1SYD A;  1LTT D;  1FGU A;  4BY7 B;  5JJL A;  4GNX C;  2NVT B;  4A75 A;  3STB D;  4JVZ A;  2KA7 A;  2PYK A;  4DV1 Q;  3TQY A;  4R8N A;  1K83 H;  2WP8 J;  3ER0 A;  2TMP A;  3D6C A;  1Q1E A;  5FO9 B;  3A7A B;  2EJG C;  1SNP A;  1K0R A;  1VQH A;  2FFK B;  1I94 L;  4R4C A;  1X3P A;  4WOR A;  3GO5 A;  1PHJ A;  1L1O B;  2EVB A;  4OIJ A;  4IFD H;  1WJJ A;  1Y1V H;  1AZQ A;  2BH8 A;  2M2L A;  4JYA Q;  3V96 A;  4JC0 A;  4IUQ A;  1S5F D;  1HNX L;  1JJG A;  3BG3 A;  3JC6 6;  5C3E H;  1A8V A;  2K03 A;  3HOZ H;  1JB7 A;  1IZ6 A;  1Q7Y C;  1PH1 A;  2PMZ E;  1J6Q A;  3U9S A;  4YWL A;  3HOY B;  1CT1 D;  1HUN A;  5C5L A;  2K5Q A;  4B3M Q;  2EOT A;  3SDZ A;  4A3E G;  3PUZ A;  1AW7 A;  4DR3 Q;  1YNJ D;  1R4Q B;  3KUP A;  2UUB Q;  3L7Z C;  2EDG A;  4R1J A;  3UDG A;  1IKM A;  2A6H C;  4OHJ A;  3PO2 H;  4C3H H;  4UDU C;  4X3U A;  5G3L D;  1IYJ B;  1TY0 A;  1SND A;  2R92 B;  5ELD A;  2RKS A;  3I4O A;  4CGY B;  4CJ0 B;  1PFB A;  2NZH A;  3HGB A;  1G29 1;  4PV1 C;  1Y8P B;  5GRO A;  3RLF A;  1X54 A;  4P74 A;  1DOK A;  2B29 A;  1H9R A;  2CFM A;  4MN3 A;  3TP6 A;  1TWC B;  2OCE A;  5CBE E;  5E3F A;  1YNN C;  3KYH C;  1EIG A;  1C0A A;  4FXD A;  2IT1 A;  4KY7 A;  5K5P A;  4A3I G;  4BBR H;  4NPS A;  3KFU A;  1VMP A;  3IFT A;  3H15 A;  2EYH A;  1STH A;  5I9P A;  3K5L A;  4JI3 L;  3GTK B;  3ND9 A;  2I5H A;  2AQ3 B;  1ILP A;  3MWY W;  1D5M C;  1I4X A;  1KAB A;  2K14 A;  2KVM A;  1PH2 A;  1TWH B;  3GTG H;  1SLJ A;  3FPP A;  1VQE A;  3CF5 A;  2R61 A;  1E1T A;  3FRP B;  4U68 A;  4IPH A;  2NN6 H;  5EGT A;  1X9N A;  1V43 A;  5C44 B;  4ZUJ A;  4LF7 Q;  5DM6 3;  1EEI D;  1Z6H A;  1HRJ A;  1SYC A;  2AUK A;  4FDB A;  1BF4 A;  3PIP 3;  4K5W A;  1TR5 A;  3GQB A;  4HIO A;  3K59 A;  4EQO A;  1LTA D;  4IPG A;  5CV7 A;  3HOW H;  2JA6 H;  2OQ0 A;  3CCU A;  2VL6 A;  5D14 A;  4A3D H;  1N32 L;  3H91 A;  4DV7 Q;  4LFB Q;  1IHZ A;  1KNA A;  3X3N A;  1VF5 C;  4JI1 Q;  1HFG A;  4AH6 A;  1FL0 A;  1EOT A;  4GN3 B;  4Y7N B;  2D9U A;  5HY6 A;  2IL8 A;  2A74 C;  1EIH A;  4A3L H;  3M3Y H;  1Y14 B;  5IY0 A;  3H3V C;  1LT6 D;  2F0K A;  2R6G A;  3NEN A;  4IPC A;  4K5X A;  4UAI A;  2K01 A;  1EL0 A;  3D4W A;  3H3V H;  4B3S L;  4CJ2 C;  4KN4 C;  3RD4 A;  1XX8 A;  3MFY A;  1NUC A;  1EIY B;  4A3G H;  5M3F G;  4UPA A;  2KED A;  3BZK A;  3HRZ C;  4A4I A;  5I2X A;  4OWW B;  1FGB D;  1DON A;  3G6E A;  4G7H C;  4A3J B;  1O7I A;  2Q8T A;  3S9W A;  2F0P A;  1I4P A;  2ALY B;  4KD4 A;  4C3I G;  3S15 B;  2B2Y A;  3BDL A;  4RHR A;  1H95 A;  2MNA A;  1I3Q B;  4LF6 Q;  3TEH B;  2VQE L;  1J8I A;  1Q82 C;  1Y1W G;  5LL6 S;  1G91 A;  1JJC B;  1Q46 A;  2JEA I;  2ATW A;  4B9X A;  5FLX L;  4LFB L;  4GOP A;  1I6V C;  1ET9 A;  3V2T A;  3S17 B;  1JB3 A;  3HG9 A;  5E1F A;  1WTX A;  2N3S A;  3GV3 A;  3NTH A;  1RHP A;  4A93 H;  1CQF A;  1PRT C;  4LJZ C;  4WJW A;  1SR3 A;  4K6L A;  1TXY A;  4JI4 L;  2UXB Q;  3I91 A;  3FP9 A;  3WWV A;  4FF4 A;  1A6X A;  5JPN C;  3AYH B;  3DWP A;  4G4K A;  5M3M H;  3ERS X;  3F2D A;  3VYS A;  5EKL A;  1B7Y B;  1RDP D;  2VB3 X;  1X65 A;  3O13 A;  3PIP A;  2A6E C;  2X6G A;  3DEP A;  1X3E A;  4M8A A;  3I55 A;  1YVC A;  1AEX A;  4CKE A;  4BY1 H;  5M5X B;  1GOZ A;  1NTG A;  4BXX G;  2E2H B;  1Y8N B;  3Q0A A;  1PV4 A;  2CW0 C;  5C4X H;  4ABN A;  2B8F A;  1SFO B;  5C0X H;  3EBE A;  4UP9 A;  4EQN A;  1KD1 C;  1J5E Q;  1RIP A;  4FXG C;  4HCS A;  2A1A A;  1V1P A;  3BZD B;  1HPC A;  3D4D A;  4HIK A;  2O5I C;  3KF6 B;  3TBI B;  1PZI D;  1VCI A;  3C3L A;  1LYL A;  2K75 A;  2OEO A;  3I4N B;  4K2L A;  1HQM C;  5IGG A;  1QZG A;  2NVQ H;  2Q8R E;  2UXB L;  2QCP X;  1ROD A;  1CKN A;  1SE8 A;  4CDD C;  3RN5 A;  3M7N A;  4LF9 L;  1VF7 A;  1HNZ L;  1CSP A;  2EY6 A;  4C3J H;  5K36 G;  2G9D A;  1TWA H;  1RCV D;  1SMY D;  2F52 A;  2F3W A;  2IY5 B;  1WTR A;  5EPJ A;  2JA8 H;  3Q24 A;  3VYU A;  4GS3 A;  5GQO A;  2BA0 A;  2B2U C;  1XNQ Q;  5COY A;  4JI8 Q;  4LWC A;  1XMO L;  5FK9 C;  4DR7 L;  1ML0 D;  2HIX A;  2ZXR A;  3S14 H;  2F4I A;  3KK7 A;  1XNR L;  5CV6 A;  3M4Q A;  1Q1B A;  1IW7 C;  1PZK D;  2CVR A;  3OMC A;  4LUV A;  1RJT A;  3K8A A;  5EPK A;  1P8L A;  3BVG A;  1N33 Q;  4BBS H;  5IP7 H;  4PNY A;  3CC4 A;  4JI6 L;  1MJE A;  3VR3 A;  5BR8 L;  2Y0S G;  4N8X 1;  3K81 C;  4CHT B;  1OXU A;  3ICE A;  2A69 D;  1S5C D;  2K32 A;  3A5U A;  2Y0S E;  2Z9H A;  3D6W A;  4ODG A;  4JI2 Q;  3QG1 A;  3RZO B;  2MHV A;  1FNV A;  1IBM Q;  1NCV A;  4JBM A;  2RDH A;  1ASZ A;  1LT3 D;  3AFQ A;  4GN5 A;  4PG3 A;  2G9H D;  2E5L L;  3S16 H;  2HIV A;  5EKI A;  1DZ1 A;  1V1Q A;  2DJG C;  1B2T A;  1KIX A;  1STN A;  5IP9 G;  5L37 A;  1ONL A;  2E75 C;  4B3R Q;  4OO1 G;  1NSN S;  3KF8 A;  2HHH Q;  3MEF A;  1C9O A;  1D5X C;  2RDG A;  2AKW B;  3I3C A;  3WDN A;  4BWG B;  4NDX A;  2F0G A;  2CH4 W;  3BDO A;  1SE4 A;  3SHL A;  4DR6 L;  2ZJQ A;  1DXM A;  3E0J A;  2FXQ A;  5I6Y A;  4V0B A;  4X66 L;  4DR2 Q;  1GJX A;  2RCN A;  4B9W A;  3I2Z A;  4APV A;  4MNO A;  5AJ3 L;  2UU9 L;  4IJL A;  1TII D;  4YCU A;  2ZT9 C;  1NE3 A;  4BBR B;  3SK8 A;  4GNX A;  1FNW A;  5C3X A;  1C48 A;  4RH6 A;  4RFB A;  1YJ9 A;  4LF4 Q;  1D7Q A;  1WCM G;  4JI2 L;  3E0E A;  1DD2 A;  4X62 Q;  4S3S A;  1JC7 A;  5LMN W;  4CKC A;  2Z4I A;  4DV4 Q;  2UUA Q;  1T9H A;  2LKV A;  4B3T Q;  3GTG B;  1PZJ D;  4DU9 A;  1VQN A;  4KV6 A;  1PYW D;  2PCF B;  2AHO B;  2QW7 A;  4KI0 A;  2JA5 G;  4XT1 B;  2XWB B;  2Z8L A;  1WOC A;  1FVI A;  5NUC A;  1STA A;  2R93 G;  2CH4 A;  1B44 D;  2DGY A;  3A8I E;  3OHX C;  1BUV T;  5CR3 A;  3G4S A;  2JN4 A;  4QIW E;  5I6W A;  2PNR C;  4HTH A;  3TRE A;  5CBA E;  5JOB A;  1CQV A;  2JA6 B;  3QJY A;  3DWA A;  4HMI A;  3GV6 A;  3TS0 A;  1VQP A;  2NTS A;  3FDT A;  1X3G A;  4DR2 L;  2EYF A;  2LS0 1;  5IYB G;  2OT2 A;  2HQL A;  2JSO A;  3ULJ A;  1TWF H;  2F0U A;  4A3E H;  1E2V A;  3LGJ A;  3RN2 A;  3F8T A;  4HJ5 A;  1EYD A;  3QR8 A;  4BS9 A;  3DM3 A;  4LF4 L;  5J22 A;  4AQY L;  1PFM A;  1PMR A;  1HZC A;  4A3F B;  1GVP A;  1YNX A;  3K0X A;  4JBW A;  2IJ0 A;  2WAQ E;  1PTO C;  3ERQ A;  1LO5 D;  3M4O H;  2L0C A;  3Q23 A;  1XMQ L;  1PTO H;  2HDL A;  2KHJ A;  2F03 A;  1B50 A;  1C4Q A;  2VQF L;  1SAP A;  1STY A;  3UE0 A;  2NUC A;  1TKW B;  3LNN A;  1TWG H;  3HOU B;  2F0F A;  5FLM H;  2VUM G;  2B63 B;  3CME A;  3PUY A;  1I50 H;  3OIQ A;  4JBK A;  1GHK A;  1DCZ A;  2PQE A;  4QF4 A;  4QUF A;  2PQA B;  4CBV A;  1E2Z A;  4A3I H;  5FLX c;  1QVG A;  3PQI A;  1T5X D;  5KEE A;  5M9O A;  4MTN A;  4OL7 A;  3EFX D;  4KHV A;  1STB A;  3J81 j;  1N34 Q;  1NNX A;  2HD3 A;  4LK1 C;  3U50 C; 
#chains in the Genus database with same CATH homology
 5J39 A;  5CV4 A;  1BDO A;  1EY5 A;  3AMU A;  3QO2 A;  5ELC A;  5CC4 A;  2IPK D;  1HFN A;  1ENC A;  4ZRZ A;  2WB1 B;  4WRD A;  2KCN A;  3KBG A;  1PRT F;  2QKI C;  4Q0F A;  3L9A X;  4BY1 B;  1LTG D;  1Y8O B;  1O80 A;  3K58 A;  2RDF A;  2HCC A;  5T1I A;  5KIX A;  1LT5 D;  3MTS A;  1LTS D;  5J1Z A;  4XQN A;  2F0D A;  5JEA J;  1HCZ A;  1SNC A;  4IUP A;  2RA4 A;  2NB0 A;  3GTL B;  2NVQ B;  3R93 A;  1EQT A;  1JE4 A;  5JJZ A;  3RMH A;  1EQV A;  1OXS C;  5ELF A;  1G2T A;  5D65 A;  3MXU A;  4K6D A;  1I4Q A;  3VR4 A;  2JA8 B;  4DFA A;  1SBB B;  3T4A C;  3K5N A;  4U67 3;  2EYP A;  4PMW A;  2SNS A;  1O7Z A;  2F0I A;  1HXY D;  5A35 A;  3I4M B;  3S14 B;  4MIU A;  4A3B B;  3K0Y A;  3R2T A;  4PQX A;  3ND8 A;  4BBS B;  2MGS A;  2BDO A;  1F77 A;  3TP7 A;  5JPM C;  2F3V A;  3S1Q B;  1A3T A;  1U4M A;  2F0S A;  3S1R B;  2R7Z B;  1ZYR C;  5I4D A;  1R9T B;  3QIA A;  2E2I B;  2KEC A;  4A3K B;  3ZYY X;  3S16 B;  3PV0 A;  3K7A B;  4AYB B;  2J7Z A;  5IGD A;  3SEB A;  3A54 A;  2X6L A;  1B1Z A;  1HHV A;  4IFD I;  5HUR A;  4F8M A;  1SXT A;  3TP5 A;  1SYF A;  3H94 A;  2K5D A;  5COR A;  2SEB D;  3K6O A;  4KN7 C;  1EY0 A;  1JOR A;  4WFN 3;  1B9M A;  2EJF C;  1MSH A;  2B2U A;  3D31 A;  3T56 B;  1EY6 A;  3VR6 A;  2K1B A;  2IX1 A;  2JA7 B;  2L55 A;  4FF1 A;  2HQE A;  2BA1 A;  4XIG S;  3K57 A;  2B39 A;  3J80 E;  2KHS A;  4H44 C;  2NTT A;  1KDC A;  4L8J A;  2KEE A;  2PMZ B;  1SJE D;  3PMF A;  4X3T A;  1Y69 U;  1H9S A;  5A2Q E;  2A5H A;  3CQZ B;  2JE6 I;  3OOC A;  4F87 A;  4K5V A;  2DY8 A;  1RTN A;  1M8A A;  1H9J A;  1WVL A;  4QMG A;  3WOE A;  4XXE A;  3SK4 A;  1HQR D;  2IX3 A;  2L9H A;  3PO3 B;  4OO1 H;  3S1M B;  2F0L A;  1A3U A;  4XQJ A;  2KOL A;  2DN8 A;  3GP7 A;  4JK1 C;  2NN6 I;  2PZU A;  3OIP A;  4KKT A;  2EYM A;  2B2V C;  3X3M A;  1E0B A;  2FHT A;  1PTO F;  3I73 A;  3WOF A;  3C2P A;  1F2M A;  1F9R A;  3MXG A;  1F9P A;  4DK1 A;  3NUC A;  2H1E A;  3MEH A;  1JOQ A;  1V1P B;  3Q6S A;  1F2L A;  3S1N B;  1EY8 A;  3R8B A;  1GHJ A;  2L1B A;  2A73 B;  1Q3L A;  1VDZ A;  2X69 A;  2FMC A;  3UI2 A;  3EVQ A;  2B2W C;  2EYL A;  2BE5 D;  1EY7 A;  1BCP C;  1BR9 A;  3FKI B;  5C4J B;  1A2U A;  3KLR A;  5DM7 3;  1NR4 A;  3H09 A;  4RGN A;  3NSW A;  2NVX B;  3GTO B;  5JEA G;  3P20 A;  3VA7 A;  3H0G B;  2BDN A;  3M4Y A;  4KMU C;  2SNM A;  1L0X B;  1FR3 A;  1ENA A;  1ZXT A;  1SYG A;  1SNO A;  2OXP A;  2H4O A;  2C5C A;  2JEB I;  3NK9 A;  5IGB A;  1O78 A;  3R2I A;  4PMC A;  1D2B A;  1KLG D;  5FOB B;  2DNC A;  1JQY D;  5IT9 E;  3S2H B;  1J9O A;  2K7V A;  3FMC A;  5C0X I;  1SNM A;  2NWG A;  5M5W B;  3A7L A;  1V8Q A;  3RZD B;  1ENF A;  3MXN A;  2ICE C;  3I90 A;  3OWF A;  2Z4H A;  1K83 B;  4X3K A;  1EWH A;  3TZU A;  4HED A;  3NWT A;  1U4L A;  1GXD C;  1HTL D;  2BOS A;  1PXU A;  3BVZ A;  3I4L A;  4H13 C;  4HCE A;  2N55 A;  3NPP A;  4HR7 B;  2B2T C;  4DXF A;  1HA5 A;  4EQP A;  1Y1V B;  1YNJ C;  4FO2 A;  1HTP A;  2F1M A;  3IAY A;  3DWQ A;  3OMG A;  4XT3 B;  5BN3 A;  1JWM D;  1W6J A;  5C3E B;  1EEF D;  4DAY A;  1TS2 A;  1F2Z A;  3HOZ B;  2IW3 A;  3W3A A;  5E4X A;  1UEA B;  2CHB D;  2PW5 A;  4QCL A;  4F88 A;  1UAP A;  4C1N I;  3TN2 A;  2SDF A;  4NMZ A;  4RGT A;  1U9R A;  4O1N A;  1JOO A;  5IIF A;  3K5O A;  3BS1 A;  2FIN B;  1GUS A;  1S5D D;  3EA6 A;  2L11 A;  2K33 A;  3PO2 B;  2A68 D;  4IUN A;  4C3H B;  1CFM A;  3VA5 A;  4K2K A;  3ITP A;  3TSS A;  3Q22 A;  4OGQ C;  3VR5 A;  3J80 L;  1EZ6 A;  1FNU A;  1BXT A;  1NAP A;  3VR2 A;  1ESR A;  1TS4 A;  2XNA C;  5A2Q L;  4A3M B;  1CA5 A;  4QUC A;  2O4X A;  5EBC A;  1XTC D;  2XVS A;  3NE5 B;  1D5Z C;  1II3 A;  1S4Z A;  3T16 A;  4N9T A;  2WKD A;  5DNF A;  3SK5 A;  3CRL C;  2E74 C;  3ONA B;  4DNT B;  2HCI A;  1AFP A;  4TQU S;  3LWU A;  5IOC A;  1QB5 D;  5C3W A;  1D1K A;  3HOW B;  4A3D B;  1BO0 A;  3T13 A;  5HGT A;  4TRD A;  5JVG 3;  4NP5 A;  3LWE A;  4DA2 A;  1DM0 B;  2I46 A;  3TZD A;  1KNE A;  3M3Y B;  1EYA A;  1EU3 A;  3NBH A;  1LAB A;  4J8Q A;  4XDX A;  4A3G B;  5ELE A;  5EQ0 A;  2A6H D;  1BBX C;  1SYE A;  4RGM A;  5LL6 X;  2E2D C;  4K8I A;  1ILQ A;  1T5E A;  4QIW B;  3HOV B;  3QWN A;  2MPM A;  2DY7 A;  2NBF A;  3A56 A;  1YNN D;  3DUZ A;  4Z9C B;  1OXT A;  1IYV A;  4DGZ A;  4ZK9 B;  3V05 A;  2OF1 A;  3TP8 A;  4O42 A;  5DEH A;  1I4R A;  4A93 B;  3T51 B;  2QDB A;  1PRT B;  1STE A;  4G7O C;  1RKN A;  2WAQ B;  5C4H A;  5T1G A;  2AWN A;  2WKC A;  1BCP F;  3EJI A;  5M3M B;  5KNB A;  1TQO A;  3N52 A;  3MZ5 A;  3KLS X;  4RWS C;  2J0T D;  2FJ2 A;  4PMB A;  3PUW A;  4NKL A;  2VUM B;  1O7L A;  2AUJ D;  3NTK A;  5C4X B;  2B2V A;  2M00 A;  2D2C C;  2YYZ A;  4V19 0;  3NTI A;  1SSO A;  1S5E D;  2O2L D;  4P2C B;  1SMY C;  5IT9 L;  1X32 A;  4FF3 A;  5JVH 3;  3OW7 A;  1WTO A;  2LMC B;  5IGC A;  1V1O A;  2F0W A;  1LTR D;  4XYO A;  4XTC S;  2VB2 X;  1M4V A;  5CGK A;  3DXJ C;  3CHB D;  4C3J B;  3J81 E;  4KD3 A;  1TWA B;  3MC0 B;  2TSS A;  3D4R A;  1LTI D;  4F7X A;  4R8I A;  2B2W A;  3DHQ A;  2B8G A;  1HUM A;  1A15 A;  3VYR A;  3F2U A;  4BA1 I;  1PRT D;  5C4Z A;  4ZLT F;  4DNR B;  5JEA H;  2LY7 A;  5FO7 B;  3GD7 A;  5TSS A;  2D62 A;  4G7Z C;  3NQT A;  3A55 A;  2RBM A;  1Z7T A;  1LLR D;  5IOD A;  1H9S B;  3L3O C;  1G8Z D;  2A6E D;  4ZUI A;  1OO9 B;  3NP8 A;  5EBD A;  3HP3 A;  2RSN A;  3C1F A;  1E2W A;  1WD0 A;  1L0Y B;  1OXV A;  3P75 A;  5G3L F;  4FF2 A;  2CW0 D;  2WIN B;  3HS0 C;  2MP1 A;  2F0T A;  2KUM A;  1D6E C;  5KRU A;  2LFN A;  2NZ1 D;  4KTA A;  1GUN A;  4IUV A;  2EJM A;  4ZKB B;  3JAM E;  2PW7 A;  4DF7 A;  2E76 C;  4R9W A;  4DAV A;  4FNF A;  1DOM A;  3MVV A;  5K36 H;  5ISR A;  1EWC A;  1TY2 A;  4H0L C;  1QOH A;  1B53 A;  3NQI A;  3CU7 A;  3HKZ B;  2MUY A;  1RTO A;  4RKL A;  3PUV A;  5EJW A;  1ZKO A;  2B2T A;  4RCN A;  2ZXO A;  1EZ8 A;  1LAC A;  2F0H A;  1IW7 D;  3D8G A;  1D1I A;  2KQ3 A;  1MBY A;  4ME5 A;  2HDM A;  4LMQ D;  2EYJ A;  1WTW A;  4J6H A;  5EPL A;  4TSS A;  1QJO A;  1JIC A;  1TWF B;  1VMC A;  2F0Q A;  4A3E B;  2AQ1 B;  1RD9 D;  1GUG A;  3E6Z X;  3P1H A;  1CZW A;  3TDQ A;  3D3R A;  3G7L A;  1FD7 D;  4X3S A;  3M4O B;  2EXZ A;  1PTO B;  1JR0 D;  1QE6 A;  4HSP A;  3C1E A;  3OSO A;  2BCO A;  3BYY B;  2MJ8 A;  1TWG B;  3N6R A;  1I50 B;  2M9V A;  5LHY 1;  4OO1 I;  3URY A;  1CM9 A;  3DEO A;  4A3I B;  3BVM A;  1X3Q A;  4QB4 A;  4TKO B;  3MA2 B;  2ICI A;  1QIL A;  5ELB A;  3K5M A;  5C6A A;  1RF2 D;  4K14 A;  5CV9 A;  1I4G A;  1O7Y A;  2N88 A;  4IUR A;  2QIL A;  3AU7 A;  1AP0 A;  1MD2 D;  4YIJ A;  3U9O A;  3KLS A;  4ULL A;  2NYZ D;  3S2D B;  3NHH A;  4C2M B;  3R3O A;  2K6A A;  4G57 A;  5CV8 A;  1G6Z A;  1TU2 B;  1AZP A;  2ID0 A;  2F0V A;  2VXW A;  2PZW A;  2D5D A;  1JCK B;  5M3F B;  4HSV A;  3C46 A;  2AWO A;  3MFG A;  3ERO A;  5CV5 A;  4KHZ A;  2EE1 A;  1PTO D;  5C0X J;  1F9Q A;  5IGE A;  1R4P B;  3OPO A;  1TS5 A;  1LT4 D;  4C3I B;  4RGO S;  3GTJ B;  1KAA A;  2PZT A;  2GA4 B;  3J81 L;  4H7B A;  1CHP D;  4RCO A;  1Y1W B;  1SNQ A;  1CK1 A;  3I70 A;  1EYC A;  1DYQ A;  3TME A;  1A2T A;  4DN4 M;  1WTQ A;  1ET6 A;  5KNC A;  1F9S A;  1UUP A;  2ZXP A;  2PPB C;  3FEW X;  1IL8 A;  2O5J C;  3FVQ A;  1MGS A;  1ICW A;  4KJN A;  4IFD G;  1WD1 A;  5DAU A;  1XYI A;  2F0O A;  2FMM A;  3E5S A;  1S5B D;  1DOL A;  3W2D A;  2KJX A;  3NBI A;  3A8J E;  2WAC A;  4EVO A;  3SVM A;  2L12 A;  1SEB D;  1F2Y A;  1Q12 A;  3QOL A;  4KJO A;  4RAU C;  2F0J A;  2K28 A;  5E4W C;  4C56 C;  1BNZ A;  4RHS A;  5I9O A;  1STG A;  2XRQ D;  1QNK A;  1CTM A;  1Q90 A;  2K5W A;  3DMU A;  3BDC A;  1EY4 A;  3JAM L;  2E2J B;  4C3H G;  2J4X A;  4RKB A;  1TT2 A;  5FO8 B;  1GUO A;  1H9K A;  3EQL C;  4FXK C;  1CZG A;  1QWY A;  3IL8 A;  4IAL A;  4OIK A;  1JWS D;  1CA6 A;  1Q8I A;  3T53 B;  5KND A;  4E6I A;  5D3I B;  2JYO A;  2WII B;  2IWH A;  1XWE A;  1SE2 A;  2YU9 B;  3FPU B;  4ILW A;  4BA2 I;  2EYO A;  2Z1C A;  4FP5 D;  3GTQ B;  2Y0S B;  1QNU A;  3H6M A;  1Z47 A;  2NN6 G;  4C1N K;  1EY9 A;  2IX0 A;  3CRK C;  2R3Z A;  2QEJ C;  4NW2 A;  4I65 A;  1ZYR D;  4FYD A;  1HA6 A;  4DAP A;  4MHE A;  3P7J A;  1TS3 A;  1LV9 A;  3RUZ A;  2WV6 D;  2RQX A;  3NWS A;  5CYU A;  4L63 B;  3SXH A;  2F0E A;  1BQQ T;  3I8Z A;  3QOJ A;  4IUU A;  3CKI B;  3SE0 A;  5IGF A;  1C8C A;  4GZY C;  2XIW A;  3SR1 A;  5I2Y A;  2L5T A;  2SOB A;  4ID6 A;  2I07 B;  1KDB A;  1BOS A;  2B2Y C;  4KY5 A;  5JAV A;  5KYI A;  1PDQ A;  1WCM B;  1NR2 A;  1K8M A;  4HAE A;  4ZQ3 A;  4Q5V A;  2C9O A;  1B9N A;  2XSC A;  5BN4 A;  2BE5 C;  3HEJ A;  1U4R A;  2JA5 B;  5M5Y B;  2QF7 A;  1SE3 A;  2R93 B;  2L4N A;  4I7Z C;  5C5M A;  1IYU A;  1G2S A;  1W6K A;  3OWE B;  3PIO 3;  1A3V A;  5EKK A;  4KK7 A;  2JXM B;  1MSG A;  3VYT A;  4DXG A;  4IN3 A;  2F0N A;  2RSO A;  1I6H B;  1QCB D;  4DK0 A;  3MXP A;  2RVL A;  1BCP B;  4IUT A;  3NXW A;  4J1M A;  2Q8I B;  3G6J B;  3KBX A;  2DNE A;  3MHB A;  2F0M A;  3J7A V;  4EGV A;  4KY6 A;  4KKS A;  1UNS A;  5C0X G;  1K8O A;  4ZKC B;  2XN9 C;  1JWU D;  1SYB A;  4M1U B;  2VNU D;  1EU4 A;  1U4P A;  2K05 A;  3I72 A;  4XYQ A;  4CJ1 B;  2EZV A;  5BN5 A;  4IZ8 A;  2ENB A;  1EFI D;  1JOK A;  1H9M A;  3PUX A;  1QG7 A;  4FVM A;  3LX0 A;  2NVY B;  4C3J G;  2EY2 A;  3J7Y W;  2XRS D;  5KGU A;  2JP1 A;  1LTB D;  1IKL A;  4ZAI A;  3MAQ A;  1MI2 A;  3AB9 A;  1AN8 A;  2PO4 A;  5FLX E;  1XXG A;  3M85 A;  3GTP B;  4RA8 A;  1DJR D;  1SJH D;  4B08 A;  1PLF A;  2CQA A;  3IKJ A;  5AFW A;  4N9P A;  3DM1 A;  3HOX B;  3BYT B;  1SDF A;  1CHQ D;  3A8K E;  4LAA A;  5F2D A;  2A69 C;  4CKB A;  2HUG A;  1ZEQ X;  2EPB A;  1WTV A;  1FYC A;  1B4O A;  3HZX A;  4ZYS A;  2AQ2 B;  1GUT A;  4XQQ A;  1ESF A;  2EY5 A;  3M7G A;  2KCC A;  1B3A A;  1BCP D;  1WTP A;  1GUW A;  5FKA C;  3IFD A;  3GTM B;  2V4D A;  2XWJ B;  3SK6 A;  1OXX K;  2EY1 A;  2A68 C;  5D3D A;  3QB3 A;  4L6T B;  1CI3 M;  4HN7 A;  4K8J A;  4IFD J;  2K04 A;  4HMJ A;  3J7A F;  1KLU D;  1I4H A;  1KDA A;  5CMD A;  1TVX A;  4IQZ A;  4KKU A;  5KYL A;  1PFN A;  1KTK A;  1SYD A;  1LTT D;  4BY7 B;  2NVT B;  2KA7 A;  2PYK A;  4R8N A;  2WP8 J;  2TMP A;  3D6C A;  1Q1E A;  5FO9 B;  3A7A B;  2EJG C;  1SNP A;  2FFK B;  1X3P A;  4WOR A;  3GO5 A;  2EVB A;  4OIJ A;  4IFD H;  1AZQ A;  2M2L A;  3V96 A;  4IUQ A;  1S5F D;  3BG3 A;  2K03 A;  3U9S A;  3HOY B;  1CT1 D;  1HUN A;  5C5L A;  2K5Q A;  2EOT A;  3SDZ A;  3PUZ A;  1AW7 A;  1YNJ D;  1R4Q B;  3KUP A;  3L7Z C;  2EDG A;  1IKM A;  2A6H C;  4OHJ A;  4UDU C;  4X3U A;  5G3L D;  1TY0 A;  1SND A;  2R92 B;  5ELD A;  2RKS A;  4CGY B;  4CJ0 B;  1PFB A;  3HGB A;  4PV1 C;  1G29 1;  3RLF A;  1Y8P B;  1DOK A;  1H9R A;  4MN3 A;  3TP6 A;  1TWC B;  5CBE E;  5E3F A;  1YNN C;  1EIG A;  4FXD A;  2IT1 A;  4KY7 A;  5K5P A;  1VMP A;  3IFT A;  2EYH A;  1STH A;  5I9P A;  3K5L A;  3GTK B;  3ND9 A;  1ILP A;  2AQ3 B;  3MWY W;  1D5M C;  1I4X A;  1KAB A;  2KVM A;  1TWH B;  3FPP A;  2R61 A;  3FRP B;  4U68 A;  2NN6 H;  5EGT A;  1V43 A;  5C44 B;  4ZUJ A;  5DM6 3;  1EEI D;  1Z6H A;  1HRJ A;  1SYC A;  2AUK A;  1BF4 A;  3PIP 3;  4K5W A;  1TR5 A;  3GQB A;  3K59 A;  4EQO A;  1LTA D;  5CV7 A;  5D14 A;  3H91 A;  1IHZ A;  1KNA A;  3X3N A;  1VF5 C;  1HFG A;  1EOT A;  4Y7N B;  2D9U A;  2IL8 A;  2A74 C;  1EIH A;  3H3V C;  1LT6 D;  2F0K A;  2R6G A;  4K5X A;  4UAI A;  2K01 A;  1EL0 A;  3D4W A;  4CJ2 C;  4KN4 C;  3RD4 A;  1XX8 A;  3MFY A;  1NUC A;  2KED A;  3HRZ C;  5I2X A;  1FGB D;  1DON A;  4G7H C;  4A3J B;  2Q8T A;  3S9W A;  2F0P A;  1I4P A;  3S15 B;  4KD4 A;  4C3I G;  2B2Y A;  3BDL A;  4RHR A;  1I3Q B;  1J8I A;  5LL6 S;  1G91 A;  2JEA I;  4B9X A;  5FLX L;  1I6V C;  1ET9 A;  3V2T A;  3S17 B;  1JB3 A;  3HG9 A;  5E1F A;  1WTX A;  3GV3 A;  3NTH A;  1RHP A;  1CQF A;  1PRT C;  4LJZ C;  4WJW A;  4K6L A;  3I91 A;  4FF4 A;  1A6X A;  5JPN C;  3DWP A;  4G4K A;  3VYS A;  5EKL A;  1RDP D;  2VB3 X;  3O13 A;  2A6E C;  2X6G A;  3DEP A;  4M8A A;  1AEX A;  4CKE A;  5M5X B;  1GOZ A;  2E2H B;  1Y8N B;  3Q0A A;  2CW0 C;  4ABN A;  2B8F A;  1SFO B;  5C0X H;  4EQN A;  4FXG C;  4HCS A;  1V1P A;  3BZD B;  1HPC A;  3D4D A;  2O5I C;  3TBI B;  1PZI D;  1VCI A;  3C3L A;  2OEO A;  3I4N B;  4K2L A;  1HQM C;  5IGG A;  2Q8R E;  2QCP X;  1ROD A;  3M7N A;  1VF7 A;  2EY6 A;  5K36 G;  2G9D A;  1RCV D;  1SMY D;  2F3W A;  1WTR A;  5EPJ A;  3Q24 A;  3VYU A;  2BA0 A;  2B2U C;  5COY A;  5FK9 C;  1ML0 D;  2ZXR A;  2F4I A;  3KK7 A;  5CV6 A;  1Q1B A;  1IW7 C;  1PZK D;  2CVR A;  3OMC A;  1RJT A;  5EPK A;  3BVG A;  4PNY A;  3VR3 A;  4CHT B;  1OXU A;  2A69 D;  1S5C D;  2K32 A;  3D6W A;  4ODG A;  3QG1 A;  3RZO B;  2MHV A;  1FNV A;  1NCV A;  2RDH A;  1LT3 D;  2G9H D;  5EKI A;  1DZ1 A;  1B2T A;  1STN A;  1ONL A;  2E75 C;  4OO1 G;  1NSN S;  3KF8 A;  1D5X C;  2RDG A;  3I3C A;  3WDN A;  4BWG B;  4NDX A;  2F0G A;  3BDO A;  1SE4 A;  3SHL A;  1DXM A;  3E0J A;  5I6Y A;  4V0B A;  1GJX A;  4B9W A;  1TII D;  2ZT9 C;  4BBR B;  3SK8 A;  1FNW A;  5C3X A;  1C48 A;  4RH6 A;  4RFB A;  1DD2 A;  4S3S A;  1JC7 A;  4CKC A;  2Z4I A;  2LKV A;  3GTG B;  1PZJ D;  4DU9 A;  4KV6 A;  1PYW D;  2PCF B;  4KI0 A;  4XT1 B;  2XWB B;  2Z8L A;  5NUC A;  1STA A;  1B44 D;  3A8I E;  3OHX C;  1BUV T;  5CR3 A;  5I6W A;  2PNR C;  4HTH A;  5CBA E;  5JOB A;  1CQV A;  2JA6 B;  3QJY A;  3DWA A;  4HMI A;  3GV6 A;  2NTS A;  3FDT A;  2EYF A;  2LS0 1;  2OT2 A;  2JSO A;  2F0U A;  1E2V A;  1EYD A;  4BS9 A;  5J22 A;  1PFM A;  1PMR A;  4A3F B;  4JBW A;  2IJ0 A;  1PTO C;  3ERQ A;  1LO5 D;  2L0C A;  3Q23 A;  1PTO H;  2HDL A;  1B50 A;  2F03 A;  1C4Q A;  1SAP A;  1STY A;  2NUC A;  1TKW B;  3LNN A;  3HOU B;  2F0F A;  2B63 B;  3PUY A;  3OIQ A;  1GHK A;  1DCZ A;  2PQE A;  4QF4 A;  4QUF A;  4CBV A;  1E2Z A;  1T5X D;  5KEE A;  5M9O A;  4OL7 A;  3EFX D;  4KHV A;  1STB A;  4LK1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...