1IYUA

Lipoyl domain of pyruvate dehydrogenase complex, nmr, minimized average structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
79
structure length
79
Chain Sequence
b'SEIIRVPDIGGDGEVIELLVKTGDLIEVEQGLVVLESAKASMEVPSPKAGVVKSVSVKLGDKLKEGDAIIELEPAAGAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROLIPOAMIDE ACETYLTRANSFERASE COMPONENT OF PYRUVATE DEH
publication title Three-dimensional structure in solution of the N-terminal lipoyl domain of the pyruvate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
molecule tags Acyltransferase
total genus 5
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1996-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1iyuA00
1VF5C 2AWOA 2L5TA 3OPOA 1Z6HA 2B8FA 1VDZA 2E76C 3I73A 2E74C 2A6EC 2BA0A 4IQZA 3T51B 1H9KA 3A7AB 2A68D 4JK1C 2A6HD 4XTCS 3ND9A 3DXJC 4H0LC 3GD7A 3I72A 1I6VC 2YYZA 1ZKOA 3VR3A 1Q1EA 5K36G 1ONLA 3CRLC 1HTPA 3KLRA 3PUYA 1H9SA 1TU2B 3VR5A 2KA7A 5KNCA 1PMRA 2BE5C 1YNJC 3TZUA 2BA1A 2DN8A 1E2ZA 2NN6G 4KKUA 2V4DA 1Q12A 2IT1A 2D5DA 2JXMB 2NN6H 2R6GA 3A8IE 3SDZA 1K8OA 4KI0A 1K8MA 1OXSC 2CW0C 3PUVA 5KNDA 2PCFB 3P20A 4TQUS 5A35A 4G7ZC 2DNEA 1G291 4KHZA 4OGQC 1E2VA 3VR4A 1HPCA 2EVBA 3M4YA 4LJZC 2ZT9C 3PUZA 1CFMA 1DXMA 3BG3A 3GQBA 3QJYA 4XIGS 2B8GA 2A6ED 4BA2I 4OO1G 1GUGA 4OO1H 3PUXA 1QJOA 2E75C 2AUKA 3OOCA 3W3AA 3M85A 1HCZA 2NN6I 1GUNA 3FMCA 3A8JE 5K36H 2PNRC 1FYCA 1LABA 1Q1BA 4KN4C 1Y8PB 1Y8NB 1YNNC 3VR6A 4DK0A 4GZYC 1GHJA 1VCIA 1H9JA 3A8KE 3FPPA 2AUJD 3QIAA 3L7ZC 3LWUA 1OXXK 3BDOA 5BN3A 4I7ZC 1FR3A 2A68C 2EDGA 1EWHA 1IW7D 4IFDG 3ND8A 2EJMA 1Z7TA 4IFDH 1V8QA 1H9MA 3A7LA 3D31A 2O5IC 2A69D 5C0XG 1CI3M 4TKOB 2K33A 5C0XH 1V43A 2D2CC 2JEBI 2K7VA 4DK1A 2Q8IB 1A6XA 3M7NA 3LNNA 1IYVA 1H9RA 4H13C 1BDOA 1CTMA 2QF7A 3MXUA 1SMYC 2K32A 1Y69U 5KNBA 1B9MA 1GUTA 1TKWB 1OXVA 3I4LA 3IFTA 1ZYRC 1IYUA 1O7LA 4PV1C 3T56B 4KMUC 3HGBA 2LMCB 1GJXA 2BE5D 4H44C 1B9NA 4JBWA 5BN4A 1E2WA 1O78A 1Q90A 2JE6I 4KKSA 2A6HC 3VR2A 4HR7B 3WDNA 1OXTA 3EQLC 3H94A 2EJFC 3U9SA 2O5JC 3AB9A 4DNTB 1HQMC 3D4RA 3SE0A 5BN5A 3N6RA 3VA7A 3CRKC 3MFYA 4DNRB 2D62A 3QG1A 4G7HC 3IKJA 4KKTA 3NE5B 3PUWA 1DCZA 1GUSA 2KCCA 2DNCA 4KN7C 2F1MA 4RCNA 1GHKA 1Y8OB 4L8JA 3T53B 1GUOA 1T5EA 5JEAG 2EJGC 1IW7C 2BDOA 1VF7A 1OXUA 3RLFA 5JEAH 4G7OC 2PPBC 1DD2A 1H9SB 3OW7A 2JEAI 3PV0A 1LACA 4LK1C 2A69C 4BA1I
chains in the Genus database with same CATH superfamily
1PYWD 2HHHL 4HJ7A 1Z6HA 4JYAL 3NSWA 2WAQG 3R93A 3TS0A 1H9KA 4A3BB 2FMMA 4WORA 1F2YA 1JQYD 2K5DA 2UUBQ 4HMIA 4DR7Q 1KC8C 3T4AC 1I50B 2HD3A 1BKBA 1DONA 1WTVA 2NVYB 2Y0SE 4KLKA 2TMPA 5L37A 1YHBA 1HA6A 2PQAB 1KAWA 1NAPA 1G6PA 1EYDA 4ZYSA 1VQ9A 3F2CA 3Q6SA 3S16B 1F9PA 3RZOB 4R4QA 3QJYA 2EXZA 2K5VA 2O4XA 5FLXL 4YCVA 2I07B 2RSOA 1B70B 3TP8A 3CU7A 4LF7L 1ICWA 3PO2G 3HOXG 3G7LA 4NXNL 1YJ9A 1BNZA 2IL8A 4IOCA 1AE2A 5ELBA 3BZCA 3OTOQ 3DUZA 3A8KE 4CBVA 4DV6L 3QIAA 3K59A 1LTRD 1QE6A 4EGVA 1KHIA 5JPMC 4JI0L 3GTPB 1HNZQ 1RODA 1N34Q 1HR0Q 1Y1WH 2KJXA 4DR2Q 1FGBD 1YVCA 2MJ8A 3U58A 1VQAA 2L4NA 4H13C 2L1BA 3KYHC 2I0QA 1D1IA 2ES2A 1NR4A 1PH8A 1Y69U 3CCQA 1TWHB 1YNND 2Z4HA 4A3IH 4RFBA 4A3MH 2KEEA 1B8AA 5LL6X 3PIPA 4LF9L 3K5OA 1R4QB 4YWMA 2HUGA 4R4TA 1XMQQ 2EY2A 2FFKB 2OEOA 1SYCA 2RCFA 1UUPA 3J81c 4QJFA 1P16A 1CZGA 2MFIA 4O0AA 1GVPA 2WKDA 1XPUA 1NJIC 1EY9A 2XRQD 4JV5Q 1D5ZC 1VQNA 2LKVA 1DD2A 1PLFA 5LHY1 3GTQH 1L1OB 3KK7A 4A3CG 3OW7A 2QEJC 4UP8A 5FJ8H 1U4RA 2DUDA 3HKZB 5I4DA 4K0KQ 3OHXC 1ZXTA 1VQPA 3T1YQ 3CC7A 4RGMA 4JI3Q 4LF6L 5T1IA 3PUYA 1PH7A 2AQ3B 2VXWA 5KRUA 3Q24A 1HNWL 4QGUA 4OIJA 2VNUD 1RJTA 2LXJA 4DV0L 1QUQB 1X3GA 2DN8A 3DWQA 5JJZA 3DHQA 2B2WC 1S3OA 2IT1A 2D5DA 1SROA 2BH8A 3J80i 4P71A 2VZAA 4DV7L 3P20A 4AQYQ 1E1OA 2CHBD 1LT6D 1LYLA 2KQ3A 4XIGS 1EWIA 3J7ZC 3ICEA 1JJ2A 2E75C 4DUYL 1PH9A 3KF6B 4C3HH 4DR4Q 3VR6A 3HOVB 2R93H 5JVG3 1LTSD 2BOSA 2F0FA 4IUPA 1EOVA 2VQFQ 4BY7G 1CHQD 4U68A 1STBA 3K7AH 4QY7A 1TQOA 4OWXB 2H5XA 3TP5A 3PF4A 4V190 1S72A 3D31A 4HJ5A 3T1HQ 1EEID 2MP1A 1I3QB 3K5LA 2Q8IB 4K5VA 1WI5A 3DLLA 3MC0B 4AYBG 1KRSA 5C44B 4BXXG 4IFDI 1B9MA 2GN5A 2F0LA 4A3LG 4A93B 2B63H 2K5WA 3G4SA 3CCMA 2VUMB 2BE5D 1B9NA 4LF8L 2ZM6Q 4A3EG 1NR2A 4KKSA 3GTLB 3CC2A 5E4WC 1BUVT 2JA8B 1AH9A 3S1QH 4MTNA 2R61A 2GA4B 5FLMH 1B50A 2CKZB 2A73B 2OQKA 2KCCA 3QWNA 1VQLA 3E0EA 4LFAL 1EL0A 3GTKH 2F1MA 3CF5A 1NBWA 1E3PA 2EY5A 5I6YA 1T5EA 4IOAA 1WTXA 1E7ZA 3GTJH 2NZOA 4L5TA 4DR6L 3K8AA 5LL6S 4AIMA 1PVOA 1JB7A 4A4IA 4LNQA 1N8RC 3GD7A 1RL2A 4HIKA 1H9SA 2NYZD 2F0MA 4JBKA 4DV4L 3SK4A 4YHHQ 4UP9A 4FP5D 3PO3H 2OCEA 2NWGA 4JI1L 1FD7D 3J80L 4WJWA 4KHPL 2DNEA 3M4YA 3K57A 3DEOA 3PUZA 2B3GA 3PGZA 4JI4Q 4DV1L 4RWSC 3HOWH 4N8X1 2PYKA 4L5RC 2PNRC 2UXDL 1Q1BA 4B3MQ 3I4NB 4DAYA 1YZ6A 4A3KG 4GOPC 2AUJD 1XTDA 3LWEA 2E5LQ 4PMBA 5D3IB 4IFDH 1WCMG 4LUZA 1TWGB 3OSOA 3U50C 2RDFA 1ENFA 4BY1G 5IP9H 3X3MA 5J3BA 4Y7NH 3S1MH 4C3JB 1IBKQ 2XWBB 3IRBA 4JI7L 1ZYRC 2JA7H 3H0GB 2NUCA 5NUCA 2IY5B 4JOIC 2R7ZH 4QQBX 1HA5A 4LAAA 4DR1Q 4X3TA 4A3BG 1EQRA 5DEHA 2D0OA 2I5HA 4C3IH 3NBHA 3S14B 2EYFA 4A3FH 1K8GA 1AEXA 3P75A 3OW2A 5IT9c 4RGOS 1B2TA 4ABNA 3TDQA 1SE8A 2K50A 3G6EA 4YCUA 3ERSX 1LTLA 4HN7A 1NSNS 4A75A 4GKKQ 2PI2A 5C4JH 3H3VI 1D2BA 1NMGA 4WRDA 3M3YH 2HQLA 1CK1A 3W1GA 4GN4B 4R4IA 2Y0SB 4KV6A 1RTOA 4G4KA 2R7DA 1U4PA 2ICIA 1WYDA 2ASBA 2OQ0A 4NXML 1FL0A 4I7AA 1F9QA 4PZ8A 5EPLA 1GOZA 1N9WA 4R8NA 4YY3Q 4LF5Q 2F0OA 3S24A 1LV9A 3FEWX 4R1JA 3EFXD 1AW7A 5HGTA 5IWAQ 4MN3A 1B7YB 1SE2A 3PUXA 1YJWA 1SJHD 1S4ZA 3CQZB 1GUNA 4B9XA 1GKHA 4BBSH 1Y8NB 1FNVA 1FNWA 1HZBA 2ZJRA 3GV6A 4NDXA 3S2DB 3HOZB 3STBC 1PYSB 5IOCA 1LT4D 2E2IH 5C0XG 5JOBA 2HQEA 1JOOA 4ID6A 1NE3A 1C48A 3QOLA 4X65L 2ZJPA 2MPMA 1HZAA 1GO3E 2A19A 4XQQA 2QF7A 1N36L 4X66Q 5EJWA 4BBRH 2Q2TA 1STGA 3OWFA 1QILA 3TSSA 4H44C 3HKZG 1TY0A 5AJ3Q 1QCBD 3BZDB 3EQLC 2UU9Q 4A3DB 4KY7A 1KIXA 1T5XD 4DNTB 1UAPA 1BBXC 5ELEA 1FGUA 3H3VH 2F0SA 2R3ZA 3LGJA 1J6QA 3AEVA 4RKBA 4FXDA 5M5XB 1QOHA 5JEAG 4NW2A 3MEHA 3C1FA 1WJJA 2QGQA 5HURA 1ET9A 1H9SB 2UXBQ 1Q8KA 4PNYA 1XNRQ 1VQHA 5C4XB 1SNQA 5IYDH 3OPOA 1VDZA 4ZRZA 1R9TB 3I4OA 1BCPF 2CCZA 5EQ0A 2UUCQ 1XMOQ 4TSSA 2JQOA 4DAPA 1VQFA 3HOWG 1ZKOA 5JJLA 1STAA 3HOVG 4JCVE 1G51A 2K05A 3UE0A 5M5YH 3RZDH 1PH6A 1PMRA 1IBLL 3QO2A 3CC4A 2MUYA 3JAMc 4M1UB 4L5QA 2V4DA 3PIOA 5DAUA 1PTOB 1K73C 4KHZA 1CA6A 2J4XA 4IPDA 5EBCA 1CFMA 1OO9B 1WOCA 2ZTCA 1SYGA 2F0EA 2NN6I 5C44G 5ELNA 1A63A 2CWPA 2EIFA 1WD0A 4A93G 4H02A 4JI8Q 2VUMG 4X64L 3EVQA 3RMHA 2AKWB 3TREA 3GP7A 3NPPA 2LSSA 3I8ZA 5M3MH 2BH2A 1UE1A 2JEBI 1KRTA 4XXEA 3W5OA 1I4RA 4J8QA 1NNXA 3E9HA 3A5ZB 4QF4A 1GUTA 1VQJA 2E8GA 1BCPD 3RLNA 1LTID 1YNJD 3SEBA 2EYOA 5CV9A 2JE6I 4GN5A 4QUCA 5KIXA 5J39A 2NBFA 1DGSA 3AB9A 2RKSA 1S5CD 3I4MH 3N6RA 2KBNA 3STBD 3EBEA 1Y1WB 3NBIA 3GTMH 3C3LA 4K2KA 5DM73 1I6HH 3O13A 5GAGC 1U5KA 3DM3A 1N33Q 1D6EC 4JVZA 1VQ5A 1B3QA 4Z9CB 5GAEC 4J15A 1D5XC 3J81i 4NPSA 2IWHA 5M3FH 4LK1C 3BU2A 5C4XH 1ESFA 3CKIB 4A3IB 2IPKD 4A3MB 1QVCA 5EBDA 5BR8Q 5JJKA 1X65A 3A7AB 1KLUD 3C46A 1STNA 2HHHQ 3AQQA 2EPBA 1UNSA 4OX9Q 2WKCA 2UUAL 3KLRA 2AQ2B 2JYOA 3I4NG 4OL7A 1AFPA 1ILPA 4G57A 1HNXL 2F0UA 2RCNA 3BYYB 4IZ8A 2YTYA 2D0PA 2CQAA 3GTQB 1TXYA 1SNPA 2PMZB 2N78A 2NN6H 4K5WA 5E1FA 4L5SA 3RUZA 2CW0C 2VQEL 4RMFA 1Q7YC 3VR4A 2YU9H 3KF8A 3R3OA 1NY4A 2H1EA 4KHVA 3E9IA 3C1EA 4FYDA 2XRSD 4C3JG 2XSCA 2F3WA 3B6YA 4MHEA 1K3RA 3F2BA 1GD7A 1PZJD 2RVLA 3X3NA 1LABA 1Y1VB 4DK0A 1D1KA 1FVIA 4X62L 4IURA 4LFBL 3H0GG 4NXNQ 2JA5H 3HRZC 1I94Q 1SYDA 1K0SA 4A3GH 1BF4A 1UEAB 2NZ1D 1FR3A 1IL8A 4DV6Q 3A7LA 2O5IC 4JI0Q 2ZTEA 2Z6KC 1MIUA 1F9SA 3NXWA 1A2UA 2F0WA 1NMFA 3H6MA 5C3EH 1L1OC 1Z9FA 4C3HB 4ZK9B 1C0AA 1RF2D 2R93B 3IFTA 3I4LA 4CKCA 5IYDG 1LO5D 5BN4A 4YCWA 3K7AB 4C1NI 3VR2A 4HR7B 2Y0SG 3WDNA 3SVMA 2F0KA 2F0DA 1HQMC 2E2HH 2K52A 3MXNB 2CFMA 4NB3A 5IYCH 1VMPA 2I5MX 3ULPA 3CW2C 1PRTB 1W2BA 2KCNA 3PSIA 3KDFB 1MJEA 3SK5A 3PV0A 2K04A 4L8JA 3J81L 3LX0A 4ZUIA 3I56A 1HJPA 3I91A 1OXUA 1JB3A 3NTHA 2HDLA 5FLXc 4UDUC 2A69C 4BA1I 2B63B 1VF5C 4IUNA 1VS0A 2B8FA 2A1AA 1IHZA 1IKLA 5KYIA 4QB4A 3BVMA 1L0YB 5C0XJ 1XTCD 5CBEE 2A68D 5EPKA 1S40A 4V0BA 2NVTH 3S1QB 3VR3A 4DK6C 3HP3A 4DV3Q 4XYOA 1F2MA 5T1GA 3OTOL 4GKJQ 4DPGA 3BDLA 5EPJA 3DWPA 2R92H 5C4ZA 1A0IA 2NTTA 3A56A 4LF6Q 3GTKB 1TIID 2O2LD 3BZKA 3HOZG 1WTWA 1KXLA 4KJNA 1HNWQ 1TT2A 4KKUA 2FXQA 1HR0L 2EYMA 1Q12A 4F87A 4RHSA 4PQXA 4IUTA 3GTJB 4KI0A 1UWVA 1TY2A 2QCPX 5IP7H 5COYA 1ICFB 2EVBA 4LJZC 3CPFA 1CA5A 3I55A 4LWCA 4DV7Q 4KD3A 2L11A 3M85A 3V05A 3FMCA 3A8JE 1IBMQ 1VQ6A 1X56A 1Y1VH 3PQIA 5JEAJ 2MQHA 1VCIA 1TWAH 1SYEA 4KTAA 2KHIA 3PO3B 1DYQA 4R8IA 3NP8A 1OXXK 1VQBA 1ML0D 4P73A 1YBYA 1ASYA 1EWHA 4A3DG 1IW7D 2WB1E 3ND8A 1Z7TA 1DOLA 1CI3M 3J80E 2ZJQA 4JV5L 4FF2A 1A6XA 3AMUA 1P8LA 3GTOH 3VYTA 3I90A 2K01A 5AFWA 3ONAB 3HOWB 4GOPA 5D14A 1IL2A 3JC66 1F77A 1KNEA 1QVGA 4NKLA 1IYUA 1C8CA 4GNXB 5C4XG 4PZ7A 1XNQQ 4IFDJ 2F0PA 1E2WA 1Q90A 3T1YL 4JI3L 4GLXA 2NZHA 1OXTA 4LF8Q 1JR0D 2NVXH 1MGSA 3D4RA 3URYA 5BN5A 4ALPA 2JA6H 3FKIH 5EGTA 4O42A 1O80A 2IJ0A 3HOUH 4FO2A 3C2PA 2G9HD 1DCZA 4XQJA 4ZAIA 5M5WH 4Y7NB 3WWVA 3S1MB 4RCNA 2ALYB 3F1ZA 2L9HA 4JOIA 4WJ3M 4AQYL 1ASZA 4HJ9A 2JA7B 1YHAA 2OF1A 5CGKA 4IJHA 2L5TA 2N3SA 1SRUA 1E24A 2NTSA 2R7ZB 3OWEB 3NWSA 1G8ZD 3TEHB 4X3UA 4XYQA 4C3IB 4XTCS 3ND9A 4DR4L 1I6VC 3I7FA 4ZKCB 4A3FB 2WINB 4MNOA 2IX3A 3KF8B 1NUCA 1MHWC 5IGEA 1EY8A 1EQVA 4HMJA 1Q86C 1N32Q 3VDYA 3CCEA 1XJVA 4DV4Q 1BOSA 4ODGA 4LFCQ 1AE3A 2PI2E 1PYBA 5C4JB 1EZ8A 4RA8A 1Q8IA 4ME5A 4RAUC 4J6HA 3M3YB 1WD1A 1JC7A 4KHPQ 1KQSA 2L0CA 5ISRA 2RDGA 2Z4IA 3GQBA 3GO5A 1SSOA 2SEBD 3T13A 4BA2I 2Z0SA 3OMCA 1JE5A 1GUGA 1GUWA 5LMNL 1TWCB 4ZLTF 4DV1Q 5K36H 3CP0A 1SN8A 1VQMA 2ZM6L 1H9JA 2RSNA 5IODA 1EWCA 2F4VL 1HRJA 1MBYA 1LM0A 2ID0A 4OO1I 2EJMA 2WP8J 1V8QA 1SNCA 2KHSA 1BXTA 1A3TA 1VQCA 3I2ZA 1Y1WG 4DAMA 2M2LA 3NQTA 2CVRA 4J1MA 4U673 3KFUA 3PF5A 1IYVA 2OTJA 3S1NH 3NTKA 2F52A 2PMZE 1M1KC 2NVQH 3A0JA 1EUJA 4R4OA 1KABA 4BBSB 2N55A 1HR0W 4JI2Q 3HEJA 4A3IG 2LMCB 4YIJA 4A3MG 2ICEC 1SFOH 1SEBD 1LTGD 4JBWA 4JI7Q 3PIO3 3H94A 1ESRA 3R2TA 1WVLA 2E2IB 4YWKA 2HCCA 3M9BA 1WTQA 1JWMD 3CRKC 3NENA 4E6IA 3QOJA 1NCVA 3EIVA 4P72A 1BR9A 3MTSA 2ENBA 1BO0A 1LT3D 1KDAA 5IT9L 5FOBB 4BBRB 5FJ8G 5CYUA 4HEDA 2VY3A 5KGUA 4JI4L 3SXHA 2GVBA 1C4QA 2IX1A 3VYRA 1X55A 3HFZB 2JN4A 4FXKC 4DR3L 1Y1VG 2B2YC 1PH1A 5I2XA 2KA7A 3MEFA 5KNCA 2VW9A 3SK8A 2BA1A 1V1OA 2KEDA 4F7XA 1RIPA 3M4PA 3K58A 3U4ZA 3OIQA 3CCVA 3F2UA 2LFNA 2LY7A 1K8AC 4H7BA 3ZJYC 3S1RH 2G5DA 1VQEA 4B3RQ 3L2PA 1E1TA 1JICA 3HOYH 2K5NA 1T9HA 2B8GA 4PMCA 1X9NA 3UE1A 3JAMi 2B2VC 4OO1H 1TWCH 2B2TC 3L0OA 1J9OA 3MFGA 4HIDA 5I2YA 4C3HG 3S9WA 4HJAA 2R93G 1Y8PB 5EKKA 5IYBH 5M5YB 4DFAA 4B9WA 3RZDB 1MSGA 4DR1L 4KJOA 3MZ5A 1RDPD 3CXCA 1CKNA 4K6LA 3TMEA 3L7ZC 3UDGA 2K4KA 2XGTA 2FJ2A 2J0TD 1BQQT 3OMGA 3EA6A 3E0JA 4DV2Q 1FJGL 4KD4A 3OIPA 3SR1A 2K33A 2K7VA 4LW1A 1DOKA 1G2TA 3K0YA 2LXKA 4NP5A 4A3JH 4GKKL 3MXUA 3ULLA 4X65Q 4EQOA 2EYHA 1RCVD 2FMCA 1TKWB 1OXVA 3KUPA 4PV1C 4DUZQ 1O7LA 2B63G 4GN3B 2C9OA 1QG7A 1V1PA 4XDXA 5IGCA 1O78A 1JCKB 3S15H 4IUVA 2K5HA 4Q5VA 5M3MB 4JI5Q 5FLMG 2F03A 5LMNW 2WIIB 4DNRB 1BBWA 2EYLA 2D62A 3QG1A 3PUWA 1K83H 1SDFA 1SYBA 4LF5L 5JJIA 4POFA 1F2ZA 1PH4A 2XVSA 3MXPA 4X6AH 1TS3A 1XWEA 3NHHA 1YJNA 1HZCA 2B39A 3CPWA 1KDCA 1PTOC 2UXCQ 4UP7A 4CGYB 4DXGA 1VMCA 2CH4A 1GM5A 1HHVA 3D4DA 3UDIA 2VB3X 4UAIA 1W6KA 2F0JA 2HIXA 3I4MB 4DR5L 2XIWA 1JT8A 3GTMB 5K36G 1VQDA 2AHOB 1X54A 2EYPA 1I6HB 1BBUA 2VB2X 3PO3G 1QZGA 4DV5L 1O7IA 3CAMA 5H1SE 2KHJA 2WFWA 2K03A 3A8IE 2QEXA 5M3FB 4WJ4A 1K8MA 1OXSC 4HSVA 5KNDA 1ZYRD 5A35A 2OTLA 3E6ZX 1I4XA 3JAML 3R8BA 4JBMA 2G9DA 3BG3A 4CJ1B 4B3SQ 2WB1B 1D5MC 1QWYA 5D3DA 1M8AA 2H4OA 3HOXH 3PO2H 1X32A 4KY5A 2Q2IA 2Z6BA 4KK7A 4RKLA 3VYUA 1GHJA 1VQKA 4L63B 4K8JA 1F9RA 4FF4A 2B2UC 1BCPB 5LMUL 3FPUB 4JI6L 5CV6A 4N9PA 1EY4A 4DAVA 4DNIA 4IFDG 4O2DA 4IUUA 2SDFA 4DAYB 4B3TL 3PIP3 3NEMA 2YU9B 4ZUJA 5IP9G 1H95A 4IPHA 1J5EQ 3FP9A 4JC0A 3NTIA 4GLVB 2K32A 5ELFA 5DM63 3W2DA 4CDCC 2JA7G 2AMCB 4IPCA 4POGA 2JA5B 2R7ZG 4A3GB 1NTGA 1XMOL 1EY6A 2VS1A 4DF7A 2BCOA 3EROA 3S17H 4C3IG 1B3AA 2Z6KA 2MHVA 3RN2A 2Q8RE 2RA4A 4A3FG 1WTPA 3K5NA 1L1OA 1FNUA 2DNCA 3NBHB 5CBAE 5C3EB 3T53B 1PH5A 3NWTA 3J7YW 1HUNA 2B29A 1SMXA 4PMWA 1B53A 1PZKD 2MO1A 5C4HA 4A3CH 3G71A 2E76C 4P75A 3TBIB 4IQZA 2A6EC 2E2HB 1QUQA 5ELDA 3F8TA 2EOTA 1VQOA 2XWJB 1DOMA 2ATWA 2EYJA 2V1CC 1HH2P 4FF3A 4JI8L 4RCOA 3FVQA 3RD4A 3D3RA 5CV8A 1HNXQ 1MI2A 3GTGH 3BJUA 1XX8A 4OXPA 3SDZA 4K6DA 1K8OA 3J81E 4JPBW 1G291 3K5MA 1CKNB 2L12A 2YV5A 3KF6A 4AH6A 3CMEA 2ZXOA 4JYAQ 1D8LA 5IE8A 5GQOA 2NVTB 1ZEQX 3OOCA 2ZXPA 2X6GA 4CDDC 2CH4W 3D4WA 5GROA 3HZXA 1SJED 2CWAA 4BBSG 2R92B 3KLWA 3G48A 4K14A 2WV6D 5IGDA 1U9RA 1HFGA 2WAQE 3TP6A 4BY7H 3BYTB 2F0NA 2F0TA 3TN2A 2MO0A 5FO9B 4OEMB 2E2JH 2F3VA 1CSQA 2M00A 1TWFH 2K5QA 1PRTC 3MVVA 1EOTA 3A74A 1N33L 1TS5A 4PZ6A 1JOQA 1CKMA 1PFMA 3UDXA 1H9RA 3IAYA 4LF4L 1BDOA 1I4GA 3IL8A 2EY6A 2F0QA 1SMYC 4XT3B 3GV3A 4BXXH 1OTCA 2B2WA 3TP7A 5I9PA 1UE7A 3GDEA 4ZCKA 4BBRG 1SNDA 4LF7Q 1ENCA 4A3LH 1TWAB 1GJXA 1KLGD 4EQPA 4A3EH 4OX9L 2RHQB 2DGYA 3MXGA 4CJ0B 2FHTA 3RR5A 3GTOB 5EAYA 2PW7A 4IALA 2EJGC 3RLFA 1K3BC 3QR8A 1E22A 2PPBC 3K7UC 2XTIA 5CV4A 1XPOA 1IXRA 4HAEA 1YNXA 2OXPA 5EKIA 4TRDA 4N8FA 2SNSA 1YEZA 2UUBL 2NVXB 4LF9Q 2JA6B 3I72A 3KJPA 4DR7L 3FKIB 3TQYA 3CRLC 1M4VA 2FINB 5GAHC 3ER0A 1KL9A 3HOUB 4QIWE 1I94L 1DZ1A 4HIMA 5M5WB 5DLQE 2BE5C 2N49A 1JWSD 4XT1B 2F0VA 1PRTF 2CQOA 1MJCA 5FK9C 1EY5A 3ERQA 1SLJA 2BDNA 3KOJA 1CSPA 1RHPA 1EQTA 2XN9C 4O1NA 2PNHA 4HIOA 4S3SA 1ET6A 1DXMA 1F2LA 2A6ED 3UI2A 3BVZA 1HCZA 3EJIA 4KN4C 4QCLA 4GNXC 4I65A 4GZYC 2A5HA 3BDCA 1WTOA 3FPPA 4A3KH 3PMFA 3RLOA 4C2MH 5I6WA 1HNZL 2TSSA 1N34L 5TSSA 4DV0Q 1HTLD 4OONA 1JORA 4LUVA 1UE6A 4Q0FA 3E5SA 2IX0A 5M3MG 4Y52H 5IY0A 1MSHA 1WCMH 2QKIC 4DR2L 1U0LA 1SE3A 2D9UA 4BY1H 1AP0A 1O7ZA 1U4MA 4OELB 3Q8DA 3M7GA 3T16A 5CMDA 5M9OA 3K6OA 1ENAA 4ILWA 5J1ZA 3KJOA 4DUYQ 3SGIA 4A76A 2K28A 3ULJA 5C0XI 1PHJA 3M4OH 1BVSA 1XMQL 2N8NA 4RHRA 3L3OC 5A2QE 1PFBA 5CV7A 4IPGA 1EY7A 2HDMA 5IIFA 4A3BH 3I4MG 4DV3L 3KLSX 1B1ZA 2RQXA 4GKJL 1WTHA 1PFSA 2CW0D 2MNAA 2OT2A 1PA6A 2EXDA 3Q22A 1PRTD 3IKJA 4G7HC 1I50H 3K81C 2NVYH 3S1NB 2NVQB 2PZUA 3MHBA 4N9TA 1Z47A 1SMYD 5M3FG 2MGSA 5F2DA 3WOFA 2K1BA 3CHBD 3N52A 1LTAD 1STEA 1EZ6A 3U4VA 5I9OA 4K0KL 5DNFA 2AWOA 4K2LA 1EU3A 3D6WA 1SFOB 5C5MA 2DY7A 3S16H 1MD2D 2E74C 2BA0A 3RZOH 1DM0B 1K28A 4JK1C 2WB1G 1EYCA 1IBML 3K0XA 3DXJC 1YIJA 4DN4M 4AYBE 1Q1EA 1LLRD 3H09A 1EY0A 2QDBA 1E2ZA 1B44D 2YTVA 3D8GA 4OHJA 4LFAQ 4DK3C 4OIKA 2NN6G 4NMZA 1U4LA 4MTKA 3K80C 2F3IA 3GTPH 1EIGA 3PUVA 2PCFB 4TQUS 2RF4A 4X3KA 5IT9E 1Q46A 2DY8A 3FRPB 1SR3A 3M4QA 4DR6Q 1L2FA 3TZDA 2B2YA 2EY1A 2F0IA 1CM9A 4R9WA 3AU7A 1GXDC 1LT5D 1FYCA 2VQFL 1TWHH 5LMNQ 1XNQL 1A8VA 2JA5G 3S2HB 4A3GG 1EU4A 2EE1A 3V96A 3NK9A 2L55A 2EDGA 3T1HL 3A54A 1E0BA 2F4VQ 4JI1Q 4FXGC 3R2IA 5K5PA 2WACA 2A69D 2B2VA 4P74A 3S1RB 2B2TA 4QL5A 5C0XH 3HOYB 3UDFA 1YHQA 3MA2B 2EQSA 1QNUA 5C3EG 2HCIA 5JPNC 2K75A 2M9VA 3AFQA 5A2QL 3CD6A 4RH6A 2UXDQ 3RNUA 1RKNA 3TS2A 4APVA 1VQ8A 3U9SA 3SHLA 3CCSA 4UHVA 1R4PB 3A55A 5IYCG 3H3VC 5FO7B 4P2CB 1S5ED 1N32L 4CHTB 1J8IA 1XYIA 2DJGC 1KDBA 4LFCL 4B08A 4A3JB 2A74C 1VF7A 5JEAH 3W1BA 5G3LF 1LACA 3WOEA 4ULLA 1JOKA 2PZWA 1PH2A 1QB5D 2XNAC 3J81j 3S15B 4RGTA 3G6JB 1G2SA 5HGQA 1QNKA 2YYZA 4YHHL 2SNMA 3A5UA 2JK8A 5E3FA 3J80c 3PCOB 2R92G 3HOVH 1K83B 1UEBA 1S5FD 2I46A 1PDQA 4DR3Q 3TZUA 4RGNA 3CCLA 4FNFA 2QA4A 1CT1D 1EFID 5IP7G 1JJCB 1KD1C 3AFPA 3J7AF 1E2VA 1I3QH 2F0HA 2WAQB 1LTBD 1XXGA 4M8AA 4B3ML 3W3AA 2DJFC 2R7FA 4JI2L 5C44H 4QUFA 2RBMA 3Q23A 1PXUA 4LMQD 4HCSA 1JMCA 4A93H 3S2HH 3P7JA 2E5LL 5ELOA 2E2DC 2VUMH 4NXMQ 2PO4A 3LWUA 1PV4A 3BDOA 1A3UA 1AZPA 1UE5A 3ITPA 3GTLH 3I3CA 3P1HA 2K14A 3IFDA 2JA8H 3CMAA 1CHPD 2D2CC 1FJGQ 4OWTB 1EIYB 1IBKL 3M7NA 3LNNA 5CC4A 5G3LD 4JW0A 1HFNA 2GVAA 3JAME 2B2UA 4K8IA 4EVOA 1M90C 3NELA 3PO2B 3HOXB 3NUCA 2JP1A 3VYSA 1S5BD 2KOLA 1D7QA 1EIHA 3HGBA 1S5DD 1MKHA 4GOPB 2A6HC 1TVXA 1EEFD 2EZVA 1A62A 2JA6G 1C7YA 2HIVA 3FKIG 3HG9A 2QDLA 3HOUG 1O7YA 4DXFA 3NE5B 5JAVA 4IN3A 2N88A 1GHKA 4UY8C 2K6AA 2C35B 2C5CA 1Q81C 4HSPA 2X69A 2J7ZA 1CQFA 3DMUA 2QILA 4QIWB 1N36Q 1JE4A 4B3RL 4PG3A 3I70A 5C6AA 1SE4A 1ILQA 3S17B 2Q2UA 1W3SA 4GS3A 4TVAB 4H0LC 1XPRA 1A3VA 3RN5A 1B4OA 3EN2A 4DA2A 2HT1A 3FDTA 4ME3A 4DKAC 1HTPA 1VQ7A 4DR5Q 1EQQA 3I4NH 1BCPC 1STYA 4YY3L 2I5LX 3VR5A 1Q82C 1YNJC 3QB3A 3HKZE 3DM1A 4HCEA 4C1NK 1QVFA 4JG2A 1V9PA 4DV2L 5CORA 5IWAL 3H15A 3AYHB 4IJLA 5JVH3 2F0GA 3E3XA 3H91A 4DV5Q 1TWGH 1HZ9A 4JBJA 5HY6A 4G7ZC 3U9OA 1JJGA 1W6JA 1HPCA 1EIFA 3OYYA 4MIUA 2QW7A 1JWUD 4FDBA 5D65A 2LS01 1QJOA 2NB0A 4C3JH 2IHEA 1RTNA 4DUZL 4ZQ3A 1V1QA 1I5FA 4QMGA 3HKSA 2PQAA 1YI2A 1TR5A 2Q8TA 3H0GH 2SOBA 1AZQA 2JSOA 5BN3A 3GTGB 4I7ZC 3J7A5 5IGGA 1IBLQ 4FVMA 3KLSA 2AQ1B 5LMUQ 4JI5L 4JI6Q 1G91A 4HJ8A 4EX5A 1X3EA 3NQIA 1HXYD 3S14H 4TKOB 4UPAA 1WTRA 4DK1A 2P5ZX 5IGFA 4B3TQ 2RDHA 4CKBA 4X66L 1PH3A 2UXCL 1A2TA 1EYGA 5C3XA 5KNBA 3KBGA 3CCUA 5AJ3L 4DU9A 3T56B 3MAQA 4IO9A 4KMUC 2UU9L 3MXNA 1QZHA 4BY7B 2Q2HA 3DWAA 1IKMA 4X64Q 1X6OA 3KDFA 5KEEA 2OWOA 3SE0A 2E2JB 1TWFB 1KAAA 1PTOF 2Z1CA 5CR3A 2JA9A 1PZID 1KNAA 4KKTA 3L9AX 5C5LA 5KYLA 4C56C 4X3SA 1Y8OB 1SAPA 4F8MA 1I4HA 2UXBL 1GUOA 1WFQA 1Y14B 1XNRL 2BDOA 4AYBB 4G7OC 2JEAI 5E4XA 5C3WA 4LUOA 2UUCL 4RG1A 4B3SL 1EFWA 3I73A 4A3EB 1C9OA 4EQ5A 3T51B 2A6HD 4CDFC 1I4PA 1X3QA 2KUMA 3CQZH 1ONLA 5CV5A 3SK6A 1CZWA 1TU2B 1VQGA 2KCTA 4BS9A 4R4CA 2X6LA 1LTTD 3S2DH 3HOZH 2ZXRA 5EKLA 4FF1A 3V2TA 2JXMB 5IGBA 4BWGB 2R6GA 5ELCA 4CJ2C 1TS4A 4ZKBB 1STHA 1II3A 4YWLA 5J22A 2JA8G 1RD9D 3HS0C 4OGQC 4L6TB 3HOYG 1I4QA 1SBBB 2ZT9C 1J5EL 4K5XA 5E7NA 4OO1G 2YTXA 1L0XB 1VQIA 2KECA 2AUKA 4CDEC 2PW5A 2Z8LA 3TRZA 1DJRD 5IYBG 5FLXE 3M4OB 3ZYYX 4MZ9A 2KENA 3BS1A 1YNNC 2UUAQ 3D6CA 3CCJA 5GADC 3F2DA 1CKOA 2IHFA 2L15A 3J7AV 1CUKA 1K9MC 1SNMA 2A68C 3Q0AA 4A3DH 1PTOD 2RHSB 1H9MA 1KTKA 1G6ZA 1V43A 4IUQA 2VQEQ 1CQVA 4GNXA 4OWWB 1LUZA 3D0FA 4A3JG 5M5XH 2KVMA 3VA5A 1CTMA 1SNOA 3BVGA 5FKAC 5FO8B 1SYFA 1HUMA 1EYAA 1HQRD 4GLAC 4LF4Q 1PFNA 2Z9HA 2A8VA 1X3PA 1VQ4A 1K0RA 1AN8A 4A3KB 4C2MB 4X62Q 1A15A 1SXTA 1R9TH 4LFBQ 3DEPA 3KBXA 4F88A 1IYJB 2EJFC 2O5JC 4KY6A 2VL6A 3VA7A 1WCMB 1V1PB 2JJQA 2PQEA 3MFYA 1YITA 4DGZA 2AWNA 4HTHA 2KCMA 3MWYW 4KN7C 1GUSA 4BY1B 1IZ6A 3CCRA 2PZTA 4CKEA 3FHWA 1Q3LA 1X3FA 1IW7C 2ZTDA 4XQNA 2F4IA 4WFN3 2IW3A 1TS2A 1L0WA 5BR8L 1PTOH 4EQNA
chains in the Genus database with same CATH topology
1PYWD 1Z6HA 3NSWA 3R93A 1H9KA 4A3BB 2FMMA 4WORA 1F2YA 1JQYD 2K5DA 4HMIA 3T4AC 1I50B 1DONA 1WTVA 2NVYB 2TMPA 1HA6A 1NAPA 1EYDA 4ZYSA 3Q6SA 3S16B 1F9PA 3RZOB 3QJYA 2EXZA 2O4XA 5FLXL 2I07B 2RSOA 3TP8A 3CU7A 1ICWA 3G7LA 1BNZA 2IL8A 5ELBA 3DUZA 3A8KE 4CBVA 3QIAA 3K59A 1LTRD 1QE6A 4EGVA 5JPMC 3GTPB 1RODA 2KJXA 1FGBD 2MJ8A 2L4NA 4H13C 2L1BA 1D1IA 1NR4A 1Y69U 1TWHB 1YNND 2Z4HA 4RFBA 2KEEA 5LL6X 3K5OA 1R4QB 2HUGA 2EY2A 2FFKB 2OEOA 1SYCA 1UUPA 1CZGA 2WKDA 1EY9A 2XRQD 1D5ZC 2LKVA 1DD2A 1PLFA 5LHY1 3KK7A 3OW7A 2QEJC 1U4RA 3HKZB 5I4DA 3OHXC 1ZXTA 4RGMA 5T1IA 3PUYA 2AQ3B 2VXWA 5KRUA 3Q24A 4OIJA 2VNUD 1RJTA 2DN8A 3DWQA 5JJZA 3DHQA 2B2WC 2IT1A 2D5DA 3P20A 2CHBD 1LT6D 2KQ3A 4XIGS 2E75C 3VR6A 3HOVB 5JVG3 1LTSD 2BOSA 2F0FA 4IUPA 1CHQD 4U68A 1STBA 1TQOA 3TP5A 4V190 3D31A 1EEID 2MP1A 1I3QB 3K5LA 2Q8IB 4K5VA 3MC0B 5C44B 4IFDI 1B9MA 2F0LA 4A93B 2K5WA 2VUMB 2BE5D 1B9NA 1NR2A 4KKSA 3GTLB 5E4WC 1BUVT 2JA8B 2R61A 2GA4B 1B50A 2A73B 2KCCA 3QWNA 1EL0A 2F1MA 2EY5A 5I6YA 1T5EA 1WTXA 5LL6S 3GD7A 1H9SA 2NYZD 2F0MA 3SK4A 4FP5D 2NWGA 1FD7D 3J80L 4WJWA 2DNEA 3M4YA 3K57A 3DEOA 3PUZA 4RWSC 2PYKA 2PNRC 1Q1BA 3I4NB 4DAYA 2AUJD 3LWEA 4PMBA 5D3IB 4IFDH 1TWGB 3OSOA 2RDFA 1ENFA 3X3MA 4C3JB 2XWBB 1ZYRC 3H0GB 2NUCA 5NUCA 1HA5A 4LAAA 4X3TA 5DEHA 3NBHA 3S14B 2EYFA 1AEXA 3P75A 1B2TA 4RGOS 4ABNA 3TDQA 4HN7A 1NSNS 1D2BA 4WRDA 1CK1A 2Y0SB 4KV6A 1RTOA 4G4KA 1U4PA 2ICIA 1F9QA 5EPLA 1GOZA 4R8NA 2F0OA 1LV9A 3FEWX 3EFXD 1AW7A 5HGTA 4MN3A 1SE2A 3PUXA 1SJHD 1S4ZA 3CQZB 1GUNA 4B9XA 1Y8NB 1FNVA 1FNWA 3GV6A 4NDXA 3S2DB 3HOZB 5IOCA 1LT4D 5C0XG 5JOBA 2HQEA 1JOOA 4ID6A 1C48A 3QOLA 2MPMA 4XQQA 2QF7A 5EJWA 1STGA 3OWFA 1QILA 3TSSA 4H44C 1TY0A 1QCBD 3BZDB 3EQLC 4A3DB 4KY7A 1T5XD 4DNTB 1UAPA 1BBXC 5ELEA 2F0SA 2R3ZA 4RKBA 4FXDA 5M5XB 1QOHA 5JEAG 4NW2A 3MEHA 3C1FA 5HURA 1ET9A 1H9SB 4PNYA 5C4XB 1SNQA 3OPOA 1VDZA 4ZRZA 1R9TB 1BCPF 5EQ0A 4TSSA 4DAPA 1ZKOA 1STAA 2K05A 1PMRA 3QO2A 2MUYA 4M1UB 2V4DA 5DAUA 1PTOB 4KHZA 1CA6A 2J4XA 5EBCA 1CFMA 1OO9B 1SYGA 2F0EA 2NN6I 1WD0A 3EVQA 3RMHA 3GP7A 3NPPA 3I8ZA 2JEBI 4XXEA 1I4RA 4J8QA 4QF4A 1GUTA 1BCPD 1LTID 1YNJD 3SEBA 2EYOA 5CV9A 2JE6I 4QUCA 5KIXA 5J39A 2NBFA 3AB9A 2RKSA 1S5CD 3N6RA 1Y1WB 3NBIA 3C3LA 4K2KA 5DM73 3O13A 1D6EC 4Z9CB 1D5XC 2IWHA 4LK1C 1ESFA 3CKIB 4A3IB 2IPKD 4A3MB 5EBDA 3A7AB 1KLUD 3C46A 1STNA 2EPBA 1UNSA 2WKCA 3KLRA 2AQ2B 2JYOA 4OL7A 1AFPA 1ILPA 4G57A 2F0UA 3BYYB 4IZ8A 2CQAA 3GTQB 2PMZB 1SNPA 2NN6H 4K5WA 5E1FA 3RUZA 2CW0C 3VR4A 3KF8A 3R3OA 2H1EA 4KHVA 3C1EA 4FYDA 2XRSD 4C3JG 2XSCA 2F3WA 4MHEA 1PZJD 2RVLA 3X3NA 1LABA 1Y1VB 4DK0A 1D1KA 4IURA 3HRZC 1SYDA 1BF4A 1UEAB 2NZ1D 1FR3A 1IL8A 3A7LA 2O5IC 1F9SA 3NXWA 1A2UA 2F0WA 3H6MA 4C3HB 4ZK9B 1RF2D 2R93B 3IFTA 3I4LA 4CKCA 1LO5D 5BN4A 3K7AB 4C1NI 3VR2A 4HR7B 3WDNA 3SVMA 2F0KA 2F0DA 1HQMC 1VMPA 1PRTB 2KCNA 3SK5A 2K04A 4L8JA 3J81L 3LX0A 4ZUIA 3I91A 1OXUA 1JB3A 3NTHA 2HDLA 4UDUC 2A69C 4BA1I 2B63B 1VF5C 4IUNA 2B8FA 1IHZA 1IKLA 5KYIA 4QB4A 3BVMA 1L0YB 5C0XJ 1XTCD 5CBEE 2A68D 5EPKA 4V0BA 3S1QB 3VR3A 3HP3A 4XYOA 1F2MA 5T1GA 3BDLA 5EPJA 3DWPA 5C4ZA 2NTTA 3A56A 3GTKB 1TIID 2O2LD 1WTWA 4KJNA 1TT2A 4KKUA 2EYMA 1Q12A 4F87A 4RHSA 4PQXA 4IUTA 3GTJB 4KI0A 1TY2A 2QCPX 5COYA 2EVBA 4LJZC 1CA5A 4KD3A 2L11A 3M85A 3V05A 3FMCA 3A8JE 5JEAJ 1VCIA 1SYEA 4KTAA 3PO3B 1DYQA 4R8IA 1OXXK 3NP8A 1ML0D 1EWHA 1IW7D 3ND8A 1Z7TA 1DOLA 1CI3M 3J80E 4FF2A 1A6XA 3AMUA 3VYTA 3I90A 2K01A 5AFWA 3ONAB 3HOWB 5D14A 1F77A 1KNEA 4NKLA 1IYUA 1C8CA 4IFDJ 2F0PA 1E2WA 1Q90A 1OXTA 1JR0D 1MGSA 3D4RA 3URYA 5BN5A 5EGTA 4O42A 1O80A 2IJ0A 4FO2A 3C2PA 2G9HD 1DCZA 4XQJA 4ZAIA 4Y7NB 3S1MB 4RCNA 2L9HA 2JA7B 2OF1A 5CGKA 2L5TA 2NTSA 2R7ZB 3OWEB 3NWSA 1G8ZD 4X3UA 4XYQA 4C3IB 4XTCS 3ND9A 1I6VC 4ZKCB 4A3FB 2WINB 2IX3A 1NUCA 5IGEA 1EY8A 1EQVA 4HMJA 1BOSA 4ODGA 5C4JB 1EZ8A 4RA8A 1Q8IA 4ME5A 4RAUC 4J6HA 3M3YB 1WD1A 1JC7A 2L0CA 5ISRA 2RDGA 2Z4IA 3GQBA 3GO5A 1SSOA 2SEBD 3T13A 4BA2I 3OMCA 1GUWA 1GUGA 1TWCB 4ZLTF 5K36H 1H9JA 2RSNA 5IODA 1EWCA 1HRJA 1MBYA 2ID0A 4OO1I 2EJMA 2WP8J 1V8QA 1SNCA 2KHSA 1BXTA 1A3TA 2M2LA 3NQTA 2CVRA 4J1MA 4U673 1IYVA 3NTKA 1KABA 4BBSB 2N55A 3HEJA 2LMCB 4YIJA 2ICEC 1SEBD 1LTGD 4JBWA 3PIO3 3H94A 1ESRA 3R2TA 1WVLA 2E2IB 2HCCA 1WTQA 1JWMD 3CRKC 4E6IA 3QOJA 1NCVA 1BR9A 3MTSA 2ENBA 1BO0A 1LT3D 1KDAA 5IT9L 5FOBB 4BBRB 5CYUA 4HEDA 5KGUA 3SXHA 1C4QA 2IX1A 3VYRA 4FXKC 2B2YC 5I2XA 2KA7A 5KNCA 3SK8A 2BA1A 1V1OA 2KEDA 4F7XA 3K58A 3OIQA 3F2UA 2LFNA 2LY7A 4H7BA 1JICA 2B8GA 4PMCA 2B2VC 4OO1H 2B2TC 1J9OA 3MFGA 5I2YA 4C3HG 3S9WA 1Y8PB 5EKKA 5M5YB 4DFAA 4B9WA 3RZDB 1MSGA 4KJOA 3MZ5A 1RDPD 4K6LA 3TMEA 3L7ZC 2FJ2A 2J0TD 1BQQT 3OMGA 3EA6A 3E0JA 4KD4A 3OIPA 3SR1A 2K33A 2K7VA 1DOKA 1G2TA 3K0YA 4NP5A 3MXUA 4EQOA 2EYHA 1RCVD 2FMCA 1TKWB 1OXVA 3KUPA 4PV1C 1O7LA 2C9OA 1QG7A 1V1PA 4XDXA 5IGCA 1O78A 1JCKB 4IUVA 4Q5VA 5M3MB 2F03A 2WIIB 4DNRB 2EYLA 2D62A 3QG1A 3PUWA 1SDFA 1SYBA 1F2ZA 2XVSA 3MXPA 1TS3A 1XWEA 3NHHA 2B39A 1KDCA 1PTOC 4CGYB 4DXGA 1VMCA 1HHVA 3D4DA 2VB3X 4UAIA 1W6KA 2F0JA 3I4MB 2XIWA 3GTMB 5K36G 2EYPA 1I6HB 2VB2X 3A8IE 2K03A 5M3FB 1K8MA 1OXSC 4HSVA 5KNDA 1ZYRD 5A35A 3E6ZX 1I4XA 3JAML 3R8BA 2G9DA 3BG3A 4CJ1B 2WB1B 1D5MC 1QWYA 5D3DA 1M8AA 2H4OA 1X32A 4KY5A 4KK7A 4RKLA 3VYUA 1GHJA 4L63B 4K8JA 1F9RA 4FF4A 2B2UC 1BCPB 3FPUB 5CV6A 4N9PA 1EY4A 4DAVA 4IFDG 4IUUA 2SDFA 3PIP3 2YU9B 4ZUJA 3NTIA 2K32A 5ELFA 5DM63 3W2DA 2JA5B 4A3GB 1EY6A 4DF7A 2BCOA 3EROA 4C3IG 1B3AA 2MHVA 2Q8RE 2RA4A 1WTPA 3K5NA 1FNUA 2DNCA 1PTOH 5CBAE 5C3EB 3T53B 3NWTA 3J7YW 1HUNA 4PMWA 1B53A 1PZKD 5C4HA 2E76C 3TBIB 4IQZA 2A6EC 2E2HB 5ELDA 2EOTA 2XWJB 1DOMA 2EYJA 4FF3A 4RCOA 3FVQA 3RD4A 3D3RA 5CV8A 1MI2A 1XX8A 3SDZA 4K6DA 1K8OA 3J81E 1G291 3K5MA 2L12A 2ZXOA 2NVTB 1ZEQX 3OOCA 2ZXPA 2X6GA 3D4WA 3HZXA 1SJED 2R92B 4K14A 2WV6D 5IGDA 1U9RA 1HFGA 3TP6A 3BYTB 2F0NA 2F0TA 3TN2A 5FO9B 2F3VA 2M00A 2K5QA 1PRTC 3MVVA 1EOTA 1TS5A 1JOQA 1PFMA 1H9RA 3IAYA 1BDOA 1I4GA 3IL8A 2EY6A 2F0QA 1SMYC 4XT3B 3GV3A 2B2WA 3TP7A 5I9PA 1SNDA 1ENCA 1TWAB 1GJXA 1KLGD 4EQPA 3MXGA 4CJ0B 2FHTA 3GTOB 2PW7A 4IALA 2EJGC 3RLFA 2PPBC 5CV4A 4HAEA 2OXPA 5EKIA 4TRDA 2SNSA 2NVXB 2JA6B 3I72A 3FKIB 3CRLC 1M4VA 2FINB 3HOUB 1DZ1A 5M5WB 2BE5C 1JWSD 4XT1B 2F0VA 1PRTF 5FK9C 1EY5A 3ERQA 2BDNA 1RHPA 1EQTA 2XN9C 4O1NA 4S3SA 1ET6A 1DXMA 1F2LA 2A6ED 3UI2A 3BVZA 1HCZA 3EJIA 4KN4C 4QCLA 4I65A 4GZYC 2A5HA 3BDCA 1WTOA 3FPPA 3PMFA 5I6WA 2TSSA 5TSSA 1HTLD 1JORA 4Q0FA 3E5SA 2IX0A 1MSHA 2QKIC 1SE3A 2D9UA 1AP0A 1O7ZA 1U4MA 3M7GA 3T16A 5CMDA 5M9OA 3K6OA 1ENAA 4ILWA 5J1ZA 2K28A 5C0XI 4RHRA 3L3OC 5A2QE 1PFBA 5CV7A 1EY7A 2HDMA 5IIFA 3KLSX 1B1ZA 2RQXA 2CW0D 2OT2A 3Q22A 1PRTD 3IKJA 4G7HC 3S1NB 2NVQB 2PZUA 3MHBA 4N9TA 1Z47A 1SMYD 2MGSA 5F2DA 3WOFA 2K1BA 3CHBD 1LTAD 3N52A 1STEA 5I9OA 1EZ6A 5DNFA 2AWOA 4K2LA 1EU3A 3D6WA 1SFOB 5C5MA 2DY7A 1MD2D 2E74C 2BA0A 1DM0B 4JK1C 1EYCA 3DXJC 4DN4M 1Q1EA 1LLRD 3H09A 1EY0A 2QDBA 1E2ZA 1B44D 4OHJA 3D8GA 4OIKA 2NN6G 4NMZA 1U4LA 1EIGA 3PUVA 2PCFB 4TQUS 4X3KA 5IT9E 2DY8A 3FRPB 3TZDA 2B2YA 2EY1A 2F0IA 1CM9A 4R9WA 3AU7A 1GXDC 1LT5D 1FYCA 3S2HB 1EU4A 2EE1A 3V96A 3NK9A 2L55A 2EDGA 3A54A 1E0BA 4FXGC 3R2IA 5K5PA 2WACA 2A69D 2B2VA 3S1RB 2B2TA 5C0XH 3HOYB 3MA2B 1QNUA 2HCIA 5JPNC 2M9VA 5A2QL 4RH6A 1RKNA 3U9SA 3SHLA 1R4PB 3A55A 3H3VC 5FO7B 4P2CB 1S5ED 4CHTB 1J8IA 1XYIA 1KDBA 4B08A 4A3JB 2A74C 1VF7A 5JEAH 5G3LF 1LACA 3WOEA 4ULLA 1JOKA 2PZWA 1QB5D 2XNAC 3S15B 4RGTA 3G6JB 1G2SA 1QNKA 2YYZA 2SNMA 5E3FA 1K83B 1S5FD 2I46A 1PDQA 3TZUA 4RGNA 4FNFA 1CT1D 1EFID 3J7AF 1E2VA 2F0HA 2WAQB 1LTBD 1XXGA 4M8AA 3W3AA 4QUFA 2RBMA 3Q23A 1PXUA 4LMQD 4HCSA 3P7JA 2E2DC 2PO4A 3LWUA 3BDOA 1A3UA 1AZPA 3ITPA 3I3CA 3P1HA 3IFDA 1CHPD 2D2CC 3M7NA 3LNNA 5CC4A 5G3LD 1HFNA 3JAME 2B2UA 4K8IA 4EVOA 3PO2B 3HOXB 3NUCA 2JP1A 3VYSA 1S5BD 2KOLA 1EIHA 3HGBA 1S5DD 2A6HC 1TVXA 1EEFD 2EZVA 3HG9A 1O7YA 4DXFA 3NE5B 5JAVA 4IN3A 2N88A 1GHKA 2K6AA 2C5CA 4HSPA 2X69A 2J7ZA 1CQFA 3DMUA 2QILA 4QIWB 1JE4A 3I70A 5C6AA 1SE4A 1ILQA 3S17B 4H0LC 1A3VA 1B4OA 4DA2A 3FDTA 1HTPA 1BCPC 1STYA 3VR5A 1YNJC 3QB3A 3DM1A 4HCEA 4C1NK 5CORA 5JVH3 2F0GA 3H91A 4G7ZC 3U9OA 1W6JA 1HPCA 4MIUA 1JWUD 5D65A 2LS01 1QJOA 2NB0A 1RTNA 4ZQ3A 4QMGA 1TR5A 2Q8TA 2SOBA 1AZQA 2JSOA 5BN3A 3GTGB 4I7ZC 5IGGA 4FVMA 3KLSA 2AQ1B 1G91A 3NQIA 1HXYD 4TKOB 1WTRA 4DK1A 5IGFA 2RDHA 4CKBA 1A2TA 5C3XA 5KNBA 3KBGA 3MAQA 4DU9A 3T56B 4KMUC 3MXNA 4BY7B 3DWAA 1IKMA 5KEEA 3SE0A 2E2JB 1TWFB 1KAAA 1PTOF 2Z1CA 5CR3A 1PZID 1KNAA 4KKTA 3L9AX 5C5LA 5KYLA 4C56C 4X3SA 1Y8OB 1SAPA 4F8MA 1I4HA 1GUOA 4G7OC 2BDOA 4AYBB 2JEAI 5E4XA 5C3WA 3I73A 4A3EB 3T51B 2A6HD 1I4PA 1X3QA 2KUMA 1ONLA 5CV5A 3SK6A 1CZWA 1TU2B 4BS9A 2X6LA 1LTTD 2ZXRA 5EKLA 4FF1A 3V2TA 2JXMB 5IGBA 4BWGB 2R6GA 5ELCA 4CJ2C 1TS4A 4ZKBB 1STHA 1II3A 5J22A 1RD9D 3HS0C 4OGQC 4L6TB 1I4QA 1SBBB 2ZT9C 4K5XA 4OO1G 1L0XB 2KECA 2AUKA 2PW5A 2Z8LA 1DJRD 5FLXE 3M4OB 3ZYYX 3BS1A 1YNNC 3D6CA 3J7AV 1SNMA 2A68C 3Q0AA 1PTOD 1H9MA 1KTKA 1G6ZA 1V43A 4IUQA 1CQVA 2KVMA 3VA5A 1CTMA 1SNOA 3BVGA 5FKAC 5FO8B 1SYFA 1HUMA 1EYAA 1HQRD 1PFNA 1X3PA 1AN8A 4A3KB 4C2MB 1A15A 1SXTA 3DEPA 3KBXA 4F88A 2EJFC 2O5JC 4KY6A 3VA7A 1WCMB 1V1PB 2PQEA 3MFYA 4DGZA 2AWNA 4HTHA 3MWYW 4KN7C 1GUSA 4BY1B 2PZTA 4CKEA 1Q3LA 4XQNA 1IW7C 2F4IA 4WFN3 2IW3A 1TS2A 3PV0A 4EQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF5 C;  2AWO A;  2L5T A;  3OPO A;  1Z6H A;  2B8F A;  1VDZ A;  2E76 C;  3I73 A;  2E74 C;  2A6E C;  2BA0 A;  4IQZ A;  3T51 B;  1H9K A;  3A7A B;  2A68 D;  4JK1 C;  2A6H D;  4XTC S;  3ND9 A;  3DXJ C;  4H0L C;  3GD7 A;  3I72 A;  1I6V C;  2YYZ A;  1ZKO A;  3VR3 A;  1Q1E A;  5K36 G;  1ONL A;  3CRL C;  1HTP A;  3KLR A;  3PUY A;  1H9S A;  1TU2 B;  3VR5 A;  2KA7 A;  5KNC A;  1PMR A;  2BE5 C;  1YNJ C;  3TZU A;  2BA1 A;  2DN8 A;  1E2Z A;  2NN6 G;  4KKU A;  2V4D A;  1Q12 A;  2IT1 A;  2D5D A;  2JXM B;  2NN6 H;  2R6G A;  3A8I E;  3SDZ A;  1K8O A;  4KI0 A;  1K8M A;  1OXS C;  2CW0 C;  3PUV A;  5KND A;  2PCF B;  3P20 A;  4TQU S;  5A35 A;  4G7Z C;  2DNE A;  1G29 1;  4KHZ A;  4OGQ C;  1E2V A;  3VR4 A;  1HPC A;  2EVB A;  3M4Y A;  4LJZ C;  2ZT9 C;  3PUZ A;  1CFM A;  1DXM A;  3BG3 A;  3GQB A;  3QJY A;  4XIG S;  2B8G A;  2A6E D;  4BA2 I;  4OO1 G;  1GUG A;  4OO1 H;  3PUX A;  1QJO A;  2E75 C;  2AUK A;  3OOC A;  3W3A A;  3M85 A;  1HCZ A;  2NN6 I;  1GUN A;  3FMC A;  3A8J E;  5K36 H;  2PNR C;  1FYC A;  1LAB A;  1Q1B A;  4KN4 C;  1Y8P B;  1Y8N B;  1YNN C;  3VR6 A;  4DK0 A;  4GZY C;  1GHJ A;  1VCI A;  1H9J A;  3A8K E;  3FPP A;  2AUJ D;  3QIA A;  3L7Z C;  3LWU A;  1OXX K;  3BDO A;  5BN3 A;  4I7Z C;  1FR3 A;  2A68 C;  2EDG A;  1EWH A;  1IW7 D;  4IFD G;  3ND8 A;  2EJM A;  1Z7T A;  4IFD H;  1V8Q A;  1H9M A;  3A7L A;  3D31 A;  2O5I C;  2A69 D;  5C0X G;  1CI3 M;  4TKO B;  2K33 A;  5C0X H;  1V43 A;  2D2C C;  2JEB I;  2K7V A;  4DK1 A;  2Q8I B;  1A6X A;  3M7N A;  3LNN A;  1IYV A;  1H9R A;  4H13 C;  1BDO A;  1CTM A;  2QF7 A;  3MXU A;  1SMY C;  2K32 A;  1Y69 U;  5KNB A;  1B9M A;  1GUT A;  1TKW B;  1OXV A;  3I4L A;  3IFT A;  1ZYR C;  1IYU A;  1O7L A;  4PV1 C;  3T56 B;  4KMU C;  3HGB A;  2LMC B;  1GJX A;  2BE5 D;  4H44 C;  1B9N A;  4JBW A;  5BN4 A;  1E2W A;  1O78 A;  1Q90 A;  2JE6 I;  4KKS A;  2A6H C;  3VR2 A;  4HR7 B;  3WDN A;  1OXT A;  3EQL C;  3H94 A;  2EJF C;  3U9S A;  2O5J C;  3AB9 A;  4DNT B;  1HQM C;  3D4R A;  3SE0 A;  5BN5 A;  3N6R A;  3VA7 A;  3CRK C;  3MFY A;  4DNR B;  2D62 A;  3QG1 A;  4G7H C;  3IKJ A;  4KKT A;  3NE5 B;  3PUW A;  1DCZ A;  1GUS A;  2KCC A;  2DNC A;  4KN7 C;  2F1M A;  4RCN A;  1GHK A;  1Y8O B;  4L8J A;  3T53 B;  1GUO A;  1T5E A;  5JEA G;  2EJG C;  1IW7 C;  2BDO A;  1VF7 A;  1OXU A;  3RLF A;  5JEA H;  4G7O C;  2PPB C;  1DD2 A;  1H9S B;  3OW7 A;  2JEA I;  3PV0 A;  1LAC A;  4LK1 C;  2A69 C;  4BA1 I; 
#chains in the Genus database with same CATH topology
 1PYW D;  2HHH L;  4HJ7 A;  1Z6H A;  4JYA L;  3NSW A;  2WAQ G;  3R93 A;  3TS0 A;  1H9K A;  4A3B B;  2FMM A;  4WOR A;  1F2Y A;  1JQY D;  2K5D A;  2UUB Q;  4HMI A;  4DR7 Q;  1KC8 C;  3T4A C;  1I50 B;  2HD3 A;  1BKB A;  1DON A;  1WTV A;  2NVY B;  2Y0S E;  4KLK A;  2TMP A;  5L37 A;  1YHB A;  1HA6 A;  2PQA B;  1KAW A;  1NAP A;  1G6P A;  1EYD A;  4ZYS A;  1VQ9 A;  3F2C A;  3Q6S A;  3S16 B;  1F9P A;  3RZO B;  4R4Q A;  3QJY A;  2EXZ A;  2K5V A;  2O4X A;  5FLX L;  4YCV A;  2I07 B;  2RSO A;  1B70 B;  3TP8 A;  3CU7 A;  4LF7 L;  1ICW A;  3PO2 G;  3HOX G;  3G7L A;  4NXN L;  1YJ9 A;  1BNZ A;  2IL8 A;  4IOC A;  1AE2 A;  5ELB A;  3BZC A;  3OTO Q;  3DUZ A;  3A8K E;  4CBV A;  4DV6 L;  3QIA A;  3K59 A;  1LTR D;  1QE6 A;  4EGV A;  1KHI A;  5JPM C;  4JI0 L;  3GTP B;  1HNZ Q;  1ROD A;  1N34 Q;  1HR0 Q;  1Y1W H;  2KJX A;  4DR2 Q;  1FGB D;  1YVC A;  2MJ8 A;  3U58 A;  1VQA A;  2L4N A;  4H13 C;  2L1B A;  3KYH C;  2I0Q A;  1D1I A;  2ES2 A;  1NR4 A;  1PH8 A;  1Y69 U;  3CCQ A;  1TWH B;  1YNN D;  2Z4H A;  4A3I H;  4RFB A;  4A3M H;  2KEE A;  1B8A A;  5LL6 X;  3PIP A;  4LF9 L;  3K5O A;  1R4Q B;  4YWM A;  2HUG A;  4R4T A;  1XMQ Q;  2EY2 A;  2FFK B;  2OEO A;  1SYC A;  2RCF A;  1UUP A;  3J81 c;  4QJF A;  1P16 A;  1CZG A;  2MFI A;  4O0A A;  1GVP A;  2WKD A;  1XPU A;  1NJI C;  1EY9 A;  2XRQ D;  4JV5 Q;  1D5Z C;  1VQN A;  2LKV A;  1DD2 A;  1PLF A;  5LHY 1;  3GTQ H;  1L1O B;  3KK7 A;  4A3C G;  3OW7 A;  2QEJ C;  4UP8 A;  5FJ8 H;  1U4R A;  2DUD A;  3HKZ B;  5I4D A;  4K0K Q;  3OHX C;  1ZXT A;  1VQP A;  3T1Y Q;  3CC7 A;  4RGM A;  4JI3 Q;  4LF6 L;  5T1I A;  3PUY A;  1PH7 A;  2AQ3 B;  2VXW A;  5KRU A;  3Q24 A;  1HNW L;  4QGU A;  4OIJ A;  2VNU D;  1RJT A;  2LXJ A;  4DV0 L;  1QUQ B;  1X3G A;  2DN8 A;  3DWQ A;  5JJZ A;  3DHQ A;  2B2W C;  1S3O A;  2IT1 A;  2D5D A;  1SRO A;  2BH8 A;  3J80 i;  4P71 A;  2VZA A;  4DV7 L;  3P20 A;  4AQY Q;  1E1O A;  2CHB D;  1LT6 D;  1LYL A;  2KQ3 A;  4XIG S;  1EWI A;  3J7Z C;  3ICE A;  1JJ2 A;  2E75 C;  4DUY L;  1PH9 A;  3KF6 B;  4C3H H;  4DR4 Q;  3VR6 A;  3HOV B;  2R93 H;  5JVG 3;  1LTS D;  2BOS A;  2F0F A;  4IUP A;  1EOV A;  2VQF Q;  4BY7 G;  1CHQ D;  4U68 A;  1STB A;  3K7A H;  4QY7 A;  1TQO A;  4OWX B;  2H5X A;  3TP5 A;  3PF4 A;  4V19 0;  1S72 A;  3D31 A;  4HJ5 A;  3T1H Q;  1EEI D;  2MP1 A;  1I3Q B;  3K5L A;  2Q8I B;  4K5V A;  1WI5 A;  3DLL A;  3MC0 B;  4AYB G;  1KRS A;  5C44 B;  4BXX G;  4IFD I;  1B9M A;  2GN5 A;  2F0L A;  4A3L G;  4A93 B;  2B63 H;  2K5W A;  3G4S A;  3CCM A;  2VUM B;  2BE5 D;  1B9N A;  4LF8 L;  2ZM6 Q;  4A3E G;  1NR2 A;  4KKS A;  3GTL B;  3CC2 A;  5E4W C;  1BUV T;  2JA8 B;  1AH9 A;  3S1Q H;  4MTN A;  2R61 A;  2GA4 B;  5FLM H;  1B50 A;  2CKZ B;  2A73 B;  2OQK A;  2KCC A;  3QWN A;  1VQL A;  3E0E A;  4LFA L;  1EL0 A;  3GTK H;  2F1M A;  3CF5 A;  1NBW A;  1E3P A;  2EY5 A;  5I6Y A;  1T5E A;  4IOA A;  1WTX A;  1E7Z A;  3GTJ H;  2NZO A;  4L5T A;  4DR6 L;  3K8A A;  5LL6 S;  4AIM A;  1PVO A;  1JB7 A;  4A4I A;  4LNQ A;  1N8R C;  3GD7 A;  1RL2 A;  4HIK A;  1H9S A;  2NYZ D;  2F0M A;  4JBK A;  4DV4 L;  3SK4 A;  4YHH Q;  4UP9 A;  4FP5 D;  3PO3 H;  2OCE A;  2NWG A;  4JI1 L;  1FD7 D;  3J80 L;  4WJW A;  4KHP L;  2DNE A;  3M4Y A;  3K57 A;  3DEO A;  3PUZ A;  2B3G A;  3PGZ A;  4JI4 Q;  4DV1 L;  4RWS C;  3HOW H;  4N8X 1;  2PYK A;  4L5R C;  2PNR C;  2UXD L;  1Q1B A;  4B3M Q;  3I4N B;  4DAY A;  1YZ6 A;  4A3K G;  4GOP C;  2AUJ D;  1XTD A;  3LWE A;  2E5L Q;  4PMB A;  5D3I B;  4IFD H;  1WCM G;  4LUZ A;  1TWG B;  3OSO A;  3U50 C;  2RDF A;  1ENF A;  4BY1 G;  5IP9 H;  3X3M A;  5J3B A;  4Y7N H;  3S1M H;  4C3J B;  1IBK Q;  2XWB B;  3IRB A;  4JI7 L;  1ZYR C;  2JA7 H;  3H0G B;  2NUC A;  5NUC A;  2IY5 B;  4JOI C;  2R7Z H;  4QQB X;  1HA5 A;  4LAA A;  4DR1 Q;  4X3T A;  4A3B G;  1EQR A;  5DEH A;  2D0O A;  2I5H A;  4C3I H;  3NBH A;  3S14 B;  2EYF A;  4A3F H;  1K8G A;  1AEX A;  3P75 A;  3OW2 A;  5IT9 c;  4RGO S;  1B2T A;  4ABN A;  3TDQ A;  1SE8 A;  2K50 A;  3G6E A;  4YCU A;  3ERS X;  1LTL A;  4HN7 A;  1NSN S;  4A75 A;  4GKK Q;  2PI2 A;  5C4J H;  3H3V I;  1D2B A;  1NMG A;  4WRD A;  3M3Y H;  2HQL A;  1CK1 A;  3W1G A;  4GN4 B;  4R4I A;  2Y0S B;  4KV6 A;  1RTO A;  4G4K A;  2R7D A;  1U4P A;  2ICI A;  1WYD A;  2ASB A;  2OQ0 A;  4NXM L;  1FL0 A;  4I7A A;  1F9Q A;  4PZ8 A;  5EPL A;  1GOZ A;  1N9W A;  4R8N A;  4YY3 Q;  4LF5 Q;  2F0O A;  3S24 A;  1LV9 A;  3FEW X;  4R1J A;  3EFX D;  1AW7 A;  5HGT A;  5IWA Q;  4MN3 A;  1B7Y B;  1SE2 A;  3PUX A;  1YJW A;  1SJH D;  1S4Z A;  3CQZ B;  1GUN A;  4B9X A;  1GKH A;  4BBS H;  1Y8N B;  1FNV A;  1FNW A;  1HZB A;  2ZJR A;  3GV6 A;  4NDX A;  3S2D B;  3HOZ B;  3STB C;  1PYS B;  5IOC A;  1LT4 D;  2E2I H;  5C0X G;  5JOB A;  2HQE A;  1JOO A;  4ID6 A;  1NE3 A;  1C48 A;  3QOL A;  4X65 L;  2ZJP A;  2MPM A;  1HZA A;  1GO3 E;  2A19 A;  4XQQ A;  2QF7 A;  1N36 L;  4X66 Q;  5EJW A;  4BBR H;  2Q2T A;  1STG A;  3OWF A;  1QIL A;  3TSS A;  4H44 C;  3HKZ G;  1TY0 A;  5AJ3 Q;  1QCB D;  3BZD B;  3EQL C;  2UU9 Q;  4A3D B;  4KY7 A;  1KIX A;  1T5X D;  4DNT B;  1UAP A;  1BBX C;  5ELE A;  1FGU A;  3H3V H;  2F0S A;  2R3Z A;  3LGJ A;  1J6Q A;  3AEV A;  4RKB A;  4FXD A;  5M5X B;  1QOH A;  5JEA G;  4NW2 A;  3MEH A;  3C1F A;  1WJJ A;  2QGQ A;  5HUR A;  1ET9 A;  1H9S B;  2UXB Q;  1Q8K A;  4PNY A;  1XNR Q;  1VQH A;  5C4X B;  1SNQ A;  5IYD H;  3OPO A;  1VDZ A;  4ZRZ A;  1R9T B;  3I4O A;  1BCP F;  2CCZ A;  5EQ0 A;  2UUC Q;  1XMO Q;  4TSS A;  2JQO A;  4DAP A;  1VQF A;  3HOW G;  1ZKO A;  5JJL A;  1STA A;  3HOV G;  4JCV E;  1G51 A;  2K05 A;  3UE0 A;  5M5Y H;  3RZD H;  1PH6 A;  1PMR A;  1IBL L;  3QO2 A;  3CC4 A;  2MUY A;  3JAM c;  4M1U B;  4L5Q A;  2V4D A;  3PIO A;  5DAU A;  1PTO B;  1K73 C;  4KHZ A;  1CA6 A;  2J4X A;  4IPD A;  5EBC A;  1CFM A;  1OO9 B;  1WOC A;  2ZTC A;  1SYG A;  2F0E A;  2NN6 I;  5C44 G;  5ELN A;  1A63 A;  2CWP A;  2EIF A;  1WD0 A;  4A93 G;  4H02 A;  4JI8 Q;  2VUM G;  4X64 L;  3EVQ A;  3RMH A;  2AKW B;  3TRE A;  3GP7 A;  3NPP A;  2LSS A;  3I8Z A;  5M3M H;  2BH2 A;  1UE1 A;  2JEB I;  1KRT A;  4XXE A;  3W5O A;  1I4R A;  4J8Q A;  1NNX A;  3E9H A;  3A5Z B;  4QF4 A;  1GUT A;  1VQJ A;  2E8G A;  1BCP D;  3RLN A;  1LTI D;  1YNJ D;  3SEB A;  2EYO A;  5CV9 A;  2JE6 I;  4GN5 A;  4QUC A;  5KIX A;  5J39 A;  2NBF A;  1DGS A;  3AB9 A;  2RKS A;  1S5C D;  3I4M H;  3N6R A;  2KBN A;  3STB D;  3EBE A;  1Y1W B;  3NBI A;  3GTM H;  3C3L A;  4K2K A;  5DM7 3;  1I6H H;  3O13 A;  5GAG C;  1U5K A;  3DM3 A;  1N33 Q;  1D6E C;  4JVZ A;  1VQ5 A;  1B3Q A;  4Z9C B;  5GAE C;  4J15 A;  1D5X C;  3J81 i;  4NPS A;  2IWH A;  5M3F H;  4LK1 C;  3BU2 A;  5C4X H;  1ESF A;  3CKI B;  4A3I B;  2IPK D;  4A3M B;  1QVC A;  5EBD A;  5BR8 Q;  5JJK A;  1X65 A;  3A7A B;  1KLU D;  3C46 A;  1STN A;  2HHH Q;  3AQQ A;  2EPB A;  1UNS A;  4OX9 Q;  2WKC A;  2UUA L;  3KLR A;  2AQ2 B;  2JYO A;  3I4N G;  4OL7 A;  1AFP A;  1ILP A;  4G57 A;  1HNX L;  2F0U A;  2RCN A;  3BYY B;  4IZ8 A;  2YTY A;  2D0P A;  2CQA A;  3GTQ B;  1TXY A;  1SNP A;  2PMZ B;  2N78 A;  2NN6 H;  4K5W A;  5E1F A;  4L5S A;  3RUZ A;  2CW0 C;  2VQE L;  4RMF A;  1Q7Y C;  3VR4 A;  2YU9 H;  3KF8 A;  3R3O A;  1NY4 A;  2H1E A;  4KHV A;  3E9I A;  3C1E A;  4FYD A;  2XRS D;  4C3J G;  2XSC A;  2F3W A;  3B6Y A;  4MHE A;  1K3R A;  3F2B A;  1GD7 A;  1PZJ D;  2RVL A;  3X3N A;  1LAB A;  1Y1V B;  4DK0 A;  1D1K A;  1FVI A;  4X62 L;  4IUR A;  4LFB L;  3H0G G;  4NXN Q;  2JA5 H;  3HRZ C;  1I94 Q;  1SYD A;  1K0S A;  4A3G H;  1BF4 A;  1UEA B;  2NZ1 D;  1FR3 A;  1IL8 A;  4DV6 Q;  3A7L A;  2O5I C;  4JI0 Q;  2ZTE A;  2Z6K C;  1MIU A;  1F9S A;  3NXW A;  1A2U A;  2F0W A;  1NMF A;  3H6M A;  5C3E H;  1L1O C;  1Z9F A;  4C3H B;  4ZK9 B;  1C0A A;  1RF2 D;  2R93 B;  3IFT A;  3I4L A;  4CKC A;  5IYD G;  1LO5 D;  5BN4 A;  4YCW A;  3K7A B;  4C1N I;  3VR2 A;  4HR7 B;  2Y0S G;  3WDN A;  3SVM A;  2F0K A;  2F0D A;  1HQM C;  2E2H H;  2K52 A;  3MXN B;  2CFM A;  4NB3 A;  5IYC H;  1VMP A;  2I5M X;  3ULP A;  3CW2 C;  1PRT B;  1W2B A;  2KCN A;  3PSI A;  3KDF B;  1MJE A;  3SK5 A;  3PV0 A;  2K04 A;  4L8J A;  3J81 L;  3LX0 A;  4ZUI A;  3I56 A;  1HJP A;  3I91 A;  1OXU A;  1JB3 A;  3NTH A;  2HDL A;  5FLX c;  4UDU C;  2A69 C;  4BA1 I;  2B63 B;  1VF5 C;  4IUN A;  1VS0 A;  2B8F A;  2A1A A;  1IHZ A;  1IKL A;  5KYI A;  4QB4 A;  3BVM A;  1L0Y B;  5C0X J;  1XTC D;  5CBE E;  2A68 D;  5EPK A;  1S40 A;  4V0B A;  2NVT H;  3S1Q B;  3VR3 A;  4DK6 C;  3HP3 A;  4DV3 Q;  4XYO A;  1F2M A;  5T1G A;  3OTO L;  4GKJ Q;  4DPG A;  3BDL A;  5EPJ A;  3DWP A;  2R92 H;  5C4Z A;  1A0I A;  2NTT A;  3A56 A;  4LF6 Q;  3GTK B;  1TII D;  2O2L D;  3BZK A;  3HOZ G;  1WTW A;  1KXL A;  4KJN A;  1HNW Q;  1TT2 A;  4KKU A;  2FXQ A;  1HR0 L;  2EYM A;  1Q12 A;  4F87 A;  4RHS A;  4PQX A;  4IUT A;  3GTJ B;  4KI0 A;  1UWV A;  1TY2 A;  2QCP X;  5IP7 H;  5COY A;  1ICF B;  2EVB A;  4LJZ C;  3CPF A;  1CA5 A;  3I55 A;  4LWC A;  4DV7 Q;  4KD3 A;  2L11 A;  3M85 A;  3V05 A;  3FMC A;  3A8J E;  1IBM Q;  1VQ6 A;  1X56 A;  1Y1V H;  3PQI A;  5JEA J;  2MQH A;  1VCI A;  1TWA H;  1SYE A;  4KTA A;  2KHI A;  3PO3 B;  1DYQ A;  4R8I A;  3NP8 A;  1OXX K;  1VQB A;  1ML0 D;  4P73 A;  1YBY A;  1ASY A;  1EWH A;  4A3D G;  1IW7 D;  2WB1 E;  3ND8 A;  1Z7T A;  1DOL A;  1CI3 M;  3J80 E;  2ZJQ A;  4JV5 L;  4FF2 A;  1A6X A;  3AMU A;  1P8L A;  3GTO H;  3VYT A;  3I90 A;  2K01 A;  5AFW A;  3ONA B;  3HOW B;  4GOP A;  5D14 A;  1IL2 A;  3JC6 6;  1F77 A;  1KNE A;  1QVG A;  4NKL A;  1IYU A;  1C8C A;  4GNX B;  5C4X G;  4PZ7 A;  1XNQ Q;  4IFD J;  2F0P A;  1E2W A;  1Q90 A;  3T1Y L;  4JI3 L;  4GLX A;  2NZH A;  1OXT A;  4LF8 Q;  1JR0 D;  2NVX H;  1MGS A;  3D4R A;  3URY A;  5BN5 A;  4ALP A;  2JA6 H;  3FKI H;  5EGT A;  4O42 A;  1O80 A;  2IJ0 A;  3HOU H;  4FO2 A;  3C2P A;  2G9H D;  1DCZ A;  4XQJ A;  4ZAI A;  5M5W H;  4Y7N B;  3WWV A;  3S1M B;  4RCN A;  2ALY B;  3F1Z A;  2L9H A;  4JOI A;  4WJ3 M;  4AQY L;  1ASZ A;  4HJ9 A;  2JA7 B;  1YHA A;  2OF1 A;  5CGK A;  4IJH A;  2L5T A;  2N3S A;  1SRU A;  1E24 A;  2NTS A;  2R7Z B;  3OWE B;  3NWS A;  1G8Z D;  3TEH B;  4X3U A;  4XYQ A;  4C3I B;  4XTC S;  3ND9 A;  4DR4 L;  1I6V C;  3I7F A;  4ZKC B;  4A3F B;  2WIN B;  4MNO A;  2IX3 A;  3KF8 B;  1NUC A;  1MHW C;  5IGE A;  1EY8 A;  1EQV A;  4HMJ A;  1Q86 C;  1N32 Q;  3VDY A;  3CCE A;  1XJV A;  4DV4 Q;  1BOS A;  4ODG A;  4LFC Q;  1AE3 A;  2PI2 E;  1PYB A;  5C4J B;  1EZ8 A;  4RA8 A;  1Q8I A;  4ME5 A;  4RAU C;  4J6H A;  3M3Y B;  1WD1 A;  1JC7 A;  4KHP Q;  1KQS A;  2L0C A;  5ISR A;  2RDG A;  2Z4I A;  3GQB A;  3GO5 A;  1SSO A;  2SEB D;  3T13 A;  4BA2 I;  2Z0S A;  3OMC A;  1JE5 A;  1GUG A;  1GUW A;  5LMN L;  1TWC B;  4ZLT F;  4DV1 Q;  5K36 H;  3CP0 A;  1SN8 A;  1VQM A;  2ZM6 L;  1H9J A;  2RSN A;  5IOD A;  1EWC A;  2F4V L;  1HRJ A;  1MBY A;  1LM0 A;  2ID0 A;  4OO1 I;  2EJM A;  2WP8 J;  1V8Q A;  1SNC A;  2KHS A;  1BXT A;  1A3T A;  1VQC A;  3I2Z A;  1Y1W G;  4DAM A;  2M2L A;  3NQT A;  2CVR A;  4J1M A;  4U67 3;  3KFU A;  3PF5 A;  1IYV A;  2OTJ A;  3S1N H;  3NTK A;  2F52 A;  2PMZ E;  1M1K C;  2NVQ H;  3A0J A;  1EUJ A;  4R4O A;  1KAB A;  4BBS B;  2N55 A;  1HR0 W;  4JI2 Q;  3HEJ A;  4A3I G;  2LMC B;  4YIJ A;  4A3M G;  2ICE C;  1SFO H;  1SEB D;  1LTG D;  4JBW A;  4JI7 Q;  3PIO 3;  3H94 A;  1ESR A;  3R2T A;  1WVL A;  2E2I B;  4YWK A;  2HCC A;  3M9B A;  1WTQ A;  1JWM D;  3CRK C;  3NEN A;  4E6I A;  3QOJ A;  1NCV A;  3EIV A;  4P72 A;  1BR9 A;  3MTS A;  2ENB A;  1BO0 A;  1LT3 D;  1KDA A;  5IT9 L;  5FOB B;  4BBR B;  5FJ8 G;  5CYU A;  4HED A;  2VY3 A;  5KGU A;  4JI4 L;  3SXH A;  2GVB A;  1C4Q A;  2IX1 A;  3VYR A;  1X55 A;  3HFZ B;  2JN4 A;  4FXK C;  4DR3 L;  1Y1V G;  2B2Y C;  1PH1 A;  5I2X A;  2KA7 A;  3MEF A;  5KNC A;  2VW9 A;  3SK8 A;  2BA1 A;  1V1O A;  2KED A;  4F7X A;  1RIP A;  3M4P A;  3K58 A;  3U4Z A;  3OIQ A;  3CCV A;  3F2U A;  2LFN A;  2LY7 A;  1K8A C;  4H7B A;  3ZJY C;  3S1R H;  2G5D A;  1VQE A;  4B3R Q;  3L2P A;  1E1T A;  1JIC A;  3HOY H;  2K5N A;  1T9H A;  2B8G A;  4PMC A;  1X9N A;  3UE1 A;  3JAM i;  2B2V C;  4OO1 H;  1TWC H;  2B2T C;  3L0O A;  1J9O A;  3MFG A;  4HID A;  5I2Y A;  4C3H G;  3S9W A;  4HJA A;  2R93 G;  1Y8P B;  5EKK A;  5IYB H;  5M5Y B;  4DFA A;  4B9W A;  3RZD B;  1MSG A;  4DR1 L;  4KJO A;  3MZ5 A;  1RDP D;  3CXC A;  1CKN A;  4K6L A;  3TME A;  3L7Z C;  3UDG A;  2K4K A;  2XGT A;  2FJ2 A;  2J0T D;  1BQQ T;  3OMG A;  3EA6 A;  3E0J A;  4DV2 Q;  1FJG L;  4KD4 A;  3OIP A;  3SR1 A;  2K33 A;  2K7V A;  4LW1 A;  1DOK A;  1G2T A;  3K0Y A;  2LXK A;  4NP5 A;  4A3J H;  4GKK L;  3MXU A;  3ULL A;  4X65 Q;  4EQO A;  2EYH A;  1RCV D;  2FMC A;  1TKW B;  1OXV A;  3KUP A;  4PV1 C;  4DUZ Q;  1O7L A;  2B63 G;  4GN3 B;  2C9O A;  1QG7 A;  1V1P A;  4XDX A;  5IGC A;  1O78 A;  1JCK B;  3S15 H;  4IUV A;  2K5H A;  4Q5V A;  5M3M B;  4JI5 Q;  5FLM G;  2F03 A;  5LMN W;  2WII B;  4DNR B;  1BBW A;  2EYL A;  2D62 A;  3QG1 A;  3PUW A;  1K83 H;  1SDF A;  1SYB A;  4LF5 L;  5JJI A;  4POF A;  1F2Z A;  1PH4 A;  2XVS A;  3MXP A;  4X6A H;  1TS3 A;  1XWE A;  3NHH A;  1YJN A;  1HZC A;  2B39 A;  3CPW A;  1KDC A;  1PTO C;  2UXC Q;  4UP7 A;  4CGY B;  4DXG A;  1VMC A;  2CH4 A;  1GM5 A;  1HHV A;  3D4D A;  3UDI A;  2VB3 X;  4UAI A;  1W6K A;  2F0J A;  2HIX A;  3I4M B;  4DR5 L;  2XIW A;  1JT8 A;  3GTM B;  5K36 G;  1VQD A;  2AHO B;  1X54 A;  2EYP A;  1I6H B;  1BBU A;  2VB2 X;  3PO3 G;  1QZG A;  4DV5 L;  1O7I A;  3CAM A;  5H1S E;  2KHJ A;  2WFW A;  2K03 A;  3A8I E;  2QEX A;  5M3F B;  4WJ4 A;  1K8M A;  1OXS C;  4HSV A;  5KND A;  1ZYR D;  5A35 A;  2OTL A;  3E6Z X;  1I4X A;  3JAM L;  3R8B A;  4JBM A;  2G9D A;  3BG3 A;  4CJ1 B;  4B3S Q;  2WB1 B;  1D5M C;  1QWY A;  5D3D A;  1M8A A;  2H4O A;  3HOX H;  3PO2 H;  1X32 A;  4KY5 A;  2Q2I A;  2Z6B A;  4KK7 A;  4RKL A;  3VYU A;  1GHJ A;  1VQK A;  4L63 B;  4K8J A;  1F9R A;  4FF4 A;  2B2U C;  1BCP B;  5LMU L;  3FPU B;  4JI6 L;  5CV6 A;  4N9P A;  1EY4 A;  4DAV A;  4DNI A;  4IFD G;  4O2D A;  4IUU A;  2SDF A;  4DAY B;  4B3T L;  3PIP 3;  3NEM A;  2YU9 B;  4ZUJ A;  5IP9 G;  1H95 A;  4IPH A;  1J5E Q;  3FP9 A;  4JC0 A;  3NTI A;  4GLV B;  2K32 A;  5ELF A;  5DM6 3;  3W2D A;  4CDC C;  2JA7 G;  2AMC B;  4IPC A;  4POG A;  2JA5 B;  2R7Z G;  4A3G B;  1NTG A;  1XMO L;  1EY6 A;  2VS1 A;  4DF7 A;  2BCO A;  3ERO A;  3S17 H;  4C3I G;  1B3A A;  2Z6K A;  2MHV A;  3RN2 A;  2Q8R E;  2RA4 A;  4A3F G;  1WTP A;  3K5N A;  1L1O A;  1FNU A;  2DNC A;  3NBH B;  5CBA E;  5C3E B;  3T53 B;  1PH5 A;  3NWT A;  3J7Y W;  1HUN A;  2B29 A;  1SMX A;  4PMW A;  1B53 A;  1PZK D;  2MO1 A;  5C4H A;  4A3C H;  3G71 A;  2E76 C;  4P75 A;  3TBI B;  4IQZ A;  2A6E C;  2E2H B;  1QUQ A;  5ELD A;  3F8T A;  2EOT A;  1VQO A;  2XWJ B;  1DOM A;  2ATW A;  2EYJ A;  2V1C C;  1HH2 P;  4FF3 A;  4JI8 L;  4RCO A;  3FVQ A;  3RD4 A;  3D3R A;  5CV8 A;  1HNX Q;  1MI2 A;  3GTG H;  3BJU A;  1XX8 A;  4OXP A;  3SDZ A;  4K6D A;  1K8O A;  3J81 E;  4JPB W;  1G29 1;  3K5M A;  1CKN B;  2L12 A;  2YV5 A;  3KF6 A;  4AH6 A;  3CME A;  2ZXO A;  4JYA Q;  1D8L A;  5IE8 A;  5GQO A;  2NVT B;  1ZEQ X;  3OOC A;  2ZXP A;  2X6G A;  4CDD C;  2CH4 W;  3D4W A;  5GRO A;  3HZX A;  1SJE D;  2CWA A;  4BBS G;  2R92 B;  3KLW A;  3G48 A;  4K14 A;  2WV6 D;  5IGD A;  1U9R A;  1HFG A;  2WAQ E;  3TP6 A;  4BY7 H;  3BYT B;  2F0N A;  2F0T A;  3TN2 A;  2MO0 A;  5FO9 B;  4OEM B;  2E2J H;  2F3V A;  1CSQ A;  2M00 A;  1TWF H;  2K5Q A;  1PRT C;  3MVV A;  1EOT A;  3A74 A;  1N33 L;  1TS5 A;  4PZ6 A;  1JOQ A;  1CKM A;  1PFM A;  3UDX A;  1H9R A;  3IAY A;  4LF4 L;  1BDO A;  1I4G A;  3IL8 A;  2EY6 A;  2F0Q A;  1SMY C;  4XT3 B;  3GV3 A;  4BXX H;  1OTC A;  2B2W A;  3TP7 A;  5I9P A;  1UE7 A;  3GDE A;  4ZCK A;  4BBR G;  1SND A;  4LF7 Q;  1ENC A;  4A3L H;  1TWA B;  1GJX A;  1KLG D;  4EQP A;  4A3E H;  4OX9 L;  2RHQ B;  2DGY A;  3MXG A;  4CJ0 B;  2FHT A;  3RR5 A;  3GTO B;  5EAY A;  2PW7 A;  4IAL A;  2EJG C;  3RLF A;  1K3B C;  3QR8 A;  1E22 A;  2PPB C;  3K7U C;  2XTI A;  5CV4 A;  1XPO A;  1IXR A;  4HAE A;  1YNX A;  2OXP A;  5EKI A;  4TRD A;  4N8F A;  2SNS A;  1YEZ A;  2UUB L;  2NVX B;  4LF9 Q;  2JA6 B;  3I72 A;  3KJP A;  4DR7 L;  3FKI B;  3TQY A;  3CRL C;  1M4V A;  2FIN B;  5GAH C;  3ER0 A;  1KL9 A;  3HOU B;  4QIW E;  1I94 L;  1DZ1 A;  4HIM A;  5M5W B;  5DLQ E;  2BE5 C;  2N49 A;  1JWS D;  4XT1 B;  2F0V A;  1PRT F;  2CQO A;  1MJC A;  5FK9 C;  1EY5 A;  3ERQ A;  1SLJ A;  2BDN A;  3KOJ A;  1CSP A;  1RHP A;  1EQT A;  2XN9 C;  4O1N A;  2PNH A;  4HIO A;  4S3S A;  1ET6 A;  1DXM A;  1F2L A;  2A6E D;  3UI2 A;  3BVZ A;  1HCZ A;  3EJI A;  4KN4 C;  4QCL A;  4GNX C;  4I65 A;  4GZY C;  2A5H A;  3BDC A;  1WTO A;  3FPP A;  4A3K H;  3PMF A;  3RLO A;  4C2M H;  5I6W A;  1HNZ L;  2TSS A;  1N34 L;  5TSS A;  4DV0 Q;  1HTL D;  4OON A;  1JOR A;  4LUV A;  1UE6 A;  4Q0F A;  3E5S A;  2IX0 A;  5M3M G;  4Y52 H;  5IY0 A;  1MSH A;  1WCM H;  2QKI C;  4DR2 L;  1U0L A;  1SE3 A;  2D9U A;  4BY1 H;  1AP0 A;  1O7Z A;  1U4M A;  4OEL B;  3Q8D A;  3M7G A;  3T16 A;  5CMD A;  5M9O A;  3K6O A;  1ENA A;  4ILW A;  5J1Z A;  3KJO A;  4DUY Q;  3SGI A;  4A76 A;  2K28 A;  3ULJ A;  5C0X I;  1PHJ A;  3M4O H;  1BVS A;  1XMQ L;  2N8N A;  4RHR A;  3L3O C;  5A2Q E;  1PFB A;  5CV7 A;  4IPG A;  1EY7 A;  2HDM A;  5IIF A;  4A3B H;  3I4M G;  4DV3 L;  3KLS X;  1B1Z A;  2RQX A;  4GKJ L;  1WTH A;  1PFS A;  2CW0 D;  2MNA A;  2OT2 A;  1PA6 A;  2EXD A;  3Q22 A;  1PRT D;  3IKJ A;  4G7H C;  1I50 H;  3K81 C;  2NVY H;  3S1N B;  2NVQ B;  2PZU A;  3MHB A;  4N9T A;  1Z47 A;  1SMY D;  5M3F G;  2MGS A;  5F2D A;  3WOF A;  2K1B A;  3CHB D;  3N52 A;  1LTA D;  1STE A;  1EZ6 A;  3U4V A;  5I9O A;  4K0K L;  5DNF A;  2AWO A;  4K2L A;  1EU3 A;  3D6W A;  1SFO B;  5C5M A;  2DY7 A;  3S16 H;  1MD2 D;  2E74 C;  2BA0 A;  3RZO H;  1DM0 B;  1K28 A;  4JK1 C;  2WB1 G;  1EYC A;  1IBM L;  3K0X A;  3DXJ C;  1YIJ A;  4DN4 M;  4AYB E;  1Q1E A;  1LLR D;  3H09 A;  1EY0 A;  2QDB A;  1E2Z A;  1B44 D;  2YTV A;  3D8G A;  4OHJ A;  4LFA Q;  4DK3 C;  4OIK A;  2NN6 G;  4NMZ A;  1U4L A;  4MTK A;  3K80 C;  2F3I A;  3GTP H;  1EIG A;  3PUV A;  2PCF B;  4TQU S;  2RF4 A;  4X3K A;  5IT9 E;  1Q46 A;  2DY8 A;  3FRP B;  1SR3 A;  3M4Q A;  4DR6 Q;  1L2F A;  3TZD A;  2B2Y A;  2EY1 A;  2F0I A;  1CM9 A;  4R9W A;  3AU7 A;  1GXD C;  1LT5 D;  1FYC A;  2VQF L;  1TWH H;  5LMN Q;  1XNQ L;  1A8V A;  2JA5 G;  3S2H B;  4A3G G;  1EU4 A;  2EE1 A;  3V96 A;  3NK9 A;  2L55 A;  2EDG A;  3T1H L;  3A54 A;  1E0B A;  2F4V Q;  4JI1 Q;  4FXG C;  3R2I A;  5K5P A;  2WAC A;  2A69 D;  2B2V A;  4P74 A;  3S1R B;  2B2T A;  4QL5 A;  5C0X H;  3HOY B;  3UDF A;  1YHQ A;  3MA2 B;  2EQS A;  1QNU A;  5C3E G;  2HCI A;  5JPN C;  2K75 A;  2M9V A;  3AFQ A;  5A2Q L;  3CD6 A;  4RH6 A;  2UXD Q;  3RNU A;  1RKN A;  3TS2 A;  4APV A;  1VQ8 A;  3U9S A;  3SHL A;  3CCS A;  4UHV A;  1R4P B;  3A55 A;  5IYC G;  3H3V C;  5FO7 B;  4P2C B;  1S5E D;  1N32 L;  4CHT B;  1J8I A;  1XYI A;  2DJG C;  1KDB A;  4LFC L;  4B08 A;  4A3J B;  2A74 C;  1VF7 A;  5JEA H;  3W1B A;  5G3L F;  1LAC A;  3WOE A;  4ULL A;  1JOK A;  2PZW A;  1PH2 A;  1QB5 D;  2XNA C;  3J81 j;  3S15 B;  4RGT A;  3G6J B;  1G2S A;  5HGQ A;  1QNK A;  2YYZ A;  4YHH L;  2SNM A;  3A5U A;  2JK8 A;  5E3F A;  3J80 c;  3PCO B;  2R92 G;  3HOV H;  1K83 B;  1UEB A;  1S5F D;  2I46 A;  1PDQ A;  4DR3 Q;  3TZU A;  4RGN A;  3CCL A;  4FNF A;  2QA4 A;  1CT1 D;  1EFI D;  5IP7 G;  1JJC B;  1KD1 C;  3AFP A;  3J7A F;  1E2V A;  1I3Q H;  2F0H A;  2WAQ B;  1LTB D;  1XXG A;  4M8A A;  4B3M L;  3W3A A;  2DJF C;  2R7F A;  4JI2 L;  5C44 H;  4QUF A;  2RBM A;  3Q23 A;  1PXU A;  4LMQ D;  4HCS A;  1JMC A;  4A93 H;  3S2H H;  3P7J A;  2E5L L;  5ELO A;  2E2D C;  2VUM H;  4NXM Q;  2PO4 A;  3LWU A;  1PV4 A;  3BDO A;  1A3U A;  1AZP A;  1UE5 A;  3ITP A;  3GTL H;  3I3C A;  3P1H A;  2K14 A;  3IFD A;  2JA8 H;  3CMA A;  1CHP D;  2D2C C;  1FJG Q;  4OWT B;  1EIY B;  1IBK L;  3M7N A;  3LNN A;  5CC4 A;  5G3L D;  4JW0 A;  1HFN A;  2GVA A;  3JAM E;  2B2U A;  4K8I A;  4EVO A;  1M90 C;  3NEL A;  3PO2 B;  3HOX B;  3NUC A;  2JP1 A;  3VYS A;  1S5B D;  2KOL A;  1D7Q A;  1EIH A;  3HGB A;  1S5D D;  1MKH A;  4GOP B;  2A6H C;  1TVX A;  1EEF D;  2EZV A;  1A62 A;  2JA6 G;  1C7Y A;  2HIV A;  3FKI G;  3HG9 A;  2QDL A;  3HOU G;  1O7Y A;  4DXF A;  3NE5 B;  5JAV A;  4IN3 A;  2N88 A;  1GHK A;  4UY8 C;  2K6A A;  2C35 B;  2C5C A;  1Q81 C;  4HSP A;  2X69 A;  2J7Z A;  1CQF A;  3DMU A;  2QIL A;  4QIW B;  1N36 Q;  1JE4 A;  4B3R L;  4PG3 A;  3I70 A;  5C6A A;  1SE4 A;  1ILQ A;  3S17 B;  2Q2U A;  1W3S A;  4GS3 A;  4TVA B;  4H0L C;  1XPR A;  1A3V A;  3RN5 A;  1B4O A;  3EN2 A;  4DA2 A;  2HT1 A;  3FDT A;  4ME3 A;  4DKA C;  1HTP A;  1VQ7 A;  4DR5 Q;  1EQQ A;  3I4N H;  1BCP C;  1STY A;  4YY3 L;  2I5L X;  3VR5 A;  1Q82 C;  1YNJ C;  3QB3 A;  3HKZ E;  3DM1 A;  4HCE A;  4C1N K;  1QVF A;  4JG2 A;  1V9P A;  4DV2 L;  5COR A;  5IWA L;  3H15 A;  3AYH B;  4IJL A;  5JVH 3;  2F0G A;  3E3X A;  3H91 A;  4DV5 Q;  1TWG H;  1HZ9 A;  4JBJ A;  5HY6 A;  4G7Z C;  3U9O A;  1JJG A;  1W6J A;  1HPC A;  1EIF A;  3OYY A;  4MIU A;  2QW7 A;  1JWU D;  4FDB A;  5D65 A;  2LS0 1;  1QJO A;  2NB0 A;  4C3J H;  2IHE A;  1RTN A;  4DUZ L;  4ZQ3 A;  1V1Q A;  1I5F A;  4QMG A;  3HKS A;  2PQA A;  1YI2 A;  1TR5 A;  2Q8T A;  3H0G H;  2SOB A;  1AZQ A;  2JSO A;  5BN3 A;  3GTG B;  4I7Z C;  3J7A 5;  5IGG A;  1IBL Q;  4FVM A;  3KLS A;  2AQ1 B;  5LMU Q;  4JI5 L;  4JI6 Q;  1G91 A;  4HJ8 A;  4EX5 A;  1X3E A;  3NQI A;  1HXY D;  3S14 H;  4TKO B;  4UPA A;  1WTR A;  4DK1 A;  2P5Z X;  5IGF A;  4B3T Q;  2RDH A;  4CKB A;  4X66 L;  1PH3 A;  2UXC L;  1A2T A;  1EYG A;  5C3X A;  5KNB A;  3KBG A;  3CCU A;  5AJ3 L;  4DU9 A;  3T56 B;  3MAQ A;  4IO9 A;  4KMU C;  2UU9 L;  3MXN A;  1QZH A;  4BY7 B;  2Q2H A;  3DWA A;  1IKM A;  4X64 Q;  1X6O A;  3KDF A;  5KEE A;  2OWO A;  3SE0 A;  2E2J B;  1TWF B;  1KAA A;  1PTO F;  2Z1C A;  5CR3 A;  2JA9 A;  1PZI D;  1KNA A;  4KKT A;  3L9A X;  5C5L A;  5KYL A;  4C56 C;  4X3S A;  1Y8O B;  1SAP A;  4F8M A;  1I4H A;  2UXB L;  1GUO A;  1WFQ A;  1Y14 B;  1XNR L;  2BDO A;  4AYB B;  4G7O C;  2JEA I;  5E4X A;  5C3W A;  4LUO A;  2UUC L;  4RG1 A;  4B3S L;  1EFW A;  3I73 A;  4A3E B;  1C9O A;  4EQ5 A;  3T51 B;  2A6H D;  4CDF C;  1I4P A;  1X3Q A;  2KUM A;  3CQZ H;  1ONL A;  5CV5 A;  3SK6 A;  1CZW A;  1TU2 B;  1VQG A;  2KCT A;  4BS9 A;  4R4C A;  2X6L A;  1LTT D;  3S2D H;  3HOZ H;  2ZXR A;  5EKL A;  4FF1 A;  3V2T A;  2JXM B;  5IGB A;  4BWG B;  2R6G A;  5ELC A;  4CJ2 C;  1TS4 A;  4ZKB B;  1STH A;  1II3 A;  4YWL A;  5J22 A;  2JA8 G;  1RD9 D;  3HS0 C;  4OGQ C;  4L6T B;  3HOY G;  1I4Q A;  1SBB B;  2ZT9 C;  1J5E L;  4K5X A;  5E7N A;  4OO1 G;  2YTX A;  1L0X B;  1VQI A;  2KEC A;  2AUK A;  4CDE C;  2PW5 A;  2Z8L A;  3TRZ A;  1DJR D;  5IYB G;  5FLX E;  3M4O B;  3ZYY X;  4MZ9 A;  2KEN A;  3BS1 A;  1YNN C;  2UUA Q;  3D6C A;  3CCJ A;  5GAD C;  3F2D A;  1CKO A;  2IHF A;  2L15 A;  3J7A V;  1CUK A;  1K9M C;  1SNM A;  2A68 C;  3Q0A A;  4A3D H;  1PTO D;  2RHS B;  1H9M A;  1KTK A;  1G6Z A;  1V43 A;  4IUQ A;  2VQE Q;  1CQV A;  4GNX A;  4OWW B;  1LUZ A;  3D0F A;  4A3J G;  5M5X H;  2KVM A;  3VA5 A;  1CTM A;  1SNO A;  3BVG A;  5FKA C;  5FO8 B;  1SYF A;  1HUM A;  1EYA A;  1HQR D;  4GLA C;  4LF4 Q;  1PFN A;  2Z9H A;  2A8V A;  1X3P A;  1VQ4 A;  1K0R A;  1AN8 A;  4A3K B;  4C2M B;  4X62 Q;  1A15 A;  1SXT A;  1R9T H;  4LFB Q;  3DEP A;  3KBX A;  4F88 A;  1IYJ B;  2EJF C;  2O5J C;  4KY6 A;  2VL6 A;  3VA7 A;  1WCM B;  1V1P B;  2JJQ A;  2PQE A;  3MFY A;  1YIT A;  4DGZ A;  2AWN A;  4HTH A;  2KCM A;  3MWY W;  4KN7 C;  1GUS A;  4BY1 B;  1IZ6 A;  3CCR A;  2PZT A;  4CKE A;  3FHW A;  1Q3L A;  1X3F A;  1IW7 C;  2ZTD A;  4XQN A;  2F4I A;  4WFN 3;  2IW3 A;  1TS2 A;  1L0W A;  5BR8 L;  1PTO H;  4EQN A; 
#chains in the Genus database with same CATH homology
 1PYW D;  1Z6H A;  3NSW A;  3R93 A;  1H9K A;  4A3B B;  2FMM A;  4WOR A;  1F2Y A;  1JQY D;  2K5D A;  4HMI A;  3T4A C;  1I50 B;  1DON A;  1WTV A;  2NVY B;  2TMP A;  1HA6 A;  1NAP A;  1EYD A;  4ZYS A;  3Q6S A;  3S16 B;  1F9P A;  3RZO B;  3QJY A;  2EXZ A;  2O4X A;  5FLX L;  2I07 B;  2RSO A;  3TP8 A;  3CU7 A;  1ICW A;  3G7L A;  1BNZ A;  2IL8 A;  5ELB A;  3DUZ A;  3A8K E;  4CBV A;  3QIA A;  3K59 A;  1LTR D;  1QE6 A;  4EGV A;  5JPM C;  3GTP B;  1ROD A;  2KJX A;  1FGB D;  2MJ8 A;  2L4N A;  4H13 C;  2L1B A;  1D1I A;  1NR4 A;  1Y69 U;  1TWH B;  1YNN D;  2Z4H A;  4RFB A;  2KEE A;  5LL6 X;  3K5O A;  1R4Q B;  2HUG A;  2EY2 A;  2FFK B;  2OEO A;  1SYC A;  1UUP A;  1CZG A;  2WKD A;  1EY9 A;  2XRQ D;  1D5Z C;  2LKV A;  1DD2 A;  1PLF A;  5LHY 1;  3KK7 A;  3OW7 A;  2QEJ C;  1U4R A;  3HKZ B;  5I4D A;  3OHX C;  1ZXT A;  4RGM A;  5T1I A;  3PUY A;  2AQ3 B;  2VXW A;  5KRU A;  3Q24 A;  4OIJ A;  2VNU D;  1RJT A;  2DN8 A;  3DWQ A;  5JJZ A;  3DHQ A;  2B2W C;  2IT1 A;  2D5D A;  3P20 A;  2CHB D;  1LT6 D;  2KQ3 A;  4XIG S;  2E75 C;  3VR6 A;  3HOV B;  5JVG 3;  1LTS D;  2BOS A;  2F0F A;  4IUP A;  1CHQ D;  4U68 A;  1STB A;  1TQO A;  3TP5 A;  4V19 0;  3D31 A;  1EEI D;  2MP1 A;  1I3Q B;  3K5L A;  2Q8I B;  4K5V A;  3MC0 B;  5C44 B;  4IFD I;  1B9M A;  2F0L A;  4A93 B;  2K5W A;  2VUM B;  2BE5 D;  1B9N A;  1NR2 A;  4KKS A;  3GTL B;  5E4W C;  1BUV T;  2JA8 B;  2R61 A;  2GA4 B;  1B50 A;  2A73 B;  2KCC A;  3QWN A;  1EL0 A;  2F1M A;  2EY5 A;  5I6Y A;  1T5E A;  1WTX A;  5LL6 S;  3GD7 A;  1H9S A;  2NYZ D;  2F0M A;  3SK4 A;  4FP5 D;  2NWG A;  1FD7 D;  3J80 L;  4WJW A;  2DNE A;  3M4Y A;  3K57 A;  3DEO A;  3PUZ A;  4RWS C;  2PYK A;  2PNR C;  1Q1B A;  3I4N B;  4DAY A;  2AUJ D;  3LWE A;  4PMB A;  5D3I B;  4IFD H;  1TWG B;  3OSO A;  2RDF A;  1ENF A;  3X3M A;  4C3J B;  2XWB B;  1ZYR C;  3H0G B;  2NUC A;  5NUC A;  1HA5 A;  4LAA A;  4X3T A;  5DEH A;  3NBH A;  3S14 B;  2EYF A;  1AEX A;  3P75 A;  1B2T A;  4RGO S;  4ABN A;  3TDQ A;  4HN7 A;  1NSN S;  1D2B A;  4WRD A;  1CK1 A;  2Y0S B;  4KV6 A;  1RTO A;  4G4K A;  1U4P A;  2ICI A;  1F9Q A;  5EPL A;  1GOZ A;  4R8N A;  2F0O A;  1LV9 A;  3FEW X;  3EFX D;  1AW7 A;  5HGT A;  4MN3 A;  1SE2 A;  3PUX A;  1SJH D;  1S4Z A;  3CQZ B;  1GUN A;  4B9X A;  1Y8N B;  1FNV A;  1FNW A;  3GV6 A;  4NDX A;  3S2D B;  3HOZ B;  5IOC A;  1LT4 D;  5C0X G;  5JOB A;  2HQE A;  1JOO A;  4ID6 A;  1C48 A;  3QOL A;  2MPM A;  4XQQ A;  2QF7 A;  5EJW A;  1STG A;  3OWF A;  1QIL A;  3TSS A;  4H44 C;  1TY0 A;  1QCB D;  3BZD B;  3EQL C;  4A3D B;  4KY7 A;  1T5X D;  4DNT B;  1UAP A;  1BBX C;  5ELE A;  2F0S A;  2R3Z A;  4RKB A;  4FXD A;  5M5X B;  1QOH A;  5JEA G;  4NW2 A;  3MEH A;  3C1F A;  5HUR A;  1ET9 A;  1H9S B;  4PNY A;  5C4X B;  1SNQ A;  3OPO A;  1VDZ A;  4ZRZ A;  1R9T B;  1BCP F;  5EQ0 A;  4TSS A;  4DAP A;  1ZKO A;  1STA A;  2K05 A;  1PMR A;  3QO2 A;  2MUY A;  4M1U B;  2V4D A;  5DAU A;  1PTO B;  4KHZ A;  1CA6 A;  2J4X A;  5EBC A;  1CFM A;  1OO9 B;  1SYG A;  2F0E A;  2NN6 I;  1WD0 A;  3EVQ A;  3RMH A;  3GP7 A;  3NPP A;  3I8Z A;  2JEB I;  4XXE A;  1I4R A;  4J8Q A;  4QF4 A;  1GUT A;  1BCP D;  1LTI D;  1YNJ D;  3SEB A;  2EYO A;  5CV9 A;  2JE6 I;  4QUC A;  5KIX A;  5J39 A;  2NBF A;  3AB9 A;  2RKS A;  1S5C D;  3N6R A;  1Y1W B;  3NBI A;  3C3L A;  4K2K A;  5DM7 3;  3O13 A;  1D6E C;  4Z9C B;  1D5X C;  2IWH A;  4LK1 C;  1ESF A;  3CKI B;  4A3I B;  2IPK D;  4A3M B;  5EBD A;  3A7A B;  1KLU D;  3C46 A;  1STN A;  2EPB A;  1UNS A;  2WKC A;  3KLR A;  2AQ2 B;  2JYO A;  4OL7 A;  1AFP A;  1ILP A;  4G57 A;  2F0U A;  3BYY B;  4IZ8 A;  2CQA A;  3GTQ B;  2PMZ B;  1SNP A;  2NN6 H;  4K5W A;  5E1F A;  3RUZ A;  2CW0 C;  3VR4 A;  3KF8 A;  3R3O A;  2H1E A;  4KHV A;  3C1E A;  4FYD A;  2XRS D;  4C3J G;  2XSC A;  2F3W A;  4MHE A;  1PZJ D;  2RVL A;  3X3N A;  1LAB A;  1Y1V B;  4DK0 A;  1D1K A;  4IUR A;  3HRZ C;  1SYD A;  1BF4 A;  1UEA B;  2NZ1 D;  1FR3 A;  1IL8 A;  3A7L A;  2O5I C;  1F9S A;  3NXW A;  1A2U A;  2F0W A;  3H6M A;  4C3H B;  4ZK9 B;  1RF2 D;  2R93 B;  3IFT A;  3I4L A;  4CKC A;  1LO5 D;  5BN4 A;  3K7A B;  4C1N I;  3VR2 A;  4HR7 B;  3WDN A;  3SVM A;  2F0K A;  2F0D A;  1HQM C;  1VMP A;  1PRT B;  2KCN A;  3SK5 A;  2K04 A;  4L8J A;  3J81 L;  3LX0 A;  4ZUI A;  3I91 A;  1OXU A;  1JB3 A;  3NTH A;  2HDL A;  4UDU C;  2A69 C;  4BA1 I;  2B63 B;  1VF5 C;  4IUN A;  2B8F A;  1IHZ A;  1IKL A;  5KYI A;  4QB4 A;  3BVM A;  1L0Y B;  5C0X J;  1XTC D;  5CBE E;  2A68 D;  5EPK A;  4V0B A;  3S1Q B;  3VR3 A;  3HP3 A;  4XYO A;  1F2M A;  5T1G A;  3BDL A;  5EPJ A;  3DWP A;  5C4Z A;  2NTT A;  3A56 A;  3GTK B;  1TII D;  2O2L D;  1WTW A;  4KJN A;  1TT2 A;  4KKU A;  2EYM A;  1Q12 A;  4F87 A;  4RHS A;  4PQX A;  4IUT A;  3GTJ B;  4KI0 A;  1TY2 A;  2QCP X;  5COY A;  2EVB A;  4LJZ C;  1CA5 A;  4KD3 A;  2L11 A;  3M85 A;  3V05 A;  3FMC A;  3A8J E;  5JEA J;  1VCI A;  1SYE A;  4KTA A;  3PO3 B;  1DYQ A;  4R8I A;  1OXX K;  3NP8 A;  1ML0 D;  1EWH A;  1IW7 D;  3ND8 A;  1Z7T A;  1DOL A;  1CI3 M;  3J80 E;  4FF2 A;  1A6X A;  3AMU A;  3VYT A;  3I90 A;  2K01 A;  5AFW A;  3ONA B;  3HOW B;  5D14 A;  1F77 A;  1KNE A;  4NKL A;  1IYU A;  1C8C A;  4IFD J;  2F0P A;  1E2W A;  1Q90 A;  1OXT A;  1JR0 D;  1MGS A;  3D4R A;  3URY A;  5BN5 A;  5EGT A;  4O42 A;  1O80 A;  2IJ0 A;  4FO2 A;  3C2P A;  2G9H D;  1DCZ A;  4XQJ A;  4ZAI A;  4Y7N B;  3S1M B;  4RCN A;  2L9H A;  2JA7 B;  2OF1 A;  5CGK A;  2L5T A;  2NTS A;  2R7Z B;  3OWE B;  3NWS A;  1G8Z D;  4X3U A;  4XYQ A;  4C3I B;  4XTC S;  3ND9 A;  1I6V C;  4ZKC B;  4A3F B;  2WIN B;  2IX3 A;  1NUC A;  5IGE A;  1EY8 A;  1EQV A;  4HMJ A;  1BOS A;  4ODG A;  5C4J B;  1EZ8 A;  4RA8 A;  1Q8I A;  4ME5 A;  4RAU C;  4J6H A;  3M3Y B;  1WD1 A;  1JC7 A;  2L0C A;  5ISR A;  2RDG A;  2Z4I A;  3GQB A;  3GO5 A;  1SSO A;  2SEB D;  3T13 A;  4BA2 I;  3OMC A;  1GUW A;  1GUG A;  1TWC B;  4ZLT F;  5K36 H;  1H9J A;  2RSN A;  5IOD A;  1EWC A;  1HRJ A;  1MBY A;  2ID0 A;  4OO1 I;  2EJM A;  2WP8 J;  1V8Q A;  1SNC A;  2KHS A;  1BXT A;  1A3T A;  2M2L A;  3NQT A;  2CVR A;  4J1M A;  4U67 3;  1IYV A;  3NTK A;  1KAB A;  4BBS B;  2N55 A;  3HEJ A;  2LMC B;  4YIJ A;  2ICE C;  1SEB D;  1LTG D;  4JBW A;  3PIO 3;  3H94 A;  1ESR A;  3R2T A;  1WVL A;  2E2I B;  2HCC A;  1WTQ A;  1JWM D;  3CRK C;  4E6I A;  3QOJ A;  1NCV A;  1BR9 A;  3MTS A;  2ENB A;  1BO0 A;  1LT3 D;  1KDA A;  5IT9 L;  5FOB B;  4BBR B;  5CYU A;  4HED A;  5KGU A;  3SXH A;  1C4Q A;  2IX1 A;  3VYR A;  4FXK C;  2B2Y C;  5I2X A;  2KA7 A;  5KNC A;  3SK8 A;  2BA1 A;  1V1O A;  2KED A;  4F7X A;  3K58 A;  3OIQ A;  3F2U A;  2LFN A;  2LY7 A;  4H7B A;  1JIC A;  2B8G A;  4PMC A;  2B2V C;  4OO1 H;  2B2T C;  1J9O A;  3MFG A;  5I2Y A;  4C3H G;  3S9W A;  1Y8P B;  5EKK A;  5M5Y B;  4DFA A;  4B9W A;  3RZD B;  1MSG A;  4KJO A;  3MZ5 A;  1RDP D;  4K6L A;  3TME A;  3L7Z C;  2FJ2 A;  2J0T D;  1BQQ T;  3OMG A;  3EA6 A;  3E0J A;  4KD4 A;  3OIP A;  3SR1 A;  2K33 A;  2K7V A;  1DOK A;  1G2T A;  3K0Y A;  4NP5 A;  3MXU A;  4EQO A;  2EYH A;  1RCV D;  2FMC A;  1TKW B;  1OXV A;  3KUP A;  4PV1 C;  1O7L A;  2C9O A;  1QG7 A;  1V1P A;  4XDX A;  5IGC A;  1O78 A;  1JCK B;  4IUV A;  4Q5V A;  5M3M B;  2F03 A;  2WII B;  4DNR B;  2EYL A;  2D62 A;  3QG1 A;  3PUW A;  1SDF A;  1SYB A;  1F2Z A;  2XVS A;  3MXP A;  1TS3 A;  1XWE A;  3NHH A;  2B39 A;  1KDC A;  1PTO C;  4CGY B;  4DXG A;  1VMC A;  1HHV A;  3D4D A;  2VB3 X;  4UAI A;  1W6K A;  2F0J A;  3I4M B;  2XIW A;  3GTM B;  5K36 G;  2EYP A;  1I6H B;  2VB2 X;  3A8I E;  2K03 A;  5M3F B;  1K8M A;  1OXS C;  4HSV A;  5KND A;  1ZYR D;  5A35 A;  3E6Z X;  1I4X A;  3JAM L;  3R8B A;  2G9D A;  3BG3 A;  4CJ1 B;  2WB1 B;  1D5M C;  1QWY A;  5D3D A;  1M8A A;  2H4O A;  1X32 A;  4KY5 A;  4KK7 A;  4RKL A;  3VYU A;  1GHJ A;  4L63 B;  4K8J A;  1F9R A;  4FF4 A;  2B2U C;  1BCP B;  3FPU B;  5CV6 A;  4N9P A;  1EY4 A;  4DAV A;  4IFD G;  4IUU A;  2SDF A;  3PIP 3;  2YU9 B;  4ZUJ A;  3NTI A;  2K32 A;  5ELF A;  5DM6 3;  3W2D A;  2JA5 B;  4A3G B;  1EY6 A;  4DF7 A;  2BCO A;  3ERO A;  4C3I G;  1B3A A;  2MHV A;  2Q8R E;  2RA4 A;  1WTP A;  3K5N A;  1FNU A;  2DNC A;  1PTO H;  5CBA E;  5C3E B;  3T53 B;  3NWT A;  3J7Y W;  1HUN A;  4PMW A;  1B53 A;  1PZK D;  5C4H A;  2E76 C;  3TBI B;  4IQZ A;  2A6E C;  2E2H B;  5ELD A;  2EOT A;  2XWJ B;  1DOM A;  2EYJ A;  4FF3 A;  4RCO A;  3FVQ A;  3RD4 A;  3D3R A;  5CV8 A;  1MI2 A;  1XX8 A;  3SDZ A;  4K6D A;  1K8O A;  3J81 E;  1G29 1;  3K5M A;  2L12 A;  2ZXO A;  2NVT B;  1ZEQ X;  3OOC A;  2ZXP A;  2X6G A;  3D4W A;  3HZX A;  1SJE D;  2R92 B;  4K14 A;  2WV6 D;  5IGD A;  1U9R A;  1HFG A;  3TP6 A;  3BYT B;  2F0N A;  2F0T A;  3TN2 A;  5FO9 B;  2F3V A;  2M00 A;  2K5Q A;  1PRT C;  3MVV A;  1EOT A;  1TS5 A;  1JOQ A;  1PFM A;  1H9R A;  3IAY A;  1BDO A;  1I4G A;  3IL8 A;  2EY6 A;  2F0Q A;  1SMY C;  4XT3 B;  3GV3 A;  2B2W A;  3TP7 A;  5I9P A;  1SND A;  1ENC A;  1TWA B;  1GJX A;  1KLG D;  4EQP A;  3MXG A;  4CJ0 B;  2FHT A;  3GTO B;  2PW7 A;  4IAL A;  2EJG C;  3RLF A;  2PPB C;  5CV4 A;  4HAE A;  2OXP A;  5EKI A;  4TRD A;  2SNS A;  2NVX B;  2JA6 B;  3I72 A;  3FKI B;  3CRL C;  1M4V A;  2FIN B;  3HOU B;  1DZ1 A;  5M5W B;  2BE5 C;  1JWS D;  4XT1 B;  2F0V A;  1PRT F;  5FK9 C;  1EY5 A;  3ERQ A;  2BDN A;  1RHP A;  1EQT A;  2XN9 C;  4O1N A;  4S3S A;  1ET6 A;  1DXM A;  1F2L A;  2A6E D;  3UI2 A;  3BVZ A;  1HCZ A;  3EJI A;  4KN4 C;  4QCL A;  4I65 A;  4GZY C;  2A5H A;  3BDC A;  1WTO A;  3FPP A;  3PMF A;  5I6W A;  2TSS A;  5TSS A;  1HTL D;  1JOR A;  4Q0F A;  3E5S A;  2IX0 A;  1MSH A;  2QKI C;  1SE3 A;  2D9U A;  1AP0 A;  1O7Z A;  1U4M A;  3M7G A;  3T16 A;  5CMD A;  5M9O A;  3K6O A;  1ENA A;  4ILW A;  5J1Z A;  2K28 A;  5C0X I;  4RHR A;  3L3O C;  5A2Q E;  1PFB A;  5CV7 A;  1EY7 A;  2HDM A;  5IIF A;  3KLS X;  1B1Z A;  2RQX A;  2CW0 D;  2OT2 A;  3Q22 A;  1PRT D;  3IKJ A;  4G7H C;  3S1N B;  2NVQ B;  2PZU A;  3MHB A;  4N9T A;  1Z47 A;  1SMY D;  2MGS A;  5F2D A;  3WOF A;  2K1B A;  3CHB D;  1LTA D;  3N52 A;  1STE A;  5I9O A;  1EZ6 A;  5DNF A;  2AWO A;  4K2L A;  1EU3 A;  3D6W A;  1SFO B;  5C5M A;  2DY7 A;  1MD2 D;  2E74 C;  2BA0 A;  1DM0 B;  4JK1 C;  1EYC A;  3DXJ C;  4DN4 M;  1Q1E A;  1LLR D;  3H09 A;  1EY0 A;  2QDB A;  1E2Z A;  1B44 D;  4OHJ A;  3D8G A;  4OIK A;  2NN6 G;  4NMZ A;  1U4L A;  1EIG A;  3PUV A;  2PCF B;  4TQU S;  4X3K A;  5IT9 E;  2DY8 A;  3FRP B;  3TZD A;  2B2Y A;  2EY1 A;  2F0I A;  1CM9 A;  4R9W A;  3AU7 A;  1GXD C;  1LT5 D;  1FYC A;  3S2H B;  1EU4 A;  2EE1 A;  3V96 A;  3NK9 A;  2L55 A;  2EDG A;  3A54 A;  1E0B A;  4FXG C;  3R2I A;  5K5P A;  2WAC A;  2A69 D;  2B2V A;  3S1R B;  2B2T A;  5C0X H;  3HOY B;  3MA2 B;  1QNU A;  2HCI A;  5JPN C;  2M9V A;  5A2Q L;  4RH6 A;  1RKN A;  3U9S A;  3SHL A;  1R4P B;  3A55 A;  3H3V C;  5FO7 B;  4P2C B;  1S5E D;  4CHT B;  1J8I A;  1XYI A;  1KDB A;  4B08 A;  4A3J B;  2A74 C;  1VF7 A;  5JEA H;  5G3L F;  1LAC A;  3WOE A;  4ULL A;  1JOK A;  2PZW A;  1QB5 D;  2XNA C;  3S15 B;  4RGT A;  3G6J B;  1G2S A;  1QNK A;  2YYZ A;  2SNM A;  5E3F A;  1K83 B;  1S5F D;  2I46 A;  1PDQ A;  3TZU A;  4RGN A;  4FNF A;  1CT1 D;  1EFI D;  3J7A F;  1E2V A;  2F0H A;  2WAQ B;  1LTB D;  1XXG A;  4M8A A;  3W3A A;  4QUF A;  2RBM A;  3Q23 A;  1PXU A;  4LMQ D;  4HCS A;  3P7J A;  2E2D C;  2PO4 A;  3LWU A;  3BDO A;  1A3U A;  1AZP A;  3ITP A;  3I3C A;  3P1H A;  3IFD A;  1CHP D;  2D2C C;  3M7N A;  3LNN A;  5CC4 A;  5G3L D;  1HFN A;  3JAM E;  2B2U A;  4K8I A;  4EVO A;  3PO2 B;  3HOX B;  3NUC A;  2JP1 A;  3VYS A;  1S5B D;  2KOL A;  1EIH A;  3HGB A;  1S5D D;  2A6H C;  1TVX A;  1EEF D;  2EZV A;  3HG9 A;  1O7Y A;  4DXF A;  3NE5 B;  5JAV A;  4IN3 A;  2N88 A;  1GHK A;  2K6A A;  2C5C A;  4HSP A;  2X69 A;  2J7Z A;  1CQF A;  3DMU A;  2QIL A;  4QIW B;  1JE4 A;  3I70 A;  5C6A A;  1SE4 A;  1ILQ A;  3S17 B;  4H0L C;  1A3V A;  1B4O A;  4DA2 A;  3FDT A;  1HTP A;  1BCP C;  1STY A;  3VR5 A;  1YNJ C;  3QB3 A;  3DM1 A;  4HCE A;  4C1N K;  5COR A;  5JVH 3;  2F0G A;  3H91 A;  4G7Z C;  3U9O A;  1W6J A;  1HPC A;  4MIU A;  1JWU D;  5D65 A;  2LS0 1;  1QJO A;  2NB0 A;  1RTN A;  4ZQ3 A;  4QMG A;  1TR5 A;  2Q8T A;  2SOB A;  1AZQ A;  2JSO A;  5BN3 A;  3GTG B;  4I7Z C;  5IGG A;  4FVM A;  3KLS A;  2AQ1 B;  1G91 A;  3NQI A;  1HXY D;  4TKO B;  1WTR A;  4DK1 A;  5IGF A;  2RDH A;  4CKB A;  1A2T A;  5C3X A;  5KNB A;  3KBG A;  3MAQ A;  4DU9 A;  3T56 B;  4KMU C;  3MXN A;  4BY7 B;  3DWA A;  1IKM A;  5KEE A;  3SE0 A;  2E2J B;  1TWF B;  1KAA A;  1PTO F;  2Z1C A;  5CR3 A;  1PZI D;  1KNA A;  4KKT A;  3L9A X;  5C5L A;  5KYL A;  4C56 C;  4X3S A;  1Y8O B;  1SAP A;  4F8M A;  1I4H A;  1GUO A;  4G7O C;  2BDO A;  4AYB B;  2JEA I;  5E4X A;  5C3W A;  3I73 A;  4A3E B;  3T51 B;  2A6H D;  1I4P A;  1X3Q A;  2KUM A;  1ONL A;  5CV5 A;  3SK6 A;  1CZW A;  1TU2 B;  4BS9 A;  2X6L A;  1LTT D;  2ZXR A;  5EKL A;  4FF1 A;  3V2T A;  2JXM B;  5IGB A;  4BWG B;  2R6G A;  5ELC A;  4CJ2 C;  1TS4 A;  4ZKB B;  1STH A;  1II3 A;  5J22 A;  1RD9 D;  3HS0 C;  4OGQ C;  4L6T B;  1I4Q A;  1SBB B;  2ZT9 C;  4K5X A;  4OO1 G;  1L0X B;  2KEC A;  2AUK A;  2PW5 A;  2Z8L A;  1DJR D;  5FLX E;  3M4O B;  3ZYY X;  3BS1 A;  1YNN C;  3D6C A;  3J7A V;  1SNM A;  2A68 C;  3Q0A A;  1PTO D;  1H9M A;  1KTK A;  1G6Z A;  1V43 A;  4IUQ A;  1CQV A;  2KVM A;  3VA5 A;  1CTM A;  1SNO A;  3BVG A;  5FKA C;  5FO8 B;  1SYF A;  1HUM A;  1EYA A;  1HQR D;  1PFN A;  1X3P A;  1AN8 A;  4A3K B;  4C2M B;  1A15 A;  1SXT A;  3DEP A;  3KBX A;  4F88 A;  2EJF C;  2O5J C;  4KY6 A;  3VA7 A;  1WCM B;  1V1P B;  2PQE A;  3MFY A;  4DGZ A;  2AWN A;  4HTH A;  3MWY W;  4KN7 C;  1GUS A;  4BY1 B;  2PZT A;  4CKE A;  1Q3L A;  4XQN A;  1IW7 C;  2F4I A;  4WFN 3;  2IW3 A;  1TS2 A;  3PV0 A;  4EQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...