1IYUA

Lipoyl domain of pyruvate dehydrogenase complex, nmr, minimized average structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
79
structure length
79
Chain Sequence
SEIIRVPDIGGDGEVIELLVKTGDLIEVEQGLVVLESAKASMEVPSPKAGVVKSVSVKLGDKLKEGDAIIELEPAAGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acyltransferase
molecule keywords DIHYDROLIPOAMIDE ACETYLTRANSFERASE COMPONENT OF PYRUVATE DEH
publication title Three-dimensional structure in solution of the N-terminal lipoyl domain of the pyruvate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
total genus 5
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1996-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1iyuA00
2AUJD 3SDZA 5BN4A 3I4LA 2K7VA 3CRLC 1ZKOA 3A7LA 3VR3A 4H0LC 1CFMA 3SE0A 1VCIA 3PUYA 2A6ED 2ZT9C 2YYZA 4JBWA 4TKOB 2A6EC 3PUWA 3PUVA 4RCNA 5JEAH 1IW7D 2O5JC 4PV1C 2BA0A 3M4YA 1B9NA 1K8MA 1LACA 1TKWB 1IW7C 2E74C 3ND8A 4LK1C 3A8KE 4KN7C 3T56B 1GUTA 2D2CC 3AB9A 3VR5A 1FYCA 1YNJC 1Q12A 4KN4C 4IFDH 3D4RA 1HQMC 2EJGC 2NN6G 2EJMA 1H9SB 3DXJC 3N6RA 3OW7A 4JK1C 3T51B 1T5EA 1Q1EA 2E75C 5K36G 1GHKA 1LABA 3H94A 4BA2I 4HR7B 4LJZC 5C0XH 3U9SA 1V43A 2LMCB 1YNNC 1CI3M 4G7ZC 3KLRA 1HPCA 1I6VC 1O7LA 1E2VA 4KKUA 3OPOA 1QJOA 1SMYC 1Z6HA 3FMCA 3VR4A 1GUOA 3MFYA 2B8GA 1DXMA 4DNRB 2EVBA 4KKTA 1Z7TA 3VR2A 5BN5A 4GZYC 1GHJA 3QG1A 4L8JA 2BE5D 1A6XA 3BG3A 2PCFB 3PUXA 1H9MA 1EWHA 3L7ZC 4DK0A 5KNBA 1Q90A 3QIAA 1H9KA 1VF7A 1OXVA 2A68D 3W3AA 1ONLA 4G7OC 3ND9A 2A68C 1GUSA 1Y8OB 1HTPA 2QF7A 3LWUA 5BN3A 1DD2A 1Y8NB 2NN6H 4IFDG 3A7AB 2JEBI 4XIGS 5KNCA 3QJYA 4XTCS 1H9RA 2EDGA 3VR6A 4OO1G 4G7HC 4H13C 2KA7A 2K32A 2L5TA 4H44C 2O5IC 4BA1I 2B8FA 1FR3A 3GD7A 1VF5C 4I7ZC 4KHZA 4TQUS 3WDNA 2DNCA 1E2ZA 1VDZA 1IYUA 1E2WA 1H9SA 1OXTA 1OXXK 2AUKA 1ZYRC 2EJFC 3A8JE 3IFTA 2PPBC 2Q8IB 2BA1A 2AWOA 3MXUA 1G291 1O78A 2A6HD 2V4DA 3HGBA 2BE5C 4OGQC 2NN6I 1B9MA 1HCZA 3M7NA 5JEAG 3LNNA 1OXSC 3IKJA 2R6GA 1Q1BA 1Y8PB 2BDOA 4DNTB 1GUNA 5KNDA 2D5DA 4KKSA 2D62A 2JEAI 3A8IE 3PV0A 1GJXA 1DCZA 3OOCA 1V8QA 4KMUC 5K36H 2JE6I 4DK1A 3BDOA 4IQZA 2E76C 2K33A 2F1MA 2DNEA 3CRKC 2CW0C 1H9JA 2IT1A 2PNRC 3VA7A 5C0XG 1Y69U 3P20A 4KI0A 2JXMB 3GQBA 1TU2B 3D31A 1OXUA 2DN8A 3EQLC 3FPPA 3I73A 3T53B 3RLFA 3TZUA 4OO1H 1IYVA 1CTMA 3I72A 3M85A 1GUGA 1K8OA 5A35A 3PUZA 1PMRA 2A69D 1BDOA 2A6HC 2KCCA 3NE5B 2A69C
chains in the Genus database with same CATH superfamily
1SJHD 2K05A 4HCSA 5IYCG 5J1ZA 2AUJD 4GOPB 2QW7A 3CHBD 5AFWA 3T1HL 1JWSD 2RSOA 5JEAH 1P8LA 2VS1A 3M4YA 3VR6A 3EJIA 2XGTA 3CMAA 3E9IA 5M3FG 3I4OA 1Q46A 1IZ6A 1D7QA 2FINB 3S16H 1H9SB 3RMHA 3PO2B 1KLGD 3S2DB 2RCNA 2MPMA 1HZBA 1V43A 4DR2Q 2NZOA 3IFDA 3UDFA 2HT1A 4HCEA 3GO5A 1CSPA 3FMCA 2EY6A 1UE1A 2MP1A 1UE7A 4BY1H 3R8BA 3BDCA 3VR2A 4EVOA 3HS0C 4NXML 1WTXA 4XT1B 1CQFA 3PUXA 2K5QA 3OSOA 1KAAA 3QIAA 4QB4A 4JI3L 3QB3A 1EY9A 2EYJA 4HEDA 1Y8NB 2R93G 3GTGH 2ICEC 4FF4A 4ZKCB 2B2TA 4J8QA 2OCEA 2F0QA 2YTYA 4DV5Q 2DJGC 5M5YH 2ZTEA 5ELCA 4YHHL 4KJNA 5J3BA 2BA1A 4A3FG 1STNA 1KL9A 1TIID 4R8NA 2MJ8A 1B9MA 1HCZA 4HJ9A 1YIJA 2F0KA 3I3CA 1OXSC 5J39A 4E6IA 3KDFB 1K73C 1K0RA 1IBMQ 1A0IA 4A3JH 4R1JA 2JP1A 2N78A 2JSOA 2NVYH 3FVQA 2UUBL 3BDOA 2OTJA 1PH6A 1HRJA 4GKJL 3HOYG 3HOVG 1KXLA 2RDGA 2ES2A 2CHBD 5GADC 4DR4Q 2R7DA 3TBIB 1O7IA 5LL6X 1BVSA 4UP8A 4FF3A 4C2MB 1WTWA 3EFXD 3V96A 3A74A 3H0GG 4IJLA 4IFDJ 5C4HA 2UXDQ 2KOLA 3SE0A 4LNQA 1G91A 1YI2A 2B63H 2Q8RE 3PCOB 1HHVA 1PH7A 4AYBB 4Q0FA 1B9NA 4LMQD 4KN7C 2UUAL 2K03A 5C3EB 4ABNA 3L9AX 3J80c 2VZAA 4CJ2C 4KHPQ 4OX9Q 3DXJC 3NK9A 3OW2A 3A5UA 1KNEA 2UXBQ 4XQJA 2UXCQ 1A2UA 4Y52H 5CORA 4B9XA 2R92B 2VL6A 3HOWG 3EBEA 1CT1D 1BO0A 2LXJA 3A55A 2G9DA 4KKTA 3K0XA 1S72A 5BN5A 4A3DH 3GP7A 2I5LX 2Z6KA 5DM63 5CV7A 2C9OA 2CVRA 3S1MB 4A93H 2SEBD 2F0GA 4EGVA 1JICA 1KDBA 2FMMA 2JA5B 4IUTA 1U4RA 1BOSA 4AYBE 1Z9FA 1SROA 1YZ6A 2JEBI 1EQTA 1LTAD 4X62L 3ZYYX 2A1AA 2O5IC 5T1IA 1IHZA 4LFBQ 1DOMA 1WFQA 3C2PA 2DNCA 2KJXA 4DV3L 1IYUA 2PPBC 2FXQA 1HUMA 3J81j 2BE5C 1E24A 1SYDA 5EKLA 3L0OA 3DEOA 5EPJA 2GA4B 2N3SA 2JA6H 2KEDA 4NB3A 4A3EH 2F0OA 2NVXB 1EY4A 1D5XC 4B3TQ 4KMUC 4LF8Q 4JCVE 3KK7A 3F2BA 1JCKB 4P72A 1EYDA 3CRKC 1L2FA 3D31A 1NE3A 3T53B 1MJEA 2XN9C 3HOUH 1EYAA 5E7NA 4LF7Q 1IBLQ 4CKCA 3PIP3 1QVFA 1DYQA 1MBYA 2LFNA 2F0FA 4R9WA 4QQBX 1Q81C 2KENA 1SFOB 2B2UA 3GTMB 2R3ZA 4K6LA 5I9PA 1PTOD 2MO1A 1FJGL 4FXKC 4ILWA 1QE6A 2X69A 4IJHA 2F0LA 3WOFA 2WKCA 4J1MA 5C0XI 1F9RA 3OWEB 1L1OB 5C4JB 3S2HB 1C8CA 1E1TA 3OHXC 5CV9A 2IX0A 1GHKA 4J6HA 5CV6A 1D1KA 1EIGA 5EKKA 4BA2I 1EUJA 2NVQH 3S15B 5M3FB 2V1CC 4LF9Q 3STBC 5IT9L 3W2DA 4DUZQ 5C44H 4KKUA 4OONA 4QMGA 4OELB 3S14H 4A76A 2R7FA 4OWWB 1NSNS 1CZWA 3CC4A 4JI0Q 2A19A 4P71A 5JPMC 1VQFA 1XWEA 1A6XA 1EWHA 5L37A 4GN3B 1I3QH 1MJCA 1UEBA 1L1OC 5FK9C 3C1FA 1JOQA 3PO3H 2ZXPA 4XDXA 1EEID 3T1HQ 1P16A 1Q3LA 2QF7A 2WB1E 4L6TB 1ENCA 3MEHA 3P7JA 4XTCS 1MKHA 4A3IG 1UWVA 2AWNA 1GO3E 3SK8A 2F0HA 3TSSA 4DV6L 3X3MA 1A3UA 4JI7L 1L0YB 4LUOA 2E2HB 3JAMc 1E2WA 1OXXK 4KK7A 5M5WH 3P1HA 4N8FA 3L3OC 2R93B 3MXUA 4HAEA 2E2JB 1QNUA 1F9QA 3S1NH 2KBNA 3M7GA 4HJAA 3S24A 1PTOB 1X3GA 1CM9A 2A74C 5I4DA 3KLSA 3CCEA 2F03A 1V9PA 4A3FB 4HIKA 4FO2A 2JE6I 1NNXA 1TWAB 1FNWA 3KYHC 2JA7H 4CBVA 4DAVA 2ZXRA 1G2SA 4MNOA 3I7FA 3M4QA 3QO2A 1SNPA 1A2TA 3J81c 1X3QA 4ZCKA 1CTMA 1HZAA 1PZID 3J7ZC 1K0SA 2KHSA 2KCCA 1AFPA 3HOYB 3HOVB 3PGZA 1ZEQX 3J7AF 5IP7H 1VCIA 2ZT9C 1STGA 2F0IA 4EQPA 2VUMG 3BJUA 4RCNA 4YHHQ 2BA0A 3H0GB 1WTHA 3A8KE 1VQGA 2D2CC 4I65A 4TSSA 4UY8C 2MUYA 4IFDH 3GTKB 5JEAJ 2NBFA 5IYBG 3QWNA 1NJIC 2IHEA 3FKIG 1EIFA 2AQ1B 3Q22A 5IGGA 2FHTA 1TWFB 2UUBQ 4HSPA 5CV8A 1XXGA 4GKJQ 1E2VA 2AQ3B 2IY5B 2BH8A 1EFID 1GUOA 1TS4A 2KQ3A 3I56A 3SVMA 3U4ZA 3RZDB 1X9NA 1EOVA 1HQRD 4X3TA 5IGBA 2WFWA 3HOWB 5ELBA 4P75A 5C4XH 4HMIA 4JV5L 1ONLA 4Y7NB 1K83H 4DK6C 1S40A 1JMCA 2UU9L 4RKLA 1JB7A 1MIUA 3BVMA 5JVG3 1PFNA 3J7A5 2QCPX 1IBML 1NMGA 4B3SQ 1YJWA 2K5NA 4NMZA 1OO9B 4TVAB 4EQOA 1RD9D 3HOZG 3KFUA 1QB5D 1R9TH 3ULJA 1N33Q 2H4OA 4ZAIA 4CHTB 1EIHA 4TRDA 4BY1G 3I70A 4NDXA 4ZRZA 4ZUJA 3PIO3 3FDTA 4UAIA 5ELDA 1IXRA 3B6YA 1BBXC 2JEAI 3PV0A 2PZTA 1ML0D 1B7YB 3N52A 4DNIA 4WJWA 2E76C 5ISRA 1O80A 1JR0D 2PYKA 1VQ5A 1Y69U 3D6CA 2EYHA 4G57A 4N9TA 2F52A 1LT4D 4DR5L 2UUCL 3K6OA 3HKSA 2F3VA 4WFN3 1QOHA 1D8LA 2ZTDA 2N8NA 1H9RA 3NE5B 4X62Q 1NMFA 2K52A 3K5LA 5BN4A 1WTQA 1EZ8A 1QCBD 2OEOA 4KHPL 2OXPA 1CKNB 1GUWA 1LT3D 1PFSA 4DV3Q 1N9WA 3G4SA 4B3ML 3ZJYC 1IW7D 4RGNA 4DV4Q 4FXGC 3T56B 1NY4A 2CQOA 1NUCA 3I4NG 5M5XH 4A3JG 1IKLA 2IW3A 2E75C 1KD1C 4YWMA 1JQYD 4PZ7A 3EVQA 3GV3A 5EBCA 3BYTB 3CQZH 3T1YQ 4F7XA 1TS3A 3ULLA 3K80C 3M3YH 3KJOA 4K2LA 5FJ8G 4PZ8A 1HUNA 1K8AC 4IPHA 4FF1A 2CWAA 1F9PA 1GHJA 2G9HD 4L8JA 3HOXH 1BF4A 1A62A 2MNAA 1M4VA 1EZ6A 4JI1L 3RUZA 1FJGQ 1ESRA 1FGUA 2EY5A 3D6WA 1Y8OB 5BN3A 4HN7A 5DNFA 5IYDH 3A7AB 4DAYA 4RG1A 4XYOA 4OO1G 3KBXA 1KDAA 1BR9A 2MHVA 2N55A 2K04A 2DY7A 1YHQA 2ATWA 1R4PB 1A63A 4B08A 5IOCA 4A3BG 1FR3A 3CAMA 1BNZA 1RL2A 1K9MC 4GLXA 4X6AH 3TEHB 5IIFA 3MXNB 2MQHA 4LF8L 2Z4HA 1G291 3J80i 4A3IB 5ELEA 3VYUA 1SE8A 3H3VC 1HNXL 4GOPA 1IKMA 1PH3A 1NR4A 3MFGA 5KNDA 4LF7L 1ET9A 2D62A 2X6LA 5FO8B 3MA2B 4QIWB 1DCZA 2B29A 3CCUA 4A93G 3M4OB 1WYDA 1B8AA 3UI2A 4DR6L 1NCVA 2E2DC 4UPAA 4JI5Q 1TWGH 2CQAA 1B53A 5GAGC 4ZYSA 3RZOH 4X66Q 3SXHA 3GTPB 4JI7Q 1B4OA 4XQNA 2Z6BA 5FO9B 4LFCQ 1NR2A 3G6JB 4DAYB 3P75A 2RSNA 1I4XA 2E74C 1IW7C 4DFAA 3VDYA 4DUZL 3LWEA 1KABA 3GDEA 2QDBA 3K7AH 5GAEC 3BYYB 2WP8J 2NN6G 4L5TA 1KRSA 1SYFA 2WINB 2OTLA 5E4XA 4JI0L 3TP7A 2VUMB 4DPGA 2WB1G 3K0YA 3FPUB 1YNND 4JVZA 1TT2A 4HSVA 5KEEA 3FP9A 1KIXA 2NZ1D 2B8GA 3FKIB 5K5PA 4LF5L 5IODA 2NTSA 3DEPA 4JOIC 1CA6A 4U68A 1Y1VG 2ZJPA 1G6PA 2F0TA 3ER0A 1JJGA 4H7BA 2F0MA 3PO2H 4I7AA 3GTOB 1N34Q 1PTOF 4NXNL 3KDFA 1JWUD 5TSSA 2K01A 1SNOA 1DD2A 1TS2A 2JA9A 3QJYA 1WCMH 2CCZA 5AJ3L 3U50C 4GOPC 5E3FA 3CKIB 4BA1I 4IZ8A 4BXXH 1DZ1A 4C1NI 1VQ4A 1E2ZA 4A3GH 2F3WA 4R4CA 2R61A 1EQVA 5GROA 2Q8IB 5HGQA 3S16B 2NN6I 1VQ8A 1BCPF 1PFMA 2VY3A 3RNUA 1Y8PB 2IPKD 5ELOA 3HOZB 1PFBA 1TVXA 1SN8A 2CKZB 3NBHB 1RHPA 1TWCB 1V1OA 3O13A 1K3RA 4UP9A 2ENBA 4MTKA 4PMWA 4BY1B 1ASYA 1FGBD 4BY7G 4JV5Q 4P2CB 1BUVT 4HJ7A 3K57A 1FNUA 3GTJH 2R7ZH 1Q82C 3MWYW 4GKKL 4HIOA 1GUGA 3K8AA 2KUMA 2HCCA 2UU9Q 1T5XD 3Q8DA 4QL5A 5IT9c 4RHRA 2JA8G 4GN5A 3VR3A 1WI5A 3OWFA 1V1PB 2MFIA 4H0LC 3PMFA 2SOBA 4BBRH 1GXDC 3F1ZA 3EROA 3FEWX 4EX5A 1EFWA 1TKWB 3VYTA 3Q6SA 3X3NA 3BZDB 3TN2A 2KECA 3CCVA 2RDFA 3CF5A 1XYIA 4C2MH 3JAMi 2JJQA 3NQIA 1AZQA 1SYBA 1LABA 1I4PA 4LJZC 1YITA 4DR3L 1MD2D 2LMCB 4HMJA 1YNNC 3H91A 1CI3M 3DMUA 2M2LA 3I4NB 1QUQB 4A3JB 5G3LF 1QJOA 1TWHB 1U4PA 4DR5Q 2UUCQ 1K8GA 5C3EH 4CKEA 4BWGB 3GTLH 1ET6A 4O42A 1F2ZA 3E6ZX 3J81i 4B3SL 4QY7A 5C5MA 5FLXc 5IGEA 1VQCA 3C46A 4B3MQ 2R92H 1J5EQ 4IFDG 2WV6D 1A15A 3AEVA 1N33L 2L1BA 2K32A 4H44C 2VB3X 3T16A 1VF5C 4K2KA 3RLNA 1YNXA 3DWQA 4ZQ3A 4A3MG 4CDFC 3S1MH 2AWOA 2F3IA 4C1NK 1WVLA 1JE5A 1I6HH 4KHVA 5C5LA 2XNAC 4A3BB 2R6GA 1S3OA 4NW2A 2HD3A 2SNSA 3TP8A 5JPNC 3A8IE 4GNXB 1EY0A 2LKVA 1HZCA 1LV9A 4DGZA 5I2XA 2K33A 5M3MH 1Y1WH 1W2BA 3QOLA 2DNEA 1SNDA 2Q2HA 1DJRD 5C0XG 1STYA 4KI0A 4JI1Q 1L1OA 3GQBA 5JVH3 1TU2B 1S5CD 3D8GA 4DV4L 1N8RC 1ENAA 4MZ9A 5FLMH 4A93B 1VQHA 1YVCA 2NVTH 1X54A 3TMEA 1SMYD 3S1RH 2HHHL 2NVXH 4A3KG 1R4QB 4DAMA 2RHSB 2Z8LA 3KF8B 4F87A 4JI2L 1N32L 4KY7A 4IFDI 2E2IB 3PUWA 1O7YA 3I4MG 4DR7L 3T1YL 4GNXC 2GVBA 4OWTB 1WD1A 1HTLD 1N36L 1S5FD 4EQ5A 1KDCA 4KN4C 2X6GA 4PMBA 4C3JG 4EQNA 2ZJRA 1HNXQ 1Q8KA 3J81E 4JK1C 4OXPA 1CQVA 2F0NA 4FVMA 3KF6B 4V0BA 4DF7A 1SFOH 3DWPA 3GTMH 2QKIC 1J6QA 1CSQA 4IUVA 4G7ZC 2B2VA 2RHQB 4DR6Q 3OPOA 2EYLA 2K28A 4OIKA 4FDBA 1SNMA 4A4IA 1QWYA 3A56A 1F77A 4RGMA 5IYCH 1M8AA 1LTLA 2WB1B 1MHWC 3S2HH 1JJ2A 2PCFB 4QCLA 1DOKA 3MHBA 5M3FH 3CCMA 5IGCA 2EIFA 1Y1VB 4G7OC 1GUSA 1GM5A 4YIJA 1I50H 1BCPD 1GVPA 2B8FA 5EJWA 1RTNA 1TR5A 2EJFC 3CD6A 2Z1CA 2EPBA 2ZM6L 2DUDA 1EYCA 2A6HD 1NTGA 4OGQC 3MZ5A 1ESFA 1B3AA 4LF5Q 2NVQB 4C3IG 1RCVD 1GUNA 2D5DA 2H5XA 4N9PA 3A54A 1FVIA 4JI5L 1VQMA 1PDQA 4L63B 1VQNA 3R93A 4B9WA 3HOXG 3S14B 5NUCA 1ICWA 1PYSB 4X66L 1EQRA 2YU9B 4K14A 2OQKA 2RA4A 1UEAB 3AFPA 4A3CH 3VA7A 2PI2E 1XMQL 3W1GA 2R93H 4NXNQ 1EWIA 2DN8A 2E2JH 3TZUA 4LFCL 2KCTA 4APVA 3U9OA 4DN4M 3PUZA 2JYOA 1I3QB 1SLJA 3NELA 4LUVA 5AJ3Q 3HG9A 1NAPA 3KUPA 4BY7B 1SXTA 3HEJA 2YTXA 4A3FH 2FMCA 1JT8A 3NTKA 1TWAH 3SGIA 1XPOA 3PIPA 2O5JC 4PV1C 2JQOA 4KD4A 2B2VC 5G3LD 2JA8B 1JOKA 2IX1A 2D9UA 2EOTA 4JBMA 3OW7A 3BVZA 1T5EA 1Q1EA 1SYEA 3HOYH 5FOBB 2K14A 3TDQA 3CMEA 1BCPB 2F0SA 3VA5A 4K8JA 1F2YA 1N34L 2VB2X 2K6AA 2Z0SA 1PRTF 3MFYA 1PTOC 4CJ1B 1PHJA 4AQYL 1ICFB 1SE2A 4MN3A 4KTAA 5DLQE 4A3LG 3EIVA 4GKKQ 1DGSA 3GTKH 1JORA 4S3SA 2MGSA 4HTHA 2C5CA 1GD7A 2VXWA 2Q2UA 4IUNA 1LTID 5GAHC 5HGTA 1LTTD 1UAPA 1S5ED 1EYGA 5IGFA 4BBSG 5GQOA 2EXDA 1G6ZA 1BCPC 3HFZB 2M00A 2CW0D 3RZDH 1CKMA 1ENFA 1QVCA 3MXGA 4RH6A 2ZJQA 2F0PA 2WAQE 4DR3Q 2OWOA 3ICEA 2OT2A 3NTHA 4HJ8A 2BOSA 4RCOA 4JG2A 3J7AV 4PQXA 5JEAG 3LNNA 3M9BA 1HR0L 1C7YA 4A3MB 1CKNA 3NP8A 2Z9HA 3D3RA 3GTQB 2K4KA 3CCQA 3JC66 1GOZA 3SK5A 2EYFA 1J8IA 3D0FA 1KHIA 2K5WA 3G71A 4GN4B 4K5XA 4R8IA 3I73A 3EQLC 2RBMA 3CPWA 1WTPA 4UP7A 2EZVA 1WCMG 2AMCB 2QILA 3I90A 4IOCA 4R4OA 1XNQL 5E4WC 3S1QH 1K83B 4DK3C 4A3GG 4JBWA 2Q8TA 3PUVA 1JB3A 1X3EA 1LACA 1W6JA 3ND8A 1E7ZA 4GS3A 3VR5A 1Q12A 2M9VA 1XPUA 3D4RA 4NKLA 4A3KB 4RFBA 1Q86C 2EJGC 1WJJA 1SSOA 1VQJA 3N6RA 3T51B 1CHPD 1HH2P 5EPLA 3I4MB 1SE3A 1IBKL 1RJTA 2D0OA 2BCOA 4WRDA 2PO4A 4OHJA 2QA4A 2F0UA 3NENA 5IE8A 3T4AC 4RHSA 1Z6HA 4C3JB 2R7ZG 1PVOA 5JJIA 1DXMA 1J5EL 4JI6Q 3F2DA 1U0LA 4GZYC 3I8ZA 1VS0A 1TS5A 3FRPB 1D1IA 1L0WA 3MXNA 5BR8Q 4ID6A 4IPGA 2PZUA 2LY7A 4IO9A 1H9MA 2HHHQ 4R4TA 4BBRG 2RKSA 2QGQA 1Q90A 1HNWQ 1YJ9A 4JI2Q 1LT6D 1N32Q 1H9KA 1OXVA 1VQPA 4DR7Q 2HQLA 3DM3A 3C3LA 2EE1A 3CPFA 1N36Q 1EU3A 2PMZB 2J4XA 2OF1A 3MVVA 4NP5A 5ELNA 4H13C 1PH8A 3GD7A 1SEBD 1ZYRD 5D3DA 1B1ZA 1C9OA 3H3VH 2A8VA 2WIIB 2Y0SG 2IWHA 5M9OA 4FYDA 2V4DA 2PQEA 2B63G 2LSSA 2NYZD 2E5LQ 2F0VA 2XRQD 2HCIA 4DNTB 1HXYD 1XNRQ 4JOIA 4C3HH 4K5WA 1GJXA 2CH4W 4AIMA 2K5VA 1EEFD 1LUZA 1V8QA 1PZKD 1EY5A 3IRBA 1F9SA 5T1GA 3F2CA 5FO7B 5CYUA 1SYGA 2FJ2A 2ALYB 4C3IB 1IL8A 3UE0A 4A3IH 2DJFC 3J81L 2EY1A 1MSHA 1RKNA 3HOXB 1SMXA 2A69D 2NZHA 2L9HA 4UHVA 2PMZE 1ILQA 3AFQA 4MTNA 2B2WA 4A3DG 3TREA 3F2UA 4DV0L 3G7LA 4TKOB 5CGKA 3M4OH 1PYWD 5CBAE 3CCSA 2ZM6Q 2LS01 4R4QA 1PH9A 2NWGA 2I0QA 1PRTD 4ALPA 2E8GA 2AQ2B 3S17H 1HQMC 3KJPA 4FNFA 1AH9A 2WACA 2NUCA 5M3MG 1Y1WG 1FL0A 4DR1L 3NBIA 4N8X1 3KLRA 2PW7A 1ASZA 1M90C 3PSIA 4PNYA 1XMQQ 3S9WA 4YCWA 1ZXTA 5DM73 4DNRB 2K5HA 2JA6G 4RAUC 3PQIA 5JAVA 4O2DA 3QG1A 2XRSD 2ICIA 5D65A 4A3EG 3BG3A 5LL6S 3SK4A 2Q2IA 2ID0A 3OMGA 1W3SA 1XX8A 3TS2A 1TWGB 4YY3L 2RQXA 1VF7A 2HDLA 3LWUA 4X3UA 2BH2A 3E0EA 4XXEA 5IYBH 1STBA 2PQAB 3RN5A 2HIXA 3FKIH 1SNQA 3NBHA 4OIJA 4XIGS 3CP0A 3HOUG 1PH1A 2L5TA 3KLWA 1WTOA 1F2MA 2B3GA 1KLUD 4ME3A 5LMUL 4R4IA 1IL2A 3NPPA 1VDZA 4KJOA 1VQEA 4BBSB 1ZYRC 1D5MC 3A8JE 3IFTA 1FNVA 3GTOH 4LWCA 3J80E 3S2DH 4HJ5A 1SR3A 1RTOA 1XMOL 4PZ6A 3M7NA 5FLXE 4CGYB 4X65L 1VQ6A 4AQYQ 2KCNA 5EBDA 1V1PA 1E3PA 2NTTA 5EGTA 3MXPA 1VQLA 4X3KA 1II3A 2F4IA 1PRTB 2B2WC 1Y14B 3W5OA 4B3RL 1H9JA 4IURA 1AE2A 1KC8C 5KGUA 3FPPA 2L0CA 4Z9CB 3T13A 1IYVA 1LTSD 3RLFA 1TXYA 5C44G 1UNSA 4LF4L 2I46A 4NPSA 2VQFL 4O1NA 2A69C 3RN2A 4JI8L 2IJ0A 3CRLC 1QUQA 2VQEL 3HOZH 2SNMA 1CFMA 2IHFA 4XT3B 1TWCH 4LF6L 1UUPA 2RDHA 2XTIA 1WCMB 3CC2A 2A5HA 2O2LD 2RCFA 1HFNA 4RMFA 4F88A 2JK8A 2F4VL 4IOAA 3PO3G 2L11A 5LMNL 1PRTC 4J15A 1O7ZA 4UDUC 4A3GB 4ZKBB 1HR0Q 4U673 2A73B 3TP5A 3Q24A 1SJED 1B50A 2NB0A 1SAPA 4A3CG 2H1EA 2F0WA 2KEEA 3G48A 3NXWA 3TS0A 3AU7A 3GTGB 5JJZA 4FXDA 3D4WA 1Z7TA 4JPBW 2WAQG 1VQIA 2IX3A 3TQYA 4IUPA 4JBKA 1U9RA 2BE5D 5M5YB 1XNQQ 4DU9A 5KIXA 3GTJB 2R7ZB 3U58A 4RKBA 2EQSA 5KNBA 2YTVA 1PXUA 1HA5A 1VQ9A 2JA7G 3V2TA 3I4NH 4PG3A 4F8MA 5ELFA 4GNXA 4YCVA 1TWHH 2KHJA 4KLKA 5KNCA 4X64L 1X32A 4QUFA 2XWJB 1EOTA 4BBRB 4MIUA 2NVYB 1B2TA 5IWAL 1BBWA 3FHWA 5JJLA 4JI4L 1IBKQ 2KVMA 5FJ8H 4IALA 5IP7G 5IP9H 3V05A 1GKHA 1FD7D 4RGOS 4L5SA 1Q7YC 4A75A 1EWCA 1LTRD 4JC0A 4RGTA 1CUKA 1S5BD 3OTOL 5IY0A 3R2TA 3KF8A 5LHY1 1V1QA 1LO5D 1KNAA 2Y0SB 3E5SA 1CHQD 1SE4A 4DV7Q 5K36H 3HP3A 4DV1Q 1AE3A 4KV6A 2B63B 4YWLA 1AP0A 1RF2D 3GTLB 4OO1H 3BVGA 1U4MA 1AEXA 2AKWB 1HNZL 5A35A 3KF6A 1PMRA 2HIVA 4A3BH 1BDOA 4DUYL 3MTSA 3STBD 2JA5H 1B44D 3SDZA 4DAPA 4ZLTF 5FKAC 1ZKOA 1PH5A 1LT5D 2DY8A 3VYRA 5C0XJ 5I9OA 4POFA 1BQQT 5HURA 1WTRA 4LK1C 5C4XG 2AHOB 1RDPD 1GUTA 3K59A 5CV5A 3Q23A 4A3DB 2EYOA 2K75A 4H02A 4PMCA 3JAME 1HR0W 2B2TC 4YWKA 3R2IA 1PZJD 2PI2A 1S5DD 5A2QE 4JI6L 2Y0SE 2K1BA 5CR3A 1I6HB 5BR8L 1JC7A 3RLOA 4IN3A 3TP6A 4JYAL 1HPCA 1LYLA 1VQ7A 2E2IH 1HNWL 1CZGA 3R3OA 1JE4A 2K5DA 3NEMA 1UE6A 1SNCA 5M3MB 2ZXOA 1Y1WB 1YEZA 5EAYA 1X3FA 3OIQA 4K0KL 2F0JA 1LM0A 2ZTCA 3SK6A 1PA6A 2D0PA 1WD0A 4DV0Q 3W3AA 4GLAC 3ND9A 5EKIA 2NVTB 1HTPA 2JA6B 3NUCA 1XTDA 3S1RB 2NN6H 3WWVA 4A3EB 1G2TA 3KOJA 2E5LL 1QNKA 1XNRL 4CKBA 4KD3A 1QILA 1E1OA 2QDLA 5C4JH 1HZ9A 4WJ4A 1BXTA 1AW7A 3CU7A 5KRUA 4DR1Q 3NTIA 3HOUB 4QGUA 1Y1VH 4FP5D 3S15H 3QR8A 2QEJC 2FFKB 3LGJA 1U4LA 3UDIA 4LFAL 4WJ3M 2GVAA 2SDFA 4RWSC 1JOOA 4IQZA 1RIPA 5C3XA 3C1EA 1A8VA 1BBUA 1K3BC 1I94L 4DV2Q 1KAWA 1VMCA 4YY3Q 3MEFA 1X56A 3I72A 1PYBA 5CC4A 4IUQA 5J22A 2Z6KC 1TY2A 2F0EA 5CBEE 3ERQA 5JJKA 2K7VA 5LMUQ 2IL8A 3ONAB 1I50B 1X65A 2YYZA 1HA6A 1CA5A 3HRZC 4QJFA 5C44B 2G5DA 1XJVA 1VMPA 2YU9H 3UE1A 3F8TA 4P74A 4IPDA 3I55A 3CCJA 2E2HH 2MO0A 1YNJD 3AB9A 1XMOQ 1PH4A 2I5HA 4DXGA 5D14A 4X65Q 1YHAA 4C3HG 3HKZG 5IYDG 4HIDA 4OWXB 3H94A 4Q5VA 4HR7B 1JWMD 1PTOH 4BY7H 2CH4A 4FF2A 4WORA 1B3QA 4CDEC 3PO3B 3BS1A 1O7LA 4B3RQ 1SMYC 2N88A 2Z4IA 2L12A 1XPRA 3K7UC 3H15A 2JA8H 4L5RC 2GN5A 3MC0B 3KLSX 2JN4A 4LF4Q 1I4RA 2VQFQ 1H95A 2HQEA 2P5ZX 4JI8Q 3J80L 3G6EA 5D3IB 3CCRA 5M5WB 1UE5A 3WOEA 2VQEQ 1YBYA 5IGDA 4L5QA 1LLRD 1X6OA 3E0JA 5FLXL 1QVGA 2A68D 4LF6Q 3HOVH 3S1NB 3ERSX 1EIYB 4ULLA 2WAQB 1AN8A 1EY6A 1MGSA 3AQQA 3AYHB 2F4VQ 4NXMQ 4LUZA 1I4HA 5LMNQ 3H3VI 3SR1A 4G7HC 2KA7A 3H0GH 2B2UC 1J9OA 2QEXA 1XTCD 1MI2A 3WDNA 2XVSA 4JI3Q 2B39A 5F2DA 3MAQA 2JA7B 4X3SA 1OXTA 2EY2A 3DLLA 1EY7A 1HFGA 1F2LA 2XWBB 4HIMA 3E3XA 1TWFH 1YHBA 3BDLA 5JOBA 1SYCA 2PZWA 3CW2C 3IKJA 3RD4A 2EYPA 2RF4A 1CKOA 1ILPA 2LXKA 3OYYA 3H09A 5H1SE 4K5VA 4DR2L 3ITPA 1G8ZD 1QZGA 4BS9A 4M1UB 2KCMA 3URYA 2PNRC 1VQKA 1STAA 3NSWA 5I2YA 2JXMB 3I91A 1OXUA 1W6KA 2F0DA 3HOWH 3EA6A 2HDMA 2L4NA 4JW0A 2O4XA 1K8OA 4ME5A 4ZK9B 5I6WA 1BKBA 2A6HC 1C4QA 4X64Q 4K6DA 2I07B 3HZXA 4Y7NH 4A3MH 4ZUIA 3AMUA 4CJ0B 2PNHA 3I4LA 4C56C 5HY6A 3GTQH 1LTGD 5IWAQ 3PUYA 2A6ED 3DHQA 1PLFA 3PO2G 4JI4Q 1STHA 3K5NA 1OTCA 5CV4A 1QG7A 2B2YA 2YV5A 1K8MA 1RODA 3GV6A 1C48A 1E22A 3UDGA 1FYCA 1YNJC 1JJCB 1L0XB 3IAYA 1WTVA 1E0BA 2C35B 3OTOQ 2EJMA 3NHHA 1VQBA 1MSGA 3J7YW 4DV5L 5C0XH 3U9SA 5C4XB 1Q8IA 2OQ0A 4LW1A 3SEBA 3NWTA 3VYSA 1A3TA 4BXXG 2N49A 1WOCA 3CC7A 2UUAQ 3NQTA 4V190 1NBWA 4JBJA 4K8IA 4DA2A 3I2ZA 1DONA 5EPKA 4CDCC 4AH6A 1VQOA 2KHIA 4KY5A 1HNZQ 1YJNA 1SRUA 4A3KH 4DUYQ 3UDXA 3BZCA 4QF4A 3I4MH 3ULPA 5DAUA 4XYQA 3L7ZC 4DK0A 3A5ZB 4DR4L 1X3PA 1R9TB 1EY8A 4POGA 2A68C 4C3JH 3S1QB 5LMNW 2DGYA 3A0JA 1DM0B 3K5OA 1CK1A 2UXDL 1TQOA 4I7ZC 1EU4A 4KHZA 4TQUS 5C6AA 1TY0A 3DWAA 4O0AA 3KBGA 1D6EC 4DV7L 4DV1L 1C0AA 3OMCA 4OEMB 3HGBA 4JYAQ 2XIWA 3EN2A 5KYLA 1S4ZA 2L15A 1Q1BA 1AZPA 4OX9L 4KKSA 4ODGA 2UXBL 2UXCL 2VNUD 2Q2TA 1M1KC 3RR5A 1STEA 4DK1A 4K0KQ 1QZHA 3K5MA 2CW0C 2K50A 2WKDA 3P20A 1KRTA 3JAML 5COYA 1I4GA 2B2YC 3DUZA 1IYJB 1B70B 5A2QL 3M85A 5M5XB 3TZDA 4AYBG 4M8AA 2TMPA 3CCLA 5DEHA 3K58A 3IL8A 1G51A 2HUGA 5C3EG 2RVLA 4IPCA 3CQZB 3A7LA 4DXFA 3H6MA 4CDDC 3M3YB 4YCUA 5IP9G 2A6EC 1D5ZC 4C3IH 3PIOA 5EQ0A 2R92G 2EXZA 4LFBL 3TRZA 2ASBA 4GLVB 5CMDA 4OL7A 4LFAQ 5K36G 3SHLA 2I5MX 3U4VA 5C4ZA 1U5KA 5KYIA 2PQAA 1I5FA 1X55A 1I6VC 1HJPA 3QOJA 4C3HB 1KQSA 1I94Q 3HKZB 3VR4A 4QUCA 1KTKA 3D4DA 4KY6A 2PW5A 1Z47A 2EVBA 4XQQA 2JA5G 1K28A 4B3TL 3BZKA 2BDNA 1I4QA 3DM1A 1SBBB 4RA8A 3PF4A 4MHEA 3E9HA 1PV4A 3GTPH 4P73A 2CWPA 5IT9E 1IBLL 2VW9A 4LAAA 1LTBD 2EDGA 4DKAC 4IUUA 5FLMG 2EYMA 1T9HA 5C3WA 1H9SA 2J7ZA 2AUKA 3Q0AA 1A3VA 3S17B 1O78A 2VUMH 4A3LH 2L55A 3HKZE 4G4KA 5I6YA 4DV2L 1VQAA 5E1FA 4DV6Q 2BDOA 3PF5A 3K81C 3RZOB 2J0TD 3BU2A 3OOCA 3LX0A 2CFMA 4OO1I 3W1BA 4LF9L 1DOLA 2F1MA 1PH2A 3M4PA 3L2PA 4BBSH 2IT1A 3CXCA 2XSCA 3OIPA 1EL0A 1EQQA 3K7AB 2TSSA 1D2BA 1VQDA 1SDFA 3NWSA 4QIWE
chains in the Genus database with same CATH topology
1SJHD 2K05A 4HCSA 5J1ZA 2AUJD 3CHBD 5AFWA 1JWSD 2RSOA 5JEAH 3M4YA 3VR6A 3EJIA 2FINB 1H9SB 3RMHA 3PO2B 1KLGD 3S2DB 2MPMA 1V43A 3IFDA 4HCEA 3GO5A 3FMCA 2EY6A 2MP1A 3R8BA 3BDCA 3VR2A 4EVOA 3HS0C 1WTXA 4XT1B 1CQFA 3PUXA 2K5QA 3OSOA 1KAAA 3QIAA 4QB4A 3QB3A 1EY9A 2EYJA 4HEDA 1Y8NB 2ICEC 4FF4A 4ZKCB 2B2TA 4J8QA 2F0QA 5ELCA 4KJNA 2BA1A 1STNA 1TIID 4R8NA 2MJ8A 1B9MA 1HCZA 2F0KA 3I3CA 1OXSC 5J39A 4E6IA 2JP1A 2JSOA 3FVQA 3BDOA 1HRJA 2RDGA 2CHBD 3TBIB 5LL6X 4FF3A 4C2MB 1WTWA 3EFXD 3V96A 4IFDJ 5C4HA 2KOLA 3SE0A 1G91A 2Q8RE 1HHVA 4AYBB 4Q0FA 1B9NA 4LMQD 4KN7C 2K03A 5C3EB 4ABNA 3L9AX 4CJ2C 3DXJC 3NK9A 1KNEA 4XQJA 1A2UA 5CORA 4B9XA 2R92B 1CT1D 1BO0A 3A55A 2G9DA 4KKTA 5BN5A 3GP7A 5DM63 5CV7A 2C9OA 2CVRA 3S1MB 2SEBD 2F0GA 4EGVA 1JICA 1KDBA 2FMMA 2JA5B 4IUTA 1U4RA 1BOSA 2JEBI 1EQTA 1LTAD 3ZYYX 2O5IC 5T1IA 1IHZA 1DOMA 3C2PA 2DNCA 2KJXA 1IYUA 2PPBC 1HUMA 2BE5C 1SYDA 5EKLA 3DEOA 5EPJA 2GA4B 2KEDA 2F0OA 2NVXB 1EY4A 1D5XC 4KMUC 3KK7A 1JCKB 1EYDA 3CRKC 3D31A 3T53B 2XN9C 1EYAA 4CKCA 3PIP3 1DYQA 1MBYA 2LFNA 2F0FA 4R9WA 1SFOB 2B2UA 3GTMB 2R3ZA 4K6LA 5I9PA 1PTOD 4FXKC 4ILWA 1QE6A 2X69A 2F0LA 3WOFA 2WKCA 4J1MA 5C0XI 1F9RA 3OWEB 5C4JB 3S2HB 1C8CA 3OHXC 5CV9A 2IX0A 1GHKA 4J6HA 5CV6A 1D1KA 1EIGA 5EKKA 4BA2I 3S15B 5M3FB 5IT9L 3W2DA 4KKUA 4QMGA 1NSNS 1CZWA 5JPMC 1XWEA 1A6XA 1EWHA 5FK9C 3C1FA 1JOQA 2ZXPA 4XDXA 1EEID 1Q3LA 2QF7A 4L6TB 1ENCA 3MEHA 3P7JA 4XTCS 2AWNA 3SK8A 2F0HA 3TSSA 3X3MA 1A3UA 1L0YB 2E2HB 1E2WA 1OXXK 4KK7A 3P1HA 3L3OC 2R93B 3MXUA 4HAEA 2E2JB 1QNUA 1F9QA 3M7GA 1PTOB 1CM9A 2A74C 5I4DA 3KLSA 2F03A 4A3FB 4FO2A 2JE6I 1TWAB 1FNWA 4CBVA 4DAVA 2ZXRA 1G2SA 1SNPA 3QO2A 1A2TA 1X3QA 1CTMA 1PZID 2KHSA 2KCCA 1AFPA 3HOYB 3HOVB 3J7AF 1ZEQX 1VCIA 2ZT9C 1STGA 2F0IA 4EQPA 4RCNA 2BA0A 3H0GB 3A8KE 2D2CC 4I65A 4TSSA 4IFDH 2MUYA 3GTKB 5JEAJ 2NBFA 3QWNA 2AQ1B 3Q22A 5IGGA 2FHTA 1TWFB 4HSPA 5CV8A 1XXGA 1E2VA 2AQ3B 1EFID 1GUOA 1TS4A 2KQ3A 3SVMA 3RZDB 1HQRD 4X3TA 5IGBA 3HOWB 5ELBA 4HMIA 1ONLA 4Y7NB 4RKLA 3BVMA 5JVG3 1PFNA 2QCPX 4NMZA 1OO9B 4EQOA 1RD9D 1QB5D 2H4OA 4ZAIA 4CHTB 1EIHA 4TRDA 3I70A 4NDXA 4ZRZA 4ZUJA 3PIO3 3FDTA 4UAIA 5ELDA 1BBXC 2JEAI 3PV0A 2PZTA 1ML0D 3N52A 4WJWA 2E76C 5ISRA 1O80A 1JR0D 2PYKA 1Y69U 3D6CA 2EYHA 4G57A 4N9TA 1LT4D 3K6OA 2F3VA 4WFN3 1QOHA 1H9RA 3NE5B 3K5LA 5BN4A 1WTQA 1EZ8A 1QCBD 2OEOA 2OXPA 1GUWA 1LT3D 1IW7D 4RGNA 4FXGC 3T56B 1NUCA 1IKLA 2IW3A 2E75C 1JQYD 3EVQA 3GV3A 5EBCA 3BYTB 4F7XA 1TS3A 4K2LA 1HUNA 4FF1A 1F9PA 1GHJA 2G9HD 4L8JA 1BF4A 1M4VA 1EZ6A 3RUZA 1ESRA 2EY5A 3D6WA 1Y8OB 5BN3A 4HN7A 5DNFA 3A7AB 4DAYA 4XYOA 4OO1G 3KBXA 1KDAA 1BR9A 2MHVA 2N55A 2K04A 2DY7A 1R4PB 4B08A 5IOCA 1FR3A 1BNZA 5IIFA 2Z4HA 1G291 4A3IB 5ELEA 3VYUA 3H3VC 1IKMA 1NR4A 3MFGA 5KNDA 1ET9A 2D62A 2X6LA 5FO8B 3MA2B 4QIWB 1DCZA 3M4OB 3UI2A 1NCVA 2E2DC 2CQAA 1B53A 4ZYSA 3SXHA 3GTPB 1B4OA 4XQNA 5FO9B 1NR2A 3G6JB 3P75A 2RSNA 1I4XA 2E74C 1IW7C 4DFAA 3LWEA 1KABA 2QDBA 3BYYB 2WP8J 2NN6G 1SYFA 2WINB 5E4XA 3TP7A 2VUMB 3K0YA 3FPUB 1YNND 1TT2A 4HSVA 5KEEA 2NZ1D 2B8GA 3FKIB 5K5PA 5IODA 2NTSA 3DEPA 1CA6A 4U68A 2F0TA 4H7BA 2F0MA 3GTOB 1PTOF 1JWUD 5TSSA 2K01A 1SNOA 1DD2A 1TS2A 3QJYA 5E3FA 3CKIB 4BA1I 4IZ8A 1DZ1A 4C1NI 1E2ZA 2F3WA 2R61A 1EQVA 2Q8IB 3S16B 2NN6I 1BCPF 1PFMA 1Y8PB 2IPKD 3HOZB 1PFBA 1TVXA 1RHPA 1TWCB 1V1OA 3O13A 2ENBA 4PMWA 4BY1B 1FGBD 4P2CB 1BUVT 3K57A 1FNUA 3MWYW 1GUGA 2KUMA 2HCCA 1T5XD 4RHRA 3VR3A 3OWFA 1V1PB 4H0LC 3PMFA 2SOBA 1GXDC 3EROA 3FEWX 1TKWB 3VYTA 3Q6SA 3X3NA 3BZDB 3TN2A 2KECA 2RDFA 1XYIA 3NQIA 1AZQA 1SYBA 1LABA 1I4PA 4LJZC 1MD2D 2LMCB 4HMJA 1YNNC 3H91A 1CI3M 3DMUA 2M2LA 3I4NB 4A3JB 5G3LF 1QJOA 1TWHB 1U4PA 4CKEA 4BWGB 1ET6A 4O42A 1F2ZA 3E6ZX 5C5MA 5IGEA 3C46A 4IFDG 2WV6D 1A15A 2L1BA 2K32A 4H44C 2VB3X 3T16A 1VF5C 4K2KA 3DWQA 4ZQ3A 2AWOA 4C1NK 1WVLA 4KHVA 5C5LA 2XNAC 4A3BB 2R6GA 4NW2A 2SNSA 3TP8A 5JPNC 3A8IE 1EY0A 2LKVA 1LV9A 4DGZA 5I2XA 2K33A 3QOLA 2DNEA 1SNDA 5C0XG 1DJRD 1STYA 4KI0A 5JVH3 3GQBA 1TU2B 1S5CD 3D8GA 1ENAA 4A93B 3TMEA 1SMYD 1R4QB 2Z8LA 4F87A 4KY7A 4IFDI 2E2IB 3PUWA 1O7YA 1WD1A 1HTLD 1S5FD 1KDCA 4KN4C 2X6GA 4PMBA 4C3JG 4EQNA 3J81E 4JK1C 1CQVA 2F0NA 4FVMA 4V0BA 4DF7A 3DWPA 2QKIC 4IUVA 4G7ZC 2B2VA 3OPOA 2EYLA 2K28A 4OIKA 1SNMA 1QWYA 3A56A 1F77A 4RGMA 1M8AA 2WB1B 2PCFB 4QCLA 1DOKA 3MHBA 5IGCA 1Y1VB 4G7OC 1GUSA 4YIJA 1BCPD 2B8FA 5EJWA 1RTNA 1TR5A 2EJFC 2Z1CA 2EPBA 1EYCA 2A6HD 4OGQC 3MZ5A 1ESFA 1B3AA 2NVQB 4C3IG 1RCVD 1GUNA 2D5DA 4N9PA 3A54A 1PDQA 4L63B 3R93A 4B9WA 3S14B 5NUCA 1ICWA 2YU9B 4K14A 2RA4A 1UEAB 3VA7A 2DN8A 3TZUA 3U9OA 4DN4M 3PUZA 2JYOA 1I3QB 3HG9A 1NAPA 3KUPA 4BY7B 1SXTA 3HEJA 2FMCA 3NTKA 2O5JC 4PV1C 4KD4A 2B2VC 5G3LD 2JA8B 1JOKA 2IX1A 2D9UA 2EOTA 3OW7A 3BVZA 1T5EA 1Q1EA 1SYEA 5FOBB 3TDQA 1BCPB 2F0SA 3VA5A 4K8JA 1F2YA 2VB2X 2K6AA 1PRTF 3MFYA 1PTOC 4CJ1B 1SE2A 4MN3A 4KTAA 1JORA 4S3SA 2MGSA 4HTHA 2C5CA 2VXWA 4IUNA 1LTID 5HGTA 1LTTD 1UAPA 1S5ED 5IGFA 1G6ZA 1BCPC 2M00A 2CW0D 1ENFA 3MXGA 4RH6A 2F0PA 2OT2A 3NTHA 2BOSA 4RCOA 3J7AV 4PQXA 5JEAG 3LNNA 4A3MB 3NP8A 3D3RA 3GTQB 1GOZA 3SK5A 2EYFA 1J8IA 2K5WA 4K5XA 4R8IA 3I73A 3EQLC 2RBMA 1WTPA 2EZVA 2QILA 3I90A 5E4WC 1K83B 4JBWA 2Q8TA 3PUVA 1JB3A 1LACA 1W6JA 3ND8A 3VR5A 1Q12A 2M9VA 3D4RA 4NKLA 4A3KB 4RFBA 2EJGC 1SSOA 3N6RA 3T51B 1CHPD 5EPLA 3I4MB 1SE3A 1RJTA 2BCOA 4WRDA 2PO4A 4OHJA 2F0UA 3T4AC 4RHSA 1Z6HA 4C3JB 1DXMA 4GZYC 3I8ZA 3FRPB 1TS5A 1D1IA 3MXNA 4ID6A 2PZUA 2LY7A 1H9MA 2RKSA 1Q90A 1LT6D 1H9KA 1OXVA 3C3LA 2EE1A 1EU3A 2PMZB 2J4XA 2OF1A 3MVVA 4NP5A 4H13C 3GD7A 1SEBD 1ZYRD 5D3DA 1B1ZA 2WIIB 2IWHA 5M9OA 4FYDA 2V4DA 2PQEA 2NYZD 2F0VA 2XRQD 2HCIA 4DNTB 1HXYD 4K5WA 1GJXA 1EEFD 1V8QA 1PZKD 1EY5A 1F9SA 5T1GA 5FO7B 5CYUA 1SYGA 2FJ2A 4C3IB 1IL8A 3J81L 2EY1A 1MSHA 1RKNA 3HOXB 2A69D 2L9HA 1ILQA 2B2WA 3F2UA 3G7LA 4TKOB 5CGKA 1PYWD 5CBAE 2LS01 2NWGA 1PRTD 2AQ2B 1HQMC 4FNFA 2WACA 2NUCA 3NBIA 3KLRA 2PW7A 4PNYA 3S9WA 1ZXTA 5DM73 4DNRB 4RAUC 5JAVA 3QG1A 2XRSD 2ICIA 5D65A 3BG3A 5LL6S 3SK4A 2ID0A 3OMGA 1XX8A 1TWGB 2RQXA 1VF7A 2HDLA 3LWUA 4X3UA 4XXEA 1STBA 4XIGS 1SNQA 3NBHA 4OIJA 2L5TA 1WTOA 1F2MA 1KLUD 3NPPA 1VDZA 4KJOA 4BBSB 1ZYRC 1D5MC 3A8JE 3IFTA 1FNVA 3J80E 1RTOA 3M7NA 5FLXE 4CGYB 2KCNA 5EBDA 1V1PA 2NTTA 5EGTA 3MXPA 4X3KA 1II3A 2F4IA 1PRTB 2B2WC 1H9JA 4IURA 5KGUA 3FPPA 2L0CA 4Z9CB 3T13A 1IYVA 1LTSD 3RLFA 1UNSA 2I46A 4O1NA 2A69C 2IJ0A 3CRLC 2SNMA 1CFMA 4XT3B 1UUPA 2RDHA 1WCMB 2A5HA 2O2LD 1HFNA 4F88A 2L11A 1PRTC 4UDUC 1O7ZA 4A3GB 4ZKBB 4U673 2A73B 3TP5A 3Q24A 1SJED 1B50A 2NB0A 1SAPA 2H1EA 2F0WA 2KEEA 3NXWA 3AU7A 3GTGB 5JJZA 4FXDA 3D4WA 1Z7TA 2IX3A 4IUPA 1U9RA 2BE5D 5M5YB 4DU9A 5KIXA 3GTJB 2R7ZB 4RKBA 5KNBA 1PXUA 1HA5A 3V2TA 4F8MA 5ELFA 5KNCA 1X32A 4QUFA 2XWJB 1EOTA 4BBRB 4MIUA 2NVYB 1B2TA 2KVMA 4IALA 3V05A 1FD7D 4RGOS 1EWCA 1LTRD 4RGTA 1S5BD 3KF8A 3R2TA 5LHY1 1LO5D 1KNAA 2Y0SB 3E5SA 1CHQD 1SE4A 5K36H 3HP3A 4KV6A 2B63B 1AP0A 1RF2D 3GTLB 4OO1H 3BVGA 1U4MA 1AEXA 5A35A 1PMRA 1BDOA 3MTSA 1B44D 3SDZA 4DAPA 4ZLTF 5FKAC 1ZKOA 1LT5D 2DY8A 3VYRA 5C0XJ 5I9OA 1BQQT 5HURA 1WTRA 4LK1C 1RDPD 1GUTA 3K59A 5CV5A 3Q23A 4A3DB 2EYOA 3JAME 4PMCA 2B2TC 3R2IA 1PZJD 5A2QE 1S5DD 2K1BA 5CR3A 1I6HB 1JC7A 4IN3A 3TP6A 1HPCA 1CZGA 3R3OA 1JE4A 2K5DA 1SNCA 5M3MB 2ZXOA 1Y1WB 3OIQA 2F0JA 3SK6A 1WD0A 3W3AA 3ND9A 5EKIA 2NVTB 1HTPA 2JA6B 3NUCA 3S1RB 2NN6H 4A3EB 1G2TA 1QNKA 4CKBA 4KD3A 1QILA 1BXTA 1AW7A 3CU7A 5KRUA 3NTIA 3HOUB 4FP5D 2QEJC 2FFKB 1U4LA 2SDFA 4RWSC 1JOOA 4IQZA 5C3XA 3C1EA 1VMCA 3I72A 5CC4A 4IUQA 5J22A 1TY2A 2F0EA 5CBEE 3ERQA 2K7VA 2IL8A 3ONAB 1I50B 2YYZA 1HA6A 1CA5A 3HRZC 5C44B 1VMPA 1YNJD 3AB9A 4DXGA 5D14A 4C3HG 3H94A 4Q5VA 4HR7B 1JWMD 1PTOH 4FF2A 4WORA 3PO3B 3BS1A 1O7LA 1SMYC 2N88A 2Z4IA 2L12A 3KLSX 3MC0B 1I4RA 2HQEA 3J80L 5D3IB 5M5WB 3WOEA 5IGDA 1LLRD 3E0JA 5FLXL 2A68D 3S1NB 4ULLA 2WAQB 1AN8A 1EY6A 1MGSA 1I4HA 3SR1A 4G7HC 2KA7A 2B2UC 1J9OA 1XTCD 1MI2A 3WDNA 2XVSA 2B39A 5F2DA 3MAQA 2JA7B 4X3SA 1OXTA 2EY2A 1EY7A 1HFGA 1F2LA 2XWBB 5JOBA 3BDLA 1SYCA 2PZWA 3IKJA 3RD4A 2EYPA 1ILPA 3H09A 4K5VA 3ITPA 1G8ZD 4BS9A 4M1UB 3URYA 2PNRC 1STAA 3NSWA 5I2YA 2JXMB 3I91A 1OXUA 1W6KA 2F0DA 3EA6A 2HDMA 2L4NA 2O4XA 1K8OA 4ME5A 4ZK9B 5I6WA 2A6HC 1C4QA 4K6DA 2I07B 3HZXA 3AMUA 4ZUIA 4CJ0B 3I4LA 4C56C 1LTGD 3PUYA 2A6ED 3DHQA 1PLFA 1STHA 3K5NA 5CV4A 1QG7A 2B2YA 1K8MA 1RODA 3GV6A 1C48A 1FYCA 1YNJC 1L0XB 3IAYA 1WTVA 1E0BA 2EJMA 3NHHA 1MSGA 3J7YW 5C0XH 3U9SA 5C4XB 1Q8IA 3SEBA 3NWTA 3VYSA 1A3TA 3NQTA 4V190 4K8IA 4DA2A 1DONA 5EPKA 4KY5A 4QF4A 5DAUA 4XYQA 3L7ZC 4DK0A 1X3PA 1R9TB 1EY8A 2A68C 3S1QB 1DM0B 3K5OA 1CK1A 1TQOA 4I7ZC 1EU4A 4KHZA 4TQUS 5C6AA 1TY0A 3DWAA 3KBGA 1D6EC 3OMCA 3HGBA 2XIWA 5KYLA 1S4ZA 1Q1BA 1AZPA 4KKSA 4ODGA 2VNUD 1STEA 4DK1A 3K5MA 2CW0C 2WKDA 3P20A 3JAML 5COYA 1I4GA 2B2YC 3DUZA 5M5XB 3M85A 5A2QL 3TZDA 4M8AA 2TMPA 5DEHA 3K58A 3IL8A 2HUGA 2RVLA 3CQZB 3A7LA 4DXFA 3H6MA 3M3YB 2A6EC 1D5ZC 5EQ0A 2EXZA 5CMDA 4OL7A 5K36G 3SHLA 5C4ZA 5KYIA 1I6VC 3QOJA 4C3HB 3HKZB 3VR4A 4QUCA 1KTKA 3D4DA 4KY6A 2PW5A 1Z47A 2EVBA 4XQQA 2BDNA 1I4QA 3DM1A 1SBBB 4RA8A 4MHEA 5IT9E 4LAAA 1LTBD 2EDGA 4IUUA 2EYMA 5C3WA 1H9SA 2J7ZA 2AUKA 3Q0AA 1A3VA 3S17B 1O78A 2L55A 4G4KA 5I6YA 5E1FA 2BDOA 3RZOB 2J0TD 3OOCA 3LX0A 4OO1I 1DOLA 2F1MA 2IT1A 2XSCA 3OIPA 1EL0A 2TSSA 3K7AB 1D2BA 1SDFA 3NWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUJ D;  3SDZ A;  5BN4 A;  3I4L A;  2K7V A;  3CRL C;  1ZKO A;  3A7L A;  3VR3 A;  4H0L C;  1CFM A;  3SE0 A;  1VCI A;  3PUY A;  2A6E D;  2ZT9 C;  2YYZ A;  4JBW A;  4TKO B;  2A6E C;  3PUW A;  3PUV A;  4RCN A;  5JEA H;  1IW7 D;  2O5J C;  4PV1 C;  2BA0 A;  3M4Y A;  1B9N A;  1K8M A;  1LAC A;  1TKW B;  1IW7 C;  2E74 C;  3ND8 A;  4LK1 C;  3A8K E;  4KN7 C;  3T56 B;  1GUT A;  2D2C C;  3AB9 A;  3VR5 A;  1FYC A;  1YNJ C;  1Q12 A;  4KN4 C;  4IFD H;  3D4R A;  1HQM C;  2EJG C;  2NN6 G;  2EJM A;  1H9S B;  3DXJ C;  3N6R A;  3OW7 A;  4JK1 C;  3T51 B;  1T5E A;  1Q1E A;  2E75 C;  5K36 G;  1GHK A;  1LAB A;  3H94 A;  4BA2 I;  4HR7 B;  4LJZ C;  5C0X H;  3U9S A;  1V43 A;  2LMC B;  1YNN C;  1CI3 M;  4G7Z C;  3KLR A;  1HPC A;  1I6V C;  1O7L A;  1E2V A;  4KKU A;  3OPO A;  1QJO A;  1SMY C;  1Z6H A;  3FMC A;  3VR4 A;  1GUO A;  3MFY A;  2B8G A;  1DXM A;  4DNR B;  2EVB A;  4KKT A;  1Z7T A;  3VR2 A;  5BN5 A;  4GZY C;  1GHJ A;  3QG1 A;  4L8J A;  2BE5 D;  1A6X A;  3BG3 A;  2PCF B;  3PUX A;  1H9M A;  1EWH A;  3L7Z C;  4DK0 A;  5KNB A;  1Q90 A;  3QIA A;  1H9K A;  1VF7 A;  1OXV A;  2A68 D;  3W3A A;  1ONL A;  4G7O C;  3ND9 A;  2A68 C;  1GUS A;  1Y8O B;  1HTP A;  2QF7 A;  3LWU A;  5BN3 A;  1DD2 A;  1Y8N B;  2NN6 H;  4IFD G;  3A7A B;  2JEB I;  4XIG S;  5KNC A;  3QJY A;  4XTC S;  1H9R A;  2EDG A;  3VR6 A;  4OO1 G;  4G7H C;  4H13 C;  2KA7 A;  2K32 A;  2L5T A;  4H44 C;  2O5I C;  4BA1 I;  2B8F A;  1FR3 A;  3GD7 A;  1VF5 C;  4I7Z C;  4KHZ A;  4TQU S;  3WDN A;  2DNC A;  1E2Z A;  1VDZ A;  1IYU A;  1E2W A;  1H9S A;  1OXT A;  1OXX K;  2AUK A;  1ZYR C;  2EJF C;  3A8J E;  3IFT A;  2PPB C;  2Q8I B;  2BA1 A;  2AWO A;  3MXU A;  1G29 1;  1O78 A;  2A6H D;  2V4D A;  3HGB A;  2BE5 C;  4OGQ C;  2NN6 I;  1B9M A;  1HCZ A;  3M7N A;  5JEA G;  3LNN A;  1OXS C;  3IKJ A;  2R6G A;  1Q1B A;  1Y8P B;  2BDO A;  4DNT B;  1GUN A;  5KND A;  2D5D A;  4KKS A;  2D62 A;  2JEA I;  3A8I E;  3PV0 A;  1GJX A;  1DCZ A;  3OOC A;  1V8Q A;  4KMU C;  5K36 H;  2JE6 I;  4DK1 A;  3BDO A;  4IQZ A;  2E76 C;  2K33 A;  2F1M A;  2DNE A;  3CRK C;  2CW0 C;  1H9J A;  2IT1 A;  2PNR C;  3VA7 A;  5C0X G;  1Y69 U;  3P20 A;  4KI0 A;  2JXM B;  3GQB A;  1TU2 B;  3D31 A;  1OXU A;  2DN8 A;  3EQL C;  3FPP A;  3I73 A;  3T53 B;  3RLF A;  3TZU A;  4OO1 H;  1IYV A;  1CTM A;  3I72 A;  3M85 A;  1GUG A;  1K8O A;  5A35 A;  3PUZ A;  1PMR A;  2A69 D;  1BDO A;  2A6H C;  2KCC A;  3NE5 B;  2A69 C; 
#chains in the Genus database with same CATH topology
 1SJH D;  2K05 A;  4HCS A;  5IYC G;  5J1Z A;  2AUJ D;  4GOP B;  2QW7 A;  3CHB D;  5AFW A;  3T1H L;  1JWS D;  2RSO A;  5JEA H;  1P8L A;  2VS1 A;  3M4Y A;  3VR6 A;  3EJI A;  2XGT A;  3CMA A;  3E9I A;  5M3F G;  3I4O A;  1Q46 A;  1IZ6 A;  1D7Q A;  2FIN B;  3S16 H;  1H9S B;  3RMH A;  3PO2 B;  1KLG D;  3S2D B;  2RCN A;  2MPM A;  1HZB A;  1V43 A;  4DR2 Q;  2NZO A;  3IFD A;  3UDF A;  2HT1 A;  4HCE A;  3GO5 A;  1CSP A;  3FMC A;  2EY6 A;  1UE1 A;  2MP1 A;  1UE7 A;  4BY1 H;  3R8B A;  3BDC A;  3VR2 A;  4EVO A;  3HS0 C;  4NXM L;  1WTX A;  4XT1 B;  1CQF A;  3PUX A;  2K5Q A;  3OSO A;  1KAA A;  3QIA A;  4QB4 A;  4JI3 L;  3QB3 A;  1EY9 A;  2EYJ A;  4HED A;  1Y8N B;  2R93 G;  3GTG H;  2ICE C;  4FF4 A;  4ZKC B;  2B2T A;  4J8Q A;  2OCE A;  2F0Q A;  2YTY A;  4DV5 Q;  2DJG C;  5M5Y H;  2ZTE A;  5ELC A;  4YHH L;  4KJN A;  5J3B A;  2BA1 A;  4A3F G;  1STN A;  1KL9 A;  1TII D;  4R8N A;  2MJ8 A;  1B9M A;  1HCZ A;  4HJ9 A;  1YIJ A;  2F0K A;  3I3C A;  1OXS C;  5J39 A;  4E6I A;  3KDF B;  1K73 C;  1K0R A;  1IBM Q;  1A0I A;  4A3J H;  4R1J A;  2JP1 A;  2N78 A;  2JSO A;  2NVY H;  3FVQ A;  2UUB L;  3BDO A;  2OTJ A;  1PH6 A;  1HRJ A;  4GKJ L;  3HOY G;  3HOV G;  1KXL A;  2RDG A;  2ES2 A;  2CHB D;  5GAD C;  4DR4 Q;  2R7D A;  3TBI B;  1O7I A;  5LL6 X;  1BVS A;  4UP8 A;  4FF3 A;  4C2M B;  1WTW A;  3EFX D;  3V96 A;  3A74 A;  3H0G G;  4IJL A;  4IFD J;  5C4H A;  2UXD Q;  2KOL A;  3SE0 A;  4LNQ A;  1G91 A;  1YI2 A;  2B63 H;  2Q8R E;  3PCO B;  1HHV A;  1PH7 A;  4AYB B;  4Q0F A;  1B9N A;  4LMQ D;  4KN7 C;  2UUA L;  2K03 A;  5C3E B;  4ABN A;  3L9A X;  3J80 c;  2VZA A;  4CJ2 C;  4KHP Q;  4OX9 Q;  3DXJ C;  3NK9 A;  3OW2 A;  3A5U A;  1KNE A;  2UXB Q;  4XQJ A;  2UXC Q;  1A2U A;  4Y52 H;  5COR A;  4B9X A;  2R92 B;  2VL6 A;  3HOW G;  3EBE A;  1CT1 D;  1BO0 A;  2LXJ A;  3A55 A;  2G9D A;  4KKT A;  3K0X A;  1S72 A;  5BN5 A;  4A3D H;  3GP7 A;  2I5L X;  2Z6K A;  5DM6 3;  5CV7 A;  2C9O A;  2CVR A;  3S1M B;  4A93 H;  2SEB D;  2F0G A;  4EGV A;  1JIC A;  1KDB A;  2FMM A;  2JA5 B;  4IUT A;  1U4R A;  1BOS A;  4AYB E;  1Z9F A;  1SRO A;  1YZ6 A;  2JEB I;  1EQT A;  1LTA D;  4X62 L;  3ZYY X;  2A1A A;  2O5I C;  5T1I A;  1IHZ A;  4LFB Q;  1DOM A;  1WFQ A;  3C2P A;  2DNC A;  2KJX A;  4DV3 L;  1IYU A;  2PPB C;  2FXQ A;  1HUM A;  3J81 j;  2BE5 C;  1E24 A;  1SYD A;  5EKL A;  3L0O A;  3DEO A;  5EPJ A;  2GA4 B;  2N3S A;  2JA6 H;  2KED A;  4NB3 A;  4A3E H;  2F0O A;  2NVX B;  1EY4 A;  1D5X C;  4B3T Q;  4KMU C;  4LF8 Q;  4JCV E;  3KK7 A;  3F2B A;  1JCK B;  4P72 A;  1EYD A;  3CRK C;  1L2F A;  3D31 A;  1NE3 A;  3T53 B;  1MJE A;  2XN9 C;  3HOU H;  1EYA A;  5E7N A;  4LF7 Q;  1IBL Q;  4CKC A;  3PIP 3;  1QVF A;  1DYQ A;  1MBY A;  2LFN A;  2F0F A;  4R9W A;  4QQB X;  1Q81 C;  2KEN A;  1SFO B;  2B2U A;  3GTM B;  2R3Z A;  4K6L A;  5I9P A;  1PTO D;  2MO1 A;  1FJG L;  4FXK C;  4ILW A;  1QE6 A;  2X69 A;  4IJH A;  2F0L A;  3WOF A;  2WKC A;  4J1M A;  5C0X I;  1F9R A;  3OWE B;  1L1O B;  5C4J B;  3S2H B;  1C8C A;  1E1T A;  3OHX C;  5CV9 A;  2IX0 A;  1GHK A;  4J6H A;  5CV6 A;  1D1K A;  1EIG A;  5EKK A;  4BA2 I;  1EUJ A;  2NVQ H;  3S15 B;  5M3F B;  2V1C C;  4LF9 Q;  3STB C;  5IT9 L;  3W2D A;  4DUZ Q;  5C44 H;  4KKU A;  4OON A;  4QMG A;  4OEL B;  3S14 H;  4A76 A;  2R7F A;  4OWW B;  1NSN S;  1CZW A;  3CC4 A;  4JI0 Q;  2A19 A;  4P71 A;  5JPM C;  1VQF A;  1XWE A;  1A6X A;  1EWH A;  5L37 A;  4GN3 B;  1I3Q H;  1MJC A;  1UEB A;  1L1O C;  5FK9 C;  3C1F A;  1JOQ A;  3PO3 H;  2ZXP A;  4XDX A;  1EEI D;  3T1H Q;  1P16 A;  1Q3L A;  2QF7 A;  2WB1 E;  4L6T B;  1ENC A;  3MEH A;  3P7J A;  4XTC S;  1MKH A;  4A3I G;  1UWV A;  2AWN A;  1GO3 E;  3SK8 A;  2F0H A;  3TSS A;  4DV6 L;  3X3M A;  1A3U A;  4JI7 L;  1L0Y B;  4LUO A;  2E2H B;  3JAM c;  1E2W A;  1OXX K;  4KK7 A;  5M5W H;  3P1H A;  4N8F A;  3L3O C;  2R93 B;  3MXU A;  4HAE A;  2E2J B;  1QNU A;  1F9Q A;  3S1N H;  2KBN A;  3M7G A;  4HJA A;  3S24 A;  1PTO B;  1X3G A;  1CM9 A;  2A74 C;  5I4D A;  3KLS A;  3CCE A;  2F03 A;  1V9P A;  4A3F B;  4HIK A;  4FO2 A;  2JE6 I;  1NNX A;  1TWA B;  1FNW A;  3KYH C;  2JA7 H;  4CBV A;  4DAV A;  2ZXR A;  1G2S A;  4MNO A;  3I7F A;  3M4Q A;  3QO2 A;  1SNP A;  1A2T A;  3J81 c;  1X3Q A;  4ZCK A;  1CTM A;  1HZA A;  1PZI D;  3J7Z C;  1K0S A;  2KHS A;  2KCC A;  1AFP A;  3HOY B;  3HOV B;  3PGZ A;  1ZEQ X;  3J7A F;  5IP7 H;  1VCI A;  2ZT9 C;  1STG A;  2F0I A;  4EQP A;  2VUM G;  3BJU A;  4RCN A;  4YHH Q;  2BA0 A;  3H0G B;  1WTH A;  3A8K E;  1VQG A;  2D2C C;  4I65 A;  4TSS A;  4UY8 C;  2MUY A;  4IFD H;  3GTK B;  5JEA J;  2NBF A;  5IYB G;  3QWN A;  1NJI C;  2IHE A;  3FKI G;  1EIF A;  2AQ1 B;  3Q22 A;  5IGG A;  2FHT A;  1TWF B;  2UUB Q;  4HSP A;  5CV8 A;  1XXG A;  4GKJ Q;  1E2V A;  2AQ3 B;  2IY5 B;  2BH8 A;  1EFI D;  1GUO A;  1TS4 A;  2KQ3 A;  3I56 A;  3SVM A;  3U4Z A;  3RZD B;  1X9N A;  1EOV A;  1HQR D;  4X3T A;  5IGB A;  2WFW A;  3HOW B;  5ELB A;  4P75 A;  5C4X H;  4HMI A;  4JV5 L;  1ONL A;  4Y7N B;  1K83 H;  4DK6 C;  1S40 A;  1JMC A;  2UU9 L;  4RKL A;  1JB7 A;  1MIU A;  3BVM A;  5JVG 3;  1PFN A;  3J7A 5;  2QCP X;  1IBM L;  1NMG A;  4B3S Q;  1YJW A;  2K5N A;  4NMZ A;  1OO9 B;  4TVA B;  4EQO A;  1RD9 D;  3HOZ G;  3KFU A;  1QB5 D;  1R9T H;  3ULJ A;  1N33 Q;  2H4O A;  4ZAI A;  4CHT B;  1EIH A;  4TRD A;  4BY1 G;  3I70 A;  4NDX A;  4ZRZ A;  4ZUJ A;  3PIO 3;  3FDT A;  4UAI A;  5ELD A;  1IXR A;  3B6Y A;  1BBX C;  2JEA I;  3PV0 A;  2PZT A;  1ML0 D;  1B7Y B;  3N52 A;  4DNI A;  4WJW A;  2E76 C;  5ISR A;  1O80 A;  1JR0 D;  2PYK A;  1VQ5 A;  1Y69 U;  3D6C A;  2EYH A;  4G57 A;  4N9T A;  2F52 A;  1LT4 D;  4DR5 L;  2UUC L;  3K6O A;  3HKS A;  2F3V A;  4WFN 3;  1QOH A;  1D8L A;  2ZTD A;  2N8N A;  1H9R A;  3NE5 B;  4X62 Q;  1NMF A;  2K52 A;  3K5L A;  5BN4 A;  1WTQ A;  1EZ8 A;  1QCB D;  2OEO A;  4KHP L;  2OXP A;  1CKN B;  1GUW A;  1LT3 D;  1PFS A;  4DV3 Q;  1N9W A;  3G4S A;  4B3M L;  3ZJY C;  1IW7 D;  4RGN A;  4DV4 Q;  4FXG C;  3T56 B;  1NY4 A;  2CQO A;  1NUC A;  3I4N G;  5M5X H;  4A3J G;  1IKL A;  2IW3 A;  2E75 C;  1KD1 C;  4YWM A;  1JQY D;  4PZ7 A;  3EVQ A;  3GV3 A;  5EBC A;  3BYT B;  3CQZ H;  3T1Y Q;  4F7X A;  1TS3 A;  3ULL A;  3K80 C;  3M3Y H;  3KJO A;  4K2L A;  5FJ8 G;  4PZ8 A;  1HUN A;  1K8A C;  4IPH A;  4FF1 A;  2CWA A;  1F9P A;  1GHJ A;  2G9H D;  4L8J A;  3HOX H;  1BF4 A;  1A62 A;  2MNA A;  1M4V A;  1EZ6 A;  4JI1 L;  3RUZ A;  1FJG Q;  1ESR A;  1FGU A;  2EY5 A;  3D6W A;  1Y8O B;  5BN3 A;  4HN7 A;  5DNF A;  5IYD H;  3A7A B;  4DAY A;  4RG1 A;  4XYO A;  4OO1 G;  3KBX A;  1KDA A;  1BR9 A;  2MHV A;  2N55 A;  2K04 A;  2DY7 A;  1YHQ A;  2ATW A;  1R4P B;  1A63 A;  4B08 A;  5IOC A;  4A3B G;  1FR3 A;  3CAM A;  1BNZ A;  1RL2 A;  1K9M C;  4GLX A;  4X6A H;  3TEH B;  5IIF A;  3MXN B;  2MQH A;  4LF8 L;  2Z4H A;  1G29 1;  3J80 i;  4A3I B;  5ELE A;  3VYU A;  1SE8 A;  3H3V C;  1HNX L;  4GOP A;  1IKM A;  1PH3 A;  1NR4 A;  3MFG A;  5KND A;  4LF7 L;  1ET9 A;  2D62 A;  2X6L A;  5FO8 B;  3MA2 B;  4QIW B;  1DCZ A;  2B29 A;  3CCU A;  4A93 G;  3M4O B;  1WYD A;  1B8A A;  3UI2 A;  4DR6 L;  1NCV A;  2E2D C;  4UPA A;  4JI5 Q;  1TWG H;  2CQA A;  1B53 A;  5GAG C;  4ZYS A;  3RZO H;  4X66 Q;  3SXH A;  3GTP B;  4JI7 Q;  1B4O A;  4XQN A;  2Z6B A;  5FO9 B;  4LFC Q;  1NR2 A;  3G6J B;  4DAY B;  3P75 A;  2RSN A;  1I4X A;  2E74 C;  1IW7 C;  4DFA A;  3VDY A;  4DUZ L;  3LWE A;  1KAB A;  3GDE A;  2QDB A;  3K7A H;  5GAE C;  3BYY B;  2WP8 J;  2NN6 G;  4L5T A;  1KRS A;  1SYF A;  2WIN B;  2OTL A;  5E4X A;  4JI0 L;  3TP7 A;  2VUM B;  4DPG A;  2WB1 G;  3K0Y A;  3FPU B;  1YNN D;  4JVZ A;  1TT2 A;  4HSV A;  5KEE A;  3FP9 A;  1KIX A;  2NZ1 D;  2B8G A;  3FKI B;  5K5P A;  4LF5 L;  5IOD A;  2NTS A;  3DEP A;  4JOI C;  1CA6 A;  4U68 A;  1Y1V G;  2ZJP A;  1G6P A;  2F0T A;  3ER0 A;  1JJG A;  4H7B A;  2F0M A;  3PO2 H;  4I7A A;  3GTO B;  1N34 Q;  1PTO F;  4NXN L;  3KDF A;  1JWU D;  5TSS A;  2K01 A;  1SNO A;  1DD2 A;  1TS2 A;  2JA9 A;  3QJY A;  1WCM H;  2CCZ A;  5AJ3 L;  3U50 C;  4GOP C;  5E3F A;  3CKI B;  4BA1 I;  4IZ8 A;  4BXX H;  1DZ1 A;  4C1N I;  1VQ4 A;  1E2Z A;  4A3G H;  2F3W A;  4R4C A;  2R61 A;  1EQV A;  5GRO A;  2Q8I B;  5HGQ A;  3S16 B;  2NN6 I;  1VQ8 A;  1BCP F;  1PFM A;  2VY3 A;  3RNU A;  1Y8P B;  2IPK D;  5ELO A;  3HOZ B;  1PFB A;  1TVX A;  1SN8 A;  2CKZ B;  3NBH B;  1RHP A;  1TWC B;  1V1O A;  3O13 A;  1K3R A;  4UP9 A;  2ENB A;  4MTK A;  4PMW A;  4BY1 B;  1ASY A;  1FGB D;  4BY7 G;  4JV5 Q;  4P2C B;  1BUV T;  4HJ7 A;  3K57 A;  1FNU A;  3GTJ H;  2R7Z H;  1Q82 C;  3MWY W;  4GKK L;  4HIO A;  1GUG A;  3K8A A;  2KUM A;  2HCC A;  2UU9 Q;  1T5X D;  3Q8D A;  4QL5 A;  5IT9 c;  4RHR A;  2JA8 G;  4GN5 A;  3VR3 A;  1WI5 A;  3OWF A;  1V1P B;  2MFI A;  4H0L C;  3PMF A;  2SOB A;  4BBR H;  1GXD C;  3F1Z A;  3ERO A;  3FEW X;  4EX5 A;  1EFW A;  1TKW B;  3VYT A;  3Q6S A;  3X3N A;  3BZD B;  3TN2 A;  2KEC A;  3CCV A;  2RDF A;  3CF5 A;  1XYI A;  4C2M H;  3JAM i;  2JJQ A;  3NQI A;  1AZQ A;  1SYB A;  1LAB A;  1I4P A;  4LJZ C;  1YIT A;  4DR3 L;  1MD2 D;  2LMC B;  4HMJ A;  1YNN C;  3H91 A;  1CI3 M;  3DMU A;  2M2L A;  3I4N B;  1QUQ B;  4A3J B;  5G3L F;  1QJO A;  1TWH B;  1U4P A;  4DR5 Q;  2UUC Q;  1K8G A;  5C3E H;  4CKE A;  4BWG B;  3GTL H;  1ET6 A;  4O42 A;  1F2Z A;  3E6Z X;  3J81 i;  4B3S L;  4QY7 A;  5C5M A;  5FLX c;  5IGE A;  1VQC A;  3C46 A;  4B3M Q;  2R92 H;  1J5E Q;  4IFD G;  2WV6 D;  1A15 A;  3AEV A;  1N33 L;  2L1B A;  2K32 A;  4H44 C;  2VB3 X;  3T16 A;  1VF5 C;  4K2K A;  3RLN A;  1YNX A;  3DWQ A;  4ZQ3 A;  4A3M G;  4CDF C;  3S1M H;  2AWO A;  2F3I A;  4C1N K;  1WVL A;  1JE5 A;  1I6H H;  4KHV A;  5C5L A;  2XNA C;  4A3B B;  2R6G A;  1S3O A;  4NW2 A;  2HD3 A;  2SNS A;  3TP8 A;  5JPN C;  3A8I E;  4GNX B;  1EY0 A;  2LKV A;  1HZC A;  1LV9 A;  4DGZ A;  5I2X A;  2K33 A;  5M3M H;  1Y1W H;  1W2B A;  3QOL A;  2DNE A;  1SND A;  2Q2H A;  1DJR D;  5C0X G;  1STY A;  4KI0 A;  4JI1 Q;  1L1O A;  3GQB A;  5JVH 3;  1TU2 B;  1S5C D;  3D8G A;  4DV4 L;  1N8R C;  1ENA A;  4MZ9 A;  5FLM H;  4A93 B;  1VQH A;  1YVC A;  2NVT H;  1X54 A;  3TME A;  1SMY D;  3S1R H;  2HHH L;  2NVX H;  4A3K G;  1R4Q B;  4DAM A;  2RHS B;  2Z8L A;  3KF8 B;  4F87 A;  4JI2 L;  1N32 L;  4KY7 A;  4IFD I;  2E2I B;  3PUW A;  1O7Y A;  3I4M G;  4DR7 L;  3T1Y L;  4GNX C;  2GVB A;  4OWT B;  1WD1 A;  1HTL D;  1N36 L;  1S5F D;  4EQ5 A;  1KDC A;  4KN4 C;  2X6G A;  4PMB A;  4C3J G;  4EQN A;  2ZJR A;  1HNX Q;  1Q8K A;  3J81 E;  4JK1 C;  4OXP A;  1CQV A;  2F0N A;  4FVM A;  3KF6 B;  4V0B A;  4DF7 A;  1SFO H;  3DWP A;  3GTM H;  2QKI C;  1J6Q A;  1CSQ A;  4IUV A;  4G7Z C;  2B2V A;  2RHQ B;  4DR6 Q;  3OPO A;  2EYL A;  2K28 A;  4OIK A;  4FDB A;  1SNM A;  4A4I A;  1QWY A;  3A56 A;  1F77 A;  4RGM A;  5IYC H;  1M8A A;  1LTL A;  2WB1 B;  1MHW C;  3S2H H;  1JJ2 A;  2PCF B;  4QCL A;  1DOK A;  3MHB A;  5M3F H;  3CCM A;  5IGC A;  2EIF A;  1Y1V B;  4G7O C;  1GUS A;  1GM5 A;  4YIJ A;  1I50 H;  1BCP D;  1GVP A;  2B8F A;  5EJW A;  1RTN A;  1TR5 A;  2EJF C;  3CD6 A;  2Z1C A;  2EPB A;  2ZM6 L;  2DUD A;  1EYC A;  2A6H D;  1NTG A;  4OGQ C;  3MZ5 A;  1ESF A;  1B3A A;  4LF5 Q;  2NVQ B;  4C3I G;  1RCV D;  1GUN A;  2D5D A;  2H5X A;  4N9P A;  3A54 A;  1FVI A;  4JI5 L;  1VQM A;  1PDQ A;  4L63 B;  1VQN A;  3R93 A;  4B9W A;  3HOX G;  3S14 B;  5NUC A;  1ICW A;  1PYS B;  4X66 L;  1EQR A;  2YU9 B;  4K14 A;  2OQK A;  2RA4 A;  1UEA B;  3AFP A;  4A3C H;  3VA7 A;  2PI2 E;  1XMQ L;  3W1G A;  2R93 H;  4NXN Q;  1EWI A;  2DN8 A;  2E2J H;  3TZU A;  4LFC L;  2KCT A;  4APV A;  3U9O A;  4DN4 M;  3PUZ A;  2JYO A;  1I3Q B;  1SLJ A;  3NEL A;  4LUV A;  5AJ3 Q;  3HG9 A;  1NAP A;  3KUP A;  4BY7 B;  1SXT A;  3HEJ A;  2YTX A;  4A3F H;  2FMC A;  1JT8 A;  3NTK A;  1TWA H;  3SGI A;  1XPO A;  3PIP A;  2O5J C;  4PV1 C;  2JQO A;  4KD4 A;  2B2V C;  5G3L D;  2JA8 B;  1JOK A;  2IX1 A;  2D9U A;  2EOT A;  4JBM A;  3OW7 A;  3BVZ A;  1T5E A;  1Q1E A;  1SYE A;  3HOY H;  5FOB B;  2K14 A;  3TDQ A;  3CME A;  1BCP B;  2F0S A;  3VA5 A;  4K8J A;  1F2Y A;  1N34 L;  2VB2 X;  2K6A A;  2Z0S A;  1PRT F;  3MFY A;  1PTO C;  4CJ1 B;  1PHJ A;  4AQY L;  1ICF B;  1SE2 A;  4MN3 A;  4KTA A;  5DLQ E;  4A3L G;  3EIV A;  4GKK Q;  1DGS A;  3GTK H;  1JOR A;  4S3S A;  2MGS A;  4HTH A;  2C5C A;  1GD7 A;  2VXW A;  2Q2U A;  4IUN A;  1LTI D;  5GAH C;  5HGT A;  1LTT D;  1UAP A;  1S5E D;  1EYG A;  5IGF A;  4BBS G;  5GQO A;  2EXD A;  1G6Z A;  1BCP C;  3HFZ B;  2M00 A;  2CW0 D;  3RZD H;  1CKM A;  1ENF A;  1QVC A;  3MXG A;  4RH6 A;  2ZJQ A;  2F0P A;  2WAQ E;  4DR3 Q;  2OWO A;  3ICE A;  2OT2 A;  3NTH A;  4HJ8 A;  2BOS A;  4RCO A;  4JG2 A;  3J7A V;  4PQX A;  5JEA G;  3LNN A;  3M9B A;  1HR0 L;  1C7Y A;  4A3M B;  1CKN A;  3NP8 A;  2Z9H A;  3D3R A;  3GTQ B;  2K4K A;  3CCQ A;  3JC6 6;  1GOZ A;  3SK5 A;  2EYF A;  1J8I A;  3D0F A;  1KHI A;  2K5W A;  3G71 A;  4GN4 B;  4K5X A;  4R8I A;  3I73 A;  3EQL C;  2RBM A;  3CPW A;  1WTP A;  4UP7 A;  2EZV A;  1WCM G;  2AMC B;  2QIL A;  3I90 A;  4IOC A;  4R4O A;  1XNQ L;  5E4W C;  3S1Q H;  1K83 B;  4DK3 C;  4A3G G;  4JBW A;  2Q8T A;  3PUV A;  1JB3 A;  1X3E A;  1LAC A;  1W6J A;  3ND8 A;  1E7Z A;  4GS3 A;  3VR5 A;  1Q12 A;  2M9V A;  1XPU A;  3D4R A;  4NKL A;  4A3K B;  4RFB A;  1Q86 C;  2EJG C;  1WJJ A;  1SSO A;  1VQJ A;  3N6R A;  3T51 B;  1CHP D;  1HH2 P;  5EPL A;  3I4M B;  1SE3 A;  1IBK L;  1RJT A;  2D0O A;  2BCO A;  4WRD A;  2PO4 A;  4OHJ A;  2QA4 A;  2F0U A;  3NEN A;  5IE8 A;  3T4A C;  4RHS A;  1Z6H A;  4C3J B;  2R7Z G;  1PVO A;  5JJI A;  1DXM A;  1J5E L;  4JI6 Q;  3F2D A;  1U0L A;  4GZY C;  3I8Z A;  1VS0 A;  1TS5 A;  3FRP B;  1D1I A;  1L0W A;  3MXN A;  5BR8 Q;  4ID6 A;  4IPG A;  2PZU A;  2LY7 A;  4IO9 A;  1H9M A;  2HHH Q;  4R4T A;  4BBR G;  2RKS A;  2QGQ A;  1Q90 A;  1HNW Q;  1YJ9 A;  4JI2 Q;  1LT6 D;  1N32 Q;  1H9K A;  1OXV A;  1VQP A;  4DR7 Q;  2HQL A;  3DM3 A;  3C3L A;  2EE1 A;  3CPF A;  1N36 Q;  1EU3 A;  2PMZ B;  2J4X A;  2OF1 A;  3MVV A;  4NP5 A;  5ELN A;  4H13 C;  1PH8 A;  3GD7 A;  1SEB D;  1ZYR D;  5D3D A;  1B1Z A;  1C9O A;  3H3V H;  2A8V A;  2WII B;  2Y0S G;  2IWH A;  5M9O A;  4FYD A;  2V4D A;  2PQE A;  2B63 G;  2LSS A;  2NYZ D;  2E5L Q;  2F0V A;  2XRQ D;  2HCI A;  4DNT B;  1HXY D;  1XNR Q;  4JOI A;  4C3H H;  4K5W A;  1GJX A;  2CH4 W;  4AIM A;  2K5V A;  1EEF D;  1LUZ A;  1V8Q A;  1PZK D;  1EY5 A;  3IRB A;  1F9S A;  5T1G A;  3F2C A;  5FO7 B;  5CYU A;  1SYG A;  2FJ2 A;  2ALY B;  4C3I B;  1IL8 A;  3UE0 A;  4A3I H;  2DJF C;  3J81 L;  2EY1 A;  1MSH A;  1RKN A;  3HOX B;  1SMX A;  2A69 D;  2NZH A;  2L9H A;  4UHV A;  2PMZ E;  1ILQ A;  3AFQ A;  4MTN A;  2B2W A;  4A3D G;  3TRE A;  3F2U A;  4DV0 L;  3G7L A;  4TKO B;  5CGK A;  3M4O H;  1PYW D;  5CBA E;  3CCS A;  2ZM6 Q;  2LS0 1;  4R4Q A;  1PH9 A;  2NWG A;  2I0Q A;  1PRT D;  4ALP A;  2E8G A;  2AQ2 B;  3S17 H;  1HQM C;  3KJP A;  4FNF A;  1AH9 A;  2WAC A;  2NUC A;  5M3M G;  1Y1W G;  1FL0 A;  4DR1 L;  3NBI A;  4N8X 1;  3KLR A;  2PW7 A;  1ASZ A;  1M90 C;  3PSI A;  4PNY A;  1XMQ Q;  3S9W A;  4YCW A;  1ZXT A;  5DM7 3;  4DNR B;  2K5H A;  2JA6 G;  4RAU C;  3PQI A;  5JAV A;  4O2D A;  3QG1 A;  2XRS D;  2ICI A;  5D65 A;  4A3E G;  3BG3 A;  5LL6 S;  3SK4 A;  2Q2I A;  2ID0 A;  3OMG A;  1W3S A;  1XX8 A;  3TS2 A;  1TWG B;  4YY3 L;  2RQX A;  1VF7 A;  2HDL A;  3LWU A;  4X3U A;  2BH2 A;  3E0E A;  4XXE A;  5IYB H;  1STB A;  2PQA B;  3RN5 A;  2HIX A;  3FKI H;  1SNQ A;  3NBH A;  4OIJ A;  4XIG S;  3CP0 A;  3HOU G;  1PH1 A;  2L5T A;  3KLW A;  1WTO A;  1F2M A;  2B3G A;  1KLU D;  4ME3 A;  5LMU L;  4R4I A;  1IL2 A;  3NPP A;  1VDZ A;  4KJO A;  1VQE A;  4BBS B;  1ZYR C;  1D5M C;  3A8J E;  3IFT A;  1FNV A;  3GTO H;  4LWC A;  3J80 E;  3S2D H;  4HJ5 A;  1SR3 A;  1RTO A;  1XMO L;  4PZ6 A;  3M7N A;  5FLX E;  4CGY B;  4X65 L;  1VQ6 A;  4AQY Q;  2KCN A;  5EBD A;  1V1P A;  1E3P A;  2NTT A;  5EGT A;  3MXP A;  1VQL A;  4X3K A;  1II3 A;  2F4I A;  1PRT B;  2B2W C;  1Y14 B;  3W5O A;  4B3R L;  1H9J A;  4IUR A;  1AE2 A;  1KC8 C;  5KGU A;  3FPP A;  2L0C A;  4Z9C B;  3T13 A;  1IYV A;  1LTS D;  3RLF A;  1TXY A;  5C44 G;  1UNS A;  4LF4 L;  2I46 A;  4NPS A;  2VQF L;  4O1N A;  2A69 C;  3RN2 A;  4JI8 L;  2IJ0 A;  3CRL C;  1QUQ A;  2VQE L;  3HOZ H;  2SNM A;  1CFM A;  2IHF A;  4XT3 B;  1TWC H;  4LF6 L;  1UUP A;  2RDH A;  2XTI A;  1WCM B;  3CC2 A;  2A5H A;  2O2L D;  2RCF A;  1HFN A;  4RMF A;  4F88 A;  2JK8 A;  2F4V L;  4IOA A;  3PO3 G;  2L11 A;  5LMN L;  1PRT C;  4J15 A;  1O7Z A;  4UDU C;  4A3G B;  4ZKB B;  1HR0 Q;  4U67 3;  2A73 B;  3TP5 A;  3Q24 A;  1SJE D;  1B50 A;  2NB0 A;  1SAP A;  4A3C G;  2H1E A;  2F0W A;  2KEE A;  3G48 A;  3NXW A;  3TS0 A;  3AU7 A;  3GTG B;  5JJZ A;  4FXD A;  3D4W A;  1Z7T A;  4JPB W;  2WAQ G;  1VQI A;  2IX3 A;  3TQY A;  4IUP A;  4JBK A;  1U9R A;  2BE5 D;  5M5Y B;  1XNQ Q;  4DU9 A;  5KIX A;  3GTJ B;  2R7Z B;  3U58 A;  4RKB A;  2EQS A;  5KNB A;  2YTV A;  1PXU A;  1HA5 A;  1VQ9 A;  2JA7 G;  3V2T A;  3I4N H;  4PG3 A;  4F8M A;  5ELF A;  4GNX A;  4YCV A;  1TWH H;  2KHJ A;  4KLK A;  5KNC A;  4X64 L;  1X32 A;  4QUF A;  2XWJ B;  1EOT A;  4BBR B;  4MIU A;  2NVY B;  1B2T A;  5IWA L;  1BBW A;  3FHW A;  5JJL A;  4JI4 L;  1IBK Q;  2KVM A;  5FJ8 H;  4IAL A;  5IP7 G;  5IP9 H;  3V05 A;  1GKH A;  1FD7 D;  4RGO S;  4L5S A;  1Q7Y C;  4A75 A;  1EWC A;  1LTR D;  4JC0 A;  4RGT A;  1CUK A;  1S5B D;  3OTO L;  5IY0 A;  3R2T A;  3KF8 A;  5LHY 1;  1V1Q A;  1LO5 D;  1KNA A;  2Y0S B;  3E5S A;  1CHQ D;  1SE4 A;  4DV7 Q;  5K36 H;  3HP3 A;  4DV1 Q;  1AE3 A;  4KV6 A;  2B63 B;  4YWL A;  1AP0 A;  1RF2 D;  3GTL B;  4OO1 H;  3BVG A;  1U4M A;  1AEX A;  2AKW B;  1HNZ L;  5A35 A;  3KF6 A;  1PMR A;  2HIV A;  4A3B H;  1BDO A;  4DUY L;  3MTS A;  3STB D;  2JA5 H;  1B44 D;  3SDZ A;  4DAP A;  4ZLT F;  5FKA C;  1ZKO A;  1PH5 A;  1LT5 D;  2DY8 A;  3VYR A;  5C0X J;  5I9O A;  4POF A;  1BQQ T;  5HUR A;  1WTR A;  4LK1 C;  5C4X G;  2AHO B;  1RDP D;  1GUT A;  3K59 A;  5CV5 A;  3Q23 A;  4A3D B;  2EYO A;  2K75 A;  4H02 A;  4PMC A;  3JAM E;  1HR0 W;  2B2T C;  4YWK A;  3R2I A;  1PZJ D;  2PI2 A;  1S5D D;  5A2Q E;  4JI6 L;  2Y0S E;  2K1B A;  5CR3 A;  1I6H B;  5BR8 L;  1JC7 A;  3RLO A;  4IN3 A;  3TP6 A;  4JYA L;  1HPC A;  1LYL A;  1VQ7 A;  2E2I H;  1HNW L;  1CZG A;  3R3O A;  1JE4 A;  2K5D A;  3NEM A;  1UE6 A;  1SNC A;  5M3M B;  2ZXO A;  1Y1W B;  1YEZ A;  5EAY A;  1X3F A;  3OIQ A;  4K0K L;  2F0J A;  1LM0 A;  2ZTC A;  3SK6 A;  1PA6 A;  2D0P A;  1WD0 A;  4DV0 Q;  3W3A A;  4GLA C;  3ND9 A;  5EKI A;  2NVT B;  1HTP A;  2JA6 B;  3NUC A;  1XTD A;  3S1R B;  2NN6 H;  3WWV A;  4A3E B;  1G2T A;  3KOJ A;  2E5L L;  1QNK A;  1XNR L;  4CKB A;  4KD3 A;  1QIL A;  1E1O A;  2QDL A;  5C4J H;  1HZ9 A;  4WJ4 A;  1BXT A;  1AW7 A;  3CU7 A;  5KRU A;  4DR1 Q;  3NTI A;  3HOU B;  4QGU A;  1Y1V H;  4FP5 D;  3S15 H;  3QR8 A;  2QEJ C;  2FFK B;  3LGJ A;  1U4L A;  3UDI A;  4LFA L;  4WJ3 M;  2GVA A;  2SDF A;  4RWS C;  1JOO A;  4IQZ A;  1RIP A;  5C3X A;  3C1E A;  1A8V A;  1BBU A;  1K3B C;  1I94 L;  4DV2 Q;  1KAW A;  1VMC A;  4YY3 Q;  3MEF A;  1X56 A;  3I72 A;  1PYB A;  5CC4 A;  4IUQ A;  5J22 A;  2Z6K C;  1TY2 A;  2F0E A;  5CBE E;  3ERQ A;  5JJK A;  2K7V A;  5LMU Q;  2IL8 A;  3ONA B;  1I50 B;  1X65 A;  2YYZ A;  1HA6 A;  1CA5 A;  3HRZ C;  4QJF A;  5C44 B;  2G5D A;  1XJV A;  1VMP A;  2YU9 H;  3UE1 A;  3F8T A;  4P74 A;  4IPD A;  3I55 A;  3CCJ A;  2E2H H;  2MO0 A;  1YNJ D;  3AB9 A;  1XMO Q;  1PH4 A;  2I5H A;  4DXG A;  5D14 A;  4X65 Q;  1YHA A;  4C3H G;  3HKZ G;  5IYD G;  4HID A;  4OWX B;  3H94 A;  4Q5V A;  4HR7 B;  1JWM D;  1PTO H;  4BY7 H;  2CH4 A;  4FF2 A;  4WOR A;  1B3Q A;  4CDE C;  3PO3 B;  3BS1 A;  1O7L A;  4B3R Q;  1SMY C;  2N88 A;  2Z4I A;  2L12 A;  1XPR A;  3K7U C;  3H15 A;  2JA8 H;  4L5R C;  2GN5 A;  3MC0 B;  3KLS X;  2JN4 A;  4LF4 Q;  1I4R A;  2VQF Q;  1H95 A;  2HQE A;  2P5Z X;  4JI8 Q;  3J80 L;  3G6E A;  5D3I B;  3CCR A;  5M5W B;  1UE5 A;  3WOE A;  2VQE Q;  1YBY A;  5IGD A;  4L5Q A;  1LLR D;  1X6O A;  3E0J A;  5FLX L;  1QVG A;  2A68 D;  4LF6 Q;  3HOV H;  3S1N B;  3ERS X;  1EIY B;  4ULL A;  2WAQ B;  1AN8 A;  1EY6 A;  1MGS A;  3AQQ A;  3AYH B;  2F4V Q;  4NXM Q;  4LUZ A;  1I4H A;  5LMN Q;  3H3V I;  3SR1 A;  4G7H C;  2KA7 A;  3H0G H;  2B2U C;  1J9O A;  2QEX A;  1XTC D;  1MI2 A;  3WDN A;  2XVS A;  4JI3 Q;  2B39 A;  5F2D A;  3MAQ A;  2JA7 B;  4X3S A;  1OXT A;  2EY2 A;  3DLL A;  1EY7 A;  1HFG A;  1F2L A;  2XWB B;  4HIM A;  3E3X A;  1TWF H;  1YHB A;  3BDL A;  5JOB A;  1SYC A;  2PZW A;  3CW2 C;  3IKJ A;  3RD4 A;  2EYP A;  2RF4 A;  1CKO A;  1ILP A;  2LXK A;  3OYY A;  3H09 A;  5H1S E;  4K5V A;  4DR2 L;  3ITP A;  1G8Z D;  1QZG A;  4BS9 A;  4M1U B;  2KCM A;  3URY A;  2PNR C;  1VQK A;  1STA A;  3NSW A;  5I2Y A;  2JXM B;  3I91 A;  1OXU A;  1W6K A;  2F0D A;  3HOW H;  3EA6 A;  2HDM A;  2L4N A;  4JW0 A;  2O4X A;  1K8O A;  4ME5 A;  4ZK9 B;  5I6W A;  1BKB A;  2A6H C;  1C4Q A;  4X64 Q;  4K6D A;  2I07 B;  3HZX A;  4Y7N H;  4A3M H;  4ZUI A;  3AMU A;  4CJ0 B;  2PNH A;  3I4L A;  4C56 C;  5HY6 A;  3GTQ H;  1LTG D;  5IWA Q;  3PUY A;  2A6E D;  3DHQ A;  1PLF A;  3PO2 G;  4JI4 Q;  1STH A;  3K5N A;  1OTC A;  5CV4 A;  1QG7 A;  2B2Y A;  2YV5 A;  1K8M A;  1ROD A;  3GV6 A;  1C48 A;  1E22 A;  3UDG A;  1FYC A;  1YNJ C;  1JJC B;  1L0X B;  3IAY A;  1WTV A;  1E0B A;  2C35 B;  3OTO Q;  2EJM A;  3NHH A;  1VQB A;  1MSG A;  3J7Y W;  4DV5 L;  5C0X H;  3U9S A;  5C4X B;  1Q8I A;  2OQ0 A;  4LW1 A;  3SEB A;  3NWT A;  3VYS A;  1A3T A;  4BXX G;  2N49 A;  1WOC A;  3CC7 A;  2UUA Q;  3NQT A;  4V19 0;  1NBW A;  4JBJ A;  4K8I A;  4DA2 A;  3I2Z A;  1DON A;  5EPK A;  4CDC C;  4AH6 A;  1VQO A;  2KHI A;  4KY5 A;  1HNZ Q;  1YJN A;  1SRU A;  4A3K H;  4DUY Q;  3UDX A;  3BZC A;  4QF4 A;  3I4M H;  3ULP A;  5DAU A;  4XYQ A;  3L7Z C;  4DK0 A;  3A5Z B;  4DR4 L;  1X3P A;  1R9T B;  1EY8 A;  4POG A;  2A68 C;  4C3J H;  3S1Q B;  5LMN W;  2DGY A;  3A0J A;  1DM0 B;  3K5O A;  1CK1 A;  2UXD L;  1TQO A;  4I7Z C;  1EU4 A;  4KHZ A;  4TQU S;  5C6A A;  1TY0 A;  3DWA A;  4O0A A;  3KBG A;  1D6E C;  4DV7 L;  4DV1 L;  1C0A A;  3OMC A;  4OEM B;  3HGB A;  4JYA Q;  2XIW A;  3EN2 A;  5KYL A;  1S4Z A;  2L15 A;  1Q1B A;  1AZP A;  4OX9 L;  4KKS A;  4ODG A;  2UXB L;  2UXC L;  2VNU D;  2Q2T A;  1M1K C;  3RR5 A;  1STE A;  4DK1 A;  4K0K Q;  1QZH A;  3K5M A;  2CW0 C;  2K50 A;  2WKD A;  3P20 A;  1KRT A;  3JAM L;  5COY A;  1I4G A;  2B2Y C;  3DUZ A;  1IYJ B;  1B70 B;  5A2Q L;  3M85 A;  5M5X B;  3TZD A;  4AYB G;  4M8A A;  2TMP A;  3CCL A;  5DEH A;  3K58 A;  3IL8 A;  1G51 A;  2HUG A;  5C3E G;  2RVL A;  4IPC A;  3CQZ B;  3A7L A;  4DXF A;  3H6M A;  4CDD C;  3M3Y B;  4YCU A;  5IP9 G;  2A6E C;  1D5Z C;  4C3I H;  3PIO A;  5EQ0 A;  2R92 G;  2EXZ A;  4LFB L;  3TRZ A;  2ASB A;  4GLV B;  5CMD A;  4OL7 A;  4LFA Q;  5K36 G;  3SHL A;  2I5M X;  3U4V A;  5C4Z A;  1U5K A;  5KYI A;  2PQA A;  1I5F A;  1X55 A;  1I6V C;  1HJP A;  3QOJ A;  4C3H B;  1KQS A;  1I94 Q;  3HKZ B;  3VR4 A;  4QUC A;  1KTK A;  3D4D A;  4KY6 A;  2PW5 A;  1Z47 A;  2EVB A;  4XQQ A;  2JA5 G;  1K28 A;  4B3T L;  3BZK A;  2BDN A;  1I4Q A;  3DM1 A;  1SBB B;  4RA8 A;  3PF4 A;  4MHE A;  3E9H A;  1PV4 A;  3GTP H;  4P73 A;  2CWP A;  5IT9 E;  1IBL L;  2VW9 A;  4LAA A;  1LTB D;  2EDG A;  4DKA C;  4IUU A;  5FLM G;  2EYM A;  1T9H A;  5C3W A;  1H9S A;  2J7Z A;  2AUK A;  3Q0A A;  1A3V A;  3S17 B;  1O78 A;  2VUM H;  4A3L H;  2L55 A;  3HKZ E;  4G4K A;  5I6Y A;  4DV2 L;  1VQA A;  5E1F A;  4DV6 Q;  2BDO A;  3PF5 A;  3K81 C;  3RZO B;  2J0T D;  3BU2 A;  3OOC A;  3LX0 A;  2CFM A;  4OO1 I;  3W1B A;  4LF9 L;  1DOL A;  2F1M A;  1PH2 A;  3M4P A;  3L2P A;  4BBS H;  2IT1 A;  3CXC A;  2XSC A;  3OIP A;  1EL0 A;  1EQQ A;  3K7A B;  2TSS A;  1D2B A;  1VQD A;  1SDF A;  3NWS A;  4QIW E; 
#chains in the Genus database with same CATH homology
 1SJH D;  2K05 A;  4HCS A;  5J1Z A;  2AUJ D;  3CHB D;  5AFW A;  1JWS D;  2RSO A;  5JEA H;  3M4Y A;  3VR6 A;  3EJI A;  2FIN B;  1H9S B;  3RMH A;  3PO2 B;  1KLG D;  3S2D B;  2MPM A;  1V43 A;  3IFD A;  4HCE A;  3GO5 A;  3FMC A;  2EY6 A;  2MP1 A;  3R8B A;  3BDC A;  3VR2 A;  4EVO A;  3HS0 C;  1WTX A;  4XT1 B;  1CQF A;  3PUX A;  2K5Q A;  3OSO A;  1KAA A;  3QIA A;  4QB4 A;  3QB3 A;  1EY9 A;  2EYJ A;  4HED A;  1Y8N B;  2ICE C;  4FF4 A;  4ZKC B;  2B2T A;  4J8Q A;  2F0Q A;  5ELC A;  4KJN A;  2BA1 A;  1STN A;  1TII D;  4R8N A;  2MJ8 A;  1B9M A;  1HCZ A;  2F0K A;  3I3C A;  1OXS C;  5J39 A;  4E6I A;  2JP1 A;  2JSO A;  3FVQ A;  3BDO A;  1HRJ A;  2RDG A;  2CHB D;  3TBI B;  5LL6 X;  4FF3 A;  4C2M B;  1WTW A;  3EFX D;  3V96 A;  4IFD J;  5C4H A;  2KOL A;  3SE0 A;  1G91 A;  2Q8R E;  1HHV A;  4AYB B;  4Q0F A;  1B9N A;  4LMQ D;  4KN7 C;  2K03 A;  5C3E B;  4ABN A;  3L9A X;  4CJ2 C;  3DXJ C;  3NK9 A;  1KNE A;  4XQJ A;  1A2U A;  5COR A;  4B9X A;  2R92 B;  1CT1 D;  1BO0 A;  3A55 A;  2G9D A;  4KKT A;  5BN5 A;  3GP7 A;  5DM6 3;  5CV7 A;  2C9O A;  2CVR A;  3S1M B;  2SEB D;  2F0G A;  4EGV A;  1JIC A;  1KDB A;  2FMM A;  2JA5 B;  4IUT A;  1U4R A;  1BOS A;  2JEB I;  1EQT A;  1LTA D;  3ZYY X;  2O5I C;  5T1I A;  1IHZ A;  1DOM A;  3C2P A;  2DNC A;  2KJX A;  1IYU A;  2PPB C;  1HUM A;  2BE5 C;  1SYD A;  5EKL A;  3DEO A;  5EPJ A;  2GA4 B;  2KED A;  2F0O A;  2NVX B;  1EY4 A;  1D5X C;  4KMU C;  3KK7 A;  1JCK B;  1EYD A;  3CRK C;  3D31 A;  3T53 B;  2XN9 C;  1EYA A;  4CKC A;  3PIP 3;  1DYQ A;  1MBY A;  2LFN A;  2F0F A;  4R9W A;  1SFO B;  2B2U A;  3GTM B;  2R3Z A;  4K6L A;  5I9P A;  1PTO D;  4FXK C;  4ILW A;  1QE6 A;  2X69 A;  2F0L A;  3WOF A;  2WKC A;  4J1M A;  5C0X I;  1F9R A;  3OWE B;  5C4J B;  3S2H B;  1C8C A;  3OHX C;  5CV9 A;  2IX0 A;  1GHK A;  4J6H A;  5CV6 A;  1D1K A;  1EIG A;  5EKK A;  4BA2 I;  3S15 B;  5M3F B;  5IT9 L;  3W2D A;  4KKU A;  4QMG A;  1NSN S;  1CZW A;  5JPM C;  1XWE A;  1A6X A;  1EWH A;  5FK9 C;  3C1F A;  1JOQ A;  2ZXP A;  4XDX A;  1EEI D;  1Q3L A;  2QF7 A;  4L6T B;  1ENC A;  3MEH A;  3P7J A;  4XTC S;  2AWN A;  3SK8 A;  2F0H A;  3TSS A;  3X3M A;  1A3U A;  1L0Y B;  2E2H B;  1E2W A;  1OXX K;  4KK7 A;  3P1H A;  3L3O C;  2R93 B;  3MXU A;  4HAE A;  2E2J B;  1QNU A;  1F9Q A;  3M7G A;  1PTO B;  1CM9 A;  2A74 C;  5I4D A;  3KLS A;  2F03 A;  4A3F B;  4FO2 A;  2JE6 I;  1TWA B;  1FNW A;  4CBV A;  4DAV A;  2ZXR A;  1G2S A;  1SNP A;  3QO2 A;  1A2T A;  1X3Q A;  1CTM A;  1PZI D;  2KHS A;  2KCC A;  1AFP A;  3HOY B;  3HOV B;  3J7A F;  1ZEQ X;  1VCI A;  2ZT9 C;  1STG A;  2F0I A;  4EQP A;  4RCN A;  2BA0 A;  3H0G B;  3A8K E;  2D2C C;  4I65 A;  4TSS A;  4IFD H;  2MUY A;  3GTK B;  5JEA J;  2NBF A;  3QWN A;  2AQ1 B;  3Q22 A;  5IGG A;  2FHT A;  1TWF B;  4HSP A;  5CV8 A;  1XXG A;  1E2V A;  2AQ3 B;  1EFI D;  1GUO A;  1TS4 A;  2KQ3 A;  3SVM A;  3RZD B;  1HQR D;  4X3T A;  5IGB A;  3HOW B;  5ELB A;  4HMI A;  1ONL A;  4Y7N B;  4RKL A;  3BVM A;  5JVG 3;  1PFN A;  2QCP X;  4NMZ A;  1OO9 B;  4EQO A;  1RD9 D;  1QB5 D;  2H4O A;  4ZAI A;  4CHT B;  1EIH A;  4TRD A;  3I70 A;  4NDX A;  4ZRZ A;  4ZUJ A;  3PIO 3;  3FDT A;  4UAI A;  5ELD A;  1BBX C;  2JEA I;  3PV0 A;  2PZT A;  1ML0 D;  3N52 A;  4WJW A;  2E76 C;  5ISR A;  1O80 A;  1JR0 D;  2PYK A;  1Y69 U;  3D6C A;  2EYH A;  4G57 A;  4N9T A;  1LT4 D;  3K6O A;  2F3V A;  4WFN 3;  1QOH A;  1H9R A;  3NE5 B;  3K5L A;  5BN4 A;  1WTQ A;  1EZ8 A;  1QCB D;  2OEO A;  2OXP A;  1GUW A;  1LT3 D;  1IW7 D;  4RGN A;  4FXG C;  3T56 B;  1NUC A;  1IKL A;  2IW3 A;  2E75 C;  1JQY D;  3EVQ A;  3GV3 A;  5EBC A;  3BYT B;  4F7X A;  1TS3 A;  4K2L A;  1HUN A;  4FF1 A;  1F9P A;  1GHJ A;  2G9H D;  4L8J A;  1BF4 A;  1M4V A;  1EZ6 A;  3RUZ A;  1ESR A;  2EY5 A;  3D6W A;  1Y8O B;  5BN3 A;  4HN7 A;  5DNF A;  3A7A B;  4DAY A;  4XYO A;  4OO1 G;  3KBX A;  1KDA A;  1BR9 A;  2MHV A;  2N55 A;  2K04 A;  2DY7 A;  1R4P B;  4B08 A;  5IOC A;  1FR3 A;  1BNZ A;  5IIF A;  2Z4H A;  1G29 1;  4A3I B;  5ELE A;  3VYU A;  3H3V C;  1IKM A;  1NR4 A;  3MFG A;  5KND A;  1ET9 A;  2D62 A;  2X6L A;  5FO8 B;  3MA2 B;  4QIW B;  1DCZ A;  3M4O B;  3UI2 A;  1NCV A;  2E2D C;  2CQA A;  1B53 A;  4ZYS A;  3SXH A;  3GTP B;  1B4O A;  4XQN A;  5FO9 B;  1NR2 A;  3G6J B;  3P75 A;  2RSN A;  1I4X A;  2E74 C;  1IW7 C;  4DFA A;  3LWE A;  1KAB A;  2QDB A;  3BYY B;  2WP8 J;  2NN6 G;  1SYF A;  2WIN B;  5E4X A;  3TP7 A;  2VUM B;  3K0Y A;  3FPU B;  1YNN D;  1TT2 A;  4HSV A;  5KEE A;  2NZ1 D;  2B8G A;  3FKI B;  5K5P A;  5IOD A;  2NTS A;  3DEP A;  1CA6 A;  4U68 A;  2F0T A;  4H7B A;  2F0M A;  3GTO B;  1PTO F;  1JWU D;  5TSS A;  2K01 A;  1SNO A;  1DD2 A;  1TS2 A;  3QJY A;  5E3F A;  3CKI B;  4BA1 I;  4IZ8 A;  1DZ1 A;  4C1N I;  1E2Z A;  2F3W A;  2R61 A;  1EQV A;  2Q8I B;  3S16 B;  2NN6 I;  1BCP F;  1PFM A;  1Y8P B;  2IPK D;  3HOZ B;  1PFB A;  1TVX A;  1RHP A;  1TWC B;  1V1O A;  3O13 A;  2ENB A;  4PMW A;  4BY1 B;  1FGB D;  4P2C B;  1BUV T;  3K57 A;  1FNU A;  3MWY W;  1GUG A;  2KUM A;  2HCC A;  1T5X D;  4RHR A;  3VR3 A;  3OWF A;  1V1P B;  4H0L C;  3PMF A;  2SOB A;  1GXD C;  3ERO A;  3FEW X;  1TKW B;  3VYT A;  3Q6S A;  3X3N A;  3BZD B;  3TN2 A;  2KEC A;  2RDF A;  1XYI A;  3NQI A;  1AZQ A;  1SYB A;  1LAB A;  1I4P A;  4LJZ C;  1MD2 D;  2LMC B;  4HMJ A;  1YNN C;  3H91 A;  1CI3 M;  3DMU A;  2M2L A;  3I4N B;  4A3J B;  5G3L F;  1QJO A;  1TWH B;  1U4P A;  4CKE A;  4BWG B;  1ET6 A;  4O42 A;  1F2Z A;  3E6Z X;  5C5M A;  5IGE A;  3C46 A;  4IFD G;  2WV6 D;  1A15 A;  2L1B A;  2K32 A;  4H44 C;  2VB3 X;  3T16 A;  1VF5 C;  4K2K A;  3DWQ A;  4ZQ3 A;  2AWO A;  4C1N K;  1WVL A;  4KHV A;  5C5L A;  2XNA C;  4A3B B;  2R6G A;  4NW2 A;  2SNS A;  3TP8 A;  5JPN C;  3A8I E;  1EY0 A;  2LKV A;  1LV9 A;  4DGZ A;  5I2X A;  2K33 A;  3QOL A;  2DNE A;  1SND A;  5C0X G;  1DJR D;  1STY A;  4KI0 A;  5JVH 3;  3GQB A;  1TU2 B;  1S5C D;  3D8G A;  1ENA A;  4A93 B;  3TME A;  1SMY D;  1R4Q B;  2Z8L A;  4F87 A;  4KY7 A;  4IFD I;  2E2I B;  3PUW A;  1O7Y A;  1WD1 A;  1HTL D;  1S5F D;  1KDC A;  4KN4 C;  2X6G A;  4PMB A;  4C3J G;  4EQN A;  3J81 E;  4JK1 C;  1CQV A;  2F0N A;  4FVM A;  4V0B A;  4DF7 A;  3DWP A;  2QKI C;  4IUV A;  4G7Z C;  2B2V A;  3OPO A;  2EYL A;  2K28 A;  4OIK A;  1SNM A;  1QWY A;  3A56 A;  1F77 A;  4RGM A;  1M8A A;  2WB1 B;  2PCF B;  4QCL A;  1DOK A;  3MHB A;  5IGC A;  1Y1V B;  4G7O C;  1GUS A;  4YIJ A;  1BCP D;  2B8F A;  5EJW A;  1RTN A;  1TR5 A;  2EJF C;  2Z1C A;  2EPB A;  1EYC A;  2A6H D;  4OGQ C;  3MZ5 A;  1ESF A;  1B3A A;  2NVQ B;  4C3I G;  1RCV D;  1GUN A;  2D5D A;  4N9P A;  3A54 A;  1PDQ A;  4L63 B;  3R93 A;  4B9W A;  3S14 B;  5NUC A;  1ICW A;  2YU9 B;  4K14 A;  2RA4 A;  1UEA B;  3VA7 A;  2DN8 A;  3TZU A;  3U9O A;  4DN4 M;  3PUZ A;  2JYO A;  1I3Q B;  3HG9 A;  1NAP A;  3KUP A;  4BY7 B;  1SXT A;  3HEJ A;  2FMC A;  3NTK A;  2O5J C;  4PV1 C;  4KD4 A;  2B2V C;  5G3L D;  2JA8 B;  1JOK A;  2IX1 A;  2D9U A;  2EOT A;  3OW7 A;  3BVZ A;  1T5E A;  1Q1E A;  1SYE A;  5FOB B;  3TDQ A;  1BCP B;  2F0S A;  3VA5 A;  4K8J A;  1F2Y A;  2VB2 X;  2K6A A;  1PRT F;  3MFY A;  1PTO C;  4CJ1 B;  1SE2 A;  4MN3 A;  4KTA A;  1JOR A;  4S3S A;  2MGS A;  4HTH A;  2C5C A;  2VXW A;  4IUN A;  1LTI D;  5HGT A;  1LTT D;  1UAP A;  1S5E D;  5IGF A;  1G6Z A;  1BCP C;  2M00 A;  2CW0 D;  1ENF A;  3MXG A;  4RH6 A;  2F0P A;  2OT2 A;  3NTH A;  2BOS A;  4RCO A;  3J7A V;  4PQX A;  5JEA G;  3LNN A;  4A3M B;  3NP8 A;  3D3R A;  3GTQ B;  1GOZ A;  3SK5 A;  2EYF A;  1J8I A;  2K5W A;  4K5X A;  4R8I A;  3I73 A;  3EQL C;  2RBM A;  1WTP A;  2EZV A;  2QIL A;  3I90 A;  5E4W C;  1K83 B;  4JBW A;  2Q8T A;  3PUV A;  1JB3 A;  1LAC A;  1W6J A;  3ND8 A;  3VR5 A;  1Q12 A;  2M9V A;  3D4R A;  4NKL A;  4A3K B;  4RFB A;  2EJG C;  1SSO A;  3N6R A;  3T51 B;  1CHP D;  5EPL A;  3I4M B;  1SE3 A;  1RJT A;  2BCO A;  4WRD A;  2PO4 A;  4OHJ A;  2F0U A;  3T4A C;  4RHS A;  1Z6H A;  4C3J B;  1DXM A;  4GZY C;  3I8Z A;  3FRP B;  1TS5 A;  1D1I A;  3MXN A;  4ID6 A;  2PZU A;  2LY7 A;  1H9M A;  2RKS A;  1Q90 A;  1LT6 D;  1H9K A;  1OXV A;  3C3L A;  2EE1 A;  1EU3 A;  2PMZ B;  2J4X A;  2OF1 A;  3MVV A;  4NP5 A;  4H13 C;  3GD7 A;  1SEB D;  1ZYR D;  5D3D A;  1B1Z A;  2WII B;  2IWH A;  5M9O A;  4FYD A;  2V4D A;  2PQE A;  2NYZ D;  2F0V A;  2XRQ D;  2HCI A;  4DNT B;  1HXY D;  4K5W A;  1GJX A;  1EEF D;  1V8Q A;  1PZK D;  1EY5 A;  1F9S A;  5T1G A;  5FO7 B;  5CYU A;  1SYG A;  2FJ2 A;  4C3I B;  1IL8 A;  3J81 L;  2EY1 A;  1MSH A;  1RKN A;  3HOX B;  2A69 D;  2L9H A;  1ILQ A;  2B2W A;  3F2U A;  3G7L A;  4TKO B;  5CGK A;  1PYW D;  5CBA E;  2LS0 1;  2NWG A;  1PRT D;  2AQ2 B;  1HQM C;  4FNF A;  2WAC A;  2NUC A;  3NBI A;  3KLR A;  2PW7 A;  4PNY A;  3S9W A;  1ZXT A;  5DM7 3;  4DNR B;  4RAU C;  5JAV A;  3QG1 A;  2XRS D;  2ICI A;  5D65 A;  3BG3 A;  5LL6 S;  3SK4 A;  2ID0 A;  3OMG A;  1XX8 A;  1TWG B;  2RQX A;  1VF7 A;  2HDL A;  3LWU A;  4X3U A;  4XXE A;  1STB A;  4XIG S;  1SNQ A;  3NBH A;  4OIJ A;  2L5T A;  1WTO A;  1F2M A;  1KLU D;  3NPP A;  1VDZ A;  4KJO A;  4BBS B;  1ZYR C;  1D5M C;  3A8J E;  3IFT A;  1FNV A;  3J80 E;  1RTO A;  3M7N A;  5FLX E;  4CGY B;  2KCN A;  5EBD A;  1V1P A;  2NTT A;  5EGT A;  3MXP A;  4X3K A;  1II3 A;  2F4I A;  1PRT B;  2B2W C;  1H9J A;  4IUR A;  5KGU A;  3FPP A;  2L0C A;  4Z9C B;  3T13 A;  1IYV A;  1LTS D;  3RLF A;  1UNS A;  2I46 A;  4O1N A;  2A69 C;  2IJ0 A;  3CRL C;  2SNM A;  1CFM A;  4XT3 B;  1UUP A;  2RDH A;  1WCM B;  2A5H A;  2O2L D;  1HFN A;  4F88 A;  2L11 A;  1PRT C;  4UDU C;  1O7Z A;  4A3G B;  4ZKB B;  4U67 3;  2A73 B;  3TP5 A;  3Q24 A;  1SJE D;  1B50 A;  2NB0 A;  1SAP A;  2H1E A;  2F0W A;  2KEE A;  3NXW A;  3AU7 A;  3GTG B;  5JJZ A;  4FXD A;  3D4W A;  1Z7T A;  2IX3 A;  4IUP A;  1U9R A;  2BE5 D;  5M5Y B;  4DU9 A;  5KIX A;  3GTJ B;  2R7Z B;  4RKB A;  5KNB A;  1PXU A;  1HA5 A;  3V2T A;  4F8M A;  5ELF A;  5KNC A;  1X32 A;  4QUF A;  2XWJ B;  1EOT A;  4BBR B;  4MIU A;  2NVY B;  1B2T A;  2KVM A;  4IAL A;  3V05 A;  1FD7 D;  4RGO S;  1EWC A;  1LTR D;  4RGT A;  1S5B D;  3KF8 A;  3R2T A;  5LHY 1;  1LO5 D;  1KNA A;  2Y0S B;  3E5S A;  1CHQ D;  1SE4 A;  5K36 H;  3HP3 A;  4KV6 A;  2B63 B;  1AP0 A;  1RF2 D;  3GTL B;  4OO1 H;  3BVG A;  1U4M A;  1AEX A;  5A35 A;  1PMR A;  1BDO A;  3MTS A;  1B44 D;  3SDZ A;  4DAP A;  4ZLT F;  5FKA C;  1ZKO A;  1LT5 D;  2DY8 A;  3VYR A;  5C0X J;  5I9O A;  1BQQ T;  5HUR A;  1WTR A;  4LK1 C;  1RDP D;  1GUT A;  3K59 A;  5CV5 A;  3Q23 A;  4A3D B;  2EYO A;  3JAM E;  4PMC A;  2B2T C;  3R2I A;  1PZJ D;  5A2Q E;  1S5D D;  2K1B A;  5CR3 A;  1I6H B;  1JC7 A;  4IN3 A;  3TP6 A;  1HPC A;  1CZG A;  3R3O A;  1JE4 A;  2K5D A;  1SNC A;  5M3M B;  2ZXO A;  1Y1W B;  3OIQ A;  2F0J A;  3SK6 A;  1WD0 A;  3W3A A;  3ND9 A;  5EKI A;  2NVT B;  1HTP A;  2JA6 B;  3NUC A;  3S1R B;  2NN6 H;  4A3E B;  1G2T A;  1QNK A;  4CKB A;  4KD3 A;  1QIL A;  1BXT A;  1AW7 A;  3CU7 A;  5KRU A;  3NTI A;  3HOU B;  4FP5 D;  2QEJ C;  2FFK B;  1U4L A;  2SDF A;  4RWS C;  1JOO A;  4IQZ A;  5C3X A;  3C1E A;  1VMC A;  3I72 A;  5CC4 A;  4IUQ A;  5J22 A;  1TY2 A;  2F0E A;  5CBE E;  3ERQ A;  2K7V A;  2IL8 A;  3ONA B;  1I50 B;  2YYZ A;  1HA6 A;  1CA5 A;  3HRZ C;  5C44 B;  1VMP A;  1YNJ D;  3AB9 A;  4DXG A;  5D14 A;  4C3H G;  3H94 A;  4Q5V A;  4HR7 B;  1JWM D;  1PTO H;  4FF2 A;  4WOR A;  3PO3 B;  3BS1 A;  1O7L A;  1SMY C;  2N88 A;  2Z4I A;  2L12 A;  3KLS X;  3MC0 B;  1I4R A;  2HQE A;  3J80 L;  5D3I B;  5M5W B;  3WOE A;  5IGD A;  1LLR D;  3E0J A;  5FLX L;  2A68 D;  3S1N B;  4ULL A;  2WAQ B;  1AN8 A;  1EY6 A;  1MGS A;  1I4H A;  3SR1 A;  4G7H C;  2KA7 A;  2B2U C;  1J9O A;  1XTC D;  1MI2 A;  3WDN A;  2XVS A;  2B39 A;  5F2D A;  3MAQ A;  2JA7 B;  4X3S A;  1OXT A;  2EY2 A;  1EY7 A;  1HFG A;  1F2L A;  2XWB B;  5JOB A;  3BDL A;  1SYC A;  2PZW A;  3IKJ A;  3RD4 A;  2EYP A;  1ILP A;  3H09 A;  4K5V A;  3ITP A;  1G8Z D;  4BS9 A;  4M1U B;  3URY A;  2PNR C;  1STA A;  3NSW A;  5I2Y A;  2JXM B;  3I91 A;  1OXU A;  1W6K A;  2F0D A;  3EA6 A;  2HDM A;  2L4N A;  2O4X A;  1K8O A;  4ME5 A;  4ZK9 B;  5I6W A;  2A6H C;  1C4Q A;  4K6D A;  2I07 B;  3HZX A;  3AMU A;  4ZUI A;  4CJ0 B;  3I4L A;  4C56 C;  1LTG D;  3PUY A;  2A6E D;  3DHQ A;  1PLF A;  1STH A;  3K5N A;  5CV4 A;  1QG7 A;  2B2Y A;  1K8M A;  1ROD A;  3GV6 A;  1C48 A;  1FYC A;  1YNJ C;  1L0X B;  3IAY A;  1WTV A;  1E0B A;  2EJM A;  3NHH A;  1MSG A;  3J7Y W;  5C0X H;  3U9S A;  5C4X B;  1Q8I A;  3SEB A;  3NWT A;  3VYS A;  1A3T A;  3NQT A;  4V19 0;  4K8I A;  4DA2 A;  1DON A;  5EPK A;  4KY5 A;  4QF4 A;  5DAU A;  4XYQ A;  3L7Z C;  4DK0 A;  1X3P A;  1R9T B;  1EY8 A;  2A68 C;  3S1Q B;  1DM0 B;  3K5O A;  1CK1 A;  1TQO A;  4I7Z C;  1EU4 A;  4KHZ A;  4TQU S;  5C6A A;  1TY0 A;  3DWA A;  3KBG A;  1D6E C;  3OMC A;  3HGB A;  2XIW A;  5KYL A;  1S4Z A;  1Q1B A;  1AZP A;  4KKS A;  4ODG A;  2VNU D;  1STE A;  4DK1 A;  3K5M A;  2CW0 C;  2WKD A;  3P20 A;  3JAM L;  5COY A;  1I4G A;  2B2Y C;  3DUZ A;  5M5X B;  3M85 A;  5A2Q L;  3TZD A;  4M8A A;  2TMP A;  5DEH A;  3K58 A;  3IL8 A;  2HUG A;  2RVL A;  3CQZ B;  3A7L A;  4DXF A;  3H6M A;  3M3Y B;  2A6E C;  1D5Z C;  5EQ0 A;  2EXZ A;  5CMD A;  4OL7 A;  5K36 G;  3SHL A;  5C4Z A;  5KYI A;  1I6V C;  3QOJ A;  4C3H B;  3HKZ B;  3VR4 A;  4QUC A;  1KTK A;  3D4D A;  4KY6 A;  2PW5 A;  1Z47 A;  2EVB A;  4XQQ A;  2BDN A;  1I4Q A;  3DM1 A;  1SBB B;  4RA8 A;  4MHE A;  5IT9 E;  4LAA A;  1LTB D;  2EDG A;  4IUU A;  2EYM A;  5C3W A;  1H9S A;  2J7Z A;  2AUK A;  3Q0A A;  1A3V A;  3S17 B;  1O78 A;  2L55 A;  4G4K A;  5I6Y A;  5E1F A;  2BDO A;  3RZO B;  2J0T D;  3OOC A;  3LX0 A;  4OO1 I;  1DOL A;  2F1M A;  2IT1 A;  2XSC A;  3OIP A;  1EL0 A;  2TSS A;  3K7A B;  1D2B A;  1SDF A;  3NWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...