1IYUA

Lipoyl domain of pyruvate dehydrogenase complex, nmr, minimized average structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
79
structure length
79
Chain Sequence
SEIIRVPDIGGDGEVIELLVKTGDLIEVEQGLVVLESAKASMEVPSPKAGVVKSVSVKLGDKLKEGDAIIELEPAAGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROLIPOAMIDE ACETYLTRANSFERASE COMPONENT OF PYRUVATE DEH
publication title Three-dimensional structure in solution of the N-terminal lipoyl domain of the pyruvate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
molecule tags Acyltransferase
total genus 5
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1996-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1iyuA00
2KA7A 5K36G 3QJYA 1GUNA 1OXUA 2F1MA 3N6RA 1Z6HA 1LACA 1TU2B 4PV1C 4IFDG 3FMCA 1H9SB 3DXJC 3MFYA 4OGQC 2D2CC 3GQBA 1E2VA 1OXTA 1GUOA 3A7AB 1OXXK 4KKUA 2EJGC 1B9NA 1GUTA 1GUGA 2CW0C 1QJOA 2JEBI 1TKWB 2DNCA 1FYCA 3BG3A 3I4LA 3QG1A 3QIAA 1DCZA 2A6ED 3M85A 3PUYA 1H9JA 2E75C 3VR4A 1Y69U 3M7NA 2AWOA 1IYVA 2PNRC 5BN4A 3A8IE 3IKJA 1GJXA 4H13C 1IW7C 2BA1A 2BDOA 3PUVA 3RLFA 1IYUA 2PPBC 4OO1H 1T5EA 3LNNA 3T56B 2O5IC 4IQZA 1LABA 2B8GA 3PV0A 3KLRA 2K7VA 2K32A 3W3AA 3T53B 2EVBA 1EWHA 2DNEA 1HPCA 2NN6I 1Z7TA 4G7ZC 1V8QA 3P20A 4HR7B 4TKOB 3L7ZC 3EQLC 3NE5B 2BE5C 4LJZC 5C0XH 2A69D 1GHKA 1ONLA 1K8OA 3A8KE 3PUWA 4H0LC 3PUXA 3VR3A 2A68C 1BDOA 2AUKA 3FPPA 3M4YA 3LWUA 2A6HC 2NN6H 3OW7A 1V43A 2O5JC 1K8MA 1H9MA 4TQUS 3GD7A 2R6GA 3AB9A 5C0XG 1SMYC 2BA0A 3I73A 1OXVA 1O78A 2YYZA 1ZYRC 3MXUA 4KHZA 5KNDA 1Y8PB 3VR6A 1E2ZA 1HQMC 2EJFC 1CI3M 2PCFB 3HGBA 4DK1A 4L8JA 3SDZA 4BA1I 3A7LA 1Q12A 1Y8NB 2DN8A 2IT1A 3WDNA 2AUJD 1HTPA 3SE0A 3U9SA 1GHJA 2K33A 3I72A 3OOCA 3TZUA 4BA2I 5JEAH 3CRKC 4KKTA 2V4DA 1O7LA 1ZKOA 3D4RA 4G7HC 5K36H 1G291 3T51B 4LK1C 3IFTA 1H9RA 2JXMB 4OO1G 4JBWA 1A6XA 4IFDH 1VCIA 2Q8IB 1B9MA 1IW7D 2EDGA 2D62A 4XIGS 3VA7A 1Q90A 2E76C 1CFMA 3ND9A 2JEAI 3OPOA 4KN7C 2JE6I 5KNBA 3VR2A 2A6EC 1YNJC 4KI0A 1OXSC 4DNRB 1I6VC 2ZT9C 3CRLC 1YNNC 3BDOA 2BE5D 1DD2A 1VF5C 1Y8OB 2E74C 2B8FA 2L5TA 2NN6G 2A68D 1FR3A 3ND8A 4DNTB 1GUSA 1H9SA 2A6HD 1H9KA 1Q1BA 2KCCA 3A8JE 2LMCB 1PMRA 2EJMA 4G7OC 2A69C 4RCNA 4DK0A 2QF7A 1Q1EA 1HCZA 4H44C 1CTMA 5KNCA 1E2WA 4XTCS 4I7ZC 5BN5A 4JK1C 3H94A 3PUZA 5BN3A 1VDZA 4GZYC 2D5DA 3D31A 3VR5A 4KMUC 5JEAG 4KKSA 1DXMA 5A35A 4KN4C 1VF7A
chains in the Genus database with same CATH superfamily
5K36G 2UXCQ 2KEDA 4PZ6A 3K5OA 2VQFL 2PQAA 4OIJA 1E2VA 3HOYH 3JAML 5IGEA 2RHSB 3RN2A 3BG3A 2RQXA 1HZAA 3M85A 3PUYA 2KCNA 2NVTH 3ITPA 2NZOA 3S16B 3UDXA 1IYVA 2VQFQ 4LNQA 2NVYB 4GKJL 3TP8A 3SK4A 1O7IA 2EY5A 3PV0A 4WFN3 2NVYH 4JI0L 3SK5A 4R4TA 2B63B 3P20A 4K0KL 4ZCKA 4ULLA 3ULPA 1B50A 4GKJQ 1FGUA 2JJQA 2RDGA 4AYBE 5JVG3 5FO7B 4JVZA 4C3JG 4E6IA 1VQ6A 4X3SA 3BDLA 5C4XG 3GTOB 4K0KQ 5ELCA 1GD7A 4OL7A 2CCZA 2XWJB 2N3SA 4P75A 1KRTA 2MO1A 1CI3M 3HGBA 2BH8A 4GLAC 1XTDA 2RVLA 5D3IB 2KOLA 2RBMA 3T51B 4UP7A 1GM5A 5EGTA 4A3BG 3VA5A 1VCIA 1XWEA 2O2LD 3MZ5A 3DEPA 4LAAA 5DLQE 1S3OA 1SNMA 1ET6A 3J7AV 1JJ2A 2UXDL 4CJ1B 2WINB 4BY7B 4J8QA 2Z8LA 2OWOA 1PZKD 4N9PA 3FKIH 4YCUA 1AZPA 1EFID 3CMEA 3E9HA 4KY7A 5D14A 2KCCA 2UXDQ 1WTPA 1X3EA 4C3IG 1L1OC 1IL2A 2CWAA 4DK3C 1PLFA 1Q1EA 2CFMA 4GNXA 1X65A 4K2LA 4A3KH 1E1OA 2JP1A 5ELBA 2L1BA 1BKBA 5NUCA 3J7A5 3KLSA 2K6AA 2Q2IA 4A93B 4HCEA 5LL6S 4DPGA 4OGQC 1Q81C 3X3NA 2ZJPA 5DM63 4X3KA 1SYEA 3RLOA 3I55A 4HJ7A 5JVH3 3QWNA 1KRSA 1HA5A 1YNJD 2WP8J 1Y14B 3MHBA 5IGDA 2K4KA 1S5BD 1Q46A 2G9HD 3HKSA 5CR3A 3UDIA 4DV1L 1MHWC 5I2YA 1T5EA 1F2LA 1ENFA 1TWAH 5IYCG 5D3DA 3I4MG 2WFWA 1NUCA 3ZJYC 4TKOB 1SNDA 1Q86C 4LF9L 3S15H 1K0SA 2VQEL 4DV1Q 5M5XH 3WWVA 2NVXB 1JJGA 1EOTA 4RGTA 1E3PA 4A3FH 3OW7A 1G2SA 1X55A 4DKAC 5CV6A 4LF9Q 4QIWB 4QUCA 1RDPD 1QZHA 1B4OA 1O78A 2YYZA 1MGSA 3BYYB 2ES2A 3WOEA 5KIXA 4EQ5A 4GOPC 4RGOS 3KYHC 5EKKA 1I4PA 1LT3D 4DU9A 4IFDI 5IGBA 1LT4D 3OOCA 1K8GA 1J6QA 3NTIA 5M3MG 4AQYL 3S1RH 4H02A 4WRDA 3AFQA 3CHBD 5FLXE 5LHY1 2L15A 4HSVA 2JA8H 3ERQA 1MIUA 5C4JB 4XYOA 2ZTEA 4JBKA 1IW7D 4HCSA 1S5DD 1CUKA 4AQYQ 2A6EC 1NCVA 4KJOA 3S2HB 2F0IA 2BE5D 2WAQG 1TY0A 3CCQA 4XQQA 1EQVA 4RGMA 2FINB 1PH1A 3S1QB 1PRTC 2K5QA 4POGA 1UE1A 1HR0L 1UEBA 5IOCA 2NB0A 4OO1I 3A8JE 1KLUD 2K75A 4H44C 2XIWA 4V0BA 3NTHA 4JI5Q 2AQ1B 5FLMG 1YEZA 4IUTA 2D5DA 1HR0Q 4IALA 1PH2A 5IY0A 4A3EB 4M1UB 3AMUA 4B3RL 3HOXH 1DOKA 3TP7A 2I46A 3NENA 5CBAE 1YIJA 2UXBL 1I5FA 1Z47A 1CA6A 4JBMA 3M3YB 4FVMA 1U0LA 3GTQB 4B3TL 4B3RQ 1QILA 2SNMA 2CH4W 2PZWA 3KBXA 1VQBA 2UXBQ 1B70B 2AWOA 1KTKA 3PIP3 1LTRD 2BDOA 1DOMA 2IW3A 5CMDA 5CV7A 1IBLL 4IPDA 3J80c 4B3TQ 4OO1H 4GNXC 1KHIA 2R7FA 2K14A 3MXGA 2EVBA 3E5SA 2DNEA 4BBSH 2PI2E 1Z7TA 2HCIA 5FLXL 3HOVG 2MUYA 3GDEA 1IBLQ 4B3ML 2R92H 2WACA 5H1SE 2HDLA 3UDFA 2JA5G 3VDYA 4UDUC 5I4DA 3GTPB 1BNZA 4B3MQ 3H0GH 4L5TA 1LUZA 2EXDA 1TT2A 4O42A 3K57A 1Y8PB 1HQMC 2YTVA 3JC66 5A2QE 4JV5L 3HOWB 2AUJD 4IUVA 3A5UA 4KKTA 2L9HA 1O7LA 4CJ2C 1C8CA 3H15A 1WTQA 2HT1A 4A75A 3HOWH 2MNAA 4KHVA 4LUVA 1LLRD 1LTBD 1VQAA 4JV5Q 1F2YA 1PYSB 2PQEA 1Q90A 4HEDA 5EQ0A 3OPOA 1S4ZA 2FJ2A 3NK9A 4DFAA 3FP9A 1TWHB 3NBIA 1SN8A 3DEOA 3J80i 3GTMB 4RWSC 4DF7A 4LF7Q 1TQOA 1SNCA 1QWYA 1MI2A 4DNTB 2RCNA 2HHHL 2LY7A 3K80C 4EVOA 1PH7A 2PMZB 3CC2A 1EL0A 1RJTA 5JOBA 1JE4A 1CTMA 1ESFA 4DV4L 3K7AB 1KIXA 5BN3A 1VQHA 2HHHQ 2PW7A 4LUZA 3W1GA 5JEAG 4X64Q 2DN8A 3K7AH 5E3FA 4DV4Q 2OEOA 3J7ZC 1LACA 5C3EG 3Q24A 5GADC 3NBHB 4IUUA 4JW0A 1TXYA 3HG9A 4QIWE 2F0SA 4HJ5A 1J9OA 2HCCA 3I90A 3HOZG 3QG1A 3ER0A 2HUGA 4WJ3M 3VR4A 2R7ZB 1RKNA 2EYLA 5I9OA 3STBD 1A15A 3RLFA 1YJWA 1RD9D 1PDQA 1FNWA 2J7ZA 1SSOA 5IYBG 5C44B 1LABA 1SYCA 5LMNL 4A3LG 1SE3A 4R8IA 4BY1B 3DM3A 2IHEA 2D0OA 2Y0SB 4IOCA 3PQIA 4ME3A 3ULJA 1ASYA 4UAIA 5LMNQ 4DV2L 4FF2A 4WJ4A 1P16A 1IXRA 4JI6L 3K58A 2LFNA 3TDQA 3J81j 2R6GA 4IJHA 2BA0A 4C3HH 4DV5L 2FMMA 4BBRH 4DV2Q 1Y1WH 2PCFB 4J15A 3K5NA 3PF5A 3KDFA 1HTPA 2LKVA 2Z4IA 3SE0A 3J7YW 3OIQA 3KLSX 3H09A 2C5CA 3GV3A 4KLKA 1B53A 2FMCA 4DV5Q 1WTRA 5K36H 2PZUA 1HJPA 1I6HB 2CHBD 3MXNB 5FJ8G 4DR5L 5EKIA 4CKEA 5JPNC 1HQRD 1SXTA 3BZKA 5KNBA 2K50A 4H7BA 4X66L 4GKKL 4R4IA 5EAYA 1X32A 2L11A 1I50H 1B44D 4MTNA 1J8IA 3D4DA 5M3FG 2E8GA 3VYRA 2E2JB 2ASBA 4NXNL 4GKKQ 4X66Q 1R9TB 1H9KA 1GXDC 2BDNA 3GTLB 1UE6A 1NTGA 2A69C 4RCNA 4R4CA 5IYDG 3BDCA 1JWMD 2GVAA 1R9TH 4A3EG 2PYKA 5CC4A 4Y7NB 4NXNQ 2K04A 5EBDA 3WOFA 3VR5A 2X6GA 3UE1A 1Q8KA 4K2KA 4C3JH 2IPKD 1XMQL 3P1HA 4IZ8A 4Y7NH 4DAYA 3NXWA 5CV5A 3QJYA 5C4XH 1F9PA 1TU2B 1AH9A 1XMQQ 1VQPA 2F0TA 3H3VI 4F7XA 2EJGC 2VUMB 1KNAA 1RCVD 2JA7B 1NR2A 4X62L 2F0DA 2ZTDA 3K5LA 4A3GG 5C5LA 5KRUA 1N8RC 2VY3A 1R4PB 2JYOA 1UEAB 3W2DA 1PH8A 3IRBA 3URYA 2JA7H 1ICFB 2E2HB 3HRZC 3V96A 1DZ1A 1ASZA 4X62Q 5E4WC 5COYA 3V2TA 2K7VA 1SEBD 2NVQB 1GHKA 1KAAA 5I2XA 5M9OA 3QO2A 4NDXA 3CCJA 5KGUA 3M4PA 3A8KE 3VR3A 1EIGA 2EQSA 1TWCB 1SFOB 5ELDA 3PSIA 1B1ZA 1PRTF 3NUCA 4C3IH 3H3VH 1QUQA 1VQGA 3FPUB 2F0MA 3A7LA 3K6OA 5C0XJ 4Z9CB 1LTLA 2PMZE 3SXHA 3I2ZA 4XXEA 1DOLA 2ALYB 3HKZB 3RN5A 2Z6KA 4EQPA 4A76A 5IT9c 3NTKA 1M4VA 3NP8A 3DM1A 4PMBA 1GKHA 1CQVA 3I4NG 4PZ7A 2WB1E 5I6WA 2QGQA 4RKBA 3PO2G 1EU3A 3RUZA 4LFAL 1IHZA 4DV6L 3S1NH 1NBWA 1SNOA 2NN6G 1BBUA 5IYCH 4YCWA 3I4MH 1JCKB 3MXPA 5K5PA 1WFQA 4R4OA 4LFAQ 1STBA 3A55A 4DV6Q 1SAPA 4DR2L 3OYYA 1X3PA 3J81i 2VZAA 5GQOA 3BVMA 5J39A 1DGSA 1LV9A 1STEA 2V1CC 2FXQA 1LM0A 1EQRA 1RTOA 3B6YA 1DXMA 1M8AA 1XTCD 2Y0SE 5M5WH 4BWGB 4DR2Q 1PHJA 1H9SB 5HGQA 3E9IA 3FDTA 4FDBA 2B29A 3GQBA 2L12A 2H1EA 2QA4A 1G91A 2R7DA 1CZGA 4K5VA 1KL9A 1SJHD 5M3MH 2VL6A 2PNRC 1YNND 1BCPC 1TWFH 4OX9L 1AW7A 4A3JG 2YU9H 2PW5A 3T56B 4CDCC 5JPMC 1EQQA 2Z6BA 3W3AA 3HOYB 2DJGC 1VQOA 4MTKA 4X3UA 1SE8A 1WTOA 3PO3G 2K52A 1UAPA 2NVTB 4LWCA 2PI2A 3LWUA 1KQSA 4QB4A 5EPJA 2IJ0A 1V9PA 3PIPA 1EEID 3NWTA 3MEHA 1MSHA 3Q8DA 2ZXRA 2F0QA 5C6AA 5L37A 1SMYC 1WTHA 3N52A 4HMIA 1E0BA 2DGYA 1ZYRC 2YV5A 2JA6G 1L1OB 1V1QA 1BR9A 4L8JA 2Z0SA 3SDZA 5FLMH 2E2IH 1V1PB 4P2CB 3Q22A 3CCLA 4JC0A 3U9OA 2KHJA 4LUOA 1LTAD 3D4RA 1YJNA 1B3AA 1G291 2NTSA 1I94L 4JBWA 2R3ZA 5KYIA 4OWXB 4G4KA 4JI0Q 4C1NK 3R93A 3KUPA 1VQNA 1TVXA 1PA6A 3KF8B 3A74A 3SR1A 4ME5A 1YZ6A 2D0PA 4DNRB 1I94Q 4K8IA 2R93G 4UPAA 2BH2A 4KD3A 3I91A 5DM73 1SROA 2BCOA 1ET9A 4IPCA 2ZJRA 3A5ZB 1EU4A 4A4IA 2ENBA 2LMCB 1EUJA 4AYBG 2B2TA 2ZTCA 4I7ZC 1XNRL 3S17H 4KTAA 3M7GA 2H4OA 3D31A 2Z6KC 1D7QA 4TSSA 2JA5H 4DXFA 2VW9A 1VF7A 3FKIB 1PFBA 1GUNA 1IL8A 2L55A 1PH5A 3RMHA 1D1KA 1LO5D 1X3QA 4PV1C 1STNA 1BO0A 3G7LA 1VQ8A 3DWPA 2SNSA 1DYQA 4A3KB 3BJUA 4GOPB 3S1MH 2B2YA 1VQ7A 1IBML 2IHFA 1IZ6A 3BS1A 1K9MC 2JQOA 2G5DA 2XRQD 2BA1A 4O1NA 2HQLA 4G57A 3NQTA 3KLRA 4HSPA 2K32A 1JE5A 1IBMQ 4TVAB 1ENAA 3MA2B 1NMFA 2A5HA 3HKZE 1FVIA 1HNXL 2KECA 1EWCA 4K8JA 5G3LF 3PUXA 2K05A 1WTWA 2RSNA 3OIPA 4JI2L 2N88A 4YHHL 3JAMi 4TRDA 1HNXQ 1TWAB 2RDFA 5C0XG 3L2PA 3M4OH 3RNUA 4JI2Q 3PCOB 2K28A 1ENCA 1SJED 1A0IA 4L6TB 3S15B 4BA1I 4YHHQ 4JPBW 1T9HA 1EIFA 1Q12A 1HNWL 1S5CD 3D8GA 3PIO3 5M5XB 2CW0D 1GHJA 1UE5A 4R1JA 5JEAH 4A3FB 1ZKOA 5T1GA 2K5WA 3TP5A 4XQNA 2KVMA 3EROA 1JMCA 4DR1L 1NSNS 5C3EH 1HNWQ 3K5MA 1WI5A 2TMPA 4KY5A 1SRUA 1PH6A 3TP6A 2DJFC 3LWEA 2VQEQ 3OMCA 2IX3A 3HOZH 1CZWA 5FO9B 4DR1Q 1DD2A 3S1RB 4QCLA 2A74C 3ND8A 2A68D 2RHQB 4A3DH 4UP9A 1C48A 2JA8B 4HIOA 5IYBH 4K5XA 3MAQA 4A3LH 4A3CG 3P7JA 5ELEA 3OTOL 3ULLA 3RZDH 1LTID 1PTOH 2VNUD 1STHA 2B2UA 1PZJD 4LF8L 1I4HA 2OTJA 3D4WA 1K3BC 3S24A 3TS2A 2UUAL 3L3OC 3OTOQ 2F1MA 2Q2UA 2CVRA 4PG3A 4ZUJA 3MWYW 4RHSA 2UUAQ 1TKWB 4IFDJ 2B2VA 5ELNA 3E0EA 4O0AA 4A3IB 4FYDA 1QNUA 3HOXB 1FGBD 2HDMA 3IKJA 4AIMA 1QVFA 1C9OA 4QL5A 4IOAA 1JOKA 4JOIA 4MHEA 5FJ8H 3FEWX 4A3IH 1PH4A 3NQIA 4RG1A 3Q23A 3GTKH 1D8LA 2B3GA 2SEBD 1UWVA 3I7FA 3EQLC 1YHQA 1HZ9A 3D0FA 1CHPD 4QMGA 3O13A 1BDOA 2F0FA 5M3FH 2HIVA 1MSGA 2EYOA 2O4XA 1VQEA 4X65L 1S5FD 1AP0A 4C1NI 3TRZA 4OWTB 4DN4M 5IODA 1L0YB 2B2YC 4BBSB 5IYDH 5KNDA 2OF1A 1RF2D 1M1KC 2B63G 1N33L 2UUBL 4FXGC 1Q8IA 1W3SA 1PTOC 2R92B 2BOSA 3GO5A 3G6JB 3U9SA 4OEMB 3CCMA 1MBYA 3U4ZA 1H9RA 4A3MB 5JJLA 2UUBQ 3H0GB 2M9VA 2PNHA 4XIGS 4QGUA 5C4HA 5IGGA 1Q82C 1PVOA 4NPSA 4A3MH 1SLJA 1W6JA 3I70A 2F0KA 3K0YA 3SK8A 1XMOL 2F3WA 4YIJA 2E74C 4FF3A 1QOHA 1TS5A 2K5HA 1BCPF 4ZKBB 2A6HD 5C3WA 1EWIA 4YWKA 1XMOQ 1E2WA 5BN5A 4L5QA 2MFIA 2NBFA 1WTXA 4BY7G 1BUVT 2L0CA 2CQAA 4RH6A 1CQFA 2MGSA 3W5OA 3CD6A 4OHJA 2IY5B 2F3VA 1QNKA 4K6DA 1Z6HA 1Q7YC 3PMFA 4HMJA 1PH3A 3AYHB 1NMGA 4XQJA 3BZDB 3HOUB 4MNOA 5IGCA 2GN5A 2QILA 2D9UA 1LTTD 4LMQD 1QJOA 4FNFA 1RIPA 3HOUH 1Y1VB 4KD4A 2HD3A 4YCVA 5EKLA 5BN4A 3A8IE 3KBGA 1XPUA 2I0QA 2XNAC 1C4QA 1Y1VH 2ZXPA 4HJ8A 1VQ5A 2CH4A 4A93G 4U673 1L0XB 2F0UA 1WCMB 3I4NH 4C2MH 2WB1B 3L7ZC 2SOBA 3PO2H 1KDCA 1VQJA 1WCMH 1EZ8A 4ZQ3A 2H5XA 2NN6H 1BBXC 3MXNA 3EA6A 1MD2D 4TQUS 2I5MX 4UY8C 5A2QL 3GTGH 3U50C 5IE8A 3I4OA 2B2VC 3TQYA 1QG7A 2DY7A 3MC0B 1EOVA 1TS2A 1SBBB 3NWSA 3AU7A 1U4RA 1G51A 3TS0A 3AFPA 1UNSA 4JI8L 2OT2A 3C46A 4RCOA 5C5MA 5JJKA 2XRSD 4N8FA 3T4AC 4LF4L 2E2DC 4C3HB 4BXXH 4KV6A 1LT5D 4BBRB 1Y1WB 3G48A 1YNJC 3M4QA 5C4ZA 3CRLC 4JI8Q 5DNFA 1EFWA 4LF4Q 3H6MA 4GLXA 4JI6Q 1FD7D 4A3JH 2K5VA 4IUQA 1NNXA 1Q1BA 4DA2A 2OQ0A 1L2FA 3KOJA 1P8LA 1HH2P 2NWGA 1BXTA 3DMUA 5IT9E 1NAPA 1S40A 1I50B 1U4LA 3H94A 4IN3A 3PO3H 1SYFA 5JAVA 3F2BA 4ZAIA 2ATWA 1EIHA 3KF6B 1STYA 4DR5Q 2EZVA 2NUCA 1Z9FA 4IFDG 1NE3A 2JA6H 2KHSA 1U4MA 3NHHA 3CCSA 5ELOA 1N34L 4KKUA 2A19A 1QCBD 3EIVA 4CHTB 1FL0A 3CU7A 4L5SA 2B2WA 3OWEB 4KK7A 4C3JB 3D3RA 2E75C 2ZM6L 1Y69U 4WJWA 4IURA 5C4XB 1CKMA 1IW7C 1N34Q 2EYPA 4YWLA 4I65A 1HTLD 5E4XA 4IQZA 3EJIA 3T53B 4DAVA 2ZM6Q 1IBKL 5EBCA 1JWSD 2BE5C 1K8OA 5M5YH 2R93H 1F9SA 2N78A 2K5DA 2KEEA 3A0JA 1EIYB 2F0OA 5TSSA 5T1IA 1WD1A 2RA4A 2RDHA 1IBKQ 5ISRA 4A3BB 1JORA 3K59A 3AB9A 1EYAA 1D6EC 4L63B 1LTGD 3MXUA 2QEXA 2AMCB 2KCMA 4A3BH 2EJFC 1X3FA 2IT1A 4EQNA 1SYDA 5EPKA 3CRKC 1U5KA 5IT9L 3RLNA 3IFTA 3DLLA 3CQZH 3TEHB 1WOCA 3KLWA 1U9RA 5D65A 1NY4A 2F0JA 2XGTA 1K28A 4C3IB 3J81c 4FF4A 4IO9A 1CFMA 1FNVA 1PYWD 3CF5A 3E0JA 3HP3A 4FP5D 4F88A 3HOWG 3L0OA 3PIOA 4GLVB 4FO2A 4ID6A 2E5LL 4RA8A 1O7ZA 1A62A 1MKHA 4QUFA 5F2DA 1GUSA 1BCPB 1H9SA 2A1AA 2I5LX 3FVQA 4EGVA 1EYGA 2J4XA 3R2IA 3SGIA 1EY8A 1SYGA 3RD4A 4G7OC 4YWMA 5ELFA 4JI7L 4R8NA 2E5LQ 3PUZA 5DEHA 2IX1A 5KYLA 3S1NB 4JI7Q 3NEMA 1A8VA 1WTVA 1X56A 2GA4B 2I07B 2Q8RE 5CYUA 2EE1A 2AQ3B 1YBYA 3I4MB 3FMCA 3MFYA 1RODA 1KABA 3A7AB 4RKLA 2I5HA 3T1HL 2F03A 2JEBI 3DWAA 4RMFA 3MEFA 1PTOF 2A6ED 1H9JA 1ILPA 4CKCA 3C2PA 4H13C 5M5WB 2F0WA 1ML0D 1F77A 3GP7A 3T1HQ 1A2TA 2Z1CA 2WB1G 3W1BA 2RCFA 1PRTD 2JA9A 3S14H 1L1OA 4CGYB 5FOBB 1EY0A 1KC8C 1SNQA 1EYCA 1V1PA 1K83H 4F8MA 2EYMA 3K8AA 1NR4A 3FPPA 5M3MB 3RZOH 4BS9A 2R7ZG 1TWFB 1AEXA 4CDDC 4GN4B 2YU9B 1EZ6A 1AE2A 5LL6X 3TMEA 5C44G 3E3XA 4A3CH 3EN2A 3K7UC 2B2WC 1SNPA 4BY1G 4DV3L 1QZGA 1JOQA 2Y0SG 2WAQB 2UUCL 3SHLA 2KHIA 3I72A 4OX9Q 2LXJA 4UHVA 2K01A 4LK1C 2ID0A 3S2DH 4DV3Q 2UXCL 4ALPA 1VQLA 3HZXA 5J3BA 3UI2A 1QVCA 2Q8TA 3CPWA 4X6AH 2E2IB 2ZT9C 3STBC 4ZRZA 1VF5C 4GN5A 4S3SA 2B8FA 2L5TA 1X3GA 4HJAA 1PMRA 2EOTA 1LTSD 1SYBA 1WJJA 1Q3LA 4GOPA 5CGKA 2VS1A 2HIXA 1HFGA 5IP9G 2MP1A 4XT1B 1L0WA 2F0VA 4WORA 3S16H 2KA7A 4JI1L 2RKSA 5E1FA 4V190 2ICEC 5AJ3L 1KAWA 5JJZA 1JB3A 1CKNB 1OXTA 2LSSA 3Q0AA 2B63H 1G2TA 3HOVB 1GUTA 2TSSA 3S17B 4JI1Q 3C1EA 1EY6A 4PQXA 4R9WA 5IGFA 3JAMc 3TZDA 1TWGB 1STAA 3K0XA 2JA5B 3HOVH 5AJ3Q 3OSOA 2Q2TA 1O80A 5IIFA 1IKLA 1S5ED 2KBNA 3TREA 3GTOH 3SVMA 2Q2HA 1TWGH 3CCVA 3I56A 3PF4A 4RGNA 2JK8A 3OMGA 1XNRQ 2PQAB 5I6YA 1TIID 1NJIC 2VUMG 2JA7G 1YI2A 3S1MB 3PUWA 3IAYA 4QF4A 3ICEA 1VQCA 4HN7A 1QVGA 4HJ9A 4DAPA 4IPGA 5GAHC 1O7YA 1U4PA 1JJCB 5CBEE 2LS01 3A56A 2K03A 1OXVA 5GAGC 3OWFA 4B08A 3EFXD 3R3OA 5IP7G 1Y8NB 4QJFA 3HEJA 1SE2A 1KDBA 4B9WA 1FJGL 2DUDA 4XYQA 5KEEA 4BY7H 2XWBB 2A73B 3TSSA 3OW2A 4LF5L 1A63A 4DUZL 4OELB 2JXMB 3F2DA 1XJVA 4XDXA 4CDEC 1X9NA 1ZEQX 1A6XA 1UE7A 1FJGQ 3M4OB 2E76C 1A3UA 3ND9A 4YY3L 1XPOA 1G6PA 1PRTB 4OIKA 4LF5Q 4FF1A 4DUZQ 5HURA 2AHOB 2JSOA 1I6VC 4EX5A 2Z4HA 3R8BA 1D2BA 2NTTA 3J80E 2FHTA 4PNYA 4Q0FA 3VYTA 3FRPB 4J6HA 4YY3Q 1S72A 4CDFC 1FR3A 5JEAJ 1E24A 3HKZG 2OQKA 4A93H 5GAEC 5C3EB 3SEBA 4DV0L 1GUWA 1OTCA 1QB5D 4JG2A 4LFBL 4DK0A 3MTSA 1VQFA 4XTCS 1VQKA 5CORA 3HOZB 4HAEA 2WKCA 4P72A 1HA6A 1VQIA 2IX0A 4KMUC 3CCUA 4DV0Q 5A35A 4EQOA 4LFBQ 4JYAL 1BOSA 4A3DB 2KJXA 1D5ZC 2C9OA 3CP0A 4RAUC 3MVVA 4R4QA 1H95A 5EPLA 3CCEA 1OXXK 4PMCA 1B9NA 4JYAQ 1C0AA 1XNQL 4GNXB 1EY4A 1I3QB 3RZDB 1YITA 4QQBX 2F0PA 5G3LD 1PTOB 3KK7A 4P74A 5I9PA 2NVXH 3T13A 1I3QH 3PUVA 3BZCA 3HS0C 4X3TA 2WAQE 3NELA 1SMXA 1XNQQ 2O5IC 2CQOA 3CPFA 4NXML 3G6EA 3G71A 1SE4A 1JQYD 1V8QA 1PFMA 3D6CA 3F2UA 3KJPA 2A69D 4LW1A 1ONLA 5AFWA 4IJLA 1W6KA 2EY2A 4LF8Q 1I4QA 2CWPA 4NXMQ 4DXGA 4GS3A 1X6OA 2J0TD 1V43A 1K8MA 1H9MA 1WD0A 2EY1A 3GD7A 1F2ZA 5C4JH 3L9AX 3J80L 2F0NA 4FXKC 1GO3E 2GVBA 3PGZA 5FKAC 3GTKB 1DJRD 2B2TC 3HOYG 4KY6A 1HRJA 3K81C 4DK1A 1K8AC 3I8ZA 2F4IA 3WDNA 4JI5L 1ICWA 3S2HH 2KUMA 1EY9A 4U68A 5M3FB 4BA2I 1N36L 4LF6L 1SR3A 1D1IA 3S1QH 2EY6A 3P75A 4IFDH 2Q8IB 1B9MA 2EDGA 4PZ8A 1M90C 1AN8A 1CK1A 4IUNA 2RSOA 1X54A 2VB2X 5JJIA 2WKDA 1N36Q 1JB7A 4LF6Q 4I7AA 3TN2A 1YNNC 4DGZA 1K3RA 2M00A 1W2BA 5FK9C 4DK6C 4A3EH 3QOJA 1OO9B 4PMWA 1LT6D 5CV8A 1QE6A 4X65Q 4ZK9B 4AH6A 5IWAL 2PZTA 2F0EA 1N33Q 3M3YH 2QF7A 3GTQH 4N9TA 4DR4L 2WIIB 4JI3L 4A3GB 4DAMA 2MHVA 3NPPA 4GZYC 5IWAQ 3M9BA 4KKSA 4A3GH 1CSPA 1J5EL 5J22A 2EYHA 2XSCA 4KJNA 4DR4Q 4JI3Q 1HZBA 2G9DA 2VXWA 1GUOA 1R4QB 1VQ9A 3NBHA 3IL8A 1J5EQ 2EXZA 3I4LA 3EBEA 1SDFA 1JOOA 1XYIA 1F2MA 2PPBC 3FKIG 3GTPH 4KHPL 1YNXA 2NYZD 1VQ4A 1XX8A 1UUPA 1HPCA 2NN6I 4F87A 1CSQA 1KDAA 4LJZC 3J7AF 1D5MC 3R2TA 5FLXc 1RL2A 3CXCA 2MO0A 4A3KG 3DHQA 1GVPA 2OCEA 4KHPQ 3FHWA 4FXDA 1WYDA 1JICA 3C1FA 4LF7L 2IL8A 2O5JC 1AZQA 3GTJB 3BU2A 3AEVA 1JR0D 1CT1D 3CW2C 3I73A 2X69A 1B7YB 5DAUA 3I4NB 4C2MB 1EQTA 3GTJH 1ILQA 4ABNA 1IKMA 4HIKA 2NZHA 1CA5A 1G6ZA 3PO2B 1CM9A 1GOZA 1TWHH 3S9WA 2B2UC 3GTMH 4CJ0B 4JI4L 2V4DA 2QEJC 4NKLA 4DNIA 2N49A 2ZXOA 3ERSX 4X64L 3Q6SA 4Q5VA 1BCPD 3LGJA 1BBWA 3CAMA 2D62A 3GTGB 4KN7C 4JI4Q 5BR8L 2MJ8A 2MPMA 2OXPA 2AWNA 4N8X1 1PFNA 1A3VA 3KF6A 2EPBA 2EYJA 4J1MA 1PH9A 1CKOA 2QW7A 4A3FG 4POFA 5BR8Q 4JOIC 2XVSA 1XXGA 1ZXTA 3CC7A 2KQ3A 1SMYD 1HCZA 3AQQA 1B3QA 2YTXA 1ZYRD 3J81E 4A3DG 1E22A 3HFZB 4DR7L 2R7ZH 2OTLA 2EIFA 5J1ZA 4A3JB 1RTNA 1OXUA 2JA8G 4Y52H 2L4NA 5C44H 1HNZL 1DM0B 3QR8A 2R61A 4BY1H 4DR7Q 5CV9A 2CW0C 1GUGA 2QDLA 4NMZA 4ODGA 3U4VA 3PO3B 1HR0W 1DCZA 1LYLA 2DY8A 1HNZQ 3F2CA 1IYJB 3VYUA 1TS3A 1TR5A 5HGTA 4P73A 5CV4A 3BVZA 2XN9C 4RFBA 2JA6B 1A2UA 3SK6A 4G7ZC 4HR7B 4K5WA 1V1OA 4H0LC 1JWUD 2A68C 1STGA 2AUKA 1KNEA 4A3IG 2VB3X 3HOXG 2F4VL 1N32L 1HXYD 1I6HH 1AFPA 1ESRA 1E7ZA 1PXUA 2NZ1D 2N8NA 4UP8A 1AE3A 3OHXC 3VR6A 1HFNA 1XPRA 2F4VQ 1TS4A 1N32Q 4DUYL 5M5YB 1WVLA 4O2DA 2R93B 4DR6L 1JT8A 1KXLA 5IP9H 2M2LA 2LXKA 1PFSA 2E2JH 1HHVA 1EYDA 3J81L 4DR3L 4OO1G 4DUYQ 1KLGD 3A54A 3UE0A 4DR6Q 3GTLH 2UU9L 4AYBB 4ILWA 1CHQD 2EYFA 4BBSG 4IPHA 1VQMA 1B8AA 4K6LA 2F0GA 1DONA 1BQQT 2ICIA 1B2TA 5C3XA 3TBIB 4DR3Q 2R92G 3BDOA 3F1ZA 1YHBA 3G4SA 1EY7A 1C7YA 2XTIA 3KDFB 1F9RA 4JBJA 1PYBA 1BF4A 2UU9Q 4JCVE 3VYSA 3CQZB 2F52A 4A3MG 4HTHA 4B9XA 5LMUL 1TY2A 1RHPA 4HIMA 2QKIC 3H0GG 4NB3A 3ZYYX 4HIDA 4MIUA 3RR5A 3IFDA 3D6WA 1G8ZD 1MJCA 5GROA 2VUMH 5C0XI 1VMCA 4ZKCB 1VDZA 1YHAA 5LMUQ 3H91A 4NP5A 2F0HA 3C3LA 3NSWA 3CMAA 3LX0A 2E2HH 3GV6A 1HUMA 4QY7A 1YVCA 1D5XC 3N6RA 4CBVA 1PZID 3DXJC 1EEFD 4M8AA 1I4GA 5HY6A 2D2CC 4ZUIA 4L5RC 4OWWB 2NVQH 5IP7H 4K14A 2WV6D 2DNCA 1FYCA 2QCPX 3BYTB 3QIAA 5E7NA 3M7NA 1EY5A 2C35B 3BVGA 2F0LA 1GJXA 1IYUA 1TWCH 1SFOH 4DAYB 1PV4A 3LNNA 2JN4A 2RF4A 2QDBA 2B8GA 4MZ9A 1EWHA 2FFKB 1I4XA 3DWQA 4XT3B 2PO4A 3HOUG 5FO8B 2MQHA 5C0XH 3NE5B 2YTYA 1N9WA 1A3TA 4OXPA 4APVA 1Y1VG 1HUNA 3M4YA 3DUZA 2A6HC 3MFGA 1E1TA 3E6ZX 4B3SL 3JAME 1MJEA 3F8TA 3S14B 4P71A 1HZCA 1K73C 2P5ZX 4C56C 3U58A 4KHZA 1WCMG 1E2ZA 2KCTA 1FNUA 1VS0A 4ZYSA 3QOLA 1K83B 1T5XD 2SDFA 3CKIB 4LFCL 4B3SQ 1BVSA 2F3IA 2K33A 5LMNW 3TZUA 3RZOB 1K0RA 2HQEA 4GN3B 4G7HC 1I4RA 2AKWB 1VQDA 2IWHA 2A8VA 4LFCQ 4IUPA 3KJOA 1KD1C 3VA7A 2JEAI 3X3MA 2JE6I 4RHRA 3VR2A 2KENA 2K5NA 2CKZB 4CKBA 4KI0A 1OXSC 2AQ2B 3KF8A 1QUQB 1YJ9A 1JC7A 1II3A 1F9QA 2B39A 3H3VC 4MN3A 1Y8OB 2ZJQA 3UDGA 3S2DB 3ONAB 3T1YL 2Z9HA 4ZLTF 4BXXG 4DV7L 1VMPA 3T16A 1CKNA 4OONA 3CCRA 3EVQA 2EJMA 3I3CA 3V05A 2K1BA 4C3HG 3CC4A 4BBRG 5KNCA 2N55A 3QB3A 1Y1WG 4JK1C 2UUCQ 5EJWA 3T1YQ 3KFUA 4NW2A 4DV7Q 1PTOD 4KN4C 2X6LA
chains in the Genus database with same CATH topology
5K36G 2KEDA 3K5OA 4OIJA 1E2VA 3JAML 5IGEA 3BG3A 2RQXA 3M85A 3PUYA 2KCNA 3ITPA 3S16B 1IYVA 2NVYB 3TP8A 3SK4A 2EY5A 3PV0A 4WFN3 3SK5A 2B63B 3P20A 4ULLA 1B50A 5JVG3 2RDGA 5FO7B 4C3JG 4E6IA 4X3SA 3BDLA 3GTOB 5ELCA 4OL7A 2XWJB 1CI3M 3HGBA 2RVLA 5D3IB 2KOLA 2RBMA 3T51B 5EGTA 3VA5A 1VCIA 1XWEA 2O2LD 3MZ5A 3DEPA 4LAAA 1SNMA 1ET6A 3J7AV 4CJ1B 2WINB 4BY7B 4J8QA 2Z8LA 1PZKD 4N9PA 1AZPA 1EFID 5D14A 4KY7A 2KCCA 1WTPA 4C3IG 1PLFA 1Q1EA 4K2LA 2JP1A 5ELBA 2L1BA 5NUCA 3KLSA 2K6AA 4A93B 4HCEA 5LL6S 4OGQC 3X3NA 5DM63 4X3KA 1SYEA 5JVH3 3QWNA 1HA5A 1YNJD 2WP8J 3MHBA 5IGDA 1S5BD 2G9HD 5CR3A 5I2YA 1T5EA 1F2LA 1ENFA 5D3DA 1NUCA 4TKOB 1SNDA 2NVXB 1EOTA 4RGTA 3OW7A 1G2SA 5CV6A 4QIWB 4QUCA 1RDPD 1B4OA 1O78A 2YYZA 1MGSA 3BYYB 3WOEA 5KIXA 4RGOS 5EKKA 1I4PA 1LT3D 4DU9A 4IFDI 5IGBA 1LT4D 3OOCA 3NTIA 4WRDA 3CHBD 5FLXE 5LHY1 4HSVA 3ERQA 5C4JB 4XYOA 1IW7D 4HCSA 1S5DD 2A6EC 1NCVA 4KJOA 3S2HB 2F0IA 2BE5D 1TY0A 4XQQA 1EQVA 4RGMA 2FINB 3S1QB 1PRTC 2K5QA 5IOCA 2NB0A 4OO1I 3A8JE 1KLUD 4H44C 2XIWA 4V0BA 3NTHA 2AQ1B 4IUTA 2D5DA 4IALA 4A3EB 4M1UB 3AMUA 1DOKA 3TP7A 2I46A 5CBAE 1Z47A 1CA6A 3M3YB 4FVMA 3GTQB 1QILA 2SNMA 2PZWA 3KBXA 2AWOA 1KTKA 3PIP3 1LTRD 2BDOA 1DOMA 2IW3A 5CMDA 5CV7A 4OO1H 3MXGA 2EVBA 3E5SA 2DNEA 1Z7TA 2HCIA 5FLXL 2MUYA 2WACA 2HDLA 4UDUC 5I4DA 3GTPB 1BNZA 1TT2A 4O42A 3K57A 1Y8PB 1HQMC 5A2QE 3HOWB 2AUJD 4IUVA 4KKTA 2L9HA 1O7LA 4CJ2C 1C8CA 1WTQA 4KHVA 1LLRD 1LTBD 1F2YA 2PQEA 1Q90A 4HEDA 5EQ0A 3OPOA 1S4ZA 2FJ2A 3NK9A 4DFAA 1TWHB 3NBIA 3DEOA 3GTMB 4RWSC 4DF7A 1TQOA 1SNCA 1QWYA 1MI2A 4DNTB 2LY7A 4EVOA 2PMZB 1EL0A 1RJTA 5JOBA 1JE4A 1CTMA 1ESFA 3K7AB 5BN3A 2PW7A 5JEAG 2DN8A 5E3FA 2OEOA 1LACA 3Q24A 4IUUA 3HG9A 2F0SA 1J9OA 2HCCA 3I90A 3QG1A 2HUGA 3VR4A 2R7ZB 1RKNA 2EYLA 5I9OA 1A15A 3RLFA 1RD9D 1PDQA 1FNWA 2J7ZA 1SSOA 5C44B 1LABA 1SYCA 1SE3A 4R8IA 4BY1B 2Y0SB 4UAIA 4FF2A 3K58A 2LFNA 3TDQA 2R6GA 2BA0A 2FMMA 2PCFB 3K5NA 1HTPA 2LKVA 2Z4IA 3SE0A 3J7YW 3OIQA 3KLSX 3H09A 2C5CA 3GV3A 1B53A 2FMCA 1WTRA 5K36H 2PZUA 1I6HB 2CHBD 5EKIA 4CKEA 5JPNC 1HQRD 1SXTA 5KNBA 4H7BA 1X32A 2L11A 1B44D 1J8IA 3D4DA 3VYRA 2E2JB 1R9TB 1H9KA 1GXDC 2BDNA 3GTLB 2A69C 4RCNA 3BDCA 1JWMD 2PYKA 5CC4A 4Y7NB 2K04A 5EBDA 3WOFA 3VR5A 2X6GA 4K2KA 2IPKD 3P1HA 4IZ8A 4DAYA 3NXWA 5CV5A 3QJYA 1F9PA 1TU2B 2F0TA 4F7XA 2EJGC 2VUMB 1KNAA 1RCVD 2JA7B 1NR2A 2F0DA 3K5LA 5C5LA 5KRUA 1R4PB 2JYOA 1UEAB 3W2DA 3URYA 2E2HB 3HRZC 3V96A 1DZ1A 5E4WC 5COYA 3V2TA 2K7VA 1SEBD 2NVQB 1GHKA 1KAAA 5I2XA 5M9OA 3QO2A 4NDXA 5KGUA 3A8KE 3VR3A 1EIGA 1TWCB 1SFOB 5ELDA 1B1ZA 1PRTF 3NUCA 3FPUB 2F0MA 3A7LA 3K6OA 5C0XJ 4Z9CB 3SXHA 4XXEA 1DOLA 3HKZB 4EQPA 3NTKA 1M4VA 3NP8A 3DM1A 4PMBA 1CQVA 5I6WA 4RKBA 1EU3A 3RUZA 1IHZA 1SNOA 2NN6G 1JCKB 3MXPA 5K5PA 1STBA 3A55A 1SAPA 1X3PA 3BVMA 5J39A 1LV9A 1STEA 1RTOA 1DXMA 1M8AA 1XTCD 4BWGB 1H9SB 3FDTA 3GQBA 2L12A 2H1EA 1G91A 1CZGA 4K5VA 1SJHD 2PNRC 1YNND 1BCPC 1AW7A 2PW5A 3T56B 5JPMC 3W3AA 3HOYB 4X3UA 1WTOA 1UAPA 2NVTB 3LWUA 4QB4A 5EPJA 2IJ0A 1EEID 3NWTA 3MEHA 1MSHA 2ZXRA 2F0QA 5C6AA 1SMYC 3N52A 4HMIA 1E0BA 1ZYRC 1BR9A 4L8JA 3SDZA 1V1PB 4P2CB 3Q22A 3U9OA 1LTAD 3D4RA 1B3AA 1G291 2NTSA 4JBWA 2R3ZA 5KYIA 4G4KA 4C1NK 3R93A 3KUPA 1TVXA 3SR1A 4ME5A 4DNRB 4K8IA 4KD3A 3I91A 5DM73 2BCOA 1ET9A 1EU4A 2ENBA 2LMCB 2B2TA 4I7ZC 4KTAA 3M7GA 2H4OA 3D31A 4TSSA 4DXFA 1VF7A 3FKIB 1PFBA 1GUNA 1IL8A 2L55A 3RMHA 1D1KA 1LO5D 1X3QA 4PV1C 1STNA 1BO0A 3G7LA 3DWPA 2SNSA 1DYQA 4A3KB 2B2YA 3BS1A 2XRQD 2BA1A 4O1NA 4G57A 3NQTA 3KLRA 4HSPA 2K32A 1ENAA 3MA2B 2A5HA 2KECA 1EWCA 4K8JA 5G3LF 3PUXA 2K05A 1WTWA 2RSNA 3OIPA 2N88A 4TRDA 1TWAB 2RDFA 5C0XG 2K28A 1ENCA 1SJED 4L6TB 3S15B 4BA1I 1Q12A 1S5CD 3D8GA 3PIO3 5M5XB 2CW0D 1GHJA 5JEAH 4A3FB 1ZKOA 5T1GA 2K5WA 3TP5A 4XQNA 2KVMA 3EROA 1NSNS 3K5MA 2TMPA 4KY5A 3TP6A 3LWEA 3OMCA 2IX3A 1CZWA 5FO9B 1DD2A 3S1RB 4QCLA 2A74C 3ND8A 2A68D 1C48A 2JA8B 4K5XA 3MAQA 3P7JA 5ELEA 1LTID 1PTOH 2VNUD 1STHA 2B2UA 1PZJD 1I4HA 3D4WA 3L3OC 2F1MA 2CVRA 4ZUJA 3MWYW 4RHSA 1TKWB 4IFDJ 2B2VA 4A3IB 4FYDA 1QNUA 3HOXB 1FGBD 2HDMA 3IKJA 1JOKA 4MHEA 3FEWX 3NQIA 3Q23A 2SEBD 3EQLC 1CHPD 4QMGA 3O13A 1BDOA 2F0FA 1MSGA 2EYOA 2O4XA 1S5FD 1AP0A 4C1NI 4DN4M 5IODA 1L0YB 2B2YC 4BBSB 5KNDA 2OF1A 1RF2D 4FXGC 1Q8IA 1PTOC 2R92B 2BOSA 3GO5A 3G6JB 3U9SA 1MBYA 1H9RA 4A3MB 3H0GB 2M9VA 4XIGS 5C4HA 5IGGA 1W6JA 3I70A 2F0KA 3K0YA 3SK8A 2F3WA 4YIJA 2E74C 4FF3A 1QOHA 1TS5A 1BCPF 4ZKBB 2A6HD 5C3WA 1E2WA 5BN5A 2NBFA 1WTXA 1BUVT 2L0CA 2CQAA 4RH6A 1CQFA 2MGSA 4OHJA 2F3VA 1QNKA 4K6DA 1Z6HA 3PMFA 4HMJA 4XQJA 3BZDB 3HOUB 5IGCA 2QILA 2D9UA 1LTTD 4LMQD 1QJOA 4FNFA 1Y1VB 4KD4A 5EKLA 5BN4A 3A8IE 3KBGA 2XNAC 1C4QA 2ZXPA 4U673 1L0XB 2F0UA 1WCMB 2WB1B 3L7ZC 2SOBA 1KDCA 1EZ8A 4ZQ3A 2NN6H 1BBXC 3MXNA 3EA6A 1MD2D 4TQUS 5A2QL 2B2VC 1QG7A 2DY7A 3MC0B 1TS2A 1SBBB 3NWSA 3AU7A 1U4RA 1UNSA 3C46A 2OT2A 4RCOA 5C5MA 2XRSD 3T4AC 2E2DC 4C3HB 4KV6A 1LT5D 4BBRB 1Y1WB 1YNJC 5C4ZA 3CRLC 5DNFA 3H6MA 1FD7D 4IUQA 1Q1BA 4DA2A 2NWGA 1BXTA 3DMUA 5IT9E 1NAPA 1I50B 1U4LA 3H94A 4IN3A 1SYFA 5JAVA 4ZAIA 1EIHA 1STYA 2EZVA 2NUCA 4IFDG 2KHSA 1U4MA 3NHHA 4KKUA 1QCBD 4CHTB 3CU7A 2B2WA 3OWEB 4KK7A 4C3JB 3D3RA 2E75C 1Y69U 4WJWA 4IURA 5C4XB 1IW7C 2EYPA 4I65A 1HTLD 5E4XA 4IQZA 3EJIA 3T53B 4DAVA 5EBCA 1JWSD 2BE5C 1K8OA 1F9SA 2K5DA 2KEEA 2F0OA 5TSSA 5T1IA 1WD1A 2RA4A 2RDHA 5ISRA 4A3BB 1JORA 3K59A 3AB9A 1EYAA 1D6EC 4L63B 1LTGD 3MXUA 2EJFC 2IT1A 4EQNA 1SYDA 5EPKA 3CRKC 5IT9L 3IFTA 1U9RA 5D65A 2F0JA 4C3IB 4FF4A 1CFMA 1FNVA 1PYWD 3E0JA 3HP3A 4FP5D 4F88A 4FO2A 4ID6A 4RA8A 1O7ZA 4QUFA 5F2DA 1GUSA 1BCPB 1H9SA 3FVQA 4EGVA 2J4XA 3R2IA 1EY8A 1SYGA 3RD4A 4G7OC 5ELFA 4R8NA 3PUZA 5DEHA 2IX1A 5KYLA 3S1NB 1WTVA 2GA4B 2I07B 2Q8RE 5CYUA 2EE1A 2AQ3B 3I4MB 3FMCA 3MFYA 1RODA 1KABA 3A7AB 4RKLA 2F03A 2JEBI 3DWAA 1PTOF 2A6ED 1H9JA 1ILPA 4CKCA 3C2PA 4H13C 5M5WB 2F0WA 1ML0D 1F77A 3GP7A 1A2TA 2Z1CA 1PRTD 4CGYB 5FOBB 1EY0A 1SNQA 1EYCA 1V1PA 4F8MA 2EYMA 1NR4A 3FPPA 5M3MB 4BS9A 1TWFB 1AEXA 2YU9B 1EZ6A 5LL6X 3TMEA 2B2WC 1SNPA 1JOQA 2WAQB 3SHLA 3I72A 2K01A 4LK1C 2ID0A 3HZXA 3UI2A 2Q8TA 2E2IB 2ZT9C 4ZRZA 1VF5C 4S3SA 2B8FA 2L5TA 1PMRA 2EOTA 1LTSD 1SYBA 1Q3LA 5CGKA 1HFGA 2MP1A 4XT1B 2F0VA 4WORA 2KA7A 2RKSA 5E1FA 4V190 2ICEC 5JJZA 1JB3A 1OXTA 3Q0AA 1G2TA 3HOVB 1GUTA 2TSSA 3S17B 3C1EA 1EY6A 5IGFA 4R9WA 4PQXA 3TZDA 1TWGB 1STAA 2JA5B 3OSOA 1O80A 5IIFA 1IKLA 1S5ED 3SVMA 4RGNA 3OMGA 5I6YA 1TIID 3S1MB 3PUWA 3IAYA 4QF4A 4HN7A 4DAPA 1O7YA 1U4PA 5CBEE 2LS01 3A56A 2K03A 1OXVA 3OWFA 4B08A 3EFXD 3R3OA 1Y8NB 4B9WA 3HEJA 1SE2A 1KDBA 4XYQA 5KEEA 2XWBB 2A73B 3TSSA 2JXMB 4XDXA 1ZEQX 1A6XA 3M4OB 2E76C 1A3UA 3ND9A 1PRTB 4OIKA 4FF1A 5HURA 2JSOA 1I6VC 2Z4HA 3R8BA 1D2BA 2NTTA 3J80E 2FHTA 4PNYA 3VYTA 4Q0FA 3FRPB 4J6HA 1FR3A 5JEAJ 5C3EB 3SEBA 1GUWA 1QB5D 4DK0A 3MTSA 4XTCS 5CORA 3HOZB 4HAEA 2WKCA 1HA6A 2IX0A 4KMUC 5A35A 4EQOA 1BOSA 4A3DB 2KJXA 1D5ZC 2C9OA 4RAUC 3MVVA 5EPLA 1OXXK 4PMCA 1B9NA 1EY4A 1I3QB 3RZDB 2F0PA 5G3LD 1PTOB 3KK7A 5I9PA 3T13A 3PUVA 3HS0C 4X3TA 2O5IC 1SE4A 1JQYD 1V8QA 1PFMA 3D6CA 3F2UA 2A69D 1ONLA 5AFWA 1W6KA 2EY2A 1I4QA 4DXGA 2J0TD 1V43A 1K8MA 1H9MA 1WD0A 2EY1A 3GD7A 1F2ZA 3L9AX 3J80L 2F0NA 4FXKC 5FKAC 3GTKB 1DJRD 2B2TC 4KY6A 1HRJA 4DK1A 3I8ZA 2F4IA 3WDNA 1ICWA 2KUMA 1EY9A 4U68A 5M3FB 4BA2I 1D1IA 2EY6A 3P75A 4IFDH 2Q8IB 1B9MA 2EDGA 1AN8A 1CK1A 4IUNA 2RSOA 2VB2X 2WKDA 3TN2A 1YNNC 4DGZA 2M00A 5FK9C 3QOJA 1OO9B 4PMWA 1LT6D 5CV8A 1QE6A 4ZK9B 2PZTA 2F0EA 2QF7A 4N9TA 2WIIB 4A3GB 2MHVA 3NPPA 4GZYC 4KKSA 5J22A 2EYHA 2XSCA 4KJNA 2G9DA 2VXWA 1GUOA 1R4QB 3NBHA 3IL8A 2EXZA 3I4LA 1SDFA 1JOOA 1XYIA 1F2MA 2PPBC 2NYZD 1XX8A 1UUPA 1HPCA 2NN6I 4F87A 1KDAA 4LJZC 3J7AF 1D5MC 3R2TA 3DHQA 4FXDA 1JICA 3C1FA 2IL8A 2O5JC 1AZQA 3GTJB 1JR0D 1CT1D 3I73A 2X69A 5DAUA 3I4NB 4C2MB 1EQTA 1ILQA 4ABNA 1IKMA 1CA5A 1G6ZA 3PO2B 1CM9A 1GOZA 3S9WA 2B2UC 4CJ0B 2V4DA 2QEJC 4NKLA 2ZXOA 4Q5VA 3Q6SA 1BCPD 2D62A 3GTGB 4KN7C 2MJ8A 2MPMA 2OXPA 2AWNA 1PFNA 1A3VA 2EPBA 2EYJA 4J1MA 2XVSA 1XXGA 1ZXTA 2KQ3A 1SMYD 1HCZA 1ZYRD 3J81E 5J1ZA 4A3JB 1RTNA 1OXUA 2L4NA 1DM0B 2R61A 5CV9A 2CW0C 1GUGA 4NMZA 4ODGA 3PO3B 1DCZA 2DY8A 3VYUA 1TS3A 1TR5A 5HGTA 5CV4A 3BVZA 2XN9C 4RFBA 2JA6B 1A2UA 3SK6A 4G7ZC 4HR7B 4K5WA 1V1OA 4H0LC 1JWUD 2A68C 1STGA 2AUKA 1KNEA 2VB3X 1HXYD 1AFPA 1ESRA 1PXUA 2NZ1D 3VR6A 3OHXC 1HFNA 1TS4A 5M5YB 1WVLA 2R93B 2M2LA 1HHVA 1EYDA 3J81L 4OO1G 1KLGD 3A54A 4AYBB 4ILWA 1CHQD 2EYFA 4K6LA 2F0GA 1DONA 1BQQT 2ICIA 1B2TA 5C3XA 3TBIB 3BDOA 1EY7A 1F9RA 1BF4A 3VYSA 3CQZB 4HTHA 4B9XA 1TY2A 1RHPA 2QKIC 3ZYYX 4MIUA 3IFDA 3D6WA 1G8ZD 5C0XI 1VMCA 4ZKCB 1VDZA 3H91A 4NP5A 2F0HA 3C3LA 3NSWA 3LX0A 3GV6A 1HUMA 1D5XC 3N6RA 4CBVA 1PZID 3DXJC 1EEFD 4M8AA 1I4GA 2D2CC 4ZUIA 4K14A 2WV6D 2DNCA 1FYCA 2QCPX 3BYTB 3QIAA 3M7NA 1EY5A 3BVGA 2F0LA 1GJXA 1IYUA 3LNNA 2QDBA 2B8GA 1EWHA 2FFKB 1I4XA 3DWQA 4XT3B 2PO4A 5FO8B 5C0XH 3NE5B 1A3TA 1HUNA 3M4YA 3DUZA 2A6HC 3MFGA 3E6ZX 3JAME 3S14B 4C56C 4KHZA 1E2ZA 1FNUA 4ZYSA 3QOLA 1K83B 1T5XD 2SDFA 3CKIB 2K33A 3TZUA 3RZOB 2HQEA 4G7HC 1I4RA 2IWHA 4IUPA 3VA7A 2JEAI 3X3MA 2JE6I 4RHRA 3VR2A 4CKBA 4KI0A 1OXSC 2AQ2B 3KF8A 1JC7A 1II3A 1F9QA 2B39A 3H3VC 4MN3A 1Y8OB 3S2DB 3ONAB 4ZLTF 1VMPA 3T16A 3EVQA 2EJMA 3I3CA 3V05A 2K1BA 4C3HG 5KNCA 2N55A 3QB3A 4JK1C 5EJWA 4NW2A 1PTOD 4KN4C 2X6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KA7 A;  5K36 G;  3QJY A;  1GUN A;  1OXU A;  2F1M A;  3N6R A;  1Z6H A;  1LAC A;  1TU2 B;  4PV1 C;  4IFD G;  3FMC A;  1H9S B;  3DXJ C;  3MFY A;  4OGQ C;  2D2C C;  3GQB A;  1E2V A;  1OXT A;  1GUO A;  3A7A B;  1OXX K;  4KKU A;  2EJG C;  1B9N A;  1GUT A;  1GUG A;  2CW0 C;  1QJO A;  2JEB I;  1TKW B;  2DNC A;  1FYC A;  3BG3 A;  3I4L A;  3QG1 A;  3QIA A;  1DCZ A;  2A6E D;  3M85 A;  3PUY A;  1H9J A;  2E75 C;  3VR4 A;  1Y69 U;  3M7N A;  2AWO A;  1IYV A;  2PNR C;  5BN4 A;  3A8I E;  3IKJ A;  1GJX A;  4H13 C;  1IW7 C;  2BA1 A;  2BDO A;  3PUV A;  3RLF A;  1IYU A;  2PPB C;  4OO1 H;  1T5E A;  3LNN A;  3T56 B;  2O5I C;  4IQZ A;  1LAB A;  2B8G A;  3PV0 A;  3KLR A;  2K7V A;  2K32 A;  3W3A A;  3T53 B;  2EVB A;  1EWH A;  2DNE A;  1HPC A;  2NN6 I;  1Z7T A;  4G7Z C;  1V8Q A;  3P20 A;  4HR7 B;  4TKO B;  3L7Z C;  3EQL C;  3NE5 B;  2BE5 C;  4LJZ C;  5C0X H;  2A69 D;  1GHK A;  1ONL A;  1K8O A;  3A8K E;  3PUW A;  4H0L C;  3PUX A;  3VR3 A;  2A68 C;  1BDO A;  2AUK A;  3FPP A;  3M4Y A;  3LWU A;  2A6H C;  2NN6 H;  3OW7 A;  1V43 A;  2O5J C;  1K8M A;  1H9M A;  4TQU S;  3GD7 A;  2R6G A;  3AB9 A;  5C0X G;  1SMY C;  2BA0 A;  3I73 A;  1OXV A;  1O78 A;  2YYZ A;  1ZYR C;  3MXU A;  4KHZ A;  5KND A;  1Y8P B;  3VR6 A;  1E2Z A;  1HQM C;  2EJF C;  1CI3 M;  2PCF B;  3HGB A;  4DK1 A;  4L8J A;  3SDZ A;  4BA1 I;  3A7L A;  1Q12 A;  1Y8N B;  2DN8 A;  2IT1 A;  3WDN A;  2AUJ D;  1HTP A;  3SE0 A;  3U9S A;  1GHJ A;  2K33 A;  3I72 A;  3OOC A;  3TZU A;  4BA2 I;  5JEA H;  3CRK C;  4KKT A;  2V4D A;  1O7L A;  1ZKO A;  3D4R A;  4G7H C;  5K36 H;  1G29 1;  3T51 B;  4LK1 C;  3IFT A;  1H9R A;  2JXM B;  4OO1 G;  4JBW A;  1A6X A;  4IFD H;  1VCI A;  2Q8I B;  1B9M A;  1IW7 D;  2EDG A;  2D62 A;  4XIG S;  3VA7 A;  1Q90 A;  2E76 C;  1CFM A;  3ND9 A;  2JEA I;  3OPO A;  4KN7 C;  2JE6 I;  5KNB A;  3VR2 A;  2A6E C;  1YNJ C;  4KI0 A;  1OXS C;  4DNR B;  1I6V C;  2ZT9 C;  3CRL C;  1YNN C;  3BDO A;  2BE5 D;  1DD2 A;  1VF5 C;  1Y8O B;  2E74 C;  2B8F A;  2L5T A;  2NN6 G;  2A68 D;  1FR3 A;  3ND8 A;  4DNT B;  1GUS A;  1H9S A;  2A6H D;  1H9K A;  1Q1B A;  2KCC A;  3A8J E;  2LMC B;  1PMR A;  2EJM A;  4G7O C;  2A69 C;  4RCN A;  4DK0 A;  2QF7 A;  1Q1E A;  1HCZ A;  4H44 C;  1CTM A;  5KNC A;  1E2W A;  4XTC S;  4I7Z C;  5BN5 A;  4JK1 C;  3H94 A;  3PUZ A;  5BN3 A;  1VDZ A;  4GZY C;  2D5D A;  3D31 A;  3VR5 A;  4KMU C;  5JEA G;  4KKS A;  1DXM A;  5A35 A;  4KN4 C;  1VF7 A; 
#chains in the Genus database with same CATH topology
 5K36 G;  2UXC Q;  2KED A;  4PZ6 A;  3K5O A;  2VQF L;  2PQA A;  4OIJ A;  1E2V A;  3HOY H;  3JAM L;  5IGE A;  2RHS B;  3RN2 A;  3BG3 A;  2RQX A;  1HZA A;  3M85 A;  3PUY A;  2KCN A;  2NVT H;  3ITP A;  2NZO A;  3S16 B;  3UDX A;  1IYV A;  2VQF Q;  4LNQ A;  2NVY B;  4GKJ L;  3TP8 A;  3SK4 A;  1O7I A;  2EY5 A;  3PV0 A;  4WFN 3;  2NVY H;  4JI0 L;  3SK5 A;  4R4T A;  2B63 B;  3P20 A;  4K0K L;  4ZCK A;  4ULL A;  3ULP A;  1B50 A;  4GKJ Q;  1FGU A;  2JJQ A;  2RDG A;  4AYB E;  5JVG 3;  5FO7 B;  4JVZ A;  4C3J G;  4E6I A;  1VQ6 A;  4X3S A;  3BDL A;  5C4X G;  3GTO B;  4K0K Q;  5ELC A;  1GD7 A;  4OL7 A;  2CCZ A;  2XWJ B;  2N3S A;  4P75 A;  1KRT A;  2MO1 A;  1CI3 M;  3HGB A;  2BH8 A;  4GLA C;  1XTD A;  2RVL A;  5D3I B;  2KOL A;  2RBM A;  3T51 B;  4UP7 A;  1GM5 A;  5EGT A;  4A3B G;  3VA5 A;  1VCI A;  1XWE A;  2O2L D;  3MZ5 A;  3DEP A;  4LAA A;  5DLQ E;  1S3O A;  1SNM A;  1ET6 A;  3J7A V;  1JJ2 A;  2UXD L;  4CJ1 B;  2WIN B;  4BY7 B;  4J8Q A;  2Z8L A;  2OWO A;  1PZK D;  4N9P A;  3FKI H;  4YCU A;  1AZP A;  1EFI D;  3CME A;  3E9H A;  4KY7 A;  5D14 A;  2KCC A;  2UXD Q;  1WTP A;  1X3E A;  4C3I G;  1L1O C;  1IL2 A;  2CWA A;  4DK3 C;  1PLF A;  1Q1E A;  2CFM A;  4GNX A;  1X65 A;  4K2L A;  4A3K H;  1E1O A;  2JP1 A;  5ELB A;  2L1B A;  1BKB A;  5NUC A;  3J7A 5;  3KLS A;  2K6A A;  2Q2I A;  4A93 B;  4HCE A;  5LL6 S;  4DPG A;  4OGQ C;  1Q81 C;  3X3N A;  2ZJP A;  5DM6 3;  4X3K A;  1SYE A;  3RLO A;  3I55 A;  4HJ7 A;  5JVH 3;  3QWN A;  1KRS A;  1HA5 A;  1YNJ D;  2WP8 J;  1Y14 B;  3MHB A;  5IGD A;  2K4K A;  1S5B D;  1Q46 A;  2G9H D;  3HKS A;  5CR3 A;  3UDI A;  4DV1 L;  1MHW C;  5I2Y A;  1T5E A;  1F2L A;  1ENF A;  1TWA H;  5IYC G;  5D3D A;  3I4M G;  2WFW A;  1NUC A;  3ZJY C;  4TKO B;  1SND A;  1Q86 C;  4LF9 L;  3S15 H;  1K0S A;  2VQE L;  4DV1 Q;  5M5X H;  3WWV A;  2NVX B;  1JJG A;  1EOT A;  4RGT A;  1E3P A;  4A3F H;  3OW7 A;  1G2S A;  1X55 A;  4DKA C;  5CV6 A;  4LF9 Q;  4QIW B;  4QUC A;  1RDP D;  1QZH A;  1B4O A;  1O78 A;  2YYZ A;  1MGS A;  3BYY B;  2ES2 A;  3WOE A;  5KIX A;  4EQ5 A;  4GOP C;  4RGO S;  3KYH C;  5EKK A;  1I4P A;  1LT3 D;  4DU9 A;  4IFD I;  5IGB A;  1LT4 D;  3OOC A;  1K8G A;  1J6Q A;  3NTI A;  5M3M G;  4AQY L;  3S1R H;  4H02 A;  4WRD A;  3AFQ A;  3CHB D;  5FLX E;  5LHY 1;  2L15 A;  4HSV A;  2JA8 H;  3ERQ A;  1MIU A;  5C4J B;  4XYO A;  2ZTE A;  4JBK A;  1IW7 D;  4HCS A;  1S5D D;  1CUK A;  4AQY Q;  2A6E C;  1NCV A;  4KJO A;  3S2H B;  2F0I A;  2BE5 D;  2WAQ G;  1TY0 A;  3CCQ A;  4XQQ A;  1EQV A;  4RGM A;  2FIN B;  1PH1 A;  3S1Q B;  1PRT C;  2K5Q A;  4POG A;  1UE1 A;  1HR0 L;  1UEB A;  5IOC A;  2NB0 A;  4OO1 I;  3A8J E;  1KLU D;  2K75 A;  4H44 C;  2XIW A;  4V0B A;  3NTH A;  4JI5 Q;  2AQ1 B;  5FLM G;  1YEZ A;  4IUT A;  2D5D A;  1HR0 Q;  4IAL A;  1PH2 A;  5IY0 A;  4A3E B;  4M1U B;  3AMU A;  4B3R L;  3HOX H;  1DOK A;  3TP7 A;  2I46 A;  3NEN A;  5CBA E;  1YIJ A;  2UXB L;  1I5F A;  1Z47 A;  1CA6 A;  4JBM A;  3M3Y B;  4FVM A;  1U0L A;  3GTQ B;  4B3T L;  4B3R Q;  1QIL A;  2SNM A;  2CH4 W;  2PZW A;  3KBX A;  1VQB A;  2UXB Q;  1B70 B;  2AWO A;  1KTK A;  3PIP 3;  1LTR D;  2BDO A;  1DOM A;  2IW3 A;  5CMD A;  5CV7 A;  1IBL L;  4IPD A;  3J80 c;  4B3T Q;  4OO1 H;  4GNX C;  1KHI A;  2R7F A;  2K14 A;  3MXG A;  2EVB A;  3E5S A;  2DNE A;  4BBS H;  2PI2 E;  1Z7T A;  2HCI A;  5FLX L;  3HOV G;  2MUY A;  3GDE A;  1IBL Q;  4B3M L;  2R92 H;  2WAC A;  5H1S E;  2HDL A;  3UDF A;  2JA5 G;  3VDY A;  4UDU C;  5I4D A;  3GTP B;  1BNZ A;  4B3M Q;  3H0G H;  4L5T A;  1LUZ A;  2EXD A;  1TT2 A;  4O42 A;  3K57 A;  1Y8P B;  1HQM C;  2YTV A;  3JC6 6;  5A2Q E;  4JV5 L;  3HOW B;  2AUJ D;  4IUV A;  3A5U A;  4KKT A;  2L9H A;  1O7L A;  4CJ2 C;  1C8C A;  3H15 A;  1WTQ A;  2HT1 A;  4A75 A;  3HOW H;  2MNA A;  4KHV A;  4LUV A;  1LLR D;  1LTB D;  1VQA A;  4JV5 Q;  1F2Y A;  1PYS B;  2PQE A;  1Q90 A;  4HED A;  5EQ0 A;  3OPO A;  1S4Z A;  2FJ2 A;  3NK9 A;  4DFA A;  3FP9 A;  1TWH B;  3NBI A;  1SN8 A;  3DEO A;  3J80 i;  3GTM B;  4RWS C;  4DF7 A;  4LF7 Q;  1TQO A;  1SNC A;  1QWY A;  1MI2 A;  4DNT B;  2RCN A;  2HHH L;  2LY7 A;  3K80 C;  4EVO A;  1PH7 A;  2PMZ B;  3CC2 A;  1EL0 A;  1RJT A;  5JOB A;  1JE4 A;  1CTM A;  1ESF A;  4DV4 L;  3K7A B;  1KIX A;  5BN3 A;  1VQH A;  2HHH Q;  2PW7 A;  4LUZ A;  3W1G A;  5JEA G;  4X64 Q;  2DN8 A;  3K7A H;  5E3F A;  4DV4 Q;  2OEO A;  3J7Z C;  1LAC A;  5C3E G;  3Q24 A;  5GAD C;  3NBH B;  4IUU A;  4JW0 A;  1TXY A;  3HG9 A;  4QIW E;  2F0S A;  4HJ5 A;  1J9O A;  2HCC A;  3I90 A;  3HOZ G;  3QG1 A;  3ER0 A;  2HUG A;  4WJ3 M;  3VR4 A;  2R7Z B;  1RKN A;  2EYL A;  5I9O A;  3STB D;  1A15 A;  3RLF A;  1YJW A;  1RD9 D;  1PDQ A;  1FNW A;  2J7Z A;  1SSO A;  5IYB G;  5C44 B;  1LAB A;  1SYC A;  5LMN L;  4A3L G;  1SE3 A;  4R8I A;  4BY1 B;  3DM3 A;  2IHE A;  2D0O A;  2Y0S B;  4IOC A;  3PQI A;  4ME3 A;  3ULJ A;  1ASY A;  4UAI A;  5LMN Q;  4DV2 L;  4FF2 A;  4WJ4 A;  1P16 A;  1IXR A;  4JI6 L;  3K58 A;  2LFN A;  3TDQ A;  3J81 j;  2R6G A;  4IJH A;  2BA0 A;  4C3H H;  4DV5 L;  2FMM A;  4BBR H;  4DV2 Q;  1Y1W H;  2PCF B;  4J15 A;  3K5N A;  3PF5 A;  3KDF A;  1HTP A;  2LKV A;  2Z4I A;  3SE0 A;  3J7Y W;  3OIQ A;  3KLS X;  3H09 A;  2C5C A;  3GV3 A;  4KLK A;  1B53 A;  2FMC A;  4DV5 Q;  1WTR A;  5K36 H;  2PZU A;  1HJP A;  1I6H B;  2CHB D;  3MXN B;  5FJ8 G;  4DR5 L;  5EKI A;  4CKE A;  5JPN C;  1HQR D;  1SXT A;  3BZK A;  5KNB A;  2K50 A;  4H7B A;  4X66 L;  4GKK L;  4R4I A;  5EAY A;  1X32 A;  2L11 A;  1I50 H;  1B44 D;  4MTN A;  1J8I A;  3D4D A;  5M3F G;  2E8G A;  3VYR A;  2E2J B;  2ASB A;  4NXN L;  4GKK Q;  4X66 Q;  1R9T B;  1H9K A;  1GXD C;  2BDN A;  3GTL B;  1UE6 A;  1NTG A;  2A69 C;  4RCN A;  4R4C A;  5IYD G;  3BDC A;  1JWM D;  2GVA A;  1R9T H;  4A3E G;  2PYK A;  5CC4 A;  4Y7N B;  4NXN Q;  2K04 A;  5EBD A;  3WOF A;  3VR5 A;  2X6G A;  3UE1 A;  1Q8K A;  4K2K A;  4C3J H;  2IPK D;  1XMQ L;  3P1H A;  4IZ8 A;  4Y7N H;  4DAY A;  3NXW A;  5CV5 A;  3QJY A;  5C4X H;  1F9P A;  1TU2 B;  1AH9 A;  1XMQ Q;  1VQP A;  2F0T A;  3H3V I;  4F7X A;  2EJG C;  2VUM B;  1KNA A;  1RCV D;  2JA7 B;  1NR2 A;  4X62 L;  2F0D A;  2ZTD A;  3K5L A;  4A3G G;  5C5L A;  5KRU A;  1N8R C;  2VY3 A;  1R4P B;  2JYO A;  1UEA B;  3W2D A;  1PH8 A;  3IRB A;  3URY A;  2JA7 H;  1ICF B;  2E2H B;  3HRZ C;  3V96 A;  1DZ1 A;  1ASZ A;  4X62 Q;  5E4W C;  5COY A;  3V2T A;  2K7V A;  1SEB D;  2NVQ B;  1GHK A;  1KAA A;  5I2X A;  5M9O A;  3QO2 A;  4NDX A;  3CCJ A;  5KGU A;  3M4P A;  3A8K E;  3VR3 A;  1EIG A;  2EQS A;  1TWC B;  1SFO B;  5ELD A;  3PSI A;  1B1Z A;  1PRT F;  3NUC A;  4C3I H;  3H3V H;  1QUQ A;  1VQG A;  3FPU B;  2F0M A;  3A7L A;  3K6O A;  5C0X J;  4Z9C B;  1LTL A;  2PMZ E;  3SXH A;  3I2Z A;  4XXE A;  1DOL A;  2ALY B;  3HKZ B;  3RN5 A;  2Z6K A;  4EQP A;  4A76 A;  5IT9 c;  3NTK A;  1M4V A;  3NP8 A;  3DM1 A;  4PMB A;  1GKH A;  1CQV A;  3I4N G;  4PZ7 A;  2WB1 E;  5I6W A;  2QGQ A;  4RKB A;  3PO2 G;  1EU3 A;  3RUZ A;  4LFA L;  1IHZ A;  4DV6 L;  3S1N H;  1NBW A;  1SNO A;  2NN6 G;  1BBU A;  5IYC H;  4YCW A;  3I4M H;  1JCK B;  3MXP A;  5K5P A;  1WFQ A;  4R4O A;  4LFA Q;  1STB A;  3A55 A;  4DV6 Q;  1SAP A;  4DR2 L;  3OYY A;  1X3P A;  3J81 i;  2VZA A;  5GQO A;  3BVM A;  5J39 A;  1DGS A;  1LV9 A;  1STE A;  2V1C C;  2FXQ A;  1LM0 A;  1EQR A;  1RTO A;  3B6Y A;  1DXM A;  1M8A A;  1XTC D;  2Y0S E;  5M5W H;  4BWG B;  4DR2 Q;  1PHJ A;  1H9S B;  5HGQ A;  3E9I A;  3FDT A;  4FDB A;  2B29 A;  3GQB A;  2L12 A;  2H1E A;  2QA4 A;  1G91 A;  2R7D A;  1CZG A;  4K5V A;  1KL9 A;  1SJH D;  5M3M H;  2VL6 A;  2PNR C;  1YNN D;  1BCP C;  1TWF H;  4OX9 L;  1AW7 A;  4A3J G;  2YU9 H;  2PW5 A;  3T56 B;  4CDC C;  5JPM C;  1EQQ A;  2Z6B A;  3W3A A;  3HOY B;  2DJG C;  1VQO A;  4MTK A;  4X3U A;  1SE8 A;  1WTO A;  3PO3 G;  2K52 A;  1UAP A;  2NVT B;  4LWC A;  2PI2 A;  3LWU A;  1KQS A;  4QB4 A;  5EPJ A;  2IJ0 A;  1V9P A;  3PIP A;  1EEI D;  3NWT A;  3MEH A;  1MSH A;  3Q8D A;  2ZXR A;  2F0Q A;  5C6A A;  5L37 A;  1SMY C;  1WTH A;  3N52 A;  4HMI A;  1E0B A;  2DGY A;  1ZYR C;  2YV5 A;  2JA6 G;  1L1O B;  1V1Q A;  1BR9 A;  4L8J A;  2Z0S A;  3SDZ A;  5FLM H;  2E2I H;  1V1P B;  4P2C B;  3Q22 A;  3CCL A;  4JC0 A;  3U9O A;  2KHJ A;  4LUO A;  1LTA D;  3D4R A;  1YJN A;  1B3A A;  1G29 1;  2NTS A;  1I94 L;  4JBW A;  2R3Z A;  5KYI A;  4OWX B;  4G4K A;  4JI0 Q;  4C1N K;  3R93 A;  3KUP A;  1VQN A;  1TVX A;  1PA6 A;  3KF8 B;  3A74 A;  3SR1 A;  4ME5 A;  1YZ6 A;  2D0P A;  4DNR B;  1I94 Q;  4K8I A;  2R93 G;  4UPA A;  2BH2 A;  4KD3 A;  3I91 A;  5DM7 3;  1SRO A;  2BCO A;  1ET9 A;  4IPC A;  2ZJR A;  3A5Z B;  1EU4 A;  4A4I A;  2ENB A;  2LMC B;  1EUJ A;  4AYB G;  2B2T A;  2ZTC A;  4I7Z C;  1XNR L;  3S17 H;  4KTA A;  3M7G A;  2H4O A;  3D31 A;  2Z6K C;  1D7Q A;  4TSS A;  2JA5 H;  4DXF A;  2VW9 A;  1VF7 A;  3FKI B;  1PFB A;  1GUN A;  1IL8 A;  2L55 A;  1PH5 A;  3RMH A;  1D1K A;  1LO5 D;  1X3Q A;  4PV1 C;  1STN A;  1BO0 A;  3G7L A;  1VQ8 A;  3DWP A;  2SNS A;  1DYQ A;  4A3K B;  3BJU A;  4GOP B;  3S1M H;  2B2Y A;  1VQ7 A;  1IBM L;  2IHF A;  1IZ6 A;  3BS1 A;  1K9M C;  2JQO A;  2G5D A;  2XRQ D;  2BA1 A;  4O1N A;  2HQL A;  4G57 A;  3NQT A;  3KLR A;  4HSP A;  2K32 A;  1JE5 A;  1IBM Q;  4TVA B;  1ENA A;  3MA2 B;  1NMF A;  2A5H A;  3HKZ E;  1FVI A;  1HNX L;  2KEC A;  1EWC A;  4K8J A;  5G3L F;  3PUX A;  2K05 A;  1WTW A;  2RSN A;  3OIP A;  4JI2 L;  2N88 A;  4YHH L;  3JAM i;  4TRD A;  1HNX Q;  1TWA B;  2RDF A;  5C0X G;  3L2P A;  3M4O H;  3RNU A;  4JI2 Q;  3PCO B;  2K28 A;  1ENC A;  1SJE D;  1A0I A;  4L6T B;  3S15 B;  4BA1 I;  4YHH Q;  4JPB W;  1T9H A;  1EIF A;  1Q12 A;  1HNW L;  1S5C D;  3D8G A;  3PIO 3;  5M5X B;  2CW0 D;  1GHJ A;  1UE5 A;  4R1J A;  5JEA H;  4A3F B;  1ZKO A;  5T1G A;  2K5W A;  3TP5 A;  4XQN A;  2KVM A;  3ERO A;  1JMC A;  4DR1 L;  1NSN S;  5C3E H;  1HNW Q;  3K5M A;  1WI5 A;  2TMP A;  4KY5 A;  1SRU A;  1PH6 A;  3TP6 A;  2DJF C;  3LWE A;  2VQE Q;  3OMC A;  2IX3 A;  3HOZ H;  1CZW A;  5FO9 B;  4DR1 Q;  1DD2 A;  3S1R B;  4QCL A;  2A74 C;  3ND8 A;  2A68 D;  2RHQ B;  4A3D H;  4UP9 A;  1C48 A;  2JA8 B;  4HIO A;  5IYB H;  4K5X A;  3MAQ A;  4A3L H;  4A3C G;  3P7J A;  5ELE A;  3OTO L;  3ULL A;  3RZD H;  1LTI D;  1PTO H;  2VNU D;  1STH A;  2B2U A;  1PZJ D;  4LF8 L;  1I4H A;  2OTJ A;  3D4W A;  1K3B C;  3S24 A;  3TS2 A;  2UUA L;  3L3O C;  3OTO Q;  2F1M A;  2Q2U A;  2CVR A;  4PG3 A;  4ZUJ A;  3MWY W;  4RHS A;  2UUA Q;  1TKW B;  4IFD J;  2B2V A;  5ELN A;  3E0E A;  4O0A A;  4A3I B;  4FYD A;  1QNU A;  3HOX B;  1FGB D;  2HDM A;  3IKJ A;  4AIM A;  1QVF A;  1C9O A;  4QL5 A;  4IOA A;  1JOK A;  4JOI A;  4MHE A;  5FJ8 H;  3FEW X;  4A3I H;  1PH4 A;  3NQI A;  4RG1 A;  3Q23 A;  3GTK H;  1D8L A;  2B3G A;  2SEB D;  1UWV A;  3I7F A;  3EQL C;  1YHQ A;  1HZ9 A;  3D0F A;  1CHP D;  4QMG A;  3O13 A;  1BDO A;  2F0F A;  5M3F H;  2HIV A;  1MSG A;  2EYO A;  2O4X A;  1VQE A;  4X65 L;  1S5F D;  1AP0 A;  4C1N I;  3TRZ A;  4OWT B;  4DN4 M;  5IOD A;  1L0Y B;  2B2Y C;  4BBS B;  5IYD H;  5KND A;  2OF1 A;  1RF2 D;  1M1K C;  2B63 G;  1N33 L;  2UUB L;  4FXG C;  1Q8I A;  1W3S A;  1PTO C;  2R92 B;  2BOS A;  3GO5 A;  3G6J B;  3U9S A;  4OEM B;  3CCM A;  1MBY A;  3U4Z A;  1H9R A;  4A3M B;  5JJL A;  2UUB Q;  3H0G B;  2M9V A;  2PNH A;  4XIG S;  4QGU A;  5C4H A;  5IGG A;  1Q82 C;  1PVO A;  4NPS A;  4A3M H;  1SLJ A;  1W6J A;  3I70 A;  2F0K A;  3K0Y A;  3SK8 A;  1XMO L;  2F3W A;  4YIJ A;  2E74 C;  4FF3 A;  1QOH A;  1TS5 A;  2K5H A;  1BCP F;  4ZKB B;  2A6H D;  5C3W A;  1EWI A;  4YWK A;  1XMO Q;  1E2W A;  5BN5 A;  4L5Q A;  2MFI A;  2NBF A;  1WTX A;  4BY7 G;  1BUV T;  2L0C A;  2CQA A;  4RH6 A;  1CQF A;  2MGS A;  3W5O A;  3CD6 A;  4OHJ A;  2IY5 B;  2F3V A;  1QNK A;  4K6D A;  1Z6H A;  1Q7Y C;  3PMF A;  4HMJ A;  1PH3 A;  3AYH B;  1NMG A;  4XQJ A;  3BZD B;  3HOU B;  4MNO A;  5IGC A;  2GN5 A;  2QIL A;  2D9U A;  1LTT D;  4LMQ D;  1QJO A;  4FNF A;  1RIP A;  3HOU H;  1Y1V B;  4KD4 A;  2HD3 A;  4YCV A;  5EKL A;  5BN4 A;  3A8I E;  3KBG A;  1XPU A;  2I0Q A;  2XNA C;  1C4Q A;  1Y1V H;  2ZXP A;  4HJ8 A;  1VQ5 A;  2CH4 A;  4A93 G;  4U67 3;  1L0X B;  2F0U A;  1WCM B;  3I4N H;  4C2M H;  2WB1 B;  3L7Z C;  2SOB A;  3PO2 H;  1KDC A;  1VQJ A;  1WCM H;  1EZ8 A;  4ZQ3 A;  2H5X A;  2NN6 H;  1BBX C;  3MXN A;  3EA6 A;  1MD2 D;  4TQU S;  2I5M X;  4UY8 C;  5A2Q L;  3GTG H;  3U50 C;  5IE8 A;  3I4O A;  2B2V C;  3TQY A;  1QG7 A;  2DY7 A;  3MC0 B;  1EOV A;  1TS2 A;  1SBB B;  3NWS A;  3AU7 A;  1U4R A;  1G51 A;  3TS0 A;  3AFP A;  1UNS A;  4JI8 L;  2OT2 A;  3C46 A;  4RCO A;  5C5M A;  5JJK A;  2XRS D;  4N8F A;  3T4A C;  4LF4 L;  2E2D C;  4C3H B;  4BXX H;  4KV6 A;  1LT5 D;  4BBR B;  1Y1W B;  3G48 A;  1YNJ C;  3M4Q A;  5C4Z A;  3CRL C;  4JI8 Q;  5DNF A;  1EFW A;  4LF4 Q;  3H6M A;  4GLX A;  4JI6 Q;  1FD7 D;  4A3J H;  2K5V A;  4IUQ A;  1NNX A;  1Q1B A;  4DA2 A;  2OQ0 A;  1L2F A;  3KOJ A;  1P8L A;  1HH2 P;  2NWG A;  1BXT A;  3DMU A;  5IT9 E;  1NAP A;  1S40 A;  1I50 B;  1U4L A;  3H94 A;  4IN3 A;  3PO3 H;  1SYF A;  5JAV A;  3F2B A;  4ZAI A;  2ATW A;  1EIH A;  3KF6 B;  1STY A;  4DR5 Q;  2EZV A;  2NUC A;  1Z9F A;  4IFD G;  1NE3 A;  2JA6 H;  2KHS A;  1U4M A;  3NHH A;  3CCS A;  5ELO A;  1N34 L;  4KKU A;  2A19 A;  1QCB D;  3EIV A;  4CHT B;  1FL0 A;  3CU7 A;  4L5S A;  2B2W A;  3OWE B;  4KK7 A;  4C3J B;  3D3R A;  2E75 C;  2ZM6 L;  1Y69 U;  4WJW A;  4IUR A;  5C4X B;  1CKM A;  1IW7 C;  1N34 Q;  2EYP A;  4YWL A;  4I65 A;  1HTL D;  5E4X A;  4IQZ A;  3EJI A;  3T53 B;  4DAV A;  2ZM6 Q;  1IBK L;  5EBC A;  1JWS D;  2BE5 C;  1K8O A;  5M5Y H;  2R93 H;  1F9S A;  2N78 A;  2K5D A;  2KEE A;  3A0J A;  1EIY B;  2F0O A;  5TSS A;  5T1I A;  1WD1 A;  2RA4 A;  2RDH A;  1IBK Q;  5ISR A;  4A3B B;  1JOR A;  3K59 A;  3AB9 A;  1EYA A;  1D6E C;  4L63 B;  1LTG D;  3MXU A;  2QEX A;  2AMC B;  2KCM A;  4A3B H;  2EJF C;  1X3F A;  2IT1 A;  4EQN A;  1SYD A;  5EPK A;  3CRK C;  1U5K A;  5IT9 L;  3RLN A;  3IFT A;  3DLL A;  3CQZ H;  3TEH B;  1WOC A;  3KLW A;  1U9R A;  5D65 A;  1NY4 A;  2F0J A;  2XGT A;  1K28 A;  4C3I B;  3J81 c;  4FF4 A;  4IO9 A;  1CFM A;  1FNV A;  1PYW D;  3CF5 A;  3E0J A;  3HP3 A;  4FP5 D;  4F88 A;  3HOW G;  3L0O A;  3PIO A;  4GLV B;  4FO2 A;  4ID6 A;  2E5L L;  4RA8 A;  1O7Z A;  1A62 A;  1MKH A;  4QUF A;  5F2D A;  1GUS A;  1BCP B;  1H9S A;  2A1A A;  2I5L X;  3FVQ A;  4EGV A;  1EYG A;  2J4X A;  3R2I A;  3SGI A;  1EY8 A;  1SYG A;  3RD4 A;  4G7O C;  4YWM A;  5ELF A;  4JI7 L;  4R8N A;  2E5L Q;  3PUZ A;  5DEH A;  2IX1 A;  5KYL A;  3S1N B;  4JI7 Q;  3NEM A;  1A8V A;  1WTV A;  1X56 A;  2GA4 B;  2I07 B;  2Q8R E;  5CYU A;  2EE1 A;  2AQ3 B;  1YBY A;  3I4M B;  3FMC A;  3MFY A;  1ROD A;  1KAB A;  3A7A B;  4RKL A;  2I5H A;  3T1H L;  2F03 A;  2JEB I;  3DWA A;  4RMF A;  3MEF A;  1PTO F;  2A6E D;  1H9J A;  1ILP A;  4CKC A;  3C2P A;  4H13 C;  5M5W B;  2F0W A;  1ML0 D;  1F77 A;  3GP7 A;  3T1H Q;  1A2T A;  2Z1C A;  2WB1 G;  3W1B A;  2RCF A;  1PRT D;  2JA9 A;  3S14 H;  1L1O A;  4CGY B;  5FOB B;  1EY0 A;  1KC8 C;  1SNQ A;  1EYC A;  1V1P A;  1K83 H;  4F8M A;  2EYM A;  3K8A A;  1NR4 A;  3FPP A;  5M3M B;  3RZO H;  4BS9 A;  2R7Z G;  1TWF B;  1AEX A;  4CDD C;  4GN4 B;  2YU9 B;  1EZ6 A;  1AE2 A;  5LL6 X;  3TME A;  5C44 G;  3E3X A;  4A3C H;  3EN2 A;  3K7U C;  2B2W C;  1SNP A;  4BY1 G;  4DV3 L;  1QZG A;  1JOQ A;  2Y0S G;  2WAQ B;  2UUC L;  3SHL A;  2KHI A;  3I72 A;  4OX9 Q;  2LXJ A;  4UHV A;  2K01 A;  4LK1 C;  2ID0 A;  3S2D H;  4DV3 Q;  2UXC L;  4ALP A;  1VQL A;  3HZX A;  5J3B A;  3UI2 A;  1QVC A;  2Q8T A;  3CPW A;  4X6A H;  2E2I B;  2ZT9 C;  3STB C;  4ZRZ A;  1VF5 C;  4GN5 A;  4S3S A;  2B8F A;  2L5T A;  1X3G A;  4HJA A;  1PMR A;  2EOT A;  1LTS D;  1SYB A;  1WJJ A;  1Q3L A;  4GOP A;  5CGK A;  2VS1 A;  2HIX A;  1HFG A;  5IP9 G;  2MP1 A;  4XT1 B;  1L0W A;  2F0V A;  4WOR A;  3S16 H;  2KA7 A;  4JI1 L;  2RKS A;  5E1F A;  4V19 0;  2ICE C;  5AJ3 L;  1KAW A;  5JJZ A;  1JB3 A;  1CKN B;  1OXT A;  2LSS A;  3Q0A A;  2B63 H;  1G2T A;  3HOV B;  1GUT A;  2TSS A;  3S17 B;  4JI1 Q;  3C1E A;  1EY6 A;  4PQX A;  4R9W A;  5IGF A;  3JAM c;  3TZD A;  1TWG B;  1STA A;  3K0X A;  2JA5 B;  3HOV H;  5AJ3 Q;  3OSO A;  2Q2T A;  1O80 A;  5IIF A;  1IKL A;  1S5E D;  2KBN A;  3TRE A;  3GTO H;  3SVM A;  2Q2H A;  1TWG H;  3CCV A;  3I56 A;  3PF4 A;  4RGN A;  2JK8 A;  3OMG A;  1XNR Q;  2PQA B;  5I6Y A;  1TII D;  1NJI C;  2VUM G;  2JA7 G;  1YI2 A;  3S1M B;  3PUW A;  3IAY A;  4QF4 A;  3ICE A;  1VQC A;  4HN7 A;  1QVG A;  4HJ9 A;  4DAP A;  4IPG A;  5GAH C;  1O7Y A;  1U4P A;  1JJC B;  5CBE E;  2LS0 1;  3A56 A;  2K03 A;  1OXV A;  5GAG C;  3OWF A;  4B08 A;  3EFX D;  3R3O A;  5IP7 G;  1Y8N B;  4QJF A;  3HEJ A;  1SE2 A;  1KDB A;  4B9W A;  1FJG L;  2DUD A;  4XYQ A;  5KEE A;  4BY7 H;  2XWB B;  2A73 B;  3TSS A;  3OW2 A;  4LF5 L;  1A63 A;  4DUZ L;  4OEL B;  2JXM B;  3F2D A;  1XJV A;  4XDX A;  4CDE C;  1X9N A;  1ZEQ X;  1A6X A;  1UE7 A;  1FJG Q;  3M4O B;  2E76 C;  1A3U A;  3ND9 A;  4YY3 L;  1XPO A;  1G6P A;  1PRT B;  4OIK A;  4LF5 Q;  4FF1 A;  4DUZ Q;  5HUR A;  2AHO B;  2JSO A;  1I6V C;  4EX5 A;  2Z4H A;  3R8B A;  1D2B A;  2NTT A;  3J80 E;  2FHT A;  4PNY A;  4Q0F A;  3VYT A;  3FRP B;  4J6H A;  4YY3 Q;  1S72 A;  4CDF C;  1FR3 A;  5JEA J;  1E24 A;  3HKZ G;  2OQK A;  4A93 H;  5GAE C;  5C3E B;  3SEB A;  4DV0 L;  1GUW A;  1OTC A;  1QB5 D;  4JG2 A;  4LFB L;  4DK0 A;  3MTS A;  1VQF A;  4XTC S;  1VQK A;  5COR A;  3HOZ B;  4HAE A;  2WKC A;  4P72 A;  1HA6 A;  1VQI A;  2IX0 A;  4KMU C;  3CCU A;  4DV0 Q;  5A35 A;  4EQO A;  4LFB Q;  4JYA L;  1BOS A;  4A3D B;  2KJX A;  1D5Z C;  2C9O A;  3CP0 A;  4RAU C;  3MVV A;  4R4Q A;  1H95 A;  5EPL A;  3CCE A;  1OXX K;  4PMC A;  1B9N A;  4JYA Q;  1C0A A;  1XNQ L;  4GNX B;  1EY4 A;  1I3Q B;  3RZD B;  1YIT A;  4QQB X;  2F0P A;  5G3L D;  1PTO B;  3KK7 A;  4P74 A;  5I9P A;  2NVX H;  3T13 A;  1I3Q H;  3PUV A;  3BZC A;  3HS0 C;  4X3T A;  2WAQ E;  3NEL A;  1SMX A;  1XNQ Q;  2O5I C;  2CQO A;  3CPF A;  4NXM L;  3G6E A;  3G71 A;  1SE4 A;  1JQY D;  1V8Q A;  1PFM A;  3D6C A;  3F2U A;  3KJP A;  2A69 D;  4LW1 A;  1ONL A;  5AFW A;  4IJL A;  1W6K A;  2EY2 A;  4LF8 Q;  1I4Q A;  2CWP A;  4NXM Q;  4DXG A;  4GS3 A;  1X6O A;  2J0T D;  1V43 A;  1K8M A;  1H9M A;  1WD0 A;  2EY1 A;  3GD7 A;  1F2Z A;  5C4J H;  3L9A X;  3J80 L;  2F0N A;  4FXK C;  1GO3 E;  2GVB A;  3PGZ A;  5FKA C;  3GTK B;  1DJR D;  2B2T C;  3HOY G;  4KY6 A;  1HRJ A;  3K81 C;  4DK1 A;  1K8A C;  3I8Z A;  2F4I A;  3WDN A;  4JI5 L;  1ICW A;  3S2H H;  2KUM A;  1EY9 A;  4U68 A;  5M3F B;  4BA2 I;  1N36 L;  4LF6 L;  1SR3 A;  1D1I A;  3S1Q H;  2EY6 A;  3P75 A;  4IFD H;  2Q8I B;  1B9M A;  2EDG A;  4PZ8 A;  1M90 C;  1AN8 A;  1CK1 A;  4IUN A;  2RSO A;  1X54 A;  2VB2 X;  5JJI A;  2WKD A;  1N36 Q;  1JB7 A;  4LF6 Q;  4I7A A;  3TN2 A;  1YNN C;  4DGZ A;  1K3R A;  2M00 A;  1W2B A;  5FK9 C;  4DK6 C;  4A3E H;  3QOJ A;  1OO9 B;  4PMW A;  1LT6 D;  5CV8 A;  1QE6 A;  4X65 Q;  4ZK9 B;  4AH6 A;  5IWA L;  2PZT A;  2F0E A;  1N33 Q;  3M3Y H;  2QF7 A;  3GTQ H;  4N9T A;  4DR4 L;  2WII B;  4JI3 L;  4A3G B;  4DAM A;  2MHV A;  3NPP A;  4GZY C;  5IWA Q;  3M9B A;  4KKS A;  4A3G H;  1CSP A;  1J5E L;  5J22 A;  2EYH A;  2XSC A;  4KJN A;  4DR4 Q;  4JI3 Q;  1HZB A;  2G9D A;  2VXW A;  1GUO A;  1R4Q B;  1VQ9 A;  3NBH A;  3IL8 A;  1J5E Q;  2EXZ A;  3I4L A;  3EBE A;  1SDF A;  1JOO A;  1XYI A;  1F2M A;  2PPB C;  3FKI G;  3GTP H;  4KHP L;  1YNX A;  2NYZ D;  1VQ4 A;  1XX8 A;  1UUP A;  1HPC A;  2NN6 I;  4F87 A;  1CSQ A;  1KDA A;  4LJZ C;  3J7A F;  1D5M C;  3R2T A;  5FLX c;  1RL2 A;  3CXC A;  2MO0 A;  4A3K G;  3DHQ A;  1GVP A;  2OCE A;  4KHP Q;  3FHW A;  4FXD A;  1WYD A;  1JIC A;  3C1F A;  4LF7 L;  2IL8 A;  2O5J C;  1AZQ A;  3GTJ B;  3BU2 A;  3AEV A;  1JR0 D;  1CT1 D;  3CW2 C;  3I73 A;  2X69 A;  1B7Y B;  5DAU A;  3I4N B;  4C2M B;  1EQT A;  3GTJ H;  1ILQ A;  4ABN A;  1IKM A;  4HIK A;  2NZH A;  1CA5 A;  1G6Z A;  3PO2 B;  1CM9 A;  1GOZ A;  1TWH H;  3S9W A;  2B2U C;  3GTM H;  4CJ0 B;  4JI4 L;  2V4D A;  2QEJ C;  4NKL A;  4DNI A;  2N49 A;  2ZXO A;  3ERS X;  4X64 L;  3Q6S A;  4Q5V A;  1BCP D;  3LGJ A;  1BBW A;  3CAM A;  2D62 A;  3GTG B;  4KN7 C;  4JI4 Q;  5BR8 L;  2MJ8 A;  2MPM A;  2OXP A;  2AWN A;  4N8X 1;  1PFN A;  1A3V A;  3KF6 A;  2EPB A;  2EYJ A;  4J1M A;  1PH9 A;  1CKO A;  2QW7 A;  4A3F G;  4POF A;  5BR8 Q;  4JOI C;  2XVS A;  1XXG A;  1ZXT A;  3CC7 A;  2KQ3 A;  1SMY D;  1HCZ A;  3AQQ A;  1B3Q A;  2YTX A;  1ZYR D;  3J81 E;  4A3D G;  1E22 A;  3HFZ B;  4DR7 L;  2R7Z H;  2OTL A;  2EIF A;  5J1Z A;  4A3J B;  1RTN A;  1OXU A;  2JA8 G;  4Y52 H;  2L4N A;  5C44 H;  1HNZ L;  1DM0 B;  3QR8 A;  2R61 A;  4BY1 H;  4DR7 Q;  5CV9 A;  2CW0 C;  1GUG A;  2QDL A;  4NMZ A;  4ODG A;  3U4V A;  3PO3 B;  1HR0 W;  1DCZ A;  1LYL A;  2DY8 A;  1HNZ Q;  3F2C A;  1IYJ B;  3VYU A;  1TS3 A;  1TR5 A;  5HGT A;  4P73 A;  5CV4 A;  3BVZ A;  2XN9 C;  4RFB A;  2JA6 B;  1A2U A;  3SK6 A;  4G7Z C;  4HR7 B;  4K5W A;  1V1O A;  4H0L C;  1JWU D;  2A68 C;  1STG A;  2AUK A;  1KNE A;  4A3I G;  2VB3 X;  3HOX G;  2F4V L;  1N32 L;  1HXY D;  1I6H H;  1AFP A;  1ESR A;  1E7Z A;  1PXU A;  2NZ1 D;  2N8N A;  4UP8 A;  1AE3 A;  3OHX C;  3VR6 A;  1HFN A;  1XPR A;  2F4V Q;  1TS4 A;  1N32 Q;  4DUY L;  5M5Y B;  1WVL A;  4O2D A;  2R93 B;  4DR6 L;  1JT8 A;  1KXL A;  5IP9 H;  2M2L A;  2LXK A;  1PFS A;  2E2J H;  1HHV A;  1EYD A;  3J81 L;  4DR3 L;  4OO1 G;  4DUY Q;  1KLG D;  3A54 A;  3UE0 A;  4DR6 Q;  3GTL H;  2UU9 L;  4AYB B;  4ILW A;  1CHQ D;  2EYF A;  4BBS G;  4IPH A;  1VQM A;  1B8A A;  4K6L A;  2F0G A;  1DON A;  1BQQ T;  2ICI A;  1B2T A;  5C3X A;  3TBI B;  4DR3 Q;  2R92 G;  3BDO A;  3F1Z A;  1YHB A;  3G4S A;  1EY7 A;  1C7Y A;  2XTI A;  3KDF B;  1F9R A;  4JBJ A;  1PYB A;  1BF4 A;  2UU9 Q;  4JCV E;  3VYS A;  3CQZ B;  2F52 A;  4A3M G;  4HTH A;  4B9X A;  5LMU L;  1TY2 A;  1RHP A;  4HIM A;  2QKI C;  3H0G G;  4NB3 A;  3ZYY X;  4HID A;  4MIU A;  3RR5 A;  3IFD A;  3D6W A;  1G8Z D;  1MJC A;  5GRO A;  2VUM H;  5C0X I;  1VMC A;  4ZKC B;  1VDZ A;  1YHA A;  5LMU Q;  3H91 A;  4NP5 A;  2F0H A;  3C3L A;  3NSW A;  3CMA A;  3LX0 A;  2E2H H;  3GV6 A;  1HUM A;  4QY7 A;  1YVC A;  1D5X C;  3N6R A;  4CBV A;  1PZI D;  3DXJ C;  1EEF D;  4M8A A;  1I4G A;  5HY6 A;  2D2C C;  4ZUI A;  4L5R C;  4OWW B;  2NVQ H;  5IP7 H;  4K14 A;  2WV6 D;  2DNC A;  1FYC A;  2QCP X;  3BYT B;  3QIA A;  5E7N A;  3M7N A;  1EY5 A;  2C35 B;  3BVG A;  2F0L A;  1GJX A;  1IYU A;  1TWC H;  1SFO H;  4DAY B;  1PV4 A;  3LNN A;  2JN4 A;  2RF4 A;  2QDB A;  2B8G A;  4MZ9 A;  1EWH A;  2FFK B;  1I4X A;  3DWQ A;  4XT3 B;  2PO4 A;  3HOU G;  5FO8 B;  2MQH A;  5C0X H;  3NE5 B;  2YTY A;  1N9W A;  1A3T A;  4OXP A;  4APV A;  1Y1V G;  1HUN A;  3M4Y A;  3DUZ A;  2A6H C;  3MFG A;  1E1T A;  3E6Z X;  4B3S L;  3JAM E;  1MJE A;  3F8T A;  3S14 B;  4P71 A;  1HZC A;  1K73 C;  2P5Z X;  4C56 C;  3U58 A;  4KHZ A;  1WCM G;  1E2Z A;  2KCT A;  1FNU A;  1VS0 A;  4ZYS A;  3QOL A;  1K83 B;  1T5X D;  2SDF A;  3CKI B;  4LFC L;  4B3S Q;  1BVS A;  2F3I A;  2K33 A;  5LMN W;  3TZU A;  3RZO B;  1K0R A;  2HQE A;  4GN3 B;  4G7H C;  1I4R A;  2AKW B;  1VQD A;  2IWH A;  2A8V A;  4LFC Q;  4IUP A;  3KJO A;  1KD1 C;  3VA7 A;  2JEA I;  3X3M A;  2JE6 I;  4RHR A;  3VR2 A;  2KEN A;  2K5N A;  2CKZ B;  4CKB A;  4KI0 A;  1OXS C;  2AQ2 B;  3KF8 A;  1QUQ B;  1YJ9 A;  1JC7 A;  1II3 A;  1F9Q A;  2B39 A;  3H3V C;  4MN3 A;  1Y8O B;  2ZJQ A;  3UDG A;  3S2D B;  3ONA B;  3T1Y L;  2Z9H A;  4ZLT F;  4BXX G;  4DV7 L;  1VMP A;  3T16 A;  1CKN A;  4OON A;  3CCR A;  3EVQ A;  2EJM A;  3I3C A;  3V05 A;  2K1B A;  4C3H G;  3CC4 A;  4BBR G;  5KNC A;  2N55 A;  3QB3 A;  1Y1W G;  4JK1 C;  2UUC Q;  5EJW A;  3T1Y Q;  3KFU A;  4NW2 A;  4DV7 Q;  1PTO D;  4KN4 C;  2X6L A; 
#chains in the Genus database with same CATH homology
 5K36 G;  2KED A;  3K5O A;  4OIJ A;  1E2V A;  3JAM L;  5IGE A;  3BG3 A;  2RQX A;  3M85 A;  3PUY A;  2KCN A;  3ITP A;  3S16 B;  1IYV A;  2NVY B;  3TP8 A;  3SK4 A;  2EY5 A;  3PV0 A;  4WFN 3;  3SK5 A;  2B63 B;  3P20 A;  4ULL A;  1B50 A;  5JVG 3;  2RDG A;  5FO7 B;  4C3J G;  4E6I A;  4X3S A;  3BDL A;  3GTO B;  5ELC A;  4OL7 A;  2XWJ B;  1CI3 M;  3HGB A;  2RVL A;  5D3I B;  2KOL A;  2RBM A;  3T51 B;  5EGT A;  3VA5 A;  1VCI A;  1XWE A;  2O2L D;  3MZ5 A;  3DEP A;  4LAA A;  1SNM A;  1ET6 A;  3J7A V;  4CJ1 B;  2WIN B;  4BY7 B;  4J8Q A;  2Z8L A;  1PZK D;  4N9P A;  1AZP A;  1EFI D;  5D14 A;  4KY7 A;  2KCC A;  1WTP A;  4C3I G;  1PLF A;  1Q1E A;  4K2L A;  2JP1 A;  5ELB A;  2L1B A;  5NUC A;  3KLS A;  2K6A A;  4A93 B;  4HCE A;  5LL6 S;  4OGQ C;  3X3N A;  5DM6 3;  4X3K A;  1SYE A;  5JVH 3;  3QWN A;  1HA5 A;  1YNJ D;  2WP8 J;  3MHB A;  5IGD A;  1S5B D;  2G9H D;  5CR3 A;  5I2Y A;  1T5E A;  1F2L A;  1ENF A;  5D3D A;  1NUC A;  4TKO B;  1SND A;  2NVX B;  1EOT A;  4RGT A;  3OW7 A;  1G2S A;  5CV6 A;  4QIW B;  4QUC A;  1RDP D;  1B4O A;  1O78 A;  2YYZ A;  1MGS A;  3BYY B;  3WOE A;  5KIX A;  4RGO S;  5EKK A;  1I4P A;  1LT3 D;  4DU9 A;  4IFD I;  5IGB A;  1LT4 D;  3OOC A;  3NTI A;  4WRD A;  3CHB D;  5FLX E;  5LHY 1;  4HSV A;  3ERQ A;  5C4J B;  4XYO A;  1IW7 D;  4HCS A;  1S5D D;  2A6E C;  1NCV A;  4KJO A;  3S2H B;  2F0I A;  2BE5 D;  1TY0 A;  4XQQ A;  1EQV A;  4RGM A;  2FIN B;  3S1Q B;  1PRT C;  2K5Q A;  5IOC A;  2NB0 A;  4OO1 I;  3A8J E;  1KLU D;  4H44 C;  2XIW A;  4V0B A;  3NTH A;  2AQ1 B;  4IUT A;  2D5D A;  4IAL A;  4A3E B;  4M1U B;  3AMU A;  1DOK A;  3TP7 A;  2I46 A;  5CBA E;  1Z47 A;  1CA6 A;  3M3Y B;  4FVM A;  3GTQ B;  1QIL A;  2SNM A;  2PZW A;  3KBX A;  2AWO A;  1KTK A;  3PIP 3;  1LTR D;  2BDO A;  1DOM A;  2IW3 A;  5CMD A;  5CV7 A;  4OO1 H;  3MXG A;  2EVB A;  3E5S A;  2DNE A;  1Z7T A;  2HCI A;  5FLX L;  2MUY A;  2WAC A;  2HDL A;  4UDU C;  5I4D A;  3GTP B;  1BNZ A;  1TT2 A;  4O42 A;  3K57 A;  1Y8P B;  1HQM C;  5A2Q E;  3HOW B;  2AUJ D;  4IUV A;  4KKT A;  2L9H A;  1O7L A;  4CJ2 C;  1C8C A;  1WTQ A;  4KHV A;  1LLR D;  1LTB D;  1F2Y A;  2PQE A;  1Q90 A;  4HED A;  5EQ0 A;  3OPO A;  1S4Z A;  2FJ2 A;  3NK9 A;  4DFA A;  1TWH B;  3NBI A;  3DEO A;  3GTM B;  4RWS C;  4DF7 A;  1TQO A;  1SNC A;  1QWY A;  1MI2 A;  4DNT B;  2LY7 A;  4EVO A;  2PMZ B;  1EL0 A;  1RJT A;  5JOB A;  1JE4 A;  1CTM A;  1ESF A;  3K7A B;  5BN3 A;  2PW7 A;  5JEA G;  2DN8 A;  5E3F A;  2OEO A;  1LAC A;  3Q24 A;  4IUU A;  3HG9 A;  2F0S A;  1J9O A;  2HCC A;  3I90 A;  3QG1 A;  2HUG A;  3VR4 A;  2R7Z B;  1RKN A;  2EYL A;  5I9O A;  1A15 A;  3RLF A;  1RD9 D;  1PDQ A;  1FNW A;  2J7Z A;  1SSO A;  5C44 B;  1LAB A;  1SYC A;  1SE3 A;  4R8I A;  4BY1 B;  2Y0S B;  4UAI A;  4FF2 A;  3K58 A;  2LFN A;  3TDQ A;  2R6G A;  2BA0 A;  2FMM A;  2PCF B;  3K5N A;  1HTP A;  2LKV A;  2Z4I A;  3SE0 A;  3J7Y W;  3OIQ A;  3KLS X;  3H09 A;  2C5C A;  3GV3 A;  1B53 A;  2FMC A;  1WTR A;  5K36 H;  2PZU A;  1I6H B;  2CHB D;  5EKI A;  4CKE A;  5JPN C;  1HQR D;  1SXT A;  5KNB A;  4H7B A;  1X32 A;  2L11 A;  1B44 D;  1J8I A;  3D4D A;  3VYR A;  2E2J B;  1R9T B;  1H9K A;  1GXD C;  2BDN A;  3GTL B;  2A69 C;  4RCN A;  3BDC A;  1JWM D;  2PYK A;  5CC4 A;  4Y7N B;  2K04 A;  5EBD A;  3WOF A;  3VR5 A;  2X6G A;  4K2K A;  2IPK D;  3P1H A;  4IZ8 A;  4DAY A;  3NXW A;  5CV5 A;  3QJY A;  1F9P A;  1TU2 B;  2F0T A;  4F7X A;  2EJG C;  2VUM B;  1KNA A;  1RCV D;  2JA7 B;  1NR2 A;  2F0D A;  3K5L A;  5C5L A;  5KRU A;  1R4P B;  2JYO A;  1UEA B;  3W2D A;  3URY A;  2E2H B;  3HRZ C;  3V96 A;  1DZ1 A;  5E4W C;  5COY A;  3V2T A;  2K7V A;  1SEB D;  2NVQ B;  1GHK A;  1KAA A;  5I2X A;  5M9O A;  3QO2 A;  4NDX A;  5KGU A;  3A8K E;  3VR3 A;  1EIG A;  1TWC B;  1SFO B;  5ELD A;  1B1Z A;  1PRT F;  3NUC A;  3FPU B;  2F0M A;  3A7L A;  3K6O A;  5C0X J;  4Z9C B;  3SXH A;  4XXE A;  1DOL A;  3HKZ B;  4EQP A;  3NTK A;  1M4V A;  3NP8 A;  3DM1 A;  4PMB A;  1CQV A;  5I6W A;  4RKB A;  1EU3 A;  3RUZ A;  1IHZ A;  1SNO A;  2NN6 G;  1JCK B;  3MXP A;  5K5P A;  1STB A;  3A55 A;  1SAP A;  1X3P A;  3BVM A;  5J39 A;  1LV9 A;  1STE A;  1RTO A;  1DXM A;  1M8A A;  1XTC D;  4BWG B;  1H9S B;  3FDT A;  3GQB A;  2L12 A;  2H1E A;  1G91 A;  1CZG A;  4K5V A;  1SJH D;  2PNR C;  1YNN D;  1BCP C;  1AW7 A;  2PW5 A;  3T56 B;  5JPM C;  3W3A A;  3HOY B;  4X3U A;  1WTO A;  1UAP A;  2NVT B;  3LWU A;  4QB4 A;  5EPJ A;  2IJ0 A;  1EEI D;  3NWT A;  3MEH A;  1MSH A;  2ZXR A;  2F0Q A;  5C6A A;  1SMY C;  3N52 A;  4HMI A;  1E0B A;  1ZYR C;  1BR9 A;  4L8J A;  3SDZ A;  1V1P B;  4P2C B;  3Q22 A;  3U9O A;  1LTA D;  3D4R A;  1B3A A;  1G29 1;  2NTS A;  4JBW A;  2R3Z A;  5KYI A;  4G4K A;  4C1N K;  3R93 A;  3KUP A;  1TVX A;  3SR1 A;  4ME5 A;  4DNR B;  4K8I A;  4KD3 A;  3I91 A;  5DM7 3;  2BCO A;  1ET9 A;  1EU4 A;  2ENB A;  2LMC B;  2B2T A;  4I7Z C;  4KTA A;  3M7G A;  2H4O A;  3D31 A;  4TSS A;  4DXF A;  1VF7 A;  3FKI B;  1PFB A;  1GUN A;  1IL8 A;  2L55 A;  3RMH A;  1D1K A;  1LO5 D;  1X3Q A;  4PV1 C;  1STN A;  1BO0 A;  3G7L A;  3DWP A;  2SNS A;  1DYQ A;  4A3K B;  2B2Y A;  3BS1 A;  2XRQ D;  2BA1 A;  4O1N A;  4G57 A;  3NQT A;  3KLR A;  4HSP A;  2K32 A;  1ENA A;  3MA2 B;  2A5H A;  2KEC A;  1EWC A;  4K8J A;  5G3L F;  3PUX A;  2K05 A;  1WTW A;  2RSN A;  3OIP A;  2N88 A;  4TRD A;  1TWA B;  2RDF A;  5C0X G;  2K28 A;  1ENC A;  1SJE D;  4L6T B;  3S15 B;  4BA1 I;  1Q12 A;  1S5C D;  3D8G A;  3PIO 3;  5M5X B;  2CW0 D;  1GHJ A;  5JEA H;  4A3F B;  1ZKO A;  5T1G A;  2K5W A;  3TP5 A;  4XQN A;  2KVM A;  3ERO A;  1NSN S;  3K5M A;  2TMP A;  4KY5 A;  3TP6 A;  3LWE A;  3OMC A;  2IX3 A;  1CZW A;  5FO9 B;  1DD2 A;  3S1R B;  4QCL A;  2A74 C;  3ND8 A;  2A68 D;  1C48 A;  2JA8 B;  4K5X A;  3MAQ A;  3P7J A;  5ELE A;  1LTI D;  1PTO H;  2VNU D;  1STH A;  2B2U A;  1PZJ D;  1I4H A;  3D4W A;  3L3O C;  2F1M A;  2CVR A;  4ZUJ A;  3MWY W;  4RHS A;  1TKW B;  4IFD J;  2B2V A;  4A3I B;  4FYD A;  1QNU A;  3HOX B;  1FGB D;  2HDM A;  3IKJ A;  1JOK A;  4MHE A;  3FEW X;  3NQI A;  3Q23 A;  2SEB D;  3EQL C;  1CHP D;  4QMG A;  3O13 A;  1BDO A;  2F0F A;  1MSG A;  2EYO A;  2O4X A;  1S5F D;  1AP0 A;  4C1N I;  4DN4 M;  5IOD A;  1L0Y B;  2B2Y C;  4BBS B;  5KND A;  2OF1 A;  1RF2 D;  4FXG C;  1Q8I A;  1PTO C;  2R92 B;  2BOS A;  3GO5 A;  3G6J B;  3U9S A;  1MBY A;  1H9R A;  4A3M B;  3H0G B;  2M9V A;  4XIG S;  5C4H A;  5IGG A;  1W6J A;  3I70 A;  2F0K A;  3K0Y A;  3SK8 A;  2F3W A;  4YIJ A;  2E74 C;  4FF3 A;  1QOH A;  1TS5 A;  1BCP F;  4ZKB B;  2A6H D;  5C3W A;  1E2W A;  5BN5 A;  2NBF A;  1WTX A;  1BUV T;  2L0C A;  2CQA A;  4RH6 A;  1CQF A;  2MGS A;  4OHJ A;  2F3V A;  1QNK A;  4K6D A;  1Z6H A;  3PMF A;  4HMJ A;  4XQJ A;  3BZD B;  3HOU B;  5IGC A;  2QIL A;  2D9U A;  1LTT D;  4LMQ D;  1QJO A;  4FNF A;  1Y1V B;  4KD4 A;  5EKL A;  5BN4 A;  3A8I E;  3KBG A;  2XNA C;  1C4Q A;  2ZXP A;  4U67 3;  1L0X B;  2F0U A;  1WCM B;  2WB1 B;  3L7Z C;  2SOB A;  1KDC A;  1EZ8 A;  4ZQ3 A;  2NN6 H;  1BBX C;  3MXN A;  3EA6 A;  1MD2 D;  4TQU S;  5A2Q L;  2B2V C;  1QG7 A;  2DY7 A;  3MC0 B;  1TS2 A;  1SBB B;  3NWS A;  3AU7 A;  1U4R A;  1UNS A;  3C46 A;  2OT2 A;  4RCO A;  5C5M A;  2XRS D;  3T4A C;  2E2D C;  4C3H B;  4KV6 A;  1LT5 D;  4BBR B;  1Y1W B;  1YNJ C;  5C4Z A;  3CRL C;  5DNF A;  3H6M A;  1FD7 D;  4IUQ A;  1Q1B A;  4DA2 A;  2NWG A;  1BXT A;  3DMU A;  5IT9 E;  1NAP A;  1I50 B;  1U4L A;  3H94 A;  4IN3 A;  1SYF A;  5JAV A;  4ZAI A;  1EIH A;  1STY A;  2EZV A;  2NUC A;  4IFD G;  2KHS A;  1U4M A;  3NHH A;  4KKU A;  1QCB D;  4CHT B;  3CU7 A;  2B2W A;  3OWE B;  4KK7 A;  4C3J B;  3D3R A;  2E75 C;  1Y69 U;  4WJW A;  4IUR A;  5C4X B;  1IW7 C;  2EYP A;  4I65 A;  1HTL D;  5E4X A;  4IQZ A;  3EJI A;  3T53 B;  4DAV A;  5EBC A;  1JWS D;  2BE5 C;  1K8O A;  1F9S A;  2K5D A;  2KEE A;  2F0O A;  5TSS A;  5T1I A;  1WD1 A;  2RA4 A;  2RDH A;  5ISR A;  4A3B B;  1JOR A;  3K59 A;  3AB9 A;  1EYA A;  1D6E C;  4L63 B;  1LTG D;  3MXU A;  2EJF C;  2IT1 A;  4EQN A;  1SYD A;  5EPK A;  3CRK C;  5IT9 L;  3IFT A;  1U9R A;  5D65 A;  2F0J A;  4C3I B;  4FF4 A;  1CFM A;  1FNV A;  1PYW D;  3E0J A;  3HP3 A;  4FP5 D;  4F88 A;  4FO2 A;  4ID6 A;  4RA8 A;  1O7Z A;  4QUF A;  5F2D A;  1GUS A;  1BCP B;  1H9S A;  3FVQ A;  4EGV A;  2J4X A;  3R2I A;  1EY8 A;  1SYG A;  3RD4 A;  4G7O C;  5ELF A;  4R8N A;  3PUZ A;  5DEH A;  2IX1 A;  5KYL A;  3S1N B;  1WTV A;  2GA4 B;  2I07 B;  2Q8R E;  5CYU A;  2EE1 A;  2AQ3 B;  3I4M B;  3FMC A;  3MFY A;  1ROD A;  1KAB A;  3A7A B;  4RKL A;  2F03 A;  2JEB I;  3DWA A;  1PTO F;  2A6E D;  1H9J A;  1ILP A;  4CKC A;  3C2P A;  4H13 C;  5M5W B;  2F0W A;  1ML0 D;  1F77 A;  3GP7 A;  1A2T A;  2Z1C A;  1PRT D;  4CGY B;  5FOB B;  1EY0 A;  1SNQ A;  1EYC A;  1V1P A;  4F8M A;  2EYM A;  1NR4 A;  3FPP A;  5M3M B;  4BS9 A;  1TWF B;  1AEX A;  2YU9 B;  1EZ6 A;  5LL6 X;  3TME A;  2B2W C;  1SNP A;  1JOQ A;  2WAQ B;  3SHL A;  3I72 A;  2K01 A;  4LK1 C;  2ID0 A;  3HZX A;  3UI2 A;  2Q8T A;  2E2I B;  2ZT9 C;  4ZRZ A;  1VF5 C;  4S3S A;  2B8F A;  2L5T A;  1PMR A;  2EOT A;  1LTS D;  1SYB A;  1Q3L A;  5CGK A;  1HFG A;  2MP1 A;  4XT1 B;  2F0V A;  4WOR A;  2KA7 A;  2RKS A;  5E1F A;  4V19 0;  2ICE C;  5JJZ A;  1JB3 A;  1OXT A;  3Q0A A;  1G2T A;  3HOV B;  1GUT A;  2TSS A;  3S17 B;  3C1E A;  1EY6 A;  5IGF A;  4R9W A;  4PQX A;  3TZD A;  1TWG B;  1STA A;  2JA5 B;  3OSO A;  1O80 A;  5IIF A;  1IKL A;  1S5E D;  3SVM A;  4RGN A;  3OMG A;  5I6Y A;  1TII D;  3S1M B;  3PUW A;  3IAY A;  4QF4 A;  4HN7 A;  4DAP A;  1O7Y A;  1U4P A;  5CBE E;  2LS0 1;  3A56 A;  2K03 A;  1OXV A;  3OWF A;  4B08 A;  3EFX D;  3R3O A;  1Y8N B;  4B9W A;  3HEJ A;  1SE2 A;  1KDB A;  4XYQ A;  5KEE A;  2XWB B;  2A73 B;  3TSS A;  2JXM B;  4XDX A;  1ZEQ X;  1A6X A;  3M4O B;  2E76 C;  1A3U A;  3ND9 A;  1PRT B;  4OIK A;  4FF1 A;  5HUR A;  2JSO A;  1I6V C;  2Z4H A;  3R8B A;  1D2B A;  2NTT A;  3J80 E;  2FHT A;  4PNY A;  3VYT A;  4Q0F A;  3FRP B;  4J6H A;  1FR3 A;  5JEA J;  5C3E B;  3SEB A;  1GUW A;  1QB5 D;  4DK0 A;  3MTS A;  4XTC S;  5COR A;  3HOZ B;  4HAE A;  2WKC A;  1HA6 A;  2IX0 A;  4KMU C;  5A35 A;  4EQO A;  1BOS A;  4A3D B;  2KJX A;  1D5Z C;  2C9O A;  4RAU C;  3MVV A;  5EPL A;  1OXX K;  4PMC A;  1B9N A;  1EY4 A;  1I3Q B;  3RZD B;  2F0P A;  5G3L D;  1PTO B;  3KK7 A;  5I9P A;  3T13 A;  3PUV A;  3HS0 C;  4X3T A;  2O5I C;  1SE4 A;  1JQY D;  1V8Q A;  1PFM A;  3D6C A;  3F2U A;  2A69 D;  1ONL A;  5AFW A;  1W6K A;  2EY2 A;  1I4Q A;  4DXG A;  2J0T D;  1V43 A;  1K8M A;  1H9M A;  1WD0 A;  2EY1 A;  3GD7 A;  1F2Z A;  3L9A X;  3J80 L;  2F0N A;  4FXK C;  5FKA C;  3GTK B;  1DJR D;  2B2T C;  4KY6 A;  1HRJ A;  4DK1 A;  3I8Z A;  2F4I A;  3WDN A;  1ICW A;  2KUM A;  1EY9 A;  4U68 A;  5M3F B;  4BA2 I;  1D1I A;  2EY6 A;  3P75 A;  4IFD H;  2Q8I B;  1B9M A;  2EDG A;  1AN8 A;  1CK1 A;  4IUN A;  2RSO A;  2VB2 X;  2WKD A;  3TN2 A;  1YNN C;  4DGZ A;  2M00 A;  5FK9 C;  3QOJ A;  1OO9 B;  4PMW A;  1LT6 D;  5CV8 A;  1QE6 A;  4ZK9 B;  2PZT A;  2F0E A;  2QF7 A;  4N9T A;  2WII B;  4A3G B;  2MHV A;  3NPP A;  4GZY C;  4KKS A;  5J22 A;  2EYH A;  2XSC A;  4KJN A;  2G9D A;  2VXW A;  1GUO A;  1R4Q B;  3NBH A;  3IL8 A;  2EXZ A;  3I4L A;  1SDF A;  1JOO A;  1XYI A;  1F2M A;  2PPB C;  2NYZ D;  1XX8 A;  1UUP A;  1HPC A;  2NN6 I;  4F87 A;  1KDA A;  4LJZ C;  3J7A F;  1D5M C;  3R2T A;  3DHQ A;  4FXD A;  1JIC A;  3C1F A;  2IL8 A;  2O5J C;  1AZQ A;  3GTJ B;  1JR0 D;  1CT1 D;  3I73 A;  2X69 A;  5DAU A;  3I4N B;  4C2M B;  1EQT A;  1ILQ A;  4ABN A;  1IKM A;  1CA5 A;  1G6Z A;  3PO2 B;  1CM9 A;  1GOZ A;  3S9W A;  2B2U C;  4CJ0 B;  2V4D A;  2QEJ C;  4NKL A;  2ZXO A;  4Q5V A;  3Q6S A;  1BCP D;  2D62 A;  3GTG B;  4KN7 C;  2MJ8 A;  2MPM A;  2OXP A;  2AWN A;  1PFN A;  1A3V A;  2EPB A;  2EYJ A;  4J1M A;  2XVS A;  1XXG A;  1ZXT A;  2KQ3 A;  1SMY D;  1HCZ A;  1ZYR D;  3J81 E;  5J1Z A;  4A3J B;  1RTN A;  1OXU A;  2L4N A;  1DM0 B;  2R61 A;  5CV9 A;  2CW0 C;  1GUG A;  4NMZ A;  4ODG A;  3PO3 B;  1DCZ A;  2DY8 A;  3VYU A;  1TS3 A;  1TR5 A;  5HGT A;  5CV4 A;  3BVZ A;  2XN9 C;  4RFB A;  2JA6 B;  1A2U A;  3SK6 A;  4G7Z C;  4HR7 B;  4K5W A;  1V1O A;  4H0L C;  1JWU D;  2A68 C;  1STG A;  2AUK A;  1KNE A;  2VB3 X;  1HXY D;  1AFP A;  1ESR A;  1PXU A;  2NZ1 D;  3VR6 A;  3OHX C;  1HFN A;  1TS4 A;  5M5Y B;  1WVL A;  2R93 B;  2M2L A;  1HHV A;  1EYD A;  3J81 L;  4OO1 G;  1KLG D;  3A54 A;  4AYB B;  4ILW A;  1CHQ D;  2EYF A;  4K6L A;  2F0G A;  1DON A;  1BQQ T;  2ICI A;  1B2T A;  5C3X A;  3TBI B;  3BDO A;  1EY7 A;  1F9R A;  1BF4 A;  3VYS A;  3CQZ B;  4HTH A;  4B9X A;  1TY2 A;  1RHP A;  2QKI C;  3ZYY X;  4MIU A;  3IFD A;  3D6W A;  1G8Z D;  5C0X I;  1VMC A;  4ZKC B;  1VDZ A;  3H91 A;  4NP5 A;  2F0H A;  3C3L A;  3NSW A;  3LX0 A;  3GV6 A;  1HUM A;  1D5X C;  3N6R A;  4CBV A;  1PZI D;  3DXJ C;  1EEF D;  4M8A A;  1I4G A;  2D2C C;  4ZUI A;  4K14 A;  2WV6 D;  2DNC A;  1FYC A;  2QCP X;  3BYT B;  3QIA A;  3M7N A;  1EY5 A;  3BVG A;  2F0L A;  1GJX A;  1IYU A;  3LNN A;  2QDB A;  2B8G A;  1EWH A;  2FFK B;  1I4X A;  3DWQ A;  4XT3 B;  2PO4 A;  5FO8 B;  5C0X H;  3NE5 B;  1A3T A;  1HUN A;  3M4Y A;  3DUZ A;  2A6H C;  3MFG A;  3E6Z X;  3JAM E;  3S14 B;  4C56 C;  4KHZ A;  1E2Z A;  1FNU A;  4ZYS A;  3QOL A;  1K83 B;  1T5X D;  2SDF A;  3CKI B;  2K33 A;  3TZU A;  3RZO B;  2HQE A;  4G7H C;  1I4R A;  2IWH A;  4IUP A;  3VA7 A;  2JEA I;  3X3M A;  2JE6 I;  4RHR A;  3VR2 A;  4CKB A;  4KI0 A;  1OXS C;  2AQ2 B;  3KF8 A;  1JC7 A;  1II3 A;  1F9Q A;  2B39 A;  3H3V C;  4MN3 A;  1Y8O B;  3S2D B;  3ONA B;  4ZLT F;  1VMP A;  3T16 A;  3EVQ A;  2EJM A;  3I3C A;  3V05 A;  2K1B A;  4C3H G;  5KNC A;  2N55 A;  3QB3 A;  4JK1 C;  5EJW A;  4NW2 A;  1PTO D;  4KN4 C;  2X6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...