2PI2A

Full-length replication protein a subunits rpa14 and rpa32
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
136
structure length
129
Chain Sequence
ARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDNTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication, dna binding protein
molecule keywords Replication protein A 32 kDa subunit
publication title Structure of the Full-length Human RPA14/32 Complex Gives Insights into the Mechanism of DNA Binding and Complex Formation.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 129
sequence length 136
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08784 RPA_C Replication protein A C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2pi2A00
1FJGQ 4GS3A 2JA5H 1HJPA 4BBRH 1PHJA 3EBEA 4JI2L 1WCMH 1UWVA 1HZAA 4YCVA 4DR2L 1A62A 3HOWG 2R93G 4H02A 4GOPC 1VS0A 2VQFQ 4DAYB 4K0KL 2YYZA 1OXTA 2OTJA 1EFWA 1GVPA 2K75A 1Y1WG 3CC2A 1JB7A 2Q2HA 5C4XG 1LUZA 4LFBQ 5J3BA 2H5XA 2KENA 4C3HH 4B3TL 4JI1L 5FJ8H 4KHZA 5IYCH 3CCQA 4GN3B 1VQDA 2KCMA 4DAMA 4LF9L 1WOCA 4AYBG 3CQZH 3CCRA 4DV1Q 4YWMA 4DV0L 1JJCB 2R7ZH 3K7AH 3RZDH 1SROA 3M85A 2JQOA 1MJEA 1Y1VG 4EX5A 4J15A 3I4MH 2KCTA 1E7ZA 1NMFA 3S2HH 5C44H 4JBKA 1N36L 4JBMA 2KHJA 3J7A5 2NVXH 4HJ7A 2ATWA 3ICEA 2RCNA 3CMAA 4LF7L 3ZJYC 1QUQA 1S40A 1VQ4A 4LFCQ 1A0IA 4JOIC 2UUAQ 1X9NA 4A4IA 1QVFA 3U58A 3F1ZA 2UXBL 1K8GA 4LFAQ 2B3GA 3HFZB 2L15A 5AJ3Q 5GROA 4KHPL 4GLAC 3CCJA 2LXJA 4IFDI 4QY7A 4BA1I 1DGSA 2VY3A 4NXNL 5E7NA 2E5LL 2D62A 1B7YB 2YTVA 3S15H 2VQEQ 4DV7L 4JI5Q 2K52A 4QGUA 1YJNA 1YITA 3FP9A 3H0GG 1YJ9A 4QL5A 2WB1G 3NENA 4P72A 4AQYQ 3PIOA 1P8LA 2E5LQ 4A3BG 4OWTB 1PA6A 1Q8KA 4UP7A 2PNHA 3HOUG 1E24A 4GNXA 2OWOA 1LM0A 3I4OA 3I7FA 4A3KH 4BA2I 1EUJA 3CPWA 1Q46A 3KOJA 3J81j 2JA9A 5C0XI 4DR5L 1PFSA 3NELA 1N34L 4DR4Q 3CCSA 3J7ZC 3I4NH 3AFQA 2N49A 1VQEA 3OYYA 4GN4B 1P16A 2R6GA 4DR3Q 2IHEA 4HJ5A 2ES2A 3TQYA 4OO1G 4B3MQ 3J81c 3HOVH 1X54A 1W2BA 2ZTCA 1WYDA 4DPGA 1EIYB 1Z9FA 3Q8DA 2F3IA 3UDFA 3JAMi 4BY7H 2F4VQ 5BR8Q 5FLMG 2D0PA 4TVAB 1Q12A 2JA6H 1HR0Q 2XTIA 2Z6KA 2CQOA 1X3EA 1HR0W 4YHHQ 2UUCL 1GO3E 1SFOH 4JI3Q 4LF8L 1J5EL 1PH5A 3HOZG 3S1NH 2WAQG 4B3SL 2N8NA 3STBD 2QGQA 1TWGH 2HHHQ 2UUCQ 4IPDA 1X55A 3KF8B 1KC8C 2Q2UA 2VUMG 4X6AH 1CSPA 2B29A 1TWFH 3CF5A 4BXXG 4X66Q 4BBSG 5JJLA 2PI2A 4A3FH 5M5XH 4DV2L 3PF5A 1IYJB 4A3DH 1HNXL 5GAHC 4AH6A 1XMOL 1TWCH 3M4QA 2NZOA 1V9PA 1VQKA 3FHWA 3VDYA 4DR1L 1L1OA 1X3GA 2ZM6L 1HZ9A 3S1RH 5C4JH 2IY5B 1S72A 1IBKQ 4OX9L 3S1MH 4JYAL 4DV4Q 4IO9A 1JJ2A 3U50C 2Q2IA 4XTCS 3GTQH 4HIOA 2UUBQ 3AEVA 4A3CH 4X65L 4LF4Q 1GKHA 4DUZL 1SMXA 4DK3C 3SGIA 4GKKL 4YWLA 1IBLQ 1ASZA 1ASYA 2ZJQA 1I6HH 2I0QA 3HKZG 1E1OA 5GAEC 1NTGA 2E2HH 2JEBI 2CKZB 4UP8A 1KXLA 3PCOB 3STBC 5IYBH 3HOXG 1N32Q 1K0RA 1PYBA 4NXMQ 1XNRQ 4LUZA 1VQOA 4O2DA 1FJGL 3GTGH 1SN8A 5C3EH 2K14A 1EOVA 2K5HA 4JC0A 1SLJA 3CC7A 4POGA 1Q1EA 3RN2A 4X64Q 1L2FA 1K3RA 1VQAA 1YJWA 1HNWQ 1YHQA 2VQFL 1HH2P 3W5OA 1QUQB 1YEZA 3PV0A 4DNIA 1AH9A 1SE8A 3PUVA 4R4QA 1XMQQ 1D7QA 3KDFB 4IOCA 2ID0A 3PO2H 1VQNA 2C35B 4LFBL 2YU9H 3M4OH 1JT8A 4X62L 4LWCA 1Y14B 1PYSB 2VS1A 3BU2A 3PUZA 2JA8H 4A93H 4L5QA 4LF6Q 4HJAA 3HOYG 2MNAA 3GTLH 4DV1L 3E9HA 4A3EH 4A3MH 1Q81C 4GOPA 4X62Q 4IJHA 1VQ6A 1NMGA 2BA1A 2EXDA 2MFIA 2R7DA 4ME3A 5GAGC 3OTOQ 2AKWB 3T1HQ 4DV3Q 5JEAG 3CMEA 1YI2A 1PH9A 3F8TA 1BVSA 4LUOA 3BJUA 1BBWA 4DUYQ 1KRSA 2HIVA 4GNXB 4NB3A 1U0LA 1N33Q 1EWIA 2Y0SE 4LFCL 5IP7H 2UUAL 2JA7G 1BBUA 4ALPA 3KLWA 3PO3G 3L7ZC 4P75A 4LFAL 4UY8C 2MO0A 1OXVA 1W3SA 5AJ3L 1QVCA 3J80i 3H15A 5IYDH 1QZHA 3KDFA 2PQAA 3WWVA 5M3FH 4PG3A 1CSQA 5DLQE 1JE5A 1E1TA 3A74A 4OWXB 3F2CA 1QVGA 2VQEL 4JI5L 2N3SA 2IX0A 5IYDG 4AQYL 5HY6A 3AYHB 3GO5A 4KI0A 4JOIA 1NY4A 1VQ5A 1IL2A 4JI0Q 4A3JG 1UE5A 1K8AC 2JA5G 4BBRG 5IP9H 1HZBA 2VW9A 1WCMG 3M9BA 3W1BA 3CPFA 3UDXA 2ALYB 2KHIA 3CCLA 1TWHH 4DR4L 3B6YA 4A3IH 1EYGA 4DR3L 1XJVA 1U5KA 3GTMH 4P74A 4B3ML 1L0WA 2A19A 2ASBA 5LMUQ 4OXPA 3JAMc 1YZ6A 4PZ7A 1JMCA 1L1OB 3M7NA 1J6QA 3ULLA 3AQQA 5FJ8G 4GKJQ 5IYCG 2HQLA 2F4VL 4OONA 4YWKA 5BR8L 1S3OA 1HR0L 1IBMQ 4EQ5A 2R7ZG 3RLOA 3EIVA 4YHHL 4JI3L 1NBWA 3I4MG 1YNXA 3CCEA 3M3YH 1GM5A 4Y52H 4Y7NH 5C44G 4WJ3M 3GDEA 4YCWA 2HHHL 4JI7Q 4HJ8A 1AE3A 4HIDA 4DV5Q 2EIFA 1RIPA 4JV5L 3IRBA 2HT1A 4A3LH 4X66L 1UE6A 2GN5A 1CKOA 2RF4A 3EN2A 4QJFA 1X6OA 5IE8A 1NE3A 1VQIA 4LNQA 1XPUA 4BY1H 3PUWA 3RZOH 2B63H 5GADC 3BZCA 1M90C 3S1QH 4JV5Q 5LMNQ 5LMNW 4DR7Q 1IBKL 5M3MH 3FKIH 4R4OA 4DV4L 2BH2A 4A3GH 1UEBA 2R92H 3CD6A 2A1AA 1CKNB 3JC66 1KHIA 2UUBL 4LF4L 1I5FA 3T1YQ 1EQRA 1N9WA 3S24A 3G4SA 2RHQB 1IBLL 1PH7A 3HOWH 4A3JH 3DM3A 3KJOA 1XPOA 2Z0SA 4P71A 2F52A 5FLXc 2R93H 3RNUA 4JI6Q 2UXCQ 4A3KG 3PF4A 3ULJA 2N78A 1PH1A 4IFDJ 5EAYA 1PV4A 4TQUS 1Y1WH 1OTCA 1BKBA 1N32L 4C3IH 4DR6Q 4GOPB 1IZ6A 3HKSA 3I4NG 5C4XH 4NXML 1XNRL 2I5HA 2YTXA 4XIGS 1FGUA 2NVYH 4L5SA 3HOVG 3K81C 1CKMA 1VQBA 3HKZE 3M4PA 4X64L 3DLLA 4A76A 3I56A 1V43A 4UP9A 2E2IH 5GQOA 1HNWL 4POFA 3I55A 3CAMA 1PH8A 4IPCA 1PH3A 4APVA 4BY7G 1KQSA 4QQBX 1E22A 2Q2TA 3RLNA 1XNQQ 1Y1VH 2GVAA 4MNOA 2DUDA 1KRTA 2MQHA 3K0XA 5C0XJ 1XMQL 1D8LA 1HNZQ 4JBJA 3UDGA 1CKNA 2AWOA 2A8VA 1O7IA 4JI4Q 1H95A 1TWAH 1VQ7A 1B8AA 1GD7A 2BH8A 3UE1A 2PQAB 4LUVA 4LF6L 4AYBE 2WP8J 4JI8Q 1MIUA 1A63A 4GLVB 2D0OA 3E0EA 2AHOB 3TREA 2K5VA 3OTOL 4WJ4A 4A3FG 3T1HL 4DV3L 4A3DG 1M1KC 4RMFA 4MZ9A 3TEHB 2PMZE 1NJIC 2QA4A 2MO1A 4DUYL 4OWWB 1VQGA 2UU9Q 2CWPA 1JJGA 2OTLA 3MEFA 5IWAQ 1TXYA 1YHBA 3H0GH 1N33L 1FL0A 1VQHA 2OQKA 3K7UC 4A3BH 1WJJA 3H3VH 3J80c 2DGYA 2VNUD 1Q1BA 4LW1A 4JCVE 3F2DA 2JJQA 4C3JH 4UPAA 3RN5A 3HOUH 4A3CG 3UDIA 3BZKA 3ER0A 1I94L 4FDBA 4JI2Q 1HZCA 2IT1A 2ZTDA 3LGJA 4GN5A 4DR2Q 1IXRA 3ERSX 4R1JA 3A0JA 4RG1A 1I94Q 1YBYA 1LTLA 3KFUA 1AE2A 4K0KQ 1PVOA 5IYBG 2LXKA 1XTDA 3A5ZB 1VQFA 1MKHA 2BA0A 3CCVA 3TS0A 4R4IA 3PUYA 5ELOA 4JI0L 2VZAA 2Y0SG 2HIXA 5C3EG 2K50A 4B3TQ 4JI1Q 5JJIA 1B70B 4LF9Q 1KIXA 2FXQA 4L5TA 5FLMH 2WFWA 3CC4A 3CCMA 4DV0Q 3U4VA 1QZGA 4P73A 1VQ8A 1Z47A 4HJ9A 2CCZA 3G48A 1EIFA 5M5YH 4A75A 3HOZH 4DV6L 2JA6G 2UXDL 1KL9A 3PO2G 4B3RL 1VQJA 2ZJRA 5LMUL 1N36Q 2WB1E 1OXUA 2VUMH 4JG2A 4DV6Q 4GKJL 2JK8A 1CUKA 2I5LX 4MTNA 4LF7Q 2JA8G 4BXXH 4B3RQ 4BBSH 4YCUA 1YHAA 4A93G 4A3EG 4A3MG 1IBML 4PZ6A 3KF6B 1X56A 3KJPA 2K4KA 4PZ8A 2UXBQ 2I5MX 1UE7A 4GLXA 4KHPQ 4GNXC 2AWNA 1Q86C 4AIMA 2UXDQ 3CXCA 4JI7L 4NXNQ 1SRUA 2E2JH 4DV5L 3RR5A 3G6EA 3D0FA 3G71A 4DV7Q 3S16H 4NPSA 1I50H 2OCEA 1G6PA 1VCIA 2JE6I 2NZHA 5IP7G 4KLKA 1PH2A 1WFQA 1N8RC 2NN6G 2QEXA 4PMWA 1X65A 3CCUA 2ZJPA 1T9HA 5LMNL 4R4TA 2E8GA 4HIMA 4DR7L 5IT9c 5M3FG 2JEAI 1G51A 3L0OA 4DR5Q 3HOXH 2WAQE 2Z6KC 1N34Q 3E9IA 1FVIA 3W1GA 1YIJA 1K9MC 1A8VA 2OQ0A 1VQMA 3T1YL 4O0AA 1V1QA 2VL6A 3KF6A 1E3PA 3CP0A 3K8AA 3NEMA 1KAWA 2NVQH 4YY3L 3GD7A 3J81i 4JI6L 4LF5L 4HIKA 2UXCL 5IP9G 1PH4A 2GVBA 4IPHA 2CWAA 3I2ZA 5ELNA 2KBNA 3NBHB 1PH6A 4DR6L 1WI5A 2PI2E 2EQSA 4YY3Q 5M5WH 1UE1A 4A3IG 4LF5Q 1X3FA 3PUXA 4LF8Q 1L1OC 5HGQA 1J5EQ 1MJCA 4C2MH 3A5UA 4B3SQ 2CFMA 1RL2A 1C9OA 1VQCA 3AFPA 3CW2C 3ULPA 1EQQA 1VQLA 3HOYH 4IJLA 3PGZA 1C7YA 2NVTH 4QIWE 1G291 4R4CA 1SR3A 1XNQL 4DV2Q 3L2PA 1HNZL 3S14H 1HNXQ 4DK6C 1XMOQ 3KYHC 1YVCA 2R7FA 1XPRA 3K80C 4DR1Q 3PSIA 1KD1C 2IX1A 2RHSB 3PIPA 2ZM6Q 4JI4L 2LSSA 1K83H 5H1SE 3UE0A 3MXNB 2YV5A 4OX9Q 3GTOH 4JYAQ 4L5RC 2JA7H 4JI8L 1VQPA 1VQ9A 4IFDG 5IY0A 3PO3H 4A3LG 2XGTA 1R9TH 3GTPH 4X65Q 5JJKA 1OXXK 4DUZQ 3U4ZA 1Q7YC 1C0AA 4BY1G 2B63G 4IOAA 3H3VI 4GKKQ 2IHFA 2AMCB 1OXSC 3GTKH 4DKAC 2UU9L 3OW2A 5IWAL 2K5NA 1I3QH 2V1CC 1K73C 5K36G 2NN6I 4IPGA 5M3MG 3F2BA 3S17H 3FKIG 3TS2A 4A3GG 3GTJH 3D31A 3RLFA 1Q82C 2R92G 3S2DH 2YTYA 4JBWA 3TRZA 5C0XG 2ZTEA 5JEAJ 1LYLA 4OO1I
chains in the Genus database with same CATH superfamily
1FJGQ 1K3BC 4ZLTF 1HXYD 1KNEA 1PTOD 4FNFA 1K0SA 4A3EB 1WCMH 2L4NA 1HZAA 4DR2L 4GOPC 1VS0A 4X3TA 4K0KL 2K33A 4CDEC 1B3QA 2WB1B 4XQJA 2WV6D 5KYLA 1LUZA 4J6HA 3TP5A 2KENA 4B3TL 4LF9L 5I9OA 1WOCA 2CW0C 4MHEA 3CCRA 2F3WA 4DV0L 5COYA 1VF5C 3K7AH 3PIP3 1SROA 3M85A 4K6DA 3I4MH 1E7ZA 5C44H 1N36L 2O2LD 2RCNA 4LK1C 1O7YA 4KJOA 1VQ4A 2UUAQ 3LWEA 2EJGC 2AUJD 1K8GA 4LFAQ 3HFZB 1B1ZA 3CCJA 5IGDA 2O5JC 1Z7TA 4Q0FA 4TKOB 4NXNL 2D62A 1B7YB 1PZKD 5DEHA 2VQEQ 4DV7L 4JI5Q 3FP9A 4QL5A 3GTMB 2WB1G 3DEOA 1QG7A 5EJWA 2IWHA 3AU7A 1Q8KA 4DK1A 2OWOA 5IIFA 4XT3B 4BA2I 1EUJA 3CPWA 1GOZA 4DR5L 5C0XI 5DNFA 2KJXA 3NELA 4DR4Q 1B50A 3J7ZC 1I4RA 3I4NH 3AFQA 1G6ZA 2HD3A 4DR3Q 1SYGA 5CV4A 4K2KA 4B3MQ 3HOVH 1X54A 3NE5B 4DPGA 4G4KA 1Z9FA 3IL8A 3UDFA 2ENBA 1EY8A 2D0PA 4H44C 2XTIA 4KY5A 3S1QB 5JJZA 1X3EA 1GO3E 4C1NK 5LL6X 2F0TA 3S1NH 4B9XA 5M3MB 1STGA 3STBD 4KHVA 3VYSA 3TZDA 2UUCQ 1PRTF 1RODA 1GHKA 4V190 1CSPA 3W2DA 4X66Q 1KLUD 5M5XH 3PF5A 5KRUA 4TSSA 1SJED 4ID6A 1EY4A 4DR1L 5I6WA 5C4JH 2IY5B 4TRDA 3U9SA 1S5DD 5EKLA 3SVMA 4DV4Q 5C4XB 3KBGA 1I4XA 4HIOA 3BYYB 3AEVA 4X65L 3R2IA 1GKHA 3Q0AA 4GKKL 1ASYA 4NKLA 2PO4A 2RCFA 1ML0D 2K5DA 3BYTB 1GUOA 3SK6A 4ZRZA 2F03A 1JORA 1PZID 1VQOA 3GTGH 5KNCA 1AFPA 3CC7A 2K5HA 2A6HD 4V0BA 3W5OA 1EWCA 1Z6HA 1YEZA 1I3QB 4RH6A 1XMQQ 3KDFB 3S2DB 5ISRA 1VQNA 4NMZA 2ZT9C 2YU9H 2LY7A 1SE2A 2J7ZA 4X62L 4A3JB 2VS1A 2K5WA 2JA8H 2PCFB 4A93H 2JA5B 4HJAA 2MNAA 2XSCA 5CC4A 1RD9D 4KN7C 3A55A 4C3JB 1NMGA 5KIXA 3CMEA 1NCVA 1PH9A 3F8TA 3EFXD 1RTOA 1GUNA 1BBWA 3BJUA 1KRSA 1LTGD 4C3HB 1FGBD 3T13A 2F1MA 1EWIA 4HTHA 5IP7H 1BBUA 4ALPA 4ZAIA 2NN6H 4DXGA 1SYEA 1HPCA 4UY8C 2K32A 1QVCA 3J80i 3I73A 4PG3A 3FRPB 3M7GA 2NVXB 2N3SA 1C8CA 2IX0A 1U4RA 3MAQA 3QWNA 4FP5D 1HA5A 3V05A 5IYDG 4KY7A 3AYHB 1VQ5A 3MFGA 1PLFA 1PRTD 2KA7A 2XIWA 1UAPA 4JOIA 4KKUA 1EEFD 1JWUD 4F8MA 4A3JG 3GP7A 3CKIB 2JA5G 4DU9A 2HCCA 5CMDA 3W1BA 3UDXA 1ILPA 4DF7A 3B6YA 3H09A 5C4HA 2ASBA 4MTKA 1S5CD 3BG3A 3DWAA 3M7NA 3CRKC 4C3HG 4DK0A 3U9OA 5IYCG 5BR8L 1J9OA 4QIWB 4RCOA 1ILQA 2MGSA 2R7ZG 4C1NI 2BCOA 4EQPA 1GM5A 3T53B 4Y7NH 4Q5VA 1LTBD 1FNUA 1RIPA 3A7LA 3IRBA 3I91A 4BY7B 3EN2A 2FMCA 1X6OA 4KY6A 3RZOH 1WTHA 3BVMA 5LMNQ 3NWSA 5LMNW 1STNA 1IBKL 3FKIH 4LJZC 5M5WB 4A3GH 1UEBA 3MVVA 2UUBL 1VF7A 2B2WA 5ELEA 1EQRA 1HTLD 4NW2A 3SK8A 2RHQB 4N9TA 4A3DB 3W3AA 1IBLL 1PH7A 1TWCB 3HOWH 3DM3A 2R93H 2Z0SA 2D5DA 4P71A 5FLXc 2K6AA 2UXCQ 3PF4A 2N78A 2DY8A 2XRSD 3HP3A 5EAYA 4FF1A 1N32L 3QG1A 3D6CA 4C3IH 4NXML 1FGUA 4IUPA 4L5SA 1ENAA 1SEBD 1VQBA 3MXPA 4UP9A 2E2IH 5GQOA 4QQBX 1PH8A 4BY7G 2EY5A 3N52A 2Z9HA 1F2MA 1ZEQX 5IODA 1HNZQ 2JA6G 2MQHA 5KEEA 5C0XJ 1D8LA 2F0DA 5DAUA 1CKNA 3VYTA 1O7IA 2B39A 1TWAH 1VQ7A 3S17B 2BH8A 3UE1A 4LF6L 4LUVA 3GTJB 4AYBE 1B3AA 5BN4A 3D3RA 2QW7A 2XVSA 4GLVB 4FO2A 2AHOB 1PTOB 4BBRB 5IGGA 4DV3L 3T1HL 4A3DG 1H9MA 4MZ9A 4RMFA 1U4MA 1NJIC 4IUUA 2MO1A 2UU9Q 2KQ3A 2I46A 3MEFA 4RHSA 3KLRA 2F0SA 1YHBA 1N33L 1TKWB 1VQHA 4MIUA 2OQKA 3GTLB 1E2WA 4A3BH 2L0CA 3J80c 1WD0A 3A54A 2JJQA 2CH4A 3OHXC 3HOUH 5KGUA 3CQZB 1HZCA 4DR2Q 1NNXA 3ERSX 3BS1A 4K0KQ 1D1KA 1VMCA 2M00A 4ULLA 5IYBG 3S2HB 4RGMA 3A5ZB 4CDDC 2H4OA 4JI0L 2Y0SG 5C3EG 1KDAA 4B3TQ 4DNTB 5CV5A 4LF9Q 3CC4A 3HEJA 4DV0Q 3P20A 1QZGA 1VQ8A 3MA2B 3G48A 3HOZH 4B3RL 1ICFB 2ZJRA 1N36Q 1YNNC 1CK1A 3S15B 2VUMH 1TU2B 3MHBA 4JG2A 3J81L 1BF4A 2JK8A 2I5LX 2JSOA 4BXXH 2UXDQ 1GUWA 4BBSH 4YCUA 1HFGA 5JVG3 4CJ1B 1PDQA 3SHLA 2EY2A 2K1BA 2AWNA 4AIMA 4KV6A 3CXCA 4NXNQ 5JAVA 4DV5L 3RR5A 1HRJA 4DV7Q 2B2TA 4WRDA 1KDBA 1I50H 3R3OA 1TR5A 2QCPX 3CRLC 2BDNA 2E76C 1WFQA 1LACA 1SMYD 4PMWA 2O5IC 4R4TA 3ITPA 5IT9c 5M3FG 1EYDA 1G51A 4DR5Q 3HOXH 2WAQE 1OO9B 1VQMA 1HFNA 1V1QA 3VR2A 3KF6A 2B63B 3CP0A 1JB3A 3S9WA 2A6ED 3TP7A 1PH4A 1L0XB 3DWQA 2XRQD 4BWGB 1PH6A 5I6YA 4DR6L 1WI5A 5ELCA 3PUXA 3S1RB 4EVOA 1AP0A 1EZ6A 3A5UA 1ZYRD 5FLXE 2L55A 3GTQB 2NB0A 3PGZA 4J1MA 2F0LA 3BVGA 1G291 1CI3M 4R4CA 1FR3A 2BDOA 3J7AV 3T16A 3L2PA 3K59A 4RGOS 2F0IA 4DR1Q 2IX1A 4HSVA 2RHSB 4ILWA 5H1SE 5FO9B 2C5CA 2EYLA 1IW7C 1ENCA 1JOQA 1CQFA 1VQ9A 1VQPA 5KNBA 4IFDG 1LTAD 3A7AB 1QILA 1CFMA 1SYDA 3TN2A 5JJKA 4X65Q 3CU7A 1Y1VB 2B63G 2EY1A 4GKKQ 3EA6A 3KF8A 1OXSC 2K05A 4KN4C 4DKAC 3H6MA 2K5NA 1K73C 3KLSA 1BO0A 5T1GA 3ONAB 1Q3LA 2RA4A 5M9OA 5I4DA 1Y69U 4JBWA 3M4OB 4ZUJA 3D4WA 4LAAA 2K7VA 1HJPA 4LMQD 1A3VA 2C9OA 5E4XA 2Z1CA 1OXTA 1V1OA 2K75A 3J80E 1JB7A 3O13A 3BZDB 2H5XA 1QOHA 3IFDA 3CCQA 1ZKOA 4KHZA 5A2QL 4GN3B 1WTOA 1JJCB 5FO7B 3GV3A 2L9HA 2JQOA 1DONA 1MJEA 1Y1VG 4J15A 2KCTA 4OEMB 2KHJA 3MTSA 3SEBA 5J39A 3CMAA 1PTOC 2EPBA 1PRTB 1MD2D 1NR2A 3G6JB 4JOIC 4A4IA 5AFWA 1O80A 2B3GA 4GLAC 4OIKA 4IFDI 4BA1I 5J1ZA 1DGSA 2VY3A 2NBFA 3RD4A 5E7NA 4RGNA 4A3IB 1SNPA 1YJNA 1YITA 1XWEA 3H0GG 1YJ9A 3C2PA 2E5LQ 2EJMA 3J81j 1EOTA 1N34L 2EYFA 4CKCA 2R6GA 2ES2A 1KTKA 1BCPF 3LWUA 3MZ5A 1K8OA 3QR8A 2IW3A 1WYDA 3I4LA 5JVH3 4XDXA 1EIYB 3Q8DA 1RCVD 3HKZB 2F0FA 5BR8Q 4BY1B 4TVAB 2CQOA 2NZ1D 1J5EL 1TS2A 4CDCC 4L8JA 4IPDA 3KF8B 1KC8C 1J8IA 4X6AH 1EIHA 4CKEA 1TWFH 4QF4A 1CTMA 1CM9A 2PI2A 4A3FH 4DV2L 2KHSA 1V9PA 1NAPA 4MN3A 1D2BA 4ME5A 1IBKQ 4OX9L 3S1MH 3I70A 1JJ2A 3MXUA 2Q2IA 2UUBQ 2QF7A 1UUPA 2NVYB 4A3CH 4KKTA 1HA6A 1SMXA 4DK3C 3SGIA 1I6HH 1IBLQ 2ZJQA 3I90A 3HKZG 1E1OA 5GAEC 2E2HH 2JEBI 2CKZB 3EJIA 1RKNA 3STBC 2F0NA 1N32Q 2A74C 4DN4M 2EYJA 2ICIA 1CZWA 2DJFC 1K0RA 1CA6A 4NXMQ 2E2DC 5FK9C 3K5MA 2BE5D 3T51B 4DAVA 1Q1EA 1FNWA 1YJWA 3BDCA 1HH2P 4R4QA 4IOCA 2ID0A 3PO2H 1JT8A 3L3OC 2IJ0A 4LWCA 1PYSB 1TY2A 1QNKA 4LF6Q 3NBIA 2FINB 4DV1L 4A3EH 4A3MH 4KTAA 4IJHA 2BA1A 2MFIA 1VMPA 4ME3A 4NDXA 3T1HQ 4DV3Q 1O7LA 2PZWA 1BVSA 2RVLA 1PYWD 4EQNA 2DN8A 1BCPD 2CHBD 4JW0A 1U0LA 2A6HC 1N33Q 4RWSC 1A3UA 4LFCL 3IFTA 3PO3G 4FYDA 4WJWA 1R4QB 3K7AB 5LHY1 2MO0A 1OXVA 1W3SA 3JAML 5AJ3L 5CYUA 3I4MB 3KDFA 2PQAA 5DLQE 1ONLA 1JE5A 2EYHA 4OWXB 3F2CA 2VXWA 5M5YB 5HURA 1D5XC 5FOBB 3I3CA 4AQYL 2N88A 3GO5A 1JQYD 1HQMC 4JI0Q 1I4HA 1JC7A 2IPKD 2LFNA 5IP9H 2VW9A 1WCMG 3G7LA 2ALYB 2KHIA 2PW5A 2F0HA 4G7ZC 3H3VC 1JOOA 1U5KA 3GTMH 3ND8A 2A19A 2E2JB 1GHJA 1JMCA 1YZ6A 4JPBW 4H13C 3ULLA 2B2TC 4IN3A 1AZQA 2HQLA 3R8BA 2F4VL 1BQQT 1HTPA 1HR0L 1U9RA 2AQ3B 3EIVA 3MXGA 3I4MG 3CCEA 3DHQA 5CGKA 1SBBB 5C44G 1PRTC 2HHHL 5G3LF 3HOVB 1EZ8A 4HIDA 4DV5Q 2EIFA 4JV5L 1EY0A 2QDLA 1UE6A 2GN5A 2R61A 4LNQA 1XPUA 3T4AC 2NVQB 3S1QH 2HCIA 2PYKA 3K5OA 2B2UA 4RAUC 1EYCA 2EOTA 3X3NA 2PNRC 4RCNA 5K36H 5M3MH 4K8IA 2EZVA 1MGSA 2R92H 3CD6A 4QMGA 1KHIA 1K8MA 5C5LA 4OIJA 3Q22A 1N9WA 2L5TA 5M5XB 1E2VA 4WJ4A 1KXLA 2HQEA 2FHTA 5ELBA 5C4JB 1NSNS 3ULJA 4IFDJ 1PV4A 3NQIA 1Y1WH 1BKBA 4CJ0B 4DR6Q 3I4NG 3HKSA 5C4XH 1XNRL 2I07B 3OWEB 2JXMB 1GUTA 3K81C 2EVBA 4OGQC 3HOVG 3GTOB 1KDCA 1XXGA 3M4PA 4X64L 4A76A 1BOSA 1SE3A 1V43A 2OEOA 4POFA 3CAMA 4IPCA 1LV9A 1PH3A 3GV6A 1R9TB 2Q2TA 2GVAA 4MNOA 3KUPA 3GTKB 5E1FA 2PPBC 1B8AA 5CV9A 5C5MA 3GTGB 3QOJA 2PQAB 4K5XA 1C48A 2WP8J 3URYA 2VB3X 3H91A 4PMBA 2K5VA 3OTOL 2CH4W 3TEHB 1SJHD 4B9WA 4OWWB 1LT3D 1Q8IA 1STHA 1AZPA 2OTLA 3ERQA 1FL0A 2JA8B 3K7UC 1WJJA 1ZXTA 1DD2A 1Q1BA 4LW1A 4JCVE 3F2DA 4C3JH 5IOCA 3BZKA 3MXNA 4I7ZC 2IT1A 2NYZD 5EPLA 2R7ZB 4RFBA 5LL6S 3P7JA 4R1JA 3A0JA 4RG1A 1I94Q 1YBYA 1DZ1A 1AE2A 4OO1H 5G3LD 1XTDA 1MKHA 4RKLA 3FEWX 3TS0A 2EXZA 4R4IA 2TSSA 2HIXA 1DM0B 4R9WA 1B70B 4PMCA 1F77A 1KIXA 5FLMH 3CCMA 4P73A 4F88A 4HJ9A 2CCZA 1RF2D 1SYFA 1KL9A 2KEDA 1VQJA 5CBAE 2F0GA 4DV6Q 2JA8G 3V96A 4A93G 1IBML 4K2LA 4PZ6A 3KJPA 2K4KA 4PZ8A 5L37A 1LT6D 1UE7A 1AEXA 2WKCA 3PMFA 1DXMA 3M4YA 3A8KE 3SE0A 5C3XA 1U4PA 2EYOA 3G71A 3S16H 4KD3A 4NPSA 5KNDA 1GXDC 1G6PA 5IP7G 1PH2A 2JN4A 2NN6G 2KCNA 2TMPA 1TQOA 3KLSX 2ZJPA 4HIMA 3QO2A 3OMCA 4DR7L 2JA6B 3NHHA 1N34Q 3VR6A 3E3XA 2FJ2A 4U673 2PW7A 1TWGB 3T1YL 4O0AA 5DM63 3GQBA 3NTIA 1II3A 3I72A 2VL6A 1WD1A 2A73B 1KAWA 2HDLA 2KECA 2RSNA 4CBVA 2GVBA 4IPHA 2CWAA 1PZJD 5ELNA 3NBHB 1CQVA 4YY3Q 3FKIB 2EQSA 2NTSA 2K03A 5ELDA 5M5WH 4LF5Q 4A3GB 2F0MA 5FO8B 5HGTA 1J5EQ 4C2MH 1C9OA 1Q90A 3CW2C 3HOYH 1EQQA 1SMYC 3HOWB 2OXPA 3KK7A 4QIWE 3FVQA 5JPMC 1XNQL 4DV2Q 3S14H 3I8ZA 5JEAH 2R7FA 1XPRA 3K80C 3PSIA 1KD1C 4HMIA 1K83H 3UE0A 3MXNB 1K28A 4KK7A 4OX9Q 2JA7H 3DUZA 3EVQA 5IY0A 5IGCA 2Y0SB 2A6EC 5C3EB 1D1IA 3NTHA 3VR3A 4EGVA 3GTPH 1ESFA 5I2YA 5EKIA 3IAYA 2ZXOA 5IWAL 4F7XA 2V1CC 2NN6I 3NTKA 4IPGA 1ZYRC 5CORA 3FKIG 5EPKA 3S17H 3GTJH 4A3GG 5JJIA 2YTYA 3TBIB 4AYBG 2E75C 4OO1I 1PTOH 4GS3A 4BBRH 4JI2L 4RGTA 4YCVA 5E3FA 3HOWG 1A62A 2R93G 4H02A 1VDZA 4DAYB 4WFN3 1HUNA 2OTJA 1EFWA 1GVPA 4C3IG 2Q2HA 4HCSA 4O42A 3MC0B 4A3BB 1BCPB 3VYUA 4HSPA 4G57A 4JI1L 5FJ8H 1GUSA 2EJFC 2KCMA 4DAMA 4DV1Q 3CQZH 2A68D 3RZDH 4EX5A 4N9PA 1H9RA 5M3FB 1NMFA 4L63B 3S2HH 2NUCA 3OPOA 1FNVA 4HJ7A 2ATWA 3ICEA 1RJTA 1QUQA 4FF3A 1S40A 3D8GA 4LFCQ 1A0IA 3TSSA 1X9NA 3U58A 3F1ZA 2UXBL 4WORA 4ODGA 2L15A 5AJ3Q 4KHPL 4UDUC 5I2XA 4QY7A 1TWHB 4ZYSA 3S15H 2K52A 1TS5A 4QGUA 1D6EC 3IKJA 4AQYQ 3TP8A 1B9MA 3PIOA 1P8LA 4A3BG 4UP7A 2PNHA 3HOUG 1QNUA 4NP5A 1LM0A 4A3KH 1Q46A 3KOJA 3K0YA 4CHTB 1SNCA 2F0WA 3CCSA 4U68A 2CQAA 2N49A 1VQEA 3OYYA 1I4PA 3M3YB 4HJ5A 1I50B 3TQYA 1D5MC 3TZUA 1W2BA 4OL7A 2AQ1B 3SK4A 3JAMi 2F4VQ 5FLXL 1Q12A 1HR0Q 2Z6KA 4XXEA 1HR0W 2UUCL 4LF8L 1SFOH 2B2UC 1SNQA 2QEJC 3SK5A 2WAQG 1PH5A 3HOZG 4B3SL 1LT4D 3VR5A 1O78A 2HHHQ 5C3WA 2VUMG 2Q2UA 2DNEA 4HR7B 4BXXG 4BBSG 5JJLA 3J7AF 1IYJB 1VQKA 1QE6A 2NZOA 2LKVA 3FHWA 1X3GA 2ZM6L 3S1RH 1LTID 2IL8A 2PZTA 2PMZB 3PIO3 2B2YA 1H9JA 3U50C 3GTQH 4K5WA 1IYVA 4DUZL 2RSOA 4YWLA 1ASZA 2I0QA 1EL0A 3HOXG 1EY7A 2QKIC 2A69C 5EBCA 1QJOA 1XNRQ 3R93A 4LUZA 1KABA 4O2DA 1AH9A 1SLJA 3RN2A 4X64Q 1L2FA 1CHPD 1V1PB 3X3MA 2EY6A 2Q8TA 1YHQA 3BDOA 2VQFL 1QUQB 1SE8A 3PUVA 1D7QA 2MJ8A 3NQTA 4LFBL 3KBXA 5K5PA 3M4OH 1Y14B 3H0GB 3BU2A 1WTVA 4L5QA 4DXFA 3UI2A 4K8JA 2M2LA 1Q81C 4X62Q 1E0BA 2DJGC 3OTOQ 2AKWB 1YI2A 1DJRD 1JWSD 4X3SA 1BNZA 2BE5C 4NB3A 1JE4A 4XQQA 3OIQA 4YIJA 4ZQ3A 4P75A 2QDBA 1CT1D 4I7AA 1E1TA 3A74A 4HN7A 1F2LA 2KOLA 1SNOA 1EU3A 4KI0A 1NY4A 1IL2A 3BDLA 1TIID 2Z4HA 4FVMA 1K8AC 3OMGA 3CCLA 1EEID 3T56B 4A3IH 1BCPC 2HUGA 1ENFA 4KJNA 1XJVA 4P74A 3Q6SA 4OXPA 3JAMc 4PZ7A 1CHQD 1J6QA 4OONA 4YWKA 2LS01 1S3OA 3DEPA 1IBMQ 1PFMA 5TSSA 4EQ5A 5IT9E 4YHHL 4JI3L 1SXTA 1KNAA 1YNXA 4FXKC 2Q8RE 3GDEA 4YCWA 4HJ8A 1AE3A 3P75A 2F0OA 2Z4IA 2HT1A 4A3LH 5EQ0A 5IE8A 1CKOA 4QJFA 4KKSA 1G91A 4BS9A 1KAAA 4BY1H 3PUWA 5BN5A 4FF4A 1FD7D 4X3UA 4DR7Q 2WKDA 4R4OA 2BH2A 1AW7A 2A1AA 5C0XH 2IX3A 2D2CC 3JC66 2SEBD 2Z8LA 3NSWA 4ZUIA 4LF4L 5EKKA 3T1YQ 4A3FB 2WIIB 3N6RA 1XPOA 3KJOA 3C46A 2NVTB 2F52A 1KLGD 3RNUA 2K04A 1PFBA 1NR4A 4TQUS 1OTCA 2PZUA 1IZ6A 1W6KA 4IUQA 2I5HA 3CHBD 1R4PB 2NVYH 1I4GA 1CKMA 3HKZE 3PO3B 3I56A 1HNWL 4E6IA 4APVA 1E22A 2AUKA 1XNQQ 2K01A 1KRTA 4IZ8A 4JBJA 1MBYA 3UDGA 2AWOA 1EY9A 2A8VA 2SNSA 1GD7A 2EYMA 1IL8A 1C4QA 1SYBA 2XN9C 1MIUA 2B8GA 1UNSA 1A63A 3K58A 3TREA 4A3FG 3VA7A 1A15A 1WCMB 2A5HA 1F2ZA 3PO2B 1F9PA 2QA4A 4G7HC 4DUYL 3P1HA 4O1NA 1H9SA 2CWPA 5IWAQ 1TXYA 1SDFA 1A3TA 4A3MB 1I4QA 3PQIA 4A3CG 3Q24A 5C6AA 3ER0A 2EYPA 4FF2A 3NWTA 4JI2Q 2MHVA 2FFKB 3LGJA 3DMUA 1IXRA 1ESRA 2FMMA 3KFUA 1LTLA 1PVOA 3K5LA 2K28A 5C44B 1S5BD 3TMEA 1VQFA 1DOKA 1F9QA 5T1IA 3CCVA 3PUYA 4CKBA 4JI1Q 4L5TA 2WFWA 2XWBB 4PNYA 4JVZA 1DCZA 1EIFA 5M5YH 4A75A 1EIGA 1QB5D 2UXDL 1EYAA 3PO2G 1EFID 5D14A 5LMUL 1DOMA 2WB1E 2RBMA 1WVLA 2MUYA 1STBA 2F0JA 4MTNA 1CUKA 4GKJL 4B3RQ 1YHAA 1TS3A 4DFAA 2KCCA 4XYQA 4A3EG 4N8FA 4A3MG 3TP6A 5D3IB 2UXBQ 3WDNA 3D6WA 2I5MX 4GLXA 4KHPQ 4GZYC 3JAME 1Q86C 2E74C 3C3LA 4JI7L 3I4NB 2E2JH 5IGFA 1BBXC 3D0FA 4CJ2C 5EBDA 2JE6I 2NZHA 1WTXA 4KLKA 3MFYA 1WTRA 2QEXA 3OWFA 1X65A 2ZXPA 1B9NA 3QIAA 1S5ED 5KYIA 2JEAI 2Z6KC 3E9IA 3L9AX 3S1NB 1A8VA 2Q8IB 2OQ0A 4ZK9B 4RHRA 1PXUA 4RA8A 2B2VA 3K8AA 2NVQH 3J81i 3GD7A 1SNMA 1JOKA 3HS0C 4JI6L 4X3KA 5IP9G 4F87A 3RMHA 5I9PA 1YNJD 3I2ZA 2KBNA 2EE1A 1F9RA 2PI2E 5BN3A 4LF8Q 2R92B 1MJCA 4B3SQ 3OSOA 4N8X1 3AFPA 2B2YC 4IJLA 4UHVA 1C7YA 1H9SB 1EY6A 4DGZA 5F2DA 4QCLA 1Y1WB 4DK6C 4DAPA 1YVCA 1LTTD 2ZM6Q 4JI4L 2ZXRA 2YV5A 3GTOH 4L5RC 4JI8L 3QOLA 3QB3A 2XGTA 1R9TH 1OXXK 1SE4A 3U4ZA 4DUZQ 1Q7YC 3NBHA 4IOAA 2CW0D 3VR4A 2IHFA 2AMCB 3GTKH 1ET9A 1I3QH 5K36G 5M3MG 5IYDH 3S2DH 3RLFA 2R92G 2YU9B 3TRZA 2XNAC 3DWPA 4A3JH 1H9KA 1Y8PB 4A93B 1BXTA 2JA5H 1PHJA 3EBEA 1UWVA 1DYQA 1JR0D 1B2TA 4HMJA 3EROA 5A35A 2VQFQ 2YYZA 3ND9A 1Y1WG 1G8ZD 3CC2A 1F2YA 3FMCA 5C4XG 3NP8A 4LFBQ 5J3BA 4C3HH 1Y8NB 5DM73 4HEDA 5IYCH 3DXJC 4XQNA 1VQDA 4UAIA 1TT2A 4YWMA 2BOSA 3HZXA 2R7ZH 2G9DA 3C1FA 4M8AA 4CDFC 2D9UA 4JBKA 4JBMA 5D65A 2J4XA 3J7A5 2NVXH 4M1UB 3HGBA 4LF7L 3D4RA 3ZJYC 4Z9CB 1F9SA 1QVFA 4DAYA 4OELB 5IGBA 5GROA 1WTPA 2LXJA 2F3VA 2E5LL 2O4XA 1WTQA 2YTVA 1BUVT 3QJYA 3NENA 4P72A 4OWTB 4DA2A 2G9HD 1PA6A 2A68C 4C3JG 1E24A 4GNXA 3I4OA 3I7FA 2X69A 4QB4A 2JA9A 4HAEA 1PFSA 3E6ZX 2J0TD 2G5DA 4GN4B 1P16A 3S16B 4OO1G 2IHEA 4Y7NB 3J81c 2X6LA 1S4ZA 2ZTCA 4XYOA 2F3IA 4BY7H 1HCZA 2MPMA 4H0LC 5FLMG 2NTTA 1T5EA 2OF1A 2JA6H 3RZOB 4YHHQ 3BVZA 4JI3Q 4EQOA 2N8NA 2QGQA 1JICA 1TWGH 1ET6A 1X55A 4PV1C 2B29A 3HG9A 4AYBB 4ABNA 4DNRB 3CF5A 4IQZA 4A3DH 1HNXL 3RUZA 4AH6A 5GAHC 1TWCH 1V8QA 3M4QA 1XMOL 2R93B 2F0UA 3VDYA 1CA5A 1L1OA 1HHVA 2DY7A 1HZ9A 3FPUB 1S72A 4C2MB 2Z6BA 4C3IB 4JYAL 1NUCA 3HOYB 4IO9A 4XTCS 3LX0A 3A8IE 1LABA 2ICEC 2WACA 4LF4Q 3S14B 1SSOA 1WTWA 2E2IB 1STEA 3NUCA 1NTGA 4ZKBB 1K83B 1MI2A 4UP8A 2KEEA 3PCOB 5IYBH 2JA7B 1MHWC 2RDGA 1PYBA 3MEHA 3EQLC 1TWAB 1G2SA 1FJGL 1IKLA 1SN8A 5C3EH 2K14A 1EOVA 4JC0A 3GTPB 3VA5A 4POGA 3WOFA 3J7YW 1K3RA 1TY0A 1VQAA 1HNWQ 4PQXA 2PQEA 2F0EA 4DNIA 3PV0A 2L12A 4CGYB 3HRZC 2C35B 2WINB 3R2TA 3PUZA 2L11A 1O7ZA 2SNMA 3HOYG 1SNDA 3GTLH 3OW7A 3E9HA 4GOPA 1VQ6A 2EXDA 3HOUB 2R7DA 5GAGC 1B53A 1B44D 1MSHA 5JEAG 4LUOA 4DUYQ 2HIVA 2F0KA 4GNXB 1LT5D 4G7OC 2Y0SE 2JA7G 4IUVA 2UUAL 1V1PA 3KLWA 3AB9A 3V2TA 3L7ZC 4LFAL 3RZDB 3H15A 1BR9A 1QZHA 1U4LA 5M3FH 3WWVA 3VYRA 1JWMD 3OIPA 1CSQA 1MSGA 1QVGA 2VQEL 5C4ZA 4JI5L 1RDPD 3HOZB 2WAQB 5HY6A 2KUMA 2VUMB 2F4IA 2NWGA 1UE5A 2JP1A 4L6TB 4BBRG 4BBSB 1HZBA 1JCKB 3M9BA 4RKBA 5EPJA 3CPFA 1STAA 1TWHH 4DR4L 3MWYW 1Y8OB 4KD4A 1EYGA 4DR3L 1E2ZA 4B3ML 1GJXA 1L0WA 5LMUQ 1L1OB 4FXDA 3AQQA 1UEAB 5FJ8G 4GKJQ 4A3KB 1QCBD 2SDFA 1A2TA 3RLOA 1QWYA 1NBWA 3J81E 3M3YH 4Y52H 2LMCB 2RKSA 2XWJB 4WJ3M 3HOXB 4JI7Q 1GUGA 4IFDH 3LNNA 4FXGC 4KMUC 1LLRD 2RF4A 4X66L 1NE3A 1VQIA 2B63H 4ZCKA 2F0QA 5GADC 3BZCA 2B2VC 2H1EA 3F2UA 3A8JE 1M90C 4JV5Q 2QILA 1SFOB 4QUFA 2K5QA 5E4WC 4HCEA 2RDHA 4DV4L 3Q23A 1CKNB 1SAPA 1I5FA 1IYUA 3G4SA 3S24A 5D3DA 3A56A 4JI6Q 3SXHA 1STYA 4A3KG 1PH1A 2EDGA 3SDZA 1EQTA 4GOPB 4B08A 4QUCA 1HUMA 2YTXA 4XIGS 3DLLA 1BDOA 3I55A 2RDFA 1KQSA 3J80L 3RLNA 1Y1VH 2DUDA 3K0XA 3K6OA 1XMQL 1EY5A 2M9VA 4JI4Q 1H95A 2B8FA 4K5VA 5NUCA 4JI8Q 2MP1A 2D0OA 5IGEA 1ICWA 3E0EA 5CR3A 5J22A 3AMUA 3K5NA 3DM1A 1M1KC 2PMZE 4H7BA 1VQGA 1JJGA 2R3ZA 2V4DA 1X3PA 3H0GH 3H3VH 2VNUD 1YNND 2DGYA 3C1EA 1M4VA 3NPPA 4UPAA 3RN5A 1SYCA 3UDIA 1I94L 1DOLA 4FDBA 4JK1C 1XTCD 1EU4A 2ZTDA 4GN5A 3K57A 3E5SA 5CV6A 2LXKA 2L1BA 4J8QA 2BA0A 2F0VA 5CBEE 3FDTA 5ELOA 2VZAA 5ELFA 1W6JA 2K50A 1XYIA 1T5XD 4IALA 2FXQA 3U4VA 1Z47A 4DV6L 4OHJA 1FYCA 5A2QE 1LO5D 1LTSD 5IT9L 1OXUA 1A2UA 4LF7Q 1RHPA 1PTOF 4IUTA 5JOBA 3KF6B 1X56A 3FPPA 2SOBA 5FKAC 4GNXC 2VB2X 1L0YB 2X6GA 4IURA 1SRUA 4K6LA 3NXWA 3G6EA 2RQXA 4I65A 2OCEA 4P2CB 1VCIA 2P5ZX 1N8RC 4K14A 1S5FD 1AN8A 1PFNA 3CCUA 5LMNL 1T9HA 1EQVA 3D4DA 2E8GA 2DNCA 2N55A 1B4OA 2CVRA 3L0OA 1EWHA 1K9MC 1FVIA 3W1GA 1YIJA 1I6VC 4XT1B 1A6XA 1IW7D 1CZGA 3ZYYX 1E3PA 3NEMA 4YY3L 1TWFB 4LF5L 4HIKA 2UXCL 1UE1A 4A3IG 1X3FA 4R8IA 2F0PA 1L1OC 2A69D 5HGQA 1D5ZC 2CFMA 1RL2A 1VQCA 3S1MB 2B2WC 1X32A 1X3QA 2OT2A 1LTRD 3ULPA 4R8NA 1VQLA 3E0JA 3WOEA 2KVMA 2NVTH 3H94A 1SR3A 2HDMA 1HNZL 1I6HB 1HNXQ 1PMRA 1XMOQ 3KYHC 3TDQA 2E2HB 1TS4A 4C56C 3PIPA 2LSSA 2GA4B 5JPNC 5EGTA 2JYOA 4IUNA 5CV7A 4JYAQ 3PO3H 1IHZA 4A3LG 1HQRD 1YNJC 3OOCA 5CV8A 2AQ2B 1C0AA 4BY1G 3H3VI 1XX8A 4S3SA 3NK9A 2UU9L 3SR1A 3OW2A 3F2BA 3TS2A 1IKMA 1M8AA 1G2TA 3D31A 1TVXA 1Q82C 5C0XG 2ZTEA 4ZKCB 5JEAJ 1RTNA 1LYLA
chains in the Genus database with same CATH topology
1FJGQ 4GS3A 2JA5H 1HJPA 4BBRH 1PHJA 3EBEA 4JI2L 1WCMH 1UWVA 1HZAA 4YCVA 4DR2L 1A62A 3HOWG 2R93G 4H02A 4GOPC 1VS0A 2VQFQ 4DAYB 4K0KL 2YYZA 1OXTA 2OTJA 1EFWA 1GVPA 2K75A 1Y1WG 3CC2A 1JB7A 2Q2HA 5C4XG 1LUZA 4LFBQ 5J3BA 2H5XA 2KENA 4C3HH 4B3TL 4JI1L 5FJ8H 4KHZA 5IYCH 3CCQA 4GN3B 1VQDA 2KCMA 4DAMA 4LF9L 1WOCA 4AYBG 3CQZH 3CCRA 4DV1Q 4YWMA 4DV0L 1JJCB 2R7ZH 3K7AH 3RZDH 1SROA 3M85A 2JQOA 1MJEA 1Y1VG 4EX5A 4J15A 3I4MH 2KCTA 1E7ZA 1NMFA 3S2HH 5C44H 4JBKA 1N36L 4JBMA 2KHJA 3J7A5 2NVXH 4HJ7A 2ATWA 3ICEA 2RCNA 3CMAA 4LF7L 3ZJYC 1QUQA 1S40A 1VQ4A 4LFCQ 1A0IA 4JOIC 2UUAQ 1X9NA 4A4IA 1QVFA 3U58A 3F1ZA 2UXBL 1K8GA 4LFAQ 2B3GA 3HFZB 2L15A 5AJ3Q 5GROA 4KHPL 4GLAC 3CCJA 2LXJA 4IFDI 4QY7A 4BA1I 1DGSA 2VY3A 4NXNL 5E7NA 2E5LL 2D62A 1B7YB 2YTVA 3S15H 2VQEQ 4DV7L 4JI5Q 2K52A 4QGUA 1YJNA 1YITA 3FP9A 3H0GG 1YJ9A 4QL5A 2WB1G 3NENA 4P72A 4AQYQ 3PIOA 1P8LA 2E5LQ 4A3BG 4OWTB 1PA6A 1Q8KA 4UP7A 2PNHA 3HOUG 1E24A 4GNXA 2OWOA 1LM0A 3I4OA 3I7FA 4A3KH 4BA2I 1EUJA 3CPWA 1Q46A 3KOJA 3J81j 2JA9A 5C0XI 4DR5L 1PFSA 3NELA 1N34L 4DR4Q 3CCSA 3J7ZC 3I4NH 3AFQA 2N49A 1VQEA 3OYYA 4GN4B 1P16A 2R6GA 4DR3Q 2IHEA 4HJ5A 2ES2A 3TQYA 4OO1G 4B3MQ 3J81c 3HOVH 1X54A 1W2BA 2ZTCA 1WYDA 4DPGA 1EIYB 1Z9FA 3Q8DA 2F3IA 3UDFA 3JAMi 4BY7H 2F4VQ 5BR8Q 5FLMG 2D0PA 4TVAB 1Q12A 2JA6H 1HR0Q 2XTIA 2Z6KA 2CQOA 1X3EA 1HR0W 4YHHQ 2UUCL 1GO3E 1SFOH 4JI3Q 4LF8L 1J5EL 1PH5A 3HOZG 3S1NH 2WAQG 4B3SL 2N8NA 3STBD 2QGQA 1TWGH 2HHHQ 2UUCQ 4IPDA 1X55A 3KF8B 1KC8C 2Q2UA 2VUMG 4X6AH 1CSPA 2B29A 1TWFH 3CF5A 4BXXG 4X66Q 4BBSG 5JJLA 2PI2A 4A3FH 5M5XH 4DV2L 3PF5A 1IYJB 4A3DH 1HNXL 5GAHC 4AH6A 1XMOL 1TWCH 3M4QA 2NZOA 1V9PA 1VQKA 3FHWA 3VDYA 4DR1L 1L1OA 1X3GA 2ZM6L 1HZ9A 3S1RH 5C4JH 2IY5B 1S72A 1IBKQ 4OX9L 3S1MH 4JYAL 4DV4Q 4IO9A 1JJ2A 3U50C 2Q2IA 4XTCS 3GTQH 4HIOA 2UUBQ 3AEVA 4A3CH 4X65L 4LF4Q 1GKHA 4DUZL 1SMXA 4DK3C 3SGIA 4GKKL 4YWLA 1IBLQ 1ASZA 1ASYA 2ZJQA 1I6HH 2I0QA 3HKZG 1E1OA 5GAEC 1NTGA 2E2HH 2JEBI 2CKZB 4UP8A 1KXLA 3PCOB 3STBC 5IYBH 3HOXG 1N32Q 1K0RA 1PYBA 4NXMQ 1XNRQ 4LUZA 1VQOA 4O2DA 1FJGL 3GTGH 1SN8A 5C3EH 2K14A 1EOVA 2K5HA 4JC0A 1SLJA 3CC7A 4POGA 1Q1EA 3RN2A 4X64Q 1L2FA 1K3RA 1VQAA 1YJWA 1HNWQ 1YHQA 2VQFL 1HH2P 3W5OA 1QUQB 1YEZA 3PV0A 4DNIA 1AH9A 1SE8A 3PUVA 4R4QA 1XMQQ 1D7QA 3KDFB 4IOCA 2ID0A 3PO2H 1VQNA 2C35B 4LFBL 2YU9H 3M4OH 1JT8A 4X62L 4LWCA 1Y14B 1PYSB 2VS1A 3BU2A 3PUZA 2JA8H 4A93H 4L5QA 4LF6Q 4HJAA 3HOYG 2MNAA 3GTLH 4DV1L 3E9HA 4A3EH 4A3MH 1Q81C 4GOPA 4X62Q 4IJHA 1VQ6A 1NMGA 2BA1A 2EXDA 2MFIA 2R7DA 4ME3A 5GAGC 3OTOQ 2AKWB 3T1HQ 4DV3Q 5JEAG 3CMEA 1YI2A 1PH9A 3F8TA 1BVSA 4LUOA 3BJUA 1BBWA 4DUYQ 1KRSA 2HIVA 4GNXB 4NB3A 1U0LA 1N33Q 1EWIA 2Y0SE 4LFCL 5IP7H 2UUAL 2JA7G 1BBUA 4ALPA 3KLWA 3PO3G 3L7ZC 4P75A 4LFAL 4UY8C 2MO0A 1OXVA 1W3SA 5AJ3L 1QVCA 3J80i 3H15A 5IYDH 1QZHA 3KDFA 2PQAA 3WWVA 5M3FH 4PG3A 1CSQA 5DLQE 1JE5A 1E1TA 3A74A 4OWXB 3F2CA 1QVGA 2VQEL 4JI5L 2N3SA 2IX0A 5IYDG 4AQYL 5HY6A 3AYHB 3GO5A 4KI0A 4JOIA 1NY4A 1VQ5A 1IL2A 4JI0Q 4A3JG 1UE5A 1K8AC 2JA5G 4BBRG 5IP9H 1HZBA 2VW9A 1WCMG 3M9BA 3W1BA 3CPFA 3UDXA 2ALYB 2KHIA 3CCLA 1TWHH 4DR4L 3B6YA 4A3IH 1EYGA 4DR3L 1XJVA 1U5KA 3GTMH 4P74A 4B3ML 1L0WA 2A19A 2ASBA 5LMUQ 4OXPA 3JAMc 1YZ6A 4PZ7A 1JMCA 1L1OB 3M7NA 1J6QA 3ULLA 3AQQA 5FJ8G 4GKJQ 5IYCG 2HQLA 2F4VL 4OONA 4YWKA 5BR8L 1S3OA 1HR0L 1IBMQ 4EQ5A 2R7ZG 3RLOA 3EIVA 4YHHL 4JI3L 1NBWA 3I4MG 1YNXA 3CCEA 3M3YH 1GM5A 4Y52H 4Y7NH 5C44G 4WJ3M 3GDEA 4YCWA 2HHHL 4JI7Q 4HJ8A 1AE3A 4HIDA 4DV5Q 2EIFA 1RIPA 4JV5L 3IRBA 2HT1A 4A3LH 4X66L 1UE6A 2GN5A 1CKOA 2RF4A 3EN2A 4QJFA 1X6OA 5IE8A 1NE3A 1VQIA 4LNQA 1XPUA 4BY1H 3PUWA 3RZOH 2B63H 5GADC 3BZCA 1M90C 3S1QH 4JV5Q 5LMNQ 5LMNW 4DR7Q 1IBKL 5M3MH 3FKIH 4R4OA 4DV4L 2BH2A 4A3GH 1UEBA 2R92H 3CD6A 2A1AA 1CKNB 3JC66 1KHIA 2UUBL 4LF4L 1I5FA 3T1YQ 1EQRA 1N9WA 3S24A 3G4SA 2RHQB 1IBLL 1PH7A 3HOWH 4A3JH 3DM3A 3KJOA 1XPOA 2Z0SA 4P71A 2F52A 5FLXc 2R93H 3RNUA 4JI6Q 2UXCQ 4A3KG 3PF4A 3ULJA 2N78A 1PH1A 4IFDJ 5EAYA 1PV4A 4TQUS 1Y1WH 1OTCA 1BKBA 1N32L 4C3IH 4DR6Q 4GOPB 1IZ6A 3HKSA 3I4NG 5C4XH 4NXML 1XNRL 2I5HA 2YTXA 4XIGS 1FGUA 2NVYH 4L5SA 3HOVG 3K81C 1CKMA 1VQBA 3HKZE 3M4PA 4X64L 3DLLA 4A76A 3I56A 1V43A 4UP9A 2E2IH 5GQOA 1HNWL 4POFA 3I55A 3CAMA 1PH8A 4IPCA 1PH3A 4APVA 4BY7G 1KQSA 4QQBX 1E22A 2Q2TA 3RLNA 1XNQQ 1Y1VH 2GVAA 4MNOA 2DUDA 1KRTA 2MQHA 3K0XA 5C0XJ 1XMQL 1D8LA 1HNZQ 4JBJA 3UDGA 1CKNA 2AWOA 2A8VA 1O7IA 4JI4Q 1H95A 1TWAH 1VQ7A 1B8AA 1GD7A 2BH8A 3UE1A 2PQAB 4LUVA 4LF6L 4AYBE 2WP8J 4JI8Q 1MIUA 1A63A 4GLVB 2D0OA 3E0EA 2AHOB 3TREA 2K5VA 3OTOL 4WJ4A 4A3FG 3T1HL 4DV3L 4A3DG 1M1KC 4RMFA 4MZ9A 3TEHB 2PMZE 1NJIC 2QA4A 2MO1A 4DUYL 4OWWB 1VQGA 2UU9Q 2CWPA 1JJGA 2OTLA 3MEFA 5IWAQ 1TXYA 1YHBA 3H0GH 1N33L 1FL0A 1VQHA 2OQKA 3K7UC 4A3BH 1WJJA 3H3VH 3J80c 2DGYA 2VNUD 1Q1BA 4LW1A 4JCVE 3F2DA 2JJQA 4C3JH 4UPAA 3RN5A 3HOUH 4A3CG 3UDIA 3BZKA 3ER0A 1I94L 4FDBA 4JI2Q 1HZCA 2IT1A 2ZTDA 3LGJA 4GN5A 4DR2Q 1IXRA 3ERSX 4R1JA 3A0JA 4RG1A 1I94Q 1YBYA 1LTLA 3KFUA 1AE2A 4K0KQ 1PVOA 5IYBG 2LXKA 1XTDA 3A5ZB 1VQFA 1MKHA 2BA0A 3CCVA 3TS0A 4R4IA 3PUYA 5ELOA 4JI0L 2VZAA 2Y0SG 2HIXA 5C3EG 2K50A 4B3TQ 4JI1Q 5JJIA 1B70B 4LF9Q 1KIXA 2FXQA 4L5TA 5FLMH 2WFWA 3CC4A 3CCMA 4DV0Q 3U4VA 1QZGA 4P73A 1VQ8A 1Z47A 4HJ9A 2CCZA 3G48A 1EIFA 5M5YH 4A75A 3HOZH 4DV6L 2JA6G 2UXDL 1KL9A 3PO2G 4B3RL 1VQJA 2ZJRA 5LMUL 1N36Q 2WB1E 1OXUA 2VUMH 4JG2A 4DV6Q 4GKJL 2JK8A 1CUKA 2I5LX 4MTNA 4LF7Q 2JA8G 4BXXH 4B3RQ 4BBSH 4YCUA 1YHAA 4A93G 4A3EG 4A3MG 1IBML 4PZ6A 3KF6B 1X56A 3KJPA 2K4KA 4PZ8A 2UXBQ 2I5MX 1UE7A 4GLXA 4KHPQ 4GNXC 2AWNA 1Q86C 4AIMA 2UXDQ 3CXCA 4JI7L 4NXNQ 1SRUA 2E2JH 4DV5L 3RR5A 3G6EA 3D0FA 3G71A 4DV7Q 3S16H 4NPSA 1I50H 2OCEA 1G6PA 1VCIA 2JE6I 2NZHA 5IP7G 4KLKA 1PH2A 1WFQA 1N8RC 2NN6G 2QEXA 4PMWA 1X65A 3CCUA 2ZJPA 1T9HA 5LMNL 4R4TA 2E8GA 4HIMA 4DR7L 5IT9c 5M3FG 2JEAI 1G51A 3L0OA 4DR5Q 3HOXH 2WAQE 2Z6KC 1N34Q 3E9IA 1FVIA 3W1GA 1YIJA 1K9MC 1A8VA 2OQ0A 1VQMA 3T1YL 4O0AA 1V1QA 2VL6A 3KF6A 1E3PA 3CP0A 3K8AA 3NEMA 1KAWA 2NVQH 4YY3L 3GD7A 3J81i 4JI6L 4LF5L 4HIKA 2UXCL 5IP9G 1PH4A 2GVBA 4IPHA 2CWAA 3I2ZA 5ELNA 2KBNA 3NBHB 1PH6A 4DR6L 1WI5A 2PI2E 2EQSA 4YY3Q 5M5WH 1UE1A 4A3IG 4LF5Q 1X3FA 3PUXA 4LF8Q 1L1OC 5HGQA 1J5EQ 1MJCA 4C2MH 3A5UA 4B3SQ 2CFMA 1RL2A 1C9OA 1VQCA 3AFPA 3CW2C 3ULPA 1EQQA 1VQLA 3HOYH 4IJLA 3PGZA 1C7YA 2NVTH 4QIWE 1G291 4R4CA 1SR3A 1XNQL 4DV2Q 3L2PA 1HNZL 3S14H 1HNXQ 4DK6C 1XMOQ 3KYHC 1YVCA 2R7FA 1XPRA 3K80C 4DR1Q 3PSIA 1KD1C 2IX1A 2RHSB 3PIPA 2ZM6Q 4JI4L 2LSSA 1K83H 5H1SE 3UE0A 3MXNB 2YV5A 4OX9Q 3GTOH 4JYAQ 4L5RC 2JA7H 4JI8L 1VQPA 1VQ9A 4IFDG 5IY0A 3PO3H 4A3LG 2XGTA 1R9TH 3GTPH 4X65Q 5JJKA 1OXXK 4DUZQ 3U4ZA 1Q7YC 1C0AA 4BY1G 2B63G 4IOAA 3H3VI 4GKKQ 2IHFA 2AMCB 1OXSC 3GTKH 4DKAC 2UU9L 3OW2A 5IWAL 2K5NA 1I3QH 2V1CC 1K73C 5K36G 2NN6I 4IPGA 5M3MG 3F2BA 3S17H 3FKIG 3TS2A 4A3GG 3GTJH 3D31A 3RLFA 1Q82C 2R92G 3S2DH 2YTYA 4JBWA 3TRZA 5C0XG 2ZTEA 5JEAJ 1LYLA 4OO1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG Q;  4GS3 A;  2JA5 H;  1HJP A;  4BBR H;  1PHJ A;  3EBE A;  4JI2 L;  1WCM H;  1UWV A;  1HZA A;  4YCV A;  4DR2 L;  1A62 A;  3HOW G;  2R93 G;  4H02 A;  4GOP C;  1VS0 A;  2VQF Q;  4DAY B;  4K0K L;  2YYZ A;  1OXT A;  2OTJ A;  1EFW A;  1GVP A;  2K75 A;  1Y1W G;  3CC2 A;  1JB7 A;  2Q2H A;  5C4X G;  1LUZ A;  4LFB Q;  5J3B A;  2H5X A;  2KEN A;  4C3H H;  4B3T L;  4JI1 L;  5FJ8 H;  4KHZ A;  5IYC H;  3CCQ A;  4GN3 B;  1VQD A;  2KCM A;  4DAM A;  4LF9 L;  1WOC A;  4AYB G;  3CQZ H;  3CCR A;  4DV1 Q;  4YWM A;  4DV0 L;  1JJC B;  2R7Z H;  3K7A H;  3RZD H;  1SRO A;  3M85 A;  2JQO A;  1MJE A;  1Y1V G;  4EX5 A;  4J15 A;  3I4M H;  2KCT A;  1E7Z A;  1NMF A;  3S2H H;  5C44 H;  4JBK A;  1N36 L;  4JBM A;  2KHJ A;  3J7A 5;  2NVX H;  4HJ7 A;  2ATW A;  3ICE A;  2RCN A;  3CMA A;  4LF7 L;  3ZJY C;  1QUQ A;  1S40 A;  1VQ4 A;  4LFC Q;  1A0I A;  4JOI C;  2UUA Q;  1X9N A;  4A4I A;  1QVF A;  3U58 A;  3F1Z A;  2UXB L;  1K8G A;  4LFA Q;  2B3G A;  3HFZ B;  2L15 A;  5AJ3 Q;  5GRO A;  4KHP L;  4GLA C;  3CCJ A;  2LXJ A;  4IFD I;  4QY7 A;  4BA1 I;  1DGS A;  2VY3 A;  4NXN L;  5E7N A;  2E5L L;  2D62 A;  1B7Y B;  2YTV A;  3S15 H;  2VQE Q;  4DV7 L;  4JI5 Q;  2K52 A;  4QGU A;  1YJN A;  1YIT A;  3FP9 A;  3H0G G;  1YJ9 A;  4QL5 A;  2WB1 G;  3NEN A;  4P72 A;  4AQY Q;  3PIO A;  1P8L A;  2E5L Q;  4A3B G;  4OWT B;  1PA6 A;  1Q8K A;  4UP7 A;  2PNH A;  3HOU G;  1E24 A;  4GNX A;  2OWO A;  1LM0 A;  3I4O A;  3I7F A;  4A3K H;  4BA2 I;  1EUJ A;  3CPW A;  1Q46 A;  3KOJ A;  3J81 j;  2JA9 A;  5C0X I;  4DR5 L;  1PFS A;  3NEL A;  1N34 L;  4DR4 Q;  3CCS A;  3J7Z C;  3I4N H;  3AFQ A;  2N49 A;  1VQE A;  3OYY A;  4GN4 B;  1P16 A;  2R6G A;  4DR3 Q;  2IHE A;  4HJ5 A;  2ES2 A;  3TQY A;  4OO1 G;  4B3M Q;  3J81 c;  3HOV H;  1X54 A;  1W2B A;  2ZTC A;  1WYD A;  4DPG A;  1EIY B;  1Z9F A;  3Q8D A;  2F3I A;  3UDF A;  3JAM i;  4BY7 H;  2F4V Q;  5BR8 Q;  5FLM G;  2D0P A;  4TVA B;  1Q12 A;  2JA6 H;  1HR0 Q;  2XTI A;  2Z6K A;  2CQO A;  1X3E A;  1HR0 W;  4YHH Q;  2UUC L;  1GO3 E;  1SFO H;  4JI3 Q;  4LF8 L;  1J5E L;  1PH5 A;  3HOZ G;  3S1N H;  2WAQ G;  4B3S L;  2N8N A;  3STB D;  2QGQ A;  1TWG H;  2HHH Q;  2UUC Q;  4IPD A;  1X55 A;  3KF8 B;  1KC8 C;  2Q2U A;  2VUM G;  4X6A H;  1CSP A;  2B29 A;  1TWF H;  3CF5 A;  4BXX G;  4X66 Q;  4BBS G;  5JJL A;  2PI2 A;  4A3F H;  5M5X H;  4DV2 L;  3PF5 A;  1IYJ B;  4A3D H;  1HNX L;  5GAH C;  4AH6 A;  1XMO L;  1TWC H;  3M4Q A;  2NZO A;  1V9P A;  1VQK A;  3FHW A;  3VDY A;  4DR1 L;  1L1O A;  1X3G A;  2ZM6 L;  1HZ9 A;  3S1R H;  5C4J H;  2IY5 B;  1S72 A;  1IBK Q;  4OX9 L;  3S1M H;  4JYA L;  4DV4 Q;  4IO9 A;  1JJ2 A;  3U50 C;  2Q2I A;  4XTC S;  3GTQ H;  4HIO A;  2UUB Q;  3AEV A;  4A3C H;  4X65 L;  4LF4 Q;  1GKH A;  4DUZ L;  1SMX A;  4DK3 C;  3SGI A;  4GKK L;  4YWL A;  1IBL Q;  1ASZ A;  1ASY A;  2ZJQ A;  1I6H H;  2I0Q A;  3HKZ G;  1E1O A;  5GAE C;  1NTG A;  2E2H H;  2JEB I;  2CKZ B;  4UP8 A;  1KXL A;  3PCO B;  3STB C;  5IYB H;  3HOX G;  1N32 Q;  1K0R A;  1PYB A;  4NXM Q;  1XNR Q;  4LUZ A;  1VQO A;  4O2D A;  1FJG L;  3GTG H;  1SN8 A;  5C3E H;  2K14 A;  1EOV A;  2K5H A;  4JC0 A;  1SLJ A;  3CC7 A;  4POG A;  1Q1E A;  3RN2 A;  4X64 Q;  1L2F A;  1K3R A;  1VQA A;  1YJW A;  1HNW Q;  1YHQ A;  2VQF L;  1HH2 P;  3W5O A;  1QUQ B;  1YEZ A;  3PV0 A;  4DNI A;  1AH9 A;  1SE8 A;  3PUV A;  4R4Q A;  1XMQ Q;  1D7Q A;  3KDF B;  4IOC A;  2ID0 A;  3PO2 H;  1VQN A;  2C35 B;  4LFB L;  2YU9 H;  3M4O H;  1JT8 A;  4X62 L;  4LWC A;  1Y14 B;  1PYS B;  2VS1 A;  3BU2 A;  3PUZ A;  2JA8 H;  4A93 H;  4L5Q A;  4LF6 Q;  4HJA A;  3HOY G;  2MNA A;  3GTL H;  4DV1 L;  3E9H A;  4A3E H;  4A3M H;  1Q81 C;  4GOP A;  4X62 Q;  4IJH A;  1VQ6 A;  1NMG A;  2BA1 A;  2EXD A;  2MFI A;  2R7D A;  4ME3 A;  5GAG C;  3OTO Q;  2AKW B;  3T1H Q;  4DV3 Q;  5JEA G;  3CME A;  1YI2 A;  1PH9 A;  3F8T A;  1BVS A;  4LUO A;  3BJU A;  1BBW A;  4DUY Q;  1KRS A;  2HIV A;  4GNX B;  4NB3 A;  1U0L A;  1N33 Q;  1EWI A;  2Y0S E;  4LFC L;  5IP7 H;  2UUA L;  2JA7 G;  1BBU A;  4ALP A;  3KLW A;  3PO3 G;  3L7Z C;  4P75 A;  4LFA L;  4UY8 C;  2MO0 A;  1OXV A;  1W3S A;  5AJ3 L;  1QVC A;  3J80 i;  3H15 A;  5IYD H;  1QZH A;  3KDF A;  2PQA A;  3WWV A;  5M3F H;  4PG3 A;  1CSQ A;  5DLQ E;  1JE5 A;  1E1T A;  3A74 A;  4OWX B;  3F2C A;  1QVG A;  2VQE L;  4JI5 L;  2N3S A;  2IX0 A;  5IYD G;  4AQY L;  5HY6 A;  3AYH B;  3GO5 A;  4KI0 A;  4JOI A;  1NY4 A;  1VQ5 A;  1IL2 A;  4JI0 Q;  4A3J G;  1UE5 A;  1K8A C;  2JA5 G;  4BBR G;  5IP9 H;  1HZB A;  2VW9 A;  1WCM G;  3M9B A;  3W1B A;  3CPF A;  3UDX A;  2ALY B;  2KHI A;  3CCL A;  1TWH H;  4DR4 L;  3B6Y A;  4A3I H;  1EYG A;  4DR3 L;  1XJV A;  1U5K A;  3GTM H;  4P74 A;  4B3M L;  1L0W A;  2A19 A;  2ASB A;  5LMU Q;  4OXP A;  3JAM c;  1YZ6 A;  4PZ7 A;  1JMC A;  1L1O B;  3M7N A;  1J6Q A;  3ULL A;  3AQQ A;  5FJ8 G;  4GKJ Q;  5IYC G;  2HQL A;  2F4V L;  4OON A;  4YWK A;  5BR8 L;  1S3O A;  1HR0 L;  1IBM Q;  4EQ5 A;  2R7Z G;  3RLO A;  3EIV A;  4YHH L;  4JI3 L;  1NBW A;  3I4M G;  1YNX A;  3CCE A;  3M3Y H;  1GM5 A;  4Y52 H;  4Y7N H;  5C44 G;  4WJ3 M;  3GDE A;  4YCW A;  2HHH L;  4JI7 Q;  4HJ8 A;  1AE3 A;  4HID A;  4DV5 Q;  2EIF A;  1RIP A;  4JV5 L;  3IRB A;  2HT1 A;  4A3L H;  4X66 L;  1UE6 A;  2GN5 A;  1CKO A;  2RF4 A;  3EN2 A;  4QJF A;  1X6O A;  5IE8 A;  1NE3 A;  1VQI A;  4LNQ A;  1XPU A;  4BY1 H;  3PUW A;  3RZO H;  2B63 H;  5GAD C;  3BZC A;  1M90 C;  3S1Q H;  4JV5 Q;  5LMN Q;  5LMN W;  4DR7 Q;  1IBK L;  5M3M H;  3FKI H;  4R4O A;  4DV4 L;  2BH2 A;  4A3G H;  1UEB A;  2R92 H;  3CD6 A;  2A1A A;  1CKN B;  3JC6 6;  1KHI A;  2UUB L;  4LF4 L;  1I5F A;  3T1Y Q;  1EQR A;  1N9W A;  3S24 A;  3G4S A;  2RHQ B;  1IBL L;  1PH7 A;  3HOW H;  4A3J H;  3DM3 A;  3KJO A;  1XPO A;  2Z0S A;  4P71 A;  2F52 A;  5FLX c;  2R93 H;  3RNU A;  4JI6 Q;  2UXC Q;  4A3K G;  3PF4 A;  3ULJ A;  2N78 A;  1PH1 A;  4IFD J;  5EAY A;  1PV4 A;  4TQU S;  1Y1W H;  1OTC A;  1BKB A;  1N32 L;  4C3I H;  4DR6 Q;  4GOP B;  1IZ6 A;  3HKS A;  3I4N G;  5C4X H;  4NXM L;  1XNR L;  2I5H A;  2YTX A;  4XIG S;  1FGU A;  2NVY H;  4L5S A;  3HOV G;  3K81 C;  1CKM A;  1VQB A;  3HKZ E;  3M4P A;  4X64 L;  3DLL A;  4A76 A;  3I56 A;  1V43 A;  4UP9 A;  2E2I H;  5GQO A;  1HNW L;  4POF A;  3I55 A;  3CAM A;  1PH8 A;  4IPC A;  1PH3 A;  4APV A;  4BY7 G;  1KQS A;  4QQB X;  1E22 A;  2Q2T A;  3RLN A;  1XNQ Q;  1Y1V H;  2GVA A;  4MNO A;  2DUD A;  1KRT A;  2MQH A;  3K0X A;  5C0X J;  1XMQ L;  1D8L A;  1HNZ Q;  4JBJ A;  3UDG A;  1CKN A;  2AWO A;  2A8V A;  1O7I A;  4JI4 Q;  1H95 A;  1TWA H;  1VQ7 A;  1B8A A;  1GD7 A;  2BH8 A;  3UE1 A;  2PQA B;  4LUV A;  4LF6 L;  4AYB E;  2WP8 J;  4JI8 Q;  1MIU A;  1A63 A;  4GLV B;  2D0O A;  3E0E A;  2AHO B;  3TRE A;  2K5V A;  3OTO L;  4WJ4 A;  4A3F G;  3T1H L;  4DV3 L;  4A3D G;  1M1K C;  4RMF A;  4MZ9 A;  3TEH B;  2PMZ E;  1NJI C;  2QA4 A;  2MO1 A;  4DUY L;  4OWW B;  1VQG A;  2UU9 Q;  2CWP A;  1JJG A;  2OTL A;  3MEF A;  5IWA Q;  1TXY A;  1YHB A;  3H0G H;  1N33 L;  1FL0 A;  1VQH A;  2OQK A;  3K7U C;  4A3B H;  1WJJ A;  3H3V H;  3J80 c;  2DGY A;  2VNU D;  1Q1B A;  4LW1 A;  4JCV E;  3F2D A;  2JJQ A;  4C3J H;  4UPA A;  3RN5 A;  3HOU H;  4A3C G;  3UDI A;  3BZK A;  3ER0 A;  1I94 L;  4FDB A;  4JI2 Q;  1HZC A;  2IT1 A;  2ZTD A;  3LGJ A;  4GN5 A;  4DR2 Q;  1IXR A;  3ERS X;  4R1J A;  3A0J A;  4RG1 A;  1I94 Q;  1YBY A;  1LTL A;  3KFU A;  1AE2 A;  4K0K Q;  1PVO A;  5IYB G;  2LXK A;  1XTD A;  3A5Z B;  1VQF A;  1MKH A;  2BA0 A;  3CCV A;  3TS0 A;  4R4I A;  3PUY A;  5ELO A;  4JI0 L;  2VZA A;  2Y0S G;  2HIX A;  5C3E G;  2K50 A;  4B3T Q;  4JI1 Q;  5JJI A;  1B70 B;  4LF9 Q;  1KIX A;  2FXQ A;  4L5T A;  5FLM H;  2WFW A;  3CC4 A;  3CCM A;  4DV0 Q;  3U4V A;  1QZG A;  4P73 A;  1VQ8 A;  1Z47 A;  4HJ9 A;  2CCZ A;  3G48 A;  1EIF A;  5M5Y H;  4A75 A;  3HOZ H;  4DV6 L;  2JA6 G;  2UXD L;  1KL9 A;  3PO2 G;  4B3R L;  1VQJ A;  2ZJR A;  5LMU L;  1N36 Q;  2WB1 E;  1OXU A;  2VUM H;  4JG2 A;  4DV6 Q;  4GKJ L;  2JK8 A;  1CUK A;  2I5L X;  4MTN A;  4LF7 Q;  2JA8 G;  4BXX H;  4B3R Q;  4BBS H;  4YCU A;  1YHA A;  4A93 G;  4A3E G;  4A3M G;  1IBM L;  4PZ6 A;  3KF6 B;  1X56 A;  3KJP A;  2K4K A;  4PZ8 A;  2UXB Q;  2I5M X;  1UE7 A;  4GLX A;  4KHP Q;  4GNX C;  2AWN A;  1Q86 C;  4AIM A;  2UXD Q;  3CXC A;  4JI7 L;  4NXN Q;  1SRU A;  2E2J H;  4DV5 L;  3RR5 A;  3G6E A;  3D0F A;  3G71 A;  4DV7 Q;  3S16 H;  4NPS A;  1I50 H;  2OCE A;  1G6P A;  1VCI A;  2JE6 I;  2NZH A;  5IP7 G;  4KLK A;  1PH2 A;  1WFQ A;  1N8R C;  2NN6 G;  2QEX A;  4PMW A;  1X65 A;  3CCU A;  2ZJP A;  1T9H A;  5LMN L;  4R4T A;  2E8G A;  4HIM A;  4DR7 L;  5IT9 c;  5M3F G;  2JEA I;  1G51 A;  3L0O A;  4DR5 Q;  3HOX H;  2WAQ E;  2Z6K C;  1N34 Q;  3E9I A;  1FVI A;  3W1G A;  1YIJ A;  1K9M C;  1A8V A;  2OQ0 A;  1VQM A;  3T1Y L;  4O0A A;  1V1Q A;  2VL6 A;  3KF6 A;  1E3P A;  3CP0 A;  3K8A A;  3NEM A;  1KAW A;  2NVQ H;  4YY3 L;  3GD7 A;  3J81 i;  4JI6 L;  4LF5 L;  4HIK A;  2UXC L;  5IP9 G;  1PH4 A;  2GVB A;  4IPH A;  2CWA A;  3I2Z A;  5ELN A;  2KBN A;  3NBH B;  1PH6 A;  4DR6 L;  1WI5 A;  2PI2 E;  2EQS A;  4YY3 Q;  5M5W H;  1UE1 A;  4A3I G;  4LF5 Q;  1X3F A;  3PUX A;  4LF8 Q;  1L1O C;  5HGQ A;  1J5E Q;  1MJC A;  4C2M H;  3A5U A;  4B3S Q;  2CFM A;  1RL2 A;  1C9O A;  1VQC A;  3AFP A;  3CW2 C;  3ULP A;  1EQQ A;  1VQL A;  3HOY H;  4IJL A;  3PGZ A;  1C7Y A;  2NVT H;  4QIW E;  1G29 1;  4R4C A;  1SR3 A;  1XNQ L;  4DV2 Q;  3L2P A;  1HNZ L;  3S14 H;  1HNX Q;  4DK6 C;  1XMO Q;  3KYH C;  1YVC A;  2R7F A;  1XPR A;  3K80 C;  4DR1 Q;  3PSI A;  1KD1 C;  2IX1 A;  2RHS B;  3PIP A;  2ZM6 Q;  4JI4 L;  2LSS A;  1K83 H;  5H1S E;  3UE0 A;  3MXN B;  2YV5 A;  4OX9 Q;  3GTO H;  4JYA Q;  4L5R C;  2JA7 H;  4JI8 L;  1VQP A;  1VQ9 A;  4IFD G;  5IY0 A;  3PO3 H;  4A3L G;  2XGT A;  1R9T H;  3GTP H;  4X65 Q;  5JJK A;  1OXX K;  4DUZ Q;  3U4Z A;  1Q7Y C;  1C0A A;  4BY1 G;  2B63 G;  4IOA A;  3H3V I;  4GKK Q;  2IHF A;  2AMC B;  1OXS C;  3GTK H;  4DKA C;  2UU9 L;  3OW2 A;  5IWA L;  2K5N A;  1I3Q H;  2V1C C;  1K73 C;  5K36 G;  2NN6 I;  4IPG A;  5M3M G;  3F2B A;  3S17 H;  3FKI G;  3TS2 A;  4A3G G;  3GTJ H;  3D31 A;  3RLF A;  1Q82 C;  2R92 G;  3S2D H;  2YTY A;  4JBW A;  3TRZ A;  5C0X G;  2ZTE A;  5JEA J;  1LYL A;  4OO1 I; 
#chains in the Genus database with same CATH topology
 1FJG Q;  1K3B C;  4ZLT F;  1HXY D;  1KNE A;  1PTO D;  4FNF A;  1K0S A;  4A3E B;  1WCM H;  2L4N A;  1HZA A;  4DR2 L;  4GOP C;  1VS0 A;  4X3T A;  4K0K L;  2K33 A;  4CDE C;  1B3Q A;  2WB1 B;  4XQJ A;  2WV6 D;  5KYL A;  1LUZ A;  4J6H A;  3TP5 A;  2KEN A;  4B3T L;  4LF9 L;  5I9O A;  1WOC A;  2CW0 C;  4MHE A;  3CCR A;  2F3W A;  4DV0 L;  5COY A;  1VF5 C;  3K7A H;  3PIP 3;  1SRO A;  3M85 A;  4K6D A;  3I4M H;  1E7Z A;  5C44 H;  1N36 L;  2O2L D;  2RCN A;  4LK1 C;  1O7Y A;  4KJO A;  1VQ4 A;  2UUA Q;  3LWE A;  2EJG C;  2AUJ D;  1K8G A;  4LFA Q;  3HFZ B;  1B1Z A;  3CCJ A;  5IGD A;  2O5J C;  1Z7T A;  4Q0F A;  4TKO B;  4NXN L;  2D62 A;  1B7Y B;  1PZK D;  5DEH A;  2VQE Q;  4DV7 L;  4JI5 Q;  3FP9 A;  4QL5 A;  3GTM B;  2WB1 G;  3DEO A;  1QG7 A;  5EJW A;  2IWH A;  3AU7 A;  1Q8K A;  4DK1 A;  2OWO A;  5IIF A;  4XT3 B;  4BA2 I;  1EUJ A;  3CPW A;  1GOZ A;  4DR5 L;  5C0X I;  5DNF A;  2KJX A;  3NEL A;  4DR4 Q;  1B50 A;  3J7Z C;  1I4R A;  3I4N H;  3AFQ A;  1G6Z A;  2HD3 A;  4DR3 Q;  1SYG A;  5CV4 A;  4K2K A;  4B3M Q;  3HOV H;  1X54 A;  3NE5 B;  4DPG A;  4G4K A;  1Z9F A;  3IL8 A;  3UDF A;  2ENB A;  1EY8 A;  2D0P A;  4H44 C;  2XTI A;  4KY5 A;  3S1Q B;  5JJZ A;  1X3E A;  1GO3 E;  4C1N K;  5LL6 X;  2F0T A;  3S1N H;  4B9X A;  5M3M B;  1STG A;  3STB D;  4KHV A;  3VYS A;  3TZD A;  2UUC Q;  1PRT F;  1ROD A;  1GHK A;  4V19 0;  1CSP A;  3W2D A;  4X66 Q;  1KLU D;  5M5X H;  3PF5 A;  5KRU A;  4TSS A;  1SJE D;  4ID6 A;  1EY4 A;  4DR1 L;  5I6W A;  5C4J H;  2IY5 B;  4TRD A;  3U9S A;  1S5D D;  5EKL A;  3SVM A;  4DV4 Q;  5C4X B;  3KBG A;  1I4X A;  4HIO A;  3BYY B;  3AEV A;  4X65 L;  3R2I A;  1GKH A;  3Q0A A;  4GKK L;  1ASY A;  4NKL A;  2PO4 A;  2RCF A;  1ML0 D;  2K5D A;  3BYT B;  1GUO A;  3SK6 A;  4ZRZ A;  2F03 A;  1JOR A;  1PZI D;  1VQO A;  3GTG H;  5KNC A;  1AFP A;  3CC7 A;  2K5H A;  2A6H D;  4V0B A;  3W5O A;  1EWC A;  1Z6H A;  1YEZ A;  1I3Q B;  4RH6 A;  1XMQ Q;  3KDF B;  3S2D B;  5ISR A;  1VQN A;  4NMZ A;  2ZT9 C;  2YU9 H;  2LY7 A;  1SE2 A;  2J7Z A;  4X62 L;  4A3J B;  2VS1 A;  2K5W A;  2JA8 H;  2PCF B;  4A93 H;  2JA5 B;  4HJA A;  2MNA A;  2XSC A;  5CC4 A;  1RD9 D;  4KN7 C;  3A55 A;  4C3J B;  1NMG A;  5KIX A;  3CME A;  1NCV A;  1PH9 A;  3F8T A;  3EFX D;  1RTO A;  1GUN A;  1BBW A;  3BJU A;  1KRS A;  1LTG D;  4C3H B;  1FGB D;  3T13 A;  2F1M A;  1EWI A;  4HTH A;  5IP7 H;  1BBU A;  4ALP A;  4ZAI A;  2NN6 H;  4DXG A;  1SYE A;  1HPC A;  4UY8 C;  2K32 A;  1QVC A;  3J80 i;  3I73 A;  4PG3 A;  3FRP B;  3M7G A;  2NVX B;  2N3S A;  1C8C A;  2IX0 A;  1U4R A;  3MAQ A;  3QWN A;  4FP5 D;  1HA5 A;  3V05 A;  5IYD G;  4KY7 A;  3AYH B;  1VQ5 A;  3MFG A;  1PLF A;  1PRT D;  2KA7 A;  2XIW A;  1UAP A;  4JOI A;  4KKU A;  1EEF D;  1JWU D;  4F8M A;  4A3J G;  3GP7 A;  3CKI B;  2JA5 G;  4DU9 A;  2HCC A;  5CMD A;  3W1B A;  3UDX A;  1ILP A;  4DF7 A;  3B6Y A;  3H09 A;  5C4H A;  2ASB A;  4MTK A;  1S5C D;  3BG3 A;  3DWA A;  3M7N A;  3CRK C;  4C3H G;  4DK0 A;  3U9O A;  5IYC G;  5BR8 L;  1J9O A;  4QIW B;  4RCO A;  1ILQ A;  2MGS A;  2R7Z G;  4C1N I;  2BCO A;  4EQP A;  1GM5 A;  3T53 B;  4Y7N H;  4Q5V A;  1LTB D;  1FNU A;  1RIP A;  3A7L A;  3IRB A;  3I91 A;  4BY7 B;  3EN2 A;  2FMC A;  1X6O A;  4KY6 A;  3RZO H;  1WTH A;  3BVM A;  5LMN Q;  3NWS A;  5LMN W;  1STN A;  1IBK L;  3FKI H;  4LJZ C;  5M5W B;  4A3G H;  1UEB A;  3MVV A;  2UUB L;  1VF7 A;  2B2W A;  5ELE A;  1EQR A;  1HTL D;  4NW2 A;  3SK8 A;  2RHQ B;  4N9T A;  4A3D B;  3W3A A;  1IBL L;  1PH7 A;  1TWC B;  3HOW H;  3DM3 A;  2R93 H;  2Z0S A;  2D5D A;  4P71 A;  5FLX c;  2K6A A;  2UXC Q;  3PF4 A;  2N78 A;  2DY8 A;  2XRS D;  3HP3 A;  5EAY A;  4FF1 A;  1N32 L;  3QG1 A;  3D6C A;  4C3I H;  4NXM L;  1FGU A;  4IUP A;  4L5S A;  1ENA A;  1SEB D;  1VQB A;  3MXP A;  4UP9 A;  2E2I H;  5GQO A;  4QQB X;  1PH8 A;  4BY7 G;  2EY5 A;  3N52 A;  2Z9H A;  1F2M A;  1ZEQ X;  5IOD A;  1HNZ Q;  2JA6 G;  2MQH A;  5KEE A;  5C0X J;  1D8L A;  2F0D A;  5DAU A;  1CKN A;  3VYT A;  1O7I A;  2B39 A;  1TWA H;  1VQ7 A;  3S17 B;  2BH8 A;  3UE1 A;  4LF6 L;  4LUV A;  3GTJ B;  4AYB E;  1B3A A;  5BN4 A;  3D3R A;  2QW7 A;  2XVS A;  4GLV B;  4FO2 A;  2AHO B;  1PTO B;  4BBR B;  5IGG A;  4DV3 L;  3T1H L;  4A3D G;  1H9M A;  4MZ9 A;  4RMF A;  1U4M A;  1NJI C;  4IUU A;  2MO1 A;  2UU9 Q;  2KQ3 A;  2I46 A;  3MEF A;  4RHS A;  3KLR A;  2F0S A;  1YHB A;  1N33 L;  1TKW B;  1VQH A;  4MIU A;  2OQK A;  3GTL B;  1E2W A;  4A3B H;  2L0C A;  3J80 c;  1WD0 A;  3A54 A;  2JJQ A;  2CH4 A;  3OHX C;  3HOU H;  5KGU A;  3CQZ B;  1HZC A;  4DR2 Q;  1NNX A;  3ERS X;  3BS1 A;  4K0K Q;  1D1K A;  1VMC A;  2M00 A;  4ULL A;  5IYB G;  3S2H B;  4RGM A;  3A5Z B;  4CDD C;  2H4O A;  4JI0 L;  2Y0S G;  5C3E G;  1KDA A;  4B3T Q;  4DNT B;  5CV5 A;  4LF9 Q;  3CC4 A;  3HEJ A;  4DV0 Q;  3P20 A;  1QZG A;  1VQ8 A;  3MA2 B;  3G48 A;  3HOZ H;  4B3R L;  1ICF B;  2ZJR A;  1N36 Q;  1YNN C;  1CK1 A;  3S15 B;  2VUM H;  1TU2 B;  3MHB A;  4JG2 A;  3J81 L;  1BF4 A;  2JK8 A;  2I5L X;  2JSO A;  4BXX H;  2UXD Q;  1GUW A;  4BBS H;  4YCU A;  1HFG A;  5JVG 3;  4CJ1 B;  1PDQ A;  3SHL A;  2EY2 A;  2K1B A;  2AWN A;  4AIM A;  4KV6 A;  3CXC A;  4NXN Q;  5JAV A;  4DV5 L;  3RR5 A;  1HRJ A;  4DV7 Q;  2B2T A;  4WRD A;  1KDB A;  1I50 H;  3R3O A;  1TR5 A;  2QCP X;  3CRL C;  2BDN A;  2E76 C;  1WFQ A;  1LAC A;  1SMY D;  4PMW A;  2O5I C;  4R4T A;  3ITP A;  5IT9 c;  5M3F G;  1EYD A;  1G51 A;  4DR5 Q;  3HOX H;  2WAQ E;  1OO9 B;  1VQM A;  1HFN A;  1V1Q A;  3VR2 A;  3KF6 A;  2B63 B;  3CP0 A;  1JB3 A;  3S9W A;  2A6E D;  3TP7 A;  1PH4 A;  1L0X B;  3DWQ A;  2XRQ D;  4BWG B;  1PH6 A;  5I6Y A;  4DR6 L;  1WI5 A;  5ELC A;  3PUX A;  3S1R B;  4EVO A;  1AP0 A;  1EZ6 A;  3A5U A;  1ZYR D;  5FLX E;  2L55 A;  3GTQ B;  2NB0 A;  3PGZ A;  4J1M A;  2F0L A;  3BVG A;  1G29 1;  1CI3 M;  4R4C A;  1FR3 A;  2BDO A;  3J7A V;  3T16 A;  3L2P A;  3K59 A;  4RGO S;  2F0I A;  4DR1 Q;  2IX1 A;  4HSV A;  2RHS B;  4ILW A;  5H1S E;  5FO9 B;  2C5C A;  2EYL A;  1IW7 C;  1ENC A;  1JOQ A;  1CQF A;  1VQ9 A;  1VQP A;  5KNB A;  4IFD G;  1LTA D;  3A7A B;  1QIL A;  1CFM A;  1SYD A;  3TN2 A;  5JJK A;  4X65 Q;  3CU7 A;  1Y1V B;  2B63 G;  2EY1 A;  4GKK Q;  3EA6 A;  3KF8 A;  1OXS C;  2K05 A;  4KN4 C;  4DKA C;  3H6M A;  2K5N A;  1K73 C;  3KLS A;  1BO0 A;  5T1G A;  3ONA B;  1Q3L A;  2RA4 A;  5M9O A;  5I4D A;  1Y69 U;  4JBW A;  3M4O B;  4ZUJ A;  3D4W A;  4LAA A;  2K7V A;  1HJP A;  4LMQ D;  1A3V A;  2C9O A;  5E4X A;  2Z1C A;  1OXT A;  1V1O A;  2K75 A;  3J80 E;  1JB7 A;  3O13 A;  3BZD B;  2H5X A;  1QOH A;  3IFD A;  3CCQ A;  1ZKO A;  4KHZ A;  5A2Q L;  4GN3 B;  1WTO A;  1JJC B;  5FO7 B;  3GV3 A;  2L9H A;  2JQO A;  1DON A;  1MJE A;  1Y1V G;  4J15 A;  2KCT A;  4OEM B;  2KHJ A;  3MTS A;  3SEB A;  5J39 A;  3CMA A;  1PTO C;  2EPB A;  1PRT B;  1MD2 D;  1NR2 A;  3G6J B;  4JOI C;  4A4I A;  5AFW A;  1O80 A;  2B3G A;  4GLA C;  4OIK A;  4IFD I;  4BA1 I;  5J1Z A;  1DGS A;  2VY3 A;  2NBF A;  3RD4 A;  5E7N A;  4RGN A;  4A3I B;  1SNP A;  1YJN A;  1YIT A;  1XWE A;  3H0G G;  1YJ9 A;  3C2P A;  2E5L Q;  2EJM A;  3J81 j;  1EOT A;  1N34 L;  2EYF A;  4CKC A;  2R6G A;  2ES2 A;  1KTK A;  1BCP F;  3LWU A;  3MZ5 A;  1K8O A;  3QR8 A;  2IW3 A;  1WYD A;  3I4L A;  5JVH 3;  4XDX A;  1EIY B;  3Q8D A;  1RCV D;  3HKZ B;  2F0F A;  5BR8 Q;  4BY1 B;  4TVA B;  2CQO A;  2NZ1 D;  1J5E L;  1TS2 A;  4CDC C;  4L8J A;  4IPD A;  3KF8 B;  1KC8 C;  1J8I A;  4X6A H;  1EIH A;  4CKE A;  1TWF H;  4QF4 A;  1CTM A;  1CM9 A;  2PI2 A;  4A3F H;  4DV2 L;  2KHS A;  1V9P A;  1NAP A;  4MN3 A;  1D2B A;  4ME5 A;  1IBK Q;  4OX9 L;  3S1M H;  3I70 A;  1JJ2 A;  3MXU A;  2Q2I A;  2UUB Q;  2QF7 A;  1UUP A;  2NVY B;  4A3C H;  4KKT A;  1HA6 A;  1SMX A;  4DK3 C;  3SGI A;  1I6H H;  1IBL Q;  2ZJQ A;  3I90 A;  3HKZ G;  1E1O A;  5GAE C;  2E2H H;  2JEB I;  2CKZ B;  3EJI A;  1RKN A;  3STB C;  2F0N A;  1N32 Q;  2A74 C;  4DN4 M;  2EYJ A;  2ICI A;  1CZW A;  2DJF C;  1K0R A;  1CA6 A;  4NXM Q;  2E2D C;  5FK9 C;  3K5M A;  2BE5 D;  3T51 B;  4DAV A;  1Q1E A;  1FNW A;  1YJW A;  3BDC A;  1HH2 P;  4R4Q A;  4IOC A;  2ID0 A;  3PO2 H;  1JT8 A;  3L3O C;  2IJ0 A;  4LWC A;  1PYS B;  1TY2 A;  1QNK A;  4LF6 Q;  3NBI A;  2FIN B;  4DV1 L;  4A3E H;  4A3M H;  4KTA A;  4IJH A;  2BA1 A;  2MFI A;  1VMP A;  4ME3 A;  4NDX A;  3T1H Q;  4DV3 Q;  1O7L A;  2PZW A;  1BVS A;  2RVL A;  1PYW D;  4EQN A;  2DN8 A;  1BCP D;  2CHB D;  4JW0 A;  1U0L A;  2A6H C;  1N33 Q;  4RWS C;  1A3U A;  4LFC L;  3IFT A;  3PO3 G;  4FYD A;  4WJW A;  1R4Q B;  3K7A B;  5LHY 1;  2MO0 A;  1OXV A;  1W3S A;  3JAM L;  5AJ3 L;  5CYU A;  3I4M B;  3KDF A;  2PQA A;  5DLQ E;  1ONL A;  1JE5 A;  2EYH A;  4OWX B;  3F2C A;  2VXW A;  5M5Y B;  5HUR A;  1D5X C;  5FOB B;  3I3C A;  4AQY L;  2N88 A;  3GO5 A;  1JQY D;  1HQM C;  4JI0 Q;  1I4H A;  1JC7 A;  2IPK D;  2LFN A;  5IP9 H;  2VW9 A;  1WCM G;  3G7L A;  2ALY B;  2KHI A;  2PW5 A;  2F0H A;  4G7Z C;  3H3V C;  1JOO A;  1U5K A;  3GTM H;  3ND8 A;  2A19 A;  2E2J B;  1GHJ A;  1JMC A;  1YZ6 A;  4JPB W;  4H13 C;  3ULL A;  2B2T C;  4IN3 A;  1AZQ A;  2HQL A;  3R8B A;  2F4V L;  1BQQ T;  1HTP A;  1HR0 L;  1U9R A;  2AQ3 B;  3EIV A;  3MXG A;  3I4M G;  3CCE A;  3DHQ A;  5CGK A;  1SBB B;  5C44 G;  1PRT C;  2HHH L;  5G3L F;  3HOV B;  1EZ8 A;  4HID A;  4DV5 Q;  2EIF A;  4JV5 L;  1EY0 A;  2QDL A;  1UE6 A;  2GN5 A;  2R61 A;  4LNQ A;  1XPU A;  3T4A C;  2NVQ B;  3S1Q H;  2HCI A;  2PYK A;  3K5O A;  2B2U A;  4RAU C;  1EYC A;  2EOT A;  3X3N A;  2PNR C;  4RCN A;  5K36 H;  5M3M H;  4K8I A;  2EZV A;  1MGS A;  2R92 H;  3CD6 A;  4QMG A;  1KHI A;  1K8M A;  5C5L A;  4OIJ A;  3Q22 A;  1N9W A;  2L5T A;  5M5X B;  1E2V A;  4WJ4 A;  1KXL A;  2HQE A;  2FHT A;  5ELB A;  5C4J B;  1NSN S;  3ULJ A;  4IFD J;  1PV4 A;  3NQI A;  1Y1W H;  1BKB A;  4CJ0 B;  4DR6 Q;  3I4N G;  3HKS A;  5C4X H;  1XNR L;  2I07 B;  3OWE B;  2JXM B;  1GUT A;  3K81 C;  2EVB A;  4OGQ C;  3HOV G;  3GTO B;  1KDC A;  1XXG A;  3M4P A;  4X64 L;  4A76 A;  1BOS A;  1SE3 A;  1V43 A;  2OEO A;  4POF A;  3CAM A;  4IPC A;  1LV9 A;  1PH3 A;  3GV6 A;  1R9T B;  2Q2T A;  2GVA A;  4MNO A;  3KUP A;  3GTK B;  5E1F A;  2PPB C;  1B8A A;  5CV9 A;  5C5M A;  3GTG B;  3QOJ A;  2PQA B;  4K5X A;  1C48 A;  2WP8 J;  3URY A;  2VB3 X;  3H91 A;  4PMB A;  2K5V A;  3OTO L;  2CH4 W;  3TEH B;  1SJH D;  4B9W A;  4OWW B;  1LT3 D;  1Q8I A;  1STH A;  1AZP A;  2OTL A;  3ERQ A;  1FL0 A;  2JA8 B;  3K7U C;  1WJJ A;  1ZXT A;  1DD2 A;  1Q1B A;  4LW1 A;  4JCV E;  3F2D A;  4C3J H;  5IOC A;  3BZK A;  3MXN A;  4I7Z C;  2IT1 A;  2NYZ D;  5EPL A;  2R7Z B;  4RFB A;  5LL6 S;  3P7J A;  4R1J A;  3A0J A;  4RG1 A;  1I94 Q;  1YBY A;  1DZ1 A;  1AE2 A;  4OO1 H;  5G3L D;  1XTD A;  1MKH A;  4RKL A;  3FEW X;  3TS0 A;  2EXZ A;  4R4I A;  2TSS A;  2HIX A;  1DM0 B;  4R9W A;  1B70 B;  4PMC A;  1F77 A;  1KIX A;  5FLM H;  3CCM A;  4P73 A;  4F88 A;  4HJ9 A;  2CCZ A;  1RF2 D;  1SYF A;  1KL9 A;  2KED A;  1VQJ A;  5CBA E;  2F0G A;  4DV6 Q;  2JA8 G;  3V96 A;  4A93 G;  1IBM L;  4K2L A;  4PZ6 A;  3KJP A;  2K4K A;  4PZ8 A;  5L37 A;  1LT6 D;  1UE7 A;  1AEX A;  2WKC A;  3PMF A;  1DXM A;  3M4Y A;  3A8K E;  3SE0 A;  5C3X A;  1U4P A;  2EYO A;  3G71 A;  3S16 H;  4KD3 A;  4NPS A;  5KND A;  1GXD C;  1G6P A;  5IP7 G;  1PH2 A;  2JN4 A;  2NN6 G;  2KCN A;  2TMP A;  1TQO A;  3KLS X;  2ZJP A;  4HIM A;  3QO2 A;  3OMC A;  4DR7 L;  2JA6 B;  3NHH A;  1N34 Q;  3VR6 A;  3E3X A;  2FJ2 A;  4U67 3;  2PW7 A;  1TWG B;  3T1Y L;  4O0A A;  5DM6 3;  3GQB A;  3NTI A;  1II3 A;  3I72 A;  2VL6 A;  1WD1 A;  2A73 B;  1KAW A;  2HDL A;  2KEC A;  2RSN A;  4CBV A;  2GVB A;  4IPH A;  2CWA A;  1PZJ D;  5ELN A;  3NBH B;  1CQV A;  4YY3 Q;  3FKI B;  2EQS A;  2NTS A;  2K03 A;  5ELD A;  5M5W H;  4LF5 Q;  4A3G B;  2F0M A;  5FO8 B;  5HGT A;  1J5E Q;  4C2M H;  1C9O A;  1Q90 A;  3CW2 C;  3HOY H;  1EQQ A;  1SMY C;  3HOW B;  2OXP A;  3KK7 A;  4QIW E;  3FVQ A;  5JPM C;  1XNQ L;  4DV2 Q;  3S14 H;  3I8Z A;  5JEA H;  2R7F A;  1XPR A;  3K80 C;  3PSI A;  1KD1 C;  4HMI A;  1K83 H;  3UE0 A;  3MXN B;  1K28 A;  4KK7 A;  4OX9 Q;  2JA7 H;  3DUZ A;  3EVQ A;  5IY0 A;  5IGC A;  2Y0S B;  2A6E C;  5C3E B;  1D1I A;  3NTH A;  3VR3 A;  4EGV A;  3GTP H;  1ESF A;  5I2Y A;  5EKI A;  3IAY A;  2ZXO A;  5IWA L;  4F7X A;  2V1C C;  2NN6 I;  3NTK A;  4IPG A;  1ZYR C;  5COR A;  3FKI G;  5EPK A;  3S17 H;  3GTJ H;  4A3G G;  5JJI A;  2YTY A;  3TBI B;  4AYB G;  2E75 C;  4OO1 I;  1PTO H;  4GS3 A;  4BBR H;  4JI2 L;  4RGT A;  4YCV A;  5E3F A;  3HOW G;  1A62 A;  2R93 G;  4H02 A;  1VDZ A;  4DAY B;  4WFN 3;  1HUN A;  2OTJ A;  1EFW A;  1GVP A;  4C3I G;  2Q2H A;  4HCS A;  4O42 A;  3MC0 B;  4A3B B;  1BCP B;  3VYU A;  4HSP A;  4G57 A;  4JI1 L;  5FJ8 H;  1GUS A;  2EJF C;  2KCM A;  4DAM A;  4DV1 Q;  3CQZ H;  2A68 D;  3RZD H;  4EX5 A;  4N9P A;  1H9R A;  5M3F B;  1NMF A;  4L63 B;  3S2H H;  2NUC A;  3OPO A;  1FNV A;  4HJ7 A;  2ATW A;  3ICE A;  1RJT A;  1QUQ A;  4FF3 A;  1S40 A;  3D8G A;  4LFC Q;  1A0I A;  3TSS A;  1X9N A;  3U58 A;  3F1Z A;  2UXB L;  4WOR A;  4ODG A;  2L15 A;  5AJ3 Q;  4KHP L;  4UDU C;  5I2X A;  4QY7 A;  1TWH B;  4ZYS A;  3S15 H;  2K52 A;  1TS5 A;  4QGU A;  1D6E C;  3IKJ A;  4AQY Q;  3TP8 A;  1B9M A;  3PIO A;  1P8L A;  4A3B G;  4UP7 A;  2PNH A;  3HOU G;  1QNU A;  4NP5 A;  1LM0 A;  4A3K H;  1Q46 A;  3KOJ A;  3K0Y A;  4CHT B;  1SNC A;  2F0W A;  3CCS A;  4U68 A;  2CQA A;  2N49 A;  1VQE A;  3OYY A;  1I4P A;  3M3Y B;  4HJ5 A;  1I50 B;  3TQY A;  1D5M C;  3TZU A;  1W2B A;  4OL7 A;  2AQ1 B;  3SK4 A;  3JAM i;  2F4V Q;  5FLX L;  1Q12 A;  1HR0 Q;  2Z6K A;  4XXE A;  1HR0 W;  2UUC L;  4LF8 L;  1SFO H;  2B2U C;  1SNQ A;  2QEJ C;  3SK5 A;  2WAQ G;  1PH5 A;  3HOZ G;  4B3S L;  1LT4 D;  3VR5 A;  1O78 A;  2HHH Q;  5C3W A;  2VUM G;  2Q2U A;  2DNE A;  4HR7 B;  4BXX G;  4BBS G;  5JJL A;  3J7A F;  1IYJ B;  1VQK A;  1QE6 A;  2NZO A;  2LKV A;  3FHW A;  1X3G A;  2ZM6 L;  3S1R H;  1LTI D;  2IL8 A;  2PZT A;  2PMZ B;  3PIO 3;  2B2Y A;  1H9J A;  3U50 C;  3GTQ H;  4K5W A;  1IYV A;  4DUZ L;  2RSO A;  4YWL A;  1ASZ A;  2I0Q A;  1EL0 A;  3HOX G;  1EY7 A;  2QKI C;  2A69 C;  5EBC A;  1QJO A;  1XNR Q;  3R93 A;  4LUZ A;  1KAB A;  4O2D A;  1AH9 A;  1SLJ A;  3RN2 A;  4X64 Q;  1L2F A;  1CHP D;  1V1P B;  3X3M A;  2EY6 A;  2Q8T A;  1YHQ A;  3BDO A;  2VQF L;  1QUQ B;  1SE8 A;  3PUV A;  1D7Q A;  2MJ8 A;  3NQT A;  4LFB L;  3KBX A;  5K5P A;  3M4O H;  1Y14 B;  3H0G B;  3BU2 A;  1WTV A;  4L5Q A;  4DXF A;  3UI2 A;  4K8J A;  2M2L A;  1Q81 C;  4X62 Q;  1E0B A;  2DJG C;  3OTO Q;  2AKW B;  1YI2 A;  1DJR D;  1JWS D;  4X3S A;  1BNZ A;  2BE5 C;  4NB3 A;  1JE4 A;  4XQQ A;  3OIQ A;  4YIJ A;  4ZQ3 A;  4P75 A;  2QDB A;  1CT1 D;  4I7A A;  1E1T A;  3A74 A;  4HN7 A;  1F2L A;  2KOL A;  1SNO A;  1EU3 A;  4KI0 A;  1NY4 A;  1IL2 A;  3BDL A;  1TII D;  2Z4H A;  4FVM A;  1K8A C;  3OMG A;  3CCL A;  1EEI D;  3T56 B;  4A3I H;  1BCP C;  2HUG A;  1ENF A;  4KJN A;  1XJV A;  4P74 A;  3Q6S A;  4OXP A;  3JAM c;  4PZ7 A;  1CHQ D;  1J6Q A;  4OON A;  4YWK A;  2LS0 1;  1S3O A;  3DEP A;  1IBM Q;  1PFM A;  5TSS A;  4EQ5 A;  5IT9 E;  4YHH L;  4JI3 L;  1SXT A;  1KNA A;  1YNX A;  4FXK C;  2Q8R E;  3GDE A;  4YCW A;  4HJ8 A;  1AE3 A;  3P75 A;  2F0O A;  2Z4I A;  2HT1 A;  4A3L H;  5EQ0 A;  5IE8 A;  1CKO A;  4QJF A;  4KKS A;  1G91 A;  4BS9 A;  1KAA A;  4BY1 H;  3PUW A;  5BN5 A;  4FF4 A;  1FD7 D;  4X3U A;  4DR7 Q;  2WKD A;  4R4O A;  2BH2 A;  1AW7 A;  2A1A A;  5C0X H;  2IX3 A;  2D2C C;  3JC6 6;  2SEB D;  2Z8L A;  3NSW A;  4ZUI A;  4LF4 L;  5EKK A;  3T1Y Q;  4A3F B;  2WII B;  3N6R A;  1XPO A;  3KJO A;  3C46 A;  2NVT B;  2F52 A;  1KLG D;  3RNU A;  2K04 A;  1PFB A;  1NR4 A;  4TQU S;  1OTC A;  2PZU A;  1IZ6 A;  1W6K A;  4IUQ A;  2I5H A;  3CHB D;  1R4P B;  2NVY H;  1I4G A;  1CKM A;  3HKZ E;  3PO3 B;  3I56 A;  1HNW L;  4E6I A;  4APV A;  1E22 A;  2AUK A;  1XNQ Q;  2K01 A;  1KRT A;  4IZ8 A;  4JBJ A;  1MBY A;  3UDG A;  2AWO A;  1EY9 A;  2A8V A;  2SNS A;  1GD7 A;  2EYM A;  1IL8 A;  1C4Q A;  1SYB A;  2XN9 C;  1MIU A;  2B8G A;  1UNS A;  1A63 A;  3K58 A;  3TRE A;  4A3F G;  3VA7 A;  1A15 A;  1WCM B;  2A5H A;  1F2Z A;  3PO2 B;  1F9P A;  2QA4 A;  4G7H C;  4DUY L;  3P1H A;  4O1N A;  1H9S A;  2CWP A;  5IWA Q;  1TXY A;  1SDF A;  1A3T A;  4A3M B;  1I4Q A;  3PQI A;  4A3C G;  3Q24 A;  5C6A A;  3ER0 A;  2EYP A;  4FF2 A;  3NWT A;  4JI2 Q;  2MHV A;  2FFK B;  3LGJ A;  3DMU A;  1IXR A;  1ESR A;  2FMM A;  3KFU A;  1LTL A;  1PVO A;  3K5L A;  2K28 A;  5C44 B;  1S5B D;  3TME A;  1VQF A;  1DOK A;  1F9Q A;  5T1I A;  3CCV A;  3PUY A;  4CKB A;  4JI1 Q;  4L5T A;  2WFW A;  2XWB B;  4PNY A;  4JVZ A;  1DCZ A;  1EIF A;  5M5Y H;  4A75 A;  1EIG A;  1QB5 D;  2UXD L;  1EYA A;  3PO2 G;  1EFI D;  5D14 A;  5LMU L;  1DOM A;  2WB1 E;  2RBM A;  1WVL A;  2MUY A;  1STB A;  2F0J A;  4MTN A;  1CUK A;  4GKJ L;  4B3R Q;  1YHA A;  1TS3 A;  4DFA A;  2KCC A;  4XYQ A;  4A3E G;  4N8F A;  4A3M G;  3TP6 A;  5D3I B;  2UXB Q;  3WDN A;  3D6W A;  2I5M X;  4GLX A;  4KHP Q;  4GZY C;  3JAM E;  1Q86 C;  2E74 C;  3C3L A;  4JI7 L;  3I4N B;  2E2J H;  5IGF A;  1BBX C;  3D0F A;  4CJ2 C;  5EBD A;  2JE6 I;  2NZH A;  1WTX A;  4KLK A;  3MFY A;  1WTR A;  2QEX A;  3OWF A;  1X65 A;  2ZXP A;  1B9N A;  3QIA A;  1S5E D;  5KYI A;  2JEA I;  2Z6K C;  3E9I A;  3L9A X;  3S1N B;  1A8V A;  2Q8I B;  2OQ0 A;  4ZK9 B;  4RHR A;  1PXU A;  4RA8 A;  2B2V A;  3K8A A;  2NVQ H;  3J81 i;  3GD7 A;  1SNM A;  1JOK A;  3HS0 C;  4JI6 L;  4X3K A;  5IP9 G;  4F87 A;  3RMH A;  5I9P A;  1YNJ D;  3I2Z A;  2KBN A;  2EE1 A;  1F9R A;  2PI2 E;  5BN3 A;  4LF8 Q;  2R92 B;  1MJC A;  4B3S Q;  3OSO A;  4N8X 1;  3AFP A;  2B2Y C;  4IJL A;  4UHV A;  1C7Y A;  1H9S B;  1EY6 A;  4DGZ A;  5F2D A;  4QCL A;  1Y1W B;  4DK6 C;  4DAP A;  1YVC A;  1LTT D;  2ZM6 Q;  4JI4 L;  2ZXR A;  2YV5 A;  3GTO H;  4L5R C;  4JI8 L;  3QOL A;  3QB3 A;  2XGT A;  1R9T H;  1OXX K;  1SE4 A;  3U4Z A;  4DUZ Q;  1Q7Y C;  3NBH A;  4IOA A;  2CW0 D;  3VR4 A;  2IHF A;  2AMC B;  3GTK H;  1ET9 A;  1I3Q H;  5K36 G;  5M3M G;  5IYD H;  3S2D H;  3RLF A;  2R92 G;  2YU9 B;  3TRZ A;  2XNA C;  3DWP A;  4A3J H;  1H9K A;  1Y8P B;  4A93 B;  1BXT A;  2JA5 H;  1PHJ A;  3EBE A;  1UWV A;  1DYQ A;  1JR0 D;  1B2T A;  4HMJ A;  3ERO A;  5A35 A;  2VQF Q;  2YYZ A;  3ND9 A;  1Y1W G;  1G8Z D;  3CC2 A;  1F2Y A;  3FMC A;  5C4X G;  3NP8 A;  4LFB Q;  5J3B A;  4C3H H;  1Y8N B;  5DM7 3;  4HED A;  5IYC H;  3DXJ C;  4XQN A;  1VQD A;  4UAI A;  1TT2 A;  4YWM A;  2BOS A;  3HZX A;  2R7Z H;  2G9D A;  3C1F A;  4M8A A;  4CDF C;  2D9U A;  4JBK A;  4JBM A;  5D65 A;  2J4X A;  3J7A 5;  2NVX H;  4M1U B;  3HGB A;  4LF7 L;  3D4R A;  3ZJY C;  4Z9C B;  1F9S A;  1QVF A;  4DAY A;  4OEL B;  5IGB A;  5GRO A;  1WTP A;  2LXJ A;  2F3V A;  2E5L L;  2O4X A;  1WTQ A;  2YTV A;  1BUV T;  3QJY A;  3NEN A;  4P72 A;  4OWT B;  4DA2 A;  2G9H D;  1PA6 A;  2A68 C;  4C3J G;  1E24 A;  4GNX A;  3I4O A;  3I7F A;  2X69 A;  4QB4 A;  2JA9 A;  4HAE A;  1PFS A;  3E6Z X;  2J0T D;  2G5D A;  4GN4 B;  1P16 A;  3S16 B;  4OO1 G;  2IHE A;  4Y7N B;  3J81 c;  2X6L A;  1S4Z A;  2ZTC A;  4XYO A;  2F3I A;  4BY7 H;  1HCZ A;  2MPM A;  4H0L C;  5FLM G;  2NTT A;  1T5E A;  2OF1 A;  2JA6 H;  3RZO B;  4YHH Q;  3BVZ A;  4JI3 Q;  4EQO A;  2N8N A;  2QGQ A;  1JIC A;  1TWG H;  1ET6 A;  1X55 A;  4PV1 C;  2B29 A;  3HG9 A;  4AYB B;  4ABN A;  4DNR B;  3CF5 A;  4IQZ A;  4A3D H;  1HNX L;  3RUZ A;  4AH6 A;  5GAH C;  1TWC H;  1V8Q A;  3M4Q A;  1XMO L;  2R93 B;  2F0U A;  3VDY A;  1CA5 A;  1L1O A;  1HHV A;  2DY7 A;  1HZ9 A;  3FPU B;  1S72 A;  4C2M B;  2Z6B A;  4C3I B;  4JYA L;  1NUC A;  3HOY B;  4IO9 A;  4XTC S;  3LX0 A;  3A8I E;  1LAB A;  2ICE C;  2WAC A;  4LF4 Q;  3S14 B;  1SSO A;  1WTW A;  2E2I B;  1STE A;  3NUC A;  1NTG A;  4ZKB B;  1K83 B;  1MI2 A;  4UP8 A;  2KEE A;  3PCO B;  5IYB H;  2JA7 B;  1MHW C;  2RDG A;  1PYB A;  3MEH A;  3EQL C;  1TWA B;  1G2S A;  1FJG L;  1IKL A;  1SN8 A;  5C3E H;  2K14 A;  1EOV A;  4JC0 A;  3GTP B;  3VA5 A;  4POG A;  3WOF A;  3J7Y W;  1K3R A;  1TY0 A;  1VQA A;  1HNW Q;  4PQX A;  2PQE A;  2F0E A;  4DNI A;  3PV0 A;  2L12 A;  4CGY B;  3HRZ C;  2C35 B;  2WIN B;  3R2T A;  3PUZ A;  2L11 A;  1O7Z A;  2SNM A;  3HOY G;  1SND A;  3GTL H;  3OW7 A;  3E9H A;  4GOP A;  1VQ6 A;  2EXD A;  3HOU B;  2R7D A;  5GAG C;  1B53 A;  1B44 D;  1MSH A;  5JEA G;  4LUO A;  4DUY Q;  2HIV A;  2F0K A;  4GNX B;  1LT5 D;  4G7O C;  2Y0S E;  2JA7 G;  4IUV A;  2UUA L;  1V1P A;  3KLW A;  3AB9 A;  3V2T A;  3L7Z C;  4LFA L;  3RZD B;  3H15 A;  1BR9 A;  1QZH A;  1U4L A;  5M3F H;  3WWV A;  3VYR A;  1JWM D;  3OIP A;  1CSQ A;  1MSG A;  1QVG A;  2VQE L;  5C4Z A;  4JI5 L;  1RDP D;  3HOZ B;  2WAQ B;  5HY6 A;  2KUM A;  2VUM B;  2F4I A;  2NWG A;  1UE5 A;  2JP1 A;  4L6T B;  4BBR G;  4BBS B;  1HZB A;  1JCK B;  3M9B A;  4RKB A;  5EPJ A;  3CPF A;  1STA A;  1TWH H;  4DR4 L;  3MWY W;  1Y8O B;  4KD4 A;  1EYG A;  4DR3 L;  1E2Z A;  4B3M L;  1GJX A;  1L0W A;  5LMU Q;  1L1O B;  4FXD A;  3AQQ A;  1UEA B;  5FJ8 G;  4GKJ Q;  4A3K B;  1QCB D;  2SDF A;  1A2T A;  3RLO A;  1QWY A;  1NBW A;  3J81 E;  3M3Y H;  4Y52 H;  2LMC B;  2RKS A;  2XWJ B;  4WJ3 M;  3HOX B;  4JI7 Q;  1GUG A;  4IFD H;  3LNN A;  4FXG C;  4KMU C;  1LLR D;  2RF4 A;  4X66 L;  1NE3 A;  1VQI A;  2B63 H;  4ZCK A;  2F0Q A;  5GAD C;  3BZC A;  2B2V C;  2H1E A;  3F2U A;  3A8J E;  1M90 C;  4JV5 Q;  2QIL A;  1SFO B;  4QUF A;  2K5Q A;  5E4W C;  4HCE A;  2RDH A;  4DV4 L;  3Q23 A;  1CKN B;  1SAP A;  1I5F A;  1IYU A;  3G4S A;  3S24 A;  5D3D A;  3A56 A;  4JI6 Q;  3SXH A;  1STY A;  4A3K G;  1PH1 A;  2EDG A;  3SDZ A;  1EQT A;  4GOP B;  4B08 A;  4QUC A;  1HUM A;  2YTX A;  4XIG S;  3DLL A;  1BDO A;  3I55 A;  2RDF A;  1KQS A;  3J80 L;  3RLN A;  1Y1V H;  2DUD A;  3K0X A;  3K6O A;  1XMQ L;  1EY5 A;  2M9V A;  4JI4 Q;  1H95 A;  2B8F A;  4K5V A;  5NUC A;  4JI8 Q;  2MP1 A;  2D0O A;  5IGE A;  1ICW A;  3E0E A;  5CR3 A;  5J22 A;  3AMU A;  3K5N A;  3DM1 A;  1M1K C;  2PMZ E;  4H7B A;  1VQG A;  1JJG A;  2R3Z A;  2V4D A;  1X3P A;  3H0G H;  3H3V H;  2VNU D;  1YNN D;  2DGY A;  3C1E A;  1M4V A;  3NPP A;  4UPA A;  3RN5 A;  1SYC A;  3UDI A;  1I94 L;  1DOL A;  4FDB A;  4JK1 C;  1XTC D;  1EU4 A;  2ZTD A;  4GN5 A;  3K57 A;  3E5S A;  5CV6 A;  2LXK A;  2L1B A;  4J8Q A;  2BA0 A;  2F0V A;  5CBE E;  3FDT A;  5ELO A;  2VZA A;  5ELF A;  1W6J A;  2K50 A;  1XYI A;  1T5X D;  4IAL A;  2FXQ A;  3U4V A;  1Z47 A;  4DV6 L;  4OHJ A;  1FYC A;  5A2Q E;  1LO5 D;  1LTS D;  5IT9 L;  1OXU A;  1A2U A;  4LF7 Q;  1RHP A;  1PTO F;  4IUT A;  5JOB A;  3KF6 B;  1X56 A;  3FPP A;  2SOB A;  5FKA C;  4GNX C;  2VB2 X;  1L0Y B;  2X6G A;  4IUR A;  1SRU A;  4K6L A;  3NXW A;  3G6E A;  2RQX A;  4I65 A;  2OCE A;  4P2C B;  1VCI A;  2P5Z X;  1N8R C;  4K14 A;  1S5F D;  1AN8 A;  1PFN A;  3CCU A;  5LMN L;  1T9H A;  1EQV A;  3D4D A;  2E8G A;  2DNC A;  2N55 A;  1B4O A;  2CVR A;  3L0O A;  1EWH A;  1K9M C;  1FVI A;  3W1G A;  1YIJ A;  1I6V C;  4XT1 B;  1A6X A;  1IW7 D;  1CZG A;  3ZYY X;  1E3P A;  3NEM A;  4YY3 L;  1TWF B;  4LF5 L;  4HIK A;  2UXC L;  1UE1 A;  4A3I G;  1X3F A;  4R8I A;  2F0P A;  1L1O C;  2A69 D;  5HGQ A;  1D5Z C;  2CFM A;  1RL2 A;  1VQC A;  3S1M B;  2B2W C;  1X32 A;  1X3Q A;  2OT2 A;  1LTR D;  3ULP A;  4R8N A;  1VQL A;  3E0J A;  3WOE A;  2KVM A;  2NVT H;  3H94 A;  1SR3 A;  2HDM A;  1HNZ L;  1I6H B;  1HNX Q;  1PMR A;  1XMO Q;  3KYH C;  3TDQ A;  2E2H B;  1TS4 A;  4C56 C;  3PIP A;  2LSS A;  2GA4 B;  5JPN C;  5EGT A;  2JYO A;  4IUN A;  5CV7 A;  4JYA Q;  3PO3 H;  1IHZ A;  4A3L G;  1HQR D;  1YNJ C;  3OOC A;  5CV8 A;  2AQ2 B;  1C0A A;  4BY1 G;  3H3V I;  1XX8 A;  4S3S A;  3NK9 A;  2UU9 L;  3SR1 A;  3OW2 A;  3F2B A;  3TS2 A;  1IKM A;  1M8A A;  1G2T A;  3D31 A;  1TVX A;  1Q82 C;  5C0X G;  2ZTE A;  4ZKC B;  5JEA J;  1RTN A;  1LYL A; 
#chains in the Genus database with same CATH homology
 1FJG Q;  4GS3 A;  2JA5 H;  1HJP A;  4BBR H;  1PHJ A;  3EBE A;  4JI2 L;  1WCM H;  1UWV A;  1HZA A;  4YCV A;  4DR2 L;  1A62 A;  3HOW G;  2R93 G;  4H02 A;  4GOP C;  1VS0 A;  2VQF Q;  4DAY B;  4K0K L;  2YYZ A;  1OXT A;  2OTJ A;  1EFW A;  1GVP A;  2K75 A;  1Y1W G;  3CC2 A;  1JB7 A;  2Q2H A;  5C4X G;  1LUZ A;  4LFB Q;  5J3B A;  2H5X A;  2KEN A;  4C3H H;  4B3T L;  4JI1 L;  5FJ8 H;  4KHZ A;  5IYC H;  3CCQ A;  4GN3 B;  1VQD A;  2KCM A;  4DAM A;  4LF9 L;  1WOC A;  4AYB G;  3CQZ H;  3CCR A;  4DV1 Q;  4YWM A;  4DV0 L;  1JJC B;  2R7Z H;  3K7A H;  3RZD H;  1SRO A;  3M85 A;  2JQO A;  1MJE A;  1Y1V G;  4EX5 A;  4J15 A;  3I4M H;  2KCT A;  1E7Z A;  1NMF A;  3S2H H;  5C44 H;  4JBK A;  1N36 L;  4JBM A;  2KHJ A;  3J7A 5;  2NVX H;  4HJ7 A;  2ATW A;  3ICE A;  2RCN A;  3CMA A;  4LF7 L;  3ZJY C;  1QUQ A;  1S40 A;  1VQ4 A;  4LFC Q;  1A0I A;  4JOI C;  2UUA Q;  1X9N A;  4A4I A;  1QVF A;  3U58 A;  3F1Z A;  2UXB L;  1K8G A;  4LFA Q;  2B3G A;  3HFZ B;  2L15 A;  5AJ3 Q;  5GRO A;  4KHP L;  4GLA C;  3CCJ A;  2LXJ A;  4IFD I;  4QY7 A;  4BA1 I;  1DGS A;  2VY3 A;  4NXN L;  5E7N A;  2E5L L;  2D62 A;  1B7Y B;  2YTV A;  3S15 H;  2VQE Q;  4DV7 L;  4JI5 Q;  2K52 A;  4QGU A;  1YJN A;  1YIT A;  3FP9 A;  3H0G G;  1YJ9 A;  4QL5 A;  2WB1 G;  3NEN A;  4P72 A;  4AQY Q;  3PIO A;  1P8L A;  2E5L Q;  4A3B G;  4OWT B;  1PA6 A;  1Q8K A;  4UP7 A;  2PNH A;  3HOU G;  1E24 A;  4GNX A;  2OWO A;  1LM0 A;  3I4O A;  3I7F A;  4A3K H;  4BA2 I;  1EUJ A;  3CPW A;  1Q46 A;  3KOJ A;  3J81 j;  2JA9 A;  5C0X I;  4DR5 L;  1PFS A;  3NEL A;  1N34 L;  4DR4 Q;  3CCS A;  3J7Z C;  3I4N H;  3AFQ A;  2N49 A;  1VQE A;  3OYY A;  4GN4 B;  1P16 A;  2R6G A;  4DR3 Q;  2IHE A;  4HJ5 A;  2ES2 A;  3TQY A;  4OO1 G;  4B3M Q;  3J81 c;  3HOV H;  1X54 A;  1W2B A;  2ZTC A;  1WYD A;  4DPG A;  1EIY B;  1Z9F A;  3Q8D A;  2F3I A;  3UDF A;  3JAM i;  4BY7 H;  2F4V Q;  5BR8 Q;  5FLM G;  2D0P A;  4TVA B;  1Q12 A;  2JA6 H;  1HR0 Q;  2XTI A;  2Z6K A;  2CQO A;  1X3E A;  1HR0 W;  4YHH Q;  2UUC L;  1GO3 E;  1SFO H;  4JI3 Q;  4LF8 L;  1J5E L;  1PH5 A;  3HOZ G;  3S1N H;  2WAQ G;  4B3S L;  2N8N A;  3STB D;  2QGQ A;  1TWG H;  2HHH Q;  2UUC Q;  4IPD A;  1X55 A;  3KF8 B;  1KC8 C;  2Q2U A;  2VUM G;  4X6A H;  1CSP A;  2B29 A;  1TWF H;  3CF5 A;  4BXX G;  4X66 Q;  4BBS G;  5JJL A;  2PI2 A;  4A3F H;  5M5X H;  4DV2 L;  3PF5 A;  1IYJ B;  4A3D H;  1HNX L;  5GAH C;  4AH6 A;  1XMO L;  1TWC H;  3M4Q A;  2NZO A;  1V9P A;  1VQK A;  3FHW A;  3VDY A;  4DR1 L;  1L1O A;  1X3G A;  2ZM6 L;  1HZ9 A;  3S1R H;  5C4J H;  2IY5 B;  1S72 A;  1IBK Q;  4OX9 L;  3S1M H;  4JYA L;  4DV4 Q;  4IO9 A;  1JJ2 A;  3U50 C;  2Q2I A;  4XTC S;  3GTQ H;  4HIO A;  2UUB Q;  3AEV A;  4A3C H;  4X65 L;  4LF4 Q;  1GKH A;  4DUZ L;  1SMX A;  4DK3 C;  3SGI A;  4GKK L;  4YWL A;  1IBL Q;  1ASZ A;  1ASY A;  2ZJQ A;  1I6H H;  2I0Q A;  3HKZ G;  1E1O A;  5GAE C;  1NTG A;  2E2H H;  2JEB I;  2CKZ B;  4UP8 A;  1KXL A;  3PCO B;  3STB C;  5IYB H;  3HOX G;  1N32 Q;  1K0R A;  1PYB A;  4NXM Q;  1XNR Q;  4LUZ A;  1VQO A;  4O2D A;  1FJG L;  3GTG H;  1SN8 A;  5C3E H;  2K14 A;  1EOV A;  2K5H A;  4JC0 A;  1SLJ A;  3CC7 A;  4POG A;  1Q1E A;  3RN2 A;  4X64 Q;  1L2F A;  1K3R A;  1VQA A;  1YJW A;  1HNW Q;  1YHQ A;  2VQF L;  1HH2 P;  3W5O A;  1QUQ B;  1YEZ A;  3PV0 A;  4DNI A;  1AH9 A;  1SE8 A;  3PUV A;  4R4Q A;  1XMQ Q;  1D7Q A;  3KDF B;  4IOC A;  2ID0 A;  3PO2 H;  1VQN A;  2C35 B;  4LFB L;  2YU9 H;  3M4O H;  1JT8 A;  4X62 L;  4LWC A;  1Y14 B;  1PYS B;  2VS1 A;  3BU2 A;  3PUZ A;  2JA8 H;  4A93 H;  4L5Q A;  4LF6 Q;  4HJA A;  3HOY G;  2MNA A;  3GTL H;  4DV1 L;  3E9H A;  4A3E H;  4A3M H;  1Q81 C;  4GOP A;  4X62 Q;  4IJH A;  1VQ6 A;  1NMG A;  2BA1 A;  2EXD A;  2MFI A;  2R7D A;  4ME3 A;  5GAG C;  3OTO Q;  2AKW B;  3T1H Q;  4DV3 Q;  5JEA G;  3CME A;  1YI2 A;  1PH9 A;  3F8T A;  1BVS A;  4LUO A;  3BJU A;  1BBW A;  4DUY Q;  1KRS A;  2HIV A;  4GNX B;  4NB3 A;  1U0L A;  1N33 Q;  1EWI A;  2Y0S E;  4LFC L;  5IP7 H;  2UUA L;  2JA7 G;  1BBU A;  4ALP A;  3KLW A;  3PO3 G;  3L7Z C;  4P75 A;  4LFA L;  4UY8 C;  2MO0 A;  1OXV A;  1W3S A;  5AJ3 L;  1QVC A;  3J80 i;  3H15 A;  5IYD H;  1QZH A;  3KDF A;  2PQA A;  3WWV A;  5M3F H;  4PG3 A;  1CSQ A;  5DLQ E;  1JE5 A;  1E1T A;  3A74 A;  4OWX B;  3F2C A;  1QVG A;  2VQE L;  4JI5 L;  2N3S A;  2IX0 A;  5IYD G;  4AQY L;  5HY6 A;  3AYH B;  3GO5 A;  4KI0 A;  4JOI A;  1NY4 A;  1VQ5 A;  1IL2 A;  4JI0 Q;  4A3J G;  1UE5 A;  1K8A C;  2JA5 G;  4BBR G;  5IP9 H;  1HZB A;  2VW9 A;  1WCM G;  3M9B A;  3W1B A;  3CPF A;  3UDX A;  2ALY B;  2KHI A;  3CCL A;  1TWH H;  4DR4 L;  3B6Y A;  4A3I H;  1EYG A;  4DR3 L;  1XJV A;  1U5K A;  3GTM H;  4P74 A;  4B3M L;  1L0W A;  2A19 A;  2ASB A;  5LMU Q;  4OXP A;  3JAM c;  1YZ6 A;  4PZ7 A;  1JMC A;  1L1O B;  3M7N A;  1J6Q A;  3ULL A;  3AQQ A;  5FJ8 G;  4GKJ Q;  5IYC G;  2HQL A;  2F4V L;  4OON A;  4YWK A;  5BR8 L;  1S3O A;  1HR0 L;  1IBM Q;  4EQ5 A;  2R7Z G;  3RLO A;  3EIV A;  4YHH L;  4JI3 L;  1NBW A;  3I4M G;  1YNX A;  3CCE A;  3M3Y H;  1GM5 A;  4Y52 H;  4Y7N H;  5C44 G;  4WJ3 M;  3GDE A;  4YCW A;  2HHH L;  4JI7 Q;  4HJ8 A;  1AE3 A;  4HID A;  4DV5 Q;  2EIF A;  1RIP A;  4JV5 L;  3IRB A;  2HT1 A;  4A3L H;  4X66 L;  1UE6 A;  2GN5 A;  1CKO A;  2RF4 A;  3EN2 A;  4QJF A;  1X6O A;  5IE8 A;  1NE3 A;  1VQI A;  4LNQ A;  1XPU A;  4BY1 H;  3PUW A;  3RZO H;  2B63 H;  5GAD C;  3BZC A;  1M90 C;  3S1Q H;  4JV5 Q;  5LMN Q;  5LMN W;  4DR7 Q;  1IBK L;  5M3M H;  3FKI H;  4R4O A;  4DV4 L;  2BH2 A;  4A3G H;  1UEB A;  2R92 H;  3CD6 A;  2A1A A;  1CKN B;  3JC6 6;  1KHI A;  2UUB L;  4LF4 L;  1I5F A;  3T1Y Q;  1EQR A;  1N9W A;  3S24 A;  3G4S A;  2RHQ B;  1IBL L;  1PH7 A;  3HOW H;  4A3J H;  3DM3 A;  3KJO A;  1XPO A;  2Z0S A;  4P71 A;  2F52 A;  5FLX c;  2R93 H;  3RNU A;  4JI6 Q;  2UXC Q;  4A3K G;  3PF4 A;  3ULJ A;  2N78 A;  1PH1 A;  4IFD J;  5EAY A;  1PV4 A;  4TQU S;  1Y1W H;  1OTC A;  1BKB A;  1N32 L;  4C3I H;  4DR6 Q;  4GOP B;  1IZ6 A;  3HKS A;  3I4N G;  5C4X H;  4NXM L;  1XNR L;  2I5H A;  2YTX A;  4XIG S;  1FGU A;  2NVY H;  4L5S A;  3HOV G;  3K81 C;  1CKM A;  1VQB A;  3HKZ E;  3M4P A;  4X64 L;  3DLL A;  4A76 A;  3I56 A;  1V43 A;  4UP9 A;  2E2I H;  5GQO A;  1HNW L;  4POF A;  3I55 A;  3CAM A;  1PH8 A;  4IPC A;  1PH3 A;  4APV A;  4BY7 G;  1KQS A;  4QQB X;  1E22 A;  2Q2T A;  3RLN A;  1XNQ Q;  1Y1V H;  2GVA A;  4MNO A;  2DUD A;  1KRT A;  2MQH A;  3K0X A;  5C0X J;  1XMQ L;  1D8L A;  1HNZ Q;  4JBJ A;  3UDG A;  1CKN A;  2AWO A;  2A8V A;  1O7I A;  4JI4 Q;  1H95 A;  1TWA H;  1VQ7 A;  1B8A A;  1GD7 A;  2BH8 A;  3UE1 A;  2PQA B;  4LUV A;  4LF6 L;  4AYB E;  2WP8 J;  4JI8 Q;  1MIU A;  1A63 A;  4GLV B;  2D0O A;  3E0E A;  2AHO B;  3TRE A;  2K5V A;  3OTO L;  4WJ4 A;  4A3F G;  3T1H L;  4DV3 L;  4A3D G;  1M1K C;  4RMF A;  4MZ9 A;  3TEH B;  2PMZ E;  1NJI C;  2QA4 A;  2MO1 A;  4DUY L;  4OWW B;  1VQG A;  2UU9 Q;  2CWP A;  1JJG A;  2OTL A;  3MEF A;  5IWA Q;  1TXY A;  1YHB A;  3H0G H;  1N33 L;  1FL0 A;  1VQH A;  2OQK A;  3K7U C;  4A3B H;  1WJJ A;  3H3V H;  3J80 c;  2DGY A;  2VNU D;  1Q1B A;  4LW1 A;  4JCV E;  3F2D A;  2JJQ A;  4C3J H;  4UPA A;  3RN5 A;  3HOU H;  4A3C G;  3UDI A;  3BZK A;  3ER0 A;  1I94 L;  4FDB A;  4JI2 Q;  1HZC A;  2IT1 A;  2ZTD A;  3LGJ A;  4GN5 A;  4DR2 Q;  1IXR A;  3ERS X;  4R1J A;  3A0J A;  4RG1 A;  1I94 Q;  1YBY A;  1LTL A;  3KFU A;  1AE2 A;  4K0K Q;  1PVO A;  5IYB G;  2LXK A;  1XTD A;  3A5Z B;  1VQF A;  1MKH A;  2BA0 A;  3CCV A;  3TS0 A;  4R4I A;  3PUY A;  5ELO A;  4JI0 L;  2VZA A;  2Y0S G;  2HIX A;  5C3E G;  2K50 A;  4B3T Q;  4JI1 Q;  5JJI A;  1B70 B;  4LF9 Q;  1KIX A;  2FXQ A;  4L5T A;  5FLM H;  2WFW A;  3CC4 A;  3CCM A;  4DV0 Q;  3U4V A;  1QZG A;  4P73 A;  1VQ8 A;  1Z47 A;  4HJ9 A;  2CCZ A;  3G48 A;  1EIF A;  5M5Y H;  4A75 A;  3HOZ H;  4DV6 L;  2JA6 G;  2UXD L;  1KL9 A;  3PO2 G;  4B3R L;  1VQJ A;  2ZJR A;  5LMU L;  1N36 Q;  2WB1 E;  1OXU A;  2VUM H;  4JG2 A;  4DV6 Q;  4GKJ L;  2JK8 A;  1CUK A;  2I5L X;  4MTN A;  4LF7 Q;  2JA8 G;  4BXX H;  4B3R Q;  4BBS H;  4YCU A;  1YHA A;  4A93 G;  4A3E G;  4A3M G;  1IBM L;  4PZ6 A;  3KF6 B;  1X56 A;  3KJP A;  2K4K A;  4PZ8 A;  2UXB Q;  2I5M X;  1UE7 A;  4GLX A;  4KHP Q;  4GNX C;  2AWN A;  1Q86 C;  4AIM A;  2UXD Q;  3CXC A;  4JI7 L;  4NXN Q;  1SRU A;  2E2J H;  4DV5 L;  3RR5 A;  3G6E A;  3D0F A;  3G71 A;  4DV7 Q;  3S16 H;  4NPS A;  1I50 H;  2OCE A;  1G6P A;  1VCI A;  2JE6 I;  2NZH A;  5IP7 G;  4KLK A;  1PH2 A;  1WFQ A;  1N8R C;  2NN6 G;  2QEX A;  4PMW A;  1X65 A;  3CCU A;  2ZJP A;  1T9H A;  5LMN L;  4R4T A;  2E8G A;  4HIM A;  4DR7 L;  5IT9 c;  5M3F G;  2JEA I;  1G51 A;  3L0O A;  4DR5 Q;  3HOX H;  2WAQ E;  2Z6K C;  1N34 Q;  3E9I A;  1FVI A;  3W1G A;  1YIJ A;  1K9M C;  1A8V A;  2OQ0 A;  1VQM A;  3T1Y L;  4O0A A;  1V1Q A;  2VL6 A;  3KF6 A;  1E3P A;  3CP0 A;  3K8A A;  3NEM A;  1KAW A;  2NVQ H;  4YY3 L;  3GD7 A;  3J81 i;  4JI6 L;  4LF5 L;  4HIK A;  2UXC L;  5IP9 G;  1PH4 A;  2GVB A;  4IPH A;  2CWA A;  3I2Z A;  5ELN A;  2KBN A;  3NBH B;  1PH6 A;  4DR6 L;  1WI5 A;  2PI2 E;  2EQS A;  4YY3 Q;  5M5W H;  1UE1 A;  4A3I G;  4LF5 Q;  1X3F A;  3PUX A;  4LF8 Q;  1L1O C;  5HGQ A;  1J5E Q;  1MJC A;  4C2M H;  3A5U A;  4B3S Q;  2CFM A;  1RL2 A;  1C9O A;  1VQC A;  3AFP A;  3CW2 C;  3ULP A;  1EQQ A;  1VQL A;  3HOY H;  4IJL A;  3PGZ A;  1C7Y A;  2NVT H;  4QIW E;  1G29 1;  4R4C A;  1SR3 A;  1XNQ L;  4DV2 Q;  3L2P A;  1HNZ L;  3S14 H;  1HNX Q;  4DK6 C;  1XMO Q;  3KYH C;  1YVC A;  2R7F A;  1XPR A;  3K80 C;  4DR1 Q;  3PSI A;  1KD1 C;  2IX1 A;  2RHS B;  3PIP A;  2ZM6 Q;  4JI4 L;  2LSS A;  1K83 H;  5H1S E;  3UE0 A;  3MXN B;  2YV5 A;  4OX9 Q;  3GTO H;  4JYA Q;  4L5R C;  2JA7 H;  4JI8 L;  1VQP A;  1VQ9 A;  4IFD G;  5IY0 A;  3PO3 H;  4A3L G;  2XGT A;  1R9T H;  3GTP H;  4X65 Q;  5JJK A;  1OXX K;  4DUZ Q;  3U4Z A;  1Q7Y C;  1C0A A;  4BY1 G;  2B63 G;  4IOA A;  3H3V I;  4GKK Q;  2IHF A;  2AMC B;  1OXS C;  3GTK H;  4DKA C;  2UU9 L;  3OW2 A;  5IWA L;  2K5N A;  1I3Q H;  2V1C C;  1K73 C;  5K36 G;  2NN6 I;  4IPG A;  5M3M G;  3F2B A;  3S17 H;  3FKI G;  3TS2 A;  4A3G G;  3GTJ H;  3D31 A;  3RLF A;  1Q82 C;  2R92 G;  3S2D H;  2YTY A;  4JBW A;  3TRZ A;  5C0X G;  2ZTE A;  5JEA J;  1LYL A;  4OO1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...