2M00A

Solution structure of staphylococcal nuclease e43s mutant in the presence of ssdna and cd2+
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
b'ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPSTKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Modeling of the [E43S]SNase-ssDNA-Cd(2+) complex: Structural insight into the action of nuclease on ssDNA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 43
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2m00A00
1IHZA 2F0WA 4ZUIA 5JAVA 3P1HA 1TT2A 4QF4A 3QOJA 3C1FA 4B9WA 1KABA 4ME5A 2OEOA 4B9XA 1SYGA 1SYBA 2RKSA 3EJIA 3T16A 1ENAA 3NXWA 4K5WA 4WORA 5CV9A 4EVOA 5I6WA 5IGDA 2F0JA 1KDAA 2PZWA 3DMUA 3TP6A 4N9PA 1F2MA 1TQOA 3MZ5A 3R3OA 2KHSA 1EY0A 1JORA 2OXPA 3BDLA 4HTHA 2F0PA 3SR1A 4IUNA 3TMEA 2EYFA 4KHVA 3MXPA 2F0DA 2EXZA 3D6CA 4OL7A 1EZ6A 4ODGA 5JOBA 2F0UA 1A2UA 5IOCA 1A2TA 2F0QA 2EYJA 1U9RA 4KD4A 3SK6A 2OF1A 3V2TA 4F8MA 5C5MA 4KY5A 2RDFA 3DHQA 5C6AA 5KYLA 3NQTA 5CGKA 3QOLA 4PMBA 2PZUA 3PMFA 3NP8A 2F0OA 4K2LA 4TRDA 2LKVA 1SNQA 4KY7A 4K2KA 4HMIA 1STGA 3EROA 4HMJA 4RKBA 2NUCA 4S3SA 5CV8A 5C4HA 5NUCA 5IGBA 4DF7A 3HZXA 4IALA 2F3VA 1EYCA 3TP5A 4N9TA 2EYPA 5EKKA 5CV5A 1STBA 4QMGA 3E5SA 3MEHA 3MHBA 3MVVA 5CR3A 1EYAA 1EZ8A 1TR5A 3OMCA 2F0FA 4I65A 5I9OA 4F7XA 1F2ZA 2ENBA 4DU9A 1A3UA 1STYA 2F0HA 5I9PA 5HGTA 1F2YA 3C1EA 2SOBA 3SK5A 4K6DA 2F0KA 3S9WA 1EY7A 2F0GA 4ZQ3A 4NP5A 4R8NA 3D4DA 5CV4A 2F0TA 4KTAA 4EQOA 2EYMA 5CC4A 4K5VA 5K5PA 4E6IA 4KJNA 2SNSA 1EY9A 2PQEA 5C5LA 5J39A 2QDBA 4K8IA 1SYDA 5DAUA 1SYCA 2KQ3A 5KGUA 3D4WA 5IGFA 1EY4A 1SNOA 2F3WA 5C3WA 1JOOA 1STHA 2RBMA 3NK9A 3EVQA 2SNMA 4KD3A 3P75A 4KY6A 3H6MA 4LAAA 1KAAA 4KJOA 3RUZA 2EY1A 2F0SA 3D8GA 4G57A 3OMGA 3TP7A 4DFAA 1RKNA 5IGEA 4NKLA 5F2DA 4ID6A 2F0IA 3ITPA 3SHLA 5C3XA 4EQNA 1SYEA 5KRUA 2EY2A 1JOKA 4K8JA 5HURA 4K5XA 1A3TA 1SNMA 3U9OA 2WACA 2F0NA 1EQVA 3LX0A 1NSNS 1EY6A 2F0MA 3VA5A 4QB4A 3BDCA 3NHHA 4RKLA 3TP8A 5IGCA 4NMZA 4J1MA 3ERQA 4H7BA 3HEJA 5IIFA 1STNA 2EYHA 1JOQA 5I6YA 3OWFA 3SK4A 1ENCA 3OSOA 2PZTA 4EQPA 4J6HA 5DEHA 3QB3A 2F0EA 5EKLA 1SNPA 1NUCA 2F0VA 5CV6A 2EY5A 4K14A 5C4ZA 4ZUJA 4MIUA 5KIXA 1KDCA 4PMCA 4WRDA 4YIJA 5ISRA 3T13A 2EY6A 4IZ8A 4DGZA 1AEXA 2EYOA 2PW5A 1SNCA 5IODA 1EY5A 5IGGA 5EGTA 1A3VA 3NUCA 1II3A 1STAA 1KDBA 4NDXA 3SK8A 5KEEA 2PYKA 5J1ZA 1EYDA 2PW7A 5CV7A 2O4XA 2EYLA 2HQEA 4PNYA 5KYIA 1EY8A 5E1FA 2F0LA 5E3FA 3SXHA 5J22A 1SNDA 5M9OA 4KV6A 2M00A 1SYFA
chains in the Genus database with same CATH superfamily
1IHZA 4KN4C 5IYBH 5C0XI 1QB5D 3PGZA 4KKSA 4U673 5FO7B 3PIOA 5E4WC 1FR3A 2ICIA 4LF6Q 3HOWH 4DXGA 3I55A 1WCMB 4FF3A 3KLSA 4MN3A 1Q8KA 3DWAA 4IUNA 3J81L 3GTQH 5JEAG 2MFIA 3S17B 4O42A 2EXZA 1DM0B 1Q1EA 1I4XA 4IPGA 1G6PA 3I70A 1B50A 1TY0A 3HOYB 1D8LA 1VQ5A 2NZHA 2ZXRA 3MXNA 4X3UA 2ES2A 1EEFD 5M3MH 2KEEA 4N9TA 4G7ZC 4DV4Q 2K33A 4QMGA 1OTCA 1PTOF 4YY3Q 2UU9Q 5C0XH 1EZ8A 1XYIA 1QVCA 1QE6A 2IX1A 5JJLA 3S1NB 1EIGA 1RIPA 2Q2TA 3HG9A 3PF5A 5DM73 5CC4A 3GTPB 1LT6D 1SYDA 1PRTF 5DAUA 3CQZB 4IPHA 2BDOA 5G3LF 4RHRA 1Y1WG 1Y1VG 2F0SA 3D8GA 1MIUA 2B2UA 3KBGA 3QG1A 1VQGA 2RSNA 2QCPX 5C3XA 3I4NB 1DOMA 1VQPA 4A3FB 4RKLA 1HNWL 5IIFA 1HQMC 2VL6A 3HEJA 3P7JA 3DWPA 1XPUA 1ENCA 4KN7C 1HJPA 1TKWB 1PXUA 1W6JA 4RA8A 2XSCA 4YIJA 1YHAA 4DGZA 4NXNQ 3S1QB 4JOIC 4A93G 1EY5A 3PO2B 5ELFA 2O2LD 4X62L 5FLXL 2HDLA 1JICA 3D6WA 3HGBA 1AZQA 3PO3B 1E2VA 3S14H 1GM5A 1PZJD 4A3GG 4OX9L 3S2DH 3J7A5 3M9BA 4ZUIA 3L3OC 1ENFA 1Q86C 4GNXA 1VQBA 1W3SA 4IFDI 1LTAD 4HEDA 1XNRL 1F2LA 3HRZC 1GUWA 2OEOA 4LF9L 4C3HG 3HKZE 3A8JE 1DONA 2AWOA 1VQ4A 2KENA 3VA7A 3MTSA 3FEWX 5CORA 3E9HA 1GHJA 1YJ9A 1EZ6A 1IBMQ 3HOZH 5C6AA 4FXGC 1KRTA 2Y0SB 4DAVA 3GTLH 4Y52H 2RVLA 2JA8B 1ESFA 1JORA 1JB3A 4K2KA 1JJCB 1KQSA 1NCVA 1EYCA 2A1AA 2B2VC 3BVZA 4A3CG 2WKDA 4A3JG 3MHBA 4P74A 1TR5A 4N8FA 1TIID 4J8QA 4A3EG 5CYUA 3D4DA 1BCPD 1H9KA 3TSSA 1B8AA 1B7YB 1MHWC 2D9UA 4V190 3HKSA 2E5LQ 4BBSH 3B6YA 2KQ3A 2R93G 2UXBQ 3D4WA 3MFYA 4FNFA 3OTOL 1LTSD 2IX3A 1R4PB 3OMGA 2EDGA 2BH8A 4ZK9B 1HCZA 1JJGA 2B8GA 1Q46A 4EQNA 4DN4M 2Z6KA 3MEFA 4GOPC 1D2BA 2JA6H 2OTJA 3J7AV 4HJ9A 1C4QA 3PIP3 3Q23A 2K1BA 5EPJA 3KDFB 1D1KA 3STBD 1QUQB 3DXJC 1I4GA 2F0EA 1LT5D 5FLMH 1BOSA 2EY5A 2JK8A 4ZUJA 3D3RA 2HCIA 3ND9A 4XIGS 1WCMG 5BN5A 3OW7A 3H3VC 2ZJPA 3NTHA 3HOUB 1L1OB 3BG3A 4B3MQ 1SN8A 4YHHQ 4C1NK 2LS01 1ILQA 2HQLA 1SXTA 1VQIA 2CWAA 1VMCA 3TZDA 4H0LC 1TVXA 4BY1H 4YCUA 1QWYA 4ZKCB 1GKHA 3I3CA 1SROA 3GTMH 3S2HH 3HOYG 3JAME 4GKKL 2MO0A 2A6EC 1PFNA 1LTGD 1SYBA 5CV9A 2CKZB 4XYOA 4N8X1 4QIWE 1VCIA 3TEHB 2CCZA 2D5DA 3KUPA 1IZ6A 3MXPA 1WOCA 4KHPQ 1G8ZD 5JEAH 1K73C 4KKTA 1HNZL 1E3PA 4JBKA 4F8MA 4H44C 2Z6BA 1N32Q 2LKVA 1BVSA 1E2WA 3EROA 2I5HA 2F3VA 1KLUD 2AUJD 2VXWA 5IWAL 1EIHA 1AW7A 2VB2X 5C3EB 1EFWA 2G9HD 1EYAA 1O7IA 4IUPA 3RZOH 4WJ3M 4C2MH 2QILA 1Y8OB 1F2YA 4A3FG 3CF5A 2XTIA 5BR8Q 1SE2A 4DV2Q 1PMRA 2IY5B 3UE1A 5LL6S 4OO1G 4DR6L 1CKNA 2E75C 3A74A 1TU2B 1BBUA 5EBDA 4JBJA 4MNOA 5M5YH 2F3WA 4L5TA 1G2SA 2A8VA 2B63G 3P75A 3VR5A 5I4DA 3PO2G 1KAAA 1Y1WH 3FP9A 3Q24A 1PH4A 4OIKA 2WB1B 2D0OA 1SYEA 4C3JB 4K5XA 1CZWA 4OGQC 4A3IH 5FK9C 4C56C 2EJGC 1YJNA 3ZYYX 2ZTEA 3HFZB 5LMNQ 3S16H 2L9HA 5C4XB 3OPOA 2MP1A 1Q8IA 1SFOB 2FMMA 2BH2A 1Q81C 3M3YB 2L55A 2RDHA 1YIJA 1WFQA 4A93H 2VY3A 5LHY1 3S1RB 2JQOA 5J22A 1V9PA 2X6GA 1BDOA 4A3GH 2Y0SG 1WTXA 3GTJB 5DLQE 2JA8G 1W6KA 5M5WB 3P1HA 4H02A 1A0IA 5JPNC 4G4KA 4ULLA 1D7QA 1K83B 3DEOA 1ENAA 4X65L 4NB3A 2XWBB 3S1MB 4C3HH 1EYGA 4DV6Q 2KCNA 3BDLA 4V0BA 1DYQA 4B3ML 4I7ZC 5JVH3 4DUZQ 2MNAA 4CKCA 4A3KH 2OF1A 2E2HB 3S24A 1QZHA 4JI2Q 1TWCB 1I3QH 3L2PA 4PMBA 4GLVB 2MUYA 1ML0D 1BF4A 1ZYRD 4LMQD 5IGBA 5NUCA 2YU9H 1I5FA 4JI6Q 3QIAA 3LWUA 1Z7TA 2IPKD 1DGSA 1S72A 1KIXA 2HT1A 4A3CH 3ICEA 3LNNA 4A3JH 3OMCA 2PQAA 1X3QA 1VQJA 2CW0D 3SK5A 4X66L 2I5LX 2GVAA 1JWMD 4A3EH 3H3VI 4XTCS 3W3AA 4EQ5A 5FO9B 2SEBD 2KUMA 2QDBA 2EE1A 1N32L 3NTKA 3G48A 1HR0W 2R93H 1L1OC 2PMZB 1FD7D 3HOUG 1CA6A 3T53B 5M3FB 1H9RA 2XWJB 2K50A 1QNKA 1VS0A 1VQ7A 4TQUS 1JWSD 2J7ZA 1N36Q 1KL9A 1Y14B 5BR8L 5T1GA 4NMZA 3ERQA 1OXUA 1STNA 2B2WA 3M7NA 1K3BC 3OSOA 4EQPA 4NPSA 1BCPC 1GJXA 4GS3A 4DV1Q 3EFXD 2AWNA 1EU4A 3OYYA 1WCMH 2K5DA 3I73A 5EGTA 1E0BA 2H5XA 3H3VH 4JI4L 1S4ZA 4PNYA 2QEXA 3S17H 1EY8A 1BQQT 3Q22A 4KV6A 1PHJA 4QGUA 3K7AB 3JAMi 1Y8PB 4QCLA 4CGYB 2OTLA 5ELOA 1LYLA 3OW2A 1NAPA 1UNSA 3HOYH 3PUVA 1H95A 3NXWA 1T5EA 2EJMA 3CHBD 2NN6I 4P75A 1HNXL 4HIKA 1CHQD 1TWHB 4OO1I 2F52A 1SE8A 1TQOA 3I8ZA 3STBC 2YYZA 3R3OA 3VYTA 4K6LA 5C3EG 1S5CD 1HZ9A 1E24A 3M4PA 1U5KA 3PV0A 1PZKD 2C35B 4LK1C 4KKUA 3S1NH 4DK6C 3X3NA 1L0WA 3D4RA 5L37A 3BZDB 3CCVA 3GTPH 4TRDA 1YNXA 4JI1L 1SAPA 4RH6A 4RKBA 2OQ0A 4LF5L 5G3LD 5C4HA 3KFUA 3TN2A 3LWEA 1L0XB 1ASYA 1X54A 3ER0A 1KNAA 4DV6L 3MVVA 4OWWB 1BR9A 3CC4A 3RLOA 4EGVA 3NWSA 3I4NH 4RCOA 3KJPA 1UAPA 4DUZL 5E7NA 4IQZA 4A3FH 4L6TB 1D6EC 1AZPA 1VQHA 1CQVA 4IUVA 5C4XG 2IJ0A 4GLXA 4P72A 1G291 4OO1H 1YNND 2N49A 3AFQA 1KC8C 4CDCC 4BS9A 1EY4A 1SNOA 2R7DA 3FPUB 4X3SA 1GXDC 3HOVB 1V1PA 4HIDA 3S1QH 3TP7A 1LTLA 4JI6L 4PMWA 3DUZA 4LF7L 3PO3H 2EY2A 4K8JA 5HURA 1VQ8A 4G7HC 5JJKA 3ULPA 2YTXA 3VA5A 1T9HA 5IP9H 3GTKB 3CCQA 4CDFC 1HNWQ 2AKWB 2ASBA 2Y0SE 1Y69U 2WKCA 4JI5Q 1LTID 1DOLA 3CMAA 5C4ZA 3K59A 3OIPA 2EJFC 5EJWA 1B1ZA 4IZ8A 1G51A 1J6QA 1VQDA 4X62Q 3TREA 1EU3A 1LM0A 5IE8A 1PRTB 4B3TL 2K4KA 1KDBA 4Y7NB 2WP8J 3MAQA 1GVPA 4OX9Q 3SGIA 5M9OA 4G57A 2RA4A 4HJ7A 4BXXG 4LNQA 2Q8IB 3S15B 1IKLA 3H09A 2JA8H 4DR5L 4LF9Q 2M9VA 5IYDG 2FXQA 4K5WA 4WORA 1HFGA 2ZXOA 4DV1L 3GTGB 1PA6A 2KHSA 3CAMA 3RZDB 1EY0A 4KHZA 2RCFA 4HTHA 1Q82C 3SR1A 3TBIB 4JI0L 2HDMA 3G71A 4IOAA 1VQEA 1Z47A 5IOCA 1VQOA 4DR7L 1VMPA 1Z9FA 4BBRG 3CXCA 2F4VL 2I07B 1RJTA 1SNQA 1KD1C 4HMIA 4CDEC 4PG3A 2ICEC 2R92B 5M3FG 3E5SA 1E1TA 1CTMA 4OONA 2IWHA 1YVCA 1PH6A 3CP0A 2B2YA 4K6DA 3KK7A 2ZTDA 4ZLTF 2F0GA 1FYCA 4ZQ3A 4XQQA 5IT9E 2KCMA 2EPBA 3F1ZA 3CMEA 2NVQB 3NPPA 4A3MB 4UHVA 3DLLA 5JVG3 4DK1A 3LGJA 3OTOQ 1E1OA 2B2TA 1JOOA 2D62A 4HR7B 1OO9B 1WTHA 4KY6A 4Z9CB 2WAQB 3A5UA 2J4XA 3HOUH 1ZYRC 2JXMB 2F0IA 4RG1A 1TXYA 5KRUA 4MZ9A 5FJ8G 3RN5A 1SNMA 5D3DA 3U9OA 2MHVA 3KBXA 4FXKC 4RGOS 3PQIA 3K57A 1FVIA 2AQ3B 4YCVA 3K5NA 5GQOA 2QGQA 4POGA 2CW0C 1SE4A 3SDZA 1XJVA 5GAEC 1YI2A 1NUCA 3G6JB 3T4AC 3T1YL 4MIUA 1BBXC 3E0EA 2C9OA 2PW5A 1EQQA 4JV5L 4WJ4A 4APVA 1RTNA 3S9WA 1HZAA 4JK1C 2A6HD 2M00A 1B2TA 1YNJD 3NELA 2B8FA 2KOLA 3I90A 3F2UA 5CBEE 4UPAA 4GKKQ 3CD6A 2RKSA 4UAIA 3T16A 3W1GA 2D2CC 3RD4A 2NWGA 4JI5L 5IY0A 1ICWA 1VQCA 3DMUA 1AE3A 2MJ8A 2RHSB 3TZUA 5KNBA 4L5RC 4IO9A 4DR3L 2B63B 1I94L 3I4MB 5C3EH 2OXPA 4YWLA 3K7UC 4KHVA 2V1CC 1Q3LA 4HIOA 1HNZQ 2WB1E 2LFNA 2VS1A 1K8MA 2A68D 1GD7A 3SE0A 5C44B 4DR2L 3V05A 4CBVA 2Z0SA 2R6GA 4DF7A 3HOVG 1OXTA 5IWAQ 4BY7B 2VQFL 4J15A 4IFDJ 3NBHB 4QY7A 3H91A 1VQLA 1SMYD 4C3JH 1C7YA 5A35A 1KTKA 5CV4A 2K01A 4NXML 1NR4A 4DR6Q 1CFMA 3J7AF 1UE6A 1YBYA 3UDFA 1NTGA 1B9MA 4UP8A 5C5LA 5J39A 1JR0D 2JA9A 4FP5D 1XMOL 1QVFA 3D0FA 3JAMc 3M85A 1SFOH 3K0YA 1K8OA 3VYSA 4GN5A 3F2DA 3H6MA 1WTVA 2IHFA 2MQHA 3M7GA 4L5SA 1MBYA 3OOCA 4WFN3 3S1RH 1R9TB 2G5DA 3BDCA 4A3DB 3GTJH 3ZJYC 2GA4B 1HPCA 3VR6A 5M5WH 1ET9A 4F88A 5I6YA 3SK4A 1SJHD 3AYHB 1CQFA 2I5MX 1K83H 1B3QA 3BS1A 3S1MH 3AU7A 3RMHA 3T13A 2RSOA 5AFWA 3EA6A 3TDQA 1MJCA 4JYAL 1HXYD 1HR0L 1HA6A 1EYDA 2EYLA 3MC0B 2B39A 1K0RA 5E3FA 2ZJRA 3RLFA 3KF8A 2FHTA 1SYFA 1HUMA 1XXGA 3I91A 2E2HH 2BA1A 1TWCH 3A7LA 2BOSA 1RTOA 4HAEA 4QJFA 3H0GB 1J5EL 4X65Q 1SYGA 3A8IE 1V1PB 3T1HL 5IYDH 1CSQA 2PNRC 2R92G 4DK3C 4X64Q 2PMZE 4GLAC 1A2UA 5LMUL 4P73A 3DHQA 5CGKA 2PO4A 1MGSA 2NVXB 1Q90A 4A3MG 4RMFA 4R4IA 5M5XB 4LFCL 3HZXA 1K28A 1WJJA 2WAQG 3G6EA 1WTPA 5EKKA 4I7AA 1OXSC 1K3RA 1IBLL 5M3FH 1X3GA 2A5HA 4F87A 4JOIA 1X56A 3BVMA 4X66Q 3CCMA 3CPFA 1JT8A 4L5QA 3Q6SA 5K36G 1SSOA 2R7ZB 2XRQD 3U9SA 3K80C 3Q8DA 5BN3A 4UDUC 2L11A 4JC0A 3ND8A 4ID6A 1ASZA 2E2JB 4PZ8A 3EN2A 1DZ1A 3KLWA 1I50B 3LX0A 3K7AH 3HS0C 3CPWA 3NHHA 4H7BA 3VR3A 4HCSA 4DR4L 4XQNA 2IHEA 2UXDL 1NY4A 4LJZC 4FXDA 1MD2D 1GHKA 1ILPA 3FKIB 4FYDA 1QNUA 4PZ6A 1TWHH 3I4MG 2VB3X 1XX8A 3RLNA 1A3VA 3NUCA 1Y1VH 4NDXA 4JI4Q 2Q8TA 4B3RL 3KOJA 3C46A 3AFPA 1MI2A 2B2WC 3J80E 1S5BD 5A2QE 2WFWA 1AH9A 1ET6A 2XVSA 3MXNB 4LW1A 5C44G 4P2CB 2F3IA 5BN4A 3UDIA 4CKBA 1HNXQ 1PH3A 1VF7A 4YWKA 4ABNA 4BY7G 3P20A 2PZWA 3FVQA 3A0JA 1EWCA 1I6HH 3GTOB 3NTIA 2F0PA 2Z8LA 1IKMA 2B29A 5DNFA 2CQOA 1JMCA 2F0DA 4OL7A 1IXRA 5EKIA 3DM1A 2ZTCA 3JC66 4GOPA 1MJEA 4PQXA 3UE0A 3PIPA 4JI1Q 2F0OA 4LF5Q 1YNJC 2NZOA 1X55A 3J81E 3BJUA 1IYUA 3HOVH 5COYA 4A4IA 2VNUD 3IAYA 3BDOA 4LF8Q 5IGGA 2PNHA 2K6AA 2ENBA 3F2CA 4X64L 3C2PA 1QJOA 5HGTA 1F9QA 2SOBA 4JBWA 4TKOB 4A3DG 1TY2A 4IJHA 1GUTA 3E6ZX 3GTKH 1BCPF 1DD2A 2HCCA 1VQAA 2L12A 5K5PA 3CW2C 2K05A 3FHWA 1WD1A 1UE7A 4BBSB 2L0CA 4IOCA 2RDGA 4AH6A 1JC7A 1JE4A 2XGTA 5C3WA 3J7ZC 2JA7B 1STHA 2HD3A 4ZAIA 1PYWD 2IW3A 3EVQA 1XPRA 2A68C 1VDZA 1DOKA 1O7LA 4DFAA 4C3IB 3ITPA 3SHLA 3IFTA 4LF7Q 1B44D 2K7VA 4Y7NH 5HY6A 4RCNA 1NSNS 4HSPA 4GNXB 2UUAL 1L0YB 3NSWA 3S15H 1RCVD 1SMYC 1LTTD 3H0GG 4UP7A 3OWFA 4BBRB 1X3FA 2ZM6L 5KNDA 3QB3A 5I2YA 4DV5L 1SDFA 3GTGH 1N34Q 3K6OA 1FJGL 3RZDH 4B3TQ 4RAUC 1II3A 5C4JB 2PYKA 3TRZA 5J1ZA 1T5XD 5E1FA 1FL0A 5I2XA 2KCCA 4CJ2C 3K5OA 3WDNA 2R3ZA 5FO8B 4B9WA 3MXUA 3QOJA 4IUUA 4DR5Q 1BXTA 1SEBD 4MTKA 3E3XA 2Z4HA 5D14A 4FF1A 3EJIA 5FLXE 2DNCA 4HN7A 3CC7A 1PH8A 1AN8A 3CCSA 4CHTB 1D5ZC 4N9PA 3MZ5A 3CU7A 2EZVA 4XT1B 5KNCA 1ESRA 5LL6X 2R92H 1C0AA 3NWTA 4Q0FA 4JI0Q 5GADC 3TMEA 1CSPA 2WAQE 4LF4L 2E74C 4YWMA 4FDBA 2F0UA 4R4CA 4DR7Q 1B3AA 2F0QA 4RGMA 4KY5A 4PV1C 2R7ZG 5KYLA 2F4VQ 3M4OB 1N8RC 2NVYB 3BVGA 4DPGA 2NVQH 2VQEL 4A3MH 2BE5D 3TQYA 3A56A 3CRLC 4JI8Q 4HCEA 1PTOD 1STBA 4DUYL 2SDFA 4YCWA 4O2DA 3BZCA 2K04A 4F7XA 1STYA 3KF8B 1YJWA 5FKAC 4DV0L 3C1EA 5ELDA 2JJQA 3G7LA 2ID0A 3CRKC 4NP5A 5GAGC 4JPBW 4DAYA 2EYMA 3AMUA 5K36H 4LUVA 1PRTD 3K8AA 4DV7L 2KHJA 1K9MC 1XPOA 5TSSA 3PIO3 1XMQL 3FKIG 4R4OA 3CQZH 3NK9A 1PYSB 4NKLA 1MKHA 4X6AH 4LF8L 1A3TA 1EL0A 4RHSA 4FF4A 2WACA 4DV3L 1S40A 1TS5A 3GV3A 3F2BA 3Q0AA 3S16B 1J9OA 5HGQA 1D5MC 1Q1BA 3PUXA 1ZKOA 2HUGA 4IPDA 3T1YQ 1I6VC 2D0PA 4K14A 4TVAB 1PFSA 5ISRA 1KDCA 1SBBB 4WRDA 4B3SQ 1S5FD 2EY6A 2Q8RE 2EYOA 3JAML 2AMCB 5EPKA 4AQYL 1PH2A 4JV5Q 2B63H 3I4MH 1A15A 1STAA 3PO2H 1PH5A 5CV7A 2O4XA 1Z6HA 2DJFC 4KK7A 2CVRA 3I4LA 3I56A 2UXCL 2ZT9C 1PTOB 5JJIA 4FO2A 2XRSD 1M90C 4TSSA 4QF4A 2DUDA 2FJ2A 5IT9c 3KYHC 3ULLA 3KDFA 5C44H 4R8IA 1KLGD 2E76C 2JEBI 2B2UC 1IBKL 3I72A 1TWFB 4BY7H 4DR3Q 4LUZA 1I94Q 2P5ZX 1N34L 4IFDG 4C1NI 1L1OA 4POFA 1KHIA 1TS4A 3D6CA 1BBWA 1X3EA 2FFKB 4A3KB 1A2TA 3V2TA 1CKNB 1I3QB 5EQ0A 3R8BA 1AE2A 1LTRD 2A73B 4OWXB 3A54A 5H1SE 4ILWA 3J81i 4BBSG 3PMFA 1CKOA 1F77A 2K28A 4DR2Q 3HOXB 4HMJA 4DAMA 2JA7G 4AIMA 1H9SA 1JQYD 1JCKB 5IP7G 1HUNA 2VQFQ 2K52A 2EYPA 1B4OA 2IL8A 4C3IG 2K5NA 1OXXK 2HIVA 1F2ZA 4GNXC 4DR1Q 5DM63 2VUMB 4CJ1B 4NXMQ 4A3DH 4R4TA 2K5VA 4BA1I 4XDXA 1GOZA 4KJNA 2SNSA 3WOEA 1XMOQ 4HJAA 1K8GA 3IFDA 5ELCA 2Z1CA 1TWGB 2QDLA 2RBMA 5C0XJ 2L5TA 4M8AA 4RFBA 2DN8A 3RUZA 4KJOA 3NBIA 1V8QA 1XNQQ 2RHQB 4JI8L 5F2DA 3EBEA 1ICFB 3CCJA 2VZAA 3KF6A 2F0NA 1G6ZA 1UE1A 2N3SA 2JN4A 2KJXA 3NQIA 3UDXA 1CA5A 4UY8C 2NBFA 4HSVA 3M4YA 4G7OC 2AQ2B 1HA5A 3H0GH 5AJ3L 3UI2A 1EOTA 4J6HA 4RGNA 2WINB 4O1NA 1ZEQX 2I0QA 5FOBB 1TWAB 4JYAQ 4QUCA 1HR0Q 4ZCKA 2PW7A 2LY7A 4GN3B 3X3MA 4OIJA 2KBNA 1I4HA 2G9DA 4ZKBB 1XTCD 3AB9A 1J5EQ 2NVXH 3BZKA 3T1HQ 5M5XH 2PI2E 4JG2A 2X69A 2Z6KC 4B3SL 4GKJL 1BKBA 1QILA 2PQAB 2LMCB 1EFID 4XT3B 1TS3A 4GN4B 5LMUQ 1YEZA 2NTTA 4LWCA 3SK6A 4B08A 3M4QA 3MXGA 2R7ZH 2JA5B 4R1JA 1HTLD 3L7ZC 1B70B 4AYBB 1W2BA 3CCLA 2Z9HA 4LFCQ 3W2DA 1STGA 4OEMB 1KRSA 2NUCA 2X6LA 1YITA 5ELBA 1X32A 3TP5A 1S5ED 3U4VA 2ZXPA 2QEJC 1IBLQ 4OHJA 4LFBL 1MSHA 4K0KQ 5I9OA 4A3IG 1U4PA 3L9AX 1A3UA 1IYJB 1RD9D 1X9NA 5LMNW 3EQLC 1A8VA 2E2JH 3FDTA 1I50H 4JW0A 4R8NA 1K8AC 4OXPA 1LTBD 1AFPA 2NB0A 4O0AA 2E2IB 1N9WA 4U68A 2MGSA 1WTOA 4LFAL 1CT1D 3OWEB 3KLSX 1EQRA 5KGUA 4JI7L 1E7ZA 1D1IA 1GO3E 1XWEA 5IGFA 4ALPA 2A69D 3FKIH 4LAAA 2L4NA 4HJ5A 2R7FA 3QO2A 1VQ6A 4X3KA 4A3BB 2BE5C 2NTSA 3VR4A 1JWUD 1JOKA 1SMXA 1QOHA 1PTOC 4DR1L 1EY6A 1KXLA 3WWVA 1LABA 5D65A 4DR4Q 1JOQA 2WV6D 3GD7A 2OWOA 2PCFB 2PZTA 5C4XH 2UXDQ 2Q2HA 1FGBD 1UUPA 1S3OA 4PMCA 3C3LA 1FGUA 2BDNA 2MPMA 1UWVA 1PRTC 3M3YH 3VR2A 1NE3A 4B3RQ 3SK8A 3GTOH 2ATWA 2NZ1D 5GROA 5KEEA 1XNQL 3NEMA 5EPLA 3G4SA 4A3KG 2HQEA 4DAYB 5KYIA 4QQBX 1I4RA 1LT3D 1X3PA 3GO5A 3WOFA 5E4XA 2B3GA 1KABA 5EAYA 3HOXG 4QL5A 1VQFA 1VQNA 2NVTB 4XQJA 1KDAA 2BA0A 5EBCA 5GAHC 3TP6A 4LF6L 1F9SA 1YNNC 1PH7A 2LXJA 2JP1A 3FMCA 4IFDH 2VUMG 2EYFA 2CFMA 2FINB 2EYJA 1F9RA 5C5MA 3FPPA 1LUZA 1QG7A 3HP3A 3QOLA 4BXXH 3R93A 1UEAB 1G91A 4L8JA 4KY7A 1EUJA 4MTNA 5CV8A 1B9NA 4GZYC 2MO1A 2JA7H 3HOWB 4CJ0B 5IP7H 3SVMA 4DV4L 5JEAJ 4C3IH 2JYOA 4YY3L 2UU9L 3GTQB 1X6OA 4DU9A 4A75A 1A62A 4OWTB 1DCZA 4OELB 2KVMA 3CCRA 3W5OA 2YTVA 1SR3A 4KTAA 1ZXTA 2QA4A 4MHEA 1WI5A 2Q2IA 3J80c 4EX5A 1RHPA 1X65A 2DJGC 4E6IA 2PQEA 3K58A 4BBRH 2AQ1B 3CCEA 3BU2A 3H15A 1RF2D 2QF7A 2JE6I 5M3MB 3DM3A 2EXDA 5IGEA 2EY1A 3A5ZB 3VYRA 3UDGA 1IW7D 1U4LA 5C4JH 1WTRA 4K0KL 1CHPD 5J3BA 2TSSA 1RL2A 4IURA 4IUQA 1CI3M 2QKIC 2UUAQ 2LXKA 2IX0A 3GQBA 1VQKA 1WD0A 4P71A 1GUNA 1I4QA 3OIQA 2HHHQ 2ZM6Q 3VDYA 2VW9A 2BCOA 1H9SB 5D3IB 1NBWA 1SNPA 3DWQA 1BCPB 4DV5Q 2IT1A 1FJGQ 1FNUA 3J81c 4NXNL 3ERSX 2RCNA 1ONLA 4HJ8A 1OXVA 3U50C 1PLFA 2K5QA 1N33Q 3IKJA 4DAPA 3AQQA 1PFBA 1SNDA 3PUYA 3H94A 3L0OA 5FJ8H 1HFNA 4WJWA 2JA5G 4KLKA 1WTWA 1HTPA 4AYBG 5JAVA 3M4OH 1NNXA 1TT2A 2NVYH 1WVLA 2DY7A 4ME5A 1IL8A 4A3LG 3A55A 1V1QA 1HH2P 3NE5B 4EVOA 5I6WA 1PV4A 1O7YA 4R9WA 3GV6A 2H4OA 1YZ6A 1F2MA 2CH4W 3BYTB 1C48A 3I4NG 3KF6B 4LF4Q 3S14B 1G2TA 2B2VA 3GDEA 4PZ7A 4ODGA 5JOBA 2JEAI 3S2DB 1STEA 2NN6G 1U9RA 3MA2B 1IL2A 4A76A 1IBML 1LT4D 3NQTA 4KI0A 4NW2A 3R2TA 1SLJA 2HIXA 2VQEQ 1PZID 3J81j 5IT9L 1E2ZA 3FRPB 2OT2A 2DNEA 2CH4A 1P8LA 1RDPD 3E0JA 4DUYQ 4A3BG 3QWNA 3PO3G 1JJ2A 1UE5A 2F0FA 4DV0Q 2F0HA 4H13C 5IP9G 1Q7YC 1BUVT 2J0TD 3HOZB 2JSOA 1A6XA 2RQXA 2F0TA 2UUCQ 4EQOA 3GTLB 1HQRD 5IYCG 1EIFA 3HKZB 2KHIA 3K0XA 1EY9A 4DV7Q 4M1UB 1A63A 2A6HC 2K5WA 4IJLA 1XMQQ 2E5LL 1HZCA 5ELEA 1E22A 3N6RA 2UXBL 2E2DC 4KD3A 5FLXc 2YTYA 4L63B 1U4RA 3IRBA 3BYYB 4DV3Q 2O5IC 3J7YW 2F0MA 1BNZA 2UUBQ 4CKEA 5IGCA 2K5HA 3AEVA 2ZJQA 1PTOH 1C8CA 2N88A 2K03A 3T56B 1LACA 1M8AA 1CZGA 3I4OA 1HZBA 3RNUA 5EKLA 5CV6A 3ULJA 1TWFH 3A8KE 3I7FA 1QVGA 4AQYQ 4IUTA 1FNWA 1LLRD 3I2ZA 4R4QA 4YHHL 1VQ9A 2A69C 3MWYW 2AHOB 4BA2I 2UXCQ 2F0LA 1EIYB 5IYBG 2JA6B 2XIWA 1WYDA 2F0WA 2I46A 3SEBA 2A74C 3A7AB 4JI3Q 4LUOA 2HHHL 1WTQA 5CBAE 3HOXH 3F8TA 2ALYB 1CM9A 4B9XA 1IBKQ 5IGDA 4FF2A 5ELNA 4DNRB 3HOWG 2F0JA 3N52A 1P16A 2RF4A 2R61A 2F1MA 2OCEA 1EOVA 1U0LA 1N33L 2TMPA 2VUMH 4BY1B 4KHPL 1D5XC 2RDFA 2Q2UA 1VQMA 3GTMB 2LSSA 3S2HB 2V4DA 1FNVA 3NP8A 2EQSA 1CK1A 1PDQA 1HHVA 2DGYA 1TWGH 3U58A 5M3MG 3PSIA 4BWGB 2AUKA 1F9PA 3KJOA 5C0XG 2E8GA 3W1BA 2O5JC 1RODA 5CR3A 4I65A 1NR2A 2F0KA 2KECA 2QW7A 2EVBA 2NYZD 4DV2L 1KAWA 1GUOA 3K5LA 1NMGA 1XTDA 4QUFA 3QR8A 4Q5VA 1SE3A 1SYCA 3R2IA 4QIWB 2KCTA 2N78A 2CWPA 2YV5A 1YHBA 1DJRD 1U4MA 1TWAH 5CMDA 1RKNA 3NBHA 3O13A 3NENA 3RZOB 4C2MB 1DXMA 4JBMA 2WIIB 1GUSA 1VF5C 3TP8A 4DA2A 1QZGA 2UUCL 5LMNL 5AJ3Q 4X3TA 5DEHA 4DKAC 5M5YB 3PF4A 4AYBE 1S5DD 5KIXA 1MSGA 4CDDC 1SNCA 1Y1WB 1NMFA 2B2YC 1Y1VB 3DEPA 4JVZA 2F4IA 4ZRZA 1PYBA 4A3IB 1BO0A 3VYUA 1JB7A 1CKMA 1CUKA 2M2LA 5JJZA 3RN2A 1HRJA 3ONAB 1IW7C 3PUZA 4HIMA 1YHQA 4ZYSA 2F03A 2UUBL 2B2TC 2JA5H 3C1FA 3EIVA 1KNEA 1R4QB 2Z4IA 1V43A 4A3LH 3MFGA 1I6HB 4GKJQ 1C9OA 4DNTB 2WB1G 4A93B 3CC2A 4C3JG 3RR5A 3TS2A 1UEBA 2K14A 3J80i 1SJED 3CCUA 1H9JA 1QCBD 3HOZG 2EOTA 4KD4A 4A3GB 1LO5D 3GP7A 3D31A 2NN6H 3CKIB 2CQAA 4RGTA 3HKZG 2E2IH 2CHBD 2OQKA 2PZUA 4JI2L 4XYQA 1K0SA 4K2LA 2XNAC 4UP9A 1EEID 1AP0A 4JI3L 2N8NA 4S3SA 2A19A 4C3HB 1QUQA 2GVBA 4IALA 1EQTA 1SRUA 2GN5A 4FVMA 1L2FA 1LV9A 4LFBQ 5CV5A 2C5CA 1TS2A 3MEHA 4JCVE 3PUWA 4A3BH 5I9PA 1M1KC 3QJYA 1EY7A 2FMCA 2DY8A 2H1EA 4IPCA 4DNIA 2EIFA 5T1IA 3K81C 3OHXC 2K75A 4K5VA 1GUGA 2L15A 4LFAQ 5IYCH 2N55A 3E9IA 1EWIA 4K8IA 4JI7Q 1B53A 1O7ZA 1PH9A 2YU9B 1EWHA 4DK0A 2KA7A 1J8IA 2SNMA 2KEDA 4KMUC 1JE5A 4A3JB 5JPMC 1O78A 3PCOB 3IL8A 1PFMA 4IN3A 1O80A 2JA6G 1EQVA 3KLRA 2A6ED 1R9TH 1NJIC 4QB4A 4A3EB 3URYA 1V1OA 1N36L 3K5MA 4J1MA 3TS0A 2EYHA 1XNRQ 1I4PA 1H9MA 2XN9C 5FLMG 3J80L 1PVOA 2PI2A 5A2QL 2NVTH 2F0VA 3V96A 2R93B 1Y8NB 4DXFA 4RWSC 1AEXA 1Q12A 4ME3A 2L1BA 5IODA 3T51B 2K32A 4XXEA 3U4ZA 2PPBC 4BY1G 1PH1A 1M4VA 4GOPB 3SXHA 1IYVA
chains in the Genus database with same CATH topology
1IHZA 4KN4C 5C0XI 1QB5D 4KKSA 4U673 5FO7B 5E4WC 1FR3A 2ICIA 4DXGA 1WCMB 4FF3A 3KLSA 4MN3A 3DWAA 4IUNA 3J81L 5JEAG 3S17B 4O42A 2EXZA 1DM0B 1Q1EA 1I4XA 3I70A 1B50A 1TY0A 3HOYB 4X3UA 2ZXRA 3MXNA 1EEFD 2KEEA 4N9TA 4G7ZC 2K33A 4QMGA 1PTOF 5C0XH 1EZ8A 1XYIA 1QE6A 2IX1A 3S1NB 1EIGA 3HG9A 5DM73 5CC4A 3GTPB 1LT6D 1SYDA 1PRTF 5DAUA 3CQZB 2BDOA 5G3LF 4RHRA 2F0SA 3D8GA 2B2UA 3KBGA 3QG1A 2RSNA 2QCPX 5C3XA 3I4NB 1DOMA 4A3FB 4RKLA 5IIFA 1HQMC 3HEJA 3P7JA 3DWPA 1ENCA 4KN7C 1TKWB 1PXUA 1W6JA 4RA8A 2XSCA 4YIJA 4DGZA 3S1QB 1EY5A 3PO2B 5ELFA 2O2LD 5FLXL 2HDLA 1JICA 3D6WA 3HGBA 1AZQA 3PO3B 1E2VA 1PZJD 4ZUIA 3L3OC 1ENFA 4IFDI 1LTAD 4HEDA 1F2LA 3HRZC 1GUWA 2OEOA 4C3HG 3A8JE 1DONA 2AWOA 3VA7A 3MTSA 3FEWX 5CORA 1GHJA 1EZ6A 5C6AA 4FXGC 2Y0SB 4DAVA 2RVLA 2JA8B 1ESFA 1JORA 1JB3A 4K2KA 1NCVA 1EYCA 2B2VC 3BVZA 2WKDA 3MHBA 1TR5A 1TIID 4J8QA 5CYUA 3D4DA 1BCPD 1H9KA 3TSSA 2D9UA 4V190 2KQ3A 3D4WA 3MFYA 4FNFA 1LTSD 2IX3A 1R4PB 3OMGA 2EDGA 4ZK9B 1HCZA 2B8GA 4EQNA 4DN4M 1D2BA 3J7AV 1C4QA 3PIP3 3Q23A 2K1BA 5EPJA 1D1KA 3DXJC 1I4GA 2F0EA 1LT5D 1BOSA 2EY5A 4ZUJA 3D3RA 2HCIA 3ND9A 4XIGS 3H3VC 5BN5A 3OW7A 3NTHA 3HOUB 3BG3A 4C1NK 2LS01 1ILQA 1SXTA 1VMCA 3TZDA 4H0LC 1TVXA 1QWYA 4ZKCB 3I3CA 3JAME 2A6EC 1PFNA 1LTGD 1SYBA 5CV9A 4XYOA 1VCIA 2D5DA 3KUPA 3MXPA 1G8ZD 5JEAH 4KKTA 4F8MA 4H44C 2LKVA 1E2WA 3EROA 2F3VA 1KLUD 2AUJD 2VXWA 1EIHA 1AW7A 2VB2X 5C3EB 2G9HD 1EYAA 4IUPA 2QILA 1Y8OB 1F2YA 1SE2A 1PMRA 5LL6S 4OO1G 2E75C 1TU2B 5EBDA 2F3WA 1G2SA 3VR5A 3P75A 5I4DA 1KAAA 3Q24A 4OIKA 2WB1B 1SYEA 4C3JB 4K5XA 1CZWA 4OGQC 5FK9C 4C56C 2EJGC 3ZYYX 2L9HA 5C4XB 3OPOA 2MP1A 1Q8IA 1SFOB 2FMMA 3M3YB 2L55A 2RDHA 5LHY1 3S1RB 5J22A 2X6GA 1BDOA 1WTXA 3GTJB 1W6KA 5M5WB 3P1HA 5JPNC 4G4KA 4ULLA 1K83B 3DEOA 1ENAA 2XWBB 3S1MB 2KCNA 3BDLA 4V0BA 1DYQA 4I7ZC 5JVH3 4CKCA 2OF1A 2E2HB 1TWCB 4PMBA 2MUYA 1ML0D 1BF4A 1ZYRD 4LMQD 5IGBA 5NUCA 3QIAA 3LWUA 1Z7TA 2IPKD 3LNNA 3OMCA 1X3QA 2CW0D 3SK5A 1JWMD 4XTCS 3W3AA 5FO9B 2SEBD 2KUMA 2QDBA 2EE1A 3NTKA 2PMZB 1FD7D 1CA6A 3T53B 5M3FB 1H9RA 2XWJB 1QNKA 4TQUS 1JWSD 2J7ZA 5T1GA 4NMZA 3ERQA 1OXUA 1STNA 2B2WA 3M7NA 3OSOA 4EQPA 1BCPC 1GJXA 3EFXD 2AWNA 1EU4A 2K5DA 3I73A 5EGTA 1E0BA 1S4ZA 4PNYA 1EY8A 1BQQT 3Q22A 4KV6A 3K7AB 1Y8PB 4QCLA 4CGYB 1NAPA 1UNSA 3PUVA 3NXWA 1T5EA 2EJMA 3CHBD 2NN6I 1CHQD 1TWHB 4OO1I 3I8ZA 1TQOA 3VYTA 2YYZA 3R3OA 4K6LA 1S5CD 3PV0A 1PZKD 4LK1C 4KKUA 3X3NA 3D4RA 3BZDB 4TRDA 1SAPA 4RH6A 4RKBA 5G3LD 5C4HA 3TN2A 3LWEA 1L0XB 1KNAA 3MVVA 1BR9A 4EGVA 3NWSA 4RCOA 1UAPA 4IQZA 4L6TB 1D6EC 1AZPA 1CQVA 4IUVA 2IJ0A 1G291 4OO1H 1YNND 4BS9A 1EY4A 1SNOA 3FPUB 4X3SA 1GXDC 3HOVB 1V1PA 3TP7A 4PMWA 3DUZA 2EY2A 4K8JA 5HURA 4G7HC 3VA5A 3GTKB 1Y69U 2WKCA 1LTID 1DOLA 5C4ZA 3K59A 3OIPA 2EJFC 5EJWA 1B1ZA 4IZ8A 1EU3A 1PRTB 1KDBA 4Y7NB 2WP8J 3MAQA 5M9OA 4G57A 2RA4A 2Q8IB 3S15B 1IKLA 3H09A 2M9VA 4K5WA 4WORA 1HFGA 2ZXOA 3GTGB 2KHSA 3RZDB 1EY0A 4KHZA 4HTHA 3SR1A 3TBIB 2HDMA 1Z47A 5IOCA 1VMPA 2I07B 1RJTA 1SNQA 4HMIA 2ICEC 2R92B 3E5SA 2IWHA 1CTMA 2B2YA 4K6DA 3KK7A 4ZLTF 2F0GA 1FYCA 4ZQ3A 4XQQA 5IT9E 2EPBA 2NVQB 3NPPA 4A3MB 5JVG3 4DK1A 2B2TA 1JOOA 2D62A 4HR7B 1OO9B 4KY6A 4Z9CB 2WAQB 2J4XA 1ZYRC 2JXMB 2F0IA 5KRUA 1SNMA 5D3DA 3U9OA 2MHVA 3KBXA 4FXKC 4RGOS 3K57A 2AQ3B 3K5NA 2CW0C 1SE4A 3SDZA 1NUCA 3G6JB 3T4AC 4MIUA 1BBXC 2C9OA 2PW5A 1RTNA 3S9WA 4JK1C 2A6HD 2M00A 1B2TA 1YNJD 2B8FA 2KOLA 3I90A 3F2UA 5CBEE 2RKSA 4UAIA 3T16A 2D2CC 3RD4A 2NWGA 1ICWA 3DMUA 2MJ8A 3TZUA 5KNBA 2B63B 3I4MB 2OXPA 4KHVA 1Q3LA 2LFNA 1K8MA 2A68D 3SE0A 5C44B 3V05A 4CBVA 2R6GA 4DF7A 1OXTA 4BY7B 4IFDJ 3H91A 1SMYD 5A35A 1KTKA 5CV4A 2K01A 1NR4A 1CFMA 3J7AF 1B9MA 5C5LA 5J39A 1JR0D 4FP5D 3M85A 1K8OA 3K0YA 3VYSA 3H6MA 1WTVA 3M7GA 1MBYA 3OOCA 4WFN3 1R9TB 3BDCA 4A3DB 2GA4B 1HPCA 3VR6A 1ET9A 4F88A 5I6YA 3SK4A 1SJHD 1CQFA 3BS1A 3AU7A 3RMHA 3T13A 2RSOA 5AFWA 3EA6A 3TDQA 1HXYD 1HA6A 1EYDA 2EYLA 3MC0B 2B39A 5E3FA 3RLFA 3KF8A 2FHTA 1SYFA 1HUMA 1XXGA 3I91A 2BA1A 3A7LA 2BOSA 1RTOA 4HAEA 3H0GB 1SYGA 3A8IE 1V1PB 2PNRC 1A2UA 3DHQA 5CGKA 2PO4A 1MGSA 2NVXB 1Q90A 5M5XB 3HZXA 1WTPA 5EKKA 1OXSC 2A5HA 4F87A 3BVMA 3Q6SA 5K36G 1SSOA 2R7ZB 2XRQD 3U9SA 5BN3A 4UDUC 2L11A 3ND8A 4ID6A 2E2JB 1DZ1A 1I50B 3LX0A 3HS0C 3NHHA 4H7BA 3VR3A 4HCSA 4XQNA 4LJZC 4FXDA 1MD2D 1GHKA 1ILPA 3FKIB 4FYDA 1QNUA 2VB3X 1XX8A 1A3VA 3NUCA 4NDXA 2Q8TA 3C46A 1MI2A 2B2WC 3J80E 1S5BD 5A2QE 1ET6A 2XVSA 4P2CB 5BN4A 4CKBA 1VF7A 4ABNA 3P20A 2PZWA 3FVQA 1EWCA 3GTOB 3NTIA 2F0PA 2Z8LA 1IKMA 5DNFA 2F0DA 4OL7A 5EKIA 3DM1A 4PQXA 2F0OA 1YNJC 3J81E 1IYUA 5COYA 2VNUD 3IAYA 3BDOA 5IGGA 2K6AA 2ENBA 3C2PA 1QJOA 5HGTA 1F9QA 2SOBA 4JBWA 4TKOB 1TY2A 1GUTA 3E6ZX 1BCPF 1DD2A 2HCCA 2L12A 5K5PA 2K05A 1WD1A 4BBSB 2L0CA 2RDGA 1JC7A 1JE4A 5C3WA 2JA7B 1STHA 4ZAIA 1PYWD 2IW3A 3EVQA 2A68C 1VDZA 1DOKA 1O7LA 4DFAA 4C3IB 3ITPA 3SHLA 3IFTA 1B44D 2K7VA 4RCNA 1NSNS 4HSPA 1L0YB 3NSWA 1RCVD 1SMYC 1LTTD 3OWFA 4BBRB 5KNDA 3QB3A 5I2YA 1SDFA 3K6OA 4RAUC 1II3A 5C4JB 2PYKA 5J1ZA 1T5XD 5E1FA 5I2XA 2KCCA 4CJ2C 3K5OA 3WDNA 2R3ZA 5FO8B 4B9WA 3MXUA 3QOJA 4IUUA 1BXTA 1SEBD 2Z4HA 5D14A 4FF1A 3EJIA 5FLXE 2DNCA 4HN7A 1AN8A 4CHTB 1D5ZC 4N9PA 3MZ5A 3CU7A 2EZVA 4XT1B 5KNCA 1ESRA 5LL6X 3NWTA 4Q0FA 3TMEA 2E74C 2F0UA 1B3AA 2F0QA 4RGMA 4KY5A 4PV1C 5KYLA 3M4OB 2NVYB 3BVGA 2BE5D 3A56A 3CRLC 4HCEA 1PTOD 1STBA 2SDFA 2K04A 4F7XA 1STYA 5FKAC 3C1EA 5ELDA 3G7LA 2ID0A 3CRKC 4NP5A 4DAYA 2EYMA 3AMUA 5K36H 1PRTD 5TSSA 3PIO3 3NK9A 4NKLA 1A3TA 1EL0A 4RHSA 4FF4A 2WACA 1TS5A 3GV3A 3Q0AA 3S16B 1J9OA 1D5MC 1Q1BA 3PUXA 1ZKOA 2HUGA 1I6VC 4K14A 5ISRA 1KDCA 1SBBB 4WRDA 1S5FD 2EY6A 2Q8RE 2EYOA 3JAML 5EPKA 1A15A 1STAA 5CV7A 2O4XA 1Z6HA 4KK7A 2CVRA 3I4LA 2ZT9C 1PTOB 4FO2A 2XRSD 4TSSA 4QF4A 2FJ2A 4R8IA 1KLGD 2E76C 2JEBI 2B2UC 3I72A 1TWFB 4IFDG 4C1NI 1TS4A 3D6CA 2FFKB 4A3KB 1A2TA 3V2TA 1I3QB 5EQ0A 3R8BA 1LTRD 2A73B 3A54A 4ILWA 3PMFA 1F77A 2K28A 3HOXB 4HMJA 1H9SA 1JQYD 1JCKB 1HUNA 2EYPA 1B4OA 2IL8A 4C3IG 1OXXK 1F2ZA 5DM63 2VUMB 4CJ1B 4BA1I 4XDXA 1GOZA 4KJNA 2SNSA 3WOEA 3IFDA 5ELCA 2Z1CA 1TWGB 2RBMA 5C0XJ 4M8AA 2L5TA 4RFBA 2DN8A 3RUZA 4KJOA 3NBIA 1V8QA 5F2DA 2F0NA 1G6ZA 2KJXA 3NQIA 1CA5A 2NBFA 4HSVA 3M4YA 4G7OC 2AQ2B 1HA5A 3UI2A 1EOTA 4J6HA 4RGNA 2WINB 4O1NA 1ZEQX 5FOBB 1TWAB 4QUCA 2PW7A 2LY7A 3X3MA 4OIJA 1I4HA 2G9DA 4ZKBB 1XTCD 3AB9A 2X69A 1QILA 2LMCB 1EFID 4XT3B 1TS3A 2NTTA 3SK6A 4B08A 3MXGA 2JA5B 1HTLD 4AYBB 3L7ZC 3W2DA 1STGA 2NUCA 2X6LA 5ELBA 1X32A 3TP5A 1S5ED 2ZXPA 2QEJC 4OHJA 1MSHA 5I9OA 1U4PA 3L9AX 1A3UA 1RD9D 3EQLC 3FDTA 4R8NA 1LTBD 1AFPA 2NB0A 2E2IB 4U68A 2MGSA 1WTOA 1CT1D 3OWEB 3KLSX 5KGUA 1XWEA 1D1IA 5IGFA 2A69D 4LAAA 2L4NA 3QO2A 4X3KA 4A3BB 2BE5C 2NTSA 3VR4A 1JWUD 1JOKA 1QOHA 1PTOC 1EY6A 1LABA 5D65A 1JOQA 2WV6D 3GD7A 2PCFB 2PZTA 1FGBD 1UUPA 4PMCA 3C3LA 2BDNA 2MPMA 1PRTC 3VR2A 3SK8A 2NZ1D 5KEEA 5EPLA 2HQEA 5KYIA 1I4RA 1LT3D 1X3PA 3GO5A 3WOFA 5E4XA 1KABA 2NVTB 4XQJA 1KDAA 2BA0A 5EBCA 3TP6A 1F9SA 1YNNC 2JP1A 3FMCA 4IFDH 2EYFA 2FINB 2EYJA 1F9RA 5C5MA 3FPPA 1QG7A 3HP3A 3QOLA 3R93A 1UEAB 1G91A 4L8JA 4KY7A 5CV8A 1B9NA 4GZYC 3HOWB 4CJ0B 3SVMA 5JEAJ 2JYOA 3GTQB 4DU9A 1DCZA 2KVMA 4KTAA 1ZXTA 4MHEA 1RHPA 4E6IA 2PQEA 3K58A 2AQ1B 1RF2D 2QF7A 2JE6I 5M3MB 5IGEA 2EY1A 3VYRA 1IW7D 1U4LA 1WTRA 1CHPD 2TSSA 4IURA 4IUQA 1CI3M 2QKIC 2IX0A 3GQBA 1WD0A 1GUNA 1I4QA 3OIQA 2BCOA 1H9SB 5D3IB 1SNPA 3DWQA 1BCPB 2IT1A 1FNUA 1ONLA 1OXVA 1PLFA 2K5QA 3IKJA 4DAPA 1PFBA 1SNDA 3PUYA 3H94A 1HFNA 4WJWA 1WTWA 1HTPA 5JAVA 1TT2A 1WVLA 2DY7A 4ME5A 1IL8A 3A55A 3NE5B 4EVOA 5I6WA 1O7YA 4R9WA 3GV6A 2H4OA 1F2MA 3BYTB 1C48A 3S14B 1G2TA 2B2VA 4ODGA 5JOBA 2JEAI 3S2DB 1STEA 2NN6G 1U9RA 3MA2B 1LT4D 3NQTA 4KI0A 4NW2A 3R2TA 1PZID 5IT9L 1E2ZA 3FRPB 2OT2A 2DNEA 1RDPD 3E0JA 3QWNA 2F0FA 2F0HA 4H13C 1BUVT 2J0TD 3HOZB 2JSOA 1A6XA 2RQXA 2F0TA 4EQOA 3GTLB 1HQRD 3HKZB 1EY9A 4M1UB 2A6HC 2K5WA 5ELEA 3N6RA 2E2DC 4KD3A 4L63B 1U4RA 3BYYB 2O5IC 3J7YW 2F0MA 1BNZA 4CKEA 5IGCA 1PTOH 1C8CA 2N88A 2K03A 3T56B 1LACA 1M8AA 1CZGA 5EKLA 5CV6A 3A8KE 4IUTA 1FNWA 1LLRD 2A69C 3MWYW 4BA2I 2F0LA 2JA6B 2XIWA 2F0WA 2I46A 3SEBA 2A74C 3A7AB 1WTQA 5CBAE 4B9XA 1CM9A 5IGDA 4FF2A 4DNRB 2F0JA 3N52A 2R61A 2F1MA 2TMPA 4BY1B 1D5XC 2RDFA 3GTMB 3S2HB 2V4DA 1FNVA 3NP8A 1HHVA 1CK1A 1PDQA 4BWGB 2AUKA 1F9PA 5C0XG 2O5JC 1RODA 5CR3A 4I65A 1NR2A 2F0KA 2KECA 2EVBA 2NYZD 1GUOA 3K5LA 4QUFA 4Q5VA 1SE3A 1SYCA 3R2IA 4QIWB 1DJRD 1U4MA 5CMDA 1RKNA 3NBHA 3O13A 3RZOB 4C2MB 1DXMA 2WIIB 1GUSA 1VF5C 3TP8A 4DA2A 4X3TA 5DEHA 5M5YB 1S5DD 5KIXA 1MSGA 1SNCA 1Y1WB 2B2YC 1Y1VB 3DEPA 2F4IA 4ZRZA 4A3IB 1BO0A 3VYUA 2M2LA 5JJZA 1HRJA 3ONAB 1IW7C 3PUZA 2F03A 4ZYSA 2B2TC 3C1FA 1KNEA 1R4QB 2Z4IA 1V43A 3MFGA 1I6HB 4DNTB 4A93B 4C3JG 1SJED 1H9JA 1QCBD 2EOTA 4KD4A 4A3GB 1LO5D 3GP7A 3D31A 2NN6H 3CKIB 2CQAA 4RGTA 2CHBD 2PZUA 4XYQA 4K2LA 2XNAC 1EEID 1AP0A 4S3SA 4C3HB 4IALA 1EQTA 4FVMA 1LV9A 5CV5A 2C5CA 1TS2A 3MEHA 3PUWA 5I9PA 3QJYA 1EY7A 2FMCA 2DY8A 2H1EA 5T1IA 3OHXC 4K5VA 1GUGA 2N55A 4K8IA 1B53A 1O7ZA 2YU9B 1EWHA 4DK0A 2KA7A 1J8IA 2SNMA 2KEDA 4KMUC 4A3JB 5JPMC 1O78A 3IL8A 1PFMA 4IN3A 1O80A 1EQVA 3KLRA 2A6ED 4QB4A 4A3EB 3URYA 1V1OA 3K5MA 4J1MA 2EYHA 1I4PA 1H9MA 2XN9C 3J80L 5A2QL 2F0VA 3V96A 2R93B 4DXFA 1Y8NB 4RWSC 1AEXA 1Q12A 2L1BA 5IODA 3T51B 2K32A 4XXEA 2PPBC 1M4VA 3SXHA 1IYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IHZ A;  2F0W A;  4ZUI A;  5JAV A;  3P1H A;  1TT2 A;  4QF4 A;  3QOJ A;  3C1F A;  4B9W A;  1KAB A;  4ME5 A;  2OEO A;  4B9X A;  1SYG A;  1SYB A;  2RKS A;  3EJI A;  3T16 A;  1ENA A;  3NXW A;  4K5W A;  4WOR A;  5CV9 A;  4EVO A;  5I6W A;  5IGD A;  2F0J A;  1KDA A;  2PZW A;  3DMU A;  3TP6 A;  4N9P A;  1F2M A;  1TQO A;  3MZ5 A;  3R3O A;  2KHS A;  1EY0 A;  1JOR A;  2OXP A;  3BDL A;  4HTH A;  2F0P A;  3SR1 A;  4IUN A;  3TME A;  2EYF A;  4KHV A;  3MXP A;  2F0D A;  2EXZ A;  3D6C A;  4OL7 A;  1EZ6 A;  4ODG A;  5JOB A;  2F0U A;  1A2U A;  5IOC A;  1A2T A;  2F0Q A;  2EYJ A;  1U9R A;  4KD4 A;  3SK6 A;  2OF1 A;  3V2T A;  4F8M A;  5C5M A;  4KY5 A;  2RDF A;  3DHQ A;  5C6A A;  5KYL A;  3NQT A;  5CGK A;  3QOL A;  4PMB A;  2PZU A;  3PMF A;  3NP8 A;  2F0O A;  4K2L A;  4TRD A;  2LKV A;  1SNQ A;  4KY7 A;  4K2K A;  4HMI A;  1STG A;  3ERO A;  4HMJ A;  4RKB A;  2NUC A;  4S3S A;  5CV8 A;  5C4H A;  5NUC A;  5IGB A;  4DF7 A;  3HZX A;  4IAL A;  2F3V A;  1EYC A;  3TP5 A;  4N9T A;  2EYP A;  5EKK A;  5CV5 A;  1STB A;  4QMG A;  3E5S A;  3MEH A;  3MHB A;  3MVV A;  5CR3 A;  1EYA A;  1EZ8 A;  1TR5 A;  3OMC A;  2F0F A;  4I65 A;  5I9O A;  4F7X A;  1F2Z A;  2ENB A;  4DU9 A;  1A3U A;  1STY A;  2F0H A;  5I9P A;  5HGT A;  1F2Y A;  3C1E A;  2SOB A;  3SK5 A;  4K6D A;  2F0K A;  3S9W A;  1EY7 A;  2F0G A;  4ZQ3 A;  4NP5 A;  4R8N A;  3D4D A;  5CV4 A;  2F0T A;  4KTA A;  4EQO A;  2EYM A;  5CC4 A;  4K5V A;  5K5P A;  4E6I A;  4KJN A;  2SNS A;  1EY9 A;  2PQE A;  5C5L A;  5J39 A;  2QDB A;  4K8I A;  1SYD A;  5DAU A;  1SYC A;  2KQ3 A;  5KGU A;  3D4W A;  5IGF A;  1EY4 A;  1SNO A;  2F3W A;  5C3W A;  1JOO A;  1STH A;  2RBM A;  3NK9 A;  3EVQ A;  2SNM A;  4KD3 A;  3P75 A;  4KY6 A;  3H6M A;  4LAA A;  1KAA A;  4KJO A;  3RUZ A;  2EY1 A;  2F0S A;  3D8G A;  4G57 A;  3OMG A;  3TP7 A;  4DFA A;  1RKN A;  5IGE A;  4NKL A;  5F2D A;  4ID6 A;  2F0I A;  3ITP A;  3SHL A;  5C3X A;  4EQN A;  1SYE A;  5KRU A;  2EY2 A;  1JOK A;  4K8J A;  5HUR A;  4K5X A;  1A3T A;  1SNM A;  3U9O A;  2WAC A;  2F0N A;  1EQV A;  3LX0 A;  1NSN S;  1EY6 A;  2F0M A;  3VA5 A;  4QB4 A;  3BDC A;  3NHH A;  4RKL A;  3TP8 A;  5IGC A;  4NMZ A;  4J1M A;  3ERQ A;  4H7B A;  3HEJ A;  5IIF A;  1STN A;  2EYH A;  1JOQ A;  5I6Y A;  3OWF A;  3SK4 A;  1ENC A;  3OSO A;  2PZT A;  4EQP A;  4J6H A;  5DEH A;  3QB3 A;  2F0E A;  5EKL A;  1SNP A;  1NUC A;  2F0V A;  5CV6 A;  2EY5 A;  4K14 A;  5C4Z A;  4ZUJ A;  4MIU A;  5KIX A;  1KDC A;  4PMC A;  4WRD A;  4YIJ A;  5ISR A;  3T13 A;  2EY6 A;  4IZ8 A;  4DGZ A;  1AEX A;  2EYO A;  2PW5 A;  1SNC A;  5IOD A;  1EY5 A;  5IGG A;  5EGT A;  1A3V A;  3NUC A;  1II3 A;  1STA A;  1KDB A;  4NDX A;  3SK8 A;  5KEE A;  2PYK A;  5J1Z A;  1EYD A;  2PW7 A;  5CV7 A;  2O4X A;  2EYL A;  2HQE A;  4PNY A;  5KYI A;  1EY8 A;  5E1F A;  2F0L A;  5E3F A;  3SXH A;  5J22 A;  1SND A;  5M9O A;  4KV6 A;  2M00 A;  1SYF A; 
#chains in the Genus database with same CATH topology
 1IHZ A;  4KN4 C;  5IYB H;  5C0X I;  1QB5 D;  3PGZ A;  4KKS A;  4U67 3;  5FO7 B;  3PIO A;  5E4W C;  1FR3 A;  2ICI A;  4LF6 Q;  3HOW H;  4DXG A;  3I55 A;  1WCM B;  4FF3 A;  3KLS A;  4MN3 A;  1Q8K A;  3DWA A;  4IUN A;  3J81 L;  3GTQ H;  5JEA G;  2MFI A;  3S17 B;  4O42 A;  2EXZ A;  1DM0 B;  1Q1E A;  1I4X A;  4IPG A;  1G6P A;  3I70 A;  1B50 A;  1TY0 A;  3HOY B;  1D8L A;  1VQ5 A;  2NZH A;  2ZXR A;  3MXN A;  4X3U A;  2ES2 A;  1EEF D;  5M3M H;  2KEE A;  4N9T A;  4G7Z C;  4DV4 Q;  2K33 A;  4QMG A;  1OTC A;  1PTO F;  4YY3 Q;  2UU9 Q;  5C0X H;  1EZ8 A;  1XYI A;  1QVC A;  1QE6 A;  2IX1 A;  5JJL A;  3S1N B;  1EIG A;  1RIP A;  2Q2T A;  3HG9 A;  3PF5 A;  5DM7 3;  5CC4 A;  3GTP B;  1LT6 D;  1SYD A;  1PRT F;  5DAU A;  3CQZ B;  4IPH A;  2BDO A;  5G3L F;  4RHR A;  1Y1W G;  1Y1V G;  2F0S A;  3D8G A;  1MIU A;  2B2U A;  3KBG A;  3QG1 A;  1VQG A;  2RSN A;  2QCP X;  5C3X A;  3I4N B;  1DOM A;  1VQP A;  4A3F B;  4RKL A;  1HNW L;  5IIF A;  1HQM C;  2VL6 A;  3HEJ A;  3P7J A;  3DWP A;  1XPU A;  1ENC A;  4KN7 C;  1HJP A;  1TKW B;  1PXU A;  1W6J A;  4RA8 A;  2XSC A;  4YIJ A;  1YHA A;  4DGZ A;  4NXN Q;  3S1Q B;  4JOI C;  4A93 G;  1EY5 A;  3PO2 B;  5ELF A;  2O2L D;  4X62 L;  5FLX L;  2HDL A;  1JIC A;  3D6W A;  3HGB A;  1AZQ A;  3PO3 B;  1E2V A;  3S14 H;  1GM5 A;  1PZJ D;  4A3G G;  4OX9 L;  3S2D H;  3J7A 5;  3M9B A;  4ZUI A;  3L3O C;  1ENF A;  1Q86 C;  4GNX A;  1VQB A;  1W3S A;  4IFD I;  1LTA D;  4HED A;  1XNR L;  1F2L A;  3HRZ C;  1GUW A;  2OEO A;  4LF9 L;  4C3H G;  3HKZ E;  3A8J E;  1DON A;  2AWO A;  1VQ4 A;  2KEN A;  3VA7 A;  3MTS A;  3FEW X;  5COR A;  3E9H A;  1GHJ A;  1YJ9 A;  1EZ6 A;  1IBM Q;  3HOZ H;  5C6A A;  4FXG C;  1KRT A;  2Y0S B;  4DAV A;  3GTL H;  4Y52 H;  2RVL A;  2JA8 B;  1ESF A;  1JOR A;  1JB3 A;  4K2K A;  1JJC B;  1KQS A;  1NCV A;  1EYC A;  2A1A A;  2B2V C;  3BVZ A;  4A3C G;  2WKD A;  4A3J G;  3MHB A;  4P74 A;  1TR5 A;  4N8F A;  1TII D;  4J8Q A;  4A3E G;  5CYU A;  3D4D A;  1BCP D;  1H9K A;  3TSS A;  1B8A A;  1B7Y B;  1MHW C;  2D9U A;  4V19 0;  3HKS A;  2E5L Q;  4BBS H;  3B6Y A;  2KQ3 A;  2R93 G;  2UXB Q;  3D4W A;  3MFY A;  4FNF A;  3OTO L;  1LTS D;  2IX3 A;  1R4P B;  3OMG A;  2EDG A;  2BH8 A;  4ZK9 B;  1HCZ A;  1JJG A;  2B8G A;  1Q46 A;  4EQN A;  4DN4 M;  2Z6K A;  3MEF A;  4GOP C;  1D2B A;  2JA6 H;  2OTJ A;  3J7A V;  4HJ9 A;  1C4Q A;  3PIP 3;  3Q23 A;  2K1B A;  5EPJ A;  3KDF B;  1D1K A;  3STB D;  1QUQ B;  3DXJ C;  1I4G A;  2F0E A;  1LT5 D;  5FLM H;  1BOS A;  2EY5 A;  2JK8 A;  4ZUJ A;  3D3R A;  2HCI A;  3ND9 A;  4XIG S;  1WCM G;  5BN5 A;  3OW7 A;  3H3V C;  2ZJP A;  3NTH A;  3HOU B;  1L1O B;  3BG3 A;  4B3M Q;  1SN8 A;  4YHH Q;  4C1N K;  2LS0 1;  1ILQ A;  2HQL A;  1SXT A;  1VQI A;  2CWA A;  1VMC A;  3TZD A;  4H0L C;  1TVX A;  4BY1 H;  4YCU A;  1QWY A;  4ZKC B;  1GKH A;  3I3C A;  1SRO A;  3GTM H;  3S2H H;  3HOY G;  3JAM E;  4GKK L;  2MO0 A;  2A6E C;  1PFN A;  1LTG D;  1SYB A;  5CV9 A;  2CKZ B;  4XYO A;  4N8X 1;  4QIW E;  1VCI A;  3TEH B;  2CCZ A;  2D5D A;  3KUP A;  1IZ6 A;  3MXP A;  1WOC A;  4KHP Q;  1G8Z D;  5JEA H;  1K73 C;  4KKT A;  1HNZ L;  1E3P A;  4JBK A;  4F8M A;  4H44 C;  2Z6B A;  1N32 Q;  2LKV A;  1BVS A;  1E2W A;  3ERO A;  2I5H A;  2F3V A;  1KLU D;  2AUJ D;  2VXW A;  5IWA L;  1EIH A;  1AW7 A;  2VB2 X;  5C3E B;  1EFW A;  2G9H D;  1EYA A;  1O7I A;  4IUP A;  3RZO H;  4WJ3 M;  4C2M H;  2QIL A;  1Y8O B;  1F2Y A;  4A3F G;  3CF5 A;  2XTI A;  5BR8 Q;  1SE2 A;  4DV2 Q;  1PMR A;  2IY5 B;  3UE1 A;  5LL6 S;  4OO1 G;  4DR6 L;  1CKN A;  2E75 C;  3A74 A;  1TU2 B;  1BBU A;  5EBD A;  4JBJ A;  4MNO A;  5M5Y H;  2F3W A;  4L5T A;  1G2S A;  2A8V A;  2B63 G;  3P75 A;  3VR5 A;  5I4D A;  3PO2 G;  1KAA A;  1Y1W H;  3FP9 A;  3Q24 A;  1PH4 A;  4OIK A;  2WB1 B;  2D0O A;  1SYE A;  4C3J B;  4K5X A;  1CZW A;  4OGQ C;  4A3I H;  5FK9 C;  4C56 C;  2EJG C;  1YJN A;  3ZYY X;  2ZTE A;  3HFZ B;  5LMN Q;  3S16 H;  2L9H A;  5C4X B;  3OPO A;  2MP1 A;  1Q8I A;  1SFO B;  2FMM A;  2BH2 A;  1Q81 C;  3M3Y B;  2L55 A;  2RDH A;  1YIJ A;  1WFQ A;  4A93 H;  2VY3 A;  5LHY 1;  3S1R B;  2JQO A;  5J22 A;  1V9P A;  2X6G A;  1BDO A;  4A3G H;  2Y0S G;  1WTX A;  3GTJ B;  5DLQ E;  2JA8 G;  1W6K A;  5M5W B;  3P1H A;  4H02 A;  1A0I A;  5JPN C;  4G4K A;  4ULL A;  1D7Q A;  1K83 B;  3DEO A;  1ENA A;  4X65 L;  4NB3 A;  2XWB B;  3S1M B;  4C3H H;  1EYG A;  4DV6 Q;  2KCN A;  3BDL A;  4V0B A;  1DYQ A;  4B3M L;  4I7Z C;  5JVH 3;  4DUZ Q;  2MNA A;  4CKC A;  4A3K H;  2OF1 A;  2E2H B;  3S24 A;  1QZH A;  4JI2 Q;  1TWC B;  1I3Q H;  3L2P A;  4PMB A;  4GLV B;  2MUY A;  1ML0 D;  1BF4 A;  1ZYR D;  4LMQ D;  5IGB A;  5NUC A;  2YU9 H;  1I5F A;  4JI6 Q;  3QIA A;  3LWU A;  1Z7T A;  2IPK D;  1DGS A;  1S72 A;  1KIX A;  2HT1 A;  4A3C H;  3ICE A;  3LNN A;  4A3J H;  3OMC A;  2PQA A;  1X3Q A;  1VQJ A;  2CW0 D;  3SK5 A;  4X66 L;  2I5L X;  2GVA A;  1JWM D;  4A3E H;  3H3V I;  4XTC S;  3W3A A;  4EQ5 A;  5FO9 B;  2SEB D;  2KUM A;  2QDB A;  2EE1 A;  1N32 L;  3NTK A;  3G48 A;  1HR0 W;  2R93 H;  1L1O C;  2PMZ B;  1FD7 D;  3HOU G;  1CA6 A;  3T53 B;  5M3F B;  1H9R A;  2XWJ B;  2K50 A;  1QNK A;  1VS0 A;  1VQ7 A;  4TQU S;  1JWS D;  2J7Z A;  1N36 Q;  1KL9 A;  1Y14 B;  5BR8 L;  5T1G A;  4NMZ A;  3ERQ A;  1OXU A;  1STN A;  2B2W A;  3M7N A;  1K3B C;  3OSO A;  4EQP A;  4NPS A;  1BCP C;  1GJX A;  4GS3 A;  4DV1 Q;  3EFX D;  2AWN A;  1EU4 A;  3OYY A;  1WCM H;  2K5D A;  3I73 A;  5EGT A;  1E0B A;  2H5X A;  3H3V H;  4JI4 L;  1S4Z A;  4PNY A;  2QEX A;  3S17 H;  1EY8 A;  1BQQ T;  3Q22 A;  4KV6 A;  1PHJ A;  4QGU A;  3K7A B;  3JAM i;  1Y8P B;  4QCL A;  4CGY B;  2OTL A;  5ELO A;  1LYL A;  3OW2 A;  1NAP A;  1UNS A;  3HOY H;  3PUV A;  1H95 A;  3NXW A;  1T5E A;  2EJM A;  3CHB D;  2NN6 I;  4P75 A;  1HNX L;  4HIK A;  1CHQ D;  1TWH B;  4OO1 I;  2F52 A;  1SE8 A;  1TQO A;  3I8Z A;  3STB C;  2YYZ A;  3R3O A;  3VYT A;  4K6L A;  5C3E G;  1S5C D;  1HZ9 A;  1E24 A;  3M4P A;  1U5K A;  3PV0 A;  1PZK D;  2C35 B;  4LK1 C;  4KKU A;  3S1N H;  4DK6 C;  3X3N A;  1L0W A;  3D4R A;  5L37 A;  3BZD B;  3CCV A;  3GTP H;  4TRD A;  1YNX A;  4JI1 L;  1SAP A;  4RH6 A;  4RKB A;  2OQ0 A;  4LF5 L;  5G3L D;  5C4H A;  3KFU A;  3TN2 A;  3LWE A;  1L0X B;  1ASY A;  1X54 A;  3ER0 A;  1KNA A;  4DV6 L;  3MVV A;  4OWW B;  1BR9 A;  3CC4 A;  3RLO A;  4EGV A;  3NWS A;  3I4N H;  4RCO A;  3KJP A;  1UAP A;  4DUZ L;  5E7N A;  4IQZ A;  4A3F H;  4L6T B;  1D6E C;  1AZP A;  1VQH A;  1CQV A;  4IUV A;  5C4X G;  2IJ0 A;  4GLX A;  4P72 A;  1G29 1;  4OO1 H;  1YNN D;  2N49 A;  3AFQ A;  1KC8 C;  4CDC C;  4BS9 A;  1EY4 A;  1SNO A;  2R7D A;  3FPU B;  4X3S A;  1GXD C;  3HOV B;  1V1P A;  4HID A;  3S1Q H;  3TP7 A;  1LTL A;  4JI6 L;  4PMW A;  3DUZ A;  4LF7 L;  3PO3 H;  2EY2 A;  4K8J A;  5HUR A;  1VQ8 A;  4G7H C;  5JJK A;  3ULP A;  2YTX A;  3VA5 A;  1T9H A;  5IP9 H;  3GTK B;  3CCQ A;  4CDF C;  1HNW Q;  2AKW B;  2ASB A;  2Y0S E;  1Y69 U;  2WKC A;  4JI5 Q;  1LTI D;  1DOL A;  3CMA A;  5C4Z A;  3K59 A;  3OIP A;  2EJF C;  5EJW A;  1B1Z A;  4IZ8 A;  1G51 A;  1J6Q A;  1VQD A;  4X62 Q;  3TRE A;  1EU3 A;  1LM0 A;  5IE8 A;  1PRT B;  4B3T L;  2K4K A;  1KDB A;  4Y7N B;  2WP8 J;  3MAQ A;  1GVP A;  4OX9 Q;  3SGI A;  5M9O A;  4G57 A;  2RA4 A;  4HJ7 A;  4BXX G;  4LNQ A;  2Q8I B;  3S15 B;  1IKL A;  3H09 A;  2JA8 H;  4DR5 L;  4LF9 Q;  2M9V A;  5IYD G;  2FXQ A;  4K5W A;  4WOR A;  1HFG A;  2ZXO A;  4DV1 L;  3GTG B;  1PA6 A;  2KHS A;  3CAM A;  3RZD B;  1EY0 A;  4KHZ A;  2RCF A;  4HTH A;  1Q82 C;  3SR1 A;  3TBI B;  4JI0 L;  2HDM A;  3G71 A;  4IOA A;  1VQE A;  1Z47 A;  5IOC A;  1VQO A;  4DR7 L;  1VMP A;  1Z9F A;  4BBR G;  3CXC A;  2F4V L;  2I07 B;  1RJT A;  1SNQ A;  1KD1 C;  4HMI A;  4CDE C;  4PG3 A;  2ICE C;  2R92 B;  5M3F G;  3E5S A;  1E1T A;  1CTM A;  4OON A;  2IWH A;  1YVC A;  1PH6 A;  3CP0 A;  2B2Y A;  4K6D A;  3KK7 A;  2ZTD A;  4ZLT F;  2F0G A;  1FYC A;  4ZQ3 A;  4XQQ A;  5IT9 E;  2KCM A;  2EPB A;  3F1Z A;  3CME A;  2NVQ B;  3NPP A;  4A3M B;  4UHV A;  3DLL A;  5JVG 3;  4DK1 A;  3LGJ A;  3OTO Q;  1E1O A;  2B2T A;  1JOO A;  2D62 A;  4HR7 B;  1OO9 B;  1WTH A;  4KY6 A;  4Z9C B;  2WAQ B;  3A5U A;  2J4X A;  3HOU H;  1ZYR C;  2JXM B;  2F0I A;  4RG1 A;  1TXY A;  5KRU A;  4MZ9 A;  5FJ8 G;  3RN5 A;  1SNM A;  5D3D A;  3U9O A;  2MHV A;  3KBX A;  4FXK C;  4RGO S;  3PQI A;  3K57 A;  1FVI A;  2AQ3 B;  4YCV A;  3K5N A;  5GQO A;  2QGQ A;  4POG A;  2CW0 C;  1SE4 A;  3SDZ A;  1XJV A;  5GAE C;  1YI2 A;  1NUC A;  3G6J B;  3T4A C;  3T1Y L;  4MIU A;  1BBX C;  3E0E A;  2C9O A;  2PW5 A;  1EQQ A;  4JV5 L;  4WJ4 A;  4APV A;  1RTN A;  3S9W A;  1HZA A;  4JK1 C;  2A6H D;  2M00 A;  1B2T A;  1YNJ D;  3NEL A;  2B8F A;  2KOL A;  3I90 A;  3F2U A;  5CBE E;  4UPA A;  4GKK Q;  3CD6 A;  2RKS A;  4UAI A;  3T16 A;  3W1G A;  2D2C C;  3RD4 A;  2NWG A;  4JI5 L;  5IY0 A;  1ICW A;  1VQC A;  3DMU A;  1AE3 A;  2MJ8 A;  2RHS B;  3TZU A;  5KNB A;  4L5R C;  4IO9 A;  4DR3 L;  2B63 B;  1I94 L;  3I4M B;  5C3E H;  2OXP A;  4YWL A;  3K7U C;  4KHV A;  2V1C C;  1Q3L A;  4HIO A;  1HNZ Q;  2WB1 E;  2LFN A;  2VS1 A;  1K8M A;  2A68 D;  1GD7 A;  3SE0 A;  5C44 B;  4DR2 L;  3V05 A;  4CBV A;  2Z0S A;  2R6G A;  4DF7 A;  3HOV G;  1OXT A;  5IWA Q;  4BY7 B;  2VQF L;  4J15 A;  4IFD J;  3NBH B;  4QY7 A;  3H91 A;  1VQL A;  1SMY D;  4C3J H;  1C7Y A;  5A35 A;  1KTK A;  5CV4 A;  2K01 A;  4NXM L;  1NR4 A;  4DR6 Q;  1CFM A;  3J7A F;  1UE6 A;  1YBY A;  3UDF A;  1NTG A;  1B9M A;  4UP8 A;  5C5L A;  5J39 A;  1JR0 D;  2JA9 A;  4FP5 D;  1XMO L;  1QVF A;  3D0F A;  3JAM c;  3M85 A;  1SFO H;  3K0Y A;  1K8O A;  3VYS A;  4GN5 A;  3F2D A;  3H6M A;  1WTV A;  2IHF A;  2MQH A;  3M7G A;  4L5S A;  1MBY A;  3OOC A;  4WFN 3;  3S1R H;  1R9T B;  2G5D A;  3BDC A;  4A3D B;  3GTJ H;  3ZJY C;  2GA4 B;  1HPC A;  3VR6 A;  5M5W H;  1ET9 A;  4F88 A;  5I6Y A;  3SK4 A;  1SJH D;  3AYH B;  1CQF A;  2I5M X;  1K83 H;  1B3Q A;  3BS1 A;  3S1M H;  3AU7 A;  3RMH A;  3T13 A;  2RSO A;  5AFW A;  3EA6 A;  3TDQ A;  1MJC A;  4JYA L;  1HXY D;  1HR0 L;  1HA6 A;  1EYD A;  2EYL A;  3MC0 B;  2B39 A;  1K0R A;  5E3F A;  2ZJR A;  3RLF A;  3KF8 A;  2FHT A;  1SYF A;  1HUM A;  1XXG A;  3I91 A;  2E2H H;  2BA1 A;  1TWC H;  3A7L A;  2BOS A;  1RTO A;  4HAE A;  4QJF A;  3H0G B;  1J5E L;  4X65 Q;  1SYG A;  3A8I E;  1V1P B;  3T1H L;  5IYD H;  1CSQ A;  2PNR C;  2R92 G;  4DK3 C;  4X64 Q;  2PMZ E;  4GLA C;  1A2U A;  5LMU L;  4P73 A;  3DHQ A;  5CGK A;  2PO4 A;  1MGS A;  2NVX B;  1Q90 A;  4A3M G;  4RMF A;  4R4I A;  5M5X B;  4LFC L;  3HZX A;  1K28 A;  1WJJ A;  2WAQ G;  3G6E A;  1WTP A;  5EKK A;  4I7A A;  1OXS C;  1K3R A;  1IBL L;  5M3F H;  1X3G A;  2A5H A;  4F87 A;  4JOI A;  1X56 A;  3BVM A;  4X66 Q;  3CCM A;  3CPF A;  1JT8 A;  4L5Q A;  3Q6S A;  5K36 G;  1SSO A;  2R7Z B;  2XRQ D;  3U9S A;  3K80 C;  3Q8D A;  5BN3 A;  4UDU C;  2L11 A;  4JC0 A;  3ND8 A;  4ID6 A;  1ASZ A;  2E2J B;  4PZ8 A;  3EN2 A;  1DZ1 A;  3KLW A;  1I50 B;  3LX0 A;  3K7A H;  3HS0 C;  3CPW A;  3NHH A;  4H7B A;  3VR3 A;  4HCS A;  4DR4 L;  4XQN A;  2IHE A;  2UXD L;  1NY4 A;  4LJZ C;  4FXD A;  1MD2 D;  1GHK A;  1ILP A;  3FKI B;  4FYD A;  1QNU A;  4PZ6 A;  1TWH H;  3I4M G;  2VB3 X;  1XX8 A;  3RLN A;  1A3V A;  3NUC A;  1Y1V H;  4NDX A;  4JI4 Q;  2Q8T A;  4B3R L;  3KOJ A;  3C46 A;  3AFP A;  1MI2 A;  2B2W C;  3J80 E;  1S5B D;  5A2Q E;  2WFW A;  1AH9 A;  1ET6 A;  2XVS A;  3MXN B;  4LW1 A;  5C44 G;  4P2C B;  2F3I A;  5BN4 A;  3UDI A;  4CKB A;  1HNX Q;  1PH3 A;  1VF7 A;  4YWK A;  4ABN A;  4BY7 G;  3P20 A;  2PZW A;  3FVQ A;  3A0J A;  1EWC A;  1I6H H;  3GTO B;  3NTI A;  2F0P A;  2Z8L A;  1IKM A;  2B29 A;  5DNF A;  2CQO A;  1JMC A;  2F0D A;  4OL7 A;  1IXR A;  5EKI A;  3DM1 A;  2ZTC A;  3JC6 6;  4GOP A;  1MJE A;  4PQX A;  3UE0 A;  3PIP A;  4JI1 Q;  2F0O A;  4LF5 Q;  1YNJ C;  2NZO A;  1X55 A;  3J81 E;  3BJU A;  1IYU A;  3HOV H;  5COY A;  4A4I A;  2VNU D;  3IAY A;  3BDO A;  4LF8 Q;  5IGG A;  2PNH A;  2K6A A;  2ENB A;  3F2C A;  4X64 L;  3C2P A;  1QJO A;  5HGT A;  1F9Q A;  2SOB A;  4JBW A;  4TKO B;  4A3D G;  1TY2 A;  4IJH A;  1GUT A;  3E6Z X;  3GTK H;  1BCP F;  1DD2 A;  2HCC A;  1VQA A;  2L12 A;  5K5P A;  3CW2 C;  2K05 A;  3FHW A;  1WD1 A;  1UE7 A;  4BBS B;  2L0C A;  4IOC A;  2RDG A;  4AH6 A;  1JC7 A;  1JE4 A;  2XGT A;  5C3W A;  3J7Z C;  2JA7 B;  1STH A;  2HD3 A;  4ZAI A;  1PYW D;  2IW3 A;  3EVQ A;  1XPR A;  2A68 C;  1VDZ A;  1DOK A;  1O7L A;  4DFA A;  4C3I B;  3ITP A;  3SHL A;  3IFT A;  4LF7 Q;  1B44 D;  2K7V A;  4Y7N H;  5HY6 A;  4RCN A;  1NSN S;  4HSP A;  4GNX B;  2UUA L;  1L0Y B;  3NSW A;  3S15 H;  1RCV D;  1SMY C;  1LTT D;  3H0G G;  4UP7 A;  3OWF A;  4BBR B;  1X3F A;  2ZM6 L;  5KND A;  3QB3 A;  5I2Y A;  4DV5 L;  1SDF A;  3GTG H;  1N34 Q;  3K6O A;  1FJG L;  3RZD H;  4B3T Q;  4RAU C;  1II3 A;  5C4J B;  2PYK A;  3TRZ A;  5J1Z A;  1T5X D;  5E1F A;  1FL0 A;  5I2X A;  2KCC A;  4CJ2 C;  3K5O A;  3WDN A;  2R3Z A;  5FO8 B;  4B9W A;  3MXU A;  3QOJ A;  4IUU A;  4DR5 Q;  1BXT A;  1SEB D;  4MTK A;  3E3X A;  2Z4H A;  5D14 A;  4FF1 A;  3EJI A;  5FLX E;  2DNC A;  4HN7 A;  3CC7 A;  1PH8 A;  1AN8 A;  3CCS A;  4CHT B;  1D5Z C;  4N9P A;  3MZ5 A;  3CU7 A;  2EZV A;  4XT1 B;  5KNC A;  1ESR A;  5LL6 X;  2R92 H;  1C0A A;  3NWT A;  4Q0F A;  4JI0 Q;  5GAD C;  3TME A;  1CSP A;  2WAQ E;  4LF4 L;  2E74 C;  4YWM A;  4FDB A;  2F0U A;  4R4C A;  4DR7 Q;  1B3A A;  2F0Q A;  4RGM A;  4KY5 A;  4PV1 C;  2R7Z G;  5KYL A;  2F4V Q;  3M4O B;  1N8R C;  2NVY B;  3BVG A;  4DPG A;  2NVQ H;  2VQE L;  4A3M H;  2BE5 D;  3TQY A;  3A56 A;  3CRL C;  4JI8 Q;  4HCE A;  1PTO D;  1STB A;  4DUY L;  2SDF A;  4YCW A;  4O2D A;  3BZC A;  2K04 A;  4F7X A;  1STY A;  3KF8 B;  1YJW A;  5FKA C;  4DV0 L;  3C1E A;  5ELD A;  2JJQ A;  3G7L A;  2ID0 A;  3CRK C;  4NP5 A;  5GAG C;  4JPB W;  4DAY A;  2EYM A;  3AMU A;  5K36 H;  4LUV A;  1PRT D;  3K8A A;  4DV7 L;  2KHJ A;  1K9M C;  1XPO A;  5TSS A;  3PIO 3;  1XMQ L;  3FKI G;  4R4O A;  3CQZ H;  3NK9 A;  1PYS B;  4NKL A;  1MKH A;  4X6A H;  4LF8 L;  1A3T A;  1EL0 A;  4RHS A;  4FF4 A;  2WAC A;  4DV3 L;  1S40 A;  1TS5 A;  3GV3 A;  3F2B A;  3Q0A A;  3S16 B;  1J9O A;  5HGQ A;  1D5M C;  1Q1B A;  3PUX A;  1ZKO A;  2HUG A;  4IPD A;  3T1Y Q;  1I6V C;  2D0P A;  4K14 A;  4TVA B;  1PFS A;  5ISR A;  1KDC A;  1SBB B;  4WRD A;  4B3S Q;  1S5F D;  2EY6 A;  2Q8R E;  2EYO A;  3JAM L;  2AMC B;  5EPK A;  4AQY L;  1PH2 A;  4JV5 Q;  2B63 H;  3I4M H;  1A15 A;  1STA A;  3PO2 H;  1PH5 A;  5CV7 A;  2O4X A;  1Z6H A;  2DJF C;  4KK7 A;  2CVR A;  3I4L A;  3I56 A;  2UXC L;  2ZT9 C;  1PTO B;  5JJI A;  4FO2 A;  2XRS D;  1M90 C;  4TSS A;  4QF4 A;  2DUD A;  2FJ2 A;  5IT9 c;  3KYH C;  3ULL A;  3KDF A;  5C44 H;  4R8I A;  1KLG D;  2E76 C;  2JEB I;  2B2U C;  1IBK L;  3I72 A;  1TWF B;  4BY7 H;  4DR3 Q;  4LUZ A;  1I94 Q;  2P5Z X;  1N34 L;  4IFD G;  4C1N I;  1L1O A;  4POF A;  1KHI A;  1TS4 A;  3D6C A;  1BBW A;  1X3E A;  2FFK B;  4A3K B;  1A2T A;  3V2T A;  1CKN B;  1I3Q B;  5EQ0 A;  3R8B A;  1AE2 A;  1LTR D;  2A73 B;  4OWX B;  3A54 A;  5H1S E;  4ILW A;  3J81 i;  4BBS G;  3PMF A;  1CKO A;  1F77 A;  2K28 A;  4DR2 Q;  3HOX B;  4HMJ A;  4DAM A;  2JA7 G;  4AIM A;  1H9S A;  1JQY D;  1JCK B;  5IP7 G;  1HUN A;  2VQF Q;  2K52 A;  2EYP A;  1B4O A;  2IL8 A;  4C3I G;  2K5N A;  1OXX K;  2HIV A;  1F2Z A;  4GNX C;  4DR1 Q;  5DM6 3;  2VUM B;  4CJ1 B;  4NXM Q;  4A3D H;  4R4T A;  2K5V A;  4BA1 I;  4XDX A;  1GOZ A;  4KJN A;  2SNS A;  3WOE A;  1XMO Q;  4HJA A;  1K8G A;  3IFD A;  5ELC A;  2Z1C A;  1TWG B;  2QDL A;  2RBM A;  5C0X J;  2L5T A;  4M8A A;  4RFB A;  2DN8 A;  3RUZ A;  4KJO A;  3NBI A;  1V8Q A;  1XNQ Q;  2RHQ B;  4JI8 L;  5F2D A;  3EBE A;  1ICF B;  3CCJ A;  2VZA A;  3KF6 A;  2F0N A;  1G6Z A;  1UE1 A;  2N3S A;  2JN4 A;  2KJX A;  3NQI A;  3UDX A;  1CA5 A;  4UY8 C;  2NBF A;  4HSV A;  3M4Y A;  4G7O C;  2AQ2 B;  1HA5 A;  3H0G H;  5AJ3 L;  3UI2 A;  1EOT A;  4J6H A;  4RGN A;  2WIN B;  4O1N A;  1ZEQ X;  2I0Q A;  5FOB B;  1TWA B;  4JYA Q;  4QUC A;  1HR0 Q;  4ZCK A;  2PW7 A;  2LY7 A;  4GN3 B;  3X3M A;  4OIJ A;  2KBN A;  1I4H A;  2G9D A;  4ZKB B;  1XTC D;  3AB9 A;  1J5E Q;  2NVX H;  3BZK A;  3T1H Q;  5M5X H;  2PI2 E;  4JG2 A;  2X69 A;  2Z6K C;  4B3S L;  4GKJ L;  1BKB A;  1QIL A;  2PQA B;  2LMC B;  1EFI D;  4XT3 B;  1TS3 A;  4GN4 B;  5LMU Q;  1YEZ A;  2NTT A;  4LWC A;  3SK6 A;  4B08 A;  3M4Q A;  3MXG A;  2R7Z H;  2JA5 B;  4R1J A;  1HTL D;  3L7Z C;  1B70 B;  4AYB B;  1W2B A;  3CCL A;  2Z9H A;  4LFC Q;  3W2D A;  1STG A;  4OEM B;  1KRS A;  2NUC A;  2X6L A;  1YIT A;  5ELB A;  1X32 A;  3TP5 A;  1S5E D;  3U4V A;  2ZXP A;  2QEJ C;  1IBL Q;  4OHJ A;  4LFB L;  1MSH A;  4K0K Q;  5I9O A;  4A3I G;  1U4P A;  3L9A X;  1A3U A;  1IYJ B;  1RD9 D;  1X9N A;  5LMN W;  3EQL C;  1A8V A;  2E2J H;  3FDT A;  1I50 H;  4JW0 A;  4R8N A;  1K8A C;  4OXP A;  1LTB D;  1AFP A;  2NB0 A;  4O0A A;  2E2I B;  1N9W A;  4U68 A;  2MGS A;  1WTO A;  4LFA L;  1CT1 D;  3OWE B;  3KLS X;  1EQR A;  5KGU A;  4JI7 L;  1E7Z A;  1D1I A;  1GO3 E;  1XWE A;  5IGF A;  4ALP A;  2A69 D;  3FKI H;  4LAA A;  2L4N A;  4HJ5 A;  2R7F A;  3QO2 A;  1VQ6 A;  4X3K A;  4A3B B;  2BE5 C;  2NTS A;  3VR4 A;  1JWU D;  1JOK A;  1SMX A;  1QOH A;  1PTO C;  4DR1 L;  1EY6 A;  1KXL A;  3WWV A;  1LAB A;  5D65 A;  4DR4 Q;  1JOQ A;  2WV6 D;  3GD7 A;  2OWO A;  2PCF B;  2PZT A;  5C4X H;  2UXD Q;  2Q2H A;  1FGB D;  1UUP A;  1S3O A;  4PMC A;  3C3L A;  1FGU A;  2BDN A;  2MPM A;  1UWV A;  1PRT C;  3M3Y H;  3VR2 A;  1NE3 A;  4B3R Q;  3SK8 A;  3GTO H;  2ATW A;  2NZ1 D;  5GRO A;  5KEE A;  1XNQ L;  3NEM A;  5EPL A;  3G4S A;  4A3K G;  2HQE A;  4DAY B;  5KYI A;  4QQB X;  1I4R A;  1LT3 D;  1X3P A;  3GO5 A;  3WOF A;  5E4X A;  2B3G A;  1KAB A;  5EAY A;  3HOX G;  4QL5 A;  1VQF A;  1VQN A;  2NVT B;  4XQJ A;  1KDA A;  2BA0 A;  5EBC A;  5GAH C;  3TP6 A;  4LF6 L;  1F9S A;  1YNN C;  1PH7 A;  2LXJ A;  2JP1 A;  3FMC A;  4IFD H;  2VUM G;  2EYF A;  2CFM A;  2FIN B;  2EYJ A;  1F9R A;  5C5M A;  3FPP A;  1LUZ A;  1QG7 A;  3HP3 A;  3QOL A;  4BXX H;  3R93 A;  1UEA B;  1G91 A;  4L8J A;  4KY7 A;  1EUJ A;  4MTN A;  5CV8 A;  1B9N A;  4GZY C;  2MO1 A;  2JA7 H;  3HOW B;  4CJ0 B;  5IP7 H;  3SVM A;  4DV4 L;  5JEA J;  4C3I H;  2JYO A;  4YY3 L;  2UU9 L;  3GTQ B;  1X6O A;  4DU9 A;  4A75 A;  1A62 A;  4OWT B;  1DCZ A;  4OEL B;  2KVM A;  3CCR A;  3W5O A;  2YTV A;  1SR3 A;  4KTA A;  1ZXT A;  2QA4 A;  4MHE A;  1WI5 A;  2Q2I A;  3J80 c;  4EX5 A;  1RHP A;  1X65 A;  2DJG C;  4E6I A;  2PQE A;  3K58 A;  4BBR H;  2AQ1 B;  3CCE A;  3BU2 A;  3H15 A;  1RF2 D;  2QF7 A;  2JE6 I;  5M3M B;  3DM3 A;  2EXD A;  5IGE A;  2EY1 A;  3A5Z B;  3VYR A;  3UDG A;  1IW7 D;  1U4L A;  5C4J H;  1WTR A;  4K0K L;  1CHP D;  5J3B A;  2TSS A;  1RL2 A;  4IUR A;  4IUQ A;  1CI3 M;  2QKI C;  2UUA Q;  2LXK A;  2IX0 A;  3GQB A;  1VQK A;  1WD0 A;  4P71 A;  1GUN A;  1I4Q A;  3OIQ A;  2HHH Q;  2ZM6 Q;  3VDY A;  2VW9 A;  2BCO A;  1H9S B;  5D3I B;  1NBW A;  1SNP A;  3DWQ A;  1BCP B;  4DV5 Q;  2IT1 A;  1FJG Q;  1FNU A;  3J81 c;  4NXN L;  3ERS X;  2RCN A;  1ONL A;  4HJ8 A;  1OXV A;  3U50 C;  1PLF A;  2K5Q A;  1N33 Q;  3IKJ A;  4DAP A;  3AQQ A;  1PFB A;  1SND A;  3PUY A;  3H94 A;  3L0O A;  5FJ8 H;  1HFN A;  4WJW A;  2JA5 G;  4KLK A;  1WTW A;  1HTP A;  4AYB G;  5JAV A;  3M4O H;  1NNX A;  1TT2 A;  2NVY H;  1WVL A;  2DY7 A;  4ME5 A;  1IL8 A;  4A3L G;  3A55 A;  1V1Q A;  1HH2 P;  3NE5 B;  4EVO A;  5I6W A;  1PV4 A;  1O7Y A;  4R9W A;  3GV6 A;  2H4O A;  1YZ6 A;  1F2M A;  2CH4 W;  3BYT B;  1C48 A;  3I4N G;  3KF6 B;  4LF4 Q;  3S14 B;  1G2T A;  2B2V A;  3GDE A;  4PZ7 A;  4ODG A;  5JOB A;  2JEA I;  3S2D B;  1STE A;  2NN6 G;  1U9R A;  3MA2 B;  1IL2 A;  4A76 A;  1IBM L;  1LT4 D;  3NQT A;  4KI0 A;  4NW2 A;  3R2T A;  1SLJ A;  2HIX A;  2VQE Q;  1PZI D;  3J81 j;  5IT9 L;  1E2Z A;  3FRP B;  2OT2 A;  2DNE A;  2CH4 A;  1P8L A;  1RDP D;  3E0J A;  4DUY Q;  4A3B G;  3QWN A;  3PO3 G;  1JJ2 A;  1UE5 A;  2F0F A;  4DV0 Q;  2F0H A;  4H13 C;  5IP9 G;  1Q7Y C;  1BUV T;  2J0T D;  3HOZ B;  2JSO A;  1A6X A;  2RQX A;  2F0T A;  2UUC Q;  4EQO A;  3GTL B;  1HQR D;  5IYC G;  1EIF A;  3HKZ B;  2KHI A;  3K0X A;  1EY9 A;  4DV7 Q;  4M1U B;  1A63 A;  2A6H C;  2K5W A;  4IJL A;  1XMQ Q;  2E5L L;  1HZC A;  5ELE A;  1E22 A;  3N6R A;  2UXB L;  2E2D C;  4KD3 A;  5FLX c;  2YTY A;  4L63 B;  1U4R A;  3IRB A;  3BYY B;  4DV3 Q;  2O5I C;  3J7Y W;  2F0M A;  1BNZ A;  2UUB Q;  4CKE A;  5IGC A;  2K5H A;  3AEV A;  2ZJQ A;  1PTO H;  1C8C A;  2N88 A;  2K03 A;  3T56 B;  1LAC A;  1M8A A;  1CZG A;  3I4O A;  1HZB A;  3RNU A;  5EKL A;  5CV6 A;  3ULJ A;  1TWF H;  3A8K E;  3I7F A;  1QVG A;  4AQY Q;  4IUT A;  1FNW A;  1LLR D;  3I2Z A;  4R4Q A;  4YHH L;  1VQ9 A;  2A69 C;  3MWY W;  2AHO B;  4BA2 I;  2UXC Q;  2F0L A;  1EIY B;  5IYB G;  2JA6 B;  2XIW A;  1WYD A;  2F0W A;  2I46 A;  3SEB A;  2A74 C;  3A7A B;  4JI3 Q;  4LUO A;  2HHH L;  1WTQ A;  5CBA E;  3HOX H;  3F8T A;  2ALY B;  1CM9 A;  4B9X A;  1IBK Q;  5IGD A;  4FF2 A;  5ELN A;  4DNR B;  3HOW G;  2F0J A;  3N52 A;  1P16 A;  2RF4 A;  2R61 A;  2F1M A;  2OCE A;  1EOV A;  1U0L A;  1N33 L;  2TMP A;  2VUM H;  4BY1 B;  4KHP L;  1D5X C;  2RDF A;  2Q2U A;  1VQM A;  3GTM B;  2LSS A;  3S2H B;  2V4D A;  1FNV A;  3NP8 A;  2EQS A;  1CK1 A;  1PDQ A;  1HHV A;  2DGY A;  1TWG H;  3U58 A;  5M3M G;  3PSI A;  4BWG B;  2AUK A;  1F9P A;  3KJO A;  5C0X G;  2E8G A;  3W1B A;  2O5J C;  1ROD A;  5CR3 A;  4I65 A;  1NR2 A;  2F0K A;  2KEC A;  2QW7 A;  2EVB A;  2NYZ D;  4DV2 L;  1KAW A;  1GUO A;  3K5L A;  1NMG A;  1XTD A;  4QUF A;  3QR8 A;  4Q5V A;  1SE3 A;  1SYC A;  3R2I A;  4QIW B;  2KCT A;  2N78 A;  2CWP A;  2YV5 A;  1YHB A;  1DJR D;  1U4M A;  1TWA H;  5CMD A;  1RKN A;  3NBH A;  3O13 A;  3NEN A;  3RZO B;  4C2M B;  1DXM A;  4JBM A;  2WII B;  1GUS A;  1VF5 C;  3TP8 A;  4DA2 A;  1QZG A;  2UUC L;  5LMN L;  5AJ3 Q;  4X3T A;  5DEH A;  4DKA C;  5M5Y B;  3PF4 A;  4AYB E;  1S5D D;  5KIX A;  1MSG A;  4CDD C;  1SNC A;  1Y1W B;  1NMF A;  2B2Y C;  1Y1V B;  3DEP A;  4JVZ A;  2F4I A;  4ZRZ A;  1PYB A;  4A3I B;  1BO0 A;  3VYU A;  1JB7 A;  1CKM A;  1CUK A;  2M2L A;  5JJZ A;  3RN2 A;  1HRJ A;  3ONA B;  1IW7 C;  3PUZ A;  4HIM A;  1YHQ A;  4ZYS A;  2F03 A;  2UUB L;  2B2T C;  2JA5 H;  3C1F A;  3EIV A;  1KNE A;  1R4Q B;  2Z4I A;  1V43 A;  4A3L H;  3MFG A;  1I6H B;  4GKJ Q;  1C9O A;  4DNT B;  2WB1 G;  4A93 B;  3CC2 A;  4C3J G;  3RR5 A;  3TS2 A;  1UEB A;  2K14 A;  3J80 i;  1SJE D;  3CCU A;  1H9J A;  1QCB D;  3HOZ G;  2EOT A;  4KD4 A;  4A3G B;  1LO5 D;  3GP7 A;  3D31 A;  2NN6 H;  3CKI B;  2CQA A;  4RGT A;  3HKZ G;  2E2I H;  2CHB D;  2OQK A;  2PZU A;  4JI2 L;  4XYQ A;  1K0S A;  4K2L A;  2XNA C;  4UP9 A;  1EEI D;  1AP0 A;  4JI3 L;  2N8N A;  4S3S A;  2A19 A;  4C3H B;  1QUQ A;  2GVB A;  4IAL A;  1EQT A;  1SRU A;  2GN5 A;  4FVM A;  1L2F A;  1LV9 A;  4LFB Q;  5CV5 A;  2C5C A;  1TS2 A;  3MEH A;  4JCV E;  3PUW A;  4A3B H;  5I9P A;  1M1K C;  3QJY A;  1EY7 A;  2FMC A;  2DY8 A;  2H1E A;  4IPC A;  4DNI A;  2EIF A;  5T1I A;  3K81 C;  3OHX C;  2K75 A;  4K5V A;  1GUG A;  2L15 A;  4LFA Q;  5IYC H;  2N55 A;  3E9I A;  1EWI A;  4K8I A;  4JI7 Q;  1B53 A;  1O7Z A;  1PH9 A;  2YU9 B;  1EWH A;  4DK0 A;  2KA7 A;  1J8I A;  2SNM A;  2KED A;  4KMU C;  1JE5 A;  4A3J B;  5JPM C;  1O78 A;  3PCO B;  3IL8 A;  1PFM A;  4IN3 A;  1O80 A;  2JA6 G;  1EQV A;  3KLR A;  2A6E D;  1R9T H;  1NJI C;  4QB4 A;  4A3E B;  3URY A;  1V1O A;  1N36 L;  3K5M A;  4J1M A;  3TS0 A;  2EYH A;  1XNR Q;  1I4P A;  1H9M A;  2XN9 C;  5FLM G;  3J80 L;  1PVO A;  2PI2 A;  5A2Q L;  2NVT H;  2F0V A;  3V96 A;  2R93 B;  1Y8N B;  4DXF A;  4RWS C;  1AEX A;  1Q12 A;  4ME3 A;  2L1B A;  5IOD A;  3T51 B;  2K32 A;  4XXE A;  3U4Z A;  2PPB C;  4BY1 G;  1PH1 A;  1M4V A;  4GOP B;  3SXH A;  1IYV A; 
#chains in the Genus database with same CATH homology
 1IHZ A;  4KN4 C;  5C0X I;  1QB5 D;  4KKS A;  4U67 3;  5FO7 B;  5E4W C;  1FR3 A;  2ICI A;  4DXG A;  1WCM B;  4FF3 A;  3KLS A;  4MN3 A;  3DWA A;  4IUN A;  3J81 L;  5JEA G;  3S17 B;  4O42 A;  2EXZ A;  1DM0 B;  1Q1E A;  1I4X A;  3I70 A;  1B50 A;  1TY0 A;  3HOY B;  4X3U A;  2ZXR A;  3MXN A;  1EEF D;  2KEE A;  4N9T A;  4G7Z C;  2K33 A;  4QMG A;  1PTO F;  5C0X H;  1EZ8 A;  1XYI A;  1QE6 A;  2IX1 A;  3S1N B;  1EIG A;  3HG9 A;  5DM7 3;  5CC4 A;  3GTP B;  1LT6 D;  1SYD A;  1PRT F;  5DAU A;  3CQZ B;  2BDO A;  5G3L F;  4RHR A;  2F0S A;  3D8G A;  2B2U A;  3KBG A;  3QG1 A;  2RSN A;  2QCP X;  5C3X A;  3I4N B;  1DOM A;  4A3F B;  4RKL A;  5IIF A;  1HQM C;  3HEJ A;  3P7J A;  3DWP A;  1ENC A;  4KN7 C;  1TKW B;  1PXU A;  1W6J A;  4RA8 A;  2XSC A;  4YIJ A;  4DGZ A;  3S1Q B;  1EY5 A;  3PO2 B;  5ELF A;  2O2L D;  5FLX L;  2HDL A;  1JIC A;  3D6W A;  3HGB A;  1AZQ A;  3PO3 B;  1E2V A;  1PZJ D;  4ZUI A;  3L3O C;  1ENF A;  4IFD I;  1LTA D;  4HED A;  1F2L A;  3HRZ C;  1GUW A;  2OEO A;  4C3H G;  3A8J E;  1DON A;  2AWO A;  3VA7 A;  3MTS A;  3FEW X;  5COR A;  1GHJ A;  1EZ6 A;  5C6A A;  4FXG C;  2Y0S B;  4DAV A;  2RVL A;  2JA8 B;  1ESF A;  1JOR A;  1JB3 A;  4K2K A;  1NCV A;  1EYC A;  2B2V C;  3BVZ A;  2WKD A;  3MHB A;  1TR5 A;  1TII D;  4J8Q A;  5CYU A;  3D4D A;  1BCP D;  1H9K A;  3TSS A;  2D9U A;  4V19 0;  2KQ3 A;  3D4W A;  3MFY A;  4FNF A;  1LTS D;  2IX3 A;  1R4P B;  3OMG A;  2EDG A;  4ZK9 B;  1HCZ A;  2B8G A;  4EQN A;  4DN4 M;  1D2B A;  3J7A V;  1C4Q A;  3PIP 3;  3Q23 A;  2K1B A;  5EPJ A;  1D1K A;  3DXJ C;  1I4G A;  2F0E A;  1LT5 D;  1BOS A;  2EY5 A;  4ZUJ A;  3D3R A;  2HCI A;  3ND9 A;  4XIG S;  3H3V C;  5BN5 A;  3OW7 A;  3NTH A;  3HOU B;  3BG3 A;  4C1N K;  2LS0 1;  1ILQ A;  1SXT A;  1VMC A;  3TZD A;  4H0L C;  1TVX A;  1QWY A;  4ZKC B;  3I3C A;  3JAM E;  2A6E C;  1PFN A;  1LTG D;  1SYB A;  5CV9 A;  4XYO A;  1VCI A;  2D5D A;  3KUP A;  3MXP A;  1G8Z D;  5JEA H;  4KKT A;  4F8M A;  4H44 C;  2LKV A;  1E2W A;  3ERO A;  2F3V A;  1KLU D;  2AUJ D;  2VXW A;  1EIH A;  1AW7 A;  2VB2 X;  5C3E B;  2G9H D;  1EYA A;  4IUP A;  2QIL A;  1Y8O B;  1F2Y A;  1SE2 A;  1PMR A;  5LL6 S;  4OO1 G;  2E75 C;  1TU2 B;  5EBD A;  2F3W A;  1G2S A;  3VR5 A;  3P75 A;  5I4D A;  1KAA A;  3Q24 A;  4OIK A;  2WB1 B;  1SYE A;  4C3J B;  4K5X A;  1CZW A;  4OGQ C;  5FK9 C;  4C56 C;  2EJG C;  3ZYY X;  2L9H A;  5C4X B;  3OPO A;  2MP1 A;  1Q8I A;  1SFO B;  2FMM A;  3M3Y B;  2L55 A;  2RDH A;  5LHY 1;  3S1R B;  5J22 A;  2X6G A;  1BDO A;  1WTX A;  3GTJ B;  1W6K A;  5M5W B;  3P1H A;  5JPN C;  4G4K A;  4ULL A;  1K83 B;  3DEO A;  1ENA A;  2XWB B;  3S1M B;  2KCN A;  3BDL A;  4V0B A;  1DYQ A;  4I7Z C;  5JVH 3;  4CKC A;  2OF1 A;  2E2H B;  1TWC B;  4PMB A;  2MUY A;  1ML0 D;  1BF4 A;  1ZYR D;  4LMQ D;  5IGB A;  5NUC A;  3QIA A;  3LWU A;  1Z7T A;  2IPK D;  3LNN A;  3OMC A;  1X3Q A;  2CW0 D;  3SK5 A;  1JWM D;  4XTC S;  3W3A A;  5FO9 B;  2SEB D;  2KUM A;  2QDB A;  2EE1 A;  3NTK A;  2PMZ B;  1FD7 D;  1CA6 A;  3T53 B;  5M3F B;  1H9R A;  2XWJ B;  1QNK A;  4TQU S;  1JWS D;  2J7Z A;  5T1G A;  4NMZ A;  3ERQ A;  1OXU A;  1STN A;  2B2W A;  3M7N A;  3OSO A;  4EQP A;  1BCP C;  1GJX A;  3EFX D;  2AWN A;  1EU4 A;  2K5D A;  3I73 A;  5EGT A;  1E0B A;  1S4Z A;  4PNY A;  1EY8 A;  1BQQ T;  3Q22 A;  4KV6 A;  3K7A B;  1Y8P B;  4QCL A;  4CGY B;  1NAP A;  1UNS A;  3PUV A;  3NXW A;  1T5E A;  2EJM A;  3CHB D;  2NN6 I;  1CHQ D;  1TWH B;  4OO1 I;  3I8Z A;  1TQO A;  3VYT A;  2YYZ A;  3R3O A;  4K6L A;  1S5C D;  3PV0 A;  1PZK D;  4LK1 C;  4KKU A;  3X3N A;  3D4R A;  3BZD B;  4TRD A;  1SAP A;  4RH6 A;  4RKB A;  5G3L D;  5C4H A;  3TN2 A;  3LWE A;  1L0X B;  1KNA A;  3MVV A;  1BR9 A;  4EGV A;  3NWS A;  4RCO A;  1UAP A;  4IQZ A;  4L6T B;  1D6E C;  1AZP A;  1CQV A;  4IUV A;  2IJ0 A;  1G29 1;  4OO1 H;  1YNN D;  4BS9 A;  1EY4 A;  1SNO A;  3FPU B;  4X3S A;  1GXD C;  3HOV B;  1V1P A;  3TP7 A;  4PMW A;  3DUZ A;  2EY2 A;  4K8J A;  5HUR A;  4G7H C;  3VA5 A;  3GTK B;  1Y69 U;  2WKC A;  1LTI D;  1DOL A;  5C4Z A;  3K59 A;  3OIP A;  2EJF C;  5EJW A;  1B1Z A;  4IZ8 A;  1EU3 A;  1PRT B;  1KDB A;  4Y7N B;  2WP8 J;  3MAQ A;  5M9O A;  4G57 A;  2RA4 A;  2Q8I B;  3S15 B;  1IKL A;  3H09 A;  2M9V A;  4K5W A;  4WOR A;  1HFG A;  2ZXO A;  3GTG B;  2KHS A;  3RZD B;  1EY0 A;  4KHZ A;  4HTH A;  3SR1 A;  3TBI B;  2HDM A;  1Z47 A;  5IOC A;  1VMP A;  2I07 B;  1RJT A;  1SNQ A;  4HMI A;  2ICE C;  2R92 B;  3E5S A;  2IWH A;  1CTM A;  2B2Y A;  4K6D A;  3KK7 A;  4ZLT F;  2F0G A;  1FYC A;  4ZQ3 A;  4XQQ A;  5IT9 E;  2EPB A;  2NVQ B;  3NPP A;  4A3M B;  5JVG 3;  4DK1 A;  2B2T A;  1JOO A;  2D62 A;  4HR7 B;  1OO9 B;  4KY6 A;  4Z9C B;  2WAQ B;  2J4X A;  1ZYR C;  2JXM B;  2F0I A;  5KRU A;  1SNM A;  5D3D A;  3U9O A;  2MHV A;  3KBX A;  4FXK C;  4RGO S;  3K57 A;  2AQ3 B;  3K5N A;  2CW0 C;  1SE4 A;  3SDZ A;  1NUC A;  3G6J B;  3T4A C;  4MIU A;  1BBX C;  2C9O A;  2PW5 A;  1RTN A;  3S9W A;  4JK1 C;  2A6H D;  2M00 A;  1B2T A;  1YNJ D;  2B8F A;  2KOL A;  3I90 A;  3F2U A;  5CBE E;  2RKS A;  4UAI A;  3T16 A;  2D2C C;  3RD4 A;  2NWG A;  1ICW A;  3DMU A;  2MJ8 A;  3TZU A;  5KNB A;  2B63 B;  3I4M B;  2OXP A;  4KHV A;  1Q3L A;  2LFN A;  1K8M A;  2A68 D;  3SE0 A;  5C44 B;  3V05 A;  4CBV A;  2R6G A;  4DF7 A;  1OXT A;  4BY7 B;  4IFD J;  3H91 A;  1SMY D;  5A35 A;  1KTK A;  5CV4 A;  2K01 A;  1NR4 A;  1CFM A;  3J7A F;  1B9M A;  5C5L A;  5J39 A;  1JR0 D;  4FP5 D;  3M85 A;  1K8O A;  3K0Y A;  3VYS A;  3H6M A;  1WTV A;  3M7G A;  1MBY A;  3OOC A;  4WFN 3;  1R9T B;  3BDC A;  4A3D B;  2GA4 B;  1HPC A;  3VR6 A;  1ET9 A;  4F88 A;  5I6Y A;  3SK4 A;  1SJH D;  1CQF A;  3BS1 A;  3AU7 A;  3RMH A;  3T13 A;  2RSO A;  5AFW A;  3EA6 A;  3TDQ A;  1HXY D;  1HA6 A;  1EYD A;  2EYL A;  3MC0 B;  2B39 A;  5E3F A;  3RLF A;  3KF8 A;  2FHT A;  1SYF A;  1HUM A;  1XXG A;  3I91 A;  2BA1 A;  3A7L A;  2BOS A;  1RTO A;  4HAE A;  3H0G B;  1SYG A;  3A8I E;  1V1P B;  2PNR C;  1A2U A;  3DHQ A;  5CGK A;  2PO4 A;  1MGS A;  2NVX B;  1Q90 A;  5M5X B;  3HZX A;  1WTP A;  5EKK A;  1OXS C;  2A5H A;  4F87 A;  3BVM A;  3Q6S A;  5K36 G;  1SSO A;  2R7Z B;  2XRQ D;  3U9S A;  5BN3 A;  4UDU C;  2L11 A;  3ND8 A;  4ID6 A;  2E2J B;  1DZ1 A;  1I50 B;  3LX0 A;  3HS0 C;  3NHH A;  4H7B A;  3VR3 A;  4HCS A;  4XQN A;  4LJZ C;  4FXD A;  1MD2 D;  1GHK A;  1ILP A;  3FKI B;  4FYD A;  1QNU A;  2VB3 X;  1XX8 A;  1A3V A;  3NUC A;  4NDX A;  2Q8T A;  3C46 A;  1MI2 A;  2B2W C;  3J80 E;  1S5B D;  5A2Q E;  1ET6 A;  2XVS A;  4P2C B;  5BN4 A;  4CKB A;  1VF7 A;  4ABN A;  3P20 A;  2PZW A;  3FVQ A;  1EWC A;  3GTO B;  3NTI A;  2F0P A;  2Z8L A;  1IKM A;  5DNF A;  2F0D A;  4OL7 A;  5EKI A;  3DM1 A;  4PQX A;  2F0O A;  1YNJ C;  3J81 E;  1IYU A;  5COY A;  2VNU D;  3IAY A;  3BDO A;  5IGG A;  2K6A A;  2ENB A;  3C2P A;  1QJO A;  5HGT A;  1F9Q A;  2SOB A;  4JBW A;  4TKO B;  1TY2 A;  1GUT A;  3E6Z X;  1BCP F;  1DD2 A;  2HCC A;  2L12 A;  5K5P A;  2K05 A;  1WD1 A;  4BBS B;  2L0C A;  2RDG A;  1JC7 A;  1JE4 A;  5C3W A;  2JA7 B;  1STH A;  4ZAI A;  1PYW D;  2IW3 A;  3EVQ A;  2A68 C;  1VDZ A;  1DOK A;  1O7L A;  4DFA A;  4C3I B;  3ITP A;  3SHL A;  3IFT A;  1B44 D;  2K7V A;  4RCN A;  1NSN S;  4HSP A;  1L0Y B;  3NSW A;  1RCV D;  1SMY C;  1LTT D;  3OWF A;  4BBR B;  5KND A;  3QB3 A;  5I2Y A;  1SDF A;  3K6O A;  4RAU C;  1II3 A;  5C4J B;  2PYK A;  5J1Z A;  1T5X D;  5E1F A;  5I2X A;  2KCC A;  4CJ2 C;  3K5O A;  3WDN A;  2R3Z A;  5FO8 B;  4B9W A;  3MXU A;  3QOJ A;  4IUU A;  1BXT A;  1SEB D;  2Z4H A;  5D14 A;  4FF1 A;  3EJI A;  5FLX E;  2DNC A;  4HN7 A;  1AN8 A;  4CHT B;  1D5Z C;  4N9P A;  3MZ5 A;  3CU7 A;  2EZV A;  4XT1 B;  5KNC A;  1ESR A;  5LL6 X;  3NWT A;  4Q0F A;  3TME A;  2E74 C;  2F0U A;  1B3A A;  2F0Q A;  4RGM A;  4KY5 A;  4PV1 C;  5KYL A;  3M4O B;  2NVY B;  3BVG A;  2BE5 D;  3A56 A;  3CRL C;  4HCE A;  1PTO D;  1STB A;  2SDF A;  2K04 A;  4F7X A;  1STY A;  5FKA C;  3C1E A;  5ELD A;  3G7L A;  2ID0 A;  3CRK C;  4NP5 A;  4DAY A;  2EYM A;  3AMU A;  5K36 H;  1PRT D;  5TSS A;  3PIO 3;  3NK9 A;  4NKL A;  1A3T A;  1EL0 A;  4RHS A;  4FF4 A;  2WAC A;  1TS5 A;  3GV3 A;  3Q0A A;  3S16 B;  1J9O A;  1D5M C;  1Q1B A;  3PUX A;  1ZKO A;  2HUG A;  1I6V C;  4K14 A;  5ISR A;  1KDC A;  1SBB B;  4WRD A;  1S5F D;  2EY6 A;  2Q8R E;  2EYO A;  3JAM L;  5EPK A;  1A15 A;  1STA A;  5CV7 A;  2O4X A;  1Z6H A;  4KK7 A;  2CVR A;  3I4L A;  2ZT9 C;  1PTO B;  4FO2 A;  2XRS D;  4TSS A;  4QF4 A;  2FJ2 A;  4R8I A;  1KLG D;  2E76 C;  2JEB I;  2B2U C;  3I72 A;  1TWF B;  4IFD G;  4C1N I;  1TS4 A;  3D6C A;  2FFK B;  4A3K B;  1A2T A;  3V2T A;  1I3Q B;  5EQ0 A;  3R8B A;  1LTR D;  2A73 B;  3A54 A;  4ILW A;  3PMF A;  1F77 A;  2K28 A;  3HOX B;  4HMJ A;  1H9S A;  1JQY D;  1JCK B;  1HUN A;  2EYP A;  1B4O A;  2IL8 A;  4C3I G;  1OXX K;  1F2Z A;  5DM6 3;  2VUM B;  4CJ1 B;  4BA1 I;  4XDX A;  1GOZ A;  4KJN A;  2SNS A;  3WOE A;  3IFD A;  5ELC A;  2Z1C A;  1TWG B;  2RBM A;  5C0X J;  4M8A A;  2L5T A;  4RFB A;  2DN8 A;  3RUZ A;  4KJO A;  3NBI A;  1V8Q A;  5F2D A;  2F0N A;  1G6Z A;  2KJX A;  3NQI A;  1CA5 A;  2NBF A;  4HSV A;  3M4Y A;  4G7O C;  2AQ2 B;  1HA5 A;  3UI2 A;  1EOT A;  4J6H A;  4RGN A;  2WIN B;  4O1N A;  1ZEQ X;  5FOB B;  1TWA B;  4QUC A;  2PW7 A;  2LY7 A;  3X3M A;  4OIJ A;  1I4H A;  2G9D A;  4ZKB B;  1XTC D;  3AB9 A;  2X69 A;  1QIL A;  2LMC B;  1EFI D;  4XT3 B;  1TS3 A;  2NTT A;  3SK6 A;  4B08 A;  3MXG A;  2JA5 B;  1HTL D;  4AYB B;  3L7Z C;  3W2D A;  1STG A;  2NUC A;  2X6L A;  5ELB A;  1X32 A;  3TP5 A;  1S5E D;  2ZXP A;  2QEJ C;  4OHJ A;  1MSH A;  5I9O A;  1U4P A;  3L9A X;  1A3U A;  1RD9 D;  3EQL C;  3FDT A;  4R8N A;  1LTB D;  1AFP A;  2NB0 A;  2E2I B;  4U68 A;  2MGS A;  1WTO A;  1CT1 D;  3OWE B;  3KLS X;  5KGU A;  1XWE A;  1D1I A;  5IGF A;  2A69 D;  4LAA A;  2L4N A;  3QO2 A;  4X3K A;  4A3B B;  2BE5 C;  2NTS A;  3VR4 A;  1JWU D;  1JOK A;  1QOH A;  1PTO C;  1EY6 A;  1LAB A;  5D65 A;  1JOQ A;  2WV6 D;  3GD7 A;  2PCF B;  2PZT A;  1FGB D;  1UUP A;  4PMC A;  3C3L A;  2BDN A;  2MPM A;  1PRT C;  3VR2 A;  3SK8 A;  2NZ1 D;  5KEE A;  5EPL A;  2HQE A;  5KYI A;  1I4R A;  1LT3 D;  1X3P A;  3GO5 A;  3WOF A;  5E4X A;  1KAB A;  2NVT B;  4XQJ A;  1KDA A;  2BA0 A;  5EBC A;  3TP6 A;  1F9S A;  1YNN C;  2JP1 A;  3FMC A;  4IFD H;  2EYF A;  2FIN B;  2EYJ A;  1F9R A;  5C5M A;  3FPP A;  1QG7 A;  3HP3 A;  3QOL A;  3R93 A;  1UEA B;  1G91 A;  4L8J A;  4KY7 A;  5CV8 A;  1B9N A;  4GZY C;  3HOW B;  4CJ0 B;  3SVM A;  5JEA J;  2JYO A;  3GTQ B;  4DU9 A;  1DCZ A;  2KVM A;  4KTA A;  1ZXT A;  4MHE A;  1RHP A;  4E6I A;  2PQE A;  3K58 A;  2AQ1 B;  1RF2 D;  2QF7 A;  2JE6 I;  5M3M B;  5IGE A;  2EY1 A;  3VYR A;  1IW7 D;  1U4L A;  1WTR A;  1CHP D;  2TSS A;  4IUR A;  4IUQ A;  1CI3 M;  2QKI C;  2IX0 A;  3GQB A;  1WD0 A;  1GUN A;  1I4Q A;  3OIQ A;  2BCO A;  1H9S B;  5D3I B;  1SNP A;  3DWQ A;  1BCP B;  2IT1 A;  1FNU A;  1ONL A;  1OXV A;  1PLF A;  2K5Q A;  3IKJ A;  4DAP A;  1PFB A;  1SND A;  3PUY A;  3H94 A;  1HFN A;  4WJW A;  1WTW A;  1HTP A;  5JAV A;  1TT2 A;  1WVL A;  2DY7 A;  4ME5 A;  1IL8 A;  3A55 A;  3NE5 B;  4EVO A;  5I6W A;  1O7Y A;  4R9W A;  3GV6 A;  2H4O A;  1F2M A;  3BYT B;  1C48 A;  3S14 B;  1G2T A;  2B2V A;  4ODG A;  5JOB A;  2JEA I;  3S2D B;  1STE A;  2NN6 G;  1U9R A;  3MA2 B;  1LT4 D;  3NQT A;  4KI0 A;  4NW2 A;  3R2T A;  1PZI D;  5IT9 L;  1E2Z A;  3FRP B;  2OT2 A;  2DNE A;  1RDP D;  3E0J A;  3QWN A;  2F0F A;  2F0H A;  4H13 C;  1BUV T;  2J0T D;  3HOZ B;  2JSO A;  1A6X A;  2RQX A;  2F0T A;  4EQO A;  3GTL B;  1HQR D;  3HKZ B;  1EY9 A;  4M1U B;  2A6H C;  2K5W A;  5ELE A;  3N6R A;  2E2D C;  4KD3 A;  4L63 B;  1U4R A;  3BYY B;  2O5I C;  3J7Y W;  2F0M A;  1BNZ A;  4CKE A;  5IGC A;  1PTO H;  1C8C A;  2N88 A;  2K03 A;  3T56 B;  1LAC A;  1M8A A;  1CZG A;  5EKL A;  5CV6 A;  3A8K E;  4IUT A;  1FNW A;  1LLR D;  2A69 C;  3MWY W;  4BA2 I;  2F0L A;  2JA6 B;  2XIW A;  2F0W A;  2I46 A;  3SEB A;  2A74 C;  3A7A B;  1WTQ A;  5CBA E;  4B9X A;  1CM9 A;  5IGD A;  4FF2 A;  4DNR B;  2F0J A;  3N52 A;  2R61 A;  2F1M A;  2TMP A;  4BY1 B;  1D5X C;  2RDF A;  3GTM B;  3S2H B;  2V4D A;  1FNV A;  3NP8 A;  1HHV A;  1CK1 A;  1PDQ A;  4BWG B;  2AUK A;  1F9P A;  5C0X G;  2O5J C;  1ROD A;  5CR3 A;  4I65 A;  1NR2 A;  2F0K A;  2KEC A;  2EVB A;  2NYZ D;  1GUO A;  3K5L A;  4QUF A;  4Q5V A;  1SE3 A;  1SYC A;  3R2I A;  4QIW B;  1DJR D;  1U4M A;  5CMD A;  1RKN A;  3NBH A;  3O13 A;  3RZO B;  4C2M B;  1DXM A;  2WII B;  1GUS A;  1VF5 C;  3TP8 A;  4DA2 A;  4X3T A;  5DEH A;  5M5Y B;  1S5D D;  5KIX A;  1MSG A;  1SNC A;  1Y1W B;  2B2Y C;  1Y1V B;  3DEP A;  2F4I A;  4ZRZ A;  4A3I B;  1BO0 A;  3VYU A;  2M2L A;  5JJZ A;  1HRJ A;  3ONA B;  1IW7 C;  3PUZ A;  2F03 A;  4ZYS A;  2B2T C;  3C1F A;  1KNE A;  1R4Q B;  2Z4I A;  1V43 A;  3MFG A;  1I6H B;  4DNT B;  4A93 B;  4C3J G;  1SJE D;  1H9J A;  1QCB D;  2EOT A;  4KD4 A;  4A3G B;  1LO5 D;  3GP7 A;  3D31 A;  2NN6 H;  3CKI B;  2CQA A;  4RGT A;  2CHB D;  2PZU A;  4XYQ A;  4K2L A;  2XNA C;  1EEI D;  1AP0 A;  4S3S A;  4C3H B;  4IAL A;  1EQT A;  4FVM A;  1LV9 A;  5CV5 A;  2C5C A;  1TS2 A;  3MEH A;  3PUW A;  5I9P A;  3QJY A;  1EY7 A;  2FMC A;  2DY8 A;  2H1E A;  5T1I A;  3OHX C;  4K5V A;  1GUG A;  2N55 A;  4K8I A;  1B53 A;  1O7Z A;  2YU9 B;  1EWH A;  4DK0 A;  2KA7 A;  1J8I A;  2SNM A;  2KED A;  4KMU C;  4A3J B;  5JPM C;  1O78 A;  3IL8 A;  1PFM A;  4IN3 A;  1O80 A;  1EQV A;  3KLR A;  2A6E D;  4QB4 A;  4A3E B;  3URY A;  1V1O A;  3K5M A;  4J1M A;  2EYH A;  1I4P A;  1H9M A;  2XN9 C;  3J80 L;  5A2Q L;  2F0V A;  3V96 A;  2R93 B;  4DXF A;  1Y8N B;  4RWS C;  1AEX A;  1Q12 A;  2L1B A;  5IOD A;  3T51 B;  2K32 A;  4XXE A;  2PPB C;  1M4V A;  3SXH A;  1IYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...