2M00A

Solution structure of staphylococcal nuclease e43s mutant in the presence of ssdna and cd2+
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPSTKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modeling of the [E43S]SNase-ssDNA-Cd(2+) complex: Structural insight into the action of nuclease on ssDNA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 43
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2m00A00
5CV9A 1A2UA 2F0LA 4HMIA 4MIUA 5E3FA 5KEEA 1EY5A 2F0VA 5C4HA 3VA5A 2OXPA 2F3VA 5F2DA 5J22A 5IGFA 1F2YA 3QOLA 4EQPA 3HZXA 1SNCA 2RDFA 4ZQ3A 2SNMA 5I6WA 5KIXA 2EY2A 1EQVA 4E6IA 2EYHA 1JOQA 3BDLA 3OWFA 4IZ8A 4NKLA 2RBMA 4RKBA 4KY7A 5CV8A 3NXWA 4IALA 2F0NA 4KJOA 5CGKA 3NHHA 1F2ZA 1EY6A 4N9TA 4YIJA 5DEHA 5KYIA 1TR5A 3SK8A 2EYFA 2F0JA 3EROA 3R3OA 4ZUJA 4PNYA 1F2MA 5K5PA 4ZUIA 1TQOA 2PZWA 1II3A 2OF1A 1SNMA 4RKLA 5CC4A 4H7BA 1AEXA 4DGZA 1STBA 5CV5A 4HTHA 2F0DA 3DHQA 2KHSA 3OSOA 4NDXA 3ERQA 4DFAA 3SHLA 5HGTA 3SK4A 5M9OA 2F0UA 5HURA 2EYPA 2QDBA 5NUCA 3ITPA 3P1HA 4J6HA 4HMJA 2F0QA 3SXHA 2F0PA 3NQTA 5I9PA 1NUCA 5DAUA 1STHA 1KDAA 4K2KA 4LAAA 4QB4A 4OL7A 1U9RA 4TRDA 1EY7A 2NUCA 3OMGA 1SYEA 2F0SA 1EY8A 5KGUA 2F0GA 4EVOA 3V2TA 1SYGA 3OMCA 2SNSA 4F8MA 2EYLA 4PMBA 1JOOA 3T13A 2F0EA 5EKKA 5CR3A 3TP5A 2F0KA 2EY6A 5IGBA 1EZ6A 1EY9A 4QMGA 1A3VA 3D6CA 5J1ZA 1EYCA 3U9OA 3PMFA 4F7XA 2ENBA 1EYDA 4KD3A 1SYCA 3D4WA 4S3SA 2OEOA 3D8GA 1EY4A 5IGDA 4KY5A 2PZTA 5I9OA 2F0WA 3NUCA 3H6MA 4I65A 4NMZA 5CV6A 3SR1A 3T16A 5C4ZA 4KJNA 3TP8A 5C3WA 3MXPA 3TP6A 1SNQA 4EQOA 4ODGA 5C5MA 2EXZA 3TMEA 3EJIA 4DF7A 5IGEA 4B9WA 5J39A 4K8IA 4K8JA 1STNA 5JOBA 2RKSA 1ENAA 2PZUA 2EYJA 5CV7A 3QOJA 2F3WA 1EZ8A 2F0OA 3DMUA 2PYKA 3MHBA 3TP7A 1A3TA 3C1EA 3MVVA 1RKNA 5JAVA 5C3XA 5KRUA 4NP5A 4ME5A 4WRDA 2EYOA 2HQEA 1SNPA 3P75A 3SK6A 4DU9A 5IGGA 3QB3A 3RUZA 4IUNA 5C5LA 1STYA 4B9XA 1SNDA 1KABA 5KYLA 2WACA 2LKVA 5IIFA 5IODA 4R8NA 2F0FA 4KY6A 3S9WA 4N9PA 3MEHA 1KDBA 4ID6A 5I6YA 5C6AA 2M00A 4WORA 4K5WA 4K5XA 4K5VA 3C1FA 1JORA 3NK9A 1SYBA 4G57A 4KD4A 1TT2A 3BDCA 1STGA 3SK5A 3EVQA 1STAA 5IGCA 3D4DA 5IOCA 1KDCA 3NP8A 1KAAA 2F0TA 1SYFA 2PW7A 1EYAA 1A3UA 1NSNS 3E5SA 2F0MA 3HEJA 4K2LA 5EGTA 5ISRA 2KQ3A 4KHVA 1SYDA 4KTAA 4K6DA 4J1MA 4QF4A 2EY5A 1IHZA 1ENCA 2F0HA 2PW5A 2SOBA 3LX0A 1JOKA 3MZ5A 4K14A 1EY0A 1SNOA 4PMCA 5E1FA 1A2TA 2O4XA 2PQEA 2F0IA 4KV6A 5CV4A 5EKLA 2EY1A 4EQNA 2EYMA
chains in the Genus database with same CATH superfamily
3BYTB 2GA4B 2K03A 4LFBL 4M8AA 2AUKA 1FD7D 1PTOF 1S5BD 1LYLA 1WD0A 2Q2IA 4NB3A 3MEFA 5M3FB 1HCZA 2Z6BA 4GLAC 4KY7A 3NPPA 5CV8A 3CCVA 3OTOQ 3OW2A 3RZDH 3CQZH 1U4MA 4JI0L 4QCLA 3Q23A 2KOLA 2E2DC 3LGJA 2VXWA 1HZ9A 1HXYD 2JQOA 4LF6L 4HN7A 4GKKQ 1L0XB 3TSSA 1SNMA 4O1NA 2R6GA 4RKLA 1B70B 1XNRL 2JA7H 1JJGA 2IY5B 2B2YC 4QIWB 3CAMA 5LMNQ 4HTHA 3CCMA 4JYAQ 1GJXA 5ELOA 4AIMA 1J6QA 4DV4Q 5CBEE 4HMJA 1CA6A 1HQMC 4DR6Q 5DAUA 1SROA 4DV6L 4KKUA 1PFMA 2C5CA 3FKIB 4DV3Q 1MSHA 3PV0A 2JA9A 3X3NA 1E2WA 3OMCA 1UNSA 1JOOA 4PZ6A 3H0GG 3NEMA 1QOHA 5M5YB 2PNRC 4DNIA 2UXBL 2DN8A 3JAME 1B53A 1NNXA 2E5LL 3ZJYC 3CHBD 2OEOA 4DV4L 1DOMA 3T16A 3RN5A 2PMZE 2XIWA 3GTKB 4KJNA 3TP8A 4KHPL 2FXQA 1K8OA 3I8ZA 2R7FA 1NY4A 2F4VQ 4X65L 1E3PA 4DV1Q 4L5QA 2Z4HA 4C3JH 3PO2H 2OT2A 2XTIA 3S24A 4FXGC 1YI2A 2I0QA 3K7UC 3NE5B 1JJCB 3OYYA 3STBD 2MJ8A 4DKAC 2RHSB 3D31A 3C46A 1DD2A 1SNDA 2XVSA 2E2IB 2LKVA 3S1RH 2ZTCA 3BZDB 4B3TL 2DJGC 3HOUB 3LNNA 4G57A 1LTBD 3A74A 1A62A 2XRQD 2F0MA 2DY8A 4KI0A 3HOVB 2EPBA 3PF4A 3MA2B 3B6YA 4BBSH 4R8IA 1EIFA 1I94Q 1RL2A 2UUBL 4DR3Q 2L9HA 2R92B 2L55A 4JV5L 4JI5L 1XTDA 2PI2A 1SNCA 2RDFA 1SLJA 2SNMA 3ULJA 1TWHB 5IWAL 5M3FG 3BYYB 1OO9B 1FYCA 2F4IA 2JE6I 2VS1A 3BDLA 4UY8C 3MXUA 1V43A 5A2QL 3GTKH 3QG1A 3DWQA 4AYBB 3G6JB 3JAMc 3I91A 3GTLH 3KBGA 2R3ZA 5K5PA 4LF5Q 1B8AA 1JWSD 1BNZA 5EQ0A 1LT4D 4DV0Q 4BBRH 4LF9Q 1JR0D 3E0JA 4XTCS 3MC0B 3BVGA 1BCPD 3VR5A 5EPKA 3KDFB 4HIDA 4GN3B 3G7LA 5EKIA 3N6RA 1SFOB 1STHA 1YJ9A 1SMYC 1CM9A 1TIID 5BN4A 4DK3C 1HZAA 4JI1L 5LMNW 1Q7YC 1Z7TA 1YVCA 4QMGA 1EY9A 5DLQE 3D6WA 1K83B 2CQOA 5LL6S 4BBSG 4OO1I 2KENA 3K58A 1R4QB 1ML0D 2V1CC 2L4NA 4PMWA 1I4HA 5JOBA 1VQOA 2KCNA 1IBKL 4L8JA 5EJWA 2OTLA 2F3WA 2G9DA 2A6HD 2XWJB 1SR3A 2F0OA 3DMUA 1E22A 1NTGA 2BA1A 1RHPA 1SNPA 1AE2A 3SK6A 4G7HC 3HOXH 4KMUC 3T51B 1I4QA 1HNWQ 2LXKA 4CKCA 3S9WA 3FDTA 1GUWA 3WDNA 5FO8B 2BOSA 2IL8A 4A3LG 1JC7A 4B3TQ 2D9UA 3NP8A 1CZGA 2H1EA 4RAUC 4RWSC 4C3JG 4DR5L 3JC66 2WINB 1G6PA 3I4MH 2JK8A 4DAYA 1TU2B 1TS5A 3I4LA 3CPWA 2YU9H 2JSOA 4BWGB 4GOPC 2F3VA 1I94L 1PRTF 4P72A 2M2LA 4V0BA 1S3OA 2WAQE 3U50C 5C44B 3ULLA 2ZM6Q 3K57A 1X3GA 4N9TA 1I3QB 5JJLA 4Q5VA 5K36H 3NTIA 4RH6A 4UDUC 3S16H 4BY7B 5CYUA 4R4OA 5IT9L 1HHVA 2HCIA 2K75A 4A3FG 1IYUA 1HFNA 4LUOA 4LF9L 2A68D 4IPCA 3SGIA 2F0QA 3L9AX 4B3MQ 1KDAA 4LAAA 4RCOA 1U9RA 4LUVA 4GNXC 3OMGA 5KGUA 4A93G 3CC2A 1HA5A 1SE4A 1VQ7A 2UUAQ 3UDIA 5LMUQ 1EYCA 2E5LQ 3HOVH 3DWPA 5JJZA 1N32L 3I4MG 1B4OA 4LW1A 1SNQA 2R61A 1U4PA 3EJIA 5KNBA 2D0PA 1B2TA 3FKIG 4FXDA 2X6GA 4MTKA 1X3QA 4LFBQ 2GN5A 5GQOA 4C56C 4WRDA 4BBRB 4DAMA 3HKZB 1AZPA 5BN3A 3VYTA 4KLKA 4UAIA 1AFPA 4U673 3S1MH 4KKSA 4BA2I 1EIHA 4UHVA 1JT8A 1WTHA 4NXMQ 1EYGA 4K5XA 2K32A 2L12A 3NK9A 1QNUA 2I5MX 2ZXPA 5IGCA 3U9OA 2PW7A 4GN5A 2NVXB 1YNJC 2NZHA 2WB1E 4BY1G 2EY5A 1E2VA 4YCUA 2XRSD 1DJRD 2G5DA 4RMFA 3S15H 1VQIA 2EY1A 2CH4W 5IY0A 4A3BH 3AMUA 1F2YA 4A3CH 4WFN3 1HA6A 1KRTA 4A3BB 3KUPA 1W2BA 3KLSA 4RKBA 1B50A 4A3LH 3NXWA 1F9RA 4A3JH 5CGKA 1F2ZA 1KHIA 1DCZA 3OOCA 1XWEA 3STBC 3V05A 2E2HB 4IOAA 4X3UA 2JEAI 3SK8A 2R93H 2B39A 4JI3L 2RDGA 5FLXc 1CKMA 4A93B 4YY3Q 4DGZA 2EQSA 5CV5A 3S1NB 5HGTA 1IW7C 4LF7Q 4JBKA 2KCMA 2EYPA 2JA6G 1LO5D 4J6HA 2ZTEA 3GTMH 3VR6A 1NUCA 4DAVA 3F2BA 2I5HA 3FPPA 2QEJC 2NVTH 1VQHA 5C4JB 2ALYB 3V2TA 1VS0A 4LF6Q 4O0AA 4Y52H 3J80E 1TWFB 1EWHA 1MIUA 3U4VA 4OWWB 2QILA 1F9PA 1N36Q 4OONA 1H9MA 1S5FD 3D8GA 4DR6L 5CV6A 3S1QH 1PRTD 4DUYL 1PTOB 3TP6A 3HGBA 3JAMi 1I6HB 4DF7A 1H9JA 1TS3A 4JG2A 1NMGA 2RKSA 2EYJA 4IQZA 4JBJA 1X56A 5GROA 3TP7A 3RZOB 2D2CC 1RKNA 2I5LX 1WYDA 2PCFB 2A73B 3RZDB 2JA5H 2VQEL 5KYLA 4A3MH 4A3IB 1GXDC 1H9RA 1KDBA 1MKHA 4IJHA 3HOXB 4K5WA 2LS01 3PUWA 4AH6A 1N33Q 1B9NA 1EYAA 3BDOA 3I72A 1A15A 2NN6G 3J81i 3A8IE 3K5MA 4B3ML 1MBYA 1VQKA 4B3RQ 5C4JH 3KK7A 1NE3A 1PH2A 3HOUG 4EQNA 3NQIA 1N9WA 2EJMA 4X64L 5IP7G 5CV9A 1A2UA 1PH7A 3VR4A 3P20A 1KQSA 3HZXA 1N33L 3I2ZA 2Q8TA 1OXVA 2A6HC 4IZ8A 4A3FH 1AE3A 1W3SA 1GUOA 1V1PA 2E76C 4XT3B 4F88A 5FJ8G 1N32Q 4EQ5A 1B7YB 1Y8OB 1YITA 1FNWA 1C48A 2L11A 1EU3A 3MAQA 1CHQD 5ELFA 1HTLD 3CC4A 5D65A 3KLRA 1AP0A 1AEXA 4JI2Q 2HIXA 2KHSA 4DFAA 2IPKD 4FF4A 2EE1A 2MPMA 1FGBD 2CVRA 3SXHA 2L0CA 4DK0A 2UU9Q 2LSSA 1L0WA 1GM5A 2KEDA 1JCKB 4WJ4A 4RG1A 3HG9A 1QG7A 3T13A 4DPGA 4ALPA 4HSPA 1EZ6A 1V1OA 1JICA 5J1ZA 3BU2A 4OIKA 3UE1A 3S17H 1Q1BA 4X66L 5AFWA 2ICEC 1HQRD 3E9HA 4YCWA 1B1ZA 1EYDA 2VZAA 3MFGA 3PCOB 4CDEC 3HOWG 1HFGA 4NMZA 4IPDA 2UXCQ 5KNDA 3PF5A 4OX9L 2Y0SE 1TWAB 1PYBA 5M5XH 3J81j 4IOCA 1HJPA 4IN3A 1YHAA 5FLMH 3FP9A 1ENAA 4GKKL 1RJTA 1PTOC 2XSCA 5GAHC 1Q82C 3W5OA 2B8GA 1SMXA 2HQEA 4EX5A 1BKBA 5HGQA 1VQ5A 3OTOL 1XX8A 4IUTA 5C5LA 4B9XA 1QZGA 3UE0A 1L1OC 4TSSA 5FO7B 4C2MB 3J7A5 1NR4A 3SK5A 1D5XC 2HHHL 4WJ3M 5IOCA 1FJGL 3NWSA 4IUVA 4FVMA 1PFSA 2OQKA 2KA7A 1JOKA 1E7ZA 1X3PA 3T1YQ 1SNOA 3NWTA 2NVXH 1Y1VH 2F0IA 2RHQB 3K0XA 5EKLA 1D1IA 2EYMA 2K05A 2QF7A 1ET6A 1TWFH 3KLWA 2CFMA 3S15B 4IURA 5F2DA 4ZQ3A 2EY2A 1I4RA 3E6ZX 1F9QA 3ERSX 4NKLA 5A35A 3M4OH 3RLFA 1V1PB 5IP7H 4IALA 5C44G 4HJ5A 2WFWA 4XYQA 3PSIA 1QB5D 3M4YA 5JVH3 2PNHA 2KHJA 1BQQT 4JK1C 4U68A 1NJIC 1NCVA 4H7BA 4CHTB 1D5MC 1J5EL 4ZCKA 3SK4A 1NAPA 2XGTA 1G51A 5HURA 3I4NB 2A69C 1SE3A 4DXFA 4A3GH 3H09A 4G4KA 1XMOL 5DM73 4YWLA 2UUBQ 2NZ1D 4K2KA 1GKHA 2WV6D 2D0OA 2O5IC 4A3GB 3U4ZA 4LF4Q 3GTOB 2N3SA 1XPOA 3J7YW 1KL9A 1KIXA 1WTOA 1A3VA 1H9SB 1CHPD 1HZBA 4MNOA 5I4DA 1UUPA 4JOIC 2JA6H 3H3VI 5C3EB 2PZTA 2JJQA 4OEMB 1MD2D 1PXUA 4H44C 5C4XB 3TMEA 4K8IA 2KECA 4R1JA 2YTXA 4X62L 4JV5Q 1EZ8A 2H4OA 1LTID 3T56B 1PHJA 3MVVA 1VQNA 2KHIA 4HIKA 4OO1H 3S1MB 1KNEA 3MXNA 5IGGA 1CZWA 4LF8L 4DAYB 3DLLA 1VMPA 1S72A 1A0IA 2M00A 4LK1C 1BBWA 4JI3Q 3VDYA 4A3EG 1ESFA 2DGYA 2CCZA 3H3VC 4KKTA 2IWHA 2HUGA 2SOBA 3M3YH 3NENA 4K14A 4C3HH 5JVG3 2QEXA 4J8QA 1VQFA 2IW3A 3VR3A 1IBML 2ZJRA 4GN4B 3V96A 4RGTA 5E3FA 1TWAH 2XNAC 1I4PA 1WTPA 1F77A 1L0YB 4DK1A 1R4PB 2VW9A 3KOJA 2JA8B 3PIOA 2QW7A 3VYUA 1SXTA 1BVSA 1EOVA 3OWFA 4P74A 1UE6A 4AYBG 2BH2A 1VQGA 2FINB 3K6OA 4KJOA 2AQ2B 2J0TD 3F8TA 5M5XB 5M3MG 1UEBA 3EA6A 1HNWL 2JA7B 4A3FB 5K36G 2F0JA 1R9TB 1LTAD 2OQ0A 3PUXA 3I55A 2WIIB 3UI2A 5CMDA 1VQEA 1WFQA 3D3RA 2R7ZH 2E74C 1KLUD 3SHLA 4IJLA 3EFXD 3D4RA 2F0PA 2QA4A 1MJEA 4JVZA 2R93G 1SYEA 2O2LD 4JOIA 2SNSA 1HH2P 3NBHA 3S2HH 4P71A 5CR3A 5IGBA 1EQRA 3QIAA 2HT1A 3DEOA 3UDXA 4JI4L 5M5WH 2XN9C 3W1GA 2F0WA 3PO2B 2AQ1B 3I70A 3KFUA 1RTNA 1S5CD 5IGEA 1SE2A 5FKAC 4B9WA 4HJ9A 1K8MA 5ELCA 1VQPA 1VQ8A 1JB7A 1V8QA 2A1AA 3VR2A 2HIVA 4H0LC 1Y14B 2BCOA 1W6JA 4A3JB 4LMQD 2PO4A 5IYBH 2ZM6L 3PIP3 3K5OA 1KD1C 4IFDI 3U9SA 2B2TA 2F0FA 4DUYQ 2R92G 3CU7A 2MNAA 3ND8A 1VCIA 3HKSA 5C6AA 4QL5A 1DYQA 1TS2A 1GOZA 1BF4A 4K5VA 4A3MB 3SVMA 2CW0D 3S1NH 4A3IH 1LT6D 4QGUA 1VQLA 1STAA 1FNVA 1TWGH 1SYFA 2BE5C 5ISRA 4PZ8A 1QVCA 1OTCA 4M1UB 1CA5A 1G2TA 3L3OC 3QWNA 2RF4A 1O7IA 3K7AH 4LFAL 1LM0A 4JI8L 4HIMA 1G291 4A3EB 2EZVA 1JWMD 3LWEA 3M85A 4C3JB 1HRJA 2N55A 5C3EH 3GTQB 2K04A 4ZAIA 1KTKA 3GTLB 3MFYA 1ICFB 2AUJD 4DNTB 4P2CB 4LUZA 3NHHA 5AJ3L 4A3KG 2L5TA 2B29A 5D3IB 1RDPD 1GUNA 3W2DA 2E2IH 4JI0Q 2VB2X 3U58A 1WCMH 2PZWA 2BH8A 2B2UA 5CC4A 1J5EQ 3OSOA 4XXEA 3FRPB 2N78A 2EIFA 2QDBA 3KBXA 4CGYB 2RVLA 3PUVA 4G7OC 3H91A 4DR7Q 3ER0A 4MHEA 5EAYA 2NUCA 1LTRD 2F0SA 2YV5A 3I4OA 1GHJA 1PFBA 1VQ6A 3L0OA 5EKKA 2BA0A 2IX3A 1L1OB 1PV4A 1G91A 3E0EA 1E1TA 1AW7A 1IZ6A 4N8FA 1P16A 2MGSA 4ME3A 3AEVA 4IUUA 1UE1A 2JA6B 2VQFQ 1STEA 1X3EA 5C5MA 3T1YL 3A54A 4V190 1I50B 2K50A 1Q8KA 3GV3A 2NVQH 1IKLA 5IP9G 1X6OA 3O13A 1GUSA 3RD4A 3G4SA 4R4TA 2PYKA 1CUKA 4CJ0B 4X66Q 5C3XA 1FVIA 4GKJQ 3A55A 2Z6KA 4LF8Q 5IE8A 4P73A 4DR4Q 5C0XG 1SE8A 1Q86C 4OGQC 1K3RA 5IIFA 4GS3A 1LTLA 2RSNA 2VQFL 3PO3G 4N9PA 3I7FA 1BBUA 5I6YA 2G9HD 3A7LA 1KAAA 4GKJL 3J80i 2IJ0A 1AH9A 4KHPQ 2MUYA 2YYZA 3H0GH 4X65Q 2TMPA 3BVZA 4H02A 3ONAB 2CHBD 2KBNA 4L6TB 5JPNC 2GVAA 3R2TA 4B08A 1EFID 1K28A 1X9NA 4MIUA 1B9MA 5IYDG 1DZ1A 1PYSB 1EY5A 4OWTB 2JA5G 3VA5A 4KK7A 2K5QA 1JOQA 5M5WB 3CCUA 3WWVA 2V4DA 1UE7A 2R93B 1HR0L 2QDLA 5KYIA 2VUMH 5FLXL 3Q0AA 1QCBD 4JC0A 4BS9A 2E2JB 1C7YA 2MP1A 4JCVE 2L15A 5D14A 1K9MC 3AYHB 1EOTA 3ERQA 2K4KA 1VQCA 2F0UA 2IHFA 1NR2A 5I2XA 4K0KL 3KF8B 4HCSA 1EQTA 2ASBA 3A8JE 4GNXB 1XJVA 3K59A 4FYDA 3BG3A 4EVOA 2UUCL 1EFWA 2ID0A 3W1BA 3HS0C 3MXGA 4C3HG 3M4PA 1ILPA 3TS2A 2B2VA 3D6CA 4OHJA 1YJNA 1G2SA 1WTVA 3HOZG 1T9HA 3OPOA 4HSVA 2B63B 3FMCA 3I4MB 4CKEA 5BN5A 3I56A 4IPGA 1RIPA 4K0KQ 3NUCA 4I65A 4ZYSA 4Y7NB 3K81C 3SDZA 3T4AC 4JI2L 1T5EA 4PV1C 3RZOH 3CF5A 1PZJD 2NVYH 1HNXL 5CV7A 2X6LA 5I2YA 4FF3A 1GUTA 2K28A 4JI7L 5EPJA 2EOTA 5JAVA 3C1EA 1G8ZD 1W6KA 3Q8DA 3K5NA 5KRUA 3I73A 4YHHL 4ME5A 1ASZA 1D1KA 4FF1A 3W3AA 3CQZB 3NBIA 2YTVA 4GOPA 1WOCA 3A5ZB 5IP9H 2DJFC 3HOXG 1HNZQ 1SFOH 2L1BA 4ID6A 5JEAJ 2E8GA 1VDZA 2N88A 3E9IA 4H13C 4DR2Q 2KUMA 1BUVT 1NSNS 4K2LA 1VQAA 4KHVA 1SYDA 4K6DA 4YY3L 1Q90A 2F0HA 1TWGB 2KEEA 2NN6I 2FHTA 4LNQA 1V1QA 5GAEC 1H95A 4MZ9A 2F0LA 5KEEA 2Q8IB 4ULLA 2K01A 2K1BA 4JI6Q 1PZID 2MFIA 1XNQQ 4FDBA 1S5ED 4Y7NH 2K5VA 1R9TH 2Z1CA 1EY6A 4WJWA 5C4XH 1TR5A 4FO2A 1N34Q 4ZUJA 3TZUA 1XNRQ 3RLOA 3GP7A 4JBMA 1A6XA 2K5HA 2K6AA 1ZYRD 3Q24A 2AKWB 1S5DD 3TBIB 4JI6L 1I4XA 3L7ZC 1SAPA 1BR9A 1PMRA 4ABNA 4DAPA 3DM1A 3ITPA 2J7ZA 3S2HB 3SE0A 3G71A 3J81E 2VB3X 1K83H 1PZKD 3TRZA 2WAQG 2AWOA 1ENFA 1B44D 3A0JA 3A7AB 3H0GB 3CCEA 1U5KA 2ZXOA 4HAEA 3CCJA 1DOLA 4DA2A 2UUAL 1YJWA 4OELB 3KLSX 1UWVA 4KY5A 5ELEA 3S14H 1B3AA 4ILWA 3HOWB 1PH4A 1RF2D 3CC7A 1HR0W 2R92H 3K5LA 1GO3E 3CRLC 3NTHA 1FR3A 1ILQA 1SJHD 3TZDA 4BA1I 1TKWB 2F1MA 3TS0A 2A69D 2EVBA 5KNCA 3HKZE 3F2DA 1HNXQ 2OTJA 3UDFA 4AYBE 4NP5A 2Q2UA 3KJPA 5G3LD 2K5DA 4R9WA 3CP0A 4IUNA 4CJ2C 2BDOA 4JPBW 1C8CA 5IODA 1LLRD 4A3DG 3GO5A 1IW7D 1BXTA 2C9OA 3ND9A 4CDDC 5LMUL 3VA7A 1Y69U 4A93H 3GD7A 5L37A 1G6ZA 2P5ZX 1PH1A 2M9VA 1CFMA 1XYIA 3D4DA 2VL6A 3HKZG 1IBLQ 2F0TA 4BXXH 5EGTA 1CKNB 1ENCA 2F03A 1WTQA 3FEWX 1YNNC 3E3XA 1IL2A 1PVOA 4X62Q 1EEFD 1YNJD 3PO3H 3CMEA 3MXNB 2DUDA 3S2DB 2J4XA 1ZYRC 3KDFA 1LTTD 3J81c 1SEBD 4QQBX 3QOLA 4EQPA 3TN2A 1XMQQ 5LMNL 2HD3A 1EQVA 4IFDG 1O7YA 1QZHA 3RN2A 4TKOB 4RHRA 2KJXA 5EBDA 1TY0A 4ZKCB 2DY7A 4ZUIA 3NTKA 1QWYA 4NW2A 2A5HA 1M4VA 4OIJA 4O42A 1VF5C 2LFNA 1STBA 3H15A 1PFNA 1GUGA 4NDXA 1WTWA 1GD7A 5EPLA 5LHY1 3KJOA 1JE5A 4Q0FA 5I9PA 4R4IA 5D3DA 2Z6KC 2WB1B 1CQFA 4TRDA 5ELNA 1EY7A 4UPAA 2F4VL 3HOUH 1EWCA 1SYGA 5C4XG 4PMBA 3TP5A 2WB1G 2JXMB 1QVGA 1QILA 4CDFC 5C3EG 4JW0A 4DNRB 1NBWA 1RCVD 2RCNA 1YHQA 2Z0SA 5M5YH 1RODA 1IBMQ 4DR5Q 2K14A 3OIPA 2EXZA 1SMYD 2B2TC 1A63A 4RGNA 1U4RA 4DV7L 4ZLTF 2C35B 3EIVA 2QCPX 4PZ7A 3HRZC 2EXDA 3FPUB 4UP7A 1I3QH 3QB3A 3VYRA 1STYA 2O5JC 4I7ZC 5C0XJ 1QUQB 1PA6A 3I3CA 5LL6X 1JORA 3C1FA 3HOYH 4JI5Q 5GAGC 5IWAQ 1VF7A 4HIOA 1IKMA 4A3KB 1C4QA 4QF4A 4RHSA 1N8RC 2JYOA 3K80C 4DV1L 1KXLA 1Z47A 4POFA 4BY1B 2QGQA 3Q6SA 3C3LA 5M3MB 4TVAB 3GTPB 4GLVB 1M1KC 3T53B 3PIO3 4PG3A 3S17B 2B2WC 5J22A 5IGFA 2N8NA 2ZT9C 4YWKA 4JI8Q 2NB0A 1FJGQ 4E6IA 1IXRA 1ICWA 2JA8G 2RBMA 1T5XD 1YHBA 2FMCA 1EIYB 1D8LA 5DEHA 1D7QA 1BCPB 2JA5B 2MO0A 3EROA 3R3OA 4R4CA 4DR1Q 2B8FA 2Z9HA 1DGSA 3EBEA 2R7ZB 3SEBA 1L2FA 4XQNA 1SRUA 1BBXC 1F2LA 4YCVA 3I4NG 2AMCB 5C0XI 3GTMB 1VQ9A 4XT1B 2Q2TA 1Q46A 5IYCG 4IO9A 3R93A 4RFBA 2JA7G 3NQTA 1Q12A 2WKDA 2B2VC 4CBVA 4OL7A 3GTJH 2XWBB 3KYHC 3K8AA 2F0GA 2Y0SG 4F8MA 2EYLA 3TEHB 1TS4A 1E0BA 2JN4A 2UXDL 3DUZA 1CQVA 2ICIA 4KN4C 4DV2Q 4NXML 4PQXA 4KD3A 2GVBA 1VQMA 2SDFA 3WOEA 3SR1A 2ATWA 3F2UA 2CWAA 1DOKA 4DV0L 1F9SA 4RGMA 3TREA 2PZUA 1SBBB 3QOJA 4F87A 3H3VH 2RCFA 1XMQL 1QE6A 3MHBA 1PH3A 1A3TA 2D62A 1TY2A 1ET9A 3LWUA 3PGZA 4P75A 2NTTA 1X55A 3RUZA 1YBYA 3J7AV 5BR8L 2CW0C 2DNCA 1XNQL 1K0SA 1Q1EA 4R8NA 1C0AA 3OIQA 4IFDJ 1LACA 1IBLL 1SYBA 3BDCA 3KF6B 4B3SQ 5FLXE 1CSQA 4LFCL 3M3YB 2CQAA 3I4NH 1JMCA 1Y1WG 2KQ3A 4NXNL 1LV9A 4KTAA 4OX9Q 1K3BC 3GV6A 1IHZA 4A3BG 5J3BA 4JYAL 1TWCH 1YZ6A 5CV4A 1VQ4A 3GTOH 3F1ZA 4UP8A 3CMAA 2K5WA 4C3IG 4HMIA 3PIPA 2JA8H 1PRTC 1TWCB 4UP9A 3PO3B 2PQAA 1PLFA 4A3CG 4LFCQ 5I6WA 4GZYC 1PRTB 1Z6HA 2KCCA 3TDQA 1KAWA 1EWIA 4A4IA 3AFPA 4C1NI 3EN2A 1WCMB 2ZJQA 4ZKBB 1O78A 3OHXC 2WKCA 4QUCA 1IYVA 1TQOA 5CBAE 1XTCD 3CW2C 1HUMA 2R7ZG 3G6EA 5E4WC 5FO9B 4LF7L 1PH8A 4HJAA 3DHQA 4L63B 5M9OA 2VNUD 2EJFC 3CCLA 4X6AH 1ONLA 5NUCA 5DM63 4A76A 2A19A 1B3QA 2PMZB 4O2DA 2VQEQ 1UEAB 3FHWA 4JBWA 5ELDA 1N36L 4POGA 1E1OA 1D6EC 2PPBC 1Q8IA 2LXJA 3OW7A 3D4WA 3A56A 4BBSB 1VQDA 5I9OA 1I50H 2NVQB 1JE4A 2SEBD 1M8AA 2B3GA 5C4ZA 5C3WA 1DONA 3MXPA 2B2UC 1CTMA 4ODGA 1PYWD 3C2PA 4A3DH 1L1OA 4X3TA 1U0LA 1STNA 2H5XA 1HUNA 2VY3A 5FK9C 4ZRZA 3HOVG 4N8X1 5GADC 1DXMA 1O7LA 1WJJA 1ZKOA 1KLGD 4DV5Q 1HR0Q 1RTOA 1MSGA 3IFTA 3AB9A 4KY6A 3MEHA 1EU4A 4X3KA 3GTGH 3QJYA 1A8VA 3M7GA 1BO0A 5JEAH 3GDEA 2K52A 2AQ3B 1Y1WB 4IFDH 3HEJA 4C2MH 3CKIB 1WVLA 2BDNA 3CPFA 3LX0A 2YU9B 1LUZA 2MHVA 4HR7B 2O4XA 2PQEA 3D0FA 4KV6A 5FOBB 3J80L 4DR3L 1GHKA 3IL8A 3RNUA 5CORA 1I6HH 1CSPA 1Y1VB 3BZCA 5C4HA 1QNKA 1EEID 2OXPA 1IBKQ 1TXYA 4DV2L 2ES2A 4X3SA 5KIXA 2EYHA 4XYOA 1ZXTA 5HY6A 4L5SA 2F0NA 3DXJC 3S16B 4BY7H 4YIJA 1XPRA 1BCPF 4HCEA 1HNZL 1F2MA 4HJ8A 2UXCL 1UE5A 2OF1A 2VUMB 1Y8NB 3L2PA 4Z9CB 4BXXG 2MQHA 2AWNA 4DV7Q 2UXBQ 4YHHQ 3IFDA 4EGVA 3AFQA 1SJED 1EL0A 3P1HA 1O80A 5AJ3Q 3HP3A 1LT3D 2UU9L 4DR4L 1X32A 4BY7G 1X54A 1KRSA 3DEPA 2I07B 2I46A 1EY8A 3ICEA 2F0KA 2F3IA 1BCPC 2F52A 3GQBA 1K8AC 3PMFA 4CJ1B 2A6ED 5IYBG 4DXGA 1HZCA 4S3SA 2RSOA 1EY4A 2IX0A 1RD9D 3F2CA 3WOFA 1VQBA 4AQYL 5TSSA 5J39A 3PO2G 2IX1A 3R8BA 2HDMA 2A8VA 1X3FA 2AHOB 3S1QB 1MJCA 4L5TA 1VMCA 2Z4IA 5EBCA 5ELBA 3GTQH 1MI2A 5JEAG 2BE5D 2CH4A 5C44H 4FP5D 4QY7A 5BR8Q 4IUQA 1P8LA 4DV6Q 1XXGA 3P75A 2EDGA 1KABA 2E75C 4OWXB 2ZJPA 5E4XA 4J15A 2A6EC 1Q81C 4DUZL 4RA8A 5IYCH 2HHHQ 4IUPA 5G3LF 1S4ZA 1EUJA 4KD4A 4NXNQ 1OXTA 4BBRG 2K33A 1Y1VG 3E5SA 3J7AF 4J1MA 3DM3A 5JJKA 1CKOA 1EY0A 1HPCA 1OXXK 2EJGC 2WP8J 4LF5L 4XQQA 2F0VA 4A3DB 3RR5A 2ZXRA 5M3FH 1CI3M 5M3MH 3G48A 2HCCA 3BS1A 2B2YA 1TWHH 1KNAA 1YEZA 3P7JA 3KF6A 3CD6A 1JB3A 3R2IA 1CKNA 1JJ2A 4PNYA 1K8GA 1MGSA 5FLMG 3FVQA 1XPUA 4JI1Q 3K0YA 2VUMG 1BOSA 2FFKB 2E2HH 4C1NK 2RDHA 4A3GG 3UDGA 1H9SA 1WTRA 3NSWA 1AN8A 1OXSC 3HFZB 4IPHA 2F0DA 3PUYA 1XMOQ 1CT1D 1H9KA 3IRBA 3MWYW 4DV5L 1IL8A 1E2ZA 4JI7Q 4NPSA 2YTYA 1J8IA 5T1GA 2HQLA 3CCQA 3GTGB 1I6VC 1EIGA 1EQQA 1PH6A 4DR7L 3MTSA 1JWUD 3M9BA 2B63G 4A3JG 3GTJB 2EY6A 3S2DH 1WI5A 1NMFA 4MTNA 2A68C 4HJ7A 1QUQA 1U4LA 2ENBA 3X3MA 3Q22A 1QVFA 4C3HB 4C3IH 4FNFA 4B3SL 1SYCA 4QJFA 1PTOH 2CWPA 2KVMA 3RLNA 2RQXA 3M4OB 3BVMA 4FF2A 1WD1A 3H6MA 4QIWE 2NVYB 1ESRA 1FL0A 1OXUA 1K73C 4EQOA 3EQLC 3BZKA 4RGOS 5H1SE 3S14B 1ASYA 3VYSA 4R4QA 2JP1A 2UXDQ 1LABA 1PDQA 2CKZB 3ULPA 2PI2E 2NTSA 2ZTDA 3CCRA 1CK1A 4FXKC 2NYZD 3AU7A 3S1RB 1D5ZC 2WACA 1IYJB 5E7NA 1SDFA 4TQUS 1I5FA 3T1HQ 4A75A 1YNND 1TT2A 1LTSD 1STGA 3EVQA 1BDOA 1JQYD 1KDCA 1MHWC 1A3UA 1Y8PB 4XQJA 2PW5A 3HOYG 1Y1WH 3N52A 3ZYYX 3FKIH 2FJ2A 4PMCA 5E1FA 1A2TA 4AQYQ 4DV3L 4GNXA 2K5NA 4LJZC 1M90C 5IT9E 4DR2L 4QUFA 4A3EH 5T1IA 2QKIC 4XDXA 3CXCA 5IYDH 1D2BA 4ZK9B 1X65A 4GLXA 1PH5A 3PUZA 1FGUA 1SN8A 3QO2A 4JI4Q 2EYFA 2LMCB 3NBHB 4OXPA 1II3A 2NBFA 3I90A 1QJOA 2DNEA 3PQIA 1E24A 5A2QE 4OO1G 1TVXA 2K7VA 1J9OA 1WTXA 2Q2HA 3HOZB 2RA4A 4MN3A 3BJUA 2TSSA 2D5DA 2OWOA 3M4QA 4QB4A 3OWEB 4DUZQ 4L5RC 2HDLA 1YNXA 1VQJA 5C0XH 1I4GA 1KC8C 3IKJA 2F0EA 1LT5D 4RCNA 5FJ8H 4DN4M 1K0RA 3RMHA 3J80c 2Y0SB 2A74C 4F7XA 1ZEQX 2WAQB 1UAPA 3NELA 3URYA 4A3IG 3QR8A 5IGDA 3A5UA 1PTOD 3J81L 2LY7A 5DNFA 1V9PA 3AQQA 3K7AB 4APVA 4X64Q 3M7NA 2NWGA 1YIJA 4K8JA 4HEDA 2JEBI 4B3RL 3IAYA 4XIGS 3J7ZC 2KCTA 4LWCA 3CCSA 2E2JH 4KHZA 4G7ZC 4KN7C 2PQAB 2Q8RE 2B2WA 2EYOA 4DK6C 5JPMC 2OCEA 4DU9A 5IT9c 4GOPB 1AZQA 1DM0B 3KF8A 2FMMA 2UUCQ 4LF4L 3HOYB 1FNUA 2IHEA 2X69A 4K6LA 3H94A 1LTGD 2N49A 5COYA 2IT1A 4DR1L 3A8KE 4WORA 4A3KH 2NN6H 1Z9FA 4I7AA 1C9OA 1GVPA 2NVTB 2MO1A 4YWMA 2R7DA 3T1HL 3TQYA 2Z8LA 1HTPA 4CKBA 1O7ZA 3HOZH 3JAML 1Q3LA 1WCMG 1S40A 4BY1H 1PH9A 3MZ5A 1SSOA 3CRKC 2NZOA 4CDCC 3GTPH 2B63H 4C3IB 5JJIA 4LFAQ 1N34L 3HOWH 4A3MG 3DWAA
chains in the Genus database with same CATH topology
3BYTB 2GA4B 2K03A 4M8AA 2AUKA 1FD7D 1PTOF 1S5BD 1WD0A 5M3FB 1HCZA 4KY7A 5CV8A 3NPPA 1U4MA 4QCLA 3Q23A 2KOLA 2E2DC 2VXWA 1HXYD 4HN7A 1L0XB 3TSSA 1SNMA 4O1NA 2R6GA 4RKLA 2B2YC 4QIWB 4HTHA 1GJXA 5CBEE 4HMJA 1CA6A 1HQMC 5DAUA 4KKUA 1PFMA 2C5CA 3FKIB 1MSHA 3PV0A 3X3NA 1E2WA 3OMCA 1UNSA 1JOOA 1QOHA 5M5YB 2PNRC 2DN8A 3JAME 1B53A 3CHBD 2OEOA 1DOMA 3T16A 3GTKB 2XIWA 4KJNA 3TP8A 1K8OA 3I8ZA 2Z4HA 2OT2A 4FXGC 3NE5B 2MJ8A 3D31A 3C46A 1DD2A 1SNDA 2XVSA 2E2IB 2LKVA 3BZDB 3HOUB 3LNNA 4G57A 1LTBD 2XRQD 2F0MA 2DY8A 4KI0A 3HOVB 2EPBA 3MA2B 4R8IA 2L9HA 2R92B 2L55A 1SNCA 2RDFA 2SNMA 1TWHB 3BYYB 1OO9B 1FYCA 2F4IA 2JE6I 3BDLA 3MXUA 1V43A 5A2QL 3QG1A 3DWQA 4AYBB 3G6JB 3I91A 3KBGA 2R3ZA 5K5PA 1JWSD 1BNZA 5EQ0A 1LT4D 1JR0D 3E0JA 4XTCS 3MC0B 3BVGA 1BCPD 3VR5A 5EPKA 3G7LA 5EKIA 3N6RA 1SFOB 1STHA 1SMYC 1CM9A 1TIID 5BN4A 1Z7TA 4QMGA 1EY9A 3D6WA 1K83B 5LL6S 4OO1I 3K58A 1R4QB 1ML0D 2L4NA 4PMWA 1I4HA 5JOBA 2KCNA 4L8JA 5EJWA 2F3WA 2G9DA 2A6HD 2XWJB 2F0OA 3DMUA 2BA1A 1RHPA 1SNPA 3SK6A 4G7HC 4KMUC 3T51B 1I4QA 4CKCA 3S9WA 3FDTA 1GUWA 3WDNA 5FO8B 2BOSA 2IL8A 1JC7A 2D9UA 3NP8A 1CZGA 2H1EA 4RAUC 4RWSC 4C3JG 2WINB 4DAYA 1TU2B 1TS5A 3I4LA 2JSOA 4BWGB 2F3VA 1PRTF 2M2LA 4V0BA 5C44B 3K57A 4N9TA 1I3QB 4Q5VA 5K36H 3NTIA 4RH6A 4UDUC 4BY7B 5CYUA 5IT9L 1HHVA 2HCIA 1IYUA 1HFNA 2A68D 2F0QA 3L9AX 1KDAA 4LAAA 4RCOA 1U9RA 3OMGA 5KGUA 1HA5A 1SE4A 1EYCA 3DWPA 5JJZA 1B4OA 1SNQA 2R61A 1U4PA 3EJIA 5KNBA 1B2TA 4FXDA 2X6GA 1X3QA 4C56C 4WRDA 4BBRB 3HKZB 1AZPA 5BN3A 3VYTA 4UAIA 1AFPA 4U673 4KKSA 4BA2I 1EIHA 4K5XA 2K32A 2L12A 3NK9A 1QNUA 2ZXPA 5IGCA 3U9OA 2PW7A 2NVXB 1YNJC 2EY5A 1E2VA 2XRSD 1DJRD 2EY1A 3AMUA 1F2YA 4WFN3 1HA6A 4A3BB 3KUPA 3KLSA 4RKBA 1B50A 3NXWA 1F9RA 5CGKA 1F2ZA 1DCZA 3OOCA 1XWEA 3V05A 2E2HB 4X3UA 2JEAI 3SK8A 2B39A 2RDGA 4A93B 4DGZA 5CV5A 3S1NB 5HGTA 1IW7C 2EYPA 1LO5D 4J6HA 3VR6A 1NUCA 4DAVA 3FPPA 2QEJC 5C4JB 3V2TA 3J80E 1TWFB 1EWHA 2QILA 1F9PA 1H9MA 1S5FD 3D8GA 5CV6A 1PRTD 1PTOB 3TP6A 3HGBA 1I6HB 4DF7A 1H9JA 1TS3A 2RKSA 2EYJA 4IQZA 3TP7A 3RZOB 2D2CC 1RKNA 2PCFB 2A73B 3RZDB 5KYLA 4A3IB 1GXDC 1H9RA 1KDBA 3HOXB 4K5WA 2LS01 3PUWA 1B9NA 1EYAA 3BDOA 3I72A 1A15A 2NN6G 3A8IE 3K5MA 1MBYA 3KK7A 4EQNA 3NQIA 2EJMA 5CV9A 1A2UA 3VR4A 3P20A 3HZXA 2Q8TA 1OXVA 2A6HC 4IZ8A 4XT3B 2E76C 1GUOA 1V1PA 4F88A 1Y8OB 1FNWA 1C48A 2L11A 1EU3A 3MAQA 1CHQD 5ELFA 1HTLD 5D65A 3KLRA 1AP0A 1AEXA 2KHSA 4DFAA 2IPKD 4FF4A 2EE1A 2MPMA 1FGBD 2CVRA 3SXHA 2L0CA 4DK0A 2KEDA 1JCKB 3HG9A 1QG7A 3T13A 4HSPA 1EZ6A 1V1OA 1JICA 5J1ZA 4OIKA 1Q1BA 5AFWA 2ICEC 1HQRD 1B1ZA 1EYDA 3MFGA 1HFGA 4NMZA 5KNDA 1TWAB 4IN3A 1ENAA 1RJTA 1PTOC 2XSCA 2B8GA 2HQEA 1XX8A 4IUTA 5C5LA 4B9XA 4TSSA 5FO7B 4C2MB 1NR4A 3SK5A 1D5XC 5IOCA 3NWSA 4IUVA 4FVMA 2KA7A 1JOKA 1X3PA 1SNOA 3NWTA 2F0IA 5EKLA 1D1IA 2EYMA 2K05A 2QF7A 1ET6A 3S15B 4IURA 5F2DA 4ZQ3A 2EY2A 1I4RA 3E6ZX 1F9QA 4NKLA 5A35A 3RLFA 1V1PB 4IALA 4XYQA 1QB5D 3M4YA 5JVH3 1BQQT 4JK1C 4U68A 1NCVA 4H7BA 4CHTB 1D5MC 3SK4A 1NAPA 3I4NB 5HURA 2A69C 1SE3A 4DXFA 3H09A 4G4KA 5DM73 2NZ1D 4K2KA 2WV6D 2O5IC 4A3GB 3GTOB 3J7YW 1WTOA 1A3VA 1H9SB 1CHPD 5I4DA 1UUPA 5C3EB 2PZTA 1MD2D 1PXUA 4H44C 5C4XB 3TMEA 2KECA 4K8IA 1EZ8A 2H4OA 1LTID 3T56B 3MVVA 4OO1H 3S1MB 1KNEA 3MXNA 5IGGA 1CZWA 1VMPA 2M00A 4LK1C 1ESFA 3H3VC 4KKTA 2IWHA 2HUGA 2SOBA 4K14A 5JVG3 4J8QA 2IW3A 3VR3A 3V96A 4RGTA 5E3FA 2XNAC 1I4PA 1WTPA 1F77A 1L0YB 4DK1A 1R4PB 2JA8B 3VYUA 1SXTA 3OWFA 4KJOA 2FINB 3K6OA 2AQ2B 2J0TD 5M5XB 3EA6A 2JA7B 4A3FB 5K36G 2F0JA 1R9TB 1LTAD 3PUXA 2WIIB 3UI2A 5CMDA 3D3RA 2E74C 1KLUD 3SHLA 3EFXD 3D4RA 2F0PA 1SYEA 2O2LD 2SNSA 3NBHA 5CR3A 5IGBA 3QIAA 3DEOA 2XN9C 2F0WA 3PO2B 2AQ1B 3I70A 5IGEA 1RTNA 1S5CD 1SE2A 5FKAC 4B9WA 1K8MA 5ELCA 1V8QA 3VR2A 4H0LC 2BCOA 1W6JA 4A3JB 4LMQD 2PO4A 3PIP3 3K5OA 4IFDI 3U9SA 2B2TA 2F0FA 3CU7A 3ND8A 1VCIA 5C6AA 1DYQA 1TS2A 1GOZA 1BF4A 4K5VA 4A3MB 3SVMA 2CW0D 1LT6D 1STAA 1FNVA 1SYFA 2BE5C 5ISRA 4M1UB 1CA5A 1G2TA 3L3OC 3QWNA 1G291 4A3EB 2EZVA 1JWMD 3LWEA 3M85A 4C3JB 1HRJA 2N55A 3GTQB 2K04A 4ZAIA 1KTKA 3GTLB 3MFYA 2AUJD 4DNTB 4P2CB 3NHHA 2L5TA 5D3IB 1RDPD 1GUNA 3W2DA 2VB2X 2PZWA 2B2UA 5CC4A 3OSOA 4XXEA 3FRPB 2QDBA 3KBXA 4CGYB 2RVLA 3PUVA 4G7OC 3H91A 4MHEA 2NUCA 1LTRD 2F0SA 1GHJA 1PFBA 5EKKA 2BA0A 2IX3A 1G91A 1AW7A 2MGSA 4IUUA 2JA6B 1STEA 5C5MA 4V190 3A54A 1I50B 3GV3A 1IKLA 3O13A 1GUSA 3RD4A 2PYKA 4CJ0B 5C3XA 3A55A 5C0XG 4OGQC 5IIFA 2RSNA 4N9PA 5I6YA 2G9HD 3A7LA 1KAAA 2IJ0A 2MUYA 2YYZA 2TMPA 3BVZA 3ONAB 2CHBD 4L6TB 5JPNC 3R2TA 4B08A 1EFID 1DZ1A 4MIUA 1B9MA 1EY5A 3VA5A 4KK7A 2K5QA 1JOQA 5M5WB 2V4DA 2R93B 5KYIA 5FLXL 3Q0AA 1QCBD 4BS9A 2E2JB 2MP1A 5D14A 1EOTA 3ERQA 2F0UA 5I2XA 1NR2A 4HCSA 1EQTA 3A8JE 3K59A 4FYDA 3BG3A 4EVOA 2ID0A 4C3HG 3HS0C 3MXGA 1ILPA 2B2VA 3D6CA 4OHJA 1G2SA 1WTVA 3OPOA 4HSVA 2B63B 3FMCA 3I4MB 4CKEA 5BN5A 3NUCA 4I65A 4ZYSA 4Y7NB 3SDZA 3T4AC 1T5EA 4PV1C 1PZJD 5CV7A 2X6LA 5I2YA 4FF3A 1GUTA 2K28A 5EPJA 2EOTA 5JAVA 3C1EA 1G8ZD 1W6KA 3K5NA 5KRUA 3I73A 4ME5A 4FF1A 1D1KA 3W3AA 3CQZB 3NBIA 2L1BA 4ID6A 5JEAJ 1VDZA 2N88A 4H13C 2KUMA 1BUVT 1NSNS 4K2LA 4KHVA 1SYDA 4K6DA 1Q90A 2F0HA 1TWGB 2KEEA 2NN6I 2FHTA 2F0LA 5KEEA 2Q8IB 4ULLA 2K01A 2K1BA 1PZID 1S5ED 2Z1CA 1EY6A 4WJWA 1TR5A 4FO2A 4ZUJA 3TZUA 3GP7A 1A6XA 2K6AA 1ZYRD 3Q24A 1S5DD 3TBIB 1I4XA 3L7ZC 1SAPA 1BR9A 1PMRA 4ABNA 4DAPA 3DM1A 3ITPA 2J7ZA 3S2HB 3SE0A 3J81E 2VB3X 1PZKD 2AWOA 1ENFA 1B44D 3A7AB 3H0GB 2ZXOA 4HAEA 1DOLA 4DA2A 3KLSX 4KY5A 5ELEA 1B3AA 4ILWA 3HOWB 1RF2D 3K5LA 3CRLC 3NTHA 1FR3A 1ILQA 1SJHD 4BA1I 3TZDA 1TKWB 2F1MA 2A69D 5KNCA 2EVBA 4NP5A 5G3LD 2K5DA 4R9WA 4IUNA 4CJ2C 2BDOA 1C8CA 5IODA 1LLRD 3GO5A 1IW7D 1BXTA 2C9OA 3ND9A 1Y69U 3VA7A 3GD7A 1G6ZA 2M9VA 1CFMA 1XYIA 3D4DA 2F0TA 5EGTA 1ENCA 2F03A 1WTQA 3FEWX 1YNNC 1EEFD 1YNJD 3S2DB 2J4XA 1ZYRC 1LTTD 1SEBD 3QOLA 4EQPA 3TN2A 1EQVA 4IFDG 1O7YA 4TKOB 4RHRA 2KJXA 5EBDA 1TY0A 4ZKCB 2DY7A 4ZUIA 3NTKA 1QWYA 4NW2A 2A5HA 1M4VA 4OIJA 4O42A 1VF5C 2LFNA 1STBA 1PFNA 1GUGA 4NDXA 1WTWA 5EPLA 5LHY1 4Q0FA 5I9PA 5D3DA 2WB1B 1CQFA 4TRDA 1EY7A 1EWCA 1SYGA 4PMBA 3TP5A 2JXMB 1QILA 4DNRB 1RCVD 1RODA 3OIPA 2EXZA 1SMYD 2B2TC 4RGNA 1U4RA 4ZLTF 2QCPX 3HRZC 3FPUB 3QB3A 3VYRA 1STYA 2O5JC 4I7ZC 5C0XJ 3I3CA 5LL6X 1JORA 3C1FA 1VF7A 1IKMA 4A3KB 1C4QA 4QF4A 4RHSA 2JYOA 1Z47A 4BY1B 3Q6SA 3C3LA 5M3MB 3GTPB 3T53B 3PIO3 3S17B 2B2WC 5J22A 5IGFA 2ZT9C 2NB0A 4E6IA 1ICWA 2RBMA 1T5XD 2FMCA 5DEHA 1BCPB 2JA5B 3EROA 3R3OA 2B8FA 2R7ZB 3SEBA 4XQNA 1BBXC 1F2LA 5C0XI 3GTMB 4XT1B 3R93A 4RFBA 3NQTA 1Q12A 2WKDA 2B2VC 4CBVA 4OL7A 2XWBB 2F0GA 4F8MA 2EYLA 1TS4A 1E0BA 3DUZA 1CQVA 2ICIA 4KN4C 4PQXA 4KD3A 2SDFA 3WOEA 3SR1A 3F2UA 1DOKA 1F9SA 4RGMA 2PZUA 1SBBB 3QOJA 4F87A 1QE6A 3MHBA 1A3TA 2D62A 1TY2A 1ET9A 3LWUA 2NTTA 3RUZA 3J7AV 2CW0C 2DNCA 1Q1EA 4R8NA 3OIQA 4IFDJ 1LACA 1SYBA 3BDCA 5FLXE 3M3YB 2CQAA 2KQ3A 1LV9A 4KTAA 3GV6A 1IHZA 5CV4A 2K5WA 4C3IG 4HMIA 1PRTC 1TWCB 3PO3B 1PLFA 5I6WA 4GZYC 1PRTB 1Z6HA 2KCCA 3TDQA 4C1NI 1WCMB 4ZKBB 1O78A 3OHXC 2WKCA 4QUCA 1IYVA 1TQOA 5CBAE 1XTCD 1HUMA 5E4WC 5FO9B 3DHQA 4L63B 5M9OA 2VNUD 2EJFC 1ONLA 5NUCA 5DM63 2PMZB 1UEAB 4JBWA 5ELDA 1D6EC 2PPBC 1Q8IA 3OW7A 3D4WA 3A56A 4BBSB 5I9OA 2NVQB 1JE4A 2SEBD 1M8AA 5C4ZA 5C3WA 1DONA 3MXPA 2B2UC 1CTMA 4ODGA 1PYWD 3C2PA 4X3TA 1STNA 1HUNA 5FK9C 4ZRZA 1DXMA 1O7LA 1ZKOA 1KLGD 1RTOA 1MSGA 3IFTA 3AB9A 4KY6A 3MEHA 1EU4A 4X3KA 3QJYA 3M7GA 1BO0A 5JEAH 2AQ3B 1Y1WB 4IFDH 3HEJA 3CKIB 1WVLA 2BDNA 3LX0A 2YU9B 2MHVA 4HR7B 2O4XA 2PQEA 4KV6A 5FOBB 3J80L 1GHKA 3IL8A 5CORA 1Y1VB 5C4HA 1QNKA 1EEID 2OXPA 4X3SA 5KIXA 2EYHA 4XYOA 1ZXTA 2F0NA 3DXJC 3S16B 4YIJA 1BCPF 4HCEA 1F2MA 2OF1A 2VUMB 1Y8NB 4Z9CB 2AWNA 3IFDA 4EGVA 1SJED 1EL0A 3P1HA 1O80A 3HP3A 1LT3D 1X32A 3DEPA 2I07B 2I46A 1EY8A 2F0KA 1BCPC 3GQBA 3PMFA 4CJ1B 2A6ED 4DXGA 4S3SA 2RSOA 1EY4A 2IX0A 1RD9D 3WOFA 5TSSA 5J39A 2IX1A 3R8BA 2HDMA 3S1QB 1VMCA 2Z4IA 5ELBA 5EBCA 1MI2A 5JEAG 2BE5D 4FP5D 4IUQA 1XXGA 3P75A 2EDGA 1KABA 2E75C 5E4XA 2A6EC 4RA8A 4IUPA 5G3LF 1S4ZA 4KD4A 1OXTA 2K33A 3E5SA 3J7AF 4J1MA 1EY0A 1HPCA 1OXXK 2EJGC 2WP8J 4XQQA 2F0VA 4A3DB 2ZXRA 1CI3M 2HCCA 3BS1A 2B2YA 1KNAA 3P7JA 1JB3A 3R2IA 4PNYA 1MGSA 3FVQA 3K0YA 1BOSA 2FFKB 4C1NK 2RDHA 1H9SA 1WTRA 3NSWA 1AN8A 1OXSC 2F0DA 3PUYA 1CT1D 1H9KA 3MWYW 1IL8A 1E2ZA 1J8IA 5T1GA 3GTGB 1I6VC 1EIGA 3MTSA 1JWUD 3GTJB 2EY6A 2A68C 1U4LA 2ENBA 3X3MA 3Q22A 4C3HB 4FNFA 1SYCA 1PTOH 2KVMA 2RQXA 3M4OB 3BVMA 4FF2A 1WD1A 3H6MA 2NVYB 1ESRA 1OXUA 4EQOA 3EQLC 4RGOS 3S14B 3VYSA 2JP1A 1LABA 1PDQA 2NTSA 1CK1A 4FXKC 2NYZD 3AU7A 3S1RB 1D5ZC 2WACA 1SDFA 4TQUS 1YNND 1TT2A 1LTSD 1STGA 3EVQA 1BDOA 1JQYD 1KDCA 1A3UA 1Y8PB 4XQJA 2PW5A 3N52A 3ZYYX 2FJ2A 4PMCA 5E1FA 1A2TA 4LJZC 5IT9E 4QUFA 5T1IA 2QKIC 4XDXA 1D2BA 4ZK9B 3PUZA 3QO2A 2EYFA 2LMCB 1II3A 2NBFA 3I90A 1QJOA 2DNEA 4OO1G 5A2QE 1TVXA 2K7VA 1J9OA 1WTXA 3HOZB 2RA4A 4MN3A 2TSSA 2D5DA 4QB4A 3OWEB 2HDLA 5C0XH 1I4GA 3IKJA 2F0EA 1LT5D 4RCNA 4DN4M 3RMHA 2Y0SB 2A74C 4F7XA 1ZEQX 2WAQB 1UAPA 3URYA 5IGDA 1PTOD 3J81L 2LY7A 5DNFA 3K7AB 3M7NA 2NWGA 4K8JA 4HEDA 2JEBI 3IAYA 4XIGS 4KHZA 4G7ZC 4KN7C 2Q8RE 2B2WA 2EYOA 5JPMC 4DU9A 1AZQA 1DM0B 3KF8A 2FMMA 3HOYB 1FNUA 3H94A 2X69A 4K6LA 1LTGD 5COYA 2IT1A 3A8KE 4WORA 2NN6H 2NVTB 2Z8LA 1HTPA 4CKBA 1O7ZA 3JAML 1Q3LA 3MZ5A 1SSOA 3CRKC 4C3IB 3DWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CV9 A;  1A2U A;  2F0L A;  4HMI A;  4MIU A;  5E3F A;  5KEE A;  1EY5 A;  2F0V A;  5C4H A;  3VA5 A;  2OXP A;  2F3V A;  5F2D A;  5J22 A;  5IGF A;  1F2Y A;  3QOL A;  4EQP A;  3HZX A;  1SNC A;  2RDF A;  4ZQ3 A;  2SNM A;  5I6W A;  5KIX A;  2EY2 A;  1EQV A;  4E6I A;  2EYH A;  1JOQ A;  3BDL A;  3OWF A;  4IZ8 A;  4NKL A;  2RBM A;  4RKB A;  4KY7 A;  5CV8 A;  3NXW A;  4IAL A;  2F0N A;  4KJO A;  5CGK A;  3NHH A;  1F2Z A;  1EY6 A;  4N9T A;  4YIJ A;  5DEH A;  5KYI A;  1TR5 A;  3SK8 A;  2EYF A;  2F0J A;  3ERO A;  3R3O A;  4ZUJ A;  4PNY A;  1F2M A;  5K5P A;  4ZUI A;  1TQO A;  2PZW A;  1II3 A;  2OF1 A;  1SNM A;  4RKL A;  5CC4 A;  4H7B A;  1AEX A;  4DGZ A;  1STB A;  5CV5 A;  4HTH A;  2F0D A;  3DHQ A;  2KHS A;  3OSO A;  4NDX A;  3ERQ A;  4DFA A;  3SHL A;  5HGT A;  3SK4 A;  5M9O A;  2F0U A;  5HUR A;  2EYP A;  2QDB A;  5NUC A;  3ITP A;  3P1H A;  4J6H A;  4HMJ A;  2F0Q A;  3SXH A;  2F0P A;  3NQT A;  5I9P A;  1NUC A;  5DAU A;  1STH A;  1KDA A;  4K2K A;  4LAA A;  4QB4 A;  4OL7 A;  1U9R A;  4TRD A;  1EY7 A;  2NUC A;  3OMG A;  1SYE A;  2F0S A;  1EY8 A;  5KGU A;  2F0G A;  4EVO A;  3V2T A;  1SYG A;  3OMC A;  2SNS A;  4F8M A;  2EYL A;  4PMB A;  1JOO A;  3T13 A;  2F0E A;  5EKK A;  5CR3 A;  3TP5 A;  2F0K A;  2EY6 A;  5IGB A;  1EZ6 A;  1EY9 A;  4QMG A;  1A3V A;  3D6C A;  5J1Z A;  1EYC A;  3U9O A;  3PMF A;  4F7X A;  2ENB A;  1EYD A;  4KD3 A;  1SYC A;  3D4W A;  4S3S A;  2OEO A;  3D8G A;  1EY4 A;  5IGD A;  4KY5 A;  2PZT A;  5I9O A;  2F0W A;  3NUC A;  3H6M A;  4I65 A;  4NMZ A;  5CV6 A;  3SR1 A;  3T16 A;  5C4Z A;  4KJN A;  3TP8 A;  5C3W A;  3MXP A;  3TP6 A;  1SNQ A;  4EQO A;  4ODG A;  5C5M A;  2EXZ A;  3TME A;  3EJI A;  4DF7 A;  5IGE A;  4B9W A;  5J39 A;  4K8I A;  4K8J A;  1STN A;  5JOB A;  2RKS A;  1ENA A;  2PZU A;  2EYJ A;  5CV7 A;  3QOJ A;  2F3W A;  1EZ8 A;  2F0O A;  3DMU A;  2PYK A;  3MHB A;  3TP7 A;  1A3T A;  3C1E A;  3MVV A;  1RKN A;  5JAV A;  5C3X A;  5KRU A;  4NP5 A;  4ME5 A;  4WRD A;  2EYO A;  2HQE A;  1SNP A;  3P75 A;  3SK6 A;  4DU9 A;  5IGG A;  3QB3 A;  3RUZ A;  4IUN A;  5C5L A;  1STY A;  4B9X A;  1SND A;  1KAB A;  5KYL A;  2WAC A;  2LKV A;  5IIF A;  5IOD A;  4R8N A;  2F0F A;  4KY6 A;  3S9W A;  4N9P A;  3MEH A;  1KDB A;  4ID6 A;  5I6Y A;  5C6A A;  2M00 A;  4WOR A;  4K5W A;  4K5X A;  4K5V A;  3C1F A;  1JOR A;  3NK9 A;  1SYB A;  4G57 A;  4KD4 A;  1TT2 A;  3BDC A;  1STG A;  3SK5 A;  3EVQ A;  1STA A;  5IGC A;  3D4D A;  5IOC A;  1KDC A;  3NP8 A;  1KAA A;  2F0T A;  1SYF A;  2PW7 A;  1EYA A;  1A3U A;  1NSN S;  3E5S A;  2F0M A;  3HEJ A;  4K2L A;  5EGT A;  5ISR A;  2KQ3 A;  4KHV A;  1SYD A;  4KTA A;  4K6D A;  4J1M A;  4QF4 A;  2EY5 A;  1IHZ A;  1ENC A;  2F0H A;  2PW5 A;  2SOB A;  3LX0 A;  1JOK A;  3MZ5 A;  4K14 A;  1EY0 A;  1SNO A;  4PMC A;  5E1F A;  1A2T A;  2O4X A;  2PQE A;  2F0I A;  4KV6 A;  5CV4 A;  5EKL A;  2EY1 A;  4EQN A;  2EYM A; 
#chains in the Genus database with same CATH topology
 3BYT B;  2GA4 B;  2K03 A;  4LFB L;  4M8A A;  2AUK A;  1FD7 D;  1PTO F;  1S5B D;  1LYL A;  1WD0 A;  2Q2I A;  4NB3 A;  3MEF A;  5M3F B;  1HCZ A;  2Z6B A;  4GLA C;  4KY7 A;  3NPP A;  5CV8 A;  3CCV A;  3OTO Q;  3OW2 A;  3RZD H;  3CQZ H;  1U4M A;  4JI0 L;  4QCL A;  3Q23 A;  2KOL A;  2E2D C;  3LGJ A;  2VXW A;  1HZ9 A;  1HXY D;  2JQO A;  4LF6 L;  4HN7 A;  4GKK Q;  1L0X B;  3TSS A;  1SNM A;  4O1N A;  2R6G A;  4RKL A;  1B70 B;  1XNR L;  2JA7 H;  1JJG A;  2IY5 B;  2B2Y C;  4QIW B;  3CAM A;  5LMN Q;  4HTH A;  3CCM A;  4JYA Q;  1GJX A;  5ELO A;  4AIM A;  1J6Q A;  4DV4 Q;  5CBE E;  4HMJ A;  1CA6 A;  1HQM C;  4DR6 Q;  5DAU A;  1SRO A;  4DV6 L;  4KKU A;  1PFM A;  2C5C A;  3FKI B;  4DV3 Q;  1MSH A;  3PV0 A;  2JA9 A;  3X3N A;  1E2W A;  3OMC A;  1UNS A;  1JOO A;  4PZ6 A;  3H0G G;  3NEM A;  1QOH A;  5M5Y B;  2PNR C;  4DNI A;  2UXB L;  2DN8 A;  3JAM E;  1B53 A;  1NNX A;  2E5L L;  3ZJY C;  3CHB D;  2OEO A;  4DV4 L;  1DOM A;  3T16 A;  3RN5 A;  2PMZ E;  2XIW A;  3GTK B;  4KJN A;  3TP8 A;  4KHP L;  2FXQ A;  1K8O A;  3I8Z A;  2R7F A;  1NY4 A;  2F4V Q;  4X65 L;  1E3P A;  4DV1 Q;  4L5Q A;  2Z4H A;  4C3J H;  3PO2 H;  2OT2 A;  2XTI A;  3S24 A;  4FXG C;  1YI2 A;  2I0Q A;  3K7U C;  3NE5 B;  1JJC B;  3OYY A;  3STB D;  2MJ8 A;  4DKA C;  2RHS B;  3D31 A;  3C46 A;  1DD2 A;  1SND A;  2XVS A;  2E2I B;  2LKV A;  3S1R H;  2ZTC A;  3BZD B;  4B3T L;  2DJG C;  3HOU B;  3LNN A;  4G57 A;  1LTB D;  3A74 A;  1A62 A;  2XRQ D;  2F0M A;  2DY8 A;  4KI0 A;  3HOV B;  2EPB A;  3PF4 A;  3MA2 B;  3B6Y A;  4BBS H;  4R8I A;  1EIF A;  1I94 Q;  1RL2 A;  2UUB L;  4DR3 Q;  2L9H A;  2R92 B;  2L55 A;  4JV5 L;  4JI5 L;  1XTD A;  2PI2 A;  1SNC A;  2RDF A;  1SLJ A;  2SNM A;  3ULJ A;  1TWH B;  5IWA L;  5M3F G;  3BYY B;  1OO9 B;  1FYC A;  2F4I A;  2JE6 I;  2VS1 A;  3BDL A;  4UY8 C;  3MXU A;  1V43 A;  5A2Q L;  3GTK H;  3QG1 A;  3DWQ A;  4AYB B;  3G6J B;  3JAM c;  3I91 A;  3GTL H;  3KBG A;  2R3Z A;  5K5P A;  4LF5 Q;  1B8A A;  1JWS D;  1BNZ A;  5EQ0 A;  1LT4 D;  4DV0 Q;  4BBR H;  4LF9 Q;  1JR0 D;  3E0J A;  4XTC S;  3MC0 B;  3BVG A;  1BCP D;  3VR5 A;  5EPK A;  3KDF B;  4HID A;  4GN3 B;  3G7L A;  5EKI A;  3N6R A;  1SFO B;  1STH A;  1YJ9 A;  1SMY C;  1CM9 A;  1TII D;  5BN4 A;  4DK3 C;  1HZA A;  4JI1 L;  5LMN W;  1Q7Y C;  1Z7T A;  1YVC A;  4QMG A;  1EY9 A;  5DLQ E;  3D6W A;  1K83 B;  2CQO A;  5LL6 S;  4BBS G;  4OO1 I;  2KEN A;  3K58 A;  1R4Q B;  1ML0 D;  2V1C C;  2L4N A;  4PMW A;  1I4H A;  5JOB A;  1VQO A;  2KCN A;  1IBK L;  4L8J A;  5EJW A;  2OTL A;  2F3W A;  2G9D A;  2A6H D;  2XWJ B;  1SR3 A;  2F0O A;  3DMU A;  1E22 A;  1NTG A;  2BA1 A;  1RHP A;  1SNP A;  1AE2 A;  3SK6 A;  4G7H C;  3HOX H;  4KMU C;  3T51 B;  1I4Q A;  1HNW Q;  2LXK A;  4CKC A;  3S9W A;  3FDT A;  1GUW A;  3WDN A;  5FO8 B;  2BOS A;  2IL8 A;  4A3L G;  1JC7 A;  4B3T Q;  2D9U A;  3NP8 A;  1CZG A;  2H1E A;  4RAU C;  4RWS C;  4C3J G;  4DR5 L;  3JC6 6;  2WIN B;  1G6P A;  3I4M H;  2JK8 A;  4DAY A;  1TU2 B;  1TS5 A;  3I4L A;  3CPW A;  2YU9 H;  2JSO A;  4BWG B;  4GOP C;  2F3V A;  1I94 L;  1PRT F;  4P72 A;  2M2L A;  4V0B A;  1S3O A;  2WAQ E;  3U50 C;  5C44 B;  3ULL A;  2ZM6 Q;  3K57 A;  1X3G A;  4N9T A;  1I3Q B;  5JJL A;  4Q5V A;  5K36 H;  3NTI A;  4RH6 A;  4UDU C;  3S16 H;  4BY7 B;  5CYU A;  4R4O A;  5IT9 L;  1HHV A;  2HCI A;  2K75 A;  4A3F G;  1IYU A;  1HFN A;  4LUO A;  4LF9 L;  2A68 D;  4IPC A;  3SGI A;  2F0Q A;  3L9A X;  4B3M Q;  1KDA A;  4LAA A;  4RCO A;  1U9R A;  4LUV A;  4GNX C;  3OMG A;  5KGU A;  4A93 G;  3CC2 A;  1HA5 A;  1SE4 A;  1VQ7 A;  2UUA Q;  3UDI A;  5LMU Q;  1EYC A;  2E5L Q;  3HOV H;  3DWP A;  5JJZ A;  1N32 L;  3I4M G;  1B4O A;  4LW1 A;  1SNQ A;  2R61 A;  1U4P A;  3EJI A;  5KNB A;  2D0P A;  1B2T A;  3FKI G;  4FXD A;  2X6G A;  4MTK A;  1X3Q A;  4LFB Q;  2GN5 A;  5GQO A;  4C56 C;  4WRD A;  4BBR B;  4DAM A;  3HKZ B;  1AZP A;  5BN3 A;  3VYT A;  4KLK A;  4UAI A;  1AFP A;  4U67 3;  3S1M H;  4KKS A;  4BA2 I;  1EIH A;  4UHV A;  1JT8 A;  1WTH A;  4NXM Q;  1EYG A;  4K5X A;  2K32 A;  2L12 A;  3NK9 A;  1QNU A;  2I5M X;  2ZXP A;  5IGC A;  3U9O A;  2PW7 A;  4GN5 A;  2NVX B;  1YNJ C;  2NZH A;  2WB1 E;  4BY1 G;  2EY5 A;  1E2V A;  4YCU A;  2XRS D;  1DJR D;  2G5D A;  4RMF A;  3S15 H;  1VQI A;  2EY1 A;  2CH4 W;  5IY0 A;  4A3B H;  3AMU A;  1F2Y A;  4A3C H;  4WFN 3;  1HA6 A;  1KRT A;  4A3B B;  3KUP A;  1W2B A;  3KLS A;  4RKB A;  1B50 A;  4A3L H;  3NXW A;  1F9R A;  4A3J H;  5CGK A;  1F2Z A;  1KHI A;  1DCZ A;  3OOC A;  1XWE A;  3STB C;  3V05 A;  2E2H B;  4IOA A;  4X3U A;  2JEA I;  3SK8 A;  2R93 H;  2B39 A;  4JI3 L;  2RDG A;  5FLX c;  1CKM A;  4A93 B;  4YY3 Q;  4DGZ A;  2EQS A;  5CV5 A;  3S1N B;  5HGT A;  1IW7 C;  4LF7 Q;  4JBK A;  2KCM A;  2EYP A;  2JA6 G;  1LO5 D;  4J6H A;  2ZTE A;  3GTM H;  3VR6 A;  1NUC A;  4DAV A;  3F2B A;  2I5H A;  3FPP A;  2QEJ C;  2NVT H;  1VQH A;  5C4J B;  2ALY B;  3V2T A;  1VS0 A;  4LF6 Q;  4O0A A;  4Y52 H;  3J80 E;  1TWF B;  1EWH A;  1MIU A;  3U4V A;  4OWW B;  2QIL A;  1F9P A;  1N36 Q;  4OON A;  1H9M A;  1S5F D;  3D8G A;  4DR6 L;  5CV6 A;  3S1Q H;  1PRT D;  4DUY L;  1PTO B;  3TP6 A;  3HGB A;  3JAM i;  1I6H B;  4DF7 A;  1H9J A;  1TS3 A;  4JG2 A;  1NMG A;  2RKS A;  2EYJ A;  4IQZ A;  4JBJ A;  1X56 A;  5GRO A;  3TP7 A;  3RZO B;  2D2C C;  1RKN A;  2I5L X;  1WYD A;  2PCF B;  2A73 B;  3RZD B;  2JA5 H;  2VQE L;  5KYL A;  4A3M H;  4A3I B;  1GXD C;  1H9R A;  1KDB A;  1MKH A;  4IJH A;  3HOX B;  4K5W A;  2LS0 1;  3PUW A;  4AH6 A;  1N33 Q;  1B9N A;  1EYA A;  3BDO A;  3I72 A;  1A15 A;  2NN6 G;  3J81 i;  3A8I E;  3K5M A;  4B3M L;  1MBY A;  1VQK A;  4B3R Q;  5C4J H;  3KK7 A;  1NE3 A;  1PH2 A;  3HOU G;  4EQN A;  3NQI A;  1N9W A;  2EJM A;  4X64 L;  5IP7 G;  5CV9 A;  1A2U A;  1PH7 A;  3VR4 A;  3P20 A;  1KQS A;  3HZX A;  1N33 L;  3I2Z A;  2Q8T A;  1OXV A;  2A6H C;  4IZ8 A;  4A3F H;  1AE3 A;  1W3S A;  1GUO A;  1V1P A;  2E76 C;  4XT3 B;  4F88 A;  5FJ8 G;  1N32 Q;  4EQ5 A;  1B7Y B;  1Y8O B;  1YIT A;  1FNW A;  1C48 A;  2L11 A;  1EU3 A;  3MAQ A;  1CHQ D;  5ELF A;  1HTL D;  3CC4 A;  5D65 A;  3KLR A;  1AP0 A;  1AEX A;  4JI2 Q;  2HIX A;  2KHS A;  4DFA A;  2IPK D;  4FF4 A;  2EE1 A;  2MPM A;  1FGB D;  2CVR A;  3SXH A;  2L0C A;  4DK0 A;  2UU9 Q;  2LSS A;  1L0W A;  1GM5 A;  2KED A;  1JCK B;  4WJ4 A;  4RG1 A;  3HG9 A;  1QG7 A;  3T13 A;  4DPG A;  4ALP A;  4HSP A;  1EZ6 A;  1V1O A;  1JIC A;  5J1Z A;  3BU2 A;  4OIK A;  3UE1 A;  3S17 H;  1Q1B A;  4X66 L;  5AFW A;  2ICE C;  1HQR D;  3E9H A;  4YCW A;  1B1Z A;  1EYD A;  2VZA A;  3MFG A;  3PCO B;  4CDE C;  3HOW G;  1HFG A;  4NMZ A;  4IPD A;  2UXC Q;  5KND A;  3PF5 A;  4OX9 L;  2Y0S E;  1TWA B;  1PYB A;  5M5X H;  3J81 j;  4IOC A;  1HJP A;  4IN3 A;  1YHA A;  5FLM H;  3FP9 A;  1ENA A;  4GKK L;  1RJT A;  1PTO C;  2XSC A;  5GAH C;  1Q82 C;  3W5O A;  2B8G A;  1SMX A;  2HQE A;  4EX5 A;  1BKB A;  5HGQ A;  1VQ5 A;  3OTO L;  1XX8 A;  4IUT A;  5C5L A;  4B9X A;  1QZG A;  3UE0 A;  1L1O C;  4TSS A;  5FO7 B;  4C2M B;  3J7A 5;  1NR4 A;  3SK5 A;  1D5X C;  2HHH L;  4WJ3 M;  5IOC A;  1FJG L;  3NWS A;  4IUV A;  4FVM A;  1PFS A;  2OQK A;  2KA7 A;  1JOK A;  1E7Z A;  1X3P A;  3T1Y Q;  1SNO A;  3NWT A;  2NVX H;  1Y1V H;  2F0I A;  2RHQ B;  3K0X A;  5EKL A;  1D1I A;  2EYM A;  2K05 A;  2QF7 A;  1ET6 A;  1TWF H;  3KLW A;  2CFM A;  3S15 B;  4IUR A;  5F2D A;  4ZQ3 A;  2EY2 A;  1I4R A;  3E6Z X;  1F9Q A;  3ERS X;  4NKL A;  5A35 A;  3M4O H;  3RLF A;  1V1P B;  5IP7 H;  4IAL A;  5C44 G;  4HJ5 A;  2WFW A;  4XYQ A;  3PSI A;  1QB5 D;  3M4Y A;  5JVH 3;  2PNH A;  2KHJ A;  1BQQ T;  4JK1 C;  4U68 A;  1NJI C;  1NCV A;  4H7B A;  4CHT B;  1D5M C;  1J5E L;  4ZCK A;  3SK4 A;  1NAP A;  2XGT A;  1G51 A;  5HUR A;  3I4N B;  2A69 C;  1SE3 A;  4DXF A;  4A3G H;  3H09 A;  4G4K A;  1XMO L;  5DM7 3;  4YWL A;  2UUB Q;  2NZ1 D;  4K2K A;  1GKH A;  2WV6 D;  2D0O A;  2O5I C;  4A3G B;  3U4Z A;  4LF4 Q;  3GTO B;  2N3S A;  1XPO A;  3J7Y W;  1KL9 A;  1KIX A;  1WTO A;  1A3V A;  1H9S B;  1CHP D;  1HZB A;  4MNO A;  5I4D A;  1UUP A;  4JOI C;  2JA6 H;  3H3V I;  5C3E B;  2PZT A;  2JJQ A;  4OEM B;  1MD2 D;  1PXU A;  4H44 C;  5C4X B;  3TME A;  4K8I A;  2KEC A;  4R1J A;  2YTX A;  4X62 L;  4JV5 Q;  1EZ8 A;  2H4O A;  1LTI D;  3T56 B;  1PHJ A;  3MVV A;  1VQN A;  2KHI A;  4HIK A;  4OO1 H;  3S1M B;  1KNE A;  3MXN A;  5IGG A;  1CZW A;  4LF8 L;  4DAY B;  3DLL A;  1VMP A;  1S72 A;  1A0I A;  2M00 A;  4LK1 C;  1BBW A;  4JI3 Q;  3VDY A;  4A3E G;  1ESF A;  2DGY A;  2CCZ A;  3H3V C;  4KKT A;  2IWH A;  2HUG A;  2SOB A;  3M3Y H;  3NEN A;  4K14 A;  4C3H H;  5JVG 3;  2QEX A;  4J8Q A;  1VQF A;  2IW3 A;  3VR3 A;  1IBM L;  2ZJR A;  4GN4 B;  3V96 A;  4RGT A;  5E3F A;  1TWA H;  2XNA C;  1I4P A;  1WTP A;  1F77 A;  1L0Y B;  4DK1 A;  1R4P B;  2VW9 A;  3KOJ A;  2JA8 B;  3PIO A;  2QW7 A;  3VYU A;  1SXT A;  1BVS A;  1EOV A;  3OWF A;  4P74 A;  1UE6 A;  4AYB G;  2BH2 A;  1VQG A;  2FIN B;  3K6O A;  4KJO A;  2AQ2 B;  2J0T D;  3F8T A;  5M5X B;  5M3M G;  1UEB A;  3EA6 A;  1HNW L;  2JA7 B;  4A3F B;  5K36 G;  2F0J A;  1R9T B;  1LTA D;  2OQ0 A;  3PUX A;  3I55 A;  2WII B;  3UI2 A;  5CMD A;  1VQE A;  1WFQ A;  3D3R A;  2R7Z H;  2E74 C;  1KLU D;  3SHL A;  4IJL A;  3EFX D;  3D4R A;  2F0P A;  2QA4 A;  1MJE A;  4JVZ A;  2R93 G;  1SYE A;  2O2L D;  4JOI A;  2SNS A;  1HH2 P;  3NBH A;  3S2H H;  4P71 A;  5CR3 A;  5IGB A;  1EQR A;  3QIA A;  2HT1 A;  3DEO A;  3UDX A;  4JI4 L;  5M5W H;  2XN9 C;  3W1G A;  2F0W A;  3PO2 B;  2AQ1 B;  3I70 A;  3KFU A;  1RTN A;  1S5C D;  5IGE A;  1SE2 A;  5FKA C;  4B9W A;  4HJ9 A;  1K8M A;  5ELC A;  1VQP A;  1VQ8 A;  1JB7 A;  1V8Q A;  2A1A A;  3VR2 A;  2HIV A;  4H0L C;  1Y14 B;  2BCO A;  1W6J A;  4A3J B;  4LMQ D;  2PO4 A;  5IYB H;  2ZM6 L;  3PIP 3;  3K5O A;  1KD1 C;  4IFD I;  3U9S A;  2B2T A;  2F0F A;  4DUY Q;  2R92 G;  3CU7 A;  2MNA A;  3ND8 A;  1VCI A;  3HKS A;  5C6A A;  4QL5 A;  1DYQ A;  1TS2 A;  1GOZ A;  1BF4 A;  4K5V A;  4A3M B;  3SVM A;  2CW0 D;  3S1N H;  4A3I H;  1LT6 D;  4QGU A;  1VQL A;  1STA A;  1FNV A;  1TWG H;  1SYF A;  2BE5 C;  5ISR A;  4PZ8 A;  1QVC A;  1OTC A;  4M1U B;  1CA5 A;  1G2T A;  3L3O C;  3QWN A;  2RF4 A;  1O7I A;  3K7A H;  4LFA L;  1LM0 A;  4JI8 L;  4HIM A;  1G29 1;  4A3E B;  2EZV A;  1JWM D;  3LWE A;  3M85 A;  4C3J B;  1HRJ A;  2N55 A;  5C3E H;  3GTQ B;  2K04 A;  4ZAI A;  1KTK A;  3GTL B;  3MFY A;  1ICF B;  2AUJ D;  4DNT B;  4P2C B;  4LUZ A;  3NHH A;  5AJ3 L;  4A3K G;  2L5T A;  2B29 A;  5D3I B;  1RDP D;  1GUN A;  3W2D A;  2E2I H;  4JI0 Q;  2VB2 X;  3U58 A;  1WCM H;  2PZW A;  2BH8 A;  2B2U A;  5CC4 A;  1J5E Q;  3OSO A;  4XXE A;  3FRP B;  2N78 A;  2EIF A;  2QDB A;  3KBX A;  4CGY B;  2RVL A;  3PUV A;  4G7O C;  3H91 A;  4DR7 Q;  3ER0 A;  4MHE A;  5EAY A;  2NUC A;  1LTR D;  2F0S A;  2YV5 A;  3I4O A;  1GHJ A;  1PFB A;  1VQ6 A;  3L0O A;  5EKK A;  2BA0 A;  2IX3 A;  1L1O B;  1PV4 A;  1G91 A;  3E0E A;  1E1T A;  1AW7 A;  1IZ6 A;  4N8F A;  1P16 A;  2MGS A;  4ME3 A;  3AEV A;  4IUU A;  1UE1 A;  2JA6 B;  2VQF Q;  1STE A;  1X3E A;  5C5M A;  3T1Y L;  3A54 A;  4V19 0;  1I50 B;  2K50 A;  1Q8K A;  3GV3 A;  2NVQ H;  1IKL A;  5IP9 G;  1X6O A;  3O13 A;  1GUS A;  3RD4 A;  3G4S A;  4R4T A;  2PYK A;  1CUK A;  4CJ0 B;  4X66 Q;  5C3X A;  1FVI A;  4GKJ Q;  3A55 A;  2Z6K A;  4LF8 Q;  5IE8 A;  4P73 A;  4DR4 Q;  5C0X G;  1SE8 A;  1Q86 C;  4OGQ C;  1K3R A;  5IIF A;  4GS3 A;  1LTL A;  2RSN A;  2VQF L;  3PO3 G;  4N9P A;  3I7F A;  1BBU A;  5I6Y A;  2G9H D;  3A7L A;  1KAA A;  4GKJ L;  3J80 i;  2IJ0 A;  1AH9 A;  4KHP Q;  2MUY A;  2YYZ A;  3H0G H;  4X65 Q;  2TMP A;  3BVZ A;  4H02 A;  3ONA B;  2CHB D;  2KBN A;  4L6T B;  5JPN C;  2GVA A;  3R2T A;  4B08 A;  1EFI D;  1K28 A;  1X9N A;  4MIU A;  1B9M A;  5IYD G;  1DZ1 A;  1PYS B;  1EY5 A;  4OWT B;  2JA5 G;  3VA5 A;  4KK7 A;  2K5Q A;  1JOQ A;  5M5W B;  3CCU A;  3WWV A;  2V4D A;  1UE7 A;  2R93 B;  1HR0 L;  2QDL A;  5KYI A;  2VUM H;  5FLX L;  3Q0A A;  1QCB D;  4JC0 A;  4BS9 A;  2E2J B;  1C7Y A;  2MP1 A;  4JCV E;  2L15 A;  5D14 A;  1K9M C;  3AYH B;  1EOT A;  3ERQ A;  2K4K A;  1VQC A;  2F0U A;  2IHF A;  1NR2 A;  5I2X A;  4K0K L;  3KF8 B;  4HCS A;  1EQT A;  2ASB A;  3A8J E;  4GNX B;  1XJV A;  3K59 A;  4FYD A;  3BG3 A;  4EVO A;  2UUC L;  1EFW A;  2ID0 A;  3W1B A;  3HS0 C;  3MXG A;  4C3H G;  3M4P A;  1ILP A;  3TS2 A;  2B2V A;  3D6C A;  4OHJ A;  1YJN A;  1G2S A;  1WTV A;  3HOZ G;  1T9H A;  3OPO A;  4HSV A;  2B63 B;  3FMC A;  3I4M B;  4CKE A;  5BN5 A;  3I56 A;  4IPG A;  1RIP A;  4K0K Q;  3NUC A;  4I65 A;  4ZYS A;  4Y7N B;  3K81 C;  3SDZ A;  3T4A C;  4JI2 L;  1T5E A;  4PV1 C;  3RZO H;  3CF5 A;  1PZJ D;  2NVY H;  1HNX L;  5CV7 A;  2X6L A;  5I2Y A;  4FF3 A;  1GUT A;  2K28 A;  4JI7 L;  5EPJ A;  2EOT A;  5JAV A;  3C1E A;  1G8Z D;  1W6K A;  3Q8D A;  3K5N A;  5KRU A;  3I73 A;  4YHH L;  4ME5 A;  1ASZ A;  1D1K A;  4FF1 A;  3W3A A;  3CQZ B;  3NBI A;  2YTV A;  4GOP A;  1WOC A;  3A5Z B;  5IP9 H;  2DJF C;  3HOX G;  1HNZ Q;  1SFO H;  2L1B A;  4ID6 A;  5JEA J;  2E8G A;  1VDZ A;  2N88 A;  3E9I A;  4H13 C;  4DR2 Q;  2KUM A;  1BUV T;  1NSN S;  4K2L A;  1VQA A;  4KHV A;  1SYD A;  4K6D A;  4YY3 L;  1Q90 A;  2F0H A;  1TWG B;  2KEE A;  2NN6 I;  2FHT A;  4LNQ A;  1V1Q A;  5GAE C;  1H95 A;  4MZ9 A;  2F0L A;  5KEE A;  2Q8I B;  4ULL A;  2K01 A;  2K1B A;  4JI6 Q;  1PZI D;  2MFI A;  1XNQ Q;  4FDB A;  1S5E D;  4Y7N H;  2K5V A;  1R9T H;  2Z1C A;  1EY6 A;  4WJW A;  5C4X H;  1TR5 A;  4FO2 A;  1N34 Q;  4ZUJ A;  3TZU A;  1XNR Q;  3RLO A;  3GP7 A;  4JBM A;  1A6X A;  2K5H A;  2K6A A;  1ZYR D;  3Q24 A;  2AKW B;  1S5D D;  3TBI B;  4JI6 L;  1I4X A;  3L7Z C;  1SAP A;  1BR9 A;  1PMR A;  4ABN A;  4DAP A;  3DM1 A;  3ITP A;  2J7Z A;  3S2H B;  3SE0 A;  3G71 A;  3J81 E;  2VB3 X;  1K83 H;  1PZK D;  3TRZ A;  2WAQ G;  2AWO A;  1ENF A;  1B44 D;  3A0J A;  3A7A B;  3H0G B;  3CCE A;  1U5K A;  2ZXO A;  4HAE A;  3CCJ A;  1DOL A;  4DA2 A;  2UUA L;  1YJW A;  4OEL B;  3KLS X;  1UWV A;  4KY5 A;  5ELE A;  3S14 H;  1B3A A;  4ILW A;  3HOW B;  1PH4 A;  1RF2 D;  3CC7 A;  1HR0 W;  2R92 H;  3K5L A;  1GO3 E;  3CRL C;  3NTH A;  1FR3 A;  1ILQ A;  1SJH D;  3TZD A;  4BA1 I;  1TKW B;  2F1M A;  3TS0 A;  2A69 D;  2EVB A;  5KNC A;  3HKZ E;  3F2D A;  1HNX Q;  2OTJ A;  3UDF A;  4AYB E;  4NP5 A;  2Q2U A;  3KJP A;  5G3L D;  2K5D A;  4R9W A;  3CP0 A;  4IUN A;  4CJ2 C;  2BDO A;  4JPB W;  1C8C A;  5IOD A;  1LLR D;  4A3D G;  3GO5 A;  1IW7 D;  1BXT A;  2C9O A;  3ND9 A;  4CDD C;  5LMU L;  3VA7 A;  1Y69 U;  4A93 H;  3GD7 A;  5L37 A;  1G6Z A;  2P5Z X;  1PH1 A;  2M9V A;  1CFM A;  1XYI A;  3D4D A;  2VL6 A;  3HKZ G;  1IBL Q;  2F0T A;  4BXX H;  5EGT A;  1CKN B;  1ENC A;  2F03 A;  1WTQ A;  3FEW X;  1YNN C;  3E3X A;  1IL2 A;  1PVO A;  4X62 Q;  1EEF D;  1YNJ D;  3PO3 H;  3CME A;  3MXN B;  2DUD A;  3S2D B;  2J4X A;  1ZYR C;  3KDF A;  1LTT D;  3J81 c;  1SEB D;  4QQB X;  3QOL A;  4EQP A;  3TN2 A;  1XMQ Q;  5LMN L;  2HD3 A;  1EQV A;  4IFD G;  1O7Y A;  1QZH A;  3RN2 A;  4TKO B;  4RHR A;  2KJX A;  5EBD A;  1TY0 A;  4ZKC B;  2DY7 A;  4ZUI A;  3NTK A;  1QWY A;  4NW2 A;  2A5H A;  1M4V A;  4OIJ A;  4O42 A;  1VF5 C;  2LFN A;  1STB A;  3H15 A;  1PFN A;  1GUG A;  4NDX A;  1WTW A;  1GD7 A;  5EPL A;  5LHY 1;  3KJO A;  1JE5 A;  4Q0F A;  5I9P A;  4R4I A;  5D3D A;  2Z6K C;  2WB1 B;  1CQF A;  4TRD A;  5ELN A;  1EY7 A;  4UPA A;  2F4V L;  3HOU H;  1EWC A;  1SYG A;  5C4X G;  4PMB A;  3TP5 A;  2WB1 G;  2JXM B;  1QVG A;  1QIL A;  4CDF C;  5C3E G;  4JW0 A;  4DNR B;  1NBW A;  1RCV D;  2RCN A;  1YHQ A;  2Z0S A;  5M5Y H;  1ROD A;  1IBM Q;  4DR5 Q;  2K14 A;  3OIP A;  2EXZ A;  1SMY D;  2B2T C;  1A63 A;  4RGN A;  1U4R A;  4DV7 L;  4ZLT F;  2C35 B;  3EIV A;  2QCP X;  4PZ7 A;  3HRZ C;  2EXD A;  3FPU B;  4UP7 A;  1I3Q H;  3QB3 A;  3VYR A;  1STY A;  2O5J C;  4I7Z C;  5C0X J;  1QUQ B;  1PA6 A;  3I3C A;  5LL6 X;  1JOR A;  3C1F A;  3HOY H;  4JI5 Q;  5GAG C;  5IWA Q;  1VF7 A;  4HIO A;  1IKM A;  4A3K B;  1C4Q A;  4QF4 A;  4RHS A;  1N8R C;  2JYO A;  3K80 C;  4DV1 L;  1KXL A;  1Z47 A;  4POF A;  4BY1 B;  2QGQ A;  3Q6S A;  3C3L A;  5M3M B;  4TVA B;  3GTP B;  4GLV B;  1M1K C;  3T53 B;  3PIO 3;  4PG3 A;  3S17 B;  2B2W C;  5J22 A;  5IGF A;  2N8N A;  2ZT9 C;  4YWK A;  4JI8 Q;  2NB0 A;  1FJG Q;  4E6I A;  1IXR A;  1ICW A;  2JA8 G;  2RBM A;  1T5X D;  1YHB A;  2FMC A;  1EIY B;  1D8L A;  5DEH A;  1D7Q A;  1BCP B;  2JA5 B;  2MO0 A;  3ERO A;  3R3O A;  4R4C A;  4DR1 Q;  2B8F A;  2Z9H A;  1DGS A;  3EBE A;  2R7Z B;  3SEB A;  1L2F A;  4XQN A;  1SRU A;  1BBX C;  1F2L A;  4YCV A;  3I4N G;  2AMC B;  5C0X I;  3GTM B;  1VQ9 A;  4XT1 B;  2Q2T A;  1Q46 A;  5IYC G;  4IO9 A;  3R93 A;  4RFB A;  2JA7 G;  3NQT A;  1Q12 A;  2WKD A;  2B2V C;  4CBV A;  4OL7 A;  3GTJ H;  2XWB B;  3KYH C;  3K8A A;  2F0G A;  2Y0S G;  4F8M A;  2EYL A;  3TEH B;  1TS4 A;  1E0B A;  2JN4 A;  2UXD L;  3DUZ A;  1CQV A;  2ICI A;  4KN4 C;  4DV2 Q;  4NXM L;  4PQX A;  4KD3 A;  2GVB A;  1VQM A;  2SDF A;  3WOE A;  3SR1 A;  2ATW A;  3F2U A;  2CWA A;  1DOK A;  4DV0 L;  1F9S A;  4RGM A;  3TRE A;  2PZU A;  1SBB B;  3QOJ A;  4F87 A;  3H3V H;  2RCF A;  1XMQ L;  1QE6 A;  3MHB A;  1PH3 A;  1A3T A;  2D62 A;  1TY2 A;  1ET9 A;  3LWU A;  3PGZ A;  4P75 A;  2NTT A;  1X55 A;  3RUZ A;  1YBY A;  3J7A V;  5BR8 L;  2CW0 C;  2DNC A;  1XNQ L;  1K0S A;  1Q1E A;  4R8N A;  1C0A A;  3OIQ A;  4IFD J;  1LAC A;  1IBL L;  1SYB A;  3BDC A;  3KF6 B;  4B3S Q;  5FLX E;  1CSQ A;  4LFC L;  3M3Y B;  2CQA A;  3I4N H;  1JMC A;  1Y1W G;  2KQ3 A;  4NXN L;  1LV9 A;  4KTA A;  4OX9 Q;  1K3B C;  3GV6 A;  1IHZ A;  4A3B G;  5J3B A;  4JYA L;  1TWC H;  1YZ6 A;  5CV4 A;  1VQ4 A;  3GTO H;  3F1Z A;  4UP8 A;  3CMA A;  2K5W A;  4C3I G;  4HMI A;  3PIP A;  2JA8 H;  1PRT C;  1TWC B;  4UP9 A;  3PO3 B;  2PQA A;  1PLF A;  4A3C G;  4LFC Q;  5I6W A;  4GZY C;  1PRT B;  1Z6H A;  2KCC A;  3TDQ A;  1KAW A;  1EWI A;  4A4I A;  3AFP A;  4C1N I;  3EN2 A;  1WCM B;  2ZJQ A;  4ZKB B;  1O78 A;  3OHX C;  2WKC A;  4QUC A;  1IYV A;  1TQO A;  5CBA E;  1XTC D;  3CW2 C;  1HUM A;  2R7Z G;  3G6E A;  5E4W C;  5FO9 B;  4LF7 L;  1PH8 A;  4HJA A;  3DHQ A;  4L63 B;  5M9O A;  2VNU D;  2EJF C;  3CCL A;  4X6A H;  1ONL A;  5NUC A;  5DM6 3;  4A76 A;  2A19 A;  1B3Q A;  2PMZ B;  4O2D A;  2VQE Q;  1UEA B;  3FHW A;  4JBW A;  5ELD A;  1N36 L;  4POG A;  1E1O A;  1D6E C;  2PPB C;  1Q8I A;  2LXJ A;  3OW7 A;  3D4W A;  3A56 A;  4BBS B;  1VQD A;  5I9O A;  1I50 H;  2NVQ B;  1JE4 A;  2SEB D;  1M8A A;  2B3G A;  5C4Z A;  5C3W A;  1DON A;  3MXP A;  2B2U C;  1CTM A;  4ODG A;  1PYW D;  3C2P A;  4A3D H;  1L1O A;  4X3T A;  1U0L A;  1STN A;  2H5X A;  1HUN A;  2VY3 A;  5FK9 C;  4ZRZ A;  3HOV G;  4N8X 1;  5GAD C;  1DXM A;  1O7L A;  1WJJ A;  1ZKO A;  1KLG D;  4DV5 Q;  1HR0 Q;  1RTO A;  1MSG A;  3IFT A;  3AB9 A;  4KY6 A;  3MEH A;  1EU4 A;  4X3K A;  3GTG H;  3QJY A;  1A8V A;  3M7G A;  1BO0 A;  5JEA H;  3GDE A;  2K52 A;  2AQ3 B;  1Y1W B;  4IFD H;  3HEJ A;  4C2M H;  3CKI B;  1WVL A;  2BDN A;  3CPF A;  3LX0 A;  2YU9 B;  1LUZ A;  2MHV A;  4HR7 B;  2O4X A;  2PQE A;  3D0F A;  4KV6 A;  5FOB B;  3J80 L;  4DR3 L;  1GHK A;  3IL8 A;  3RNU A;  5COR A;  1I6H H;  1CSP A;  1Y1V B;  3BZC A;  5C4H A;  1QNK A;  1EEI D;  2OXP A;  1IBK Q;  1TXY A;  4DV2 L;  2ES2 A;  4X3S A;  5KIX A;  2EYH A;  4XYO A;  1ZXT A;  5HY6 A;  4L5S A;  2F0N A;  3DXJ C;  3S16 B;  4BY7 H;  4YIJ A;  1XPR A;  1BCP F;  4HCE A;  1HNZ L;  1F2M A;  4HJ8 A;  2UXC L;  1UE5 A;  2OF1 A;  2VUM B;  1Y8N B;  3L2P A;  4Z9C B;  4BXX G;  2MQH A;  2AWN A;  4DV7 Q;  2UXB Q;  4YHH Q;  3IFD A;  4EGV A;  3AFQ A;  1SJE D;  1EL0 A;  3P1H A;  1O80 A;  5AJ3 Q;  3HP3 A;  1LT3 D;  2UU9 L;  4DR4 L;  1X32 A;  4BY7 G;  1X54 A;  1KRS A;  3DEP A;  2I07 B;  2I46 A;  1EY8 A;  3ICE A;  2F0K A;  2F3I A;  1BCP C;  2F52 A;  3GQB A;  1K8A C;  3PMF A;  4CJ1 B;  2A6E D;  5IYB G;  4DXG A;  1HZC A;  4S3S A;  2RSO A;  1EY4 A;  2IX0 A;  1RD9 D;  3F2C A;  3WOF A;  1VQB A;  4AQY L;  5TSS A;  5J39 A;  3PO2 G;  2IX1 A;  3R8B A;  2HDM A;  2A8V A;  1X3F A;  2AHO B;  3S1Q B;  1MJC A;  4L5T A;  1VMC A;  2Z4I A;  5EBC A;  5ELB A;  3GTQ H;  1MI2 A;  5JEA G;  2BE5 D;  2CH4 A;  5C44 H;  4FP5 D;  4QY7 A;  5BR8 Q;  4IUQ A;  1P8L A;  4DV6 Q;  1XXG A;  3P75 A;  2EDG A;  1KAB A;  2E75 C;  4OWX B;  2ZJP A;  5E4X A;  4J15 A;  2A6E C;  1Q81 C;  4DUZ L;  4RA8 A;  5IYC H;  2HHH Q;  4IUP A;  5G3L F;  1S4Z A;  1EUJ A;  4KD4 A;  4NXN Q;  1OXT A;  4BBR G;  2K33 A;  1Y1V G;  3E5S A;  3J7A F;  4J1M A;  3DM3 A;  5JJK A;  1CKO A;  1EY0 A;  1HPC A;  1OXX K;  2EJG C;  2WP8 J;  4LF5 L;  4XQQ A;  2F0V A;  4A3D B;  3RR5 A;  2ZXR A;  5M3F H;  1CI3 M;  5M3M H;  3G48 A;  2HCC A;  3BS1 A;  2B2Y A;  1TWH H;  1KNA A;  1YEZ A;  3P7J A;  3KF6 A;  3CD6 A;  1JB3 A;  3R2I A;  1CKN A;  1JJ2 A;  4PNY A;  1K8G A;  1MGS A;  5FLM G;  3FVQ A;  1XPU A;  4JI1 Q;  3K0Y A;  2VUM G;  1BOS A;  2FFK B;  2E2H H;  4C1N K;  2RDH A;  4A3G G;  3UDG A;  1H9S A;  1WTR A;  3NSW A;  1AN8 A;  1OXS C;  3HFZ B;  4IPH A;  2F0D A;  3PUY A;  1XMO Q;  1CT1 D;  1H9K A;  3IRB A;  3MWY W;  4DV5 L;  1IL8 A;  1E2Z A;  4JI7 Q;  4NPS A;  2YTY A;  1J8I A;  5T1G A;  2HQL A;  3CCQ A;  3GTG B;  1I6V C;  1EIG A;  1EQQ A;  1PH6 A;  4DR7 L;  3MTS A;  1JWU D;  3M9B A;  2B63 G;  4A3J G;  3GTJ B;  2EY6 A;  3S2D H;  1WI5 A;  1NMF A;  4MTN A;  2A68 C;  4HJ7 A;  1QUQ A;  1U4L A;  2ENB A;  3X3M A;  3Q22 A;  1QVF A;  4C3H B;  4C3I H;  4FNF A;  4B3S L;  1SYC A;  4QJF A;  1PTO H;  2CWP A;  2KVM A;  3RLN A;  2RQX A;  3M4O B;  3BVM A;  4FF2 A;  1WD1 A;  3H6M A;  4QIW E;  2NVY B;  1ESR A;  1FL0 A;  1OXU A;  1K73 C;  4EQO A;  3EQL C;  3BZK A;  4RGO S;  5H1S E;  3S14 B;  1ASY A;  3VYS A;  4R4Q A;  2JP1 A;  2UXD Q;  1LAB A;  1PDQ A;  2CKZ B;  3ULP A;  2PI2 E;  2NTS A;  2ZTD A;  3CCR A;  1CK1 A;  4FXK C;  2NYZ D;  3AU7 A;  3S1R B;  1D5Z C;  2WAC A;  1IYJ B;  5E7N A;  1SDF A;  4TQU S;  1I5F A;  3T1H Q;  4A75 A;  1YNN D;  1TT2 A;  1LTS D;  1STG A;  3EVQ A;  1BDO A;  1JQY D;  1KDC A;  1MHW C;  1A3U A;  1Y8P B;  4XQJ A;  2PW5 A;  3HOY G;  1Y1W H;  3N52 A;  3ZYY X;  3FKI H;  2FJ2 A;  4PMC A;  5E1F A;  1A2T A;  4AQY Q;  4DV3 L;  4GNX A;  2K5N A;  4LJZ C;  1M90 C;  5IT9 E;  4DR2 L;  4QUF A;  4A3E H;  5T1I A;  2QKI C;  4XDX A;  3CXC A;  5IYD H;  1D2B A;  4ZK9 B;  1X65 A;  4GLX A;  1PH5 A;  3PUZ A;  1FGU A;  1SN8 A;  3QO2 A;  4JI4 Q;  2EYF A;  2LMC B;  3NBH B;  4OXP A;  1II3 A;  2NBF A;  3I90 A;  1QJO A;  2DNE A;  3PQI A;  1E24 A;  5A2Q E;  4OO1 G;  1TVX A;  2K7V A;  1J9O A;  1WTX A;  2Q2H A;  3HOZ B;  2RA4 A;  4MN3 A;  3BJU A;  2TSS A;  2D5D A;  2OWO A;  3M4Q A;  4QB4 A;  3OWE B;  4DUZ Q;  4L5R C;  2HDL A;  1YNX A;  1VQJ A;  5C0X H;  1I4G A;  1KC8 C;  3IKJ A;  2F0E A;  1LT5 D;  4RCN A;  5FJ8 H;  4DN4 M;  1K0R A;  3RMH A;  3J80 c;  2Y0S B;  2A74 C;  4F7X A;  1ZEQ X;  2WAQ B;  1UAP A;  3NEL A;  3URY A;  4A3I G;  3QR8 A;  5IGD A;  3A5U A;  1PTO D;  3J81 L;  2LY7 A;  5DNF A;  1V9P A;  3AQQ A;  3K7A B;  4APV A;  4X64 Q;  3M7N A;  2NWG A;  1YIJ A;  4K8J A;  4HED A;  2JEB I;  4B3R L;  3IAY A;  4XIG S;  3J7Z C;  2KCT A;  4LWC A;  3CCS A;  2E2J H;  4KHZ A;  4G7Z C;  4KN7 C;  2PQA B;  2Q8R E;  2B2W A;  2EYO A;  4DK6 C;  5JPM C;  2OCE A;  4DU9 A;  5IT9 c;  4GOP B;  1AZQ A;  1DM0 B;  3KF8 A;  2FMM A;  2UUC Q;  4LF4 L;  3HOY B;  1FNU A;  2IHE A;  2X69 A;  4K6L A;  3H94 A;  1LTG D;  2N49 A;  5COY A;  2IT1 A;  4DR1 L;  3A8K E;  4WOR A;  4A3K H;  2NN6 H;  1Z9F A;  4I7A A;  1C9O A;  1GVP A;  2NVT B;  2MO1 A;  4YWM A;  2R7D A;  3T1H L;  3TQY A;  2Z8L A;  1HTP A;  4CKB A;  1O7Z A;  3HOZ H;  3JAM L;  1Q3L A;  1WCM G;  1S40 A;  4BY1 H;  1PH9 A;  3MZ5 A;  1SSO A;  3CRK C;  2NZO A;  4CDC C;  3GTP H;  2B63 H;  4C3I B;  5JJI A;  4LFA Q;  1N34 L;  3HOW H;  4A3M G;  3DWA A; 
#chains in the Genus database with same CATH homology
 3BYT B;  2GA4 B;  2K03 A;  4M8A A;  2AUK A;  1FD7 D;  1PTO F;  1S5B D;  1WD0 A;  5M3F B;  1HCZ A;  4KY7 A;  5CV8 A;  3NPP A;  1U4M A;  4QCL A;  3Q23 A;  2KOL A;  2E2D C;  2VXW A;  1HXY D;  4HN7 A;  1L0X B;  3TSS A;  1SNM A;  4O1N A;  2R6G A;  4RKL A;  2B2Y C;  4QIW B;  4HTH A;  1GJX A;  5CBE E;  4HMJ A;  1CA6 A;  1HQM C;  5DAU A;  4KKU A;  1PFM A;  2C5C A;  3FKI B;  1MSH A;  3PV0 A;  3X3N A;  1E2W A;  3OMC A;  1UNS A;  1JOO A;  1QOH A;  5M5Y B;  2PNR C;  2DN8 A;  3JAM E;  1B53 A;  3CHB D;  2OEO A;  1DOM A;  3T16 A;  3GTK B;  2XIW A;  4KJN A;  3TP8 A;  1K8O A;  3I8Z A;  2Z4H A;  2OT2 A;  4FXG C;  3NE5 B;  2MJ8 A;  3D31 A;  3C46 A;  1DD2 A;  1SND A;  2XVS A;  2E2I B;  2LKV A;  3BZD B;  3HOU B;  3LNN A;  4G57 A;  1LTB D;  2XRQ D;  2F0M A;  2DY8 A;  4KI0 A;  3HOV B;  2EPB A;  3MA2 B;  4R8I A;  2L9H A;  2R92 B;  2L55 A;  1SNC A;  2RDF A;  2SNM A;  1TWH B;  3BYY B;  1OO9 B;  1FYC A;  2F4I A;  2JE6 I;  3BDL A;  3MXU A;  1V43 A;  5A2Q L;  3QG1 A;  3DWQ A;  4AYB B;  3G6J B;  3I91 A;  3KBG A;  2R3Z A;  5K5P A;  1JWS D;  1BNZ A;  5EQ0 A;  1LT4 D;  1JR0 D;  3E0J A;  4XTC S;  3MC0 B;  3BVG A;  1BCP D;  3VR5 A;  5EPK A;  3G7L A;  5EKI A;  3N6R A;  1SFO B;  1STH A;  1SMY C;  1CM9 A;  1TII D;  5BN4 A;  1Z7T A;  4QMG A;  1EY9 A;  3D6W A;  1K83 B;  5LL6 S;  4OO1 I;  3K58 A;  1R4Q B;  1ML0 D;  2L4N A;  4PMW A;  1I4H A;  5JOB A;  2KCN A;  4L8J A;  5EJW A;  2F3W A;  2G9D A;  2A6H D;  2XWJ B;  2F0O A;  3DMU A;  2BA1 A;  1RHP A;  1SNP A;  3SK6 A;  4G7H C;  4KMU C;  3T51 B;  1I4Q A;  4CKC A;  3S9W A;  3FDT A;  1GUW A;  3WDN A;  5FO8 B;  2BOS A;  2IL8 A;  1JC7 A;  2D9U A;  3NP8 A;  1CZG A;  2H1E A;  4RAU C;  4RWS C;  4C3J G;  2WIN B;  4DAY A;  1TU2 B;  1TS5 A;  3I4L A;  2JSO A;  4BWG B;  2F3V A;  1PRT F;  2M2L A;  4V0B A;  5C44 B;  3K57 A;  4N9T A;  1I3Q B;  4Q5V A;  5K36 H;  3NTI A;  4RH6 A;  4UDU C;  4BY7 B;  5CYU A;  5IT9 L;  1HHV A;  2HCI A;  1IYU A;  1HFN A;  2A68 D;  2F0Q A;  3L9A X;  1KDA A;  4LAA A;  4RCO A;  1U9R A;  3OMG A;  5KGU A;  1HA5 A;  1SE4 A;  1EYC A;  3DWP A;  5JJZ A;  1B4O A;  1SNQ A;  2R61 A;  1U4P A;  3EJI A;  5KNB A;  1B2T A;  4FXD A;  2X6G A;  1X3Q A;  4C56 C;  4WRD A;  4BBR B;  3HKZ B;  1AZP A;  5BN3 A;  3VYT A;  4UAI A;  1AFP A;  4U67 3;  4KKS A;  4BA2 I;  1EIH A;  4K5X A;  2K32 A;  2L12 A;  3NK9 A;  1QNU A;  2ZXP A;  5IGC A;  3U9O A;  2PW7 A;  2NVX B;  1YNJ C;  2EY5 A;  1E2V A;  2XRS D;  1DJR D;  2EY1 A;  3AMU A;  1F2Y A;  4WFN 3;  1HA6 A;  4A3B B;  3KUP A;  3KLS A;  4RKB A;  1B50 A;  3NXW A;  1F9R A;  5CGK A;  1F2Z A;  1DCZ A;  3OOC A;  1XWE A;  3V05 A;  2E2H B;  4X3U A;  2JEA I;  3SK8 A;  2B39 A;  2RDG A;  4A93 B;  4DGZ A;  5CV5 A;  3S1N B;  5HGT A;  1IW7 C;  2EYP A;  1LO5 D;  4J6H A;  3VR6 A;  1NUC A;  4DAV A;  3FPP A;  2QEJ C;  5C4J B;  3V2T A;  3J80 E;  1TWF B;  1EWH A;  2QIL A;  1F9P A;  1H9M A;  1S5F D;  3D8G A;  5CV6 A;  1PRT D;  1PTO B;  3TP6 A;  3HGB A;  1I6H B;  4DF7 A;  1H9J A;  1TS3 A;  2RKS A;  2EYJ A;  4IQZ A;  3TP7 A;  3RZO B;  2D2C C;  1RKN A;  2PCF B;  2A73 B;  3RZD B;  5KYL A;  4A3I B;  1GXD C;  1H9R A;  1KDB A;  3HOX B;  4K5W A;  2LS0 1;  3PUW A;  1B9N A;  1EYA A;  3BDO A;  3I72 A;  1A15 A;  2NN6 G;  3A8I E;  3K5M A;  1MBY A;  3KK7 A;  4EQN A;  3NQI A;  2EJM A;  5CV9 A;  1A2U A;  3VR4 A;  3P20 A;  3HZX A;  2Q8T A;  1OXV A;  2A6H C;  4IZ8 A;  4XT3 B;  2E76 C;  1GUO A;  1V1P A;  4F88 A;  1Y8O B;  1FNW A;  1C48 A;  2L11 A;  1EU3 A;  3MAQ A;  1CHQ D;  5ELF A;  1HTL D;  5D65 A;  3KLR A;  1AP0 A;  1AEX A;  2KHS A;  4DFA A;  2IPK D;  4FF4 A;  2EE1 A;  2MPM A;  1FGB D;  2CVR A;  3SXH A;  2L0C A;  4DK0 A;  2KED A;  1JCK B;  3HG9 A;  1QG7 A;  3T13 A;  4HSP A;  1EZ6 A;  1V1O A;  1JIC A;  5J1Z A;  4OIK A;  1Q1B A;  5AFW A;  2ICE C;  1HQR D;  1B1Z A;  1EYD A;  3MFG A;  1HFG A;  4NMZ A;  5KND A;  1TWA B;  4IN3 A;  1ENA A;  1RJT A;  1PTO C;  2XSC A;  2B8G A;  2HQE A;  1XX8 A;  4IUT A;  5C5L A;  4B9X A;  4TSS A;  5FO7 B;  4C2M B;  1NR4 A;  3SK5 A;  1D5X C;  5IOC A;  3NWS A;  4IUV A;  4FVM A;  2KA7 A;  1JOK A;  1X3P A;  1SNO A;  3NWT A;  2F0I A;  5EKL A;  1D1I A;  2EYM A;  2K05 A;  2QF7 A;  1ET6 A;  3S15 B;  4IUR A;  5F2D A;  4ZQ3 A;  2EY2 A;  1I4R A;  3E6Z X;  1F9Q A;  4NKL A;  5A35 A;  3RLF A;  1V1P B;  4IAL A;  4XYQ A;  1QB5 D;  3M4Y A;  5JVH 3;  1BQQ T;  4JK1 C;  4U68 A;  1NCV A;  4H7B A;  4CHT B;  1D5M C;  3SK4 A;  1NAP A;  3I4N B;  5HUR A;  2A69 C;  1SE3 A;  4DXF A;  3H09 A;  4G4K A;  5DM7 3;  2NZ1 D;  4K2K A;  2WV6 D;  2O5I C;  4A3G B;  3GTO B;  3J7Y W;  1WTO A;  1A3V A;  1H9S B;  1CHP D;  5I4D A;  1UUP A;  5C3E B;  2PZT A;  1MD2 D;  1PXU A;  4H44 C;  5C4X B;  3TME A;  2KEC A;  4K8I A;  1EZ8 A;  2H4O A;  1LTI D;  3T56 B;  3MVV A;  4OO1 H;  3S1M B;  1KNE A;  3MXN A;  5IGG A;  1CZW A;  1VMP A;  2M00 A;  4LK1 C;  1ESF A;  3H3V C;  4KKT A;  2IWH A;  2HUG A;  2SOB A;  4K14 A;  5JVG 3;  4J8Q A;  2IW3 A;  3VR3 A;  3V96 A;  4RGT A;  5E3F A;  2XNA C;  1I4P A;  1WTP A;  1F77 A;  1L0Y B;  4DK1 A;  1R4P B;  2JA8 B;  3VYU A;  1SXT A;  3OWF A;  4KJO A;  2FIN B;  3K6O A;  2AQ2 B;  2J0T D;  5M5X B;  3EA6 A;  2JA7 B;  4A3F B;  5K36 G;  2F0J A;  1R9T B;  1LTA D;  3PUX A;  2WII B;  3UI2 A;  5CMD A;  3D3R A;  2E74 C;  1KLU D;  3SHL A;  3EFX D;  3D4R A;  2F0P A;  1SYE A;  2O2L D;  2SNS A;  3NBH A;  5CR3 A;  5IGB A;  3QIA A;  3DEO A;  2XN9 C;  2F0W A;  3PO2 B;  2AQ1 B;  3I70 A;  5IGE A;  1RTN A;  1S5C D;  1SE2 A;  5FKA C;  4B9W A;  1K8M A;  5ELC A;  1V8Q A;  3VR2 A;  4H0L C;  2BCO A;  1W6J A;  4A3J B;  4LMQ D;  2PO4 A;  3PIP 3;  3K5O A;  4IFD I;  3U9S A;  2B2T A;  2F0F A;  3CU7 A;  3ND8 A;  1VCI A;  5C6A A;  1DYQ A;  1TS2 A;  1GOZ A;  1BF4 A;  4K5V A;  4A3M B;  3SVM A;  2CW0 D;  1LT6 D;  1STA A;  1FNV A;  1SYF A;  2BE5 C;  5ISR A;  4M1U B;  1CA5 A;  1G2T A;  3L3O C;  3QWN A;  1G29 1;  4A3E B;  2EZV A;  1JWM D;  3LWE A;  3M85 A;  4C3J B;  1HRJ A;  2N55 A;  3GTQ B;  2K04 A;  4ZAI A;  1KTK A;  3GTL B;  3MFY A;  2AUJ D;  4DNT B;  4P2C B;  3NHH A;  2L5T A;  5D3I B;  1RDP D;  1GUN A;  3W2D A;  2VB2 X;  2PZW A;  2B2U A;  5CC4 A;  3OSO A;  4XXE A;  3FRP B;  2QDB A;  3KBX A;  4CGY B;  2RVL A;  3PUV A;  4G7O C;  3H91 A;  4MHE A;  2NUC A;  1LTR D;  2F0S A;  1GHJ A;  1PFB A;  5EKK A;  2BA0 A;  2IX3 A;  1G91 A;  1AW7 A;  2MGS A;  4IUU A;  2JA6 B;  1STE A;  5C5M A;  4V19 0;  3A54 A;  1I50 B;  3GV3 A;  1IKL A;  3O13 A;  1GUS A;  3RD4 A;  2PYK A;  4CJ0 B;  5C3X A;  3A55 A;  5C0X G;  4OGQ C;  5IIF A;  2RSN A;  4N9P A;  5I6Y A;  2G9H D;  3A7L A;  1KAA A;  2IJ0 A;  2MUY A;  2YYZ A;  2TMP A;  3BVZ A;  3ONA B;  2CHB D;  4L6T B;  5JPN C;  3R2T A;  4B08 A;  1EFI D;  1DZ1 A;  4MIU A;  1B9M A;  1EY5 A;  3VA5 A;  4KK7 A;  2K5Q A;  1JOQ A;  5M5W B;  2V4D A;  2R93 B;  5KYI A;  5FLX L;  3Q0A A;  1QCB D;  4BS9 A;  2E2J B;  2MP1 A;  5D14 A;  1EOT A;  3ERQ A;  2F0U A;  5I2X A;  1NR2 A;  4HCS A;  1EQT A;  3A8J E;  3K59 A;  4FYD A;  3BG3 A;  4EVO A;  2ID0 A;  4C3H G;  3HS0 C;  3MXG A;  1ILP A;  2B2V A;  3D6C A;  4OHJ A;  1G2S A;  1WTV A;  3OPO A;  4HSV A;  2B63 B;  3FMC A;  3I4M B;  4CKE A;  5BN5 A;  3NUC A;  4I65 A;  4ZYS A;  4Y7N B;  3SDZ A;  3T4A C;  1T5E A;  4PV1 C;  1PZJ D;  5CV7 A;  2X6L A;  5I2Y A;  4FF3 A;  1GUT A;  2K28 A;  5EPJ A;  2EOT A;  5JAV A;  3C1E A;  1G8Z D;  1W6K A;  3K5N A;  5KRU A;  3I73 A;  4ME5 A;  4FF1 A;  1D1K A;  3W3A A;  3CQZ B;  3NBI A;  2L1B A;  4ID6 A;  5JEA J;  1VDZ A;  2N88 A;  4H13 C;  2KUM A;  1BUV T;  1NSN S;  4K2L A;  4KHV A;  1SYD A;  4K6D A;  1Q90 A;  2F0H A;  1TWG B;  2KEE A;  2NN6 I;  2FHT A;  2F0L A;  5KEE A;  2Q8I B;  4ULL A;  2K01 A;  2K1B A;  1PZI D;  1S5E D;  2Z1C A;  1EY6 A;  4WJW A;  1TR5 A;  4FO2 A;  4ZUJ A;  3TZU A;  3GP7 A;  1A6X A;  2K6A A;  1ZYR D;  3Q24 A;  1S5D D;  3TBI B;  1I4X A;  3L7Z C;  1SAP A;  1BR9 A;  1PMR A;  4ABN A;  4DAP A;  3DM1 A;  3ITP A;  2J7Z A;  3S2H B;  3SE0 A;  3J81 E;  2VB3 X;  1PZK D;  2AWO A;  1ENF A;  1B44 D;  3A7A B;  3H0G B;  2ZXO A;  4HAE A;  1DOL A;  4DA2 A;  3KLS X;  4KY5 A;  5ELE A;  1B3A A;  4ILW A;  3HOW B;  1RF2 D;  3K5L A;  3CRL C;  3NTH A;  1FR3 A;  1ILQ A;  1SJH D;  4BA1 I;  3TZD A;  1TKW B;  2F1M A;  2A69 D;  5KNC A;  2EVB A;  4NP5 A;  5G3L D;  2K5D A;  4R9W A;  4IUN A;  4CJ2 C;  2BDO A;  1C8C A;  5IOD A;  1LLR D;  3GO5 A;  1IW7 D;  1BXT A;  2C9O A;  3ND9 A;  1Y69 U;  3VA7 A;  3GD7 A;  1G6Z A;  2M9V A;  1CFM A;  1XYI A;  3D4D A;  2F0T A;  5EGT A;  1ENC A;  2F03 A;  1WTQ A;  3FEW X;  1YNN C;  1EEF D;  1YNJ D;  3S2D B;  2J4X A;  1ZYR C;  1LTT D;  1SEB D;  3QOL A;  4EQP A;  3TN2 A;  1EQV A;  4IFD G;  1O7Y A;  4TKO B;  4RHR A;  2KJX A;  5EBD A;  1TY0 A;  4ZKC B;  2DY7 A;  4ZUI A;  3NTK A;  1QWY A;  4NW2 A;  2A5H A;  1M4V A;  4OIJ A;  4O42 A;  1VF5 C;  2LFN A;  1STB A;  1PFN A;  1GUG A;  4NDX A;  1WTW A;  5EPL A;  5LHY 1;  4Q0F A;  5I9P A;  5D3D A;  2WB1 B;  1CQF A;  4TRD A;  1EY7 A;  1EWC A;  1SYG A;  4PMB A;  3TP5 A;  2JXM B;  1QIL A;  4DNR B;  1RCV D;  1ROD A;  3OIP A;  2EXZ A;  1SMY D;  2B2T C;  4RGN A;  1U4R A;  4ZLT F;  2QCP X;  3HRZ C;  3FPU B;  3QB3 A;  3VYR A;  1STY A;  2O5J C;  4I7Z C;  5C0X J;  3I3C A;  5LL6 X;  1JOR A;  3C1F A;  1VF7 A;  1IKM A;  4A3K B;  1C4Q A;  4QF4 A;  4RHS A;  2JYO A;  1Z47 A;  4BY1 B;  3Q6S A;  3C3L A;  5M3M B;  3GTP B;  3T53 B;  3PIO 3;  3S17 B;  2B2W C;  5J22 A;  5IGF A;  2ZT9 C;  2NB0 A;  4E6I A;  1ICW A;  2RBM A;  1T5X D;  2FMC A;  5DEH A;  1BCP B;  2JA5 B;  3ERO A;  3R3O A;  2B8F A;  2R7Z B;  3SEB A;  4XQN A;  1BBX C;  1F2L A;  5C0X I;  3GTM B;  4XT1 B;  3R93 A;  4RFB A;  3NQT A;  1Q12 A;  2WKD A;  2B2V C;  4CBV A;  4OL7 A;  2XWB B;  2F0G A;  4F8M A;  2EYL A;  1TS4 A;  1E0B A;  3DUZ A;  1CQV A;  2ICI A;  4KN4 C;  4PQX A;  4KD3 A;  2SDF A;  3WOE A;  3SR1 A;  3F2U A;  1DOK A;  1F9S A;  4RGM A;  2PZU A;  1SBB B;  3QOJ A;  4F87 A;  1QE6 A;  3MHB A;  1A3T A;  2D62 A;  1TY2 A;  1ET9 A;  3LWU A;  2NTT A;  3RUZ A;  3J7A V;  2CW0 C;  2DNC A;  1Q1E A;  4R8N A;  3OIQ A;  4IFD J;  1LAC A;  1SYB A;  3BDC A;  5FLX E;  3M3Y B;  2CQA A;  2KQ3 A;  1LV9 A;  4KTA A;  3GV6 A;  1IHZ A;  5CV4 A;  2K5W A;  4C3I G;  4HMI A;  1PRT C;  1TWC B;  3PO3 B;  1PLF A;  5I6W A;  4GZY C;  1PRT B;  1Z6H A;  2KCC A;  3TDQ A;  4C1N I;  1WCM B;  4ZKB B;  1O78 A;  3OHX C;  2WKC A;  4QUC A;  1IYV A;  1TQO A;  5CBA E;  1XTC D;  1HUM A;  5E4W C;  5FO9 B;  3DHQ A;  4L63 B;  5M9O A;  2VNU D;  2EJF C;  1ONL A;  5NUC A;  5DM6 3;  2PMZ B;  1UEA B;  4JBW A;  5ELD A;  1D6E C;  2PPB C;  1Q8I A;  3OW7 A;  3D4W A;  3A56 A;  4BBS B;  5I9O A;  2NVQ B;  1JE4 A;  2SEB D;  1M8A A;  5C4Z A;  5C3W A;  1DON A;  3MXP A;  2B2U C;  1CTM A;  4ODG A;  1PYW D;  3C2P A;  4X3T A;  1STN A;  1HUN A;  5FK9 C;  4ZRZ A;  1DXM A;  1O7L A;  1ZKO A;  1KLG D;  1RTO A;  1MSG A;  3IFT A;  3AB9 A;  4KY6 A;  3MEH A;  1EU4 A;  4X3K A;  3QJY A;  3M7G A;  1BO0 A;  5JEA H;  2AQ3 B;  1Y1W B;  4IFD H;  3HEJ A;  3CKI B;  1WVL A;  2BDN A;  3LX0 A;  2YU9 B;  2MHV A;  4HR7 B;  2O4X A;  2PQE A;  4KV6 A;  5FOB B;  3J80 L;  1GHK A;  3IL8 A;  5COR A;  1Y1V B;  5C4H A;  1QNK A;  1EEI D;  2OXP A;  4X3S A;  5KIX A;  2EYH A;  4XYO A;  1ZXT A;  2F0N A;  3DXJ C;  3S16 B;  4YIJ A;  1BCP F;  4HCE A;  1F2M A;  2OF1 A;  2VUM B;  1Y8N B;  4Z9C B;  2AWN A;  3IFD A;  4EGV A;  1SJE D;  1EL0 A;  3P1H A;  1O80 A;  3HP3 A;  1LT3 D;  1X32 A;  3DEP A;  2I07 B;  2I46 A;  1EY8 A;  2F0K A;  1BCP C;  3GQB A;  3PMF A;  4CJ1 B;  2A6E D;  4DXG A;  4S3S A;  2RSO A;  1EY4 A;  2IX0 A;  1RD9 D;  3WOF A;  5TSS A;  5J39 A;  2IX1 A;  3R8B A;  2HDM A;  3S1Q B;  1VMC A;  2Z4I A;  5ELB A;  5EBC A;  1MI2 A;  5JEA G;  2BE5 D;  4FP5 D;  4IUQ A;  1XXG A;  3P75 A;  2EDG A;  1KAB A;  2E75 C;  5E4X A;  2A6E C;  4RA8 A;  4IUP A;  5G3L F;  1S4Z A;  4KD4 A;  1OXT A;  2K33 A;  3E5S A;  3J7A F;  4J1M A;  1EY0 A;  1HPC A;  1OXX K;  2EJG C;  2WP8 J;  4XQQ A;  2F0V A;  4A3D B;  2ZXR A;  1CI3 M;  2HCC A;  3BS1 A;  2B2Y A;  1KNA A;  3P7J A;  1JB3 A;  3R2I A;  4PNY A;  1MGS A;  3FVQ A;  3K0Y A;  1BOS A;  2FFK B;  4C1N K;  2RDH A;  1H9S A;  1WTR A;  3NSW A;  1AN8 A;  1OXS C;  2F0D A;  3PUY A;  1CT1 D;  1H9K A;  3MWY W;  1IL8 A;  1E2Z A;  1J8I A;  5T1G A;  3GTG B;  1I6V C;  1EIG A;  3MTS A;  1JWU D;  3GTJ B;  2EY6 A;  2A68 C;  1U4L A;  2ENB A;  3X3M A;  3Q22 A;  4C3H B;  4FNF A;  1SYC A;  1PTO H;  2KVM A;  2RQX A;  3M4O B;  3BVM A;  4FF2 A;  1WD1 A;  3H6M A;  2NVY B;  1ESR A;  1OXU A;  4EQO A;  3EQL C;  4RGO S;  3S14 B;  3VYS A;  2JP1 A;  1LAB A;  1PDQ A;  2NTS A;  1CK1 A;  4FXK C;  2NYZ D;  3AU7 A;  3S1R B;  1D5Z C;  2WAC A;  1SDF A;  4TQU S;  1YNN D;  1TT2 A;  1LTS D;  1STG A;  3EVQ A;  1BDO A;  1JQY D;  1KDC A;  1A3U A;  1Y8P B;  4XQJ A;  2PW5 A;  3N52 A;  3ZYY X;  2FJ2 A;  4PMC A;  5E1F A;  1A2T A;  4LJZ C;  5IT9 E;  4QUF A;  5T1I A;  2QKI C;  4XDX A;  1D2B A;  4ZK9 B;  3PUZ A;  3QO2 A;  2EYF A;  2LMC B;  1II3 A;  2NBF A;  3I90 A;  1QJO A;  2DNE A;  4OO1 G;  5A2Q E;  1TVX A;  2K7V A;  1J9O A;  1WTX A;  3HOZ B;  2RA4 A;  4MN3 A;  2TSS A;  2D5D A;  4QB4 A;  3OWE B;  2HDL A;  5C0X H;  1I4G A;  3IKJ A;  2F0E A;  1LT5 D;  4RCN A;  4DN4 M;  3RMH A;  2Y0S B;  2A74 C;  4F7X A;  1ZEQ X;  2WAQ B;  1UAP A;  3URY A;  5IGD A;  1PTO D;  3J81 L;  2LY7 A;  5DNF A;  3K7A B;  3M7N A;  2NWG A;  4K8J A;  4HED A;  2JEB I;  3IAY A;  4XIG S;  4KHZ A;  4G7Z C;  4KN7 C;  2Q8R E;  2B2W A;  2EYO A;  5JPM C;  4DU9 A;  1AZQ A;  1DM0 B;  3KF8 A;  2FMM A;  3HOY B;  1FNU A;  3H94 A;  2X69 A;  4K6L A;  1LTG D;  5COY A;  2IT1 A;  3A8K E;  4WOR A;  2NN6 H;  2NVT B;  2Z8L A;  1HTP A;  4CKB A;  1O7Z A;  3JAM L;  1Q3L A;  3MZ5 A;  1SSO A;  3CRK C;  4C3I B;  3DWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...