2M00A

Solution structure of staphylococcal nuclease e43s mutant in the presence of ssdna and cd2+
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPSTKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Modeling of the [E43S]SNase-ssDNA-Cd(2+) complex: Structural insight into the action of nuclease on ssDNA.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 43
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2m00A00
2PW7A 2PQEA 4KY7A 2PZWA 1JOQA 5CGKA 3D6CA 5CV5A 4NP5A 4NDXA 1STAA 2F0QA 5CV6A 2O4XA 1NUCA 2F0FA 5CV8A 1TT2A 2F0PA 1A2UA 1KAAA 1U9RA 2LKVA 4QMGA 5J39A 1STNA 5JOBA 1JOKA 1KDCA 1SYGA 2EY5A 3RUZA 5IGFA 1EYAA 4IALA 1A3UA 3T13A 3V2TA 1A3TA 1A3VA 3HEJA 4NKLA 3TP5A 4F7XA 3NK9A 2F0NA 2F0DA 4ODGA 3DHQA 2NUCA 4QF4A 1F2ZA 5F2DA 2EYOA 2RKSA 4OL7A 4ZUIA 2EYMA 1AEXA 3C1EA 1SYBA 4PMCA 5C3XA 4HMIA 5IODA 4K8IA 1EYCA 3D4WA 1II3A 1TQOA 3NUCA 5M9OA 4EQOA 1JORA 1ENCA 2F0MA 3OMCA 4J6HA 2F0VA 1EY9A 2KQ3A 4DF7A 2EYLA 3R3OA 1KABA 4KY6A 5CC4A 5ISRA 3MXPA 2EYHA 4R8NA 3VA5A 1EY7A 1EYDA 3PMFA 3TMEA 3EJIA 4EVOA 5I9OA 5KGUA 2F0IA 4K6DA 4PMBA 2SOBA 4KD3A 5C4ZA 2HQEA 1KDBA 3SR1A 5IOCA 4WORA 3TP6A 4DFAA 4KD4A 2EYJA 2M00A 3H6MA 5DEHA 3P75A 4QB4A 5KEEA 5CV4A 5KYIA 4N9TA 4TRDA 4YIJA 3T16A 4B9WA 5K5PA 1A2TA 3BDCA 4K5XA 1STGA 1JOOA 2F0SA 5I9PA 3OWFA 4J1MA 1SNCA 3SK6A 3DMUA 3MZ5A 4K2LA 2EY2A 4LAAA 5C5MA 2RBMA 4E6IA 5KRUA 4F8MA 3C1FA 3SK4A 3NP8A 5KIXA 2F3VA 4I65A 1EY6A 5JAVA 3ERQA 4B9XA 1EY0A 4HMJA 3TP8A 2KHSA 5NUCA 4ZUJA 3QOLA 1KDAA 2QDBA 4ME5A 4KHVA 5I6YA 2PZTA 2EYPA 4MIUA 1EZ6A 2OEOA 1EY8A 2F0JA 2OXPA 4KJOA 3BDLA 4RKLA 4DGZA 3NHHA 3NQTA 4S3SA 4DU9A 4KJNA 2PW5A 2ENBA 1F2YA 3D4DA 3OSOA 1SYFA 2EY1A 1SNOA 5IGGA 3MEHA 1IHZA 1ENAA 4PNYA 5I6WA 1STYA 1SYEA 3LX0A 4WRDA 4K14A 2F0UA 5J1ZA 2RDFA 3MVVA 3OMGA 1SYDA 4ZQ3A 2F0KA 1SNQA 4RKBA 4EQNA 5EGTA 1EY5A 1TR5A 1SNPA 5CV7A 5CV9A 4ID6A 5C5LA 2PZUA 1SNDA 1STBA 5EKLA 3SK5A 1STHA 5DAUA 3EROA 4IUNA 2EY6A 2WACA 2EXZA 3S9WA 3QB3A 1EQVA 4KY5A 3SXHA 5HGTA 4K8JA 4EQPA 5J22A 5CR3A 1SYCA 5C6AA 5C4HA 3ITPA 3P1HA 4K2KA 3SK8A 3D8GA 4HTHA 2SNSA 4NMZA 5E1FA 5IGBA 5KYLA 3NXWA 4H7BA 2PYKA 4KV6A 1NSNS 2SNMA 4G57A 4N9PA 3U9OA 5IGDA 2F0HA 1F2MA 4K5WA 5IGEA 3QOJA 5IIFA 4IZ8A 5IGCA 2F0LA 3MHBA 1EY4A 5E3FA 5HURA 1SNMA 2F0GA 3HZXA 2EYFA 2F0WA 3EVQA 2F0EA 3TP7A 5C3WA 2F0OA 5EKKA 3SHLA 2F3WA 4K5VA 2F0TA 4KTAA 2OF1A 1EZ8A 1RKNA 3E5SA
chains in the Genus database with same CATH superfamily
1X3QA 2XVSA 3M4PA 2KENA 4NP5A 3CRLC 2UUCL 2OTJA 5CV8A 1NJIC 3M4OB 1A2UA 1G2TA 1AW7A 4CKBA 4LFCL 4TVAB 4M1UB 4JI2L 1PMRA 3HEJA 2ZXPA 1PH1A 1IBMQ 4BA1I 3OTOQ 3HOXH 3QJYA 4OWWB 4LF7L 5LL6X 1EEFD 4C3IH 1Q1EA 1UEBA 2JYOA 3DM1A 3NWTA 4EVOA 2VZAA 1N34Q 2EZVA 4X64Q 3P7JA 1X3EA 4BXXG 2B63H 4A3KG 2I0QA 1HNXL 4A3KB 1JE4A 4JI0Q 1N32L 1LTLA 1HR0Q 2D62A 4LF4L 2NVYH 2B2WC 3DEOA 1QVGA 2PMZB 4Z9CB 3J7AF 3C1FA 2DUDA 5C0XI 4A3FG 4DAMA 2B3GA 1EUJA 4ME5A 4PV1C 1DM0B 4FF1A 1EZ6A 1MJCA 4KHZA 3BDLA 3I56A 1Q1BA 2Z4IA 4DR4Q 2N8NA 3E0JA 4GOPC 3NBHB 1I6VC 2FMMA 3S17H 1QJOA 1FJGL 1NNXA 1MJEA 1SR3A 4FF4A 3Q6SA 3K57A 1WTVA 2JE6I 2RDFA 1P8LA 3FDTA 4UY8C 2ATWA 1QB5D 1EY5A 1TWAB 3SK5A 1N36L 1FYCA 4DR5Q 5EPLA 3P20A 3SE0A 5FJ8G 4XYQA 4YY3L 4ALPA 2K4KA 3L9AX 5M5XH 2F4VL 1E1TA 1I4QA 3FHWA 3LWEA 4G57A 1YEZA 4P74A 2NVXH 4DV2L 1HXYD 3T1YL 3S1RH 3AEVA 2UUCQ 4JI4Q 3PO2G 5FLMH 3I7FA 3J81i 1AE3A 3PO2B 3KJOA 2LY7A 4K6LA 4LFCQ 4AQYL 1RIPA 2C35B 2F3WA 4A3BH 1RKNA 1XXGA 1B3QA 2UUBL 1I50H 5CV5A 1V9PA 1JJCB 1B50A 3NTKA 4LF7Q 1U9RA 5JEAG 1AH9A 5ELBA 1Q7YC 3U4ZA 4DR3L 2QGQA 4ZUIA 3J7YW 4IPCA 2EYMA 3NUCA 1N32Q 1TWGB 3TQYA 1KABA 1GUOA 1QZHA 2K03A 3U4VA 2YU9H 1K8OA 1H9SB 4OHJA 2NWGA 3PMFA 4KN7C 4KMUC 3R2TA 1O7LA 2VY3A 4TRDA 1A0IA 2N55A 4FYDA 2DJGC 5IT9L 4XT1B 5LMNW 4A3GH 3A0JA 1KAWA 5KRUA 4XIGS 4LF6L 1GD7A 1EY6A 4B08A 1EU4A 1HQRD 1HZ9A 2D2CC 4A3EH 3NSWA 4OIJA 1K3BC 1IZ6A 3G6JB 4R4CA 4KHVA 2B29A 2NB0A 3M9BA 4ZKCB 2PZTA 1CZGA 4KJOA 4RKLA 3NQTA 3HOXG 2PW5A 3M4YA 3HOXB 4POGA 5GROA 1N36Q 3AB9A 4C3IG 1VF5C 1YVCA 2HIXA 4RMFA 4UP7A 4C3IB 2VQEL 2JA8H 3BS1A 3CRKC 1WOCA 1K8AC 2XN9C 4WRDA 3HGBA 2YTYA 1YIJA 5KNBA 3EBEA 1BR9A 2MHVA 1U5KA 2A19A 3OYYA 2K75A 5IP9G 3K5LA 1GM5A 3V96A 1TWHH 4EQPA 2VW9A 4JI7Q 4LF5L 1G6PA 4AQYQ 4KV6A 3QOJA 3W1GA 4X3SA 2RQXA 1UE5A 1VQOA 4LNQA 4DV3Q 5JPMC 2HCIA 3AYHB 1F9SA 2L55A 4MNOA 1ET6A 1SDFA 4HJ8A 5M3FH 2NBFA 2UUAL 1WD0A 3GTKH 4RH6A 2ID0A 1G91A 1CTMA 4RA8A 3I72A 2OWOA 2E74C 1JB3A 1UWVA 3ZJYC 3BJUA 1Q8IA 3TP5A 4F7XA 2F0NA 1VDZA 2MO1A 4APVA 3J80L 5ELEA 5M5XB 4PMCA 3BZDB 3D4WA 4DKAC 1RTNA 5CC4A 4CDEC 3GD7A 1U4LA 3ND8A 3S1RB 1Y1VH 1HTLD 1GHJA 3RN5A 2R61A 3PUZA 1PH5A 1LT3D 3S15B 4X65L 5EJWA 5IYBH 2BCOA 4A3BG 2WP8J 4A3BB 4C2MH 1Z6HA 2JQOA 1J8IA 1KLGD 4K0KL 4UHVA 2EY2A 1CSPA 3PIP3 4V190 2PI2E 3ERQA 2VQEQ 2R93G 2R93B 2KHSA 3JAML 2OT2A 2IHFA 1OO9B 1AE2A 2X69A 3UDFA 1D5MC 4S3SA 3J81c 2A68D 1F2YA 2J4XA 3UDGA 2EY1A 5CBEE 1K9MC 2AKWB 2YU9B 2A6HC 1NAPA 1X3FA 4K14A 4YCVA 3IFDA 3PQIA 1GUGA 4XTCS 2BA0A 1D1IA 3KK7A 1KRTA 1MHWC 1VQGA 1D5XC 3FEWX 1Z7TA 2A68C 4A3GG 4JV5L 2IY5B 1B8AA 4A3GB 2LXJA 4DR7Q 1KRSA 1Y14B 5J22A 4V0BA 2VUMH 2WB1E 4JBJA 2PQAA 2FFKB 2UUAQ 2N49A 3F8TA 3D8GA 2E2DC 4A3EG 1C8CA 3CAMA 3X3MA 4A3EB 3TS2A 2Z8LA 3F2UA 3M3YH 4HAEA 1Q90A 3AFPA 5FO7B 1HCZA 1T9HA 1CKNA 1V1OA 1VQBA 3I4MG 1FD7D 1TS5A 3I4MB 3K58A 4DNRB 2JJQA 2KUMA 2A74C 4RGNA 3GTPH 4LF9L 4HJ9A 2JEBI 3SHLA 2JA8G 4KTAA 4FVMA 2JA8B 3H3VH 4IFDH 3G48A 1M4VA 1JB7A 3CQZH 3D6CA 4X62L 1BBWA 1BVSA 1A6XA 1NUCA 2O5JC 4JI5L 1Z47A 2G5DA 5IT9E 1Q12A 1QCBD 5IGFA 1AZPA 1TWHB 3K6OA 4LFAQ 1E22A 1HFGA 1JWMD 2NUCA 1LUZA 3U9OA 3PF4A 1OTCA 3NWSA 4HJAA 5IYCH 5JJKA 2B2UC 3OMCA 2CCZA 3KDFB 1KIXA 3QO2A 4HCSA 5I9OA 2SDFA 4K6DA 2SOBA 2XWBB 5JPNC 2HQEA 2E2HH 4GNXC 3KOJA 4IJHA 1VQ9A 4LMQD 1I4RA 2B2YC 4R4OA 4DPGA 2ES2A 5M3MH 3HOYH 4RAUC 1X6OA 1L0XB 1TU2B 4TSSA 1PRTB 2MUYA 2R7DA 1FL0A 4FXKC 3MAQA 1PYWD 1L0YB 3I2ZA 2HCCA 4DUZL 1XPUA 3PUVA 5ELOA 1DOMA 3TBIB 2B2TA 1W2BA 4WJ3M 4DU9A 2E5LL 3D4DA 3TREA 2RHQB 4JV5Q 2QEJC 1HFNA 1CHQD 2FJ2A 3NEMA 2E76C 1Y1VG 5I6WA 1D7QA 1Y1VB 1SYEA 4JYAL 3MVVA 4ZQ3A 2SEBD 1JICA 3MTSA 5CV7A 3KLRA 5GAGC 3AU7A 3URYA 2RHSB 1ILPA 1HNZL 3EROA 3RMHA 3PIOA 4C2MB 3S2DH 3DXJC 3KLSX 1K0SA 1A8VA 2FINB 5BN4A 5E1FA 4NB3A 2OQKA 2EE1A 1ESFA 4RGTA 3J80E 3GV3A 1GVPA 4X62Q 4HJ5A 4HSPA 4DXGA 1RHPA 1M90C 3Q22A 4JI5Q 2E75C 1XWEA 3TP7A 5FO9B 2Q2IA 3EA6A 4UPAA 3M4OH 3I91A 3VR5A 2AMCB 2XNAC 1PTOB 2RCNA 1W6JA 4IOAA 2EQSA 2L15A 1I4XA 3TRZA 4QMGA 1Y1WH 5EPJA 5JOBA 4JOIC 3RUZA 2VUMG 3V2TA 4JI3L 3L7ZC 1VMCA 2VUMB 3NK9A 4HCEA 4ODGA 1ASYA 2KCCA 3DUZA 1R9TH 1K0RA 4WJWA 4KHPL 2IW3A 5KNCA 1JQYD 3JAME 1EIHA 3E6ZX 1EY9A 3JAMi 5H1SE 4BXXH 2I07B 3M3YB 1EIGA 2LS01 3VYTA 3CCQA 2CQOA 3VA5A 3CCJA 1XNQL 3TMEA 1LTGD 4KD3A 2JA7H 1G8ZD 2AHOB 3CHBD 5DNFA 2HDMA 3SR1A 1NR4A 2M00A 4DK3C 4DUZQ 5KEEA 5CV4A 4IFDG 1VQDA 4RWSC 1M8AA 4OX9L 3CQZB 5C5MA 2E5LQ 1P16A 2RDHA 1X3PA 4O42A 2V1CC 3UDIA 1SE4A 3FVQA 1FR3A 2KA7A 4CJ2C 3MXNB 4JYAQ 5CORA 3A8IE 1B7YB 1O78A 1QNUA 2KHJA 1LT4D 1PYSB 5IYCG 3BG3A 2K1BA 1VQ5A 4Y7NB 1XPRA 1ILQA 3GTOH 1RD9D 1TWAH 1W6KA 1IYVA 4JI6Q 4FF3A 3OIQA 4MHEA 4RGMA 3OIPA 5J1ZA 4LF8Q 2E2HB 4B3RQ 1TR5A 1SNDA 2WB1G 2RSNA 4R4QA 4CDCC 5EKLA 5M3MG 2J7ZA 2WB1B 3SVMA 5M3MB 5EPKA 5IT9c 4OGQC 3U58A 4LK1C 1SYCA 4ZYSA 2A73B 4AH6A 3G4SA 5IGBA 2I46A 1KQSA 2VXWA 2RA4A 4IOCA 4K5WA 4ZRZA 1PFNA 4KK7A 1LTBD 3M7GA 5IGEA 2UXBQ 5LMNL 1A62A 4IUQA 4J8QA 3FKIH 3H3VI 3HOVH 2EYFA 2N88A 1EEID 2ZXOA 4DN4M 2GVBA 1TIID 3I4LA 2ALYB 1OXVA 2I5MX 3IKJA 3HOZB 1XMOQ 1JOQA 1GJXA 5KNDA 4KHPQ 3CCMA 1ENFA 3K81C 3CCVA 4DV7L 5J39A 1STNA 1VQMA 1TWGH 1KD1C 1XNQQ 1AFPA 4A4IA 3S2DB 4X6AH 5IGCA 2KCMA 5A35A 1B9NA 1N33L 3H3VC 2Z6KC 2K32A 2XRQD 3GTJH 4B3SL 1HPCA 2KQ3A 4OX9Q 1JCKB 2BOSA 2E8GA 2K5WA 3I70A 3EIVA 4P73A 1I94L 4QUCA 4PMBA 1S5DD 1KDBA 2RF4A 1NBWA 4U68A 2ZJPA 2NVQB 4KLKA 2UU9Q 4H13C 3SGIA 4K5XA 4G7HC 2CFMA 3C3LA 1D5ZC 1RL2A 1TVXA 2XWJB 5KIXA 4GN4B 3MFGA 1Y1WG 3TSSA 2UXDL 1Y1WB 2UXCL 4B3TQ 3HG9A 2Z1CA 3VR6A 3RN2A 1LT5D 1R9TB 1RF2D 1QG7A 3S24A 3OSOA 1KXLA 3NENA 2DY7A 4L5SA 4FF2A 1ASZA 1TWFH 1HJPA 5IP9H 2JA7G 2ZTEA 2K33A 2JA7B 1F2LA 4R1JA 3MWYW 5EGTA 2MFIA 1OXSC 1L1OA 2EXZA 2OTLA 3MA2B 1YNJD 5LMNQ 3CMAA 4C3JG 4K8JA 4C3JB 3NE5B 2N78A 2SNSA 1EFID 4XQQA 1BQQT 4H0LC 1LTAD 3QR8A 5IGDA 3PSIA 3JAMc 2WV6D 3R8BA 3VYUA 1S72A 4AYBE 5ELDA 1SE3A 3I4NH 3RNUA 1JJGA 3BYTB 1YNJC 3IAYA 1PHJA 2B2VC 2NTTA 3GTOB 4DUYQ 4QL5A 1C0AA 2RVLA 3UE1A 2D0PA 1Q3LA 2L0CA 5G3LF 1MIUA 2IX0A 3S1QH 4OONA 2F0QA 1PZKD 2F0FA 3OHXC 4LUVA 2EOTA 2PQAB 4HIKA 1F9PA 3TS0A 2ICIA 2AQ3B 3T53B 4JPBW 1EL0A 1WI5A 1B4OA 1PXUA 1S5BD 2L4NA 4POFA 4QCLA 4MZ9A 5M9OA 1JORA 1PRTF 3A8JE 4C1NI 3S15H 4JI2Q 2AWOA 3LGJA 1EY7A 2CQAA 3HOVG 2H5XA 3FKIG 3HOVB 1VQNA 3FKIB 4LWCA 1TY2A 2EYJA 5FOBB 1PYBA 4N8FA 2NTSA 3HKZE 4YIJA 5LMUL 2JN4A 2PNRC 3PUWA 2R93H 1STGA 4IUUA 3H91A 1CI3M 1LYLA 3BDOA 4YHHL 1HNXQ 1WTQA 2ICEC 5DLQE 2ZM6L 3K7UC 1XMQL 2K6AA 4IURA 1U4RA 2KVMA 4RHRA 2L12A 4LF4Q 2CKZB 4NXML 1MSGA 2OEOA 1EY8A 2OXPA 2Q8IB 3I3CA 3GTJB 2VQFL 1D1KA 4HSVA 3H94A 1SSOA 3RZDH 2F0UA 3HP3A 1EYGA 3RD4A 4A93H 4P2CB 5C5LA 3Q8DA 1DJRD 1TS4A 4IPGA 1STHA 1S3OA 5AJ3L 1HR0W 3M7NA 1FJGQ 4BBRH 4C3HG 1Q46A 4JK1C 4C3HB 4A3JG 3S1NH 1N8RC 4A3JB 1BOSA 2IPKD 1VQPA 3PV0A 4IUPA 3I4MH 5M5YB 3NXWA 2HUGA 3E9HA 5ELCA 1PTOF 2HHHL 4GKKL 1IXRA 4YY3Q 3QIAA 4BBSG 4BBSB 2F4VQ 3CC7A 2EDGA 2MPMA 2HT1A 4JBMA 1TWFB 1X55A 1KNAA 1XTCD 4DV2Q 4JC0A 2B2WA 1OXUA 2G9HD 4DV5L 3T1YQ 4DAYA 1VQ6A 2A1AA 3ERSX 4UDUC 4J15A 4HIDA 3TZDA 1NMGA 2LKVA 1HA6A 1SYGA 4JI1L 4P75A 1EYAA 3KLSA 1A3UA 1A3VA 2QEXA 5AFWA 1X3GA 2XRSD 5LL6S 4CJ0B 2UUBQ 1GUSA 1CA6A 1PH8A 1F9RA 1CK1A 1DONA 4GOPA 3RLOA 5ISRA 4GZYC 5E4WC 4DR3Q 3I4NG 1LLRD 3I4NB 1ML0D 4PG3A 4JBKA 1FNVA 1UAPA 4DFAA 2ZM6Q 3N52A 4B9WA 3BDCA 1CT1D 4GN3B 4NXMQ 5I9PA 3OWFA 4LFBL 3M85A 3S14H 1VQCA 1X54A 4LUOA 4PQXA 3VR3A 4DR2L 3J7A5 2GN5A 3S1QB 1B9MA 4DV6L 2QCPX 3SK4A 2VQFQ 5GQOA 3FPPA 3Q24A 4HMJA 4BY7G 3H0GH 4DR6L 4BY7B 1KDAA 1SJHD 2LMCB 1WVLA 4AIMA 2XSCA 4MTNA 3A7LA 4LF6Q 4DR1L 5CMDA 3CC2A 1HUNA 4O0AA 2G9DA 2BA1A 1PFBA 5T1GA 1GUTA 2JA6H 1SNQA 1VQ7A 3W5OA 1I4GA 4DK1A 2PCFB 1VQLA 1YNXA 2EY6A 4ZCKA 4GKKQ 3S9WA 3QB3A 3SXHA 3MFYA 4BY1G 1CQVA 2M2LA 4BY1B 4AYBG 4PZ8A 4OXPA 4ME3A 4AYBB 2PPBC 1F2MA 4DV5Q 1IBKL 1VQKA 4WFN3 2Q8RE 1B3AA 2NYZD 1N9WA 4IPDA 1PTOH 4LF5Q 1DCZA 2OCEA 5FLXL 4HIMA 1LTRD 2Q2UA 1VQEA 2F0OA 1VQ8A 3GQBA 3RZDB 1JJ2A 3NBHA 2PQEA 2KEEA 4JBWA 4A93G 2HIVA 4L5RC 4A93B 4TKOB 1LTSD 1KAAA 1S5FD 5EAYA 4BBRG 2OQ0A 4BBRB 4R4TA 1WD1A 3A55A 4NKLA 4LJZC 3S1NB 1DOKA 1I4HA 4R8IA 5F2DA 4BWGB 3IRBA 1IL8A 1SYBA 3CC4A 5IODA 3SDZA 3PCOB 2F0MA 1IYUA 5LHY1 5JJIA 2V4DA 4ZKBB 2I5HA 1EYDA 2K5NA 1O7YA 4DR2Q 1XPOA 3HKZG 2F0IA 4X66L 3HKZB 4A76A 5IOCA 1E3PA 4KD4A 4H02A 1YITA 3CW2C 4RHSA 1ICFB 5TSSA 3I90A 3OPOA 4DR6Q 2AUJD 4HN7A 2D5DA 4LW1A 1XX8A 2IWHA 2RSOA 4X3TA 1KNEA 2L5TA 1YBYA 2IX3A 1HZAA 4Q0FA 4DR1Q 3QWNA 4X65Q 5JEAJ 4Y7NH 1EY0A 1JWUD 5IE8A 3TP8A 3MC0B 2VL6A 1C7YA 2H1EA 3K59A 1GHKA 4K0KQ 1BUVT 4QGUA 1E2ZA 5C44H 4DGZA 3NHHA 2ZJQA 4LUZA 4YWKA 3WWVA 4QY7A 2Q2HA 1EQQA 2CVRA 4PNYA 5BN5A 2PO4A 1IL2A 2K5DA 1G2SA 5L37A 4QUFA 3AQQA 1SE2A 3NQIA 3ULPA 1IBKQ 2KECA 3RZOB 4O2DA 1GUWA 1WJJA 1X65A 3S16H 2NN6G 1DXMA 3S14B 4EGVA 2Z6BA 5KYLA 4IJLA 1K28A 1QUQA 1WTXA 2NVTB 1AZQA 1VQAA 3H0GG 1MKHA 4NPSA 3H0GB 5BN3A 4C1NK 4IZ8A 3NTIA 3HOZH 5I4DA 3W3AA 1FGUA 4PMWA 1QZGA 5GADC 3CKIB 1U0LA 2F3IA 1K8GA 2P5ZX 5JVG3 1X32A 4HR7B 4K5VA 5K36G 2K52A 4KY7A 3ULLA 2JA6G 3RLFA 2JA6B 1B44D 3M4QA 4L63B 5CV6A 3T56B 5I2XA 4WJ4A 4JCVE 5DM73 4LF9Q 1VQ4A 1RTOA 2HD3A 3T13A 2ZTDA 5G3LD 2FHTA 2WKCA 3KBXA 1BCPB 3J80i 1BO0A 4P71A 3KFUA 4XQNA 2VB3X 3BVGA 1SROA 1EYCA 2WIIB 3KBGA 1TQOA 3CCLA 2IJ0A 4DF7A 1W3SA 2NVQH 4DXFA 5KGUA 1PDQA 2ZTCA 1MD2D 4ZAIA 1PRTD 2E2IB 1FVIA 4OWXB 4QB4A 2NN6I 2F52A 5K5PA 3ICEA 2F0SA 3CMEA 1TS2A 1D8LA 3F2DA 2K01A 4X3KA 2CH4A 1OXTA 1FGBD 2F3VA 3I4OA 4JI8L 1PRTC 4I7ZC 3G7LA 4KKUA 3G71A 2QDBA 1LV9A 2CHBD 1YI2A 1U4MA 4CJ1B 1EOVA 1E2VA 1SEBD 1GUNA 2ENBA 1LTID 1ENAA 1JR0D 5CBAE 4ZK9B 4A3IH 3ZYYX 1NY4A 2KEDA 5FLXE 1J6QA 2F4IA 4C3JH 5E7NA 3DM3A 1MI2A 1YNND 4F87A 5M5WH 2WFWA 4B3ML 5J3BA 3ONAB 1EQVA 4OIKA 3ITPA 3SK8A 4NMZA 2B2UA 1XNRL 2F0HA 2FXQA 1HNZQ 1YNNC 3CP0A 5IIFA 3CU7A 3T4AC 5C44G 4XYOA 2CWAA 2GVAA 2VS1A 5C44B 4HJ7A 4GNXA 3J81L 3A56A 1TKWB 1PTOD 2B2YA 4IO9A 1EZ8A 5D3IB 3L2PA 3FMCA 4DK6C 4A3MH 4IUTA 4GLAC 2R92G 1IBML 1IKLA 2WKDA 1VMPA 2R92B 1DZ1A 2F0PA 1VQFA 4OELB 3FP9A 1ZEQX 1JOKA 1PTOC 3JC66 5JJLA 3S16B 3BZKA 2QA4A 2IT1A 1SE8A 1N34L 3GTMB 1E24A 3C1EA 3KJPA 3CCUA 1S5CD 4J6HA 2F0VA 2K50A 4JI0L 4KY6A 3GO5A 5EKIA 4KKSA 1HR0L 2XTIA 4JI3Q 4ABNA 2BH2A 3HOZG 4OO1G 1G51A 1NMFA 4WORA 4NXNL 4DAYB 4M8AA 4JI8Q 4DA2A 3P75A 1R4PB 1PH3A 5C4XH 3DEPA 3T16A 2YYZA 1A2TA 2B8FA 3K0XA 1QWYA 5FK9C 1PH2A 2I5LX 1SRUA 1Y8PB 3K7AB 4ILWA 1EFWA 3QOLA 2EYPA 2KBNA 2F0JA 3CD6A 1PVOA 4EQ5A 2WAQE 1WTOA 1TS3A 3BVZA 5ELFA 2PNHA 4IPHA 3DLLA 1LTTD 1BXTA 3GTLH 4C3HH 3OMGA 3KDFA 4A3JH 1PFMA 4G7ZC 2F1MA 1STBA 5M5YH 4P72A 5DAUA 4CGYB 4JOIA 1BDOA 2Z4HA 5IY0A 1QNKA 2BDNA 3CCEA 3AFQA 4RCNA 3H15A 2D9UA 3J80c 1LM0A 2CH4W 4JI4L 3TDQA 4BBSH 1PH9A 2PYKA 1H9KA 4JG2A 4OO1I 4FXDA 3A7AB 1SFOB 3S1MH 1RCVD 4PZ7A 3PIPA 3MHBA 1ZXTA 2F0GA 3UDXA 3HZXA 3T1HL 3MXUA 2F0EA 1B2TA 5FKAC 4FP5D 2ZJRA 4A3IG 1NTGA 4A3IB 2HDLA 3J7ZC 2PZWA 1KLUD 4GKJL 4BA2I 4NDXA 1L0WA 2YTVA 5EBCA 3PO3H 3D6WA 5M5WB 2EJGC 2Z9HA 2LXKA 3DHQA 1F2ZA 2RKSA 4NXNQ 4R9WA 1JT8A 1CQFA 2AQ2B 4DV7Q 1WCMG 1LT6D 1WCMB 5DM63 4A3FB 2X6LA 3SEBA 2EYHA 4UAIA 3E3XA 5BR8L 4UP9A 1I3QH 5C4ZA 3EQLC 3PIO3 3I55A 1N33Q 5FLXc 3F1ZA 4B3SQ 1EIYB 4N9TA 1NCVA 2RCFA 1R4QB 2JP1A 2BH8A 1I94Q 3MXGA 4A3MG 4BY7H 3A54A 4A3MB 4IN3A 3SK6A 1CSQA 4E6IA 1UE6A 4LAAA 2XGTA 4GLXA 4I65A 1UE7A 2KOLA 1CKNB 1Q8KA 3CF5A 1DOLA 2QKIC 3GTGB 1Y8OB 1SAPA 1K73C 3VR2A 1C48A 4KKTA 2UXDQ 4EX5A 5C4JH 1SYFA 3K80C 2UXCQ 2WINB 3PUYA 4OWTB 4Y52H 1CA5A 3HOWH 1STYA 4X3UA 3LX0A 1HHVA 1SMXA 3J81E 4JI7L 4DAPA 4RKBA 2N3SA 1SNPA 1T5XD 5C4XG 4IFDJ 4BY1H 1EWHA 5C4XB 4XDXA 3CCRA 2WACA 1KTKA 1IKMA 4MN3A 3T1HQ 1KL9A 1PLFA 4HTHA 4DV3L 2O2LD 2Z6KA 3HOUH 4CDFC 3D4RA 1TWCH 3VDYA 3HFZB 2PI2A 4O1NA 1Q81C 2IX1A 1G6ZA 2KJXA 3DWAA 1FNUA 3KF6A 1DD2A 5HURA 4GKJQ 3X3NA 1SNMA 2EJMA 5I2YA 2ZXRA 1JC7A 2NZOA 3MXNA 1RJTA 2B8GA 2L1BA 3EVQA 1K83H 1NE3A 5C3WA 3CPWA 1BCPF 1HUMA 2A5HA 2F0TA 3GTLB 1EWCA 3I8ZA 5HY6A 1K8MA 1BNZA 3EFXD 2MQHA 1L2FA 1STAA 1V1PA 2DNEA 3MEFA 2R7ZH 3PGZA 1DYQA 1LO5D 4L5TA 1KDCA 3OW7A 4DV1L 1QUQB 5BR8Q 5HGQA 4RG1A 1X9NA 4QF4A 2F0DA 1YJ9A 4QIWE 1IYJB 1I4PA 4H44C 4L5QA 2EPBA 4HMIA 2O5IC 2EIFA 3KLWA 2Q8TA 1KHIA 1ENCA 3V05A 1O7IA 3CPFA 3L0OA 2EYLA 1BF4A 1SMYD 4CKEA 1BBXC 3S1MB 2K04A 1K3RA 1BBUA 4ULLA 4A3DH 3K0YA 3S2HH 2ZT9C 4QJFA 3ND9A 5GAHC 2Q2TA 2TSSA 1X56A 4KN4C 1SMYC 3QG1A 2MNAA 1O80A 2B63G 1SLJA 1VQJA 2B63B 2EVBA 4A3CH 4OEMB 1IBLL 3PO3G 5JJZA 1YHQA 3PO3B 3VA7A 5LMUQ 4DK0A 2NVYB 2K28A 4C56C 2WAQG 1QVFA 2WAQB 4GLVB 2DGYA 5C0XJ 3D3RA 4XXEA 4YHHQ 2B2VA 4KJNA 1E1OA 3STBD 3GV6A 2K5VA 5A2QL 5IGGA 1XMQQ 1IHZA 3KF8A 2VNUD 3RZOH 4DR7L 1ZYRD 1Y8NB 1I3QB 1QE6A 5IWAL 2K5HA 1H9MA 2NN6H 4I7AA 2KCNA 2QF7A 1FNWA 4ID6A 1EIFA 3S17B 1MBYA 2NVTH 2A6ED 3STBC 1CHPD 1NR2A 4UP8A 4HIOA 4KY5A 5HGTA 2K5QA 2L9HA 1UE1A 1ZYRC 4YCWA 3P1HA 1Q86C 4H7BA 1RDPD 3I73A 3DWQA 3OW2A 5AJ3Q 1VQHA 2EJFC 1ZKOA 2JA9A 1EQTA 1G291 2YTXA 1XJVA 2IHEA 2A6EC 2F0LA 5E3FA 5IP7H 1S5ED 5K36H 1C4QA 2B2TC 2ASBA 2Y0SE 3CXCA 3TN2A 5C4JB 1GOZA 2F0WA 2K05A 1HZCA 3HOWG 2NVXB 4DV1Q 3HOWB 2D0OA 1C9OA 2HHHQ 1HH2P 4G4KA 2DNCA 4LFAL 1I6HH 5FLMG 2RDGA 5CGKA 1CKOA 5EQ0A 4TQUS 3A8KE 2O4XA 4DNTB 1SBBB 1CUKA 1V1QA 3TZUA 4DNIA 3J7AV 1SXTA 1I50B 4YWMA 3HOUG 3HOUB 1VS0A 2AUKA 1TWCB 2A6HD 3H09A 1GXDC 2E2IH 4EQOA 1CZWA 4JI1Q 4GNXB 1XTDA 2JA5H 2VB2X 1PH4A 1QOHA 5D14A 5ELNA 1PZJD 2R6GA 3VR4A 1IBLQ 3L3OC 1GKHA 1K83B 4FO2A 5DEHA 1JWSD 4BS9A 1CM9A 3D31A 3DMUA 2K14A 1UEAB 2R7ZG 4F8MA 2R7ZB 1LACA 1A15A 2MGSA 3KUPA 5CYUA 4ZUJA 5NUCA 3GDEA 3NBIA 1AP0A 2QILA 4LFBQ 3BU2A 3EN2A 5IWAQ 4DV6Q 2M9VA 2LFNA 3HRZC 3T51B 3Q0AA 4XQJA 5E4XA 4MTKA 3A74A 1D2BA 4A3DG 1WTRA 1DGSA 4A3DB 4CKCA 1WYDA 4KI0A 3DWPA 2B39A 2F0KA 3PF5A 3S2HB 2J0TD 5CV9A 2EXDA 1S40A 3C2PA 4A3LH 5CR3A 4A3CG 4DV0L 1I5FA 2LSSA 3FPUB 4IUVA 1PA6A 1H9JA 2SNMA 3IL8A 1Q82C 1HZBA 1V8QA 2R3ZA 2GA4B 2H4OA 2A8VA 1YHAA 4N8X1 2E2JH 1H9SA 2FMCA 2R92H 1CFMA 5EKKA 4L8JA 4CDDC 1Y69U 1B53A 5M3FG 5M3FB 2NZ1D 3HKSA 1YZ6A 3GTMH 2X6GA 3GTKB 4FDBA 3RR5A 4QIWB 2EY5A 3R93A 3Q23A 1J5EL 1A3TA 3OWEB 1ONLA 3TEHB 3ER0A 2EYOA 5C3EH 3N6RA 4OO1H 1D6EC 1OXXK 1II3A 3J81j 4F88A 3R3OA 2CWPA 1HNWL 4R8NA 4U673 1AN8A 5IP7G 1TXYA 1L1OB 3H6MA 5A2QE 2K7VA 1WTWA 3K5NA 4GN5A 1IW7D 3GP7A 2XIWA 1I6HB 3K7AH 2L11A 4X66Q 4CBVA 3K5OA 3MZ5A 4K2LA 2RBMA 1O7ZA 2CW0D 5IYBG 1F77A 3NP8A 2PMZE 1XYIA 3GTQH 4B9XA 5D65A 1PV4A 3E9IA 3WOEA 3VYSA 4JI6L 3E0EA 3IFTA 1IW7C 4G7OC 5C0XH 2KCTA 3BZCA 4LF8L 1YHBA 4B3RL 2CW0C 1SNOA 2JA5G 1J9OA 2JA5B 5IYDH 2AWNA 4XT3B 1JE5A 1V43A 3R2IA 1H9RA 2Z0SA 4DV0Q 2JK8A 3WOFA 3WDNA 3FRPB 3A5ZB 3A5UA 1F9QA 3HS0C 1PZID 2UXBL 1SFOH 2DJFC 2BE5D 5C6AA 5C4HA 3AMUA 2R7FA 1NSNS 2HQLA 3VYRA 1PH6A 1EQRA 2Y0SG 1E2WA 2Y0SB 1SJED 1S4ZA 1EY4A 1XMOL 3LNNA 1UNSA 2BE5C 2KHIA 2MO0A 4DAVA 3U9SA 4FXGC 4L6TB 4A3KH 1J5EQ 4QQBX 1HQMC 1ICWA 1JMCA 2F03A 2PW7A 3K8AA 1VCIA 1B70B 4JW0A 4DV4L 3GTPB 4A3LG 1TT2A 1BCPD 2JEAI 1HNWQ 2NZHA 3KYHC 1A63A 3UE0A 1L1OC 1WCMH 4IALA 3U50C 4A3FH 1WFQA 3BYYB 2AQ1B 2MP1A 1Z9FA 1STEA 4OL7A 1AEXA 5C3XA 3F2BA 3NPPA 3KF6B 4K8IA 1RODA 3B6YA 4YWLA 4RFBA 4ZLTF 3BVMA 1BCPC 2DN8A 3MXPA 2UU9L 1HTPA 5T1IA 4A75A 3EJIA 3PUXA 5GAEC 3NELA 1E0BA 4RGOS 3TP6A 1KC8C 2E2JB 2C5CA 1ET9A 3O13A 1VF7A 5KYIA 4B3TL 3OTOL 1V1PB 4JVZA 1CKMA 1JOOA 3GTGH 1PFSA 1EOTA 4J1MA 1SNCA 3CCSA 1M1KC 3RLNA 2TMPA 5FJ8H 2A69D 3D0FA 3OOCA 1UUPA 4X64L 5JAVA 3HOYG 1PH7A 4HEDA 3HOYB 1ESRA 1B1ZA 3UI2A 1HRJA 5C3EG 1YJNA 5I6YA 2BDOA 4CHTB 5C3EB 4MIUA 2QW7A 1TY0A 3PO2H 2A69C 2YV5A 3MEHA 4R4IA 1SN8A 1T5EA 5JVH3 1H95A 1YJWA 2DY8A 4IFDI 5COYA 1HA5A 1SYDA 4EQNA 4Q5VA 4RCOA 4DR4L 2PZUA 3G6EA 5EBDA 3K5MA 1U4PA 4FNFA 1QVCA 4IUNA 5JEAH 1LABA 3W2DA 4GOPB 1EU3A 3W1BA 4K2KA 5FO8B 4PZ6A 3ULJA 1EWIA 3GTQB 1WTHA 4N9PA 4DUYL 2C9OA 2MJ8A 3F2CA 4B3MQ 1MSHA 3C46A 4DR5L 4IQZA 5C0XG 1QILA 3NTHA 3KF8B 5D3DA 2QDLA 4DV4Q 2JSOA 4NW2A 4GS3A 4YCUA 2JXMB 1E7ZA 5IYDG 1XNRQ 1GO3E 1WTPA 3LWUA 2IL8A 1BKBA 1VQIA 1MGSA 2OF1A 3E5SA
chains in the Genus database with same CATH topology
1X3QA 2XVSA 4NP5A 3CRLC 5CV8A 3M4OB 1A2UA 1G2TA 1AW7A 4CKBA 4M1UB 1PMRA 3HEJA 2ZXPA 4BA1I 3QJYA 5LL6X 1EEFD 1Q1EA 3NWTA 2JYOA 3DM1A 4EVOA 2EZVA 3P7JA 4A3KB 1JE4A 2D62A 2B2WC 3DEOA 2PMZB 4Z9CB 3J7AF 3C1FA 5C0XI 4ME5A 4PV1C 1DM0B 4FF1A 1EZ6A 4KHZA 3BDLA 1Q1BA 2Z4IA 3E0JA 1I6VC 2FMMA 1QJOA 4FF4A 3Q6SA 3K57A 1WTVA 2JE6I 2RDFA 3FDTA 1QB5D 1EY5A 1TWAB 3SK5A 1FYCA 5EPLA 3P20A 3SE0A 4XYQA 3L9AX 1I4QA 3LWEA 4G57A 1HXYD 3PO2B 2LY7A 4K6LA 2F3WA 1RKNA 1XXGA 5CV5A 1B50A 3NTKA 1U9RA 5JEAG 5ELBA 4ZUIA 3J7YW 2EYMA 3NUCA 1TWGB 1KABA 1GUOA 2K03A 1K8OA 1H9SB 4OHJA 2NWGA 3PMFA 4KN7C 4KMUC 3R2TA 1O7LA 4TRDA 2N55A 4FYDA 5IT9L 4XT1B 5KRUA 4XIGS 1EY6A 4B08A 1EU4A 1HQRD 2D2CC 3NSWA 4OIJA 3G6JB 4KHVA 2NB0A 4ZKCB 2PZTA 1CZGA 4KJOA 4RKLA 3NQTA 2PW5A 3M4YA 3HOXB 3AB9A 4C3IG 1VF5C 4C3IB 3BS1A 3CRKC 2XN9C 4WRDA 3HGBA 5KNBA 1BR9A 2MHVA 3K5LA 3V96A 4EQPA 4KV6A 3QOJA 4X3SA 2RQXA 5JPMC 2HCIA 1F9SA 2L55A 1ET6A 1SDFA 2NBFA 1WD0A 4RH6A 2ID0A 1G91A 1CTMA 4RA8A 3I72A 2E74C 1JB3A 1Q8IA 3TP5A 4F7XA 2F0NA 1VDZA 3J80L 5ELEA 5M5XB 4PMCA 3BZDB 3D4WA 1RTNA 5CC4A 3GD7A 1U4LA 3ND8A 3S1RB 1HTLD 1GHJA 2R61A 3PUZA 1LT3D 3S15B 5EJWA 2BCOA 2WP8J 4A3BB 1Z6HA 1J8IA 1KLGD 2EY2A 3PIP3 4V190 3ERQA 2R93B 2KHSA 3JAML 2OT2A 1OO9B 2X69A 1D5MC 4S3SA 2A68D 1F2YA 2J4XA 2EY1A 5CBEE 2YU9B 2A6HC 1NAPA 4K14A 3IFDA 1GUGA 4XTCS 2BA0A 1D1IA 3KK7A 3FEWX 1D5XC 1Z7TA 2A68C 4A3GB 5J22A 4V0BA 2FFKB 3D8GA 2E2DC 1C8CA 4A3EB 3X3MA 2Z8LA 3F2UA 4HAEA 1Q90A 5FO7B 1HCZA 1V1OA 1FD7D 1TS5A 3I4MB 3K58A 4DNRB 2KUMA 2A74C 4RGNA 2JEBI 3SHLA 4KTAA 4FVMA 2JA8B 4IFDH 1M4VA 3D6CA 1A6XA 1NUCA 2O5JC 1Z47A 5IT9E 1Q12A 1QCBD 5IGFA 1AZPA 1TWHB 3K6OA 1HFGA 1JWMD 2NUCA 3U9OA 3NWSA 2B2UC 3OMCA 3QO2A 4HCSA 5I9OA 2SDFA 4K6DA 2SOBA 2XWBB 5JPNC 2HQEA 4LMQD 1I4RA 2B2YC 4RAUC 1L0XB 1TU2B 4TSSA 1PRTB 2MUYA 4FXKC 3MAQA 1PYWD 1L0YB 2HCCA 3PUVA 1DOMA 3TBIB 2B2TA 4DU9A 3D4DA 2QEJC 1HFNA 1CHQD 2FJ2A 2E76C 5I6WA 1Y1VB 1SYEA 3MVVA 4ZQ3A 2SEBD 1JICA 3MTSA 5CV7A 3KLRA 3AU7A 3URYA 1ILPA 3EROA 3RMHA 4C2MB 3DXJC 3KLSX 2FINB 5BN4A 5E1FA 2EE1A 1ESFA 4RGTA 3J80E 3GV3A 4HSPA 4DXGA 1RHPA 3Q22A 2E75C 1XWEA 3TP7A 5FO9B 3EA6A 3I91A 3VR5A 2XNAC 1PTOB 1W6JA 1I4XA 4QMGA 5EPJA 5JOBA 3RUZA 3V2TA 3L7ZC 1VMCA 2VUMB 3NK9A 4HCEA 4ODGA 2KCCA 3DUZA 4WJWA 2IW3A 5KNCA 1JQYD 3JAME 1EIHA 3E6ZX 1EY9A 2I07B 3M3YB 1EIGA 2LS01 3VYTA 3VA5A 3TMEA 1LTGD 4KD3A 1G8ZD 3CHBD 5DNFA 2HDMA 3SR1A 1NR4A 2M00A 5KEEA 5CV4A 4IFDG 4RWSC 1M8AA 3CQZB 5C5MA 2RDHA 1X3PA 4O42A 1SE4A 3FVQA 1FR3A 2KA7A 4CJ2C 5CORA 3A8IE 1O78A 1QNUA 1LT4D 3BG3A 2K1BA 4Y7NB 1ILQA 1RD9D 1W6KA 1IYVA 4FF3A 3OIQA 4MHEA 4RGMA 3OIPA 5J1ZA 2E2HB 1TR5A 1SNDA 3SVMA 2RSNA 5EKLA 2J7ZA 2WB1B 5M3MB 5EPKA 4OGQC 4LK1C 1SYCA 4ZYSA 2A73B 5IGBA 2I46A 2VXWA 2RA4A 4K5WA 4ZRZA 1PFNA 4KK7A 1LTBD 3M7GA 5IGEA 4IUQA 4J8QA 2EYFA 2N88A 1EEID 2ZXOA 4DN4M 1TIID 3I4LA 1OXVA 3IKJA 3HOZB 1JOQA 1GJXA 5KNDA 1ENFA 5J39A 1STNA 1AFPA 3S2DB 5IGCA 5A35A 1B9NA 3H3VC 2K32A 2XRQD 1HPCA 2KQ3A 1JCKB 2BOSA 2K5WA 3I70A 4QUCA 4PMBA 1S5DD 1KDBA 4U68A 2NVQB 4H13C 4K5XA 4G7HC 3C3LA 1D5ZC 1TVXA 2XWJB 5KIXA 3MFGA 3TSSA 1Y1WB 3HG9A 2Z1CA 3VR6A 1LT5D 1R9TB 1RF2D 1QG7A 3OSOA 2DY7A 4FF2A 2K33A 2JA7B 1F2LA 3MWYW 5EGTA 1OXSC 2EXZA 3MA2B 1YNJD 4C3JG 4K8JA 4C3JB 3NE5B 2SNSA 1EFID 4XQQA 1BQQT 4H0LC 1LTAD 5IGDA 2WV6D 3R8BA 3VYUA 5ELDA 1SE3A 3BYTB 1YNJC 3IAYA 2B2VC 2NTTA 3GTOB 2RVLA 1Q3LA 2L0CA 5G3LF 2IX0A 2F0QA 1PZKD 2F0FA 3OHXC 2EOTA 1F9PA 2ICIA 2AQ3B 3T53B 1EL0A 1B4OA 1PXUA 1S5BD 2L4NA 4QCLA 5M9OA 1JORA 1PRTF 3A8JE 4C1NI 2AWOA 1EY7A 2CQAA 3HOVB 3FKIB 1TY2A 2EYJA 5FOBB 2NTSA 4YIJA 2PNRC 3PUWA 1STGA 4IUUA 3H91A 1CI3M 3BDOA 1WTQA 2ICEC 2K6AA 4IURA 1U4RA 2KVMA 4RHRA 2L12A 1MSGA 2OEOA 1EY8A 2OXPA 2Q8IB 3I3CA 3GTJB 1D1KA 4HSVA 3H94A 1SSOA 2F0UA 3HP3A 3RD4A 4P2CB 5C5LA 1DJRD 1TS4A 3M7NA 1STHA 4C3HG 4JK1C 4C3HB 4A3JB 1BOSA 2IPKD 3PV0A 4IUPA 5M5YB 3NXWA 2HUGA 5ELCA 1PTOF 3QIAA 4BBSB 2EDGA 2MPMA 1TWFB 1XTCD 1KNAA 2B2WA 1OXUA 2G9HD 4DAYA 4UDUC 3TZDA 2LKVA 1HA6A 1SYGA 1EYAA 3KLSA 1A3UA 1A3VA 5AFWA 5LL6S 2XRSD 4CJ0B 1GUSA 1CA6A 1F9RA 1CK1A 1DONA 5ISRA 4GZYC 5E4WC 1LLRD 3I4NB 1ML0D 1FNVA 1UAPA 4DFAA 3N52A 4B9WA 3BDCA 1CT1D 5I9PA 3OWFA 3M85A 3S1QB 4PQXA 3VR3A 1B9MA 2QCPX 3SK4A 3FPPA 3Q24A 4HMJA 4BY7B 1KDAA 1SJHD 2LMCB 1WVLA 2XSCA 3A7LA 5CMDA 1HUNA 2G9DA 2BA1A 1PFBA 5T1GA 1GUTA 1SNQA 1I4GA 4DK1A 2PCFB 2EY6A 3S9WA 3QB3A 3SXHA 3MFYA 1CQVA 2M2LA 4BY1B 4AYBB 2PPBC 1F2MA 4WFN3 2Q8RE 1B3AA 2NYZD 1PTOH 1DCZA 5FLXL 1LTRD 2F0OA 3GQBA 3RZDB 3NBHA 2PQEA 2KEEA 4JBWA 4A93B 4TKOB 1LTSD 1KAAA 1S5FD 4BBRB 1WD1A 3A55A 4NKLA 4LJZC 3S1NB 1DOKA 1I4HA 4R8IA 5F2DA 4BWGB 1IL8A 1SYBA 5IODA 3SDZA 2F0MA 1IYUA 5LHY1 2V4DA 4ZKBB 1EYDA 1O7YA 2F0IA 3HKZB 5IOCA 4KD4A 4RHSA 5TSSA 3I90A 3OPOA 2AUJD 4HN7A 2D5DA 2IWHA 1XX8A 2RSOA 4X3TA 1KNEA 2L5TA 2IX3A 4Q0FA 3QWNA 5JEAJ 1EY0A 1JWUD 3TP8A 3MC0B 2H1EA 3K59A 1GHKA 1BUVT 1E2ZA 4DGZA 3NHHA 2CVRA 4PNYA 5BN5A 2PO4A 2K5DA 1G2SA 4QUFA 1SE2A 3NQIA 2KECA 3RZOB 1GUWA 2NN6G 1DXMA 3S14B 4EGVA 5KYLA 1WTXA 2NVTB 1AZQA 3H0GB 5BN3A 4C1NK 4IZ8A 3NTIA 5I4DA 3W3AA 4PMWA 3CKIB 5JVG3 1X32A 4HR7B 4K5VA 5K36G 4KY7A 3RLFA 2JA6B 1B44D 4L63B 5CV6A 3T56B 5I2XA 5DM73 1RTOA 3T13A 5G3LD 2FHTA 2WKCA 3KBXA 1BCPB 1BO0A 4XQNA 2VB3X 3BVGA 1EYCA 2WIIB 3KBGA 1TQOA 2IJ0A 4DF7A 4DXFA 5KGUA 1PDQA 1MD2D 4ZAIA 1PRTD 2E2IB 4QB4A 2NN6I 5K5PA 2F0SA 1TS2A 2K01A 4X3KA 1OXTA 1FGBD 2F3VA 1PRTC 4I7ZC 3G7LA 4KKUA 2QDBA 1LV9A 2CHBD 1U4MA 4CJ1B 1E2VA 1SEBD 1GUNA 2ENBA 1LTID 1ENAA 1JR0D 5CBAE 4ZK9B 3ZYYX 2KEDA 5FLXE 2F4IA 1MI2A 1YNND 4F87A 3ONAB 1EQVA 4OIKA 3ITPA 3SK8A 4NMZA 2B2UA 2F0HA 1YNNC 5IIFA 3CU7A 3T4AC 4XYOA 5C44B 3J81L 3A56A 1TKWB 1PTOD 2B2YA 1EZ8A 5D3IB 3FMCA 4IUTA 1IKLA 2WKDA 1VMPA 2R92B 1DZ1A 2F0PA 1ZEQX 1JOKA 1PTOC 3S16B 2IT1A 3GTMB 3C1EA 1S5CD 4J6HA 2F0VA 4KY6A 3GO5A 5EKIA 4KKSA 4ABNA 4OO1G 4WORA 4M8AA 4DA2A 3P75A 1R4PB 3DEPA 3T16A 2YYZA 1A2TA 2B8FA 5FK9C 1QWYA 1Y8PB 3K7AB 4ILWA 3QOLA 2EYPA 2F0JA 1WTOA 1TS3A 3BVZA 5ELFA 1LTTD 1BXTA 3OMGA 1PFMA 4G7ZC 2F1MA 1STBA 5DAUA 4CGYB 1BDOA 2Z4HA 1QNKA 2BDNA 4RCNA 2D9UA 3TDQA 2PYKA 1H9KA 4OO1I 4FXDA 3A7AB 1SFOB 1RCVD 3MHBA 1ZXTA 2F0GA 3HZXA 3MXUA 2F0EA 1B2TA 5FKAC 4FP5D 4A3IB 2HDLA 2PZWA 1KLUD 4BA2I 4NDXA 5EBCA 3D6WA 5M5WB 2EJGC 3DHQA 1F2ZA 2RKSA 4R9WA 1CQFA 2AQ2B 1LT6D 1WCMB 5DM63 4A3FB 2X6LA 3SEBA 2EYHA 4UAIA 5C4ZA 3EQLC 3PIO3 4N9TA 1NCVA 1R4QB 2JP1A 3MXGA 3A54A 4A3MB 4IN3A 3SK6A 4E6IA 4LAAA 4I65A 2KOLA 1DOLA 2QKIC 3GTGB 1Y8OB 1SAPA 3VR2A 1C48A 4KKTA 1SYFA 2WINB 3PUYA 1CA5A 1STYA 4X3UA 3LX0A 1HHVA 3J81E 4DAPA 4RKBA 1SNPA 1T5XD 4IFDJ 1EWHA 5C4XB 4XDXA 2WACA 1KTKA 1IKMA 4MN3A 1PLFA 4HTHA 2O2LD 3D4RA 4O1NA 2IX1A 1G6ZA 2KJXA 3DWAA 1FNUA 1DD2A 5HURA 3X3NA 1SNMA 2EJMA 5I2YA 2ZXRA 1JC7A 3MXNA 1RJTA 2B8GA 2L1BA 3EVQA 5C3WA 1BCPF 1HUMA 2A5HA 2F0TA 3GTLB 1EWCA 3I8ZA 1BNZA 1K8MA 3EFXD 1STAA 1V1PA 2DNEA 1DYQA 1LO5D 1KDCA 3OW7A 4QF4A 2F0DA 1I4PA 4H44C 2EPBA 4HMIA 2O5IC 2Q8TA 1ENCA 3V05A 1BF4A 2EYLA 1SMYD 4CKEA 1BBXC 3S1MB 2K04A 4ULLA 3K0YA 2ZT9C 3ND9A 2TSSA 4KN4C 1SMYC 3QG1A 1O80A 2B63B 2EVBA 5JJZA 3PO3B 3VA7A 4DK0A 2NVYB 2K28A 4C56C 2WAQB 5C0XJ 3D3RA 4XXEA 2B2VA 4KJNA 3GV6A 5A2QL 5IGGA 1IHZA 3KF8A 2VNUD 1ZYRD 1Y8NB 1I3QB 1QE6A 1H9MA 2NN6H 2KCNA 2QF7A 1FNWA 4ID6A 3S17B 1MBYA 2A6ED 1CHPD 1NR2A 4KY5A 5HGTA 2K5QA 2L9HA 1ZYRC 3P1HA 4H7BA 1RDPD 3I73A 3DWQA 2EJFC 1ZKOA 1EQTA 1G291 2A6EC 2F0LA 5E3FA 5K36H 1S5ED 1C4QA 2B2TC 3TN2A 5C4JB 1GOZA 2F0WA 2K05A 2NVXB 3HOWB 4G4KA 2DNCA 2RDGA 5CGKA 5EQ0A 4TQUS 3A8KE 2O4XA 4DNTB 1SBBB 3TZUA 3J7AV 1SXTA 1I50B 3HOUB 2AUKA 1TWCB 2A6HD 3H09A 1GXDC 4EQOA 1CZWA 2VB2X 1QOHA 5D14A 1PZJD 2R6GA 3VR4A 3L3OC 1K83B 4FO2A 5DEHA 1JWSD 4BS9A 1CM9A 3D31A 3DMUA 1UEAB 4F8MA 2R7ZB 1LACA 1A15A 2MGSA 3KUPA 5CYUA 4ZUJA 5NUCA 3NBIA 1AP0A 2QILA 2M9VA 2LFNA 3HRZC 3T51B 3Q0AA 4XQJA 5E4XA 1D2BA 1WTRA 4A3DB 4CKCA 4KI0A 3DWPA 2B39A 2F0KA 3S2HB 2J0TD 5CV9A 3C2PA 5CR3A 3FPUB 4IUVA 1H9JA 2SNMA 3IL8A 1V8QA 2R3ZA 2GA4B 2H4OA 1H9SA 2FMCA 1CFMA 5EKKA 4L8JA 1Y69U 1B53A 5M3FB 2NZ1D 3GTKB 2X6GA 4QIWB 2EY5A 3R93A 3Q23A 1A3TA 3OWEB 1ONLA 2EYOA 3N6RA 4OO1H 1D6EC 1OXXK 1II3A 4F88A 3R3OA 4R8NA 4U673 1AN8A 3H6MA 5A2QE 2K7VA 1WTWA 3K5NA 1IW7D 3GP7A 2XIWA 1I6HB 2L11A 4CBVA 3K5OA 3MZ5A 4K2LA 2RBMA 1O7ZA 2CW0D 1F77A 3NP8A 1XYIA 4B9XA 5D65A 3WOEA 3VYSA 3IFTA 1IW7C 4G7OC 5C0XH 2CW0C 1SNOA 1J9OA 2JA5B 2AWNA 4XT3B 1V43A 3R2IA 1H9RA 3WOFA 3WDNA 3FRPB 1F9QA 3HS0C 1PZID 2BE5D 5C6AA 5C4HA 3AMUA 1NSNS 3VYRA 1E2WA 2Y0SB 1SJED 1S4ZA 1EY4A 3LNNA 1UNSA 2BE5C 4DAVA 3U9SA 4FXGC 4L6TB 1HQMC 1ICWA 2F03A 2PW7A 1VCIA 3GTPB 1TT2A 1BCPD 2JEAI 4IALA 3BYYB 2AQ1B 2MP1A 1STEA 4OL7A 1AEXA 5C3XA 3NPPA 4K8IA 1RODA 4RFBA 4ZLTF 3BVMA 1BCPC 2DN8A 3MXPA 1HTPA 5T1IA 3EJIA 3PUXA 1E0BA 4RGOS 3TP6A 2E2JB 2C5CA 1ET9A 3O13A 1VF7A 5KYIA 1V1PB 1JOOA 1EOTA 4J1MA 1SNCA 2TMPA 2A69D 3OOCA 1UUPA 5JAVA 4HEDA 3HOYB 1ESRA 1B1ZA 3UI2A 1HRJA 5I6YA 2BDOA 4CHTB 5C3EB 4MIUA 1TY0A 2A69C 3MEHA 5JVH3 1T5EA 2DY8A 4IFDI 5COYA 1HA5A 1SYDA 4EQNA 4Q5VA 4RCOA 2PZUA 5EBDA 3K5MA 1U4PA 4FNFA 4IUNA 5JEAH 1LABA 3W2DA 1EU3A 4K2KA 5FO8B 3GTQB 4N9PA 2C9OA 2MJ8A 1MSHA 3C46A 4IQZA 5C0XG 1QILA 3NTHA 5D3DA 2JSOA 4NW2A 2JXMB 1WTPA 3LWUA 2IL8A 1MGSA 2OF1A 3E5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PW7 A;  2PQE A;  4KY7 A;  2PZW A;  1JOQ A;  5CGK A;  3D6C A;  5CV5 A;  4NP5 A;  4NDX A;  1STA A;  2F0Q A;  5CV6 A;  2O4X A;  1NUC A;  2F0F A;  5CV8 A;  1TT2 A;  2F0P A;  1A2U A;  1KAA A;  1U9R A;  2LKV A;  4QMG A;  5J39 A;  1STN A;  5JOB A;  1JOK A;  1KDC A;  1SYG A;  2EY5 A;  3RUZ A;  5IGF A;  1EYA A;  4IAL A;  1A3U A;  3T13 A;  3V2T A;  1A3T A;  1A3V A;  3HEJ A;  4NKL A;  3TP5 A;  4F7X A;  3NK9 A;  2F0N A;  2F0D A;  4ODG A;  3DHQ A;  2NUC A;  4QF4 A;  1F2Z A;  5F2D A;  2EYO A;  2RKS A;  4OL7 A;  4ZUI A;  2EYM A;  1AEX A;  3C1E A;  1SYB A;  4PMC A;  5C3X A;  4HMI A;  5IOD A;  4K8I A;  1EYC A;  3D4W A;  1II3 A;  1TQO A;  3NUC A;  5M9O A;  4EQO A;  1JOR A;  1ENC A;  2F0M A;  3OMC A;  4J6H A;  2F0V A;  1EY9 A;  2KQ3 A;  4DF7 A;  2EYL A;  3R3O A;  1KAB A;  4KY6 A;  5CC4 A;  5ISR A;  3MXP A;  2EYH A;  4R8N A;  3VA5 A;  1EY7 A;  1EYD A;  3PMF A;  3TME A;  3EJI A;  4EVO A;  5I9O A;  5KGU A;  2F0I A;  4K6D A;  4PMB A;  2SOB A;  4KD3 A;  5C4Z A;  2HQE A;  1KDB A;  3SR1 A;  5IOC A;  4WOR A;  3TP6 A;  4DFA A;  4KD4 A;  2EYJ A;  2M00 A;  3H6M A;  5DEH A;  3P75 A;  4QB4 A;  5KEE A;  5CV4 A;  5KYI A;  4N9T A;  4TRD A;  4YIJ A;  3T16 A;  4B9W A;  5K5P A;  1A2T A;  3BDC A;  4K5X A;  1STG A;  1JOO A;  2F0S A;  5I9P A;  3OWF A;  4J1M A;  1SNC A;  3SK6 A;  3DMU A;  3MZ5 A;  4K2L A;  2EY2 A;  4LAA A;  5C5M A;  2RBM A;  4E6I A;  5KRU A;  4F8M A;  3C1F A;  3SK4 A;  3NP8 A;  5KIX A;  2F3V A;  4I65 A;  1EY6 A;  5JAV A;  3ERQ A;  4B9X A;  1EY0 A;  4HMJ A;  3TP8 A;  2KHS A;  5NUC A;  4ZUJ A;  3QOL A;  1KDA A;  2QDB A;  4ME5 A;  4KHV A;  5I6Y A;  2PZT A;  2EYP A;  4MIU A;  1EZ6 A;  2OEO A;  1EY8 A;  2F0J A;  2OXP A;  4KJO A;  3BDL A;  4RKL A;  4DGZ A;  3NHH A;  3NQT A;  4S3S A;  4DU9 A;  4KJN A;  2PW5 A;  2ENB A;  1F2Y A;  3D4D A;  3OSO A;  1SYF A;  2EY1 A;  1SNO A;  5IGG A;  3MEH A;  1IHZ A;  1ENA A;  4PNY A;  5I6W A;  1STY A;  1SYE A;  3LX0 A;  4WRD A;  4K14 A;  2F0U A;  5J1Z A;  2RDF A;  3MVV A;  3OMG A;  1SYD A;  4ZQ3 A;  2F0K A;  1SNQ A;  4RKB A;  4EQN A;  5EGT A;  1EY5 A;  1TR5 A;  1SNP A;  5CV7 A;  5CV9 A;  4ID6 A;  5C5L A;  2PZU A;  1SND A;  1STB A;  5EKL A;  3SK5 A;  1STH A;  5DAU A;  3ERO A;  4IUN A;  2EY6 A;  2WAC A;  2EXZ A;  3S9W A;  3QB3 A;  1EQV A;  4KY5 A;  3SXH A;  5HGT A;  4K8J A;  4EQP A;  5J22 A;  5CR3 A;  1SYC A;  5C6A A;  5C4H A;  3ITP A;  3P1H A;  4K2K A;  3SK8 A;  3D8G A;  4HTH A;  2SNS A;  4NMZ A;  5E1F A;  5IGB A;  5KYL A;  3NXW A;  4H7B A;  2PYK A;  4KV6 A;  1NSN S;  2SNM A;  4G57 A;  4N9P A;  3U9O A;  5IGD A;  2F0H A;  1F2M A;  4K5W A;  5IGE A;  3QOJ A;  5IIF A;  4IZ8 A;  5IGC A;  2F0L A;  3MHB A;  1EY4 A;  5E3F A;  5HUR A;  1SNM A;  2F0G A;  3HZX A;  2EYF A;  2F0W A;  3EVQ A;  2F0E A;  3TP7 A;  5C3W A;  2F0O A;  5EKK A;  3SHL A;  2F3W A;  4K5V A;  2F0T A;  4KTA A;  2OF1 A;  1EZ8 A;  1RKN A;  3E5S A; 
#chains in the Genus database with same CATH topology
 1X3Q A;  2XVS A;  3M4P A;  2KEN A;  4NP5 A;  3CRL C;  2UUC L;  2OTJ A;  5CV8 A;  1NJI C;  3M4O B;  1A2U A;  1G2T A;  1AW7 A;  4CKB A;  4LFC L;  4TVA B;  4M1U B;  4JI2 L;  1PMR A;  3HEJ A;  2ZXP A;  1PH1 A;  1IBM Q;  4BA1 I;  3OTO Q;  3HOX H;  3QJY A;  4OWW B;  4LF7 L;  5LL6 X;  1EEF D;  4C3I H;  1Q1E A;  1UEB A;  2JYO A;  3DM1 A;  3NWT A;  4EVO A;  2VZA A;  1N34 Q;  2EZV A;  4X64 Q;  3P7J A;  1X3E A;  4BXX G;  2B63 H;  4A3K G;  2I0Q A;  1HNX L;  4A3K B;  1JE4 A;  4JI0 Q;  1N32 L;  1LTL A;  1HR0 Q;  2D62 A;  4LF4 L;  2NVY H;  2B2W C;  3DEO A;  1QVG A;  2PMZ B;  4Z9C B;  3J7A F;  3C1F A;  2DUD A;  5C0X I;  4A3F G;  4DAM A;  2B3G A;  1EUJ A;  4ME5 A;  4PV1 C;  1DM0 B;  4FF1 A;  1EZ6 A;  1MJC A;  4KHZ A;  3BDL A;  3I56 A;  1Q1B A;  2Z4I A;  4DR4 Q;  2N8N A;  3E0J A;  4GOP C;  3NBH B;  1I6V C;  2FMM A;  3S17 H;  1QJO A;  1FJG L;  1NNX A;  1MJE A;  1SR3 A;  4FF4 A;  3Q6S A;  3K57 A;  1WTV A;  2JE6 I;  2RDF A;  1P8L A;  3FDT A;  4UY8 C;  2ATW A;  1QB5 D;  1EY5 A;  1TWA B;  3SK5 A;  1N36 L;  1FYC A;  4DR5 Q;  5EPL A;  3P20 A;  3SE0 A;  5FJ8 G;  4XYQ A;  4YY3 L;  4ALP A;  2K4K A;  3L9A X;  5M5X H;  2F4V L;  1E1T A;  1I4Q A;  3FHW A;  3LWE A;  4G57 A;  1YEZ A;  4P74 A;  2NVX H;  4DV2 L;  1HXY D;  3T1Y L;  3S1R H;  3AEV A;  2UUC Q;  4JI4 Q;  3PO2 G;  5FLM H;  3I7F A;  3J81 i;  1AE3 A;  3PO2 B;  3KJO A;  2LY7 A;  4K6L A;  4LFC Q;  4AQY L;  1RIP A;  2C35 B;  2F3W A;  4A3B H;  1RKN A;  1XXG A;  1B3Q A;  2UUB L;  1I50 H;  5CV5 A;  1V9P A;  1JJC B;  1B50 A;  3NTK A;  4LF7 Q;  1U9R A;  5JEA G;  1AH9 A;  5ELB A;  1Q7Y C;  3U4Z A;  4DR3 L;  2QGQ A;  4ZUI A;  3J7Y W;  4IPC A;  2EYM A;  3NUC A;  1N32 Q;  1TWG B;  3TQY A;  1KAB A;  1GUO A;  1QZH A;  2K03 A;  3U4V A;  2YU9 H;  1K8O A;  1H9S B;  4OHJ A;  2NWG A;  3PMF A;  4KN7 C;  4KMU C;  3R2T A;  1O7L A;  2VY3 A;  4TRD A;  1A0I A;  2N55 A;  4FYD A;  2DJG C;  5IT9 L;  4XT1 B;  5LMN W;  4A3G H;  3A0J A;  1KAW A;  5KRU A;  4XIG S;  4LF6 L;  1GD7 A;  1EY6 A;  4B08 A;  1EU4 A;  1HQR D;  1HZ9 A;  2D2C C;  4A3E H;  3NSW A;  4OIJ A;  1K3B C;  1IZ6 A;  3G6J B;  4R4C A;  4KHV A;  2B29 A;  2NB0 A;  3M9B A;  4ZKC B;  2PZT A;  1CZG A;  4KJO A;  4RKL A;  3NQT A;  3HOX G;  2PW5 A;  3M4Y A;  3HOX B;  4POG A;  5GRO A;  1N36 Q;  3AB9 A;  4C3I G;  1VF5 C;  1YVC A;  2HIX A;  4RMF A;  4UP7 A;  4C3I B;  2VQE L;  2JA8 H;  3BS1 A;  3CRK C;  1WOC A;  1K8A C;  2XN9 C;  4WRD A;  3HGB A;  2YTY A;  1YIJ A;  5KNB A;  3EBE A;  1BR9 A;  2MHV A;  1U5K A;  2A19 A;  3OYY A;  2K75 A;  5IP9 G;  3K5L A;  1GM5 A;  3V96 A;  1TWH H;  4EQP A;  2VW9 A;  4JI7 Q;  4LF5 L;  1G6P A;  4AQY Q;  4KV6 A;  3QOJ A;  3W1G A;  4X3S A;  2RQX A;  1UE5 A;  1VQO A;  4LNQ A;  4DV3 Q;  5JPM C;  2HCI A;  3AYH B;  1F9S A;  2L55 A;  4MNO A;  1ET6 A;  1SDF A;  4HJ8 A;  5M3F H;  2NBF A;  2UUA L;  1WD0 A;  3GTK H;  4RH6 A;  2ID0 A;  1G91 A;  1CTM A;  4RA8 A;  3I72 A;  2OWO A;  2E74 C;  1JB3 A;  1UWV A;  3ZJY C;  3BJU A;  1Q8I A;  3TP5 A;  4F7X A;  2F0N A;  1VDZ A;  2MO1 A;  4APV A;  3J80 L;  5ELE A;  5M5X B;  4PMC A;  3BZD B;  3D4W A;  4DKA C;  1RTN A;  5CC4 A;  4CDE C;  3GD7 A;  1U4L A;  3ND8 A;  3S1R B;  1Y1V H;  1HTL D;  1GHJ A;  3RN5 A;  2R61 A;  3PUZ A;  1PH5 A;  1LT3 D;  3S15 B;  4X65 L;  5EJW A;  5IYB H;  2BCO A;  4A3B G;  2WP8 J;  4A3B B;  4C2M H;  1Z6H A;  2JQO A;  1J8I A;  1KLG D;  4K0K L;  4UHV A;  2EY2 A;  1CSP A;  3PIP 3;  4V19 0;  2PI2 E;  3ERQ A;  2VQE Q;  2R93 G;  2R93 B;  2KHS A;  3JAM L;  2OT2 A;  2IHF A;  1OO9 B;  1AE2 A;  2X69 A;  3UDF A;  1D5M C;  4S3S A;  3J81 c;  2A68 D;  1F2Y A;  2J4X A;  3UDG A;  2EY1 A;  5CBE E;  1K9M C;  2AKW B;  2YU9 B;  2A6H C;  1NAP A;  1X3F A;  4K14 A;  4YCV A;  3IFD A;  3PQI A;  1GUG A;  4XTC S;  2BA0 A;  1D1I A;  3KK7 A;  1KRT A;  1MHW C;  1VQG A;  1D5X C;  3FEW X;  1Z7T A;  2A68 C;  4A3G G;  4JV5 L;  2IY5 B;  1B8A A;  4A3G B;  2LXJ A;  4DR7 Q;  1KRS A;  1Y14 B;  5J22 A;  4V0B A;  2VUM H;  2WB1 E;  4JBJ A;  2PQA A;  2FFK B;  2UUA Q;  2N49 A;  3F8T A;  3D8G A;  2E2D C;  4A3E G;  1C8C A;  3CAM A;  3X3M A;  4A3E B;  3TS2 A;  2Z8L A;  3F2U A;  3M3Y H;  4HAE A;  1Q90 A;  3AFP A;  5FO7 B;  1HCZ A;  1T9H A;  1CKN A;  1V1O A;  1VQB A;  3I4M G;  1FD7 D;  1TS5 A;  3I4M B;  3K58 A;  4DNR B;  2JJQ A;  2KUM A;  2A74 C;  4RGN A;  3GTP H;  4LF9 L;  4HJ9 A;  2JEB I;  3SHL A;  2JA8 G;  4KTA A;  4FVM A;  2JA8 B;  3H3V H;  4IFD H;  3G48 A;  1M4V A;  1JB7 A;  3CQZ H;  3D6C A;  4X62 L;  1BBW A;  1BVS A;  1A6X A;  1NUC A;  2O5J C;  4JI5 L;  1Z47 A;  2G5D A;  5IT9 E;  1Q12 A;  1QCB D;  5IGF A;  1AZP A;  1TWH B;  3K6O A;  4LFA Q;  1E22 A;  1HFG A;  1JWM D;  2NUC A;  1LUZ A;  3U9O A;  3PF4 A;  1OTC A;  3NWS A;  4HJA A;  5IYC H;  5JJK A;  2B2U C;  3OMC A;  2CCZ A;  3KDF B;  1KIX A;  3QO2 A;  4HCS A;  5I9O A;  2SDF A;  4K6D A;  2SOB A;  2XWB B;  5JPN C;  2HQE A;  2E2H H;  4GNX C;  3KOJ A;  4IJH A;  1VQ9 A;  4LMQ D;  1I4R A;  2B2Y C;  4R4O A;  4DPG A;  2ES2 A;  5M3M H;  3HOY H;  4RAU C;  1X6O A;  1L0X B;  1TU2 B;  4TSS A;  1PRT B;  2MUY A;  2R7D A;  1FL0 A;  4FXK C;  3MAQ A;  1PYW D;  1L0Y B;  3I2Z A;  2HCC A;  4DUZ L;  1XPU A;  3PUV A;  5ELO A;  1DOM A;  3TBI B;  2B2T A;  1W2B A;  4WJ3 M;  4DU9 A;  2E5L L;  3D4D A;  3TRE A;  2RHQ B;  4JV5 Q;  2QEJ C;  1HFN A;  1CHQ D;  2FJ2 A;  3NEM A;  2E76 C;  1Y1V G;  5I6W A;  1D7Q A;  1Y1V B;  1SYE A;  4JYA L;  3MVV A;  4ZQ3 A;  2SEB D;  1JIC A;  3MTS A;  5CV7 A;  3KLR A;  5GAG C;  3AU7 A;  3URY A;  2RHS B;  1ILP A;  1HNZ L;  3ERO A;  3RMH A;  3PIO A;  4C2M B;  3S2D H;  3DXJ C;  3KLS X;  1K0S A;  1A8V A;  2FIN B;  5BN4 A;  5E1F A;  4NB3 A;  2OQK A;  2EE1 A;  1ESF A;  4RGT A;  3J80 E;  3GV3 A;  1GVP A;  4X62 Q;  4HJ5 A;  4HSP A;  4DXG A;  1RHP A;  1M90 C;  3Q22 A;  4JI5 Q;  2E75 C;  1XWE A;  3TP7 A;  5FO9 B;  2Q2I A;  3EA6 A;  4UPA A;  3M4O H;  3I91 A;  3VR5 A;  2AMC B;  2XNA C;  1PTO B;  2RCN A;  1W6J A;  4IOA A;  2EQS A;  2L15 A;  1I4X A;  3TRZ A;  4QMG A;  1Y1W H;  5EPJ A;  5JOB A;  4JOI C;  3RUZ A;  2VUM G;  3V2T A;  4JI3 L;  3L7Z C;  1VMC A;  2VUM B;  3NK9 A;  4HCE A;  4ODG A;  1ASY A;  2KCC A;  3DUZ A;  1R9T H;  1K0R A;  4WJW A;  4KHP L;  2IW3 A;  5KNC A;  1JQY D;  3JAM E;  1EIH A;  3E6Z X;  1EY9 A;  3JAM i;  5H1S E;  4BXX H;  2I07 B;  3M3Y B;  1EIG A;  2LS0 1;  3VYT A;  3CCQ A;  2CQO A;  3VA5 A;  3CCJ A;  1XNQ L;  3TME A;  1LTG D;  4KD3 A;  2JA7 H;  1G8Z D;  2AHO B;  3CHB D;  5DNF A;  2HDM A;  3SR1 A;  1NR4 A;  2M00 A;  4DK3 C;  4DUZ Q;  5KEE A;  5CV4 A;  4IFD G;  1VQD A;  4RWS C;  1M8A A;  4OX9 L;  3CQZ B;  5C5M A;  2E5L Q;  1P16 A;  2RDH A;  1X3P A;  4O42 A;  2V1C C;  3UDI A;  1SE4 A;  3FVQ A;  1FR3 A;  2KA7 A;  4CJ2 C;  3MXN B;  4JYA Q;  5COR A;  3A8I E;  1B7Y B;  1O78 A;  1QNU A;  2KHJ A;  1LT4 D;  1PYS B;  5IYC G;  3BG3 A;  2K1B A;  1VQ5 A;  4Y7N B;  1XPR A;  1ILQ A;  3GTO H;  1RD9 D;  1TWA H;  1W6K A;  1IYV A;  4JI6 Q;  4FF3 A;  3OIQ A;  4MHE A;  4RGM A;  3OIP A;  5J1Z A;  4LF8 Q;  2E2H B;  4B3R Q;  1TR5 A;  1SND A;  2WB1 G;  2RSN A;  4R4Q A;  4CDC C;  5EKL A;  5M3M G;  2J7Z A;  2WB1 B;  3SVM A;  5M3M B;  5EPK A;  5IT9 c;  4OGQ C;  3U58 A;  4LK1 C;  1SYC A;  4ZYS A;  2A73 B;  4AH6 A;  3G4S A;  5IGB A;  2I46 A;  1KQS A;  2VXW A;  2RA4 A;  4IOC A;  4K5W A;  4ZRZ A;  1PFN A;  4KK7 A;  1LTB D;  3M7G A;  5IGE A;  2UXB Q;  5LMN L;  1A62 A;  4IUQ A;  4J8Q A;  3FKI H;  3H3V I;  3HOV H;  2EYF A;  2N88 A;  1EEI D;  2ZXO A;  4DN4 M;  2GVB A;  1TII D;  3I4L A;  2ALY B;  1OXV A;  2I5M X;  3IKJ A;  3HOZ B;  1XMO Q;  1JOQ A;  1GJX A;  5KND A;  4KHP Q;  3CCM A;  1ENF A;  3K81 C;  3CCV A;  4DV7 L;  5J39 A;  1STN A;  1VQM A;  1TWG H;  1KD1 C;  1XNQ Q;  1AFP A;  4A4I A;  3S2D B;  4X6A H;  5IGC A;  2KCM A;  5A35 A;  1B9N A;  1N33 L;  3H3V C;  2Z6K C;  2K32 A;  2XRQ D;  3GTJ H;  4B3S L;  1HPC A;  2KQ3 A;  4OX9 Q;  1JCK B;  2BOS A;  2E8G A;  2K5W A;  3I70 A;  3EIV A;  4P73 A;  1I94 L;  4QUC A;  4PMB A;  1S5D D;  1KDB A;  2RF4 A;  1NBW A;  4U68 A;  2ZJP A;  2NVQ B;  4KLK A;  2UU9 Q;  4H13 C;  3SGI A;  4K5X A;  4G7H C;  2CFM A;  3C3L A;  1D5Z C;  1RL2 A;  1TVX A;  2XWJ B;  5KIX A;  4GN4 B;  3MFG A;  1Y1W G;  3TSS A;  2UXD L;  1Y1W B;  2UXC L;  4B3T Q;  3HG9 A;  2Z1C A;  3VR6 A;  3RN2 A;  1LT5 D;  1R9T B;  1RF2 D;  1QG7 A;  3S24 A;  3OSO A;  1KXL A;  3NEN A;  2DY7 A;  4L5S A;  4FF2 A;  1ASZ A;  1TWF H;  1HJP A;  5IP9 H;  2JA7 G;  2ZTE A;  2K33 A;  2JA7 B;  1F2L A;  4R1J A;  3MWY W;  5EGT A;  2MFI A;  1OXS C;  1L1O A;  2EXZ A;  2OTL A;  3MA2 B;  1YNJ D;  5LMN Q;  3CMA A;  4C3J G;  4K8J A;  4C3J B;  3NE5 B;  2N78 A;  2SNS A;  1EFI D;  4XQQ A;  1BQQ T;  4H0L C;  1LTA D;  3QR8 A;  5IGD A;  3PSI A;  3JAM c;  2WV6 D;  3R8B A;  3VYU A;  1S72 A;  4AYB E;  5ELD A;  1SE3 A;  3I4N H;  3RNU A;  1JJG A;  3BYT B;  1YNJ C;  3IAY A;  1PHJ A;  2B2V C;  2NTT A;  3GTO B;  4DUY Q;  4QL5 A;  1C0A A;  2RVL A;  3UE1 A;  2D0P A;  1Q3L A;  2L0C A;  5G3L F;  1MIU A;  2IX0 A;  3S1Q H;  4OON A;  2F0Q A;  1PZK D;  2F0F A;  3OHX C;  4LUV A;  2EOT A;  2PQA B;  4HIK A;  1F9P A;  3TS0 A;  2ICI A;  2AQ3 B;  3T53 B;  4JPB W;  1EL0 A;  1WI5 A;  1B4O A;  1PXU A;  1S5B D;  2L4N A;  4POF A;  4QCL A;  4MZ9 A;  5M9O A;  1JOR A;  1PRT F;  3A8J E;  4C1N I;  3S15 H;  4JI2 Q;  2AWO A;  3LGJ A;  1EY7 A;  2CQA A;  3HOV G;  2H5X A;  3FKI G;  3HOV B;  1VQN A;  3FKI B;  4LWC A;  1TY2 A;  2EYJ A;  5FOB B;  1PYB A;  4N8F A;  2NTS A;  3HKZ E;  4YIJ A;  5LMU L;  2JN4 A;  2PNR C;  3PUW A;  2R93 H;  1STG A;  4IUU A;  3H91 A;  1CI3 M;  1LYL A;  3BDO A;  4YHH L;  1HNX Q;  1WTQ A;  2ICE C;  5DLQ E;  2ZM6 L;  3K7U C;  1XMQ L;  2K6A A;  4IUR A;  1U4R A;  2KVM A;  4RHR A;  2L12 A;  4LF4 Q;  2CKZ B;  4NXM L;  1MSG A;  2OEO A;  1EY8 A;  2OXP A;  2Q8I B;  3I3C A;  3GTJ B;  2VQF L;  1D1K A;  4HSV A;  3H94 A;  1SSO A;  3RZD H;  2F0U A;  3HP3 A;  1EYG A;  3RD4 A;  4A93 H;  4P2C B;  5C5L A;  3Q8D A;  1DJR D;  1TS4 A;  4IPG A;  1STH A;  1S3O A;  5AJ3 L;  1HR0 W;  3M7N A;  1FJG Q;  4BBR H;  4C3H G;  1Q46 A;  4JK1 C;  4C3H B;  4A3J G;  3S1N H;  1N8R C;  4A3J B;  1BOS A;  2IPK D;  1VQP A;  3PV0 A;  4IUP A;  3I4M H;  5M5Y B;  3NXW A;  2HUG A;  3E9H A;  5ELC A;  1PTO F;  2HHH L;  4GKK L;  1IXR A;  4YY3 Q;  3QIA A;  4BBS G;  4BBS B;  2F4V Q;  3CC7 A;  2EDG A;  2MPM A;  2HT1 A;  4JBM A;  1TWF B;  1X55 A;  1KNA A;  1XTC D;  4DV2 Q;  4JC0 A;  2B2W A;  1OXU A;  2G9H D;  4DV5 L;  3T1Y Q;  4DAY A;  1VQ6 A;  2A1A A;  3ERS X;  4UDU C;  4J15 A;  4HID A;  3TZD A;  1NMG A;  2LKV A;  1HA6 A;  1SYG A;  4JI1 L;  4P75 A;  1EYA A;  3KLS A;  1A3U A;  1A3V A;  2QEX A;  5AFW A;  1X3G A;  2XRS D;  5LL6 S;  4CJ0 B;  2UUB Q;  1GUS A;  1CA6 A;  1PH8 A;  1F9R A;  1CK1 A;  1DON A;  4GOP A;  3RLO A;  5ISR A;  4GZY C;  5E4W C;  4DR3 Q;  3I4N G;  1LLR D;  3I4N B;  1ML0 D;  4PG3 A;  4JBK A;  1FNV A;  1UAP A;  4DFA A;  2ZM6 Q;  3N52 A;  4B9W A;  3BDC A;  1CT1 D;  4GN3 B;  4NXM Q;  5I9P A;  3OWF A;  4LFB L;  3M85 A;  3S14 H;  1VQC A;  1X54 A;  4LUO A;  4PQX A;  3VR3 A;  4DR2 L;  3J7A 5;  2GN5 A;  3S1Q B;  1B9M A;  4DV6 L;  2QCP X;  3SK4 A;  2VQF Q;  5GQO A;  3FPP A;  3Q24 A;  4HMJ A;  4BY7 G;  3H0G H;  4DR6 L;  4BY7 B;  1KDA A;  1SJH D;  2LMC B;  1WVL A;  4AIM A;  2XSC A;  4MTN A;  3A7L A;  4LF6 Q;  4DR1 L;  5CMD A;  3CC2 A;  1HUN A;  4O0A A;  2G9D A;  2BA1 A;  1PFB A;  5T1G A;  1GUT A;  2JA6 H;  1SNQ A;  1VQ7 A;  3W5O A;  1I4G A;  4DK1 A;  2PCF B;  1VQL A;  1YNX A;  2EY6 A;  4ZCK A;  4GKK Q;  3S9W A;  3QB3 A;  3SXH A;  3MFY A;  4BY1 G;  1CQV A;  2M2L A;  4BY1 B;  4AYB G;  4PZ8 A;  4OXP A;  4ME3 A;  4AYB B;  2PPB C;  1F2M A;  4DV5 Q;  1IBK L;  1VQK A;  4WFN 3;  2Q8R E;  1B3A A;  2NYZ D;  1N9W A;  4IPD A;  1PTO H;  4LF5 Q;  1DCZ A;  2OCE A;  5FLX L;  4HIM A;  1LTR D;  2Q2U A;  1VQE A;  2F0O A;  1VQ8 A;  3GQB A;  3RZD B;  1JJ2 A;  3NBH A;  2PQE A;  2KEE A;  4JBW A;  4A93 G;  2HIV A;  4L5R C;  4A93 B;  4TKO B;  1LTS D;  1KAA A;  1S5F D;  5EAY A;  4BBR G;  2OQ0 A;  4BBR B;  4R4T A;  1WD1 A;  3A55 A;  4NKL A;  4LJZ C;  3S1N B;  1DOK A;  1I4H A;  4R8I A;  5F2D A;  4BWG B;  3IRB A;  1IL8 A;  1SYB A;  3CC4 A;  5IOD A;  3SDZ A;  3PCO B;  2F0M A;  1IYU A;  5LHY 1;  5JJI A;  2V4D A;  4ZKB B;  2I5H A;  1EYD A;  2K5N A;  1O7Y A;  4DR2 Q;  1XPO A;  3HKZ G;  2F0I A;  4X66 L;  3HKZ B;  4A76 A;  5IOC A;  1E3P A;  4KD4 A;  4H02 A;  1YIT A;  3CW2 C;  4RHS A;  1ICF B;  5TSS A;  3I90 A;  3OPO A;  4DR6 Q;  2AUJ D;  4HN7 A;  2D5D A;  4LW1 A;  1XX8 A;  2IWH A;  2RSO A;  4X3T A;  1KNE A;  2L5T A;  1YBY A;  2IX3 A;  1HZA A;  4Q0F A;  4DR1 Q;  3QWN A;  4X65 Q;  5JEA J;  4Y7N H;  1EY0 A;  1JWU D;  5IE8 A;  3TP8 A;  3MC0 B;  2VL6 A;  1C7Y A;  2H1E A;  3K59 A;  1GHK A;  4K0K Q;  1BUV T;  4QGU A;  1E2Z A;  5C44 H;  4DGZ A;  3NHH A;  2ZJQ A;  4LUZ A;  4YWK A;  3WWV A;  4QY7 A;  2Q2H A;  1EQQ A;  2CVR A;  4PNY A;  5BN5 A;  2PO4 A;  1IL2 A;  2K5D A;  1G2S A;  5L37 A;  4QUF A;  3AQQ A;  1SE2 A;  3NQI A;  3ULP A;  1IBK Q;  2KEC A;  3RZO B;  4O2D A;  1GUW A;  1WJJ A;  1X65 A;  3S16 H;  2NN6 G;  1DXM A;  3S14 B;  4EGV A;  2Z6B A;  5KYL A;  4IJL A;  1K28 A;  1QUQ A;  1WTX A;  2NVT B;  1AZQ A;  1VQA A;  3H0G G;  1MKH A;  4NPS A;  3H0G B;  5BN3 A;  4C1N K;  4IZ8 A;  3NTI A;  3HOZ H;  5I4D A;  3W3A A;  1FGU A;  4PMW A;  1QZG A;  5GAD C;  3CKI B;  1U0L A;  2F3I A;  1K8G A;  2P5Z X;  5JVG 3;  1X32 A;  4HR7 B;  4K5V A;  5K36 G;  2K52 A;  4KY7 A;  3ULL A;  2JA6 G;  3RLF A;  2JA6 B;  1B44 D;  3M4Q A;  4L63 B;  5CV6 A;  3T56 B;  5I2X A;  4WJ4 A;  4JCV E;  5DM7 3;  4LF9 Q;  1VQ4 A;  1RTO A;  2HD3 A;  3T13 A;  2ZTD A;  5G3L D;  2FHT A;  2WKC A;  3KBX A;  1BCP B;  3J80 i;  1BO0 A;  4P71 A;  3KFU A;  4XQN A;  2VB3 X;  3BVG A;  1SRO A;  1EYC A;  2WII B;  3KBG A;  1TQO A;  3CCL A;  2IJ0 A;  4DF7 A;  1W3S A;  2NVQ H;  4DXF A;  5KGU A;  1PDQ A;  2ZTC A;  1MD2 D;  4ZAI A;  1PRT D;  2E2I B;  1FVI A;  4OWX B;  4QB4 A;  2NN6 I;  2F52 A;  5K5P A;  3ICE A;  2F0S A;  3CME A;  1TS2 A;  1D8L A;  3F2D A;  2K01 A;  4X3K A;  2CH4 A;  1OXT A;  1FGB D;  2F3V A;  3I4O A;  4JI8 L;  1PRT C;  4I7Z C;  3G7L A;  4KKU A;  3G71 A;  2QDB A;  1LV9 A;  2CHB D;  1YI2 A;  1U4M A;  4CJ1 B;  1EOV A;  1E2V A;  1SEB D;  1GUN A;  2ENB A;  1LTI D;  1ENA A;  1JR0 D;  5CBA E;  4ZK9 B;  4A3I H;  3ZYY X;  1NY4 A;  2KED A;  5FLX E;  1J6Q A;  2F4I A;  4C3J H;  5E7N A;  3DM3 A;  1MI2 A;  1YNN D;  4F87 A;  5M5W H;  2WFW A;  4B3M L;  5J3B A;  3ONA B;  1EQV A;  4OIK A;  3ITP A;  3SK8 A;  4NMZ A;  2B2U A;  1XNR L;  2F0H A;  2FXQ A;  1HNZ Q;  1YNN C;  3CP0 A;  5IIF A;  3CU7 A;  3T4A C;  5C44 G;  4XYO A;  2CWA A;  2GVA A;  2VS1 A;  5C44 B;  4HJ7 A;  4GNX A;  3J81 L;  3A56 A;  1TKW B;  1PTO D;  2B2Y A;  4IO9 A;  1EZ8 A;  5D3I B;  3L2P A;  3FMC A;  4DK6 C;  4A3M H;  4IUT A;  4GLA C;  2R92 G;  1IBM L;  1IKL A;  2WKD A;  1VMP A;  2R92 B;  1DZ1 A;  2F0P A;  1VQF A;  4OEL B;  3FP9 A;  1ZEQ X;  1JOK A;  1PTO C;  3JC6 6;  5JJL A;  3S16 B;  3BZK A;  2QA4 A;  2IT1 A;  1SE8 A;  1N34 L;  3GTM B;  1E24 A;  3C1E A;  3KJP A;  3CCU A;  1S5C D;  4J6H A;  2F0V A;  2K50 A;  4JI0 L;  4KY6 A;  3GO5 A;  5EKI A;  4KKS A;  1HR0 L;  2XTI A;  4JI3 Q;  4ABN A;  2BH2 A;  3HOZ G;  4OO1 G;  1G51 A;  1NMF A;  4WOR A;  4NXN L;  4DAY B;  4M8A A;  4JI8 Q;  4DA2 A;  3P75 A;  1R4P B;  1PH3 A;  5C4X H;  3DEP A;  3T16 A;  2YYZ A;  1A2T A;  2B8F A;  3K0X A;  1QWY A;  5FK9 C;  1PH2 A;  2I5L X;  1SRU A;  1Y8P B;  3K7A B;  4ILW A;  1EFW A;  3QOL A;  2EYP A;  2KBN A;  2F0J A;  3CD6 A;  1PVO A;  4EQ5 A;  2WAQ E;  1WTO A;  1TS3 A;  3BVZ A;  5ELF A;  2PNH A;  4IPH A;  3DLL A;  1LTT D;  1BXT A;  3GTL H;  4C3H H;  3OMG A;  3KDF A;  4A3J H;  1PFM A;  4G7Z C;  2F1M A;  1STB A;  5M5Y H;  4P72 A;  5DAU A;  4CGY B;  4JOI A;  1BDO A;  2Z4H A;  5IY0 A;  1QNK A;  2BDN A;  3CCE A;  3AFQ A;  4RCN A;  3H15 A;  2D9U A;  3J80 c;  1LM0 A;  2CH4 W;  4JI4 L;  3TDQ A;  4BBS H;  1PH9 A;  2PYK A;  1H9K A;  4JG2 A;  4OO1 I;  4FXD A;  3A7A B;  1SFO B;  3S1M H;  1RCV D;  4PZ7 A;  3PIP A;  3MHB A;  1ZXT A;  2F0G A;  3UDX A;  3HZX A;  3T1H L;  3MXU A;  2F0E A;  1B2T A;  5FKA C;  4FP5 D;  2ZJR A;  4A3I G;  1NTG A;  4A3I B;  2HDL A;  3J7Z C;  2PZW A;  1KLU D;  4GKJ L;  4BA2 I;  4NDX A;  1L0W A;  2YTV A;  5EBC A;  3PO3 H;  3D6W A;  5M5W B;  2EJG C;  2Z9H A;  2LXK A;  3DHQ A;  1F2Z A;  2RKS A;  4NXN Q;  4R9W A;  1JT8 A;  1CQF A;  2AQ2 B;  4DV7 Q;  1WCM G;  1LT6 D;  1WCM B;  5DM6 3;  4A3F B;  2X6L A;  3SEB A;  2EYH A;  4UAI A;  3E3X A;  5BR8 L;  4UP9 A;  1I3Q H;  5C4Z A;  3EQL C;  3PIO 3;  3I55 A;  1N33 Q;  5FLX c;  3F1Z A;  4B3S Q;  1EIY B;  4N9T A;  1NCV A;  2RCF A;  1R4Q B;  2JP1 A;  2BH8 A;  1I94 Q;  3MXG A;  4A3M G;  4BY7 H;  3A54 A;  4A3M B;  4IN3 A;  3SK6 A;  1CSQ A;  4E6I A;  1UE6 A;  4LAA A;  2XGT A;  4GLX A;  4I65 A;  1UE7 A;  2KOL A;  1CKN B;  1Q8K A;  3CF5 A;  1DOL A;  2QKI C;  3GTG B;  1Y8O B;  1SAP A;  1K73 C;  3VR2 A;  1C48 A;  4KKT A;  2UXD Q;  4EX5 A;  5C4J H;  1SYF A;  3K80 C;  2UXC Q;  2WIN B;  3PUY A;  4OWT B;  4Y52 H;  1CA5 A;  3HOW H;  1STY A;  4X3U A;  3LX0 A;  1HHV A;  1SMX A;  3J81 E;  4JI7 L;  4DAP A;  4RKB A;  2N3S A;  1SNP A;  1T5X D;  5C4X G;  4IFD J;  4BY1 H;  1EWH A;  5C4X B;  4XDX A;  3CCR A;  2WAC A;  1KTK A;  1IKM A;  4MN3 A;  3T1H Q;  1KL9 A;  1PLF A;  4HTH A;  4DV3 L;  2O2L D;  2Z6K A;  3HOU H;  4CDF C;  3D4R A;  1TWC H;  3VDY A;  3HFZ B;  2PI2 A;  4O1N A;  1Q81 C;  2IX1 A;  1G6Z A;  2KJX A;  3DWA A;  1FNU A;  3KF6 A;  1DD2 A;  5HUR A;  4GKJ Q;  3X3N A;  1SNM A;  2EJM A;  5I2Y A;  2ZXR A;  1JC7 A;  2NZO A;  3MXN A;  1RJT A;  2B8G A;  2L1B A;  3EVQ A;  1K83 H;  1NE3 A;  5C3W A;  3CPW A;  1BCP F;  1HUM A;  2A5H A;  2F0T A;  3GTL B;  1EWC A;  3I8Z A;  5HY6 A;  1K8M A;  1BNZ A;  3EFX D;  2MQH A;  1L2F A;  1STA A;  1V1P A;  2DNE A;  3MEF A;  2R7Z H;  3PGZ A;  1DYQ A;  1LO5 D;  4L5T A;  1KDC A;  3OW7 A;  4DV1 L;  1QUQ B;  5BR8 Q;  5HGQ A;  4RG1 A;  1X9N A;  4QF4 A;  2F0D A;  1YJ9 A;  4QIW E;  1IYJ B;  1I4P A;  4H44 C;  4L5Q A;  2EPB A;  4HMI A;  2O5I C;  2EIF A;  3KLW A;  2Q8T A;  1KHI A;  1ENC A;  3V05 A;  1O7I A;  3CPF A;  3L0O A;  2EYL A;  1BF4 A;  1SMY D;  4CKE A;  1BBX C;  3S1M B;  2K04 A;  1K3R A;  1BBU A;  4ULL A;  4A3D H;  3K0Y A;  3S2H H;  2ZT9 C;  4QJF A;  3ND9 A;  5GAH C;  2Q2T A;  2TSS A;  1X56 A;  4KN4 C;  1SMY C;  3QG1 A;  2MNA A;  1O80 A;  2B63 G;  1SLJ A;  1VQJ A;  2B63 B;  2EVB A;  4A3C H;  4OEM B;  1IBL L;  3PO3 G;  5JJZ A;  1YHQ A;  3PO3 B;  3VA7 A;  5LMU Q;  4DK0 A;  2NVY B;  2K28 A;  4C56 C;  2WAQ G;  1QVF A;  2WAQ B;  4GLV B;  2DGY A;  5C0X J;  3D3R A;  4XXE A;  4YHH Q;  2B2V A;  4KJN A;  1E1O A;  3STB D;  3GV6 A;  2K5V A;  5A2Q L;  5IGG A;  1XMQ Q;  1IHZ A;  3KF8 A;  2VNU D;  3RZO H;  4DR7 L;  1ZYR D;  1Y8N B;  1I3Q B;  1QE6 A;  5IWA L;  2K5H A;  1H9M A;  2NN6 H;  4I7A A;  2KCN A;  2QF7 A;  1FNW A;  4ID6 A;  1EIF A;  3S17 B;  1MBY A;  2NVT H;  2A6E D;  3STB C;  1CHP D;  1NR2 A;  4UP8 A;  4HIO A;  4KY5 A;  5HGT A;  2K5Q A;  2L9H A;  1UE1 A;  1ZYR C;  4YCW A;  3P1H A;  1Q86 C;  4H7B A;  1RDP D;  3I73 A;  3DWQ A;  3OW2 A;  5AJ3 Q;  1VQH A;  2EJF C;  1ZKO A;  2JA9 A;  1EQT A;  1G29 1;  2YTX A;  1XJV A;  2IHE A;  2A6E C;  2F0L A;  5E3F A;  5IP7 H;  1S5E D;  5K36 H;  1C4Q A;  2B2T C;  2ASB A;  2Y0S E;  3CXC A;  3TN2 A;  5C4J B;  1GOZ A;  2F0W A;  2K05 A;  1HZC A;  3HOW G;  2NVX B;  4DV1 Q;  3HOW B;  2D0O A;  1C9O A;  2HHH Q;  1HH2 P;  4G4K A;  2DNC A;  4LFA L;  1I6H H;  5FLM G;  2RDG A;  5CGK A;  1CKO A;  5EQ0 A;  4TQU S;  3A8K E;  2O4X A;  4DNT B;  1SBB B;  1CUK A;  1V1Q A;  3TZU A;  4DNI A;  3J7A V;  1SXT A;  1I50 B;  4YWM A;  3HOU G;  3HOU B;  1VS0 A;  2AUK A;  1TWC B;  2A6H D;  3H09 A;  1GXD C;  2E2I H;  4EQO A;  1CZW A;  4JI1 Q;  4GNX B;  1XTD A;  2JA5 H;  2VB2 X;  1PH4 A;  1QOH A;  5D14 A;  5ELN A;  1PZJ D;  2R6G A;  3VR4 A;  1IBL Q;  3L3O C;  1GKH A;  1K83 B;  4FO2 A;  5DEH A;  1JWS D;  4BS9 A;  1CM9 A;  3D31 A;  3DMU A;  2K14 A;  1UEA B;  2R7Z G;  4F8M A;  2R7Z B;  1LAC A;  1A15 A;  2MGS A;  3KUP A;  5CYU A;  4ZUJ A;  5NUC A;  3GDE A;  3NBI A;  1AP0 A;  2QIL A;  4LFB Q;  3BU2 A;  3EN2 A;  5IWA Q;  4DV6 Q;  2M9V A;  2LFN A;  3HRZ C;  3T51 B;  3Q0A A;  4XQJ A;  5E4X A;  4MTK A;  3A74 A;  1D2B A;  4A3D G;  1WTR A;  1DGS A;  4A3D B;  4CKC A;  1WYD A;  4KI0 A;  3DWP A;  2B39 A;  2F0K A;  3PF5 A;  3S2H B;  2J0T D;  5CV9 A;  2EXD A;  1S40 A;  3C2P A;  4A3L H;  5CR3 A;  4A3C G;  4DV0 L;  1I5F A;  2LSS A;  3FPU B;  4IUV A;  1PA6 A;  1H9J A;  2SNM A;  3IL8 A;  1Q82 C;  1HZB A;  1V8Q A;  2R3Z A;  2GA4 B;  2H4O A;  2A8V A;  1YHA A;  4N8X 1;  2E2J H;  1H9S A;  2FMC A;  2R92 H;  1CFM A;  5EKK A;  4L8J A;  4CDD C;  1Y69 U;  1B53 A;  5M3F G;  5M3F B;  2NZ1 D;  3HKS A;  1YZ6 A;  3GTM H;  2X6G A;  3GTK B;  4FDB A;  3RR5 A;  4QIW B;  2EY5 A;  3R93 A;  3Q23 A;  1J5E L;  1A3T A;  3OWE B;  1ONL A;  3TEH B;  3ER0 A;  2EYO A;  5C3E H;  3N6R A;  4OO1 H;  1D6E C;  1OXX K;  1II3 A;  3J81 j;  4F88 A;  3R3O A;  2CWP A;  1HNW L;  4R8N A;  4U67 3;  1AN8 A;  5IP7 G;  1TXY A;  1L1O B;  3H6M A;  5A2Q E;  2K7V A;  1WTW A;  3K5N A;  4GN5 A;  1IW7 D;  3GP7 A;  2XIW A;  1I6H B;  3K7A H;  2L11 A;  4X66 Q;  4CBV A;  3K5O A;  3MZ5 A;  4K2L A;  2RBM A;  1O7Z A;  2CW0 D;  5IYB G;  1F77 A;  3NP8 A;  2PMZ E;  1XYI A;  3GTQ H;  4B9X A;  5D65 A;  1PV4 A;  3E9I A;  3WOE A;  3VYS A;  4JI6 L;  3E0E A;  3IFT A;  1IW7 C;  4G7O C;  5C0X H;  2KCT A;  3BZC A;  4LF8 L;  1YHB A;  4B3R L;  2CW0 C;  1SNO A;  2JA5 G;  1J9O A;  2JA5 B;  5IYD H;  2AWN A;  4XT3 B;  1JE5 A;  1V43 A;  3R2I A;  1H9R A;  2Z0S A;  4DV0 Q;  2JK8 A;  3WOF A;  3WDN A;  3FRP B;  3A5Z B;  3A5U A;  1F9Q A;  3HS0 C;  1PZI D;  2UXB L;  1SFO H;  2DJF C;  2BE5 D;  5C6A A;  5C4H A;  3AMU A;  2R7F A;  1NSN S;  2HQL A;  3VYR A;  1PH6 A;  1EQR A;  2Y0S G;  1E2W A;  2Y0S B;  1SJE D;  1S4Z A;  1EY4 A;  1XMO L;  3LNN A;  1UNS A;  2BE5 C;  2KHI A;  2MO0 A;  4DAV A;  3U9S A;  4FXG C;  4L6T B;  4A3K H;  1J5E Q;  4QQB X;  1HQM C;  1ICW A;  1JMC A;  2F03 A;  2PW7 A;  3K8A A;  1VCI A;  1B70 B;  4JW0 A;  4DV4 L;  3GTP B;  4A3L G;  1TT2 A;  1BCP D;  2JEA I;  1HNW Q;  2NZH A;  3KYH C;  1A63 A;  3UE0 A;  1L1O C;  1WCM H;  4IAL A;  3U50 C;  4A3F H;  1WFQ A;  3BYY B;  2AQ1 B;  2MP1 A;  1Z9F A;  1STE A;  4OL7 A;  1AEX A;  5C3X A;  3F2B A;  3NPP A;  3KF6 B;  4K8I A;  1ROD A;  3B6Y A;  4YWL A;  4RFB A;  4ZLT F;  3BVM A;  1BCP C;  2DN8 A;  3MXP A;  2UU9 L;  1HTP A;  5T1I A;  4A75 A;  3EJI A;  3PUX A;  5GAE C;  3NEL A;  1E0B A;  4RGO S;  3TP6 A;  1KC8 C;  2E2J B;  2C5C A;  1ET9 A;  3O13 A;  1VF7 A;  5KYI A;  4B3T L;  3OTO L;  1V1P B;  4JVZ A;  1CKM A;  1JOO A;  3GTG H;  1PFS A;  1EOT A;  4J1M A;  1SNC A;  3CCS A;  1M1K C;  3RLN A;  2TMP A;  5FJ8 H;  2A69 D;  3D0F A;  3OOC A;  1UUP A;  4X64 L;  5JAV A;  3HOY G;  1PH7 A;  4HED A;  3HOY B;  1ESR A;  1B1Z A;  3UI2 A;  1HRJ A;  5C3E G;  1YJN A;  5I6Y A;  2BDO A;  4CHT B;  5C3E B;  4MIU A;  2QW7 A;  1TY0 A;  3PO2 H;  2A69 C;  2YV5 A;  3MEH A;  4R4I A;  1SN8 A;  1T5E A;  5JVH 3;  1H95 A;  1YJW A;  2DY8 A;  4IFD I;  5COY A;  1HA5 A;  1SYD A;  4EQN A;  4Q5V A;  4RCO A;  4DR4 L;  2PZU A;  3G6E A;  5EBD A;  3K5M A;  1U4P A;  4FNF A;  1QVC A;  4IUN A;  5JEA H;  1LAB A;  3W2D A;  4GOP B;  1EU3 A;  3W1B A;  4K2K A;  5FO8 B;  4PZ6 A;  3ULJ A;  1EWI A;  3GTQ B;  1WTH A;  4N9P A;  4DUY L;  2C9O A;  2MJ8 A;  3F2C A;  4B3M Q;  1MSH A;  3C46 A;  4DR5 L;  4IQZ A;  5C0X G;  1QIL A;  3NTH A;  3KF8 B;  5D3D A;  2QDL A;  4DV4 Q;  2JSO A;  4NW2 A;  4GS3 A;  4YCU A;  2JXM B;  1E7Z A;  5IYD G;  1XNR Q;  1GO3 E;  1WTP A;  3LWU A;  2IL8 A;  1BKB A;  1VQI A;  1MGS A;  2OF1 A;  3E5S A; 
#chains in the Genus database with same CATH homology
 1X3Q A;  2XVS A;  4NP5 A;  3CRL C;  5CV8 A;  3M4O B;  1A2U A;  1G2T A;  1AW7 A;  4CKB A;  4M1U B;  1PMR A;  3HEJ A;  2ZXP A;  4BA1 I;  3QJY A;  5LL6 X;  1EEF D;  1Q1E A;  3NWT A;  2JYO A;  3DM1 A;  4EVO A;  2EZV A;  3P7J A;  4A3K B;  1JE4 A;  2D62 A;  2B2W C;  3DEO A;  2PMZ B;  4Z9C B;  3J7A F;  3C1F A;  5C0X I;  4ME5 A;  4PV1 C;  1DM0 B;  4FF1 A;  1EZ6 A;  4KHZ A;  3BDL A;  1Q1B A;  2Z4I A;  3E0J A;  1I6V C;  2FMM A;  1QJO A;  4FF4 A;  3Q6S A;  3K57 A;  1WTV A;  2JE6 I;  2RDF A;  3FDT A;  1QB5 D;  1EY5 A;  1TWA B;  3SK5 A;  1FYC A;  5EPL A;  3P20 A;  3SE0 A;  4XYQ A;  3L9A X;  1I4Q A;  3LWE A;  4G57 A;  1HXY D;  3PO2 B;  2LY7 A;  4K6L A;  2F3W A;  1RKN A;  1XXG A;  5CV5 A;  1B50 A;  3NTK A;  1U9R A;  5JEA G;  5ELB A;  4ZUI A;  3J7Y W;  2EYM A;  3NUC A;  1TWG B;  1KAB A;  1GUO A;  2K03 A;  1K8O A;  1H9S B;  4OHJ A;  2NWG A;  3PMF A;  4KN7 C;  4KMU C;  3R2T A;  1O7L A;  4TRD A;  2N55 A;  4FYD A;  5IT9 L;  4XT1 B;  5KRU A;  4XIG S;  1EY6 A;  4B08 A;  1EU4 A;  1HQR D;  2D2C C;  3NSW A;  4OIJ A;  3G6J B;  4KHV A;  2NB0 A;  4ZKC B;  2PZT A;  1CZG A;  4KJO A;  4RKL A;  3NQT A;  2PW5 A;  3M4Y A;  3HOX B;  3AB9 A;  4C3I G;  1VF5 C;  4C3I B;  3BS1 A;  3CRK C;  2XN9 C;  4WRD A;  3HGB A;  5KNB A;  1BR9 A;  2MHV A;  3K5L A;  3V96 A;  4EQP A;  4KV6 A;  3QOJ A;  4X3S A;  2RQX A;  5JPM C;  2HCI A;  1F9S A;  2L55 A;  1ET6 A;  1SDF A;  2NBF A;  1WD0 A;  4RH6 A;  2ID0 A;  1G91 A;  1CTM A;  4RA8 A;  3I72 A;  2E74 C;  1JB3 A;  1Q8I A;  3TP5 A;  4F7X A;  2F0N A;  1VDZ A;  3J80 L;  5ELE A;  5M5X B;  4PMC A;  3BZD B;  3D4W A;  1RTN A;  5CC4 A;  3GD7 A;  1U4L A;  3ND8 A;  3S1R B;  1HTL D;  1GHJ A;  2R61 A;  3PUZ A;  1LT3 D;  3S15 B;  5EJW A;  2BCO A;  2WP8 J;  4A3B B;  1Z6H A;  1J8I A;  1KLG D;  2EY2 A;  3PIP 3;  4V19 0;  3ERQ A;  2R93 B;  2KHS A;  3JAM L;  2OT2 A;  1OO9 B;  2X69 A;  1D5M C;  4S3S A;  2A68 D;  1F2Y A;  2J4X A;  2EY1 A;  5CBE E;  2YU9 B;  2A6H C;  1NAP A;  4K14 A;  3IFD A;  1GUG A;  4XTC S;  2BA0 A;  1D1I A;  3KK7 A;  3FEW X;  1D5X C;  1Z7T A;  2A68 C;  4A3G B;  5J22 A;  4V0B A;  2FFK B;  3D8G A;  2E2D C;  1C8C A;  4A3E B;  3X3M A;  2Z8L A;  3F2U A;  4HAE A;  1Q90 A;  5FO7 B;  1HCZ A;  1V1O A;  1FD7 D;  1TS5 A;  3I4M B;  3K58 A;  4DNR B;  2KUM A;  2A74 C;  4RGN A;  2JEB I;  3SHL A;  4KTA A;  4FVM A;  2JA8 B;  4IFD H;  1M4V A;  3D6C A;  1A6X A;  1NUC A;  2O5J C;  1Z47 A;  5IT9 E;  1Q12 A;  1QCB D;  5IGF A;  1AZP A;  1TWH B;  3K6O A;  1HFG A;  1JWM D;  2NUC A;  3U9O A;  3NWS A;  2B2U C;  3OMC A;  3QO2 A;  4HCS A;  5I9O A;  2SDF A;  4K6D A;  2SOB A;  2XWB B;  5JPN C;  2HQE A;  4LMQ D;  1I4R A;  2B2Y C;  4RAU C;  1L0X B;  1TU2 B;  4TSS A;  1PRT B;  2MUY A;  4FXK C;  3MAQ A;  1PYW D;  1L0Y B;  2HCC A;  3PUV A;  1DOM A;  3TBI B;  2B2T A;  4DU9 A;  3D4D A;  2QEJ C;  1HFN A;  1CHQ D;  2FJ2 A;  2E76 C;  5I6W A;  1Y1V B;  1SYE A;  3MVV A;  4ZQ3 A;  2SEB D;  1JIC A;  3MTS A;  5CV7 A;  3KLR A;  3AU7 A;  3URY A;  1ILP A;  3ERO A;  3RMH A;  4C2M B;  3DXJ C;  3KLS X;  2FIN B;  5BN4 A;  5E1F A;  2EE1 A;  1ESF A;  4RGT A;  3J80 E;  3GV3 A;  4HSP A;  4DXG A;  1RHP A;  3Q22 A;  2E75 C;  1XWE A;  3TP7 A;  5FO9 B;  3EA6 A;  3I91 A;  3VR5 A;  2XNA C;  1PTO B;  1W6J A;  1I4X A;  4QMG A;  5EPJ A;  5JOB A;  3RUZ A;  3V2T A;  3L7Z C;  1VMC A;  2VUM B;  3NK9 A;  4HCE A;  4ODG A;  2KCC A;  3DUZ A;  4WJW A;  2IW3 A;  5KNC A;  1JQY D;  3JAM E;  1EIH A;  3E6Z X;  1EY9 A;  2I07 B;  3M3Y B;  1EIG A;  2LS0 1;  3VYT A;  3VA5 A;  3TME A;  1LTG D;  4KD3 A;  1G8Z D;  3CHB D;  5DNF A;  2HDM A;  3SR1 A;  1NR4 A;  2M00 A;  5KEE A;  5CV4 A;  4IFD G;  4RWS C;  1M8A A;  3CQZ B;  5C5M A;  2RDH A;  1X3P A;  4O42 A;  1SE4 A;  3FVQ A;  1FR3 A;  2KA7 A;  4CJ2 C;  5COR A;  3A8I E;  1O78 A;  1QNU A;  1LT4 D;  3BG3 A;  2K1B A;  4Y7N B;  1ILQ A;  1RD9 D;  1W6K A;  1IYV A;  4FF3 A;  3OIQ A;  4MHE A;  4RGM A;  3OIP A;  5J1Z A;  2E2H B;  1TR5 A;  1SND A;  3SVM A;  2RSN A;  5EKL A;  2J7Z A;  2WB1 B;  5M3M B;  5EPK A;  4OGQ C;  4LK1 C;  1SYC A;  4ZYS A;  2A73 B;  5IGB A;  2I46 A;  2VXW A;  2RA4 A;  4K5W A;  4ZRZ A;  1PFN A;  4KK7 A;  1LTB D;  3M7G A;  5IGE A;  4IUQ A;  4J8Q A;  2EYF A;  2N88 A;  1EEI D;  2ZXO A;  4DN4 M;  1TII D;  3I4L A;  1OXV A;  3IKJ A;  3HOZ B;  1JOQ A;  1GJX A;  5KND A;  1ENF A;  5J39 A;  1STN A;  1AFP A;  3S2D B;  5IGC A;  5A35 A;  1B9N A;  3H3V C;  2K32 A;  2XRQ D;  1HPC A;  2KQ3 A;  1JCK B;  2BOS A;  2K5W A;  3I70 A;  4QUC A;  4PMB A;  1S5D D;  1KDB A;  4U68 A;  2NVQ B;  4H13 C;  4K5X A;  4G7H C;  3C3L A;  1D5Z C;  1TVX A;  2XWJ B;  5KIX A;  3MFG A;  3TSS A;  1Y1W B;  3HG9 A;  2Z1C A;  3VR6 A;  1LT5 D;  1R9T B;  1RF2 D;  1QG7 A;  3OSO A;  2DY7 A;  4FF2 A;  2K33 A;  2JA7 B;  1F2L A;  3MWY W;  5EGT A;  1OXS C;  2EXZ A;  3MA2 B;  1YNJ D;  4C3J G;  4K8J A;  4C3J B;  3NE5 B;  2SNS A;  1EFI D;  4XQQ A;  1BQQ T;  4H0L C;  1LTA D;  5IGD A;  2WV6 D;  3R8B A;  3VYU A;  5ELD A;  1SE3 A;  3BYT B;  1YNJ C;  3IAY A;  2B2V C;  2NTT A;  3GTO B;  2RVL A;  1Q3L A;  2L0C A;  5G3L F;  2IX0 A;  2F0Q A;  1PZK D;  2F0F A;  3OHX C;  2EOT A;  1F9P A;  2ICI A;  2AQ3 B;  3T53 B;  1EL0 A;  1B4O A;  1PXU A;  1S5B D;  2L4N A;  4QCL A;  5M9O A;  1JOR A;  1PRT F;  3A8J E;  4C1N I;  2AWO A;  1EY7 A;  2CQA A;  3HOV B;  3FKI B;  1TY2 A;  2EYJ A;  5FOB B;  2NTS A;  4YIJ A;  2PNR C;  3PUW A;  1STG A;  4IUU A;  3H91 A;  1CI3 M;  3BDO A;  1WTQ A;  2ICE C;  2K6A A;  4IUR A;  1U4R A;  2KVM A;  4RHR A;  2L12 A;  1MSG A;  2OEO A;  1EY8 A;  2OXP A;  2Q8I B;  3I3C A;  3GTJ B;  1D1K A;  4HSV A;  3H94 A;  1SSO A;  2F0U A;  3HP3 A;  3RD4 A;  4P2C B;  5C5L A;  1DJR D;  1TS4 A;  3M7N A;  1STH A;  4C3H G;  4JK1 C;  4C3H B;  4A3J B;  1BOS A;  2IPK D;  3PV0 A;  4IUP A;  5M5Y B;  3NXW A;  2HUG A;  5ELC A;  1PTO F;  3QIA A;  4BBS B;  2EDG A;  2MPM A;  1TWF B;  1XTC D;  1KNA A;  2B2W A;  1OXU A;  2G9H D;  4DAY A;  4UDU C;  3TZD A;  2LKV A;  1HA6 A;  1SYG A;  1EYA A;  3KLS A;  1A3U A;  1A3V A;  5AFW A;  5LL6 S;  2XRS D;  4CJ0 B;  1GUS A;  1CA6 A;  1F9R A;  1CK1 A;  1DON A;  5ISR A;  4GZY C;  5E4W C;  1LLR D;  3I4N B;  1ML0 D;  1FNV A;  1UAP A;  4DFA A;  3N52 A;  4B9W A;  3BDC A;  1CT1 D;  5I9P A;  3OWF A;  3M85 A;  3S1Q B;  4PQX A;  3VR3 A;  1B9M A;  2QCP X;  3SK4 A;  3FPP A;  3Q24 A;  4HMJ A;  4BY7 B;  1KDA A;  1SJH D;  2LMC B;  1WVL A;  2XSC A;  3A7L A;  5CMD A;  1HUN A;  2G9D A;  2BA1 A;  1PFB A;  5T1G A;  1GUT A;  1SNQ A;  1I4G A;  4DK1 A;  2PCF B;  2EY6 A;  3S9W A;  3QB3 A;  3SXH A;  3MFY A;  1CQV A;  2M2L A;  4BY1 B;  4AYB B;  2PPB C;  1F2M A;  4WFN 3;  2Q8R E;  1B3A A;  2NYZ D;  1PTO H;  1DCZ A;  5FLX L;  1LTR D;  2F0O A;  3GQB A;  3RZD B;  3NBH A;  2PQE A;  2KEE A;  4JBW A;  4A93 B;  4TKO B;  1LTS D;  1KAA A;  1S5F D;  4BBR B;  1WD1 A;  3A55 A;  4NKL A;  4LJZ C;  3S1N B;  1DOK A;  1I4H A;  4R8I A;  5F2D A;  4BWG B;  1IL8 A;  1SYB A;  5IOD A;  3SDZ A;  2F0M A;  1IYU A;  5LHY 1;  2V4D A;  4ZKB B;  1EYD A;  1O7Y A;  2F0I A;  3HKZ B;  5IOC A;  4KD4 A;  4RHS A;  5TSS A;  3I90 A;  3OPO A;  2AUJ D;  4HN7 A;  2D5D A;  2IWH A;  1XX8 A;  2RSO A;  4X3T A;  1KNE A;  2L5T A;  2IX3 A;  4Q0F A;  3QWN A;  5JEA J;  1EY0 A;  1JWU D;  3TP8 A;  3MC0 B;  2H1E A;  3K59 A;  1GHK A;  1BUV T;  1E2Z A;  4DGZ A;  3NHH A;  2CVR A;  4PNY A;  5BN5 A;  2PO4 A;  2K5D A;  1G2S A;  4QUF A;  1SE2 A;  3NQI A;  2KEC A;  3RZO B;  1GUW A;  2NN6 G;  1DXM A;  3S14 B;  4EGV A;  5KYL A;  1WTX A;  2NVT B;  1AZQ A;  3H0G B;  5BN3 A;  4C1N K;  4IZ8 A;  3NTI A;  5I4D A;  3W3A A;  4PMW A;  3CKI B;  5JVG 3;  1X32 A;  4HR7 B;  4K5V A;  5K36 G;  4KY7 A;  3RLF A;  2JA6 B;  1B44 D;  4L63 B;  5CV6 A;  3T56 B;  5I2X A;  5DM7 3;  1RTO A;  3T13 A;  5G3L D;  2FHT A;  2WKC A;  3KBX A;  1BCP B;  1BO0 A;  4XQN A;  2VB3 X;  3BVG A;  1EYC A;  2WII B;  3KBG A;  1TQO A;  2IJ0 A;  4DF7 A;  4DXF A;  5KGU A;  1PDQ A;  1MD2 D;  4ZAI A;  1PRT D;  2E2I B;  4QB4 A;  2NN6 I;  5K5P A;  2F0S A;  1TS2 A;  2K01 A;  4X3K A;  1OXT A;  1FGB D;  2F3V A;  1PRT C;  4I7Z C;  3G7L A;  4KKU A;  2QDB A;  1LV9 A;  2CHB D;  1U4M A;  4CJ1 B;  1E2V A;  1SEB D;  1GUN A;  2ENB A;  1LTI D;  1ENA A;  1JR0 D;  5CBA E;  4ZK9 B;  3ZYY X;  2KED A;  5FLX E;  2F4I A;  1MI2 A;  1YNN D;  4F87 A;  3ONA B;  1EQV A;  4OIK A;  3ITP A;  3SK8 A;  4NMZ A;  2B2U A;  2F0H A;  1YNN C;  5IIF A;  3CU7 A;  3T4A C;  4XYO A;  5C44 B;  3J81 L;  3A56 A;  1TKW B;  1PTO D;  2B2Y A;  1EZ8 A;  5D3I B;  3FMC A;  4IUT A;  1IKL A;  2WKD A;  1VMP A;  2R92 B;  1DZ1 A;  2F0P A;  1ZEQ X;  1JOK A;  1PTO C;  3S16 B;  2IT1 A;  3GTM B;  3C1E A;  1S5C D;  4J6H A;  2F0V A;  4KY6 A;  3GO5 A;  5EKI A;  4KKS A;  4ABN A;  4OO1 G;  4WOR A;  4M8A A;  4DA2 A;  3P75 A;  1R4P B;  3DEP A;  3T16 A;  2YYZ A;  1A2T A;  2B8F A;  5FK9 C;  1QWY A;  1Y8P B;  3K7A B;  4ILW A;  3QOL A;  2EYP A;  2F0J A;  1WTO A;  1TS3 A;  3BVZ A;  5ELF A;  1LTT D;  1BXT A;  3OMG A;  1PFM A;  4G7Z C;  2F1M A;  1STB A;  5DAU A;  4CGY B;  1BDO A;  2Z4H A;  1QNK A;  2BDN A;  4RCN A;  2D9U A;  3TDQ A;  2PYK A;  1H9K A;  4OO1 I;  4FXD A;  3A7A B;  1SFO B;  1RCV D;  3MHB A;  1ZXT A;  2F0G A;  3HZX A;  3MXU A;  2F0E A;  1B2T A;  5FKA C;  4FP5 D;  4A3I B;  2HDL A;  2PZW A;  1KLU D;  4BA2 I;  4NDX A;  5EBC A;  3D6W A;  5M5W B;  2EJG C;  3DHQ A;  1F2Z A;  2RKS A;  4R9W A;  1CQF A;  2AQ2 B;  1LT6 D;  1WCM B;  5DM6 3;  4A3F B;  2X6L A;  3SEB A;  2EYH A;  4UAI A;  5C4Z A;  3EQL C;  3PIO 3;  4N9T A;  1NCV A;  1R4Q B;  2JP1 A;  3MXG A;  3A54 A;  4A3M B;  4IN3 A;  3SK6 A;  4E6I A;  4LAA A;  4I65 A;  2KOL A;  1DOL A;  2QKI C;  3GTG B;  1Y8O B;  1SAP A;  3VR2 A;  1C48 A;  4KKT A;  1SYF A;  2WIN B;  3PUY A;  1CA5 A;  1STY A;  4X3U A;  3LX0 A;  1HHV A;  3J81 E;  4DAP A;  4RKB A;  1SNP A;  1T5X D;  4IFD J;  1EWH A;  5C4X B;  4XDX A;  2WAC A;  1KTK A;  1IKM A;  4MN3 A;  1PLF A;  4HTH A;  2O2L D;  3D4R A;  4O1N A;  2IX1 A;  1G6Z A;  2KJX A;  3DWA A;  1FNU A;  1DD2 A;  5HUR A;  3X3N A;  1SNM A;  2EJM A;  5I2Y A;  2ZXR A;  1JC7 A;  3MXN A;  1RJT A;  2B8G A;  2L1B A;  3EVQ A;  5C3W A;  1BCP F;  1HUM A;  2A5H A;  2F0T A;  3GTL B;  1EWC A;  3I8Z A;  1BNZ A;  1K8M A;  3EFX D;  1STA A;  1V1P A;  2DNE A;  1DYQ A;  1LO5 D;  1KDC A;  3OW7 A;  4QF4 A;  2F0D A;  1I4P A;  4H44 C;  2EPB A;  4HMI A;  2O5I C;  2Q8T A;  1ENC A;  3V05 A;  1BF4 A;  2EYL A;  1SMY D;  4CKE A;  1BBX C;  3S1M B;  2K04 A;  4ULL A;  3K0Y A;  2ZT9 C;  3ND9 A;  2TSS A;  4KN4 C;  1SMY C;  3QG1 A;  1O80 A;  2B63 B;  2EVB A;  5JJZ A;  3PO3 B;  3VA7 A;  4DK0 A;  2NVY B;  2K28 A;  4C56 C;  2WAQ B;  5C0X J;  3D3R A;  4XXE A;  2B2V A;  4KJN A;  3GV6 A;  5A2Q L;  5IGG A;  1IHZ A;  3KF8 A;  2VNU D;  1ZYR D;  1Y8N B;  1I3Q B;  1QE6 A;  1H9M A;  2NN6 H;  2KCN A;  2QF7 A;  1FNW A;  4ID6 A;  3S17 B;  1MBY A;  2A6E D;  1CHP D;  1NR2 A;  4KY5 A;  5HGT A;  2K5Q A;  2L9H A;  1ZYR C;  3P1H A;  4H7B A;  1RDP D;  3I73 A;  3DWQ A;  2EJF C;  1ZKO A;  1EQT A;  1G29 1;  2A6E C;  2F0L A;  5E3F A;  5K36 H;  1S5E D;  1C4Q A;  2B2T C;  3TN2 A;  5C4J B;  1GOZ A;  2F0W A;  2K05 A;  2NVX B;  3HOW B;  4G4K A;  2DNC A;  2RDG A;  5CGK A;  5EQ0 A;  4TQU S;  3A8K E;  2O4X A;  4DNT B;  1SBB B;  3TZU A;  3J7A V;  1SXT A;  1I50 B;  3HOU B;  2AUK A;  1TWC B;  2A6H D;  3H09 A;  1GXD C;  4EQO A;  1CZW A;  2VB2 X;  1QOH A;  5D14 A;  1PZJ D;  2R6G A;  3VR4 A;  3L3O C;  1K83 B;  4FO2 A;  5DEH A;  1JWS D;  4BS9 A;  1CM9 A;  3D31 A;  3DMU A;  1UEA B;  4F8M A;  2R7Z B;  1LAC A;  1A15 A;  2MGS A;  3KUP A;  5CYU A;  4ZUJ A;  5NUC A;  3NBI A;  1AP0 A;  2QIL A;  2M9V A;  2LFN A;  3HRZ C;  3T51 B;  3Q0A A;  4XQJ A;  5E4X A;  1D2B A;  1WTR A;  4A3D B;  4CKC A;  4KI0 A;  3DWP A;  2B39 A;  2F0K A;  3S2H B;  2J0T D;  5CV9 A;  3C2P A;  5CR3 A;  3FPU B;  4IUV A;  1H9J A;  2SNM A;  3IL8 A;  1V8Q A;  2R3Z A;  2GA4 B;  2H4O A;  1H9S A;  2FMC A;  1CFM A;  5EKK A;  4L8J A;  1Y69 U;  1B53 A;  5M3F B;  2NZ1 D;  3GTK B;  2X6G A;  4QIW B;  2EY5 A;  3R93 A;  3Q23 A;  1A3T A;  3OWE B;  1ONL A;  2EYO A;  3N6R A;  4OO1 H;  1D6E C;  1OXX K;  1II3 A;  4F88 A;  3R3O A;  4R8N A;  4U67 3;  1AN8 A;  3H6M A;  5A2Q E;  2K7V A;  1WTW A;  3K5N A;  1IW7 D;  3GP7 A;  2XIW A;  1I6H B;  2L11 A;  4CBV A;  3K5O A;  3MZ5 A;  4K2L A;  2RBM A;  1O7Z A;  2CW0 D;  1F77 A;  3NP8 A;  1XYI A;  4B9X A;  5D65 A;  3WOE A;  3VYS A;  3IFT A;  1IW7 C;  4G7O C;  5C0X H;  2CW0 C;  1SNO A;  1J9O A;  2JA5 B;  2AWN A;  4XT3 B;  1V43 A;  3R2I A;  1H9R A;  3WOF A;  3WDN A;  3FRP B;  1F9Q A;  3HS0 C;  1PZI D;  2BE5 D;  5C6A A;  5C4H A;  3AMU A;  1NSN S;  3VYR A;  1E2W A;  2Y0S B;  1SJE D;  1S4Z A;  1EY4 A;  3LNN A;  1UNS A;  2BE5 C;  4DAV A;  3U9S A;  4FXG C;  4L6T B;  1HQM C;  1ICW A;  2F03 A;  2PW7 A;  1VCI A;  3GTP B;  1TT2 A;  1BCP D;  2JEA I;  4IAL A;  3BYY B;  2AQ1 B;  2MP1 A;  1STE A;  4OL7 A;  1AEX A;  5C3X A;  3NPP A;  4K8I A;  1ROD A;  4RFB A;  4ZLT F;  3BVM A;  1BCP C;  2DN8 A;  3MXP A;  1HTP A;  5T1I A;  3EJI A;  3PUX A;  1E0B A;  4RGO S;  3TP6 A;  2E2J B;  2C5C A;  1ET9 A;  3O13 A;  1VF7 A;  5KYI A;  1V1P B;  1JOO A;  1EOT A;  4J1M A;  1SNC A;  2TMP A;  2A69 D;  3OOC A;  1UUP A;  5JAV A;  4HED A;  3HOY B;  1ESR A;  1B1Z A;  3UI2 A;  1HRJ A;  5I6Y A;  2BDO A;  4CHT B;  5C3E B;  4MIU A;  1TY0 A;  2A69 C;  3MEH A;  5JVH 3;  1T5E A;  2DY8 A;  4IFD I;  5COY A;  1HA5 A;  1SYD A;  4EQN A;  4Q5V A;  4RCO A;  2PZU A;  5EBD A;  3K5M A;  1U4P A;  4FNF A;  4IUN A;  5JEA H;  1LAB A;  3W2D A;  1EU3 A;  4K2K A;  5FO8 B;  3GTQ B;  4N9P A;  2C9O A;  2MJ8 A;  1MSH A;  3C46 A;  4IQZ A;  5C0X G;  1QIL A;  3NTH A;  5D3D A;  2JSO A;  4NW2 A;  2JXM B;  1WTP A;  3LWU A;  2IL8 A;  1MGS A;  2OF1 A;  3E5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...