4QL5A

Crystal structure of translation initiation factor if-1 from streptococcus pneumoniae tigr4
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
DVIEVEGKVVDTMPNAMFTVELENGHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of translation initiation factor IF-1 from Streptococcus pneumoniae TIGR4
rcsb
source organism Streptococcus pneumoniae
molecule tags Translation
molecule keywords Translation initiation factor IF-1
total genus 13
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ql5A00
3GD7A 4DV5L 3S15H 3BJUA 3TREA 5C0XG 3KYHC 3L7ZC 5C4JH 2AWOA 3HOYG 4GKJQ 4X66Q 4DV3Q 1S3OA 2V1CC 4BBRH 2BA1A 3UDXA 4DV1L 4A3FH 3S1NH 3OTOL 4LF4Q 4JI4L 1KC8C 3ZJYC 1KHIA 4QJFA 1IZ6A 4OWTB 4MNOA 1N33Q 4KHPL 4LFBL 3KDFA 1EUJA 4LFCQ 4A3CG 4WJ4A 4MTNA 2N3SA 3KF6B 2UXDL 4LUZA 1VS0A 2JEBI 5FJ8G 1LM0A 2JA5G 4LF4L 1G51A 3TEHB 2KENA 3BU2A 4KLKA 1VQIA 2I5HA 2B63H 2HIVA 1X55A 3A0JA 4P71A 2VQFL 4AQYQ 4AIMA 2UXDQ 1KL9A 1TWAH 5JJIA 4DNIA 1VQBA 2DGYA 1N32Q 2ATWA 1YI2A 1JT8A 1Y1WG 3CCVA 4B3TQ 3RN5A 4R4CA 4OONA 1BBWA 1XNRQ 1Z47A 3TRZA 4A3BG 1JJCB 1Z9FA 5BR8Q 3W1GA 5IP7H 1VQMA 1FVIA 1AE3A 5IYCG 4C3IH 5C3EG 3J81j 2UU9Q 1J5EQ 3HKZG 1VQ5A 1X65A 1JJ2A 4IOAA 3JAMi 4DR2Q 4K0KL 3CCEA 2NVXH 4GN3B 5HGQA 1IL2A 4DV0L 4GLVB 2A8VA 3F2DA 4BY7H 4P75A 1IBML 1KXLA 1Q7YC 3ULLA 1IBLQ 2EQSA 4DAMA 4QL5A 4A3GG 4DR7Q 1EIFA 3K0XA 4JI0L 2RHQB 4IPCA 3UDFA 4HJAA 4DR3L 3M4PA 1N8RC 4IPGA 2JA6H 2EIFA 3HOUH 2MQHA 3PUVA 2JA8G 3HOVH 4B3RL 3AFPA 5C44H 2VL6A 4DV7Q 4DK6C 1CKNA 1ASYA 2JQOA 3GTMH 4R4IA 1HR0Q 4LF7Q 1Q12A 4DR7L 5IT9c 5LMNW 4JI8Q 3GO5A 3HOZH 1YNXA 4TVAB 5GAHC 2I5MX 2CWAA 2WB1E 1YZ6A 4R1JA 1XMOL 2LXKA 3F2BA 1KRSA 4A3GH 3PSIA 1IYJB 3ERSX 4O2DA 2RCNA 3RN2A 3UE1A 1E22A 4J15A 3M7NA 4YWLA 1CSPA 3H3VI 5E7NA 4DR4Q 4LW1A 2VNUD 2IX0A 1VQLA 4GNXB 3BZKA 1Q8KA 1R9TH 4BXXG 2PQAB 4DV2Q 2YTYA 2KCTA 4OWXB 4GLXA 1VQ8A 3G4SA 4B3TL 2UUCQ 2VY3A 2CKZB 3PF4A 1YEZA 1VQEA 3STBD 1XNQL 1XTDA 4JI2Q 3CD6A 1E1OA 1A63A 1UE7A 1PHJA 4JI5L 3H3VH 3M3YH 3B6YA 2BH2A 4NB3A 1WJJA 3I4NG 4LF9L 2LSSA 4FDBA 1M1KC 3CC4A 2K4KA 4X64Q 1YHBA 5C44G 1EOVA 3CPFA 1X56A 5M3MG 1PH1A 1PH8A 2B63G 3KJOA 1KIXA 1OTCA 2UXCQ 1VQCA 3CC7A 2IHEA 5M5WH 2PI2E 1EFWA 2JJQA 4OXPA 4X62L 4JV5L 2B3GA 4IFDI 4LFAL 2F4VQ 1L2FA 3NELA 1WI5A 3K7AH 4YHHQ 3RZOH 2QA4A 1SR3A 3I2ZA 5GADC 2HQLA 2OQ0A 3GTKH 5JJKA 4JI8L 1YVCA 4ME3A 2ZJQA 1WYDA 1PH3A 3PO2H 1G291 1Q46A 4UP8A 1NTGA 2R92H 3CCSA 3NENA 3CCLA 2WAQG 3HOWH 4GKKQ 1PH6A 2KHJA 3J80c 3G6EA 1QUQB 2GVAA 3M4QA 3U50C 2ALYB 3FHWA 3H0GG 3VDYA 2JA9A 1PH4A 1N33L 4KHPQ 5M3FH 4JI3L 2Q2IA 4NXML 2KHIA 1K8AC 4H02A 1BBUA 1Y14B 2LXJA 1EIYB 2ID0A 4QY7A 5IE8A 4LF6L 4HJ8A 3HOUG 4OO1G 1UE1A 4DV0Q 3G71A 4L5TA 1LUZA 1C9OA 2VQEQ 2R93G 4BY7G 3S17H 3A5ZB 4GOPB 1K8GA 4MZ9A 4PZ8A 2NN6I 4A3KH 3UE0A 1K9MC 4A3IH 2UXBL 5H1SE 4HIOA 1HH2P 2K5VA 1VQ7A 1CKMA 3RZDH 5BR8L 2OCEA 1N34Q 3KDFB 1OXSC 1L1OC 1BVSA 1TWCH 4X64L 5FLMH 1XJVA 1ASZA 1CUKA 2K52A 3KF6A 2CFMA 4YY3Q 4QQBX 1YJ9A 1HZCA 3S1MH 1L1OB 1YHAA 1VCIA 3PO3G 4DV3L 2Y0SG 4JI1L 2Z0SA 4OX9Q 3S14H 1IBKL 4PZ6A 4TQUS 4AYBE 5IY0A 4YHHL 3U58A 2E2HH 4JI6Q 1FJGL 5C4XG 3M85A 4OWWB 1K0RA 4LFBQ 2MFIA 1TWFH 4O0AA 2K14A 3MEFA 3S2DH 4PG3A 5C0XI 1BKBA 1W3SA 5IYBH 4IFDG 5K36G 4LWCA 1HNXQ 3CAMA 4EQ5A 4A3CH 5IYDG 1QZGA 4A3MH 3K7UC 1HZ9A 4JBMA 5AJ3L 4A3LG 4X65L 1PH5A 3OW2A 1LTLA 2K5NA 2ASBA 2RHSB 2E2JH 4JCVE 1NE3A 2ZJPA 1X6OA 3DLLA 1XMQL 1XPRA 1B70B 2YYZA 1QVFA 3S16H 2PMZE 4POFA 1X3GA 1XNRL 1Q1BA 3E9IA 4GN4B 4BA2I 2GN5A 1YJWA 4JC0A 1EWIA 1P8LA 2ZTEA 2L15A 2NZOA 2K75A 1VQ9A 4P73A 1JB7A 1L0WA 2UU9L 4KI0A 2UXBQ 1CSQA 3E9HA 1E24A 1S40A 1SRUA 1N36L 3OTOQ 2VS1A 1B8AA 2VUMH 1E1TA 2QGQA 4POGA 3KF8B 5EAYA 2BH8A 2JA6G 1Q86C 1PH2A 5DLQE 4L5RC 1JJGA 1DGSA 1VQJA 5ELNA 4GOPC 4JBKA 2AKWB 3RLNA 3HOWG 4DV4Q 4UPAA 2R6GA 1A0IA 4P74A 4APVA 3KFUA 4DV6Q 2K50A 1GM5A 4IOCA 1O7IA 4JI6L 1VQHA 3FP9A 1FJGQ 3F8TA 4B3RQ 2VZAA 2ES2A 1MIUA 2H5XA 4L5QA 4YCUA 1A8VA 1PA6A 4JI3Q 3EBEA 4B3MQ 4LF5Q 4DUZL 1X9NA 1PH7A 3S1QH 4DV4L 4A3KG 1NJIC 1EQQA 5M5YH 2UUAQ 1JE5A 4JI4Q 1HNWL 3AYHB 4JBJA 4DAYB 2VQEL 2KCMA 4HJ5A 1E3PA 1GKHA 3PGZA 2K5HA 2PNHA 2PI2A 1I94Q 2I5LX 2OQKA 2UUAL 4B3SL 1HNWQ 3RLFA 4JOIC 4C2MH 4C3HH 2R7FA 1TWGH 3W5OA 4A93H 4AYBG 2WB1G 3AFQA 2R7ZG 2D62A 1IBLL 4A3JH 3SGIA 4JBWA 4JI0Q 1RL2A 3S1RH 1I5FA 1X3EA 2JA7G 1IXRA 3CCRA 3PO2G 4JI1Q 1PV4A 1TXYA 4NXNL 1HR0L 4A3IG 4LF7L 3RR5A 4DUYL 4DR2L 1SMXA 2RF4A 3IRBA 1V9PA 3TQYA 2R7DA 3CCMA 3BZCA 4BBRG 3T1YL 3CP0A 5LMUQ 5IYBG 1P16A 5C0XJ 4DV1Q 4A3FG 4LFAQ 1HNXL 2CWPA 4NXNQ 3J7A5 2Q2HA 4DR6L 1RIPA 1WCMG 5AJ3Q 3PUYA 4DUYQ 1CKNB 1KQSA 1HNZQ 4DR3Q 4A4IA 1X54A 2NN6G 3KOJA 1H95A 3F2CA 4YWKA 4OX9L 1WOCA 2AHOB 1PVOA 4IJLA 3PUXA 3NBHB 1QVCA 4LUOA 1SE8A 1V43A 3GTQH 2JE6I 4IPDA 2IHFA 1VQPA 3CCQA 1HZAA 3KLWA 4BBSG 2C35B 1SROA 4WJ3M 1UE6A 4A75A 3GTPH 3HKSA 1N32L 4UP9A 4GNXA 1I94L 2I0QA 1JMCA 3I55A 1EQRA 1QVGA 2Q2TA 4PMWA 3CMEA 4DV5Q 4LF8L 4A3BH 4X6AH 3I4MH 3CXCA 1NMGA 3M4OH 2KBNA 3PIPA 3T1HL 3M9BA 3CW2C 4LUVA 4X62Q 4JV5Q 4YCWA 5IP7G 4YWMA 2AWNA 4L5SA 4JG2A 1MJEA 4HJ9A 4GLAC 2NVTH 3EN2A 3ULJA 2YU9H 1Y1WH 4LF8Q 1UE5A 1MKHA 3L2PA 3PIOA 1S72A 1NBWA 3J80i 2ZM6L 4BA1I 3HOXG 2UUBL 4A76A 3A5UA 4DR6Q 2A1AA 2HIXA 3PF5A 2HHHQ 5GROA 3CC2A 2JA5H 3I4NH 4A3DG 1Y1VH 4IO9A 3H0GH 5ELOA 4GNXC 1LYLA 1PYBA 2R93H 3J81c 4DR5L 1U5KA 4ALPA 3S2HH 2ZTDA 1KAWA 1HR0W 5FLMG 3ICEA 2Q2UA 2ZTCA 3MXNB 3HKZE 4DV7L 3E0EA 3GTGH 1YHQA 2EXDA 4XTCS 2UUCL 2VW9A 2HHHL 1YITA 1M90C 3GTLH 1XNQQ 1OXTA 4GN5A 2JK8A 1G6PA 3UDGA 1N9WA 2PQAA 5HY6A 4B3SQ 1HNZL 1AH9A 3STBC 3NEMA 4Y52H 2JA7H 5IYDH 2OWOA 4IFDJ 2MO1A 4HIMA 3K80C 1VQ4A 1VQNA 1J6QA 1VQGA 2R7ZH 2OTJA 4LNQA 1D7QA 4A3DH 2Y0SE 1J5EL 4LF5L 1FGUA 3W1BA 4UY8C 3HOYH 2AMCB 3G48A 5LMNQ 3A74A 1YJNA 4K0KQ 4X65Q 2UXCL 1HJPA 3LGJA 4QIWE 1YIJA 4X66L 4DKAC 1Q82C 2N8NA 3OYYA 3I7FA 4QGUA 2IT1A 3D0FA 1VQ6A 2MO0A 1GVPA 2A19A 1QZHA 1T9HA 5GQOA 1E7ZA 2YV5A 2Z6KA 4YY3L 4NXMQ 3HOVG 3S24A 2NVQH 3PCOB 2IY5B 4C3JH 3AEVA 4R4OA 1OXXK 2D0PA 3Q8DA 1GD7A 4LFCL 3PUWA 1PFSA 1U0LA 3CCUA 1Q81C 1PH9A 1UEBA 3L0OA 5GAGC 5LMUL 3ULPA 4GOPA 1OXVA 1VQFA 1Q1EA 4BXXH 4GS3A 4KHZA 4DPGA 5IWAL 2WAQE 1FL0A 2CCZA 1XPOA 2NVYH 3GDEA 2VQFQ 4AQYL 4JI7Q 1I3QH 4RMFA 4EX5A 3RNUA 5C3EH 4HIDA 2F4VL 4BBSH 2Z6KC 1K73C 1B7YB 5M3MH 5GAEC 3CPWA 2FXQA 3GTOH 3K8AA 2B29A 3T1YQ 4RG1A 1UWVA 4DUZQ 3TS2A 1AE2A 4GKKL 3CF5A 3PO3H 4BY1G 1EYGA 2F52A 1GO3E 5J3BA 5LMNL 3RLOA 5IP9H 4JOIA 4XIGS 4JI2L 1IBMQ 3I4OA 4JI5Q 3FKIH 4HIKA 1K3RA 3T1HQ 4A3EH 4LF9Q 2JEAI 4LF6Q 3DM3A 1MJCA 2E5LL 1V1QA 2QEXA 1WFQA 1I6HH 4NPSA 1VQDA 1K83H 4UP7A 2GVBA 2XTIA 3EIVA 5JEAG 4DR1L 4A3MG 3ER0A 3J81i 2UUBQ 3GTJH 4DK3C 4A3EG 3JC66 1IBKQ 3F1ZA 3K81C 5IYCH 1L1OA 2E2IH 1SFOH 2WP8J 1C7YA 1C0AA 2MNAA 1I50H 2E5LQ 4A93G 1A62A 2D0OA 1KD1C 4BY1H 2E8GA 1Y1VG 4OO1I 1W2BA 4HJ7A 3U4VA 3KJPA 2YTXA 1X3FA 3HOXH 1KRTA 5IWAQ 1XPUA 5M3FG 2IX1A 4R4QA 1N36Q 4DR4L 2JA8H 4JYAQ 2F3IA 5JJLA 1N34L 3I4MG 1D8LA 5FLXc 4JI7L 3CMAA 2XGTA 4DV2L 3TS0A 2R92G 4IJHA 5FJ8H 4Y7NH 2ZM6Q 3PV0A 2DUDA 1VQKA 1VQAA 1TWHH 1YBYA 1PYSB 3WWVA 1NY4A 3AQQA 4JYAL 2YTVA 3HFZB 2CQOA 1SN8A 4DR5Q 3CCJA 4A3LH 4R4TA 1HZBA 1SLJA 2NZHA 3U4ZA 3PUZA 3H15A 2N78A 2BA0A 5JEAJ 1XMOQ 3FKIG 2WFWA 4IPHA 3J7ZC 3D31A 1OXUA 1QUQA 4A3JG 5IP9G 4B3ML 3CQZH 4AH6A 3HOZG 2ZJRA 2HT1A 4GKJL 4YCVA 4P72A 1VQOA 2N49A 5M5XH 4DR1Q 5C4XH 2VUMG 3JAMc 4DV6L 3UDIA 3I56A 1XMQQ 4PZ7A 1CKOA 1WCMH 1NMFA 2OTLA
chains in the Genus database with same CATH superfamily
3S15H 2EYLA 3BJUA 3HOYG 4X66Q 1S3OA 1F2LA 4K2LA 4BBRH 1L0YB 5C3WA 3ZJYC 4QJFA 1IZ6A 2CW0C 4MNOA 3DWPA 1ZYRD 3HG9A 4N8X1 2N3SA 2UXDL 2K01A 1VS0A 5FJ8G 4KJNA 1MGSA 2JA5G 5G3LF 4LF4L 5E4XA 4ZCKA 4FVMA 1VQIA 2B63H 4OO1H 2HIVA 1X55A 1S5BD 2F4IA 2B63B 4DNIA 1JT8A 1N32Q 2L11A 5IGDA 2F03A 2L1BA 4FF4A 1FYCA 3GTMB 1YNJD 2WACA 1Z47A 4A3BG 1JJCB 1N34L 4C3IH 3J81j 2OT2A 2DNEA 2JA6B 2B2UA 2BE5D 2Q8RE 1WTXA 3OIQA 5FLXE 3H09A 3LWUA 1QNUA 4BY7H 5IGFA 1Q7YC 4PV1C 2F0QA 2BDOA 3S2DB 1U9RA 1MD2D 1EIFA 3K0XA 4IPCA 3M4PA 2MQHA 2ICIA 3HOVH 4B3RL 4K5XA 2K03A 1CKNA 1ASYA 2GA4B 3GTMH 2ZXPA 2B2UC 3VYSA 5CV9A 3SK5A 4FXKC 3X3NA 1A3VA 2DY7A 4A3EB 4NW2A 2CWAA 1TY2A 1YZ6A 2LXKA 1IYJB 1JE4A 3UE1A 1E22A 4J15A 4YWLA 1O7LA 3H3VI 4LW1A 2VNUD 2QW7A 1VQLA 3BZKA 5LL6X 1R9TH 4BXXG 2PQAB 5IGGA 2KCTA 4RCOA 5ELCA 4B3TL 5A35A 1XNQL 3CD6A 1E1OA 5C3EB 1SNQA 1PRTD 1UE7A 4JI5L 2D9UA 4CHTB 1PZID 4TRDA 4NB3A 5C4JB 3J81L 2K4KA 4X64Q 5C44G 3CPFA 1X56A 1PH1A 3C1EA 4C3IB 2O5IC 3NSWA 1VQCA 1EFWA 4JV5L 2B3GA 2F4VQ 1WI5A 2X6LA 1SR3A 3GTKH 5BN5A 1HXYD 1BOSA 4F87A 2ZJQA 4OGQC 4O42A 5M5WB 2R92H 4GKKQ 3BDCA 4ZUJA 3NP8A 1PH6A 3HOVB 1ET9A 1STEA 2ALYB 3FHWA 3H0GG 1N33L 1J8IA 1I4HA 1LACA 2EJGC 2Q2IA 2MGSA 2MHVA 3GV6A 3I4LA 4H02A 1BBUA 1Y14B 4RGMA 1K8AC 2LMCB 1EIYB 4LF6L 3A56A 4XT3B 1T5EA 4DXGA 3WOFA 4DV0Q 1TY0A 3QIAA 5AFWA 2VQEQ 4E6IA 1K8GA 2LKVA 3IAYA 4PZ8A 2J4XA 3I4NB 1K9MC 4A3IH 1E0BA 5KRUA 3RZDH 5BR8L 1B9NA 1OXSC 1W6JA 1BVSA 4YY3Q 3KF6A 1LT4D 4HTHA 1HZCA 1IW7D 3BVZA 1UUPA 4V0BA 4FF1A 1VCIA 3E5SA 4JI1L 3R2TA 2PZWA 4K2KA 4OX9Q 4TQUS 1VMPA 1FJGL 2F0KA 5E4WC 2K5DA 1EL0A 4KV6A 3S2DH 2OF1A 4PG3A 5C0XI 2RDHA 3BDLA 3I72A 5K36G 1HNXQ 5I9PA 1EYCA 2XVSA 2SOBA 4DXFA 4EQ5A 3K7UC 4QCLA 2SEBD 3H6MA 1SFOB 5D3DA 2PZUA 2ZJPA 1X6OA 3DLLA 1XMQL 2EOTA 2H4OA 3S2HB 4WRDA 4JC0A 1EWIA 5I2XA 2UU9L 4P73A 2DNCA 3BYTB 1JB7A 3E9HA 1S40A 4MTKA 5DEHA 1N36L 2VS1A 1B8AA 1S5FD 2QGQA 3M7GA 3T53B 3J80E 4L5RC 1VQJA 5CMDA 1SEBD 3DWAA 2VB2X 2RA4A 1GM5A 3URYA 1FD7D 4IOCA 1O7IA 2CH4A 1FJGQ 5DAUA 3NTHA 1MIUA 4H44C 4LF5Q 1SDFA 5A2QL 3QB3A 1NAPA 2JXMB 1PH7A 1NJIC 1EQQA 5M5YH 4MIUA 1DOLA 2XNAC 1UNSA 3SEBA 3CHBD 4DAYB 2WKCA 4XDXA 1E3PA 4HJ5A 5L37A 2I5LX 1HHVA 1HUNA 1O7YA 4ZAIA 5EBDA 4P2CB 4G7ZC 1QNKA 1IKMA 1YNJC 1NR4A 4UDUC 5CORA 3S1RB 1TXYA 4NXNL 3TP7A 4DUYL 3F2UA 3TSSA 4CJ2C 5FO8B 1F2MA 1V9PA 2R7DA 4MN3A 4FXGC 4A3FG 2R93G 4DV1Q 5IYBG 1P16A 4IFDH 4LFAQ 2IPKD 2PYKA 3D6CA 5JVH3 5C6AA 1CKNB 4FF2A 5CV7A 1X54A 2NN6G 1CA6A 3F2CA 4YWKA 2EYOA 3GTQH 3MA2B 1HFGA 2IHFA 3V2TA 3CCQA 1HZAA 3DHQA 3SR1A 4IN3A 2XWJB 4A75A 3I70A 3HKSA 1JOQA 2PMZB 1PYWD 1QG7A 2FFKB 1I94L 1JMCA 3I55A 5DM73 1CI3M 1QVGA 1CQFA 3Q0AA 4DV5Q 3S9WA 1NMGA 3OMCA 4DK1A 1J9OA 4JV5Q 2AWNA 4L5SA 1PFMA 1V1OA 3ULJA 2YU9H 1MKHA 4R8NA 2E74C 3G6JB 4RHRA 3PF5A 2HHHQ 1ILPA 5GROA 2RSOA 2VXWA 4BY1B 1I4QA 4GNXC 4DR5L 3NTIA 1HR0W 2Q2UA 3SE0A 3GTGH 3E0EA 1VDZA 2EXDA 2Z4HA 2A69D 1YITA 1DJRD 2E76C 3UDGA 1N9WA 1WTRA 2A6ED 4XQJA 3I90A 1FR3A 1W6KA 3X3MA 4LNQA 3NQIA 3KLSA 3W1BA 3H94A 3G48A 4K0KQ 2HDLA 3LGJA 4X66L 4DKAC 3OYYA 2N8NA 1C8CA 3IKJA 4QGUA 5FO7B 1BNZA 2MP1A 1K83B 2A19A 3EQLC 1T9HA 4LK1C 1E7ZA 2YV5A 5IT9L 4YY3L 3S24A 1B1ZA 4KY7A 4YIJA 4R4OA 3CCUA 1PFSA 3L0OA 3ULPA 1TWCB 3MWYW 1VQFA 4DAPA 3A7LA 4BXXH 2ICEC 2Z4IA 1QJOA 5IWAL 3DWQA 1FL0A 2CCZA 4U673 5EKIA 5JAVA 3GDEA 4JI7Q 1I3QH 4EX5A 3RNUA 1Q8IA 2Z6KC 3DEOA 1RHPA 3L9AX 1TWFB 1DZ1A 3CPWA 3BDOA 4QUFA 2F0IA 4RGTA 4BY1G 1LLRD 2B2TC 2LY7A 3RLOA 5IGCA 3SK6A 1U4MA 4KKSA 3EVQA 4LF9Q 3DM3A 1QWYA 4V190 4NPSA 3EIVA 1IBKQ 1Y8OB 5IYCH 3OPOA 1B9MA 2OXPA 1SFOH 1C7YA 2MNAA 1Z7TA 1KDCA 1I50H 1KD1C 1AEXA 5ISRA 1XTCD 1Y1VG 4OO1I 1W2BA 3U4VA 3MXUA 2JA8B 5M5YB 2YTXA 1X3FA 1LTBD 1XPUA 4J6HA 2IX1A 1N36Q 5JJLA 3I4MG 1R9TB 2WINB 3TS0A 4IJHA 5FJ8H 1QE6A 2DUDA 3W3AA 1YBYA 3WWVA 5I2YA 5EBCA 3ERQA 4A3LH 2F0LA 4R4TA 1NUCA 2F3WA 5JEAJ 3FKIG 2WFWA 3D31A 1OXUA 1QUQA 5IP9G 3CQZH 2D2CC 4AH6A 3GTGB 2NZ1D 2G9DA 1Z6HA 5M5XH 1KNAA 1WTOA 5C4XH 4N8FA 1XWEA 4KN4C 1R4PB 3UDIA 3I56A 4PZ7A 1G291 2JA5B 2R3ZA 2OTLA 4EVOA 5C0XG 3KYHC 4WJWA 2AWOA 3T56B 4IUPA 2KVMA 4DV1L 4BBSB 3UDXA 3TP8A 1KDBA 1O78A 2WAQB 4IUUA 4KJOA 1CFMA 2B2TA 1N33Q 1EUJA 1EWHA 4WFN3 4WJ4A 3OSOA 4KK7A 3PIO3 1PZJD 4HSVA 5M5XB 1TWAB 1TQOA 2KENA 3BU2A 3GTKB 4AQYQ 4P71A 1SNMA 3HOZB 1CHQD 2ATWA 1YI2A 2NTTA 3A8JE 5C44B 1Y1WG 4RKLA 4R4CA 4OONA 1BBWA 1LT6D 1GUOA 1XNRQ 3TRZA 1MBYA 5BR8Q 1AE3A 1KAAA 2E2DC 3NBHA 1J5EQ 1DOMA 3HKZG 1LTID 1VQ5A 1X65A 4DR2Q 2Q8IB 3KK7A 4K14A 2NVXH 1IL2A 3CRKC 5HGQA 4G57A 4DV0L 5JPMC 1IBLQ 3R8BA 4G4KA 2RVLA 3QOJA 4DR7Q 4R8IA 1BQQT 4OHJA 5M3FB 4JI0L 4A3GG 4DR3L 2QKIC 4IPGA 3PUVA 4CKCA 2NN6H 5C44H 2VL6A 2L5TA 1KTKA 1O7ZA 4DK6C 4FF3A 5CGKA 4R4IA 1HR0Q 4LF7Q 1ZYRC 4KN7C 4ZK9B 1UAPA 2I07B 2CW0D 2Z9HA 3RZOB 2WKDA 3F2BA 3M4YA 1HA5A 3HZXA 3M7NA 3QG1A 5E7NA 2IX0A 4GNXB 1Q8KA 3DEPA 2YTYA 1VQ8A 4JVZA 2VY3A 2KCCA 3PF4A 1VQEA 4DAYA 3TP5A 4JI2Q 1PHJA 4A3FB 3M3YH 4KKUA 1WJJA 4H7BA 2B2VA 5C4ZA 1ZKOA 1JOOA 1KIXA 4DN4M 5C5LA 3H3VC 4CKEA 1XXGA 3K58A 2JJQA 1SMYD 4IFDI 2EE1A 1L2FA 3NELA 3MHBA 3BVGA 2QA4A 3NTKA 1KNEA 4RFBA 5JJKA 3TBIB 3T51B 1PH3A 2G9HD 3IFDA 1SSOA 3Q23A 1NTGA 4PNYA 3CCSA 3HOWH 5IIFA 4QUCA 3J80c 1I4PA 5C5MA 1QUQB 1PH4A 3VDYA 2JA9A 2QDLA 1AN8A 3HOYB 4NXML 1ZEQX 2ID0A 1DONA 4HJ8A 1UE1A 1EQVA 1JWMD 3G71A 1WTHA 4ZKBB 1GUNA 1JR0D 2KEEA 2F0GA 4BY7G 2XIWA 1QOHA 3HOWB 4MZ9A 3UE0A 2B8FA 5H1SE 3QJYA 1HH2P 5J1ZA 4DR6L 5EPLA 4CJ0B 2WIIB 4X64L 1L1OC 2L9HA 4J1MA 4DV3L 2Y0SG 1SYGA 5E3FA 2K05A 1IBKL 4PZ6A 3U58A 5C4XG 3BG3A 4LFBQ 1SJHD 5HGTA 2MFIA 4O0AA 1M8AA 1PFNA 3I8ZA 1SAPA 1EY6A 2PW7A 2CVRA 4LWCA 3CAMA 1I4GA 5IGBA 5IYDG 4JBMA 4X65L 2KJXA 3GTLB 3T13A 3OW2A 2K5NA 2RHSB 1PRTB 2Z1CA 4JCVE 5CC4A 1HPCA 2YYZA 2HDMA 4BS9A 4POFA 1AZQA 1Q1BA 2GN5A 5I4DA 2L15A 3T4AC 2K75A 1XYIA 1VQ9A 2KOLA 1E24A 5KIXA 4ODGA 2VUMH 1E1TA 5EAYA 2BH8A 2K28A 3OW7A 2JA6G 3M4OB 4NP5A 1PH2A 4GOPC 3NXWA 1STYA 4DGZA 5C3XA 5JVG3 4DV4Q 4UPAA 4APVA 3GQBA 4I7ZC 2IX3A 2F0TA 2K50A 1VQHA 3FP9A 1GOZA 1EU3A 1RJTA 2VZAA 2H5XA 4L5QA 4YCUA 1A8VA 4JI3Q 2JA7B 3EBEA 3S1QH 3PIP3 1B53A 2NTSA 4ZRZA 5IOCA 1JE5A 4N9PA 3AYHB 4X3SA 1PDQA 2EY5A 5CV5A 1ICFB 2A6HD 3CRLC 4I7AA 4KY6A 4CDFC 3K57A 3PGZA 2PNHA 2PI2A 2UUAL 1HNWQ 4JOIC 4C3HH 3W5OA 3AFQA 2D62A 1IBLL 4A3JH 3NHHA 4JI0Q 5J39A 3TZDA 2JA7G 1SXTA 2BDNA 3CCRA 3S14B 1PV4A 2HCIA 1HR0L 1G2SA 4LF7L 3RR5A 4DR2L 1SMXA 1KLUD 2NVXB 2KQ3A 5C0XJ 3LNNA 1GUWA 2CWPA 3J7AF 1SNOA 5AJ3Q 4DR3Q 1PZKD 5ELFA 1PVOA 2J7ZA 3NBHB 1QVCA 1SE8A 1V43A 1H9RA 2JE6I 2QILA 2AQ3B 5KNDA 1STHA 3KLWA 4DNTB 2C35B 2B2YC 2K32A 4LJZC 4XXEA 3Q6SA 3CMEA 4X3KA 2KBNA 3M9BA 2K5QA 1BUVT 4YCWA 4JG2A 1RCVD 4A3GB 2NVTH 4KMUC 3SXHA 1Y1WH 1KABA 4LF8Q 3AB9A 3PIOA 2F3VA 2IJ0A 2A1AA 1B3QA 1WTVA 1GUTA 2JA5H 3DUZA 2QDBA 5ELOA 4IO9A 3MEHA 3S2HH 1KAWA 3H91A 3HKZE 4DV7L 2VW9A 2NB0A 1OXTA 4GN5A 3TDQA 4BY7B 2X69A 4B3SQ 5CBEE 4HCEA 4EQNA 2MO1A 2OEOA 4HIMA 3K80C 2R7ZH 4UHVA 3HOYH 4UY8C 5EPJA 2AMCB 3A74A 1GXDC 2UXCL 2E2IB 1CM9A 1Q82C 1GHKA 1TS2A 4G7OC 1GVPA 4NXMQ 4C2MB 3K5OA 3AEVA 1GD7A 3PUWA 1V8QA 1UEBA 4RH6A 5GAGC 5LMUL 3NQTA 3V96A 1V1PA 5I6YA 1BCPD 4AQYL 4DAVA 5EKLA 5KNBA 1LV9A 4RMFA 4K5VA 4X3TA 3KLRA 5C3EH 4HIDA 5M9OA 4BBSH 1ICWA 3E0JA 3GTOH 1JICA 3A7AB 4C56C 2HD3A 3T1YQ 2E2HB 4RG1A 4DUZQ 1SYCA 2KUMA 3CF5A 3PO3H 2F52A 4XIGS 3I4OA 3VR3A 4JI5Q 3T16A 2EYHA 1YNND 3CQZB 3FKIH 5C4HA 3T1HQ 2JEAI 2A68C 5I6WA 1ET6A 1V1QA 4PMCA 2K6AA 5FK9C 4CDCC 4A3MG 2GVBA 3ER0A 1O80A 4I65A 4NMZA 3GTJH 1ZXTA 4A3EG 3HEJA 1TWHB 2E2IH 1C0AA 4Y7NB 3K5MA 3TMEA 2E5LQ 2EDGA 1A62A 4BY1H 3M3YB 4HEDA 4TKOB 4HJ7A 4A3MB 2PZTA 2B8GA 5IWAQ 5M3FG 2PW5A 4R4QA 1EZ8A 2JA8H 2F3IA 3BVMA 1D8LA 5FLXc 4JI7L 1PTOB 4DA2A 2R92G 1BR9A 3WDNA 1TWHH 5NUCA 3E6ZX 3AQQA 4JYAL 2KA7A 1SN8A 3CCJA 3HRZC 1HZBA 2NZHA 3PUZA 5KNCA 3OHXC 1A2TA 5CR3A 3SVMA 4A3IB 1X3PA 3RZDB 4WORA 1SNDA 4YCVA 2TSSA 4HSPA 2N49A 2VUMG 5FLXL 1EQTA 2CH4W 4DV6L 1ENAA 1CKOA 1PTOH 1SYFA 1CZGA 2EPBA 3GD7A 3IFTA 2R7ZB 4NKLA 3GTPB 3TREA 4GKJQ 1JQYD 3S1NH 4A3FH 2BA1A 2EY2A 2K33A 2QEJC 2FJ2A 5ELDA 3OTOL 4LF4Q 4JI4L 2EYMA 3S1NB 4L6TB 1KHIA 1FNUA 3V05A 1SE2A 1HUMA 4IQZA 3J81E 3KDFA 4A3CG 4H0LC 4MTNA 1JWUD 1IKLA 4LUZA 2JEBI 4TSSA 1LM0A 1Q3LA 4OIKA 1G51A 3TEHB 4C3HG 2PQEA 2I5HA 4AIMA 2UXDQ 1TWAH 3SK4A 2DGYA 1EY8A 3VR4A 1QILA 5JOBA 3RN5A 2RDGA 2RQXA 1JCKB 1Z9FA 3D4DA 5IP7H 2UU9Q 2F0JA 3P7JA 1STAA 4IOAA 1JJ2A 3JAMi 3CCEA 2PPBC 4DNRB 3HOXB 2EY1A 4P75A 1IBML 1KXLA 2RDFA 3FMCA 2EQSA 3NE5B 1DOKA 4Q0FA 4DAMA 3UDFA 1N8RC 4C3JG 1F9PA 2JA6H 1ONLA 3AFPA 3RMHA 4DV7Q 2B2WA 1Y1VB 1D1IA 2CQAA 2JQOA 3R93A 1BCPC 2TMPA 5LMNW 5IT9E 3GO5A 4EQPA 3HOZH 4PQXA 5GAHC 2I5MX 4DF7A 4R1JA 1XMOL 3K6OA 1KRSA 3RN2A 4DR4Q 3PO3B 2EYFA 4DV2Q 4OWXB 2KECA 5K36H 3FPPA 4Q5VA 1TS5A 2CKZB 1B2TA 1YEZA 3VA5A 2Q8TA 3QOLA 1A3UA 2RKSA 3MAQA 3B6YA 2BH2A 1WTQA 2O4XA 1EY7A 4BWGB 2F0PA 2EYJA 4FDBA 3EJIA 5M3MG 2AQ1B 4IUTA 5T1IA 4ZLTF 5KYLA 1PH8A 3KJOA 5ELEA 1OTCA 1KDAA 3A54A 2UXCQ 3CC7A 1WVLA 2IHEA 5M5WH 2PI2E 4OXPA 2FINB 4X3UA 1HTPA 4LFAL 1EFID 4G7HC 4YHHQ 3RZOH 2NYZD 3D3RA 3I2ZA 2HQLA 2OQ0A 1RTNA 1TT2A 4ME3A 3PO2H 1WYDA 3NK9A 4UP8A 1TS4A 3NENA 3G6EA 4FP5D 1XX8A 2GVAA 5KEEA 4KHPQ 3RUZA 5M3FH 1TS3A 4JI3L 2KHIA 2IWHA 2LXJA 3P1HA 3HOUG 1HRJA 2F0VA 1MSGA 4RGNA 2L0CA 2B2WC 1LTSD 2NVYB 1DYQA 4GOPB 3LWEA 1EY4A 3Q24A 1ENCA 1TIID 2RCFA 2K5VA 2OCEA 3KDFB 1TWCH 1PXUA 5FLMH 1XJVA 1CUKA 1I6HB 2K52A 4QQBX 2CFMA 2F0WA 3BS1A 2N55A 4IURA 3I4MB 3S14H 2E2HH 4IUNA 1DXMA 1TWFH 3MEFA 2PO4A 5LL6S 4CGYB 1DCZA 5IYBH 4IFDG 1IYVA 4KY5A 4A3CH 1QZGA 4A3MH 3SK8A 4K6LA 1I4XA 1LTRD 5AJ3L 1CA5A 4A3LG 5JPNC 1NE3A 2XWBB 2V4DA 1XPRA 1G6ZA 2PMZE 3GP7A 2ZXRA 4GN4B 3JAML 2ZTEA 4OELB 1L0WA 4KI0A 2ZT9C 5D65A 3OTOQ 1HA6A 4POGA 1EY9A 1IYUA 3KF8B 1Q86C 3RD4A 1DGSA 1TVXA 1A0IA 4P74A 4NDXA 2EJMA 4DV6Q 3EROA 3F8TA 4RGOS 4B3RQ 1II3A 1PA6A 1R4QB 1VF5C 3C46A 4A3KG 4JI4Q 4JBJA 4L8JA 1I50B 2KCMA 2XN9C 5G3LD 2K5HA 1YNNC 2E75C 1K28A 1E2VA 1WD1A 4B3SL 3P20A 2SNSA 3K5LA 3I3CA 1WTPA 2R7FA 3N52A 2WB1G 2MUYA 2R61A 3U9SA 3SGIA 4JBWA 1I5FA 1KLGD 1F77A 1MI2A 1IXRA 4K5WA 5EGTA 3OIPA 1L0XB 3PO2G 1GHJA 5KYIA 1PMRA 4ZKCB 1IW7C 2RF4A 3IRBA 3VYRA 3T1YL 3BZCA 4BBRG 3CP0A 2EY6A 3FDTA 5LMUQ 4NXNQ 2F0SA 4HAEA 3EA6A 3FPUB 3PUYA 4DUYQ 1LT3D 1KQSA 1HNZQ 3U9OA 4A4IA 2F0EA 3KOJA 1H95A 3HP3A 1EY5A 1WOCA 1SYBA 4IJLA 3PUXA 1H9SA 3KBGA 1VQPA 3PQIA 2NVQB 1AFPA 1C4QA 3NWTA 1SROA 4WJ3M 1D5ZC 1UE6A 3J80L 1B3AA 4UP9A 2I0QA 1EQRA 3K59A 4X6AH 4A3BH 4RKBA 1LO5D 3M4OH 3PIPA 3T1HL 4LUVA 1E2WA 4M1UB 4HJ9A 4GLAC 3EN2A 3I91A 5FO9B 2Y0SB 3L2PA 1PFBA 1BCPF 1NBWA 3J80i 4BA1I 3HOXG 4A76A 4A3DG 3I4NH 1F2YA 3J7AV 2B2YA 3H0GH 2P5ZX 1LYLA 1PYBA 3GV3A 2R93H 3QWNA 1U5KA 4ALPA 2ZTDA 5FOBB 3ND8A 5FLMG 2R93B 5BN3A 1YHQA 2UUCL 2E2JB 2XSCA 1S5DD 2HHHL 2JK8A 2AQ2B 3FRPB 1G6PA 4JW0A 1AH9A 3STBC 3NEMA 5KGUA 2EVBA 4Y52H 2OWOA 4IFDJ 1MHWC 1VQ4A 1VQGA 4HR7B 4S3SA 3JAME 1D7QA 2Y0SE 1J5EL 1FGUA 5LMNQ 4Z9CB 1K8MA 1F9SA 1HJPA 1YIJA 4QF4A 1VQ6A 1CQVA 3I7FA 2NBFA 2IT1A 1GUSA 3D0FA 1Y69U 2MO0A 3OWFA 1QZHA 1UEAB 4R9WA 3DM1A 5K5PA 2NVQH 2IY5B 1I4RA 2D0PA 1Q81C 1A15A 1U0LA 5DNFA 1PH9A 5F2DA 3K7AB 2L4NA 1Q1EA 4GS3A 1PTOC 1QCBD 4DPGA 4A3KB 2WAQE 2J0TD 4B08A 1BDOA 2NVYH 1TU2B 2O5JC 4C3IG 5COYA 1EIHA 4N9TA 5M3MB 2K5WA 1IL8A 1HQRD 1B7YB 5M3MH 5GAEC 2ENBA 2FXQA 4L63B 4CDDC 4PMBA 1G8ZD 1AE2A 2HCCA 3TS2A 2DJGC 2NWGA 1EYGA 1ENFA 1GO3E 5CV6A 5LMNL 4A3DB 5IP9H 4JI2L 1IBMQ 4HIKA 4A3EH 1RODA 1MJCA 1WFQA 1I6HH 1VQDA 2L55A 5JEAG 2XTIA 4ABNA 1BF4A 2UUBQ 2C5CA 1S4ZA 3JC66 3F1ZA 4DU9A 3K81C 4IUVA 1G2TA 1L1OA 3OOCA 1TR5A 2FMMA 1D2BA 2E8GA 2A6EC 1ESRA 4RA8A 1D6EC 3HOXH 3K5NA 1FGBD 1K0SA 1C48A 4DR4L 4IUQA 1E2ZA 4KHVA 1H9JA 3CMAA 2XGTA 4DV2L 2ZM6Q 1K8OA 1VQKA 1VQAA 3BZDB 4XT1B 3MXPA 1PYSB 1LTAD 1NY4A 2YTVA 3HFZB 2F0UA 4XQNA 2CQOA 3U4ZA 1SLJA 3H15A 1Y8PB 1XMOQ 4IPHA 5LHY1 3OMGA 1Y1WB 4OEMB 4A3JG 4RWSC 2ZJRA 2HT1A 2IL8A 3S17B 1F9RA 3JAMc 1A6XA 3VYTA 2F1MA 2EXZA 5D14A 3UI2A 1EIGA 3HOUB 1WCMH 1NMFA 4DV5L 5I9OA 3L7ZC 4AYBB 5C4JH 2DN8A 1BCPB 1T5XD 4OL7A 2V1CC 4DV3Q 1NCVA 3TZUA 1KC8C 5D3IB 4O1NA 4OWTB 1OO9B 3ND9A 4KHPL 4LFBL 1EEFD 4LFCQ 5ELBA 3KF6B 3WOEA 4RCNA 3E3XA 1FNWA 4KLKA 2VUMB 2BE5C 2MJ8A 3ONAB 2VQFL 3A0JA 5JJIA 1KL9A 1VQBA 3MFYA 3C2PA 3CCVA 4B3TQ 2JSOA 4KTAA 1JWSD 1SNPA 3S16B 1VQMA 3W1GA 1FVIA 3VYUA 1RD9D 5IYCG 5C3EG 1H9SB 3SDZA 4K0KL 1JOKA 4KKTA 4GN3B 1EYDA 2N88A 4UAIA 4GLVB 2A8VA 2H1EA 3F2DA 1BBXC 4FXDA 3ULLA 1JC7A 5FKAC 2A5HA 4QL5A 4ULLA 1A2UA 2RHQB 4HJAA 1SYDA 1F9QA 1MSHA 2EIFA 2K1BA 3HOUH 2JA8G 2JYOA 1PTOD 4IZ8A 2QF7A 5DM63 5J22A 2F0FA 1G91A 1Q12A 4QMGA 4DR7L 2D5DA 5IT9c 4JI8Q 4FYDA 1IHZA 1H9KA 1YNXA 4TVAB 2WB1E 2AUJD 2NUCA 1RF2D 4A3GH 3L3OC 3PSIA 3ERSX 4O2DA 1JB3A 2RCNA 2PCFB 1AZPA 1HFNA 1SE3A 1CSPA 3MTSA 1NR2A 1STNA 1Q90A 1AW7A 3NUCA 4GLXA 4B9XA 1JORA 3G4SA 2UUCQ 3STBD 1XTDA 4FNFA 3A55A 1A63A 4BBRB 1EEID 5CV4A 3H3VH 3I4NG 4LF9L 1B44D 1SE4A 2K7VA 2LSSA 2RSNA 1M1KC 3CC4A 1YHBA 1EOVA 3A8KE 1H9MA 2B63G 4LAAA 5BN4A 5EJWA 1U4RA 1AP0A 3VR2A 4X62L 2F0HA 3K0YA 1FNVA 3K7AH 3MXNA 2XRQD 3S1QB 1EOTA 1X3QA 1EYAA 3MXGA 5GADC 4JI8L 1PTOF 1YVCA 1V1PB 4ME5A 2BCOA 3TN2A 1Q46A 2HQEA 3MZ5A 3HGBA 2WAQG 3CCLA 2KHJA 3M4QA 3U50C 1CZWA 1EU4A 4IALA 5IE8A 4QY7A 1NNXA 4OO1G 1WTWA 2A68D 4L5TA 1LUZA 4JK1C 1C9OA 2M00A 4QIWB 3BYYB 1I3QB 2XRSD 3S17H 3A5ZB 1STBA 2G5DA 2NN6I 4A3KH 2UXBL 4C1NI 4HIOA 3DXJC 3R3OA 1VQ7A 1CKMA 1N34Q 1ASZA 1F2ZA 1YJ9A 3P75A 2O2LD 3S1MH 3SHLA 1L1OB 2K04A 2F0OA 1YHAA 3PO3G 5EQ0A 2NVTB 4ID6A 2IW3A 2Z0SA 2JP1A 4YHHL 4AYBE 5IY0A 3D4RA 4JI6Q 1BXTA 3M85A 1SBBB 2EZVA 4OWWB 1K0RA 1WD0A 2K14A 1D5XC 1BKBA 1W3SA 3GTOB 3LX0A 2F0NA 3GTQB 2F0DA 1TWGB 4A93B 1HZ9A 5TSSA 1PH5A 1LTLA 2ASBA 2E2JH 4XYOA 5EPKA 1SJED 1B70B 1QVFA 3S16H 5C4XB 1X3GA 1XNRL 2LS01 1PRTC 3E9IA 4BA2I 1YJWA 1P8LA 2NZOA 4HN7A 2A69C 1CSQA 2UXBQ 2JN4A 2YU9B 1SRUA 2M2LA 5EKKA 2A6HC 1HQMC 1ILQA 5IODA 5DLQE 4A3BB 1JJGA 2A73B 5ELNA 4JBKA 1SMYC 2AKWB 3RLNA 1CT1D 3HOWG 2R6GA 3KFUA 2BOSA 2VB3X 2AUKA 4ZYSA 4JI6L 3PO2B 1S5CD 1U4LA 2ES2A 2M9VA 3MVVA 1DM0B 3EFXD 4C3HB 3VA7A 4B3MQ 4DUZL 1X9NA 4DV4L 2UUAQ 1HNWL 3G7LA 1LTTD 2ZXOA 3I73A 1EWCA 3C1FA 3H0GB 3NPPA 2VQEL 1GKHA 1NSNS 3GTJB 4F7XA 3OWEB 1I94Q 1SYEA 2OQKA 3RLFA 4C2MH 3R2IA 1TWGH 4ZUIA 4A93H 4AYBG 2SDFA 2R7ZG 4XYQA 1RL2A 1X32A 3S1RH 1X3EA 2PNRC 1VMCA 2C9OA 3FEWX 4JI1Q 3J7YW 4RAUC 3QO2A 4A3IG 4A3JB 4J8QA 3AU7A 3CCMA 3TQYA 3CKIB 3VR5A 1PRTF 3C3LA 1HNXL 3J7A5 2Q2HA 1RIPA 1WCMG 3D8GA 1EY0A 3NWSA 4FO2A 3AMUA 4KD4A 4OX9L 2AHOB 1CK1A 4LUOA 4IPDA 1PLFA 3GTPH 1N32L 4ZQ3A 4GNXA 1RDPD 4K8JA 3CU7A 2Q2TA 4LF8L 4PMWA 5CBAE 3I4MH 2EYPA 3CXCA 3CW2C 1Y8NB 4X62Q 5IP7G 4YWMA 1MJEA 4M8AA 1UE5A 4MHEA 1STGA 1S72A 3A8IE 2UUBL 2ZM6L 1ML0D 3W2DA 4DR6Q 3A5UA 2I46A 2HIXA 2QCPX 4OIJA 1WCMB 3CC2A 1Y1VH 3D4WA 4HMIA 4C1NK 3HKZB 2Z8LA 3J81c 2F0MA 2KEDA 3ICEA 4HCSA 1B50A 2ZTCA 3MXNB 1I6VC 1ESFA 4XTCS 3KBXA 1M90C 3GTLH 1XNQQ 4LMQD 2PQAA 3KUPA 5HY6A 1HNZL 2X6GA 2JA7H 5IYDH 5C0XH 1LABA 1VQNA 3S15B 1J6QA 1CHPD 2OTJA 4A3DH 4LF5L 1SNCA 1VF7A 1YJNA 4K6DA 4X65Q 4QB4A 4QIWE 2KCNA 2WB1B 2DJFC 4F8MA 4CJ1B 1GJXA 4EGVA 1B4OA 3PMFA 2L12A 3ITPA 5GQOA 1TKWB 2Z6KA 3HOVG 2B2VC 1BO0A 3PCOB 2MPMA 4JPBW 4C3JH 4K8IA 4LFCL 1OXXK 3Q8DA 4BBSG 4XQQA 3DMUA 4CBVA 4GOPA 1OXVA 3FVQA 3O13A 4B9WA 2EJFC 4ILWA 4KHZA 2LFNA 1XPOA 3VR6A 2VQFQ 1M4VA 4H13C 3NBIA 2F4VL 3D6WA 3TP6A 4EQOA 1K73C 4RHSA 3FKIB 1GUGA 3Q22A 3N6RA 2A74C 5CV8A 3K8AA 2B29A 1UWVA 1EZ6A 3MFGA 4GKKL 1QB5D 5T1GA 1D5MC 1HCZA 2SNMA 2Z6BA 4KD3A 3S1MB 5J3BA 1CTMA 4JOIA 2R92B 5JEAH 1RKNA 5E1FA 1K3RA 4LF6Q 5IGEA 2E5LL 3MC0B 2QEXA 3KLSX 2KHSA 4UP7A 1K83H 3HS0C 4DR1L 3J81i 4DK3C 4CDEC 2WP8J 4A93G 2DY8A 2D0OA 1LTGD 5CYUA 3KJPA 1S5ED 4C3JB 3QR8A 1KRTA 2CHBD 1DD2A 2RBMA 4HMJA 4JYAQ 1RTOA 2HUGA 2B39A 4CKBA 1D1KA 1K3BC 5HURA 4U68A 3IL8A 4Y7NH 3PV0A 5JJZA 1A3TA 2FHTA 4DR5Q 2N78A 2BA0A 2FMCA 1LT5D 4DFAA 4DK0A 3J7ZC 4B3ML 3ZYYX 1U4PA 3HOZG 4GKJL 2WV6D 4P72A 1VQOA 4GZYC 4DR1Q 3KF8A 1HTLD 1XMQQ 5A2QE 4F88A
chains in the Genus database with same CATH topology
3GD7A 4DV5L 3S15H 3BJUA 3TREA 5C0XG 3KYHC 3L7ZC 5C4JH 2AWOA 3HOYG 4GKJQ 4X66Q 4DV3Q 1S3OA 2V1CC 4BBRH 2BA1A 3UDXA 4DV1L 4A3FH 3S1NH 3OTOL 4LF4Q 4JI4L 1KC8C 3ZJYC 1KHIA 4QJFA 1IZ6A 4OWTB 4MNOA 1N33Q 4KHPL 4LFBL 3KDFA 1EUJA 4LFCQ 4A3CG 4WJ4A 4MTNA 2N3SA 3KF6B 2UXDL 4LUZA 1VS0A 2JEBI 5FJ8G 1LM0A 2JA5G 4LF4L 1G51A 3TEHB 2KENA 3BU2A 4KLKA 1VQIA 2I5HA 2B63H 2HIVA 1X55A 3A0JA 4P71A 2VQFL 4AQYQ 4AIMA 2UXDQ 1KL9A 1TWAH 5JJIA 4DNIA 1VQBA 2DGYA 1N32Q 2ATWA 1YI2A 1JT8A 1Y1WG 3CCVA 4B3TQ 3RN5A 4R4CA 4OONA 1BBWA 1XNRQ 1Z47A 3TRZA 4A3BG 1JJCB 1Z9FA 5BR8Q 3W1GA 5IP7H 1VQMA 1FVIA 1AE3A 5IYCG 4C3IH 5C3EG 3J81j 2UU9Q 1J5EQ 3HKZG 1VQ5A 1X65A 1JJ2A 4IOAA 3JAMi 4DR2Q 4K0KL 3CCEA 2NVXH 4GN3B 5HGQA 1IL2A 4DV0L 4GLVB 2A8VA 3F2DA 4BY7H 4P75A 1IBML 1KXLA 1Q7YC 3ULLA 1IBLQ 2EQSA 4DAMA 4QL5A 4A3GG 4DR7Q 1EIFA 3K0XA 4JI0L 2RHQB 4IPCA 3UDFA 4HJAA 4DR3L 3M4PA 1N8RC 4IPGA 2JA6H 2EIFA 3HOUH 2MQHA 3PUVA 2JA8G 3HOVH 4B3RL 3AFPA 5C44H 2VL6A 4DV7Q 4DK6C 1CKNA 1ASYA 2JQOA 3GTMH 4R4IA 1HR0Q 4LF7Q 1Q12A 4DR7L 5IT9c 5LMNW 4JI8Q 3GO5A 3HOZH 1YNXA 4TVAB 5GAHC 2I5MX 2CWAA 2WB1E 1YZ6A 4R1JA 1XMOL 2LXKA 3F2BA 1KRSA 4A3GH 3PSIA 1IYJB 3ERSX 4O2DA 2RCNA 3RN2A 3UE1A 1E22A 4J15A 3M7NA 4YWLA 1CSPA 3H3VI 5E7NA 4DR4Q 4LW1A 2VNUD 2IX0A 1VQLA 4GNXB 3BZKA 1Q8KA 1R9TH 4BXXG 2PQAB 4DV2Q 2YTYA 2KCTA 4OWXB 4GLXA 1VQ8A 3G4SA 4B3TL 2UUCQ 2VY3A 2CKZB 3PF4A 1YEZA 1VQEA 3STBD 1XNQL 1XTDA 4JI2Q 3CD6A 1E1OA 1A63A 1UE7A 1PHJA 4JI5L 3H3VH 3M3YH 3B6YA 2BH2A 4NB3A 1WJJA 3I4NG 4LF9L 2LSSA 4FDBA 1M1KC 3CC4A 2K4KA 4X64Q 1YHBA 5C44G 1EOVA 3CPFA 1X56A 5M3MG 1PH1A 1PH8A 2B63G 3KJOA 1KIXA 1OTCA 2UXCQ 1VQCA 3CC7A 2IHEA 5M5WH 2PI2E 1EFWA 2JJQA 4OXPA 4X62L 4JV5L 2B3GA 4IFDI 4LFAL 2F4VQ 1L2FA 3NELA 1WI5A 3K7AH 4YHHQ 3RZOH 2QA4A 1SR3A 3I2ZA 5GADC 2HQLA 2OQ0A 3GTKH 5JJKA 4JI8L 1YVCA 4ME3A 2ZJQA 1WYDA 1PH3A 3PO2H 1G291 1Q46A 4UP8A 1NTGA 2R92H 3CCSA 3NENA 3CCLA 2WAQG 3HOWH 4GKKQ 1PH6A 2KHJA 3J80c 3G6EA 1QUQB 2GVAA 3M4QA 3U50C 2ALYB 3FHWA 3H0GG 3VDYA 2JA9A 1PH4A 1N33L 4KHPQ 5M3FH 4JI3L 2Q2IA 4NXML 2KHIA 1K8AC 4H02A 1BBUA 1Y14B 2LXJA 1EIYB 2ID0A 4QY7A 5IE8A 4LF6L 4HJ8A 3HOUG 4OO1G 1UE1A 4DV0Q 3G71A 4L5TA 1LUZA 1C9OA 2VQEQ 2R93G 4BY7G 3S17H 3A5ZB 4GOPB 1K8GA 4MZ9A 4PZ8A 2NN6I 4A3KH 3UE0A 1K9MC 4A3IH 2UXBL 5H1SE 4HIOA 1HH2P 2K5VA 1VQ7A 1CKMA 3RZDH 5BR8L 2OCEA 1N34Q 3KDFB 1OXSC 1L1OC 1BVSA 1TWCH 4X64L 5FLMH 1XJVA 1ASZA 1CUKA 2K52A 3KF6A 2CFMA 4YY3Q 4QQBX 1YJ9A 1HZCA 3S1MH 1L1OB 1YHAA 1VCIA 3PO3G 4DV3L 2Y0SG 4JI1L 2Z0SA 4OX9Q 3S14H 1IBKL 4PZ6A 4TQUS 4AYBE 5IY0A 4YHHL 3U58A 2E2HH 4JI6Q 1FJGL 5C4XG 3M85A 4OWWB 1K0RA 4LFBQ 2MFIA 1TWFH 4O0AA 2K14A 3MEFA 3S2DH 4PG3A 5C0XI 1BKBA 1W3SA 5IYBH 4IFDG 5K36G 4LWCA 1HNXQ 3CAMA 4EQ5A 4A3CH 5IYDG 1QZGA 4A3MH 3K7UC 1HZ9A 4JBMA 5AJ3L 4A3LG 4X65L 1PH5A 3OW2A 1LTLA 2K5NA 2ASBA 2RHSB 2E2JH 4JCVE 1NE3A 2ZJPA 1X6OA 3DLLA 1XMQL 1XPRA 1B70B 2YYZA 1QVFA 3S16H 2PMZE 4POFA 1X3GA 1XNRL 1Q1BA 3E9IA 4GN4B 4BA2I 2GN5A 1YJWA 4JC0A 1EWIA 1P8LA 2ZTEA 2L15A 2NZOA 2K75A 1VQ9A 4P73A 1JB7A 1L0WA 2UU9L 4KI0A 2UXBQ 1CSQA 3E9HA 1E24A 1S40A 1SRUA 1N36L 3OTOQ 2VS1A 1B8AA 2VUMH 1E1TA 2QGQA 4POGA 3KF8B 5EAYA 2BH8A 2JA6G 1Q86C 1PH2A 5DLQE 4L5RC 1JJGA 1DGSA 1VQJA 5ELNA 4GOPC 4JBKA 2AKWB 3RLNA 3HOWG 4DV4Q 4UPAA 2R6GA 1A0IA 4P74A 4APVA 3KFUA 4DV6Q 2K50A 1GM5A 4IOCA 1O7IA 4JI6L 1VQHA 3FP9A 1FJGQ 3F8TA 4B3RQ 2VZAA 2ES2A 1MIUA 2H5XA 4L5QA 4YCUA 1A8VA 1PA6A 4JI3Q 3EBEA 4B3MQ 4LF5Q 4DUZL 1X9NA 1PH7A 3S1QH 4DV4L 4A3KG 1NJIC 1EQQA 5M5YH 2UUAQ 1JE5A 4JI4Q 1HNWL 3AYHB 4JBJA 4DAYB 2VQEL 2KCMA 4HJ5A 1E3PA 1GKHA 3PGZA 2K5HA 2PNHA 2PI2A 1I94Q 2I5LX 2OQKA 2UUAL 4B3SL 1HNWQ 3RLFA 4JOIC 4C2MH 4C3HH 2R7FA 1TWGH 3W5OA 4A93H 4AYBG 2WB1G 3AFQA 2R7ZG 2D62A 1IBLL 4A3JH 3SGIA 4JBWA 4JI0Q 1RL2A 3S1RH 1I5FA 1X3EA 2JA7G 1IXRA 3CCRA 3PO2G 4JI1Q 1PV4A 1TXYA 4NXNL 1HR0L 4A3IG 4LF7L 3RR5A 4DUYL 4DR2L 1SMXA 2RF4A 3IRBA 1V9PA 3TQYA 2R7DA 3CCMA 3BZCA 4BBRG 3T1YL 3CP0A 5LMUQ 5IYBG 1P16A 5C0XJ 4DV1Q 4A3FG 4LFAQ 1HNXL 2CWPA 4NXNQ 3J7A5 2Q2HA 4DR6L 1RIPA 1WCMG 5AJ3Q 3PUYA 4DUYQ 1CKNB 1KQSA 1HNZQ 4DR3Q 4A4IA 1X54A 2NN6G 3KOJA 1H95A 3F2CA 4YWKA 4OX9L 1WOCA 2AHOB 1PVOA 4IJLA 3PUXA 3NBHB 1QVCA 4LUOA 1SE8A 1V43A 3GTQH 2JE6I 4IPDA 2IHFA 1VQPA 3CCQA 1HZAA 3KLWA 4BBSG 2C35B 1SROA 4WJ3M 1UE6A 4A75A 3GTPH 3HKSA 1N32L 4UP9A 4GNXA 1I94L 2I0QA 1JMCA 3I55A 1EQRA 1QVGA 2Q2TA 4PMWA 3CMEA 4DV5Q 4LF8L 4A3BH 4X6AH 3I4MH 3CXCA 1NMGA 3M4OH 2KBNA 3PIPA 3T1HL 3M9BA 3CW2C 4LUVA 4X62Q 4JV5Q 4YCWA 5IP7G 4YWMA 2AWNA 4L5SA 4JG2A 1MJEA 4HJ9A 4GLAC 2NVTH 3EN2A 3ULJA 2YU9H 1Y1WH 4LF8Q 1UE5A 1MKHA 3L2PA 3PIOA 1S72A 1NBWA 3J80i 2ZM6L 4BA1I 3HOXG 2UUBL 4A76A 3A5UA 4DR6Q 2A1AA 2HIXA 3PF5A 2HHHQ 5GROA 3CC2A 2JA5H 3I4NH 4A3DG 1Y1VH 4IO9A 3H0GH 5ELOA 4GNXC 1LYLA 1PYBA 2R93H 3J81c 4DR5L 1U5KA 4ALPA 3S2HH 2ZTDA 1KAWA 1HR0W 5FLMG 3ICEA 2Q2UA 2ZTCA 3MXNB 3HKZE 4DV7L 3E0EA 3GTGH 1YHQA 2EXDA 4XTCS 2UUCL 2VW9A 2HHHL 1YITA 1M90C 3GTLH 1XNQQ 1OXTA 4GN5A 2JK8A 1G6PA 3UDGA 1N9WA 2PQAA 5HY6A 4B3SQ 1HNZL 1AH9A 3STBC 3NEMA 4Y52H 2JA7H 5IYDH 2OWOA 4IFDJ 2MO1A 4HIMA 3K80C 1VQ4A 1VQNA 1J6QA 1VQGA 2R7ZH 2OTJA 4LNQA 1D7QA 4A3DH 2Y0SE 1J5EL 4LF5L 1FGUA 3W1BA 4UY8C 3HOYH 2AMCB 3G48A 5LMNQ 3A74A 1YJNA 4K0KQ 4X65Q 2UXCL 1HJPA 3LGJA 4QIWE 1YIJA 4X66L 4DKAC 1Q82C 2N8NA 3OYYA 3I7FA 4QGUA 2IT1A 3D0FA 1VQ6A 2MO0A 1GVPA 2A19A 1QZHA 1T9HA 5GQOA 1E7ZA 2YV5A 2Z6KA 4YY3L 4NXMQ 3HOVG 3S24A 2NVQH 3PCOB 2IY5B 4C3JH 3AEVA 4R4OA 1OXXK 2D0PA 3Q8DA 1GD7A 4LFCL 3PUWA 1PFSA 1U0LA 3CCUA 1Q81C 1PH9A 1UEBA 3L0OA 5GAGC 5LMUL 3ULPA 4GOPA 1OXVA 1VQFA 1Q1EA 4BXXH 4GS3A 4KHZA 4DPGA 5IWAL 2WAQE 1FL0A 2CCZA 1XPOA 2NVYH 3GDEA 2VQFQ 4AQYL 4JI7Q 1I3QH 4RMFA 4EX5A 3RNUA 5C3EH 4HIDA 2F4VL 4BBSH 2Z6KC 1K73C 1B7YB 5M3MH 5GAEC 3CPWA 2FXQA 3GTOH 3K8AA 2B29A 3T1YQ 4RG1A 1UWVA 4DUZQ 3TS2A 1AE2A 4GKKL 3CF5A 3PO3H 4BY1G 1EYGA 2F52A 1GO3E 5J3BA 5LMNL 3RLOA 5IP9H 4JOIA 4XIGS 4JI2L 1IBMQ 3I4OA 4JI5Q 3FKIH 4HIKA 1K3RA 3T1HQ 4A3EH 4LF9Q 2JEAI 4LF6Q 3DM3A 1MJCA 2E5LL 1V1QA 2QEXA 1WFQA 1I6HH 4NPSA 1VQDA 1K83H 4UP7A 2GVBA 2XTIA 3EIVA 5JEAG 4DR1L 4A3MG 3ER0A 3J81i 2UUBQ 3GTJH 4DK3C 4A3EG 3JC66 1IBKQ 3F1ZA 3K81C 5IYCH 1L1OA 2E2IH 1SFOH 2WP8J 1C7YA 1C0AA 2MNAA 1I50H 2E5LQ 4A93G 1A62A 2D0OA 1KD1C 4BY1H 2E8GA 1Y1VG 4OO1I 1W2BA 4HJ7A 3U4VA 3KJPA 2YTXA 1X3FA 3HOXH 1KRTA 5IWAQ 1XPUA 5M3FG 2IX1A 4R4QA 1N36Q 4DR4L 2JA8H 4JYAQ 2F3IA 5JJLA 1N34L 3I4MG 1D8LA 5FLXc 4JI7L 3CMAA 2XGTA 4DV2L 3TS0A 2R92G 4IJHA 5FJ8H 4Y7NH 2ZM6Q 3PV0A 2DUDA 1VQKA 1VQAA 1TWHH 1YBYA 1PYSB 3WWVA 1NY4A 3AQQA 4JYAL 2YTVA 3HFZB 2CQOA 1SN8A 4DR5Q 3CCJA 4A3LH 4R4TA 1HZBA 1SLJA 2NZHA 3U4ZA 3PUZA 3H15A 2N78A 2BA0A 5JEAJ 1XMOQ 3FKIG 2WFWA 4IPHA 3J7ZC 3D31A 1OXUA 1QUQA 4A3JG 5IP9G 4B3ML 3CQZH 4AH6A 3HOZG 2ZJRA 2HT1A 4GKJL 4YCVA 4P72A 1VQOA 2N49A 5M5XH 4DR1Q 5C4XH 2VUMG 3JAMc 4DV6L 3UDIA 3I56A 1XMQQ 4PZ7A 1CKOA 1WCMH 1NMFA 2OTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GD7 A;  4DV5 L;  3S15 H;  3BJU A;  3TRE A;  5C0X G;  3KYH C;  3L7Z C;  5C4J H;  2AWO A;  3HOY G;  4GKJ Q;  4X66 Q;  4DV3 Q;  1S3O A;  2V1C C;  4BBR H;  2BA1 A;  3UDX A;  4DV1 L;  4A3F H;  3S1N H;  3OTO L;  4LF4 Q;  4JI4 L;  1KC8 C;  3ZJY C;  1KHI A;  4QJF A;  1IZ6 A;  4OWT B;  4MNO A;  1N33 Q;  4KHP L;  4LFB L;  3KDF A;  1EUJ A;  4LFC Q;  4A3C G;  4WJ4 A;  4MTN A;  2N3S A;  3KF6 B;  2UXD L;  4LUZ A;  1VS0 A;  2JEB I;  5FJ8 G;  1LM0 A;  2JA5 G;  4LF4 L;  1G51 A;  3TEH B;  2KEN A;  3BU2 A;  4KLK A;  1VQI A;  2I5H A;  2B63 H;  2HIV A;  1X55 A;  3A0J A;  4P71 A;  2VQF L;  4AQY Q;  4AIM A;  2UXD Q;  1KL9 A;  1TWA H;  5JJI A;  4DNI A;  1VQB A;  2DGY A;  1N32 Q;  2ATW A;  1YI2 A;  1JT8 A;  1Y1W G;  3CCV A;  4B3T Q;  3RN5 A;  4R4C A;  4OON A;  1BBW A;  1XNR Q;  1Z47 A;  3TRZ A;  4A3B G;  1JJC B;  1Z9F A;  5BR8 Q;  3W1G A;  5IP7 H;  1VQM A;  1FVI A;  1AE3 A;  5IYC G;  4C3I H;  5C3E G;  3J81 j;  2UU9 Q;  1J5E Q;  3HKZ G;  1VQ5 A;  1X65 A;  1JJ2 A;  4IOA A;  3JAM i;  4DR2 Q;  4K0K L;  3CCE A;  2NVX H;  4GN3 B;  5HGQ A;  1IL2 A;  4DV0 L;  4GLV B;  2A8V A;  3F2D A;  4BY7 H;  4P75 A;  1IBM L;  1KXL A;  1Q7Y C;  3ULL A;  1IBL Q;  2EQS A;  4DAM A;  4QL5 A;  4A3G G;  4DR7 Q;  1EIF A;  3K0X A;  4JI0 L;  2RHQ B;  4IPC A;  3UDF A;  4HJA A;  4DR3 L;  3M4P A;  1N8R C;  4IPG A;  2JA6 H;  2EIF A;  3HOU H;  2MQH A;  3PUV A;  2JA8 G;  3HOV H;  4B3R L;  3AFP A;  5C44 H;  2VL6 A;  4DV7 Q;  4DK6 C;  1CKN A;  1ASY A;  2JQO A;  3GTM H;  4R4I A;  1HR0 Q;  4LF7 Q;  1Q12 A;  4DR7 L;  5IT9 c;  5LMN W;  4JI8 Q;  3GO5 A;  3HOZ H;  1YNX A;  4TVA B;  5GAH C;  2I5M X;  2CWA A;  2WB1 E;  1YZ6 A;  4R1J A;  1XMO L;  2LXK A;  3F2B A;  1KRS A;  4A3G H;  3PSI A;  1IYJ B;  3ERS X;  4O2D A;  2RCN A;  3RN2 A;  3UE1 A;  1E22 A;  4J15 A;  3M7N A;  4YWL A;  1CSP A;  3H3V I;  5E7N A;  4DR4 Q;  4LW1 A;  2VNU D;  2IX0 A;  1VQL A;  4GNX B;  3BZK A;  1Q8K A;  1R9T H;  4BXX G;  2PQA B;  4DV2 Q;  2YTY A;  2KCT A;  4OWX B;  4GLX A;  1VQ8 A;  3G4S A;  4B3T L;  2UUC Q;  2VY3 A;  2CKZ B;  3PF4 A;  1YEZ A;  1VQE A;  3STB D;  1XNQ L;  1XTD A;  4JI2 Q;  3CD6 A;  1E1O A;  1A63 A;  1UE7 A;  1PHJ A;  4JI5 L;  3H3V H;  3M3Y H;  3B6Y A;  2BH2 A;  4NB3 A;  1WJJ A;  3I4N G;  4LF9 L;  2LSS A;  4FDB A;  1M1K C;  3CC4 A;  2K4K A;  4X64 Q;  1YHB A;  5C44 G;  1EOV A;  3CPF A;  1X56 A;  5M3M G;  1PH1 A;  1PH8 A;  2B63 G;  3KJO A;  1KIX A;  1OTC A;  2UXC Q;  1VQC A;  3CC7 A;  2IHE A;  5M5W H;  2PI2 E;  1EFW A;  2JJQ A;  4OXP A;  4X62 L;  4JV5 L;  2B3G A;  4IFD I;  4LFA L;  2F4V Q;  1L2F A;  3NEL A;  1WI5 A;  3K7A H;  4YHH Q;  3RZO H;  2QA4 A;  1SR3 A;  3I2Z A;  5GAD C;  2HQL A;  2OQ0 A;  3GTK H;  5JJK A;  4JI8 L;  1YVC A;  4ME3 A;  2ZJQ A;  1WYD A;  1PH3 A;  3PO2 H;  1G29 1;  1Q46 A;  4UP8 A;  1NTG A;  2R92 H;  3CCS A;  3NEN A;  3CCL A;  2WAQ G;  3HOW H;  4GKK Q;  1PH6 A;  2KHJ A;  3J80 c;  3G6E A;  1QUQ B;  2GVA A;  3M4Q A;  3U50 C;  2ALY B;  3FHW A;  3H0G G;  3VDY A;  2JA9 A;  1PH4 A;  1N33 L;  4KHP Q;  5M3F H;  4JI3 L;  2Q2I A;  4NXM L;  2KHI A;  1K8A C;  4H02 A;  1BBU A;  1Y14 B;  2LXJ A;  1EIY B;  2ID0 A;  4QY7 A;  5IE8 A;  4LF6 L;  4HJ8 A;  3HOU G;  4OO1 G;  1UE1 A;  4DV0 Q;  3G71 A;  4L5T A;  1LUZ A;  1C9O A;  2VQE Q;  2R93 G;  4BY7 G;  3S17 H;  3A5Z B;  4GOP B;  1K8G A;  4MZ9 A;  4PZ8 A;  2NN6 I;  4A3K H;  3UE0 A;  1K9M C;  4A3I H;  2UXB L;  5H1S E;  4HIO A;  1HH2 P;  2K5V A;  1VQ7 A;  1CKM A;  3RZD H;  5BR8 L;  2OCE A;  1N34 Q;  3KDF B;  1OXS C;  1L1O C;  1BVS A;  1TWC H;  4X64 L;  5FLM H;  1XJV A;  1ASZ A;  1CUK A;  2K52 A;  3KF6 A;  2CFM A;  4YY3 Q;  4QQB X;  1YJ9 A;  1HZC A;  3S1M H;  1L1O B;  1YHA A;  1VCI A;  3PO3 G;  4DV3 L;  2Y0S G;  4JI1 L;  2Z0S A;  4OX9 Q;  3S14 H;  1IBK L;  4PZ6 A;  4TQU S;  4AYB E;  5IY0 A;  4YHH L;  3U58 A;  2E2H H;  4JI6 Q;  1FJG L;  5C4X G;  3M85 A;  4OWW B;  1K0R A;  4LFB Q;  2MFI A;  1TWF H;  4O0A A;  2K14 A;  3MEF A;  3S2D H;  4PG3 A;  5C0X I;  1BKB A;  1W3S A;  5IYB H;  4IFD G;  5K36 G;  4LWC A;  1HNX Q;  3CAM A;  4EQ5 A;  4A3C H;  5IYD G;  1QZG A;  4A3M H;  3K7U C;  1HZ9 A;  4JBM A;  5AJ3 L;  4A3L G;  4X65 L;  1PH5 A;  3OW2 A;  1LTL A;  2K5N A;  2ASB A;  2RHS B;  2E2J H;  4JCV E;  1NE3 A;  2ZJP A;  1X6O A;  3DLL A;  1XMQ L;  1XPR A;  1B70 B;  2YYZ A;  1QVF A;  3S16 H;  2PMZ E;  4POF A;  1X3G A;  1XNR L;  1Q1B A;  3E9I A;  4GN4 B;  4BA2 I;  2GN5 A;  1YJW A;  4JC0 A;  1EWI A;  1P8L A;  2ZTE A;  2L15 A;  2NZO A;  2K75 A;  1VQ9 A;  4P73 A;  1JB7 A;  1L0W A;  2UU9 L;  4KI0 A;  2UXB Q;  1CSQ A;  3E9H A;  1E24 A;  1S40 A;  1SRU A;  1N36 L;  3OTO Q;  2VS1 A;  1B8A A;  2VUM H;  1E1T A;  2QGQ A;  4POG A;  3KF8 B;  5EAY A;  2BH8 A;  2JA6 G;  1Q86 C;  1PH2 A;  5DLQ E;  4L5R C;  1JJG A;  1DGS A;  1VQJ A;  5ELN A;  4GOP C;  4JBK A;  2AKW B;  3RLN A;  3HOW G;  4DV4 Q;  4UPA A;  2R6G A;  1A0I A;  4P74 A;  4APV A;  3KFU A;  4DV6 Q;  2K50 A;  1GM5 A;  4IOC A;  1O7I A;  4JI6 L;  1VQH A;  3FP9 A;  1FJG Q;  3F8T A;  4B3R Q;  2VZA A;  2ES2 A;  1MIU A;  2H5X A;  4L5Q A;  4YCU A;  1A8V A;  1PA6 A;  4JI3 Q;  3EBE A;  4B3M Q;  4LF5 Q;  4DUZ L;  1X9N A;  1PH7 A;  3S1Q H;  4DV4 L;  4A3K G;  1NJI C;  1EQQ A;  5M5Y H;  2UUA Q;  1JE5 A;  4JI4 Q;  1HNW L;  3AYH B;  4JBJ A;  4DAY B;  2VQE L;  2KCM A;  4HJ5 A;  1E3P A;  1GKH A;  3PGZ A;  2K5H A;  2PNH A;  2PI2 A;  1I94 Q;  2I5L X;  2OQK A;  2UUA L;  4B3S L;  1HNW Q;  3RLF A;  4JOI C;  4C2M H;  4C3H H;  2R7F A;  1TWG H;  3W5O A;  4A93 H;  4AYB G;  2WB1 G;  3AFQ A;  2R7Z G;  2D62 A;  1IBL L;  4A3J H;  3SGI A;  4JBW A;  4JI0 Q;  1RL2 A;  3S1R H;  1I5F A;  1X3E A;  2JA7 G;  1IXR A;  3CCR A;  3PO2 G;  4JI1 Q;  1PV4 A;  1TXY A;  4NXN L;  1HR0 L;  4A3I G;  4LF7 L;  3RR5 A;  4DUY L;  4DR2 L;  1SMX A;  2RF4 A;  3IRB A;  1V9P A;  3TQY A;  2R7D A;  3CCM A;  3BZC A;  4BBR G;  3T1Y L;  3CP0 A;  5LMU Q;  5IYB G;  1P16 A;  5C0X J;  4DV1 Q;  4A3F G;  4LFA Q;  1HNX L;  2CWP A;  4NXN Q;  3J7A 5;  2Q2H A;  4DR6 L;  1RIP A;  1WCM G;  5AJ3 Q;  3PUY A;  4DUY Q;  1CKN B;  1KQS A;  1HNZ Q;  4DR3 Q;  4A4I A;  1X54 A;  2NN6 G;  3KOJ A;  1H95 A;  3F2C A;  4YWK A;  4OX9 L;  1WOC A;  2AHO B;  1PVO A;  4IJL A;  3PUX A;  3NBH B;  1QVC A;  4LUO A;  1SE8 A;  1V43 A;  3GTQ H;  2JE6 I;  4IPD A;  2IHF A;  1VQP A;  3CCQ A;  1HZA A;  3KLW A;  4BBS G;  2C35 B;  1SRO A;  4WJ3 M;  1UE6 A;  4A75 A;  3GTP H;  3HKS A;  1N32 L;  4UP9 A;  4GNX A;  1I94 L;  2I0Q A;  1JMC A;  3I55 A;  1EQR A;  1QVG A;  2Q2T A;  4PMW A;  3CME A;  4DV5 Q;  4LF8 L;  4A3B H;  4X6A H;  3I4M H;  3CXC A;  1NMG A;  3M4O H;  2KBN A;  3PIP A;  3T1H L;  3M9B A;  3CW2 C;  4LUV A;  4X62 Q;  4JV5 Q;  4YCW A;  5IP7 G;  4YWM A;  2AWN A;  4L5S A;  4JG2 A;  1MJE A;  4HJ9 A;  4GLA C;  2NVT H;  3EN2 A;  3ULJ A;  2YU9 H;  1Y1W H;  4LF8 Q;  1UE5 A;  1MKH A;  3L2P A;  3PIO A;  1S72 A;  1NBW A;  3J80 i;  2ZM6 L;  4BA1 I;  3HOX G;  2UUB L;  4A76 A;  3A5U A;  4DR6 Q;  2A1A A;  2HIX A;  3PF5 A;  2HHH Q;  5GRO A;  3CC2 A;  2JA5 H;  3I4N H;  4A3D G;  1Y1V H;  4IO9 A;  3H0G H;  5ELO A;  4GNX C;  1LYL A;  1PYB A;  2R93 H;  3J81 c;  4DR5 L;  1U5K A;  4ALP A;  3S2H H;  2ZTD A;  1KAW A;  1HR0 W;  5FLM G;  3ICE A;  2Q2U A;  2ZTC A;  3MXN B;  3HKZ E;  4DV7 L;  3E0E A;  3GTG H;  1YHQ A;  2EXD A;  4XTC S;  2UUC L;  2VW9 A;  2HHH L;  1YIT A;  1M90 C;  3GTL H;  1XNQ Q;  1OXT A;  4GN5 A;  2JK8 A;  1G6P A;  3UDG A;  1N9W A;  2PQA A;  5HY6 A;  4B3S Q;  1HNZ L;  1AH9 A;  3STB C;  3NEM A;  4Y52 H;  2JA7 H;  5IYD H;  2OWO A;  4IFD J;  2MO1 A;  4HIM A;  3K80 C;  1VQ4 A;  1VQN A;  1J6Q A;  1VQG A;  2R7Z H;  2OTJ A;  4LNQ A;  1D7Q A;  4A3D H;  2Y0S E;  1J5E L;  4LF5 L;  1FGU A;  3W1B A;  4UY8 C;  3HOY H;  2AMC B;  3G48 A;  5LMN Q;  3A74 A;  1YJN A;  4K0K Q;  4X65 Q;  2UXC L;  1HJP A;  3LGJ A;  4QIW E;  1YIJ A;  4X66 L;  4DKA C;  1Q82 C;  2N8N A;  3OYY A;  3I7F A;  4QGU A;  2IT1 A;  3D0F A;  1VQ6 A;  2MO0 A;  1GVP A;  2A19 A;  1QZH A;  1T9H A;  5GQO A;  1E7Z A;  2YV5 A;  2Z6K A;  4YY3 L;  4NXM Q;  3HOV G;  3S24 A;  2NVQ H;  3PCO B;  2IY5 B;  4C3J H;  3AEV A;  4R4O A;  1OXX K;  2D0P A;  3Q8D A;  1GD7 A;  4LFC L;  3PUW A;  1PFS A;  1U0L A;  3CCU A;  1Q81 C;  1PH9 A;  1UEB A;  3L0O A;  5GAG C;  5LMU L;  3ULP A;  4GOP A;  1OXV A;  1VQF A;  1Q1E A;  4BXX H;  4GS3 A;  4KHZ A;  4DPG A;  5IWA L;  2WAQ E;  1FL0 A;  2CCZ A;  1XPO A;  2NVY H;  3GDE A;  2VQF Q;  4AQY L;  4JI7 Q;  1I3Q H;  4RMF A;  4EX5 A;  3RNU A;  5C3E H;  4HID A;  2F4V L;  4BBS H;  2Z6K C;  1K73 C;  1B7Y B;  5M3M H;  5GAE C;  3CPW A;  2FXQ A;  3GTO H;  3K8A A;  2B29 A;  3T1Y Q;  4RG1 A;  1UWV A;  4DUZ Q;  3TS2 A;  1AE2 A;  4GKK L;  3CF5 A;  3PO3 H;  4BY1 G;  1EYG A;  2F52 A;  1GO3 E;  5J3B A;  5LMN L;  3RLO A;  5IP9 H;  4JOI A;  4XIG S;  4JI2 L;  1IBM Q;  3I4O A;  4JI5 Q;  3FKI H;  4HIK A;  1K3R A;  3T1H Q;  4A3E H;  4LF9 Q;  2JEA I;  4LF6 Q;  3DM3 A;  1MJC A;  2E5L L;  1V1Q A;  2QEX A;  1WFQ A;  1I6H H;  4NPS A;  1VQD A;  1K83 H;  4UP7 A;  2GVB A;  2XTI A;  3EIV A;  5JEA G;  4DR1 L;  4A3M G;  3ER0 A;  3J81 i;  2UUB Q;  3GTJ H;  4DK3 C;  4A3E G;  3JC6 6;  1IBK Q;  3F1Z A;  3K81 C;  5IYC H;  1L1O A;  2E2I H;  1SFO H;  2WP8 J;  1C7Y A;  1C0A A;  2MNA A;  1I50 H;  2E5L Q;  4A93 G;  1A62 A;  2D0O A;  1KD1 C;  4BY1 H;  2E8G A;  1Y1V G;  4OO1 I;  1W2B A;  4HJ7 A;  3U4V A;  3KJP A;  2YTX A;  1X3F A;  3HOX H;  1KRT A;  5IWA Q;  1XPU A;  5M3F G;  2IX1 A;  4R4Q A;  1N36 Q;  4DR4 L;  2JA8 H;  4JYA Q;  2F3I A;  5JJL A;  1N34 L;  3I4M G;  1D8L A;  5FLX c;  4JI7 L;  3CMA A;  2XGT A;  4DV2 L;  3TS0 A;  2R92 G;  4IJH A;  5FJ8 H;  4Y7N H;  2ZM6 Q;  3PV0 A;  2DUD A;  1VQK A;  1VQA A;  1TWH H;  1YBY A;  1PYS B;  3WWV A;  1NY4 A;  3AQQ A;  4JYA L;  2YTV A;  3HFZ B;  2CQO A;  1SN8 A;  4DR5 Q;  3CCJ A;  4A3L H;  4R4T A;  1HZB A;  1SLJ A;  2NZH A;  3U4Z A;  3PUZ A;  3H15 A;  2N78 A;  2BA0 A;  5JEA J;  1XMO Q;  3FKI G;  2WFW A;  4IPH A;  3J7Z C;  3D31 A;  1OXU A;  1QUQ A;  4A3J G;  5IP9 G;  4B3M L;  3CQZ H;  4AH6 A;  3HOZ G;  2ZJR A;  2HT1 A;  4GKJ L;  4YCV A;  4P72 A;  1VQO A;  2N49 A;  5M5X H;  4DR1 Q;  5C4X H;  2VUM G;  3JAM c;  4DV6 L;  3UDI A;  3I56 A;  1XMQ Q;  4PZ7 A;  1CKO A;  1WCM H;  1NMF A;  2OTL A; 
#chains in the Genus database with same CATH topology
 3S15 H;  2EYL A;  3BJU A;  3HOY G;  4X66 Q;  1S3O A;  1F2L A;  4K2L A;  4BBR H;  1L0Y B;  5C3W A;  3ZJY C;  4QJF A;  1IZ6 A;  2CW0 C;  4MNO A;  3DWP A;  1ZYR D;  3HG9 A;  4N8X 1;  2N3S A;  2UXD L;  2K01 A;  1VS0 A;  5FJ8 G;  4KJN A;  1MGS A;  2JA5 G;  5G3L F;  4LF4 L;  5E4X A;  4ZCK A;  4FVM A;  1VQI A;  2B63 H;  4OO1 H;  2HIV A;  1X55 A;  1S5B D;  2F4I A;  2B63 B;  4DNI A;  1JT8 A;  1N32 Q;  2L11 A;  5IGD A;  2F03 A;  2L1B A;  4FF4 A;  1FYC A;  3GTM B;  1YNJ D;  2WAC A;  1Z47 A;  4A3B G;  1JJC B;  1N34 L;  4C3I H;  3J81 j;  2OT2 A;  2DNE A;  2JA6 B;  2B2U A;  2BE5 D;  2Q8R E;  1WTX A;  3OIQ A;  5FLX E;  3H09 A;  3LWU A;  1QNU A;  4BY7 H;  5IGF A;  1Q7Y C;  4PV1 C;  2F0Q A;  2BDO A;  3S2D B;  1U9R A;  1MD2 D;  1EIF A;  3K0X A;  4IPC A;  3M4P A;  2MQH A;  2ICI A;  3HOV H;  4B3R L;  4K5X A;  2K03 A;  1CKN A;  1ASY A;  2GA4 B;  3GTM H;  2ZXP A;  2B2U C;  3VYS A;  5CV9 A;  3SK5 A;  4FXK C;  3X3N A;  1A3V A;  2DY7 A;  4A3E B;  4NW2 A;  2CWA A;  1TY2 A;  1YZ6 A;  2LXK A;  1IYJ B;  1JE4 A;  3UE1 A;  1E22 A;  4J15 A;  4YWL A;  1O7L A;  3H3V I;  4LW1 A;  2VNU D;  2QW7 A;  1VQL A;  3BZK A;  5LL6 X;  1R9T H;  4BXX G;  2PQA B;  5IGG A;  2KCT A;  4RCO A;  5ELC A;  4B3T L;  5A35 A;  1XNQ L;  3CD6 A;  1E1O A;  5C3E B;  1SNQ A;  1PRT D;  1UE7 A;  4JI5 L;  2D9U A;  4CHT B;  1PZI D;  4TRD A;  4NB3 A;  5C4J B;  3J81 L;  2K4K A;  4X64 Q;  5C44 G;  3CPF A;  1X56 A;  1PH1 A;  3C1E A;  4C3I B;  2O5I C;  3NSW A;  1VQC A;  1EFW A;  4JV5 L;  2B3G A;  2F4V Q;  1WI5 A;  2X6L A;  1SR3 A;  3GTK H;  5BN5 A;  1HXY D;  1BOS A;  4F87 A;  2ZJQ A;  4OGQ C;  4O42 A;  5M5W B;  2R92 H;  4GKK Q;  3BDC A;  4ZUJ A;  3NP8 A;  1PH6 A;  3HOV B;  1ET9 A;  1STE A;  2ALY B;  3FHW A;  3H0G G;  1N33 L;  1J8I A;  1I4H A;  1LAC A;  2EJG C;  2Q2I A;  2MGS A;  2MHV A;  3GV6 A;  3I4L A;  4H02 A;  1BBU A;  1Y14 B;  4RGM A;  1K8A C;  2LMC B;  1EIY B;  4LF6 L;  3A56 A;  4XT3 B;  1T5E A;  4DXG A;  3WOF A;  4DV0 Q;  1TY0 A;  3QIA A;  5AFW A;  2VQE Q;  4E6I A;  1K8G A;  2LKV A;  3IAY A;  4PZ8 A;  2J4X A;  3I4N B;  1K9M C;  4A3I H;  1E0B A;  5KRU A;  3RZD H;  5BR8 L;  1B9N A;  1OXS C;  1W6J A;  1BVS A;  4YY3 Q;  3KF6 A;  1LT4 D;  4HTH A;  1HZC A;  1IW7 D;  3BVZ A;  1UUP A;  4V0B A;  4FF1 A;  1VCI A;  3E5S A;  4JI1 L;  3R2T A;  2PZW A;  4K2K A;  4OX9 Q;  4TQU S;  1VMP A;  1FJG L;  2F0K A;  5E4W C;  2K5D A;  1EL0 A;  4KV6 A;  3S2D H;  2OF1 A;  4PG3 A;  5C0X I;  2RDH A;  3BDL A;  3I72 A;  5K36 G;  1HNX Q;  5I9P A;  1EYC A;  2XVS A;  2SOB A;  4DXF A;  4EQ5 A;  3K7U C;  4QCL A;  2SEB D;  3H6M A;  1SFO B;  5D3D A;  2PZU A;  2ZJP A;  1X6O A;  3DLL A;  1XMQ L;  2EOT A;  2H4O A;  3S2H B;  4WRD A;  4JC0 A;  1EWI A;  5I2X A;  2UU9 L;  4P73 A;  2DNC A;  3BYT B;  1JB7 A;  3E9H A;  1S40 A;  4MTK A;  5DEH A;  1N36 L;  2VS1 A;  1B8A A;  1S5F D;  2QGQ A;  3M7G A;  3T53 B;  3J80 E;  4L5R C;  1VQJ A;  5CMD A;  1SEB D;  3DWA A;  2VB2 X;  2RA4 A;  1GM5 A;  3URY A;  1FD7 D;  4IOC A;  1O7I A;  2CH4 A;  1FJG Q;  5DAU A;  3NTH A;  1MIU A;  4H44 C;  4LF5 Q;  1SDF A;  5A2Q L;  3QB3 A;  1NAP A;  2JXM B;  1PH7 A;  1NJI C;  1EQQ A;  5M5Y H;  4MIU A;  1DOL A;  2XNA C;  1UNS A;  3SEB A;  3CHB D;  4DAY B;  2WKC A;  4XDX A;  1E3P A;  4HJ5 A;  5L37 A;  2I5L X;  1HHV A;  1HUN A;  1O7Y A;  4ZAI A;  5EBD A;  4P2C B;  4G7Z C;  1QNK A;  1IKM A;  1YNJ C;  1NR4 A;  4UDU C;  5COR A;  3S1R B;  1TXY A;  4NXN L;  3TP7 A;  4DUY L;  3F2U A;  3TSS A;  4CJ2 C;  5FO8 B;  1F2M A;  1V9P A;  2R7D A;  4MN3 A;  4FXG C;  4A3F G;  2R93 G;  4DV1 Q;  5IYB G;  1P16 A;  4IFD H;  4LFA Q;  2IPK D;  2PYK A;  3D6C A;  5JVH 3;  5C6A A;  1CKN B;  4FF2 A;  5CV7 A;  1X54 A;  2NN6 G;  1CA6 A;  3F2C A;  4YWK A;  2EYO A;  3GTQ H;  3MA2 B;  1HFG A;  2IHF A;  3V2T A;  3CCQ A;  1HZA A;  3DHQ A;  3SR1 A;  4IN3 A;  2XWJ B;  4A75 A;  3I70 A;  3HKS A;  1JOQ A;  2PMZ B;  1PYW D;  1QG7 A;  2FFK B;  1I94 L;  1JMC A;  3I55 A;  5DM7 3;  1CI3 M;  1QVG A;  1CQF A;  3Q0A A;  4DV5 Q;  3S9W A;  1NMG A;  3OMC A;  4DK1 A;  1J9O A;  4JV5 Q;  2AWN A;  4L5S A;  1PFM A;  1V1O A;  3ULJ A;  2YU9 H;  1MKH A;  4R8N A;  2E74 C;  3G6J B;  4RHR A;  3PF5 A;  2HHH Q;  1ILP A;  5GRO A;  2RSO A;  2VXW A;  4BY1 B;  1I4Q A;  4GNX C;  4DR5 L;  3NTI A;  1HR0 W;  2Q2U A;  3SE0 A;  3GTG H;  3E0E A;  1VDZ A;  2EXD A;  2Z4H A;  2A69 D;  1YIT A;  1DJR D;  2E76 C;  3UDG A;  1N9W A;  1WTR A;  2A6E D;  4XQJ A;  3I90 A;  1FR3 A;  1W6K A;  3X3M A;  4LNQ A;  3NQI A;  3KLS A;  3W1B A;  3H94 A;  3G48 A;  4K0K Q;  2HDL A;  3LGJ A;  4X66 L;  4DKA C;  3OYY A;  2N8N A;  1C8C A;  3IKJ A;  4QGU A;  5FO7 B;  1BNZ A;  2MP1 A;  1K83 B;  2A19 A;  3EQL C;  1T9H A;  4LK1 C;  1E7Z A;  2YV5 A;  5IT9 L;  4YY3 L;  3S24 A;  1B1Z A;  4KY7 A;  4YIJ A;  4R4O A;  3CCU A;  1PFS A;  3L0O A;  3ULP A;  1TWC B;  3MWY W;  1VQF A;  4DAP A;  3A7L A;  4BXX H;  2ICE C;  2Z4I A;  1QJO A;  5IWA L;  3DWQ A;  1FL0 A;  2CCZ A;  4U67 3;  5EKI A;  5JAV A;  3GDE A;  4JI7 Q;  1I3Q H;  4EX5 A;  3RNU A;  1Q8I A;  2Z6K C;  3DEO A;  1RHP A;  3L9A X;  1TWF B;  1DZ1 A;  3CPW A;  3BDO A;  4QUF A;  2F0I A;  4RGT A;  4BY1 G;  1LLR D;  2B2T C;  2LY7 A;  3RLO A;  5IGC A;  3SK6 A;  1U4M A;  4KKS A;  3EVQ A;  4LF9 Q;  3DM3 A;  1QWY A;  4V19 0;  4NPS A;  3EIV A;  1IBK Q;  1Y8O B;  5IYC H;  3OPO A;  1B9M A;  2OXP A;  1SFO H;  1C7Y A;  2MNA A;  1Z7T A;  1KDC A;  1I50 H;  1KD1 C;  1AEX A;  5ISR A;  1XTC D;  1Y1V G;  4OO1 I;  1W2B A;  3U4V A;  3MXU A;  2JA8 B;  5M5Y B;  2YTX A;  1X3F A;  1LTB D;  1XPU A;  4J6H A;  2IX1 A;  1N36 Q;  5JJL A;  3I4M G;  1R9T B;  2WIN B;  3TS0 A;  4IJH A;  5FJ8 H;  1QE6 A;  2DUD A;  3W3A A;  1YBY A;  3WWV A;  5I2Y A;  5EBC A;  3ERQ A;  4A3L H;  2F0L A;  4R4T A;  1NUC A;  2F3W A;  5JEA J;  3FKI G;  2WFW A;  3D31 A;  1OXU A;  1QUQ A;  5IP9 G;  3CQZ H;  2D2C C;  4AH6 A;  3GTG B;  2NZ1 D;  2G9D A;  1Z6H A;  5M5X H;  1KNA A;  1WTO A;  5C4X H;  4N8F A;  1XWE A;  4KN4 C;  1R4P B;  3UDI A;  3I56 A;  4PZ7 A;  1G29 1;  2JA5 B;  2R3Z A;  2OTL A;  4EVO A;  5C0X G;  3KYH C;  4WJW A;  2AWO A;  3T56 B;  4IUP A;  2KVM A;  4DV1 L;  4BBS B;  3UDX A;  3TP8 A;  1KDB A;  1O78 A;  2WAQ B;  4IUU A;  4KJO A;  1CFM A;  2B2T A;  1N33 Q;  1EUJ A;  1EWH A;  4WFN 3;  4WJ4 A;  3OSO A;  4KK7 A;  3PIO 3;  1PZJ D;  4HSV A;  5M5X B;  1TWA B;  1TQO A;  2KEN A;  3BU2 A;  3GTK B;  4AQY Q;  4P71 A;  1SNM A;  3HOZ B;  1CHQ D;  2ATW A;  1YI2 A;  2NTT A;  3A8J E;  5C44 B;  1Y1W G;  4RKL A;  4R4C A;  4OON A;  1BBW A;  1LT6 D;  1GUO A;  1XNR Q;  3TRZ A;  1MBY A;  5BR8 Q;  1AE3 A;  1KAA A;  2E2D C;  3NBH A;  1J5E Q;  1DOM A;  3HKZ G;  1LTI D;  1VQ5 A;  1X65 A;  4DR2 Q;  2Q8I B;  3KK7 A;  4K14 A;  2NVX H;  1IL2 A;  3CRK C;  5HGQ A;  4G57 A;  4DV0 L;  5JPM C;  1IBL Q;  3R8B A;  4G4K A;  2RVL A;  3QOJ A;  4DR7 Q;  4R8I A;  1BQQ T;  4OHJ A;  5M3F B;  4JI0 L;  4A3G G;  4DR3 L;  2QKI C;  4IPG A;  3PUV A;  4CKC A;  2NN6 H;  5C44 H;  2VL6 A;  2L5T A;  1KTK A;  1O7Z A;  4DK6 C;  4FF3 A;  5CGK A;  4R4I A;  1HR0 Q;  4LF7 Q;  1ZYR C;  4KN7 C;  4ZK9 B;  1UAP A;  2I07 B;  2CW0 D;  2Z9H A;  3RZO B;  2WKD A;  3F2B A;  3M4Y A;  1HA5 A;  3HZX A;  3M7N A;  3QG1 A;  5E7N A;  2IX0 A;  4GNX B;  1Q8K A;  3DEP A;  2YTY A;  1VQ8 A;  4JVZ A;  2VY3 A;  2KCC A;  3PF4 A;  1VQE A;  4DAY A;  3TP5 A;  4JI2 Q;  1PHJ A;  4A3F B;  3M3Y H;  4KKU A;  1WJJ A;  4H7B A;  2B2V A;  5C4Z A;  1ZKO A;  1JOO A;  1KIX A;  4DN4 M;  5C5L A;  3H3V C;  4CKE A;  1XXG A;  3K58 A;  2JJQ A;  1SMY D;  4IFD I;  2EE1 A;  1L2F A;  3NEL A;  3MHB A;  3BVG A;  2QA4 A;  3NTK A;  1KNE A;  4RFB A;  5JJK A;  3TBI B;  3T51 B;  1PH3 A;  2G9H D;  3IFD A;  1SSO A;  3Q23 A;  1NTG A;  4PNY A;  3CCS A;  3HOW H;  5IIF A;  4QUC A;  3J80 c;  1I4P A;  5C5M A;  1QUQ B;  1PH4 A;  3VDY A;  2JA9 A;  2QDL A;  1AN8 A;  3HOY B;  4NXM L;  1ZEQ X;  2ID0 A;  1DON A;  4HJ8 A;  1UE1 A;  1EQV A;  1JWM D;  3G71 A;  1WTH A;  4ZKB B;  1GUN A;  1JR0 D;  2KEE A;  2F0G A;  4BY7 G;  2XIW A;  1QOH A;  3HOW B;  4MZ9 A;  3UE0 A;  2B8F A;  5H1S E;  3QJY A;  1HH2 P;  5J1Z A;  4DR6 L;  5EPL A;  4CJ0 B;  2WII B;  4X64 L;  1L1O C;  2L9H A;  4J1M A;  4DV3 L;  2Y0S G;  1SYG A;  5E3F A;  2K05 A;  1IBK L;  4PZ6 A;  3U58 A;  5C4X G;  3BG3 A;  4LFB Q;  1SJH D;  5HGT A;  2MFI A;  4O0A A;  1M8A A;  1PFN A;  3I8Z A;  1SAP A;  1EY6 A;  2PW7 A;  2CVR A;  4LWC A;  3CAM A;  1I4G A;  5IGB A;  5IYD G;  4JBM A;  4X65 L;  2KJX A;  3GTL B;  3T13 A;  3OW2 A;  2K5N A;  2RHS B;  1PRT B;  2Z1C A;  4JCV E;  5CC4 A;  1HPC A;  2YYZ A;  2HDM A;  4BS9 A;  4POF A;  1AZQ A;  1Q1B A;  2GN5 A;  5I4D A;  2L15 A;  3T4A C;  2K75 A;  1XYI A;  1VQ9 A;  2KOL A;  1E24 A;  5KIX A;  4ODG A;  2VUM H;  1E1T A;  5EAY A;  2BH8 A;  2K28 A;  3OW7 A;  2JA6 G;  3M4O B;  4NP5 A;  1PH2 A;  4GOP C;  3NXW A;  1STY A;  4DGZ A;  5C3X A;  5JVG 3;  4DV4 Q;  4UPA A;  4APV A;  3GQB A;  4I7Z C;  2IX3 A;  2F0T A;  2K50 A;  1VQH A;  3FP9 A;  1GOZ A;  1EU3 A;  1RJT A;  2VZA A;  2H5X A;  4L5Q A;  4YCU A;  1A8V A;  4JI3 Q;  2JA7 B;  3EBE A;  3S1Q H;  3PIP 3;  1B53 A;  2NTS A;  4ZRZ A;  5IOC A;  1JE5 A;  4N9P A;  3AYH B;  4X3S A;  1PDQ A;  2EY5 A;  5CV5 A;  1ICF B;  2A6H D;  3CRL C;  4I7A A;  4KY6 A;  4CDF C;  3K57 A;  3PGZ A;  2PNH A;  2PI2 A;  2UUA L;  1HNW Q;  4JOI C;  4C3H H;  3W5O A;  3AFQ A;  2D62 A;  1IBL L;  4A3J H;  3NHH A;  4JI0 Q;  5J39 A;  3TZD A;  2JA7 G;  1SXT A;  2BDN A;  3CCR A;  3S14 B;  1PV4 A;  2HCI A;  1HR0 L;  1G2S A;  4LF7 L;  3RR5 A;  4DR2 L;  1SMX A;  1KLU D;  2NVX B;  2KQ3 A;  5C0X J;  3LNN A;  1GUW A;  2CWP A;  3J7A F;  1SNO A;  5AJ3 Q;  4DR3 Q;  1PZK D;  5ELF A;  1PVO A;  2J7Z A;  3NBH B;  1QVC A;  1SE8 A;  1V43 A;  1H9R A;  2JE6 I;  2QIL A;  2AQ3 B;  5KND A;  1STH A;  3KLW A;  4DNT B;  2C35 B;  2B2Y C;  2K32 A;  4LJZ C;  4XXE A;  3Q6S A;  3CME A;  4X3K A;  2KBN A;  3M9B A;  2K5Q A;  1BUV T;  4YCW A;  4JG2 A;  1RCV D;  4A3G B;  2NVT H;  4KMU C;  3SXH A;  1Y1W H;  1KAB A;  4LF8 Q;  3AB9 A;  3PIO A;  2F3V A;  2IJ0 A;  2A1A A;  1B3Q A;  1WTV A;  1GUT A;  2JA5 H;  3DUZ A;  2QDB A;  5ELO A;  4IO9 A;  3MEH A;  3S2H H;  1KAW A;  3H91 A;  3HKZ E;  4DV7 L;  2VW9 A;  2NB0 A;  1OXT A;  4GN5 A;  3TDQ A;  4BY7 B;  2X69 A;  4B3S Q;  5CBE E;  4HCE A;  4EQN A;  2MO1 A;  2OEO A;  4HIM A;  3K80 C;  2R7Z H;  4UHV A;  3HOY H;  4UY8 C;  5EPJ A;  2AMC B;  3A74 A;  1GXD C;  2UXC L;  2E2I B;  1CM9 A;  1Q82 C;  1GHK A;  1TS2 A;  4G7O C;  1GVP A;  4NXM Q;  4C2M B;  3K5O A;  3AEV A;  1GD7 A;  3PUW A;  1V8Q A;  1UEB A;  4RH6 A;  5GAG C;  5LMU L;  3NQT A;  3V96 A;  1V1P A;  5I6Y A;  1BCP D;  4AQY L;  4DAV A;  5EKL A;  5KNB A;  1LV9 A;  4RMF A;  4K5V A;  4X3T A;  3KLR A;  5C3E H;  4HID A;  5M9O A;  4BBS H;  1ICW A;  3E0J A;  3GTO H;  1JIC A;  3A7A B;  4C56 C;  2HD3 A;  3T1Y Q;  2E2H B;  4RG1 A;  4DUZ Q;  1SYC A;  2KUM A;  3CF5 A;  3PO3 H;  2F52 A;  4XIG S;  3I4O A;  3VR3 A;  4JI5 Q;  3T16 A;  2EYH A;  1YNN D;  3CQZ B;  3FKI H;  5C4H A;  3T1H Q;  2JEA I;  2A68 C;  5I6W A;  1ET6 A;  1V1Q A;  4PMC A;  2K6A A;  5FK9 C;  4CDC C;  4A3M G;  2GVB A;  3ER0 A;  1O80 A;  4I65 A;  4NMZ A;  3GTJ H;  1ZXT A;  4A3E G;  3HEJ A;  1TWH B;  2E2I H;  1C0A A;  4Y7N B;  3K5M A;  3TME A;  2E5L Q;  2EDG A;  1A62 A;  4BY1 H;  3M3Y B;  4HED A;  4TKO B;  4HJ7 A;  4A3M B;  2PZT A;  2B8G A;  5IWA Q;  5M3F G;  2PW5 A;  4R4Q A;  1EZ8 A;  2JA8 H;  2F3I A;  3BVM A;  1D8L A;  5FLX c;  4JI7 L;  1PTO B;  4DA2 A;  2R92 G;  1BR9 A;  3WDN A;  1TWH H;  5NUC A;  3E6Z X;  3AQQ A;  4JYA L;  2KA7 A;  1SN8 A;  3CCJ A;  3HRZ C;  1HZB A;  2NZH A;  3PUZ A;  5KNC A;  3OHX C;  1A2T A;  5CR3 A;  3SVM A;  4A3I B;  1X3P A;  3RZD B;  4WOR A;  1SND A;  4YCV A;  2TSS A;  4HSP A;  2N49 A;  2VUM G;  5FLX L;  1EQT A;  2CH4 W;  4DV6 L;  1ENA A;  1CKO A;  1PTO H;  1SYF A;  1CZG A;  2EPB A;  3GD7 A;  3IFT A;  2R7Z B;  4NKL A;  3GTP B;  3TRE A;  4GKJ Q;  1JQY D;  3S1N H;  4A3F H;  2BA1 A;  2EY2 A;  2K33 A;  2QEJ C;  2FJ2 A;  5ELD A;  3OTO L;  4LF4 Q;  4JI4 L;  2EYM A;  3S1N B;  4L6T B;  1KHI A;  1FNU A;  3V05 A;  1SE2 A;  1HUM A;  4IQZ A;  3J81 E;  3KDF A;  4A3C G;  4H0L C;  4MTN A;  1JWU D;  1IKL A;  4LUZ A;  2JEB I;  4TSS A;  1LM0 A;  1Q3L A;  4OIK A;  1G51 A;  3TEH B;  4C3H G;  2PQE A;  2I5H A;  4AIM A;  2UXD Q;  1TWA H;  3SK4 A;  2DGY A;  1EY8 A;  3VR4 A;  1QIL A;  5JOB A;  3RN5 A;  2RDG A;  2RQX A;  1JCK B;  1Z9F A;  3D4D A;  5IP7 H;  2UU9 Q;  2F0J A;  3P7J A;  1STA A;  4IOA A;  1JJ2 A;  3JAM i;  3CCE A;  2PPB C;  4DNR B;  3HOX B;  2EY1 A;  4P75 A;  1IBM L;  1KXL A;  2RDF A;  3FMC A;  2EQS A;  3NE5 B;  1DOK A;  4Q0F A;  4DAM A;  3UDF A;  1N8R C;  4C3J G;  1F9P A;  2JA6 H;  1ONL A;  3AFP A;  3RMH A;  4DV7 Q;  2B2W A;  1Y1V B;  1D1I A;  2CQA A;  2JQO A;  3R93 A;  1BCP C;  2TMP A;  5LMN W;  5IT9 E;  3GO5 A;  4EQP A;  3HOZ H;  4PQX A;  5GAH C;  2I5M X;  4DF7 A;  4R1J A;  1XMO L;  3K6O A;  1KRS A;  3RN2 A;  4DR4 Q;  3PO3 B;  2EYF A;  4DV2 Q;  4OWX B;  2KEC A;  5K36 H;  3FPP A;  4Q5V A;  1TS5 A;  2CKZ B;  1B2T A;  1YEZ A;  3VA5 A;  2Q8T A;  3QOL A;  1A3U A;  2RKS A;  3MAQ A;  3B6Y A;  2BH2 A;  1WTQ A;  2O4X A;  1EY7 A;  4BWG B;  2F0P A;  2EYJ A;  4FDB A;  3EJI A;  5M3M G;  2AQ1 B;  4IUT A;  5T1I A;  4ZLT F;  5KYL A;  1PH8 A;  3KJO A;  5ELE A;  1OTC A;  1KDA A;  3A54 A;  2UXC Q;  3CC7 A;  1WVL A;  2IHE A;  5M5W H;  2PI2 E;  4OXP A;  2FIN B;  4X3U A;  1HTP A;  4LFA L;  1EFI D;  4G7H C;  4YHH Q;  3RZO H;  2NYZ D;  3D3R A;  3I2Z A;  2HQL A;  2OQ0 A;  1RTN A;  1TT2 A;  4ME3 A;  3PO2 H;  1WYD A;  3NK9 A;  4UP8 A;  1TS4 A;  3NEN A;  3G6E A;  4FP5 D;  1XX8 A;  2GVA A;  5KEE A;  4KHP Q;  3RUZ A;  5M3F H;  1TS3 A;  4JI3 L;  2KHI A;  2IWH A;  2LXJ A;  3P1H A;  3HOU G;  1HRJ A;  2F0V A;  1MSG A;  4RGN A;  2L0C A;  2B2W C;  1LTS D;  2NVY B;  1DYQ A;  4GOP B;  3LWE A;  1EY4 A;  3Q24 A;  1ENC A;  1TII D;  2RCF A;  2K5V A;  2OCE A;  3KDF B;  1TWC H;  1PXU A;  5FLM H;  1XJV A;  1CUK A;  1I6H B;  2K52 A;  4QQB X;  2CFM A;  2F0W A;  3BS1 A;  2N55 A;  4IUR A;  3I4M B;  3S14 H;  2E2H H;  4IUN A;  1DXM A;  1TWF H;  3MEF A;  2PO4 A;  5LL6 S;  4CGY B;  1DCZ A;  5IYB H;  4IFD G;  1IYV A;  4KY5 A;  4A3C H;  1QZG A;  4A3M H;  3SK8 A;  4K6L A;  1I4X A;  1LTR D;  5AJ3 L;  1CA5 A;  4A3L G;  5JPN C;  1NE3 A;  2XWB B;  2V4D A;  1XPR A;  1G6Z A;  2PMZ E;  3GP7 A;  2ZXR A;  4GN4 B;  3JAM L;  2ZTE A;  4OEL B;  1L0W A;  4KI0 A;  2ZT9 C;  5D65 A;  3OTO Q;  1HA6 A;  4POG A;  1EY9 A;  1IYU A;  3KF8 B;  1Q86 C;  3RD4 A;  1DGS A;  1TVX A;  1A0I A;  4P74 A;  4NDX A;  2EJM A;  4DV6 Q;  3ERO A;  3F8T A;  4RGO S;  4B3R Q;  1II3 A;  1PA6 A;  1R4Q B;  1VF5 C;  3C46 A;  4A3K G;  4JI4 Q;  4JBJ A;  4L8J A;  1I50 B;  2KCM A;  2XN9 C;  5G3L D;  2K5H A;  1YNN C;  2E75 C;  1K28 A;  1E2V A;  1WD1 A;  4B3S L;  3P20 A;  2SNS A;  3K5L A;  3I3C A;  1WTP A;  2R7F A;  3N52 A;  2WB1 G;  2MUY A;  2R61 A;  3U9S A;  3SGI A;  4JBW A;  1I5F A;  1KLG D;  1F77 A;  1MI2 A;  1IXR A;  4K5W A;  5EGT A;  3OIP A;  1L0X B;  3PO2 G;  1GHJ A;  5KYI A;  1PMR A;  4ZKC B;  1IW7 C;  2RF4 A;  3IRB A;  3VYR A;  3T1Y L;  3BZC A;  4BBR G;  3CP0 A;  2EY6 A;  3FDT A;  5LMU Q;  4NXN Q;  2F0S A;  4HAE A;  3EA6 A;  3FPU B;  3PUY A;  4DUY Q;  1LT3 D;  1KQS A;  1HNZ Q;  3U9O A;  4A4I A;  2F0E A;  3KOJ A;  1H95 A;  3HP3 A;  1EY5 A;  1WOC A;  1SYB A;  4IJL A;  3PUX A;  1H9S A;  3KBG A;  1VQP A;  3PQI A;  2NVQ B;  1AFP A;  1C4Q A;  3NWT A;  1SRO A;  4WJ3 M;  1D5Z C;  1UE6 A;  3J80 L;  1B3A A;  4UP9 A;  2I0Q A;  1EQR A;  3K59 A;  4X6A H;  4A3B H;  4RKB A;  1LO5 D;  3M4O H;  3PIP A;  3T1H L;  4LUV A;  1E2W A;  4M1U B;  4HJ9 A;  4GLA C;  3EN2 A;  3I91 A;  5FO9 B;  2Y0S B;  3L2P A;  1PFB A;  1BCP F;  1NBW A;  3J80 i;  4BA1 I;  3HOX G;  4A76 A;  4A3D G;  3I4N H;  1F2Y A;  3J7A V;  2B2Y A;  3H0G H;  2P5Z X;  1LYL A;  1PYB A;  3GV3 A;  2R93 H;  3QWN A;  1U5K A;  4ALP A;  2ZTD A;  5FOB B;  3ND8 A;  5FLM G;  2R93 B;  5BN3 A;  1YHQ A;  2UUC L;  2E2J B;  2XSC A;  1S5D D;  2HHH L;  2JK8 A;  2AQ2 B;  3FRP B;  1G6P A;  4JW0 A;  1AH9 A;  3STB C;  3NEM A;  5KGU A;  2EVB A;  4Y52 H;  2OWO A;  4IFD J;  1MHW C;  1VQ4 A;  1VQG A;  4HR7 B;  4S3S A;  3JAM E;  1D7Q A;  2Y0S E;  1J5E L;  1FGU A;  5LMN Q;  4Z9C B;  1K8M A;  1F9S A;  1HJP A;  1YIJ A;  4QF4 A;  1VQ6 A;  1CQV A;  3I7F A;  2NBF A;  2IT1 A;  1GUS A;  3D0F A;  1Y69 U;  2MO0 A;  3OWF A;  1QZH A;  1UEA B;  4R9W A;  3DM1 A;  5K5P A;  2NVQ H;  2IY5 B;  1I4R A;  2D0P A;  1Q81 C;  1A15 A;  1U0L A;  5DNF A;  1PH9 A;  5F2D A;  3K7A B;  2L4N A;  1Q1E A;  4GS3 A;  1PTO C;  1QCB D;  4DPG A;  4A3K B;  2WAQ E;  2J0T D;  4B08 A;  1BDO A;  2NVY H;  1TU2 B;  2O5J C;  4C3I G;  5COY A;  1EIH A;  4N9T A;  5M3M B;  2K5W A;  1IL8 A;  1HQR D;  1B7Y B;  5M3M H;  5GAE C;  2ENB A;  2FXQ A;  4L63 B;  4CDD C;  4PMB A;  1G8Z D;  1AE2 A;  2HCC A;  3TS2 A;  2DJG C;  2NWG A;  1EYG A;  1ENF A;  1GO3 E;  5CV6 A;  5LMN L;  4A3D B;  5IP9 H;  4JI2 L;  1IBM Q;  4HIK A;  4A3E H;  1ROD A;  1MJC A;  1WFQ A;  1I6H H;  1VQD A;  2L55 A;  5JEA G;  2XTI A;  4ABN A;  1BF4 A;  2UUB Q;  2C5C A;  1S4Z A;  3JC6 6;  3F1Z A;  4DU9 A;  3K81 C;  4IUV A;  1G2T A;  1L1O A;  3OOC A;  1TR5 A;  2FMM A;  1D2B A;  2E8G A;  2A6E C;  1ESR A;  4RA8 A;  1D6E C;  3HOX H;  3K5N A;  1FGB D;  1K0S A;  1C48 A;  4DR4 L;  4IUQ A;  1E2Z A;  4KHV A;  1H9J A;  3CMA A;  2XGT A;  4DV2 L;  2ZM6 Q;  1K8O A;  1VQK A;  1VQA A;  3BZD B;  4XT1 B;  3MXP A;  1PYS B;  1LTA D;  1NY4 A;  2YTV A;  3HFZ B;  2F0U A;  4XQN A;  2CQO A;  3U4Z A;  1SLJ A;  3H15 A;  1Y8P B;  1XMO Q;  4IPH A;  5LHY 1;  3OMG A;  1Y1W B;  4OEM B;  4A3J G;  4RWS C;  2ZJR A;  2HT1 A;  2IL8 A;  3S17 B;  1F9R A;  3JAM c;  1A6X A;  3VYT A;  2F1M A;  2EXZ A;  5D14 A;  3UI2 A;  1EIG A;  3HOU B;  1WCM H;  1NMF A;  4DV5 L;  5I9O A;  3L7Z C;  4AYB B;  5C4J H;  2DN8 A;  1BCP B;  1T5X D;  4OL7 A;  2V1C C;  4DV3 Q;  1NCV A;  3TZU A;  1KC8 C;  5D3I B;  4O1N A;  4OWT B;  1OO9 B;  3ND9 A;  4KHP L;  4LFB L;  1EEF D;  4LFC Q;  5ELB A;  3KF6 B;  3WOE A;  4RCN A;  3E3X A;  1FNW A;  4KLK A;  2VUM B;  2BE5 C;  2MJ8 A;  3ONA B;  2VQF L;  3A0J A;  5JJI A;  1KL9 A;  1VQB A;  3MFY A;  3C2P A;  3CCV A;  4B3T Q;  2JSO A;  4KTA A;  1JWS D;  1SNP A;  3S16 B;  1VQM A;  3W1G A;  1FVI A;  3VYU A;  1RD9 D;  5IYC G;  5C3E G;  1H9S B;  3SDZ A;  4K0K L;  1JOK A;  4KKT A;  4GN3 B;  1EYD A;  2N88 A;  4UAI A;  4GLV B;  2A8V A;  2H1E A;  3F2D A;  1BBX C;  4FXD A;  3ULL A;  1JC7 A;  5FKA C;  2A5H A;  4QL5 A;  4ULL A;  1A2U A;  2RHQ B;  4HJA A;  1SYD A;  1F9Q A;  1MSH A;  2EIF A;  2K1B A;  3HOU H;  2JA8 G;  2JYO A;  1PTO D;  4IZ8 A;  2QF7 A;  5DM6 3;  5J22 A;  2F0F A;  1G91 A;  1Q12 A;  4QMG A;  4DR7 L;  2D5D A;  5IT9 c;  4JI8 Q;  4FYD A;  1IHZ A;  1H9K A;  1YNX A;  4TVA B;  2WB1 E;  2AUJ D;  2NUC A;  1RF2 D;  4A3G H;  3L3O C;  3PSI A;  3ERS X;  4O2D A;  1JB3 A;  2RCN A;  2PCF B;  1AZP A;  1HFN A;  1SE3 A;  1CSP A;  3MTS A;  1NR2 A;  1STN A;  1Q90 A;  1AW7 A;  3NUC A;  4GLX A;  4B9X A;  1JOR A;  3G4S A;  2UUC Q;  3STB D;  1XTD A;  4FNF A;  3A55 A;  1A63 A;  4BBR B;  1EEI D;  5CV4 A;  3H3V H;  3I4N G;  4LF9 L;  1B44 D;  1SE4 A;  2K7V A;  2LSS A;  2RSN A;  1M1K C;  3CC4 A;  1YHB A;  1EOV A;  3A8K E;  1H9M A;  2B63 G;  4LAA A;  5BN4 A;  5EJW A;  1U4R A;  1AP0 A;  3VR2 A;  4X62 L;  2F0H A;  3K0Y A;  1FNV A;  3K7A H;  3MXN A;  2XRQ D;  3S1Q B;  1EOT A;  1X3Q A;  1EYA A;  3MXG A;  5GAD C;  4JI8 L;  1PTO F;  1YVC A;  1V1P B;  4ME5 A;  2BCO A;  3TN2 A;  1Q46 A;  2HQE A;  3MZ5 A;  3HGB A;  2WAQ G;  3CCL A;  2KHJ A;  3M4Q A;  3U50 C;  1CZW A;  1EU4 A;  4IAL A;  5IE8 A;  4QY7 A;  1NNX A;  4OO1 G;  1WTW A;  2A68 D;  4L5T A;  1LUZ A;  4JK1 C;  1C9O A;  2M00 A;  4QIW B;  3BYY B;  1I3Q B;  2XRS D;  3S17 H;  3A5Z B;  1STB A;  2G5D A;  2NN6 I;  4A3K H;  2UXB L;  4C1N I;  4HIO A;  3DXJ C;  3R3O A;  1VQ7 A;  1CKM A;  1N34 Q;  1ASZ A;  1F2Z A;  1YJ9 A;  3P75 A;  2O2L D;  3S1M H;  3SHL A;  1L1O B;  2K04 A;  2F0O A;  1YHA A;  3PO3 G;  5EQ0 A;  2NVT B;  4ID6 A;  2IW3 A;  2Z0S A;  2JP1 A;  4YHH L;  4AYB E;  5IY0 A;  3D4R A;  4JI6 Q;  1BXT A;  3M85 A;  1SBB B;  2EZV A;  4OWW B;  1K0R A;  1WD0 A;  2K14 A;  1D5X C;  1BKB A;  1W3S A;  3GTO B;  3LX0 A;  2F0N A;  3GTQ B;  2F0D A;  1TWG B;  4A93 B;  1HZ9 A;  5TSS A;  1PH5 A;  1LTL A;  2ASB A;  2E2J H;  4XYO A;  5EPK A;  1SJE D;  1B70 B;  1QVF A;  3S16 H;  5C4X B;  1X3G A;  1XNR L;  2LS0 1;  1PRT C;  3E9I A;  4BA2 I;  1YJW A;  1P8L A;  2NZO A;  4HN7 A;  2A69 C;  1CSQ A;  2UXB Q;  2JN4 A;  2YU9 B;  1SRU A;  2M2L A;  5EKK A;  2A6H C;  1HQM C;  1ILQ A;  5IOD A;  5DLQ E;  4A3B B;  1JJG A;  2A73 B;  5ELN A;  4JBK A;  1SMY C;  2AKW B;  3RLN A;  1CT1 D;  3HOW G;  2R6G A;  3KFU A;  2BOS A;  2VB3 X;  2AUK A;  4ZYS A;  4JI6 L;  3PO2 B;  1S5C D;  1U4L A;  2ES2 A;  2M9V A;  3MVV A;  1DM0 B;  3EFX D;  4C3H B;  3VA7 A;  4B3M Q;  4DUZ L;  1X9N A;  4DV4 L;  2UUA Q;  1HNW L;  3G7L A;  1LTT D;  2ZXO A;  3I73 A;  1EWC A;  3C1F A;  3H0G B;  3NPP A;  2VQE L;  1GKH A;  1NSN S;  3GTJ B;  4F7X A;  3OWE B;  1I94 Q;  1SYE A;  2OQK A;  3RLF A;  4C2M H;  3R2I A;  1TWG H;  4ZUI A;  4A93 H;  4AYB G;  2SDF A;  2R7Z G;  4XYQ A;  1RL2 A;  1X32 A;  3S1R H;  1X3E A;  2PNR C;  1VMC A;  2C9O A;  3FEW X;  4JI1 Q;  3J7Y W;  4RAU C;  3QO2 A;  4A3I G;  4A3J B;  4J8Q A;  3AU7 A;  3CCM A;  3TQY A;  3CKI B;  3VR5 A;  1PRT F;  3C3L A;  1HNX L;  3J7A 5;  2Q2H A;  1RIP A;  1WCM G;  3D8G A;  1EY0 A;  3NWS A;  4FO2 A;  3AMU A;  4KD4 A;  4OX9 L;  2AHO B;  1CK1 A;  4LUO A;  4IPD A;  1PLF A;  3GTP H;  1N32 L;  4ZQ3 A;  4GNX A;  1RDP D;  4K8J A;  3CU7 A;  2Q2T A;  4LF8 L;  4PMW A;  5CBA E;  3I4M H;  2EYP A;  3CXC A;  3CW2 C;  1Y8N B;  4X62 Q;  5IP7 G;  4YWM A;  1MJE A;  4M8A A;  1UE5 A;  4MHE A;  1STG A;  1S72 A;  3A8I E;  2UUB L;  2ZM6 L;  1ML0 D;  3W2D A;  4DR6 Q;  3A5U A;  2I46 A;  2HIX A;  2QCP X;  4OIJ A;  1WCM B;  3CC2 A;  1Y1V H;  3D4W A;  4HMI A;  4C1N K;  3HKZ B;  2Z8L A;  3J81 c;  2F0M A;  2KED A;  3ICE A;  4HCS A;  1B50 A;  2ZTC A;  3MXN B;  1I6V C;  1ESF A;  4XTC S;  3KBX A;  1M90 C;  3GTL H;  1XNQ Q;  4LMQ D;  2PQA A;  3KUP A;  5HY6 A;  1HNZ L;  2X6G A;  2JA7 H;  5IYD H;  5C0X H;  1LAB A;  1VQN A;  3S15 B;  1J6Q A;  1CHP D;  2OTJ A;  4A3D H;  4LF5 L;  1SNC A;  1VF7 A;  1YJN A;  4K6D A;  4X65 Q;  4QB4 A;  4QIW E;  2KCN A;  2WB1 B;  2DJF C;  4F8M A;  4CJ1 B;  1GJX A;  4EGV A;  1B4O A;  3PMF A;  2L12 A;  3ITP A;  5GQO A;  1TKW B;  2Z6K A;  3HOV G;  2B2V C;  1BO0 A;  3PCO B;  2MPM A;  4JPB W;  4C3J H;  4K8I A;  4LFC L;  1OXX K;  3Q8D A;  4BBS G;  4XQQ A;  3DMU A;  4CBV A;  4GOP A;  1OXV A;  3FVQ A;  3O13 A;  4B9W A;  2EJF C;  4ILW A;  4KHZ A;  2LFN A;  1XPO A;  3VR6 A;  2VQF Q;  1M4V A;  4H13 C;  3NBI A;  2F4V L;  3D6W A;  3TP6 A;  4EQO A;  1K73 C;  4RHS A;  3FKI B;  1GUG A;  3Q22 A;  3N6R A;  2A74 C;  5CV8 A;  3K8A A;  2B29 A;  1UWV A;  1EZ6 A;  3MFG A;  4GKK L;  1QB5 D;  5T1G A;  1D5M C;  1HCZ A;  2SNM A;  2Z6B A;  4KD3 A;  3S1M B;  5J3B A;  1CTM A;  4JOI A;  2R92 B;  5JEA H;  1RKN A;  5E1F A;  1K3R A;  4LF6 Q;  5IGE A;  2E5L L;  3MC0 B;  2QEX A;  3KLS X;  2KHS A;  4UP7 A;  1K83 H;  3HS0 C;  4DR1 L;  3J81 i;  4DK3 C;  4CDE C;  2WP8 J;  4A93 G;  2DY8 A;  2D0O A;  1LTG D;  5CYU A;  3KJP A;  1S5E D;  4C3J B;  3QR8 A;  1KRT A;  2CHB D;  1DD2 A;  2RBM A;  4HMJ A;  4JYA Q;  1RTO A;  2HUG A;  2B39 A;  4CKB A;  1D1K A;  1K3B C;  5HUR A;  4U68 A;  3IL8 A;  4Y7N H;  3PV0 A;  5JJZ A;  1A3T A;  2FHT A;  4DR5 Q;  2N78 A;  2BA0 A;  2FMC A;  1LT5 D;  4DFA A;  4DK0 A;  3J7Z C;  4B3M L;  3ZYY X;  1U4P A;  3HOZ G;  4GKJ L;  2WV6 D;  4P72 A;  1VQO A;  4GZY C;  4DR1 Q;  3KF8 A;  1HTL D;  1XMQ Q;  5A2Q E;  4F88 A; 
#chains in the Genus database with same CATH homology
 3GD7 A;  4DV5 L;  3S15 H;  3BJU A;  3TRE A;  5C0X G;  3KYH C;  3L7Z C;  5C4J H;  2AWO A;  3HOY G;  4GKJ Q;  4X66 Q;  4DV3 Q;  1S3O A;  2V1C C;  4BBR H;  2BA1 A;  3UDX A;  4DV1 L;  4A3F H;  3S1N H;  3OTO L;  4LF4 Q;  4JI4 L;  1KC8 C;  3ZJY C;  1KHI A;  4QJF A;  1IZ6 A;  4OWT B;  4MNO A;  1N33 Q;  4KHP L;  4LFB L;  3KDF A;  1EUJ A;  4LFC Q;  4A3C G;  4WJ4 A;  4MTN A;  2N3S A;  3KF6 B;  2UXD L;  4LUZ A;  1VS0 A;  2JEB I;  5FJ8 G;  1LM0 A;  2JA5 G;  4LF4 L;  1G51 A;  3TEH B;  2KEN A;  3BU2 A;  4KLK A;  1VQI A;  2I5H A;  2B63 H;  2HIV A;  1X55 A;  3A0J A;  4P71 A;  2VQF L;  4AQY Q;  4AIM A;  2UXD Q;  1KL9 A;  1TWA H;  5JJI A;  4DNI A;  1VQB A;  2DGY A;  1N32 Q;  2ATW A;  1YI2 A;  1JT8 A;  1Y1W G;  3CCV A;  4B3T Q;  3RN5 A;  4R4C A;  4OON A;  1BBW A;  1XNR Q;  1Z47 A;  3TRZ A;  4A3B G;  1JJC B;  1Z9F A;  5BR8 Q;  3W1G A;  5IP7 H;  1VQM A;  1FVI A;  1AE3 A;  5IYC G;  4C3I H;  5C3E G;  3J81 j;  2UU9 Q;  1J5E Q;  3HKZ G;  1VQ5 A;  1X65 A;  1JJ2 A;  4IOA A;  3JAM i;  4DR2 Q;  4K0K L;  3CCE A;  2NVX H;  4GN3 B;  5HGQ A;  1IL2 A;  4DV0 L;  4GLV B;  2A8V A;  3F2D A;  4BY7 H;  4P75 A;  1IBM L;  1KXL A;  1Q7Y C;  3ULL A;  1IBL Q;  2EQS A;  4DAM A;  4QL5 A;  4A3G G;  4DR7 Q;  1EIF A;  3K0X A;  4JI0 L;  2RHQ B;  4IPC A;  3UDF A;  4HJA A;  4DR3 L;  3M4P A;  1N8R C;  4IPG A;  2JA6 H;  2EIF A;  3HOU H;  2MQH A;  3PUV A;  2JA8 G;  3HOV H;  4B3R L;  3AFP A;  5C44 H;  2VL6 A;  4DV7 Q;  4DK6 C;  1CKN A;  1ASY A;  2JQO A;  3GTM H;  4R4I A;  1HR0 Q;  4LF7 Q;  1Q12 A;  4DR7 L;  5IT9 c;  5LMN W;  4JI8 Q;  3GO5 A;  3HOZ H;  1YNX A;  4TVA B;  5GAH C;  2I5M X;  2CWA A;  2WB1 E;  1YZ6 A;  4R1J A;  1XMO L;  2LXK A;  3F2B A;  1KRS A;  4A3G H;  3PSI A;  1IYJ B;  3ERS X;  4O2D A;  2RCN A;  3RN2 A;  3UE1 A;  1E22 A;  4J15 A;  3M7N A;  4YWL A;  1CSP A;  3H3V I;  5E7N A;  4DR4 Q;  4LW1 A;  2VNU D;  2IX0 A;  1VQL A;  4GNX B;  3BZK A;  1Q8K A;  1R9T H;  4BXX G;  2PQA B;  4DV2 Q;  2YTY A;  2KCT A;  4OWX B;  4GLX A;  1VQ8 A;  3G4S A;  4B3T L;  2UUC Q;  2VY3 A;  2CKZ B;  3PF4 A;  1YEZ A;  1VQE A;  3STB D;  1XNQ L;  1XTD A;  4JI2 Q;  3CD6 A;  1E1O A;  1A63 A;  1UE7 A;  1PHJ A;  4JI5 L;  3H3V H;  3M3Y H;  3B6Y A;  2BH2 A;  4NB3 A;  1WJJ A;  3I4N G;  4LF9 L;  2LSS A;  4FDB A;  1M1K C;  3CC4 A;  2K4K A;  4X64 Q;  1YHB A;  5C44 G;  1EOV A;  3CPF A;  1X56 A;  5M3M G;  1PH1 A;  1PH8 A;  2B63 G;  3KJO A;  1KIX A;  1OTC A;  2UXC Q;  1VQC A;  3CC7 A;  2IHE A;  5M5W H;  2PI2 E;  1EFW A;  2JJQ A;  4OXP A;  4X62 L;  4JV5 L;  2B3G A;  4IFD I;  4LFA L;  2F4V Q;  1L2F A;  3NEL A;  1WI5 A;  3K7A H;  4YHH Q;  3RZO H;  2QA4 A;  1SR3 A;  3I2Z A;  5GAD C;  2HQL A;  2OQ0 A;  3GTK H;  5JJK A;  4JI8 L;  1YVC A;  4ME3 A;  2ZJQ A;  1WYD A;  1PH3 A;  3PO2 H;  1G29 1;  1Q46 A;  4UP8 A;  1NTG A;  2R92 H;  3CCS A;  3NEN A;  3CCL A;  2WAQ G;  3HOW H;  4GKK Q;  1PH6 A;  2KHJ A;  3J80 c;  3G6E A;  1QUQ B;  2GVA A;  3M4Q A;  3U50 C;  2ALY B;  3FHW A;  3H0G G;  3VDY A;  2JA9 A;  1PH4 A;  1N33 L;  4KHP Q;  5M3F H;  4JI3 L;  2Q2I A;  4NXM L;  2KHI A;  1K8A C;  4H02 A;  1BBU A;  1Y14 B;  2LXJ A;  1EIY B;  2ID0 A;  4QY7 A;  5IE8 A;  4LF6 L;  4HJ8 A;  3HOU G;  4OO1 G;  1UE1 A;  4DV0 Q;  3G71 A;  4L5T A;  1LUZ A;  1C9O A;  2VQE Q;  2R93 G;  4BY7 G;  3S17 H;  3A5Z B;  4GOP B;  1K8G A;  4MZ9 A;  4PZ8 A;  2NN6 I;  4A3K H;  3UE0 A;  1K9M C;  4A3I H;  2UXB L;  5H1S E;  4HIO A;  1HH2 P;  2K5V A;  1VQ7 A;  1CKM A;  3RZD H;  5BR8 L;  2OCE A;  1N34 Q;  3KDF B;  1OXS C;  1L1O C;  1BVS A;  1TWC H;  4X64 L;  5FLM H;  1XJV A;  1ASZ A;  1CUK A;  2K52 A;  3KF6 A;  2CFM A;  4YY3 Q;  4QQB X;  1YJ9 A;  1HZC A;  3S1M H;  1L1O B;  1YHA A;  1VCI A;  3PO3 G;  4DV3 L;  2Y0S G;  4JI1 L;  2Z0S A;  4OX9 Q;  3S14 H;  1IBK L;  4PZ6 A;  4TQU S;  4AYB E;  5IY0 A;  4YHH L;  3U58 A;  2E2H H;  4JI6 Q;  1FJG L;  5C4X G;  3M85 A;  4OWW B;  1K0R A;  4LFB Q;  2MFI A;  1TWF H;  4O0A A;  2K14 A;  3MEF A;  3S2D H;  4PG3 A;  5C0X I;  1BKB A;  1W3S A;  5IYB H;  4IFD G;  5K36 G;  4LWC A;  1HNX Q;  3CAM A;  4EQ5 A;  4A3C H;  5IYD G;  1QZG A;  4A3M H;  3K7U C;  1HZ9 A;  4JBM A;  5AJ3 L;  4A3L G;  4X65 L;  1PH5 A;  3OW2 A;  1LTL A;  2K5N A;  2ASB A;  2RHS B;  2E2J H;  4JCV E;  1NE3 A;  2ZJP A;  1X6O A;  3DLL A;  1XMQ L;  1XPR A;  1B70 B;  2YYZ A;  1QVF A;  3S16 H;  2PMZ E;  4POF A;  1X3G A;  1XNR L;  1Q1B A;  3E9I A;  4GN4 B;  4BA2 I;  2GN5 A;  1YJW A;  4JC0 A;  1EWI A;  1P8L A;  2ZTE A;  2L15 A;  2NZO A;  2K75 A;  1VQ9 A;  4P73 A;  1JB7 A;  1L0W A;  2UU9 L;  4KI0 A;  2UXB Q;  1CSQ A;  3E9H A;  1E24 A;  1S40 A;  1SRU A;  1N36 L;  3OTO Q;  2VS1 A;  1B8A A;  2VUM H;  1E1T A;  2QGQ A;  4POG A;  3KF8 B;  5EAY A;  2BH8 A;  2JA6 G;  1Q86 C;  1PH2 A;  5DLQ E;  4L5R C;  1JJG A;  1DGS A;  1VQJ A;  5ELN A;  4GOP C;  4JBK A;  2AKW B;  3RLN A;  3HOW G;  4DV4 Q;  4UPA A;  2R6G A;  1A0I A;  4P74 A;  4APV A;  3KFU A;  4DV6 Q;  2K50 A;  1GM5 A;  4IOC A;  1O7I A;  4JI6 L;  1VQH A;  3FP9 A;  1FJG Q;  3F8T A;  4B3R Q;  2VZA A;  2ES2 A;  1MIU A;  2H5X A;  4L5Q A;  4YCU A;  1A8V A;  1PA6 A;  4JI3 Q;  3EBE A;  4B3M Q;  4LF5 Q;  4DUZ L;  1X9N A;  1PH7 A;  3S1Q H;  4DV4 L;  4A3K G;  1NJI C;  1EQQ A;  5M5Y H;  2UUA Q;  1JE5 A;  4JI4 Q;  1HNW L;  3AYH B;  4JBJ A;  4DAY B;  2VQE L;  2KCM A;  4HJ5 A;  1E3P A;  1GKH A;  3PGZ A;  2K5H A;  2PNH A;  2PI2 A;  1I94 Q;  2I5L X;  2OQK A;  2UUA L;  4B3S L;  1HNW Q;  3RLF A;  4JOI C;  4C2M H;  4C3H H;  2R7F A;  1TWG H;  3W5O A;  4A93 H;  4AYB G;  2WB1 G;  3AFQ A;  2R7Z G;  2D62 A;  1IBL L;  4A3J H;  3SGI A;  4JBW A;  4JI0 Q;  1RL2 A;  3S1R H;  1I5F A;  1X3E A;  2JA7 G;  1IXR A;  3CCR A;  3PO2 G;  4JI1 Q;  1PV4 A;  1TXY A;  4NXN L;  1HR0 L;  4A3I G;  4LF7 L;  3RR5 A;  4DUY L;  4DR2 L;  1SMX A;  2RF4 A;  3IRB A;  1V9P A;  3TQY A;  2R7D A;  3CCM A;  3BZC A;  4BBR G;  3T1Y L;  3CP0 A;  5LMU Q;  5IYB G;  1P16 A;  5C0X J;  4DV1 Q;  4A3F G;  4LFA Q;  1HNX L;  2CWP A;  4NXN Q;  3J7A 5;  2Q2H A;  4DR6 L;  1RIP A;  1WCM G;  5AJ3 Q;  3PUY A;  4DUY Q;  1CKN B;  1KQS A;  1HNZ Q;  4DR3 Q;  4A4I A;  1X54 A;  2NN6 G;  3KOJ A;  1H95 A;  3F2C A;  4YWK A;  4OX9 L;  1WOC A;  2AHO B;  1PVO A;  4IJL A;  3PUX A;  3NBH B;  1QVC A;  4LUO A;  1SE8 A;  1V43 A;  3GTQ H;  2JE6 I;  4IPD A;  2IHF A;  1VQP A;  3CCQ A;  1HZA A;  3KLW A;  4BBS G;  2C35 B;  1SRO A;  4WJ3 M;  1UE6 A;  4A75 A;  3GTP H;  3HKS A;  1N32 L;  4UP9 A;  4GNX A;  1I94 L;  2I0Q A;  1JMC A;  3I55 A;  1EQR A;  1QVG A;  2Q2T A;  4PMW A;  3CME A;  4DV5 Q;  4LF8 L;  4A3B H;  4X6A H;  3I4M H;  3CXC A;  1NMG A;  3M4O H;  2KBN A;  3PIP A;  3T1H L;  3M9B A;  3CW2 C;  4LUV A;  4X62 Q;  4JV5 Q;  4YCW A;  5IP7 G;  4YWM A;  2AWN A;  4L5S A;  4JG2 A;  1MJE A;  4HJ9 A;  4GLA C;  2NVT H;  3EN2 A;  3ULJ A;  2YU9 H;  1Y1W H;  4LF8 Q;  1UE5 A;  1MKH A;  3L2P A;  3PIO A;  1S72 A;  1NBW A;  3J80 i;  2ZM6 L;  4BA1 I;  3HOX G;  2UUB L;  4A76 A;  3A5U A;  4DR6 Q;  2A1A A;  2HIX A;  3PF5 A;  2HHH Q;  5GRO A;  3CC2 A;  2JA5 H;  3I4N H;  4A3D G;  1Y1V H;  4IO9 A;  3H0G H;  5ELO A;  4GNX C;  1LYL A;  1PYB A;  2R93 H;  3J81 c;  4DR5 L;  1U5K A;  4ALP A;  3S2H H;  2ZTD A;  1KAW A;  1HR0 W;  5FLM G;  3ICE A;  2Q2U A;  2ZTC A;  3MXN B;  3HKZ E;  4DV7 L;  3E0E A;  3GTG H;  1YHQ A;  2EXD A;  4XTC S;  2UUC L;  2VW9 A;  2HHH L;  1YIT A;  1M90 C;  3GTL H;  1XNQ Q;  1OXT A;  4GN5 A;  2JK8 A;  1G6P A;  3UDG A;  1N9W A;  2PQA A;  5HY6 A;  4B3S Q;  1HNZ L;  1AH9 A;  3STB C;  3NEM A;  4Y52 H;  2JA7 H;  5IYD H;  2OWO A;  4IFD J;  2MO1 A;  4HIM A;  3K80 C;  1VQ4 A;  1VQN A;  1J6Q A;  1VQG A;  2R7Z H;  2OTJ A;  4LNQ A;  1D7Q A;  4A3D H;  2Y0S E;  1J5E L;  4LF5 L;  1FGU A;  3W1B A;  4UY8 C;  3HOY H;  2AMC B;  3G48 A;  5LMN Q;  3A74 A;  1YJN A;  4K0K Q;  4X65 Q;  2UXC L;  1HJP A;  3LGJ A;  4QIW E;  1YIJ A;  4X66 L;  4DKA C;  1Q82 C;  2N8N A;  3OYY A;  3I7F A;  4QGU A;  2IT1 A;  3D0F A;  1VQ6 A;  2MO0 A;  1GVP A;  2A19 A;  1QZH A;  1T9H A;  5GQO A;  1E7Z A;  2YV5 A;  2Z6K A;  4YY3 L;  4NXM Q;  3HOV G;  3S24 A;  2NVQ H;  3PCO B;  2IY5 B;  4C3J H;  3AEV A;  4R4O A;  1OXX K;  2D0P A;  3Q8D A;  1GD7 A;  4LFC L;  3PUW A;  1PFS A;  1U0L A;  3CCU A;  1Q81 C;  1PH9 A;  1UEB A;  3L0O A;  5GAG C;  5LMU L;  3ULP A;  4GOP A;  1OXV A;  1VQF A;  1Q1E A;  4BXX H;  4GS3 A;  4KHZ A;  4DPG A;  5IWA L;  2WAQ E;  1FL0 A;  2CCZ A;  1XPO A;  2NVY H;  3GDE A;  2VQF Q;  4AQY L;  4JI7 Q;  1I3Q H;  4RMF A;  4EX5 A;  3RNU A;  5C3E H;  4HID A;  2F4V L;  4BBS H;  2Z6K C;  1K73 C;  1B7Y B;  5M3M H;  5GAE C;  3CPW A;  2FXQ A;  3GTO H;  3K8A A;  2B29 A;  3T1Y Q;  4RG1 A;  1UWV A;  4DUZ Q;  3TS2 A;  1AE2 A;  4GKK L;  3CF5 A;  3PO3 H;  4BY1 G;  1EYG A;  2F52 A;  1GO3 E;  5J3B A;  5LMN L;  3RLO A;  5IP9 H;  4JOI A;  4XIG S;  4JI2 L;  1IBM Q;  3I4O A;  4JI5 Q;  3FKI H;  4HIK A;  1K3R A;  3T1H Q;  4A3E H;  4LF9 Q;  2JEA I;  4LF6 Q;  3DM3 A;  1MJC A;  2E5L L;  1V1Q A;  2QEX A;  1WFQ A;  1I6H H;  4NPS A;  1VQD A;  1K83 H;  4UP7 A;  2GVB A;  2XTI A;  3EIV A;  5JEA G;  4DR1 L;  4A3M G;  3ER0 A;  3J81 i;  2UUB Q;  3GTJ H;  4DK3 C;  4A3E G;  3JC6 6;  1IBK Q;  3F1Z A;  3K81 C;  5IYC H;  1L1O A;  2E2I H;  1SFO H;  2WP8 J;  1C7Y A;  1C0A A;  2MNA A;  1I50 H;  2E5L Q;  4A93 G;  1A62 A;  2D0O A;  1KD1 C;  4BY1 H;  2E8G A;  1Y1V G;  4OO1 I;  1W2B A;  4HJ7 A;  3U4V A;  3KJP A;  2YTX A;  1X3F A;  3HOX H;  1KRT A;  5IWA Q;  1XPU A;  5M3F G;  2IX1 A;  4R4Q A;  1N36 Q;  4DR4 L;  2JA8 H;  4JYA Q;  2F3I A;  5JJL A;  1N34 L;  3I4M G;  1D8L A;  5FLX c;  4JI7 L;  3CMA A;  2XGT A;  4DV2 L;  3TS0 A;  2R92 G;  4IJH A;  5FJ8 H;  4Y7N H;  2ZM6 Q;  3PV0 A;  2DUD A;  1VQK A;  1VQA A;  1TWH H;  1YBY A;  1PYS B;  3WWV A;  1NY4 A;  3AQQ A;  4JYA L;  2YTV A;  3HFZ B;  2CQO A;  1SN8 A;  4DR5 Q;  3CCJ A;  4A3L H;  4R4T A;  1HZB A;  1SLJ A;  2NZH A;  3U4Z A;  3PUZ A;  3H15 A;  2N78 A;  2BA0 A;  5JEA J;  1XMO Q;  3FKI G;  2WFW A;  4IPH A;  3J7Z C;  3D31 A;  1OXU A;  1QUQ A;  4A3J G;  5IP9 G;  4B3M L;  3CQZ H;  4AH6 A;  3HOZ G;  2ZJR A;  2HT1 A;  4GKJ L;  4YCV A;  4P72 A;  1VQO A;  2N49 A;  5M5X H;  4DR1 Q;  5C4X H;  2VUM G;  3JAM c;  4DV6 L;  3UDI A;  3I56 A;  1XMQ Q;  4PZ7 A;  1CKO A;  1WCM H;  1NMF A;  2OTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...