4QL5A

Crystal structure of translation initiation factor if-1 from streptococcus pneumoniae tigr4
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
DVIEVEGKVVDTMPNAMFTVELENGHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor IF-1
publication title Crystal structure of translation initiation factor IF-1 from Streptococcus pneumoniae TIGR4
rcsb
source organism Streptococcus pneumoniae
total genus 13
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ql5A00
1L1OB 3W5OA 2ZM6L 2QEXA 4DR7Q 3BJUA 2BA1A 4HIOA 4POGA 1PA6A 4NXNL 3STBD 3CMAA 1M1KC 3T1HL 1VQ8A 1N32Q 4DR6L 2NVXH 1EIFA 4KHPQ 4X6AH 3PCOB 3VDYA 3DM3A 4A3FG 2BH8A 2ATWA 3S1MH 1XNQL 2MNAA 2F3IA 5IYCH 1KRTA 2UU9L 1JJ2A 2OTJA 2MFIA 2VUMH 3G4SA 2RCNA 3G6EA 2F4VQ 5IYDH 1ASYA 4YY3L 5GQOA 2R6GA 4GKKQ 4UY8C 1SROA 1MJCA 5M5WH 1Q82C 3TS2A 5J3BA 1Q81C 1IBLQ 3OW2A 3DLLA 1WJJA 4QL5A 2HT1A 4JI5Q 1Q1EA 4GNXA 5JEAJ 2B63G 5LMUL 1S40A 3W1GA 1Q86C 2MO1A 3RN5A 2NVTH 2AWOA 3PIPA 2PQAB 1YVCA 4DV3L 3K81C 1EIYB 3OTOQ 3GTMH 1Q1BA 4YHHL 3M85A 4X64Q 1CUKA 1J5EQ 2KENA 2XTIA 3L7ZC 4L5QA 1KC8C 1KD1C 3S17H 2R7ZH 1V1QA 2DGYA 3CPWA 3RLOA 1IXRA 1ASZA 3SGIA 4A3CG 4GOPB 5M3FG 4DV1L 4A3LG 2I5LX 5IP9H 5C3EH 1N33Q 3RZOH 4UP7A 3MXNB 3EN2A 4JI3L 1EYGA 3M7NA 4HJ8A 3H3VH 1D7QA 2LSSA 4AH6A 3KLWA 4DK6C 2UUCL 1E1TA 2BA0A 3A5UA 4DAMA 2IX1A 2N8NA 1EFWA 2D62A 5C4XH 4P75A 5AJ3Q 1TWGH 1NBWA 1VQNA 3CCUA 4C3IH 4DV2L 4UPAA 2JJQA 1YIJA 1HJPA 1KAWA 3M9BA 4QQBX 3AEVA 1GKHA 2PI2E 4A3MH 3GTOH 2PI2A 3D31A 3MEFA 3CC7A 4JBMA 1I94L 3PV0A 1JB7A 4WJ3M 2H5XA 2IX0A 4IPCA 1HNZQ 3UDXA 1G51A 2Q2UA 2K75A 1PVOA 3ULJA 3PO3H 4NB3A 2UXBQ 3M3YH 3ICEA 5HY6A 4PG3A 3J81j 3F1ZA 2N78A 4X65L 2NZHA 3UE1A 2CCZA 3AYHB 2ZTDA 1IBKQ 1HZCA 1L2FA 1VQHA 4LF9Q 1BVSA 1VQBA 1I3QH 4NXML 2YU9H 3IRBA 3CCVA 3S15H 4JBJA 4A3BG 2ZTCA 1I50H 3OYYA 1A62A 4IPGA 1BKBA 3ERSX 4DUZQ 4DV6L 2NVYH 3CCLA 1L1OA 3I55A 2QGQA 4A93H 5IT9c 3TREA 1G291 3HOZG 4JV5Q 1OXVA 5GAHC 3S1QH 4A3IH 4HJ5A 4GN4B 2JA5G 2VS1A 2KHJA 3UDGA 1HNWQ 1YJWA 1VQ7A 3KYHC 2CQOA 3PUVA 3CCSA 4JI1Q 1SE8A 4HIMA 4LFAQ 2K52A 2Q2HA 4JI4L 3J81i 2JA6G 1XTDA 2ES2A 2UXCL 2MO0A 4RMFA 1U0LA 5LMNW 3GTKH 4NPSA 2IHEA 4MNOA 3HOUG 3J81c 4B3SL 3T1YL 2NZOA 1YHAA 1J6QA 2OQKA 4DK3C 4A3DG 2A8VA 4HIDA 1T9HA 1IBMQ 3HOXH 4IPDA 2I5HA 1Y14B 4A3GH 2PQAA 4POFA 1X3FA 4JYAQ 5BR8Q 5C0XJ 4X66L 1PH4A 3S1RH 4PZ8A 1C0AA 1EUJA 1X3EA 1VQFA 3D0FA 3JC66 4DR7L 2HHHQ 2UUBQ 1Z47A 1YZ6A 2RHQB 4BBRG 4A3KG 1QVGA 2NVQH 3HOWH 4KLKA 3S24A 3KJPA 1N32L 4YWKA 5LMNQ 4GOPA 1KIXA 4LF4Q 3PO2H 3HFZB 1XNRQ 4BXXH 4BBSH 4LF7Q 1A0IA 2E2HH 4L5SA 2JK8A 2JQOA 2VZAA 1UE5A 4JG2A 1PH7A 3I4MH 4B3MQ 2ZJPA 2HQLA 2F4VL 4GKKL 1WOCA 2YV5A 4R4QA 1AH9A 2N49A 3BZKA 3E9IA 1IBLL 4LF8Q 2GN5A 3NBHB 4A3EH 4XIGS 1Y1WG 2WFWA 4TQUS 2B3GA 4LFCQ 1X6OA 2Z6KA 4JI2Q 1JMCA 3LGJA 5E7NA 3I7FA 2E2IH 1IZ6A 2JA8H 2R93G 3BU2A 3OTOL 3STBC 2PNHA 5GAEC 1X9NA 4X64L 1J5EL 1H95A 1U5KA 4P72A 2I5MX 5IE8A 2EQSA 3G48A 4DAYB 1NY4A 2ZTEA 5FLXc 1Q12A 4GN5A 4KI0A 3H15A 4DR4Q 3S2DH 4B3TQ 5C44H 1EWIA 3GO5A 3HOYH 4IOAA 4A76A 1VQGA 3PUYA 3K0XA 1MKHA 1IYJB 4A4IA 1N33L 3CXCA 4JC0A 5IYCG 4X62Q 3HKZG 4IFDI 4DV0Q 2OCEA 4IFDG 1EQRA 2VUMG 3PUWA 2HIVA 5IYDG 2JEAI 1QVFA 1E22A 3M4PA 3K7AH 2KHIA 1TXYA 4UP9A 3JAMi 2A19A 5AJ3L 3I56A 3E0EA 5C44G 1XJVA 4OWXB 2YYZA 1R9TH 2NN6I 1PH3A 2NN6G 2QA4A 2JA7H 1JJCB 1VQAA 5FJ8H 1AE2A 1WYDA 1PH6A 1KHIA 3H0GH 5IWAQ 1YNXA 2MQHA 3JAMc 1QZHA 1UWVA 2ID0A 5FLMH 2WP8J 4DR6Q 4WJ4A 4LF6Q 4QY7A 1HNZL 2E5LQ 3PIOA 1QVCA 2Q2IA 1AE3A 4PZ6A 2RHSB 1NMGA 2UXBL 2LXKA 2YTVA 3KJOA 5K36G 5GADC 1SR3A 3FP9A 1HNXQ 2R7ZG 1BBUA 4P74A 1PH5A 3F8TA 1FJGQ 4B3RL 1A63A 1PH9A 1N8RC 3FHWA 1IBKL 3FKIH 2I0QA 4LF9L 4L5RC 4GNXC 1V43A 3A0JA 3EBEA 5IP9G 3B6YA 5C3EG 2GVAA 4A3JH 4DV4Q 3HKZE 1NMFA 3L2PA 4DUZL 3F2DA 3CQZH 4DV5Q 2UUAL 3H3VI 3HOVH 1K0RA 2R92H 3PSIA 2D0PA 1CKNB 4JV5L 1Q7YC 1K9MC 3AFQA 5JJIA 4K0KQ 3GD7A 1VQLA 4OX9Q 4JOIA 5GROA 4HIKA 5C4XG 1W3SA 1E24A 1Z9FA 2IHFA 1HNWL 4DR1Q 1SN8A 4Y52H 1TWHH 1XPOA 4C2MH 4JI1L 2PMZE 1NJIC 4GLVB 5JJKA 4LFAL 3KOJA 3TS0A 4A3MG 4AQYQ 4JBKA 2UXDQ 1X3GA 4O2DA 1RIPA 1TWFH 1VS0A 2A1AA 4DR3Q 3U4ZA 3CC4A 4JI0Q 3I4NH 1XMOQ 1B8AA 3CCJA 2OWOA 2D0OA 3PO3G 1E3PA 3GTGH 1L0WA 2ZJQA 2VQFQ 1LYLA 1IBML 4DPGA 4AYBG 1NTGA 1PHJA 1VQ6A 1YI2A 3S2HH 4GN3B 2CWPA 5H1SE 5IP7H 3KF6B 4JYAL 4JCVE 1K83H 5BR8L 1VQDA 4JI8Q 3CCQA 1Y1VH 4R4CA 2KBNA 2WB1G 3CC2A 1SRUA 1JJGA 3UE0A 2HHHL 2UUBL 1C7YA 4A93G 2Z0SA 1OXUA 2FXQA 2JE6I 4TVAB 1JT8A 4IJLA 5LMNL 4JOIC 4A3IG 1VQOA 4LF4L 3U4VA 4A75A 5JEAG 4DV7Q 1XNRL 4BY1H 4LF7L 1VQMA 1PYSB 3E9HA 3KDFB 3CD6A 4LFBQ 2N3SA 3F2BA 4B3ML 3EIVA 3M4QA 2OTLA 3J7A5 2CKZB 5IYBH 3TRZA 1L1OC 1SLJA 2YTXA 3NENA 1M90C 1P8LA 4J15A 4OO1I 4OO1G 1RL2A 1HR0W 4LF8L 5M5XH 4DUYQ 2KCMA 4KHPL 5IY0A 4LFCL 1BBWA 4AYBE 3HOXG 1OXXK 4LUZA 2CFMA 1X65A 4A3GG 2KCTA 4C3JH 4YCWA 4EQ5A 5GAGC 4GLXA 1S72A 1HZBA 5EAYA 4R4IA 1WCMH 2OQ0A 2WB1E 4LW1A 3CW2C 3S14H 5M3MH 4QGUA 4BY7H 3M4OH 4DR4L 4B3TL 1IL2A 1VQCA 1EQQA 3HOWG 2F52A 1X56A 3U50C 4JI5L 4O0AA 1HR0Q 1B70B 3PO2G 2R7DA 4IPHA 4LUOA 3RNUA 1PYBA 4YWLA 4BXXG 4QIWE 1UE6A 2YTYA 3AQQA 4X62L 4IOCA 4BBSG 1K73C 4DV0L 1Q8KA 2XGTA 4A3FH 3I4MG 4KHZA 2E8GA 4P71A 1CKNA 3A5ZB 2B29A 1C9OA 4ALPA 1VQPA 1N9WA 1FL0A 1KL9A 1N34Q 2V1CC 4YCVA 4JI7Q 1KXLA 4C3HH 4EX5A 4QJFA 4GOPC 3NEMA 4A3EG 3RZDH 5IWAL 4DNIA 1GVPA 3K80C 4DR5Q 4LNQA 1YBYA 1N36Q 2VQEQ 4Y7NH 1UE1A 1PFSA 1Q46A 1YJNA 4H02A 3CMEA 2E5LL 4LF6L 2B63H 2JA8G 4LF5Q 5C4JH 4DR2Q 1XMQQ 1EOVA 3CF5A 1OXTA 4HJ7A 4OXPA 1TWCH 2C35B 2JA9A 1G6PA 3GDEA 3CPFA 1HNXL 4JI6Q 3RLNA 2R7FA 1QUQB 1UEBA 1FJGL 4MTNA 3HOYG 2IY5B 4GKJQ 1B7YB 3GTQH 2Y0SG 1MIUA 2ZM6Q 2Z6KC 1E7ZA 3KF6A 1CKMA 4DV4L 3ULPA 4NXNQ 1K8AC 4A3CH 5M3FH 4DV5L 3T1HQ 3PF4A 4A3LH 1X54A 1SMXA 2HIXA 1O7IA 4PZ7A 4AIMA 2AMCB 2K5NA 1I5FA 2AWNA 3PF5A 1WI5A 3TQYA 1K8GA 1VQ9A 4OX9L 1XNQQ 2UU9Q 4IJHA 1DGSA 3HKSA 3A74A 3UDIA 4DR1L 1D8LA 2JA7G 5FJ8G 4YY3Q 3KDFA 3H0GG 4AQYL 3L0OA 2UXDL 5C0XI 5HGQA 5C0XG 5FLMG 3J80i 4DR3L 4JI0L 3PGZA 4FDBA 1GM5A 1XMOL 1FVIA 1CSPA 3RLFA 1GO3E 2ASBA 1LUZA 5LMUQ 3RR5A 2K5HA 3CCEA 3J80c 2EXDA 2VQFL 2ZJRA 4DV3Q 4L5TA 2GVBA 2K50A 3ULLA 4HJAA 5DLQE 4YHHQ 3GTLH 2JEBI 2Y0SE 3FKIG 1OXSC 1LTLA 2AKWB 2VL6A 4PMWA 4JI8L 1HH2P 4A3JG 1MJEA 1CKOA 1KQSA 2BH2A 2L15A 2DUDA 3PUZA 4XTCS 4DV1Q 4P73A 1I6HH 3ZJYC 3HOVG 1W2BA 2R92G 4APVA 4A3BH 1PH2A 4JI3Q 3GTPH 4UP8A 4DV7L 1PV4A 1OTCA 1TWAH 5ELNA 3HOZH 2UUCQ 4R4TA 3BZCA 1K3RA 4R4OA 3WWVA 1FGUA 1HZAA 2LXJA 4JBWA 4LFBL 5JJLA 2JA5H 1SFOH 1YEZA 4DV2Q 4B3RQ 1PH1A 4DKAC 1VQKA 1X55A 4GNXB 3I4NG 1JE5A 2AHOB 3CP0A 4DUYL 2JA6H 1I94Q 4IFDJ 2E2JH 3ER0A 4HJ9A 2UUAQ 3RN2A 3HOUH 1YITA 2IT1A 4BA1I 1A8VA 4R1JA 1XPUA 3G71A 2VY3A 4OONA 4A3DH 1HZ9A 1CSQA 4K0KL 5IP7G 4LWCA 4LUVA 1YHQA 3AFPA 4X65Q 2WAQG 4MZ9A 1VQIA 1LM0A 1Y1VG 4ME3A 3J7ZC 2EIFA 3TEHB 1VQEA 3CCRA 4IO9A 4GLAC 4NXMQ 1QUQA 1HR0L 4DV6Q 1P16A 1E1OA 3KF8B 3Q8DA 4BBRH 4YWMA 4OWTB 4A3KH 4OWWB 4BY1G 4JI2L 1VQJA 3F2CA 3KFUA 1PH8A 1S3OA 5ELOA 3CCMA 1V9PA 3CAMA 5IYBG 1YJ9A 1N34L 4JI7L 3GTJH 2RF4A 2K14A 3PUXA 2VNUD 1UE7A 3I2ZA 4JI4Q 3S1NH 4RG1A 1QZGA 1GD7A 2UXCQ 4DR5L 1YHBA 2VW9A 1VQ4A 1NE3A 4GS3A 1XPRA 2VQEL 1N36L 1VQ5A 1KRSA 4B3SQ 4BA2I 5M5YH 3T1YQ 1VCIA 1Y1WH 4LF5L 3K8AA 4DR2L 1XMQL 2WAQE 2K5VA 3NELA 1WCMG 3UDFA 3W1BA 2CWAA 3U58A 2R93H 5M3MG 4BY7G 1WFQA 4JI6L 2ALYB 3S16H 2K4KA 3I4OA 3K7UC 2Q2TA 4YCUA 4GKJL 4X66Q
chains in the Genus database with same CATH superfamily
3RUZA 3BJUA 4OELB 1BF4A 3TN2A 4FF2A 3PCOB 2DN8A 2MNAA 4IFDH 3BG3A 2VUMH 2F4VQ 2DJGC 5GQOA 4GKKQ 3ND8A 4K14A 3J81E 1MJCA 5M5WH 1Q82C 2NN6H 5C5LA 2B63G 2A74C 3W1GA 1Q86C 2EYPA 4F88A 1EL0A 1Q1BA 2B2UC 3T13A 2KENA 4IALA 3GTPB 1QOHA 1HQRD 1KD1C 1TWAB 3HOZB 2DGYA 1II3A 3OOCA 3RLOA 1KTKA 3X3NA 1HQMC 4A3CG 4GOPB 1FNVA 4N9TA 2I5LX 4WORA 5C3EH 2JA5B 2CHBD 4HMJA 2EYLA 3H3VH 1D7QA 2LSSA 4AH6A 1EU3A 4J1MA 3A5UA 2JA6B 3NBIA 5C4XH 3NSWA 1YIJA 2JJQA 3M9BA 2PI2E 5LHY1 1RKNA 3F2UA 3PMFA 4KN4C 2B2TA 1SXTA 4IPCA 4WJ3M 1HNZQ 1PVOA 2K75A 3NTKA 3ICEA 3HG9A 4RH6A 3F1ZA 5C5MA 4N8X1 4A3KB 2NZHA 1HZCA 1VQHA 4HMIA 1VQBA 2A73B 3D4DA 1F2YA 2ZTCA 3H6MA 1A62A 1BKBA 3ERSX 2NVYH 2IX3A 1L1OA 4IUNA 2EJFC 1IYVA 2LS01 4GN4B 1PRTB 3DXJC 2Q8IB 1QJOA 5M5YB 1SE8A 1TVXA 2R93B 1J9OA 5T1GA 2MO0A 5EJWA 2PQEA 4RMFA 5JPNC 3LWEA 4K2KA 5LMNW 3GTKH 4K8IA 4NPSA 2EZVA 4B3SL 1YHAA 3A7LA 1IBMQ 3HOXH 2IJ0A 4NMZA 5D3DA 1Y14B 2PQAA 1PFBA 4ILWA 3OIQA 3C46A 4JYAQ 2BCOA 1C0AA 1X3EA 3JC66 3D0FA 5I6YA 1YZ6A 4BBRG 3HOWH 4KLKA 1N32L 4QB4A 4MTKA 4K6LA 2RVLA 3PO2H 2WACA 3HEJA 5JPMC 3MXNA 4L5SA 2JK8A 2JQOA 2VZAA 2ZJPA 2HQLA 1SE4A 2WKCA 4KK7A 1WOCA 2YV5A 1AH9A 1CHPD 2N49A 4LF8Q 2DJFC 1JOKA 3NBHB 3E3XA 2GA4B 1W6KA 2NZ1D 4TQUS 4LFCQ 4OGQC 2F0WA 3QO2A 2JA8H 2KOLA 2PNHA 4ODGA 1STYA 4L6TB 3DEPA 3STBC 4P72A 2EQSA 4GN5A 3QIAA 4DR4Q 3GO5A 2F0FA 3HOYH 4A76A 1VQGA 1HFGA 4RGMA 1EOTA 1IYJB 4A4IA 1N33L 1TWGB 2R61A 1TQOA 2B2YC 4K5WA 4X62Q 4OIJA 4DV0Q 4IFDG 2VUMG 3GTOB 3BVMA 1SNCA 4QCLA 3G7LA 3M4PA 3D8GA 3PO3B 2QF7A 2YYZA 4OWXB 3GQBA 2NN6G 2JA7H 2F0LA 1AE2A 1WYDA 3H0GH 4RGOS 3JAMc 1S5FD 1STNA 2MQHA 1UWVA 2PO4A 3R93A 4AYBB 1QZHA 5FLMH 3ITPA 2F3VA 2TSSA 5E1FA 3PIOA 1B9MA 3I73A 1I3QB 1QVCA 2UXBL 2QDBA 2LXKA 3KJOA 2KUMA 3MZ5A 4A93B 2F0IA 1HNXQ 3URYA 1BBUA 1PH5A 3F8TA 1FJGQ 1DJRD 4DK1A 1IBKL 3FHWA 2I0QA 4LF9L 5ELFA 4GNXC 3A0JA 3EBEA 5C3EG 3B6YA 1NMFA 4QIWB 1GUWA 3CQZH 4DV5Q 1H9SB 1K0RA 2PW7A 3GD7A 4ZLTF 4OX9Q 5C4XG 1E24A 4DR1Q 3JAML 1XPOA 4C2MH 4JI1L 2PMZE 2EY1A 1YNJC 1RIPA 1VS0A 2A6ED 4A3GB 4CDDC 3CCJA 3J7YW 1E3PA 2ZJQA 1LYLA 4EGVA 4XXEA 4IZ8A 1VQ6A 3S2HH 4GN3B 4H7BA 1JE4A 3FRPB 3KF6B 5BR8L 1VQDA 1AP0A 3I8ZA 4R4CA 4DAYA 4NDXA 1SRUA 2UUBL 2JE6I 2X69A 4TVAB 4LF4L 3FVQA 3KLRA 1XNRL 3SXHA 4LF7L 1VQMA 1OO9B 2FHTA 5CV4A 5F2DA 4A3EB 5L37A 3MVVA 1ZYRC 1SNOA 1EWCA 1T5EA 4B3ML 4KKTA 1EYCA 3M4QA 2OTLA 2K04A 2CKZB 5IYBH 2N55A 1HR0W 2F0DA 2EJGC 3S2DB 3E0JA 3HOXG 4LUZA 1NUCA 1X65A 4R4IA 5EKIA 4RA8A 3S14H 4YIJA 3D6CA 3HOWG 4IUUA 4Q0FA 2F52A 3NXWA 3K7AB 3PO2G 2R7DA 3R8BA 3PIO3 3RNUA 1PYBA 1UE6A 1BCPD 3SEBA 1VQPA 1N9WA 1LTAD 3IL8A 2V1CC 3QR8A 4K8JA 4JI7Q 4CJ0B 1B1ZA 1KXLA 1EY0A 3I91A 4KY5A 2K6AA 4V0BA 3AMUA 1RODA 2B8GA 4MN3A 1UE1A 1YJNA 1BO0A 4LF6L 2JA8G 4DXFA 4LF5Q 1PTOH 5J39A 4OXPA 2F0EA 4JI6Q 1QUQB 1UEBA 3HOYG 2IY5B 1JC7A 4QUFA 1SMYC 1K3BC 2Z6KC 3ULPA 1TWHB 5M3FH 3PF4A 2HIXA 2EVBA 2CH4A 1QCBD 4K0KL 3PF5A 1I5FA 1WI5A 2JP1A 3TQYA 3UDIA 4FF1A 2Q8RE 1A2UA 3KK7A 3GTGB 2JA7G 1JB3A 3KDFA 3H0GG 4Z9CB 5C0XI 5FLMG 4JI0L 3E6ZX 1FVIA 3CCEA 4DN4M 2EXDA 1CM9A 2LFNA 4FP5D 4L5TA 3GV3A 3MEHA 5C6AA 1GHJA 1ENFA 1H9MA 2AKWB 1KDCA 3T56B 2PZUA 4JI8L 2PZWA 1HH2P 1I6VC 1DOKA 4NW2A 1E2ZA 2F0VA 4XYQA 3GTPH 3NWSA 1PV4A 1TWAH 3HOZH 1H9KA 4R4TA 3BZCA 2Q8TA 4LFBL 4PMBA 2JA5H 3K5MA 3VR5A 1X55A 4GNXB 4G57A 4O42A 3OSOA 1WCMB 2JA6H 1Q8IA 5M3MB 1NR4A 2WIIB 1KDAA 4DGZA 1YITA 1RCVD 4RFBA 2CW0D 3HGBA 1A8VA 4QF4A 3SDZA 1CSQA 1O78A 2JXMB 2WAQG 1VQIA 4ME3A 1D1IA 4X3KA 4HCSA 4IUPA 3D3RA 2H4OA 1X32A 1SNDA 2F0JA 1E1OA 1GUGA 4JK1C 2K32A 4A3KH 4OWWB 4C3HB 2X6GA 2MPMA 2LMCB 2XWBB 3MAQA 2K7VA 3OMGA 2WV6D 1V9PA 4UAIA 3CCMA 5IYBG 3Q23A 4GZYC 2RF4A 2K14A 1S5ED 3KBXA 5C3WA 1QZGA 5KYLA 4GS3A 1XPRA 1QWYA 2VQEL 1N36L 1VQ5A 4ZUJA 4B3SQ 5M5YH 3IAYA 4BA2I 1F9SA 1DONA 3K8AA 1XMQL 2WAQE 1G91A 1EY4A 2SNMA 2FMCA 4P2CB 1QILA 2R93H 4C1NI 2K4KA 4YCUA 4JVZA 3CKIB 2DNEA 1CFMA 1VQ8A 1N32Q 3IFTA 5CMDA 4KTAA 1ICWA 2M9VA 2IPKD 1JJ2A 2EYJA 4C1NK 4M8AA 2RCNA 5IYDH 1JWMD 4CDEC 1MSGA 1ASYA 1SJHD 4ZQ3A 1Z7TA 3Q0AA 4NP5A 4I7AA 3DLLA 4JI5Q 1F2ZA 5JEAJ 1VMCA 1E2VA 2O2LD 5I9PA 2F3WA 2AWOA 2MGSA 3NE5B 3RN5A 4DV3L 4ABNA 1EIYB 2J4XA 4DNRB 4FNFA 1UEAB 1IXRA 5M3FG 2EXZA 2EE1A 5IP9H 1N33Q 4JI3L 3EN2A 1XWEA 5EPLA 1LABA 2ENBA 4DK6C 5IGGA 2UUCL 3KF8A 3TDQA 1WTRA 4KKUA 1EEFD 1SE2A 2E2JB 2NWGA 4P75A 1TWGH 1VQNA 3CCUA 4UPAA 2NTTA 4LK1C 1EY8A 3AEVA 3GTOH 2PI2A 3D31A 3PV0A 1AFPA 1QNKA 1D5MC 3AB9A 4RKLA 3PO3H 2UXBQ 4I65A 3VR6A 5HY6A 3J81j 4H0LC 3UE1A 5CORA 1H9RA 4HTHA 1IBKQ 1GUOA 4LF9Q 2QCPX 1I3QH 3IRBA 1LT3D 1EWHA 1R4PB 4JBJA 3OYYA 4IPGA 4ZK9B 4DV6L 3CCLA 3I55A 2HDMA 4A93H 3BDCA 3TREA 3HOZG 3S1NB 3MWYW 3TP5A 4HSPA 5A2QE 3NBHA 2RBMA 3VYTA 2JA5G 2VS1A 2KHJA 3WDNA 1YJWA 2CQOA 3CCSA 1HUMA 1TS5A 4JI1Q 3SR1A 4HIMA 5DAUA 5EGTA 5KNCA 2K52A 3A56A 3BYTB 2JA6G 2UXCL 3EJIA 4MNOA 3J81c 3BVZA 2A8VA 2OF1A 1EZ6A 4R8NA 1ESFA 2NVXB 4A3GH 1MI2A 2K5QA 4POFA 1QG7A 3NP8A 3S1MB 5BR8Q 5KNBA 5C0XJ 4X66L 1PH4A 4PZ8A 5BN3A 2UUBQ 4A3KG 1ZKOA 3GP7A 4YWKA 1NNXA 4LF4Q 2QKIC 5I6WA 3HFZB 1XNRQ 2B2WA 4LF7Q 1A0IA 4JG2A 1UE5A 2F0MA 4OHJA 1LLRD 4B3MQ 2NVTB 1LTRD 1M4VA 3J81L 4R4QA 5CR3A 3E9IA 4ME5A 3TP8A 1IBLL 4A3EH 3ERQA 5IGEA 4XIGS 3S17B 1B2TA 1IHZA 2B3GA 2L1BA 1V1PB 2B39A 1JMCA 3LGJA 1FR3A 2R93G 1DXMA 5KYIA 1JOOA 5LL6X 3OTOL 3RZOB 1J5EL 3ONAB 5FLXc 3S2DH 2RKSA 5CBEE 1MKHA 1TT2A 3CXCA 4C3IB 1IW7D 5IYDG 1GUNA 2JEAI 2JSOA 2D5DA 3HRZC 3MFGA 1X3QA 1R4QB 3K7AH 4DK0A 5AJ3L 2A19A 3I56A 1A3TA 5C44G 4FXDA 1PH3A 1GHKA 5FJ8H 1EQTA 4IUQA 3VR3A 4U673 1DD2A 1O80A 1YNXA 4ZKBB 1D5ZC 2WP8J 3CHBD 1LTBD 1EZ8A 4QY7A 4LF6Q 3L9AX 5FLXL 1A3UA 2RHSB 1NMGA 1LT6D 2YTVA 2WB1B 5GADC 3C3LA 1SR3A 2L9HA 4KY7A 3R2TA 4P74A 2I07B 1SNMA 3S1QB 1HXYD 4A3IB 1A63A 5IP9G 2GVAA 1JICA 1U4MA 4DUZL 3A8JE 3PSIA 2D0PA 3AFQA 2HQEA 4K0KQ 3D4WA 1HNWL 4RCOA 3V2TA 1TWHH 4DAPA 4BS9A 1NJIC 5JJKA 2FFKB 3QOLA 2L4NA 1X3GA 3RD4A 4JI0Q 2NYZD 3CC4A 2KHSA 2OWOA 2D0OA 3PO3G 3R3OA 3GTGH 1BQQT 1XX8A 1PTOF 1RDPD 4AYBG 5HGTA 1PHJA 2CWPA 2IWHA 5IP7H 4G7HC 1F77A 4JI8Q 2F4IA 2P5ZX 2B2TC 2F0NA 1JJGA 2XVSA 5CGKA 4A93G 1ZXTA 1K28A 3BDLA 5I2XA 4IJLA 5EPJA 5KNDA 3U4VA 3A55A 3P20A 3BS1A 1V8QA 1PYSB 4RAUC 4XQQA 4LFBQ 3EIVA 1JWUD 2Z9HA 1L1OC 1M90C 1P8LA 4J15A 5A35A 4OO1I 1PFMA 2KQ3A 3BVGA 3MA2B 5IGFA 1BBWA 2F0QA 4AYBE 5C44B 2KVMA 4KN7C 4A3GG 2Y0SB 1S72A 2EJMA 5EAYA 3D6WA 1RHPA 1WCMH 4S3SA 5M3MH 4QGUA 3QWNA 5J22A 1VQCA 4V190 1HFNA 4JI5L 3M4YA 2G9DA 4LUOA 2ICIA 1F9PA 4QIWE 4IOCA 2K28A 4B08A 2XGTA 4OIKA 3P7JA 1A2TA 4P71A 1CKNA 2G9HD 5COYA 3EQLC 2B29A 1C9OA 2HDLA 4ALPA 1VMPA 2K33A 3A8KE 1RD9D 1KL9A 4YCVA 1NSNS 2ZXOA 4C3HH 4EX5A 4QJFA 4A3EG 1B53A 3K80C 4KKSA 1I4QA 1N36Q 2VQEQ 1DYQA 1Q46A 2E5LL 1I4HA 4KD4A 1QB5D 2AUKA 2XWJB 4RGTA 1EOVA 3CF5A 1XMQQ 1CQVA 2JA9A 3GDEA 1WTHA 2KEDA 2R7FA 4MTNA 3SHLA 3IFDA 1MIUA 1CKMA 4CDFC 1K8AC 3KBGA 4A3LH 1O7IA 1YNND 4PZ7A 4AIMA 1PYWD 4KJNA 1EIGA 1GUTA 2AWNA 1TWFB 1K8GA 1Y8OB 1A6XA 3BYYB 4K2LA 5AFWA 5IOCA 5FJ8G 2EPBA 2UXDL 4DR3L 3J80i 4X3TA 3PGZA 1A3VA 1XMOL 1PRTF 1K83B 1LUZA 1Y1VB 4PQXA 1D6EC 2VQFL 1XXGA 4DV3Q 2K50A 1ENAA 1GJXA 2NBFA 4FVMA 1E0BA 4PMWA 1KQSA 1MJEA 1EYAA 4HEDA 3PUZA 4XTCS 5CYUA 5CV9A 2L11A 2V4DA 1TIID 5C3XA 5HURA 4JI3Q 1UUPA 1OTCA 2A6EC 2UUCQ 1WTOA 4JBWA 2LXJA 1TY2A 4B3RQ 1VQKA 1JE5A 3DUZA 1FD7D 2E2JH 3M4OB 2UUAQ 3RN2A 1Q3LA 2IT1A 4BA1I 1DM0B 1O7YA 4OONA 4XT1B 5IP7G 5J1ZA 3K0YA 4Q5VA 1SNQA 1LM0A 2K1BA 1MD2D 2FJ2A 4A3FB 1LTTD 5ELCA 1VQEA 5NUCA 4ZCKA 4ULLA 1F9QA 1STHA 1S4ZA 4DV6Q 2FMMA 2AQ3B 3Q22A 3Q8DA 4YWMA 1EY6A 2D2CC 3DHQA 1PH8A 1S3OA 3E5SA 5ELOA 3DWQA 3X3MA 2F0TA 2EOTA 1I6HB 5C4JB 3TZDA 3S1NH 3I2ZA 3NTIA 1TWCB 2EYMA 1GD7A 2UXCQ 2VW9A 1B3QA 1L0YB 2F0PA 3GTQB 1VCIA 2PZTA 4DR2L 1I4GA 2K5VA 3MFYA 1WCMG 4CHTB 3UDFA 2C9OA 2CWAA 5M3MG 1HTPA 2JN4A 3K7UC 2RDFA 4GKJL 1D5XC 1EY7A 1BCPC 1FNWA 1L1OB 4X66Q 1WTQA 1D2BA 5IT9E 5D65A 2BA1A 4HIOA 4POGA 1PA6A 2IL8A 1M1KC 4PNYA 3T1HL 2Z8LA 3OWEB 2NVXH 4KHPQ 1EFID 3Q6SA 3VDYA 3DM3A 3I4LA 2BH8A 3S1MH 1XNQL 1KRTA 2HCCA 2A6HD 1SAPA 2OTJA 2TMPA 3A54A 2WINB 3RMHA 4C3HG 4CKBA 3G6EA 5FOBB 3GTLB 1Q81C 1IBLQ 3OW2A 1SYFA 2HT1A 5I4DA 1CA5A 2NVTH 1PZJD 2PQAB 3K81C 3OTOQ 2BOSA 4YHHL 3M85A 4A3BB 1J5EQ 1EQVA 3L7ZC 4L5QA 3S17H 4IUTA 3CPWA 1WD0A 1ASZA 3SGIA 5FO9B 4A3LG 1SFOB 3RZOH 3MXNB 3KUPA 3M7NA 2AQ2B 5EQ0A 1LT4D 2SDFA 1ONLA 1SNPA 1E1TA 2PCFB 4DAMA 2IX1A 2D62A 5AJ3Q 4K6DA 2A5HA 3HOUB 4N8FA 1CZWA 4C3IH 1HJPA 3ND9A 4A3DB 4U68A 3W3AA 1GOZA 4LJZC 1JB7A 2IX0A 3T4AC 1JWSD 3UDXA 3NQIA 2NTSA 4UHVA 3ULJA 5CBAE 4PG3A 4UDUC 4X65L 5FKAC 3AYHB 5FO7B 2ZTDA 1L2FA 1CK1A 1EY9A 1RTNA 4QUCA 4NXML 4DUZQ 2L0CA 1G291 4QMGA 3S1QH 4A3IH 1PTOD 5DM63 2O5JC 3UDGA 1HNWQ 1LO5D 4X3UA 3PUVA 1STBA 4CGYB 1Y1WB 2CW0C 2MJ8A 1ET9A 1XTDA 5CC4A 4WJWA 4KY6A 2ZT9C 2NUCA 3T1YL 2NZOA 1J6QA 2OQKA 2BE5D 4HIDA 1T9HA 5E3FA 4EQNA 4G4KA 2VB2X 4IPDA 1CI3M 2I5HA 1I4PA 2K03A 3G6JB 3MXUA 3HKZB 1EUJA 1VQFA 4DR7L 2XRSD 1WVLA 1O7ZA 4DF7A 3S24A 1DOLA 4XT3B 4GOPA 1KIXA 2F0HA 4BXXH 1AEXA 1ESRA 1CHQD 1CQFA 2BDNA 3N6RA 3FPPA 1PH7A 2QILA 2A69C 5CV5A 3C1FA 1AZQA 2D9UA 3GTMB 3BZKA 2GN5A 2NB0A 1ML0D 3QB3A 2R7ZB 1X6OA 5E7NA 2OEOA 1IZ6A 4F7XA 1X9NA 5G3LF 3Q24A 2PYKA 3HP3A 4X64L 2I5MX 3G48A 4DAYB 2XN9C 5EBCA 2KJXA 3H15A 2H1EA 5C44H 2B2VA 2J0TD 1EEID 3J7AF 2RSNA 4JC0A 4IFDI 1EQRA 1KNEA 4A3MB 4EQOA 4OL7A 1JR0D 3PUWA 3WOFA 4RHRA 1QVFA 2KHIA 4UP9A 3JAMi 1NR2A 1X3PA 3DEOA 3E0EA 2NN6I 3M3YB 2QA4A 1BCPB 4FXKC 4KHVA 2XSCA 1SEBD 1TS3A 5C0XH 4DR6Q 2A68D 2E5LQ 3MXPA 2YU9B 2Q2IA 3S15B 4PZ6A 1I50B 3EROA 3V96A 2OXPA 2RA4A 3FP9A 4B3RL 1PH9A 1N8RC 4L5RC 1V43A 3BZDB 1PRTD 5DEHA 1SE3A 3A7AB 3F2DA 1Y8NB 3S9WA 1QNUA 2UUAL 3H3VI 4KV6A 4JV5L 1ENCA 5A2QL 3H91A 1Q7YC 1K9MC 1E2WA 1VQLA 5BN5A 4JOIA 5GROA 1W3SA 1Z9FA 1SN8A 4C3IG 1QE6A 4FF4A 3R2IA 2JYOA 4Y52H 1HHVA 3K5NA 4GLVB 1HRJA 4LFAL 3TS0A 3I90A 3HS0C 2UXDQ 3SE0A 3U9OA 4O2DA 1TWFH 3NUCA 4DR3Q 3OIPA 1XMOQ 4LMQD 2KCNA 3S1RB 2VQFQ 2M2LA 2NVQB 1YI2A 1LT5D 4DU9A 1K83H 3CCQA 4BBSB 2IW3A 1Y1VH 2QDLA 1PFNA 2WB1G 3CC2A 2E2HB 3N52A 3UE0A 2HHHL 4ZRZA 3I4MB 1WTVA 3J7AV 4N9PA 2Z0SA 1OXUA 2FXQA 2L5TA 4JOIC 5LMNL 4A3IG 1VQOA 1LTID 4A75A 3I72A 5JEAG 3VR4A 3D4RA 3KDFB 3OMCA 3F2BA 1BNZA 2MP1A 1H9JA 3J7A5 2E2IB 5LL6S 3GV6A 1IKLA 1SLJA 2YTXA 3NENA 4FXGC 1T5XD 2DNCA 3J80E 3H94A 4KHPL 1ET6A 3O13A 5IY0A 4FF3A 3L3OC 1OXXK 3K57A 4IURA 3P1HA 2KCTA 4YCWA 4ZYSA 2WB1E 4LW1A 3CW2C 1PMRA 3M4OH 1F9RA 4B3TL 1D1KA 1IL2A 2M00A 4I7ZC 2RCFA 4HSVA 1X56A 4O0AA 5CV7A 1KLGD 1G6ZA 4BXXG 1R9TB 3AQQA 1K73C 3EVQA 4A3FH 1H9SA 4KHZA 2E76C 2E8GA 1JQYD 1TU2B 3A5ZB 3TZUA 2SNSA 1C4QA 1JCKB 1UNSA 1ILQA 2B2UA 5M9OA 5JVG3 2PPBC 3NEMA 5IWAL 1GVPA 2B2WC 2CH4W 4LNQA 3FKIB 1I6HH 1PFSA 1U4RA 4H02A 4J8QA 5C4JH 1FNUA 4DR2Q 4A3JB 3TP6A 3DM1A 1OXTA 4HJ7A 1TWCH 1IKMA 3HOVB 2R92B 4GKJQ 3GTQH 2Y0SG 1W6JA 1IW7C 3KF6A 1E7ZA 4DV4L 3LNNA 3T1HQ 4RCNA 1X54A 4JPBW 5ELBA 3EFXD 1XNQQ 2XRQD 1VQ9A 3I4NB 2DY8A 1JOQA 4IJHA 4DFAA 2KA7A 1D8LA 1KABA 4AQYL 3L0OA 1SYEA 5CV8A 5I9OA 5HGQA 4G7OC 4B9WA 5C0XG 1GM5A 3K5OA 1CSPA 3RLFA 3DWAA 1GO3E 2ASBA 2K5HA 3LX0A 4MHEA 3K5LA 1B44D 2ZJRA 3NPPA 2GVBA 3ULLA 3LWUA 5DLQE 4YHHQ 3GTLH 2JEBI 2Y0SE 1BDOA 2EDGA 1CA6A 1OXSC 1LTLA 5KRUA 2VL6A 4BY1B 1CKOA 2BH2A 2DUDA 3TSSA 4P73A 4KJOA 1W2BA 4A3BH 1PH2A 4XQJA 2EY5A 4EQPA 1UAPA 4G7ZC 4DV7L 5ELNA 5M5XB 5FLXE 4FO2A 1HA5A 1PDQA 1FGUA 1HZAA 4RGNA 1SFOH 5DNFA 1KAAA 1LACA 1YEZA 1PH1A 2SEBD 3NWTA 3TMEA 4C3JB 1S5CD 2AHOB 2BDOA 1IYUA 4IN3A 1EYDA 4DUYL 4BY7B 4IFDJ 3HOUH 1O7LA 1KNAA 1XPUA 4R1JA 3G71A 4J6HA 2VY3A 2O5IC 4A3DH 5IIFA 4LWCA 3VA5A 1YHQA 3AFPA 4X65Q 4MZ9A 2EYFA 1Y1VG 3J7ZC 5TSSA 3PQIA 4NXMQ 2B8FA 3W2DA 1QUQA 1HR0L 2QEJC 2RDGA 4C56C 1U9RA 1P16A 3KF8B 3T51B 4CKCA 1VQJA 2RDHA 3RZDB 4Y7NB 5IGDA 3H3VC 2B63B 1N34L 4WFN3 3PUXA 1LTSD 1UE7A 2K5WA 3HZXA 4R9WA 4RG1A 5IODA 4DR5L 4IQZA 1YHBA 1VQ4A 3SK5A 1NE3A 3T1YQ 1Y1WH 3W1BA 2B2YA 1WFQA 2ALYB 1ILPA 2Q2TA 3K6OA 1HTLD 4CBVA 3W5OA 2ZM6L 1G8ZD 2QEXA 4DR7Q 1XTCD 4NXNL 3STBD 3CMAA 4DR6L 1EIFA 4X6AH 1Z6HA 3P75A 4FYDA 4A3FG 2ATWA 5G3LD 2F3IA 5IYCH 2UU9L 1LV9A 2KEEA 2MFIA 3G4SA 1IL8A 4YY3L 2R6GA 1SYDA 4UY8C 1SROA 4PV1C 3TS2A 5J3BA 1Y8PB 1WJJA 3I70A 4K5XA 4QL5A 1RTOA 3UI2A 3WOEA 1Q1EA 4GNXA 1VDZA 5LMUL 1S40A 2MO1A 3PIPA 3SK6A 1YVCA 3NTHA 3GTMH 2E74C 1CUKA 4X64Q 2XTIA 5K36H 4RWSC 1YNNC 1KC8C 1BXTA 1RJTA 2R7ZH 1WD1A 1V1QA 1HUNA 4DV1L 2X6LA 3C2PA 2QW7A 2SOBA 1GUSA 4UP7A 5KIXA 1WTXA 1EYGA 4HJ8A 4F87A 3KLWA 3K59A 4RHSA 2BA0A 3CRLC 3C1EA 2N8NA 1EFWA 3ZYYX 4IUVA 1NBWA 4DV2L 1STGA 4JW0A 4QQBX 1KAWA 1GKHA 1BR9A 2RSOA 4A3MH 3MEFA 4JBMA 3CC7A 1I94L 1RF2D 2N88A 1M8AA 2H5XA 2Q2UA 1G51A 3V05A 4NB3A 4XYOA 3M3YH 4NKLA 1G2TA 1YNJD 3TBIB 4BBRB 2N78A 2CCZA 5EKLA 1BVSA 1SYCA 2K01A 3CCVA 2YU9H 3S15H 4A3BG 2EY2A 4K5VA 1I50H 2QGQA 3GTJB 1L0XB 5IT9c 4JV5Q 1OXVA 5GAHC 4O1NA 3OHXC 5D14A 4HJ5A 4ZKCB 3MHBA 1HA6A 1VQ7A 3KYHC 4L8JA 3QJYA 3JAME 4LFAQ 1TS2A 2Q2HA 4JI4L 3J81i 2ES2A 5EPKA 5ISRA 4DNTB 4DXGA 1U0LA 3S16B 4OO1H 4CKEA 3HOUG 1ZYRD 2AQ1B 2IHEA 2KECA 4DK3C 4A3DG 1PZKD 1I4RA 2I46A 1X3FA 3AU7A 4KMUC 1EY5A 5E4XA 2R3ZA 2Z4HA 5IT9L 4M1UB 3S1RH 1SDFA 3FEWX 2VUMB 2HHHQ 1Z47A 1QVGA 2RHQB 2NVQH 3KJPA 1Y69U 5LMNQ 3PIP3 1B3AA 5M5WB 4BBSH 4CDCC 5FK9C 4RKBA 2E2HH 2F1MA 2PMZB 4X3SA 3I4MH 2LY7A 2F4VL 2K5DA 4GKKL 3BDOA 3TP7A 4HCEA 3VR2A 1C48A 5IGCA 1MHWC 4L63B 1Y1WG 2WFWA 2F0OA 1STEA 3OPOA 1SJED 2Z6KA 4JI2Q 2OT2A 1K8OA 3I7FA 2E2IH 3BU2A 5GAEC 5C3EB 1H95A 2EYHA 1U5KA 2E2DC 5IE8A 1AZPA 2EY6A 1NY4A 2ZTEA 1Q12A 4KI0A 1BOSA 4B3TQ 1EWIA 4IOAA 2A6HC 3PUYA 3K0XA 4OEMB 5C4XB 4HR7B 4XDXA 5IYCG 3HKZG 1B50A 2OCEA 1NCVA 5DM73 1SYGA 2HIVA 1SMYD 1E22A 1HCZA 2Z4IA 2G5DA 1TXYA 4H13C 2HD3A 1KDBA 5D3IB 2DY7A 2F0KA 3VYRA 1XJVA 1R9TH 4CJ1B 1JJCB 1VQAA 2C5CA 4DA2A 1PH6A 1KHIA 2ICEC 5IWAQ 2ID0A 1MGSA 4WJ4A 1HNZL 2WKDA 1EIHA 1AE3A 5FO8B 1XYIA 5K36G 2O4XA 3NHHA 2NVYB 3K58A 2F03A 2R7ZG 5JOBA 3FKIH 4ID6A 3A8IE 1STAA 5JJZA 4A3JH 4DV4Q 3HKZE 3L2PA 2F0SA 1NAPA 5ELDA 3HOVH 2R92H 1CKNB 2MUYA 1SSOA 2ZXPA 5JJIA 3SK8A 4HIKA 3GTKB 1JORA 4TSSA 2IHFA 1EU4A 1ZEQX 3KOJA 3HOXB 4A3MG 4AQYQ 4JBKA 2A1AA 3U4ZA 1U4LA 3I4NH 1B8AA 3CRKC 2FINB 1L0WA 2F0UA 1IBML 4DPGA 5JEAH 1Q90A 2PW5A 3HOWB 1NTGA 1HPCA 1V1PA 1FYCA 3MC0B 5T1IA 1PZID 5JVH3 3PO2B 1ICFB 5H1SE 4JYAL 4JCVE 1PTOC 3SK4A 1VF5C 2KBNA 4HN7A 1C7YA 4ZAIA 1JT8A 1MSHA 2AUJD 4DV7Q 1AW7A 1I4XA 4ZUIA 4BY1H 3E9HA 2XNAC 3CD6A 3M7GA 2N3SA 2BE5C 2E75C 2JA8B 2PNRC 2VXWA 1TS4A 3U9SA 3TRZA 1VF7A 4OO1G 1RL2A 2CVRA 4LF8L 5M5XH 4DUYQ 3QG1A 2KCMA 4LFCL 5EKKA 1PLFA 3HOYB 2CFMA 4EQ5A 4C3JH 4GLXA 5GAGC 1U4PA 1HZBA 1CT1D 2OQ0A 2LKVA 2KCCA 1S5BD 1F2MA 3NK9A 4BY7H 4DR4L 3H09A 4B9XA 3DMUA 3SVMA 3NQTA 1EQQA 1J8IA 3U50C 1HR0Q 1B70B 4IPHA 4YWLA 4TKOB 2YTYA 4X62L 4BBSG 4HAEA 2A69D 2JA7B 1BBXC 2RQXA 4DV0L 1Q8KA 2L55A 3H0GB 3I4MG 1PXUA 5C4ZA 5E4WC 4WRDA 1FL0A 1N34Q 3FMCA 4PMCA 4GOPC 3RZDH 4R8IA 2ZXRA 4DNIA 3MTSA 4DR5Q 1YBYA 4Y7NH 3CMEA 2B63H 4H44C 2K05A 4EVOA 3CQZB 3VA7A 2C35B 3FPUB 5KGUA 1G6PA 3CPFA 1HNXL 5KEEA 3RLNA 4CJ2C 1FJGL 1B7YB 2ZM6Q 1SYBA 2J7ZA 4A3CH 4NXNQ 1MBYA 1AN8A 2MHVA 4C2MB 4DAVA 4DV5L 1SMXA 1TY0A 2AMCB 2K5NA 4OX9L 1WTWA 2L12A 2UU9Q 3QOJA 1DGSA 3HKSA 3A74A 2B2VC 1DZ1A 4DR1L 5I2YA 2A68C 5JAVA 1LTGD 4YY3Q 5K5PA 3S2HB 3EA6A 4FDBA 1A15A 5ELEA 1C8CA 3I3CA 5LMUQ 3RR5A 2XIWA 2WAQB 3J80c 3VYUA 3DWPA 1PRTC 4TRDA 4HJAA 4KD3A 1F2LA 5CV6A 3FKIG 1FGBD 1CTMA 1BUVT 4A3JG 2L15A 4DV1Q 3ZJYC 3HOVG 2R92G 4APVA 2Z1CA 4UP8A 1K8MA 3IKJA 4R4OA 1K3RA 4MIUA 4E6IA 3WWVA 5BN4A 2HUGA 5JJLA 3KLSA 1TR5A 2VB3X 4DV2Q 4DKAC 3I4NG 2F0GA 3J80L 3CP0A 1S5DD 1KLUD 1WTPA 5C4HA 3S14B 1I94Q 3ER0A 4HJ9A 4LAAA 1DCZA 1HZ9A 4LUVA 3CU7A 4BWGB 2EIFA 2HCIA 3TEHB 3CCRA 4IO9A 1B9NA 4GLAC 3MXGA 3KLSX 4F8MA 4BBRH 4OWTB 3VYSA 4BY1G 4XQNA 4JI2L 3F2CA 3KFUA 5EBDA 1TKWB 2EYOA 1SBBB 3FDTA 3T16A 3CAMA 5IGBA 3OWFA 1YJ9A 4JI7L 3GTJH 1PTOB 2VNUD 4JI4Q 3OW7A 1CZGA 1G2SA 1KRSA 1DOMA 4LF5L 4C3JG 3NELA 2Z6BA 1B4OA 2CQAA 1K0SA 5M3FB 1BCPF 3U58A 3T53B 1GXDC 4BY7G 4JI6L 3S16H 3I4OA 1V1OA
chains in the Genus database with same CATH topology
1L1OB 3W5OA 2ZM6L 2QEXA 4DR7Q 3BJUA 2BA1A 4HIOA 4POGA 1PA6A 4NXNL 3STBD 3CMAA 1M1KC 3T1HL 1VQ8A 1N32Q 4DR6L 2NVXH 1EIFA 4KHPQ 4X6AH 3PCOB 3VDYA 3DM3A 4A3FG 2BH8A 2ATWA 3S1MH 1XNQL 2MNAA 2F3IA 5IYCH 1KRTA 2UU9L 1JJ2A 2OTJA 2MFIA 2VUMH 3G4SA 2RCNA 3G6EA 2F4VQ 5IYDH 1ASYA 4YY3L 5GQOA 2R6GA 4GKKQ 4UY8C 1SROA 1MJCA 5M5WH 1Q82C 3TS2A 5J3BA 1Q81C 1IBLQ 3OW2A 3DLLA 1WJJA 4QL5A 2HT1A 4JI5Q 1Q1EA 4GNXA 5JEAJ 2B63G 5LMUL 1S40A 3W1GA 1Q86C 2MO1A 3RN5A 2NVTH 2AWOA 3PIPA 2PQAB 1YVCA 4DV3L 3K81C 1EIYB 3OTOQ 3GTMH 1Q1BA 4YHHL 3M85A 4X64Q 1CUKA 1J5EQ 2KENA 2XTIA 3L7ZC 4L5QA 1KC8C 1KD1C 3S17H 2R7ZH 1V1QA 2DGYA 3CPWA 3RLOA 1IXRA 1ASZA 3SGIA 4A3CG 4GOPB 5M3FG 4DV1L 4A3LG 2I5LX 5IP9H 5C3EH 1N33Q 3RZOH 4UP7A 3MXNB 3EN2A 4JI3L 1EYGA 3M7NA 4HJ8A 3H3VH 1D7QA 2LSSA 4AH6A 3KLWA 4DK6C 2UUCL 1E1TA 2BA0A 3A5UA 4DAMA 2IX1A 2N8NA 1EFWA 2D62A 5C4XH 4P75A 5AJ3Q 1TWGH 1NBWA 1VQNA 3CCUA 4C3IH 4DV2L 4UPAA 2JJQA 1YIJA 1HJPA 1KAWA 3M9BA 4QQBX 3AEVA 1GKHA 2PI2E 4A3MH 3GTOH 2PI2A 3D31A 3MEFA 3CC7A 4JBMA 1I94L 3PV0A 1JB7A 4WJ3M 2H5XA 2IX0A 4IPCA 1HNZQ 3UDXA 1G51A 2Q2UA 2K75A 1PVOA 3ULJA 3PO3H 4NB3A 2UXBQ 3M3YH 3ICEA 5HY6A 4PG3A 3J81j 3F1ZA 2N78A 4X65L 2NZHA 3UE1A 2CCZA 3AYHB 2ZTDA 1IBKQ 1HZCA 1L2FA 1VQHA 4LF9Q 1BVSA 1VQBA 1I3QH 4NXML 2YU9H 3IRBA 3CCVA 3S15H 4JBJA 4A3BG 2ZTCA 1I50H 3OYYA 1A62A 4IPGA 1BKBA 3ERSX 4DUZQ 4DV6L 2NVYH 3CCLA 1L1OA 3I55A 2QGQA 4A93H 5IT9c 3TREA 1G291 3HOZG 4JV5Q 1OXVA 5GAHC 3S1QH 4A3IH 4HJ5A 4GN4B 2JA5G 2VS1A 2KHJA 3UDGA 1HNWQ 1YJWA 1VQ7A 3KYHC 2CQOA 3PUVA 3CCSA 4JI1Q 1SE8A 4HIMA 4LFAQ 2K52A 2Q2HA 4JI4L 3J81i 2JA6G 1XTDA 2ES2A 2UXCL 2MO0A 4RMFA 1U0LA 5LMNW 3GTKH 4NPSA 2IHEA 4MNOA 3HOUG 3J81c 4B3SL 3T1YL 2NZOA 1YHAA 1J6QA 2OQKA 4DK3C 4A3DG 2A8VA 4HIDA 1T9HA 1IBMQ 3HOXH 4IPDA 2I5HA 1Y14B 4A3GH 2PQAA 4POFA 1X3FA 4JYAQ 5BR8Q 5C0XJ 4X66L 1PH4A 3S1RH 4PZ8A 1C0AA 1EUJA 1X3EA 1VQFA 3D0FA 3JC66 4DR7L 2HHHQ 2UUBQ 1Z47A 1YZ6A 2RHQB 4BBRG 4A3KG 1QVGA 2NVQH 3HOWH 4KLKA 3S24A 3KJPA 1N32L 4YWKA 5LMNQ 4GOPA 1KIXA 4LF4Q 3PO2H 3HFZB 1XNRQ 4BXXH 4BBSH 4LF7Q 1A0IA 2E2HH 4L5SA 2JK8A 2JQOA 2VZAA 1UE5A 4JG2A 1PH7A 3I4MH 4B3MQ 2ZJPA 2HQLA 2F4VL 4GKKL 1WOCA 2YV5A 4R4QA 1AH9A 2N49A 3BZKA 3E9IA 1IBLL 4LF8Q 2GN5A 3NBHB 4A3EH 4XIGS 1Y1WG 2WFWA 4TQUS 2B3GA 4LFCQ 1X6OA 2Z6KA 4JI2Q 1JMCA 3LGJA 5E7NA 3I7FA 2E2IH 1IZ6A 2JA8H 2R93G 3BU2A 3OTOL 3STBC 2PNHA 5GAEC 1X9NA 4X64L 1J5EL 1H95A 1U5KA 4P72A 2I5MX 5IE8A 2EQSA 3G48A 4DAYB 1NY4A 2ZTEA 5FLXc 1Q12A 4GN5A 4KI0A 3H15A 4DR4Q 3S2DH 4B3TQ 5C44H 1EWIA 3GO5A 3HOYH 4IOAA 4A76A 1VQGA 3PUYA 3K0XA 1MKHA 1IYJB 4A4IA 1N33L 3CXCA 4JC0A 5IYCG 4X62Q 3HKZG 4IFDI 4DV0Q 2OCEA 4IFDG 1EQRA 2VUMG 3PUWA 2HIVA 5IYDG 2JEAI 1QVFA 1E22A 3M4PA 3K7AH 2KHIA 1TXYA 4UP9A 3JAMi 2A19A 5AJ3L 3I56A 3E0EA 5C44G 1XJVA 4OWXB 2YYZA 1R9TH 2NN6I 1PH3A 2NN6G 2QA4A 2JA7H 1JJCB 1VQAA 5FJ8H 1AE2A 1WYDA 1PH6A 1KHIA 3H0GH 5IWAQ 1YNXA 2MQHA 3JAMc 1QZHA 1UWVA 2ID0A 5FLMH 2WP8J 4DR6Q 4WJ4A 4LF6Q 4QY7A 1HNZL 2E5LQ 3PIOA 1QVCA 2Q2IA 1AE3A 4PZ6A 2RHSB 1NMGA 2UXBL 2LXKA 2YTVA 3KJOA 5K36G 5GADC 1SR3A 3FP9A 1HNXQ 2R7ZG 1BBUA 4P74A 1PH5A 3F8TA 1FJGQ 4B3RL 1A63A 1PH9A 1N8RC 3FHWA 1IBKL 3FKIH 2I0QA 4LF9L 4L5RC 4GNXC 1V43A 3A0JA 3EBEA 5IP9G 3B6YA 5C3EG 2GVAA 4A3JH 4DV4Q 3HKZE 1NMFA 3L2PA 4DUZL 3F2DA 3CQZH 4DV5Q 2UUAL 3H3VI 3HOVH 1K0RA 2R92H 3PSIA 2D0PA 1CKNB 4JV5L 1Q7YC 1K9MC 3AFQA 5JJIA 4K0KQ 3GD7A 1VQLA 4OX9Q 4JOIA 5GROA 4HIKA 5C4XG 1W3SA 1E24A 1Z9FA 2IHFA 1HNWL 4DR1Q 1SN8A 4Y52H 1TWHH 1XPOA 4C2MH 4JI1L 2PMZE 1NJIC 4GLVB 5JJKA 4LFAL 3KOJA 3TS0A 4A3MG 4AQYQ 4JBKA 2UXDQ 1X3GA 4O2DA 1RIPA 1TWFH 1VS0A 2A1AA 4DR3Q 3U4ZA 3CC4A 4JI0Q 3I4NH 1XMOQ 1B8AA 3CCJA 2OWOA 2D0OA 3PO3G 1E3PA 3GTGH 1L0WA 2ZJQA 2VQFQ 1LYLA 1IBML 4DPGA 4AYBG 1NTGA 1PHJA 1VQ6A 1YI2A 3S2HH 4GN3B 2CWPA 5H1SE 5IP7H 3KF6B 4JYAL 4JCVE 1K83H 5BR8L 1VQDA 4JI8Q 3CCQA 1Y1VH 4R4CA 2KBNA 2WB1G 3CC2A 1SRUA 1JJGA 3UE0A 2HHHL 2UUBL 1C7YA 4A93G 2Z0SA 1OXUA 2FXQA 2JE6I 4TVAB 1JT8A 4IJLA 5LMNL 4JOIC 4A3IG 1VQOA 4LF4L 3U4VA 4A75A 5JEAG 4DV7Q 1XNRL 4BY1H 4LF7L 1VQMA 1PYSB 3E9HA 3KDFB 3CD6A 4LFBQ 2N3SA 3F2BA 4B3ML 3EIVA 3M4QA 2OTLA 3J7A5 2CKZB 5IYBH 3TRZA 1L1OC 1SLJA 2YTXA 3NENA 1M90C 1P8LA 4J15A 4OO1I 4OO1G 1RL2A 1HR0W 4LF8L 5M5XH 4DUYQ 2KCMA 4KHPL 5IY0A 4LFCL 1BBWA 4AYBE 3HOXG 1OXXK 4LUZA 2CFMA 1X65A 4A3GG 2KCTA 4C3JH 4YCWA 4EQ5A 5GAGC 4GLXA 1S72A 1HZBA 5EAYA 4R4IA 1WCMH 2OQ0A 2WB1E 4LW1A 3CW2C 3S14H 5M3MH 4QGUA 4BY7H 3M4OH 4DR4L 4B3TL 1IL2A 1VQCA 1EQQA 3HOWG 2F52A 1X56A 3U50C 4JI5L 4O0AA 1HR0Q 1B70B 3PO2G 2R7DA 4IPHA 4LUOA 3RNUA 1PYBA 4YWLA 4BXXG 4QIWE 1UE6A 2YTYA 3AQQA 4X62L 4IOCA 4BBSG 1K73C 4DV0L 1Q8KA 2XGTA 4A3FH 3I4MG 4KHZA 2E8GA 4P71A 1CKNA 3A5ZB 2B29A 1C9OA 4ALPA 1VQPA 1N9WA 1FL0A 1KL9A 1N34Q 2V1CC 4YCVA 4JI7Q 1KXLA 4C3HH 4EX5A 4QJFA 4GOPC 3NEMA 4A3EG 3RZDH 5IWAL 4DNIA 1GVPA 3K80C 4DR5Q 4LNQA 1YBYA 1N36Q 2VQEQ 4Y7NH 1UE1A 1PFSA 1Q46A 1YJNA 4H02A 3CMEA 2E5LL 4LF6L 2B63H 2JA8G 4LF5Q 5C4JH 4DR2Q 1XMQQ 1EOVA 3CF5A 1OXTA 4HJ7A 4OXPA 1TWCH 2C35B 2JA9A 1G6PA 3GDEA 3CPFA 1HNXL 4JI6Q 3RLNA 2R7FA 1QUQB 1UEBA 1FJGL 4MTNA 3HOYG 2IY5B 4GKJQ 1B7YB 3GTQH 2Y0SG 1MIUA 2ZM6Q 2Z6KC 1E7ZA 3KF6A 1CKMA 4DV4L 3ULPA 4NXNQ 1K8AC 4A3CH 5M3FH 4DV5L 3T1HQ 3PF4A 4A3LH 1X54A 1SMXA 2HIXA 1O7IA 4PZ7A 4AIMA 2AMCB 2K5NA 1I5FA 2AWNA 3PF5A 1WI5A 3TQYA 1K8GA 1VQ9A 4OX9L 1XNQQ 2UU9Q 4IJHA 1DGSA 3HKSA 3A74A 3UDIA 4DR1L 1D8LA 2JA7G 5FJ8G 4YY3Q 3KDFA 3H0GG 4AQYL 3L0OA 2UXDL 5C0XI 5HGQA 5C0XG 5FLMG 3J80i 4DR3L 4JI0L 3PGZA 4FDBA 1GM5A 1XMOL 1FVIA 1CSPA 3RLFA 1GO3E 2ASBA 1LUZA 5LMUQ 3RR5A 2K5HA 3CCEA 3J80c 2EXDA 2VQFL 2ZJRA 4DV3Q 4L5TA 2GVBA 2K50A 3ULLA 4HJAA 5DLQE 4YHHQ 3GTLH 2JEBI 2Y0SE 3FKIG 1OXSC 1LTLA 2AKWB 2VL6A 4PMWA 4JI8L 1HH2P 4A3JG 1MJEA 1CKOA 1KQSA 2BH2A 2L15A 2DUDA 3PUZA 4XTCS 4DV1Q 4P73A 1I6HH 3ZJYC 3HOVG 1W2BA 2R92G 4APVA 4A3BH 1PH2A 4JI3Q 3GTPH 4UP8A 4DV7L 1PV4A 1OTCA 1TWAH 5ELNA 3HOZH 2UUCQ 4R4TA 3BZCA 1K3RA 4R4OA 3WWVA 1FGUA 1HZAA 2LXJA 4JBWA 4LFBL 5JJLA 2JA5H 1SFOH 1YEZA 4DV2Q 4B3RQ 1PH1A 4DKAC 1VQKA 1X55A 4GNXB 3I4NG 1JE5A 2AHOB 3CP0A 4DUYL 2JA6H 1I94Q 4IFDJ 2E2JH 3ER0A 4HJ9A 2UUAQ 3RN2A 3HOUH 1YITA 2IT1A 4BA1I 1A8VA 4R1JA 1XPUA 3G71A 2VY3A 4OONA 4A3DH 1HZ9A 1CSQA 4K0KL 5IP7G 4LWCA 4LUVA 1YHQA 3AFPA 4X65Q 2WAQG 4MZ9A 1VQIA 1LM0A 1Y1VG 4ME3A 3J7ZC 2EIFA 3TEHB 1VQEA 3CCRA 4IO9A 4GLAC 4NXMQ 1QUQA 1HR0L 4DV6Q 1P16A 1E1OA 3KF8B 3Q8DA 4BBRH 4YWMA 4OWTB 4A3KH 4OWWB 4BY1G 4JI2L 1VQJA 3F2CA 3KFUA 1PH8A 1S3OA 5ELOA 3CCMA 1V9PA 3CAMA 5IYBG 1YJ9A 1N34L 4JI7L 3GTJH 2RF4A 2K14A 3PUXA 2VNUD 1UE7A 3I2ZA 4JI4Q 3S1NH 4RG1A 1QZGA 1GD7A 2UXCQ 4DR5L 1YHBA 2VW9A 1VQ4A 1NE3A 4GS3A 1XPRA 2VQEL 1N36L 1VQ5A 1KRSA 4B3SQ 4BA2I 5M5YH 3T1YQ 1VCIA 1Y1WH 4LF5L 3K8AA 4DR2L 1XMQL 2WAQE 2K5VA 3NELA 1WCMG 3UDFA 3W1BA 2CWAA 3U58A 2R93H 5M3MG 4BY7G 1WFQA 4JI6L 2ALYB 3S16H 2K4KA 3I4OA 3K7UC 2Q2TA 4YCUA 4GKJL 4X66Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1O B;  3W5O A;  2ZM6 L;  2QEX A;  4DR7 Q;  3BJU A;  2BA1 A;  4HIO A;  4POG A;  1PA6 A;  4NXN L;  3STB D;  3CMA A;  1M1K C;  3T1H L;  1VQ8 A;  1N32 Q;  4DR6 L;  2NVX H;  1EIF A;  4KHP Q;  4X6A H;  3PCO B;  3VDY A;  3DM3 A;  4A3F G;  2BH8 A;  2ATW A;  3S1M H;  1XNQ L;  2MNA A;  2F3I A;  5IYC H;  1KRT A;  2UU9 L;  1JJ2 A;  2OTJ A;  2MFI A;  2VUM H;  3G4S A;  2RCN A;  3G6E A;  2F4V Q;  5IYD H;  1ASY A;  4YY3 L;  5GQO A;  2R6G A;  4GKK Q;  4UY8 C;  1SRO A;  1MJC A;  5M5W H;  1Q82 C;  3TS2 A;  5J3B A;  1Q81 C;  1IBL Q;  3OW2 A;  3DLL A;  1WJJ A;  4QL5 A;  2HT1 A;  4JI5 Q;  1Q1E A;  4GNX A;  5JEA J;  2B63 G;  5LMU L;  1S40 A;  3W1G A;  1Q86 C;  2MO1 A;  3RN5 A;  2NVT H;  2AWO A;  3PIP A;  2PQA B;  1YVC A;  4DV3 L;  3K81 C;  1EIY B;  3OTO Q;  3GTM H;  1Q1B A;  4YHH L;  3M85 A;  4X64 Q;  1CUK A;  1J5E Q;  2KEN A;  2XTI A;  3L7Z C;  4L5Q A;  1KC8 C;  1KD1 C;  3S17 H;  2R7Z H;  1V1Q A;  2DGY A;  3CPW A;  3RLO A;  1IXR A;  1ASZ A;  3SGI A;  4A3C G;  4GOP B;  5M3F G;  4DV1 L;  4A3L G;  2I5L X;  5IP9 H;  5C3E H;  1N33 Q;  3RZO H;  4UP7 A;  3MXN B;  3EN2 A;  4JI3 L;  1EYG A;  3M7N A;  4HJ8 A;  3H3V H;  1D7Q A;  2LSS A;  4AH6 A;  3KLW A;  4DK6 C;  2UUC L;  1E1T A;  2BA0 A;  3A5U A;  4DAM A;  2IX1 A;  2N8N A;  1EFW A;  2D62 A;  5C4X H;  4P75 A;  5AJ3 Q;  1TWG H;  1NBW A;  1VQN A;  3CCU A;  4C3I H;  4DV2 L;  4UPA A;  2JJQ A;  1YIJ A;  1HJP A;  1KAW A;  3M9B A;  4QQB X;  3AEV A;  1GKH A;  2PI2 E;  4A3M H;  3GTO H;  2PI2 A;  3D31 A;  3MEF A;  3CC7 A;  4JBM A;  1I94 L;  3PV0 A;  1JB7 A;  4WJ3 M;  2H5X A;  2IX0 A;  4IPC A;  1HNZ Q;  3UDX A;  1G51 A;  2Q2U A;  2K75 A;  1PVO A;  3ULJ A;  3PO3 H;  4NB3 A;  2UXB Q;  3M3Y H;  3ICE A;  5HY6 A;  4PG3 A;  3J81 j;  3F1Z A;  2N78 A;  4X65 L;  2NZH A;  3UE1 A;  2CCZ A;  3AYH B;  2ZTD A;  1IBK Q;  1HZC A;  1L2F A;  1VQH A;  4LF9 Q;  1BVS A;  1VQB A;  1I3Q H;  4NXM L;  2YU9 H;  3IRB A;  3CCV A;  3S15 H;  4JBJ A;  4A3B G;  2ZTC A;  1I50 H;  3OYY A;  1A62 A;  4IPG A;  1BKB A;  3ERS X;  4DUZ Q;  4DV6 L;  2NVY H;  3CCL A;  1L1O A;  3I55 A;  2QGQ A;  4A93 H;  5IT9 c;  3TRE A;  1G29 1;  3HOZ G;  4JV5 Q;  1OXV A;  5GAH C;  3S1Q H;  4A3I H;  4HJ5 A;  4GN4 B;  2JA5 G;  2VS1 A;  2KHJ A;  3UDG A;  1HNW Q;  1YJW A;  1VQ7 A;  3KYH C;  2CQO A;  3PUV A;  3CCS A;  4JI1 Q;  1SE8 A;  4HIM A;  4LFA Q;  2K52 A;  2Q2H A;  4JI4 L;  3J81 i;  2JA6 G;  1XTD A;  2ES2 A;  2UXC L;  2MO0 A;  4RMF A;  1U0L A;  5LMN W;  3GTK H;  4NPS A;  2IHE A;  4MNO A;  3HOU G;  3J81 c;  4B3S L;  3T1Y L;  2NZO A;  1YHA A;  1J6Q A;  2OQK A;  4DK3 C;  4A3D G;  2A8V A;  4HID A;  1T9H A;  1IBM Q;  3HOX H;  4IPD A;  2I5H A;  1Y14 B;  4A3G H;  2PQA A;  4POF A;  1X3F A;  4JYA Q;  5BR8 Q;  5C0X J;  4X66 L;  1PH4 A;  3S1R H;  4PZ8 A;  1C0A A;  1EUJ A;  1X3E A;  1VQF A;  3D0F A;  3JC6 6;  4DR7 L;  2HHH Q;  2UUB Q;  1Z47 A;  1YZ6 A;  2RHQ B;  4BBR G;  4A3K G;  1QVG A;  2NVQ H;  3HOW H;  4KLK A;  3S24 A;  3KJP A;  1N32 L;  4YWK A;  5LMN Q;  4GOP A;  1KIX A;  4LF4 Q;  3PO2 H;  3HFZ B;  1XNR Q;  4BXX H;  4BBS H;  4LF7 Q;  1A0I A;  2E2H H;  4L5S A;  2JK8 A;  2JQO A;  2VZA A;  1UE5 A;  4JG2 A;  1PH7 A;  3I4M H;  4B3M Q;  2ZJP A;  2HQL A;  2F4V L;  4GKK L;  1WOC A;  2YV5 A;  4R4Q A;  1AH9 A;  2N49 A;  3BZK A;  3E9I A;  1IBL L;  4LF8 Q;  2GN5 A;  3NBH B;  4A3E H;  4XIG S;  1Y1W G;  2WFW A;  4TQU S;  2B3G A;  4LFC Q;  1X6O A;  2Z6K A;  4JI2 Q;  1JMC A;  3LGJ A;  5E7N A;  3I7F A;  2E2I H;  1IZ6 A;  2JA8 H;  2R93 G;  3BU2 A;  3OTO L;  3STB C;  2PNH A;  5GAE C;  1X9N A;  4X64 L;  1J5E L;  1H95 A;  1U5K A;  4P72 A;  2I5M X;  5IE8 A;  2EQS A;  3G48 A;  4DAY B;  1NY4 A;  2ZTE A;  5FLX c;  1Q12 A;  4GN5 A;  4KI0 A;  3H15 A;  4DR4 Q;  3S2D H;  4B3T Q;  5C44 H;  1EWI A;  3GO5 A;  3HOY H;  4IOA A;  4A76 A;  1VQG A;  3PUY A;  3K0X A;  1MKH A;  1IYJ B;  4A4I A;  1N33 L;  3CXC A;  4JC0 A;  5IYC G;  4X62 Q;  3HKZ G;  4IFD I;  4DV0 Q;  2OCE A;  4IFD G;  1EQR A;  2VUM G;  3PUW A;  2HIV A;  5IYD G;  2JEA I;  1QVF A;  1E22 A;  3M4P A;  3K7A H;  2KHI A;  1TXY A;  4UP9 A;  3JAM i;  2A19 A;  5AJ3 L;  3I56 A;  3E0E A;  5C44 G;  1XJV A;  4OWX B;  2YYZ A;  1R9T H;  2NN6 I;  1PH3 A;  2NN6 G;  2QA4 A;  2JA7 H;  1JJC B;  1VQA A;  5FJ8 H;  1AE2 A;  1WYD A;  1PH6 A;  1KHI A;  3H0G H;  5IWA Q;  1YNX A;  2MQH A;  3JAM c;  1QZH A;  1UWV A;  2ID0 A;  5FLM H;  2WP8 J;  4DR6 Q;  4WJ4 A;  4LF6 Q;  4QY7 A;  1HNZ L;  2E5L Q;  3PIO A;  1QVC A;  2Q2I A;  1AE3 A;  4PZ6 A;  2RHS B;  1NMG A;  2UXB L;  2LXK A;  2YTV A;  3KJO A;  5K36 G;  5GAD C;  1SR3 A;  3FP9 A;  1HNX Q;  2R7Z G;  1BBU A;  4P74 A;  1PH5 A;  3F8T A;  1FJG Q;  4B3R L;  1A63 A;  1PH9 A;  1N8R C;  3FHW A;  1IBK L;  3FKI H;  2I0Q A;  4LF9 L;  4L5R C;  4GNX C;  1V43 A;  3A0J A;  3EBE A;  5IP9 G;  3B6Y A;  5C3E G;  2GVA A;  4A3J H;  4DV4 Q;  3HKZ E;  1NMF A;  3L2P A;  4DUZ L;  3F2D A;  3CQZ H;  4DV5 Q;  2UUA L;  3H3V I;  3HOV H;  1K0R A;  2R92 H;  3PSI A;  2D0P A;  1CKN B;  4JV5 L;  1Q7Y C;  1K9M C;  3AFQ A;  5JJI A;  4K0K Q;  3GD7 A;  1VQL A;  4OX9 Q;  4JOI A;  5GRO A;  4HIK A;  5C4X G;  1W3S A;  1E24 A;  1Z9F A;  2IHF A;  1HNW L;  4DR1 Q;  1SN8 A;  4Y52 H;  1TWH H;  1XPO A;  4C2M H;  4JI1 L;  2PMZ E;  1NJI C;  4GLV B;  5JJK A;  4LFA L;  3KOJ A;  3TS0 A;  4A3M G;  4AQY Q;  4JBK A;  2UXD Q;  1X3G A;  4O2D A;  1RIP A;  1TWF H;  1VS0 A;  2A1A A;  4DR3 Q;  3U4Z A;  3CC4 A;  4JI0 Q;  3I4N H;  1XMO Q;  1B8A A;  3CCJ A;  2OWO A;  2D0O A;  3PO3 G;  1E3P A;  3GTG H;  1L0W A;  2ZJQ A;  2VQF Q;  1LYL A;  1IBM L;  4DPG A;  4AYB G;  1NTG A;  1PHJ A;  1VQ6 A;  1YI2 A;  3S2H H;  4GN3 B;  2CWP A;  5H1S E;  5IP7 H;  3KF6 B;  4JYA L;  4JCV E;  1K83 H;  5BR8 L;  1VQD A;  4JI8 Q;  3CCQ A;  1Y1V H;  4R4C A;  2KBN A;  2WB1 G;  3CC2 A;  1SRU A;  1JJG A;  3UE0 A;  2HHH L;  2UUB L;  1C7Y A;  4A93 G;  2Z0S A;  1OXU A;  2FXQ A;  2JE6 I;  4TVA B;  1JT8 A;  4IJL A;  5LMN L;  4JOI C;  4A3I G;  1VQO A;  4LF4 L;  3U4V A;  4A75 A;  5JEA G;  4DV7 Q;  1XNR L;  4BY1 H;  4LF7 L;  1VQM A;  1PYS B;  3E9H A;  3KDF B;  3CD6 A;  4LFB Q;  2N3S A;  3F2B A;  4B3M L;  3EIV A;  3M4Q A;  2OTL A;  3J7A 5;  2CKZ B;  5IYB H;  3TRZ A;  1L1O C;  1SLJ A;  2YTX A;  3NEN A;  1M90 C;  1P8L A;  4J15 A;  4OO1 I;  4OO1 G;  1RL2 A;  1HR0 W;  4LF8 L;  5M5X H;  4DUY Q;  2KCM A;  4KHP L;  5IY0 A;  4LFC L;  1BBW A;  4AYB E;  3HOX G;  1OXX K;  4LUZ A;  2CFM A;  1X65 A;  4A3G G;  2KCT A;  4C3J H;  4YCW A;  4EQ5 A;  5GAG C;  4GLX A;  1S72 A;  1HZB A;  5EAY A;  4R4I A;  1WCM H;  2OQ0 A;  2WB1 E;  4LW1 A;  3CW2 C;  3S14 H;  5M3M H;  4QGU A;  4BY7 H;  3M4O H;  4DR4 L;  4B3T L;  1IL2 A;  1VQC A;  1EQQ A;  3HOW G;  2F52 A;  1X56 A;  3U50 C;  4JI5 L;  4O0A A;  1HR0 Q;  1B70 B;  3PO2 G;  2R7D A;  4IPH A;  4LUO A;  3RNU A;  1PYB A;  4YWL A;  4BXX G;  4QIW E;  1UE6 A;  2YTY A;  3AQQ A;  4X62 L;  4IOC A;  4BBS G;  1K73 C;  4DV0 L;  1Q8K A;  2XGT A;  4A3F H;  3I4M G;  4KHZ A;  2E8G A;  4P71 A;  1CKN A;  3A5Z B;  2B29 A;  1C9O A;  4ALP A;  1VQP A;  1N9W A;  1FL0 A;  1KL9 A;  1N34 Q;  2V1C C;  4YCV A;  4JI7 Q;  1KXL A;  4C3H H;  4EX5 A;  4QJF A;  4GOP C;  3NEM A;  4A3E G;  3RZD H;  5IWA L;  4DNI A;  1GVP A;  3K80 C;  4DR5 Q;  4LNQ A;  1YBY A;  1N36 Q;  2VQE Q;  4Y7N H;  1UE1 A;  1PFS A;  1Q46 A;  1YJN A;  4H02 A;  3CME A;  2E5L L;  4LF6 L;  2B63 H;  2JA8 G;  4LF5 Q;  5C4J H;  4DR2 Q;  1XMQ Q;  1EOV A;  3CF5 A;  1OXT A;  4HJ7 A;  4OXP A;  1TWC H;  2C35 B;  2JA9 A;  1G6P A;  3GDE A;  3CPF A;  1HNX L;  4JI6 Q;  3RLN A;  2R7F A;  1QUQ B;  1UEB A;  1FJG L;  4MTN A;  3HOY G;  2IY5 B;  4GKJ Q;  1B7Y B;  3GTQ H;  2Y0S G;  1MIU A;  2ZM6 Q;  2Z6K C;  1E7Z A;  3KF6 A;  1CKM A;  4DV4 L;  3ULP A;  4NXN Q;  1K8A C;  4A3C H;  5M3F H;  4DV5 L;  3T1H Q;  3PF4 A;  4A3L H;  1X54 A;  1SMX A;  2HIX A;  1O7I A;  4PZ7 A;  4AIM A;  2AMC B;  2K5N A;  1I5F A;  2AWN A;  3PF5 A;  1WI5 A;  3TQY A;  1K8G A;  1VQ9 A;  4OX9 L;  1XNQ Q;  2UU9 Q;  4IJH A;  1DGS A;  3HKS A;  3A74 A;  3UDI A;  4DR1 L;  1D8L A;  2JA7 G;  5FJ8 G;  4YY3 Q;  3KDF A;  3H0G G;  4AQY L;  3L0O A;  2UXD L;  5C0X I;  5HGQ A;  5C0X G;  5FLM G;  3J80 i;  4DR3 L;  4JI0 L;  3PGZ A;  4FDB A;  1GM5 A;  1XMO L;  1FVI A;  1CSP A;  3RLF A;  1GO3 E;  2ASB A;  1LUZ A;  5LMU Q;  3RR5 A;  2K5H A;  3CCE A;  3J80 c;  2EXD A;  2VQF L;  2ZJR A;  4DV3 Q;  4L5T A;  2GVB A;  2K50 A;  3ULL A;  4HJA A;  5DLQ E;  4YHH Q;  3GTL H;  2JEB I;  2Y0S E;  3FKI G;  1OXS C;  1LTL A;  2AKW B;  2VL6 A;  4PMW A;  4JI8 L;  1HH2 P;  4A3J G;  1MJE A;  1CKO A;  1KQS A;  2BH2 A;  2L15 A;  2DUD A;  3PUZ A;  4XTC S;  4DV1 Q;  4P73 A;  1I6H H;  3ZJY C;  3HOV G;  1W2B A;  2R92 G;  4APV A;  4A3B H;  1PH2 A;  4JI3 Q;  3GTP H;  4UP8 A;  4DV7 L;  1PV4 A;  1OTC A;  1TWA H;  5ELN A;  3HOZ H;  2UUC Q;  4R4T A;  3BZC A;  1K3R A;  4R4O A;  3WWV A;  1FGU A;  1HZA A;  2LXJ A;  4JBW A;  4LFB L;  5JJL A;  2JA5 H;  1SFO H;  1YEZ A;  4DV2 Q;  4B3R Q;  1PH1 A;  4DKA C;  1VQK A;  1X55 A;  4GNX B;  3I4N G;  1JE5 A;  2AHO B;  3CP0 A;  4DUY L;  2JA6 H;  1I94 Q;  4IFD J;  2E2J H;  3ER0 A;  4HJ9 A;  2UUA Q;  3RN2 A;  3HOU H;  1YIT A;  2IT1 A;  4BA1 I;  1A8V A;  4R1J A;  1XPU A;  3G71 A;  2VY3 A;  4OON A;  4A3D H;  1HZ9 A;  1CSQ A;  4K0K L;  5IP7 G;  4LWC A;  4LUV A;  1YHQ A;  3AFP A;  4X65 Q;  2WAQ G;  4MZ9 A;  1VQI A;  1LM0 A;  1Y1V G;  4ME3 A;  3J7Z C;  2EIF A;  3TEH B;  1VQE A;  3CCR A;  4IO9 A;  4GLA C;  4NXM Q;  1QUQ A;  1HR0 L;  4DV6 Q;  1P16 A;  1E1O A;  3KF8 B;  3Q8D A;  4BBR H;  4YWM A;  4OWT B;  4A3K H;  4OWW B;  4BY1 G;  4JI2 L;  1VQJ A;  3F2C A;  3KFU A;  1PH8 A;  1S3O A;  5ELO A;  3CCM A;  1V9P A;  3CAM A;  5IYB G;  1YJ9 A;  1N34 L;  4JI7 L;  3GTJ H;  2RF4 A;  2K14 A;  3PUX A;  2VNU D;  1UE7 A;  3I2Z A;  4JI4 Q;  3S1N H;  4RG1 A;  1QZG A;  1GD7 A;  2UXC Q;  4DR5 L;  1YHB A;  2VW9 A;  1VQ4 A;  1NE3 A;  4GS3 A;  1XPR A;  2VQE L;  1N36 L;  1VQ5 A;  1KRS A;  4B3S Q;  4BA2 I;  5M5Y H;  3T1Y Q;  1VCI A;  1Y1W H;  4LF5 L;  3K8A A;  4DR2 L;  1XMQ L;  2WAQ E;  2K5V A;  3NEL A;  1WCM G;  3UDF A;  3W1B A;  2CWA A;  3U58 A;  2R93 H;  5M3M G;  4BY7 G;  1WFQ A;  4JI6 L;  2ALY B;  3S16 H;  2K4K A;  3I4O A;  3K7U C;  2Q2T A;  4YCU A;  4GKJ L;  4X66 Q; 
#chains in the Genus database with same CATH topology
 3RUZ A;  3BJU A;  4OEL B;  1BF4 A;  3TN2 A;  4FF2 A;  3PCO B;  2DN8 A;  2MNA A;  4IFD H;  3BG3 A;  2VUM H;  2F4V Q;  2DJG C;  5GQO A;  4GKK Q;  3ND8 A;  4K14 A;  3J81 E;  1MJC A;  5M5W H;  1Q82 C;  2NN6 H;  5C5L A;  2B63 G;  2A74 C;  3W1G A;  1Q86 C;  2EYP A;  4F88 A;  1EL0 A;  1Q1B A;  2B2U C;  3T13 A;  2KEN A;  4IAL A;  3GTP B;  1QOH A;  1HQR D;  1KD1 C;  1TWA B;  3HOZ B;  2DGY A;  1II3 A;  3OOC A;  3RLO A;  1KTK A;  3X3N A;  1HQM C;  4A3C G;  4GOP B;  1FNV A;  4N9T A;  2I5L X;  4WOR A;  5C3E H;  2JA5 B;  2CHB D;  4HMJ A;  2EYL A;  3H3V H;  1D7Q A;  2LSS A;  4AH6 A;  1EU3 A;  4J1M A;  3A5U A;  2JA6 B;  3NBI A;  5C4X H;  3NSW A;  1YIJ A;  2JJQ A;  3M9B A;  2PI2 E;  5LHY 1;  1RKN A;  3F2U A;  3PMF A;  4KN4 C;  2B2T A;  1SXT A;  4IPC A;  4WJ3 M;  1HNZ Q;  1PVO A;  2K75 A;  3NTK A;  3ICE A;  3HG9 A;  4RH6 A;  3F1Z A;  5C5M A;  4N8X 1;  4A3K B;  2NZH A;  1HZC A;  1VQH A;  4HMI A;  1VQB A;  2A73 B;  3D4D A;  1F2Y A;  2ZTC A;  3H6M A;  1A62 A;  1BKB A;  3ERS X;  2NVY H;  2IX3 A;  1L1O A;  4IUN A;  2EJF C;  1IYV A;  2LS0 1;  4GN4 B;  1PRT B;  3DXJ C;  2Q8I B;  1QJO A;  5M5Y B;  1SE8 A;  1TVX A;  2R93 B;  1J9O A;  5T1G A;  2MO0 A;  5EJW A;  2PQE A;  4RMF A;  5JPN C;  3LWE A;  4K2K A;  5LMN W;  3GTK H;  4K8I A;  4NPS A;  2EZV A;  4B3S L;  1YHA A;  3A7L A;  1IBM Q;  3HOX H;  2IJ0 A;  4NMZ A;  5D3D A;  1Y14 B;  2PQA A;  1PFB A;  4ILW A;  3OIQ A;  3C46 A;  4JYA Q;  2BCO A;  1C0A A;  1X3E A;  3JC6 6;  3D0F A;  5I6Y A;  1YZ6 A;  4BBR G;  3HOW H;  4KLK A;  1N32 L;  4QB4 A;  4MTK A;  4K6L A;  2RVL A;  3PO2 H;  2WAC A;  3HEJ A;  5JPM C;  3MXN A;  4L5S A;  2JK8 A;  2JQO A;  2VZA A;  2ZJP A;  2HQL A;  1SE4 A;  2WKC A;  4KK7 A;  1WOC A;  2YV5 A;  1AH9 A;  1CHP D;  2N49 A;  4LF8 Q;  2DJF C;  1JOK A;  3NBH B;  3E3X A;  2GA4 B;  1W6K A;  2NZ1 D;  4TQU S;  4LFC Q;  4OGQ C;  2F0W A;  3QO2 A;  2JA8 H;  2KOL A;  2PNH A;  4ODG A;  1STY A;  4L6T B;  3DEP A;  3STB C;  4P72 A;  2EQS A;  4GN5 A;  3QIA A;  4DR4 Q;  3GO5 A;  2F0F A;  3HOY H;  4A76 A;  1VQG A;  1HFG A;  4RGM A;  1EOT A;  1IYJ B;  4A4I A;  1N33 L;  1TWG B;  2R61 A;  1TQO A;  2B2Y C;  4K5W A;  4X62 Q;  4OIJ A;  4DV0 Q;  4IFD G;  2VUM G;  3GTO B;  3BVM A;  1SNC A;  4QCL A;  3G7L A;  3M4P A;  3D8G A;  3PO3 B;  2QF7 A;  2YYZ A;  4OWX B;  3GQB A;  2NN6 G;  2JA7 H;  2F0L A;  1AE2 A;  1WYD A;  3H0G H;  4RGO S;  3JAM c;  1S5F D;  1STN A;  2MQH A;  1UWV A;  2PO4 A;  3R93 A;  4AYB B;  1QZH A;  5FLM H;  3ITP A;  2F3V A;  2TSS A;  5E1F A;  3PIO A;  1B9M A;  3I73 A;  1I3Q B;  1QVC A;  2UXB L;  2QDB A;  2LXK A;  3KJO A;  2KUM A;  3MZ5 A;  4A93 B;  2F0I A;  1HNX Q;  3URY A;  1BBU A;  1PH5 A;  3F8T A;  1FJG Q;  1DJR D;  4DK1 A;  1IBK L;  3FHW A;  2I0Q A;  4LF9 L;  5ELF A;  4GNX C;  3A0J A;  3EBE A;  5C3E G;  3B6Y A;  1NMF A;  4QIW B;  1GUW A;  3CQZ H;  4DV5 Q;  1H9S B;  1K0R A;  2PW7 A;  3GD7 A;  4ZLT F;  4OX9 Q;  5C4X G;  1E24 A;  4DR1 Q;  3JAM L;  1XPO A;  4C2M H;  4JI1 L;  2PMZ E;  2EY1 A;  1YNJ C;  1RIP A;  1VS0 A;  2A6E D;  4A3G B;  4CDD C;  3CCJ A;  3J7Y W;  1E3P A;  2ZJQ A;  1LYL A;  4EGV A;  4XXE A;  4IZ8 A;  1VQ6 A;  3S2H H;  4GN3 B;  4H7B A;  1JE4 A;  3FRP B;  3KF6 B;  5BR8 L;  1VQD A;  1AP0 A;  3I8Z A;  4R4C A;  4DAY A;  4NDX A;  1SRU A;  2UUB L;  2JE6 I;  2X69 A;  4TVA B;  4LF4 L;  3FVQ A;  3KLR A;  1XNR L;  3SXH A;  4LF7 L;  1VQM A;  1OO9 B;  2FHT A;  5CV4 A;  5F2D A;  4A3E B;  5L37 A;  3MVV A;  1ZYR C;  1SNO A;  1EWC A;  1T5E A;  4B3M L;  4KKT A;  1EYC A;  3M4Q A;  2OTL A;  2K04 A;  2CKZ B;  5IYB H;  2N55 A;  1HR0 W;  2F0D A;  2EJG C;  3S2D B;  3E0J A;  3HOX G;  4LUZ A;  1NUC A;  1X65 A;  4R4I A;  5EKI A;  4RA8 A;  3S14 H;  4YIJ A;  3D6C A;  3HOW G;  4IUU A;  4Q0F A;  2F52 A;  3NXW A;  3K7A B;  3PO2 G;  2R7D A;  3R8B A;  3PIO 3;  3RNU A;  1PYB A;  1UE6 A;  1BCP D;  3SEB A;  1VQP A;  1N9W A;  1LTA D;  3IL8 A;  2V1C C;  3QR8 A;  4K8J A;  4JI7 Q;  4CJ0 B;  1B1Z A;  1KXL A;  1EY0 A;  3I91 A;  4KY5 A;  2K6A A;  4V0B A;  3AMU A;  1ROD A;  2B8G A;  4MN3 A;  1UE1 A;  1YJN A;  1BO0 A;  4LF6 L;  2JA8 G;  4DXF A;  4LF5 Q;  1PTO H;  5J39 A;  4OXP A;  2F0E A;  4JI6 Q;  1QUQ B;  1UEB A;  3HOY G;  2IY5 B;  1JC7 A;  4QUF A;  1SMY C;  1K3B C;  2Z6K C;  3ULP A;  1TWH B;  5M3F H;  3PF4 A;  2HIX A;  2EVB A;  2CH4 A;  1QCB D;  4K0K L;  3PF5 A;  1I5F A;  1WI5 A;  2JP1 A;  3TQY A;  3UDI A;  4FF1 A;  2Q8R E;  1A2U A;  3KK7 A;  3GTG B;  2JA7 G;  1JB3 A;  3KDF A;  3H0G G;  4Z9C B;  5C0X I;  5FLM G;  4JI0 L;  3E6Z X;  1FVI A;  3CCE A;  4DN4 M;  2EXD A;  1CM9 A;  2LFN A;  4FP5 D;  4L5T A;  3GV3 A;  3MEH A;  5C6A A;  1GHJ A;  1ENF A;  1H9M A;  2AKW B;  1KDC A;  3T56 B;  2PZU A;  4JI8 L;  2PZW A;  1HH2 P;  1I6V C;  1DOK A;  4NW2 A;  1E2Z A;  2F0V A;  4XYQ A;  3GTP H;  3NWS A;  1PV4 A;  1TWA H;  3HOZ H;  1H9K A;  4R4T A;  3BZC A;  2Q8T A;  4LFB L;  4PMB A;  2JA5 H;  3K5M A;  3VR5 A;  1X55 A;  4GNX B;  4G57 A;  4O42 A;  3OSO A;  1WCM B;  2JA6 H;  1Q8I A;  5M3M B;  1NR4 A;  2WII B;  1KDA A;  4DGZ A;  1YIT A;  1RCV D;  4RFB A;  2CW0 D;  3HGB A;  1A8V A;  4QF4 A;  3SDZ A;  1CSQ A;  1O78 A;  2JXM B;  2WAQ G;  1VQI A;  4ME3 A;  1D1I A;  4X3K A;  4HCS A;  4IUP A;  3D3R A;  2H4O A;  1X32 A;  1SND A;  2F0J A;  1E1O A;  1GUG A;  4JK1 C;  2K32 A;  4A3K H;  4OWW B;  4C3H B;  2X6G A;  2MPM A;  2LMC B;  2XWB B;  3MAQ A;  2K7V A;  3OMG A;  2WV6 D;  1V9P A;  4UAI A;  3CCM A;  5IYB G;  3Q23 A;  4GZY C;  2RF4 A;  2K14 A;  1S5E D;  3KBX A;  5C3W A;  1QZG A;  5KYL A;  4GS3 A;  1XPR A;  1QWY A;  2VQE L;  1N36 L;  1VQ5 A;  4ZUJ A;  4B3S Q;  5M5Y H;  3IAY A;  4BA2 I;  1F9S A;  1DON A;  3K8A A;  1XMQ L;  2WAQ E;  1G91 A;  1EY4 A;  2SNM A;  2FMC A;  4P2C B;  1QIL A;  2R93 H;  4C1N I;  2K4K A;  4YCU A;  4JVZ A;  3CKI B;  2DNE A;  1CFM A;  1VQ8 A;  1N32 Q;  3IFT A;  5CMD A;  4KTA A;  1ICW A;  2M9V A;  2IPK D;  1JJ2 A;  2EYJ A;  4C1N K;  4M8A A;  2RCN A;  5IYD H;  1JWM D;  4CDE C;  1MSG A;  1ASY A;  1SJH D;  4ZQ3 A;  1Z7T A;  3Q0A A;  4NP5 A;  4I7A A;  3DLL A;  4JI5 Q;  1F2Z A;  5JEA J;  1VMC A;  1E2V A;  2O2L D;  5I9P A;  2F3W A;  2AWO A;  2MGS A;  3NE5 B;  3RN5 A;  4DV3 L;  4ABN A;  1EIY B;  2J4X A;  4DNR B;  4FNF A;  1UEA B;  1IXR A;  5M3F G;  2EXZ A;  2EE1 A;  5IP9 H;  1N33 Q;  4JI3 L;  3EN2 A;  1XWE A;  5EPL A;  1LAB A;  2ENB A;  4DK6 C;  5IGG A;  2UUC L;  3KF8 A;  3TDQ A;  1WTR A;  4KKU A;  1EEF D;  1SE2 A;  2E2J B;  2NWG A;  4P75 A;  1TWG H;  1VQN A;  3CCU A;  4UPA A;  2NTT A;  4LK1 C;  1EY8 A;  3AEV A;  3GTO H;  2PI2 A;  3D31 A;  3PV0 A;  1AFP A;  1QNK A;  1D5M C;  3AB9 A;  4RKL A;  3PO3 H;  2UXB Q;  4I65 A;  3VR6 A;  5HY6 A;  3J81 j;  4H0L C;  3UE1 A;  5COR A;  1H9R A;  4HTH A;  1IBK Q;  1GUO A;  4LF9 Q;  2QCP X;  1I3Q H;  3IRB A;  1LT3 D;  1EWH A;  1R4P B;  4JBJ A;  3OYY A;  4IPG A;  4ZK9 B;  4DV6 L;  3CCL A;  3I55 A;  2HDM A;  4A93 H;  3BDC A;  3TRE A;  3HOZ G;  3S1N B;  3MWY W;  3TP5 A;  4HSP A;  5A2Q E;  3NBH A;  2RBM A;  3VYT A;  2JA5 G;  2VS1 A;  2KHJ A;  3WDN A;  1YJW A;  2CQO A;  3CCS A;  1HUM A;  1TS5 A;  4JI1 Q;  3SR1 A;  4HIM A;  5DAU A;  5EGT A;  5KNC A;  2K52 A;  3A56 A;  3BYT B;  2JA6 G;  2UXC L;  3EJI A;  4MNO A;  3J81 c;  3BVZ A;  2A8V A;  2OF1 A;  1EZ6 A;  4R8N A;  1ESF A;  2NVX B;  4A3G H;  1MI2 A;  2K5Q A;  4POF A;  1QG7 A;  3NP8 A;  3S1M B;  5BR8 Q;  5KNB A;  5C0X J;  4X66 L;  1PH4 A;  4PZ8 A;  5BN3 A;  2UUB Q;  4A3K G;  1ZKO A;  3GP7 A;  4YWK A;  1NNX A;  4LF4 Q;  2QKI C;  5I6W A;  3HFZ B;  1XNR Q;  2B2W A;  4LF7 Q;  1A0I A;  4JG2 A;  1UE5 A;  2F0M A;  4OHJ A;  1LLR D;  4B3M Q;  2NVT B;  1LTR D;  1M4V A;  3J81 L;  4R4Q A;  5CR3 A;  3E9I A;  4ME5 A;  3TP8 A;  1IBL L;  4A3E H;  3ERQ A;  5IGE A;  4XIG S;  3S17 B;  1B2T A;  1IHZ A;  2B3G A;  2L1B A;  1V1P B;  2B39 A;  1JMC A;  3LGJ A;  1FR3 A;  2R93 G;  1DXM A;  5KYI A;  1JOO A;  5LL6 X;  3OTO L;  3RZO B;  1J5E L;  3ONA B;  5FLX c;  3S2D H;  2RKS A;  5CBE E;  1MKH A;  1TT2 A;  3CXC A;  4C3I B;  1IW7 D;  5IYD G;  1GUN A;  2JEA I;  2JSO A;  2D5D A;  3HRZ C;  3MFG A;  1X3Q A;  1R4Q B;  3K7A H;  4DK0 A;  5AJ3 L;  2A19 A;  3I56 A;  1A3T A;  5C44 G;  4FXD A;  1PH3 A;  1GHK A;  5FJ8 H;  1EQT A;  4IUQ A;  3VR3 A;  4U67 3;  1DD2 A;  1O80 A;  1YNX A;  4ZKB B;  1D5Z C;  2WP8 J;  3CHB D;  1LTB D;  1EZ8 A;  4QY7 A;  4LF6 Q;  3L9A X;  5FLX L;  1A3U A;  2RHS B;  1NMG A;  1LT6 D;  2YTV A;  2WB1 B;  5GAD C;  3C3L A;  1SR3 A;  2L9H A;  4KY7 A;  3R2T A;  4P74 A;  2I07 B;  1SNM A;  3S1Q B;  1HXY D;  4A3I B;  1A63 A;  5IP9 G;  2GVA A;  1JIC A;  1U4M A;  4DUZ L;  3A8J E;  3PSI A;  2D0P A;  3AFQ A;  2HQE A;  4K0K Q;  3D4W A;  1HNW L;  4RCO A;  3V2T A;  1TWH H;  4DAP A;  4BS9 A;  1NJI C;  5JJK A;  2FFK B;  3QOL A;  2L4N A;  1X3G A;  3RD4 A;  4JI0 Q;  2NYZ D;  3CC4 A;  2KHS A;  2OWO A;  2D0O A;  3PO3 G;  3R3O A;  3GTG H;  1BQQ T;  1XX8 A;  1PTO F;  1RDP D;  4AYB G;  5HGT A;  1PHJ A;  2CWP A;  2IWH A;  5IP7 H;  4G7H C;  1F77 A;  4JI8 Q;  2F4I A;  2P5Z X;  2B2T C;  2F0N A;  1JJG A;  2XVS A;  5CGK A;  4A93 G;  1ZXT A;  1K28 A;  3BDL A;  5I2X A;  4IJL A;  5EPJ A;  5KND A;  3U4V A;  3A55 A;  3P20 A;  3BS1 A;  1V8Q A;  1PYS B;  4RAU C;  4XQQ A;  4LFB Q;  3EIV A;  1JWU D;  2Z9H A;  1L1O C;  1M90 C;  1P8L A;  4J15 A;  5A35 A;  4OO1 I;  1PFM A;  2KQ3 A;  3BVG A;  3MA2 B;  5IGF A;  1BBW A;  2F0Q A;  4AYB E;  5C44 B;  2KVM A;  4KN7 C;  4A3G G;  2Y0S B;  1S72 A;  2EJM A;  5EAY A;  3D6W A;  1RHP A;  1WCM H;  4S3S A;  5M3M H;  4QGU A;  3QWN A;  5J22 A;  1VQC A;  4V19 0;  1HFN A;  4JI5 L;  3M4Y A;  2G9D A;  4LUO A;  2ICI A;  1F9P A;  4QIW E;  4IOC A;  2K28 A;  4B08 A;  2XGT A;  4OIK A;  3P7J A;  1A2T A;  4P71 A;  1CKN A;  2G9H D;  5COY A;  3EQL C;  2B29 A;  1C9O A;  2HDL A;  4ALP A;  1VMP A;  2K33 A;  3A8K E;  1RD9 D;  1KL9 A;  4YCV A;  1NSN S;  2ZXO A;  4C3H H;  4EX5 A;  4QJF A;  4A3E G;  1B53 A;  3K80 C;  4KKS A;  1I4Q A;  1N36 Q;  2VQE Q;  1DYQ A;  1Q46 A;  2E5L L;  1I4H A;  4KD4 A;  1QB5 D;  2AUK A;  2XWJ B;  4RGT A;  1EOV A;  3CF5 A;  1XMQ Q;  1CQV A;  2JA9 A;  3GDE A;  1WTH A;  2KED A;  2R7F A;  4MTN A;  3SHL A;  3IFD A;  1MIU A;  1CKM A;  4CDF C;  1K8A C;  3KBG A;  4A3L H;  1O7I A;  1YNN D;  4PZ7 A;  4AIM A;  1PYW D;  4KJN A;  1EIG A;  1GUT A;  2AWN A;  1TWF B;  1K8G A;  1Y8O B;  1A6X A;  3BYY B;  4K2L A;  5AFW A;  5IOC A;  5FJ8 G;  2EPB A;  2UXD L;  4DR3 L;  3J80 i;  4X3T A;  3PGZ A;  1A3V A;  1XMO L;  1PRT F;  1K83 B;  1LUZ A;  1Y1V B;  4PQX A;  1D6E C;  2VQF L;  1XXG A;  4DV3 Q;  2K50 A;  1ENA A;  1GJX A;  2NBF A;  4FVM A;  1E0B A;  4PMW A;  1KQS A;  1MJE A;  1EYA A;  4HED A;  3PUZ A;  4XTC S;  5CYU A;  5CV9 A;  2L11 A;  2V4D A;  1TII D;  5C3X A;  5HUR A;  4JI3 Q;  1UUP A;  1OTC A;  2A6E C;  2UUC Q;  1WTO A;  4JBW A;  2LXJ A;  1TY2 A;  4B3R Q;  1VQK A;  1JE5 A;  3DUZ A;  1FD7 D;  2E2J H;  3M4O B;  2UUA Q;  3RN2 A;  1Q3L A;  2IT1 A;  4BA1 I;  1DM0 B;  1O7Y A;  4OON A;  4XT1 B;  5IP7 G;  5J1Z A;  3K0Y A;  4Q5V A;  1SNQ A;  1LM0 A;  2K1B A;  1MD2 D;  2FJ2 A;  4A3F B;  1LTT D;  5ELC A;  1VQE A;  5NUC A;  4ZCK A;  4ULL A;  1F9Q A;  1STH A;  1S4Z A;  4DV6 Q;  2FMM A;  2AQ3 B;  3Q22 A;  3Q8D A;  4YWM A;  1EY6 A;  2D2C C;  3DHQ A;  1PH8 A;  1S3O A;  3E5S A;  5ELO A;  3DWQ A;  3X3M A;  2F0T A;  2EOT A;  1I6H B;  5C4J B;  3TZD A;  3S1N H;  3I2Z A;  3NTI A;  1TWC B;  2EYM A;  1GD7 A;  2UXC Q;  2VW9 A;  1B3Q A;  1L0Y B;  2F0P A;  3GTQ B;  1VCI A;  2PZT A;  4DR2 L;  1I4G A;  2K5V A;  3MFY A;  1WCM G;  4CHT B;  3UDF A;  2C9O A;  2CWA A;  5M3M G;  1HTP A;  2JN4 A;  3K7U C;  2RDF A;  4GKJ L;  1D5X C;  1EY7 A;  1BCP C;  1FNW A;  1L1O B;  4X66 Q;  1WTQ A;  1D2B A;  5IT9 E;  5D65 A;  2BA1 A;  4HIO A;  4POG A;  1PA6 A;  2IL8 A;  1M1K C;  4PNY A;  3T1H L;  2Z8L A;  3OWE B;  2NVX H;  4KHP Q;  1EFI D;  3Q6S A;  3VDY A;  3DM3 A;  3I4L A;  2BH8 A;  3S1M H;  1XNQ L;  1KRT A;  2HCC A;  2A6H D;  1SAP A;  2OTJ A;  2TMP A;  3A54 A;  2WIN B;  3RMH A;  4C3H G;  4CKB A;  3G6E A;  5FOB B;  3GTL B;  1Q81 C;  1IBL Q;  3OW2 A;  1SYF A;  2HT1 A;  5I4D A;  1CA5 A;  2NVT H;  1PZJ D;  2PQA B;  3K81 C;  3OTO Q;  2BOS A;  4YHH L;  3M85 A;  4A3B B;  1J5E Q;  1EQV A;  3L7Z C;  4L5Q A;  3S17 H;  4IUT A;  3CPW A;  1WD0 A;  1ASZ A;  3SGI A;  5FO9 B;  4A3L G;  1SFO B;  3RZO H;  3MXN B;  3KUP A;  3M7N A;  2AQ2 B;  5EQ0 A;  1LT4 D;  2SDF A;  1ONL A;  1SNP A;  1E1T A;  2PCF B;  4DAM A;  2IX1 A;  2D62 A;  5AJ3 Q;  4K6D A;  2A5H A;  3HOU B;  4N8F A;  1CZW A;  4C3I H;  1HJP A;  3ND9 A;  4A3D B;  4U68 A;  3W3A A;  1GOZ A;  4LJZ C;  1JB7 A;  2IX0 A;  3T4A C;  1JWS D;  3UDX A;  3NQI A;  2NTS A;  4UHV A;  3ULJ A;  5CBA E;  4PG3 A;  4UDU C;  4X65 L;  5FKA C;  3AYH B;  5FO7 B;  2ZTD A;  1L2F A;  1CK1 A;  1EY9 A;  1RTN A;  4QUC A;  4NXM L;  4DUZ Q;  2L0C A;  1G29 1;  4QMG A;  3S1Q H;  4A3I H;  1PTO D;  5DM6 3;  2O5J C;  3UDG A;  1HNW Q;  1LO5 D;  4X3U A;  3PUV A;  1STB A;  4CGY B;  1Y1W B;  2CW0 C;  2MJ8 A;  1ET9 A;  1XTD A;  5CC4 A;  4WJW A;  4KY6 A;  2ZT9 C;  2NUC A;  3T1Y L;  2NZO A;  1J6Q A;  2OQK A;  2BE5 D;  4HID A;  1T9H A;  5E3F A;  4EQN A;  4G4K A;  2VB2 X;  4IPD A;  1CI3 M;  2I5H A;  1I4P A;  2K03 A;  3G6J B;  3MXU A;  3HKZ B;  1EUJ A;  1VQF A;  4DR7 L;  2XRS D;  1WVL A;  1O7Z A;  4DF7 A;  3S24 A;  1DOL A;  4XT3 B;  4GOP A;  1KIX A;  2F0H A;  4BXX H;  1AEX A;  1ESR A;  1CHQ D;  1CQF A;  2BDN A;  3N6R A;  3FPP A;  1PH7 A;  2QIL A;  2A69 C;  5CV5 A;  3C1F A;  1AZQ A;  2D9U A;  3GTM B;  3BZK A;  2GN5 A;  2NB0 A;  1ML0 D;  3QB3 A;  2R7Z B;  1X6O A;  5E7N A;  2OEO A;  1IZ6 A;  4F7X A;  1X9N A;  5G3L F;  3Q24 A;  2PYK A;  3HP3 A;  4X64 L;  2I5M X;  3G48 A;  4DAY B;  2XN9 C;  5EBC A;  2KJX A;  3H15 A;  2H1E A;  5C44 H;  2B2V A;  2J0T D;  1EEI D;  3J7A F;  2RSN A;  4JC0 A;  4IFD I;  1EQR A;  1KNE A;  4A3M B;  4EQO A;  4OL7 A;  1JR0 D;  3PUW A;  3WOF A;  4RHR A;  1QVF A;  2KHI A;  4UP9 A;  3JAM i;  1NR2 A;  1X3P A;  3DEO A;  3E0E A;  2NN6 I;  3M3Y B;  2QA4 A;  1BCP B;  4FXK C;  4KHV A;  2XSC A;  1SEB D;  1TS3 A;  5C0X H;  4DR6 Q;  2A68 D;  2E5L Q;  3MXP A;  2YU9 B;  2Q2I A;  3S15 B;  4PZ6 A;  1I50 B;  3ERO A;  3V96 A;  2OXP A;  2RA4 A;  3FP9 A;  4B3R L;  1PH9 A;  1N8R C;  4L5R C;  1V43 A;  3BZD B;  1PRT D;  5DEH A;  1SE3 A;  3A7A B;  3F2D A;  1Y8N B;  3S9W A;  1QNU A;  2UUA L;  3H3V I;  4KV6 A;  4JV5 L;  1ENC A;  5A2Q L;  3H91 A;  1Q7Y C;  1K9M C;  1E2W A;  1VQL A;  5BN5 A;  4JOI A;  5GRO A;  1W3S A;  1Z9F A;  1SN8 A;  4C3I G;  1QE6 A;  4FF4 A;  3R2I A;  2JYO A;  4Y52 H;  1HHV A;  3K5N A;  4GLV B;  1HRJ A;  4LFA L;  3TS0 A;  3I90 A;  3HS0 C;  2UXD Q;  3SE0 A;  3U9O A;  4O2D A;  1TWF H;  3NUC A;  4DR3 Q;  3OIP A;  1XMO Q;  4LMQ D;  2KCN A;  3S1R B;  2VQF Q;  2M2L A;  2NVQ B;  1YI2 A;  1LT5 D;  4DU9 A;  1K83 H;  3CCQ A;  4BBS B;  2IW3 A;  1Y1V H;  2QDL A;  1PFN A;  2WB1 G;  3CC2 A;  2E2H B;  3N52 A;  3UE0 A;  2HHH L;  4ZRZ A;  3I4M B;  1WTV A;  3J7A V;  4N9P A;  2Z0S A;  1OXU A;  2FXQ A;  2L5T A;  4JOI C;  5LMN L;  4A3I G;  1VQO A;  1LTI D;  4A75 A;  3I72 A;  5JEA G;  3VR4 A;  3D4R A;  3KDF B;  3OMC A;  3F2B A;  1BNZ A;  2MP1 A;  1H9J A;  3J7A 5;  2E2I B;  5LL6 S;  3GV6 A;  1IKL A;  1SLJ A;  2YTX A;  3NEN A;  4FXG C;  1T5X D;  2DNC A;  3J80 E;  3H94 A;  4KHP L;  1ET6 A;  3O13 A;  5IY0 A;  4FF3 A;  3L3O C;  1OXX K;  3K57 A;  4IUR A;  3P1H A;  2KCT A;  4YCW A;  4ZYS A;  2WB1 E;  4LW1 A;  3CW2 C;  1PMR A;  3M4O H;  1F9R A;  4B3T L;  1D1K A;  1IL2 A;  2M00 A;  4I7Z C;  2RCF A;  4HSV A;  1X56 A;  4O0A A;  5CV7 A;  1KLG D;  1G6Z A;  4BXX G;  1R9T B;  3AQQ A;  1K73 C;  3EVQ A;  4A3F H;  1H9S A;  4KHZ A;  2E76 C;  2E8G A;  1JQY D;  1TU2 B;  3A5Z B;  3TZU A;  2SNS A;  1C4Q A;  1JCK B;  1UNS A;  1ILQ A;  2B2U A;  5M9O A;  5JVG 3;  2PPB C;  3NEM A;  5IWA L;  1GVP A;  2B2W C;  2CH4 W;  4LNQ A;  3FKI B;  1I6H H;  1PFS A;  1U4R A;  4H02 A;  4J8Q A;  5C4J H;  1FNU A;  4DR2 Q;  4A3J B;  3TP6 A;  3DM1 A;  1OXT A;  4HJ7 A;  1TWC H;  1IKM A;  3HOV B;  2R92 B;  4GKJ Q;  3GTQ H;  2Y0S G;  1W6J A;  1IW7 C;  3KF6 A;  1E7Z A;  4DV4 L;  3LNN A;  3T1H Q;  4RCN A;  1X54 A;  4JPB W;  5ELB A;  3EFX D;  1XNQ Q;  2XRQ D;  1VQ9 A;  3I4N B;  2DY8 A;  1JOQ A;  4IJH A;  4DFA A;  2KA7 A;  1D8L A;  1KAB A;  4AQY L;  3L0O A;  1SYE A;  5CV8 A;  5I9O A;  5HGQ A;  4G7O C;  4B9W A;  5C0X G;  1GM5 A;  3K5O A;  1CSP A;  3RLF A;  3DWA A;  1GO3 E;  2ASB A;  2K5H A;  3LX0 A;  4MHE A;  3K5L A;  1B44 D;  2ZJR A;  3NPP A;  2GVB A;  3ULL A;  3LWU A;  5DLQ E;  4YHH Q;  3GTL H;  2JEB I;  2Y0S E;  1BDO A;  2EDG A;  1CA6 A;  1OXS C;  1LTL A;  5KRU A;  2VL6 A;  4BY1 B;  1CKO A;  2BH2 A;  2DUD A;  3TSS A;  4P73 A;  4KJO A;  1W2B A;  4A3B H;  1PH2 A;  4XQJ A;  2EY5 A;  4EQP A;  1UAP A;  4G7Z C;  4DV7 L;  5ELN A;  5M5X B;  5FLX E;  4FO2 A;  1HA5 A;  1PDQ A;  1FGU A;  1HZA A;  4RGN A;  1SFO H;  5DNF A;  1KAA A;  1LAC A;  1YEZ A;  1PH1 A;  2SEB D;  3NWT A;  3TME A;  4C3J B;  1S5C D;  2AHO B;  2BDO A;  1IYU A;  4IN3 A;  1EYD A;  4DUY L;  4BY7 B;  4IFD J;  3HOU H;  1O7L A;  1KNA A;  1XPU A;  4R1J A;  3G71 A;  4J6H A;  2VY3 A;  2O5I C;  4A3D H;  5IIF A;  4LWC A;  3VA5 A;  1YHQ A;  3AFP A;  4X65 Q;  4MZ9 A;  2EYF A;  1Y1V G;  3J7Z C;  5TSS A;  3PQI A;  4NXM Q;  2B8F A;  3W2D A;  1QUQ A;  1HR0 L;  2QEJ C;  2RDG A;  4C56 C;  1U9R A;  1P16 A;  3KF8 B;  3T51 B;  4CKC A;  1VQJ A;  2RDH A;  3RZD B;  4Y7N B;  5IGD A;  3H3V C;  2B63 B;  1N34 L;  4WFN 3;  3PUX A;  1LTS D;  1UE7 A;  2K5W A;  3HZX A;  4R9W A;  4RG1 A;  5IOD A;  4DR5 L;  4IQZ A;  1YHB A;  1VQ4 A;  3SK5 A;  1NE3 A;  3T1Y Q;  1Y1W H;  3W1B A;  2B2Y A;  1WFQ A;  2ALY B;  1ILP A;  2Q2T A;  3K6O A;  1HTL D;  4CBV A;  3W5O A;  2ZM6 L;  1G8Z D;  2QEX A;  4DR7 Q;  1XTC D;  4NXN L;  3STB D;  3CMA A;  4DR6 L;  1EIF A;  4X6A H;  1Z6H A;  3P75 A;  4FYD A;  4A3F G;  2ATW A;  5G3L D;  2F3I A;  5IYC H;  2UU9 L;  1LV9 A;  2KEE A;  2MFI A;  3G4S A;  1IL8 A;  4YY3 L;  2R6G A;  1SYD A;  4UY8 C;  1SRO A;  4PV1 C;  3TS2 A;  5J3B A;  1Y8P B;  1WJJ A;  3I70 A;  4K5X A;  4QL5 A;  1RTO A;  3UI2 A;  3WOE A;  1Q1E A;  4GNX A;  1VDZ A;  5LMU L;  1S40 A;  2MO1 A;  3PIP A;  3SK6 A;  1YVC A;  3NTH A;  3GTM H;  2E74 C;  1CUK A;  4X64 Q;  2XTI A;  5K36 H;  4RWS C;  1YNN C;  1KC8 C;  1BXT A;  1RJT A;  2R7Z H;  1WD1 A;  1V1Q A;  1HUN A;  4DV1 L;  2X6L A;  3C2P A;  2QW7 A;  2SOB A;  1GUS A;  4UP7 A;  5KIX A;  1WTX A;  1EYG A;  4HJ8 A;  4F87 A;  3KLW A;  3K59 A;  4RHS A;  2BA0 A;  3CRL C;  3C1E A;  2N8N A;  1EFW A;  3ZYY X;  4IUV A;  1NBW A;  4DV2 L;  1STG A;  4JW0 A;  4QQB X;  1KAW A;  1GKH A;  1BR9 A;  2RSO A;  4A3M H;  3MEF A;  4JBM A;  3CC7 A;  1I94 L;  1RF2 D;  2N88 A;  1M8A A;  2H5X A;  2Q2U A;  1G51 A;  3V05 A;  4NB3 A;  4XYO A;  3M3Y H;  4NKL A;  1G2T A;  1YNJ D;  3TBI B;  4BBR B;  2N78 A;  2CCZ A;  5EKL A;  1BVS A;  1SYC A;  2K01 A;  3CCV A;  2YU9 H;  3S15 H;  4A3B G;  2EY2 A;  4K5V A;  1I50 H;  2QGQ A;  3GTJ B;  1L0X B;  5IT9 c;  4JV5 Q;  1OXV A;  5GAH C;  4O1N A;  3OHX C;  5D14 A;  4HJ5 A;  4ZKC B;  3MHB A;  1HA6 A;  1VQ7 A;  3KYH C;  4L8J A;  3QJY A;  3JAM E;  4LFA Q;  1TS2 A;  2Q2H A;  4JI4 L;  3J81 i;  2ES2 A;  5EPK A;  5ISR A;  4DNT B;  4DXG A;  1U0L A;  3S16 B;  4OO1 H;  4CKE A;  3HOU G;  1ZYR D;  2AQ1 B;  2IHE A;  2KEC A;  4DK3 C;  4A3D G;  1PZK D;  1I4R A;  2I46 A;  1X3F A;  3AU7 A;  4KMU C;  1EY5 A;  5E4X A;  2R3Z A;  2Z4H A;  5IT9 L;  4M1U B;  3S1R H;  1SDF A;  3FEW X;  2VUM B;  2HHH Q;  1Z47 A;  1QVG A;  2RHQ B;  2NVQ H;  3KJP A;  1Y69 U;  5LMN Q;  3PIP 3;  1B3A A;  5M5W B;  4BBS H;  4CDC C;  5FK9 C;  4RKB A;  2E2H H;  2F1M A;  2PMZ B;  4X3S A;  3I4M H;  2LY7 A;  2F4V L;  2K5D A;  4GKK L;  3BDO A;  3TP7 A;  4HCE A;  3VR2 A;  1C48 A;  5IGC A;  1MHW C;  4L63 B;  1Y1W G;  2WFW A;  2F0O A;  1STE A;  3OPO A;  1SJE D;  2Z6K A;  4JI2 Q;  2OT2 A;  1K8O A;  3I7F A;  2E2I H;  3BU2 A;  5GAE C;  5C3E B;  1H95 A;  2EYH A;  1U5K A;  2E2D C;  5IE8 A;  1AZP A;  2EY6 A;  1NY4 A;  2ZTE A;  1Q12 A;  4KI0 A;  1BOS A;  4B3T Q;  1EWI A;  4IOA A;  2A6H C;  3PUY A;  3K0X A;  4OEM B;  5C4X B;  4HR7 B;  4XDX A;  5IYC G;  3HKZ G;  1B50 A;  2OCE A;  1NCV A;  5DM7 3;  1SYG A;  2HIV A;  1SMY D;  1E22 A;  1HCZ A;  2Z4I A;  2G5D A;  1TXY A;  4H13 C;  2HD3 A;  1KDB A;  5D3I B;  2DY7 A;  2F0K A;  3VYR A;  1XJV A;  1R9T H;  4CJ1 B;  1JJC B;  1VQA A;  2C5C A;  4DA2 A;  1PH6 A;  1KHI A;  2ICE C;  5IWA Q;  2ID0 A;  1MGS A;  4WJ4 A;  1HNZ L;  2WKD A;  1EIH A;  1AE3 A;  5FO8 B;  1XYI A;  5K36 G;  2O4X A;  3NHH A;  2NVY B;  3K58 A;  2F03 A;  2R7Z G;  5JOB A;  3FKI H;  4ID6 A;  3A8I E;  1STA A;  5JJZ A;  4A3J H;  4DV4 Q;  3HKZ E;  3L2P A;  2F0S A;  1NAP A;  5ELD A;  3HOV H;  2R92 H;  1CKN B;  2MUY A;  1SSO A;  2ZXP A;  5JJI A;  3SK8 A;  4HIK A;  3GTK B;  1JOR A;  4TSS A;  2IHF A;  1EU4 A;  1ZEQ X;  3KOJ A;  3HOX B;  4A3M G;  4AQY Q;  4JBK A;  2A1A A;  3U4Z A;  1U4L A;  3I4N H;  1B8A A;  3CRK C;  2FIN B;  1L0W A;  2F0U A;  1IBM L;  4DPG A;  5JEA H;  1Q90 A;  2PW5 A;  3HOW B;  1NTG A;  1HPC A;  1V1P A;  1FYC A;  3MC0 B;  5T1I A;  1PZI D;  5JVH 3;  3PO2 B;  1ICF B;  5H1S E;  4JYA L;  4JCV E;  1PTO C;  3SK4 A;  1VF5 C;  2KBN A;  4HN7 A;  1C7Y A;  4ZAI A;  1JT8 A;  1MSH A;  2AUJ D;  4DV7 Q;  1AW7 A;  1I4X A;  4ZUI A;  4BY1 H;  3E9H A;  2XNA C;  3CD6 A;  3M7G A;  2N3S A;  2BE5 C;  2E75 C;  2JA8 B;  2PNR C;  2VXW A;  1TS4 A;  3U9S A;  3TRZ A;  1VF7 A;  4OO1 G;  1RL2 A;  2CVR A;  4LF8 L;  5M5X H;  4DUY Q;  3QG1 A;  2KCM A;  4LFC L;  5EKK A;  1PLF A;  3HOY B;  2CFM A;  4EQ5 A;  4C3J H;  4GLX A;  5GAG C;  1U4P A;  1HZB A;  1CT1 D;  2OQ0 A;  2LKV A;  2KCC A;  1S5B D;  1F2M A;  3NK9 A;  4BY7 H;  4DR4 L;  3H09 A;  4B9X A;  3DMU A;  3SVM A;  3NQT A;  1EQQ A;  1J8I A;  3U50 C;  1HR0 Q;  1B70 B;  4IPH A;  4YWL A;  4TKO B;  2YTY A;  4X62 L;  4BBS G;  4HAE A;  2A69 D;  2JA7 B;  1BBX C;  2RQX A;  4DV0 L;  1Q8K A;  2L55 A;  3H0G B;  3I4M G;  1PXU A;  5C4Z A;  5E4W C;  4WRD A;  1FL0 A;  1N34 Q;  3FMC A;  4PMC A;  4GOP C;  3RZD H;  4R8I A;  2ZXR A;  4DNI A;  3MTS A;  4DR5 Q;  1YBY A;  4Y7N H;  3CME A;  2B63 H;  4H44 C;  2K05 A;  4EVO A;  3CQZ B;  3VA7 A;  2C35 B;  3FPU B;  5KGU A;  1G6P A;  3CPF A;  1HNX L;  5KEE A;  3RLN A;  4CJ2 C;  1FJG L;  1B7Y B;  2ZM6 Q;  1SYB A;  2J7Z A;  4A3C H;  4NXN Q;  1MBY A;  1AN8 A;  2MHV A;  4C2M B;  4DAV A;  4DV5 L;  1SMX A;  1TY0 A;  2AMC B;  2K5N A;  4OX9 L;  1WTW A;  2L12 A;  2UU9 Q;  3QOJ A;  1DGS A;  3HKS A;  3A74 A;  2B2V C;  1DZ1 A;  4DR1 L;  5I2Y A;  2A68 C;  5JAV A;  1LTG D;  4YY3 Q;  5K5P A;  3S2H B;  3EA6 A;  4FDB A;  1A15 A;  5ELE A;  1C8C A;  3I3C A;  5LMU Q;  3RR5 A;  2XIW A;  2WAQ B;  3J80 c;  3VYU A;  3DWP A;  1PRT C;  4TRD A;  4HJA A;  4KD3 A;  1F2L A;  5CV6 A;  3FKI G;  1FGB D;  1CTM A;  1BUV T;  4A3J G;  2L15 A;  4DV1 Q;  3ZJY C;  3HOV G;  2R92 G;  4APV A;  2Z1C A;  4UP8 A;  1K8M A;  3IKJ A;  4R4O A;  1K3R A;  4MIU A;  4E6I A;  3WWV A;  5BN4 A;  2HUG A;  5JJL A;  3KLS A;  1TR5 A;  2VB3 X;  4DV2 Q;  4DKA C;  3I4N G;  2F0G A;  3J80 L;  3CP0 A;  1S5D D;  1KLU D;  1WTP A;  5C4H A;  3S14 B;  1I94 Q;  3ER0 A;  4HJ9 A;  4LAA A;  1DCZ A;  1HZ9 A;  4LUV A;  3CU7 A;  4BWG B;  2EIF A;  2HCI A;  3TEH B;  3CCR A;  4IO9 A;  1B9N A;  4GLA C;  3MXG A;  3KLS X;  4F8M A;  4BBR H;  4OWT B;  3VYS A;  4BY1 G;  4XQN A;  4JI2 L;  3F2C A;  3KFU A;  5EBD A;  1TKW B;  2EYO A;  1SBB B;  3FDT A;  3T16 A;  3CAM A;  5IGB A;  3OWF A;  1YJ9 A;  4JI7 L;  3GTJ H;  1PTO B;  2VNU D;  4JI4 Q;  3OW7 A;  1CZG A;  1G2S A;  1KRS A;  1DOM A;  4LF5 L;  4C3J G;  3NEL A;  2Z6B A;  1B4O A;  2CQA A;  1K0S A;  5M3F B;  1BCP F;  3U58 A;  3T53 B;  1GXD C;  4BY7 G;  4JI6 L;  3S16 H;  3I4O A;  1V1O A; 
#chains in the Genus database with same CATH homology
 1L1O B;  3W5O A;  2ZM6 L;  2QEX A;  4DR7 Q;  3BJU A;  2BA1 A;  4HIO A;  4POG A;  1PA6 A;  4NXN L;  3STB D;  3CMA A;  1M1K C;  3T1H L;  1VQ8 A;  1N32 Q;  4DR6 L;  2NVX H;  1EIF A;  4KHP Q;  4X6A H;  3PCO B;  3VDY A;  3DM3 A;  4A3F G;  2BH8 A;  2ATW A;  3S1M H;  1XNQ L;  2MNA A;  2F3I A;  5IYC H;  1KRT A;  2UU9 L;  1JJ2 A;  2OTJ A;  2MFI A;  2VUM H;  3G4S A;  2RCN A;  3G6E A;  2F4V Q;  5IYD H;  1ASY A;  4YY3 L;  5GQO A;  2R6G A;  4GKK Q;  4UY8 C;  1SRO A;  1MJC A;  5M5W H;  1Q82 C;  3TS2 A;  5J3B A;  1Q81 C;  1IBL Q;  3OW2 A;  3DLL A;  1WJJ A;  4QL5 A;  2HT1 A;  4JI5 Q;  1Q1E A;  4GNX A;  5JEA J;  2B63 G;  5LMU L;  1S40 A;  3W1G A;  1Q86 C;  2MO1 A;  3RN5 A;  2NVT H;  2AWO A;  3PIP A;  2PQA B;  1YVC A;  4DV3 L;  3K81 C;  1EIY B;  3OTO Q;  3GTM H;  1Q1B A;  4YHH L;  3M85 A;  4X64 Q;  1CUK A;  1J5E Q;  2KEN A;  2XTI A;  3L7Z C;  4L5Q A;  1KC8 C;  1KD1 C;  3S17 H;  2R7Z H;  1V1Q A;  2DGY A;  3CPW A;  3RLO A;  1IXR A;  1ASZ A;  3SGI A;  4A3C G;  4GOP B;  5M3F G;  4DV1 L;  4A3L G;  2I5L X;  5IP9 H;  5C3E H;  1N33 Q;  3RZO H;  4UP7 A;  3MXN B;  3EN2 A;  4JI3 L;  1EYG A;  3M7N A;  4HJ8 A;  3H3V H;  1D7Q A;  2LSS A;  4AH6 A;  3KLW A;  4DK6 C;  2UUC L;  1E1T A;  2BA0 A;  3A5U A;  4DAM A;  2IX1 A;  2N8N A;  1EFW A;  2D62 A;  5C4X H;  4P75 A;  5AJ3 Q;  1TWG H;  1NBW A;  1VQN A;  3CCU A;  4C3I H;  4DV2 L;  4UPA A;  2JJQ A;  1YIJ A;  1HJP A;  1KAW A;  3M9B A;  4QQB X;  3AEV A;  1GKH A;  2PI2 E;  4A3M H;  3GTO H;  2PI2 A;  3D31 A;  3MEF A;  3CC7 A;  4JBM A;  1I94 L;  3PV0 A;  1JB7 A;  4WJ3 M;  2H5X A;  2IX0 A;  4IPC A;  1HNZ Q;  3UDX A;  1G51 A;  2Q2U A;  2K75 A;  1PVO A;  3ULJ A;  3PO3 H;  4NB3 A;  2UXB Q;  3M3Y H;  3ICE A;  5HY6 A;  4PG3 A;  3J81 j;  3F1Z A;  2N78 A;  4X65 L;  2NZH A;  3UE1 A;  2CCZ A;  3AYH B;  2ZTD A;  1IBK Q;  1HZC A;  1L2F A;  1VQH A;  4LF9 Q;  1BVS A;  1VQB A;  1I3Q H;  4NXM L;  2YU9 H;  3IRB A;  3CCV A;  3S15 H;  4JBJ A;  4A3B G;  2ZTC A;  1I50 H;  3OYY A;  1A62 A;  4IPG A;  1BKB A;  3ERS X;  4DUZ Q;  4DV6 L;  2NVY H;  3CCL A;  1L1O A;  3I55 A;  2QGQ A;  4A93 H;  5IT9 c;  3TRE A;  1G29 1;  3HOZ G;  4JV5 Q;  1OXV A;  5GAH C;  3S1Q H;  4A3I H;  4HJ5 A;  4GN4 B;  2JA5 G;  2VS1 A;  2KHJ A;  3UDG A;  1HNW Q;  1YJW A;  1VQ7 A;  3KYH C;  2CQO A;  3PUV A;  3CCS A;  4JI1 Q;  1SE8 A;  4HIM A;  4LFA Q;  2K52 A;  2Q2H A;  4JI4 L;  3J81 i;  2JA6 G;  1XTD A;  2ES2 A;  2UXC L;  2MO0 A;  4RMF A;  1U0L A;  5LMN W;  3GTK H;  4NPS A;  2IHE A;  4MNO A;  3HOU G;  3J81 c;  4B3S L;  3T1Y L;  2NZO A;  1YHA A;  1J6Q A;  2OQK A;  4DK3 C;  4A3D G;  2A8V A;  4HID A;  1T9H A;  1IBM Q;  3HOX H;  4IPD A;  2I5H A;  1Y14 B;  4A3G H;  2PQA A;  4POF A;  1X3F A;  4JYA Q;  5BR8 Q;  5C0X J;  4X66 L;  1PH4 A;  3S1R H;  4PZ8 A;  1C0A A;  1EUJ A;  1X3E A;  1VQF A;  3D0F A;  3JC6 6;  4DR7 L;  2HHH Q;  2UUB Q;  1Z47 A;  1YZ6 A;  2RHQ B;  4BBR G;  4A3K G;  1QVG A;  2NVQ H;  3HOW H;  4KLK A;  3S24 A;  3KJP A;  1N32 L;  4YWK A;  5LMN Q;  4GOP A;  1KIX A;  4LF4 Q;  3PO2 H;  3HFZ B;  1XNR Q;  4BXX H;  4BBS H;  4LF7 Q;  1A0I A;  2E2H H;  4L5S A;  2JK8 A;  2JQO A;  2VZA A;  1UE5 A;  4JG2 A;  1PH7 A;  3I4M H;  4B3M Q;  2ZJP A;  2HQL A;  2F4V L;  4GKK L;  1WOC A;  2YV5 A;  4R4Q A;  1AH9 A;  2N49 A;  3BZK A;  3E9I A;  1IBL L;  4LF8 Q;  2GN5 A;  3NBH B;  4A3E H;  4XIG S;  1Y1W G;  2WFW A;  4TQU S;  2B3G A;  4LFC Q;  1X6O A;  2Z6K A;  4JI2 Q;  1JMC A;  3LGJ A;  5E7N A;  3I7F A;  2E2I H;  1IZ6 A;  2JA8 H;  2R93 G;  3BU2 A;  3OTO L;  3STB C;  2PNH A;  5GAE C;  1X9N A;  4X64 L;  1J5E L;  1H95 A;  1U5K A;  4P72 A;  2I5M X;  5IE8 A;  2EQS A;  3G48 A;  4DAY B;  1NY4 A;  2ZTE A;  5FLX c;  1Q12 A;  4GN5 A;  4KI0 A;  3H15 A;  4DR4 Q;  3S2D H;  4B3T Q;  5C44 H;  1EWI A;  3GO5 A;  3HOY H;  4IOA A;  4A76 A;  1VQG A;  3PUY A;  3K0X A;  1MKH A;  1IYJ B;  4A4I A;  1N33 L;  3CXC A;  4JC0 A;  5IYC G;  4X62 Q;  3HKZ G;  4IFD I;  4DV0 Q;  2OCE A;  4IFD G;  1EQR A;  2VUM G;  3PUW A;  2HIV A;  5IYD G;  2JEA I;  1QVF A;  1E22 A;  3M4P A;  3K7A H;  2KHI A;  1TXY A;  4UP9 A;  3JAM i;  2A19 A;  5AJ3 L;  3I56 A;  3E0E A;  5C44 G;  1XJV A;  4OWX B;  2YYZ A;  1R9T H;  2NN6 I;  1PH3 A;  2NN6 G;  2QA4 A;  2JA7 H;  1JJC B;  1VQA A;  5FJ8 H;  1AE2 A;  1WYD A;  1PH6 A;  1KHI A;  3H0G H;  5IWA Q;  1YNX A;  2MQH A;  3JAM c;  1QZH A;  1UWV A;  2ID0 A;  5FLM H;  2WP8 J;  4DR6 Q;  4WJ4 A;  4LF6 Q;  4QY7 A;  1HNZ L;  2E5L Q;  3PIO A;  1QVC A;  2Q2I A;  1AE3 A;  4PZ6 A;  2RHS B;  1NMG A;  2UXB L;  2LXK A;  2YTV A;  3KJO A;  5K36 G;  5GAD C;  1SR3 A;  3FP9 A;  1HNX Q;  2R7Z G;  1BBU A;  4P74 A;  1PH5 A;  3F8T A;  1FJG Q;  4B3R L;  1A63 A;  1PH9 A;  1N8R C;  3FHW A;  1IBK L;  3FKI H;  2I0Q A;  4LF9 L;  4L5R C;  4GNX C;  1V43 A;  3A0J A;  3EBE A;  5IP9 G;  3B6Y A;  5C3E G;  2GVA A;  4A3J H;  4DV4 Q;  3HKZ E;  1NMF A;  3L2P A;  4DUZ L;  3F2D A;  3CQZ H;  4DV5 Q;  2UUA L;  3H3V I;  3HOV H;  1K0R A;  2R92 H;  3PSI A;  2D0P A;  1CKN B;  4JV5 L;  1Q7Y C;  1K9M C;  3AFQ A;  5JJI A;  4K0K Q;  3GD7 A;  1VQL A;  4OX9 Q;  4JOI A;  5GRO A;  4HIK A;  5C4X G;  1W3S A;  1E24 A;  1Z9F A;  2IHF A;  1HNW L;  4DR1 Q;  1SN8 A;  4Y52 H;  1TWH H;  1XPO A;  4C2M H;  4JI1 L;  2PMZ E;  1NJI C;  4GLV B;  5JJK A;  4LFA L;  3KOJ A;  3TS0 A;  4A3M G;  4AQY Q;  4JBK A;  2UXD Q;  1X3G A;  4O2D A;  1RIP A;  1TWF H;  1VS0 A;  2A1A A;  4DR3 Q;  3U4Z A;  3CC4 A;  4JI0 Q;  3I4N H;  1XMO Q;  1B8A A;  3CCJ A;  2OWO A;  2D0O A;  3PO3 G;  1E3P A;  3GTG H;  1L0W A;  2ZJQ A;  2VQF Q;  1LYL A;  1IBM L;  4DPG A;  4AYB G;  1NTG A;  1PHJ A;  1VQ6 A;  1YI2 A;  3S2H H;  4GN3 B;  2CWP A;  5H1S E;  5IP7 H;  3KF6 B;  4JYA L;  4JCV E;  1K83 H;  5BR8 L;  1VQD A;  4JI8 Q;  3CCQ A;  1Y1V H;  4R4C A;  2KBN A;  2WB1 G;  3CC2 A;  1SRU A;  1JJG A;  3UE0 A;  2HHH L;  2UUB L;  1C7Y A;  4A93 G;  2Z0S A;  1OXU A;  2FXQ A;  2JE6 I;  4TVA B;  1JT8 A;  4IJL A;  5LMN L;  4JOI C;  4A3I G;  1VQO A;  4LF4 L;  3U4V A;  4A75 A;  5JEA G;  4DV7 Q;  1XNR L;  4BY1 H;  4LF7 L;  1VQM A;  1PYS B;  3E9H A;  3KDF B;  3CD6 A;  4LFB Q;  2N3S A;  3F2B A;  4B3M L;  3EIV A;  3M4Q A;  2OTL A;  3J7A 5;  2CKZ B;  5IYB H;  3TRZ A;  1L1O C;  1SLJ A;  2YTX A;  3NEN A;  1M90 C;  1P8L A;  4J15 A;  4OO1 I;  4OO1 G;  1RL2 A;  1HR0 W;  4LF8 L;  5M5X H;  4DUY Q;  2KCM A;  4KHP L;  5IY0 A;  4LFC L;  1BBW A;  4AYB E;  3HOX G;  1OXX K;  4LUZ A;  2CFM A;  1X65 A;  4A3G G;  2KCT A;  4C3J H;  4YCW A;  4EQ5 A;  5GAG C;  4GLX A;  1S72 A;  1HZB A;  5EAY A;  4R4I A;  1WCM H;  2OQ0 A;  2WB1 E;  4LW1 A;  3CW2 C;  3S14 H;  5M3M H;  4QGU A;  4BY7 H;  3M4O H;  4DR4 L;  4B3T L;  1IL2 A;  1VQC A;  1EQQ A;  3HOW G;  2F52 A;  1X56 A;  3U50 C;  4JI5 L;  4O0A A;  1HR0 Q;  1B70 B;  3PO2 G;  2R7D A;  4IPH A;  4LUO A;  3RNU A;  1PYB A;  4YWL A;  4BXX G;  4QIW E;  1UE6 A;  2YTY A;  3AQQ A;  4X62 L;  4IOC A;  4BBS G;  1K73 C;  4DV0 L;  1Q8K A;  2XGT A;  4A3F H;  3I4M G;  4KHZ A;  2E8G A;  4P71 A;  1CKN A;  3A5Z B;  2B29 A;  1C9O A;  4ALP A;  1VQP A;  1N9W A;  1FL0 A;  1KL9 A;  1N34 Q;  2V1C C;  4YCV A;  4JI7 Q;  1KXL A;  4C3H H;  4EX5 A;  4QJF A;  4GOP C;  3NEM A;  4A3E G;  3RZD H;  5IWA L;  4DNI A;  1GVP A;  3K80 C;  4DR5 Q;  4LNQ A;  1YBY A;  1N36 Q;  2VQE Q;  4Y7N H;  1UE1 A;  1PFS A;  1Q46 A;  1YJN A;  4H02 A;  3CME A;  2E5L L;  4LF6 L;  2B63 H;  2JA8 G;  4LF5 Q;  5C4J H;  4DR2 Q;  1XMQ Q;  1EOV A;  3CF5 A;  1OXT A;  4HJ7 A;  4OXP A;  1TWC H;  2C35 B;  2JA9 A;  1G6P A;  3GDE A;  3CPF A;  1HNX L;  4JI6 Q;  3RLN A;  2R7F A;  1QUQ B;  1UEB A;  1FJG L;  4MTN A;  3HOY G;  2IY5 B;  4GKJ Q;  1B7Y B;  3GTQ H;  2Y0S G;  1MIU A;  2ZM6 Q;  2Z6K C;  1E7Z A;  3KF6 A;  1CKM A;  4DV4 L;  3ULP A;  4NXN Q;  1K8A C;  4A3C H;  5M3F H;  4DV5 L;  3T1H Q;  3PF4 A;  4A3L H;  1X54 A;  1SMX A;  2HIX A;  1O7I A;  4PZ7 A;  4AIM A;  2AMC B;  2K5N A;  1I5F A;  2AWN A;  3PF5 A;  1WI5 A;  3TQY A;  1K8G A;  1VQ9 A;  4OX9 L;  1XNQ Q;  2UU9 Q;  4IJH A;  1DGS A;  3HKS A;  3A74 A;  3UDI A;  4DR1 L;  1D8L A;  2JA7 G;  5FJ8 G;  4YY3 Q;  3KDF A;  3H0G G;  4AQY L;  3L0O A;  2UXD L;  5C0X I;  5HGQ A;  5C0X G;  5FLM G;  3J80 i;  4DR3 L;  4JI0 L;  3PGZ A;  4FDB A;  1GM5 A;  1XMO L;  1FVI A;  1CSP A;  3RLF A;  1GO3 E;  2ASB A;  1LUZ A;  5LMU Q;  3RR5 A;  2K5H A;  3CCE A;  3J80 c;  2EXD A;  2VQF L;  2ZJR A;  4DV3 Q;  4L5T A;  2GVB A;  2K50 A;  3ULL A;  4HJA A;  5DLQ E;  4YHH Q;  3GTL H;  2JEB I;  2Y0S E;  3FKI G;  1OXS C;  1LTL A;  2AKW B;  2VL6 A;  4PMW A;  4JI8 L;  1HH2 P;  4A3J G;  1MJE A;  1CKO A;  1KQS A;  2BH2 A;  2L15 A;  2DUD A;  3PUZ A;  4XTC S;  4DV1 Q;  4P73 A;  1I6H H;  3ZJY C;  3HOV G;  1W2B A;  2R92 G;  4APV A;  4A3B H;  1PH2 A;  4JI3 Q;  3GTP H;  4UP8 A;  4DV7 L;  1PV4 A;  1OTC A;  1TWA H;  5ELN A;  3HOZ H;  2UUC Q;  4R4T A;  3BZC A;  1K3R A;  4R4O A;  3WWV A;  1FGU A;  1HZA A;  2LXJ A;  4JBW A;  4LFB L;  5JJL A;  2JA5 H;  1SFO H;  1YEZ A;  4DV2 Q;  4B3R Q;  1PH1 A;  4DKA C;  1VQK A;  1X55 A;  4GNX B;  3I4N G;  1JE5 A;  2AHO B;  3CP0 A;  4DUY L;  2JA6 H;  1I94 Q;  4IFD J;  2E2J H;  3ER0 A;  4HJ9 A;  2UUA Q;  3RN2 A;  3HOU H;  1YIT A;  2IT1 A;  4BA1 I;  1A8V A;  4R1J A;  1XPU A;  3G71 A;  2VY3 A;  4OON A;  4A3D H;  1HZ9 A;  1CSQ A;  4K0K L;  5IP7 G;  4LWC A;  4LUV A;  1YHQ A;  3AFP A;  4X65 Q;  2WAQ G;  4MZ9 A;  1VQI A;  1LM0 A;  1Y1V G;  4ME3 A;  3J7Z C;  2EIF A;  3TEH B;  1VQE A;  3CCR A;  4IO9 A;  4GLA C;  4NXM Q;  1QUQ A;  1HR0 L;  4DV6 Q;  1P16 A;  1E1O A;  3KF8 B;  3Q8D A;  4BBR H;  4YWM A;  4OWT B;  4A3K H;  4OWW B;  4BY1 G;  4JI2 L;  1VQJ A;  3F2C A;  3KFU A;  1PH8 A;  1S3O A;  5ELO A;  3CCM A;  1V9P A;  3CAM A;  5IYB G;  1YJ9 A;  1N34 L;  4JI7 L;  3GTJ H;  2RF4 A;  2K14 A;  3PUX A;  2VNU D;  1UE7 A;  3I2Z A;  4JI4 Q;  3S1N H;  4RG1 A;  1QZG A;  1GD7 A;  2UXC Q;  4DR5 L;  1YHB A;  2VW9 A;  1VQ4 A;  1NE3 A;  4GS3 A;  1XPR A;  2VQE L;  1N36 L;  1VQ5 A;  1KRS A;  4B3S Q;  4BA2 I;  5M5Y H;  3T1Y Q;  1VCI A;  1Y1W H;  4LF5 L;  3K8A A;  4DR2 L;  1XMQ L;  2WAQ E;  2K5V A;  3NEL A;  1WCM G;  3UDF A;  3W1B A;  2CWA A;  3U58 A;  2R93 H;  5M3M G;  4BY7 G;  1WFQ A;  4JI6 L;  2ALY B;  3S16 H;  2K4K A;  3I4O A;  3K7U C;  2Q2T A;  4YCU A;  4GKJ L;  4X66 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...