4QL5A

Crystal structure of translation initiation factor if-1 from streptococcus pneumoniae tigr4
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
DVIEVEGKVVDTMPNAMFTVELENGHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of translation initiation factor IF-1 from Streptococcus pneumoniae TIGR4
rcsb
source organism Streptococcus pneumoniae
molecule tags Translation
molecule keywords Translation initiation factor IF-1
total genus 13
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ql5A00
2XGTA 1UEBA 5DLQE 4LF4L 2OQ0A 4PZ6A 2VUMH 1X54A 5C0XG 1P16A 2ZJPA 5C44H 3A5ZB 3JAMc 3G6EA 4A4IA 2AWNA 2Q2UA 2F52A 1YNXA 3KJPA 4JI8Q 3HOWH 5IYCH 2K5VA 2JA9A 3PGZA 1VQOA 4AH6A 4P72A 3CAMA 2YU9H 1YBYA 2GN5A 2ZTCA 4X6AH 1EUJA 4DR6L 2LXKA 4DUZQ 1QVGA 2JA6H 4A3MH 5IT9c 4BY1H 4JBKA 3G4SA 2HHHQ 3CCMA 1IBLQ 1XTDA 5IP9G 4K0KL 1SRUA 1HR0L 5K36G 4QIWE 3HFZB 4KI0A 2BA1A 3WWVA 2B63H 3M9BA 4UP8A 1MJCA 4IPDA 1YEZA 5E7NA 3NELA 3PIPA 5AJ3Q 3S24A 1K9MC 3S1NH 4BXXG 3L7ZC 4IOCA 1CSPA 1I50H 1MKHA 4DK6C 3HOYH 1IZ6A 4A3IG 2R7ZG 2WB1G 3KF6B 4NPSA 2HIXA 1IBKQ 2AHOB 1GO3E 3STBD 4DV6Q 3S17H 1QVCA 1AE2A 4XTCS 4JI2Q 2WB1E 3J81c 3CC2A 1YJWA 2VQEQ 1Q12A 4DR5Q 1HNZQ 3I4MG 2CWAA 2HIVA 4P73A 4JI7Q 3GTKH 1VS0A 2UUCL 1UE1A 5IYDG 1YVCA 4A3GG 2VS1A 1YIJA 3FKIG 3GD7A 1K8GA 5IYCG 4LFBQ 4C3JH 2YTYA 3HOXG 3CCJA 5M3FG 3I56A 1A63A 1EWIA 4JI0L 1XPUA 4GKJQ 4Y7NH 3NBHB 5IP7G 2IHEA 1VQAA 2N78A 2H5XA 4DV4Q 4DR3L 1Q81C 5FLMG 3K0XA 3MXNB 1D7QA 3K8AA 1HZBA 1GKHA 2I5LX 1KD1C 1HNXL 3CPFA 3H0GG 1A0IA 3GTJH 2RF4A 4DV5L 4LF5Q 1PH3A 4QGUA 1E1TA 2UXDL 2V1CC 2VY3A 3S2DH 4IOAA 2C35B 3DLLA 2CWPA 1W2BA 4NXNQ 1PH5A 2YV5A 2JA7H 3I7FA 1EQRA 3GTPH 1X3EA 1Q7YC 1K8AC 4IFDG 2MFIA 2D62A 2UUCQ 4A3JH 3E9IA 1C9OA 2Q2IA 3K81C 1XMQQ 3G48A 1WCMH 5GAEC 1OXSC 3IRBA 4JI4Q 3RZOH 4AIMA 5M5YH 3I55A 2D0PA 4WJ3M 1J5EQ 1X6OA 1XNRL 3HOUG 2VQFQ 1PYBA 4DR4L 1JJCB 3PO2G 1N9WA 4DV6L 4HJ5A 3J81j 3PUYA 2Z6KC 4APVA 1JMCA 1J6QA 3TRZA 4H02A 2PMZE 2A8VA 5JJIA 3HOVH 2NN6G 4KHZA 4C3IH 1NJIC 1M1KC 4JI1L 4LF6Q 4LFAQ 1HNXQ 3U4ZA 5M5XH 2KHJA 4JI5L 1KC8C 3EN2A 1YI2A 4O0AA 1I3QH 4MNOA 4R4TA 1Q1EA 5M3MH 2R93H 2IX1A 1XMOL 4DR1Q 5IWAL 1N32L 2ZM6Q 4JI3Q 3ERSX 3CCLA 3S1RH 1AH9A 4GKKQ 1PVOA 3TS0A 4A3DG 4B3RQ 1QVFA 3CCEA 1KRSA 5C0XJ 2NZOA 1P8LA 1Y14B 2JE6I 4DKAC 4X64L 1VQHA 3H15A 1G51A 4DUYQ 3GTQH 4GOPC 5C4XG 3GTMH 4IJLA 1HR0Q 3M4PA 1X56A 2MNAA 4LWCA 1N34L 4EQ5A 4POFA 3F2BA 1JE5A 2HHHL 3UDGA 4A93G 2YTVA 4DV3L 1Q82C 2R93G 1V43A 1N36L 2E5LL 1FGUA 4B3TQ 1LUZA 4EX5A 2UXDQ 3S1MH 2R92H 1N8RC 1C7YA 3B6YA 4LF4Q 4LF5L 4A3CH 1KAWA 4KLKA 1E22A 3GTOH 2IY5B 1JJGA 2ZM6L 5JJKA 1ASYA 2B63G 1TWAH 1X3GA 2CKZB 1UE5A 1X65A 2NVTH 4RG1A 3VDYA 1KQSA 1RL2A 4LF7Q 2D0OA 4TVAB 1W3SA 3CMEA 4A3JG 2ZTEA 2JA7G 1VQNA 4LFBL 3KF8B 4NXML 2R7ZH 1PFSA 3M7NA 4DUYL 4IFDI 2PQAA 2R7FA 3SGIA 1VQPA 1IBMQ 4OWXB 2BH2A 1G291 1Q86C 2B29A 4UP9A 2IHFA 2UUAL 4JCVE 4YCUA 3AQQA 5M5WH 4BY7H 3EBEA 1CKOA 2UXCQ 4JI7L 4DR2L 2UUBL 4KHPQ 1SN8A 1XPRA 1PA6A 2KENA 1K0RA 2UXBQ 3Q8DA 4YHHQ 1TXYA 1Y1WG 4DR1L 2F4VL 3EIVA 5FLXc 4R1JA 2IX0A 2N3SA 5J3BA 2IT1A 5LMUL 4LF8L 3U4VA 1U5KA 1UE6A 1TWGH 4GOPA 1KXLA 1CKMA 3LGJA 1CUKA 4YCVA 3FP9A 1L1OA 2JA6G 2JJQA 1SE8A 1PH4A 2NN6I 4GNXC 3NENA 1G6PA 5IE8A 1FJGL 3GDEA 4YWKA 3BJUA 1OXVA 3J81i 2VQFL 4A76A 2ID0A 3ULPA 1XPOA 4A3CG 2CFMA 3HOUH 2Y0SG 1NTGA 4KHPL 3M3YH 3CCRA 4DAYB 3DM3A 5EAYA 1PH1A 3CD6A 1IYJB 4A3KG 3W1BA 2DGYA 3T1YQ 3HOZH 2K75A 2WAQE 3PUWA 4LFCL 3W1GA 4P71A 2JA8H 2K14A 1VQ8A 4A3IH 2I5MX 3ER0A 1UWVA 2PI2A 3RLFA 1S40A 2BH8A 1I94L 1HNWQ 5IP7H 3K7AH 4JBMA 4YY3L 5FLMH 1S72A 4GKKL 1MIUA 2ZJRA 1T9HA 1SMXA 4DV2L 3RNUA 1VQMA 1EYGA 2WP8J 1FVIA 4GN5A 3RR5A 2RCNA 1K3RA 4BA1I 3H0GH 3E0EA 5IYDH 4MZ9A 2LXJA 1PHJA 4NXNL 3AEVA 4AQYL 1WI5A 2K50A 3ULJA 5HY6A 3UDXA 2NVXH 4LF9L 4HJ7A 4LW1A 2I0QA 4GKJL 4LF9Q 1EIYB 2Z6KA 4IPGA 2JA8G 1OTCA 1XMOQ 3HOYG 4DV3Q 4DR4Q 3HOXH 3PSIA 1X55A 2ES2A 1D8LA 4B3MQ 4LFAL 4DV0Q 4YHHL 3F2CA 1PH6A 1ASZA 1LTLA 4QL5A 1VQIA 4DV2Q 1EFWA 4A3DH 1QUQA 3STBC 1LM0A 1OXUA 3UDFA 3KDFB 3T1HQ 3F2DA 2R92G 2Q2HA 4WJ4A 3RLNA 2K5NA 2Z0SA 4DV1Q 2VNUD 4ALPA 2Q2TA 2ZTDA 1WYDA 2EXDA 1NY4A 3KOJA 4QY7A 1E1OA 1VQEA 2KBNA 4NB3A 4JI3L 4JOIC 5C4JH 1VQBA 4BY1G 5AJ3L 4AQYQ 5JEAJ 4BA2I 1HZCA 4X66L 5IY0A 1I5FA 3F8TA 4PG3A 3M4QA 1IL2A 3KFUA 3BZKA 4A3MG 2HQLA 3CCVA 1AE3A 4PMWA 2QGQA 4YY3Q 3RN5A 4UPAA 2RHQB 1CKNA 4P74A 3G71A 5C44G 1VQ5A 3PO2H 4JBWA 3H3VI 2B3GA 3PUXA 2KHIA 2RHSB 2Y0SE 4DV4L 1L1OC 2JA5H 1FL0A 5M3FH 5BR8Q 4MTNA 4X65Q 3J80c 1BBUA 2UXCL 3S1QH 4JC0A 3K7UC 4GNXA 1H95A 4L5SA 2JEAI 2AKWB 3PUVA 4IPHA 2VQEL 3CC4A 3U50C 2OWOA 1XJVA 3CP0A 1MJEA 4LFCQ 5C0XI 2L15A 3CMAA 3TS2A 2OCEA 4GN3B 4A3FH 3PF4A 4QQBX 4A75A 2E2HH 2UU9Q 4L5RC 1WFQA 2VL6A 4BBSH 2A19A 5LMUQ 1K73C 4OWWB 3PCOB 1KIXA 1HJPA 1VQCA 4DV7Q 2K4KA 3A74A 2JA5G 1QUQB 3FKIH 3ICEA 1SROA 5H1SE 2KCTA 3J7ZC 4A3LH 1KL9A 2UUBQ 4YWMA 1OXXK 4JI1Q 1YJNA 2MO1A 4O2DA 1YITA 4LUOA 1A62A 4OONA 3PIOA 1BKBA 2NZHA 2XTIA 1GM5A 1I94Q 1TWHH 4BY7G 1HH2P 1XNQL 2WAQG 4DR7L 1XNRQ 3M4OH 4DUZL 1XNQQ 3PUZA 4GN4B 4LUVA 1V9PA 4PZ8A 3OTOQ 4JV5L 4JI4L 4C3HH 3I2ZA 1SLJA 3ZJYC 4X65L 5LMNW 3F1ZA 1X3FA 3TREA 1N33Q 2ATWA 3CXCA 4LF7L 1TWFH 2EQSA 1WOCA 4LUZA 4DV7L 4OO1G 4DR6Q 4AYBG 5C3EG 4XIGS 4UP7A 1PH7A 5FJ8H 3TQYA 4YCWA 3D0FA 5IYBH 1K83H 4AYBE 4B3SL 2N8NA 1GD7A 4GNXB 2QA4A 2NVQH 1QZHA 1PYSB 4DK3C 3I4NH 2EIFA 3U58A 4UY8C 1N32Q 1S3OA 5GQOA 1B70B 4GLAC 4Y52H 1SR3A 4RMFA 1KRTA 3HOZG 1UE7A 2NVYH 4BBRH 2HT1A 2R7DA 3D31A 4DR2Q 4DR3Q 1NBWA 1CSQA 4IFDJ 4HJAA 3CF5A 4JI0Q 1L0WA 1A8VA 5M3MG 3S15H 3CCUA 1CKNB 3BU2A 4HIMA 2VZAA 3KF6A 2E2JH 4GLVB 3S2HH 1WJJA 4DV1L 4JI6Q 4NXMQ 1N34Q 4C2MH 3A0JA 1SFOH 1EQQA 3K80C 4HIDA 1XMQL 1E24A 4JYAQ 1Y1VH 3PO3H 3UDIA 5LMNL 3H3VH 3HKSA 1VQJA 4R4CA 2R6GA 4DV0L 3PO3G 4BBSG 4GS3A 2DUDA 2N49A 4IJHA 4X66Q 3A5UA 3I4NG 1TWCH 2F3IA 1E7ZA 2GVAA 2YTXA 2ZJQA 3RN2A 3UE0A 1C0AA 1YHAA 4GLXA 3JC66 1PH8A 4X62Q 1Z9FA 4QJFA 2E2IH 5ELNA 2E5LQ 4B3TL 1NE3A 1Z47A 1NMFA 1JJ2A 1N33L 4A3LG 3J80i 4POGA 1EOVA 3PV0A 1YZ6A 1VQFA 1X9NA 2KCMA 3BZCA 3M85A 4YWLA 5BR8L 4JV5Q 1I6HH 1L1OB 1VQLA 3FHWA 4BBRG 3JAMi 1YJ9A 4X64Q 1HNWL 1IBLL 1Y1WH 3OW2A 4A3GH 3RLOA 1VQGA 3E9HA 2JEBI 4BXXH 4B3RL 2AMCB 4OX9Q 4J15A 1L2FA 2WFWA 1IXRA 3T1YL 4OXPA 3S14H 2BA0A 3AFQA 3KJOA 1PH9A 2UU9L 1RIPA 1V1QA 3KYHC 4JI8L 5IWAQ 4DR5L 1VQ6A 4A93H 3GTGH 4OO1I 3W5OA 4HJ8A 4JI5Q 3I4MH 5IP9H 1VQ4A 2A1AA 1NMGA 3KLWA 4X62L 4L5TA 3CCSA 3L0OA 3CC7A 3RZDH 2OQKA 2MO0A 1QZGA 4LF6L 4HJ9A 5GAGC 4A3EG 4OWTB 4R4IA 1B7YB 1PV4A 4IPCA 5JJLA 3L2PA 3MEFA 1J5EL 4JI6L 4DNIA 1KHIA 3HKZG 2LSSA 1M90C 1VQ9A 2F4VQ 3HOWG 3AYHB 5C3EH 1O7IA 3AFPA 3HKZE 4JG2A 1PH2A 3ULLA 3I4OA 5ELOA 1VQ7A 3S16H 5FJ8G 1LYLA 1E3PA 4JOIA 1YHBA 4R4OA 5IYBG 2CCZA 4B3ML 4ME3A 5GROA 4JI2L 2MQHA 1VQDA 1EIFA 1GVPA 2ALYB 2OTJA 1IBKL 4A3KH 4JBJA 4A3EH 4TQUS 3OYYA 4P75A 5C4XH 4DV5Q 1HNZL 2GVBA 4B3SQ 1VQKA 3J7A5 3CPWA 2AWOA 2PQAB 1HZAA 3HOVG 3CW2C 2FXQA 1BVSA 1DGSA 4FDBA 5HGQA 2PNHA 5LMNQ 1OXTA 4HIOA 4LNQA 2YYZA 3CCQA 3GO5A 1WCMG 4JYAL 3CQZH 3KDFA 1HR0W 1Q1BA 4OX9L 4K0KQ 4LF8Q 2JQOA 3NEMA 2UUAQ 4IO9A 3GTLH 3PF5A 1JB7A 2VUMG 1N36Q 2UXBL 4R4QA 2E8GA 1Y1VG 5GADC 1YHQA 4DR7Q 1JT8A 3T1HL 1Q8KA 2CQOA 2I5HA 4HIKA 4A3FG 1BBWA 4DAMA 4GOPB 1HZ9A 2OTLA 2JK8A 3TEHB 3OTOL 2VW9A 4A3BG 1U0LA 5JEAG 1IBML 4DPGA 1VCIA 4A3BH 5GAHC 1FJGQ 4PZ7A 1Q46A 2K52A 2ASBA 3UE1A 1B8AA 1R9TH 2PI2E 2K5HA 4L5QA 2QEXA
chains in the Genus database with same CATH superfamily
1D5ZC 1UEBA 4LF4L 4A3IB 5CC4A 3TP8A 1HTLD 2QW7A 1B3AA 1H9JA 1ENCA 3PGZA 4AH6A 4P72A 5IYCH 5EQ0A 2GN5A 2ZTCA 2WACA 3M3YB 3LWUA 1M4VA 1EUJA 4DUZQ 3PQIA 3S2DB 2JP1A 5IT9c 4FXGC 3EVQA 5JVG3 4RWSC 1AFPA 1BCPC 4KI0A 2BDNA 2HCCA 1Y1VB 2DN8A 1CTMA 2B63H 4IPDA 1SE2A 1YEZA 1D6EC 1AW7A 2DNEA 5E7NA 3NELA 4WFN3 2WV6D 4C3JG 5AJ3Q 1I50H 4PV1C 4XQNA 2B39A 2WB1G 4HN7A 1IBKQ 3S17H 1QVCA 2WB1E 4H0LC 2A69D 2CWAA 2HIVA 4P73A 2NVTB 1LTID 4H7BA 1VS0A 3IFDA 2VUMB 4MN3A 1HFNA 1UE1A 3CRLC 3HRZC 2Z4IA 3FKIG 5IYCG 1DYQA 2GA4B 3CCJA 2L0CA 2BDOA 2G9DA 3I56A 2O5JC 4Y7NH 3NBHB 3K0XA 4I7AA 3K8AA 1Y1WB 1GKHA 1LLRD 4JPBW 2G5DA 1A0IA 4LF5Q 1S5BD 1DD2A 1E1TA 1I4GA 1WTPA 2V1CC 5I4DA 2P5ZX 3Q6SA 4FXDA 2YV5A 3K58A 1Q7YC 1B4OA 1F9RA 1GOZA 1SSOA 1NAPA 1RJTA 2C5CA 4JI4Q 5C4XB 2D0PA 4WJ3M 4X3UA 1XNRL 3HOUG 4DR4L 1JJCB 4DV6L 3J81j 4APVA 2Z6KC 1JMCA 2QEJC 4H02A 4C3IH 4LFAQ 4TKOB 1HNXQ 1YI2A 1XMOL 2SDFA 3M4YA 3EQLC 2B2UA 5IT9E 3GTKB 2ZXRA 3TZDA 1Y14B 5IGGA 4DKAC 1VQHA 3GTQH 1LACA 1I6VC 4KD4A 3T13A 1SJED 5ELCA 5JJZA 4EQ5A 2OF1A 1JE5A 2HHHL 3A8KE 2O2LD 1V43A 1TQOA 1N36L 4B3TQ 2EYFA 4E6IA 3S1QB 1DONA 1N8RC 1TT2A 1JB3A 1E22A 4CKEA 4U673 1X3GA 5I2XA 3K5NA 2CKZB 1JE4A 4LF7Q 4KD3A 2D0OA 2K28A 4CJ0B 3A7AB 3S17B 1VQNA 2DJFC 4LFBL 2R7ZH 2F0OA 3SGIA 3RD4A 2BH2A 1G291 4JCVE 4R8IA 3A55A 3S1NB 4KHPQ 1SN8A 2Q8IB 5JOBA 2F4VL 4YHHQ 2KEDA 4DR1L 3EIVA 4LF8L 1UE6A 3NTKA 4GOPA 1ESFA 4YCVA 2JA6G 2JJQA 5C4HA 1SE8A 4WJWA 2NN6I 3NENA 5IE8A 4YWKA 2VQFL 1XPOA 1DOLA 2JXMB 2Y0SG 4Z9CB 4DAYB 1PH1A 1IYJB 3PUWA 1CA6A 2R3ZA 5IT9L 2J7ZA 4ZLTF 3ER0A 3AMUA 2PI2A 1STEA 3RLFA 1I94L 4C1NI 3VR3A 3BS1A 2E2HB 1MIUA 2ZJRA 1T9HA 1PZKD 2BCOA 3H6MA 2WP8J 1EYGA 2RCNA 4EQNA 1F77A 2L4NA 4BA1I 3H0GH 1ZYRC 1CQFA 1Y8PB 3AEVA 4AQYL 1JOKA 2RSOA 4CDDC 2AQ1B 3RMHA 4LF9Q 1QWYA 2JA8G 1E0BA 3HOXH 3PSIA 4RGNA 2ES2A 5KNDA 1S4ZA 3A8JE 4EQPA 5ELEA 4DV2Q 1IYUA 2B8FA 1TR5A 3STBC 1JQYD 3KDFB 2A6ED 1IW7D 1TWCB 1EFID 2K5NA 2Z0SA 3R8BA 5F2DA 1K83B 1PRTC 4C3IG 2ZTDA 1WYDA 2EXDA 1NY4A 2KBNA 2OT2A 1LT3D 2L55A 3X3MA 1EY6A 1BCPF 3BDCA 4X66L 1CI3M 4PG3A 2E2DC 3KFUA 3BZKA 3MXPA 1ET6A 2HQLA 3I4LA 4YY3Q 1LT5D 4UPAA 4HSPA 5C44G 1F9QA 4JBWA 2VB2X 2RHSB 4H13C 3C1EA 3SK5A 2JA5H 1FL0A 5K5PA 4MTNA 3VYTA 2R92B 1BNZA 4GNXA 1VF7A 2JEAI 2VQEL 3HOVB 1GXDC 3VR2A 5JVH3 3L9AX 3A8IE 4GN3B 2UU9Q 1WFQA 5I6YA 5LMUQ 1K73C 1TKWB 3PCOB 1SNPA 1DJRD 1QUQB 4MHEA 3J7ZC 4A3LH 1AP0A 1QG7A 4YWMA 1YITA 1A62A 1JOQA 5D65A 2NZHA 3HOUB 1XNQL 1STBA 1D5MC 3CHBD 4CDEC 3VR4A 1XNQQ 3PUZA 4L6TB 2QDLA 3I2ZA 2FJ2A 4X65L 2X6GA 5I9OA 1B3QA 2EQSA 4HCEA 2KQ3A 5CYUA 4OO1G 1QNUA 4DR6Q 5C3EG 1PH7A 1SYFA 3TQYA 1O7YA 4YCWA 3P75A 1K83H 4B3SL 4GNXB 2NVQH 1QZHA 1Q3LA 3Q0AA 3K6OA 4UY8C 1N32Q 1IHZA 1Q90A 3KBGA 1CFMA 2HT1A 3OWFA 4C3HG 4DR2Q 1H9KA 4DR3Q 3TN2A 1EEFD 3BVGA 3HOXB 1L0WA 1A8VA 5JPNC 3BVZA 4OHJA 3S15H 3C3LA 3KF6A 1WJJA 2K5WA 4NXMQ 2D9UA 4C2MH 4HIDA 3FRPB 3DMUA 2Q8RE 2FMMA 1B44D 3UDIA 1ILPA 4TSSA 3HKSA 3J80E 4Y7NB 4GS3A 2EYPA 2XN9C 3UI2A 1DXMA 4F88A 4K5VA 2YTXA 1C0AA 3RN2A 3UE0A 1YHAA 2PW5A 1Z9FA 2CVRA 4X62Q 1NMFA 2B8GA 1VQFA 1I6HH 4DNRB 3M85A 4KMUC 4YWLA 5BR8L 4Q5VA 1HQRD 4JV5Q 2PNRC 4P2CB 1PXUA 4X64Q 1Y1WH 4FF1A 3E9HA 4B3RL 2FHTA 1L2FA 3R93A 1C48A 4A3EB 3AFQA 1PH9A 1K8OA 5IWAQ 4A93H 4JI8L 1VQ6A 2Q8TA 4DR5L 5NUCA 1B9NA 3W5OA 5M5YB 3ONAB 1QE6A 4J1MA 1VQ4A 1NMGA 1Y69U 4X62L 4L5TA 3CCSA 3L0OA 3RZDH 2MO0A 1EYDA 1CZGA 4OWTB 1PV4A 4RKLA 1XX8A 3D6CA 4JI6L 3LX0A 1KHIA 1VQ9A 4EGVA 1M90C 2K7VA 5HGTA 2F4VQ 2KA7A 4ULLA 3AYHB 5M3MB 3ULLA 4QIWB 1PH2A 2SNMA 1TWAB 2SEBD 4B3ML 4ME3A 1GHJA 5GROA 4K2LA 2MQHA 1EIFA 2ALYB 1STAA 3OMGA 4A3EH 1TWFB 2DY8A 2XNAC 4P75A 3SDZA 3V2TA 2EOTA 4XT3B 1BVSA 1DGSA 1D1KA 3CKIB 1A2UA 2YYZA 3BDLA 3GO5A 4FF2A 2F0NA 4JYAL 3CQZH 3KDFA 2LKVA 1HR0W 4OX9L 1C4QA 2F0MA 1SNDA 2JQOA 3PF5A 1JB7A 2HCIA 2VUMG 1N36Q 4R4QA 2E8GA 2K5QA 3T1HL 2WAQB 1Q8KA 4DAMA 5LHY1 1GUWA 3BYTB 3IFTA 1TIID 2JK8A 5T1GA 3TEHB 1PZJD 2VW9A 3IAYA 5JEAG 4DPGA 5COYA 1PRTD 1Q46A 3UE1A 2K5HA 2A6EC 1G2TA 5G3LD 4NMZA 1NUCA 1X54A 5C0XG 1P16A 1PTOF 1S5ED 3JAMc 4XYQA 2NYZD 5A2QE 4JI8Q 1BXTA 4LJZC 5CV4A 1VQOA 2YU9H 4N8FA 3PO2B 4X6AH 4CHTB 2H1EA 2LXKA 1QVGA 2CW0D 1Y8NB 1I3QB 2F1MA 4BY1H 3CCMA 4N9TA 4K0KL 3HFZB 3V05A 3FDTA 1K9MC 3S1NH 1EY0A 3L7ZC 3VA7A 4IOCA 1CSPA 1MKHA 3HOYH 1HRJA 3S15B 3KF6B 2B2VC 3STBD 4DV6Q 1YJWA 1EY4A 1QNKA 4JI7Q 2D2CC 4HR7B 5C5LA 2QDBA 2E2IB 2UUCL 4A3GG 4K14A 5FO9B 4A3FB 2XVSA 4C3JH 1SYBA 2YTYA 5IGEA 5M3FG 4A3BB 1XPUA 1BF4A 3MTSA 3MWYW 5IP7G 4FF4A 4KJNA 4DR3L 2WKDA 3D3RA 1HZBA 1LTAD 1SXTA 3D4WA 4F8MA 3A56A 5J1ZA 4DV5L 4DN4M 3I91A 5EGTA 4QGUA 4LMQD 2UXDL 3GTMB 4IOAA 4RAUC 2R7ZB 1W2BA 1KNEA 2JA7H 3I7FA 2CHBD 2J4XA 1X3EA 4IFDG 4G57A 3I70A 4A3JH 3ND8A 3E9IA 1TS3A 3E5SA 2XWJB 5C4JB 1RDPD 1LV9A 5M5YH 1J5EQ 1PYBA 3S1MB 3PO2G 1N9WA 2KJXA 4X3SA 2F0GA 3TRZA 1J6QA 2HD3A 5E3FA 1M1KC 5JJKA 4CKCA 4DF7A 3EN2A 4MNOA 5M3MH 2IX1A 2ZM6Q 1F9SA 3TP6A 4DA2A 4DK1A 1NR2A 3TS0A 2JA7B 1MD2D 1J8IA 4S3SA 1KRSA 2NZOA 2JE6I 5CBEE 1LTSD 5C5MA 2MHVA 3J7AV 4DUYQ 2PZTA 5BN5A 2N55A 4IJLA 1HR0Q 4A93B 4POFA 3UDGA 4DV3L 2F0TA 4M1UB 2UXDQ 1UUPA 2R92H 2BE5D 5DM63 1C7YA 3SVMA 4LF4Q 4A3CH 1MSHA 3GTOH 1ASYA 2B63G 1M8AA 1UE5A 4KJOA 4I65A 3E3XA 4PMCA 3CMEA 3QB3A 4A3JG 3KF8B 1F2LA 1EY9A 3M7NA 1S5DD 4DUYL 2PQAA 3VR5A 1NR4A 1VQPA 3SEBA 1LTRD 4RCNA 1JR0D 4UP9A 2IHFA 1JWSD 4BBSB 3AQQA 4U68A 1CKOA 2UXCQ 4HMJA 4JI7L 2UUBL 1B53A 4FXKC 3NHHA 1K0RA 3Q8DA 1TS2A 4R1JA 5EPJA 2N3SA 1I4QA 2IT1A 4NP5A 3U4VA 1U5KA 1KXLA 1RTOA 1SYGA 3MC0B 4GNXC 2O5IC 2ID0A 2OXPA 4FNFA 4A3CG 4KHPL 3HOUH 1IYVA 1J9OA 1AEXA 3T16A 3K5OA 1JCKB 3PIO3 3J80L 2K75A 3W1GA 4XT1B 4UHVA 1I50B 2BH8A 3URYA 1SNCA 4ZK9B 5IP7H 3J81E 2N88A 3K7AH 4KK7A 4JBMA 4KKUA 4YY3L 1BCPD 3RNUA 1VQMA 3HGBA 4GN5A 3IKJA 5IYDH 2LXJA 1PHJA 5HY6A 2NVXH 4LW1A 1HTPA 4GKJL 2Z6KA 4IPGA 3OIPA 1X55A 4B3MQ 4FP5D 4YHHL 4C1NK 2EY1A 3F2CA 1PH6A 2NVYB 1ASZA 1VQIA 1EFWA 2ZXPA 4AYBB 1LM0A 3F2DA 2XRSD 3RLNA 5ELBA 3DHQA 2QCPX 4NB3A 2PPBC 2EYHA 3KLSA 1VQBA 4BY1G 1I4HA 3F8TA 1H9RA 3D8GA 5FKAC 3SK8A 3GTPB 1Z7TA 2QKIC 3R3OA 1MHWC 4R9WA 5IODA 1IKLA 1CK1A 1CKNA 1STYA 2B3GA 2RBMA 3PUXA 5C44B 2Y0SE 1NCVA 1X3QA 3NTHA 5BR8Q 4X65Q 4JC0A 3SK4A 3DM1A 4QF4A 1R9TB 4IUTA 2AKWB 3PUVA 3VYSA 3CP0A 4LFCQ 1STNA 5HURA 3TS2A 3NTIA 4A75A 2VL6A 3GTQB 5LL6X 4OWWB 4IQZA 4DV7Q 2JA5G 1EEID 3ICEA 1DOKA 1PTOC 1KL9A 2UUBQ 2MO1A 4O2DA 4OONA 3QJYA 3PIOA 1TWHH 1G6ZA 4DXGA 2WAQG 5E4XA 3M4OH 4LUVA 4PZ8A 3OTOQ 4ZCKA 4JV5L 2K01A 5A2QL 2PYKA 2DY7A 3I4NB 1SLJA 3ZJYC 5D3DA 3GTGB 5LMNW 1X3FA 1SNOA 4RA8A 4H44C 3CXCA 4LF7L 1TWFH 1RCVD 2CQAA 3I4NG 1S5FD 1NNXA 4OELB 4DK3C 3K57A 3U58A 1TS5A 2RDHA 5GQOA 1B70B 4Y52H 3C2PA 4ID6A 2MJ8A 3A7LA 2Z4HA 3D31A 1TVXA 3H3VC 3DXJC 1D2BA 5M3MG 2NN6H 3CCUA 5J22A 1QILA 1U4PA 1HA5A 2B2UC 1YNJD 3GTJB 3CRKC 3A0JA 3MXUA 3TP7A 3TSSA 1EQQA 1XMQL 4G7OC 2A73B 5LL6S 1Y1VH 2B63B 3PO3H 3DUZA 1RF2D 4R4CA 4DV0L 1SDFA 2DUDA 4IJHA 4ZYSA 4R8NA 2F3IA 2R61A 2X69A 3LWEA 4GLXA 1PH8A 1A3VA 2E2IH 2E5LQ 2MP1A 1JJ2A 1TWHB 3F2UA 1BCPB 1STHA 1SE4A 1LT4D 3BZCA 4JK1C 3S1RB 1HQMC 1ZXTA 1VQLA 3FHWA 2K03A 4HEDA 1WTXA 1SBBB 2JEBI 4BXXH 2AMCB 1W6KA 4J15A 2WFWA 3PO3B 2V4DA 2F0QA 2KECA 4OXPA 3S14H 1FR3A 1TU2B 1RIPA 4K6DA 3KYHC 3Q24A 3GTGH 2NBFA 2EE1A 3C1FA 4JI5Q 3I4MH 5IP9H 1LTBD 2MUYA 3V96A 1QZGA 3CC7A 2K5DA 1OO9B 1B7YB 1BBXC 3R2TA 3NWSA 3A54A 1J5EL 3WOFA 4DNIA 2LSSA 2A68C 2F0KA 1O78A 5C3EH 5ELFA 1O7IA 3AFPA 1LABA 3OW7A 5ELOA 5FJ8G 5KEEA 5IYBG 1YHBA 2CCZA 2XWBB 4XXEA 4DAVA 1MGSA 1GVPA 1IBKL 1EYCA 4GZYC 4KV6A 2H4OA 4TQUS 2L12A 4B3SQ 1HNZL 3C46A 1ICWA 1HPCA 2PQAB 4XYOA 3M7GA 1E2ZA 1OXTA 4LNQA 2EYMA 3CCQA 2QILA 1WCMG 3MXGA 1Q1BA 4K0KQ 4LF8Q 1EOTA 2UUAQ 4IO9A 2CQOA 3N52A 2I5HA 4A3FG 1BBWA 4GOPB 1D1IA 1HZ9A 2OTLA 2PMZB 4A3BG 1LT6D 1U0LA 3MXNA 1EL0A 1TS4A 5EBDA 5GAHC 2K52A 4DU9A 1R9TH 2F4IA 2PI2E 5EKIA 3S1MH 1X9NA 2ICIA 5DLQE 4PZ6A 3K59A 1GUOA 2VUMH 5C44H 3A5ZB 4A4IA 2AWNA 2Q2UA 1GUGA 2F52A 3DWPA 3I72A 4FO2A 3BZDB 3H09A 2K5VA 2JA9A 5CR3A 2RDFA 4DR6L 2JA6H 1SYEA 2NVQB 4JBKA 2HHHQ 3VYUA 3RZDB 2NTSA 1XTDA 1HR0L 5K36G 3KUPA 2MPMA 1RHPA 2BA1A 5IIFA 1HUNA 4UP8A 1YNNC 4ME5A 1JWUD 1PMRA 3PIPA 3FEWX 4HSVA 3S24A 1MI2A 1FNVA 5CMDA 2D5DA 1PRTB 2ZXOA 2WB1B 3EJIA 2K6AA 4XTCS 1AE2A 2HDLA 3J81c 4EQOA 3CC2A 1CQVA 1PTOD 1HNZQ 3GTKH 3T4AC 3FKIB 5IYDG 2LFNA 1YVCA 4CKBA 2VS1A 3HEJA 1JWMD 4OO1H 4LFBQ 1QJOA 2XSCA 3Q22A 5KIXA 3HOXG 3NSWA 4GKJQ 1ZKOA 2IHEA 1VQAA 2N78A 2H5XA 2RSNA 3NUCA 1SAPA 3SE0A 5FLMG 1D7QA 3MXNB 3NBIA 2I5LX 4RFBA 1KD1C 1HNXL 3CPFA 3OPOA 2XRQD 2F0DA 5CV6A 2VY3A 3DEPA 2A6HC 3R2IA 2C35B 1Y8OB 1I4PA 3I8ZA 1PH5A 2B2YA 1U4LA 2D62A 1C9OA 2F0UA 2Q2IA 2VB3X 3K81C 1XMQQ 2KUMA 3G48A 2IX3A 1X3PA 3RZOH 4AIMA 3I55A 3I4MB 4ZQ3A 3KLSX 2VQFQ 3HG9A 3PUYA 5FLXL 1V1OA 2PMZE 1WTWA 5JJIA 2NN6G 1WD1A 4QB4A 5BN4A 5M5XH 4JI5L 1I3QH 3OWEB 4J6HA 4R4TA 3TDQA 2R93H 1I4XA 4DR1Q 3NE5B 1N32L 4JI3Q 2F0WA 1WTQA 3S1RH 1AH9A 4GKKQ 3T53B 1PVOA 4KY6A 2IJ0A 3NP8A 1QVFA 3AU7A 1BQQT 1P8LA 4BWGB 1G2SA 5L37A 3H15A 1G51A 2F0JA 5C4XG 3GTMH 2MNAA 4LWCA 4X3TA 1EY7A 1N34L 1VMCA 3J7AF 4A93G 2YTVA 3ITPA 1FD7D 2E5LL 1PFMA 4EX5A 1TY0A 4FYDA 3B6YA 4KLKA 3K7AB 4CDCC 1WVLA 2IY5B 1JJGA 5C4ZA 1BUVT 1TWAH 1WCMB 1ENAA 3H94A 3MZ5A 3TP5A 3S2HB 1GUSA 3OSOA 2NVTH 4RG1A 2JA6B 1RL2A 1E2VA 3BDOA 1W3SA 4NXML 4IFDI 5BN3A 1SMYD 4XQJA 4OWXB 2UUAL 1G91A 3NXWA 3EBEA 2R93B 4K6LA 1A3TA 2DNCA 5CBAE 1XPRA 2M2LA 1TXYA 5TSSA 5IGBA 5LMUL 1B1ZA 1EU4A 5CV9A 1CKMA 5M3FB 1A2TA 1CUKA 2IW3A 1L1OA 1SMYC 3FP9A 3QG1A 1PH4A 1I4RA 1FJGL 3GDEA 3BJUA 3J81i 2CW0C 4A76A 4CJ1B 3U9SA 3ULPA 1K3BC 2CFMA 1WD0A 3CCRA 5C3WA 3DM3A 3NPPA 5EAYA 3CD6A 2MGSA 3HOZH 3W1BA 2WAQE 4P71A 2K14A 4A3IH 2I5MX 1UWVA 3NWTA 1S40A 2L11A 1HNWQ 4HMIA 4ILWA 5FLMH 1S72A 4GKKL 1EIGA 4DV2L 1SMXA 1WTVA 1FVIA 1SNQA 1KDAA 3SHLA 1K3RA 1PLFA 4MZ9A 4IUVA 4NXNL 1WI5A 4ODGA 4LF9L 1XXGA 1I6HB 1KNAA 1C8CA 2I0QA 4IN3A 3JAME 1OTCA 1XMOQ 4Q0FA 3HOYG 3OOCA 1VDZA 3I90A 4LFAL 2PCFB 3W3AA 5A35A 4QL5A 1OXUA 2R92G 1CHPD 3T1HQ 3GTOB 1Q8IA 1IKMA 4DV1Q 3MEHA 4K8JA 2E74C 2VNUD 1FNWA 2Q2TA 2L9HA 4JW0A 2Z1CA 4QY7A 1ONLA 1UEAB 4ZUIA 4ZAIA 4AQYQ 5AJ3L 3T51B 3Q23A 5JEAJ 5IY0A 1KAAA 2E2JB 4BS9A 1IL2A 4A3MG 4QCLA 4V0BA 2J0TD 3CCVA 2QGQA 4DAYA 1DOMA 4RKBA 4CJ2C 4P74A 5FO7B 3G71A 4HTHA 2KHIA 2TSSA 1KLUD 1ICFB 5M3FH 2EPBA 3J80c 1EY5A 1HCZA 2EVBA 2UXCL 1O7ZA 4DXFA 1H95A 4L5SA 1SJHD 5E1FA 3U50C 3GV3A 1ESRA 4HCSA 2VXWA 4KHVA 5C0XI 2L15A 4QUCA 5KYLA 2OCEA 2LY7A 5JPMC 3CMAA 4QQBX 4L5RC 2LMCB 1KABA 4PQXA 2A19A 3HP3A 4KY7A 1KIXA 1HJPA 3U9OA 1UAPA 3A74A 1Z6HA 4WORA 1SROA 2I46A 2E75C 2KCTA 5M9OA 4IFDH 2JA5B 1HHVA 4JI1Q 4LUOA 1I94Q 3MAQA 4DR7L 3T56B 1XNRQ 4IALA 1V9PA 2RCFA 1EY8A 4JI4L 3HOYB 1SNMA 2WIIB 4NDXA 5D3IB 3F1ZA 5DNFA 3TREA 1N33Q 2ATWA 1WOCA 4AYBG 1T5EA 1F2ZA 3G6JB 3OIQA 4QUFA 1B2TA 4AYBE 3FVQA 1S5CD 1GD7A 2N8NA 3HKZB 5CV8A 1PYSB 2B2WA 3I4NH 2EIFA 2EDGA 1PDQA 5CORA 4ABNA 3MVVA 4GLAC 4RMFA 3HOZG 1EYAA 1NBWA 1CSQA 2A6HD 4IUNA 4L63B 2WINB 3GP7A 4IFDJ 3CF5A 1EZ6A 1JICA 1CKNB 3BU2A 2VZAA 2PO4A 2WKCA 3E6ZX 3EA6A 5C6AA 2E2JH 4JI6Q 1PRTF 2KOLA 1N34Q 4F7XA 1SFOH 4ZKBB 4JYAQ 1VQJA 3PO3G 3TZUA 3HZXA 5ELDA 1WTHA 2N49A 4JVZA 3A5UA 4KTAA 1TWCH 4KKTA 4G4KA 2GVAA 2ZJQA 2SOBA 1PYWD 1UNSA 1SYCA 2ICEC 1NE3A 1Z47A 1V1PB 2KEEA 3W2DA 4A3LG 3WOEA 1EOVA 3PV0A 1YZ6A 1JORA 1X32A 1FNUA 1L1OB 5KYIA 4YIJA 3TMEA 1HNWL 4F87A 3OW2A 2K32A 3RLOA 3E0JA 2BOSA 1IXRA 4RHSA 3T1YL 4N8X1 1RTNA 3SXHA 3KJOA 2Z6BA 1V1QA 1PFNA 4RCOA 4OO1I 1STGA 4HJ8A 1O7LA 3HOZB 5GAGC 4CDFC 1JOOA 4FF3A 4RGTA 3L2PA 3MEFA 2EJMA 4DFAA 2LS01 1U4MA 3HKZG 3HOWG 4BBRB 4K5WA 3HKZE 1II3A 2PZUA 3I4OA 4WRDA 3S16H 1LYLA 2NVXB 1E3PA 4UAIA 3BG3A 4R4OA 2SNSA 4JI2L 4JBJA 1YNND 1PTOH 4DV5Q 3J7A5 1G8ZD 2NWGA 2EZVA 3S16B 1HZAA 3QIAA 3HOVG 3CW2C 1RKNA 1K0SA 2NZ1D 1IW7C 3J81L 4HIOA 5KNBA 1A3UA 3KLRA 4QMGA 3I3CA 3FPUB 3NEMA 1EU3A 3MFGA 1YHQA 2L1BA 1ILQA 4HIKA 1KDBA 4I7ZC 4CBVA 4NKLA 1E2WA 4KY5A 3DWAA 3P20A 1V8QA 1ZYRD 3MHBA 4A3BH 1FJGQ 4PZ7A 2ASBA 1B8AA 1FYCA 2FMCA 4UDUC 2UU9L 2XGTA 2OQ0A 4C2MB 2A68D 4DAPA 2ZJPA 2C9OA 2PQEA 2HUGA 5ISRA 3G6EA 3PMFA 1YNXA 3KJPA 1D5XC 2EJGC 2QF7A 3HOWH 3CAMA 1YBYA 4RGOS 1DCZA 3EFXD 4X3KA 2EJFC 4A3MH 3G4SA 2BE5C 1IBLQ 5CV7A 4M8AA 5IP9G 1SRUA 5IOCA 3H0GB 4QIWE 2ENBA 4PNYA 3WWVA 4XDXA 3SK6A 3DWQA 3M9BA 1MJCA 3ERQA 5DEHA 1QB5D 3RZOB 3SR1A 4K5XA 1CHQD 4BXXG 3M4OB 4DK6C 4B9XA 1IZ6A 4A3IG 2R7ZG 4NPSA 2HIXA 2AHOB 1GO3E 5I2YA 1SYDA 4JI2Q 3HOWB 5I6WA 2VQEQ 1Q12A 3K5LA 4DR5Q 3I4MG 1T5XD 5FO8B 2EY6A 3ND9A 3GQBA 2K05A 1YIJA 3GD7A 1LTTD 1K8GA 4RGMA 1DM0B 2B2WC 5EKKA 1H9SB 4NW2A 1GHKA 1GJXA 1A63A 1EWIA 5EPKA 4JI0L 4DV4Q 1Q81C 1YNJC 1U4RA 1B9MA 3H0GG 3GTJH 2RF4A 1PH3A 1LO5D 3S2DH 5JAVA 5C0XH 3DLLA 2CWPA 4NXNQ 2A74C 1EQRA 3GTPH 1K8AC 2MFIA 2AQ2B 5C3XA 2AUJD 2UUCQ 1EQTA 1WCMH 5GAEC 1OXSC 3NBHA 2JYOA 3IRBA 1PTOB 1X6OA 1U9RA 1SE3A 3OHXC 4HJ5A 2G9HD 1AZPA 2A8VA 3HOVH 4LF6Q 2B2TA 4KHZA 1NJIC 4JI1L 3J7YW 1EWCA 3U4ZA 1KC8C 2KHJA 4O0AA 4C3JB 1Q1EA 5IWAL 3ERSX 3CCLA 4DK0A 4DNTB 1R4QB 4KN4C 4A3DG 4B3RQ 2F3WA 1RODA 3CCEA 4L8JA 5C0XJ 2K1BA 4X64L 4ZKCB 4EVOA 3K5MA 4GOPC 3D6WA 1B50A 3M4PA 1X56A 3WDNA 2B2TC 3F2BA 4DGZA 1Q82C 2R93G 1FGUA 1LUZA 2HDMA 1WTRA 2FINB 1H9SA 1JC7A 5AFWA 4C3HB 2RVLA 4LF5L 1KAWA 2EY5A 3S9WA 2ZM6L 1KDCA 1X65A 2L5TA 3VDYA 1HFGA 1KQSA 1XYIA 1O80A 5EKLA 4TVAB 2AUKA 2F0VA 2RDGA 2ZTEA 2EYOA 2JA7G 1HXYD 2KCNA 1PFSA 1VMPA 1F2YA 2R7FA 2RKSA 1IBMQ 4HAEA 1L0XB 1KTKA 4K8IA 1Q86C 2B29A 5M5WH 3GV6A 4YCUA 4BY7H 4IUQA 2IWHA 4DR2L 3TBIB 2IL8A 3QO2A 1PA6A 2NTTA 2KENA 2UXBQ 1Y1WG 5FLXc 2IX0A 5J3BA 2Z8LA 2PW7A 3NQTA 1TWGH 1AN8A 3LGJA 5J39A 2F0LA 1G6PA 3JAML 1EWHA 1OXVA 3H91A 4A3JB 3ZYYX 1NTGA 3M3YH 4OL7A 4A3KG 2DGYA 1ET9A 2E76C 3T1YQ 5CV5A 4LFCL 2JA8H 1VQ8A 3D4DA 4LAAA 1ML0D 2B2YC 3OMCA 1EZ8A 1GUTA 3RR5A 2B2VA 3E0EA 3VA5A 2K50A 3FMCA 3K0YA 3UDXA 3ULJA 2ZT9C 4HJ7A 1EIYB 3P1HA 3BVMA 4DV3Q 4DR4Q 1CT1D 1DZ1A 1D8LA 1SEBD 3GTLB 4DV0Q 2M00A 4FVMA 1LTLA 4B08A 3MA2B 4A3DH 1F9PA 1QUQA 3UDFA 2Q2HA 4WJ4A 5FK9C 1GUNA 3EROA 5D14A 1TWGB 2F0EA 4ALPA 1BOSA 5FOBB 4CGYB 3KOJA 1E1OA 1VQEA 5I9PA 2OEOA 1K28A 4O42A 4JI3L 1MBYA 4JOIC 5C4JH 4BA2I 1HZCA 1I5FA 3L3OC 5T1IA 3M4QA 2JA8B 1H9MA 2RA4A 5M5WB 4BY7B 2HQEA 1AE3A 1IL8A 4A3MB 4PMWA 2JN4A 1RD9D 1ENFA 5C3EB 2KCCA 3RN5A 2RHQB 1LTGD 1VQ5A 4MIUA 3PO2H 2Y0SB 3H3VI 4DV4L 1L1OC 5EBCA 5KRUA 1QOHA 1BBUA 4LK1C 5M5XB 3S1QH 1XWEA 3K7UC 1ZEQX 3D4RA 4IPHA 2OWOA 3CC4A 4PMBA 1XJVA 1EIHA 2PZWA 1PZID 1MJEA 2F3VA 1L0YB 2Z9HA 4A3FH 3PF4A 3DEOA 3G7LA 2E2HH 4BBSH 3FPPA 4RH6A 1R4PB 5KGUA 1VQCA 2K4KA 3FKIH 4O1NA 5H1SE 1OXXK 1YJNA 2AQ3B 1BKBA 1V1PA 2XTIA 1GM5A 2X6LA 4BY7G 1HH2P 4K2KA 4IURA 4DUZL 2RQXA 4GN4B 4C3HH 2XIWA 1XTCD 4C3IB 3QR8A 3NK9A 2EYLA 5CGKA 3NQIA 4A3KB 5EJWA 4ZUJA 4LUZA 4DV7L 3S14B 4IUPA 4XIGS 4UP7A 1HA6A 5FJ8H 3P7JA 3D0FA 2TMPA 5IYBH 4BY1B 5KNCA 2QA4A 3KF8A 4C56C 1CZWA 5K36H 1S3OA 4IUUA 1BO0A 1SR3A 1KRTA 1UE7A 2NVYH 4BBRH 2R7DA 4G7ZC 2NUCA 4HJAA 3PIP3 4JI0Q 3QOJA 1QCBD 5DM73 1FGBD 4HIMA 2JSOA 4GLVB 3S2HH 4DV1L 4OGQC 3HS0C 5IGFA 2KVMA 3K80C 2K04A 1KLGD 4OIJA 1E24A 4OIKA 1TY2A 1EQVA 2F0PA 5LMNL 3H3VH 2A5HA 2R6GA 4BBSG 4B9WA 1HUMA 4X66Q 4KKSA 1E7ZA 2KHSA 4J8QA 3JC66 3N6RA 1K8MA 5JEAH 4QJFA 5EPLA 5ELNA 5IGCA 4B3TL 5DAUA 1N33L 3LNNA 4OEMB 3J80i 1AZQA 3VR6A 1BDOA 4POGA 1F2MA 1PFBA 2CH4A 2KCMA 3KK7A 2F0HA 4BBRG 3BYYB 3JAMi 1YJ9A 1IBLL 1A15A 4A3GH 1VQGA 2CH4W 3X3NA 2EY2A 4OX9Q 4V190 2I07B 2FFKB 4MTKA 2BA0A 1CM9A 1W6JA 4IZ8A 2F0SA 2NB0A 2O4XA 1SFOB 2A1AA 3KLWA 4KN7C 2EXZA 1MSGA 2OQKA 3MFYA 4LF6L 4HJ9A 4A3EG 1A6XA 4R4IA 2IPKD 1BR9A 4IPCA 2F03A 5JJLA 2YU9B 4XQQA 1NSNS 3VYRA 2A69C 4JG2A 2EYJA 1VQ7A 2DJGC 2F0IA 2F0FA 4JOIA 3RUZA 5G3LF 1VQDA 3O13A 3AB9A 2OTJA 4A3KH 5C4XH 3OYYA 2GVBA 1VQKA 4RHRA 3CPWA 2AWOA 2K33A 2FXQA 4FDBA 5HGQA 2PNHA 5LMNQ 4N9PA 4G7HC 4A3DB 2M9VA 3GTLH 3KBXA 3CQZB 1VF5C 3QOLA 1CA5A 1Y1VG 5GADC 4DR7Q 2UXBL 4ZRZA 3I73A 1JT8A 5FLXE 4TRDA 3IL8A 1WTOA 3QWNA 5IGDA 3OTOL 5E4WC 1IBML 1VCIA 3CU7A 4A3GB 4L5QA 2QEXA
chains in the Genus database with same CATH topology
2XGTA 1UEBA 5DLQE 4LF4L 2OQ0A 4PZ6A 2VUMH 1X54A 5C0XG 1P16A 2ZJPA 5C44H 3A5ZB 3JAMc 3G6EA 4A4IA 2AWNA 2Q2UA 2F52A 1YNXA 3KJPA 4JI8Q 3HOWH 5IYCH 2K5VA 2JA9A 3PGZA 1VQOA 4AH6A 4P72A 3CAMA 2YU9H 1YBYA 2GN5A 2ZTCA 4X6AH 1EUJA 4DR6L 2LXKA 4DUZQ 1QVGA 2JA6H 4A3MH 5IT9c 4BY1H 4JBKA 3G4SA 2HHHQ 3CCMA 1IBLQ 1XTDA 5IP9G 4K0KL 1SRUA 1HR0L 5K36G 4QIWE 3HFZB 4KI0A 2BA1A 3WWVA 2B63H 3M9BA 4UP8A 1MJCA 4IPDA 1YEZA 5E7NA 3NELA 3PIPA 5AJ3Q 3S24A 1K9MC 3S1NH 4BXXG 3L7ZC 4IOCA 1CSPA 1I50H 1MKHA 4DK6C 3HOYH 1IZ6A 4A3IG 2R7ZG 2WB1G 3KF6B 4NPSA 2HIXA 1IBKQ 2AHOB 1GO3E 3STBD 4DV6Q 3S17H 1QVCA 1AE2A 4XTCS 4JI2Q 2WB1E 3J81c 3CC2A 1YJWA 2VQEQ 1Q12A 4DR5Q 1HNZQ 3I4MG 2CWAA 2HIVA 4P73A 4JI7Q 3GTKH 1VS0A 2UUCL 1UE1A 5IYDG 1YVCA 4A3GG 2VS1A 1YIJA 3FKIG 3GD7A 1K8GA 5IYCG 4LFBQ 4C3JH 2YTYA 3HOXG 3CCJA 5M3FG 3I56A 1A63A 1EWIA 4JI0L 1XPUA 4GKJQ 4Y7NH 3NBHB 5IP7G 2IHEA 1VQAA 2N78A 2H5XA 4DV4Q 4DR3L 1Q81C 5FLMG 3K0XA 3MXNB 1D7QA 3K8AA 1HZBA 1GKHA 2I5LX 1KD1C 1HNXL 3CPFA 3H0GG 1A0IA 3GTJH 2RF4A 4DV5L 4LF5Q 1PH3A 4QGUA 1E1TA 2UXDL 2V1CC 2VY3A 3S2DH 4IOAA 2C35B 3DLLA 2CWPA 1W2BA 4NXNQ 1PH5A 2YV5A 2JA7H 3I7FA 1EQRA 3GTPH 1X3EA 1Q7YC 1K8AC 4IFDG 2MFIA 2D62A 2UUCQ 4A3JH 3E9IA 1C9OA 2Q2IA 3K81C 1XMQQ 3G48A 1WCMH 5GAEC 1OXSC 3IRBA 4JI4Q 3RZOH 4AIMA 5M5YH 3I55A 2D0PA 4WJ3M 1J5EQ 1X6OA 1XNRL 3HOUG 2VQFQ 1PYBA 4DR4L 1JJCB 3PO2G 1N9WA 4DV6L 4HJ5A 3J81j 3PUYA 2Z6KC 4APVA 1JMCA 1J6QA 3TRZA 4H02A 2PMZE 2A8VA 5JJIA 3HOVH 2NN6G 4KHZA 4C3IH 1NJIC 1M1KC 4JI1L 4LF6Q 4LFAQ 1HNXQ 3U4ZA 5M5XH 2KHJA 4JI5L 1KC8C 3EN2A 1YI2A 4O0AA 1I3QH 4MNOA 4R4TA 1Q1EA 5M3MH 2R93H 2IX1A 1XMOL 4DR1Q 5IWAL 1N32L 2ZM6Q 4JI3Q 3ERSX 3CCLA 3S1RH 1AH9A 4GKKQ 1PVOA 3TS0A 4A3DG 4B3RQ 1QVFA 3CCEA 1KRSA 5C0XJ 2NZOA 1P8LA 1Y14B 2JE6I 4DKAC 4X64L 1VQHA 3H15A 1G51A 4DUYQ 3GTQH 4GOPC 5C4XG 3GTMH 4IJLA 1HR0Q 3M4PA 1X56A 2MNAA 4LWCA 1N34L 4EQ5A 4POFA 3F2BA 1JE5A 2HHHL 3UDGA 4A93G 2YTVA 4DV3L 1Q82C 2R93G 1V43A 1N36L 2E5LL 1FGUA 4B3TQ 1LUZA 4EX5A 2UXDQ 3S1MH 2R92H 1N8RC 1C7YA 3B6YA 4LF4Q 4LF5L 4A3CH 1KAWA 4KLKA 1E22A 3GTOH 2IY5B 1JJGA 2ZM6L 5JJKA 1ASYA 2B63G 1TWAH 1X3GA 2CKZB 1UE5A 1X65A 2NVTH 4RG1A 3VDYA 1KQSA 1RL2A 4LF7Q 2D0OA 4TVAB 1W3SA 3CMEA 4A3JG 2ZTEA 2JA7G 1VQNA 4LFBL 3KF8B 4NXML 2R7ZH 1PFSA 3M7NA 4DUYL 4IFDI 2PQAA 2R7FA 3SGIA 1VQPA 1IBMQ 4OWXB 2BH2A 1G291 1Q86C 2B29A 4UP9A 2IHFA 2UUAL 4JCVE 4YCUA 3AQQA 5M5WH 4BY7H 3EBEA 1CKOA 2UXCQ 4JI7L 4DR2L 2UUBL 4KHPQ 1SN8A 1XPRA 1PA6A 2KENA 1K0RA 2UXBQ 3Q8DA 4YHHQ 1TXYA 1Y1WG 4DR1L 2F4VL 3EIVA 5FLXc 4R1JA 2IX0A 2N3SA 5J3BA 2IT1A 5LMUL 4LF8L 3U4VA 1U5KA 1UE6A 1TWGH 4GOPA 1KXLA 1CKMA 3LGJA 1CUKA 4YCVA 3FP9A 1L1OA 2JA6G 2JJQA 1SE8A 1PH4A 2NN6I 4GNXC 3NENA 1G6PA 5IE8A 1FJGL 3GDEA 4YWKA 3BJUA 1OXVA 3J81i 2VQFL 4A76A 2ID0A 3ULPA 1XPOA 4A3CG 2CFMA 3HOUH 2Y0SG 1NTGA 4KHPL 3M3YH 3CCRA 4DAYB 3DM3A 5EAYA 1PH1A 3CD6A 1IYJB 4A3KG 3W1BA 2DGYA 3T1YQ 3HOZH 2K75A 2WAQE 3PUWA 4LFCL 3W1GA 4P71A 2JA8H 2K14A 1VQ8A 4A3IH 2I5MX 3ER0A 1UWVA 2PI2A 3RLFA 1S40A 2BH8A 1I94L 1HNWQ 5IP7H 3K7AH 4JBMA 4YY3L 5FLMH 1S72A 4GKKL 1MIUA 2ZJRA 1T9HA 1SMXA 4DV2L 3RNUA 1VQMA 1EYGA 2WP8J 1FVIA 4GN5A 3RR5A 2RCNA 1K3RA 4BA1I 3H0GH 3E0EA 5IYDH 4MZ9A 2LXJA 1PHJA 4NXNL 3AEVA 4AQYL 1WI5A 2K50A 3ULJA 5HY6A 3UDXA 2NVXH 4LF9L 4HJ7A 4LW1A 2I0QA 4GKJL 4LF9Q 1EIYB 2Z6KA 4IPGA 2JA8G 1OTCA 1XMOQ 3HOYG 4DV3Q 4DR4Q 3HOXH 3PSIA 1X55A 2ES2A 1D8LA 4B3MQ 4LFAL 4DV0Q 4YHHL 3F2CA 1PH6A 1ASZA 1LTLA 4QL5A 1VQIA 4DV2Q 1EFWA 4A3DH 1QUQA 3STBC 1LM0A 1OXUA 3UDFA 3KDFB 3T1HQ 3F2DA 2R92G 2Q2HA 4WJ4A 3RLNA 2K5NA 2Z0SA 4DV1Q 2VNUD 4ALPA 2Q2TA 2ZTDA 1WYDA 2EXDA 1NY4A 3KOJA 4QY7A 1E1OA 1VQEA 2KBNA 4NB3A 4JI3L 4JOIC 5C4JH 1VQBA 4BY1G 5AJ3L 4AQYQ 5JEAJ 4BA2I 1HZCA 4X66L 5IY0A 1I5FA 3F8TA 4PG3A 3M4QA 1IL2A 3KFUA 3BZKA 4A3MG 2HQLA 3CCVA 1AE3A 4PMWA 2QGQA 4YY3Q 3RN5A 4UPAA 2RHQB 1CKNA 4P74A 3G71A 5C44G 1VQ5A 3PO2H 4JBWA 3H3VI 2B3GA 3PUXA 2KHIA 2RHSB 2Y0SE 4DV4L 1L1OC 2JA5H 1FL0A 5M3FH 5BR8Q 4MTNA 4X65Q 3J80c 1BBUA 2UXCL 3S1QH 4JC0A 3K7UC 4GNXA 1H95A 4L5SA 2JEAI 2AKWB 3PUVA 4IPHA 2VQEL 3CC4A 3U50C 2OWOA 1XJVA 3CP0A 1MJEA 4LFCQ 5C0XI 2L15A 3CMAA 3TS2A 2OCEA 4GN3B 4A3FH 3PF4A 4QQBX 4A75A 2E2HH 2UU9Q 4L5RC 1WFQA 2VL6A 4BBSH 2A19A 5LMUQ 1K73C 4OWWB 3PCOB 1KIXA 1HJPA 1VQCA 4DV7Q 2K4KA 3A74A 2JA5G 1QUQB 3FKIH 3ICEA 1SROA 5H1SE 2KCTA 3J7ZC 4A3LH 1KL9A 2UUBQ 4YWMA 1OXXK 4JI1Q 1YJNA 2MO1A 4O2DA 1YITA 4LUOA 1A62A 4OONA 3PIOA 1BKBA 2NZHA 2XTIA 1GM5A 1I94Q 1TWHH 4BY7G 1HH2P 1XNQL 2WAQG 4DR7L 1XNRQ 3M4OH 4DUZL 1XNQQ 3PUZA 4GN4B 4LUVA 1V9PA 4PZ8A 3OTOQ 4JV5L 4JI4L 4C3HH 3I2ZA 1SLJA 3ZJYC 4X65L 5LMNW 3F1ZA 1X3FA 3TREA 1N33Q 2ATWA 3CXCA 4LF7L 1TWFH 2EQSA 1WOCA 4LUZA 4DV7L 4OO1G 4DR6Q 4AYBG 5C3EG 4XIGS 4UP7A 1PH7A 5FJ8H 3TQYA 4YCWA 3D0FA 5IYBH 1K83H 4AYBE 4B3SL 2N8NA 1GD7A 4GNXB 2QA4A 2NVQH 1QZHA 1PYSB 4DK3C 3I4NH 2EIFA 3U58A 4UY8C 1N32Q 1S3OA 5GQOA 1B70B 4GLAC 4Y52H 1SR3A 4RMFA 1KRTA 3HOZG 1UE7A 2NVYH 4BBRH 2HT1A 2R7DA 3D31A 4DR2Q 4DR3Q 1NBWA 1CSQA 4IFDJ 4HJAA 3CF5A 4JI0Q 1L0WA 1A8VA 5M3MG 3S15H 3CCUA 1CKNB 3BU2A 4HIMA 2VZAA 3KF6A 2E2JH 4GLVB 3S2HH 1WJJA 4DV1L 4JI6Q 4NXMQ 1N34Q 4C2MH 3A0JA 1SFOH 1EQQA 3K80C 4HIDA 1XMQL 1E24A 4JYAQ 1Y1VH 3PO3H 3UDIA 5LMNL 3H3VH 3HKSA 1VQJA 4R4CA 2R6GA 4DV0L 3PO3G 4BBSG 4GS3A 2DUDA 2N49A 4IJHA 4X66Q 3A5UA 3I4NG 1TWCH 2F3IA 1E7ZA 2GVAA 2YTXA 2ZJQA 3RN2A 3UE0A 1C0AA 1YHAA 4GLXA 3JC66 1PH8A 4X62Q 1Z9FA 4QJFA 2E2IH 5ELNA 2E5LQ 4B3TL 1NE3A 1Z47A 1NMFA 1JJ2A 1N33L 4A3LG 3J80i 4POGA 1EOVA 3PV0A 1YZ6A 1VQFA 1X9NA 2KCMA 3BZCA 3M85A 4YWLA 5BR8L 4JV5Q 1I6HH 1L1OB 1VQLA 3FHWA 4BBRG 3JAMi 1YJ9A 4X64Q 1HNWL 1IBLL 1Y1WH 3OW2A 4A3GH 3RLOA 1VQGA 3E9HA 2JEBI 4BXXH 4B3RL 2AMCB 4OX9Q 4J15A 1L2FA 2WFWA 1IXRA 3T1YL 4OXPA 3S14H 2BA0A 3AFQA 3KJOA 1PH9A 2UU9L 1RIPA 1V1QA 3KYHC 4JI8L 5IWAQ 4DR5L 1VQ6A 4A93H 3GTGH 4OO1I 3W5OA 4HJ8A 4JI5Q 3I4MH 5IP9H 1VQ4A 2A1AA 1NMGA 3KLWA 4X62L 4L5TA 3CCSA 3L0OA 3CC7A 3RZDH 2OQKA 2MO0A 1QZGA 4LF6L 4HJ9A 5GAGC 4A3EG 4OWTB 4R4IA 1B7YB 1PV4A 4IPCA 5JJLA 3L2PA 3MEFA 1J5EL 4JI6L 4DNIA 1KHIA 3HKZG 2LSSA 1M90C 1VQ9A 2F4VQ 3HOWG 3AYHB 5C3EH 1O7IA 3AFPA 3HKZE 4JG2A 1PH2A 3ULLA 3I4OA 5ELOA 1VQ7A 3S16H 5FJ8G 1LYLA 1E3PA 4JOIA 1YHBA 4R4OA 5IYBG 2CCZA 4B3ML 4ME3A 5GROA 4JI2L 2MQHA 1VQDA 1EIFA 1GVPA 2ALYB 2OTJA 1IBKL 4A3KH 4JBJA 4A3EH 4TQUS 3OYYA 4P75A 5C4XH 4DV5Q 1HNZL 2GVBA 4B3SQ 1VQKA 3J7A5 3CPWA 2AWOA 2PQAB 1HZAA 3HOVG 3CW2C 2FXQA 1BVSA 1DGSA 4FDBA 5HGQA 2PNHA 5LMNQ 1OXTA 4HIOA 4LNQA 2YYZA 3CCQA 3GO5A 1WCMG 4JYAL 3CQZH 3KDFA 1HR0W 1Q1BA 4OX9L 4K0KQ 4LF8Q 2JQOA 3NEMA 2UUAQ 4IO9A 3GTLH 3PF5A 1JB7A 2VUMG 1N36Q 2UXBL 4R4QA 2E8GA 1Y1VG 5GADC 1YHQA 4DR7Q 1JT8A 3T1HL 1Q8KA 2CQOA 2I5HA 4HIKA 4A3FG 1BBWA 4DAMA 4GOPB 1HZ9A 2OTLA 2JK8A 3TEHB 3OTOL 2VW9A 4A3BG 1U0LA 5JEAG 1IBML 4DPGA 1VCIA 4A3BH 5GAHC 1FJGQ 4PZ7A 1Q46A 2K52A 2ASBA 3UE1A 1B8AA 1R9TH 2PI2E 2K5HA 4L5QA 2QEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGT A;  1UEB A;  5DLQ E;  4LF4 L;  2OQ0 A;  4PZ6 A;  2VUM H;  1X54 A;  5C0X G;  1P16 A;  2ZJP A;  5C44 H;  3A5Z B;  3JAM c;  3G6E A;  4A4I A;  2AWN A;  2Q2U A;  2F52 A;  1YNX A;  3KJP A;  4JI8 Q;  3HOW H;  5IYC H;  2K5V A;  2JA9 A;  3PGZ A;  1VQO A;  4AH6 A;  4P72 A;  3CAM A;  2YU9 H;  1YBY A;  2GN5 A;  2ZTC A;  4X6A H;  1EUJ A;  4DR6 L;  2LXK A;  4DUZ Q;  1QVG A;  2JA6 H;  4A3M H;  5IT9 c;  4BY1 H;  4JBK A;  3G4S A;  2HHH Q;  3CCM A;  1IBL Q;  1XTD A;  5IP9 G;  4K0K L;  1SRU A;  1HR0 L;  5K36 G;  4QIW E;  3HFZ B;  4KI0 A;  2BA1 A;  3WWV A;  2B63 H;  3M9B A;  4UP8 A;  1MJC A;  4IPD A;  1YEZ A;  5E7N A;  3NEL A;  3PIP A;  5AJ3 Q;  3S24 A;  1K9M C;  3S1N H;  4BXX G;  3L7Z C;  4IOC A;  1CSP A;  1I50 H;  1MKH A;  4DK6 C;  3HOY H;  1IZ6 A;  4A3I G;  2R7Z G;  2WB1 G;  3KF6 B;  4NPS A;  2HIX A;  1IBK Q;  2AHO B;  1GO3 E;  3STB D;  4DV6 Q;  3S17 H;  1QVC A;  1AE2 A;  4XTC S;  4JI2 Q;  2WB1 E;  3J81 c;  3CC2 A;  1YJW A;  2VQE Q;  1Q12 A;  4DR5 Q;  1HNZ Q;  3I4M G;  2CWA A;  2HIV A;  4P73 A;  4JI7 Q;  3GTK H;  1VS0 A;  2UUC L;  1UE1 A;  5IYD G;  1YVC A;  4A3G G;  2VS1 A;  1YIJ A;  3FKI G;  3GD7 A;  1K8G A;  5IYC G;  4LFB Q;  4C3J H;  2YTY A;  3HOX G;  3CCJ A;  5M3F G;  3I56 A;  1A63 A;  1EWI A;  4JI0 L;  1XPU A;  4GKJ Q;  4Y7N H;  3NBH B;  5IP7 G;  2IHE A;  1VQA A;  2N78 A;  2H5X A;  4DV4 Q;  4DR3 L;  1Q81 C;  5FLM G;  3K0X A;  3MXN B;  1D7Q A;  3K8A A;  1HZB A;  1GKH A;  2I5L X;  1KD1 C;  1HNX L;  3CPF A;  3H0G G;  1A0I A;  3GTJ H;  2RF4 A;  4DV5 L;  4LF5 Q;  1PH3 A;  4QGU A;  1E1T A;  2UXD L;  2V1C C;  2VY3 A;  3S2D H;  4IOA A;  2C35 B;  3DLL A;  2CWP A;  1W2B A;  4NXN Q;  1PH5 A;  2YV5 A;  2JA7 H;  3I7F A;  1EQR A;  3GTP H;  1X3E A;  1Q7Y C;  1K8A C;  4IFD G;  2MFI A;  2D62 A;  2UUC Q;  4A3J H;  3E9I A;  1C9O A;  2Q2I A;  3K81 C;  1XMQ Q;  3G48 A;  1WCM H;  5GAE C;  1OXS C;  3IRB A;  4JI4 Q;  3RZO H;  4AIM A;  5M5Y H;  3I55 A;  2D0P A;  4WJ3 M;  1J5E Q;  1X6O A;  1XNR L;  3HOU G;  2VQF Q;  1PYB A;  4DR4 L;  1JJC B;  3PO2 G;  1N9W A;  4DV6 L;  4HJ5 A;  3J81 j;  3PUY A;  2Z6K C;  4APV A;  1JMC A;  1J6Q A;  3TRZ A;  4H02 A;  2PMZ E;  2A8V A;  5JJI A;  3HOV H;  2NN6 G;  4KHZ A;  4C3I H;  1NJI C;  1M1K C;  4JI1 L;  4LF6 Q;  4LFA Q;  1HNX Q;  3U4Z A;  5M5X H;  2KHJ A;  4JI5 L;  1KC8 C;  3EN2 A;  1YI2 A;  4O0A A;  1I3Q H;  4MNO A;  4R4T A;  1Q1E A;  5M3M H;  2R93 H;  2IX1 A;  1XMO L;  4DR1 Q;  5IWA L;  1N32 L;  2ZM6 Q;  4JI3 Q;  3ERS X;  3CCL A;  3S1R H;  1AH9 A;  4GKK Q;  1PVO A;  3TS0 A;  4A3D G;  4B3R Q;  1QVF A;  3CCE A;  1KRS A;  5C0X J;  2NZO A;  1P8L A;  1Y14 B;  2JE6 I;  4DKA C;  4X64 L;  1VQH A;  3H15 A;  1G51 A;  4DUY Q;  3GTQ H;  4GOP C;  5C4X G;  3GTM H;  4IJL A;  1HR0 Q;  3M4P A;  1X56 A;  2MNA A;  4LWC A;  1N34 L;  4EQ5 A;  4POF A;  3F2B A;  1JE5 A;  2HHH L;  3UDG A;  4A93 G;  2YTV A;  4DV3 L;  1Q82 C;  2R93 G;  1V43 A;  1N36 L;  2E5L L;  1FGU A;  4B3T Q;  1LUZ A;  4EX5 A;  2UXD Q;  3S1M H;  2R92 H;  1N8R C;  1C7Y A;  3B6Y A;  4LF4 Q;  4LF5 L;  4A3C H;  1KAW A;  4KLK A;  1E22 A;  3GTO H;  2IY5 B;  1JJG A;  2ZM6 L;  5JJK A;  1ASY A;  2B63 G;  1TWA H;  1X3G A;  2CKZ B;  1UE5 A;  1X65 A;  2NVT H;  4RG1 A;  3VDY A;  1KQS A;  1RL2 A;  4LF7 Q;  2D0O A;  4TVA B;  1W3S A;  3CME A;  4A3J G;  2ZTE A;  2JA7 G;  1VQN A;  4LFB L;  3KF8 B;  4NXM L;  2R7Z H;  1PFS A;  3M7N A;  4DUY L;  4IFD I;  2PQA A;  2R7F A;  3SGI A;  1VQP A;  1IBM Q;  4OWX B;  2BH2 A;  1G29 1;  1Q86 C;  2B29 A;  4UP9 A;  2IHF A;  2UUA L;  4JCV E;  4YCU A;  3AQQ A;  5M5W H;  4BY7 H;  3EBE A;  1CKO A;  2UXC Q;  4JI7 L;  4DR2 L;  2UUB L;  4KHP Q;  1SN8 A;  1XPR A;  1PA6 A;  2KEN A;  1K0R A;  2UXB Q;  3Q8D A;  4YHH Q;  1TXY A;  1Y1W G;  4DR1 L;  2F4V L;  3EIV A;  5FLX c;  4R1J A;  2IX0 A;  2N3S A;  5J3B A;  2IT1 A;  5LMU L;  4LF8 L;  3U4V A;  1U5K A;  1UE6 A;  1TWG H;  4GOP A;  1KXL A;  1CKM A;  3LGJ A;  1CUK A;  4YCV A;  3FP9 A;  1L1O A;  2JA6 G;  2JJQ A;  1SE8 A;  1PH4 A;  2NN6 I;  4GNX C;  3NEN A;  1G6P A;  5IE8 A;  1FJG L;  3GDE A;  4YWK A;  3BJU A;  1OXV A;  3J81 i;  2VQF L;  4A76 A;  2ID0 A;  3ULP A;  1XPO A;  4A3C G;  2CFM A;  3HOU H;  2Y0S G;  1NTG A;  4KHP L;  3M3Y H;  3CCR A;  4DAY B;  3DM3 A;  5EAY A;  1PH1 A;  3CD6 A;  1IYJ B;  4A3K G;  3W1B A;  2DGY A;  3T1Y Q;  3HOZ H;  2K75 A;  2WAQ E;  3PUW A;  4LFC L;  3W1G A;  4P71 A;  2JA8 H;  2K14 A;  1VQ8 A;  4A3I H;  2I5M X;  3ER0 A;  1UWV A;  2PI2 A;  3RLF A;  1S40 A;  2BH8 A;  1I94 L;  1HNW Q;  5IP7 H;  3K7A H;  4JBM A;  4YY3 L;  5FLM H;  1S72 A;  4GKK L;  1MIU A;  2ZJR A;  1T9H A;  1SMX A;  4DV2 L;  3RNU A;  1VQM A;  1EYG A;  2WP8 J;  1FVI A;  4GN5 A;  3RR5 A;  2RCN A;  1K3R A;  4BA1 I;  3H0G H;  3E0E A;  5IYD H;  4MZ9 A;  2LXJ A;  1PHJ A;  4NXN L;  3AEV A;  4AQY L;  1WI5 A;  2K50 A;  3ULJ A;  5HY6 A;  3UDX A;  2NVX H;  4LF9 L;  4HJ7 A;  4LW1 A;  2I0Q A;  4GKJ L;  4LF9 Q;  1EIY B;  2Z6K A;  4IPG A;  2JA8 G;  1OTC A;  1XMO Q;  3HOY G;  4DV3 Q;  4DR4 Q;  3HOX H;  3PSI A;  1X55 A;  2ES2 A;  1D8L A;  4B3M Q;  4LFA L;  4DV0 Q;  4YHH L;  3F2C A;  1PH6 A;  1ASZ A;  1LTL A;  4QL5 A;  1VQI A;  4DV2 Q;  1EFW A;  4A3D H;  1QUQ A;  3STB C;  1LM0 A;  1OXU A;  3UDF A;  3KDF B;  3T1H Q;  3F2D A;  2R92 G;  2Q2H A;  4WJ4 A;  3RLN A;  2K5N A;  2Z0S A;  4DV1 Q;  2VNU D;  4ALP A;  2Q2T A;  2ZTD A;  1WYD A;  2EXD A;  1NY4 A;  3KOJ A;  4QY7 A;  1E1O A;  1VQE A;  2KBN A;  4NB3 A;  4JI3 L;  4JOI C;  5C4J H;  1VQB A;  4BY1 G;  5AJ3 L;  4AQY Q;  5JEA J;  4BA2 I;  1HZC A;  4X66 L;  5IY0 A;  1I5F A;  3F8T A;  4PG3 A;  3M4Q A;  1IL2 A;  3KFU A;  3BZK A;  4A3M G;  2HQL A;  3CCV A;  1AE3 A;  4PMW A;  2QGQ A;  4YY3 Q;  3RN5 A;  4UPA A;  2RHQ B;  1CKN A;  4P74 A;  3G71 A;  5C44 G;  1VQ5 A;  3PO2 H;  4JBW A;  3H3V I;  2B3G A;  3PUX A;  2KHI A;  2RHS B;  2Y0S E;  4DV4 L;  1L1O C;  2JA5 H;  1FL0 A;  5M3F H;  5BR8 Q;  4MTN A;  4X65 Q;  3J80 c;  1BBU A;  2UXC L;  3S1Q H;  4JC0 A;  3K7U C;  4GNX A;  1H95 A;  4L5S A;  2JEA I;  2AKW B;  3PUV A;  4IPH A;  2VQE L;  3CC4 A;  3U50 C;  2OWO A;  1XJV A;  3CP0 A;  1MJE A;  4LFC Q;  5C0X I;  2L15 A;  3CMA A;  3TS2 A;  2OCE A;  4GN3 B;  4A3F H;  3PF4 A;  4QQB X;  4A75 A;  2E2H H;  2UU9 Q;  4L5R C;  1WFQ A;  2VL6 A;  4BBS H;  2A19 A;  5LMU Q;  1K73 C;  4OWW B;  3PCO B;  1KIX A;  1HJP A;  1VQC A;  4DV7 Q;  2K4K A;  3A74 A;  2JA5 G;  1QUQ B;  3FKI H;  3ICE A;  1SRO A;  5H1S E;  2KCT A;  3J7Z C;  4A3L H;  1KL9 A;  2UUB Q;  4YWM A;  1OXX K;  4JI1 Q;  1YJN A;  2MO1 A;  4O2D A;  1YIT A;  4LUO A;  1A62 A;  4OON A;  3PIO A;  1BKB A;  2NZH A;  2XTI A;  1GM5 A;  1I94 Q;  1TWH H;  4BY7 G;  1HH2 P;  1XNQ L;  2WAQ G;  4DR7 L;  1XNR Q;  3M4O H;  4DUZ L;  1XNQ Q;  3PUZ A;  4GN4 B;  4LUV A;  1V9P A;  4PZ8 A;  3OTO Q;  4JV5 L;  4JI4 L;  4C3H H;  3I2Z A;  1SLJ A;  3ZJY C;  4X65 L;  5LMN W;  3F1Z A;  1X3F A;  3TRE A;  1N33 Q;  2ATW A;  3CXC A;  4LF7 L;  1TWF H;  2EQS A;  1WOC A;  4LUZ A;  4DV7 L;  4OO1 G;  4DR6 Q;  4AYB G;  5C3E G;  4XIG S;  4UP7 A;  1PH7 A;  5FJ8 H;  3TQY A;  4YCW A;  3D0F A;  5IYB H;  1K83 H;  4AYB E;  4B3S L;  2N8N A;  1GD7 A;  4GNX B;  2QA4 A;  2NVQ H;  1QZH A;  1PYS B;  4DK3 C;  3I4N H;  2EIF A;  3U58 A;  4UY8 C;  1N32 Q;  1S3O A;  5GQO A;  1B70 B;  4GLA C;  4Y52 H;  1SR3 A;  4RMF A;  1KRT A;  3HOZ G;  1UE7 A;  2NVY H;  4BBR H;  2HT1 A;  2R7D A;  3D31 A;  4DR2 Q;  4DR3 Q;  1NBW A;  1CSQ A;  4IFD J;  4HJA A;  3CF5 A;  4JI0 Q;  1L0W A;  1A8V A;  5M3M G;  3S15 H;  3CCU A;  1CKN B;  3BU2 A;  4HIM A;  2VZA A;  3KF6 A;  2E2J H;  4GLV B;  3S2H H;  1WJJ A;  4DV1 L;  4JI6 Q;  4NXM Q;  1N34 Q;  4C2M H;  3A0J A;  1SFO H;  1EQQ A;  3K80 C;  4HID A;  1XMQ L;  1E24 A;  4JYA Q;  1Y1V H;  3PO3 H;  3UDI A;  5LMN L;  3H3V H;  3HKS A;  1VQJ A;  4R4C A;  2R6G A;  4DV0 L;  3PO3 G;  4BBS G;  4GS3 A;  2DUD A;  2N49 A;  4IJH A;  4X66 Q;  3A5U A;  3I4N G;  1TWC H;  2F3I A;  1E7Z A;  2GVA A;  2YTX A;  2ZJQ A;  3RN2 A;  3UE0 A;  1C0A A;  1YHA A;  4GLX A;  3JC6 6;  1PH8 A;  4X62 Q;  1Z9F A;  4QJF A;  2E2I H;  5ELN A;  2E5L Q;  4B3T L;  1NE3 A;  1Z47 A;  1NMF A;  1JJ2 A;  1N33 L;  4A3L G;  3J80 i;  4POG A;  1EOV A;  3PV0 A;  1YZ6 A;  1VQF A;  1X9N A;  2KCM A;  3BZC A;  3M85 A;  4YWL A;  5BR8 L;  4JV5 Q;  1I6H H;  1L1O B;  1VQL A;  3FHW A;  4BBR G;  3JAM i;  1YJ9 A;  4X64 Q;  1HNW L;  1IBL L;  1Y1W H;  3OW2 A;  4A3G H;  3RLO A;  1VQG A;  3E9H A;  2JEB I;  4BXX H;  4B3R L;  2AMC B;  4OX9 Q;  4J15 A;  1L2F A;  2WFW A;  1IXR A;  3T1Y L;  4OXP A;  3S14 H;  2BA0 A;  3AFQ A;  3KJO A;  1PH9 A;  2UU9 L;  1RIP A;  1V1Q A;  3KYH C;  4JI8 L;  5IWA Q;  4DR5 L;  1VQ6 A;  4A93 H;  3GTG H;  4OO1 I;  3W5O A;  4HJ8 A;  4JI5 Q;  3I4M H;  5IP9 H;  1VQ4 A;  2A1A A;  1NMG A;  3KLW A;  4X62 L;  4L5T A;  3CCS A;  3L0O A;  3CC7 A;  3RZD H;  2OQK A;  2MO0 A;  1QZG A;  4LF6 L;  4HJ9 A;  5GAG C;  4A3E G;  4OWT B;  4R4I A;  1B7Y B;  1PV4 A;  4IPC A;  5JJL A;  3L2P A;  3MEF A;  1J5E L;  4JI6 L;  4DNI A;  1KHI A;  3HKZ G;  2LSS A;  1M90 C;  1VQ9 A;  2F4V Q;  3HOW G;  3AYH B;  5C3E H;  1O7I A;  3AFP A;  3HKZ E;  4JG2 A;  1PH2 A;  3ULL A;  3I4O A;  5ELO A;  1VQ7 A;  3S16 H;  5FJ8 G;  1LYL A;  1E3P A;  4JOI A;  1YHB A;  4R4O A;  5IYB G;  2CCZ A;  4B3M L;  4ME3 A;  5GRO A;  4JI2 L;  2MQH A;  1VQD A;  1EIF A;  1GVP A;  2ALY B;  2OTJ A;  1IBK L;  4A3K H;  4JBJ A;  4A3E H;  4TQU S;  3OYY A;  4P75 A;  5C4X H;  4DV5 Q;  1HNZ L;  2GVB A;  4B3S Q;  1VQK A;  3J7A 5;  3CPW A;  2AWO A;  2PQA B;  1HZA A;  3HOV G;  3CW2 C;  2FXQ A;  1BVS A;  1DGS A;  4FDB A;  5HGQ A;  2PNH A;  5LMN Q;  1OXT A;  4HIO A;  4LNQ A;  2YYZ A;  3CCQ A;  3GO5 A;  1WCM G;  4JYA L;  3CQZ H;  3KDF A;  1HR0 W;  1Q1B A;  4OX9 L;  4K0K Q;  4LF8 Q;  2JQO A;  3NEM A;  2UUA Q;  4IO9 A;  3GTL H;  3PF5 A;  1JB7 A;  2VUM G;  1N36 Q;  2UXB L;  4R4Q A;  2E8G A;  1Y1V G;  5GAD C;  1YHQ A;  4DR7 Q;  1JT8 A;  3T1H L;  1Q8K A;  2CQO A;  2I5H A;  4HIK A;  4A3F G;  1BBW A;  4DAM A;  4GOP B;  1HZ9 A;  2OTL A;  2JK8 A;  3TEH B;  3OTO L;  2VW9 A;  4A3B G;  1U0L A;  5JEA G;  1IBM L;  4DPG A;  1VCI A;  4A3B H;  5GAH C;  1FJG Q;  4PZ7 A;  1Q46 A;  2K52 A;  2ASB A;  3UE1 A;  1B8A A;  1R9T H;  2PI2 E;  2K5H A;  4L5Q A;  2QEX A; 
#chains in the Genus database with same CATH topology
 1D5Z C;  1UEB A;  4LF4 L;  4A3I B;  5CC4 A;  3TP8 A;  1HTL D;  2QW7 A;  1B3A A;  1H9J A;  1ENC A;  3PGZ A;  4AH6 A;  4P72 A;  5IYC H;  5EQ0 A;  2GN5 A;  2ZTC A;  2WAC A;  3M3Y B;  3LWU A;  1M4V A;  1EUJ A;  4DUZ Q;  3PQI A;  3S2D B;  2JP1 A;  5IT9 c;  4FXG C;  3EVQ A;  5JVG 3;  4RWS C;  1AFP A;  1BCP C;  4KI0 A;  2BDN A;  2HCC A;  1Y1V B;  2DN8 A;  1CTM A;  2B63 H;  4IPD A;  1SE2 A;  1YEZ A;  1D6E C;  1AW7 A;  2DNE A;  5E7N A;  3NEL A;  4WFN 3;  2WV6 D;  4C3J G;  5AJ3 Q;  1I50 H;  4PV1 C;  4XQN A;  2B39 A;  2WB1 G;  4HN7 A;  1IBK Q;  3S17 H;  1QVC A;  2WB1 E;  4H0L C;  2A69 D;  2CWA A;  2HIV A;  4P73 A;  2NVT B;  1LTI D;  4H7B A;  1VS0 A;  3IFD A;  2VUM B;  4MN3 A;  1HFN A;  1UE1 A;  3CRL C;  3HRZ C;  2Z4I A;  3FKI G;  5IYC G;  1DYQ A;  2GA4 B;  3CCJ A;  2L0C A;  2BDO A;  2G9D A;  3I56 A;  2O5J C;  4Y7N H;  3NBH B;  3K0X A;  4I7A A;  3K8A A;  1Y1W B;  1GKH A;  1LLR D;  4JPB W;  2G5D A;  1A0I A;  4LF5 Q;  1S5B D;  1DD2 A;  1E1T A;  1I4G A;  1WTP A;  2V1C C;  5I4D A;  2P5Z X;  3Q6S A;  4FXD A;  2YV5 A;  3K58 A;  1Q7Y C;  1B4O A;  1F9R A;  1GOZ A;  1SSO A;  1NAP A;  1RJT A;  2C5C A;  4JI4 Q;  5C4X B;  2D0P A;  4WJ3 M;  4X3U A;  1XNR L;  3HOU G;  4DR4 L;  1JJC B;  4DV6 L;  3J81 j;  4APV A;  2Z6K C;  1JMC A;  2QEJ C;  4H02 A;  4C3I H;  4LFA Q;  4TKO B;  1HNX Q;  1YI2 A;  1XMO L;  2SDF A;  3M4Y A;  3EQL C;  2B2U A;  5IT9 E;  3GTK B;  2ZXR A;  3TZD A;  1Y14 B;  5IGG A;  4DKA C;  1VQH A;  3GTQ H;  1LAC A;  1I6V C;  4KD4 A;  3T13 A;  1SJE D;  5ELC A;  5JJZ A;  4EQ5 A;  2OF1 A;  1JE5 A;  2HHH L;  3A8K E;  2O2L D;  1V43 A;  1TQO A;  1N36 L;  4B3T Q;  2EYF A;  4E6I A;  3S1Q B;  1DON A;  1N8R C;  1TT2 A;  1JB3 A;  1E22 A;  4CKE A;  4U67 3;  1X3G A;  5I2X A;  3K5N A;  2CKZ B;  1JE4 A;  4LF7 Q;  4KD3 A;  2D0O A;  2K28 A;  4CJ0 B;  3A7A B;  3S17 B;  1VQN A;  2DJF C;  4LFB L;  2R7Z H;  2F0O A;  3SGI A;  3RD4 A;  2BH2 A;  1G29 1;  4JCV E;  4R8I A;  3A55 A;  3S1N B;  4KHP Q;  1SN8 A;  2Q8I B;  5JOB A;  2F4V L;  4YHH Q;  2KED A;  4DR1 L;  3EIV A;  4LF8 L;  1UE6 A;  3NTK A;  4GOP A;  1ESF A;  4YCV A;  2JA6 G;  2JJQ A;  5C4H A;  1SE8 A;  4WJW A;  2NN6 I;  3NEN A;  5IE8 A;  4YWK A;  2VQF L;  1XPO A;  1DOL A;  2JXM B;  2Y0S G;  4Z9C B;  4DAY B;  1PH1 A;  1IYJ B;  3PUW A;  1CA6 A;  2R3Z A;  5IT9 L;  2J7Z A;  4ZLT F;  3ER0 A;  3AMU A;  2PI2 A;  1STE A;  3RLF A;  1I94 L;  4C1N I;  3VR3 A;  3BS1 A;  2E2H B;  1MIU A;  2ZJR A;  1T9H A;  1PZK D;  2BCO A;  3H6M A;  2WP8 J;  1EYG A;  2RCN A;  4EQN A;  1F77 A;  2L4N A;  4BA1 I;  3H0G H;  1ZYR C;  1CQF A;  1Y8P B;  3AEV A;  4AQY L;  1JOK A;  2RSO A;  4CDD C;  2AQ1 B;  3RMH A;  4LF9 Q;  1QWY A;  2JA8 G;  1E0B A;  3HOX H;  3PSI A;  4RGN A;  2ES2 A;  5KND A;  1S4Z A;  3A8J E;  4EQP A;  5ELE A;  4DV2 Q;  1IYU A;  2B8F A;  1TR5 A;  3STB C;  1JQY D;  3KDF B;  2A6E D;  1IW7 D;  1TWC B;  1EFI D;  2K5N A;  2Z0S A;  3R8B A;  5F2D A;  1K83 B;  1PRT C;  4C3I G;  2ZTD A;  1WYD A;  2EXD A;  1NY4 A;  2KBN A;  2OT2 A;  1LT3 D;  2L55 A;  3X3M A;  1EY6 A;  1BCP F;  3BDC A;  4X66 L;  1CI3 M;  4PG3 A;  2E2D C;  3KFU A;  3BZK A;  3MXP A;  1ET6 A;  2HQL A;  3I4L A;  4YY3 Q;  1LT5 D;  4UPA A;  4HSP A;  5C44 G;  1F9Q A;  4JBW A;  2VB2 X;  2RHS B;  4H13 C;  3C1E A;  3SK5 A;  2JA5 H;  1FL0 A;  5K5P A;  4MTN A;  3VYT A;  2R92 B;  1BNZ A;  4GNX A;  1VF7 A;  2JEA I;  2VQE L;  3HOV B;  1GXD C;  3VR2 A;  5JVH 3;  3L9A X;  3A8I E;  4GN3 B;  2UU9 Q;  1WFQ A;  5I6Y A;  5LMU Q;  1K73 C;  1TKW B;  3PCO B;  1SNP A;  1DJR D;  1QUQ B;  4MHE A;  3J7Z C;  4A3L H;  1AP0 A;  1QG7 A;  4YWM A;  1YIT A;  1A62 A;  1JOQ A;  5D65 A;  2NZH A;  3HOU B;  1XNQ L;  1STB A;  1D5M C;  3CHB D;  4CDE C;  3VR4 A;  1XNQ Q;  3PUZ A;  4L6T B;  2QDL A;  3I2Z A;  2FJ2 A;  4X65 L;  2X6G A;  5I9O A;  1B3Q A;  2EQS A;  4HCE A;  2KQ3 A;  5CYU A;  4OO1 G;  1QNU A;  4DR6 Q;  5C3E G;  1PH7 A;  1SYF A;  3TQY A;  1O7Y A;  4YCW A;  3P75 A;  1K83 H;  4B3S L;  4GNX B;  2NVQ H;  1QZH A;  1Q3L A;  3Q0A A;  3K6O A;  4UY8 C;  1N32 Q;  1IHZ A;  1Q90 A;  3KBG A;  1CFM A;  2HT1 A;  3OWF A;  4C3H G;  4DR2 Q;  1H9K A;  4DR3 Q;  3TN2 A;  1EEF D;  3BVG A;  3HOX B;  1L0W A;  1A8V A;  5JPN C;  3BVZ A;  4OHJ A;  3S15 H;  3C3L A;  3KF6 A;  1WJJ A;  2K5W A;  4NXM Q;  2D9U A;  4C2M H;  4HID A;  3FRP B;  3DMU A;  2Q8R E;  2FMM A;  1B44 D;  3UDI A;  1ILP A;  4TSS A;  3HKS A;  3J80 E;  4Y7N B;  4GS3 A;  2EYP A;  2XN9 C;  3UI2 A;  1DXM A;  4F88 A;  4K5V A;  2YTX A;  1C0A A;  3RN2 A;  3UE0 A;  1YHA A;  2PW5 A;  1Z9F A;  2CVR A;  4X62 Q;  1NMF A;  2B8G A;  1VQF A;  1I6H H;  4DNR B;  3M85 A;  4KMU C;  4YWL A;  5BR8 L;  4Q5V A;  1HQR D;  4JV5 Q;  2PNR C;  4P2C B;  1PXU A;  4X64 Q;  1Y1W H;  4FF1 A;  3E9H A;  4B3R L;  2FHT A;  1L2F A;  3R93 A;  1C48 A;  4A3E B;  3AFQ A;  1PH9 A;  1K8O A;  5IWA Q;  4A93 H;  4JI8 L;  1VQ6 A;  2Q8T A;  4DR5 L;  5NUC A;  1B9N A;  3W5O A;  5M5Y B;  3ONA B;  1QE6 A;  4J1M A;  1VQ4 A;  1NMG A;  1Y69 U;  4X62 L;  4L5T A;  3CCS A;  3L0O A;  3RZD H;  2MO0 A;  1EYD A;  1CZG A;  4OWT B;  1PV4 A;  4RKL A;  1XX8 A;  3D6C A;  4JI6 L;  3LX0 A;  1KHI A;  1VQ9 A;  4EGV A;  1M90 C;  2K7V A;  5HGT A;  2F4V Q;  2KA7 A;  4ULL A;  3AYH B;  5M3M B;  3ULL A;  4QIW B;  1PH2 A;  2SNM A;  1TWA B;  2SEB D;  4B3M L;  4ME3 A;  1GHJ A;  5GRO A;  4K2L A;  2MQH A;  1EIF A;  2ALY B;  1STA A;  3OMG A;  4A3E H;  1TWF B;  2DY8 A;  2XNA C;  4P75 A;  3SDZ A;  3V2T A;  2EOT A;  4XT3 B;  1BVS A;  1DGS A;  1D1K A;  3CKI B;  1A2U A;  2YYZ A;  3BDL A;  3GO5 A;  4FF2 A;  2F0N A;  4JYA L;  3CQZ H;  3KDF A;  2LKV A;  1HR0 W;  4OX9 L;  1C4Q A;  2F0M A;  1SND A;  2JQO A;  3PF5 A;  1JB7 A;  2HCI A;  2VUM G;  1N36 Q;  4R4Q A;  2E8G A;  2K5Q A;  3T1H L;  2WAQ B;  1Q8K A;  4DAM A;  5LHY 1;  1GUW A;  3BYT B;  3IFT A;  1TII D;  2JK8 A;  5T1G A;  3TEH B;  1PZJ D;  2VW9 A;  3IAY A;  5JEA G;  4DPG A;  5COY A;  1PRT D;  1Q46 A;  3UE1 A;  2K5H A;  2A6E C;  1G2T A;  5G3L D;  4NMZ A;  1NUC A;  1X54 A;  5C0X G;  1P16 A;  1PTO F;  1S5E D;  3JAM c;  4XYQ A;  2NYZ D;  5A2Q E;  4JI8 Q;  1BXT A;  4LJZ C;  5CV4 A;  1VQO A;  2YU9 H;  4N8F A;  3PO2 B;  4X6A H;  4CHT B;  2H1E A;  2LXK A;  1QVG A;  2CW0 D;  1Y8N B;  1I3Q B;  2F1M A;  4BY1 H;  3CCM A;  4N9T A;  4K0K L;  3HFZ B;  3V05 A;  3FDT A;  1K9M C;  3S1N H;  1EY0 A;  3L7Z C;  3VA7 A;  4IOC A;  1CSP A;  1MKH A;  3HOY H;  1HRJ A;  3S15 B;  3KF6 B;  2B2V C;  3STB D;  4DV6 Q;  1YJW A;  1EY4 A;  1QNK A;  4JI7 Q;  2D2C C;  4HR7 B;  5C5L A;  2QDB A;  2E2I B;  2UUC L;  4A3G G;  4K14 A;  5FO9 B;  4A3F B;  2XVS A;  4C3J H;  1SYB A;  2YTY A;  5IGE A;  5M3F G;  4A3B B;  1XPU A;  1BF4 A;  3MTS A;  3MWY W;  5IP7 G;  4FF4 A;  4KJN A;  4DR3 L;  2WKD A;  3D3R A;  1HZB A;  1LTA D;  1SXT A;  3D4W A;  4F8M A;  3A56 A;  5J1Z A;  4DV5 L;  4DN4 M;  3I91 A;  5EGT A;  4QGU A;  4LMQ D;  2UXD L;  3GTM B;  4IOA A;  4RAU C;  2R7Z B;  1W2B A;  1KNE A;  2JA7 H;  3I7F A;  2CHB D;  2J4X A;  1X3E A;  4IFD G;  4G57 A;  3I70 A;  4A3J H;  3ND8 A;  3E9I A;  1TS3 A;  3E5S A;  2XWJ B;  5C4J B;  1RDP D;  1LV9 A;  5M5Y H;  1J5E Q;  1PYB A;  3S1M B;  3PO2 G;  1N9W A;  2KJX A;  4X3S A;  2F0G A;  3TRZ A;  1J6Q A;  2HD3 A;  5E3F A;  1M1K C;  5JJK A;  4CKC A;  4DF7 A;  3EN2 A;  4MNO A;  5M3M H;  2IX1 A;  2ZM6 Q;  1F9S A;  3TP6 A;  4DA2 A;  4DK1 A;  1NR2 A;  3TS0 A;  2JA7 B;  1MD2 D;  1J8I A;  4S3S A;  1KRS A;  2NZO A;  2JE6 I;  5CBE E;  1LTS D;  5C5M A;  2MHV A;  3J7A V;  4DUY Q;  2PZT A;  5BN5 A;  2N55 A;  4IJL A;  1HR0 Q;  4A93 B;  4POF A;  3UDG A;  4DV3 L;  2F0T A;  4M1U B;  2UXD Q;  1UUP A;  2R92 H;  2BE5 D;  5DM6 3;  1C7Y A;  3SVM A;  4LF4 Q;  4A3C H;  1MSH A;  3GTO H;  1ASY A;  2B63 G;  1M8A A;  1UE5 A;  4KJO A;  4I65 A;  3E3X A;  4PMC A;  3CME A;  3QB3 A;  4A3J G;  3KF8 B;  1F2L A;  1EY9 A;  3M7N A;  1S5D D;  4DUY L;  2PQA A;  3VR5 A;  1NR4 A;  1VQP A;  3SEB A;  1LTR D;  4RCN A;  1JR0 D;  4UP9 A;  2IHF A;  1JWS D;  4BBS B;  3AQQ A;  4U68 A;  1CKO A;  2UXC Q;  4HMJ A;  4JI7 L;  2UUB L;  1B53 A;  4FXK C;  3NHH A;  1K0R A;  3Q8D A;  1TS2 A;  4R1J A;  5EPJ A;  2N3S A;  1I4Q A;  2IT1 A;  4NP5 A;  3U4V A;  1U5K A;  1KXL A;  1RTO A;  1SYG A;  3MC0 B;  4GNX C;  2O5I C;  2ID0 A;  2OXP A;  4FNF A;  4A3C G;  4KHP L;  3HOU H;  1IYV A;  1J9O A;  1AEX A;  3T16 A;  3K5O A;  1JCK B;  3PIO 3;  3J80 L;  2K75 A;  3W1G A;  4XT1 B;  4UHV A;  1I50 B;  2BH8 A;  3URY A;  1SNC A;  4ZK9 B;  5IP7 H;  3J81 E;  2N88 A;  3K7A H;  4KK7 A;  4JBM A;  4KKU A;  4YY3 L;  1BCP D;  3RNU A;  1VQM A;  3HGB A;  4GN5 A;  3IKJ A;  5IYD H;  2LXJ A;  1PHJ A;  5HY6 A;  2NVX H;  4LW1 A;  1HTP A;  4GKJ L;  2Z6K A;  4IPG A;  3OIP A;  1X55 A;  4B3M Q;  4FP5 D;  4YHH L;  4C1N K;  2EY1 A;  3F2C A;  1PH6 A;  2NVY B;  1ASZ A;  1VQI A;  1EFW A;  2ZXP A;  4AYB B;  1LM0 A;  3F2D A;  2XRS D;  3RLN A;  5ELB A;  3DHQ A;  2QCP X;  4NB3 A;  2PPB C;  2EYH A;  3KLS A;  1VQB A;  4BY1 G;  1I4H A;  3F8T A;  1H9R A;  3D8G A;  5FKA C;  3SK8 A;  3GTP B;  1Z7T A;  2QKI C;  3R3O A;  1MHW C;  4R9W A;  5IOD A;  1IKL A;  1CK1 A;  1CKN A;  1STY A;  2B3G A;  2RBM A;  3PUX A;  5C44 B;  2Y0S E;  1NCV A;  1X3Q A;  3NTH A;  5BR8 Q;  4X65 Q;  4JC0 A;  3SK4 A;  3DM1 A;  4QF4 A;  1R9T B;  4IUT A;  2AKW B;  3PUV A;  3VYS A;  3CP0 A;  4LFC Q;  1STN A;  5HUR A;  3TS2 A;  3NTI A;  4A75 A;  2VL6 A;  3GTQ B;  5LL6 X;  4OWW B;  4IQZ A;  4DV7 Q;  2JA5 G;  1EEI D;  3ICE A;  1DOK A;  1PTO C;  1KL9 A;  2UUB Q;  2MO1 A;  4O2D A;  4OON A;  3QJY A;  3PIO A;  1TWH H;  1G6Z A;  4DXG A;  2WAQ G;  5E4X A;  3M4O H;  4LUV A;  4PZ8 A;  3OTO Q;  4ZCK A;  4JV5 L;  2K01 A;  5A2Q L;  2PYK A;  2DY7 A;  3I4N B;  1SLJ A;  3ZJY C;  5D3D A;  3GTG B;  5LMN W;  1X3F A;  1SNO A;  4RA8 A;  4H44 C;  3CXC A;  4LF7 L;  1TWF H;  1RCV D;  2CQA A;  3I4N G;  1S5F D;  1NNX A;  4OEL B;  4DK3 C;  3K57 A;  3U58 A;  1TS5 A;  2RDH A;  5GQO A;  1B70 B;  4Y52 H;  3C2P A;  4ID6 A;  2MJ8 A;  3A7L A;  2Z4H A;  3D31 A;  1TVX A;  3H3V C;  3DXJ C;  1D2B A;  5M3M G;  2NN6 H;  3CCU A;  5J22 A;  1QIL A;  1U4P A;  1HA5 A;  2B2U C;  1YNJ D;  3GTJ B;  3CRK C;  3A0J A;  3MXU A;  3TP7 A;  3TSS A;  1EQQ A;  1XMQ L;  4G7O C;  2A73 B;  5LL6 S;  1Y1V H;  2B63 B;  3PO3 H;  3DUZ A;  1RF2 D;  4R4C A;  4DV0 L;  1SDF A;  2DUD A;  4IJH A;  4ZYS A;  4R8N A;  2F3I A;  2R61 A;  2X69 A;  3LWE A;  4GLX A;  1PH8 A;  1A3V A;  2E2I H;  2E5L Q;  2MP1 A;  1JJ2 A;  1TWH B;  3F2U A;  1BCP B;  1STH A;  1SE4 A;  1LT4 D;  3BZC A;  4JK1 C;  3S1R B;  1HQM C;  1ZXT A;  1VQL A;  3FHW A;  2K03 A;  4HED A;  1WTX A;  1SBB B;  2JEB I;  4BXX H;  2AMC B;  1W6K A;  4J15 A;  2WFW A;  3PO3 B;  2V4D A;  2F0Q A;  2KEC A;  4OXP A;  3S14 H;  1FR3 A;  1TU2 B;  1RIP A;  4K6D A;  3KYH C;  3Q24 A;  3GTG H;  2NBF A;  2EE1 A;  3C1F A;  4JI5 Q;  3I4M H;  5IP9 H;  1LTB D;  2MUY A;  3V96 A;  1QZG A;  3CC7 A;  2K5D A;  1OO9 B;  1B7Y B;  1BBX C;  3R2T A;  3NWS A;  3A54 A;  1J5E L;  3WOF A;  4DNI A;  2LSS A;  2A68 C;  2F0K A;  1O78 A;  5C3E H;  5ELF A;  1O7I A;  3AFP A;  1LAB A;  3OW7 A;  5ELO A;  5FJ8 G;  5KEE A;  5IYB G;  1YHB A;  2CCZ A;  2XWB B;  4XXE A;  4DAV A;  1MGS A;  1GVP A;  1IBK L;  1EYC A;  4GZY C;  4KV6 A;  2H4O A;  4TQU S;  2L12 A;  4B3S Q;  1HNZ L;  3C46 A;  1ICW A;  1HPC A;  2PQA B;  4XYO A;  3M7G A;  1E2Z A;  1OXT A;  4LNQ A;  2EYM A;  3CCQ A;  2QIL A;  1WCM G;  3MXG A;  1Q1B A;  4K0K Q;  4LF8 Q;  1EOT A;  2UUA Q;  4IO9 A;  2CQO A;  3N52 A;  2I5H A;  4A3F G;  1BBW A;  4GOP B;  1D1I A;  1HZ9 A;  2OTL A;  2PMZ B;  4A3B G;  1LT6 D;  1U0L A;  3MXN A;  1EL0 A;  1TS4 A;  5EBD A;  5GAH C;  2K52 A;  4DU9 A;  1R9T H;  2F4I A;  2PI2 E;  5EKI A;  3S1M H;  1X9N A;  2ICI A;  5DLQ E;  4PZ6 A;  3K59 A;  1GUO A;  2VUM H;  5C44 H;  3A5Z B;  4A4I A;  2AWN A;  2Q2U A;  1GUG A;  2F52 A;  3DWP A;  3I72 A;  4FO2 A;  3BZD B;  3H09 A;  2K5V A;  2JA9 A;  5CR3 A;  2RDF A;  4DR6 L;  2JA6 H;  1SYE A;  2NVQ B;  4JBK A;  2HHH Q;  3VYU A;  3RZD B;  2NTS A;  1XTD A;  1HR0 L;  5K36 G;  3KUP A;  2MPM A;  1RHP A;  2BA1 A;  5IIF A;  1HUN A;  4UP8 A;  1YNN C;  4ME5 A;  1JWU D;  1PMR A;  3PIP A;  3FEW X;  4HSV A;  3S24 A;  1MI2 A;  1FNV A;  5CMD A;  2D5D A;  1PRT B;  2ZXO A;  2WB1 B;  3EJI A;  2K6A A;  4XTC S;  1AE2 A;  2HDL A;  3J81 c;  4EQO A;  3CC2 A;  1CQV A;  1PTO D;  1HNZ Q;  3GTK H;  3T4A C;  3FKI B;  5IYD G;  2LFN A;  1YVC A;  4CKB A;  2VS1 A;  3HEJ A;  1JWM D;  4OO1 H;  4LFB Q;  1QJO A;  2XSC A;  3Q22 A;  5KIX A;  3HOX G;  3NSW A;  4GKJ Q;  1ZKO A;  2IHE A;  1VQA A;  2N78 A;  2H5X A;  2RSN A;  3NUC A;  1SAP A;  3SE0 A;  5FLM G;  1D7Q A;  3MXN B;  3NBI A;  2I5L X;  4RFB A;  1KD1 C;  1HNX L;  3CPF A;  3OPO A;  2XRQ D;  2F0D A;  5CV6 A;  2VY3 A;  3DEP A;  2A6H C;  3R2I A;  2C35 B;  1Y8O B;  1I4P A;  3I8Z A;  1PH5 A;  2B2Y A;  1U4L A;  2D62 A;  1C9O A;  2F0U A;  2Q2I A;  2VB3 X;  3K81 C;  1XMQ Q;  2KUM A;  3G48 A;  2IX3 A;  1X3P A;  3RZO H;  4AIM A;  3I55 A;  3I4M B;  4ZQ3 A;  3KLS X;  2VQF Q;  3HG9 A;  3PUY A;  5FLX L;  1V1O A;  2PMZ E;  1WTW A;  5JJI A;  2NN6 G;  1WD1 A;  4QB4 A;  5BN4 A;  5M5X H;  4JI5 L;  1I3Q H;  3OWE B;  4J6H A;  4R4T A;  3TDQ A;  2R93 H;  1I4X A;  4DR1 Q;  3NE5 B;  1N32 L;  4JI3 Q;  2F0W A;  1WTQ A;  3S1R H;  1AH9 A;  4GKK Q;  3T53 B;  1PVO A;  4KY6 A;  2IJ0 A;  3NP8 A;  1QVF A;  3AU7 A;  1BQQ T;  1P8L A;  4BWG B;  1G2S A;  5L37 A;  3H15 A;  1G51 A;  2F0J A;  5C4X G;  3GTM H;  2MNA A;  4LWC A;  4X3T A;  1EY7 A;  1N34 L;  1VMC A;  3J7A F;  4A93 G;  2YTV A;  3ITP A;  1FD7 D;  2E5L L;  1PFM A;  4EX5 A;  1TY0 A;  4FYD A;  3B6Y A;  4KLK A;  3K7A B;  4CDC C;  1WVL A;  2IY5 B;  1JJG A;  5C4Z A;  1BUV T;  1TWA H;  1WCM B;  1ENA A;  3H94 A;  3MZ5 A;  3TP5 A;  3S2H B;  1GUS A;  3OSO A;  2NVT H;  4RG1 A;  2JA6 B;  1RL2 A;  1E2V A;  3BDO A;  1W3S A;  4NXM L;  4IFD I;  5BN3 A;  1SMY D;  4XQJ A;  4OWX B;  2UUA L;  1G91 A;  3NXW A;  3EBE A;  2R93 B;  4K6L A;  1A3T A;  2DNC A;  5CBA E;  1XPR A;  2M2L A;  1TXY A;  5TSS A;  5IGB A;  5LMU L;  1B1Z A;  1EU4 A;  5CV9 A;  1CKM A;  5M3F B;  1A2T A;  1CUK A;  2IW3 A;  1L1O A;  1SMY C;  3FP9 A;  3QG1 A;  1PH4 A;  1I4R A;  1FJG L;  3GDE A;  3BJU A;  3J81 i;  2CW0 C;  4A76 A;  4CJ1 B;  3U9S A;  3ULP A;  1K3B C;  2CFM A;  1WD0 A;  3CCR A;  5C3W A;  3DM3 A;  3NPP A;  5EAY A;  3CD6 A;  2MGS A;  3HOZ H;  3W1B A;  2WAQ E;  4P71 A;  2K14 A;  4A3I H;  2I5M X;  1UWV A;  3NWT A;  1S40 A;  2L11 A;  1HNW Q;  4HMI A;  4ILW A;  5FLM H;  1S72 A;  4GKK L;  1EIG A;  4DV2 L;  1SMX A;  1WTV A;  1FVI A;  1SNQ A;  1KDA A;  3SHL A;  1K3R A;  1PLF A;  4MZ9 A;  4IUV A;  4NXN L;  1WI5 A;  4ODG A;  4LF9 L;  1XXG A;  1I6H B;  1KNA A;  1C8C A;  2I0Q A;  4IN3 A;  3JAM E;  1OTC A;  1XMO Q;  4Q0F A;  3HOY G;  3OOC A;  1VDZ A;  3I90 A;  4LFA L;  2PCF B;  3W3A A;  5A35 A;  4QL5 A;  1OXU A;  2R92 G;  1CHP D;  3T1H Q;  3GTO B;  1Q8I A;  1IKM A;  4DV1 Q;  3MEH A;  4K8J A;  2E74 C;  2VNU D;  1FNW A;  2Q2T A;  2L9H A;  4JW0 A;  2Z1C A;  4QY7 A;  1ONL A;  1UEA B;  4ZUI A;  4ZAI A;  4AQY Q;  5AJ3 L;  3T51 B;  3Q23 A;  5JEA J;  5IY0 A;  1KAA A;  2E2J B;  4BS9 A;  1IL2 A;  4A3M G;  4QCL A;  4V0B A;  2J0T D;  3CCV A;  2QGQ A;  4DAY A;  1DOM A;  4RKB A;  4CJ2 C;  4P74 A;  5FO7 B;  3G71 A;  4HTH A;  2KHI A;  2TSS A;  1KLU D;  1ICF B;  5M3F H;  2EPB A;  3J80 c;  1EY5 A;  1HCZ A;  2EVB A;  2UXC L;  1O7Z A;  4DXF A;  1H95 A;  4L5S A;  1SJH D;  5E1F A;  3U50 C;  3GV3 A;  1ESR A;  4HCS A;  2VXW A;  4KHV A;  5C0X I;  2L15 A;  4QUC A;  5KYL A;  2OCE A;  2LY7 A;  5JPM C;  3CMA A;  4QQB X;  4L5R C;  2LMC B;  1KAB A;  4PQX A;  2A19 A;  3HP3 A;  4KY7 A;  1KIX A;  1HJP A;  3U9O A;  1UAP A;  3A74 A;  1Z6H A;  4WOR A;  1SRO A;  2I46 A;  2E75 C;  2KCT A;  5M9O A;  4IFD H;  2JA5 B;  1HHV A;  4JI1 Q;  4LUO A;  1I94 Q;  3MAQ A;  4DR7 L;  3T56 B;  1XNR Q;  4IAL A;  1V9P A;  2RCF A;  1EY8 A;  4JI4 L;  3HOY B;  1SNM A;  2WII B;  4NDX A;  5D3I B;  3F1Z A;  5DNF A;  3TRE A;  1N33 Q;  2ATW A;  1WOC A;  4AYB G;  1T5E A;  1F2Z A;  3G6J B;  3OIQ A;  4QUF A;  1B2T A;  4AYB E;  3FVQ A;  1S5C D;  1GD7 A;  2N8N A;  3HKZ B;  5CV8 A;  1PYS B;  2B2W A;  3I4N H;  2EIF A;  2EDG A;  1PDQ A;  5COR A;  4ABN A;  3MVV A;  4GLA C;  4RMF A;  3HOZ G;  1EYA A;  1NBW A;  1CSQ A;  2A6H D;  4IUN A;  4L63 B;  2WIN B;  3GP7 A;  4IFD J;  3CF5 A;  1EZ6 A;  1JIC A;  1CKN B;  3BU2 A;  2VZA A;  2PO4 A;  2WKC A;  3E6Z X;  3EA6 A;  5C6A A;  2E2J H;  4JI6 Q;  1PRT F;  2KOL A;  1N34 Q;  4F7X A;  1SFO H;  4ZKB B;  4JYA Q;  1VQJ A;  3PO3 G;  3TZU A;  3HZX A;  5ELD A;  1WTH A;  2N49 A;  4JVZ A;  3A5U A;  4KTA A;  1TWC H;  4KKT A;  4G4K A;  2GVA A;  2ZJQ A;  2SOB A;  1PYW D;  1UNS A;  1SYC A;  2ICE C;  1NE3 A;  1Z47 A;  1V1P B;  2KEE A;  3W2D A;  4A3L G;  3WOE A;  1EOV A;  3PV0 A;  1YZ6 A;  1JOR A;  1X32 A;  1FNU A;  1L1O B;  5KYI A;  4YIJ A;  3TME A;  1HNW L;  4F87 A;  3OW2 A;  2K32 A;  3RLO A;  3E0J A;  2BOS A;  1IXR A;  4RHS A;  3T1Y L;  4N8X 1;  1RTN A;  3SXH A;  3KJO A;  2Z6B A;  1V1Q A;  1PFN A;  4RCO A;  4OO1 I;  1STG A;  4HJ8 A;  1O7L A;  3HOZ B;  5GAG C;  4CDF C;  1JOO A;  4FF3 A;  4RGT A;  3L2P A;  3MEF A;  2EJM A;  4DFA A;  2LS0 1;  1U4M A;  3HKZ G;  3HOW G;  4BBR B;  4K5W A;  3HKZ E;  1II3 A;  2PZU A;  3I4O A;  4WRD A;  3S16 H;  1LYL A;  2NVX B;  1E3P A;  4UAI A;  3BG3 A;  4R4O A;  2SNS A;  4JI2 L;  4JBJ A;  1YNN D;  1PTO H;  4DV5 Q;  3J7A 5;  1G8Z D;  2NWG A;  2EZV A;  3S16 B;  1HZA A;  3QIA A;  3HOV G;  3CW2 C;  1RKN A;  1K0S A;  2NZ1 D;  1IW7 C;  3J81 L;  4HIO A;  5KNB A;  1A3U A;  3KLR A;  4QMG A;  3I3C A;  3FPU B;  3NEM A;  1EU3 A;  3MFG A;  1YHQ A;  2L1B A;  1ILQ A;  4HIK A;  1KDB A;  4I7Z C;  4CBV A;  4NKL A;  1E2W A;  4KY5 A;  3DWA A;  3P20 A;  1V8Q A;  1ZYR D;  3MHB A;  4A3B H;  1FJG Q;  4PZ7 A;  2ASB A;  1B8A A;  1FYC A;  2FMC A;  4UDU C;  2UU9 L;  2XGT A;  2OQ0 A;  4C2M B;  2A68 D;  4DAP A;  2ZJP A;  2C9O A;  2PQE A;  2HUG A;  5ISR A;  3G6E A;  3PMF A;  1YNX A;  3KJP A;  1D5X C;  2EJG C;  2QF7 A;  3HOW H;  3CAM A;  1YBY A;  4RGO S;  1DCZ A;  3EFX D;  4X3K A;  2EJF C;  4A3M H;  3G4S A;  2BE5 C;  1IBL Q;  5CV7 A;  4M8A A;  5IP9 G;  1SRU A;  5IOC A;  3H0G B;  4QIW E;  2ENB A;  4PNY A;  3WWV A;  4XDX A;  3SK6 A;  3DWQ A;  3M9B A;  1MJC A;  3ERQ A;  5DEH A;  1QB5 D;  3RZO B;  3SR1 A;  4K5X A;  1CHQ D;  4BXX G;  3M4O B;  4DK6 C;  4B9X A;  1IZ6 A;  4A3I G;  2R7Z G;  4NPS A;  2HIX A;  2AHO B;  1GO3 E;  5I2Y A;  1SYD A;  4JI2 Q;  3HOW B;  5I6W A;  2VQE Q;  1Q12 A;  3K5L A;  4DR5 Q;  3I4M G;  1T5X D;  5FO8 B;  2EY6 A;  3ND9 A;  3GQB A;  2K05 A;  1YIJ A;  3GD7 A;  1LTT D;  1K8G A;  4RGM A;  1DM0 B;  2B2W C;  5EKK A;  1H9S B;  4NW2 A;  1GHK A;  1GJX A;  1A63 A;  1EWI A;  5EPK A;  4JI0 L;  4DV4 Q;  1Q81 C;  1YNJ C;  1U4R A;  1B9M A;  3H0G G;  3GTJ H;  2RF4 A;  1PH3 A;  1LO5 D;  3S2D H;  5JAV A;  5C0X H;  3DLL A;  2CWP A;  4NXN Q;  2A74 C;  1EQR A;  3GTP H;  1K8A C;  2MFI A;  2AQ2 B;  5C3X A;  2AUJ D;  2UUC Q;  1EQT A;  1WCM H;  5GAE C;  1OXS C;  3NBH A;  2JYO A;  3IRB A;  1PTO B;  1X6O A;  1U9R A;  1SE3 A;  3OHX C;  4HJ5 A;  2G9H D;  1AZP A;  2A8V A;  3HOV H;  4LF6 Q;  2B2T A;  4KHZ A;  1NJI C;  4JI1 L;  3J7Y W;  1EWC A;  3U4Z A;  1KC8 C;  2KHJ A;  4O0A A;  4C3J B;  1Q1E A;  5IWA L;  3ERS X;  3CCL A;  4DK0 A;  4DNT B;  1R4Q B;  4KN4 C;  4A3D G;  4B3R Q;  2F3W A;  1ROD A;  3CCE A;  4L8J A;  5C0X J;  2K1B A;  4X64 L;  4ZKC B;  4EVO A;  3K5M A;  4GOP C;  3D6W A;  1B50 A;  3M4P A;  1X56 A;  3WDN A;  2B2T C;  3F2B A;  4DGZ A;  1Q82 C;  2R93 G;  1FGU A;  1LUZ A;  2HDM A;  1WTR A;  2FIN B;  1H9S A;  1JC7 A;  5AFW A;  4C3H B;  2RVL A;  4LF5 L;  1KAW A;  2EY5 A;  3S9W A;  2ZM6 L;  1KDC A;  1X65 A;  2L5T A;  3VDY A;  1HFG A;  1KQS A;  1XYI A;  1O80 A;  5EKL A;  4TVA B;  2AUK A;  2F0V A;  2RDG A;  2ZTE A;  2EYO A;  2JA7 G;  1HXY D;  2KCN A;  1PFS A;  1VMP A;  1F2Y A;  2R7F A;  2RKS A;  1IBM Q;  4HAE A;  1L0X B;  1KTK A;  4K8I A;  1Q86 C;  2B29 A;  5M5W H;  3GV6 A;  4YCU A;  4BY7 H;  4IUQ A;  2IWH A;  4DR2 L;  3TBI B;  2IL8 A;  3QO2 A;  1PA6 A;  2NTT A;  2KEN A;  2UXB Q;  1Y1W G;  5FLX c;  2IX0 A;  5J3B A;  2Z8L A;  2PW7 A;  3NQT A;  1TWG H;  1AN8 A;  3LGJ A;  5J39 A;  2F0L A;  1G6P A;  3JAM L;  1EWH A;  1OXV A;  3H91 A;  4A3J B;  3ZYY X;  1NTG A;  3M3Y H;  4OL7 A;  4A3K G;  2DGY A;  1ET9 A;  2E76 C;  3T1Y Q;  5CV5 A;  4LFC L;  2JA8 H;  1VQ8 A;  3D4D A;  4LAA A;  1ML0 D;  2B2Y C;  3OMC A;  1EZ8 A;  1GUT A;  3RR5 A;  2B2V A;  3E0E A;  3VA5 A;  2K50 A;  3FMC A;  3K0Y A;  3UDX A;  3ULJ A;  2ZT9 C;  4HJ7 A;  1EIY B;  3P1H A;  3BVM A;  4DV3 Q;  4DR4 Q;  1CT1 D;  1DZ1 A;  1D8L A;  1SEB D;  3GTL B;  4DV0 Q;  2M00 A;  4FVM A;  1LTL A;  4B08 A;  3MA2 B;  4A3D H;  1F9P A;  1QUQ A;  3UDF A;  2Q2H A;  4WJ4 A;  5FK9 C;  1GUN A;  3ERO A;  5D14 A;  1TWG B;  2F0E A;  4ALP A;  1BOS A;  5FOB B;  4CGY B;  3KOJ A;  1E1O A;  1VQE A;  5I9P A;  2OEO A;  1K28 A;  4O42 A;  4JI3 L;  1MBY A;  4JOI C;  5C4J H;  4BA2 I;  1HZC A;  1I5F A;  3L3O C;  5T1I A;  3M4Q A;  2JA8 B;  1H9M A;  2RA4 A;  5M5W B;  4BY7 B;  2HQE A;  1AE3 A;  1IL8 A;  4A3M B;  4PMW A;  2JN4 A;  1RD9 D;  1ENF A;  5C3E B;  2KCC A;  3RN5 A;  2RHQ B;  1LTG D;  1VQ5 A;  4MIU A;  3PO2 H;  2Y0S B;  3H3V I;  4DV4 L;  1L1O C;  5EBC A;  5KRU A;  1QOH A;  1BBU A;  4LK1 C;  5M5X B;  3S1Q H;  1XWE A;  3K7U C;  1ZEQ X;  3D4R A;  4IPH A;  2OWO A;  3CC4 A;  4PMB A;  1XJV A;  1EIH A;  2PZW A;  1PZI D;  1MJE A;  2F3V A;  1L0Y B;  2Z9H A;  4A3F H;  3PF4 A;  3DEO A;  3G7L A;  2E2H H;  4BBS H;  3FPP A;  4RH6 A;  1R4P B;  5KGU A;  1VQC A;  2K4K A;  3FKI H;  4O1N A;  5H1S E;  1OXX K;  1YJN A;  2AQ3 B;  1BKB A;  1V1P A;  2XTI A;  1GM5 A;  2X6L A;  4BY7 G;  1HH2 P;  4K2K A;  4IUR A;  4DUZ L;  2RQX A;  4GN4 B;  4C3H H;  2XIW A;  1XTC D;  4C3I B;  3QR8 A;  3NK9 A;  2EYL A;  5CGK A;  3NQI A;  4A3K B;  5EJW A;  4ZUJ A;  4LUZ A;  4DV7 L;  3S14 B;  4IUP A;  4XIG S;  4UP7 A;  1HA6 A;  5FJ8 H;  3P7J A;  3D0F A;  2TMP A;  5IYB H;  4BY1 B;  5KNC A;  2QA4 A;  3KF8 A;  4C56 C;  1CZW A;  5K36 H;  1S3O A;  4IUU A;  1BO0 A;  1SR3 A;  1KRT A;  1UE7 A;  2NVY H;  4BBR H;  2R7D A;  4G7Z C;  2NUC A;  4HJA A;  3PIP 3;  4JI0 Q;  3QOJ A;  1QCB D;  5DM7 3;  1FGB D;  4HIM A;  2JSO A;  4GLV B;  3S2H H;  4DV1 L;  4OGQ C;  3HS0 C;  5IGF A;  2KVM A;  3K80 C;  2K04 A;  1KLG D;  4OIJ A;  1E24 A;  4OIK A;  1TY2 A;  1EQV A;  2F0P A;  5LMN L;  3H3V H;  2A5H A;  2R6G A;  4BBS G;  4B9W A;  1HUM A;  4X66 Q;  4KKS A;  1E7Z A;  2KHS A;  4J8Q A;  3JC6 6;  3N6R A;  1K8M A;  5JEA H;  4QJF A;  5EPL A;  5ELN A;  5IGC A;  4B3T L;  5DAU A;  1N33 L;  3LNN A;  4OEM B;  3J80 i;  1AZQ A;  3VR6 A;  1BDO A;  4POG A;  1F2M A;  1PFB A;  2CH4 A;  2KCM A;  3KK7 A;  2F0H A;  4BBR G;  3BYY B;  3JAM i;  1YJ9 A;  1IBL L;  1A15 A;  4A3G H;  1VQG A;  2CH4 W;  3X3N A;  2EY2 A;  4OX9 Q;  4V19 0;  2I07 B;  2FFK B;  4MTK A;  2BA0 A;  1CM9 A;  1W6J A;  4IZ8 A;  2F0S A;  2NB0 A;  2O4X A;  1SFO B;  2A1A A;  3KLW A;  4KN7 C;  2EXZ A;  1MSG A;  2OQK A;  3MFY A;  4LF6 L;  4HJ9 A;  4A3E G;  1A6X A;  4R4I A;  2IPK D;  1BR9 A;  4IPC A;  2F03 A;  5JJL A;  2YU9 B;  4XQQ A;  1NSN S;  3VYR A;  2A69 C;  4JG2 A;  2EYJ A;  1VQ7 A;  2DJG C;  2F0I A;  2F0F A;  4JOI A;  3RUZ A;  5G3L F;  1VQD A;  3O13 A;  3AB9 A;  2OTJ A;  4A3K H;  5C4X H;  3OYY A;  2GVB A;  1VQK A;  4RHR A;  3CPW A;  2AWO A;  2K33 A;  2FXQ A;  4FDB A;  5HGQ A;  2PNH A;  5LMN Q;  4N9P A;  4G7H C;  4A3D B;  2M9V A;  3GTL H;  3KBX A;  3CQZ B;  1VF5 C;  3QOL A;  1CA5 A;  1Y1V G;  5GAD C;  4DR7 Q;  2UXB L;  4ZRZ A;  3I73 A;  1JT8 A;  5FLX E;  4TRD A;  3IL8 A;  1WTO A;  3QWN A;  5IGD A;  3OTO L;  5E4W C;  1IBM L;  1VCI A;  3CU7 A;  4A3G B;  4L5Q A;  2QEX A; 
#chains in the Genus database with same CATH homology
 2XGT A;  1UEB A;  5DLQ E;  4LF4 L;  2OQ0 A;  4PZ6 A;  2VUM H;  1X54 A;  5C0X G;  1P16 A;  2ZJP A;  5C44 H;  3A5Z B;  3JAM c;  3G6E A;  4A4I A;  2AWN A;  2Q2U A;  2F52 A;  1YNX A;  3KJP A;  4JI8 Q;  3HOW H;  5IYC H;  2K5V A;  2JA9 A;  3PGZ A;  1VQO A;  4AH6 A;  4P72 A;  3CAM A;  2YU9 H;  1YBY A;  2GN5 A;  2ZTC A;  4X6A H;  1EUJ A;  4DR6 L;  2LXK A;  4DUZ Q;  1QVG A;  2JA6 H;  4A3M H;  5IT9 c;  4BY1 H;  4JBK A;  3G4S A;  2HHH Q;  3CCM A;  1IBL Q;  1XTD A;  5IP9 G;  4K0K L;  1SRU A;  1HR0 L;  5K36 G;  4QIW E;  3HFZ B;  4KI0 A;  2BA1 A;  3WWV A;  2B63 H;  3M9B A;  4UP8 A;  1MJC A;  4IPD A;  1YEZ A;  5E7N A;  3NEL A;  3PIP A;  5AJ3 Q;  3S24 A;  1K9M C;  3S1N H;  4BXX G;  3L7Z C;  4IOC A;  1CSP A;  1I50 H;  1MKH A;  4DK6 C;  3HOY H;  1IZ6 A;  4A3I G;  2R7Z G;  2WB1 G;  3KF6 B;  4NPS A;  2HIX A;  1IBK Q;  2AHO B;  1GO3 E;  3STB D;  4DV6 Q;  3S17 H;  1QVC A;  1AE2 A;  4XTC S;  4JI2 Q;  2WB1 E;  3J81 c;  3CC2 A;  1YJW A;  2VQE Q;  1Q12 A;  4DR5 Q;  1HNZ Q;  3I4M G;  2CWA A;  2HIV A;  4P73 A;  4JI7 Q;  3GTK H;  1VS0 A;  2UUC L;  1UE1 A;  5IYD G;  1YVC A;  4A3G G;  2VS1 A;  1YIJ A;  3FKI G;  3GD7 A;  1K8G A;  5IYC G;  4LFB Q;  4C3J H;  2YTY A;  3HOX G;  3CCJ A;  5M3F G;  3I56 A;  1A63 A;  1EWI A;  4JI0 L;  1XPU A;  4GKJ Q;  4Y7N H;  3NBH B;  5IP7 G;  2IHE A;  1VQA A;  2N78 A;  2H5X A;  4DV4 Q;  4DR3 L;  1Q81 C;  5FLM G;  3K0X A;  3MXN B;  1D7Q A;  3K8A A;  1HZB A;  1GKH A;  2I5L X;  1KD1 C;  1HNX L;  3CPF A;  3H0G G;  1A0I A;  3GTJ H;  2RF4 A;  4DV5 L;  4LF5 Q;  1PH3 A;  4QGU A;  1E1T A;  2UXD L;  2V1C C;  2VY3 A;  3S2D H;  4IOA A;  2C35 B;  3DLL A;  2CWP A;  1W2B A;  4NXN Q;  1PH5 A;  2YV5 A;  2JA7 H;  3I7F A;  1EQR A;  3GTP H;  1X3E A;  1Q7Y C;  1K8A C;  4IFD G;  2MFI A;  2D62 A;  2UUC Q;  4A3J H;  3E9I A;  1C9O A;  2Q2I A;  3K81 C;  1XMQ Q;  3G48 A;  1WCM H;  5GAE C;  1OXS C;  3IRB A;  4JI4 Q;  3RZO H;  4AIM A;  5M5Y H;  3I55 A;  2D0P A;  4WJ3 M;  1J5E Q;  1X6O A;  1XNR L;  3HOU G;  2VQF Q;  1PYB A;  4DR4 L;  1JJC B;  3PO2 G;  1N9W A;  4DV6 L;  4HJ5 A;  3J81 j;  3PUY A;  2Z6K C;  4APV A;  1JMC A;  1J6Q A;  3TRZ A;  4H02 A;  2PMZ E;  2A8V A;  5JJI A;  3HOV H;  2NN6 G;  4KHZ A;  4C3I H;  1NJI C;  1M1K C;  4JI1 L;  4LF6 Q;  4LFA Q;  1HNX Q;  3U4Z A;  5M5X H;  2KHJ A;  4JI5 L;  1KC8 C;  3EN2 A;  1YI2 A;  4O0A A;  1I3Q H;  4MNO A;  4R4T A;  1Q1E A;  5M3M H;  2R93 H;  2IX1 A;  1XMO L;  4DR1 Q;  5IWA L;  1N32 L;  2ZM6 Q;  4JI3 Q;  3ERS X;  3CCL A;  3S1R H;  1AH9 A;  4GKK Q;  1PVO A;  3TS0 A;  4A3D G;  4B3R Q;  1QVF A;  3CCE A;  1KRS A;  5C0X J;  2NZO A;  1P8L A;  1Y14 B;  2JE6 I;  4DKA C;  4X64 L;  1VQH A;  3H15 A;  1G51 A;  4DUY Q;  3GTQ H;  4GOP C;  5C4X G;  3GTM H;  4IJL A;  1HR0 Q;  3M4P A;  1X56 A;  2MNA A;  4LWC A;  1N34 L;  4EQ5 A;  4POF A;  3F2B A;  1JE5 A;  2HHH L;  3UDG A;  4A93 G;  2YTV A;  4DV3 L;  1Q82 C;  2R93 G;  1V43 A;  1N36 L;  2E5L L;  1FGU A;  4B3T Q;  1LUZ A;  4EX5 A;  2UXD Q;  3S1M H;  2R92 H;  1N8R C;  1C7Y A;  3B6Y A;  4LF4 Q;  4LF5 L;  4A3C H;  1KAW A;  4KLK A;  1E22 A;  3GTO H;  2IY5 B;  1JJG A;  2ZM6 L;  5JJK A;  1ASY A;  2B63 G;  1TWA H;  1X3G A;  2CKZ B;  1UE5 A;  1X65 A;  2NVT H;  4RG1 A;  3VDY A;  1KQS A;  1RL2 A;  4LF7 Q;  2D0O A;  4TVA B;  1W3S A;  3CME A;  4A3J G;  2ZTE A;  2JA7 G;  1VQN A;  4LFB L;  3KF8 B;  4NXM L;  2R7Z H;  1PFS A;  3M7N A;  4DUY L;  4IFD I;  2PQA A;  2R7F A;  3SGI A;  1VQP A;  1IBM Q;  4OWX B;  2BH2 A;  1G29 1;  1Q86 C;  2B29 A;  4UP9 A;  2IHF A;  2UUA L;  4JCV E;  4YCU A;  3AQQ A;  5M5W H;  4BY7 H;  3EBE A;  1CKO A;  2UXC Q;  4JI7 L;  4DR2 L;  2UUB L;  4KHP Q;  1SN8 A;  1XPR A;  1PA6 A;  2KEN A;  1K0R A;  2UXB Q;  3Q8D A;  4YHH Q;  1TXY A;  1Y1W G;  4DR1 L;  2F4V L;  3EIV A;  5FLX c;  4R1J A;  2IX0 A;  2N3S A;  5J3B A;  2IT1 A;  5LMU L;  4LF8 L;  3U4V A;  1U5K A;  1UE6 A;  1TWG H;  4GOP A;  1KXL A;  1CKM A;  3LGJ A;  1CUK A;  4YCV A;  3FP9 A;  1L1O A;  2JA6 G;  2JJQ A;  1SE8 A;  1PH4 A;  2NN6 I;  4GNX C;  3NEN A;  1G6P A;  5IE8 A;  1FJG L;  3GDE A;  4YWK A;  3BJU A;  1OXV A;  3J81 i;  2VQF L;  4A76 A;  2ID0 A;  3ULP A;  1XPO A;  4A3C G;  2CFM A;  3HOU H;  2Y0S G;  1NTG A;  4KHP L;  3M3Y H;  3CCR A;  4DAY B;  3DM3 A;  5EAY A;  1PH1 A;  3CD6 A;  1IYJ B;  4A3K G;  3W1B A;  2DGY A;  3T1Y Q;  3HOZ H;  2K75 A;  2WAQ E;  3PUW A;  4LFC L;  3W1G A;  4P71 A;  2JA8 H;  2K14 A;  1VQ8 A;  4A3I H;  2I5M X;  3ER0 A;  1UWV A;  2PI2 A;  3RLF A;  1S40 A;  2BH8 A;  1I94 L;  1HNW Q;  5IP7 H;  3K7A H;  4JBM A;  4YY3 L;  5FLM H;  1S72 A;  4GKK L;  1MIU A;  2ZJR A;  1T9H A;  1SMX A;  4DV2 L;  3RNU A;  1VQM A;  1EYG A;  2WP8 J;  1FVI A;  4GN5 A;  3RR5 A;  2RCN A;  1K3R A;  4BA1 I;  3H0G H;  3E0E A;  5IYD H;  4MZ9 A;  2LXJ A;  1PHJ A;  4NXN L;  3AEV A;  4AQY L;  1WI5 A;  2K50 A;  3ULJ A;  5HY6 A;  3UDX A;  2NVX H;  4LF9 L;  4HJ7 A;  4LW1 A;  2I0Q A;  4GKJ L;  4LF9 Q;  1EIY B;  2Z6K A;  4IPG A;  2JA8 G;  1OTC A;  1XMO Q;  3HOY G;  4DV3 Q;  4DR4 Q;  3HOX H;  3PSI A;  1X55 A;  2ES2 A;  1D8L A;  4B3M Q;  4LFA L;  4DV0 Q;  4YHH L;  3F2C A;  1PH6 A;  1ASZ A;  1LTL A;  4QL5 A;  1VQI A;  4DV2 Q;  1EFW A;  4A3D H;  1QUQ A;  3STB C;  1LM0 A;  1OXU A;  3UDF A;  3KDF B;  3T1H Q;  3F2D A;  2R92 G;  2Q2H A;  4WJ4 A;  3RLN A;  2K5N A;  2Z0S A;  4DV1 Q;  2VNU D;  4ALP A;  2Q2T A;  2ZTD A;  1WYD A;  2EXD A;  1NY4 A;  3KOJ A;  4QY7 A;  1E1O A;  1VQE A;  2KBN A;  4NB3 A;  4JI3 L;  4JOI C;  5C4J H;  1VQB A;  4BY1 G;  5AJ3 L;  4AQY Q;  5JEA J;  4BA2 I;  1HZC A;  4X66 L;  5IY0 A;  1I5F A;  3F8T A;  4PG3 A;  3M4Q A;  1IL2 A;  3KFU A;  3BZK A;  4A3M G;  2HQL A;  3CCV A;  1AE3 A;  4PMW A;  2QGQ A;  4YY3 Q;  3RN5 A;  4UPA A;  2RHQ B;  1CKN A;  4P74 A;  3G71 A;  5C44 G;  1VQ5 A;  3PO2 H;  4JBW A;  3H3V I;  2B3G A;  3PUX A;  2KHI A;  2RHS B;  2Y0S E;  4DV4 L;  1L1O C;  2JA5 H;  1FL0 A;  5M3F H;  5BR8 Q;  4MTN A;  4X65 Q;  3J80 c;  1BBU A;  2UXC L;  3S1Q H;  4JC0 A;  3K7U C;  4GNX A;  1H95 A;  4L5S A;  2JEA I;  2AKW B;  3PUV A;  4IPH A;  2VQE L;  3CC4 A;  3U50 C;  2OWO A;  1XJV A;  3CP0 A;  1MJE A;  4LFC Q;  5C0X I;  2L15 A;  3CMA A;  3TS2 A;  2OCE A;  4GN3 B;  4A3F H;  3PF4 A;  4QQB X;  4A75 A;  2E2H H;  2UU9 Q;  4L5R C;  1WFQ A;  2VL6 A;  4BBS H;  2A19 A;  5LMU Q;  1K73 C;  4OWW B;  3PCO B;  1KIX A;  1HJP A;  1VQC A;  4DV7 Q;  2K4K A;  3A74 A;  2JA5 G;  1QUQ B;  3FKI H;  3ICE A;  1SRO A;  5H1S E;  2KCT A;  3J7Z C;  4A3L H;  1KL9 A;  2UUB Q;  4YWM A;  1OXX K;  4JI1 Q;  1YJN A;  2MO1 A;  4O2D A;  1YIT A;  4LUO A;  1A62 A;  4OON A;  3PIO A;  1BKB A;  2NZH A;  2XTI A;  1GM5 A;  1I94 Q;  1TWH H;  4BY7 G;  1HH2 P;  1XNQ L;  2WAQ G;  4DR7 L;  1XNR Q;  3M4O H;  4DUZ L;  1XNQ Q;  3PUZ A;  4GN4 B;  4LUV A;  1V9P A;  4PZ8 A;  3OTO Q;  4JV5 L;  4JI4 L;  4C3H H;  3I2Z A;  1SLJ A;  3ZJY C;  4X65 L;  5LMN W;  3F1Z A;  1X3F A;  3TRE A;  1N33 Q;  2ATW A;  3CXC A;  4LF7 L;  1TWF H;  2EQS A;  1WOC A;  4LUZ A;  4DV7 L;  4OO1 G;  4DR6 Q;  4AYB G;  5C3E G;  4XIG S;  4UP7 A;  1PH7 A;  5FJ8 H;  3TQY A;  4YCW A;  3D0F A;  5IYB H;  1K83 H;  4AYB E;  4B3S L;  2N8N A;  1GD7 A;  4GNX B;  2QA4 A;  2NVQ H;  1QZH A;  1PYS B;  4DK3 C;  3I4N H;  2EIF A;  3U58 A;  4UY8 C;  1N32 Q;  1S3O A;  5GQO A;  1B70 B;  4GLA C;  4Y52 H;  1SR3 A;  4RMF A;  1KRT A;  3HOZ G;  1UE7 A;  2NVY H;  4BBR H;  2HT1 A;  2R7D A;  3D31 A;  4DR2 Q;  4DR3 Q;  1NBW A;  1CSQ A;  4IFD J;  4HJA A;  3CF5 A;  4JI0 Q;  1L0W A;  1A8V A;  5M3M G;  3S15 H;  3CCU A;  1CKN B;  3BU2 A;  4HIM A;  2VZA A;  3KF6 A;  2E2J H;  4GLV B;  3S2H H;  1WJJ A;  4DV1 L;  4JI6 Q;  4NXM Q;  1N34 Q;  4C2M H;  3A0J A;  1SFO H;  1EQQ A;  3K80 C;  4HID A;  1XMQ L;  1E24 A;  4JYA Q;  1Y1V H;  3PO3 H;  3UDI A;  5LMN L;  3H3V H;  3HKS A;  1VQJ A;  4R4C A;  2R6G A;  4DV0 L;  3PO3 G;  4BBS G;  4GS3 A;  2DUD A;  2N49 A;  4IJH A;  4X66 Q;  3A5U A;  3I4N G;  1TWC H;  2F3I A;  1E7Z A;  2GVA A;  2YTX A;  2ZJQ A;  3RN2 A;  3UE0 A;  1C0A A;  1YHA A;  4GLX A;  3JC6 6;  1PH8 A;  4X62 Q;  1Z9F A;  4QJF A;  2E2I H;  5ELN A;  2E5L Q;  4B3T L;  1NE3 A;  1Z47 A;  1NMF A;  1JJ2 A;  1N33 L;  4A3L G;  3J80 i;  4POG A;  1EOV A;  3PV0 A;  1YZ6 A;  1VQF A;  1X9N A;  2KCM A;  3BZC A;  3M85 A;  4YWL A;  5BR8 L;  4JV5 Q;  1I6H H;  1L1O B;  1VQL A;  3FHW A;  4BBR G;  3JAM i;  1YJ9 A;  4X64 Q;  1HNW L;  1IBL L;  1Y1W H;  3OW2 A;  4A3G H;  3RLO A;  1VQG A;  3E9H A;  2JEB I;  4BXX H;  4B3R L;  2AMC B;  4OX9 Q;  4J15 A;  1L2F A;  2WFW A;  1IXR A;  3T1Y L;  4OXP A;  3S14 H;  2BA0 A;  3AFQ A;  3KJO A;  1PH9 A;  2UU9 L;  1RIP A;  1V1Q A;  3KYH C;  4JI8 L;  5IWA Q;  4DR5 L;  1VQ6 A;  4A93 H;  3GTG H;  4OO1 I;  3W5O A;  4HJ8 A;  4JI5 Q;  3I4M H;  5IP9 H;  1VQ4 A;  2A1A A;  1NMG A;  3KLW A;  4X62 L;  4L5T A;  3CCS A;  3L0O A;  3CC7 A;  3RZD H;  2OQK A;  2MO0 A;  1QZG A;  4LF6 L;  4HJ9 A;  5GAG C;  4A3E G;  4OWT B;  4R4I A;  1B7Y B;  1PV4 A;  4IPC A;  5JJL A;  3L2P A;  3MEF A;  1J5E L;  4JI6 L;  4DNI A;  1KHI A;  3HKZ G;  2LSS A;  1M90 C;  1VQ9 A;  2F4V Q;  3HOW G;  3AYH B;  5C3E H;  1O7I A;  3AFP A;  3HKZ E;  4JG2 A;  1PH2 A;  3ULL A;  3I4O A;  5ELO A;  1VQ7 A;  3S16 H;  5FJ8 G;  1LYL A;  1E3P A;  4JOI A;  1YHB A;  4R4O A;  5IYB G;  2CCZ A;  4B3M L;  4ME3 A;  5GRO A;  4JI2 L;  2MQH A;  1VQD A;  1EIF A;  1GVP A;  2ALY B;  2OTJ A;  1IBK L;  4A3K H;  4JBJ A;  4A3E H;  4TQU S;  3OYY A;  4P75 A;  5C4X H;  4DV5 Q;  1HNZ L;  2GVB A;  4B3S Q;  1VQK A;  3J7A 5;  3CPW A;  2AWO A;  2PQA B;  1HZA A;  3HOV G;  3CW2 C;  2FXQ A;  1BVS A;  1DGS A;  4FDB A;  5HGQ A;  2PNH A;  5LMN Q;  1OXT A;  4HIO A;  4LNQ A;  2YYZ A;  3CCQ A;  3GO5 A;  1WCM G;  4JYA L;  3CQZ H;  3KDF A;  1HR0 W;  1Q1B A;  4OX9 L;  4K0K Q;  4LF8 Q;  2JQO A;  3NEM A;  2UUA Q;  4IO9 A;  3GTL H;  3PF5 A;  1JB7 A;  2VUM G;  1N36 Q;  2UXB L;  4R4Q A;  2E8G A;  1Y1V G;  5GAD C;  1YHQ A;  4DR7 Q;  1JT8 A;  3T1H L;  1Q8K A;  2CQO A;  2I5H A;  4HIK A;  4A3F G;  1BBW A;  4DAM A;  4GOP B;  1HZ9 A;  2OTL A;  2JK8 A;  3TEH B;  3OTO L;  2VW9 A;  4A3B G;  1U0L A;  5JEA G;  1IBM L;  4DPG A;  1VCI A;  4A3B H;  5GAH C;  1FJG Q;  4PZ7 A;  1Q46 A;  2K52 A;  2ASB A;  3UE1 A;  1B8A A;  1R9T H;  2PI2 E;  2K5H A;  4L5Q A;  2QEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...