4QL5A

Crystal structure of translation initiation factor if-1 from streptococcus pneumoniae tigr4
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
b'DVIEVEGKVVDTMPNAMFTVELENGHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor IF-1
publication title Crystal structure of translation initiation factor IF-1 from Streptococcus pneumoniae TIGR4
rcsb
source organism Streptococcus pneumoniae
molecule tags Translation
total genus 13
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ql5A00
4P75A 1PYSB 1HH2P 3K0XA 1PFSA 4R1JA 3RN2A 1S40A 2K14A 4A3JH 2A1AA 3TS2A 1L1OB 1JE5A 3FKIG 4DV6Q 2VUMG 3CF5A 1BKBA 1W2BA 4LFAQ 2AWOA 4A3FG 2R7FA 1AE2A 2E2JH 5FLMG 4JOIA 3JAMi 2I0QA 3H15A 4BY7H 2Q2UA 4UP9A 1U0LA 2RCNA 2XGTA 4RMFA 1XMOQ 1UE7A 2WAQG 1C7YA 4GN5A 4OO1I 3I4MH 1OXXK 1N36Q 2CQOA 1HZBA 3JC66 4IPGA 2B63H 1PH6A 1PA6A 3M3YH 1R9TH 2ES2A 1Q1BA 3PO2G 3S2DH 1CKMA 1ASYA 3PIPA 4GN3B 1LTLA 2JK8A 3CMEA 4A76A 3T1HQ 1Q46A 1IBKL 4GN4B 5C0XG 5FLXc 3M4OH 2PMZE 4DV4L 1CSQA 4YHHQ 1VQHA 3BZCA 1RIPA 3U58A 4GOPB 4HIMA 1QVCA 2DGYA 4DKAC 1C9OA 1J6QA 1X56A 3M4PA 4ALPA 5GAEC 3RR5A 5IYCG 5HY6A 3GTPH 3HKSA 1PVOA 2BH8A 4NXML 3PF4A 5M3MH 2ALYB 1EQRA 1QUQA 3K8AA 4R4QA 2BA1A 2GN5A 5IP9G 2UU9L 4AH6A 1VQ6A 5IYDG 4KI0A 1G6PA 2D62A 1VCIA 4LF4L 1K73C 2NN6G 1LUZA 1YZ6A 3NEMA 4HJAA 1K9MC 3PIOA 4DR7L 3S16H 1V43A 4KHPQ 1YJ9A 3ULJA 1QZHA 1TXYA 3HOZH 4O0AA 1Q86C 1CKOA 1JB7A 3GD7A 3M9BA 4A3IG 1GO3E 1VQEA 4GLVB 3HFZB 4NB3A 3J81i 1IL2A 4BA1I 1X6OA 4Y7NH 1VQGA 1HNXL 2R92G 4IFDJ 2JJQA 4XIGS 4OX9L 2H5XA 4LFAL 5C0XI 4QQBX 1E24A 1VQ8A 2HHHL 2OQ0A 3S1RH 2GVBA 4JI2Q 3NELA 1VQMA 1FL0A 3K80C 4R4OA 2KCMA 3STBD 2Z0SA 2VQFQ 1TWFH 2AKWB 4LUOA 5ELOA 3BU2A 3K7AH 3I4OA 1PH1A 4HJ7A 3HOWH 1B70B 2OWOA 4LUVA 3OTOQ 1B8AA 3CCJA 2LSSA 4AIMA 3CCUA 3CW2C 5M5YH 5GAGC 4LF7L 1L0WA 2NVTH 1HZCA 2NN6I 4YCVA 2WFWA 1MIUA 2I5LX 2OQKA 2ZTDA 3CCVA 1Q7YC 3FKIH 4JI5Q 2VUMH 2E8GA 4TQUS 3CCEA 3G6EA 1N9WA 2RF4A 1PH8A 4LF8L 1Q8KA 1GD7A 1S3OA 4JI1Q 5GROA 5IYBG 3PUWA 4GLAC 4L5TA 4A3FH 3RZDH 4B3ML 3UDGA 2YTVA 3FP9A 4A3EG 5FLMH 3RZOH 1XMQL 1SRUA 1X65A 3PV0A 3OW2A 1KAWA 2Q2HA 1XNRQ 3S2HH 4RG1A 2WP8J 1NJIC 3AQQA 5E7NA 2UUBQ 4NXNQ 2JA8G 2IX1A 2K5HA 2MO0A 1B7YB 3W1GA 2VQEQ 1KIXA 1TWHH 3MEFA 1IBLQ 4JBKA 3PO2H 4XTCS 5LMUL 3HOVG 4B3TQ 4DK6C 1MJCA 3U50C 2HIXA 1Q82C 3KOJA 1W3SA 3EBEA 4YY3L 3F8TA 1N33Q 4A3MG 4DV0Q 3BJUA 2IT1A 3KF6B 2QGQA 3K81C 5C44G 5AJ3L 4DAMA 5M3FG 1QVGA 5IYCH 4A3LG 1LYLA 5ELNA 4JI3Q 5M5WH 4X64Q 1UE6A 2MFIA 3UE0A 3F2BA 4A93G 4JI2L 1YJNA 3AEVA 1EYGA 5LMNQ 3RLOA 2K5VA 2VQFL 4P73A 2RHQB 2K52A 5IP9H 4H02A 4DR3L 2A8VA 5IYDH 1P8LA 4OXPA 1Q1EA 1CSPA 2BH2A 1DGSA 4K0KQ 2YYZA 3PF5A 1YEZA 2V1CC 2E5LL 3M7NA 4A3IH 2K50A 4GKJQ 1N32Q 2UXDQ 3PCOB 2VS1A 4B3RQ 3D0FA 1WJJA 3AFQA 2OCEA 4JI1L 4C2MH 4PZ8A 4JI4L 4HIDA 1EIFA 3UDFA 4A3BG 2VL6A 5J3BA 4JBMA 1VQ5A 2ID0A 5IWAQ 3A0JA 4LF5Q 2F4VQ 2ATWA 2HT1A 1BBUA 4JYAL 1VQ7A 2MNAA 3G71A 4POFA 1JJCB 4NXNL 4EX5A 4DV5Q 4HIKA 2JQOA 4DK3C 4OONA 4BXXG 4NPSA 3TEHB 5C0XJ 1EQQA 3E0EA 2VQEL 3M4QA 2Z6KA 1IBLL 1GVPA 3H3VI 1HZAA 3CMAA 1E1TA 1XTDA 1Y14B 4DAYB 4IJHA 3GTLH 4A3KG 2AMCB 2KENA 4GNXA 1HNZQ 2B3GA 4UPAA 1NY4A 2Y0SE 3PSIA 5C3EG 4A3GG 3T1YQ 5JJIA 4LF9Q 3I56A 1QVFA 3HOYH 2VZAA 2A19A 4LFCL 1YHAA 3KYHC 4PZ7A 1CKNA 5IYBH 1E3PA 3GO5A 5GQOA 2JA9A 3WWVA 3J81j 4A3EH 1GM5A 4L5SA 2WB1E 4C3HH 3KLWA 5EAYA 4JI8L 1KL9A 1UE1A 1HR0L 1Z9FA 5FJ8G 5LMNL 1L1OC 4BA2I 1IZ6A 1NE3A 3S1QH 1YIJA 3SGIA 3GDEA 2JA8H 3GTGH 3GTJH 1EIYB 5M5XH 4DV7L 1PH4A 3LGJA 3HOXG 4WJ3M 2CWAA 4JC0A 1K0RA 3UE1A 4DR1Q 3HOVH 3KJPA 4K0KL 4AYBE 2YTXA 2KBNA 4DV1Q 4L5RC 2HIVA 1OXUA 2NVYH 3RN5A 4X6AH 3ULPA 4DV6L 4A3MH 2DUDA 4IJLA 3PUYA 2ZM6Q 5C44H 2UXBQ 3W1BA 5M3FH 4JCVE 4A3LH 1SFOH 1H95A 2N8NA 2UXCQ 1TWCH 3ERSX 1HJPA 1UWVA 4YCUA 3F2DA 4A93H 4A3DG 4BBRG 4DR6Q 4LF5L 4YWMA 4O2DA 2VY3A 5C4XG 1XMOL 1IYJB 4LW1A 4GOPC 2IX0A 1Y1WG 3GTOH 3H3VH 3CCSA 1NMGA 1VQIA 1X55A 4IPCA 4DV5L 2IHFA 1N34Q 1K8GA 1JJGA 4GLXA 1N36L 1I94Q 2CWPA 3CQZH 4Y52H 1EOVA 2HQLA 4TVAB 3MXNB 4OWXB 1QUQB 3T1HL 2B29A 4L5QA 1YJWA 1C0AA 4DR2Q 3G48A 1SN8A 1VQ9A 3GTKH 1YNXA 5IT9c 3F2CA 4YHHL 1V1QA 4HJ9A 2KHIA 4JOIC 3T1YL 4JI6Q 2IY5B 3HKZE 1VS0A 3DLLA 4LFBQ 4DR5Q 1IBMQ 3PUVA 1PHJA 2NVQH 2ZJRA 5JEAG 4A3BH 3W5OA 1A63A 3J80c 2EQSA 4QIWE 2RHSB 4X65Q 2WAQE 3CC4A 3AFPA 3A74A 3I2ZA 4R4CA 3GTMH 5BR8Q 4BXXH 1E22A 1S72A 4PG3A 3GTQH 3ZJYC 1V9PA 4KHPL 4KLKA 1SMXA 1OXTA 2QA4A 1XPUA 4DV1L 4A3KH 4IPDA 3U4ZA 1HNWQ 3I7FA 1UE5A 1X3EA 3A5UA 5H1SE 1VQCA 5C3EH 4A3GH 1Z47A 4MZ9A 1QZGA 3CXCA 4QL5A 4AQYQ 2R7DA 2WB1G 3S1NH 2UXBL 4DV2Q 3E9HA 1K83H 5JJKA 4GS3A 4R4TA 2UXCL 1KQSA 1VQAA 3NENA 2Q2IA 4IFDI 4DPGA 3OYYA 3KJOA 1PH5A 3ICEA 4DR6L 1L1OA 1L2FA 5FJ8H 1U5KA 1NMFA 1WYDA 4GKKQ 3RNUA 4X66Q 1YHBA 1GKHA 1PH3A 1IBKQ 1HR0W 4OWWB 3I4NG 5LMNW 3OTOL 3HOXH 4QGUA 3UDIA 2FXQA 3ER0A 3RLNA 1TWGH 1A62A 4ME3A 3RLFA 3UDXA 4BBSG 4R4IA 4JG2A 1NBWA 4DR2L 1KRSA 4PZ6A 2VW9A 2JA5H 4A3CG 3VDYA 2JA7G 4JI5L 2LXJA 2ASBA 4HJ5A 4NXMQ 1EUJA 4YWLA 4MTNA 4JBJA 2PI2E 1N8RC 1XNQQ 4LFBL 2K4KA 4DV3Q 2F52A 2JA6G 3ULLA 1M90C 2UU9Q 4A3DH 1A8VA 1I6HH 4IOAA 2VNUD 2CFMA 4BBRH 1XNRL 3EN2A 2EXDA 4QJFA 4C3JH 1YI2A 5C4XH 2D0OA 4X65L 4GOPA 1WCMG 1YHQA 4DR7Q 2I5HA 1Y1WH 3HOUG 1XPOA 3D31A 3KDFA 5C4JH 1X54A 5DLQE 1JMCA 2UUBL 3CCLA 2R7ZG 3E9IA 3B6YA 3TQYA 5BR8L 2ZJPA 1FJGQ 1Q12A 3L0OA 1X9NA 1VQ4A 1HNXQ 1K8AC 2JEAI 2KHJA 2N3SA 2CCZA 2NVXH 3PO3G 4B3TL 4OX9Q 4WJ4A 2NZHA 1HNWL 2IHEA 2PQAA 3HKZG 4P71A 2HHHQ 1N33L 5GADC 2PNHA 3Q8DA 2UUAQ 4LF6Q 4LUZA 4UP8A 3DM3A 5IP7G 3CCQA 4DV0L 2F3IA 4HIOA 4X62Q 5IE8A 4DR4Q 1VQFA 4AQYL 2L15A 2GVAA 3H0GG 4DV2L 4IO9A 1PYBA 2XTIA 4JI3L 5IY0A 3K7UC 1Y1VG 4X64L 1SROA 2MO1A 4QY7A 4MNOA 3BZKA 3S24A 4DUZQ 1I50H 1PV4A 1MJEA 1D7QA 4UP7A 2BA0A 3CCRA 4GKKL 1VQDA 3CP0A 2PI2A 4X66L 4LF7Q 3M85A 1FVIA 1XPRA 1O7IA 1VQPA 2OTJA 3TS0A 3KFUA 4LF8Q 4DNIA 4OWTB 3JAMc 3IRBA 3PUZA 1HZ9A 2Q2TA 3KDFB 1FGUA 1KHIA 4B3MQ 1TWAH 4GKJL 2JA5G 2UXDL 4BY1G 2OTLA 4C3IH 4B3RL 1K3RA 1XMQQ 1ASZA 1CUKA 4JI7Q 1XNQL 4JI0Q 4EQ5A 3CCMA 4DV3L 4GNXB 2YU9H 1VQJA 2PQAB 3CPFA 3NBHB 4PMWA 2YTYA 3L2PA 4IOCA 5IWAL 4B3SQ 4UY8C 2UUCQ 2F4VL 3PGZA 1WFQA 2I5MX 3J80i 5LMUQ 1M1KC 2NZOA 1SR3A 5GAHC 1CKNB 4FDBA 5HGQA 1G291 3I4NH 1JJ2A 1FJGL 2QEXA 3TREA 4HJ8A 4YY3Q 4A3JG 1BVSA 2YV5A 3CC2A 4P74A 2N78A 1VQNA 3TRZA 1D8LA 1OTCA 1J5EQ 4BBSH 1YBYA 1NTGA 5AJ3Q 1HNZL 2ZTCA 2R93H 4BY7G 1PH7A 1VQOA 3CD6A 4A3CH 5JEAJ 2JA7H 1OXVA 2UUAL 4LF9L 4LF6L 4IFDG 4DR4L 1VQBA 2AWNA 4JV5L 4X62L 4POGA 4A75A 3F1ZA 4DUYQ 1I5FA 3AYHB 2ZTEA 3PUXA 2JA6H 4DR3Q 1YVCA 4APVA 1XJVA 3I4MG 3FHWA 2B63G 2R92H 4J15A 3J7A5 2E2HH 4DUZL 1T9HA 1WCMH 2Z6KC 3HOUH 3KF6A 2K75A 2E5LQ 3J81c 2R7ZH 3PO3H 3S15H 4JBWA 1LM0A 2CKZB 4GNXC 3S1MH 4DR1L 1VQLA 1A0IA 2Y0SG 1X3FA 2MQHA 4JI4Q 1UEBA 1OXSC 1SE8A 1EWIA 5IP7H 4JI7L 2ZM6L 3CC7A 5M3MG 2AHOB 3G4SA 3H0GH 3I55A 3HOYG 4JYAQ 1I3QH 4JI0L 1SLJA 1Y1VH 1AH9A 2LXKA 4KHZA 4A4IA 1MKHA 3S14H 4B3SL 4IPHA 2EIFA 2N49A 1YITA 2UUCL 1RL2A 1IXRA 1KXLA 3HOZG 2K5NA 3CAMA 5JJLA 1N34L 3S17H 3CPWA 1Q81C 1VQKA 4AYBG 1I94L 1PH2A 1KC8C 1AE3A 1P16A 4DV4Q 3STBC 4P72A 1EFWA 2JE6I 4LWCA 2ZJQA 4LNQA 3EIVA 2E2IH 1G51A 1J5EL 2R93G 4LFCQ 4BY1H 4OO1G 1WI5A 1X3GA 2R6GA 1N32L 1JT8A 4YWKA 4JI6L 4JI8Q 1HR0Q 1WOCA 4DUYL 3L7ZC 4DR5L 3U4VA 3KF8B 1PH9A 1IBML 1KRTA 1BBWA 2KCTA 4YCWA 1E1OA 1E7ZA 4LF4Q 3HOWG 3J7ZC 4DV7Q 1KD1C 2JEBI 4JV5Q 5K36G 2C35B 2D0PA 3A5ZB
chains in the Genus database with same CATH superfamily
3NWSA 3I8ZA 3MAQA 3K0XA 1PFSA 3S1MB 3HGBA 1ZEQX 2K14A 2VB2X 4OEMB 5I6WA 2A1AA 1S5CD 1BKBA 3CF5A 4A3FB 2R7FA 3RZOB 3CKIB 2E2JH 2Z4IA 2G9DA 3H15A 4UP9A 3E5SA 2XGTA 3EFXD 4RMFA 3L3OC 4R9WA 4EQNA 2HDLA 1HZBA 3JC66 3PO2B 3M3YH 2ES2A 2CVRA 5IODA 2JK8A 3T1HQ 1Q46A 2PMZE 4DV4L 5KIXA 5C6AA 3OOCA 1ET6A 3U58A 4HIMA 2DGYA 5I4DA 4F88A 1DCZA 1EL0A 1A3UA 3RR5A 5IYCG 5EQ0A 4IUTA 3TSSA 4NXML 3PF4A 5M3MH 2ALYB 3IKJA 4KY5A 1EQRA 4R4QA 2BA1A 1VQ6A 1GOZA 4KI0A 2D62A 1VCIA 4XQQA 1K9MC 4X3TA 4KHPQ 1YJ9A 3X3MA 1TXYA 2IX3A 1ENAA 4A3IB 4PMCA 2FMCA 4GLVB 4OGQC 3J7AF 3HFZB 1K28A 3J81i 5E1FA 3K5MA 1IL2A 4K6DA 4Y7NH 1VQGA 2D5DA 4IFDJ 2F0EA 4OX9L 1Y8OB 4HCSA 5C0XI 4X3UA 3SHLA 2HHHL 3SK5A 2GVBA 4KY6A 1VQMA 1FL0A 2KHSA 1KDAA 4RGOS 4DGZA 2VQFQ 1TWFH 1A6XA 4DU9A 3WDNA 3QWNA 1PH1A 4HJ7A 3Q23A 3HOWH 3TP7A 2HDMA 1Z7TA 2LSSA 3CCUA 3VR4A 5GAGC 4LF7L 4YCVA 1PXUA 1MIUA 2OQKA 1MD2D 1Q7YC 2HD3A 2A6HD 2VUMH 1PH8A 3NBIA 3VR6A 3A7AB 1Q8KA 3LX0A 1G2SA 3FEWX 3RZDH 3FP9A 3MFGA 4A3EG 5M3MB 4K2KA 1X65A 4C3HG 2QF7A 5IT9E 3S2HH 2LY7A 4NXNQ 5E7NA 5M5XB 2IX1A 2MO0A 4CHTB 5CGKA 2DNCA 4K8IA 3J80E 1I4PA 1Q82C 2HIXA 3EQLC 3NP8A 3P20A 1W6KA 4A3MG 1LTRD 2IT1A 5C44G 4XYOA 3SK6A 1HFNA 4JI3Q 5M5WH 4OIKA 3DHQA 4X64Q 3UE0A 1PTOH 3KUPA 1YJNA 2F0OA 2E75C 2VQFL 3T56B 1BCPC 2K52A 3KLSX 4H02A 4FF4A 2Q8TA 2NN6H 5ELCA 2KQ3A 5JVG3 2YYZA 4DAPA 3PCOB 3C3LA 3AFQA 3D4RA 4C2MH 4PZ8A 5D14A 1DYQA 1GJXA 4A3BG 5J3BA 4JBMA 1VQ5A 4GZYC 1EY9A 3G7LA 1Y69U 3SE0A 2MNAA 1F9PA 3G71A 4NXNL 4EX5A 3C2PA 2HCCA 5G3LD 1E2ZA 2KCNA 2JP1A 3VYUA 4ZUIA 2F0QA 4A3KB 1XTDA 4DAYB 2B3GA 4A3GB 4Q5VA 1PFBA 2L12A 4LF9Q 2F1MA 4WFN3 2PZTA 4MIUA 5M5WB 1K83B 5IYBH 1F2YA 1CKNA 4RKLA 3EA6A 3WWVA 4KD4A 2WB1E 4PV1C 5KEEA 3SDZA 1UE1A 2L1BA 5FJ8G 1L1OC 1S4ZA 4V190 1JOQA 1D5ZC 3S1QH 2CQAA 3GDEA 2JA8H 4DNRB 3GTJH 1EIYB 4G7HC 3HOXG 2CWAA 4DR1Q 3HOVH 1Y8NB 2VB3X 4DV1Q 1CI3M 2I07B 4C2MB 3PUYA 2ZM6Q 1H9KA 5FLXE 3W1BA 4J8QA 2SOBA 3ERSX 1HJPA 1UWVA 4YCUA 4A93H 5LL6X 4XT3B 5C4XB 1EY7A 4DR6Q 4FVMA 4YWMA 1XMOL 2E74C 1Y1WG 1K8GA 1NMGA 4DXGA 2PNRC 1TY0A 3TN2A 1EY8A 4G7ZC 4DA2A 3MXNB 2F0LA 1QUQB 2EXZA 2Z6BA 4RKBA 1SN8A 2AUJD 4G4KA 5EPLA 1BQQT 2OF1A 4HJ9A 1JOOA 2B2YA 2RSNA 1ET9A 1RJTA 1QILA 2A68D 1YNJC 1IBMQ 3PUVA 2ZJRA 1A63A 1CA6A 1STAA 2TMPA 4QIWE 3S1QB 2RHSB 2WAQE 1B9NA 3CC4A 3I2ZA 3GTJB 1WTRA 1GUTA 4M8AA 5BR8Q 2PMZB 3HOVB 3DWAA 1PDQA 1STYA 4HCEA 4HMIA 1TWAB 3KF8A 4DV1L 3U4ZA 5H1SE 2BCOA 1VQCA 2B2TC 4AQYQ 2R7DA 3E9HA 4ID6A 5JJKA 1I6HB 5J39A 1F2MA 4IFDI 1PH5A 4DR6L 4K6LA 4UHVA 2RSOA 3PMFA 3RNUA 1YHBA 1GKHA 3OTOL 4BBSB 4FNFA 4NKLA 1A62A 4ME3A 1QG7A 3RMHA 1KRSA 3BVMA 5NUCA 1HUNA 4A3CG 4ME5A 4JBJA 1XNQQ 4IUQA 2JA6G 2DY7A 4A3DH 1GUGA 2A6ED 2CFMA 1XNRL 3FPPA 2EXDA 4H44C 4C3JH 2R92G 4GOPA 1XPOA 3R3OA 2UUBL 1JMCA 1V1OA 3TMEA 3PO3G 3CCLA 1JQYD 5BR8L 4CKCA 5EBDA 1FJGQ 3L0OA 1X9NA 4OELB 1X3PA 1VQ4A 1HNXQ 1PZID 2JEAI 2NVXH 3H3VC 3TP6A 3NUCA 4DK0A 4P71A 3R93A 3R8BA 2IWHA 2K32A 3FRPB 4UP8A 4DV0L 3K5OA 4HIOA 3OSOA 3H0GB 1FNVA 5IE8A 4X62Q 1VQFA 4CDCC 4AQYL 2M00A 4UAIA 4J6HA 4IO9A 4FXDA 3K7UC 1Y1VG 2MO1A 5JEAH 2QILA 4QY7A 1E2VA 5I2XA 1HQMC 1EEFD 3BZKA 4MNOA 2DJGC 4IUNA 1D2BA 1JICA 2PI2A 3WOFA 2N55A 2TSSA 1C8CA 1B1ZA 2SNSA 1FVIA 2OTJA 3KFUA 4R8IA 1ILPA 2UXDL 1ASZA 1VF5C 2KCCA 4A3DB 1XNQL 4KKUA 4GNXB 4C3JB 2PQAB 4B3SQ 1QCBD 2YTYA 2UUCQ 5LMUQ 2FMMA 2NZOA 5GAHC 1K0SA 2LMCB 5HGQA 1S5ED 4A3JB 3DEOA 1FJGL 2EZVA 5COYA 4N8X1 2EYFA 1OTCA 1J5EQ 1NTGA 2ZTCA 1BCPD 2MHVA 2B2VA 1R4PB 1DM0B 1OXVA 4JV5L 4X62L 4A75A 3H09A 1I5FA 3I4MB 3AYHB 1IYVA 1YVCA 2NBFA 1R9TB 1QB5D 2F0JA 3KF6A 1JB3A 3NSWA 2KA7A 1K8OA 2R7ZH 1CTMA 3ND8A 4N9PA 3M4YA 4QUFA 1PRTB 2MGSA 1IW7C 2AQ1B 5M3MG 2KEDA 5I6YA 5A2QL 3G4SA 1EY5A 2RDGA 3K57A 1PZKD 4KHZA 3S14H 2V4DA 4B3SL 3BDLA 3L9AX 3DWQA 2UUCL 2J0TD 2N49A 1YITA 1IXRA 2L5TA 2LFNA 2F0SA 3CPWA 4ZAIA 3TDQA 4AYBG 1VQKA 1AE3A 3H6MA 1SJED 4E6IA 1TS4A 4DXFA 3E0JA 2E2IH 3C1EA 1J5EL 2F3WA 2R93G 1RODA 5C4ZA 2BE5C 4JI6L 4ZYSA 1NR4A 4CDFC 4DR5L 1BBWA 1E1OA 1E7ZA 2A6HC 3TZDA 1A2UA 3HOWG 1G6ZA 1MHWC 1D5MC 1BUVT 4JV5Q 2D0PA 3A5ZB 4P75A 1D5XC 2XRSD 2P5ZX 2NVTB 2XWJB 2EOTA 3NQIA 3HEJA 3FKIB 2EYMA 3TS2A 4DV6Q 2VUMG 1EQVA 4UDUC 3RD4A 2IJ0A 5KNCA 3H91A 1UEAB 3SXHA 2Q2UA 4QIWB 2WAQB 2XNAC 3QG1A 4HSPA 2AUKA 4OHJA 2B2UC 2QKIC 4FO2A 5CC4A 1C7YA 2F0UA 1EZ6A 4L6TB 1N36Q 1RTNA 4IPGA 4L63B 2B63H 1II3A 1PA6A 3S2DH 1ASYA 1LTLA 4EQPA 1JWMD 3VYRA 4A76A 3M4OH 1XYIA 1YNJD 4YHHQ 1EIGA 3BZCA 2E2IB 1RF2D 2NZ1D 3HP3A 3M4PA 5CV5A 5GAEC 1PVOA 2F3VA 3W2DA 5ISRA 3K8AA 1ML0D 2UU9L 5CORA 4AH6A 1DZ1A 5JOBA 2NN6G 5JPNC 2Z8LA 1V43A 3ULJA 3HOZH 2RA4A 1CKOA 4ZCKA 1JB7A 3D4WA 3GD7A 3M9BA 2D2CC 1GO3E 1JE4A 1ICWA 3K5LA 1A2TA 1X6OA 1EWCA 4NP5A 4XIGS 1VQ8A 1SMYC 3A54A 5HURA 2KECA 2KCMA 2B63B 4OIJA 4LUVA 4IUPA 4FF1A 2CH4A 4U68A 3M4OB 1PZJD 2MUYA 1BNZA 3QO2A 4CGYB 2ZTDA 3CCVA 1NAPA 2AQ3B 3HOYB 2E8GA 5L37A 3G6EA 2RF4A 1H9SA 1GD7A 4ODGA 5IYBG 4A3FH 4B3ML 2A73B 2YTVA 2F0WA 3V05A 3RZOH 1SRUA 3PV0A 4JVZA 2WP8J 3D4DA 2BDOA 4IURA 5D65A 1F9SA 1I4HA 1NJIC 2EYOA 2F0DA 1DJRD 2JA8G 2VQEQ 4JBKA 4MHEA 3HOZB 2XIWA 4HMJA 1IBLQ 1JWUD 3PO2H 1EEID 2EY1A 3HOVG 1SSOA 2NB0A 4DK6C 1MJCA 1SE4A 3Q0AA 5C0XH 1W3SA 1XX8A 5I9OA 5M3FB 3FPUB 3Q22A 1SEBD 3BJUA 2QGQA 3K81C 3BYTB 1QVGA 1KABA 1LYLA 1UE6A 2MFIA 2O5JC 4A93G 4I7AA 2EJFC 2K5VA 2KEEA 2RHQB 5IP9H 4DR3L 3D3RA 2K5WA 5IYDH 1P8LA 1CSPA 4ZLTF 4K2LA 2N88A 2BH2A 4MTKA 5BN3A 2E5LL 2V1CC 2R3ZA 1DD2A 4A3IH 1GUSA 4RGTA 3T53B 1JC7A 1AN8A 5CV8A 3D0FA 2B2YC 2KVMA 5T1IA 4JI4L 1B3AA 2EYPA 2L55A 3AU7A 2ID0A 2F4VQ 2RCFA 4DV5Q 4POFA 1JJCB 2F0VA 2JQOA 1PRTF 3GTQB 1F2ZA 3TEHB 5J22A 3E0EA 2VQEL 1IBLL 1HZAA 1LABA 4IJHA 1VMCA 3GQBA 2KENA 5DNFA 1HNZQ 5C3EB 1CK1A 2XVSA 1NY4A 3T1YQ 2VZAA 2A19A 4KJOA 4PZ7A 1E3PA 3GO5A 1GM5A 2BDNA 2B8FA 3KLWA 5CR3A 4JI8L 1KL9A 1HR0L 1WTXA 2K5QA 2RVLA 4XT1B 1WTWA 4XDXA 1IW7D 1TIID 3FMCA 5M5XH 4DV7L 3PIP3 1DXMA 4C1NK 1PH4A 1K0RA 5IGBA 2YTXA 2A6EC 2KBNA 1IKLA 3K59A 4X6AH 3OHXC 1UAPA 3ULPA 1R4QB 3VR5A 2DUDA 4IJLA 2LS01 1B44D 4A3LH 4JCVE 1LT5D 1H95A 1TWCH 3F2DA 3JAME 4A3DG 2K03A 3DUZA 1MGSA 2H1EA 4C3JG 1HQRD 2F0FA 4GOPC 3GTOH 2IX0A 2EDGA 1VQIA 4DV5L 1JJGA 4H13C 4GLXA 1I94Q 1TU2B 1PTOC 3CQZH 4DF7A 4V0BA 4H7BA 5JVH3 2K33A 4TVAB 2BE5D 1DOMA 3KLRA 1EOTA 2ZXPA 3T1HL 2B29A 1C0AA 4DR2Q 1I4GA 5IT9c 2J4XA 3K0YA 4CJ0B 5EKLA 3SVMA 3T1YL 4ILWA 4ZKBB 3DLLA 1VF7A 4I7ZC 3SEBA 2WIIB 4I65A 5JEAG 3W5OA 1QE6A 3J80c 3OPOA 3HZXA 2B2UA 5EGTA 2QW7A 4RFBA 3R2IA 4BXXH 2K6AA 1E22A 4PG3A 5DM73 3N52A 4EQOA 5FO9B 4KHPL 1TS5A 5A35A 4KLKA 1OXTA 1U4MA 4A3KH 5FO7B 1TS2A 1B53A 4C3IB 1X3EA 3A5UA 4A3GH 4MZ9A 2WB1G 5LL6S 1TWCB 4TSSA 1K83H 4GS3A 1VQAA 1ENFA 2RKSA 2ZXRA 3GTOB 3A7LA 1KAAA 1L2FA 5IGDA 1JORA 4GKKQ 1SE2A 4X66Q 3CQZB 3I4NB 1TS3A 5A2QE 1IBKQ 1CZWA 2EY6A 1HR0W 1CZGA 2FXQA 2K01A 3ER0A 3RLNA 1TWGH 1KLUD 4DR2L 3ONAB 4NW2A 5BN5A 2JA7B 2IL8A 2VW9A 2B2VC 2JA5H 2ASBA 2LXJA 4HJ5A 4KJNA 1EUJA 4YWLA 1N8RC 2KJXA 1M8AA 3MXPA 3ULLA 1ESFA 4IOAA 4G57A 2VNUD 1WCMB 3EN2A 1YI2A 5C4XH 2D0OA 4DR7Q 2I5HA 3NQTA 4PMBA 3S15B 3D31A 3KDFA 4F7XA 1X54A 2R7ZG 2XN9C 3B6YA 1SYBA 3TQYA 5C3XA 1SMYD 1PMRA 1HCZA 3HKZB 2NZHA 3TP8A 2SDFA 5GADC 2EYLA 4JW0A 3NPPA 4LUZA 1AZQA 1CQVA 2MP1A 2L15A 1I3QB 3CHBD 1PYBA 2O4XA 4JI3L 4X64L 1O80A 1I50H 1PV4A 3S17B 4GKKL 1Q3LA 4X66L 1PLFA 4FXKC 1TWGB 2ZT9C 1O7IA 4HSVA 4LF8Q 2JA5B 4BY1B 1FGUA 1TWAH 1HHVA 1K3RA 1XMQQ 1CUKA 3CRKC 3NWTA 3QR8A 3CCMA 1VQJA 1TT2A 3NBHB 1I6HH 3L2PA 4UY8C 1Q90A 3MTSA 5F2DA 3J80i 1AZPA 3PIO3 1M1KC 4FDBA 1CA5A 4HJ8A 4M1UB 4YY3Q 3I3CA 4K5WA 2YV5A 3FVQA 3TRZA 1VQNA 4BBSH 5AJ3Q 4DFAA 1AW7A 5JEAJ 4LF9L 4DNTB 3KLSA 1RTOA 4POGA 4JPBW 3F1ZA 2MPMA 4DUYQ 1D1KA 3E6ZX 1A3TA 2ZTEA 1XJVA 2B63G 1I50B 2XWBB 1T9HA 1V8QA 2Z6KC 3HOUH 2K75A 3FDTA 2K7VA 3J81L 3IFDA 4JBWA 4HAEA 1LLRD 4GNXC 4DR1L 3GV3A 3QB3A 2Y0SG 4C56C 1WTHA 1FYCA 2MQHA 5CV9A 1OXSC 2F4IA 1SE8A 5D3DA 2ZM6L 1UUPA 3A56A 1RHPA 3H0GH 1BOSA 4JYAQ 1RD9D 1AH9A 4DN4M 3S16B 2EIFA 3NTHA 3U9SA 1RL2A 1C48A 1KXLA 2FHTA 1V1PB 3HOZG 1E2WA 3PQIA 1KC8C 2A74C 4LWCA 1F9RA 1U4RA 2ZJQA 3EIVA 5TSSA 2KOLA 3S1RB 3C1FA 4LFCQ 1QJOA 2NUCA 2DN8A 1JT8A 4YWKA 1NNXA 5CYUA 3K7AB 4DUYL 3L7ZC 1IBML 4DAYA 1PH9A 2KCTA 5EBCA 1MBYA 4LF4Q 3HOUB 1HA5A 3J7AV 3MXGA 5K5PA 4FYDA 3T4AC 1PYSB 5IGEA 1QWYA 1HH2P 3RN2A 4A3JH 1HPCA 2RBMA 1L1OB 1MSHA 1HTLD 3MWYW 1QNKA 1W2BA 2AWOA 4A3FG 5CBEE 4BY7H 4RHRA 1PTOD 4IZ8A 2RCNA 1UE7A 2EY5A 4GN5A 4Z9CB 3T16A 3I4MH 3H94A 4OO1I 1PH6A 4G7OC 1J8IA 3BYYB 1R9TH 2K5DA 2VXWA 3PO2G 3D6WA 1TVXA 3CMEA 1CM9A 5C0XG 5D3IB 1ILQA 5I9PA 1C9OA 1SXTA 1X56A 5HY6A 3BVGA 3BDOA 3HKSA 1QUQA 4KTAA 1QOHA 5IP9G 2EVBA 5IYDG 4LF4L 1K73C 1LUZA 1YZ6A 3PIOA 1QZHA 4O0AA 1Q86C 1WD1A 4A3IG 2JN4A 2DY8A 2X6GA 1LTID 1S5FD 3I70A 3DEPA 4BA1I 1HNXL 2JJQA 2F0NA 4BY7B 1J9OA 4QQBX 3KBXA 3HS0C 3OW7A 4R4OA 1F2LA 2Z0SA 4CDEC 3BU2A 1XWEA 1FNUA 1GXDC 3T51B 3I4OA 5EKIA 1A15A 1B8AA 3GTLB 5EPKA 1KNAA 2NVTH 3ITPA 2WFWA 2I5LX 5IT9L 3FKIH 4JI5Q 4TQUS 3CCEA 1N9WA 3OMGA 1S3OA 3Q6SA 4JI1Q 5GROA 4A3EB 3PUWA 4GLAC 4L5TA 1SYDA 3TZUA 5FLMH 4TRDA 1KAWA 2Q2HA 4RG1A 4KN4C 3O13A 3VR2A 3NHHA 3AQQA 4KKSA 3GTGB 1B7YB 3W1GA 1STEA 3CRLC 1KIXA 3BVZA 1EYCA 4CKEA 1LTBD 5LMUL 4B3TQ 2NVYB 3U50C 1Y8PB 3KOJA 3F8TA 1N33Q 1BO0A 4RGNA 1B3QA 5C44B 1WTPA 1NCVA 4A3LG 3M7GA 4DAMA 3IAYA 3AEVA 1EYGA 4L8JA 1AP0A 2C9OA 3OIQA 2A8VA 2AQ2B 2I46A 1K3BC 1LTAD 3OWEB 5EJWA 3M7NA 1CHQD 2O2LD 4K5XA 2K50A 4GKJQ 2VS1A 4B3RQ 2QDLA 1D6EC 2K05A 1GHJA 4KN7C 1BXTA 2OCEA 3EJIA 3MXUA 4JI1L 4A3BB 1U4LA 3VYTA 1EIFA 1U9RA 3UDFA 3URYA 3RUZA 2FINB 5IWAQ 4LF5Q 1BBUA 5EKKA 3GTMB 5FOBB 4DK3C 4BXXG 1SE3A 1SYFA 4NPSA 5C0XJ 1EQQA 2Z6KA 2E76C 1EYAA 3H3VI 3N6RA 3LWUA 4S3SA 5KYIA 4A3KG 2AMCB 4GNXA 4UPAA 3PSIA 1G91A 4A3GG 3S1NB 5JJIA 3HOYH 4LAAA 3KYHC 1WD0A 2JA9A 1EY0A 1TR5A 2XSCA 1XXGA 5KRUA 4BA2I 1IZ6A 1NE3A 3R2TA 1UNSA 4DK1A 2FFKB 2L11A 3HOXB 4WJ3M 3UE1A 2EYHA 4AYBE 1DOKA 2ZXOA 1OXUA 3P75A 3RN5A 1EU3A 4DV6L 2UXBQ 2WINB 5M3FH 4N8FA 4F8MA 2N8NA 2UXCQ 4ABNA 2Z4HA 4LF5L 1Y1WB 4RCNA 5C4XG 4XQJA 1IYJB 5C4JB 3CCSA 4WRDA 4IPCA 1N34Q 2IHFA 1N36L 2CWPA 4Y52H 5DEHA 4JK1C 1SYEA 1SYCA 4OWXB 5KNDA 1YJWA 3GTKH 1VQ9A 1YNXA 5CBAE 4YHHL 3F2CA 1PRTD 3ZYYX 1V1QA 2B2WA 2KHIA 4JOIC 3HKZE 2M9VA 3QJYA 4CJ2C 1PHJA 2A69D 3V2TA 2NVQH 4HTHA 4BWGB 2EQSA 3AFPA 5IOCA 4R4CA 2IW3A 1S72A 3GTQH 1ZKOA 1XTCD 1V9PA 2D9UA 5IIFA 2QA4A 1FGBD 1HNWQ 1BDOA 3J81E 5C3EH 1Z47A 4KKTA 1QZGA 2CH4W 2UXBL 2YU9B 1AEXA 1SDFA 2UXCL 1KQSA 3HG9A 4DPGA 3OYYA 3KJOA 5ELDA 1NMFA 2CHBD 2SEBD 3I4LA 3D6CA 5C5MA 2B39A 1PH3A 2E2DC 3KK7A 2R61A 4KV6A 4OWWB 1FR3A 1LV9A 1LT3D 1BF4A 4QGUA 2MJ8A 3UDIA 3GTKB 4BBSG 3UDXA 3DXJC 1CT1D 4NXMQ 2H4OA 4OL7A 2X69A 2NYZD 2NVQB 2PI2E 4B9XA 2CW0C 2QEJC 1M90C 3T13A 1A8VA 4BBRH 2BOSA 4QJFA 3C46A 2ICIA 1CQFA 1A3VA 3HOUG 4QMGA 5DLQE 3K5NA 2ZJPA 1Q12A 1HA6A 4F87A 5JJZA 1WVLA 1K8AC 2N3SA 4OX9Q 3VYSA 1HNWL 2HHHQ 4ZKCB 4DR4Q 3DM3A 1TY2A 2F3IA 4B9WA 2K1BA 3H0GG 3MVVA 1Y1VB 1SROA 4ZUJA 3NXWA 4RWSC 1JR0D 1I4QA 1MJEA 1D7QA 1EFID 1SNPA 1VQDA 3CP0A 5J1ZA 5BN4A 4LF7Q 3M85A 4IUUA 1F77A 5E4XA 1XPRA 1VQPA 1DOLA 3TS0A 4K5VA 3JAMc 3DM1A 3IRBA 3PUZA 3KDFB 1ESRA 2JXMB 4C3IH 1ZYRC 4LJZC 4JI7Q 4FF2A 4JI0Q 1WTQA 1L0XB 4EQ5A 4BBRB 3P1HA 5IGCA 3CPFA 4PMWA 2F4VL 3P7JA 3PGZA 3ERQA 1KTKA 1G2TA 1CKNB 1BR9A 3I4NH 4J1MA 2QEXA 3TREA 4A3JG 1BVSA 1OO9B 4XXEA 1IL8A 2N78A 1D8LA 1YBYA 3F2UA 3MZ5A 1HNZL 2E2JB 4KK7A 2PPBC 2R93H 4BY7G 5I2YA 1VQOA 3CD6A 1O7LA 2JA7H 4DR4L 1VQBA 2AWNA 3A8KE 5EPJA 3I73A 2F0TA 3PUXA 3I4MG 3FHWA 3M3YB 4J15A 1WCMH 2M2LA 4C1NI 2L9HA 3S15H 4RGMA 1VQLA 3U9OA 1A0IA 1KDCA 1VDZA 1UEBA 5IP7H 4JI7L 3DMUA 2EY2A 1EZ8A 3I55A 1I3QH 4JI0L 2XRQD 1MKHA 4IPHA 2QCPX 2K5NA 3CAMA 4AYBB 3S17H 1ICFB 1I94L 3VA5A 1P16A 4P72A 5CV6A 4Y7NB 1X3QA 1EFWA 1STNA 3EROA 1EU4A 5T1GA 2R93B 1SNCA 4BY1H 2R6GA 5DAUA 1STHA 1TWFB 3IFTA 3KF8B 1KRTA 3HOWB 4YCWA 2X6LA 2EPBA 1LTSD 3J7ZC 1KD1C 1SJHD 2F0KA 2C35B 1O7ZA 3J7YW 1B9MA 1NUCA 1EIHA 4R1JA 5AFWA 1S40A 5ELFA 3X3NA 2VUMB 3FKIG 1JE5A 3RZDB 2WACA 4LFAQ 1AE2A 2I0QA 5FLMG 3BZDB 4JOIA 3JAMi 1I4RA 4IFDH 1S5DD 4PNYA 1U0LA 2NWGA 3TBIB 3S2HB 1PYWD 4KHVA 1XMOQ 2WAQG 4U673 1H9MA 1OXXK 2CQOA 3WOEA 1LACA 1Q1BA 1QNUA 1GUWA 5E4WC 1CKMA 4KMUC 2ENBA 3PIPA 4GN3B 1X32A 5KYLA 1IBKL 4QCLA 4GN4B 1YNNC 5FLXc 1CSQA 1VQHA 3S9WA 1G8ZD 1RIPA 4GOPB 1QVCA 4DKAC 1J6QA 4ALPA 3MC0B 3GTPH 2JYOA 1PTOB 1KNEA 2BH8A 5IGFA 1EYDA 2GN5A 1G6PA 3NEMA 1ENCA 4HJAA 4DR7L 2QDBA 4CKBA 3A8JE 5HGTA 3S16H 2EYJA 4EVOA 2Q8RE 4WORA 1VQEA 3A55A 4NB3A 1SNOA 1SAPA 1B50A 1SBBB 1L0YB 4LK1C 2H5XA 4LFAL 1E24A 2OQ0A 3S1RH 1O78A 4OO1H 2K28A 4JI2Q 3NELA 1GUOA 1MSGA 3K80C 3STBD 5ELOA 2AKWB 4LUOA 3K7AH 2PYKA 1B70B 2OWOA 3OTOQ 5K36H 3CCJA 4AIMA 3CW2C 1EWHA 2RQXA 5M5YH 1L0WA 2Q8IB 1HZCA 5CMDA 2CW0D 1TQOA 1HTPA 2NN6I 5M9OA 1BCPB 4LF8L 3GTPB 2F0MA 3HOYG 5G3LF 3UDGA 5CV7A 3NTKA 1XMQL 3OW2A 1RKNA 4WJWA 1XNRQ 3QOJA 2G5DA 2IPKD 1WTVA 4HN7A 2UUBQ 2JA8B 4QF4A 4IN3A 2K5HA 1TWHH 3MEFA 4XTCS 3D8GA 1I4XA 1HXYD 1HUMA 3EBEA 4YY3L 2NTSA 1KLGD 2OXPA 4DV0Q 3KF6B 5M3FG 5AJ3L 5IYCH 1FNWA 5ELNA 4A93B 2F0IA 4ZQ3A 3F2BA 5FO8B 4JI2L 1O7YA 3MEHA 5LMNQ 3RLOA 4P73A 3AMUA 1PRTC 3BG3A 4OXPA 1Q1EA 1EQTA 1DGSA 1ZYRD 5M5YB 4K0KQ 2A69C 3PF5A 1YEZA 2FJ2A 3LWEA 2SNMA 2UXDQ 1WTOA 2B2WC 1WJJA 3G6JB 1IYUA 1W6JA 4HEDA 4ZRZA 4HIDA 2VL6A 2Z9HA 2PZWA 2OEOA 2B8GA 3A0JA 2PW5A 2ATWA 2HT1A 4FXGC 4JYAL 1VQ7A 4XQNA 4CBVA 4HIKA 1TWHB 2A5HA 4OONA 4R8NA 3EVQA 4MN3A 3IL8A 3M4QA 1GVPA 2L0CA 4NMZA 3CMAA 1F9QA 1E1TA 3QOLA 1Y14B 1ZXTA 3GTLH 3K58A 3NBHA 2Y0SE 5C3EG 3SK4A 4RCOA 3I56A 1QVFA 4LFCL 1YHAA 1Q8IA 4L5SA 5GQOA 4A3EH 3J81j 2J7ZA 4B08A 4C3HH 3UI2A 3MXNA 5EAYA 1Z9FA 1NR2A 3V96A 5LMNL 1T5XD 1E0BA 5KGUA 1YIJA 5C5LA 3SGIA 4RA8A 3GTGH 3LGJA 4JC0A 1RCVD 4DAVA 3KJPA 4K0KL 4IQZA 4L5RC 5JPMC 2HIVA 3JAML 2NVYH 4O1NA 4A3MH 4RAUC 1H9JA 5C44H 1SFOH 2PZUA 4CDDC 2PO4A 4N9TA 4BBRG 1NSNS 2JSOA 4O2DA 2VY3A 4LW1A 3H3VH 3NTIA 3NK9A 3BS1A 1X55A 1EY4A 1EOVA 2HQLA 2EJGC 2NVXB 4L5QA 4FF3A 3G48A 2RDHA 5KNBA 1HFGA 3GV6A 3Q24A 4JI6Q 2IY5B 1SNQA 1VS0A 1V1PA 4LFBQ 2WKCA 4DR5Q 4C3HB 4A3BH 5FK9C 3W3AA 3J80L 1KDBA 1CFMA 4X65Q 3A74A 5E3FA 5LHY1 3GTMH 3ZJYC 1PTOF 4QUCA 1SMXA 2WKDA 1XPUA 1PFNA 3BDCA 4IPDA 3I7FA 1UE5A 1SNMA 4A3MB 4C3IG 2WB1B 1SFOB 3CXCA 4QL5A 3S1NH 4DV2Q 1B4OA 2ICEC 1D1IA 1CHPD 4R4TA 3NENA 2Q2IA 3OMCA 1YNND 4NDXA 3ICEA 1L1OA 3K6OA 5FJ8H 1U5KA 1WYDA 1H9SB 3I4NG 5LMNW 3HOXH 1JWSD 3TP5A 3RLFA 4R4IA 4JG2A 1NBWA 3SR1A 4ULLA 4PZ6A 4ZK9B 2L4NA 3VDYA 2JA7G 4JI5L 1SYGA 4IALA 3VR3A 1STBA 1T5EA 1GUNA 2EE1A 4K14A 4MTNA 4LFBL 2K4KA 1M4VA 2F52A 4DV3Q 3QIAA 2UU9Q 3GP7A 1LT6D 3HRZC 4X65L 1YHQA 1LT4D 1WCMG 1Y1WH 2R7ZB 2EJMA 5C4JH 1BCPF 5CV4A 3E9IA 1IKMA 1GHKA 3NE5B 2HUGA 2HCIA 2KHJA 2CCZA 4B3TL 2OT2A 4WJ4A 3A8IE 2IHEA 2PQAA 3HKZG 1LTGD 1N33L 2PNHA 1SNDA 3Q8DA 1JOKA 4Q0FA 4BS9A 3CCQA 5IP7G 2UUAQ 4LF6Q 2DJFC 1DONA 2GVAA 4DV2L 2F03A 2XTIA 3DWPA 3S14B 5IY0A 1Z6HA 2G9HD 5C3WA 3S24A 4DUZQ 3MFYA 4TKOB 2HQEA 2BA0A 4UP7A 3CCRA 5DM63 2NTTA 4RH6A 1BBXC 2F0GA 5FLXL 4PQXA 2WV6D 3KBGA 1HRJA 3I91A 2GA4B 2RDFA 4OWTB 4DNIA 1HZ9A 2Q2TA 1KHIA 4EGVA 4B3MQ 3OIPA 4KY7A 4GKJL 2JA5G 4BY1G 1C4QA 4HR7B 2OTLA 4B3RL 2B2TA 1H9RA 4XYQA 3I90A 3CU7A 3VA7A 4DV3L 2YU9H 2F0HA 4IOCA 2PW7A 5IWAL 1B2TA 1WFQA 2I5MX 1SR3A 1G291 3ND9A 1JJ2A 2PCFB 5JAVA 4K8JA 3CC2A 2K04A 4P74A 3SK8A 4YIJA 4O42A 3I72A 1PH7A 1N32Q 4A3CH 1AFPA 2UUAL 4IFDG 4LF6L 4QB4A 1LTTD 1I6VC 2JA6H 4RHSA 4IUVA 1U4PA 4DR3Q 4APVA 4LMQD 2R92H 3S2DB 3J7A5 2E2HH 4DUZL 2Z1CA 1LO5D 2E5LQ 4CJ1B 3J81c 3PO3H 1IHZA 1LM0A 2CKZB 2PQEA 2KUMA 2Y0SB 3S1MH 3OWFA 1X3FA 3LNNA 5FKAC 2C5CA 3E3XA 3MA2B 2O5IC 4JI4Q 1EWIA 1JCKB 3CC7A 5C4HA 2AHOB 4KD3A 1S5BD 4P2CB 1MI2A 4X3KA 1SLJA 1Y1VH 1FD7D 2LXKA 4A4IA 1EY6A 1STGA 5IGGA 3AB9A 5ELBA 5JJLA 1N34L 1Q81C 1PH2A 2DNEA 4DV4Q 3STBC 2JE6I 4H0LC 4LNQA 1G51A 1ONLA 4X3SA 5ELEA 4OO1G 1PFMA 1TKWB 1WI5A 1X3GA 4FP5D 1N32L 4JI8Q 2JA6B 1HR0Q 1WOCA 2F0PA 3U4VA 3MHBA 2R92B 1K8MA 1VMPA 2E2HB 1RDPD 2LKVA 4DV7Q 5K36G 2JEBI 3PO3B 2A68C
chains in the Genus database with same CATH topology
4P75A 1PYSB 1HH2P 3K0XA 1PFSA 4R1JA 3RN2A 1S40A 2K14A 4A3JH 2A1AA 3TS2A 1L1OB 1JE5A 3FKIG 4DV6Q 2VUMG 3CF5A 1BKBA 1W2BA 4LFAQ 2AWOA 4A3FG 2R7FA 1AE2A 2E2JH 5FLMG 4JOIA 3JAMi 2I0QA 3H15A 4BY7H 2Q2UA 4UP9A 1U0LA 2RCNA 2XGTA 4RMFA 1XMOQ 1UE7A 2WAQG 1C7YA 4GN5A 4OO1I 3I4MH 1OXXK 1N36Q 2CQOA 1HZBA 3JC66 4IPGA 2B63H 1PH6A 1PA6A 3M3YH 1R9TH 2ES2A 1Q1BA 3PO2G 3S2DH 1CKMA 1ASYA 3PIPA 4GN3B 1LTLA 2JK8A 3CMEA 4A76A 3T1HQ 1Q46A 1IBKL 4GN4B 5C0XG 5FLXc 3M4OH 2PMZE 4DV4L 1CSQA 4YHHQ 1VQHA 3BZCA 1RIPA 3U58A 4GOPB 4HIMA 1QVCA 2DGYA 4DKAC 1C9OA 1J6QA 1X56A 3M4PA 4ALPA 5GAEC 3RR5A 5IYCG 5HY6A 3GTPH 3HKSA 1PVOA 2BH8A 4NXML 3PF4A 5M3MH 2ALYB 1EQRA 1QUQA 3K8AA 4R4QA 2BA1A 2GN5A 5IP9G 2UU9L 4AH6A 1VQ6A 5IYDG 4KI0A 1G6PA 2D62A 1VCIA 4LF4L 1K73C 2NN6G 1LUZA 1YZ6A 3NEMA 4HJAA 1K9MC 3PIOA 4DR7L 3S16H 1V43A 4KHPQ 1YJ9A 3ULJA 1QZHA 1TXYA 3HOZH 4O0AA 1Q86C 1CKOA 1JB7A 3GD7A 3M9BA 4A3IG 1GO3E 1VQEA 4GLVB 3HFZB 4NB3A 3J81i 1IL2A 4BA1I 1X6OA 4Y7NH 1VQGA 1HNXL 2R92G 4IFDJ 2JJQA 4XIGS 4OX9L 2H5XA 4LFAL 5C0XI 4QQBX 1E24A 1VQ8A 2HHHL 2OQ0A 3S1RH 2GVBA 4JI2Q 3NELA 1VQMA 1FL0A 3K80C 4R4OA 2KCMA 3STBD 2Z0SA 2VQFQ 1TWFH 2AKWB 4LUOA 5ELOA 3BU2A 3K7AH 3I4OA 1PH1A 4HJ7A 3HOWH 1B70B 2OWOA 4LUVA 3OTOQ 1B8AA 3CCJA 2LSSA 4AIMA 3CCUA 3CW2C 5M5YH 5GAGC 4LF7L 1L0WA 2NVTH 1HZCA 2NN6I 4YCVA 2WFWA 1MIUA 2I5LX 2OQKA 2ZTDA 3CCVA 1Q7YC 3FKIH 4JI5Q 2VUMH 2E8GA 4TQUS 3CCEA 3G6EA 1N9WA 2RF4A 1PH8A 4LF8L 1Q8KA 1GD7A 1S3OA 4JI1Q 5GROA 5IYBG 3PUWA 4GLAC 4L5TA 4A3FH 3RZDH 4B3ML 3UDGA 2YTVA 3FP9A 4A3EG 5FLMH 3RZOH 1XMQL 1SRUA 1X65A 3PV0A 3OW2A 1KAWA 2Q2HA 1XNRQ 3S2HH 4RG1A 2WP8J 1NJIC 3AQQA 5E7NA 2UUBQ 4NXNQ 2JA8G 2IX1A 2K5HA 2MO0A 1B7YB 3W1GA 2VQEQ 1KIXA 1TWHH 3MEFA 1IBLQ 4JBKA 3PO2H 4XTCS 5LMUL 3HOVG 4B3TQ 4DK6C 1MJCA 3U50C 2HIXA 1Q82C 3KOJA 1W3SA 3EBEA 4YY3L 3F8TA 1N33Q 4A3MG 4DV0Q 3BJUA 2IT1A 3KF6B 2QGQA 3K81C 5C44G 5AJ3L 4DAMA 5M3FG 1QVGA 5IYCH 4A3LG 1LYLA 5ELNA 4JI3Q 5M5WH 4X64Q 1UE6A 2MFIA 3UE0A 3F2BA 4A93G 4JI2L 1YJNA 3AEVA 1EYGA 5LMNQ 3RLOA 2K5VA 2VQFL 4P73A 2RHQB 2K52A 5IP9H 4H02A 4DR3L 2A8VA 5IYDH 1P8LA 4OXPA 1Q1EA 1CSPA 2BH2A 1DGSA 4K0KQ 2YYZA 3PF5A 1YEZA 2V1CC 2E5LL 3M7NA 4A3IH 2K50A 4GKJQ 1N32Q 2UXDQ 3PCOB 2VS1A 4B3RQ 3D0FA 1WJJA 3AFQA 2OCEA 4JI1L 4C2MH 4PZ8A 4JI4L 4HIDA 1EIFA 3UDFA 4A3BG 2VL6A 5J3BA 4JBMA 1VQ5A 2ID0A 5IWAQ 3A0JA 4LF5Q 2F4VQ 2ATWA 2HT1A 1BBUA 4JYAL 1VQ7A 2MNAA 3G71A 4POFA 1JJCB 4NXNL 4EX5A 4DV5Q 4HIKA 2JQOA 4DK3C 4OONA 4BXXG 4NPSA 3TEHB 5C0XJ 1EQQA 3E0EA 2VQEL 3M4QA 2Z6KA 1IBLL 1GVPA 3H3VI 1HZAA 3CMAA 1E1TA 1XTDA 1Y14B 4DAYB 4IJHA 3GTLH 4A3KG 2AMCB 2KENA 4GNXA 1HNZQ 2B3GA 4UPAA 1NY4A 2Y0SE 3PSIA 5C3EG 4A3GG 3T1YQ 5JJIA 4LF9Q 3I56A 1QVFA 3HOYH 2VZAA 2A19A 4LFCL 1YHAA 3KYHC 4PZ7A 1CKNA 5IYBH 1E3PA 3GO5A 5GQOA 2JA9A 3WWVA 3J81j 4A3EH 1GM5A 4L5SA 2WB1E 4C3HH 3KLWA 5EAYA 4JI8L 1KL9A 1UE1A 1HR0L 1Z9FA 5FJ8G 5LMNL 1L1OC 4BA2I 1IZ6A 1NE3A 3S1QH 1YIJA 3SGIA 3GDEA 2JA8H 3GTGH 3GTJH 1EIYB 5M5XH 4DV7L 1PH4A 3LGJA 3HOXG 4WJ3M 2CWAA 4JC0A 1K0RA 3UE1A 4DR1Q 3HOVH 3KJPA 4K0KL 4AYBE 2YTXA 2KBNA 4DV1Q 4L5RC 2HIVA 1OXUA 2NVYH 3RN5A 4X6AH 3ULPA 4DV6L 4A3MH 2DUDA 4IJLA 3PUYA 2ZM6Q 5C44H 2UXBQ 3W1BA 5M3FH 4JCVE 4A3LH 1SFOH 1H95A 2N8NA 2UXCQ 1TWCH 3ERSX 1HJPA 1UWVA 4YCUA 3F2DA 4A93H 4A3DG 4BBRG 4DR6Q 4LF5L 4YWMA 4O2DA 2VY3A 5C4XG 1XMOL 1IYJB 4LW1A 4GOPC 2IX0A 1Y1WG 3GTOH 3H3VH 3CCSA 1NMGA 1VQIA 1X55A 4IPCA 4DV5L 2IHFA 1N34Q 1K8GA 1JJGA 4GLXA 1N36L 1I94Q 2CWPA 3CQZH 4Y52H 1EOVA 2HQLA 4TVAB 3MXNB 4OWXB 1QUQB 3T1HL 2B29A 4L5QA 1YJWA 1C0AA 4DR2Q 3G48A 1SN8A 1VQ9A 3GTKH 1YNXA 5IT9c 3F2CA 4YHHL 1V1QA 4HJ9A 2KHIA 4JOIC 3T1YL 4JI6Q 2IY5B 3HKZE 1VS0A 3DLLA 4LFBQ 4DR5Q 1IBMQ 3PUVA 1PHJA 2NVQH 2ZJRA 5JEAG 4A3BH 3W5OA 1A63A 3J80c 2EQSA 4QIWE 2RHSB 4X65Q 2WAQE 3CC4A 3AFPA 3A74A 3I2ZA 4R4CA 3GTMH 5BR8Q 4BXXH 1E22A 1S72A 4PG3A 3GTQH 3ZJYC 1V9PA 4KHPL 4KLKA 1SMXA 1OXTA 2QA4A 1XPUA 4DV1L 4A3KH 4IPDA 3U4ZA 1HNWQ 3I7FA 1UE5A 1X3EA 3A5UA 5H1SE 1VQCA 5C3EH 4A3GH 1Z47A 4MZ9A 1QZGA 3CXCA 4QL5A 4AQYQ 2R7DA 2WB1G 3S1NH 2UXBL 4DV2Q 3E9HA 1K83H 5JJKA 4GS3A 4R4TA 2UXCL 1KQSA 1VQAA 3NENA 2Q2IA 4IFDI 4DPGA 3OYYA 3KJOA 1PH5A 3ICEA 4DR6L 1L1OA 1L2FA 5FJ8H 1U5KA 1NMFA 1WYDA 4GKKQ 3RNUA 4X66Q 1YHBA 1GKHA 1PH3A 1IBKQ 1HR0W 4OWWB 3I4NG 5LMNW 3OTOL 3HOXH 4QGUA 3UDIA 2FXQA 3ER0A 3RLNA 1TWGH 1A62A 4ME3A 3RLFA 3UDXA 4BBSG 4R4IA 4JG2A 1NBWA 4DR2L 1KRSA 4PZ6A 2VW9A 2JA5H 4A3CG 3VDYA 2JA7G 4JI5L 2LXJA 2ASBA 4HJ5A 4NXMQ 1EUJA 4YWLA 4MTNA 4JBJA 2PI2E 1N8RC 1XNQQ 4LFBL 2K4KA 4DV3Q 2F52A 2JA6G 3ULLA 1M90C 2UU9Q 4A3DH 1A8VA 1I6HH 4IOAA 2VNUD 2CFMA 4BBRH 1XNRL 3EN2A 2EXDA 4QJFA 4C3JH 1YI2A 5C4XH 2D0OA 4X65L 4GOPA 1WCMG 1YHQA 4DR7Q 2I5HA 1Y1WH 3HOUG 1XPOA 3D31A 3KDFA 5C4JH 1X54A 5DLQE 1JMCA 2UUBL 3CCLA 2R7ZG 3E9IA 3B6YA 3TQYA 5BR8L 2ZJPA 1FJGQ 1Q12A 3L0OA 1X9NA 1VQ4A 1HNXQ 1K8AC 2JEAI 2KHJA 2N3SA 2CCZA 2NVXH 3PO3G 4B3TL 4OX9Q 4WJ4A 2NZHA 1HNWL 2IHEA 2PQAA 3HKZG 4P71A 2HHHQ 1N33L 5GADC 2PNHA 3Q8DA 2UUAQ 4LF6Q 4LUZA 4UP8A 3DM3A 5IP7G 3CCQA 4DV0L 2F3IA 4HIOA 4X62Q 5IE8A 4DR4Q 1VQFA 4AQYL 2L15A 2GVAA 3H0GG 4DV2L 4IO9A 1PYBA 2XTIA 4JI3L 5IY0A 3K7UC 1Y1VG 4X64L 1SROA 2MO1A 4QY7A 4MNOA 3BZKA 3S24A 4DUZQ 1I50H 1PV4A 1MJEA 1D7QA 4UP7A 2BA0A 3CCRA 4GKKL 1VQDA 3CP0A 2PI2A 4X66L 4LF7Q 3M85A 1FVIA 1XPRA 1O7IA 1VQPA 2OTJA 3TS0A 3KFUA 4LF8Q 4DNIA 4OWTB 3JAMc 3IRBA 3PUZA 1HZ9A 2Q2TA 3KDFB 1FGUA 1KHIA 4B3MQ 1TWAH 4GKJL 2JA5G 2UXDL 4BY1G 2OTLA 4C3IH 4B3RL 1K3RA 1XMQQ 1ASZA 1CUKA 4JI7Q 1XNQL 4JI0Q 4EQ5A 3CCMA 4DV3L 4GNXB 2YU9H 1VQJA 2PQAB 3CPFA 3NBHB 4PMWA 2YTYA 3L2PA 4IOCA 5IWAL 4B3SQ 4UY8C 2UUCQ 2F4VL 3PGZA 1WFQA 2I5MX 3J80i 5LMUQ 1M1KC 2NZOA 1SR3A 5GAHC 1CKNB 4FDBA 5HGQA 1G291 3I4NH 1JJ2A 1FJGL 2QEXA 3TREA 4HJ8A 4YY3Q 4A3JG 1BVSA 2YV5A 3CC2A 4P74A 2N78A 1VQNA 3TRZA 1D8LA 1OTCA 1J5EQ 4BBSH 1YBYA 1NTGA 5AJ3Q 1HNZL 2ZTCA 2R93H 4BY7G 1PH7A 1VQOA 3CD6A 4A3CH 5JEAJ 2JA7H 1OXVA 2UUAL 4LF9L 4LF6L 4IFDG 4DR4L 1VQBA 2AWNA 4JV5L 4X62L 4POGA 4A75A 3F1ZA 4DUYQ 1I5FA 3AYHB 2ZTEA 3PUXA 2JA6H 4DR3Q 1YVCA 4APVA 1XJVA 3I4MG 3FHWA 2B63G 2R92H 4J15A 3J7A5 2E2HH 4DUZL 1T9HA 1WCMH 2Z6KC 3HOUH 3KF6A 2K75A 2E5LQ 3J81c 2R7ZH 3PO3H 3S15H 4JBWA 1LM0A 2CKZB 4GNXC 3S1MH 4DR1L 1VQLA 1A0IA 2Y0SG 1X3FA 2MQHA 4JI4Q 1UEBA 1OXSC 1SE8A 1EWIA 5IP7H 4JI7L 2ZM6L 3CC7A 5M3MG 2AHOB 3G4SA 3H0GH 3I55A 3HOYG 4JYAQ 1I3QH 4JI0L 1SLJA 1Y1VH 1AH9A 2LXKA 4KHZA 4A4IA 1MKHA 3S14H 4B3SL 4IPHA 2EIFA 2N49A 1YITA 2UUCL 1RL2A 1IXRA 1KXLA 3HOZG 2K5NA 3CAMA 5JJLA 1N34L 3S17H 3CPWA 1Q81C 1VQKA 4AYBG 1I94L 1PH2A 1KC8C 1AE3A 1P16A 4DV4Q 3STBC 4P72A 1EFWA 2JE6I 4LWCA 2ZJQA 4LNQA 3EIVA 2E2IH 1G51A 1J5EL 2R93G 4LFCQ 4BY1H 4OO1G 1WI5A 1X3GA 2R6GA 1N32L 1JT8A 4YWKA 4JI6L 4JI8Q 1HR0Q 1WOCA 4DUYL 3L7ZC 4DR5L 3U4VA 3KF8B 1PH9A 1IBML 1KRTA 1BBWA 2KCTA 4YCWA 1E1OA 1E7ZA 4LF4Q 3HOWG 3J7ZC 4DV7Q 1KD1C 2JEBI 4JV5Q 5K36G 2C35B 2D0PA 3A5ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P75 A;  1PYS B;  1HH2 P;  3K0X A;  1PFS A;  4R1J A;  3RN2 A;  1S40 A;  2K14 A;  4A3J H;  2A1A A;  3TS2 A;  1L1O B;  1JE5 A;  3FKI G;  4DV6 Q;  2VUM G;  3CF5 A;  1BKB A;  1W2B A;  4LFA Q;  2AWO A;  4A3F G;  2R7F A;  1AE2 A;  2E2J H;  5FLM G;  4JOI A;  3JAM i;  2I0Q A;  3H15 A;  4BY7 H;  2Q2U A;  4UP9 A;  1U0L A;  2RCN A;  2XGT A;  4RMF A;  1XMO Q;  1UE7 A;  2WAQ G;  1C7Y A;  4GN5 A;  4OO1 I;  3I4M H;  1OXX K;  1N36 Q;  2CQO A;  1HZB A;  3JC6 6;  4IPG A;  2B63 H;  1PH6 A;  1PA6 A;  3M3Y H;  1R9T H;  2ES2 A;  1Q1B A;  3PO2 G;  3S2D H;  1CKM A;  1ASY A;  3PIP A;  4GN3 B;  1LTL A;  2JK8 A;  3CME A;  4A76 A;  3T1H Q;  1Q46 A;  1IBK L;  4GN4 B;  5C0X G;  5FLX c;  3M4O H;  2PMZ E;  4DV4 L;  1CSQ A;  4YHH Q;  1VQH A;  3BZC A;  1RIP A;  3U58 A;  4GOP B;  4HIM A;  1QVC A;  2DGY A;  4DKA C;  1C9O A;  1J6Q A;  1X56 A;  3M4P A;  4ALP A;  5GAE C;  3RR5 A;  5IYC G;  5HY6 A;  3GTP H;  3HKS A;  1PVO A;  2BH8 A;  4NXM L;  3PF4 A;  5M3M H;  2ALY B;  1EQR A;  1QUQ A;  3K8A A;  4R4Q A;  2BA1 A;  2GN5 A;  5IP9 G;  2UU9 L;  4AH6 A;  1VQ6 A;  5IYD G;  4KI0 A;  1G6P A;  2D62 A;  1VCI A;  4LF4 L;  1K73 C;  2NN6 G;  1LUZ A;  1YZ6 A;  3NEM A;  4HJA A;  1K9M C;  3PIO A;  4DR7 L;  3S16 H;  1V43 A;  4KHP Q;  1YJ9 A;  3ULJ A;  1QZH A;  1TXY A;  3HOZ H;  4O0A A;  1Q86 C;  1CKO A;  1JB7 A;  3GD7 A;  3M9B A;  4A3I G;  1GO3 E;  1VQE A;  4GLV B;  3HFZ B;  4NB3 A;  3J81 i;  1IL2 A;  4BA1 I;  1X6O A;  4Y7N H;  1VQG A;  1HNX L;  2R92 G;  4IFD J;  2JJQ A;  4XIG S;  4OX9 L;  2H5X A;  4LFA L;  5C0X I;  4QQB X;  1E24 A;  1VQ8 A;  2HHH L;  2OQ0 A;  3S1R H;  2GVB A;  4JI2 Q;  3NEL A;  1VQM A;  1FL0 A;  3K80 C;  4R4O A;  2KCM A;  3STB D;  2Z0S A;  2VQF Q;  1TWF H;  2AKW B;  4LUO A;  5ELO A;  3BU2 A;  3K7A H;  3I4O A;  1PH1 A;  4HJ7 A;  3HOW H;  1B70 B;  2OWO A;  4LUV A;  3OTO Q;  1B8A A;  3CCJ A;  2LSS A;  4AIM A;  3CCU A;  3CW2 C;  5M5Y H;  5GAG C;  4LF7 L;  1L0W A;  2NVT H;  1HZC A;  2NN6 I;  4YCV A;  2WFW A;  1MIU A;  2I5L X;  2OQK A;  2ZTD A;  3CCV A;  1Q7Y C;  3FKI H;  4JI5 Q;  2VUM H;  2E8G A;  4TQU S;  3CCE A;  3G6E A;  1N9W A;  2RF4 A;  1PH8 A;  4LF8 L;  1Q8K A;  1GD7 A;  1S3O A;  4JI1 Q;  5GRO A;  5IYB G;  3PUW A;  4GLA C;  4L5T A;  4A3F H;  3RZD H;  4B3M L;  3UDG A;  2YTV A;  3FP9 A;  4A3E G;  5FLM H;  3RZO H;  1XMQ L;  1SRU A;  1X65 A;  3PV0 A;  3OW2 A;  1KAW A;  2Q2H A;  1XNR Q;  3S2H H;  4RG1 A;  2WP8 J;  1NJI C;  3AQQ A;  5E7N A;  2UUB Q;  4NXN Q;  2JA8 G;  2IX1 A;  2K5H A;  2MO0 A;  1B7Y B;  3W1G A;  2VQE Q;  1KIX A;  1TWH H;  3MEF A;  1IBL Q;  4JBK A;  3PO2 H;  4XTC S;  5LMU L;  3HOV G;  4B3T Q;  4DK6 C;  1MJC A;  3U50 C;  2HIX A;  1Q82 C;  3KOJ A;  1W3S A;  3EBE A;  4YY3 L;  3F8T A;  1N33 Q;  4A3M G;  4DV0 Q;  3BJU A;  2IT1 A;  3KF6 B;  2QGQ A;  3K81 C;  5C44 G;  5AJ3 L;  4DAM A;  5M3F G;  1QVG A;  5IYC H;  4A3L G;  1LYL A;  5ELN A;  4JI3 Q;  5M5W H;  4X64 Q;  1UE6 A;  2MFI A;  3UE0 A;  3F2B A;  4A93 G;  4JI2 L;  1YJN A;  3AEV A;  1EYG A;  5LMN Q;  3RLO A;  2K5V A;  2VQF L;  4P73 A;  2RHQ B;  2K52 A;  5IP9 H;  4H02 A;  4DR3 L;  2A8V A;  5IYD H;  1P8L A;  4OXP A;  1Q1E A;  1CSP A;  2BH2 A;  1DGS A;  4K0K Q;  2YYZ A;  3PF5 A;  1YEZ A;  2V1C C;  2E5L L;  3M7N A;  4A3I H;  2K50 A;  4GKJ Q;  1N32 Q;  2UXD Q;  3PCO B;  2VS1 A;  4B3R Q;  3D0F A;  1WJJ A;  3AFQ A;  2OCE A;  4JI1 L;  4C2M H;  4PZ8 A;  4JI4 L;  4HID A;  1EIF A;  3UDF A;  4A3B G;  2VL6 A;  5J3B A;  4JBM A;  1VQ5 A;  2ID0 A;  5IWA Q;  3A0J A;  4LF5 Q;  2F4V Q;  2ATW A;  2HT1 A;  1BBU A;  4JYA L;  1VQ7 A;  2MNA A;  3G71 A;  4POF A;  1JJC B;  4NXN L;  4EX5 A;  4DV5 Q;  4HIK A;  2JQO A;  4DK3 C;  4OON A;  4BXX G;  4NPS A;  3TEH B;  5C0X J;  1EQQ A;  3E0E A;  2VQE L;  3M4Q A;  2Z6K A;  1IBL L;  1GVP A;  3H3V I;  1HZA A;  3CMA A;  1E1T A;  1XTD A;  1Y14 B;  4DAY B;  4IJH A;  3GTL H;  4A3K G;  2AMC B;  2KEN A;  4GNX A;  1HNZ Q;  2B3G A;  4UPA A;  1NY4 A;  2Y0S E;  3PSI A;  5C3E G;  4A3G G;  3T1Y Q;  5JJI A;  4LF9 Q;  3I56 A;  1QVF A;  3HOY H;  2VZA A;  2A19 A;  4LFC L;  1YHA A;  3KYH C;  4PZ7 A;  1CKN A;  5IYB H;  1E3P A;  3GO5 A;  5GQO A;  2JA9 A;  3WWV A;  3J81 j;  4A3E H;  1GM5 A;  4L5S A;  2WB1 E;  4C3H H;  3KLW A;  5EAY A;  4JI8 L;  1KL9 A;  1UE1 A;  1HR0 L;  1Z9F A;  5FJ8 G;  5LMN L;  1L1O C;  4BA2 I;  1IZ6 A;  1NE3 A;  3S1Q H;  1YIJ A;  3SGI A;  3GDE A;  2JA8 H;  3GTG H;  3GTJ H;  1EIY B;  5M5X H;  4DV7 L;  1PH4 A;  3LGJ A;  3HOX G;  4WJ3 M;  2CWA A;  4JC0 A;  1K0R A;  3UE1 A;  4DR1 Q;  3HOV H;  3KJP A;  4K0K L;  4AYB E;  2YTX A;  2KBN A;  4DV1 Q;  4L5R C;  2HIV A;  1OXU A;  2NVY H;  3RN5 A;  4X6A H;  3ULP A;  4DV6 L;  4A3M H;  2DUD A;  4IJL A;  3PUY A;  2ZM6 Q;  5C44 H;  2UXB Q;  3W1B A;  5M3F H;  4JCV E;  4A3L H;  1SFO H;  1H95 A;  2N8N A;  2UXC Q;  1TWC H;  3ERS X;  1HJP A;  1UWV A;  4YCU A;  3F2D A;  4A93 H;  4A3D G;  4BBR G;  4DR6 Q;  4LF5 L;  4YWM A;  4O2D A;  2VY3 A;  5C4X G;  1XMO L;  1IYJ B;  4LW1 A;  4GOP C;  2IX0 A;  1Y1W G;  3GTO H;  3H3V H;  3CCS A;  1NMG A;  1VQI A;  1X55 A;  4IPC A;  4DV5 L;  2IHF A;  1N34 Q;  1K8G A;  1JJG A;  4GLX A;  1N36 L;  1I94 Q;  2CWP A;  3CQZ H;  4Y52 H;  1EOV A;  2HQL A;  4TVA B;  3MXN B;  4OWX B;  1QUQ B;  3T1H L;  2B29 A;  4L5Q A;  1YJW A;  1C0A A;  4DR2 Q;  3G48 A;  1SN8 A;  1VQ9 A;  3GTK H;  1YNX A;  5IT9 c;  3F2C A;  4YHH L;  1V1Q A;  4HJ9 A;  2KHI A;  4JOI C;  3T1Y L;  4JI6 Q;  2IY5 B;  3HKZ E;  1VS0 A;  3DLL A;  4LFB Q;  4DR5 Q;  1IBM Q;  3PUV A;  1PHJ A;  2NVQ H;  2ZJR A;  5JEA G;  4A3B H;  3W5O A;  1A63 A;  3J80 c;  2EQS A;  4QIW E;  2RHS B;  4X65 Q;  2WAQ E;  3CC4 A;  3AFP A;  3A74 A;  3I2Z A;  4R4C A;  3GTM H;  5BR8 Q;  4BXX H;  1E22 A;  1S72 A;  4PG3 A;  3GTQ H;  3ZJY C;  1V9P A;  4KHP L;  4KLK A;  1SMX A;  1OXT A;  2QA4 A;  1XPU A;  4DV1 L;  4A3K H;  4IPD A;  3U4Z A;  1HNW Q;  3I7F A;  1UE5 A;  1X3E A;  3A5U A;  5H1S E;  1VQC A;  5C3E H;  4A3G H;  1Z47 A;  4MZ9 A;  1QZG A;  3CXC A;  4QL5 A;  4AQY Q;  2R7D A;  2WB1 G;  3S1N H;  2UXB L;  4DV2 Q;  3E9H A;  1K83 H;  5JJK A;  4GS3 A;  4R4T A;  2UXC L;  1KQS A;  1VQA A;  3NEN A;  2Q2I A;  4IFD I;  4DPG A;  3OYY A;  3KJO A;  1PH5 A;  3ICE A;  4DR6 L;  1L1O A;  1L2F A;  5FJ8 H;  1U5K A;  1NMF A;  1WYD A;  4GKK Q;  3RNU A;  4X66 Q;  1YHB A;  1GKH A;  1PH3 A;  1IBK Q;  1HR0 W;  4OWW B;  3I4N G;  5LMN W;  3OTO L;  3HOX H;  4QGU A;  3UDI A;  2FXQ A;  3ER0 A;  3RLN A;  1TWG H;  1A62 A;  4ME3 A;  3RLF A;  3UDX A;  4BBS G;  4R4I A;  4JG2 A;  1NBW A;  4DR2 L;  1KRS A;  4PZ6 A;  2VW9 A;  2JA5 H;  4A3C G;  3VDY A;  2JA7 G;  4JI5 L;  2LXJ A;  2ASB A;  4HJ5 A;  4NXM Q;  1EUJ A;  4YWL A;  4MTN A;  4JBJ A;  2PI2 E;  1N8R C;  1XNQ Q;  4LFB L;  2K4K A;  4DV3 Q;  2F52 A;  2JA6 G;  3ULL A;  1M90 C;  2UU9 Q;  4A3D H;  1A8V A;  1I6H H;  4IOA A;  2VNU D;  2CFM A;  4BBR H;  1XNR L;  3EN2 A;  2EXD A;  4QJF A;  4C3J H;  1YI2 A;  5C4X H;  2D0O A;  4X65 L;  4GOP A;  1WCM G;  1YHQ A;  4DR7 Q;  2I5H A;  1Y1W H;  3HOU G;  1XPO A;  3D31 A;  3KDF A;  5C4J H;  1X54 A;  5DLQ E;  1JMC A;  2UUB L;  3CCL A;  2R7Z G;  3E9I A;  3B6Y A;  3TQY A;  5BR8 L;  2ZJP A;  1FJG Q;  1Q12 A;  3L0O A;  1X9N A;  1VQ4 A;  1HNX Q;  1K8A C;  2JEA I;  2KHJ A;  2N3S A;  2CCZ A;  2NVX H;  3PO3 G;  4B3T L;  4OX9 Q;  4WJ4 A;  2NZH A;  1HNW L;  2IHE A;  2PQA A;  3HKZ G;  4P71 A;  2HHH Q;  1N33 L;  5GAD C;  2PNH A;  3Q8D A;  2UUA Q;  4LF6 Q;  4LUZ A;  4UP8 A;  3DM3 A;  5IP7 G;  3CCQ A;  4DV0 L;  2F3I A;  4HIO A;  4X62 Q;  5IE8 A;  4DR4 Q;  1VQF A;  4AQY L;  2L15 A;  2GVA A;  3H0G G;  4DV2 L;  4IO9 A;  1PYB A;  2XTI A;  4JI3 L;  5IY0 A;  3K7U C;  1Y1V G;  4X64 L;  1SRO A;  2MO1 A;  4QY7 A;  4MNO A;  3BZK A;  3S24 A;  4DUZ Q;  1I50 H;  1PV4 A;  1MJE A;  1D7Q A;  4UP7 A;  2BA0 A;  3CCR A;  4GKK L;  1VQD A;  3CP0 A;  2PI2 A;  4X66 L;  4LF7 Q;  3M85 A;  1FVI A;  1XPR A;  1O7I A;  1VQP A;  2OTJ A;  3TS0 A;  3KFU A;  4LF8 Q;  4DNI A;  4OWT B;  3JAM c;  3IRB A;  3PUZ A;  1HZ9 A;  2Q2T A;  3KDF B;  1FGU A;  1KHI A;  4B3M Q;  1TWA H;  4GKJ L;  2JA5 G;  2UXD L;  4BY1 G;  2OTL A;  4C3I H;  4B3R L;  1K3R A;  1XMQ Q;  1ASZ A;  1CUK A;  4JI7 Q;  1XNQ L;  4JI0 Q;  4EQ5 A;  3CCM A;  4DV3 L;  4GNX B;  2YU9 H;  1VQJ A;  2PQA B;  3CPF A;  3NBH B;  4PMW A;  2YTY A;  3L2P A;  4IOC A;  5IWA L;  4B3S Q;  4UY8 C;  2UUC Q;  2F4V L;  3PGZ A;  1WFQ A;  2I5M X;  3J80 i;  5LMU Q;  1M1K C;  2NZO A;  1SR3 A;  5GAH C;  1CKN B;  4FDB A;  5HGQ A;  1G29 1;  3I4N H;  1JJ2 A;  1FJG L;  2QEX A;  3TRE A;  4HJ8 A;  4YY3 Q;  4A3J G;  1BVS A;  2YV5 A;  3CC2 A;  4P74 A;  2N78 A;  1VQN A;  3TRZ A;  1D8L A;  1OTC A;  1J5E Q;  4BBS H;  1YBY A;  1NTG A;  5AJ3 Q;  1HNZ L;  2ZTC A;  2R93 H;  4BY7 G;  1PH7 A;  1VQO A;  3CD6 A;  4A3C H;  5JEA J;  2JA7 H;  1OXV A;  2UUA L;  4LF9 L;  4LF6 L;  4IFD G;  4DR4 L;  1VQB A;  2AWN A;  4JV5 L;  4X62 L;  4POG A;  4A75 A;  3F1Z A;  4DUY Q;  1I5F A;  3AYH B;  2ZTE A;  3PUX A;  2JA6 H;  4DR3 Q;  1YVC A;  4APV A;  1XJV A;  3I4M G;  3FHW A;  2B63 G;  2R92 H;  4J15 A;  3J7A 5;  2E2H H;  4DUZ L;  1T9H A;  1WCM H;  2Z6K C;  3HOU H;  3KF6 A;  2K75 A;  2E5L Q;  3J81 c;  2R7Z H;  3PO3 H;  3S15 H;  4JBW A;  1LM0 A;  2CKZ B;  4GNX C;  3S1M H;  4DR1 L;  1VQL A;  1A0I A;  2Y0S G;  1X3F A;  2MQH A;  4JI4 Q;  1UEB A;  1OXS C;  1SE8 A;  1EWI A;  5IP7 H;  4JI7 L;  2ZM6 L;  3CC7 A;  5M3M G;  2AHO B;  3G4S A;  3H0G H;  3I55 A;  3HOY G;  4JYA Q;  1I3Q H;  4JI0 L;  1SLJ A;  1Y1V H;  1AH9 A;  2LXK A;  4KHZ A;  4A4I A;  1MKH A;  3S14 H;  4B3S L;  4IPH A;  2EIF A;  2N49 A;  1YIT A;  2UUC L;  1RL2 A;  1IXR A;  1KXL A;  3HOZ G;  2K5N A;  3CAM A;  5JJL A;  1N34 L;  3S17 H;  3CPW A;  1Q81 C;  1VQK A;  4AYB G;  1I94 L;  1PH2 A;  1KC8 C;  1AE3 A;  1P16 A;  4DV4 Q;  3STB C;  4P72 A;  1EFW A;  2JE6 I;  4LWC A;  2ZJQ A;  4LNQ A;  3EIV A;  2E2I H;  1G51 A;  1J5E L;  2R93 G;  4LFC Q;  4BY1 H;  4OO1 G;  1WI5 A;  1X3G A;  2R6G A;  1N32 L;  1JT8 A;  4YWK A;  4JI6 L;  4JI8 Q;  1HR0 Q;  1WOC A;  4DUY L;  3L7Z C;  4DR5 L;  3U4V A;  3KF8 B;  1PH9 A;  1IBM L;  1KRT A;  1BBW A;  2KCT A;  4YCW A;  1E1O A;  1E7Z A;  4LF4 Q;  3HOW G;  3J7Z C;  4DV7 Q;  1KD1 C;  2JEB I;  4JV5 Q;  5K36 G;  2C35 B;  2D0P A;  3A5Z B; 
#chains in the Genus database with same CATH topology
 3NWS A;  3I8Z A;  3MAQ A;  3K0X A;  1PFS A;  3S1M B;  3HGB A;  1ZEQ X;  2K14 A;  2VB2 X;  4OEM B;  5I6W A;  2A1A A;  1S5C D;  1BKB A;  3CF5 A;  4A3F B;  2R7F A;  3RZO B;  3CKI B;  2E2J H;  2Z4I A;  2G9D A;  3H15 A;  4UP9 A;  3E5S A;  2XGT A;  3EFX D;  4RMF A;  3L3O C;  4R9W A;  4EQN A;  2HDL A;  1HZB A;  3JC6 6;  3PO2 B;  3M3Y H;  2ES2 A;  2CVR A;  5IOD A;  2JK8 A;  3T1H Q;  1Q46 A;  2PMZ E;  4DV4 L;  5KIX A;  5C6A A;  3OOC A;  1ET6 A;  3U58 A;  4HIM A;  2DGY A;  5I4D A;  4F88 A;  1DCZ A;  1EL0 A;  1A3U A;  3RR5 A;  5IYC G;  5EQ0 A;  4IUT A;  3TSS A;  4NXM L;  3PF4 A;  5M3M H;  2ALY B;  3IKJ A;  4KY5 A;  1EQR A;  4R4Q A;  2BA1 A;  1VQ6 A;  1GOZ A;  4KI0 A;  2D62 A;  1VCI A;  4XQQ A;  1K9M C;  4X3T A;  4KHP Q;  1YJ9 A;  3X3M A;  1TXY A;  2IX3 A;  1ENA A;  4A3I B;  4PMC A;  2FMC A;  4GLV B;  4OGQ C;  3J7A F;  3HFZ B;  1K28 A;  3J81 i;  5E1F A;  3K5M A;  1IL2 A;  4K6D A;  4Y7N H;  1VQG A;  2D5D A;  4IFD J;  2F0E A;  4OX9 L;  1Y8O B;  4HCS A;  5C0X I;  4X3U A;  3SHL A;  2HHH L;  3SK5 A;  2GVB A;  4KY6 A;  1VQM A;  1FL0 A;  2KHS A;  1KDA A;  4RGO S;  4DGZ A;  2VQF Q;  1TWF H;  1A6X A;  4DU9 A;  3WDN A;  3QWN A;  1PH1 A;  4HJ7 A;  3Q23 A;  3HOW H;  3TP7 A;  2HDM A;  1Z7T A;  2LSS A;  3CCU A;  3VR4 A;  5GAG C;  4LF7 L;  4YCV A;  1PXU A;  1MIU A;  2OQK A;  1MD2 D;  1Q7Y C;  2HD3 A;  2A6H D;  2VUM H;  1PH8 A;  3NBI A;  3VR6 A;  3A7A B;  1Q8K A;  3LX0 A;  1G2S A;  3FEW X;  3RZD H;  3FP9 A;  3MFG A;  4A3E G;  5M3M B;  4K2K A;  1X65 A;  4C3H G;  2QF7 A;  5IT9 E;  3S2H H;  2LY7 A;  4NXN Q;  5E7N A;  5M5X B;  2IX1 A;  2MO0 A;  4CHT B;  5CGK A;  2DNC A;  4K8I A;  3J80 E;  1I4P A;  1Q82 C;  2HIX A;  3EQL C;  3NP8 A;  3P20 A;  1W6K A;  4A3M G;  1LTR D;  2IT1 A;  5C44 G;  4XYO A;  3SK6 A;  1HFN A;  4JI3 Q;  5M5W H;  4OIK A;  3DHQ A;  4X64 Q;  3UE0 A;  1PTO H;  3KUP A;  1YJN A;  2F0O A;  2E75 C;  2VQF L;  3T56 B;  1BCP C;  2K52 A;  3KLS X;  4H02 A;  4FF4 A;  2Q8T A;  2NN6 H;  5ELC A;  2KQ3 A;  5JVG 3;  2YYZ A;  4DAP A;  3PCO B;  3C3L A;  3AFQ A;  3D4R A;  4C2M H;  4PZ8 A;  5D14 A;  1DYQ A;  1GJX A;  4A3B G;  5J3B A;  4JBM A;  1VQ5 A;  4GZY C;  1EY9 A;  3G7L A;  1Y69 U;  3SE0 A;  2MNA A;  1F9P A;  3G71 A;  4NXN L;  4EX5 A;  3C2P A;  2HCC A;  5G3L D;  1E2Z A;  2KCN A;  2JP1 A;  3VYU A;  4ZUI A;  2F0Q A;  4A3K B;  1XTD A;  4DAY B;  2B3G A;  4A3G B;  4Q5V A;  1PFB A;  2L12 A;  4LF9 Q;  2F1M A;  4WFN 3;  2PZT A;  4MIU A;  5M5W B;  1K83 B;  5IYB H;  1F2Y A;  1CKN A;  4RKL A;  3EA6 A;  3WWV A;  4KD4 A;  2WB1 E;  4PV1 C;  5KEE A;  3SDZ A;  1UE1 A;  2L1B A;  5FJ8 G;  1L1O C;  1S4Z A;  4V19 0;  1JOQ A;  1D5Z C;  3S1Q H;  2CQA A;  3GDE A;  2JA8 H;  4DNR B;  3GTJ H;  1EIY B;  4G7H C;  3HOX G;  2CWA A;  4DR1 Q;  3HOV H;  1Y8N B;  2VB3 X;  4DV1 Q;  1CI3 M;  2I07 B;  4C2M B;  3PUY A;  2ZM6 Q;  1H9K A;  5FLX E;  3W1B A;  4J8Q A;  2SOB A;  3ERS X;  1HJP A;  1UWV A;  4YCU A;  4A93 H;  5LL6 X;  4XT3 B;  5C4X B;  1EY7 A;  4DR6 Q;  4FVM A;  4YWM A;  1XMO L;  2E74 C;  1Y1W G;  1K8G A;  1NMG A;  4DXG A;  2PNR C;  1TY0 A;  3TN2 A;  1EY8 A;  4G7Z C;  4DA2 A;  3MXN B;  2F0L A;  1QUQ B;  2EXZ A;  2Z6B A;  4RKB A;  1SN8 A;  2AUJ D;  4G4K A;  5EPL A;  1BQQ T;  2OF1 A;  4HJ9 A;  1JOO A;  2B2Y A;  2RSN A;  1ET9 A;  1RJT A;  1QIL A;  2A68 D;  1YNJ C;  1IBM Q;  3PUV A;  2ZJR A;  1A63 A;  1CA6 A;  1STA A;  2TMP A;  4QIW E;  3S1Q B;  2RHS B;  2WAQ E;  1B9N A;  3CC4 A;  3I2Z A;  3GTJ B;  1WTR A;  1GUT A;  4M8A A;  5BR8 Q;  2PMZ B;  3HOV B;  3DWA A;  1PDQ A;  1STY A;  4HCE A;  4HMI A;  1TWA B;  3KF8 A;  4DV1 L;  3U4Z A;  5H1S E;  2BCO A;  1VQC A;  2B2T C;  4AQY Q;  2R7D A;  3E9H A;  4ID6 A;  5JJK A;  1I6H B;  5J39 A;  1F2M A;  4IFD I;  1PH5 A;  4DR6 L;  4K6L A;  4UHV A;  2RSO A;  3PMF A;  3RNU A;  1YHB A;  1GKH A;  3OTO L;  4BBS B;  4FNF A;  4NKL A;  1A62 A;  4ME3 A;  1QG7 A;  3RMH A;  1KRS A;  3BVM A;  5NUC A;  1HUN A;  4A3C G;  4ME5 A;  4JBJ A;  1XNQ Q;  4IUQ A;  2JA6 G;  2DY7 A;  4A3D H;  1GUG A;  2A6E D;  2CFM A;  1XNR L;  3FPP A;  2EXD A;  4H44 C;  4C3J H;  2R92 G;  4GOP A;  1XPO A;  3R3O A;  2UUB L;  1JMC A;  1V1O A;  3TME A;  3PO3 G;  3CCL A;  1JQY D;  5BR8 L;  4CKC A;  5EBD A;  1FJG Q;  3L0O A;  1X9N A;  4OEL B;  1X3P A;  1VQ4 A;  1HNX Q;  1PZI D;  2JEA I;  2NVX H;  3H3V C;  3TP6 A;  3NUC A;  4DK0 A;  4P71 A;  3R93 A;  3R8B A;  2IWH A;  2K32 A;  3FRP B;  4UP8 A;  4DV0 L;  3K5O A;  4HIO A;  3OSO A;  3H0G B;  1FNV A;  5IE8 A;  4X62 Q;  1VQF A;  4CDC C;  4AQY L;  2M00 A;  4UAI A;  4J6H A;  4IO9 A;  4FXD A;  3K7U C;  1Y1V G;  2MO1 A;  5JEA H;  2QIL A;  4QY7 A;  1E2V A;  5I2X A;  1HQM C;  1EEF D;  3BZK A;  4MNO A;  2DJG C;  4IUN A;  1D2B A;  1JIC A;  2PI2 A;  3WOF A;  2N55 A;  2TSS A;  1C8C A;  1B1Z A;  2SNS A;  1FVI A;  2OTJ A;  3KFU A;  4R8I A;  1ILP A;  2UXD L;  1ASZ A;  1VF5 C;  2KCC A;  4A3D B;  1XNQ L;  4KKU A;  4GNX B;  4C3J B;  2PQA B;  4B3S Q;  1QCB D;  2YTY A;  2UUC Q;  5LMU Q;  2FMM A;  2NZO A;  5GAH C;  1K0S A;  2LMC B;  5HGQ A;  1S5E D;  4A3J B;  3DEO A;  1FJG L;  2EZV A;  5COY A;  4N8X 1;  2EYF A;  1OTC A;  1J5E Q;  1NTG A;  2ZTC A;  1BCP D;  2MHV A;  2B2V A;  1R4P B;  1DM0 B;  1OXV A;  4JV5 L;  4X62 L;  4A75 A;  3H09 A;  1I5F A;  3I4M B;  3AYH B;  1IYV A;  1YVC A;  2NBF A;  1R9T B;  1QB5 D;  2F0J A;  3KF6 A;  1JB3 A;  3NSW A;  2KA7 A;  1K8O A;  2R7Z H;  1CTM A;  3ND8 A;  4N9P A;  3M4Y A;  4QUF A;  1PRT B;  2MGS A;  1IW7 C;  2AQ1 B;  5M3M G;  2KED A;  5I6Y A;  5A2Q L;  3G4S A;  1EY5 A;  2RDG A;  3K57 A;  1PZK D;  4KHZ A;  3S14 H;  2V4D A;  4B3S L;  3BDL A;  3L9A X;  3DWQ A;  2UUC L;  2J0T D;  2N49 A;  1YIT A;  1IXR A;  2L5T A;  2LFN A;  2F0S A;  3CPW A;  4ZAI A;  3TDQ A;  4AYB G;  1VQK A;  1AE3 A;  3H6M A;  1SJE D;  4E6I A;  1TS4 A;  4DXF A;  3E0J A;  2E2I H;  3C1E A;  1J5E L;  2F3W A;  2R93 G;  1ROD A;  5C4Z A;  2BE5 C;  4JI6 L;  4ZYS A;  1NR4 A;  4CDF C;  4DR5 L;  1BBW A;  1E1O A;  1E7Z A;  2A6H C;  3TZD A;  1A2U A;  3HOW G;  1G6Z A;  1MHW C;  1D5M C;  1BUV T;  4JV5 Q;  2D0P A;  3A5Z B;  4P75 A;  1D5X C;  2XRS D;  2P5Z X;  2NVT B;  2XWJ B;  2EOT A;  3NQI A;  3HEJ A;  3FKI B;  2EYM A;  3TS2 A;  4DV6 Q;  2VUM G;  1EQV A;  4UDU C;  3RD4 A;  2IJ0 A;  5KNC A;  3H91 A;  1UEA B;  3SXH A;  2Q2U A;  4QIW B;  2WAQ B;  2XNA C;  3QG1 A;  4HSP A;  2AUK A;  4OHJ A;  2B2U C;  2QKI C;  4FO2 A;  5CC4 A;  1C7Y A;  2F0U A;  1EZ6 A;  4L6T B;  1N36 Q;  1RTN A;  4IPG A;  4L63 B;  2B63 H;  1II3 A;  1PA6 A;  3S2D H;  1ASY A;  1LTL A;  4EQP A;  1JWM D;  3VYR A;  4A76 A;  3M4O H;  1XYI A;  1YNJ D;  4YHH Q;  1EIG A;  3BZC A;  2E2I B;  1RF2 D;  2NZ1 D;  3HP3 A;  3M4P A;  5CV5 A;  5GAE C;  1PVO A;  2F3V A;  3W2D A;  5ISR A;  3K8A A;  1ML0 D;  2UU9 L;  5COR A;  4AH6 A;  1DZ1 A;  5JOB A;  2NN6 G;  5JPN C;  2Z8L A;  1V43 A;  3ULJ A;  3HOZ H;  2RA4 A;  1CKO A;  4ZCK A;  1JB7 A;  3D4W A;  3GD7 A;  3M9B A;  2D2C C;  1GO3 E;  1JE4 A;  1ICW A;  3K5L A;  1A2T A;  1X6O A;  1EWC A;  4NP5 A;  4XIG S;  1VQ8 A;  1SMY C;  3A54 A;  5HUR A;  2KEC A;  2KCM A;  2B63 B;  4OIJ A;  4LUV A;  4IUP A;  4FF1 A;  2CH4 A;  4U68 A;  3M4O B;  1PZJ D;  2MUY A;  1BNZ A;  3QO2 A;  4CGY B;  2ZTD A;  3CCV A;  1NAP A;  2AQ3 B;  3HOY B;  2E8G A;  5L37 A;  3G6E A;  2RF4 A;  1H9S A;  1GD7 A;  4ODG A;  5IYB G;  4A3F H;  4B3M L;  2A73 B;  2YTV A;  2F0W A;  3V05 A;  3RZO H;  1SRU A;  3PV0 A;  4JVZ A;  2WP8 J;  3D4D A;  2BDO A;  4IUR A;  5D65 A;  1F9S A;  1I4H A;  1NJI C;  2EYO A;  2F0D A;  1DJR D;  2JA8 G;  2VQE Q;  4JBK A;  4MHE A;  3HOZ B;  2XIW A;  4HMJ A;  1IBL Q;  1JWU D;  3PO2 H;  1EEI D;  2EY1 A;  3HOV G;  1SSO A;  2NB0 A;  4DK6 C;  1MJC A;  1SE4 A;  3Q0A A;  5C0X H;  1W3S A;  1XX8 A;  5I9O A;  5M3F B;  3FPU B;  3Q22 A;  1SEB D;  3BJU A;  2QGQ A;  3K81 C;  3BYT B;  1QVG A;  1KAB A;  1LYL A;  1UE6 A;  2MFI A;  2O5J C;  4A93 G;  4I7A A;  2EJF C;  2K5V A;  2KEE A;  2RHQ B;  5IP9 H;  4DR3 L;  3D3R A;  2K5W A;  5IYD H;  1P8L A;  1CSP A;  4ZLT F;  4K2L A;  2N88 A;  2BH2 A;  4MTK A;  5BN3 A;  2E5L L;  2V1C C;  2R3Z A;  1DD2 A;  4A3I H;  1GUS A;  4RGT A;  3T53 B;  1JC7 A;  1AN8 A;  5CV8 A;  3D0F A;  2B2Y C;  2KVM A;  5T1I A;  4JI4 L;  1B3A A;  2EYP A;  2L55 A;  3AU7 A;  2ID0 A;  2F4V Q;  2RCF A;  4DV5 Q;  4POF A;  1JJC B;  2F0V A;  2JQO A;  1PRT F;  3GTQ B;  1F2Z A;  3TEH B;  5J22 A;  3E0E A;  2VQE L;  1IBL L;  1HZA A;  1LAB A;  4IJH A;  1VMC A;  3GQB A;  2KEN A;  5DNF A;  1HNZ Q;  5C3E B;  1CK1 A;  2XVS A;  1NY4 A;  3T1Y Q;  2VZA A;  2A19 A;  4KJO A;  4PZ7 A;  1E3P A;  3GO5 A;  1GM5 A;  2BDN A;  2B8F A;  3KLW A;  5CR3 A;  4JI8 L;  1KL9 A;  1HR0 L;  1WTX A;  2K5Q A;  2RVL A;  4XT1 B;  1WTW A;  4XDX A;  1IW7 D;  1TII D;  3FMC A;  5M5X H;  4DV7 L;  3PIP 3;  1DXM A;  4C1N K;  1PH4 A;  1K0R A;  5IGB A;  2YTX A;  2A6E C;  2KBN A;  1IKL A;  3K59 A;  4X6A H;  3OHX C;  1UAP A;  3ULP A;  1R4Q B;  3VR5 A;  2DUD A;  4IJL A;  2LS0 1;  1B44 D;  4A3L H;  4JCV E;  1LT5 D;  1H95 A;  1TWC H;  3F2D A;  3JAM E;  4A3D G;  2K03 A;  3DUZ A;  1MGS A;  2H1E A;  4C3J G;  1HQR D;  2F0F A;  4GOP C;  3GTO H;  2IX0 A;  2EDG A;  1VQI A;  4DV5 L;  1JJG A;  4H13 C;  4GLX A;  1I94 Q;  1TU2 B;  1PTO C;  3CQZ H;  4DF7 A;  4V0B A;  4H7B A;  5JVH 3;  2K33 A;  4TVA B;  2BE5 D;  1DOM A;  3KLR A;  1EOT A;  2ZXP A;  3T1H L;  2B29 A;  1C0A A;  4DR2 Q;  1I4G A;  5IT9 c;  2J4X A;  3K0Y A;  4CJ0 B;  5EKL A;  3SVM A;  3T1Y L;  4ILW A;  4ZKB B;  3DLL A;  1VF7 A;  4I7Z C;  3SEB A;  2WII B;  4I65 A;  5JEA G;  3W5O A;  1QE6 A;  3J80 c;  3OPO A;  3HZX A;  2B2U A;  5EGT A;  2QW7 A;  4RFB A;  3R2I A;  4BXX H;  2K6A A;  1E22 A;  4PG3 A;  5DM7 3;  3N52 A;  4EQO A;  5FO9 B;  4KHP L;  1TS5 A;  5A35 A;  4KLK A;  1OXT A;  1U4M A;  4A3K H;  5FO7 B;  1TS2 A;  1B53 A;  4C3I B;  1X3E A;  3A5U A;  4A3G H;  4MZ9 A;  2WB1 G;  5LL6 S;  1TWC B;  4TSS A;  1K83 H;  4GS3 A;  1VQA A;  1ENF A;  2RKS A;  2ZXR A;  3GTO B;  3A7L A;  1KAA A;  1L2F A;  5IGD A;  1JOR A;  4GKK Q;  1SE2 A;  4X66 Q;  3CQZ B;  3I4N B;  1TS3 A;  5A2Q E;  1IBK Q;  1CZW A;  2EY6 A;  1HR0 W;  1CZG A;  2FXQ A;  2K01 A;  3ER0 A;  3RLN A;  1TWG H;  1KLU D;  4DR2 L;  3ONA B;  4NW2 A;  5BN5 A;  2JA7 B;  2IL8 A;  2VW9 A;  2B2V C;  2JA5 H;  2ASB A;  2LXJ A;  4HJ5 A;  4KJN A;  1EUJ A;  4YWL A;  1N8R C;  2KJX A;  1M8A A;  3MXP A;  3ULL A;  1ESF A;  4IOA A;  4G57 A;  2VNU D;  1WCM B;  3EN2 A;  1YI2 A;  5C4X H;  2D0O A;  4DR7 Q;  2I5H A;  3NQT A;  4PMB A;  3S15 B;  3D31 A;  3KDF A;  4F7X A;  1X54 A;  2R7Z G;  2XN9 C;  3B6Y A;  1SYB A;  3TQY A;  5C3X A;  1SMY D;  1PMR A;  1HCZ A;  3HKZ B;  2NZH A;  3TP8 A;  2SDF A;  5GAD C;  2EYL A;  4JW0 A;  3NPP A;  4LUZ A;  1AZQ A;  1CQV A;  2MP1 A;  2L15 A;  1I3Q B;  3CHB D;  1PYB A;  2O4X A;  4JI3 L;  4X64 L;  1O80 A;  1I50 H;  1PV4 A;  3S17 B;  4GKK L;  1Q3L A;  4X66 L;  1PLF A;  4FXK C;  1TWG B;  2ZT9 C;  1O7I A;  4HSV A;  4LF8 Q;  2JA5 B;  4BY1 B;  1FGU A;  1TWA H;  1HHV A;  1K3R A;  1XMQ Q;  1CUK A;  3CRK C;  3NWT A;  3QR8 A;  3CCM A;  1VQJ A;  1TT2 A;  3NBH B;  1I6H H;  3L2P A;  4UY8 C;  1Q90 A;  3MTS A;  5F2D A;  3J80 i;  1AZP A;  3PIO 3;  1M1K C;  4FDB A;  1CA5 A;  4HJ8 A;  4M1U B;  4YY3 Q;  3I3C A;  4K5W A;  2YV5 A;  3FVQ A;  3TRZ A;  1VQN A;  4BBS H;  5AJ3 Q;  4DFA A;  1AW7 A;  5JEA J;  4LF9 L;  4DNT B;  3KLS A;  1RTO A;  4POG A;  4JPB W;  3F1Z A;  2MPM A;  4DUY Q;  1D1K A;  3E6Z X;  1A3T A;  2ZTE A;  1XJV A;  2B63 G;  1I50 B;  2XWB B;  1T9H A;  1V8Q A;  2Z6K C;  3HOU H;  2K75 A;  3FDT A;  2K7V A;  3J81 L;  3IFD A;  4JBW A;  4HAE A;  1LLR D;  4GNX C;  4DR1 L;  3GV3 A;  3QB3 A;  2Y0S G;  4C56 C;  1WTH A;  1FYC A;  2MQH A;  5CV9 A;  1OXS C;  2F4I A;  1SE8 A;  5D3D A;  2ZM6 L;  1UUP A;  3A56 A;  1RHP A;  3H0G H;  1BOS A;  4JYA Q;  1RD9 D;  1AH9 A;  4DN4 M;  3S16 B;  2EIF A;  3NTH A;  3U9S A;  1RL2 A;  1C48 A;  1KXL A;  2FHT A;  1V1P B;  3HOZ G;  1E2W A;  3PQI A;  1KC8 C;  2A74 C;  4LWC A;  1F9R A;  1U4R A;  2ZJQ A;  3EIV A;  5TSS A;  2KOL A;  3S1R B;  3C1F A;  4LFC Q;  1QJO A;  2NUC A;  2DN8 A;  1JT8 A;  4YWK A;  1NNX A;  5CYU A;  3K7A B;  4DUY L;  3L7Z C;  1IBM L;  4DAY A;  1PH9 A;  2KCT A;  5EBC A;  1MBY A;  4LF4 Q;  3HOU B;  1HA5 A;  3J7A V;  3MXG A;  5K5P A;  4FYD A;  3T4A C;  1PYS B;  5IGE A;  1QWY A;  1HH2 P;  3RN2 A;  4A3J H;  1HPC A;  2RBM A;  1L1O B;  1MSH A;  1HTL D;  3MWY W;  1QNK A;  1W2B A;  2AWO A;  4A3F G;  5CBE E;  4BY7 H;  4RHR A;  1PTO D;  4IZ8 A;  2RCN A;  1UE7 A;  2EY5 A;  4GN5 A;  4Z9C B;  3T16 A;  3I4M H;  3H94 A;  4OO1 I;  1PH6 A;  4G7O C;  1J8I A;  3BYY B;  1R9T H;  2K5D A;  2VXW A;  3PO2 G;  3D6W A;  1TVX A;  3CME A;  1CM9 A;  5C0X G;  5D3I B;  1ILQ A;  5I9P A;  1C9O A;  1SXT A;  1X56 A;  5HY6 A;  3BVG A;  3BDO A;  3HKS A;  1QUQ A;  4KTA A;  1QOH A;  5IP9 G;  2EVB A;  5IYD G;  4LF4 L;  1K73 C;  1LUZ A;  1YZ6 A;  3PIO A;  1QZH A;  4O0A A;  1Q86 C;  1WD1 A;  4A3I G;  2JN4 A;  2DY8 A;  2X6G A;  1LTI D;  1S5F D;  3I70 A;  3DEP A;  4BA1 I;  1HNX L;  2JJQ A;  2F0N A;  4BY7 B;  1J9O A;  4QQB X;  3KBX A;  3HS0 C;  3OW7 A;  4R4O A;  1F2L A;  2Z0S A;  4CDE C;  3BU2 A;  1XWE A;  1FNU A;  1GXD C;  3T51 B;  3I4O A;  5EKI A;  1A15 A;  1B8A A;  3GTL B;  5EPK A;  1KNA A;  2NVT H;  3ITP A;  2WFW A;  2I5L X;  5IT9 L;  3FKI H;  4JI5 Q;  4TQU S;  3CCE A;  1N9W A;  3OMG A;  1S3O A;  3Q6S A;  4JI1 Q;  5GRO A;  4A3E B;  3PUW A;  4GLA C;  4L5T A;  1SYD A;  3TZU A;  5FLM H;  4TRD A;  1KAW A;  2Q2H A;  4RG1 A;  4KN4 C;  3O13 A;  3VR2 A;  3NHH A;  3AQQ A;  4KKS A;  3GTG B;  1B7Y B;  3W1G A;  1STE A;  3CRL C;  1KIX A;  3BVZ A;  1EYC A;  4CKE A;  1LTB D;  5LMU L;  4B3T Q;  2NVY B;  3U50 C;  1Y8P B;  3KOJ A;  3F8T A;  1N33 Q;  1BO0 A;  4RGN A;  1B3Q A;  5C44 B;  1WTP A;  1NCV A;  4A3L G;  3M7G A;  4DAM A;  3IAY A;  3AEV A;  1EYG A;  4L8J A;  1AP0 A;  2C9O A;  3OIQ A;  2A8V A;  2AQ2 B;  2I46 A;  1K3B C;  1LTA D;  3OWE B;  5EJW A;  3M7N A;  1CHQ D;  2O2L D;  4K5X A;  2K50 A;  4GKJ Q;  2VS1 A;  4B3R Q;  2QDL A;  1D6E C;  2K05 A;  1GHJ A;  4KN7 C;  1BXT A;  2OCE A;  3EJI A;  3MXU A;  4JI1 L;  4A3B B;  1U4L A;  3VYT A;  1EIF A;  1U9R A;  3UDF A;  3URY A;  3RUZ A;  2FIN B;  5IWA Q;  4LF5 Q;  1BBU A;  5EKK A;  3GTM B;  5FOB B;  4DK3 C;  4BXX G;  1SE3 A;  1SYF A;  4NPS A;  5C0X J;  1EQQ A;  2Z6K A;  2E76 C;  1EYA A;  3H3V I;  3N6R A;  3LWU A;  4S3S A;  5KYI A;  4A3K G;  2AMC B;  4GNX A;  4UPA A;  3PSI A;  1G91 A;  4A3G G;  3S1N B;  5JJI A;  3HOY H;  4LAA A;  3KYH C;  1WD0 A;  2JA9 A;  1EY0 A;  1TR5 A;  2XSC A;  1XXG A;  5KRU A;  4BA2 I;  1IZ6 A;  1NE3 A;  3R2T A;  1UNS A;  4DK1 A;  2FFK B;  2L11 A;  3HOX B;  4WJ3 M;  3UE1 A;  2EYH A;  4AYB E;  1DOK A;  2ZXO A;  1OXU A;  3P75 A;  3RN5 A;  1EU3 A;  4DV6 L;  2UXB Q;  2WIN B;  5M3F H;  4N8F A;  4F8M A;  2N8N A;  2UXC Q;  4ABN A;  2Z4H A;  4LF5 L;  1Y1W B;  4RCN A;  5C4X G;  4XQJ A;  1IYJ B;  5C4J B;  3CCS A;  4WRD A;  4IPC A;  1N34 Q;  2IHF A;  1N36 L;  2CWP A;  4Y52 H;  5DEH A;  4JK1 C;  1SYE A;  1SYC A;  4OWX B;  5KND A;  1YJW A;  3GTK H;  1VQ9 A;  1YNX A;  5CBA E;  4YHH L;  3F2C A;  1PRT D;  3ZYY X;  1V1Q A;  2B2W A;  2KHI A;  4JOI C;  3HKZ E;  2M9V A;  3QJY A;  4CJ2 C;  1PHJ A;  2A69 D;  3V2T A;  2NVQ H;  4HTH A;  4BWG B;  2EQS A;  3AFP A;  5IOC A;  4R4C A;  2IW3 A;  1S72 A;  3GTQ H;  1ZKO A;  1XTC D;  1V9P A;  2D9U A;  5IIF A;  2QA4 A;  1FGB D;  1HNW Q;  1BDO A;  3J81 E;  5C3E H;  1Z47 A;  4KKT A;  1QZG A;  2CH4 W;  2UXB L;  2YU9 B;  1AEX A;  1SDF A;  2UXC L;  1KQS A;  3HG9 A;  4DPG A;  3OYY A;  3KJO A;  5ELD A;  1NMF A;  2CHB D;  2SEB D;  3I4L A;  3D6C A;  5C5M A;  2B39 A;  1PH3 A;  2E2D C;  3KK7 A;  2R61 A;  4KV6 A;  4OWW B;  1FR3 A;  1LV9 A;  1LT3 D;  1BF4 A;  4QGU A;  2MJ8 A;  3UDI A;  3GTK B;  4BBS G;  3UDX A;  3DXJ C;  1CT1 D;  4NXM Q;  2H4O A;  4OL7 A;  2X69 A;  2NYZ D;  2NVQ B;  2PI2 E;  4B9X A;  2CW0 C;  2QEJ C;  1M90 C;  3T13 A;  1A8V A;  4BBR H;  2BOS A;  4QJF A;  3C46 A;  2ICI A;  1CQF A;  1A3V A;  3HOU G;  4QMG A;  5DLQ E;  3K5N A;  2ZJP A;  1Q12 A;  1HA6 A;  4F87 A;  5JJZ A;  1WVL A;  1K8A C;  2N3S A;  4OX9 Q;  3VYS A;  1HNW L;  2HHH Q;  4ZKC B;  4DR4 Q;  3DM3 A;  1TY2 A;  2F3I A;  4B9W A;  2K1B A;  3H0G G;  3MVV A;  1Y1V B;  1SRO A;  4ZUJ A;  3NXW A;  4RWS C;  1JR0 D;  1I4Q A;  1MJE A;  1D7Q A;  1EFI D;  1SNP A;  1VQD A;  3CP0 A;  5J1Z A;  5BN4 A;  4LF7 Q;  3M85 A;  4IUU A;  1F77 A;  5E4X A;  1XPR A;  1VQP A;  1DOL A;  3TS0 A;  4K5V A;  3JAM c;  3DM1 A;  3IRB A;  3PUZ A;  3KDF B;  1ESR A;  2JXM B;  4C3I H;  1ZYR C;  4LJZ C;  4JI7 Q;  4FF2 A;  4JI0 Q;  1WTQ A;  1L0X B;  4EQ5 A;  4BBR B;  3P1H A;  5IGC A;  3CPF A;  4PMW A;  2F4V L;  3P7J A;  3PGZ A;  3ERQ A;  1KTK A;  1G2T A;  1CKN B;  1BR9 A;  3I4N H;  4J1M A;  2QEX A;  3TRE A;  4A3J G;  1BVS A;  1OO9 B;  4XXE A;  1IL8 A;  2N78 A;  1D8L A;  1YBY A;  3F2U A;  3MZ5 A;  1HNZ L;  2E2J B;  4KK7 A;  2PPB C;  2R93 H;  4BY7 G;  5I2Y A;  1VQO A;  3CD6 A;  1O7L A;  2JA7 H;  4DR4 L;  1VQB A;  2AWN A;  3A8K E;  5EPJ A;  3I73 A;  2F0T A;  3PUX A;  3I4M G;  3FHW A;  3M3Y B;  4J15 A;  1WCM H;  2M2L A;  4C1N I;  2L9H A;  3S15 H;  4RGM A;  1VQL A;  3U9O A;  1A0I A;  1KDC A;  1VDZ A;  1UEB A;  5IP7 H;  4JI7 L;  3DMU A;  2EY2 A;  1EZ8 A;  3I55 A;  1I3Q H;  4JI0 L;  2XRQ D;  1MKH A;  4IPH A;  2QCP X;  2K5N A;  3CAM A;  4AYB B;  3S17 H;  1ICF B;  1I94 L;  3VA5 A;  1P16 A;  4P72 A;  5CV6 A;  4Y7N B;  1X3Q A;  1EFW A;  1STN A;  3ERO A;  1EU4 A;  5T1G A;  2R93 B;  1SNC A;  4BY1 H;  2R6G A;  5DAU A;  1STH A;  1TWF B;  3IFT A;  3KF8 B;  1KRT A;  3HOW B;  4YCW A;  2X6L A;  2EPB A;  1LTS D;  3J7Z C;  1KD1 C;  1SJH D;  2F0K A;  2C35 B;  1O7Z A;  3J7Y W;  1B9M A;  1NUC A;  1EIH A;  4R1J A;  5AFW A;  1S40 A;  5ELF A;  3X3N A;  2VUM B;  3FKI G;  1JE5 A;  3RZD B;  2WAC A;  4LFA Q;  1AE2 A;  2I0Q A;  5FLM G;  3BZD B;  4JOI A;  3JAM i;  1I4R A;  4IFD H;  1S5D D;  4PNY A;  1U0L A;  2NWG A;  3TBI B;  3S2H B;  1PYW D;  4KHV A;  1XMO Q;  2WAQ G;  4U67 3;  1H9M A;  1OXX K;  2CQO A;  3WOE A;  1LAC A;  1Q1B A;  1QNU A;  1GUW A;  5E4W C;  1CKM A;  4KMU C;  2ENB A;  3PIP A;  4GN3 B;  1X32 A;  5KYL A;  1IBK L;  4QCL A;  4GN4 B;  1YNN C;  5FLX c;  1CSQ A;  1VQH A;  3S9W A;  1G8Z D;  1RIP A;  4GOP B;  1QVC A;  4DKA C;  1J6Q A;  4ALP A;  3MC0 B;  3GTP H;  2JYO A;  1PTO B;  1KNE A;  2BH8 A;  5IGF A;  1EYD A;  2GN5 A;  1G6P A;  3NEM A;  1ENC A;  4HJA A;  4DR7 L;  2QDB A;  4CKB A;  3A8J E;  5HGT A;  3S16 H;  2EYJ A;  4EVO A;  2Q8R E;  4WOR A;  1VQE A;  3A55 A;  4NB3 A;  1SNO A;  1SAP A;  1B50 A;  1SBB B;  1L0Y B;  4LK1 C;  2H5X A;  4LFA L;  1E24 A;  2OQ0 A;  3S1R H;  1O78 A;  4OO1 H;  2K28 A;  4JI2 Q;  3NEL A;  1GUO A;  1MSG A;  3K80 C;  3STB D;  5ELO A;  2AKW B;  4LUO A;  3K7A H;  2PYK A;  1B70 B;  2OWO A;  3OTO Q;  5K36 H;  3CCJ A;  4AIM A;  3CW2 C;  1EWH A;  2RQX A;  5M5Y H;  1L0W A;  2Q8I B;  1HZC A;  5CMD A;  2CW0 D;  1TQO A;  1HTP A;  2NN6 I;  5M9O A;  1BCP B;  4LF8 L;  3GTP B;  2F0M A;  3HOY G;  5G3L F;  3UDG A;  5CV7 A;  3NTK A;  1XMQ L;  3OW2 A;  1RKN A;  4WJW A;  1XNR Q;  3QOJ A;  2G5D A;  2IPK D;  1WTV A;  4HN7 A;  2UUB Q;  2JA8 B;  4QF4 A;  4IN3 A;  2K5H A;  1TWH H;  3MEF A;  4XTC S;  3D8G A;  1I4X A;  1HXY D;  1HUM A;  3EBE A;  4YY3 L;  2NTS A;  1KLG D;  2OXP A;  4DV0 Q;  3KF6 B;  5M3F G;  5AJ3 L;  5IYC H;  1FNW A;  5ELN A;  4A93 B;  2F0I A;  4ZQ3 A;  3F2B A;  5FO8 B;  4JI2 L;  1O7Y A;  3MEH A;  5LMN Q;  3RLO A;  4P73 A;  3AMU A;  1PRT C;  3BG3 A;  4OXP A;  1Q1E A;  1EQT A;  1DGS A;  1ZYR D;  5M5Y B;  4K0K Q;  2A69 C;  3PF5 A;  1YEZ A;  2FJ2 A;  3LWE A;  2SNM A;  2UXD Q;  1WTO A;  2B2W C;  1WJJ A;  3G6J B;  1IYU A;  1W6J A;  4HED A;  4ZRZ A;  4HID A;  2VL6 A;  2Z9H A;  2PZW A;  2OEO A;  2B8G A;  3A0J A;  2PW5 A;  2ATW A;  2HT1 A;  4FXG C;  4JYA L;  1VQ7 A;  4XQN A;  4CBV A;  4HIK A;  1TWH B;  2A5H A;  4OON A;  4R8N A;  3EVQ A;  4MN3 A;  3IL8 A;  3M4Q A;  1GVP A;  2L0C A;  4NMZ A;  3CMA A;  1F9Q A;  1E1T A;  3QOL A;  1Y14 B;  1ZXT A;  3GTL H;  3K58 A;  3NBH A;  2Y0S E;  5C3E G;  3SK4 A;  4RCO A;  3I56 A;  1QVF A;  4LFC L;  1YHA A;  1Q8I A;  4L5S A;  5GQO A;  4A3E H;  3J81 j;  2J7Z A;  4B08 A;  4C3H H;  3UI2 A;  3MXN A;  5EAY A;  1Z9F A;  1NR2 A;  3V96 A;  5LMN L;  1T5X D;  1E0B A;  5KGU A;  1YIJ A;  5C5L A;  3SGI A;  4RA8 A;  3GTG H;  3LGJ A;  4JC0 A;  1RCV D;  4DAV A;  3KJP A;  4K0K L;  4IQZ A;  4L5R C;  5JPM C;  2HIV A;  3JAM L;  2NVY H;  4O1N A;  4A3M H;  4RAU C;  1H9J A;  5C44 H;  1SFO H;  2PZU A;  4CDD C;  2PO4 A;  4N9T A;  4BBR G;  1NSN S;  2JSO A;  4O2D A;  2VY3 A;  4LW1 A;  3H3V H;  3NTI A;  3NK9 A;  3BS1 A;  1X55 A;  1EY4 A;  1EOV A;  2HQL A;  2EJG C;  2NVX B;  4L5Q A;  4FF3 A;  3G48 A;  2RDH A;  5KNB A;  1HFG A;  3GV6 A;  3Q24 A;  4JI6 Q;  2IY5 B;  1SNQ A;  1VS0 A;  1V1P A;  4LFB Q;  2WKC A;  4DR5 Q;  4C3H B;  4A3B H;  5FK9 C;  3W3A A;  3J80 L;  1KDB A;  1CFM A;  4X65 Q;  3A74 A;  5E3F A;  5LHY 1;  3GTM H;  3ZJY C;  1PTO F;  4QUC A;  1SMX A;  2WKD A;  1XPU A;  1PFN A;  3BDC A;  4IPD A;  3I7F A;  1UE5 A;  1SNM A;  4A3M B;  4C3I G;  2WB1 B;  1SFO B;  3CXC A;  4QL5 A;  3S1N H;  4DV2 Q;  1B4O A;  2ICE C;  1D1I A;  1CHP D;  4R4T A;  3NEN A;  2Q2I A;  3OMC A;  1YNN D;  4NDX A;  3ICE A;  1L1O A;  3K6O A;  5FJ8 H;  1U5K A;  1WYD A;  1H9S B;  3I4N G;  5LMN W;  3HOX H;  1JWS D;  3TP5 A;  3RLF A;  4R4I A;  4JG2 A;  1NBW A;  3SR1 A;  4ULL A;  4PZ6 A;  4ZK9 B;  2L4N A;  3VDY A;  2JA7 G;  4JI5 L;  1SYG A;  4IAL A;  3VR3 A;  1STB A;  1T5E A;  1GUN A;  2EE1 A;  4K14 A;  4MTN A;  4LFB L;  2K4K A;  1M4V A;  2F52 A;  4DV3 Q;  3QIA A;  2UU9 Q;  3GP7 A;  1LT6 D;  3HRZ C;  4X65 L;  1YHQ A;  1LT4 D;  1WCM G;  1Y1W H;  2R7Z B;  2EJM A;  5C4J H;  1BCP F;  5CV4 A;  3E9I A;  1IKM A;  1GHK A;  3NE5 B;  2HUG A;  2HCI A;  2KHJ A;  2CCZ A;  4B3T L;  2OT2 A;  4WJ4 A;  3A8I E;  2IHE A;  2PQA A;  3HKZ G;  1LTG D;  1N33 L;  2PNH A;  1SND A;  3Q8D A;  1JOK A;  4Q0F A;  4BS9 A;  3CCQ A;  5IP7 G;  2UUA Q;  4LF6 Q;  2DJF C;  1DON A;  2GVA A;  4DV2 L;  2F03 A;  2XTI A;  3DWP A;  3S14 B;  5IY0 A;  1Z6H A;  2G9H D;  5C3W A;  3S24 A;  4DUZ Q;  3MFY A;  4TKO B;  2HQE A;  2BA0 A;  4UP7 A;  3CCR A;  5DM6 3;  2NTT A;  4RH6 A;  1BBX C;  2F0G A;  5FLX L;  4PQX A;  2WV6 D;  3KBG A;  1HRJ A;  3I91 A;  2GA4 B;  2RDF A;  4OWT B;  4DNI A;  1HZ9 A;  2Q2T A;  1KHI A;  4EGV A;  4B3M Q;  3OIP A;  4KY7 A;  4GKJ L;  2JA5 G;  4BY1 G;  1C4Q A;  4HR7 B;  2OTL A;  4B3R L;  2B2T A;  1H9R A;  4XYQ A;  3I90 A;  3CU7 A;  3VA7 A;  4DV3 L;  2YU9 H;  2F0H A;  4IOC A;  2PW7 A;  5IWA L;  1B2T A;  1WFQ A;  2I5M X;  1SR3 A;  1G29 1;  3ND9 A;  1JJ2 A;  2PCF B;  5JAV A;  4K8J A;  3CC2 A;  2K04 A;  4P74 A;  3SK8 A;  4YIJ A;  4O42 A;  3I72 A;  1PH7 A;  1N32 Q;  4A3C H;  1AFP A;  2UUA L;  4IFD G;  4LF6 L;  4QB4 A;  1LTT D;  1I6V C;  2JA6 H;  4RHS A;  4IUV A;  1U4P A;  4DR3 Q;  4APV A;  4LMQ D;  2R92 H;  3S2D B;  3J7A 5;  2E2H H;  4DUZ L;  2Z1C A;  1LO5 D;  2E5L Q;  4CJ1 B;  3J81 c;  3PO3 H;  1IHZ A;  1LM0 A;  2CKZ B;  2PQE A;  2KUM A;  2Y0S B;  3S1M H;  3OWF A;  1X3F A;  3LNN A;  5FKA C;  2C5C A;  3E3X A;  3MA2 B;  2O5I C;  4JI4 Q;  1EWI A;  1JCK B;  3CC7 A;  5C4H A;  2AHO B;  4KD3 A;  1S5B D;  4P2C B;  1MI2 A;  4X3K A;  1SLJ A;  1Y1V H;  1FD7 D;  2LXK A;  4A4I A;  1EY6 A;  1STG A;  5IGG A;  3AB9 A;  5ELB A;  5JJL A;  1N34 L;  1Q81 C;  1PH2 A;  2DNE A;  4DV4 Q;  3STB C;  2JE6 I;  4H0L C;  4LNQ A;  1G51 A;  1ONL A;  4X3S A;  5ELE A;  4OO1 G;  1PFM A;  1TKW B;  1WI5 A;  1X3G A;  4FP5 D;  1N32 L;  4JI8 Q;  2JA6 B;  1HR0 Q;  1WOC A;  2F0P A;  3U4V A;  3MHB A;  2R92 B;  1K8M A;  1VMP A;  2E2H B;  1RDP D;  2LKV A;  4DV7 Q;  5K36 G;  2JEB I;  3PO3 B;  2A68 C; 
#chains in the Genus database with same CATH homology
 4P75 A;  1PYS B;  1HH2 P;  3K0X A;  1PFS A;  4R1J A;  3RN2 A;  1S40 A;  2K14 A;  4A3J H;  2A1A A;  3TS2 A;  1L1O B;  1JE5 A;  3FKI G;  4DV6 Q;  2VUM G;  3CF5 A;  1BKB A;  1W2B A;  4LFA Q;  2AWO A;  4A3F G;  2R7F A;  1AE2 A;  2E2J H;  5FLM G;  4JOI A;  3JAM i;  2I0Q A;  3H15 A;  4BY7 H;  2Q2U A;  4UP9 A;  1U0L A;  2RCN A;  2XGT A;  4RMF A;  1XMO Q;  1UE7 A;  2WAQ G;  1C7Y A;  4GN5 A;  4OO1 I;  3I4M H;  1OXX K;  1N36 Q;  2CQO A;  1HZB A;  3JC6 6;  4IPG A;  2B63 H;  1PH6 A;  1PA6 A;  3M3Y H;  1R9T H;  2ES2 A;  1Q1B A;  3PO2 G;  3S2D H;  1CKM A;  1ASY A;  3PIP A;  4GN3 B;  1LTL A;  2JK8 A;  3CME A;  4A76 A;  3T1H Q;  1Q46 A;  1IBK L;  4GN4 B;  5C0X G;  5FLX c;  3M4O H;  2PMZ E;  4DV4 L;  1CSQ A;  4YHH Q;  1VQH A;  3BZC A;  1RIP A;  3U58 A;  4GOP B;  4HIM A;  1QVC A;  2DGY A;  4DKA C;  1C9O A;  1J6Q A;  1X56 A;  3M4P A;  4ALP A;  5GAE C;  3RR5 A;  5IYC G;  5HY6 A;  3GTP H;  3HKS A;  1PVO A;  2BH8 A;  4NXM L;  3PF4 A;  5M3M H;  2ALY B;  1EQR A;  1QUQ A;  3K8A A;  4R4Q A;  2BA1 A;  2GN5 A;  5IP9 G;  2UU9 L;  4AH6 A;  1VQ6 A;  5IYD G;  4KI0 A;  1G6P A;  2D62 A;  1VCI A;  4LF4 L;  1K73 C;  2NN6 G;  1LUZ A;  1YZ6 A;  3NEM A;  4HJA A;  1K9M C;  3PIO A;  4DR7 L;  3S16 H;  1V43 A;  4KHP Q;  1YJ9 A;  3ULJ A;  1QZH A;  1TXY A;  3HOZ H;  4O0A A;  1Q86 C;  1CKO A;  1JB7 A;  3GD7 A;  3M9B A;  4A3I G;  1GO3 E;  1VQE A;  4GLV B;  3HFZ B;  4NB3 A;  3J81 i;  1IL2 A;  4BA1 I;  1X6O A;  4Y7N H;  1VQG A;  1HNX L;  2R92 G;  4IFD J;  2JJQ A;  4XIG S;  4OX9 L;  2H5X A;  4LFA L;  5C0X I;  4QQB X;  1E24 A;  1VQ8 A;  2HHH L;  2OQ0 A;  3S1R H;  2GVB A;  4JI2 Q;  3NEL A;  1VQM A;  1FL0 A;  3K80 C;  4R4O A;  2KCM A;  3STB D;  2Z0S A;  2VQF Q;  1TWF H;  2AKW B;  4LUO A;  5ELO A;  3BU2 A;  3K7A H;  3I4O A;  1PH1 A;  4HJ7 A;  3HOW H;  1B70 B;  2OWO A;  4LUV A;  3OTO Q;  1B8A A;  3CCJ A;  2LSS A;  4AIM A;  3CCU A;  3CW2 C;  5M5Y H;  5GAG C;  4LF7 L;  1L0W A;  2NVT H;  1HZC A;  2NN6 I;  4YCV A;  2WFW A;  1MIU A;  2I5L X;  2OQK A;  2ZTD A;  3CCV A;  1Q7Y C;  3FKI H;  4JI5 Q;  2VUM H;  2E8G A;  4TQU S;  3CCE A;  3G6E A;  1N9W A;  2RF4 A;  1PH8 A;  4LF8 L;  1Q8K A;  1GD7 A;  1S3O A;  4JI1 Q;  5GRO A;  5IYB G;  3PUW A;  4GLA C;  4L5T A;  4A3F H;  3RZD H;  4B3M L;  3UDG A;  2YTV A;  3FP9 A;  4A3E G;  5FLM H;  3RZO H;  1XMQ L;  1SRU A;  1X65 A;  3PV0 A;  3OW2 A;  1KAW A;  2Q2H A;  1XNR Q;  3S2H H;  4RG1 A;  2WP8 J;  1NJI C;  3AQQ A;  5E7N A;  2UUB Q;  4NXN Q;  2JA8 G;  2IX1 A;  2K5H A;  2MO0 A;  1B7Y B;  3W1G A;  2VQE Q;  1KIX A;  1TWH H;  3MEF A;  1IBL Q;  4JBK A;  3PO2 H;  4XTC S;  5LMU L;  3HOV G;  4B3T Q;  4DK6 C;  1MJC A;  3U50 C;  2HIX A;  1Q82 C;  3KOJ A;  1W3S A;  3EBE A;  4YY3 L;  3F8T A;  1N33 Q;  4A3M G;  4DV0 Q;  3BJU A;  2IT1 A;  3KF6 B;  2QGQ A;  3K81 C;  5C44 G;  5AJ3 L;  4DAM A;  5M3F G;  1QVG A;  5IYC H;  4A3L G;  1LYL A;  5ELN A;  4JI3 Q;  5M5W H;  4X64 Q;  1UE6 A;  2MFI A;  3UE0 A;  3F2B A;  4A93 G;  4JI2 L;  1YJN A;  3AEV A;  1EYG A;  5LMN Q;  3RLO A;  2K5V A;  2VQF L;  4P73 A;  2RHQ B;  2K52 A;  5IP9 H;  4H02 A;  4DR3 L;  2A8V A;  5IYD H;  1P8L A;  4OXP A;  1Q1E A;  1CSP A;  2BH2 A;  1DGS A;  4K0K Q;  2YYZ A;  3PF5 A;  1YEZ A;  2V1C C;  2E5L L;  3M7N A;  4A3I H;  2K50 A;  4GKJ Q;  1N32 Q;  2UXD Q;  3PCO B;  2VS1 A;  4B3R Q;  3D0F A;  1WJJ A;  3AFQ A;  2OCE A;  4JI1 L;  4C2M H;  4PZ8 A;  4JI4 L;  4HID A;  1EIF A;  3UDF A;  4A3B G;  2VL6 A;  5J3B A;  4JBM A;  1VQ5 A;  2ID0 A;  5IWA Q;  3A0J A;  4LF5 Q;  2F4V Q;  2ATW A;  2HT1 A;  1BBU A;  4JYA L;  1VQ7 A;  2MNA A;  3G71 A;  4POF A;  1JJC B;  4NXN L;  4EX5 A;  4DV5 Q;  4HIK A;  2JQO A;  4DK3 C;  4OON A;  4BXX G;  4NPS A;  3TEH B;  5C0X J;  1EQQ A;  3E0E A;  2VQE L;  3M4Q A;  2Z6K A;  1IBL L;  1GVP A;  3H3V I;  1HZA A;  3CMA A;  1E1T A;  1XTD A;  1Y14 B;  4DAY B;  4IJH A;  3GTL H;  4A3K G;  2AMC B;  2KEN A;  4GNX A;  1HNZ Q;  2B3G A;  4UPA A;  1NY4 A;  2Y0S E;  3PSI A;  5C3E G;  4A3G G;  3T1Y Q;  5JJI A;  4LF9 Q;  3I56 A;  1QVF A;  3HOY H;  2VZA A;  2A19 A;  4LFC L;  1YHA A;  3KYH C;  4PZ7 A;  1CKN A;  5IYB H;  1E3P A;  3GO5 A;  5GQO A;  2JA9 A;  3WWV A;  3J81 j;  4A3E H;  1GM5 A;  4L5S A;  2WB1 E;  4C3H H;  3KLW A;  5EAY A;  4JI8 L;  1KL9 A;  1UE1 A;  1HR0 L;  1Z9F A;  5FJ8 G;  5LMN L;  1L1O C;  4BA2 I;  1IZ6 A;  1NE3 A;  3S1Q H;  1YIJ A;  3SGI A;  3GDE A;  2JA8 H;  3GTG H;  3GTJ H;  1EIY B;  5M5X H;  4DV7 L;  1PH4 A;  3LGJ A;  3HOX G;  4WJ3 M;  2CWA A;  4JC0 A;  1K0R A;  3UE1 A;  4DR1 Q;  3HOV H;  3KJP A;  4K0K L;  4AYB E;  2YTX A;  2KBN A;  4DV1 Q;  4L5R C;  2HIV A;  1OXU A;  2NVY H;  3RN5 A;  4X6A H;  3ULP A;  4DV6 L;  4A3M H;  2DUD A;  4IJL A;  3PUY A;  2ZM6 Q;  5C44 H;  2UXB Q;  3W1B A;  5M3F H;  4JCV E;  4A3L H;  1SFO H;  1H95 A;  2N8N A;  2UXC Q;  1TWC H;  3ERS X;  1HJP A;  1UWV A;  4YCU A;  3F2D A;  4A93 H;  4A3D G;  4BBR G;  4DR6 Q;  4LF5 L;  4YWM A;  4O2D A;  2VY3 A;  5C4X G;  1XMO L;  1IYJ B;  4LW1 A;  4GOP C;  2IX0 A;  1Y1W G;  3GTO H;  3H3V H;  3CCS A;  1NMG A;  1VQI A;  1X55 A;  4IPC A;  4DV5 L;  2IHF A;  1N34 Q;  1K8G A;  1JJG A;  4GLX A;  1N36 L;  1I94 Q;  2CWP A;  3CQZ H;  4Y52 H;  1EOV A;  2HQL A;  4TVA B;  3MXN B;  4OWX B;  1QUQ B;  3T1H L;  2B29 A;  4L5Q A;  1YJW A;  1C0A A;  4DR2 Q;  3G48 A;  1SN8 A;  1VQ9 A;  3GTK H;  1YNX A;  5IT9 c;  3F2C A;  4YHH L;  1V1Q A;  4HJ9 A;  2KHI A;  4JOI C;  3T1Y L;  4JI6 Q;  2IY5 B;  3HKZ E;  1VS0 A;  3DLL A;  4LFB Q;  4DR5 Q;  1IBM Q;  3PUV A;  1PHJ A;  2NVQ H;  2ZJR A;  5JEA G;  4A3B H;  3W5O A;  1A63 A;  3J80 c;  2EQS A;  4QIW E;  2RHS B;  4X65 Q;  2WAQ E;  3CC4 A;  3AFP A;  3A74 A;  3I2Z A;  4R4C A;  3GTM H;  5BR8 Q;  4BXX H;  1E22 A;  1S72 A;  4PG3 A;  3GTQ H;  3ZJY C;  1V9P A;  4KHP L;  4KLK A;  1SMX A;  1OXT A;  2QA4 A;  1XPU A;  4DV1 L;  4A3K H;  4IPD A;  3U4Z A;  1HNW Q;  3I7F A;  1UE5 A;  1X3E A;  3A5U A;  5H1S E;  1VQC A;  5C3E H;  4A3G H;  1Z47 A;  4MZ9 A;  1QZG A;  3CXC A;  4QL5 A;  4AQY Q;  2R7D A;  2WB1 G;  3S1N H;  2UXB L;  4DV2 Q;  3E9H A;  1K83 H;  5JJK A;  4GS3 A;  4R4T A;  2UXC L;  1KQS A;  1VQA A;  3NEN A;  2Q2I A;  4IFD I;  4DPG A;  3OYY A;  3KJO A;  1PH5 A;  3ICE A;  4DR6 L;  1L1O A;  1L2F A;  5FJ8 H;  1U5K A;  1NMF A;  1WYD A;  4GKK Q;  3RNU A;  4X66 Q;  1YHB A;  1GKH A;  1PH3 A;  1IBK Q;  1HR0 W;  4OWW B;  3I4N G;  5LMN W;  3OTO L;  3HOX H;  4QGU A;  3UDI A;  2FXQ A;  3ER0 A;  3RLN A;  1TWG H;  1A62 A;  4ME3 A;  3RLF A;  3UDX A;  4BBS G;  4R4I A;  4JG2 A;  1NBW A;  4DR2 L;  1KRS A;  4PZ6 A;  2VW9 A;  2JA5 H;  4A3C G;  3VDY A;  2JA7 G;  4JI5 L;  2LXJ A;  2ASB A;  4HJ5 A;  4NXM Q;  1EUJ A;  4YWL A;  4MTN A;  4JBJ A;  2PI2 E;  1N8R C;  1XNQ Q;  4LFB L;  2K4K A;  4DV3 Q;  2F52 A;  2JA6 G;  3ULL A;  1M90 C;  2UU9 Q;  4A3D H;  1A8V A;  1I6H H;  4IOA A;  2VNU D;  2CFM A;  4BBR H;  1XNR L;  3EN2 A;  2EXD A;  4QJF A;  4C3J H;  1YI2 A;  5C4X H;  2D0O A;  4X65 L;  4GOP A;  1WCM G;  1YHQ A;  4DR7 Q;  2I5H A;  1Y1W H;  3HOU G;  1XPO A;  3D31 A;  3KDF A;  5C4J H;  1X54 A;  5DLQ E;  1JMC A;  2UUB L;  3CCL A;  2R7Z G;  3E9I A;  3B6Y A;  3TQY A;  5BR8 L;  2ZJP A;  1FJG Q;  1Q12 A;  3L0O A;  1X9N A;  1VQ4 A;  1HNX Q;  1K8A C;  2JEA I;  2KHJ A;  2N3S A;  2CCZ A;  2NVX H;  3PO3 G;  4B3T L;  4OX9 Q;  4WJ4 A;  2NZH A;  1HNW L;  2IHE A;  2PQA A;  3HKZ G;  4P71 A;  2HHH Q;  1N33 L;  5GAD C;  2PNH A;  3Q8D A;  2UUA Q;  4LF6 Q;  4LUZ A;  4UP8 A;  3DM3 A;  5IP7 G;  3CCQ A;  4DV0 L;  2F3I A;  4HIO A;  4X62 Q;  5IE8 A;  4DR4 Q;  1VQF A;  4AQY L;  2L15 A;  2GVA A;  3H0G G;  4DV2 L;  4IO9 A;  1PYB A;  2XTI A;  4JI3 L;  5IY0 A;  3K7U C;  1Y1V G;  4X64 L;  1SRO A;  2MO1 A;  4QY7 A;  4MNO A;  3BZK A;  3S24 A;  4DUZ Q;  1I50 H;  1PV4 A;  1MJE A;  1D7Q A;  4UP7 A;  2BA0 A;  3CCR A;  4GKK L;  1VQD A;  3CP0 A;  2PI2 A;  4X66 L;  4LF7 Q;  3M85 A;  1FVI A;  1XPR A;  1O7I A;  1VQP A;  2OTJ A;  3TS0 A;  3KFU A;  4LF8 Q;  4DNI A;  4OWT B;  3JAM c;  3IRB A;  3PUZ A;  1HZ9 A;  2Q2T A;  3KDF B;  1FGU A;  1KHI A;  4B3M Q;  1TWA H;  4GKJ L;  2JA5 G;  2UXD L;  4BY1 G;  2OTL A;  4C3I H;  4B3R L;  1K3R A;  1XMQ Q;  1ASZ A;  1CUK A;  4JI7 Q;  1XNQ L;  4JI0 Q;  4EQ5 A;  3CCM A;  4DV3 L;  4GNX B;  2YU9 H;  1VQJ A;  2PQA B;  3CPF A;  3NBH B;  4PMW A;  2YTY A;  3L2P A;  4IOC A;  5IWA L;  4B3S Q;  4UY8 C;  2UUC Q;  2F4V L;  3PGZ A;  1WFQ A;  2I5M X;  3J80 i;  5LMU Q;  1M1K C;  2NZO A;  1SR3 A;  5GAH C;  1CKN B;  4FDB A;  5HGQ A;  1G29 1;  3I4N H;  1JJ2 A;  1FJG L;  2QEX A;  3TRE A;  4HJ8 A;  4YY3 Q;  4A3J G;  1BVS A;  2YV5 A;  3CC2 A;  4P74 A;  2N78 A;  1VQN A;  3TRZ A;  1D8L A;  1OTC A;  1J5E Q;  4BBS H;  1YBY A;  1NTG A;  5AJ3 Q;  1HNZ L;  2ZTC A;  2R93 H;  4BY7 G;  1PH7 A;  1VQO A;  3CD6 A;  4A3C H;  5JEA J;  2JA7 H;  1OXV A;  2UUA L;  4LF9 L;  4LF6 L;  4IFD G;  4DR4 L;  1VQB A;  2AWN A;  4JV5 L;  4X62 L;  4POG A;  4A75 A;  3F1Z A;  4DUY Q;  1I5F A;  3AYH B;  2ZTE A;  3PUX A;  2JA6 H;  4DR3 Q;  1YVC A;  4APV A;  1XJV A;  3I4M G;  3FHW A;  2B63 G;  2R92 H;  4J15 A;  3J7A 5;  2E2H H;  4DUZ L;  1T9H A;  1WCM H;  2Z6K C;  3HOU H;  3KF6 A;  2K75 A;  2E5L Q;  3J81 c;  2R7Z H;  3PO3 H;  3S15 H;  4JBW A;  1LM0 A;  2CKZ B;  4GNX C;  3S1M H;  4DR1 L;  1VQL A;  1A0I A;  2Y0S G;  1X3F A;  2MQH A;  4JI4 Q;  1UEB A;  1OXS C;  1SE8 A;  1EWI A;  5IP7 H;  4JI7 L;  2ZM6 L;  3CC7 A;  5M3M G;  2AHO B;  3G4S A;  3H0G H;  3I55 A;  3HOY G;  4JYA Q;  1I3Q H;  4JI0 L;  1SLJ A;  1Y1V H;  1AH9 A;  2LXK A;  4KHZ A;  4A4I A;  1MKH A;  3S14 H;  4B3S L;  4IPH A;  2EIF A;  2N49 A;  1YIT A;  2UUC L;  1RL2 A;  1IXR A;  1KXL A;  3HOZ G;  2K5N A;  3CAM A;  5JJL A;  1N34 L;  3S17 H;  3CPW A;  1Q81 C;  1VQK A;  4AYB G;  1I94 L;  1PH2 A;  1KC8 C;  1AE3 A;  1P16 A;  4DV4 Q;  3STB C;  4P72 A;  1EFW A;  2JE6 I;  4LWC A;  2ZJQ A;  4LNQ A;  3EIV A;  2E2I H;  1G51 A;  1J5E L;  2R93 G;  4LFC Q;  4BY1 H;  4OO1 G;  1WI5 A;  1X3G A;  2R6G A;  1N32 L;  1JT8 A;  4YWK A;  4JI6 L;  4JI8 Q;  1HR0 Q;  1WOC A;  4DUY L;  3L7Z C;  4DR5 L;  3U4V A;  3KF8 B;  1PH9 A;  1IBM L;  1KRT A;  1BBW A;  2KCT A;  4YCW A;  1E1O A;  1E7Z A;  4LF4 Q;  3HOW G;  3J7Z C;  4DV7 Q;  1KD1 C;  2JEB I;  4JV5 Q;  5K36 G;  2C35 B;  2D0P A;  3A5Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...