4QL5A

Crystal structure of translation initiation factor if-1 from streptococcus pneumoniae tigr4
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
b'DVIEVEGKVVDTMPNAMFTVELENGHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor IF-1
molecule tags Translation
source organism Streptococcus pneumoniae
publication title Crystal structure of translation initiation factor IF-1 from Streptococcus pneumoniae TIGR4
rcsb
total genus 13
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ql5A00
2D62A 1GD7A 3RZOH 4J15A 2R92G 1ASYA 1CSPA 4BY7H 1IXRA 1E22A 2CWAA 4O0AA 3G6EA 1N9WA 3JAMc 3TQYA 3F2CA 4K0KL 1XNRQ 1PH3A 1LM0A 4DR1L 1VQ8A 3CCVA 1I3QH 1SFOH 3HOZH 4A3LH 1N36Q 4POGA 4BY1G 1SR3A 3CPWA 1NJIC 3AFPA 4MNOA 1P16A 1GKHA 3A5ZB 3L2PA 2I0QA 1VQ6A 1TXYA 2VQEL 2MFIA 3KJPA 3IRBA 2D0OA 3RN5A 1Z47A 2KHIA 1VQOA 3TREA 1KXLA 5FJ8H 5H1SE 4LF8Q 1JT8A 4LF5L 4A3EG 1X3EA 1X3FA 1L1OB 5JEAG 3CCRA 4A75A 4DR5Q 4X65Q 4DAMA 1JJ2A 4A3DH 4DNIA 5J3BA 2R7FA 2XGTA 1AE3A 5FLMH 1YZ6A 1CKMA 3J80c 2QEXA 1A8VA 2UUCL 3ERSX 3PO3H 4P72A 1PH6A 1RIPA 2H5XA 1N32L 2OQKA 3H3VI 2V1CC 2JJQA 1Q8KA 3KDFA 4OO1G 1B70B 4RG1A 2PNHA 1UWVA 4GKKL 2Q2HA 1C9OA 1VQFA 3OTOL 3PGZA 3GTPH 1WJJA 3I4MG 1A63A 4B3SQ 1WI5A 4GNXB 2AWOA 2E8GA 5IYBG 1K3RA 1VQLA 2Z6KA 3HOXG 3I56A 2VL6A 3E0EA 4DR4L 1K8GA 1SE8A 3KYHC 3HOXH 2VNUD 1IYJB 2K5NA 4AIMA 3CCSA 5JJIA 2QGQA 3GTGH 5LMUQ 1S72A 4GNXA 2EXDA 4WJ4A 1FJGL 2WFWA 1MIUA 2Z6KC 3ULLA 1N32Q 3MXNB 2NZHA 1Y1WG 4YHHL 2LSSA 4LFBQ 2VW9A 5IP9G 2RHSB 1LTLA 5IY0A 3M85A 2UU9L 4QGUA 4LF5Q 2B63G 3RLNA 3HKZE 4BBSG 4UY8C 2JA8G 1EYGA 1HNXL 4DR6L 3L0OA 4JYAQ 4R1JA 2JA5G 4IPDA 1WCMH 5C0XJ 2GVAA 4DV7L 4IPGA 1VCIA 2D0PA 4GN4B 1EUJA 3K7AH 4EQ5A 5C4XH 5FJ8G 4HJAA 4X6AH 1PH5A 3CCMA 1G6PA 2N78A 1O7IA 1TWCH 4QL5A 2UU9Q 4JI0Q 3PV0A 4A3MG 3HKZG 3PF5A 4JI8L 4LFBL 5JEAJ 1HNXQ 2IHEA 3KF6B 2XTIA 1Q1BA 1OXTA 2VS1A 2GVBA 2K5HA 4BBSH 1I6HH 3S1NH 1KAWA 2MO1A 1CKNB 4R4IA 4A3JG 1VQ4A 3CD6A 5BR8Q 3UE0A 1Y1VH 1X54A 2LXJA 2JA5H 4BXXH 1ASZA 1YHAA 2ZJQA 4PMWA 2WB1E 4NXMQ 3GTQH 3HOWH 3K7UC 1PH2A 3PUVA 5LMNL 3RLFA 5GAGC 2EIFA 4OXPA 1EFWA 2IX0A 4DR2L 4OO1I 3A5UA 4HIKA 1QVCA 1R9TH 5M3FH 1XNQL 1HZ9A 3U58A 3M4OH 1KC8C 1QUQB 2ATWA 3PF4A 5C3EH 1EIYB 1BBWA 4DAYB 1WFQA 2CQOA 3J80i 4OWWB 4JV5L 4JBWA 1K0RA 1E1OA 2F4VL 4JOIA 2MQHA 2VQFL 1I94Q 2PI2E 2UUCQ 4AH6A 2YV5A 2VY3A 2Y0SG 4NPSA 1GO3E 4PG3A 4DV4L 1C0AA 1B7YB 4A3MH 4R4TA 4JI8Q 1QZGA 3G48A 1E7ZA 4QJFA 2YU9H 4LF9Q 3PSIA 4LF8L 2E5LQ 3F8TA 1N34L 4LNQA 1WCMG 4DV7Q 2NVTH 2KCTA 4OWXB 1TWHH 3H0GH 1SMXA 1M90C 4JOIC 2IX1A 2ALYB 3H3VH 2AMCB 2RF4A 4GLAC 4YWKA 3T1HQ 4DR6Q 5C0XG 1SLJA 4LUVA 1QZHA 3KFUA 3L7ZC 2CWPA 3F2BA 4UP7A 3CC2A 4IJLA 4LF4Q 4GOPB 1IBLL 3AEVA 4QQBX 4LFCL 4LF6L 4AYBE 3ULJA 1VQCA 2BH8A 3RNUA 1PH7A 4DV4Q 1BBUA 3EN2A 1TWGH 1XMQL 1HR0L 3S24A 2Q2TA 5ELOA 4XTCS 1YI2A 4A3DG 3M7NA 1VQ5A 2R6GA 4X66Q 1Q46A 3D31A 1KL9A 3I4OA 1FJGQ 1HH2P 2UXDL 2K14A 4APVA 4B3ML 2E2HH 2KCMA 4L5RC 3CCQA 4KI0A 1LUZA 2ZTCA 3DLLA 1MJEA 4QIWE 3GTKH 1DGSA 1PH4A 4DKAC 5JJLA 4LW1A 1Y14B 1VQ9A 2ZM6Q 4A3KG 4X62Q 4LFAL 1HNWL 1E3PA 4P73A 4B3TL 3OTOQ 5DLQE 1EOVA 3J7A5 3UDGA 3D0FA 4NB3A 5ELNA 1W2BA 3OYYA 5IT9c 5EAYA 5BR8L 3HOUH 4BA1I 1VQEA 1XTDA 3M9BA 5M5XH 5AJ3Q 2HIVA 2K4KA 4PZ6A 4DV3L 1SN8A 3FHWA 1IZ6A 2NVYH 5C44G 4R4QA 3STBD 1HR0Q 2A8VA 4JC0A 4DV0Q 4JI5Q 3I4NG 1HZAA 1HJPA 4O2DA 2EQSA 1BKBA 3PUWA 3EIVA 3NELA 1EQRA 1TWFH 4NXNL 4A3CG 1SROA 3DM3A 2UXBL 4JYAL 2KENA 4NXNQ 3HOYH 2KBNA 4GOPA 4GNXC 1M1KC 1KD1C 2K75A 5GAEC 4UPAA 4KLKA 2C35B 2AHOB 4LUOA 2PQAB 3W5OA 4A3IH 2HHHL 4DR7Q 4KHPQ 4C3IH 1JJGA 4BA2I 1VQKA 2I5HA 1K73C 4JI6L 1XNRL 4A3BH 5HY6A 2E2JH 3U50C 4DV3Q 2F4VQ 3J81j 1S40A 3CQZH 1X6OA 1UEBA 4BY1H 1OXUA 3GTLH 1AH9A 3KF8B 5LMUL 4KHPL 3RLOA 4DR3L 1XNQQ 4IOCA 3T1YL 3CCEA 2CFMA 3W1GA 4A3JH 1VQAA 3BU2A 4A3FG 4OX9Q 1VQGA 5GQOA 1NBWA 4DV1L 1C7YA 2JA7H 1X56A 2PMZE 2IY5B 5K36G 4A93G 5M3MH 5IYDG 5HGQA 2CKZB 4L5SA 3I4MH 4IFDI 3E9HA 1PFSA 4BXXG 4H02A 4DUZL 4JBJA 4A3CH 4DR3Q 3LGJA 2NN6G 2F3IA 2GN5A 4A3GG 4WJ3M 3Q8DA 1Z9FA 1OTCA 2IT1A 2Q2UA 3A0JA 4MZ9A 4X66L 2UUBQ 1G51A 4JI2Q 3KLWA 3VDYA 4JI6Q 1D7QA 3M4PA 3M4QA 1JB7A 3AQQA 1Q7YC 3JAMi 2BA0A 3NEMA 3S15H 3ER0A 4YCUA 4DV6L 4LF6Q 4LFCQ 1GM5A 1EWIA 2JE6I 5C0XI 2HHHQ 3GDEA 1EIFA 4JI0L 1YEZA 2OCEA 3J7ZC 3PIOA 3TS0A 3S1QH 1IL2A 2I5MX 5IP9H 4JI4L 2WAQG 1X55A 1G291 4GN5A 3TRZA 3CF5A 4XIGS 3A74A 3CC4A 4C2MH 3CPFA 4JI4Q 1PH8A 2F52A 2E5LL 2KHJA 3I2ZA 3UE1A 3BZCA 1KHIA 1L2FA 1VQPA 1Y1WH 4Y7NH 1N8RC 4IJHA 2JK8A 1JMCA 4Y52H 2RCNA 1L0WA 3PCOB 4JI2L 4C3JH 3BJUA 2VQFQ 2AKWB 4JI1L 4HIOA 2UUBL 4A4IA 1H95A 1V9PA 5AJ3L 4KHZA 1PH9A 1AE2A 1PV4A 4JV5Q 3H15A 2ZJRA 1J6QA 1VS0A 4A76A 4HJ9A 4DUZQ 4DV2Q 5M3FG 5FLXc 1U0LA 2OQ0A 4DR2Q 1VQNA 4A3KH 1JJCB 4LFAQ 4X62L 3JC66 2OTLA 4B3SL 1GVPA 4PZ8A 4DV5Q 4JI3Q 3G4SA 3I55A 1YITA 4OX9L 2B3GA 2YYZA 5M5WH 1Q82C 1W3SA 1VQDA 1QVGA 4P71A 1K9MC 4JBMA 1CUKA 1XPUA 2PI2A 2NVQH 1Q12A 4GKKQ 2E2IH 3U4VA 2UXDQ 1Q1EA 3G71A 4GOPC 3UDXA 4A3IG 3AFQA 1XPOA 4JI1Q 3CC7A 3K0XA 1PA6A 5FLMG 3CAMA 3ZJYC 1NTGA 4QY7A 3CW2C 4X65L 1YIJA 2MNAA 1K83H 3K80C 1PVOA 2IHFA 2ZTEA 4GS3A 4GN3B 1T9HA 2JA9A 4HIMA 3KJOA 1YBYA 4BBRG 3I4NH 2Q2IA 3STBC 3S16H 4DK6C 5E7NA 1KQSA 2YTYA 1QUQA 2ASBA 5IYCH 5GADC 4A3BG 1NE3A 1Q86C 2DUDA 3I7FA 4RMFA 1PH1A 3BZKA 4YY3L 5IWAL 3MEFA 4DPGA 3RR5A 1V43A 4ALPA 4IFDJ 1RL2A 2R93H 4HIDA 4BBRH 1PHJA 1NMFA 1SRUA 1YNXA 3J81c 4AQYL 1X9NA 2PQAA 5IP7H 1PYSB 2YTXA 2Z0SA 4B3TQ 3HOVG 1XMOQ 4YCVA 4OWTB 4IOAA 1K8AC 4LUZA 1IBKL 4YWLA 3HKSA 2HQLA 3CXCA 3U4ZA 2R92H 3T1YQ 3E9IA 2HT1A 3K8AA 4AYBG 4HJ5A 1HZCA 3GD7A 3GO5A 4AQYQ 3PUYA 4A93H 2ES2A 4B3MQ 2JA8H 3KDFB 4R4CA 2JA7G 1A62A 1WOCA 1YVCA 3GTJH 2JEAI 1YHBA 2AWNA 3CMEA 4A3EH 3KF6A 5IWAQ 5C4XG 1HZBA 3HOUG 4YY3Q 1XPRA 2BA1A 1XMQQ 2UUAL 3PO3G 1N33Q 2K52A 2L15A 4DR5L 5C44H 4DR7L 2YTVA 1L1OA 1E24A 4P75A 2B63H 3B6YA 4JBKA 2JA6H 3S17H 4GLVB 2HIXA 1TWAH 4P74A 1B8AA 4JG2A 4GKJQ 4TQUS 4IPCA 3T1HL 5GROA 1VQ7A 2UXBQ 3W1BA 3RZDH 1U5KA 2WB1G 4B3RQ 4MTNA 2VQEQ 4POFA 2ZJPA 4DUYQ 5IYBH 1N34Q 4R4OA 1S3OA 1CKOA 4JCVE 4PZ7A 1X65A 3RN2A 1YJ9A 1YJWA 2A1AA 3HOYG 3PO2H 3SGIA 2VUMG 1VQIA 2B29A 2N3SA 4JI5L 4DV0L 1UE5A 2N49A 4DR1Q 1VQBA 2UUAQ 1XJVA 2OWOA 1I94L 4K0KQ 4ME3A 1MKHA 2UXCQ 3AYHB 3K81C 1KIXA 3ICEA 2RHQB 2A19A 4IFDG 1E1TA 3F1ZA 4LF7Q 1UE1A 3S14H 4DK3C 1FGUA 1NY4A 1I50H 4OONA 1IBML 1P8LA 4DV5L 3S1RH 1HNWQ 1CKNA 4JI7Q 2ZM6L 3PUZA 2ID0A 2MO0A 5LMNQ 1YHQA 2LXKA 4X64Q 4NXML 3TS2A 4DV2L 1JE5A 1V1QA 1HNZL 4LF7L 3FKIG 1FVIA 1EQQA 4HJ8A 4HJ7A 3ULPA 1UE6A 2UXCL 2K50A 1J5EL 2BH2A 3WWVA 2R7DA 4GLXA 2JEBI 3CCLA 4L5TA 3PIPA 3CCUA 2NVXH 1FL0A 3NENA 3UDIA 2I5LX 4IO9A 2VUMH 1UE7A 4C3HH 1YJNA 3PO2G 5M3MG 1IBLQ 5IYDH 4TVAB 4LWCA 5M5YH 3CMAA 3NBHB 1Q81C 4LF4L 1LYLA 3EBEA 2OTJA 5IYCG 4EX5A 1OXXK 4FDBA 4YWMA 1X3GA 4DUYL 3HOZG 3M3YH 4A3LG 3HOWG 2N8NA 3TEHB 5C4JH 1I5FA 2Y0SE 4B3RL 5JJKA 2QA4A 4GKJL 3CP0A 3S2HH 3J81i 2JA6G 1D8LA 2ZTDA 2CCZA 4BY7G 2NZOA 4LF9L 3S1MH 2R7ZH 4DV6Q 3H0GG 1N36L 2K5VA 4YHHQ 1PYBA 1A0IA 1VQHA 1N33L 3OW2A 3FKIH 1Y1VG 1KRTA 3GTMH 3FP9A 2VZAA 3F2DA 4L5QA 1NMGA 3UDFA 1J5EQ 3S2DH 1WYDA 4A3GH 4UP9A 4YCWA 1BVSA 4IPHA 5IE8A 2WAQE 2JQOA 2FXQA 1HR0W 1HNZQ 5LMNW 1KRSA 3HFZB 1L1OC 5GAHC 3PUXA 3CCJA 4DR4Q 2R93G 4X64L 2NN6I 2WP8J 1VQMA 3GTOH 2R7ZG 4UP8A 1OXVA 4JI3L 4JI7L 1IBKQ 3KOJA 4A3FH 5C3EG 1CSQA 4DV1Q 1XMOL 5IP7G 1QVFA 3HOVH 1IBMQ 1OXSC 1VQJA 2DGYA 1MJCA
chains in the Genus database with same CATH superfamily
4FF4A 4J15A 5C6AA 1E22A 4CHTB 3H91A 4K0KL 4ILWA 2XNAC 3CCVA 3TMEA 3UI2A 5M3FB 1SFOH 3HOZH 4A3LH 1N36Q 4BY1G 1PTOB 1P16A 4K14A 1I4GA 4HMIA 5EQ0A 4JVZA 4ZK9B 1DM0B 1Z47A 3N52A 1CM9A 4QUCA 1JT8A 4LF5L 1EZ8A 1X3EA 4A75A 1SJHD 4X65Q 1JJ2A 3NWTA 4DNIA 1CKMA 1A8VA 2UUCL 3ERSX 1RIPA 2H5XA 3H3VI 4A3GB 1ZYRD 2J4XA 2A6HD 4OO1G 1B70B 4RG1A 2L5TA 2PNHA 2SOBA 3OOCA 2MHVA 1S5ED 4RAUC 4L6TB 5BN4A 3OTOL 1WJJA 1D2BA 2AWOA 2EOTA 1VQLA 2Z6KA 3HOXG 5A35A 3E0EA 1Z7TA 1K8GA 1U4RA 3KLSX 4ZYSA 2K5NA 1MBYA 1CT1D 1MIUA 4XT3B 5M5YB 5EJWA 2F03A 1EY7A 1SE2A 2LSSA 2CW0D 2E2HB 3BYYB 4RWSC 2XVSA 1TY2A 2HCCA 2JA5G 1WCMH 2GVAA 4EQ5A 1VCIA 5C4XH 4B9WA 1HA6A 4HJAA 2O5JC 1O7IA 1K28A 1TWCH 3CU7A 3PF5A 2RDGA 4PV1C 1WTVA 2XTIA 2EJGC 2MGSA 1OXTA 3J7AV 2K5HA 5CV4A 5BN3A 1ONLA 1LT5D 3S1NH 2MO1A 5IT9E 1VQ4A 2YU9B 1HHVA 2A6EC 4WRDA 2SNMA 2JA5H 2F0WA 2F3VA 3FPPA 4IN3A 4BXXH 4ABNA 3PUVA 5LMNL 3BVGA 3SK5A 2EIFA 2QDLA 4IUUA 1EFWA 1DYQA 2IX0A 4DR2L 3HOZB 3RZDB 1PFBA 1I4PA 3HP3A 3M4OH 3PF4A 1EIYB 1WFQA 2F4VL 1E1OA 1I94Q 5T1GA 4AH6A 2VY3A 3FPUB 4NPSA 1GO3E 4PG3A 4DK1A 4A3MH 1QZGA 1Y1VB 1E7ZA 4QJFA 3VYSA 4LF8L 1N34L 2DJFC 2EYOA 2SEBD 1M90C 4GZYC 3H3VC 2AMCB 2RF4A 4GLAC 4LUVA 2RQXA 2G9HD 3KFUA 1ZKOA 1SNDA 2CWPA 1VMCA 3DWQA 4UP7A 3Q23A 4LFCL 1VQCA 4DXFA 3RNUA 4DV4Q 1BBUA 1BF4A 2Q2TA 3QOJA 2A69D 4X66Q 2JA7B 1PRTB 3A8IE 3D31A 4QMGA 1FJGQ 2KCMA 1O80A 4KI0A 1DD2A 2EDGA 3A55A 1PH4A 2Z4HA 4DKAC 5JJLA 4LW1A 1VQ9A 4BY1B 1A3UA 1O7YA 4X62Q 2LMCB 1GUGA 4ZLTF 2WKDA 1EOVA 3OYYA 4FXDA 1KDBA 2R3ZA 5BR8L 1XTDA 1O7ZA 4F88A 2HIVA 2JYOA 1IZ6A 2XN9C 2DY8A 4O2DA 1WTQA 1JOKA 3PMFA 4O1NA 3NELA 1TWFH 4FXGC 3T53B 1VF7A 5FO8B 4GOPA 4GNXC 2K75A 3AMUA 5EBDA 2Q8TA 3MWYW 2F0JA 4KHPQ 4ZUJA 4OHJA 4BA2I 3E5SA 1CZWA 2I5HA 4OGQC 3J81j 1X6OA 5KGUA 1U4MA 3GTLH 1AH9A 3KF8B 5IGEA 3RLOA 4DR3L 1XNQQ 4IOCA 5C3XA 3G7LA 4A3FG 3BU2A 3SDZA 4OX9Q 4DV1L 1PDQA 1XXGA 2PMZE 4A93G 5M3MH 4L5SA 3I4MH 4DUZL 4A3CH 1DONA 5CV7A 3Q8DA 1SNOA 5IGBA 3MC0B 3Q0AA 3NWSA 3AQQA 1Q7YC 3GV6A 3ER0A 4DV6L 4LFCQ 3AB9A 5C0XI 2P5ZX 4JI0L 3S1QH 3PIOA 5IP9H 2Q8IB 3FMCA 1G291 3A8KE 4IALA 3CC4A 2F0NA 5E3FA 2TMPA 3BZCA 4RH6A 4Y7NH 4IJHA 2EXZA 2H1EA 2XWJB 1H95A 3GTLB 4HIOA 2UUBL 2B2YA 5AJ3L 5ELBA 4JV5Q 3GTQB 5JAVA 1LABA 2ZJRA 3S16B 1J6QA 3TP5A 1FD7D 4A76A 1AW7A 5M3FG 4HAEA 1U0LA 3NXWA 1VQNA 1CA6A 4A3KH 1I6HB 2J0TD 1G8ZD 4LFAQ 4JPBW 4RGOS 4JI3Q 1GVPA 3ND9A 4ME5A 4PZ8A 4DV5Q 3I55A 1QVGA 1XPUA 4FO2A 3TZDA 3NBIA 2L55A 3OIPA 3A8JE 1I6VC 3AFQA 3H09A 1IYUA 2PQEA 4R8NA 3VR3A 3T4AC 3NP8A 5A2QL 1YIJA 2HUGA 3R2IA 3K80C 5CC4A 2DY7A 5J39A 4E6IA 1H9JA 1TS2A 4GS3A 4I7AA 5EBCA 1DZ1A 1ESFA 2Z6BA 5E7NA 4F8MA 2HDLA 2RKSA 2ASBA 3IFDA 4DAYA 3GTGB 1F2YA 4RMFA 1PH1A 4YY3L 1SMYD 1LTRD 5KRUA 4DPGA 2Z4IA 2R93H 5KEEA 5C5MA 4QUFA 5C44B 1SRUA 2ICIA 4AQYL 2PQAA 3HOVG 2Z0SA 1BCPD 4YCVA 4DF7A 1YNJD 4A3EB 4YWLA 4NDXA 3U4ZA 1NAPA 5IGFA 3E9IA 4HSVA 3T1YQ 2HT1A 1HZCA 3GD7A 1WTOA 4B3MQ 3FDTA 1TS3A 2A6HC 2JA7G 2JEAI 5JEAH 3CMEA 5JVG3 4A3EH 5C4XG 4YY3Q 1XPRA 4LMQD 2BA1A 1W6JA 4A3MB 2UUAL 4DR5L 2YTVA 3CRLC 3S17H 4GLVB 3MEHA 1EL0A 1B8AA 5GROA 1I3QB 2RSNA 1S5CD 2A73B 1FNUA 4POFA 5CORA 3NHHA 4L8JA 5IYBH 3R93A 3CQZB 2XRQD 4JCVE 1YJ9A 3BVZA 2EYHA 3SGIA 2B29A 2F0LA 3EJIA 1XJVA 4ME3A 2PO4A 3S1NB 1HUMA 1MKHA 4UHVA 4BBSB 1L0YB 2NUCA 2A6ED 2RHQB 1MSGA 1UE1A 2KJXA 1NY4A 1I50H 3R2TA 2ID0A 3JAME 5TSSA 2FMMA 4FVMA 4B9XA 4LF7L 2AQ3B 1FVIA 5M5WB 4HJ8A 4N9PA 3MXGA 1J5EL 3HG9A 2BH2A 3S2HB 2MUYA 2NVXH 3Q6SA 3UDIA 2I5LX 1BNZA 3EQLC 1IBLQ 5IYDH 5M5YH 2OTJA 5IYCG 4EX5A 4FDBA 3K5MA 1X3GA 2PPBC 1B9MA 1O78A 2QA4A 2DN8A 3CP0A 4I65A 3J81i 4LK1C 4IUVA 1LT3D 1SYEA 1RDPD 3TN2A 1LTGD 1LTID 2EY5A 1RTNA 3FP9A 3G6JB 2VZAA 1NMGA 2NWGA 1PFMA 4A3GH 4UP9A 1CI3M 1CQFA 4CDDC 1SYBA 5CBAE 4IPHA 2FXQA 2MJ8A 1HNZQ 5LMNW 3CCJA 2NVTB 5E1FA 2K04A 4CKCA 1IBKQ 4DV1Q 1OXSC 2EYLA 3BS1A 5G3LF 3J7AF 1ASYA 1CSPA 2L1BA 4BY7H 1IXRA 2CWAA 1N9WA 3JAMc 4RHRA 1XNRQ 4F87A 2WKCA 1SFOB 1VQ8A 1F9RA 4H13C 1I3QH 4WORA 4POGA 3S17B 1EZ6A 2FINB 1NJIC 1GKHA 3A5ZB 4ZRZA 3L2PA 2I0QA 1VQ6A 1TXYA 2VQEL 1CQVA 2MFIA 3M7GA 3KJPA 4OO1H 4KJNA 1QNUA 1SJED 2KHIA 1ENCA 2TSSA 4A3FB 5CV5A 1II3A 4A3EG 4DGZA 4A3DH 4A93B 1QWYA 4DAMA 2EYMA 5FLMH 2QEXA 3J80c 3PO3H 3E3XA 2OQKA 4OELB 5D65A 2KHSA 1C9OA 1VQFA 4RGNA 3I4MG 1A2UA 2IW3A 2E8GA 1K3RA 5I4DA 3H6MA 3I56A 2MP1A 4UDUC 4DR4L 4DNRB 1SE8A 3F2UA 3KYHC 2VNUD 1IYJB 5I9OA 3M3YB 3GTGH 3LWEA 4KY7A 4GNXA 4WJ4A 1FJGL 2WFWA 2O5IC 4DNTB 3CRKC 2IJ0A 1N32Q 5EKKA 4YHHL 5IP9G 1LTLA 3I70A 3BDCA 2D9UA 1E2WA 3RLNA 1QCBD 2ICEC 3EROA 4K6LA 2JA8G 1EYGA 1HNXL 3GTPB 3KLSA 4DK0A 3HS0C 4R1JA 4IPDA 4Q0FA 1HNXQ 4GN4B 2D0PA 1EUJA 3K7AH 4ZUIA 1PXUA 5IIFA 5EKLA 2UU9Q 2GA4B 1RHPA 4A3MG 1K3BC 1PZID 5JEAJ 2NVQB 2EZVA 1QOHA 1I6HH 2K28A 3MAQA 1X54A 1ASZA 1YHAA 1XX8A 2WB1E 1X3PA 3K7UC 3V96A 4OO1I 1JOQA 3M4OB 1ET9A 2ATWA 5C3EH 5F2DA 1BBWA 4DAYB 1Q8IA 4JBWA 1S4ZA 4KJOA 1K0RA 4JOIA 3D6CA 2UUCQ 1BOSA 3WOEA 2M2LA 1C0AA 1G2TA 1B7YB 2KA7A 3G48A 2YU9H 4LF9Q 1RF2D 4U673 3GTJB 3TDQA 1RKNA 1TWHH 3H0GH 3NUCA 3H3VH 2ALYB 2EJFC 3T1HQ 5C0XG 1LT4D 1QZHA 1STEA 5KNCA 3CC2A 3DM1A 2B2UA 1F9PA 4KD4A 4ZQ3A 3DHQA 2BH8A 1J9OA 1HR0L 1LTAD 3DUZA 1XMQL 1SMYC 4XTCS 3M7NA 2R6GA 4MHEA 2LS01 2K14A 4APVA 4L5RC 2E2HH 1HFNA 4WJWA 4QIWE 2A68C 1DGSA 1Y14B 2LFNA 4LFAL 1DOMA 4A3BB 3OWEB 4B3TL 3OTOQ 1WD1A 1JQYD 3D0FA 3K5LA 1LTBD 4BA1I 4FP5D 5AJ3Q 4DXGA 1K83B 4PZ6A 2NVYH 3HOYB 4R4QA 1EY0A 2A8VA 4EVOA 2PZWA 1HZAA 4ODGA 1A3TA 1HJPA 1FNVA 4RKLA 4QCLA 3R3OA 1A6XA 1STYA 1EQRA 1E2ZA 2NTTA 3OW7A 1QG7A 4XQNA 1SROA 2R92B 3DM3A 2PZTA 1B9NA 1KD1C 1GUWA 5GAEC 4KLKA 2C35B 2HHHL 2PQAB 2EYFA 4A3IH 1JJGA 3BG3A 5CV6A 1VQKA 1X3QA 1E0BA 2F4IA 1YNNC 4JI6L 5HY6A 2E2JH 5KNBA 1S40A 3CQZH 3OWFA 1OXUA 4KHVA 3SK4A 3DXJC 1UAPA 4J1MA 1TU2B 2B39A 2ZXRA 2WB1B 1EIGA 4K8JA 3T13A 2B2YC 1C7YA 4DU9A 2IY5B 5K36G 1X56A 1S5DD 4X3TA 5IYDG 2CKZB 4IFDI 5FK9C 4BXXG 3OHXC 3RUZA 2HD3A 3GP7A 1EYAA 4OEMB 2NN6G 2F3IA 4J8QA 4NMZA 2I07B 3A0JA 1RJTA 4QF4A 4JI6Q 1OO9B 3GTOB 3M4QA 1ZXTA 1JB7A 3JAMi 2BA0A 4YCUA 3R8BA 4CBVA 4KHPL 3TBIB 1EIFA 2OCEA 3TS0A 2I5MX 4JI4L 2EY2A 3HZXA 4WFN3 1ESRA 2RA4A 1D5XC 2RDHA 2E5LL 1B2TA 2EJMA 2KHJA 3BDLA 1KHIA 2K5DA 5D14A 1S5FD 4Q5VA 1JMCA 4Y52H 5C4JB 3BJUA 2VQFQ 2AKWB 4OIKA 4KHZA 1GUNA 1PV4A 3SK6A 1VS0A 2KEEA 1AZQA 5C4HA 4HJ9A 4DV2Q 5FLXc 1PTOF 5IOCA 4DR2Q 3QG1A 1SNMA 2Z1CA 4C1NI 3HKZB 3Q24A 1C48A 2B3GA 4IUPA 1IW7D 1W3SA 1VQDA 2LKVA 4P71A 2E2IH 1ILPA 3M4YA 3G71A 4A3IG 4JI1Q 5FLMG 3CAMA 5DM73 1EFID 1H9KA 1SYCA 1EWHA 4X65L 1KABA 1BCPB 4FF1A 1PVOA 2IHFA 3AU7A 2X6GA 3TP7A 4GN3B 1SE4A 3KBXA 1NR4A 3QR8A 4HIMA 3KJOA 1YBYA 4BBRG 2NBFA 1Q3LA 2YTYA 5CV8A 4LAAA 3QB3A 4KMUC 3NTHA 1NE3A 3GTKB 5JOBA 4K5WA 3MEFA 4IFDJ 4BBRH 1PHJA 1M4VA 2F0OA 1YNXA 2CH4W 3NPPA 4G57A 1XMOQ 5I6YA 1K8AC 2VB3X 1IBKL 3HKSA 2J7ZA 4AYBG 2JA8B 1PYWD 2JA8H 2K01A 3KDFB 5KYIA 1A62A 1HPCA 2AWNA 5IWAQ 2WIIB 5EPJA 2XIWA 1E24A 5KNDA 4JBKA 4N9TA 2XWBB 1TWAH 5ELDA 5CGKA 4IPCA 1VQ7A 2UXBQ 3VR4A 4G7ZC 3W1BA 1GOZA 2EYJA 4XQJA 1KNAA 2FMCA 4M8AA 4R4OA 3MZ5A 1CKOA 4HN7A 3HOYG 4C1NK 4CJ1B 1YJWA 2VXWA 1VQIA 2N3SA 4JI5L 5JVH3 4DV0L 3I4NB 1VQBA 2V4DA 1LLRD 2OWOA 2F0UA 4KKUA 4H7BA 3W3AA 3AYHB 1HRJA 1KIXA 2MPMA 3I4LA 4EQOA 3ICEA 3TP8A 1E1TA 1CHPD 4LF7Q 1HQRD 4DK3C 1IBML 1P8LA 1HNWQ 1CKNA 4JI7Q 3KUPA 3VYUA 3GTMB 2F0VA 1VMPA 3TS2A 2PNRC 2HQEA 3NQTA 3S1MB 1EQQA 2XSCA 1UE6A 1JOOA 2UXCL 3KK7A 3WWVA 1U9RA 2R7DA 4GLXA 1KDCA 3CCLA 4XYQA 4OL7A 1UE7A 4C3HH 3L3OC 2R61A 4TVAB 1FR3A 2XRSD 3CMAA 3NBHB 1Q81C 4LF4L 1LYLA 1EWCA 3EBEA 3T51B 1OXXK 4YWMA 3M3YH 2BDNA 4B3RL 4KN7C 5DNFA 3HEJA 3ITPA 2JA6G 4V0BA 2B2UC 2HDMA 2K5VA 4YHHQ 1T5EA 1D5ZC 3GTMH 3P1HA 2FHTA 4L5QA 1STAA 1J5EQ 1WYDA 3OMCA 3S1RB 2WAQE 2JQOA 5D3DA 1FYCA 3S14B 2IX3A 1KRSA 3S15B 4B08A 3HFZB 5GAHC 3OSOA 3O13A 1VQMA 2R7ZG 4UP8A 4CJ0B 3KOJA 5C4ZA 5C3EG 1XMOL 5IP7G 1IBMQ 2DGYA 5DM63 3RZOH 2OXPA 2R92G 2F0TA 4O0AA 3NTKA 5LL6S 3F2CA 1YNJC 2LY7A 1PH3A 4DR1L 1AN8A 1WTXA 1TWAB 1EEID 1SR3A 3CPWA 3AFPA 3KLRA 4MNOA 3K57A 2QW7A 4K6DA 3VR6A 2D0OA 3RN5A 4XYOA 3HOVB 5E4XA 4A3IB 3TREA 5FJ8H 4LF8Q 4DA2A 4DR5Q 2NB0A 5J3BA 2R7FA 2PCFB 1YNND 2XGTA 2NZ1D 1YZ6A 1WTWA 1O7LA 2B2WC 4PNYA 1PH6A 1SNQA 1N32L 2V1CC 1D1KA 1C4QA 1Q8KA 2F0SA 3KDFA 5C4XB 4IUQA 4N8X1 4BBRB 4EQPA 4KKTA 3D6WA 1I4XA 3V2TA 1WI5A 4GNXB 3MXUA 2OEOA 1MSHA 5I9PA 3HOXH 4XT1B 3CCSA 1F2ZA 2QGQA 5LMUQ 4TSSA 1S72A 1A2TA 3ULLA 2C5CA 2KUMA 1STHA 1ICWA 2NZHA 4LFBQ 1TVXA 2UU9L 4LF5Q 1BDOA 1I4HA 2Q8RE 4RGTA 2B63G 5KYLA 4BBSG 3HKZE 4UY8C 3BZDB 4JYAQ 2M00A 2B8FA 5JPNC 3H94A 5LL6X 4DV7L 1LO5D 1PH2A 4IPGA 1A63A 5FJ8G 4X6AH 3HRZC 1PH5A 5E4WC 3EA6A 4JI0Q 3PV0A 1IKMA 3HKZG 5HGTA 4JI8L 4FNFA 1Q1BA 1HTLD 3KF8A 1AFPA 2GVBA 3SXHA 2K03A 4BBSH 3X3NA 3D4DA 4R4IA 4IURA 3CD6A 3UE0A 2LXJA 1GXDC 2ZJQA 4PMWA 3HOWH 3VR2A 1WTHA 4G7HC 2B8GA 1Q90A 2G5DA 5CR3A 4HIKA 3FEWX 1NNXA 1XNQL 5M3FH 1HZ9A 3U58A 1R9TB 1LACA 1BBXC 2CQOA 3J80i 4OWWB 2JA6B 2MQHA 4C2MB 4CGYB 4DV4L 1CA5A 4JI8Q 4QB4A 1F9QA 1H9RA 2NTSA 3PSIA 4HR7B 4N8FA 3F8TA 3VA7A 4LNQA 1WCMG 1SAPA 1EU3A 2KCTA 4OWXB 1ZEQX 1SLJA 4RCOA 3L7ZC 4LF4Q 3F2BA 3S2DB 2QEJC 4GOPB 1IBLL 3IAYA 3I72A 3ULJA 1PH7A 2F0FA 2A74C 3EN2A 1I4QA 1TWGH 3E0JA 5EKIA 1LT6D 5KIXA 3I4OA 3J81E 2HCIA 2UXDL 3CCQA 1J8IA 3WOFA 1MJEA 4M1UB 1QB5D 2E2JB 1HNWL 1E3PA 4FYDA 2PW5A 5DLQE 2NYZD 3UDGA 5ELNA 1W2BA 5IT9c 5EAYA 3OPOA 3M9BA 5M5XH 5EPLA 2K5QA 1SN8A 5EPKA 4DV3L 3FHWA 2KCCA 4PMCA 3STBD 1HR0Q 1D5MC 4JC0A 4DV0Q 4JI5Q 3I91A 3I4NG 4TKOB 5C5LA 1BKBA 3PUWA 5C0XH 4C56C 2JP1A 2NN6H 4NXNL 2K1BA 4JYAL 1HTPA 1CK1A 2K7VA 2FJ2A 2NVYB 4NXNQ 3HOYH 3RMHA 4X3KA 1BCPF 1EY5A 4XDXA 1H9SA 3HOUB 4LUOA 4DR7Q 3J7YW 2KQ3A 4C3IH 4BS9A 3RD4A 1NSNS 4PMBA 1PRTD 1XNRL 4A3BH 1JWSD 2F4VQ 1UEBA 2RVLA 3U9OA 1PZKD 1GJXA 3I8ZA 1CFMA 2I46A 3DWAA 1GHJA 3CCEA 2CFMA 3W1GA 4A3JH 1VQAA 5GQOA 1NBWA 2F0EA 2B2VA 2B63B 1SDFA 1PFSA 4H02A 1K0SA 1FNWA 4QIWB 1Z9FA 1SBBB 2IT1A 3S1QB 1SYDA 4MZ9A 1A15A 1G51A 2FFKB 1D7QA 1HA5A 1TWHB 3H0GB 1JWUD 3I73A 2HHHQ 1YEZA 3J7ZC 2EPBA 2DJGC 2BE5C 3TRZA 3VYTA 3CF5A 4XIGS 3A74A 2VB2X 3CPFA 4JI4Q 2IPKD 2R7ZB 2EY1A 3I2ZA 3UE1A 5C3EB 3C1FA 1L2FA 3NQIA 4RCNA 3PQIA 1N8RC 2JK8A 2RCNA 1L0WA 1PRTC 4C3JH 4JI1L 3P75A 2QKIC 5IGDA 4RHSA 1AE2A 2EYPA 2X6LA 3H15A 4FF2A 3EFXD 2L11A 3CHBD 3NSWA 4R9WA 3JC66 1JR0D 2OTLA 1ILQA 1YITA 5M5WH 4CDFC 3QWNA 4GKKQ 3NBHA 4JK1C 4JBMA 2NVQH 2PI2A 1G6ZA 1Q12A 3BYTB 3U4VA 4EGVA 4GOPC 5FLXL 1XPOA 5LHY1 4RA8A 3CC7A 1PA6A 3ND8A 4KY6A 4NW2A 3C2PA 1NTGA 5G3LD 1B3AA 2MNAA 1F9SA 3JAML 5M5XB 1T5XD 1ZYRC 3DEOA 2JA9A 3MA2B 2JXMB 4DK6C 2B2WA 1PMRA 1QUQA 5GADC 1NCVA 2KVMA 3IL8A 4A3BG 2L0CA 3I7FA 4H44C 1JORA 5ISRA 5IWAL 1V43A 3MTSA 1KDAA 1Z6HA 4HIDA 2AQ2B 1NMFA 3TZUA 3J81c 1X9NA 4R8IA 1CZGA 1PYSB 2YTXA 4B3TQ 5IT9L 5JPMC 4IOAA 2CQAA 1STGA 2HQLA 3NK9A 2AQ1B 3OIQA 4IUTA 3K8AA 4HJ5A 4AQYQ 2SNSA 4TRDA 3PUYA 4A93H 4A3DB 2ES2A 1YVCA 1EEFD 2L12A 3HOUG 1RD9D 3PO3G 1JICA 2K52A 2ZT9C 1G2SA 5C44H 1F77A 3ERQA 2JA6H 2HIXA 4JG2A 4YIJA 4GKJQ 4X3SA 1K8OA 1R4PB 4DAPA 3RZDH 2WB1G 4MTNA 4X3UA 2VQEQ 4DUYQ 1N34Q 4BWGB 1C8CA 1S3OA 3RN2A 2A1AA 4LJZC 4CDEC 3K6OA 3OMGA 2VUMG 5CBEE 1UE5A 2N49A 2F0GA 1I94L 1EIHA 1B50A 4K5XA 3F1ZA 1I4RA 1IKLA 2ZXPA 2X69A 1QJOA 2Y0SB 4DV5L 4V190 5J1ZA 2PMZB 5LMNQ 1YHQA 1WCMB 4NXML 1HNZL 4CKEA 4HJ7A 3ULPA 3TSSA 5AFWA 3W2DA 2K50A 4IZ8A 1EQVA 4RKBA 3PIPA 3D4WA 3NENA 4P2CB 4IO9A 1YJNA 3PO2G 1IHZA 4L63B 3T56B 4LWCA 4MIUA 4DUYL 1JWMD 1R4QB 3BVMA 3HOZG 2CW0C 4A3LG 2N8NA 1I5FA 2Y0SE 1EY9A 2NVXB 1B4OA 4GKJL 3S2HH 3FRPB 2ZTDA 4BY7G 4LF9L 2R7ZH 2Z9HA 2D2CC 4DV6Q 3H0GG 3S9WA 1PYBA 1A0IA 1N33L 3SK8A 2DNCA 1KRTA 1VDZA 3F2DA 1RCVD 1HQMC 4CDCC 2WAQB 4YCWA 1I50B 5IE8A 2F0HA 3A54A 2L9HA 1EY8A 1BO0A 5ELFA 1TR5A 2R93G 2WP8J 1M8AA 4FF3A 4JI3L 2B2TC 1BR9A 3X3MA 5DEHA 1QVFA 3HOVH 3ZYYX 1VQJA 3K81C 1MJCA 2D62A 1GD7A 3TP6A 3PIP3 3G6EA 1ICFB 3TQYA 1DJRD 1LM0A 3SHLA 1TQOA 2QILA 3QJYA 1IW7C 1KNEA 3MFGA 1U4LA 1RODA 1ML0D 2F0DA 1KTKA 3IRBA 1MHWC 1VQOA 4UAIA 1KXLA 5H1SE 2AUJD 1X3FA 1L1OB 5JEAG 3CCRA 1GUOA 4KTAA 1WTRA 3D8GA 4AYBB 1AE3A 2B2TA 1TWFB 4P72A 4NKLA 5T1IA 2JJQA 1V8QA 3A7LA 1UWVA 4GKKL 2Q2HA 3U9SA 5D3IB 1B44D 3PGZA 1H9MA 3GTPH 1XWEA 4B3SQ 5IYBG 2A69C 1B1ZA 2VL6A 2QDBA 2F3WA 2RBMA 4AIMA 1HCZA 1KLGD 1PLFA 5EGTA 5JJIA 3BDOA 3HGBA 2EY6A 4IQZA 2EXDA 2OT2A 2Z6KC 3MXNB 4C3HB 2VUMB 1Y1WG 2VW9A 1IL8A 2RHSB 5IY0A 3D4RA 3M85A 4QGUA 5IGCA 1EYCA 1JB3A 1QE6A 1UEAB 3KBGA 4DR6L 3L0OA 1AP0A 1BUVT 5C0XJ 4KK7A 1IYVA 3CCMA 2ENBA 1G6PA 2N78A 1STBA 4QL5A 4O42A 3PO3B 4LFBL 2IHEA 3KF6B 4S3SA 5A2QE 3K59A 1QILA 2VS1A 4FXKC 3D3RA 1EY6A 4OIJA 4HCEA 1KAWA 4A3JG 1CKNB 1JC7A 5BR8Q 1Y1VH 1D1IA 1AEXA 3C46A 1BQQT 1GUTA 3Q22A 4K2KA 4NXMQ 3GTQH 1XTCD 3PO2B 1U4PA 3RLFA 5GAGC 1V1PA 4OXPA 4C3JB 1NUCA 3A5UA 3GQBA 1QVCA 2A5HA 1R9TH 1KC8C 1QUQB 4JV5L 3NTIA 5FKAC 1K8MA 2VQFL 4BY7B 2PI2E 2YV5A 3I3CA 2Y0SG 1SEBD 4K2LA 4R4TA 1MGSA 2E5LQ 4DV7Q 2NVTH 4HMJA 1SMXA 4JOIC 4ULLA 2IX1A 2O4XA 4YWKA 4DR6Q 1TWCB 3SE0A 4HCSA 4IJLA 4QQBX 3AEVA 4ZKBB 4EQNA 4LF6L 4AYBE 2RSOA 2PW7A 1DOLA 4K5VA 1MD2D 1KAAA 3S24A 5M3MB 5ELOA 2ZXOA 1YI2A 4A3DG 1VQ5A 1Q46A 1KL9A 1HH2P 4B3ML 2BCOA 3VA5A 1LUZA 2ZTCA 3DLLA 1LV9A 3P20A 5I6WA 3GTKH 1TS5A 2ZM6Q 4P73A 1S5BD 1HXYD 3J7A5 4NB3A 4J6HA 3HOUH 3MHBA 2K5WA 1VQEA 2WV6D 2K4KA 4DFAA 4KN4C 5C44G 1ET6A 2D5DA 1L0XB 2K05A 4C3IG 1Y8OB 2EQSA 3EVQA 3EIVA 2KOLA 3E6ZX 1H9SB 2CHBD 4A3CG 2BE5D 2UXBL 2KENA 2KBNA 4I7ZC 1M1KC 1HUNA 2KEDA 4UPAA 1HFGA 3LWUA 2AHOB 3W5OA 5FOBB 2BOSA 1K73C 1JE4A 3MFYA 4G7OC 2BDOA 3U50C 4DV3Q 4BY1H 3WDNA 5K5PA 4HEDA 5FO9B 5LMUL 2F0KA 3IKJA 1D6EC 5C3WA 4C3HG 3P7JA 5ELCA 1Y1WB 3T1YL 3MXNA 1VQGA 2JA7H 3K5NA 4DN4M 5FO7B 3K0YA 5HGQA 4K8IA 1EYDA 3E9HA 4Z9CB 2RCFA 4JBJA 4DR3Q 3LGJA 1TKWB 1LTSD 2H4OA 2GN5A 5CV9A 4A3GG 1B53A 1W6KA 1OTCA 4RFBA 2Q2UA 4X66L 5JJZA 2UUBQ 4RGMA 1CHQD 4JI2Q 3KLWA 4KY5A 5NUCA 3VDYA 3M4PA 1PZJD 5COYA 4G4KA 1G91A 3PIO3 2CH4A 1ENFA 3NEMA 3S15H 5ELEA 4MN3A 4LF6Q 1GM5A 1EQTA 1EWIA 1BXTA 1F2LA 2JE6I 3GDEA 4JW0A 1IL2A 3VR5A 1MI2A 2WAQG 1X55A 4KV6A 4GN5A 3FKIB 1Y8NB 2E76C 2KCNA 4C2MH 3QOLA 2IL8A 2R93B 1PH8A 2F52A 1CTMA 5CMDA 5I2XA 2E75C 1TIID 4KD3A 1VQPA 1Y1WH 3VYRA 2B2VC 1SSOA 3PCOB 4ZCKA 4JI2L 4A4IA 1V9PA 3DEPA 3A56A 1PH9A 3A7AB 5J22A 3HOWB 2JA5B 5HURA 4DUZQ 3QO2A 1A3VA 2OQ0A 4XQQA 1JJCB 1GUSA 1TS4A 4X62L 4B3SL 4OX9L 3G4SA 2YYZA 1Q82C 1K9MC 2R92H 2KECA 1CUKA 3SR1A 2UXDQ 1Q1EA 3UDXA 2SDFA 4F7XA 1SE3A 4ZKCB 3K0XA 2E74C 2WACA 1EY4A 3ZJYC 1Y69U 4IFDH 1B3QA 3LNNA 4QY7A 3CW2C 1DXMA 5IODA 3J80L 1SYGA 1K83H 4C3JG 2K32A 3DWPA 4PQXA 2ZTEA 1AZPA 4A3KB 1ENAA 1XYIA 5CYUA 3T16A 1T9HA 4WJ3M 3I4NH 2Q2IA 3STBC 3S16H 1KQSA 2IWHA 3URYA 5IYCH 1E2VA 1Y8PB 3SVMA 1Q86C 3HOXB 2DUDA 5L37A 3BZKA 4Y7NB 3ONAB 3RR5A 4ALPA 2M9VA 1JCKB 1BCPC 1RL2A 2F0QA 1DCZA 2Z8LA 2A68D 1WD0A 5BN5A 5IP7H 5M9OA 3QIAA 2AUKA 4OWTB 2O2LD 4LUZA 4HTHA 3CXCA 4CJ2C 1DOKA 4ZAIA 1QNKA 3GO5A 2C9OA 4H0LC 4R4CA 1WOCA 3GTJH 1LTTD 1YHBA 3LX0A 3KF6A 5FLXE 2F1MA 1HZBA 3IFTA 1XMQQ 3N6RA 1N33Q 2L4NA 1VF5C 2L15A 3I4MB 4DR7L 1L1OA 2N55A 1SXTA 4P75A 3B6YA 2B63H 1PTOH 1SNPA 2DNEA 1PTOC 2EVBA 4P74A 2F0MA 4A3JB 4TQUS 3T1HL 1UNSA 2QCPX 4B3RQ 1U5KA 1TY0A 4MTKA 2OF1A 2ZJPA 4DAVA 4PZ7A 1X65A 3PO2H 3V05A 3RZOB 4DR1Q 4KKSA 2UUAQ 4C3IB 4K0KQ 2N88A 2UXCQ 2A19A 4IFDG 3S14H 3NE5B 1FGUA 4OONA 3GV3A 3C3LA 3L9AX 3S1RH 2RDFA 1NR2A 2ZM6L 3PUZA 3K7AB 1EU4A 2MO0A 4XXEA 1TT2A 5I2YA 2LXKA 4X64Q 2F0IA 1PTOD 2PZUA 3MXPA 1JE5A 4DV2L 2E2IB 1V1QA 3FKIG 1SYFA 3K58A 1V1OA 1F2MA 2JN4A 1PRTF 2JEBI 4L5TA 3CCUA 3C1EA 1EOTA 1FL0A 3I90A 1SNCA 2JSOA 2VUMH 1GHKA 2QF7A 5M3MG 2G9DA 2F0PA 1X32A 5K36H 3J80E 5IGGA 2E2DC 2CVRA 5DAUA 3HOWG 3TEHB 5C4JH 3MVVA 4CKBA 5JJKA 1D8LA 2CCZA 2NZOA 3CKIB 3S1MH 1PFNA 1RTOA 1N36L 4HSPA 1TWGB 3SEBA 1VQHA 3FVQA 3OW2A 1V1PB 3FKIH 1KLUD 1Y1VG 4NP5A 3K5OA 4ID6A 3UDFA 3S2DH 2PYKA 1WVLA 1FGBD 1BVSA 2WINB 3DMUA 4U68A 1HR0W 1L1OC 3PUXA 1UUPA 4DR4Q 4X64L 2NN6I 1WTPA 3GTOH 2K6AA 2K33A 1OXVA 3J81L 4JI7L 2EE1A 4A3FH 1CSQA 1STNA 4IUNA 4A3KG
chains in the Genus database with same CATH topology
2D62A 1GD7A 3RZOH 4J15A 2R92G 1ASYA 1CSPA 4BY7H 1IXRA 1E22A 2CWAA 4O0AA 3G6EA 1N9WA 3JAMc 3TQYA 3F2CA 4K0KL 1XNRQ 1PH3A 1LM0A 4DR1L 1VQ8A 3CCVA 1I3QH 1SFOH 3HOZH 4A3LH 1N36Q 4POGA 4BY1G 1SR3A 3CPWA 1NJIC 3AFPA 4MNOA 1P16A 1GKHA 3A5ZB 3L2PA 2I0QA 1VQ6A 1TXYA 2VQEL 2MFIA 3KJPA 3IRBA 2D0OA 3RN5A 1Z47A 2KHIA 1VQOA 3TREA 1KXLA 5FJ8H 5H1SE 4LF8Q 1JT8A 4LF5L 4A3EG 1X3EA 1X3FA 1L1OB 5JEAG 3CCRA 4A75A 4DR5Q 4X65Q 4DAMA 1JJ2A 4A3DH 4DNIA 5J3BA 2R7FA 2XGTA 1AE3A 5FLMH 1YZ6A 1CKMA 3J80c 2QEXA 1A8VA 2UUCL 3ERSX 3PO3H 4P72A 1PH6A 1RIPA 2H5XA 1N32L 2OQKA 3H3VI 2V1CC 2JJQA 1Q8KA 3KDFA 4OO1G 1B70B 4RG1A 2PNHA 1UWVA 4GKKL 2Q2HA 1C9OA 1VQFA 3OTOL 3PGZA 3GTPH 1WJJA 3I4MG 1A63A 4B3SQ 1WI5A 4GNXB 2AWOA 2E8GA 5IYBG 1K3RA 1VQLA 2Z6KA 3HOXG 3I56A 2VL6A 3E0EA 4DR4L 1K8GA 1SE8A 3KYHC 3HOXH 2VNUD 1IYJB 2K5NA 4AIMA 3CCSA 5JJIA 2QGQA 3GTGH 5LMUQ 1S72A 4GNXA 2EXDA 4WJ4A 1FJGL 2WFWA 1MIUA 2Z6KC 3ULLA 1N32Q 3MXNB 2NZHA 1Y1WG 4YHHL 2LSSA 4LFBQ 2VW9A 5IP9G 2RHSB 1LTLA 5IY0A 3M85A 2UU9L 4QGUA 4LF5Q 2B63G 3RLNA 3HKZE 4BBSG 4UY8C 2JA8G 1EYGA 1HNXL 4DR6L 3L0OA 4JYAQ 4R1JA 2JA5G 4IPDA 1WCMH 5C0XJ 2GVAA 4DV7L 4IPGA 1VCIA 2D0PA 4GN4B 1EUJA 3K7AH 4EQ5A 5C4XH 5FJ8G 4HJAA 4X6AH 1PH5A 3CCMA 1G6PA 2N78A 1O7IA 1TWCH 4QL5A 2UU9Q 4JI0Q 3PV0A 4A3MG 3HKZG 3PF5A 4JI8L 4LFBL 5JEAJ 1HNXQ 2IHEA 3KF6B 2XTIA 1Q1BA 1OXTA 2VS1A 2GVBA 2K5HA 4BBSH 1I6HH 3S1NH 1KAWA 2MO1A 1CKNB 4R4IA 4A3JG 1VQ4A 3CD6A 5BR8Q 3UE0A 1Y1VH 1X54A 2LXJA 2JA5H 4BXXH 1ASZA 1YHAA 2ZJQA 4PMWA 2WB1E 4NXMQ 3GTQH 3HOWH 3K7UC 1PH2A 3PUVA 5LMNL 3RLFA 5GAGC 2EIFA 4OXPA 1EFWA 2IX0A 4DR2L 4OO1I 3A5UA 4HIKA 1QVCA 1R9TH 5M3FH 1XNQL 1HZ9A 3U58A 3M4OH 1KC8C 1QUQB 2ATWA 3PF4A 5C3EH 1EIYB 1BBWA 4DAYB 1WFQA 2CQOA 3J80i 4OWWB 4JV5L 4JBWA 1K0RA 1E1OA 2F4VL 4JOIA 2MQHA 2VQFL 1I94Q 2PI2E 2UUCQ 4AH6A 2YV5A 2VY3A 2Y0SG 4NPSA 1GO3E 4PG3A 4DV4L 1C0AA 1B7YB 4A3MH 4R4TA 4JI8Q 1QZGA 3G48A 1E7ZA 4QJFA 2YU9H 4LF9Q 3PSIA 4LF8L 2E5LQ 3F8TA 1N34L 4LNQA 1WCMG 4DV7Q 2NVTH 2KCTA 4OWXB 1TWHH 3H0GH 1SMXA 1M90C 4JOIC 2IX1A 2ALYB 3H3VH 2AMCB 2RF4A 4GLAC 4YWKA 3T1HQ 4DR6Q 5C0XG 1SLJA 4LUVA 1QZHA 3KFUA 3L7ZC 2CWPA 3F2BA 4UP7A 3CC2A 4IJLA 4LF4Q 4GOPB 1IBLL 3AEVA 4QQBX 4LFCL 4LF6L 4AYBE 3ULJA 1VQCA 2BH8A 3RNUA 1PH7A 4DV4Q 1BBUA 3EN2A 1TWGH 1XMQL 1HR0L 3S24A 2Q2TA 5ELOA 4XTCS 1YI2A 4A3DG 3M7NA 1VQ5A 2R6GA 4X66Q 1Q46A 3D31A 1KL9A 3I4OA 1FJGQ 1HH2P 2UXDL 2K14A 4APVA 4B3ML 2E2HH 2KCMA 4L5RC 3CCQA 4KI0A 1LUZA 2ZTCA 3DLLA 1MJEA 4QIWE 3GTKH 1DGSA 1PH4A 4DKAC 5JJLA 4LW1A 1Y14B 1VQ9A 2ZM6Q 4A3KG 4X62Q 4LFAL 1HNWL 1E3PA 4P73A 4B3TL 3OTOQ 5DLQE 1EOVA 3J7A5 3UDGA 3D0FA 4NB3A 5ELNA 1W2BA 3OYYA 5IT9c 5EAYA 5BR8L 3HOUH 4BA1I 1VQEA 1XTDA 3M9BA 5M5XH 5AJ3Q 2HIVA 2K4KA 4PZ6A 4DV3L 1SN8A 3FHWA 1IZ6A 2NVYH 5C44G 4R4QA 3STBD 1HR0Q 2A8VA 4JC0A 4DV0Q 4JI5Q 3I4NG 1HZAA 1HJPA 4O2DA 2EQSA 1BKBA 3PUWA 3EIVA 3NELA 1EQRA 1TWFH 4NXNL 4A3CG 1SROA 3DM3A 2UXBL 4JYAL 2KENA 4NXNQ 3HOYH 2KBNA 4GOPA 4GNXC 1M1KC 1KD1C 2K75A 5GAEC 4UPAA 4KLKA 2C35B 2AHOB 4LUOA 2PQAB 3W5OA 4A3IH 2HHHL 4DR7Q 4KHPQ 4C3IH 1JJGA 4BA2I 1VQKA 2I5HA 1K73C 4JI6L 1XNRL 4A3BH 5HY6A 2E2JH 3U50C 4DV3Q 2F4VQ 3J81j 1S40A 3CQZH 1X6OA 1UEBA 4BY1H 1OXUA 3GTLH 1AH9A 3KF8B 5LMUL 4KHPL 3RLOA 4DR3L 1XNQQ 4IOCA 3T1YL 3CCEA 2CFMA 3W1GA 4A3JH 1VQAA 3BU2A 4A3FG 4OX9Q 1VQGA 5GQOA 1NBWA 4DV1L 1C7YA 2JA7H 1X56A 2PMZE 2IY5B 5K36G 4A93G 5M3MH 5IYDG 5HGQA 2CKZB 4L5SA 3I4MH 4IFDI 3E9HA 1PFSA 4BXXG 4H02A 4DUZL 4JBJA 4A3CH 4DR3Q 3LGJA 2NN6G 2F3IA 2GN5A 4A3GG 4WJ3M 3Q8DA 1Z9FA 1OTCA 2IT1A 2Q2UA 3A0JA 4MZ9A 4X66L 2UUBQ 1G51A 4JI2Q 3KLWA 3VDYA 4JI6Q 1D7QA 3M4PA 3M4QA 1JB7A 3AQQA 1Q7YC 3JAMi 2BA0A 3NEMA 3S15H 3ER0A 4YCUA 4DV6L 4LF6Q 4LFCQ 1GM5A 1EWIA 2JE6I 5C0XI 2HHHQ 3GDEA 1EIFA 4JI0L 1YEZA 2OCEA 3J7ZC 3PIOA 3TS0A 3S1QH 1IL2A 2I5MX 5IP9H 4JI4L 2WAQG 1X55A 1G291 4GN5A 3TRZA 3CF5A 4XIGS 3A74A 3CC4A 4C2MH 3CPFA 4JI4Q 1PH8A 2F52A 2E5LL 2KHJA 3I2ZA 3UE1A 3BZCA 1KHIA 1L2FA 1VQPA 1Y1WH 4Y7NH 1N8RC 4IJHA 2JK8A 1JMCA 4Y52H 2RCNA 1L0WA 3PCOB 4JI2L 4C3JH 3BJUA 2VQFQ 2AKWB 4JI1L 4HIOA 2UUBL 4A4IA 1H95A 1V9PA 5AJ3L 4KHZA 1PH9A 1AE2A 1PV4A 4JV5Q 3H15A 2ZJRA 1J6QA 1VS0A 4A76A 4HJ9A 4DUZQ 4DV2Q 5M3FG 5FLXc 1U0LA 2OQ0A 4DR2Q 1VQNA 4A3KH 1JJCB 4LFAQ 4X62L 3JC66 2OTLA 4B3SL 1GVPA 4PZ8A 4DV5Q 4JI3Q 3G4SA 3I55A 1YITA 4OX9L 2B3GA 2YYZA 5M5WH 1Q82C 1W3SA 1VQDA 1QVGA 4P71A 1K9MC 4JBMA 1CUKA 1XPUA 2PI2A 2NVQH 1Q12A 4GKKQ 2E2IH 3U4VA 2UXDQ 1Q1EA 3G71A 4GOPC 3UDXA 4A3IG 3AFQA 1XPOA 4JI1Q 3CC7A 3K0XA 1PA6A 5FLMG 3CAMA 3ZJYC 1NTGA 4QY7A 3CW2C 4X65L 1YIJA 2MNAA 1K83H 3K80C 1PVOA 2IHFA 2ZTEA 4GS3A 4GN3B 1T9HA 2JA9A 4HIMA 3KJOA 1YBYA 4BBRG 3I4NH 2Q2IA 3STBC 3S16H 4DK6C 5E7NA 1KQSA 2YTYA 1QUQA 2ASBA 5IYCH 5GADC 4A3BG 1NE3A 1Q86C 2DUDA 3I7FA 4RMFA 1PH1A 3BZKA 4YY3L 5IWAL 3MEFA 4DPGA 3RR5A 1V43A 4ALPA 4IFDJ 1RL2A 2R93H 4HIDA 4BBRH 1PHJA 1NMFA 1SRUA 1YNXA 3J81c 4AQYL 1X9NA 2PQAA 5IP7H 1PYSB 2YTXA 2Z0SA 4B3TQ 3HOVG 1XMOQ 4YCVA 4OWTB 4IOAA 1K8AC 4LUZA 1IBKL 4YWLA 3HKSA 2HQLA 3CXCA 3U4ZA 2R92H 3T1YQ 3E9IA 2HT1A 3K8AA 4AYBG 4HJ5A 1HZCA 3GD7A 3GO5A 4AQYQ 3PUYA 4A93H 2ES2A 4B3MQ 2JA8H 3KDFB 4R4CA 2JA7G 1A62A 1WOCA 1YVCA 3GTJH 2JEAI 1YHBA 2AWNA 3CMEA 4A3EH 3KF6A 5IWAQ 5C4XG 1HZBA 3HOUG 4YY3Q 1XPRA 2BA1A 1XMQQ 2UUAL 3PO3G 1N33Q 2K52A 2L15A 4DR5L 5C44H 4DR7L 2YTVA 1L1OA 1E24A 4P75A 2B63H 3B6YA 4JBKA 2JA6H 3S17H 4GLVB 2HIXA 1TWAH 4P74A 1B8AA 4JG2A 4GKJQ 4TQUS 4IPCA 3T1HL 5GROA 1VQ7A 2UXBQ 3W1BA 3RZDH 1U5KA 2WB1G 4B3RQ 4MTNA 2VQEQ 4POFA 2ZJPA 4DUYQ 5IYBH 1N34Q 4R4OA 1S3OA 1CKOA 4JCVE 4PZ7A 1X65A 3RN2A 1YJ9A 1YJWA 2A1AA 3HOYG 3PO2H 3SGIA 2VUMG 1VQIA 2B29A 2N3SA 4JI5L 4DV0L 1UE5A 2N49A 4DR1Q 1VQBA 2UUAQ 1XJVA 2OWOA 1I94L 4K0KQ 4ME3A 1MKHA 2UXCQ 3AYHB 3K81C 1KIXA 3ICEA 2RHQB 2A19A 4IFDG 1E1TA 3F1ZA 4LF7Q 1UE1A 3S14H 4DK3C 1FGUA 1NY4A 1I50H 4OONA 1IBML 1P8LA 4DV5L 3S1RH 1HNWQ 1CKNA 4JI7Q 2ZM6L 3PUZA 2ID0A 2MO0A 5LMNQ 1YHQA 2LXKA 4X64Q 4NXML 3TS2A 4DV2L 1JE5A 1V1QA 1HNZL 4LF7L 3FKIG 1FVIA 1EQQA 4HJ8A 4HJ7A 3ULPA 1UE6A 2UXCL 2K50A 1J5EL 2BH2A 3WWVA 2R7DA 4GLXA 2JEBI 3CCLA 4L5TA 3PIPA 3CCUA 2NVXH 1FL0A 3NENA 3UDIA 2I5LX 4IO9A 2VUMH 1UE7A 4C3HH 1YJNA 3PO2G 5M3MG 1IBLQ 5IYDH 4TVAB 4LWCA 5M5YH 3CMAA 3NBHB 1Q81C 4LF4L 1LYLA 3EBEA 2OTJA 5IYCG 4EX5A 1OXXK 4FDBA 4YWMA 1X3GA 4DUYL 3HOZG 3M3YH 4A3LG 3HOWG 2N8NA 3TEHB 5C4JH 1I5FA 2Y0SE 4B3RL 5JJKA 2QA4A 4GKJL 3CP0A 3S2HH 3J81i 2JA6G 1D8LA 2ZTDA 2CCZA 4BY7G 2NZOA 4LF9L 3S1MH 2R7ZH 4DV6Q 3H0GG 1N36L 2K5VA 4YHHQ 1PYBA 1A0IA 1VQHA 1N33L 3OW2A 3FKIH 1Y1VG 1KRTA 3GTMH 3FP9A 2VZAA 3F2DA 4L5QA 1NMGA 3UDFA 1J5EQ 3S2DH 1WYDA 4A3GH 4UP9A 4YCWA 1BVSA 4IPHA 5IE8A 2WAQE 2JQOA 2FXQA 1HR0W 1HNZQ 5LMNW 1KRSA 3HFZB 1L1OC 5GAHC 3PUXA 3CCJA 4DR4Q 2R93G 4X64L 2NN6I 2WP8J 1VQMA 3GTOH 2R7ZG 4UP8A 1OXVA 4JI3L 4JI7L 1IBKQ 3KOJA 4A3FH 5C3EG 1CSQA 4DV1Q 1XMOL 5IP7G 1QVFA 3HOVH 1IBMQ 1OXSC 1VQJA 2DGYA 1MJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D62 A;  1GD7 A;  3RZO H;  4J15 A;  2R92 G;  1ASY A;  1CSP A;  4BY7 H;  1IXR A;  1E22 A;  2CWA A;  4O0A A;  3G6E A;  1N9W A;  3JAM c;  3TQY A;  3F2C A;  4K0K L;  1XNR Q;  1PH3 A;  1LM0 A;  4DR1 L;  1VQ8 A;  3CCV A;  1I3Q H;  1SFO H;  3HOZ H;  4A3L H;  1N36 Q;  4POG A;  4BY1 G;  1SR3 A;  3CPW A;  1NJI C;  3AFP A;  4MNO A;  1P16 A;  1GKH A;  3A5Z B;  3L2P A;  2I0Q A;  1VQ6 A;  1TXY A;  2VQE L;  2MFI A;  3KJP A;  3IRB A;  2D0O A;  3RN5 A;  1Z47 A;  2KHI A;  1VQO A;  3TRE A;  1KXL A;  5FJ8 H;  5H1S E;  4LF8 Q;  1JT8 A;  4LF5 L;  4A3E G;  1X3E A;  1X3F A;  1L1O B;  5JEA G;  3CCR A;  4A75 A;  4DR5 Q;  4X65 Q;  4DAM A;  1JJ2 A;  4A3D H;  4DNI A;  5J3B A;  2R7F A;  2XGT A;  1AE3 A;  5FLM H;  1YZ6 A;  1CKM A;  3J80 c;  2QEX A;  1A8V A;  2UUC L;  3ERS X;  3PO3 H;  4P72 A;  1PH6 A;  1RIP A;  2H5X A;  1N32 L;  2OQK A;  3H3V I;  2V1C C;  2JJQ A;  1Q8K A;  3KDF A;  4OO1 G;  1B70 B;  4RG1 A;  2PNH A;  1UWV A;  4GKK L;  2Q2H A;  1C9O A;  1VQF A;  3OTO L;  3PGZ A;  3GTP H;  1WJJ A;  3I4M G;  1A63 A;  4B3S Q;  1WI5 A;  4GNX B;  2AWO A;  2E8G A;  5IYB G;  1K3R A;  1VQL A;  2Z6K A;  3HOX G;  3I56 A;  2VL6 A;  3E0E A;  4DR4 L;  1K8G A;  1SE8 A;  3KYH C;  3HOX H;  2VNU D;  1IYJ B;  2K5N A;  4AIM A;  3CCS A;  5JJI A;  2QGQ A;  3GTG H;  5LMU Q;  1S72 A;  4GNX A;  2EXD A;  4WJ4 A;  1FJG L;  2WFW A;  1MIU A;  2Z6K C;  3ULL A;  1N32 Q;  3MXN B;  2NZH A;  1Y1W G;  4YHH L;  2LSS A;  4LFB Q;  2VW9 A;  5IP9 G;  2RHS B;  1LTL A;  5IY0 A;  3M85 A;  2UU9 L;  4QGU A;  4LF5 Q;  2B63 G;  3RLN A;  3HKZ E;  4BBS G;  4UY8 C;  2JA8 G;  1EYG A;  1HNX L;  4DR6 L;  3L0O A;  4JYA Q;  4R1J A;  2JA5 G;  4IPD A;  1WCM H;  5C0X J;  2GVA A;  4DV7 L;  4IPG A;  1VCI A;  2D0P A;  4GN4 B;  1EUJ A;  3K7A H;  4EQ5 A;  5C4X H;  5FJ8 G;  4HJA A;  4X6A H;  1PH5 A;  3CCM A;  1G6P A;  2N78 A;  1O7I A;  1TWC H;  4QL5 A;  2UU9 Q;  4JI0 Q;  3PV0 A;  4A3M G;  3HKZ G;  3PF5 A;  4JI8 L;  4LFB L;  5JEA J;  1HNX Q;  2IHE A;  3KF6 B;  2XTI A;  1Q1B A;  1OXT A;  2VS1 A;  2GVB A;  2K5H A;  4BBS H;  1I6H H;  3S1N H;  1KAW A;  2MO1 A;  1CKN B;  4R4I A;  4A3J G;  1VQ4 A;  3CD6 A;  5BR8 Q;  3UE0 A;  1Y1V H;  1X54 A;  2LXJ A;  2JA5 H;  4BXX H;  1ASZ A;  1YHA A;  2ZJQ A;  4PMW A;  2WB1 E;  4NXM Q;  3GTQ H;  3HOW H;  3K7U C;  1PH2 A;  3PUV A;  5LMN L;  3RLF A;  5GAG C;  2EIF A;  4OXP A;  1EFW A;  2IX0 A;  4DR2 L;  4OO1 I;  3A5U A;  4HIK A;  1QVC A;  1R9T H;  5M3F H;  1XNQ L;  1HZ9 A;  3U58 A;  3M4O H;  1KC8 C;  1QUQ B;  2ATW A;  3PF4 A;  5C3E H;  1EIY B;  1BBW A;  4DAY B;  1WFQ A;  2CQO A;  3J80 i;  4OWW B;  4JV5 L;  4JBW A;  1K0R A;  1E1O A;  2F4V L;  4JOI A;  2MQH A;  2VQF L;  1I94 Q;  2PI2 E;  2UUC Q;  4AH6 A;  2YV5 A;  2VY3 A;  2Y0S G;  4NPS A;  1GO3 E;  4PG3 A;  4DV4 L;  1C0A A;  1B7Y B;  4A3M H;  4R4T A;  4JI8 Q;  1QZG A;  3G48 A;  1E7Z A;  4QJF A;  2YU9 H;  4LF9 Q;  3PSI A;  4LF8 L;  2E5L Q;  3F8T A;  1N34 L;  4LNQ A;  1WCM G;  4DV7 Q;  2NVT H;  2KCT A;  4OWX B;  1TWH H;  3H0G H;  1SMX A;  1M90 C;  4JOI C;  2IX1 A;  2ALY B;  3H3V H;  2AMC B;  2RF4 A;  4GLA C;  4YWK A;  3T1H Q;  4DR6 Q;  5C0X G;  1SLJ A;  4LUV A;  1QZH A;  3KFU A;  3L7Z C;  2CWP A;  3F2B A;  4UP7 A;  3CC2 A;  4IJL A;  4LF4 Q;  4GOP B;  1IBL L;  3AEV A;  4QQB X;  4LFC L;  4LF6 L;  4AYB E;  3ULJ A;  1VQC A;  2BH8 A;  3RNU A;  1PH7 A;  4DV4 Q;  1BBU A;  3EN2 A;  1TWG H;  1XMQ L;  1HR0 L;  3S24 A;  2Q2T A;  5ELO A;  4XTC S;  1YI2 A;  4A3D G;  3M7N A;  1VQ5 A;  2R6G A;  4X66 Q;  1Q46 A;  3D31 A;  1KL9 A;  3I4O A;  1FJG Q;  1HH2 P;  2UXD L;  2K14 A;  4APV A;  4B3M L;  2E2H H;  2KCM A;  4L5R C;  3CCQ A;  4KI0 A;  1LUZ A;  2ZTC A;  3DLL A;  1MJE A;  4QIW E;  3GTK H;  1DGS A;  1PH4 A;  4DKA C;  5JJL A;  4LW1 A;  1Y14 B;  1VQ9 A;  2ZM6 Q;  4A3K G;  4X62 Q;  4LFA L;  1HNW L;  1E3P A;  4P73 A;  4B3T L;  3OTO Q;  5DLQ E;  1EOV A;  3J7A 5;  3UDG A;  3D0F A;  4NB3 A;  5ELN A;  1W2B A;  3OYY A;  5IT9 c;  5EAY A;  5BR8 L;  3HOU H;  4BA1 I;  1VQE A;  1XTD A;  3M9B A;  5M5X H;  5AJ3 Q;  2HIV A;  2K4K A;  4PZ6 A;  4DV3 L;  1SN8 A;  3FHW A;  1IZ6 A;  2NVY H;  5C44 G;  4R4Q A;  3STB D;  1HR0 Q;  2A8V A;  4JC0 A;  4DV0 Q;  4JI5 Q;  3I4N G;  1HZA A;  1HJP A;  4O2D A;  2EQS A;  1BKB A;  3PUW A;  3EIV A;  3NEL A;  1EQR A;  1TWF H;  4NXN L;  4A3C G;  1SRO A;  3DM3 A;  2UXB L;  4JYA L;  2KEN A;  4NXN Q;  3HOY H;  2KBN A;  4GOP A;  4GNX C;  1M1K C;  1KD1 C;  2K75 A;  5GAE C;  4UPA A;  4KLK A;  2C35 B;  2AHO B;  4LUO A;  2PQA B;  3W5O A;  4A3I H;  2HHH L;  4DR7 Q;  4KHP Q;  4C3I H;  1JJG A;  4BA2 I;  1VQK A;  2I5H A;  1K73 C;  4JI6 L;  1XNR L;  4A3B H;  5HY6 A;  2E2J H;  3U50 C;  4DV3 Q;  2F4V Q;  3J81 j;  1S40 A;  3CQZ H;  1X6O A;  1UEB A;  4BY1 H;  1OXU A;  3GTL H;  1AH9 A;  3KF8 B;  5LMU L;  4KHP L;  3RLO A;  4DR3 L;  1XNQ Q;  4IOC A;  3T1Y L;  3CCE A;  2CFM A;  3W1G A;  4A3J H;  1VQA A;  3BU2 A;  4A3F G;  4OX9 Q;  1VQG A;  5GQO A;  1NBW A;  4DV1 L;  1C7Y A;  2JA7 H;  1X56 A;  2PMZ E;  2IY5 B;  5K36 G;  4A93 G;  5M3M H;  5IYD G;  5HGQ A;  2CKZ B;  4L5S A;  3I4M H;  4IFD I;  3E9H A;  1PFS A;  4BXX G;  4H02 A;  4DUZ L;  4JBJ A;  4A3C H;  4DR3 Q;  3LGJ A;  2NN6 G;  2F3I A;  2GN5 A;  4A3G G;  4WJ3 M;  3Q8D A;  1Z9F A;  1OTC A;  2IT1 A;  2Q2U A;  3A0J A;  4MZ9 A;  4X66 L;  2UUB Q;  1G51 A;  4JI2 Q;  3KLW A;  3VDY A;  4JI6 Q;  1D7Q A;  3M4P A;  3M4Q A;  1JB7 A;  3AQQ A;  1Q7Y C;  3JAM i;  2BA0 A;  3NEM A;  3S15 H;  3ER0 A;  4YCU A;  4DV6 L;  4LF6 Q;  4LFC Q;  1GM5 A;  1EWI A;  2JE6 I;  5C0X I;  2HHH Q;  3GDE A;  1EIF A;  4JI0 L;  1YEZ A;  2OCE A;  3J7Z C;  3PIO A;  3TS0 A;  3S1Q H;  1IL2 A;  2I5M X;  5IP9 H;  4JI4 L;  2WAQ G;  1X55 A;  1G29 1;  4GN5 A;  3TRZ A;  3CF5 A;  4XIG S;  3A74 A;  3CC4 A;  4C2M H;  3CPF A;  4JI4 Q;  1PH8 A;  2F52 A;  2E5L L;  2KHJ A;  3I2Z A;  3UE1 A;  3BZC A;  1KHI A;  1L2F A;  1VQP A;  1Y1W H;  4Y7N H;  1N8R C;  4IJH A;  2JK8 A;  1JMC A;  4Y52 H;  2RCN A;  1L0W A;  3PCO B;  4JI2 L;  4C3J H;  3BJU A;  2VQF Q;  2AKW B;  4JI1 L;  4HIO A;  2UUB L;  4A4I A;  1H95 A;  1V9P A;  5AJ3 L;  4KHZ A;  1PH9 A;  1AE2 A;  1PV4 A;  4JV5 Q;  3H15 A;  2ZJR A;  1J6Q A;  1VS0 A;  4A76 A;  4HJ9 A;  4DUZ Q;  4DV2 Q;  5M3F G;  5FLX c;  1U0L A;  2OQ0 A;  4DR2 Q;  1VQN A;  4A3K H;  1JJC B;  4LFA Q;  4X62 L;  3JC6 6;  2OTL A;  4B3S L;  1GVP A;  4PZ8 A;  4DV5 Q;  4JI3 Q;  3G4S A;  3I55 A;  1YIT A;  4OX9 L;  2B3G A;  2YYZ A;  5M5W H;  1Q82 C;  1W3S A;  1VQD A;  1QVG A;  4P71 A;  1K9M C;  4JBM A;  1CUK A;  1XPU A;  2PI2 A;  2NVQ H;  1Q12 A;  4GKK Q;  2E2I H;  3U4V A;  2UXD Q;  1Q1E A;  3G71 A;  4GOP C;  3UDX A;  4A3I G;  3AFQ A;  1XPO A;  4JI1 Q;  3CC7 A;  3K0X A;  1PA6 A;  5FLM G;  3CAM A;  3ZJY C;  1NTG A;  4QY7 A;  3CW2 C;  4X65 L;  1YIJ A;  2MNA A;  1K83 H;  3K80 C;  1PVO A;  2IHF A;  2ZTE A;  4GS3 A;  4GN3 B;  1T9H A;  2JA9 A;  4HIM A;  3KJO A;  1YBY A;  4BBR G;  3I4N H;  2Q2I A;  3STB C;  3S16 H;  4DK6 C;  5E7N A;  1KQS A;  2YTY A;  1QUQ A;  2ASB A;  5IYC H;  5GAD C;  4A3B G;  1NE3 A;  1Q86 C;  2DUD A;  3I7F A;  4RMF A;  1PH1 A;  3BZK A;  4YY3 L;  5IWA L;  3MEF A;  4DPG A;  3RR5 A;  1V43 A;  4ALP A;  4IFD J;  1RL2 A;  2R93 H;  4HID A;  4BBR H;  1PHJ A;  1NMF A;  1SRU A;  1YNX A;  3J81 c;  4AQY L;  1X9N A;  2PQA A;  5IP7 H;  1PYS B;  2YTX A;  2Z0S A;  4B3T Q;  3HOV G;  1XMO Q;  4YCV A;  4OWT B;  4IOA A;  1K8A C;  4LUZ A;  1IBK L;  4YWL A;  3HKS A;  2HQL A;  3CXC A;  3U4Z A;  2R92 H;  3T1Y Q;  3E9I A;  2HT1 A;  3K8A A;  4AYB G;  4HJ5 A;  1HZC A;  3GD7 A;  3GO5 A;  4AQY Q;  3PUY A;  4A93 H;  2ES2 A;  4B3M Q;  2JA8 H;  3KDF B;  4R4C A;  2JA7 G;  1A62 A;  1WOC A;  1YVC A;  3GTJ H;  2JEA I;  1YHB A;  2AWN A;  3CME A;  4A3E H;  3KF6 A;  5IWA Q;  5C4X G;  1HZB A;  3HOU G;  4YY3 Q;  1XPR A;  2BA1 A;  1XMQ Q;  2UUA L;  3PO3 G;  1N33 Q;  2K52 A;  2L15 A;  4DR5 L;  5C44 H;  4DR7 L;  2YTV A;  1L1O A;  1E24 A;  4P75 A;  2B63 H;  3B6Y A;  4JBK A;  2JA6 H;  3S17 H;  4GLV B;  2HIX A;  1TWA H;  4P74 A;  1B8A A;  4JG2 A;  4GKJ Q;  4TQU S;  4IPC A;  3T1H L;  5GRO A;  1VQ7 A;  2UXB Q;  3W1B A;  3RZD H;  1U5K A;  2WB1 G;  4B3R Q;  4MTN A;  2VQE Q;  4POF A;  2ZJP A;  4DUY Q;  5IYB H;  1N34 Q;  4R4O A;  1S3O A;  1CKO A;  4JCV E;  4PZ7 A;  1X65 A;  3RN2 A;  1YJ9 A;  1YJW A;  2A1A A;  3HOY G;  3PO2 H;  3SGI A;  2VUM G;  1VQI A;  2B29 A;  2N3S A;  4JI5 L;  4DV0 L;  1UE5 A;  2N49 A;  4DR1 Q;  1VQB A;  2UUA Q;  1XJV A;  2OWO A;  1I94 L;  4K0K Q;  4ME3 A;  1MKH A;  2UXC Q;  3AYH B;  3K81 C;  1KIX A;  3ICE A;  2RHQ B;  2A19 A;  4IFD G;  1E1T A;  3F1Z A;  4LF7 Q;  1UE1 A;  3S14 H;  4DK3 C;  1FGU A;  1NY4 A;  1I50 H;  4OON A;  1IBM L;  1P8L A;  4DV5 L;  3S1R H;  1HNW Q;  1CKN A;  4JI7 Q;  2ZM6 L;  3PUZ A;  2ID0 A;  2MO0 A;  5LMN Q;  1YHQ A;  2LXK A;  4X64 Q;  4NXM L;  3TS2 A;  4DV2 L;  1JE5 A;  1V1Q A;  1HNZ L;  4LF7 L;  3FKI G;  1FVI A;  1EQQ A;  4HJ8 A;  4HJ7 A;  3ULP A;  1UE6 A;  2UXC L;  2K50 A;  1J5E L;  2BH2 A;  3WWV A;  2R7D A;  4GLX A;  2JEB I;  3CCL A;  4L5T A;  3PIP A;  3CCU A;  2NVX H;  1FL0 A;  3NEN A;  3UDI A;  2I5L X;  4IO9 A;  2VUM H;  1UE7 A;  4C3H H;  1YJN A;  3PO2 G;  5M3M G;  1IBL Q;  5IYD H;  4TVA B;  4LWC A;  5M5Y H;  3CMA A;  3NBH B;  1Q81 C;  4LF4 L;  1LYL A;  3EBE A;  2OTJ A;  5IYC G;  4EX5 A;  1OXX K;  4FDB A;  4YWM A;  1X3G A;  4DUY L;  3HOZ G;  3M3Y H;  4A3L G;  3HOW G;  2N8N A;  3TEH B;  5C4J H;  1I5F A;  2Y0S E;  4B3R L;  5JJK A;  2QA4 A;  4GKJ L;  3CP0 A;  3S2H H;  3J81 i;  2JA6 G;  1D8L A;  2ZTD A;  2CCZ A;  4BY7 G;  2NZO A;  4LF9 L;  3S1M H;  2R7Z H;  4DV6 Q;  3H0G G;  1N36 L;  2K5V A;  4YHH Q;  1PYB A;  1A0I A;  1VQH A;  1N33 L;  3OW2 A;  3FKI H;  1Y1V G;  1KRT A;  3GTM H;  3FP9 A;  2VZA A;  3F2D A;  4L5Q A;  1NMG A;  3UDF A;  1J5E Q;  3S2D H;  1WYD A;  4A3G H;  4UP9 A;  4YCW A;  1BVS A;  4IPH A;  5IE8 A;  2WAQ E;  2JQO A;  2FXQ A;  1HR0 W;  1HNZ Q;  5LMN W;  1KRS A;  3HFZ B;  1L1O C;  5GAH C;  3PUX A;  3CCJ A;  4DR4 Q;  2R93 G;  4X64 L;  2NN6 I;  2WP8 J;  1VQM A;  3GTO H;  2R7Z G;  4UP8 A;  1OXV A;  4JI3 L;  4JI7 L;  1IBK Q;  3KOJ A;  4A3F H;  5C3E G;  1CSQ A;  4DV1 Q;  1XMO L;  5IP7 G;  1QVF A;  3HOV H;  1IBM Q;  1OXS C;  1VQJ A;  2DGY A;  1MJC A; 
#chains in the Genus database with same CATH topology
 4FF4 A;  4J15 A;  5C6A A;  1E22 A;  4CHT B;  3H91 A;  4K0K L;  4ILW A;  2XNA C;  3CCV A;  3TME A;  3UI2 A;  5M3F B;  1SFO H;  3HOZ H;  4A3L H;  1N36 Q;  4BY1 G;  1PTO B;  1P16 A;  4K14 A;  1I4G A;  4HMI A;  5EQ0 A;  4JVZ A;  4ZK9 B;  1DM0 B;  1Z47 A;  3N52 A;  1CM9 A;  4QUC A;  1JT8 A;  4LF5 L;  1EZ8 A;  1X3E A;  4A75 A;  1SJH D;  4X65 Q;  1JJ2 A;  3NWT A;  4DNI A;  1CKM A;  1A8V A;  2UUC L;  3ERS X;  1RIP A;  2H5X A;  3H3V I;  4A3G B;  1ZYR D;  2J4X A;  2A6H D;  4OO1 G;  1B70 B;  4RG1 A;  2L5T A;  2PNH A;  2SOB A;  3OOC A;  2MHV A;  1S5E D;  4RAU C;  4L6T B;  5BN4 A;  3OTO L;  1WJJ A;  1D2B A;  2AWO A;  2EOT A;  1VQL A;  2Z6K A;  3HOX G;  5A35 A;  3E0E A;  1Z7T A;  1K8G A;  1U4R A;  3KLS X;  4ZYS A;  2K5N A;  1MBY A;  1CT1 D;  1MIU A;  4XT3 B;  5M5Y B;  5EJW A;  2F03 A;  1EY7 A;  1SE2 A;  2LSS A;  2CW0 D;  2E2H B;  3BYY B;  4RWS C;  2XVS A;  1TY2 A;  2HCC A;  2JA5 G;  1WCM H;  2GVA A;  4EQ5 A;  1VCI A;  5C4X H;  4B9W A;  1HA6 A;  4HJA A;  2O5J C;  1O7I A;  1K28 A;  1TWC H;  3CU7 A;  3PF5 A;  2RDG A;  4PV1 C;  1WTV A;  2XTI A;  2EJG C;  2MGS A;  1OXT A;  3J7A V;  2K5H A;  5CV4 A;  5BN3 A;  1ONL A;  1LT5 D;  3S1N H;  2MO1 A;  5IT9 E;  1VQ4 A;  2YU9 B;  1HHV A;  2A6E C;  4WRD A;  2SNM A;  2JA5 H;  2F0W A;  2F3V A;  3FPP A;  4IN3 A;  4BXX H;  4ABN A;  3PUV A;  5LMN L;  3BVG A;  3SK5 A;  2EIF A;  2QDL A;  4IUU A;  1EFW A;  1DYQ A;  2IX0 A;  4DR2 L;  3HOZ B;  3RZD B;  1PFB A;  1I4P A;  3HP3 A;  3M4O H;  3PF4 A;  1EIY B;  1WFQ A;  2F4V L;  1E1O A;  1I94 Q;  5T1G A;  4AH6 A;  2VY3 A;  3FPU B;  4NPS A;  1GO3 E;  4PG3 A;  4DK1 A;  4A3M H;  1QZG A;  1Y1V B;  1E7Z A;  4QJF A;  3VYS A;  4LF8 L;  1N34 L;  2DJF C;  2EYO A;  2SEB D;  1M90 C;  4GZY C;  3H3V C;  2AMC B;  2RF4 A;  4GLA C;  4LUV A;  2RQX A;  2G9H D;  3KFU A;  1ZKO A;  1SND A;  2CWP A;  1VMC A;  3DWQ A;  4UP7 A;  3Q23 A;  4LFC L;  1VQC A;  4DXF A;  3RNU A;  4DV4 Q;  1BBU A;  1BF4 A;  2Q2T A;  3QOJ A;  2A69 D;  4X66 Q;  2JA7 B;  1PRT B;  3A8I E;  3D31 A;  4QMG A;  1FJG Q;  2KCM A;  1O80 A;  4KI0 A;  1DD2 A;  2EDG A;  3A55 A;  1PH4 A;  2Z4H A;  4DKA C;  5JJL A;  4LW1 A;  1VQ9 A;  4BY1 B;  1A3U A;  1O7Y A;  4X62 Q;  2LMC B;  1GUG A;  4ZLT F;  2WKD A;  1EOV A;  3OYY A;  4FXD A;  1KDB A;  2R3Z A;  5BR8 L;  1XTD A;  1O7Z A;  4F88 A;  2HIV A;  2JYO A;  1IZ6 A;  2XN9 C;  2DY8 A;  4O2D A;  1WTQ A;  1JOK A;  3PMF A;  4O1N A;  3NEL A;  1TWF H;  4FXG C;  3T53 B;  1VF7 A;  5FO8 B;  4GOP A;  4GNX C;  2K75 A;  3AMU A;  5EBD A;  2Q8T A;  3MWY W;  2F0J A;  4KHP Q;  4ZUJ A;  4OHJ A;  4BA2 I;  3E5S A;  1CZW A;  2I5H A;  4OGQ C;  3J81 j;  1X6O A;  5KGU A;  1U4M A;  3GTL H;  1AH9 A;  3KF8 B;  5IGE A;  3RLO A;  4DR3 L;  1XNQ Q;  4IOC A;  5C3X A;  3G7L A;  4A3F G;  3BU2 A;  3SDZ A;  4OX9 Q;  4DV1 L;  1PDQ A;  1XXG A;  2PMZ E;  4A93 G;  5M3M H;  4L5S A;  3I4M H;  4DUZ L;  4A3C H;  1DON A;  5CV7 A;  3Q8D A;  1SNO A;  5IGB A;  3MC0 B;  3Q0A A;  3NWS A;  3AQQ A;  1Q7Y C;  3GV6 A;  3ER0 A;  4DV6 L;  4LFC Q;  3AB9 A;  5C0X I;  2P5Z X;  4JI0 L;  3S1Q H;  3PIO A;  5IP9 H;  2Q8I B;  3FMC A;  1G29 1;  3A8K E;  4IAL A;  3CC4 A;  2F0N A;  5E3F A;  2TMP A;  3BZC A;  4RH6 A;  4Y7N H;  4IJH A;  2EXZ A;  2H1E A;  2XWJ B;  1H95 A;  3GTL B;  4HIO A;  2UUB L;  2B2Y A;  5AJ3 L;  5ELB A;  4JV5 Q;  3GTQ B;  5JAV A;  1LAB A;  2ZJR A;  3S16 B;  1J6Q A;  3TP5 A;  1FD7 D;  4A76 A;  1AW7 A;  5M3F G;  4HAE A;  1U0L A;  3NXW A;  1VQN A;  1CA6 A;  4A3K H;  1I6H B;  2J0T D;  1G8Z D;  4LFA Q;  4JPB W;  4RGO S;  4JI3 Q;  1GVP A;  3ND9 A;  4ME5 A;  4PZ8 A;  4DV5 Q;  3I55 A;  1QVG A;  1XPU A;  4FO2 A;  3TZD A;  3NBI A;  2L55 A;  3OIP A;  3A8J E;  1I6V C;  3AFQ A;  3H09 A;  1IYU A;  2PQE A;  4R8N A;  3VR3 A;  3T4A C;  3NP8 A;  5A2Q L;  1YIJ A;  2HUG A;  3R2I A;  3K80 C;  5CC4 A;  2DY7 A;  5J39 A;  4E6I A;  1H9J A;  1TS2 A;  4GS3 A;  4I7A A;  5EBC A;  1DZ1 A;  1ESF A;  2Z6B A;  5E7N A;  4F8M A;  2HDL A;  2RKS A;  2ASB A;  3IFD A;  4DAY A;  3GTG B;  1F2Y A;  4RMF A;  1PH1 A;  4YY3 L;  1SMY D;  1LTR D;  5KRU A;  4DPG A;  2Z4I A;  2R93 H;  5KEE A;  5C5M A;  4QUF A;  5C44 B;  1SRU A;  2ICI A;  4AQY L;  2PQA A;  3HOV G;  2Z0S A;  1BCP D;  4YCV A;  4DF7 A;  1YNJ D;  4A3E B;  4YWL A;  4NDX A;  3U4Z A;  1NAP A;  5IGF A;  3E9I A;  4HSV A;  3T1Y Q;  2HT1 A;  1HZC A;  3GD7 A;  1WTO A;  4B3M Q;  3FDT A;  1TS3 A;  2A6H C;  2JA7 G;  2JEA I;  5JEA H;  3CME A;  5JVG 3;  4A3E H;  5C4X G;  4YY3 Q;  1XPR A;  4LMQ D;  2BA1 A;  1W6J A;  4A3M B;  2UUA L;  4DR5 L;  2YTV A;  3CRL C;  3S17 H;  4GLV B;  3MEH A;  1EL0 A;  1B8A A;  5GRO A;  1I3Q B;  2RSN A;  1S5C D;  2A73 B;  1FNU A;  4POF A;  5COR A;  3NHH A;  4L8J A;  5IYB H;  3R93 A;  3CQZ B;  2XRQ D;  4JCV E;  1YJ9 A;  3BVZ A;  2EYH A;  3SGI A;  2B29 A;  2F0L A;  3EJI A;  1XJV A;  4ME3 A;  2PO4 A;  3S1N B;  1HUM A;  1MKH A;  4UHV A;  4BBS B;  1L0Y B;  2NUC A;  2A6E D;  2RHQ B;  1MSG A;  1UE1 A;  2KJX A;  1NY4 A;  1I50 H;  3R2T A;  2ID0 A;  3JAM E;  5TSS A;  2FMM A;  4FVM A;  4B9X A;  4LF7 L;  2AQ3 B;  1FVI A;  5M5W B;  4HJ8 A;  4N9P A;  3MXG A;  1J5E L;  3HG9 A;  2BH2 A;  3S2H B;  2MUY A;  2NVX H;  3Q6S A;  3UDI A;  2I5L X;  1BNZ A;  3EQL C;  1IBL Q;  5IYD H;  5M5Y H;  2OTJ A;  5IYC G;  4EX5 A;  4FDB A;  3K5M A;  1X3G A;  2PPB C;  1B9M A;  1O78 A;  2QA4 A;  2DN8 A;  3CP0 A;  4I65 A;  3J81 i;  4LK1 C;  4IUV A;  1LT3 D;  1SYE A;  1RDP D;  3TN2 A;  1LTG D;  1LTI D;  2EY5 A;  1RTN A;  3FP9 A;  3G6J B;  2VZA A;  1NMG A;  2NWG A;  1PFM A;  4A3G H;  4UP9 A;  1CI3 M;  1CQF A;  4CDD C;  1SYB A;  5CBA E;  4IPH A;  2FXQ A;  2MJ8 A;  1HNZ Q;  5LMN W;  3CCJ A;  2NVT B;  5E1F A;  2K04 A;  4CKC A;  1IBK Q;  4DV1 Q;  1OXS C;  2EYL A;  3BS1 A;  5G3L F;  3J7A F;  1ASY A;  1CSP A;  2L1B A;  4BY7 H;  1IXR A;  2CWA A;  1N9W A;  3JAM c;  4RHR A;  1XNR Q;  4F87 A;  2WKC A;  1SFO B;  1VQ8 A;  1F9R A;  4H13 C;  1I3Q H;  4WOR A;  4POG A;  3S17 B;  1EZ6 A;  2FIN B;  1NJI C;  1GKH A;  3A5Z B;  4ZRZ A;  3L2P A;  2I0Q A;  1VQ6 A;  1TXY A;  2VQE L;  1CQV A;  2MFI A;  3M7G A;  3KJP A;  4OO1 H;  4KJN A;  1QNU A;  1SJE D;  2KHI A;  1ENC A;  2TSS A;  4A3F B;  5CV5 A;  1II3 A;  4A3E G;  4DGZ A;  4A3D H;  4A93 B;  1QWY A;  4DAM A;  2EYM A;  5FLM H;  2QEX A;  3J80 c;  3PO3 H;  3E3X A;  2OQK A;  4OEL B;  5D65 A;  2KHS A;  1C9O A;  1VQF A;  4RGN A;  3I4M G;  1A2U A;  2IW3 A;  2E8G A;  1K3R A;  5I4D A;  3H6M A;  3I56 A;  2MP1 A;  4UDU C;  4DR4 L;  4DNR B;  1SE8 A;  3F2U A;  3KYH C;  2VNU D;  1IYJ B;  5I9O A;  3M3Y B;  3GTG H;  3LWE A;  4KY7 A;  4GNX A;  4WJ4 A;  1FJG L;  2WFW A;  2O5I C;  4DNT B;  3CRK C;  2IJ0 A;  1N32 Q;  5EKK A;  4YHH L;  5IP9 G;  1LTL A;  3I70 A;  3BDC A;  2D9U A;  1E2W A;  3RLN A;  1QCB D;  2ICE C;  3ERO A;  4K6L A;  2JA8 G;  1EYG A;  1HNX L;  3GTP B;  3KLS A;  4DK0 A;  3HS0 C;  4R1J A;  4IPD A;  4Q0F A;  1HNX Q;  4GN4 B;  2D0P A;  1EUJ A;  3K7A H;  4ZUI A;  1PXU A;  5IIF A;  5EKL A;  2UU9 Q;  2GA4 B;  1RHP A;  4A3M G;  1K3B C;  1PZI D;  5JEA J;  2NVQ B;  2EZV A;  1QOH A;  1I6H H;  2K28 A;  3MAQ A;  1X54 A;  1ASZ A;  1YHA A;  1XX8 A;  2WB1 E;  1X3P A;  3K7U C;  3V96 A;  4OO1 I;  1JOQ A;  3M4O B;  1ET9 A;  2ATW A;  5C3E H;  5F2D A;  1BBW A;  4DAY B;  1Q8I A;  4JBW A;  1S4Z A;  4KJO A;  1K0R A;  4JOI A;  3D6C A;  2UUC Q;  1BOS A;  3WOE A;  2M2L A;  1C0A A;  1G2T A;  1B7Y B;  2KA7 A;  3G48 A;  2YU9 H;  4LF9 Q;  1RF2 D;  4U67 3;  3GTJ B;  3TDQ A;  1RKN A;  1TWH H;  3H0G H;  3NUC A;  3H3V H;  2ALY B;  2EJF C;  3T1H Q;  5C0X G;  1LT4 D;  1QZH A;  1STE A;  5KNC A;  3CC2 A;  3DM1 A;  2B2U A;  1F9P A;  4KD4 A;  4ZQ3 A;  3DHQ A;  2BH8 A;  1J9O A;  1HR0 L;  1LTA D;  3DUZ A;  1XMQ L;  1SMY C;  4XTC S;  3M7N A;  2R6G A;  4MHE A;  2LS0 1;  2K14 A;  4APV A;  4L5R C;  2E2H H;  1HFN A;  4WJW A;  4QIW E;  2A68 C;  1DGS A;  1Y14 B;  2LFN A;  4LFA L;  1DOM A;  4A3B B;  3OWE B;  4B3T L;  3OTO Q;  1WD1 A;  1JQY D;  3D0F A;  3K5L A;  1LTB D;  4BA1 I;  4FP5 D;  5AJ3 Q;  4DXG A;  1K83 B;  4PZ6 A;  2NVY H;  3HOY B;  4R4Q A;  1EY0 A;  2A8V A;  4EVO A;  2PZW A;  1HZA A;  4ODG A;  1A3T A;  1HJP A;  1FNV A;  4RKL A;  4QCL A;  3R3O A;  1A6X A;  1STY A;  1EQR A;  1E2Z A;  2NTT A;  3OW7 A;  1QG7 A;  4XQN A;  1SRO A;  2R92 B;  3DM3 A;  2PZT A;  1B9N A;  1KD1 C;  1GUW A;  5GAE C;  4KLK A;  2C35 B;  2HHH L;  2PQA B;  2EYF A;  4A3I H;  1JJG A;  3BG3 A;  5CV6 A;  1VQK A;  1X3Q A;  1E0B A;  2F4I A;  1YNN C;  4JI6 L;  5HY6 A;  2E2J H;  5KNB A;  1S40 A;  3CQZ H;  3OWF A;  1OXU A;  4KHV A;  3SK4 A;  3DXJ C;  1UAP A;  4J1M A;  1TU2 B;  2B39 A;  2ZXR A;  2WB1 B;  1EIG A;  4K8J A;  3T13 A;  2B2Y C;  1C7Y A;  4DU9 A;  2IY5 B;  5K36 G;  1X56 A;  1S5D D;  4X3T A;  5IYD G;  2CKZ B;  4IFD I;  5FK9 C;  4BXX G;  3OHX C;  3RUZ A;  2HD3 A;  3GP7 A;  1EYA A;  4OEM B;  2NN6 G;  2F3I A;  4J8Q A;  4NMZ A;  2I07 B;  3A0J A;  1RJT A;  4QF4 A;  4JI6 Q;  1OO9 B;  3GTO B;  3M4Q A;  1ZXT A;  1JB7 A;  3JAM i;  2BA0 A;  4YCU A;  3R8B A;  4CBV A;  4KHP L;  3TBI B;  1EIF A;  2OCE A;  3TS0 A;  2I5M X;  4JI4 L;  2EY2 A;  3HZX A;  4WFN 3;  1ESR A;  2RA4 A;  1D5X C;  2RDH A;  2E5L L;  1B2T A;  2EJM A;  2KHJ A;  3BDL A;  1KHI A;  2K5D A;  5D14 A;  1S5F D;  4Q5V A;  1JMC A;  4Y52 H;  5C4J B;  3BJU A;  2VQF Q;  2AKW B;  4OIK A;  4KHZ A;  1GUN A;  1PV4 A;  3SK6 A;  1VS0 A;  2KEE A;  1AZQ A;  5C4H A;  4HJ9 A;  4DV2 Q;  5FLX c;  1PTO F;  5IOC A;  4DR2 Q;  3QG1 A;  1SNM A;  2Z1C A;  4C1N I;  3HKZ B;  3Q24 A;  1C48 A;  2B3G A;  4IUP A;  1IW7 D;  1W3S A;  1VQD A;  2LKV A;  4P71 A;  2E2I H;  1ILP A;  3M4Y A;  3G71 A;  4A3I G;  4JI1 Q;  5FLM G;  3CAM A;  5DM7 3;  1EFI D;  1H9K A;  1SYC A;  1EWH A;  4X65 L;  1KAB A;  1BCP B;  4FF1 A;  1PVO A;  2IHF A;  3AU7 A;  2X6G A;  3TP7 A;  4GN3 B;  1SE4 A;  3KBX A;  1NR4 A;  3QR8 A;  4HIM A;  3KJO A;  1YBY A;  4BBR G;  2NBF A;  1Q3L A;  2YTY A;  5CV8 A;  4LAA A;  3QB3 A;  4KMU C;  3NTH A;  1NE3 A;  3GTK B;  5JOB A;  4K5W A;  3MEF A;  4IFD J;  4BBR H;  1PHJ A;  1M4V A;  2F0O A;  1YNX A;  2CH4 W;  3NPP A;  4G57 A;  1XMO Q;  5I6Y A;  1K8A C;  2VB3 X;  1IBK L;  3HKS A;  2J7Z A;  4AYB G;  2JA8 B;  1PYW D;  2JA8 H;  2K01 A;  3KDF B;  5KYI A;  1A62 A;  1HPC A;  2AWN A;  5IWA Q;  2WII B;  5EPJ A;  2XIW A;  1E24 A;  5KND A;  4JBK A;  4N9T A;  2XWB B;  1TWA H;  5ELD A;  5CGK A;  4IPC A;  1VQ7 A;  2UXB Q;  3VR4 A;  4G7Z C;  3W1B A;  1GOZ A;  2EYJ A;  4XQJ A;  1KNA A;  2FMC A;  4M8A A;  4R4O A;  3MZ5 A;  1CKO A;  4HN7 A;  3HOY G;  4C1N K;  4CJ1 B;  1YJW A;  2VXW A;  1VQI A;  2N3S A;  4JI5 L;  5JVH 3;  4DV0 L;  3I4N B;  1VQB A;  2V4D A;  1LLR D;  2OWO A;  2F0U A;  4KKU A;  4H7B A;  3W3A A;  3AYH B;  1HRJ A;  1KIX A;  2MPM A;  3I4L A;  4EQO A;  3ICE A;  3TP8 A;  1E1T A;  1CHP D;  4LF7 Q;  1HQR D;  4DK3 C;  1IBM L;  1P8L A;  1HNW Q;  1CKN A;  4JI7 Q;  3KUP A;  3VYU A;  3GTM B;  2F0V A;  1VMP A;  3TS2 A;  2PNR C;  2HQE A;  3NQT A;  3S1M B;  1EQQ A;  2XSC A;  1UE6 A;  1JOO A;  2UXC L;  3KK7 A;  3WWV A;  1U9R A;  2R7D A;  4GLX A;  1KDC A;  3CCL A;  4XYQ A;  4OL7 A;  1UE7 A;  4C3H H;  3L3O C;  2R61 A;  4TVA B;  1FR3 A;  2XRS D;  3CMA A;  3NBH B;  1Q81 C;  4LF4 L;  1LYL A;  1EWC A;  3EBE A;  3T51 B;  1OXX K;  4YWM A;  3M3Y H;  2BDN A;  4B3R L;  4KN7 C;  5DNF A;  3HEJ A;  3ITP A;  2JA6 G;  4V0B A;  2B2U C;  2HDM A;  2K5V A;  4YHH Q;  1T5E A;  1D5Z C;  3GTM H;  3P1H A;  2FHT A;  4L5Q A;  1STA A;  1J5E Q;  1WYD A;  3OMC A;  3S1R B;  2WAQ E;  2JQO A;  5D3D A;  1FYC A;  3S14 B;  2IX3 A;  1KRS A;  3S15 B;  4B08 A;  3HFZ B;  5GAH C;  3OSO A;  3O13 A;  1VQM A;  2R7Z G;  4UP8 A;  4CJ0 B;  3KOJ A;  5C4Z A;  5C3E G;  1XMO L;  5IP7 G;  1IBM Q;  2DGY A;  5DM6 3;  3RZO H;  2OXP A;  2R92 G;  2F0T A;  4O0A A;  3NTK A;  5LL6 S;  3F2C A;  1YNJ C;  2LY7 A;  1PH3 A;  4DR1 L;  1AN8 A;  1WTX A;  1TWA B;  1EEI D;  1SR3 A;  3CPW A;  3AFP A;  3KLR A;  4MNO A;  3K57 A;  2QW7 A;  4K6D A;  3VR6 A;  2D0O A;  3RN5 A;  4XYO A;  3HOV B;  5E4X A;  4A3I B;  3TRE A;  5FJ8 H;  4LF8 Q;  4DA2 A;  4DR5 Q;  2NB0 A;  5J3B A;  2R7F A;  2PCF B;  1YNN D;  2XGT A;  2NZ1 D;  1YZ6 A;  1WTW A;  1O7L A;  2B2W C;  4PNY A;  1PH6 A;  1SNQ A;  1N32 L;  2V1C C;  1D1K A;  1C4Q A;  1Q8K A;  2F0S A;  3KDF A;  5C4X B;  4IUQ A;  4N8X 1;  4BBR B;  4EQP A;  4KKT A;  3D6W A;  1I4X A;  3V2T A;  1WI5 A;  4GNX B;  3MXU A;  2OEO A;  1MSH A;  5I9P A;  3HOX H;  4XT1 B;  3CCS A;  1F2Z A;  2QGQ A;  5LMU Q;  4TSS A;  1S72 A;  1A2T A;  3ULL A;  2C5C A;  2KUM A;  1STH A;  1ICW A;  2NZH A;  4LFB Q;  1TVX A;  2UU9 L;  4LF5 Q;  1BDO A;  1I4H A;  2Q8R E;  4RGT A;  2B63 G;  5KYL A;  4BBS G;  3HKZ E;  4UY8 C;  3BZD B;  4JYA Q;  2M00 A;  2B8F A;  5JPN C;  3H94 A;  5LL6 X;  4DV7 L;  1LO5 D;  1PH2 A;  4IPG A;  1A63 A;  5FJ8 G;  4X6A H;  3HRZ C;  1PH5 A;  5E4W C;  3EA6 A;  4JI0 Q;  3PV0 A;  1IKM A;  3HKZ G;  5HGT A;  4JI8 L;  4FNF A;  1Q1B A;  1HTL D;  3KF8 A;  1AFP A;  2GVB A;  3SXH A;  2K03 A;  4BBS H;  3X3N A;  3D4D A;  4R4I A;  4IUR A;  3CD6 A;  3UE0 A;  2LXJ A;  1GXD C;  2ZJQ A;  4PMW A;  3HOW H;  3VR2 A;  1WTH A;  4G7H C;  2B8G A;  1Q90 A;  2G5D A;  5CR3 A;  4HIK A;  3FEW X;  1NNX A;  1XNQ L;  5M3F H;  1HZ9 A;  3U58 A;  1R9T B;  1LAC A;  1BBX C;  2CQO A;  3J80 i;  4OWW B;  2JA6 B;  2MQH A;  4C2M B;  4CGY B;  4DV4 L;  1CA5 A;  4JI8 Q;  4QB4 A;  1F9Q A;  1H9R A;  2NTS A;  3PSI A;  4HR7 B;  4N8F A;  3F8T A;  3VA7 A;  4LNQ A;  1WCM G;  1SAP A;  1EU3 A;  2KCT A;  4OWX B;  1ZEQ X;  1SLJ A;  4RCO A;  3L7Z C;  4LF4 Q;  3F2B A;  3S2D B;  2QEJ C;  4GOP B;  1IBL L;  3IAY A;  3I72 A;  3ULJ A;  1PH7 A;  2F0F A;  2A74 C;  3EN2 A;  1I4Q A;  1TWG H;  3E0J A;  5EKI A;  1LT6 D;  5KIX A;  3I4O A;  3J81 E;  2HCI A;  2UXD L;  3CCQ A;  1J8I A;  3WOF A;  1MJE A;  4M1U B;  1QB5 D;  2E2J B;  1HNW L;  1E3P A;  4FYD A;  2PW5 A;  5DLQ E;  2NYZ D;  3UDG A;  5ELN A;  1W2B A;  5IT9 c;  5EAY A;  3OPO A;  3M9B A;  5M5X H;  5EPL A;  2K5Q A;  1SN8 A;  5EPK A;  4DV3 L;  3FHW A;  2KCC A;  4PMC A;  3STB D;  1HR0 Q;  1D5M C;  4JC0 A;  4DV0 Q;  4JI5 Q;  3I91 A;  3I4N G;  4TKO B;  5C5L A;  1BKB A;  3PUW A;  5C0X H;  4C56 C;  2JP1 A;  2NN6 H;  4NXN L;  2K1B A;  4JYA L;  1HTP A;  1CK1 A;  2K7V A;  2FJ2 A;  2NVY B;  4NXN Q;  3HOY H;  3RMH A;  4X3K A;  1BCP F;  1EY5 A;  4XDX A;  1H9S A;  3HOU B;  4LUO A;  4DR7 Q;  3J7Y W;  2KQ3 A;  4C3I H;  4BS9 A;  3RD4 A;  1NSN S;  4PMB A;  1PRT D;  1XNR L;  4A3B H;  1JWS D;  2F4V Q;  1UEB A;  2RVL A;  3U9O A;  1PZK D;  1GJX A;  3I8Z A;  1CFM A;  2I46 A;  3DWA A;  1GHJ A;  3CCE A;  2CFM A;  3W1G A;  4A3J H;  1VQA A;  5GQO A;  1NBW A;  2F0E A;  2B2V A;  2B63 B;  1SDF A;  1PFS A;  4H02 A;  1K0S A;  1FNW A;  4QIW B;  1Z9F A;  1SBB B;  2IT1 A;  3S1Q B;  1SYD A;  4MZ9 A;  1A15 A;  1G51 A;  2FFK B;  1D7Q A;  1HA5 A;  1TWH B;  3H0G B;  1JWU D;  3I73 A;  2HHH Q;  1YEZ A;  3J7Z C;  2EPB A;  2DJG C;  2BE5 C;  3TRZ A;  3VYT A;  3CF5 A;  4XIG S;  3A74 A;  2VB2 X;  3CPF A;  4JI4 Q;  2IPK D;  2R7Z B;  2EY1 A;  3I2Z A;  3UE1 A;  5C3E B;  3C1F A;  1L2F A;  3NQI A;  4RCN A;  3PQI A;  1N8R C;  2JK8 A;  2RCN A;  1L0W A;  1PRT C;  4C3J H;  4JI1 L;  3P75 A;  2QKI C;  5IGD A;  4RHS A;  1AE2 A;  2EYP A;  2X6L A;  3H15 A;  4FF2 A;  3EFX D;  2L11 A;  3CHB D;  3NSW A;  4R9W A;  3JC6 6;  1JR0 D;  2OTL A;  1ILQ A;  1YIT A;  5M5W H;  4CDF C;  3QWN A;  4GKK Q;  3NBH A;  4JK1 C;  4JBM A;  2NVQ H;  2PI2 A;  1G6Z A;  1Q12 A;  3BYT B;  3U4V A;  4EGV A;  4GOP C;  5FLX L;  1XPO A;  5LHY 1;  4RA8 A;  3CC7 A;  1PA6 A;  3ND8 A;  4KY6 A;  4NW2 A;  3C2P A;  1NTG A;  5G3L D;  1B3A A;  2MNA A;  1F9S A;  3JAM L;  5M5X B;  1T5X D;  1ZYR C;  3DEO A;  2JA9 A;  3MA2 B;  2JXM B;  4DK6 C;  2B2W A;  1PMR A;  1QUQ A;  5GAD C;  1NCV A;  2KVM A;  3IL8 A;  4A3B G;  2L0C A;  3I7F A;  4H44 C;  1JOR A;  5ISR A;  5IWA L;  1V43 A;  3MTS A;  1KDA A;  1Z6H A;  4HID A;  2AQ2 B;  1NMF A;  3TZU A;  3J81 c;  1X9N A;  4R8I A;  1CZG A;  1PYS B;  2YTX A;  4B3T Q;  5IT9 L;  5JPM C;  4IOA A;  2CQA A;  1STG A;  2HQL A;  3NK9 A;  2AQ1 B;  3OIQ A;  4IUT A;  3K8A A;  4HJ5 A;  4AQY Q;  2SNS A;  4TRD A;  3PUY A;  4A93 H;  4A3D B;  2ES2 A;  1YVC A;  1EEF D;  2L12 A;  3HOU G;  1RD9 D;  3PO3 G;  1JIC A;  2K52 A;  2ZT9 C;  1G2S A;  5C44 H;  1F77 A;  3ERQ A;  2JA6 H;  2HIX A;  4JG2 A;  4YIJ A;  4GKJ Q;  4X3S A;  1K8O A;  1R4P B;  4DAP A;  3RZD H;  2WB1 G;  4MTN A;  4X3U A;  2VQE Q;  4DUY Q;  1N34 Q;  4BWG B;  1C8C A;  1S3O A;  3RN2 A;  2A1A A;  4LJZ C;  4CDE C;  3K6O A;  3OMG A;  2VUM G;  5CBE E;  1UE5 A;  2N49 A;  2F0G A;  1I94 L;  1EIH A;  1B50 A;  4K5X A;  3F1Z A;  1I4R A;  1IKL A;  2ZXP A;  2X69 A;  1QJO A;  2Y0S B;  4DV5 L;  4V19 0;  5J1Z A;  2PMZ B;  5LMN Q;  1YHQ A;  1WCM B;  4NXM L;  1HNZ L;  4CKE A;  4HJ7 A;  3ULP A;  3TSS A;  5AFW A;  3W2D A;  2K50 A;  4IZ8 A;  1EQV A;  4RKB A;  3PIP A;  3D4W A;  3NEN A;  4P2C B;  4IO9 A;  1YJN A;  3PO2 G;  1IHZ A;  4L63 B;  3T56 B;  4LWC A;  4MIU A;  4DUY L;  1JWM D;  1R4Q B;  3BVM A;  3HOZ G;  2CW0 C;  4A3L G;  2N8N A;  1I5F A;  2Y0S E;  1EY9 A;  2NVX B;  1B4O A;  4GKJ L;  3S2H H;  3FRP B;  2ZTD A;  4BY7 G;  4LF9 L;  2R7Z H;  2Z9H A;  2D2C C;  4DV6 Q;  3H0G G;  3S9W A;  1PYB A;  1A0I A;  1N33 L;  3SK8 A;  2DNC A;  1KRT A;  1VDZ A;  3F2D A;  1RCV D;  1HQM C;  4CDC C;  2WAQ B;  4YCW A;  1I50 B;  5IE8 A;  2F0H A;  3A54 A;  2L9H A;  1EY8 A;  1BO0 A;  5ELF A;  1TR5 A;  2R93 G;  2WP8 J;  1M8A A;  4FF3 A;  4JI3 L;  2B2T C;  1BR9 A;  3X3M A;  5DEH A;  1QVF A;  3HOV H;  3ZYY X;  1VQJ A;  3K81 C;  1MJC A;  2D62 A;  1GD7 A;  3TP6 A;  3PIP 3;  3G6E A;  1ICF B;  3TQY A;  1DJR D;  1LM0 A;  3SHL A;  1TQO A;  2QIL A;  3QJY A;  1IW7 C;  1KNE A;  3MFG A;  1U4L A;  1ROD A;  1ML0 D;  2F0D A;  1KTK A;  3IRB A;  1MHW C;  1VQO A;  4UAI A;  1KXL A;  5H1S E;  2AUJ D;  1X3F A;  1L1O B;  5JEA G;  3CCR A;  1GUO A;  4KTA A;  1WTR A;  3D8G A;  4AYB B;  1AE3 A;  2B2T A;  1TWF B;  4P72 A;  4NKL A;  5T1I A;  2JJQ A;  1V8Q A;  3A7L A;  1UWV A;  4GKK L;  2Q2H A;  3U9S A;  5D3I B;  1B44 D;  3PGZ A;  1H9M A;  3GTP H;  1XWE A;  4B3S Q;  5IYB G;  2A69 C;  1B1Z A;  2VL6 A;  2QDB A;  2F3W A;  2RBM A;  4AIM A;  1HCZ A;  1KLG D;  1PLF A;  5EGT A;  5JJI A;  3BDO A;  3HGB A;  2EY6 A;  4IQZ A;  2EXD A;  2OT2 A;  2Z6K C;  3MXN B;  4C3H B;  2VUM B;  1Y1W G;  2VW9 A;  1IL8 A;  2RHS B;  5IY0 A;  3D4R A;  3M85 A;  4QGU A;  5IGC A;  1EYC A;  1JB3 A;  1QE6 A;  1UEA B;  3KBG A;  4DR6 L;  3L0O A;  1AP0 A;  1BUV T;  5C0X J;  4KK7 A;  1IYV A;  3CCM A;  2ENB A;  1G6P A;  2N78 A;  1STB A;  4QL5 A;  4O42 A;  3PO3 B;  4LFB L;  2IHE A;  3KF6 B;  4S3S A;  5A2Q E;  3K59 A;  1QIL A;  2VS1 A;  4FXK C;  3D3R A;  1EY6 A;  4OIJ A;  4HCE A;  1KAW A;  4A3J G;  1CKN B;  1JC7 A;  5BR8 Q;  1Y1V H;  1D1I A;  1AEX A;  3C46 A;  1BQQ T;  1GUT A;  3Q22 A;  4K2K A;  4NXM Q;  3GTQ H;  1XTC D;  3PO2 B;  1U4P A;  3RLF A;  5GAG C;  1V1P A;  4OXP A;  4C3J B;  1NUC A;  3A5U A;  3GQB A;  1QVC A;  2A5H A;  1R9T H;  1KC8 C;  1QUQ B;  4JV5 L;  3NTI A;  5FKA C;  1K8M A;  2VQF L;  4BY7 B;  2PI2 E;  2YV5 A;  3I3C A;  2Y0S G;  1SEB D;  4K2L A;  4R4T A;  1MGS A;  2E5L Q;  4DV7 Q;  2NVT H;  4HMJ A;  1SMX A;  4JOI C;  4ULL A;  2IX1 A;  2O4X A;  4YWK A;  4DR6 Q;  1TWC B;  3SE0 A;  4HCS A;  4IJL A;  4QQB X;  3AEV A;  4ZKB B;  4EQN A;  4LF6 L;  4AYB E;  2RSO A;  2PW7 A;  1DOL A;  4K5V A;  1MD2 D;  1KAA A;  3S24 A;  5M3M B;  5ELO A;  2ZXO A;  1YI2 A;  4A3D G;  1VQ5 A;  1Q46 A;  1KL9 A;  1HH2 P;  4B3M L;  2BCO A;  3VA5 A;  1LUZ A;  2ZTC A;  3DLL A;  1LV9 A;  3P20 A;  5I6W A;  3GTK H;  1TS5 A;  2ZM6 Q;  4P73 A;  1S5B D;  1HXY D;  3J7A 5;  4NB3 A;  4J6H A;  3HOU H;  3MHB A;  2K5W A;  1VQE A;  2WV6 D;  2K4K A;  4DFA A;  4KN4 C;  5C44 G;  1ET6 A;  2D5D A;  1L0X B;  2K05 A;  4C3I G;  1Y8O B;  2EQS A;  3EVQ A;  3EIV A;  2KOL A;  3E6Z X;  1H9S B;  2CHB D;  4A3C G;  2BE5 D;  2UXB L;  2KEN A;  2KBN A;  4I7Z C;  1M1K C;  1HUN A;  2KED A;  4UPA A;  1HFG A;  3LWU A;  2AHO B;  3W5O A;  5FOB B;  2BOS A;  1K73 C;  1JE4 A;  3MFY A;  4G7O C;  2BDO A;  3U50 C;  4DV3 Q;  4BY1 H;  3WDN A;  5K5P A;  4HED A;  5FO9 B;  5LMU L;  2F0K A;  3IKJ A;  1D6E C;  5C3W A;  4C3H G;  3P7J A;  5ELC A;  1Y1W B;  3T1Y L;  3MXN A;  1VQG A;  2JA7 H;  3K5N A;  4DN4 M;  5FO7 B;  3K0Y A;  5HGQ A;  4K8I A;  1EYD A;  3E9H A;  4Z9C B;  2RCF A;  4JBJ A;  4DR3 Q;  3LGJ A;  1TKW B;  1LTS D;  2H4O A;  2GN5 A;  5CV9 A;  4A3G G;  1B53 A;  1W6K A;  1OTC A;  4RFB A;  2Q2U A;  4X66 L;  5JJZ A;  2UUB Q;  4RGM A;  1CHQ D;  4JI2 Q;  3KLW A;  4KY5 A;  5NUC A;  3VDY A;  3M4P A;  1PZJ D;  5COY A;  4G4K A;  1G91 A;  3PIO 3;  2CH4 A;  1ENF A;  3NEM A;  3S15 H;  5ELE A;  4MN3 A;  4LF6 Q;  1GM5 A;  1EQT A;  1EWI A;  1BXT A;  1F2L A;  2JE6 I;  3GDE A;  4JW0 A;  1IL2 A;  3VR5 A;  1MI2 A;  2WAQ G;  1X55 A;  4KV6 A;  4GN5 A;  3FKI B;  1Y8N B;  2E76 C;  2KCN A;  4C2M H;  3QOL A;  2IL8 A;  2R93 B;  1PH8 A;  2F52 A;  1CTM A;  5CMD A;  5I2X A;  2E75 C;  1TII D;  4KD3 A;  1VQP A;  1Y1W H;  3VYR A;  2B2V C;  1SSO A;  3PCO B;  4ZCK A;  4JI2 L;  4A4I A;  1V9P A;  3DEP A;  3A56 A;  1PH9 A;  3A7A B;  5J22 A;  3HOW B;  2JA5 B;  5HUR A;  4DUZ Q;  3QO2 A;  1A3V A;  2OQ0 A;  4XQQ A;  1JJC B;  1GUS A;  1TS4 A;  4X62 L;  4B3S L;  4OX9 L;  3G4S A;  2YYZ A;  1Q82 C;  1K9M C;  2R92 H;  2KEC A;  1CUK A;  3SR1 A;  2UXD Q;  1Q1E A;  3UDX A;  2SDF A;  4F7X A;  1SE3 A;  4ZKC B;  3K0X A;  2E74 C;  2WAC A;  1EY4 A;  3ZJY C;  1Y69 U;  4IFD H;  1B3Q A;  3LNN A;  4QY7 A;  3CW2 C;  1DXM A;  5IOD A;  3J80 L;  1SYG A;  1K83 H;  4C3J G;  2K32 A;  3DWP A;  4PQX A;  2ZTE A;  1AZP A;  4A3K B;  1ENA A;  1XYI A;  5CYU A;  3T16 A;  1T9H A;  4WJ3 M;  3I4N H;  2Q2I A;  3STB C;  3S16 H;  1KQS A;  2IWH A;  3URY A;  5IYC H;  1E2V A;  1Y8P B;  3SVM A;  1Q86 C;  3HOX B;  2DUD A;  5L37 A;  3BZK A;  4Y7N B;  3ONA B;  3RR5 A;  4ALP A;  2M9V A;  1JCK B;  1BCP C;  1RL2 A;  2F0Q A;  1DCZ A;  2Z8L A;  2A68 D;  1WD0 A;  5BN5 A;  5IP7 H;  5M9O A;  3QIA A;  2AUK A;  4OWT B;  2O2L D;  4LUZ A;  4HTH A;  3CXC A;  4CJ2 C;  1DOK A;  4ZAI A;  1QNK A;  3GO5 A;  2C9O A;  4H0L C;  4R4C A;  1WOC A;  3GTJ H;  1LTT D;  1YHB A;  3LX0 A;  3KF6 A;  5FLX E;  2F1M A;  1HZB A;  3IFT A;  1XMQ Q;  3N6R A;  1N33 Q;  2L4N A;  1VF5 C;  2L15 A;  3I4M B;  4DR7 L;  1L1O A;  2N55 A;  1SXT A;  4P75 A;  3B6Y A;  2B63 H;  1PTO H;  1SNP A;  2DNE A;  1PTO C;  2EVB A;  4P74 A;  2F0M A;  4A3J B;  4TQU S;  3T1H L;  1UNS A;  2QCP X;  4B3R Q;  1U5K A;  1TY0 A;  4MTK A;  2OF1 A;  2ZJP A;  4DAV A;  4PZ7 A;  1X65 A;  3PO2 H;  3V05 A;  3RZO B;  4DR1 Q;  4KKS A;  2UUA Q;  4C3I B;  4K0K Q;  2N88 A;  2UXC Q;  2A19 A;  4IFD G;  3S14 H;  3NE5 B;  1FGU A;  4OON A;  3GV3 A;  3C3L A;  3L9A X;  3S1R H;  2RDF A;  1NR2 A;  2ZM6 L;  3PUZ A;  3K7A B;  1EU4 A;  2MO0 A;  4XXE A;  1TT2 A;  5I2Y A;  2LXK A;  4X64 Q;  2F0I A;  1PTO D;  2PZU A;  3MXP A;  1JE5 A;  4DV2 L;  2E2I B;  1V1Q A;  3FKI G;  1SYF A;  3K58 A;  1V1O A;  1F2M A;  2JN4 A;  1PRT F;  2JEB I;  4L5T A;  3CCU A;  3C1E A;  1EOT A;  1FL0 A;  3I90 A;  1SNC A;  2JSO A;  2VUM H;  1GHK A;  2QF7 A;  5M3M G;  2G9D A;  2F0P A;  1X32 A;  5K36 H;  3J80 E;  5IGG A;  2E2D C;  2CVR A;  5DAU A;  3HOW G;  3TEH B;  5C4J H;  3MVV A;  4CKB A;  5JJK A;  1D8L A;  2CCZ A;  2NZO A;  3CKI B;  3S1M H;  1PFN A;  1RTO A;  1N36 L;  4HSP A;  1TWG B;  3SEB A;  1VQH A;  3FVQ A;  3OW2 A;  1V1P B;  3FKI H;  1KLU D;  1Y1V G;  4NP5 A;  3K5O A;  4ID6 A;  3UDF A;  3S2D H;  2PYK A;  1WVL A;  1FGB D;  1BVS A;  2WIN B;  3DMU A;  4U68 A;  1HR0 W;  1L1O C;  3PUX A;  1UUP A;  4DR4 Q;  4X64 L;  2NN6 I;  1WTP A;  3GTO H;  2K6A A;  2K33 A;  1OXV A;  3J81 L;  4JI7 L;  2EE1 A;  4A3F H;  1CSQ A;  1STN A;  4IUN A;  4A3K G; 
#chains in the Genus database with same CATH homology
 2D62 A;  1GD7 A;  3RZO H;  4J15 A;  2R92 G;  1ASY A;  1CSP A;  4BY7 H;  1IXR A;  1E22 A;  2CWA A;  4O0A A;  3G6E A;  1N9W A;  3JAM c;  3TQY A;  3F2C A;  4K0K L;  1XNR Q;  1PH3 A;  1LM0 A;  4DR1 L;  1VQ8 A;  3CCV A;  1I3Q H;  1SFO H;  3HOZ H;  4A3L H;  1N36 Q;  4POG A;  4BY1 G;  1SR3 A;  3CPW A;  1NJI C;  3AFP A;  4MNO A;  1P16 A;  1GKH A;  3A5Z B;  3L2P A;  2I0Q A;  1VQ6 A;  1TXY A;  2VQE L;  2MFI A;  3KJP A;  3IRB A;  2D0O A;  3RN5 A;  1Z47 A;  2KHI A;  1VQO A;  3TRE A;  1KXL A;  5FJ8 H;  5H1S E;  4LF8 Q;  1JT8 A;  4LF5 L;  4A3E G;  1X3E A;  1X3F A;  1L1O B;  5JEA G;  3CCR A;  4A75 A;  4DR5 Q;  4X65 Q;  4DAM A;  1JJ2 A;  4A3D H;  4DNI A;  5J3B A;  2R7F A;  2XGT A;  1AE3 A;  5FLM H;  1YZ6 A;  1CKM A;  3J80 c;  2QEX A;  1A8V A;  2UUC L;  3ERS X;  3PO3 H;  4P72 A;  1PH6 A;  1RIP A;  2H5X A;  1N32 L;  2OQK A;  3H3V I;  2V1C C;  2JJQ A;  1Q8K A;  3KDF A;  4OO1 G;  1B70 B;  4RG1 A;  2PNH A;  1UWV A;  4GKK L;  2Q2H A;  1C9O A;  1VQF A;  3OTO L;  3PGZ A;  3GTP H;  1WJJ A;  3I4M G;  1A63 A;  4B3S Q;  1WI5 A;  4GNX B;  2AWO A;  2E8G A;  5IYB G;  1K3R A;  1VQL A;  2Z6K A;  3HOX G;  3I56 A;  2VL6 A;  3E0E A;  4DR4 L;  1K8G A;  1SE8 A;  3KYH C;  3HOX H;  2VNU D;  1IYJ B;  2K5N A;  4AIM A;  3CCS A;  5JJI A;  2QGQ A;  3GTG H;  5LMU Q;  1S72 A;  4GNX A;  2EXD A;  4WJ4 A;  1FJG L;  2WFW A;  1MIU A;  2Z6K C;  3ULL A;  1N32 Q;  3MXN B;  2NZH A;  1Y1W G;  4YHH L;  2LSS A;  4LFB Q;  2VW9 A;  5IP9 G;  2RHS B;  1LTL A;  5IY0 A;  3M85 A;  2UU9 L;  4QGU A;  4LF5 Q;  2B63 G;  3RLN A;  3HKZ E;  4BBS G;  4UY8 C;  2JA8 G;  1EYG A;  1HNX L;  4DR6 L;  3L0O A;  4JYA Q;  4R1J A;  2JA5 G;  4IPD A;  1WCM H;  5C0X J;  2GVA A;  4DV7 L;  4IPG A;  1VCI A;  2D0P A;  4GN4 B;  1EUJ A;  3K7A H;  4EQ5 A;  5C4X H;  5FJ8 G;  4HJA A;  4X6A H;  1PH5 A;  3CCM A;  1G6P A;  2N78 A;  1O7I A;  1TWC H;  4QL5 A;  2UU9 Q;  4JI0 Q;  3PV0 A;  4A3M G;  3HKZ G;  3PF5 A;  4JI8 L;  4LFB L;  5JEA J;  1HNX Q;  2IHE A;  3KF6 B;  2XTI A;  1Q1B A;  1OXT A;  2VS1 A;  2GVB A;  2K5H A;  4BBS H;  1I6H H;  3S1N H;  1KAW A;  2MO1 A;  1CKN B;  4R4I A;  4A3J G;  1VQ4 A;  3CD6 A;  5BR8 Q;  3UE0 A;  1Y1V H;  1X54 A;  2LXJ A;  2JA5 H;  4BXX H;  1ASZ A;  1YHA A;  2ZJQ A;  4PMW A;  2WB1 E;  4NXM Q;  3GTQ H;  3HOW H;  3K7U C;  1PH2 A;  3PUV A;  5LMN L;  3RLF A;  5GAG C;  2EIF A;  4OXP A;  1EFW A;  2IX0 A;  4DR2 L;  4OO1 I;  3A5U A;  4HIK A;  1QVC A;  1R9T H;  5M3F H;  1XNQ L;  1HZ9 A;  3U58 A;  3M4O H;  1KC8 C;  1QUQ B;  2ATW A;  3PF4 A;  5C3E H;  1EIY B;  1BBW A;  4DAY B;  1WFQ A;  2CQO A;  3J80 i;  4OWW B;  4JV5 L;  4JBW A;  1K0R A;  1E1O A;  2F4V L;  4JOI A;  2MQH A;  2VQF L;  1I94 Q;  2PI2 E;  2UUC Q;  4AH6 A;  2YV5 A;  2VY3 A;  2Y0S G;  4NPS A;  1GO3 E;  4PG3 A;  4DV4 L;  1C0A A;  1B7Y B;  4A3M H;  4R4T A;  4JI8 Q;  1QZG A;  3G48 A;  1E7Z A;  4QJF A;  2YU9 H;  4LF9 Q;  3PSI A;  4LF8 L;  2E5L Q;  3F8T A;  1N34 L;  4LNQ A;  1WCM G;  4DV7 Q;  2NVT H;  2KCT A;  4OWX B;  1TWH H;  3H0G H;  1SMX A;  1M90 C;  4JOI C;  2IX1 A;  2ALY B;  3H3V H;  2AMC B;  2RF4 A;  4GLA C;  4YWK A;  3T1H Q;  4DR6 Q;  5C0X G;  1SLJ A;  4LUV A;  1QZH A;  3KFU A;  3L7Z C;  2CWP A;  3F2B A;  4UP7 A;  3CC2 A;  4IJL A;  4LF4 Q;  4GOP B;  1IBL L;  3AEV A;  4QQB X;  4LFC L;  4LF6 L;  4AYB E;  3ULJ A;  1VQC A;  2BH8 A;  3RNU A;  1PH7 A;  4DV4 Q;  1BBU A;  3EN2 A;  1TWG H;  1XMQ L;  1HR0 L;  3S24 A;  2Q2T A;  5ELO A;  4XTC S;  1YI2 A;  4A3D G;  3M7N A;  1VQ5 A;  2R6G A;  4X66 Q;  1Q46 A;  3D31 A;  1KL9 A;  3I4O A;  1FJG Q;  1HH2 P;  2UXD L;  2K14 A;  4APV A;  4B3M L;  2E2H H;  2KCM A;  4L5R C;  3CCQ A;  4KI0 A;  1LUZ A;  2ZTC A;  3DLL A;  1MJE A;  4QIW E;  3GTK H;  1DGS A;  1PH4 A;  4DKA C;  5JJL A;  4LW1 A;  1Y14 B;  1VQ9 A;  2ZM6 Q;  4A3K G;  4X62 Q;  4LFA L;  1HNW L;  1E3P A;  4P73 A;  4B3T L;  3OTO Q;  5DLQ E;  1EOV A;  3J7A 5;  3UDG A;  3D0F A;  4NB3 A;  5ELN A;  1W2B A;  3OYY A;  5IT9 c;  5EAY A;  5BR8 L;  3HOU H;  4BA1 I;  1VQE A;  1XTD A;  3M9B A;  5M5X H;  5AJ3 Q;  2HIV A;  2K4K A;  4PZ6 A;  4DV3 L;  1SN8 A;  3FHW A;  1IZ6 A;  2NVY H;  5C44 G;  4R4Q A;  3STB D;  1HR0 Q;  2A8V A;  4JC0 A;  4DV0 Q;  4JI5 Q;  3I4N G;  1HZA A;  1HJP A;  4O2D A;  2EQS A;  1BKB A;  3PUW A;  3EIV A;  3NEL A;  1EQR A;  1TWF H;  4NXN L;  4A3C G;  1SRO A;  3DM3 A;  2UXB L;  4JYA L;  2KEN A;  4NXN Q;  3HOY H;  2KBN A;  4GOP A;  4GNX C;  1M1K C;  1KD1 C;  2K75 A;  5GAE C;  4UPA A;  4KLK A;  2C35 B;  2AHO B;  4LUO A;  2PQA B;  3W5O A;  4A3I H;  2HHH L;  4DR7 Q;  4KHP Q;  4C3I H;  1JJG A;  4BA2 I;  1VQK A;  2I5H A;  1K73 C;  4JI6 L;  1XNR L;  4A3B H;  5HY6 A;  2E2J H;  3U50 C;  4DV3 Q;  2F4V Q;  3J81 j;  1S40 A;  3CQZ H;  1X6O A;  1UEB A;  4BY1 H;  1OXU A;  3GTL H;  1AH9 A;  3KF8 B;  5LMU L;  4KHP L;  3RLO A;  4DR3 L;  1XNQ Q;  4IOC A;  3T1Y L;  3CCE A;  2CFM A;  3W1G A;  4A3J H;  1VQA A;  3BU2 A;  4A3F G;  4OX9 Q;  1VQG A;  5GQO A;  1NBW A;  4DV1 L;  1C7Y A;  2JA7 H;  1X56 A;  2PMZ E;  2IY5 B;  5K36 G;  4A93 G;  5M3M H;  5IYD G;  5HGQ A;  2CKZ B;  4L5S A;  3I4M H;  4IFD I;  3E9H A;  1PFS A;  4BXX G;  4H02 A;  4DUZ L;  4JBJ A;  4A3C H;  4DR3 Q;  3LGJ A;  2NN6 G;  2F3I A;  2GN5 A;  4A3G G;  4WJ3 M;  3Q8D A;  1Z9F A;  1OTC A;  2IT1 A;  2Q2U A;  3A0J A;  4MZ9 A;  4X66 L;  2UUB Q;  1G51 A;  4JI2 Q;  3KLW A;  3VDY A;  4JI6 Q;  1D7Q A;  3M4P A;  3M4Q A;  1JB7 A;  3AQQ A;  1Q7Y C;  3JAM i;  2BA0 A;  3NEM A;  3S15 H;  3ER0 A;  4YCU A;  4DV6 L;  4LF6 Q;  4LFC Q;  1GM5 A;  1EWI A;  2JE6 I;  5C0X I;  2HHH Q;  3GDE A;  1EIF A;  4JI0 L;  1YEZ A;  2OCE A;  3J7Z C;  3PIO A;  3TS0 A;  3S1Q H;  1IL2 A;  2I5M X;  5IP9 H;  4JI4 L;  2WAQ G;  1X55 A;  1G29 1;  4GN5 A;  3TRZ A;  3CF5 A;  4XIG S;  3A74 A;  3CC4 A;  4C2M H;  3CPF A;  4JI4 Q;  1PH8 A;  2F52 A;  2E5L L;  2KHJ A;  3I2Z A;  3UE1 A;  3BZC A;  1KHI A;  1L2F A;  1VQP A;  1Y1W H;  4Y7N H;  1N8R C;  4IJH A;  2JK8 A;  1JMC A;  4Y52 H;  2RCN A;  1L0W A;  3PCO B;  4JI2 L;  4C3J H;  3BJU A;  2VQF Q;  2AKW B;  4JI1 L;  4HIO A;  2UUB L;  4A4I A;  1H95 A;  1V9P A;  5AJ3 L;  4KHZ A;  1PH9 A;  1AE2 A;  1PV4 A;  4JV5 Q;  3H15 A;  2ZJR A;  1J6Q A;  1VS0 A;  4A76 A;  4HJ9 A;  4DUZ Q;  4DV2 Q;  5M3F G;  5FLX c;  1U0L A;  2OQ0 A;  4DR2 Q;  1VQN A;  4A3K H;  1JJC B;  4LFA Q;  4X62 L;  3JC6 6;  2OTL A;  4B3S L;  1GVP A;  4PZ8 A;  4DV5 Q;  4JI3 Q;  3G4S A;  3I55 A;  1YIT A;  4OX9 L;  2B3G A;  2YYZ A;  5M5W H;  1Q82 C;  1W3S A;  1VQD A;  1QVG A;  4P71 A;  1K9M C;  4JBM A;  1CUK A;  1XPU A;  2PI2 A;  2NVQ H;  1Q12 A;  4GKK Q;  2E2I H;  3U4V A;  2UXD Q;  1Q1E A;  3G71 A;  4GOP C;  3UDX A;  4A3I G;  3AFQ A;  1XPO A;  4JI1 Q;  3CC7 A;  3K0X A;  1PA6 A;  5FLM G;  3CAM A;  3ZJY C;  1NTG A;  4QY7 A;  3CW2 C;  4X65 L;  1YIJ A;  2MNA A;  1K83 H;  3K80 C;  1PVO A;  2IHF A;  2ZTE A;  4GS3 A;  4GN3 B;  1T9H A;  2JA9 A;  4HIM A;  3KJO A;  1YBY A;  4BBR G;  3I4N H;  2Q2I A;  3STB C;  3S16 H;  4DK6 C;  5E7N A;  1KQS A;  2YTY A;  1QUQ A;  2ASB A;  5IYC H;  5GAD C;  4A3B G;  1NE3 A;  1Q86 C;  2DUD A;  3I7F A;  4RMF A;  1PH1 A;  3BZK A;  4YY3 L;  5IWA L;  3MEF A;  4DPG A;  3RR5 A;  1V43 A;  4ALP A;  4IFD J;  1RL2 A;  2R93 H;  4HID A;  4BBR H;  1PHJ A;  1NMF A;  1SRU A;  1YNX A;  3J81 c;  4AQY L;  1X9N A;  2PQA A;  5IP7 H;  1PYS B;  2YTX A;  2Z0S A;  4B3T Q;  3HOV G;  1XMO Q;  4YCV A;  4OWT B;  4IOA A;  1K8A C;  4LUZ A;  1IBK L;  4YWL A;  3HKS A;  2HQL A;  3CXC A;  3U4Z A;  2R92 H;  3T1Y Q;  3E9I A;  2HT1 A;  3K8A A;  4AYB G;  4HJ5 A;  1HZC A;  3GD7 A;  3GO5 A;  4AQY Q;  3PUY A;  4A93 H;  2ES2 A;  4B3M Q;  2JA8 H;  3KDF B;  4R4C A;  2JA7 G;  1A62 A;  1WOC A;  1YVC A;  3GTJ H;  2JEA I;  1YHB A;  2AWN A;  3CME A;  4A3E H;  3KF6 A;  5IWA Q;  5C4X G;  1HZB A;  3HOU G;  4YY3 Q;  1XPR A;  2BA1 A;  1XMQ Q;  2UUA L;  3PO3 G;  1N33 Q;  2K52 A;  2L15 A;  4DR5 L;  5C44 H;  4DR7 L;  2YTV A;  1L1O A;  1E24 A;  4P75 A;  2B63 H;  3B6Y A;  4JBK A;  2JA6 H;  3S17 H;  4GLV B;  2HIX A;  1TWA H;  4P74 A;  1B8A A;  4JG2 A;  4GKJ Q;  4TQU S;  4IPC A;  3T1H L;  5GRO A;  1VQ7 A;  2UXB Q;  3W1B A;  3RZD H;  1U5K A;  2WB1 G;  4B3R Q;  4MTN A;  2VQE Q;  4POF A;  2ZJP A;  4DUY Q;  5IYB H;  1N34 Q;  4R4O A;  1S3O A;  1CKO A;  4JCV E;  4PZ7 A;  1X65 A;  3RN2 A;  1YJ9 A;  1YJW A;  2A1A A;  3HOY G;  3PO2 H;  3SGI A;  2VUM G;  1VQI A;  2B29 A;  2N3S A;  4JI5 L;  4DV0 L;  1UE5 A;  2N49 A;  4DR1 Q;  1VQB A;  2UUA Q;  1XJV A;  2OWO A;  1I94 L;  4K0K Q;  4ME3 A;  1MKH A;  2UXC Q;  3AYH B;  3K81 C;  1KIX A;  3ICE A;  2RHQ B;  2A19 A;  4IFD G;  1E1T A;  3F1Z A;  4LF7 Q;  1UE1 A;  3S14 H;  4DK3 C;  1FGU A;  1NY4 A;  1I50 H;  4OON A;  1IBM L;  1P8L A;  4DV5 L;  3S1R H;  1HNW Q;  1CKN A;  4JI7 Q;  2ZM6 L;  3PUZ A;  2ID0 A;  2MO0 A;  5LMN Q;  1YHQ A;  2LXK A;  4X64 Q;  4NXM L;  3TS2 A;  4DV2 L;  1JE5 A;  1V1Q A;  1HNZ L;  4LF7 L;  3FKI G;  1FVI A;  1EQQ A;  4HJ8 A;  4HJ7 A;  3ULP A;  1UE6 A;  2UXC L;  2K50 A;  1J5E L;  2BH2 A;  3WWV A;  2R7D A;  4GLX A;  2JEB I;  3CCL A;  4L5T A;  3PIP A;  3CCU A;  2NVX H;  1FL0 A;  3NEN A;  3UDI A;  2I5L X;  4IO9 A;  2VUM H;  1UE7 A;  4C3H H;  1YJN A;  3PO2 G;  5M3M G;  1IBL Q;  5IYD H;  4TVA B;  4LWC A;  5M5Y H;  3CMA A;  3NBH B;  1Q81 C;  4LF4 L;  1LYL A;  3EBE A;  2OTJ A;  5IYC G;  4EX5 A;  1OXX K;  4FDB A;  4YWM A;  1X3G A;  4DUY L;  3HOZ G;  3M3Y H;  4A3L G;  3HOW G;  2N8N A;  3TEH B;  5C4J H;  1I5F A;  2Y0S E;  4B3R L;  5JJK A;  2QA4 A;  4GKJ L;  3CP0 A;  3S2H H;  3J81 i;  2JA6 G;  1D8L A;  2ZTD A;  2CCZ A;  4BY7 G;  2NZO A;  4LF9 L;  3S1M H;  2R7Z H;  4DV6 Q;  3H0G G;  1N36 L;  2K5V A;  4YHH Q;  1PYB A;  1A0I A;  1VQH A;  1N33 L;  3OW2 A;  3FKI H;  1Y1V G;  1KRT A;  3GTM H;  3FP9 A;  2VZA A;  3F2D A;  4L5Q A;  1NMG A;  3UDF A;  1J5E Q;  3S2D H;  1WYD A;  4A3G H;  4UP9 A;  4YCW A;  1BVS A;  4IPH A;  5IE8 A;  2WAQ E;  2JQO A;  2FXQ A;  1HR0 W;  1HNZ Q;  5LMN W;  1KRS A;  3HFZ B;  1L1O C;  5GAH C;  3PUX A;  3CCJ A;  4DR4 Q;  2R93 G;  4X64 L;  2NN6 I;  2WP8 J;  1VQM A;  3GTO H;  2R7Z G;  4UP8 A;  1OXV A;  4JI3 L;  4JI7 L;  1IBK Q;  3KOJ A;  4A3F H;  5C3E G;  1CSQ A;  4DV1 Q;  1XMO L;  5IP7 G;  1QVF A;  3HOV H;  1IBM Q;  1OXS C;  1VQJ A;  2DGY A;  1MJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...