3V2TA

Crystal structure of staphylococcal nuclease variant delta+phs i92a/v66a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3v2tA00
4KTAA 5C4HA 2F0PA 3PMFA 1NSNS 1STNA 4WORA 2ENBA 4YIJA 3SK6A 4ZUJA 5C6AA 5J22A 3TP8A 2F0OA 4NKLA 3T13A 1EY0A 4QF4A 1A3VA 1A2UA 2RKSA 2F0HA 4K2KA 4B9WA 4HTHA 1KAAA 2KHSA 3TP7A 1EY4A 5E1FA 2F0UA 1JORA 4J6HA 5IOCA 1KDAA 3D6CA 2HQEA 3EROA 2OXPA 3P75A 2M00A 2PW5A 4N9TA 3E5SA 2PZUA 3T16A 2PZWA 3DMUA 4F7XA 2F0NA 3R3OA 2EYHA 3H6MA 3S9WA 4HMIA 2O4XA 5K5PA 1F2MA 2RBMA 3MVVA 1SYEA 2EYFA 3HEJA 5KYLA 2PZTA 5J1ZA 1SYFA 4RKBA 2F0KA 1EZ8A 4IUNA 2EY5A 2OEOA 2F3WA 3BDCA 3EVQA 3NP8A 1JOKA 1SYGA 3BDLA 3HZXA 4K6DA 4KD3A 4ODGA 1EY6A 1IHZA 3MEHA 3QOLA 1SYBA 2PQEA 1AEXA 5CV9A 3NUCA 5DEHA 2F0LA 3D4DA 5HGTA 2EYMA 4EQNA 5KEEA 4KJOA 2KQ3A 2WACA 5CV7A 3TP6A 5J39A 5IGCA 2EYPA 5KIXA 4KY5A 5EKKA 1KDBA 3QB3A 1A3UA 5C3WA 3SXHA 3TP5A 5C5MA 3LX0A 1EY7A 1SNMA 2F0DA 2SOBA 4DGZA 1STHA 4QMGA 1EY8A 5CV8A 3VA5A 2EY1A 3EJIA 4RKLA 3D8GA 1RKNA 5IODA 5ISRA 4B9XA 4KV6A 2EYJA 5I6YA 2SNSA 1SNCA 3MZ5A 3OMCA 2EYOA 4ID6A 4WRDA 3P1HA 1A2TA 3DHQA 2OF1A 3NXWA 4I65A 4F8MA 4MIUA 2RDFA 3SK4A 1EYCA 1SNOA 4PNYA 1STAA 5JOBA 1SYCA 5IGBA 2F0VA 4KY7A 4LAAA 4EQPA 4OL7A 5EGTA 3ITPA 4K2LA 1EYAA 1ENCA 5C5LA 4N9PA 1JOOA 2F0GA 2NUCA 5EKLA 4EVOA 4QB4A 1EY5A 5IIFA 1STGA 3OSOA 1II3A 5CV4A 3V2TA 3MHBA 1ENAA 3NHHA 4DU9A 2F0TA 4TRDA 5NUCA 4KJNA 5I9PA 4K5VA 4DFAA 2F0EA 2LKVA 5C4ZA 5DAUA 5CV5A 4IALA 3TMEA 5KGUA 1F2ZA 3NQTA 4K8JA 1STBA 3NK9A 4K5XA 5I6WA 3OWFA 2EXZA 1F2YA 1SNQA 2F0QA 3OMGA 4KD4A 4S3SA 5CGKA 4KHVA 4EQOA 2EY6A 4NMZA 5CC4A 5IGEA 1KABA 3QOJA 1SNDA 5HURA 2F0FA 1EQVA 5E3FA 2F3VA 5C3XA 5CR3A 4PMBA 1U9RA 3SK5A 4DF7A 3U9OA 4NDXA 4K14A 3C1EA 1EZ6A 1SYDA 2F0SA 3C1FA 4K5WA 4IZ8A 3SHLA 2PW7A 5F2DA 5KRUA 2EY2A 2SNMA 4ZQ3A 1EY9A 4KY6A 3SR1A 1EYDA 2EYLA 2F0IA 5IGFA 4H7BA 5IGGA 4ZUIA 3ERQA 1KDCA 1A3TA 2F0WA 3D4WA 4K8IA 4R8NA 5I9OA 1TQOA 4PMCA 5JAVA 4NP5A 3RUZA 1TT2A 5M9OA 5IGDA 4E6IA 5CV6A 1JOQA 4G57A 5KYIA 1TR5A 4J1MA 2F0MA 4HMJA 2QDBA 1STYA 3SK8A 4ME5A 3MXPA 1SNPA 2F0JA 1NUCA 2PYKA
chains in the Genus database with same CATH superfamily
3HOWB 3G48A 1HZCA 5C6AA 4NKLA 4KKSA 4UPAA 4JI5L 3HOZB 5LL6X 3K5NA 1V1OA 1BQQT 3K5OA 5IYCH 5ELEA 3UDXA 4DNIA 2O5IC 1B2TA 2N3SA 4F7XA 1V1PA 4MTNA 4IFDG 1G51A 4IQZA 1JR0D 4DAMA 5LMNW 1PRTB 4UY8C 1YHQA 1NBWA 1DONA 3BDCA 1WCMG 1WJJA 3F2DA 1EQQA 2WINB 4DPGA 1QJOA 1DXMA 4OIJA 4B3TL 2WB1G 3VR5A 1C8CA 2EYMA 1NNXA 5JEAG 1FGBD 4K6LA 2IW3A 3I4LA 5HGQA 3HOUB 4XT1B 3DEPA 4AIMA 1STHA 4QMGA 1EY8A 3KLSX 3S1NH 3PUWA 4GKKQ 3VR4A 4P2CB 3RMHA 2XN9C 2JYOA 4P75A 4H0LC 4DK1A 4WJWA 1FVIA 1Q8KA 4AQYQ 4JI4L 4OX9L 1YHBA 1GVPA 3NQIA 4DV3L 1GXDC 3A5ZB 4DKAC 3A0JA 3I8ZA 4QL5A 4DAPA 1NAPA 1QNKA 4RGOS 2F0TA 4HIMA 1GM5A 1JT8A 2EQSA 4QCLA 1EQRA 1YVCA 4JI3Q 3QIAA 1SFOB 2BA1A 4JK1C 4C3JG 4HIOA 5CC4A 3ULPA 2VUMH 1I94Q 2F3VA 3SK5A 1VQEA 1G8ZD 2VXWA 1RDPD 5KRUA 2PI2A 4ZQ3A 2YU9H 3K7UC 1IKMA 4ALPA 5KYIA 4HJ8A 4K8IA 5M9OA 3I7FA 3TEHB 1Q7YC 1TY2A 4WJ4A 2B2TA 1D1IA 3MC0B 1PV4A 4JBKA 3PUXA 1BF4A 2UXBQ 1EY0A 4O0AA 5IP9H 1A2UA 1GUGA 1RL2A 4LFCQ 2XRQD 1HZAA 3RZOH 2AQ2B 4JI6Q 1D8LA 4HTHA 4CGYB 1F9SA 1SLJA 3BDOA 2F0UA 3CCQA 2H5XA 4B08A 3NE5B 4X3SA 4GOPC 1M8AA 1X3EA 4OELB 2P5ZX 2XVSA 2RBMA 1CZGA 2AUKA 5DM73 1B1ZA 3KYHC 3OW2A 1VQ9A 3G4SA 3S1NB 1YZ6A 2VNUD 1UEBA 2R93B 4JI7L 2EJMA 2UUAL 1LM0A 4A3GG 4A3BB 2F0LA 3D4DA 3V96A 1AFPA 4C56C 4PZ7A 2C9OA 4PZ8A 1PRTC 4A3EG 2A69C 1WD0A 2A6ED 1WYDA 2F0DA 3H15A 2G9DA 4QQBX 2MNAA 1QUQA 1EQTA 1X32A 3PO3G 4A75A 4FXDA 1SAPA 5AFWA 1A2TA 3NXWA 4I65A 4MIUA 2F4VL 2PCFB 3HFZB 4A3JH 2UUCL 2K04A 5A35A 4C2MH 3FEWX 5C5LA 2R92H 1RTOA 5T1GA 1EY5A 4HIKA 3GD7A 5FO9B 1Z47A 1Q8IA 2QW7A 4C3IG 4FVMA 3S15B 3Q0AA 3T51B 3CQZB 1CSQA 3E9IA 3E0EA 2L12A 5ELDA 3G7LA 3TMEA 4JI0Q 1F2ZA 4DR1Q 3HOVB 1WOCA 4RFBA 3ND9A 1C48A 4R4CA 4KHVA 3Q22A 2EY6A 2QILA 2HHHL 1OXVA 1WTVA 2AKWB 3H09A 1K0SA 1YHAA 1K0RA 1RODA 4K0KL 4LW1A 2B2VA 4O2DA 1L0YB 3QR8A 3UDGA 3RZOB 4CJ1B 1X9NA 3GTLH 4H7BA 1IBLQ 2CWAA 5CYUA 3J7YW 1TQOA 5JPNC 2NZ1D 1EEFD 5E4XA 3PIO3 3FP9A 1XNQL 1CZWA 1JB3A 1KLUD 4DK0A 4AH6A 1N32Q 4DN4M 4DV1L 3PGZA 4DV7Q 2F0PA 3FKIH 2BH2A 1U5KA 4LK1C 4DUZL 1YEZA 2R7ZG 5C44G 3LNNA 4DR4L 5DM63 4HJ5A 1XPOA 1HZBA 2B2WA 2SEBD 2A68C 2WAQB 3CCSA 3R3OA 3W1GA 1AZPA 2E2JH 4BA2I 1LO5D 3K8AA 3J7ZC 4X65L 1EWCA 4LFBL 2WV6D 2KA7A 5CORA 1ZEQX 4KN4C 1N33L 4CDDC 4YCUA 2F3WA 3OTOL 3CCLA 2JE6I 1XWEA 1IHZA 3TDQA 4BY1G 1B9NA 1BBUA 3ND8A 4A3JB 1VQ6A 1AEXA 5CV9A 5M3FG 1J6QA 1BR9A 5HGTA 1DOLA 1KNEA 4JBJA 5CV7A 2R92B 1NTGA 2VY3A 5EKKA 2WKDA 2Q8TA 4JW0A 3LWUA 5C3WA 3HRZC 2L11A 5C5MA 3SXHA 2Z0SA 2O2LD 5GROA 1QUQB 5CBEE 1Q86C 2RCFA 1X65A 2D62A 3TN2A 5IODA 2NZOA 3DWAA 1KRTA 2RHQB 2ZXPA 3NELA 3GTKH 2H4OA 4DA2A 1JJGA 2F1MA 3AFPA 2UU9Q 4A3DG 1HHVA 4LF7Q 1K83H 3L3OC 2VQFL 4WFN3 4X64L 4A3KG 4EVOA 5EKLA 1KC8C 2A1AA 4B3SQ 3NHHA 2GVAA 5I9PA 4IUPA 3KDFB 2Q2TA 5CV5A 1EWHA 2WFWA 1PLFA 4RMFA 2ZJQA 2EXZA 5K36G 3GTPH 4L5SA 5C0XJ 2HIVA 5C3XA 3FKIB 5C4JB 4OO1H 3HKZB 2F0SA 1FNUA 2NN6I 3PSIA 1VF5C 1IBKQ 1CHPD 4GN4B 1MIUA 3NWSA 2JA5B 2B29A 2E2IH 3AFQA 4A3LG 1LTTD 4A3FG 1E24A 2E2JB 4X3TA 4ME5A 1SNPA 5TSSA 5IY0A 2PYKA 3HS0C 1S5CD 3KOJA 1C4QA 1O78A 3VR3A 5J22A 1PZJD 3DEOA 3NBHA 3BZDB 5IP7G 4FO2A 3M4OH 4JI2Q 4DR2Q 1TU2B 4IPHA 1KDAA 4X62L 1AN8A 3J80E 3SVMA 1F2LA 2H1EA 3S14H 3K0YA 2IX3A 4ZKBB 2L5TA 3EFXD 3CCJA 4JG2A 4DR6L 2LY7A 1A0IA 3HEJA 3CCRA 4X3KA 2OTLA 5ELFA 2PNRC 3RLNA 2RDHA 1PZID 1S5BD 3NTHA 1J5EL 1VQJA 4BBRG 2J4XA 4NXNQ 1H95A 4A3IG 4C3HB 2B2YA 2EJGC 3M7NA 5GAEC 1HR0L 1P8LA 1VMPA 3JAMc 1TWAH 1Y1WH 4KY5A 4FXGC 5ELNA 1PH1A 2ZXOA 1A3UA 1QG7A 1VQDA 3M3YH 1ENFA 1BNZA 3BYYB 3FVQA 2NN6G 4RCNA 4U68A 4A3CH 1IW7C 3VA5A 3SE0A 3EJIA 1PTOD 4LF8Q 2ID0A 2K4KA 2KBNA 1SN8A 2BH8A 3I2ZA 4DR7L 1SNCA 3A74A 3GTPB 1IYUA 1Y14B 5JOBA 3J81E 4LAAA 1E2VA 2K33A 1WCMB 2EOTA 3CKIB 4MN3A 2JA6B 2CKZB 2DY8A 3AQQA 1N34L 3PUYA 4B3ML 1KAWA 1ILPA 3T1YQ 2A6HD 2K14A 1YJWA 5IE8A 3PO2B 3J81j 5FOBB 2VUMG 2D0OA 3W2DA 1F2YA 1SNQA 2UXDL 1VMCA 2XNAC 4POFA 1Y1VG 2E76C 4MZ9A 1IL2A 3BG3A 4NMZA 4EQOA 1C7YA 3I4NB 4OHJA 2Q2UA 4JVZA 5M3MG 4LMQD 3CCUA 4HJ7A 5F2DA 1IL8A 3S2DB 4KY6A 4ZCKA 1EYDA 2EYLA 3Q23A 2JK8A 1WVLA 5LMNL 1JC7A 1KDCA 3D4WA 2JEAI 1D1KA 4ME3A 1YNJD 2K5NA 2LMCB 5JPMC 3OIPA 1HA6A 4DAYA 3S14B 1HRJA 3CRKC 1PH7A 5G3LD 1N8RC 1HCZA 4JI4Q 3UDFA 4NXML 3NBHB 3QWNA 1D2BA 1YNND 5EKIA 1QZGA 4C3JB 4DV3Q 2N55A 1B7YB 4QY7A 4K2KA 5HY6A 1KD1C 2KHIA 2NWGA 3GDEA 4DF7A 3T16A 2K32A 3K5LA 3NWTA 1TWAB 1K9MC 2NVYH 5IYDH 1HNXQ 3A8IE 3ULJA 3H6MA 2VB3X 4M8AA 1F2MA 2EVBA 2DJGC 4P73A 4A93H 3M3YB 2BCOA 1PH8A 1SYFA 1U4LA 1NR4A 2ZT9C 2BDNA 3I4MB 1EY6A 2JP1A 2RSOA 1VQHA 1E1TA 3GTJB 2WP8J 1B70B 1L1OC 1ZXTA 3P20A 3OOCA 4OWXB 2QEXA 3MXGA 2TMPA 1S40A 4IURA 3KF6B 3AEVA 1TS5A 3D8GA 1Y8NB 4IUQA 4B9XA 3HOWH 3I4OA 3MFYA 1D5XC 1C0AA 2OF1A 2XTIA 3U4ZA 1LUZA 1STAA 2E2HB 2C5CA 4KY7A 4CDCC 1PDQA 2SDFA 3Q24A 5EGTA 3HOZH 1V1QA 3CMEA 4UP7A 2FMMA 1TS4A 1QB5D 1VQGA 1D7QA 2D0PA 1CKNB 3L2PA 3OSOA 2KOLA 4IPGA 2F0EA 1ONLA 1I50H 2HDMA 5DAUA 2DJFC 1SMYC 3NQTA 3W3AA 4R4OA 4JBMA 1QWYA 2JA7H 3M85A 1FJGQ 4LNQA 1IYJB 2IHFA 3EBEA 3EN2A 3MTSA 1HQRD 3KJOA 3U9OA 3QJYA 4XQJA 2F0IA 1O7LA 1LTID 3K81C 1VQBA 2PMZE 4DAYB 3LWEA 2K5WA 1LTRD 5JAVA 4OWWB 5KNBA 4DNTB 3WWVA 3BVMA 2HDLA 2JA8H 4DV2L 3X3MA 1GUWA 1B53A 2F4VQ 4A93B 1EOTA 1VQNA 3FMCA 1WI5A 3PMFA 3AMUA 2B3GA 3H3VI 3STBD 1IBML 2MO1A 4JV5Q 4NB3A 1WTQA 3M7GA 1W2BA 3CCMA 3SGIA 2X69A 4IOAA 3KBGA 1U0LA 1EU4A 2CCZA 4CDEC 2J7ZA 1VS0A 4FF1A 3MWYW 1XPUA 1SYEA 1J9OA 1SFOH 2HHHQ 4GNXC 5A2QE 2OEOA 2BOSA 4K0KQ 3NSWA 3HZXA 4R8IA 2KVMA 1YI2A 4EGVA 4DV0L 4UP9A 2B63G 4RAUC 5DEHA 2FMCA 4R4IA 4MNOA 1QE6A 2R7ZB 1XNQQ 4H44C 5GQOA 3HG9A 1GUNA 2ICEC 1LABA 1TIID 4DV1Q 3I91A 1I50B 1Y69U 3K57A 1D5MC 2MUYA 2JA7B 1OTCA 1IZ6A 2IPKD 3H0GB 4WRDA 4DR4Q 3MXNB 3TS2A 2Y0SE 4DUYL 1SJED 1PH3A 4OGQC 3S16H 4XYQA 5IT9E 4RH6A 4AYBE 1BCPF 5C3EH 4ILWA 1CA6A 5M3FB 3FDTA 2KEDA 1YJNA 1WTPA 2B2UA 4F88A 4QUFA 1PVOA 4LUVA 4K8JA 5EAYA 4J15A 3T1HL 4A3MH 3KF8B 2JA8B 1LLRD 3I70A 3U58A 3T53B 1IKLA 2R93H 3QG1A 5D3IB 3CXCA 1KABA 1YIJA 4FF4A 2OT2A 3ZJYC 4O1NA 5CR3A 1R4PB 1PFSA 4GS3A 4A3BH 4X3UA 4A3DB 1EY9A 1DZ1A 3D3RA 3J80L 4KKUA 1DCZA 1U4MA 4A3KB 3K59A 3CC4A 1TR5A 2F0MA 1PYBA 1KQSA 4V190 1JQYD 3K0XA 4O42A 2F0JA 4TVAB 5KNDA 1HNZL 5JJKA 5BR8L 1SMXA 2UUBL 4X64Q 3I90A 1A3VA 5EPKA 1YJ9A 3OIQA 1X54A 5E1FA 3E0JA 3S1MH 3D6CA 1EOVA 3A8JE 4N9TA 2CQAA 3S15H 1O7YA 1JJ2A 4FYDA 2E5LL 1FD7D 3CQZH 3OHXC 5FLXL 3HOVH 2VQEL 3B6YA 1S5DD 1EIGA 2Z8LA 1H9KA 4FF3A 2NVQB 4R4TA 2A6EC 2PZTA 4ULLA 1RCVD 3AYHB 5FO7B 3J80i 2CHBD 4GN5A 2I46A 3F8TA 4BY7G 4K6DA 1K8GA 4XDXA 2IX0A 1JOKA 3HOYG 4FNFA 3QOLA 3GTMB 1Y1WG 3SEBA 4V0BA 3S16B 1RF2D 3NUCA 3HP3A 2TSSA 4L5TA 4CDFC 1BBXC 5C3EB 1V1PB 5IGCA 3D6WA 3A7LA 3BU2A 1BXTA 2YV5A 3CW2C 3GTQH 3M4YA 3K7AH 1KHIA 3RN2A 4A3MB 2SNSA 2VL6A 4LF5Q 1G91A 2KECA 2PQAA 3SK4A 1C9OA 1EYCA 3IKJA 5IGBA 1JB7A 4LF4L 3MAQA 4B3RL 4BBRB 3R2TA 5FLMG 1B44D 4A3IB 4N9PA 2F0GA 4QB4A 2Q2HA 2O5JC 2OWOA 2MJ8A 1W6KA 3CC2A 3R2IA 5CV4A 1EEID 1EFWA 4DU9A 3J81i 4LFAQ 2LKVA 1EIFA 3P7JA 2L55A 1J5EQ 2ZTCA 5KGUA 4K5XA 4YY3L 2IL8A 4GLAC 1V8QA 2F0QA 3CF5A 5JVH3 4IUTA 1PZKD 3BYTB 1LT3D 1RJTA 3QOJA 1N36Q 1U9RA 4K14A 1EZ6A 1SYDA 4LUZA 3VYRA 5IGFA 2YTVA 4XIGS 3T4AC 1BCPD 1MKHA 1EIYB 3S1MB 5M5YB 5IGDA 2A74C 3U4VA 4JBWA 2ZM6Q 1I5FA 5C4XH 2JEBI 4HSVA 2Y0SG 4BBSB 3BVGA 4YIJA 4ZUJA 1NR2A 1B3AA 1VQCA 4DR3L 4DR5L 1VQ4A 4AYBG 2D5DA 1I6HB 4Q0FA 1PTOB 5BN4A 5CMDA 5IYDG 2N78A 4OONA 4B3MQ 2YTYA 1OO9B 2R7DA 2F4IA 1KLGD 1HXYD 3W1BA 4HMIA 4ZLTF 2MFIA 2UXDQ 4X66L 2Q8RE 2KJXA 3GTQB 1I4QA 3KK7A 3K7AB 5M5XB 3HOXB 4DV5L 3A8KE 5FO8B 4HR7B 1CQVA 3DUZA 4ODGA 4KD3A 5C4JH 1Q82C 4LF9Q 2B39A 5IWAQ 4UP8A 1QILA 1JE4A 2OQKA 3S17H 4I7AA 1A63A 1E2WA 3PIP3 2PPBC 1E3PA 1PRTD 2A69D 4HJAA 2JA5H 1KDBA 1WFQA 4R4QA 2ZXRA 2K5HA 4FF2A 4NXMQ 3HOWG 2CFMA 2ZTDA 1PTOF 4IJHA 5CV8A 2EY1A 1MSGA 1GD7A 3VYUA 5IYBG 3MZ5A 3OMCA 3HOZG 1HNWQ 1I3QB 2CH4W 1I4PA 4PNYA 3A56A 1UWVA 1BO0A 2F0VA 3KLRA 2QKIC 4G7HC 3X3NA 1GO3E 4IUVA 1VQ5A 1RTNA 1VCIA 2NVXB 2EZVA 5CBAE 2JJQA 1FNWA 4TRDA 1ZYRC 1SE2A 3H94A 1XMOQ 4KHPQ 1Z9FA 4JOIA 3OWFA 1CQFA 1L1OA 4Y7NB 1FYCA 5C4XB 4C3HH 5HURA 5GAGC 4GKKL 1MI2A 3C1EA 4JPBW 4AQYL 1TWGB 2SNMA 3HOUG 3K5MA 5J3BA 3JC66 2Q2IA 1RHPA 1EYGA 1XMQL 1OXSC 5AJ3Q 3FHWA 3I3CA 4HMJA 5G3LF 2QDBA 5NUCA 4IFDH 3F1ZA 4IFDJ 4Q5VA 5C0XH 3GTOB 3R93A 3WOFA 1E22A 2IHEA 2RVLA 2RSNA 3D0FA 4DK6C 1OXUA 1WCMH 1O80A 1I94L 2A68D 3VA7A 3S17B 2WAQE 2JA6H 1V9PA 2HQEA 1DYQA 3E5SA 2PZWA 1SRUA 5JEAJ 5FJ8G 3S9WA 1X56A 2JXMB 3PO2H 2V1CC 2XWJB 1K8AC 2JA9A 4Z9CB 2QGQA 3OWEB 3U50C 3I4NH 2F0KA 4Y52H 1A62A 3PF5A 3EQLC 5JJLA 1A6XA 1SYGA 4LF6Q 2DNCA 3C2PA 1ILQA 3MEHA 2GVBA 5IYCG 3S2DH 2PQEA 3GP7A 2UXBL 1LTAD 3PQIA 5FK9C 1YBYA 4JI1Q 3GV6A 2XWBB 3TP5A 3J7AV 3LX0A 2UXCL 1PH6A 1TWFB 1VQ7A 2A6HC 1IXRA 3IFDA 2OQ0A 1O7IA 4RKLA 1WTOA 1M1KC 3AU7A 2FXQA 4KV6A 4TSSA 2NTTA 2QDLA 4C3JH 4N8X1 1F77A 4GNXA 4CHTB 3GTGB 1LT4D 1EYAA 3RZDB 2NUCA 1D6EC 3PF4A 2IT1A 2ATWA 2EIFA 1II3A 3V2TA 2B63B 3MHBA 1VQPA 1BVSA 2XRSD 1DOKA 1YNJC 1T9HA 1B9MA 3CRLC 2HUGA 3RD4A 4NPSA 1X3QA 5CGKA 3HKZE 3I4MH 4JI5Q 2G9HD 2BE5C 2N88A 4IZ8A 5ELBA 2EY2A 3GO5A 3GTJH 2AUJD 1QVGA 5I9OA 1TVXA 1PFBA 4NP5A 3VDYA 1LTLA 2WB1B 3AB9A 3URYA 4FP5D 3QO2A 2Z4IA 3TZDA 3KFUA 2L15A 5GADC 1CK1A 1LV9A 2CWPA 2QCPX 4A4IA 4DUYQ 1TWCH 4DR1L 3ER0A 1G2TA 1VQOA 1NSNS 1XX8A 2ENBA 4B3TQ 1PYWD 2E2HH 3T13A 1JWSD 2LFNA 1WTXA 4XT3B 1EWIA 3TP7A 1K73C 1JORA 2LS01 3W5OA 2K01A 1WD1A 2MPMA 3HOVG 4A3GH 5BN3A 2PZUA 4QIWB 2B8FA 1IBLL 2O4XA 3HGBA 1DOMA 4FXKC 1SXTA 4A3EH 4POGA 1X55A 2B2VC 4CBVA 5IP9G 4OX9Q 2VZAA 1N32L 2Z6KC 3EVQA 3KUPA 5LHY1 4DV7L 4RA8A 1TWHH 4WJ3M 1K8OA 5LMUL 2CW0C 2ZTEA 2QEJC 1AZQA 3U9SA 2MQHA 4G7OC 1ESRA 4EQ5A 1G6PA 1IW7D 2E2DC 4C3IH 2CVRA 1AW7A 4IPDA 2J0TD 2EYJA 2HIXA 3ONAB 5I2XA 2HQLA 2E74C 2B2WC 4BWGB 4L5QA 2K5QA 2RQXA 1Q1EA 3J80c 2AWOA 2K6AA 4XYOA 4BY7B 2I0QA 2WAQG 4PG3A 1K3RA 1Q3LA 1X6OA 3KJPA 2FHTA 1VQIA 3N6RA 4IPCA 1ENAA 1L2FA 1B8AA 5D3DA 4G4KA 2JN4A 3FRPB 4DV4L 1XPRA 1EIHA 3PCOB 1VQMA 4KK7A 4OWTB 1STBA 1I4GA 3BVZA 4P74A 3F2BA 1KTKA 4GOPA 4A3JG 1TWCB 2K28A 3O13A 2X6GA 4DNRB 3L9AX 3ZYYX 4PMBA 2ASBA 2F03A 2R92G 2K7VA 4DXFA 1DGSA 1DM0B 5I4DA 2PW7A 4IUUA 4YWMA 5L37A 2UU9L 4LF7L 5FLXc 2R7ZH 5C44H 2YTXA 4C1NI 4PZ6A 5IGGA 2EDGA 1V43A 4A3GB 3RUZA 5EPJA 3UI2A 1K28A 4G57A 4B3SL 1TS3A 1YNXA 2L0CA 3TREA 2IX1A 1SE8A 3BZCA 2A73B 4A3EB 1PMRA 4LF4Q 1SJHD 3H0GH 4JI7Q 1SR3A 1I4HA 2UUAQ 4ZK9B 4OEMB 3KLWA 3PO3B 5ELCA 2N8NA 1TWHB 1WTHA 2M2LA 3WDNA 1NJIC 4BY1H 2RCNA 5M3FH 2OXPA 2PW5A 3DMUA 2K5VA 1IBKL 4YY3Q 1F9QA 2IJ0A 3FKIG 4C3IB 2VS1A 1JICA 3HKZG 5ELOA 2UUCQ 3S24A 3E9HA 4CKBA 3C46A 1LTGD 2JA5G 4A3DH 1H9MA 4RHSA 2WACA 1NY4A 2EYPA 4A3KH 4JI2L 4YWKA 2HCCA 4JI8L 1S4ZA 4OO1I 3WOEA 4KHZA 2C35B 4DGZA 2Z9HA 1S3OA 2NZHA 1AE3A 1BCPB 1PH2A 2F3IA 5K36H 1HH2P 1M4VA 1VQLA 5KNCA 2ZJPA 1CSPA 5C44B 1T5EA 1SMYD 2KENA 2NVQH 1U4PA 4QJFA 5EBCA 2EJFC 2B2YC 4DV5Q 4A3LH 2KHJA 3FPPA 1ZKOA 1W3SA 3A55A 4DUZQ 4LF8L 1NCVA 1SNDA 3JAMi 1ET6A 2D2CC 3GTMH 1PYSB 1JCKB 4HJ9A 2G5DA 3UE1A 4RGMA 1P16A 3S2HH 1PFNA 5IP7H 1MSHA 1UE6A 2F0WA 4MHEA 4BY1B 1HTPA 1B4OA 1TT2A 1J8IA 4HEDA 1EUJA 5E4WC 1CKMA 4E6IA 4X65Q 4LFBQ 4J1MA 1UUPA 1N33Q 4DV6L 5C0XG 2L9HA 1STYA 2K75A 3T1YL 4XQNA 4JYAL 3F2CA 1UE7A 4KKTA 3OTOQ 1K8MA 3S1QH 4OO1G 4WORA 2RF4A 1H9SA 4CKCA 1KIXA 4BBRH 3EA6A 1X3FA 4A3IH 2JA6G 1HUNA 2F0HA 4DAVA 1MGSA 3RN5A 4J6HA 4XQQA 3NTIA 1L0WA 3ERSX 3PO2G 3K80C 1TY0A 1XNRL 4RG1A 4EX5A 1HFGA 1LT5D 5K5PA 3IRBA 3MVVA 3I4NG 2EPBA 1S5ED 4H13C 4R1JA 2NYZD 2NN6H 3G71A 1KRSA 1OXXK 1EZ8A 3A7AB 2EY5A 2I5HA 1UE5A 2VQFQ 5M5WB 4P72A 2M9VA 3CP0A 1XYIA 1PRTF 3F2UA 1LTSD 1XMQQ 2RA4A 3CPWA 3A54A 1Y8PB 5M5YH 1EY7A 2IWHA 1HNXL 3ICEA 4J8QA 1BOSA 3J7AF 4A3FB 2ALYB 4BBSH 3P1HA 1PA6A 2WIIB 2R6GA 1FR3A 1Y1VH 3J81L 1PH9A 4IJLA 1I6HH 1PTOH 3DWPA 4K2LA 5M3MH 2I5LX 3IL8A 1SSOA 3S2HB 2Z1CA 1UEAB 1JMCA 1ML0D 1CA5A 1BCPC 1HQMC 4A3CG 1VQKA 2GN5A 4IO9A 2V4DA 3I4MG 5M5XH 3TS0A 3HOXH 2A5HA 3OW7A 3RNUA 4LUOA 3S1QB 3A5UA 4BXXH 4K5WA 3NTKA 1GKHA 4RGTA 4PMWA 4X62Q 3TSSA 1MHWC 1CT1D 1ESFA 2UXCQ 1A3TA 1VQAA 2Q8IB 1M90C 4DR6Q 2X6LA 1JOQA 2K5DA 5CV6A 4BA1I 3SK8A 5EQ0A 3MXPA 1LACA 3NP8A 5IT9c 4M1UB 1H9SB 4KTAA 4GLVB 1I3QH 3E3XA 4L5RC 4R9WA 3BS1A 1E0BA 1LT6D 3DLLA 3VR2A 1HR0Q 1E1OA 4QF4A 1FJGL 2RKSA 1AH9A 2NVXH 2OCEA 2EXDA 2M00A 4RHRA 1XTDA 3G6JB 2F0NA 4BS9A 3MFGA 3SDZA 1S72A 3DM1A 3PUVA 4LJZC 5BN5A 3VR6A 5KYLA 4DR7Q 3NEMA 5JVG3 1T5XD 2KCMA 4CKEA 4Y7NH 2ZJRA 1QCBD 1FL0A 2AQ3B 2CH4A 1DD2A 3TQYA 2VUMB 2VW9A 1Z6HA 4JV5L 1Y1VB 3BJUA 5E7NA 1TWGH 1ICFB 1UE1A 4QUCA 2YU9B 1N34Q 4GKJL 2KQ3A 5M3MB 5J39A 3I73A 5KIXA 4HCSA 3PUZA 4YHHL 3KBXA 2VB2X 4A93G 1JJCB 1HPCA 2SOBA 3KDFA 4DXGA 1BBWA 1KNAA 1XXGA 2NVTH 1Q81C 1Q90A 5ISRA 1TS2A 2DN8A 3GTOH 4XXEA 1QNUA 1I4XA 1MJCA 3OPOA 2XIWA 1SYCA 3MA2B 3CCEA 4EQPA 2I5MX 5LMNQ 1NMGA 2Z6KA 4CJ0B 1JWMD 1STGA 4G7ZC 4RGNA 1MD2D 3BZKA 4KJNA 1MBYA 4DFAA 3ULLA 1CM9A 5C4ZA 3DWQA 4TKOB 5DLQE 1CUKA 4NW2A 2AQ1B 1UAPA 1D5ZC 2PQAB 5LMUQ 5EJWA 3CC7A 3CHBD 3DM3A 1O7ZA 2R7FA 5EPLA 3SR1A 3CPFA 4ZKCB 2DY7A 2XGTA 3ERQA 4R8NA 4L8JA 2FFKB 4RWSC 1VF7A 1TWFH 2JA7G 3H0GG 3CCVA 4ZAIA 1HUMA 2EE1A 3K6OA 2R61A 4KN7C 3JAME 2K1BA 1SEBD 2PI2E 3TBIB 3SK6A 3TP8A 3GTGH 3RZDH 2B2UC 2A8VA 4C2MB 5COYA 2K52A 1BDOA 2R3ZA 2E8GA 2B63H 4UAIA 4DV4Q 3PV0A 1A8VA 2JA8G 3FPUB 2MHVA 1BKBA 1SROA 1XJVA 5A2QL 1PHJA 1FNVA 5J1ZA 3I72A 2NVTB 4JI3L 1ASYA 4GZYC 3BDLA 4YCVA 1GHJA 2JQOA 2PO4A 4UDUC 1CI3M 1N9WA 1SYBA 2DGYA 2MP1A 4C1NK 4F87A 3TP6A 1AE2A 2PNHA 3GTLB 2E75C 3H3VH 3H91A 3NENA 3QB3A 5JEAH 2DUDA 3HKSA 2RHSB 1SNMA 4LWCA 3J7A5 2NB0A 1NE3A 5JJIA 1RKNA 3R8BA 2GA4B 2MO0A 1PTOC 4DK3C 1R9TH 1GHKA 3MEFA 1PFMA 5IT9L 3S1RH 3T56B 1JOOA 1HTLD 5DNFA 1SE4A 5IIFA 1ZYRD 1BUVT 4LFCL 3RR5A 2B2TC 4JI6L 4IOCA 1G291 3KLSA 3Q8DA 4DV2Q 3DXJC 1H9JA 4L6TB 4ABNA 1QZHA 1JE5A 2NTSA 3I56A 5I6WA 1QVCA 2Z4HA 1IBMQ 4N8FA 1Q1BA 3UE0A 4KD4A 2AHOB 1GJXA 1I4RA 2NBFA 5C3EG 4LF5L 4NDXA 2B8GA 1I6VC 4PV1C 3VYTA 1ICWA 4JI8Q 1RD9D 3VYSA 3GV3A 1Y8OB 4PMCA 3TZUA 1PH4A 1SE3A 4KMUC 4A3MG 2KCCA 4HIDA 4LFAL 1L1OB 2R93G 4APVA 1NUCA 5C4HA 3CU7A 3GTKB 1UNSA 4A3BG 2BA0A 2F0OA 4DV0Q 3IFTA 1LYLA 4BY7H 1YNNC 3HOYH 1K83B 4B9WA 1N36L 1EY4A 5IOCA 3P75A 1GOZA 3EROA 3D31A 5LL6S 2IY5B 1B3QA 5FLXE 1QOHA 2EYFA 2QF7A 5FKAC 1E7ZA 2KEEA 2RDGA 5GAHC 2YYZA 3KF6A 4RKBA 4JI0L 1W6JA 2OTJA 4CJ2C 2ZM6L 2FJ2A 4H02A 1GUOA 3N52A 1HA5A 1R9TB 2ES2A 1X3GA 3CMAA 3S1RB 2QA4A 4EQNA 2LSSA 5FLMH 2KCNA 3L0OA 2XSCA 4DV6Q 1CKNA 4HN7A 1B50A 4JYAQ 2E2IB 1NMFA 2K03A 1CTMA 3T1HQ 2L1BA 1LTBD 4BBSG 1CFMA 3OYYA 3PIOA 3Q6SA 3D4RA 4GLXA 4QGUA 3M4QA 5I2YA 5I6YA 4JC0A 1EFID 3MXUA 4ID6A 4F8MA 1KXLA 1SNOA 4UHVA 3PO3H 3I55A 4LF9L 1QVFA 1ENCA 3G6EA 5IWAL 2JSOA 3M4OB 1XNRQ 1WTRA 1R4QB 2K05A 3PIPA 1GUSA 2DNEA 5EBDA 1SDFA 1KL9A 2LXJA 3HOXG 5D14A 4U673 4FDBA 2FINB 1HNZQ 1HZ9A 5BR8Q 3NK9A 1AP0A 3E6ZX 2UUBQ 5D65A 4S3SA 3OMGA 3M9BA 4HSPA 2BE5D 4BXXG 1DJRD 1U4RA 1H9RA 4GNXB 1TXYA 1EQVA 4KLKA 2AMCB 1G2SA 1HNWL 3SHLA 1ASZA 1PH5A 3HOYB 2WB1E 2HT1A 2E5LQ 4YCWA 4ZUIA 1Y1WB 3UDIA 2KUMA 3V05A 2VQEQ 2PMZB 1F9PA 1VQFA 2WKCA 1Q46A 1XMOL 4KHPL 1STNA 4RCOA 1MJEA 3RLOA 4ZRZA 1Q12A 3M4PA 3L7ZC 3STBC 1KAAA 2KHSA 3TRZA 3LGJA 4L63B 1IYVA 2AWNA 4QIWE 4JOIC 2LXKA 1PXUA 2EYHA 1HJPA 5C4XG 5AJ3L 1CKOA 3J81c 3IAYA 4IUNA 4B3RQ 1HFNA 5IYBH 1X3PA 1VDZA 2CW0D 3MXNA 1SBBB 4OXPA 1L0XB 1XTCD 2A19A 1S5FD 2MGSA 3H3VC 1G6ZA 2L4NA 1K3BC 4KJOA 5KEEA 3EIVA 2BDOA 2HCIA 2Z6BA 2N49A 2HD3A 4IN3A 4PQXA 3CAMA 4MTKA 1OXTA 1Z7TA 1CHQD 3KF8A 3NBIA 2EYOA 3DHQA 4TQUS 2RDFA 5JJZA 4OL7A 4LF6L 3ITPA 1GUTA 2Y0SB 1ET9A 1STEA 4IFDI 1E2ZA 1TKWB 3CD6A 5C0XI 4XTCS 4AYBB 2ICIA 1A15A 4JI1L 5H1SE 1WTWA 3HOUH 4DR2L 2NVYB 4K5VA 4JCVE 1YITA 3JAML 4I7ZC 4IALA 4P71A 5T1IA 1HR0W 3C3LA 4A76A 2KCTA 2CQOA 3GQBA 2K50A 4DR3Q 1F9RA 4DR5Q 1JWUD 4ZYSA 5IGEA 5M5WH 3RLFA 2F0FA 5E3FA 4HAEA 4GKJQ 4NXNL 3C1FA 1EL0A 1VQ8A 4YHHQ 4GN3B 1EU3A 3NPPA 2D9UA 4YWLA 4X66Q 1RIPA 1FGUA 4X6AH 2I07B 4HCEA 5FJ8H 2F52A 4OIKA 4KI0A 4GOPB 4C3HG 3K58A 4A3FH
chains in the Genus database with same CATH topology
3HOWB 5C6AA 4NKLA 4KKSA 3HOZB 5LL6X 3K5NA 1V1OA 1BQQT 3K5OA 5ELEA 2O5IC 1B2TA 4F7XA 1V1PA 4IFDG 4IQZA 1JR0D 1PRTB 1DONA 3BDCA 2WINB 1QJOA 1DXMA 4OIJA 3VR5A 1C8CA 2EYMA 5JEAG 1FGBD 4K6LA 2IW3A 3I4LA 3HOUB 4XT1B 3DEPA 4QMGA 1STHA 1EY8A 3KLSX 3PUWA 3VR4A 4P2CB 3RMHA 2XN9C 2JYOA 4DK1A 4H0LC 4WJWA 3NQIA 1GXDC 3I8ZA 4DAPA 1NAPA 1QNKA 4RGOS 2F0TA 4QCLA 3QIAA 1SFOB 2BA1A 4JK1C 4C3JG 5CC4A 2F3VA 3SK5A 1G8ZD 2VXWA 1RDPD 5KRUA 4ZQ3A 1IKMA 5KYIA 4K8IA 5M9OA 1TY2A 2B2TA 1D1IA 3MC0B 3PUXA 1BF4A 1EY0A 1A2UA 1GUGA 2XRQD 2AQ2B 4HTHA 4CGYB 1F9SA 3BDOA 2F0UA 4B08A 3NE5B 4X3SA 1M8AA 2XVSA 2RBMA 1CZGA 2AUKA 5DM73 1B1ZA 3S1NB 2VNUD 2R93B 2EJMA 4A3BB 2F0LA 3D4DA 3V96A 1AFPA 4C56C 2C9OA 1PRTC 2A69C 1WD0A 2A6ED 2F0DA 2G9DA 1X32A 1EQTA 4FXDA 1SAPA 5AFWA 1A2TA 3NXWA 4I65A 4MIUA 2PCFB 2K04A 5A35A 3FEWX 5C5LA 1RTOA 5T1GA 1EY5A 3GD7A 5FO9B 1Z47A 1Q8IA 4C3IG 4FVMA 3S15B 3Q0AA 3T51B 3CQZB 3TMEA 2L12A 5ELDA 3G7LA 3HOVB 1F2ZA 4RFBA 3ND9A 1C48A 4KHVA 3Q22A 2EY6A 2QILA 1OXVA 1WTVA 3H09A 1RODA 2B2VA 1L0YB 3RZOB 4CJ1B 4H7BA 5CYUA 3J7YW 1TQOA 5JPNC 2NZ1D 1EEFD 5E4XA 3PIO3 1CZWA 1JB3A 1KLUD 4DK0A 4DN4M 2F0PA 4LK1C 3LNNA 5DM63 2B2WA 2SEBD 2A68C 2WAQB 3R3OA 1AZPA 4BA2I 1LO5D 1EWCA 2WV6D 2KA7A 5CORA 1ZEQX 4KN4C 2F3WA 2JE6I 1XWEA 1IHZA 3TDQA 1B9NA 3ND8A 4A3JB 1AEXA 5CV9A 1BR9A 5HGTA 1DOLA 1KNEA 5CV7A 2R92B 5EKKA 2WKDA 2Q8TA 3LWUA 5C3WA 3HRZC 2L11A 5C5MA 3SXHA 2O2LD 5CBEE 2D62A 3TN2A 5IODA 3DWAA 2ZXPA 2H4OA 4DA2A 2F1MA 1HHVA 3L3OC 4WFN3 4EVOA 5EKLA 3NHHA 5I9PA 4IUPA 5CV5A 1EWHA 1PLFA 2EXZA 5K36G 5C0XJ 5C3XA 3FKIB 5C4JB 4OO1H 3HKZB 2F0SA 1FNUA 2NN6I 1VF5C 1CHPD 3NWSA 2JA5B 1LTTD 2E2JB 4X3TA 4ME5A 1SNPA 5TSSA 2PYKA 3HS0C 1S5CD 1C4QA 1O78A 3VR3A 5J22A 1PZJD 3DEOA 3NBHA 3BZDB 4FO2A 1TU2B 1KDAA 1AN8A 3J80E 3SVMA 1F2LA 2H1EA 3K0YA 2IX3A 4ZKBB 2L5TA 3EFXD 2LY7A 3HEJA 4X3KA 5ELFA 2PNRC 2RDHA 1PZID 1S5BD 3NTHA 2J4XA 4C3HB 2B2YA 2EJGC 3M7NA 1VMPA 4KY5A 4FXGC 2ZXOA 1A3UA 1QG7A 1ENFA 1BNZA 3BYYB 3FVQA 2NN6G 4RCNA 4U68A 1IW7C 3VA5A 3SE0A 3EJIA 1PTOD 2ID0A 1SNCA 3GTPB 1IYUA 5JOBA 3J81E 4LAAA 1E2VA 2K33A 1WCMB 2EOTA 3CKIB 4MN3A 2JA6B 2DY8A 3PUYA 1ILPA 2A6HD 3PO2B 5FOBB 3W2DA 1F2YA 1SNQA 1VMCA 2XNAC 2E76C 3BG3A 4NMZA 4EQOA 3I4NB 4OHJA 4LMQD 5F2DA 1IL8A 3S2DB 4KY6A 1EYDA 2EYLA 3Q23A 1WVLA 2JEAI 1JC7A 1KDCA 3D4WA 1D1KA 1YNJD 2LMCB 5JPMC 3OIPA 1HA6A 4DAYA 3S14B 1HRJA 3CRKC 5G3LD 1HCZA 3QWNA 1D2BA 1YNND 5EKIA 4C3JB 2N55A 4K2KA 2NWGA 4DF7A 3T16A 2K32A 3K5LA 3NWTA 1TWAB 3A8IE 3H6MA 2VB3X 4M8AA 1F2MA 2EVBA 3M3YB 2BCOA 1SYFA 1U4LA 1NR4A 2ZT9C 2BDNA 3I4MB 1EY6A 2JP1A 2RSOA 3GTJB 2WP8J 1ZXTA 3P20A 3OOCA 3MXGA 2TMPA 4IURA 1TS5A 3D8GA 1Y8NB 4IUQA 4B9XA 3MFYA 1D5XC 2OF1A 2E2HB 1STAA 2C5CA 4KY7A 3Q24A 1PDQA 2SDFA 5EGTA 2FMMA 1TS4A 1QB5D 3OSOA 2KOLA 2F0EA 1ONLA 2HDMA 5DAUA 1SMYC 3NQTA 3W3AA 1QWYA 3M85A 3MTSA 1HQRD 3U9OA 3QJYA 4XQJA 2F0IA 1O7LA 1LTID 3LWEA 2K5WA 1LTRD 5JAVA 5KNBA 4DNTB 3BVMA 2HDLA 3X3MA 1GUWA 1B53A 4A93B 1EOTA 3FMCA 3PMFA 3AMUA 1WTQA 3M7GA 2X69A 3KBGA 1EU4A 2J7ZA 4FF1A 3MWYW 1SYEA 1J9OA 5A2QE 2OEOA 2BOSA 3NSWA 3HZXA 4R8IA 2KVMA 4EGVA 4RAUC 5DEHA 2FMCA 1QE6A 2R7ZB 4H44C 3HG9A 1GUNA 2ICEC 1LABA 1TIID 3I91A 1I50B 1Y69U 3K57A 1D5MC 2MUYA 2JA7B 3H0GB 2IPKD 4WRDA 1SJED 4OGQC 4XYQA 5IT9E 4RH6A 1BCPF 4ILWA 1CA6A 5M3FB 3FDTA 2KEDA 1WTPA 2B2UA 4F88A 4QUFA 4K8JA 2JA8B 1LLRD 3I70A 3T53B 1IKLA 3QG1A 5D3IB 1KABA 4FF4A 2OT2A 4O1NA 5CR3A 1R4PB 4X3UA 4A3DB 1EY9A 1DZ1A 3D3RA 3J80L 4KKUA 1DCZA 1U4MA 4A3KB 3K59A 1TR5A 2F0MA 4V190 1JQYD 4O42A 2F0JA 5KNDA 3I90A 1A3VA 5EPKA 3OIQA 5E1FA 3E0JA 3D6CA 3A8JE 4N9TA 2CQAA 1O7YA 4FYDA 1FD7D 3OHXC 5FLXL 1S5DD 1EIGA 2Z8LA 1H9KA 4FF3A 2NVQB 2A6EC 2PZTA 4ULLA 1RCVD 5FO7B 2CHBD 2I46A 4K6DA 4XDXA 2IX0A 1JOKA 4FNFA 3QOLA 3GTMB 3SEBA 4V0BA 3S16B 1RF2D 3NUCA 3HP3A 2TSSA 1BBXC 5C3EB 1V1PB 5IGCA 3D6WA 3A7LA 1BXTA 3M4YA 4A3MB 2SNSA 1G91A 2KECA 3SK4A 1EYCA 3IKJA 5IGBA 3MAQA 4BBRB 3R2TA 1B44D 4A3IB 4N9PA 2F0GA 4QB4A 2O5JC 2MJ8A 1W6KA 3R2IA 5CV4A 1EEID 4DU9A 2LKVA 3P7JA 2L55A 5KGUA 4K5XA 2IL8A 1V8QA 2F0QA 5JVH3 4IUTA 1PZKD 3BYTB 1LT3D 1RJTA 3QOJA 1U9RA 4K14A 1EZ6A 1SYDA 3VYRA 5IGFA 4XIGS 3T4AC 1BCPD 3S1MB 5M5YB 5IGDA 2A74C 4JBWA 2JEBI 4HSVA 4BBSB 3BVGA 4YIJA 4ZUJA 1NR2A 1B3AA 2D5DA 1I6HB 4Q0FA 1PTOB 5BN4A 5CMDA 1OO9B 2F4IA 1KLGD 1HXYD 4ZLTF 4HMIA 2Q8RE 2KJXA 3GTQB 1I4QA 3KK7A 3K7AB 5M5XB 3HOXB 3A8KE 5FO8B 4HR7B 1CQVA 3DUZA 4ODGA 4KD3A 2B39A 1QILA 1JE4A 1E2WA 3PIP3 2PPBC 1PRTD 2A69D 1KDBA 2ZXRA 4FF2A 1PTOF 5CV8A 2EY1A 1MSGA 3VYUA 3MZ5A 3OMCA 1I3QB 1I4PA 4PNYA 3A56A 1BO0A 2F0VA 3KLRA 2QKIC 4G7HC 3X3NA 4IUVA 1RTNA 1VCIA 2NVXB 2EZVA 5CBAE 1FNWA 4TRDA 1ZYRC 1SE2A 3H94A 3OWFA 1CQFA 4Y7NB 1FYCA 5C4XB 5HURA 1MI2A 3C1EA 1TWGB 2SNMA 3K5MA 1RHPA 1OXSC 3I3CA 4HMJA 5G3LF 2QDBA 5NUCA 4IFDH 4IFDJ 4Q5VA 5C0XH 3GTOB 3R93A 3WOFA 2RVLA 2RSNA 1OXUA 1O80A 2A68D 3VA7A 3S17B 2HQEA 1DYQA 3E5SA 2PZWA 5JEAJ 3S9WA 2JXMB 2XWJB 4Z9CB 3OWEB 2F0KA 3EQLC 1A6XA 1SYGA 2DNCA 3C2PA 1ILQA 3MEHA 2PQEA 3GP7A 1LTAD 5FK9C 3GV6A 2XWBB 3TP5A 3J7AV 3LX0A 1TWFB 2A6HC 3IFDA 4RKLA 1WTOA 3AU7A 4KV6A 4TSSA 2NTTA 1F77A 4CHTB 3GTGB 1LT4D 1EYAA 3RZDB 2NUCA 1D6EC 2IT1A 1II3A 3V2TA 2B63B 3MHBA 2XRSD 1DOKA 1YNJC 1B9MA 3CRLC 2HUGA 3RD4A 1X3QA 5CGKA 2G9HD 2BE5C 2N88A 4IZ8A 5ELBA 2EY2A 3GO5A 2AUJD 5I9OA 1TVXA 1PFBA 4NP5A 2WB1B 3AB9A 3URYA 4FP5D 3QO2A 2Z4IA 3TZDA 1CK1A 1LV9A 2QCPX 1G2TA 1NSNS 1XX8A 2ENBA 1PYWD 3T13A 1JWSD 2LFNA 1WTXA 4XT3B 3TP7A 1JORA 2LS01 1WD1A 2K01A 2MPMA 5BN3A 2PZUA 4QIWB 2B8FA 2O4XA 3HGBA 1DOMA 4FXKC 1SXTA 2B2VC 4CBVA 3EVQA 3KUPA 5LHY1 4RA8A 1K8OA 2CW0C 2QEJC 1AZQA 3U9SA 4G7OC 1ESRA 1IW7D 2E2DC 2CVRA 1AW7A 2J0TD 2EYJA 3ONAB 5I2XA 2E74C 2B2WC 4BWGB 2K5QA 2RQXA 1Q1EA 2AWOA 2K6AA 4XYOA 4BY7B 1Q3LA 2FHTA 3N6RA 1ENAA 5D3DA 4G4KA 3FRPB 1EIHA 4KK7A 1STBA 1I4GA 3BVZA 1KTKA 1TWCB 2K28A 3O13A 2X6GA 4DNRB 3L9AX 3ZYYX 4PMBA 2F03A 2K7VA 4DXFA 1DM0B 5I4DA 2PW7A 4IUUA 4C1NI 5IGGA 2EDGA 1V43A 4A3GB 3RUZA 5EPJA 3UI2A 4G57A 1TS3A 2L0CA 2IX1A 2A73B 4A3EB 1PMRA 1SJHD 1I4HA 4ZK9B 3PO3B 5ELCA 1TWHB 2M2LA 3WDNA 2OXPA 2PW5A 3DMUA 1F9QA 2IJ0A 4C3IB 1JICA 4CKBA 3C46A 1LTGD 1H9MA 4RHSA 2WACA 2EYPA 2HCCA 1S4ZA 4OO1I 3WOEA 4KHZA 4DGZA 1BCPB 5K36H 1M4VA 5KNCA 5C44B 1T5EA 1SMYD 1U4PA 5EBCA 2EJFC 2B2YC 3FPPA 1ZKOA 3A55A 1NCVA 1SNDA 1ET6A 2D2CC 1JCKB 4RGMA 1PFNA 1MSHA 2F0WA 4MHEA 4BY1B 1HTPA 1B4OA 1TT2A 1J8IA 4HEDA 5E4WC 4E6IA 4J1MA 1UUPA 5C0XG 2L9HA 1STYA 4XQNA 4KKTA 1K8MA 4OO1G 4WORA 4CKCA 1H9SA 3EA6A 1HUNA 2F0HA 4DAVA 1MGSA 4J6HA 4XQQA 3NTIA 1TY0A 1HFGA 1LT5D 5K5PA 3MVVA 2EPBA 1S5ED 4H13C 2NYZD 2NN6H 1OXXK 1EZ8A 3A7AB 2EY5A 5M5WB 2M9VA 1XYIA 1PRTF 1LTSD 3F2UA 2RA4A 3A54A 1Y8PB 1EY7A 2IWHA 4J8QA 1BOSA 3J7AF 4A3FB 3P1HA 2WIIB 2R6GA 1FR3A 3J81L 1PTOH 3DWPA 4K2LA 3IL8A 1SSOA 3S2HB 2Z1CA 1UEAB 1ML0D 1CA5A 1BCPC 1HQMC 2V4DA 2A5HA 3OW7A 3S1QB 4K5WA 3NTKA 4RGTA 4PMWA 3TSSA 1CT1D 1ESFA 1A3TA 2Q8IB 2X6LA 1JOQA 2K5DA 5CV6A 4BA1I 3SK8A 5EQ0A 3MXPA 1LACA 3NP8A 4M1UB 1H9SB 4KTAA 4R9WA 3BS1A 1E0BA 1LT6D 3VR2A 4QF4A 2RKSA 2M00A 4RHRA 3G6JB 2F0NA 4BS9A 3MFGA 3SDZA 3DM1A 3PUVA 4LJZC 5BN5A 3VR6A 5KYLA 5JVG3 1T5XD 4CKEA 1QCBD 2AQ3B 1DD2A 2VUMB 1Z6HA 1Y1VB 4QUCA 2YU9B 2KQ3A 5M3MB 5J39A 3I73A 5KIXA 4HCSA 3PUZA 3KBXA 2VB2X 1HPCA 2SOBA 4DXGA 1KNAA 1XXGA 1Q90A 5ISRA 1TS2A 2DN8A 4XXEA 1QNUA 1I4XA 3OPOA 2XIWA 1SYCA 3MA2B 4EQPA 4CJ0B 1JWMD 1STGA 4G7ZC 4RGNA 1MD2D 4KJNA 1MBYA 4DFAA 1CM9A 5C4ZA 3DWQA 4TKOB 4NW2A 2AQ1B 1UAPA 1D5ZC 5EJWA 3CHBD 1O7ZA 5EPLA 3SR1A 4ZKCB 2DY7A 3ERQA 4R8NA 4L8JA 2FFKB 4RWSC 1VF7A 4ZAIA 1HUMA 2EE1A 3K6OA 2R61A 4KN7C 3JAME 2K1BA 1SEBD 3TBIB 3SK6A 3TP8A 2B2UC 4C2MB 5COYA 1BDOA 2R3ZA 4UAIA 3PV0A 3FPUB 2MHVA 5A2QL 1FNVA 5J1ZA 3I72A 2NVTB 4GZYC 3BDLA 1GHJA 2PO4A 4UDUC 1CI3M 4C1NK 1SYBA 2MP1A 4F87A 3TP6A 3GTLB 2E75C 3H91A 3QB3A 5JEAH 1SNMA 2NB0A 1RKNA 3R8BA 2GA4B 1PTOC 1GHKA 1PFMA 5IT9L 3T56B 1JOOA 1HTLD 5DNFA 1SE4A 5IIFA 1ZYRD 1BUVT 2B2TC 1G291 3KLSA 3DXJC 1H9JA 4L6TB 4ABNA 2NTSA 5I6WA 2Z4HA 1Q1BA 4KD4A 1GJXA 1I4RA 2NBFA 4NDXA 2B8GA 1I6VC 4PV1C 3VYTA 1ICWA 1RD9D 3VYSA 3GV3A 1Y8OB 4PMCA 3TZUA 1SE3A 4KMUC 2KCCA 1NUCA 5C4HA 3CU7A 3GTKB 1UNSA 2BA0A 2F0OA 3IFTA 1YNNC 1K83B 4B9WA 1EY4A 5IOCA 3P75A 1GOZA 3EROA 3D31A 5LL6S 5FLXE 1QOHA 2EYFA 2QF7A 5FKAC 2KEEA 2RDGA 2YYZA 4RKBA 1W6JA 4CJ2C 2FJ2A 1GUOA 3N52A 1HA5A 1R9TB 3S1RB 4EQNA 2KCNA 2XSCA 4HN7A 1B50A 2E2IB 2K03A 1CTMA 2L1BA 1LTBD 1CFMA 3Q6SA 3D4RA 5I2YA 5I6YA 1EFID 3MXUA 4ID6A 4F8MA 1SNOA 1ENCA 2JSOA 3M4OB 1WTRA 1R4QB 2K05A 1GUSA 2DNEA 5EBDA 1SDFA 5D14A 4U673 2FINB 3NK9A 1AP0A 3E6ZX 5D65A 4S3SA 3OMGA 4HSPA 2BE5D 1DJRD 1U4RA 1H9RA 1EQVA 1G2SA 3SHLA 3HOYB 4ZUIA 1Y1WB 2KUMA 3V05A 2PMZB 1F9PA 2WKCA 1STNA 4RCOA 4ZRZA 1Q12A 3L7ZC 1KAAA 2KHSA 4L63B 1IYVA 2AWNA 1PXUA 2EYHA 3IAYA 4IUNA 1HFNA 1X3PA 1VDZA 2CW0D 3MXNA 1SBBB 1L0XB 1XTCD 1S5FD 2MGSA 3H3VC 1G6ZA 2L4NA 5KEEA 4KJOA 2BDOA 2HCIA 4IN3A 4PQXA 1OXTA 1Z7TA 1CHQD 3KF8A 3NBIA 2EYOA 3DHQA 4TQUS 2RDFA 5JJZA 4OL7A 3ITPA 1GUTA 2Y0SB 1ET9A 1STEA 4IFDI 1E2ZA 1TKWB 5C0XI 4XTCS 4AYBB 2ICIA 1A15A 1WTWA 2NVYB 4K5VA 3JAML 4I7ZC 4IALA 5T1IA 3C3LA 3GQBA 1F9RA 1JWUD 4ZYSA 5IGEA 3RLFA 2F0FA 5E3FA 4HAEA 1EL0A 3C1FA 1EU3A 3NPPA 2D9UA 2I07B 4HCEA 4OIKA 4KI0A 4C3HG 3K58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KTA A;  5C4H A;  2F0P A;  3PMF A;  1NSN S;  1STN A;  4WOR A;  2ENB A;  4YIJ A;  3SK6 A;  4ZUJ A;  5C6A A;  5J22 A;  3TP8 A;  2F0O A;  4NKL A;  3T13 A;  1EY0 A;  4QF4 A;  1A3V A;  1A2U A;  2RKS A;  2F0H A;  4K2K A;  4B9W A;  4HTH A;  1KAA A;  2KHS A;  3TP7 A;  1EY4 A;  5E1F A;  2F0U A;  1JOR A;  4J6H A;  5IOC A;  1KDA A;  3D6C A;  2HQE A;  3ERO A;  2OXP A;  3P75 A;  2M00 A;  2PW5 A;  4N9T A;  3E5S A;  2PZU A;  3T16 A;  2PZW A;  3DMU A;  4F7X A;  2F0N A;  3R3O A;  2EYH A;  3H6M A;  3S9W A;  4HMI A;  2O4X A;  5K5P A;  1F2M A;  2RBM A;  3MVV A;  1SYE A;  2EYF A;  3HEJ A;  5KYL A;  2PZT A;  5J1Z A;  1SYF A;  4RKB A;  2F0K A;  1EZ8 A;  4IUN A;  2EY5 A;  2OEO A;  2F3W A;  3BDC A;  3EVQ A;  3NP8 A;  1JOK A;  1SYG A;  3BDL A;  3HZX A;  4K6D A;  4KD3 A;  4ODG A;  1EY6 A;  1IHZ A;  3MEH A;  3QOL A;  1SYB A;  2PQE A;  1AEX A;  5CV9 A;  3NUC A;  5DEH A;  2F0L A;  3D4D A;  5HGT A;  2EYM A;  4EQN A;  5KEE A;  4KJO A;  2KQ3 A;  2WAC A;  5CV7 A;  3TP6 A;  5J39 A;  5IGC A;  2EYP A;  5KIX A;  4KY5 A;  5EKK A;  1KDB A;  3QB3 A;  1A3U A;  5C3W A;  3SXH A;  3TP5 A;  5C5M A;  3LX0 A;  1EY7 A;  1SNM A;  2F0D A;  2SOB A;  4DGZ A;  1STH A;  4QMG A;  1EY8 A;  5CV8 A;  3VA5 A;  2EY1 A;  3EJI A;  4RKL A;  3D8G A;  1RKN A;  5IOD A;  5ISR A;  4B9X A;  4KV6 A;  2EYJ A;  5I6Y A;  2SNS A;  1SNC A;  3MZ5 A;  3OMC A;  2EYO A;  4ID6 A;  4WRD A;  3P1H A;  1A2T A;  3DHQ A;  2OF1 A;  3NXW A;  4I65 A;  4F8M A;  4MIU A;  2RDF A;  3SK4 A;  1EYC A;  1SNO A;  4PNY A;  1STA A;  5JOB A;  1SYC A;  5IGB A;  2F0V A;  4KY7 A;  4LAA A;  4EQP A;  4OL7 A;  5EGT A;  3ITP A;  4K2L A;  1EYA A;  1ENC A;  5C5L A;  4N9P A;  1JOO A;  2F0G A;  2NUC A;  5EKL A;  4EVO A;  4QB4 A;  1EY5 A;  5IIF A;  1STG A;  3OSO A;  1II3 A;  5CV4 A;  3V2T A;  3MHB A;  1ENA A;  3NHH A;  4DU9 A;  2F0T A;  4TRD A;  5NUC A;  4KJN A;  5I9P A;  4K5V A;  4DFA A;  2F0E A;  2LKV A;  5C4Z A;  5DAU A;  5CV5 A;  4IAL A;  3TME A;  5KGU A;  1F2Z A;  3NQT A;  4K8J A;  1STB A;  3NK9 A;  4K5X A;  5I6W A;  3OWF A;  2EXZ A;  1F2Y A;  1SNQ A;  2F0Q A;  3OMG A;  4KD4 A;  4S3S A;  5CGK A;  4KHV A;  4EQO A;  2EY6 A;  4NMZ A;  5CC4 A;  5IGE A;  1KAB A;  3QOJ A;  1SND A;  5HUR A;  2F0F A;  1EQV A;  5E3F A;  2F3V A;  5C3X A;  5CR3 A;  4PMB A;  1U9R A;  3SK5 A;  4DF7 A;  3U9O A;  4NDX A;  4K14 A;  3C1E A;  1EZ6 A;  1SYD A;  2F0S A;  3C1F A;  4K5W A;  4IZ8 A;  3SHL A;  2PW7 A;  5F2D A;  5KRU A;  2EY2 A;  2SNM A;  4ZQ3 A;  1EY9 A;  4KY6 A;  3SR1 A;  1EYD A;  2EYL A;  2F0I A;  5IGF A;  4H7B A;  5IGG A;  4ZUI A;  3ERQ A;  1KDC A;  1A3T A;  2F0W A;  3D4W A;  4K8I A;  4R8N A;  5I9O A;  1TQO A;  4PMC A;  5JAV A;  4NP5 A;  3RUZ A;  1TT2 A;  5M9O A;  5IGD A;  4E6I A;  5CV6 A;  1JOQ A;  4G57 A;  5KYI A;  1TR5 A;  4J1M A;  2F0M A;  4HMJ A;  2QDB A;  1STY A;  3SK8 A;  4ME5 A;  3MXP A;  1SNP A;  2F0J A;  1NUC A;  2PYK A; 
#chains in the Genus database with same CATH topology
 3HOW B;  3G48 A;  1HZC A;  5C6A A;  4NKL A;  4KKS A;  4UPA A;  4JI5 L;  3HOZ B;  5LL6 X;  3K5N A;  1V1O A;  1BQQ T;  3K5O A;  5IYC H;  5ELE A;  3UDX A;  4DNI A;  2O5I C;  1B2T A;  2N3S A;  4F7X A;  1V1P A;  4MTN A;  4IFD G;  1G51 A;  4IQZ A;  1JR0 D;  4DAM A;  5LMN W;  1PRT B;  4UY8 C;  1YHQ A;  1NBW A;  1DON A;  3BDC A;  1WCM G;  1WJJ A;  3F2D A;  1EQQ A;  2WIN B;  4DPG A;  1QJO A;  1DXM A;  4OIJ A;  4B3T L;  2WB1 G;  3VR5 A;  1C8C A;  2EYM A;  1NNX A;  5JEA G;  1FGB D;  4K6L A;  2IW3 A;  3I4L A;  5HGQ A;  3HOU B;  4XT1 B;  3DEP A;  4AIM A;  1STH A;  4QMG A;  1EY8 A;  3KLS X;  3S1N H;  3PUW A;  4GKK Q;  3VR4 A;  4P2C B;  3RMH A;  2XN9 C;  2JYO A;  4P75 A;  4H0L C;  4DK1 A;  4WJW A;  1FVI A;  1Q8K A;  4AQY Q;  4JI4 L;  4OX9 L;  1YHB A;  1GVP A;  3NQI A;  4DV3 L;  1GXD C;  3A5Z B;  4DKA C;  3A0J A;  3I8Z A;  4QL5 A;  4DAP A;  1NAP A;  1QNK A;  4RGO S;  2F0T A;  4HIM A;  1GM5 A;  1JT8 A;  2EQS A;  4QCL A;  1EQR A;  1YVC A;  4JI3 Q;  3QIA A;  1SFO B;  2BA1 A;  4JK1 C;  4C3J G;  4HIO A;  5CC4 A;  3ULP A;  2VUM H;  1I94 Q;  2F3V A;  3SK5 A;  1VQE A;  1G8Z D;  2VXW A;  1RDP D;  5KRU A;  2PI2 A;  4ZQ3 A;  2YU9 H;  3K7U C;  1IKM A;  4ALP A;  5KYI A;  4HJ8 A;  4K8I A;  5M9O A;  3I7F A;  3TEH B;  1Q7Y C;  1TY2 A;  4WJ4 A;  2B2T A;  1D1I A;  3MC0 B;  1PV4 A;  4JBK A;  3PUX A;  1BF4 A;  2UXB Q;  1EY0 A;  4O0A A;  5IP9 H;  1A2U A;  1GUG A;  1RL2 A;  4LFC Q;  2XRQ D;  1HZA A;  3RZO H;  2AQ2 B;  4JI6 Q;  1D8L A;  4HTH A;  4CGY B;  1F9S A;  1SLJ A;  3BDO A;  2F0U A;  3CCQ A;  2H5X A;  4B08 A;  3NE5 B;  4X3S A;  4GOP C;  1M8A A;  1X3E A;  4OEL B;  2P5Z X;  2XVS A;  2RBM A;  1CZG A;  2AUK A;  5DM7 3;  1B1Z A;  3KYH C;  3OW2 A;  1VQ9 A;  3G4S A;  3S1N B;  1YZ6 A;  2VNU D;  1UEB A;  2R93 B;  4JI7 L;  2EJM A;  2UUA L;  1LM0 A;  4A3G G;  4A3B B;  2F0L A;  3D4D A;  3V96 A;  1AFP A;  4C56 C;  4PZ7 A;  2C9O A;  4PZ8 A;  1PRT C;  4A3E G;  2A69 C;  1WD0 A;  2A6E D;  1WYD A;  2F0D A;  3H15 A;  2G9D A;  4QQB X;  2MNA A;  1QUQ A;  1EQT A;  1X32 A;  3PO3 G;  4A75 A;  4FXD A;  1SAP A;  5AFW A;  1A2T A;  3NXW A;  4I65 A;  4MIU A;  2F4V L;  2PCF B;  3HFZ B;  4A3J H;  2UUC L;  2K04 A;  5A35 A;  4C2M H;  3FEW X;  5C5L A;  2R92 H;  1RTO A;  5T1G A;  1EY5 A;  4HIK A;  3GD7 A;  5FO9 B;  1Z47 A;  1Q8I A;  2QW7 A;  4C3I G;  4FVM A;  3S15 B;  3Q0A A;  3T51 B;  3CQZ B;  1CSQ A;  3E9I A;  3E0E A;  2L12 A;  5ELD A;  3G7L A;  3TME A;  4JI0 Q;  1F2Z A;  4DR1 Q;  3HOV B;  1WOC A;  4RFB A;  3ND9 A;  1C48 A;  4R4C A;  4KHV A;  3Q22 A;  2EY6 A;  2QIL A;  2HHH L;  1OXV A;  1WTV A;  2AKW B;  3H09 A;  1K0S A;  1YHA A;  1K0R A;  1ROD A;  4K0K L;  4LW1 A;  2B2V A;  4O2D A;  1L0Y B;  3QR8 A;  3UDG A;  3RZO B;  4CJ1 B;  1X9N A;  3GTL H;  4H7B A;  1IBL Q;  2CWA A;  5CYU A;  3J7Y W;  1TQO A;  5JPN C;  2NZ1 D;  1EEF D;  5E4X A;  3PIO 3;  3FP9 A;  1XNQ L;  1CZW A;  1JB3 A;  1KLU D;  4DK0 A;  4AH6 A;  1N32 Q;  4DN4 M;  4DV1 L;  3PGZ A;  4DV7 Q;  2F0P A;  3FKI H;  2BH2 A;  1U5K A;  4LK1 C;  4DUZ L;  1YEZ A;  2R7Z G;  5C44 G;  3LNN A;  4DR4 L;  5DM6 3;  4HJ5 A;  1XPO A;  1HZB A;  2B2W A;  2SEB D;  2A68 C;  2WAQ B;  3CCS A;  3R3O A;  3W1G A;  1AZP A;  2E2J H;  4BA2 I;  1LO5 D;  3K8A A;  3J7Z C;  4X65 L;  1EWC A;  4LFB L;  2WV6 D;  2KA7 A;  5COR A;  1ZEQ X;  4KN4 C;  1N33 L;  4CDD C;  4YCU A;  2F3W A;  3OTO L;  3CCL A;  2JE6 I;  1XWE A;  1IHZ A;  3TDQ A;  4BY1 G;  1B9N A;  1BBU A;  3ND8 A;  4A3J B;  1VQ6 A;  1AEX A;  5CV9 A;  5M3F G;  1J6Q A;  1BR9 A;  5HGT A;  1DOL A;  1KNE A;  4JBJ A;  5CV7 A;  2R92 B;  1NTG A;  2VY3 A;  5EKK A;  2WKD A;  2Q8T A;  4JW0 A;  3LWU A;  5C3W A;  3HRZ C;  2L11 A;  5C5M A;  3SXH A;  2Z0S A;  2O2L D;  5GRO A;  1QUQ B;  5CBE E;  1Q86 C;  2RCF A;  1X65 A;  2D62 A;  3TN2 A;  5IOD A;  2NZO A;  3DWA A;  1KRT A;  2RHQ B;  2ZXP A;  3NEL A;  3GTK H;  2H4O A;  4DA2 A;  1JJG A;  2F1M A;  3AFP A;  2UU9 Q;  4A3D G;  1HHV A;  4LF7 Q;  1K83 H;  3L3O C;  2VQF L;  4WFN 3;  4X64 L;  4A3K G;  4EVO A;  5EKL A;  1KC8 C;  2A1A A;  4B3S Q;  3NHH A;  2GVA A;  5I9P A;  4IUP A;  3KDF B;  2Q2T A;  5CV5 A;  1EWH A;  2WFW A;  1PLF A;  4RMF A;  2ZJQ A;  2EXZ A;  5K36 G;  3GTP H;  4L5S A;  5C0X J;  2HIV A;  5C3X A;  3FKI B;  5C4J B;  4OO1 H;  3HKZ B;  2F0S A;  1FNU A;  2NN6 I;  3PSI A;  1VF5 C;  1IBK Q;  1CHP D;  4GN4 B;  1MIU A;  3NWS A;  2JA5 B;  2B29 A;  2E2I H;  3AFQ A;  4A3L G;  1LTT D;  4A3F G;  1E24 A;  2E2J B;  4X3T A;  4ME5 A;  1SNP A;  5TSS A;  5IY0 A;  2PYK A;  3HS0 C;  1S5C D;  3KOJ A;  1C4Q A;  1O78 A;  3VR3 A;  5J22 A;  1PZJ D;  3DEO A;  3NBH A;  3BZD B;  5IP7 G;  4FO2 A;  3M4O H;  4JI2 Q;  4DR2 Q;  1TU2 B;  4IPH A;  1KDA A;  4X62 L;  1AN8 A;  3J80 E;  3SVM A;  1F2L A;  2H1E A;  3S14 H;  3K0Y A;  2IX3 A;  4ZKB B;  2L5T A;  3EFX D;  3CCJ A;  4JG2 A;  4DR6 L;  2LY7 A;  1A0I A;  3HEJ A;  3CCR A;  4X3K A;  2OTL A;  5ELF A;  2PNR C;  3RLN A;  2RDH A;  1PZI D;  1S5B D;  3NTH A;  1J5E L;  1VQJ A;  4BBR G;  2J4X A;  4NXN Q;  1H95 A;  4A3I G;  4C3H B;  2B2Y A;  2EJG C;  3M7N A;  5GAE C;  1HR0 L;  1P8L A;  1VMP A;  3JAM c;  1TWA H;  1Y1W H;  4KY5 A;  4FXG C;  5ELN A;  1PH1 A;  2ZXO A;  1A3U A;  1QG7 A;  1VQD A;  3M3Y H;  1ENF A;  1BNZ A;  3BYY B;  3FVQ A;  2NN6 G;  4RCN A;  4U68 A;  4A3C H;  1IW7 C;  3VA5 A;  3SE0 A;  3EJI A;  1PTO D;  4LF8 Q;  2ID0 A;  2K4K A;  2KBN A;  1SN8 A;  2BH8 A;  3I2Z A;  4DR7 L;  1SNC A;  3A74 A;  3GTP B;  1IYU A;  1Y14 B;  5JOB A;  3J81 E;  4LAA A;  1E2V A;  2K33 A;  1WCM B;  2EOT A;  3CKI B;  4MN3 A;  2JA6 B;  2CKZ B;  2DY8 A;  3AQQ A;  1N34 L;  3PUY A;  4B3M L;  1KAW A;  1ILP A;  3T1Y Q;  2A6H D;  2K14 A;  1YJW A;  5IE8 A;  3PO2 B;  3J81 j;  5FOB B;  2VUM G;  2D0O A;  3W2D A;  1F2Y A;  1SNQ A;  2UXD L;  1VMC A;  2XNA C;  4POF A;  1Y1V G;  2E76 C;  4MZ9 A;  1IL2 A;  3BG3 A;  4NMZ A;  4EQO A;  1C7Y A;  3I4N B;  4OHJ A;  2Q2U A;  4JVZ A;  5M3M G;  4LMQ D;  3CCU A;  4HJ7 A;  5F2D A;  1IL8 A;  3S2D B;  4KY6 A;  4ZCK A;  1EYD A;  2EYL A;  3Q23 A;  2JK8 A;  1WVL A;  5LMN L;  1JC7 A;  1KDC A;  3D4W A;  2JEA I;  1D1K A;  4ME3 A;  1YNJ D;  2K5N A;  2LMC B;  5JPM C;  3OIP A;  1HA6 A;  4DAY A;  3S14 B;  1HRJ A;  3CRK C;  1PH7 A;  5G3L D;  1N8R C;  1HCZ A;  4JI4 Q;  3UDF A;  4NXM L;  3NBH B;  3QWN A;  1D2B A;  1YNN D;  5EKI A;  1QZG A;  4C3J B;  4DV3 Q;  2N55 A;  1B7Y B;  4QY7 A;  4K2K A;  5HY6 A;  1KD1 C;  2KHI A;  2NWG A;  3GDE A;  4DF7 A;  3T16 A;  2K32 A;  3K5L A;  3NWT A;  1TWA B;  1K9M C;  2NVY H;  5IYD H;  1HNX Q;  3A8I E;  3ULJ A;  3H6M A;  2VB3 X;  4M8A A;  1F2M A;  2EVB A;  2DJG C;  4P73 A;  4A93 H;  3M3Y B;  2BCO A;  1PH8 A;  1SYF A;  1U4L A;  1NR4 A;  2ZT9 C;  2BDN A;  3I4M B;  1EY6 A;  2JP1 A;  2RSO A;  1VQH A;  1E1T A;  3GTJ B;  2WP8 J;  1B70 B;  1L1O C;  1ZXT A;  3P20 A;  3OOC A;  4OWX B;  2QEX A;  3MXG A;  2TMP A;  1S40 A;  4IUR A;  3KF6 B;  3AEV A;  1TS5 A;  3D8G A;  1Y8N B;  4IUQ A;  4B9X A;  3HOW H;  3I4O A;  3MFY A;  1D5X C;  1C0A A;  2OF1 A;  2XTI A;  3U4Z A;  1LUZ A;  1STA A;  2E2H B;  2C5C A;  4KY7 A;  4CDC C;  1PDQ A;  2SDF A;  3Q24 A;  5EGT A;  3HOZ H;  1V1Q A;  3CME A;  4UP7 A;  2FMM A;  1TS4 A;  1QB5 D;  1VQG A;  1D7Q A;  2D0P A;  1CKN B;  3L2P A;  3OSO A;  2KOL A;  4IPG A;  2F0E A;  1ONL A;  1I50 H;  2HDM A;  5DAU A;  2DJF C;  1SMY C;  3NQT A;  3W3A A;  4R4O A;  4JBM A;  1QWY A;  2JA7 H;  3M85 A;  1FJG Q;  4LNQ A;  1IYJ B;  2IHF A;  3EBE A;  3EN2 A;  3MTS A;  1HQR D;  3KJO A;  3U9O A;  3QJY A;  4XQJ A;  2F0I A;  1O7L A;  1LTI D;  3K81 C;  1VQB A;  2PMZ E;  4DAY B;  3LWE A;  2K5W A;  1LTR D;  5JAV A;  4OWW B;  5KNB A;  4DNT B;  3WWV A;  3BVM A;  2HDL A;  2JA8 H;  4DV2 L;  3X3M A;  1GUW A;  1B53 A;  2F4V Q;  4A93 B;  1EOT A;  1VQN A;  3FMC A;  1WI5 A;  3PMF A;  3AMU A;  2B3G A;  3H3V I;  3STB D;  1IBM L;  2MO1 A;  4JV5 Q;  4NB3 A;  1WTQ A;  3M7G A;  1W2B A;  3CCM A;  3SGI A;  2X69 A;  4IOA A;  3KBG A;  1U0L A;  1EU4 A;  2CCZ A;  4CDE C;  2J7Z A;  1VS0 A;  4FF1 A;  3MWY W;  1XPU A;  1SYE A;  1J9O A;  1SFO H;  2HHH Q;  4GNX C;  5A2Q E;  2OEO A;  2BOS A;  4K0K Q;  3NSW A;  3HZX A;  4R8I A;  2KVM A;  1YI2 A;  4EGV A;  4DV0 L;  4UP9 A;  2B63 G;  4RAU C;  5DEH A;  2FMC A;  4R4I A;  4MNO A;  1QE6 A;  2R7Z B;  1XNQ Q;  4H44 C;  5GQO A;  3HG9 A;  1GUN A;  2ICE C;  1LAB A;  1TII D;  4DV1 Q;  3I91 A;  1I50 B;  1Y69 U;  3K57 A;  1D5M C;  2MUY A;  2JA7 B;  1OTC A;  1IZ6 A;  2IPK D;  3H0G B;  4WRD A;  4DR4 Q;  3MXN B;  3TS2 A;  2Y0S E;  4DUY L;  1SJE D;  1PH3 A;  4OGQ C;  3S16 H;  4XYQ A;  5IT9 E;  4RH6 A;  4AYB E;  1BCP F;  5C3E H;  4ILW A;  1CA6 A;  5M3F B;  3FDT A;  2KED A;  1YJN A;  1WTP A;  2B2U A;  4F88 A;  4QUF A;  1PVO A;  4LUV A;  4K8J A;  5EAY A;  4J15 A;  3T1H L;  4A3M H;  3KF8 B;  2JA8 B;  1LLR D;  3I70 A;  3U58 A;  3T53 B;  1IKL A;  2R93 H;  3QG1 A;  5D3I B;  3CXC A;  1KAB A;  1YIJ A;  4FF4 A;  2OT2 A;  3ZJY C;  4O1N A;  5CR3 A;  1R4P B;  1PFS A;  4GS3 A;  4A3B H;  4X3U A;  4A3D B;  1EY9 A;  1DZ1 A;  3D3R A;  3J80 L;  4KKU A;  1DCZ A;  1U4M A;  4A3K B;  3K59 A;  3CC4 A;  1TR5 A;  2F0M A;  1PYB A;  1KQS A;  4V19 0;  1JQY D;  3K0X A;  4O42 A;  2F0J A;  4TVA B;  5KND A;  1HNZ L;  5JJK A;  5BR8 L;  1SMX A;  2UUB L;  4X64 Q;  3I90 A;  1A3V A;  5EPK A;  1YJ9 A;  3OIQ A;  1X54 A;  5E1F A;  3E0J A;  3S1M H;  3D6C A;  1EOV A;  3A8J E;  4N9T A;  2CQA A;  3S15 H;  1O7Y A;  1JJ2 A;  4FYD A;  2E5L L;  1FD7 D;  3CQZ H;  3OHX C;  5FLX L;  3HOV H;  2VQE L;  3B6Y A;  1S5D D;  1EIG A;  2Z8L A;  1H9K A;  4FF3 A;  2NVQ B;  4R4T A;  2A6E C;  2PZT A;  4ULL A;  1RCV D;  3AYH B;  5FO7 B;  3J80 i;  2CHB D;  4GN5 A;  2I46 A;  3F8T A;  4BY7 G;  4K6D A;  1K8G A;  4XDX A;  2IX0 A;  1JOK A;  3HOY G;  4FNF A;  3QOL A;  3GTM B;  1Y1W G;  3SEB A;  4V0B A;  3S16 B;  1RF2 D;  3NUC A;  3HP3 A;  2TSS A;  4L5T A;  4CDF C;  1BBX C;  5C3E B;  1V1P B;  5IGC A;  3D6W A;  3A7L A;  3BU2 A;  1BXT A;  2YV5 A;  3CW2 C;  3GTQ H;  3M4Y A;  3K7A H;  1KHI A;  3RN2 A;  4A3M B;  2SNS A;  2VL6 A;  4LF5 Q;  1G91 A;  2KEC A;  2PQA A;  3SK4 A;  1C9O A;  1EYC A;  3IKJ A;  5IGB A;  1JB7 A;  4LF4 L;  3MAQ A;  4B3R L;  4BBR B;  3R2T A;  5FLM G;  1B44 D;  4A3I B;  4N9P A;  2F0G A;  4QB4 A;  2Q2H A;  2O5J C;  2OWO A;  2MJ8 A;  1W6K A;  3CC2 A;  3R2I A;  5CV4 A;  1EEI D;  1EFW A;  4DU9 A;  3J81 i;  4LFA Q;  2LKV A;  1EIF A;  3P7J A;  2L55 A;  1J5E Q;  2ZTC A;  5KGU A;  4K5X A;  4YY3 L;  2IL8 A;  4GLA C;  1V8Q A;  2F0Q A;  3CF5 A;  5JVH 3;  4IUT A;  1PZK D;  3BYT B;  1LT3 D;  1RJT A;  3QOJ A;  1N36 Q;  1U9R A;  4K14 A;  1EZ6 A;  1SYD A;  4LUZ A;  3VYR A;  5IGF A;  2YTV A;  4XIG S;  3T4A C;  1BCP D;  1MKH A;  1EIY B;  3S1M B;  5M5Y B;  5IGD A;  2A74 C;  3U4V A;  4JBW A;  2ZM6 Q;  1I5F A;  5C4X H;  2JEB I;  4HSV A;  2Y0S G;  4BBS B;  3BVG A;  4YIJ A;  4ZUJ A;  1NR2 A;  1B3A A;  1VQC A;  4DR3 L;  4DR5 L;  1VQ4 A;  4AYB G;  2D5D A;  1I6H B;  4Q0F A;  1PTO B;  5BN4 A;  5CMD A;  5IYD G;  2N78 A;  4OON A;  4B3M Q;  2YTY A;  1OO9 B;  2R7D A;  2F4I A;  1KLG D;  1HXY D;  3W1B A;  4HMI A;  4ZLT F;  2MFI A;  2UXD Q;  4X66 L;  2Q8R E;  2KJX A;  3GTQ B;  1I4Q A;  3KK7 A;  3K7A B;  5M5X B;  3HOX B;  4DV5 L;  3A8K E;  5FO8 B;  4HR7 B;  1CQV A;  3DUZ A;  4ODG A;  4KD3 A;  5C4J H;  1Q82 C;  4LF9 Q;  2B39 A;  5IWA Q;  4UP8 A;  1QIL A;  1JE4 A;  2OQK A;  3S17 H;  4I7A A;  1A63 A;  1E2W A;  3PIP 3;  2PPB C;  1E3P A;  1PRT D;  2A69 D;  4HJA A;  2JA5 H;  1KDB A;  1WFQ A;  4R4Q A;  2ZXR A;  2K5H A;  4FF2 A;  4NXM Q;  3HOW G;  2CFM A;  2ZTD A;  1PTO F;  4IJH A;  5CV8 A;  2EY1 A;  1MSG A;  1GD7 A;  3VYU A;  5IYB G;  3MZ5 A;  3OMC A;  3HOZ G;  1HNW Q;  1I3Q B;  2CH4 W;  1I4P A;  4PNY A;  3A56 A;  1UWV A;  1BO0 A;  2F0V A;  3KLR A;  2QKI C;  4G7H C;  3X3N A;  1GO3 E;  4IUV A;  1VQ5 A;  1RTN A;  1VCI A;  2NVX B;  2EZV A;  5CBA E;  2JJQ A;  1FNW A;  4TRD A;  1ZYR C;  1SE2 A;  3H94 A;  1XMO Q;  4KHP Q;  1Z9F A;  4JOI A;  3OWF A;  1CQF A;  1L1O A;  4Y7N B;  1FYC A;  5C4X B;  4C3H H;  5HUR A;  5GAG C;  4GKK L;  1MI2 A;  3C1E A;  4JPB W;  4AQY L;  1TWG B;  2SNM A;  3HOU G;  3K5M A;  5J3B A;  3JC6 6;  2Q2I A;  1RHP A;  1EYG A;  1XMQ L;  1OXS C;  5AJ3 Q;  3FHW A;  3I3C A;  4HMJ A;  5G3L F;  2QDB A;  5NUC A;  4IFD H;  3F1Z A;  4IFD J;  4Q5V A;  5C0X H;  3GTO B;  3R93 A;  3WOF A;  1E22 A;  2IHE A;  2RVL A;  2RSN A;  3D0F A;  4DK6 C;  1OXU A;  1WCM H;  1O80 A;  1I94 L;  2A68 D;  3VA7 A;  3S17 B;  2WAQ E;  2JA6 H;  1V9P A;  2HQE A;  1DYQ A;  3E5S A;  2PZW A;  1SRU A;  5JEA J;  5FJ8 G;  3S9W A;  1X56 A;  2JXM B;  3PO2 H;  2V1C C;  2XWJ B;  1K8A C;  2JA9 A;  4Z9C B;  2QGQ A;  3OWE B;  3U50 C;  3I4N H;  2F0K A;  4Y52 H;  1A62 A;  3PF5 A;  3EQL C;  5JJL A;  1A6X A;  1SYG A;  4LF6 Q;  2DNC A;  3C2P A;  1ILQ A;  3MEH A;  2GVB A;  5IYC G;  3S2D H;  2PQE A;  3GP7 A;  2UXB L;  1LTA D;  3PQI A;  5FK9 C;  1YBY A;  4JI1 Q;  3GV6 A;  2XWB B;  3TP5 A;  3J7A V;  3LX0 A;  2UXC L;  1PH6 A;  1TWF B;  1VQ7 A;  2A6H C;  1IXR A;  3IFD A;  2OQ0 A;  1O7I A;  4RKL A;  1WTO A;  1M1K C;  3AU7 A;  2FXQ A;  4KV6 A;  4TSS A;  2NTT A;  2QDL A;  4C3J H;  4N8X 1;  1F77 A;  4GNX A;  4CHT B;  3GTG B;  1LT4 D;  1EYA A;  3RZD B;  2NUC A;  1D6E C;  3PF4 A;  2IT1 A;  2ATW A;  2EIF A;  1II3 A;  3V2T A;  2B63 B;  3MHB A;  1VQP A;  1BVS A;  2XRS D;  1DOK A;  1YNJ C;  1T9H A;  1B9M A;  3CRL C;  2HUG A;  3RD4 A;  4NPS A;  1X3Q A;  5CGK A;  3HKZ E;  3I4M H;  4JI5 Q;  2G9H D;  2BE5 C;  2N88 A;  4IZ8 A;  5ELB A;  2EY2 A;  3GO5 A;  3GTJ H;  2AUJ D;  1QVG A;  5I9O A;  1TVX A;  1PFB A;  4NP5 A;  3VDY A;  1LTL A;  2WB1 B;  3AB9 A;  3URY A;  4FP5 D;  3QO2 A;  2Z4I A;  3TZD A;  3KFU A;  2L15 A;  5GAD C;  1CK1 A;  1LV9 A;  2CWP A;  2QCP X;  4A4I A;  4DUY Q;  1TWC H;  4DR1 L;  3ER0 A;  1G2T A;  1VQO A;  1NSN S;  1XX8 A;  2ENB A;  4B3T Q;  1PYW D;  2E2H H;  3T13 A;  1JWS D;  2LFN A;  1WTX A;  4XT3 B;  1EWI A;  3TP7 A;  1K73 C;  1JOR A;  2LS0 1;  3W5O A;  2K01 A;  1WD1 A;  2MPM A;  3HOV G;  4A3G H;  5BN3 A;  2PZU A;  4QIW B;  2B8F A;  1IBL L;  2O4X A;  3HGB A;  1DOM A;  4FXK C;  1SXT A;  4A3E H;  4POG A;  1X55 A;  2B2V C;  4CBV A;  5IP9 G;  4OX9 Q;  2VZA A;  1N32 L;  2Z6K C;  3EVQ A;  3KUP A;  5LHY 1;  4DV7 L;  4RA8 A;  1TWH H;  4WJ3 M;  1K8O A;  5LMU L;  2CW0 C;  2ZTE A;  2QEJ C;  1AZQ A;  3U9S A;  2MQH A;  4G7O C;  1ESR A;  4EQ5 A;  1G6P A;  1IW7 D;  2E2D C;  4C3I H;  2CVR A;  1AW7 A;  4IPD A;  2J0T D;  2EYJ A;  2HIX A;  3ONA B;  5I2X A;  2HQL A;  2E74 C;  2B2W C;  4BWG B;  4L5Q A;  2K5Q A;  2RQX A;  1Q1E A;  3J80 c;  2AWO A;  2K6A A;  4XYO A;  4BY7 B;  2I0Q A;  2WAQ G;  4PG3 A;  1K3R A;  1Q3L A;  1X6O A;  3KJP A;  2FHT A;  1VQI A;  3N6R A;  4IPC A;  1ENA A;  1L2F A;  1B8A A;  5D3D A;  4G4K A;  2JN4 A;  3FRP B;  4DV4 L;  1XPR A;  1EIH A;  3PCO B;  1VQM A;  4KK7 A;  4OWT B;  1STB A;  1I4G A;  3BVZ A;  4P74 A;  3F2B A;  1KTK A;  4GOP A;  4A3J G;  1TWC B;  2K28 A;  3O13 A;  2X6G A;  4DNR B;  3L9A X;  3ZYY X;  4PMB A;  2ASB A;  2F03 A;  2R92 G;  2K7V A;  4DXF A;  1DGS A;  1DM0 B;  5I4D A;  2PW7 A;  4IUU A;  4YWM A;  5L37 A;  2UU9 L;  4LF7 L;  5FLX c;  2R7Z H;  5C44 H;  2YTX A;  4C1N I;  4PZ6 A;  5IGG A;  2EDG A;  1V43 A;  4A3G B;  3RUZ A;  5EPJ A;  3UI2 A;  1K28 A;  4G57 A;  4B3S L;  1TS3 A;  1YNX A;  2L0C A;  3TRE A;  2IX1 A;  1SE8 A;  3BZC A;  2A73 B;  4A3E B;  1PMR A;  4LF4 Q;  1SJH D;  3H0G H;  4JI7 Q;  1SR3 A;  1I4H A;  2UUA Q;  4ZK9 B;  4OEM B;  3KLW A;  3PO3 B;  5ELC A;  2N8N A;  1TWH B;  1WTH A;  2M2L A;  3WDN A;  1NJI C;  4BY1 H;  2RCN A;  5M3F H;  2OXP A;  2PW5 A;  3DMU A;  2K5V A;  1IBK L;  4YY3 Q;  1F9Q A;  2IJ0 A;  3FKI G;  4C3I B;  2VS1 A;  1JIC A;  3HKZ G;  5ELO A;  2UUC Q;  3S24 A;  3E9H A;  4CKB A;  3C46 A;  1LTG D;  2JA5 G;  4A3D H;  1H9M A;  4RHS A;  2WAC A;  1NY4 A;  2EYP A;  4A3K H;  4JI2 L;  4YWK A;  2HCC A;  4JI8 L;  1S4Z A;  4OO1 I;  3WOE A;  4KHZ A;  2C35 B;  4DGZ A;  2Z9H A;  1S3O A;  2NZH A;  1AE3 A;  1BCP B;  1PH2 A;  2F3I A;  5K36 H;  1HH2 P;  1M4V A;  1VQL A;  5KNC A;  2ZJP A;  1CSP A;  5C44 B;  1T5E A;  1SMY D;  2KEN A;  2NVQ H;  1U4P A;  4QJF A;  5EBC A;  2EJF C;  2B2Y C;  4DV5 Q;  4A3L H;  2KHJ A;  3FPP A;  1ZKO A;  1W3S A;  3A55 A;  4DUZ Q;  4LF8 L;  1NCV A;  1SND A;  3JAM i;  1ET6 A;  2D2C C;  3GTM H;  1PYS B;  1JCK B;  4HJ9 A;  2G5D A;  3UE1 A;  4RGM A;  1P16 A;  3S2H H;  1PFN A;  5IP7 H;  1MSH A;  1UE6 A;  2F0W A;  4MHE A;  4BY1 B;  1HTP A;  1B4O A;  1TT2 A;  1J8I A;  4HED A;  1EUJ A;  5E4W C;  1CKM A;  4E6I A;  4X65 Q;  4LFB Q;  4J1M A;  1UUP A;  1N33 Q;  4DV6 L;  5C0X G;  2L9H A;  1STY A;  2K75 A;  3T1Y L;  4XQN A;  4JYA L;  3F2C A;  1UE7 A;  4KKT A;  3OTO Q;  1K8M A;  3S1Q H;  4OO1 G;  4WOR A;  2RF4 A;  1H9S A;  4CKC A;  1KIX A;  4BBR H;  3EA6 A;  1X3F A;  4A3I H;  2JA6 G;  1HUN A;  2F0H A;  4DAV A;  1MGS A;  3RN5 A;  4J6H A;  4XQQ A;  3NTI A;  1L0W A;  3ERS X;  3PO2 G;  3K80 C;  1TY0 A;  1XNR L;  4RG1 A;  4EX5 A;  1HFG A;  1LT5 D;  5K5P A;  3IRB A;  3MVV A;  3I4N G;  2EPB A;  1S5E D;  4H13 C;  4R1J A;  2NYZ D;  2NN6 H;  3G71 A;  1KRS A;  1OXX K;  1EZ8 A;  3A7A B;  2EY5 A;  2I5H A;  1UE5 A;  2VQF Q;  5M5W B;  4P72 A;  2M9V A;  3CP0 A;  1XYI A;  1PRT F;  3F2U A;  1LTS D;  1XMQ Q;  2RA4 A;  3CPW A;  3A54 A;  1Y8P B;  5M5Y H;  1EY7 A;  2IWH A;  1HNX L;  3ICE A;  4J8Q A;  1BOS A;  3J7A F;  4A3F B;  2ALY B;  4BBS H;  3P1H A;  1PA6 A;  2WII B;  2R6G A;  1FR3 A;  1Y1V H;  3J81 L;  1PH9 A;  4IJL A;  1I6H H;  1PTO H;  3DWP A;  4K2L A;  5M3M H;  2I5L X;  3IL8 A;  1SSO A;  3S2H B;  2Z1C A;  1UEA B;  1JMC A;  1ML0 D;  1CA5 A;  1BCP C;  1HQM C;  4A3C G;  1VQK A;  2GN5 A;  4IO9 A;  2V4D A;  3I4M G;  5M5X H;  3TS0 A;  3HOX H;  2A5H A;  3OW7 A;  3RNU A;  4LUO A;  3S1Q B;  3A5U A;  4BXX H;  4K5W A;  3NTK A;  1GKH A;  4RGT A;  4PMW A;  4X62 Q;  3TSS A;  1MHW C;  1CT1 D;  1ESF A;  2UXC Q;  1A3T A;  1VQA A;  2Q8I B;  1M90 C;  4DR6 Q;  2X6L A;  1JOQ A;  2K5D A;  5CV6 A;  4BA1 I;  3SK8 A;  5EQ0 A;  3MXP A;  1LAC A;  3NP8 A;  5IT9 c;  4M1U B;  1H9S B;  4KTA A;  4GLV B;  1I3Q H;  3E3X A;  4L5R C;  4R9W A;  3BS1 A;  1E0B A;  1LT6 D;  3DLL A;  3VR2 A;  1HR0 Q;  1E1O A;  4QF4 A;  1FJG L;  2RKS A;  1AH9 A;  2NVX H;  2OCE A;  2EXD A;  2M00 A;  4RHR A;  1XTD A;  3G6J B;  2F0N A;  4BS9 A;  3MFG A;  3SDZ A;  1S72 A;  3DM1 A;  3PUV A;  4LJZ C;  5BN5 A;  3VR6 A;  5KYL A;  4DR7 Q;  3NEM A;  5JVG 3;  1T5X D;  2KCM A;  4CKE A;  4Y7N H;  2ZJR A;  1QCB D;  1FL0 A;  2AQ3 B;  2CH4 A;  1DD2 A;  3TQY A;  2VUM B;  2VW9 A;  1Z6H A;  4JV5 L;  1Y1V B;  3BJU A;  5E7N A;  1TWG H;  1ICF B;  1UE1 A;  4QUC A;  2YU9 B;  1N34 Q;  4GKJ L;  2KQ3 A;  5M3M B;  5J39 A;  3I73 A;  5KIX A;  4HCS A;  3PUZ A;  4YHH L;  3KBX A;  2VB2 X;  4A93 G;  1JJC B;  1HPC A;  2SOB A;  3KDF A;  4DXG A;  1BBW A;  1KNA A;  1XXG A;  2NVT H;  1Q81 C;  1Q90 A;  5ISR A;  1TS2 A;  2DN8 A;  3GTO H;  4XXE A;  1QNU A;  1I4X A;  1MJC A;  3OPO A;  2XIW A;  1SYC A;  3MA2 B;  3CCE A;  4EQP A;  2I5M X;  5LMN Q;  1NMG A;  2Z6K A;  4CJ0 B;  1JWM D;  1STG A;  4G7Z C;  4RGN A;  1MD2 D;  3BZK A;  4KJN A;  1MBY A;  4DFA A;  3ULL A;  1CM9 A;  5C4Z A;  3DWQ A;  4TKO B;  5DLQ E;  1CUK A;  4NW2 A;  2AQ1 B;  1UAP A;  1D5Z C;  2PQA B;  5LMU Q;  5EJW A;  3CC7 A;  3CHB D;  3DM3 A;  1O7Z A;  2R7F A;  5EPL A;  3SR1 A;  3CPF A;  4ZKC B;  2DY7 A;  2XGT A;  3ERQ A;  4R8N A;  4L8J A;  2FFK B;  4RWS C;  1VF7 A;  1TWF H;  2JA7 G;  3H0G G;  3CCV A;  4ZAI A;  1HUM A;  2EE1 A;  3K6O A;  2R61 A;  4KN7 C;  3JAM E;  2K1B A;  1SEB D;  2PI2 E;  3TBI B;  3SK6 A;  3TP8 A;  3GTG H;  3RZD H;  2B2U C;  2A8V A;  4C2M B;  5COY A;  2K52 A;  1BDO A;  2R3Z A;  2E8G A;  2B63 H;  4UAI A;  4DV4 Q;  3PV0 A;  1A8V A;  2JA8 G;  3FPU B;  2MHV A;  1BKB A;  1SRO A;  1XJV A;  5A2Q L;  1PHJ A;  1FNV A;  5J1Z A;  3I72 A;  2NVT B;  4JI3 L;  1ASY A;  4GZY C;  3BDL A;  4YCV A;  1GHJ A;  2JQO A;  2PO4 A;  4UDU C;  1CI3 M;  1N9W A;  1SYB A;  2DGY A;  2MP1 A;  4C1N K;  4F87 A;  3TP6 A;  1AE2 A;  2PNH A;  3GTL B;  2E75 C;  3H3V H;  3H91 A;  3NEN A;  3QB3 A;  5JEA H;  2DUD A;  3HKS A;  2RHS B;  1SNM A;  4LWC A;  3J7A 5;  2NB0 A;  1NE3 A;  5JJI A;  1RKN A;  3R8B A;  2GA4 B;  2MO0 A;  1PTO C;  4DK3 C;  1R9T H;  1GHK A;  3MEF A;  1PFM A;  5IT9 L;  3S1R H;  3T56 B;  1JOO A;  1HTL D;  5DNF A;  1SE4 A;  5IIF A;  1ZYR D;  1BUV T;  4LFC L;  3RR5 A;  2B2T C;  4JI6 L;  4IOC A;  1G29 1;  3KLS A;  3Q8D A;  4DV2 Q;  3DXJ C;  1H9J A;  4L6T B;  4ABN A;  1QZH A;  1JE5 A;  2NTS A;  3I56 A;  5I6W A;  1QVC A;  2Z4H A;  1IBM Q;  4N8F A;  1Q1B A;  3UE0 A;  4KD4 A;  2AHO B;  1GJX A;  1I4R A;  2NBF A;  5C3E G;  4LF5 L;  4NDX A;  2B8G A;  1I6V C;  4PV1 C;  3VYT A;  1ICW A;  4JI8 Q;  1RD9 D;  3VYS A;  3GV3 A;  1Y8O B;  4PMC A;  3TZU A;  1PH4 A;  1SE3 A;  4KMU C;  4A3M G;  2KCC A;  4HID A;  4LFA L;  1L1O B;  2R93 G;  4APV A;  1NUC A;  5C4H A;  3CU7 A;  3GTK B;  1UNS A;  4A3B G;  2BA0 A;  2F0O A;  4DV0 Q;  3IFT A;  1LYL A;  4BY7 H;  1YNN C;  3HOY H;  1K83 B;  4B9W A;  1N36 L;  1EY4 A;  5IOC A;  3P75 A;  1GOZ A;  3ERO A;  3D31 A;  5LL6 S;  2IY5 B;  1B3Q A;  5FLX E;  1QOH A;  2EYF A;  2QF7 A;  5FKA C;  1E7Z A;  2KEE A;  2RDG A;  5GAH C;  2YYZ A;  3KF6 A;  4RKB A;  4JI0 L;  1W6J A;  2OTJ A;  4CJ2 C;  2ZM6 L;  2FJ2 A;  4H02 A;  1GUO A;  3N52 A;  1HA5 A;  1R9T B;  2ES2 A;  1X3G A;  3CMA A;  3S1R B;  2QA4 A;  4EQN A;  2LSS A;  5FLM H;  2KCN A;  3L0O A;  2XSC A;  4DV6 Q;  1CKN A;  4HN7 A;  1B50 A;  4JYA Q;  2E2I B;  1NMF A;  2K03 A;  1CTM A;  3T1H Q;  2L1B A;  1LTB D;  4BBS G;  1CFM A;  3OYY A;  3PIO A;  3Q6S A;  3D4R A;  4GLX A;  4QGU A;  3M4Q A;  5I2Y A;  5I6Y A;  4JC0 A;  1EFI D;  3MXU A;  4ID6 A;  4F8M A;  1KXL A;  1SNO A;  4UHV A;  3PO3 H;  3I55 A;  4LF9 L;  1QVF A;  1ENC A;  3G6E A;  5IWA L;  2JSO A;  3M4O B;  1XNR Q;  1WTR A;  1R4Q B;  2K05 A;  3PIP A;  1GUS A;  2DNE A;  5EBD A;  1SDF A;  1KL9 A;  2LXJ A;  3HOX G;  5D14 A;  4U67 3;  4FDB A;  2FIN B;  1HNZ Q;  1HZ9 A;  5BR8 Q;  3NK9 A;  1AP0 A;  3E6Z X;  2UUB Q;  5D65 A;  4S3S A;  3OMG A;  3M9B A;  4HSP A;  2BE5 D;  4BXX G;  1DJR D;  1U4R A;  1H9R A;  4GNX B;  1TXY A;  1EQV A;  4KLK A;  2AMC B;  1G2S A;  1HNW L;  3SHL A;  1ASZ A;  1PH5 A;  3HOY B;  2WB1 E;  2HT1 A;  2E5L Q;  4YCW A;  4ZUI A;  1Y1W B;  3UDI A;  2KUM A;  3V05 A;  2VQE Q;  2PMZ B;  1F9P A;  1VQF A;  2WKC A;  1Q46 A;  1XMO L;  4KHP L;  1STN A;  4RCO A;  1MJE A;  3RLO A;  4ZRZ A;  1Q12 A;  3M4P A;  3L7Z C;  3STB C;  1KAA A;  2KHS A;  3TRZ A;  3LGJ A;  4L63 B;  1IYV A;  2AWN A;  4QIW E;  4JOI C;  2LXK A;  1PXU A;  2EYH A;  1HJP A;  5C4X G;  5AJ3 L;  1CKO A;  3J81 c;  3IAY A;  4IUN A;  4B3R Q;  1HFN A;  5IYB H;  1X3P A;  1VDZ A;  2CW0 D;  3MXN A;  1SBB B;  4OXP A;  1L0X B;  1XTC D;  2A19 A;  1S5F D;  2MGS A;  3H3V C;  1G6Z A;  2L4N A;  1K3B C;  4KJO A;  5KEE A;  3EIV A;  2BDO A;  2HCI A;  2Z6B A;  2N49 A;  2HD3 A;  4IN3 A;  4PQX A;  3CAM A;  4MTK A;  1OXT A;  1Z7T A;  1CHQ D;  3KF8 A;  3NBI A;  2EYO A;  3DHQ A;  4TQU S;  2RDF A;  5JJZ A;  4OL7 A;  4LF6 L;  3ITP A;  1GUT A;  2Y0S B;  1ET9 A;  1STE A;  4IFD I;  1E2Z A;  1TKW B;  3CD6 A;  5C0X I;  4XTC S;  4AYB B;  2ICI A;  1A15 A;  4JI1 L;  5H1S E;  1WTW A;  3HOU H;  4DR2 L;  2NVY B;  4K5V A;  4JCV E;  1YIT A;  3JAM L;  4I7Z C;  4IAL A;  4P71 A;  5T1I A;  1HR0 W;  3C3L A;  4A76 A;  2KCT A;  2CQO A;  3GQB A;  2K50 A;  4DR3 Q;  1F9R A;  4DR5 Q;  1JWU D;  4ZYS A;  5IGE A;  5M5W H;  3RLF A;  2F0F A;  5E3F A;  4HAE A;  4GKJ Q;  4NXN L;  3C1F A;  1EL0 A;  1VQ8 A;  4YHH Q;  4GN3 B;  1EU3 A;  3NPP A;  2D9U A;  4YWL A;  4X66 Q;  1RIP A;  1FGU A;  4X6A H;  2I07 B;  4HCE A;  5FJ8 H;  2F52 A;  4OIK A;  4KI0 A;  4GOP B;  4C3H G;  3K58 A;  4A3F H; 
#chains in the Genus database with same CATH homology
 3HOW B;  5C6A A;  4NKL A;  4KKS A;  3HOZ B;  5LL6 X;  3K5N A;  1V1O A;  1BQQ T;  3K5O A;  5ELE A;  2O5I C;  1B2T A;  4F7X A;  1V1P A;  4IFD G;  4IQZ A;  1JR0 D;  1PRT B;  1DON A;  3BDC A;  2WIN B;  1QJO A;  1DXM A;  4OIJ A;  3VR5 A;  1C8C A;  2EYM A;  5JEA G;  1FGB D;  4K6L A;  2IW3 A;  3I4L A;  3HOU B;  4XT1 B;  3DEP A;  4QMG A;  1STH A;  1EY8 A;  3KLS X;  3PUW A;  3VR4 A;  4P2C B;  3RMH A;  2XN9 C;  2JYO A;  4DK1 A;  4H0L C;  4WJW A;  3NQI A;  1GXD C;  3I8Z A;  4DAP A;  1NAP A;  1QNK A;  4RGO S;  2F0T A;  4QCL A;  3QIA A;  1SFO B;  2BA1 A;  4JK1 C;  4C3J G;  5CC4 A;  2F3V A;  3SK5 A;  1G8Z D;  2VXW A;  1RDP D;  5KRU A;  4ZQ3 A;  1IKM A;  5KYI A;  4K8I A;  5M9O A;  1TY2 A;  2B2T A;  1D1I A;  3MC0 B;  3PUX A;  1BF4 A;  1EY0 A;  1A2U A;  1GUG A;  2XRQ D;  2AQ2 B;  4HTH A;  4CGY B;  1F9S A;  3BDO A;  2F0U A;  4B08 A;  3NE5 B;  4X3S A;  1M8A A;  2XVS A;  2RBM A;  1CZG A;  2AUK A;  5DM7 3;  1B1Z A;  3S1N B;  2VNU D;  2R93 B;  2EJM A;  4A3B B;  2F0L A;  3D4D A;  3V96 A;  1AFP A;  4C56 C;  2C9O A;  1PRT C;  2A69 C;  1WD0 A;  2A6E D;  2F0D A;  2G9D A;  1X32 A;  1EQT A;  4FXD A;  1SAP A;  5AFW A;  1A2T A;  3NXW A;  4I65 A;  4MIU A;  2PCF B;  2K04 A;  5A35 A;  3FEW X;  5C5L A;  1RTO A;  5T1G A;  1EY5 A;  3GD7 A;  5FO9 B;  1Z47 A;  1Q8I A;  4C3I G;  4FVM A;  3S15 B;  3Q0A A;  3T51 B;  3CQZ B;  3TME A;  2L12 A;  5ELD A;  3G7L A;  3HOV B;  1F2Z A;  4RFB A;  3ND9 A;  1C48 A;  4KHV A;  3Q22 A;  2EY6 A;  2QIL A;  1OXV A;  1WTV A;  3H09 A;  1ROD A;  2B2V A;  1L0Y B;  3RZO B;  4CJ1 B;  4H7B A;  5CYU A;  3J7Y W;  1TQO A;  5JPN C;  2NZ1 D;  1EEF D;  5E4X A;  3PIO 3;  1CZW A;  1JB3 A;  1KLU D;  4DK0 A;  4DN4 M;  2F0P A;  4LK1 C;  3LNN A;  5DM6 3;  2B2W A;  2SEB D;  2A68 C;  2WAQ B;  3R3O A;  1AZP A;  4BA2 I;  1LO5 D;  1EWC A;  2WV6 D;  2KA7 A;  5COR A;  1ZEQ X;  4KN4 C;  2F3W A;  2JE6 I;  1XWE A;  1IHZ A;  3TDQ A;  1B9N A;  3ND8 A;  4A3J B;  1AEX A;  5CV9 A;  1BR9 A;  5HGT A;  1DOL A;  1KNE A;  5CV7 A;  2R92 B;  5EKK A;  2WKD A;  2Q8T A;  3LWU A;  5C3W A;  3HRZ C;  2L11 A;  5C5M A;  3SXH A;  2O2L D;  5CBE E;  2D62 A;  3TN2 A;  5IOD A;  3DWA A;  2ZXP A;  2H4O A;  4DA2 A;  2F1M A;  1HHV A;  3L3O C;  4WFN 3;  4EVO A;  5EKL A;  3NHH A;  5I9P A;  4IUP A;  5CV5 A;  1EWH A;  1PLF A;  2EXZ A;  5K36 G;  5C0X J;  5C3X A;  3FKI B;  5C4J B;  4OO1 H;  3HKZ B;  2F0S A;  1FNU A;  2NN6 I;  1VF5 C;  1CHP D;  3NWS A;  2JA5 B;  1LTT D;  2E2J B;  4X3T A;  4ME5 A;  1SNP A;  5TSS A;  2PYK A;  3HS0 C;  1S5C D;  1C4Q A;  1O78 A;  3VR3 A;  5J22 A;  1PZJ D;  3DEO A;  3NBH A;  3BZD B;  4FO2 A;  1TU2 B;  1KDA A;  1AN8 A;  3J80 E;  3SVM A;  1F2L A;  2H1E A;  3K0Y A;  2IX3 A;  4ZKB B;  2L5T A;  3EFX D;  2LY7 A;  3HEJ A;  4X3K A;  5ELF A;  2PNR C;  2RDH A;  1PZI D;  1S5B D;  3NTH A;  2J4X A;  4C3H B;  2B2Y A;  2EJG C;  3M7N A;  1VMP A;  4KY5 A;  4FXG C;  2ZXO A;  1A3U A;  1QG7 A;  1ENF A;  1BNZ A;  3BYY B;  3FVQ A;  2NN6 G;  4RCN A;  4U68 A;  1IW7 C;  3VA5 A;  3SE0 A;  3EJI A;  1PTO D;  2ID0 A;  1SNC A;  3GTP B;  1IYU A;  5JOB A;  3J81 E;  4LAA A;  1E2V A;  2K33 A;  1WCM B;  2EOT A;  3CKI B;  4MN3 A;  2JA6 B;  2DY8 A;  3PUY A;  1ILP A;  2A6H D;  3PO2 B;  5FOB B;  3W2D A;  1F2Y A;  1SNQ A;  1VMC A;  2XNA C;  2E76 C;  3BG3 A;  4NMZ A;  4EQO A;  3I4N B;  4OHJ A;  4LMQ D;  5F2D A;  1IL8 A;  3S2D B;  4KY6 A;  1EYD A;  2EYL A;  3Q23 A;  1WVL A;  2JEA I;  1JC7 A;  1KDC A;  3D4W A;  1D1K A;  1YNJ D;  2LMC B;  5JPM C;  3OIP A;  1HA6 A;  4DAY A;  3S14 B;  1HRJ A;  3CRK C;  5G3L D;  1HCZ A;  3QWN A;  1D2B A;  1YNN D;  5EKI A;  4C3J B;  2N55 A;  4K2K A;  2NWG A;  4DF7 A;  3T16 A;  2K32 A;  3K5L A;  3NWT A;  1TWA B;  3A8I E;  3H6M A;  2VB3 X;  4M8A A;  1F2M A;  2EVB A;  3M3Y B;  2BCO A;  1SYF A;  1U4L A;  1NR4 A;  2ZT9 C;  2BDN A;  3I4M B;  1EY6 A;  2JP1 A;  2RSO A;  3GTJ B;  2WP8 J;  1ZXT A;  3P20 A;  3OOC A;  3MXG A;  2TMP A;  4IUR A;  1TS5 A;  3D8G A;  1Y8N B;  4IUQ A;  4B9X A;  3MFY A;  1D5X C;  2OF1 A;  2E2H B;  1STA A;  2C5C A;  4KY7 A;  3Q24 A;  1PDQ A;  2SDF A;  5EGT A;  2FMM A;  1TS4 A;  1QB5 D;  3OSO A;  2KOL A;  2F0E A;  1ONL A;  2HDM A;  5DAU A;  1SMY C;  3NQT A;  3W3A A;  1QWY A;  3M85 A;  3MTS A;  1HQR D;  3U9O A;  3QJY A;  4XQJ A;  2F0I A;  1O7L A;  1LTI D;  3LWE A;  2K5W A;  1LTR D;  5JAV A;  5KNB A;  4DNT B;  3BVM A;  2HDL A;  3X3M A;  1GUW A;  1B53 A;  4A93 B;  1EOT A;  3FMC A;  3PMF A;  3AMU A;  1WTQ A;  3M7G A;  2X69 A;  3KBG A;  1EU4 A;  2J7Z A;  4FF1 A;  3MWY W;  1SYE A;  1J9O A;  5A2Q E;  2OEO A;  2BOS A;  3NSW A;  3HZX A;  4R8I A;  2KVM A;  4EGV A;  4RAU C;  5DEH A;  2FMC A;  1QE6 A;  2R7Z B;  4H44 C;  3HG9 A;  1GUN A;  2ICE C;  1LAB A;  1TII D;  3I91 A;  1I50 B;  1Y69 U;  3K57 A;  1D5M C;  2MUY A;  2JA7 B;  3H0G B;  2IPK D;  4WRD A;  1SJE D;  4OGQ C;  4XYQ A;  5IT9 E;  4RH6 A;  1BCP F;  4ILW A;  1CA6 A;  5M3F B;  3FDT A;  2KED A;  1WTP A;  2B2U A;  4F88 A;  4QUF A;  4K8J A;  2JA8 B;  1LLR D;  3I70 A;  3T53 B;  1IKL A;  3QG1 A;  5D3I B;  1KAB A;  4FF4 A;  2OT2 A;  4O1N A;  5CR3 A;  1R4P B;  4X3U A;  4A3D B;  1EY9 A;  1DZ1 A;  3D3R A;  3J80 L;  4KKU A;  1DCZ A;  1U4M A;  4A3K B;  3K59 A;  1TR5 A;  2F0M A;  4V19 0;  1JQY D;  4O42 A;  2F0J A;  5KND A;  3I90 A;  1A3V A;  5EPK A;  3OIQ A;  5E1F A;  3E0J A;  3D6C A;  3A8J E;  4N9T A;  2CQA A;  1O7Y A;  4FYD A;  1FD7 D;  3OHX C;  5FLX L;  1S5D D;  1EIG A;  2Z8L A;  1H9K A;  4FF3 A;  2NVQ B;  2A6E C;  2PZT A;  4ULL A;  1RCV D;  5FO7 B;  2CHB D;  2I46 A;  4K6D A;  4XDX A;  2IX0 A;  1JOK A;  4FNF A;  3QOL A;  3GTM B;  3SEB A;  4V0B A;  3S16 B;  1RF2 D;  3NUC A;  3HP3 A;  2TSS A;  1BBX C;  5C3E B;  1V1P B;  5IGC A;  3D6W A;  3A7L A;  1BXT A;  3M4Y A;  4A3M B;  2SNS A;  1G91 A;  2KEC A;  3SK4 A;  1EYC A;  3IKJ A;  5IGB A;  3MAQ A;  4BBR B;  3R2T A;  1B44 D;  4A3I B;  4N9P A;  2F0G A;  4QB4 A;  2O5J C;  2MJ8 A;  1W6K A;  3R2I A;  5CV4 A;  1EEI D;  4DU9 A;  2LKV A;  3P7J A;  2L55 A;  5KGU A;  4K5X A;  2IL8 A;  1V8Q A;  2F0Q A;  5JVH 3;  4IUT A;  1PZK D;  3BYT B;  1LT3 D;  1RJT A;  3QOJ A;  1U9R A;  4K14 A;  1EZ6 A;  1SYD A;  3VYR A;  5IGF A;  4XIG S;  3T4A C;  1BCP D;  3S1M B;  5M5Y B;  5IGD A;  2A74 C;  4JBW A;  2JEB I;  4HSV A;  4BBS B;  3BVG A;  4YIJ A;  4ZUJ A;  1NR2 A;  1B3A A;  2D5D A;  1I6H B;  4Q0F A;  1PTO B;  5BN4 A;  5CMD A;  1OO9 B;  2F4I A;  1KLG D;  1HXY D;  4ZLT F;  4HMI A;  2Q8R E;  2KJX A;  3GTQ B;  1I4Q A;  3KK7 A;  3K7A B;  5M5X B;  3HOX B;  3A8K E;  5FO8 B;  4HR7 B;  1CQV A;  3DUZ A;  4ODG A;  4KD3 A;  2B39 A;  1QIL A;  1JE4 A;  1E2W A;  3PIP 3;  2PPB C;  1PRT D;  2A69 D;  1KDB A;  2ZXR A;  4FF2 A;  1PTO F;  5CV8 A;  2EY1 A;  1MSG A;  3VYU A;  3MZ5 A;  3OMC A;  1I3Q B;  1I4P A;  4PNY A;  3A56 A;  1BO0 A;  2F0V A;  3KLR A;  2QKI C;  4G7H C;  3X3N A;  4IUV A;  1RTN A;  1VCI A;  2NVX B;  2EZV A;  5CBA E;  1FNW A;  4TRD A;  1ZYR C;  1SE2 A;  3H94 A;  3OWF A;  1CQF A;  4Y7N B;  1FYC A;  5C4X B;  5HUR A;  1MI2 A;  3C1E A;  1TWG B;  2SNM A;  3K5M A;  1RHP A;  1OXS C;  3I3C A;  4HMJ A;  5G3L F;  2QDB A;  5NUC A;  4IFD H;  4IFD J;  4Q5V A;  5C0X H;  3GTO B;  3R93 A;  3WOF A;  2RVL A;  2RSN A;  1OXU A;  1O80 A;  2A68 D;  3VA7 A;  3S17 B;  2HQE A;  1DYQ A;  3E5S A;  2PZW A;  5JEA J;  3S9W A;  2JXM B;  2XWJ B;  4Z9C B;  3OWE B;  2F0K A;  3EQL C;  1A6X A;  1SYG A;  2DNC A;  3C2P A;  1ILQ A;  3MEH A;  2PQE A;  3GP7 A;  1LTA D;  5FK9 C;  3GV6 A;  2XWB B;  3TP5 A;  3J7A V;  3LX0 A;  1TWF B;  2A6H C;  3IFD A;  4RKL A;  1WTO A;  3AU7 A;  4KV6 A;  4TSS A;  2NTT A;  1F77 A;  4CHT B;  3GTG B;  1LT4 D;  1EYA A;  3RZD B;  2NUC A;  1D6E C;  2IT1 A;  1II3 A;  3V2T A;  2B63 B;  3MHB A;  2XRS D;  1DOK A;  1YNJ C;  1B9M A;  3CRL C;  2HUG A;  3RD4 A;  1X3Q A;  5CGK A;  2G9H D;  2BE5 C;  2N88 A;  4IZ8 A;  5ELB A;  2EY2 A;  3GO5 A;  2AUJ D;  5I9O A;  1TVX A;  1PFB A;  4NP5 A;  2WB1 B;  3AB9 A;  3URY A;  4FP5 D;  3QO2 A;  2Z4I A;  3TZD A;  1CK1 A;  1LV9 A;  2QCP X;  1G2T A;  1NSN S;  1XX8 A;  2ENB A;  1PYW D;  3T13 A;  1JWS D;  2LFN A;  1WTX A;  4XT3 B;  3TP7 A;  1JOR A;  2LS0 1;  1WD1 A;  2K01 A;  2MPM A;  5BN3 A;  2PZU A;  4QIW B;  2B8F A;  2O4X A;  3HGB A;  1DOM A;  4FXK C;  1SXT A;  2B2V C;  4CBV A;  3EVQ A;  3KUP A;  5LHY 1;  4RA8 A;  1K8O A;  2CW0 C;  2QEJ C;  1AZQ A;  3U9S A;  4G7O C;  1ESR A;  1IW7 D;  2E2D C;  2CVR A;  1AW7 A;  2J0T D;  2EYJ A;  3ONA B;  5I2X A;  2E74 C;  2B2W C;  4BWG B;  2K5Q A;  2RQX A;  1Q1E A;  2AWO A;  2K6A A;  4XYO A;  4BY7 B;  1Q3L A;  2FHT A;  3N6R A;  1ENA A;  5D3D A;  4G4K A;  3FRP B;  1EIH A;  4KK7 A;  1STB A;  1I4G A;  3BVZ A;  1KTK A;  1TWC B;  2K28 A;  3O13 A;  2X6G A;  4DNR B;  3L9A X;  3ZYY X;  4PMB A;  2F03 A;  2K7V A;  4DXF A;  1DM0 B;  5I4D A;  2PW7 A;  4IUU A;  4C1N I;  5IGG A;  2EDG A;  1V43 A;  4A3G B;  3RUZ A;  5EPJ A;  3UI2 A;  4G57 A;  1TS3 A;  2L0C A;  2IX1 A;  2A73 B;  4A3E B;  1PMR A;  1SJH D;  1I4H A;  4ZK9 B;  3PO3 B;  5ELC A;  1TWH B;  2M2L A;  3WDN A;  2OXP A;  2PW5 A;  3DMU A;  1F9Q A;  2IJ0 A;  4C3I B;  1JIC A;  4CKB A;  3C46 A;  1LTG D;  1H9M A;  4RHS A;  2WAC A;  2EYP A;  2HCC A;  1S4Z A;  4OO1 I;  3WOE A;  4KHZ A;  4DGZ A;  1BCP B;  5K36 H;  1M4V A;  5KNC A;  5C44 B;  1T5E A;  1SMY D;  1U4P A;  5EBC A;  2EJF C;  2B2Y C;  3FPP A;  1ZKO A;  3A55 A;  1NCV A;  1SND A;  1ET6 A;  2D2C C;  1JCK B;  4RGM A;  1PFN A;  1MSH A;  2F0W A;  4MHE A;  4BY1 B;  1HTP A;  1B4O A;  1TT2 A;  1J8I A;  4HED A;  5E4W C;  4E6I A;  4J1M A;  1UUP A;  5C0X G;  2L9H A;  1STY A;  4XQN A;  4KKT A;  1K8M A;  4OO1 G;  4WOR A;  4CKC A;  1H9S A;  3EA6 A;  1HUN A;  2F0H A;  4DAV A;  1MGS A;  4J6H A;  4XQQ A;  3NTI A;  1TY0 A;  1HFG A;  1LT5 D;  5K5P A;  3MVV A;  2EPB A;  1S5E D;  4H13 C;  2NYZ D;  2NN6 H;  1OXX K;  1EZ8 A;  3A7A B;  2EY5 A;  5M5W B;  2M9V A;  1XYI A;  1PRT F;  1LTS D;  3F2U A;  2RA4 A;  3A54 A;  1Y8P B;  1EY7 A;  2IWH A;  4J8Q A;  1BOS A;  3J7A F;  4A3F B;  3P1H A;  2WII B;  2R6G A;  1FR3 A;  3J81 L;  1PTO H;  3DWP A;  4K2L A;  3IL8 A;  1SSO A;  3S2H B;  2Z1C A;  1UEA B;  1ML0 D;  1CA5 A;  1BCP C;  1HQM C;  2V4D A;  2A5H A;  3OW7 A;  3S1Q B;  4K5W A;  3NTK A;  4RGT A;  4PMW A;  3TSS A;  1CT1 D;  1ESF A;  1A3T A;  2Q8I B;  2X6L A;  1JOQ A;  2K5D A;  5CV6 A;  4BA1 I;  3SK8 A;  5EQ0 A;  3MXP A;  1LAC A;  3NP8 A;  4M1U B;  1H9S B;  4KTA A;  4R9W A;  3BS1 A;  1E0B A;  1LT6 D;  3VR2 A;  4QF4 A;  2RKS A;  2M00 A;  4RHR A;  3G6J B;  2F0N A;  4BS9 A;  3MFG A;  3SDZ A;  3DM1 A;  3PUV A;  4LJZ C;  5BN5 A;  3VR6 A;  5KYL A;  5JVG 3;  1T5X D;  4CKE A;  1QCB D;  2AQ3 B;  1DD2 A;  2VUM B;  1Z6H A;  1Y1V B;  4QUC A;  2YU9 B;  2KQ3 A;  5M3M B;  5J39 A;  3I73 A;  5KIX A;  4HCS A;  3PUZ A;  3KBX A;  2VB2 X;  1HPC A;  2SOB A;  4DXG A;  1KNA A;  1XXG A;  1Q90 A;  5ISR A;  1TS2 A;  2DN8 A;  4XXE A;  1QNU A;  1I4X A;  3OPO A;  2XIW A;  1SYC A;  3MA2 B;  4EQP A;  4CJ0 B;  1JWM D;  1STG A;  4G7Z C;  4RGN A;  1MD2 D;  4KJN A;  1MBY A;  4DFA A;  1CM9 A;  5C4Z A;  3DWQ A;  4TKO B;  4NW2 A;  2AQ1 B;  1UAP A;  1D5Z C;  5EJW A;  3CHB D;  1O7Z A;  5EPL A;  3SR1 A;  4ZKC B;  2DY7 A;  3ERQ A;  4R8N A;  4L8J A;  2FFK B;  4RWS C;  1VF7 A;  4ZAI A;  1HUM A;  2EE1 A;  3K6O A;  2R61 A;  4KN7 C;  3JAM E;  2K1B A;  1SEB D;  3TBI B;  3SK6 A;  3TP8 A;  2B2U C;  4C2M B;  5COY A;  1BDO A;  2R3Z A;  4UAI A;  3PV0 A;  3FPU B;  2MHV A;  5A2Q L;  1FNV A;  5J1Z A;  3I72 A;  2NVT B;  4GZY C;  3BDL A;  1GHJ A;  2PO4 A;  4UDU C;  1CI3 M;  4C1N K;  1SYB A;  2MP1 A;  4F87 A;  3TP6 A;  3GTL B;  2E75 C;  3H91 A;  3QB3 A;  5JEA H;  1SNM A;  2NB0 A;  1RKN A;  3R8B A;  2GA4 B;  1PTO C;  1GHK A;  1PFM A;  5IT9 L;  3T56 B;  1JOO A;  1HTL D;  5DNF A;  1SE4 A;  5IIF A;  1ZYR D;  1BUV T;  2B2T C;  1G29 1;  3KLS A;  3DXJ C;  1H9J A;  4L6T B;  4ABN A;  2NTS A;  5I6W A;  2Z4H A;  1Q1B A;  4KD4 A;  1GJX A;  1I4R A;  2NBF A;  4NDX A;  2B8G A;  1I6V C;  4PV1 C;  3VYT A;  1ICW A;  1RD9 D;  3VYS A;  3GV3 A;  1Y8O B;  4PMC A;  3TZU A;  1SE3 A;  4KMU C;  2KCC A;  1NUC A;  5C4H A;  3CU7 A;  3GTK B;  1UNS A;  2BA0 A;  2F0O A;  3IFT A;  1YNN C;  1K83 B;  4B9W A;  1EY4 A;  5IOC A;  3P75 A;  1GOZ A;  3ERO A;  3D31 A;  5LL6 S;  5FLX E;  1QOH A;  2EYF A;  2QF7 A;  5FKA C;  2KEE A;  2RDG A;  2YYZ A;  4RKB A;  1W6J A;  4CJ2 C;  2FJ2 A;  1GUO A;  3N52 A;  1HA5 A;  1R9T B;  3S1R B;  4EQN A;  2KCN A;  2XSC A;  4HN7 A;  1B50 A;  2E2I B;  2K03 A;  1CTM A;  2L1B A;  1LTB D;  1CFM A;  3Q6S A;  3D4R A;  5I2Y A;  5I6Y A;  1EFI D;  3MXU A;  4ID6 A;  4F8M A;  1SNO A;  1ENC A;  2JSO A;  3M4O B;  1WTR A;  1R4Q B;  2K05 A;  1GUS A;  2DNE A;  5EBD A;  1SDF A;  5D14 A;  4U67 3;  2FIN B;  3NK9 A;  1AP0 A;  3E6Z X;  5D65 A;  4S3S A;  3OMG A;  4HSP A;  2BE5 D;  1DJR D;  1U4R A;  1H9R A;  1EQV A;  1G2S A;  3SHL A;  3HOY B;  4ZUI A;  1Y1W B;  2KUM A;  3V05 A;  2PMZ B;  1F9P A;  2WKC A;  1STN A;  4RCO A;  4ZRZ A;  1Q12 A;  3L7Z C;  1KAA A;  2KHS A;  4L63 B;  1IYV A;  2AWN A;  1PXU A;  2EYH A;  3IAY A;  4IUN A;  1HFN A;  1X3P A;  1VDZ A;  2CW0 D;  3MXN A;  1SBB B;  1L0X B;  1XTC D;  1S5F D;  2MGS A;  3H3V C;  1G6Z A;  2L4N A;  5KEE A;  4KJO A;  2BDO A;  2HCI A;  4IN3 A;  4PQX A;  1OXT A;  1Z7T A;  1CHQ D;  3KF8 A;  3NBI A;  2EYO A;  3DHQ A;  4TQU S;  2RDF A;  5JJZ A;  4OL7 A;  3ITP A;  1GUT A;  2Y0S B;  1ET9 A;  1STE A;  4IFD I;  1E2Z A;  1TKW B;  5C0X I;  4XTC S;  4AYB B;  2ICI A;  1A15 A;  1WTW A;  2NVY B;  4K5V A;  3JAM L;  4I7Z C;  4IAL A;  5T1I A;  3C3L A;  3GQB A;  1F9R A;  1JWU D;  4ZYS A;  5IGE A;  3RLF A;  2F0F A;  5E3F A;  4HAE A;  1EL0 A;  3C1F A;  1EU3 A;  3NPP A;  2D9U A;  2I07 B;  4HCE A;  4OIK A;  4KI0 A;  4C3H G;  3K58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...