3V2TA

Crystal structure of staphylococcal nuclease variant delta+phs i92a/v66a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3v2tA00
4N9TA 1EYAA 5E1FA 2PYKA 3H6MA 2F0QA 4KY7A 4K2LA 5C5MA 3T16A 5C6AA 5E3FA 5CR3A 5I6YA 5IGFA 5J22A 4PMCA 1F2YA 1A3UA 3OMGA 2F0MA 4KV6A 3NUCA 1EY8A 3OWFA 4ME5A 1EYDA 4KTAA 1SYBA 4QF4A 1ENAA 1EY6A 1JORA 5JOBA 4EQPA 1TT2A 1IHZA 1KDAA 1F2MA 1SNQA 3LX0A 1NSNS 4NMZA 1STGA 2OF1A 2OEOA 3C1FA 5CV5A 3SK5A 2SNSA 5I9OA 1EY4A 1STYA 3OMCA 2EXZA 3RUZA 4OL7A 3TP7A 5C4ZA 5IOCA 2EYLA 5IODA 5KYIA 4ZUIA 2HQEA 4ZUJA 2KHSA 2EYHA 5M9OA 4K2KA 3P75A 2F0UA 1EZ6A 2F0WA 3MEHA 4K5WA 4LAAA 2F0OA 4H7BA 3SK6A 1TR5A 3T13A 3EROA 2EY2A 1SNMA 2EYJA 2F0TA 3V2TA 2EY5A 5KEEA 5J39A 2EYMA 1EY5A 1F2ZA 1SYGA 2KQ3A 4DU9A 3R3OA 1TQOA 1EYCA 4NKLA 4ZQ3A 5ISRA 5CC4A 3QOLA 1SYDA 3D4DA 4KJNA 5KRUA 3SK8A 4F8MA 2LKVA 3QOJA 3SXHA 5CGKA 2ENBA 4HMJA 2WACA 3D6CA 4KY5A 4NDXA 3DMUA 3HEJA 3EVQA 3SHLA 5IGGA 2F0VA 4KJOA 2PW5A 3D4WA 3NP8A 1KDBA 3P1HA 4DF7A 1A2UA 2F0FA 2F0JA 5C3WA 3DHQA 3VA5A 3QB3A 4EQOA 4S3SA 5EGTA 3NHHA 1AEXA 5IGBA 2PZTA 4IALA 2F0DA 4IUNA 4R8NA 4K5VA 1SYCA 2F0IA 2RBMA 3OSOA 5EKLA 1KABA 4B9WA 3D8GA 3S9WA 2RKSA 2PW7A 4B9XA 3PMFA 5CV4A 1EY0A 2PQEA 1SNOA 4IZ8A 4K8IA 1SNCA 3TMEA 4KD3A 5IIFA 2RDFA 5K5PA 4EQNA 4EVOA 3E5SA 5CV9A 1NUCA 1SYFA 2F3VA 3NQTA 4HTHA 2F0GA 4KD4A 4I65A 4K8JA 1JOKA 1SNDA 5EKKA 5KGUA 4PMBA 2EY1A 3MHBA 4QB4A 2PZWA 4KHVA 3TP8A 4MIUA 1A3TA 1U9RA 5I9PA 1STBA 4K5XA 1KDCA 1STHA 2F0SA 2M00A 3SK4A 3HZXA 1ENCA 3EJIA 4E6IA 5JAVA 1EY7A 4K6DA 2F0LA 2F0HA 3SR1A 2NUCA 4KY6A 1A3VA 5J1ZA 4PNYA 4QMGA 2O4XA 5C3XA 5HGTA 1SYEA 3TP5A 5I6WA 4J6HA 2QDBA 3NXWA 4RKBA 5CV8A 1RKNA 5CV7A 5DAUA 2EYFA 5IGEA 4WRDA 3C1EA 4HMIA 3BDCA 5IGDA 1STNA 5NUCA 3MXPA 4WORA 2EY6A 2OXPA 3BDLA 5CV6A 4G57A 5HURA 3ERQA 1EY9A 4TRDA 2F0KA 3MVVA 4J1MA 4DGZA 1A2TA 3ITPA 4ODGA 5C5LA 4RKLA 2PZUA 2EYPA 4ID6A 5IGCA 4YIJA 3TP6A 1JOOA 4N9PA 5C4HA 2SNMA 1EZ8A 3U9OA 1II3A 4K14A 5F2DA 2F3WA 5DEHA 4DFAA 1STAA 4NP5A 2F0PA 3MZ5A 2F0NA 2F0EA 3NK9A 1EQVA 4F7XA 2EYOA 1SNPA 1KAAA 1JOQA 5KYLA 5KIXA 2SOBA
chains in the Genus database with same CATH superfamily
5BR8L 1GOZA 3R2IA 4KY7A 5JEAJ 3QJYA 1R4QB 2ES2A 2HCIA 3IRBA 3GTKB 1PFNA 3CD6A 1YIJA 1A8VA 4GKJL 3BZCA 2EXZA 4JI6L 4C3IG 2EYLA 4QCLA 1SAPA 5M9OA 1NY4A 3HOXG 2ATWA 2EQSA 4R4CA 1H95A 1A63A 2K4KA 1DZ1A 1SNMA 3HKSA 4LF6Q 2CKZB 4I7ZC 2K5VA 3FKIH 1Z6HA 4DV7L 3S2HH 2K5WA 1PRTD 4WJ4A 2K75A 3I4NH 5CORA 4X64Q 1CKNB 3K7AB 1XTDA 1X54A 1EQRA 1KDBA 2MPMA 2LXKA 4XQNA 2R93H 4ZAIA 1WTHA 1KL9A 4JYAL 1PFBA 2ZXRA 3WWVA 5EKLA 1Q82C 4HIKA 3HOYG 4MTKA 2FFKB 4NXMQ 1VQNA 1VQ8A 2K01A 3M4QA 2Q2TA 1UE6A 3F2BA 2UUBL 1AP0A 5ELOA 2GN5A 2H1EA 1UEBA 4F87A 2L55A 3K5NA 3LGJA 2N78A 2AQ1B 3GV6A 1OXUA 5M3MB 3KF6B 3NENA 3F8TA 1KLGD 4K6DA 4QL5A 2K33A 2UXBL 1TWGH 4LFAL 2LXJA 2ZTCA 1SYEA 2MFIA 1PRTC 2ZJPA 1X65A 1EEFD 2EJFC 3S1RB 4LF9L 3T53B 3MVVA 3GTPH 4J1MA 4DGZA 3GTQB 3PQIA 3HOZB 3U50C 1DOKA 2XWBB 2EYPA 2NVYB 1MHWC 2C9OA 4MZ9A 4QQBX 3CXCA 2EYOA 1KAAA 1PTOH 3L2PA 2RHQB 4N9TA 1JCKB 3I4LA 2L0CA 1F2YA 5M3MG 2UUAL 1HQMC 4A3GG 2KCMA 4KV6A 4ME5A 1JORA 4KTAA 5ELBA 1STGA 3AMUA 1L0YB 4DNRB 5C3EG 1TVXA 4A93H 4ZUJA 4GKKQ 1H9SB 2F3IA 2N55A 1TWHH 4IFDI 4LF4Q 3PUWA 4JC0A 2ICIA 1VCIA 3I8ZA 1AE2A 3WDNA 3PCOB 4IPGA 4KHPL 3W1GA 2RCFA 4RMFA 1B70B 3BVGA 2CQAA 2B2VC 3CC7A 3GTOH 2Z8LA 4QJFA 3F2DA 2JXMB 3D4DA 3EIVA 1SBBB 3SXHA 5CGKA 5JVH3 4PV1C 1QILA 4DUZL 4BBSH 4TKOB 1S5FD 3D4WA 2HT1A 4FO2A 5C3WA 3KF8A 3UE0A 3Q22A 1RTOA 1TS2A 2B63G 2F4VL 5E7NA 4X66L 2VS1A 2R92B 4A3KG 1BKBA 1S4ZA 1EWHA 5HGQA 2I5MX 2NVXH 3MWYW 4M8AA 4XYQA 1KABA 2BCOA 1BUVT 2K05A 1WOCA 2I07B 1S72A 1S5ED 2PQEA 3TMEA 4AH6A 1PXUA 1H9KA 1NUCA 1E24A 4JK1C 1JOKA 1WCMB 3MXNB 4KHVA 1TS5A 5I9PA 3O13A 4OIKA 5H1SE 1N33Q 5A2QL 3AYHB 3HZXA 4E6IA 3CCUA 3JAML 1HNZQ 2ASBA 3VR6A 2CQOA 4J15A 1PRTB 3F2UA 4C3IH 2X6GA 5NUCA 3S14B 4KI0A 2RSOA 2RF4A 3VR3A 5CV6A 4IUTA 2DN8A 3HOXH 4UPAA 3I91A 1XTCD 3TP6A 4FF2A 1LTID 3CCEA 1CQFA 5E4XA 4L5RC 1FYCA 5F2DA 2MUYA 5T1IA 1BQQT 2ZM6L 4B3SQ 1RODA 1BCPF 1EU3A 1PZID 4RAUC 3T56B 4JG2A 5KIXA 2SOBA 1EYAA 4LFCQ 1S3OA 3I73A 4BY1G 1JJGA 4PMCA 1HNWQ 1HQRD 1KXLA 1EYGA 4CJ1B 5M5XB 5M5YB 1HTLD 3IKJA 4NW2A 4QF4A 1J5EL 3OIQA 3TSSA 4JVZA 1SNQA 2E2JH 1T9HA 1SE3A 3TP7A 4LNQA 4RGTA 4JI3L 5C4JB 2NZ1D 4IPHA 3HOYH 2IWHA 4LF7L 2K52A 3KLRA 1CKNA 2N8NA 2F0WA 2A19A 1E0BA 4AQYQ 3IFTA 4LUVA 3SK6A 5JVG3 4DR5L 5D65A 4JOIA 3UDFA 2K32A 5J39A 5ELNA 2NYZD 3AB9A 1LT5D 5CYUA 1B8AA 1X3FA 4NKLA 3W2DA 1LO5D 1KRSA 1SROA 3E9IA 3OW2A 4A3IG 3OWEB 4C3HG 3FHWA 3K7AH 2QGQA 5EPJA 3MFYA 4BXXG 3DM3A 1QJOA 1WD0A 4JI0Q 5IGGA 3J80i 2HCCA 2HHHQ 1FGBD 1I94L 2PPBC 1ICWA 2F1MA 2LS01 4DV6L 3PO2G 2PQAB 3HFZB 3KLSX 4GZYC 3T4AC 1X3PA 4DNTB 2XTIA 4DK3C 1V1OA 5CV4A 3CW2C 5LL6X 4IN3A 1S5DD 1BVSA 3KBXA 1TKWB 4B3TL 1XMQQ 2IX3A 4DV5Q 4KD4A 4L63B 1SNDA 1HR0L 2E75C 5FK9C 1BBUA 2EY1A 1L2FA 5JJZA 1IZ6A 3TP8A 1RL2A 1VQIA 2UU9L 5M3MH 4GOPC 1STBA 4A3GH 4A76A 1UEAB 3BS1A 4P2CB 4LK1C 2K28A 5DNFA 1OO9B 4G7ZC 1CQVA 4JI7Q 3RZDH 3HOUG 3TP5A 5C3EH 5LMNQ 2OQKA 2UUCL 4K0KL 1PTOD 5D3DA 2EY6A 3A7LA 3CKIB 3GTQH 4JI5L 1BF4A 2WKDA 1VQ5A 1I4RA 2WIIB 4L5SA 1F2LA 1XMOQ 4DFAA 1NAPA 4KK7A 1GUSA 4UP9A 2F0PA 4DXFA 5IGBA 4LW1A 5D14A 1YNJD 2PYKA 2L4NA 1G291 4RGMA 5EBCA 1H9SA 4DV7Q 1G2SA 5IYDG 4M1UB 2WAQG 3CQZB 1EY6A 1LACA 5LMNW 1IYVA 4C1NK 5CV5A 2OF1A 4A3KH 4XTCS 2OQ0A 4JPBW 4GNXA 3H3VI 1F9QA 1P8LA 1SRUA 1DYQA 1EU4A 3DWAA 4HSVA 3J7A5 1CFMA 1LTAD 1TS4A 2KOLA 2GVBA 3OYYA 1HNXQ 4OWWB 2E2HB 2A69D 3EROA 1B3AA 1PTOC 1BO0A 3ULLA 1K9MC 1FD7D 3A8JE 4I7AA 1CI3M 1F2ZA 3R3OA 3TBIB 2JJQA 1CA6A 4G7OC 4DV2L 4DR7Q 4ZYSA 5C0XI 2A74C 3MA2B 1D5XC 2LKVA 5IYCG 1KTKA 1K0RA 4RHSA 3HEJA 3A8IE 1M4VA 1B9MA 1YNJC 1T5EA 1B4OA 3GDEA 3DHQA 2R92H 3MXNA 1Q12A 1GHKA 1HA5A 1X6OA 2RA4A 4NXNL 2V4DA 3D8GA 3GD7A 2Y0SG 1YHQA 1S5BD 2PW7A 4DA2A 3PUXA 4JCVE 4C3JB 1J9OA 4FXGC 5D3IB 4YWKA 1WCMH 3NQTA 5KNDA 3I2ZA 4FF4A 2F0GA 4XIGS 1VQOA 4BY1H 3NTHA 1LTBD 4GOPB 2A69C 2VZAA 3EJIA 5JAVA 3NSWA 5IYBG 1TIID 1B53A 2BA1A 1C4QA 2WP8J 3HRZC 2UUAQ 1U4LA 1HZ9A 4P73A 4AYBG 3NXWA 3NELA 3S14H 5IGEA 5CMDA 4LF8L 3BDLA 2XVSA 4G57A 4X65L 2P5ZX 3T1HQ 2BA0A 1IBLL 1B44D 1GD7A 2Z6KA 4HN7A 2F3WA 4XT3B 1EOVA 3WOFA 4LF5L 4IALA 4A3IH 1WFQA 4C3HH 1GUGA 5E1FA 5FO9B 4BXXH 1K3RA 1CKOA 3A54A 1FJGQ 3R8BA 2UXDQ 4DR6L 3A55A 3K59A 2PNHA 1Q1BA 2J7ZA 5LL6S 3LX0A 3GTGH 2A1AA 4MNOA 3SK5A 3PO2H 1VQ6A 5C4JH 5KNCA 2B2VA 4OL7A 4A3CG 4ILWA 1A6XA 2PI2A 1D1KA 3BJUA 5IY0A 1NR2A 3BYYB 4RHRA 3E3XA 1PLFA 1YJWA 2XWJB 5I2YA 3T13A 1PTOB 4L5TA 1GVPA 3BU2A 2SEBD 1K28A 4X3SA 4LUZA 3EBEA 1LTSD 4O2DA 2PQAA 4KJNA 1YHBA 2WACA 1F9SA 4R9WA 2HIVA 3HOUH 3FMCA 4R4OA 4Q5VA 4LFBQ 3A56A 1MI2A 4XDXA 1KNAA 4YCVA 1SMXA 2BE5D 2NVTB 1PH4A 2K5NA 1UE7A 1PHJA 3D31A 1TWHB 1AEXA 3Q0AA 2XN9C 1Y1VB 3AEVA 2CCZA 1SNCA 4B3ML 2RDFA 3GTOB 2PMZB 1EEID 2L11A 5BN4A 5EKKA 4K8JA 4YY3Q 2A73B 3OIPA 2D62A 2ZJQA 4UY8C 3NTIA 1Y8OB 1WVLA 4U673 2DY8A 1EQQA 2O5JC 3QR8A 1VQCA 5J1ZA 1NJIC 4V190 1J5EQ 3QG1A 2G9DA 2B2YA 2NVXB 1K0SA 1KC8C 5AJ3L 4DV4L 3U9SA 2YTVA 1D5MC 2KEDA 1JWUD 1E22A 1Y1VG 1K8MA 2IL8A 4FYDA 2BE5C 3S15B 3J7AF 1VQ9A 4A3MG 4HCSA 1R9TH 3J81c 1LTLA 3NWSA 5HY6A 1SEBD 5I6YA 2K1BA 4K2LA 2KEEA 2I46A 1U5KA 1PH7A 1LUZA 2XIWA 1XJVA 1Q1EA 1DD2A 1QVGA 3CQZH 1IBML 1EYDA 1IBKL 1S40A 4C3IB 2WINB 4WJ3M 1HZAA 2YYZA 3S2DH 2WFWA 4R4QA 3HOXB 3T1YL 4CDEC 3HOVG 1CSPA 1TY0A 3J7YW 2DJFC 1CK1A 4DAYB 3TZDA 2PI2E 1QUQA 3P75A 2AWNA 2MQHA 1PZJD 1O78A 1GHJA 3T51B 2F0OA 1A0IA 1ET6A 3CC2A 1VQHA 4UHVA 1B2TA 1B9NA 1RD9D 3S1MH 2KHJA 5CC4A 2C5CA 3MAQA 2YTYA 1CTMA 3L7ZC 2UXCL 2VQFL 2E2JB 3KDFB 3SHLA 4JBKA 1MJEA 1UE1A 3HOYB 4R8IA 2MO1A 1L0WA 3CPWA 1FNVA 2LY7A 3TS0A 1QNKA 1HRJA 4GOPA 2DY7A 3S9WA 2VQEQ 2NZHA 1XNRQ 3B6YA 4C3JH 4X62L 1VQEA 1FR3A 4OWXB 3BG3A 1EL0A 1VQAA 3IAYA 4DKAC 4UAIA 2AWOA 4Q0FA 1I3QH 5IWAL 3F1ZA 3CCRA 3N6RA 2IX1A 4RCNA 2L15A 3G6EA 4R1JA 3BYTB 1PFMA 2K7VA 2XRQD 2B2TC 3C46A 5CV8A 4A3CH 1BR9A 3Q23A 1QVCA 2R6GA 2E5LQ 2JA8G 1QOHA 3K8AA 4OXPA 4JV5L 1B3QA 4ODGA 4IFDG 5IGCA 1DOMA 1E3PA 2OTJA 1G6PA 1IKMA 4DAMA 2KJXA 1LT4D 4K14A 3KK7A 1STAA 4RCOA 3C2PA 4A3GB 1JOQA 2EJMA 2HQLA 5C5MA 3S24A 3FRPB 2L1BA 3HG9A 5IT9L 1QZGA 5IP7G 3OMGA 1E2VA 3RZDB 1NMFA 4PZ7A 5C3EB 3MFGA 1GKHA 3AU7A 2L5TA 1KDAA 1A15A 1NSNS 4JI4L 1PFSA 4HEDA 2SNSA 4B3RQ 5KYIA 1B50A 1MD2D 1PH9A 3E0EA 3ICEA 2A6HD 1YITA 3S1NH 1R4PB 1SE8A 2WB1G 2CVRA 4YCUA 4QUFA 2J4XA 2F0TA 4DR3Q 2EY5A 2EYMA 5CBEE 4A3LG 1EYCA 3QOLA 1SYDA 3V05A 1YHAA 1HUNA 1VQMA 3QOJA 2PCFB 3D3RA 2B63B 3DMUA 2CH4W 4A3KB 2NVTH 1ZXTA 4Y7NB 3N52A 4DUYL 3K5OA 4DR2Q 3CMEA 1HFNA 3QB3A 3SDZA 3H3VC 1E1OA 2EZVA 1Y1VH 1HZCA 2F0IA 3SE0A 4A3MH 4IUQA 1HZBA 1YZ6A 1JWSD 3PMFA 5GAHC 4KD3A 1IBLQ 2ZTDA 1E1TA 2JA7G 2A6HC 4F8MA 2VNUD 4XYOA 1CUKA 4OO1I 3LWUA 1C9OA 3U58A 1N32Q 1A3VA 2Q8RE 4PNYA 4QMGA 1N9WA 3VYUA 5HGTA 3PF4A 4RFBA 1O7LA 3GV3A 3MTSA 3HOVH 4RKBA 1RDPD 4CKCA 4JI2Q 1X56A 2OWOA 4BA2I 1STNA 3KUPA 3J80L 4HJ8A 4IOCA 3OOCA 3PUVA 2IHFA 5C44G 1Y1WG 1W6JA 2QCPX 3S15H 2BDNA 5FLXL 1V8QA 3CCLA 3QIAA 5LMUQ 3J81j 5EJWA 1IYUA 4BY1B 2F03A 1XPRA 1V9PA 3DEOA 5J3BA 3IL8A 4UP7A 4ZK9B 4CDDC 5J22A 5K36G 5E3FA 1E2WA 4DAYA 1HPCA 3CCQA 3CCJA 1PH6A 3NUCA 2QKIC 3OWFA 1XYIA 3OPOA 3VA7A 5G3LF 3H15A 3RZOH 3CPFA 4EGVA 2A68D 1X3EA 2JEAI 4YHHL 2NN6I 1D8LA 5A35A 5FO7B 2H5XA 1STYA 1ZYRD 3NBIA 1L1OC 4WJWA 3BZKA 2RDHA 4DR1L 3KDFA 1CZWA 2L12A 3VR4A 2VW9A 4A3IB 4C3HB 1N8RC 1EY5A 2KQ3A 1TQOA 1Z9FA 4MN3A 4ZQ3A 4GN3B 4L8JA 5DM73 1WYDA 4H0LC 1WJJA 4LJZC 3D6CA 4KY5A 1QCBD 1N36L 4UP8A 4DV0L 3A74A 2K14A 3GTGB 1D6EC 3UE1A 3PO2B 2PW5A 1A2UA 4ZRZA 4L5QA 2AQ2B 2PMZE 2JA6G 1HCZA 2JA8H 2QF7A 4KKTA 4A4IA 5GAEC 3CHBD 4LUOA 2B8FA 4IFDH 2CW0D 3ULPA 4P74A 2A68C 5IP9G 2D0PA 2ZXPA 4KLKA 2KVMA 3M4PA 4XXEA 4JI8Q 4BBRG 4OX9Q 3S16H 1N34L 2AUJD 5IIFA 1ZYRC 5ELDA 2VXWA 1BCPD 4DK0A 4EQNA 3M3YB 1PDQA 4C2MH 4EQ5A 1NR4A 1IL2A 1U9RA 1HA6A 5IP7H 4DV3Q 3HOUB 3EN2A 1PYBA 4ABNA 4DR4Q 1QG7A 2MO0A 1QVFA 2IW3A 3CP0A 5M3FB 5CV7A 3KF6A 3BDCA 3W3AA 3KLWA 3T1YQ 3ERQA 2R7DA 1IW7D 4OWTB 2N49A 4CJ2C 3S17H 2LSSA 2SNMA 4A3LH 1LLRD 3OHXC 3Q24A 3I56A 4TQUS 5BR8Q 2CW0C 4F7XA 1WTRA 1SNPA 1K83B 2WAQB 3UI2A 5C6AA 1SDFA 3E9HA 1QB5D 5C0XG 3MXGA 1DM0B 1A3UA 1BCPC 3GP7A 4L6TB 3K81C 2PO4A 4IJLA 3TEHB 1KRTA 1TY2A 1F2MA 4GKJQ 4KHZA 4JI6Q 5M3FG 3HOWG 1L1OB 3DEPA 1Q3LA 1LT3D 3HKZG 4OGQC 3JC66 2D0OA 4OEMB 4OIJA 1I4GA 4H7BA 1V1QA 1R9TB 2A8VA 2NBFA 3J81i 1LYLA 4KMUC 5KEEA 3KFUA 4LF6L 3M85A 3CU7A 1IW7C 1WTPA 3V96A 4DNIA 1DJRD 4GS3A 2B63H 2R7ZG 4A3EG 3S2DB 4X64L 4IFDJ 4Y7NH 4QIWB 2F0VA 4KJOA 1ZEQX 4G7HC 2MNAA 2Y0SB 4DPGA 4JYAQ 3NPPA 2H4OA 5LHY1 1IXRA 1SFOH 1JE5A 4B9WA 2RKSA 4RGOS 4B9XA 3PIPA 1QWYA 1D5ZC 1VQFA 5FKAC 2B29A 2UUBQ 4NXML 4EVOA 3S1MB 2B2TA 4DF7A 4A3JB 5EAYA 2FXQA 1PYWD 4NPSA 3KJOA 2I5LX 2UXBQ 4AYBB 4LFAQ 1OTCA 1KHIA 2E2DC 3J81E 4HJ5A 2JA5G 3BZDB 1FVIA 1WTXA 1EFWA 2QDBA 5EQ0A 1RKNA 1LTTD 3IFDA 2EYFA 4HMIA 3UDXA 4YWMA 4LF9Q 1W2BA 1ILQA 1VMPA 2OXPA 4JW0A 3A5ZB 3BVZA 2F0KA 5EPKA 3I4MG 1JOOA 4O42A 1EZ8A 2KBNA 3CCVA 3D0FA 4NP5A 4ULLA 2K50A 1CHQD 4A75A 4A3JG 4CDCC 2Q2UA 1I3QB 3KYHC 3H6MA 4FF3A 1CKMA 2JP1A 1MKHA 1BCPB 2JA9A 5ELEA 1RCVD 4HJ9A 3ND8A 4K6LA 3S1QB 4JBWA 1PH3A 2N3SA 3X3MA 4NMZA 3TDQA 2HUGA 2SDFA 4X3UA 3HS0C 3M4OB 1RTNA 1KLUD 2CH4A 2DGYA 2VB2X 4ZUIA 4BBRH 2EOTA 5IE8A 4GKKL 5JJIA 2KCCA 4LF4L 4KHPQ 3HGBA 3FVQA 1F9PA 1SYGA 1QE6A 1Q46A 1I4HA 1K73C 5AFWA 2Q2IA 5ISRA 2D9UA 4HIMA 4N8FA 3K5LA 4DUZQ 2ENBA 2KUMA 1LTRD 3FKIG 3FPUB 5TSSA 3NP8A 1K3BC 2Q8TA 1Q8KA 2F4VQ 4A3DB 2F0JA 3Q8DA 4X66Q 3URYA 2B8GA 3VA5A 3W5OA 3H3VH 3S1NB 1JR0D 4S3SA 5KNBA 4K5VA 4DV1L 4P71A 4QUCA 3M3YH 3GTLB 3SGIA 5CV9A 5JPNC 1LTGD 2F3VA 4HTHA 4HIDA 2R61A 3MHBA 1O80A 5C0XH 4Z9CB 1CA5A 1N33L 1ENCA 3D6WA 4KY6A 3K0YA 3OTOL 1HNZL 5M3FH 3HOWH 1VQLA 4A3DG 1GO3E 1JQYD 2KENA 5FJ8G 3C1EA 1D7QA 2FMMA 4WORA 4YHHQ 1ML0D 3J7ZC 4A3MB 2EPBA 4B08A 4H02A 4JI1L 1VQ7A 3ITPA 4KKUA 3I3CA 2ZM6Q 5DLQE 4JBMA 1BXTA 1OXSC 3OW7A 2YTXA 5IYDH 1K83H 4A3FB 4B3SL 1TWCH 1L1OA 2R7ZH 4LFCL 4A3EH 4GN4B 1I4XA 3JAMc 4FXDA 2IY5B 3PIP3 1HNWL 3VR5A 1C48A 3HOVB 4EQPA 1IHZA 4DV0Q 2L9HA 3L0OA 3EFXD 4JI3Q 3PV0A 4DXGA 4LF7Q 1AFPA 1EUJA 1YVCA 1H9JA 2JE6I 2KHSA 2XRSD 2DNCA 3STBD 4DR5Q 1EZ6A 2F0UA 3MEHA 2NWGA 1LT6D 2E8GA 1X3GA 1AZQA 4UDUC 1XNQL 3MXUA 1PH8A 5E4WC 5IYCH 4AQYL 3UDIA 1IYJB 1SE2A 4A3FG 1Z7TA 3CMAA 2QDLA 3A5UA 2WKCA 4KN7C 4IPCA 1WTVA 2JA5H 3RZOB 4RH6A 4NDXA 2TMPA 1HUMA 2K04A 3FP9A 5JJKA 1MIUA 4N8X1 1I94Q 3NEMA 4JI0L 1VQBA 2ALYB 2F0FA 3MEFA 3RD4A 4DV6Q 4EQOA 1SLJA 1YNXA 2HHHL 4X3KA 5EGTA 1JMCA 3GTMB 1WTQA 3I4MH 3TN2A 2CWAA 2AMCB 4DN4M 1ENFA 5C0XJ 3E6ZX 4B3TQ 4HAEA 1KD1C 2FMCA 1CZGA 1J6QA 4AIMA 2K03A 1HR0Q 5K5PA 4A3JH 3A7AB 5IYBH 5EBDA 2A5HA 1STEA 2UU9Q 2RCNA 4A3BB 2PZWA 4DV5L 1WD1A 4K5XA 5CBAE 4GLXA 4ZLTF 2XNAC 1AZPA 1D2BA 2JN4A 1PRTF 3HKZE 4OONA 1WTOA 2F0LA 2NUCA 3AQQA 3NBHB 4HCEA 5C3XA 2JA8B 2UUCQ 5I6WA 4K0KQ 4JI7L 5IGDA 2ID0A 5LMNL 4JI5Q 3SEBA 2WAQE 1Z47A 2B2WC 3RR5A 3K7UC 1X3QA 3S16B 1JWMD 2G5DA 2MHVA 1GUTA 4HIOA 4C2MB 2XSCA 1HR0W 1HFGA 5JPMC 3MZ5A 1XMOL 4H44C 4XT1B 2VUMG 1ESRA 4A3BG 2B2UC 1NBWA 3I70A 4XQJA 2Z1CA 2KA7A 3U4VA 4C56C 4GNXC 3S1QH 3ZYYX 1EIFA 3BVMA 1TT2A 4RG1A 1U4RA 1O7IA 4FP5D 2OCEA 1VMCA 3LWEA 4PZ6A 3M4OH 2WB1B 1ZKOA 5IODA 1FNWA 3TQYA 2E2IB 2DUDA 4JBJA 2EYHA 1VQ4A 3S17B 4KKSA 1UAPA 1UWVA 3DWQA 2D2CC 4K5WA 3W1BA 1UE5A 3GO5A 3PO3B 2RDGA 1Q86C 1HNXL 1AH9A 4QIWE 1K8AC 1LV9A 3DWPA 1GUNA 4DV2Q 4OO1G 3ONAB 2Y0SE 5T1GA 4DR7L 4IUUA 2C35B 1XX8A 3CRKC 2IJ0A 2I5HA 4A3DH 3L9AX 5FJ8H 3EA6A 1KNEA 2CWPA 2OT2A 3PUYA 3M9BA 3NHHA 4NXNQ 1YJ9A 2PZTA 1TS3A 4EX5A 2JA7B 1HXYD 5EKIA 4IJHA 2EDGA 3GTLH 4AYBE 3K57A 3PO3G 1E2ZA 5L37A 4P75A 2DJGC 3E0JA 3PIOA 4HSPA 2A6ED 2KCNA 2EIFA 4RGNA 1SR3A 2ZJRA 4IUVA 3PF5A 1QNUA 3M4YA 2M00A 1BDOA 1SN8A 3SK4A 1T5XD 2K5HA 1EY7A 1ICFB 1VQGA 2ZT9C 2TSSA 2O4XA 4TSSA 5C44B 1DOLA 4LF8Q 1Y1WB 2LMCB 2K5QA 2NN6G 1MSHA 2Z4IA 3G71A 1QZHA 1SFOB 4X65Q 3MXPA 2Z6KC 1J8IA 3I55A 4F88A 1I6HH 4RKLA 4ID6A 5C4HA 3T1HL 2QA4A 4LF5Q 2O5IC 5DEHA 4A3FH 1G51A 3HOZG 1YEZA 1HH2P 1BBWA 4Y52H 2BH8A 2GA4B 1WTWA 4R4TA 2F0QA 4J8QA 2RQXA 3LNNA 5CR3A 1NCVA 3A0JA 1AW7A 4DR6Q 2F0MA 4GNXB 3GTJB 2F52A 3H0GB 3VR2A 2A6EC 1FJGL 1EWIA 2WV6D 2UXDL 1F77A 4MTNA 4DAVA 3OMCA 1ASYA 3RUZA 4GLVB 2AKWB 5C4ZA 4OELB 2JEBI 2RHSB 5ELFA 1I4QA 1XXGA 1TWFB 4DV1Q 2GVAA 3CAMA 1JJCB 1CHPD 4LMQD 1JB3A 4DK6C 1DONA 1EIYB 3K0XA 2EJGC 2Z0SA 5C4XB 4C1NI 5KRUA 2Q8IB 2YV5A 3R93A 2JA6B 4YWLA 3EQLC 3H0GG 4RWSC 3RN2A 3CF5A 4R4IA 3P1HA 3CCSA 4LFBL 2JYOA 2E76C 3OTOQ 3GTMH 1M90C 5EPLA 1MGSA 2I0QA 2YU9H 4BBRB 1AN8A 1Q90A 3KOJA 3D4RA 1SYCA 4KN4C 3TREA 4B3MQ 1Q8IA 3AFQA 4JI1Q 2R92G 1EY0A 1Y69U 4K8IA 2NVQB 1PZKD 1UUPA 1V1PB 3NBHA 2VUMH 1MSGA 4A3BH 4BWGB 2DNEA 4QB4A 3DXJC 1NE3A 3J81L 4YY3L 4BS9A 1KDCA 5C4XG 2B2YC 1JC7A 5G3LD 1WCMG 3FPPA 1FL0A 2NTTA 3C3LA 1SJED 1XWEA 2QEJC 4PZ8A 3A8KE 4J6HA 4HJ7A 5DAUA 5AJ3Q 3GTKH 1IL8A 2IX0A 2PNRC 5FO8B 4DV4Q 2CFMA 1WI5A 5IT9E 2ZTEA 1I50B 1ESFA 1U0LA 5GAGC 3VYSA 4POGA 1C0AA 1RIPA 4N9PA 3U9OA 1JICA 5I9OA 3P20A 3K58A 2KHIA 5ELCA 4OO1H 1XNQQ 4CDFC 4WRDA 1Q81C 5KYLA 4FNFA 1G8ZD 3T16A 2RVLA 5IGFA 1Q7YC 1IBMQ 1A62A 1LABA 1IBKQ 3HOWB 3VDYA 1SYBA 3DUZA 1DGSA 5JOBA 1IKLA 2IPKD 1VF5C 4QGUA 3HKZB 5FLMG 2OEOA 3C1FA 3PIO3 3K5MA 1EY4A 4YCWA 2E2IH 4PQXA 5IOCA 2Z4HA 1HHVA 1PTOF 4BY7B 1I6VC 3PO3H 4LAAA 1VS0A 1SSOA 1BNZA 4MHEA 3KJPA 2EYJA 2JQOA 1TWCB 3V2TA 3I4OA 4IPDA 2R7ZB 4A3EB 1ONLA 4RA8A 3JAMi 2UXCQ 1MJCA 3K80C 2VQFQ 4CBVA 2HIXA 1S5CD 4X3TA 3G4SA 3VYRA 2NN6H 2J0TD 1HJPA 4GN5A 4CGYB 2K6AA 5JEAG 4HJAA 3FDTA 2FHTA 4BA1I 2JA7H 1VQPA 4BY7G 3S1RH 1K8OA 4FDBA 4NB3A 4X62Q 1SNOA 2VQEL 2EXDA 1XNRL 1F9RA 1YI2A 3HOZH 1TWAB 1Y8PB 2HD3A 3L3OC 4FXKC 1AE3A 2NVYH 5KGUA 3J80E 1H9RA 2Z6BA 1ASZA 3J7AV 2JA5B 3F2CA 3BDOA 3TS2A 4V0BA 1OXTA 5IWAQ 2B39A 1STHA 2F0SA 2B2WA 2M2LA 1YNND 1PV4A 1RJTA 2BDOA 3GQBA 3NTKA 5FLXE 1HTPA 1YBYA 5C44H 1BBXC 1KIXA 2EE1A 1Y1WH 5A2QE 1W3SA 4ZKCB 2ZXOA 3RN5A 3M7NA 3M7GA 3JAME 3RLOA 1OXVA 3I4MB 4JV5Q 1L0XB 1JB7A 1RHPA 4LWCA 2B2UA 2E5LL 1W6KA 4CKBA 1JE4A 1H9MA 4CHTB 4IQZA 3SVMA 5K36H 4POFA 1G91A 1O7YA 4ALPA 1EQTA 3CCMA 1SE4A 3QO2A 1PYSB 1VF7A 3PSIA 2WB1E 5FOBB 5M5WB 1GJXA 3GTJH 1Y14B 3H0GH 1EY8A 5BN5A 3ULJA 2Z9HA 1YJNA 2OTLA 4JI4Q 1QUQB 2FJ2A 3HP3A 2BOSA 4IOAA 1V43A 2V1CC 1YNNC 1FGUA 2BH2A 4B3RL 4PG3A 1TWFH 1OXXK 2JK8A 1GUWA 1I4PA 1U4MA 2XGTA 1JJ2A 1KAWA 3H94A 1TR5A 2EY2A 3PGZA 1XPOA 2AHOB 4GLAC 4DU9A 2O2LD 4DR3L 3G7LA 5C4XH 3FKIB 2QW7A 5IT9c 3FEWX 2CHBD 3SK8A 3S2HB 2JA6H 3I4NB 3NE5B 4DUYQ 1PVOA 4X6AH 1VQJA 2FINB 5COYA 5GROA 1V1PA 5IP9H 1VDZA 3P7JA 3K6OA 4U68A 4DR2L 5I4DA 1ET9A 2ICEC 2Q2HA 4O0AA 1CT1D 2R93B 1EIHA 2B3GA 3OSOA 2NVQH 1X55A 4IZ8A 5JJLA 4OHJA 1M1KC 3RLFA 3TZUA 1PA6A 2NTSA 3ERSX 1E7ZA 3ZJYC 1C7YA 4IURA 4PMBA 1XPUA 1BOSA 4C3JG 5I2XA 3TRZA 2K5DA 2F4IA 4IO9A 3CC4A 4ZKBB 2F0HA 1VQKA 3I4NG 1N32L 1SXTA 1NTGA 1TWGB 2AQ3B 5M5XH 5M5YH 5FLMH 3DLLA 1GM5A 3H91A 4PMWA 2AUKA 4JI2L 1I50H 1G2TA 4O1NA 5BN3A 2VB3X 5HURA 1EY9A 2R93G 2JSOA 1M8AA 1A2TA 1DCZA 1UNSA 3GTPB 1EOTA 1II3A 1GXDC 2R7FA 2HDMA 3NK9A 1X32A 2F0EA 3CRLC 5LMUL 1VQDA 3NWTA 3RMHA 2QEXA 1B1ZA 2MJ8A 4ME3A 2X69A 2VL6A 1SMYD 4ZCKA 3I72A 4APVA 4DAPA 1TU2B 3Q6SA 2KCTA 1ENAA 5JEAH 3QWNA 3J80c 1X9NA 5GQOA 3I90A 1C8CA 1I6HB 2VY3A 1EFID 4BY7H 2HQEA 1ILPA 3U4ZA 3ND9A 4A93B 4K2KA 5FLXc 1U4PA 4DR1Q 3MC0B 1MBYA 1NNXA 3RLNA 3VYTA 1B7YB 4G4KA 3KBGA 3PUZA 4H13C 1PH2A 3AFPA 3WOEA 1N36Q 2EVBA 1DXMA 1O7ZA 4HMJA 4DK1A 1PMRA 1G6ZA 4XQQA 4WFN3 4JOIC 4BBSB 2MP1A 2NZOA 1TXYA 1PH1A 3ER0A 1SMYC 1JT8A 1PH5A 1NMGA 1KQSA 4FVMA 1GUOA 5GADC 3X3NA 4IUPA 3I7FA 1EIGA 2F0DA 4IUNA 4R8NA 4A93G 2RBMA 2LFNA 1N34Q 1TWAH 2IT1A 4OX9L 2D5DA 4JI8L 3G48A 3RNUA 1CSQA 3E5SA 3KF8B 1SYFA 4TVAB 4I65A 4QY7A 4HR7B 4MIUA 1A3TA 3DM1A 3UDGA 1FNUA 1EWCA 4DV3L 4CJ0B 3R2TA 3SR1A 1Y8NB 2QILA 1P16A 1RF2D 4BBSG 4DR4L 2YU9B 1CM9A 2MGSA 2E74C 2N88A 4FF1A 2X6LA 2IHEA 2HDLA 2KECA 1SJHD 1I5FA 1K8GA 4P72A 3KLSA 4TRDA 5C5LA 3G6JB 1XMQL 2VUMB 2NB0A 2PZUA 5DM63 4YIJA 3STBC 2G9HD 3H09A 2M9VA 2E2HH 1D1IA 1LM0A 2F0NA 2RSNA 1EQVA 3NQIA 2R3ZA 3EVQA 5M5WH 4CKEA
chains in the Genus database with same CATH topology
1GOZA 3R2IA 4KY7A 5JEAJ 3QJYA 1R4QB 2HCIA 3GTKB 1PFNA 2EXZA 4C3IG 2EYLA 4QCLA 1SAPA 5M9OA 1DZ1A 1SNMA 4I7ZC 1Z6HA 2K5WA 1PRTD 5CORA 3K7AB 1KDBA 2MPMA 4XQNA 4ZAIA 1PFBA 2ZXRA 5EKLA 2FFKB 2K01A 1AP0A 2H1EA 4F87A 2L55A 3K5NA 2AQ1B 3GV6A 1OXUA 5M3MB 1KLGD 4K6DA 2K33A 1SYEA 1PRTC 1EEFD 2EJFC 3S1RB 3T53B 3MVVA 4J1MA 4DGZA 3GTQB 3HOZB 1DOKA 2XWBB 2EYPA 2NVYB 2C9OA 2EYOA 1PTOH 1KAAA 4N9TA 1JCKB 3I4LA 2L0CA 1F2YA 1HQMC 4KV6A 4ME5A 1JORA 4KTAA 5ELBA 1STGA 3AMUA 1L0YB 4DNRB 1TVXA 4ZUJA 1H9SB 2N55A 4IFDI 3PUWA 2ICIA 1VCIA 3I8ZA 3WDNA 3BVGA 2CQAA 2B2VC 2Z8LA 2JXMB 3D4DA 1SBBB 3SXHA 5CGKA 5JVH3 4PV1C 1QILA 4TKOB 1S5FD 3D4WA 4FO2A 5C3WA 3KF8A 3Q22A 1RTOA 1TS2A 2R92B 1S4ZA 1EWHA 3MWYW 4M8AA 4XYQA 1KABA 2BCOA 1BUVT 2K05A 2I07B 1S5ED 2PQEA 3TMEA 1PXUA 1H9KA 1NUCA 4JK1C 1JOKA 1WCMB 4KHVA 1TS5A 5I9PA 3O13A 4OIKA 5A2QL 3HZXA 4E6IA 3JAML 3VR6A 1PRTB 3F2UA 2X6GA 5NUCA 3S14B 4KI0A 2RSOA 3VR3A 5CV6A 4IUTA 2DN8A 3I91A 1XTCD 3TP6A 4FF2A 1LTID 1CQFA 5E4XA 1FYCA 5F2DA 2MUYA 5T1IA 1BQQT 1RODA 1BCPF 1EU3A 1PZID 4RAUC 3T56B 5KIXA 2SOBA 1EYAA 3I73A 4PMCA 1HQRD 4CJ1B 5M5XB 5M5YB 1HTLD 3IKJA 4NW2A 4QF4A 3OIQA 3TSSA 1SNQA 1SE3A 3TP7A 4RGTA 5C4JB 2NZ1D 2IWHA 3KLRA 2F0WA 1E0BA 3IFTA 3SK6A 5JVG3 5D65A 2K32A 5J39A 2NYZD 3AB9A 1LT5D 5CYUA 4NKLA 3W2DA 1LO5D 3OWEB 4C3HG 5EPJA 3MFYA 1QJOA 1WD0A 5IGGA 2HCCA 1FGBD 2PPBC 1ICWA 2F1MA 2LS01 3KLSX 4GZYC 3T4AC 1X3PA 4DNTB 1V1OA 5CV4A 5LL6X 4IN3A 1S5DD 3KBXA 1TKWB 2IX3A 4KD4A 4L63B 1SNDA 2E75C 5FK9C 2EY1A 5JJZA 3TP8A 1STBA 1UEAB 3BS1A 4P2CB 4LK1C 2K28A 5DNFA 1OO9B 4G7ZC 1CQVA 3TP5A 1PTOD 5D3DA 2EY6A 3A7LA 3CKIB 1BF4A 2WKDA 1I4RA 2WIIB 1F2LA 4DFAA 1NAPA 4DXFA 1GUSA 4KK7A 2F0PA 5IGBA 5D14A 1YNJD 2PYKA 2L4NA 1G291 4RGMA 5EBCA 1H9SA 1G2SA 4M1UB 3CQZB 1EY6A 1LACA 1IYVA 4C1NK 5CV5A 2OF1A 4XTCS 1F9QA 4HSVA 1DYQA 1EU4A 3DWAA 1CFMA 1LTAD 1TS4A 2KOLA 2E2HB 2A69D 3EROA 1B3AA 1PTOC 1BO0A 1FD7D 3A8JE 1CI3M 1F2ZA 3R3OA 3TBIB 1CA6A 4G7OC 4ZYSA 5C0XI 2A74C 3MA2B 1D5XC 2LKVA 1KTKA 4RHSA 3HEJA 3A8IE 1M4VA 1B9MA 1YNJC 1T5EA 1B4OA 3DHQA 3MXNA 1Q12A 1GHKA 1HA5A 2RA4A 2V4DA 3D8GA 3GD7A 1S5BD 2PW7A 4DA2A 3PUXA 4C3JB 1J9OA 4FXGC 5D3IB 3NQTA 5KNDA 4FF4A 2F0GA 4XIGS 3NTHA 1LTBD 2A69C 3EJIA 5JAVA 3NSWA 1TIID 1B53A 2BA1A 1C4QA 2WP8J 3HRZC 1U4LA 3NXWA 5IGEA 5CMDA 3BDLA 2XVSA 4G57A 2BA0A 1B44D 4HN7A 2F3WA 4XT3B 3WOFA 4IALA 1GUGA 5E1FA 5FO9B 3A54A 3R8BA 3A55A 3K59A 1Q1BA 2J7ZA 5LL6S 3LX0A 3SK5A 5KNCA 2B2VA 4OL7A 1A6XA 4ILWA 1D1KA 1NR2A 3BYYB 4RHRA 1PLFA 2XWJB 5I2YA 3T13A 1PTOB 2SEBD 4X3SA 1LTSD 4KJNA 2WACA 1F9SA 4R9WA 3FMCA 4Q5VA 3A56A 1MI2A 4XDXA 1KNAA 2BE5D 2NVTB 3D31A 1TWHB 1AEXA 3Q0AA 2XN9C 1Y1VB 1SNCA 2RDFA 3GTOB 2PMZB 1EEID 2L11A 5BN4A 5EKKA 4K8JA 2A73B 3OIPA 2D62A 3NTIA 1Y8OB 1WVLA 4U673 2DY8A 2O5JC 5J1ZA 4V190 3QG1A 2G9DA 2B2YA 2NVXB 3U9SA 1D5MC 2KEDA 1JWUD 2IL8A 1K8MA 4FYDA 2BE5C 3S15B 3J7AF 4HCSA 3NWSA 1SEBD 5I6YA 2K1BA 4K2LA 2KEEA 2I46A 2XIWA 1Q1EA 1DD2A 1EYDA 4C3IB 2WINB 2YYZA 3HOXB 1TY0A 3J7YW 1CK1A 3TZDA 3P75A 2AWNA 1PZJD 1O78A 1GHJA 3T51B 2F0OA 1ET6A 1B2TA 1B9NA 1RD9D 5CC4A 2C5CA 3MAQA 1CTMA 3L7ZC 2E2JB 3SHLA 3HOYB 4R8IA 1FNVA 2LY7A 1QNKA 1HRJA 2DY7A 3S9WA 1FR3A 3BG3A 1EL0A 3IAYA 4UAIA 2AWOA 4Q0FA 2IX1A 3N6RA 4RCNA 3BYTB 1PFMA 2K7VA 2XRQD 2B2TC 3C46A 5CV8A 1BR9A 3Q23A 2R6GA 1QOHA 4ODGA 4IFDG 5IGCA 1DOMA 1IKMA 2KJXA 1LT4D 4K14A 3KK7A 1STAA 4RCOA 3C2PA 4A3GB 1JOQA 2EJMA 5C5MA 3FRPB 2L1BA 3HG9A 5IT9L 3OMGA 1E2VA 3RZDB 5C3EB 3MFGA 3AU7A 2L5TA 1KDAA 1A15A 1NSNS 4HEDA 2SNSA 5KYIA 1B50A 1MD2D 2A6HD 1R4PB 2CVRA 4QUFA 2J4XA 2F0TA 2EY5A 2EYMA 5CBEE 1EYCA 3QOLA 1SYDA 3V05A 1HUNA 3QOJA 2PCFB 3D3RA 2B63B 3DMUA 4A3KB 1ZXTA 4Y7NB 3N52A 3K5OA 1HFNA 3QB3A 3SDZA 3H3VC 2EZVA 2F0IA 3SE0A 4IUQA 3PMFA 1JWSD 4KD3A 2A6HC 4F8MA 2VNUD 4XYOA 4OO1I 3LWUA 1A3VA 2Q8RE 4PNYA 4QMGA 3VYUA 5HGTA 4RFBA 1O7LA 3GV3A 3MTSA 4RKBA 1RDPD 4CKCA 4BA2I 1STNA 3KUPA 3J80L 3OOCA 3PUVA 1W6JA 2QCPX 2BDNA 5FLXL 1V8QA 3QIAA 5EJWA 1IYUA 4BY1B 2F03A 3DEOA 3IL8A 4ZK9B 5J22A 5K36G 5E3FA 1E2WA 4DAYA 1HPCA 3NUCA 2QKIC 3OWFA 1XYIA 3OPOA 3VA7A 5G3LF 4EGVA 2A68D 2JEAI 2NN6I 5A35A 5FO7B 1STYA 1ZYRD 3NBIA 4WJWA 2RDHA 1CZWA 2L12A 3VR4A 4A3IB 4C3HB 1EY5A 2KQ3A 1TQOA 4MN3A 4ZQ3A 4L8JA 5DM73 4H0LC 4LJZC 3D6CA 4KY5A 1QCBD 3GTGB 1D6EC 3PO2B 2PW5A 1A2UA 4ZRZA 2AQ2B 1HCZA 2QF7A 4KKTA 3CHBD 2B8FA 4IFDH 2CW0D 2A68C 2ZXPA 2KVMA 4XXEA 2AUJD 5IIFA 1ZYRC 5ELDA 2VXWA 1BCPD 4DK0A 4EQNA 3M3YB 1PDQA 1NR4A 1U9RA 1HA6A 3HOUB 4ABNA 1QG7A 2IW3A 5M3FB 5CV7A 3BDCA 3W3AA 3ERQA 1IW7D 4CJ2C 2SNMA 1LLRD 3OHXC 3Q24A 4TQUS 2CW0C 4F7XA 1WTRA 1SNPA 1K83B 3UI2A 2WAQB 5C6AA 1SDFA 1QB5D 5C0XG 3MXGA 1DM0B 1A3UA 1BCPC 3GP7A 4L6TB 2PO4A 1TY2A 1F2MA 4KHZA 3DEPA 1Q3LA 1LT3D 4OGQC 4OIJA 1I4GA 4H7BA 1R9TB 2NBFA 4KMUC 5KEEA 3M85A 3CU7A 1IW7C 1WTPA 3V96A 1DJRD 3S2DB 4IFDJ 4QIWB 2F0VA 4KJOA 1ZEQX 4G7HC 2Y0SB 3NPPA 2H4OA 5LHY1 4B9WA 2RKSA 4RGOS 4B9XA 1QWYA 1D5ZC 5FKAC 4EVOA 3S1MB 2B2TA 4DF7A 4A3JB 1PYWD 4AYBB 2E2DC 3J81E 3BZDB 1WTXA 2QDBA 5EQ0A 1RKNA 1LTTD 3IFDA 2EYFA 4HMIA 1ILQA 1VMPA 2OXPA 3BVZA 2F0KA 5EPKA 1JOOA 4O42A 1EZ8A 4NP5A 4ULLA 1CHQD 1I3QB 3H6MA 4FF3A 2JP1A 1BCPB 5ELEA 1RCVD 3ND8A 4K6LA 3S1QB 4JBWA 3X3MA 4NMZA 3TDQA 2HUGA 2SDFA 4X3UA 3HS0C 3M4OB 1RTNA 1KLUD 4ZUIA 2VB2X 2EOTA 2KCCA 3HGBA 3FVQA 1F9PA 1SYGA 1QE6A 1I4HA 5AFWA 5ISRA 2D9UA 3K5LA 2ENBA 2KUMA 1LTRD 3FPUB 5TSSA 3NP8A 2Q8TA 4A3DB 2F0JA 3URYA 2B8GA 3VA5A 3S1NB 1JR0D 4S3SA 5KNBA 4K5VA 4QUCA 3GTLB 5CV9A 5JPNC 1LTGD 2F3VA 4HTHA 2R61A 3MHBA 1O80A 5C0XH 4Z9CB 1CA5A 1ENCA 3D6WA 4KY6A 3K0YA 1JQYD 3C1EA 2FMMA 4WORA 1ML0D 4A3MB 2EPBA 4B08A 3ITPA 4KKUA 3I3CA 1BXTA 1OXSC 3OW7A 4A3FB 1I4XA 4FXDA 3PIP3 3VR5A 1C48A 3HOVB 4EQPA 1IHZA 2L9HA 3EFXD 3PV0A 4DXGA 1AFPA 1H9JA 2JE6I 2KHSA 2XRSD 2DNCA 1EZ6A 2F0UA 3MEHA 2NWGA 1LT6D 1AZQA 4UDUC 3MXUA 5E4WC 1SE2A 1Z7TA 2WKCA 4KN7C 1WTVA 3RZOB 4RH6A 4NDXA 2TMPA 1HUMA 2K04A 2F0FA 3RD4A 4EQOA 4X3KA 5EGTA 3GTMB 1WTQA 3TN2A 4DN4M 1ENFA 5C0XJ 3E6ZX 4HAEA 2FMCA 1CZGA 2K03A 5K5PA 3A7AB 5EBDA 2A5HA 1STEA 4A3BB 2PZWA 1WD1A 4K5XA 5CBAE 4ZLTF 2XNAC 1AZPA 1D2BA 1PRTF 1WTOA 2F0LA 2NUCA 4HCEA 5C3XA 2JA8B 5I6WA 5IGDA 2ID0A 3SEBA 1Z47A 2B2WC 1X3QA 3S16B 1JWMD 2MHVA 1GUTA 4C2MB 2XSCA 1HFGA 5JPMC 3MZ5A 4H44C 4XT1B 1ESRA 2B2UC 3I70A 4XQJA 2Z1CA 2KA7A 4C56C 3ZYYX 3BVMA 1TT2A 1U4RA 4FP5D 1VMCA 3LWEA 2WB1B 1ZKOA 5IODA 1FNWA 2E2IB 2EYHA 3S17B 4KKSA 1UAPA 3DWQA 2D2CC 4K5WA 3GO5A 3PO3B 2RDGA 1LV9A 3DWPA 1GUNA 4OO1G 3ONAB 5T1GA 4IUUA 1XX8A 3CRKC 2IJ0A 3L9AX 3EA6A 1KNEA 2OT2A 3PUYA 3NHHA 2PZTA 1TS3A 2JA7B 1HXYD 5EKIA 2EDGA 3K57A 1E2ZA 3E0JA 4HSPA 2A6ED 2KCNA 4RGNA 4IUVA 1QNUA 3M4YA 2M00A 1BDOA 3SK4A 1T5XD 1EY7A 2ZT9C 2TSSA 2O4XA 4TSSA 5C44B 1DOLA 1Y1WB 2LMCB 2K5QA 2NN6G 1MSHA 2Z4IA 1SFOB 3MXPA 1J8IA 4F88A 4RKLA 4ID6A 5C4HA 2O5IC 5DEHA 2GA4B 1WTWA 2F0QA 4J8QA 2RQXA 3LNNA 5CR3A 1NCVA 1AW7A 2F0MA 3GTJB 3H0GB 3VR2A 2A6EC 2WV6D 1F77A 4DAVA 3OMCA 3RUZA 5C4ZA 2JEBI 5ELFA 1I4QA 1XXGA 1TWFB 1CHPD 4LMQD 1JB3A 1DONA 2EJGC 5C4XB 4C1NI 5KRUA 2Q8IB 3R93A 2JA6B 3EQLC 4RWSC 3P1HA 2JYOA 2E76C 5EPLA 1MGSA 4BBRB 1AN8A 1Q90A 3D4RA 1SYCA 4KN4C 1Q8IA 1EY0A 1Y69U 4K8IA 2NVQB 1PZKD 1UUPA 1V1PB 3NBHA 1MSGA 4BWGB 2DNEA 4QB4A 3DXJC 3J81L 4BS9A 1KDCA 2B2YC 1JC7A 5G3LD 3FPPA 2NTTA 3C3LA 1SJED 1XWEA 2QEJC 3A8KE 4J6HA 5DAUA 1IL8A 2IX0A 2PNRC 5FO8B 5IT9E 1I50B 1ESFA 3VYSA 4N9PA 3U9OA 1JICA 5I9OA 3P20A 3K58A 5ELCA 4OO1H 4WRDA 5KYLA 4FNFA 1G8ZD 3T16A 2RVLA 5IGFA 1LABA 3HOWB 1SYBA 3DUZA 5JOBA 1IKLA 2IPKD 1VF5C 3HKZB 3PIO3 2OEOA 3C1FA 3K5MA 1EY4A 1HHVA 4PQXA 5IOCA 2Z4HA 1PTOF 4BY7B 1I6VC 4LAAA 1SSOA 1BNZA 4MHEA 2EYJA 1TWCB 3V2TA 2R7ZB 4A3EB 1ONLA 4RA8A 4CBVA 1S5CD 4X3TA 3VYRA 2NN6H 2J0TD 4CGYB 2K6AA 5JEAG 3FDTA 2FHTA 4BA1I 1K8OA 1SNOA 1F9RA 1TWAB 1Y8PB 3L3OC 4FXKC 5KGUA 3J80E 3J7AV 1H9RA 2JA5B 3BDOA 4V0BA 1OXTA 2B39A 1STHA 2F0SA 2B2WA 2M2LA 1YNND 1RJTA 2BDOA 3GQBA 3NTKA 5FLXE 1HTPA 1BBXC 2EE1A 5A2QE 4ZKCB 2ZXOA 3M7NA 3M7GA 3JAME 1OXVA 3I4MB 1L0XB 1RHPA 2B2UA 1W6KA 4CKBA 1JE4A 1H9MA 4CHTB 4IQZA 3SVMA 5K36H 1G91A 1O7YA 1EQTA 1SE4A 3QO2A 1VF7A 5FOBB 5M5WB 1GJXA 1EY8A 5BN5A 2FJ2A 3HP3A 2BOSA 1V43A 1YNNC 1OXXK 1GUWA 1I4PA 1U4MA 3H94A 1TR5A 2EY2A 4DU9A 2O2LD 3G7LA 3FKIB 3FEWX 2CHBD 3SK8A 3S2HB 3I4NB 3NE5B 2FINB 5COYA 1V1PA 1VDZA 3P7JA 3K6OA 4U68A 5I4DA 1ET9A 2ICEC 1CT1D 2R93B 1EIHA 3OSOA 4IZ8A 4OHJA 3RLFA 3TZUA 2NTSA 4IURA 4PMBA 1BOSA 4C3JG 5I2XA 2K5DA 2F4IA 4ZKBB 2F0HA 1SXTA 1TWGB 2AQ3B 3H91A 4PMWA 2AUKA 1G2TA 4O1NA 5BN3A 2VB3X 5HURA 1EY9A 2JSOA 1M8AA 1A2TA 1DCZA 1UNSA 3GTPB 1EOTA 1II3A 1GXDC 2HDMA 3NK9A 1X32A 2F0EA 3CRLC 3NWTA 3RMHA 1B1ZA 2MJ8A 2X69A 1SMYD 3I72A 4DAPA 1TU2B 3Q6SA 1ENAA 5JEAH 3QWNA 3I90A 1C8CA 1I6HB 1EFID 2HQEA 1ILPA 3ND9A 4A93B 4K2KA 1U4PA 3MC0B 1MBYA 3VYTA 4G4KA 3KBGA 3PUZA 4H13C 3WOEA 2EVBA 1DXMA 4DK1A 1O7ZA 4HMJA 1PMRA 1G6ZA 4XQQA 4WFN3 4BBSB 2MP1A 1SMYC 4FVMA 1GUOA 3X3NA 4IUPA 1EIGA 2F0DA 4IUNA 4R8NA 2RBMA 2LFNA 2IT1A 2D5DA 3E5SA 1SYFA 4I65A 4HR7B 4MIUA 1A3TA 3DM1A 1FNUA 1EWCA 4CJ0B 3R2TA 3SR1A 1Y8NB 2QILA 1RF2D 2YU9B 1CM9A 2MGSA 2E74C 2N88A 4FF1A 2X6LA 2HDLA 2KECA 1SJHD 3KLSA 4TRDA 5C5LA 3G6JB 2VUMB 2NB0A 2PZUA 5DM63 4YIJA 2G9HD 3H09A 2M9VA 1D1IA 2F0NA 2RSNA 1EQVA 3NQIA 2R3ZA 3EVQA 4CKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N9T A;  1EYA A;  5E1F A;  2PYK A;  3H6M A;  2F0Q A;  4KY7 A;  4K2L A;  5C5M A;  3T16 A;  5C6A A;  5E3F A;  5CR3 A;  5I6Y A;  5IGF A;  5J22 A;  4PMC A;  1F2Y A;  1A3U A;  3OMG A;  2F0M A;  4KV6 A;  3NUC A;  1EY8 A;  3OWF A;  4ME5 A;  1EYD A;  4KTA A;  1SYB A;  4QF4 A;  1ENA A;  1EY6 A;  1JOR A;  5JOB A;  4EQP A;  1TT2 A;  1IHZ A;  1KDA A;  1F2M A;  1SNQ A;  3LX0 A;  1NSN S;  4NMZ A;  1STG A;  2OF1 A;  2OEO A;  3C1F A;  5CV5 A;  3SK5 A;  2SNS A;  5I9O A;  1EY4 A;  1STY A;  3OMC A;  2EXZ A;  3RUZ A;  4OL7 A;  3TP7 A;  5C4Z A;  5IOC A;  2EYL A;  5IOD A;  5KYI A;  4ZUI A;  2HQE A;  4ZUJ A;  2KHS A;  2EYH A;  5M9O A;  4K2K A;  3P75 A;  2F0U A;  1EZ6 A;  2F0W A;  3MEH A;  4K5W A;  4LAA A;  2F0O A;  4H7B A;  3SK6 A;  1TR5 A;  3T13 A;  3ERO A;  2EY2 A;  1SNM A;  2EYJ A;  2F0T A;  3V2T A;  2EY5 A;  5KEE A;  5J39 A;  2EYM A;  1EY5 A;  1F2Z A;  1SYG A;  2KQ3 A;  4DU9 A;  3R3O A;  1TQO A;  1EYC A;  4NKL A;  4ZQ3 A;  5ISR A;  5CC4 A;  3QOL A;  1SYD A;  3D4D A;  4KJN A;  5KRU A;  3SK8 A;  4F8M A;  2LKV A;  3QOJ A;  3SXH A;  5CGK A;  2ENB A;  4HMJ A;  2WAC A;  3D6C A;  4KY5 A;  4NDX A;  3DMU A;  3HEJ A;  3EVQ A;  3SHL A;  5IGG A;  2F0V A;  4KJO A;  2PW5 A;  3D4W A;  3NP8 A;  1KDB A;  3P1H A;  4DF7 A;  1A2U A;  2F0F A;  2F0J A;  5C3W A;  3DHQ A;  3VA5 A;  3QB3 A;  4EQO A;  4S3S A;  5EGT A;  3NHH A;  1AEX A;  5IGB A;  2PZT A;  4IAL A;  2F0D A;  4IUN A;  4R8N A;  4K5V A;  1SYC A;  2F0I A;  2RBM A;  3OSO A;  5EKL A;  1KAB A;  4B9W A;  3D8G A;  3S9W A;  2RKS A;  2PW7 A;  4B9X A;  3PMF A;  5CV4 A;  1EY0 A;  2PQE A;  1SNO A;  4IZ8 A;  4K8I A;  1SNC A;  3TME A;  4KD3 A;  5IIF A;  2RDF A;  5K5P A;  4EQN A;  4EVO A;  3E5S A;  5CV9 A;  1NUC A;  1SYF A;  2F3V A;  3NQT A;  4HTH A;  2F0G A;  4KD4 A;  4I65 A;  4K8J A;  1JOK A;  1SND A;  5EKK A;  5KGU A;  4PMB A;  2EY1 A;  3MHB A;  4QB4 A;  2PZW A;  4KHV A;  3TP8 A;  4MIU A;  1A3T A;  1U9R A;  5I9P A;  1STB A;  4K5X A;  1KDC A;  1STH A;  2F0S A;  2M00 A;  3SK4 A;  3HZX A;  1ENC A;  3EJI A;  4E6I A;  5JAV A;  1EY7 A;  4K6D A;  2F0L A;  2F0H A;  3SR1 A;  2NUC A;  4KY6 A;  1A3V A;  5J1Z A;  4PNY A;  4QMG A;  2O4X A;  5C3X A;  5HGT A;  1SYE A;  3TP5 A;  5I6W A;  4J6H A;  2QDB A;  3NXW A;  4RKB A;  5CV8 A;  1RKN A;  5CV7 A;  5DAU A;  2EYF A;  5IGE A;  4WRD A;  3C1E A;  4HMI A;  3BDC A;  5IGD A;  1STN A;  5NUC A;  3MXP A;  4WOR A;  2EY6 A;  2OXP A;  3BDL A;  5CV6 A;  4G57 A;  5HUR A;  3ERQ A;  1EY9 A;  4TRD A;  2F0K A;  3MVV A;  4J1M A;  4DGZ A;  1A2T A;  3ITP A;  4ODG A;  5C5L A;  4RKL A;  2PZU A;  2EYP A;  4ID6 A;  5IGC A;  4YIJ A;  3TP6 A;  1JOO A;  4N9P A;  5C4H A;  2SNM A;  1EZ8 A;  3U9O A;  1II3 A;  4K14 A;  5F2D A;  2F3W A;  5DEH A;  4DFA A;  1STA A;  4NP5 A;  2F0P A;  3MZ5 A;  2F0N A;  2F0E A;  3NK9 A;  1EQV A;  4F7X A;  2EYO A;  1SNP A;  1KAA A;  1JOQ A;  5KYL A;  5KIX A;  2SOB A; 
#chains in the Genus database with same CATH topology
 5BR8 L;  1GOZ A;  3R2I A;  4KY7 A;  5JEA J;  3QJY A;  1R4Q B;  2ES2 A;  2HCI A;  3IRB A;  3GTK B;  1PFN A;  3CD6 A;  1YIJ A;  1A8V A;  4GKJ L;  3BZC A;  2EXZ A;  4JI6 L;  4C3I G;  2EYL A;  4QCL A;  1SAP A;  5M9O A;  1NY4 A;  3HOX G;  2ATW A;  2EQS A;  4R4C A;  1H95 A;  1A63 A;  2K4K A;  1DZ1 A;  1SNM A;  3HKS A;  4LF6 Q;  2CKZ B;  4I7Z C;  2K5V A;  3FKI H;  1Z6H A;  4DV7 L;  3S2H H;  2K5W A;  1PRT D;  4WJ4 A;  2K75 A;  3I4N H;  5COR A;  4X64 Q;  1CKN B;  3K7A B;  1XTD A;  1X54 A;  1EQR A;  1KDB A;  2MPM A;  2LXK A;  4XQN A;  2R93 H;  4ZAI A;  1WTH A;  1KL9 A;  4JYA L;  1PFB A;  2ZXR A;  3WWV A;  5EKL A;  1Q82 C;  4HIK A;  3HOY G;  4MTK A;  2FFK B;  4NXM Q;  1VQN A;  1VQ8 A;  2K01 A;  3M4Q A;  2Q2T A;  1UE6 A;  3F2B A;  2UUB L;  1AP0 A;  5ELO A;  2GN5 A;  2H1E A;  1UEB A;  4F87 A;  2L55 A;  3K5N A;  3LGJ A;  2N78 A;  2AQ1 B;  3GV6 A;  1OXU A;  5M3M B;  3KF6 B;  3NEN A;  3F8T A;  1KLG D;  4K6D A;  4QL5 A;  2K33 A;  2UXB L;  1TWG H;  4LFA L;  2LXJ A;  2ZTC A;  1SYE A;  2MFI A;  1PRT C;  2ZJP A;  1X65 A;  1EEF D;  2EJF C;  3S1R B;  4LF9 L;  3T53 B;  3MVV A;  3GTP H;  4J1M A;  4DGZ A;  3GTQ B;  3PQI A;  3HOZ B;  3U50 C;  1DOK A;  2XWB B;  2EYP A;  2NVY B;  1MHW C;  2C9O A;  4MZ9 A;  4QQB X;  3CXC A;  2EYO A;  1KAA A;  1PTO H;  3L2P A;  2RHQ B;  4N9T A;  1JCK B;  3I4L A;  2L0C A;  1F2Y A;  5M3M G;  2UUA L;  1HQM C;  4A3G G;  2KCM A;  4KV6 A;  4ME5 A;  1JOR A;  4KTA A;  5ELB A;  1STG A;  3AMU A;  1L0Y B;  4DNR B;  5C3E G;  1TVX A;  4A93 H;  4ZUJ A;  4GKK Q;  1H9S B;  2F3I A;  2N55 A;  1TWH H;  4IFD I;  4LF4 Q;  3PUW A;  4JC0 A;  2ICI A;  1VCI A;  3I8Z A;  1AE2 A;  3WDN A;  3PCO B;  4IPG A;  4KHP L;  3W1G A;  2RCF A;  4RMF A;  1B70 B;  3BVG A;  2CQA A;  2B2V C;  3CC7 A;  3GTO H;  2Z8L A;  4QJF A;  3F2D A;  2JXM B;  3D4D A;  3EIV A;  1SBB B;  3SXH A;  5CGK A;  5JVH 3;  4PV1 C;  1QIL A;  4DUZ L;  4BBS H;  4TKO B;  1S5F D;  3D4W A;  2HT1 A;  4FO2 A;  5C3W A;  3KF8 A;  3UE0 A;  3Q22 A;  1RTO A;  1TS2 A;  2B63 G;  2F4V L;  5E7N A;  4X66 L;  2VS1 A;  2R92 B;  4A3K G;  1BKB A;  1S4Z A;  1EWH A;  5HGQ A;  2I5M X;  2NVX H;  3MWY W;  4M8A A;  4XYQ A;  1KAB A;  2BCO A;  1BUV T;  2K05 A;  1WOC A;  2I07 B;  1S72 A;  1S5E D;  2PQE A;  3TME A;  4AH6 A;  1PXU A;  1H9K A;  1NUC A;  1E24 A;  4JK1 C;  1JOK A;  1WCM B;  3MXN B;  4KHV A;  1TS5 A;  5I9P A;  3O13 A;  4OIK A;  5H1S E;  1N33 Q;  5A2Q L;  3AYH B;  3HZX A;  4E6I A;  3CCU A;  3JAM L;  1HNZ Q;  2ASB A;  3VR6 A;  2CQO A;  4J15 A;  1PRT B;  3F2U A;  4C3I H;  2X6G A;  5NUC A;  3S14 B;  4KI0 A;  2RSO A;  2RF4 A;  3VR3 A;  5CV6 A;  4IUT A;  2DN8 A;  3HOX H;  4UPA A;  3I91 A;  1XTC D;  3TP6 A;  4FF2 A;  1LTI D;  3CCE A;  1CQF A;  5E4X A;  4L5R C;  1FYC A;  5F2D A;  2MUY A;  5T1I A;  1BQQ T;  2ZM6 L;  4B3S Q;  1ROD A;  1BCP F;  1EU3 A;  1PZI D;  4RAU C;  3T56 B;  4JG2 A;  5KIX A;  2SOB A;  1EYA A;  4LFC Q;  1S3O A;  3I73 A;  4BY1 G;  1JJG A;  4PMC A;  1HNW Q;  1HQR D;  1KXL A;  1EYG A;  4CJ1 B;  5M5X B;  5M5Y B;  1HTL D;  3IKJ A;  4NW2 A;  4QF4 A;  1J5E L;  3OIQ A;  3TSS A;  4JVZ A;  1SNQ A;  2E2J H;  1T9H A;  1SE3 A;  3TP7 A;  4LNQ A;  4RGT A;  4JI3 L;  5C4J B;  2NZ1 D;  4IPH A;  3HOY H;  2IWH A;  4LF7 L;  2K52 A;  3KLR A;  1CKN A;  2N8N A;  2F0W A;  2A19 A;  1E0B A;  4AQY Q;  3IFT A;  4LUV A;  3SK6 A;  5JVG 3;  4DR5 L;  5D65 A;  4JOI A;  3UDF A;  2K32 A;  5J39 A;  5ELN A;  2NYZ D;  3AB9 A;  1LT5 D;  5CYU A;  1B8A A;  1X3F A;  4NKL A;  3W2D A;  1LO5 D;  1KRS A;  1SRO A;  3E9I A;  3OW2 A;  4A3I G;  3OWE B;  4C3H G;  3FHW A;  3K7A H;  2QGQ A;  5EPJ A;  3MFY A;  4BXX G;  3DM3 A;  1QJO A;  1WD0 A;  4JI0 Q;  5IGG A;  3J80 i;  2HCC A;  2HHH Q;  1FGB D;  1I94 L;  2PPB C;  1ICW A;  2F1M A;  2LS0 1;  4DV6 L;  3PO2 G;  2PQA B;  3HFZ B;  3KLS X;  4GZY C;  3T4A C;  1X3P A;  4DNT B;  2XTI A;  4DK3 C;  1V1O A;  5CV4 A;  3CW2 C;  5LL6 X;  4IN3 A;  1S5D D;  1BVS A;  3KBX A;  1TKW B;  4B3T L;  1XMQ Q;  2IX3 A;  4DV5 Q;  4KD4 A;  4L63 B;  1SND A;  1HR0 L;  2E75 C;  5FK9 C;  1BBU A;  2EY1 A;  1L2F A;  5JJZ A;  1IZ6 A;  3TP8 A;  1RL2 A;  1VQI A;  2UU9 L;  5M3M H;  4GOP C;  1STB A;  4A3G H;  4A76 A;  1UEA B;  3BS1 A;  4P2C B;  4LK1 C;  2K28 A;  5DNF A;  1OO9 B;  4G7Z C;  1CQV A;  4JI7 Q;  3RZD H;  3HOU G;  3TP5 A;  5C3E H;  5LMN Q;  2OQK A;  2UUC L;  4K0K L;  1PTO D;  5D3D A;  2EY6 A;  3A7L A;  3CKI B;  3GTQ H;  4JI5 L;  1BF4 A;  2WKD A;  1VQ5 A;  1I4R A;  2WII B;  4L5S A;  1F2L A;  1XMO Q;  4DFA A;  1NAP A;  4KK7 A;  1GUS A;  4UP9 A;  2F0P A;  4DXF A;  5IGB A;  4LW1 A;  5D14 A;  1YNJ D;  2PYK A;  2L4N A;  1G29 1;  4RGM A;  5EBC A;  1H9S A;  4DV7 Q;  1G2S A;  5IYD G;  4M1U B;  2WAQ G;  3CQZ B;  1EY6 A;  1LAC A;  5LMN W;  1IYV A;  4C1N K;  5CV5 A;  2OF1 A;  4A3K H;  4XTC S;  2OQ0 A;  4JPB W;  4GNX A;  3H3V I;  1F9Q A;  1P8L A;  1SRU A;  1DYQ A;  1EU4 A;  3DWA A;  4HSV A;  3J7A 5;  1CFM A;  1LTA D;  1TS4 A;  2KOL A;  2GVB A;  3OYY A;  1HNX Q;  4OWW B;  2E2H B;  2A69 D;  3ERO A;  1B3A A;  1PTO C;  1BO0 A;  3ULL A;  1K9M C;  1FD7 D;  3A8J E;  4I7A A;  1CI3 M;  1F2Z A;  3R3O A;  3TBI B;  2JJQ A;  1CA6 A;  4G7O C;  4DV2 L;  4DR7 Q;  4ZYS A;  5C0X I;  2A74 C;  3MA2 B;  1D5X C;  2LKV A;  5IYC G;  1KTK A;  1K0R A;  4RHS A;  3HEJ A;  3A8I E;  1M4V A;  1B9M A;  1YNJ C;  1T5E A;  1B4O A;  3GDE A;  3DHQ A;  2R92 H;  3MXN A;  1Q12 A;  1GHK A;  1HA5 A;  1X6O A;  2RA4 A;  4NXN L;  2V4D A;  3D8G A;  3GD7 A;  2Y0S G;  1YHQ A;  1S5B D;  2PW7 A;  4DA2 A;  3PUX A;  4JCV E;  4C3J B;  1J9O A;  4FXG C;  5D3I B;  4YWK A;  1WCM H;  3NQT A;  5KND A;  3I2Z A;  4FF4 A;  2F0G A;  4XIG S;  1VQO A;  4BY1 H;  3NTH A;  1LTB D;  4GOP B;  2A69 C;  2VZA A;  3EJI A;  5JAV A;  3NSW A;  5IYB G;  1TII D;  1B53 A;  2BA1 A;  1C4Q A;  2WP8 J;  3HRZ C;  2UUA Q;  1U4L A;  1HZ9 A;  4P73 A;  4AYB G;  3NXW A;  3NEL A;  3S14 H;  5IGE A;  5CMD A;  4LF8 L;  3BDL A;  2XVS A;  4G57 A;  4X65 L;  2P5Z X;  3T1H Q;  2BA0 A;  1IBL L;  1B44 D;  1GD7 A;  2Z6K A;  4HN7 A;  2F3W A;  4XT3 B;  1EOV A;  3WOF A;  4LF5 L;  4IAL A;  4A3I H;  1WFQ A;  4C3H H;  1GUG A;  5E1F A;  5FO9 B;  4BXX H;  1K3R A;  1CKO A;  3A54 A;  1FJG Q;  3R8B A;  2UXD Q;  4DR6 L;  3A55 A;  3K59 A;  2PNH A;  1Q1B A;  2J7Z A;  5LL6 S;  3LX0 A;  3GTG H;  2A1A A;  4MNO A;  3SK5 A;  3PO2 H;  1VQ6 A;  5C4J H;  5KNC A;  2B2V A;  4OL7 A;  4A3C G;  4ILW A;  1A6X A;  2PI2 A;  1D1K A;  3BJU A;  5IY0 A;  1NR2 A;  3BYY B;  4RHR A;  3E3X A;  1PLF A;  1YJW A;  2XWJ B;  5I2Y A;  3T13 A;  1PTO B;  4L5T A;  1GVP A;  3BU2 A;  2SEB D;  1K28 A;  4X3S A;  4LUZ A;  3EBE A;  1LTS D;  4O2D A;  2PQA A;  4KJN A;  1YHB A;  2WAC A;  1F9S A;  4R9W A;  2HIV A;  3HOU H;  3FMC A;  4R4O A;  4Q5V A;  4LFB Q;  3A56 A;  1MI2 A;  4XDX A;  1KNA A;  4YCV A;  1SMX A;  2BE5 D;  2NVT B;  1PH4 A;  2K5N A;  1UE7 A;  1PHJ A;  3D31 A;  1TWH B;  1AEX A;  3Q0A A;  2XN9 C;  1Y1V B;  3AEV A;  2CCZ A;  1SNC A;  4B3M L;  2RDF A;  3GTO B;  2PMZ B;  1EEI D;  2L11 A;  5BN4 A;  5EKK A;  4K8J A;  4YY3 Q;  2A73 B;  3OIP A;  2D62 A;  2ZJQ A;  4UY8 C;  3NTI A;  1Y8O B;  1WVL A;  4U67 3;  2DY8 A;  1EQQ A;  2O5J C;  3QR8 A;  1VQC A;  5J1Z A;  1NJI C;  4V19 0;  1J5E Q;  3QG1 A;  2G9D A;  2B2Y A;  2NVX B;  1K0S A;  1KC8 C;  5AJ3 L;  4DV4 L;  3U9S A;  2YTV A;  1D5M C;  2KED A;  1JWU D;  1E22 A;  1Y1V G;  1K8M A;  2IL8 A;  4FYD A;  2BE5 C;  3S15 B;  3J7A F;  1VQ9 A;  4A3M G;  4HCS A;  1R9T H;  3J81 c;  1LTL A;  3NWS A;  5HY6 A;  1SEB D;  5I6Y A;  2K1B A;  4K2L A;  2KEE A;  2I46 A;  1U5K A;  1PH7 A;  1LUZ A;  2XIW A;  1XJV A;  1Q1E A;  1DD2 A;  1QVG A;  3CQZ H;  1IBM L;  1EYD A;  1IBK L;  1S40 A;  4C3I B;  2WIN B;  4WJ3 M;  1HZA A;  2YYZ A;  3S2D H;  2WFW A;  4R4Q A;  3HOX B;  3T1Y L;  4CDE C;  3HOV G;  1CSP A;  1TY0 A;  3J7Y W;  2DJF C;  1CK1 A;  4DAY B;  3TZD A;  2PI2 E;  1QUQ A;  3P75 A;  2AWN A;  2MQH A;  1PZJ D;  1O78 A;  1GHJ A;  3T51 B;  2F0O A;  1A0I A;  1ET6 A;  3CC2 A;  1VQH A;  4UHV A;  1B2T A;  1B9N A;  1RD9 D;  3S1M H;  2KHJ A;  5CC4 A;  2C5C A;  3MAQ A;  2YTY A;  1CTM A;  3L7Z C;  2UXC L;  2VQF L;  2E2J B;  3KDF B;  3SHL A;  4JBK A;  1MJE A;  1UE1 A;  3HOY B;  4R8I A;  2MO1 A;  1L0W A;  3CPW A;  1FNV A;  2LY7 A;  3TS0 A;  1QNK A;  1HRJ A;  4GOP A;  2DY7 A;  3S9W A;  2VQE Q;  2NZH A;  1XNR Q;  3B6Y A;  4C3J H;  4X62 L;  1VQE A;  1FR3 A;  4OWX B;  3BG3 A;  1EL0 A;  1VQA A;  3IAY A;  4DKA C;  4UAI A;  2AWO A;  4Q0F A;  1I3Q H;  5IWA L;  3F1Z A;  3CCR A;  3N6R A;  2IX1 A;  4RCN A;  2L15 A;  3G6E A;  4R1J A;  3BYT B;  1PFM A;  2K7V A;  2XRQ D;  2B2T C;  3C46 A;  5CV8 A;  4A3C H;  1BR9 A;  3Q23 A;  1QVC A;  2R6G A;  2E5L Q;  2JA8 G;  1QOH A;  3K8A A;  4OXP A;  4JV5 L;  1B3Q A;  4ODG A;  4IFD G;  5IGC A;  1DOM A;  1E3P A;  2OTJ A;  1G6P A;  1IKM A;  4DAM A;  2KJX A;  1LT4 D;  4K14 A;  3KK7 A;  1STA A;  4RCO A;  3C2P A;  4A3G B;  1JOQ A;  2EJM A;  2HQL A;  5C5M A;  3S24 A;  3FRP B;  2L1B A;  3HG9 A;  5IT9 L;  1QZG A;  5IP7 G;  3OMG A;  1E2V A;  3RZD B;  1NMF A;  4PZ7 A;  5C3E B;  3MFG A;  1GKH A;  3AU7 A;  2L5T A;  1KDA A;  1A15 A;  1NSN S;  4JI4 L;  1PFS A;  4HED A;  2SNS A;  4B3R Q;  5KYI A;  1B50 A;  1MD2 D;  1PH9 A;  3E0E A;  3ICE A;  2A6H D;  1YIT A;  3S1N H;  1R4P B;  1SE8 A;  2WB1 G;  2CVR A;  4YCU A;  4QUF A;  2J4X A;  2F0T A;  4DR3 Q;  2EY5 A;  2EYM A;  5CBE E;  4A3L G;  1EYC A;  3QOL A;  1SYD A;  3V05 A;  1YHA A;  1HUN A;  1VQM A;  3QOJ A;  2PCF B;  3D3R A;  2B63 B;  3DMU A;  2CH4 W;  4A3K B;  2NVT H;  1ZXT A;  4Y7N B;  3N52 A;  4DUY L;  3K5O A;  4DR2 Q;  3CME A;  1HFN A;  3QB3 A;  3SDZ A;  3H3V C;  1E1O A;  2EZV A;  1Y1V H;  1HZC A;  2F0I A;  3SE0 A;  4A3M H;  4IUQ A;  1HZB A;  1YZ6 A;  1JWS D;  3PMF A;  5GAH C;  4KD3 A;  1IBL Q;  2ZTD A;  1E1T A;  2JA7 G;  2A6H C;  4F8M A;  2VNU D;  4XYO A;  1CUK A;  4OO1 I;  3LWU A;  1C9O A;  3U58 A;  1N32 Q;  1A3V A;  2Q8R E;  4PNY A;  4QMG A;  1N9W A;  3VYU A;  5HGT A;  3PF4 A;  4RFB A;  1O7L A;  3GV3 A;  3MTS A;  3HOV H;  4RKB A;  1RDP D;  4CKC A;  4JI2 Q;  1X56 A;  2OWO A;  4BA2 I;  1STN A;  3KUP A;  3J80 L;  4HJ8 A;  4IOC A;  3OOC A;  3PUV A;  2IHF A;  5C44 G;  1Y1W G;  1W6J A;  2QCP X;  3S15 H;  2BDN A;  5FLX L;  1V8Q A;  3CCL A;  3QIA A;  5LMU Q;  3J81 j;  5EJW A;  1IYU A;  4BY1 B;  2F03 A;  1XPR A;  1V9P A;  3DEO A;  5J3B A;  3IL8 A;  4UP7 A;  4ZK9 B;  4CDD C;  5J22 A;  5K36 G;  5E3F A;  1E2W A;  4DAY A;  1HPC A;  3CCQ A;  3CCJ A;  1PH6 A;  3NUC A;  2QKI C;  3OWF A;  1XYI A;  3OPO A;  3VA7 A;  5G3L F;  3H15 A;  3RZO H;  3CPF A;  4EGV A;  2A68 D;  1X3E A;  2JEA I;  4YHH L;  2NN6 I;  1D8L A;  5A35 A;  5FO7 B;  2H5X A;  1STY A;  1ZYR D;  3NBI A;  1L1O C;  4WJW A;  3BZK A;  2RDH A;  4DR1 L;  3KDF A;  1CZW A;  2L12 A;  3VR4 A;  2VW9 A;  4A3I B;  4C3H B;  1N8R C;  1EY5 A;  2KQ3 A;  1TQO A;  1Z9F A;  4MN3 A;  4ZQ3 A;  4GN3 B;  4L8J A;  5DM7 3;  1WYD A;  4H0L C;  1WJJ A;  4LJZ C;  3D6C A;  4KY5 A;  1QCB D;  1N36 L;  4UP8 A;  4DV0 L;  3A74 A;  2K14 A;  3GTG B;  1D6E C;  3UE1 A;  3PO2 B;  2PW5 A;  1A2U A;  4ZRZ A;  4L5Q A;  2AQ2 B;  2PMZ E;  2JA6 G;  1HCZ A;  2JA8 H;  2QF7 A;  4KKT A;  4A4I A;  5GAE C;  3CHB D;  4LUO A;  2B8F A;  4IFD H;  2CW0 D;  3ULP A;  4P74 A;  2A68 C;  5IP9 G;  2D0P A;  2ZXP A;  4KLK A;  2KVM A;  3M4P A;  4XXE A;  4JI8 Q;  4BBR G;  4OX9 Q;  3S16 H;  1N34 L;  2AUJ D;  5IIF A;  1ZYR C;  5ELD A;  2VXW A;  1BCP D;  4DK0 A;  4EQN A;  3M3Y B;  1PDQ A;  4C2M H;  4EQ5 A;  1NR4 A;  1IL2 A;  1U9R A;  1HA6 A;  5IP7 H;  4DV3 Q;  3HOU B;  3EN2 A;  1PYB A;  4ABN A;  4DR4 Q;  1QG7 A;  2MO0 A;  1QVF A;  2IW3 A;  3CP0 A;  5M3F B;  5CV7 A;  3KF6 A;  3BDC A;  3W3A A;  3KLW A;  3T1Y Q;  3ERQ A;  2R7D A;  1IW7 D;  4OWT B;  2N49 A;  4CJ2 C;  3S17 H;  2LSS A;  2SNM A;  4A3L H;  1LLR D;  3OHX C;  3Q24 A;  3I56 A;  4TQU S;  5BR8 Q;  2CW0 C;  4F7X A;  1WTR A;  1SNP A;  1K83 B;  2WAQ B;  3UI2 A;  5C6A A;  1SDF A;  3E9H A;  1QB5 D;  5C0X G;  3MXG A;  1DM0 B;  1A3U A;  1BCP C;  3GP7 A;  4L6T B;  3K81 C;  2PO4 A;  4IJL A;  3TEH B;  1KRT A;  1TY2 A;  1F2M A;  4GKJ Q;  4KHZ A;  4JI6 Q;  5M3F G;  3HOW G;  1L1O B;  3DEP A;  1Q3L A;  1LT3 D;  3HKZ G;  4OGQ C;  3JC6 6;  2D0O A;  4OEM B;  4OIJ A;  1I4G A;  4H7B A;  1V1Q A;  1R9T B;  2A8V A;  2NBF A;  3J81 i;  1LYL A;  4KMU C;  5KEE A;  3KFU A;  4LF6 L;  3M85 A;  3CU7 A;  1IW7 C;  1WTP A;  3V96 A;  4DNI A;  1DJR D;  4GS3 A;  2B63 H;  2R7Z G;  4A3E G;  3S2D B;  4X64 L;  4IFD J;  4Y7N H;  4QIW B;  2F0V A;  4KJO A;  1ZEQ X;  4G7H C;  2MNA A;  2Y0S B;  4DPG A;  4JYA Q;  3NPP A;  2H4O A;  5LHY 1;  1IXR A;  1SFO H;  1JE5 A;  4B9W A;  2RKS A;  4RGO S;  4B9X A;  3PIP A;  1QWY A;  1D5Z C;  1VQF A;  5FKA C;  2B29 A;  2UUB Q;  4NXM L;  4EVO A;  3S1M B;  2B2T A;  4DF7 A;  4A3J B;  5EAY A;  2FXQ A;  1PYW D;  4NPS A;  3KJO A;  2I5L X;  2UXB Q;  4AYB B;  4LFA Q;  1OTC A;  1KHI A;  2E2D C;  3J81 E;  4HJ5 A;  2JA5 G;  3BZD B;  1FVI A;  1WTX A;  1EFW A;  2QDB A;  5EQ0 A;  1RKN A;  1LTT D;  3IFD A;  2EYF A;  4HMI A;  3UDX A;  4YWM A;  4LF9 Q;  1W2B A;  1ILQ A;  1VMP A;  2OXP A;  4JW0 A;  3A5Z B;  3BVZ A;  2F0K A;  5EPK A;  3I4M G;  1JOO A;  4O42 A;  1EZ8 A;  2KBN A;  3CCV A;  3D0F A;  4NP5 A;  4ULL A;  2K50 A;  1CHQ D;  4A75 A;  4A3J G;  4CDC C;  2Q2U A;  1I3Q B;  3KYH C;  3H6M A;  4FF3 A;  1CKM A;  2JP1 A;  1MKH A;  1BCP B;  2JA9 A;  5ELE A;  1RCV D;  4HJ9 A;  3ND8 A;  4K6L A;  3S1Q B;  4JBW A;  1PH3 A;  2N3S A;  3X3M A;  4NMZ A;  3TDQ A;  2HUG A;  2SDF A;  4X3U A;  3HS0 C;  3M4O B;  1RTN A;  1KLU D;  2CH4 A;  2DGY A;  2VB2 X;  4ZUI A;  4BBR H;  2EOT A;  5IE8 A;  4GKK L;  5JJI A;  2KCC A;  4LF4 L;  4KHP Q;  3HGB A;  3FVQ A;  1F9P A;  1SYG A;  1QE6 A;  1Q46 A;  1I4H A;  1K73 C;  5AFW A;  2Q2I A;  5ISR A;  2D9U A;  4HIM A;  4N8F A;  3K5L A;  4DUZ Q;  2ENB A;  2KUM A;  1LTR D;  3FKI G;  3FPU B;  5TSS A;  3NP8 A;  1K3B C;  2Q8T A;  1Q8K A;  2F4V Q;  4A3D B;  2F0J A;  3Q8D A;  4X66 Q;  3URY A;  2B8G A;  3VA5 A;  3W5O A;  3H3V H;  3S1N B;  1JR0 D;  4S3S A;  5KNB A;  4K5V A;  4DV1 L;  4P71 A;  4QUC A;  3M3Y H;  3GTL B;  3SGI A;  5CV9 A;  5JPN C;  1LTG D;  2F3V A;  4HTH A;  4HID A;  2R61 A;  3MHB A;  1O80 A;  5C0X H;  4Z9C B;  1CA5 A;  1N33 L;  1ENC A;  3D6W A;  4KY6 A;  3K0Y A;  3OTO L;  1HNZ L;  5M3F H;  3HOW H;  1VQL A;  4A3D G;  1GO3 E;  1JQY D;  2KEN A;  5FJ8 G;  3C1E A;  1D7Q A;  2FMM A;  4WOR A;  4YHH Q;  1ML0 D;  3J7Z C;  4A3M B;  2EPB A;  4B08 A;  4H02 A;  4JI1 L;  1VQ7 A;  3ITP A;  4KKU A;  3I3C A;  2ZM6 Q;  5DLQ E;  4JBM A;  1BXT A;  1OXS C;  3OW7 A;  2YTX A;  5IYD H;  1K83 H;  4A3F B;  4B3S L;  1TWC H;  1L1O A;  2R7Z H;  4LFC L;  4A3E H;  4GN4 B;  1I4X A;  3JAM c;  4FXD A;  2IY5 B;  3PIP 3;  1HNW L;  3VR5 A;  1C48 A;  3HOV B;  4EQP A;  1IHZ A;  4DV0 Q;  2L9H A;  3L0O A;  3EFX D;  4JI3 Q;  3PV0 A;  4DXG A;  4LF7 Q;  1AFP A;  1EUJ A;  1YVC A;  1H9J A;  2JE6 I;  2KHS A;  2XRS D;  2DNC A;  3STB D;  4DR5 Q;  1EZ6 A;  2F0U A;  3MEH A;  2NWG A;  1LT6 D;  2E8G A;  1X3G A;  1AZQ A;  4UDU C;  1XNQ L;  3MXU A;  1PH8 A;  5E4W C;  5IYC H;  4AQY L;  3UDI A;  1IYJ B;  1SE2 A;  4A3F G;  1Z7T A;  3CMA A;  2QDL A;  3A5U A;  2WKC A;  4KN7 C;  4IPC A;  1WTV A;  2JA5 H;  3RZO B;  4RH6 A;  4NDX A;  2TMP A;  1HUM A;  2K04 A;  3FP9 A;  5JJK A;  1MIU A;  4N8X 1;  1I94 Q;  3NEM A;  4JI0 L;  1VQB A;  2ALY B;  2F0F A;  3MEF A;  3RD4 A;  4DV6 Q;  4EQO A;  1SLJ A;  1YNX A;  2HHH L;  4X3K A;  5EGT A;  1JMC A;  3GTM B;  1WTQ A;  3I4M H;  3TN2 A;  2CWA A;  2AMC B;  4DN4 M;  1ENF A;  5C0X J;  3E6Z X;  4B3T Q;  4HAE A;  1KD1 C;  2FMC A;  1CZG A;  1J6Q A;  4AIM A;  2K03 A;  1HR0 Q;  5K5P A;  4A3J H;  3A7A B;  5IYB H;  5EBD A;  2A5H A;  1STE A;  2UU9 Q;  2RCN A;  4A3B B;  2PZW A;  4DV5 L;  1WD1 A;  4K5X A;  5CBA E;  4GLX A;  4ZLT F;  2XNA C;  1AZP A;  1D2B A;  2JN4 A;  1PRT F;  3HKZ E;  4OON A;  1WTO A;  2F0L A;  2NUC A;  3AQQ A;  3NBH B;  4HCE A;  5C3X A;  2JA8 B;  2UUC Q;  5I6W A;  4K0K Q;  4JI7 L;  5IGD A;  2ID0 A;  5LMN L;  4JI5 Q;  3SEB A;  2WAQ E;  1Z47 A;  2B2W C;  3RR5 A;  3K7U C;  1X3Q A;  3S16 B;  1JWM D;  2G5D A;  2MHV A;  1GUT A;  4HIO A;  4C2M B;  2XSC A;  1HR0 W;  1HFG A;  5JPM C;  3MZ5 A;  1XMO L;  4H44 C;  4XT1 B;  2VUM G;  1ESR A;  4A3B G;  2B2U C;  1NBW A;  3I70 A;  4XQJ A;  2Z1C A;  2KA7 A;  3U4V A;  4C56 C;  4GNX C;  3S1Q H;  3ZYY X;  1EIF A;  3BVM A;  1TT2 A;  4RG1 A;  1U4R A;  1O7I A;  4FP5 D;  2OCE A;  1VMC A;  3LWE A;  4PZ6 A;  3M4O H;  2WB1 B;  1ZKO A;  5IOD A;  1FNW A;  3TQY A;  2E2I B;  2DUD A;  4JBJ A;  2EYH A;  1VQ4 A;  3S17 B;  4KKS A;  1UAP A;  1UWV A;  3DWQ A;  2D2C C;  4K5W A;  3W1B A;  1UE5 A;  3GO5 A;  3PO3 B;  2RDG A;  1Q86 C;  1HNX L;  1AH9 A;  4QIW E;  1K8A C;  1LV9 A;  3DWP A;  1GUN A;  4DV2 Q;  4OO1 G;  3ONA B;  2Y0S E;  5T1G A;  4DR7 L;  4IUU A;  2C35 B;  1XX8 A;  3CRK C;  2IJ0 A;  2I5H A;  4A3D H;  3L9A X;  5FJ8 H;  3EA6 A;  1KNE A;  2CWP A;  2OT2 A;  3PUY A;  3M9B A;  3NHH A;  4NXN Q;  1YJ9 A;  2PZT A;  1TS3 A;  4EX5 A;  2JA7 B;  1HXY D;  5EKI A;  4IJH A;  2EDG A;  3GTL H;  4AYB E;  3K57 A;  3PO3 G;  1E2Z A;  5L37 A;  4P75 A;  2DJG C;  3E0J A;  3PIO A;  4HSP A;  2A6E D;  2KCN A;  2EIF A;  4RGN A;  1SR3 A;  2ZJR A;  4IUV A;  3PF5 A;  1QNU A;  3M4Y A;  2M00 A;  1BDO A;  1SN8 A;  3SK4 A;  1T5X D;  2K5H A;  1EY7 A;  1ICF B;  1VQG A;  2ZT9 C;  2TSS A;  2O4X A;  4TSS A;  5C44 B;  1DOL A;  4LF8 Q;  1Y1W B;  2LMC B;  2K5Q A;  2NN6 G;  1MSH A;  2Z4I A;  3G71 A;  1QZH A;  1SFO B;  4X65 Q;  3MXP A;  2Z6K C;  1J8I A;  3I55 A;  4F88 A;  1I6H H;  4RKL A;  4ID6 A;  5C4H A;  3T1H L;  2QA4 A;  4LF5 Q;  2O5I C;  5DEH A;  4A3F H;  1G51 A;  3HOZ G;  1YEZ A;  1HH2 P;  1BBW A;  4Y52 H;  2BH8 A;  2GA4 B;  1WTW A;  4R4T A;  2F0Q A;  4J8Q A;  2RQX A;  3LNN A;  5CR3 A;  1NCV A;  3A0J A;  1AW7 A;  4DR6 Q;  2F0M A;  4GNX B;  3GTJ B;  2F52 A;  3H0G B;  3VR2 A;  2A6E C;  1FJG L;  1EWI A;  2WV6 D;  2UXD L;  1F77 A;  4MTN A;  4DAV A;  3OMC A;  1ASY A;  3RUZ A;  4GLV B;  2AKW B;  5C4Z A;  4OEL B;  2JEB I;  2RHS B;  5ELF A;  1I4Q A;  1XXG A;  1TWF B;  4DV1 Q;  2GVA A;  3CAM A;  1JJC B;  1CHP D;  4LMQ D;  1JB3 A;  4DK6 C;  1DON A;  1EIY B;  3K0X A;  2EJG C;  2Z0S A;  5C4X B;  4C1N I;  5KRU A;  2Q8I B;  2YV5 A;  3R93 A;  2JA6 B;  4YWL A;  3EQL C;  3H0G G;  4RWS C;  3RN2 A;  3CF5 A;  4R4I A;  3P1H A;  3CCS A;  4LFB L;  2JYO A;  2E76 C;  3OTO Q;  3GTM H;  1M90 C;  5EPL A;  1MGS A;  2I0Q A;  2YU9 H;  4BBR B;  1AN8 A;  1Q90 A;  3KOJ A;  3D4R A;  1SYC A;  4KN4 C;  3TRE A;  4B3M Q;  1Q8I A;  3AFQ A;  4JI1 Q;  2R92 G;  1EY0 A;  1Y69 U;  4K8I A;  2NVQ B;  1PZK D;  1UUP A;  1V1P B;  3NBH A;  2VUM H;  1MSG A;  4A3B H;  4BWG B;  2DNE A;  4QB4 A;  3DXJ C;  1NE3 A;  3J81 L;  4YY3 L;  4BS9 A;  1KDC A;  5C4X G;  2B2Y C;  1JC7 A;  5G3L D;  1WCM G;  3FPP A;  1FL0 A;  2NTT A;  3C3L A;  1SJE D;  1XWE A;  2QEJ C;  4PZ8 A;  3A8K E;  4J6H A;  4HJ7 A;  5DAU A;  5AJ3 Q;  3GTK H;  1IL8 A;  2IX0 A;  2PNR C;  5FO8 B;  4DV4 Q;  2CFM A;  1WI5 A;  5IT9 E;  2ZTE A;  1I50 B;  1ESF A;  1U0L A;  5GAG C;  3VYS A;  4POG A;  1C0A A;  1RIP A;  4N9P A;  3U9O A;  1JIC A;  5I9O A;  3P20 A;  3K58 A;  2KHI A;  5ELC A;  4OO1 H;  1XNQ Q;  4CDF C;  4WRD A;  1Q81 C;  5KYL A;  4FNF A;  1G8Z D;  3T16 A;  2RVL A;  5IGF A;  1Q7Y C;  1IBM Q;  1A62 A;  1LAB A;  1IBK Q;  3HOW B;  3VDY A;  1SYB A;  3DUZ A;  1DGS A;  5JOB A;  1IKL A;  2IPK D;  1VF5 C;  4QGU A;  3HKZ B;  5FLM G;  2OEO A;  3C1F A;  3PIO 3;  3K5M A;  1EY4 A;  4YCW A;  2E2I H;  4PQX A;  5IOC A;  2Z4H A;  1HHV A;  1PTO F;  4BY7 B;  1I6V C;  3PO3 H;  4LAA A;  1VS0 A;  1SSO A;  1BNZ A;  4MHE A;  3KJP A;  2EYJ A;  2JQO A;  1TWC B;  3V2T A;  3I4O A;  4IPD A;  2R7Z B;  4A3E B;  1ONL A;  4RA8 A;  3JAM i;  2UXC Q;  1MJC A;  3K80 C;  2VQF Q;  4CBV A;  2HIX A;  1S5C D;  4X3T A;  3G4S A;  3VYR A;  2NN6 H;  2J0T D;  1HJP A;  4GN5 A;  4CGY B;  2K6A A;  5JEA G;  4HJA A;  3FDT A;  2FHT A;  4BA1 I;  2JA7 H;  1VQP A;  4BY7 G;  3S1R H;  1K8O A;  4FDB A;  4NB3 A;  4X62 Q;  1SNO A;  2VQE L;  2EXD A;  1XNR L;  1F9R A;  1YI2 A;  3HOZ H;  1TWA B;  1Y8P B;  2HD3 A;  3L3O C;  4FXK C;  1AE3 A;  2NVY H;  5KGU A;  3J80 E;  1H9R A;  2Z6B A;  1ASZ A;  3J7A V;  2JA5 B;  3F2C A;  3BDO A;  3TS2 A;  4V0B A;  1OXT A;  5IWA Q;  2B39 A;  1STH A;  2F0S A;  2B2W A;  2M2L A;  1YNN D;  1PV4 A;  1RJT A;  2BDO A;  3GQB A;  3NTK A;  5FLX E;  1HTP A;  1YBY A;  5C44 H;  1BBX C;  1KIX A;  2EE1 A;  1Y1W H;  5A2Q E;  1W3S A;  4ZKC B;  2ZXO A;  3RN5 A;  3M7N A;  3M7G A;  3JAM E;  3RLO A;  1OXV A;  3I4M B;  4JV5 Q;  1L0X B;  1JB7 A;  1RHP A;  4LWC A;  2B2U A;  2E5L L;  1W6K A;  4CKB A;  1JE4 A;  1H9M A;  4CHT B;  4IQZ A;  3SVM A;  5K36 H;  4POF A;  1G91 A;  1O7Y A;  4ALP A;  1EQT A;  3CCM A;  1SE4 A;  3QO2 A;  1PYS B;  1VF7 A;  3PSI A;  2WB1 E;  5FOB B;  5M5W B;  1GJX A;  3GTJ H;  1Y14 B;  3H0G H;  1EY8 A;  5BN5 A;  3ULJ A;  2Z9H A;  1YJN A;  2OTL A;  4JI4 Q;  1QUQ B;  2FJ2 A;  3HP3 A;  2BOS A;  4IOA A;  1V43 A;  2V1C C;  1YNN C;  1FGU A;  2BH2 A;  4B3R L;  4PG3 A;  1TWF H;  1OXX K;  2JK8 A;  1GUW A;  1I4P A;  1U4M A;  2XGT A;  1JJ2 A;  1KAW A;  3H94 A;  1TR5 A;  2EY2 A;  3PGZ A;  1XPO A;  2AHO B;  4GLA C;  4DU9 A;  2O2L D;  4DR3 L;  3G7L A;  5C4X H;  3FKI B;  2QW7 A;  5IT9 c;  3FEW X;  2CHB D;  3SK8 A;  3S2H B;  2JA6 H;  3I4N B;  3NE5 B;  4DUY Q;  1PVO A;  4X6A H;  1VQJ A;  2FIN B;  5COY A;  5GRO A;  1V1P A;  5IP9 H;  1VDZ A;  3P7J A;  3K6O A;  4U68 A;  4DR2 L;  5I4D A;  1ET9 A;  2ICE C;  2Q2H A;  4O0A A;  1CT1 D;  2R93 B;  1EIH A;  2B3G A;  3OSO A;  2NVQ H;  1X55 A;  4IZ8 A;  5JJL A;  4OHJ A;  1M1K C;  3RLF A;  3TZU A;  1PA6 A;  2NTS A;  3ERS X;  1E7Z A;  3ZJY C;  1C7Y A;  4IUR A;  4PMB A;  1XPU A;  1BOS A;  4C3J G;  5I2X A;  3TRZ A;  2K5D A;  2F4I A;  4IO9 A;  3CC4 A;  4ZKB B;  2F0H A;  1VQK A;  3I4N G;  1N32 L;  1SXT A;  1NTG A;  1TWG B;  2AQ3 B;  5M5X H;  5M5Y H;  5FLM H;  3DLL A;  1GM5 A;  3H91 A;  4PMW A;  2AUK A;  4JI2 L;  1I50 H;  1G2T A;  4O1N A;  5BN3 A;  2VB3 X;  5HUR A;  1EY9 A;  2R93 G;  2JSO A;  1M8A A;  1A2T A;  1DCZ A;  1UNS A;  3GTP B;  1EOT A;  1II3 A;  1GXD C;  2R7F A;  2HDM A;  3NK9 A;  1X32 A;  2F0E A;  3CRL C;  5LMU L;  1VQD A;  3NWT A;  3RMH A;  2QEX A;  1B1Z A;  2MJ8 A;  4ME3 A;  2X69 A;  2VL6 A;  1SMY D;  4ZCK A;  3I72 A;  4APV A;  4DAP A;  1TU2 B;  3Q6S A;  2KCT A;  1ENA A;  5JEA H;  3QWN A;  3J80 c;  1X9N A;  5GQO A;  3I90 A;  1C8C A;  1I6H B;  2VY3 A;  1EFI D;  4BY7 H;  2HQE A;  1ILP A;  3U4Z A;  3ND9 A;  4A93 B;  4K2K A;  5FLX c;  1U4P A;  4DR1 Q;  3MC0 B;  1MBY A;  1NNX A;  3RLN A;  3VYT A;  1B7Y B;  4G4K A;  3KBG A;  3PUZ A;  4H13 C;  1PH2 A;  3AFP A;  3WOE A;  1N36 Q;  2EVB A;  1DXM A;  1O7Z A;  4HMJ A;  4DK1 A;  1PMR A;  1G6Z A;  4XQQ A;  4WFN 3;  4JOI C;  4BBS B;  2MP1 A;  2NZO A;  1TXY A;  1PH1 A;  3ER0 A;  1SMY C;  1JT8 A;  1PH5 A;  1NMG A;  1KQS A;  4FVM A;  1GUO A;  5GAD C;  3X3N A;  4IUP A;  3I7F A;  1EIG A;  2F0D A;  4IUN A;  4R8N A;  4A93 G;  2RBM A;  2LFN A;  1N34 Q;  1TWA H;  2IT1 A;  4OX9 L;  2D5D A;  4JI8 L;  3G48 A;  3RNU A;  1CSQ A;  3E5S A;  3KF8 B;  1SYF A;  4TVA B;  4I65 A;  4QY7 A;  4HR7 B;  4MIU A;  1A3T A;  3DM1 A;  3UDG A;  1FNU A;  1EWC A;  4DV3 L;  4CJ0 B;  3R2T A;  3SR1 A;  1Y8N B;  2QIL A;  1P16 A;  1RF2 D;  4BBS G;  4DR4 L;  2YU9 B;  1CM9 A;  2MGS A;  2E74 C;  2N88 A;  4FF1 A;  2X6L A;  2IHE A;  2HDL A;  2KEC A;  1SJH D;  1I5F A;  1K8G A;  4P72 A;  3KLS A;  4TRD A;  5C5L A;  3G6J B;  1XMQ L;  2VUM B;  2NB0 A;  2PZU A;  5DM6 3;  4YIJ A;  3STB C;  2G9H D;  3H09 A;  2M9V A;  2E2H H;  1D1I A;  1LM0 A;  2F0N A;  2RSN A;  1EQV A;  3NQI A;  2R3Z A;  3EVQ A;  5M5W H;  4CKE A; 
#chains in the Genus database with same CATH homology
 1GOZ A;  3R2I A;  4KY7 A;  5JEA J;  3QJY A;  1R4Q B;  2HCI A;  3GTK B;  1PFN A;  2EXZ A;  4C3I G;  2EYL A;  4QCL A;  1SAP A;  5M9O A;  1DZ1 A;  1SNM A;  4I7Z C;  1Z6H A;  2K5W A;  1PRT D;  5COR A;  3K7A B;  1KDB A;  2MPM A;  4XQN A;  4ZAI A;  1PFB A;  2ZXR A;  5EKL A;  2FFK B;  2K01 A;  1AP0 A;  2H1E A;  4F87 A;  2L55 A;  3K5N A;  2AQ1 B;  3GV6 A;  1OXU A;  5M3M B;  1KLG D;  4K6D A;  2K33 A;  1SYE A;  1PRT C;  1EEF D;  2EJF C;  3S1R B;  3T53 B;  3MVV A;  4J1M A;  4DGZ A;  3GTQ B;  3HOZ B;  1DOK A;  2XWB B;  2EYP A;  2NVY B;  2C9O A;  2EYO A;  1PTO H;  1KAA A;  4N9T A;  1JCK B;  3I4L A;  2L0C A;  1F2Y A;  1HQM C;  4KV6 A;  4ME5 A;  1JOR A;  4KTA A;  5ELB A;  1STG A;  3AMU A;  1L0Y B;  4DNR B;  1TVX A;  4ZUJ A;  1H9S B;  2N55 A;  4IFD I;  3PUW A;  2ICI A;  1VCI A;  3I8Z A;  3WDN A;  3BVG A;  2CQA A;  2B2V C;  2Z8L A;  2JXM B;  3D4D A;  1SBB B;  3SXH A;  5CGK A;  5JVH 3;  4PV1 C;  1QIL A;  4TKO B;  1S5F D;  3D4W A;  4FO2 A;  5C3W A;  3KF8 A;  3Q22 A;  1RTO A;  1TS2 A;  2R92 B;  1S4Z A;  1EWH A;  3MWY W;  4M8A A;  4XYQ A;  1KAB A;  2BCO A;  1BUV T;  2K05 A;  2I07 B;  1S5E D;  2PQE A;  3TME A;  1PXU A;  1H9K A;  1NUC A;  4JK1 C;  1JOK A;  1WCM B;  4KHV A;  1TS5 A;  5I9P A;  3O13 A;  4OIK A;  5A2Q L;  3HZX A;  4E6I A;  3JAM L;  3VR6 A;  1PRT B;  3F2U A;  2X6G A;  5NUC A;  3S14 B;  4KI0 A;  2RSO A;  3VR3 A;  5CV6 A;  4IUT A;  2DN8 A;  3I91 A;  1XTC D;  3TP6 A;  4FF2 A;  1LTI D;  1CQF A;  5E4X A;  1FYC A;  5F2D A;  2MUY A;  5T1I A;  1BQQ T;  1ROD A;  1BCP F;  1EU3 A;  1PZI D;  4RAU C;  3T56 B;  5KIX A;  2SOB A;  1EYA A;  3I73 A;  4PMC A;  1HQR D;  4CJ1 B;  5M5X B;  5M5Y B;  1HTL D;  3IKJ A;  4NW2 A;  4QF4 A;  3OIQ A;  3TSS A;  1SNQ A;  1SE3 A;  3TP7 A;  4RGT A;  5C4J B;  2NZ1 D;  2IWH A;  3KLR A;  2F0W A;  1E0B A;  3IFT A;  3SK6 A;  5JVG 3;  5D65 A;  2K32 A;  5J39 A;  2NYZ D;  3AB9 A;  1LT5 D;  5CYU A;  4NKL A;  3W2D A;  1LO5 D;  3OWE B;  4C3H G;  5EPJ A;  3MFY A;  1QJO A;  1WD0 A;  5IGG A;  2HCC A;  1FGB D;  2PPB C;  1ICW A;  2F1M A;  2LS0 1;  3KLS X;  4GZY C;  3T4A C;  1X3P A;  4DNT B;  1V1O A;  5CV4 A;  5LL6 X;  4IN3 A;  1S5D D;  3KBX A;  1TKW B;  2IX3 A;  4KD4 A;  4L63 B;  1SND A;  2E75 C;  5FK9 C;  2EY1 A;  5JJZ A;  3TP8 A;  1STB A;  1UEA B;  3BS1 A;  4P2C B;  4LK1 C;  2K28 A;  5DNF A;  1OO9 B;  4G7Z C;  1CQV A;  3TP5 A;  1PTO D;  5D3D A;  2EY6 A;  3A7L A;  3CKI B;  1BF4 A;  2WKD A;  1I4R A;  2WII B;  1F2L A;  4DFA A;  1NAP A;  4DXF A;  1GUS A;  4KK7 A;  2F0P A;  5IGB A;  5D14 A;  1YNJ D;  2PYK A;  2L4N A;  1G29 1;  4RGM A;  5EBC A;  1H9S A;  1G2S A;  4M1U B;  3CQZ B;  1EY6 A;  1LAC A;  1IYV A;  4C1N K;  5CV5 A;  2OF1 A;  4XTC S;  1F9Q A;  4HSV A;  1DYQ A;  1EU4 A;  3DWA A;  1CFM A;  1LTA D;  1TS4 A;  2KOL A;  2E2H B;  2A69 D;  3ERO A;  1B3A A;  1PTO C;  1BO0 A;  1FD7 D;  3A8J E;  1CI3 M;  1F2Z A;  3R3O A;  3TBI B;  1CA6 A;  4G7O C;  4ZYS A;  5C0X I;  2A74 C;  3MA2 B;  1D5X C;  2LKV A;  1KTK A;  4RHS A;  3HEJ A;  3A8I E;  1M4V A;  1B9M A;  1YNJ C;  1T5E A;  1B4O A;  3DHQ A;  3MXN A;  1Q12 A;  1GHK A;  1HA5 A;  2RA4 A;  2V4D A;  3D8G A;  3GD7 A;  1S5B D;  2PW7 A;  4DA2 A;  3PUX A;  4C3J B;  1J9O A;  4FXG C;  5D3I B;  3NQT A;  5KND A;  4FF4 A;  2F0G A;  4XIG S;  3NTH A;  1LTB D;  2A69 C;  3EJI A;  5JAV A;  3NSW A;  1TII D;  1B53 A;  2BA1 A;  1C4Q A;  2WP8 J;  3HRZ C;  1U4L A;  3NXW A;  5IGE A;  5CMD A;  3BDL A;  2XVS A;  4G57 A;  2BA0 A;  1B44 D;  4HN7 A;  2F3W A;  4XT3 B;  3WOF A;  4IAL A;  1GUG A;  5E1F A;  5FO9 B;  3A54 A;  3R8B A;  3A55 A;  3K59 A;  1Q1B A;  2J7Z A;  5LL6 S;  3LX0 A;  3SK5 A;  5KNC A;  2B2V A;  4OL7 A;  1A6X A;  4ILW A;  1D1K A;  1NR2 A;  3BYY B;  4RHR A;  1PLF A;  2XWJ B;  5I2Y A;  3T13 A;  1PTO B;  2SEB D;  4X3S A;  1LTS D;  4KJN A;  2WAC A;  1F9S A;  4R9W A;  3FMC A;  4Q5V A;  3A56 A;  1MI2 A;  4XDX A;  1KNA A;  2BE5 D;  2NVT B;  3D31 A;  1TWH B;  1AEX A;  3Q0A A;  2XN9 C;  1Y1V B;  1SNC A;  2RDF A;  3GTO B;  2PMZ B;  1EEI D;  2L11 A;  5BN4 A;  5EKK A;  4K8J A;  2A73 B;  3OIP A;  2D62 A;  3NTI A;  1Y8O B;  1WVL A;  4U67 3;  2DY8 A;  2O5J C;  5J1Z A;  4V19 0;  3QG1 A;  2G9D A;  2B2Y A;  2NVX B;  3U9S A;  1D5M C;  2KED A;  1JWU D;  2IL8 A;  1K8M A;  4FYD A;  2BE5 C;  3S15 B;  3J7A F;  4HCS A;  3NWS A;  1SEB D;  5I6Y A;  2K1B A;  4K2L A;  2KEE A;  2I46 A;  2XIW A;  1Q1E A;  1DD2 A;  1EYD A;  4C3I B;  2WIN B;  2YYZ A;  3HOX B;  1TY0 A;  3J7Y W;  1CK1 A;  3TZD A;  3P75 A;  2AWN A;  1PZJ D;  1O78 A;  1GHJ A;  3T51 B;  2F0O A;  1ET6 A;  1B2T A;  1B9N A;  1RD9 D;  5CC4 A;  2C5C A;  3MAQ A;  1CTM A;  3L7Z C;  2E2J B;  3SHL A;  3HOY B;  4R8I A;  1FNV A;  2LY7 A;  1QNK A;  1HRJ A;  2DY7 A;  3S9W A;  1FR3 A;  3BG3 A;  1EL0 A;  3IAY A;  4UAI A;  2AWO A;  4Q0F A;  2IX1 A;  3N6R A;  4RCN A;  3BYT B;  1PFM A;  2K7V A;  2XRQ D;  2B2T C;  3C46 A;  5CV8 A;  1BR9 A;  3Q23 A;  2R6G A;  1QOH A;  4ODG A;  4IFD G;  5IGC A;  1DOM A;  1IKM A;  2KJX A;  1LT4 D;  4K14 A;  3KK7 A;  1STA A;  4RCO A;  3C2P A;  4A3G B;  1JOQ A;  2EJM A;  5C5M A;  3FRP B;  2L1B A;  3HG9 A;  5IT9 L;  3OMG A;  1E2V A;  3RZD B;  5C3E B;  3MFG A;  3AU7 A;  2L5T A;  1KDA A;  1A15 A;  1NSN S;  4HED A;  2SNS A;  5KYI A;  1B50 A;  1MD2 D;  2A6H D;  1R4P B;  2CVR A;  4QUF A;  2J4X A;  2F0T A;  2EY5 A;  2EYM A;  5CBE E;  1EYC A;  3QOL A;  1SYD A;  3V05 A;  1HUN A;  3QOJ A;  2PCF B;  3D3R A;  2B63 B;  3DMU A;  4A3K B;  1ZXT A;  4Y7N B;  3N52 A;  3K5O A;  1HFN A;  3QB3 A;  3SDZ A;  3H3V C;  2EZV A;  2F0I A;  3SE0 A;  4IUQ A;  3PMF A;  1JWS D;  4KD3 A;  2A6H C;  4F8M A;  2VNU D;  4XYO A;  4OO1 I;  3LWU A;  1A3V A;  2Q8R E;  4PNY A;  4QMG A;  3VYU A;  5HGT A;  4RFB A;  1O7L A;  3GV3 A;  3MTS A;  4RKB A;  1RDP D;  4CKC A;  4BA2 I;  1STN A;  3KUP A;  3J80 L;  3OOC A;  3PUV A;  1W6J A;  2QCP X;  2BDN A;  5FLX L;  1V8Q A;  3QIA A;  5EJW A;  1IYU A;  4BY1 B;  2F03 A;  3DEO A;  3IL8 A;  4ZK9 B;  5J22 A;  5K36 G;  5E3F A;  1E2W A;  4DAY A;  1HPC A;  3NUC A;  2QKI C;  3OWF A;  1XYI A;  3OPO A;  3VA7 A;  5G3L F;  4EGV A;  2A68 D;  2JEA I;  2NN6 I;  5A35 A;  5FO7 B;  1STY A;  1ZYR D;  3NBI A;  4WJW A;  2RDH A;  1CZW A;  2L12 A;  3VR4 A;  4A3I B;  4C3H B;  1EY5 A;  2KQ3 A;  1TQO A;  4MN3 A;  4ZQ3 A;  4L8J A;  5DM7 3;  4H0L C;  4LJZ C;  3D6C A;  4KY5 A;  1QCB D;  3GTG B;  1D6E C;  3PO2 B;  2PW5 A;  1A2U A;  4ZRZ A;  2AQ2 B;  1HCZ A;  2QF7 A;  4KKT A;  3CHB D;  2B8F A;  4IFD H;  2CW0 D;  2A68 C;  2ZXP A;  2KVM A;  4XXE A;  2AUJ D;  5IIF A;  1ZYR C;  5ELD A;  2VXW A;  1BCP D;  4DK0 A;  4EQN A;  3M3Y B;  1PDQ A;  1NR4 A;  1U9R A;  1HA6 A;  3HOU B;  4ABN A;  1QG7 A;  2IW3 A;  5M3F B;  5CV7 A;  3BDC A;  3W3A A;  3ERQ A;  1IW7 D;  4CJ2 C;  2SNM A;  1LLR D;  3OHX C;  3Q24 A;  4TQU S;  2CW0 C;  4F7X A;  1WTR A;  1SNP A;  1K83 B;  3UI2 A;  2WAQ B;  5C6A A;  1SDF A;  1QB5 D;  5C0X G;  3MXG A;  1DM0 B;  1A3U A;  1BCP C;  3GP7 A;  4L6T B;  2PO4 A;  1TY2 A;  1F2M A;  4KHZ A;  3DEP A;  1Q3L A;  1LT3 D;  4OGQ C;  4OIJ A;  1I4G A;  4H7B A;  1R9T B;  2NBF A;  4KMU C;  5KEE A;  3M85 A;  3CU7 A;  1IW7 C;  1WTP A;  3V96 A;  1DJR D;  3S2D B;  4IFD J;  4QIW B;  2F0V A;  4KJO A;  1ZEQ X;  4G7H C;  2Y0S B;  3NPP A;  2H4O A;  5LHY 1;  4B9W A;  2RKS A;  4RGO S;  4B9X A;  1QWY A;  1D5Z C;  5FKA C;  4EVO A;  3S1M B;  2B2T A;  4DF7 A;  4A3J B;  1PYW D;  4AYB B;  2E2D C;  3J81 E;  3BZD B;  1WTX A;  2QDB A;  5EQ0 A;  1RKN A;  1LTT D;  3IFD A;  2EYF A;  4HMI A;  1ILQ A;  1VMP A;  2OXP A;  3BVZ A;  2F0K A;  5EPK A;  1JOO A;  4O42 A;  1EZ8 A;  4NP5 A;  4ULL A;  1CHQ D;  1I3Q B;  3H6M A;  4FF3 A;  2JP1 A;  1BCP B;  5ELE A;  1RCV D;  3ND8 A;  4K6L A;  3S1Q B;  4JBW A;  3X3M A;  4NMZ A;  3TDQ A;  2HUG A;  2SDF A;  4X3U A;  3HS0 C;  3M4O B;  1RTN A;  1KLU D;  4ZUI A;  2VB2 X;  2EOT A;  2KCC A;  3HGB A;  3FVQ A;  1F9P A;  1SYG A;  1QE6 A;  1I4H A;  5AFW A;  5ISR A;  2D9U A;  3K5L A;  2ENB A;  2KUM A;  1LTR D;  3FPU B;  5TSS A;  3NP8 A;  2Q8T A;  4A3D B;  2F0J A;  3URY A;  2B8G A;  3VA5 A;  3S1N B;  1JR0 D;  4S3S A;  5KNB A;  4K5V A;  4QUC A;  3GTL B;  5CV9 A;  5JPN C;  1LTG D;  2F3V A;  4HTH A;  2R61 A;  3MHB A;  1O80 A;  5C0X H;  4Z9C B;  1CA5 A;  1ENC A;  3D6W A;  4KY6 A;  3K0Y A;  1JQY D;  3C1E A;  2FMM A;  4WOR A;  1ML0 D;  4A3M B;  2EPB A;  4B08 A;  3ITP A;  4KKU A;  3I3C A;  1BXT A;  1OXS C;  3OW7 A;  4A3F B;  1I4X A;  4FXD A;  3PIP 3;  3VR5 A;  1C48 A;  3HOV B;  4EQP A;  1IHZ A;  2L9H A;  3EFX D;  3PV0 A;  4DXG A;  1AFP A;  1H9J A;  2JE6 I;  2KHS A;  2XRS D;  2DNC A;  1EZ6 A;  2F0U A;  3MEH A;  2NWG A;  1LT6 D;  1AZQ A;  4UDU C;  3MXU A;  5E4W C;  1SE2 A;  1Z7T A;  2WKC A;  4KN7 C;  1WTV A;  3RZO B;  4RH6 A;  4NDX A;  2TMP A;  1HUM A;  2K04 A;  2F0F A;  3RD4 A;  4EQO A;  4X3K A;  5EGT A;  3GTM B;  1WTQ A;  3TN2 A;  4DN4 M;  1ENF A;  5C0X J;  3E6Z X;  4HAE A;  2FMC A;  1CZG A;  2K03 A;  5K5P A;  3A7A B;  5EBD A;  2A5H A;  1STE A;  4A3B B;  2PZW A;  1WD1 A;  4K5X A;  5CBA E;  4ZLT F;  2XNA C;  1AZP A;  1D2B A;  1PRT F;  1WTO A;  2F0L A;  2NUC A;  4HCE A;  5C3X A;  2JA8 B;  5I6W A;  5IGD A;  2ID0 A;  3SEB A;  1Z47 A;  2B2W C;  1X3Q A;  3S16 B;  1JWM D;  2MHV A;  1GUT A;  4C2M B;  2XSC A;  1HFG A;  5JPM C;  3MZ5 A;  4H44 C;  4XT1 B;  1ESR A;  2B2U C;  3I70 A;  4XQJ A;  2Z1C A;  2KA7 A;  4C56 C;  3ZYY X;  3BVM A;  1TT2 A;  1U4R A;  4FP5 D;  1VMC A;  3LWE A;  2WB1 B;  1ZKO A;  5IOD A;  1FNW A;  2E2I B;  2EYH A;  3S17 B;  4KKS A;  1UAP A;  3DWQ A;  2D2C C;  4K5W A;  3GO5 A;  3PO3 B;  2RDG A;  1LV9 A;  3DWP A;  1GUN A;  4OO1 G;  3ONA B;  5T1G A;  4IUU A;  1XX8 A;  3CRK C;  2IJ0 A;  3L9A X;  3EA6 A;  1KNE A;  2OT2 A;  3PUY A;  3NHH A;  2PZT A;  1TS3 A;  2JA7 B;  1HXY D;  5EKI A;  2EDG A;  3K57 A;  1E2Z A;  3E0J A;  4HSP A;  2A6E D;  2KCN A;  4RGN A;  4IUV A;  1QNU A;  3M4Y A;  2M00 A;  1BDO A;  3SK4 A;  1T5X D;  1EY7 A;  2ZT9 C;  2TSS A;  2O4X A;  4TSS A;  5C44 B;  1DOL A;  1Y1W B;  2LMC B;  2K5Q A;  2NN6 G;  1MSH A;  2Z4I A;  1SFO B;  3MXP A;  1J8I A;  4F88 A;  4RKL A;  4ID6 A;  5C4H A;  2O5I C;  5DEH A;  2GA4 B;  1WTW A;  2F0Q A;  4J8Q A;  2RQX A;  3LNN A;  5CR3 A;  1NCV A;  1AW7 A;  2F0M A;  3GTJ B;  3H0G B;  3VR2 A;  2A6E C;  2WV6 D;  1F77 A;  4DAV A;  3OMC A;  3RUZ A;  5C4Z A;  2JEB I;  5ELF A;  1I4Q A;  1XXG A;  1TWF B;  1CHP D;  4LMQ D;  1JB3 A;  1DON A;  2EJG C;  5C4X B;  4C1N I;  5KRU A;  2Q8I B;  3R93 A;  2JA6 B;  3EQL C;  4RWS C;  3P1H A;  2JYO A;  2E76 C;  5EPL A;  1MGS A;  4BBR B;  1AN8 A;  1Q90 A;  3D4R A;  1SYC A;  4KN4 C;  1Q8I A;  1EY0 A;  1Y69 U;  4K8I A;  2NVQ B;  1PZK D;  1UUP A;  1V1P B;  3NBH A;  1MSG A;  4BWG B;  2DNE A;  4QB4 A;  3DXJ C;  3J81 L;  4BS9 A;  1KDC A;  2B2Y C;  1JC7 A;  5G3L D;  3FPP A;  2NTT A;  3C3L A;  1SJE D;  1XWE A;  2QEJ C;  3A8K E;  4J6H A;  5DAU A;  1IL8 A;  2IX0 A;  2PNR C;  5FO8 B;  5IT9 E;  1I50 B;  1ESF A;  3VYS A;  4N9P A;  3U9O A;  1JIC A;  5I9O A;  3P20 A;  3K58 A;  5ELC A;  4OO1 H;  4WRD A;  5KYL A;  4FNF A;  1G8Z D;  3T16 A;  2RVL A;  5IGF A;  1LAB A;  3HOW B;  1SYB A;  3DUZ A;  5JOB A;  1IKL A;  2IPK D;  1VF5 C;  3HKZ B;  3PIO 3;  2OEO A;  3C1F A;  3K5M A;  1EY4 A;  1HHV A;  4PQX A;  5IOC A;  2Z4H A;  1PTO F;  4BY7 B;  1I6V C;  4LAA A;  1SSO A;  1BNZ A;  4MHE A;  2EYJ A;  1TWC B;  3V2T A;  2R7Z B;  4A3E B;  1ONL A;  4RA8 A;  4CBV A;  1S5C D;  4X3T A;  3VYR A;  2NN6 H;  2J0T D;  4CGY B;  2K6A A;  5JEA G;  3FDT A;  2FHT A;  4BA1 I;  1K8O A;  1SNO A;  1F9R A;  1TWA B;  1Y8P B;  3L3O C;  4FXK C;  5KGU A;  3J80 E;  3J7A V;  1H9R A;  2JA5 B;  3BDO A;  4V0B A;  1OXT A;  2B39 A;  1STH A;  2F0S A;  2B2W A;  2M2L A;  1YNN D;  1RJT A;  2BDO A;  3GQB A;  3NTK A;  5FLX E;  1HTP A;  1BBX C;  2EE1 A;  5A2Q E;  4ZKC B;  2ZXO A;  3M7N A;  3M7G A;  3JAM E;  1OXV A;  3I4M B;  1L0X B;  1RHP A;  2B2U A;  1W6K A;  4CKB A;  1JE4 A;  1H9M A;  4CHT B;  4IQZ A;  3SVM A;  5K36 H;  1G91 A;  1O7Y A;  1EQT A;  1SE4 A;  3QO2 A;  1VF7 A;  5FOB B;  5M5W B;  1GJX A;  1EY8 A;  5BN5 A;  2FJ2 A;  3HP3 A;  2BOS A;  1V43 A;  1YNN C;  1OXX K;  1GUW A;  1I4P A;  1U4M A;  3H94 A;  1TR5 A;  2EY2 A;  4DU9 A;  2O2L D;  3G7L A;  3FKI B;  3FEW X;  2CHB D;  3SK8 A;  3S2H B;  3I4N B;  3NE5 B;  2FIN B;  5COY A;  1V1P A;  1VDZ A;  3P7J A;  3K6O A;  4U68 A;  5I4D A;  1ET9 A;  2ICE C;  1CT1 D;  2R93 B;  1EIH A;  3OSO A;  4IZ8 A;  4OHJ A;  3RLF A;  3TZU A;  2NTS A;  4IUR A;  4PMB A;  1BOS A;  4C3J G;  5I2X A;  2K5D A;  2F4I A;  4ZKB B;  2F0H A;  1SXT A;  1TWG B;  2AQ3 B;  3H91 A;  4PMW A;  2AUK A;  1G2T A;  4O1N A;  5BN3 A;  2VB3 X;  5HUR A;  1EY9 A;  2JSO A;  1M8A A;  1A2T A;  1DCZ A;  1UNS A;  3GTP B;  1EOT A;  1II3 A;  1GXD C;  2HDM A;  3NK9 A;  1X32 A;  2F0E A;  3CRL C;  3NWT A;  3RMH A;  1B1Z A;  2MJ8 A;  2X69 A;  1SMY D;  3I72 A;  4DAP A;  1TU2 B;  3Q6S A;  1ENA A;  5JEA H;  3QWN A;  3I90 A;  1C8C A;  1I6H B;  1EFI D;  2HQE A;  1ILP A;  3ND9 A;  4A93 B;  4K2K A;  1U4P A;  3MC0 B;  1MBY A;  3VYT A;  4G4K A;  3KBG A;  3PUZ A;  4H13 C;  3WOE A;  2EVB A;  1DXM A;  4DK1 A;  1O7Z A;  4HMJ A;  1PMR A;  1G6Z A;  4XQQ A;  4WFN 3;  4BBS B;  2MP1 A;  1SMY C;  4FVM A;  1GUO A;  3X3N A;  4IUP A;  1EIG A;  2F0D A;  4IUN A;  4R8N A;  2RBM A;  2LFN A;  2IT1 A;  2D5D A;  3E5S A;  1SYF A;  4I65 A;  4HR7 B;  4MIU A;  1A3T A;  3DM1 A;  1FNU A;  1EWC A;  4CJ0 B;  3R2T A;  3SR1 A;  1Y8N B;  2QIL A;  1RF2 D;  2YU9 B;  1CM9 A;  2MGS A;  2E74 C;  2N88 A;  4FF1 A;  2X6L A;  2HDL A;  2KEC A;  1SJH D;  3KLS A;  4TRD A;  5C5L A;  3G6J B;  2VUM B;  2NB0 A;  2PZU A;  5DM6 3;  4YIJ A;  2G9H D;  3H09 A;  2M9V A;  1D1I A;  2F0N A;  2RSN A;  1EQV A;  3NQI A;  2R3Z A;  3EVQ A;  4CKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...