3V2TA

Crystal structure of staphylococcal nuclease variant delta+phs i92a/v66a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3v2tA00
3QOJA 1EQVA 4NP5A 5CC4A 1A3TA 3EVQA 3QOLA 4KD4A 2PZUA 4R8NA 2EY2A 5CGKA 2F0DA 2F0UA 1EY4A 3OWFA 3VA5A 3NUCA 2F0OA 4QB4A 2SNMA 3D6CA 3U9OA 4KY7A 2EY1A 2RDFA 4S3SA 5I6WA 5KGUA 5EKKA 3SXHA 5HGTA 4PNYA 3OMGA 4NDXA 1STHA 4MIUA 4K8IA 5CR3A 4G57A 4RKLA 5C3XA 4IZ8A 1EY8A 4PMCA 3T13A 1STYA 1SYGA 4IALA 4EQPA 5I6YA 1SNOA 5IODA 5J1ZA 1KAAA 5KYIA 1KDBA 3D4DA 3EJIA 3QB3A 2F0PA 1II3A 4F7XA 3D4WA 2F3VA 1EY0A 1EY5A 5C6AA 5IGCA 2OXPA 2F0VA 2OEOA 1SYFA 1STBA 2SNSA 3BDCA 2PQEA 4OL7A 2KHSA 4EVOA 5J22A 3S9WA 4ZUJA 3HEJA 5IGFA 2OF1A 1SYBA 5HURA 2PZTA 4KHVA 1JOQA 4K5WA 1NUCA 2EYOA 3MZ5A 4E6IA 4KV6A 4B9WA 1SNPA 1JOKA 2F0HA 1TQOA 2O4XA 3MHBA 3MVVA 3NQTA 1A3UA 1STNA 3MEHA 4IUNA 3NP8A 3TP8A 4EQNA 3ITPA 4KY6A 5IOCA 5I9OA 3TP6A 5E1FA 2PW7A 5KYLA 5KIXA 3SK6A 1STAA 1SNQA 2EYMA 2F0TA 3MXPA 5DAUA 5KEEA 2EYLA 4N9PA 3H6MA 3PMFA 4K5XA 2F0MA 2NUCA 3LX0A 3TP7A 1F2MA 2EY6A 2F0SA 1SYDA 3ERQA 4DFAA 3T16A 5IIFA 4PMBA 3P75A 2RKSA 4QMGA 4HMJA 4DF7A 2PYKA 3NXWA 4I65A 1SYCA 1U9RA 2KQ3A 4KTAA 2EYPA 4N9TA 1STGA 5NUCA 5IGDA 2EYFA 5I9PA 4LAAA 2F0JA 2HQEA 2WACA 1SNDA 5DEHA 4KY5A 1EY6A 4KJNA 3V2TA 1F2ZA 3SR1A 3DMUA 1SNMA 1TR5A 1JORA 5CV4A 2QDBA 5IGBA 1A2TA 1ENAA 1KDCA 2EYHA 2F3WA 1EYCA 4WRDA 3OMCA 1KABA 3HZXA 2LKVA 1EYAA 2RBMA 4B9XA 5KRUA 1F2YA 2F0KA 5J39A 1SYEA 2EY5A 4WORA 2PZWA 5JOBA 2SOBA 4ID6A 3BDLA 2PW5A 4DGZA 5K5PA 3RUZA 5CV6A 5F2DA 3DHQA 5CV5A 2F0FA 3NK9A 4H7BA 2ENBA 3C1EA 4K2KA 3OSOA 4J1MA 5CV8A 4NMZA 5C5LA 3TMEA 2M00A 3NHHA 5C5MA 2F0NA 4EQOA 4F8MA 5M9OA 1A3VA 2EYJA 4HMIA 2F0WA 4J6HA 4K2LA 1A2UA 4HTHA 1KDAA 4KJOA 1TT2A 4YIJA 1SNCA 5ISRA 1IHZA 1EY7A 4ODGA 4ZQ3A 3SHLA 2EXZA 4ZUIA 4DU9A 4ME5A 3SK8A 2F0IA 5EKLA 1EY9A 2F0EA 5CV9A 3SK5A 5IGGA 1AEXA 2F0QA 1EZ8A 4TRDA 4K14A 4K8JA 1EZ6A 5JAVA 1EYDA 3R3OA 4NKLA 3SK4A 3C1FA 5E3FA 1JOOA 5C3WA 4QF4A 1ENCA 4RKBA 2F0GA 1NSNS 1RKNA 4K5VA 4K6DA 2F0LA 4KD3A 5EGTA 3TP5A 3D8GA 5C4HA 5IGEA 3E5SA 5C4ZA 3EROA 3P1HA 5CV7A
chains in the Genus database with same CATH superfamily
1X3PA 5CORA 5ELEA 3W5OA 4DV2Q 2MPMA 1PH5A 4KD4A 3MFYA 4CJ2C 3VDYA 3D4RA 4EQ5A 1HXYD 5K36H 2MHVA 1CT1D 3SXHA 4OO1I 1WI5A 3K0XA 3OMGA 2VXWA 1FGBD 4RKLA 2SDFA 3S2HB 4EQPA 2K28A 5JVG3 1PZJD 1SNOA 1X56A 4C3IG 3TBIB 4X64L 1DOKA 1EY0A 2LXKA 1Q90A 3BDCA 5C4XB 2Z0SA 2UUAQ 3Q23A 1EIHA 4Z9CB 1BXTA 4H13C 2PZTA 5IWAL 4P73A 3N52A 4XQNA 4GKKQ 4DKAC 3CPWA 3MHBA 3BG3A 3TP8A 1QG7A 4GOPC 2V4DA 4AYBE 2Z9HA 3CCEA 3LNNA 1Q1EA 1X55A 4DNRB 4YY3L 1WCMB 3VYTA 2F0TA 4N9PA 3Q8DA 4GKJQ 1LT6D 2XIWA 3MWYW 4HCEA 2A6ED 4LF8L 1BKBA 1STEA 1QCBD 1SXTA 4ZRZA 3OW2A 1Q3LA 5M3FB 1WTXA 1Y1WH 4P71A 3GTGH 4DV4L 3DM1A 4DK0A 3U58A 3PIP3 1HH2P 1JE5A 3U4ZA 3HZXA 4RGTA 1Y69U 3K8AA 3F2CA 3PF4A 2L9HA 1QB5D 2L55A 1TY2A 1Z47A 2PW5A 3RZDB 1WJJA 2CQAA 3U9OA 2RDGA 4A75A 3GTLH 4EQOA 3NHHA 4BY7H 4C3IB 3HKSA 4J6HA 3KJPA 4RHSA 1V1QA 4UDUC 4YIJA 4HJAA 4H02A 1VQBA 1N33Q 3J80L 1H95A 4XTCS 2B2UC 3SHLA 4LF4L 4IFDH 4MTKA 1C48A 1C7YA 1P8LA 5FLXE 1VCIA 1AEXA 4DR7L 4XXEA 4K8JA 1EZ6A 2EIFA 5JAVA 2IW3A 2FJ2A 1CHQD 3BZCA 2R7DA 4X65L 3RLOA 2VUMH 1R4PB 2F0GA 3EFXD 4K5VA 3H94A 4PZ7A 2F4IA 3AQQA 4U68A 1S72A 2L4NA 2K14A 1R9TB 5D14A 1K9MC 2NB0A 5CC4A 5IYCG 2M2LA 2BCOA 1VF5C 2AHOB 1VQ7A 4LF6L 1UEAB 1NMGA 1DONA 4L5RC 3C46A 5KGUA 4IQZA 2R7FA 4BBSG 3F2DA 3HOWG 4DAVA 4X66Q 3CF5A 2B2YA 4RCOA 5M5XB 5JJKA 1HUNA 1KDBA 1I4HA 5JPNC 4JOIA 1QVCA 3NELA 2KA7A 1IL8A 2L5TA 3G7LA 1FJGQ 1K3RA 3ULJA 4HJ8A 3T1YL 2B3GA 2JYOA 4M8AA 1CUKA 1HTPA 1TWAH 1XXGA 3TDQA 1M8AA 1I6VC 5E1FA 5FO8B 1EU3A 4CHTB 2EYMA 1NNXA 4OWXB 3R93A 2K5DA 1SYDA 2I5MX 1E2ZA 3X3MA 4QUFA 4Q5VA 2UU9Q 2PPBC 1EFWA 1GKHA 1D8LA 3I8ZA 5H1SE 4YHHL 1YHQA 1TWFB 1B7YB 2B63G 2EJGC 1VQJA 2NZHA 2CWAA 1VQ4A 1I4RA 2A8VA 1A2TA 1ENAA 4NPSA 4I7ZC 4HJ9A 2F0KA 5IT9c 1LTBD 3W1GA 3RNUA 3JAMc 4BBSB 1PMRA 3HOWB 1WD1A 3UI2A 2ZM6Q 2EYJA 5KNBA 5C0XG 4LFAL 1M90C 4IUQA 1X54A 1JWUD 1PFBA 1OXUA 3KYHC 2E2JB 3EBEA 1EY9A 2YYZA 3H3VI 4FDBA 4ZAIA 4DAYB 1AFPA 3A54A 4JI6L 1RHPA 1LTLA 2CH4A 3M4PA 1S5CD 1WTVA 4JI4Q 2ALYB 2E2DC 3CW2C 4TVAB 1VQ8A 2NN6H 2K5WA 4A3BH 4A3LG 3CCQA 3HOZG 1ML0D 1VQGA 1D1KA 3DM3A 1B2TA 5CGKA 3AFPA 3WOFA 4OX9L 2Y0SG 4A3IG 2OT2A 3HOYG 4B3RL 2RDFA 2B63B 3A55A 2BOSA 1N34L 3M4OH 1SYGA 4IALA 4DA2A 2BA1A 3ULLA 4A3JG 2I07B 4Y52H 4QY7A 4LW1A 3J7AF 1ILPA 1RTNA 3J7ZC 1VQAA 3S9WA 4ZUJA 1B3QA 3R2IA 5ELCA 2XVSA 4C56C 2K04A 3H0GH 1EWCA 1JC7A 2LXJA 3CCUA 3A7LA 3HOVH 3I56A 1AE3A 1WD0A 4ZKBB 4MHEA 3WWVA 1SRUA 2RSOA 2H5XA 4JBJA 1HNWL 5KEEA 2NVYB 4KLKA 3JAMi 3I2ZA 4GNXC 4JYAL 1F2MA 1JR0D 4U673 5IIFA 1YNXA 1CK1A 1ESRA 4AQYL 4H0LC 5I9PA 3HOZB 3DEOA 1SNDA 5DEHA 4HR7B 4LFCQ 1VQ9A 1BDOA 1YNJD 3VYSA 5CBAE 2ATWA 3KK7A 3T1HL 2Y0SB 3K7AH 2HCCA 2LKVA 4A3IB 3T53B 1LTTD 3HOYB 2PZWA 3CCSA 5C4JB 2ENBA 4A3FG 4NMZA 3TMEA 2E2HH 4A3JB 1A3VA 1IW7D 5A35A 1J6QA 5CBEE 1I5FA 1XMOL 1S4ZA 5FOBB 1SNCA 1UUPA 2F4VL 3FRPB 1DOLA 1PRTF 4POGA 5JEAH 4ZUIA 4B3ML 1C0AA 4XDXA 2AQ2B 1UAPA 1ET9A 3TZDA 3SK5A 5EQ0A 3I7FA 2HDMA 1LUZA 4FF3A 2DY8A 5E3FA 3J81L 3A0JA 1I6HB 1F9PA 4B3TQ 1NSNS 2XRQD 1PRTB 3H91A 2VQEL 4HIDA 4FF1A 1IW7C 2K5HA 4DR5L 2WB1G 4DR1L 3AYHB 3EVQA 3MXUA 4A3MG 5LMUL 1O7IA 4XQJA 2ZTDA 1IYVA 1LABA 1BCPF 3PV0A 1QILA 2G9HD 2K33A 4S3SA 4UP8A 3WOEA 4JI0Q 3UE0A 2Q2IA 4PMWA 2ICIA 5D3DA 4PMCA 2JA7G 4FYDA 1K0SA 3OHXC 1BCPB 3FHWA 3MC0B 5J22A 1E3PA 4A3FB 4KN7C 2DNEA 1QJOA 1F9QA 2IHFA 2WKCA 4A3CH 1NY4A 3ITPA 3A5UA 3RZOB 4QCLA 2NVTH 1AE2A 3MXPA 1STAA 3TS2A 1DZ1A 1J9OA 1I4GA 1W3SA 2F3IA 1RTOA 2K05A 4A3GG 3W1BA 1I94Q 1EWHA 4DFAA 3NBHB 5E4WC 3NBHA 2PYKA 1PTOC 1U9RA 4BXXG 3I70A 5CMDA 2AUJD 3F2UA 4IOAA 2WB1B 1CQFA 4JI3Q 1EL0A 4A3MB 1YZ6A 1T5EA 1EYGA 1KDCA 1EYCA 2V1CC 3L9AX 4GOPB 1TXYA 5JJZA 4JV5L 3TREA 4GOPA 1E1TA 1AN8A 1Y1VH 4IPGA 5CV8A 4ZLTF 1Q82C 2JA7B 2QGQA 2F0WA 2ZJPA 2KHJA 2CW0C 4DAMA 5JVH3 4C2MB 3I55A 4R1JA 4ODGA 4ZQ3A 2PNHA 4MNOA 2EXZA 4DU9A 4ME5A 2Y0SE 1CM9A 2EPBA 1GUSA 3SVMA 4LF9Q 2F0QA 4K14A 4DV7Q 1KD1C 1DXMA 3RD4A 3SK4A 2UXDL 3VR2A 1SMYC 4R4OA 1BOSA 1SSOA 5EBCA 3PF5A 4JI8Q 3K80C 2PI2A 4APVA 1MGSA 1O78A 1BBUA 1B9MA 5LL6S 1OXVA 4C3JG 5LL6X 1IZ6A 3KLWA 5BN3A 4A3GB 1XMQL 1BQQT 4B3SQ 4BA2I 2EY2A 2IHEA 4JI1L 2H4OA 1YNND 5LHY1 1Y14B 5G3LD 2B2UA 2UXBQ 3K5NA 4XIGS 4DR6Q 4CKEA 4A4IA 4NDXA 4G57A 1BF4A 3I4NG 3ZYYX 1II3A 3OIQA 3CRKC 2VY3A 5C6AA 3TS0A 2WKDA 1PZID 5C3EG 4OL7A 1SBBB 2PQEA 4P72A 4L5TA 3FKIG 3FEWX 4AIMA 2EE1A 4LUZA 4E6IA 2R92G 2HHHL 1EIFA 1GUTA 4UPAA 4IPHA 3QWNA 5IP9G 2AQ1B 5C4XH 3HOUH 2K7VA 1RODA 4RGOS 3WDNA 1ONLA 3PMFA 2XSCA 2JEAI 2E8GA 3STBD 4Y7NB 1PH6A 3OW7A 3P75A 4DUZQ 1SROA 4I65A 4KTAA 1A63A 3J7AV 3CXCA 3NQIA 4YWLA 4C3JB 1WCMH 1E1OA 5IWAQ 4KN4C 2L11A 2IY5B 5IGBA 4RMFA 1SFOB 3D31A 3NWSA 5M3MB 3ER0A 4DNTB 5IP7G 1G51A 1WOCA 4YCUA 4YY3Q 5M5YB 4J15A 4PQXA 2KCMA 1J5EL 1S5ED 3STBC 3VA7A 2A19A 3I4NB 1B4OA 1RCVD 2WB1E 2CFMA 2A69C 5C3EB 3RZDH 4HEDA 4YWMA 3FKIB 4JI2L 2A5HA 4DV5L 1EIYB 3SGIA 1VMCA 1SAPA 2K6AA 1G6ZA 2QEJC 2R92B 4C3IH 3E0JA 2MJ8A 4KHZA 4BWGB 1PLFA 2A68C 2KCCA 2VW9A 1IBLL 1LO5D 1L0XB 1Q12A 1JWMD 3FPPA 1VQLA 4IFDI 1NR2A 1X6OA 2F0UA 1EY4A 1VDZA 5I2XA 1DGSA 1EQRA 4K0KL 4XYOA 1Y8OB 4LF4Q 1CKNB 2EY1A 4C1NI 1CKNA 4DR2L 1R9TH 3M3YB 4TQUS 4UP7A 1EY8A 5IT9E 2F0PA 5IE8A 1PH9A 3J80c 3G6EA 1RDPD 2OEOA 1STBA 1D1IA 3FMCA 5IGFA 1SYBA 2A1AA 1LLRD 1NUCA 3MZ5A 1KRSA 5M5XH 2HQLA 2O4XA 3VR5A 1ZYRD 5M5WB 5AJ3Q 1WYDA 1QNKA 3K57A 3PIOA 5DAUA 1N8RC 3H6MA 2MFIA 2F0MA 1S3OA 1WTWA 2IL8A 1LV9A 4CDEC 2KECA 2SEBD 1XPRA 5IGCA 1N36L 4LFBL 5JJIA 4N9TA 3HOUB 5IGDA 2J7ZA 3R8BA 1DD2A 3S1RB 5T1IA 1Q7YC 2C9OA 3T1YQ 3UDXA 3CC4A 4LJZC 1MHWC 1S5BD 4ID6A 3BDLA 3CCJA 1TWFH 2BH2A 1JQYD 1LT4D 2B2TC 4L5SA 2FXQA 1IBKQ 1A2UA 4DK1A 1ZEQX 2ZJQA 3GTPB 3PSIA 3MXGA 1YIJA 1LTGD 5EKLA 4BBSH 3HOWH 2MUYA 2UXCL 2HT1A 1PDQA 1TWGB 2N8NA 3JC66 3GO5A 5EGTA 2F0LA 2N55A 3J80i 2E2JH 2B8GA 2PNRC 1EQVA 3BJUA 2K4KA 2UUCL 4HCSA 1WTHA 2A6EC 1GUGA 4O2DA 1CKOA 2QEXA 1XNQQ 2AWNA 1HR0Q 2JSOA 3OTOL 1Z6HA 5HGTA 3KDFB 4JI6Q 4IPCA 3KDFA 1G2SA 2WIIB 2GVBA 3KJOA 1EOTA 1G8ZD 2XWJB 3M4QA 4DV0L 3M7NA 1D6EC 1BVSA 3H3VC 2B63H 3U4VA 4G7OC 4L8JA 5EJWA 1LTSD 4KHVA 1F77A 4DV3L 1K73C 3FVQA 4V190 1HRJA 2E2IB 4IN3A 5LMNL 2L15A 2F0HA 4DV1L 4B3RQ 2G9DA 2JA6G 1PYBA 4JPBW 2UUBQ 1SNQA 1K83B 3T51B 1N34Q 1YJNA 1JJGA 1H9SB 5C0XH 4WJWA 1QZGA 1K8OA 1H9SA 1KLGD 2PMZB 4DV2L 3T16A 3CPFA 3HKZG 3AMUA 1NAPA 5NUCA 5C44G 2WAQE 1LM0A 1UE6A 2EYFA 1KC8C 4KY5A 1Z9FA 2FHTA 2NVYH 2BE5D 1YVCA 1JORA 4GS3A 4G7ZC 4WRDA 1PTOF 3S1MB 5A2QL 2IT1A 2XRSD 1BO0A 4A3LH 1YI2A 1HNWQ 4DV6L 1K8MA 4CJ1B 5GAHC 5EPLA 1HZ9A 1XPOA 4LF7L 3HOZH 3S16B 5EKIA 1MD2D 4OWWB 4JYAQ 2GA4B 2X6GA 2EDGA 1QNUA 3QO2A 4WFN3 1L0WA 4KJOA 1PTOB 2DY7A 4A3IH 4N8X1 3HOYH 3PUVA 4IJLA 1NMFA 2BE5C 3NTIA 5C4JH 2RSNA 3K5MA 3H15A 1YJWA 4A3JH 3NWTA 3C1FA 4RHRA 3BDOA 2YU9B 2A6HD 1NE3A 1IKMA 4IPDA 2RHQB 2DNCA 1W2BA 2JA6B 3TP5A 2EOTA 3BZKA 4O0AA 5FO7B 4QJFA 1I3QB 2D5DA 4IFDJ 1E2VA 3ONAB 4X6AH 3K58A 4MN3A 4R4IA 2K32A 4JI5L 4JW0A 3HKZB 3BVMA 5C44B 1D2BA 4DK3C 4B3MQ 1I6HH 3D6CA 5I6WA 4BBRG 2ZXPA 1XNRQ 3BU2A 2R7ZG 4M1UB 4DAYA 4A3KG 1HNXL 3NBIA 4NXMQ 2N49A 4QQBX 4ZK9B 1G291 1TWCB 1TWHB 2B2WA 4OO1G 2OXPA 1KNEA 2F0VA 2VQEQ 1NCVA 4CBVA 4FXGC 3HEJA 5D3IB 1R4QB 2HIXA 3A7AB 1LTID 1Q81C 3CRLC 4DXGA 1X32A 2IX0A 3HOXG 3CCLA 3S1NB 4BY1G 1ILQA 3SE0A 1GOZA 1JMCA 1TS4A 1PH2A 1SDFA 3KF8B 3TP6A 3L2PA 2DJFC 2PW7A 1KL9A 3KF8A 4A3FH 2K01A 1GUWA 2EYLA 5IYDG 1FYCA 4DAPA 1RL2A 2XGTA 2EY6A 2YTYA 3PO3G 4OEMB 1IXRA 2RKSA 2WP8J 3NXWA 4CDCC 3RZOH 1SR3A 3J81j 4LNQA 4LAAA 1EFID 1YHBA 1FL0A 1HZAA 2QKIC 5GADC 1F2ZA 2IX3A 3I90A 4AH6A 2EYHA 1KABA 5FO9B 1EYAA 1VQHA 1LACA 3E6ZX 2N3SA 4V0BA 4QIWB 2QA4A 4BBRB 3G48A 2PMZE 3RUZA 1C8CA 2R7ZB 3A5ZB 1W6JA 4H7BA 4A3KB 1AZQA 5C5MA 4A3MH 2F0NA 4HMIA 3KBXA 1FJGL 1I4QA 5E4XA 2MGSA 3S2DB 3S14B 1OO9B 2JEBI 3RR5A 3SK8A 1HA6A 3A8JE 3FPUB 3HOXB 2K5VA 5IY0A 1XYIA 2J4XA 2JA7H 1EYDA 4WJ3M 4A93G 1D7QA 1VQFA 1RIPA 3PIPA 5C3WA 4JV5Q 1I50B 1YEZA 2Z1CA 4C2MH 2MP1A 4K6DA 2UU9L 3CQZB 4KKSA 2Q8RE 1CA5A 4J8QA 5IGEA 1CA6A 4DR3Q 3JAML 5FK9C 4A3DG 5FJ8G 1MJCA 4CKBA 1U5KA 2FMCA 4R8NA 3PO3B 5BN4A 3GTOB 1DOMA 1V1OA 3L3OC 2M9VA 2Q8TA 4DK6C 1YNJC 3J81i 2CHBD 4PNYA 1STHA 1A15A 4KI0A 4A3GH 1ENFA 2N88A 1ASZA 1M1KC 5T1GA 1KAAA 3S17B 4IUUA 2O2LD 4ALPA 1UE7A 5BR8Q 3AFQA 4BXXH 1UE1A 4L6TB 3PGZA 3GTMB 4DR4L 4EVOA 3KFUA 3HKZE 1RD9D 1C4QA 1BNZA 1JOQA 4JI1Q 4K5WA 4RWSC 1SNPA 4MTNA 2NBFA 3H0GG 1TQOA 5FKAC 1SN8A 1STNA 3CHBD 3LWEA 1PH7A 2G5DA 1GHJA 3SDZA 5I4DA 2L0CA 2ZTCA 1AW7A 3GQBA 1K8AC 5ELFA 2C35B 4ILWA 4G7HC 4A93B 4UY8C 4C3HG 2KOLA 2Z6BA 2JA8G 3S15B 2XTIA 4ME3A 4A3DB 1U4LA 3V2TA 1IBMQ 4Y7NH 4X3KA 4JG2A 2RBMA 2I46A 1SYEA 4WORA 3L7ZC 3J7YW 3URYA 1DCZA 4C3JH 1TIID 2DGYA 3DHQA 3NK9A 1UEBA 2JJQA 4IO9A 2M00A 3CC2A 2EJFC 3J80E 1BBXC 5JJLA 1SFOH 5HGQA 3ZJYC 2TMPA 5M3MH 1GM5A 4R4TA 4DN4M 5M5YH 3DWPA 1U4MA 2OCEA 4I7AA 1GUNA 3PIO3 1JB7A 1HNZQ 4FF4A 4HIOA 4HAEA 4QIWE 3I4NH 2Q2UA 2R93G 5FLXL 1WTOA 3F2BA 1VQEA 2JA5G 3SEBA 2KCNA 5C3EH 2E76C 3ND8A 3NPPA 1GVPA 1QVGA 1SE4A 1QVFA 3FKIH 2D62A 3CKIB 5ELOA 1BBWA 2X6LA 3TSSA 5FLMG 4GLXA 2ES2A 1N32Q 2B2TA 1E22A 4NP5A 5JEAJ 4C3HB 1XPUA 2R92H 2JA8B 4GN3B 3AEVA 1VMPA 4YCVA 1PZKD 4NXNQ 2SNMA 4GN5A 3U9SA 1S5DD 4DV5Q 3CMAA 2VQFQ 2XNAC 1E24A 2PO4A 2A74C 4LWCA 3EJIA 2AWOA 2RDHA 5IYBG 4OGQC 2JP1A 3T56B 4QGUA 3GTJB 1IBLQ 1DM0B 4X3UA 2OF1A 3M3YH 3HFZB 3IKJA 1HJPA 3GTQB 2DJGC 2R3ZA 4RH6A 2NTTA 2E5LQ 2OWOA 4B9WA 1AZPA 5IP7H 3Q24A 4DR2Q 3PO2G 2JN4A 2OTLA 1VQPA 2NVQB 4HIKA 4K5XA 2R93B 1EQQA 4FP5D 5DM63 3TP7A 3PUWA 2JA5B 1PHJA 1HFGA 4LUOA 2MQHA 1PA6A 4JI7Q 4PZ8A 4DF7A 2RA4A 5M5WH 3B6YA 1FVIA 1X3FA 3DEPA 2K50A 5LMNW 1YNNC 3W3AA 3DMUA 1FNWA 2FFKB 3BVGA 3TRZA 1H9KA 3IRBA 1EOVA 1VS0A 5F2DA 3S1RH 4TSSA 1HZCA 4J1MA 1JJ2A 4X64Q 2QCPX 4ABNA 2NYZD 4K2LA 1KTKA 4BA1I 3D3RA 3NEMA 3QIAA 4LFBQ 4ZCKA 5ISRA 1IHZA 1CKMA 3GV6A 1YHAA 3KF6B 3KF6A 1AH9A 1KXLA 1JOOA 4ZYSA 3GTPH 1CSPA 2BA0A 2QW7A 3PO2B 1I94L 2AQ3B 3T4AC 2C5CA 3IAYA 3VYRA 3P1HA 1YITA 4UAIA 5GQOA 4HJ5A 1A6XA 1L2FA 1CFMA 4X3SA 2WAQG 4CKCA 4LF8Q 1ICWA 4JI3L 4WJ4A 1TWGH 1SJHD 1VF7A 3O13A 3NUCA 1G2TA 4KMUC 4DV4Q 1CZGA 2JA9A 2KHIA 3VR3A 3VYUA 4K8IA 4P2CB 1KQSA 1V8QA 2EQSA 1QE6A 5I6YA 3MA2B 2LFNA 5J1ZA 1EY5A 3D6WA 1D5MC 1LT3D 3I4OA 4OELB 3K0YA 1SYFA 4HIMA 2KHSA 2YV5A 2UUCQ 1IYUA 1JWSD 1PYSB 2D0OA 1HFNA 4JBMA 4FO2A 4PZ6A 1PH4A 1D5ZC 2O5IC 5I9OA 4DR7Q 1MBYA 1KRTA 4JI8L 4OWTB 4X65Q 1F2LA 1UNSA 5I2YA 1BCPD 3CMEA 4A3EG 2E2IH 3GTKB 3ERQA 2NTSA 3K59A 4B3SL 4PMBA 2B2VC 5KYLA 2B39A 1K83H 4GLAC 2WAQB 4KJNA 4RGMA 1ESFA 3SR1A 3QJYA 4DR6L 1HTLD 1L1OC 2QDBA 4LF6Q 3OMCA 4LMQD 5KRUA 2D9UA 5C0XI 1PYWD 3OWEB 3GV3A 1PFNA 2B8FA 2KVMA 5CV6A 2BDNA 2KCTA 4NW2A 5M9OA 1MI2A 5M3FG 4HN7A 3I3CA 2NVXB 3S1MH 5CYUA 2Z6KC 2WV6D 4KHPL 2K5QA 1VQOA 3S16H 1WFQA 1MSHA 5E7NA 4X62L 2F0EA 1WTQA 1B9NA 1ZYRC 3J81E 4JVZA 3BYTB 4R4QA 4JBKA 2JK8A 1QWYA 1ENCA 1PTOH 4KK7A 4DV6Q 4EX5A 4LF7Q 3FP9A 3I4MG 4GNXB 1H9JA 3TQYA 1JICA 5IYCH 4DUZL 4GNXA 1HCZA 1OXSC 4XYQA 2WINB 1EWIA 4A3EB 2PZUA 3CCVA 1L0YB 4YHHQ 2QILA 3OWFA 4DUYL 4R9WA 1RF2D 4KKTA 3S24A 2YU9H 1XJVA 3I72A 4OIKA 2JA6H 1SE2A 4KY7A 2L12A 5EKKA 2B29A 4OHJA 5CR3A 2QDLA 4IJHA 2VNUD 1I3QH 4IZ8A 5ELDA 1STYA 3NTHA 3RMHA 1E0BA 3QB3A 4CDFC 5C44H 3UDGA 1NR4A 2SNSA 1JB3A 2DN8A 3A8IE 2F52A 1J8IA 4LFAQ 4JI5Q 1H9RA 1PFMA 4RA8A 1CHPD 4ULLA 1KAWA 4K6LA 3MVVA 2ZXRA 1I4XA 4FVMA 1TWHH 1TWCH 4EQNA 3MXNB 1MJEA 4KY6A 3MXNA 5K36G 4BS9A 3GP7A 3HG9A 2KUMA 2NN6I 3SK6A 1TY0A 2DUDA 3P7JA 1HNXQ 2ZTEA 3TN2A 2RF4A 3S1NH 1FR3A 1CI3M 2O5JC 3K5OA 2J0TD 3QR8A 1GUOA 4G4KA 2XWBB 3I4MB 2EYPA 1NBWA 4CJ0B 2HQEA 1VQDA 4L63B 3Q0AA 4JC0A 1SNMA 4OX9Q 5HY6A 4UHVA 2FMMA 3ERSX 3MFGA 3NTKA 1ASYA 5D65A 2SOBA 4LF5L 3RN2A 1SE3A 5K5PA 2VZAA 5JPMC 3M9BA 4FXKC 4ZKCB 4POFA 1SLJA 3N6RA 3S1QB 1KDAA 3ULPA 5L37A 1GXDC 1FNVA 4RFBA 2FINB 4RGNA 1O80A 4R4CA 4BBRH 4R8IA 1PH3A 2R7ZH 1T9HA 2VB2X 4A3KH 2F1MA 5AJ3L 4FF2A 1JT8A 1Y1WG 1G91A 1CSQA 1LTRD 2ID0A 3V96A 1VQMA 4OO1H 2CWPA 2JXMB 4RKBA 3S2DH 3S14H 2D2CC 3C3LA 2RCFA 3DXJC 1Y8PB 3EROA 1X65A 3HOXH 2UUAL 2F03A 2WFWA 3KLRA 1B3AA 3CD6A 1LTAD 4BY1H 1CQVA 2EVBA 1SJED 4BY7G 1HHVA 3LGJA 4AQYQ 3DUZA 3VA5A 1MKHA 1K28A 4GKKL 1I50H 1GD7A 2BH8A 5KNDA 1QZHA 3CQZH 4IFDG 1Q1BA 5IYDH 3CCMA 4JK1C 1PVOA 2H1EA 3T1HQ 3W2DA 3PO3H 4F7XA 3GTOH 4GKJL 1IBKL 2TSSA 2VUMG 2VS1A 4QUCA 4HSVA 3M85A 2GN5A 1XMOQ 2RHSB 3L0OA 3TEHB 1S5FD 2F4VQ 3S17H 1JOKA 1W6KA 3OIPA 4IUNA 3NQTA 2AMCB 3MEHA 1O7YA 1AP0A 3GTMH 1FGUA 1KHIA 2ZT9C 3KBGA 3AU7A 1Y1WB 3GTGB 1V43A 2GVAA 2A6HC 2NUCA 4XT3B 2Z8LA 3RLNA 1Y8NB 3K81C 2EXDA 4DR4Q 1ICFB 3EN2A 1N33L 4DR5Q 1XNQL 1U0LA 2WACA 4DR1Q 3UDFA 1HR0L 5LMUQ 1B53A 1HUMA 3GTLB 4A93H 4BY7B 2HDLA 5CV4A 3E9IA 3HRZC 1EEID 1K3BC 1YBYA 4B9XA 3J81c 2CKZB 3S15H 2JQOA 5J39A 5C0XJ 1HPCA 3I73A 3CU7A 3C2PA 3HP3A 4DGZA 4IUVA 1VQ6A 1H9MA 5EPKA 5CV5A 2F0FA 5G3LF 1PV4A 1PFSA 3C1EA 1RJTA 5FJ8H 4A3DH 1K0RA 4F8MA 4OXPA 1SE8A 2K1BA 1V9PA 3H09A 4HTHA 3MTSA 2VUMB 1X3QA 1QUQB 1GO3E 2IJ0A 4TKOB 3OOCA 1QUQA 1EIGA 4F87A 5DM73 5CV9A 3RN5A 1OXXK 2XN9C 4TRDA 2RCNA 2UUBL 2ZJRA 4X66L 1I4PA 3A56A 4QF4A 1O7LA 2Q8IB 5TSSA 3QOJA 2EJMA 4HSPA 5EBDA 3QOLA 1TS3A 3BVZA 3PUZA 4A76A 1XTDA 2JE6I 2K5NA 3IFDA 3RLFA 1QOHA 2PQAB 1Z7TA 2HCIA 2PQAA 1O7ZA 4BY1B 5J3BA 4UP9A 4F88A 4RAUC 4C3HH 1T5XD 2JA8H 3D4DA 5ELNA 5IT9L 1TWAB 1YJ9A 4L5QA 1F9SA 2R6GA 3CC7A 2K75A 2NN6G 1X3EA 4A3BG 1JCKB 4PG3A 4P75A 5HURA 4EGVA 2OQKA 3KLSA 1A62A 2EYOA 1VQIA 2HUGA 4KV6A 2CCZA 5FLXc 1A3UA 1VQCA 1A0IA 3GTJH 3VR4A 5KIXA 2UXDQ 1ZXTA 1U4PA 1FD7D 1HQMC 3D0FA 3PUYA 3GTQH 2HIVA 3LX0A 2ZM6L 4QMGA 4HMJA 3I91A 5DLQE 2LS01 2K03A 1XMQQ 4RCNA 2NVQH 1XTCD 2R93H 2F3WA 1XNRL 4CGYB 2JA5H 5EAYA 3EQLC 4JCVE 3H3VH 4JI4L 3HOVG 4NXML 1PXUA 2IPKD 3IL8A 3U50C 3KUPA 1WTPA 2X69A 5FLMH 1VQ5A 2ZXOA 4K2KA 3NENA 1B70B 2Z4IA 3P20A 4OIJA 1Q8KA 2B2VA 3K7UC 1EY7A 3E3XA 3CCRA 1PH8A 4A3BB 2F0IA 1L1OB 3K6OA 4IUTA 2HHHQ 1L1OA 3EIVA 4JBWA 2B2YC 3UE1A 5IYBH 1XWEA 3KOJA 2K52A 4JOIC 3HS0C 1LT5D 1RKNA 3D8GA 5C4HA 1B1ZA 2PCFB 3G71A 4RG1A 1PTOD 2OQ0A 1D5XC 1EU4A 3M4OB 1A3TA 3GDEA 1LYLA 1B8AA 4XT1B 3LWUA 1TU2B 2F0OA 1B50A 2Z6KA 1N9WA 4IURA 4QB4A 1K8GA 3PO2H 3DWQA 5GAEC 5JEAG 1VQNA 3QG1A 2MO1A 4MIUA 3H0GB 1P16A 3UDIA 5IODA 1KLUD 1TS2A 5KYIA 1B44D 3I4LA 2HD3A 3D4WA 3J7A5 3HOVB 2VB3X 1J5EQ 2CW0D 2NZ1D 1S40A 1HA5A 3EA6A 3DWAA 2Q2TA 1JJCB 3ND9A 4LFCL 3MEFA 1HQRD 5IP9H 4OONA 1TKWB 2N78A 2CVRA 3NP8A 3PCOB 4JI2Q 2CH4W 2MO0A 1SMYD 3A74A 2I0QA 3G6JB 3OYYA 3MAQA 4C1NK 3V05A 3K5LA 1UWVA 2KJXA 4DR3L 2CQOA 3R2TA 2NZOA 1FNUA 2F0SA 1Q86C 3K7AB 3X3NA 2AUKA 4P74A 3Q22A 1IYJB 1OTCA 1TVXA 1CTMA 4FNFA 1JE4A 2I5HA 2KQ3A 3PQIA 2AKWB 2I5LX 1EQTA 2F0JA 1GHKA 4GZYC 1UE5A 4PV1C 1EY6A 2E2HB 4IOCA 1TR5A 4KKUA 2D0PA 5A2QE 4K0KQ 3A8KE 1SMXA 2RVLA 3AB9A 4CDDC 3GTKH 4NB3A 4AYBG 1TS5A 1F2YA 2LMCB 4H44C 2EY5A 1ET6A 4A3CG 5EPJA 2B2WC 4B3TL 2KBNA 5BR8L 1ZKOA 3OSOA 5C5LA 2P5ZX 1NJIC 3OPOA 3CP0A 1G6PA 4YWKA 4B08A 2KENA 1HZBA 2A73B 2E75C 5M3MG 1PH1A 5ELBA 4JI0L 1EZ8A 4DXFA 3TZUA 5AFWA 3R3OA 1MIUA 3F8TA 1F9RA 1WTRA 2BDOA 2NVXH 3BZDB 1X3GA 5C4ZA 2RQXA 3PUXA 2Z4HA 1IKLA 1Y1VG 2Q2HA 1SEBD 4MZ9A 2R61A 4QL5A 4XQQA 1N36Q 3NE5B 1DYQA 2F0DA 1IL2A 3S2HH 1C9OA 1IBML 1NTGA 4KHPQ 2LSSA 1V1PB 2KEEA 4X62Q 1V1PA 1XX8A 3BYYB 3NSWA 5KNCA 2NWGA 4GN4B 5C3XA 3T13A 4A3EH 4FXDA 4AYBB 2YTVA 3FDTA 2YTXA 2F3VA 1BUVT 1BR9A 1E7ZA 1A8VA 1M4VA 2NVTB 2A69D 1Q8IA 4IUPA 2ICEC 4N8FA 4DUYQ 1HNZL 3CAMA 3E9HA 1CZWA 2KEDA 5IOCA 1VQKA 4HJ7A 2UXCQ 4GLVB 2A68D 2L1BA 1KNAA 3IFTA 5M3FH 1OXTA 1PRTD 2EZVA 1N32L 3E0EA 1MSGA 3KLSX 2VL6A 1SYCA 3G4SA 1STGA 4LUVA 2MNAA 3HGBA 1U4RA 4NXNL 1Y1VB 4X3TA 1DJRD 3ICEA 1KIXA 2ASBA 2VQFL 4LF9L 3Q6SA 3OTOQ 4DV7L 4YCWA 2QF7A 5BN5A 3I4MH 5JOBA 5GAGC 4LK1C 3BS1A 5C4XG 3HOUG 1EEFD 1PRTC 4O1NA 4DV0Q 3F1ZA 1TT2A 4Q0FA 2LY7A 3M4YA 1HR0W 2E5LL 5DNFA 3VR6A 2UXBL 4O42A 2IWHA 4DV3Q 1Q46A 5LMNQ 1WCMG 5IGGA 2OTJA 1GJXA 5GROA 3DLLA 2PI2E 3S1QH 4DV1Q 4NKLA 1EUJA 2IX1A 3M7GA 4DPGA 4LF5Q 3JAME 2E74C 5COYA 4JI7L 4DNIA 4KD3A 1E2WA 1X9NA 3GD7A 3E5SA 1BCPC 1WVLA 5CV7A
chains in the Genus database with same CATH topology
1X3PA 5CORA 5ELEA 2MPMA 4KD4A 3MFYA 4CJ2C 3D4RA 1HXYD 5K36H 2MHVA 1CT1D 3SXHA 4OO1I 3OMGA 2VXWA 1FGBD 4RKLA 2SDFA 3S2HB 4EQPA 2K28A 5JVG3 1PZJD 1SNOA 4C3IG 3TBIB 1DOKA 1EY0A 1Q90A 3BDCA 5C4XB 3Q23A 1EIHA 4Z9CB 1BXTA 4H13C 2PZTA 3N52A 4XQNA 3MHBA 3BG3A 3TP8A 1QG7A 2V4DA 3LNNA 1Q1EA 4DNRB 1WCMB 3VYTA 2F0TA 4N9PA 1LT6D 2XIWA 3MWYW 4HCEA 2A6ED 1STEA 1QCBD 1SXTA 4ZRZA 1Q3LA 5M3FB 1WTXA 3DM1A 4DK0A 3PIP3 3HZXA 4RGTA 1Y69U 2L9HA 1QB5D 2L55A 1TY2A 1Z47A 2PW5A 3RZDB 2CQAA 3U9OA 2RDGA 4EQOA 3NHHA 4C3IB 4J6HA 4RHSA 4UDUC 4YIJA 3J80L 4XTCS 2B2UC 3SHLA 4IFDH 1C48A 5FLXE 1VCIA 1AEXA 4XXEA 4K8JA 1EZ6A 5JAVA 2IW3A 2FJ2A 1CHQD 1R4PB 2F0GA 3EFXD 4K5VA 3H94A 2F4IA 4U68A 2L4NA 1R9TB 5D14A 2NB0A 5CC4A 2M2LA 2BCOA 1VF5C 1UEAB 1DONA 3C46A 5KGUA 4IQZA 4DAVA 2B2YA 4RCOA 5M5XB 1HUNA 1KDBA 1I4HA 5JPNC 2KA7A 1IL8A 2L5TA 3G7LA 2JYOA 4M8AA 1HTPA 1XXGA 3TDQA 1M8AA 1I6VC 5E1FA 5FO8B 1EU3A 4CHTB 2EYMA 3R93A 2K5DA 1SYDA 3X3MA 1E2ZA 4QUFA 4Q5VA 2PPBC 3I8ZA 1TWFB 2EJGC 1I4RA 1A2TA 1ENAA 4I7ZC 2F0KA 1LTBD 4BBSB 1PMRA 3HOWB 1WD1A 3UI2A 2EYJA 5KNBA 5C0XG 4IUQA 1JWUD 1PFBA 1OXUA 2E2JB 1EY9A 2YYZA 4ZAIA 1AFPA 3A54A 1RHPA 1S5CD 1WTVA 2E2DC 2NN6H 2K5WA 1ML0D 1D1KA 1B2TA 5CGKA 3WOFA 2OT2A 2RDFA 2B63B 3A55A 2BOSA 1SYGA 4IALA 4DA2A 2BA1A 2I07B 1ILPA 3J7AF 1RTNA 3S9WA 4ZUJA 3R2IA 5ELCA 2XVSA 4C56C 2K04A 1EWCA 1JC7A 3A7LA 1WD0A 4ZKBB 4MHEA 2RSOA 5KEEA 2NVYB 1F2MA 1JR0D 4U673 5IIFA 1CK1A 1ESRA 4H0LC 5I9PA 3HOZB 3DEOA 1SNDA 5DEHA 4HR7B 1BDOA 1YNJD 3VYSA 5CBAE 3KK7A 2Y0SB 2HCCA 2LKVA 4A3IB 3T53B 1LTTD 3HOYB 2PZWA 5C4JB 2ENBA 4NMZA 3TMEA 4A3JB 1A3VA 1IW7D 5A35A 5CBEE 1S4ZA 5FOBB 1SNCA 1UUPA 3FRPB 1DOLA 1PRTF 5JEAH 4ZUIA 4XDXA 2AQ2B 1UAPA 1ET9A 3TZDA 3SK5A 5EQ0A 2HDMA 4FF3A 2DY8A 5E3FA 3J81L 1I6HB 1F9PA 1NSNS 2XRQD 1PRTB 3H91A 4FF1A 1IW7C 3EVQA 3MXUA 4XQJA 1IYVA 1LABA 1BCPF 3PV0A 1QILA 2G9HD 2K33A 4S3SA 3WOEA 4PMWA 2ICIA 5D3DA 4PMCA 4FYDA 3OHXC 1BCPB 3MC0B 5J22A 4A3FB 4KN7C 2DNEA 1QJOA 1F9QA 2WKCA 3ITPA 3RZOB 4QCLA 1STAA 3MXPA 1DZ1A 1J9OA 1I4GA 1RTOA 2K05A 1EWHA 4DFAA 5E4WC 3NBHA 2PYKA 1PTOC 1U9RA 3I70A 5CMDA 2AUJD 3F2UA 2WB1B 1CQFA 1EL0A 4A3MB 1T5EA 1KDCA 1EYCA 3L9AX 5JJZA 1AN8A 5CV8A 4ZLTF 2JA7B 2F0WA 2CW0C 5JVH3 4C2MB 4ODGA 4ZQ3A 2EXZA 4DU9A 4ME5A 1CM9A 2EPBA 1GUSA 3SVMA 2F0QA 4K14A 1DXMA 3RD4A 3SK4A 3VR2A 1SMYC 1BOSA 1SSOA 5EBCA 1MGSA 1O78A 1B9MA 5LL6S 4C3JG 1OXVA 5LL6X 4A3GB 5BN3A 1BQQT 4BA2I 2EY2A 2H4OA 1YNND 5LHY1 5G3LD 2B2UA 3K5NA 4XIGS 4CKEA 4NDXA 4G57A 1BF4A 3ZYYX 1II3A 3OIQA 3CRKC 5C6AA 2WKDA 1PZID 4OL7A 1SBBB 2PQEA 3FEWX 2EE1A 4E6IA 1GUTA 3QWNA 2AQ1B 2K7VA 1RODA 4RGOS 3WDNA 1ONLA 3PMFA 2XSCA 2JEAI 4Y7NB 3OW7A 3P75A 4I65A 4KTAA 3J7AV 3NQIA 4C3JB 4KN4C 2L11A 5IGBA 1SFOB 3D31A 3NWSA 5M3MB 4DNTB 5M5YB 4PQXA 1S5ED 3VA7A 3I4NB 1B4OA 1RCVD 2A69C 5C3EB 4HEDA 3FKIB 2A5HA 1VMCA 1SAPA 2K6AA 1G6ZA 2QEJC 2R92B 3E0JA 2MJ8A 4KHZA 4BWGB 1PLFA 2A68C 2KCCA 1LO5D 1L0XB 1Q12A 1JWMD 3FPPA 4IFDI 1NR2A 2F0UA 1EY4A 1VDZA 5I2XA 4XYOA 1Y8OB 2EY1A 4C1NI 3M3YB 4TQUS 1EY8A 5IT9E 2F0PA 1RDPD 2OEOA 1STBA 1D1IA 3FMCA 5IGFA 1SYBA 1LLRD 1NUCA 3MZ5A 2O4XA 3VR5A 1ZYRD 5M5WB 1QNKA 3K57A 5DAUA 3H6MA 2F0MA 1WTWA 2IL8A 1LV9A 2KECA 2SEBD 5IGCA 4N9TA 3HOUB 5IGDA 2J7ZA 3R8BA 1DD2A 3S1RB 5T1IA 2C9OA 4LJZC 1S5BD 4ID6A 3BDLA 1JQYD 1LT4D 2B2TC 1A2UA 4DK1A 1ZEQX 3GTPB 3MXGA 1LTGD 5EKLA 2MUYA 1PDQA 1TWGB 3GO5A 5EGTA 2F0LA 2N55A 2B8GA 2PNRC 1EQVA 4HCSA 2A6EC 1GUGA 2AWNA 2JSOA 1Z6HA 5HGTA 1G2SA 2WIIB 1EOTA 1G8ZD 2XWJB 3M7NA 1D6EC 3H3VC 4G7OC 4L8JA 5EJWA 1LTSD 4KHVA 1F77A 3FVQA 4V190 1HRJA 2E2IB 4IN3A 2F0HA 2G9DA 1SNQA 1K83B 3T51B 1H9SB 5C0XH 4WJWA 1K8OA 1H9SA 1KLGD 2PMZB 3T16A 3AMUA 1NAPA 5NUCA 2EYFA 4KY5A 2FHTA 2BE5D 1JORA 4G7ZC 4WRDA 1PTOF 3S1MB 5A2QL 2IT1A 2XRSD 1BO0A 1K8MA 4CJ1B 5EPLA 3S16B 5EKIA 1MD2D 2GA4B 2X6GA 2EDGA 1QNUA 3QO2A 4WFN3 4KJOA 1PTOB 2DY7A 3PUVA 2BE5C 3NTIA 2RSNA 3K5MA 3NWTA 3C1FA 4RHRA 3BDOA 2YU9B 2A6HD 1IKMA 2DNCA 2JA6B 3TP5A 2EOTA 5FO7B 1I3QB 2D5DA 4IFDJ 1E2VA 3ONAB 3K58A 4MN3A 2K32A 3HKZB 3BVMA 5C44B 1D2BA 3D6CA 5I6WA 2ZXPA 4M1UB 4DAYA 3NBIA 4ZK9B 1G291 1TWCB 1TWHB 2B2WA 4OO1G 2OXPA 1KNEA 2F0VA 1NCVA 4CBVA 4FXGC 3HEJA 5D3IB 1R4QB 3A7AB 1LTID 3CRLC 4DXGA 1X32A 2IX0A 3S1NB 1ILQA 3SE0A 1GOZA 1TS4A 1SDFA 3TP6A 2PW7A 3KF8A 2K01A 1GUWA 2EYLA 1FYCA 4DAPA 2EY6A 2RKSA 2WP8J 3NXWA 4LAAA 1EFID 2QKIC 1F2ZA 2IX3A 3I90A 2EYHA 1KABA 5FO9B 1EYAA 1LACA 3E6ZX 4V0BA 4QIWB 4BBRB 3RUZA 1C8CA 2R7ZB 4A3KB 1W6JA 4H7BA 1AZQA 5C5MA 2F0NA 4HMIA 3KBXA 1I4QA 5E4XA 2MGSA 3S2DB 3S14B 1OO9B 2JEBI 3SK8A 1HA6A 3A8JE 3FPUB 3HOXB 1XYIA 2J4XA 1EYDA 5C3WA 1I50B 2Z1CA 2MP1A 4K6DA 4KKSA 3CQZB 2Q8RE 1CA5A 5IGEA 4J8QA 1CA6A 3JAML 5FK9C 4CKBA 2FMCA 4R8NA 3PO3B 5BN4A 3GTOB 1DOMA 1V1OA 3L3OC 2M9VA 2Q8TA 1YNJC 2CHBD 4PNYA 1STHA 1A15A 4KI0A 1ENFA 2N88A 5T1GA 1KAAA 3S17B 4IUUA 2O2LD 4L6TB 3GTMB 4EVOA 1RD9D 1C4QA 1BNZA 1JOQA 4K5WA 4RWSC 1SNPA 2NBFA 1TQOA 5FKAC 1STNA 3CHBD 3LWEA 1GHJA 3SDZA 5I4DA 2L0CA 1AW7A 3GQBA 5ELFA 4ILWA 4G7HC 4A93B 4C3HG 2KOLA 3S15B 4A3DB 1U4LA 3V2TA 4X3KA 2RBMA 2I46A 1SYEA 4WORA 3L7ZC 3J7YW 3URYA 1DCZA 1TIID 3DHQA 3NK9A 2M00A 2EJFC 3J80E 1BBXC 2TMPA 4DN4M 3DWPA 1U4MA 1GUNA 3PIO3 4FF4A 4HAEA 5FLXL 1WTOA 3SEBA 2KCNA 2E76C 3ND8A 3NPPA 1SE4A 2D62A 3CKIB 2X6LA 3TSSA 2B2TA 4NP5A 5JEAJ 4C3HB 2JA8B 1VMPA 1PZKD 2SNMA 3U9SA 1S5DD 2XNAC 2PO4A 2A74C 3EJIA 2AWOA 2RDHA 4OGQC 2JP1A 3T56B 3GTJB 1DM0B 4X3UA 2OF1A 3IKJA 3GTQB 2R3ZA 4RH6A 2NTTA 4B9WA 1AZPA 3Q24A 2NVQB 4K5XA 2R93B 4FP5D 5DM63 3TP7A 3PUWA 2JA5B 1HFGA 4DF7A 2RA4A 3DEPA 1YNNC 3W3AA 3DMUA 1FNWA 2FFKB 3BVGA 1H9KA 5F2DA 4TSSA 4J1MA 2QCPX 4ABNA 2NYZD 4K2LA 1KTKA 4BA1I 3D3RA 3QIAA 5ISRA 1IHZA 3GV6A 1JOOA 4ZYSA 2BA0A 3PO2B 2AQ3B 3T4AC 2C5CA 3IAYA 3VYRA 3P1HA 4UAIA 1A6XA 1CFMA 4X3SA 4CKCA 1ICWA 1SJHD 1VF7A 3O13A 3NUCA 1G2TA 4KMUC 1CZGA 3VR3A 3VYUA 4K8IA 4P2CB 1V8QA 1QE6A 5I6YA 3MA2B 2LFNA 5J1ZA 1EY5A 3D6WA 1D5MC 1LT3D 3K0YA 1SYFA 2KHSA 1IYUA 1JWSD 1HFNA 4FO2A 1D5ZC 2O5IC 5I9OA 1MBYA 1F2LA 1UNSA 5I2YA 1BCPD 3GTKB 3ERQA 2NTSA 3K59A 4PMBA 2B2VC 5KYLA 2B39A 2WAQB 4KJNA 4RGMA 1ESFA 3SR1A 3QJYA 1HTLD 2QDBA 3OMCA 4LMQD 5KRUA 2D9UA 5C0XI 1PYWD 3OWEB 3GV3A 1PFNA 2B8FA 2KVMA 5CV6A 2BDNA 4NW2A 5M9OA 1MI2A 4HN7A 3I3CA 2NVXB 5CYUA 2WV6D 2K5QA 1MSHA 2F0EA 1WTQA 1B9NA 1ZYRC 3J81E 3BYTB 1QWYA 1ENCA 1PTOH 4KK7A 1H9JA 1JICA 1HCZA 1OXSC 4XYQA 2WINB 4A3EB 2PZUA 1L0YB 2QILA 3OWFA 4R9WA 1RF2D 4KKTA 3I72A 4OIKA 1SE2A 4KY7A 2L12A 5EKKA 4OHJA 5CR3A 2VNUD 4IZ8A 5ELDA 1STYA 3NTHA 3RMHA 1E0BA 3QB3A 1NR4A 2SNSA 1JB3A 2DN8A 3A8IE 1J8IA 1H9RA 1PFMA 4RA8A 1CHPD 4ULLA 4K6LA 3MVVA 2ZXRA 1I4XA 4FVMA 4EQNA 4KY6A 3MXNA 5K36G 4BS9A 3GP7A 3SK6A 2KUMA 2NN6I 3HG9A 1TY0A 3P7JA 3TN2A 1FR3A 1CI3M 2O5JC 3K5OA 2J0TD 1GUOA 4G4KA 2XWBB 3I4MB 2EYPA 4CJ0B 2HQEA 4L63B 3Q0AA 1SNMA 2FMMA 3MFGA 3NTKA 5D65A 2SOBA 1SE3A 5K5PA 5JPMC 4FXKC 4ZKCB 3N6RA 3S1QB 1KDAA 1GXDC 1FNVA 4RFBA 2FINB 4RGNA 1O80A 4R8IA 2VB2X 2F1MA 4FF2A 1G91A 1LTRD 2ID0A 3V96A 4OO1H 2JXMB 4RKBA 2D2CC 3C3LA 3DXJC 1Y8PB 3EROA 2F03A 3KLRA 1B3AA 1LTAD 1CQVA 2EVBA 1SJED 1HHVA 3DUZA 3VA5A 5KNDA 4IFDG 1Q1BA 4JK1C 2H1EA 3W2DA 4F7XA 2TSSA 4QUCA 4HSVA 3M85A 1S5FD 1JOKA 1W6KA 3OIPA 4IUNA 3NQTA 3MEHA 1O7YA 1AP0A 2ZT9C 3KBGA 3AU7A 1Y1WB 3GTGB 1V43A 2A6HC 2NUCA 4XT3B 2Z8LA 1Y8NB 2WACA 1B53A 1HUMA 3GTLB 4BY7B 2HDLA 5CV4A 3HRZC 1EEID 4B9XA 5J39A 5C0XJ 1HPCA 3I73A 3CU7A 3C2PA 3HP3A 4DGZA 4IUVA 1H9MA 5EPKA 5CV5A 2F0FA 5G3LF 3C1EA 1RJTA 4F8MA 2K1BA 3H09A 4HTHA 3MTSA 2VUMB 1X3QA 2IJ0A 4TKOB 3OOCA 1EIGA 4F87A 5DM73 5CV9A 1OXXK 2XN9C 4TRDA 1I4PA 3A56A 4QF4A 1O7LA 2Q8IB 5TSSA 3QOJA 2EJMA 4HSPA 5EBDA 3QOLA 1TS3A 3BVZA 3PUZA 2JE6I 3IFDA 3RLFA 1QOHA 1Z7TA 2HCIA 1O7ZA 4BY1B 4F88A 4RAUC 1T5XD 3D4DA 5IT9L 1TWAB 1F9SA 2R6GA 2NN6G 1JCKB 5HURA 4EGVA 3KLSA 2EYOA 2HUGA 4KV6A 1A3UA 3VR4A 5KIXA 1ZXTA 1U4PA 1FD7D 1HQMC 3PUYA 3LX0A 4QMGA 4HMJA 3I91A 2LS01 2K03A 4RCNA 1XTCD 2F3WA 4CGYB 3EQLC 1PXUA 2IPKD 3IL8A 3KUPA 1WTPA 2X69A 2ZXOA 4K2KA 2Z4IA 3P20A 4OIJA 2B2VA 1EY7A 4A3BB 2F0IA 3K6OA 4IUTA 4JBWA 2B2YC 1XWEA 3HS0C 1LT5D 1RKNA 3D8GA 5C4HA 1B1ZA 2PCFB 1PTOD 1D5XC 1EU4A 3M4OB 1A3TA 4XT1B 3LWUA 1TU2B 2F0OA 1B50A 4QB4A 4IURA 3DWQA 5JEAG 3QG1A 4MIUA 3H0GB 5IODA 1KLUD 1TS2A 5KYIA 1B44D 3I4LA 3D4WA 3HOVB 2VB3X 2CW0D 2NZ1D 1HA5A 3EA6A 3DWAA 3ND9A 1HQRD 1TKWB 2CVRA 3NP8A 1SMYD 3G6JB 3MAQA 4C1NK 3V05A 3K5LA 2KJXA 3R2TA 1FNUA 2F0SA 3K7AB 3X3NA 2AUKA 3Q22A 1TVXA 1CTMA 1JE4A 2KQ3A 4FNFA 1EQTA 2F0JA 1GHKA 4GZYC 4PV1C 1EY6A 2E2HB 1TR5A 4KKUA 5A2QE 3A8KE 2RVLA 3AB9A 1TS5A 1F2YA 2LMCB 4H44C 2EY5A 1ET6A 5EPJA 2B2WC 1ZKOA 3OSOA 5C5LA 3OPOA 4B08A 2A73B 2E75C 5ELBA 1EZ8A 4DXFA 3TZUA 5AFWA 3R3OA 1F9RA 1WTRA 2BDOA 3BZDB 5C4ZA 2RQXA 3PUXA 2Z4HA 1IKLA 1SEBD 2R61A 4XQQA 3NE5B 1DYQA 2F0DA 1V1PB 2KEEA 1V1PA 1XX8A 3BYYB 3NSWA 5KNCA 2NWGA 5C3XA 3T13A 4FXDA 4AYBB 3FDTA 2F3VA 1BUVT 1BR9A 1M4VA 2NVTB 2A69D 1Q8IA 4IUPA 2ICEC 1CZWA 2KEDA 5IOCA 2A68D 2L1BA 1KNAA 3IFTA 1OXTA 1PRTD 2EZVA 1MSGA 3KLSX 1SYCA 1STGA 3HGBA 1U4RA 1Y1VB 4X3TA 1DJRD 3Q6SA 2QF7A 5BN5A 5JOBA 4LK1C 3BS1A 1EEFD 1PRTC 4O1NA 1TT2A 4Q0FA 2LY7A 3M4YA 5DNFA 3VR6A 4O42A 2IWHA 5IGGA 1GJXA 4NKLA 2IX1A 3M7GA 3JAME 2E74C 5COYA 4KD3A 1E2WA 3GD7A 3E5SA 1BCPC 1WVLA 5CV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QOJ A;  1EQV A;  4NP5 A;  5CC4 A;  1A3T A;  3EVQ A;  3QOL A;  4KD4 A;  2PZU A;  4R8N A;  2EY2 A;  5CGK A;  2F0D A;  2F0U A;  1EY4 A;  3OWF A;  3VA5 A;  3NUC A;  2F0O A;  4QB4 A;  2SNM A;  3D6C A;  3U9O A;  4KY7 A;  2EY1 A;  2RDF A;  4S3S A;  5I6W A;  5KGU A;  5EKK A;  3SXH A;  5HGT A;  4PNY A;  3OMG A;  4NDX A;  1STH A;  4MIU A;  4K8I A;  5CR3 A;  4G57 A;  4RKL A;  5C3X A;  4IZ8 A;  1EY8 A;  4PMC A;  3T13 A;  1STY A;  1SYG A;  4IAL A;  4EQP A;  5I6Y A;  1SNO A;  5IOD A;  5J1Z A;  1KAA A;  5KYI A;  1KDB A;  3D4D A;  3EJI A;  3QB3 A;  2F0P A;  1II3 A;  4F7X A;  3D4W A;  2F3V A;  1EY0 A;  1EY5 A;  5C6A A;  5IGC A;  2OXP A;  2F0V A;  2OEO A;  1SYF A;  1STB A;  2SNS A;  3BDC A;  2PQE A;  4OL7 A;  2KHS A;  4EVO A;  5J22 A;  3S9W A;  4ZUJ A;  3HEJ A;  5IGF A;  2OF1 A;  1SYB A;  5HUR A;  2PZT A;  4KHV A;  1JOQ A;  4K5W A;  1NUC A;  2EYO A;  3MZ5 A;  4E6I A;  4KV6 A;  4B9W A;  1SNP A;  1JOK A;  2F0H A;  1TQO A;  2O4X A;  3MHB A;  3MVV A;  3NQT A;  1A3U A;  1STN A;  3MEH A;  4IUN A;  3NP8 A;  3TP8 A;  4EQN A;  3ITP A;  4KY6 A;  5IOC A;  5I9O A;  3TP6 A;  5E1F A;  2PW7 A;  5KYL A;  5KIX A;  3SK6 A;  1STA A;  1SNQ A;  2EYM A;  2F0T A;  3MXP A;  5DAU A;  5KEE A;  2EYL A;  4N9P A;  3H6M A;  3PMF A;  4K5X A;  2F0M A;  2NUC A;  3LX0 A;  3TP7 A;  1F2M A;  2EY6 A;  2F0S A;  1SYD A;  3ERQ A;  4DFA A;  3T16 A;  5IIF A;  4PMB A;  3P75 A;  2RKS A;  4QMG A;  4HMJ A;  4DF7 A;  2PYK A;  3NXW A;  4I65 A;  1SYC A;  1U9R A;  2KQ3 A;  4KTA A;  2EYP A;  4N9T A;  1STG A;  5NUC A;  5IGD A;  2EYF A;  5I9P A;  4LAA A;  2F0J A;  2HQE A;  2WAC A;  1SND A;  5DEH A;  4KY5 A;  1EY6 A;  4KJN A;  3V2T A;  1F2Z A;  3SR1 A;  3DMU A;  1SNM A;  1TR5 A;  1JOR A;  5CV4 A;  2QDB A;  5IGB A;  1A2T A;  1ENA A;  1KDC A;  2EYH A;  2F3W A;  1EYC A;  4WRD A;  3OMC A;  1KAB A;  3HZX A;  2LKV A;  1EYA A;  2RBM A;  4B9X A;  5KRU A;  1F2Y A;  2F0K A;  5J39 A;  1SYE A;  2EY5 A;  4WOR A;  2PZW A;  5JOB A;  2SOB A;  4ID6 A;  3BDL A;  2PW5 A;  4DGZ A;  5K5P A;  3RUZ A;  5CV6 A;  5F2D A;  3DHQ A;  5CV5 A;  2F0F A;  3NK9 A;  4H7B A;  2ENB A;  3C1E A;  4K2K A;  3OSO A;  4J1M A;  5CV8 A;  4NMZ A;  5C5L A;  3TME A;  2M00 A;  3NHH A;  5C5M A;  2F0N A;  4EQO A;  4F8M A;  5M9O A;  1A3V A;  2EYJ A;  4HMI A;  2F0W A;  4J6H A;  4K2L A;  1A2U A;  4HTH A;  1KDA A;  4KJO A;  1TT2 A;  4YIJ A;  1SNC A;  5ISR A;  1IHZ A;  1EY7 A;  4ODG A;  4ZQ3 A;  3SHL A;  2EXZ A;  4ZUI A;  4DU9 A;  4ME5 A;  3SK8 A;  2F0I A;  5EKL A;  1EY9 A;  2F0E A;  5CV9 A;  3SK5 A;  5IGG A;  1AEX A;  2F0Q A;  1EZ8 A;  4TRD A;  4K14 A;  4K8J A;  1EZ6 A;  5JAV A;  1EYD A;  3R3O A;  4NKL A;  3SK4 A;  3C1F A;  5E3F A;  1JOO A;  5C3W A;  4QF4 A;  1ENC A;  4RKB A;  2F0G A;  1NSN S;  1RKN A;  4K5V A;  4K6D A;  2F0L A;  4KD3 A;  5EGT A;  3TP5 A;  3D8G A;  5C4H A;  5IGE A;  3E5S A;  5C4Z A;  3ERO A;  3P1H A;  5CV7 A; 
#chains in the Genus database with same CATH topology
 1X3P A;  5COR A;  5ELE A;  3W5O A;  4DV2 Q;  2MPM A;  1PH5 A;  4KD4 A;  3MFY A;  4CJ2 C;  3VDY A;  3D4R A;  4EQ5 A;  1HXY D;  5K36 H;  2MHV A;  1CT1 D;  3SXH A;  4OO1 I;  1WI5 A;  3K0X A;  3OMG A;  2VXW A;  1FGB D;  4RKL A;  2SDF A;  3S2H B;  4EQP A;  2K28 A;  5JVG 3;  1PZJ D;  1SNO A;  1X56 A;  4C3I G;  3TBI B;  4X64 L;  1DOK A;  1EY0 A;  2LXK A;  1Q90 A;  3BDC A;  5C4X B;  2Z0S A;  2UUA Q;  3Q23 A;  1EIH A;  4Z9C B;  1BXT A;  4H13 C;  2PZT A;  5IWA L;  4P73 A;  3N52 A;  4XQN A;  4GKK Q;  4DKA C;  3CPW A;  3MHB A;  3BG3 A;  3TP8 A;  1QG7 A;  4GOP C;  2V4D A;  4AYB E;  2Z9H A;  3CCE A;  3LNN A;  1Q1E A;  1X55 A;  4DNR B;  4YY3 L;  1WCM B;  3VYT A;  2F0T A;  4N9P A;  3Q8D A;  4GKJ Q;  1LT6 D;  2XIW A;  3MWY W;  4HCE A;  2A6E D;  4LF8 L;  1BKB A;  1STE A;  1QCB D;  1SXT A;  4ZRZ A;  3OW2 A;  1Q3L A;  5M3F B;  1WTX A;  1Y1W H;  4P71 A;  3GTG H;  4DV4 L;  3DM1 A;  4DK0 A;  3U58 A;  3PIP 3;  1HH2 P;  1JE5 A;  3U4Z A;  3HZX A;  4RGT A;  1Y69 U;  3K8A A;  3F2C A;  3PF4 A;  2L9H A;  1QB5 D;  2L55 A;  1TY2 A;  1Z47 A;  2PW5 A;  3RZD B;  1WJJ A;  2CQA A;  3U9O A;  2RDG A;  4A75 A;  3GTL H;  4EQO A;  3NHH A;  4BY7 H;  4C3I B;  3HKS A;  4J6H A;  3KJP A;  4RHS A;  1V1Q A;  4UDU C;  4YIJ A;  4HJA A;  4H02 A;  1VQB A;  1N33 Q;  3J80 L;  1H95 A;  4XTC S;  2B2U C;  3SHL A;  4LF4 L;  4IFD H;  4MTK A;  1C48 A;  1C7Y A;  1P8L A;  5FLX E;  1VCI A;  1AEX A;  4DR7 L;  4XXE A;  4K8J A;  1EZ6 A;  2EIF A;  5JAV A;  2IW3 A;  2FJ2 A;  1CHQ D;  3BZC A;  2R7D A;  4X65 L;  3RLO A;  2VUM H;  1R4P B;  2F0G A;  3EFX D;  4K5V A;  3H94 A;  4PZ7 A;  2F4I A;  3AQQ A;  4U68 A;  1S72 A;  2L4N A;  2K14 A;  1R9T B;  5D14 A;  1K9M C;  2NB0 A;  5CC4 A;  5IYC G;  2M2L A;  2BCO A;  1VF5 C;  2AHO B;  1VQ7 A;  4LF6 L;  1UEA B;  1NMG A;  1DON A;  4L5R C;  3C46 A;  5KGU A;  4IQZ A;  2R7F A;  4BBS G;  3F2D A;  3HOW G;  4DAV A;  4X66 Q;  3CF5 A;  2B2Y A;  4RCO A;  5M5X B;  5JJK A;  1HUN A;  1KDB A;  1I4H A;  5JPN C;  4JOI A;  1QVC A;  3NEL A;  2KA7 A;  1IL8 A;  2L5T A;  3G7L A;  1FJG Q;  1K3R A;  3ULJ A;  4HJ8 A;  3T1Y L;  2B3G A;  2JYO A;  4M8A A;  1CUK A;  1HTP A;  1TWA H;  1XXG A;  3TDQ A;  1M8A A;  1I6V C;  5E1F A;  5FO8 B;  1EU3 A;  4CHT B;  2EYM A;  1NNX A;  4OWX B;  3R93 A;  2K5D A;  1SYD A;  2I5M X;  1E2Z A;  3X3M A;  4QUF A;  4Q5V A;  2UU9 Q;  2PPB C;  1EFW A;  1GKH A;  1D8L A;  3I8Z A;  5H1S E;  4YHH L;  1YHQ A;  1TWF B;  1B7Y B;  2B63 G;  2EJG C;  1VQJ A;  2NZH A;  2CWA A;  1VQ4 A;  1I4R A;  2A8V A;  1A2T A;  1ENA A;  4NPS A;  4I7Z C;  4HJ9 A;  2F0K A;  5IT9 c;  1LTB D;  3W1G A;  3RNU A;  3JAM c;  4BBS B;  1PMR A;  3HOW B;  1WD1 A;  3UI2 A;  2ZM6 Q;  2EYJ A;  5KNB A;  5C0X G;  4LFA L;  1M90 C;  4IUQ A;  1X54 A;  1JWU D;  1PFB A;  1OXU A;  3KYH C;  2E2J B;  3EBE A;  1EY9 A;  2YYZ A;  3H3V I;  4FDB A;  4ZAI A;  4DAY B;  1AFP A;  3A54 A;  4JI6 L;  1RHP A;  1LTL A;  2CH4 A;  3M4P A;  1S5C D;  1WTV A;  4JI4 Q;  2ALY B;  2E2D C;  3CW2 C;  4TVA B;  1VQ8 A;  2NN6 H;  2K5W A;  4A3B H;  4A3L G;  3CCQ A;  3HOZ G;  1ML0 D;  1VQG A;  1D1K A;  3DM3 A;  1B2T A;  5CGK A;  3AFP A;  3WOF A;  4OX9 L;  2Y0S G;  4A3I G;  2OT2 A;  3HOY G;  4B3R L;  2RDF A;  2B63 B;  3A55 A;  2BOS A;  1N34 L;  3M4O H;  1SYG A;  4IAL A;  4DA2 A;  2BA1 A;  3ULL A;  4A3J G;  2I07 B;  4Y52 H;  4QY7 A;  4LW1 A;  3J7A F;  1ILP A;  1RTN A;  3J7Z C;  1VQA A;  3S9W A;  4ZUJ A;  1B3Q A;  3R2I A;  5ELC A;  2XVS A;  4C56 C;  2K04 A;  3H0G H;  1EWC A;  1JC7 A;  2LXJ A;  3CCU A;  3A7L A;  3HOV H;  3I56 A;  1AE3 A;  1WD0 A;  4ZKB B;  4MHE A;  3WWV A;  1SRU A;  2RSO A;  2H5X A;  4JBJ A;  1HNW L;  5KEE A;  2NVY B;  4KLK A;  3JAM i;  3I2Z A;  4GNX C;  4JYA L;  1F2M A;  1JR0 D;  4U67 3;  5IIF A;  1YNX A;  1CK1 A;  1ESR A;  4AQY L;  4H0L C;  5I9P A;  3HOZ B;  3DEO A;  1SND A;  5DEH A;  4HR7 B;  4LFC Q;  1VQ9 A;  1BDO A;  1YNJ D;  3VYS A;  5CBA E;  2ATW A;  3KK7 A;  3T1H L;  2Y0S B;  3K7A H;  2HCC A;  2LKV A;  4A3I B;  3T53 B;  1LTT D;  3HOY B;  2PZW A;  3CCS A;  5C4J B;  2ENB A;  4A3F G;  4NMZ A;  3TME A;  2E2H H;  4A3J B;  1A3V A;  1IW7 D;  5A35 A;  1J6Q A;  5CBE E;  1I5F A;  1XMO L;  1S4Z A;  5FOB B;  1SNC A;  1UUP A;  2F4V L;  3FRP B;  1DOL A;  1PRT F;  4POG A;  5JEA H;  4ZUI A;  4B3M L;  1C0A A;  4XDX A;  2AQ2 B;  1UAP A;  1ET9 A;  3TZD A;  3SK5 A;  5EQ0 A;  3I7F A;  2HDM A;  1LUZ A;  4FF3 A;  2DY8 A;  5E3F A;  3J81 L;  3A0J A;  1I6H B;  1F9P A;  4B3T Q;  1NSN S;  2XRQ D;  1PRT B;  3H91 A;  2VQE L;  4HID A;  4FF1 A;  1IW7 C;  2K5H A;  4DR5 L;  2WB1 G;  4DR1 L;  3AYH B;  3EVQ A;  3MXU A;  4A3M G;  5LMU L;  1O7I A;  4XQJ A;  2ZTD A;  1IYV A;  1LAB A;  1BCP F;  3PV0 A;  1QIL A;  2G9H D;  2K33 A;  4S3S A;  4UP8 A;  3WOE A;  4JI0 Q;  3UE0 A;  2Q2I A;  4PMW A;  2ICI A;  5D3D A;  4PMC A;  2JA7 G;  4FYD A;  1K0S A;  3OHX C;  1BCP B;  3FHW A;  3MC0 B;  5J22 A;  1E3P A;  4A3F B;  4KN7 C;  2DNE A;  1QJO A;  1F9Q A;  2IHF A;  2WKC A;  4A3C H;  1NY4 A;  3ITP A;  3A5U A;  3RZO B;  4QCL A;  2NVT H;  1AE2 A;  3MXP A;  1STA A;  3TS2 A;  1DZ1 A;  1J9O A;  1I4G A;  1W3S A;  2F3I A;  1RTO A;  2K05 A;  4A3G G;  3W1B A;  1I94 Q;  1EWH A;  4DFA A;  3NBH B;  5E4W C;  3NBH A;  2PYK A;  1PTO C;  1U9R A;  4BXX G;  3I70 A;  5CMD A;  2AUJ D;  3F2U A;  4IOA A;  2WB1 B;  1CQF A;  4JI3 Q;  1EL0 A;  4A3M B;  1YZ6 A;  1T5E A;  1EYG A;  1KDC A;  1EYC A;  2V1C C;  3L9A X;  4GOP B;  1TXY A;  5JJZ A;  4JV5 L;  3TRE A;  4GOP A;  1E1T A;  1AN8 A;  1Y1V H;  4IPG A;  5CV8 A;  4ZLT F;  1Q82 C;  2JA7 B;  2QGQ A;  2F0W A;  2ZJP A;  2KHJ A;  2CW0 C;  4DAM A;  5JVH 3;  4C2M B;  3I55 A;  4R1J A;  4ODG A;  4ZQ3 A;  2PNH A;  4MNO A;  2EXZ A;  4DU9 A;  4ME5 A;  2Y0S E;  1CM9 A;  2EPB A;  1GUS A;  3SVM A;  4LF9 Q;  2F0Q A;  4K14 A;  4DV7 Q;  1KD1 C;  1DXM A;  3RD4 A;  3SK4 A;  2UXD L;  3VR2 A;  1SMY C;  4R4O A;  1BOS A;  1SSO A;  5EBC A;  3PF5 A;  4JI8 Q;  3K80 C;  2PI2 A;  4APV A;  1MGS A;  1O78 A;  1BBU A;  1B9M A;  5LL6 S;  1OXV A;  4C3J G;  5LL6 X;  1IZ6 A;  3KLW A;  5BN3 A;  4A3G B;  1XMQ L;  1BQQ T;  4B3S Q;  4BA2 I;  2EY2 A;  2IHE A;  4JI1 L;  2H4O A;  1YNN D;  5LHY 1;  1Y14 B;  5G3L D;  2B2U A;  2UXB Q;  3K5N A;  4XIG S;  4DR6 Q;  4CKE A;  4A4I A;  4NDX A;  4G57 A;  1BF4 A;  3I4N G;  3ZYY X;  1II3 A;  3OIQ A;  3CRK C;  2VY3 A;  5C6A A;  3TS0 A;  2WKD A;  1PZI D;  5C3E G;  4OL7 A;  1SBB B;  2PQE A;  4P72 A;  4L5T A;  3FKI G;  3FEW X;  4AIM A;  2EE1 A;  4LUZ A;  4E6I A;  2R92 G;  2HHH L;  1EIF A;  1GUT A;  4UPA A;  4IPH A;  3QWN A;  5IP9 G;  2AQ1 B;  5C4X H;  3HOU H;  2K7V A;  1ROD A;  4RGO S;  3WDN A;  1ONL A;  3PMF A;  2XSC A;  2JEA I;  2E8G A;  3STB D;  4Y7N B;  1PH6 A;  3OW7 A;  3P75 A;  4DUZ Q;  1SRO A;  4I65 A;  4KTA A;  1A63 A;  3J7A V;  3CXC A;  3NQI A;  4YWL A;  4C3J B;  1WCM H;  1E1O A;  5IWA Q;  4KN4 C;  2L11 A;  2IY5 B;  5IGB A;  4RMF A;  1SFO B;  3D31 A;  3NWS A;  5M3M B;  3ER0 A;  4DNT B;  5IP7 G;  1G51 A;  1WOC A;  4YCU A;  4YY3 Q;  5M5Y B;  4J15 A;  4PQX A;  2KCM A;  1J5E L;  1S5E D;  3STB C;  3VA7 A;  2A19 A;  3I4N B;  1B4O A;  1RCV D;  2WB1 E;  2CFM A;  2A69 C;  5C3E B;  3RZD H;  4HED A;  4YWM A;  3FKI B;  4JI2 L;  2A5H A;  4DV5 L;  1EIY B;  3SGI A;  1VMC A;  1SAP A;  2K6A A;  1G6Z A;  2QEJ C;  2R92 B;  4C3I H;  3E0J A;  2MJ8 A;  4KHZ A;  4BWG B;  1PLF A;  2A68 C;  2KCC A;  2VW9 A;  1IBL L;  1LO5 D;  1L0X B;  1Q12 A;  1JWM D;  3FPP A;  1VQL A;  4IFD I;  1NR2 A;  1X6O A;  2F0U A;  1EY4 A;  1VDZ A;  5I2X A;  1DGS A;  1EQR A;  4K0K L;  4XYO A;  1Y8O B;  4LF4 Q;  1CKN B;  2EY1 A;  4C1N I;  1CKN A;  4DR2 L;  1R9T H;  3M3Y B;  4TQU S;  4UP7 A;  1EY8 A;  5IT9 E;  2F0P A;  5IE8 A;  1PH9 A;  3J80 c;  3G6E A;  1RDP D;  2OEO A;  1STB A;  1D1I A;  3FMC A;  5IGF A;  1SYB A;  2A1A A;  1LLR D;  1NUC A;  3MZ5 A;  1KRS A;  5M5X H;  2HQL A;  2O4X A;  3VR5 A;  1ZYR D;  5M5W B;  5AJ3 Q;  1WYD A;  1QNK A;  3K57 A;  3PIO A;  5DAU A;  1N8R C;  3H6M A;  2MFI A;  2F0M A;  1S3O A;  1WTW A;  2IL8 A;  1LV9 A;  4CDE C;  2KEC A;  2SEB D;  1XPR A;  5IGC A;  1N36 L;  4LFB L;  5JJI A;  4N9T A;  3HOU B;  5IGD A;  2J7Z A;  3R8B A;  1DD2 A;  3S1R B;  5T1I A;  1Q7Y C;  2C9O A;  3T1Y Q;  3UDX A;  3CC4 A;  4LJZ C;  1MHW C;  1S5B D;  4ID6 A;  3BDL A;  3CCJ A;  1TWF H;  2BH2 A;  1JQY D;  1LT4 D;  2B2T C;  4L5S A;  2FXQ A;  1IBK Q;  1A2U A;  4DK1 A;  1ZEQ X;  2ZJQ A;  3GTP B;  3PSI A;  3MXG A;  1YIJ A;  1LTG D;  5EKL A;  4BBS H;  3HOW H;  2MUY A;  2UXC L;  2HT1 A;  1PDQ A;  1TWG B;  2N8N A;  3JC6 6;  3GO5 A;  5EGT A;  2F0L A;  2N55 A;  3J80 i;  2E2J H;  2B8G A;  2PNR C;  1EQV A;  3BJU A;  2K4K A;  2UUC L;  4HCS A;  1WTH A;  2A6E C;  1GUG A;  4O2D A;  1CKO A;  2QEX A;  1XNQ Q;  2AWN A;  1HR0 Q;  2JSO A;  3OTO L;  1Z6H A;  5HGT A;  3KDF B;  4JI6 Q;  4IPC A;  3KDF A;  1G2S A;  2WII B;  2GVB A;  3KJO A;  1EOT A;  1G8Z D;  2XWJ B;  3M4Q A;  4DV0 L;  3M7N A;  1D6E C;  1BVS A;  3H3V C;  2B63 H;  3U4V A;  4G7O C;  4L8J A;  5EJW A;  1LTS D;  4KHV A;  1F77 A;  4DV3 L;  1K73 C;  3FVQ A;  4V19 0;  1HRJ A;  2E2I B;  4IN3 A;  5LMN L;  2L15 A;  2F0H A;  4DV1 L;  4B3R Q;  2G9D A;  2JA6 G;  1PYB A;  4JPB W;  2UUB Q;  1SNQ A;  1K83 B;  3T51 B;  1N34 Q;  1YJN A;  1JJG A;  1H9S B;  5C0X H;  4WJW A;  1QZG A;  1K8O A;  1H9S A;  1KLG D;  2PMZ B;  4DV2 L;  3T16 A;  3CPF A;  3HKZ G;  3AMU A;  1NAP A;  5NUC A;  5C44 G;  2WAQ E;  1LM0 A;  1UE6 A;  2EYF A;  1KC8 C;  4KY5 A;  1Z9F A;  2FHT A;  2NVY H;  2BE5 D;  1YVC A;  1JOR A;  4GS3 A;  4G7Z C;  4WRD A;  1PTO F;  3S1M B;  5A2Q L;  2IT1 A;  2XRS D;  1BO0 A;  4A3L H;  1YI2 A;  1HNW Q;  4DV6 L;  1K8M A;  4CJ1 B;  5GAH C;  5EPL A;  1HZ9 A;  1XPO A;  4LF7 L;  3HOZ H;  3S16 B;  5EKI A;  1MD2 D;  4OWW B;  4JYA Q;  2GA4 B;  2X6G A;  2EDG A;  1QNU A;  3QO2 A;  4WFN 3;  1L0W A;  4KJO A;  1PTO B;  2DY7 A;  4A3I H;  4N8X 1;  3HOY H;  3PUV A;  4IJL A;  1NMF A;  2BE5 C;  3NTI A;  5C4J H;  2RSN A;  3K5M A;  3H15 A;  1YJW A;  4A3J H;  3NWT A;  3C1F A;  4RHR A;  3BDO A;  2YU9 B;  2A6H D;  1NE3 A;  1IKM A;  4IPD A;  2RHQ B;  2DNC A;  1W2B A;  2JA6 B;  3TP5 A;  2EOT A;  3BZK A;  4O0A A;  5FO7 B;  4QJF A;  1I3Q B;  2D5D A;  4IFD J;  1E2V A;  3ONA B;  4X6A H;  3K58 A;  4MN3 A;  4R4I A;  2K32 A;  4JI5 L;  4JW0 A;  3HKZ B;  3BVM A;  5C44 B;  1D2B A;  4DK3 C;  4B3M Q;  1I6H H;  3D6C A;  5I6W A;  4BBR G;  2ZXP A;  1XNR Q;  3BU2 A;  2R7Z G;  4M1U B;  4DAY A;  4A3K G;  1HNX L;  3NBI A;  4NXM Q;  2N49 A;  4QQB X;  4ZK9 B;  1G29 1;  1TWC B;  1TWH B;  2B2W A;  4OO1 G;  2OXP A;  1KNE A;  2F0V A;  2VQE Q;  1NCV A;  4CBV A;  4FXG C;  3HEJ A;  5D3I B;  1R4Q B;  2HIX A;  3A7A B;  1LTI D;  1Q81 C;  3CRL C;  4DXG A;  1X32 A;  2IX0 A;  3HOX G;  3CCL A;  3S1N B;  4BY1 G;  1ILQ A;  3SE0 A;  1GOZ A;  1JMC A;  1TS4 A;  1PH2 A;  1SDF A;  3KF8 B;  3TP6 A;  3L2P A;  2DJF C;  2PW7 A;  1KL9 A;  3KF8 A;  4A3F H;  2K01 A;  1GUW A;  2EYL A;  5IYD G;  1FYC A;  4DAP A;  1RL2 A;  2XGT A;  2EY6 A;  2YTY A;  3PO3 G;  4OEM B;  1IXR A;  2RKS A;  2WP8 J;  3NXW A;  4CDC C;  3RZO H;  1SR3 A;  3J81 j;  4LNQ A;  4LAA A;  1EFI D;  1YHB A;  1FL0 A;  1HZA A;  2QKI C;  5GAD C;  1F2Z A;  2IX3 A;  3I90 A;  4AH6 A;  2EYH A;  1KAB A;  5FO9 B;  1EYA A;  1VQH A;  1LAC A;  3E6Z X;  2N3S A;  4V0B A;  4QIW B;  2QA4 A;  4BBR B;  3G48 A;  2PMZ E;  3RUZ A;  1C8C A;  2R7Z B;  3A5Z B;  1W6J A;  4H7B A;  4A3K B;  1AZQ A;  5C5M A;  4A3M H;  2F0N A;  4HMI A;  3KBX A;  1FJG L;  1I4Q A;  5E4X A;  2MGS A;  3S2D B;  3S14 B;  1OO9 B;  2JEB I;  3RR5 A;  3SK8 A;  1HA6 A;  3A8J E;  3FPU B;  3HOX B;  2K5V A;  5IY0 A;  1XYI A;  2J4X A;  2JA7 H;  1EYD A;  4WJ3 M;  4A93 G;  1D7Q A;  1VQF A;  1RIP A;  3PIP A;  5C3W A;  4JV5 Q;  1I50 B;  1YEZ A;  2Z1C A;  4C2M H;  2MP1 A;  4K6D A;  2UU9 L;  3CQZ B;  4KKS A;  2Q8R E;  1CA5 A;  4J8Q A;  5IGE A;  1CA6 A;  4DR3 Q;  3JAM L;  5FK9 C;  4A3D G;  5FJ8 G;  1MJC A;  4CKB A;  1U5K A;  2FMC A;  4R8N A;  3PO3 B;  5BN4 A;  3GTO B;  1DOM A;  1V1O A;  3L3O C;  2M9V A;  2Q8T A;  4DK6 C;  1YNJ C;  3J81 i;  2CHB D;  4PNY A;  1STH A;  1A15 A;  4KI0 A;  4A3G H;  1ENF A;  2N88 A;  1ASZ A;  1M1K C;  5T1G A;  1KAA A;  3S17 B;  4IUU A;  2O2L D;  4ALP A;  1UE7 A;  5BR8 Q;  3AFQ A;  4BXX H;  1UE1 A;  4L6T B;  3PGZ A;  3GTM B;  4DR4 L;  4EVO A;  3KFU A;  3HKZ E;  1RD9 D;  1C4Q A;  1BNZ A;  1JOQ A;  4JI1 Q;  4K5W A;  4RWS C;  1SNP A;  4MTN A;  2NBF A;  3H0G G;  1TQO A;  5FKA C;  1SN8 A;  1STN A;  3CHB D;  3LWE A;  1PH7 A;  2G5D A;  1GHJ A;  3SDZ A;  5I4D A;  2L0C A;  2ZTC A;  1AW7 A;  3GQB A;  1K8A C;  5ELF A;  2C35 B;  4ILW A;  4G7H C;  4A93 B;  4UY8 C;  4C3H G;  2KOL A;  2Z6B A;  2JA8 G;  3S15 B;  2XTI A;  4ME3 A;  4A3D B;  1U4L A;  3V2T A;  1IBM Q;  4Y7N H;  4X3K A;  4JG2 A;  2RBM A;  2I46 A;  1SYE A;  4WOR A;  3L7Z C;  3J7Y W;  3URY A;  1DCZ A;  4C3J H;  1TII D;  2DGY A;  3DHQ A;  3NK9 A;  1UEB A;  2JJQ A;  4IO9 A;  2M00 A;  3CC2 A;  2EJF C;  3J80 E;  1BBX C;  5JJL A;  1SFO H;  5HGQ A;  3ZJY C;  2TMP A;  5M3M H;  1GM5 A;  4R4T A;  4DN4 M;  5M5Y H;  3DWP A;  1U4M A;  2OCE A;  4I7A A;  1GUN A;  3PIO 3;  1JB7 A;  1HNZ Q;  4FF4 A;  4HIO A;  4HAE A;  4QIW E;  3I4N H;  2Q2U A;  2R93 G;  5FLX L;  1WTO A;  3F2B A;  1VQE A;  2JA5 G;  3SEB A;  2KCN A;  5C3E H;  2E76 C;  3ND8 A;  3NPP A;  1GVP A;  1QVG A;  1SE4 A;  1QVF A;  3FKI H;  2D62 A;  3CKI B;  5ELO A;  1BBW A;  2X6L A;  3TSS A;  5FLM G;  4GLX A;  2ES2 A;  1N32 Q;  2B2T A;  1E22 A;  4NP5 A;  5JEA J;  4C3H B;  1XPU A;  2R92 H;  2JA8 B;  4GN3 B;  3AEV A;  1VMP A;  4YCV A;  1PZK D;  4NXN Q;  2SNM A;  4GN5 A;  3U9S A;  1S5D D;  4DV5 Q;  3CMA A;  2VQF Q;  2XNA C;  1E24 A;  2PO4 A;  2A74 C;  4LWC A;  3EJI A;  2AWO A;  2RDH A;  5IYB G;  4OGQ C;  2JP1 A;  3T56 B;  4QGU A;  3GTJ B;  1IBL Q;  1DM0 B;  4X3U A;  2OF1 A;  3M3Y H;  3HFZ B;  3IKJ A;  1HJP A;  3GTQ B;  2DJG C;  2R3Z A;  4RH6 A;  2NTT A;  2E5L Q;  2OWO A;  4B9W A;  1AZP A;  5IP7 H;  3Q24 A;  4DR2 Q;  3PO2 G;  2JN4 A;  2OTL A;  1VQP A;  2NVQ B;  4HIK A;  4K5X A;  2R93 B;  1EQQ A;  4FP5 D;  5DM6 3;  3TP7 A;  3PUW A;  2JA5 B;  1PHJ A;  1HFG A;  4LUO A;  2MQH A;  1PA6 A;  4JI7 Q;  4PZ8 A;  4DF7 A;  2RA4 A;  5M5W H;  3B6Y A;  1FVI A;  1X3F A;  3DEP A;  2K50 A;  5LMN W;  1YNN C;  3W3A A;  3DMU A;  1FNW A;  2FFK B;  3BVG A;  3TRZ A;  1H9K A;  3IRB A;  1EOV A;  1VS0 A;  5F2D A;  3S1R H;  4TSS A;  1HZC A;  4J1M A;  1JJ2 A;  4X64 Q;  2QCP X;  4ABN A;  2NYZ D;  4K2L A;  1KTK A;  4BA1 I;  3D3R A;  3NEM A;  3QIA A;  4LFB Q;  4ZCK A;  5ISR A;  1IHZ A;  1CKM A;  3GV6 A;  1YHA A;  3KF6 B;  3KF6 A;  1AH9 A;  1KXL A;  1JOO A;  4ZYS A;  3GTP H;  1CSP A;  2BA0 A;  2QW7 A;  3PO2 B;  1I94 L;  2AQ3 B;  3T4A C;  2C5C A;  3IAY A;  3VYR A;  3P1H A;  1YIT A;  4UAI A;  5GQO A;  4HJ5 A;  1A6X A;  1L2F A;  1CFM A;  4X3S A;  2WAQ G;  4CKC A;  4LF8 Q;  1ICW A;  4JI3 L;  4WJ4 A;  1TWG H;  1SJH D;  1VF7 A;  3O13 A;  3NUC A;  1G2T A;  4KMU C;  4DV4 Q;  1CZG A;  2JA9 A;  2KHI A;  3VR3 A;  3VYU A;  4K8I A;  4P2C B;  1KQS A;  1V8Q A;  2EQS A;  1QE6 A;  5I6Y A;  3MA2 B;  2LFN A;  5J1Z A;  1EY5 A;  3D6W A;  1D5M C;  1LT3 D;  3I4O A;  4OEL B;  3K0Y A;  1SYF A;  4HIM A;  2KHS A;  2YV5 A;  2UUC Q;  1IYU A;  1JWS D;  1PYS B;  2D0O A;  1HFN A;  4JBM A;  4FO2 A;  4PZ6 A;  1PH4 A;  1D5Z C;  2O5I C;  5I9O A;  4DR7 Q;  1MBY A;  1KRT A;  4JI8 L;  4OWT B;  4X65 Q;  1F2L A;  1UNS A;  5I2Y A;  1BCP D;  3CME A;  4A3E G;  2E2I H;  3GTK B;  3ERQ A;  2NTS A;  3K59 A;  4B3S L;  4PMB A;  2B2V C;  5KYL A;  2B39 A;  1K83 H;  4GLA C;  2WAQ B;  4KJN A;  4RGM A;  1ESF A;  3SR1 A;  3QJY A;  4DR6 L;  1HTL D;  1L1O C;  2QDB A;  4LF6 Q;  3OMC A;  4LMQ D;  5KRU A;  2D9U A;  5C0X I;  1PYW D;  3OWE B;  3GV3 A;  1PFN A;  2B8F A;  2KVM A;  5CV6 A;  2BDN A;  2KCT A;  4NW2 A;  5M9O A;  1MI2 A;  5M3F G;  4HN7 A;  3I3C A;  2NVX B;  3S1M H;  5CYU A;  2Z6K C;  2WV6 D;  4KHP L;  2K5Q A;  1VQO A;  3S16 H;  1WFQ A;  1MSH A;  5E7N A;  4X62 L;  2F0E A;  1WTQ A;  1B9N A;  1ZYR C;  3J81 E;  4JVZ A;  3BYT B;  4R4Q A;  4JBK A;  2JK8 A;  1QWY A;  1ENC A;  1PTO H;  4KK7 A;  4DV6 Q;  4EX5 A;  4LF7 Q;  3FP9 A;  3I4M G;  4GNX B;  1H9J A;  3TQY A;  1JIC A;  5IYC H;  4DUZ L;  4GNX A;  1HCZ A;  1OXS C;  4XYQ A;  2WIN B;  1EWI A;  4A3E B;  2PZU A;  3CCV A;  1L0Y B;  4YHH Q;  2QIL A;  3OWF A;  4DUY L;  4R9W A;  1RF2 D;  4KKT A;  3S24 A;  2YU9 H;  1XJV A;  3I72 A;  4OIK A;  2JA6 H;  1SE2 A;  4KY7 A;  2L12 A;  5EKK A;  2B29 A;  4OHJ A;  5CR3 A;  2QDL A;  4IJH A;  2VNU D;  1I3Q H;  4IZ8 A;  5ELD A;  1STY A;  3NTH A;  3RMH A;  1E0B A;  3QB3 A;  4CDF C;  5C44 H;  3UDG A;  1NR4 A;  2SNS A;  1JB3 A;  2DN8 A;  3A8I E;  2F52 A;  1J8I A;  4LFA Q;  4JI5 Q;  1H9R A;  1PFM A;  4RA8 A;  1CHP D;  4ULL A;  1KAW A;  4K6L A;  3MVV A;  2ZXR A;  1I4X A;  4FVM A;  1TWH H;  1TWC H;  4EQN A;  3MXN B;  1MJE A;  4KY6 A;  3MXN A;  5K36 G;  4BS9 A;  3GP7 A;  3HG9 A;  2KUM A;  2NN6 I;  3SK6 A;  1TY0 A;  2DUD A;  3P7J A;  1HNX Q;  2ZTE A;  3TN2 A;  2RF4 A;  3S1N H;  1FR3 A;  1CI3 M;  2O5J C;  3K5O A;  2J0T D;  3QR8 A;  1GUO A;  4G4K A;  2XWB B;  3I4M B;  2EYP A;  1NBW A;  4CJ0 B;  2HQE A;  1VQD A;  4L63 B;  3Q0A A;  4JC0 A;  1SNM A;  4OX9 Q;  5HY6 A;  4UHV A;  2FMM A;  3ERS X;  3MFG A;  3NTK A;  1ASY A;  5D65 A;  2SOB A;  4LF5 L;  3RN2 A;  1SE3 A;  5K5P A;  2VZA A;  5JPM C;  3M9B A;  4FXK C;  4ZKC B;  4POF A;  1SLJ A;  3N6R A;  3S1Q B;  1KDA A;  3ULP A;  5L37 A;  1GXD C;  1FNV A;  4RFB A;  2FIN B;  4RGN A;  1O80 A;  4R4C A;  4BBR H;  4R8I A;  1PH3 A;  2R7Z H;  1T9H A;  2VB2 X;  4A3K H;  2F1M A;  5AJ3 L;  4FF2 A;  1JT8 A;  1Y1W G;  1G91 A;  1CSQ A;  1LTR D;  2ID0 A;  3V96 A;  1VQM A;  4OO1 H;  2CWP A;  2JXM B;  4RKB A;  3S2D H;  3S14 H;  2D2C C;  3C3L A;  2RCF A;  3DXJ C;  1Y8P B;  3ERO A;  1X65 A;  3HOX H;  2UUA L;  2F03 A;  2WFW A;  3KLR A;  1B3A A;  3CD6 A;  1LTA D;  4BY1 H;  1CQV A;  2EVB A;  1SJE D;  4BY7 G;  1HHV A;  3LGJ A;  4AQY Q;  3DUZ A;  3VA5 A;  1MKH A;  1K28 A;  4GKK L;  1I50 H;  1GD7 A;  2BH8 A;  5KND A;  1QZH A;  3CQZ H;  4IFD G;  1Q1B A;  5IYD H;  3CCM A;  4JK1 C;  1PVO A;  2H1E A;  3T1H Q;  3W2D A;  3PO3 H;  4F7X A;  3GTO H;  4GKJ L;  1IBK L;  2TSS A;  2VUM G;  2VS1 A;  4QUC A;  4HSV A;  3M85 A;  2GN5 A;  1XMO Q;  2RHS B;  3L0O A;  3TEH B;  1S5F D;  2F4V Q;  3S17 H;  1JOK A;  1W6K A;  3OIP A;  4IUN A;  3NQT A;  2AMC B;  3MEH A;  1O7Y A;  1AP0 A;  3GTM H;  1FGU A;  1KHI A;  2ZT9 C;  3KBG A;  3AU7 A;  1Y1W B;  3GTG B;  1V43 A;  2GVA A;  2A6H C;  2NUC A;  4XT3 B;  2Z8L A;  3RLN A;  1Y8N B;  3K81 C;  2EXD A;  4DR4 Q;  1ICF B;  3EN2 A;  1N33 L;  4DR5 Q;  1XNQ L;  1U0L A;  2WAC A;  4DR1 Q;  3UDF A;  1HR0 L;  5LMU Q;  1B53 A;  1HUM A;  3GTL B;  4A93 H;  4BY7 B;  2HDL A;  5CV4 A;  3E9I A;  3HRZ C;  1EEI D;  1K3B C;  1YBY A;  4B9X A;  3J81 c;  2CKZ B;  3S15 H;  2JQO A;  5J39 A;  5C0X J;  1HPC A;  3I73 A;  3CU7 A;  3C2P A;  3HP3 A;  4DGZ A;  4IUV A;  1VQ6 A;  1H9M A;  5EPK A;  5CV5 A;  2F0F A;  5G3L F;  1PV4 A;  1PFS A;  3C1E A;  1RJT A;  5FJ8 H;  4A3D H;  1K0R A;  4F8M A;  4OXP A;  1SE8 A;  2K1B A;  1V9P A;  3H09 A;  4HTH A;  3MTS A;  2VUM B;  1X3Q A;  1QUQ B;  1GO3 E;  2IJ0 A;  4TKO B;  3OOC A;  1QUQ A;  1EIG A;  4F87 A;  5DM7 3;  5CV9 A;  3RN5 A;  1OXX K;  2XN9 C;  4TRD A;  2RCN A;  2UUB L;  2ZJR A;  4X66 L;  1I4P A;  3A56 A;  4QF4 A;  1O7L A;  2Q8I B;  5TSS A;  3QOJ A;  2EJM A;  4HSP A;  5EBD A;  3QOL A;  1TS3 A;  3BVZ A;  3PUZ A;  4A76 A;  1XTD A;  2JE6 I;  2K5N A;  3IFD A;  3RLF A;  1QOH A;  2PQA B;  1Z7T A;  2HCI A;  2PQA A;  1O7Z A;  4BY1 B;  5J3B A;  4UP9 A;  4F88 A;  4RAU C;  4C3H H;  1T5X D;  2JA8 H;  3D4D A;  5ELN A;  5IT9 L;  1TWA B;  1YJ9 A;  4L5Q A;  1F9S A;  2R6G A;  3CC7 A;  2K75 A;  2NN6 G;  1X3E A;  4A3B G;  1JCK B;  4PG3 A;  4P75 A;  5HUR A;  4EGV A;  2OQK A;  3KLS A;  1A62 A;  2EYO A;  1VQI A;  2HUG A;  4KV6 A;  2CCZ A;  5FLX c;  1A3U A;  1VQC A;  1A0I A;  3GTJ H;  3VR4 A;  5KIX A;  2UXD Q;  1ZXT A;  1U4P A;  1FD7 D;  1HQM C;  3D0F A;  3PUY A;  3GTQ H;  2HIV A;  3LX0 A;  2ZM6 L;  4QMG A;  4HMJ A;  3I91 A;  5DLQ E;  2LS0 1;  2K03 A;  1XMQ Q;  4RCN A;  2NVQ H;  1XTC D;  2R93 H;  2F3W A;  1XNR L;  4CGY B;  2JA5 H;  5EAY A;  3EQL C;  4JCV E;  3H3V H;  4JI4 L;  3HOV G;  4NXM L;  1PXU A;  2IPK D;  3IL8 A;  3U50 C;  3KUP A;  1WTP A;  2X69 A;  5FLM H;  1VQ5 A;  2ZXO A;  4K2K A;  3NEN A;  1B70 B;  2Z4I A;  3P20 A;  4OIJ A;  1Q8K A;  2B2V A;  3K7U C;  1EY7 A;  3E3X A;  3CCR A;  1PH8 A;  4A3B B;  2F0I A;  1L1O B;  3K6O A;  4IUT A;  2HHH Q;  1L1O A;  3EIV A;  4JBW A;  2B2Y C;  3UE1 A;  5IYB H;  1XWE A;  3KOJ A;  2K52 A;  4JOI C;  3HS0 C;  1LT5 D;  1RKN A;  3D8G A;  5C4H A;  1B1Z A;  2PCF B;  3G71 A;  4RG1 A;  1PTO D;  2OQ0 A;  1D5X C;  1EU4 A;  3M4O B;  1A3T A;  3GDE A;  1LYL A;  1B8A A;  4XT1 B;  3LWU A;  1TU2 B;  2F0O A;  1B50 A;  2Z6K A;  1N9W A;  4IUR A;  4QB4 A;  1K8G A;  3PO2 H;  3DWQ A;  5GAE C;  5JEA G;  1VQN A;  3QG1 A;  2MO1 A;  4MIU A;  3H0G B;  1P16 A;  3UDI A;  5IOD A;  1KLU D;  1TS2 A;  5KYI A;  1B44 D;  3I4L A;  2HD3 A;  3D4W A;  3J7A 5;  3HOV B;  2VB3 X;  1J5E Q;  2CW0 D;  2NZ1 D;  1S40 A;  1HA5 A;  3EA6 A;  3DWA A;  2Q2T A;  1JJC B;  3ND9 A;  4LFC L;  3MEF A;  1HQR D;  5IP9 H;  4OON A;  1TKW B;  2N78 A;  2CVR A;  3NP8 A;  3PCO B;  4JI2 Q;  2CH4 W;  2MO0 A;  1SMY D;  3A74 A;  2I0Q A;  3G6J B;  3OYY A;  3MAQ A;  4C1N K;  3V05 A;  3K5L A;  1UWV A;  2KJX A;  4DR3 L;  2CQO A;  3R2T A;  2NZO A;  1FNU A;  2F0S A;  1Q86 C;  3K7A B;  3X3N A;  2AUK A;  4P74 A;  3Q22 A;  1IYJ B;  1OTC A;  1TVX A;  1CTM A;  4FNF A;  1JE4 A;  2I5H A;  2KQ3 A;  3PQI A;  2AKW B;  2I5L X;  1EQT A;  2F0J A;  1GHK A;  4GZY C;  1UE5 A;  4PV1 C;  1EY6 A;  2E2H B;  4IOC A;  1TR5 A;  4KKU A;  2D0P A;  5A2Q E;  4K0K Q;  3A8K E;  1SMX A;  2RVL A;  3AB9 A;  4CDD C;  3GTK H;  4NB3 A;  4AYB G;  1TS5 A;  1F2Y A;  2LMC B;  4H44 C;  2EY5 A;  1ET6 A;  4A3C G;  5EPJ A;  2B2W C;  4B3T L;  2KBN A;  5BR8 L;  1ZKO A;  3OSO A;  5C5L A;  2P5Z X;  1NJI C;  3OPO A;  3CP0 A;  1G6P A;  4YWK A;  4B08 A;  2KEN A;  1HZB A;  2A73 B;  2E75 C;  5M3M G;  1PH1 A;  5ELB A;  4JI0 L;  1EZ8 A;  4DXF A;  3TZU A;  5AFW A;  3R3O A;  1MIU A;  3F8T A;  1F9R A;  1WTR A;  2BDO A;  2NVX H;  3BZD B;  1X3G A;  5C4Z A;  2RQX A;  3PUX A;  2Z4H A;  1IKL A;  1Y1V G;  2Q2H A;  1SEB D;  4MZ9 A;  2R61 A;  4QL5 A;  4XQQ A;  1N36 Q;  3NE5 B;  1DYQ A;  2F0D A;  1IL2 A;  3S2H H;  1C9O A;  1IBM L;  1NTG A;  4KHP Q;  2LSS A;  1V1P B;  2KEE A;  4X62 Q;  1V1P A;  1XX8 A;  3BYY B;  3NSW A;  5KNC A;  2NWG A;  4GN4 B;  5C3X A;  3T13 A;  4A3E H;  4FXD A;  4AYB B;  2YTV A;  3FDT A;  2YTX A;  2F3V A;  1BUV T;  1BR9 A;  1E7Z A;  1A8V A;  1M4V A;  2NVT B;  2A69 D;  1Q8I A;  4IUP A;  2ICE C;  4N8F A;  4DUY Q;  1HNZ L;  3CAM A;  3E9H A;  1CZW A;  2KED A;  5IOC A;  1VQK A;  4HJ7 A;  2UXC Q;  4GLV B;  2A68 D;  2L1B A;  1KNA A;  3IFT A;  5M3F H;  1OXT A;  1PRT D;  2EZV A;  1N32 L;  3E0E A;  1MSG A;  3KLS X;  2VL6 A;  1SYC A;  3G4S A;  1STG A;  4LUV A;  2MNA A;  3HGB A;  1U4R A;  4NXN L;  1Y1V B;  4X3T A;  1DJR D;  3ICE A;  1KIX A;  2ASB A;  2VQF L;  4LF9 L;  3Q6S A;  3OTO Q;  4DV7 L;  4YCW A;  2QF7 A;  5BN5 A;  3I4M H;  5JOB A;  5GAG C;  4LK1 C;  3BS1 A;  5C4X G;  3HOU G;  1EEF D;  1PRT C;  4O1N A;  4DV0 Q;  3F1Z A;  1TT2 A;  4Q0F A;  2LY7 A;  3M4Y A;  1HR0 W;  2E5L L;  5DNF A;  3VR6 A;  2UXB L;  4O42 A;  2IWH A;  4DV3 Q;  1Q46 A;  5LMN Q;  1WCM G;  5IGG A;  2OTJ A;  1GJX A;  5GRO A;  3DLL A;  2PI2 E;  3S1Q H;  4DV1 Q;  4NKL A;  1EUJ A;  2IX1 A;  3M7G A;  4DPG A;  4LF5 Q;  3JAM E;  2E74 C;  5COY A;  4JI7 L;  4DNI A;  4KD3 A;  1E2W A;  1X9N A;  3GD7 A;  3E5S A;  1BCP C;  1WVL A;  5CV7 A; 
#chains in the Genus database with same CATH homology
 1X3P A;  5COR A;  5ELE A;  2MPM A;  4KD4 A;  3MFY A;  4CJ2 C;  3D4R A;  1HXY D;  5K36 H;  2MHV A;  1CT1 D;  3SXH A;  4OO1 I;  3OMG A;  2VXW A;  1FGB D;  4RKL A;  2SDF A;  3S2H B;  4EQP A;  2K28 A;  5JVG 3;  1PZJ D;  1SNO A;  4C3I G;  3TBI B;  1DOK A;  1EY0 A;  1Q90 A;  3BDC A;  5C4X B;  3Q23 A;  1EIH A;  4Z9C B;  1BXT A;  4H13 C;  2PZT A;  3N52 A;  4XQN A;  3MHB A;  3BG3 A;  3TP8 A;  1QG7 A;  2V4D A;  3LNN A;  1Q1E A;  4DNR B;  1WCM B;  3VYT A;  2F0T A;  4N9P A;  1LT6 D;  2XIW A;  3MWY W;  4HCE A;  2A6E D;  1STE A;  1QCB D;  1SXT A;  4ZRZ A;  1Q3L A;  5M3F B;  1WTX A;  3DM1 A;  4DK0 A;  3PIP 3;  3HZX A;  4RGT A;  1Y69 U;  2L9H A;  1QB5 D;  2L55 A;  1TY2 A;  1Z47 A;  2PW5 A;  3RZD B;  2CQA A;  3U9O A;  2RDG A;  4EQO A;  3NHH A;  4C3I B;  4J6H A;  4RHS A;  4UDU C;  4YIJ A;  3J80 L;  4XTC S;  2B2U C;  3SHL A;  4IFD H;  1C48 A;  5FLX E;  1VCI A;  1AEX A;  4XXE A;  4K8J A;  1EZ6 A;  5JAV A;  2IW3 A;  2FJ2 A;  1CHQ D;  1R4P B;  2F0G A;  3EFX D;  4K5V A;  3H94 A;  2F4I A;  4U68 A;  2L4N A;  1R9T B;  5D14 A;  2NB0 A;  5CC4 A;  2M2L A;  2BCO A;  1VF5 C;  1UEA B;  1DON A;  3C46 A;  5KGU A;  4IQZ A;  4DAV A;  2B2Y A;  4RCO A;  5M5X B;  1HUN A;  1KDB A;  1I4H A;  5JPN C;  2KA7 A;  1IL8 A;  2L5T A;  3G7L A;  2JYO A;  4M8A A;  1HTP A;  1XXG A;  3TDQ A;  1M8A A;  1I6V C;  5E1F A;  5FO8 B;  1EU3 A;  4CHT B;  2EYM A;  3R93 A;  2K5D A;  1SYD A;  3X3M A;  1E2Z A;  4QUF A;  4Q5V A;  2PPB C;  3I8Z A;  1TWF B;  2EJG C;  1I4R A;  1A2T A;  1ENA A;  4I7Z C;  2F0K A;  1LTB D;  4BBS B;  1PMR A;  3HOW B;  1WD1 A;  3UI2 A;  2EYJ A;  5KNB A;  5C0X G;  4IUQ A;  1JWU D;  1PFB A;  1OXU A;  2E2J B;  1EY9 A;  2YYZ A;  4ZAI A;  1AFP A;  3A54 A;  1RHP A;  1S5C D;  1WTV A;  2E2D C;  2NN6 H;  2K5W A;  1ML0 D;  1D1K A;  1B2T A;  5CGK A;  3WOF A;  2OT2 A;  2RDF A;  2B63 B;  3A55 A;  2BOS A;  1SYG A;  4IAL A;  4DA2 A;  2BA1 A;  2I07 B;  1ILP A;  3J7A F;  1RTN A;  3S9W A;  4ZUJ A;  3R2I A;  5ELC A;  2XVS A;  4C56 C;  2K04 A;  1EWC A;  1JC7 A;  3A7L A;  1WD0 A;  4ZKB B;  4MHE A;  2RSO A;  5KEE A;  2NVY B;  1F2M A;  1JR0 D;  4U67 3;  5IIF A;  1CK1 A;  1ESR A;  4H0L C;  5I9P A;  3HOZ B;  3DEO A;  1SND A;  5DEH A;  4HR7 B;  1BDO A;  1YNJ D;  3VYS A;  5CBA E;  3KK7 A;  2Y0S B;  2HCC A;  2LKV A;  4A3I B;  3T53 B;  1LTT D;  3HOY B;  2PZW A;  5C4J B;  2ENB A;  4NMZ A;  3TME A;  4A3J B;  1A3V A;  1IW7 D;  5A35 A;  5CBE E;  1S4Z A;  5FOB B;  1SNC A;  1UUP A;  3FRP B;  1DOL A;  1PRT F;  5JEA H;  4ZUI A;  4XDX A;  2AQ2 B;  1UAP A;  1ET9 A;  3TZD A;  3SK5 A;  5EQ0 A;  2HDM A;  4FF3 A;  2DY8 A;  5E3F A;  3J81 L;  1I6H B;  1F9P A;  1NSN S;  2XRQ D;  1PRT B;  3H91 A;  4FF1 A;  1IW7 C;  3EVQ A;  3MXU A;  4XQJ A;  1IYV A;  1LAB A;  1BCP F;  3PV0 A;  1QIL A;  2G9H D;  2K33 A;  4S3S A;  3WOE A;  4PMW A;  2ICI A;  5D3D A;  4PMC A;  4FYD A;  3OHX C;  1BCP B;  3MC0 B;  5J22 A;  4A3F B;  4KN7 C;  2DNE A;  1QJO A;  1F9Q A;  2WKC A;  3ITP A;  3RZO B;  4QCL A;  1STA A;  3MXP A;  1DZ1 A;  1J9O A;  1I4G A;  1RTO A;  2K05 A;  1EWH A;  4DFA A;  5E4W C;  3NBH A;  2PYK A;  1PTO C;  1U9R A;  3I70 A;  5CMD A;  2AUJ D;  3F2U A;  2WB1 B;  1CQF A;  1EL0 A;  4A3M B;  1T5E A;  1KDC A;  1EYC A;  3L9A X;  5JJZ A;  1AN8 A;  5CV8 A;  4ZLT F;  2JA7 B;  2F0W A;  2CW0 C;  5JVH 3;  4C2M B;  4ODG A;  4ZQ3 A;  2EXZ A;  4DU9 A;  4ME5 A;  1CM9 A;  2EPB A;  1GUS A;  3SVM A;  2F0Q A;  4K14 A;  1DXM A;  3RD4 A;  3SK4 A;  3VR2 A;  1SMY C;  1BOS A;  1SSO A;  5EBC A;  1MGS A;  1O78 A;  1B9M A;  5LL6 S;  4C3J G;  1OXV A;  5LL6 X;  4A3G B;  5BN3 A;  1BQQ T;  4BA2 I;  2EY2 A;  2H4O A;  1YNN D;  5LHY 1;  5G3L D;  2B2U A;  3K5N A;  4XIG S;  4CKE A;  4NDX A;  4G57 A;  1BF4 A;  3ZYY X;  1II3 A;  3OIQ A;  3CRK C;  5C6A A;  2WKD A;  1PZI D;  4OL7 A;  1SBB B;  2PQE A;  3FEW X;  2EE1 A;  4E6I A;  1GUT A;  3QWN A;  2AQ1 B;  2K7V A;  1ROD A;  4RGO S;  3WDN A;  1ONL A;  3PMF A;  2XSC A;  2JEA I;  4Y7N B;  3OW7 A;  3P75 A;  4I65 A;  4KTA A;  3J7A V;  3NQI A;  4C3J B;  4KN4 C;  2L11 A;  5IGB A;  1SFO B;  3D31 A;  3NWS A;  5M3M B;  4DNT B;  5M5Y B;  4PQX A;  1S5E D;  3VA7 A;  3I4N B;  1B4O A;  1RCV D;  2A69 C;  5C3E B;  4HED A;  3FKI B;  2A5H A;  1VMC A;  1SAP A;  2K6A A;  1G6Z A;  2QEJ C;  2R92 B;  3E0J A;  2MJ8 A;  4KHZ A;  4BWG B;  1PLF A;  2A68 C;  2KCC A;  1LO5 D;  1L0X B;  1Q12 A;  1JWM D;  3FPP A;  4IFD I;  1NR2 A;  2F0U A;  1EY4 A;  1VDZ A;  5I2X A;  4XYO A;  1Y8O B;  2EY1 A;  4C1N I;  3M3Y B;  4TQU S;  1EY8 A;  5IT9 E;  2F0P A;  1RDP D;  2OEO A;  1STB A;  1D1I A;  3FMC A;  5IGF A;  1SYB A;  1LLR D;  1NUC A;  3MZ5 A;  2O4X A;  3VR5 A;  1ZYR D;  5M5W B;  1QNK A;  3K57 A;  5DAU A;  3H6M A;  2F0M A;  1WTW A;  2IL8 A;  1LV9 A;  2KEC A;  2SEB D;  5IGC A;  4N9T A;  3HOU B;  5IGD A;  2J7Z A;  3R8B A;  1DD2 A;  3S1R B;  5T1I A;  2C9O A;  4LJZ C;  1S5B D;  4ID6 A;  3BDL A;  1JQY D;  1LT4 D;  2B2T C;  1A2U A;  4DK1 A;  1ZEQ X;  3GTP B;  3MXG A;  1LTG D;  5EKL A;  2MUY A;  1PDQ A;  1TWG B;  3GO5 A;  5EGT A;  2F0L A;  2N55 A;  2B8G A;  2PNR C;  1EQV A;  4HCS A;  2A6E C;  1GUG A;  2AWN A;  2JSO A;  1Z6H A;  5HGT A;  1G2S A;  2WII B;  1EOT A;  1G8Z D;  2XWJ B;  3M7N A;  1D6E C;  3H3V C;  4G7O C;  4L8J A;  5EJW A;  1LTS D;  4KHV A;  1F77 A;  3FVQ A;  4V19 0;  1HRJ A;  2E2I B;  4IN3 A;  2F0H A;  2G9D A;  1SNQ A;  1K83 B;  3T51 B;  1H9S B;  5C0X H;  4WJW A;  1K8O A;  1H9S A;  1KLG D;  2PMZ B;  3T16 A;  3AMU A;  1NAP A;  5NUC A;  2EYF A;  4KY5 A;  2FHT A;  2BE5 D;  1JOR A;  4G7Z C;  4WRD A;  1PTO F;  3S1M B;  5A2Q L;  2IT1 A;  2XRS D;  1BO0 A;  1K8M A;  4CJ1 B;  5EPL A;  3S16 B;  5EKI A;  1MD2 D;  2GA4 B;  2X6G A;  2EDG A;  1QNU A;  3QO2 A;  4WFN 3;  4KJO A;  1PTO B;  2DY7 A;  3PUV A;  2BE5 C;  3NTI A;  2RSN A;  3K5M A;  3NWT A;  3C1F A;  4RHR A;  3BDO A;  2YU9 B;  2A6H D;  1IKM A;  2DNC A;  2JA6 B;  3TP5 A;  2EOT A;  5FO7 B;  1I3Q B;  2D5D A;  4IFD J;  1E2V A;  3ONA B;  3K58 A;  4MN3 A;  2K32 A;  3HKZ B;  3BVM A;  5C44 B;  1D2B A;  3D6C A;  5I6W A;  2ZXP A;  4M1U B;  4DAY A;  3NBI A;  4ZK9 B;  1G29 1;  1TWC B;  1TWH B;  2B2W A;  4OO1 G;  2OXP A;  1KNE A;  2F0V A;  1NCV A;  4CBV A;  4FXG C;  3HEJ A;  5D3I B;  1R4Q B;  3A7A B;  1LTI D;  3CRL C;  4DXG A;  1X32 A;  2IX0 A;  3S1N B;  1ILQ A;  3SE0 A;  1GOZ A;  1TS4 A;  1SDF A;  3TP6 A;  2PW7 A;  3KF8 A;  2K01 A;  1GUW A;  2EYL A;  1FYC A;  4DAP A;  2EY6 A;  2RKS A;  2WP8 J;  3NXW A;  4LAA A;  1EFI D;  2QKI C;  1F2Z A;  2IX3 A;  3I90 A;  2EYH A;  1KAB A;  5FO9 B;  1EYA A;  1LAC A;  3E6Z X;  4V0B A;  4QIW B;  4BBR B;  3RUZ A;  1C8C A;  2R7Z B;  4A3K B;  1W6J A;  4H7B A;  1AZQ A;  5C5M A;  2F0N A;  4HMI A;  3KBX A;  1I4Q A;  5E4X A;  2MGS A;  3S2D B;  3S14 B;  1OO9 B;  2JEB I;  3SK8 A;  1HA6 A;  3A8J E;  3FPU B;  3HOX B;  1XYI A;  2J4X A;  1EYD A;  5C3W A;  1I50 B;  2Z1C A;  2MP1 A;  4K6D A;  4KKS A;  3CQZ B;  2Q8R E;  1CA5 A;  5IGE A;  4J8Q A;  1CA6 A;  3JAM L;  5FK9 C;  4CKB A;  2FMC A;  4R8N A;  3PO3 B;  5BN4 A;  3GTO B;  1DOM A;  1V1O A;  3L3O C;  2M9V A;  2Q8T A;  1YNJ C;  2CHB D;  4PNY A;  1STH A;  1A15 A;  4KI0 A;  1ENF A;  2N88 A;  5T1G A;  1KAA A;  3S17 B;  4IUU A;  2O2L D;  4L6T B;  3GTM B;  4EVO A;  1RD9 D;  1C4Q A;  1BNZ A;  1JOQ A;  4K5W A;  4RWS C;  1SNP A;  2NBF A;  1TQO A;  5FKA C;  1STN A;  3CHB D;  3LWE A;  1GHJ A;  3SDZ A;  5I4D A;  2L0C A;  1AW7 A;  3GQB A;  5ELF A;  4ILW A;  4G7H C;  4A93 B;  4C3H G;  2KOL A;  3S15 B;  4A3D B;  1U4L A;  3V2T A;  4X3K A;  2RBM A;  2I46 A;  1SYE A;  4WOR A;  3L7Z C;  3J7Y W;  3URY A;  1DCZ A;  1TII D;  3DHQ A;  3NK9 A;  2M00 A;  2EJF C;  3J80 E;  1BBX C;  2TMP A;  4DN4 M;  3DWP A;  1U4M A;  1GUN A;  3PIO 3;  4FF4 A;  4HAE A;  5FLX L;  1WTO A;  3SEB A;  2KCN A;  2E76 C;  3ND8 A;  3NPP A;  1SE4 A;  2D62 A;  3CKI B;  2X6L A;  3TSS A;  2B2T A;  4NP5 A;  5JEA J;  4C3H B;  2JA8 B;  1VMP A;  1PZK D;  2SNM A;  3U9S A;  1S5D D;  2XNA C;  2PO4 A;  2A74 C;  3EJI A;  2AWO A;  2RDH A;  4OGQ C;  2JP1 A;  3T56 B;  3GTJ B;  1DM0 B;  4X3U A;  2OF1 A;  3IKJ A;  3GTQ B;  2R3Z A;  4RH6 A;  2NTT A;  4B9W A;  1AZP A;  3Q24 A;  2NVQ B;  4K5X A;  2R93 B;  4FP5 D;  5DM6 3;  3TP7 A;  3PUW A;  2JA5 B;  1HFG A;  4DF7 A;  2RA4 A;  3DEP A;  1YNN C;  3W3A A;  3DMU A;  1FNW A;  2FFK B;  3BVG A;  1H9K A;  5F2D A;  4TSS A;  4J1M A;  2QCP X;  4ABN A;  2NYZ D;  4K2L A;  1KTK A;  4BA1 I;  3D3R A;  3QIA A;  5ISR A;  1IHZ A;  3GV6 A;  1JOO A;  4ZYS A;  2BA0 A;  3PO2 B;  2AQ3 B;  3T4A C;  2C5C A;  3IAY A;  3VYR A;  3P1H A;  4UAI A;  1A6X A;  1CFM A;  4X3S A;  4CKC A;  1ICW A;  1SJH D;  1VF7 A;  3O13 A;  3NUC A;  1G2T A;  4KMU C;  1CZG A;  3VR3 A;  3VYU A;  4K8I A;  4P2C B;  1V8Q A;  1QE6 A;  5I6Y A;  3MA2 B;  2LFN A;  5J1Z A;  1EY5 A;  3D6W A;  1D5M C;  1LT3 D;  3K0Y A;  1SYF A;  2KHS A;  1IYU A;  1JWS D;  1HFN A;  4FO2 A;  1D5Z C;  2O5I C;  5I9O A;  1MBY A;  1F2L A;  1UNS A;  5I2Y A;  1BCP D;  3GTK B;  3ERQ A;  2NTS A;  3K59 A;  4PMB A;  2B2V C;  5KYL A;  2B39 A;  2WAQ B;  4KJN A;  4RGM A;  1ESF A;  3SR1 A;  3QJY A;  1HTL D;  2QDB A;  3OMC A;  4LMQ D;  5KRU A;  2D9U A;  5C0X I;  1PYW D;  3OWE B;  3GV3 A;  1PFN A;  2B8F A;  2KVM A;  5CV6 A;  2BDN A;  4NW2 A;  5M9O A;  1MI2 A;  4HN7 A;  3I3C A;  2NVX B;  5CYU A;  2WV6 D;  2K5Q A;  1MSH A;  2F0E A;  1WTQ A;  1B9N A;  1ZYR C;  3J81 E;  3BYT B;  1QWY A;  1ENC A;  1PTO H;  4KK7 A;  1H9J A;  1JIC A;  1HCZ A;  1OXS C;  4XYQ A;  2WIN B;  4A3E B;  2PZU A;  1L0Y B;  2QIL A;  3OWF A;  4R9W A;  1RF2 D;  4KKT A;  3I72 A;  4OIK A;  1SE2 A;  4KY7 A;  2L12 A;  5EKK A;  4OHJ A;  5CR3 A;  2VNU D;  4IZ8 A;  5ELD A;  1STY A;  3NTH A;  3RMH A;  1E0B A;  3QB3 A;  1NR4 A;  2SNS A;  1JB3 A;  2DN8 A;  3A8I E;  1J8I A;  1H9R A;  1PFM A;  4RA8 A;  1CHP D;  4ULL A;  4K6L A;  3MVV A;  2ZXR A;  1I4X A;  4FVM A;  4EQN A;  4KY6 A;  3MXN A;  5K36 G;  4BS9 A;  3GP7 A;  3SK6 A;  2KUM A;  2NN6 I;  3HG9 A;  1TY0 A;  3P7J A;  3TN2 A;  1FR3 A;  1CI3 M;  2O5J C;  3K5O A;  2J0T D;  1GUO A;  4G4K A;  2XWB B;  3I4M B;  2EYP A;  4CJ0 B;  2HQE A;  4L63 B;  3Q0A A;  1SNM A;  2FMM A;  3MFG A;  3NTK A;  5D65 A;  2SOB A;  1SE3 A;  5K5P A;  5JPM C;  4FXK C;  4ZKC B;  3N6R A;  3S1Q B;  1KDA A;  1GXD C;  1FNV A;  4RFB A;  2FIN B;  4RGN A;  1O80 A;  4R8I A;  2VB2 X;  2F1M A;  4FF2 A;  1G91 A;  1LTR D;  2ID0 A;  3V96 A;  4OO1 H;  2JXM B;  4RKB A;  2D2C C;  3C3L A;  3DXJ C;  1Y8P B;  3ERO A;  2F03 A;  3KLR A;  1B3A A;  1LTA D;  1CQV A;  2EVB A;  1SJE D;  1HHV A;  3DUZ A;  3VA5 A;  5KND A;  4IFD G;  1Q1B A;  4JK1 C;  2H1E A;  3W2D A;  4F7X A;  2TSS A;  4QUC A;  4HSV A;  3M85 A;  1S5F D;  1JOK A;  1W6K A;  3OIP A;  4IUN A;  3NQT A;  3MEH A;  1O7Y A;  1AP0 A;  2ZT9 C;  3KBG A;  3AU7 A;  1Y1W B;  3GTG B;  1V43 A;  2A6H C;  2NUC A;  4XT3 B;  2Z8L A;  1Y8N B;  2WAC A;  1B53 A;  1HUM A;  3GTL B;  4BY7 B;  2HDL A;  5CV4 A;  3HRZ C;  1EEI D;  4B9X A;  5J39 A;  5C0X J;  1HPC A;  3I73 A;  3CU7 A;  3C2P A;  3HP3 A;  4DGZ A;  4IUV A;  1H9M A;  5EPK A;  5CV5 A;  2F0F A;  5G3L F;  3C1E A;  1RJT A;  4F8M A;  2K1B A;  3H09 A;  4HTH A;  3MTS A;  2VUM B;  1X3Q A;  2IJ0 A;  4TKO B;  3OOC A;  1EIG A;  4F87 A;  5DM7 3;  5CV9 A;  1OXX K;  2XN9 C;  4TRD A;  1I4P A;  3A56 A;  4QF4 A;  1O7L A;  2Q8I B;  5TSS A;  3QOJ A;  2EJM A;  4HSP A;  5EBD A;  3QOL A;  1TS3 A;  3BVZ A;  3PUZ A;  2JE6 I;  3IFD A;  3RLF A;  1QOH A;  1Z7T A;  2HCI A;  1O7Z A;  4BY1 B;  4F88 A;  4RAU C;  1T5X D;  3D4D A;  5IT9 L;  1TWA B;  1F9S A;  2R6G A;  2NN6 G;  1JCK B;  5HUR A;  4EGV A;  3KLS A;  2EYO A;  2HUG A;  4KV6 A;  1A3U A;  3VR4 A;  5KIX A;  1ZXT A;  1U4P A;  1FD7 D;  1HQM C;  3PUY A;  3LX0 A;  4QMG A;  4HMJ A;  3I91 A;  2LS0 1;  2K03 A;  4RCN A;  1XTC D;  2F3W A;  4CGY B;  3EQL C;  1PXU A;  2IPK D;  3IL8 A;  3KUP A;  1WTP A;  2X69 A;  2ZXO A;  4K2K A;  2Z4I A;  3P20 A;  4OIJ A;  2B2V A;  1EY7 A;  4A3B B;  2F0I A;  3K6O A;  4IUT A;  4JBW A;  2B2Y C;  1XWE A;  3HS0 C;  1LT5 D;  1RKN A;  3D8G A;  5C4H A;  1B1Z A;  2PCF B;  1PTO D;  1D5X C;  1EU4 A;  3M4O B;  1A3T A;  4XT1 B;  3LWU A;  1TU2 B;  2F0O A;  1B50 A;  4QB4 A;  4IUR A;  3DWQ A;  5JEA G;  3QG1 A;  4MIU A;  3H0G B;  5IOD A;  1KLU D;  1TS2 A;  5KYI A;  1B44 D;  3I4L A;  3D4W A;  3HOV B;  2VB3 X;  2CW0 D;  2NZ1 D;  1HA5 A;  3EA6 A;  3DWA A;  3ND9 A;  1HQR D;  1TKW B;  2CVR A;  3NP8 A;  1SMY D;  3G6J B;  3MAQ A;  4C1N K;  3V05 A;  3K5L A;  2KJX A;  3R2T A;  1FNU A;  2F0S A;  3K7A B;  3X3N A;  2AUK A;  3Q22 A;  1TVX A;  1CTM A;  1JE4 A;  2KQ3 A;  4FNF A;  1EQT A;  2F0J A;  1GHK A;  4GZY C;  4PV1 C;  1EY6 A;  2E2H B;  1TR5 A;  4KKU A;  5A2Q E;  3A8K E;  2RVL A;  3AB9 A;  1TS5 A;  1F2Y A;  2LMC B;  4H44 C;  2EY5 A;  1ET6 A;  5EPJ A;  2B2W C;  1ZKO A;  3OSO A;  5C5L A;  3OPO A;  4B08 A;  2A73 B;  2E75 C;  5ELB A;  1EZ8 A;  4DXF A;  3TZU A;  5AFW A;  3R3O A;  1F9R A;  1WTR A;  2BDO A;  3BZD B;  5C4Z A;  2RQX A;  3PUX A;  2Z4H A;  1IKL A;  1SEB D;  2R61 A;  4XQQ A;  3NE5 B;  1DYQ A;  2F0D A;  1V1P B;  2KEE A;  1V1P A;  1XX8 A;  3BYY B;  3NSW A;  5KNC A;  2NWG A;  5C3X A;  3T13 A;  4FXD A;  4AYB B;  3FDT A;  2F3V A;  1BUV T;  1BR9 A;  1M4V A;  2NVT B;  2A69 D;  1Q8I A;  4IUP A;  2ICE C;  1CZW A;  2KED A;  5IOC A;  2A68 D;  2L1B A;  1KNA A;  3IFT A;  1OXT A;  1PRT D;  2EZV A;  1MSG A;  3KLS X;  1SYC A;  1STG A;  3HGB A;  1U4R A;  1Y1V B;  4X3T A;  1DJR D;  3Q6S A;  2QF7 A;  5BN5 A;  5JOB A;  4LK1 C;  3BS1 A;  1EEF D;  1PRT C;  4O1N A;  1TT2 A;  4Q0F A;  2LY7 A;  3M4Y A;  5DNF A;  3VR6 A;  4O42 A;  2IWH A;  5IGG A;  1GJX A;  4NKL A;  2IX1 A;  3M7G A;  3JAM E;  2E74 C;  5COY A;  4KD3 A;  1E2W A;  3GD7 A;  3E5S A;  1BCP C;  1WVL A;  5CV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...