3V2TA

Crystal structure of staphylococcal nuclease variant delta+phs i92a/v66a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3v2tA00
4NMZA 3V2TA 4K2LA 5I6WA 4DF7A 5KGUA 2EYMA 2F0TA 1SNCA 5IODA 4K8IA 5J1ZA 5E3FA 1EY4A 1F2ZA 4HMJA 5IGCA 5CC4A 4G57A 3TP5A 3OMGA 1EY5A 5IGDA 4TRDA 3NXWA 2F0UA 1U9RA 4QMGA 1EZ6A 5DAUA 4K6DA 2HQEA 4B9XA 2EXZA 4DGZA 2F0VA 3C1EA 2O4XA 3U9OA 1II3A 1TQOA 4K8JA 4ODGA 3P1HA 3NUCA 4KJOA 1JORA 2EYOA 5CV6A 4EVOA 5IGFA 4KD3A 5F2DA 5K5PA 5KRUA 2F0HA 4NKLA 4KHVA 5HURA 3SR1A 2F0MA 5IGBA 4K14A 2F0JA 1A2UA 1RKNA 1STBA 2ENBA 1EYAA 2F0SA 2F0GA 2F0NA 2RBMA 1A2TA 2F0IA 2RDFA 2M00A 2RKSA 1ENCA 4ME5A 1SNMA 1SNDA 2LKVA 2OEOA 3TP6A 3NK9A 3QB3A 1EY7A 4ZQ3A 1STHA 4DFAA 3DHQA 3MHBA 1EZ8A 4J1MA 2F0PA 4J6HA 4OL7A 3SK4A 2EYLA 4K5XA 4EQNA 5CV4A 1SYGA 2PW5A 4QF4A 2F0LA 4HTHA 1NSNS 4YIJA 1STGA 4KY6A 2EY6A 4RKBA 3D6CA 4PMBA 5C3WA 3SK8A 4KTAA 5KYIA 5JOBA 2EY1A 5HGTA 5J39A 4N9PA 2F3VA 4QB4A 4RKLA 4WORA 2QDBA 3MVVA 2F0WA 1SYCA 2PZUA 5I6YA 1KDAA 3ITPA 5ISRA 2PYKA 4KV6A 4EQPA 3OMCA 3TP7A 5C4ZA 2KQ3A 2OXPA 3NQTA 3MEHA 5CV9A 3C1FA 4F8MA 5C6AA 2SNMA 1SYFA 4I65A 4DU9A 5IGEA 1KDBA 3QOLA 4N9TA 4IALA 1EYCA 2F0EA 1SYEA 2PZWA 2EYHA 1ENAA 1SNOA 3D4WA 3EJIA 3R3OA 4K2KA 1TR5A 4WRDA 3EVQA 4S3SA 2KHSA 5CV7A 5EKKA 2EYJA 3NP8A 1EY8A 1AEXA 4IZ8A 4LAAA 4MIUA 2F3WA 1IHZA 3PMFA 5IOCA 2EYPA 5KYLA 1JOKA 1SNPA 3E5SA 5KEEA 1SYDA 2OF1A 3OSOA 4KY5A 1EY6A 5EGTA 5C5LA 2WACA 4KY7A 5DEHA 3D8GA 1JOQA 3SXHA 4ZUJA 3OWFA 4K5VA 4KJNA 4B9WA 1F2MA 3MXPA 4E6IA 3DMUA 3HZXA 4KD4A 3SK6A 2F0OA 5E1FA 1EYDA 5KIXA 1KDCA 5M9OA 4PNYA 3T13A 4K5WA 2F0DA 3S9WA 1STAA 2SOBA 2F0KA 4NDXA 1TT2A 2F0QA 5C5MA 1KAAA 1A3TA 3ERQA 3P75A 1NUCA 5I9OA 5CV8A 4F7XA 3SHLA 3SK5A 4PMCA 5JAVA 5J22A 5IIFA 1STYA 1SYBA 4NP5A 1SNQA 5C4HA 5CGKA 4IUNA 3TP8A 1A3UA 3RUZA 3MZ5A 4ZUIA 1EQVA 3EROA 3D4DA 2SNSA 3QOJA 5IGGA 1EY0A 1STNA 1JOOA 1A3VA 3NHHA 1EY9A 5I9PA 2EY5A 3VA5A 2NUCA 3T16A 3BDCA 4ID6A 5NUCA 2F0FA 4HMIA 3LX0A 1F2YA 5CV5A 3TMEA 4EQOA 5C3XA 3HEJA 4R8NA 3H6MA 3BDLA 5EKLA 2PZTA 2EYFA 2PW7A 1KABA 5CR3A 2EY2A 2PQEA 4H7BA
chains in the Genus database with same CATH superfamily
1QCBD 3EFXD 3A54A 4FF4A 4JI6L 2XRSD 1EY4A 3DLLA 4DAMA 3J7A5 5C0XH 5EBDA 2Q2HA 3RLNA 2I07B 3K5LA 2B2TA 3A7LA 1ILQA 1FVIA 3OOCA 5K5PA 2NVTB 2D5DA 4DUZL 1H9KA 1VQFA 4L5TA 5C4XB 1CK1A 1I6VC 1TWAB 3QO2A 4FF3A 1PFSA 5M3MH 4FDBA 1BCPB 3A8IE 1OXTA 1J9OA 1K8AC 3P20A 5IY0A 4LF7L 1EIGA 1BOSA 2F0PA 3D3RA 3JAMi 2E5LL 1UNSA 2EJMA 3WOFA 4L5RC 1NSNS 2C35B 3LNNA 1SFOB 4NXNL 1IL2A 1WYDA 4XIGS 1QJOA 1MSGA 5JOBA 3A5ZB 2QDBA 1Y8NB 4H44C 1JR0D 1S5DD 1SAPA 1NR2A 4DK1A 3VDYA 1LLRD 2PO4A 2B2YC 3G48A 4IALA 1JJGA 2MO1A 2QEXA 1WTHA 2VQEL 2IT1A 4DUYQ 2K28A 1GUSA 1W2BA 3BVMA 1R4QB 2Z0SA 1EWHA 3E5SA 3GTGH 3HKZB 3A5UA 1SRUA 4GNXB 3OSOA 4KKUA 3CCLA 3SXHA 4B9WA 2JA8B 2K14A 1KIXA 1EYDA 3NE5B 3H94A 1O7LA 3M9BA 3D0FA 5M3FG 1E3PA 2JN4A 2R7DA 3M7NA 4CJ2C 4QIWE 2E8GA 4FF1A 4HSPA 1Y1VG 2KCMA 3LWUA 2IW3A 1LABA 5CV8A 1L1OC 3S2HH 1RTOA 5EBCA 3CKIB 5M3FB 1K0SA 4RCNA 3H3VI 1WTQA 2Z6KC 4IUPA 5I9PA 4OXPA 1RCVD 4DR2Q 2F03A 4HMIA 3X3MA 2XRQD 1Y1WG 4GZYC 2IWHA 4X3TA 1U4PA 1YNNC 5I2XA 3I91A 3TP5A 1HNZQ 5IGDA 2VZAA 3G6JB 2OQKA 2KCNA 1BCPC 1B9MA 1PZID 3DEPA 3FKIB 1L0YB 1YHBA 3NUCA 1B2TA 2L0CA 1G6ZA 4L63B 2OCEA 1PH1A 4RHRA 1FR3A 1C8CA 3RLFA 2XSCA 3SGIA 1EQRA 4A3LG 2F0IA 5C0XG 4PQXA 1UAPA 4DV7Q 3W2DA 1QUQB 1STHA 5A35A 1KL9A 2CVRA 3HGBA 2OWOA 4B3RL 5D3IB 2KHJA 2JEAI 3CCVA 2YU9B 5C4XG 1B3QA 2Q2IA 4RG1A 5CMDA 3CCMA 2WV6D 2JA6H 3ITPA 3S1NH 1D5XC 4IPDA 1D2BA 3J80i 2AQ1B 3MXGA 2M9VA 1KDBA 3L0OA 1EUJA 1T5EA 2F52A 2HHHQ 3AYHB 1N34Q 1E1TA 1VF5C 3JAML 1HNXQ 2B2YA 5JVG3 3M3YH 2M2LA 4MIUA 4LAAA 1IBML 1PTOH 3S1MH 4LUOA 5IOCA 2UXDL 3DM3A 4KHPQ 3CU7A 4XXEA 1WI5A 1Q8IA 1FD7D 1SEBD 5E1FA 1QOHA 2RCFA 4WJ4A 4JI6Q 1E2WA 2L15A 1I3QB 4DV7L 4Y7NH 2PQAB 1HNZL 1TT2A 3C46A 4LFCL 3TZUA 3W5OA 4C2MH 3CC7A 4LF4L 4QJFA 4JBJA 5JAVA 5L37A 5J22A 4NP5A 4A3JH 3NPPA 3A8JE 3MZ5A 4LFBQ 1STNA 2XNAC 1A3VA 1S5ED 3T1HL 1WJJA 1TY0A 4OIKA 2K5NA 3HEJA 3KFUA 2R93G 5EKIA 2UUAL 1X3FA 4UP9A 1ASZA 2WKCA 3C2PA 5IYCG 1L0WA 3TSSA 4CKCA 1KHIA 4ZKBB 1SROA 4ME3A 1X3EA 4BXXH 2F0VA 2EYOA 3KYHC 4NXMQ 5KRUA 2OTLA 2B2UC 5EJWA 2PCFB 1YZ6A 1N33Q 3PCOB 4MN3A 3S14B 1RKNA 3Q24A 3HOXB 2WB1E 2LKVA 2NVXH 1M1KC 1JCKB 4RFBA 4YCVA 3DHQA 3S2DH 4DR3L 1FGBD 1A62A 4J1MA 1SN8A 4J15A 4K5XA 4L5SA 1NMFA 1U5KA 2R7ZH 5LMNW 5JVH3 3ND8A 1DOLA 2K4KA 4YWMA 4YY3L 4DV1Q 5LL6X 1PZKD 1SYCA 2FMCA 4BXXG 3OYYA 3K57A 1Q86C 3NQTA 1DM0B 1CM9A 5IGEA 5FK9C 4GS3A 1Z6HA 4NPSA 1PH3A 1AH9A 1KXLA 4JYAQ 3NP8A 2NVTH 2EE1A 1QUQA 4XQQA 4MTKA 1SNPA 2A6ED 5LHY1 1XPOA 4B3SQ 1Q8KA 3I4NH 3I4MH 3TDQA 5EGTA 1JOQA 1HZ9A 2JA9A 2A6HC 2UUBQ 1VS0A 1K3RA 4A3BG 3GTKH 4IPGA 5DLQE 3HFZB 1EOVA 1PRTC 1QNUA 5C5MA 5A2QE 2R92G 1Y1WB 3F2CA 4A3MH 3NQIA 2HUGA 1SXTA 5C4JB 4OWWB 1CUKA 1N32L 2NN6G 3RUZA 4CBVA 1QVGA 3W1BA 4BY1B 1XMQL 1HA6A 4KKSA 4C3HH 4OWTB 2RHSB 4JOIA 4JI0Q 4GKKQ 1HQRD 3KF6A 3LX0A 3ULLA 2V4DA 3PUVA 4BBRH 2WINB 3I72A 2PW7A 2Q8IB 5M5WH 1LT4D 2BA1A 2EY2A 3NBHA 2FXQA 4JYAL 3PO3H 1HFGA 1JE5A 4K8IA 3S14H 3DXJC 5IGCA 3GTQB 5COYA 2JA8G 1WTWA 1EZ6A 1G291 3FEWX 2E76C 3HKZG 4HEDA 1BR9A 2FINB 2KBNA 4KJOA 3TREA 4DR5Q 4BY7H 1KLUD 5DM63 4QL5A 4RWSC 1HFNA 5T1IA 1GO3E 3J81j 2B2UA 2F0NA 2RDFA 4XYQA 3DWQA 1XNQL 1ENCA 5IT9c 4AQYQ 2E5LQ 4DAYA 2G9DA 5M3FH 4R4QA 3Q23A 4DAVA 4A3LH 4OL7A 3KBXA 1ILPA 3NTHA 1VQNA 1ENFA 4KY6A 2B39A 5C3EB 1KRTA 1FNUA 1G8ZD 5JPNC 2KEDA 3D6WA 1LO5D 4QB4A 4NB3A 3U58A 3M4YA 1HNWQ 3I4MB 5C6AA 3SEBA 1HA5A 3KLSA 2SNMA 3Q6SA 1RJTA 2E2HH 4PZ6A 4IFDH 4RCOA 1ICWA 1B4OA 1TS5A 1VQ4A 2R3ZA 2K01A 3FVQA 5ELNA 1Z47A 1AW7A 3VR3A 5T1GA 3DUZA 1V1QA 3J81E 3FPUB 3HZXA 2F0OA 5FKAC 1IYVA 2PMZB 4PNYA 3CCEA 1KD1C 3U4ZA 3S9WA 1HXYD 1SDFA 1DCZA 1NAPA 1KAAA 1XPUA 1B44D 2OQ0A 2FMMA 4DR1L 4DV3L 3CMAA 3H3VC 5FOBB 1DYQA 1E24A 1FL0A 2RF4A 3QOJA 1IYUA 1PH7A 2E2JB 1YHAA 3E0EA 1LTBD 3I8ZA 3E3XA 3K7AH 1VQLA 4LUVA 1K0RA 3PIO3 1VMPA 1NMGA 2H1EA 2JXMB 3D31A 1I4GA 1N36Q 2EDGA 1H9SA 1XPRA 1LTRD 2Y0SG 2E2DC 4IFDJ 1CQFA 2D2CC 1U0LA 1FYCA 1RF2D 2UU9L 4WJ3M 4ZRZA 1JORA 2UXBL 1Y8OB 2IX3A 4JI3L 1FGUA 1O80A 3FRPB 1HZCA 4R4OA 1TVXA 3F2BA 1OTCA 3HOUB 5IGBA 2WAQB 3A7AB 2N88A 4JW0A 2R93B 3P75A 1X55A 5E4XA 1VQ9A 4B3RQ 2A1AA 2BOSA 1XJVA 2BDOA 5G3LD 3ULPA 4C3IB 3FDTA 4DV4Q 3MHBA 5JEAH 1U4MA 3PSIA 2KUMA 3ZJYC 1YIJA 1EIHA 3SK4A 1MBYA 1MI2A 2EJGC 2PW5A 1PYSB 1BO0A 1JMCA 3HOVB 4LF8L 5GAGC 1B70B 3S15B 2Z4HA 5FLXE 3SK8A 5GAHC 3KJPA 4PZ8A 1NCVA 4B08A 3HOXH 4JV5L 3PQIA 2QDLA 4DV6L 4IUTA 3SVMA 1AZQA 1A6XA 1Q81C 5D3DA 2K75A 4HCEA 4IN3A 1SJHD 4MHEA 2NTTA 2NZOA 4I7AA 1VQOA 4A3IG 3BZKA 5CV7A 4IZ8A 1JE4A 2PQAA 4Q5VA 1QILA 5AJ3L 3J7ZC 3VR4A 1OO9B 3MAQA 2EVBA 1QVCA 2A8VA 1WCMG 2K32A 1HR0L 2NVXB 3DMUA 1R9TH 4AIMA 4UP7A 4DV2Q 1TWHH 3HOYB 2GVBA 3A0JA 4DK0A 2B63H 4HR7B 4A3MG 4R1JA 4NDXA 2X6GA 1A3TA 2NZHA 2R92H 2JQOA 1PA6A 2D62A 1B9NA 1TWFH 2WFWA 1IW7C 1HH2P 3QJYA 1E22A 3BVGA 3I4NB 3G6EA 1NBWA 3OW2A 4V0BA 3T1YQ 1CTMA 4JBMA 4CDEC 3FKIH 1JJCB 3T1YL 5JJKA 2L11A 1G51A 4DNTB 1VQMA 3I7FA 1K8GA 4P2CB 4ID6A 4JI1L 3K59A 5EKLA 2R61A 4IQZA 2GN5A 2PZTA 1GHKA 4EQ5A 2BA0A 2XTIA 4NMZA 1HQMC 3HOUH 4JG2A 4HIDA 2F0TA 2R93H 5E3FA 4C1NI 4KK7A 5CC4A 2QGQA 2G9HD 4HN7A 2JA7H 2HQEA 3HS0C 2NVYH 3FKIG 2R6GA 3CRLC 1TKWB 1GUGA 3L3OC 3AEVA 4EVOA 3CPFA 2F1MA 4NKLA 3S1RH 5ELCA 1QWYA 3K0YA 3GTOB 4CDCC 3GTGB 3PO3B 1ESFA 4LF8Q 2L4NA 1CKNA 1I6HH 1EYAA 2ENBA 3CQZH 3TP8A 1FJGL 2M00A 3OTOQ 2NTSA 2OEOA 4DV5Q 5IP9G 2AWOA 1KQSA 1J5EQ 1I4XA 3J80c 1CI3M 1PH5A 1XTCD 4EQNA 2V1CC 4AH6A 4DR7L 3ULJA 3HOWB 3VYTA 1V8QA 1X32A 1STGA 3STBC 2R7FA 4PMBA 3CD6A 2BH8A 2H5XA 5BR8Q 1X3QA 4RHSA 1Y1VB 2MO0A 3OMCA 4BBSG 1ET6A 2AWNA 4JOIC 1MKHA 2VB2X 3K0XA 2AQ3B 3R8BA 1GOZA 1SNOA 3D4WA 1HCZA 5M5XH 2SEBD 4Y7NB 1J8IA 1GVPA 3Q0AA 3D4RA 3S16H 5C3EH 2BDNA 4N8X1 4PV1C 3GTPB 5BN3A 2K1BA 2PNHA 4JBKA 3J7YW 3OHXC 2UU9Q 1KTKA 2IPKD 4LWCA 4POFA 1O78A 1AZPA 1STAA 3BZDB 3PF5A 4DPGA 4OO1G 4EX5A 4XQNA 3GTMH 1DJRD 1Q1BA 3HRZC 4FYDA 2B63G 1Q1EA 1I4QA 3TBIB 1PH2A 3M4QA 4IPHA 1SNQA 5C4HA 1IKMA 5D65A 4LF5L 1JJ2A 2JA7B 1EFID 1ZKOA 4LUZA 1I5FA 4GLAC 1BBUA 1Q12A 3CC2A 3NTIA 2IY5B 3H6MA 1KABA 1TS4A 2YYZA 5FLXc 1I4PA 2JA6B 1WTPA 2MUYA 3T4AC 2H4OA 3BU2A 2Z1CA 4GN3B 4JI8Q 3NXWA 1IBLL 3PO2H 1EIYB 2DNCA 1B8AA 4CJ0B 5CV6A 3HOZB 2B29A 1KC8C 3K7AB 1TY2A 5IT9E 1WTVA 4B3MQ 1TWCH 5IE8A 3OIQA 4DA2A 4QQBX 3VR5A 2QA4A 3I70A 4A3IH 4K14A 1ZEQX 2BE5D 4ZUIA 4ALPA 1A2TA 3MTSA 1SNMA 3WOEA 3ICEA 4DV5L 2EZVA 2E2IB 3OTOL 1C7YA 2MHVA 5C44B 1IL8A 1I4RA 1CSQA 4QF4A 4XTCS 1CSPA 4X6AH 4YWKA 1D1IA 1HUNA 3M7GA 2NWGA 5ELBA 2K5QA 3GTJH 3MVVA 1HTLD 4EQPA 4DXGA 5ELFA 3HG9A 4C3IH 3BS1A 1SYFA 4IFDG 1V1PB 1EYCA 5K36G 2UUAQ 1WTRA 3GV6A 3EJIA 3K7UC 2GVAA 5GQOA 4A76A 1EQTA 5IYBH 2X6LA 1EY8A 1AEXA 2Z6BA 3OPOA 1IHZA 5AFWA 3PIOA 2EYPA 1QE6A 2MJ8A 1VQ5A 1ZXTA 1CKNB 4JVZA 3URYA 2CCZA 1UE1A 1RODA 1IZ6A 1VQDA 1YHQA 2Q8RE 1PYWD 2KVMA 3X3NA 4HCSA 1WD0A 3B6YA 3PUZA 4OWXB 4KN7C 4BBRB 2K6AA 3G7LA 3S15H 4FF2A 3SHLA 2MNAA 3KLSX 4H02A 4BY7G 1LACA 2J0TD 4A3GB 5M5YB 4A3KG 2NVQB 3RNUA 1EQVA 2MPMA 3D4DA 2A73B 1JOOA 3DWAA 2UUCL 2VUMH 4IURA 4MZ9A 3CCRA 2JA5H 3TMEA 4LF5Q 4G7HC 1Q46A 4KMUC 4O42A 2HHHL 3TN2A 4R8IA 4C3JG 1PTOB 5IODA 4QUFA 1EY5A 2LY7A 2K7VA 4QMGA 3UE0A 4C3HG 4ODGA 1BCPD 5C44H 2N78A 4ZLTF 4HJ9A 4FVMA 1JWMD 3KDFB 2CHBD 1U4RA 1F2LA 2K52A 2KECA 3BYYB 4C2MB 4CDDC 4LF4Q 2QEJC 1JB3A 2F0JA 2RSOA 2SNSA 5IGGA 4LFCQ 4GKJQ 4EQOA 4CKEA 1K8MA 1EY7A 4DR3Q 4QY7A 1MJEA 4J6HA 4OGQC 3K80C 1CZWA 3NWSA 4Q0FA 3T53B 1S4ZA 3GV3A 4ILWA 5LMUL 4KTAA 4DXFA 2VUMG 2EY1A 1DGSA 4N9PA 2F3VA 4PG3A 5I6YA 1L0XB 3BYTB 5C4ZA 1H95A 4F8MA 5CORA 1VQEA 4DU9A 1NJIC 1EYGA 2IJ0A 2A6HD 4XT3B 4DV0Q 1SR3A 3HOWH 5ELOA 1TR5A 2KHSA 4N8FA 1HHVA 3CC4A 3PMFA 1H9JA 2UXBQ 4DV2L 4NXML 4AYBB 1JOKA 2PPBC 1ASYA 4A3EB 3GTQH 2IX0A 2KCCA 1SYDA 1EFWA 5JPMC 1WOCA 1HR0Q 1EY6A 1VQBA 2WB1B 3RZDH 1IW7D 4ZUJA 1F2MA 3MWYW 2F0DA 2VUMB 3NWTA 1JT8A 2ZM6L 3KJOA 3NEMA 1CZGA 3TRZA 1WFQA 4LJZC 4JI1Q 3NENA 2FHTA 1X56A 1XYIA 4LFBL 3O13A 1EY9A 2XWJB 2EY5A 4A3DG 2XGTA 1F2YA 4U673 2A19A 4R8NA 4OO1I 2I5MX 2D0PA 3AFQA 2LS01 4KHVA 1IBMQ 3I73A 2DGYA 2MGSA 4G57A 2AQ2B 2E2HB 4LNQA 4JC0A 2PI2E 4X62L 3KOJA 3P1HA 2Y0SE 3FP9A 1XNRL 1MIUA 1QZHA 1OXXK 1S72A 2BH2A 1BVSA 1H9RA 1RHPA 1HNXL 2LXJA 5H1SE 1A2UA 4DR4L 4GN5A 1P8LA 1EWCA 4A3KB 2CWAA 1NTGA 4RAUC 2L9HA 1SE8A 1S40A 4APVA 1JWUD 1XNQQ 1GUOA 1TWGH 3TQYA 1VQIA 3MC0B 4HTHA 1TU2B 4M8AA 4BBRG 1OXVA 4HJAA 5LMUQ 5C3WA 3HP3A 4V190 3H0GH 1BQQT 4XQJA 4WFN3 3Q22A 4A3EH 2CQAA 2ZJPA 4IUVA 3NBIA 3PO2B 1BXTA 1F77A 1QB5D 3H91A 3AFPA 3TZDA 4M1UB 2ZXOA 1EU3A 1A8VA 4WRDA 3EVQA 3K5MA 1ML0D 3PUWA 1VQ8A 1YNXA 1G91A 3EBEA 1DOKA 2YTXA 4O1NA 3KK7A 1M8AA 2ZTCA 4HSVA 5M3MB 4XT1B 4JI3Q 2WACA 1HZBA 4K5VA 3CP0A 3PIPA 2J7ZA 5M9OA 2HIVA 3K81C 4RGNA 5JEAG 3QIAA 2ICIA 3A55A 1L1OB 1T9HA 5CYUA 2JK8A 2QF7A 4IOAA 2D0OA 5JJIA 4F7XA 1NR4A 4DR6Q 3I3CA 3E6ZX 1TS3A 1RDPD 4DR2L 1MJCA 3HKSA 3GQBA 3GTJB 3J81L 4B3TL 1V9PA 2K03A 4QGUA 1RIPA 1VQ7A 4RMFA 4BS9A 1EEID 1HTPA 3KF6B 5C3XA 3E9IA 2Z9HA 4X66Q 4OX9Q 4LF9Q 3S1QB 2KHIA 4P71A 1KAWA 1PFMA 1K3BC 1Y8PB 4P72A 5J1ZA 1E1OA 2VL6A 2NVQH 4JK1C 2UXCL 3S24A 4TRDA 3AQQA 1MD2D 2N55A 2RCNA 2JA6G 3C1EA 1E7ZA 1A15A 1I94Q 3JAME 1HJPA 1TWGB 3TS0A 3VYUA 4A3FG 1N8RC 1STEA 2VXWA 1A63A 3PUXA 1PHJA 2B8FA 3UE1A 3G71A 3GDEA 4NW2A 3L9AX 4JI2L 2B2VC 2JA7G 1SLJA 1GJXA 5M5YH 3E0JA 4X64L 4A93H 2JEBI 2B63B 1CHQD 3KDFA 2TMPA 2K5WA 1ICFB 5GADC 1GUNA 4GLVB 3U4VA 2PZUA 2PYKA 1LTLA 2MQHA 4OIJA 1XTDA 4R4IA 4UAIA 2PZWA 3N6RA 1C4QA 2SDFA 5EKKA 1PVOA 2XWBB 2ZJRA 2L1BA 4DUZQ 4B3ML 1S5FD 2YTVA 3NSWA 5KEEA 4A3DB 1I50H 4BBSB 3MXPA 4XYOA 5KIXA 1BBWA 4K5WA 1YJNA 4ZAIA 3BJUA 2AUJD 5CBAE 2SOBA 2UXCQ 4JI2Q 3W3AA 3I56A 2NYZD 2QCPX 3ER0A 3ERQA 3S1QH 1KNEA 5M5WB 3ZYYX 5I9OA 1O7ZA 4DK3C 2JA5G 1A3UA 4JI0L 2BE5C 4GKKL 4IUUA 2CW0D 4R4TA 2WB1G 2K33A 5CV5A 4AYBG 4QCLA 4O0AA 2DY7A 3M3YB 1D8LA 2RDHA 3KLRA 1N34L 1Y1VH 3MFYA 3OWEB 2KCTA 2LMCB 4LF9L 3ND9A 1K8OA 3M4PA 1XXGA 2CKZB 1SBBB 1NNXA 2K5HA 2AUKA 1U9RA 4KHPL 3FPPA 1IKLA 4L8JA 3U9SA 1UWVA 1TQOA 4K8JA 2L12A 5FLMH 5M5XB 1UE5A 2JYOA 5IGFA 4HIMA 1N33L 4HIKA 5CBEE 1M4VA 5FO7B 1EEFD 3J81i 5IP7G 1RD9D 2F0MA 3T16A 4A3CH 1STBA 3CCSA 1QG7A 1VF7A 1YNJD 1SMYD 1CHPD 4DR4Q 1UEBA 3H09A 2C9OA 2VQFQ 3KBGA 4RGTA 1EZ8A 1VQHA 2B2VA 3R2TA 1QZGA 3BZCA 4IJLA 4A3CG 4KN4C 2CWPA 4YIJA 1Y1WH 5DM73 3K8AA 2EY6A 1DOMA 4O2DA 4A3MB 4ZKCB 5D14A 3HOYG 3AU7A 1SE2A 3K5NA 5KNCA 3E9HA 4DR7Q 4YCUA 1KDAA 2K5VA 3STBD 3AMUA 4A93G 5IYDH 3C1FA 4GOPC 1H9MA 2VNUD 1VQGA 3H15A 1B50A 4PZ7A 1G2SA 2EQSA 4UY8C 4JI7L 4CKBA 2EYJA 1PMRA 1MHWC 1LM0A 4LFAL 1UE6A 4A3FH 3PF4A 4DNIA 3H0GB 2R7ZG 3FHWA 1VQAA 2N8NA 1M90C 4KY5A 2CH4W 5DEHA 1XNRQ 2VY3A 3D8GA 2HCIA 4KJNA 4A3KH 4GLXA 1D1KA 4X62Q 4FP5D 1DD2A 3OW7A 1SSOA 2PMZE 1YJ9A 1VQPA 4DR6L 3HOVG 1B7YB 4CGYB 1K83B 4IUQA 1GUWA 1L2FA 3NTKA 1SYBA 1MSHA 4IUNA 5FO9B 4U68A 1GM5A 3M4OH 2DN8A 2YTYA 2O2LD 4Y52H 3RZOB 2GA4B 1X9NA 1D6EC 4A4IA 2F0FA 5GROA 4IJHA 1VMCA 3I55A 5IYCH 5EPKA 4FNFA 1YNND 5IYBG 4KKTA 2VQEQ 4PMCA 4JI7Q 1AFPA 4GN4B 5I6WA 1Z7TA 4HMJA 4ABNA 2JP1A 4HJ8A 4IPCA 4DKAC 2XIWA 1XWEA 4KI0A 2NZ1D 4GKJL 2Q2TA 3U9OA 4BA2I 2F4IA 1LTGD 1KNAA 3WWVA 5AJ3Q 4DUYL 2MFIA 2OTJA 3SR1A 2VB3X 1WD1A 4XDXA 2Z8LA 2RBMA 5ELEA 1PDQA 3IL8A 4Z9CB 3PO2G 1MGSA 3DM1A 1SNDA 1HUMA 1LT6D 3Q8DA 4JI5L 2F4VQ 4LF6L 3WDNA 2CH4A 2EYLA 5FJ8H 5CV4A 1ZYRD 4QIWB 3IFTA 3J7AF 4JV5Q 3DWPA 1O7YA 3D6CA 1FNWA 3PV0A 1KLGD 1WTXA 3A56A 3GO5A 5J39A 4RKLA 2JSOA 3SDZA 3R2IA 5ELDA 3HOZG 4DN4M 3N52A 1PH8A 3MEHA 4DV4L 4CDFC 2EPBA 1BF4A 1V43A 3IFDA 2EYHA 5E4WC 3BG3A 2EXDA 4GOPA 2KA7A 5TSSA 1RTNA 3H0GG 2R7ZB 5JJLA 2DNEA 2J4XA 3P7JA 1PRTF 2UUCQ 1K83H 5C4XH 4RH6A 5KYLA 2IL8A 4YWLA 2VS1A 2RHQB 4KY7A 1IBLQ 3I4MG 5FJ8G 3GTLH 3SK6A 3I2ZA 1GUTA 1V1OA 1O7IA 4A93B 5C3EG 5EQ0A 3CHBD 4LMQD 3PGZA 1Y69U 1K9MC 1ZYRC 2E75C 5HY6A 5IWAL 1NUCA 2HQLA 1X54A 3SK5A 1WVLA 1DZ1A 1IBKL 1STYA 1I50B 4BBSH 1LUZA 1PFBA 2LSSA 1XMOQ 3GTKB 5BN4A 1PH4A 3RLOA 3BDLA 3TS2A 3S1RB 2RA4A 2A68C 1E0BA 1SNCA 1I6HB 1W6KA 4JCVE 4DV0L 3HKZE 3OMGA 1B3AA 2KENA 4UPAA 4A3EG 2O4XA 5LMNQ 1II3A 3IRBA 3BVZA 5F2DA 3RR5A 2F0HA 1CFMA 4MTNA 3RD4A 3CF5A 3S1MB 1PH9A 1YBYA 3CRKC 4KLKA 4DK6C 3UDXA 1YVCA 2TSSA 4BY1G 3HOWG 3RZDB 2QW7A 4KHZA 4RGOS 3QB3A 1G2TA 1R9TB 5EAYA 1C0AA 3J80L 4YHHL 1I4HA 3V96A 1BBXC 1LTTD 3EQLC 2JA5B 2R92B 1FNVA 2RVLA 5I4DA 4FO2A 1DONA 1LTSD 4CHTB 1Q90A 5GAEC 3MXNB 1ONLA 1SMXA 1QVFA 4A3BB 2NB0A 3CAMA 4WORA 1I94L 1S3OA 2WKDA 2JE6I 2B2WA 2G5DA 2YV5A 1A0IA 3GTLB 2F3IA 4OHJA 1DXMA 2AMCB 4HIOA 2IHEA 3R3OA 1VQKA 3F2UA 3NELA 4DR5L 1XX8A 4X65Q 2WAQE 2ZTEA 4HAEA 2A69D 4L5QA 2NVYB 2KJXA 4B3TQ 1EQQA 1CA6A 2RDGA 2O5JC 4JI4Q 3BDOA 1IYJB 4F88A 1B1ZA 4X3SA 1ESRA 4TSSA 3G4SA 3MXUA 4C3JH 2K5DA 2XVSA 1VQ6A 1EWIA 5IP7H 2FFKB 3CQZB 3ERSX 4X3KA 4L6TB 2PNRC 3F8TA 1RL2A 3QR8A 3DEOA 1F9QA 1N9WA 2AKWB 3UDIA 1WTOA 1XMQQ 5FLMG 1LTAD 2K50A 4R9WA 3HOXG 3EIVA 3T51B 5BR8L 2B3GA 3A8KE 4UHVA 3VYSA 1AP0A 1CQVA 2QKIC 1Q82C 1PTOF 4H7BA 4OONA 2I5HA 4A3IB 1F2ZA 4A3FB 2ES2A 2N3SA 3V05A 1VDZA 2UUBL 3MEFA 2N49A 3AB9A 5IYDG 4B9XA 1S5CD 2E2JH 3J80E 2HIXA 1JB7A 2A5HA 1F9RA 1GHJA 1YNJC 3S17B 1Y14B 5HURA 3UDGA 3GTPH 1F9SA 4LW1A 4ZYSA 5IWAQ 2K05A 2F0SA 4JI5Q 4DAYB 1TWFB 2RKSA 4DGZA 3VA7A 5DNFA 3CPWA 1J5EL 5K36H 4YHHQ 3EN2A 4UP8A 3M4OB 4C3IG 1SYGA 2OT2A 3H3VH 4YY3Q 4RKBA 4TQUS 1PXUA 3K58A 5I2YA 4WJWA 5KNBA 4FXGC 5KYIA 3MA2B 5HGTA 4LK1C 1C9OA 1EIFA 1F9PA 3K6OA 5ISRA 3VR2A 3TP7A 2A6EC 1JICA 3KF8A 2WIIB 4K0KL 4N9TA 1W6JA 2Q8TA 4HJ5A 5C0XI 1PH6A 3HOVH 5M3MG 1SJED 2B2TC 2Y0SB 1X3GA 4MNOA 4S3SA 2YU9H 1JC7A 2IHFA 1UEAB 2F3WA 2EIFA 1PRTB 5FO8B 2OF1A 4A3GH 5C5LA 3SE0A 1LT3D 3LWEA 4GNXA 2ZTDA 5FLXL 2P5ZX 3CMEA 4HJ7A 1TIID 1TWCB 1HPCA 3QWNA 4IFDI 1TWAH 2ZM6Q 5LL6S 3L7ZC 4JPBW 2PI2A 2C5CA 4K6LA 2Q2UA 3T1HQ 5CGKA 4RA8A 1Q7YC 1XMOL 2DJFC 4GOPB 1EY0A 4DV6Q 4QUCA 3T56B 1JQYD 1TWHB 2NN6H 2HD3A 4LFAQ 1I3QH 2ZJQA 2NUCA 4CJ1B 3HOYH 5NUCA 2E74C 2VW9A 4A75A 1KRSA 1PLFA 2ALYB 2EYFA 3MXNA 4C1NK 3S16B 5KGUA 2CFMA 2KEEA 1JWSD 2HT1A 4F87A 1S5BD 1UE7A 4K0KQ 3CCJA 3CW2C 3GP7A 5DAUA 1NE3A 1YI2A 5JJZA 2I46A 2UXDQ 4POGA 1YEZA 1AE2A 2B8GA 2EJFC 1TXYA 1BUVT 1PTOD 5KNDA 3GTMB 2QILA 2F0GA 1ET9A 3IKJA 4K6DA 1LYLA 3ONAB 4ME5A 4OO1H 3NK9A 4LF6Q 2JA8H 2F4VL 4ZQ3A 2I5LX 4DFAA 4BWGB 4G4KA 4YCWA 2CW0C 4BY1H 1HRJA 2Z6KA 3F1ZA 1PYBA 1FJGQ 1HZAA 2F0LA 5IT9L 1PRTD 1EL0A 1VQJA 1BNZA 1YITA 3KF8B 3GTOH 2Z4IA 1LTID 2K04A 3I4LA 1QNKA 2F0WA 4X3UA 1BDOA 3PUYA 2AHOB 5E7NA 2KQ3A 3I90A 1YJWA 3QOLA 1CA5A 2HDMA 2I0QA 3U50C 5BN5A 3PO3G 4P74A 1VCIA 1BKBA 4RGMA 3A74A 3RN2A 3J7AV 1OXUA 4OEMB 1X6OA 3FMCA 4A3BH 2ASBA 4JBWA 2RQXA 3S2HB 1D5MC 1D7QA 1BCPF 4G7ZC 1K28A 3QG1A 3OWFA 1GXDC 2L5TA 2VQFL 3T13A 2HCCA 3J81c 2E2IH 5IP9H 2HDLA 4GNXC 1LV9A 2F0KA 1SE3A 3R93A 2F0QA 1CT1D 4I7ZC 4DAPA 3JAMc 1NY4A 1X3PA 1VQCA 5C0XJ 5IIFA 1TS2A 3TEHB 3EA6A 1PFNA 1B53A 1HNWL 3EROA 2ZXRA 1N32Q 3I4NG 2A68D 3JC66 1PTOC 1C48A 3NHHA 1H9SB 5HGQA 4X65L 2LXKA 4DNRB 3I4OA 5J3BA 3RMHA 3OIPA 5CR3A 5EPJA 1Q3LA 3BDCA 3K5OA 4FXKC 4EGVA 3V2TA 1AE3A 4K2LA 2JJQA 4DF7A 2EYMA 5C4JH 4ZCKA 1G6PA 5JEAJ 2B2WC 4BA1I 5EPLA 3M85A 2NN6I 4A3DH 1WCMB 2F0UA 1P16A 2BCOA 2NBFA 3CXCA 4C3HB 3KLWA 2EXZA 5G3LF 3W1GA 4B3SL 4PMWA 3RN5A 2FJ2A 1K73C 1AN8A 2ATWA 4C3JB 1CKOA 4AYBE 2CQOA 2KOLA 4G7OC 2ICEC 4KD3A 1OXSC 3TP6A 1E2ZA 3S1NB 2O5IC 3PIP3 4IOCA 4J8QA 1UUPA 3HOZH 5A2QL 3GD7A 3S17H 4A3GG 2DJGC 2WP8J 4BY7B 4TKOB 1LT5D 4ULLA 4NXNQ 3UDFA 3CCUA 3F2DA 1PZJD 4R4CA 4KV6A 1GD7A 1D5ZC 2OXPA 5CV9A 3L2PA 4A3JG 4JI8L 4LF7Q 2ID0A 1HR0W 3RZOH 4I65A 3UI2A 1PV4A 2EOTA 2DUDA 2F0EA 1W3SA 1SYEA 2DY8A 1ENAA 1EU4A 2WAQG 1GKHA 3HOUG 4K2KA 1SE4A 4X66L 1SFOH 4OX9L 1SMYC 1J6QA 2D9UA 1R4PB 1N36L 1EOTA 4C56C 1E2VA 2ZXPA 4JI4L 5LMNL 2ZT9C 3VYRA 2IX1A 4A3JB 4E6IA 4KD4A 4X64Q 3CCQA 1KDCA 2LFNA 4FXDA 3VR6A 4OELB 4TVAB 1CKMA 1IBKQ 4AQYL 1L1OA 4DV3Q 3C3LA 3KUPA 4DR1Q 1Z9FA 2RSNA 4P75A 4ZK9B 4H13C 2MP1A 1T5XD 1V1PA 2A69C 2XN9C 1X65A 4P73A 5C44G 3S2DB 3IAYA 1WCMH 1IXRA 3MFGA 1U4LA 4DV1L 4UDUC 4IO9A 3VA5A 4H0LC 3LGJA 2X69A 3NBHB 2L55A 2A74C 2PQEA
chains in the Genus database with same CATH topology
1QCBD 3EFXD 3A54A 4FF4A 2XRSD 1EY4A 5C0XH 5EBDA 2I07B 3K5LA 2B2TA 3A7LA 1ILQA 3OOCA 5K5PA 2NVTB 2D5DA 1H9KA 5C4XB 1CK1A 1I6VC 1TWAB 3QO2A 4FF3A 1BCPB 3A8IE 1OXTA 1J9OA 3P20A 1EIGA 1BOSA 2F0PA 3D3RA 1UNSA 2EJMA 3WOFA 1NSNS 3LNNA 1SFOB 4XIGS 1QJOA 1MSGA 5JOBA 2QDBA 1Y8NB 4H44C 1JR0D 1S5DD 1SAPA 1NR2A 4DK1A 1LLRD 2PO4A 2B2YC 4IALA 2IT1A 2K28A 1GUSA 3BVMA 1R4QB 1EWHA 3E5SA 3HKZB 3OSOA 4KKUA 3SXHA 4B9WA 2JA8B 1EYDA 3NE5B 3H94A 1O7LA 3M7NA 4CJ2C 4FF1A 4HSPA 3LWUA 2IW3A 1LABA 5CV8A 1RTOA 5EBCA 3CKIB 5M3FB 4RCNA 1WTQA 4IUPA 5I9PA 1RCVD 2F03A 4HMIA 3X3MA 2XRQD 4GZYC 2IWHA 4X3TA 1U4PA 1YNNC 5I2XA 3I91A 3TP5A 5IGDA 3G6JB 2KCNA 1BCPC 1B9MA 1PZID 3DEPA 3FKIB 1L0YB 3NUCA 1B2TA 2L0CA 1G6ZA 4L63B 4RHRA 1FR3A 1C8CA 3RLFA 2XSCA 2F0IA 5C0XG 4PQXA 1UAPA 3W2DA 1STHA 5A35A 2CVRA 3HGBA 5D3IB 2JEAI 2YU9B 5CMDA 2WV6D 3ITPA 1D5XC 1D2BA 2AQ1B 3MXGA 2M9VA 1KDBA 1T5EA 1VF5C 3JAML 2B2YA 5JVG3 2M2LA 4MIUA 4LAAA 1PTOH 5IOCA 3CU7A 4XXEA 1Q8IA 1FD7D 1SEBD 5E1FA 1QOHA 1E2WA 1I3QB 1TT2A 3C46A 3TZUA 5JAVA 5J22A 4NP5A 3NPPA 3A8JE 3MZ5A 1STNA 2XNAC 1A3VA 1S5ED 1TY0A 4OIKA 3HEJA 5EKIA 2WKCA 3C2PA 3TSSA 4CKCA 4ZKBB 2F0VA 2EYOA 5KRUA 2B2UC 5EJWA 2PCFB 4MN3A 3S14B 3HOXB 1RKNA 3Q24A 2LKVA 1JCKB 4RFBA 3DHQA 1FGBD 4J1MA 4K5XA 5JVH3 3ND8A 1DOLA 5LL6X 1PZKD 1SYCA 2FMCA 3K57A 3NQTA 1DM0B 1CM9A 5IGEA 5FK9C 1Z6HA 3NP8A 2EE1A 4XQQA 1SNPA 2A6ED 5LHY1 3TDQA 5EGTA 1JOQA 2A6HC 1PRTC 1QNUA 5C5MA 5A2QE 1Y1WB 3NQIA 2HUGA 1SXTA 5C4JB 2NN6G 3RUZA 4CBVA 4BY1B 1HA6A 4KKSA 1HQRD 3LX0A 2V4DA 3PUVA 2WINB 3I72A 2Q8IB 2PW7A 1LT4D 2BA1A 2EY2A 3NBHA 1HFGA 4K8IA 3DXJC 5IGCA 3GTQB 5COYA 1WTWA 1EZ6A 1G291 3FEWX 2E76C 4HEDA 1BR9A 2FINB 4KJOA 1KLUD 5DM63 4RWSC 1HFNA 5T1IA 2B2UA 2F0NA 2RDFA 4XYQA 3DWQA 1ENCA 4DAYA 2G9DA 3Q23A 4DAVA 4OL7A 3KBXA 1ILPA 3NTHA 1ENFA 4KY6A 2B39A 5C3EB 1FNUA 1G8ZD 5JPNC 2KEDA 3D6WA 1LO5D 4QB4A 3M4YA 3I4MB 5C6AA 3SEBA 1HA5A 3KLSA 2SNMA 3Q6SA 1RJTA 4IFDH 4RCOA 1ICWA 1B4OA 1TS5A 2R3ZA 2K01A 3FVQA 1Z47A 1AW7A 3VR3A 5T1GA 3DUZA 3J81E 3FPUB 3HZXA 2F0OA 5FKAC 1IYVA 2PMZB 4PNYA 3S9WA 1HXYD 1SDFA 1DCZA 1NAPA 1KAAA 1B44D 2FMMA 3H3VC 5FOBB 1DYQA 3QOJA 1IYUA 2E2JB 1LTBD 3I8ZA 3PIO3 1VMPA 2H1EA 2JXMB 3D31A 1I4GA 2EDGA 1H9SA 1LTRD 2E2DC 4IFDJ 1CQFA 2D2CC 1FYCA 1RF2D 4ZRZA 1JORA 1Y8OB 2IX3A 1O80A 3FRPB 1TVXA 3HOUB 5IGBA 2WAQB 3A7AB 2N88A 2R93B 3P75A 5E4XA 2BOSA 2BDOA 5G3LD 4C3IB 3FDTA 3MHBA 5JEAH 1U4MA 2KUMA 1EIHA 3SK4A 1MBYA 1MI2A 2EJGC 2PW5A 1BO0A 3HOVB 3S15B 2Z4HA 5FLXE 3SK8A 1NCVA 4B08A 4IUTA 3SVMA 1AZQA 1A6XA 5D3DA 4HCEA 4IN3A 1SJHD 4MHEA 2NTTA 5CV7A 4IZ8A 1JE4A 4Q5VA 1QILA 3VR4A 1OO9B 3MAQA 2EVBA 2K32A 2NVXB 3DMUA 3HOYB 4DK0A 4HR7B 4NDXA 2X6GA 1A3TA 2D62A 1B9NA 1IW7C 3QJYA 3BVGA 3I4NB 4V0BA 1CTMA 2L11A 4DNTB 4P2CB 4ID6A 3K59A 5EKLA 2R61A 4IQZA 1GHKA 2PZTA 2BA0A 4NMZA 1HQMC 2F0TA 5E3FA 4C1NI 4KK7A 5CC4A 2G9HD 4HN7A 2HQEA 3HS0C 2R6GA 3CRLC 1TKWB 1GUGA 3L3OC 4EVOA 2F1MA 4NKLA 5ELCA 1QWYA 3K0YA 3GTOB 3GTGB 3PO3B 1ESFA 2L4NA 1EYAA 2ENBA 3TP8A 2M00A 2NTSA 2OEOA 2AWOA 1I4XA 1CI3M 1XTCD 4EQNA 3HOWB 3VYTA 1V8QA 1X32A 1STGA 4PMBA 1X3QA 4RHSA 1Y1VB 3OMCA 1ET6A 2AWNA 2VB2X 2AQ3B 3R8BA 1GOZA 1SNOA 3D4WA 1HCZA 2SEBD 4Y7NB 1J8IA 3Q0AA 3D4RA 2BDNA 4PV1C 3GTPB 5BN3A 2K1BA 3J7YW 3OHXC 1KTKA 2IPKD 1O78A 1AZPA 1STAA 3BZDB 4OO1G 4XQNA 1DJRD 1Q1BA 3HRZC 4FYDA 1Q1EA 1I4QA 3TBIB 1SNQA 5C4HA 1IKMA 5D65A 2JA7B 1EFID 1ZKOA 1Q12A 3NTIA 3H6MA 1KABA 1TS4A 2YYZA 1I4PA 2JA6B 1WTPA 2MUYA 3T4AC 2H4OA 2Z1CA 3NXWA 2DNCA 4CJ0B 5CV6A 3HOZB 3K7AB 1TY2A 5IT9E 1WTVA 3OIQA 4DA2A 3VR5A 3I70A 4K14A 1ZEQX 2BE5D 4ZUIA 1A2TA 3MTSA 1SNMA 3WOEA 2EZVA 2E2IB 2MHVA 5C44B 1IL8A 1I4RA 4QF4A 4XTCS 1D1IA 1HUNA 3M7GA 2NWGA 5ELBA 2K5QA 3MVVA 1HTLD 4EQPA 4DXGA 5ELFA 3HG9A 3BS1A 1SYFA 4IFDG 1V1PB 1EYCA 5K36G 1WTRA 3GV6A 3EJIA 1EQTA 2X6LA 1EY8A 1AEXA 3OPOA 1IHZA 5AFWA 2EYPA 1QE6A 2MJ8A 1ZXTA 3URYA 1RODA 2Q8RE 1PYWD 2KVMA 3X3NA 4HCSA 1WD0A 3PUZA 4KN7C 4BBRB 2K6AA 3G7LA 4FF2A 3SHLA 3KLSX 1LACA 2J0TD 4A3GB 5M5YB 2NVQB 1EQVA 2MPMA 3D4DA 2A73B 1JOOA 3DWAA 4IURA 3TMEA 4G7HC 4KMUC 4O42A 3TN2A 4R8IA 4C3JG 1PTOB 5IODA 4QUFA 1EY5A 2LY7A 2K7VA 4QMGA 4C3HG 4ODGA 1BCPD 4ZLTF 4FVMA 1JWMD 2CHBD 1U4RA 1F2LA 2KECA 3BYYB 4C2MB 2QEJC 1JB3A 2F0JA 2RSOA 5IGGA 2SNSA 4EQOA 4CKEA 1K8MA 1EY7A 4J6HA 4OGQC 1CZWA 3NWSA 4Q0FA 3T53B 1S4ZA 3GV3A 4ILWA 4KTAA 4DXFA 2EY1A 4N9PA 2F3VA 5I6YA 1L0XB 5C4ZA 3BYTB 4F8MA 5CORA 4DU9A 2IJ0A 2A6HD 4XT3B 1TR5A 2KHSA 1HHVA 3PMFA 1H9JA 4AYBB 1JOKA 2PPBC 4A3EB 2IX0A 2KCCA 1SYDA 5JPMC 1EY6A 2WB1B 1IW7D 4ZUJA 1F2MA 3MWYW 2F0DA 2VUMB 3NWTA 1CZGA 4LJZC 2FHTA 1XYIA 3O13A 1EY9A 2XWJB 2EY5A 1F2YA 4U673 4R8NA 4OO1I 2LS01 4KHVA 3I73A 2MGSA 4G57A 2AQ2B 2E2HB 3P1HA 1OXXK 1H9RA 1RHPA 1A2UA 1EWCA 4A3KB 4RAUC 2L9HA 1JWUD 1GUOA 3MC0B 4HTHA 1TU2B 4M8AA 1OXVA 5C3WA 3HP3A 4V190 1BQQT 4XQJA 4WFN3 3Q22A 2CQAA 4IUVA 3NBIA 3PO2B 1BXTA 1F77A 1QB5D 3H91A 3TZDA 4M1UB 2ZXOA 1EU3A 4WRDA 3K5MA 3EVQA 1ML0D 3PUWA 1G91A 1DOKA 4O1NA 3KK7A 1M8AA 4HSVA 5M3MB 4XT1B 2WACA 4K5VA 2J7ZA 5M9OA 4RGNA 5JEAG 3QIAA 2ICIA 3A55A 5CYUA 2QF7A 4F7XA 1NR4A 3I3CA 3E6ZX 1TS3A 1RDPD 3GTJB 3GQBA 3J81L 2K03A 4BS9A 1EEID 1HTPA 5C3XA 3S1QB 1PFMA 1Y8PB 5J1ZA 4JK1C 4TRDA 1MD2D 2N55A 3C1EA 1A15A 3JAME 1TWGB 3VYUA 1STEA 2VXWA 3PUXA 2B8FA 4NW2A 3L9AX 2B2VC 1GJXA 3E0JA 2JEBI 2B63B 1CHQD 2TMPA 2K5WA 1GUNA 2PZUA 2PYKA 4OIJA 4UAIA 2PZWA 3N6RA 1C4QA 2SDFA 5EKKA 2XWBB 2L1BA 1S5FD 3NSWA 5KEEA 4A3DB 4BBSB 3MXPA 4XYOA 5KIXA 4K5WA 4ZAIA 2AUJD 5CBAE 2SOBA 3W3AA 2NYZD 2QCPX 3ERQA 1KNEA 5M5WB 3ZYYX 5I9OA 1O7ZA 1A3UA 2BE5C 4IUUA 2CW0D 2K33A 5CV5A 4QCLA 2DY7A 3M3YB 2RDHA 3KLRA 3MFYA 3OWEB 2LMCB 3ND9A 1K8OA 1XXGA 1SBBB 2AUKA 1U9RA 3FPPA 1IKLA 4L8JA 3U9SA 1TQOA 4K8JA 2L12A 5M5XB 2JYOA 5IGFA 5CBEE 1M4VA 5FO7B 1EEFD 1RD9D 2F0MA 3T16A 1STBA 1QG7A 1VF7A 1YNJD 1SMYD 1CHPD 3H09A 2C9OA 3KBGA 4RGTA 1EZ8A 2B2VA 3R2TA 4KN4C 4YIJA 5DM73 2EY6A 1DOMA 4A3MB 4ZKCB 5D14A 3AU7A 1SE2A 3K5NA 5KNCA 1KDAA 3AMUA 3C1FA 1H9MA 2VNUD 1B50A 1G2SA 4CKBA 2EYJA 1PMRA 3H0GB 4KY5A 5DEHA 3D8GA 2HCIA 4KJNA 1D1KA 4FP5D 1DD2A 3OW7A 1SSOA 4CGYB 1K83B 4IUQA 1GUWA 3NTKA 1SYBA 1MSHA 4IUNA 5FO9B 4U68A 2DN8A 2O2LD 3RZOB 2GA4B 1D6EC 2F0FA 1VMCA 5EPKA 4FNFA 1YNND 4KKTA 4PMCA 1AFPA 5I6WA 1Z7TA 4HMJA 4ABNA 2JP1A 2XIWA 1XWEA 4KI0A 2NZ1D 3U9OA 4BA2I 2F4IA 1LTGD 1KNAA 3SR1A 2VB3X 1WD1A 4XDXA 5ELEA 2RBMA 2Z8LA 1PDQA 3IL8A 4Z9CB 1MGSA 3DM1A 1SNDA 1HUMA 1LT6D 3WDNA 2EYLA 5CV4A 1ZYRD 4QIWB 3IFTA 3J7AF 3DWPA 1O7YA 3D6CA 1FNWA 3PV0A 1KLGD 1WTXA 3A56A 3GO5A 5J39A 4RKLA 2JSOA 3SDZA 3R2IA 5ELDA 4DN4M 3N52A 3MEHA 2EPBA 1BF4A 1V43A 3IFDA 2EYHA 5E4WC 3BG3A 2KA7A 5TSSA 1RTNA 2R7ZB 2DNEA 2J4XA 3P7JA 1PRTF 4RH6A 5KYLA 2IL8A 4KY7A 3SK6A 1GUTA 1V1OA 4A93B 5EQ0A 3CHBD 4LMQD 1Y69U 1ZYRC 2E75C 1NUCA 3SK5A 1WVLA 1DZ1A 1STYA 1I50B 1PFBA 3GTKB 5BN4A 3BDLA 3S1RB 2RA4A 2A68C 1E0BA 1SNCA 1I6HB 1W6KA 3OMGA 1B3AA 2O4XA 1II3A 3BVZA 5F2DA 2F0HA 1CFMA 3RD4A 3S1MB 3CRKC 2TSSA 3RZDB 4RGOS 4KHZA 3QB3A 1G2TA 1R9TB 3J80L 1I4HA 3V96A 1BBXC 1LTTD 3EQLC 2JA5B 2R92B 1FNVA 2RVLA 5I4DA 4FO2A 1DONA 1LTSD 4CHTB 1Q90A 1ONLA 4A3BB 2NB0A 4WORA 2WKDA 2JE6I 2B2WA 3GTLB 4OHJA 1DXMA 3R3OA 3F2UA 1XX8A 4HAEA 2A69D 2NVYB 2KJXA 1CA6A 2RDGA 2O5JC 3BDOA 4F88A 1B1ZA 4X3SA 1ESRA 4TSSA 3MXUA 2K5DA 2XVSA 2FFKB 3CQZB 4X3KA 4L6TB 2PNRC 3DEOA 1F9QA 1WTOA 1LTAD 4R9WA 3T51B 3A8KE 3VYSA 1AP0A 1CQVA 2QKIC 1PTOF 4H7BA 4A3IB 1F2ZA 4A3FB 3V05A 1VDZA 3AB9A 4B9XA 1S5CD 3J80E 2A5HA 1F9RA 1GHJA 1YNJC 3S17B 5HURA 1F9SA 4ZYSA 2K05A 2F0SA 1TWFB 2RKSA 4DGZA 3VA7A 5DNFA 5K36H 3M4OB 4C3IG 1SYGA 2OT2A 4RKBA 4TQUS 1PXUA 3K58A 5I2YA 4WJWA 5KNBA 4FXGC 5KYIA 3MA2B 5HGTA 4LK1C 1F9PA 3K6OA 5ISRA 3VR2A 3TP7A 2A6EC 1JICA 3KF8A 2WIIB 4N9TA 1W6JA 2Q8TA 5C0XI 1SJED 2B2TC 2Y0SB 4S3SA 1JC7A 1UEAB 2F3WA 1PRTB 5FO8B 2OF1A 5C5LA 3SE0A 1LT3D 3LWEA 5FLXL 1TIID 1TWCB 1HPCA 3QWNA 4IFDI 5LL6S 3L7ZC 2C5CA 4K6LA 5CGKA 4RA8A 1EY0A 4QUCA 3T56B 1JQYD 1TWHB 2NN6H 2NUCA 4CJ1B 5NUCA 2E74C 1PLFA 2EYFA 3MXNA 4C1NK 3S16B 5KGUA 2KEEA 1JWSD 4F87A 1S5BD 3GP7A 5DAUA 5JJZA 2I46A 2B8GA 2EJFC 1BUVT 1PTOD 5KNDA 3GTMB 2QILA 2F0GA 1ET9A 3IKJA 4K6DA 3ONAB 4ME5A 4OO1H 3NK9A 4ZQ3A 4DFAA 4BWGB 4G4KA 2CW0C 1HRJA 5IT9L 2F0LA 1PRTD 1EL0A 1BNZA 2Z4IA 1LTID 2K04A 3I4LA 1QNKA 2F0WA 4X3UA 1BDOA 3PUYA 2KQ3A 3I90A 3QOLA 1CA5A 2HDMA 5BN5A 1VCIA 4RGMA 3J7AV 1OXUA 3FMCA 4JBWA 2RQXA 3S2HB 1D5MC 1BCPF 4G7ZC 3QG1A 3OWFA 1GXDC 2L5TA 3T13A 2HCCA 2HDLA 1LV9A 2F0KA 1SE3A 3R93A 2F0QA 1CT1D 4I7ZC 4DAPA 1X3PA 5C0XJ 5IIFA 1TS2A 3EA6A 1PFNA 1B53A 3EROA 2ZXRA 2A68D 3NHHA 1C48A 1PTOC 1H9SB 4DNRB 3RMHA 3OIPA 5CR3A 5EPJA 1Q3LA 3BDCA 3K5OA 4FXKC 4EGVA 3V2TA 4K2LA 4DF7A 2EYMA 5JEAJ 2B2WC 4BA1I 5EPLA 3M85A 2NN6I 1WCMB 2F0UA 2BCOA 2NBFA 4C3HB 2EXZA 5G3LF 4PMWA 2FJ2A 1AN8A 4C3JB 2KOLA 4G7OC 2ICEC 4KD3A 1OXSC 3TP6A 1E2ZA 3S1NB 2O5IC 3PIP3 4J8QA 1UUPA 5A2QL 3GD7A 2WP8J 4BY7B 4TKOB 1LT5D 4ULLA 1PZJD 4KV6A 2OXPA 1D5ZC 5CV9A 2ID0A 4I65A 3UI2A 2EOTA 2F0EA 1SYEA 2DY8A 1ENAA 1EU4A 4K2KA 1SE4A 1SMYC 2D9UA 1R4PB 1EOTA 4C56C 1E2VA 2ZXPA 2ZT9C 3VYRA 2IX1A 4A3JB 4E6IA 4KD4A 1KDCA 2LFNA 4FXDA 3VR6A 3C3LA 3KUPA 2RSNA 4ZK9B 4H13C 2MP1A 1T5XD 1V1PA 2A69C 2XN9C 3S2DB 3IAYA 3MFGA 1U4LA 4UDUC 3VA5A 4H0LC 2X69A 2L55A 2A74C 2PQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NMZ A;  3V2T A;  4K2L A;  5I6W A;  4DF7 A;  5KGU A;  2EYM A;  2F0T A;  1SNC A;  5IOD A;  4K8I A;  5J1Z A;  5E3F A;  1EY4 A;  1F2Z A;  4HMJ A;  5IGC A;  5CC4 A;  4G57 A;  3TP5 A;  3OMG A;  1EY5 A;  5IGD A;  4TRD A;  3NXW A;  2F0U A;  1U9R A;  4QMG A;  1EZ6 A;  5DAU A;  4K6D A;  2HQE A;  4B9X A;  2EXZ A;  4DGZ A;  2F0V A;  3C1E A;  2O4X A;  3U9O A;  1II3 A;  1TQO A;  4K8J A;  4ODG A;  3P1H A;  3NUC A;  4KJO A;  1JOR A;  2EYO A;  5CV6 A;  4EVO A;  5IGF A;  4KD3 A;  5F2D A;  5K5P A;  5KRU A;  2F0H A;  4NKL A;  4KHV A;  5HUR A;  3SR1 A;  2F0M A;  5IGB A;  4K14 A;  2F0J A;  1A2U A;  1RKN A;  1STB A;  2ENB A;  1EYA A;  2F0S A;  2F0G A;  2F0N A;  2RBM A;  1A2T A;  2F0I A;  2RDF A;  2M00 A;  2RKS A;  1ENC A;  4ME5 A;  1SNM A;  1SND A;  2LKV A;  2OEO A;  3TP6 A;  3NK9 A;  3QB3 A;  1EY7 A;  4ZQ3 A;  1STH A;  4DFA A;  3DHQ A;  3MHB A;  1EZ8 A;  4J1M A;  2F0P A;  4J6H A;  4OL7 A;  3SK4 A;  2EYL A;  4K5X A;  4EQN A;  5CV4 A;  1SYG A;  2PW5 A;  4QF4 A;  2F0L A;  4HTH A;  1NSN S;  4YIJ A;  1STG A;  4KY6 A;  2EY6 A;  4RKB A;  3D6C A;  4PMB A;  5C3W A;  3SK8 A;  4KTA A;  5KYI A;  5JOB A;  2EY1 A;  5HGT A;  5J39 A;  4N9P A;  2F3V A;  4QB4 A;  4RKL A;  4WOR A;  2QDB A;  3MVV A;  2F0W A;  1SYC A;  2PZU A;  5I6Y A;  1KDA A;  3ITP A;  5ISR A;  2PYK A;  4KV6 A;  4EQP A;  3OMC A;  3TP7 A;  5C4Z A;  2KQ3 A;  2OXP A;  3NQT A;  3MEH A;  5CV9 A;  3C1F A;  4F8M A;  5C6A A;  2SNM A;  1SYF A;  4I65 A;  4DU9 A;  5IGE A;  1KDB A;  3QOL A;  4N9T A;  4IAL A;  1EYC A;  2F0E A;  1SYE A;  2PZW A;  2EYH A;  1ENA A;  1SNO A;  3D4W A;  3EJI A;  3R3O A;  4K2K A;  1TR5 A;  4WRD A;  3EVQ A;  4S3S A;  2KHS A;  5CV7 A;  5EKK A;  2EYJ A;  3NP8 A;  1EY8 A;  1AEX A;  4IZ8 A;  4LAA A;  4MIU A;  2F3W A;  1IHZ A;  3PMF A;  5IOC A;  2EYP A;  5KYL A;  1JOK A;  1SNP A;  3E5S A;  5KEE A;  1SYD A;  2OF1 A;  3OSO A;  4KY5 A;  1EY6 A;  5EGT A;  5C5L A;  2WAC A;  4KY7 A;  5DEH A;  3D8G A;  1JOQ A;  3SXH A;  4ZUJ A;  3OWF A;  4K5V A;  4KJN A;  4B9W A;  1F2M A;  3MXP A;  4E6I A;  3DMU A;  3HZX A;  4KD4 A;  3SK6 A;  2F0O A;  5E1F A;  1EYD A;  5KIX A;  1KDC A;  5M9O A;  4PNY A;  3T13 A;  4K5W A;  2F0D A;  3S9W A;  1STA A;  2SOB A;  2F0K A;  4NDX A;  1TT2 A;  2F0Q A;  5C5M A;  1KAA A;  1A3T A;  3ERQ A;  3P75 A;  1NUC A;  5I9O A;  5CV8 A;  4F7X A;  3SHL A;  3SK5 A;  4PMC A;  5JAV A;  5J22 A;  5IIF A;  1STY A;  1SYB A;  4NP5 A;  1SNQ A;  5C4H A;  5CGK A;  4IUN A;  3TP8 A;  1A3U A;  3RUZ A;  3MZ5 A;  4ZUI A;  1EQV A;  3ERO A;  3D4D A;  2SNS A;  3QOJ A;  5IGG A;  1EY0 A;  1STN A;  1JOO A;  1A3V A;  3NHH A;  1EY9 A;  5I9P A;  2EY5 A;  3VA5 A;  2NUC A;  3T16 A;  3BDC A;  4ID6 A;  5NUC A;  2F0F A;  4HMI A;  3LX0 A;  1F2Y A;  5CV5 A;  3TME A;  4EQO A;  5C3X A;  3HEJ A;  4R8N A;  3H6M A;  3BDL A;  5EKL A;  2PZT A;  2EYF A;  2PW7 A;  1KAB A;  5CR3 A;  2EY2 A;  2PQE A;  4H7B A; 
#chains in the Genus database with same CATH topology
 1QCB D;  3EFX D;  3A54 A;  4FF4 A;  4JI6 L;  2XRS D;  1EY4 A;  3DLL A;  4DAM A;  3J7A 5;  5C0X H;  5EBD A;  2Q2H A;  3RLN A;  2I07 B;  3K5L A;  2B2T A;  3A7L A;  1ILQ A;  1FVI A;  3OOC A;  5K5P A;  2NVT B;  2D5D A;  4DUZ L;  1H9K A;  1VQF A;  4L5T A;  5C4X B;  1CK1 A;  1I6V C;  1TWA B;  3QO2 A;  4FF3 A;  1PFS A;  5M3M H;  4FDB A;  1BCP B;  3A8I E;  1OXT A;  1J9O A;  1K8A C;  3P20 A;  5IY0 A;  4LF7 L;  1EIG A;  1BOS A;  2F0P A;  3D3R A;  3JAM i;  2E5L L;  1UNS A;  2EJM A;  3WOF A;  4L5R C;  1NSN S;  2C35 B;  3LNN A;  1SFO B;  4NXN L;  1IL2 A;  1WYD A;  4XIG S;  1QJO A;  1MSG A;  5JOB A;  3A5Z B;  2QDB A;  1Y8N B;  4H44 C;  1JR0 D;  1S5D D;  1SAP A;  1NR2 A;  4DK1 A;  3VDY A;  1LLR D;  2PO4 A;  2B2Y C;  3G48 A;  4IAL A;  1JJG A;  2MO1 A;  2QEX A;  1WTH A;  2VQE L;  2IT1 A;  4DUY Q;  2K28 A;  1GUS A;  1W2B A;  3BVM A;  1R4Q B;  2Z0S A;  1EWH A;  3E5S A;  3GTG H;  3HKZ B;  3A5U A;  1SRU A;  4GNX B;  3OSO A;  4KKU A;  3CCL A;  3SXH A;  4B9W A;  2JA8 B;  2K14 A;  1KIX A;  1EYD A;  3NE5 B;  3H94 A;  1O7L A;  3M9B A;  3D0F A;  5M3F G;  1E3P A;  2JN4 A;  2R7D A;  3M7N A;  4CJ2 C;  4QIW E;  2E8G A;  4FF1 A;  4HSP A;  1Y1V G;  2KCM A;  3LWU A;  2IW3 A;  1LAB A;  5CV8 A;  1L1O C;  3S2H H;  1RTO A;  5EBC A;  3CKI B;  5M3F B;  1K0S A;  4RCN A;  3H3V I;  1WTQ A;  2Z6K C;  4IUP A;  5I9P A;  4OXP A;  1RCV D;  4DR2 Q;  2F03 A;  4HMI A;  3X3M A;  2XRQ D;  1Y1W G;  4GZY C;  2IWH A;  4X3T A;  1U4P A;  1YNN C;  5I2X A;  3I91 A;  3TP5 A;  1HNZ Q;  5IGD A;  2VZA A;  3G6J B;  2OQK A;  2KCN A;  1BCP C;  1B9M A;  1PZI D;  3DEP A;  3FKI B;  1L0Y B;  1YHB A;  3NUC A;  1B2T A;  2L0C A;  1G6Z A;  4L63 B;  2OCE A;  1PH1 A;  4RHR A;  1FR3 A;  1C8C A;  3RLF A;  2XSC A;  3SGI A;  1EQR A;  4A3L G;  2F0I A;  5C0X G;  4PQX A;  1UAP A;  4DV7 Q;  3W2D A;  1QUQ B;  1STH A;  5A35 A;  1KL9 A;  2CVR A;  3HGB A;  2OWO A;  4B3R L;  5D3I B;  2KHJ A;  2JEA I;  3CCV A;  2YU9 B;  5C4X G;  1B3Q A;  2Q2I A;  4RG1 A;  5CMD A;  3CCM A;  2WV6 D;  2JA6 H;  3ITP A;  3S1N H;  1D5X C;  4IPD A;  1D2B A;  3J80 i;  2AQ1 B;  3MXG A;  2M9V A;  1KDB A;  3L0O A;  1EUJ A;  1T5E A;  2F52 A;  2HHH Q;  3AYH B;  1N34 Q;  1E1T A;  1VF5 C;  3JAM L;  1HNX Q;  2B2Y A;  5JVG 3;  3M3Y H;  2M2L A;  4MIU A;  4LAA A;  1IBM L;  1PTO H;  3S1M H;  4LUO A;  5IOC A;  2UXD L;  3DM3 A;  4KHP Q;  3CU7 A;  4XXE A;  1WI5 A;  1Q8I A;  1FD7 D;  1SEB D;  5E1F A;  1QOH A;  2RCF A;  4WJ4 A;  4JI6 Q;  1E2W A;  2L15 A;  1I3Q B;  4DV7 L;  4Y7N H;  2PQA B;  1HNZ L;  1TT2 A;  3C46 A;  4LFC L;  3TZU A;  3W5O A;  4C2M H;  3CC7 A;  4LF4 L;  4QJF A;  4JBJ A;  5JAV A;  5L37 A;  5J22 A;  4NP5 A;  4A3J H;  3NPP A;  3A8J E;  3MZ5 A;  4LFB Q;  1STN A;  2XNA C;  1A3V A;  1S5E D;  3T1H L;  1WJJ A;  1TY0 A;  4OIK A;  2K5N A;  3HEJ A;  3KFU A;  2R93 G;  5EKI A;  2UUA L;  1X3F A;  4UP9 A;  1ASZ A;  2WKC A;  3C2P A;  5IYC G;  1L0W A;  3TSS A;  4CKC A;  1KHI A;  4ZKB B;  1SRO A;  4ME3 A;  1X3E A;  4BXX H;  2F0V A;  2EYO A;  3KYH C;  4NXM Q;  5KRU A;  2OTL A;  2B2U C;  5EJW A;  2PCF B;  1YZ6 A;  1N33 Q;  3PCO B;  4MN3 A;  3S14 B;  1RKN A;  3Q24 A;  3HOX B;  2WB1 E;  2LKV A;  2NVX H;  1M1K C;  1JCK B;  4RFB A;  4YCV A;  3DHQ A;  3S2D H;  4DR3 L;  1FGB D;  1A62 A;  4J1M A;  1SN8 A;  4J15 A;  4K5X A;  4L5S A;  1NMF A;  1U5K A;  2R7Z H;  5LMN W;  5JVH 3;  3ND8 A;  1DOL A;  2K4K A;  4YWM A;  4YY3 L;  4DV1 Q;  5LL6 X;  1PZK D;  1SYC A;  2FMC A;  4BXX G;  3OYY A;  3K57 A;  1Q86 C;  3NQT A;  1DM0 B;  1CM9 A;  5IGE A;  5FK9 C;  4GS3 A;  1Z6H A;  4NPS A;  1PH3 A;  1AH9 A;  1KXL A;  4JYA Q;  3NP8 A;  2NVT H;  2EE1 A;  1QUQ A;  4XQQ A;  4MTK A;  1SNP A;  2A6E D;  5LHY 1;  1XPO A;  4B3S Q;  1Q8K A;  3I4N H;  3I4M H;  3TDQ A;  5EGT A;  1JOQ A;  1HZ9 A;  2JA9 A;  2A6H C;  2UUB Q;  1VS0 A;  1K3R A;  4A3B G;  3GTK H;  4IPG A;  5DLQ E;  3HFZ B;  1EOV A;  1PRT C;  1QNU A;  5C5M A;  5A2Q E;  2R92 G;  1Y1W B;  3F2C A;  4A3M H;  3NQI A;  2HUG A;  1SXT A;  5C4J B;  4OWW B;  1CUK A;  1N32 L;  2NN6 G;  3RUZ A;  4CBV A;  1QVG A;  3W1B A;  4BY1 B;  1XMQ L;  1HA6 A;  4KKS A;  4C3H H;  4OWT B;  2RHS B;  4JOI A;  4JI0 Q;  4GKK Q;  1HQR D;  3KF6 A;  3LX0 A;  3ULL A;  2V4D A;  3PUV A;  4BBR H;  2WIN B;  3I72 A;  2PW7 A;  2Q8I B;  5M5W H;  1LT4 D;  2BA1 A;  2EY2 A;  3NBH A;  2FXQ A;  4JYA L;  3PO3 H;  1HFG A;  1JE5 A;  4K8I A;  3S14 H;  3DXJ C;  5IGC A;  3GTQ B;  5COY A;  2JA8 G;  1WTW A;  1EZ6 A;  1G29 1;  3FEW X;  2E76 C;  3HKZ G;  4HED A;  1BR9 A;  2FIN B;  2KBN A;  4KJO A;  3TRE A;  4DR5 Q;  4BY7 H;  1KLU D;  5DM6 3;  4QL5 A;  4RWS C;  1HFN A;  5T1I A;  1GO3 E;  3J81 j;  2B2U A;  2F0N A;  2RDF A;  4XYQ A;  3DWQ A;  1XNQ L;  1ENC A;  5IT9 c;  4AQY Q;  2E5L Q;  4DAY A;  2G9D A;  5M3F H;  4R4Q A;  3Q23 A;  4DAV A;  4A3L H;  4OL7 A;  3KBX A;  1ILP A;  3NTH A;  1VQN A;  1ENF A;  4KY6 A;  2B39 A;  5C3E B;  1KRT A;  1FNU A;  1G8Z D;  5JPN C;  2KED A;  3D6W A;  1LO5 D;  4QB4 A;  4NB3 A;  3U58 A;  3M4Y A;  1HNW Q;  3I4M B;  5C6A A;  3SEB A;  1HA5 A;  3KLS A;  2SNM A;  3Q6S A;  1RJT A;  2E2H H;  4PZ6 A;  4IFD H;  4RCO A;  1ICW A;  1B4O A;  1TS5 A;  1VQ4 A;  2R3Z A;  2K01 A;  3FVQ A;  5ELN A;  1Z47 A;  1AW7 A;  3VR3 A;  5T1G A;  3DUZ A;  1V1Q A;  3J81 E;  3FPU B;  3HZX A;  2F0O A;  5FKA C;  1IYV A;  2PMZ B;  4PNY A;  3CCE A;  1KD1 C;  3U4Z A;  3S9W A;  1HXY D;  1SDF A;  1DCZ A;  1NAP A;  1KAA A;  1XPU A;  1B44 D;  2OQ0 A;  2FMM A;  4DR1 L;  4DV3 L;  3CMA A;  3H3V C;  5FOB B;  1DYQ A;  1E24 A;  1FL0 A;  2RF4 A;  3QOJ A;  1IYU A;  1PH7 A;  2E2J B;  1YHA A;  3E0E A;  1LTB D;  3I8Z A;  3E3X A;  3K7A H;  1VQL A;  4LUV A;  1K0R A;  3PIO 3;  1VMP A;  1NMG A;  2H1E A;  2JXM B;  3D31 A;  1I4G A;  1N36 Q;  2EDG A;  1H9S A;  1XPR A;  1LTR D;  2Y0S G;  2E2D C;  4IFD J;  1CQF A;  2D2C C;  1U0L A;  1FYC A;  1RF2 D;  2UU9 L;  4WJ3 M;  4ZRZ A;  1JOR A;  2UXB L;  1Y8O B;  2IX3 A;  4JI3 L;  1FGU A;  1O80 A;  3FRP B;  1HZC A;  4R4O A;  1TVX A;  3F2B A;  1OTC A;  3HOU B;  5IGB A;  2WAQ B;  3A7A B;  2N88 A;  4JW0 A;  2R93 B;  3P75 A;  1X55 A;  5E4X A;  1VQ9 A;  4B3R Q;  2A1A A;  2BOS A;  1XJV A;  2BDO A;  5G3L D;  3ULP A;  4C3I B;  3FDT A;  4DV4 Q;  3MHB A;  5JEA H;  1U4M A;  3PSI A;  2KUM A;  3ZJY C;  1YIJ A;  1EIH A;  3SK4 A;  1MBY A;  1MI2 A;  2EJG C;  2PW5 A;  1PYS B;  1BO0 A;  1JMC A;  3HOV B;  4LF8 L;  5GAG C;  1B70 B;  3S15 B;  2Z4H A;  5FLX E;  3SK8 A;  5GAH C;  3KJP A;  4PZ8 A;  1NCV A;  4B08 A;  3HOX H;  4JV5 L;  3PQI A;  2QDL A;  4DV6 L;  4IUT A;  3SVM A;  1AZQ A;  1A6X A;  1Q81 C;  5D3D A;  2K75 A;  4HCE A;  4IN3 A;  1SJH D;  4MHE A;  2NTT A;  2NZO A;  4I7A A;  1VQO A;  4A3I G;  3BZK A;  5CV7 A;  4IZ8 A;  1JE4 A;  2PQA A;  4Q5V A;  1QIL A;  5AJ3 L;  3J7Z C;  3VR4 A;  1OO9 B;  3MAQ A;  2EVB A;  1QVC A;  2A8V A;  1WCM G;  2K32 A;  1HR0 L;  2NVX B;  3DMU A;  1R9T H;  4AIM A;  4UP7 A;  4DV2 Q;  1TWH H;  3HOY B;  2GVB A;  3A0J A;  4DK0 A;  2B63 H;  4HR7 B;  4A3M G;  4R1J A;  4NDX A;  2X6G A;  1A3T A;  2NZH A;  2R92 H;  2JQO A;  1PA6 A;  2D62 A;  1B9N A;  1TWF H;  2WFW A;  1IW7 C;  1HH2 P;  3QJY A;  1E22 A;  3BVG A;  3I4N B;  3G6E A;  1NBW A;  3OW2 A;  4V0B A;  3T1Y Q;  1CTM A;  4JBM A;  4CDE C;  3FKI H;  1JJC B;  3T1Y L;  5JJK A;  2L11 A;  1G51 A;  4DNT B;  1VQM A;  3I7F A;  1K8G A;  4P2C B;  4ID6 A;  4JI1 L;  3K59 A;  5EKL A;  2R61 A;  4IQZ A;  2GN5 A;  2PZT A;  1GHK A;  4EQ5 A;  2BA0 A;  2XTI A;  4NMZ A;  1HQM C;  3HOU H;  4JG2 A;  4HID A;  2F0T A;  2R93 H;  5E3F A;  4C1N I;  4KK7 A;  5CC4 A;  2QGQ A;  2G9H D;  4HN7 A;  2JA7 H;  2HQE A;  3HS0 C;  2NVY H;  3FKI G;  2R6G A;  3CRL C;  1TKW B;  1GUG A;  3L3O C;  3AEV A;  4EVO A;  3CPF A;  2F1M A;  4NKL A;  3S1R H;  5ELC A;  1QWY A;  3K0Y A;  3GTO B;  4CDC C;  3GTG B;  3PO3 B;  1ESF A;  4LF8 Q;  2L4N A;  1CKN A;  1I6H H;  1EYA A;  2ENB A;  3CQZ H;  3TP8 A;  1FJG L;  2M00 A;  3OTO Q;  2NTS A;  2OEO A;  4DV5 Q;  5IP9 G;  2AWO A;  1KQS A;  1J5E Q;  1I4X A;  3J80 c;  1CI3 M;  1PH5 A;  1XTC D;  4EQN A;  2V1C C;  4AH6 A;  4DR7 L;  3ULJ A;  3HOW B;  3VYT A;  1V8Q A;  1X32 A;  1STG A;  3STB C;  2R7F A;  4PMB A;  3CD6 A;  2BH8 A;  2H5X A;  5BR8 Q;  1X3Q A;  4RHS A;  1Y1V B;  2MO0 A;  3OMC A;  4BBS G;  1ET6 A;  2AWN A;  4JOI C;  1MKH A;  2VB2 X;  3K0X A;  2AQ3 B;  3R8B A;  1GOZ A;  1SNO A;  3D4W A;  1HCZ A;  5M5X H;  2SEB D;  4Y7N B;  1J8I A;  1GVP A;  3Q0A A;  3D4R A;  3S16 H;  5C3E H;  2BDN A;  4N8X 1;  4PV1 C;  3GTP B;  5BN3 A;  2K1B A;  2PNH A;  4JBK A;  3J7Y W;  3OHX C;  2UU9 Q;  1KTK A;  2IPK D;  4LWC A;  4POF A;  1O78 A;  1AZP A;  1STA A;  3BZD B;  3PF5 A;  4DPG A;  4OO1 G;  4EX5 A;  4XQN A;  3GTM H;  1DJR D;  1Q1B A;  3HRZ C;  4FYD A;  2B63 G;  1Q1E A;  1I4Q A;  3TBI B;  1PH2 A;  3M4Q A;  4IPH A;  1SNQ A;  5C4H A;  1IKM A;  5D65 A;  4LF5 L;  1JJ2 A;  2JA7 B;  1EFI D;  1ZKO A;  4LUZ A;  1I5F A;  4GLA C;  1BBU A;  1Q12 A;  3CC2 A;  3NTI A;  2IY5 B;  3H6M A;  1KAB A;  1TS4 A;  2YYZ A;  5FLX c;  1I4P A;  2JA6 B;  1WTP A;  2MUY A;  3T4A C;  2H4O A;  3BU2 A;  2Z1C A;  4GN3 B;  4JI8 Q;  3NXW A;  1IBL L;  3PO2 H;  1EIY B;  2DNC A;  1B8A A;  4CJ0 B;  5CV6 A;  3HOZ B;  2B29 A;  1KC8 C;  3K7A B;  1TY2 A;  5IT9 E;  1WTV A;  4B3M Q;  1TWC H;  5IE8 A;  3OIQ A;  4DA2 A;  4QQB X;  3VR5 A;  2QA4 A;  3I70 A;  4A3I H;  4K14 A;  1ZEQ X;  2BE5 D;  4ZUI A;  4ALP A;  1A2T A;  3MTS A;  1SNM A;  3WOE A;  3ICE A;  4DV5 L;  2EZV A;  2E2I B;  3OTO L;  1C7Y A;  2MHV A;  5C44 B;  1IL8 A;  1I4R A;  1CSQ A;  4QF4 A;  4XTC S;  1CSP A;  4X6A H;  4YWK A;  1D1I A;  1HUN A;  3M7G A;  2NWG A;  5ELB A;  2K5Q A;  3GTJ H;  3MVV A;  1HTL D;  4EQP A;  4DXG A;  5ELF A;  3HG9 A;  4C3I H;  3BS1 A;  1SYF A;  4IFD G;  1V1P B;  1EYC A;  5K36 G;  2UUA Q;  1WTR A;  3GV6 A;  3EJI A;  3K7U C;  2GVA A;  5GQO A;  4A76 A;  1EQT A;  5IYB H;  2X6L A;  1EY8 A;  1AEX A;  2Z6B A;  3OPO A;  1IHZ A;  5AFW A;  3PIO A;  2EYP A;  1QE6 A;  2MJ8 A;  1VQ5 A;  1ZXT A;  1CKN B;  4JVZ A;  3URY A;  2CCZ A;  1UE1 A;  1ROD A;  1IZ6 A;  1VQD A;  1YHQ A;  2Q8R E;  1PYW D;  2KVM A;  3X3N A;  4HCS A;  1WD0 A;  3B6Y A;  3PUZ A;  4OWX B;  4KN7 C;  4BBR B;  2K6A A;  3G7L A;  3S15 H;  4FF2 A;  3SHL A;  2MNA A;  3KLS X;  4H02 A;  4BY7 G;  1LAC A;  2J0T D;  4A3G B;  5M5Y B;  4A3K G;  2NVQ B;  3RNU A;  1EQV A;  2MPM A;  3D4D A;  2A73 B;  1JOO A;  3DWA A;  2UUC L;  2VUM H;  4IUR A;  4MZ9 A;  3CCR A;  2JA5 H;  3TME A;  4LF5 Q;  4G7H C;  1Q46 A;  4KMU C;  4O42 A;  2HHH L;  3TN2 A;  4R8I A;  4C3J G;  1PTO B;  5IOD A;  4QUF A;  1EY5 A;  2LY7 A;  2K7V A;  4QMG A;  3UE0 A;  4C3H G;  4ODG A;  1BCP D;  5C44 H;  2N78 A;  4ZLT F;  4HJ9 A;  4FVM A;  1JWM D;  3KDF B;  2CHB D;  1U4R A;  1F2L A;  2K52 A;  2KEC A;  3BYY B;  4C2M B;  4CDD C;  4LF4 Q;  2QEJ C;  1JB3 A;  2F0J A;  2RSO A;  2SNS A;  5IGG A;  4LFC Q;  4GKJ Q;  4EQO A;  4CKE A;  1K8M A;  1EY7 A;  4DR3 Q;  4QY7 A;  1MJE A;  4J6H A;  4OGQ C;  3K80 C;  1CZW A;  3NWS A;  4Q0F A;  3T53 B;  1S4Z A;  3GV3 A;  4ILW A;  5LMU L;  4KTA A;  4DXF A;  2VUM G;  2EY1 A;  1DGS A;  4N9P A;  2F3V A;  4PG3 A;  5I6Y A;  1L0X B;  3BYT B;  5C4Z A;  1H95 A;  4F8M A;  5COR A;  1VQE A;  4DU9 A;  1NJI C;  1EYG A;  2IJ0 A;  2A6H D;  4XT3 B;  4DV0 Q;  1SR3 A;  3HOW H;  5ELO A;  1TR5 A;  2KHS A;  4N8F A;  1HHV A;  3CC4 A;  3PMF A;  1H9J A;  2UXB Q;  4DV2 L;  4NXM L;  4AYB B;  1JOK A;  2PPB C;  1ASY A;  4A3E B;  3GTQ H;  2IX0 A;  2KCC A;  1SYD A;  1EFW A;  5JPM C;  1WOC A;  1HR0 Q;  1EY6 A;  1VQB A;  2WB1 B;  3RZD H;  1IW7 D;  4ZUJ A;  1F2M A;  3MWY W;  2F0D A;  2VUM B;  3NWT A;  1JT8 A;  2ZM6 L;  3KJO A;  3NEM A;  1CZG A;  3TRZ A;  1WFQ A;  4LJZ C;  4JI1 Q;  3NEN A;  2FHT A;  1X56 A;  1XYI A;  4LFB L;  3O13 A;  1EY9 A;  2XWJ B;  2EY5 A;  4A3D G;  2XGT A;  1F2Y A;  4U67 3;  2A19 A;  4R8N A;  4OO1 I;  2I5M X;  2D0P A;  3AFQ A;  2LS0 1;  4KHV A;  1IBM Q;  3I73 A;  2DGY A;  2MGS A;  4G57 A;  2AQ2 B;  2E2H B;  4LNQ A;  4JC0 A;  2PI2 E;  4X62 L;  3KOJ A;  3P1H A;  2Y0S E;  3FP9 A;  1XNR L;  1MIU A;  1QZH A;  1OXX K;  1S72 A;  2BH2 A;  1BVS A;  1H9R A;  1RHP A;  1HNX L;  2LXJ A;  5H1S E;  1A2U A;  4DR4 L;  4GN5 A;  1P8L A;  1EWC A;  4A3K B;  2CWA A;  1NTG A;  4RAU C;  2L9H A;  1SE8 A;  1S40 A;  4APV A;  1JWU D;  1XNQ Q;  1GUO A;  1TWG H;  3TQY A;  1VQI A;  3MC0 B;  4HTH A;  1TU2 B;  4M8A A;  4BBR G;  1OXV A;  4HJA A;  5LMU Q;  5C3W A;  3HP3 A;  4V19 0;  3H0G H;  1BQQ T;  4XQJ A;  4WFN 3;  3Q22 A;  4A3E H;  2CQA A;  2ZJP A;  4IUV A;  3NBI A;  3PO2 B;  1BXT A;  1F77 A;  1QB5 D;  3H91 A;  3AFP A;  3TZD A;  4M1U B;  2ZXO A;  1EU3 A;  1A8V A;  4WRD A;  3EVQ A;  3K5M A;  1ML0 D;  3PUW A;  1VQ8 A;  1YNX A;  1G91 A;  3EBE A;  1DOK A;  2YTX A;  4O1N A;  3KK7 A;  1M8A A;  2ZTC A;  4HSV A;  5M3M B;  4XT1 B;  4JI3 Q;  2WAC A;  1HZB A;  4K5V A;  3CP0 A;  3PIP A;  2J7Z A;  5M9O A;  2HIV A;  3K81 C;  4RGN A;  5JEA G;  3QIA A;  2ICI A;  3A55 A;  1L1O B;  1T9H A;  5CYU A;  2JK8 A;  2QF7 A;  4IOA A;  2D0O A;  5JJI A;  4F7X A;  1NR4 A;  4DR6 Q;  3I3C A;  3E6Z X;  1TS3 A;  1RDP D;  4DR2 L;  1MJC A;  3HKS A;  3GQB A;  3GTJ B;  3J81 L;  4B3T L;  1V9P A;  2K03 A;  4QGU A;  1RIP A;  1VQ7 A;  4RMF A;  4BS9 A;  1EEI D;  1HTP A;  3KF6 B;  5C3X A;  3E9I A;  2Z9H A;  4X66 Q;  4OX9 Q;  4LF9 Q;  3S1Q B;  2KHI A;  4P71 A;  1KAW A;  1PFM A;  1K3B C;  1Y8P B;  4P72 A;  5J1Z A;  1E1O A;  2VL6 A;  2NVQ H;  4JK1 C;  2UXC L;  3S24 A;  4TRD A;  3AQQ A;  1MD2 D;  2N55 A;  2RCN A;  2JA6 G;  3C1E A;  1E7Z A;  1A15 A;  1I94 Q;  3JAM E;  1HJP A;  1TWG B;  3TS0 A;  3VYU A;  4A3F G;  1N8R C;  1STE A;  2VXW A;  1A63 A;  3PUX A;  1PHJ A;  2B8F A;  3UE1 A;  3G71 A;  3GDE A;  4NW2 A;  3L9A X;  4JI2 L;  2B2V C;  2JA7 G;  1SLJ A;  1GJX A;  5M5Y H;  3E0J A;  4X64 L;  4A93 H;  2JEB I;  2B63 B;  1CHQ D;  3KDF A;  2TMP A;  2K5W A;  1ICF B;  5GAD C;  1GUN A;  4GLV B;  3U4V A;  2PZU A;  2PYK A;  1LTL A;  2MQH A;  4OIJ A;  1XTD A;  4R4I A;  4UAI A;  2PZW A;  3N6R A;  1C4Q A;  2SDF A;  5EKK A;  1PVO A;  2XWB B;  2ZJR A;  2L1B A;  4DUZ Q;  4B3M L;  1S5F D;  2YTV A;  3NSW A;  5KEE A;  4A3D B;  1I50 H;  4BBS B;  3MXP A;  4XYO A;  5KIX A;  1BBW A;  4K5W A;  1YJN A;  4ZAI A;  3BJU A;  2AUJ D;  5CBA E;  2SOB A;  2UXC Q;  4JI2 Q;  3W3A A;  3I56 A;  2NYZ D;  2QCP X;  3ER0 A;  3ERQ A;  3S1Q H;  1KNE A;  5M5W B;  3ZYY X;  5I9O A;  1O7Z A;  4DK3 C;  2JA5 G;  1A3U A;  4JI0 L;  2BE5 C;  4GKK L;  4IUU A;  2CW0 D;  4R4T A;  2WB1 G;  2K33 A;  5CV5 A;  4AYB G;  4QCL A;  4O0A A;  2DY7 A;  3M3Y B;  1D8L A;  2RDH A;  3KLR A;  1N34 L;  1Y1V H;  3MFY A;  3OWE B;  2KCT A;  2LMC B;  4LF9 L;  3ND9 A;  1K8O A;  3M4P A;  1XXG A;  2CKZ B;  1SBB B;  1NNX A;  2K5H A;  2AUK A;  1U9R A;  4KHP L;  3FPP A;  1IKL A;  4L8J A;  3U9S A;  1UWV A;  1TQO A;  4K8J A;  2L12 A;  5FLM H;  5M5X B;  1UE5 A;  2JYO A;  5IGF A;  4HIM A;  1N33 L;  4HIK A;  5CBE E;  1M4V A;  5FO7 B;  1EEF D;  3J81 i;  5IP7 G;  1RD9 D;  2F0M A;  3T16 A;  4A3C H;  1STB A;  3CCS A;  1QG7 A;  1VF7 A;  1YNJ D;  1SMY D;  1CHP D;  4DR4 Q;  1UEB A;  3H09 A;  2C9O A;  2VQF Q;  3KBG A;  4RGT A;  1EZ8 A;  1VQH A;  2B2V A;  3R2T A;  1QZG A;  3BZC A;  4IJL A;  4A3C G;  4KN4 C;  2CWP A;  4YIJ A;  1Y1W H;  5DM7 3;  3K8A A;  2EY6 A;  1DOM A;  4O2D A;  4A3M B;  4ZKC B;  5D14 A;  3HOY G;  3AU7 A;  1SE2 A;  3K5N A;  5KNC A;  3E9H A;  4DR7 Q;  4YCU A;  1KDA A;  2K5V A;  3STB D;  3AMU A;  4A93 G;  5IYD H;  3C1F A;  4GOP C;  1H9M A;  2VNU D;  1VQG A;  3H15 A;  1B50 A;  4PZ7 A;  1G2S A;  2EQS A;  4UY8 C;  4JI7 L;  4CKB A;  2EYJ A;  1PMR A;  1MHW C;  1LM0 A;  4LFA L;  1UE6 A;  4A3F H;  3PF4 A;  4DNI A;  3H0G B;  2R7Z G;  3FHW A;  1VQA A;  2N8N A;  1M90 C;  4KY5 A;  2CH4 W;  5DEH A;  1XNR Q;  2VY3 A;  3D8G A;  2HCI A;  4KJN A;  4A3K H;  4GLX A;  1D1K A;  4X62 Q;  4FP5 D;  1DD2 A;  3OW7 A;  1SSO A;  2PMZ E;  1YJ9 A;  1VQP A;  4DR6 L;  3HOV G;  1B7Y B;  4CGY B;  1K83 B;  4IUQ A;  1GUW A;  1L2F A;  3NTK A;  1SYB A;  1MSH A;  4IUN A;  5FO9 B;  4U68 A;  1GM5 A;  3M4O H;  2DN8 A;  2YTY A;  2O2L D;  4Y52 H;  3RZO B;  2GA4 B;  1X9N A;  1D6E C;  4A4I A;  2F0F A;  5GRO A;  4IJH A;  1VMC A;  3I55 A;  5IYC H;  5EPK A;  4FNF A;  1YNN D;  5IYB G;  4KKT A;  2VQE Q;  4PMC A;  4JI7 Q;  1AFP A;  4GN4 B;  5I6W A;  1Z7T A;  4HMJ A;  4ABN A;  2JP1 A;  4HJ8 A;  4IPC A;  4DKA C;  2XIW A;  1XWE A;  4KI0 A;  2NZ1 D;  4GKJ L;  2Q2T A;  3U9O A;  4BA2 I;  2F4I A;  1LTG D;  1KNA A;  3WWV A;  5AJ3 Q;  4DUY L;  2MFI A;  2OTJ A;  3SR1 A;  2VB3 X;  1WD1 A;  4XDX A;  2Z8L A;  2RBM A;  5ELE A;  1PDQ A;  3IL8 A;  4Z9C B;  3PO2 G;  1MGS A;  3DM1 A;  1SND A;  1HUM A;  1LT6 D;  3Q8D A;  4JI5 L;  2F4V Q;  4LF6 L;  3WDN A;  2CH4 A;  2EYL A;  5FJ8 H;  5CV4 A;  1ZYR D;  4QIW B;  3IFT A;  3J7A F;  4JV5 Q;  3DWP A;  1O7Y A;  3D6C A;  1FNW A;  3PV0 A;  1KLG D;  1WTX A;  3A56 A;  3GO5 A;  5J39 A;  4RKL A;  2JSO A;  3SDZ A;  3R2I A;  5ELD A;  3HOZ G;  4DN4 M;  3N52 A;  1PH8 A;  3MEH A;  4DV4 L;  4CDF C;  2EPB A;  1BF4 A;  1V43 A;  3IFD A;  2EYH A;  5E4W C;  3BG3 A;  2EXD A;  4GOP A;  2KA7 A;  5TSS A;  1RTN A;  3H0G G;  2R7Z B;  5JJL A;  2DNE A;  2J4X A;  3P7J A;  1PRT F;  2UUC Q;  1K83 H;  5C4X H;  4RH6 A;  5KYL A;  2IL8 A;  4YWL A;  2VS1 A;  2RHQ B;  4KY7 A;  1IBL Q;  3I4M G;  5FJ8 G;  3GTL H;  3SK6 A;  3I2Z A;  1GUT A;  1V1O A;  1O7I A;  4A93 B;  5C3E G;  5EQ0 A;  3CHB D;  4LMQ D;  3PGZ A;  1Y69 U;  1K9M C;  1ZYR C;  2E75 C;  5HY6 A;  5IWA L;  1NUC A;  2HQL A;  1X54 A;  3SK5 A;  1WVL A;  1DZ1 A;  1IBK L;  1STY A;  1I50 B;  4BBS H;  1LUZ A;  1PFB A;  2LSS A;  1XMO Q;  3GTK B;  5BN4 A;  1PH4 A;  3RLO A;  3BDL A;  3TS2 A;  3S1R B;  2RA4 A;  2A68 C;  1E0B A;  1SNC A;  1I6H B;  1W6K A;  4JCV E;  4DV0 L;  3HKZ E;  3OMG A;  1B3A A;  2KEN A;  4UPA A;  4A3E G;  2O4X A;  5LMN Q;  1II3 A;  3IRB A;  3BVZ A;  5F2D A;  3RR5 A;  2F0H A;  1CFM A;  4MTN A;  3RD4 A;  3CF5 A;  3S1M B;  1PH9 A;  1YBY A;  3CRK C;  4KLK A;  4DK6 C;  3UDX A;  1YVC A;  2TSS A;  4BY1 G;  3HOW G;  3RZD B;  2QW7 A;  4KHZ A;  4RGO S;  3QB3 A;  1G2T A;  1R9T B;  5EAY A;  1C0A A;  3J80 L;  4YHH L;  1I4H A;  3V96 A;  1BBX C;  1LTT D;  3EQL C;  2JA5 B;  2R92 B;  1FNV A;  2RVL A;  5I4D A;  4FO2 A;  1DON A;  1LTS D;  4CHT B;  1Q90 A;  5GAE C;  3MXN B;  1ONL A;  1SMX A;  1QVF A;  4A3B B;  2NB0 A;  3CAM A;  4WOR A;  1I94 L;  1S3O A;  2WKD A;  2JE6 I;  2B2W A;  2G5D A;  2YV5 A;  1A0I A;  3GTL B;  2F3I A;  4OHJ A;  1DXM A;  2AMC B;  4HIO A;  2IHE A;  3R3O A;  1VQK A;  3F2U A;  3NEL A;  4DR5 L;  1XX8 A;  4X65 Q;  2WAQ E;  2ZTE A;  4HAE A;  2A69 D;  4L5Q A;  2NVY B;  2KJX A;  4B3T Q;  1EQQ A;  1CA6 A;  2RDG A;  2O5J C;  4JI4 Q;  3BDO A;  1IYJ B;  4F88 A;  1B1Z A;  4X3S A;  1ESR A;  4TSS A;  3G4S A;  3MXU A;  4C3J H;  2K5D A;  2XVS A;  1VQ6 A;  1EWI A;  5IP7 H;  2FFK B;  3CQZ B;  3ERS X;  4X3K A;  4L6T B;  2PNR C;  3F8T A;  1RL2 A;  3QR8 A;  3DEO A;  1F9Q A;  1N9W A;  2AKW B;  3UDI A;  1WTO A;  1XMQ Q;  5FLM G;  1LTA D;  2K50 A;  4R9W A;  3HOX G;  3EIV A;  3T51 B;  5BR8 L;  2B3G A;  3A8K E;  4UHV A;  3VYS A;  1AP0 A;  1CQV A;  2QKI C;  1Q82 C;  1PTO F;  4H7B A;  4OON A;  2I5H A;  4A3I B;  1F2Z A;  4A3F B;  2ES2 A;  2N3S A;  3V05 A;  1VDZ A;  2UUB L;  3MEF A;  2N49 A;  3AB9 A;  5IYD G;  4B9X A;  1S5C D;  2E2J H;  3J80 E;  2HIX A;  1JB7 A;  2A5H A;  1F9R A;  1GHJ A;  1YNJ C;  3S17 B;  1Y14 B;  5HUR A;  3UDG A;  3GTP H;  1F9S A;  4LW1 A;  4ZYS A;  5IWA Q;  2K05 A;  2F0S A;  4JI5 Q;  4DAY B;  1TWF B;  2RKS A;  4DGZ A;  3VA7 A;  5DNF A;  3CPW A;  1J5E L;  5K36 H;  4YHH Q;  3EN2 A;  4UP8 A;  3M4O B;  4C3I G;  1SYG A;  2OT2 A;  3H3V H;  4YY3 Q;  4RKB A;  4TQU S;  1PXU A;  3K58 A;  5I2Y A;  4WJW A;  5KNB A;  4FXG C;  5KYI A;  3MA2 B;  5HGT A;  4LK1 C;  1C9O A;  1EIF A;  1F9P A;  3K6O A;  5ISR A;  3VR2 A;  3TP7 A;  2A6E C;  1JIC A;  3KF8 A;  2WII B;  4K0K L;  4N9T A;  1W6J A;  2Q8T A;  4HJ5 A;  5C0X I;  1PH6 A;  3HOV H;  5M3M G;  1SJE D;  2B2T C;  2Y0S B;  1X3G A;  4MNO A;  4S3S A;  2YU9 H;  1JC7 A;  2IHF A;  1UEA B;  2F3W A;  2EIF A;  1PRT B;  5FO8 B;  2OF1 A;  4A3G H;  5C5L A;  3SE0 A;  1LT3 D;  3LWE A;  4GNX A;  2ZTD A;  5FLX L;  2P5Z X;  3CME A;  4HJ7 A;  1TII D;  1TWC B;  1HPC A;  3QWN A;  4IFD I;  1TWA H;  2ZM6 Q;  5LL6 S;  3L7Z C;  4JPB W;  2PI2 A;  2C5C A;  4K6L A;  2Q2U A;  3T1H Q;  5CGK A;  4RA8 A;  1Q7Y C;  1XMO L;  2DJF C;  4GOP B;  1EY0 A;  4DV6 Q;  4QUC A;  3T56 B;  1JQY D;  1TWH B;  2NN6 H;  2HD3 A;  4LFA Q;  1I3Q H;  2ZJQ A;  2NUC A;  4CJ1 B;  3HOY H;  5NUC A;  2E74 C;  2VW9 A;  4A75 A;  1KRS A;  1PLF A;  2ALY B;  2EYF A;  3MXN A;  4C1N K;  3S16 B;  5KGU A;  2CFM A;  2KEE A;  1JWS D;  2HT1 A;  4F87 A;  1S5B D;  1UE7 A;  4K0K Q;  3CCJ A;  3CW2 C;  3GP7 A;  5DAU A;  1NE3 A;  1YI2 A;  5JJZ A;  2I46 A;  2UXD Q;  4POG A;  1YEZ A;  1AE2 A;  2B8G A;  2EJF C;  1TXY A;  1BUV T;  1PTO D;  5KND A;  3GTM B;  2QIL A;  2F0G A;  1ET9 A;  3IKJ A;  4K6D A;  1LYL A;  3ONA B;  4ME5 A;  4OO1 H;  3NK9 A;  4LF6 Q;  2JA8 H;  2F4V L;  4ZQ3 A;  2I5L X;  4DFA A;  4BWG B;  4G4K A;  4YCW A;  2CW0 C;  4BY1 H;  1HRJ A;  2Z6K A;  3F1Z A;  1PYB A;  1FJG Q;  1HZA A;  2F0L A;  5IT9 L;  1PRT D;  1EL0 A;  1VQJ A;  1BNZ A;  1YIT A;  3KF8 B;  3GTO H;  2Z4I A;  1LTI D;  2K04 A;  3I4L A;  1QNK A;  2F0W A;  4X3U A;  1BDO A;  3PUY A;  2AHO B;  5E7N A;  2KQ3 A;  3I90 A;  1YJW A;  3QOL A;  1CA5 A;  2HDM A;  2I0Q A;  3U50 C;  5BN5 A;  3PO3 G;  4P74 A;  1VCI A;  1BKB A;  4RGM A;  3A74 A;  3RN2 A;  3J7A V;  1OXU A;  4OEM B;  1X6O A;  3FMC A;  4A3B H;  2ASB A;  4JBW A;  2RQX A;  3S2H B;  1D5M C;  1D7Q A;  1BCP F;  4G7Z C;  1K28 A;  3QG1 A;  3OWF A;  1GXD C;  2L5T A;  2VQF L;  3T13 A;  2HCC A;  3J81 c;  2E2I H;  5IP9 H;  2HDL A;  4GNX C;  1LV9 A;  2F0K A;  1SE3 A;  3R93 A;  2F0Q A;  1CT1 D;  4I7Z C;  4DAP A;  3JAM c;  1NY4 A;  1X3P A;  1VQC A;  5C0X J;  5IIF A;  1TS2 A;  3TEH B;  3EA6 A;  1PFN A;  1B53 A;  1HNW L;  3ERO A;  2ZXR A;  1N32 Q;  3I4N G;  2A68 D;  3JC6 6;  1PTO C;  1C48 A;  3NHH A;  1H9S B;  5HGQ A;  4X65 L;  2LXK A;  4DNR B;  3I4O A;  5J3B A;  3RMH A;  3OIP A;  5CR3 A;  5EPJ A;  1Q3L A;  3BDC A;  3K5O A;  4FXK C;  4EGV A;  3V2T A;  1AE3 A;  4K2L A;  2JJQ A;  4DF7 A;  2EYM A;  5C4J H;  4ZCK A;  1G6P A;  5JEA J;  2B2W C;  4BA1 I;  5EPL A;  3M85 A;  2NN6 I;  4A3D H;  1WCM B;  2F0U A;  1P16 A;  2BCO A;  2NBF A;  3CXC A;  4C3H B;  3KLW A;  2EXZ A;  5G3L F;  3W1G A;  4B3S L;  4PMW A;  3RN5 A;  2FJ2 A;  1K73 C;  1AN8 A;  2ATW A;  4C3J B;  1CKO A;  4AYB E;  2CQO A;  2KOL A;  4G7O C;  2ICE C;  4KD3 A;  1OXS C;  3TP6 A;  1E2Z A;  3S1N B;  2O5I C;  3PIP 3;  4IOC A;  4J8Q A;  1UUP A;  3HOZ H;  5A2Q L;  3GD7 A;  3S17 H;  4A3G G;  2DJG C;  2WP8 J;  4BY7 B;  4TKO B;  1LT5 D;  4ULL A;  4NXN Q;  3UDF A;  3CCU A;  3F2D A;  1PZJ D;  4R4C A;  4KV6 A;  1GD7 A;  1D5Z C;  2OXP A;  5CV9 A;  3L2P A;  4A3J G;  4JI8 L;  4LF7 Q;  2ID0 A;  1HR0 W;  3RZO H;  4I65 A;  3UI2 A;  1PV4 A;  2EOT A;  2DUD A;  2F0E A;  1W3S A;  1SYE A;  2DY8 A;  1ENA A;  1EU4 A;  2WAQ G;  1GKH A;  3HOU G;  4K2K A;  1SE4 A;  4X66 L;  1SFO H;  4OX9 L;  1SMY C;  1J6Q A;  2D9U A;  1R4P B;  1N36 L;  1EOT A;  4C56 C;  1E2V A;  2ZXP A;  4JI4 L;  5LMN L;  2ZT9 C;  3VYR A;  2IX1 A;  4A3J B;  4E6I A;  4KD4 A;  4X64 Q;  3CCQ A;  1KDC A;  2LFN A;  4FXD A;  3VR6 A;  4OEL B;  4TVA B;  1CKM A;  1IBK Q;  4AQY L;  1L1O A;  4DV3 Q;  3C3L A;  3KUP A;  4DR1 Q;  1Z9F A;  2RSN A;  4P75 A;  4ZK9 B;  4H13 C;  2MP1 A;  1T5X D;  1V1P A;  2A69 C;  2XN9 C;  1X65 A;  4P73 A;  5C44 G;  3S2D B;  3IAY A;  1WCM H;  1IXR A;  3MFG A;  1U4L A;  4DV1 L;  4UDU C;  4IO9 A;  3VA5 A;  4H0L C;  3LGJ A;  2X69 A;  3NBH B;  2L55 A;  2A74 C;  2PQE A; 
#chains in the Genus database with same CATH homology
 1QCB D;  3EFX D;  3A54 A;  4FF4 A;  2XRS D;  1EY4 A;  5C0X H;  5EBD A;  2I07 B;  3K5L A;  2B2T A;  3A7L A;  1ILQ A;  3OOC A;  5K5P A;  2NVT B;  2D5D A;  1H9K A;  5C4X B;  1CK1 A;  1I6V C;  1TWA B;  3QO2 A;  4FF3 A;  1BCP B;  3A8I E;  1OXT A;  1J9O A;  3P20 A;  1EIG A;  1BOS A;  2F0P A;  3D3R A;  1UNS A;  2EJM A;  3WOF A;  1NSN S;  3LNN A;  1SFO B;  4XIG S;  1QJO A;  1MSG A;  5JOB A;  2QDB A;  1Y8N B;  4H44 C;  1JR0 D;  1S5D D;  1SAP A;  1NR2 A;  4DK1 A;  1LLR D;  2PO4 A;  2B2Y C;  4IAL A;  2IT1 A;  2K28 A;  1GUS A;  3BVM A;  1R4Q B;  1EWH A;  3E5S A;  3HKZ B;  3OSO A;  4KKU A;  3SXH A;  4B9W A;  2JA8 B;  1EYD A;  3NE5 B;  3H94 A;  1O7L A;  3M7N A;  4CJ2 C;  4FF1 A;  4HSP A;  3LWU A;  2IW3 A;  1LAB A;  5CV8 A;  1RTO A;  5EBC A;  3CKI B;  5M3F B;  4RCN A;  1WTQ A;  4IUP A;  5I9P A;  1RCV D;  2F03 A;  4HMI A;  3X3M A;  2XRQ D;  4GZY C;  2IWH A;  4X3T A;  1U4P A;  1YNN C;  5I2X A;  3I91 A;  3TP5 A;  5IGD A;  3G6J B;  2KCN A;  1BCP C;  1B9M A;  1PZI D;  3DEP A;  3FKI B;  1L0Y B;  3NUC A;  1B2T A;  2L0C A;  1G6Z A;  4L63 B;  4RHR A;  1FR3 A;  1C8C A;  3RLF A;  2XSC A;  2F0I A;  5C0X G;  4PQX A;  1UAP A;  3W2D A;  1STH A;  5A35 A;  2CVR A;  3HGB A;  5D3I B;  2JEA I;  2YU9 B;  5CMD A;  2WV6 D;  3ITP A;  1D5X C;  1D2B A;  2AQ1 B;  3MXG A;  2M9V A;  1KDB A;  1T5E A;  1VF5 C;  3JAM L;  2B2Y A;  5JVG 3;  2M2L A;  4MIU A;  4LAA A;  1PTO H;  5IOC A;  3CU7 A;  4XXE A;  1Q8I A;  1FD7 D;  1SEB D;  5E1F A;  1QOH A;  1E2W A;  1I3Q B;  1TT2 A;  3C46 A;  3TZU A;  5JAV A;  5J22 A;  4NP5 A;  3NPP A;  3A8J E;  3MZ5 A;  1STN A;  2XNA C;  1A3V A;  1S5E D;  1TY0 A;  4OIK A;  3HEJ A;  5EKI A;  2WKC A;  3C2P A;  3TSS A;  4CKC A;  4ZKB B;  2F0V A;  2EYO A;  5KRU A;  2B2U C;  5EJW A;  2PCF B;  4MN3 A;  3S14 B;  3HOX B;  1RKN A;  3Q24 A;  2LKV A;  1JCK B;  4RFB A;  3DHQ A;  1FGB D;  4J1M A;  4K5X A;  5JVH 3;  3ND8 A;  1DOL A;  5LL6 X;  1PZK D;  1SYC A;  2FMC A;  3K57 A;  3NQT A;  1DM0 B;  1CM9 A;  5IGE A;  5FK9 C;  1Z6H A;  3NP8 A;  2EE1 A;  4XQQ A;  1SNP A;  2A6E D;  5LHY 1;  3TDQ A;  5EGT A;  1JOQ A;  2A6H C;  1PRT C;  1QNU A;  5C5M A;  5A2Q E;  1Y1W B;  3NQI A;  2HUG A;  1SXT A;  5C4J B;  2NN6 G;  3RUZ A;  4CBV A;  4BY1 B;  1HA6 A;  4KKS A;  1HQR D;  3LX0 A;  2V4D A;  3PUV A;  2WIN B;  3I72 A;  2Q8I B;  2PW7 A;  1LT4 D;  2BA1 A;  2EY2 A;  3NBH A;  1HFG A;  4K8I A;  3DXJ C;  5IGC A;  3GTQ B;  5COY A;  1WTW A;  1EZ6 A;  1G29 1;  3FEW X;  2E76 C;  4HED A;  1BR9 A;  2FIN B;  4KJO A;  1KLU D;  5DM6 3;  4RWS C;  1HFN A;  5T1I A;  2B2U A;  2F0N A;  2RDF A;  4XYQ A;  3DWQ A;  1ENC A;  4DAY A;  2G9D A;  3Q23 A;  4DAV A;  4OL7 A;  3KBX A;  1ILP A;  3NTH A;  1ENF A;  4KY6 A;  2B39 A;  5C3E B;  1FNU A;  1G8Z D;  5JPN C;  2KED A;  3D6W A;  1LO5 D;  4QB4 A;  3M4Y A;  3I4M B;  5C6A A;  3SEB A;  1HA5 A;  3KLS A;  2SNM A;  3Q6S A;  1RJT A;  4IFD H;  4RCO A;  1ICW A;  1B4O A;  1TS5 A;  2R3Z A;  2K01 A;  3FVQ A;  1Z47 A;  1AW7 A;  3VR3 A;  5T1G A;  3DUZ A;  3J81 E;  3FPU B;  3HZX A;  2F0O A;  5FKA C;  1IYV A;  2PMZ B;  4PNY A;  3S9W A;  1HXY D;  1SDF A;  1DCZ A;  1NAP A;  1KAA A;  1B44 D;  2FMM A;  3H3V C;  5FOB B;  1DYQ A;  3QOJ A;  1IYU A;  2E2J B;  1LTB D;  3I8Z A;  3PIO 3;  1VMP A;  2H1E A;  2JXM B;  3D31 A;  1I4G A;  2EDG A;  1H9S A;  1LTR D;  2E2D C;  4IFD J;  1CQF A;  2D2C C;  1FYC A;  1RF2 D;  4ZRZ A;  1JOR A;  1Y8O B;  2IX3 A;  1O80 A;  3FRP B;  1TVX A;  3HOU B;  5IGB A;  2WAQ B;  3A7A B;  2N88 A;  2R93 B;  3P75 A;  5E4X A;  2BOS A;  2BDO A;  5G3L D;  4C3I B;  3FDT A;  3MHB A;  5JEA H;  1U4M A;  2KUM A;  1EIH A;  3SK4 A;  1MBY A;  1MI2 A;  2EJG C;  2PW5 A;  1BO0 A;  3HOV B;  3S15 B;  2Z4H A;  5FLX E;  3SK8 A;  1NCV A;  4B08 A;  4IUT A;  3SVM A;  1AZQ A;  1A6X A;  5D3D A;  4HCE A;  4IN3 A;  1SJH D;  4MHE A;  2NTT A;  5CV7 A;  4IZ8 A;  1JE4 A;  4Q5V A;  1QIL A;  3VR4 A;  1OO9 B;  3MAQ A;  2EVB A;  2K32 A;  2NVX B;  3DMU A;  3HOY B;  4DK0 A;  4HR7 B;  4NDX A;  2X6G A;  1A3T A;  2D62 A;  1B9N A;  1IW7 C;  3QJY A;  3BVG A;  3I4N B;  4V0B A;  1CTM A;  2L11 A;  4DNT B;  4P2C B;  4ID6 A;  3K59 A;  5EKL A;  2R61 A;  4IQZ A;  1GHK A;  2PZT A;  2BA0 A;  4NMZ A;  1HQM C;  2F0T A;  5E3F A;  4C1N I;  4KK7 A;  5CC4 A;  2G9H D;  4HN7 A;  2HQE A;  3HS0 C;  2R6G A;  3CRL C;  1TKW B;  1GUG A;  3L3O C;  4EVO A;  2F1M A;  4NKL A;  5ELC A;  1QWY A;  3K0Y A;  3GTO B;  3GTG B;  3PO3 B;  1ESF A;  2L4N A;  1EYA A;  2ENB A;  3TP8 A;  2M00 A;  2NTS A;  2OEO A;  2AWO A;  1I4X A;  1CI3 M;  1XTC D;  4EQN A;  3HOW B;  3VYT A;  1V8Q A;  1X32 A;  1STG A;  4PMB A;  1X3Q A;  4RHS A;  1Y1V B;  3OMC A;  1ET6 A;  2AWN A;  2VB2 X;  2AQ3 B;  3R8B A;  1GOZ A;  1SNO A;  3D4W A;  1HCZ A;  2SEB D;  4Y7N B;  1J8I A;  3Q0A A;  3D4R A;  2BDN A;  4PV1 C;  3GTP B;  5BN3 A;  2K1B A;  3J7Y W;  3OHX C;  1KTK A;  2IPK D;  1O78 A;  1AZP A;  1STA A;  3BZD B;  4OO1 G;  4XQN A;  1DJR D;  1Q1B A;  3HRZ C;  4FYD A;  1Q1E A;  1I4Q A;  3TBI B;  1SNQ A;  5C4H A;  1IKM A;  5D65 A;  2JA7 B;  1EFI D;  1ZKO A;  1Q12 A;  3NTI A;  3H6M A;  1KAB A;  1TS4 A;  2YYZ A;  1I4P A;  2JA6 B;  1WTP A;  2MUY A;  3T4A C;  2H4O A;  2Z1C A;  3NXW A;  2DNC A;  4CJ0 B;  5CV6 A;  3HOZ B;  3K7A B;  1TY2 A;  5IT9 E;  1WTV A;  3OIQ A;  4DA2 A;  3VR5 A;  3I70 A;  4K14 A;  1ZEQ X;  2BE5 D;  4ZUI A;  1A2T A;  3MTS A;  1SNM A;  3WOE A;  2EZV A;  2E2I B;  2MHV A;  5C44 B;  1IL8 A;  1I4R A;  4QF4 A;  4XTC S;  1D1I A;  1HUN A;  3M7G A;  2NWG A;  5ELB A;  2K5Q A;  3MVV A;  1HTL D;  4EQP A;  4DXG A;  5ELF A;  3HG9 A;  3BS1 A;  1SYF A;  4IFD G;  1V1P B;  1EYC A;  5K36 G;  1WTR A;  3GV6 A;  3EJI A;  1EQT A;  2X6L A;  1EY8 A;  1AEX A;  3OPO A;  1IHZ A;  5AFW A;  2EYP A;  1QE6 A;  2MJ8 A;  1ZXT A;  3URY A;  1ROD A;  2Q8R E;  1PYW D;  2KVM A;  3X3N A;  4HCS A;  1WD0 A;  3PUZ A;  4KN7 C;  4BBR B;  2K6A A;  3G7L A;  4FF2 A;  3SHL A;  3KLS X;  1LAC A;  2J0T D;  4A3G B;  5M5Y B;  2NVQ B;  1EQV A;  2MPM A;  3D4D A;  2A73 B;  1JOO A;  3DWA A;  4IUR A;  3TME A;  4G7H C;  4KMU C;  4O42 A;  3TN2 A;  4R8I A;  4C3J G;  1PTO B;  5IOD A;  4QUF A;  1EY5 A;  2LY7 A;  2K7V A;  4QMG A;  4C3H G;  4ODG A;  1BCP D;  4ZLT F;  4FVM A;  1JWM D;  2CHB D;  1U4R A;  1F2L A;  2KEC A;  3BYY B;  4C2M B;  2QEJ C;  1JB3 A;  2F0J A;  2RSO A;  5IGG A;  2SNS A;  4EQO A;  4CKE A;  1K8M A;  1EY7 A;  4J6H A;  4OGQ C;  1CZW A;  3NWS A;  4Q0F A;  3T53 B;  1S4Z A;  3GV3 A;  4ILW A;  4KTA A;  4DXF A;  2EY1 A;  4N9P A;  2F3V A;  5I6Y A;  1L0X B;  5C4Z A;  3BYT B;  4F8M A;  5COR A;  4DU9 A;  2IJ0 A;  2A6H D;  4XT3 B;  1TR5 A;  2KHS A;  1HHV A;  3PMF A;  1H9J A;  4AYB B;  1JOK A;  2PPB C;  4A3E B;  2IX0 A;  2KCC A;  1SYD A;  5JPM C;  1EY6 A;  2WB1 B;  1IW7 D;  4ZUJ A;  1F2M A;  3MWY W;  2F0D A;  2VUM B;  3NWT A;  1CZG A;  4LJZ C;  2FHT A;  1XYI A;  3O13 A;  1EY9 A;  2XWJ B;  2EY5 A;  1F2Y A;  4U67 3;  4R8N A;  4OO1 I;  2LS0 1;  4KHV A;  3I73 A;  2MGS A;  4G57 A;  2AQ2 B;  2E2H B;  3P1H A;  1OXX K;  1H9R A;  1RHP A;  1A2U A;  1EWC A;  4A3K B;  4RAU C;  2L9H A;  1JWU D;  1GUO A;  3MC0 B;  4HTH A;  1TU2 B;  4M8A A;  1OXV A;  5C3W A;  3HP3 A;  4V19 0;  1BQQ T;  4XQJ A;  4WFN 3;  3Q22 A;  2CQA A;  4IUV A;  3NBI A;  3PO2 B;  1BXT A;  1F77 A;  1QB5 D;  3H91 A;  3TZD A;  4M1U B;  2ZXO A;  1EU3 A;  4WRD A;  3K5M A;  3EVQ A;  1ML0 D;  3PUW A;  1G91 A;  1DOK A;  4O1N A;  3KK7 A;  1M8A A;  4HSV A;  5M3M B;  4XT1 B;  2WAC A;  4K5V A;  2J7Z A;  5M9O A;  4RGN A;  5JEA G;  3QIA A;  2ICI A;  3A55 A;  5CYU A;  2QF7 A;  4F7X A;  1NR4 A;  3I3C A;  3E6Z X;  1TS3 A;  1RDP D;  3GTJ B;  3GQB A;  3J81 L;  2K03 A;  4BS9 A;  1EEI D;  1HTP A;  5C3X A;  3S1Q B;  1PFM A;  1Y8P B;  5J1Z A;  4JK1 C;  4TRD A;  1MD2 D;  2N55 A;  3C1E A;  1A15 A;  3JAM E;  1TWG B;  3VYU A;  1STE A;  2VXW A;  3PUX A;  2B8F A;  4NW2 A;  3L9A X;  2B2V C;  1GJX A;  3E0J A;  2JEB I;  2B63 B;  1CHQ D;  2TMP A;  2K5W A;  1GUN A;  2PZU A;  2PYK A;  4OIJ A;  4UAI A;  2PZW A;  3N6R A;  1C4Q A;  2SDF A;  5EKK A;  2XWB B;  2L1B A;  1S5F D;  3NSW A;  5KEE A;  4A3D B;  4BBS B;  3MXP A;  4XYO A;  5KIX A;  4K5W A;  4ZAI A;  2AUJ D;  5CBA E;  2SOB A;  3W3A A;  2NYZ D;  2QCP X;  3ERQ A;  1KNE A;  5M5W B;  3ZYY X;  5I9O A;  1O7Z A;  1A3U A;  2BE5 C;  4IUU A;  2CW0 D;  2K33 A;  5CV5 A;  4QCL A;  2DY7 A;  3M3Y B;  2RDH A;  3KLR A;  3MFY A;  3OWE B;  2LMC B;  3ND9 A;  1K8O A;  1XXG A;  1SBB B;  2AUK A;  1U9R A;  3FPP A;  1IKL A;  4L8J A;  3U9S A;  1TQO A;  4K8J A;  2L12 A;  5M5X B;  2JYO A;  5IGF A;  5CBE E;  1M4V A;  5FO7 B;  1EEF D;  1RD9 D;  2F0M A;  3T16 A;  1STB A;  1QG7 A;  1VF7 A;  1YNJ D;  1SMY D;  1CHP D;  3H09 A;  2C9O A;  3KBG A;  4RGT A;  1EZ8 A;  2B2V A;  3R2T A;  4KN4 C;  4YIJ A;  5DM7 3;  2EY6 A;  1DOM A;  4A3M B;  4ZKC B;  5D14 A;  3AU7 A;  1SE2 A;  3K5N A;  5KNC A;  1KDA A;  3AMU A;  3C1F A;  1H9M A;  2VNU D;  1B50 A;  1G2S A;  4CKB A;  2EYJ A;  1PMR A;  3H0G B;  4KY5 A;  5DEH A;  3D8G A;  2HCI A;  4KJN A;  1D1K A;  4FP5 D;  1DD2 A;  3OW7 A;  1SSO A;  4CGY B;  1K83 B;  4IUQ A;  1GUW A;  3NTK A;  1SYB A;  1MSH A;  4IUN A;  5FO9 B;  4U68 A;  2DN8 A;  2O2L D;  3RZO B;  2GA4 B;  1D6E C;  2F0F A;  1VMC A;  5EPK A;  4FNF A;  1YNN D;  4KKT A;  4PMC A;  1AFP A;  5I6W A;  1Z7T A;  4HMJ A;  4ABN A;  2JP1 A;  2XIW A;  1XWE A;  4KI0 A;  2NZ1 D;  3U9O A;  4BA2 I;  2F4I A;  1LTG D;  1KNA A;  3SR1 A;  2VB3 X;  1WD1 A;  4XDX A;  5ELE A;  2RBM A;  2Z8L A;  1PDQ A;  3IL8 A;  4Z9C B;  1MGS A;  3DM1 A;  1SND A;  1HUM A;  1LT6 D;  3WDN A;  2EYL A;  5CV4 A;  1ZYR D;  4QIW B;  3IFT A;  3J7A F;  3DWP A;  1O7Y A;  3D6C A;  1FNW A;  3PV0 A;  1KLG D;  1WTX A;  3A56 A;  3GO5 A;  5J39 A;  4RKL A;  2JSO A;  3SDZ A;  3R2I A;  5ELD A;  4DN4 M;  3N52 A;  3MEH A;  2EPB A;  1BF4 A;  1V43 A;  3IFD A;  2EYH A;  5E4W C;  3BG3 A;  2KA7 A;  5TSS A;  1RTN A;  2R7Z B;  2DNE A;  2J4X A;  3P7J A;  1PRT F;  4RH6 A;  5KYL A;  2IL8 A;  4KY7 A;  3SK6 A;  1GUT A;  1V1O A;  4A93 B;  5EQ0 A;  3CHB D;  4LMQ D;  1Y69 U;  1ZYR C;  2E75 C;  1NUC A;  3SK5 A;  1WVL A;  1DZ1 A;  1STY A;  1I50 B;  1PFB A;  3GTK B;  5BN4 A;  3BDL A;  3S1R B;  2RA4 A;  2A68 C;  1E0B A;  1SNC A;  1I6H B;  1W6K A;  3OMG A;  1B3A A;  2O4X A;  1II3 A;  3BVZ A;  5F2D A;  2F0H A;  1CFM A;  3RD4 A;  3S1M B;  3CRK C;  2TSS A;  3RZD B;  4RGO S;  4KHZ A;  3QB3 A;  1G2T A;  1R9T B;  3J80 L;  1I4H A;  3V96 A;  1BBX C;  1LTT D;  3EQL C;  2JA5 B;  2R92 B;  1FNV A;  2RVL A;  5I4D A;  4FO2 A;  1DON A;  1LTS D;  4CHT B;  1Q90 A;  1ONL A;  4A3B B;  2NB0 A;  4WOR A;  2WKD A;  2JE6 I;  2B2W A;  3GTL B;  4OHJ A;  1DXM A;  3R3O A;  3F2U A;  1XX8 A;  4HAE A;  2A69 D;  2NVY B;  2KJX A;  1CA6 A;  2RDG A;  2O5J C;  3BDO A;  4F88 A;  1B1Z A;  4X3S A;  1ESR A;  4TSS A;  3MXU A;  2K5D A;  2XVS A;  2FFK B;  3CQZ B;  4X3K A;  4L6T B;  2PNR C;  3DEO A;  1F9Q A;  1WTO A;  1LTA D;  4R9W A;  3T51 B;  3A8K E;  3VYS A;  1AP0 A;  1CQV A;  2QKI C;  1PTO F;  4H7B A;  4A3I B;  1F2Z A;  4A3F B;  3V05 A;  1VDZ A;  3AB9 A;  4B9X A;  1S5C D;  3J80 E;  2A5H A;  1F9R A;  1GHJ A;  1YNJ C;  3S17 B;  5HUR A;  1F9S A;  4ZYS A;  2K05 A;  2F0S A;  1TWF B;  2RKS A;  4DGZ A;  3VA7 A;  5DNF A;  5K36 H;  3M4O B;  4C3I G;  1SYG A;  2OT2 A;  4RKB A;  4TQU S;  1PXU A;  3K58 A;  5I2Y A;  4WJW A;  5KNB A;  4FXG C;  5KYI A;  3MA2 B;  5HGT A;  4LK1 C;  1F9P A;  3K6O A;  5ISR A;  3VR2 A;  3TP7 A;  2A6E C;  1JIC A;  3KF8 A;  2WII B;  4N9T A;  1W6J A;  2Q8T A;  5C0X I;  1SJE D;  2B2T C;  2Y0S B;  4S3S A;  1JC7 A;  1UEA B;  2F3W A;  1PRT B;  5FO8 B;  2OF1 A;  5C5L A;  3SE0 A;  1LT3 D;  3LWE A;  5FLX L;  1TII D;  1TWC B;  1HPC A;  3QWN A;  4IFD I;  5LL6 S;  3L7Z C;  2C5C A;  4K6L A;  5CGK A;  4RA8 A;  1EY0 A;  4QUC A;  3T56 B;  1JQY D;  1TWH B;  2NN6 H;  2NUC A;  4CJ1 B;  5NUC A;  2E74 C;  1PLF A;  2EYF A;  3MXN A;  4C1N K;  3S16 B;  5KGU A;  2KEE A;  1JWS D;  4F87 A;  1S5B D;  3GP7 A;  5DAU A;  5JJZ A;  2I46 A;  2B8G A;  2EJF C;  1BUV T;  1PTO D;  5KND A;  3GTM B;  2QIL A;  2F0G A;  1ET9 A;  3IKJ A;  4K6D A;  3ONA B;  4ME5 A;  4OO1 H;  3NK9 A;  4ZQ3 A;  4DFA A;  4BWG B;  4G4K A;  2CW0 C;  1HRJ A;  5IT9 L;  2F0L A;  1PRT D;  1EL0 A;  1BNZ A;  2Z4I A;  1LTI D;  2K04 A;  3I4L A;  1QNK A;  2F0W A;  4X3U A;  1BDO A;  3PUY A;  2KQ3 A;  3I90 A;  3QOL A;  1CA5 A;  2HDM A;  5BN5 A;  1VCI A;  4RGM A;  3J7A V;  1OXU A;  3FMC A;  4JBW A;  2RQX A;  3S2H B;  1D5M C;  1BCP F;  4G7Z C;  3QG1 A;  3OWF A;  1GXD C;  2L5T A;  3T13 A;  2HCC A;  2HDL A;  1LV9 A;  2F0K A;  1SE3 A;  3R93 A;  2F0Q A;  1CT1 D;  4I7Z C;  4DAP A;  1X3P A;  5C0X J;  5IIF A;  1TS2 A;  3EA6 A;  1PFN A;  1B53 A;  3ERO A;  2ZXR A;  2A68 D;  3NHH A;  1C48 A;  1PTO C;  1H9S B;  4DNR B;  3RMH A;  3OIP A;  5CR3 A;  5EPJ A;  1Q3L A;  3BDC A;  3K5O A;  4FXK C;  4EGV A;  3V2T A;  4K2L A;  4DF7 A;  2EYM A;  5JEA J;  2B2W C;  4BA1 I;  5EPL A;  3M85 A;  2NN6 I;  1WCM B;  2F0U A;  2BCO A;  2NBF A;  4C3H B;  2EXZ A;  5G3L F;  4PMW A;  2FJ2 A;  1AN8 A;  4C3J B;  2KOL A;  4G7O C;  2ICE C;  4KD3 A;  1OXS C;  3TP6 A;  1E2Z A;  3S1N B;  2O5I C;  3PIP 3;  4J8Q A;  1UUP A;  5A2Q L;  3GD7 A;  2WP8 J;  4BY7 B;  4TKO B;  1LT5 D;  4ULL A;  1PZJ D;  4KV6 A;  2OXP A;  1D5Z C;  5CV9 A;  2ID0 A;  4I65 A;  3UI2 A;  2EOT A;  2F0E A;  1SYE A;  2DY8 A;  1ENA A;  1EU4 A;  4K2K A;  1SE4 A;  1SMY C;  2D9U A;  1R4P B;  1EOT A;  4C56 C;  1E2V A;  2ZXP A;  2ZT9 C;  3VYR A;  2IX1 A;  4A3J B;  4E6I A;  4KD4 A;  1KDC A;  2LFN A;  4FXD A;  3VR6 A;  3C3L A;  3KUP A;  2RSN A;  4ZK9 B;  4H13 C;  2MP1 A;  1T5X D;  1V1P A;  2A69 C;  2XN9 C;  3S2D B;  3IAY A;  3MFG A;  1U4L A;  4UDU C;  3VA5 A;  4H0L C;  2X69 A;  2L55 A;  2A74 C;  2PQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...