3V2TA

Crystal structure of staphylococcal nuclease variant delta+phs i92a/v66a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3v2tA00
3PMFA 4I65A 5HGTA 4NDXA 5EKLA 3T16A 3NK9A 4KY6A 3NUCA 3TP5A 4DF7A 3D8GA 1EY9A 4E6IA 4K8IA 4NP5A 3SK6A 5JOBA 2RBMA 3NHHA 3T13A 3C1EA 3U9OA 5IIFA 4MIUA 5CR3A 3EJIA 3SR1A 3V2TA 2F0PA 1II3A 3BDLA 4KJOA 4ID6A 4QF4A 2F3WA 4KY7A 4B9XA 1TQOA 5IGFA 5J22A 5KGUA 4TRDA 4WORA 5EGTA 5IGDA 1STHA 2F0HA 3QOLA 1EY8A 3MEHA 1EYAA 4KHVA 4H7BA 2EYOA 4KJNA 2F0LA 4N9PA 5E1FA 4K8JA 1SNCA 4K6DA 3TMEA 4ODGA 1IHZA 2F0TA 2F0QA 2KHSA 1STYA 5CV7A 5EKKA 5KIXA 3OMCA 4ZUJA 3NP8A 4S3SA 2QDBA 5CC4A 3MXPA 2SOBA 1ENAA 3D6CA 1EYDA 4QMGA 4ZUIA 5C4ZA 2PZWA 3SXHA 1ENCA 5K5PA 1SYCA 5KYLA 4KY5A 5KRUA 1A3TA 1KDCA 2OXPA 1EYCA 3R3OA 4J1MA 3TP7A 4KD4A 2EXZA 1EY5A 2EYHA 5DEHA 2EY6A 1EY7A 3QOJA 3D4WA 3SK8A 3DMUA 3LX0A 3MHBA 4F8MA 4HMJA 5JAVA 4NKLA 2F0OA 4NMZA 2F0MA 1KDAA 1SYFA 4PMCA 3MVVA 2OEOA 2F0IA 4DFAA 4LAAA 2PW7A 1A3UA 3BDCA 3ITPA 5KYIA 2F0UA 3H6MA 2LKVA 5IGCA 2F0SA 5C5MA 5IGBA 4K2KA 1SYGA 4PNYA 3EROA 1STGA 2PYKA 3EVQA 2SNMA 4IALA 5CV6A 5F2DA 1EQVA 1STNA 2F0WA 5I6YA 2HQEA 1EY4A 2NUCA 3HZXA 1EY6A 1KAAA 4K5VA 4KV6A 4R8NA 4EVOA 2F0FA 2EYLA 3QB3A 1JORA 1JOQA 2EYFA 3ERQA 5IODA 1A3VA 2EYJA 1EZ6A 2F0JA 3SK4A 4F7XA 1SNDA 1JOOA 5IGGA 5E3FA 5ISRA 1SYBA 3OWFA 5CV5A 1NSNS 2OF1A 4DGZA 5M9OA 4HTHA 2SNSA 3SHLA 1TR5A 2EY1A 2F0VA 4ME5A 5NUCA 3RUZA 5CV4A 2EYMA 2EY5A 4K5XA 1NUCA 1SYEA 1STAA 4RKLA 5J1ZA 1RKNA 4ZQ3A 4KD3A 1SNPA 5C3XA 2O4XA 5HURA 4HMIA 1JOKA 4OL7A 4WRDA 3DHQA 1F2ZA 5I6WA 3VA5A 2F0NA 4RKBA 4K5WA 3MZ5A 1KDBA 2PZTA 2WACA 3D4DA 4IZ8A 3P75A 5I9OA 3SK5A 1F2MA 4EQOA 5KEEA 5C3WA 4EQNA 5CGKA 1A2UA 2RDFA 1EY0A 4EQPA 3NQTA 2F3VA 3P1HA 2PZUA 2F0KA 2F0DA 3OMGA 3TP6A 2EYPA 1TT2A 3E5SA 4PMBA 4K14A 5CV8A 4J6HA 1SNOA 4B9WA 5IOCA 4DU9A 3OSOA 4QB4A 1EZ8A 5C6AA 3NXWA 4IUNA 5IGEA 4G57A 3TP8A 2PW5A 3S9WA 2F0GA 2KQ3A 4K2LA 5I9PA 1AEXA 1SNMA 5C4HA 2ENBA 2PQEA 2EY2A 5CV9A 1A2TA 2M00A 1F2YA 1STBA 2RKSA 1SYDA 1U9RA 1SNQA 2F0EA 3HEJA 3C1FA 4N9TA 4YIJA 5DAUA 5J39A 1KABA 4KTAA 5C5LA
chains in the Genus database with same CATH superfamily
1Y1VB 4IFDJ 5HGTA 2K01A 3TP5A 1MD2D 3M3YB 2JA8B 4NP5A 3C1EA 4X62L 1CHQD 1S72A 3S2DH 3PUVA 1NJIC 1I6HH 4MTNA 3GTGB 4RHRA 1JE5A 3GV6A 5BN5A 3OTOL 5IYBH 1PMRA 3KLSX 2FINB 4RGOS 1NNXA 4K8JA 4QY7A 5DM73 2MUYA 4ODGA 1S5CD 1KXLA 4JI1Q 1L0YB 4LF8Q 4AYBE 4K0KL 1SYCA 2C5CA 3QJYA 3GTQH 3E0EA 2RHQB 1AZQA 2EYHA 3KLSA 1E24A 4A3FG 4UP8A 3KYHC 1C7YA 1JJ2A 5LL6X 4HMJA 1F2LA 1LTRD 4NKLA 1EFWA 4RWSC 2KCMA 1HA5A 1B8AA 3CF5A 4BBRH 3GTMH 4JI6L 5IP9G 4GKJL 2ZXPA 3SVMA 2JA6G 2R7ZB 4Y7NH 4R4TA 1WYDA 2XWBB 1VQHA 2EYFA 4MZ9A 3W5OA 3RZOH 4HSVA 5IGGA 1I94Q 3NBHB 3K8AA 1CHPD 4CDCC 2QF7A 2I46A 4DGZA 2EJFC 1TR5A 3MA2B 1OXXK 3F2BA 4P71A 5IYDH 1CKNB 2JJQA 2VB3X 3HKZE 4X66L 2M9VA 1BCPF 1B50A 4IPDA 4LMQD 5D3IB 2MPMA 1CKMA 3T51B 4DR4L 3D4DA 5I9OA 1CKOA 1TS4A 1WI5A 2B3GA 2HQLA 2HT1A 3NWSA 5CMDA 1SE4A 3GTKH 1E2VA 2PZUA 2F0KA 1HUMA 3T4AC 4BWGB 2I07B 3TN2A 2IL8A 4CKBA 4J6HA 1TWHB 1PLFA 2CVRA 1LTBD 1X3PA 2B2TA 4GS3A 2PNHA 2DJFC 4A3MB 3EFXD 1WD1A 4HJ8A 5D14A 2Y0SE 4TVAB 2KBNA 1HXYD 4F88A 1HZBA 4AQYL 5DAUA 3K5MA 3CC7A 3HOZB 5C5LA 2X6LA 4BY7H 2IX0A 4HIKA 3WOEA 3H3VH 1B9NA 1N36L 1SN8A 4U68A 3JAML 3T13A 3PSIA 2LS01 2UUBL 1UEAB 2Q8IB 2VW9A 4B9XA 1TQOA 3PUZA 1BO0A 3J81j 1QILA 1D6EC 4PV1C 1ICFB 5COYA 1PH7A 2HCCA 2HUGA 2EYOA 2BDOA 1PTOD 2E2HH 4JI3L 1E22A 5CV7A 1E0BA 4J8QA 3Q8DA 1GUTA 3Q24A 2K5NA 3RLFA 1XNQQ 2OTJA 1TWFB 4QIWB 3R3OA 4YHHL 4J1MA 2VUMG 4H02A 1PH5A 1IBMQ 3QOJA 1WTQA 4JC0A 3A8JE 2Z6KA 5M3FB 1NR4A 1T5XD 3QIAA 1L1OC 3MWYW 3CC4A 3HOYG 4DV3L 1ESRA 1SFOB 5I2YA 2F0SA 2L5TA 1LO5D 1NY4A 3OYYA 1VDZA 3NE5B 1DGSA 1EY6A 4O42A 4CKCA 3K6OA 2MO1A 3PQIA 3ERQA 2I5LX 1RIPA 2UUAQ 2L12A 3J80c 1D7QA 1IW7C 4C1NK 3BVGA 2K04A 3ICEA 1ICWA 1N33Q 3CQZH 1I4PA 4U673 2HDMA 3RUZA 2EY5A 1F77A 2LY7A 5KNDA 5C3XA 1S5DD 1S5BD 3S14B 4UHVA 4WRDA 1IYVA 3E3XA 3Q22A 3PO2H 4X3KA 5EAYA 3S1RH 1QVCA 1QNKA 2RDFA 1YNNC 4LWCA 4XQNA 4X65Q 3E5SA 1GUGA 1X3GA 1X6OA 1XNRL 3ND8A 5T1IA 2B8GA 1NMFA 2RQXA 4IFDG 1PYWD 3CU7A 1XPOA 1F9RA 2WB1B 4DR7L 1Z9FA 3S9WA 1AEXA 1JC7A 2QGQA 3KLRA 1SYDA 1V8QA 4A3JH 2L4NA 1YNXA 1K0SA 4NPSA 2NVYH 4DR3Q 4IPHA 1TWAB 4K8IA 2RBMA 2ZXOA 4DUZQ 1PZJD 4QF4A 4WORA 1LTTD 4OONA 3QOLA 1BCPC 4JG2A 1EYAA 4LUVA 4X64L 1WJJA 4BA1I 2VXWA 4N9PA 4RHSA 1SNCA 5IT9c 2XGTA 2NWGA 1YNJC 4B3SL 2R93G 1VQKA 5A35A 2IHEA 1I4GA 4XDXA 5I4DA 5K5PA 1LUZA 3RNUA 4PZ8A 2J4XA 1TWGH 1EYCA 4HIMA 4KD4A 1S5ED 1TWHH 4R9WA 1X65A 2N3SA 2P5ZX 2VS1A 3DMUA 1GKHA 3C3LA 1WOCA 4KHZA 5JVG3 4GNXA 3DLLA 2K6AA 3MVVA 2F0IA 3MXUA 4LAAA 5FO9B 2ZM6Q 1B7YB 3I73A 2EJGC 2LKVA 5F2DA 4ZLTF 1XMQL 3W1GA 1B9MA 2B2YC 2Z0SA 2I5MX 3HOWB 3J80E 3H3VC 1ET9A 2AKWB 4EVOA 4A3DG 1WCMG 1UUPA 4V190 1JORA 1JOQA 2EYJA 1OTCA 1I6VC 2X69A 4BY1H 5JJIA 3GV3A 3SE0A 2R6GA 3S1QH 4HIDA 1L2FA 5GAEC 4X3SA 2D62A 5C4XB 2WINB 3V05A 4IOCA 4HCEA 3STBD 5HURA 2I0QA 1Z6HA 2A19A 2DY7A 1VQ9A 2R7DA 2O2LD 2YTXA 3T1YQ 3VYUA 4EQNA 3HOUB 4OWWB 2F3VA 5C3EB 2KENA 2EJMA 3CCSA 2RCNA 3I4MG 1Y1WG 1E1TA 4JI8Q 3K7AH 3OSOA 3HOXB 5M3FH 2NVQH 4V0BA 2A73B 3D31A 3WWVA 1Z7TA 2BOSA 2L15A 2XSCA 2ZTDA 4FDBA 1SMXA 2B2UA 3FKIB 4YIJA 1SNQA 5FKAC 3T1HQ 2RDGA 4A3KG 4NDXA 1LTAD 4LF4Q 4DV4Q 4FP5D 4ZKBB 4JPBW 1XX8A 4A3IB 4FXDA 1SEBD 5LMNQ 2K28A 1U4LA 3VA7A 2NVTH 1V1PA 4HIOA 2ASBA 3A5ZB 2F0LA 4ULLA 2K5DA 4ZAIA 1HQRD 1IL8A 3GO5A 1ESFA 3ONAB 3E0JA 4L8JA 3CD6A 4QMGA 2UXBL 3A8IE 2D0OA 4O0AA 1YEZA 2YU9H 2R92G 2OXPA 1K28A 2CCZA 2BH8A 1KD1C 3VR6A 3PV0A 5ELDA 2KECA 3M4PA 4RCNA 3FPUB 3GTOB 1TWCB 4CDFC 2RDHA 2O5IC 1Q12A 1K73C 1YNND 2A1AA 3PO3B 5CV6A 3Q0AA 3U58A 4GKKL 4BS9A 4Q5VA 2OCEA 1EOTA 1TWAH 4RGNA 4LFAL 2PNRC 1G51A 1PH4A 1PH1A 1HFGA 1UWVA 1B1ZA 4GNXB 1PV4A 3EIVA 3D3RA 2EYMA 1O80A 2Z1CA 5IY0A 4B3TQ 1EIHA 1Y69U 1EU3A 1NR2A 2O4XA 5M3MB 1YHQA 3P7JA 3I4NG 5C0XG 1BXTA 4A3EH 4WJ3M 1F2MA 5KEEA 1F9QA 2A6EC 4R4QA 1ASYA 4LF5Q 4GOPC 2Z8LA 4OHJA 2K50A 4OIKA 3MEFA 4JI2Q 2ATWA 5LL6S 3OIPA 4UP7A 4B9WA 1YBYA 1BCPD 1E2ZA 4XQQA 1P16A 3KFUA 1NMGA 5AJ3L 1SMYD 1YNJD 2XRSD 3ZJYC 4IFDI 4L5TA 2E2JB 3F2CA 1B53A 5FOBB 3HOVB 1H9SB 1SNMA 3GTJB 1C0AA 3TS0A 3W3AA 3UDFA 1A15A 1H9JA 3H91A 4G4KA 4C3JB 4KTAA 3M4QA 2K32A 1PZID 2Z4HA 4H44C 2JYOA 3ULPA 3IKJA 2TMPA 1KLUD 4H0LC 4YY3L 2H5XA 4JK1C 2WAQE 5C4XH 1AP0A 5ELBA 3KBGA 4C3HG 2YTVA 1QE6A 1Q1BA 3MEHA 3BU2A 3NTHA 3I3CA 1S4ZA 4FF1A 2HHHQ 5JPMC 1L0WA 2AWNA 4LF7Q 4NW2A 2V1CC 2AUJD 1HR0Q 5FO7B 3P20A 4DV6L 1TXYA 1OXUA 5DEHA 1EY7A 4OELB 2IW3A 2PCFB 3WDNA 1P8LA 3HG9A 3R93A 1CA5A 1BF4A 3NTIA 2F0MA 1V1PB 4DR2L 2E2DC 2F0UA 1HNXL 4BBSB 4LUOA 4A93B 2PMZE 4KV6A 3E9HA 1PFBA 4UAIA 4RFBA 4JVZA 3PIP3 4A3IH 3PUYA 3J7YW 2OF1A 2K5HA 4GN5A 2WAQG 3TSSA 5CV4A 2K7VA 1NUCA 1SYEA 3AFQA 4ZQ3A 3QR8A 1JOKA 1XTCD 5I6WA 1ZEQX 3J81E 2D9UA 5IWAQ 1KDBA 3CCVA 5IYBG 3NSWA 3IFTA 4GN3B 5EBCA 2NBFA 1JR0D 1VQFA 1OXTA 4PMBA 4ZYSA 1SNOA 1NCVA 4HJAA 1SR3A 4ALPA 2PQAA 4FXGC 3GTOH 1TWCH 1LTSD 1VQBA 2B39A 4TKOB 1YI2A 4RMFA 3G71A 4RGMA 4JI7L 3UE0A 5KNBA 1PH8A 4BBRG 4A3FB 2K52A 1JT8A 4DR5Q 4N8FA 3D4RA 2K33A 2B2TC 5BR8Q 4OWTB 1O78A 1RODA 4MIUA 1MIUA 4KK7A 2F3WA 3NQIA 1OXVA 5CORA 4MHEA 1K8OA 4R4CA 1FYCA 1YJ9A 1C4QA 1STYA 3AB9A 4XTCS 4XQJA 5IYDG 1MJEA 3MFYA 4LFCQ 3S16H 3O13A 4S3SA 2JXMB 1D5ZC 5C4JB 4A3DB 3RZDB 3BZKA 1E1OA 5M5YB 2JE6I 1H95A 1PDQA 4P74A 1I3QB 2CWPA 1HNWL 1TY2A 1H9RA 2E5LQ 1BVSA 2CH4W 4LF6L 2E2IH 2B8FA 3PF5A 1BBXC 1SLJA 4C3IH 3CMEA 1N32L 3I91A 3HOVH 2MP1A 2YV5A 4C2MH 4OO1I 2LXKA 2A6ED 3KJPA 3H0GH 4AYBB 4C3JH 4PNYA 2QEJC 2N88A 3I72A 4G7ZC 1Y8NB 2FXQA 1LABA 4PZ6A 2CHBD 1EFID 1LT3D 4EX5A 1HZAA 2BH2A 1RHPA 3KLWA 1F9SA 4LF9L 2F0JA 2XNAC 3K0XA 4UDUC 1PA6A 3OWFA 1V1QA 4BY7G 2KHIA 1KHIA 3VYTA 3PIPA 4K5XA 3ER0A 1NBWA 4A3BH 2JN4A 2FMCA 4GZYC 3G48A 3PF4A 2AMCB 5L37A 4JI0Q 2XIWA 1GUSA 2E74C 3G6JB 1A8VA 2BA0A 2KJXA 4IUVA 4J15A 5CGKA 5C0XI 1LM0A 1J6QA 4LUZA 3CCRA 2IX3A 3A7AB 2HIVA 4K14A 3TS2A 1SSOA 4LNQA 1Q8KA 3BYTB 3HKZB 1HA6A 1MGSA 3C46A 3NENA 4CHTB 5A2QL 4KHPQ 3TP8A 5CBAE 2RA4A 1VQGA 3FHWA 4DV7L 4BBSH 4A93H 3HEJA 4N9TA 2F0EA 5ELFA 4DR6L 1S5FD 2VUMB 1RDPD 4DR1Q 4KKUA 4LW1A 1R9TH 1EY9A 1KQSA 1FJGQ 2RSNA 4UP9A 5JOBA 3K81C 1JE4A 3U9OA 2AQ1B 1GD7A 3HOYB 4DV1Q 2PQAB 2Y0SB 1IBLL 4XIGS 4LFBQ 1X55A 2LXJA 5FLMH 1UNSA 2ZTCA 1AN8A 4KLKA 1WD0A 2FMMA 3UDXA 1IBKQ 1VQIA 3KDFA 5LMUL 5IP7H 1B4OA 2F0TA 4BXXG 3BJUA 5KIXA 2F52A 1G6PA 4HR7B 2N55A 1HFNA 2XTIA 2PZWA 1YJWA 3I56A 3PO2G 1A3TA 1D8LA 4A3CG 3L3OC 3CKIB 2EXZA 1D5MC 1CFMA 2Q8TA 4LJZC 3T56B 1EIFA 4NMZA 3IRBA 2OEOA 3MXGA 2LMCB 1LTID 2B2VA 4UPAA 1PRTF 3K7UC 3BZCA 3AYHB 4R4IA 3F2DA 4L63B 5EPJA 4K6LA 1EZ6A 4IURA 1QZHA 1MSHA 4A3JG 4JYAL 1IYJB 1NSNS 5C44H 2QEXA 1VQAA 1HQMC 4KI0A 3KF6A 1VQDA 4OXPA 1SAPA 2R61A 2F0NA 3X3MA 1HTLD 5E4XA 1Y1VH 4RA8A 4MNOA 3J80i 1KNEA 2Q2IA 1K9MC 3DWAA 2JA5B 1I3QH 1SJED 4OWXB 1TIID 1WVLA 2JA8H 3M3YH 1X3EA 3X3NA 4NXML 4ZKCB 4JI5L 1K8AC 3E9IA 1VQCA 1I4XA 3DEOA 4HAEA 3GTGH 1BR9A 2KEEA 4JV5Q 2CFMA 2PO4A 4CGYB 4DV0L 1O7IA 2R93B 4MN3A 3OIQA 1RF2D 2X6GA 2UXCQ 1K8GA 1HNZQ 1TU2B 1I50B 3M4OB 2ZTEA 3R8BA 3VYRA 3VR3A 4KKTA 2K05A 4E6IA 3JAMc 4P72A 1AFPA 3V2TA 1MSGA 4ID6A 3QO2A 1R4PB 5C0XJ 1Q7YC 4OX9L 1HZCA 3OWEB 2UUCL 3GTPB 2F0HA 3L9AX 4IJLA 1FGUA 1BUVT 4BY1G 1QNUA 3TMEA 1UE1A 1WCMB 1X9NA 1IHZA 2Z4IA 1STEA 1WTOA 2R7ZH 2CH4A 2RCFA 1DCZA 4B3RQ 1HHVA 2FFKB 4FF2A 5JPNC 3J7ZC 2L1BA 3D6CA 5J22A 2WFWA 1ENCA 1JJGA 3FP9A 1PTOB 3TP7A 4DKAC 1G2SA 3OW7A 3RD4A 1BOSA 1D1IA 4ZRZA 4IOAA 3HS0C 2EE1A 1EU4A 1D1KA 2PW7A 3KDFB 1FR3A 4JI1L 2F1MA 4LF8L 4K2KA 2PYKA 3I4MB 1DD2A 1Y1WB 3M7GA 1U4PA 1GUNA 4PQXA 1KAAA 5D65A 1SDFA 3QB3A 4XYQA 1DJRD 4JCVE 2OTLA 3I55A 3HOYH 5FLXc 2I5HA 2OT2A 1UE7A 1AE2A 1ONLA 4HN7A 4XYOA 2F0VA 4A3MH 2NVXB 5NUCA 1I4QA 4A3KB 4DNIA 3CCMA 3H3VI 2ZT9C 3EA6A 1WTWA 1XPRA 1EWHA 2JA7B 3HOZH 4HCSA 5CBEE 2ID0A 1PFSA 1C8CA 3K5LA 1JWMD 4IQZA 2L9HA 4B3MQ 1A2UA 1J5EQ 1VQLA 4O1NA 1I94L 4L6TB 1EIGA 2NZHA 2VQFQ 1XMOQ 1IL2A 2YTYA 3W2DA 1KTKA 3CRLC 4O2DA 3LWEA 1ZYRC 2QCPX 3GTLB 1VQ8A 4DUYQ 2F0GA 3KF6B 1PRTC 5I9PA 3I4OA 1V9PA 2RSOA 1H9SA 2M00A 2UU9Q 5I2XA 3C1FA 3JAME 2R92B 1R4QB 2WKCA 1BDOA 1EOVA 2NTTA 3S1MB 5EKLA 3T16A 3KF8A 4AH6A 1TWFH 4DF7A 2UXDQ 1AW7A 1IYUA 4APVA 5EPLA 3GQBA 2VQEQ 3UDIA 3SR1A 2A5HA 2F0PA 3TBIB 3BDLA 1LT4D 4KKSA 4YWMA 2KHJA 1JWUD 3LNNA 2B63G 1W6KA 1STHA 1CTMA 1IKLA 3L7ZC 1O7LA 5JEAH 1SFOH 2F4VQ 3CPFA 2IX1A 2VY3A 3KOJA 3BDOA 3OMCA 1Q1EA 2JA5H 1VCIA 3NP8A 1WTPA 4X3TA 1EYDA 1JWSD 4A3EG 1EY5A 1OXSC 1VQJA 4DV2Q 2F03A 3H94A 1N34Q 3I4NB 4RGTA 5IT9E 1HRJA 1Q90A 3BVMA 3BDCA 3S14H 4YWKA 3TEHB 3S17B 5IGCA 1SYGA 3EROA 2H4OA 3CXCA 2SNMA 1K83B 1OO9B 2L11A 1XNQL 4FVMA 1I5FA 4KN7C 1VQPA 1AZPA 5FLXE 5DLQE 1FL0A 2N78A 3ND9A 1IBML 2VZAA 2NN6H 1IW7D 3MFGA 4KN4C 2JP1A 3OPOA 3J81L 4NXNQ 2A69C 1JOOA 2E8GA 3S1NB 5LMNW 1GUWA 3J7A5 1HH2P 1GHKA 4ZCKA 5M5WB 5JJZA 5J1ZA 4G7HC 2PI2E 1W2BA 4QUFA 1WCMH 4A3GG 4DV5Q 5GROA 5C4XG 4JI4Q 3QWNA 4IZ8A 2BE5C 2YYZA 5BN4A 5JJKA 4C56C 2UUAL 3P1HA 1KAWA 3TREA 1GXDC 1PVOA 1N33L 1PFNA 3A7LA 4A3LH 1W3SA 1SXTA 5EQ0A 4FYDA 4X62Q 4Z9CB 3EQLC 4G57A 1EIYB 4ZK9B 3OTOQ 4DK3C 2PQEA 2RKSA 1STBA 3SHLA 1U9RA 3J81i 5J39A 1VS0A 1L0XB 3PMFA 4WJ4A 4X65L 5IYCH 2B2YA 3D8GA 2A68C 2AUKA 3R2TA 3EBEA 3I4LA 4JOIA 4CDEC 3NHHA 4K0KQ 3SDZA 2WKDA 1DYQA 2NVXH 3A54A 2BA1A 3KBXA 4A3KH 3CRKC 3GDEA 1CZGA 1PYBA 3AU7A 1L1OB 2JA7H 3M9BA 3IAYA 2ES2A 4JI6Q 3D6WA 5J3BA 4GKJQ 5EKKA 3HOWH 4DR3L 1O7ZA 2QDBA 3KF8B 2WAQB 3DWPA 5G3LF 1KDCA 2DJGC 5FJ8H 4DUZL 3CCEA 4UY8C 1PHJA 5E7NA 1B44D 4F8MA 3FDTA 1G6ZA 1I6HB 3C2PA 1Q86C 5EPKA 3CHBD 1GM5A 3VR4A 1LYLA 2IWHA 1Q81C 4G7OC 4L5SA 4QUCA 1LTGD 4FNFA 4X66Q 1RD9D 1HZ9A 3BS1A 2EXDA 3HOUH 4DR4Q 1O7YA 1JJCB 4OO1H 5C3EH 3FRPB 2D0PA 4RH6A 1BKBA 4CJ2C 1I4HA 3BYYB 1ZYRD 3GTQB 5E3FA 2PPBC 3F2UA 1TVXA 1IKMA 1PRTD 3HOXH 4HTHA 5GADC 2SNSA 1K0RA 2HDLA 1KIXA 4N8X1 2ZM6L 1EEFD 2WV6D 2PMZB 4KD3A 4BBRB 1SROA 4HMIA 1IZ6A 1KNAA 2AHOB 3FKIH 2MQHA 4Y7NB 1HR0W 2CW0C 4AQYQ 4EQPA 4WJWA 3B6YA 1BNZA 4R1JA 3I90A 3RZOB 1YHAA 5K36G 1QVGA 1TT2A 3UE1A 2EPBA 3W1BA 1LV9A 1N36Q 3I4NH 3G4SA 1EZ8A 3NXWA 1SE8A 2UUBQ 1K8MA 2F4IA 3E6ZX 3S17H 2CQOA 3DXJC 3T1YL 1BCPB 2A8VA 2HIXA 1F2YA 1X3QA 4C3IG 3H09A 1KABA 1YJNA 4JI3Q 3NK9A 3CCJA 3H0GG 1X32A 2K4KA 4OGQC 4X3UA 4JI8L 3DM3A 4A76A 3GTKB 3S1NH 1EQRA 3SK6A 1MHWC 2SDFA 4YCUA 4YHHQ 1II3A 1HJPA 2MJ8A 4DAVA 4AIMA 2J0TD 2OQKA 2NTSA 1JB7A 3OW2A 1EY8A 2JEAI 4H7BA 3T1HL 1HPCA 3PO3H 3IFDA 3AFPA 3K57A 1HCZA 2N49A 2F0QA 4DV3Q 4P2CB 4JBWA 4LF4L 4CKEA 1RTOA 1QUQA 2J7ZA 2A69D 4C1NI 4A3BG 4DV4L 2G5DA 4BY7B 4KY5A 1PH9A 1DOMA 5FO8B 4XT3B 5LMNL 1U0LA 3LX0A 1I4RA 2F0OA 3NELA 4MTKA 2JA6B 4IUQA 4ABNA 2BE5D 2OWOA 1DXMA 5M3MH 3NWTA 1RTNA 1VQOA 4ME3A 2E2HB 2FJ2A 3EVQA 3GD7A 1D5XC 3PGZA 4K5VA 2EVBA 2BCOA 1MKHA 1A3VA 2A6HC 4DK6C 4FF4A 3RN2A 4DNTB 1ZXTA 5JVH3 3RMHA 2MO0A 2JSOA 1ILQA 1XNRQ 3I70A 2FHTA 3HKSA 2E2JH 4DXFA 3MXNA 4R8IA 3GTJH 1M8AA 2R3ZA 1EEID 4DR7Q 3QG1A 3VA5A 2DY8A 4K5WA 3HFZB 4FO2A 3OHXC 5FLMG 1PH6A 1B3QA 1EWCA 4FXKC 5C3WA 3NQTA 5IP7G 4JBJA 2ZJQA 1VQMA 1QOHA 3U50C 2B2WA 3CCQA 2G9DA 1EUJA 2Z6KC 2QW7A 4PG3A 4B3TL 1VMPA 1CQFA 5C6AA 4IUNA 1LT5D 3CQZB 3FEWX 5JEAJ 1EWIA 3TZDA 2O5JC 1CA6A 4LF5L 4X64Q 3PO2B 1XXGA 3DM1A 1VF7A 3RLOA 3K59A 2Q8RE 4JI2L 4IUPA 3S1RB 1ET6A 4RCOA 1G8ZD 4XXEA 4B3SQ 3PUWA 2AQ2B 1C9OA 1JCKB 2ZJPA 3S15B 1VQ7A 1KC8C 2L0CA 3ULLA 3I2ZA 5E4WC 5IIFA 1NE3A 1WFQA 3S24A 3F1ZA 2L55A 4L5RC 1NAPA 4KHVA 5C44G 3CAMA 3HGBA 2KHSA 2GA4B 1KL9A 2GVAA 4A3JB 4PMWA 1XMQQ 3MXPA 1ENAA 2NVYB 5KRUA 4TQUS 1VF5C 1F9PA 1Y1VG 3SK8A 2EY6A 2MGSA 3UI2A 2A74C 5KNCA 1MI2A 4KMUC 3Q23A 1LTLA 1CSQA 2NZOA 1S3OA 2JA8G 1V43A 1C48A 3ITPA 3CCLA 1A6XA 2CW0D 4P73A 2HHHL 2D2CC 3K5OA 4LF7L 1QUQB 4CJ0B 1HR0L 4AYBG 3HZXA 1AH9A 2F0FA 5IODA 4GOPB 1D2BA 1TWGB 1BBUA 1SBBB 5ISRA 2BDNA 1KRTA 4A4IA 5CV5A 3J80L 2IT1A 4IPGA 1SE2A 1M90C 1H9KA 2DUDA 2WIIB 2CQAA 1XTDA 4B08A 3DHQA 1FNUA 5ELNA 3STBC 4POGA 1XWEA 3K0YA 1X56A 3CC2A 2D5DA 5H1SE 3LWUA 4A3FH 1EY0A 2R7ZG 4GLAC 1RL2A 5CV8A 3RR5A 5IP9H 4I7ZC 4GNXC 4BY1B 2DN8A 2JA6H 4HSPA 1UEBA 3T53B 2V4DA 3S1QB 2EIFA 4DN4M 3MXNB 3HKZG 3NEMA 5IWAL 5ELEA 5C4HA 3N52A 2JQOA 4KJNA 1VQ4A 1QJOA 3S2HB 5C4JH 2XVSA 3RZDH 3IL8A 4KY6A 5LHY1 1M1KC 5M5YH 3HRZC 1CSPA 1ZKOA 4DPGA 2UXBQ 3BVZA 5IE8A 1PZKD 3K7AB 4QIWE 2NVQB 4JBKA 3BZDB 2Y0SG 2EZVA 3L0OA 5TSSA 3TZUA 1JICA 4A3MG 4JW0A 2A6HD 2C35B 5IT9L 1VMCA 4DR5L 3JAMi 5JJLA 5CC4A 2SOBA 4GKKQ 5C4ZA 5BR8L 1K3RA 1J9OA 3HOZG 4LFAQ 2IY5B 3L2PA 3D4WA 5FLXL 3CP0A 3MHBA 4LK1C 2K5QA 3A55A 4CDDC 1EQQA 4BXXH 4DNRB 1YIJA 1KDAA 2NVTB 2B2UC 2HD3A 2LFNA 1SRUA 2MNAA 1A63A 5G3LD 1S40A 4LFCL 4A3CH 1STGA 3NBIA 2JK8A 1Q46A 2JA9A 3S15H 2K75A 2E75C 2E5LL 1T5EA 3EN2A 2YU9B 2Z9HA 5GAHC 1G91A 2PI2A 1CQVA 1QG7A 4QL5A 4EQ5A 4IO9A 1PXUA 3D0FA 2EOTA 1U4MA 2KA7A 1SNPA 2ALYB 5AJ3Q 1KRSA 2KVMA 1J8IA 1Q8IA 2WB1E 5M3FG 1MBYA 2PZTA 2WACA 4HJ9A 3PUXA 2VUMH 3SK5A 1BQQT 4EQOA 5JEAG 3RN5A 1TY0A 2R7FA 3LGJA 2KCCA 4FF3A 1QVFA 3TP6A 5A2QE 2B63B 2NYZD 2JA5G 2G9HD 1FVIA 2Q2UA 5FK9C 3WOFA 1GJXA 4YY3Q 4JI0L 2E76C 4HEDA 1WTRA 1PFMA 1SMYC 1A2TA 2EDGA 2QA4A 1ML0D 4A3EB 3J7AF 1JQYD 3ULJA 4I65A 4I7AA 2KUMA 2QILA 2Q2TA 2XRQD 3I8ZA 3DWQA 1ENFA 4DV6Q 2C9OA 1YZ6A 3CCUA 1QCBD 4KHPL 2NN6G 2HCIA 4TRDA 2VB2X 2GVBA 3PIO3 5E1FA 4Y52H 1L1OA 2WB1G 4IPCA 3KK7A 3MTSA 1IXRA 2Z6BA 4DR1L 4DR2Q 1Y8OB 2DNEA 1QZGA 5M5XB 1G2TA 1HNXQ 3ERSX 1FJGL 4IUUA 4JOIC 4IFDH 1KLGD 1CM9A 2NZ1D 1UE6A 1AE3A 2IJ0A 4DV1L 4LFBL 4ILWA 1NTGA 5GAGC 4OIJA 3U4VA 1FGBD 5JAVA 4A3GB 1IBKL 1CI3M 1TS3A 2CWAA 3DUZA 3SEBA 4PMCA 3AMUA 3KUPA 4A3LG 1W6JA 2ICEC 5KYIA 1GUOA 3H6MA 3R2IA 1EQTA 1JMCA 1GVPA 4RG1A 4IALA 3S2HH 1B70B 3K58A 2HQEA 1EY4A 1PH2A 2NUCA 4NB3A 3M85A 2EYLA 1B3AA 2K5VA 3VYSA 3PCOB 3HP3A 5T1GA 3SK4A 4L5QA 1SYBA 4EGVA 2TSSA 4HJ5A 1RCVD 5IYCG 3URYA 2KCTA 2R93H 2EQSA 3H15A 4RKLA 3AQQA 3G6EA 5D3DA 3A5UA 4RKBA 1GOZA 4TSSA 1I50H 1M4VA 3P75A 3M4OH 4JI7Q 1PH3A 2JA7G 2MFIA 2K03A 2AWOA 2OQ0A 1VQNA 4QGUA 5HGQA 3U4ZA 4IN3A 4IJHA 1G291 3SGIA 3HOWG 1K3BC 4JBMA 5EKIA 1CT1D 1V1OA 3RLNA 5FJ8G 3GTPH 2XWJB 3GP7A 3K80C 4YWLA 4DAYA 2KQ3A 4K2LA 4IUTA 4A3DH 5CV9A 1CZWA 5KYLA 1FNWA 4CBVA 1U5KA 5GQOA 2F3IA 2N8NA 4GN4B 1E3PA 3NUCA 3VR2A 1PTOH 4YCVA 3CW2C 1PTOF 1FNVA 3A8KE 1UE5A 1YVCA 4C3HB 3HOUG 3EJIA 4OO1G 4JV5L 4KJOA 5C3EG 1EL0A 3F8TA 1HNWQ 2VNUD 2KOLA 1VQ6A 4LF6Q 4QQBX 4RAUC 1ILPA 4R4OA 2UXCL 3HOXG 1HNZL 3CPWA 1E7ZA 1N32Q 4K6DA 3U9SA 5ELOA 3M7NA 3I4MH 1Y1WH 3PIOA 3KJOA 1X3FA 4ZUIA 3A74A 3FKIG 2B63H 1WTHA 1YITA 2ZXRA 1A0IA 1TS5A 4LF9Q 4POFA 3BG3A 3J7AV 1SYFA 4M8AA 1GHJA 4DFAA 2H1EA 1MJCA 2K1BA 1A3UA 4A3IG 1B2TA 3V96A 4A75A 4B3RL 5AFWA 3VDYA 1DONA 1EQVA 1STNA 2F0WA 1UAPA 2KEDA 3S16B 3J81c 1PYSB 1Y8PB 1LT6D 2IPKD 3VR5A 1VQEA 1SNDA 4DAMA 2ICIA 2M2LA 4F87A 3Q6SA 5M9OA 3S2DB 1T9HA 2E2IB 1N9WA 2EY1A 4ME5A 3GTLH 3I7FA 3NPPA 4C3IB 1STAA 3FPPA 4XT1B 4C2MB 5BN3A 1Q82C 3H0GB 5M5XH 1U4RA 3MZ5A 2R92H 4DV7Q 4X6AH 3S1MH 2JEBI 3TRZA 3PO3G 2DNCA 4DR6Q 4QCLA 1DM0B 2F0DA 3OMGA 4M1UB 1HUNA 3AEVA 3ZYYX 2MHVA 4A3GH 1FD7D 4QB4A 4GLXA 1CUKA 3MAQA 5IGEA 4H13C 1IBLQ 3TDQA 4Q0FA 3N6RA 1WTXA 1X54A 4A3BB 3A56A 3GTMB 3G7LA 4B3ML 1J5EL 2LSSA 4PZ7A 4DA2A 5LMUQ 5M3MG 2VQFL 2B2WC 4CJ1B 1XMOL 3NTKA 2CKZB 1YHBA 1EYGA 2RF4A 3TQYA 5CR3A 1E2WA 3CMAA 4KY7A 1DZ1A 4DUYL 5IGFA 5C0XH 2QDLA 5KGUA 5EGTA 1Q3LA 5IGDA 4DAYB 2UU9L 1JB3A 2NN6I 4WFN3 2K14A 4DK0A 1QB5D 2RHSB 3FVQA 5EBDA 4YCWA 1K83H 4BA2I 4ZUJA 2UXDL 5DM63 1SJHD 3HOVG 2VL6A 4DAPA 3SXHA 1BBWA 1R9TB 2AQ3B 2VQEL 4C3JG 4P75A 1CK1A 3NBHA 1H9MA 3A0JA 2DGYA 2QKIC 2WP8J 3MC0B 1XPUA 4JYAQ 5M5WH 2K5WA 2F4VL 1Z47A 3UDGA 1CKNA 3K5NA 1QWYA 1A62A 5C5MA 5IGBA 4GLVB 1HTPA 1TS2A 5I6YA 1N8RC 4R8NA 1PTOC 4HJ7A 4DV2L 2Q2HA 2RVLA 4C3HH 4F7XA 3M4YA 1WTVA 5HY6A 4GOPA 1N34L 5EJWA 4NXMQ 3FMCA 4JI5Q 1TKWB 1DOKA 2B29A 1RKNA 1DOLA 2IHFA 4OL7A 3DEPA 4DV0Q 1F2ZA 1PRTB 4OEMB 2GN5A 1XJVA 3JC66 1SE3A 3OOCA 4DXGA 4NXNL 4BBSG 4A93G 1GO3E 1Y14B 1VQ5A 2KCNA 2EYPA 2ZJRA 5IOCA 5ELCA 1XYIA 4DU9A 1ASZA 2NB0A 4DK1A 4QJFA 1LACA 2XN9C 5C44B 1LLRD 1RJTA 2B2VC 4DV5L 2PW5A 4JI4L 4OX9Q 2ENBA 2UUCQ 2EY2A 5DNFA 5K36H 2SEBD 5CYUA 2A68D
chains in the Genus database with same CATH topology
1Y1VB 4IFDJ 5HGTA 2K01A 3TP5A 1MD2D 3M3YB 2JA8B 4NP5A 3C1EA 1CHQD 3PUVA 3GTGB 4RHRA 3GV6A 5BN5A 1PMRA 3KLSX 2FINB 4RGOS 4K8JA 5DM73 2MUYA 4ODGA 1S5CD 1L0YB 1SYCA 2C5CA 3QJYA 1AZQA 2EYHA 3KLSA 5LL6X 4HMJA 1F2LA 1LTRD 4NKLA 4RWSC 1HA5A 2ZXPA 3SVMA 2R7ZB 2XWBB 2EYFA 4HSVA 5IGGA 1CHPD 2QF7A 2I46A 4DGZA 2EJFC 1TR5A 3MA2B 1OXXK 2VB3X 2M9VA 1BCPF 1B50A 4LMQD 5D3IB 2MPMA 3T51B 3D4DA 5I9OA 1TS4A 3NWSA 5CMDA 1SE4A 1E2VA 2PZUA 2F0KA 1HUMA 3T4AC 4BWGB 2I07B 3TN2A 2IL8A 4CKBA 4J6HA 1TWHB 1PLFA 2CVRA 1LTBD 1X3PA 2B2TA 4A3MB 3EFXD 1WD1A 5D14A 1HXYD 4F88A 5DAUA 3K5MA 3HOZB 5C5LA 2X6LA 2IX0A 3WOEA 1B9NA 4U68A 3JAML 3T13A 2LS01 1UEAB 2Q8IB 4B9XA 1TQOA 3PUZA 1BO0A 1QILA 1D6EC 4PV1C 5COYA 2HCCA 2HUGA 2EYOA 2BDOA 1PTOD 5CV7A 1E0BA 4J8QA 1GUTA 3Q24A 3RLFA 1TWFB 4QIWB 3R3OA 4J1MA 3QOJA 1WTQA 3A8JE 5M3FB 1NR4A 1T5XD 3QIAA 3MWYW 1ESRA 1SFOB 5I2YA 2F0SA 2L5TA 1LO5D 1VDZA 3NE5B 1EY6A 4O42A 4CKCA 3K6OA 3ERQA 2L12A 1IW7C 4C1NK 3BVGA 2K04A 1ICWA 1I4PA 4U673 2HDMA 3RUZA 2EY5A 1F77A 2LY7A 5KNDA 5C3XA 1S5DD 1S5BD 3S14B 4WRDA 1IYVA 3Q22A 4X3KA 1QNKA 2RDFA 1YNNC 4XQNA 3E5SA 1GUGA 3ND8A 5T1IA 2B8GA 2RQXA 4IFDG 1PYWD 3CU7A 1F9RA 2WB1B 3S9WA 1AEXA 1JC7A 3KLRA 1SYDA 1V8QA 2L4NA 1TWAB 4K8IA 2RBMA 2ZXOA 1PZJD 4QF4A 4WORA 1LTTD 3QOLA 1BCPC 1EYAA 4BA1I 2VXWA 4N9PA 4RHSA 1SNCA 2NWGA 1YNJC 5A35A 1I4GA 4XDXA 5I4DA 5K5PA 2J4XA 1EYCA 4KD4A 1S5ED 4R9WA 3DMUA 3C3LA 4KHZA 5JVG3 2K6AA 3MVVA 2F0IA 3MXUA 4LAAA 5FO9B 3I73A 2EJGC 2LKVA 5F2DA 4ZLTF 1B9MA 2B2YC 3HOWB 3J80E 3H3VC 1ET9A 4EVOA 1JOQA 1JORA 1UUPA 4V190 2EYJA 1I6VC 2X69A 3GV3A 3SE0A 2R6GA 5C4XB 4X3SA 2D62A 2WINB 3V05A 4HCEA 5HURA 1Z6HA 2DY7A 2O2LD 3VYUA 4EQNA 3HOUB 2F3VA 5C3EB 2EJMA 3OSOA 3HOXB 4V0BA 2A73B 3D31A 1Z7TA 2BOSA 2XSCA 2B2UA 3FKIB 4YIJA 1SNQA 5FKAC 2RDGA 4NDXA 1LTAD 4FP5D 4ZKBB 1XX8A 4A3IB 4FXDA 1SEBD 2K28A 1U4LA 3VA7A 1V1PA 2F0LA 4ULLA 2K5DA 4ZAIA 1HQRD 1IL8A 3GO5A 1ESFA 3ONAB 3E0JA 4L8JA 4QMGA 3A8IE 2OXPA 3VR6A 5ELDA 3PV0A 2KECA 4RCNA 3FPUB 3GTOB 1TWCB 2RDHA 2O5IC 1Q12A 1YNND 3PO3B 5CV6A 3Q0AA 4BS9A 4Q5VA 1EOTA 4RGNA 2PNRC 1HFGA 1B1ZA 3D3RA 2EYMA 1O80A 2Z1CA 1EIHA 1Y69U 1EU3A 1NR2A 2O4XA 5M3MB 3P7JA 5C0XG 1BXTA 1F2MA 5KEEA 1F9QA 2A6EC 2Z8LA 4OHJA 4OIKA 5LL6S 3OIPA 4B9WA 1BCPD 1E2ZA 4XQQA 1SMYD 1YNJD 2XRSD 4IFDI 2E2JB 1B53A 5FOBB 3HOVB 1H9SB 1SNMA 3GTJB 3W3AA 1A15A 1H9JA 3H91A 4C3JB 4G4KA 4KTAA 2K32A 1PZID 2Z4HA 4H44C 2JYOA 3IKJA 2TMPA 1KLUD 4H0LC 4JK1C 1AP0A 5ELBA 3KBGA 4C3HG 1QE6A 1Q1BA 3MEHA 3NTHA 3I3CA 1S4ZA 4FF1A 5JPMC 2AWNA 4NW2A 2AUJD 5FO7B 3P20A 1OXUA 5DEHA 1EY7A 2IW3A 2PCFB 3WDNA 3HG9A 3R93A 1CA5A 1BF4A 3NTIA 2F0MA 1V1PB 2E2DC 2F0UA 4BBSB 4A93B 4KV6A 1PFBA 4UAIA 4RFBA 3PIP3 3PUYA 3J7YW 2OF1A 3TSSA 5CV4A 2K7VA 1NUCA 1SYEA 4ZQ3A 1JOKA 1XTCD 5I6WA 1ZEQX 3J81E 2D9UA 1KDBA 3NSWA 3IFTA 5EBCA 2NBFA 1JR0D 1OXTA 4PMBA 4ZYSA 1SNOA 1NCVA 4FXGC 1LTSD 2B39A 4TKOB 4RGMA 5KNBA 4A3FB 3D4RA 2K33A 2B2TC 1O78A 1RODA 4MIUA 4KK7A 2F3WA 3NQIA 1OXVA 5CORA 4MHEA 1K8OA 1FYCA 1C4QA 1STYA 3AB9A 4XTCS 4XQJA 3MFYA 3O13A 4S3SA 2JXMB 1D5ZC 5C4JB 3RZDB 5M5YB 2JE6I 1PDQA 1I3QB 1TY2A 1H9RA 2B8FA 1BBXC 3I91A 2MP1A 4OO1I 2A6ED 4AYBB 4PNYA 2QEJC 2N88A 3I72A 4G7ZC 1Y8NB 1LABA 2CHBD 1EFID 1LT3D 1RHPA 1F9SA 2F0JA 2XNAC 4UDUC 3OWFA 3VYTA 4K5XA 2FMCA 4GZYC 2XIWA 1GUSA 2E74C 3G6JB 2BA0A 2KJXA 4IUVA 5CGKA 5C0XI 2IX3A 3A7AB 4K14A 1SSOA 3BYTB 3HKZB 1HA6A 1MGSA 3C46A 4CHTB 5A2QL 3TP8A 5CBAE 2RA4A 3HEJA 4N9TA 2F0EA 5ELFA 1S5FD 2VUMB 1RDPD 4KKUA 1EY9A 2RSNA 5JOBA 1JE4A 3U9OA 2AQ1B 3HOYB 2Y0SB 4XIGS 1UNSA 1AN8A 1WD0A 2FMMA 1B4OA 2F0TA 5KIXA 4HR7B 2N55A 1HFNA 2PZWA 1A3TA 3L3OC 3CKIB 2EXZA 1D5MC 1CFMA 2Q8TA 4LJZC 3T56B 4NMZA 2OEOA 3MXGA 2LMCB 1LTID 2B2VA 1PRTF 4L63B 5EPJA 4K6LA 1EZ6A 4IURA 1MSHA 1NSNS 1HQMC 4KI0A 1SAPA 2R61A 2F0NA 3X3MA 1HTLD 5E4XA 4RA8A 1KNEA 2JA5B 3DWAA 1SJED 1WVLA 1TIID 3X3NA 4ZKCB 1I4XA 3DEOA 4HAEA 1BR9A 2KEEA 2PO4A 4CGYB 2R93B 4MN3A 3OIQA 1RF2D 2X6GA 1TU2B 1I50B 3M4OB 3R8BA 3VYRA 3VR3A 4KKTA 2K05A 4E6IA 1AFPA 3V2TA 1MSGA 4ID6A 3QO2A 1R4PB 5C0XJ 3OWEB 3GTPB 2F0HA 3L9AX 1BUVT 1QNUA 3TMEA 4A3DB 1WCMB 1IHZA 2Z4IA 1STEA 1WTOA 1DCZA 1HHVA 2FFKB 4FF2A 5JPNC 2L1BA 3D6CA 5J22A 1ENCA 1PTOB 3TP7A 1G2SA 3OW7A 3RD4A 1BOSA 1D1IA 4ZRZA 3HS0C 2EE1A 1EU4A 1D1KA 2PW7A 1FR3A 2F1MA 4K2KA 2PYKA 3I4MB 1DD2A 1Y1WB 3M7GA 1U4PA 1GUNA 4PQXA 1KAAA 5D65A 1SDFA 3QB3A 4XYQA 1DJRD 2OT2A 1ONLA 4HN7A 4XYOA 2F0VA 2NVXB 5NUCA 1I4QA 4A3KB 2ZT9C 3EA6A 1WTWA 1EWHA 2JA7B 4HCSA 5CBEE 2ID0A 1C8CA 3K5LA 1JWMD 4IQZA 2L9HA 1A2UA 4O1NA 4L6TB 1EIGA 3W2DA 1KTKA 3CRLC 3LWEA 1ZYRC 2QCPX 3GTLB 2F0GA 5I9PA 1PRTC 2RSOA 1H9SA 2M00A 5I2XA 3C1FA 3JAME 2R92B 1R4QB 2WKCA 1BDOA 2NTTA 3S1MB 5EKLA 3T16A 3KF8A 4DF7A 1AW7A 1IYUA 5EPLA 3GQBA 3SR1A 2A5HA 2F0PA 3TBIB 3BDLA 1LT4D 4KKSA 1JWUD 3LNNA 1W6KA 1STHA 1CTMA 1IKLA 3L7ZC 1O7LA 5JEAH 2IX1A 3BDOA 3OMCA 1Q1EA 1VCIA 3NP8A 1WTPA 4X3TA 1EYDA 1JWSD 1EY5A 1OXSC 2F03A 3H94A 3I4NB 4RGTA 5IT9E 1HRJA 1Q90A 3BVMA 3BDCA 3S17B 5IGCA 1SYGA 3EROA 2H4OA 2SNMA 1K83B 1OO9B 2L11A 4FVMA 4KN7C 1AZPA 5FLXE 3ND9A 3MFGA 2NN6H 1IW7D 4KN4C 3J81L 2JP1A 3OPOA 2A69C 1JOOA 3S1NB 1GUWA 1GHKA 5M5WB 5JJZA 5J1ZA 4G7HC 4QUFA 3QWNA 4IZ8A 2BE5C 2YYZA 5BN4A 4C56C 3P1HA 1GXDC 1PFNA 3A7LA 1SXTA 5EQ0A 4FYDA 4Z9CB 3EQLC 4G57A 4ZK9B 2PQEA 2RKSA 1STBA 3SHLA 1U9RA 5J39A 1L0XB 3PMFA 2B2YA 3D8GA 2A68C 2AUKA 3R2TA 3I4LA 3NHHA 3SDZA 2WKDA 1DYQA 3A54A 2BA1A 3KBXA 3CRKC 1CZGA 3AU7A 3IAYA 3D6WA 5EKKA 1O7ZA 2QDBA 2WAQB 3DWPA 5G3LF 1KDCA 1B44D 4F8MA 3FDTA 1G6ZA 1I6HB 3C2PA 5EPKA 3CHBD 3VR4A 2IWHA 4G7OC 4QUCA 1LTGD 4FNFA 3BS1A 1RD9D 1O7YA 4OO1H 3FRPB 4RH6A 4CJ2C 1I4HA 3BYYB 1ZYRD 3GTQB 5E3FA 2PPBC 3F2UA 1TVXA 1IKMA 1PRTD 4HTHA 2SNSA 2HDLA 1EEFD 2WV6D 2PMZB 4KD3A 4BBRB 4HMIA 1KNAA 4Y7NB 2CW0C 4EQPA 4WJWA 1BNZA 3I90A 3RZOB 5K36G 1TT2A 2EPBA 1LV9A 1EZ8A 3NXWA 1K8MA 2F4IA 3E6ZX 3DXJC 1BCPB 1F2YA 1X3QA 4C3IG 3H09A 1KABA 3NK9A 4OGQC 1X32A 4X3UA 3GTKB 3SK6A 2SDFA 1II3A 2MJ8A 4DAVA 2J0TD 2NTSA 1EY8A 2JEAI 4H7BA 1HPCA 3IFDA 3K57A 1HCZA 2F0QA 4P2CB 4JBWA 4CKEA 1RTOA 2J7ZA 2A69D 4C1NI 4BY7B 4KY5A 1DOMA 5FO8B 4XT3B 3LX0A 1I4RA 2F0OA 2JA6B 4IUQA 4ABNA 2BE5D 1DXMA 3NWTA 1RTNA 2E2HB 2FJ2A 3EVQA 3GD7A 1D5XC 4K5VA 2EVBA 2BCOA 2A6HC 1A3VA 4FF4A 4DNTB 1ZXTA 5JVH3 3RMHA 2JSOA 1ILQA 3I70A 2FHTA 4DXFA 3MXNA 4R8IA 1M8AA 2R3ZA 1EEID 3QG1A 3VA5A 2DY8A 4K5WA 4FO2A 3OHXC 1EWCA 4FXKC 5C3WA 3NQTA 1QOHA 2B2WA 2G9DA 1VMPA 1CQFA 5C6AA 4IUNA 1LT5D 3CQZB 3FEWX 5JEAJ 3TZDA 2O5JC 1CA6A 3PO2B 1XXGA 3DM1A 1VF7A 3K59A 2Q8RE 4IUPA 3S1RB 1ET6A 4RCOA 1G8ZD 4XXEA 3PUWA 2AQ2B 1JCKB 3S15B 2L0CA 5E4WC 5IIFA 2L55A 1NAPA 4KHVA 3HGBA 2KHSA 2GA4B 4A3JB 4PMWA 3MXPA 1ENAA 2NVYB 5KRUA 4TQUS 1VF5C 1F9PA 3SK8A 2EY6A 2MGSA 3UI2A 2A74C 5KNCA 1MI2A 4KMUC 3Q23A 1V43A 1C48A 3ITPA 1A6XA 2CW0D 2D2CC 3K5OA 4CJ0B 3HZXA 2F0FA 5IODA 1D2BA 1TWGB 1SBBB 5ISRA 2BDNA 5CV5A 3J80L 2IT1A 1SE2A 1H9KA 2WIIB 2CQAA 4B08A 3DHQA 1FNUA 1XWEA 3K0YA 2D5DA 3LWUA 1EY0A 5CV8A 4I7ZC 4BY1B 2DN8A 4HSPA 3T53B 2V4DA 3S1QB 4DN4M 5ELEA 5C4HA 3N52A 4KJNA 1QJOA 3S2HB 2XVSA 3IL8A 4KY6A 5LHY1 3HRZC 1ZKOA 3BVZA 1PZKD 3K7AB 2NVQB 3BZDB 2EZVA 5TSSA 3TZUA 1JICA 2A6HD 5IT9L 1VMCA 5CC4A 2SOBA 5C4ZA 1J9OA 3D4WA 5FLXL 3MHBA 4LK1C 2K5QA 3A55A 4DNRB 1KDAA 2NVTB 2B2UC 2LFNA 5G3LD 1STGA 3NBIA 2E75C 1T5EA 2YU9B 1G91A 1CQVA 1QG7A 1PXUA 2EOTA 1U4MA 2KA7A 1SNPA 2KVMA 1J8IA 1Q8IA 1MBYA 2PZTA 2WACA 3PUXA 3SK5A 1BQQT 4EQOA 5JEAG 1TY0A 2KCCA 4FF3A 3TP6A 5A2QE 2B63B 2NYZD 2G9HD 5FK9C 3WOFA 1GJXA 2E76C 4HEDA 1WTRA 1PFMA 1SMYC 1A2TA 2EDGA 1ML0D 4A3EB 3J7AF 1JQYD 4I65A 2KUMA 2QILA 2XRQD 3I8ZA 3DWQA 1ENFA 2C9OA 1QCBD 2NN6G 2HCIA 4TRDA 2VB2X 3PIO3 5E1FA 3KK7A 3MTSA 1Y8OB 2DNEA 5M5XB 1G2TA 4IUUA 4IFDH 1KLGD 1CM9A 2NZ1D 2IJ0A 4ILWA 4OIJA 1FGBD 5JAVA 4A3GB 3SEBA 1CI3M 1TS3A 3DUZA 4PMCA 3AMUA 3KUPA 1W6JA 2ICEC 5KYIA 1GUOA 3H6MA 3R2IA 1EQTA 4IALA 3K58A 2HQEA 1EY4A 2NUCA 3M85A 2EYLA 1B3AA 3VYSA 3HP3A 5T1GA 3SK4A 1SYBA 4EGVA 2TSSA 1RCVD 3URYA 4RKLA 5D3DA 4RKBA 1GOZA 4TSSA 1M4VA 3P75A 2K03A 2AWOA 4IN3A 1G291 5EKIA 1CT1D 1V1OA 2XWJB 3GP7A 4DAYA 2KQ3A 4K2LA 4IUTA 5CV9A 1CZWA 5KYLA 1FNWA 4CBVA 3NUCA 3VR2A 1PTOH 1PTOF 1FNVA 3A8KE 4C3HB 3EJIA 4OO1G 4KJOA 1EL0A 2VNUD 2KOLA 1ILPA 4RAUC 4K6DA 3U9SA 3M7NA 4ZUIA 2ZXRA 1TS5A 3BG3A 3J7AV 1SYFA 4M8AA 1GHJA 4DFAA 2H1EA 1B2TA 2K1BA 1A3UA 3V96A 5AFWA 1DONA 1EQVA 1STNA 2F0WA 1UAPA 2KEDA 3S16B 1Y8PB 1LT6D 2IPKD 3VR5A 1SNDA 2ICIA 2M2LA 4F87A 3Q6SA 5M9OA 3S2DB 2E2IB 2EY1A 4ME5A 3NPPA 4C3IB 1STAA 3FPPA 4XT1B 4C2MB 5BN3A 3H0GB 1U4RA 3MZ5A 2JEBI 2DNCA 4QCLA 1DM0B 2F0DA 3OMGA 4M1UB 1HUNA 3ZYYX 2MHVA 1FD7D 4QB4A 3MAQA 5IGEA 4H13C 3TDQA 4Q0FA 3N6RA 1WTXA 4A3BB 3A56A 3GTMB 3G7LA 4DA2A 2B2WC 4CJ1B 3NTKA 5CR3A 1E2WA 4KY7A 1DZ1A 5IGFA 5C0XH 5KGUA 5EGTA 1Q3LA 5IGDA 1JB3A 2NN6I 4WFN3 4DK0A 1QB5D 3FVQA 5EBDA 4BA2I 4ZUJA 5DM63 1SJHD 4DAPA 3SXHA 1R9TB 2AQ3B 4C3JG 1CK1A 3NBHA 1H9MA 2QKIC 2WP8J 3MC0B 2K5WA 1Z47A 3K5NA 1QWYA 5C5MA 5IGBA 1HTPA 1TS2A 5I6YA 4R8NA 1PTOC 2RVLA 4F7XA 3M4YA 1WTVA 5EJWA 3FMCA 1TKWB 1DOKA 1RKNA 1DOLA 4OL7A 3DEPA 1F2ZA 1PRTB 1SE3A 3OOCA 4DXGA 2KCNA 2EYPA 5IOCA 5ELCA 1XYIA 4DU9A 2NB0A 4DK1A 1LACA 2XN9C 5C44B 1LLRD 1RJTA 2B2VC 2PW5A 2ENBA 2EY2A 5DNFA 5K36H 2SEBD 5CYUA 2A68D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMF A;  4I65 A;  5HGT A;  4NDX A;  5EKL A;  3T16 A;  3NK9 A;  4KY6 A;  3NUC A;  3TP5 A;  4DF7 A;  3D8G A;  1EY9 A;  4E6I A;  4K8I A;  4NP5 A;  3SK6 A;  5JOB A;  2RBM A;  3NHH A;  3T13 A;  3C1E A;  3U9O A;  5IIF A;  4MIU A;  5CR3 A;  3EJI A;  3SR1 A;  3V2T A;  2F0P A;  1II3 A;  3BDL A;  4KJO A;  4ID6 A;  4QF4 A;  2F3W A;  4KY7 A;  4B9X A;  1TQO A;  5IGF A;  5J22 A;  5KGU A;  4TRD A;  4WOR A;  5EGT A;  5IGD A;  1STH A;  2F0H A;  3QOL A;  1EY8 A;  3MEH A;  1EYA A;  4KHV A;  4H7B A;  2EYO A;  4KJN A;  2F0L A;  4N9P A;  5E1F A;  4K8J A;  1SNC A;  4K6D A;  3TME A;  4ODG A;  1IHZ A;  2F0T A;  2F0Q A;  2KHS A;  1STY A;  5CV7 A;  5EKK A;  5KIX A;  3OMC A;  4ZUJ A;  3NP8 A;  4S3S A;  2QDB A;  5CC4 A;  3MXP A;  2SOB A;  1ENA A;  3D6C A;  1EYD A;  4QMG A;  4ZUI A;  5C4Z A;  2PZW A;  3SXH A;  1ENC A;  5K5P A;  1SYC A;  5KYL A;  4KY5 A;  5KRU A;  1A3T A;  1KDC A;  2OXP A;  1EYC A;  3R3O A;  4J1M A;  3TP7 A;  4KD4 A;  2EXZ A;  1EY5 A;  2EYH A;  5DEH A;  2EY6 A;  1EY7 A;  3QOJ A;  3D4W A;  3SK8 A;  3DMU A;  3LX0 A;  3MHB A;  4F8M A;  4HMJ A;  5JAV A;  4NKL A;  2F0O A;  4NMZ A;  2F0M A;  1KDA A;  1SYF A;  4PMC A;  3MVV A;  2OEO A;  2F0I A;  4DFA A;  4LAA A;  2PW7 A;  1A3U A;  3BDC A;  3ITP A;  5KYI A;  2F0U A;  3H6M A;  2LKV A;  5IGC A;  2F0S A;  5C5M A;  5IGB A;  4K2K A;  1SYG A;  4PNY A;  3ERO A;  1STG A;  2PYK A;  3EVQ A;  2SNM A;  4IAL A;  5CV6 A;  5F2D A;  1EQV A;  1STN A;  2F0W A;  5I6Y A;  2HQE A;  1EY4 A;  2NUC A;  3HZX A;  1EY6 A;  1KAA A;  4K5V A;  4KV6 A;  4R8N A;  4EVO A;  2F0F A;  2EYL A;  3QB3 A;  1JOR A;  1JOQ A;  2EYF A;  3ERQ A;  5IOD A;  1A3V A;  2EYJ A;  1EZ6 A;  2F0J A;  3SK4 A;  4F7X A;  1SND A;  1JOO A;  5IGG A;  5E3F A;  5ISR A;  1SYB A;  3OWF A;  5CV5 A;  1NSN S;  2OF1 A;  4DGZ A;  5M9O A;  4HTH A;  2SNS A;  3SHL A;  1TR5 A;  2EY1 A;  2F0V A;  4ME5 A;  5NUC A;  3RUZ A;  5CV4 A;  2EYM A;  2EY5 A;  4K5X A;  1NUC A;  1SYE A;  1STA A;  4RKL A;  5J1Z A;  1RKN A;  4ZQ3 A;  4KD3 A;  1SNP A;  5C3X A;  2O4X A;  5HUR A;  4HMI A;  1JOK A;  4OL7 A;  4WRD A;  3DHQ A;  1F2Z A;  5I6W A;  3VA5 A;  2F0N A;  4RKB A;  4K5W A;  3MZ5 A;  1KDB A;  2PZT A;  2WAC A;  3D4D A;  4IZ8 A;  3P75 A;  5I9O A;  3SK5 A;  1F2M A;  4EQO A;  5KEE A;  5C3W A;  4EQN A;  5CGK A;  1A2U A;  2RDF A;  1EY0 A;  4EQP A;  3NQT A;  2F3V A;  3P1H A;  2PZU A;  2F0K A;  2F0D A;  3OMG A;  3TP6 A;  2EYP A;  1TT2 A;  3E5S A;  4PMB A;  4K14 A;  5CV8 A;  4J6H A;  1SNO A;  4B9W A;  5IOC A;  4DU9 A;  3OSO A;  4QB4 A;  1EZ8 A;  5C6A A;  3NXW A;  4IUN A;  5IGE A;  4G57 A;  3TP8 A;  2PW5 A;  3S9W A;  2F0G A;  2KQ3 A;  4K2L A;  5I9P A;  1AEX A;  1SNM A;  5C4H A;  2ENB A;  2PQE A;  2EY2 A;  5CV9 A;  1A2T A;  2M00 A;  1F2Y A;  1STB A;  2RKS A;  1SYD A;  1U9R A;  1SNQ A;  2F0E A;  3HEJ A;  3C1F A;  4N9T A;  4YIJ A;  5DAU A;  5J39 A;  1KAB A;  4KTA A;  5C5L A; 
#chains in the Genus database with same CATH topology
 1Y1V B;  4IFD J;  5HGT A;  2K01 A;  3TP5 A;  1MD2 D;  3M3Y B;  2JA8 B;  4NP5 A;  3C1E A;  4X62 L;  1CHQ D;  1S72 A;  3S2D H;  3PUV A;  1NJI C;  1I6H H;  4MTN A;  3GTG B;  4RHR A;  1JE5 A;  3GV6 A;  5BN5 A;  3OTO L;  5IYB H;  1PMR A;  3KLS X;  2FIN B;  4RGO S;  1NNX A;  4K8J A;  4QY7 A;  5DM7 3;  2MUY A;  4ODG A;  1S5C D;  1KXL A;  4JI1 Q;  1L0Y B;  4LF8 Q;  4AYB E;  4K0K L;  1SYC A;  2C5C A;  3QJY A;  3GTQ H;  3E0E A;  2RHQ B;  1AZQ A;  2EYH A;  3KLS A;  1E24 A;  4A3F G;  4UP8 A;  3KYH C;  1C7Y A;  1JJ2 A;  5LL6 X;  4HMJ A;  1F2L A;  1LTR D;  4NKL A;  1EFW A;  4RWS C;  2KCM A;  1HA5 A;  1B8A A;  3CF5 A;  4BBR H;  3GTM H;  4JI6 L;  5IP9 G;  4GKJ L;  2ZXP A;  3SVM A;  2JA6 G;  2R7Z B;  4Y7N H;  4R4T A;  1WYD A;  2XWB B;  1VQH A;  2EYF A;  4MZ9 A;  3W5O A;  3RZO H;  4HSV A;  5IGG A;  1I94 Q;  3NBH B;  3K8A A;  1CHP D;  4CDC C;  2QF7 A;  2I46 A;  4DGZ A;  2EJF C;  1TR5 A;  3MA2 B;  1OXX K;  3F2B A;  4P71 A;  5IYD H;  1CKN B;  2JJQ A;  2VB3 X;  3HKZ E;  4X66 L;  2M9V A;  1BCP F;  1B50 A;  4IPD A;  4LMQ D;  5D3I B;  2MPM A;  1CKM A;  3T51 B;  4DR4 L;  3D4D A;  5I9O A;  1CKO A;  1TS4 A;  1WI5 A;  2B3G A;  2HQL A;  2HT1 A;  3NWS A;  5CMD A;  1SE4 A;  3GTK H;  1E2V A;  2PZU A;  2F0K A;  1HUM A;  3T4A C;  4BWG B;  2I07 B;  3TN2 A;  2IL8 A;  4CKB A;  4J6H A;  1TWH B;  1PLF A;  2CVR A;  1LTB D;  1X3P A;  2B2T A;  4GS3 A;  2PNH A;  2DJF C;  4A3M B;  3EFX D;  1WD1 A;  4HJ8 A;  5D14 A;  2Y0S E;  4TVA B;  2KBN A;  1HXY D;  4F88 A;  1HZB A;  4AQY L;  5DAU A;  3K5M A;  3CC7 A;  3HOZ B;  5C5L A;  2X6L A;  4BY7 H;  2IX0 A;  4HIK A;  3WOE A;  3H3V H;  1B9N A;  1N36 L;  1SN8 A;  4U68 A;  3JAM L;  3T13 A;  3PSI A;  2LS0 1;  2UUB L;  1UEA B;  2Q8I B;  2VW9 A;  4B9X A;  1TQO A;  3PUZ A;  1BO0 A;  3J81 j;  1QIL A;  1D6E C;  4PV1 C;  1ICF B;  5COY A;  1PH7 A;  2HCC A;  2HUG A;  2EYO A;  2BDO A;  1PTO D;  2E2H H;  4JI3 L;  1E22 A;  5CV7 A;  1E0B A;  4J8Q A;  3Q8D A;  1GUT A;  3Q24 A;  2K5N A;  3RLF A;  1XNQ Q;  2OTJ A;  1TWF B;  4QIW B;  3R3O A;  4YHH L;  4J1M A;  2VUM G;  4H02 A;  1PH5 A;  1IBM Q;  3QOJ A;  1WTQ A;  4JC0 A;  3A8J E;  2Z6K A;  5M3F B;  1NR4 A;  1T5X D;  3QIA A;  1L1O C;  3MWY W;  3CC4 A;  3HOY G;  4DV3 L;  1ESR A;  1SFO B;  5I2Y A;  2F0S A;  2L5T A;  1LO5 D;  1NY4 A;  3OYY A;  1VDZ A;  3NE5 B;  1DGS A;  1EY6 A;  4O42 A;  4CKC A;  3K6O A;  2MO1 A;  3PQI A;  3ERQ A;  2I5L X;  1RIP A;  2UUA Q;  2L12 A;  3J80 c;  1D7Q A;  1IW7 C;  4C1N K;  3BVG A;  2K04 A;  3ICE A;  1ICW A;  1N33 Q;  3CQZ H;  1I4P A;  4U67 3;  2HDM A;  3RUZ A;  2EY5 A;  1F77 A;  2LY7 A;  5KND A;  5C3X A;  1S5D D;  1S5B D;  3S14 B;  4UHV A;  4WRD A;  1IYV A;  3E3X A;  3Q22 A;  3PO2 H;  4X3K A;  5EAY A;  3S1R H;  1QVC A;  1QNK A;  2RDF A;  1YNN C;  4LWC A;  4XQN A;  4X65 Q;  3E5S A;  1GUG A;  1X3G A;  1X6O A;  1XNR L;  3ND8 A;  5T1I A;  2B8G A;  1NMF A;  2RQX A;  4IFD G;  1PYW D;  3CU7 A;  1XPO A;  1F9R A;  2WB1 B;  4DR7 L;  1Z9F A;  3S9W A;  1AEX A;  1JC7 A;  2QGQ A;  3KLR A;  1SYD A;  1V8Q A;  4A3J H;  2L4N A;  1YNX A;  1K0S A;  4NPS A;  2NVY H;  4DR3 Q;  4IPH A;  1TWA B;  4K8I A;  2RBM A;  2ZXO A;  4DUZ Q;  1PZJ D;  4QF4 A;  4WOR A;  1LTT D;  4OON A;  3QOL A;  1BCP C;  4JG2 A;  1EYA A;  4LUV A;  4X64 L;  1WJJ A;  4BA1 I;  2VXW A;  4N9P A;  4RHS A;  1SNC A;  5IT9 c;  2XGT A;  2NWG A;  1YNJ C;  4B3S L;  2R93 G;  1VQK A;  5A35 A;  2IHE A;  1I4G A;  4XDX A;  5I4D A;  5K5P A;  1LUZ A;  3RNU A;  4PZ8 A;  2J4X A;  1TWG H;  1EYC A;  4HIM A;  4KD4 A;  1S5E D;  1TWH H;  4R9W A;  1X65 A;  2N3S A;  2P5Z X;  2VS1 A;  3DMU A;  1GKH A;  3C3L A;  1WOC A;  4KHZ A;  5JVG 3;  4GNX A;  3DLL A;  2K6A A;  3MVV A;  2F0I A;  3MXU A;  4LAA A;  5FO9 B;  2ZM6 Q;  1B7Y B;  3I73 A;  2EJG C;  2LKV A;  5F2D A;  4ZLT F;  1XMQ L;  3W1G A;  1B9M A;  2B2Y C;  2Z0S A;  2I5M X;  3HOW B;  3J80 E;  3H3V C;  1ET9 A;  2AKW B;  4EVO A;  4A3D G;  1WCM G;  1UUP A;  4V19 0;  1JOR A;  1JOQ A;  2EYJ A;  1OTC A;  1I6V C;  2X69 A;  4BY1 H;  5JJI A;  3GV3 A;  3SE0 A;  2R6G A;  3S1Q H;  4HID A;  1L2F A;  5GAE C;  4X3S A;  2D62 A;  5C4X B;  2WIN B;  3V05 A;  4IOC A;  4HCE A;  3STB D;  5HUR A;  2I0Q A;  1Z6H A;  2A19 A;  2DY7 A;  1VQ9 A;  2R7D A;  2O2L D;  2YTX A;  3T1Y Q;  3VYU A;  4EQN A;  3HOU B;  4OWW B;  2F3V A;  5C3E B;  2KEN A;  2EJM A;  3CCS A;  2RCN A;  3I4M G;  1Y1W G;  1E1T A;  4JI8 Q;  3K7A H;  3OSO A;  3HOX B;  5M3F H;  2NVQ H;  4V0B A;  2A73 B;  3D31 A;  3WWV A;  1Z7T A;  2BOS A;  2L15 A;  2XSC A;  2ZTD A;  4FDB A;  1SMX A;  2B2U A;  3FKI B;  4YIJ A;  1SNQ A;  5FKA C;  3T1H Q;  2RDG A;  4A3K G;  4NDX A;  1LTA D;  4LF4 Q;  4DV4 Q;  4FP5 D;  4ZKB B;  4JPB W;  1XX8 A;  4A3I B;  4FXD A;  1SEB D;  5LMN Q;  2K28 A;  1U4L A;  3VA7 A;  2NVT H;  1V1P A;  4HIO A;  2ASB A;  3A5Z B;  2F0L A;  4ULL A;  2K5D A;  4ZAI A;  1HQR D;  1IL8 A;  3GO5 A;  1ESF A;  3ONA B;  3E0J A;  4L8J A;  3CD6 A;  4QMG A;  2UXB L;  3A8I E;  2D0O A;  4O0A A;  1YEZ A;  2YU9 H;  2R92 G;  2OXP A;  1K28 A;  2CCZ A;  2BH8 A;  1KD1 C;  3VR6 A;  3PV0 A;  5ELD A;  2KEC A;  3M4P A;  4RCN A;  3FPU B;  3GTO B;  1TWC B;  4CDF C;  2RDH A;  2O5I C;  1Q12 A;  1K73 C;  1YNN D;  2A1A A;  3PO3 B;  5CV6 A;  3Q0A A;  3U58 A;  4GKK L;  4BS9 A;  4Q5V A;  2OCE A;  1EOT A;  1TWA H;  4RGN A;  4LFA L;  2PNR C;  1G51 A;  1PH4 A;  1PH1 A;  1HFG A;  1UWV A;  1B1Z A;  4GNX B;  1PV4 A;  3EIV A;  3D3R A;  2EYM A;  1O80 A;  2Z1C A;  5IY0 A;  4B3T Q;  1EIH A;  1Y69 U;  1EU3 A;  1NR2 A;  2O4X A;  5M3M B;  1YHQ A;  3P7J A;  3I4N G;  5C0X G;  1BXT A;  4A3E H;  4WJ3 M;  1F2M A;  5KEE A;  1F9Q A;  2A6E C;  4R4Q A;  1ASY A;  4LF5 Q;  4GOP C;  2Z8L A;  4OHJ A;  2K50 A;  4OIK A;  3MEF A;  4JI2 Q;  2ATW A;  5LL6 S;  3OIP A;  4UP7 A;  4B9W A;  1YBY A;  1BCP D;  1E2Z A;  4XQQ A;  1P16 A;  3KFU A;  1NMG A;  5AJ3 L;  1SMY D;  1YNJ D;  2XRS D;  3ZJY C;  4IFD I;  4L5T A;  2E2J B;  3F2C A;  1B53 A;  5FOB B;  3HOV B;  1H9S B;  1SNM A;  3GTJ B;  1C0A A;  3TS0 A;  3W3A A;  3UDF A;  1A15 A;  1H9J A;  3H91 A;  4G4K A;  4C3J B;  4KTA A;  3M4Q A;  2K32 A;  1PZI D;  2Z4H A;  4H44 C;  2JYO A;  3ULP A;  3IKJ A;  2TMP A;  1KLU D;  4H0L C;  4YY3 L;  2H5X A;  4JK1 C;  2WAQ E;  5C4X H;  1AP0 A;  5ELB A;  3KBG A;  4C3H G;  2YTV A;  1QE6 A;  1Q1B A;  3MEH A;  3BU2 A;  3NTH A;  3I3C A;  1S4Z A;  4FF1 A;  2HHH Q;  5JPM C;  1L0W A;  2AWN A;  4LF7 Q;  4NW2 A;  2V1C C;  2AUJ D;  1HR0 Q;  5FO7 B;  3P20 A;  4DV6 L;  1TXY A;  1OXU A;  5DEH A;  1EY7 A;  4OEL B;  2IW3 A;  2PCF B;  3WDN A;  1P8L A;  3HG9 A;  3R93 A;  1CA5 A;  1BF4 A;  3NTI A;  2F0M A;  1V1P B;  4DR2 L;  2E2D C;  2F0U A;  1HNX L;  4BBS B;  4LUO A;  4A93 B;  2PMZ E;  4KV6 A;  3E9H A;  1PFB A;  4UAI A;  4RFB A;  4JVZ A;  3PIP 3;  4A3I H;  3PUY A;  3J7Y W;  2OF1 A;  2K5H A;  4GN5 A;  2WAQ G;  3TSS A;  5CV4 A;  2K7V A;  1NUC A;  1SYE A;  3AFQ A;  4ZQ3 A;  3QR8 A;  1JOK A;  1XTC D;  5I6W A;  1ZEQ X;  3J81 E;  2D9U A;  5IWA Q;  1KDB A;  3CCV A;  5IYB G;  3NSW A;  3IFT A;  4GN3 B;  5EBC A;  2NBF A;  1JR0 D;  1VQF A;  1OXT A;  4PMB A;  4ZYS A;  1SNO A;  1NCV A;  4HJA A;  1SR3 A;  4ALP A;  2PQA A;  4FXG C;  3GTO H;  1TWC H;  1LTS D;  1VQB A;  2B39 A;  4TKO B;  1YI2 A;  4RMF A;  3G71 A;  4RGM A;  4JI7 L;  3UE0 A;  5KNB A;  1PH8 A;  4BBR G;  4A3F B;  2K52 A;  1JT8 A;  4DR5 Q;  4N8F A;  3D4R A;  2K33 A;  2B2T C;  5BR8 Q;  4OWT B;  1O78 A;  1ROD A;  4MIU A;  1MIU A;  4KK7 A;  2F3W A;  3NQI A;  1OXV A;  5COR A;  4MHE A;  1K8O A;  4R4C A;  1FYC A;  1YJ9 A;  1C4Q A;  1STY A;  3AB9 A;  4XTC S;  4XQJ A;  5IYD G;  1MJE A;  3MFY A;  4LFC Q;  3S16 H;  3O13 A;  4S3S A;  2JXM B;  1D5Z C;  5C4J B;  4A3D B;  3RZD B;  3BZK A;  1E1O A;  5M5Y B;  2JE6 I;  1H95 A;  1PDQ A;  4P74 A;  1I3Q B;  2CWP A;  1HNW L;  1TY2 A;  1H9R A;  2E5L Q;  1BVS A;  2CH4 W;  4LF6 L;  2E2I H;  2B8F A;  3PF5 A;  1BBX C;  1SLJ A;  4C3I H;  3CME A;  1N32 L;  3I91 A;  3HOV H;  2MP1 A;  2YV5 A;  4C2M H;  4OO1 I;  2LXK A;  2A6E D;  3KJP A;  3H0G H;  4AYB B;  4C3J H;  4PNY A;  2QEJ C;  2N88 A;  3I72 A;  4G7Z C;  1Y8N B;  2FXQ A;  1LAB A;  4PZ6 A;  2CHB D;  1EFI D;  1LT3 D;  4EX5 A;  1HZA A;  2BH2 A;  1RHP A;  3KLW A;  1F9S A;  4LF9 L;  2F0J A;  2XNA C;  3K0X A;  4UDU C;  1PA6 A;  3OWF A;  1V1Q A;  4BY7 G;  2KHI A;  1KHI A;  3VYT A;  3PIP A;  4K5X A;  3ER0 A;  1NBW A;  4A3B H;  2JN4 A;  2FMC A;  4GZY C;  3G48 A;  3PF4 A;  2AMC B;  5L37 A;  4JI0 Q;  2XIW A;  1GUS A;  2E74 C;  3G6J B;  1A8V A;  2BA0 A;  2KJX A;  4IUV A;  4J15 A;  5CGK A;  5C0X I;  1LM0 A;  1J6Q A;  4LUZ A;  3CCR A;  2IX3 A;  3A7A B;  2HIV A;  4K14 A;  3TS2 A;  1SSO A;  4LNQ A;  1Q8K A;  3BYT B;  3HKZ B;  1HA6 A;  1MGS A;  3C46 A;  3NEN A;  4CHT B;  5A2Q L;  4KHP Q;  3TP8 A;  5CBA E;  2RA4 A;  1VQG A;  3FHW A;  4DV7 L;  4BBS H;  4A93 H;  3HEJ A;  4N9T A;  2F0E A;  5ELF A;  4DR6 L;  1S5F D;  2VUM B;  1RDP D;  4DR1 Q;  4KKU A;  4LW1 A;  1R9T H;  1EY9 A;  1KQS A;  1FJG Q;  2RSN A;  4UP9 A;  5JOB A;  3K81 C;  1JE4 A;  3U9O A;  2AQ1 B;  1GD7 A;  3HOY B;  4DV1 Q;  2PQA B;  2Y0S B;  1IBL L;  4XIG S;  4LFB Q;  1X55 A;  2LXJ A;  5FLM H;  1UNS A;  2ZTC A;  1AN8 A;  4KLK A;  1WD0 A;  2FMM A;  3UDX A;  1IBK Q;  1VQI A;  3KDF A;  5LMU L;  5IP7 H;  1B4O A;  2F0T A;  4BXX G;  3BJU A;  5KIX A;  2F52 A;  1G6P A;  4HR7 B;  2N55 A;  1HFN A;  2XTI A;  2PZW A;  1YJW A;  3I56 A;  3PO2 G;  1A3T A;  1D8L A;  4A3C G;  3L3O C;  3CKI B;  2EXZ A;  1D5M C;  1CFM A;  2Q8T A;  4LJZ C;  3T56 B;  1EIF A;  4NMZ A;  3IRB A;  2OEO A;  3MXG A;  2LMC B;  1LTI D;  2B2V A;  4UPA A;  1PRT F;  3K7U C;  3BZC A;  3AYH B;  4R4I A;  3F2D A;  4L63 B;  5EPJ A;  4K6L A;  1EZ6 A;  4IUR A;  1QZH A;  1MSH A;  4A3J G;  4JYA L;  1IYJ B;  1NSN S;  5C44 H;  2QEX A;  1VQA A;  1HQM C;  4KI0 A;  3KF6 A;  1VQD A;  4OXP A;  1SAP A;  2R61 A;  2F0N A;  3X3M A;  1HTL D;  5E4X A;  1Y1V H;  4RA8 A;  4MNO A;  3J80 i;  1KNE A;  2Q2I A;  1K9M C;  3DWA A;  2JA5 B;  1I3Q H;  1SJE D;  4OWX B;  1TII D;  1WVL A;  2JA8 H;  3M3Y H;  1X3E A;  3X3N A;  4NXM L;  4ZKC B;  4JI5 L;  1K8A C;  3E9I A;  1VQC A;  1I4X A;  3DEO A;  4HAE A;  3GTG H;  1BR9 A;  2KEE A;  4JV5 Q;  2CFM A;  2PO4 A;  4CGY B;  4DV0 L;  1O7I A;  2R93 B;  4MN3 A;  3OIQ A;  1RF2 D;  2X6G A;  2UXC Q;  1K8G A;  1HNZ Q;  1TU2 B;  1I50 B;  3M4O B;  2ZTE A;  3R8B A;  3VYR A;  3VR3 A;  4KKT A;  2K05 A;  4E6I A;  3JAM c;  4P72 A;  1AFP A;  3V2T A;  1MSG A;  4ID6 A;  3QO2 A;  1R4P B;  5C0X J;  1Q7Y C;  4OX9 L;  1HZC A;  3OWE B;  2UUC L;  3GTP B;  2F0H A;  3L9A X;  4IJL A;  1FGU A;  1BUV T;  4BY1 G;  1QNU A;  3TME A;  1UE1 A;  1WCM B;  1X9N A;  1IHZ A;  2Z4I A;  1STE A;  1WTO A;  2R7Z H;  2CH4 A;  2RCF A;  1DCZ A;  4B3R Q;  1HHV A;  2FFK B;  4FF2 A;  5JPN C;  3J7Z C;  2L1B A;  3D6C A;  5J22 A;  2WFW A;  1ENC A;  1JJG A;  3FP9 A;  1PTO B;  3TP7 A;  4DKA C;  1G2S A;  3OW7 A;  3RD4 A;  1BOS A;  1D1I A;  4ZRZ A;  4IOA A;  3HS0 C;  2EE1 A;  1EU4 A;  1D1K A;  2PW7 A;  3KDF B;  1FR3 A;  4JI1 L;  2F1M A;  4LF8 L;  4K2K A;  2PYK A;  3I4M B;  1DD2 A;  1Y1W B;  3M7G A;  1U4P A;  1GUN A;  4PQX A;  1KAA A;  5D65 A;  1SDF A;  3QB3 A;  4XYQ A;  1DJR D;  4JCV E;  2OTL A;  3I55 A;  3HOY H;  5FLX c;  2I5H A;  2OT2 A;  1UE7 A;  1AE2 A;  1ONL A;  4HN7 A;  4XYO A;  2F0V A;  4A3M H;  2NVX B;  5NUC A;  1I4Q A;  4A3K B;  4DNI A;  3CCM A;  3H3V I;  2ZT9 C;  3EA6 A;  1WTW A;  1XPR A;  1EWH A;  2JA7 B;  3HOZ H;  4HCS A;  5CBE E;  2ID0 A;  1PFS A;  1C8C A;  3K5L A;  1JWM D;  4IQZ A;  2L9H A;  4B3M Q;  1A2U A;  1J5E Q;  1VQL A;  4O1N A;  1I94 L;  4L6T B;  1EIG A;  2NZH A;  2VQF Q;  1XMO Q;  1IL2 A;  2YTY A;  3W2D A;  1KTK A;  3CRL C;  4O2D A;  3LWE A;  1ZYR C;  2QCP X;  3GTL B;  1VQ8 A;  4DUY Q;  2F0G A;  3KF6 B;  1PRT C;  5I9P A;  3I4O A;  1V9P A;  2RSO A;  1H9S A;  2M00 A;  2UU9 Q;  5I2X A;  3C1F A;  3JAM E;  2R92 B;  1R4Q B;  2WKC A;  1BDO A;  1EOV A;  2NTT A;  3S1M B;  5EKL A;  3T16 A;  3KF8 A;  4AH6 A;  1TWF H;  4DF7 A;  2UXD Q;  1AW7 A;  1IYU A;  4APV A;  5EPL A;  3GQB A;  2VQE Q;  3UDI A;  3SR1 A;  2A5H A;  2F0P A;  3TBI B;  3BDL A;  1LT4 D;  4KKS A;  4YWM A;  2KHJ A;  1JWU D;  3LNN A;  2B63 G;  1W6K A;  1STH A;  1CTM A;  1IKL A;  3L7Z C;  1O7L A;  5JEA H;  1SFO H;  2F4V Q;  3CPF A;  2IX1 A;  2VY3 A;  3KOJ A;  3BDO A;  3OMC A;  1Q1E A;  2JA5 H;  1VCI A;  3NP8 A;  1WTP A;  4X3T A;  1EYD A;  1JWS D;  4A3E G;  1EY5 A;  1OXS C;  1VQJ A;  4DV2 Q;  2F03 A;  3H94 A;  1N34 Q;  3I4N B;  4RGT A;  5IT9 E;  1HRJ A;  1Q90 A;  3BVM A;  3BDC A;  3S14 H;  4YWK A;  3TEH B;  3S17 B;  5IGC A;  1SYG A;  3ERO A;  2H4O A;  3CXC A;  2SNM A;  1K83 B;  1OO9 B;  2L11 A;  1XNQ L;  4FVM A;  1I5F A;  4KN7 C;  1VQP A;  1AZP A;  5FLX E;  5DLQ E;  1FL0 A;  2N78 A;  3ND9 A;  1IBM L;  2VZA A;  2NN6 H;  1IW7 D;  3MFG A;  4KN4 C;  2JP1 A;  3OPO A;  3J81 L;  4NXN Q;  2A69 C;  1JOO A;  2E8G A;  3S1N B;  5LMN W;  1GUW A;  3J7A 5;  1HH2 P;  1GHK A;  4ZCK A;  5M5W B;  5JJZ A;  5J1Z A;  4G7H C;  2PI2 E;  1W2B A;  4QUF A;  1WCM H;  4A3G G;  4DV5 Q;  5GRO A;  5C4X G;  4JI4 Q;  3QWN A;  4IZ8 A;  2BE5 C;  2YYZ A;  5BN4 A;  5JJK A;  4C56 C;  2UUA L;  3P1H A;  1KAW A;  3TRE A;  1GXD C;  1PVO A;  1N33 L;  1PFN A;  3A7L A;  4A3L H;  1W3S A;  1SXT A;  5EQ0 A;  4FYD A;  4X62 Q;  4Z9C B;  3EQL C;  4G57 A;  1EIY B;  4ZK9 B;  3OTO Q;  4DK3 C;  2PQE A;  2RKS A;  1STB A;  3SHL A;  1U9R A;  3J81 i;  5J39 A;  1VS0 A;  1L0X B;  3PMF A;  4WJ4 A;  4X65 L;  5IYC H;  2B2Y A;  3D8G A;  2A68 C;  2AUK A;  3R2T A;  3EBE A;  3I4L A;  4JOI A;  4CDE C;  3NHH A;  4K0K Q;  3SDZ A;  2WKD A;  1DYQ A;  2NVX H;  3A54 A;  2BA1 A;  3KBX A;  4A3K H;  3CRK C;  3GDE A;  1CZG A;  1PYB A;  3AU7 A;  1L1O B;  2JA7 H;  3M9B A;  3IAY A;  2ES2 A;  4JI6 Q;  3D6W A;  5J3B A;  4GKJ Q;  5EKK A;  3HOW H;  4DR3 L;  1O7Z A;  2QDB A;  3KF8 B;  2WAQ B;  3DWP A;  5G3L F;  1KDC A;  2DJG C;  5FJ8 H;  4DUZ L;  3CCE A;  4UY8 C;  1PHJ A;  5E7N A;  1B44 D;  4F8M A;  3FDT A;  1G6Z A;  1I6H B;  3C2P A;  1Q86 C;  5EPK A;  3CHB D;  1GM5 A;  3VR4 A;  1LYL A;  2IWH A;  1Q81 C;  4G7O C;  4L5S A;  4QUC A;  1LTG D;  4FNF A;  4X66 Q;  1RD9 D;  1HZ9 A;  3BS1 A;  2EXD A;  3HOU H;  4DR4 Q;  1O7Y A;  1JJC B;  4OO1 H;  5C3E H;  3FRP B;  2D0P A;  4RH6 A;  1BKB A;  4CJ2 C;  1I4H A;  3BYY B;  1ZYR D;  3GTQ B;  5E3F A;  2PPB C;  3F2U A;  1TVX A;  1IKM A;  1PRT D;  3HOX H;  4HTH A;  5GAD C;  2SNS A;  1K0R A;  2HDL A;  1KIX A;  4N8X 1;  2ZM6 L;  1EEF D;  2WV6 D;  2PMZ B;  4KD3 A;  4BBR B;  1SRO A;  4HMI A;  1IZ6 A;  1KNA A;  2AHO B;  3FKI H;  2MQH A;  4Y7N B;  1HR0 W;  2CW0 C;  4AQY Q;  4EQP A;  4WJW A;  3B6Y A;  1BNZ A;  4R1J A;  3I90 A;  3RZO B;  1YHA A;  5K36 G;  1QVG A;  1TT2 A;  3UE1 A;  2EPB A;  3W1B A;  1LV9 A;  1N36 Q;  3I4N H;  3G4S A;  1EZ8 A;  3NXW A;  1SE8 A;  2UUB Q;  1K8M A;  2F4I A;  3E6Z X;  3S17 H;  2CQO A;  3DXJ C;  3T1Y L;  1BCP B;  2A8V A;  2HIX A;  1F2Y A;  1X3Q A;  4C3I G;  3H09 A;  1KAB A;  1YJN A;  4JI3 Q;  3NK9 A;  3CCJ A;  3H0G G;  1X32 A;  2K4K A;  4OGQ C;  4X3U A;  4JI8 L;  3DM3 A;  4A76 A;  3GTK B;  3S1N H;  1EQR A;  3SK6 A;  1MHW C;  2SDF A;  4YCU A;  4YHH Q;  1II3 A;  1HJP A;  2MJ8 A;  4DAV A;  4AIM A;  2J0T D;  2OQK A;  2NTS A;  1JB7 A;  3OW2 A;  1EY8 A;  2JEA I;  4H7B A;  3T1H L;  1HPC A;  3PO3 H;  3IFD A;  3AFP A;  3K57 A;  1HCZ A;  2N49 A;  2F0Q A;  4DV3 Q;  4P2C B;  4JBW A;  4LF4 L;  4CKE A;  1RTO A;  1QUQ A;  2J7Z A;  2A69 D;  4C1N I;  4A3B G;  4DV4 L;  2G5D A;  4BY7 B;  4KY5 A;  1PH9 A;  1DOM A;  5FO8 B;  4XT3 B;  5LMN L;  1U0L A;  3LX0 A;  1I4R A;  2F0O A;  3NEL A;  4MTK A;  2JA6 B;  4IUQ A;  4ABN A;  2BE5 D;  2OWO A;  1DXM A;  5M3M H;  3NWT A;  1RTN A;  1VQO A;  4ME3 A;  2E2H B;  2FJ2 A;  3EVQ A;  3GD7 A;  1D5X C;  3PGZ A;  4K5V A;  2EVB A;  2BCO A;  1MKH A;  1A3V A;  2A6H C;  4DK6 C;  4FF4 A;  3RN2 A;  4DNT B;  1ZXT A;  5JVH 3;  3RMH A;  2MO0 A;  2JSO A;  1ILQ A;  1XNR Q;  3I70 A;  2FHT A;  3HKS A;  2E2J H;  4DXF A;  3MXN A;  4R8I A;  3GTJ H;  1M8A A;  2R3Z A;  1EEI D;  4DR7 Q;  3QG1 A;  3VA5 A;  2DY8 A;  4K5W A;  3HFZ B;  4FO2 A;  3OHX C;  5FLM G;  1PH6 A;  1B3Q A;  1EWC A;  4FXK C;  5C3W A;  3NQT A;  5IP7 G;  4JBJ A;  2ZJQ A;  1VQM A;  1QOH A;  3U50 C;  2B2W A;  3CCQ A;  2G9D A;  1EUJ A;  2Z6K C;  2QW7 A;  4PG3 A;  4B3T L;  1VMP A;  1CQF A;  5C6A A;  4IUN A;  1LT5 D;  3CQZ B;  3FEW X;  5JEA J;  1EWI A;  3TZD A;  2O5J C;  1CA6 A;  4LF5 L;  4X64 Q;  3PO2 B;  1XXG A;  3DM1 A;  1VF7 A;  3RLO A;  3K59 A;  2Q8R E;  4JI2 L;  4IUP A;  3S1R B;  1ET6 A;  4RCO A;  1G8Z D;  4XXE A;  4B3S Q;  3PUW A;  2AQ2 B;  1C9O A;  1JCK B;  2ZJP A;  3S15 B;  1VQ7 A;  1KC8 C;  2L0C A;  3ULL A;  3I2Z A;  5E4W C;  5IIF A;  1NE3 A;  1WFQ A;  3S24 A;  3F1Z A;  2L55 A;  4L5R C;  1NAP A;  4KHV A;  5C44 G;  3CAM A;  3HGB A;  2KHS A;  2GA4 B;  1KL9 A;  2GVA A;  4A3J B;  4PMW A;  1XMQ Q;  3MXP A;  1ENA A;  2NVY B;  5KRU A;  4TQU S;  1VF5 C;  1F9P A;  1Y1V G;  3SK8 A;  2EY6 A;  2MGS A;  3UI2 A;  2A74 C;  5KNC A;  1MI2 A;  4KMU C;  3Q23 A;  1LTL A;  1CSQ A;  2NZO A;  1S3O A;  2JA8 G;  1V43 A;  1C48 A;  3ITP A;  3CCL A;  1A6X A;  2CW0 D;  4P73 A;  2HHH L;  2D2C C;  3K5O A;  4LF7 L;  1QUQ B;  4CJ0 B;  1HR0 L;  4AYB G;  3HZX A;  1AH9 A;  2F0F A;  5IOD A;  4GOP B;  1D2B A;  1TWG B;  1BBU A;  1SBB B;  5ISR A;  2BDN A;  1KRT A;  4A4I A;  5CV5 A;  3J80 L;  2IT1 A;  4IPG A;  1SE2 A;  1M90 C;  1H9K A;  2DUD A;  2WII B;  2CQA A;  1XTD A;  4B08 A;  3DHQ A;  1FNU A;  5ELN A;  3STB C;  4POG A;  1XWE A;  3K0Y A;  1X56 A;  3CC2 A;  2D5D A;  5H1S E;  3LWU A;  4A3F H;  1EY0 A;  2R7Z G;  4GLA C;  1RL2 A;  5CV8 A;  3RR5 A;  5IP9 H;  4I7Z C;  4GNX C;  4BY1 B;  2DN8 A;  2JA6 H;  4HSP A;  1UEB A;  3T53 B;  2V4D A;  3S1Q B;  2EIF A;  4DN4 M;  3MXN B;  3HKZ G;  3NEM A;  5IWA L;  5ELE A;  5C4H A;  3N52 A;  2JQO A;  4KJN A;  1VQ4 A;  1QJO A;  3S2H B;  5C4J H;  2XVS A;  3RZD H;  3IL8 A;  4KY6 A;  5LHY 1;  1M1K C;  5M5Y H;  3HRZ C;  1CSP A;  1ZKO A;  4DPG A;  2UXB Q;  3BVZ A;  5IE8 A;  1PZK D;  3K7A B;  4QIW E;  2NVQ B;  4JBK A;  3BZD B;  2Y0S G;  2EZV A;  3L0O A;  5TSS A;  3TZU A;  1JIC A;  4A3M G;  4JW0 A;  2A6H D;  2C35 B;  5IT9 L;  1VMC A;  4DR5 L;  3JAM i;  5JJL A;  5CC4 A;  2SOB A;  4GKK Q;  5C4Z A;  5BR8 L;  1K3R A;  1J9O A;  3HOZ G;  4LFA Q;  2IY5 B;  3L2P A;  3D4W A;  5FLX L;  3CP0 A;  3MHB A;  4LK1 C;  2K5Q A;  3A55 A;  4CDD C;  1EQQ A;  4BXX H;  4DNR B;  1YIJ A;  1KDA A;  2NVT B;  2B2U C;  2HD3 A;  2LFN A;  1SRU A;  2MNA A;  1A63 A;  5G3L D;  1S40 A;  4LFC L;  4A3C H;  1STG A;  3NBI A;  2JK8 A;  1Q46 A;  2JA9 A;  3S15 H;  2K75 A;  2E75 C;  2E5L L;  1T5E A;  3EN2 A;  2YU9 B;  2Z9H A;  5GAH C;  1G91 A;  2PI2 A;  1CQV A;  1QG7 A;  4QL5 A;  4EQ5 A;  4IO9 A;  1PXU A;  3D0F A;  2EOT A;  1U4M A;  2KA7 A;  1SNP A;  2ALY B;  5AJ3 Q;  1KRS A;  2KVM A;  1J8I A;  1Q8I A;  2WB1 E;  5M3F G;  1MBY A;  2PZT A;  2WAC A;  4HJ9 A;  3PUX A;  2VUM H;  3SK5 A;  1BQQ T;  4EQO A;  5JEA G;  3RN5 A;  1TY0 A;  2R7F A;  3LGJ A;  2KCC A;  4FF3 A;  1QVF A;  3TP6 A;  5A2Q E;  2B63 B;  2NYZ D;  2JA5 G;  2G9H D;  1FVI A;  2Q2U A;  5FK9 C;  3WOF A;  1GJX A;  4YY3 Q;  4JI0 L;  2E76 C;  4HED A;  1WTR A;  1PFM A;  1SMY C;  1A2T A;  2EDG A;  2QA4 A;  1ML0 D;  4A3E B;  3J7A F;  1JQY D;  3ULJ A;  4I65 A;  4I7A A;  2KUM A;  2QIL A;  2Q2T A;  2XRQ D;  3I8Z A;  3DWQ A;  1ENF A;  4DV6 Q;  2C9O A;  1YZ6 A;  3CCU A;  1QCB D;  4KHP L;  2NN6 G;  2HCI A;  4TRD A;  2VB2 X;  2GVB A;  3PIO 3;  5E1F A;  4Y52 H;  1L1O A;  2WB1 G;  4IPC A;  3KK7 A;  3MTS A;  1IXR A;  2Z6B A;  4DR1 L;  4DR2 Q;  1Y8O B;  2DNE A;  1QZG A;  5M5X B;  1G2T A;  1HNX Q;  3ERS X;  1FJG L;  4IUU A;  4JOI C;  4IFD H;  1KLG D;  1CM9 A;  2NZ1 D;  1UE6 A;  1AE3 A;  2IJ0 A;  4DV1 L;  4LFB L;  4ILW A;  1NTG A;  5GAG C;  4OIJ A;  3U4V A;  1FGB D;  5JAV A;  4A3G B;  1IBK L;  1CI3 M;  1TS3 A;  2CWA A;  3DUZ A;  3SEB A;  4PMC A;  3AMU A;  3KUP A;  4A3L G;  1W6J A;  2ICE C;  5KYI A;  1GUO A;  3H6M A;  3R2I A;  1EQT A;  1JMC A;  1GVP A;  4RG1 A;  4IAL A;  3S2H H;  1B70 B;  3K58 A;  2HQE A;  1EY4 A;  1PH2 A;  2NUC A;  4NB3 A;  3M85 A;  2EYL A;  1B3A A;  2K5V A;  3VYS A;  3PCO B;  3HP3 A;  5T1G A;  3SK4 A;  4L5Q A;  1SYB A;  4EGV A;  2TSS A;  4HJ5 A;  1RCV D;  5IYC G;  3URY A;  2KCT A;  2R93 H;  2EQS A;  3H15 A;  4RKL A;  3AQQ A;  3G6E A;  5D3D A;  3A5U A;  4RKB A;  1GOZ A;  4TSS A;  1I50 H;  1M4V A;  3P75 A;  3M4O H;  4JI7 Q;  1PH3 A;  2JA7 G;  2MFI A;  2K03 A;  2AWO A;  2OQ0 A;  1VQN A;  4QGU A;  5HGQ A;  3U4Z A;  4IN3 A;  4IJH A;  1G29 1;  3SGI A;  3HOW G;  1K3B C;  4JBM A;  5EKI A;  1CT1 D;  1V1O A;  3RLN A;  5FJ8 G;  3GTP H;  2XWJ B;  3GP7 A;  3K80 C;  4YWL A;  4DAY A;  2KQ3 A;  4K2L A;  4IUT A;  4A3D H;  5CV9 A;  1CZW A;  5KYL A;  1FNW A;  4CBV A;  1U5K A;  5GQO A;  2F3I A;  2N8N A;  4GN4 B;  1E3P A;  3NUC A;  3VR2 A;  1PTO H;  4YCV A;  3CW2 C;  1PTO F;  1FNV A;  3A8K E;  1UE5 A;  1YVC A;  4C3H B;  3HOU G;  3EJI A;  4OO1 G;  4JV5 L;  4KJO A;  5C3E G;  1EL0 A;  3F8T A;  1HNW Q;  2VNU D;  2KOL A;  1VQ6 A;  4LF6 Q;  4QQB X;  4RAU C;  1ILP A;  4R4O A;  2UXC L;  3HOX G;  1HNZ L;  3CPW A;  1E7Z A;  1N32 Q;  4K6D A;  3U9S A;  5ELO A;  3M7N A;  3I4M H;  1Y1W H;  3PIO A;  3KJO A;  1X3F A;  4ZUI A;  3A74 A;  3FKI G;  2B63 H;  1WTH A;  1YIT A;  2ZXR A;  1A0I A;  1TS5 A;  4LF9 Q;  4POF A;  3BG3 A;  3J7A V;  1SYF A;  4M8A A;  1GHJ A;  4DFA A;  2H1E A;  1MJC A;  2K1B A;  1A3U A;  4A3I G;  1B2T A;  3V96 A;  4A75 A;  4B3R L;  5AFW A;  3VDY A;  1DON A;  1EQV A;  1STN A;  2F0W A;  1UAP A;  2KED A;  3S16 B;  3J81 c;  1PYS B;  1Y8P B;  1LT6 D;  2IPK D;  3VR5 A;  1VQE A;  1SND A;  4DAM A;  2ICI A;  2M2L A;  4F87 A;  3Q6S A;  5M9O A;  3S2D B;  1T9H A;  2E2I B;  1N9W A;  2EY1 A;  4ME5 A;  3GTL H;  3I7F A;  3NPP A;  4C3I B;  1STA A;  3FPP A;  4XT1 B;  4C2M B;  5BN3 A;  1Q82 C;  3H0G B;  5M5X H;  1U4R A;  3MZ5 A;  2R92 H;  4DV7 Q;  4X6A H;  3S1M H;  2JEB I;  3TRZ A;  3PO3 G;  2DNC A;  4DR6 Q;  4QCL A;  1DM0 B;  2F0D A;  3OMG A;  4M1U B;  1HUN A;  3AEV A;  3ZYY X;  2MHV A;  4A3G H;  1FD7 D;  4QB4 A;  4GLX A;  1CUK A;  3MAQ A;  5IGE A;  4H13 C;  1IBL Q;  3TDQ A;  4Q0F A;  3N6R A;  1WTX A;  1X54 A;  4A3B B;  3A56 A;  3GTM B;  3G7L A;  4B3M L;  1J5E L;  2LSS A;  4PZ7 A;  4DA2 A;  5LMU Q;  5M3M G;  2VQF L;  2B2W C;  4CJ1 B;  1XMO L;  3NTK A;  2CKZ B;  1YHB A;  1EYG A;  2RF4 A;  3TQY A;  5CR3 A;  1E2W A;  3CMA A;  4KY7 A;  1DZ1 A;  4DUY L;  5IGF A;  5C0X H;  2QDL A;  5KGU A;  5EGT A;  1Q3L A;  5IGD A;  4DAY B;  2UU9 L;  1JB3 A;  2NN6 I;  4WFN 3;  2K14 A;  4DK0 A;  1QB5 D;  2RHS B;  3FVQ A;  5EBD A;  4YCW A;  1K83 H;  4BA2 I;  4ZUJ A;  2UXD L;  5DM6 3;  1SJH D;  3HOV G;  2VL6 A;  4DAP A;  3SXH A;  1BBW A;  1R9T B;  2AQ3 B;  2VQE L;  4C3J G;  4P75 A;  1CK1 A;  3NBH A;  1H9M A;  3A0J A;  2DGY A;  2QKI C;  2WP8 J;  3MC0 B;  1XPU A;  4JYA Q;  5M5W H;  2K5W A;  2F4V L;  1Z47 A;  3UDG A;  1CKN A;  3K5N A;  1QWY A;  1A62 A;  5C5M A;  5IGB A;  4GLV B;  1HTP A;  1TS2 A;  5I6Y A;  1N8R C;  4R8N A;  1PTO C;  4HJ7 A;  4DV2 L;  2Q2H A;  2RVL A;  4C3H H;  4F7X A;  3M4Y A;  1WTV A;  5HY6 A;  4GOP A;  1N34 L;  5EJW A;  4NXM Q;  3FMC A;  4JI5 Q;  1TKW B;  1DOK A;  2B29 A;  1RKN A;  1DOL A;  2IHF A;  4OL7 A;  3DEP A;  4DV0 Q;  1F2Z A;  1PRT B;  4OEM B;  2GN5 A;  1XJV A;  3JC6 6;  1SE3 A;  3OOC A;  4DXG A;  4NXN L;  4BBS G;  4A93 G;  1GO3 E;  1Y14 B;  1VQ5 A;  2KCN A;  2EYP A;  2ZJR A;  5IOC A;  5ELC A;  1XYI A;  4DU9 A;  1ASZ A;  2NB0 A;  4DK1 A;  4QJF A;  1LAC A;  2XN9 C;  5C44 B;  1LLR D;  1RJT A;  2B2V C;  4DV5 L;  2PW5 A;  4JI4 L;  4OX9 Q;  2ENB A;  2UUC Q;  2EY2 A;  5DNF A;  5K36 H;  2SEB D;  5CYU A;  2A68 D; 
#chains in the Genus database with same CATH homology
 1Y1V B;  4IFD J;  5HGT A;  2K01 A;  3TP5 A;  1MD2 D;  3M3Y B;  2JA8 B;  4NP5 A;  3C1E A;  1CHQ D;  3PUV A;  3GTG B;  4RHR A;  3GV6 A;  5BN5 A;  1PMR A;  3KLS X;  2FIN B;  4RGO S;  4K8J A;  5DM7 3;  2MUY A;  4ODG A;  1S5C D;  1L0Y B;  1SYC A;  2C5C A;  3QJY A;  1AZQ A;  2EYH A;  3KLS A;  5LL6 X;  4HMJ A;  1F2L A;  1LTR D;  4NKL A;  4RWS C;  1HA5 A;  2ZXP A;  3SVM A;  2R7Z B;  2XWB B;  2EYF A;  4HSV A;  5IGG A;  1CHP D;  2QF7 A;  2I46 A;  4DGZ A;  2EJF C;  1TR5 A;  3MA2 B;  1OXX K;  2VB3 X;  2M9V A;  1BCP F;  1B50 A;  4LMQ D;  5D3I B;  2MPM A;  3T51 B;  3D4D A;  5I9O A;  1TS4 A;  3NWS A;  5CMD A;  1SE4 A;  1E2V A;  2PZU A;  2F0K A;  1HUM A;  3T4A C;  4BWG B;  2I07 B;  3TN2 A;  2IL8 A;  4CKB A;  4J6H A;  1TWH B;  1PLF A;  2CVR A;  1LTB D;  1X3P A;  2B2T A;  4A3M B;  3EFX D;  1WD1 A;  5D14 A;  1HXY D;  4F88 A;  5DAU A;  3K5M A;  3HOZ B;  5C5L A;  2X6L A;  2IX0 A;  3WOE A;  1B9N A;  4U68 A;  3JAM L;  3T13 A;  2LS0 1;  1UEA B;  2Q8I B;  4B9X A;  1TQO A;  3PUZ A;  1BO0 A;  1QIL A;  1D6E C;  4PV1 C;  5COY A;  2HCC A;  2HUG A;  2EYO A;  2BDO A;  1PTO D;  5CV7 A;  1E0B A;  4J8Q A;  1GUT A;  3Q24 A;  3RLF A;  1TWF B;  4QIW B;  3R3O A;  4J1M A;  3QOJ A;  1WTQ A;  3A8J E;  5M3F B;  1NR4 A;  1T5X D;  3QIA A;  3MWY W;  1ESR A;  1SFO B;  5I2Y A;  2F0S A;  2L5T A;  1LO5 D;  1VDZ A;  3NE5 B;  1EY6 A;  4O42 A;  4CKC A;  3K6O A;  3ERQ A;  2L12 A;  1IW7 C;  4C1N K;  3BVG A;  2K04 A;  1ICW A;  1I4P A;  4U67 3;  2HDM A;  3RUZ A;  2EY5 A;  1F77 A;  2LY7 A;  5KND A;  5C3X A;  1S5D D;  1S5B D;  3S14 B;  4WRD A;  1IYV A;  3Q22 A;  4X3K A;  1QNK A;  2RDF A;  1YNN C;  4XQN A;  3E5S A;  1GUG A;  3ND8 A;  5T1I A;  2B8G A;  2RQX A;  4IFD G;  1PYW D;  3CU7 A;  1F9R A;  2WB1 B;  3S9W A;  1AEX A;  1JC7 A;  3KLR A;  1SYD A;  1V8Q A;  2L4N A;  1TWA B;  4K8I A;  2RBM A;  2ZXO A;  1PZJ D;  4QF4 A;  4WOR A;  1LTT D;  3QOL A;  1BCP C;  1EYA A;  4BA1 I;  2VXW A;  4N9P A;  4RHS A;  1SNC A;  2NWG A;  1YNJ C;  5A35 A;  1I4G A;  4XDX A;  5I4D A;  5K5P A;  2J4X A;  1EYC A;  4KD4 A;  1S5E D;  4R9W A;  3DMU A;  3C3L A;  4KHZ A;  5JVG 3;  2K6A A;  3MVV A;  2F0I A;  3MXU A;  4LAA A;  5FO9 B;  3I73 A;  2EJG C;  2LKV A;  5F2D A;  4ZLT F;  1B9M A;  2B2Y C;  3HOW B;  3J80 E;  3H3V C;  1ET9 A;  4EVO A;  1JOQ A;  1JOR A;  1UUP A;  4V19 0;  2EYJ A;  1I6V C;  2X69 A;  3GV3 A;  3SE0 A;  2R6G A;  5C4X B;  4X3S A;  2D62 A;  2WIN B;  3V05 A;  4HCE A;  5HUR A;  1Z6H A;  2DY7 A;  2O2L D;  3VYU A;  4EQN A;  3HOU B;  2F3V A;  5C3E B;  2EJM A;  3OSO A;  3HOX B;  4V0B A;  2A73 B;  3D31 A;  1Z7T A;  2BOS A;  2XSC A;  2B2U A;  3FKI B;  4YIJ A;  1SNQ A;  5FKA C;  2RDG A;  4NDX A;  1LTA D;  4FP5 D;  4ZKB B;  1XX8 A;  4A3I B;  4FXD A;  1SEB D;  2K28 A;  1U4L A;  3VA7 A;  1V1P A;  2F0L A;  4ULL A;  2K5D A;  4ZAI A;  1HQR D;  1IL8 A;  3GO5 A;  1ESF A;  3ONA B;  3E0J A;  4L8J A;  4QMG A;  3A8I E;  2OXP A;  3VR6 A;  5ELD A;  3PV0 A;  2KEC A;  4RCN A;  3FPU B;  3GTO B;  1TWC B;  2RDH A;  2O5I C;  1Q12 A;  1YNN D;  3PO3 B;  5CV6 A;  3Q0A A;  4BS9 A;  4Q5V A;  1EOT A;  4RGN A;  2PNR C;  1HFG A;  1B1Z A;  3D3R A;  2EYM A;  1O80 A;  2Z1C A;  1EIH A;  1Y69 U;  1EU3 A;  1NR2 A;  2O4X A;  5M3M B;  3P7J A;  5C0X G;  1BXT A;  1F2M A;  5KEE A;  1F9Q A;  2A6E C;  2Z8L A;  4OHJ A;  4OIK A;  5LL6 S;  3OIP A;  4B9W A;  1BCP D;  1E2Z A;  4XQQ A;  1SMY D;  1YNJ D;  2XRS D;  4IFD I;  2E2J B;  1B53 A;  5FOB B;  3HOV B;  1H9S B;  1SNM A;  3GTJ B;  3W3A A;  1A15 A;  1H9J A;  3H91 A;  4C3J B;  4G4K A;  4KTA A;  2K32 A;  1PZI D;  2Z4H A;  4H44 C;  2JYO A;  3IKJ A;  2TMP A;  1KLU D;  4H0L C;  4JK1 C;  1AP0 A;  5ELB A;  3KBG A;  4C3H G;  1QE6 A;  1Q1B A;  3MEH A;  3NTH A;  3I3C A;  1S4Z A;  4FF1 A;  5JPM C;  2AWN A;  4NW2 A;  2AUJ D;  5FO7 B;  3P20 A;  1OXU A;  5DEH A;  1EY7 A;  2IW3 A;  2PCF B;  3WDN A;  3HG9 A;  3R93 A;  1CA5 A;  1BF4 A;  3NTI A;  2F0M A;  1V1P B;  2E2D C;  2F0U A;  4BBS B;  4A93 B;  4KV6 A;  1PFB A;  4UAI A;  4RFB A;  3PIP 3;  3PUY A;  3J7Y W;  2OF1 A;  3TSS A;  5CV4 A;  2K7V A;  1NUC A;  1SYE A;  4ZQ3 A;  1JOK A;  1XTC D;  5I6W A;  1ZEQ X;  3J81 E;  2D9U A;  1KDB A;  3NSW A;  3IFT A;  5EBC A;  2NBF A;  1JR0 D;  1OXT A;  4PMB A;  4ZYS A;  1SNO A;  1NCV A;  4FXG C;  1LTS D;  2B39 A;  4TKO B;  4RGM A;  5KNB A;  4A3F B;  3D4R A;  2K33 A;  2B2T C;  1O78 A;  1ROD A;  4MIU A;  4KK7 A;  2F3W A;  3NQI A;  1OXV A;  5COR A;  4MHE A;  1K8O A;  1FYC A;  1C4Q A;  1STY A;  3AB9 A;  4XTC S;  4XQJ A;  3MFY A;  3O13 A;  4S3S A;  2JXM B;  1D5Z C;  5C4J B;  3RZD B;  5M5Y B;  2JE6 I;  1PDQ A;  1I3Q B;  1TY2 A;  1H9R A;  2B8F A;  1BBX C;  3I91 A;  2MP1 A;  4OO1 I;  2A6E D;  4AYB B;  4PNY A;  2QEJ C;  2N88 A;  3I72 A;  4G7Z C;  1Y8N B;  1LAB A;  2CHB D;  1EFI D;  1LT3 D;  1RHP A;  1F9S A;  2F0J A;  2XNA C;  4UDU C;  3OWF A;  3VYT A;  4K5X A;  2FMC A;  4GZY C;  2XIW A;  1GUS A;  2E74 C;  3G6J B;  2BA0 A;  2KJX A;  4IUV A;  5CGK A;  5C0X I;  2IX3 A;  3A7A B;  4K14 A;  1SSO A;  3BYT B;  3HKZ B;  1HA6 A;  1MGS A;  3C46 A;  4CHT B;  5A2Q L;  3TP8 A;  5CBA E;  2RA4 A;  3HEJ A;  4N9T A;  2F0E A;  5ELF A;  1S5F D;  2VUM B;  1RDP D;  4KKU A;  1EY9 A;  2RSN A;  5JOB A;  1JE4 A;  3U9O A;  2AQ1 B;  3HOY B;  2Y0S B;  4XIG S;  1UNS A;  1AN8 A;  1WD0 A;  2FMM A;  1B4O A;  2F0T A;  5KIX A;  4HR7 B;  2N55 A;  1HFN A;  2PZW A;  1A3T A;  3L3O C;  3CKI B;  2EXZ A;  1D5M C;  1CFM A;  2Q8T A;  4LJZ C;  3T56 B;  4NMZ A;  2OEO A;  3MXG A;  2LMC B;  1LTI D;  2B2V A;  1PRT F;  4L63 B;  5EPJ A;  4K6L A;  1EZ6 A;  4IUR A;  1MSH A;  1NSN S;  1HQM C;  4KI0 A;  1SAP A;  2R61 A;  2F0N A;  3X3M A;  1HTL D;  5E4X A;  4RA8 A;  1KNE A;  2JA5 B;  3DWA A;  1SJE D;  1WVL A;  1TII D;  3X3N A;  4ZKC B;  1I4X A;  3DEO A;  4HAE A;  1BR9 A;  2KEE A;  2PO4 A;  4CGY B;  2R93 B;  4MN3 A;  3OIQ A;  1RF2 D;  2X6G A;  1TU2 B;  1I50 B;  3M4O B;  3R8B A;  3VYR A;  3VR3 A;  4KKT A;  2K05 A;  4E6I A;  1AFP A;  3V2T A;  1MSG A;  4ID6 A;  3QO2 A;  1R4P B;  5C0X J;  3OWE B;  3GTP B;  2F0H A;  3L9A X;  1BUV T;  1QNU A;  3TME A;  4A3D B;  1WCM B;  1IHZ A;  2Z4I A;  1STE A;  1WTO A;  1DCZ A;  1HHV A;  2FFK B;  4FF2 A;  5JPN C;  2L1B A;  3D6C A;  5J22 A;  1ENC A;  1PTO B;  3TP7 A;  1G2S A;  3OW7 A;  3RD4 A;  1BOS A;  1D1I A;  4ZRZ A;  3HS0 C;  2EE1 A;  1EU4 A;  1D1K A;  2PW7 A;  1FR3 A;  2F1M A;  4K2K A;  2PYK A;  3I4M B;  1DD2 A;  1Y1W B;  3M7G A;  1U4P A;  1GUN A;  4PQX A;  1KAA A;  5D65 A;  1SDF A;  3QB3 A;  4XYQ A;  1DJR D;  2OT2 A;  1ONL A;  4HN7 A;  4XYO A;  2F0V A;  2NVX B;  5NUC A;  1I4Q A;  4A3K B;  2ZT9 C;  3EA6 A;  1WTW A;  1EWH A;  2JA7 B;  4HCS A;  5CBE E;  2ID0 A;  1C8C A;  3K5L A;  1JWM D;  4IQZ A;  2L9H A;  1A2U A;  4O1N A;  4L6T B;  1EIG A;  3W2D A;  1KTK A;  3CRL C;  3LWE A;  1ZYR C;  2QCP X;  3GTL B;  2F0G A;  5I9P A;  1PRT C;  2RSO A;  1H9S A;  2M00 A;  5I2X A;  3C1F A;  3JAM E;  2R92 B;  1R4Q B;  2WKC A;  1BDO A;  2NTT A;  3S1M B;  5EKL A;  3T16 A;  3KF8 A;  4DF7 A;  1AW7 A;  1IYU A;  5EPL A;  3GQB A;  3SR1 A;  2A5H A;  2F0P A;  3TBI B;  3BDL A;  1LT4 D;  4KKS A;  1JWU D;  3LNN A;  1W6K A;  1STH A;  1CTM A;  1IKL A;  3L7Z C;  1O7L A;  5JEA H;  2IX1 A;  3BDO A;  3OMC A;  1Q1E A;  1VCI A;  3NP8 A;  1WTP A;  4X3T A;  1EYD A;  1JWS D;  1EY5 A;  1OXS C;  2F03 A;  3H94 A;  3I4N B;  4RGT A;  5IT9 E;  1HRJ A;  1Q90 A;  3BVM A;  3BDC A;  3S17 B;  5IGC A;  1SYG A;  3ERO A;  2H4O A;  2SNM A;  1K83 B;  1OO9 B;  2L11 A;  4FVM A;  4KN7 C;  1AZP A;  5FLX E;  3ND9 A;  3MFG A;  2NN6 H;  1IW7 D;  4KN4 C;  3J81 L;  2JP1 A;  3OPO A;  2A69 C;  1JOO A;  3S1N B;  1GUW A;  1GHK A;  5M5W B;  5JJZ A;  5J1Z A;  4G7H C;  4QUF A;  3QWN A;  4IZ8 A;  2BE5 C;  2YYZ A;  5BN4 A;  4C56 C;  3P1H A;  1GXD C;  1PFN A;  3A7L A;  1SXT A;  5EQ0 A;  4FYD A;  4Z9C B;  3EQL C;  4G57 A;  4ZK9 B;  2PQE A;  2RKS A;  1STB A;  3SHL A;  1U9R A;  5J39 A;  1L0X B;  3PMF A;  2B2Y A;  3D8G A;  2A68 C;  2AUK A;  3R2T A;  3I4L A;  3NHH A;  3SDZ A;  2WKD A;  1DYQ A;  3A54 A;  2BA1 A;  3KBX A;  3CRK C;  1CZG A;  3AU7 A;  3IAY A;  3D6W A;  5EKK A;  1O7Z A;  2QDB A;  2WAQ B;  3DWP A;  5G3L F;  1KDC A;  1B44 D;  4F8M A;  3FDT A;  1G6Z A;  1I6H B;  3C2P A;  5EPK A;  3CHB D;  3VR4 A;  2IWH A;  4G7O C;  4QUC A;  1LTG D;  4FNF A;  3BS1 A;  1RD9 D;  1O7Y A;  4OO1 H;  3FRP B;  4RH6 A;  4CJ2 C;  1I4H A;  3BYY B;  1ZYR D;  3GTQ B;  5E3F A;  2PPB C;  3F2U A;  1TVX A;  1IKM A;  1PRT D;  4HTH A;  2SNS A;  2HDL A;  1EEF D;  2WV6 D;  2PMZ B;  4KD3 A;  4BBR B;  4HMI A;  1KNA A;  4Y7N B;  2CW0 C;  4EQP A;  4WJW A;  1BNZ A;  3I90 A;  3RZO B;  5K36 G;  1TT2 A;  2EPB A;  1LV9 A;  1EZ8 A;  3NXW A;  1K8M A;  2F4I A;  3E6Z X;  3DXJ C;  1BCP B;  1F2Y A;  1X3Q A;  4C3I G;  3H09 A;  1KAB A;  3NK9 A;  4OGQ C;  1X32 A;  4X3U A;  3GTK B;  3SK6 A;  2SDF A;  1II3 A;  2MJ8 A;  4DAV A;  2J0T D;  2NTS A;  1EY8 A;  2JEA I;  4H7B A;  1HPC A;  3IFD A;  3K57 A;  1HCZ A;  2F0Q A;  4P2C B;  4JBW A;  4CKE A;  1RTO A;  2J7Z A;  2A69 D;  4C1N I;  4BY7 B;  4KY5 A;  1DOM A;  5FO8 B;  4XT3 B;  3LX0 A;  1I4R A;  2F0O A;  2JA6 B;  4IUQ A;  4ABN A;  2BE5 D;  1DXM A;  3NWT A;  1RTN A;  2E2H B;  2FJ2 A;  3EVQ A;  3GD7 A;  1D5X C;  4K5V A;  2EVB A;  2BCO A;  2A6H C;  1A3V A;  4FF4 A;  4DNT B;  1ZXT A;  5JVH 3;  3RMH A;  2JSO A;  1ILQ A;  3I70 A;  2FHT A;  4DXF A;  3MXN A;  4R8I A;  1M8A A;  2R3Z A;  1EEI D;  3QG1 A;  3VA5 A;  2DY8 A;  4K5W A;  4FO2 A;  3OHX C;  1EWC A;  4FXK C;  5C3W A;  3NQT A;  1QOH A;  2B2W A;  2G9D A;  1VMP A;  1CQF A;  5C6A A;  4IUN A;  1LT5 D;  3CQZ B;  3FEW X;  5JEA J;  3TZD A;  2O5J C;  1CA6 A;  3PO2 B;  1XXG A;  3DM1 A;  1VF7 A;  3K59 A;  2Q8R E;  4IUP A;  3S1R B;  1ET6 A;  4RCO A;  1G8Z D;  4XXE A;  3PUW A;  2AQ2 B;  1JCK B;  3S15 B;  2L0C A;  5E4W C;  5IIF A;  2L55 A;  1NAP A;  4KHV A;  3HGB A;  2KHS A;  2GA4 B;  4A3J B;  4PMW A;  3MXP A;  1ENA A;  2NVY B;  5KRU A;  4TQU S;  1VF5 C;  1F9P A;  3SK8 A;  2EY6 A;  2MGS A;  3UI2 A;  2A74 C;  5KNC A;  1MI2 A;  4KMU C;  3Q23 A;  1V43 A;  1C48 A;  3ITP A;  1A6X A;  2CW0 D;  2D2C C;  3K5O A;  4CJ0 B;  3HZX A;  2F0F A;  5IOD A;  1D2B A;  1TWG B;  1SBB B;  5ISR A;  2BDN A;  5CV5 A;  3J80 L;  2IT1 A;  1SE2 A;  1H9K A;  2WII B;  2CQA A;  4B08 A;  3DHQ A;  1FNU A;  1XWE A;  3K0Y A;  2D5D A;  3LWU A;  1EY0 A;  5CV8 A;  4I7Z C;  4BY1 B;  2DN8 A;  4HSP A;  3T53 B;  2V4D A;  3S1Q B;  4DN4 M;  5ELE A;  5C4H A;  3N52 A;  4KJN A;  1QJO A;  3S2H B;  2XVS A;  3IL8 A;  4KY6 A;  5LHY 1;  3HRZ C;  1ZKO A;  3BVZ A;  1PZK D;  3K7A B;  2NVQ B;  3BZD B;  2EZV A;  5TSS A;  3TZU A;  1JIC A;  2A6H D;  5IT9 L;  1VMC A;  5CC4 A;  2SOB A;  5C4Z A;  1J9O A;  3D4W A;  5FLX L;  3MHB A;  4LK1 C;  2K5Q A;  3A55 A;  4DNR B;  1KDA A;  2NVT B;  2B2U C;  2LFN A;  5G3L D;  1STG A;  3NBI A;  2E75 C;  1T5E A;  2YU9 B;  1G91 A;  1CQV A;  1QG7 A;  1PXU A;  2EOT A;  1U4M A;  2KA7 A;  1SNP A;  2KVM A;  1J8I A;  1Q8I A;  1MBY A;  2PZT A;  2WAC A;  3PUX A;  3SK5 A;  1BQQ T;  4EQO A;  5JEA G;  1TY0 A;  2KCC A;  4FF3 A;  3TP6 A;  5A2Q E;  2B63 B;  2NYZ D;  2G9H D;  5FK9 C;  3WOF A;  1GJX A;  2E76 C;  4HED A;  1WTR A;  1PFM A;  1SMY C;  1A2T A;  2EDG A;  1ML0 D;  4A3E B;  3J7A F;  1JQY D;  4I65 A;  2KUM A;  2QIL A;  2XRQ D;  3I8Z A;  3DWQ A;  1ENF A;  2C9O A;  1QCB D;  2NN6 G;  2HCI A;  4TRD A;  2VB2 X;  3PIO 3;  5E1F A;  3KK7 A;  3MTS A;  1Y8O B;  2DNE A;  5M5X B;  1G2T A;  4IUU A;  4IFD H;  1KLG D;  1CM9 A;  2NZ1 D;  2IJ0 A;  4ILW A;  4OIJ A;  1FGB D;  5JAV A;  4A3G B;  3SEB A;  1CI3 M;  1TS3 A;  3DUZ A;  4PMC A;  3AMU A;  3KUP A;  1W6J A;  2ICE C;  5KYI A;  1GUO A;  3H6M A;  3R2I A;  1EQT A;  4IAL A;  3K58 A;  2HQE A;  1EY4 A;  2NUC A;  3M85 A;  2EYL A;  1B3A A;  3VYS A;  3HP3 A;  5T1G A;  3SK4 A;  1SYB A;  4EGV A;  2TSS A;  1RCV D;  3URY A;  4RKL A;  5D3D A;  4RKB A;  1GOZ A;  4TSS A;  1M4V A;  3P75 A;  2K03 A;  2AWO A;  4IN3 A;  1G29 1;  5EKI A;  1CT1 D;  1V1O A;  2XWJ B;  3GP7 A;  4DAY A;  2KQ3 A;  4K2L A;  4IUT A;  5CV9 A;  1CZW A;  5KYL A;  1FNW A;  4CBV A;  3NUC A;  3VR2 A;  1PTO H;  1PTO F;  1FNV A;  3A8K E;  4C3H B;  3EJI A;  4OO1 G;  4KJO A;  1EL0 A;  2VNU D;  2KOL A;  1ILP A;  4RAU C;  4K6D A;  3U9S A;  3M7N A;  4ZUI A;  2ZXR A;  1TS5 A;  3BG3 A;  3J7A V;  1SYF A;  4M8A A;  1GHJ A;  4DFA A;  2H1E A;  1B2T A;  2K1B A;  1A3U A;  3V96 A;  5AFW A;  1DON A;  1EQV A;  1STN A;  2F0W A;  1UAP A;  2KED A;  3S16 B;  1Y8P B;  1LT6 D;  2IPK D;  3VR5 A;  1SND A;  2ICI A;  2M2L A;  4F87 A;  3Q6S A;  5M9O A;  3S2D B;  2E2I B;  2EY1 A;  4ME5 A;  3NPP A;  4C3I B;  1STA A;  3FPP A;  4XT1 B;  4C2M B;  5BN3 A;  3H0G B;  1U4R A;  3MZ5 A;  2JEB I;  2DNC A;  4QCL A;  1DM0 B;  2F0D A;  3OMG A;  4M1U B;  1HUN A;  3ZYY X;  2MHV A;  1FD7 D;  4QB4 A;  3MAQ A;  5IGE A;  4H13 C;  3TDQ A;  4Q0F A;  3N6R A;  1WTX A;  4A3B B;  3A56 A;  3GTM B;  3G7L A;  4DA2 A;  2B2W C;  4CJ1 B;  3NTK A;  5CR3 A;  1E2W A;  4KY7 A;  1DZ1 A;  5IGF A;  5C0X H;  5KGU A;  5EGT A;  1Q3L A;  5IGD A;  1JB3 A;  2NN6 I;  4WFN 3;  4DK0 A;  1QB5 D;  3FVQ A;  5EBD A;  4BA2 I;  4ZUJ A;  5DM6 3;  1SJH D;  4DAP A;  3SXH A;  1R9T B;  2AQ3 B;  4C3J G;  1CK1 A;  3NBH A;  1H9M A;  2QKI C;  2WP8 J;  3MC0 B;  2K5W A;  1Z47 A;  3K5N A;  1QWY A;  5C5M A;  5IGB A;  1HTP A;  1TS2 A;  5I6Y A;  4R8N A;  1PTO C;  2RVL A;  4F7X A;  3M4Y A;  1WTV A;  5EJW A;  3FMC A;  1TKW B;  1DOK A;  1RKN A;  1DOL A;  4OL7 A;  3DEP A;  1F2Z A;  1PRT B;  1SE3 A;  3OOC A;  4DXG A;  2KCN A;  2EYP A;  5IOC A;  5ELC A;  1XYI A;  4DU9 A;  2NB0 A;  4DK1 A;  1LAC A;  2XN9 C;  5C44 B;  1LLR D;  1RJT A;  2B2V C;  2PW5 A;  2ENB A;  2EY2 A;  5DNF A;  5K36 H;  2SEB D;  5CYU A;  2A68 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...