3GTJH

Backtracked rna polymerase ii complex with 13mer rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
146
structure length
136
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtjH00
3OW2A 3STBC 4DR2Q 1KRTA 3AEVA 2WFWA 4JI3Q 5JJLA 1QVCA 2UUBQ 4KHPQ 1YHAA 4MZ9A 3M7NA 2KENA 4A3MH 4MTNA 3KF6A 1GM5A 4LFAQ 4A3IG 1ASYA 5GAEC 3S2HH 1PV4A 1N32Q 5IYBG 1IBMQ 1VQJA 4LF8L 4DV4L 3I56A 4BY1G 4DK6C 1Y1WH 2K5HA 1PH2A 3S17H 3AQQA 4A3GH 1OXXK 3J81j 3I55A 1VQ7A 2N78A 5DLQE 1HNZL 1AE3A 2UXBQ 1PYSB 1E1TA 1WJJA 1N36Q 1HZ9A 4NPSA 2PI2E 2VUMH 1VQLA 4JI8Q 4BY7H 1L0WA 3ULLA 1NMGA 2UUBL 4KHPL 1P8LA 1AE2A 1N8RC 3HOVH 2WAQE 3HOXG 1GKHA 2BH8A 2K14A 4A4IA 1SFOH 4OWWB 3GTMH 4OO1G 4A3LH 3RLFA 3HFZB 4DV5L 1YJWA 4A3BH 5H1SE 2RHSB 4IPDA 2VUMG 2JQOA 2JA7H 1C0AA 2KBNA 1MIUA 3CD6A 2ZJPA 3RNUA 4UP8A 1X6OA 1X56A 1FJGL 1JJCB 1Q1EA 3HOUG 3BJUA 4IO9A 3CP0A 1I94L 3HOXH 2JA6H 2IX1A 1BBWA 5BR8L 1X3EA 2XGTA 2NN6I 2K4KA 2I5LX 2D0PA 2EXDA 4O0AA 4JCVE 4LF7Q 1Q46A 4DV2L 4R4IA 3H0GG 4A75A 2HHHQ 3KFUA 3RLNA 1UE6A 4DK3C 1VQEA 3F2DA 2ZJRA 5LMUQ 1MKHA 3J7A5 1I3QH 2UXBL 5C44H 1XMOL 3WWVA 2UUAQ 3GTGH 4APVA 5IYDG 5C4JH 4DV3L 4GNXB 4LF7L 4L5TA 5ELNA 1RL2A 1TWFH 2DGYA 4TQUS 4LFBL 3D31A 5HY6A 1W2BA 2R7DA 2ATWA 2E5LL 4GOPB 3A5UA 4YCWA 1OTCA 4YWMA 1Q86C 1KD1C 1A8VA 1L1OC 1PFSA 4DUZQ 4AQYQ 1HNXQ 2KCTA 3NBHB 4QIWE 1CKOA 4LWCA 2NZHA 3J7ZC 2VZAA 2PNHA 4BBRG 3U4VA 4JI4Q 4BXXG 4C2MH 1JT8A 2R6GA 4L5RC 4DV1L 1HNXL 3GDEA 5C3EH 1SE8A 4JYAQ 1Q1BA 4DR1L 4QJFA 4JI2L 3I7FA 4IPCA 3E0EA 3D0FA 2LXKA 4DV0Q 2JA5H 2YYZA 4QY7A 2PQAA 4BBRH 4JYAL 4DR6Q 4A3JG 4A3KG 2E8GA 3TQYA 4WJ4A 1HR0L 2NVXH 1X3FA 5IE8A 3PF5A 4NXNL 1EOVA 4JBWA 2VQFL 4WJ3M 1LTLA 5LMNL 5M3MH 3W1BA 2UUAL 3KYHC 4NB3A 3H3VH 4JI1Q 1Q81C 5GADC 3L7ZC 3EIVA 1YIJA 1XPRA 5BR8Q 4IPGA 2NZOA 5ELOA 3CXCA 4DR1Q 4B3RQ 2Q2TA 1VQAA 1EIYB 2R92H 3CPFA 3S15H 2JA6G 3CCUA 5IYBH 1PH6A 1B7YB 1EQQA 3CW2C 5AJ3Q 3T1YL 1QZHA 1N34Q 4NXMQ 4OONA 2WP8J 4DUZL 2JA9A 4R4OA 3KDFB 2C35B 2K5NA 2N3SA 1IBLQ 4OXPA 3S2DH 4A3CH 4JOIC 2MO0A 1EIFA 4B3MQ 5FLMG 2R92G 4OX9L 3U58A 1YHBA 1KL9A 1C9OA 4DV7Q 1K3RA 4H02A 3I4MG 1IZ6A 4DKAC 3S1QH 4LUZA 4RMFA 1HR0W 4DPGA 4LF9Q 4GN4B 4LF4Q 2R93H 1CUKA 4A3CG 1FVIA 1YITA 3PO2H 4A3LG 1E22A 4Y7NH 3PF4A 1XPOA 3U50C 3S16H 1VQDA 2JA7G 1LM0A 4K0KL 1XNRQ 4DR3L 4LF5L 2HQLA 1CKNB 2A19A 3CMAA 3F2CA 3S1NH 2BA0A 3OYYA 4DV6Q 2A1AA 4JBJA 4DR2L 3UDGA 1PH3A 4A3DH 1VCIA 3K7AH 1CKNA 2VL6A 4JOIA 3UE1A 4R1JA 4HIMA 1MJCA 1AH9A 1LUZA 4PZ8A 4JI6Q 4OX9Q 1YZ6A 4GNXC 1I50H 1XNQL 2ASBA 4B3RL 1PH5A 4LW1A 4DR4Q 5C0XI 3BU2A 1R9TH 1PH7A 1VQNA 4IOAA 1VQCA 1EWIA 4DUYQ 1Z9FA 5C0XG 3T1HQ 3S24A 2VW9A 3UDFA 2EIFA 4GS3A 4YCUA 2VS1A 1CSPA 2AWOA 2KHJA 4BBSH 5J3BA 2I5HA 2AWNA 2FXQA 5IYCH 4OO1I 1WFQA 4B3TL 1L2FA 2D0OA 2Q2HA 1Y14B 4POGA 2IT1A 2JA8H 3CCMA 2RCNA 3HOYH 4BXXH 3M85A 4MNOA 4R4QA 4EQ5A 4GOPA 4GNXA 1PHJA 4JV5Q 3RN5A 2ZTEA 4QGUA 1PA6A 1B8AA 2JA5G 1IXRA 2ZM6Q 1VQBA 4AH6A 5IWAL 5GQOA 5GAHC 4A3IH 1EUJA 4LFCQ 1A62A 4GKJQ 4A93G 2LSSA 3K7UC 1E24A 1SRUA 3PUYA 3GTKH 5IP7H 3K80C 1VQMA 3S1MH 2WAQG 3OTOQ 1QVFA 2WB1G 4DR4L 4DR7L 2NVTH 4LFCL 4IOCA 4GKJL 2UXCL 1VQGA 4GKKQ 5LMNW 4DV5Q 1KXLA 4X64L 3BZKA 2Z6KA 2BH2A 3HOZG 3UDXA 1J6QA 4A93H 1JJGA 1WCMG 4AIMA 2UUCL 4JV5L 4YWLA 4YY3Q 5IP7G 1U5KA 2OTJA 4X65L 3G4SA 4DV4Q 3CMEA 1NMFA 3MEFA 3U4ZA 2BA1A 1GD7A 3GD7A 4A3FH 1D8LA 2HHHL 1JMCA 3PO3G 1KHIA 1CSQA 3M9BA 2QA4A 3HOUH 4IFDG 2K52A 1OXVA 3EN2A 4HJAA 3G6EA 4HJ8A 3I4MH 4QQBX 4X64Q 3TS0A 4YCVA 1N33L 3I2ZA 4X66Q 1S72A 5JEAG 1IBKQ 1UE1A 2L15A 3M4PA 3CCVA 1HH2P 1FL0A 3CC2A 2VQEQ 4J15A 2QGQA 1RIPA 4DR5L 1M1KC 1NJIC 1G6PA 3KF6B 2HIXA 1Q7YC 2E2JH 4RG1A 3KF8B 2K50A 3PUXA 1Q8KA 3FHWA 3H0GH 4AYBE 1I94Q 1HR0Q 2CCZA 2UXDQ 3KDFA 3HOWG 4LUVA 2I0QA 4ME3A 1J5EL 1U0LA 1N36L 1A0IA 3LGJA 4HJ9A 2F52A 1Q12A 1YJ9A 1Q82C 5IYCG 5M3FG 1KC8C 3J80i 4IFDI 3HKZG 1I5FA 1PVOA 5FJ8G 1NTGA 1GVPA 3ICEA 1KRSA 1VQFA 2MFIA 3CQZH 3FKIH 2ZM6L 1QZGA 1VQ9A 5M5XH 4C3HH 3PGZA 1N32L 1B70B 5IP9G 2K75A 1X54A 5IY0A 1WI5A 3ERSX 4O2DA 1S40A 4HJ5A 4DAMA 1YEZA 5HGQA 3F8TA 3TEHB 3M3YH 2B29A 4DR7Q 3PIOA 4X6AH 5FJ8H 5M5YH 4A3KH 2OCEA 4X62L 1H95A 1PYBA 3SGIA 3CF5A 1IBLL 3W1GA 4XTCS 1YBYA 1Y1VG 3S1RH 2E5LQ 3A5ZB 3JAMc 1Y1WG 4BY1H 4JI7L 2AKWB 1V9PA 1G291 1TWCH 4R4CA 4UP7A 5C4XH 4HJ7A 2YTYA 2UU9Q 3RZDH 4P72A 2Y0SE 3H15A 1WYDA 1QVGA 2OQKA 4DR5Q 4L5SA 2GVAA 4JI3L 3CCRA 2B3GA 4QL5A 2CWPA 3A0JA 2ALYB 2UU9L 1K8AC 3NELA 4JC0A 5GAGC 2JEAI 2R7FA 4JI4L 4LFBQ 3CCQA 1K8GA 3CCLA 4Y52H 2WB1E 2IHFA 4KLKA 2VNUD 4DV2Q 2JEBI 3STBD 3TS2A 3CCJA 3AYHB 4JBMA 2PI2A 4YHHL 3BZCA 5C3EG 4DAYB 3PUWA 2D62A 1P16A 4HIDA 2PMZE 2VQEL 2RHQB 4JI5L 2AHOB 1KQSA 1FJGQ 2DUDA 3CAMA 1JE5A 1VQOA 2YTXA 4GN3B 2ID0A 2YTVA 4HIOA 1UE7A 5GROA 4R4TA 3I4NG 4LF6Q 5FLMH 3TREA 1EYGA 4A3BG 4DV3Q 5M5WH 4OWTB 4JI0Q 3PCOB 4B3SQ 3CPWA 3H3VI 1VQHA 4A3DG 1IBKL 2JE6I 4A3EG 1UE5A 2IX0A 3PO2G 3B6YA 4P73A 4YHHQ 3UE0A 4IFDJ 2F3IA 1CKMA 3ER0A 1LYLA 3PUVA 5AJ3L 3RLOA 3W5OA 5LMNQ 3T1YQ 1FGUA 5M3FH 3ULPA 2R7ZG 2CWAA 2R93G 4EX5A 5IT9c 4K0KQ 1X3GA 3E9IA 3PSIA 4C3IH 3J81i 2PQAB 3A74A 1L1OA 2A8VA 1VS0A 1VQ6A 2LXJA 4B3ML 4B3SL 3GTPH 3MXNB 4XIGS 1X9NA 3TRZA 5IYDH 1DGSA 4PZ6A 1JB7A 3KJPA 3RN2A 2IY5B 4LF6L 1E3PA 3JAMi 2B63G 3PV0A 1K9MC 5JJKA 1BVSA 3Q8DA 4PG3A 1YVCA 4UPAA 4GLXA 2HIVA 3PIPA 3CC7A 1TWAH 4DV0L 3GTLH 2H5XA 3HOWH 3M4OH 1HZAA 3K0XA 3HKSA 4YY3L 5C0XJ 2NVYH 3KOJA 4JI1L 4X62Q 2EQSA 4TVAB 3GTOH 1IL2A 2KCMA 4PZ7A 4ALPA 3F2BA 3J80c 2QEXA 2VQFQ 1JJ2A 4BA1I 4DNIA 4JI7Q 1O7IA 1X65A 3NEMA 3DM3A 1VQ4A 4P74A 3KLWA 3G48A 4AYBG 2YU9H 2CQOA 4IJLA 2GVBA 2NN6G 2K5VA 4DR6L 4FDBA 4POFA 1VQ5A 3F1ZA 1N34L 4NXML 1MJEA 4JBKA 2RF4A 2Y0SG 2ZJQA 4NXNQ 1A63A 3L2PA 1UEBA 2OTLA 3HOYG 2YV5A 2NVQH 4X65Q 1N9WA 3PUZA 3AFPA 4JI0L 2VY3A 2N8NA 3HKZE 4A3MG 3I4NH 1E7ZA 1Z47A 1C7YA 3VDYA 1TWGH 3L0OA 1NY4A 4DV7L 4DV1Q 4LUOA 2JK8A 4GLVB 4BY7G 1VQIA 2UXCQ 1M90C 5IWAQ 4A3GG 2UXDL 2KHIA 1V43A 4JI2Q 3GO5A 5M3MG 4PMWA 3ULJA 1PH9A 1VQKA 2CFMA 4JI5Q 1YNXA 1KIXA 4BA2I 4OWXB 4X66L 2E2HH 4GLAC 1SROA 1VQ8A 3HOZH 4LF4L 1BKBA 2F4VL 3G71A 2MQHA 3AFQA 4B3TQ 4KI0A 4DV6L 2R7ZH 1XPUA 4GKKL 3CC4A 1NBWA 2V1CC 3JC66 1XNRL 5FLXc 2AMCB 3J81c 2Z0SA 3OTOL 1ASZA 2IHEA 2UUCQ 4A3EH 2ZTCA 4LF9L 3PO3H 5K36G 3DLLA 3S14H 5JEAJ 2CKZB 4UP9A 4A76A 3GTJH 1VQPA 1EQRA 5C44G 3E9HA 4P75A 3HOVG 5E7NA 1K83H 1PH4A 4JI6L 3KJOA 1EFWA 1XMQQ 3RR5A 1GO3E 5JJIA 1N33Q 1KAWA 1OXTA 1HNWQ 2OWOA 2JJQA 3I4OA 1K73C 3EBEA 4A3FG 3T1HL 5IP9H 1YHQA 2MNAA 3NENA 3K81C 3FP9A 1X55A 2MO1A 5LMUL 2E2IH 1HNWL 1PH8A 1G51A 2ES2A 1XJVA 4UY8C 1IYJB 1BBUA 4LNQA 2HT1A 1W3SA 1Y1VH 3IRBA 1XTDA 4L5QA 2ZTDA 4P71A 1TXYA 1WOCA 1HJPA 4DUYL 2Q2UA 1SMXA 1SLJA 5C4XG 4DR3Q 4GOPC 4LF5Q 1J5EQ 4IJHA 2N49A 1XMQL 2I5MX 1L1OB 2XTIA 1PH1A 4JI8L 3FKIG 1S3OA 1SR3A 2B63H 1E1OA 1TWHH 3M4QA 4YWKA 1K0RA 4LF8Q 1YI2A 1HZCA 1T9HA 3ZJYC 4GN5A 4HIKA 3CCEA 1NE3A 1YJNA 4AQYL 2JA8G 1SN8A 3RZOH 1HZBA 1UWVA 3CCSA 1XMOQ 1HNZQ 1OXUA 2Q2IA 1XNQQ 4A3JH 3GTQH 4BBSG 1QUQA 2OQ0A 4IPHA 4KHZA 2GN5A 5EAYA 3UDIA 1V1QA 1WCMH 4JG2A 1D7QA 3K8AA 2Z6KC 1OXSC 4LFAL 1I6HH 1QUQB 1IBML 4C3JH 2F4VQ
chains in the Genus database with same CATH superfamily
2N88A 4QUFA 3E3XA 2F0OA 5EPKA 2NTTA 2EE1A 4JPBW 1SMYC 1GM5A 4LFAQ 1LTSD 5GAEC 3TMEA 1CI3M 1TY0A 2GA4B 3RZOB 3S1RB 4BY1G 1Y1WH 4A3GH 5E1FA 2A6HC 2KJXA 3LWUA 4QF4A 3I55A 2N78A 3PIP3 1E1TA 4BY7H 1S5CD 3ULLA 1P8LA 1RDPD 2X6LA 2WAQE 4KKTA 4TKOB 3HOXG 3BDCA 2XWJB 3J7YW 4A3LH 3RLFA 3H0GB 4B9XA 2E2IB 3DEPA 1AZPA 4IPDA 2MGSA 4PMCA 1JORA 3RNUA 1FJGL 3HOUG 3BJUA 1I94L 2IX1A 1JR0D 4RGMA 1M4VA 5IGEA 4H7BA 1X3EA 2D0PA 4LF7Q 3HOWB 1FNUA 4R4IA 3KFUA 1UE6A 1VQEA 1I3QH 1XMOL 3GTQB 4A3JB 3MVVA 2Z4HA 3A55A 4P2CB 1MGSA 5JAVA 3BDLA 4APVA 5IYDG 3CHBD 5KNDA 3J7AF 4CKEA 3TDQA 4CDCC 1H9KA 1TWFH 2DGYA 1D5MC 2EPBA 5HY6A 1BO0A 1W2BA 2O4XA 2B2YA 4YWMA 1KD1C 1A8VA 4OEMB 3I70A 1PFSA 4OL7A 3Q22A 1HNXQ 2K05A 4BWGB 4LWCA 1E2ZA 3J7ZC 2VZAA 2PNHA 4C2MH 1JT8A 1SE8A 4JYAQ 5KYLA 1SYGA 4XT1B 1TWFB 4QIWB 1STHA 4KY6A 1VMPA 3E0EA 3F2UA 2JA5B 2K1BA 3I4LA 2NVYB 2KOLA 1STYA 3TQYA 5FO9B 4WJ3M 2ENBA 2OF1A 1PRTB 3KYHC 4NB3A 1KDAA 5GADC 2EYHA 1XPRA 2NB0A 4RWSC 5ELOA 1KLUD 2BOSA 3OOCA 4NDXA 1ICFB 1GUOA 2R92H 1JC7A 1A2UA 3ONAB 3HZXA 2JA9A 2N3SA 5C6AA 3K0YA 1BUVT 1SNDA 3KF8A 4X3KA 1KL9A 1K3RA 2H4OA 4H02A 4DN4M 4DKAC 3I4MG 4LUZA 2WB1B 3BDOA 1YITA 4A3LG 1VQDA 4DR3L 3LX0A 5DEHA 3S1NH 3F2CA 4DV6Q 1PH3A 4DR2L 1SE2A 4TSSA 4JOIA 1GUGA 2RVLA 1D6EC 1XXGA 5T1IA 1EY6A 1SDFA 1AH9A 1YZ6A 1PH5A 4LW1A 1PH7A 2BDNA 4IOAA 1EWIA 1WTWA 4DUYQ 5DNFA 1B3AA 3UDFA 2EIFA 5I6WA 5J3BA 2AWNA 4DXFA 3MXGA 4OO1I 2F1MA 1RJTA 1K3BC 4POGA 2IT1A 1CTMA 4R4QA 1A3UA 1PHJA 1LO5D 2JA5G 2ZM6Q 4CKCA 5GAHC 4GKJQ 1A62A 3SEBA 2QF7A 4A3FB 1TS3A 5J39A 2WAQG 1OO9B 2WB1G 4KY5A 4DR7L 2NVTH 4IOCA 4GKKQ 5I2XA 3NXWA 3NWSA 3BZKA 4Y7NB 5CV5A 3OIPA 1WCMG 2O5JC 1JJGA 3QOJA 4KJOA 1EY4A 5IP7G 5G3LF 2OTJA 1CK1A 1W6KA 2RQXA 3G4SA 1LTRD 3KLSA 3CMEA 1TU2B 3MEFA 1ET6A 1WTHA 2K5QA 4A3FH 2HHHL 1CSQA 2QA4A 3HOUH 1OXVA 3EJIA 1RODA 2EJGC 2X6GA 4YCVA 4HMJA 2O5IC 3I2ZA 4X66Q 2VB3X 1YNJC 2L15A 2F0SA 1WTXA 1DCZA 2HIXA 1Q7YC 1TKWB 4FYDA 3KF8B 2K50A 2F03A 2SDFA 3FHWA 2EJFC 1I94Q 1ENFA 2EYLA 5KEEA 4LUVA 4IUUA 4ME3A 1N36L 3LGJA 5IODA 1Q82C 1D1IA 3GTJB 3HKZG 1I5FA 1NTGA 3ICEA 3FKIH 5M5XH 1R4QB 1N32L 3R3OA 1S40A 1WI5A 4H13C 3K57A 3F8TA 4DR7Q 4X6AH 5M5YH 1B4OA 2MP1A 1H95A 3SGIA 3S2HB 1YBYA 5C4XH 1V9PA 4R4CA 4UP7A 1VF5C 3OMGA 3FKIB 2CH4W 3CCRA 3A0JA 2F0FA 3NBIA 3DEOA 1V1OA 3NELA 5GAGC 3GTMB 1K8GA 4IUPA 4Y52H 1S5FD 2K28A 1CQFA 2VNUD 1E0BA 2YU9B 2PI2A 4PV1C 4X3TA 3PUWA 4DAYB 4PNYA 3S9WA 1U4RA 4QMGA 2K7VA 1FJGQ 3CAMA 3PO2B 3C3LA 2ID0A 3P20A 3VR5A 1STAA 5FLXL 4DV3Q 3E5SA 5M5WH 4TRDA 1PLFA 4RHSA 1SNQA 1SE3A 1CHPD 3GQBA 5KRUA 4IFDJ 3ER0A 1LYLA 4WFN3 3D4RA 2WINB 3PUVA 3FPUB 4MHEA 1EY5A 1SYCA 4EX5A 4K0KQ 3PSIA 3WOFA 3J81i 5M5WB 3A74A 1L1OA 1VS0A 3TRZA 1EY8A 3P75A 3MXNB 4XIGS 1DGSA 2PZWA 3VYSA 3KJPA 5IGDA 4NW2A 1QCBD 2JYOA 3IAYA 2B63G 1HTPA 1SNMA 1BVSA 3Q8DA 1YVCA 2HIVA 1S4ZA 4DV0L 4L8JA 1HZAA 2ZT9C 2G5DA 2PYKA 4C3HG 1IW7C 3KLRA 4TVAB 3GTOH 2F0DA 3F2BA 3J80c 2QEXA 4DNIA 1O7IA 1D1KA 3DM3A 4P74A 3KLWA 3WOEA 4AYBG 4IJLA 2L4NA 3BYYB 2DNEA 2A6HD 1B50A 3NP8A 1MJEA 3AB9A 2FJ2A 4NXNQ 4RHRA 2JP1A 3DWAA 2AQ3B 3HOYG 4XYQA 2NVQH 2O2LD 3AFPA 1DOKA 2B2UC 2N8NA 1LTBD 4RKLA 3UI2A 1TWGH 4HR7B 1RTNA 2DJFC 4YIJA 4GLVB 2UXDL 1E2WA 3NHHA 4PMWA 1VQKA 1F2ZA 2HQEA 4BA2I 2J7ZA 1AN8A 4GLAC 3QWNA 3G6JB 4H44C 4GKKL 2IWHA 3JC66 1EU4A 5FLXc 5D65A 4KV6A 4DAYA 2Z1CA 3O13A 3DLLA 3HP3A 2F3VA 2CKZB 4UP9A 3NTKA 4A76A 1R9TB 5T1GA 1PTOD 1EFWA 1GO3E 1HNWQ 3PQIA 5CV4A 5BN4A 2KVMA 4OIKA 5M9OA 1PTOC 1D5XC 3FP9A 2E2IH 2MO1A 1PH8A 2R93B 3QR8A 4UY8C 1ML0D 1G2SA 3J80E 3CKIB 1BCPC 1SMXA 5C4XG 4GOPC 2MUYA 1AFPA 1L1OB 1PH1A 2FHTA 2OT2A 3EQLC 2B63H 3M4QA 4LF8Q 1YI2A 4I65A 1G6ZA 2IX3A 3ZJYC 4A3MB 1XYIA 3GTKB 2E2DC 1WVLA 4AQYL 1I3QB 3CCSA 3S1MH 1XMOQ 4NP5A 3GTQH 4BBSG 4A3JH 1U4MA 4JK1C 4KHZA 1C8CA 5KNCA 5K5PA 2Z6KC 1KDBA 1UEAB 3MC0B 1FNVA 4DR2Q 4LK1C 1CA5A 4KHPQ 4G7OC 3M7NA 3IKJA 5I9OA 5ELCA 4A3MH 4MTNA 1ASYA 5COYA 4A3IG 3K5MA 1N32Q 1IBMQ 4DV4L 3I56A 2K5HA 3IL8A 3FRPB 2JN4A 3EFXD 3J81j 4C2MB 1AE3A 1PYSB 1WJJA 4U68A 1N36Q 1EQVA 1VQLA 3SK6A 1SNPA 4KHPL 3HOVH 1AE2A 5IGGA 1N8RC 2KCCA 2PQEA 5EQ0A 2QDBA 5JPNC 4XYOA 2PZTA 4OO1G 4O42A 1C0AA 1MIUA 3VYTA 2LFNA 4IO9A 4OGQC 4ME5A 1AW7A 2NN6I 2K4KA 1KAAA 2EXDA 4O0AA 1FNWA 2KECA 3M4OB 3HOVB 3TZDA 1Q3LA 5JJZA 1F2LA 1MKHA 4V0BA 2XWBB 4BY1B 1YNNC 5I9PA 4L5TA 1SYDA 3D4WA 3MXUA 1EYCA 1EZ8A 4LAAA 1EIGA 4LFBL 3D31A 1AZQA 2A74C 5TSSA 2XVSA 3OWFA 3H3VC 4GOPB 5EPLA 3A56A 2QDLA 1QOHA 1Q86C 3HEJA 1SJED 4G4KA 4AQYQ 1BQQT 4HSPA 3KK7A 4QCLA 4Q0FA 4RGOS 2IJ0A 2R6GA 4DV1L 5C3EH 4DR1L 3U9OA 4JI2L 1IYVA 2C5CA 1O7YA 3NSWA 2LXKA 4DV0Q 1MI2A 3FVQA 2PQAA 4QY7A 1EU3A 4DR6Q 4A3JG 1ZEQX 3T56B 2NVXH 5IE8A 1G2TA 1EOVA 2VQFL 2TSSA 3W1BA 3SXHA 4JI1Q 5ELBA 3L7ZC 3MXNA 3EIVA 3VR3A 2J4XA 4IPGA 3CXCA 4DR1Q 3RZDB 5ELDA 4B3RQ 3S14B 3A8IE 1EIYB 5M3FB 3CCUA 2JA6G 1B7YB 1F9SA 4ZRZA 3J7AV 3CW2C 4DK1A 4ODGA 2CQAA 1KDCA 2WP8J 3KDFB 2C35B 2K5NA 5C44B 1Y8PB 5FLMG 4ZUIA 2F0MA 3U58A 1EFID 1YHBA 5CGKA 3S1QH 4DPGA 5D14A 1CUKA 3OIQA 3PMFA 3TBIB 1FVIA 2A6EC 4A3CG 4Y7NH 3PF4A 1XPOA 4LF5L 4XQQA 2KA7A 2BA0A 3OYYA 4F88A 2A1AA 4A3DH 1QNKA 2RSOA 3A8JE 3UE1A 1D2BA 1LTGD 1YNJD 5F2DA 1LUZA 4OX9Q 1LT4D 2ASBA 1ZXTA 5C0XI 1WCMB 1VQNA 2F0TA 2D5DA 5C0XG 1KLGD 3T1HQ 2EVBA 2B2TC 4DU9A 3KBGA 1B2TA 2KHJA 4BBSH 1QB5D 2I5HA 1DOMA 1HFNA 2PZUA 4KN4C 5FLXE 1T5XD 1QWYA 2B8FA 2JA8H 3CCMA 2RCNA 4RH6A 4GOPA 4GNXA 2PW7A 3RN5A 2ZTEA 1PA6A 1B8AA 2F3WA 3T4AC 3D8GA 4A3IH 2B39A 3K7UC 4S3SA 3NTIA 1SRUA 5IP7H 3K80C 4RCOA 3OTOQ 4KMUC 5M5YB 2PPBC 1VQGA 5LMNW 4MIUA 5JPMC 4X64L 2Z6KA 4KTAA 4DFAA 2EZVA 1HA5A 1I4GA 4A93H 1J6QA 4WJWA 3SK5A 3MWYW 1U9RA 4YY3Q 1HTLD 4X65L 1CHQD 3I3CA 5IGBA 1KTKA 1FD7D 1PTOH 3U9SA 1NMFA 3U4ZA 2BA1A 1GD7A 1D8LA 1JMCA 2M2LA 2EDGA 3BYTB 3PO3G 4RGTA 2V4DA 2E74C 2H1EA 1LTID 4QQBX 2DN8A 4X64Q 2F0GA 1S72A 3M4PA 2QW7A 1HH2P 4R9WA 5IT9L 3T51B 1RIPA 4BY7B 2E2JH 2HD3A 1WTPA 2MJ8A 1Q8KA 3H0GH 1HR0Q 2UXDQ 5EJWA 3HOWG 3KLSX 1U0LA 1PMRA 1JOQA 1A0IA 1PFNA 3HOYB 2F52A 1Q12A 5LL6S 1KC8C 1MSHA 2EJMA 2XRQD 5IIFA 4PQXA 1GVPA 2WKCA 2MFIA 3L3OC 3QIAA 3PGZA 3FPPA 4DAVA 5IP9G 2E2JB 3ERSX 4HJ5A 5CORA 1S5DD 1H9RA 3X3NA 3PIOA 5FJ8H 3CF5A 3BVGA 2A68C 4UHVA 3W1GA 1Y1VG 3JAMc 1SYEA 1EWCA 5ISRA 1DM0B 2AKWB 1EYDA 4HJ7A 4NMZA 4UDUC 3H15A 2OQKA 4L5SA 2B2YC 2GVAA 4JI3L 2B3GA 2CWPA 2UU9L 4RGNA 1K8AC 2JEAI 1TS5A 2MHVA 3NUCA 5IOCA 1O78A 4J6HA 3STBD 2XSCA 3TS2A 1WTVA 3BZCA 1P16A 2XIWA 5J22A 1PTOF 1MHWC 4I7ZC 1KQSA 1QILA 3GV6A 2YTVA 3CU7A 4HIOA 1G8ZD 1UE7A 4R4TA 5GROA 4LF6Q 5FLMH 3TREA 4MN3A 1EYGA 4JI0Q 3TP7A 2B2VA 4A3DG 1VQHA 1IBKL 2JE6I 3HG9A 2A5HA 1UE5A 3GTGB 4P73A 1TR5A 2Q8RE 5AJ3L 3T1YQ 1DZ1A 3N6RA 1PDQA 2R93G 5ELFA 2B8GA 1U4PA 1MD2D 2PQAB 2AUJD 5IYDH 4LMQD 1X9NA 3EA6A 3FEWX 4K2KA 1JB7A 5C5LA 3RN2A 3BVZA 4F8MA 4LF6L 1E3PA 3JAMi 3D4DA 3K5OA 1K9MC 5JJKA 4PG3A 4GLXA 4CJ1B 3GTLH 2H5XA 3HOWH 3K0XA 3K59A 4CJ0B 1IL2A 2KCMA 4PZ7A 4FF3A 4JI7Q 3NEMA 2QKIC 4F87A 4FDBA 2HCCA 2F0EA 4POFA 3F1ZA 1VQ5A 1N34L 4NXML 1QNUA 1PRTC 3HKZB 2Y0SG 2ZJQA 2RDHA 1A63A 3L2PA 2OTLA 1KNEA 2FINB 2YV5A 3PUZA 1ILQA 5L37A 1WTQA 4JI0L 5LHY1 5CV9A 4CKBA 2B63B 1Y69U 3VDYA 4DV7L 1NY4A 4A3GG 1PH9A 4E6IA 3RMHA 4OWXB 4X66L 1SROA 3HOZH 1H9SB 1K83B 4AYBB 4OELB 3G71A 4KI0A 3GTPB 4WRDA 3I73A 3H6MA 1SNOA 2V1CC 2Z0SA 3OTOL 2E76C 5E4WC 1ASZA 4KD4A 3W2DA 1CQVA 4A3EH 1TS2A 4N9TA 2AUKA 5K36G 5J1ZA 5JEAJ 2R92B 5C44G 3HOZB 3HOVG 1K83H 1PH4A 2KEDA 5A2QL 3D6WA 3RR5A 1OXTA 3IFDA 4ILWA 2JJQA 2Z8LA 1W6JA 4A3FG 1BBXC 3T1HL 5IP9H 1YHQA 3K6OA 3SR1A 2G9DA 3HOUB 2MNAA 2BDOA 3NENA 5LMUL 3GV3A 1C48A 1G51A 2HT1A 1W3SA 1Y1VH 4L5QA 1BNZA 1TWCB 1SLJA 5FO8B 4C3JB 2HCIA 4DR3Q 1ZYRC 2HDLA 2N49A 2NUCA 4JI8L 3SE0A 3K5LA 1TWHH 2Z4IA 4YWKA 1ILPA 4HIKA 1UAPA 1HZBA 2BE5D 1XNQQ 1OXUA 1B44D 4IPHA 5EAYA 2GN5A 1D7QA 3K8AA 1OXSC 1QUQB 4L6TB 3NK9A 4C3JH 4CJ2C 5M5XB 1X3PA 3OW2A 3STBC 3NPPA 3AEVA 2R7ZB 2UUBQ 4DNTB 2EYPA 4PMBA 3S2HH 1RD9D 1PV4A 5IYBG 4LF8L 1VQJA 3MAQA 2JA7B 4DK6C 5C4ZA 2HUGA 4CBVA 1PH2A 1OXXK 4L63B 1VQ7A 5DLQE 1HNZL 4OO1H 2UXBQ 4KHVA 3TP8A 1HZ9A 4ZYSA 3VA7A 4R8IA 3T53B 1WTRA 1SJHD 1NMGA 2UUBL 1Q8IA 4A4IA 2K14A 1SFOH 4OWWB 3GTMH 2NVTB 4DXGA 3HFZB 2RDFA 4BS9A 1A2TA 1JQYD 2ZXOA 5H1SE 4DV5L 1YJWA 4KY7A 1PRTF 2VUMG 4A3BH 2JA7H 2KBNA 1X6OA 5FKAC 1JJCB 1Q1EA 1STGA 2JA6H 1BBWA 5BR8L 1I4RA 1VMCA 2XGTA 2I5LX 3A54A 2CH4A 4JCVE 2F0WA 2A69D 3URYA 4DV2L 4RAUC 3RLNA 1RTOA 1SFOB 1DJRD 5LMUQ 2ZJRA 5IGCA 1DD2A 2UXBL 5C44H 4A3BB 3Q24A 3LWEA 2WAQB 4DV3L 4LF7L 3OHXC 3NE5B 1B9NA 2K04A 1UUPA 2K5DA 1RL2A 3W3AA 4TQUS 3MEHA 3QJYA 1NCVA 2B2WC 2R7DA 2ATWA 2I07B 4BBRB 2E5LL 3A5UA 4YCWA 1OTCA 2R3ZA 1L1OC 2SOBA 2KCTA 2N55A 1M8AA 2SNMA 4QIWE 5EGTA 3K58A 5IT9E 1GHKA 1UNSA 4BXXG 3NBHA 3SHLA 1LT6D 2CW0C 4L5RC 1HNXL 5EKIA 2EY1A 1I4HA 4QJFA 4DGZA 4IPCA 1S5BD 2E2HB 1XTCD 2JA5H 2YYZA 1EYAA 4BBRH 5FOBB 1QE6A 2E8GA 4A3KG 1NUCA 1GUNA 4HMIA 5FK9C 4NXNL 3AU7A 5LMNL 3NWTA 2BE5C 2E75C 5C4XB 4HN7A 1YIJA 5BR8Q 3DXJC 3PO3B 1B3QA 3BVMA 4U673 4ABNA 3P7JA 2RA4A 5IYBH 1A3VA 5AJ3Q 2B2UA 3T1YL 1QZHA 1N34Q 4NXMQ 1LV9A 3S2DH 1II3A 4R4OA 1PFBA 2EY5A 4X3SA 3FDTA 4JOIC 4A3CH 1ESFA 4B3MQ 2K6AA 3J81L 4R8NA 3SVMA 4RMFA 1HR0W 1HUMA 4LF9Q 5I4DA 1VF7A 3VA5A 4KKUA 4XQJA 3PO2H 1E22A 4A93B 3U50C 4X3UA 4CHTB 2JA7G 4K0KL 3TP6A 1RF2D 3CMAA 2A19A 2KEEA 3UDGA 1VCIA 1CKNA 2VL6A 2L11A 1TVXA 5C0XH 4XXEA 4PZ8A 4B3RL 1L0YB 1I50H 1PRTD 1PZKD 4DR4Q 3BU2A 1R9TH 2EYMA 5EBDA 1E2VA 1Z9FA 1ESRA 2VW9A 1J9OA 1IKLA 2VS1A 1CSPA 2AWOA 2PW5A 1ENAA 3OMCA 1GUTA 2C9OA 2RKSA 1WTOA 1WFQA 2D0OA 1EEFD 1PZJD 4K5XA 3HOYH 4FVMA 4JV5Q 3TZUA 3TN2A 2AQ2B 4H0LC 2JSOA 1VQBA 1IHZA 3GTOB 5IWAL 5GQOA 1EUJA 2F0NA 4A93G 2LSSA 1E24A 1STBA 3GTKH 1VQMA 1MSGA 2UXCL 2EYOA 4LFCL 1GUSA 3I4MB 4KJNA 2BH2A 5D3DA 4AIMA 4YWLA 1LTAD 2JXMB 4DV4Q 1Y8OB 4XQNA 2LKVA 1DYQA 4QUCA 3K7AB 3GD7A 3MFYA 3M9BA 1HQMC 2K52A 3I90A 2PMZB 3EN2A 3I4MH 3G6EA 1O7LA 4FF4A 1IKMA 5JEAG 1IBKQ 1UE1A 3CCVA 1LTTD 3JAME 2DJGC 4DR5L 1NJIC 1G6PA 3KF6B 1PZID 5CV7A 4RG1A 1BCPB 1I4QA 3OWEB 2J0TD 3PUXA 5C3XA 3C1EA 3C2PA 1BCPF 3MHBA 2I0QA 1BR9A 5NUCA 1STNA 4HJ9A 1YJ9A 5IYCG 3J80i 5CV8A 1I6HB 5CR3A 5FJ8G 2X69A 1VQFA 2K03A 3CQZH 4FXDA 1VQ9A 3ERQA 3ND9A 4C3HH 1DOLA 1B70B 2K75A 4DAMA 4RKBA 5HGQA 1KNAA 3TEHB 2B29A 4A3KH 2OCEA 1S5ED 5D3IB 1PYBA 1IBLL 4Q5VA 4XTCS 1TS4A 4ZAIA 3DWQA 2NTSA 2QEJC 4HTHA 5A2QE 3A5ZB 3S1RH 1Y1WG 1Y1WB 2E5LQ 4BY1H 4JI7L 3VYUA 1G291 1K8MA 1C4QA 2YTYA 1RHPA 4P72A 3CQZB 4C56C 1WYDA 4DR5Q 4QL5A 2ALYB 1GOZA 4IQZA 4K6LA 4LFBQ 3CCQA 4XDXA 3CCLA 2WB1E 4KLKA 2BCOA 3V05A 4DV2Q 1CM9A 1D5ZC 3T13A 3CCJA 3AYHB 4OHJA 4IFDH 5C3EG 3KBXA 2D62A 4CDDC 2PMZE 1JB3A 2LY7A 2VQEL 1CT1D 2AHOB 2DUDA 3G7LA 1JE5A 5CV6A 1VQOA 2YTXA 4IUNA 4HSVA 3S1NB 4OWTB 3PCOB 2DY8A 1F9RA 4J8QA 2F0UA 2IX0A 4RCNA 3PO2G 2R61A 3UE0A 1CKMA 5LL6X 4NKLA 3A8KE 1JWSD 3W5OA 5LMNQ 3AMUA 2M00A 4UAIA 1EQTA 5M3FH 3ULPA 1K8OA 5IGFA 3M3YB 3E9IA 4DF7A 1HFGA 2TMPA 3R93A 4RFBA 3GTPH 3DHQA 1VQ6A 4B3ML 1GJXA 5K36H 1U4LA 3VR6A 2IW3A 3PV0A 3CRLC 4UPAA 3CC7A 1TWAH 3M4OH 1NAPA 3KUPA 5C0XJ 3V96A 3KOJA 2F0PA 2NVYH 4X62Q 2EQSA 2NBFA 1RKNA 1F2YA 1I4XA 5BN5A 1VQ4A 3G48A 2CQOA 2GVBA 1NSNS 4V190 2K5VA 4IURA 1FR3A 3R2IA 3M4YA 3MA2B 3IFTA 4JBKA 2KQ3A 2RF4A 4M8AA 1ICWA 1TWAB 5G3LD 4FXKC 3H91A 4X65Q 4IN3A 5JOBA 2K32A 4A3MG 3I4NH 1K28A 3L9AX 1VQIA 3H09A 3DUZA 1V43A 4JI2Q 1JCKB 5M3MG 3PIO3 1H9SA 4C3JG 2RSNA 1QG7A 1SE4A 1VDZA 5JEAH 4LF4L 4ZQ3A 5BN3A 2MQHA 3AFQA 4B3TQ 4DV6L 1Y8NB 2R7ZH 1XPUA 3CC4A 4B08A 1T5EA 4C1NK 2AMCB 4C3IG 1PYWD 1O7ZA 2ZTCA 3S14H 1EY9A 1BXTA 3MTSA 3GP7A 3GTJH 1VQPA 1EQRA 2L12A 1HA6A 3E9HA 4JI6L 3KJOA 4EGVA 1XMQQ 3E6ZX 2OWOA 5EKKA 4CDEC 1HNWL 3K81C 2ES2A 1XJVA 1BBUA 4LNQA 1Q90A 3IRBA 4KN7C 2ZTDA 4P71A 1BDOA 4EQOA 4DUYL 2Q2UA 4LF5Q 2CW0D 3TP5A 4IJHA 1XMQL 2I5MX 4A3DB 3FKIG 1CZWA 2Z9HA 1HZCA 1T9HA 1NE3A 1YJNA 2K5WA 1MBYA 2JA8G 1UWVA 2L1BA 4ZKBB 1XWEA 3Q23A 3OW7A 1QUQA 1IL8A 3UDIA 2KUMA 1WCMH 4JG2A 4LFAL 1IBML 1XX8A 3X3MA 1KRTA 2WFWA 1B1ZA 2L55A 1QVCA 2SNSA 4ZUJA 4JI3Q 5JJLA 1JWMD 2A73B 1YHAA 4MZ9A 1H9MA 1SEBD 2KENA 3I72A 3KF6A 5HGTA 2A69C 2JA8B 3S17H 3AQQA 4EQPA 1V1PB 3HRZC 4NPSA 2PI2E 1B53A 2VUMH 4JI8Q 1L0WA 4JVZA 1GKHA 2BH8A 5EBCA 4OIJA 3VR2A 2EY6A 1TY2A 1YNND 2RHSB 2EYJA 2JQOA 3CD6A 2ZJPA 4UP8A 1X56A 4G57A 1G91A 3CP0A 3HOXH 1WD1A 4ZLTF 2VUMB 1PTOB 1Q46A 1HCZA 3H0GG 4A75A 2HHHQ 3D3RA 3A7LA 2OXPA 4DK3C 3F2DA 4ID6A 3J7A5 2PCFB 3WWVA 5CC4A 2UUAQ 3GTGH 4FXGC 1AEXA 5C4JH 4GNXB 2WKDA 2VXWA 1JICA 4WORA 5ELNA 4IUTA 3J81E 1Z7TA 2K01A 1LT5D 4IUVA 1F77A 4DUZQ 3NBHB 3J80L 1SXTA 1CKOA 3M7GA 2NYZD 5M3MB 2NZHA 4A3GB 3NQIA 4BBRG 3NTHA 3U4VA 4JI4Q 2XRSD 3GDEA 1Q1BA 3I7FA 1I50B 3D0FA 3GTLB 4JYAL 2ICEC 4FO2A 5HURA 1HR0L 4WJ4A 2Y0SB 1X3FA 2IPKD 3PF5A 2EXZA 4JBWA 1LTLA 4K8IA 5CBEE 5M3MH 2UUAL 4M1UB 1JOOA 1GXDC 1Q81C 5KIXA 4K5WA 2F0VA 1K0SA 2NZOA 2Q2TA 1VQAA 2A68D 3CPFA 3S15H 5C5MA 1PH6A 1EQQA 4K8JA 1ZYRD 4OONA 1EY7A 4DUZL 1IBLQ 3A7AB 4OXPA 1H9JA 1EIFA 2MO0A 2K33A 2R92G 4OX9L 2F0IA 1V1PA 1C9OA 4DV7Q 1IZ6A 2HDMA 4N8FA 1EY0A 4DAPA 5A35A 4GN4B 4LF4Q 2R93H 3N52A 1NR2A 3ITPA 3MFGA 1ET9A 3S15B 3S16H 2KCNA 1LM0A 3VYRA 1XNRQ 3LNNA 2HQLA 1CKNB 2Q8IB 1PFMA 1R4PB 4JBJA 4K5VA 3K7AH 4HCEA 4JW0A 1SBBB 3VR4A 4CDFC 4R1JA 4HIMA 4A3EB 5EPJA 1DXMA 5CYUA 5DM73 1MJCA 4JI6Q 4GNXC 1XNQL 5I2YA 3E0JA 1F9QA 3C1FA 5FO7B 1PXUA 1VQCA 1JWUD 3S16B 2F4IA 2NVQB 3S24A 4FP5D 4CGYB 4GS3A 4YCUA 1EWHA 3JAML 2RCFA 1TWGB 2FXQA 5IYCH 1DONA 3DWPA 4B3TL 1L2FA 2Q2HA 1Y14B 1EL0A 4ZKCB 3M85A 2L9HA 4MNOA 4EQ5A 1LACA 1HXYD 1A15A 4QGUA 1V8QA 2FFKB 1IXRA 2IL8A 3MZ5A 4AH6A 4C3HB 4LFCQ 3BZDB 2DNCA 1HHVA 3PUYA 2NN6H 4DR4L 1QVFA 4A3KB 4GKJL 1F2MA 4XT3B 2EYFA 4DV5Q 1KXLA 2RBMA 3HOZG 3UDXA 3I91A 3QOLA 2UUCL 4JV5L 1U5KA 4DNRB 1CA6A 2KHSA 2RDGA 1JOKA 1O80A 4HAEA 3HS0C 1KHIA 4IFDG 2ZXPA 5KNBA 4HJAA 4HJ8A 3QG1A 4B9WA 3TS0A 1N33L 4LJZC 5E3FA 1AP0A 1TT2A 1LT3D 3D6CA 3V2TA 1FL0A 2CHBD 3CC2A 2VQEQ 2WACA 1SYFA 1CZGA 4J15A 2QGQA 4K6DA 3I8ZA 1M1KC 4GZYC 1LLRD 1ENCA 4AYBE 2CCZA 4I7AA 3KDFA 3HGBA 2F0KA 3S1MB 2NWGA 2ICIA 1J5EL 5AFWA 1HUNA 2Q8TA 5M3FG 2JA6B 4IFDI 1PVOA 1X32A 5C3EB 1KRSA 2ZM6L 1QZGA 1X3QA 4FF2A 1EIHA 3ND8A 1J8IA 5DAUA 5IY0A 1X54A 4O2DA 1YEZA 5ELEA 3M3YH 1FGBD 3BS1A 1FYCA 1B9MA 2NVXB 1SAPA 4X62L 1BCPD 3MXPA 2CVRA 1Y1VB 1TWCH 2UU9Q 1LABA 4Z9CB 2B2WA 2Y0SE 3RZDH 1QVGA 2DY7A 4DK0A 1TWHB 2EOTA 4JC0A 2R7FA 1SMYD 2B2VC 4JI4L 2IHFA 2PNRC 1EZ6A 2JEBI 4JBMA 4ZCKA 4YHHL 3S1QB 4HIDA 2RHQB 4JI5L 4KK7A 4GN3B 3SK4A 5E4XA 4O1NA 3T16A 3I4NG 2D2CC 1SSOA 3BG3A 3R8BA 4KD3A 4A3BG 3C46A 2P5ZX 4IALA 1I6VC 3TSSA 5C3WA 4B3SQ 3CPWA 2QILA 3H3VI 3I4NB 4A3EG 2OEOA 2Z6BA 2NZ1D 3B6YA 4YHHQ 4G7ZC 2F3IA 4QB4A 3P1HA 5I6YA 3RLOA 2F0HA 1FGUA 1Z6HA 4HCSA 2R7ZG 2CWAA 1ONLA 5IT9c 1X3GA 3EROA 4RA8A 4C3IH 3S2DB 4ZK9B 2WV6D 4FF1A 2A8VA 2LXJA 4B3SL 5JVH3 1NR4A 2D9UA 1BF4A 2AQ1B 2M9VA 3WDNA 2XN9C 4G7HC 4BBSB 4J1MA 4PZ6A 2WIIB 2IY5B 1SNCA 5EKLA 4EQNA 1I4PA 1BOSA 3PIPA 3HKSA 4YY3L 4EVOA 3SDZA 1EOTA 4JI1L 2XNAC 1IW7D 1ZKOA 2FMMA 4C3IB 1EEID 3RUZA 4A3IB 4ALPA 1JJ2A 2VQFQ 4BA1I 1GUWA 1X65A 2YU9H 4N9PA 2NN6G 5KYIA 3QO2A 2MPMA 4DR6L 2PO4A 1HRJA 1TIID 3NQTA 2ZXRA 1SYBA 1UEBA 4IZ8A 2F0LA 1HPCA 5DM63 1N9WA 3Q0AA 3FMCA 2LS01 2VY3A 1TQOA 3HKZE 1E7ZA 3DM1A 1Z47A 1C7YA 1GHJA 3L0OA 4DV1Q 3H94A 2JK8A 4LUOA 4BY7G 3K5NA 1IYUA 5IWAQ 1M90C 2UXCQ 2KHIA 1A6XA 3GO5A 3ULJA 2F0JA 1STEA 3Q6SA 2CFMA 4JI5Q 1YNXA 4K14A 4MTKA 1KIXA 2A6ED 2L5TA 3RD4A 4HEDA 2LMCB 2E2HH 1VQ8A 3CRKC 1BKBA 2F4VL 1A3TA 1JE4A 4C1NI 5CMDA 2I46A 1NBWA 1XNRL 3J81c 2IHEA 2UUCQ 4LF9L 5CBAE 3PO3H 1L0XB 2QCPX 3SK8A 3S17B 4N8X1 2SEBD 1CFMA 4P75A 3QB3A 5E7NA 1F9PA 5JJIA 2EY2A 1N33Q 1KAWA 2G9HD 4KKSA 5JVG3 2B2TA 1K73C 3I4OA 3EBEA 4FNFA 1X55A 3EVQA 2F0QA 4F7XA 1IYJB 3OSOA 4ULLA 3R2TA 4K2LA 5KGUA 1XTDA 2FMCA 4DA2A 1TXYA 1WOCA 1HJPA 3HOXB 1HQRD 5C4HA 1WD0A 1QJOA 1J5EQ 2XTIA 1S3OA 1SR3A 1E1OA 1K0RA 2L0CA 3DMUA 1NNXA 4GN5A 1RCVD 1KABA 3CCEA 3ZYYX 2VB2X 1SN8A 3RZOH 4IUQA 1HNZQ 4BXXH 2Q2IA 2OQ0A 1V1QA 5C4JB 1I6HH 3OPOA 3H3VH 2F4VQ
chains in the Genus database with same CATH topology
3OW2A 3STBC 4DR2Q 1KRTA 3AEVA 2WFWA 4JI3Q 5JJLA 1QVCA 2UUBQ 4KHPQ 1YHAA 4MZ9A 3M7NA 2KENA 4A3MH 4MTNA 3KF6A 1GM5A 4LFAQ 4A3IG 1ASYA 5GAEC 3S2HH 1PV4A 1N32Q 5IYBG 1IBMQ 1VQJA 4LF8L 4DV4L 3I56A 4BY1G 4DK6C 1Y1WH 2K5HA 1PH2A 3S17H 3AQQA 4A3GH 1OXXK 3J81j 3I55A 1VQ7A 2N78A 5DLQE 1HNZL 1AE3A 2UXBQ 1PYSB 1E1TA 1WJJA 1N36Q 1HZ9A 4NPSA 2PI2E 2VUMH 1VQLA 4JI8Q 4BY7H 1L0WA 3ULLA 1NMGA 2UUBL 4KHPL 1P8LA 1AE2A 1N8RC 3HOVH 2WAQE 3HOXG 1GKHA 2BH8A 2K14A 4A4IA 1SFOH 4OWWB 3GTMH 4OO1G 4A3LH 3RLFA 3HFZB 4DV5L 1YJWA 4A3BH 5H1SE 2RHSB 4IPDA 2VUMG 2JQOA 2JA7H 1C0AA 2KBNA 1MIUA 3CD6A 2ZJPA 3RNUA 4UP8A 1X6OA 1X56A 1FJGL 1JJCB 1Q1EA 3HOUG 3BJUA 4IO9A 3CP0A 1I94L 3HOXH 2JA6H 2IX1A 1BBWA 5BR8L 1X3EA 2XGTA 2NN6I 2K4KA 2I5LX 2D0PA 2EXDA 4O0AA 4JCVE 4LF7Q 1Q46A 4DV2L 4R4IA 3H0GG 4A75A 2HHHQ 3KFUA 3RLNA 1UE6A 4DK3C 1VQEA 3F2DA 2ZJRA 5LMUQ 1MKHA 3J7A5 1I3QH 2UXBL 5C44H 1XMOL 3WWVA 2UUAQ 3GTGH 4APVA 5IYDG 5C4JH 4DV3L 4GNXB 4LF7L 4L5TA 5ELNA 1RL2A 1TWFH 2DGYA 4TQUS 4LFBL 3D31A 5HY6A 1W2BA 2R7DA 2ATWA 2E5LL 4GOPB 3A5UA 4YCWA 1OTCA 4YWMA 1Q86C 1KD1C 1A8VA 1L1OC 1PFSA 4DUZQ 4AQYQ 1HNXQ 2KCTA 3NBHB 4QIWE 1CKOA 4LWCA 2NZHA 3J7ZC 2VZAA 2PNHA 4BBRG 3U4VA 4JI4Q 4BXXG 4C2MH 1JT8A 2R6GA 4L5RC 4DV1L 1HNXL 3GDEA 5C3EH 1SE8A 4JYAQ 1Q1BA 4DR1L 4QJFA 4JI2L 3I7FA 4IPCA 3E0EA 3D0FA 2LXKA 4DV0Q 2JA5H 2YYZA 4QY7A 2PQAA 4BBRH 4JYAL 4DR6Q 4A3JG 4A3KG 2E8GA 3TQYA 4WJ4A 1HR0L 2NVXH 1X3FA 5IE8A 3PF5A 4NXNL 1EOVA 4JBWA 2VQFL 4WJ3M 1LTLA 5LMNL 5M3MH 3W1BA 2UUAL 3KYHC 4NB3A 3H3VH 4JI1Q 1Q81C 5GADC 3L7ZC 3EIVA 1YIJA 1XPRA 5BR8Q 4IPGA 2NZOA 5ELOA 3CXCA 4DR1Q 4B3RQ 2Q2TA 1VQAA 1EIYB 2R92H 3CPFA 3S15H 2JA6G 3CCUA 5IYBH 1PH6A 1B7YB 1EQQA 3CW2C 5AJ3Q 3T1YL 1QZHA 1N34Q 4NXMQ 4OONA 2WP8J 4DUZL 2JA9A 4R4OA 3KDFB 2C35B 2K5NA 2N3SA 1IBLQ 4OXPA 3S2DH 4A3CH 4JOIC 2MO0A 1EIFA 4B3MQ 5FLMG 2R92G 4OX9L 3U58A 1YHBA 1KL9A 1C9OA 4DV7Q 1K3RA 4H02A 3I4MG 1IZ6A 4DKAC 3S1QH 4LUZA 4RMFA 1HR0W 4DPGA 4LF9Q 4GN4B 4LF4Q 2R93H 1CUKA 4A3CG 1FVIA 1YITA 3PO2H 4A3LG 1E22A 4Y7NH 3PF4A 1XPOA 3U50C 3S16H 1VQDA 2JA7G 1LM0A 4K0KL 1XNRQ 4DR3L 4LF5L 2HQLA 1CKNB 2A19A 3CMAA 3F2CA 3S1NH 2BA0A 3OYYA 4DV6Q 2A1AA 4JBJA 4DR2L 3UDGA 1PH3A 4A3DH 1VCIA 3K7AH 1CKNA 2VL6A 4JOIA 3UE1A 4R1JA 4HIMA 1MJCA 1AH9A 1LUZA 4PZ8A 4JI6Q 4OX9Q 1YZ6A 4GNXC 1I50H 1XNQL 2ASBA 4B3RL 1PH5A 4LW1A 4DR4Q 5C0XI 3BU2A 1R9TH 1PH7A 1VQNA 4IOAA 1VQCA 1EWIA 4DUYQ 1Z9FA 5C0XG 3T1HQ 3S24A 2VW9A 3UDFA 2EIFA 4GS3A 4YCUA 2VS1A 1CSPA 2AWOA 2KHJA 4BBSH 5J3BA 2I5HA 2AWNA 2FXQA 5IYCH 4OO1I 1WFQA 4B3TL 1L2FA 2D0OA 2Q2HA 1Y14B 4POGA 2IT1A 2JA8H 3CCMA 2RCNA 3HOYH 4BXXH 3M85A 4MNOA 4R4QA 4EQ5A 4GOPA 4GNXA 1PHJA 4JV5Q 3RN5A 2ZTEA 4QGUA 1PA6A 1B8AA 2JA5G 1IXRA 2ZM6Q 1VQBA 4AH6A 5IWAL 5GQOA 5GAHC 4A3IH 1EUJA 4LFCQ 1A62A 4GKJQ 4A93G 2LSSA 3K7UC 1E24A 1SRUA 3PUYA 3GTKH 5IP7H 3K80C 1VQMA 3S1MH 2WAQG 3OTOQ 1QVFA 2WB1G 4DR4L 4DR7L 2NVTH 4LFCL 4IOCA 4GKJL 2UXCL 1VQGA 4GKKQ 5LMNW 4DV5Q 1KXLA 4X64L 3BZKA 2Z6KA 2BH2A 3HOZG 3UDXA 1J6QA 4A93H 1JJGA 1WCMG 4AIMA 2UUCL 4JV5L 4YWLA 4YY3Q 5IP7G 1U5KA 2OTJA 4X65L 3G4SA 4DV4Q 3CMEA 1NMFA 3MEFA 3U4ZA 2BA1A 1GD7A 3GD7A 4A3FH 1D8LA 2HHHL 1JMCA 3PO3G 1KHIA 1CSQA 3M9BA 2QA4A 3HOUH 4IFDG 2K52A 1OXVA 3EN2A 4HJAA 3G6EA 4HJ8A 3I4MH 4QQBX 4X64Q 3TS0A 4YCVA 1N33L 3I2ZA 4X66Q 1S72A 5JEAG 1IBKQ 1UE1A 2L15A 3M4PA 3CCVA 1HH2P 1FL0A 3CC2A 2VQEQ 4J15A 2QGQA 1RIPA 4DR5L 1M1KC 1NJIC 1G6PA 3KF6B 2HIXA 1Q7YC 2E2JH 4RG1A 3KF8B 2K50A 3PUXA 1Q8KA 3FHWA 3H0GH 4AYBE 1I94Q 1HR0Q 2CCZA 2UXDQ 3KDFA 3HOWG 4LUVA 2I0QA 4ME3A 1J5EL 1U0LA 1N36L 1A0IA 3LGJA 4HJ9A 2F52A 1Q12A 1YJ9A 1Q82C 5IYCG 5M3FG 1KC8C 3J80i 4IFDI 3HKZG 1I5FA 1PVOA 5FJ8G 1NTGA 1GVPA 3ICEA 1KRSA 1VQFA 2MFIA 3CQZH 3FKIH 2ZM6L 1QZGA 1VQ9A 5M5XH 4C3HH 3PGZA 1N32L 1B70B 5IP9G 2K75A 1X54A 5IY0A 1WI5A 3ERSX 4O2DA 1S40A 4HJ5A 4DAMA 1YEZA 5HGQA 3F8TA 3TEHB 3M3YH 2B29A 4DR7Q 3PIOA 4X6AH 5FJ8H 5M5YH 4A3KH 2OCEA 4X62L 1H95A 1PYBA 3SGIA 3CF5A 1IBLL 3W1GA 4XTCS 1YBYA 1Y1VG 3S1RH 2E5LQ 3A5ZB 3JAMc 1Y1WG 4BY1H 4JI7L 2AKWB 1V9PA 1G291 1TWCH 4R4CA 4UP7A 5C4XH 4HJ7A 2YTYA 2UU9Q 3RZDH 4P72A 2Y0SE 3H15A 1WYDA 1QVGA 2OQKA 4DR5Q 4L5SA 2GVAA 4JI3L 3CCRA 2B3GA 4QL5A 2CWPA 3A0JA 2ALYB 2UU9L 1K8AC 3NELA 4JC0A 5GAGC 2JEAI 2R7FA 4JI4L 4LFBQ 3CCQA 1K8GA 3CCLA 4Y52H 2WB1E 2IHFA 4KLKA 2VNUD 4DV2Q 2JEBI 3STBD 3TS2A 3CCJA 3AYHB 4JBMA 2PI2A 4YHHL 3BZCA 5C3EG 4DAYB 3PUWA 2D62A 1P16A 4HIDA 2PMZE 2VQEL 2RHQB 4JI5L 2AHOB 1KQSA 1FJGQ 2DUDA 3CAMA 1JE5A 1VQOA 2YTXA 4GN3B 2ID0A 2YTVA 4HIOA 1UE7A 5GROA 4R4TA 3I4NG 4LF6Q 5FLMH 3TREA 1EYGA 4A3BG 4DV3Q 5M5WH 4OWTB 4JI0Q 3PCOB 4B3SQ 3CPWA 3H3VI 1VQHA 4A3DG 1IBKL 2JE6I 4A3EG 1UE5A 2IX0A 3PO2G 3B6YA 4P73A 4YHHQ 3UE0A 4IFDJ 2F3IA 1CKMA 3ER0A 1LYLA 3PUVA 5AJ3L 3RLOA 3W5OA 5LMNQ 3T1YQ 1FGUA 5M3FH 3ULPA 2R7ZG 2CWAA 2R93G 4EX5A 5IT9c 4K0KQ 1X3GA 3E9IA 3PSIA 4C3IH 3J81i 2PQAB 3A74A 1L1OA 2A8VA 1VS0A 1VQ6A 2LXJA 4B3ML 4B3SL 3GTPH 3MXNB 4XIGS 1X9NA 3TRZA 5IYDH 1DGSA 4PZ6A 1JB7A 3KJPA 3RN2A 2IY5B 4LF6L 1E3PA 3JAMi 2B63G 3PV0A 1K9MC 5JJKA 1BVSA 3Q8DA 4PG3A 1YVCA 4UPAA 4GLXA 2HIVA 3PIPA 3CC7A 1TWAH 4DV0L 3GTLH 2H5XA 3HOWH 3M4OH 1HZAA 3K0XA 3HKSA 4YY3L 5C0XJ 2NVYH 3KOJA 4JI1L 4X62Q 2EQSA 4TVAB 3GTOH 1IL2A 2KCMA 4PZ7A 4ALPA 3F2BA 3J80c 2QEXA 2VQFQ 1JJ2A 4BA1I 4DNIA 4JI7Q 1O7IA 1X65A 3NEMA 3DM3A 1VQ4A 4P74A 3KLWA 3G48A 4AYBG 2YU9H 2CQOA 4IJLA 2GVBA 2NN6G 2K5VA 4DR6L 4FDBA 4POFA 1VQ5A 3F1ZA 1N34L 4NXML 1MJEA 4JBKA 2RF4A 2Y0SG 2ZJQA 4NXNQ 1A63A 3L2PA 1UEBA 2OTLA 3HOYG 2YV5A 2NVQH 4X65Q 1N9WA 3PUZA 3AFPA 4JI0L 2VY3A 2N8NA 3HKZE 4A3MG 3I4NH 1E7ZA 1Z47A 1C7YA 3VDYA 1TWGH 3L0OA 1NY4A 4DV7L 4DV1Q 4LUOA 2JK8A 4GLVB 4BY7G 1VQIA 2UXCQ 1M90C 5IWAQ 4A3GG 2UXDL 2KHIA 1V43A 4JI2Q 3GO5A 5M3MG 4PMWA 3ULJA 1PH9A 1VQKA 2CFMA 4JI5Q 1YNXA 1KIXA 4BA2I 4OWXB 4X66L 2E2HH 4GLAC 1SROA 1VQ8A 3HOZH 4LF4L 1BKBA 2F4VL 3G71A 2MQHA 3AFQA 4B3TQ 4KI0A 4DV6L 2R7ZH 1XPUA 4GKKL 3CC4A 1NBWA 2V1CC 3JC66 1XNRL 5FLXc 2AMCB 3J81c 2Z0SA 3OTOL 1ASZA 2IHEA 2UUCQ 4A3EH 2ZTCA 4LF9L 3PO3H 5K36G 3DLLA 3S14H 5JEAJ 2CKZB 4UP9A 4A76A 3GTJH 1VQPA 1EQRA 5C44G 3E9HA 4P75A 3HOVG 5E7NA 1K83H 1PH4A 4JI6L 3KJOA 1EFWA 1XMQQ 3RR5A 1GO3E 5JJIA 1N33Q 1KAWA 1OXTA 1HNWQ 2OWOA 2JJQA 3I4OA 1K73C 3EBEA 4A3FG 3T1HL 5IP9H 1YHQA 2MNAA 3NENA 3K81C 3FP9A 1X55A 2MO1A 5LMUL 2E2IH 1HNWL 1PH8A 1G51A 2ES2A 1XJVA 4UY8C 1IYJB 1BBUA 4LNQA 2HT1A 1W3SA 1Y1VH 3IRBA 1XTDA 4L5QA 2ZTDA 4P71A 1TXYA 1WOCA 1HJPA 4DUYL 2Q2UA 1SMXA 1SLJA 5C4XG 4DR3Q 4GOPC 4LF5Q 1J5EQ 4IJHA 2N49A 1XMQL 2I5MX 1L1OB 2XTIA 1PH1A 4JI8L 3FKIG 1S3OA 1SR3A 2B63H 1E1OA 1TWHH 3M4QA 4YWKA 1K0RA 4LF8Q 1YI2A 1HZCA 1T9HA 3ZJYC 4GN5A 4HIKA 3CCEA 1NE3A 1YJNA 4AQYL 2JA8G 1SN8A 3RZOH 1HZBA 1UWVA 3CCSA 1XMOQ 1HNZQ 1OXUA 2Q2IA 1XNQQ 4A3JH 3GTQH 4BBSG 1QUQA 2OQ0A 4IPHA 4KHZA 2GN5A 5EAYA 3UDIA 1V1QA 1WCMH 4JG2A 1D7QA 3K8AA 2Z6KC 1OXSC 4LFAL 1I6HH 1QUQB 1IBML 4C3JH 2F4VQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 A;  3STB C;  4DR2 Q;  1KRT A;  3AEV A;  2WFW A;  4JI3 Q;  5JJL A;  1QVC A;  2UUB Q;  4KHP Q;  1YHA A;  4MZ9 A;  3M7N A;  2KEN A;  4A3M H;  4MTN A;  3KF6 A;  1GM5 A;  4LFA Q;  4A3I G;  1ASY A;  5GAE C;  3S2H H;  1PV4 A;  1N32 Q;  5IYB G;  1IBM Q;  1VQJ A;  4LF8 L;  4DV4 L;  3I56 A;  4BY1 G;  4DK6 C;  1Y1W H;  2K5H A;  1PH2 A;  3S17 H;  3AQQ A;  4A3G H;  1OXX K;  3J81 j;  3I55 A;  1VQ7 A;  2N78 A;  5DLQ E;  1HNZ L;  1AE3 A;  2UXB Q;  1PYS B;  1E1T A;  1WJJ A;  1N36 Q;  1HZ9 A;  4NPS A;  2PI2 E;  2VUM H;  1VQL A;  4JI8 Q;  4BY7 H;  1L0W A;  3ULL A;  1NMG A;  2UUB L;  4KHP L;  1P8L A;  1AE2 A;  1N8R C;  3HOV H;  2WAQ E;  3HOX G;  1GKH A;  2BH8 A;  2K14 A;  4A4I A;  1SFO H;  4OWW B;  3GTM H;  4OO1 G;  4A3L H;  3RLF A;  3HFZ B;  4DV5 L;  1YJW A;  4A3B H;  5H1S E;  2RHS B;  4IPD A;  2VUM G;  2JQO A;  2JA7 H;  1C0A A;  2KBN A;  1MIU A;  3CD6 A;  2ZJP A;  3RNU A;  4UP8 A;  1X6O A;  1X56 A;  1FJG L;  1JJC B;  1Q1E A;  3HOU G;  3BJU A;  4IO9 A;  3CP0 A;  1I94 L;  3HOX H;  2JA6 H;  2IX1 A;  1BBW A;  5BR8 L;  1X3E A;  2XGT A;  2NN6 I;  2K4K A;  2I5L X;  2D0P A;  2EXD A;  4O0A A;  4JCV E;  4LF7 Q;  1Q46 A;  4DV2 L;  4R4I A;  3H0G G;  4A75 A;  2HHH Q;  3KFU A;  3RLN A;  1UE6 A;  4DK3 C;  1VQE A;  3F2D A;  2ZJR A;  5LMU Q;  1MKH A;  3J7A 5;  1I3Q H;  2UXB L;  5C44 H;  1XMO L;  3WWV A;  2UUA Q;  3GTG H;  4APV A;  5IYD G;  5C4J H;  4DV3 L;  4GNX B;  4LF7 L;  4L5T A;  5ELN A;  1RL2 A;  1TWF H;  2DGY A;  4TQU S;  4LFB L;  3D31 A;  5HY6 A;  1W2B A;  2R7D A;  2ATW A;  2E5L L;  4GOP B;  3A5U A;  4YCW A;  1OTC A;  4YWM A;  1Q86 C;  1KD1 C;  1A8V A;  1L1O C;  1PFS A;  4DUZ Q;  4AQY Q;  1HNX Q;  2KCT A;  3NBH B;  4QIW E;  1CKO A;  4LWC A;  2NZH A;  3J7Z C;  2VZA A;  2PNH A;  4BBR G;  3U4V A;  4JI4 Q;  4BXX G;  4C2M H;  1JT8 A;  2R6G A;  4L5R C;  4DV1 L;  1HNX L;  3GDE A;  5C3E H;  1SE8 A;  4JYA Q;  1Q1B A;  4DR1 L;  4QJF A;  4JI2 L;  3I7F A;  4IPC A;  3E0E A;  3D0F A;  2LXK A;  4DV0 Q;  2JA5 H;  2YYZ A;  4QY7 A;  2PQA A;  4BBR H;  4JYA L;  4DR6 Q;  4A3J G;  4A3K G;  2E8G A;  3TQY A;  4WJ4 A;  1HR0 L;  2NVX H;  1X3F A;  5IE8 A;  3PF5 A;  4NXN L;  1EOV A;  4JBW A;  2VQF L;  4WJ3 M;  1LTL A;  5LMN L;  5M3M H;  3W1B A;  2UUA L;  3KYH C;  4NB3 A;  3H3V H;  4JI1 Q;  1Q81 C;  5GAD C;  3L7Z C;  3EIV A;  1YIJ A;  1XPR A;  5BR8 Q;  4IPG A;  2NZO A;  5ELO A;  3CXC A;  4DR1 Q;  4B3R Q;  2Q2T A;  1VQA A;  1EIY B;  2R92 H;  3CPF A;  3S15 H;  2JA6 G;  3CCU A;  5IYB H;  1PH6 A;  1B7Y B;  1EQQ A;  3CW2 C;  5AJ3 Q;  3T1Y L;  1QZH A;  1N34 Q;  4NXM Q;  4OON A;  2WP8 J;  4DUZ L;  2JA9 A;  4R4O A;  3KDF B;  2C35 B;  2K5N A;  2N3S A;  1IBL Q;  4OXP A;  3S2D H;  4A3C H;  4JOI C;  2MO0 A;  1EIF A;  4B3M Q;  5FLM G;  2R92 G;  4OX9 L;  3U58 A;  1YHB A;  1KL9 A;  1C9O A;  4DV7 Q;  1K3R A;  4H02 A;  3I4M G;  1IZ6 A;  4DKA C;  3S1Q H;  4LUZ A;  4RMF A;  1HR0 W;  4DPG A;  4LF9 Q;  4GN4 B;  4LF4 Q;  2R93 H;  1CUK A;  4A3C G;  1FVI A;  1YIT A;  3PO2 H;  4A3L G;  1E22 A;  4Y7N H;  3PF4 A;  1XPO A;  3U50 C;  3S16 H;  1VQD A;  2JA7 G;  1LM0 A;  4K0K L;  1XNR Q;  4DR3 L;  4LF5 L;  2HQL A;  1CKN B;  2A19 A;  3CMA A;  3F2C A;  3S1N H;  2BA0 A;  3OYY A;  4DV6 Q;  2A1A A;  4JBJ A;  4DR2 L;  3UDG A;  1PH3 A;  4A3D H;  1VCI A;  3K7A H;  1CKN A;  2VL6 A;  4JOI A;  3UE1 A;  4R1J A;  4HIM A;  1MJC A;  1AH9 A;  1LUZ A;  4PZ8 A;  4JI6 Q;  4OX9 Q;  1YZ6 A;  4GNX C;  1I50 H;  1XNQ L;  2ASB A;  4B3R L;  1PH5 A;  4LW1 A;  4DR4 Q;  5C0X I;  3BU2 A;  1R9T H;  1PH7 A;  1VQN A;  4IOA A;  1VQC A;  1EWI A;  4DUY Q;  1Z9F A;  5C0X G;  3T1H Q;  3S24 A;  2VW9 A;  3UDF A;  2EIF A;  4GS3 A;  4YCU A;  2VS1 A;  1CSP A;  2AWO A;  2KHJ A;  4BBS H;  5J3B A;  2I5H A;  2AWN A;  2FXQ A;  5IYC H;  4OO1 I;  1WFQ A;  4B3T L;  1L2F A;  2D0O A;  2Q2H A;  1Y14 B;  4POG A;  2IT1 A;  2JA8 H;  3CCM A;  2RCN A;  3HOY H;  4BXX H;  3M85 A;  4MNO A;  4R4Q A;  4EQ5 A;  4GOP A;  4GNX A;  1PHJ A;  4JV5 Q;  3RN5 A;  2ZTE A;  4QGU A;  1PA6 A;  1B8A A;  2JA5 G;  1IXR A;  2ZM6 Q;  1VQB A;  4AH6 A;  5IWA L;  5GQO A;  5GAH C;  4A3I H;  1EUJ A;  4LFC Q;  1A62 A;  4GKJ Q;  4A93 G;  2LSS A;  3K7U C;  1E24 A;  1SRU A;  3PUY A;  3GTK H;  5IP7 H;  3K80 C;  1VQM A;  3S1M H;  2WAQ G;  3OTO Q;  1QVF A;  2WB1 G;  4DR4 L;  4DR7 L;  2NVT H;  4LFC L;  4IOC A;  4GKJ L;  2UXC L;  1VQG A;  4GKK Q;  5LMN W;  4DV5 Q;  1KXL A;  4X64 L;  3BZK A;  2Z6K A;  2BH2 A;  3HOZ G;  3UDX A;  1J6Q A;  4A93 H;  1JJG A;  1WCM G;  4AIM A;  2UUC L;  4JV5 L;  4YWL A;  4YY3 Q;  5IP7 G;  1U5K A;  2OTJ A;  4X65 L;  3G4S A;  4DV4 Q;  3CME A;  1NMF A;  3MEF A;  3U4Z A;  2BA1 A;  1GD7 A;  3GD7 A;  4A3F H;  1D8L A;  2HHH L;  1JMC A;  3PO3 G;  1KHI A;  1CSQ A;  3M9B A;  2QA4 A;  3HOU H;  4IFD G;  2K52 A;  1OXV A;  3EN2 A;  4HJA A;  3G6E A;  4HJ8 A;  3I4M H;  4QQB X;  4X64 Q;  3TS0 A;  4YCV A;  1N33 L;  3I2Z A;  4X66 Q;  1S72 A;  5JEA G;  1IBK Q;  1UE1 A;  2L15 A;  3M4P A;  3CCV A;  1HH2 P;  1FL0 A;  3CC2 A;  2VQE Q;  4J15 A;  2QGQ A;  1RIP A;  4DR5 L;  1M1K C;  1NJI C;  1G6P A;  3KF6 B;  2HIX A;  1Q7Y C;  2E2J H;  4RG1 A;  3KF8 B;  2K50 A;  3PUX A;  1Q8K A;  3FHW A;  3H0G H;  4AYB E;  1I94 Q;  1HR0 Q;  2CCZ A;  2UXD Q;  3KDF A;  3HOW G;  4LUV A;  2I0Q A;  4ME3 A;  1J5E L;  1U0L A;  1N36 L;  1A0I A;  3LGJ A;  4HJ9 A;  2F52 A;  1Q12 A;  1YJ9 A;  1Q82 C;  5IYC G;  5M3F G;  1KC8 C;  3J80 i;  4IFD I;  3HKZ G;  1I5F A;  1PVO A;  5FJ8 G;  1NTG A;  1GVP A;  3ICE A;  1KRS A;  1VQF A;  2MFI A;  3CQZ H;  3FKI H;  2ZM6 L;  1QZG A;  1VQ9 A;  5M5X H;  4C3H H;  3PGZ A;  1N32 L;  1B70 B;  5IP9 G;  2K75 A;  1X54 A;  5IY0 A;  1WI5 A;  3ERS X;  4O2D A;  1S40 A;  4HJ5 A;  4DAM A;  1YEZ A;  5HGQ A;  3F8T A;  3TEH B;  3M3Y H;  2B29 A;  4DR7 Q;  3PIO A;  4X6A H;  5FJ8 H;  5M5Y H;  4A3K H;  2OCE A;  4X62 L;  1H95 A;  1PYB A;  3SGI A;  3CF5 A;  1IBL L;  3W1G A;  4XTC S;  1YBY A;  1Y1V G;  3S1R H;  2E5L Q;  3A5Z B;  3JAM c;  1Y1W G;  4BY1 H;  4JI7 L;  2AKW B;  1V9P A;  1G29 1;  1TWC H;  4R4C A;  4UP7 A;  5C4X H;  4HJ7 A;  2YTY A;  2UU9 Q;  3RZD H;  4P72 A;  2Y0S E;  3H15 A;  1WYD A;  1QVG A;  2OQK A;  4DR5 Q;  4L5S A;  2GVA A;  4JI3 L;  3CCR A;  2B3G A;  4QL5 A;  2CWP A;  3A0J A;  2ALY B;  2UU9 L;  1K8A C;  3NEL A;  4JC0 A;  5GAG C;  2JEA I;  2R7F A;  4JI4 L;  4LFB Q;  3CCQ A;  1K8G A;  3CCL A;  4Y52 H;  2WB1 E;  2IHF A;  4KLK A;  2VNU D;  4DV2 Q;  2JEB I;  3STB D;  3TS2 A;  3CCJ A;  3AYH B;  4JBM A;  2PI2 A;  4YHH L;  3BZC A;  5C3E G;  4DAY B;  3PUW A;  2D62 A;  1P16 A;  4HID A;  2PMZ E;  2VQE L;  2RHQ B;  4JI5 L;  2AHO B;  1KQS A;  1FJG Q;  2DUD A;  3CAM A;  1JE5 A;  1VQO A;  2YTX A;  4GN3 B;  2ID0 A;  2YTV A;  4HIO A;  1UE7 A;  5GRO A;  4R4T A;  3I4N G;  4LF6 Q;  5FLM H;  3TRE A;  1EYG A;  4A3B G;  4DV3 Q;  5M5W H;  4OWT B;  4JI0 Q;  3PCO B;  4B3S Q;  3CPW A;  3H3V I;  1VQH A;  4A3D G;  1IBK L;  2JE6 I;  4A3E G;  1UE5 A;  2IX0 A;  3PO2 G;  3B6Y A;  4P73 A;  4YHH Q;  3UE0 A;  4IFD J;  2F3I A;  1CKM A;  3ER0 A;  1LYL A;  3PUV A;  5AJ3 L;  3RLO A;  3W5O A;  5LMN Q;  3T1Y Q;  1FGU A;  5M3F H;  3ULP A;  2R7Z G;  2CWA A;  2R93 G;  4EX5 A;  5IT9 c;  4K0K Q;  1X3G A;  3E9I A;  3PSI A;  4C3I H;  3J81 i;  2PQA B;  3A74 A;  1L1O A;  2A8V A;  1VS0 A;  1VQ6 A;  2LXJ A;  4B3M L;  4B3S L;  3GTP H;  3MXN B;  4XIG S;  1X9N A;  3TRZ A;  5IYD H;  1DGS A;  4PZ6 A;  1JB7 A;  3KJP A;  3RN2 A;  2IY5 B;  4LF6 L;  1E3P A;  3JAM i;  2B63 G;  3PV0 A;  1K9M C;  5JJK A;  1BVS A;  3Q8D A;  4PG3 A;  1YVC A;  4UPA A;  4GLX A;  2HIV A;  3PIP A;  3CC7 A;  1TWA H;  4DV0 L;  3GTL H;  2H5X A;  3HOW H;  3M4O H;  1HZA A;  3K0X A;  3HKS A;  4YY3 L;  5C0X J;  2NVY H;  3KOJ A;  4JI1 L;  4X62 Q;  2EQS A;  4TVA B;  3GTO H;  1IL2 A;  2KCM A;  4PZ7 A;  4ALP A;  3F2B A;  3J80 c;  2QEX A;  2VQF Q;  1JJ2 A;  4BA1 I;  4DNI A;  4JI7 Q;  1O7I A;  1X65 A;  3NEM A;  3DM3 A;  1VQ4 A;  4P74 A;  3KLW A;  3G48 A;  4AYB G;  2YU9 H;  2CQO A;  4IJL A;  2GVB A;  2NN6 G;  2K5V A;  4DR6 L;  4FDB A;  4POF A;  1VQ5 A;  3F1Z A;  1N34 L;  4NXM L;  1MJE A;  4JBK A;  2RF4 A;  2Y0S G;  2ZJQ A;  4NXN Q;  1A63 A;  3L2P A;  1UEB A;  2OTL A;  3HOY G;  2YV5 A;  2NVQ H;  4X65 Q;  1N9W A;  3PUZ A;  3AFP A;  4JI0 L;  2VY3 A;  2N8N A;  3HKZ E;  4A3M G;  3I4N H;  1E7Z A;  1Z47 A;  1C7Y A;  3VDY A;  1TWG H;  3L0O A;  1NY4 A;  4DV7 L;  4DV1 Q;  4LUO A;  2JK8 A;  4GLV B;  4BY7 G;  1VQI A;  2UXC Q;  1M90 C;  5IWA Q;  4A3G G;  2UXD L;  2KHI A;  1V43 A;  4JI2 Q;  3GO5 A;  5M3M G;  4PMW A;  3ULJ A;  1PH9 A;  1VQK A;  2CFM A;  4JI5 Q;  1YNX A;  1KIX A;  4BA2 I;  4OWX B;  4X66 L;  2E2H H;  4GLA C;  1SRO A;  1VQ8 A;  3HOZ H;  4LF4 L;  1BKB A;  2F4V L;  3G71 A;  2MQH A;  3AFQ A;  4B3T Q;  4KI0 A;  4DV6 L;  2R7Z H;  1XPU A;  4GKK L;  3CC4 A;  1NBW A;  2V1C C;  3JC6 6;  1XNR L;  5FLX c;  2AMC B;  3J81 c;  2Z0S A;  3OTO L;  1ASZ A;  2IHE A;  2UUC Q;  4A3E H;  2ZTC A;  4LF9 L;  3PO3 H;  5K36 G;  3DLL A;  3S14 H;  5JEA J;  2CKZ B;  4UP9 A;  4A76 A;  3GTJ H;  1VQP A;  1EQR A;  5C44 G;  3E9H A;  4P75 A;  3HOV G;  5E7N A;  1K83 H;  1PH4 A;  4JI6 L;  3KJO A;  1EFW A;  1XMQ Q;  3RR5 A;  1GO3 E;  5JJI A;  1N33 Q;  1KAW A;  1OXT A;  1HNW Q;  2OWO A;  2JJQ A;  3I4O A;  1K73 C;  3EBE A;  4A3F G;  3T1H L;  5IP9 H;  1YHQ A;  2MNA A;  3NEN A;  3K81 C;  3FP9 A;  1X55 A;  2MO1 A;  5LMU L;  2E2I H;  1HNW L;  1PH8 A;  1G51 A;  2ES2 A;  1XJV A;  4UY8 C;  1IYJ B;  1BBU A;  4LNQ A;  2HT1 A;  1W3S A;  1Y1V H;  3IRB A;  1XTD A;  4L5Q A;  2ZTD A;  4P71 A;  1TXY A;  1WOC A;  1HJP A;  4DUY L;  2Q2U A;  1SMX A;  1SLJ A;  5C4X G;  4DR3 Q;  4GOP C;  4LF5 Q;  1J5E Q;  4IJH A;  2N49 A;  1XMQ L;  2I5M X;  1L1O B;  2XTI A;  1PH1 A;  4JI8 L;  3FKI G;  1S3O A;  1SR3 A;  2B63 H;  1E1O A;  1TWH H;  3M4Q A;  4YWK A;  1K0R A;  4LF8 Q;  1YI2 A;  1HZC A;  1T9H A;  3ZJY C;  4GN5 A;  4HIK A;  3CCE A;  1NE3 A;  1YJN A;  4AQY L;  2JA8 G;  1SN8 A;  3RZO H;  1HZB A;  1UWV A;  3CCS A;  1XMO Q;  1HNZ Q;  1OXU A;  2Q2I A;  1XNQ Q;  4A3J H;  3GTQ H;  4BBS G;  1QUQ A;  2OQ0 A;  4IPH A;  4KHZ A;  2GN5 A;  5EAY A;  3UDI A;  1V1Q A;  1WCM H;  4JG2 A;  1D7Q A;  3K8A A;  2Z6K C;  1OXS C;  4LFA L;  1I6H H;  1QUQ B;  1IBM L;  4C3J H;  2F4V Q; 
#chains in the Genus database with same CATH topology
 2N88 A;  4QUF A;  3E3X A;  2F0O A;  5EPK A;  2NTT A;  2EE1 A;  4JPB W;  1SMY C;  1GM5 A;  4LFA Q;  1LTS D;  5GAE C;  3TME A;  1CI3 M;  1TY0 A;  2GA4 B;  3RZO B;  3S1R B;  4BY1 G;  1Y1W H;  4A3G H;  5E1F A;  2A6H C;  2KJX A;  3LWU A;  4QF4 A;  3I55 A;  2N78 A;  3PIP 3;  1E1T A;  4BY7 H;  1S5C D;  3ULL A;  1P8L A;  1RDP D;  2X6L A;  2WAQ E;  4KKT A;  4TKO B;  3HOX G;  3BDC A;  2XWJ B;  3J7Y W;  4A3L H;  3RLF A;  3H0G B;  4B9X A;  2E2I B;  3DEP A;  1AZP A;  4IPD A;  2MGS A;  4PMC A;  1JOR A;  3RNU A;  1FJG L;  3HOU G;  3BJU A;  1I94 L;  2IX1 A;  1JR0 D;  4RGM A;  1M4V A;  5IGE A;  4H7B A;  1X3E A;  2D0P A;  4LF7 Q;  3HOW B;  1FNU A;  4R4I A;  3KFU A;  1UE6 A;  1VQE A;  1I3Q H;  1XMO L;  3GTQ B;  4A3J B;  3MVV A;  2Z4H A;  3A55 A;  4P2C B;  1MGS A;  5JAV A;  3BDL A;  4APV A;  5IYD G;  3CHB D;  5KND A;  3J7A F;  4CKE A;  3TDQ A;  4CDC C;  1H9K A;  1TWF H;  2DGY A;  1D5M C;  2EPB A;  5HY6 A;  1BO0 A;  1W2B A;  2O4X A;  2B2Y A;  4YWM A;  1KD1 C;  1A8V A;  4OEM B;  3I70 A;  1PFS A;  4OL7 A;  3Q22 A;  1HNX Q;  2K05 A;  4BWG B;  4LWC A;  1E2Z A;  3J7Z C;  2VZA A;  2PNH A;  4C2M H;  1JT8 A;  1SE8 A;  4JYA Q;  5KYL A;  1SYG A;  4XT1 B;  1TWF B;  4QIW B;  1STH A;  4KY6 A;  1VMP A;  3E0E A;  3F2U A;  2JA5 B;  2K1B A;  3I4L A;  2NVY B;  2KOL A;  1STY A;  3TQY A;  5FO9 B;  4WJ3 M;  2ENB A;  2OF1 A;  1PRT B;  3KYH C;  4NB3 A;  1KDA A;  5GAD C;  2EYH A;  1XPR A;  2NB0 A;  4RWS C;  5ELO A;  1KLU D;  2BOS A;  3OOC A;  4NDX A;  1ICF B;  1GUO A;  2R92 H;  1JC7 A;  1A2U A;  3ONA B;  3HZX A;  2JA9 A;  2N3S A;  5C6A A;  3K0Y A;  1BUV T;  1SND A;  3KF8 A;  4X3K A;  1KL9 A;  1K3R A;  2H4O A;  4H02 A;  4DN4 M;  4DKA C;  3I4M G;  4LUZ A;  2WB1 B;  3BDO A;  1YIT A;  4A3L G;  1VQD A;  4DR3 L;  3LX0 A;  5DEH A;  3S1N H;  3F2C A;  4DV6 Q;  1PH3 A;  4DR2 L;  1SE2 A;  4TSS A;  4JOI A;  1GUG A;  2RVL A;  1D6E C;  1XXG A;  5T1I A;  1EY6 A;  1SDF A;  1AH9 A;  1YZ6 A;  1PH5 A;  4LW1 A;  1PH7 A;  2BDN A;  4IOA A;  1EWI A;  1WTW A;  4DUY Q;  5DNF A;  1B3A A;  3UDF A;  2EIF A;  5I6W A;  5J3B A;  2AWN A;  4DXF A;  3MXG A;  4OO1 I;  2F1M A;  1RJT A;  1K3B C;  4POG A;  2IT1 A;  1CTM A;  4R4Q A;  1A3U A;  1PHJ A;  1LO5 D;  2JA5 G;  2ZM6 Q;  4CKC A;  5GAH C;  4GKJ Q;  1A62 A;  3SEB A;  2QF7 A;  4A3F B;  1TS3 A;  5J39 A;  2WAQ G;  1OO9 B;  2WB1 G;  4KY5 A;  4DR7 L;  2NVT H;  4IOC A;  4GKK Q;  5I2X A;  3NXW A;  3NWS A;  3BZK A;  4Y7N B;  5CV5 A;  3OIP A;  1WCM G;  2O5J C;  1JJG A;  3QOJ A;  4KJO A;  1EY4 A;  5IP7 G;  5G3L F;  2OTJ A;  1CK1 A;  1W6K A;  2RQX A;  3G4S A;  1LTR D;  3KLS A;  3CME A;  1TU2 B;  3MEF A;  1ET6 A;  1WTH A;  2K5Q A;  4A3F H;  2HHH L;  1CSQ A;  2QA4 A;  3HOU H;  1OXV A;  3EJI A;  1ROD A;  2EJG C;  2X6G A;  4YCV A;  4HMJ A;  2O5I C;  3I2Z A;  4X66 Q;  2VB3 X;  1YNJ C;  2L15 A;  2F0S A;  1WTX A;  1DCZ A;  2HIX A;  1Q7Y C;  1TKW B;  4FYD A;  3KF8 B;  2K50 A;  2F03 A;  2SDF A;  3FHW A;  2EJF C;  1I94 Q;  1ENF A;  2EYL A;  5KEE A;  4LUV A;  4IUU A;  4ME3 A;  1N36 L;  3LGJ A;  5IOD A;  1Q82 C;  1D1I A;  3GTJ B;  3HKZ G;  1I5F A;  1NTG A;  3ICE A;  3FKI H;  5M5X H;  1R4Q B;  1N32 L;  3R3O A;  1S40 A;  1WI5 A;  4H13 C;  3K57 A;  3F8T A;  4DR7 Q;  4X6A H;  5M5Y H;  1B4O A;  2MP1 A;  1H95 A;  3SGI A;  3S2H B;  1YBY A;  5C4X H;  1V9P A;  4R4C A;  4UP7 A;  1VF5 C;  3OMG A;  3FKI B;  2CH4 W;  3CCR A;  3A0J A;  2F0F A;  3NBI A;  3DEO A;  1V1O A;  3NEL A;  5GAG C;  3GTM B;  1K8G A;  4IUP A;  4Y52 H;  1S5F D;  2K28 A;  1CQF A;  2VNU D;  1E0B A;  2YU9 B;  2PI2 A;  4PV1 C;  4X3T A;  3PUW A;  4DAY B;  4PNY A;  3S9W A;  1U4R A;  4QMG A;  2K7V A;  1FJG Q;  3CAM A;  3PO2 B;  3C3L A;  2ID0 A;  3P20 A;  3VR5 A;  1STA A;  5FLX L;  4DV3 Q;  3E5S A;  5M5W H;  4TRD A;  1PLF A;  4RHS A;  1SNQ A;  1SE3 A;  1CHP D;  3GQB A;  5KRU A;  4IFD J;  3ER0 A;  1LYL A;  4WFN 3;  3D4R A;  2WIN B;  3PUV A;  3FPU B;  4MHE A;  1EY5 A;  1SYC A;  4EX5 A;  4K0K Q;  3PSI A;  3WOF A;  3J81 i;  5M5W B;  3A74 A;  1L1O A;  1VS0 A;  3TRZ A;  1EY8 A;  3P75 A;  3MXN B;  4XIG S;  1DGS A;  2PZW A;  3VYS A;  3KJP A;  5IGD A;  4NW2 A;  1QCB D;  2JYO A;  3IAY A;  2B63 G;  1HTP A;  1SNM A;  1BVS A;  3Q8D A;  1YVC A;  2HIV A;  1S4Z A;  4DV0 L;  4L8J A;  1HZA A;  2ZT9 C;  2G5D A;  2PYK A;  4C3H G;  1IW7 C;  3KLR A;  4TVA B;  3GTO H;  2F0D A;  3F2B A;  3J80 c;  2QEX A;  4DNI A;  1O7I A;  1D1K A;  3DM3 A;  4P74 A;  3KLW A;  3WOE A;  4AYB G;  4IJL A;  2L4N A;  3BYY B;  2DNE A;  2A6H D;  1B50 A;  3NP8 A;  1MJE A;  3AB9 A;  2FJ2 A;  4NXN Q;  4RHR A;  2JP1 A;  3DWA A;  2AQ3 B;  3HOY G;  4XYQ A;  2NVQ H;  2O2L D;  3AFP A;  1DOK A;  2B2U C;  2N8N A;  1LTB D;  4RKL A;  3UI2 A;  1TWG H;  4HR7 B;  1RTN A;  2DJF C;  4YIJ A;  4GLV B;  2UXD L;  1E2W A;  3NHH A;  4PMW A;  1VQK A;  1F2Z A;  2HQE A;  4BA2 I;  2J7Z A;  1AN8 A;  4GLA C;  3QWN A;  3G6J B;  4H44 C;  4GKK L;  2IWH A;  3JC6 6;  1EU4 A;  5FLX c;  5D65 A;  4KV6 A;  4DAY A;  2Z1C A;  3O13 A;  3DLL A;  3HP3 A;  2F3V A;  2CKZ B;  4UP9 A;  3NTK A;  4A76 A;  1R9T B;  5T1G A;  1PTO D;  1EFW A;  1GO3 E;  1HNW Q;  3PQI A;  5CV4 A;  5BN4 A;  2KVM A;  4OIK A;  5M9O A;  1PTO C;  1D5X C;  3FP9 A;  2E2I H;  2MO1 A;  1PH8 A;  2R93 B;  3QR8 A;  4UY8 C;  1ML0 D;  1G2S A;  3J80 E;  3CKI B;  1BCP C;  1SMX A;  5C4X G;  4GOP C;  2MUY A;  1AFP A;  1L1O B;  1PH1 A;  2FHT A;  2OT2 A;  3EQL C;  2B63 H;  3M4Q A;  4LF8 Q;  1YI2 A;  4I65 A;  1G6Z A;  2IX3 A;  3ZJY C;  4A3M B;  1XYI A;  3GTK B;  2E2D C;  1WVL A;  4AQY L;  1I3Q B;  3CCS A;  3S1M H;  1XMO Q;  4NP5 A;  3GTQ H;  4BBS G;  4A3J H;  1U4M A;  4JK1 C;  4KHZ A;  1C8C A;  5KNC A;  5K5P A;  2Z6K C;  1KDB A;  1UEA B;  3MC0 B;  1FNV A;  4DR2 Q;  4LK1 C;  1CA5 A;  4KHP Q;  4G7O C;  3M7N A;  3IKJ A;  5I9O A;  5ELC A;  4A3M H;  4MTN A;  1ASY A;  5COY A;  4A3I G;  3K5M A;  1N32 Q;  1IBM Q;  4DV4 L;  3I56 A;  2K5H A;  3IL8 A;  3FRP B;  2JN4 A;  3EFX D;  3J81 j;  4C2M B;  1AE3 A;  1PYS B;  1WJJ A;  4U68 A;  1N36 Q;  1EQV A;  1VQL A;  3SK6 A;  1SNP A;  4KHP L;  3HOV H;  1AE2 A;  5IGG A;  1N8R C;  2KCC A;  2PQE A;  5EQ0 A;  2QDB A;  5JPN C;  4XYO A;  2PZT A;  4OO1 G;  4O42 A;  1C0A A;  1MIU A;  3VYT A;  2LFN A;  4IO9 A;  4OGQ C;  4ME5 A;  1AW7 A;  2NN6 I;  2K4K A;  1KAA A;  2EXD A;  4O0A A;  1FNW A;  2KEC A;  3M4O B;  3HOV B;  3TZD A;  1Q3L A;  5JJZ A;  1F2L A;  1MKH A;  4V0B A;  2XWB B;  4BY1 B;  1YNN C;  5I9P A;  4L5T A;  1SYD A;  3D4W A;  3MXU A;  1EYC A;  1EZ8 A;  4LAA A;  1EIG A;  4LFB L;  3D31 A;  1AZQ A;  2A74 C;  5TSS A;  2XVS A;  3OWF A;  3H3V C;  4GOP B;  5EPL A;  3A56 A;  2QDL A;  1QOH A;  1Q86 C;  3HEJ A;  1SJE D;  4G4K A;  4AQY Q;  1BQQ T;  4HSP A;  3KK7 A;  4QCL A;  4Q0F A;  4RGO S;  2IJ0 A;  2R6G A;  4DV1 L;  5C3E H;  4DR1 L;  3U9O A;  4JI2 L;  1IYV A;  2C5C A;  1O7Y A;  3NSW A;  2LXK A;  4DV0 Q;  1MI2 A;  3FVQ A;  2PQA A;  4QY7 A;  1EU3 A;  4DR6 Q;  4A3J G;  1ZEQ X;  3T56 B;  2NVX H;  5IE8 A;  1G2T A;  1EOV A;  2VQF L;  2TSS A;  3W1B A;  3SXH A;  4JI1 Q;  5ELB A;  3L7Z C;  3MXN A;  3EIV A;  3VR3 A;  2J4X A;  4IPG A;  3CXC A;  4DR1 Q;  3RZD B;  5ELD A;  4B3R Q;  3S14 B;  3A8I E;  1EIY B;  5M3F B;  3CCU A;  2JA6 G;  1B7Y B;  1F9S A;  4ZRZ A;  3J7A V;  3CW2 C;  4DK1 A;  4ODG A;  2CQA A;  1KDC A;  2WP8 J;  3KDF B;  2C35 B;  2K5N A;  5C44 B;  1Y8P B;  5FLM G;  4ZUI A;  2F0M A;  3U58 A;  1EFI D;  1YHB A;  5CGK A;  3S1Q H;  4DPG A;  5D14 A;  1CUK A;  3OIQ A;  3PMF A;  3TBI B;  1FVI A;  2A6E C;  4A3C G;  4Y7N H;  3PF4 A;  1XPO A;  4LF5 L;  4XQQ A;  2KA7 A;  2BA0 A;  3OYY A;  4F88 A;  2A1A A;  4A3D H;  1QNK A;  2RSO A;  3A8J E;  3UE1 A;  1D2B A;  1LTG D;  1YNJ D;  5F2D A;  1LUZ A;  4OX9 Q;  1LT4 D;  2ASB A;  1ZXT A;  5C0X I;  1WCM B;  1VQN A;  2F0T A;  2D5D A;  5C0X G;  1KLG D;  3T1H Q;  2EVB A;  2B2T C;  4DU9 A;  3KBG A;  1B2T A;  2KHJ A;  4BBS H;  1QB5 D;  2I5H A;  1DOM A;  1HFN A;  2PZU A;  4KN4 C;  5FLX E;  1T5X D;  1QWY A;  2B8F A;  2JA8 H;  3CCM A;  2RCN A;  4RH6 A;  4GOP A;  4GNX A;  2PW7 A;  3RN5 A;  2ZTE A;  1PA6 A;  1B8A A;  2F3W A;  3T4A C;  3D8G A;  4A3I H;  2B39 A;  3K7U C;  4S3S A;  3NTI A;  1SRU A;  5IP7 H;  3K80 C;  4RCO A;  3OTO Q;  4KMU C;  5M5Y B;  2PPB C;  1VQG A;  5LMN W;  4MIU A;  5JPM C;  4X64 L;  2Z6K A;  4KTA A;  4DFA A;  2EZV A;  1HA5 A;  1I4G A;  4A93 H;  1J6Q A;  4WJW A;  3SK5 A;  3MWY W;  1U9R A;  4YY3 Q;  1HTL D;  4X65 L;  1CHQ D;  3I3C A;  5IGB A;  1KTK A;  1FD7 D;  1PTO H;  3U9S A;  1NMF A;  3U4Z A;  2BA1 A;  1GD7 A;  1D8L A;  1JMC A;  2M2L A;  2EDG A;  3BYT B;  3PO3 G;  4RGT A;  2V4D A;  2E74 C;  2H1E A;  1LTI D;  4QQB X;  2DN8 A;  4X64 Q;  2F0G A;  1S72 A;  3M4P A;  2QW7 A;  1HH2 P;  4R9W A;  5IT9 L;  3T51 B;  1RIP A;  4BY7 B;  2E2J H;  2HD3 A;  1WTP A;  2MJ8 A;  1Q8K A;  3H0G H;  1HR0 Q;  2UXD Q;  5EJW A;  3HOW G;  3KLS X;  1U0L A;  1PMR A;  1JOQ A;  1A0I A;  1PFN A;  3HOY B;  2F52 A;  1Q12 A;  5LL6 S;  1KC8 C;  1MSH A;  2EJM A;  2XRQ D;  5IIF A;  4PQX A;  1GVP A;  2WKC A;  2MFI A;  3L3O C;  3QIA A;  3PGZ A;  3FPP A;  4DAV A;  5IP9 G;  2E2J B;  3ERS X;  4HJ5 A;  5COR A;  1S5D D;  1H9R A;  3X3N A;  3PIO A;  5FJ8 H;  3CF5 A;  3BVG A;  2A68 C;  4UHV A;  3W1G A;  1Y1V G;  3JAM c;  1SYE A;  1EWC A;  5ISR A;  1DM0 B;  2AKW B;  1EYD A;  4HJ7 A;  4NMZ A;  4UDU C;  3H15 A;  2OQK A;  4L5S A;  2B2Y C;  2GVA A;  4JI3 L;  2B3G A;  2CWP A;  2UU9 L;  4RGN A;  1K8A C;  2JEA I;  1TS5 A;  2MHV A;  3NUC A;  5IOC A;  1O78 A;  4J6H A;  3STB D;  2XSC A;  3TS2 A;  1WTV A;  3BZC A;  1P16 A;  2XIW A;  5J22 A;  1PTO F;  1MHW C;  4I7Z C;  1KQS A;  1QIL A;  3GV6 A;  2YTV A;  3CU7 A;  4HIO A;  1G8Z D;  1UE7 A;  4R4T A;  5GRO A;  4LF6 Q;  5FLM H;  3TRE A;  4MN3 A;  1EYG A;  4JI0 Q;  3TP7 A;  2B2V A;  4A3D G;  1VQH A;  1IBK L;  2JE6 I;  3HG9 A;  2A5H A;  1UE5 A;  3GTG B;  4P73 A;  1TR5 A;  2Q8R E;  5AJ3 L;  3T1Y Q;  1DZ1 A;  3N6R A;  1PDQ A;  2R93 G;  5ELF A;  2B8G A;  1U4P A;  1MD2 D;  2PQA B;  2AUJ D;  5IYD H;  4LMQ D;  1X9N A;  3EA6 A;  3FEW X;  4K2K A;  1JB7 A;  5C5L A;  3RN2 A;  3BVZ A;  4F8M A;  4LF6 L;  1E3P A;  3JAM i;  3D4D A;  3K5O A;  1K9M C;  5JJK A;  4PG3 A;  4GLX A;  4CJ1 B;  3GTL H;  2H5X A;  3HOW H;  3K0X A;  3K59 A;  4CJ0 B;  1IL2 A;  2KCM A;  4PZ7 A;  4FF3 A;  4JI7 Q;  3NEM A;  2QKI C;  4F87 A;  4FDB A;  2HCC A;  2F0E A;  4POF A;  3F1Z A;  1VQ5 A;  1N34 L;  4NXM L;  1QNU A;  1PRT C;  3HKZ B;  2Y0S G;  2ZJQ A;  2RDH A;  1A63 A;  3L2P A;  2OTL A;  1KNE A;  2FIN B;  2YV5 A;  3PUZ A;  1ILQ A;  5L37 A;  1WTQ A;  4JI0 L;  5LHY 1;  5CV9 A;  4CKB A;  2B63 B;  1Y69 U;  3VDY A;  4DV7 L;  1NY4 A;  4A3G G;  1PH9 A;  4E6I A;  3RMH A;  4OWX B;  4X66 L;  1SRO A;  3HOZ H;  1H9S B;  1K83 B;  4AYB B;  4OEL B;  3G71 A;  4KI0 A;  3GTP B;  4WRD A;  3I73 A;  3H6M A;  1SNO A;  2V1C C;  2Z0S A;  3OTO L;  2E76 C;  5E4W C;  1ASZ A;  4KD4 A;  3W2D A;  1CQV A;  4A3E H;  1TS2 A;  4N9T A;  2AUK A;  5K36 G;  5J1Z A;  5JEA J;  2R92 B;  5C44 G;  3HOZ B;  3HOV G;  1K83 H;  1PH4 A;  2KED A;  5A2Q L;  3D6W A;  3RR5 A;  1OXT A;  3IFD A;  4ILW A;  2JJQ A;  2Z8L A;  1W6J A;  4A3F G;  1BBX C;  3T1H L;  5IP9 H;  1YHQ A;  3K6O A;  3SR1 A;  2G9D A;  3HOU B;  2MNA A;  2BDO A;  3NEN A;  5LMU L;  3GV3 A;  1C48 A;  1G51 A;  2HT1 A;  1W3S A;  1Y1V H;  4L5Q A;  1BNZ A;  1TWC B;  1SLJ A;  5FO8 B;  4C3J B;  2HCI A;  4DR3 Q;  1ZYR C;  2HDL A;  2N49 A;  2NUC A;  4JI8 L;  3SE0 A;  3K5L A;  1TWH H;  2Z4I A;  4YWK A;  1ILP A;  4HIK A;  1UAP A;  1HZB A;  2BE5 D;  1XNQ Q;  1OXU A;  1B44 D;  4IPH A;  5EAY A;  2GN5 A;  1D7Q A;  3K8A A;  1OXS C;  1QUQ B;  4L6T B;  3NK9 A;  4C3J H;  4CJ2 C;  5M5X B;  1X3P A;  3OW2 A;  3STB C;  3NPP A;  3AEV A;  2R7Z B;  2UUB Q;  4DNT B;  2EYP A;  4PMB A;  3S2H H;  1RD9 D;  1PV4 A;  5IYB G;  4LF8 L;  1VQJ A;  3MAQ A;  2JA7 B;  4DK6 C;  5C4Z A;  2HUG A;  4CBV A;  1PH2 A;  1OXX K;  4L63 B;  1VQ7 A;  5DLQ E;  1HNZ L;  4OO1 H;  2UXB Q;  4KHV A;  3TP8 A;  1HZ9 A;  4ZYS A;  3VA7 A;  4R8I A;  3T53 B;  1WTR A;  1SJH D;  1NMG A;  2UUB L;  1Q8I A;  4A4I A;  2K14 A;  1SFO H;  4OWW B;  3GTM H;  2NVT B;  4DXG A;  3HFZ B;  2RDF A;  4BS9 A;  1A2T A;  1JQY D;  2ZXO A;  5H1S E;  4DV5 L;  1YJW A;  4KY7 A;  1PRT F;  2VUM G;  4A3B H;  2JA7 H;  2KBN A;  1X6O A;  5FKA C;  1JJC B;  1Q1E A;  1STG A;  2JA6 H;  1BBW A;  5BR8 L;  1I4R A;  1VMC A;  2XGT A;  2I5L X;  3A54 A;  2CH4 A;  4JCV E;  2F0W A;  2A69 D;  3URY A;  4DV2 L;  4RAU C;  3RLN A;  1RTO A;  1SFO B;  1DJR D;  5LMU Q;  2ZJR A;  5IGC A;  1DD2 A;  2UXB L;  5C44 H;  4A3B B;  3Q24 A;  3LWE A;  2WAQ B;  4DV3 L;  4LF7 L;  3OHX C;  3NE5 B;  1B9N A;  2K04 A;  1UUP A;  2K5D A;  1RL2 A;  3W3A A;  4TQU S;  3MEH A;  3QJY A;  1NCV A;  2B2W C;  2R7D A;  2ATW A;  2I07 B;  4BBR B;  2E5L L;  3A5U A;  4YCW A;  1OTC A;  2R3Z A;  1L1O C;  2SOB A;  2KCT A;  2N55 A;  1M8A A;  2SNM A;  4QIW E;  5EGT A;  3K58 A;  5IT9 E;  1GHK A;  1UNS A;  4BXX G;  3NBH A;  3SHL A;  1LT6 D;  2CW0 C;  4L5R C;  1HNX L;  5EKI A;  2EY1 A;  1I4H A;  4QJF A;  4DGZ A;  4IPC A;  1S5B D;  2E2H B;  1XTC D;  2JA5 H;  2YYZ A;  1EYA A;  4BBR H;  5FOB B;  1QE6 A;  2E8G A;  4A3K G;  1NUC A;  1GUN A;  4HMI A;  5FK9 C;  4NXN L;  3AU7 A;  5LMN L;  3NWT A;  2BE5 C;  2E75 C;  5C4X B;  4HN7 A;  1YIJ A;  5BR8 Q;  3DXJ C;  3PO3 B;  1B3Q A;  3BVM A;  4U67 3;  4ABN A;  3P7J A;  2RA4 A;  5IYB H;  1A3V A;  5AJ3 Q;  2B2U A;  3T1Y L;  1QZH A;  1N34 Q;  4NXM Q;  1LV9 A;  3S2D H;  1II3 A;  4R4O A;  1PFB A;  2EY5 A;  4X3S A;  3FDT A;  4JOI C;  4A3C H;  1ESF A;  4B3M Q;  2K6A A;  3J81 L;  4R8N A;  3SVM A;  4RMF A;  1HR0 W;  1HUM A;  4LF9 Q;  5I4D A;  1VF7 A;  3VA5 A;  4KKU A;  4XQJ A;  3PO2 H;  1E22 A;  4A93 B;  3U50 C;  4X3U A;  4CHT B;  2JA7 G;  4K0K L;  3TP6 A;  1RF2 D;  3CMA A;  2A19 A;  2KEE A;  3UDG A;  1VCI A;  1CKN A;  2VL6 A;  2L11 A;  1TVX A;  5C0X H;  4XXE A;  4PZ8 A;  4B3R L;  1L0Y B;  1I50 H;  1PRT D;  1PZK D;  4DR4 Q;  3BU2 A;  1R9T H;  2EYM A;  5EBD A;  1E2V A;  1Z9F A;  1ESR A;  2VW9 A;  1J9O A;  1IKL A;  2VS1 A;  1CSP A;  2AWO A;  2PW5 A;  1ENA A;  3OMC A;  1GUT A;  2C9O A;  2RKS A;  1WTO A;  1WFQ A;  2D0O A;  1EEF D;  1PZJ D;  4K5X A;  3HOY H;  4FVM A;  4JV5 Q;  3TZU A;  3TN2 A;  2AQ2 B;  4H0L C;  2JSO A;  1VQB A;  1IHZ A;  3GTO B;  5IWA L;  5GQO A;  1EUJ A;  2F0N A;  4A93 G;  2LSS A;  1E24 A;  1STB A;  3GTK H;  1VQM A;  1MSG A;  2UXC L;  2EYO A;  4LFC L;  1GUS A;  3I4M B;  4KJN A;  2BH2 A;  5D3D A;  4AIM A;  4YWL A;  1LTA D;  2JXM B;  4DV4 Q;  1Y8O B;  4XQN A;  2LKV A;  1DYQ A;  4QUC A;  3K7A B;  3GD7 A;  3MFY A;  3M9B A;  1HQM C;  2K52 A;  3I90 A;  2PMZ B;  3EN2 A;  3I4M H;  3G6E A;  1O7L A;  4FF4 A;  1IKM A;  5JEA G;  1IBK Q;  1UE1 A;  3CCV A;  1LTT D;  3JAM E;  2DJG C;  4DR5 L;  1NJI C;  1G6P A;  3KF6 B;  1PZI D;  5CV7 A;  4RG1 A;  1BCP B;  1I4Q A;  3OWE B;  2J0T D;  3PUX A;  5C3X A;  3C1E A;  3C2P A;  1BCP F;  3MHB A;  2I0Q A;  1BR9 A;  5NUC A;  1STN A;  4HJ9 A;  1YJ9 A;  5IYC G;  3J80 i;  5CV8 A;  1I6H B;  5CR3 A;  5FJ8 G;  2X69 A;  1VQF A;  2K03 A;  3CQZ H;  4FXD A;  1VQ9 A;  3ERQ A;  3ND9 A;  4C3H H;  1DOL A;  1B70 B;  2K75 A;  4DAM A;  4RKB A;  5HGQ A;  1KNA A;  3TEH B;  2B29 A;  4A3K H;  2OCE A;  1S5E D;  5D3I B;  1PYB A;  1IBL L;  4Q5V A;  4XTC S;  1TS4 A;  4ZAI A;  3DWQ A;  2NTS A;  2QEJ C;  4HTH A;  5A2Q E;  3A5Z B;  3S1R H;  1Y1W G;  1Y1W B;  2E5L Q;  4BY1 H;  4JI7 L;  3VYU A;  1G29 1;  1K8M A;  1C4Q A;  2YTY A;  1RHP A;  4P72 A;  3CQZ B;  4C56 C;  1WYD A;  4DR5 Q;  4QL5 A;  2ALY B;  1GOZ A;  4IQZ A;  4K6L A;  4LFB Q;  3CCQ A;  4XDX A;  3CCL A;  2WB1 E;  4KLK A;  2BCO A;  3V05 A;  4DV2 Q;  1CM9 A;  1D5Z C;  3T13 A;  3CCJ A;  3AYH B;  4OHJ A;  4IFD H;  5C3E G;  3KBX A;  2D62 A;  4CDD C;  2PMZ E;  1JB3 A;  2LY7 A;  2VQE L;  1CT1 D;  2AHO B;  2DUD A;  3G7L A;  1JE5 A;  5CV6 A;  1VQO A;  2YTX A;  4IUN A;  4HSV A;  3S1N B;  4OWT B;  3PCO B;  2DY8 A;  1F9R A;  4J8Q A;  2F0U A;  2IX0 A;  4RCN A;  3PO2 G;  2R61 A;  3UE0 A;  1CKM A;  5LL6 X;  4NKL A;  3A8K E;  1JWS D;  3W5O A;  5LMN Q;  3AMU A;  2M00 A;  4UAI A;  1EQT A;  5M3F H;  3ULP A;  1K8O A;  5IGF A;  3M3Y B;  3E9I A;  4DF7 A;  1HFG A;  2TMP A;  3R93 A;  4RFB A;  3GTP H;  3DHQ A;  1VQ6 A;  4B3M L;  1GJX A;  5K36 H;  1U4L A;  3VR6 A;  2IW3 A;  3PV0 A;  3CRL C;  4UPA A;  3CC7 A;  1TWA H;  3M4O H;  1NAP A;  3KUP A;  5C0X J;  3V96 A;  3KOJ A;  2F0P A;  2NVY H;  4X62 Q;  2EQS A;  2NBF A;  1RKN A;  1F2Y A;  1I4X A;  5BN5 A;  1VQ4 A;  3G48 A;  2CQO A;  2GVB A;  1NSN S;  4V19 0;  2K5V A;  4IUR A;  1FR3 A;  3R2I A;  3M4Y A;  3MA2 B;  3IFT A;  4JBK A;  2KQ3 A;  2RF4 A;  4M8A A;  1ICW A;  1TWA B;  5G3L D;  4FXK C;  3H91 A;  4X65 Q;  4IN3 A;  5JOB A;  2K32 A;  4A3M G;  3I4N H;  1K28 A;  3L9A X;  1VQI A;  3H09 A;  3DUZ A;  1V43 A;  4JI2 Q;  1JCK B;  5M3M G;  3PIO 3;  1H9S A;  4C3J G;  2RSN A;  1QG7 A;  1SE4 A;  1VDZ A;  5JEA H;  4LF4 L;  4ZQ3 A;  5BN3 A;  2MQH A;  3AFQ A;  4B3T Q;  4DV6 L;  1Y8N B;  2R7Z H;  1XPU A;  3CC4 A;  4B08 A;  1T5E A;  4C1N K;  2AMC B;  4C3I G;  1PYW D;  1O7Z A;  2ZTC A;  3S14 H;  1EY9 A;  1BXT A;  3MTS A;  3GP7 A;  3GTJ H;  1VQP A;  1EQR A;  2L12 A;  1HA6 A;  3E9H A;  4JI6 L;  3KJO A;  4EGV A;  1XMQ Q;  3E6Z X;  2OWO A;  5EKK A;  4CDE C;  1HNW L;  3K81 C;  2ES2 A;  1XJV A;  1BBU A;  4LNQ A;  1Q90 A;  3IRB A;  4KN7 C;  2ZTD A;  4P71 A;  1BDO A;  4EQO A;  4DUY L;  2Q2U A;  4LF5 Q;  2CW0 D;  3TP5 A;  4IJH A;  1XMQ L;  2I5M X;  4A3D B;  3FKI G;  1CZW A;  2Z9H A;  1HZC A;  1T9H A;  1NE3 A;  1YJN A;  2K5W A;  1MBY A;  2JA8 G;  1UWV A;  2L1B A;  4ZKB B;  1XWE A;  3Q23 A;  3OW7 A;  1QUQ A;  1IL8 A;  3UDI A;  2KUM A;  1WCM H;  4JG2 A;  4LFA L;  1IBM L;  1XX8 A;  3X3M A;  1KRT A;  2WFW A;  1B1Z A;  2L55 A;  1QVC A;  2SNS A;  4ZUJ A;  4JI3 Q;  5JJL A;  1JWM D;  2A73 B;  1YHA A;  4MZ9 A;  1H9M A;  1SEB D;  2KEN A;  3I72 A;  3KF6 A;  5HGT A;  2A69 C;  2JA8 B;  3S17 H;  3AQQ A;  4EQP A;  1V1P B;  3HRZ C;  4NPS A;  2PI2 E;  1B53 A;  2VUM H;  4JI8 Q;  1L0W A;  4JVZ A;  1GKH A;  2BH8 A;  5EBC A;  4OIJ A;  3VR2 A;  2EY6 A;  1TY2 A;  1YNN D;  2RHS B;  2EYJ A;  2JQO A;  3CD6 A;  2ZJP A;  4UP8 A;  1X56 A;  4G57 A;  1G91 A;  3CP0 A;  3HOX H;  1WD1 A;  4ZLT F;  2VUM B;  1PTO B;  1Q46 A;  1HCZ A;  3H0G G;  4A75 A;  2HHH Q;  3D3R A;  3A7L A;  2OXP A;  4DK3 C;  3F2D A;  4ID6 A;  3J7A 5;  2PCF B;  3WWV A;  5CC4 A;  2UUA Q;  3GTG H;  4FXG C;  1AEX A;  5C4J H;  4GNX B;  2WKD A;  2VXW A;  1JIC A;  4WOR A;  5ELN A;  4IUT A;  3J81 E;  1Z7T A;  2K01 A;  1LT5 D;  4IUV A;  1F77 A;  4DUZ Q;  3NBH B;  3J80 L;  1SXT A;  1CKO A;  3M7G A;  2NYZ D;  5M3M B;  2NZH A;  4A3G B;  3NQI A;  4BBR G;  3NTH A;  3U4V A;  4JI4 Q;  2XRS D;  3GDE A;  1Q1B A;  3I7F A;  1I50 B;  3D0F A;  3GTL B;  4JYA L;  2ICE C;  4FO2 A;  5HUR A;  1HR0 L;  4WJ4 A;  2Y0S B;  1X3F A;  2IPK D;  3PF5 A;  2EXZ A;  4JBW A;  1LTL A;  4K8I A;  5CBE E;  5M3M H;  2UUA L;  4M1U B;  1JOO A;  1GXD C;  1Q81 C;  5KIX A;  4K5W A;  2F0V A;  1K0S A;  2NZO A;  2Q2T A;  1VQA A;  2A68 D;  3CPF A;  3S15 H;  5C5M A;  1PH6 A;  1EQQ A;  4K8J A;  1ZYR D;  4OON A;  1EY7 A;  4DUZ L;  1IBL Q;  3A7A B;  4OXP A;  1H9J A;  1EIF A;  2MO0 A;  2K33 A;  2R92 G;  4OX9 L;  2F0I A;  1V1P A;  1C9O A;  4DV7 Q;  1IZ6 A;  2HDM A;  4N8F A;  1EY0 A;  4DAP A;  5A35 A;  4GN4 B;  4LF4 Q;  2R93 H;  3N52 A;  1NR2 A;  3ITP A;  3MFG A;  1ET9 A;  3S15 B;  3S16 H;  2KCN A;  1LM0 A;  3VYR A;  1XNR Q;  3LNN A;  2HQL A;  1CKN B;  2Q8I B;  1PFM A;  1R4P B;  4JBJ A;  4K5V A;  3K7A H;  4HCE A;  4JW0 A;  1SBB B;  3VR4 A;  4CDF C;  4R1J A;  4HIM A;  4A3E B;  5EPJ A;  1DXM A;  5CYU A;  5DM7 3;  1MJC A;  4JI6 Q;  4GNX C;  1XNQ L;  5I2Y A;  3E0J A;  1F9Q A;  3C1F A;  5FO7 B;  1PXU A;  1VQC A;  1JWU D;  3S16 B;  2F4I A;  2NVQ B;  3S24 A;  4FP5 D;  4CGY B;  4GS3 A;  4YCU A;  1EWH A;  3JAM L;  2RCF A;  1TWG B;  2FXQ A;  5IYC H;  1DON A;  3DWP A;  4B3T L;  1L2F A;  2Q2H A;  1Y14 B;  1EL0 A;  4ZKC B;  3M85 A;  2L9H A;  4MNO A;  4EQ5 A;  1LAC A;  1HXY D;  1A15 A;  4QGU A;  1V8Q A;  2FFK B;  1IXR A;  2IL8 A;  3MZ5 A;  4AH6 A;  4C3H B;  4LFC Q;  3BZD B;  2DNC A;  1HHV A;  3PUY A;  2NN6 H;  4DR4 L;  1QVF A;  4A3K B;  4GKJ L;  1F2M A;  4XT3 B;  2EYF A;  4DV5 Q;  1KXL A;  2RBM A;  3HOZ G;  3UDX A;  3I91 A;  3QOL A;  2UUC L;  4JV5 L;  1U5K A;  4DNR B;  1CA6 A;  2KHS A;  2RDG A;  1JOK A;  1O80 A;  4HAE A;  3HS0 C;  1KHI A;  4IFD G;  2ZXP A;  5KNB A;  4HJA A;  4HJ8 A;  3QG1 A;  4B9W A;  3TS0 A;  1N33 L;  4LJZ C;  5E3F A;  1AP0 A;  1TT2 A;  1LT3 D;  3D6C A;  3V2T A;  1FL0 A;  2CHB D;  3CC2 A;  2VQE Q;  2WAC A;  1SYF A;  1CZG A;  4J15 A;  2QGQ A;  4K6D A;  3I8Z A;  1M1K C;  4GZY C;  1LLR D;  1ENC A;  4AYB E;  2CCZ A;  4I7A A;  3KDF A;  3HGB A;  2F0K A;  3S1M B;  2NWG A;  2ICI A;  1J5E L;  5AFW A;  1HUN A;  2Q8T A;  5M3F G;  2JA6 B;  4IFD I;  1PVO A;  1X32 A;  5C3E B;  1KRS A;  2ZM6 L;  1QZG A;  1X3Q A;  4FF2 A;  1EIH A;  3ND8 A;  1J8I A;  5DAU A;  5IY0 A;  1X54 A;  4O2D A;  1YEZ A;  5ELE A;  3M3Y H;  1FGB D;  3BS1 A;  1FYC A;  1B9M A;  2NVX B;  1SAP A;  4X62 L;  1BCP D;  3MXP A;  2CVR A;  1Y1V B;  1TWC H;  2UU9 Q;  1LAB A;  4Z9C B;  2B2W A;  2Y0S E;  3RZD H;  1QVG A;  2DY7 A;  4DK0 A;  1TWH B;  2EOT A;  4JC0 A;  2R7F A;  1SMY D;  2B2V C;  4JI4 L;  2IHF A;  2PNR C;  1EZ6 A;  2JEB I;  4JBM A;  4ZCK A;  4YHH L;  3S1Q B;  4HID A;  2RHQ B;  4JI5 L;  4KK7 A;  4GN3 B;  3SK4 A;  5E4X A;  4O1N A;  3T16 A;  3I4N G;  2D2C C;  1SSO A;  3BG3 A;  3R8B A;  4KD3 A;  4A3B G;  3C46 A;  2P5Z X;  4IAL A;  1I6V C;  3TSS A;  5C3W A;  4B3S Q;  3CPW A;  2QIL A;  3H3V I;  3I4N B;  4A3E G;  2OEO A;  2Z6B A;  2NZ1 D;  3B6Y A;  4YHH Q;  4G7Z C;  2F3I A;  4QB4 A;  3P1H A;  5I6Y A;  3RLO A;  2F0H A;  1FGU A;  1Z6H A;  4HCS A;  2R7Z G;  2CWA A;  1ONL A;  5IT9 c;  1X3G A;  3ERO A;  4RA8 A;  4C3I H;  3S2D B;  4ZK9 B;  2WV6 D;  4FF1 A;  2A8V A;  2LXJ A;  4B3S L;  5JVH 3;  1NR4 A;  2D9U A;  1BF4 A;  2AQ1 B;  2M9V A;  3WDN A;  2XN9 C;  4G7H C;  4BBS B;  4J1M A;  4PZ6 A;  2WII B;  2IY5 B;  1SNC A;  5EKL A;  4EQN A;  1I4P A;  1BOS A;  3PIP A;  3HKS A;  4YY3 L;  4EVO A;  3SDZ A;  1EOT A;  4JI1 L;  2XNA C;  1IW7 D;  1ZKO A;  2FMM A;  4C3I B;  1EEI D;  3RUZ A;  4A3I B;  4ALP A;  1JJ2 A;  2VQF Q;  4BA1 I;  1GUW A;  1X65 A;  2YU9 H;  4N9P A;  2NN6 G;  5KYI A;  3QO2 A;  2MPM A;  4DR6 L;  2PO4 A;  1HRJ A;  1TII D;  3NQT A;  2ZXR A;  1SYB A;  1UEB A;  4IZ8 A;  2F0L A;  1HPC A;  5DM6 3;  1N9W A;  3Q0A A;  3FMC A;  2LS0 1;  2VY3 A;  1TQO A;  3HKZ E;  1E7Z A;  3DM1 A;  1Z47 A;  1C7Y A;  1GHJ A;  3L0O A;  4DV1 Q;  3H94 A;  2JK8 A;  4LUO A;  4BY7 G;  3K5N A;  1IYU A;  5IWA Q;  1M90 C;  2UXC Q;  2KHI A;  1A6X A;  3GO5 A;  3ULJ A;  2F0J A;  1STE A;  3Q6S A;  2CFM A;  4JI5 Q;  1YNX A;  4K14 A;  4MTK A;  1KIX A;  2A6E D;  2L5T A;  3RD4 A;  4HED A;  2LMC B;  2E2H H;  1VQ8 A;  3CRK C;  1BKB A;  2F4V L;  1A3T A;  1JE4 A;  4C1N I;  5CMD A;  2I46 A;  1NBW A;  1XNR L;  3J81 c;  2IHE A;  2UUC Q;  4LF9 L;  5CBA E;  3PO3 H;  1L0X B;  2QCP X;  3SK8 A;  3S17 B;  4N8X 1;  2SEB D;  1CFM A;  4P75 A;  3QB3 A;  5E7N A;  1F9P A;  5JJI A;  2EY2 A;  1N33 Q;  1KAW A;  2G9H D;  4KKS A;  5JVG 3;  2B2T A;  1K73 C;  3I4O A;  3EBE A;  4FNF A;  1X55 A;  3EVQ A;  2F0Q A;  4F7X A;  1IYJ B;  3OSO A;  4ULL A;  3R2T A;  4K2L A;  5KGU A;  1XTD A;  2FMC A;  4DA2 A;  1TXY A;  1WOC A;  1HJP A;  3HOX B;  1HQR D;  5C4H A;  1WD0 A;  1QJO A;  1J5E Q;  2XTI A;  1S3O A;  1SR3 A;  1E1O A;  1K0R A;  2L0C A;  3DMU A;  1NNX A;  4GN5 A;  1RCV D;  1KAB A;  3CCE A;  3ZYY X;  2VB2 X;  1SN8 A;  3RZO H;  4IUQ A;  1HNZ Q;  4BXX H;  2Q2I A;  2OQ0 A;  1V1Q A;  5C4J B;  1I6H H;  3OPO A;  3H3V H;  2F4V Q; 
#chains in the Genus database with same CATH homology
 3OW2 A;  3STB C;  4DR2 Q;  1KRT A;  3AEV A;  2WFW A;  4JI3 Q;  5JJL A;  1QVC A;  2UUB Q;  4KHP Q;  1YHA A;  4MZ9 A;  3M7N A;  2KEN A;  4A3M H;  4MTN A;  3KF6 A;  1GM5 A;  4LFA Q;  4A3I G;  1ASY A;  5GAE C;  3S2H H;  1PV4 A;  1N32 Q;  5IYB G;  1IBM Q;  1VQJ A;  4LF8 L;  4DV4 L;  3I56 A;  4BY1 G;  4DK6 C;  1Y1W H;  2K5H A;  1PH2 A;  3S17 H;  3AQQ A;  4A3G H;  1OXX K;  3J81 j;  3I55 A;  1VQ7 A;  2N78 A;  5DLQ E;  1HNZ L;  1AE3 A;  2UXB Q;  1PYS B;  1E1T A;  1WJJ A;  1N36 Q;  1HZ9 A;  4NPS A;  2PI2 E;  2VUM H;  1VQL A;  4JI8 Q;  4BY7 H;  1L0W A;  3ULL A;  1NMG A;  2UUB L;  4KHP L;  1P8L A;  1AE2 A;  1N8R C;  3HOV H;  2WAQ E;  3HOX G;  1GKH A;  2BH8 A;  2K14 A;  4A4I A;  1SFO H;  4OWW B;  3GTM H;  4OO1 G;  4A3L H;  3RLF A;  3HFZ B;  4DV5 L;  1YJW A;  4A3B H;  5H1S E;  2RHS B;  4IPD A;  2VUM G;  2JQO A;  2JA7 H;  1C0A A;  2KBN A;  1MIU A;  3CD6 A;  2ZJP A;  3RNU A;  4UP8 A;  1X6O A;  1X56 A;  1FJG L;  1JJC B;  1Q1E A;  3HOU G;  3BJU A;  4IO9 A;  3CP0 A;  1I94 L;  3HOX H;  2JA6 H;  2IX1 A;  1BBW A;  5BR8 L;  1X3E A;  2XGT A;  2NN6 I;  2K4K A;  2I5L X;  2D0P A;  2EXD A;  4O0A A;  4JCV E;  4LF7 Q;  1Q46 A;  4DV2 L;  4R4I A;  3H0G G;  4A75 A;  2HHH Q;  3KFU A;  3RLN A;  1UE6 A;  4DK3 C;  1VQE A;  3F2D A;  2ZJR A;  5LMU Q;  1MKH A;  3J7A 5;  1I3Q H;  2UXB L;  5C44 H;  1XMO L;  3WWV A;  2UUA Q;  3GTG H;  4APV A;  5IYD G;  5C4J H;  4DV3 L;  4GNX B;  4LF7 L;  4L5T A;  5ELN A;  1RL2 A;  1TWF H;  2DGY A;  4TQU S;  4LFB L;  3D31 A;  5HY6 A;  1W2B A;  2R7D A;  2ATW A;  2E5L L;  4GOP B;  3A5U A;  4YCW A;  1OTC A;  4YWM A;  1Q86 C;  1KD1 C;  1A8V A;  1L1O C;  1PFS A;  4DUZ Q;  4AQY Q;  1HNX Q;  2KCT A;  3NBH B;  4QIW E;  1CKO A;  4LWC A;  2NZH A;  3J7Z C;  2VZA A;  2PNH A;  4BBR G;  3U4V A;  4JI4 Q;  4BXX G;  4C2M H;  1JT8 A;  2R6G A;  4L5R C;  4DV1 L;  1HNX L;  3GDE A;  5C3E H;  1SE8 A;  4JYA Q;  1Q1B A;  4DR1 L;  4QJF A;  4JI2 L;  3I7F A;  4IPC A;  3E0E A;  3D0F A;  2LXK A;  4DV0 Q;  2JA5 H;  2YYZ A;  4QY7 A;  2PQA A;  4BBR H;  4JYA L;  4DR6 Q;  4A3J G;  4A3K G;  2E8G A;  3TQY A;  4WJ4 A;  1HR0 L;  2NVX H;  1X3F A;  5IE8 A;  3PF5 A;  4NXN L;  1EOV A;  4JBW A;  2VQF L;  4WJ3 M;  1LTL A;  5LMN L;  5M3M H;  3W1B A;  2UUA L;  3KYH C;  4NB3 A;  3H3V H;  4JI1 Q;  1Q81 C;  5GAD C;  3L7Z C;  3EIV A;  1YIJ A;  1XPR A;  5BR8 Q;  4IPG A;  2NZO A;  5ELO A;  3CXC A;  4DR1 Q;  4B3R Q;  2Q2T A;  1VQA A;  1EIY B;  2R92 H;  3CPF A;  3S15 H;  2JA6 G;  3CCU A;  5IYB H;  1PH6 A;  1B7Y B;  1EQQ A;  3CW2 C;  5AJ3 Q;  3T1Y L;  1QZH A;  1N34 Q;  4NXM Q;  4OON A;  2WP8 J;  4DUZ L;  2JA9 A;  4R4O A;  3KDF B;  2C35 B;  2K5N A;  2N3S A;  1IBL Q;  4OXP A;  3S2D H;  4A3C H;  4JOI C;  2MO0 A;  1EIF A;  4B3M Q;  5FLM G;  2R92 G;  4OX9 L;  3U58 A;  1YHB A;  1KL9 A;  1C9O A;  4DV7 Q;  1K3R A;  4H02 A;  3I4M G;  1IZ6 A;  4DKA C;  3S1Q H;  4LUZ A;  4RMF A;  1HR0 W;  4DPG A;  4LF9 Q;  4GN4 B;  4LF4 Q;  2R93 H;  1CUK A;  4A3C G;  1FVI A;  1YIT A;  3PO2 H;  4A3L G;  1E22 A;  4Y7N H;  3PF4 A;  1XPO A;  3U50 C;  3S16 H;  1VQD A;  2JA7 G;  1LM0 A;  4K0K L;  1XNR Q;  4DR3 L;  4LF5 L;  2HQL A;  1CKN B;  2A19 A;  3CMA A;  3F2C A;  3S1N H;  2BA0 A;  3OYY A;  4DV6 Q;  2A1A A;  4JBJ A;  4DR2 L;  3UDG A;  1PH3 A;  4A3D H;  1VCI A;  3K7A H;  1CKN A;  2VL6 A;  4JOI A;  3UE1 A;  4R1J A;  4HIM A;  1MJC A;  1AH9 A;  1LUZ A;  4PZ8 A;  4JI6 Q;  4OX9 Q;  1YZ6 A;  4GNX C;  1I50 H;  1XNQ L;  2ASB A;  4B3R L;  1PH5 A;  4LW1 A;  4DR4 Q;  5C0X I;  3BU2 A;  1R9T H;  1PH7 A;  1VQN A;  4IOA A;  1VQC A;  1EWI A;  4DUY Q;  1Z9F A;  5C0X G;  3T1H Q;  3S24 A;  2VW9 A;  3UDF A;  2EIF A;  4GS3 A;  4YCU A;  2VS1 A;  1CSP A;  2AWO A;  2KHJ A;  4BBS H;  5J3B A;  2I5H A;  2AWN A;  2FXQ A;  5IYC H;  4OO1 I;  1WFQ A;  4B3T L;  1L2F A;  2D0O A;  2Q2H A;  1Y14 B;  4POG A;  2IT1 A;  2JA8 H;  3CCM A;  2RCN A;  3HOY H;  4BXX H;  3M85 A;  4MNO A;  4R4Q A;  4EQ5 A;  4GOP A;  4GNX A;  1PHJ A;  4JV5 Q;  3RN5 A;  2ZTE A;  4QGU A;  1PA6 A;  1B8A A;  2JA5 G;  1IXR A;  2ZM6 Q;  1VQB A;  4AH6 A;  5IWA L;  5GQO A;  5GAH C;  4A3I H;  1EUJ A;  4LFC Q;  1A62 A;  4GKJ Q;  4A93 G;  2LSS A;  3K7U C;  1E24 A;  1SRU A;  3PUY A;  3GTK H;  5IP7 H;  3K80 C;  1VQM A;  3S1M H;  2WAQ G;  3OTO Q;  1QVF A;  2WB1 G;  4DR4 L;  4DR7 L;  2NVT H;  4LFC L;  4IOC A;  4GKJ L;  2UXC L;  1VQG A;  4GKK Q;  5LMN W;  4DV5 Q;  1KXL A;  4X64 L;  3BZK A;  2Z6K A;  2BH2 A;  3HOZ G;  3UDX A;  1J6Q A;  4A93 H;  1JJG A;  1WCM G;  4AIM A;  2UUC L;  4JV5 L;  4YWL A;  4YY3 Q;  5IP7 G;  1U5K A;  2OTJ A;  4X65 L;  3G4S A;  4DV4 Q;  3CME A;  1NMF A;  3MEF A;  3U4Z A;  2BA1 A;  1GD7 A;  3GD7 A;  4A3F H;  1D8L A;  2HHH L;  1JMC A;  3PO3 G;  1KHI A;  1CSQ A;  3M9B A;  2QA4 A;  3HOU H;  4IFD G;  2K52 A;  1OXV A;  3EN2 A;  4HJA A;  3G6E A;  4HJ8 A;  3I4M H;  4QQB X;  4X64 Q;  3TS0 A;  4YCV A;  1N33 L;  3I2Z A;  4X66 Q;  1S72 A;  5JEA G;  1IBK Q;  1UE1 A;  2L15 A;  3M4P A;  3CCV A;  1HH2 P;  1FL0 A;  3CC2 A;  2VQE Q;  4J15 A;  2QGQ A;  1RIP A;  4DR5 L;  1M1K C;  1NJI C;  1G6P A;  3KF6 B;  2HIX A;  1Q7Y C;  2E2J H;  4RG1 A;  3KF8 B;  2K50 A;  3PUX A;  1Q8K A;  3FHW A;  3H0G H;  4AYB E;  1I94 Q;  1HR0 Q;  2CCZ A;  2UXD Q;  3KDF A;  3HOW G;  4LUV A;  2I0Q A;  4ME3 A;  1J5E L;  1U0L A;  1N36 L;  1A0I A;  3LGJ A;  4HJ9 A;  2F52 A;  1Q12 A;  1YJ9 A;  1Q82 C;  5IYC G;  5M3F G;  1KC8 C;  3J80 i;  4IFD I;  3HKZ G;  1I5F A;  1PVO A;  5FJ8 G;  1NTG A;  1GVP A;  3ICE A;  1KRS A;  1VQF A;  2MFI A;  3CQZ H;  3FKI H;  2ZM6 L;  1QZG A;  1VQ9 A;  5M5X H;  4C3H H;  3PGZ A;  1N32 L;  1B70 B;  5IP9 G;  2K75 A;  1X54 A;  5IY0 A;  1WI5 A;  3ERS X;  4O2D A;  1S40 A;  4HJ5 A;  4DAM A;  1YEZ A;  5HGQ A;  3F8T A;  3TEH B;  3M3Y H;  2B29 A;  4DR7 Q;  3PIO A;  4X6A H;  5FJ8 H;  5M5Y H;  4A3K H;  2OCE A;  4X62 L;  1H95 A;  1PYB A;  3SGI A;  3CF5 A;  1IBL L;  3W1G A;  4XTC S;  1YBY A;  1Y1V G;  3S1R H;  2E5L Q;  3A5Z B;  3JAM c;  1Y1W G;  4BY1 H;  4JI7 L;  2AKW B;  1V9P A;  1G29 1;  1TWC H;  4R4C A;  4UP7 A;  5C4X H;  4HJ7 A;  2YTY A;  2UU9 Q;  3RZD H;  4P72 A;  2Y0S E;  3H15 A;  1WYD A;  1QVG A;  2OQK A;  4DR5 Q;  4L5S A;  2GVA A;  4JI3 L;  3CCR A;  2B3G A;  4QL5 A;  2CWP A;  3A0J A;  2ALY B;  2UU9 L;  1K8A C;  3NEL A;  4JC0 A;  5GAG C;  2JEA I;  2R7F A;  4JI4 L;  4LFB Q;  3CCQ A;  1K8G A;  3CCL A;  4Y52 H;  2WB1 E;  2IHF A;  4KLK A;  2VNU D;  4DV2 Q;  2JEB I;  3STB D;  3TS2 A;  3CCJ A;  3AYH B;  4JBM A;  2PI2 A;  4YHH L;  3BZC A;  5C3E G;  4DAY B;  3PUW A;  2D62 A;  1P16 A;  4HID A;  2PMZ E;  2VQE L;  2RHQ B;  4JI5 L;  2AHO B;  1KQS A;  1FJG Q;  2DUD A;  3CAM A;  1JE5 A;  1VQO A;  2YTX A;  4GN3 B;  2ID0 A;  2YTV A;  4HIO A;  1UE7 A;  5GRO A;  4R4T A;  3I4N G;  4LF6 Q;  5FLM H;  3TRE A;  1EYG A;  4A3B G;  4DV3 Q;  5M5W H;  4OWT B;  4JI0 Q;  3PCO B;  4B3S Q;  3CPW A;  3H3V I;  1VQH A;  4A3D G;  1IBK L;  2JE6 I;  4A3E G;  1UE5 A;  2IX0 A;  3PO2 G;  3B6Y A;  4P73 A;  4YHH Q;  3UE0 A;  4IFD J;  2F3I A;  1CKM A;  3ER0 A;  1LYL A;  3PUV A;  5AJ3 L;  3RLO A;  3W5O A;  5LMN Q;  3T1Y Q;  1FGU A;  5M3F H;  3ULP A;  2R7Z G;  2CWA A;  2R93 G;  4EX5 A;  5IT9 c;  4K0K Q;  1X3G A;  3E9I A;  3PSI A;  4C3I H;  3J81 i;  2PQA B;  3A74 A;  1L1O A;  2A8V A;  1VS0 A;  1VQ6 A;  2LXJ A;  4B3M L;  4B3S L;  3GTP H;  3MXN B;  4XIG S;  1X9N A;  3TRZ A;  5IYD H;  1DGS A;  4PZ6 A;  1JB7 A;  3KJP A;  3RN2 A;  2IY5 B;  4LF6 L;  1E3P A;  3JAM i;  2B63 G;  3PV0 A;  1K9M C;  5JJK A;  1BVS A;  3Q8D A;  4PG3 A;  1YVC A;  4UPA A;  4GLX A;  2HIV A;  3PIP A;  3CC7 A;  1TWA H;  4DV0 L;  3GTL H;  2H5X A;  3HOW H;  3M4O H;  1HZA A;  3K0X A;  3HKS A;  4YY3 L;  5C0X J;  2NVY H;  3KOJ A;  4JI1 L;  4X62 Q;  2EQS A;  4TVA B;  3GTO H;  1IL2 A;  2KCM A;  4PZ7 A;  4ALP A;  3F2B A;  3J80 c;  2QEX A;  2VQF Q;  1JJ2 A;  4BA1 I;  4DNI A;  4JI7 Q;  1O7I A;  1X65 A;  3NEM A;  3DM3 A;  1VQ4 A;  4P74 A;  3KLW A;  3G48 A;  4AYB G;  2YU9 H;  2CQO A;  4IJL A;  2GVB A;  2NN6 G;  2K5V A;  4DR6 L;  4FDB A;  4POF A;  1VQ5 A;  3F1Z A;  1N34 L;  4NXM L;  1MJE A;  4JBK A;  2RF4 A;  2Y0S G;  2ZJQ A;  4NXN Q;  1A63 A;  3L2P A;  1UEB A;  2OTL A;  3HOY G;  2YV5 A;  2NVQ H;  4X65 Q;  1N9W A;  3PUZ A;  3AFP A;  4JI0 L;  2VY3 A;  2N8N A;  3HKZ E;  4A3M G;  3I4N H;  1E7Z A;  1Z47 A;  1C7Y A;  3VDY A;  1TWG H;  3L0O A;  1NY4 A;  4DV7 L;  4DV1 Q;  4LUO A;  2JK8 A;  4GLV B;  4BY7 G;  1VQI A;  2UXC Q;  1M90 C;  5IWA Q;  4A3G G;  2UXD L;  2KHI A;  1V43 A;  4JI2 Q;  3GO5 A;  5M3M G;  4PMW A;  3ULJ A;  1PH9 A;  1VQK A;  2CFM A;  4JI5 Q;  1YNX A;  1KIX A;  4BA2 I;  4OWX B;  4X66 L;  2E2H H;  4GLA C;  1SRO A;  1VQ8 A;  3HOZ H;  4LF4 L;  1BKB A;  2F4V L;  3G71 A;  2MQH A;  3AFQ A;  4B3T Q;  4KI0 A;  4DV6 L;  2R7Z H;  1XPU A;  4GKK L;  3CC4 A;  1NBW A;  2V1C C;  3JC6 6;  1XNR L;  5FLX c;  2AMC B;  3J81 c;  2Z0S A;  3OTO L;  1ASZ A;  2IHE A;  2UUC Q;  4A3E H;  2ZTC A;  4LF9 L;  3PO3 H;  5K36 G;  3DLL A;  3S14 H;  5JEA J;  2CKZ B;  4UP9 A;  4A76 A;  3GTJ H;  1VQP A;  1EQR A;  5C44 G;  3E9H A;  4P75 A;  3HOV G;  5E7N A;  1K83 H;  1PH4 A;  4JI6 L;  3KJO A;  1EFW A;  1XMQ Q;  3RR5 A;  1GO3 E;  5JJI A;  1N33 Q;  1KAW A;  1OXT A;  1HNW Q;  2OWO A;  2JJQ A;  3I4O A;  1K73 C;  3EBE A;  4A3F G;  3T1H L;  5IP9 H;  1YHQ A;  2MNA A;  3NEN A;  3K81 C;  3FP9 A;  1X55 A;  2MO1 A;  5LMU L;  2E2I H;  1HNW L;  1PH8 A;  1G51 A;  2ES2 A;  1XJV A;  4UY8 C;  1IYJ B;  1BBU A;  4LNQ A;  2HT1 A;  1W3S A;  1Y1V H;  3IRB A;  1XTD A;  4L5Q A;  2ZTD A;  4P71 A;  1TXY A;  1WOC A;  1HJP A;  4DUY L;  2Q2U A;  1SMX A;  1SLJ A;  5C4X G;  4DR3 Q;  4GOP C;  4LF5 Q;  1J5E Q;  4IJH A;  2N49 A;  1XMQ L;  2I5M X;  1L1O B;  2XTI A;  1PH1 A;  4JI8 L;  3FKI G;  1S3O A;  1SR3 A;  2B63 H;  1E1O A;  1TWH H;  3M4Q A;  4YWK A;  1K0R A;  4LF8 Q;  1YI2 A;  1HZC A;  1T9H A;  3ZJY C;  4GN5 A;  4HIK A;  3CCE A;  1NE3 A;  1YJN A;  4AQY L;  2JA8 G;  1SN8 A;  3RZO H;  1HZB A;  1UWV A;  3CCS A;  1XMO Q;  1HNZ Q;  1OXU A;  2Q2I A;  1XNQ Q;  4A3J H;  3GTQ H;  4BBS G;  1QUQ A;  2OQ0 A;  4IPH A;  4KHZ A;  2GN5 A;  5EAY A;  3UDI A;  1V1Q A;  1WCM H;  4JG2 A;  1D7Q A;  3K8A A;  2Z6K C;  1OXS C;  4LFA L;  1I6H H;  1QUQ B;  1IBM L;  4C3J H;  2F4V Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...