3GTJH

Backtracked rna polymerase ii complex with 13mer rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
146
structure length
136
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtjH00
2JK8A 3JAMc 2UUAQ 2ALYB 2RF4A 2Q2HA 4BY1H 3AFQA 2XTIA 3G6EA 1UE7A 5C4XG 1Q7YC 4IPHA 2OWOA 2GN5A 1FL0A 2GVBA 4TQUS 3RR5A 5LMUQ 4DUYL 2K14A 4JI6L 1PHJA 1Q46A 2E8GA 3E9IA 1V9PA 2ZM6L 3HOZH 4JBKA 2OQ0A 4X65L 1FGUA 3HOVH 3I55A 4HJ7A 1VQ8A 1EWIA 5C44G 1QUQB 2AHOB 4OXPA 2E2HH 4K0KL 3S2HH 3PIOA 2JA5G 4GLXA 4BBRH 4X66Q 2VZAA 4DK6C 2PMZE 2D0OA 1NMFA 1OXUA 4A3KG 4HIOA 4LNQA 1VQGA 3UDIA 5IP9G 1VQ9A 4JI1Q 2R7FA 2QGQA 4A3BG 2NZHA 2K5NA 3TS2A 4QQBX 2NZOA 1QVGA 4NXMQ 4YCVA 4HJ5A 2LXKA 2OTLA 2R93H 1WJJA 5BR8L 2F3IA 1EIYB 4GNXB 1EUJA 3BJUA 1YHBA 2MFIA 1IXRA 1IZ6A 3EBEA 1UE1A 4JOIA 1L0WA 1WFQA 2AWNA 3G71A 2Q2UA 4DUYQ 4LUZA 4A3LG 1PA6A 1RL2A 2VY3A 1HNXL 1SROA 1NTGA 3JC66 5J3BA 3RN2A 4HJ8A 5IY0A 1YJNA 1UWVA 1IBML 4BXXG 3HFZB 1ASZA 4JYAL 3W1BA 3CC7A 1YITA 2NVTH 4KLKA 4R4CA 3A5UA 1YHQA 2JJQA 4A93G 3CCVA 4B3RQ 3BZKA 4DR1L 4JI2L 1XPUA 4BBRG 2UXCQ 3GDEA 3CCQA 3I4MH 2VQEL 1X3GA 4A3KH 1JE5A 3CD6A 4DUZL 4GLAC 3KF6B 4R4IA 4ALPA 4IJLA 3UE1A 3KFUA 1Q81C 2PQAA 3I4OA 2HHHQ 3W5OA 3HOZG 1JT8A 3CCJA 2UUCL 1L1OB 2KBNA 4GS3A 4DR4Q 3A74A 4DV0Q 5C4XH 1GM5A 1N32Q 3K81C 1QUQA 4P73A 3PIPA 4JI7L 1I50H 2VL6A 4LF9L 3J7ZC 1TWAH 1D8LA 1VQAA 1TWGH 1WCMG 3ZJYC 4MTNA 4LF6L 4WJ4A 2OQKA 2B63G 4GOPB 2VNUD 4J15A 5IWAQ 4DV7Q 2CWAA 2Y0SE 4B3RL 1K9MC 3S1NH 3UDXA 2LSSA 3G4SA 2QA4A 3M4PA 2A19A 5M3MG 4GNXA 4UP7A 2K75A 1SFOH 1PVOA 5M5WH 1YI2A 1X3FA 1HZCA 5C3EG 4GNXC 4DK3C 2UU9Q 2ZJQA 1NMGA 3ULJA 2Q2TA 3HOWG 5EAYA 4DR2Q 4WJ3M 5GAHC 1RIPA 3U4ZA 2NVXH 2AKWB 1K8GA 2I5MX 4JI0L 2IY5B 5M3MH 4DR4L 1N33L 3GD7A 3PO2G 1M90C 4JI4Q 2GVAA 2BH2A 1FJGQ 4NXML 4DKAC 5LMNW 2NN6G 1MIUA 3I4NH 5LMUL 3CAMA 3GTJH 2WAQG 1VQ7A 1TWFH 2YU9H 2JA6G 4IO9A 4KHPQ 2B3GA 3FHWA 4LFCQ 1OXTA 3OW2A 1E24A 2UUBL 2MNAA 2MO0A 3CCUA 2EIFA 4JYAQ 1YHAA 4IOAA 1HNZQ 4POGA 3L0OA 1TXYA 1BVSA 1Z9FA 4A3FH 5IT9c 2PNHA 1IYJB 1XMOQ 3BZCA 2VQEQ 4OX9L 3HOXG 5GAGC 3T1HQ 1T9HA 4GN3B 5FLMH 3BU2A 4PG3A 4DR1Q 2EQSA 1E22A 2KCTA 3M4OH 2JA9A 4OO1I 4APVA 2BA1A 4JI5L 4JI8Q 3RZDH 4GLVB 1N9WA 2PI2A 4P72A 1KRTA 4LF5L 4LFAQ 2HT1A 1VQFA 3H3VH 1CSPA 2Y0SG 4AYBE 1I5FA 4NXNQ 2K52A 2K50A 1PH1A 2UXDQ 4HIKA 4A3FG 4DPGA 4X62L 2KHIA 4C2MH 3K7AH 4DV3Q 1BKBA 3L2PA 2ASBA 5M5YH 3W1GA 3CC2A 2MQHA 2IHFA 1SLJA 3H0GH 3KLWA 3UE0A 3CW2C 1VQMA 1EYGA 3PSIA 4LUOA 3EIVA 2WP8J 2I5HA 3PUYA 3CF5A 4LF9Q 4A3LH 1GO3E 3PGZA 1JB7A 3I4NG 2FXQA 1HNWQ 3I56A 3EN2A 5IP7G 5C0XG 3S1QH 4UPAA 4A3MH 1CSQA 2R7ZH 2V1CC 4IJHA 4JI2Q 4X6AH 5K36G 2JE6I 2Z6KC 3PO2H 1L1OA 1HR0Q 1PH4A 3DM3A 3STBD 2I0QA 3CCEA 2UU9L 3A5ZB 4QGUA 1AE3A 4BY7G 3HKZE 2YTYA 1B8AA 2QEXA 2NVQH 4NB3A 4A3DG 2BH8A 1EIFA 4A75A 3S2DH 2UXCL 3CPWA 3F2CA 4X64L 2WB1E 1KHIA 3CCSA 1JMCA 1PV4A 1VQNA 4DV2Q 4LF8Q 3GTKH 3PF4A 1GKHA 3GTPH 2WB1G 1UE5A 3J80i 4L5SA 4A3IH 4QJFA 1WI5A 1XTDA 1TWHH 4AH6A 1WYDA 2ZTCA 1PH6A 1MKHA 3TRZA 4B3MQ 3JAMi 2ZJPA 4IOCA 2WAQE 1Q82C 4R1JA 4BY1G 1X6OA 4FDBA 1SRUA 4JI7Q 1AH9A 4GN4B 4OWTB 1WCMH 3KDFA 1CKNA 4YWMA 2VQFL 4DV4L 4KHPL 4IFDJ 1UE6A 3STBC 4AYBG 3J81c 1VQEA 3KF8B 4LF4Q 4A3IG 4JCVE 1SR3A 4JC0A 5GROA 1N36L 1J6QA 2CCZA 3J7A5 3RLNA 3WWVA 1IL2A 1CUKA 1VQHA 4JI0Q 1K8AC 2R92G 5HGQA 1Q1BA 4Y7NH 4A3GH 1OXXK 1XMOL 1IBLL 4X64Q 4OX9Q 3T1HL 3F1ZA 1VQIA 3AQQA 1YVCA 3CP0A 4NXNL 4YY3L 4AQYL 3I4MG 2N78A 2UXDL 5FLXc 1G291 4IFDG 1YEZA 2L15A 1VQ5A 2ES2A 4MZ9A 4A3MG 1QZGA 3NEMA 4PZ7A 2R7ZG 1NY4A 4DAMA 1O7IA 5IP7H 4KI0A 1Y1WH 1XNRQ 5IYDG 4UY8C 1LYLA 4LFBQ 1Q1EA 2B29A 1PH8A 3ULLA 4AIMA 1XMQQ 3OYYA 4P71A 1VQDA 3K0XA 1XNQL 3B6YA 4MNOA 3KYHC 3OTOL 3GTGH 5IYDH 1HR0L 3PO3G 5IWAL 4DV7L 2R93G 4RMFA 1L2FA 4LW1A 4IPGA 4BBSH 3AFPA 3GTOH 2ZTEA 2VS1A 4YCUA 4QY7A 1M1KC 4A3BH 5FLMG 4LFAL 2D0PA 1XPRA 3D31A 4DR6L 1VQBA 4DAYB 1IBKQ 2IT1A 1Q86C 2R92H 1U0LA 1K73C 1KC8C 4DNIA 3GTMH 2ZTDA 4GOPC 2XGTA 5C0XJ 2JA5H 4XIGS 1HH2P 1XNRL 4P75A 1LM0A 3K80C 2I5LX 4LF5Q 4RG1A 2R7DA 1ASYA 2RHSB 1YBYA 1N32L 1SN8A 3S16H 3E9HA 4OWWB 4DV5Q 4LUVA 5IYCH 1VCIA 4DV1L 2JA6H 1GD7A 3K8AA 2HQLA 3PUVA 1S40A 4IPDA 3S14H 3CQZH 1KXLA 4L5TA 2N3SA 4R4QA 3KF6A 1GVPA 1HNWL 1N36Q 4A3JG 1BBWA 5M3FH 1S3OA 5LMNQ 2LXJA 4OONA 4NPSA 3PUXA 1SMXA 4A3EH 1R9TH 4JBJA 1IBKL 1IBLQ 4A3CH 5GAEC 4BA2I 2IX0A 2CFMA 4DV2L 4LF8L 4LWCA 4A3DH 2ID0A 2F4VQ 1SE8A 3G48A 2A8VA 3HOUG 2YTXA 4A3CG 1A0IA 3FKIH 2AMCB 3CCLA 2CQOA 1NBWA 1QVCA 3T1YQ 4A3JH 5JJLA 2B63H 3CPFA 2E2IH 4DV3L 3I2ZA 2VQFQ 1X9NA 2R6GA 1EOVA 1PH9A 1HNXQ 2DGYA 4OWXB 3NENA 3TEHB 2A1AA 5FJ8H 4C3HH 2CWPA 4DR5Q 2HHHL 2VUMH 1HZ9A 4LFBL 2N8NA 3CCRA 3UDGA 1EQRA 1KL9A 5IYCG 3H0GG 4JI3Q 1I6HH 5LMNL 3M3YH 3MEFA 1FVIA 4GN5A 3OTOQ 5GQOA 4A76A 4DV6L 2E2JH 3RLFA 1X56A 4GKJL 5GADC 1CKOA 2N49A 1KD1C 4YHHL 3HOYG 1I3QH 4UP9A 1V43A 1MJEA 4JI8L 3F2DA 3KJOA 1I94Q 4BXXH 3CCMA 1W3SA 4YY3Q 4YWKA 4HIDA 4DR2L 1TWCH 1YNXA 3TREA 1JJ2A 1Z47A 2UXBL 3PO3H 1A62A 4GKKQ 2DUDA 3A0JA 1HZAA 4EX5A 1N34L 2UUAL 5M5XH 1E1OA 3F2BA 4B3SQ 2PQAB 1D7QA 1KIXA 1FJGL 3CC4A 3AYHB 3GTLH 4LF7Q 3E0EA 2YTVA 2EXDA 3KJPA 1H95A 5DLQE 4PMWA 5IE8A 3IRBA 4GKJQ 4P74A 1Y1WG 4OO1G 5IP9H 5JJKA 4X65Q 2UUBQ 1QZHA 3NBHB 5JEAJ 2F4VL 1LUZA 5IYBG 4JV5L 1L1OC 1N33Q 1C9OA 3LGJA 3HKZG 1VQPA 4JBMA 3M7NA 4L5QA 4GOPA 2F52A 3HOVG 3CMAA 2IX1A 4DR6Q 4A3GG 2KHJA 3VDYA 1PH7A 4ME3A 3T1YL 2E5LQ 4H02A 4DR7Q 4DV0L 1X3EA 2K5VA 3ERSX 4LFCL 3RLOA 2JA7G 4IFDI 1X55A 1J5EL 5JEAG 1K0RA 1VQLA 2K5HA 4B3ML 2C35B 2ATWA 4QL5A 1KQSA 2OTJA 1XNQQ 2KCMA 5ELNA 4DV4Q 4DR3L 3Q8DA 4LF6Q 2VUMG 3J81j 4B3TQ 3GO5A 4DV6Q 1Q12A 3I7FA 5H1SE 1VQCA 1E7ZA 1P8LA 2D62A 4LF4L 4K0KQ 3CXCA 2Z0SA 5ELOA 2JA7H 2KENA 1JJCB 4O2DA 1HZBA 4BA1I 4PZ6A 1XJVA 4R4OA 3M9BA 1DGSA 4O0AA 4IPCA 3TS0A 1K3RA 1NJIC 3S15H 5AJ3Q 2CKZB 1KAWA 5IYBH 1G6PA 4X62Q 1N8RC 4A4IA 1HJPA 4JBWA 2JA8H 3S24A 1OTCA 3J80c 4A93H 1E1TA 4YWLA 4BY7H 1UEBA 1CKNB 4DR5L 3PUWA 1PYBA 1I94L 3U4VA 5M3FG 3ICEA 2NVYH 3NELA 1B7YB 4XTCS 3S1RH 1Q8KA 3DLLA 1XPOA 1JJGA 3MXNB 1VQ4A 4B3SL 3GTQH 4DV5L 2HIXA 1S72A 2ZJRA 4DR3Q 4QIWE 1AE2A 4B3TL 3M85A 1C0AA 4LF7L 1PH5A 5BR8Q 4JI6Q 2PI2E 1Y1VG 2NN6I 4KHZA 2ZM6Q 1PH3A 1X54A 4C3JH 2IHEA 3RN5A 1YJ9A 4JI3L 1HNZL 2Q2IA 1W2BA 1PFSA 2RHQB 2JEAI 5JJIA 5C0XI 5AJ3L 3D0FA 4R4TA 4EQ5A 1PH2A 1PYSB 1YIJA 3HOYH 1LTLA 2UXBQ 1VQOA 1MJCA 1A63A 3RZOH 1NE3A 4YCWA 1K83H 4JI5Q 4L5RC 2H5XA 1VQJA 5C4JH 3TQYA 3UDFA 4UP8A 5C44H 3HOXH 2UUCQ 3AEVA 4BBSG 1VQ6A 3K7UC 4POFA 4GKKL 4JI4L 2AWOA 2K4KA 4AQYQ 1Y14B 1P16A 2E5LL 1OXSC 1EQQA 1OXVA 2Z6KA 2BA0A 1Y1VH 2RCNA 1U5KA 2HIVA 2JQOA 1J5EQ 1C7YA 4Y52H 1CKMA 4DV1Q 3ER0A 5FJ8G 1WOCA 2JEBI 1N34Q 3ULPA 1YJWA 1X65A 4TVAB 3SGIA 5E7NA 3U50C 3H15A 3U58A 2OCEA 1IBMQ 1VQKA 1VS0A 4JV5Q 1A8VA 4JOIC 2JA8G 1EFWA 1G51A 3F8TA 4JG2A 1BBUA 3FKIG 3PV0A 4PZ8A 3PCOB 1YZ6A 3KOJA 4YHHQ 4HIMA 3KDFB 3HOUH 2VW9A 5C3EH 3S1MH 3CMEA 1V1QA 4HJAA 5HY6A 3PF5A 1QVFA 3S17H 4DR7L 1B70B 3PUZA 3H3VI 3HOWH 4X66L 3FP9A 3J81i 2MO1A 4DUZQ 3RNUA 4HJ9A 1XMQL 1E3PA 4JI1L 4C3IH 4A3EG 2YV5A 1KRSA 3HKSA 2WFWA 2YYZA 1HR0W 3M4QA 3L7ZC
chains in the Genus database with same CATH superfamily
4G4KA 3AFQA 5M5WB 2OWOA 3ZYYX 1FL0A 4TQUS 3R8BA 3RUZA 2K14A 4CBVA 3HOZH 3E9IA 3NWTA 4JBKA 2OQ0A 4X65L 1ENCA 2EYLA 5C44G 3VR6A 5E4WC 3C2PA 1JORA 3BYYB 2PMZE 4DK6C 2D0OA 4LNQA 2Q8TA 3FDTA 2EOTA 4CJ2C 3I3CA 4NXMQ 1YNND 2OTLA 5J22A 3DUZA 4CGYB 3BJUA 1YHBA 1L0WA 4APVA 1IZ6A 3G71A 1CA6A 1WFQA 2SEBD 4DUYQ 4LUZA 3I4LA 3S1NB 2VY3A 1HNXL 5TSSA 4HSVA 1ASZA 3W1BA 4MN3A 3GV6A 3VR4A 1ENAA 3HOXB 1BF4A 5J1ZA 3KF6B 2AQ2B 1STBA 2EYHA 2Z1CA 4XXEA 2D2CC 3UE1A 3KFUA 2PQAA 3I4OA 2HHHQ 2L12A 3HOZG 1JT8A 3VYSA 3CCJA 2UUCL 1L1OB 4B08A 1SNPA 1N32Q 5IGGA 1QUQA 2B2WC 4WRDA 1SE4A 5CV4A 1SNQA 1UAPA 3J7ZC 4LF9L 3VYUA 1TWAH 4A3MB 2QCPX 4KD3A 3JAML 2B63G 4GOPB 4WJ4A 3RD4A 4B3RL 3UDXA 1II3A 2J7ZA 3VR3A 4ZKCB 4UP7A 5CV9A 4IQZA 1PVOA 1HZCA 3H3VC 1PMRA 1NMGA 3ULJA 4WJ3M 4DR2Q 1RIPA 4HMIA 1K8GA 2I5MX 1EU4A 4DR4L 2BE5D 1PRTB 3S15B 3WOEA 2BH2A 1STNA 2JP1A 3OIPA 5E4XA 1I6VC 2YU9H 2B2WA 2JA6G 2E2IB 3A7AB 3NTKA 3SK4A 2RCFA 1OXTA 3OW2A 2FHTA 1T5XD 3CCUA 4JYAQ 1PZJD 1YHAA 3OW7A 3L0OA 1TXYA 2G5DA 1XMOQ 2VQEQ 3HOXG 5FLMH 4EQNA 5JVH3 4OO1I 1WD0A 3QR8A 1PRTC 1LLRD 1SE2A 2PI2A 5KNDA 3I4MB 1TS4A 3H3VH 2HT1A 1AFPA 2Y0SG 2UXDQ 3TP7A 1S4ZA 4HIKA 4X62L 3NE5B 3L2PA 2EJGC 2Z6BA 2PZWA 3CC2A 2DY8A 3CW2C 1PRTD 3PSIA 4WJWA 2I5HA 1ET9A 4LF9Q 1JB7A 2FXQA 1HNWQ 3I56A 2F0NA 1OO9B 4UPAA 1FD7D 4ZLTF 3VA7A 4K6LA 4IJHA 2PW7A 2JE6I 3PO2H 4N8X1 1HHVA 4FO2A 2EYFA 3ND8A 3QG1A 1LABA 4IUPA 1GOZA 5DNFA 1AE3A 5IGEA 2YTYA 1B8AA 2QEXA 1CI3M 2NVQH 4A3DG 1B50A 4A75A 5ELBA 1ICFB 3D4RA 3CPWA 4X64L 1VQNA 1KHIA 3PF4A 4DV2Q 1EIHA 3MVVA 1V1PA 4QJFA 1TQOA 3GTKB 2BDNA 3TRZA 5EBDA 4B3MQ 3DEOA 1Q82C 4JI7Q 4ZYSA 1D5XC 1SRUA 4DNRB 1L0YB 1WCMH 3FVQA 3J80L 3STBC 3KF8B 5EKLA 3CU7A 5C5MA 5JJZA 5C4JB 4CJ1B 1J6QA 1RF2D 2DY7A 2CCZA 1VQHA 2R92G 1Q1BA 3FPPA 4ZUJA 3J80E 4NXNL 1RHPA 1RTNA 4C2MB 1G291 1VQ5A 1LTID 4MZ9A 2R7ZG 5K36H 1NY4A 4A3DB 4DAMA 1TWFB 4QUFA 1H9JA 1Y1WH 1XNRQ 2PNRC 3T13A 4AIMA 1VQDA 1TR5A 1XNQL 2BDOA 5G3LF 3OTOL 4RMFA 4IPGA 5EPJA 3GTOH 2V4DA 2VS1A 4YCUA 3D6WA 3FEWX 4A3BH 4LFAL 1UNSA 1EQVA 2D0PA 3D31A 5EJWA 1KC8C 4DNIA 1EEFD 2QW7A 5C0XJ 2R92B 3K80C 1ASYA 1YBYA 2L5TA 1WTWA 3S16H 4OWWB 1JWSD 4WORA 3S14H 3PUVA 1S40A 4L5TA 4CKCA 2F0PA 4OL7A 1BBWA 4OONA 1VMCA 1SMXA 3Q22A 1IBLQ 4A3CH 2WIIB 4ODGA 1X3QA 3CRKC 1K8MA 2SNSA 1KLGD 5GAEC 2ZT9C 4DV2L 4BA2I 2ID0A 2A8VA 3CHBD 4EVOA 1XXGA 2AMCB 5CV6A 1RCVD 3C1FA 1AP0A 1QVCA 4IUUA 2MHVA 1SYBA 3HOYB 2E2IH 1QJOA 1A2TA 3NBHA 1O7ZA 2X69A 3IAYA 1LV9A 4DR5Q 2HHHL 2VUMH 2F0KA 1GUGA 2N8NA 3CCRA 3C3LA 1KL9A 5IYCG 5I6WA 3M3YH 5M5YB 3MEFA 4DN4M 2E2JH 1H9SA 2B2YA 2MP1A 1SEBD 4GKJL 1JB3A 1EZ6A 4GZYC 2O5JC 5EKIA 1MJEA 1SDFA 2IL8A 4DAVA 2QF7A 3TP5A 2HDLA 3EVQA 1YNXA 1CZWA 5IT9L 4J8QA 3PO3H 3TN2A 1N34L 1HZAA 4EX5A 1ILPA 1E1OA 1RODA 5M3FB 2F0SA 4LF7Q 3I70A 3IRBA 4GKJQ 1Y1WG 2AQ1B 4X65Q 2UUBQ 1QZHA 1SE3A 2F4VL 1LTGD 1C9OA 3HKZG 5I9OA 4L5QA 4FF3A 4RAUC 4K8JA 2SDFA 2IX1A 4O1NA 5EKKA 3D4WA 3N6RA 2SOBA 1X3EA 4DV0L 4LFCL 2A69C 1HA5A 2JA7G 1BQQT 1J5EL 1PTOH 2ATWA 3G6JB 3L9AX 4G7OC 4HAEA 4ZRZA 5CMDA 4DV4Q 1HXYD 1BCPB 3Q8DA 3J81j 4B3TQ 4DV6Q 1Q12A 1B9NA 5H1SE 1GUTA 1VQCA 2D62A 2A5HA 1B4OA 2Z0SA 2KENA 4NW2A 1HZBA 4O0AA 1F77A 4DGZA 4U68A 3C46A 1G91A 1HJPA 4JBWA 4A93H 4BY7H 1V8QA 1UEBA 1LTTD 1EL0A 3OIQA 1B7YB 4XTCS 4XQQA 1Q8KA 1A6XA 1VQ4A 2FMCA 2OXPA 4B3SL 2HIXA 4DR3Q 2A73B 4B3TL 1PH5A 4R8NA 4DXGA 3HOUB 4JI3L 1W2BA 1PFSA 1A3TA 2JEAI 5DEHA 2C9OA 3DWAA 3D0FA 4EQ5A 1LTLA 2KCNA 1VQOA 3BDCA 2H5XA 5EQ0A 2ICIA 1BCPC 3TQYA 3HOXH 3AEVA 2L11A 3S2DB 1EQQA 2FMMA 1R4QB 2CH4W 1J5EQ 4Y52H 4DV1Q 5FJ8G 1WOCA 1YJWA 1IBMQ 3H15A 3W2DA 1QG7A 2JA8G 1EFWA 1G51A 4JG2A 1M8AA 4HIMA 1CHQD 2VW9A 5C3EH 3CMEA 1V1QA 4DR7L 2FFKB 2RA4A 4J6HA 3PIP3 1DM0B 3MEHA 1E3PA 1D1KA 1KRSA 4A3KB 2D9UA 1VF7A 3HKSA 1HR0W 1XWEA 1LT3D 2JK8A 3I91A 3JAMc 4O42A 3T4AC 4EQPA 3NTIA 1WTHA 3NUCA 4HCEA 3E5SA 4KJNA 5JJIA 1WTQA 1Q46A 2XNAC 2ZM6L 3FRPB 5C4ZA 1CHPD 1EWIA 1S5ED 1QUQB 3OWFA 4DU9A 3I55A 1VQ8A 2WKCA 3LWUA 3CKIB 3FPUB 1D6EC 1NUCA 1AZPA 2VZAA 3S16B 1OXUA 1XX8A 4HIOA 4RGNA 3UDIA 1VQ9A 3NP8A 2K04A 2K5NA 2NZOA 4YCVA 2R93H 2B2VC 2HD3A 1ZYRD 2DN8A 3GTMB 1EWCA 2F3IA 1K83B 1EIYB 1IXRA 2MFIA 4A3LG 1FNVA 1HUMA 1PA6A 3AMUA 1FYCA 3BDOA 5HURA 1NTGA 3RN2A 2K01A 1IBML 4BXXG 4JYAL 3TP6A 1D7QA 1F2YA 2NUCA 4KLKA 4QUCA 4R4CA 1YHQA 3CCVA 3J7AV 2JSOA 1Z7TA 1XPUA 4OELB 3PIO3 4BBRG 2RDFA 2J4XA 1B2TA 3GDEA 3CCQA 3I4MH 2CVRA 1JE5A 4DUZL 4GLAC 2BE5C 4IJLA 1ESRA 2NTSA 3KUPA 1LO5D 3ND9A 2JA6B 1SMYC 1SNCA 1GM5A 3I8ZA 3K81C 3M3YB 2PPBC 1I50H 2VL6A 1TS2A 1STHA 1D8LA 2B2UA 1TWGH 4MTNA 1SNDA 1WTVA 1H9RA 4BBRB 2WAQB 5JOBA 3SDZA 1K9MC 5ELEA 2NVXB 5M5WH 4NP5A 1X3FA 1YI2A 5A2QL 2EZVA 5EAYA 4P2CB 3U4ZA 3URYA 2AKWB 2ICEC 3A56A 4JI0L 1LT6D 1W6JA 3NPPA 1N33L 3GD7A 4V190 3H91A 2A6EC 3PO2G 1GHJA 4JI4Q 2N55A 2E75C 1FJGQ 1HTPA 1AW7A 1KDBA 5LMNW 2L55A 4ME5A 1MIUA 4OIJA 1EQTA 2PW5A 1VQ7A 1TWFH 3ERQA 2B3GA 2JN4A 2F0HA 1MD2D 2EIFA 3V05A 4IOAA 1HNZQ 4RKLA 1BNZA 3OMCA 4A3FH 1NCVA 2IPKD 4GN3B 3BU2A 1K0SA 2KCTA 1E22A 3M4OH 1I4PA 4KKTA 3H94A 4P72A 1CSPA 4AYBE 1A3UA 2KHIA 4C2MH 2ASBA 2XSCA 1W6KA 4EQOA 2IHFA 3KLWA 3UE0A 1Y8NB 1KAAA 2F0GA 1VQMA 4I7ZC 1EYGA 2F3WA 1GO3E 1G6ZA 2JYOA 3VR2A 5IP7G 5M5XB 1L1OA 3S9WA 1Z6HA 3CCEA 3U9OA 2UU9L 3FMCA 3A5ZB 3KLSA 1EIFA 3S2DH 3F2CA 5FLXL 3HOVB 2DJFC 2FINB 4X3SA 1RD9D 1GUOA 3J80i 4A3IH 1XTDA 4H13C 1TWHH 5CBAE 1F9SA 1MKHA 5KNCA 3R2TA 2WAQE 4OEMB 2QEJC 4LJZC 4OGQC 2VQFL 5IGCA 3KDFA 1CKNA 4PQXA 3AB9A 4IFDJ 1UE6A 2WB1B 4AYBG 1VQEA 2B2UC 2XWJB 3RMHA 1DOMA 3LNNA 1U4PA 4JI0Q 1K8AC 4A3GH 5KIXA 1B9MA 1OXXK 5EBCA 2DJGC 4X64Q 1TS3A 3F1ZA 4YY3L 4JVZA 5FLXc 2L15A 2ES2A 3I4NB 4A3MG 1O7IA 4WFN3 3ITPA 3X3MA 4LFBQ 4X3KA 3ULLA 3ONAB 1ILQA 3K0XA 2KEDA 3B6YA 2HDMA 2LMCB 5T1GA 3GTGH 1HR0L 3K57A 1B3AA 1DOLA 2ZTEA 4QY7A 1M1KC 3HS0C 1I4XA 4DR6L 1IBKQ 3GTPB 5FOBB 3GTMH 3IL8A 4F88A 3TZDA 2F4IA 4ILWA 2ZXPA 3OSOA 4XIGS 1XNRL 4P75A 4KV6A 2I5LX 2A6ED 4LF5Q 1TS5A 2RHSB 1SN8A 4IALA 4BY7B 4LUVA 5E1FA 1S5DD 3CQZH 1KXLA 1HNWL 1V1PB 5M3FH 4KY7A 2ENBA 3PUXA 1R9TH 1U9RA 1ZKOA 1IBKL 2Y0SB 1GJXA 2R93B 4LWCA 4RHSA 4A3FB 3G48A 1G2SA 4A3CG 1QWYA 2WV6D 1K28A 3MAQA 2CQOA 1NBWA 4G7ZC 2XRSD 2KEEA 5DM73 1PFMA 2VQFQ 1X9NA 1EOVA 3T53B 2DGYA 2B2TC 1PFNA 2I07B 3I72A 2K33A 3KLSX 4LFBL 3UDGA 2PQEA 4DNTB 1J8IA 5GQOA 4A76A 3R3OA 3RZDB 5D14A 2CHBD 2N49A 2KHSA 3J7YW 1V1OA 3MA2B 3BDLA 3HOYG 1RKNA 1F9RA 1HA6A 3F2DA 5CV7A 1I94Q 3MC0B 2MUYA 4BXXH 3CCMA 1RDPD 1W3SA 4YWKA 4HIDA 1CQVA 4UHVA 3A8JE 4DR2L 1BO0A 1TWCH 1NSNS 1PYWD 1Z47A 4HTHA 3NTHA 3TBIB 5BN5A 4KY5A 5J39A 2DUDA 1MSHA 5M5XH 1EY5A 2PQAB 2NN6H 3GTLH 1QCBD 2YTVA 2EXDA 3KJPA 1B53A 1STAA 5IE8A 5I4DA 4P74A 5FK9C 1PTOF 2SNMA 1BDOA 4UAIA 5IP9H 5JJKA 3DWQA 3HGBA 3NBHB 1LUZA 5IYBG 4JV5L 3NQIA 3LGJA 3TP8A 4JBMA 1CA5A 3HOVG 4RH6A 5EPKA 2LKVA 2EE1A 4JK1C 1MI2A 4ME3A 2OF1A 5JEAG 4B3ML 3BVMA 1I6HB 4C1NI 1KQSA 3IFTA 3NK9A 1E2VA 4BBSB 5JEAH 5ELNA 1CFMA 2VUMG 2Z9HA 2KVMA 2EYPA 1SJED 1Y8OB 3GTJB 5C3WA 1EY7A 5ELOA 2JA7H 2EJMA 1LTSD 2HCCA 4BA1I 1TWGB 4R4OA 4KY6A 3EJIA 1DGSA 3NWSA 2B39A 2K32A 1NJIC 3S15H 3HEJA 3DMUA 1G6PA 1KAWA 4K6DA 2OT2A 4A4IA 1OTCA 1CKNB 4I65A 4DR5L 1TU2B 1I94L 1H9SB 4F8MA 3ICEA 2NVYH 3DWPA 3S1RH 1T5EA 1LTAD 4XDXA 4DXFA 5BR8Q 4JI6Q 2PI2E 4R9WA 2NN6I 2ZM6Q 1PH3A 1NNXA 3EQLC 4C3JH 1YJ9A 2Q2IA 5C0XI 1PH2A 3P20A 1PYSB 1YIJA 2QILA 3D3RA 5CV8A 1MJCA 1A63A 1D5MC 1TWHB 1NE3A 4K2KA 4JI5Q 4L5RC 2UUCQ 1F2MA 3V96A 4JI4L 2AWOA 2K4KA 4PV1C 2X6LA 3MFGA 1OXVA 3OMGA 1U5KA 1C7YA 1GUSA 2Z4HA 1BR9A 1A3VA 2JEBI 1N34Q 1X65A 4TVAB 3SGIA 5E7NA 4A3GB 2OCEA 1KNEA 3HRZC 4JOIC 1UUPA 1EY4A 5DM63 3MTSA 3F8TA 3A7LA 1KLUD 1BBUA 3FKIG 3PV0A 1HUNA 3GV3A 4HJAA 3Q24A 3PF5A 3S17H 1U4LA 4X66L 4N9TA 4CKBA 3J81i 3BYTB 4K8IA 4DUZQ 1F2ZA 4X3TA 1XMQL 4JI1L 1DCZA 2NYZD 3MXGA 2YYZA 3M4QA 1Y69U 2UUAQ 2ALYB 2RF4A 3K6OA 4BY1H 3HOZB 2XTIA 3G6EA 2BCOA 1UE7A 2K5DA 1Q7YC 1Y1VB 4IPHA 2GVBA 3RR5A 5LMUQ 3K58A 4JI6L 2F0LA 1PHJA 4UDUC 2RKSA 1V9PA 2PCFB 4IUNA 4HJ7A 4KTAA 2AHOB 1SYDA 2E2HH 4K0KL 1O7LA 3S2HH 3PIOA 4GLXA 4X66Q 2G9HD 1LTRD 5ELCA 2FJ2A 1NMFA 3VYTA 4A3KG 5IODA 4JI1Q 4KJOA 4RFBA 4A3BG 2NZHA 4QQBX 1FGBD 1QVGA 3BS1A 2LXKA 1PLFA 5C44B 1WJJA 5BR8L 2Q8IB 4FXKC 4H0LC 2F0TA 1TY2A 5IGFA 1EUJA 1S5BD 1UE1A 2Q2UA 2AWNA 3BVGA 1R9TB 4XT1B 3W3AA 1MGSA 3BZDB 1VF5C 4HJ8A 5IY0A 1UWVA 1YITA 2I46A 5AFWA 5LL6X 4A93G 5JVG3 1EWHA 4DF7A 4CHTB 2UXCQ 3MWYW 2VQEL 3O13A 3CD6A 4C3IB 1EOTA 3TZUA 4CKEA 2A69D 1SYEA 3HOWB 4GS3A 4L6TB 3A74A 4P73A 4JI7L 3KBGA 1S5CD 1WCMG 2R61A 3PQIA 2PZTA 4LF6L 2VNUD 5IWAQ 4DV7Q 4QMGA 1PFBA 2CWAA 2RSOA 4KKSA 3G4SA 2QA4A 3M4PA 4NMZA 4GNXA 2EYJA 2K7VA 2K75A 4GNXC 4DK3C 2UU9Q 2ZJQA 2Q2TA 3HOWG 1A2UA 2F0FA 2IY5B 2L0CA 1SBBB 4RWSC 1SXTA 2VB3X 2J0TD 1M90C 1EY9A 2GVAA 3GTLB 3E0JA 2YU9B 2F0JA 3KLRA 3I4NH 5LMUL 1IW7D 3GTJH 1PXUA 2WAQG 4S3SA 4KHPQ 4IO9A 5KNBA 4LFCQ 4K5XA 3NHHA 2NZ1D 1O78A 3S1MB 2EPBA 1DONA 1B1ZA 4POGA 1WCMB 3DHQA 1BVSA 1Z9FA 4IN3A 5IT9c 1IYJB 3BZCA 5GAGC 3T1HQ 1T9HA 1ZYRC 2Z8LA 4PG3A 1LT4D 2EQSA 3WOFA 2JA9A 4A3JB 2HCIA 3P7JA 3X3NA 2BA1A 4XQNA 4JI8Q 3RZDH 1N9WA 3A54A 5KYIA 1KRTA 1VQFA 4NXNQ 1I5FA 5BN3A 1PH1A 2RDHA 3QB3A 4DPGA 3K7AH 3E6ZX 5M5YH 2MQHA 1SLJA 5T1IA 4LUOA 3EIVA 3OPOA 4CDDC 1STEA 1KTKA 1ESFA 1BBXC 3EN2A 4LK1C 5I6YA 1C4QA 1CSQA 1O80A 2R7ZH 4X6AH 5K36G 5CYUA 2Z6KC 2QDLA 1D2BA 3DM3A 3STBD 2I0QA 4FXDA 2M2LA 3PO2B 2E2DC 4BY7G 3VR5A 2IX3A 5CR3A 1IW7C 3S2HB 2M00A 4CJ0B 2B8GA 1JMCA 3GTKH 3CCSA 1PV4A 4FF4A 3GTPH 2WB1G 4BS9A 3IKJA 1UE5A 4L5SA 1F2LA 2NBFA 4AH6A 1WYDA 2ZTCA 4M1UB 1BXTA 1WVLA 2MPMA 1CM9A 1DJRD 4BY1G 3QIAA 4DV4L 1SAPA 4KHPL 4KMUC 1DXMA 2WINB 1E0BA 3J81c 4LF4Q 2RVLA 4A3IG 1GUWA 3S1QB 2E74C 1EYDA 3J7A5 1LACA 4Y7NH 1NAPA 4OX9Q 1IBLL 3MXPA 1NR2A 3T1HL 3AQQA 3GTOB 1YVCA 5BN4A 4AQYL 2UXDL 4IFDG 1QZGA 4RCNA 3NEMA 4PZ7A 4BY1B 1KNAA 4KI0A 5IIFA 5IYDG 1LYLA 1S5FD 1Q1EA 5JAVA 4AYBB 1PH8A 4P71A 4Q0FA 3SK5A 4OHJA 2DNCA 2NVYB 4MNOA 5IYDH 3TDQA 1TVXA 3PO3G 5IWAL 4DV7L 2R93G 1L2FA 3GP7A 4A93B 4BBSH 1GHKA 1SNMA 2HUGA 1JQYD 4LMQD 5FLMG 1XPRA 1VQBA 2IT1A 1Q86C 2R92H 1U0LA 2ZTDA 2XGTA 3P1HA 5EGTA 4DK1A 3VYRA 1Q8IA 1LM0A 1YNNC 5C6AA 2R7DA 1N32L 1JOKA 3OWEB 1FNUA 5IYCH 1VCIA 2F3VA 4DV1L 1GD7A 3K8AA 4IPDA 2N3SA 4RCOA 3KF6A 1N36Q 4IURA 1EY0A 1S3OA 3HZXA 5LMNQ 2RDGA 2K5WA 4A3EH 2F0MA 1SSOA 1WTOA 4C1NK 3A8KE 5LHY1 4A3DH 2F4VQ 1TT2A 1VMPA 1A0IA 4N8FA 3K0YA 2D5DA 2IWHA 3AU7A 4K14A 3T1YQ 4A3JH 2B63H 2A6HC 3CPFA 3HKZB 4DV3L 2Q8RE 1HNXQ 3NENA 5FJ8H 2A1AA 4C3HH 2Z4IA 1HZ9A 4DAYA 1EQRA 2EY6A 1WD1A 2RBMA 4JI3Q 1I6HH 1I4GA 4FF1A 4QB4A 4DV6L 3RLFA 2IW3A 1KD1C 3H09A 4YHHL 4G57A 4UP9A 1V43A 3H0GB 1PTOD 3A8IE 4DAPA 4G7HC 2XIWA 1AN8A 4YY3Q 1QNKA 4OO1H 2F0WA 5G3LD 1CQFA 3S17B 2TMPA 1JJ2A 5F2DA 2UXBL 3VA5A 1A62A 4GKKQ 3F2UA 2UUAL 4B3SQ 3F2BA 4FF2A 2PZUA 1I4QA 5KYLA 4RGOS 1KIXA 1R4PB 1FJGL 3CC4A 3AYHB 3MHBA 5IOCA 3I90A 1EIGA 4PMWA 1LT5D 1I4HA 5NUCA 2EY1A 4H44C 5ELDA 1VDZA 1PDQA 4IFDH 1L1OC 2CQAA 4B9WA 3QWNA 1VQPA 3M7NA 2IJ0A 2F52A 3DXJC 3CMAA 4DR6Q 2E2HB 2VUMB 3SVMA 1HPCA 3NXWA 3T1YL 4HCSA 4H02A 3K5MA 4IFDI 2UXBQ 2K5VA 3RLOA 3K5OA 1X55A 1K0RA 1VQLA 4TKOB 2K5HA 4QL5A 2B2TA 2OTJA 1DYQA 2KCMA 3I7FA 1RTOA 1P8LA 4Y7NB 1MBYA 3QJYA 1JJCB 4O2DA 3K5LA 1A15A 2A68C 2L9HA 3FKIB 3M9BA 2EVBA 2EYOA 4IPCA 3T56B 2PO4A 1I50B 3N52A 1N8RC 2K28A 3J80c 1E1TA 1I3QB 5I2YA 2H4OA 3U4VA 5M3FG 4MIUA 1M4VA 4JPBW 3MXNB 5IGDA 4EGVA 1IHZA 1S72A 1U4RA 5FO9B 1AE2A 5JPMC 2BOSA 3J7AF 3I73A 1ET6A 2KECA 1Y1VG 4KHZA 1X54A 4IUTA 4DA2A 2RHQB 4R4TA 1Q90A 5D3DA 3RZOH 2K1BA 4F7XA 1SYFA 1AEXA 2EY5A 1VQJA 3UDFA 5C44H 4UP8A 3BVZA 5KGUA 4C3JG 4A3BB 2CH4A 1F9QA 3K7UC 1VQ6A 2O4XA 5A35A 5C5LA 2JA8B 4AQYQ 1P16A 2E5LL 1BCPF 1Y1VH 2RCNA 2HIVA 2JQOA 4YIJA 3ER0A 3ULPA 2K5QA 3GTQB 1VQKA 3U58A 1C8CA 3M4OB 4JV5Q 1YNJD 4PZ8A 3PCOB 1YZ6A 3KOJA 3SK8A 4YHHQ 3KDFB 2KOLA 5I2XA 3S1MH 1QVFA 1B44D 1EY6A 2G9DA 1B70B 3PUZA 3HOWH 5JPNC 4C3HB 2NTTA 4HJ9A 3E3XA 4C3IH 1GXDC 2YV5A 2WFWA 2GA4B 2F1MA 1XPOA 2O2LD 5I9PA 2Q2HA 4XT3B 1CT1D 1G8ZD 3K7AB 4HR7B 3T16A 5C4XG 1ZEQX 3OOCA 3Q0AA 2GN5A 4DUYL 4ZKBB 4ZCKA 2E8GA 2WACA 3GQBA 4FNFA 1FGUA 3HOVH 5FKAC 1JCKB 4OXPA 5KRUA 1RJTA 4R8IA 2JA5G 2B63B 4BBRH 1F9PA 2E2JB 2PYKA 5FLXE 1VQGA 5IP9G 4ID6A 1PZKD 2R7FA 2QGQA 3BG3A 3CRLC 3TS2A 2QKIC 4DFAA 1AZQA 1L0XB 4HJ5A 1EY8A 4GNXB 3J81L 3EBEA 4JOIA 2XN9C 3DEPA 1BUVT 5CGKA 1XTCD 4A3EB 2QDBA 1RL2A 1BCPD 4KN7C 1SROA 5IGBA 3JC66 5C3EB 5J3BA 4FP5D 1YJNA 1STYA 1JOOA 1HFNA 2MGSA 3HFZB 2P5ZX 5A2QE 3CC7A 2NVTH 3A5UA 2JJQA 3TMEA 4B3RQ 3BZKA 4DR1L 4JI2L 3TSSA 2K03A 4KHVA 1X3PA 1X3GA 3MFYA 2A74C 4A3KH 4R4IA 4E6IA 4ALPA 1Q81C 1CTMA 3W5OA 2XRQD 2KBNA 4KK7A 1EYAA 4DR4Q 4DV0Q 5C4XH 3PIPA 4Q5VA 1PZID 1O7YA 2R7ZB 1VQAA 3ZJYC 2ZXOA 4TRDA 3SXHA 2N88A 5LL6S 2OQKA 4J15A 3IFDA 5COYA 2Y0SE 3QOJA 3S1NH 2LSSA 1CK1A 1SYGA 2A19A 5M3MG 3SE0A 1SFOH 5C3EG 1SYCA 2B2VA 1IL8A 4RKBA 2F0VA 5GAHC 3HP3A 2NVXH 1H9MA 1TY0A 1QILA 4PMCA 2XVSA 4HSPA 5CORA 5M3MH 2KA7A 5FO8B 2C5CA 4NXML 4DKAC 2NN6G 2EJFC 1HCZA 3CAMA 3FHWA 1E24A 2UUBL 2MNAA 2MO0A 2E76C 5M9OA 3R2IA 2F0IA 2PNHA 3SHLA 4OX9L 4FXGC 4DR1Q 1IKLA 1JWUD 1J9OA 4JI5L 1KDAA 2DNEA 4GLVB 4LF5L 4LFAQ 3R93A 3SR1A 4H7BA 2K52A 2K50A 4QCLA 4A3FG 4DV3Q 2LS01 1BKBA 3W1GA 3H0GH 3P75A 2WP8J 3PUYA 3CF5A 1HQMC 4A3IB 4A3LH 3I4NG 3PGZA 3UI2A 1ICWA 1G2TA 3D4DA 4PNYA 5C0XG 3S1QH 4A3MH 2V1CC 4JI2Q 2KUMA 2O5IC 1HR0Q 1PH4A 1XYIA 1EZ8A 5C3XA 4CDCC 5KEEA 4QGUA 5L37A 3HKZE 1TWCB 3U9SA 4RGMA 4NB3A 2BH8A 1QNUA 2UXCL 2B8FA 2WB1E 1JICA 3LX0A 4LF8Q 1WTRA 1GKHA 4RA8A 4NDXA 2MJ8A 1WI5A 4J1MA 1PH6A 2WKDA 1E2ZA 3JAMi 2ZJPA 4IOCA 3JAME 4R1JA 1X6OA 4FDBA 1AH9A 4GN4B 4OWTB 4YWMA 2AUKA 1C48A 4JCVE 1SR3A 4JC0A 4C3IG 4PMBA 5GROA 1QB5D 1N36L 3CQZB 2XWBB 3RLNA 3WWVA 1IL2A 1CUKA 4Z9CB 5HGQA 1XMOL 2F0UA 2VB2X 3S1RB 1VQIA 1KABA 4K5WA 3CP0A 3I4MG 2N78A 1YEZA 1UEAB 1SMYD 5IP7H 5CV5A 2EY2A 3QO2A 5ISRA 4UY8C 1QOHA 4IZ8A 3C1EA 2B29A 1XMQQ 3OYYA 1EU3A 4XQJA 1FNWA 1HTLD 4BWGB 3KYHC 2HQEA 1HFGA 4K2LA 4LW1A 1PRTF 4ZAIA 4CDEC 3AFPA 4IUVA 1EYCA 5IT9E 4FVMA 4HMJA 1JC7A 4ULLA 3M4YA 4DAYB 1K73C 3D6CA 4M8AA 4GOPC 1WTPA 4C56C 1TWAB 2JA5H 3KF8A 1HH2P 2F03A 4NKLA 2M9VA 1JR0D 4RG1A 4ZK9B 2K05A 5HGTA 3E9HA 1CZGA 4DV5Q 2JA6H 2HQLA 4XYQA 1D1IA 2RQXA 4R4QA 4U673 1SFOB 1GVPA 4A3JG 2LXJA 4I7AA 4NPSA 5DAUA 1TKWB 1DOKA 4JBJA 2X6GA 2IX0A 2CFMA 2EXZA 2VXWA 4LF8L 1I4RA 2F0OA 4CDFC 5CC4A 3HOUG 1SE8A 2YTXA 4MTKA 1DZ1A 3FKIH 1B3QA 4HEDA 3CCLA 4DK0A 5JJLA 3HG9A 3I2ZA 3V2TA 2R6GA 1PH9A 4OWXB 3TEHB 2CWPA 2EYMA 1D5ZC 2F0DA 2NB0A 2OEOA 3H0GG 3KBXA 3EROA 2LY7A 5LMNL 2KQ3A 1FVIA 4GN5A 3OTOQ 3J81E 1LTBD 1X56A 1ZXTA 3MXNA 5GADC 1CKOA 1K8OA 1STGA 3KK7A 3SK6A 4ABNA 4F87A 3LWEA 1I3QH 2LFNA 1GUNA 4RGTA 4FYDA 1EFID 2B2YC 4JW0A 4JI8L 3KJOA 1JE4A 1JWMD 2L4NA 2EDGA 4QF4A 1KDCA 3TREA 3A0JA 1H9KA 1WTXA 3E0EA 2NVQB 2KCCA 1K3BC 1H95A 4QIWB 5DLQE 2CW0D 3A55A 4OO1G 2PMZB 2H1EA 5FO7B 4N9PA 5JEAJ 5K5PA 5D3IB 1FR3A 4XYOA 2RSNA 1Y8PB 1N33Q 3NSWA 3D8GA 3M7GA 4GOPA 4A3GG 2KHJA 3VDYA 1E2WA 2JXMB 3MXUA 1PH7A 4DR7Q 2E5LQ 4B9XA 3ERSX 1IYUA 1HRJA 2F0EA 3L3OC 5EPLA 3NQTA 2C35B 3MZ5A 2NWGA 3H6MA 1XNQQ 3EA6A 4DR3L 4LF6Q 3K59A 3GO5A 2A68D 1E7ZA 1MHWC 4ZQ3A 4LF4L 4K0KQ 3CXCA 3RZOB 1IYVA 2AQ3B 5CBEE 4LAAA 4PZ6A 1XJVA 4C3JB 3TS0A 1JOQA 1K3RA 1Q3LA 4IUQA 5AJ3Q 2AUJD 2CKZB 3Q6SA 4MHEA 5IYBH 3EFXD 1Y1WB 4X62Q 3WDNA 2NVTB 1SJHD 3G7LA 2JA8H 3S24A 4YWLA 3PUWA 1PYBA 2A6HD 4L63B 3NELA 3SEBA 1ONLA 1EEID 5E3FA 3DLLA 1JJGA 3GTQH 4DV5L 1ML0D 2ZJRA 5C0XH 4QIWE 1C0AA 1DD2A 3M85A 4LF7L 4HN7A 2TSSA 4KKUA 2JA7B 3PO3B 3Q23A 1NR4A 2IHEA 3RN5A 1HNZL 4TSSA 3T51B 4X3UA 5AJ3L 2R3ZA 3OHXC 5ELFA 3GTGB 2JA5B 3HOYH 4YCWA 1K83H 1BOSA 4KN4C 5C4HA 5C4JH 2F0QA 3K5NA 4KD4A 4BBSG 1PTOB 4L8JA 4OIKA 4POFA 3S14B 4GKKL 2ZXRA 2KJXA 1QE6A 1Y14B 1OXSC 2BA0A 2Z6KA 3NBIA 1PTOC 3QOLA 4RHRA 1CKMA 1HQRD 1MSGA 3PMFA 3U50C 1VS0A 4C3HG 1A8VA 1YNJC 4V0BA 1ENFA 2K6AA 1SNOA 3HOUH 3DM1A 4K5VA 2CW0C 5HY6A 1TIID 3H3VI 1U4MA 3FP9A 2MO1A 5C4XB 3RNUA 1X32A 5D65A 4A3EG 2L1BA 1IKMA 4ZUIA 5M3MB 3L7ZC
chains in the Genus database with same CATH topology
2JK8A 3JAMc 2UUAQ 2ALYB 2RF4A 2Q2HA 4BY1H 3AFQA 2XTIA 3G6EA 1UE7A 5C4XG 1Q7YC 4IPHA 2OWOA 2GN5A 1FL0A 2GVBA 4TQUS 3RR5A 5LMUQ 4DUYL 2K14A 4JI6L 1PHJA 1Q46A 2E8GA 3E9IA 1V9PA 2ZM6L 3HOZH 4JBKA 2OQ0A 4X65L 1FGUA 3HOVH 3I55A 4HJ7A 1VQ8A 1EWIA 5C44G 1QUQB 2AHOB 4OXPA 2E2HH 4K0KL 3S2HH 3PIOA 2JA5G 4GLXA 4BBRH 4X66Q 2VZAA 4DK6C 2PMZE 2D0OA 1NMFA 1OXUA 4A3KG 4HIOA 4LNQA 1VQGA 3UDIA 5IP9G 1VQ9A 4JI1Q 2R7FA 2QGQA 4A3BG 2NZHA 2K5NA 3TS2A 4QQBX 2NZOA 1QVGA 4NXMQ 4YCVA 4HJ5A 2LXKA 2OTLA 2R93H 1WJJA 5BR8L 2F3IA 1EIYB 4GNXB 1EUJA 3BJUA 1YHBA 2MFIA 1IXRA 1IZ6A 3EBEA 1UE1A 4JOIA 1L0WA 1WFQA 2AWNA 3G71A 2Q2UA 4DUYQ 4LUZA 4A3LG 1PA6A 1RL2A 2VY3A 1HNXL 1SROA 1NTGA 3JC66 5J3BA 3RN2A 4HJ8A 5IY0A 1YJNA 1UWVA 1IBML 4BXXG 3HFZB 1ASZA 4JYAL 3W1BA 3CC7A 1YITA 2NVTH 4KLKA 4R4CA 3A5UA 1YHQA 2JJQA 4A93G 3CCVA 4B3RQ 3BZKA 4DR1L 4JI2L 1XPUA 4BBRG 2UXCQ 3GDEA 3CCQA 3I4MH 2VQEL 1X3GA 4A3KH 1JE5A 3CD6A 4DUZL 4GLAC 3KF6B 4R4IA 4ALPA 4IJLA 3UE1A 3KFUA 1Q81C 2PQAA 3I4OA 2HHHQ 3W5OA 3HOZG 1JT8A 3CCJA 2UUCL 1L1OB 2KBNA 4GS3A 4DR4Q 3A74A 4DV0Q 5C4XH 1GM5A 1N32Q 3K81C 1QUQA 4P73A 3PIPA 4JI7L 1I50H 2VL6A 4LF9L 3J7ZC 1TWAH 1D8LA 1VQAA 1TWGH 1WCMG 3ZJYC 4MTNA 4LF6L 4WJ4A 2OQKA 2B63G 4GOPB 2VNUD 4J15A 5IWAQ 4DV7Q 2CWAA 2Y0SE 4B3RL 1K9MC 3S1NH 3UDXA 2LSSA 3G4SA 2QA4A 3M4PA 2A19A 5M3MG 4GNXA 4UP7A 2K75A 1SFOH 1PVOA 5M5WH 1YI2A 1X3FA 1HZCA 5C3EG 4GNXC 4DK3C 2UU9Q 2ZJQA 1NMGA 3ULJA 2Q2TA 3HOWG 5EAYA 4DR2Q 4WJ3M 5GAHC 1RIPA 3U4ZA 2NVXH 2AKWB 1K8GA 2I5MX 4JI0L 2IY5B 5M3MH 4DR4L 1N33L 3GD7A 3PO2G 1M90C 4JI4Q 2GVAA 2BH2A 1FJGQ 4NXML 4DKAC 5LMNW 2NN6G 1MIUA 3I4NH 5LMUL 3CAMA 3GTJH 2WAQG 1VQ7A 1TWFH 2YU9H 2JA6G 4IO9A 4KHPQ 2B3GA 3FHWA 4LFCQ 1OXTA 3OW2A 1E24A 2UUBL 2MNAA 2MO0A 3CCUA 2EIFA 4JYAQ 1YHAA 4IOAA 1HNZQ 4POGA 3L0OA 1TXYA 1BVSA 1Z9FA 4A3FH 5IT9c 2PNHA 1IYJB 1XMOQ 3BZCA 2VQEQ 4OX9L 3HOXG 5GAGC 3T1HQ 1T9HA 4GN3B 5FLMH 3BU2A 4PG3A 4DR1Q 2EQSA 1E22A 2KCTA 3M4OH 2JA9A 4OO1I 4APVA 2BA1A 4JI5L 4JI8Q 3RZDH 4GLVB 1N9WA 2PI2A 4P72A 1KRTA 4LF5L 4LFAQ 2HT1A 1VQFA 3H3VH 1CSPA 2Y0SG 4AYBE 1I5FA 4NXNQ 2K52A 2K50A 1PH1A 2UXDQ 4HIKA 4A3FG 4DPGA 4X62L 2KHIA 4C2MH 3K7AH 4DV3Q 1BKBA 3L2PA 2ASBA 5M5YH 3W1GA 3CC2A 2MQHA 2IHFA 1SLJA 3H0GH 3KLWA 3UE0A 3CW2C 1VQMA 1EYGA 3PSIA 4LUOA 3EIVA 2WP8J 2I5HA 3PUYA 3CF5A 4LF9Q 4A3LH 1GO3E 3PGZA 1JB7A 3I4NG 2FXQA 1HNWQ 3I56A 3EN2A 5IP7G 5C0XG 3S1QH 4UPAA 4A3MH 1CSQA 2R7ZH 2V1CC 4IJHA 4JI2Q 4X6AH 5K36G 2JE6I 2Z6KC 3PO2H 1L1OA 1HR0Q 1PH4A 3DM3A 3STBD 2I0QA 3CCEA 2UU9L 3A5ZB 4QGUA 1AE3A 4BY7G 3HKZE 2YTYA 1B8AA 2QEXA 2NVQH 4NB3A 4A3DG 2BH8A 1EIFA 4A75A 3S2DH 2UXCL 3CPWA 3F2CA 4X64L 2WB1E 1KHIA 3CCSA 1JMCA 1PV4A 1VQNA 4DV2Q 4LF8Q 3GTKH 3PF4A 1GKHA 3GTPH 2WB1G 1UE5A 3J80i 4L5SA 4A3IH 4QJFA 1WI5A 1XTDA 1TWHH 4AH6A 1WYDA 2ZTCA 1PH6A 1MKHA 3TRZA 4B3MQ 3JAMi 2ZJPA 4IOCA 2WAQE 1Q82C 4R1JA 4BY1G 1X6OA 4FDBA 1SRUA 4JI7Q 1AH9A 4GN4B 4OWTB 1WCMH 3KDFA 1CKNA 4YWMA 2VQFL 4DV4L 4KHPL 4IFDJ 1UE6A 3STBC 4AYBG 3J81c 1VQEA 3KF8B 4LF4Q 4A3IG 4JCVE 1SR3A 4JC0A 5GROA 1N36L 1J6QA 2CCZA 3J7A5 3RLNA 3WWVA 1IL2A 1CUKA 1VQHA 4JI0Q 1K8AC 2R92G 5HGQA 1Q1BA 4Y7NH 4A3GH 1OXXK 1XMOL 1IBLL 4X64Q 4OX9Q 3T1HL 3F1ZA 1VQIA 3AQQA 1YVCA 3CP0A 4NXNL 4YY3L 4AQYL 3I4MG 2N78A 2UXDL 5FLXc 1G291 4IFDG 1YEZA 2L15A 1VQ5A 2ES2A 4MZ9A 4A3MG 1QZGA 3NEMA 4PZ7A 2R7ZG 1NY4A 4DAMA 1O7IA 5IP7H 4KI0A 1Y1WH 1XNRQ 5IYDG 4UY8C 1LYLA 4LFBQ 1Q1EA 2B29A 1PH8A 3ULLA 4AIMA 1XMQQ 3OYYA 4P71A 1VQDA 3K0XA 1XNQL 3B6YA 4MNOA 3KYHC 3OTOL 3GTGH 5IYDH 1HR0L 3PO3G 5IWAL 4DV7L 2R93G 4RMFA 1L2FA 4LW1A 4IPGA 4BBSH 3AFPA 3GTOH 2ZTEA 2VS1A 4YCUA 4QY7A 1M1KC 4A3BH 5FLMG 4LFAL 2D0PA 1XPRA 3D31A 4DR6L 1VQBA 4DAYB 1IBKQ 2IT1A 1Q86C 2R92H 1U0LA 1K73C 1KC8C 4DNIA 3GTMH 2ZTDA 4GOPC 2XGTA 5C0XJ 2JA5H 4XIGS 1HH2P 1XNRL 4P75A 1LM0A 3K80C 2I5LX 4LF5Q 4RG1A 2R7DA 1ASYA 2RHSB 1YBYA 1N32L 1SN8A 3S16H 3E9HA 4OWWB 4DV5Q 4LUVA 5IYCH 1VCIA 4DV1L 2JA6H 1GD7A 3K8AA 2HQLA 3PUVA 1S40A 4IPDA 3S14H 3CQZH 1KXLA 4L5TA 2N3SA 4R4QA 3KF6A 1GVPA 1HNWL 1N36Q 4A3JG 1BBWA 5M3FH 1S3OA 5LMNQ 2LXJA 4OONA 4NPSA 3PUXA 1SMXA 4A3EH 1R9TH 4JBJA 1IBKL 1IBLQ 4A3CH 5GAEC 4BA2I 2IX0A 2CFMA 4DV2L 4LF8L 4LWCA 4A3DH 2ID0A 2F4VQ 1SE8A 3G48A 2A8VA 3HOUG 2YTXA 4A3CG 1A0IA 3FKIH 2AMCB 3CCLA 2CQOA 1NBWA 1QVCA 3T1YQ 4A3JH 5JJLA 2B63H 3CPFA 2E2IH 4DV3L 3I2ZA 2VQFQ 1X9NA 2R6GA 1EOVA 1PH9A 1HNXQ 2DGYA 4OWXB 3NENA 3TEHB 2A1AA 5FJ8H 4C3HH 2CWPA 4DR5Q 2HHHL 2VUMH 1HZ9A 4LFBL 2N8NA 3CCRA 3UDGA 1EQRA 1KL9A 5IYCG 3H0GG 4JI3Q 1I6HH 5LMNL 3M3YH 3MEFA 1FVIA 4GN5A 3OTOQ 5GQOA 4A76A 4DV6L 2E2JH 3RLFA 1X56A 4GKJL 5GADC 1CKOA 2N49A 1KD1C 4YHHL 3HOYG 1I3QH 4UP9A 1V43A 1MJEA 4JI8L 3F2DA 3KJOA 1I94Q 4BXXH 3CCMA 1W3SA 4YY3Q 4YWKA 4HIDA 4DR2L 1TWCH 1YNXA 3TREA 1JJ2A 1Z47A 2UXBL 3PO3H 1A62A 4GKKQ 2DUDA 3A0JA 1HZAA 4EX5A 1N34L 2UUAL 5M5XH 1E1OA 3F2BA 4B3SQ 2PQAB 1D7QA 1KIXA 1FJGL 3CC4A 3AYHB 3GTLH 4LF7Q 3E0EA 2YTVA 2EXDA 3KJPA 1H95A 5DLQE 4PMWA 5IE8A 3IRBA 4GKJQ 4P74A 1Y1WG 4OO1G 5IP9H 5JJKA 4X65Q 2UUBQ 1QZHA 3NBHB 5JEAJ 2F4VL 1LUZA 5IYBG 4JV5L 1L1OC 1N33Q 1C9OA 3LGJA 3HKZG 1VQPA 4JBMA 3M7NA 4L5QA 4GOPA 2F52A 3HOVG 3CMAA 2IX1A 4DR6Q 4A3GG 2KHJA 3VDYA 1PH7A 4ME3A 3T1YL 2E5LQ 4H02A 4DR7Q 4DV0L 1X3EA 2K5VA 3ERSX 4LFCL 3RLOA 2JA7G 4IFDI 1X55A 1J5EL 5JEAG 1K0RA 1VQLA 2K5HA 4B3ML 2C35B 2ATWA 4QL5A 1KQSA 2OTJA 1XNQQ 2KCMA 5ELNA 4DV4Q 4DR3L 3Q8DA 4LF6Q 2VUMG 3J81j 4B3TQ 3GO5A 4DV6Q 1Q12A 3I7FA 5H1SE 1VQCA 1E7ZA 1P8LA 2D62A 4LF4L 4K0KQ 3CXCA 2Z0SA 5ELOA 2JA7H 2KENA 1JJCB 4O2DA 1HZBA 4BA1I 4PZ6A 1XJVA 4R4OA 3M9BA 1DGSA 4O0AA 4IPCA 3TS0A 1K3RA 1NJIC 3S15H 5AJ3Q 2CKZB 1KAWA 5IYBH 1G6PA 4X62Q 1N8RC 4A4IA 1HJPA 4JBWA 2JA8H 3S24A 1OTCA 3J80c 4A93H 1E1TA 4YWLA 4BY7H 1UEBA 1CKNB 4DR5L 3PUWA 1PYBA 1I94L 3U4VA 5M3FG 3ICEA 2NVYH 3NELA 1B7YB 4XTCS 3S1RH 1Q8KA 3DLLA 1XPOA 1JJGA 3MXNB 1VQ4A 4B3SL 3GTQH 4DV5L 2HIXA 1S72A 2ZJRA 4DR3Q 4QIWE 1AE2A 4B3TL 3M85A 1C0AA 4LF7L 1PH5A 5BR8Q 4JI6Q 2PI2E 1Y1VG 2NN6I 4KHZA 2ZM6Q 1PH3A 1X54A 4C3JH 2IHEA 3RN5A 1YJ9A 4JI3L 1HNZL 2Q2IA 1W2BA 1PFSA 2RHQB 2JEAI 5JJIA 5C0XI 5AJ3L 3D0FA 4R4TA 4EQ5A 1PH2A 1PYSB 1YIJA 3HOYH 1LTLA 2UXBQ 1VQOA 1MJCA 1A63A 3RZOH 1NE3A 4YCWA 1K83H 4JI5Q 4L5RC 2H5XA 1VQJA 5C4JH 3TQYA 3UDFA 4UP8A 5C44H 3HOXH 2UUCQ 3AEVA 4BBSG 1VQ6A 3K7UC 4POFA 4GKKL 4JI4L 2AWOA 2K4KA 4AQYQ 1Y14B 1P16A 2E5LL 1OXSC 1EQQA 1OXVA 2Z6KA 2BA0A 1Y1VH 2RCNA 1U5KA 2HIVA 2JQOA 1J5EQ 1C7YA 4Y52H 1CKMA 4DV1Q 3ER0A 5FJ8G 1WOCA 2JEBI 1N34Q 3ULPA 1YJWA 1X65A 4TVAB 3SGIA 5E7NA 3U50C 3H15A 3U58A 2OCEA 1IBMQ 1VQKA 1VS0A 4JV5Q 1A8VA 4JOIC 2JA8G 1EFWA 1G51A 3F8TA 4JG2A 1BBUA 3FKIG 3PV0A 4PZ8A 3PCOB 1YZ6A 3KOJA 4YHHQ 4HIMA 3KDFB 3HOUH 2VW9A 5C3EH 3S1MH 3CMEA 1V1QA 4HJAA 5HY6A 3PF5A 1QVFA 3S17H 4DR7L 1B70B 3PUZA 3H3VI 3HOWH 4X66L 3FP9A 3J81i 2MO1A 4DUZQ 3RNUA 4HJ9A 1XMQL 1E3PA 4JI1L 4C3IH 4A3EG 2YV5A 1KRSA 3HKSA 2WFWA 2YYZA 1HR0W 3M4QA 3L7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JK8 A;  3JAM c;  2UUA Q;  2ALY B;  2RF4 A;  2Q2H A;  4BY1 H;  3AFQ A;  2XTI A;  3G6E A;  1UE7 A;  5C4X G;  1Q7Y C;  4IPH A;  2OWO A;  2GN5 A;  1FL0 A;  2GVB A;  4TQU S;  3RR5 A;  5LMU Q;  4DUY L;  2K14 A;  4JI6 L;  1PHJ A;  1Q46 A;  2E8G A;  3E9I A;  1V9P A;  2ZM6 L;  3HOZ H;  4JBK A;  2OQ0 A;  4X65 L;  1FGU A;  3HOV H;  3I55 A;  4HJ7 A;  1VQ8 A;  1EWI A;  5C44 G;  1QUQ B;  2AHO B;  4OXP A;  2E2H H;  4K0K L;  3S2H H;  3PIO A;  2JA5 G;  4GLX A;  4BBR H;  4X66 Q;  2VZA A;  4DK6 C;  2PMZ E;  2D0O A;  1NMF A;  1OXU A;  4A3K G;  4HIO A;  4LNQ A;  1VQG A;  3UDI A;  5IP9 G;  1VQ9 A;  4JI1 Q;  2R7F A;  2QGQ A;  4A3B G;  2NZH A;  2K5N A;  3TS2 A;  4QQB X;  2NZO A;  1QVG A;  4NXM Q;  4YCV A;  4HJ5 A;  2LXK A;  2OTL A;  2R93 H;  1WJJ A;  5BR8 L;  2F3I A;  1EIY B;  4GNX B;  1EUJ A;  3BJU A;  1YHB A;  2MFI A;  1IXR A;  1IZ6 A;  3EBE A;  1UE1 A;  4JOI A;  1L0W A;  1WFQ A;  2AWN A;  3G71 A;  2Q2U A;  4DUY Q;  4LUZ A;  4A3L G;  1PA6 A;  1RL2 A;  2VY3 A;  1HNX L;  1SRO A;  1NTG A;  3JC6 6;  5J3B A;  3RN2 A;  4HJ8 A;  5IY0 A;  1YJN A;  1UWV A;  1IBM L;  4BXX G;  3HFZ B;  1ASZ A;  4JYA L;  3W1B A;  3CC7 A;  1YIT A;  2NVT H;  4KLK A;  4R4C A;  3A5U A;  1YHQ A;  2JJQ A;  4A93 G;  3CCV A;  4B3R Q;  3BZK A;  4DR1 L;  4JI2 L;  1XPU A;  4BBR G;  2UXC Q;  3GDE A;  3CCQ A;  3I4M H;  2VQE L;  1X3G A;  4A3K H;  1JE5 A;  3CD6 A;  4DUZ L;  4GLA C;  3KF6 B;  4R4I A;  4ALP A;  4IJL A;  3UE1 A;  3KFU A;  1Q81 C;  2PQA A;  3I4O A;  2HHH Q;  3W5O A;  3HOZ G;  1JT8 A;  3CCJ A;  2UUC L;  1L1O B;  2KBN A;  4GS3 A;  4DR4 Q;  3A74 A;  4DV0 Q;  5C4X H;  1GM5 A;  1N32 Q;  3K81 C;  1QUQ A;  4P73 A;  3PIP A;  4JI7 L;  1I50 H;  2VL6 A;  4LF9 L;  3J7Z C;  1TWA H;  1D8L A;  1VQA A;  1TWG H;  1WCM G;  3ZJY C;  4MTN A;  4LF6 L;  4WJ4 A;  2OQK A;  2B63 G;  4GOP B;  2VNU D;  4J15 A;  5IWA Q;  4DV7 Q;  2CWA A;  2Y0S E;  4B3R L;  1K9M C;  3S1N H;  3UDX A;  2LSS A;  3G4S A;  2QA4 A;  3M4P A;  2A19 A;  5M3M G;  4GNX A;  4UP7 A;  2K75 A;  1SFO H;  1PVO A;  5M5W H;  1YI2 A;  1X3F A;  1HZC A;  5C3E G;  4GNX C;  4DK3 C;  2UU9 Q;  2ZJQ A;  1NMG A;  3ULJ A;  2Q2T A;  3HOW G;  5EAY A;  4DR2 Q;  4WJ3 M;  5GAH C;  1RIP A;  3U4Z A;  2NVX H;  2AKW B;  1K8G A;  2I5M X;  4JI0 L;  2IY5 B;  5M3M H;  4DR4 L;  1N33 L;  3GD7 A;  3PO2 G;  1M90 C;  4JI4 Q;  2GVA A;  2BH2 A;  1FJG Q;  4NXM L;  4DKA C;  5LMN W;  2NN6 G;  1MIU A;  3I4N H;  5LMU L;  3CAM A;  3GTJ H;  2WAQ G;  1VQ7 A;  1TWF H;  2YU9 H;  2JA6 G;  4IO9 A;  4KHP Q;  2B3G A;  3FHW A;  4LFC Q;  1OXT A;  3OW2 A;  1E24 A;  2UUB L;  2MNA A;  2MO0 A;  3CCU A;  2EIF A;  4JYA Q;  1YHA A;  4IOA A;  1HNZ Q;  4POG A;  3L0O A;  1TXY A;  1BVS A;  1Z9F A;  4A3F H;  5IT9 c;  2PNH A;  1IYJ B;  1XMO Q;  3BZC A;  2VQE Q;  4OX9 L;  3HOX G;  5GAG C;  3T1H Q;  1T9H A;  4GN3 B;  5FLM H;  3BU2 A;  4PG3 A;  4DR1 Q;  2EQS A;  1E22 A;  2KCT A;  3M4O H;  2JA9 A;  4OO1 I;  4APV A;  2BA1 A;  4JI5 L;  4JI8 Q;  3RZD H;  4GLV B;  1N9W A;  2PI2 A;  4P72 A;  1KRT A;  4LF5 L;  4LFA Q;  2HT1 A;  1VQF A;  3H3V H;  1CSP A;  2Y0S G;  4AYB E;  1I5F A;  4NXN Q;  2K52 A;  2K50 A;  1PH1 A;  2UXD Q;  4HIK A;  4A3F G;  4DPG A;  4X62 L;  2KHI A;  4C2M H;  3K7A H;  4DV3 Q;  1BKB A;  3L2P A;  2ASB A;  5M5Y H;  3W1G A;  3CC2 A;  2MQH A;  2IHF A;  1SLJ A;  3H0G H;  3KLW A;  3UE0 A;  3CW2 C;  1VQM A;  1EYG A;  3PSI A;  4LUO A;  3EIV A;  2WP8 J;  2I5H A;  3PUY A;  3CF5 A;  4LF9 Q;  4A3L H;  1GO3 E;  3PGZ A;  1JB7 A;  3I4N G;  2FXQ A;  1HNW Q;  3I56 A;  3EN2 A;  5IP7 G;  5C0X G;  3S1Q H;  4UPA A;  4A3M H;  1CSQ A;  2R7Z H;  2V1C C;  4IJH A;  4JI2 Q;  4X6A H;  5K36 G;  2JE6 I;  2Z6K C;  3PO2 H;  1L1O A;  1HR0 Q;  1PH4 A;  3DM3 A;  3STB D;  2I0Q A;  3CCE A;  2UU9 L;  3A5Z B;  4QGU A;  1AE3 A;  4BY7 G;  3HKZ E;  2YTY A;  1B8A A;  2QEX A;  2NVQ H;  4NB3 A;  4A3D G;  2BH8 A;  1EIF A;  4A75 A;  3S2D H;  2UXC L;  3CPW A;  3F2C A;  4X64 L;  2WB1 E;  1KHI A;  3CCS A;  1JMC A;  1PV4 A;  1VQN A;  4DV2 Q;  4LF8 Q;  3GTK H;  3PF4 A;  1GKH A;  3GTP H;  2WB1 G;  1UE5 A;  3J80 i;  4L5S A;  4A3I H;  4QJF A;  1WI5 A;  1XTD A;  1TWH H;  4AH6 A;  1WYD A;  2ZTC A;  1PH6 A;  1MKH A;  3TRZ A;  4B3M Q;  3JAM i;  2ZJP A;  4IOC A;  2WAQ E;  1Q82 C;  4R1J A;  4BY1 G;  1X6O A;  4FDB A;  1SRU A;  4JI7 Q;  1AH9 A;  4GN4 B;  4OWT B;  1WCM H;  3KDF A;  1CKN A;  4YWM A;  2VQF L;  4DV4 L;  4KHP L;  4IFD J;  1UE6 A;  3STB C;  4AYB G;  3J81 c;  1VQE A;  3KF8 B;  4LF4 Q;  4A3I G;  4JCV E;  1SR3 A;  4JC0 A;  5GRO A;  1N36 L;  1J6Q A;  2CCZ A;  3J7A 5;  3RLN A;  3WWV A;  1IL2 A;  1CUK A;  1VQH A;  4JI0 Q;  1K8A C;  2R92 G;  5HGQ A;  1Q1B A;  4Y7N H;  4A3G H;  1OXX K;  1XMO L;  1IBL L;  4X64 Q;  4OX9 Q;  3T1H L;  3F1Z A;  1VQI A;  3AQQ A;  1YVC A;  3CP0 A;  4NXN L;  4YY3 L;  4AQY L;  3I4M G;  2N78 A;  2UXD L;  5FLX c;  1G29 1;  4IFD G;  1YEZ A;  2L15 A;  1VQ5 A;  2ES2 A;  4MZ9 A;  4A3M G;  1QZG A;  3NEM A;  4PZ7 A;  2R7Z G;  1NY4 A;  4DAM A;  1O7I A;  5IP7 H;  4KI0 A;  1Y1W H;  1XNR Q;  5IYD G;  4UY8 C;  1LYL A;  4LFB Q;  1Q1E A;  2B29 A;  1PH8 A;  3ULL A;  4AIM A;  1XMQ Q;  3OYY A;  4P71 A;  1VQD A;  3K0X A;  1XNQ L;  3B6Y A;  4MNO A;  3KYH C;  3OTO L;  3GTG H;  5IYD H;  1HR0 L;  3PO3 G;  5IWA L;  4DV7 L;  2R93 G;  4RMF A;  1L2F A;  4LW1 A;  4IPG A;  4BBS H;  3AFP A;  3GTO H;  2ZTE A;  2VS1 A;  4YCU A;  4QY7 A;  1M1K C;  4A3B H;  5FLM G;  4LFA L;  2D0P A;  1XPR A;  3D31 A;  4DR6 L;  1VQB A;  4DAY B;  1IBK Q;  2IT1 A;  1Q86 C;  2R92 H;  1U0L A;  1K73 C;  1KC8 C;  4DNI A;  3GTM H;  2ZTD A;  4GOP C;  2XGT A;  5C0X J;  2JA5 H;  4XIG S;  1HH2 P;  1XNR L;  4P75 A;  1LM0 A;  3K80 C;  2I5L X;  4LF5 Q;  4RG1 A;  2R7D A;  1ASY A;  2RHS B;  1YBY A;  1N32 L;  1SN8 A;  3S16 H;  3E9H A;  4OWW B;  4DV5 Q;  4LUV A;  5IYC H;  1VCI A;  4DV1 L;  2JA6 H;  1GD7 A;  3K8A A;  2HQL A;  3PUV A;  1S40 A;  4IPD A;  3S14 H;  3CQZ H;  1KXL A;  4L5T A;  2N3S A;  4R4Q A;  3KF6 A;  1GVP A;  1HNW L;  1N36 Q;  4A3J G;  1BBW A;  5M3F H;  1S3O A;  5LMN Q;  2LXJ A;  4OON A;  4NPS A;  3PUX A;  1SMX A;  4A3E H;  1R9T H;  4JBJ A;  1IBK L;  1IBL Q;  4A3C H;  5GAE C;  4BA2 I;  2IX0 A;  2CFM A;  4DV2 L;  4LF8 L;  4LWC A;  4A3D H;  2ID0 A;  2F4V Q;  1SE8 A;  3G48 A;  2A8V A;  3HOU G;  2YTX A;  4A3C G;  1A0I A;  3FKI H;  2AMC B;  3CCL A;  2CQO A;  1NBW A;  1QVC A;  3T1Y Q;  4A3J H;  5JJL A;  2B63 H;  3CPF A;  2E2I H;  4DV3 L;  3I2Z A;  2VQF Q;  1X9N A;  2R6G A;  1EOV A;  1PH9 A;  1HNX Q;  2DGY A;  4OWX B;  3NEN A;  3TEH B;  2A1A A;  5FJ8 H;  4C3H H;  2CWP A;  4DR5 Q;  2HHH L;  2VUM H;  1HZ9 A;  4LFB L;  2N8N A;  3CCR A;  3UDG A;  1EQR A;  1KL9 A;  5IYC G;  3H0G G;  4JI3 Q;  1I6H H;  5LMN L;  3M3Y H;  3MEF A;  1FVI A;  4GN5 A;  3OTO Q;  5GQO A;  4A76 A;  4DV6 L;  2E2J H;  3RLF A;  1X56 A;  4GKJ L;  5GAD C;  1CKO A;  2N49 A;  1KD1 C;  4YHH L;  3HOY G;  1I3Q H;  4UP9 A;  1V43 A;  1MJE A;  4JI8 L;  3F2D A;  3KJO A;  1I94 Q;  4BXX H;  3CCM A;  1W3S A;  4YY3 Q;  4YWK A;  4HID A;  4DR2 L;  1TWC H;  1YNX A;  3TRE A;  1JJ2 A;  1Z47 A;  2UXB L;  3PO3 H;  1A62 A;  4GKK Q;  2DUD A;  3A0J A;  1HZA A;  4EX5 A;  1N34 L;  2UUA L;  5M5X H;  1E1O A;  3F2B A;  4B3S Q;  2PQA B;  1D7Q A;  1KIX A;  1FJG L;  3CC4 A;  3AYH B;  3GTL H;  4LF7 Q;  3E0E A;  2YTV A;  2EXD A;  3KJP A;  1H95 A;  5DLQ E;  4PMW A;  5IE8 A;  3IRB A;  4GKJ Q;  4P74 A;  1Y1W G;  4OO1 G;  5IP9 H;  5JJK A;  4X65 Q;  2UUB Q;  1QZH A;  3NBH B;  5JEA J;  2F4V L;  1LUZ A;  5IYB G;  4JV5 L;  1L1O C;  1N33 Q;  1C9O A;  3LGJ A;  3HKZ G;  1VQP A;  4JBM A;  3M7N A;  4L5Q A;  4GOP A;  2F52 A;  3HOV G;  3CMA A;  2IX1 A;  4DR6 Q;  4A3G G;  2KHJ A;  3VDY A;  1PH7 A;  4ME3 A;  3T1Y L;  2E5L Q;  4H02 A;  4DR7 Q;  4DV0 L;  1X3E A;  2K5V A;  3ERS X;  4LFC L;  3RLO A;  2JA7 G;  4IFD I;  1X55 A;  1J5E L;  5JEA G;  1K0R A;  1VQL A;  2K5H A;  4B3M L;  2C35 B;  2ATW A;  4QL5 A;  1KQS A;  2OTJ A;  1XNQ Q;  2KCM A;  5ELN A;  4DV4 Q;  4DR3 L;  3Q8D A;  4LF6 Q;  2VUM G;  3J81 j;  4B3T Q;  3GO5 A;  4DV6 Q;  1Q12 A;  3I7F A;  5H1S E;  1VQC A;  1E7Z A;  1P8L A;  2D62 A;  4LF4 L;  4K0K Q;  3CXC A;  2Z0S A;  5ELO A;  2JA7 H;  2KEN A;  1JJC B;  4O2D A;  1HZB A;  4BA1 I;  4PZ6 A;  1XJV A;  4R4O A;  3M9B A;  1DGS A;  4O0A A;  4IPC A;  3TS0 A;  1K3R A;  1NJI C;  3S15 H;  5AJ3 Q;  2CKZ B;  1KAW A;  5IYB H;  1G6P A;  4X62 Q;  1N8R C;  4A4I A;  1HJP A;  4JBW A;  2JA8 H;  3S24 A;  1OTC A;  3J80 c;  4A93 H;  1E1T A;  4YWL A;  4BY7 H;  1UEB A;  1CKN B;  4DR5 L;  3PUW A;  1PYB A;  1I94 L;  3U4V A;  5M3F G;  3ICE A;  2NVY H;  3NEL A;  1B7Y B;  4XTC S;  3S1R H;  1Q8K A;  3DLL A;  1XPO A;  1JJG A;  3MXN B;  1VQ4 A;  4B3S L;  3GTQ H;  4DV5 L;  2HIX A;  1S72 A;  2ZJR A;  4DR3 Q;  4QIW E;  1AE2 A;  4B3T L;  3M85 A;  1C0A A;  4LF7 L;  1PH5 A;  5BR8 Q;  4JI6 Q;  2PI2 E;  1Y1V G;  2NN6 I;  4KHZ A;  2ZM6 Q;  1PH3 A;  1X54 A;  4C3J H;  2IHE A;  3RN5 A;  1YJ9 A;  4JI3 L;  1HNZ L;  2Q2I A;  1W2B A;  1PFS A;  2RHQ B;  2JEA I;  5JJI A;  5C0X I;  5AJ3 L;  3D0F A;  4R4T A;  4EQ5 A;  1PH2 A;  1PYS B;  1YIJ A;  3HOY H;  1LTL A;  2UXB Q;  1VQO A;  1MJC A;  1A63 A;  3RZO H;  1NE3 A;  4YCW A;  1K83 H;  4JI5 Q;  4L5R C;  2H5X A;  1VQJ A;  5C4J H;  3TQY A;  3UDF A;  4UP8 A;  5C44 H;  3HOX H;  2UUC Q;  3AEV A;  4BBS G;  1VQ6 A;  3K7U C;  4POF A;  4GKK L;  4JI4 L;  2AWO A;  2K4K A;  4AQY Q;  1Y14 B;  1P16 A;  2E5L L;  1OXS C;  1EQQ A;  1OXV A;  2Z6K A;  2BA0 A;  1Y1V H;  2RCN A;  1U5K A;  2HIV A;  2JQO A;  1J5E Q;  1C7Y A;  4Y52 H;  1CKM A;  4DV1 Q;  3ER0 A;  5FJ8 G;  1WOC A;  2JEB I;  1N34 Q;  3ULP A;  1YJW A;  1X65 A;  4TVA B;  3SGI A;  5E7N A;  3U50 C;  3H15 A;  3U58 A;  2OCE A;  1IBM Q;  1VQK A;  1VS0 A;  4JV5 Q;  1A8V A;  4JOI C;  2JA8 G;  1EFW A;  1G51 A;  3F8T A;  4JG2 A;  1BBU A;  3FKI G;  3PV0 A;  4PZ8 A;  3PCO B;  1YZ6 A;  3KOJ A;  4YHH Q;  4HIM A;  3KDF B;  3HOU H;  2VW9 A;  5C3E H;  3S1M H;  3CME A;  1V1Q A;  4HJA A;  5HY6 A;  3PF5 A;  1QVF A;  3S17 H;  4DR7 L;  1B70 B;  3PUZ A;  3H3V I;  3HOW H;  4X66 L;  3FP9 A;  3J81 i;  2MO1 A;  4DUZ Q;  3RNU A;  4HJ9 A;  1XMQ L;  1E3P A;  4JI1 L;  4C3I H;  4A3E G;  2YV5 A;  1KRS A;  3HKS A;  2WFW A;  2YYZ A;  1HR0 W;  3M4Q A;  3L7Z C; 
#chains in the Genus database with same CATH topology
 4G4K A;  3AFQ A;  5M5W B;  2OWO A;  3ZYY X;  1FL0 A;  4TQU S;  3R8B A;  3RUZ A;  2K14 A;  4CBV A;  3HOZ H;  3E9I A;  3NWT A;  4JBK A;  2OQ0 A;  4X65 L;  1ENC A;  2EYL A;  5C44 G;  3VR6 A;  5E4W C;  3C2P A;  1JOR A;  3BYY B;  2PMZ E;  4DK6 C;  2D0O A;  4LNQ A;  2Q8T A;  3FDT A;  2EOT A;  4CJ2 C;  3I3C A;  4NXM Q;  1YNN D;  2OTL A;  5J22 A;  3DUZ A;  4CGY B;  3BJU A;  1YHB A;  1L0W A;  4APV A;  1IZ6 A;  3G71 A;  1CA6 A;  1WFQ A;  2SEB D;  4DUY Q;  4LUZ A;  3I4L A;  3S1N B;  2VY3 A;  1HNX L;  5TSS A;  4HSV A;  1ASZ A;  3W1B A;  4MN3 A;  3GV6 A;  3VR4 A;  1ENA A;  3HOX B;  1BF4 A;  5J1Z A;  3KF6 B;  2AQ2 B;  1STB A;  2EYH A;  2Z1C A;  4XXE A;  2D2C C;  3UE1 A;  3KFU A;  2PQA A;  3I4O A;  2HHH Q;  2L12 A;  3HOZ G;  1JT8 A;  3VYS A;  3CCJ A;  2UUC L;  1L1O B;  4B08 A;  1SNP A;  1N32 Q;  5IGG A;  1QUQ A;  2B2W C;  4WRD A;  1SE4 A;  5CV4 A;  1SNQ A;  1UAP A;  3J7Z C;  4LF9 L;  3VYU A;  1TWA H;  4A3M B;  2QCP X;  4KD3 A;  3JAM L;  2B63 G;  4GOP B;  4WJ4 A;  3RD4 A;  4B3R L;  3UDX A;  1II3 A;  2J7Z A;  3VR3 A;  4ZKC B;  4UP7 A;  5CV9 A;  4IQZ A;  1PVO A;  1HZC A;  3H3V C;  1PMR A;  1NMG A;  3ULJ A;  4WJ3 M;  4DR2 Q;  1RIP A;  4HMI A;  1K8G A;  2I5M X;  1EU4 A;  4DR4 L;  2BE5 D;  1PRT B;  3S15 B;  3WOE A;  2BH2 A;  1STN A;  2JP1 A;  3OIP A;  5E4X A;  1I6V C;  2YU9 H;  2B2W A;  2JA6 G;  2E2I B;  3A7A B;  3NTK A;  3SK4 A;  2RCF A;  1OXT A;  3OW2 A;  2FHT A;  1T5X D;  3CCU A;  4JYA Q;  1PZJ D;  1YHA A;  3OW7 A;  3L0O A;  1TXY A;  2G5D A;  1XMO Q;  2VQE Q;  3HOX G;  5FLM H;  4EQN A;  5JVH 3;  4OO1 I;  1WD0 A;  3QR8 A;  1PRT C;  1LLR D;  1SE2 A;  2PI2 A;  5KND A;  3I4M B;  1TS4 A;  3H3V H;  2HT1 A;  1AFP A;  2Y0S G;  2UXD Q;  3TP7 A;  1S4Z A;  4HIK A;  4X62 L;  3NE5 B;  3L2P A;  2EJG C;  2Z6B A;  2PZW A;  3CC2 A;  2DY8 A;  3CW2 C;  1PRT D;  3PSI A;  4WJW A;  2I5H A;  1ET9 A;  4LF9 Q;  1JB7 A;  2FXQ A;  1HNW Q;  3I56 A;  2F0N A;  1OO9 B;  4UPA A;  1FD7 D;  4ZLT F;  3VA7 A;  4K6L A;  4IJH A;  2PW7 A;  2JE6 I;  3PO2 H;  4N8X 1;  1HHV A;  4FO2 A;  2EYF A;  3ND8 A;  3QG1 A;  1LAB A;  4IUP A;  1GOZ A;  5DNF A;  1AE3 A;  5IGE A;  2YTY A;  1B8A A;  2QEX A;  1CI3 M;  2NVQ H;  4A3D G;  1B50 A;  4A75 A;  5ELB A;  1ICF B;  3D4R A;  3CPW A;  4X64 L;  1VQN A;  1KHI A;  3PF4 A;  4DV2 Q;  1EIH A;  3MVV A;  1V1P A;  4QJF A;  1TQO A;  3GTK B;  2BDN A;  3TRZ A;  5EBD A;  4B3M Q;  3DEO A;  1Q82 C;  4JI7 Q;  4ZYS A;  1D5X C;  1SRU A;  4DNR B;  1L0Y B;  1WCM H;  3FVQ A;  3J80 L;  3STB C;  3KF8 B;  5EKL A;  3CU7 A;  5C5M A;  5JJZ A;  5C4J B;  4CJ1 B;  1J6Q A;  1RF2 D;  2DY7 A;  2CCZ A;  1VQH A;  2R92 G;  1Q1B A;  3FPP A;  4ZUJ A;  3J80 E;  4NXN L;  1RHP A;  1RTN A;  4C2M B;  1G29 1;  1VQ5 A;  1LTI D;  4MZ9 A;  2R7Z G;  5K36 H;  1NY4 A;  4A3D B;  4DAM A;  1TWF B;  4QUF A;  1H9J A;  1Y1W H;  1XNR Q;  2PNR C;  3T13 A;  4AIM A;  1VQD A;  1TR5 A;  1XNQ L;  2BDO A;  5G3L F;  3OTO L;  4RMF A;  4IPG A;  5EPJ A;  3GTO H;  2V4D A;  2VS1 A;  4YCU A;  3D6W A;  3FEW X;  4A3B H;  4LFA L;  1UNS A;  1EQV A;  2D0P A;  3D31 A;  5EJW A;  1KC8 C;  4DNI A;  1EEF D;  2QW7 A;  5C0X J;  2R92 B;  3K80 C;  1ASY A;  1YBY A;  2L5T A;  1WTW A;  3S16 H;  4OWW B;  1JWS D;  4WOR A;  3S14 H;  3PUV A;  1S40 A;  4L5T A;  4CKC A;  2F0P A;  4OL7 A;  1BBW A;  4OON A;  1VMC A;  1SMX A;  3Q22 A;  1IBL Q;  4A3C H;  2WII B;  4ODG A;  1X3Q A;  3CRK C;  1K8M A;  2SNS A;  1KLG D;  5GAE C;  2ZT9 C;  4DV2 L;  4BA2 I;  2ID0 A;  2A8V A;  3CHB D;  4EVO A;  1XXG A;  2AMC B;  5CV6 A;  1RCV D;  3C1F A;  1AP0 A;  1QVC A;  4IUU A;  2MHV A;  1SYB A;  3HOY B;  2E2I H;  1QJO A;  1A2T A;  3NBH A;  1O7Z A;  2X69 A;  3IAY A;  1LV9 A;  4DR5 Q;  2HHH L;  2VUM H;  2F0K A;  1GUG A;  2N8N A;  3CCR A;  3C3L A;  1KL9 A;  5IYC G;  5I6W A;  3M3Y H;  5M5Y B;  3MEF A;  4DN4 M;  2E2J H;  1H9S A;  2B2Y A;  2MP1 A;  1SEB D;  4GKJ L;  1JB3 A;  1EZ6 A;  4GZY C;  2O5J C;  5EKI A;  1MJE A;  1SDF A;  2IL8 A;  4DAV A;  2QF7 A;  3TP5 A;  2HDL A;  3EVQ A;  1YNX A;  1CZW A;  5IT9 L;  4J8Q A;  3PO3 H;  3TN2 A;  1N34 L;  1HZA A;  4EX5 A;  1ILP A;  1E1O A;  1ROD A;  5M3F B;  2F0S A;  4LF7 Q;  3I70 A;  3IRB A;  4GKJ Q;  1Y1W G;  2AQ1 B;  4X65 Q;  2UUB Q;  1QZH A;  1SE3 A;  2F4V L;  1LTG D;  1C9O A;  3HKZ G;  5I9O A;  4L5Q A;  4FF3 A;  4RAU C;  4K8J A;  2SDF A;  2IX1 A;  4O1N A;  5EKK A;  3D4W A;  3N6R A;  2SOB A;  1X3E A;  4DV0 L;  4LFC L;  2A69 C;  1HA5 A;  2JA7 G;  1BQQ T;  1J5E L;  1PTO H;  2ATW A;  3G6J B;  3L9A X;  4G7O C;  4HAE A;  4ZRZ A;  5CMD A;  4DV4 Q;  1HXY D;  1BCP B;  3Q8D A;  3J81 j;  4B3T Q;  4DV6 Q;  1Q12 A;  1B9N A;  5H1S E;  1GUT A;  1VQC A;  2D62 A;  2A5H A;  1B4O A;  2Z0S A;  2KEN A;  4NW2 A;  1HZB A;  4O0A A;  1F77 A;  4DGZ A;  4U68 A;  3C46 A;  1G91 A;  1HJP A;  4JBW A;  4A93 H;  4BY7 H;  1V8Q A;  1UEB A;  1LTT D;  1EL0 A;  3OIQ A;  1B7Y B;  4XTC S;  4XQQ A;  1Q8K A;  1A6X A;  1VQ4 A;  2FMC A;  2OXP A;  4B3S L;  2HIX A;  4DR3 Q;  2A73 B;  4B3T L;  1PH5 A;  4R8N A;  4DXG A;  3HOU B;  4JI3 L;  1W2B A;  1PFS A;  1A3T A;  2JEA I;  5DEH A;  2C9O A;  3DWA A;  3D0F A;  4EQ5 A;  1LTL A;  2KCN A;  1VQO A;  3BDC A;  2H5X A;  5EQ0 A;  2ICI A;  1BCP C;  3TQY A;  3HOX H;  3AEV A;  2L11 A;  3S2D B;  1EQQ A;  2FMM A;  1R4Q B;  2CH4 W;  1J5E Q;  4Y52 H;  4DV1 Q;  5FJ8 G;  1WOC A;  1YJW A;  1IBM Q;  3H15 A;  3W2D A;  1QG7 A;  2JA8 G;  1EFW A;  1G51 A;  4JG2 A;  1M8A A;  4HIM A;  1CHQ D;  2VW9 A;  5C3E H;  3CME A;  1V1Q A;  4DR7 L;  2FFK B;  2RA4 A;  4J6H A;  3PIP 3;  1DM0 B;  3MEH A;  1E3P A;  1D1K A;  1KRS A;  4A3K B;  2D9U A;  1VF7 A;  3HKS A;  1HR0 W;  1XWE A;  1LT3 D;  2JK8 A;  3I91 A;  3JAM c;  4O42 A;  3T4A C;  4EQP A;  3NTI A;  1WTH A;  3NUC A;  4HCE A;  3E5S A;  4KJN A;  5JJI A;  1WTQ A;  1Q46 A;  2XNA C;  2ZM6 L;  3FRP B;  5C4Z A;  1CHP D;  1EWI A;  1S5E D;  1QUQ B;  3OWF A;  4DU9 A;  3I55 A;  1VQ8 A;  2WKC A;  3LWU A;  3CKI B;  3FPU B;  1D6E C;  1NUC A;  1AZP A;  2VZA A;  3S16 B;  1OXU A;  1XX8 A;  4HIO A;  4RGN A;  3UDI A;  1VQ9 A;  3NP8 A;  2K04 A;  2K5N A;  2NZO A;  4YCV A;  2R93 H;  2B2V C;  2HD3 A;  1ZYR D;  2DN8 A;  3GTM B;  1EWC A;  2F3I A;  1K83 B;  1EIY B;  1IXR A;  2MFI A;  4A3L G;  1FNV A;  1HUM A;  1PA6 A;  3AMU A;  1FYC A;  3BDO A;  5HUR A;  1NTG A;  3RN2 A;  2K01 A;  1IBM L;  4BXX G;  4JYA L;  3TP6 A;  1D7Q A;  1F2Y A;  2NUC A;  4KLK A;  4QUC A;  4R4C A;  1YHQ A;  3CCV A;  3J7A V;  2JSO A;  1Z7T A;  1XPU A;  4OEL B;  3PIO 3;  4BBR G;  2RDF A;  2J4X A;  1B2T A;  3GDE A;  3CCQ A;  3I4M H;  2CVR A;  1JE5 A;  4DUZ L;  4GLA C;  2BE5 C;  4IJL A;  1ESR A;  2NTS A;  3KUP A;  1LO5 D;  3ND9 A;  2JA6 B;  1SMY C;  1SNC A;  1GM5 A;  3I8Z A;  3K81 C;  3M3Y B;  2PPB C;  1I50 H;  2VL6 A;  1TS2 A;  1STH A;  1D8L A;  2B2U A;  1TWG H;  4MTN A;  1SND A;  1WTV A;  1H9R A;  4BBR B;  2WAQ B;  5JOB A;  3SDZ A;  1K9M C;  5ELE A;  2NVX B;  5M5W H;  4NP5 A;  1X3F A;  1YI2 A;  5A2Q L;  2EZV A;  5EAY A;  4P2C B;  3U4Z A;  3URY A;  2AKW B;  2ICE C;  3A56 A;  4JI0 L;  1LT6 D;  1W6J A;  3NPP A;  1N33 L;  3GD7 A;  4V19 0;  3H91 A;  2A6E C;  3PO2 G;  1GHJ A;  4JI4 Q;  2N55 A;  2E75 C;  1FJG Q;  1HTP A;  1AW7 A;  1KDB A;  5LMN W;  2L55 A;  4ME5 A;  1MIU A;  4OIJ A;  1EQT A;  2PW5 A;  1VQ7 A;  1TWF H;  3ERQ A;  2B3G A;  2JN4 A;  2F0H A;  1MD2 D;  2EIF A;  3V05 A;  4IOA A;  1HNZ Q;  4RKL A;  1BNZ A;  3OMC A;  4A3F H;  1NCV A;  2IPK D;  4GN3 B;  3BU2 A;  1K0S A;  2KCT A;  1E22 A;  3M4O H;  1I4P A;  4KKT A;  3H94 A;  4P72 A;  1CSP A;  4AYB E;  1A3U A;  2KHI A;  4C2M H;  2ASB A;  2XSC A;  1W6K A;  4EQO A;  2IHF A;  3KLW A;  3UE0 A;  1Y8N B;  1KAA A;  2F0G A;  1VQM A;  4I7Z C;  1EYG A;  2F3W A;  1GO3 E;  1G6Z A;  2JYO A;  3VR2 A;  5IP7 G;  5M5X B;  1L1O A;  3S9W A;  1Z6H A;  3CCE A;  3U9O A;  2UU9 L;  3FMC A;  3A5Z B;  3KLS A;  1EIF A;  3S2D H;  3F2C A;  5FLX L;  3HOV B;  2DJF C;  2FIN B;  4X3S A;  1RD9 D;  1GUO A;  3J80 i;  4A3I H;  1XTD A;  4H13 C;  1TWH H;  5CBA E;  1F9S A;  1MKH A;  5KNC A;  3R2T A;  2WAQ E;  4OEM B;  2QEJ C;  4LJZ C;  4OGQ C;  2VQF L;  5IGC A;  3KDF A;  1CKN A;  4PQX A;  3AB9 A;  4IFD J;  1UE6 A;  2WB1 B;  4AYB G;  1VQE A;  2B2U C;  2XWJ B;  3RMH A;  1DOM A;  3LNN A;  1U4P A;  4JI0 Q;  1K8A C;  4A3G H;  5KIX A;  1B9M A;  1OXX K;  5EBC A;  2DJG C;  4X64 Q;  1TS3 A;  3F1Z A;  4YY3 L;  4JVZ A;  5FLX c;  2L15 A;  2ES2 A;  3I4N B;  4A3M G;  1O7I A;  4WFN 3;  3ITP A;  3X3M A;  4LFB Q;  4X3K A;  3ULL A;  3ONA B;  1ILQ A;  3K0X A;  2KED A;  3B6Y A;  2HDM A;  2LMC B;  5T1G A;  3GTG H;  1HR0 L;  3K57 A;  1B3A A;  1DOL A;  2ZTE A;  4QY7 A;  1M1K C;  3HS0 C;  1I4X A;  4DR6 L;  1IBK Q;  3GTP B;  5FOB B;  3GTM H;  3IL8 A;  4F88 A;  3TZD A;  2F4I A;  4ILW A;  2ZXP A;  3OSO A;  4XIG S;  1XNR L;  4P75 A;  4KV6 A;  2I5L X;  2A6E D;  4LF5 Q;  1TS5 A;  2RHS B;  1SN8 A;  4IAL A;  4BY7 B;  4LUV A;  5E1F A;  1S5D D;  3CQZ H;  1KXL A;  1HNW L;  1V1P B;  5M3F H;  4KY7 A;  2ENB A;  3PUX A;  1R9T H;  1U9R A;  1ZKO A;  1IBK L;  2Y0S B;  1GJX A;  2R93 B;  4LWC A;  4RHS A;  4A3F B;  3G48 A;  1G2S A;  4A3C G;  1QWY A;  2WV6 D;  1K28 A;  3MAQ A;  2CQO A;  1NBW A;  4G7Z C;  2XRS D;  2KEE A;  5DM7 3;  1PFM A;  2VQF Q;  1X9N A;  1EOV A;  3T53 B;  2DGY A;  2B2T C;  1PFN A;  2I07 B;  3I72 A;  2K33 A;  3KLS X;  4LFB L;  3UDG A;  2PQE A;  4DNT B;  1J8I A;  5GQO A;  4A76 A;  3R3O A;  3RZD B;  5D14 A;  2CHB D;  2N49 A;  2KHS A;  3J7Y W;  1V1O A;  3MA2 B;  3BDL A;  3HOY G;  1RKN A;  1F9R A;  1HA6 A;  3F2D A;  5CV7 A;  1I94 Q;  3MC0 B;  2MUY A;  4BXX H;  3CCM A;  1RDP D;  1W3S A;  4YWK A;  4HID A;  1CQV A;  4UHV A;  3A8J E;  4DR2 L;  1BO0 A;  1TWC H;  1NSN S;  1PYW D;  1Z47 A;  4HTH A;  3NTH A;  3TBI B;  5BN5 A;  4KY5 A;  5J39 A;  2DUD A;  1MSH A;  5M5X H;  1EY5 A;  2PQA B;  2NN6 H;  3GTL H;  1QCB D;  2YTV A;  2EXD A;  3KJP A;  1B53 A;  1STA A;  5IE8 A;  5I4D A;  4P74 A;  5FK9 C;  1PTO F;  2SNM A;  1BDO A;  4UAI A;  5IP9 H;  5JJK A;  3DWQ A;  3HGB A;  3NBH B;  1LUZ A;  5IYB G;  4JV5 L;  3NQI A;  3LGJ A;  3TP8 A;  4JBM A;  1CA5 A;  3HOV G;  4RH6 A;  5EPK A;  2LKV A;  2EE1 A;  4JK1 C;  1MI2 A;  4ME3 A;  2OF1 A;  5JEA G;  4B3M L;  3BVM A;  1I6H B;  4C1N I;  1KQS A;  3IFT A;  3NK9 A;  1E2V A;  4BBS B;  5JEA H;  5ELN A;  1CFM A;  2VUM G;  2Z9H A;  2KVM A;  2EYP A;  1SJE D;  1Y8O B;  3GTJ B;  5C3W A;  1EY7 A;  5ELO A;  2JA7 H;  2EJM A;  1LTS D;  2HCC A;  4BA1 I;  1TWG B;  4R4O A;  4KY6 A;  3EJI A;  1DGS A;  3NWS A;  2B39 A;  2K32 A;  1NJI C;  3S15 H;  3HEJ A;  3DMU A;  1G6P A;  1KAW A;  4K6D A;  2OT2 A;  4A4I A;  1OTC A;  1CKN B;  4I65 A;  4DR5 L;  1TU2 B;  1I94 L;  1H9S B;  4F8M A;  3ICE A;  2NVY H;  3DWP A;  3S1R H;  1T5E A;  1LTA D;  4XDX A;  4DXF A;  5BR8 Q;  4JI6 Q;  2PI2 E;  4R9W A;  2NN6 I;  2ZM6 Q;  1PH3 A;  1NNX A;  3EQL C;  4C3J H;  1YJ9 A;  2Q2I A;  5C0X I;  1PH2 A;  3P20 A;  1PYS B;  1YIJ A;  2QIL A;  3D3R A;  5CV8 A;  1MJC A;  1A63 A;  1D5M C;  1TWH B;  1NE3 A;  4K2K A;  4JI5 Q;  4L5R C;  2UUC Q;  1F2M A;  3V96 A;  4JI4 L;  2AWO A;  2K4K A;  4PV1 C;  2X6L A;  3MFG A;  1OXV A;  3OMG A;  1U5K A;  1C7Y A;  1GUS A;  2Z4H A;  1BR9 A;  1A3V A;  2JEB I;  1N34 Q;  1X65 A;  4TVA B;  3SGI A;  5E7N A;  4A3G B;  2OCE A;  1KNE A;  3HRZ C;  4JOI C;  1UUP A;  1EY4 A;  5DM6 3;  3MTS A;  3F8T A;  3A7L A;  1KLU D;  1BBU A;  3FKI G;  3PV0 A;  1HUN A;  3GV3 A;  4HJA A;  3Q24 A;  3PF5 A;  3S17 H;  1U4L A;  4X66 L;  4N9T A;  4CKB A;  3J81 i;  3BYT B;  4K8I A;  4DUZ Q;  1F2Z A;  4X3T A;  1XMQ L;  4JI1 L;  1DCZ A;  2NYZ D;  3MXG A;  2YYZ A;  3M4Q A;  1Y69 U;  2UUA Q;  2ALY B;  2RF4 A;  3K6O A;  4BY1 H;  3HOZ B;  2XTI A;  3G6E A;  2BCO A;  1UE7 A;  2K5D A;  1Q7Y C;  1Y1V B;  4IPH A;  2GVB A;  3RR5 A;  5LMU Q;  3K58 A;  4JI6 L;  2F0L A;  1PHJ A;  4UDU C;  2RKS A;  1V9P A;  2PCF B;  4IUN A;  4HJ7 A;  4KTA A;  2AHO B;  1SYD A;  2E2H H;  4K0K L;  1O7L A;  3S2H H;  3PIO A;  4GLX A;  4X66 Q;  2G9H D;  1LTR D;  5ELC A;  2FJ2 A;  1NMF A;  3VYT A;  4A3K G;  5IOD A;  4JI1 Q;  4KJO A;  4RFB A;  4A3B G;  2NZH A;  4QQB X;  1FGB D;  1QVG A;  3BS1 A;  2LXK A;  1PLF A;  5C44 B;  1WJJ A;  5BR8 L;  2Q8I B;  4FXK C;  4H0L C;  2F0T A;  1TY2 A;  5IGF A;  1EUJ A;  1S5B D;  1UE1 A;  2Q2U A;  2AWN A;  3BVG A;  1R9T B;  4XT1 B;  3W3A A;  1MGS A;  3BZD B;  1VF5 C;  4HJ8 A;  5IY0 A;  1UWV A;  1YIT A;  2I46 A;  5AFW A;  5LL6 X;  4A93 G;  5JVG 3;  1EWH A;  4DF7 A;  4CHT B;  2UXC Q;  3MWY W;  2VQE L;  3O13 A;  3CD6 A;  4C3I B;  1EOT A;  3TZU A;  4CKE A;  2A69 D;  1SYE A;  3HOW B;  4GS3 A;  4L6T B;  3A74 A;  4P73 A;  4JI7 L;  3KBG A;  1S5C D;  1WCM G;  2R61 A;  3PQI A;  2PZT A;  4LF6 L;  2VNU D;  5IWA Q;  4DV7 Q;  4QMG A;  1PFB A;  2CWA A;  2RSO A;  4KKS A;  3G4S A;  2QA4 A;  3M4P A;  4NMZ A;  4GNX A;  2EYJ A;  2K7V A;  2K75 A;  4GNX C;  4DK3 C;  2UU9 Q;  2ZJQ A;  2Q2T A;  3HOW G;  1A2U A;  2F0F A;  2IY5 B;  2L0C A;  1SBB B;  4RWS C;  1SXT A;  2VB3 X;  2J0T D;  1M90 C;  1EY9 A;  2GVA A;  3GTL B;  3E0J A;  2YU9 B;  2F0J A;  3KLR A;  3I4N H;  5LMU L;  1IW7 D;  3GTJ H;  1PXU A;  2WAQ G;  4S3S A;  4KHP Q;  4IO9 A;  5KNB A;  4LFC Q;  4K5X A;  3NHH A;  2NZ1 D;  1O78 A;  3S1M B;  2EPB A;  1DON A;  1B1Z A;  4POG A;  1WCM B;  3DHQ A;  1BVS A;  1Z9F A;  4IN3 A;  5IT9 c;  1IYJ B;  3BZC A;  5GAG C;  3T1H Q;  1T9H A;  1ZYR C;  2Z8L A;  4PG3 A;  1LT4 D;  2EQS A;  3WOF A;  2JA9 A;  4A3J B;  2HCI A;  3P7J A;  3X3N A;  2BA1 A;  4XQN A;  4JI8 Q;  3RZD H;  1N9W A;  3A54 A;  5KYI A;  1KRT A;  1VQF A;  4NXN Q;  1I5F A;  5BN3 A;  1PH1 A;  2RDH A;  3QB3 A;  4DPG A;  3K7A H;  3E6Z X;  5M5Y H;  2MQH A;  1SLJ A;  5T1I A;  4LUO A;  3EIV A;  3OPO A;  4CDD C;  1STE A;  1KTK A;  1ESF A;  1BBX C;  3EN2 A;  4LK1 C;  5I6Y A;  1C4Q A;  1CSQ A;  1O80 A;  2R7Z H;  4X6A H;  5K36 G;  5CYU A;  2Z6K C;  2QDL A;  1D2B A;  3DM3 A;  3STB D;  2I0Q A;  4FXD A;  2M2L A;  3PO2 B;  2E2D C;  4BY7 G;  3VR5 A;  2IX3 A;  5CR3 A;  1IW7 C;  3S2H B;  2M00 A;  4CJ0 B;  2B8G A;  1JMC A;  3GTK H;  3CCS A;  1PV4 A;  4FF4 A;  3GTP H;  2WB1 G;  4BS9 A;  3IKJ A;  1UE5 A;  4L5S A;  1F2L A;  2NBF A;  4AH6 A;  1WYD A;  2ZTC A;  4M1U B;  1BXT A;  1WVL A;  2MPM A;  1CM9 A;  1DJR D;  4BY1 G;  3QIA A;  4DV4 L;  1SAP A;  4KHP L;  4KMU C;  1DXM A;  2WIN B;  1E0B A;  3J81 c;  4LF4 Q;  2RVL A;  4A3I G;  1GUW A;  3S1Q B;  2E74 C;  1EYD A;  3J7A 5;  1LAC A;  4Y7N H;  1NAP A;  4OX9 Q;  1IBL L;  3MXP A;  1NR2 A;  3T1H L;  3AQQ A;  3GTO B;  1YVC A;  5BN4 A;  4AQY L;  2UXD L;  4IFD G;  1QZG A;  4RCN A;  3NEM A;  4PZ7 A;  4BY1 B;  1KNA A;  4KI0 A;  5IIF A;  5IYD G;  1LYL A;  1S5F D;  1Q1E A;  5JAV A;  4AYB B;  1PH8 A;  4P71 A;  4Q0F A;  3SK5 A;  4OHJ A;  2DNC A;  2NVY B;  4MNO A;  5IYD H;  3TDQ A;  1TVX A;  3PO3 G;  5IWA L;  4DV7 L;  2R93 G;  1L2F A;  3GP7 A;  4A93 B;  4BBS H;  1GHK A;  1SNM A;  2HUG A;  1JQY D;  4LMQ D;  5FLM G;  1XPR A;  1VQB A;  2IT1 A;  1Q86 C;  2R92 H;  1U0L A;  2ZTD A;  2XGT A;  3P1H A;  5EGT A;  4DK1 A;  3VYR A;  1Q8I A;  1LM0 A;  1YNN C;  5C6A A;  2R7D A;  1N32 L;  1JOK A;  3OWE B;  1FNU A;  5IYC H;  1VCI A;  2F3V A;  4DV1 L;  1GD7 A;  3K8A A;  4IPD A;  2N3S A;  4RCO A;  3KF6 A;  1N36 Q;  4IUR A;  1EY0 A;  1S3O A;  3HZX A;  5LMN Q;  2RDG A;  2K5W A;  4A3E H;  2F0M A;  1SSO A;  1WTO A;  4C1N K;  3A8K E;  5LHY 1;  4A3D H;  2F4V Q;  1TT2 A;  1VMP A;  1A0I A;  4N8F A;  3K0Y A;  2D5D A;  2IWH A;  3AU7 A;  4K14 A;  3T1Y Q;  4A3J H;  2B63 H;  2A6H C;  3CPF A;  3HKZ B;  4DV3 L;  2Q8R E;  1HNX Q;  3NEN A;  5FJ8 H;  2A1A A;  4C3H H;  2Z4I A;  1HZ9 A;  4DAY A;  1EQR A;  2EY6 A;  1WD1 A;  2RBM A;  4JI3 Q;  1I6H H;  1I4G A;  4FF1 A;  4QB4 A;  4DV6 L;  3RLF A;  2IW3 A;  1KD1 C;  3H09 A;  4YHH L;  4G57 A;  4UP9 A;  1V43 A;  3H0G B;  1PTO D;  3A8I E;  4DAP A;  4G7H C;  2XIW A;  1AN8 A;  4YY3 Q;  1QNK A;  4OO1 H;  2F0W A;  5G3L D;  1CQF A;  3S17 B;  2TMP A;  1JJ2 A;  5F2D A;  2UXB L;  3VA5 A;  1A62 A;  4GKK Q;  3F2U A;  2UUA L;  4B3S Q;  3F2B A;  4FF2 A;  2PZU A;  1I4Q A;  5KYL A;  4RGO S;  1KIX A;  1R4P B;  1FJG L;  3CC4 A;  3AYH B;  3MHB A;  5IOC A;  3I90 A;  1EIG A;  4PMW A;  1LT5 D;  1I4H A;  5NUC A;  2EY1 A;  4H44 C;  5ELD A;  1VDZ A;  1PDQ A;  4IFD H;  1L1O C;  2CQA A;  4B9W A;  3QWN A;  1VQP A;  3M7N A;  2IJ0 A;  2F52 A;  3DXJ C;  3CMA A;  4DR6 Q;  2E2H B;  2VUM B;  3SVM A;  1HPC A;  3NXW A;  3T1Y L;  4HCS A;  4H02 A;  3K5M A;  4IFD I;  2UXB Q;  2K5V A;  3RLO A;  3K5O A;  1X55 A;  1K0R A;  1VQL A;  4TKO B;  2K5H A;  4QL5 A;  2B2T A;  2OTJ A;  1DYQ A;  2KCM A;  3I7F A;  1RTO A;  1P8L A;  4Y7N B;  1MBY A;  3QJY A;  1JJC B;  4O2D A;  3K5L A;  1A15 A;  2A68 C;  2L9H A;  3FKI B;  3M9B A;  2EVB A;  2EYO A;  4IPC A;  3T56 B;  2PO4 A;  1I50 B;  3N52 A;  1N8R C;  2K28 A;  3J80 c;  1E1T A;  1I3Q B;  5I2Y A;  2H4O A;  3U4V A;  5M3F G;  4MIU A;  1M4V A;  4JPB W;  3MXN B;  5IGD A;  4EGV A;  1IHZ A;  1S72 A;  1U4R A;  5FO9 B;  1AE2 A;  5JPM C;  2BOS A;  3J7A F;  3I73 A;  1ET6 A;  2KEC A;  1Y1V G;  4KHZ A;  1X54 A;  4IUT A;  4DA2 A;  2RHQ B;  4R4T A;  1Q90 A;  5D3D A;  3RZO H;  2K1B A;  4F7X A;  1SYF A;  1AEX A;  2EY5 A;  1VQJ A;  3UDF A;  5C44 H;  4UP8 A;  3BVZ A;  5KGU A;  4C3J G;  4A3B B;  2CH4 A;  1F9Q A;  3K7U C;  1VQ6 A;  2O4X A;  5A35 A;  5C5L A;  2JA8 B;  4AQY Q;  1P16 A;  2E5L L;  1BCP F;  1Y1V H;  2RCN A;  2HIV A;  2JQO A;  4YIJ A;  3ER0 A;  3ULP A;  2K5Q A;  3GTQ B;  1VQK A;  3U58 A;  1C8C A;  3M4O B;  4JV5 Q;  1YNJ D;  4PZ8 A;  3PCO B;  1YZ6 A;  3KOJ A;  3SK8 A;  4YHH Q;  3KDF B;  2KOL A;  5I2X A;  3S1M H;  1QVF A;  1B44 D;  1EY6 A;  2G9D A;  1B70 B;  3PUZ A;  3HOW H;  5JPN C;  4C3H B;  2NTT A;  4HJ9 A;  3E3X A;  4C3I H;  1GXD C;  2YV5 A;  2WFW A;  2GA4 B;  2F1M A;  1XPO A;  2O2L D;  5I9P A;  2Q2H A;  4XT3 B;  1CT1 D;  1G8Z D;  3K7A B;  4HR7 B;  3T16 A;  5C4X G;  1ZEQ X;  3OOC A;  3Q0A A;  2GN5 A;  4DUY L;  4ZKB B;  4ZCK A;  2E8G A;  2WAC A;  3GQB A;  4FNF A;  1FGU A;  3HOV H;  5FKA C;  1JCK B;  4OXP A;  5KRU A;  1RJT A;  4R8I A;  2JA5 G;  2B63 B;  4BBR H;  1F9P A;  2E2J B;  2PYK A;  5FLX E;  1VQG A;  5IP9 G;  4ID6 A;  1PZK D;  2R7F A;  2QGQ A;  3BG3 A;  3CRL C;  3TS2 A;  2QKI C;  4DFA A;  1AZQ A;  1L0X B;  4HJ5 A;  1EY8 A;  4GNX B;  3J81 L;  3EBE A;  4JOI A;  2XN9 C;  3DEP A;  1BUV T;  5CGK A;  1XTC D;  4A3E B;  2QDB A;  1RL2 A;  1BCP D;  4KN7 C;  1SRO A;  5IGB A;  3JC6 6;  5C3E B;  5J3B A;  4FP5 D;  1YJN A;  1STY A;  1JOO A;  1HFN A;  2MGS A;  3HFZ B;  2P5Z X;  5A2Q E;  3CC7 A;  2NVT H;  3A5U A;  2JJQ A;  3TME A;  4B3R Q;  3BZK A;  4DR1 L;  4JI2 L;  3TSS A;  2K03 A;  4KHV A;  1X3P A;  1X3G A;  3MFY A;  2A74 C;  4A3K H;  4R4I A;  4E6I A;  4ALP A;  1Q81 C;  1CTM A;  3W5O A;  2XRQ D;  2KBN A;  4KK7 A;  1EYA A;  4DR4 Q;  4DV0 Q;  5C4X H;  3PIP A;  4Q5V A;  1PZI D;  1O7Y A;  2R7Z B;  1VQA A;  3ZJY C;  2ZXO A;  4TRD A;  3SXH A;  2N88 A;  5LL6 S;  2OQK A;  4J15 A;  3IFD A;  5COY A;  2Y0S E;  3QOJ A;  3S1N H;  2LSS A;  1CK1 A;  1SYG A;  2A19 A;  5M3M G;  3SE0 A;  1SFO H;  5C3E G;  1SYC A;  2B2V A;  1IL8 A;  4RKB A;  2F0V A;  5GAH C;  3HP3 A;  2NVX H;  1H9M A;  1TY0 A;  1QIL A;  4PMC A;  2XVS A;  4HSP A;  5COR A;  5M3M H;  2KA7 A;  5FO8 B;  2C5C A;  4NXM L;  4DKA C;  2NN6 G;  2EJF C;  1HCZ A;  3CAM A;  3FHW A;  1E24 A;  2UUB L;  2MNA A;  2MO0 A;  2E76 C;  5M9O A;  3R2I A;  2F0I A;  2PNH A;  3SHL A;  4OX9 L;  4FXG C;  4DR1 Q;  1IKL A;  1JWU D;  1J9O A;  4JI5 L;  1KDA A;  2DNE A;  4GLV B;  4LF5 L;  4LFA Q;  3R93 A;  3SR1 A;  4H7B A;  2K52 A;  2K50 A;  4QCL A;  4A3F G;  4DV3 Q;  2LS0 1;  1BKB A;  3W1G A;  3H0G H;  3P75 A;  2WP8 J;  3PUY A;  3CF5 A;  1HQM C;  4A3I B;  4A3L H;  3I4N G;  3PGZ A;  3UI2 A;  1ICW A;  1G2T A;  3D4D A;  4PNY A;  5C0X G;  3S1Q H;  4A3M H;  2V1C C;  4JI2 Q;  2KUM A;  2O5I C;  1HR0 Q;  1PH4 A;  1XYI A;  1EZ8 A;  5C3X A;  4CDC C;  5KEE A;  4QGU A;  5L37 A;  3HKZ E;  1TWC B;  3U9S A;  4RGM A;  4NB3 A;  2BH8 A;  1QNU A;  2UXC L;  2B8F A;  2WB1 E;  1JIC A;  3LX0 A;  4LF8 Q;  1WTR A;  1GKH A;  4RA8 A;  4NDX A;  2MJ8 A;  1WI5 A;  4J1M A;  1PH6 A;  2WKD A;  1E2Z A;  3JAM i;  2ZJP A;  4IOC A;  3JAM E;  4R1J A;  1X6O A;  4FDB A;  1AH9 A;  4GN4 B;  4OWT B;  4YWM A;  2AUK A;  1C48 A;  4JCV E;  1SR3 A;  4JC0 A;  4C3I G;  4PMB A;  5GRO A;  1QB5 D;  1N36 L;  3CQZ B;  2XWB B;  3RLN A;  3WWV A;  1IL2 A;  1CUK A;  4Z9C B;  5HGQ A;  1XMO L;  2F0U A;  2VB2 X;  3S1R B;  1VQI A;  1KAB A;  4K5W A;  3CP0 A;  3I4M G;  2N78 A;  1YEZ A;  1UEA B;  1SMY D;  5IP7 H;  5CV5 A;  2EY2 A;  3QO2 A;  5ISR A;  4UY8 C;  1QOH A;  4IZ8 A;  3C1E A;  2B29 A;  1XMQ Q;  3OYY A;  1EU3 A;  4XQJ A;  1FNW A;  1HTL D;  4BWG B;  3KYH C;  2HQE A;  1HFG A;  4K2L A;  4LW1 A;  1PRT F;  4ZAI A;  4CDE C;  3AFP A;  4IUV A;  1EYC A;  5IT9 E;  4FVM A;  4HMJ A;  1JC7 A;  4ULL A;  3M4Y A;  4DAY B;  1K73 C;  3D6C A;  4M8A A;  4GOP C;  1WTP A;  4C56 C;  1TWA B;  2JA5 H;  3KF8 A;  1HH2 P;  2F03 A;  4NKL A;  2M9V A;  1JR0 D;  4RG1 A;  4ZK9 B;  2K05 A;  5HGT A;  3E9H A;  1CZG A;  4DV5 Q;  2JA6 H;  2HQL A;  4XYQ A;  1D1I A;  2RQX A;  4R4Q A;  4U67 3;  1SFO B;  1GVP A;  4A3J G;  2LXJ A;  4I7A A;  4NPS A;  5DAU A;  1TKW B;  1DOK A;  4JBJ A;  2X6G A;  2IX0 A;  2CFM A;  2EXZ A;  2VXW A;  4LF8 L;  1I4R A;  2F0O A;  4CDF C;  5CC4 A;  3HOU G;  1SE8 A;  2YTX A;  4MTK A;  1DZ1 A;  3FKI H;  1B3Q A;  4HED A;  3CCL A;  4DK0 A;  5JJL A;  3HG9 A;  3I2Z A;  3V2T A;  2R6G A;  1PH9 A;  4OWX B;  3TEH B;  2CWP A;  2EYM A;  1D5Z C;  2F0D A;  2NB0 A;  2OEO A;  3H0G G;  3KBX A;  3ERO A;  2LY7 A;  5LMN L;  2KQ3 A;  1FVI A;  4GN5 A;  3OTO Q;  3J81 E;  1LTB D;  1X56 A;  1ZXT A;  3MXN A;  5GAD C;  1CKO A;  1K8O A;  1STG A;  3KK7 A;  3SK6 A;  4ABN A;  4F87 A;  3LWE A;  1I3Q H;  2LFN A;  1GUN A;  4RGT A;  4FYD A;  1EFI D;  2B2Y C;  4JW0 A;  4JI8 L;  3KJO A;  1JE4 A;  1JWM D;  2L4N A;  2EDG A;  4QF4 A;  1KDC A;  3TRE A;  3A0J A;  1H9K A;  1WTX A;  3E0E A;  2NVQ B;  2KCC A;  1K3B C;  1H95 A;  4QIW B;  5DLQ E;  2CW0 D;  3A55 A;  4OO1 G;  2PMZ B;  2H1E A;  5FO7 B;  4N9P A;  5JEA J;  5K5P A;  5D3I B;  1FR3 A;  4XYO A;  2RSN A;  1Y8P B;  1N33 Q;  3NSW A;  3D8G A;  3M7G A;  4GOP A;  4A3G G;  2KHJ A;  3VDY A;  1E2W A;  2JXM B;  3MXU A;  1PH7 A;  4DR7 Q;  2E5L Q;  4B9X A;  3ERS X;  1IYU A;  1HRJ A;  2F0E A;  3L3O C;  5EPL A;  3NQT A;  2C35 B;  3MZ5 A;  2NWG A;  3H6M A;  1XNQ Q;  3EA6 A;  4DR3 L;  4LF6 Q;  3K59 A;  3GO5 A;  2A68 D;  1E7Z A;  1MHW C;  4ZQ3 A;  4LF4 L;  4K0K Q;  3CXC A;  3RZO B;  1IYV A;  2AQ3 B;  5CBE E;  4LAA A;  4PZ6 A;  1XJV A;  4C3J B;  3TS0 A;  1JOQ A;  1K3R A;  1Q3L A;  4IUQ A;  5AJ3 Q;  2AUJ D;  2CKZ B;  3Q6S A;  4MHE A;  5IYB H;  3EFX D;  1Y1W B;  4X62 Q;  3WDN A;  2NVT B;  1SJH D;  3G7L A;  2JA8 H;  3S24 A;  4YWL A;  3PUW A;  1PYB A;  2A6H D;  4L63 B;  3NEL A;  3SEB A;  1ONL A;  1EEI D;  5E3F A;  3DLL A;  1JJG A;  3GTQ H;  4DV5 L;  1ML0 D;  2ZJR A;  5C0X H;  4QIW E;  1C0A A;  1DD2 A;  3M85 A;  4LF7 L;  4HN7 A;  2TSS A;  4KKU A;  2JA7 B;  3PO3 B;  3Q23 A;  1NR4 A;  2IHE A;  3RN5 A;  1HNZ L;  4TSS A;  3T51 B;  4X3U A;  5AJ3 L;  2R3Z A;  3OHX C;  5ELF A;  3GTG B;  2JA5 B;  3HOY H;  4YCW A;  1K83 H;  1BOS A;  4KN4 C;  5C4H A;  5C4J H;  2F0Q A;  3K5N A;  4KD4 A;  4BBS G;  1PTO B;  4L8J A;  4OIK A;  4POF A;  3S14 B;  4GKK L;  2ZXR A;  2KJX A;  1QE6 A;  1Y14 B;  1OXS C;  2BA0 A;  2Z6K A;  3NBI A;  1PTO C;  3QOL A;  4RHR A;  1CKM A;  1HQR D;  1MSG A;  3PMF A;  3U50 C;  1VS0 A;  4C3H G;  1A8V A;  1YNJ C;  4V0B A;  1ENF A;  2K6A A;  1SNO A;  3HOU H;  3DM1 A;  4K5V A;  2CW0 C;  5HY6 A;  1TII D;  3H3V I;  1U4M A;  3FP9 A;  2MO1 A;  5C4X B;  3RNU A;  1X32 A;  5D65 A;  4A3E G;  2L1B A;  1IKM A;  4ZUI A;  5M3M B;  3L7Z C; 
#chains in the Genus database with same CATH homology
 2JK8 A;  3JAM c;  2UUA Q;  2ALY B;  2RF4 A;  2Q2H A;  4BY1 H;  3AFQ A;  2XTI A;  3G6E A;  1UE7 A;  5C4X G;  1Q7Y C;  4IPH A;  2OWO A;  2GN5 A;  1FL0 A;  2GVB A;  4TQU S;  3RR5 A;  5LMU Q;  4DUY L;  2K14 A;  4JI6 L;  1PHJ A;  1Q46 A;  2E8G A;  3E9I A;  1V9P A;  2ZM6 L;  3HOZ H;  4JBK A;  2OQ0 A;  4X65 L;  1FGU A;  3HOV H;  3I55 A;  4HJ7 A;  1VQ8 A;  1EWI A;  5C44 G;  1QUQ B;  2AHO B;  4OXP A;  2E2H H;  4K0K L;  3S2H H;  3PIO A;  2JA5 G;  4GLX A;  4BBR H;  4X66 Q;  2VZA A;  4DK6 C;  2PMZ E;  2D0O A;  1NMF A;  1OXU A;  4A3K G;  4HIO A;  4LNQ A;  1VQG A;  3UDI A;  5IP9 G;  1VQ9 A;  4JI1 Q;  2R7F A;  2QGQ A;  4A3B G;  2NZH A;  2K5N A;  3TS2 A;  4QQB X;  2NZO A;  1QVG A;  4NXM Q;  4YCV A;  4HJ5 A;  2LXK A;  2OTL A;  2R93 H;  1WJJ A;  5BR8 L;  2F3I A;  1EIY B;  4GNX B;  1EUJ A;  3BJU A;  1YHB A;  2MFI A;  1IXR A;  1IZ6 A;  3EBE A;  1UE1 A;  4JOI A;  1L0W A;  1WFQ A;  2AWN A;  3G71 A;  2Q2U A;  4DUY Q;  4LUZ A;  4A3L G;  1PA6 A;  1RL2 A;  2VY3 A;  1HNX L;  1SRO A;  1NTG A;  3JC6 6;  5J3B A;  3RN2 A;  4HJ8 A;  5IY0 A;  1YJN A;  1UWV A;  1IBM L;  4BXX G;  3HFZ B;  1ASZ A;  4JYA L;  3W1B A;  3CC7 A;  1YIT A;  2NVT H;  4KLK A;  4R4C A;  3A5U A;  1YHQ A;  2JJQ A;  4A93 G;  3CCV A;  4B3R Q;  3BZK A;  4DR1 L;  4JI2 L;  1XPU A;  4BBR G;  2UXC Q;  3GDE A;  3CCQ A;  3I4M H;  2VQE L;  1X3G A;  4A3K H;  1JE5 A;  3CD6 A;  4DUZ L;  4GLA C;  3KF6 B;  4R4I A;  4ALP A;  4IJL A;  3UE1 A;  3KFU A;  1Q81 C;  2PQA A;  3I4O A;  2HHH Q;  3W5O A;  3HOZ G;  1JT8 A;  3CCJ A;  2UUC L;  1L1O B;  2KBN A;  4GS3 A;  4DR4 Q;  3A74 A;  4DV0 Q;  5C4X H;  1GM5 A;  1N32 Q;  3K81 C;  1QUQ A;  4P73 A;  3PIP A;  4JI7 L;  1I50 H;  2VL6 A;  4LF9 L;  3J7Z C;  1TWA H;  1D8L A;  1VQA A;  1TWG H;  1WCM G;  3ZJY C;  4MTN A;  4LF6 L;  4WJ4 A;  2OQK A;  2B63 G;  4GOP B;  2VNU D;  4J15 A;  5IWA Q;  4DV7 Q;  2CWA A;  2Y0S E;  4B3R L;  1K9M C;  3S1N H;  3UDX A;  2LSS A;  3G4S A;  2QA4 A;  3M4P A;  2A19 A;  5M3M G;  4GNX A;  4UP7 A;  2K75 A;  1SFO H;  1PVO A;  5M5W H;  1YI2 A;  1X3F A;  1HZC A;  5C3E G;  4GNX C;  4DK3 C;  2UU9 Q;  2ZJQ A;  1NMG A;  3ULJ A;  2Q2T A;  3HOW G;  5EAY A;  4DR2 Q;  4WJ3 M;  5GAH C;  1RIP A;  3U4Z A;  2NVX H;  2AKW B;  1K8G A;  2I5M X;  4JI0 L;  2IY5 B;  5M3M H;  4DR4 L;  1N33 L;  3GD7 A;  3PO2 G;  1M90 C;  4JI4 Q;  2GVA A;  2BH2 A;  1FJG Q;  4NXM L;  4DKA C;  5LMN W;  2NN6 G;  1MIU A;  3I4N H;  5LMU L;  3CAM A;  3GTJ H;  2WAQ G;  1VQ7 A;  1TWF H;  2YU9 H;  2JA6 G;  4IO9 A;  4KHP Q;  2B3G A;  3FHW A;  4LFC Q;  1OXT A;  3OW2 A;  1E24 A;  2UUB L;  2MNA A;  2MO0 A;  3CCU A;  2EIF A;  4JYA Q;  1YHA A;  4IOA A;  1HNZ Q;  4POG A;  3L0O A;  1TXY A;  1BVS A;  1Z9F A;  4A3F H;  5IT9 c;  2PNH A;  1IYJ B;  1XMO Q;  3BZC A;  2VQE Q;  4OX9 L;  3HOX G;  5GAG C;  3T1H Q;  1T9H A;  4GN3 B;  5FLM H;  3BU2 A;  4PG3 A;  4DR1 Q;  2EQS A;  1E22 A;  2KCT A;  3M4O H;  2JA9 A;  4OO1 I;  4APV A;  2BA1 A;  4JI5 L;  4JI8 Q;  3RZD H;  4GLV B;  1N9W A;  2PI2 A;  4P72 A;  1KRT A;  4LF5 L;  4LFA Q;  2HT1 A;  1VQF A;  3H3V H;  1CSP A;  2Y0S G;  4AYB E;  1I5F A;  4NXN Q;  2K52 A;  2K50 A;  1PH1 A;  2UXD Q;  4HIK A;  4A3F G;  4DPG A;  4X62 L;  2KHI A;  4C2M H;  3K7A H;  4DV3 Q;  1BKB A;  3L2P A;  2ASB A;  5M5Y H;  3W1G A;  3CC2 A;  2MQH A;  2IHF A;  1SLJ A;  3H0G H;  3KLW A;  3UE0 A;  3CW2 C;  1VQM A;  1EYG A;  3PSI A;  4LUO A;  3EIV A;  2WP8 J;  2I5H A;  3PUY A;  3CF5 A;  4LF9 Q;  4A3L H;  1GO3 E;  3PGZ A;  1JB7 A;  3I4N G;  2FXQ A;  1HNW Q;  3I56 A;  3EN2 A;  5IP7 G;  5C0X G;  3S1Q H;  4UPA A;  4A3M H;  1CSQ A;  2R7Z H;  2V1C C;  4IJH A;  4JI2 Q;  4X6A H;  5K36 G;  2JE6 I;  2Z6K C;  3PO2 H;  1L1O A;  1HR0 Q;  1PH4 A;  3DM3 A;  3STB D;  2I0Q A;  3CCE A;  2UU9 L;  3A5Z B;  4QGU A;  1AE3 A;  4BY7 G;  3HKZ E;  2YTY A;  1B8A A;  2QEX A;  2NVQ H;  4NB3 A;  4A3D G;  2BH8 A;  1EIF A;  4A75 A;  3S2D H;  2UXC L;  3CPW A;  3F2C A;  4X64 L;  2WB1 E;  1KHI A;  3CCS A;  1JMC A;  1PV4 A;  1VQN A;  4DV2 Q;  4LF8 Q;  3GTK H;  3PF4 A;  1GKH A;  3GTP H;  2WB1 G;  1UE5 A;  3J80 i;  4L5S A;  4A3I H;  4QJF A;  1WI5 A;  1XTD A;  1TWH H;  4AH6 A;  1WYD A;  2ZTC A;  1PH6 A;  1MKH A;  3TRZ A;  4B3M Q;  3JAM i;  2ZJP A;  4IOC A;  2WAQ E;  1Q82 C;  4R1J A;  4BY1 G;  1X6O A;  4FDB A;  1SRU A;  4JI7 Q;  1AH9 A;  4GN4 B;  4OWT B;  1WCM H;  3KDF A;  1CKN A;  4YWM A;  2VQF L;  4DV4 L;  4KHP L;  4IFD J;  1UE6 A;  3STB C;  4AYB G;  3J81 c;  1VQE A;  3KF8 B;  4LF4 Q;  4A3I G;  4JCV E;  1SR3 A;  4JC0 A;  5GRO A;  1N36 L;  1J6Q A;  2CCZ A;  3J7A 5;  3RLN A;  3WWV A;  1IL2 A;  1CUK A;  1VQH A;  4JI0 Q;  1K8A C;  2R92 G;  5HGQ A;  1Q1B A;  4Y7N H;  4A3G H;  1OXX K;  1XMO L;  1IBL L;  4X64 Q;  4OX9 Q;  3T1H L;  3F1Z A;  1VQI A;  3AQQ A;  1YVC A;  3CP0 A;  4NXN L;  4YY3 L;  4AQY L;  3I4M G;  2N78 A;  2UXD L;  5FLX c;  1G29 1;  4IFD G;  1YEZ A;  2L15 A;  1VQ5 A;  2ES2 A;  4MZ9 A;  4A3M G;  1QZG A;  3NEM A;  4PZ7 A;  2R7Z G;  1NY4 A;  4DAM A;  1O7I A;  5IP7 H;  4KI0 A;  1Y1W H;  1XNR Q;  5IYD G;  4UY8 C;  1LYL A;  4LFB Q;  1Q1E A;  2B29 A;  1PH8 A;  3ULL A;  4AIM A;  1XMQ Q;  3OYY A;  4P71 A;  1VQD A;  3K0X A;  1XNQ L;  3B6Y A;  4MNO A;  3KYH C;  3OTO L;  3GTG H;  5IYD H;  1HR0 L;  3PO3 G;  5IWA L;  4DV7 L;  2R93 G;  4RMF A;  1L2F A;  4LW1 A;  4IPG A;  4BBS H;  3AFP A;  3GTO H;  2ZTE A;  2VS1 A;  4YCU A;  4QY7 A;  1M1K C;  4A3B H;  5FLM G;  4LFA L;  2D0P A;  1XPR A;  3D31 A;  4DR6 L;  1VQB A;  4DAY B;  1IBK Q;  2IT1 A;  1Q86 C;  2R92 H;  1U0L A;  1K73 C;  1KC8 C;  4DNI A;  3GTM H;  2ZTD A;  4GOP C;  2XGT A;  5C0X J;  2JA5 H;  4XIG S;  1HH2 P;  1XNR L;  4P75 A;  1LM0 A;  3K80 C;  2I5L X;  4LF5 Q;  4RG1 A;  2R7D A;  1ASY A;  2RHS B;  1YBY A;  1N32 L;  1SN8 A;  3S16 H;  3E9H A;  4OWW B;  4DV5 Q;  4LUV A;  5IYC H;  1VCI A;  4DV1 L;  2JA6 H;  1GD7 A;  3K8A A;  2HQL A;  3PUV A;  1S40 A;  4IPD A;  3S14 H;  3CQZ H;  1KXL A;  4L5T A;  2N3S A;  4R4Q A;  3KF6 A;  1GVP A;  1HNW L;  1N36 Q;  4A3J G;  1BBW A;  5M3F H;  1S3O A;  5LMN Q;  2LXJ A;  4OON A;  4NPS A;  3PUX A;  1SMX A;  4A3E H;  1R9T H;  4JBJ A;  1IBK L;  1IBL Q;  4A3C H;  5GAE C;  4BA2 I;  2IX0 A;  2CFM A;  4DV2 L;  4LF8 L;  4LWC A;  4A3D H;  2ID0 A;  2F4V Q;  1SE8 A;  3G48 A;  2A8V A;  3HOU G;  2YTX A;  4A3C G;  1A0I A;  3FKI H;  2AMC B;  3CCL A;  2CQO A;  1NBW A;  1QVC A;  3T1Y Q;  4A3J H;  5JJL A;  2B63 H;  3CPF A;  2E2I H;  4DV3 L;  3I2Z A;  2VQF Q;  1X9N A;  2R6G A;  1EOV A;  1PH9 A;  1HNX Q;  2DGY A;  4OWX B;  3NEN A;  3TEH B;  2A1A A;  5FJ8 H;  4C3H H;  2CWP A;  4DR5 Q;  2HHH L;  2VUM H;  1HZ9 A;  4LFB L;  2N8N A;  3CCR A;  3UDG A;  1EQR A;  1KL9 A;  5IYC G;  3H0G G;  4JI3 Q;  1I6H H;  5LMN L;  3M3Y H;  3MEF A;  1FVI A;  4GN5 A;  3OTO Q;  5GQO A;  4A76 A;  4DV6 L;  2E2J H;  3RLF A;  1X56 A;  4GKJ L;  5GAD C;  1CKO A;  2N49 A;  1KD1 C;  4YHH L;  3HOY G;  1I3Q H;  4UP9 A;  1V43 A;  1MJE A;  4JI8 L;  3F2D A;  3KJO A;  1I94 Q;  4BXX H;  3CCM A;  1W3S A;  4YY3 Q;  4YWK A;  4HID A;  4DR2 L;  1TWC H;  1YNX A;  3TRE A;  1JJ2 A;  1Z47 A;  2UXB L;  3PO3 H;  1A62 A;  4GKK Q;  2DUD A;  3A0J A;  1HZA A;  4EX5 A;  1N34 L;  2UUA L;  5M5X H;  1E1O A;  3F2B A;  4B3S Q;  2PQA B;  1D7Q A;  1KIX A;  1FJG L;  3CC4 A;  3AYH B;  3GTL H;  4LF7 Q;  3E0E A;  2YTV A;  2EXD A;  3KJP A;  1H95 A;  5DLQ E;  4PMW A;  5IE8 A;  3IRB A;  4GKJ Q;  4P74 A;  1Y1W G;  4OO1 G;  5IP9 H;  5JJK A;  4X65 Q;  2UUB Q;  1QZH A;  3NBH B;  5JEA J;  2F4V L;  1LUZ A;  5IYB G;  4JV5 L;  1L1O C;  1N33 Q;  1C9O A;  3LGJ A;  3HKZ G;  1VQP A;  4JBM A;  3M7N A;  4L5Q A;  4GOP A;  2F52 A;  3HOV G;  3CMA A;  2IX1 A;  4DR6 Q;  4A3G G;  2KHJ A;  3VDY A;  1PH7 A;  4ME3 A;  3T1Y L;  2E5L Q;  4H02 A;  4DR7 Q;  4DV0 L;  1X3E A;  2K5V A;  3ERS X;  4LFC L;  3RLO A;  2JA7 G;  4IFD I;  1X55 A;  1J5E L;  5JEA G;  1K0R A;  1VQL A;  2K5H A;  4B3M L;  2C35 B;  2ATW A;  4QL5 A;  1KQS A;  2OTJ A;  1XNQ Q;  2KCM A;  5ELN A;  4DV4 Q;  4DR3 L;  3Q8D A;  4LF6 Q;  2VUM G;  3J81 j;  4B3T Q;  3GO5 A;  4DV6 Q;  1Q12 A;  3I7F A;  5H1S E;  1VQC A;  1E7Z A;  1P8L A;  2D62 A;  4LF4 L;  4K0K Q;  3CXC A;  2Z0S A;  5ELO A;  2JA7 H;  2KEN A;  1JJC B;  4O2D A;  1HZB A;  4BA1 I;  4PZ6 A;  1XJV A;  4R4O A;  3M9B A;  1DGS A;  4O0A A;  4IPC A;  3TS0 A;  1K3R A;  1NJI C;  3S15 H;  5AJ3 Q;  2CKZ B;  1KAW A;  5IYB H;  1G6P A;  4X62 Q;  1N8R C;  4A4I A;  1HJP A;  4JBW A;  2JA8 H;  3S24 A;  1OTC A;  3J80 c;  4A93 H;  1E1T A;  4YWL A;  4BY7 H;  1UEB A;  1CKN B;  4DR5 L;  3PUW A;  1PYB A;  1I94 L;  3U4V A;  5M3F G;  3ICE A;  2NVY H;  3NEL A;  1B7Y B;  4XTC S;  3S1R H;  1Q8K A;  3DLL A;  1XPO A;  1JJG A;  3MXN B;  1VQ4 A;  4B3S L;  3GTQ H;  4DV5 L;  2HIX A;  1S72 A;  2ZJR A;  4DR3 Q;  4QIW E;  1AE2 A;  4B3T L;  3M85 A;  1C0A A;  4LF7 L;  1PH5 A;  5BR8 Q;  4JI6 Q;  2PI2 E;  1Y1V G;  2NN6 I;  4KHZ A;  2ZM6 Q;  1PH3 A;  1X54 A;  4C3J H;  2IHE A;  3RN5 A;  1YJ9 A;  4JI3 L;  1HNZ L;  2Q2I A;  1W2B A;  1PFS A;  2RHQ B;  2JEA I;  5JJI A;  5C0X I;  5AJ3 L;  3D0F A;  4R4T A;  4EQ5 A;  1PH2 A;  1PYS B;  1YIJ A;  3HOY H;  1LTL A;  2UXB Q;  1VQO A;  1MJC A;  1A63 A;  3RZO H;  1NE3 A;  4YCW A;  1K83 H;  4JI5 Q;  4L5R C;  2H5X A;  1VQJ A;  5C4J H;  3TQY A;  3UDF A;  4UP8 A;  5C44 H;  3HOX H;  2UUC Q;  3AEV A;  4BBS G;  1VQ6 A;  3K7U C;  4POF A;  4GKK L;  4JI4 L;  2AWO A;  2K4K A;  4AQY Q;  1Y14 B;  1P16 A;  2E5L L;  1OXS C;  1EQQ A;  1OXV A;  2Z6K A;  2BA0 A;  1Y1V H;  2RCN A;  1U5K A;  2HIV A;  2JQO A;  1J5E Q;  1C7Y A;  4Y52 H;  1CKM A;  4DV1 Q;  3ER0 A;  5FJ8 G;  1WOC A;  2JEB I;  1N34 Q;  3ULP A;  1YJW A;  1X65 A;  4TVA B;  3SGI A;  5E7N A;  3U50 C;  3H15 A;  3U58 A;  2OCE A;  1IBM Q;  1VQK A;  1VS0 A;  4JV5 Q;  1A8V A;  4JOI C;  2JA8 G;  1EFW A;  1G51 A;  3F8T A;  4JG2 A;  1BBU A;  3FKI G;  3PV0 A;  4PZ8 A;  3PCO B;  1YZ6 A;  3KOJ A;  4YHH Q;  4HIM A;  3KDF B;  3HOU H;  2VW9 A;  5C3E H;  3S1M H;  3CME A;  1V1Q A;  4HJA A;  5HY6 A;  3PF5 A;  1QVF A;  3S17 H;  4DR7 L;  1B70 B;  3PUZ A;  3H3V I;  3HOW H;  4X66 L;  3FP9 A;  3J81 i;  2MO1 A;  4DUZ Q;  3RNU A;  4HJ9 A;  1XMQ L;  1E3P A;  4JI1 L;  4C3I H;  4A3E G;  2YV5 A;  1KRS A;  3HKS A;  2WFW A;  2YYZ A;  1HR0 W;  3M4Q A;  3L7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...