3GTJH

Backtracked rna polymerase ii complex with 13mer rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
146
structure length
136
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtjH00
4P74A 4A3LG 3GTKH 3RZDH 4A3IH 4A3FG 3EBEA 4LF7Q 1MJCA 2KENA 4QJFA 4UY8C 2BA0A 1EUJA 4DR6L 1WCMH 3W1GA 1VQGA 2IT1A 3Q8DA 4YCVA 3I2ZA 4JI8Q 4X66L 4DV2Q 2OTLA 1KXLA 1EWIA 1YVCA 4LF7L 2EIFA 2VY3A 3PIPA 4YWKA 1XPRA 1VQFA 4DR6Q 3HKSA 3SGIA 2C35B 2I5HA 4X66Q 1QVGA 1PHJA 2RF4A 1PFSA 4ME3A 4AYBE 1BBUA 1JB7A 1FL0A 3KFUA 2OCEA 3TS2A 4NXNQ 4X64Q 4DR1L 1VQMA 4R4IA 1I6HH 3UDXA 4KI0A 1NJIC 2LSSA 5FLXc 4B3RL 4FDBA 3I56A 4QQBX 1YEZA 2D0OA 1HNZL 3A5ZB 1VQIA 4NXNL 4JI0Q 1YHAA 2JK8A 1X6OA 3BZKA 2JA8H 4LUVA 4JI6L 4A3DG 4Y7NH 4LF4Q 4Y52H 5M5YH 3S2DH 3ERSX 3STBD 4JI2L 1CSQA 3CAMA 4IPDA 1EIFA 1LM0A 4NPSA 1UEBA 4UP7A 5IP9H 3F2BA 1UE5A 3KOJA 4DR3L 5C0XI 1VQ7A 4B3SQ 5BR8Q 3PO3G 1WJJA 4BA2I 3H0GG 2GVBA 1Q82C 3KYHC 2UUAQ 5IYDH 3NELA 3UDGA 4GN5A 1IBML 5LMUQ 4A3FH 2BH2A 4DR3Q 4QGUA 1PA6A 2AWNA 4IPCA 4YWMA 4GLVB 2N8NA 5BR8L 3CCJA 3KDFA 1Q86C 4YHHL 4B3SL 2UUAL 2V1CC 1J6QA 2E5LQ 5JJIA 2ZJPA 1N34Q 3U58A 1X55A 2KBNA 3AEVA 4BY7G 4PG3A 1I50H 4A3CH 1N32Q 2UXCQ 3CCEA 1L2FA 1X3GA 1Y14B 5C0XG 3CPWA 4DK3C 1Y1WG 1ASZA 1N34L 4WJ3M 1T9HA 2RCNA 5HGQA 2UXCL 1N32L 3G48A 1V1QA 1X3EA 3S15H 4KHPL 1OTCA 5HY6A 2R92H 3S1QH 4DV0L 1YBYA 5H1SE 3HOYG 3E9IA 3GTJH 3G4SA 1KAWA 1WCMG 1GM5A 4BBRH 4JBMA 3I4NG 1KL9A 2AHOB 2VS1A 3MEFA 4DV3Q 1K8AC 3U4VA 4AQYQ 1I94Q 1YI2A 2B63H 1VQPA 3D0FA 3PF5A 3HOUG 1OXUA 1HZAA 2A1AA 4PZ8A 4QY7A 4NXMQ 1XMOL 3HOWH 4A3GG 1KIXA 2UU9L 2F52A 3CW2C 1AE2A 2YTYA 3HOZH 2I5LX 2HIXA 3HOVH 4KLKA 1YJNA 2UXDL 1B7YB 2YTVA 1XMOQ 1PH1A 1SMXA 1UWVA 3CPFA 5JJKA 5ELNA 3M9BA 3CC7A 3H3VI 2B3GA 1IZ6A 2ZTDA 1TWHH 4A3DH 4P75A 4TVAB 4APVA 4A75A 4GOPA 1DGSA 2ZJRA 4DV2L 3S2HH 3J7ZC 2XTIA 3W5OA 1S40A 1D7QA 1M1KC 1N9WA 3PO3H 1Y1WH 4O2DA 2PMZE 4DNIA 3CCMA 5C3EH 3I4MH 2ZJQA 4BBSH 2N78A 2I5MX 4O0AA 3NENA 4A3MG 3GTGH 1SLJA 3CD6A 3S1NH 2VL6A 3PCOB 4P73A 3K81C 1G6PA 2QEXA 1GD7A 1UE7A 4L5RC 4QL5A 2JA5G 4DV5Q 1GVPA 1TWGH 1C9OA 3GDEA 4WJ4A 2R7FA 4BXXH 1U0LA 2PI2E 3RR5A 5M5XH 2Z6KC 2NVTH 3HOWG 1K73C 1JMCA 1J5EQ 4DV5L 1L1OC 3PUVA 1XNQQ 2UXBL 1YIJA 1G51A 4EX5A 4A3KH 1VCIA 1IBMQ 1D8LA 1EFWA 5LMUL 1Q7YC 2JA6G 4IFDI 4GKJQ 1E22A 3HKZG 2YYZA 4GN4B 4YHHQ 3M7NA 1C0AA 1NY4A 4JCVE 5FLMH 2UXBQ 3AFPA 2E2IH 1NMGA 5C44H 3GTOH 4POGA 4GNXA 2A19A 3A74A 1HJPA 1L1OA 2JE6I 2CFMA 2VQEQ 3CXCA 3DLLA 5IP7H 3FKIH 3IRBA 2PNHA 3STBC 2PI2A 3GD7A 4DR5Q 3KLWA 1SROA 4YWLA 5C4XG 1FGUA 1VQNA 4A3LH 2UUCL 3WWVA 5C3EG 3EIVA 1IBKL 3I4MG 3UDFA 2K5HA 3M4PA 3GO5A 5M3MH 4KHPQ 4DR5L 3I4OA 1C7YA 1E24A 3HOXG 4LF8L 4HJ7A 1XPUA 1JT8A 1BVSA 1YHBA 1CSPA 2OQKA 1IBKQ 2JA5H 3PO2H 4A3JG 2VUMH 5LMNW 5GAGC 5IYCG 4DV3L 1PH7A 3NEMA 4AQYL 1I94L 4IJLA 4JOIA 4LF8Q 1IYJB 2E2JH 1SR3A 4A76A 1XNRL 5GAEC 4NXML 3K80C 2GVAA 2E8GA 4MZ9A 2QGQA 1N36Q 4XTCS 3TQYA 3KF8B 2UU9Q 3M4QA 1K83H 4MNOA 4UP8A 4GOPC 4C3HH 3LGJA 1X9NA 1VQCA 2CWAA 3I55A 3J81i 4DV4Q 3CC4A 4UP9A 1XNRQ 3AQQA 1VQ8A 3KF6B 2B29A 4DAYB 2D0PA 4DKAC 4L5SA 1QVCA 2UXDQ 3CMEA 5K36G 2KHIA 4JYAL 2ZTCA 1PV4A 4OONA 2HT1A 3K7UC 3K7AH 2K5VA 1NMFA 4RG1A 3OW2A 1N33Q 3F8TA 1PH5A 3OYYA 2MQHA 1RIPA 2BH8A 4JI7Q 3PUZA 1S72A 1JJ2A 2IX1A 2RHSB 1XMQL 3HFZB 4DR7Q 2Y0SG 4IPGA 4JI5Q 1N33L 4OO1G 1AE3A 4A3KG 4JYAQ 1X3FA 5IYBH 1HNWQ 5JEAJ 1A62A 4GOPB 1I5FA 3TS0A 4A3EH 1XMQQ 4DR7L 4OX9L 1OXVA 1B70B 3PUYA 3F1ZA 5C44G 1SN8A 1AH9A 1QUQB 4KHZA 4A3JH 2R6GA 2OWOA 2MO1A 2F4VQ 4DV7Q 3J81c 4OX9Q 4GN3B 2YTXA 4DUYQ 1S3OA 1XTDA 5JEAG 5IYDG 5M3FH 1M90C 2R93H 1VQHA 4LFAQ 1J5EL 2NVYH 4C3IH 1JE5A 1O7IA 1HZBA 4DV7L 1VQ5A 5JJLA 1E7ZA 1VQBA 4NB3A 3AYHB 2R92G 3JAMc 1XNQL 4OXPA 4DUYL 4J15A 2RHQB 3HOYH 4IFDJ 2NZHA 1Q81C 5AJ3Q 1I3QH 4LFAL 4GKJL 4BY7H 4B3TQ 3KF6A 4X62L 4JC0A 4IJHA 5J3BA 2GN5A 1Q46A 1H95A 4IOAA 1UE1A 1XJVA 3T1YL 4JBJA 1OXSC 1YJ9A 2CWPA 2VQEL 2R7DA 4B3TL 5GADC 2R7ZH 4YY3L 3HOZG 3D31A 4X62Q 4GNXC 2IHFA 4IFDG 2R93G 4IPHA 2JA9A 2D62A 2DGYA 4DR2L 1HZ9A 4L5QA 2UUCQ 4JBKA 2IHEA 3T1YQ 3S14H 2LXJA 4DV6L 3RLOA 1FVIA 3KJPA 3S1MH 1PH6A 4YY3Q 4A93G 2JJQA 4PMWA 3I4NH 4DV1L 3M3YH 2JEBI 4LFBQ 2KHJA 4EQ5A 2HQLA 2NN6I 4A3BH 1SFOH 2B63G 1E1OA 3UDIA 3CC2A 2CQOA 5E7NA 4LUZA 3CMAA 1YNXA 3I7FA 3HOUH 4LF9L 4RMFA 1OXTA 4LFBL 3H3VH 2VQFQ 3CF5A 3S17H 4YCUA 2K52A 1X56A 4LF6L 1PH3A 3HOVG 4BY1H 4LF9Q 3BJUA 4JI2Q 3A5UA 4A3IG 1N36L 4BBSG 2QA4A 4A3EG 2ZTEA 2LXKA 4C3JH 1G291 4DV4L 1VQAA 1VQDA 4AH6A 2OQ0A 4UPAA 3CCSA 4AIMA 4LF6Q 2OTJA 1KD1C 2MO0A 3L2PA 4A4IA 5IT9c 2N3SA 1FJGQ 1X54A 4OWTB 4HJAA 1TWAH 3PSIA 1ASYA 2YU9H 3CCVA 3S1RH 5EAYA 4AYBG 4HIMA 1WFQA 2ATWA 3GTMH 4BXXG 1PVOA 1UE6A 1P16A 2ES2A 4JI7L 4DAMA 3CQZH 3M85A 5M3FG 1NTGA 1VS0A 2NZOA 2ZM6L 3VDYA 2R7ZG 4JI5L 3RN2A 1QVFA 4XIGS 2JQOA 1V9PA 4R4CA 5GAHC 3S16H 3FHWA 2XGTA 1SRUA 2YV5A 4IO9A 1L0WA 3RLFA 2JA6H 1HNWL 2I0QA 2KCMA 2EXDA 2FXQA 3CCUA 1R9TH 4L5TA 1JJGA 3G6EA 4R4QA 4TQUS 3AFQA 2K4KA 1CKNB 2VNUD 2Q2IA 5ELOA 1JJCB 4HJ5A 1EYGA 2EQSA 1BKBA 2F4VL 1KQSA 1NBWA 1KHIA 1E3PA 4DUZL 2PQAA 2DUDA 3GTLH 3T1HQ 1MKHA 2AKWB 3RN5A 3H15A 1MJEA 3ULPA 4R1JA 1QZGA 3UE0A 1PYBA 4DUZQ 4YCWA 1PH4A 2A8VA 1EIYB 2MFIA 2NVQH 1Q12A 3ICEA 1CKMA 4MTNA 5AJ3L 1YJWA 1TXYA 3RZOH 1A8VA 1YZ6A 3E0EA 3PUXA 5GQOA 3GTQH 3U4ZA 4A3CG 1VQ4A 2VUMG 2Y0SE 4PZ7A 5IP7G 3PV0A 1SE8A 3ULLA 3ZJYC 4JOIC 3EN2A 2Z0SA 4LW1A 5IY0A 4JI0L 1A63A 4DPGA 2Q2UA 4DR4Q 1LUZA 3F2CA 4K0KQ 1U5KA 4JBWA 4LNQA 4BY1G 1MIUA 1N8RC 4X6AH 1EQRA 4DK6C 1B8AA 5M3MG 3J81j 3RNUA 3OTOQ 4DR2Q 4DR4L 1K8GA 4JG2A 1VQJA 1NE3A 4DV6Q 4B3ML 3MXNB 1Q1EA 2WFWA 3BZCA 2NVXH 3G71A 1XPOA 1IBLL 4DV1Q 4LF5L 1A0IA 4IOCA 2AWOA 4LFCQ 4X65L 1PH9A 4P72A 2IX0A 4B3MQ 3GTPH 1VQEA 3FP9A 4R4OA 2WAQG 1IBLQ 4P71A 1KRSA 2JEAI 3J7A5 2E2HH 4GKKL 2CKZB 2VQFL 1PH8A 4LFCL 4X65Q 1YHQA 3KDFB 1Y1VG 5FJ8H 1Q8KA 2JA7H 3B6YA 4JI8L 5IYBG 3K0XA 1VQ6A 4BBRG 3PUWA 1QZHA 3HKZE 1PH2A 1WI5A 3U50C 3JAMi 1HR0Q 1OXXK 1VQLA 4GKKQ 3DM3A 1CKOA 3K8AA 4GS3A 2VZAA 5M5WH 2ASBA 1GO3E 4LUOA 1FJGL 1WOCA 2N49A 1E1TA 3L7ZC 4R4TA 1KC8C 4A3GH 1HR0L 1VQ9A 2Z6KA 4QIWE 1IL2A 1K9MC 4X64L 4DR1Q 2WB1G 4B3RQ 4BA1I 5C0XJ 4LWCA 2HHHQ 3M4OH 1HNZQ 2WP8J 2ZM6Q 3A0JA 2K75A 1K0RA 1HR0W 1VQKA 5LMNL 4C2MH 2K14A 5C4JH 4HIKA 4PZ6A 4JI4Q 4JI6Q 1Q1BA 2MNAA 2HHHL 4LF4L 3TREA 3J80i 3PF4A 3L0OA 5LMNQ 3S24A 2WB1E 3E9HA 3TEHB 2WAQE 4JI4L 2NN6G 3ER0A 1EOVA 1CUKA 3F2DA 2VW9A 1GKHA 2PQAB 1Z9FA 5IE8A 5IWAQ 3CCQA 4GNXB 4HJ8A 2Q2TA 4OO1I 1L1OB 2BA1A 3BU2A 4JI1Q 4HJ9A 4GLXA 1VQOA 4A3MH 3T1HL 1TWFH 1Y1VH 4H02A 3W1BA 2E5LL 3JC66 1K3RA 3NBHB 3CP0A 2IY5B 4A93H 4JI3L 5IWAL 2Q2HA 2HIVA 2K5NA 1IXRA 1X65A 4JI1L 1LTLA 3PIOA 1WYDA 4POFA 2AMCB 1HNXL 2K50A 2CCZA 1HZCA 1LYLA 4JI3Q 5IP9G 2ID0A 2L15A 1W2BA 1CKNA 2F3IA 3UE1A 2ALYB 3CCLA 1W3SA 1BBWA 3ULJA 5C4XH 4HIDA 4ALPA 4JV5Q 1RL2A 3J80c 4DV0Q 1PYSB 1HNXQ 4K0KL 1V43A 2KCTA 5GROA 5FJ8G 2H5XA 2JA7G 1HH2P 4OWWB 2UUBL 3HOXH 1KRTA 2JA8G 4JV5L 3OTOL 5FLMG 4HIOA 1EQQA 4A3BG 4OWXB 3CCRA 3KJOA 1P8LA 3PO2G 3PGZA 3RLNA 3TRZA 5IYCH 4LF5Q 1TWCH 3FKIG 5DLQE 1YITA 2UUBQ 1QUQA 1Z47A 3H0GH 4GLAC
chains in the Genus database with same CATH superfamily
2RSOA 2A69C 4A3FG 2DY7A 1MJCA 2K05A 3HOZB 1RD9D 1CI3M 1G91A 1Z7TA 5BN3A 2HCCA 2L4NA 4O42A 4ZCKA 2C9OA 4LF7L 2QEJC 1CT1D 4QIWB 1H9MA 3SGIA 3K5OA 3J7AF 4AYBE 1BBUA 3KFUA 4X64Q 2E2IB 1I6HH 4KI0A 1EY7A 4XYOA 4MIUA 1X6OA 2PPBC 4A3DG 1STBA 4Y7NH 4LF4Q 2PO4A 4ZK9B 1PTOH 4IPDA 1ESRA 4UP7A 4DR3L 1TWFB 3KOJA 3OMCA 4B3SQ 1F2LA 1VMPA 4JK1C 5LMUQ 2BH2A 2CH4W 1PA6A 2AWNA 3CU7A 4B3SL 3KDFA 4YHHL 4LJZC 3J7YW 2V1CC 2E5LQ 1SNOA 2ZJPA 3AEVA 5A2QE 4BY7G 5C4ZA 1N32Q 2UXCQ 1LV9A 4DNTB 4C2MB 4KY5A 1ASZA 2UXCL 1N32L 1V1QA 1EU4A 1I6HB 4RA8A 1A3VA 2H1EA 4DV0L 1YBYA 1SYGA 2TSSA 4FYDA 1W6KA 1GM5A 2EYHA 1SYBA 5I2XA 1FNWA 1KAAA 3U4VA 5M3MB 5COYA 1VQPA 1KLGD 1OXUA 3HOUG 2A1AA 3SEBA 4CKCA 4A3GG 4R8NA 2UU9L 2G9HD 3J80L 2I5LX 2Q8TA 1LABA 5I6YA 3BYTB 1SNMA 1EEID 4HSVA 3M9BA 5IGFA 1H9SA 4RGOS 4APVA 3TMEA 2EPBA 1EYCA 3MVVA 3NHHA 1XX8A 4EVOA 2ENBA 5DM63 5C3EH 1H9KA 2X69A 4A3MG 3NENA 3P75A 2SDFA 1IKMA 1GD7A 1UE7A 4L5RC 2JA5G 2R7FA 1D1KA 1U0LA 3KK7A 2PI2E 3S1MB 1K73C 1BOSA 3IL8A 3PUVA 3VR2A 2VB2X 4I7ZC 2M00A 1XNQQ 1YIJA 4A3KH 1VCIA 4GKJQ 1E22A 3HKZG 2R93B 4PQXA 1NY4A 4JCVE 4EGVA 5FLMH 2E2IH 5C44H 1B3AA 4H44C 5EBCA 3HGBA 1I3QB 3EROA 2KJXA 2PI2A 1EFID 5JVH3 3E6ZX 2K33A 3UDFA 4UDUC 4KHPQ 4DR5L 1C7YA 1E24A 5C4XB 1XPUA 1YHBA 1S4ZA 2JA5H 3HOUB 3PO2H 3MHBA 1ICWA 1PZID 3K5NA 1C48A 1PH7A 2XRSD 4KTAA 4IJLA 1B1ZA 4JOIA 4LF8Q 2E2JH 1EY9A 1GUOA 5GAEC 4NXML 2GVAA 2E8GA 4MZ9A 1N36Q 3KF8B 1K83H 2PW5A 2OEOA 3LGJA 1VQCA 2A6ED 3J81i 1ZXTA 2KEDA 3AQQA 1XNRQ 2B29A 2UXDQ 5EJWA 3SDZA 2RBMA 5IOCA 1TKWB 3MZ5A 1KABA 1LTSD 1EWCA 3OYYA 5LL6X 3C1FA 2WV6D 1S72A 2IJ0A 1AEXA 2RHSB 1XMQL 3HFZB 2Y0SG 3T4AC 2F3WA 5I2YA 3D6WA 2G5DA 3ONAB 1HNWQ 2QF7A 3RMHA 4GOPB 3TS0A 1XMQQ 2O5IC 1JWUD 2JA6B 3P1HA 2Q8IB 2JA5B 1SN8A 2A6HC 2F4VQ 3J81c 4M8AA 2E2JB 1EOTA 2EYOA 2K03A 4LFAQ 1K83B 1TY2A 3NWSA 1S5BD 4C3IH 5ISRA 4PNYA 4K6DA 3TP8A 2R92G 3JAMc 4ULLA 1CA5A 3GTOB 2I46A 4J15A 3HOYH 4LFAL 3UI2A 4B3TQ 3NBHA 3K57A 4F88A 4JC0A 4IJHA 2GN5A 1Q46A 3GTMB 1XJVA 2HQEA 4QCLA 1YJ9A 2CWPA 4J8QA 2VQEL 5K5PA 1PYWD 3HOZG 2IHFA 5G3LD 3W2DA 4IPHA 4L5QA 4ABNA 2IHEA 2LXJA 5DAUA 3RLOA 2O5JC 4A3GB 3S1MH 2A73B 2JJQA 3I4NH 2KHJA 4XQNA 1SDFA 1LTTD 2ZXRA 1E1OA 3CC2A 4I7AA 1YNXA 4LF9L 4KN4C 4KJOA 2BE5C 1BCPD 3VR4A 1MSGA 3HOVG 5DNFA 5ELFA 3OIQA 3P20A 4BY1H 3A5UA 4MN3A 1VQAA 4UPAA 1PRTC 4KHVA 4AIMA 1KD1C 1E2ZA 3L2PA 2IWHA 5KGUA 2MPMA 4FXKC 4HJAA 2V4DA 5FK9C 3S1RH 4DK1A 1JOQA 3GTMH 1TS2A 1F2ZA 1P16A 4DAMA 3M85A 5M3FG 2A6EC 1HA6A 2NZOA 1VS0A 2ZM6L 3VDYA 1BDOA 1QNUA 2Z8LA 1UNSA 4XIGS 4CJ0B 2LMCB 1SRUA 2XGTA 1PTOD 3RLFA 2KCMA 1F9PA 3I70A 1JJCB 3MTSA 4HJ5A 1KDBA 1BKBA 2EJMA 4ZRZA 1KHIA 2VXWA 2DUDA 4OELB 2IW3A 2FFKB 3RN5A 3H15A 1MJEA 3MWYW 1YNNC 1PYBA 2PNRC 2K5WA 1Q12A 5J39A 3S2HB 4MTNA 1TXYA 1ESFA 3RZOH 2R7ZB 3GTQH 3J81E 2OXPA 1Z6HA 3ULLA 1GJXA 3ZJYC 4LW1A 3EN2A 4R9WA 1EIGA 1LUZA 5DEHA 3F2CA 4LNQA 1N8RC 4X6AH 1EQRA 4DK6C 1B8AA 3T53B 3WOFA 1NR4A 4DR2Q 4KN7C 4IN3A 5EPKA 4JG2A 1VQJA 3Q6SA 2WFWA 4LF5L 3VYUA 1AP0A 5CV9A 1DCZA 1TVXA 4MTKA 1Q3LA 1GUNA 3BZDB 1IBLQ 1KRSA 3OOCA 3J7A5 4IUPA 4OL7A 1TWCB 3S2DB 1JOOA 2L55A 1ET9A 4RGTA 2JA7H 3B6YA 3E0JA 4RAUC 3PUWA 4C56C 3HKZE 2MP1A 1QZHA 3U50C 4UHVA 4GS3A 3MEHA 2ASBA 1GO3E 4LUOA 1WOCA 4R4TA 2NTSA 1LT4D 4A3GH 1VQ9A 2Z6KA 4DR1Q 3OIPA 5IT9L 4LWCA 2HHHQ 1HNZQ 1LTBD 4ZAIA 1QCBD 4HIKA 4JI6Q 1MGSA 2HHHL 1D2BA 1V1OA 2KHSA 3PF4A 3S24A 4FF4A 3QOLA 2WAQE 5NUCA 1B44D 2NN6G 1EEFD 1CUKA 1PTOB 4B08A 2VW9A 5ELCA 3EQLC 2PQAB 4HJ8A 1Z9FA 5IE8A 4OO1I 4JI1Q 1VQOA 2L9HA 3MXGA 2AQ3B 5C5LA 3T1HL 1Y1VH 2E76C 3W1BA 1K3RA 3NBHB 3CP0A 2F0GA 3H09A 1J8IA 4JI1L 2P5ZX 5KNBA 4G7HC 3X3MA 4POFA 2AMCB 1L0YB 2A5HA 1BCPF 5D3IB 5EPLA 3C46A 1B53A 4ALPA 2IPKD 2J7ZA 1QNKA 1QWYA 1V43A 5GROA 5FJ8G 2H5XA 4OWWB 4M1UB 2JA8G 1EY8A 4HIOA 1EQQA 1IKLA 3PIP3 2BCOA 5I4DA 3SK6A 3MXUA 3PGZA 3HRZC 1AN8A 3QR8A 3FKIG 1SJED 1Z47A 4GLAC 1SE3A 1SNPA 4P74A 4A3LG 3GTKH 3K0YA 3RZDH 1WTVA 4LF7Q 2J4XA 4Q0FA 4NKLA 4UY8C 4DN4M 1GUGA 1WCMH 2IT1A 3Q8DA 4JI8Q 2EY1A 4X66L 2K5DA 1KXLA 1EWIA 1YVCA 3VR6A 3CHBD 1HA5A 1ICFB 1VQFA 5C0XH 3HKSA 4KKTA 4X66Q 1ILPA 1QVGA 2PZWA 5FLXE 5EKLA 1JB7A 4J6HA 1FL0A 2OCEA 3NP8A 3IAYA 5FOBB 2EY5A 4R4IA 2L0CA 5JPNC 1NJIC 4B3RL 4QQBX 3C2PA 3M4OB 1YEZA 2D0OA 2X6LA 5K36H 4KD3A 1VQIA 3GV3A 3EJIA 2JK8A 4RH6A 2PZUA 4F87A 5KYIA 3PMFA 3S2DH 4RCNA 3CAMA 3URYA 1M1KC 3F2BA 4NPSA 4PV1C 5IP9H 4JI0L 5CV4A 1SEBD 1UE5A 1B2TA 1WJJA 3H0GG 2GVBA 1F9QA 3KYHC 5IYDH 3UDGA 1IBML 1KTKA 4YWMA 4GLVB 5ELEA 2B2UC 2UUAL 2MGSA 3HEJA 4PG3A 1GXDC 1I50H 1Y14B 5C0XG 2A74C 2O2LD 1Y1WG 4HCSA 1N34L 2NB0A 1IHZA 2RSNA 3G48A 1STYA 3E9IA 3GTJH 1KAWA 1WCMG 5F2DA 1NR2A 3I4NG 2F0UA 2VS1A 5FO7B 1CA6A 1K8AC 1I94Q 4AQYQ 2B63H 3I90A 1WTPA 1F9SA 4PZ8A 2RCFA 2F0IA 3CW2C 2YTYA 3HOZH 4IFDH 2CQAA 1A3TA 4XT1B 4KLKA 3O13A 1B7YB 2YTVA 4DAPA 4BS9A 4RGMA 3TP7A 3OPOA 1UWVA 3HP3A 5JJKA 5ELNA 4NDXA 3CC7A 1Y8NB 2E74C 2B3GA 2ZTDA 5KRUA 1LTAD 1TWHH 4P75A 4A75A 4GOPA 4DV2L 3S2HH 1DM0B 1PFMA 1S40A 3Q0AA 5D65A 1N9WA 1BO0A 1EWHA 4DNIA 3BDLA 3K6OA 3DXJC 1D5MC 3CCMA 2I5MX 1F77A 3GTJB 1S5FD 2F0WA 3S1NH 3K81C 3GTKB 4QL5A 2MJ8A 1TWGH 3GDEA 5A35A 5L37A 4WJ4A 4BXXH 1SAPA 1VF5C 5M5XH 5CMDA 2CVRA 1A2UA 4RHRA 5LHY1 1J5EQ 3U9OA 4K8JA 1NSNS 1G51A 3I3CA 1EFWA 1Q7YC 4H7BA 2JA6G 5C3XA 2CHBD 4GN4B 3VA5A 1AW7A 1S5CD 3AFPA 2A19A 3A7LA 3A74A 1L1OA 2CFMA 3CXCA 5IP7H 4C3JB 4DR5Q 3KLWA 4YWLA 5C4XG 4A3LH 2UUCL 1PFNA 3EIVA 2F0FA 1IBKL 2WINB 3GO5A 4CDCC 5M3MH 1WTHA 1EQVA 3M3YB 2F0MA 4LF8L 1U4LA 3D6CA 4HR7B 1SNDA 3A54A 3SK8A 1CSPA 4LK1C 1IBKQ 2VB3X 3DWPA 5LMNW 3ERQA 2IL8A 3HOXB 2NWGA 1XNRL 1SR3A 4A76A 1HUMA 1CZGA 2R93G 2QGQA 4XTCS 5T1GA 1ZYRC 1ENCA 3HOYB 2DNEA 4C3HH 1X9NA 3I55A 1ONLA 4DV4Q 3KF6B 1Y8OB 1PZJD 3TSSA 4JYAL 2ZTCA 5IODA 1JORA 5CORA 2A68D 3BVZA 4NP5A 1U4RA 1PH5A 2L11A 2BH8A 3PO3B 4JI7Q 3KLSA 1JJ2A 4CBVA 1JWSD 4DR7Q 4IPGA 2BDNA 2EE1A 5A2QL 5C4JB 2GA4B 1PRTF 4OO1G 4A3KG 1R4QB 4X3UA 3QOJA 4DR7L 4OX9L 4IALA 1WTOA 5C44G 1LT6D 1T5XD 4OX9Q 4A3KB 2NBFA 2F0DA 4GN3B 2YTXA 4DUYQ 2DNCA 5IYDG 3NSWA 2R93H 1TWHB 5IGDA 1WTXA 1JE5A 1HZBA 5JJLA 4KMUC 1E7ZA 1VQBA 1HQRD 1XNQL 4OXPA 4DUYL 1Q81C 1RTNA 1I3QH 4IUVA 1PMRA 5G3LF 1IYVA 2BDOA 3KF6A 3TP6A 1WTWA 5J3BA 1H95A 5TSSA 1H9RA 1O78A 2R7DA 3CRKC 5GADC 4YY3L 3D31A 4GNXC 1CQVA 2FINB 4JBKA 4DV6L 1MD2D 1PH6A 4YY3Q 4PMWA 4DV1L 1PXUA 4EQ5A 2HQLA 2FMCA 5JVG3 2AQ2B 1X32A 3U9SA 1GHJA 2HUGA 4LFBL 3H3VH 2XWBB 4L63B 3CF5A 2K52A 5KIXA 3WOEA 1N36L 2G9DA 4BBSG 2KUMA 4C3JH 1VQDA 3CCSA 1F2YA 2HDLA 5FO9B 1ASYA 4WJWA 5EAYA 3R2TA 1TU2B 1WFQA 1UE6A 5CBAE 3IFDA 1A3UA 5KNDA 2R7ZG 1H9SB 5E4XA 1DOMA 4JI5L 1ZKOA 2JXMB 2CH4A 4R4CA 3FHWA 5T1IA 1HNWL 2E75C 2NTTA 1R9TH 4L5TA 3EA6A 3G6EA 4TQUS 4JVZA 3D8GA 3HZXA 1J9OA 2Q2IA 4TSSA 2F4VL 1E3PA 3SK5A 2XIWA 1EZ8A 2NVYB 1LACA 1RJTA 4A3DB 1TY0A 4DUZQ 4YCWA 1PH4A 1Y1VB 2NVQH 5AJ3L 1EYDA 1IL8A 2F0PA 1YJWA 1Q8IA 1YZ6A 3ZYYX 3U4ZA 4KJNA 2VUMG 5CV7A 3PV0A 4RKBA 3FRPB 4DPGA 4DF7A 4K0KQ 1U5KA 4BY1G 1MIUA 3FEWX 2RVLA 3CQZB 1SYDA 3J81j 1LT3D 4DR4L 1K8GA 3TBIB 2L1BA 2NVXH 1IBLL 4A3BB 5IGBA 1PH9A 3QWNA 2IX0A 4IUTA 5FO8B 4R4OA 2WAQG 1BBXC 2ZXPA 4P71A 1GHKA 4GKKL 2CKZB 5M5XB 1BR9A 1PH8A 3C1EA 4X65Q 1YHQA 3KDFB 1Y1VG 5FJ8H 1Q8KA 1HCZA 3K0XA 4JPBW 4O1NA 4GKKQ 4L6TB 4NW2A 3K8AA 4HEDA 2VZAA 3BDCA 4CGYB 1FJGL 1O7YA 1QG7A 1WVLA 2XNAC 4QIWE 1IL2A 4X64L 5M9OA 3RD4A 2D9UA 2EOTA 4ZLTF 2MUYA 3NTIA 1Q90A 4BA1I 4C3IG 3NE5B 2ZM6Q 5CR3A 1VQKA 2FJ2A 3KLRA 4HSPA 4RHSA 4FF3A 2K14A 2VUMB 5J1ZA 1PRTB 2JN4A 2ZXOA 3K5LA 1FGBD 2DJGC 2F0LA 3J80i 2WB1E 3E9HA 2PZTA 4N8X1 4RWSC 3RZDB 1EOVA 3MXPA 4QF4A 3F2DA 2ICEC 4B9WA 1E2WA 2K04A 1GKHA 3BG3A 3CCQA 1SJHD 1L1OB 3PQIA 4ID6A 3Q24A 4XQJA 2IY5B 1CK1A 2Q2HA 3PIOA 2K5NA 1IXRA 1X65A 1LTLA 1BQQT 3AB9A 3NUCA 2CCZA 1HZCA 4QMGA 2ID0A 1CKNA 1TS5A 2F3IA 3TN2A 3UE1A 1SE4A 4TKOB 2F3VA 3VR3A 4A3EB 2KVMA 4Q5VA 2JA7G 1IW7D 5E3FA 2UUBL 4JV5L 2TMPA 3R8BA 3FVQA 3TDQA 1KNEA 3KF8A 4F7XA 1I6VC 1K8MA 2B63B 5IYCH 1C4QA 1TWCH 2UUBQ 1YITA 1JWMD 2B2WA 3H0GH 1PTOC 2XVSA 1WD1A 4A3IH 3EBEA 2A6HD 2KENA 2BA0A 1EU3A 3W1GA 1VQGA 1D5ZC 4YCVA 2EZVA 5IT9E 1V1PB 5IGCA 1EYAA 2EIFA 3A8KE 1D1IA 3KLSX 2F0SA 1LT5D 3Q23A 3H6MA 2KECA 2I5HA 2QW7A 2R61A 3SVMA 2RF4A 5IGEA 3TS2A 1HPCA 3BVGA 1M8AA 4OGQC 3DEOA 3S1RB 4OO1H 3UDXA 1E2VA 4FDBA 1HNZL 3A5ZB 4JI0Q 4NXNL 3BZKA 3FPPA 3S1NB 4LUVA 3I4LA 4Y52H 3ERSX 3L9AX 3STBD 1LM0A 1IW7C 1K3BC 4BA2I 3PO3G 1Q82C 2UUAQ 4GN5A 1A2TA 4A3FH 3VYTA 4QGUA 5BR8L 4A3MB 3A55A 4X3TA 1J6QA 5JJIA 5CC4A 1N34Q 3U58A 1X55A 2KBNA 5C44B 4V190 4OIKA 3A8JE 2Z1CA 5C5MA 3BS1A 1X3GA 5CYUA 1MI2A 2SOBA 4DK3C 2JSOA 1T9HA 4G57A 2Z4IA 5HGQA 1ENFA 1DZ1A 4IURA 3S15H 5HY6A 2R92H 3S1QH 1TQOA 2FMMA 4BBRH 3VYRA 1CHQD 1KL9A 1FD7D 2KA7A 3MEFA 4DV3Q 3A8IE 3E5SA 3D0FA 3AU7A 4X3KA 1HZAA 4QY7A 4NXMQ 4RKLA 1KIXA 1AE2A 3X3NA 2HIXA 3OW7A 1RODA 5HURA 2X6GA 1PH1A 4FXDA 5J22A 1SMXA 3CPFA 4S3SA 2F0KA 2RDHA 4A3DH 1DGSA 2ZJRA 3T13A 1AZQA 4IQZA 2XTIA 4PMBA 1D7QA 3QJYA 3PO3H 1Y1WH 2KCNA 2RDGA 4O2DA 2PCFB 4BY7B 3I4MH 2ZJQA 4BBSH 4KD4A 2AUKA 3GTGH 4C3JG 1SLJA 3CD6A 1VMCA 1G6PA 2QEXA 1STEA 4P2CB 1GVPA 1C9OA 4K2LA 1PFBA 4Y7NB 3RR5A 4ZQ3A 3R93A 1L1OC 2KQ3A 2H4OA 2UXBL 4EX5A 1S5DD 1PTOF 1WTRA 5LMUL 1EQTA 4H13C 4IFDI 4YHHQ 3CRLC 1C0AA 2UXBQ 1G2TA 4DFAA 2OF1A 5CV5A 1C8CA 5AFWA 2VQEQ 3FKIH 3IRBA 2PNHA 3M4YA 1K28A 1SROA 2O4XA 1FGUA 2B2YA 3WWVA 4KY6A 5C3EG 3PIO3 1HXYD 3I4MB 2K5HA 1BCPB 1M4VA 1STHA 4FNFA 4HJ7A 1BVSA 2OQKA 1EY6A 2XWJB 4A3JG 2VUMH 5IYCG 1I94L 3N52A 5FKAC 3K80C 4FF1A 4JYAQ 4JI2L 2UU9Q 3M4QA 4MNOA 4GOPC 4B9XA 1HRJA 2CWAA 4UP9A 1RCVD 1VQ8A 4DKAC 4L5SA 2D0PA 3CMEA 2KHIA 2QILA 4OONA 2HT1A 1LLRD 1E0BA 1U4MA 1H9JA 2Z6BA 3F8TA 3S1QB 2R92B 4DXGA 1RIPA 1WCMB 1G2SA 1GOZA 3PUZA 1U9RA 4IUNA 4DU9A 2A68C 1X3FA 1B4OA 5LL6S 2BOSA 5IYBH 4A3EH 5D3DA 1LTID 3QIAA 4LAAA 1A15A 3MXNA 4OEMB 3I8ZA 4UAIA 1B70B 1KLUD 3F1ZA 2QDLA 4ILWA 1AH9A 1QUQB 4KHZA 2B2VC 2MO1A 5DM73 1BF4A 1HHVA 1ZYRD 2F0HA 1S3OA 1XTDA 5M3FH 3NXWA 1TS3A 1J5EL 1O7IA 4C1NI 4DV7L 3H0GB 3QO2A 2EYMA 1EY4A 1ENAA 3D4RA 4IFDJ 1SE2A 4GKJL 4BY7H 1XYIA 1WD0A 4I65A 1STAA 3K7AB 1I4RA 1X3QA 1UE1A 3T1YL 4JBJA 4KKUA 1O80A 1I50B 3BYYB 3H91A 4IFDG 3GP7A 1O7ZA 1RHPA 2JA8B 3T1YQ 4CJ2C 3KJPA 1SYFA 4IUUA 4A93G 4LFBQ 2JEBI 1WTQA 2B63G 5E7NA 4LUZA 4KV6A 3HOUH 2E2DC 1CM9A 1OXTA 2VQFQ 4YCUA 2CW0C 2JA7B 3BJUA 3KBGA 4A3IG 3LWEA 4G7OC 1RKNA 2D5DA 1SBBB 1MBYA 2XN9C 2LXKA 4A3EG 3FKIB 1G291 3W3AA 2AQ1B 4AH6A 5IGGA 2B8FA 4LF6Q 4XT3B 2OTJA 1SYCA 2N3SA 3HKZB 1X54A 4OWTB 1TWAH 3PSIA 1JOKA 3OMGA 4AYBG 4HIMA 2ATWA 4BXXG 2ES2A 5BN4A 3CQZH 4ZUIA 1NTGA 3J80E 1HUNA 2BE5D 3RN2A 4N8FA 2C5CA 1QVFA 2JQOA 1V9PA 3D4WA 5GAHC 3S16H 2NVXB 2YV5A 4IO9A 1L0WA 3S14B 2I0QA 3CCUA 2EXDA 2FXQA 4R4QA 4XDXA 3D4DA 1CKNB 4FXGC 1O7LA 3LNNA 2B39A 2EQSA 1EY5A 1NBWA 4DUZL 2E2HB 2B2VA 2DY8A 5I6WA 4C3IB 4R1JA 4ODGA 4HTHA 2A8VA 2MFIA 3NQTA 3J7AV 3ICEA 1JR0D 3VA7A 5EKIA 3E0EA 2IX3A 4K14A 4A3CG 2L5TA 1VQ4A 3A56A 4PZ7A 5EPJA 1VDZA 1SE8A 4XXEA 4PMCA 5IY0A 3NTHA 2Q2UA 4DR4Q 3DWQA 2Z9HA 1BCPC 2EJGC 2EYPA 1U4PA 5M3MG 1ET6A 3OTOQ 4LMQD 1TT2A 4DV6Q 1NE3A 3T51B 4B3ML 1V8QA 3G71A 4K5VA 4DV1Q 1A0IA 4IOCA 3AMUA 1JB3A 4LFCQ 2NN6H 4X65L 4P72A 2LS01 3NPPA 4B3MQ 1SXTA 1VQEA 3FP9A 3GTPH 1HTLD 2JEAI 2E2HH 4LFCL 2B8GA 4C1NK 3HS0C 4BY1B 1HTPA 4JI8L 4BBRG 1WI5A 1OXXK 1TS4A 4C3HB 1KNAA 2LKVA 5IIFA 3MC0B 4CKBA 1E1TA 3L7ZC 1KC8C 1HFNA 2MHVA 3OWFA 2B2YC 4XYQA 4B3RQ 3SE0A 3M4OH 1DJRD 2WP8J 1K0RA 1CFMA 3MFGA 4DXFA 3K59A 1HR0W 3EVQA 5E1FA 3ND9A 5C4JH 5CV8A 4LF4L 2M9VA 2DN8A 1B9NA 3JAML 5LMNQ 1GUSA 4FVMA 3WDNA 3ER0A 1CHPD 3HG9A 4X3SA 2Q2TA 3V05A 2BA1A 4OHJA 4HJ9A 1II3A 1JC7A 4GLXA 3V2TA 4J1MA 2QDBA 1TWFH 2E5LL 1I4QA 2EJFC 2PW7A 4A93H 3N6RA 5IWAL 2HIVA 2ICIA 3HOVB 1FNUA 4L8JA 3GTQB 1LYLA 1QE6A 2I07B 1W2BA 2ALYB 1W3SA 5C4XH 4JV5Q 4HIDA 3MA2B 3J80c 4DV0Q 1PYSB 2K01A 1HNXQ 4K0KL 2KCTA 2HDMA 1FR3A 3PO2B 4KK7A 1HFGA 4GZYC 4BBRB 4NMZA 4A3BG 1IYUA 4OWXB 3KJOA 3TZUA 1P8LA 1CTMA 3I91A 4ZUJA 3TRZA 4G4KA 4LF5Q 4ZYSA 5DLQE 4HCEA 5I9PA 1QUQA 1SMYC 4Z9CB 1F9RA 1G6ZA 4FF2A 1BXTA 4QJFA 1EUJA 4DR6L 4U673 3I2ZA 1NCVA 2OTLA 4DV2Q 1EIHA 2VY3A 5EQ0A 4RCOA 4YWKA 3PIPA 1XPRA 2CW0D 4DR6Q 2C35B 1PHJA 2F0NA 1PFSA 4ME3A 3MAQA 4NXNQ 4DR1L 1VQMA 4CDDC 5EBDA 2LSSA 5FLXc 1Y69U 3I56A 2B2TA 1A6XA 1ZEQX 4E6IA 3GTPB 1YHAA 2JA8H 3T56B 4JI6L 4K5XA 4AYBB 3P7JA 1UAPA 3SK4A 2Y0SB 5M5YH 2LFNA 2KCCA 2WKDA 1CSQA 2K5QA 1EIFA 2RA4A 3HOWB 1UEBA 1JJGA 2A69D 1VQ7A 5C0XI 5BR8Q 5FLXL 5JEAH 3NELA 1OO9B 4DK0A 2QCPX 1KDAA 4DR3Q 4IPCA 1EY0A 2N8NA 1Q86C 3CCJA 1BNZA 3TZDA 1TR5A 2K32A 4CDEC 2KEEA 4A3CH 1CZWA 3CCEA 5C3WA 1L2FA 3CPWA 2NVQB 1TWAB 4WJ3M 3R2IA 2RCNA 4BBSB 1JICA 2F0QA 1XTCD 3TP5A 1X3EA 4WRDA 4KHPL 1OTCA 4ZKBB 5H1SE 3HOYG 3NK9A 4KY7A 3G4SA 1DOLA 4JBMA 2F0EA 4G7ZC 2AHOB 3RUZA 1YI2A 1PLFA 1RF2D 4K2KA 3PF5A 4A3IB 3HOWH 2EY2A 1XMOL 3GTLB 2NVTB 2F1MA 2F52A 4EQPA 4R8IA 3HOVH 1YJNA 1JCKB 3JAME 2UXDL 4BWGB 1XMOQ 2Z4HA 5C6AA 1SYEA 2XRQD 2QKIC 5JOBA 3H3VI 1IZ6A 4TVAB 5CBEE 3V96A 1K8OA 3T16A 3J7ZC 3W5OA 2RDFA 2NYZD 3I73A 3EFXD 2PMZE 3CKIB 1S5ED 2N78A 1PDQA 4O0AA 4RGNA 1R4PB 2VL6A 3PCOB 4P73A 1SNQA 3DUZA 4DV5Q 4IZ8A 5D14A 1EZ6A 2NVTH 4CJ1B 3HOWG 2Z6KC 1JMCA 1B50A 2EDGA 5I9OA 4DV5L 3L3OC 1B9MA 1IBMQ 1DYQA 4JW0A 1D8LA 2EYJA 5M5WB 2B2UA 2YYZA 3M7NA 2NZ1D 1NMGA 4EQOA 3GTOH 4POGA 4GNXA 1HJPA 2JE6I 1DOKA 1D6EC 3DLLA 3STBC 2SNMA 3GD7A 1VQNA 1I4XA 5C4HA 2PQEA 4H0LC 5M5YB 2KOLA 3I4MG 3R3OA 3M4PA 1LTGD 5C3EB 1SSOA 3I4OA 3HOXG 1YNJD 3BVMA 2F4IA 1JT8A 2B2TC 3KBXA 5GAGC 4DV3L 3NEMA 5KNCA 4AQYL 2B2WC 4EQNA 1Y8PB 1IYJB 3I4NB 3C3LA 4MHEA 1K0SA 2D2CC 3TQYA 4CKEA 4UP8A 3NBIA 4FO2A 3CC4A 1QILA 4DAYB 1QJOA 1QVCA 1T5EA 5K36G 3FDTA 2F0JA 5ELBA 1XWEA 2WACA 1PV4A 1Y1WB 3K7UC 3K7AH 2K5VA 1NMFA 4RG1A 3A7AB 3OW2A 1N33Q 5HGTA 4N9TA 2MQHA 3GTGB 2IX1A 4JI5Q 1N33L 1STNA 3GQBA 2SEBD 5KEEA 1AE3A 4U68A 1AZPA 5JEAJ 1A62A 1I5FA 5CV6A 1OXVA 1R9TB 3PUYA 2K7VA 3G7LA 2FHTA 4A3JH 2R6GA 2OWOA 4DV7Q 2SNSA 1FNVA 1YNND 1NUCA 4QUCA 5JEAG 1M90C 1W6JA 1VQHA 2NVYH 2LY7A 3K58A 1CQFA 2PMZB 1VQ5A 4NB3A 3AYHB 2RHQB 4WFN3 3IFTA 2NZHA 5AJ3Q 1X3PA 4A3FB 3H94A 4FP5D 4X62L 2N55A 5BN5A 4IOAA 3IKJA 1OXSC 4ME5A 4N9PA 3QG1A 3SR1A 5JJZA 4B3TL 2R7ZH 1BUVT 3RZOB 1DD2A 4X62Q 3DMUA 3S16B 4C3HG 2JA9A 3I72A 2D62A 2DGYA 3QB3A 1HZ9A 4DR2L 2UUCQ 3S14H 1RDPD 1FVIA 2M2LA 1I4GA 3M3YH 2WKCA 3VR5A 3S15B 2NN6I 4A3BH 2RKSA 2EY6A 1SFOH 3UDIA 1KDCA 2K1BA 2CQOA 3CMAA 4HMIA 3I7FA 3ITPA 2OT2A 3VYSA 3NQIA 1ILQA 4RMFA 1AFPA 4CHTB 4HMJA 3S17H 2F03A 1V1PA 1X56A 1PH3A 4LF6L 2PYKA 4LF9Q 4JI2Q 1YNJC 1L0XB 2QA4A 2ZTEA 2J0TD 4DV4L 2AUJD 2OQ0A 2F0TA 3Q22A 3LWUA 3OHXC 2MO0A 4A4IA 5IT9c 1FJGQ 1DONA 2YU9H 3CCVA 1PVOA 4JI7L 1PRTD 4DAVA 3FMCA 1SMYD 4K5WA 3ND8A 2JA6H 1HQMC 3E3XA 3DWAA 4HN7A 1NNXA 3DM1A 3AFQA 2K4KA 2VNUD 3J81L 3S9WA 5ELOA 2WB1B 1STGA 1EYGA 2NUCA 2Q8RE 1QB5D 1KQSA 4QB4A 1LTRD 2R3ZA 2PQAA 3S17B 1GUTA 1MHWC 3GTLH 3T1HQ 1MKHA 2AKWB 2F0VA 1F2MA 3ULPA 3GV6A 1QZGA 2HCIA 3UE0A 4DGZA 1MSHA 2K6AA 1EIYB 1CKMA 1A8VA 4DNRB 3PUXA 3M7GA 2JYOA 5GQOA 2YU9B 1VF7A 2Y0SE 5IP7G 4OIJA 4K6LA 4JOIC 2Z0SA 3DEPA 4RFBA 1A63A 4JBWA 1JE4A 3SHLA 3RNUA 1PZKD 1B3QA 5ELDA 3MXNB 1Q1EA 4F8MA 3BZCA 4V0BA 1QOHA 1XPOA 4DA2A 2AWOA 2XSCA 3BDOA 1LO5D 2VQFL 5CGKA 3D3RA 3OWEB 4A93B 4YIJA 5IYBG 1VQ6A 5EGTA 1PH2A 1VQLA 3JAMi 1HR0Q 3DM3A 1CKOA 5KYLA 1JQYD 5M5WH 2L12A 2DJFC 2N49A 1SNCA 3K5MA 4KKSA 4ZKCB 3NWTA 2K28A 3MFYA 1HR0L 1RTOA 2HD3A 1K9MC 2WB1G 1SFOB 5C0XJ 3A0JA 2K75A 1TWGB 2EXZA 5LMNL 4C2MH 1ML0D 4JI4Q 4PZ6A 1Q1BA 2MNAA 3TREA 1EL0A 3H3VC 3L0OA 4K8IA 1I4HA 3TEHB 4JI4L 5E4WC 2EVBA 5EKKA 3G6JB 4IUQA 2N88A 5IWAQ 4GNXB 1UEAB 3BU2A 1I4PA 1D5XC 3F2UA 4A3MH 1DXMA 4H02A 3JC66 3SXHA 5JPMC 5M3FB 4CDFC 2WAQB 4JI3L 1NAPA 4DAYA 2ZT9C 1WYDA 4QUFA 2F0OA 4XQQA 1TIID 1GUWA 1FYCA 1HNXL 1G8ZD 2K50A 4JI3Q 2EYLA 3KUPA 3DHQA 2L15A 4TRDA 5IP9G 3FPUB 3CCLA 3OSOA 1BBWA 3ULJA 2WIIB 3NTKA 1RL2A 1XXGA 4WORA 1HH2P 5JAVA 2EYFA 4HAEA 1KRTA 1UUPA 3LX0A 3OTOL 3HOXH 5FLMG 3CCRA 2JP1A 3PO2G 3RLNA 2RQXA 4A3JB
chains in the Genus database with same CATH topology
4P74A 4A3LG 3GTKH 3RZDH 4A3IH 4A3FG 3EBEA 4LF7Q 1MJCA 2KENA 4QJFA 4UY8C 2BA0A 1EUJA 4DR6L 1WCMH 3W1GA 1VQGA 2IT1A 3Q8DA 4YCVA 3I2ZA 4JI8Q 4X66L 4DV2Q 2OTLA 1KXLA 1EWIA 1YVCA 4LF7L 2EIFA 2VY3A 3PIPA 4YWKA 1XPRA 1VQFA 4DR6Q 3HKSA 3SGIA 2C35B 2I5HA 4X66Q 1QVGA 1PHJA 2RF4A 1PFSA 4ME3A 4AYBE 1BBUA 1JB7A 1FL0A 3KFUA 2OCEA 3TS2A 4NXNQ 4X64Q 4DR1L 1VQMA 4R4IA 1I6HH 3UDXA 4KI0A 1NJIC 2LSSA 5FLXc 4B3RL 4FDBA 3I56A 4QQBX 1YEZA 2D0OA 1HNZL 3A5ZB 1VQIA 4NXNL 4JI0Q 1YHAA 2JK8A 1X6OA 3BZKA 2JA8H 4LUVA 4JI6L 4A3DG 4Y7NH 4LF4Q 4Y52H 5M5YH 3S2DH 3ERSX 3STBD 4JI2L 1CSQA 3CAMA 4IPDA 1EIFA 1LM0A 4NPSA 1UEBA 4UP7A 5IP9H 3F2BA 1UE5A 3KOJA 4DR3L 5C0XI 1VQ7A 4B3SQ 5BR8Q 3PO3G 1WJJA 4BA2I 3H0GG 2GVBA 1Q82C 3KYHC 2UUAQ 5IYDH 3NELA 3UDGA 4GN5A 1IBML 5LMUQ 4A3FH 2BH2A 4DR3Q 4QGUA 1PA6A 2AWNA 4IPCA 4YWMA 4GLVB 2N8NA 5BR8L 3CCJA 3KDFA 1Q86C 4YHHL 4B3SL 2UUAL 2V1CC 1J6QA 2E5LQ 5JJIA 2ZJPA 1N34Q 3U58A 1X55A 2KBNA 3AEVA 4BY7G 4PG3A 1I50H 4A3CH 1N32Q 2UXCQ 3CCEA 1L2FA 1X3GA 1Y14B 5C0XG 3CPWA 4DK3C 1Y1WG 1ASZA 1N34L 4WJ3M 1T9HA 2RCNA 5HGQA 2UXCL 1N32L 3G48A 1V1QA 1X3EA 3S15H 4KHPL 1OTCA 5HY6A 2R92H 3S1QH 4DV0L 1YBYA 5H1SE 3HOYG 3E9IA 3GTJH 3G4SA 1KAWA 1WCMG 1GM5A 4BBRH 4JBMA 3I4NG 1KL9A 2AHOB 2VS1A 3MEFA 4DV3Q 1K8AC 3U4VA 4AQYQ 1I94Q 1YI2A 2B63H 1VQPA 3D0FA 3PF5A 3HOUG 1OXUA 1HZAA 2A1AA 4PZ8A 4QY7A 4NXMQ 1XMOL 3HOWH 4A3GG 1KIXA 2UU9L 2F52A 3CW2C 1AE2A 2YTYA 3HOZH 2I5LX 2HIXA 3HOVH 4KLKA 1YJNA 2UXDL 1B7YB 2YTVA 1XMOQ 1PH1A 1SMXA 1UWVA 3CPFA 5JJKA 5ELNA 3M9BA 3CC7A 3H3VI 2B3GA 1IZ6A 2ZTDA 1TWHH 4A3DH 4P75A 4TVAB 4APVA 4A75A 4GOPA 1DGSA 2ZJRA 4DV2L 3S2HH 3J7ZC 2XTIA 3W5OA 1S40A 1D7QA 1M1KC 1N9WA 3PO3H 1Y1WH 4O2DA 2PMZE 4DNIA 3CCMA 5C3EH 3I4MH 2ZJQA 4BBSH 2N78A 2I5MX 4O0AA 3NENA 4A3MG 3GTGH 1SLJA 3CD6A 3S1NH 2VL6A 3PCOB 4P73A 3K81C 1G6PA 2QEXA 1GD7A 1UE7A 4L5RC 4QL5A 2JA5G 4DV5Q 1GVPA 1TWGH 1C9OA 3GDEA 4WJ4A 2R7FA 4BXXH 1U0LA 2PI2E 3RR5A 5M5XH 2Z6KC 2NVTH 3HOWG 1K73C 1JMCA 1J5EQ 4DV5L 1L1OC 3PUVA 1XNQQ 2UXBL 1YIJA 1G51A 4EX5A 4A3KH 1VCIA 1IBMQ 1D8LA 1EFWA 5LMUL 1Q7YC 2JA6G 4IFDI 4GKJQ 1E22A 3HKZG 2YYZA 4GN4B 4YHHQ 3M7NA 1C0AA 1NY4A 4JCVE 5FLMH 2UXBQ 3AFPA 2E2IH 1NMGA 5C44H 3GTOH 4POGA 4GNXA 2A19A 3A74A 1HJPA 1L1OA 2JE6I 2CFMA 2VQEQ 3CXCA 3DLLA 5IP7H 3FKIH 3IRBA 2PNHA 3STBC 2PI2A 3GD7A 4DR5Q 3KLWA 1SROA 4YWLA 5C4XG 1FGUA 1VQNA 4A3LH 2UUCL 3WWVA 5C3EG 3EIVA 1IBKL 3I4MG 3UDFA 2K5HA 3M4PA 3GO5A 5M3MH 4KHPQ 4DR5L 3I4OA 1C7YA 1E24A 3HOXG 4LF8L 4HJ7A 1XPUA 1JT8A 1BVSA 1YHBA 1CSPA 2OQKA 1IBKQ 2JA5H 3PO2H 4A3JG 2VUMH 5LMNW 5GAGC 5IYCG 4DV3L 1PH7A 3NEMA 4AQYL 1I94L 4IJLA 4JOIA 4LF8Q 1IYJB 2E2JH 1SR3A 4A76A 1XNRL 5GAEC 4NXML 3K80C 2GVAA 2E8GA 4MZ9A 2QGQA 1N36Q 4XTCS 3TQYA 3KF8B 2UU9Q 3M4QA 1K83H 4MNOA 4UP8A 4GOPC 4C3HH 3LGJA 1X9NA 1VQCA 2CWAA 3I55A 3J81i 4DV4Q 3CC4A 4UP9A 1XNRQ 3AQQA 1VQ8A 3KF6B 2B29A 4DAYB 2D0PA 4DKAC 4L5SA 1QVCA 2UXDQ 3CMEA 5K36G 2KHIA 4JYAL 2ZTCA 1PV4A 4OONA 2HT1A 3K7UC 3K7AH 2K5VA 1NMFA 4RG1A 3OW2A 1N33Q 3F8TA 1PH5A 3OYYA 2MQHA 1RIPA 2BH8A 4JI7Q 3PUZA 1S72A 1JJ2A 2IX1A 2RHSB 1XMQL 3HFZB 4DR7Q 2Y0SG 4IPGA 4JI5Q 1N33L 4OO1G 1AE3A 4A3KG 4JYAQ 1X3FA 5IYBH 1HNWQ 5JEAJ 1A62A 4GOPB 1I5FA 3TS0A 4A3EH 1XMQQ 4DR7L 4OX9L 1OXVA 1B70B 3PUYA 3F1ZA 5C44G 1SN8A 1AH9A 1QUQB 4KHZA 4A3JH 2R6GA 2OWOA 2MO1A 2F4VQ 4DV7Q 3J81c 4OX9Q 4GN3B 2YTXA 4DUYQ 1S3OA 1XTDA 5JEAG 5IYDG 5M3FH 1M90C 2R93H 1VQHA 4LFAQ 1J5EL 2NVYH 4C3IH 1JE5A 1O7IA 1HZBA 4DV7L 1VQ5A 5JJLA 1E7ZA 1VQBA 4NB3A 3AYHB 2R92G 3JAMc 1XNQL 4OXPA 4DUYL 4J15A 2RHQB 3HOYH 4IFDJ 2NZHA 1Q81C 5AJ3Q 1I3QH 4LFAL 4GKJL 4BY7H 4B3TQ 3KF6A 4X62L 4JC0A 4IJHA 5J3BA 2GN5A 1Q46A 1H95A 4IOAA 1UE1A 1XJVA 3T1YL 4JBJA 1OXSC 1YJ9A 2CWPA 2VQEL 2R7DA 4B3TL 5GADC 2R7ZH 4YY3L 3HOZG 3D31A 4X62Q 4GNXC 2IHFA 4IFDG 2R93G 4IPHA 2JA9A 2D62A 2DGYA 4DR2L 1HZ9A 4L5QA 2UUCQ 4JBKA 2IHEA 3T1YQ 3S14H 2LXJA 4DV6L 3RLOA 1FVIA 3KJPA 3S1MH 1PH6A 4YY3Q 4A93G 2JJQA 4PMWA 3I4NH 4DV1L 3M3YH 2JEBI 4LFBQ 2KHJA 4EQ5A 2HQLA 2NN6I 4A3BH 1SFOH 2B63G 1E1OA 3UDIA 3CC2A 2CQOA 5E7NA 4LUZA 3CMAA 1YNXA 3I7FA 3HOUH 4LF9L 4RMFA 1OXTA 4LFBL 3H3VH 2VQFQ 3CF5A 3S17H 4YCUA 2K52A 1X56A 4LF6L 1PH3A 3HOVG 4BY1H 4LF9Q 3BJUA 4JI2Q 3A5UA 4A3IG 1N36L 4BBSG 2QA4A 4A3EG 2ZTEA 2LXKA 4C3JH 1G291 4DV4L 1VQAA 1VQDA 4AH6A 2OQ0A 4UPAA 3CCSA 4AIMA 4LF6Q 2OTJA 1KD1C 2MO0A 3L2PA 4A4IA 5IT9c 2N3SA 1FJGQ 1X54A 4OWTB 4HJAA 1TWAH 3PSIA 1ASYA 2YU9H 3CCVA 3S1RH 5EAYA 4AYBG 4HIMA 1WFQA 2ATWA 3GTMH 4BXXG 1PVOA 1UE6A 1P16A 2ES2A 4JI7L 4DAMA 3CQZH 3M85A 5M3FG 1NTGA 1VS0A 2NZOA 2ZM6L 3VDYA 2R7ZG 4JI5L 3RN2A 1QVFA 4XIGS 2JQOA 1V9PA 4R4CA 5GAHC 3S16H 3FHWA 2XGTA 1SRUA 2YV5A 4IO9A 1L0WA 3RLFA 2JA6H 1HNWL 2I0QA 2KCMA 2EXDA 2FXQA 3CCUA 1R9TH 4L5TA 1JJGA 3G6EA 4R4QA 4TQUS 3AFQA 2K4KA 1CKNB 2VNUD 2Q2IA 5ELOA 1JJCB 4HJ5A 1EYGA 2EQSA 1BKBA 2F4VL 1KQSA 1NBWA 1KHIA 1E3PA 4DUZL 2PQAA 2DUDA 3GTLH 3T1HQ 1MKHA 2AKWB 3RN5A 3H15A 1MJEA 3ULPA 4R1JA 1QZGA 3UE0A 1PYBA 4DUZQ 4YCWA 1PH4A 2A8VA 1EIYB 2MFIA 2NVQH 1Q12A 3ICEA 1CKMA 4MTNA 5AJ3L 1YJWA 1TXYA 3RZOH 1A8VA 1YZ6A 3E0EA 3PUXA 5GQOA 3GTQH 3U4ZA 4A3CG 1VQ4A 2VUMG 2Y0SE 4PZ7A 5IP7G 3PV0A 1SE8A 3ULLA 3ZJYC 4JOIC 3EN2A 2Z0SA 4LW1A 5IY0A 4JI0L 1A63A 4DPGA 2Q2UA 4DR4Q 1LUZA 3F2CA 4K0KQ 1U5KA 4JBWA 4LNQA 4BY1G 1MIUA 1N8RC 4X6AH 1EQRA 4DK6C 1B8AA 5M3MG 3J81j 3RNUA 3OTOQ 4DR2Q 4DR4L 1K8GA 4JG2A 1VQJA 1NE3A 4DV6Q 4B3ML 3MXNB 1Q1EA 2WFWA 3BZCA 2NVXH 3G71A 1XPOA 1IBLL 4DV1Q 4LF5L 1A0IA 4IOCA 2AWOA 4LFCQ 4X65L 1PH9A 4P72A 2IX0A 4B3MQ 3GTPH 1VQEA 3FP9A 4R4OA 2WAQG 1IBLQ 4P71A 1KRSA 2JEAI 3J7A5 2E2HH 4GKKL 2CKZB 2VQFL 1PH8A 4LFCL 4X65Q 1YHQA 3KDFB 1Y1VG 5FJ8H 1Q8KA 2JA7H 3B6YA 4JI8L 5IYBG 3K0XA 1VQ6A 4BBRG 3PUWA 1QZHA 3HKZE 1PH2A 1WI5A 3U50C 3JAMi 1HR0Q 1OXXK 1VQLA 4GKKQ 3DM3A 1CKOA 3K8AA 4GS3A 2VZAA 5M5WH 2ASBA 1GO3E 4LUOA 1FJGL 1WOCA 2N49A 1E1TA 3L7ZC 4R4TA 1KC8C 4A3GH 1HR0L 1VQ9A 2Z6KA 4QIWE 1IL2A 1K9MC 4X64L 4DR1Q 2WB1G 4B3RQ 4BA1I 5C0XJ 4LWCA 2HHHQ 3M4OH 1HNZQ 2WP8J 2ZM6Q 3A0JA 2K75A 1K0RA 1HR0W 1VQKA 5LMNL 4C2MH 2K14A 5C4JH 4HIKA 4PZ6A 4JI4Q 4JI6Q 1Q1BA 2MNAA 2HHHL 4LF4L 3TREA 3J80i 3PF4A 3L0OA 5LMNQ 3S24A 2WB1E 3E9HA 3TEHB 2WAQE 4JI4L 2NN6G 3ER0A 1EOVA 1CUKA 3F2DA 2VW9A 1GKHA 2PQAB 1Z9FA 5IE8A 5IWAQ 3CCQA 4GNXB 4HJ8A 2Q2TA 4OO1I 1L1OB 2BA1A 3BU2A 4JI1Q 4HJ9A 4GLXA 1VQOA 4A3MH 3T1HL 1TWFH 1Y1VH 4H02A 3W1BA 2E5LL 3JC66 1K3RA 3NBHB 3CP0A 2IY5B 4A93H 4JI3L 5IWAL 2Q2HA 2HIVA 2K5NA 1IXRA 1X65A 4JI1L 1LTLA 3PIOA 1WYDA 4POFA 2AMCB 1HNXL 2K50A 2CCZA 1HZCA 1LYLA 4JI3Q 5IP9G 2ID0A 2L15A 1W2BA 1CKNA 2F3IA 3UE1A 2ALYB 3CCLA 1W3SA 1BBWA 3ULJA 5C4XH 4HIDA 4ALPA 4JV5Q 1RL2A 3J80c 4DV0Q 1PYSB 1HNXQ 4K0KL 1V43A 2KCTA 5GROA 5FJ8G 2H5XA 2JA7G 1HH2P 4OWWB 2UUBL 3HOXH 1KRTA 2JA8G 4JV5L 3OTOL 5FLMG 4HIOA 1EQQA 4A3BG 4OWXB 3CCRA 3KJOA 1P8LA 3PO2G 3PGZA 3RLNA 3TRZA 5IYCH 4LF5Q 1TWCH 3FKIG 5DLQE 1YITA 2UUBQ 1QUQA 1Z47A 3H0GH 4GLAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P74 A;  4A3L G;  3GTK H;  3RZD H;  4A3I H;  4A3F G;  3EBE A;  4LF7 Q;  1MJC A;  2KEN A;  4QJF A;  4UY8 C;  2BA0 A;  1EUJ A;  4DR6 L;  1WCM H;  3W1G A;  1VQG A;  2IT1 A;  3Q8D A;  4YCV A;  3I2Z A;  4JI8 Q;  4X66 L;  4DV2 Q;  2OTL A;  1KXL A;  1EWI A;  1YVC A;  4LF7 L;  2EIF A;  2VY3 A;  3PIP A;  4YWK A;  1XPR A;  1VQF A;  4DR6 Q;  3HKS A;  3SGI A;  2C35 B;  2I5H A;  4X66 Q;  1QVG A;  1PHJ A;  2RF4 A;  1PFS A;  4ME3 A;  4AYB E;  1BBU A;  1JB7 A;  1FL0 A;  3KFU A;  2OCE A;  3TS2 A;  4NXN Q;  4X64 Q;  4DR1 L;  1VQM A;  4R4I A;  1I6H H;  3UDX A;  4KI0 A;  1NJI C;  2LSS A;  5FLX c;  4B3R L;  4FDB A;  3I56 A;  4QQB X;  1YEZ A;  2D0O A;  1HNZ L;  3A5Z B;  1VQI A;  4NXN L;  4JI0 Q;  1YHA A;  2JK8 A;  1X6O A;  3BZK A;  2JA8 H;  4LUV A;  4JI6 L;  4A3D G;  4Y7N H;  4LF4 Q;  4Y52 H;  5M5Y H;  3S2D H;  3ERS X;  3STB D;  4JI2 L;  1CSQ A;  3CAM A;  4IPD A;  1EIF A;  1LM0 A;  4NPS A;  1UEB A;  4UP7 A;  5IP9 H;  3F2B A;  1UE5 A;  3KOJ A;  4DR3 L;  5C0X I;  1VQ7 A;  4B3S Q;  5BR8 Q;  3PO3 G;  1WJJ A;  4BA2 I;  3H0G G;  2GVB A;  1Q82 C;  3KYH C;  2UUA Q;  5IYD H;  3NEL A;  3UDG A;  4GN5 A;  1IBM L;  5LMU Q;  4A3F H;  2BH2 A;  4DR3 Q;  4QGU A;  1PA6 A;  2AWN A;  4IPC A;  4YWM A;  4GLV B;  2N8N A;  5BR8 L;  3CCJ A;  3KDF A;  1Q86 C;  4YHH L;  4B3S L;  2UUA L;  2V1C C;  1J6Q A;  2E5L Q;  5JJI A;  2ZJP A;  1N34 Q;  3U58 A;  1X55 A;  2KBN A;  3AEV A;  4BY7 G;  4PG3 A;  1I50 H;  4A3C H;  1N32 Q;  2UXC Q;  3CCE A;  1L2F A;  1X3G A;  1Y14 B;  5C0X G;  3CPW A;  4DK3 C;  1Y1W G;  1ASZ A;  1N34 L;  4WJ3 M;  1T9H A;  2RCN A;  5HGQ A;  2UXC L;  1N32 L;  3G48 A;  1V1Q A;  1X3E A;  3S15 H;  4KHP L;  1OTC A;  5HY6 A;  2R92 H;  3S1Q H;  4DV0 L;  1YBY A;  5H1S E;  3HOY G;  3E9I A;  3GTJ H;  3G4S A;  1KAW A;  1WCM G;  1GM5 A;  4BBR H;  4JBM A;  3I4N G;  1KL9 A;  2AHO B;  2VS1 A;  3MEF A;  4DV3 Q;  1K8A C;  3U4V A;  4AQY Q;  1I94 Q;  1YI2 A;  2B63 H;  1VQP A;  3D0F A;  3PF5 A;  3HOU G;  1OXU A;  1HZA A;  2A1A A;  4PZ8 A;  4QY7 A;  4NXM Q;  1XMO L;  3HOW H;  4A3G G;  1KIX A;  2UU9 L;  2F52 A;  3CW2 C;  1AE2 A;  2YTY A;  3HOZ H;  2I5L X;  2HIX A;  3HOV H;  4KLK A;  1YJN A;  2UXD L;  1B7Y B;  2YTV A;  1XMO Q;  1PH1 A;  1SMX A;  1UWV A;  3CPF A;  5JJK A;  5ELN A;  3M9B A;  3CC7 A;  3H3V I;  2B3G A;  1IZ6 A;  2ZTD A;  1TWH H;  4A3D H;  4P75 A;  4TVA B;  4APV A;  4A75 A;  4GOP A;  1DGS A;  2ZJR A;  4DV2 L;  3S2H H;  3J7Z C;  2XTI A;  3W5O A;  1S40 A;  1D7Q A;  1M1K C;  1N9W A;  3PO3 H;  1Y1W H;  4O2D A;  2PMZ E;  4DNI A;  3CCM A;  5C3E H;  3I4M H;  2ZJQ A;  4BBS H;  2N78 A;  2I5M X;  4O0A A;  3NEN A;  4A3M G;  3GTG H;  1SLJ A;  3CD6 A;  3S1N H;  2VL6 A;  3PCO B;  4P73 A;  3K81 C;  1G6P A;  2QEX A;  1GD7 A;  1UE7 A;  4L5R C;  4QL5 A;  2JA5 G;  4DV5 Q;  1GVP A;  1TWG H;  1C9O A;  3GDE A;  4WJ4 A;  2R7F A;  4BXX H;  1U0L A;  2PI2 E;  3RR5 A;  5M5X H;  2Z6K C;  2NVT H;  3HOW G;  1K73 C;  1JMC A;  1J5E Q;  4DV5 L;  1L1O C;  3PUV A;  1XNQ Q;  2UXB L;  1YIJ A;  1G51 A;  4EX5 A;  4A3K H;  1VCI A;  1IBM Q;  1D8L A;  1EFW A;  5LMU L;  1Q7Y C;  2JA6 G;  4IFD I;  4GKJ Q;  1E22 A;  3HKZ G;  2YYZ A;  4GN4 B;  4YHH Q;  3M7N A;  1C0A A;  1NY4 A;  4JCV E;  5FLM H;  2UXB Q;  3AFP A;  2E2I H;  1NMG A;  5C44 H;  3GTO H;  4POG A;  4GNX A;  2A19 A;  3A74 A;  1HJP A;  1L1O A;  2JE6 I;  2CFM A;  2VQE Q;  3CXC A;  3DLL A;  5IP7 H;  3FKI H;  3IRB A;  2PNH A;  3STB C;  2PI2 A;  3GD7 A;  4DR5 Q;  3KLW A;  1SRO A;  4YWL A;  5C4X G;  1FGU A;  1VQN A;  4A3L H;  2UUC L;  3WWV A;  5C3E G;  3EIV A;  1IBK L;  3I4M G;  3UDF A;  2K5H A;  3M4P A;  3GO5 A;  5M3M H;  4KHP Q;  4DR5 L;  3I4O A;  1C7Y A;  1E24 A;  3HOX G;  4LF8 L;  4HJ7 A;  1XPU A;  1JT8 A;  1BVS A;  1YHB A;  1CSP A;  2OQK A;  1IBK Q;  2JA5 H;  3PO2 H;  4A3J G;  2VUM H;  5LMN W;  5GAG C;  5IYC G;  4DV3 L;  1PH7 A;  3NEM A;  4AQY L;  1I94 L;  4IJL A;  4JOI A;  4LF8 Q;  1IYJ B;  2E2J H;  1SR3 A;  4A76 A;  1XNR L;  5GAE C;  4NXM L;  3K80 C;  2GVA A;  2E8G A;  4MZ9 A;  2QGQ A;  1N36 Q;  4XTC S;  3TQY A;  3KF8 B;  2UU9 Q;  3M4Q A;  1K83 H;  4MNO A;  4UP8 A;  4GOP C;  4C3H H;  3LGJ A;  1X9N A;  1VQC A;  2CWA A;  3I55 A;  3J81 i;  4DV4 Q;  3CC4 A;  4UP9 A;  1XNR Q;  3AQQ A;  1VQ8 A;  3KF6 B;  2B29 A;  4DAY B;  2D0P A;  4DKA C;  4L5S A;  1QVC A;  2UXD Q;  3CME A;  5K36 G;  2KHI A;  4JYA L;  2ZTC A;  1PV4 A;  4OON A;  2HT1 A;  3K7U C;  3K7A H;  2K5V A;  1NMF A;  4RG1 A;  3OW2 A;  1N33 Q;  3F8T A;  1PH5 A;  3OYY A;  2MQH A;  1RIP A;  2BH8 A;  4JI7 Q;  3PUZ A;  1S72 A;  1JJ2 A;  2IX1 A;  2RHS B;  1XMQ L;  3HFZ B;  4DR7 Q;  2Y0S G;  4IPG A;  4JI5 Q;  1N33 L;  4OO1 G;  1AE3 A;  4A3K G;  4JYA Q;  1X3F A;  5IYB H;  1HNW Q;  5JEA J;  1A62 A;  4GOP B;  1I5F A;  3TS0 A;  4A3E H;  1XMQ Q;  4DR7 L;  4OX9 L;  1OXV A;  1B70 B;  3PUY A;  3F1Z A;  5C44 G;  1SN8 A;  1AH9 A;  1QUQ B;  4KHZ A;  4A3J H;  2R6G A;  2OWO A;  2MO1 A;  2F4V Q;  4DV7 Q;  3J81 c;  4OX9 Q;  4GN3 B;  2YTX A;  4DUY Q;  1S3O A;  1XTD A;  5JEA G;  5IYD G;  5M3F H;  1M90 C;  2R93 H;  1VQH A;  4LFA Q;  1J5E L;  2NVY H;  4C3I H;  1JE5 A;  1O7I A;  1HZB A;  4DV7 L;  1VQ5 A;  5JJL A;  1E7Z A;  1VQB A;  4NB3 A;  3AYH B;  2R92 G;  3JAM c;  1XNQ L;  4OXP A;  4DUY L;  4J15 A;  2RHQ B;  3HOY H;  4IFD J;  2NZH A;  1Q81 C;  5AJ3 Q;  1I3Q H;  4LFA L;  4GKJ L;  4BY7 H;  4B3T Q;  3KF6 A;  4X62 L;  4JC0 A;  4IJH A;  5J3B A;  2GN5 A;  1Q46 A;  1H95 A;  4IOA A;  1UE1 A;  1XJV A;  3T1Y L;  4JBJ A;  1OXS C;  1YJ9 A;  2CWP A;  2VQE L;  2R7D A;  4B3T L;  5GAD C;  2R7Z H;  4YY3 L;  3HOZ G;  3D31 A;  4X62 Q;  4GNX C;  2IHF A;  4IFD G;  2R93 G;  4IPH A;  2JA9 A;  2D62 A;  2DGY A;  4DR2 L;  1HZ9 A;  4L5Q A;  2UUC Q;  4JBK A;  2IHE A;  3T1Y Q;  3S14 H;  2LXJ A;  4DV6 L;  3RLO A;  1FVI A;  3KJP A;  3S1M H;  1PH6 A;  4YY3 Q;  4A93 G;  2JJQ A;  4PMW A;  3I4N H;  4DV1 L;  3M3Y H;  2JEB I;  4LFB Q;  2KHJ A;  4EQ5 A;  2HQL A;  2NN6 I;  4A3B H;  1SFO H;  2B63 G;  1E1O A;  3UDI A;  3CC2 A;  2CQO A;  5E7N A;  4LUZ A;  3CMA A;  1YNX A;  3I7F A;  3HOU H;  4LF9 L;  4RMF A;  1OXT A;  4LFB L;  3H3V H;  2VQF Q;  3CF5 A;  3S17 H;  4YCU A;  2K52 A;  1X56 A;  4LF6 L;  1PH3 A;  3HOV G;  4BY1 H;  4LF9 Q;  3BJU A;  4JI2 Q;  3A5U A;  4A3I G;  1N36 L;  4BBS G;  2QA4 A;  4A3E G;  2ZTE A;  2LXK A;  4C3J H;  1G29 1;  4DV4 L;  1VQA A;  1VQD A;  4AH6 A;  2OQ0 A;  4UPA A;  3CCS A;  4AIM A;  4LF6 Q;  2OTJ A;  1KD1 C;  2MO0 A;  3L2P A;  4A4I A;  5IT9 c;  2N3S A;  1FJG Q;  1X54 A;  4OWT B;  4HJA A;  1TWA H;  3PSI A;  1ASY A;  2YU9 H;  3CCV A;  3S1R H;  5EAY A;  4AYB G;  4HIM A;  1WFQ A;  2ATW A;  3GTM H;  4BXX G;  1PVO A;  1UE6 A;  1P16 A;  2ES2 A;  4JI7 L;  4DAM A;  3CQZ H;  3M85 A;  5M3F G;  1NTG A;  1VS0 A;  2NZO A;  2ZM6 L;  3VDY A;  2R7Z G;  4JI5 L;  3RN2 A;  1QVF A;  4XIG S;  2JQO A;  1V9P A;  4R4C A;  5GAH C;  3S16 H;  3FHW A;  2XGT A;  1SRU A;  2YV5 A;  4IO9 A;  1L0W A;  3RLF A;  2JA6 H;  1HNW L;  2I0Q A;  2KCM A;  2EXD A;  2FXQ A;  3CCU A;  1R9T H;  4L5T A;  1JJG A;  3G6E A;  4R4Q A;  4TQU S;  3AFQ A;  2K4K A;  1CKN B;  2VNU D;  2Q2I A;  5ELO A;  1JJC B;  4HJ5 A;  1EYG A;  2EQS A;  1BKB A;  2F4V L;  1KQS A;  1NBW A;  1KHI A;  1E3P A;  4DUZ L;  2PQA A;  2DUD A;  3GTL H;  3T1H Q;  1MKH A;  2AKW B;  3RN5 A;  3H15 A;  1MJE A;  3ULP A;  4R1J A;  1QZG A;  3UE0 A;  1PYB A;  4DUZ Q;  4YCW A;  1PH4 A;  2A8V A;  1EIY B;  2MFI A;  2NVQ H;  1Q12 A;  3ICE A;  1CKM A;  4MTN A;  5AJ3 L;  1YJW A;  1TXY A;  3RZO H;  1A8V A;  1YZ6 A;  3E0E A;  3PUX A;  5GQO A;  3GTQ H;  3U4Z A;  4A3C G;  1VQ4 A;  2VUM G;  2Y0S E;  4PZ7 A;  5IP7 G;  3PV0 A;  1SE8 A;  3ULL A;  3ZJY C;  4JOI C;  3EN2 A;  2Z0S A;  4LW1 A;  5IY0 A;  4JI0 L;  1A63 A;  4DPG A;  2Q2U A;  4DR4 Q;  1LUZ A;  3F2C A;  4K0K Q;  1U5K A;  4JBW A;  4LNQ A;  4BY1 G;  1MIU A;  1N8R C;  4X6A H;  1EQR A;  4DK6 C;  1B8A A;  5M3M G;  3J81 j;  3RNU A;  3OTO Q;  4DR2 Q;  4DR4 L;  1K8G A;  4JG2 A;  1VQJ A;  1NE3 A;  4DV6 Q;  4B3M L;  3MXN B;  1Q1E A;  2WFW A;  3BZC A;  2NVX H;  3G71 A;  1XPO A;  1IBL L;  4DV1 Q;  4LF5 L;  1A0I A;  4IOC A;  2AWO A;  4LFC Q;  4X65 L;  1PH9 A;  4P72 A;  2IX0 A;  4B3M Q;  3GTP H;  1VQE A;  3FP9 A;  4R4O A;  2WAQ G;  1IBL Q;  4P71 A;  1KRS A;  2JEA I;  3J7A 5;  2E2H H;  4GKK L;  2CKZ B;  2VQF L;  1PH8 A;  4LFC L;  4X65 Q;  1YHQ A;  3KDF B;  1Y1V G;  5FJ8 H;  1Q8K A;  2JA7 H;  3B6Y A;  4JI8 L;  5IYB G;  3K0X A;  1VQ6 A;  4BBR G;  3PUW A;  1QZH A;  3HKZ E;  1PH2 A;  1WI5 A;  3U50 C;  3JAM i;  1HR0 Q;  1OXX K;  1VQL A;  4GKK Q;  3DM3 A;  1CKO A;  3K8A A;  4GS3 A;  2VZA A;  5M5W H;  2ASB A;  1GO3 E;  4LUO A;  1FJG L;  1WOC A;  2N49 A;  1E1T A;  3L7Z C;  4R4T A;  1KC8 C;  4A3G H;  1HR0 L;  1VQ9 A;  2Z6K A;  4QIW E;  1IL2 A;  1K9M C;  4X64 L;  4DR1 Q;  2WB1 G;  4B3R Q;  4BA1 I;  5C0X J;  4LWC A;  2HHH Q;  3M4O H;  1HNZ Q;  2WP8 J;  2ZM6 Q;  3A0J A;  2K75 A;  1K0R A;  1HR0 W;  1VQK A;  5LMN L;  4C2M H;  2K14 A;  5C4J H;  4HIK A;  4PZ6 A;  4JI4 Q;  4JI6 Q;  1Q1B A;  2MNA A;  2HHH L;  4LF4 L;  3TRE A;  3J80 i;  3PF4 A;  3L0O A;  5LMN Q;  3S24 A;  2WB1 E;  3E9H A;  3TEH B;  2WAQ E;  4JI4 L;  2NN6 G;  3ER0 A;  1EOV A;  1CUK A;  3F2D A;  2VW9 A;  1GKH A;  2PQA B;  1Z9F A;  5IE8 A;  5IWA Q;  3CCQ A;  4GNX B;  4HJ8 A;  2Q2T A;  4OO1 I;  1L1O B;  2BA1 A;  3BU2 A;  4JI1 Q;  4HJ9 A;  4GLX A;  1VQO A;  4A3M H;  3T1H L;  1TWF H;  1Y1V H;  4H02 A;  3W1B A;  2E5L L;  3JC6 6;  1K3R A;  3NBH B;  3CP0 A;  2IY5 B;  4A93 H;  4JI3 L;  5IWA L;  2Q2H A;  2HIV A;  2K5N A;  1IXR A;  1X65 A;  4JI1 L;  1LTL A;  3PIO A;  1WYD A;  4POF A;  2AMC B;  1HNX L;  2K50 A;  2CCZ A;  1HZC A;  1LYL A;  4JI3 Q;  5IP9 G;  2ID0 A;  2L15 A;  1W2B A;  1CKN A;  2F3I A;  3UE1 A;  2ALY B;  3CCL A;  1W3S A;  1BBW A;  3ULJ A;  5C4X H;  4HID A;  4ALP A;  4JV5 Q;  1RL2 A;  3J80 c;  4DV0 Q;  1PYS B;  1HNX Q;  4K0K L;  1V43 A;  2KCT A;  5GRO A;  5FJ8 G;  2H5X A;  2JA7 G;  1HH2 P;  4OWW B;  2UUB L;  3HOX H;  1KRT A;  2JA8 G;  4JV5 L;  3OTO L;  5FLM G;  4HIO A;  1EQQ A;  4A3B G;  4OWX B;  3CCR A;  3KJO A;  1P8L A;  3PO2 G;  3PGZ A;  3RLN A;  3TRZ A;  5IYC H;  4LF5 Q;  1TWC H;  3FKI G;  5DLQ E;  1YIT A;  2UUB Q;  1QUQ A;  1Z47 A;  3H0G H;  4GLA C; 
#chains in the Genus database with same CATH topology
 2RSO A;  2A69 C;  4A3F G;  2DY7 A;  1MJC A;  2K05 A;  3HOZ B;  1RD9 D;  1CI3 M;  1G91 A;  1Z7T A;  5BN3 A;  2HCC A;  2L4N A;  4O42 A;  4ZCK A;  2C9O A;  4LF7 L;  2QEJ C;  1CT1 D;  4QIW B;  1H9M A;  3SGI A;  3K5O A;  3J7A F;  4AYB E;  1BBU A;  3KFU A;  4X64 Q;  2E2I B;  1I6H H;  4KI0 A;  1EY7 A;  4XYO A;  4MIU A;  1X6O A;  2PPB C;  4A3D G;  1STB A;  4Y7N H;  4LF4 Q;  2PO4 A;  4ZK9 B;  1PTO H;  4IPD A;  1ESR A;  4UP7 A;  4DR3 L;  1TWF B;  3KOJ A;  3OMC A;  4B3S Q;  1F2L A;  1VMP A;  4JK1 C;  5LMU Q;  2BH2 A;  2CH4 W;  1PA6 A;  2AWN A;  3CU7 A;  4B3S L;  3KDF A;  4YHH L;  4LJZ C;  3J7Y W;  2V1C C;  2E5L Q;  1SNO A;  2ZJP A;  3AEV A;  5A2Q E;  4BY7 G;  5C4Z A;  1N32 Q;  2UXC Q;  1LV9 A;  4DNT B;  4C2M B;  4KY5 A;  1ASZ A;  2UXC L;  1N32 L;  1V1Q A;  1EU4 A;  1I6H B;  4RA8 A;  1A3V A;  2H1E A;  4DV0 L;  1YBY A;  1SYG A;  2TSS A;  4FYD A;  1W6K A;  1GM5 A;  2EYH A;  1SYB A;  5I2X A;  1FNW A;  1KAA A;  3U4V A;  5M3M B;  5COY A;  1VQP A;  1KLG D;  1OXU A;  3HOU G;  2A1A A;  3SEB A;  4CKC A;  4A3G G;  4R8N A;  2UU9 L;  2G9H D;  3J80 L;  2I5L X;  2Q8T A;  1LAB A;  5I6Y A;  3BYT B;  1SNM A;  1EEI D;  4HSV A;  3M9B A;  5IGF A;  1H9S A;  4RGO S;  4APV A;  3TME A;  2EPB A;  1EYC A;  3MVV A;  3NHH A;  1XX8 A;  4EVO A;  2ENB A;  5DM6 3;  5C3E H;  1H9K A;  2X69 A;  4A3M G;  3NEN A;  3P75 A;  2SDF A;  1IKM A;  1GD7 A;  1UE7 A;  4L5R C;  2JA5 G;  2R7F A;  1D1K A;  1U0L A;  3KK7 A;  2PI2 E;  3S1M B;  1K73 C;  1BOS A;  3IL8 A;  3PUV A;  3VR2 A;  2VB2 X;  4I7Z C;  2M00 A;  1XNQ Q;  1YIJ A;  4A3K H;  1VCI A;  4GKJ Q;  1E22 A;  3HKZ G;  2R93 B;  4PQX A;  1NY4 A;  4JCV E;  4EGV A;  5FLM H;  2E2I H;  5C44 H;  1B3A A;  4H44 C;  5EBC A;  3HGB A;  1I3Q B;  3ERO A;  2KJX A;  2PI2 A;  1EFI D;  5JVH 3;  3E6Z X;  2K33 A;  3UDF A;  4UDU C;  4KHP Q;  4DR5 L;  1C7Y A;  1E24 A;  5C4X B;  1XPU A;  1YHB A;  1S4Z A;  2JA5 H;  3HOU B;  3PO2 H;  3MHB A;  1ICW A;  1PZI D;  3K5N A;  1C48 A;  1PH7 A;  2XRS D;  4KTA A;  4IJL A;  1B1Z A;  4JOI A;  4LF8 Q;  2E2J H;  1EY9 A;  1GUO A;  5GAE C;  4NXM L;  2GVA A;  2E8G A;  4MZ9 A;  1N36 Q;  3KF8 B;  1K83 H;  2PW5 A;  2OEO A;  3LGJ A;  1VQC A;  2A6E D;  3J81 i;  1ZXT A;  2KED A;  3AQQ A;  1XNR Q;  2B29 A;  2UXD Q;  5EJW A;  3SDZ A;  2RBM A;  5IOC A;  1TKW B;  3MZ5 A;  1KAB A;  1LTS D;  1EWC A;  3OYY A;  5LL6 X;  3C1F A;  2WV6 D;  1S72 A;  2IJ0 A;  1AEX A;  2RHS B;  1XMQ L;  3HFZ B;  2Y0S G;  3T4A C;  2F3W A;  5I2Y A;  3D6W A;  2G5D A;  3ONA B;  1HNW Q;  2QF7 A;  3RMH A;  4GOP B;  3TS0 A;  1XMQ Q;  2O5I C;  1JWU D;  2JA6 B;  3P1H A;  2Q8I B;  2JA5 B;  1SN8 A;  2A6H C;  2F4V Q;  3J81 c;  4M8A A;  2E2J B;  1EOT A;  2EYO A;  2K03 A;  4LFA Q;  1K83 B;  1TY2 A;  3NWS A;  1S5B D;  4C3I H;  5ISR A;  4PNY A;  4K6D A;  3TP8 A;  2R92 G;  3JAM c;  4ULL A;  1CA5 A;  3GTO B;  2I46 A;  4J15 A;  3HOY H;  4LFA L;  3UI2 A;  4B3T Q;  3NBH A;  3K57 A;  4F88 A;  4JC0 A;  4IJH A;  2GN5 A;  1Q46 A;  3GTM B;  1XJV A;  2HQE A;  4QCL A;  1YJ9 A;  2CWP A;  4J8Q A;  2VQE L;  5K5P A;  1PYW D;  3HOZ G;  2IHF A;  5G3L D;  3W2D A;  4IPH A;  4L5Q A;  4ABN A;  2IHE A;  2LXJ A;  5DAU A;  3RLO A;  2O5J C;  4A3G B;  3S1M H;  2A73 B;  2JJQ A;  3I4N H;  2KHJ A;  4XQN A;  1SDF A;  1LTT D;  2ZXR A;  1E1O A;  3CC2 A;  4I7A A;  1YNX A;  4LF9 L;  4KN4 C;  4KJO A;  2BE5 C;  1BCP D;  3VR4 A;  1MSG A;  3HOV G;  5DNF A;  5ELF A;  3OIQ A;  3P20 A;  4BY1 H;  3A5U A;  4MN3 A;  1VQA A;  4UPA A;  1PRT C;  4KHV A;  4AIM A;  1KD1 C;  1E2Z A;  3L2P A;  2IWH A;  5KGU A;  2MPM A;  4FXK C;  4HJA A;  2V4D A;  5FK9 C;  3S1R H;  4DK1 A;  1JOQ A;  3GTM H;  1TS2 A;  1F2Z A;  1P16 A;  4DAM A;  3M85 A;  5M3F G;  2A6E C;  1HA6 A;  2NZO A;  1VS0 A;  2ZM6 L;  3VDY A;  1BDO A;  1QNU A;  2Z8L A;  1UNS A;  4XIG S;  4CJ0 B;  2LMC B;  1SRU A;  2XGT A;  1PTO D;  3RLF A;  2KCM A;  1F9P A;  3I70 A;  1JJC B;  3MTS A;  4HJ5 A;  1KDB A;  1BKB A;  2EJM A;  4ZRZ A;  1KHI A;  2VXW A;  2DUD A;  4OEL B;  2IW3 A;  2FFK B;  3RN5 A;  3H15 A;  1MJE A;  3MWY W;  1YNN C;  1PYB A;  2PNR C;  2K5W A;  1Q12 A;  5J39 A;  3S2H B;  4MTN A;  1TXY A;  1ESF A;  3RZO H;  2R7Z B;  3GTQ H;  3J81 E;  2OXP A;  1Z6H A;  3ULL A;  1GJX A;  3ZJY C;  4LW1 A;  3EN2 A;  4R9W A;  1EIG A;  1LUZ A;  5DEH A;  3F2C A;  4LNQ A;  1N8R C;  4X6A H;  1EQR A;  4DK6 C;  1B8A A;  3T53 B;  3WOF A;  1NR4 A;  4DR2 Q;  4KN7 C;  4IN3 A;  5EPK A;  4JG2 A;  1VQJ A;  3Q6S A;  2WFW A;  4LF5 L;  3VYU A;  1AP0 A;  5CV9 A;  1DCZ A;  1TVX A;  4MTK A;  1Q3L A;  1GUN A;  3BZD B;  1IBL Q;  1KRS A;  3OOC A;  3J7A 5;  4IUP A;  4OL7 A;  1TWC B;  3S2D B;  1JOO A;  2L55 A;  1ET9 A;  4RGT A;  2JA7 H;  3B6Y A;  3E0J A;  4RAU C;  3PUW A;  4C56 C;  3HKZ E;  2MP1 A;  1QZH A;  3U50 C;  4UHV A;  4GS3 A;  3MEH A;  2ASB A;  1GO3 E;  4LUO A;  1WOC A;  4R4T A;  2NTS A;  1LT4 D;  4A3G H;  1VQ9 A;  2Z6K A;  4DR1 Q;  3OIP A;  5IT9 L;  4LWC A;  2HHH Q;  1HNZ Q;  1LTB D;  4ZAI A;  1QCB D;  4HIK A;  4JI6 Q;  1MGS A;  2HHH L;  1D2B A;  1V1O A;  2KHS A;  3PF4 A;  3S24 A;  4FF4 A;  3QOL A;  2WAQ E;  5NUC A;  1B44 D;  2NN6 G;  1EEF D;  1CUK A;  1PTO B;  4B08 A;  2VW9 A;  5ELC A;  3EQL C;  2PQA B;  4HJ8 A;  1Z9F A;  5IE8 A;  4OO1 I;  4JI1 Q;  1VQO A;  2L9H A;  3MXG A;  2AQ3 B;  5C5L A;  3T1H L;  1Y1V H;  2E76 C;  3W1B A;  1K3R A;  3NBH B;  3CP0 A;  2F0G A;  3H09 A;  1J8I A;  4JI1 L;  2P5Z X;  5KNB A;  4G7H C;  3X3M A;  4POF A;  2AMC B;  1L0Y B;  2A5H A;  1BCP F;  5D3I B;  5EPL A;  3C46 A;  1B53 A;  4ALP A;  2IPK D;  2J7Z A;  1QNK A;  1QWY A;  1V43 A;  5GRO A;  5FJ8 G;  2H5X A;  4OWW B;  4M1U B;  2JA8 G;  1EY8 A;  4HIO A;  1EQQ A;  1IKL A;  3PIP 3;  2BCO A;  5I4D A;  3SK6 A;  3MXU A;  3PGZ A;  3HRZ C;  1AN8 A;  3QR8 A;  3FKI G;  1SJE D;  1Z47 A;  4GLA C;  1SE3 A;  1SNP A;  4P74 A;  4A3L G;  3GTK H;  3K0Y A;  3RZD H;  1WTV A;  4LF7 Q;  2J4X A;  4Q0F A;  4NKL A;  4UY8 C;  4DN4 M;  1GUG A;  1WCM H;  2IT1 A;  3Q8D A;  4JI8 Q;  2EY1 A;  4X66 L;  2K5D A;  1KXL A;  1EWI A;  1YVC A;  3VR6 A;  3CHB D;  1HA5 A;  1ICF B;  1VQF A;  5C0X H;  3HKS A;  4KKT A;  4X66 Q;  1ILP A;  1QVG A;  2PZW A;  5FLX E;  5EKL A;  1JB7 A;  4J6H A;  1FL0 A;  2OCE A;  3NP8 A;  3IAY A;  5FOB B;  2EY5 A;  4R4I A;  2L0C A;  5JPN C;  1NJI C;  4B3R L;  4QQB X;  3C2P A;  3M4O B;  1YEZ A;  2D0O A;  2X6L A;  5K36 H;  4KD3 A;  1VQI A;  3GV3 A;  3EJI A;  2JK8 A;  4RH6 A;  2PZU A;  4F87 A;  5KYI A;  3PMF A;  3S2D H;  4RCN A;  3CAM A;  3URY A;  1M1K C;  3F2B A;  4NPS A;  4PV1 C;  5IP9 H;  4JI0 L;  5CV4 A;  1SEB D;  1UE5 A;  1B2T A;  1WJJ A;  3H0G G;  2GVB A;  1F9Q A;  3KYH C;  5IYD H;  3UDG A;  1IBM L;  1KTK A;  4YWM A;  4GLV B;  5ELE A;  2B2U C;  2UUA L;  2MGS A;  3HEJ A;  4PG3 A;  1GXD C;  1I50 H;  1Y14 B;  5C0X G;  2A74 C;  2O2L D;  1Y1W G;  4HCS A;  1N34 L;  2NB0 A;  1IHZ A;  2RSN A;  3G48 A;  1STY A;  3E9I A;  3GTJ H;  1KAW A;  1WCM G;  5F2D A;  1NR2 A;  3I4N G;  2F0U A;  2VS1 A;  5FO7 B;  1CA6 A;  1K8A C;  1I94 Q;  4AQY Q;  2B63 H;  3I90 A;  1WTP A;  1F9S A;  4PZ8 A;  2RCF A;  2F0I A;  3CW2 C;  2YTY A;  3HOZ H;  4IFD H;  2CQA A;  1A3T A;  4XT1 B;  4KLK A;  3O13 A;  1B7Y B;  2YTV A;  4DAP A;  4BS9 A;  4RGM A;  3TP7 A;  3OPO A;  1UWV A;  3HP3 A;  5JJK A;  5ELN A;  4NDX A;  3CC7 A;  1Y8N B;  2E74 C;  2B3G A;  2ZTD A;  5KRU A;  1LTA D;  1TWH H;  4P75 A;  4A75 A;  4GOP A;  4DV2 L;  3S2H H;  1DM0 B;  1PFM A;  1S40 A;  3Q0A A;  5D65 A;  1N9W A;  1BO0 A;  1EWH A;  4DNI A;  3BDL A;  3K6O A;  3DXJ C;  1D5M C;  3CCM A;  2I5M X;  1F77 A;  3GTJ B;  1S5F D;  2F0W A;  3S1N H;  3K81 C;  3GTK B;  4QL5 A;  2MJ8 A;  1TWG H;  3GDE A;  5A35 A;  5L37 A;  4WJ4 A;  4BXX H;  1SAP A;  1VF5 C;  5M5X H;  5CMD A;  2CVR A;  1A2U A;  4RHR A;  5LHY 1;  1J5E Q;  3U9O A;  4K8J A;  1NSN S;  1G51 A;  3I3C A;  1EFW A;  1Q7Y C;  4H7B A;  2JA6 G;  5C3X A;  2CHB D;  4GN4 B;  3VA5 A;  1AW7 A;  1S5C D;  3AFP A;  2A19 A;  3A7L A;  3A74 A;  1L1O A;  2CFM A;  3CXC A;  5IP7 H;  4C3J B;  4DR5 Q;  3KLW A;  4YWL A;  5C4X G;  4A3L H;  2UUC L;  1PFN A;  3EIV A;  2F0F A;  1IBK L;  2WIN B;  3GO5 A;  4CDC C;  5M3M H;  1WTH A;  1EQV A;  3M3Y B;  2F0M A;  4LF8 L;  1U4L A;  3D6C A;  4HR7 B;  1SND A;  3A54 A;  3SK8 A;  1CSP A;  4LK1 C;  1IBK Q;  2VB3 X;  3DWP A;  5LMN W;  3ERQ A;  2IL8 A;  3HOX B;  2NWG A;  1XNR L;  1SR3 A;  4A76 A;  1HUM A;  1CZG A;  2R93 G;  2QGQ A;  4XTC S;  5T1G A;  1ZYR C;  1ENC A;  3HOY B;  2DNE A;  4C3H H;  1X9N A;  3I55 A;  1ONL A;  4DV4 Q;  3KF6 B;  1Y8O B;  1PZJ D;  3TSS A;  4JYA L;  2ZTC A;  5IOD A;  1JOR A;  5COR A;  2A68 D;  3BVZ A;  4NP5 A;  1U4R A;  1PH5 A;  2L11 A;  2BH8 A;  3PO3 B;  4JI7 Q;  3KLS A;  1JJ2 A;  4CBV A;  1JWS D;  4DR7 Q;  4IPG A;  2BDN A;  2EE1 A;  5A2Q L;  5C4J B;  2GA4 B;  1PRT F;  4OO1 G;  4A3K G;  1R4Q B;  4X3U A;  3QOJ A;  4DR7 L;  4OX9 L;  4IAL A;  1WTO A;  5C44 G;  1LT6 D;  1T5X D;  4OX9 Q;  4A3K B;  2NBF A;  2F0D A;  4GN3 B;  2YTX A;  4DUY Q;  2DNC A;  5IYD G;  3NSW A;  2R93 H;  1TWH B;  5IGD A;  1WTX A;  1JE5 A;  1HZB A;  5JJL A;  4KMU C;  1E7Z A;  1VQB A;  1HQR D;  1XNQ L;  4OXP A;  4DUY L;  1Q81 C;  1RTN A;  1I3Q H;  4IUV A;  1PMR A;  5G3L F;  1IYV A;  2BDO A;  3KF6 A;  3TP6 A;  1WTW A;  5J3B A;  1H95 A;  5TSS A;  1H9R A;  1O78 A;  2R7D A;  3CRK C;  5GAD C;  4YY3 L;  3D31 A;  4GNX C;  1CQV A;  2FIN B;  4JBK A;  4DV6 L;  1MD2 D;  1PH6 A;  4YY3 Q;  4PMW A;  4DV1 L;  1PXU A;  4EQ5 A;  2HQL A;  2FMC A;  5JVG 3;  2AQ2 B;  1X32 A;  3U9S A;  1GHJ A;  2HUG A;  4LFB L;  3H3V H;  2XWB B;  4L63 B;  3CF5 A;  2K52 A;  5KIX A;  3WOE A;  1N36 L;  2G9D A;  4BBS G;  2KUM A;  4C3J H;  1VQD A;  3CCS A;  1F2Y A;  2HDL A;  5FO9 B;  1ASY A;  4WJW A;  5EAY A;  3R2T A;  1TU2 B;  1WFQ A;  1UE6 A;  5CBA E;  3IFD A;  1A3U A;  5KND A;  2R7Z G;  1H9S B;  5E4X A;  1DOM A;  4JI5 L;  1ZKO A;  2JXM B;  2CH4 A;  4R4C A;  3FHW A;  5T1I A;  1HNW L;  2E75 C;  2NTT A;  1R9T H;  4L5T A;  3EA6 A;  3G6E A;  4TQU S;  4JVZ A;  3D8G A;  3HZX A;  1J9O A;  2Q2I A;  4TSS A;  2F4V L;  1E3P A;  3SK5 A;  2XIW A;  1EZ8 A;  2NVY B;  1LAC A;  1RJT A;  4A3D B;  1TY0 A;  4DUZ Q;  4YCW A;  1PH4 A;  1Y1V B;  2NVQ H;  5AJ3 L;  1EYD A;  1IL8 A;  2F0P A;  1YJW A;  1Q8I A;  1YZ6 A;  3ZYY X;  3U4Z A;  4KJN A;  2VUM G;  5CV7 A;  3PV0 A;  4RKB A;  3FRP B;  4DPG A;  4DF7 A;  4K0K Q;  1U5K A;  4BY1 G;  1MIU A;  3FEW X;  2RVL A;  3CQZ B;  1SYD A;  3J81 j;  1LT3 D;  4DR4 L;  1K8G A;  3TBI B;  2L1B A;  2NVX H;  1IBL L;  4A3B B;  5IGB A;  1PH9 A;  3QWN A;  2IX0 A;  4IUT A;  5FO8 B;  4R4O A;  2WAQ G;  1BBX C;  2ZXP A;  4P71 A;  1GHK A;  4GKK L;  2CKZ B;  5M5X B;  1BR9 A;  1PH8 A;  3C1E A;  4X65 Q;  1YHQ A;  3KDF B;  1Y1V G;  5FJ8 H;  1Q8K A;  1HCZ A;  3K0X A;  4JPB W;  4O1N A;  4GKK Q;  4L6T B;  4NW2 A;  3K8A A;  4HED A;  2VZA A;  3BDC A;  4CGY B;  1FJG L;  1O7Y A;  1QG7 A;  1WVL A;  2XNA C;  4QIW E;  1IL2 A;  4X64 L;  5M9O A;  3RD4 A;  2D9U A;  2EOT A;  4ZLT F;  2MUY A;  3NTI A;  1Q90 A;  4BA1 I;  4C3I G;  3NE5 B;  2ZM6 Q;  5CR3 A;  1VQK A;  2FJ2 A;  3KLR A;  4HSP A;  4RHS A;  4FF3 A;  2K14 A;  2VUM B;  5J1Z A;  1PRT B;  2JN4 A;  2ZXO A;  3K5L A;  1FGB D;  2DJG C;  2F0L A;  3J80 i;  2WB1 E;  3E9H A;  2PZT A;  4N8X 1;  4RWS C;  3RZD B;  1EOV A;  3MXP A;  4QF4 A;  3F2D A;  2ICE C;  4B9W A;  1E2W A;  2K04 A;  1GKH A;  3BG3 A;  3CCQ A;  1SJH D;  1L1O B;  3PQI A;  4ID6 A;  3Q24 A;  4XQJ A;  2IY5 B;  1CK1 A;  2Q2H A;  3PIO A;  2K5N A;  1IXR A;  1X65 A;  1LTL A;  1BQQ T;  3AB9 A;  3NUC A;  2CCZ A;  1HZC A;  4QMG A;  2ID0 A;  1CKN A;  1TS5 A;  2F3I A;  3TN2 A;  3UE1 A;  1SE4 A;  4TKO B;  2F3V A;  3VR3 A;  4A3E B;  2KVM A;  4Q5V A;  2JA7 G;  1IW7 D;  5E3F A;  2UUB L;  4JV5 L;  2TMP A;  3R8B A;  3FVQ A;  3TDQ A;  1KNE A;  3KF8 A;  4F7X A;  1I6V C;  1K8M A;  2B63 B;  5IYC H;  1C4Q A;  1TWC H;  2UUB Q;  1YIT A;  1JWM D;  2B2W A;  3H0G H;  1PTO C;  2XVS A;  1WD1 A;  4A3I H;  3EBE A;  2A6H D;  2KEN A;  2BA0 A;  1EU3 A;  3W1G A;  1VQG A;  1D5Z C;  4YCV A;  2EZV A;  5IT9 E;  1V1P B;  5IGC A;  1EYA A;  2EIF A;  3A8K E;  1D1I A;  3KLS X;  2F0S A;  1LT5 D;  3Q23 A;  3H6M A;  2KEC A;  2I5H A;  2QW7 A;  2R61 A;  3SVM A;  2RF4 A;  5IGE A;  3TS2 A;  1HPC A;  3BVG A;  1M8A A;  4OGQ C;  3DEO A;  3S1R B;  4OO1 H;  3UDX A;  1E2V A;  4FDB A;  1HNZ L;  3A5Z B;  4JI0 Q;  4NXN L;  3BZK A;  3FPP A;  3S1N B;  4LUV A;  3I4L A;  4Y52 H;  3ERS X;  3L9A X;  3STB D;  1LM0 A;  1IW7 C;  1K3B C;  4BA2 I;  3PO3 G;  1Q82 C;  2UUA Q;  4GN5 A;  1A2T A;  4A3F H;  3VYT A;  4QGU A;  5BR8 L;  4A3M B;  3A55 A;  4X3T A;  1J6Q A;  5JJI A;  5CC4 A;  1N34 Q;  3U58 A;  1X55 A;  2KBN A;  5C44 B;  4V19 0;  4OIK A;  3A8J E;  2Z1C A;  5C5M A;  3BS1 A;  1X3G A;  5CYU A;  1MI2 A;  2SOB A;  4DK3 C;  2JSO A;  1T9H A;  4G57 A;  2Z4I A;  5HGQ A;  1ENF A;  1DZ1 A;  4IUR A;  3S15 H;  5HY6 A;  2R92 H;  3S1Q H;  1TQO A;  2FMM A;  4BBR H;  3VYR A;  1CHQ D;  1KL9 A;  1FD7 D;  2KA7 A;  3MEF A;  4DV3 Q;  3A8I E;  3E5S A;  3D0F A;  3AU7 A;  4X3K A;  1HZA A;  4QY7 A;  4NXM Q;  4RKL A;  1KIX A;  1AE2 A;  3X3N A;  2HIX A;  3OW7 A;  1ROD A;  5HUR A;  2X6G A;  1PH1 A;  4FXD A;  5J22 A;  1SMX A;  3CPF A;  4S3S A;  2F0K A;  2RDH A;  4A3D H;  1DGS A;  2ZJR A;  3T13 A;  1AZQ A;  4IQZ A;  2XTI A;  4PMB A;  1D7Q A;  3QJY A;  3PO3 H;  1Y1W H;  2KCN A;  2RDG A;  4O2D A;  2PCF B;  4BY7 B;  3I4M H;  2ZJQ A;  4BBS H;  4KD4 A;  2AUK A;  3GTG H;  4C3J G;  1SLJ A;  3CD6 A;  1VMC A;  1G6P A;  2QEX A;  1STE A;  4P2C B;  1GVP A;  1C9O A;  4K2L A;  1PFB A;  4Y7N B;  3RR5 A;  4ZQ3 A;  3R93 A;  1L1O C;  2KQ3 A;  2H4O A;  2UXB L;  4EX5 A;  1S5D D;  1PTO F;  1WTR A;  5LMU L;  1EQT A;  4H13 C;  4IFD I;  4YHH Q;  3CRL C;  1C0A A;  2UXB Q;  1G2T A;  4DFA A;  2OF1 A;  5CV5 A;  1C8C A;  5AFW A;  2VQE Q;  3FKI H;  3IRB A;  2PNH A;  3M4Y A;  1K28 A;  1SRO A;  2O4X A;  1FGU A;  2B2Y A;  3WWV A;  4KY6 A;  5C3E G;  3PIO 3;  1HXY D;  3I4M B;  2K5H A;  1BCP B;  1M4V A;  1STH A;  4FNF A;  4HJ7 A;  1BVS A;  2OQK A;  1EY6 A;  2XWJ B;  4A3J G;  2VUM H;  5IYC G;  1I94 L;  3N52 A;  5FKA C;  3K80 C;  4FF1 A;  4JYA Q;  4JI2 L;  2UU9 Q;  3M4Q A;  4MNO A;  4GOP C;  4B9X A;  1HRJ A;  2CWA A;  4UP9 A;  1RCV D;  1VQ8 A;  4DKA C;  4L5S A;  2D0P A;  3CME A;  2KHI A;  2QIL A;  4OON A;  2HT1 A;  1LLR D;  1E0B A;  1U4M A;  1H9J A;  2Z6B A;  3F8T A;  3S1Q B;  2R92 B;  4DXG A;  1RIP A;  1WCM B;  1G2S A;  1GOZ A;  3PUZ A;  1U9R A;  4IUN A;  4DU9 A;  2A68 C;  1X3F A;  1B4O A;  5LL6 S;  2BOS A;  5IYB H;  4A3E H;  5D3D A;  1LTI D;  3QIA A;  4LAA A;  1A15 A;  3MXN A;  4OEM B;  3I8Z A;  4UAI A;  1B70 B;  1KLU D;  3F1Z A;  2QDL A;  4ILW A;  1AH9 A;  1QUQ B;  4KHZ A;  2B2V C;  2MO1 A;  5DM7 3;  1BF4 A;  1HHV A;  1ZYR D;  2F0H A;  1S3O A;  1XTD A;  5M3F H;  3NXW A;  1TS3 A;  1J5E L;  1O7I A;  4C1N I;  4DV7 L;  3H0G B;  3QO2 A;  2EYM A;  1EY4 A;  1ENA A;  3D4R A;  4IFD J;  1SE2 A;  4GKJ L;  4BY7 H;  1XYI A;  1WD0 A;  4I65 A;  1STA A;  3K7A B;  1I4R A;  1X3Q A;  1UE1 A;  3T1Y L;  4JBJ A;  4KKU A;  1O80 A;  1I50 B;  3BYY B;  3H91 A;  4IFD G;  3GP7 A;  1O7Z A;  1RHP A;  2JA8 B;  3T1Y Q;  4CJ2 C;  3KJP A;  1SYF A;  4IUU A;  4A93 G;  4LFB Q;  2JEB I;  1WTQ A;  2B63 G;  5E7N A;  4LUZ A;  4KV6 A;  3HOU H;  2E2D C;  1CM9 A;  1OXT A;  2VQF Q;  4YCU A;  2CW0 C;  2JA7 B;  3BJU A;  3KBG A;  4A3I G;  3LWE A;  4G7O C;  1RKN A;  2D5D A;  1SBB B;  1MBY A;  2XN9 C;  2LXK A;  4A3E G;  3FKI B;  1G29 1;  3W3A A;  2AQ1 B;  4AH6 A;  5IGG A;  2B8F A;  4LF6 Q;  4XT3 B;  2OTJ A;  1SYC A;  2N3S A;  3HKZ B;  1X54 A;  4OWT B;  1TWA H;  3PSI A;  1JOK A;  3OMG A;  4AYB G;  4HIM A;  2ATW A;  4BXX G;  2ES2 A;  5BN4 A;  3CQZ H;  4ZUI A;  1NTG A;  3J80 E;  1HUN A;  2BE5 D;  3RN2 A;  4N8F A;  2C5C A;  1QVF A;  2JQO A;  1V9P A;  3D4W A;  5GAH C;  3S16 H;  2NVX B;  2YV5 A;  4IO9 A;  1L0W A;  3S14 B;  2I0Q A;  3CCU A;  2EXD A;  2FXQ A;  4R4Q A;  4XDX A;  3D4D A;  1CKN B;  4FXG C;  1O7L A;  3LNN A;  2B39 A;  2EQS A;  1EY5 A;  1NBW A;  4DUZ L;  2E2H B;  2B2V A;  2DY8 A;  5I6W A;  4C3I B;  4R1J A;  4ODG A;  4HTH A;  2A8V A;  2MFI A;  3NQT A;  3J7A V;  3ICE A;  1JR0 D;  3VA7 A;  5EKI A;  3E0E A;  2IX3 A;  4K14 A;  4A3C G;  2L5T A;  1VQ4 A;  3A56 A;  4PZ7 A;  5EPJ A;  1VDZ A;  1SE8 A;  4XXE A;  4PMC A;  5IY0 A;  3NTH A;  2Q2U A;  4DR4 Q;  3DWQ A;  2Z9H A;  1BCP C;  2EJG C;  2EYP A;  1U4P A;  5M3M G;  1ET6 A;  3OTO Q;  4LMQ D;  1TT2 A;  4DV6 Q;  1NE3 A;  3T51 B;  4B3M L;  1V8Q A;  3G71 A;  4K5V A;  4DV1 Q;  1A0I A;  4IOC A;  3AMU A;  1JB3 A;  4LFC Q;  2NN6 H;  4X65 L;  4P72 A;  2LS0 1;  3NPP A;  4B3M Q;  1SXT A;  1VQE A;  3FP9 A;  3GTP H;  1HTL D;  2JEA I;  2E2H H;  4LFC L;  2B8G A;  4C1N K;  3HS0 C;  4BY1 B;  1HTP A;  4JI8 L;  4BBR G;  1WI5 A;  1OXX K;  1TS4 A;  4C3H B;  1KNA A;  2LKV A;  5IIF A;  3MC0 B;  4CKB A;  1E1T A;  3L7Z C;  1KC8 C;  1HFN A;  2MHV A;  3OWF A;  2B2Y C;  4XYQ A;  4B3R Q;  3SE0 A;  3M4O H;  1DJR D;  2WP8 J;  1K0R A;  1CFM A;  3MFG A;  4DXF A;  3K59 A;  1HR0 W;  3EVQ A;  5E1F A;  3ND9 A;  5C4J H;  5CV8 A;  4LF4 L;  2M9V A;  2DN8 A;  1B9N A;  3JAM L;  5LMN Q;  1GUS A;  4FVM A;  3WDN A;  3ER0 A;  1CHP D;  3HG9 A;  4X3S A;  2Q2T A;  3V05 A;  2BA1 A;  4OHJ A;  4HJ9 A;  1II3 A;  1JC7 A;  4GLX A;  3V2T A;  4J1M A;  2QDB A;  1TWF H;  2E5L L;  1I4Q A;  2EJF C;  2PW7 A;  4A93 H;  3N6R A;  5IWA L;  2HIV A;  2ICI A;  3HOV B;  1FNU A;  4L8J A;  3GTQ B;  1LYL A;  1QE6 A;  2I07 B;  1W2B A;  2ALY B;  1W3S A;  5C4X H;  4JV5 Q;  4HID A;  3MA2 B;  3J80 c;  4DV0 Q;  1PYS B;  2K01 A;  1HNX Q;  4K0K L;  2KCT A;  2HDM A;  1FR3 A;  3PO2 B;  4KK7 A;  1HFG A;  4GZY C;  4BBR B;  4NMZ A;  4A3B G;  1IYU A;  4OWX B;  3KJO A;  3TZU A;  1P8L A;  1CTM A;  3I91 A;  4ZUJ A;  3TRZ A;  4G4K A;  4LF5 Q;  4ZYS A;  5DLQ E;  4HCE A;  5I9P A;  1QUQ A;  1SMY C;  4Z9C B;  1F9R A;  1G6Z A;  4FF2 A;  1BXT A;  4QJF A;  1EUJ A;  4DR6 L;  4U67 3;  3I2Z A;  1NCV A;  2OTL A;  4DV2 Q;  1EIH A;  2VY3 A;  5EQ0 A;  4RCO A;  4YWK A;  3PIP A;  1XPR A;  2CW0 D;  4DR6 Q;  2C35 B;  1PHJ A;  2F0N A;  1PFS A;  4ME3 A;  3MAQ A;  4NXN Q;  4DR1 L;  1VQM A;  4CDD C;  5EBD A;  2LSS A;  5FLX c;  1Y69 U;  3I56 A;  2B2T A;  1A6X A;  1ZEQ X;  4E6I A;  3GTP B;  1YHA A;  2JA8 H;  3T56 B;  4JI6 L;  4K5X A;  4AYB B;  3P7J A;  1UAP A;  3SK4 A;  2Y0S B;  5M5Y H;  2LFN A;  2KCC A;  2WKD A;  1CSQ A;  2K5Q A;  1EIF A;  2RA4 A;  3HOW B;  1UEB A;  1JJG A;  2A69 D;  1VQ7 A;  5C0X I;  5BR8 Q;  5FLX L;  5JEA H;  3NEL A;  1OO9 B;  4DK0 A;  2QCP X;  1KDA A;  4DR3 Q;  4IPC A;  1EY0 A;  2N8N A;  1Q86 C;  3CCJ A;  1BNZ A;  3TZD A;  1TR5 A;  2K32 A;  4CDE C;  2KEE A;  4A3C H;  1CZW A;  3CCE A;  5C3W A;  1L2F A;  3CPW A;  2NVQ B;  1TWA B;  4WJ3 M;  3R2I A;  2RCN A;  4BBS B;  1JIC A;  2F0Q A;  1XTC D;  3TP5 A;  1X3E A;  4WRD A;  4KHP L;  1OTC A;  4ZKB B;  5H1S E;  3HOY G;  3NK9 A;  4KY7 A;  3G4S A;  1DOL A;  4JBM A;  2F0E A;  4G7Z C;  2AHO B;  3RUZ A;  1YI2 A;  1PLF A;  1RF2 D;  4K2K A;  3PF5 A;  4A3I B;  3HOW H;  2EY2 A;  1XMO L;  3GTL B;  2NVT B;  2F1M A;  2F52 A;  4EQP A;  4R8I A;  3HOV H;  1YJN A;  1JCK B;  3JAM E;  2UXD L;  4BWG B;  1XMO Q;  2Z4H A;  5C6A A;  1SYE A;  2XRQ D;  2QKI C;  5JOB A;  3H3V I;  1IZ6 A;  4TVA B;  5CBE E;  3V96 A;  1K8O A;  3T16 A;  3J7Z C;  3W5O A;  2RDF A;  2NYZ D;  3I73 A;  3EFX D;  2PMZ E;  3CKI B;  1S5E D;  2N78 A;  1PDQ A;  4O0A A;  4RGN A;  1R4P B;  2VL6 A;  3PCO B;  4P73 A;  1SNQ A;  3DUZ A;  4DV5 Q;  4IZ8 A;  5D14 A;  1EZ6 A;  2NVT H;  4CJ1 B;  3HOW G;  2Z6K C;  1JMC A;  1B50 A;  2EDG A;  5I9O A;  4DV5 L;  3L3O C;  1B9M A;  1IBM Q;  1DYQ A;  4JW0 A;  1D8L A;  2EYJ A;  5M5W B;  2B2U A;  2YYZ A;  3M7N A;  2NZ1 D;  1NMG A;  4EQO A;  3GTO H;  4POG A;  4GNX A;  1HJP A;  2JE6 I;  1DOK A;  1D6E C;  3DLL A;  3STB C;  2SNM A;  3GD7 A;  1VQN A;  1I4X A;  5C4H A;  2PQE A;  4H0L C;  5M5Y B;  2KOL A;  3I4M G;  3R3O A;  3M4P A;  1LTG D;  5C3E B;  1SSO A;  3I4O A;  3HOX G;  1YNJ D;  3BVM A;  2F4I A;  1JT8 A;  2B2T C;  3KBX A;  5GAG C;  4DV3 L;  3NEM A;  5KNC A;  4AQY L;  2B2W C;  4EQN A;  1Y8P B;  1IYJ B;  3I4N B;  3C3L A;  4MHE A;  1K0S A;  2D2C C;  3TQY A;  4CKE A;  4UP8 A;  3NBI A;  4FO2 A;  3CC4 A;  1QIL A;  4DAY B;  1QJO A;  1QVC A;  1T5E A;  5K36 G;  3FDT A;  2F0J A;  5ELB A;  1XWE A;  2WAC A;  1PV4 A;  1Y1W B;  3K7U C;  3K7A H;  2K5V A;  1NMF A;  4RG1 A;  3A7A B;  3OW2 A;  1N33 Q;  5HGT A;  4N9T A;  2MQH A;  3GTG B;  2IX1 A;  4JI5 Q;  1N33 L;  1STN A;  3GQB A;  2SEB D;  5KEE A;  1AE3 A;  4U68 A;  1AZP A;  5JEA J;  1A62 A;  1I5F A;  5CV6 A;  1OXV A;  1R9T B;  3PUY A;  2K7V A;  3G7L A;  2FHT A;  4A3J H;  2R6G A;  2OWO A;  4DV7 Q;  2SNS A;  1FNV A;  1YNN D;  1NUC A;  4QUC A;  5JEA G;  1M90 C;  1W6J A;  1VQH A;  2NVY H;  2LY7 A;  3K58 A;  1CQF A;  2PMZ B;  1VQ5 A;  4NB3 A;  3AYH B;  2RHQ B;  4WFN 3;  3IFT A;  2NZH A;  5AJ3 Q;  1X3P A;  4A3F B;  3H94 A;  4FP5 D;  4X62 L;  2N55 A;  5BN5 A;  4IOA A;  3IKJ A;  1OXS C;  4ME5 A;  4N9P A;  3QG1 A;  3SR1 A;  5JJZ A;  4B3T L;  2R7Z H;  1BUV T;  3RZO B;  1DD2 A;  4X62 Q;  3DMU A;  3S16 B;  4C3H G;  2JA9 A;  3I72 A;  2D62 A;  2DGY A;  3QB3 A;  1HZ9 A;  4DR2 L;  2UUC Q;  3S14 H;  1RDP D;  1FVI A;  2M2L A;  1I4G A;  3M3Y H;  2WKC A;  3VR5 A;  3S15 B;  2NN6 I;  4A3B H;  2RKS A;  2EY6 A;  1SFO H;  3UDI A;  1KDC A;  2K1B A;  2CQO A;  3CMA A;  4HMI A;  3I7F A;  3ITP A;  2OT2 A;  3VYS A;  3NQI A;  1ILQ A;  4RMF A;  1AFP A;  4CHT B;  4HMJ A;  3S17 H;  2F03 A;  1V1P A;  1X56 A;  1PH3 A;  4LF6 L;  2PYK A;  4LF9 Q;  4JI2 Q;  1YNJ C;  1L0X B;  2QA4 A;  2ZTE A;  2J0T D;  4DV4 L;  2AUJ D;  2OQ0 A;  2F0T A;  3Q22 A;  3LWU A;  3OHX C;  2MO0 A;  4A4I A;  5IT9 c;  1FJG Q;  1DON A;  2YU9 H;  3CCV A;  1PVO A;  4JI7 L;  1PRT D;  4DAV A;  3FMC A;  1SMY D;  4K5W A;  3ND8 A;  2JA6 H;  1HQM C;  3E3X A;  3DWA A;  4HN7 A;  1NNX A;  3DM1 A;  3AFQ A;  2K4K A;  2VNU D;  3J81 L;  3S9W A;  5ELO A;  2WB1 B;  1STG A;  1EYG A;  2NUC A;  2Q8R E;  1QB5 D;  1KQS A;  4QB4 A;  1LTR D;  2R3Z A;  2PQA A;  3S17 B;  1GUT A;  1MHW C;  3GTL H;  3T1H Q;  1MKH A;  2AKW B;  2F0V A;  1F2M A;  3ULP A;  3GV6 A;  1QZG A;  2HCI A;  3UE0 A;  4DGZ A;  1MSH A;  2K6A A;  1EIY B;  1CKM A;  1A8V A;  4DNR B;  3PUX A;  3M7G A;  2JYO A;  5GQO A;  2YU9 B;  1VF7 A;  2Y0S E;  5IP7 G;  4OIJ A;  4K6L A;  4JOI C;  2Z0S A;  3DEP A;  4RFB A;  1A63 A;  4JBW A;  1JE4 A;  3SHL A;  3RNU A;  1PZK D;  1B3Q A;  5ELD A;  3MXN B;  1Q1E A;  4F8M A;  3BZC A;  4V0B A;  1QOH A;  1XPO A;  4DA2 A;  2AWO A;  2XSC A;  3BDO A;  1LO5 D;  2VQF L;  5CGK A;  3D3R A;  3OWE B;  4A93 B;  4YIJ A;  5IYB G;  1VQ6 A;  5EGT A;  1PH2 A;  1VQL A;  3JAM i;  1HR0 Q;  3DM3 A;  1CKO A;  5KYL A;  1JQY D;  5M5W H;  2L12 A;  2DJF C;  2N49 A;  1SNC A;  3K5M A;  4KKS A;  4ZKC B;  3NWT A;  2K28 A;  3MFY A;  1HR0 L;  1RTO A;  2HD3 A;  1K9M C;  2WB1 G;  1SFO B;  5C0X J;  3A0J A;  2K75 A;  1TWG B;  2EXZ A;  5LMN L;  4C2M H;  1ML0 D;  4JI4 Q;  4PZ6 A;  1Q1B A;  2MNA A;  3TRE A;  1EL0 A;  3H3V C;  3L0O A;  4K8I A;  1I4H A;  3TEH B;  4JI4 L;  5E4W C;  2EVB A;  5EKK A;  3G6J B;  4IUQ A;  2N88 A;  5IWA Q;  4GNX B;  1UEA B;  3BU2 A;  1I4P A;  1D5X C;  3F2U A;  4A3M H;  1DXM A;  4H02 A;  3JC6 6;  3SXH A;  5JPM C;  5M3F B;  4CDF C;  2WAQ B;  4JI3 L;  1NAP A;  4DAY A;  2ZT9 C;  1WYD A;  4QUF A;  2F0O A;  4XQQ A;  1TII D;  1GUW A;  1FYC A;  1HNX L;  1G8Z D;  2K50 A;  4JI3 Q;  2EYL A;  3KUP A;  3DHQ A;  2L15 A;  4TRD A;  5IP9 G;  3FPU B;  3CCL A;  3OSO A;  1BBW A;  3ULJ A;  2WII B;  3NTK A;  1RL2 A;  1XXG A;  4WOR A;  1HH2 P;  5JAV A;  2EYF A;  4HAE A;  1KRT A;  1UUP A;  3LX0 A;  3OTO L;  3HOX H;  5FLM G;  3CCR A;  2JP1 A;  3PO2 G;  3RLN A;  2RQX A;  4A3J B; 
#chains in the Genus database with same CATH homology
 4P74 A;  4A3L G;  3GTK H;  3RZD H;  4A3I H;  4A3F G;  3EBE A;  4LF7 Q;  1MJC A;  2KEN A;  4QJF A;  4UY8 C;  2BA0 A;  1EUJ A;  4DR6 L;  1WCM H;  3W1G A;  1VQG A;  2IT1 A;  3Q8D A;  4YCV A;  3I2Z A;  4JI8 Q;  4X66 L;  4DV2 Q;  2OTL A;  1KXL A;  1EWI A;  1YVC A;  4LF7 L;  2EIF A;  2VY3 A;  3PIP A;  4YWK A;  1XPR A;  1VQF A;  4DR6 Q;  3HKS A;  3SGI A;  2C35 B;  2I5H A;  4X66 Q;  1QVG A;  1PHJ A;  2RF4 A;  1PFS A;  4ME3 A;  4AYB E;  1BBU A;  1JB7 A;  1FL0 A;  3KFU A;  2OCE A;  3TS2 A;  4NXN Q;  4X64 Q;  4DR1 L;  1VQM A;  4R4I A;  1I6H H;  3UDX A;  4KI0 A;  1NJI C;  2LSS A;  5FLX c;  4B3R L;  4FDB A;  3I56 A;  4QQB X;  1YEZ A;  2D0O A;  1HNZ L;  3A5Z B;  1VQI A;  4NXN L;  4JI0 Q;  1YHA A;  2JK8 A;  1X6O A;  3BZK A;  2JA8 H;  4LUV A;  4JI6 L;  4A3D G;  4Y7N H;  4LF4 Q;  4Y52 H;  5M5Y H;  3S2D H;  3ERS X;  3STB D;  4JI2 L;  1CSQ A;  3CAM A;  4IPD A;  1EIF A;  1LM0 A;  4NPS A;  1UEB A;  4UP7 A;  5IP9 H;  3F2B A;  1UE5 A;  3KOJ A;  4DR3 L;  5C0X I;  1VQ7 A;  4B3S Q;  5BR8 Q;  3PO3 G;  1WJJ A;  4BA2 I;  3H0G G;  2GVB A;  1Q82 C;  3KYH C;  2UUA Q;  5IYD H;  3NEL A;  3UDG A;  4GN5 A;  1IBM L;  5LMU Q;  4A3F H;  2BH2 A;  4DR3 Q;  4QGU A;  1PA6 A;  2AWN A;  4IPC A;  4YWM A;  4GLV B;  2N8N A;  5BR8 L;  3CCJ A;  3KDF A;  1Q86 C;  4YHH L;  4B3S L;  2UUA L;  2V1C C;  1J6Q A;  2E5L Q;  5JJI A;  2ZJP A;  1N34 Q;  3U58 A;  1X55 A;  2KBN A;  3AEV A;  4BY7 G;  4PG3 A;  1I50 H;  4A3C H;  1N32 Q;  2UXC Q;  3CCE A;  1L2F A;  1X3G A;  1Y14 B;  5C0X G;  3CPW A;  4DK3 C;  1Y1W G;  1ASZ A;  1N34 L;  4WJ3 M;  1T9H A;  2RCN A;  5HGQ A;  2UXC L;  1N32 L;  3G48 A;  1V1Q A;  1X3E A;  3S15 H;  4KHP L;  1OTC A;  5HY6 A;  2R92 H;  3S1Q H;  4DV0 L;  1YBY A;  5H1S E;  3HOY G;  3E9I A;  3GTJ H;  3G4S A;  1KAW A;  1WCM G;  1GM5 A;  4BBR H;  4JBM A;  3I4N G;  1KL9 A;  2AHO B;  2VS1 A;  3MEF A;  4DV3 Q;  1K8A C;  3U4V A;  4AQY Q;  1I94 Q;  1YI2 A;  2B63 H;  1VQP A;  3D0F A;  3PF5 A;  3HOU G;  1OXU A;  1HZA A;  2A1A A;  4PZ8 A;  4QY7 A;  4NXM Q;  1XMO L;  3HOW H;  4A3G G;  1KIX A;  2UU9 L;  2F52 A;  3CW2 C;  1AE2 A;  2YTY A;  3HOZ H;  2I5L X;  2HIX A;  3HOV H;  4KLK A;  1YJN A;  2UXD L;  1B7Y B;  2YTV A;  1XMO Q;  1PH1 A;  1SMX A;  1UWV A;  3CPF A;  5JJK A;  5ELN A;  3M9B A;  3CC7 A;  3H3V I;  2B3G A;  1IZ6 A;  2ZTD A;  1TWH H;  4A3D H;  4P75 A;  4TVA B;  4APV A;  4A75 A;  4GOP A;  1DGS A;  2ZJR A;  4DV2 L;  3S2H H;  3J7Z C;  2XTI A;  3W5O A;  1S40 A;  1D7Q A;  1M1K C;  1N9W A;  3PO3 H;  1Y1W H;  4O2D A;  2PMZ E;  4DNI A;  3CCM A;  5C3E H;  3I4M H;  2ZJQ A;  4BBS H;  2N78 A;  2I5M X;  4O0A A;  3NEN A;  4A3M G;  3GTG H;  1SLJ A;  3CD6 A;  3S1N H;  2VL6 A;  3PCO B;  4P73 A;  3K81 C;  1G6P A;  2QEX A;  1GD7 A;  1UE7 A;  4L5R C;  4QL5 A;  2JA5 G;  4DV5 Q;  1GVP A;  1TWG H;  1C9O A;  3GDE A;  4WJ4 A;  2R7F A;  4BXX H;  1U0L A;  2PI2 E;  3RR5 A;  5M5X H;  2Z6K C;  2NVT H;  3HOW G;  1K73 C;  1JMC A;  1J5E Q;  4DV5 L;  1L1O C;  3PUV A;  1XNQ Q;  2UXB L;  1YIJ A;  1G51 A;  4EX5 A;  4A3K H;  1VCI A;  1IBM Q;  1D8L A;  1EFW A;  5LMU L;  1Q7Y C;  2JA6 G;  4IFD I;  4GKJ Q;  1E22 A;  3HKZ G;  2YYZ A;  4GN4 B;  4YHH Q;  3M7N A;  1C0A A;  1NY4 A;  4JCV E;  5FLM H;  2UXB Q;  3AFP A;  2E2I H;  1NMG A;  5C44 H;  3GTO H;  4POG A;  4GNX A;  2A19 A;  3A74 A;  1HJP A;  1L1O A;  2JE6 I;  2CFM A;  2VQE Q;  3CXC A;  3DLL A;  5IP7 H;  3FKI H;  3IRB A;  2PNH A;  3STB C;  2PI2 A;  3GD7 A;  4DR5 Q;  3KLW A;  1SRO A;  4YWL A;  5C4X G;  1FGU A;  1VQN A;  4A3L H;  2UUC L;  3WWV A;  5C3E G;  3EIV A;  1IBK L;  3I4M G;  3UDF A;  2K5H A;  3M4P A;  3GO5 A;  5M3M H;  4KHP Q;  4DR5 L;  3I4O A;  1C7Y A;  1E24 A;  3HOX G;  4LF8 L;  4HJ7 A;  1XPU A;  1JT8 A;  1BVS A;  1YHB A;  1CSP A;  2OQK A;  1IBK Q;  2JA5 H;  3PO2 H;  4A3J G;  2VUM H;  5LMN W;  5GAG C;  5IYC G;  4DV3 L;  1PH7 A;  3NEM A;  4AQY L;  1I94 L;  4IJL A;  4JOI A;  4LF8 Q;  1IYJ B;  2E2J H;  1SR3 A;  4A76 A;  1XNR L;  5GAE C;  4NXM L;  3K80 C;  2GVA A;  2E8G A;  4MZ9 A;  2QGQ A;  1N36 Q;  4XTC S;  3TQY A;  3KF8 B;  2UU9 Q;  3M4Q A;  1K83 H;  4MNO A;  4UP8 A;  4GOP C;  4C3H H;  3LGJ A;  1X9N A;  1VQC A;  2CWA A;  3I55 A;  3J81 i;  4DV4 Q;  3CC4 A;  4UP9 A;  1XNR Q;  3AQQ A;  1VQ8 A;  3KF6 B;  2B29 A;  4DAY B;  2D0P A;  4DKA C;  4L5S A;  1QVC A;  2UXD Q;  3CME A;  5K36 G;  2KHI A;  4JYA L;  2ZTC A;  1PV4 A;  4OON A;  2HT1 A;  3K7U C;  3K7A H;  2K5V A;  1NMF A;  4RG1 A;  3OW2 A;  1N33 Q;  3F8T A;  1PH5 A;  3OYY A;  2MQH A;  1RIP A;  2BH8 A;  4JI7 Q;  3PUZ A;  1S72 A;  1JJ2 A;  2IX1 A;  2RHS B;  1XMQ L;  3HFZ B;  4DR7 Q;  2Y0S G;  4IPG A;  4JI5 Q;  1N33 L;  4OO1 G;  1AE3 A;  4A3K G;  4JYA Q;  1X3F A;  5IYB H;  1HNW Q;  5JEA J;  1A62 A;  4GOP B;  1I5F A;  3TS0 A;  4A3E H;  1XMQ Q;  4DR7 L;  4OX9 L;  1OXV A;  1B70 B;  3PUY A;  3F1Z A;  5C44 G;  1SN8 A;  1AH9 A;  1QUQ B;  4KHZ A;  4A3J H;  2R6G A;  2OWO A;  2MO1 A;  2F4V Q;  4DV7 Q;  3J81 c;  4OX9 Q;  4GN3 B;  2YTX A;  4DUY Q;  1S3O A;  1XTD A;  5JEA G;  5IYD G;  5M3F H;  1M90 C;  2R93 H;  1VQH A;  4LFA Q;  1J5E L;  2NVY H;  4C3I H;  1JE5 A;  1O7I A;  1HZB A;  4DV7 L;  1VQ5 A;  5JJL A;  1E7Z A;  1VQB A;  4NB3 A;  3AYH B;  2R92 G;  3JAM c;  1XNQ L;  4OXP A;  4DUY L;  4J15 A;  2RHQ B;  3HOY H;  4IFD J;  2NZH A;  1Q81 C;  5AJ3 Q;  1I3Q H;  4LFA L;  4GKJ L;  4BY7 H;  4B3T Q;  3KF6 A;  4X62 L;  4JC0 A;  4IJH A;  5J3B A;  2GN5 A;  1Q46 A;  1H95 A;  4IOA A;  1UE1 A;  1XJV A;  3T1Y L;  4JBJ A;  1OXS C;  1YJ9 A;  2CWP A;  2VQE L;  2R7D A;  4B3T L;  5GAD C;  2R7Z H;  4YY3 L;  3HOZ G;  3D31 A;  4X62 Q;  4GNX C;  2IHF A;  4IFD G;  2R93 G;  4IPH A;  2JA9 A;  2D62 A;  2DGY A;  4DR2 L;  1HZ9 A;  4L5Q A;  2UUC Q;  4JBK A;  2IHE A;  3T1Y Q;  3S14 H;  2LXJ A;  4DV6 L;  3RLO A;  1FVI A;  3KJP A;  3S1M H;  1PH6 A;  4YY3 Q;  4A93 G;  2JJQ A;  4PMW A;  3I4N H;  4DV1 L;  3M3Y H;  2JEB I;  4LFB Q;  2KHJ A;  4EQ5 A;  2HQL A;  2NN6 I;  4A3B H;  1SFO H;  2B63 G;  1E1O A;  3UDI A;  3CC2 A;  2CQO A;  5E7N A;  4LUZ A;  3CMA A;  1YNX A;  3I7F A;  3HOU H;  4LF9 L;  4RMF A;  1OXT A;  4LFB L;  3H3V H;  2VQF Q;  3CF5 A;  3S17 H;  4YCU A;  2K52 A;  1X56 A;  4LF6 L;  1PH3 A;  3HOV G;  4BY1 H;  4LF9 Q;  3BJU A;  4JI2 Q;  3A5U A;  4A3I G;  1N36 L;  4BBS G;  2QA4 A;  4A3E G;  2ZTE A;  2LXK A;  4C3J H;  1G29 1;  4DV4 L;  1VQA A;  1VQD A;  4AH6 A;  2OQ0 A;  4UPA A;  3CCS A;  4AIM A;  4LF6 Q;  2OTJ A;  1KD1 C;  2MO0 A;  3L2P A;  4A4I A;  5IT9 c;  2N3S A;  1FJG Q;  1X54 A;  4OWT B;  4HJA A;  1TWA H;  3PSI A;  1ASY A;  2YU9 H;  3CCV A;  3S1R H;  5EAY A;  4AYB G;  4HIM A;  1WFQ A;  2ATW A;  3GTM H;  4BXX G;  1PVO A;  1UE6 A;  1P16 A;  2ES2 A;  4JI7 L;  4DAM A;  3CQZ H;  3M85 A;  5M3F G;  1NTG A;  1VS0 A;  2NZO A;  2ZM6 L;  3VDY A;  2R7Z G;  4JI5 L;  3RN2 A;  1QVF A;  4XIG S;  2JQO A;  1V9P A;  4R4C A;  5GAH C;  3S16 H;  3FHW A;  2XGT A;  1SRU A;  2YV5 A;  4IO9 A;  1L0W A;  3RLF A;  2JA6 H;  1HNW L;  2I0Q A;  2KCM A;  2EXD A;  2FXQ A;  3CCU A;  1R9T H;  4L5T A;  1JJG A;  3G6E A;  4R4Q A;  4TQU S;  3AFQ A;  2K4K A;  1CKN B;  2VNU D;  2Q2I A;  5ELO A;  1JJC B;  4HJ5 A;  1EYG A;  2EQS A;  1BKB A;  2F4V L;  1KQS A;  1NBW A;  1KHI A;  1E3P A;  4DUZ L;  2PQA A;  2DUD A;  3GTL H;  3T1H Q;  1MKH A;  2AKW B;  3RN5 A;  3H15 A;  1MJE A;  3ULP A;  4R1J A;  1QZG A;  3UE0 A;  1PYB A;  4DUZ Q;  4YCW A;  1PH4 A;  2A8V A;  1EIY B;  2MFI A;  2NVQ H;  1Q12 A;  3ICE A;  1CKM A;  4MTN A;  5AJ3 L;  1YJW A;  1TXY A;  3RZO H;  1A8V A;  1YZ6 A;  3E0E A;  3PUX A;  5GQO A;  3GTQ H;  3U4Z A;  4A3C G;  1VQ4 A;  2VUM G;  2Y0S E;  4PZ7 A;  5IP7 G;  3PV0 A;  1SE8 A;  3ULL A;  3ZJY C;  4JOI C;  3EN2 A;  2Z0S A;  4LW1 A;  5IY0 A;  4JI0 L;  1A63 A;  4DPG A;  2Q2U A;  4DR4 Q;  1LUZ A;  3F2C A;  4K0K Q;  1U5K A;  4JBW A;  4LNQ A;  4BY1 G;  1MIU A;  1N8R C;  4X6A H;  1EQR A;  4DK6 C;  1B8A A;  5M3M G;  3J81 j;  3RNU A;  3OTO Q;  4DR2 Q;  4DR4 L;  1K8G A;  4JG2 A;  1VQJ A;  1NE3 A;  4DV6 Q;  4B3M L;  3MXN B;  1Q1E A;  2WFW A;  3BZC A;  2NVX H;  3G71 A;  1XPO A;  1IBL L;  4DV1 Q;  4LF5 L;  1A0I A;  4IOC A;  2AWO A;  4LFC Q;  4X65 L;  1PH9 A;  4P72 A;  2IX0 A;  4B3M Q;  3GTP H;  1VQE A;  3FP9 A;  4R4O A;  2WAQ G;  1IBL Q;  4P71 A;  1KRS A;  2JEA I;  3J7A 5;  2E2H H;  4GKK L;  2CKZ B;  2VQF L;  1PH8 A;  4LFC L;  4X65 Q;  1YHQ A;  3KDF B;  1Y1V G;  5FJ8 H;  1Q8K A;  2JA7 H;  3B6Y A;  4JI8 L;  5IYB G;  3K0X A;  1VQ6 A;  4BBR G;  3PUW A;  1QZH A;  3HKZ E;  1PH2 A;  1WI5 A;  3U50 C;  3JAM i;  1HR0 Q;  1OXX K;  1VQL A;  4GKK Q;  3DM3 A;  1CKO A;  3K8A A;  4GS3 A;  2VZA A;  5M5W H;  2ASB A;  1GO3 E;  4LUO A;  1FJG L;  1WOC A;  2N49 A;  1E1T A;  3L7Z C;  4R4T A;  1KC8 C;  4A3G H;  1HR0 L;  1VQ9 A;  2Z6K A;  4QIW E;  1IL2 A;  1K9M C;  4X64 L;  4DR1 Q;  2WB1 G;  4B3R Q;  4BA1 I;  5C0X J;  4LWC A;  2HHH Q;  3M4O H;  1HNZ Q;  2WP8 J;  2ZM6 Q;  3A0J A;  2K75 A;  1K0R A;  1HR0 W;  1VQK A;  5LMN L;  4C2M H;  2K14 A;  5C4J H;  4HIK A;  4PZ6 A;  4JI4 Q;  4JI6 Q;  1Q1B A;  2MNA A;  2HHH L;  4LF4 L;  3TRE A;  3J80 i;  3PF4 A;  3L0O A;  5LMN Q;  3S24 A;  2WB1 E;  3E9H A;  3TEH B;  2WAQ E;  4JI4 L;  2NN6 G;  3ER0 A;  1EOV A;  1CUK A;  3F2D A;  2VW9 A;  1GKH A;  2PQA B;  1Z9F A;  5IE8 A;  5IWA Q;  3CCQ A;  4GNX B;  4HJ8 A;  2Q2T A;  4OO1 I;  1L1O B;  2BA1 A;  3BU2 A;  4JI1 Q;  4HJ9 A;  4GLX A;  1VQO A;  4A3M H;  3T1H L;  1TWF H;  1Y1V H;  4H02 A;  3W1B A;  2E5L L;  3JC6 6;  1K3R A;  3NBH B;  3CP0 A;  2IY5 B;  4A93 H;  4JI3 L;  5IWA L;  2Q2H A;  2HIV A;  2K5N A;  1IXR A;  1X65 A;  4JI1 L;  1LTL A;  3PIO A;  1WYD A;  4POF A;  2AMC B;  1HNX L;  2K50 A;  2CCZ A;  1HZC A;  1LYL A;  4JI3 Q;  5IP9 G;  2ID0 A;  2L15 A;  1W2B A;  1CKN A;  2F3I A;  3UE1 A;  2ALY B;  3CCL A;  1W3S A;  1BBW A;  3ULJ A;  5C4X H;  4HID A;  4ALP A;  4JV5 Q;  1RL2 A;  3J80 c;  4DV0 Q;  1PYS B;  1HNX Q;  4K0K L;  1V43 A;  2KCT A;  5GRO A;  5FJ8 G;  2H5X A;  2JA7 G;  1HH2 P;  4OWW B;  2UUB L;  3HOX H;  1KRT A;  2JA8 G;  4JV5 L;  3OTO L;  5FLM G;  4HIO A;  1EQQ A;  4A3B G;  4OWX B;  3CCR A;  3KJO A;  1P8L A;  3PO2 G;  3PGZ A;  3RLN A;  3TRZ A;  5IYC H;  4LF5 Q;  1TWC H;  3FKI G;  5DLQ E;  1YIT A;  2UUB Q;  1QUQ A;  1Z47 A;  3H0G H;  4GLA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...