3GTJH

Backtracked rna polymerase ii complex with 13mer rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
146
structure length
136
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 13
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtjH00
5C44H 2N49A 3K0XA 3J81c 2ALYB 1VCIA 1PH2A 3MEFA 5C4XH 1T9HA 4YCVA 5C0XG 1JJCB 1E1OA 1X55A 4HIKA 1XPOA 2KENA 1I94L 4LF9L 3W1GA 2IHEA 1XNQL 1E1TA 5E7NA 2VQFQ 2OWOA 4A3FH 1G291 2YYZA 1KXLA 4L5TA 2A19A 2VQEL 2XGTA 4JI0L 1SLJA 5FLXc 1P16A 4DR5L 1UEBA 1PH8A 1VQGA 4J15A 4APVA 2NVTH 3HOWH 3UDXA 2I5HA 3HKSA 2UXDL 1NE3A 2E2HH 1XPUA 2K5HA 3S1RH 3H15A 2F3IA 1S72A 1N32L 1SN8A 5C0XJ 1Z9FA 1VQJA 3UE0A 1NJIC 1KQSA 4KHZA 4P72A 1HNZQ 2CWPA 4HJ8A 1VQIA 1S40A 4B3TQ 3CMAA 1WYDA 4ALPA 3JC66 1EYGA 1UE7A 4A93H 1GVPA 1AE2A 2EQSA 4OWWB 3G6EA 4KI0A 2KHIA 4OWXB 1Q86C 1QZGA 1Q12A 4LFCL 2GN5A 2CFMA 4GN5A 2YTVA 4JC0A 4B3ML 3JAMi 1A8VA 2R7FA 1B8AA 4A3BG 4GOPA 1CKNB 1YBYA 1NY4A 2OTLA 1TWHH 3PO3H 4YY3L 1WCMG 4YCWA 5IP7G 3S14H 3KDFB 3CC2A 4A3DH 4JV5L 4UP7A 3HOXH 1OXXK 1YJNA 1HNWL 5K36G 1SFOH 4LF6Q 3BZKA 4C3JH 5M3FH 4IPCA 3EIVA 1BBWA 4O0AA 3TRZA 2VNUD 4DR2L 1Y1VG 2V1CC 4MZ9A 2LXJA 4DV0L 4R4TA 1GKHA 1M1KC 1XNRL 2Q2IA 1QUQA 5FJ8G 4TQUS 4DR1Q 3K7UC 4AQYQ 4BBRH 4NXNL 2VQFL 1EIYB 3PO2H 5IYBH 1K0RA 5C3EG 4DUZQ 4LFAL 1A0IA 3A0JA 4Y7NH 4NB3A 1E7ZA 5IYCG 3VDYA 2RCNA 2PNHA 3RR5A 4PMWA 1HR0L 1OXTA 4LF8Q 4A3KG 3GTPH 1Q1EA 3HOZG 4DV6Q 4PZ6A 4JI2Q 1HJPA 4K0KQ 1WI5A 2BA0A 4DV5Q 2R7ZG 1K8GA 3M85A 1TWAH 3CCEA 1IBML 5IYDH 2CKZB 3F2DA 1N34Q 4B3RQ 4H02A 2JK8A 3PUZA 3OTOQ 3U58A 1HNZL 5FLMG 3I4MH 4C3IH 5JEAJ 3CPFA 5IP9G 4B3TL 4GN4B 4OONA 1PVOA 3F1ZA 1VQAA 4DR3Q 1VQ5A 4GKKL 1YZ6A 1KAWA 2HIVA 1B7YB 4JYAQ 3H3VH 1LM0A 1X3GA 2KCMA 3M4QA 2NN6G 1Y14B 4DV7L 4X6AH 3PGZA 3U4ZA 5LMUQ 1MJEA 4JI5Q 3ULJA 5LMNL 1VQOA 4X64L 5IE8A 1I50H 4GOPB 2JA6G 1VQDA 2UUAL 1SE8A 5ELNA 4DV2Q 1NMGA 5IY0A 3GTMH 1B70B 5JJIA 1NBWA 2JQOA 3E9HA 4R4OA 3STBC 2E2IH 4LFBQ 3D31A 4POFA 2UU9Q 3HOYG 1N36Q 4BXXH 4OXPA 3GTJH 4OO1I 4AQYL 1KRTA 1LTLA 4R4IA 2AWNA 4P73A 2NVQH 1I3QH 4XTCS 1QUQB 5GADC 4DUZL 3CW2C 2KCTA 4A3LH 1KL9A 4LF8L 1VQCA 4IJLA 4RG1A 1K83H 2AWOA 4A3JG 3KJPA 2R6GA 4A4IA 4BY1H 1KHIA 2H5XA 3TEHB 4OX9Q 4HIOA 3T1HQ 1XMOQ 1UE1A 4BBSG 3RLOA 1VQ4A 3K7AH 4A3BH 3TQYA 1CKNA 1N34L 1K8AC 2IX0A 3LGJA 3UDIA 2QEXA 2ZM6Q 4GKJQ 4JBKA 3AQQA 1D7QA 2D62A 2K5VA 1WCMH 3U50C 3KDFA 1A62A 1HH2P 3E9IA 5IP7H 4GNXB 2HT1A 4A3EG 2JEAI 4A3MG 2NZOA 1OTCA 2CWAA 4DAMA 5M5YH 3GD7A 2JA7H 3GTOH 4JYAL 4IO9A 3FKIH 3HFZB 2B63H 4GS3A 1Y1VH 2PI2E 1FJGQ 1C9OA 2Q2HA 4JI1Q 3RLFA 3PUXA 4JI5L 1PH7A 4KHPL 3J80i 4P74A 5FJ8H 2WFWA 4QGUA 1OXUA 2JA8G 2N8NA 4EQ5A 5GAEC 3BU2A 3K80C 4AH6A 3JAMc 5C3EH 2LXKA 4IJHA 4DV2L 3H3VI 1KIXA 1CKMA 3PIOA 2UUBQ 5IYCH 3RN2A 1XMQQ 5C0XI 2WAQE 3KJOA 4A3KH 4JI6L 3HOZH 4LFBL 2UU9L 3J81j 1S3OA 1N36L 1KRSA 1U5KA 3HOUG 4DR4L 2R7ZH 1J5EQ 2K4KA 3CC7A 4DUYL 4NXML 4IOCA 5HY6A 4TVAB 3E0EA 3H0GH 1K73C 4X66Q 4YHHQ 3PSIA 5FLMH 2JEBI 4BA2I 2R92G 2K14A 4C3HH 2MO1A 2Z0SA 1VQ6A 4P75A 3CPWA 1BBUA 3NBHB 3M7NA 2A1AA 1YHBA 4R4CA 3S2HH 4DR7Q 2XTIA 4B3SQ 1X54A 2WB1G 1VQ7A 5C4JH 2C35B 1VQPA 2I0QA 2B3GA 3J7A5 4HJ7A 4UP8A 2ZM6L 4DV3Q 1X9NA 1Q46A 3GTQH 1P8LA 1IXRA 3NELA 4BY7G 1VQHA 4RMFA 2JA6H 4GOPC 2HQLA 1GO3E 4QY7A 1JJ2A 5DLQE 3U4VA 1Q81C 3S1MH 2UXDQ 2IY5B 1SROA 1Q1BA 2WB1E 3UDFA 2E2JH 2JA5G 3CXCA 3HOYH 1CUKA 1N8RC 1L2FA 3AFPA 1V1QA 1IBKQ 2HIXA 2R93G 3I55A 2D0OA 4UY8C 5JEAG 3RNUA 3PF4A 2OCEA 3TS2A 4WJ3M 3PUWA 1PH6A 4A3CG 4YWKA 5EAYA 3PCOB 4UPAA 3CMEA 1JB7A 1L1OB 4JOIA 3BZCA 4JI3Q 1G6PA 1E22A 4JOIC 1BVSA 3KF6B 1IL2A 4QQBX 4IFDG 1N9WA 3WWVA 3CCLA 4X66L 2CQOA 4YCUA 3T1YQ 2PI2A 4A3IH 4LF5Q 4GNXA 4QIWE 4GNXC 3AFQA 4A3EH 5C44G 5GROA 3TREA 2YTXA 4O2DA 3ULLA 3GDEA 1GM5A 1FVIA 3RN5A 2PQAB 4DR7L 4LNQA 4B3SL 2AMCB 4R4QA 3J7ZC 1VQFA 2MQHA 4IOAA 1O7IA 2F4VQ 3I2ZA 3HKZE 1XTDA 4DV4Q 1A63A 4AYBG 1IBLQ 4IFDJ 4AIMA 4POGA 1YEZA 1AE3A 1HZCA 1W3SA 3KYHC 1HR0W 1Q82C 1QVFA 4LF7Q 1AH9A 3CCSA 4HIDA 5BR8Q 4JI7Q 2PMZE 2NN6I 5IWAQ 4LUVA 4LF6L 2ZJRA 3L7ZC 1K9MC 2EIFA 2GVAA 4XIGS 1PFSA 4OWTB 2Q2UA 1MJCA 3G48A 3HOUH 1V9PA 3A74A 1YHAA 1YNXA 4AYBE 1X3FA 1VS0A 3MXNB 4QJFA 1PH1A 5M5WH 2Q2TA 4DR1L 2HHHQ 3ICEA 3DLLA 1H95A 1CKOA 4DK3C 2UUCQ 1X56A 4HJ5A 2VUMG 1EWIA 4JG2A 2ZJQA 4DAYB 3UDGA 3GTGH 1PH4A 2NZHA 1EUJA 4IPGA 1JJGA 1YI2A 4MTNA 1RIPA 2RF4A 4DV6L 5LMNW 5H1SE 1I94Q 4JI2L 3S1NH 4K0KL 4YWMA 4JI8Q 4LF9Q 1EIFA 4GLAC 3K81C 4DV5L 3RZDH 2E5LQ 4JI4Q 1EQQA 1KC8C 3I4NG 1YJWA 3HOXG 2VQEQ 1R9TH 1QVGA 4JI0Q 4B3RL 5JJKA 3OYYA 3OTOL 3G71A 1E3PA 1C7YA 2UXBQ 3CCMA 2AKWB 2Z6KA 4L5SA 3IRBA 4LWCA 4DR3L 2NVXH 3S17H 2UXCQ 4PZ7A 5IT9c 2NVYH 2JA5H 1NTGA 4BBRG 1PH3A 4DV4L 3F2CA 1N32Q 2WAQG 2E8GA 5IYBG 4X65Q 3NENA 1IBLL 3W5OA 5LMUL 3S1QH 2K52A 5GQOA 1PH5A 3M3YH 1U0LA 1YHQA 5BR8L 3CCJA 4WJ4A 2Y0SE 1N33Q 4A3CH 1L1OA 3Q8DA 4DPGA 2CCZA 4B3MQ 4DR6Q 1L1OC 1X3EA 1Q7YC 2K50A 2JJQA 3KF6A 5HGQA 1TWGH 3PIPA 4HJ9A 3I4OA 1YJ9A 1UE6A 2MNAA 2F52A 4YY3Q 3ULPA 2HHHL 1EOVA 2K5NA 1HNXQ 2ZTCA 2DGYA 3CAMA 3KF8B 3GTLH 1HNWQ 1JT8A 1HZBA 1PYSB 2VW9A 2N3SA 3M9BA 3L2PA 2ZTDA 4JCVE 3ERSX 5IP9H 3I56A 1WFQA 4DR2Q 1Y1WG 2VZAA 2QA4A 3FP9A 2PQAA 1Z47A 2IHFA 4JBJA 1UE5A 4DV0Q 1XNRQ 4OX9L 4R1JA 4JI8L 4A3GG 4NPSA 3T1HL 3KLWA 3B6YA 2E5LL 4JI4L 1XMOL 1CSPA 4NXNQ 3HOVG 4A76A 1FL0A 2RHQB 3SGIA 3CC4A 4LFAQ 3EBEA 4GKJL 1PV4A 4GLXA 3CQZH 1PHJA 1HR0Q 2UXBL 1RL2A 1VQEA 2UXCL 2LSSA 2OQKA 3GO5A 4DV1Q 1VQ9A 4BXXG 3CCRA 1TWCH 3STBD 5M3MG 1VQMA 1M90C 1OXVA 3ZJYC 4LUZA 2R7DA 4LW1A 1FJGL 1BKBA 3NEMA 4JI1L 4X65L 3W1BA 1IBMQ 1JMCA 4LF4Q 3S16H 4A3LG 3J81i 2JA9A 1X65A 3CF5A 4GKKQ 1N33L 1VQLA 4BY1G 2OQ0A 3TS0A 2VY3A 1EQRA 2GVBA 3PF5A 4DR6L 2YU9H 2UUBL 2WP8J 4Y52H 4DV7Q 1XMQL 4A3JH 2ZTEA 4JBMA 4DK6C 1K3RA 1VQBA 5LMNQ 4HIMA 2IT1A 1WJJA 1OXSC 1C0AA 4X64Q 3RZOH 4X62Q 2B29A 1J5EL 1HNXL 2KBNA 4BBSH 1MIUA 3I4NH 5M5XH 3PV0A 3OW2A 2UUAQ 1VQNA 2JA7G 4YHHL 3HKZG 2B63G 1X6OA 2L15A 3FKIG 2N78A 2VL6A 2K75A 2VUMH 2MFIA 1D8LA 4A3MH 4LUOA 4IFDI 5GAGC 1YITA 2ID0A 5C4XG 1TWFH 2MO0A 1YIJA 3AEVA 5J3BA 4DV3L 4L5RC 4A3FG 3UE1A 1HZ9A 2JA8H 1PA6A 3S2DH 3BJUA 5GAHC 3AYHB 3FHWA 1WOCA 1YVCA 4DV1L 3HOWG 1G51A 1SR3A 3F2BA 1QVCA 1L0WA 4GLVB 3G4SA 4C2MH 5AJ3Q 3CP0A 1PH9A 1XJVA 1E24A 1LYLA 3F8TA 4JBWA 3RLNA 4KLKA 3H0GG 3I7FA 2JE6I 2RHSB 1I5FA 3EN2A 2ZJPA 1ASYA 4LF4L 1SRUA 2KHJA 3CD6A 4BA1I 1IBKL 1W2BA 4A93G 1FGUA 4L5QA 1HZAA 1Y1WH 1J6QA 2R92H 2I5MX 3ER0A 2OTJA 3PUVA 3J80c 4HJAA 2A8VA 3D0FA 2EXDA 4A3GH 1LUZA 1XPRA 4KHPQ 2DUDA 4X62L 2ASBA 4DKAC 1SMXA 3HOVH 4MNOA 2BH8A 3PUYA 3S24A 3PO3G 2VS1A 3T1YL 4OO1G 1XNQQ 4ME3A 1IZ6A 3A5UA 3KOJA 4LF5L 2AHOB 4A3DG 4UP9A 4BY7H 4YWLA 4IPDA 4JI6Q 3L0OA 5M3FG 4DR5Q 2IX1A 1DGSA 1NMFA 5M3MH 4DR4Q 3CCQA 2Z6KC 2I5LX 3K8AA 2Y0SG 2D0PA 3CCUA 4DUYQ 2YTYA 1ASZA 4NXMQ 3KFUA 2YV5A 1KD1C 3M4PA 5JJLA 4A75A 1IYJB 2F4VL 3PO2G 4DNIA 3S15H 5ELOA 1CSQA 2R93H 4FDBA 4PG3A 2QGQA 2BH2A 1QZHA 1VQ8A 4JI3L 1V43A 3DM3A 4LF7L 1Q8KA 4EX5A 5AJ3L 4JI7L 2ES2A 5IWAL 1PYBA 2FXQA 2BA1A 1TXYA 1JE5A 4LFCQ 2ATWA 4A3IG 1I6HH 3A5ZB 1EFWA 5IYDG 4PZ8A 3GTKH 3CCVA 1VQKA 4GN3B 3I4MG 1GD7A 4P71A 4JV5Q 2UUCL 1UWVA 4QL5A 1MKHA 4IPHA 3M4OH
chains in the Genus database with same CATH superfamily
3J81c 5D3DA 5KRUA 5C4XH 5C0XG 1MGSA 1JJCB 1E1OA 3OPOA 3W1GA 5J39A 2IHEA 3S2DB 3P75A 3MAQA 1P16A 2ZT9C 4DR5L 1XPUA 4IUPA 1LTAD 5EKIA 1DOKA 1VQJA 3UE0A 1NJIC 1KQSA 3WOFA 4B3TQ 4ALPA 1EYGA 3JC66 1UE7A 3QR8A 4OWWB 1QZGA 1L0XB 3OSOA 4GN5A 2CFMA 4WORA 2KEDA 2R7FA 3VR3A 4A3BG 4GOPA 1CKNB 5BN4A 1NY4A 4X3UA 1ENCA 2XWJB 5IP7G 3CC2A 4A3DH 2B2WC 1KTKA 1OXXK 5K36G 5M3MB 1JWSD 1BBWA 2VNUD 1EY0A 2WKCA 4MZ9A 4R4TA 2Q2IA 3K7UC 4NXNL 2VQFL 3PO2H 5IYBH 2WIIB 1CTMA 5C3EG 3I8ZA 4IURA 1EOTA 2B8GA 3C1EA 4Y7NH 1HR0L 2PNHA 4JI2Q 1F2LA 1QCBD 3LNNA 3M85A 5I2YA 1IBML 5IYDH 3SK8A 2A6ED 1N34Q 4H02A 4TRDA 3CPFA 3MXPA 4C3HG 4GKKL 5C44B 1PTOB 4JYAQ 3H3VH 2EY2A 5J22A 2JN4A 2NN6G 1BUVT 4HSPA 1MJEA 3ULJA 2H4OA 1O7YA 3HEJA 3ITPA 1SNPA 3H6MA 1Y8NB 2JA6G 2UUAL 4YIJA 3VYUA 3GTMH 4DAVA 4QB4A 3BDLA 4R4OA 3STBC 1O7ZA 1KDBA 5ISRA 3SK4A 4OO1I 2KCCA 1GUTA 1L0YB 3CW2C 1HTPA 2IJ0A 1KL9A 4A3LH 4RG1A 4NW2A 3FMCA 1K83H 5DAUA 4A4IA 1U4RA 1KHIA 2H5XA 1ML0D 1XX8A 4J8QA 3CKIB 5DNFA 1WTQA 3TQYA 1CKNA 4KY7A 1K8AC 3PO3B 3LGJA 5CMDA 3S14B 3I72A 4JBKA 3LWEA 2D62A 1D7QA 1WCMH 5M5XB 3HOXB 1HH2P 3E9IA 5TSSA 3DWPA 2NZOA 4NMZA 4RH6A 3J7YW 2SEBD 4DGZA 2PI2E 2D2CC 4JI1Q 3V2TA 1GUOA 3PUXA 2F0LA 1UNSA 2WAQB 2WFWA 1SMYD 1GHJA 1Q90A 2IL8A 4MN3A 4DAPA 3SVMA 3K80C 4AH6A 1Y69U 3JAMc 4DV2L 3VA5A 2KCNA 2UUBQ 5IYCH 1LV9A 2QF7A 5C0XI 3KJOA 3HOZH 4XQNA 3J81j 4C2MB 1ENFA 3GV3A 4DR4L 1HTLD 4DUYL 5BN3A 4IOCA 5DM73 5FLMH 2ZXPA 2K14A 1G91A 2B39A 2K04A 3M7GA 3CPWA 2A1AA 3QJYA 1WTHA 1ZKOA 4A3GB 2F0DA 4KKTA 2BE5C 2RQXA 4DV3Q 3GTQH 4IUTA 1AW7A 1GO3E 4ABNA 1JJ2A 4K2KA 1ZEQX 1B2TA 2IY5B 2E2JH 3UDFA 3GTJB 1LTID 2XWBB 4IUNA 1N8RC 2VXWA 1A3VA 3AFPA 5F2DA 1IBKQ 2HIXA 2XRSD 1D6EC 2NTTA 2WACA 2F0WA 4YWKA 5EAYA 3CMEA 4UPAA 3BZCA 5FK9C 3TSSA 3NK9A 1I6HB 1N9WA 3CCLA 2CQOA 3NHHA 2PYKA 1Z6HA 4QIWE 5M5YB 3FKIB 5C44G 2YTXA 5LL6S 2RCFA 4O2DA 3ULLA 3M4OB 2PQAB 2Z1CA 4R4QA 1SXTA 1HPCA 1VDZA 1O7IA 4EGVA 2PMZB 1XTDA 4IFDJ 4AIMA 3NPPA 1DOLA 1AH9A 2A68C 3CCSA 4JI7Q 4K5XA 2NN6I 3VYTA 2GVAA 3D4WA 2CQAA 1PFSA 3A74A 3I4LA 4AYBE 3H0GB 2B2TA 1AZQA 1PH1A 2Q2TA 3N6RA 4KKSA 1H95A 1GUSA 5HURA 1X56A 5C3XA 2ZJQA 4MIUA 1PH4A 2NZHA 1EUJA 4IPGA 1VMPA 1YI2A 1PTOF 2RF4A 4DV6L 1SNMA 5H1SE 2RSOA 1E0BA 3H91A 1LTBD 3RZDH 3T13A 2E5LQ 1JORA 1Q8IA 1KC8C 2F0QA 3HOXG 1PYWD 4B3RL 1K28A 3G71A 3S1MB 2Z6KA 4KMUC 2TSSA 1SFOB 1ICFB 2XVSA 2NVXH 4CGYB 2JA5H 1NTGA 3A8KE 3IL8A 1PH3A 4DV4L 3F2CA 1LT6D 2WAQG 5LMUL 1EYAA 5GQOA 3SDZA 1RTOA 3MVVA 4A3CH 2CCZA 2VB2X 1DOMA 2AUJD 1Q7YC 2JJQA 3MA2B 4MTKA 5HGQA 1TWGH 1F9RA 2ICIA 3ULPA 1HNXQ 1T5XD 2ZTCA 2DGYA 3CAMA 1F2ZA 1JT8A 1AP0A 2A5HA 1CFMA 1HZBA 5EQ0A 5BN5A 2IX3A 2N3SA 1PRTB 1Q3LA 5IP9H 1WFQA 3ONAB 2PQAA 1PRTD 4K6DA 4OX9L 4A3GG 3EVQA 4OEMB 4JI4L 1XMOL 1CSPA 4NXNQ 2PW7A 4A76A 1FL0A 2AQ1B 1KABA 2DY8A 4K5VA 1PV4A 1HR0Q 3H09A 1QB5D 1RL2A 5G3LD 3URYA 3J80L 4K14A 1S5ED 2MJ8A 1OXVA 2E2IB 1QJOA 1VF7A 2R7DA 1IBMQ 1BDOA 1VMCA 3AMUA 2MPMA 1STBA 3J81i 2SNSA 4GKKQ 1A2TA 3KLSX 1N33L 1VQLA 3TS0A 4CBVA 1XWEA 3IAYA 1SNQA 1RTNA 1D1KA 1WTRA 4RAUC 1K3RA 1VQBA 3FPUB 3RZOH 1BOSA 4BBSH 2UUAQ 4YHHL 3FKIG 2L15A 3PQIA 2MFIA 4RGMA 2A6HC 1RKNA 1YITA 1OO9B 2ID0A 2OEOA 2MO0A 1SJHD 1YIJA 5J3BA 3A8JE 4MHEA 3UE1A 1HZ9A 3HRZC 5JOBA 2L12A 4GLVB 3G4SA 2IPKD 1E24A 3F8TA 5KNCA 4WFN3 2K6AA 3H0GG 2JE6I 2ZXOA 2RBMA 1SRUA 3CD6A 4H44C 3MTSA 4DK0A 4C56C 1EY5A 3C46A 1Y1WH 2R92H 3Q23A 2DUDA 4DKAC 2M9VA 1TY0A 3S24A 3DM1A 4QF4A 2VS1A 1IZ6A 1LO5D 3DEOA 3KOJA 5EKKA 4PQXA 3TDQA 2EYPA 4UP9A 3A5UA 1NMFA 4DR4Q 4E6IA 1X3QA 3I70A 1ASZA 2SDFA 2Y0SG 4DUYQ 3KFUA 2YTYA 2UXDQ 3EA6A 2K32A 3S16B 5JJLA 4A75A 1ZXTA 3BDCA 4DNIA 3S15H 2KEEA 1CSQA 1QG7A 4PG3A 1IW7D 1QZHA 1TS4A 2FINB 1B9NA 5AJ3L 2ES2A 4PMCA 4EVOA 2BA1A 2A69D 3MXUA 5IODA 1EFWA 3NTHA 3I4NB 3NXWA 1F2MA 4HR7B 2LS01 2UUCL 1MKHA 4ODGA 2N49A 1VCIA 5D65A 1PH2A 3MEFA 2E76C 1X55A 1XPOA 3Q24A 2JA8B 1XNQL 1E1TA 5E7NA 1SE3A 1JR0D 5AFWA 4L5TA 2A19A 3NTKA 3C2PA 4KY5A 1SLJA 5FLXc 1UEBA 5IGDA 4J15A 4APVA 1PH8A 2NVTH 3OW7A 3R2TA 2I5HA 3HKSA 1NE3A 2L1BA 2PCFB 3S1RH 3K5NA 1HA6A 1SN8A 1EY4A 2F0IA 5C0XJ 1Z9FA 1XXGA 1RJTA 5CBEE 4KHZA 4P72A 1HNZQ 4S3SA 3CMAA 1CHQD 4KI0A 2KHIA 4OWXB 1PRTF 5I9PA 4B9WA 2GN5A 5EPJA 5KYLA 3JAMi 3BDOA 3GV6A 1TY2A 2OTLA 1TWHH 4OHJA 4YY3L 2CHBD 3BVZA 4BY7B 3KDFB 4JV5L 5G3LF 3BZKA 1TIID 3TRZA 3EIVA 4O0AA 4DR2L 1D2BA 4F88A 2NVYB 1GKHA 3K5MA 1QUQA 1EFID 4AQYQ 4BBRH 3PIP3 5KNBA 1K0RA 1B53A 5FO7B 4DUZQ 4LFAL 3A0JA 4NB3A 5EPKA 3RR5A 1ZYRD 1OXTA 2LY7A 4A3KG 3GTPH 1Q1EA 4DV6Q 4PZ6A 1WI5A 2BA0A 4G4KA 1TWAH 1DJRD 3CCEA 2CKZB 4B3RQ 4GN4B 1PVOA 1EWHA 3OWEB 2F0GA 2HIVA 2NWGA 1X3GA 2E74C 1Y14B 2P5ZX 2NTSA 4X6AH 3PGZA 5LMUQ 2DJFC 4AYBB 4FXGC 4GOPB 2FJ2A 4RCOA 1SE8A 1SJED 1NMGA 1TS3A 1ESFA 5JJIA 1NBWA 2JQOA 2NZ1D 3E9HA 4LFBQ 4FO2A 1TWCB 1H9MA 4FP5D 4POFA 1A3TA 1N36Q 3HOYG 4OXPA 1FNUA 2K7VA 5C5MA 1KRTA 2AWNA 2FMCA 2NVQH 1PMRA 1I3QH 4XTCS 5GADC 4DFAA 2KCTA 4LF8L 3DUZA 2AWOA 1PLFA 3KJPA 2R6GA 1EYDA 4OX9Q 4HIOA 1XMOQ 1UE1A 1RF2D 3RLOA 3K7AH 4A3BH 3TBIB 3VA7A 2IX0A 1II3A 2QEXA 2ZM6Q 3AQQA 4HCSA 3U50C 3KDFA 5IP7H 2Z8LA 4GNXB 2HT1A 4OELB 3QIAA 5K36H 4OGQC 4DAMA 3GTOH 3GD7A 2B63H 1TQOA 4JPBW 1QWYA 4GS3A 1R4QB 4HSVA 2Q2HA 5IOCA 4JI5L 1C4QA 3HZXA 1SNCA 1PH7A 4P74A 1TWFB 2JA8G 1K8OA 1X32A 5C3EH 5E1FA 1H9SB 3RN2A 4XT1B 1CM9A 4HTHA 2UU9L 1U5KA 1IYUA 2B2VC 4NXML 2F4IA 3P20A 4X66Q 4YHHQ 3PSIA 2JEBI 3X3MA 4C3HH 2MO1A 3F2UA 4P75A 4H0LC 1PTOC 3NBHB 1GJXA 3MWYW 4LK1C 2B2YA 4RHRA 1FGBD 1X54A 1VQ7A 5C4JH 3J7A5 4CHTB 2RA4A 3HOVB 3KBGA 1P8LA 3NELA 1D1IA 4BY7G 4RMFA 2JA6H 2KHSA 3GTMB 1HQRD 3EFXD 5DLQE 3U4VA 1Q81C 4QUFA 1NR2A 1SROA 4OIJA 1YNNC 3SHLA 1SE2A 2F03A 3I55A 1EQVA 4DAYA 3RNUA 4K2LA 2MP1A 4O42A 5I6WA 2OCEA 4WJ3M 3PUWA 1SE4A 4G7ZC 3A8IE 4CDDC 1EEID 4JOIA 1G6PA 5CC4A 2BDOA 3KF6B 4FNFA 4QQBX 4YCUA 3GTKB 2DNCA 5ELDA 3KK7A 4XXEA 4GNXA 3A7AB 3AFQA 4RCNA 2A73B 3HKZB 4LAAA 4DN4M 3TREA 3TP6A 1EU4A 2EJGC 3R3OA 1FVIA 3D6WA 3RN5A 4DR7L 4B3SL 4IOAA 1SMYC 1R4PB 3I2ZA 4WRDA 3EJIA 4AYBG 5A35A 1NNXA 4POGA 4K5WA 1WTVA 3L3OC 1YEZA 1AE3A 5JJZA 3KYHC 4A3FB 1H9SA 5EBDA 3QOLA 3HOWB 3KLRA 4LF6L 3L7ZC 4XIGS 2B2UA 2PW5A 4OWTB 1MJCA 3U9OA 1HFNA 1S5DD 1A3UA 3KUPA 1O78A 5M5WH 4DR1L 3DLLA 3K5OA 5D3IB 2UUCQ 2E75C 1EWIA 2O5IC 4A93B 3NBHA 3GTGH 5ELFA 5L37A 2MHVA 4LMQD 4MTNA 2EY1A 5LMNW 4K0KL 1KLGD 4GLAC 4P2CB 1KAAA 3R8BA 1YJWA 5EGTA 3Q22A 1QVGA 1DONA 4NP5A 1E2ZA 2QW7A 3CCMA 3OOCA 4LWCA 4DR3L 5M3FB 2OF1A 4C3JB 2UXCQ 1DD2A 3CRKC 1IBLL 5IYBG 3NENA 3PMFA 5ELCA 3W5OA 1JOQA 5M9OA 1E2WA 3S1QH 2K52A 1YHQA 5BR8L 3CCJA 2O2LD 3A55A 2EYMA 4DR6Q 4DPGA 2K50A 3KF6A 1IYVA 3PIPA 4HJ9A 3I4OA 4CJ2C 3FEWX 4YY3Q 2HHHL 2K5NA 3KF8B 3GTLH 1A6XA 3I4MB 4TKOB 1PTOH 2ZTDA 4JCVE 3ERSX 4DR2Q 2QA4A 2IHFA 4JBJA 2JP1A 1I6VC 1GUWA 4R1JA 4JI8L 3T1HL 2DNEA 3HOVG 3J80E 3SGIA 4LFAQ 4Z9CB 1DM0B 4GKJL 1I50B 3E3XA 4GLXA 3BYTB 2UXBL 3CHBD 4R8NA 2K5DA 4KY6A 1VQ9A 1SDFA 3CCRA 3STBD 5M3MG 3ERQA 1LLRD 4LW1A 2G9HD 1FJGL 1BKBA 3T51B 5HGTA 4X65L 1I4QA 4LF4Q 4A3LG 1EY7A 2VY3A 2YU9H 2WP8J 4A3JH 1MBYA 1BCPC 1C0AA 4CJ1B 5FOBB 1J5EL 1NCVA 5M5XH 3PV0A 3OW2A 3HKZG 5KEEA 2VUMH 1D8LA 4A3MH 4LUOA 4HAEA 1Y1VB 2JXMB 4L5RC 4A3FG 3BJUA 5CGKA 1WOCA 3HOWG 4DV1L 1G51A 1QVCA 1L0WA 4C2MH 3CP0A 1TWGB 4RGNA 2R3ZA 4JBWA 3EQLC 4FXDA 2M2LA 2R7ZB 1VF5C 1SEBD 1ASYA 5CV4A 2O4XA 3EROA 3KF8A 4EQPA 1BF4A 1CQVA 1W2BA 1NAPA 5IIFA 2PQEA 4A93G 1HZAA 1BBXC 1J6QA 2I5MX 3X3NA 3PUVA 3VR4A 2PZWA 1WTWA 3S2HB 1BR9A 4A3GH 1LUZA 4X62L 1JQYD 4U673 2BH8A 3PUYA 4G57A 3PO3G 3T1YL 1ILPA 4ULLA 2KECA 5EPLA 2F1MA 4IPDA 2F0KA 4C3JG 1QNKA 5M3FG 4DR5Q 4I65A 2IX1A 3A7LA 5JAVA 3CCUA 4NXMQ 2FFKB 5IGFA 5KYIA 1MSHA 3NE5B 4L8JA 4M1UB 1C48A 1S5FD 2R93H 4FDBA 4Q5VA 4XQQA 3TN2A 4JI3L 1V43A 3DWQA 1Q8KA 4N8FA 2L4NA 4L63B 4ZAIA 5IWAL 1PYBA 4KK7A 1TXYA 3RZOB 1I6HH 1I4HA 1EZ8A 3ND9A 2F0VA 1EY8A 4BBSB 4IFDH 2Z4HA 1JOKA 5K5PA 1VQKA 1M8AA 3I4MG 2PZTA 4ZQ3A 1B3QA 4A3EB 1UWVA 4PMBA 1J8IA 4QL5A 4KN7C 3M4OH 5JVG3 2ALYB 3QOJA 1T9HA 3BG3A 4YCVA 4HIKA 1I94L 2KENA 2K33A 4LF9L 3G6JB 1F9SA 2VQFQ 1EY9A 2A68D 1VQGA 3SR1A 1PZID 3IFDA 3UDXA 2E2HH 2K5HA 4V0BA 3HOUB 4RFBA 2F3IA 4CJ0B 1S72A 1N32L 1KDCA 1S40A 4ID6A 2R92B 1WYDA 3WOEA 1FR3A 1GVPA 3G6EA 5CV6A 4LFCL 5I6YA 2YTVA 1A8VA 2K1BA 3J7AF 1B8AA 3S1NB 2F0EA 1YBYA 2XNAC 3Q0AA 4RWSC 4YCWA 4UP7A 1HNWL 1SFOH 4LF6Q 2CH4W 4IPCA 4KJNA 3S17B 1Y1VG 2M00A 2V1CC 2RSNA 2F0JA 4ZKBB 1QNUA 1M1KC 1U4PA 1XNRL 3A54A 1Z7TA 5FJ8G 4TQUS 4DR1Q 2F0FA 4NKLA 1MI2A 2K5QA 2K03A 1E7ZA 1F9PA 3VDYA 1HJPA 4K0KQ 1S5CD 1JB3A 2R7ZG 1K8GA 3NWSA 4H7BA 3JAML 3RD4A 2JK8A 1KNAA 5FKAC 4C3IH 5JEAJ 5IP9G 4RHSA 2F3VA 5JVH3 3MFYA 4B3TL 1VQAA 4XDXA 4DR3Q 3OIQA 1YZ6A 4V190 2J7ZA 1MHWC 1B7YB 3D4RA 1PXUA 1LM0A 1HCZA 2EJMA 1DXMA 4G7HC 3M4QA 4DV7L 5C5LA 1G2TA 4BS9A 3DWAA 1VQOA 5LMNL 1LT4D 3VYRA 2DJGC 3J7AV 5ELNA 4DV2Q 2NVTB 5IY0A 4HMIA 1IKMA 2E2IH 2EY5A 3D31A 1UAPA 3SK5A 4BXXH 3KBXA 4P73A 2F0SA 1QUQB 2F0UA 2D5DA 4F7XA 1VQCA 1YNJD 4IJLA 4HN7A 5T1GA 4BY1H 2IW3A 2X6GA 3TEHB 4B08A 3T1HQ 3GQBA 2N88A 4BBSG 2FHTA 1VQ4A 3ND8A 1N34L 1TR5A 3UDIA 3QO2A 2B8FA 4GKJQ 3QWNA 1STAA 2JEAI 1A62A 2NUCA 2KQ3A 4A3EG 5COYA 1XYIA 2JA7H 4JYAL 4IO9A 3HFZB 4H13C 2EYFA 1FJGQ 3RLFA 3NQTA 1EQTA 4BBRB 4KHPL 3J80i 3SEBA 2KA7A 4QCLA 1I4RA 2LXKA 2EOTA 2EYOA 1PZKD 4IUVA 4A3KH 1ILQA 2WAQE 1RODA 4CDCC 2F0NA 4JI6L 3NTIA 4OIKA 1HHVA 2CW0D 4K8IA 1TWAB 3HOUG 5CV7A 1J5EQ 2K4KA 4I7ZC 3BVMA 2ZXRA 3R2IA 1LTGD 3E0EA 1K73C 2G5DA 1CZWA 2ICEC 2R92G 1BBUA 1JICA 4R4CA 1DYQA 2XTIA 1JWMD 2B2YC 2F0TA 5C4HA 1VQPA 4HJ7A 1X9NA 1B9MA 1ET6A 2EY6A 4GOPC 4G7OC 1K0SA 1EZ6A 4OO1H 5KIXA 2WB1E 1Q1BA 3HOYH 1BNZA 1B4OA 1CUKA 3TP7A 2QDBA 2NVQB 1V1QA 4J1MA 5IT9E 2D0OA 5JEAG 3PF4A 3TS2A 3E5SA 1JB7A 3PCOB 1PZJD 1L1OB 1PFBA 4QIWB 1E22A 4JOIC 4UHVA 1IL2A 3K7AB 5CR3A 3SE0A 4UAIA 4A3IH 3T1YQ 2PI2A 2G9DA 3TMEA 1B50A 4GNXC 3OIPA 3I90A 2B63B 3S9WA 3HG9A 3J7ZC 1VQFA 5E4XA 5C4XB 4DV4Q 1A63A 1D5XC 5C0XH 2JYOA 3DEPA 3DXJC 3TZDA 5IGEA 1W3SA 3L9AX 2HCCA 4N9TA 1GXDC 2LFNA 2PMZE 5IWAQ 2XSCA 4LUVA 2ZJRA 2EIFA 3M4YA 1LT3D 4RGTA 3G48A 1STNA 2EZVA 4O1NA 5A2QE 1WVLA 3ICEA 3OMCA 4DK3C 2KJXA 4JG2A 1HA5A 4DAYB 4GZYC 5CBAE 1JJGA 5C4JB 2RVLA 1RIPA 1I94Q 1SYDA 1EL0A 4LF9Q 1EIFA 4DV5L 1WD1A 4JI4Q 3OMGA 2PZUA 4L6TB 3I4NG 1EYCA 1R9TH 3OTOL 4HEDA 4A3DB 1HQMC 3IRBA 1F77A 1W6KA 4CKBA 4F87A 4PZ7A 4NDXA 2NVYH 3SK6A 4BBRG 3NBIA 1N32Q 2E8GA 3H94A 4X3SA 3PO2B 2BDNA 1BQQT 4WJ4A 1PH5A 3M3YH 2F0OA 5FO9B 4F8MA 1EU3A 2EE1A 2Y0SE 1N33Q 4Y7NB 1L1OA 2OT2A 3Q8DA 3OHXC 1CT1D 3MFGA 3TP5A 2F0PA 1UE6A 2MNAA 2A6EC 1HNWQ 2K05A 4OL7A 1PYSB 2VW9A 3M9BA 3L2PA 3I56A 2VZAA 1Z47A 1XNRQ 2E2DC 1ESRA 1BO0A 1H9KA 4NPSA 2E5LL 2NN6H 2WKDA 3CQZH 1PHJA 4EQOA 3RUZA 2OQKA 3GO5A 1KDAA 3BZDB 1TWCH 1M90C 4LUZA 3NEMA 1DZ1A 3W1BA 2IWHA 5M5WB 1SYGA 2JA9A 1X65A 2OQ0A 3GTGB 2GVBA 3PF5A 1XTCD 3AB9A 1K83B 2I07B 4Y52H 4DV7Q 4IUQA 1XMQL 2ZTEA 5IT9L 1ICWA 4ZCKA 1UEAB 5LMNQ 2IT1A 1WJJA 1OXSC 4ZRZA 2B29A 5E4WC 1HNXL 2KBNA 5DEHA 1WCMB 2B63G 2NBFA 4RKBA 2VL6A 2RDGA 5C6AA 1MSGA 1H9JA 3PIO3 5GAGC 5T1IA 1HFGA 5C4XG 1KNEA 3BS1A 3D6CA 1TWFH 1BXTA 3AEVA 3J81E 1U9RA 3S1QB 1QE6A 1O7LA 4KJOA 1PA6A 3S2DH 3AYHB 4HCEA 3F2BA 3I3CA 5AJ3Q 3HOZB 1XJVA 2JSOA 4QMGA 1HRJA 3BVGA 3RLNA 1SBBB 4K6LA 3GTLB 1B3AA 1ET9A 3SXHA 5FLXL 2B2TC 3IFTA 4L5QA 1PTOD 1STYA 3K58A 2XRQD 2OTJA 1LT5D 5A2QL 3J80c 2A8VA 5E3FA 4KHPQ 5IGGA 3HGBA 3K59A 3HOVH 4MNOA 4JVZA 3GTQB 1PFNA 1XNQQ 4LF5L 2AHOB 4A3DG 2HDMA 1IHZA 4X3TA 2C5CA 5C3WA 3L0OA 5I4DA 4JI6Q 1EY6A 1TS5A 5M3MH 1SNDA 2L9HA 3CCQA 2Z6KC 3RMHA 2RDHA 1YNND 2E2JB 1K8MA 1KD1C 1S4ZA 2PPBC 3M4PA 3NUCA 2F4VL 1IYJB 3PO2G 1SYCA 5ELOA 1JC7A 1STGA 2FMMA 3WDNA 2QGQA 2YU9B 2EDGA 1A15A 3DM3A 4LF7L 2Q8TA 4A3JB 2KOLA 2L55A 4DK1A 1JE5A 3HS0C 5I2XA 5IYDG 3GTKH 2X6LA 3E0JA 1W6JA 1FYCA 4GN3B 5CYUA 3Q6SA 2VUMB 4IALA 4P71A 4JV5Q 4A3MB 1RCVD 5ELEA 3K0XA 5C44H 2EJFC 3NP8A 1WD0A 4QUCA 4I7AA 2TMPA 5JPMC 3A56A 1KXLA 2OWOA 4A3FH 1G291 2YYZA 5JPNC 2VQEL 2XGTA 1D5MC 4JI0L 1HXYD 1C8CA 3HOWH 2B2VA 1LTSD 2RKSA 2UXDL 3H15A 3OWFA 2LKVA 1X3PA 4J6HA 4CKCA 2CWPA 4HJ8A 1VQIA 1I4GA 4A93H 2EYLA 1B1ZA 4WJWA 1AE2A 2EQSA 3V05A 1Q86C 2HCIA 1Q12A 4JC0A 4B3ML 3DMUA 4ZYSA 1GUNA 2WB1B 1FNWA 1I4XA 3RZDB 4IN3A 5KNDA 3PO3H 5NUCA 1V1OA 1WCMG 2B2WA 3S14H 2Z9HA 1STHA 3HOXH 1YJNA 1EIHA 5M3FH 4C3JH 3UI2A 2NVXB 4EQNA 2LXJA 4DV0L 2JA5B 4LJZC 5FO8B 1JE4A 1EIYB 2BCOA 2R93B 4IZ8A 2V4DA 1A0IA 1U4MA 4DF7A 5IYCG 2X69A 2RCNA 5DM63 4LF8Q 4PMWA 4RGOS 5EJWA 3HOZG 3J81L 3JAME 3MZ5A 4DV5Q 4FF3A 1GHKA 3F2DA 3PUZA 3OTOQ 3U58A 1HNZL 1IL8A 4X3KA 5FLMG 3I4MH 3KLSA 4OONA 3F1ZA 1VQ5A 4KTAA 1KAWA 2BOSA 1PRTC 2KCMA 4JK1C 2HQEA 3U4ZA 4JI5Q 1KLUD 4X64L 2BE5D 5IE8A 1I50H 1VQDA 5IGBA 1V8QA 4KHVA 1B70B 2E2HB 3P1HA 3HP3A 2UU9Q 2R61A 3GTJH 4AQYL 1EWCA 1LTLA 2RDFA 2Z6BA 1ONLA 4R4IA 2D9UA 3FPPA 4ZUJA 4DUZL 1V1PB 2QCPX 2CH4A 1TKWB 2WINB 4A3JG 1BCPB 1SSOA 1WTXA 1BCPD 4KV6A 2KVMA 1FNVA 3MC0B 2AQ2B 4DXFA 2J4XA 1PFMA 2K5VA 4CDFC 2VUMG 3W3AA 2HUGA 4DA2A 4A3MG 1OTCA 2CWAA 5M5YH 3N52A 3FKIH 4UDUC 2NB0A 2F3WA 2Y0SB 1Y1VH 1A2UA 1C9OA 3FDTA 4FYDA 5FJ8H 4QGUA 1OXUA 2N8NA 2MUYA 4EQ5A 5GAEC 3BU2A 3K5LA 5CV8A 4XT3B 4IJHA 3T16A 3H3VI 1KIXA 3P7JA 1CKMA 3PIOA 2HDLA 1CI3M 1XMQQ 4LFBL 1DCZA 4FF4A 1JCKB 1S3OA 1N36L 1KRSA 3R93A 2K01A 2R7ZH 3K6OA 3CC7A 1U4LA 3D3RA 5HY6A 4TVAB 4KD3A 3H0GH 4C3IB 3FVQA 4DU9A 4BA2I 1GUGA 3LWUA 4KKUA 2Z0SA 1VQ6A 2HD3A 3W2DA 1Y1WB 3M7NA 1HUNA 1YHBA 3S2HH 4DR7Q 4B3SQ 2WB1G 2C35B 2I0QA 2B3GA 3C3LA 2EVBA 4UP8A 2ZM6L 1Q46A 1IXRA 2DN8A 1VQHA 2QILA 1JOOA 2HQLA 4IUUA 4QY7A 3MXGA 3S1MH 2K5WA 4FXKC 2JA5G 2EXZA 3CXCA 4CDEC 3T4AC 4ZKCB 1L2FA 2R93G 2MGSA 3I91A 1UUPA 1Y8OB 4TSSA 1V1PA 1YNJC 3S15B 4UY8C 1IW7C 3O13A 5CV9A 3C1FA 4BY1B 1PH6A 4A3CG 2O5JC 3U9SA 3DHQA 5CV5A 4K8JA 1NUCA 1BVSA 2A69C 3QB3A 4IFDG 3WWVA 4X66L 4U68A 4LF5Q 4HMJA 2EYJA 4A3EH 2JA7B 1IKLA 5GROA 1WTOA 3QG1A 1RD9D 1D5ZC 3GDEA 1GM5A 2XN9C 3MHBA 4LNQA 2AMCB 2XIWA 2MQHA 2F4VQ 2AQ3B 3HKZE 1IBLQ 1S5BD 1EEFD 3ZYYX 1HZCA 1HR0W 1QVFA 1Q82C 3I73A 4LF7Q 4FF2A 4A3KB 4HIDA 5BR8Q 3D8GA 2CW0C 3K57A 1K9MC 4RKLA 4XYOA 1GOZA 5J1ZA 2Q2UA 3HOUH 1V9PA 3S1RB 1YHAA 1YNXA 2K28A 1X3FA 1LTTD 2C9OA 1VS0A 3MXNB 4ME5A 4QJFA 1AZPA 2HHHQ 4N9PA 3VR6A 1CKOA 2OXPA 4HJ5A 3T56B 1AFPA 1SYEA 5D14A 3UDGA 3VR5A 2LMCB 2EYHA 4JI2L 3S1NH 4YWMA 4JI8Q 5EBCA 3K81C 1SYBA 1TVXA 4M8AA 1EIGA 1F9QA 1EQQA 1TWHB 3BYYB 2VQEQ 4JI0Q 1QILA 5JJKA 3OYYA 1E3PA 2ENBA 1C7YA 2UXBQ 1F2YA 2AKWB 4L5SA 3G7LA 3S17H 2L11A 2J0TD 3HOYB 1AN8A 5IT9c 4RA8A 2A6HD 4DXGA 1B44D 1NR4A 3AU7A 4X65Q 5CORA 4PNYA 3NSWA 5JEAH 1TU2B 2SNMA 1U0LA 1SNOA 3E6ZX 1ZYRC 4R9WA 3GTPB 4B3MQ 1L1OC 1T5EA 1X3EA 1BCPF 2Q8RE 4A3IB 1G2SA 1YJ9A 2F52A 4C3IG 1EOVA 3TP8A 4XQJA 4CKEA 3IKJA 4FVMA 2AUKA 5IGCA 1RHPA 1Y1WG 1I4PA 2DY7A 2QEJC 3FP9A 2A74C 1UE5A 4DV0Q 1WTPA 3KLWA 3B6YA 4KD4A 1CQFA 2RHQB 3CC4A 3EBEA 3VYSA 1J9OA 2Q8IB 1TT2A 2Z4IA 1O80A 5EKLA 1VQEA 1LACA 4PV1C 2UXCL 2LSSA 4DV1Q 4BXXG 1VQMA 3ZJYC 2VB3X 1MD2D 1RDPD 4JI1L 5C4ZA 4C1NK 3CU7A 3MXNA 1JMCA 1LTRD 3S16H 2EPBA 2QKIC 4BWGB 2N55A 1I3QB 3CF5A 4ZLTF 3FRPB 4BY1G 1G6ZA 3LX0A 1EQRA 4DR6L 4DNRB 2UUBL 4IQZA 2QDLA 1AEXA 4JBMA 4DK6C 4HIMA 4X64Q 4X62Q 4A3BB 1R9TB 1MIUA 3I4NH 2L0CA 1CA5A 1VQNA 2JA7G 2F0MA 1X6OA 2N78A 4KN4C 1JWUD 2K75A 3GTOB 4IFDI 3D4DA 3VR2A 4Q0FA 3M3YB 4DV3L 2I46A 3T53B 2JA8H 1STEA 5C3EB 5LL6X 5GAHC 2KUMA 3CRLC 3FHWA 1YVCA 2F0HA 1SR3A 4JI3Q 1PH9A 1TS2A 1LYLA 4KLKA 1E2VA 2GA4B 5FLXE 2WV6D 3I7FA 2RHSB 1M4VA 1I5FA 3EN2A 2ZJPA 3K0YA 4LF4L 3NQIA 2KHJA 2B2UC 3TZUA 1G8ZD 4BA1I 4C1NI 3MEHA 1IBKL 4R8IA 1CK1A 1FGUA 4C3HB 4JW0A 2L5TA 5KGUA 3ER0A 4HJAA 3D0FA 3H3VC 1H9RA 2EXDA 1NSNS 1XPRA 1K3BC 2ASBA 4ZK9B 1CZGA 1SMXA 2PNRC 4B9XA 1QOHA 3CQZB 4OO1G 1FD7D 4ME3A 3GP7A 2JA6B 2H1EA 1HUMA 4YWLA 4BY7H 1SAPA 3V96A 1DGSA 3K8AA 2I5LX 4FF1A 2D0PA 2YV5A 1CHPD 1LABA 5LHY1 4ZUIA 4ILWA 4XYQA 2BH2A 4N8X1 1VQ8A 2SOBA 4EX5A 4JI7L 2FXQA 5I9OA 4LFCQ 2ATWA 4A3IG 3A5ZB 1CA6A 4PZ8A 1ENAA 1SYFA 1Y8PB 2NYZD 3CCVA 1GD7A 2CVRA 2PO4A 5ELBA 3NWTA 4DNTB 1PDQA 4IPHA
chains in the Genus database with same CATH topology
5C44H 2N49A 3K0XA 3J81c 2ALYB 1VCIA 1PH2A 3MEFA 5C4XH 1T9HA 4YCVA 5C0XG 1JJCB 1E1OA 1X55A 4HIKA 1XPOA 2KENA 1I94L 4LF9L 3W1GA 2IHEA 1XNQL 1E1TA 5E7NA 2VQFQ 2OWOA 4A3FH 1G291 2YYZA 1KXLA 4L5TA 2A19A 2VQEL 2XGTA 4JI0L 1SLJA 5FLXc 1P16A 4DR5L 1UEBA 1PH8A 1VQGA 4J15A 4APVA 2NVTH 3HOWH 3UDXA 2I5HA 3HKSA 2UXDL 1NE3A 2E2HH 1XPUA 2K5HA 3S1RH 3H15A 2F3IA 1S72A 1N32L 1SN8A 5C0XJ 1Z9FA 1VQJA 3UE0A 1NJIC 1KQSA 4KHZA 4P72A 1HNZQ 2CWPA 4HJ8A 1VQIA 1S40A 4B3TQ 3CMAA 1WYDA 4ALPA 3JC66 1EYGA 1UE7A 4A93H 1GVPA 1AE2A 2EQSA 4OWWB 3G6EA 4KI0A 2KHIA 4OWXB 1Q86C 1QZGA 1Q12A 4LFCL 2GN5A 2CFMA 4GN5A 2YTVA 4JC0A 4B3ML 3JAMi 1A8VA 2R7FA 1B8AA 4A3BG 4GOPA 1CKNB 1YBYA 1NY4A 2OTLA 1TWHH 3PO3H 4YY3L 1WCMG 4YCWA 5IP7G 3S14H 3KDFB 3CC2A 4A3DH 4JV5L 4UP7A 3HOXH 1OXXK 1YJNA 1HNWL 5K36G 1SFOH 4LF6Q 3BZKA 4C3JH 5M3FH 4IPCA 3EIVA 1BBWA 4O0AA 3TRZA 2VNUD 4DR2L 1Y1VG 2V1CC 4MZ9A 2LXJA 4DV0L 4R4TA 1GKHA 1M1KC 1XNRL 2Q2IA 1QUQA 5FJ8G 4TQUS 4DR1Q 3K7UC 4AQYQ 4BBRH 4NXNL 2VQFL 1EIYB 3PO2H 5IYBH 1K0RA 5C3EG 4DUZQ 4LFAL 1A0IA 3A0JA 4Y7NH 4NB3A 1E7ZA 5IYCG 3VDYA 2RCNA 2PNHA 3RR5A 4PMWA 1HR0L 1OXTA 4LF8Q 4A3KG 3GTPH 1Q1EA 3HOZG 4DV6Q 4PZ6A 4JI2Q 1HJPA 4K0KQ 1WI5A 2BA0A 4DV5Q 2R7ZG 1K8GA 3M85A 1TWAH 3CCEA 1IBML 5IYDH 2CKZB 3F2DA 1N34Q 4B3RQ 4H02A 2JK8A 3PUZA 3OTOQ 3U58A 1HNZL 5FLMG 3I4MH 4C3IH 5JEAJ 3CPFA 5IP9G 4B3TL 4GN4B 4OONA 1PVOA 3F1ZA 1VQAA 4DR3Q 1VQ5A 4GKKL 1YZ6A 1KAWA 2HIVA 1B7YB 4JYAQ 3H3VH 1LM0A 1X3GA 2KCMA 3M4QA 2NN6G 1Y14B 4DV7L 4X6AH 3PGZA 3U4ZA 5LMUQ 1MJEA 4JI5Q 3ULJA 5LMNL 1VQOA 4X64L 5IE8A 1I50H 4GOPB 2JA6G 1VQDA 2UUAL 1SE8A 5ELNA 4DV2Q 1NMGA 5IY0A 3GTMH 1B70B 5JJIA 1NBWA 2JQOA 3E9HA 4R4OA 3STBC 2E2IH 4LFBQ 3D31A 4POFA 2UU9Q 3HOYG 1N36Q 4BXXH 4OXPA 3GTJH 4OO1I 4AQYL 1KRTA 1LTLA 4R4IA 2AWNA 4P73A 2NVQH 1I3QH 4XTCS 1QUQB 5GADC 4DUZL 3CW2C 2KCTA 4A3LH 1KL9A 4LF8L 1VQCA 4IJLA 4RG1A 1K83H 2AWOA 4A3JG 3KJPA 2R6GA 4A4IA 4BY1H 1KHIA 2H5XA 3TEHB 4OX9Q 4HIOA 3T1HQ 1XMOQ 1UE1A 4BBSG 3RLOA 1VQ4A 3K7AH 4A3BH 3TQYA 1CKNA 1N34L 1K8AC 2IX0A 3LGJA 3UDIA 2QEXA 2ZM6Q 4GKJQ 4JBKA 3AQQA 1D7QA 2D62A 2K5VA 1WCMH 3U50C 3KDFA 1A62A 1HH2P 3E9IA 5IP7H 4GNXB 2HT1A 4A3EG 2JEAI 4A3MG 2NZOA 1OTCA 2CWAA 4DAMA 5M5YH 3GD7A 2JA7H 3GTOH 4JYAL 4IO9A 3FKIH 3HFZB 2B63H 4GS3A 1Y1VH 2PI2E 1FJGQ 1C9OA 2Q2HA 4JI1Q 3RLFA 3PUXA 4JI5L 1PH7A 4KHPL 3J80i 4P74A 5FJ8H 2WFWA 4QGUA 1OXUA 2JA8G 2N8NA 4EQ5A 5GAEC 3BU2A 3K80C 4AH6A 3JAMc 5C3EH 2LXKA 4IJHA 4DV2L 3H3VI 1KIXA 1CKMA 3PIOA 2UUBQ 5IYCH 3RN2A 1XMQQ 5C0XI 2WAQE 3KJOA 4A3KH 4JI6L 3HOZH 4LFBL 2UU9L 3J81j 1S3OA 1N36L 1KRSA 1U5KA 3HOUG 4DR4L 2R7ZH 1J5EQ 2K4KA 3CC7A 4DUYL 4NXML 4IOCA 5HY6A 4TVAB 3E0EA 3H0GH 1K73C 4X66Q 4YHHQ 3PSIA 5FLMH 2JEBI 4BA2I 2R92G 2K14A 4C3HH 2MO1A 2Z0SA 1VQ6A 4P75A 3CPWA 1BBUA 3NBHB 3M7NA 2A1AA 1YHBA 4R4CA 3S2HH 4DR7Q 2XTIA 4B3SQ 1X54A 2WB1G 1VQ7A 5C4JH 2C35B 1VQPA 2I0QA 2B3GA 3J7A5 4HJ7A 4UP8A 2ZM6L 4DV3Q 1X9NA 1Q46A 3GTQH 1P8LA 1IXRA 3NELA 4BY7G 1VQHA 4RMFA 2JA6H 4GOPC 2HQLA 1GO3E 4QY7A 1JJ2A 5DLQE 3U4VA 1Q81C 3S1MH 2UXDQ 2IY5B 1SROA 1Q1BA 2WB1E 3UDFA 2E2JH 2JA5G 3CXCA 3HOYH 1CUKA 1N8RC 1L2FA 3AFPA 1V1QA 1IBKQ 2HIXA 2R93G 3I55A 2D0OA 4UY8C 5JEAG 3RNUA 3PF4A 2OCEA 3TS2A 4WJ3M 3PUWA 1PH6A 4A3CG 4YWKA 5EAYA 3PCOB 4UPAA 3CMEA 1JB7A 1L1OB 4JOIA 3BZCA 4JI3Q 1G6PA 1E22A 4JOIC 1BVSA 3KF6B 1IL2A 4QQBX 4IFDG 1N9WA 3WWVA 3CCLA 4X66L 2CQOA 4YCUA 3T1YQ 2PI2A 4A3IH 4LF5Q 4GNXA 4QIWE 4GNXC 3AFQA 4A3EH 5C44G 5GROA 3TREA 2YTXA 4O2DA 3ULLA 3GDEA 1GM5A 1FVIA 3RN5A 2PQAB 4DR7L 4LNQA 4B3SL 2AMCB 4R4QA 3J7ZC 1VQFA 2MQHA 4IOAA 1O7IA 2F4VQ 3I2ZA 3HKZE 1XTDA 4DV4Q 1A63A 4AYBG 1IBLQ 4IFDJ 4AIMA 4POGA 1YEZA 1AE3A 1HZCA 1W3SA 3KYHC 1HR0W 1Q82C 1QVFA 4LF7Q 1AH9A 3CCSA 4HIDA 5BR8Q 4JI7Q 2PMZE 2NN6I 5IWAQ 4LUVA 4LF6L 2ZJRA 3L7ZC 1K9MC 2EIFA 2GVAA 4XIGS 1PFSA 4OWTB 2Q2UA 1MJCA 3G48A 3HOUH 1V9PA 3A74A 1YHAA 1YNXA 4AYBE 1X3FA 1VS0A 3MXNB 4QJFA 1PH1A 5M5WH 2Q2TA 4DR1L 2HHHQ 3ICEA 3DLLA 1H95A 1CKOA 4DK3C 2UUCQ 1X56A 4HJ5A 2VUMG 1EWIA 4JG2A 2ZJQA 4DAYB 3UDGA 3GTGH 1PH4A 2NZHA 1EUJA 4IPGA 1JJGA 1YI2A 4MTNA 1RIPA 2RF4A 4DV6L 5LMNW 5H1SE 1I94Q 4JI2L 3S1NH 4K0KL 4YWMA 4JI8Q 4LF9Q 1EIFA 4GLAC 3K81C 4DV5L 3RZDH 2E5LQ 4JI4Q 1EQQA 1KC8C 3I4NG 1YJWA 3HOXG 2VQEQ 1R9TH 1QVGA 4JI0Q 4B3RL 5JJKA 3OYYA 3OTOL 3G71A 1E3PA 1C7YA 2UXBQ 3CCMA 2AKWB 2Z6KA 4L5SA 3IRBA 4LWCA 4DR3L 2NVXH 3S17H 2UXCQ 4PZ7A 5IT9c 2NVYH 2JA5H 1NTGA 4BBRG 1PH3A 4DV4L 3F2CA 1N32Q 2WAQG 2E8GA 5IYBG 4X65Q 3NENA 1IBLL 3W5OA 5LMUL 3S1QH 2K52A 5GQOA 1PH5A 3M3YH 1U0LA 1YHQA 5BR8L 3CCJA 4WJ4A 2Y0SE 1N33Q 4A3CH 1L1OA 3Q8DA 4DPGA 2CCZA 4B3MQ 4DR6Q 1L1OC 1X3EA 1Q7YC 2K50A 2JJQA 3KF6A 5HGQA 1TWGH 3PIPA 4HJ9A 3I4OA 1YJ9A 1UE6A 2MNAA 2F52A 4YY3Q 3ULPA 2HHHL 1EOVA 2K5NA 1HNXQ 2ZTCA 2DGYA 3CAMA 3KF8B 3GTLH 1HNWQ 1JT8A 1HZBA 1PYSB 2VW9A 2N3SA 3M9BA 3L2PA 2ZTDA 4JCVE 3ERSX 5IP9H 3I56A 1WFQA 4DR2Q 1Y1WG 2VZAA 2QA4A 3FP9A 2PQAA 1Z47A 2IHFA 4JBJA 1UE5A 4DV0Q 1XNRQ 4OX9L 4R1JA 4JI8L 4A3GG 4NPSA 3T1HL 3KLWA 3B6YA 2E5LL 4JI4L 1XMOL 1CSPA 4NXNQ 3HOVG 4A76A 1FL0A 2RHQB 3SGIA 3CC4A 4LFAQ 3EBEA 4GKJL 1PV4A 4GLXA 3CQZH 1PHJA 1HR0Q 2UXBL 1RL2A 1VQEA 2UXCL 2LSSA 2OQKA 3GO5A 4DV1Q 1VQ9A 4BXXG 3CCRA 1TWCH 3STBD 5M3MG 1VQMA 1M90C 1OXVA 3ZJYC 4LUZA 2R7DA 4LW1A 1FJGL 1BKBA 3NEMA 4JI1L 4X65L 3W1BA 1IBMQ 1JMCA 4LF4Q 3S16H 4A3LG 3J81i 2JA9A 1X65A 3CF5A 4GKKQ 1N33L 1VQLA 4BY1G 2OQ0A 3TS0A 2VY3A 1EQRA 2GVBA 3PF5A 4DR6L 2YU9H 2UUBL 2WP8J 4Y52H 4DV7Q 1XMQL 4A3JH 2ZTEA 4JBMA 4DK6C 1K3RA 1VQBA 5LMNQ 4HIMA 2IT1A 1WJJA 1OXSC 1C0AA 4X64Q 3RZOH 4X62Q 2B29A 1J5EL 1HNXL 2KBNA 4BBSH 1MIUA 3I4NH 5M5XH 3PV0A 3OW2A 2UUAQ 1VQNA 2JA7G 4YHHL 3HKZG 2B63G 1X6OA 2L15A 3FKIG 2N78A 2VL6A 2K75A 2VUMH 2MFIA 1D8LA 4A3MH 4LUOA 4IFDI 5GAGC 1YITA 2ID0A 5C4XG 1TWFH 2MO0A 1YIJA 3AEVA 5J3BA 4DV3L 4L5RC 4A3FG 3UE1A 1HZ9A 2JA8H 1PA6A 3S2DH 3BJUA 5GAHC 3AYHB 3FHWA 1WOCA 1YVCA 4DV1L 3HOWG 1G51A 1SR3A 3F2BA 1QVCA 1L0WA 4GLVB 3G4SA 4C2MH 5AJ3Q 3CP0A 1PH9A 1XJVA 1E24A 1LYLA 3F8TA 4JBWA 3RLNA 4KLKA 3H0GG 3I7FA 2JE6I 2RHSB 1I5FA 3EN2A 2ZJPA 1ASYA 4LF4L 1SRUA 2KHJA 3CD6A 4BA1I 1IBKL 1W2BA 4A93G 1FGUA 4L5QA 1HZAA 1Y1WH 1J6QA 2R92H 2I5MX 3ER0A 2OTJA 3PUVA 3J80c 4HJAA 2A8VA 3D0FA 2EXDA 4A3GH 1LUZA 1XPRA 4KHPQ 2DUDA 4X62L 2ASBA 4DKAC 1SMXA 3HOVH 4MNOA 2BH8A 3PUYA 3S24A 3PO3G 2VS1A 3T1YL 4OO1G 1XNQQ 4ME3A 1IZ6A 3A5UA 3KOJA 4LF5L 2AHOB 4A3DG 4UP9A 4BY7H 4YWLA 4IPDA 4JI6Q 3L0OA 5M3FG 4DR5Q 2IX1A 1DGSA 1NMFA 5M3MH 4DR4Q 3CCQA 2Z6KC 2I5LX 3K8AA 2Y0SG 2D0PA 3CCUA 4DUYQ 2YTYA 1ASZA 4NXMQ 3KFUA 2YV5A 1KD1C 3M4PA 5JJLA 4A75A 1IYJB 2F4VL 3PO2G 4DNIA 3S15H 5ELOA 1CSQA 2R93H 4FDBA 4PG3A 2QGQA 2BH2A 1QZHA 1VQ8A 4JI3L 1V43A 3DM3A 4LF7L 1Q8KA 4EX5A 5AJ3L 4JI7L 2ES2A 5IWAL 1PYBA 2FXQA 2BA1A 1TXYA 1JE5A 4LFCQ 2ATWA 4A3IG 1I6HH 3A5ZB 1EFWA 5IYDG 4PZ8A 3GTKH 3CCVA 1VQKA 4GN3B 3I4MG 1GD7A 4P71A 4JV5Q 2UUCL 1UWVA 4QL5A 1MKHA 4IPHA 3M4OH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C44 H;  2N49 A;  3K0X A;  3J81 c;  2ALY B;  1VCI A;  1PH2 A;  3MEF A;  5C4X H;  1T9H A;  4YCV A;  5C0X G;  1JJC B;  1E1O A;  1X55 A;  4HIK A;  1XPO A;  2KEN A;  1I94 L;  4LF9 L;  3W1G A;  2IHE A;  1XNQ L;  1E1T A;  5E7N A;  2VQF Q;  2OWO A;  4A3F H;  1G29 1;  2YYZ A;  1KXL A;  4L5T A;  2A19 A;  2VQE L;  2XGT A;  4JI0 L;  1SLJ A;  5FLX c;  1P16 A;  4DR5 L;  1UEB A;  1PH8 A;  1VQG A;  4J15 A;  4APV A;  2NVT H;  3HOW H;  3UDX A;  2I5H A;  3HKS A;  2UXD L;  1NE3 A;  2E2H H;  1XPU A;  2K5H A;  3S1R H;  3H15 A;  2F3I A;  1S72 A;  1N32 L;  1SN8 A;  5C0X J;  1Z9F A;  1VQJ A;  3UE0 A;  1NJI C;  1KQS A;  4KHZ A;  4P72 A;  1HNZ Q;  2CWP A;  4HJ8 A;  1VQI A;  1S40 A;  4B3T Q;  3CMA A;  1WYD A;  4ALP A;  3JC6 6;  1EYG A;  1UE7 A;  4A93 H;  1GVP A;  1AE2 A;  2EQS A;  4OWW B;  3G6E A;  4KI0 A;  2KHI A;  4OWX B;  1Q86 C;  1QZG A;  1Q12 A;  4LFC L;  2GN5 A;  2CFM A;  4GN5 A;  2YTV A;  4JC0 A;  4B3M L;  3JAM i;  1A8V A;  2R7F A;  1B8A A;  4A3B G;  4GOP A;  1CKN B;  1YBY A;  1NY4 A;  2OTL A;  1TWH H;  3PO3 H;  4YY3 L;  1WCM G;  4YCW A;  5IP7 G;  3S14 H;  3KDF B;  3CC2 A;  4A3D H;  4JV5 L;  4UP7 A;  3HOX H;  1OXX K;  1YJN A;  1HNW L;  5K36 G;  1SFO H;  4LF6 Q;  3BZK A;  4C3J H;  5M3F H;  4IPC A;  3EIV A;  1BBW A;  4O0A A;  3TRZ A;  2VNU D;  4DR2 L;  1Y1V G;  2V1C C;  4MZ9 A;  2LXJ A;  4DV0 L;  4R4T A;  1GKH A;  1M1K C;  1XNR L;  2Q2I A;  1QUQ A;  5FJ8 G;  4TQU S;  4DR1 Q;  3K7U C;  4AQY Q;  4BBR H;  4NXN L;  2VQF L;  1EIY B;  3PO2 H;  5IYB H;  1K0R A;  5C3E G;  4DUZ Q;  4LFA L;  1A0I A;  3A0J A;  4Y7N H;  4NB3 A;  1E7Z A;  5IYC G;  3VDY A;  2RCN A;  2PNH A;  3RR5 A;  4PMW A;  1HR0 L;  1OXT A;  4LF8 Q;  4A3K G;  3GTP H;  1Q1E A;  3HOZ G;  4DV6 Q;  4PZ6 A;  4JI2 Q;  1HJP A;  4K0K Q;  1WI5 A;  2BA0 A;  4DV5 Q;  2R7Z G;  1K8G A;  3M85 A;  1TWA H;  3CCE A;  1IBM L;  5IYD H;  2CKZ B;  3F2D A;  1N34 Q;  4B3R Q;  4H02 A;  2JK8 A;  3PUZ A;  3OTO Q;  3U58 A;  1HNZ L;  5FLM G;  3I4M H;  4C3I H;  5JEA J;  3CPF A;  5IP9 G;  4B3T L;  4GN4 B;  4OON A;  1PVO A;  3F1Z A;  1VQA A;  4DR3 Q;  1VQ5 A;  4GKK L;  1YZ6 A;  1KAW A;  2HIV A;  1B7Y B;  4JYA Q;  3H3V H;  1LM0 A;  1X3G A;  2KCM A;  3M4Q A;  2NN6 G;  1Y14 B;  4DV7 L;  4X6A H;  3PGZ A;  3U4Z A;  5LMU Q;  1MJE A;  4JI5 Q;  3ULJ A;  5LMN L;  1VQO A;  4X64 L;  5IE8 A;  1I50 H;  4GOP B;  2JA6 G;  1VQD A;  2UUA L;  1SE8 A;  5ELN A;  4DV2 Q;  1NMG A;  5IY0 A;  3GTM H;  1B70 B;  5JJI A;  1NBW A;  2JQO A;  3E9H A;  4R4O A;  3STB C;  2E2I H;  4LFB Q;  3D31 A;  4POF A;  2UU9 Q;  3HOY G;  1N36 Q;  4BXX H;  4OXP A;  3GTJ H;  4OO1 I;  4AQY L;  1KRT A;  1LTL A;  4R4I A;  2AWN A;  4P73 A;  2NVQ H;  1I3Q H;  4XTC S;  1QUQ B;  5GAD C;  4DUZ L;  3CW2 C;  2KCT A;  4A3L H;  1KL9 A;  4LF8 L;  1VQC A;  4IJL A;  4RG1 A;  1K83 H;  2AWO A;  4A3J G;  3KJP A;  2R6G A;  4A4I A;  4BY1 H;  1KHI A;  2H5X A;  3TEH B;  4OX9 Q;  4HIO A;  3T1H Q;  1XMO Q;  1UE1 A;  4BBS G;  3RLO A;  1VQ4 A;  3K7A H;  4A3B H;  3TQY A;  1CKN A;  1N34 L;  1K8A C;  2IX0 A;  3LGJ A;  3UDI A;  2QEX A;  2ZM6 Q;  4GKJ Q;  4JBK A;  3AQQ A;  1D7Q A;  2D62 A;  2K5V A;  1WCM H;  3U50 C;  3KDF A;  1A62 A;  1HH2 P;  3E9I A;  5IP7 H;  4GNX B;  2HT1 A;  4A3E G;  2JEA I;  4A3M G;  2NZO A;  1OTC A;  2CWA A;  4DAM A;  5M5Y H;  3GD7 A;  2JA7 H;  3GTO H;  4JYA L;  4IO9 A;  3FKI H;  3HFZ B;  2B63 H;  4GS3 A;  1Y1V H;  2PI2 E;  1FJG Q;  1C9O A;  2Q2H A;  4JI1 Q;  3RLF A;  3PUX A;  4JI5 L;  1PH7 A;  4KHP L;  3J80 i;  4P74 A;  5FJ8 H;  2WFW A;  4QGU A;  1OXU A;  2JA8 G;  2N8N A;  4EQ5 A;  5GAE C;  3BU2 A;  3K80 C;  4AH6 A;  3JAM c;  5C3E H;  2LXK A;  4IJH A;  4DV2 L;  3H3V I;  1KIX A;  1CKM A;  3PIO A;  2UUB Q;  5IYC H;  3RN2 A;  1XMQ Q;  5C0X I;  2WAQ E;  3KJO A;  4A3K H;  4JI6 L;  3HOZ H;  4LFB L;  2UU9 L;  3J81 j;  1S3O A;  1N36 L;  1KRS A;  1U5K A;  3HOU G;  4DR4 L;  2R7Z H;  1J5E Q;  2K4K A;  3CC7 A;  4DUY L;  4NXM L;  4IOC A;  5HY6 A;  4TVA B;  3E0E A;  3H0G H;  1K73 C;  4X66 Q;  4YHH Q;  3PSI A;  5FLM H;  2JEB I;  4BA2 I;  2R92 G;  2K14 A;  4C3H H;  2MO1 A;  2Z0S A;  1VQ6 A;  4P75 A;  3CPW A;  1BBU A;  3NBH B;  3M7N A;  2A1A A;  1YHB A;  4R4C A;  3S2H H;  4DR7 Q;  2XTI A;  4B3S Q;  1X54 A;  2WB1 G;  1VQ7 A;  5C4J H;  2C35 B;  1VQP A;  2I0Q A;  2B3G A;  3J7A 5;  4HJ7 A;  4UP8 A;  2ZM6 L;  4DV3 Q;  1X9N A;  1Q46 A;  3GTQ H;  1P8L A;  1IXR A;  3NEL A;  4BY7 G;  1VQH A;  4RMF A;  2JA6 H;  4GOP C;  2HQL A;  1GO3 E;  4QY7 A;  1JJ2 A;  5DLQ E;  3U4V A;  1Q81 C;  3S1M H;  2UXD Q;  2IY5 B;  1SRO A;  1Q1B A;  2WB1 E;  3UDF A;  2E2J H;  2JA5 G;  3CXC A;  3HOY H;  1CUK A;  1N8R C;  1L2F A;  3AFP A;  1V1Q A;  1IBK Q;  2HIX A;  2R93 G;  3I55 A;  2D0O A;  4UY8 C;  5JEA G;  3RNU A;  3PF4 A;  2OCE A;  3TS2 A;  4WJ3 M;  3PUW A;  1PH6 A;  4A3C G;  4YWK A;  5EAY A;  3PCO B;  4UPA A;  3CME A;  1JB7 A;  1L1O B;  4JOI A;  3BZC A;  4JI3 Q;  1G6P A;  1E22 A;  4JOI C;  1BVS A;  3KF6 B;  1IL2 A;  4QQB X;  4IFD G;  1N9W A;  3WWV A;  3CCL A;  4X66 L;  2CQO A;  4YCU A;  3T1Y Q;  2PI2 A;  4A3I H;  4LF5 Q;  4GNX A;  4QIW E;  4GNX C;  3AFQ A;  4A3E H;  5C44 G;  5GRO A;  3TRE A;  2YTX A;  4O2D A;  3ULL A;  3GDE A;  1GM5 A;  1FVI A;  3RN5 A;  2PQA B;  4DR7 L;  4LNQ A;  4B3S L;  2AMC B;  4R4Q A;  3J7Z C;  1VQF A;  2MQH A;  4IOA A;  1O7I A;  2F4V Q;  3I2Z A;  3HKZ E;  1XTD A;  4DV4 Q;  1A63 A;  4AYB G;  1IBL Q;  4IFD J;  4AIM A;  4POG A;  1YEZ A;  1AE3 A;  1HZC A;  1W3S A;  3KYH C;  1HR0 W;  1Q82 C;  1QVF A;  4LF7 Q;  1AH9 A;  3CCS A;  4HID A;  5BR8 Q;  4JI7 Q;  2PMZ E;  2NN6 I;  5IWA Q;  4LUV A;  4LF6 L;  2ZJR A;  3L7Z C;  1K9M C;  2EIF A;  2GVA A;  4XIG S;  1PFS A;  4OWT B;  2Q2U A;  1MJC A;  3G48 A;  3HOU H;  1V9P A;  3A74 A;  1YHA A;  1YNX A;  4AYB E;  1X3F A;  1VS0 A;  3MXN B;  4QJF A;  1PH1 A;  5M5W H;  2Q2T A;  4DR1 L;  2HHH Q;  3ICE A;  3DLL A;  1H95 A;  1CKO A;  4DK3 C;  2UUC Q;  1X56 A;  4HJ5 A;  2VUM G;  1EWI A;  4JG2 A;  2ZJQ A;  4DAY B;  3UDG A;  3GTG H;  1PH4 A;  2NZH A;  1EUJ A;  4IPG A;  1JJG A;  1YI2 A;  4MTN A;  1RIP A;  2RF4 A;  4DV6 L;  5LMN W;  5H1S E;  1I94 Q;  4JI2 L;  3S1N H;  4K0K L;  4YWM A;  4JI8 Q;  4LF9 Q;  1EIF A;  4GLA C;  3K81 C;  4DV5 L;  3RZD H;  2E5L Q;  4JI4 Q;  1EQQ A;  1KC8 C;  3I4N G;  1YJW A;  3HOX G;  2VQE Q;  1R9T H;  1QVG A;  4JI0 Q;  4B3R L;  5JJK A;  3OYY A;  3OTO L;  3G71 A;  1E3P A;  1C7Y A;  2UXB Q;  3CCM A;  2AKW B;  2Z6K A;  4L5S A;  3IRB A;  4LWC A;  4DR3 L;  2NVX H;  3S17 H;  2UXC Q;  4PZ7 A;  5IT9 c;  2NVY H;  2JA5 H;  1NTG A;  4BBR G;  1PH3 A;  4DV4 L;  3F2C A;  1N32 Q;  2WAQ G;  2E8G A;  5IYB G;  4X65 Q;  3NEN A;  1IBL L;  3W5O A;  5LMU L;  3S1Q H;  2K52 A;  5GQO A;  1PH5 A;  3M3Y H;  1U0L A;  1YHQ A;  5BR8 L;  3CCJ A;  4WJ4 A;  2Y0S E;  1N33 Q;  4A3C H;  1L1O A;  3Q8D A;  4DPG A;  2CCZ A;  4B3M Q;  4DR6 Q;  1L1O C;  1X3E A;  1Q7Y C;  2K50 A;  2JJQ A;  3KF6 A;  5HGQ A;  1TWG H;  3PIP A;  4HJ9 A;  3I4O A;  1YJ9 A;  1UE6 A;  2MNA A;  2F52 A;  4YY3 Q;  3ULP A;  2HHH L;  1EOV A;  2K5N A;  1HNX Q;  2ZTC A;  2DGY A;  3CAM A;  3KF8 B;  3GTL H;  1HNW Q;  1JT8 A;  1HZB A;  1PYS B;  2VW9 A;  2N3S A;  3M9B A;  3L2P A;  2ZTD A;  4JCV E;  3ERS X;  5IP9 H;  3I56 A;  1WFQ A;  4DR2 Q;  1Y1W G;  2VZA A;  2QA4 A;  3FP9 A;  2PQA A;  1Z47 A;  2IHF A;  4JBJ A;  1UE5 A;  4DV0 Q;  1XNR Q;  4OX9 L;  4R1J A;  4JI8 L;  4A3G G;  4NPS A;  3T1H L;  3KLW A;  3B6Y A;  2E5L L;  4JI4 L;  1XMO L;  1CSP A;  4NXN Q;  3HOV G;  4A76 A;  1FL0 A;  2RHQ B;  3SGI A;  3CC4 A;  4LFA Q;  3EBE A;  4GKJ L;  1PV4 A;  4GLX A;  3CQZ H;  1PHJ A;  1HR0 Q;  2UXB L;  1RL2 A;  1VQE A;  2UXC L;  2LSS A;  2OQK A;  3GO5 A;  4DV1 Q;  1VQ9 A;  4BXX G;  3CCR A;  1TWC H;  3STB D;  5M3M G;  1VQM A;  1M90 C;  1OXV A;  3ZJY C;  4LUZ A;  2R7D A;  4LW1 A;  1FJG L;  1BKB A;  3NEM A;  4JI1 L;  4X65 L;  3W1B A;  1IBM Q;  1JMC A;  4LF4 Q;  3S16 H;  4A3L G;  3J81 i;  2JA9 A;  1X65 A;  3CF5 A;  4GKK Q;  1N33 L;  1VQL A;  4BY1 G;  2OQ0 A;  3TS0 A;  2VY3 A;  1EQR A;  2GVB A;  3PF5 A;  4DR6 L;  2YU9 H;  2UUB L;  2WP8 J;  4Y52 H;  4DV7 Q;  1XMQ L;  4A3J H;  2ZTE A;  4JBM A;  4DK6 C;  1K3R A;  1VQB A;  5LMN Q;  4HIM A;  2IT1 A;  1WJJ A;  1OXS C;  1C0A A;  4X64 Q;  3RZO H;  4X62 Q;  2B29 A;  1J5E L;  1HNX L;  2KBN A;  4BBS H;  1MIU A;  3I4N H;  5M5X H;  3PV0 A;  3OW2 A;  2UUA Q;  1VQN A;  2JA7 G;  4YHH L;  3HKZ G;  2B63 G;  1X6O A;  2L15 A;  3FKI G;  2N78 A;  2VL6 A;  2K75 A;  2VUM H;  2MFI A;  1D8L A;  4A3M H;  4LUO A;  4IFD I;  5GAG C;  1YIT A;  2ID0 A;  5C4X G;  1TWF H;  2MO0 A;  1YIJ A;  3AEV A;  5J3B A;  4DV3 L;  4L5R C;  4A3F G;  3UE1 A;  1HZ9 A;  2JA8 H;  1PA6 A;  3S2D H;  3BJU A;  5GAH C;  3AYH B;  3FHW A;  1WOC A;  1YVC A;  4DV1 L;  3HOW G;  1G51 A;  1SR3 A;  3F2B A;  1QVC A;  1L0W A;  4GLV B;  3G4S A;  4C2M H;  5AJ3 Q;  3CP0 A;  1PH9 A;  1XJV A;  1E24 A;  1LYL A;  3F8T A;  4JBW A;  3RLN A;  4KLK A;  3H0G G;  3I7F A;  2JE6 I;  2RHS B;  1I5F A;  3EN2 A;  2ZJP A;  1ASY A;  4LF4 L;  1SRU A;  2KHJ A;  3CD6 A;  4BA1 I;  1IBK L;  1W2B A;  4A93 G;  1FGU A;  4L5Q A;  1HZA A;  1Y1W H;  1J6Q A;  2R92 H;  2I5M X;  3ER0 A;  2OTJ A;  3PUV A;  3J80 c;  4HJA A;  2A8V A;  3D0F A;  2EXD A;  4A3G H;  1LUZ A;  1XPR A;  4KHP Q;  2DUD A;  4X62 L;  2ASB A;  4DKA C;  1SMX A;  3HOV H;  4MNO A;  2BH8 A;  3PUY A;  3S24 A;  3PO3 G;  2VS1 A;  3T1Y L;  4OO1 G;  1XNQ Q;  4ME3 A;  1IZ6 A;  3A5U A;  3KOJ A;  4LF5 L;  2AHO B;  4A3D G;  4UP9 A;  4BY7 H;  4YWL A;  4IPD A;  4JI6 Q;  3L0O A;  5M3F G;  4DR5 Q;  2IX1 A;  1DGS A;  1NMF A;  5M3M H;  4DR4 Q;  3CCQ A;  2Z6K C;  2I5L X;  3K8A A;  2Y0S G;  2D0P A;  3CCU A;  4DUY Q;  2YTY A;  1ASZ A;  4NXM Q;  3KFU A;  2YV5 A;  1KD1 C;  3M4P A;  5JJL A;  4A75 A;  1IYJ B;  2F4V L;  3PO2 G;  4DNI A;  3S15 H;  5ELO A;  1CSQ A;  2R93 H;  4FDB A;  4PG3 A;  2QGQ A;  2BH2 A;  1QZH A;  1VQ8 A;  4JI3 L;  1V43 A;  3DM3 A;  4LF7 L;  1Q8K A;  4EX5 A;  5AJ3 L;  4JI7 L;  2ES2 A;  5IWA L;  1PYB A;  2FXQ A;  2BA1 A;  1TXY A;  1JE5 A;  4LFC Q;  2ATW A;  4A3I G;  1I6H H;  3A5Z B;  1EFW A;  5IYD G;  4PZ8 A;  3GTK H;  3CCV A;  1VQK A;  4GN3 B;  3I4M G;  1GD7 A;  4P71 A;  4JV5 Q;  2UUC L;  1UWV A;  4QL5 A;  1MKH A;  4IPH A;  3M4O H; 
#chains in the Genus database with same CATH topology
 3J81 c;  5D3D A;  5KRU A;  5C4X H;  5C0X G;  1MGS A;  1JJC B;  1E1O A;  3OPO A;  3W1G A;  5J39 A;  2IHE A;  3S2D B;  3P75 A;  3MAQ A;  1P16 A;  2ZT9 C;  4DR5 L;  1XPU A;  4IUP A;  1LTA D;  5EKI A;  1DOK A;  1VQJ A;  3UE0 A;  1NJI C;  1KQS A;  3WOF A;  4B3T Q;  4ALP A;  1EYG A;  3JC6 6;  1UE7 A;  3QR8 A;  4OWW B;  1QZG A;  1L0X B;  3OSO A;  4GN5 A;  2CFM A;  4WOR A;  2KED A;  2R7F A;  3VR3 A;  4A3B G;  4GOP A;  1CKN B;  5BN4 A;  1NY4 A;  4X3U A;  1ENC A;  2XWJ B;  5IP7 G;  3CC2 A;  4A3D H;  2B2W C;  1KTK A;  1OXX K;  5K36 G;  5M3M B;  1JWS D;  1BBW A;  2VNU D;  1EY0 A;  2WKC A;  4MZ9 A;  4R4T A;  2Q2I A;  3K7U C;  4NXN L;  2VQF L;  3PO2 H;  5IYB H;  2WII B;  1CTM A;  5C3E G;  3I8Z A;  4IUR A;  1EOT A;  2B8G A;  3C1E A;  4Y7N H;  1HR0 L;  2PNH A;  4JI2 Q;  1F2L A;  1QCB D;  3LNN A;  3M85 A;  5I2Y A;  1IBM L;  5IYD H;  3SK8 A;  2A6E D;  1N34 Q;  4H02 A;  4TRD A;  3CPF A;  3MXP A;  4C3H G;  4GKK L;  5C44 B;  1PTO B;  4JYA Q;  3H3V H;  2EY2 A;  5J22 A;  2JN4 A;  2NN6 G;  1BUV T;  4HSP A;  1MJE A;  3ULJ A;  2H4O A;  1O7Y A;  3HEJ A;  3ITP A;  1SNP A;  3H6M A;  1Y8N B;  2JA6 G;  2UUA L;  4YIJ A;  3VYU A;  3GTM H;  4DAV A;  4QB4 A;  3BDL A;  4R4O A;  3STB C;  1O7Z A;  1KDB A;  5ISR A;  3SK4 A;  4OO1 I;  2KCC A;  1GUT A;  1L0Y B;  3CW2 C;  1HTP A;  2IJ0 A;  1KL9 A;  4A3L H;  4RG1 A;  4NW2 A;  3FMC A;  1K83 H;  5DAU A;  4A4I A;  1U4R A;  1KHI A;  2H5X A;  1ML0 D;  1XX8 A;  4J8Q A;  3CKI B;  5DNF A;  1WTQ A;  3TQY A;  1CKN A;  4KY7 A;  1K8A C;  3PO3 B;  3LGJ A;  5CMD A;  3S14 B;  3I72 A;  4JBK A;  3LWE A;  2D62 A;  1D7Q A;  1WCM H;  5M5X B;  3HOX B;  1HH2 P;  3E9I A;  5TSS A;  3DWP A;  2NZO A;  4NMZ A;  4RH6 A;  3J7Y W;  2SEB D;  4DGZ A;  2PI2 E;  2D2C C;  4JI1 Q;  3V2T A;  1GUO A;  3PUX A;  2F0L A;  1UNS A;  2WAQ B;  2WFW A;  1SMY D;  1GHJ A;  1Q90 A;  2IL8 A;  4MN3 A;  4DAP A;  3SVM A;  3K80 C;  4AH6 A;  1Y69 U;  3JAM c;  4DV2 L;  3VA5 A;  2KCN A;  2UUB Q;  5IYC H;  1LV9 A;  2QF7 A;  5C0X I;  3KJO A;  3HOZ H;  4XQN A;  3J81 j;  4C2M B;  1ENF A;  3GV3 A;  4DR4 L;  1HTL D;  4DUY L;  5BN3 A;  4IOC A;  5DM7 3;  5FLM H;  2ZXP A;  2K14 A;  1G91 A;  2B39 A;  2K04 A;  3M7G A;  3CPW A;  2A1A A;  3QJY A;  1WTH A;  1ZKO A;  4A3G B;  2F0D A;  4KKT A;  2BE5 C;  2RQX A;  4DV3 Q;  3GTQ H;  4IUT A;  1AW7 A;  1GO3 E;  4ABN A;  1JJ2 A;  4K2K A;  1ZEQ X;  1B2T A;  2IY5 B;  2E2J H;  3UDF A;  3GTJ B;  1LTI D;  2XWB B;  4IUN A;  1N8R C;  2VXW A;  1A3V A;  3AFP A;  5F2D A;  1IBK Q;  2HIX A;  2XRS D;  1D6E C;  2NTT A;  2WAC A;  2F0W A;  4YWK A;  5EAY A;  3CME A;  4UPA A;  3BZC A;  5FK9 C;  3TSS A;  3NK9 A;  1I6H B;  1N9W A;  3CCL A;  2CQO A;  3NHH A;  2PYK A;  1Z6H A;  4QIW E;  5M5Y B;  3FKI B;  5C44 G;  2YTX A;  5LL6 S;  2RCF A;  4O2D A;  3ULL A;  3M4O B;  2PQA B;  2Z1C A;  4R4Q A;  1SXT A;  1HPC A;  1VDZ A;  1O7I A;  4EGV A;  2PMZ B;  1XTD A;  4IFD J;  4AIM A;  3NPP A;  1DOL A;  1AH9 A;  2A68 C;  3CCS A;  4JI7 Q;  4K5X A;  2NN6 I;  3VYT A;  2GVA A;  3D4W A;  2CQA A;  1PFS A;  3A74 A;  3I4L A;  4AYB E;  3H0G B;  2B2T A;  1AZQ A;  1PH1 A;  2Q2T A;  3N6R A;  4KKS A;  1H95 A;  1GUS A;  5HUR A;  1X56 A;  5C3X A;  2ZJQ A;  4MIU A;  1PH4 A;  2NZH A;  1EUJ A;  4IPG A;  1VMP A;  1YI2 A;  1PTO F;  2RF4 A;  4DV6 L;  1SNM A;  5H1S E;  2RSO A;  1E0B A;  3H91 A;  1LTB D;  3RZD H;  3T13 A;  2E5L Q;  1JOR A;  1Q8I A;  1KC8 C;  2F0Q A;  3HOX G;  1PYW D;  4B3R L;  1K28 A;  3G71 A;  3S1M B;  2Z6K A;  4KMU C;  2TSS A;  1SFO B;  1ICF B;  2XVS A;  2NVX H;  4CGY B;  2JA5 H;  1NTG A;  3A8K E;  3IL8 A;  1PH3 A;  4DV4 L;  3F2C A;  1LT6 D;  2WAQ G;  5LMU L;  1EYA A;  5GQO A;  3SDZ A;  1RTO A;  3MVV A;  4A3C H;  2CCZ A;  2VB2 X;  1DOM A;  2AUJ D;  1Q7Y C;  2JJQ A;  3MA2 B;  4MTK A;  5HGQ A;  1TWG H;  1F9R A;  2ICI A;  3ULP A;  1HNX Q;  1T5X D;  2ZTC A;  2DGY A;  3CAM A;  1F2Z A;  1JT8 A;  1AP0 A;  2A5H A;  1CFM A;  1HZB A;  5EQ0 A;  5BN5 A;  2IX3 A;  2N3S A;  1PRT B;  1Q3L A;  5IP9 H;  1WFQ A;  3ONA B;  2PQA A;  1PRT D;  4K6D A;  4OX9 L;  4A3G G;  3EVQ A;  4OEM B;  4JI4 L;  1XMO L;  1CSP A;  4NXN Q;  2PW7 A;  4A76 A;  1FL0 A;  2AQ1 B;  1KAB A;  2DY8 A;  4K5V A;  1PV4 A;  1HR0 Q;  3H09 A;  1QB5 D;  1RL2 A;  5G3L D;  3URY A;  3J80 L;  4K14 A;  1S5E D;  2MJ8 A;  1OXV A;  2E2I B;  1QJO A;  1VF7 A;  2R7D A;  1IBM Q;  1BDO A;  1VMC A;  3AMU A;  2MPM A;  1STB A;  3J81 i;  2SNS A;  4GKK Q;  1A2T A;  3KLS X;  1N33 L;  1VQL A;  3TS0 A;  4CBV A;  1XWE A;  3IAY A;  1SNQ A;  1RTN A;  1D1K A;  1WTR A;  4RAU C;  1K3R A;  1VQB A;  3FPU B;  3RZO H;  1BOS A;  4BBS H;  2UUA Q;  4YHH L;  3FKI G;  2L15 A;  3PQI A;  2MFI A;  4RGM A;  2A6H C;  1RKN A;  1YIT A;  1OO9 B;  2ID0 A;  2OEO A;  2MO0 A;  1SJH D;  1YIJ A;  5J3B A;  3A8J E;  4MHE A;  3UE1 A;  1HZ9 A;  3HRZ C;  5JOB A;  2L12 A;  4GLV B;  3G4S A;  2IPK D;  1E24 A;  3F8T A;  5KNC A;  4WFN 3;  2K6A A;  3H0G G;  2JE6 I;  2ZXO A;  2RBM A;  1SRU A;  3CD6 A;  4H44 C;  3MTS A;  4DK0 A;  4C56 C;  1EY5 A;  3C46 A;  1Y1W H;  2R92 H;  3Q23 A;  2DUD A;  4DKA C;  2M9V A;  1TY0 A;  3S24 A;  3DM1 A;  4QF4 A;  2VS1 A;  1IZ6 A;  1LO5 D;  3DEO A;  3KOJ A;  5EKK A;  4PQX A;  3TDQ A;  2EYP A;  4UP9 A;  3A5U A;  1NMF A;  4DR4 Q;  4E6I A;  1X3Q A;  3I70 A;  1ASZ A;  2SDF A;  2Y0S G;  4DUY Q;  3KFU A;  2YTY A;  2UXD Q;  3EA6 A;  2K32 A;  3S16 B;  5JJL A;  4A75 A;  1ZXT A;  3BDC A;  4DNI A;  3S15 H;  2KEE A;  1CSQ A;  1QG7 A;  4PG3 A;  1IW7 D;  1QZH A;  1TS4 A;  2FIN B;  1B9N A;  5AJ3 L;  2ES2 A;  4PMC A;  4EVO A;  2BA1 A;  2A69 D;  3MXU A;  5IOD A;  1EFW A;  3NTH A;  3I4N B;  3NXW A;  1F2M A;  4HR7 B;  2LS0 1;  2UUC L;  1MKH A;  4ODG A;  2N49 A;  1VCI A;  5D65 A;  1PH2 A;  3MEF A;  2E76 C;  1X55 A;  1XPO A;  3Q24 A;  2JA8 B;  1XNQ L;  1E1T A;  5E7N A;  1SE3 A;  1JR0 D;  5AFW A;  4L5T A;  2A19 A;  3NTK A;  3C2P A;  4KY5 A;  1SLJ A;  5FLX c;  1UEB A;  5IGD A;  4J15 A;  4APV A;  1PH8 A;  2NVT H;  3OW7 A;  3R2T A;  2I5H A;  3HKS A;  1NE3 A;  2L1B A;  2PCF B;  3S1R H;  3K5N A;  1HA6 A;  1SN8 A;  1EY4 A;  2F0I A;  5C0X J;  1Z9F A;  1XXG A;  1RJT A;  5CBE E;  4KHZ A;  4P72 A;  1HNZ Q;  4S3S A;  3CMA A;  1CHQ D;  4KI0 A;  2KHI A;  4OWX B;  1PRT F;  5I9P A;  4B9W A;  2GN5 A;  5EPJ A;  5KYL A;  3JAM i;  3BDO A;  3GV6 A;  1TY2 A;  2OTL A;  1TWH H;  4OHJ A;  4YY3 L;  2CHB D;  3BVZ A;  4BY7 B;  3KDF B;  4JV5 L;  5G3L F;  3BZK A;  1TII D;  3TRZ A;  3EIV A;  4O0A A;  4DR2 L;  1D2B A;  4F88 A;  2NVY B;  1GKH A;  3K5M A;  1QUQ A;  1EFI D;  4AQY Q;  4BBR H;  3PIP 3;  5KNB A;  1K0R A;  1B53 A;  5FO7 B;  4DUZ Q;  4LFA L;  3A0J A;  4NB3 A;  5EPK A;  3RR5 A;  1ZYR D;  1OXT A;  2LY7 A;  4A3K G;  3GTP H;  1Q1E A;  4DV6 Q;  4PZ6 A;  1WI5 A;  2BA0 A;  4G4K A;  1TWA H;  1DJR D;  3CCE A;  2CKZ B;  4B3R Q;  4GN4 B;  1PVO A;  1EWH A;  3OWE B;  2F0G A;  2HIV A;  2NWG A;  1X3G A;  2E74 C;  1Y14 B;  2P5Z X;  2NTS A;  4X6A H;  3PGZ A;  5LMU Q;  2DJF C;  4AYB B;  4FXG C;  4GOP B;  2FJ2 A;  4RCO A;  1SE8 A;  1SJE D;  1NMG A;  1TS3 A;  1ESF A;  5JJI A;  1NBW A;  2JQO A;  2NZ1 D;  3E9H A;  4LFB Q;  4FO2 A;  1TWC B;  1H9M A;  4FP5 D;  4POF A;  1A3T A;  1N36 Q;  3HOY G;  4OXP A;  1FNU A;  2K7V A;  5C5M A;  1KRT A;  2AWN A;  2FMC A;  2NVQ H;  1PMR A;  1I3Q H;  4XTC S;  5GAD C;  4DFA A;  2KCT A;  4LF8 L;  3DUZ A;  2AWO A;  1PLF A;  3KJP A;  2R6G A;  1EYD A;  4OX9 Q;  4HIO A;  1XMO Q;  1UE1 A;  1RF2 D;  3RLO A;  3K7A H;  4A3B H;  3TBI B;  3VA7 A;  2IX0 A;  1II3 A;  2QEX A;  2ZM6 Q;  3AQQ A;  4HCS A;  3U50 C;  3KDF A;  5IP7 H;  2Z8L A;  4GNX B;  2HT1 A;  4OEL B;  3QIA A;  5K36 H;  4OGQ C;  4DAM A;  3GTO H;  3GD7 A;  2B63 H;  1TQO A;  4JPB W;  1QWY A;  4GS3 A;  1R4Q B;  4HSV A;  2Q2H A;  5IOC A;  4JI5 L;  1C4Q A;  3HZX A;  1SNC A;  1PH7 A;  4P74 A;  1TWF B;  2JA8 G;  1K8O A;  1X32 A;  5C3E H;  5E1F A;  1H9S B;  3RN2 A;  4XT1 B;  1CM9 A;  4HTH A;  2UU9 L;  1U5K A;  1IYU A;  2B2V C;  4NXM L;  2F4I A;  3P20 A;  4X66 Q;  4YHH Q;  3PSI A;  2JEB I;  3X3M A;  4C3H H;  2MO1 A;  3F2U A;  4P75 A;  4H0L C;  1PTO C;  3NBH B;  1GJX A;  3MWY W;  4LK1 C;  2B2Y A;  4RHR A;  1FGB D;  1X54 A;  1VQ7 A;  5C4J H;  3J7A 5;  4CHT B;  2RA4 A;  3HOV B;  3KBG A;  1P8L A;  3NEL A;  1D1I A;  4BY7 G;  4RMF A;  2JA6 H;  2KHS A;  3GTM B;  1HQR D;  3EFX D;  5DLQ E;  3U4V A;  1Q81 C;  4QUF A;  1NR2 A;  1SRO A;  4OIJ A;  1YNN C;  3SHL A;  1SE2 A;  2F03 A;  3I55 A;  1EQV A;  4DAY A;  3RNU A;  4K2L A;  2MP1 A;  4O42 A;  5I6W A;  2OCE A;  4WJ3 M;  3PUW A;  1SE4 A;  4G7Z C;  3A8I E;  4CDD C;  1EEI D;  4JOI A;  1G6P A;  5CC4 A;  2BDO A;  3KF6 B;  4FNF A;  4QQB X;  4YCU A;  3GTK B;  2DNC A;  5ELD A;  3KK7 A;  4XXE A;  4GNX A;  3A7A B;  3AFQ A;  4RCN A;  2A73 B;  3HKZ B;  4LAA A;  4DN4 M;  3TRE A;  3TP6 A;  1EU4 A;  2EJG C;  3R3O A;  1FVI A;  3D6W A;  3RN5 A;  4DR7 L;  4B3S L;  4IOA A;  1SMY C;  1R4P B;  3I2Z A;  4WRD A;  3EJI A;  4AYB G;  5A35 A;  1NNX A;  4POG A;  4K5W A;  1WTV A;  3L3O C;  1YEZ A;  1AE3 A;  5JJZ A;  3KYH C;  4A3F B;  1H9S A;  5EBD A;  3QOL A;  3HOW B;  3KLR A;  4LF6 L;  3L7Z C;  4XIG S;  2B2U A;  2PW5 A;  4OWT B;  1MJC A;  3U9O A;  1HFN A;  1S5D D;  1A3U A;  3KUP A;  1O78 A;  5M5W H;  4DR1 L;  3DLL A;  3K5O A;  5D3I B;  2UUC Q;  2E75 C;  1EWI A;  2O5I C;  4A93 B;  3NBH A;  3GTG H;  5ELF A;  5L37 A;  2MHV A;  4LMQ D;  4MTN A;  2EY1 A;  5LMN W;  4K0K L;  1KLG D;  4GLA C;  4P2C B;  1KAA A;  3R8B A;  1YJW A;  5EGT A;  3Q22 A;  1QVG A;  1DON A;  4NP5 A;  1E2Z A;  2QW7 A;  3CCM A;  3OOC A;  4LWC A;  4DR3 L;  5M3F B;  2OF1 A;  4C3J B;  2UXC Q;  1DD2 A;  3CRK C;  1IBL L;  5IYB G;  3NEN A;  3PMF A;  5ELC A;  3W5O A;  1JOQ A;  5M9O A;  1E2W A;  3S1Q H;  2K52 A;  1YHQ A;  5BR8 L;  3CCJ A;  2O2L D;  3A55 A;  2EYM A;  4DR6 Q;  4DPG A;  2K50 A;  3KF6 A;  1IYV A;  3PIP A;  4HJ9 A;  3I4O A;  4CJ2 C;  3FEW X;  4YY3 Q;  2HHH L;  2K5N A;  3KF8 B;  3GTL H;  1A6X A;  3I4M B;  4TKO B;  1PTO H;  2ZTD A;  4JCV E;  3ERS X;  4DR2 Q;  2QA4 A;  2IHF A;  4JBJ A;  2JP1 A;  1I6V C;  1GUW A;  4R1J A;  4JI8 L;  3T1H L;  2DNE A;  3HOV G;  3J80 E;  3SGI A;  4LFA Q;  4Z9C B;  1DM0 B;  4GKJ L;  1I50 B;  3E3X A;  4GLX A;  3BYT B;  2UXB L;  3CHB D;  4R8N A;  2K5D A;  4KY6 A;  1VQ9 A;  1SDF A;  3CCR A;  3STB D;  5M3M G;  3ERQ A;  1LLR D;  4LW1 A;  2G9H D;  1FJG L;  1BKB A;  3T51 B;  5HGT A;  4X65 L;  1I4Q A;  4LF4 Q;  4A3L G;  1EY7 A;  2VY3 A;  2YU9 H;  2WP8 J;  4A3J H;  1MBY A;  1BCP C;  1C0A A;  4CJ1 B;  5FOB B;  1J5E L;  1NCV A;  5M5X H;  3PV0 A;  3OW2 A;  3HKZ G;  5KEE A;  2VUM H;  1D8L A;  4A3M H;  4LUO A;  4HAE A;  1Y1V B;  2JXM B;  4L5R C;  4A3F G;  3BJU A;  5CGK A;  1WOC A;  3HOW G;  4DV1 L;  1G51 A;  1QVC A;  1L0W A;  4C2M H;  3CP0 A;  1TWG B;  4RGN A;  2R3Z A;  4JBW A;  3EQL C;  4FXD A;  2M2L A;  2R7Z B;  1VF5 C;  1SEB D;  1ASY A;  5CV4 A;  2O4X A;  3ERO A;  3KF8 A;  4EQP A;  1BF4 A;  1CQV A;  1W2B A;  1NAP A;  5IIF A;  2PQE A;  4A93 G;  1HZA A;  1BBX C;  1J6Q A;  2I5M X;  3X3N A;  3PUV A;  3VR4 A;  2PZW A;  1WTW A;  3S2H B;  1BR9 A;  4A3G H;  1LUZ A;  4X62 L;  1JQY D;  4U67 3;  2BH8 A;  3PUY A;  4G57 A;  3PO3 G;  3T1Y L;  1ILP A;  4ULL A;  2KEC A;  5EPL A;  2F1M A;  4IPD A;  2F0K A;  4C3J G;  1QNK A;  5M3F G;  4DR5 Q;  4I65 A;  2IX1 A;  3A7L A;  5JAV A;  3CCU A;  4NXM Q;  2FFK B;  5IGF A;  5KYI A;  1MSH A;  3NE5 B;  4L8J A;  4M1U B;  1C48 A;  1S5F D;  2R93 H;  4FDB A;  4Q5V A;  4XQQ A;  3TN2 A;  4JI3 L;  1V43 A;  3DWQ A;  1Q8K A;  4N8F A;  2L4N A;  4L63 B;  4ZAI A;  5IWA L;  1PYB A;  4KK7 A;  1TXY A;  3RZO B;  1I6H H;  1I4H A;  1EZ8 A;  3ND9 A;  2F0V A;  1EY8 A;  4BBS B;  4IFD H;  2Z4H A;  1JOK A;  5K5P A;  1VQK A;  1M8A A;  3I4M G;  2PZT A;  4ZQ3 A;  1B3Q A;  4A3E B;  1UWV A;  4PMB A;  1J8I A;  4QL5 A;  4KN7 C;  3M4O H;  5JVG 3;  2ALY B;  3QOJ A;  1T9H A;  3BG3 A;  4YCV A;  4HIK A;  1I94 L;  2KEN A;  2K33 A;  4LF9 L;  3G6J B;  1F9S A;  2VQF Q;  1EY9 A;  2A68 D;  1VQG A;  3SR1 A;  1PZI D;  3IFD A;  3UDX A;  2E2H H;  2K5H A;  4V0B A;  3HOU B;  4RFB A;  2F3I A;  4CJ0 B;  1S72 A;  1N32 L;  1KDC A;  1S40 A;  4ID6 A;  2R92 B;  1WYD A;  3WOE A;  1FR3 A;  1GVP A;  3G6E A;  5CV6 A;  4LFC L;  5I6Y A;  2YTV A;  1A8V A;  2K1B A;  3J7A F;  1B8A A;  3S1N B;  2F0E A;  1YBY A;  2XNA C;  3Q0A A;  4RWS C;  4YCW A;  4UP7 A;  1HNW L;  1SFO H;  4LF6 Q;  2CH4 W;  4IPC A;  4KJN A;  3S17 B;  1Y1V G;  2M00 A;  2V1C C;  2RSN A;  2F0J A;  4ZKB B;  1QNU A;  1M1K C;  1U4P A;  1XNR L;  3A54 A;  1Z7T A;  5FJ8 G;  4TQU S;  4DR1 Q;  2F0F A;  4NKL A;  1MI2 A;  2K5Q A;  2K03 A;  1E7Z A;  1F9P A;  3VDY A;  1HJP A;  4K0K Q;  1S5C D;  1JB3 A;  2R7Z G;  1K8G A;  3NWS A;  4H7B A;  3JAM L;  3RD4 A;  2JK8 A;  1KNA A;  5FKA C;  4C3I H;  5JEA J;  5IP9 G;  4RHS A;  2F3V A;  5JVH 3;  3MFY A;  4B3T L;  1VQA A;  4XDX A;  4DR3 Q;  3OIQ A;  1YZ6 A;  4V19 0;  2J7Z A;  1MHW C;  1B7Y B;  3D4R A;  1PXU A;  1LM0 A;  1HCZ A;  2EJM A;  1DXM A;  4G7H C;  3M4Q A;  4DV7 L;  5C5L A;  1G2T A;  4BS9 A;  3DWA A;  1VQO A;  5LMN L;  1LT4 D;  3VYR A;  2DJG C;  3J7A V;  5ELN A;  4DV2 Q;  2NVT B;  5IY0 A;  4HMI A;  1IKM A;  2E2I H;  2EY5 A;  3D31 A;  1UAP A;  3SK5 A;  4BXX H;  3KBX A;  4P73 A;  2F0S A;  1QUQ B;  2F0U A;  2D5D A;  4F7X A;  1VQC A;  1YNJ D;  4IJL A;  4HN7 A;  5T1G A;  4BY1 H;  2IW3 A;  2X6G A;  3TEH B;  4B08 A;  3T1H Q;  3GQB A;  2N88 A;  4BBS G;  2FHT A;  1VQ4 A;  3ND8 A;  1N34 L;  1TR5 A;  3UDI A;  3QO2 A;  2B8F A;  4GKJ Q;  3QWN A;  1STA A;  2JEA I;  1A62 A;  2NUC A;  2KQ3 A;  4A3E G;  5COY A;  1XYI A;  2JA7 H;  4JYA L;  4IO9 A;  3HFZ B;  4H13 C;  2EYF A;  1FJG Q;  3RLF A;  3NQT A;  1EQT A;  4BBR B;  4KHP L;  3J80 i;  3SEB A;  2KA7 A;  4QCL A;  1I4R A;  2LXK A;  2EOT A;  2EYO A;  1PZK D;  4IUV A;  4A3K H;  1ILQ A;  2WAQ E;  1ROD A;  4CDC C;  2F0N A;  4JI6 L;  3NTI A;  4OIK A;  1HHV A;  2CW0 D;  4K8I A;  1TWA B;  3HOU G;  5CV7 A;  1J5E Q;  2K4K A;  4I7Z C;  3BVM A;  2ZXR A;  3R2I A;  1LTG D;  3E0E A;  1K73 C;  2G5D A;  1CZW A;  2ICE C;  2R92 G;  1BBU A;  1JIC A;  4R4C A;  1DYQ A;  2XTI A;  1JWM D;  2B2Y C;  2F0T A;  5C4H A;  1VQP A;  4HJ7 A;  1X9N A;  1B9M A;  1ET6 A;  2EY6 A;  4GOP C;  4G7O C;  1K0S A;  1EZ6 A;  4OO1 H;  5KIX A;  2WB1 E;  1Q1B A;  3HOY H;  1BNZ A;  1B4O A;  1CUK A;  3TP7 A;  2QDB A;  2NVQ B;  1V1Q A;  4J1M A;  5IT9 E;  2D0O A;  5JEA G;  3PF4 A;  3TS2 A;  3E5S A;  1JB7 A;  3PCO B;  1PZJ D;  1L1O B;  1PFB A;  4QIW B;  1E22 A;  4JOI C;  4UHV A;  1IL2 A;  3K7A B;  5CR3 A;  3SE0 A;  4UAI A;  4A3I H;  3T1Y Q;  2PI2 A;  2G9D A;  3TME A;  1B50 A;  4GNX C;  3OIP A;  3I90 A;  2B63 B;  3S9W A;  3HG9 A;  3J7Z C;  1VQF A;  5E4X A;  5C4X B;  4DV4 Q;  1A63 A;  1D5X C;  5C0X H;  2JYO A;  3DEP A;  3DXJ C;  3TZD A;  5IGE A;  1W3S A;  3L9A X;  2HCC A;  4N9T A;  1GXD C;  2LFN A;  2PMZ E;  5IWA Q;  2XSC A;  4LUV A;  2ZJR A;  2EIF A;  3M4Y A;  1LT3 D;  4RGT A;  3G48 A;  1STN A;  2EZV A;  4O1N A;  5A2Q E;  1WVL A;  3ICE A;  3OMC A;  4DK3 C;  2KJX A;  4JG2 A;  1HA5 A;  4DAY B;  4GZY C;  5CBA E;  1JJG A;  5C4J B;  2RVL A;  1RIP A;  1I94 Q;  1SYD A;  1EL0 A;  4LF9 Q;  1EIF A;  4DV5 L;  1WD1 A;  4JI4 Q;  3OMG A;  2PZU A;  4L6T B;  3I4N G;  1EYC A;  1R9T H;  3OTO L;  4HED A;  4A3D B;  1HQM C;  3IRB A;  1F77 A;  1W6K A;  4CKB A;  4F87 A;  4PZ7 A;  4NDX A;  2NVY H;  3SK6 A;  4BBR G;  3NBI A;  1N32 Q;  2E8G A;  3H94 A;  4X3S A;  3PO2 B;  2BDN A;  1BQQ T;  4WJ4 A;  1PH5 A;  3M3Y H;  2F0O A;  5FO9 B;  4F8M A;  1EU3 A;  2EE1 A;  2Y0S E;  1N33 Q;  4Y7N B;  1L1O A;  2OT2 A;  3Q8D A;  3OHX C;  1CT1 D;  3MFG A;  3TP5 A;  2F0P A;  1UE6 A;  2MNA A;  2A6E C;  1HNW Q;  2K05 A;  4OL7 A;  1PYS B;  2VW9 A;  3M9B A;  3L2P A;  3I56 A;  2VZA A;  1Z47 A;  1XNR Q;  2E2D C;  1ESR A;  1BO0 A;  1H9K A;  4NPS A;  2E5L L;  2NN6 H;  2WKD A;  3CQZ H;  1PHJ A;  4EQO A;  3RUZ A;  2OQK A;  3GO5 A;  1KDA A;  3BZD B;  1TWC H;  1M90 C;  4LUZ A;  3NEM A;  1DZ1 A;  3W1B A;  2IWH A;  5M5W B;  1SYG A;  2JA9 A;  1X65 A;  2OQ0 A;  3GTG B;  2GVB A;  3PF5 A;  1XTC D;  3AB9 A;  1K83 B;  2I07 B;  4Y52 H;  4DV7 Q;  4IUQ A;  1XMQ L;  2ZTE A;  5IT9 L;  1ICW A;  4ZCK A;  1UEA B;  5LMN Q;  2IT1 A;  1WJJ A;  1OXS C;  4ZRZ A;  2B29 A;  5E4W C;  1HNX L;  2KBN A;  5DEH A;  1WCM B;  2B63 G;  2NBF A;  4RKB A;  2VL6 A;  2RDG A;  5C6A A;  1MSG A;  1H9J A;  3PIO 3;  5GAG C;  5T1I A;  1HFG A;  5C4X G;  1KNE A;  3BS1 A;  3D6C A;  1TWF H;  1BXT A;  3AEV A;  3J81 E;  1U9R A;  3S1Q B;  1QE6 A;  1O7L A;  4KJO A;  1PA6 A;  3S2D H;  3AYH B;  4HCE A;  3F2B A;  3I3C A;  5AJ3 Q;  3HOZ B;  1XJV A;  2JSO A;  4QMG A;  1HRJ A;  3BVG A;  3RLN A;  1SBB B;  4K6L A;  3GTL B;  1B3A A;  1ET9 A;  3SXH A;  5FLX L;  2B2T C;  3IFT A;  4L5Q A;  1PTO D;  1STY A;  3K58 A;  2XRQ D;  2OTJ A;  1LT5 D;  5A2Q L;  3J80 c;  2A8V A;  5E3F A;  4KHP Q;  5IGG A;  3HGB A;  3K59 A;  3HOV H;  4MNO A;  4JVZ A;  3GTQ B;  1PFN A;  1XNQ Q;  4LF5 L;  2AHO B;  4A3D G;  2HDM A;  1IHZ A;  4X3T A;  2C5C A;  5C3W A;  3L0O A;  5I4D A;  4JI6 Q;  1EY6 A;  1TS5 A;  5M3M H;  1SND A;  2L9H A;  3CCQ A;  2Z6K C;  3RMH A;  2RDH A;  1YNN D;  2E2J B;  1K8M A;  1KD1 C;  1S4Z A;  2PPB C;  3M4P A;  3NUC A;  2F4V L;  1IYJ B;  3PO2 G;  1SYC A;  5ELO A;  1JC7 A;  1STG A;  2FMM A;  3WDN A;  2QGQ A;  2YU9 B;  2EDG A;  1A15 A;  3DM3 A;  4LF7 L;  2Q8T A;  4A3J B;  2KOL A;  2L55 A;  4DK1 A;  1JE5 A;  3HS0 C;  5I2X A;  5IYD G;  3GTK H;  2X6L A;  3E0J A;  1W6J A;  1FYC A;  4GN3 B;  5CYU A;  3Q6S A;  2VUM B;  4IAL A;  4P71 A;  4JV5 Q;  4A3M B;  1RCV D;  5ELE A;  3K0X A;  5C44 H;  2EJF C;  3NP8 A;  1WD0 A;  4QUC A;  4I7A A;  2TMP A;  5JPM C;  3A56 A;  1KXL A;  2OWO A;  4A3F H;  1G29 1;  2YYZ A;  5JPN C;  2VQE L;  2XGT A;  1D5M C;  4JI0 L;  1HXY D;  1C8C A;  3HOW H;  2B2V A;  1LTS D;  2RKS A;  2UXD L;  3H15 A;  3OWF A;  2LKV A;  1X3P A;  4J6H A;  4CKC A;  2CWP A;  4HJ8 A;  1VQI A;  1I4G A;  4A93 H;  2EYL A;  1B1Z A;  4WJW A;  1AE2 A;  2EQS A;  3V05 A;  1Q86 C;  2HCI A;  1Q12 A;  4JC0 A;  4B3M L;  3DMU A;  4ZYS A;  1GUN A;  2WB1 B;  1FNW A;  1I4X A;  3RZD B;  4IN3 A;  5KND A;  3PO3 H;  5NUC A;  1V1O A;  1WCM G;  2B2W A;  3S14 H;  2Z9H A;  1STH A;  3HOX H;  1YJN A;  1EIH A;  5M3F H;  4C3J H;  3UI2 A;  2NVX B;  4EQN A;  2LXJ A;  4DV0 L;  2JA5 B;  4LJZ C;  5FO8 B;  1JE4 A;  1EIY B;  2BCO A;  2R93 B;  4IZ8 A;  2V4D A;  1A0I A;  1U4M A;  4DF7 A;  5IYC G;  2X69 A;  2RCN A;  5DM6 3;  4LF8 Q;  4PMW A;  4RGO S;  5EJW A;  3HOZ G;  3J81 L;  3JAM E;  3MZ5 A;  4DV5 Q;  4FF3 A;  1GHK A;  3F2D A;  3PUZ A;  3OTO Q;  3U58 A;  1HNZ L;  1IL8 A;  4X3K A;  5FLM G;  3I4M H;  3KLS A;  4OON A;  3F1Z A;  1VQ5 A;  4KTA A;  1KAW A;  2BOS A;  1PRT C;  2KCM A;  4JK1 C;  2HQE A;  3U4Z A;  4JI5 Q;  1KLU D;  4X64 L;  2BE5 D;  5IE8 A;  1I50 H;  1VQD A;  5IGB A;  1V8Q A;  4KHV A;  1B70 B;  2E2H B;  3P1H A;  3HP3 A;  2UU9 Q;  2R61 A;  3GTJ H;  4AQY L;  1EWC A;  1LTL A;  2RDF A;  2Z6B A;  1ONL A;  4R4I A;  2D9U A;  3FPP A;  4ZUJ A;  4DUZ L;  1V1P B;  2QCP X;  2CH4 A;  1TKW B;  2WIN B;  4A3J G;  1BCP B;  1SSO A;  1WTX A;  1BCP D;  4KV6 A;  2KVM A;  1FNV A;  3MC0 B;  2AQ2 B;  4DXF A;  2J4X A;  1PFM A;  2K5V A;  4CDF C;  2VUM G;  3W3A A;  2HUG A;  4DA2 A;  4A3M G;  1OTC A;  2CWA A;  5M5Y H;  3N52 A;  3FKI H;  4UDU C;  2NB0 A;  2F3W A;  2Y0S B;  1Y1V H;  1A2U A;  1C9O A;  3FDT A;  4FYD A;  5FJ8 H;  4QGU A;  1OXU A;  2N8N A;  2MUY A;  4EQ5 A;  5GAE C;  3BU2 A;  3K5L A;  5CV8 A;  4XT3 B;  4IJH A;  3T16 A;  3H3V I;  1KIX A;  3P7J A;  1CKM A;  3PIO A;  2HDL A;  1CI3 M;  1XMQ Q;  4LFB L;  1DCZ A;  4FF4 A;  1JCK B;  1S3O A;  1N36 L;  1KRS A;  3R93 A;  2K01 A;  2R7Z H;  3K6O A;  3CC7 A;  1U4L A;  3D3R A;  5HY6 A;  4TVA B;  4KD3 A;  3H0G H;  4C3I B;  3FVQ A;  4DU9 A;  4BA2 I;  1GUG A;  3LWU A;  4KKU A;  2Z0S A;  1VQ6 A;  2HD3 A;  3W2D A;  1Y1W B;  3M7N A;  1HUN A;  1YHB A;  3S2H H;  4DR7 Q;  4B3S Q;  2WB1 G;  2C35 B;  2I0Q A;  2B3G A;  3C3L A;  2EVB A;  4UP8 A;  2ZM6 L;  1Q46 A;  1IXR A;  2DN8 A;  1VQH A;  2QIL A;  1JOO A;  2HQL A;  4IUU A;  4QY7 A;  3MXG A;  3S1M H;  2K5W A;  4FXK C;  2JA5 G;  2EXZ A;  3CXC A;  4CDE C;  3T4A C;  4ZKC B;  1L2F A;  2R93 G;  2MGS A;  3I91 A;  1UUP A;  1Y8O B;  4TSS A;  1V1P A;  1YNJ C;  3S15 B;  4UY8 C;  1IW7 C;  3O13 A;  5CV9 A;  3C1F A;  4BY1 B;  1PH6 A;  4A3C G;  2O5J C;  3U9S A;  3DHQ A;  5CV5 A;  4K8J A;  1NUC A;  1BVS A;  2A69 C;  3QB3 A;  4IFD G;  3WWV A;  4X66 L;  4U68 A;  4LF5 Q;  4HMJ A;  2EYJ A;  4A3E H;  2JA7 B;  1IKL A;  5GRO A;  1WTO A;  3QG1 A;  1RD9 D;  1D5Z C;  3GDE A;  1GM5 A;  2XN9 C;  3MHB A;  4LNQ A;  2AMC B;  2XIW A;  2MQH A;  2F4V Q;  2AQ3 B;  3HKZ E;  1IBL Q;  1S5B D;  1EEF D;  3ZYY X;  1HZC A;  1HR0 W;  1QVF A;  1Q82 C;  3I73 A;  4LF7 Q;  4FF2 A;  4A3K B;  4HID A;  5BR8 Q;  3D8G A;  2CW0 C;  3K57 A;  1K9M C;  4RKL A;  4XYO A;  1GOZ A;  5J1Z A;  2Q2U A;  3HOU H;  1V9P A;  3S1R B;  1YHA A;  1YNX A;  2K28 A;  1X3F A;  1LTT D;  2C9O A;  1VS0 A;  3MXN B;  4ME5 A;  4QJF A;  1AZP A;  2HHH Q;  4N9P A;  3VR6 A;  1CKO A;  2OXP A;  4HJ5 A;  3T56 B;  1AFP A;  1SYE A;  5D14 A;  3UDG A;  3VR5 A;  2LMC B;  2EYH A;  4JI2 L;  3S1N H;  4YWM A;  4JI8 Q;  5EBC A;  3K81 C;  1SYB A;  1TVX A;  4M8A A;  1EIG A;  1F9Q A;  1EQQ A;  1TWH B;  3BYY B;  2VQE Q;  4JI0 Q;  1QIL A;  5JJK A;  3OYY A;  1E3P A;  2ENB A;  1C7Y A;  2UXB Q;  1F2Y A;  2AKW B;  4L5S A;  3G7L A;  3S17 H;  2L11 A;  2J0T D;  3HOY B;  1AN8 A;  5IT9 c;  4RA8 A;  2A6H D;  4DXG A;  1B44 D;  1NR4 A;  3AU7 A;  4X65 Q;  5COR A;  4PNY A;  3NSW A;  5JEA H;  1TU2 B;  2SNM A;  1U0L A;  1SNO A;  3E6Z X;  1ZYR C;  4R9W A;  3GTP B;  4B3M Q;  1L1O C;  1T5E A;  1X3E A;  1BCP F;  2Q8R E;  4A3I B;  1G2S A;  1YJ9 A;  2F52 A;  4C3I G;  1EOV A;  3TP8 A;  4XQJ A;  4CKE A;  3IKJ A;  4FVM A;  2AUK A;  5IGC A;  1RHP A;  1Y1W G;  1I4P A;  2DY7 A;  2QEJ C;  3FP9 A;  2A74 C;  1UE5 A;  4DV0 Q;  1WTP A;  3KLW A;  3B6Y A;  4KD4 A;  1CQF A;  2RHQ B;  3CC4 A;  3EBE A;  3VYS A;  1J9O A;  2Q8I B;  1TT2 A;  2Z4I A;  1O80 A;  5EKL A;  1VQE A;  1LAC A;  4PV1 C;  2UXC L;  2LSS A;  4DV1 Q;  4BXX G;  1VQM A;  3ZJY C;  2VB3 X;  1MD2 D;  1RDP D;  4JI1 L;  5C4Z A;  4C1N K;  3CU7 A;  3MXN A;  1JMC A;  1LTR D;  3S16 H;  2EPB A;  2QKI C;  4BWG B;  2N55 A;  1I3Q B;  3CF5 A;  4ZLT F;  3FRP B;  4BY1 G;  1G6Z A;  3LX0 A;  1EQR A;  4DR6 L;  4DNR B;  2UUB L;  4IQZ A;  2QDL A;  1AEX A;  4JBM A;  4DK6 C;  4HIM A;  4X64 Q;  4X62 Q;  4A3B B;  1R9T B;  1MIU A;  3I4N H;  2L0C A;  1CA5 A;  1VQN A;  2JA7 G;  2F0M A;  1X6O A;  2N78 A;  4KN4 C;  1JWU D;  2K75 A;  3GTO B;  4IFD I;  3D4D A;  3VR2 A;  4Q0F A;  3M3Y B;  4DV3 L;  2I46 A;  3T53 B;  2JA8 H;  1STE A;  5C3E B;  5LL6 X;  5GAH C;  2KUM A;  3CRL C;  3FHW A;  1YVC A;  2F0H A;  1SR3 A;  4JI3 Q;  1PH9 A;  1TS2 A;  1LYL A;  4KLK A;  1E2V A;  2GA4 B;  5FLX E;  2WV6 D;  3I7F A;  2RHS B;  1M4V A;  1I5F A;  3EN2 A;  2ZJP A;  3K0Y A;  4LF4 L;  3NQI A;  2KHJ A;  2B2U C;  3TZU A;  1G8Z D;  4BA1 I;  4C1N I;  3MEH A;  1IBK L;  4R8I A;  1CK1 A;  1FGU A;  4C3H B;  4JW0 A;  2L5T A;  5KGU A;  3ER0 A;  4HJA A;  3D0F A;  3H3V C;  1H9R A;  2EXD A;  1NSN S;  1XPR A;  1K3B C;  2ASB A;  4ZK9 B;  1CZG A;  1SMX A;  2PNR C;  4B9X A;  1QOH A;  3CQZ B;  4OO1 G;  1FD7 D;  4ME3 A;  3GP7 A;  2JA6 B;  2H1E A;  1HUM A;  4YWL A;  4BY7 H;  1SAP A;  3V96 A;  1DGS A;  3K8A A;  2I5L X;  4FF1 A;  2D0P A;  2YV5 A;  1CHP D;  1LAB A;  5LHY 1;  4ZUI A;  4ILW A;  4XYQ A;  2BH2 A;  4N8X 1;  1VQ8 A;  2SOB A;  4EX5 A;  4JI7 L;  2FXQ A;  5I9O A;  4LFC Q;  2ATW A;  4A3I G;  3A5Z B;  1CA6 A;  4PZ8 A;  1ENA A;  1SYF A;  1Y8P B;  2NYZ D;  3CCV A;  1GD7 A;  2CVR A;  2PO4 A;  5ELB A;  3NWT A;  4DNT B;  1PDQ A;  4IPH A; 
#chains in the Genus database with same CATH homology
 5C44 H;  2N49 A;  3K0X A;  3J81 c;  2ALY B;  1VCI A;  1PH2 A;  3MEF A;  5C4X H;  1T9H A;  4YCV A;  5C0X G;  1JJC B;  1E1O A;  1X55 A;  4HIK A;  1XPO A;  2KEN A;  1I94 L;  4LF9 L;  3W1G A;  2IHE A;  1XNQ L;  1E1T A;  5E7N A;  2VQF Q;  2OWO A;  4A3F H;  1G29 1;  2YYZ A;  1KXL A;  4L5T A;  2A19 A;  2VQE L;  2XGT A;  4JI0 L;  1SLJ A;  5FLX c;  1P16 A;  4DR5 L;  1UEB A;  1PH8 A;  1VQG A;  4J15 A;  4APV A;  2NVT H;  3HOW H;  3UDX A;  2I5H A;  3HKS A;  2UXD L;  1NE3 A;  2E2H H;  1XPU A;  2K5H A;  3S1R H;  3H15 A;  2F3I A;  1S72 A;  1N32 L;  1SN8 A;  5C0X J;  1Z9F A;  1VQJ A;  3UE0 A;  1NJI C;  1KQS A;  4KHZ A;  4P72 A;  1HNZ Q;  2CWP A;  4HJ8 A;  1VQI A;  1S40 A;  4B3T Q;  3CMA A;  1WYD A;  4ALP A;  3JC6 6;  1EYG A;  1UE7 A;  4A93 H;  1GVP A;  1AE2 A;  2EQS A;  4OWW B;  3G6E A;  4KI0 A;  2KHI A;  4OWX B;  1Q86 C;  1QZG A;  1Q12 A;  4LFC L;  2GN5 A;  2CFM A;  4GN5 A;  2YTV A;  4JC0 A;  4B3M L;  3JAM i;  1A8V A;  2R7F A;  1B8A A;  4A3B G;  4GOP A;  1CKN B;  1YBY A;  1NY4 A;  2OTL A;  1TWH H;  3PO3 H;  4YY3 L;  1WCM G;  4YCW A;  5IP7 G;  3S14 H;  3KDF B;  3CC2 A;  4A3D H;  4JV5 L;  4UP7 A;  3HOX H;  1OXX K;  1YJN A;  1HNW L;  5K36 G;  1SFO H;  4LF6 Q;  3BZK A;  4C3J H;  5M3F H;  4IPC A;  3EIV A;  1BBW A;  4O0A A;  3TRZ A;  2VNU D;  4DR2 L;  1Y1V G;  2V1C C;  4MZ9 A;  2LXJ A;  4DV0 L;  4R4T A;  1GKH A;  1M1K C;  1XNR L;  2Q2I A;  1QUQ A;  5FJ8 G;  4TQU S;  4DR1 Q;  3K7U C;  4AQY Q;  4BBR H;  4NXN L;  2VQF L;  1EIY B;  3PO2 H;  5IYB H;  1K0R A;  5C3E G;  4DUZ Q;  4LFA L;  1A0I A;  3A0J A;  4Y7N H;  4NB3 A;  1E7Z A;  5IYC G;  3VDY A;  2RCN A;  2PNH A;  3RR5 A;  4PMW A;  1HR0 L;  1OXT A;  4LF8 Q;  4A3K G;  3GTP H;  1Q1E A;  3HOZ G;  4DV6 Q;  4PZ6 A;  4JI2 Q;  1HJP A;  4K0K Q;  1WI5 A;  2BA0 A;  4DV5 Q;  2R7Z G;  1K8G A;  3M85 A;  1TWA H;  3CCE A;  1IBM L;  5IYD H;  2CKZ B;  3F2D A;  1N34 Q;  4B3R Q;  4H02 A;  2JK8 A;  3PUZ A;  3OTO Q;  3U58 A;  1HNZ L;  5FLM G;  3I4M H;  4C3I H;  5JEA J;  3CPF A;  5IP9 G;  4B3T L;  4GN4 B;  4OON A;  1PVO A;  3F1Z A;  1VQA A;  4DR3 Q;  1VQ5 A;  4GKK L;  1YZ6 A;  1KAW A;  2HIV A;  1B7Y B;  4JYA Q;  3H3V H;  1LM0 A;  1X3G A;  2KCM A;  3M4Q A;  2NN6 G;  1Y14 B;  4DV7 L;  4X6A H;  3PGZ A;  3U4Z A;  5LMU Q;  1MJE A;  4JI5 Q;  3ULJ A;  5LMN L;  1VQO A;  4X64 L;  5IE8 A;  1I50 H;  4GOP B;  2JA6 G;  1VQD A;  2UUA L;  1SE8 A;  5ELN A;  4DV2 Q;  1NMG A;  5IY0 A;  3GTM H;  1B70 B;  5JJI A;  1NBW A;  2JQO A;  3E9H A;  4R4O A;  3STB C;  2E2I H;  4LFB Q;  3D31 A;  4POF A;  2UU9 Q;  3HOY G;  1N36 Q;  4BXX H;  4OXP A;  3GTJ H;  4OO1 I;  4AQY L;  1KRT A;  1LTL A;  4R4I A;  2AWN A;  4P73 A;  2NVQ H;  1I3Q H;  4XTC S;  1QUQ B;  5GAD C;  4DUZ L;  3CW2 C;  2KCT A;  4A3L H;  1KL9 A;  4LF8 L;  1VQC A;  4IJL A;  4RG1 A;  1K83 H;  2AWO A;  4A3J G;  3KJP A;  2R6G A;  4A4I A;  4BY1 H;  1KHI A;  2H5X A;  3TEH B;  4OX9 Q;  4HIO A;  3T1H Q;  1XMO Q;  1UE1 A;  4BBS G;  3RLO A;  1VQ4 A;  3K7A H;  4A3B H;  3TQY A;  1CKN A;  1N34 L;  1K8A C;  2IX0 A;  3LGJ A;  3UDI A;  2QEX A;  2ZM6 Q;  4GKJ Q;  4JBK A;  3AQQ A;  1D7Q A;  2D62 A;  2K5V A;  1WCM H;  3U50 C;  3KDF A;  1A62 A;  1HH2 P;  3E9I A;  5IP7 H;  4GNX B;  2HT1 A;  4A3E G;  2JEA I;  4A3M G;  2NZO A;  1OTC A;  2CWA A;  4DAM A;  5M5Y H;  3GD7 A;  2JA7 H;  3GTO H;  4JYA L;  4IO9 A;  3FKI H;  3HFZ B;  2B63 H;  4GS3 A;  1Y1V H;  2PI2 E;  1FJG Q;  1C9O A;  2Q2H A;  4JI1 Q;  3RLF A;  3PUX A;  4JI5 L;  1PH7 A;  4KHP L;  3J80 i;  4P74 A;  5FJ8 H;  2WFW A;  4QGU A;  1OXU A;  2JA8 G;  2N8N A;  4EQ5 A;  5GAE C;  3BU2 A;  3K80 C;  4AH6 A;  3JAM c;  5C3E H;  2LXK A;  4IJH A;  4DV2 L;  3H3V I;  1KIX A;  1CKM A;  3PIO A;  2UUB Q;  5IYC H;  3RN2 A;  1XMQ Q;  5C0X I;  2WAQ E;  3KJO A;  4A3K H;  4JI6 L;  3HOZ H;  4LFB L;  2UU9 L;  3J81 j;  1S3O A;  1N36 L;  1KRS A;  1U5K A;  3HOU G;  4DR4 L;  2R7Z H;  1J5E Q;  2K4K A;  3CC7 A;  4DUY L;  4NXM L;  4IOC A;  5HY6 A;  4TVA B;  3E0E A;  3H0G H;  1K73 C;  4X66 Q;  4YHH Q;  3PSI A;  5FLM H;  2JEB I;  4BA2 I;  2R92 G;  2K14 A;  4C3H H;  2MO1 A;  2Z0S A;  1VQ6 A;  4P75 A;  3CPW A;  1BBU A;  3NBH B;  3M7N A;  2A1A A;  1YHB A;  4R4C A;  3S2H H;  4DR7 Q;  2XTI A;  4B3S Q;  1X54 A;  2WB1 G;  1VQ7 A;  5C4J H;  2C35 B;  1VQP A;  2I0Q A;  2B3G A;  3J7A 5;  4HJ7 A;  4UP8 A;  2ZM6 L;  4DV3 Q;  1X9N A;  1Q46 A;  3GTQ H;  1P8L A;  1IXR A;  3NEL A;  4BY7 G;  1VQH A;  4RMF A;  2JA6 H;  4GOP C;  2HQL A;  1GO3 E;  4QY7 A;  1JJ2 A;  5DLQ E;  3U4V A;  1Q81 C;  3S1M H;  2UXD Q;  2IY5 B;  1SRO A;  1Q1B A;  2WB1 E;  3UDF A;  2E2J H;  2JA5 G;  3CXC A;  3HOY H;  1CUK A;  1N8R C;  1L2F A;  3AFP A;  1V1Q A;  1IBK Q;  2HIX A;  2R93 G;  3I55 A;  2D0O A;  4UY8 C;  5JEA G;  3RNU A;  3PF4 A;  2OCE A;  3TS2 A;  4WJ3 M;  3PUW A;  1PH6 A;  4A3C G;  4YWK A;  5EAY A;  3PCO B;  4UPA A;  3CME A;  1JB7 A;  1L1O B;  4JOI A;  3BZC A;  4JI3 Q;  1G6P A;  1E22 A;  4JOI C;  1BVS A;  3KF6 B;  1IL2 A;  4QQB X;  4IFD G;  1N9W A;  3WWV A;  3CCL A;  4X66 L;  2CQO A;  4YCU A;  3T1Y Q;  2PI2 A;  4A3I H;  4LF5 Q;  4GNX A;  4QIW E;  4GNX C;  3AFQ A;  4A3E H;  5C44 G;  5GRO A;  3TRE A;  2YTX A;  4O2D A;  3ULL A;  3GDE A;  1GM5 A;  1FVI A;  3RN5 A;  2PQA B;  4DR7 L;  4LNQ A;  4B3S L;  2AMC B;  4R4Q A;  3J7Z C;  1VQF A;  2MQH A;  4IOA A;  1O7I A;  2F4V Q;  3I2Z A;  3HKZ E;  1XTD A;  4DV4 Q;  1A63 A;  4AYB G;  1IBL Q;  4IFD J;  4AIM A;  4POG A;  1YEZ A;  1AE3 A;  1HZC A;  1W3S A;  3KYH C;  1HR0 W;  1Q82 C;  1QVF A;  4LF7 Q;  1AH9 A;  3CCS A;  4HID A;  5BR8 Q;  4JI7 Q;  2PMZ E;  2NN6 I;  5IWA Q;  4LUV A;  4LF6 L;  2ZJR A;  3L7Z C;  1K9M C;  2EIF A;  2GVA A;  4XIG S;  1PFS A;  4OWT B;  2Q2U A;  1MJC A;  3G48 A;  3HOU H;  1V9P A;  3A74 A;  1YHA A;  1YNX A;  4AYB E;  1X3F A;  1VS0 A;  3MXN B;  4QJF A;  1PH1 A;  5M5W H;  2Q2T A;  4DR1 L;  2HHH Q;  3ICE A;  3DLL A;  1H95 A;  1CKO A;  4DK3 C;  2UUC Q;  1X56 A;  4HJ5 A;  2VUM G;  1EWI A;  4JG2 A;  2ZJQ A;  4DAY B;  3UDG A;  3GTG H;  1PH4 A;  2NZH A;  1EUJ A;  4IPG A;  1JJG A;  1YI2 A;  4MTN A;  1RIP A;  2RF4 A;  4DV6 L;  5LMN W;  5H1S E;  1I94 Q;  4JI2 L;  3S1N H;  4K0K L;  4YWM A;  4JI8 Q;  4LF9 Q;  1EIF A;  4GLA C;  3K81 C;  4DV5 L;  3RZD H;  2E5L Q;  4JI4 Q;  1EQQ A;  1KC8 C;  3I4N G;  1YJW A;  3HOX G;  2VQE Q;  1R9T H;  1QVG A;  4JI0 Q;  4B3R L;  5JJK A;  3OYY A;  3OTO L;  3G71 A;  1E3P A;  1C7Y A;  2UXB Q;  3CCM A;  2AKW B;  2Z6K A;  4L5S A;  3IRB A;  4LWC A;  4DR3 L;  2NVX H;  3S17 H;  2UXC Q;  4PZ7 A;  5IT9 c;  2NVY H;  2JA5 H;  1NTG A;  4BBR G;  1PH3 A;  4DV4 L;  3F2C A;  1N32 Q;  2WAQ G;  2E8G A;  5IYB G;  4X65 Q;  3NEN A;  1IBL L;  3W5O A;  5LMU L;  3S1Q H;  2K52 A;  5GQO A;  1PH5 A;  3M3Y H;  1U0L A;  1YHQ A;  5BR8 L;  3CCJ A;  4WJ4 A;  2Y0S E;  1N33 Q;  4A3C H;  1L1O A;  3Q8D A;  4DPG A;  2CCZ A;  4B3M Q;  4DR6 Q;  1L1O C;  1X3E A;  1Q7Y C;  2K50 A;  2JJQ A;  3KF6 A;  5HGQ A;  1TWG H;  3PIP A;  4HJ9 A;  3I4O A;  1YJ9 A;  1UE6 A;  2MNA A;  2F52 A;  4YY3 Q;  3ULP A;  2HHH L;  1EOV A;  2K5N A;  1HNX Q;  2ZTC A;  2DGY A;  3CAM A;  3KF8 B;  3GTL H;  1HNW Q;  1JT8 A;  1HZB A;  1PYS B;  2VW9 A;  2N3S A;  3M9B A;  3L2P A;  2ZTD A;  4JCV E;  3ERS X;  5IP9 H;  3I56 A;  1WFQ A;  4DR2 Q;  1Y1W G;  2VZA A;  2QA4 A;  3FP9 A;  2PQA A;  1Z47 A;  2IHF A;  4JBJ A;  1UE5 A;  4DV0 Q;  1XNR Q;  4OX9 L;  4R1J A;  4JI8 L;  4A3G G;  4NPS A;  3T1H L;  3KLW A;  3B6Y A;  2E5L L;  4JI4 L;  1XMO L;  1CSP A;  4NXN Q;  3HOV G;  4A76 A;  1FL0 A;  2RHQ B;  3SGI A;  3CC4 A;  4LFA Q;  3EBE A;  4GKJ L;  1PV4 A;  4GLX A;  3CQZ H;  1PHJ A;  1HR0 Q;  2UXB L;  1RL2 A;  1VQE A;  2UXC L;  2LSS A;  2OQK A;  3GO5 A;  4DV1 Q;  1VQ9 A;  4BXX G;  3CCR A;  1TWC H;  3STB D;  5M3M G;  1VQM A;  1M90 C;  1OXV A;  3ZJY C;  4LUZ A;  2R7D A;  4LW1 A;  1FJG L;  1BKB A;  3NEM A;  4JI1 L;  4X65 L;  3W1B A;  1IBM Q;  1JMC A;  4LF4 Q;  3S16 H;  4A3L G;  3J81 i;  2JA9 A;  1X65 A;  3CF5 A;  4GKK Q;  1N33 L;  1VQL A;  4BY1 G;  2OQ0 A;  3TS0 A;  2VY3 A;  1EQR A;  2GVB A;  3PF5 A;  4DR6 L;  2YU9 H;  2UUB L;  2WP8 J;  4Y52 H;  4DV7 Q;  1XMQ L;  4A3J H;  2ZTE A;  4JBM A;  4DK6 C;  1K3R A;  1VQB A;  5LMN Q;  4HIM A;  2IT1 A;  1WJJ A;  1OXS C;  1C0A A;  4X64 Q;  3RZO H;  4X62 Q;  2B29 A;  1J5E L;  1HNX L;  2KBN A;  4BBS H;  1MIU A;  3I4N H;  5M5X H;  3PV0 A;  3OW2 A;  2UUA Q;  1VQN A;  2JA7 G;  4YHH L;  3HKZ G;  2B63 G;  1X6O A;  2L15 A;  3FKI G;  2N78 A;  2VL6 A;  2K75 A;  2VUM H;  2MFI A;  1D8L A;  4A3M H;  4LUO A;  4IFD I;  5GAG C;  1YIT A;  2ID0 A;  5C4X G;  1TWF H;  2MO0 A;  1YIJ A;  3AEV A;  5J3B A;  4DV3 L;  4L5R C;  4A3F G;  3UE1 A;  1HZ9 A;  2JA8 H;  1PA6 A;  3S2D H;  3BJU A;  5GAH C;  3AYH B;  3FHW A;  1WOC A;  1YVC A;  4DV1 L;  3HOW G;  1G51 A;  1SR3 A;  3F2B A;  1QVC A;  1L0W A;  4GLV B;  3G4S A;  4C2M H;  5AJ3 Q;  3CP0 A;  1PH9 A;  1XJV A;  1E24 A;  1LYL A;  3F8T A;  4JBW A;  3RLN A;  4KLK A;  3H0G G;  3I7F A;  2JE6 I;  2RHS B;  1I5F A;  3EN2 A;  2ZJP A;  1ASY A;  4LF4 L;  1SRU A;  2KHJ A;  3CD6 A;  4BA1 I;  1IBK L;  1W2B A;  4A93 G;  1FGU A;  4L5Q A;  1HZA A;  1Y1W H;  1J6Q A;  2R92 H;  2I5M X;  3ER0 A;  2OTJ A;  3PUV A;  3J80 c;  4HJA A;  2A8V A;  3D0F A;  2EXD A;  4A3G H;  1LUZ A;  1XPR A;  4KHP Q;  2DUD A;  4X62 L;  2ASB A;  4DKA C;  1SMX A;  3HOV H;  4MNO A;  2BH8 A;  3PUY A;  3S24 A;  3PO3 G;  2VS1 A;  3T1Y L;  4OO1 G;  1XNQ Q;  4ME3 A;  1IZ6 A;  3A5U A;  3KOJ A;  4LF5 L;  2AHO B;  4A3D G;  4UP9 A;  4BY7 H;  4YWL A;  4IPD A;  4JI6 Q;  3L0O A;  5M3F G;  4DR5 Q;  2IX1 A;  1DGS A;  1NMF A;  5M3M H;  4DR4 Q;  3CCQ A;  2Z6K C;  2I5L X;  3K8A A;  2Y0S G;  2D0P A;  3CCU A;  4DUY Q;  2YTY A;  1ASZ A;  4NXM Q;  3KFU A;  2YV5 A;  1KD1 C;  3M4P A;  5JJL A;  4A75 A;  1IYJ B;  2F4V L;  3PO2 G;  4DNI A;  3S15 H;  5ELO A;  1CSQ A;  2R93 H;  4FDB A;  4PG3 A;  2QGQ A;  2BH2 A;  1QZH A;  1VQ8 A;  4JI3 L;  1V43 A;  3DM3 A;  4LF7 L;  1Q8K A;  4EX5 A;  5AJ3 L;  4JI7 L;  2ES2 A;  5IWA L;  1PYB A;  2FXQ A;  2BA1 A;  1TXY A;  1JE5 A;  4LFC Q;  2ATW A;  4A3I G;  1I6H H;  3A5Z B;  1EFW A;  5IYD G;  4PZ8 A;  3GTK H;  3CCV A;  1VQK A;  4GN3 B;  3I4M G;  1GD7 A;  4P71 A;  4JV5 Q;  2UUC L;  1UWV A;  4QL5 A;  1MKH A;  4IPH A;  3M4O H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...