3VA5A

Crystal structure of staphylococcal nuclease variant delta+phs i92a/v23a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTAKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Pressure effects in proteins.
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3va5A00
3D6CA 5C3WA 1AEXA 2EYOA 3HEJA 4KD3A 4LAAA 5DAUA 3SXHA 3OSOA 3NK9A 5KGUA 2F0KA 4NMZA 1SYFA 2F0HA 3VA5A 1A3TA 5IGFA 3C1EA 5F2DA 3SK8A 1KDAA 2EYLA 3NXWA 4KD4A 3QOJA 1STNA 1F2MA 1NSNS 2HQEA 4H7BA 2EY6A 2RKSA 4KY7A 5HURA 5M9OA 5EGTA 4S3SA 2F3WA 4ZUIA 2EY1A 3EJIA 1JOKA 4HTHA 5NUCA 4EVOA 5JOBA 5J39A 3SK6A 4K2LA 3SK4A 5IGEA 4PNYA 2EXZA 2EYJA 2EYFA 4F8MA 2F0DA 4KJNA 3QB3A 1JOOA 5KIXA 1SYEA 2EY2A 4OL7A 5CV5A 4E6IA 2F0JA 4NP5A 2F0QA 4MIUA 1SYDA 3NQTA 2F0EA 2F0VA 4IUNA 3SHLA 4K5WA 1KAAA 5IGCA 3HZXA 5E3FA 1IHZA 1EY4A 2QDBA 2LKVA 3E5SA 2RDFA 2PZWA 1SYBA 1SNQA 2EYPA 3TMEA 1STGA 2F3VA 3T16A 5CGKA 5C5MA 1EY7A 4ME5A 5EKKA 4RKLA 3U9OA 3MEHA 5CV9A 2F0LA 4J6HA 1SNDA 2PW5A 3EVQA 2PQEA 1A3VA 4N9TA 1TT2A 5C6AA 5HGTA 3T13A 5IGDA 1STBA 4DGZA 5CV8A 1SNMA 4K5VA 4J1MA 3EROA 4HMJA 3MZ5A 1A3UA 4RKBA 5CV6A 2F0TA 4YIJA 4G57A 3C1FA 3MHBA 5EKLA 2OF1A 5JAVA 1EY8A 2RBMA 5IGBA 3P1HA 3TP6A 1RKNA 1U9RA 4WRDA 3TP5A 5C4ZA 1KABA 2F0WA 3QOLA 5CV7A 4EQOA 2O4XA 3P75A 2SNMA 5C5LA 1JORA 2EY5A 2M00A 4K5XA 5CR3A 3ITPA 4K14A 4EQNA 5IOCA 4WORA 1EZ8A 2F0IA 2PZUA 5I6YA 1NUCA 4KY6A 3SK5A 1EYDA 2SNSA 5C3XA 1STHA 5KYLA 2ENBA 1A2TA 3DMUA 5IGGA 3S9WA 5KRUA 2KHSA 4K6DA 1II3A 1SNOA 2F0NA 1EYAA 4KHVA 5E1FA 1EY9A 4ZQ3A 2F0FA 4NDXA 4B9WA 2F0GA 3OMCA 4K8JA 4QF4A 3OMGA 5I9OA 5C4HA 3D8GA 1SYGA 2SOBA 3D4DA 1STYA 4I65A 4DF7A 1JOQA 1EY5A 1EQVA 3SR1A 4KV6A 2PW7A 3ERQA 2OXPA 5IODA 3LX0A 2WACA 3OWFA 2F0OA 4KTAA 4KJOA 3BDLA 4DU9A 4ID6A 4QMGA 5I9PA 4PMCA 1KDBA 3PMFA 1A2UA 4IZ8A 4K2KA 5J22A 1SYCA 2F0PA 1EY0A 1STAA 2OEOA 1SNPA 5ISRA 3DHQA 4R8NA 3V2TA 3D4WA 1ENAA 4IALA 4ODGA 5DEHA 4ZUJA 4DFAA 5I6WA 5KYIA 3NP8A 2KQ3A 5IIFA 4EQPA 5K5PA 2PYKA 3MXPA 3BDCA 4N9PA 4QB4A 4F7XA 3RUZA 3H6MA 1TQOA 3NUCA 1KDCA 1SNCA 1EY6A 5KEEA 1TR5A 2F0MA 2PZTA 4HMIA 4K8IA 4KY5A 4PMBA 1EYCA 1F2YA 3R3OA 4TRDA 3TP7A 4B9XA 5CC4A 3NHHA 5CV4A 1EZ6A 2F0SA 2F0UA 1ENCA 4NKLA 5J1ZA 3TP8A 1F2ZA 2EYHA 2EYMA 2NUCA 3MVVA
chains in the Genus database with same CATH superfamily
5BN5A 5LMUL 2NZ1D 2ZXRA 4FDBA 4DR5L 2VNUD 3E9IA 1AZPA 1JB7A 4JI7L 2K5VA 1K83B 3S2DB 1SE4A 3J81L 1BCPC 1BDOA 1DONA 4EVOA 4LWCA 1D6EC 4F87A 4PNYA 1EWHA 5KIXA 1RODA 4A3EG 5GAGC 1CQVA 2RSNA 2MFIA 4K0KQ 1HNWL 2UXBL 4DUYQ 1VMCA 5C4JB 3HZXA 4R1JA 4C3IH 1S5CD 4GLVB 3PF5A 4JOIC 1QNKA 4JI6L 1O7YA 3RLOA 4ME5A 1EU4A 1MJCA 2AHOB 4DV6Q 4LUOA 4JI5L 4N8FA 1ZKOA 4DGZA 4UPAA 1T9HA 1PVOA 5EPLA 2MP1A 5IYCG 3UDIA 4OIKA 3CCJA 1J5EL 5HY6A 2IX0A 1KAWA 4DR3L 5EKIA 1SMYD 2VXWA 4OELB 3CQZH 1W6KA 4C56C 3RLFA 1EZ8A 3CC2A 3FVQA 1WFQA 4WJWA 1SFOH 3L9AX 4DAYB 5KRUA 1AP0A 2QILA 1X55A 4C1NK 1CA6A 2WB1B 1EYAA 4KHVA 3A5UA 2FFKB 3CCRA 3BVGA 1Q7YC 2O2LD 5IP7G 1SYGA 4DR1L 4DF7A 2IWHA 1I94L 2RHSB 2N88A 3RMHA 5DLQE 2ALYB 5TSSA 3CRLC 4DV3Q 1JICA 4DU9A 2NN6G 2VB3X 3UDGA 1KDBA 1CHQD 5DM73 1ZEQX 5COYA 4HR7B 1O7LA 3S1MB 4XDXA 2XNAC 4ZUJA 5KYIA 3CU7A 3NP8A 1HRJA 2J0TD 3I72A 4LNQA 1QVFA 4DK6C 1K8GA 2HD3A 1I4XA 3L2PA 2K03A 2Z6KC 3OTOQ 4HJ9A 2I5LX 4NKLA 3PO3H 3A56A 1UWVA 3QWNA 2NTTA 3EBEA 4A3EH 2YV5A 3BG3A 2EIFA 3T1HL 3GTLH 2QKIC 3C1EA 4C3JG 1EYGA 1VQPA 2EY6A 4FXKC 5HURA 4LF5L 5FO9B 4S3SA 1VQ6A 1PMRA 4A3FG 3E0JA 5IGEA 2B63B 3VYUA 1E7ZA 1OXUA 2KVMA 4KHPL 4B3RQ 2XSCA 1WOCA 3QB3A 1XYIA 1BXTA 1L0YB 3HP3A 3J80c 3F2BA 1OXSC 2EDGA 4MIUA 3MEFA 3HOYG 2E75C 5M5YB 4L63B 5IYCH 3K58A 4ULLA 5I2YA 1L1OB 2RA4A 2VQFL 2EYPA 2HHHL 4JI8Q 2F0LA 1R9TH 1E24A 1V1QA 5CV8A 2ZTCA 5FLXE 2BH2A 4RKBA 4CDCC 5CV6A 4YIJA 5JAVA 5IWAL 2KENA 2GN5A 1WVLA 1Q86C 2EY5A 2GA4B 3RNUA 5CR3A 1A6XA 4DV7Q 4YCVA 3ULPA 2NN6H 1NUCA 1STHA 2Z6KA 4U68A 1Q12A 3E6ZX 5IYDG 4DV1L 1II3A 1SNOA 1VQGA 1IYUA 1Z6HA 2CW0D 1G91A 2R61A 2MUYA 2JK8A 3D8GA 4A3IH 2WKDA 3KF6A 3BS1A 4O42A 1N33L 2OXPA 4FP5D 1PRTC 1Y1WB 4TQUS 1VQ7A 1B9MA 1SE2A 2L55A 4CKCA 1VDZA 4DR4L 3G6JB 1N34L 3FEWX 1PTOB 4WFN3 4DFAA 2JA7G 3A0JA 5EQ0A 4QGUA 4LFBL 1HZCA 5LL6X 4JVZA 2ZTDA 3BVMA 4N9PA 5AFWA 3GTQB 3H6MA 4KN7C 1XMOQ 3TBIB 4NXMQ 5FKAC 1JWMD 2RSOA 1SJHD 4GLAC 4B08A 5JEAG 1BUVT 4HCSA 4RGTA 1F9PA 2K33A 5J1ZA 3M85A 1VQNA 1RJTA 1BBXC 4A3BB 1DZ1A 3D6CA 1UE1A 2F52A 1XXGA 1Y14B 5LHY1 3HOYH 3NBHA 1A3TA 1GHKA 2Q2IA 3K80C 3SVMA 1X9NA 3VYTA 3C2PA 2QCPX 4YWMA 2XWJB 2EJGC 1EFID 3RN5A 2MNAA 4DR6L 4C2MB 1NMGA 3FRPB 1FNVA 1WCMH 2K50A 4DUZL 3HOWG 3CPWA 1SE3A 1VQBA 5CV5A 1TS5A 4LMQD 2FMMA 4U673 1TS2A 2VZAA 4FF1A 3A74A 1LTBD 3KLRA 2IX1A 2D62A 3HG9A 4NXNL 2Y0SE 3MXNA 3T16A 3AB9A 1WYDA 4RCNA 1WJJA 5G3LF 2QA4A 4B3TL 1A3VA 4QY7A 1GD7A 3KBGA 4BWGB 2K04A 4IUPA 3C3LA 4HMJA 3JAMi 5C0XJ 1F9RA 3M4PA 4QL5A 1VQFA 1CI3M 2K5QA 4XIGS 1I50H 3KYHC 4A3JB 1CFMA 2F03A 5EPJA 4HN7A 3U4ZA 4K5XA 4X66Q 1EQQA 1EUJA 4A93H 1UE5A 3H0GH 1MIUA 3FKIB 1QE6A 2JA7H 3S2HB 2F0NA 4IN3A 1MSHA 1BBWA 2G5DA 4RAUC 3CCMA 1JE5A 4UP9A 5KNCA 3ERQA 1B8AA 3T1YQ 1SBBB 4QMGA 1GUOA 2AWNA 1CTMA 2AWOA 2F4VQ 2PO4A 4GZYC 3SE0A 3KUPA 1K83H 3DHQA 3S2DH 1SR3A 1H9JA 4ME3A 2WAQG 2Z9HA 5C0XI 1XPOA 4HSVA 1LACA 2CVRA 4CGYB 2UXCQ 3R3OA 4K0KL 4XQNA 4DUYL 4L8JA 5C4JH 2VY3A 4P72A 4AYBB 2F0KA 4DV6L 1X6OA 1KDAA 2A69C 2CKZB 1J5EQ 2EE1A 1LYLA 1STNA 5KNBA 4Y7NB 3K59A 1GM5A 2F3WA 3AFPA 2IPKD 3A7AB 2LY7A 3PV0A 1WD1A 1E0BA 2UXDQ 5ELNA 2C9OA 2EYJA 1K73C 1QOHA 1BNZA 3NQTA 2K05A 3J7YW 2F0EA 3A54A 3Q22A 1JJ2A 1K3RA 5FLMG 2DJFC 1WTPA 5T1GA 4KHZA 1IBLQ 1B3AA 3U9OA 2WB1E 1SJED 1CKMA 1R4QB 1O80A 2YYZA 1O7IA 3T13A 1CM9A 4YWKA 4XT1B 2HIXA 3A55A 1VF7A 4DV3L 1GO3E 3CKIB 1W6JA 2OF1A 4LK1C 1PTOD 3P1HA 1RKNA 1U4LA 2RF4A 3S1MH 3K5OA 4J15A 4OONA 4O0AA 4A3KG 4ILWA 3K7AB 2K5HA 4HJ8A 4FF3A 3AQQA 3FPUB 1IBKQ 4LF7Q 1IL2A 3G48A 3OTOL 1Y1WG 2JA6B 3OIPA 3U4VA 1LTAD 4QUCA 4ZLTF 1P8LA 4GNXA 2ZTEA 3TEHB 1RIPA 1KC8C 4A3MB 1Q90A 1C8CA 1KNEA 2E2DC 3OPOA 3T56B 4Q5VA 4K2KA 2R93H 4IO9A 1SNPA 5BN3A 3N6RA 4IALA 3T4AC 1CT1D 1RF2D 2B63H 3VYSA 4QB4A 3E3XA 3M3YB 4B3RL 3RUZA 2ZM6Q 4A3BG 2ID0A 4TRDA 2KJXA 2B3GA 3I70A 1GUSA 3LWEA 4B3SQ 1YNND 3MXUA 1QZHA 2QEJC 2NUCA 2EYOA 2L9HA 4HIOA 3NK9A 3J80i 4KN4C 4CBVA 4JI8L 1ZYRC 2YTYA 3IL8A 3KF8A 5FLMH 2OCEA 3H3VH 4OEMB 1I3QB 4MTNA 2Z4IA 3G71A 3PIOA 5J39A 2H1EA 1EL0A 4LFCQ 2ZXPA 4K2LA 2TMPA 2OWOA 3GV3A 4A3LG 3CC4A 3URYA 3GTKB 3U9SA 1Y8NB 4A3DB 4NP5A 2X6GA 1P16A 4DV7L 3HOZG 2YU9B 1IW7C 4NB3A 1U4RA 5CGKA 1STGA 4IFDG 1GKHA 3S15B 4DK0A 1N34Q 2I07B 4P73A 2XTIA 3STBD 3NTHA 4A3JG 1MGSA 1U4MA 1Y1WH 2E76C 1HFGA 3MHBA 1MD2D 1PYWD 1WTHA 3DLLA 3EN2A 1PZID 1QCBD 3FKIG 1X54A 4FVMA 1PTOH 4EQOA 3TRZA 4K14A 1RDPD 3K5NA 1UEBA 3WOEA 1XMOL 1EIFA 3GTQH 5BN4A 4NXML 1HFNA 4IJHA 2PCFB 1EEFD 1ET6A 4FYDA 5JJIA 4RCOA 1FNUA 2R3ZA 4H44C 3OHXC 1FJGQ 2RVLA 1CUKA 3TSSA 3S14B 2L5TA 4QF4A 4UDUC 1GXDC 4A3BH 2SOBA 3D4DA 1JWUD 3GP7A 3KDFA 2PW7A 1NAPA 5D3IB 1BVSA 2BE5C 4KJOA 1LO5D 3DWQA 3CC7A 2CHBD 1CKOA 3EFXD 1ENAA 2B2UA 1YZ6A 5I6WA 3BYTB 2KQ3A 4C2MH 5M5WB 1VQ8A 5E7NA 1TU2B 3DWPA 4CDFC 3MXNB 5IE8A 2K32A 4EX5A 3MWYW 5JPNC 5KEEA 4PMBA 1EQTA 2O5JC 5JVH3 1F2LA 2QF7A 4A3LH 1F9QA 1QVGA 1B7YB 3L3OC 5EPKA 4X3KA 4BA2I 5M5XB 1BCPD 2Z6BA 3MFGA 1YBYA 1G8ZD 1HPCA 1O78A 1MBYA 3VR3A 1OXTA 5IGFA 3ICEA 2CQOA 4H02A 4KY7A 4Q0FA 5EGTA 1PRTF 1EOVA 4OHJA 1LM0A 5EBDA 3RLNA 3HGBA 4IFDH 3MFYA 3HOXB 3RR5A 1MI2A 5JJLA 4GOPB 5JJZA 3PCOB 1Q8KA 1BR9A 2N3SA 2I0QA 1ICFB 3J81E 1E22A 2F0JA 1X3PA 1MJEA 1B70B 4X66L 1UE7A 4UP8A 3HOUB 5BR8Q 5IT9c 1CQFA 4LF6Q 1WTWA 1X3GA 3AFQA 2JP1A 3FKIH 4CDDC 2K28A 1EY7A 1FYCA 3S2HH 1U0LA 1Y8PB 2WP8J 3EVQA 2PQEA 2A6ED 5H1SE 3EROA 1K0RA 3EA6A 3HKZB 5GROA 3PO3G 3T1YL 1DM0B 1YHBA 1EIYB 3PUXA 5FLXc 2F4VL 1NNXA 1GUTA 5CV7A 4JI1Q 1E2WA 2CFMA 1C0AA 1GUWA 4LF8Q 4DR2Q 2R7FA 3K8AA 5KYLA 2G9DA 1LTSD 2LMCB 2F1MA 3UI2A 2UXCL 3N52A 4A3MG 1DOKA 2ATWA 4NDXA 4JI4Q 4CJ1B 4AYBE 4ZK9B 1X3EA 1FR3A 4KTAA 1QNUA 3A8KE 3AMUA 5I9PA 4IZ8A 2JSOA 4Y7NH 1VQKA 2UXDL 1SXTA 2UUCQ 5K5PA 3ER0A 3BDCA 1M8AA 3NE5B 5HGQA 3A8JE 4F7XA 4HJ5A 4HIKA 1PFBA 2WINB 3DEPA 4FXGC 1EYCA 4IJLA 3AYHB 2M2LA 2MHVA 4X64Q 4L6TB 1YJWA 3I7FA 3HEJA 1EIHA 1ICWA 1YNXA 2NVYB 3RN2A 1IBLL 5C4XB 1VMPA 2JA5B 1RCVD 2IW3A 2EYLA 4PQXA 4RFBA 1I4RA 1TIID 2K1BA 5M9OA 1I6VC 1JOKA 4A3IG 1QZGA 4DV5Q 1LTGD 2D2CC 2ZXOA 4F88A 4E6IA 1FNWA 3HKSA 2EQSA 2PQAB 1YJNA 4C1NI 1N36Q 3LWUA 3PF4A 3K7AH 1CSPA 4YY3Q 3JAME 3K5MA 2AQ1B 1IBKL 4LF7L 5EAYA 2NVQB 4RKLA 2R93B 2B2WC 3CW2C 3MEHA 3IFDA 1SNDA 4KKSA 2JA6H 1SMYC 3J7AF 1PFMA 2VQEQ 2KBNA 2X69A 4A3MH 3O13A 1MSGA 2DUDA 1TY2A 3QR8A 3JAML 3HFZB 4TKOB 4IURA 5IY0A 2BA0A 2UU9L 4LUVA 3TS0A 4PZ7A 4RGOS 1SAPA 2RDHA 3B6YA 3ITPA 2XWBB 3CHBD 5C3EB 2KHIA 5I6YA 2NWGA 1EYDA 2SNSA 2ZM6L 3M3YH 1LT6D 2FMCA 2NZHA 2KHSA 1FD7D 3DM1A 4FXDA 4ZYSA 1J6QA 4B3SL 5E4WC 1IYJB 1WCMG 3NBIA 4QJFA 1N9WA 1PA6A 5C4HA 2JE6I 4FO2A 2NN6I 1CKNA 2IHEA 3NEMA 4RH6A 5M3MB 5GADC 2B2YC 2WACA 3NTIA 1RTOA 2ZJPA 1OXVA 3MTSA 2Y0SG 4GLXA 3I4NB 3EQLC 1I3QH 3CCEA 4LFCL 1LT4D 4KK7A 4R4QA 1NR2A 2LXJA 4RG1A 1K8OA 5IYBG 3BZKA 1SMXA 2EOTA 3M7GA 4XTCS 3GTKH 2EPBA 4A3DH 4K8IA 3M7NA 1V9PA 1NY4A 2HDMA 2QDLA 3BZCA 5J3BA 2YU9H 3PO2B 2EYHA 2B2WA 1SDFA 1XNRQ 4KD3A 3C46A 3IRBA 1EWIA 1X32A 3I4MB 2VUMB 4V0BA 3P20A 3Q6SA 1ASZA 2OQKA 4JI3Q 3HOXG 1E3PA 2Q8RE 4A93G 3H0GG 4KD4A 3S15H 2RKSA 1NMFA 2A74C 2KCMA 2JA8B 1RHPA 4DV2Q 1HNZQ 4I7AA 2OTJA 1UUPA 1HR0W 3P7JA 1HUMA 2CWPA 3W2DA 4AIMA 4LF9Q 1U5KA 2C35B 4P71A 3SDZA 1G2SA 1EU3A 4OGQC 1VQ9A 3L7ZC 3QJYA 2RDFA 5GQOA 3KLWA 1YJ9A 1XPUA 2QGQA 1TWCB 4ZKCB 1IXRA 2FHTA 1TWAB 1FJGL 1N32Q 2B2YA 3S14H 4MHEA 1V1PA 1XTDA 1SROA 4GKJQ 4DXGA 4X6AH 2P5ZX 5JEAJ 4G57A 1VQEA 4XYOA 3CCSA 5FO8B 1RD9D 1AH9A 2CW0C 2O4XA 1W3SA 3MC0B 5C5LA 5M5WH 3I55A 2H4OA 1S40A 1QJOA 2WIIB 2MGSA 4IOAA 2LSSA 4TSSA 5GAEC 4JV5Q 4GN5A 5CBEE 4DK3C 2HT1A 2NBFA 4A4IA 1O7ZA 4WJ3M 4B9WA 3OMCA 2PI2A 2HUGA 5IYBH 2D0OA 1VS0A 1JOQA 5M5XH 1JJGA 4JBKA 3ZYYX 1WD0A 1WTVA 1JC7A 4P2CB 2LFNA 2K5NA 2HIVA 3V2TA 2WB1G 2V1CC 2I5MX 1QB5D 3GTPB 3HOXH 1JWSD 5ELEA 3KBXA 1VQOA 3J80E 4DN4M 3W1BA 4R4TA 2PZTA 1ASYA 2FINB 2A69D 2VL6A 4G7OC 2JA5G 4A3GB 3VYRA 1GUGA 5BR8L 4LF6L 3HOUH 2EYMA 1JB3A 1LUZA 3K81C 1AEXA 1QWYA 5ELCA 1HXYD 5F2DA 3Q24A 3NXWA 4PV1C 5LMNQ 3J80L 1E2ZA 1F2MA 2L0CA 3CPFA 2Q8IB 5A2QE 4QQBX 2R92B 1HA6A 1PH5A 3HKZE 2E2HB 1B9NA 1I4QA 5K36G 3JC66 3UDXA 2HDLA 5ELDA 1ILPA 1SYEA 4JI1L 4XXEA 4OIJA 2H5XA 4IUNA 3HRZC 2R93G 4LF8L 1OO9B 5IGCA 4DR2L 3R8BA 2LKVA 2DGYA 5A2QL 4X3TA 1PXUA 2F4IA 4IPCA 5C5MA 2B63G 2RHQB 3PUVA 4GNXC 4YHHQ 4WJ4A 4QCLA 4JI4L 5HGTA 4IUVA 3PIP3 2XIWA 3TS2A 4OO1G 1YHAA 2MO0A 3J7A5 2D5DA 3CCQA 1A3UA 1B44D 2IX3A 2AUKA 4LW1A 2ZJRA 1HJPA 4JBMA 4A3CG 1MHWC 3D6WA 3SGIA 3TP6A 4WRDA 3S1QB 3V05A 2A6HC 2E74C 2UUCL 3OYYA 4DV0Q 2ICEC 5D3DA 4P74A 1KQSA 1SN8A 1HTLD 2C5CA 3QG1A 1BCPB 3G6EA 5M3MG 2ZJQA 4X64L 4BY7B 2CQAA 3J7AV 1PH1A 1EY5A 4UY8C 1Y1VB 4KV6A 2NVYH 5EJWA 5C4XH 3RZOB 2JA5H 3FMCA 1Z9FA 5ELBA 4ID6A 3AU7A 4DAYA 3PUYA 5J22A 4JYAQ 1H9KA 3OWEB 5ISRA 1AN8A 1UNSA 1L1OC 4ODGA 5DEHA 3VA7A 1EWCA 4DV5L 3MAQA 4PZ6A 3PO2G 1X3QA 1XTCD 4JG2A 1HNXQ 2K01A 4IPHA 2YTXA 1Y8OB 1T5EA 1N36L 1VQIA 3K5LA 2ASBA 4RWSC 1GOZA 3GTMB 5K36H 4YY3L 1FGBD 2KCTA 1ZXTA 4HEDA 4XQQA 2JA8G 1H9MA 4NMZA 4BY1B 1SYFA 3RZDB 2NVTB 2NVQH 3DEOA 1PYBA 3TZUA 2UU9Q 2HCIA 4QUFA 2VQEL 4XT3B 2B8GA 4KMUC 4O1NA 5G3LD 2I46A 1IW7D 2F0DA 1B2TA 2QEXA 4OO1H 1JOOA 3I3CA 2EY2A 2UUBQ 3H3VI 4BXXH 3NTKA 3U50C 3F2CA 3J81c 4MZ9A 5C3EH 4A3CH 3G7LA 3BU2A 3F2UA 3OIQA 3CXCA 5I4DA 4R4IA 1I6HB 1PTOC 5EKKA 1H95A 1OXXK 3DUZA 1S3OA 4J6HA 3MA2B 4KKTA 2JYOA 4K5VA 1WTOA 5M3MH 1VQDA 4JI0Q 2B2UC 1PH6A 2L4NA 1L1OA 3I4NH 1ONLA 3TP5A 4JCVE 4OWTB 1PDQA 5C4ZA 3KF6B 4EQNA 1S72A 1STEA 5IOCA 1LT5D 1JCKB 4KY6A 4YCUA 3SK5A 1F9SA 3E9HA 2AQ3B 3UE0A 5I2XA 2BE5D 1HQMC 1WTXA 2NZOA 2F0GA 5I9OA 1RL2A 2XGTA 3TZDA 3PO2H 2L15A 2WV6D 1XNRL 3T53B 1BQQT 2PNHA 4LF4Q 2FXQA 2A68C 1K9MC 1DGSA 2N49A 2VUMH 3OWFA 3I4MH 4KLKA 4JI3L 3H94A 4CJ2C 2E2IB 1I5FA 2MO1A 4DV2L 4R8IA 1YNNC 4R8NA 1HNZL 2JA8H 4IFDJ 1CSQA 1VCIA 3GTJH 1DJRD 2A73B 3NBHB 1E1OA 1CZGA 4C3JB 1X65A 1PH7A 1D2BA 1TQOA 3GV6A 4LF9L 4KY5A 3FPPA 3BJUA 3FHWA 1TWHB 4CJ0B 1SSOA 4POFA 4A3FB 3NSWA 4LFAQ 2NTSA 2V4DA 4K5WA 1YNJC 4FF4A 2XRQD 4GS3A 1TWCH 1TXYA 1TWAH 2KHJA 1N32L 4JK1C 1X56A 4DXFA 1BOSA 4GKJL 3W1GA 1YI2A 2KEEA 3GTOB 1ENFA 4XQJA 3ZJYC 4KJNA 4AYBG 3K6OA 4A75A 1PRTB 2B2TC 2RCFA 1XMQQ 4IQZA 3IKJA 4GN4B 2M9VA 4BA1I 2F0VA 3STBC 1LLRD 4IFDI 3F1ZA 1C4QA 3E5SA 1J8IA 1EOTA 2K7VA 2Q2HA 3CCUA 4JV5L 1DCZA 2AUJD 4ABNA 5CYUA 3Q23A 1BO0A 4IOCA 3BVZA 4ZRZA 2IHFA 2Q2TA 1E2VA 3A8IE 3WOFA 3NWSA 1TWFB 4BBRB 5CMDA 2PMZB 1TWGB 3V96A 1KABA 1LTID 3T51B 1HQRD 1KXLA 3K7UC 1YHQA 3GTPH 2TSSA 3CCVA 1M90C 2KEDA 4BY7G 3KOJA 1PH3A 1VQHA 2OTLA 4IUUA 3NWTA 1ET9A 3NQIA 5T1IA 3VR2A 1JT8A 1Y1VG 2J4XA 5C44B 1QILA 4ZQ3A 2F0FA 4A3GH 5CBAE 2N78A 1GJXA 3SR1A 1IKLA 1K8AC 5LMNL 2BA1A 1A15A 4PMCA 3VDYA 3I8ZA 2F0PA 2B2VC 2UUAQ 2JXMB 2EZVA 3I73A 2A1AA 2R92H 2R7ZB 2JA6G 1F77A 2B2TA 2E2HH 2XRSD 2PYKA 2G9HD 4KKUA 1I4GA 1PZKD 1PYSB 1F2YA 3GQBA 4Z9CB 4BY1G 3PUWA 4K6LA 4ZAIA 2K75A 3LNNA 2OQ0A 4LAAA 4CDEC 3OSOA 1PHJA 3ERSX 2D0PA 3HOWB 3CCLA 3M4OH 2F0HA 1KLUD 3GTGB 3QO2A 3VA5A 4L5TA 4YHHL 4G7HC 5DNFA 4FNFA 2DNCA 5ELFA 5FJ8H 4P75A 3M4YA 1Q81C 1A8VA 4DA2A 1T5XD 4DKAC 3X3NA 5JOBA 3SK6A 4LJZC 3CD6A 2EXZA 4F8MA 1KNAA 1A63A 1HR0Q 2A8VA 4DNIA 3S1QH 2CH4W 4R4CA 1M4VA 4DV0L 4POGA 3CMAA 2A6EC 3R93A 3SHLA 1KAAA 2JEAI 5E3FA 4GKKQ 1A62A 4H0LC 1SYBA 4DV4Q 5JVG3 1PH4A 2N55A 1G51A 4BY7H 3CAMA 5FOBB 2WKCA 1K3BC 1Q1BA 4JBJA 5DM63 4A3DG 2B29A 2BDNA 4J1MA 1Y1VH 3ND9A 4EQ5A 2B2VA 3PSIA 3RZOH 3A5ZB 1DYQA 2L1BA 1UE6A 5EKLA 2DJGC 1ILQA 4JYAL 3Q8DA 2IL8A 3GDEA 1HHVA 1PV4A 3PGZA 3P75A 3ULLA 1HZ9A 4GNXB 1EEID 1D5XC 1HNXL 3D31A 2Q8TA 4DR7Q 1AE3A 4IPGA 4DPGA 3S9WA 1JE4A 1HCZA 1EY9A 3GTMH 3OMGA 2X6LA 4RGMA 4NW2A 4EGVA 4JOIA 3H15A 1VF5C 1H9SA 2WAQB 4BY1H 5AJ3Q 3RZDH 2NVTH 2HCCA 3BDLA 2N8NA 1M1KC 1EIGA 3ULJA 2OEOA 1NCVA 3ND8A 1XPRA 1KRTA 5IIFA 3DXJC 3S24A 3UDFA 3MXPA 5ELOA 1PRTD 1YEZA 1KD1C 3KF8B 2KCCA 2K6AA 2NYZD 1TR5A 1C7YA 2Z0SA 3BYYB 2UUBL 1V43A 1A0IA 2IJ0A 1IZ6A 1G6PA 3NHHA 1LT3D 5IT9E 4DAPA 1QUQA 2LS01 3U58A 3TQYA 3MVVA 1KTKA 4OX9Q 3SXHA 5KGUA 2B39A 1Q8IA 1TS3A 2IY5B 4AQYQ 3HOVB 1I6HH 4C3HB 4JI2Q 3H91A 3J81i 2EJMA 1XJVA 1NSNS 4HAEA 2J7ZA 3IFTA 2NB0A 1WTQA 3W5OA 4JI0L 5IT9L 3K0XA 4GN3B 2EJFC 2E2JB 1GUNA 4IPDA 3WWVA 5IP7H 3VR5A 2MPMA 4PZ8A 2VB2X 3UE1A 1FVIA 4DNTB 2QDBA 1EY4A 1V8QA 1UEAB 4HSPA 1ML0D 2XVSA 2Q2UA 1EQRA 2F3VA 3I91A 4DAMA 1HUNA 4BBRG 2Z1CA 5FLXL 5L37A 1PH9A 2EXDA 1CHPD 5C6AA 1TT2A 4A3KB 5IGDA 3GTJB 4LF4L 1B3QA 4RMFA 1SNMA 3BDOA 3HOUG 2E2IH 3S16B 3AEVA 1PFSA 1EY8A 2CH4A 2E5LL 1K0SA 1SEBD 3W3AA 3PIPA 2SNMA 3LGJA 3NPPA 5M3FB 5E4XA 1FGUA 3KDFB 5C44G 1IBMQ 1JR0D 4X65Q 1D1IA 5JJKA 3K0YA 4C3JH 2FJ2A 5C3XA 4DAVA 4IUTA 3HKZG 3J7ZC 1CK1A 4LFAL 1TWHH 1SRUA 5E1FA 3ONAB 3J81j 4A3FH 3E0EA 4GOPC 2NVXB 2ICIA 1STYA 4JBWA 1EQVA 1PTOF 4ZCKA 3G4SA 2VS1A 1PZJD 4B3MQ 2R7ZG 4L5RC 1B53A 4OWXB 1A2UA 1DXMA 1I4PA 4HJAA 1AW7A 1PLFA 1VQMA 3D4WA 2K5DA 4MTKA 4OXPA 3GTOH 1K8MA 4QIWE 1QVCA 1KL9A 1EY6A 1RTNA 1XMQL 1S5FD 3S1RB 3S1NB 3VR4A 1ENCA 5C0XG 2PI2E 4CKEA 4X62Q 2BOSA 2KUMA 1NR4A 4BBSB 1VQAA 5C3WA 1D1KA 1H9RA 1CZWA 1Q46A 2EVBA 2K14A 3QOJA 4H7BA 3HOZB 1FL0A 3R2TA 2KECA 1XNQQ 3S17B 2VW9A 5NUCA 4HTHA 1TWFH 4BBRH 5IYDH 1AE2A 1ESRA 3SK4A 2MJ8A 4JC0A 2KCNA 1LTRD 2EYFA 2PMZE 2WFWA 4M1UB 3KK7A 1I4HA 2L12A 5C4XG 2JN4A 4UP7A 1TWGH 1ESFA 5KNDA 3M4QA 4G4KA 4JPBW 4CKBA 5JPMC 1HH2P 1IHZA 4Y52H 2K4KA 2PZWA 2IT1A 1SNQA 5LMUQ 4GOPA 1XX8A 2GVBA 3DM3A 5C44H 4DR5Q 2PW5A 4YCWA 2A6HD 4JI7Q 3MXGA 4H13C 1L2FA 1K28A 5A35A 2F0TA 3TDQA 3I90A 2KOLA 5JEAH 2RBMA 1D5ZC 3QIAA 2UUAL 4RHRA 4AH6A 2Z4HA 3QOLA 3OW7A 2R7ZH 1HNWQ 2UXBQ 3HS0C 4PG3A 5LL6S 3M4OB 4C3IB 1YVCA 2K5WA 4JI6Q 2AKWB 1AFPA 3NENA 4RHSA 4JI5Q 4BXXG 2RCNA 5IODA 3PQIA 5C3EG 3HOWH 1KLGD 1V1OA 4MNOA 5D14A 4JW0A 3GTGH 1L0XB 5C0XH 1HA5A 2Z8LA 3CRKC 1EY0A 4DR3Q 3CQZB 4EQPA 5FO7B 1SFOB 1HR0L 1KDCA 1S5DD 2JA9A 4HCEA 2F0MA 3CMEA 3TP7A 1BBUA 2AQ2B 1NJIC 3HOVG 5CV4A 4M8AA 4C3HG 2F0UA 1VQ5A 3I4NG 4GKKL 3TP8A 1HZAA 3GO5A 4UAIA 4O2DA 1R4PB 4DR1Q 5DAUA 2XN9C 4DV4L 1I94Q 2A5HA 2RQXA 1D5MC 5CORA 2B8FA 1J9OA 2QW7A 2DY7A 1W2BA 3CP0A 1C48A 2HQEA 2BCOA 1JMCA 4DNRB 4ZUIA 2GVAA 1S5ED 3VR6A 1YITA 3GD7A 2KA7A 3OOCA 3KLSA 1E1TA 4X3SA 3H3VC 3I4OA 1ZYRD 2VUMG 3I4MG 4J8QA 4N8X1 3TN2A 1N8RC 1BCPF 3CF5A 4R4OA 3I2ZA 3PO3B 4DR7L 1H9SB 4G7ZC 1HTPA 4A3EB 2YTVA 4OO1I 3GTLB 1LTLA 3T1HQ 1EFWA 5CV9A 2ZT9C 4N9TA 1VQ4A 1G6ZA 2PQAA 3K57A 4LF5Q 1B50A 5AJ3L 2WAQE 3I4LA 5M3FG 3C1FA 1SLJA 3KJOA 1JQYD 4L5SA 4KHPQ 2D9UA 2BH8A 1PH2A 1WTRA 1U9RA 2SDFA 3WDNA 5IP9G 1CKNB 1QUQB 2O5IC 4WORA 2PZUA 3Q0AA 1LABA 2A68D 1NE3A 2VQFQ 4HIMA 3EIVA 3SEBA 1PH8A 4K6DA 2HHHQ 2OT2A 1D7QA 1R9TB 3TREA 2ES2A 5M5YH 4KI0A 1VQCA 2R7DA 4I65A 4PMWA 4OX9L 3FDTA 4AQYL 2K52A 4JI2L 4I7ZC 3HOVH 1S5BD 4C3HH 5LMNW 3IAYA 3H09A 4RGNA 1AZQA 1TKWB 2AMCB 4R9WA 5IWAQ 3F2DA 2PPBC 1U4PA 1SE8A 3KLSX 3PUZA 1DD2A 3I56A 1Z7TA 1G2TA 4NPSA 2E2JH 1YIJA 1YNJD 4ALPA 4BS9A 1SNCA 4BBSG 4CHTB 4HMIA 3A7LA 4B9XA 4DV1Q 3R2IA 1XWEA 1VQJA 4A3IB 2SEBD 1B4OA 3D3RA 5IGBA 1CA5A 1N33Q 1DOMA 1GHJA 3SK8A 4DK1A 1Q1EA 2E5LQ 1TVXA 1KHIA 2L11A 2F3IA 1BKBA 2CWAA 2JEBI 4A3KH 3KJPA 4DR4Q 2RDGA 4V190 2EY1A 3EJIA 4IUQA 1KIXA 4A3GG 4FF2A 4LFBQ 3S16H 2LXKA 4MN3A 1Q3LA 1TS4A 4OL7A 1B1ZA 1GVPA 2F0QA 1V1PB 1SYDA 1Z47A 2JJQA 5M3FH 1IBML 4X65L 1IYVA 3L0OA 1BF4A 2R92G 2PNRC 3TMEA 4HJ7A 3HOYB 5IP9H 3NELA 3BZDB 2NVXH 1STBA 2R6GA 1QG7A 4UHVA 4ZKBB 3MZ5A 5GAHC 4QIWB 4B3ML 4DR6Q 1OTCA 2I5HA 1DOLA 1WCMB 2DY8A 3D4RA 4C3IG 1LTTD 4DUZQ 1D8LA 4X3UA 2F0WA 1JORA 1X3FA 5FJ8G 3D0FA 2M00A 4A76A 1VQLA 3F8TA 2F0IA 1WI5A 2DNEA 2Y0SB 1IL8A 2ENBA 1A2TA 4NXNQ 3DMUA 1Q82C 4XYQA 1HZBA 3KFUA 5EBCA 3JAMc 2BDOA 4LUZA 4L5QA 1KRSA 2E8GA 3DWAA 1Y69U 3S1RH 3S1NH 1G291 4X62L 4K8JA 4B3TQ 2CCZA 4BBSH 2MQHA 3LX0A 2F0OA 1TY0A 2HQLA 1UAPA 3RD4A 3OW2A 1MKHA 1S4ZA 3PMFA 4RA8A 3HOZH 1SYCA 1STAA 1I50B 3M9BA 3X3MA 4HIDA 1XNQL 3S17H 4APVA 1IKMA 4YWLA 1NBWA 1C9OA 1NTGA 1LV9A 4A93B 2A19A 3H0GB 3NUCA 2JQOA 2JA7B 1JJCB 5D65A 5IGGA 4OWWB 5CC4A 1L0WA 2DN8A 1PFNA 4TVAB 5FK9C 1EZ6A 2F0SA 4A3JH 1F2ZA 3FP9A 3PIO3
chains in the Genus database with same CATH topology
5BN5A 2NZ1D 2ZXRA 2VNUD 1AZPA 1K83B 3S2DB 1SE4A 3J81L 1BCPC 1BDOA 1DONA 4EVOA 1D6EC 4F87A 4PNYA 1EWHA 5KIXA 1RODA 1CQVA 2RSNA 1VMCA 5C4JB 3HZXA 1S5CD 1QNKA 1O7YA 4ME5A 1EU4A 1ZKOA 4DGZA 5EPLA 2MP1A 4OIKA 2IX0A 5EKIA 1SMYD 2VXWA 1W6KA 4C56C 3RLFA 1EZ8A 3FVQA 4WJWA 3L9AX 5KRUA 1AP0A 2QILA 4C1NK 1CA6A 2WB1B 1EYAA 4KHVA 2FFKB 3BVGA 2O2LD 1SYGA 4DF7A 2IWHA 2N88A 3RMHA 5TSSA 3CRLC 1JICA 4DU9A 2NN6G 2VB3X 1KDBA 1CHQD 5DM73 1ZEQX 5COYA 4HR7B 1O7LA 3S1MB 4XDXA 2XNAC 4ZUJA 5KYIA 3CU7A 3NP8A 1HRJA 2J0TD 3I72A 1I4XA 2K03A 4NKLA 3A56A 3QWNA 2NTTA 3BG3A 2QKIC 3C1EA 4C3JG 2EY6A 4FXKC 5HURA 5FO9B 4S3SA 1PMRA 3E0JA 5IGEA 2B63B 3VYUA 1OXUA 2KVMA 2XSCA 1XYIA 3QB3A 1BXTA 1L0YB 3HP3A 1OXSC 2EDGA 4MIUA 2E75C 5M5YB 4L63B 3K58A 4ULLA 5I2YA 2RA4A 2EYPA 2F0LA 5CV8A 5FLXE 4RKBA 5CV6A 4YIJA 5JAVA 1WVLA 2EY5A 2GA4B 5CR3A 1A6XA 2NN6H 1NUCA 1STHA 4U68A 1Q12A 3E6ZX 1II3A 1SNOA 1IYUA 1Z6HA 2CW0D 1G91A 2R61A 2MUYA 3D8GA 2WKDA 3BS1A 4O42A 2OXPA 4FP5D 1PRTC 1Y1WB 4TQUS 1B9MA 1SE2A 2L55A 4CKCA 1VDZA 3G6JB 3FEWX 1PTOB 4WFN3 4DFAA 5EQ0A 5LL6X 4N9PA 3BVMA 5AFWA 3GTQB 3H6MA 4KN7C 3TBIB 5FKAC 1JWMD 2RSOA 1SJHD 4B08A 5JEAG 1BUVT 4HCSA 4RGTA 1F9PA 2K33A 5J1ZA 3M85A 1RJTA 1BBXC 4A3BB 1DZ1A 3D6CA 1XXGA 5LHY1 3NBHA 1A3TA 1GHKA 3SVMA 3VYTA 3C2PA 2QCPX 2XWJB 2EJGC 1EFID 4C2MB 3FRPB 1FNVA 1SE3A 5CV5A 1TS5A 4LMQD 2FMMA 4U673 1TS2A 4FF1A 1LTBD 3KLRA 2IX1A 2D62A 3HG9A 3MXNA 3T16A 3AB9A 4RCNA 5G3LF 1A3VA 3KBGA 4BWGB 2K04A 4IUPA 3C3LA 4HMJA 5C0XJ 1F9RA 1CI3M 2K5QA 4XIGS 4A3JB 1CFMA 2F03A 5EPJA 4HN7A 4K5XA 3FKIB 1QE6A 3S2HB 2F0NA 4IN3A 1MSHA 4RAUC 5KNCA 3ERQA 1SBBB 4QMGA 1GUOA 2AWNA 1CTMA 2AWOA 2PO4A 4GZYC 3SE0A 3KUPA 3DHQA 1H9JA 5C0XI 4HSVA 1LACA 2CVRA 4CGYB 3R3OA 4XQNA 4L8JA 4AYBB 2F0KA 1KDAA 2A69C 2EE1A 1STNA 5KNBA 4Y7NB 3K59A 2F3WA 2IPKD 3A7AB 2LY7A 3PV0A 1WD1A 1E0BA 2C9OA 2EYJA 1QOHA 1BNZA 3NQTA 2K05A 3J7YW 2F0EA 3A54A 3Q22A 1WTPA 5T1GA 4KHZA 1B3AA 3U9OA 1SJED 1R4QB 1O80A 2YYZA 3T13A 1CM9A 4XT1B 3A55A 1VF7A 3CKIB 1W6JA 2OF1A 4LK1C 1PTOD 3P1HA 1RKNA 1U4LA 3K5OA 4ILWA 3K7AB 4FF3A 3FPUB 2JA6B 3OIPA 1LTAD 4QUCA 4ZLTF 4A3MB 1Q90A 1C8CA 1KNEA 2E2DC 3OPOA 3T56B 4Q5VA 4K2KA 1SNPA 5BN3A 3N6RA 4IALA 3T4AC 1CT1D 1RF2D 3VYSA 4QB4A 3M3YB 3RUZA 2ID0A 4TRDA 2KJXA 3I70A 1GUSA 3LWEA 1YNND 3MXUA 2QEJC 2NUCA 2EYOA 2L9HA 3NK9A 4KN4C 4CBVA 1ZYRC 3IL8A 3KF8A 1I3QB 2Z4IA 5J39A 2H1EA 1EL0A 2ZXPA 4K2LA 2TMPA 3GV3A 3URYA 3GTKB 3U9SA 1Y8NB 4A3DB 4NP5A 2X6GA 2YU9B 1IW7C 1U4RA 5CGKA 1STGA 4IFDG 3S15B 4DK0A 2I07B 3NTHA 1MGSA 1U4MA 2E76C 1HFGA 3MHBA 1MD2D 1PYWD 1PZID 1QCBD 4FVMA 4EQOA 1PTOH 4K14A 1RDPD 3K5NA 3WOEA 5BN4A 1HFNA 2PCFB 1EEFD 1ET6A 4FYDA 4RCOA 1FNUA 2R3ZA 4H44C 3OHXC 2RVLA 3TSSA 3S14B 2L5TA 4QF4A 4UDUC 1GXDC 2SOBA 3D4DA 1JWUD 3GP7A 2PW7A 1NAPA 5D3IB 2BE5C 4KJOA 1LO5D 3DWQA 2CHBD 3EFXD 1ENAA 2B2UA 5I6WA 3BYTB 2KQ3A 5M5WB 1TU2B 3DWPA 2K32A 3MWYW 5JPNC 5KEEA 4PMBA 1EQTA 2O5JC 5JVH3 1F2LA 2QF7A 1F9QA 3L3OC 5EPKA 4X3KA 4BA2I 5M5XB 1BCPD 3MFGA 1G8ZD 1HPCA 1O78A 1MBYA 3VR3A 1OXTA 5IGFA 4KY7A 4Q0FA 5EGTA 1PRTF 4OHJA 5EBDA 3HGBA 4IFDH 3MFYA 3HOXB 1MI2A 5JJZA 1BR9A 3J81E 2F0JA 1X3PA 3HOUB 1CQFA 1WTWA 2JP1A 2K28A 1EY7A 1FYCA 1Y8PB 2WP8J 3EVQA 2PQEA 2A6ED 3EROA 3EA6A 3HKZB 1DM0B 3PUXA 1GUTA 5CV7A 1E2WA 1GUWA 5KYLA 2G9DA 1LTSD 2LMCB 2F1MA 3UI2A 3N52A 1DOKA 4NDXA 4CJ1B 4ZK9B 1FR3A 4KTAA 1QNUA 3A8KE 3AMUA 5I9PA 4IZ8A 2JSOA 1SXTA 5K5PA 3BDCA 1M8AA 3NE5B 3A8JE 4F7XA 1PFBA 2WINB 3DEPA 4FXGC 1EYCA 2M2LA 2MHVA 4L6TB 3HEJA 1EIHA 1ICWA 2NVYB 5C4XB 1VMPA 2JA5B 1RCVD 2IW3A 2EYLA 4PQXA 4RFBA 1I4RA 1TIID 2K1BA 5M9OA 1I6VC 1JOKA 1LTGD 2D2CC 2ZXOA 4F88A 4E6IA 1FNWA 4C1NI 3LWUA 3JAME 3K5MA 2AQ1B 2NVQB 4RKLA 2R93B 2B2WC 3MEHA 3IFDA 1SNDA 4KKSA 1SMYC 3J7AF 1PFMA 2X69A 3O13A 1MSGA 1TY2A 3JAML 4TKOB 4IURA 2BA0A 4RGOS 1SAPA 2RDHA 3ITPA 2XWBB 3CHBD 5C3EB 5I6YA 2NWGA 1EYDA 2SNSA 1LT6D 2FMCA 2KHSA 1FD7D 3DM1A 4FXDA 4ZYSA 5E4WC 3NBIA 5C4HA 2JE6I 4FO2A 2NN6I 4RH6A 5M3MB 2B2YC 2WACA 3NTIA 1RTOA 1OXVA 3MTSA 3I4NB 3EQLC 1LT4D 4KK7A 1NR2A 1K8OA 2EOTA 3M7GA 4XTCS 2EPBA 4K8IA 3M7NA 2HDMA 3PO2B 2EYHA 2B2WA 1SDFA 4KD3A 3C46A 1X32A 3I4MB 2VUMB 4V0BA 3P20A 3Q6SA 2Q8RE 4KD4A 2RKSA 2A74C 2JA8B 1RHPA 1UUPA 3P7JA 1HUMA 3W2DA 3SDZA 1G2SA 1EU3A 4OGQC 3L7ZC 3QJYA 2RDFA 1TWCB 4ZKCB 2FHTA 1TWAB 2B2YA 4MHEA 1V1PA 4DXGA 5JEAJ 4G57A 4XYOA 5FO8B 1RD9D 2CW0C 2O4XA 3MC0B 5C5LA 2H4OA 1QJOA 2WIIB 2MGSA 4TSSA 5CBEE 2NBFA 1O7ZA 4B9WA 3OMCA 2HUGA 1JOQA 3ZYYX 1WD0A 1WTVA 1JC7A 4P2CB 2LFNA 3V2TA 3GTPB 1QB5D 1JWSD 5ELEA 3KBXA 3J80E 4DN4M 2PZTA 2FINB 2A69D 4G7OC 4A3GB 3VYRA 1GUGA 2EYMA 1JB3A 1AEXA 1QWYA 5ELCA 1HXYD 5F2DA 3Q24A 3NXWA 4PV1C 3J80L 1E2ZA 1F2MA 2L0CA 2Q8IB 5A2QE 2R92B 1HA6A 2E2HB 1B9NA 1I4QA 5K36G 2HDLA 5ELDA 1ILPA 1SYEA 4XXEA 4OIJA 4IUNA 3HRZC 1OO9B 5IGCA 3R8BA 2LKVA 5A2QL 4X3TA 1PXUA 2F4IA 5C5MA 3PUVA 4QCLA 5HGTA 4IUVA 3PIP3 2XIWA 4OO1G 2D5DA 1A3UA 1B44D 2IX3A 2AUKA 3D6WA 3TP6A 4WRDA 3S1QB 3V05A 2A6HC 2E74C 2ICEC 5D3DA 2C5CA 1HTLD 3QG1A 1BCPB 4BY7B 2CQAA 3J7AV 1EY5A 1Y1VB 4KV6A 5EJWA 3RZOB 3FMCA 5ELBA 4ID6A 3AU7A 4DAYA 3PUYA 5J22A 1H9KA 3OWEB 5ISRA 1AN8A 1UNSA 4ODGA 5DEHA 3VA7A 1EWCA 3MAQA 1X3QA 1XTCD 2K01A 1Y8OB 1T5EA 3K5LA 4RWSC 1GOZA 3GTMB 5K36H 1FGBD 4XQQA 1ZXTA 4HEDA 1H9MA 4NMZA 4BY1B 1SYFA 3RZDB 2NVTB 3DEOA 3TZUA 2HCIA 4QUFA 4XT3B 2B8GA 4KMUC 4O1NA 5G3LD 2I46A 1IW7D 2F0DA 1B2TA 4OO1H 1JOOA 3I3CA 2EY2A 3NTKA 3G7LA 3F2UA 3OIQA 5I4DA 1I6HB 1PTOC 5EKKA 1OXXK 3DUZA 4J6HA 3MA2B 4KKTA 2JYOA 4K5VA 1WTOA 2B2UC 2L4NA 1ONLA 3TP5A 1PDQA 5C4ZA 4EQNA 1STEA 5IOCA 1LT5D 1JCKB 4KY6A 3SK5A 1F9SA 2AQ3B 5I2XA 2BE5D 1HQMC 1WTXA 5I9OA 2F0GA 3TZDA 2WV6D 3T53B 1BQQT 2A68C 3OWFA 3H94A 4CJ2C 2E2IB 4R8IA 1YNNC 4R8NA 4IFDJ 1VCIA 1DJRD 2A73B 1D2BA 1CZGA 4C3JB 1TQOA 3GV6A 4KY5A 3FPPA 1TWHB 4CJ0B 1SSOA 4A3FB 3NSWA 2NTSA 2V4DA 4K5WA 1YNJC 4FF4A 2XRQD 4JK1C 4DXFA 1BOSA 2KEEA 3GTOB 1ENFA 4XQJA 4KJNA 3K6OA 1PRTB 2B2TC 4IQZA 3IKJA 2M9VA 4BA1I 2F0VA 1LLRD 4IFDI 1C4QA 3E5SA 1J8IA 1EOTA 2K7VA 1DCZA 2AUJD 4ABNA 5CYUA 3Q23A 1BO0A 3BVZA 4ZRZA 1E2VA 3A8IE 3WOFA 3NWSA 1TWFB 4BBRB 5CMDA 2PMZB 1TWGB 3V96A 1KABA 1LTID 3T51B 1HQRD 2TSSA 2KEDA 4IUUA 3NWTA 1ET9A 3NQIA 5T1IA 3VR2A 2J4XA 5C44B 1QILA 4ZQ3A 2F0FA 5CBAE 1GJXA 3SR1A 1IKLA 2BA1A 1A15A 4PMCA 3I8ZA 2F0PA 2B2VC 2JXMB 2EZVA 3I73A 2R7ZB 1F77A 2B2TA 2XRSD 2PYKA 2G9HD 4KKUA 1I4GA 1PZKD 3GQBA 1F2YA 4Z9CB 3PUWA 4K6LA 4ZAIA 3LNNA 4LAAA 3OSOA 3HOWB 2F0HA 1KLUD 3GTGB 3QO2A 3VA5A 4G7HC 5DNFA 4FNFA 2DNCA 5ELFA 3M4YA 4DA2A 1T5XD 3X3NA 5JOBA 3SK6A 4LJZC 2EXZA 4F8MA 1KNAA 1M4VA 2A6EC 3R93A 3SHLA 1KAAA 2JEAI 5E3FA 4H0LC 1SYBA 5JVG3 2N55A 5FOBB 2WKCA 1Q1BA 5DM63 2BDNA 4J1MA 3ND9A 2B2VA 1DYQA 2L1BA 5EKLA 1ILQA 2IL8A 1HHVA 3P75A 1EEID 1D5XC 3D31A 2Q8TA 3S9WA 1JE4A 1HCZA 1EY9A 3OMGA 2X6LA 4RGMA 4NW2A 4EGVA 1VF5C 1H9SA 2WAQB 2HCCA 3BDLA 1EIGA 2OEOA 1NCVA 3ND8A 5IIFA 3DXJC 3MXPA 1PRTD 2KCCA 2K6AA 2NYZD 1TR5A 3BYYB 1V43A 2IJ0A 3NHHA 1LT3D 5IT9E 4DAPA 2LS01 3MVVA 1KTKA 3SXHA 5KGUA 2B39A 1Q8IA 1TS3A 3HOVB 4C3HB 3H91A 2EJMA 1NSNS 4HAEA 2J7ZA 3IFTA 2NB0A 1WTQA 5IT9L 2EJFC 2E2JB 1GUNA 3VR5A 2MPMA 2VB2X 4DNTB 2QDBA 1EY4A 1V8QA 1UEAB 4HSPA 1ML0D 2XVSA 2F3VA 3I91A 1HUNA 2Z1CA 5FLXL 1CHPD 5C6AA 1TT2A 4A3KB 5IGDA 3GTJB 1SNMA 3BDOA 3S16B 1EY8A 1SEBD 3W3AA 2SNMA 3NPPA 5M3FB 5E4XA 1JR0D 1D1IA 3K0YA 5C3XA 2FJ2A 4DAVA 4IUTA 1CK1A 5E1FA 3ONAB 2NVXB 2ICIA 1STYA 4JBWA 1EQVA 1PTOF 1PZJD 1B53A 1A2UA 1DXMA 1I4PA 1AW7A 1PLFA 3D4WA 2K5DA 1K8MA 1EY6A 1RTNA 1S5FD 3S1RB 3S1NB 3VR4A 1ENCA 5C0XG 4CKEA 2BOSA 2KUMA 1NR4A 4BBSB 5C3WA 1D1KA 1H9RA 1CZWA 2EVBA 3QOJA 4H7BA 3HOZB 3R2TA 2KECA 3S17B 5NUCA 4HTHA 1ESRA 3SK4A 2MJ8A 2KCNA 1LTRD 2EYFA 4M1UB 3KK7A 1I4HA 2L12A 1ESFA 5KNDA 4G4KA 4CKBA 5JPMC 1IHZA 2PZWA 2IT1A 1SNQA 1XX8A 2PW5A 2A6HD 3MXGA 4H13C 5A35A 2F0TA 3TDQA 3I90A 2KOLA 5JEAH 2RBMA 1D5ZC 3QIAA 4RHRA 2Z4HA 3QOLA 3OW7A 3HS0C 5LL6S 3M4OB 4C3IB 2K5WA 1AFPA 4RHSA 5IODA 1KLGD 1V1OA 5D14A 1L0XB 5C0XH 1HA5A 2Z8LA 3CRKC 1EY0A 3CQZB 4EQPA 5FO7B 1SFOB 1KDCA 1S5DD 4HCEA 2F0MA 3TP7A 2AQ2B 5CV4A 4M8AA 4C3HG 2F0UA 3TP8A 3GO5A 4UAIA 1R4PB 5DAUA 2XN9C 2A5HA 1D5MC 2RQXA 5CORA 2B8FA 1J9OA 2DY7A 1C48A 2HQEA 2BCOA 4DNRB 4ZUIA 1S5ED 3VR6A 3GD7A 2KA7A 3OOCA 3KLSA 4X3SA 3H3VC 1ZYRD 4J8QA 3TN2A 1BCPF 3PO3B 1H9SB 4G7ZC 1HTPA 4A3EB 4OO1I 3GTLB 5CV9A 2ZT9C 4N9TA 1G6ZA 3K57A 1B50A 3I4LA 3C1FA 1JQYD 2D9UA 1WTRA 1U9RA 2SDFA 3WDNA 2O5IC 4WORA 2PZUA 3Q0AA 1LABA 2A68D 3SEBA 4K6DA 2OT2A 1R9TB 4KI0A 4I65A 4PMWA 3FDTA 4I7ZC 1S5BD 3IAYA 3H09A 4RGNA 1AZQA 1TKWB 4R9WA 2PPBC 1U4PA 3KLSX 3PUZA 1DD2A 1Z7TA 1G2TA 1YNJD 4BS9A 1SNCA 4CHTB 4HMIA 3A7LA 4B9XA 3R2IA 1XWEA 4A3IB 2SEBD 1B4OA 3D3RA 5IGBA 1CA5A 1DOMA 1GHJA 3SK8A 4DK1A 1Q1EA 1TVXA 2L11A 2JEBI 2RDGA 4V190 2EY1A 3EJIA 4IUQA 4FF2A 4MN3A 1Q3LA 1TS4A 4OL7A 1B1ZA 2F0QA 1V1PB 1SYDA 1Z47A 1IYVA 1BF4A 2PNRC 3TMEA 3HOYB 3BZDB 1STBA 2R6GA 1QG7A 4ZKBB 3MZ5A 4QIWB 1DOLA 1WCMB 2DY8A 3D4RA 4C3IG 1LTTD 4X3UA 2F0WA 1JORA 2M00A 2F0IA 2DNEA 2Y0SB 1IL8A 2ENBA 1A2TA 3DMUA 4XYQA 5EBCA 2BDOA 3DWAA 1Y69U 1G291 4K8JA 3LX0A 2F0OA 1TY0A 1UAPA 3RD4A 1S4ZA 3PMFA 4RA8A 1SYCA 1STAA 1I50B 3X3MA 1IKMA 1LV9A 4A93B 3H0GB 3NUCA 2JA7B 5D65A 5IGGA 5CC4A 2DN8A 1PFNA 5FK9C 1EZ6A 2F0SA 1F2ZA 3PIO3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D6C A;  5C3W A;  1AEX A;  2EYO A;  3HEJ A;  4KD3 A;  4LAA A;  5DAU A;  3SXH A;  3OSO A;  3NK9 A;  5KGU A;  2F0K A;  4NMZ A;  1SYF A;  2F0H A;  3VA5 A;  1A3T A;  5IGF A;  3C1E A;  5F2D A;  3SK8 A;  1KDA A;  2EYL A;  3NXW A;  4KD4 A;  3QOJ A;  1STN A;  1F2M A;  1NSN S;  2HQE A;  4H7B A;  2EY6 A;  2RKS A;  4KY7 A;  5HUR A;  5M9O A;  5EGT A;  4S3S A;  2F3W A;  4ZUI A;  2EY1 A;  3EJI A;  1JOK A;  4HTH A;  5NUC A;  4EVO A;  5JOB A;  5J39 A;  3SK6 A;  4K2L A;  3SK4 A;  5IGE A;  4PNY A;  2EXZ A;  2EYJ A;  2EYF A;  4F8M A;  2F0D A;  4KJN A;  3QB3 A;  1JOO A;  5KIX A;  1SYE A;  2EY2 A;  4OL7 A;  5CV5 A;  4E6I A;  2F0J A;  4NP5 A;  2F0Q A;  4MIU A;  1SYD A;  3NQT A;  2F0E A;  2F0V A;  4IUN A;  3SHL A;  4K5W A;  1KAA A;  5IGC A;  3HZX A;  5E3F A;  1IHZ A;  1EY4 A;  2QDB A;  2LKV A;  3E5S A;  2RDF A;  2PZW A;  1SYB A;  1SNQ A;  2EYP A;  3TME A;  1STG A;  2F3V A;  3T16 A;  5CGK A;  5C5M A;  1EY7 A;  4ME5 A;  5EKK A;  4RKL A;  3U9O A;  3MEH A;  5CV9 A;  2F0L A;  4J6H A;  1SND A;  2PW5 A;  3EVQ A;  2PQE A;  1A3V A;  4N9T A;  1TT2 A;  5C6A A;  5HGT A;  3T13 A;  5IGD A;  1STB A;  4DGZ A;  5CV8 A;  1SNM A;  4K5V A;  4J1M A;  3ERO A;  4HMJ A;  3MZ5 A;  1A3U A;  4RKB A;  5CV6 A;  2F0T A;  4YIJ A;  4G57 A;  3C1F A;  3MHB A;  5EKL A;  2OF1 A;  5JAV A;  1EY8 A;  2RBM A;  5IGB A;  3P1H A;  3TP6 A;  1RKN A;  1U9R A;  4WRD A;  3TP5 A;  5C4Z A;  1KAB A;  2F0W A;  3QOL A;  5CV7 A;  4EQO A;  2O4X A;  3P75 A;  2SNM A;  5C5L A;  1JOR A;  2EY5 A;  2M00 A;  4K5X A;  5CR3 A;  3ITP A;  4K14 A;  4EQN A;  5IOC A;  4WOR A;  1EZ8 A;  2F0I A;  2PZU A;  5I6Y A;  1NUC A;  4KY6 A;  3SK5 A;  1EYD A;  2SNS A;  5C3X A;  1STH A;  5KYL A;  2ENB A;  1A2T A;  3DMU A;  5IGG A;  3S9W A;  5KRU A;  2KHS A;  4K6D A;  1II3 A;  1SNO A;  2F0N A;  1EYA A;  4KHV A;  5E1F A;  1EY9 A;  4ZQ3 A;  2F0F A;  4NDX A;  4B9W A;  2F0G A;  3OMC A;  4K8J A;  4QF4 A;  3OMG A;  5I9O A;  5C4H A;  3D8G A;  1SYG A;  2SOB A;  3D4D A;  1STY A;  4I65 A;  4DF7 A;  1JOQ A;  1EY5 A;  1EQV A;  3SR1 A;  4KV6 A;  2PW7 A;  3ERQ A;  2OXP A;  5IOD A;  3LX0 A;  2WAC A;  3OWF A;  2F0O A;  4KTA A;  4KJO A;  3BDL A;  4DU9 A;  4ID6 A;  4QMG A;  5I9P A;  4PMC A;  1KDB A;  3PMF A;  1A2U A;  4IZ8 A;  4K2K A;  5J22 A;  1SYC A;  2F0P A;  1EY0 A;  1STA A;  2OEO A;  1SNP A;  5ISR A;  3DHQ A;  4R8N A;  3V2T A;  3D4W A;  1ENA A;  4IAL A;  4ODG A;  5DEH A;  4ZUJ A;  4DFA A;  5I6W A;  5KYI A;  3NP8 A;  2KQ3 A;  5IIF A;  4EQP A;  5K5P A;  2PYK A;  3MXP A;  3BDC A;  4N9P A;  4QB4 A;  4F7X A;  3RUZ A;  3H6M A;  1TQO A;  3NUC A;  1KDC A;  1SNC A;  1EY6 A;  5KEE A;  1TR5 A;  2F0M A;  2PZT A;  4HMI A;  4K8I A;  4KY5 A;  4PMB A;  1EYC A;  1F2Y A;  3R3O A;  4TRD A;  3TP7 A;  4B9X A;  5CC4 A;  3NHH A;  5CV4 A;  1EZ6 A;  2F0S A;  2F0U A;  1ENC A;  4NKL A;  5J1Z A;  3TP8 A;  1F2Z A;  2EYH A;  2EYM A;  2NUC A;  3MVV A; 
#chains in the Genus database with same CATH topology
 5BN5 A;  5LMU L;  2NZ1 D;  2ZXR A;  4FDB A;  4DR5 L;  2VNU D;  3E9I A;  1AZP A;  1JB7 A;  4JI7 L;  2K5V A;  1K83 B;  3S2D B;  1SE4 A;  3J81 L;  1BCP C;  1BDO A;  1DON A;  4EVO A;  4LWC A;  1D6E C;  4F87 A;  4PNY A;  1EWH A;  5KIX A;  1ROD A;  4A3E G;  5GAG C;  1CQV A;  2RSN A;  2MFI A;  4K0K Q;  1HNW L;  2UXB L;  4DUY Q;  1VMC A;  5C4J B;  3HZX A;  4R1J A;  4C3I H;  1S5C D;  4GLV B;  3PF5 A;  4JOI C;  1QNK A;  4JI6 L;  1O7Y A;  3RLO A;  4ME5 A;  1EU4 A;  1MJC A;  2AHO B;  4DV6 Q;  4LUO A;  4JI5 L;  4N8F A;  1ZKO A;  4DGZ A;  4UPA A;  1T9H A;  1PVO A;  5EPL A;  2MP1 A;  5IYC G;  3UDI A;  4OIK A;  3CCJ A;  1J5E L;  5HY6 A;  2IX0 A;  1KAW A;  4DR3 L;  5EKI A;  1SMY D;  2VXW A;  4OEL B;  3CQZ H;  1W6K A;  4C56 C;  3RLF A;  1EZ8 A;  3CC2 A;  3FVQ A;  1WFQ A;  4WJW A;  1SFO H;  3L9A X;  4DAY B;  5KRU A;  1AP0 A;  2QIL A;  1X55 A;  4C1N K;  1CA6 A;  2WB1 B;  1EYA A;  4KHV A;  3A5U A;  2FFK B;  3CCR A;  3BVG A;  1Q7Y C;  2O2L D;  5IP7 G;  1SYG A;  4DR1 L;  4DF7 A;  2IWH A;  1I94 L;  2RHS B;  2N88 A;  3RMH A;  5DLQ E;  2ALY B;  5TSS A;  3CRL C;  4DV3 Q;  1JIC A;  4DU9 A;  2NN6 G;  2VB3 X;  3UDG A;  1KDB A;  1CHQ D;  5DM7 3;  1ZEQ X;  5COY A;  4HR7 B;  1O7L A;  3S1M B;  4XDX A;  2XNA C;  4ZUJ A;  5KYI A;  3CU7 A;  3NP8 A;  1HRJ A;  2J0T D;  3I72 A;  4LNQ A;  1QVF A;  4DK6 C;  1K8G A;  2HD3 A;  1I4X A;  3L2P A;  2K03 A;  2Z6K C;  3OTO Q;  4HJ9 A;  2I5L X;  4NKL A;  3PO3 H;  3A56 A;  1UWV A;  3QWN A;  2NTT A;  3EBE A;  4A3E H;  2YV5 A;  3BG3 A;  2EIF A;  3T1H L;  3GTL H;  2QKI C;  3C1E A;  4C3J G;  1EYG A;  1VQP A;  2EY6 A;  4FXK C;  5HUR A;  4LF5 L;  5FO9 B;  4S3S A;  1VQ6 A;  1PMR A;  4A3F G;  3E0J A;  5IGE A;  2B63 B;  3VYU A;  1E7Z A;  1OXU A;  2KVM A;  4KHP L;  4B3R Q;  2XSC A;  1WOC A;  3QB3 A;  1XYI A;  1BXT A;  1L0Y B;  3HP3 A;  3J80 c;  3F2B A;  1OXS C;  2EDG A;  4MIU A;  3MEF A;  3HOY G;  2E75 C;  5M5Y B;  4L63 B;  5IYC H;  3K58 A;  4ULL A;  5I2Y A;  1L1O B;  2RA4 A;  2VQF L;  2EYP A;  2HHH L;  4JI8 Q;  2F0L A;  1R9T H;  1E24 A;  1V1Q A;  5CV8 A;  2ZTC A;  5FLX E;  2BH2 A;  4RKB A;  4CDC C;  5CV6 A;  4YIJ A;  5JAV A;  5IWA L;  2KEN A;  2GN5 A;  1WVL A;  1Q86 C;  2EY5 A;  2GA4 B;  3RNU A;  5CR3 A;  1A6X A;  4DV7 Q;  4YCV A;  3ULP A;  2NN6 H;  1NUC A;  1STH A;  2Z6K A;  4U68 A;  1Q12 A;  3E6Z X;  5IYD G;  4DV1 L;  1II3 A;  1SNO A;  1VQG A;  1IYU A;  1Z6H A;  2CW0 D;  1G91 A;  2R61 A;  2MUY A;  2JK8 A;  3D8G A;  4A3I H;  2WKD A;  3KF6 A;  3BS1 A;  4O42 A;  1N33 L;  2OXP A;  4FP5 D;  1PRT C;  1Y1W B;  4TQU S;  1VQ7 A;  1B9M A;  1SE2 A;  2L55 A;  4CKC A;  1VDZ A;  4DR4 L;  3G6J B;  1N34 L;  3FEW X;  1PTO B;  4WFN 3;  4DFA A;  2JA7 G;  3A0J A;  5EQ0 A;  4QGU A;  4LFB L;  1HZC A;  5LL6 X;  4JVZ A;  2ZTD A;  3BVM A;  4N9P A;  5AFW A;  3GTQ B;  3H6M A;  4KN7 C;  1XMO Q;  3TBI B;  4NXM Q;  5FKA C;  1JWM D;  2RSO A;  1SJH D;  4GLA C;  4B08 A;  5JEA G;  1BUV T;  4HCS A;  4RGT A;  1F9P A;  2K33 A;  5J1Z A;  3M85 A;  1VQN A;  1RJT A;  1BBX C;  4A3B B;  1DZ1 A;  3D6C A;  1UE1 A;  2F52 A;  1XXG A;  1Y14 B;  5LHY 1;  3HOY H;  3NBH A;  1A3T A;  1GHK A;  2Q2I A;  3K80 C;  3SVM A;  1X9N A;  3VYT A;  3C2P A;  2QCP X;  4YWM A;  2XWJ B;  2EJG C;  1EFI D;  3RN5 A;  2MNA A;  4DR6 L;  4C2M B;  1NMG A;  3FRP B;  1FNV A;  1WCM H;  2K50 A;  4DUZ L;  3HOW G;  3CPW A;  1SE3 A;  1VQB A;  5CV5 A;  1TS5 A;  4LMQ D;  2FMM A;  4U67 3;  1TS2 A;  2VZA A;  4FF1 A;  3A74 A;  1LTB D;  3KLR A;  2IX1 A;  2D62 A;  3HG9 A;  4NXN L;  2Y0S E;  3MXN A;  3T16 A;  3AB9 A;  1WYD A;  4RCN A;  1WJJ A;  5G3L F;  2QA4 A;  4B3T L;  1A3V A;  4QY7 A;  1GD7 A;  3KBG A;  4BWG B;  2K04 A;  4IUP A;  3C3L A;  4HMJ A;  3JAM i;  5C0X J;  1F9R A;  3M4P A;  4QL5 A;  1VQF A;  1CI3 M;  2K5Q A;  4XIG S;  1I50 H;  3KYH C;  4A3J B;  1CFM A;  2F03 A;  5EPJ A;  4HN7 A;  3U4Z A;  4K5X A;  4X66 Q;  1EQQ A;  1EUJ A;  4A93 H;  1UE5 A;  3H0G H;  1MIU A;  3FKI B;  1QE6 A;  2JA7 H;  3S2H B;  2F0N A;  4IN3 A;  1MSH A;  1BBW A;  2G5D A;  4RAU C;  3CCM A;  1JE5 A;  4UP9 A;  5KNC A;  3ERQ A;  1B8A A;  3T1Y Q;  1SBB B;  4QMG A;  1GUO A;  2AWN A;  1CTM A;  2AWO A;  2F4V Q;  2PO4 A;  4GZY C;  3SE0 A;  3KUP A;  1K83 H;  3DHQ A;  3S2D H;  1SR3 A;  1H9J A;  4ME3 A;  2WAQ G;  2Z9H A;  5C0X I;  1XPO A;  4HSV A;  1LAC A;  2CVR A;  4CGY B;  2UXC Q;  3R3O A;  4K0K L;  4XQN A;  4DUY L;  4L8J A;  5C4J H;  2VY3 A;  4P72 A;  4AYB B;  2F0K A;  4DV6 L;  1X6O A;  1KDA A;  2A69 C;  2CKZ B;  1J5E Q;  2EE1 A;  1LYL A;  1STN A;  5KNB A;  4Y7N B;  3K59 A;  1GM5 A;  2F3W A;  3AFP A;  2IPK D;  3A7A B;  2LY7 A;  3PV0 A;  1WD1 A;  1E0B A;  2UXD Q;  5ELN A;  2C9O A;  2EYJ A;  1K73 C;  1QOH A;  1BNZ A;  3NQT A;  2K05 A;  3J7Y W;  2F0E A;  3A54 A;  3Q22 A;  1JJ2 A;  1K3R A;  5FLM G;  2DJF C;  1WTP A;  5T1G A;  4KHZ A;  1IBL Q;  1B3A A;  3U9O A;  2WB1 E;  1SJE D;  1CKM A;  1R4Q B;  1O80 A;  2YYZ A;  1O7I A;  3T13 A;  1CM9 A;  4YWK A;  4XT1 B;  2HIX A;  3A55 A;  1VF7 A;  4DV3 L;  1GO3 E;  3CKI B;  1W6J A;  2OF1 A;  4LK1 C;  1PTO D;  3P1H A;  1RKN A;  1U4L A;  2RF4 A;  3S1M H;  3K5O A;  4J15 A;  4OON A;  4O0A A;  4A3K G;  4ILW A;  3K7A B;  2K5H A;  4HJ8 A;  4FF3 A;  3AQQ A;  3FPU B;  1IBK Q;  4LF7 Q;  1IL2 A;  3G48 A;  3OTO L;  1Y1W G;  2JA6 B;  3OIP A;  3U4V A;  1LTA D;  4QUC A;  4ZLT F;  1P8L A;  4GNX A;  2ZTE A;  3TEH B;  1RIP A;  1KC8 C;  4A3M B;  1Q90 A;  1C8C A;  1KNE A;  2E2D C;  3OPO A;  3T56 B;  4Q5V A;  4K2K A;  2R93 H;  4IO9 A;  1SNP A;  5BN3 A;  3N6R A;  4IAL A;  3T4A C;  1CT1 D;  1RF2 D;  2B63 H;  3VYS A;  4QB4 A;  3E3X A;  3M3Y B;  4B3R L;  3RUZ A;  2ZM6 Q;  4A3B G;  2ID0 A;  4TRD A;  2KJX A;  2B3G A;  3I70 A;  1GUS A;  3LWE A;  4B3S Q;  1YNN D;  3MXU A;  1QZH A;  2QEJ C;  2NUC A;  2EYO A;  2L9H A;  4HIO A;  3NK9 A;  3J80 i;  4KN4 C;  4CBV A;  4JI8 L;  1ZYR C;  2YTY A;  3IL8 A;  3KF8 A;  5FLM H;  2OCE A;  3H3V H;  4OEM B;  1I3Q B;  4MTN A;  2Z4I A;  3G71 A;  3PIO A;  5J39 A;  2H1E A;  1EL0 A;  4LFC Q;  2ZXP A;  4K2L A;  2TMP A;  2OWO A;  3GV3 A;  4A3L G;  3CC4 A;  3URY A;  3GTK B;  3U9S A;  1Y8N B;  4A3D B;  4NP5 A;  2X6G A;  1P16 A;  4DV7 L;  3HOZ G;  2YU9 B;  1IW7 C;  4NB3 A;  1U4R A;  5CGK A;  1STG A;  4IFD G;  1GKH A;  3S15 B;  4DK0 A;  1N34 Q;  2I07 B;  4P73 A;  2XTI A;  3STB D;  3NTH A;  4A3J G;  1MGS A;  1U4M A;  1Y1W H;  2E76 C;  1HFG A;  3MHB A;  1MD2 D;  1PYW D;  1WTH A;  3DLL A;  3EN2 A;  1PZI D;  1QCB D;  3FKI G;  1X54 A;  4FVM A;  1PTO H;  4EQO A;  3TRZ A;  4K14 A;  1RDP D;  3K5N A;  1UEB A;  3WOE A;  1XMO L;  1EIF A;  3GTQ H;  5BN4 A;  4NXM L;  1HFN A;  4IJH A;  2PCF B;  1EEF D;  1ET6 A;  4FYD A;  5JJI A;  4RCO A;  1FNU A;  2R3Z A;  4H44 C;  3OHX C;  1FJG Q;  2RVL A;  1CUK A;  3TSS A;  3S14 B;  2L5T A;  4QF4 A;  4UDU C;  1GXD C;  4A3B H;  2SOB A;  3D4D A;  1JWU D;  3GP7 A;  3KDF A;  2PW7 A;  1NAP A;  5D3I B;  1BVS A;  2BE5 C;  4KJO A;  1LO5 D;  3DWQ A;  3CC7 A;  2CHB D;  1CKO A;  3EFX D;  1ENA A;  2B2U A;  1YZ6 A;  5I6W A;  3BYT B;  2KQ3 A;  4C2M H;  5M5W B;  1VQ8 A;  5E7N A;  1TU2 B;  3DWP A;  4CDF C;  3MXN B;  5IE8 A;  2K32 A;  4EX5 A;  3MWY W;  5JPN C;  5KEE A;  4PMB A;  1EQT A;  2O5J C;  5JVH 3;  1F2L A;  2QF7 A;  4A3L H;  1F9Q A;  1QVG A;  1B7Y B;  3L3O C;  5EPK A;  4X3K A;  4BA2 I;  5M5X B;  1BCP D;  2Z6B A;  3MFG A;  1YBY A;  1G8Z D;  1HPC A;  1O78 A;  1MBY A;  3VR3 A;  1OXT A;  5IGF A;  3ICE A;  2CQO A;  4H02 A;  4KY7 A;  4Q0F A;  5EGT A;  1PRT F;  1EOV A;  4OHJ A;  1LM0 A;  5EBD A;  3RLN A;  3HGB A;  4IFD H;  3MFY A;  3HOX B;  3RR5 A;  1MI2 A;  5JJL A;  4GOP B;  5JJZ A;  3PCO B;  1Q8K A;  1BR9 A;  2N3S A;  2I0Q A;  1ICF B;  3J81 E;  1E22 A;  2F0J A;  1X3P A;  1MJE A;  1B70 B;  4X66 L;  1UE7 A;  4UP8 A;  3HOU B;  5BR8 Q;  5IT9 c;  1CQF A;  4LF6 Q;  1WTW A;  1X3G A;  3AFQ A;  2JP1 A;  3FKI H;  4CDD C;  2K28 A;  1EY7 A;  1FYC A;  3S2H H;  1U0L A;  1Y8P B;  2WP8 J;  3EVQ A;  2PQE A;  2A6E D;  5H1S E;  3ERO A;  1K0R A;  3EA6 A;  3HKZ B;  5GRO A;  3PO3 G;  3T1Y L;  1DM0 B;  1YHB A;  1EIY B;  3PUX A;  5FLX c;  2F4V L;  1NNX A;  1GUT A;  5CV7 A;  4JI1 Q;  1E2W A;  2CFM A;  1C0A A;  1GUW A;  4LF8 Q;  4DR2 Q;  2R7F A;  3K8A A;  5KYL A;  2G9D A;  1LTS D;  2LMC B;  2F1M A;  3UI2 A;  2UXC L;  3N52 A;  4A3M G;  1DOK A;  2ATW A;  4NDX A;  4JI4 Q;  4CJ1 B;  4AYB E;  4ZK9 B;  1X3E A;  1FR3 A;  4KTA A;  1QNU A;  3A8K E;  3AMU A;  5I9P A;  4IZ8 A;  2JSO A;  4Y7N H;  1VQK A;  2UXD L;  1SXT A;  2UUC Q;  5K5P A;  3ER0 A;  3BDC A;  1M8A A;  3NE5 B;  5HGQ A;  3A8J E;  4F7X A;  4HJ5 A;  4HIK A;  1PFB A;  2WIN B;  3DEP A;  4FXG C;  1EYC A;  4IJL A;  3AYH B;  2M2L A;  2MHV A;  4X64 Q;  4L6T B;  1YJW A;  3I7F A;  3HEJ A;  1EIH A;  1ICW A;  1YNX A;  2NVY B;  3RN2 A;  1IBL L;  5C4X B;  1VMP A;  2JA5 B;  1RCV D;  2IW3 A;  2EYL A;  4PQX A;  4RFB A;  1I4R A;  1TII D;  2K1B A;  5M9O A;  1I6V C;  1JOK A;  4A3I G;  1QZG A;  4DV5 Q;  1LTG D;  2D2C C;  2ZXO A;  4F88 A;  4E6I A;  1FNW A;  3HKS A;  2EQS A;  2PQA B;  1YJN A;  4C1N I;  1N36 Q;  3LWU A;  3PF4 A;  3K7A H;  1CSP A;  4YY3 Q;  3JAM E;  3K5M A;  2AQ1 B;  1IBK L;  4LF7 L;  5EAY A;  2NVQ B;  4RKL A;  2R93 B;  2B2W C;  3CW2 C;  3MEH A;  3IFD A;  1SND A;  4KKS A;  2JA6 H;  1SMY C;  3J7A F;  1PFM A;  2VQE Q;  2KBN A;  2X69 A;  4A3M H;  3O13 A;  1MSG A;  2DUD A;  1TY2 A;  3QR8 A;  3JAM L;  3HFZ B;  4TKO B;  4IUR A;  5IY0 A;  2BA0 A;  2UU9 L;  4LUV A;  3TS0 A;  4PZ7 A;  4RGO S;  1SAP A;  2RDH A;  3B6Y A;  3ITP A;  2XWB B;  3CHB D;  5C3E B;  2KHI A;  5I6Y A;  2NWG A;  1EYD A;  2SNS A;  2ZM6 L;  3M3Y H;  1LT6 D;  2FMC A;  2NZH A;  2KHS A;  1FD7 D;  3DM1 A;  4FXD A;  4ZYS A;  1J6Q A;  4B3S L;  5E4W C;  1IYJ B;  1WCM G;  3NBI A;  4QJF A;  1N9W A;  1PA6 A;  5C4H A;  2JE6 I;  4FO2 A;  2NN6 I;  1CKN A;  2IHE A;  3NEM A;  4RH6 A;  5M3M B;  5GAD C;  2B2Y C;  2WAC A;  3NTI A;  1RTO A;  2ZJP A;  1OXV A;  3MTS A;  2Y0S G;  4GLX A;  3I4N B;  3EQL C;  1I3Q H;  3CCE A;  4LFC L;  1LT4 D;  4KK7 A;  4R4Q A;  1NR2 A;  2LXJ A;  4RG1 A;  1K8O A;  5IYB G;  3BZK A;  1SMX A;  2EOT A;  3M7G A;  4XTC S;  3GTK H;  2EPB A;  4A3D H;  4K8I A;  3M7N A;  1V9P A;  1NY4 A;  2HDM A;  2QDL A;  3BZC A;  5J3B A;  2YU9 H;  3PO2 B;  2EYH A;  2B2W A;  1SDF A;  1XNR Q;  4KD3 A;  3C46 A;  3IRB A;  1EWI A;  1X32 A;  3I4M B;  2VUM B;  4V0B A;  3P20 A;  3Q6S A;  1ASZ A;  2OQK A;  4JI3 Q;  3HOX G;  1E3P A;  2Q8R E;  4A93 G;  3H0G G;  4KD4 A;  3S15 H;  2RKS A;  1NMF A;  2A74 C;  2KCM A;  2JA8 B;  1RHP A;  4DV2 Q;  1HNZ Q;  4I7A A;  2OTJ A;  1UUP A;  1HR0 W;  3P7J A;  1HUM A;  2CWP A;  3W2D A;  4AIM A;  4LF9 Q;  1U5K A;  2C35 B;  4P71 A;  3SDZ A;  1G2S A;  1EU3 A;  4OGQ C;  1VQ9 A;  3L7Z C;  3QJY A;  2RDF A;  5GQO A;  3KLW A;  1YJ9 A;  1XPU A;  2QGQ A;  1TWC B;  4ZKC B;  1IXR A;  2FHT A;  1TWA B;  1FJG L;  1N32 Q;  2B2Y A;  3S14 H;  4MHE A;  1V1P A;  1XTD A;  1SRO A;  4GKJ Q;  4DXG A;  4X6A H;  2P5Z X;  5JEA J;  4G57 A;  1VQE A;  4XYO A;  3CCS A;  5FO8 B;  1RD9 D;  1AH9 A;  2CW0 C;  2O4X A;  1W3S A;  3MC0 B;  5C5L A;  5M5W H;  3I55 A;  2H4O A;  1S40 A;  1QJO A;  2WII B;  2MGS A;  4IOA A;  2LSS A;  4TSS A;  5GAE C;  4JV5 Q;  4GN5 A;  5CBE E;  4DK3 C;  2HT1 A;  2NBF A;  4A4I A;  1O7Z A;  4WJ3 M;  4B9W A;  3OMC A;  2PI2 A;  2HUG A;  5IYB H;  2D0O A;  1VS0 A;  1JOQ A;  5M5X H;  1JJG A;  4JBK A;  3ZYY X;  1WD0 A;  1WTV A;  1JC7 A;  4P2C B;  2LFN A;  2K5N A;  2HIV A;  3V2T A;  2WB1 G;  2V1C C;  2I5M X;  1QB5 D;  3GTP B;  3HOX H;  1JWS D;  5ELE A;  3KBX A;  1VQO A;  3J80 E;  4DN4 M;  3W1B A;  4R4T A;  2PZT A;  1ASY A;  2FIN B;  2A69 D;  2VL6 A;  4G7O C;  2JA5 G;  4A3G B;  3VYR A;  1GUG A;  5BR8 L;  4LF6 L;  3HOU H;  2EYM A;  1JB3 A;  1LUZ A;  3K81 C;  1AEX A;  1QWY A;  5ELC A;  1HXY D;  5F2D A;  3Q24 A;  3NXW A;  4PV1 C;  5LMN Q;  3J80 L;  1E2Z A;  1F2M A;  2L0C A;  3CPF A;  2Q8I B;  5A2Q E;  4QQB X;  2R92 B;  1HA6 A;  1PH5 A;  3HKZ E;  2E2H B;  1B9N A;  1I4Q A;  5K36 G;  3JC6 6;  3UDX A;  2HDL A;  5ELD A;  1ILP A;  1SYE A;  4JI1 L;  4XXE A;  4OIJ A;  2H5X A;  4IUN A;  3HRZ C;  2R93 G;  4LF8 L;  1OO9 B;  5IGC A;  4DR2 L;  3R8B A;  2LKV A;  2DGY A;  5A2Q L;  4X3T A;  1PXU A;  2F4I A;  4IPC A;  5C5M A;  2B63 G;  2RHQ B;  3PUV A;  4GNX C;  4YHH Q;  4WJ4 A;  4QCL A;  4JI4 L;  5HGT A;  4IUV A;  3PIP 3;  2XIW A;  3TS2 A;  4OO1 G;  1YHA A;  2MO0 A;  3J7A 5;  2D5D A;  3CCQ A;  1A3U A;  1B44 D;  2IX3 A;  2AUK A;  4LW1 A;  2ZJR A;  1HJP A;  4JBM A;  4A3C G;  1MHW C;  3D6W A;  3SGI A;  3TP6 A;  4WRD A;  3S1Q B;  3V05 A;  2A6H C;  2E74 C;  2UUC L;  3OYY A;  4DV0 Q;  2ICE C;  5D3D A;  4P74 A;  1KQS A;  1SN8 A;  1HTL D;  2C5C A;  3QG1 A;  1BCP B;  3G6E A;  5M3M G;  2ZJQ A;  4X64 L;  4BY7 B;  2CQA A;  3J7A V;  1PH1 A;  1EY5 A;  4UY8 C;  1Y1V B;  4KV6 A;  2NVY H;  5EJW A;  5C4X H;  3RZO B;  2JA5 H;  3FMC A;  1Z9F A;  5ELB A;  4ID6 A;  3AU7 A;  4DAY A;  3PUY A;  5J22 A;  4JYA Q;  1H9K A;  3OWE B;  5ISR A;  1AN8 A;  1UNS A;  1L1O C;  4ODG A;  5DEH A;  3VA7 A;  1EWC A;  4DV5 L;  3MAQ A;  4PZ6 A;  3PO2 G;  1X3Q A;  1XTC D;  4JG2 A;  1HNX Q;  2K01 A;  4IPH A;  2YTX A;  1Y8O B;  1T5E A;  1N36 L;  1VQI A;  3K5L A;  2ASB A;  4RWS C;  1GOZ A;  3GTM B;  5K36 H;  4YY3 L;  1FGB D;  2KCT A;  1ZXT A;  4HED A;  4XQQ A;  2JA8 G;  1H9M A;  4NMZ A;  4BY1 B;  1SYF A;  3RZD B;  2NVT B;  2NVQ H;  3DEO A;  1PYB A;  3TZU A;  2UU9 Q;  2HCI A;  4QUF A;  2VQE L;  4XT3 B;  2B8G A;  4KMU C;  4O1N A;  5G3L D;  2I46 A;  1IW7 D;  2F0D A;  1B2T A;  2QEX A;  4OO1 H;  1JOO A;  3I3C A;  2EY2 A;  2UUB Q;  3H3V I;  4BXX H;  3NTK A;  3U50 C;  3F2C A;  3J81 c;  4MZ9 A;  5C3E H;  4A3C H;  3G7L A;  3BU2 A;  3F2U A;  3OIQ A;  3CXC A;  5I4D A;  4R4I A;  1I6H B;  1PTO C;  5EKK A;  1H95 A;  1OXX K;  3DUZ A;  1S3O A;  4J6H A;  3MA2 B;  4KKT A;  2JYO A;  4K5V A;  1WTO A;  5M3M H;  1VQD A;  4JI0 Q;  2B2U C;  1PH6 A;  2L4N A;  1L1O A;  3I4N H;  1ONL A;  3TP5 A;  4JCV E;  4OWT B;  1PDQ A;  5C4Z A;  3KF6 B;  4EQN A;  1S72 A;  1STE A;  5IOC A;  1LT5 D;  1JCK B;  4KY6 A;  4YCU A;  3SK5 A;  1F9S A;  3E9H A;  2AQ3 B;  3UE0 A;  5I2X A;  2BE5 D;  1HQM C;  1WTX A;  2NZO A;  2F0G A;  5I9O A;  1RL2 A;  2XGT A;  3TZD A;  3PO2 H;  2L15 A;  2WV6 D;  1XNR L;  3T53 B;  1BQQ T;  2PNH A;  4LF4 Q;  2FXQ A;  2A68 C;  1K9M C;  1DGS A;  2N49 A;  2VUM H;  3OWF A;  3I4M H;  4KLK A;  4JI3 L;  3H94 A;  4CJ2 C;  2E2I B;  1I5F A;  2MO1 A;  4DV2 L;  4R8I A;  1YNN C;  4R8N A;  1HNZ L;  2JA8 H;  4IFD J;  1CSQ A;  1VCI A;  3GTJ H;  1DJR D;  2A73 B;  3NBH B;  1E1O A;  1CZG A;  4C3J B;  1X65 A;  1PH7 A;  1D2B A;  1TQO A;  3GV6 A;  4LF9 L;  4KY5 A;  3FPP A;  3BJU A;  3FHW A;  1TWH B;  4CJ0 B;  1SSO A;  4POF A;  4A3F B;  3NSW A;  4LFA Q;  2NTS A;  2V4D A;  4K5W A;  1YNJ C;  4FF4 A;  2XRQ D;  4GS3 A;  1TWC H;  1TXY A;  1TWA H;  2KHJ A;  1N32 L;  4JK1 C;  1X56 A;  4DXF A;  1BOS A;  4GKJ L;  3W1G A;  1YI2 A;  2KEE A;  3GTO B;  1ENF A;  4XQJ A;  3ZJY C;  4KJN A;  4AYB G;  3K6O A;  4A75 A;  1PRT B;  2B2T C;  2RCF A;  1XMQ Q;  4IQZ A;  3IKJ A;  4GN4 B;  2M9V A;  4BA1 I;  2F0V A;  3STB C;  1LLR D;  4IFD I;  3F1Z A;  1C4Q A;  3E5S A;  1J8I A;  1EOT A;  2K7V A;  2Q2H A;  3CCU A;  4JV5 L;  1DCZ A;  2AUJ D;  4ABN A;  5CYU A;  3Q23 A;  1BO0 A;  4IOC A;  3BVZ A;  4ZRZ A;  2IHF A;  2Q2T A;  1E2V A;  3A8I E;  3WOF A;  3NWS A;  1TWF B;  4BBR B;  5CMD A;  2PMZ B;  1TWG B;  3V96 A;  1KAB A;  1LTI D;  3T51 B;  1HQR D;  1KXL A;  3K7U C;  1YHQ A;  3GTP H;  2TSS A;  3CCV A;  1M90 C;  2KED A;  4BY7 G;  3KOJ A;  1PH3 A;  1VQH A;  2OTL A;  4IUU A;  3NWT A;  1ET9 A;  3NQI A;  5T1I A;  3VR2 A;  1JT8 A;  1Y1V G;  2J4X A;  5C44 B;  1QIL A;  4ZQ3 A;  2F0F A;  4A3G H;  5CBA E;  2N78 A;  1GJX A;  3SR1 A;  1IKL A;  1K8A C;  5LMN L;  2BA1 A;  1A15 A;  4PMC A;  3VDY A;  3I8Z A;  2F0P A;  2B2V C;  2UUA Q;  2JXM B;  2EZV A;  3I73 A;  2A1A A;  2R92 H;  2R7Z B;  2JA6 G;  1F77 A;  2B2T A;  2E2H H;  2XRS D;  2PYK A;  2G9H D;  4KKU A;  1I4G A;  1PZK D;  1PYS B;  1F2Y A;  3GQB A;  4Z9C B;  4BY1 G;  3PUW A;  4K6L A;  4ZAI A;  2K75 A;  3LNN A;  2OQ0 A;  4LAA A;  4CDE C;  3OSO A;  1PHJ A;  3ERS X;  2D0P A;  3HOW B;  3CCL A;  3M4O H;  2F0H A;  1KLU D;  3GTG B;  3QO2 A;  3VA5 A;  4L5T A;  4YHH L;  4G7H C;  5DNF A;  4FNF A;  2DNC A;  5ELF A;  5FJ8 H;  4P75 A;  3M4Y A;  1Q81 C;  1A8V A;  4DA2 A;  1T5X D;  4DKA C;  3X3N A;  5JOB A;  3SK6 A;  4LJZ C;  3CD6 A;  2EXZ A;  4F8M A;  1KNA A;  1A63 A;  1HR0 Q;  2A8V A;  4DNI A;  3S1Q H;  2CH4 W;  4R4C A;  1M4V A;  4DV0 L;  4POG A;  3CMA A;  2A6E C;  3R93 A;  3SHL A;  1KAA A;  2JEA I;  5E3F A;  4GKK Q;  1A62 A;  4H0L C;  1SYB A;  4DV4 Q;  5JVG 3;  1PH4 A;  2N55 A;  1G51 A;  4BY7 H;  3CAM A;  5FOB B;  2WKC A;  1K3B C;  1Q1B A;  4JBJ A;  5DM6 3;  4A3D G;  2B29 A;  2BDN A;  4J1M A;  1Y1V H;  3ND9 A;  4EQ5 A;  2B2V A;  3PSI A;  3RZO H;  3A5Z B;  1DYQ A;  2L1B A;  1UE6 A;  5EKL A;  2DJG C;  1ILQ A;  4JYA L;  3Q8D A;  2IL8 A;  3GDE A;  1HHV A;  1PV4 A;  3PGZ A;  3P75 A;  3ULL A;  1HZ9 A;  4GNX B;  1EEI D;  1D5X C;  1HNX L;  3D31 A;  2Q8T A;  4DR7 Q;  1AE3 A;  4IPG A;  4DPG A;  3S9W A;  1JE4 A;  1HCZ A;  1EY9 A;  3GTM H;  3OMG A;  2X6L A;  4RGM A;  4NW2 A;  4EGV A;  4JOI A;  3H15 A;  1VF5 C;  1H9S A;  2WAQ B;  4BY1 H;  5AJ3 Q;  3RZD H;  2NVT H;  2HCC A;  3BDL A;  2N8N A;  1M1K C;  1EIG A;  3ULJ A;  2OEO A;  1NCV A;  3ND8 A;  1XPR A;  1KRT A;  5IIF A;  3DXJ C;  3S24 A;  3UDF A;  3MXP A;  5ELO A;  1PRT D;  1YEZ A;  1KD1 C;  3KF8 B;  2KCC A;  2K6A A;  2NYZ D;  1TR5 A;  1C7Y A;  2Z0S A;  3BYY B;  2UUB L;  1V43 A;  1A0I A;  2IJ0 A;  1IZ6 A;  1G6P A;  3NHH A;  1LT3 D;  5IT9 E;  4DAP A;  1QUQ A;  2LS0 1;  3U58 A;  3TQY A;  3MVV A;  1KTK A;  4OX9 Q;  3SXH A;  5KGU A;  2B39 A;  1Q8I A;  1TS3 A;  2IY5 B;  4AQY Q;  3HOV B;  1I6H H;  4C3H B;  4JI2 Q;  3H91 A;  3J81 i;  2EJM A;  1XJV A;  1NSN S;  4HAE A;  2J7Z A;  3IFT A;  2NB0 A;  1WTQ A;  3W5O A;  4JI0 L;  5IT9 L;  3K0X A;  4GN3 B;  2EJF C;  2E2J B;  1GUN A;  4IPD A;  3WWV A;  5IP7 H;  3VR5 A;  2MPM A;  4PZ8 A;  2VB2 X;  3UE1 A;  1FVI A;  4DNT B;  2QDB A;  1EY4 A;  1V8Q A;  1UEA B;  4HSP A;  1ML0 D;  2XVS A;  2Q2U A;  1EQR A;  2F3V A;  3I91 A;  4DAM A;  1HUN A;  4BBR G;  2Z1C A;  5FLX L;  5L37 A;  1PH9 A;  2EXD A;  1CHP D;  5C6A A;  1TT2 A;  4A3K B;  5IGD A;  3GTJ B;  4LF4 L;  1B3Q A;  4RMF A;  1SNM A;  3BDO A;  3HOU G;  2E2I H;  3S16 B;  3AEV A;  1PFS A;  1EY8 A;  2CH4 A;  2E5L L;  1K0S A;  1SEB D;  3W3A A;  3PIP A;  2SNM A;  3LGJ A;  3NPP A;  5M3F B;  5E4X A;  1FGU A;  3KDF B;  5C44 G;  1IBM Q;  1JR0 D;  4X65 Q;  1D1I A;  5JJK A;  3K0Y A;  4C3J H;  2FJ2 A;  5C3X A;  4DAV A;  4IUT A;  3HKZ G;  3J7Z C;  1CK1 A;  4LFA L;  1TWH H;  1SRU A;  5E1F A;  3ONA B;  3J81 j;  4A3F H;  3E0E A;  4GOP C;  2NVX B;  2ICI A;  1STY A;  4JBW A;  1EQV A;  1PTO F;  4ZCK A;  3G4S A;  2VS1 A;  1PZJ D;  4B3M Q;  2R7Z G;  4L5R C;  1B53 A;  4OWX B;  1A2U A;  1DXM A;  1I4P A;  4HJA A;  1AW7 A;  1PLF A;  1VQM A;  3D4W A;  2K5D A;  4MTK A;  4OXP A;  3GTO H;  1K8M A;  4QIW E;  1QVC A;  1KL9 A;  1EY6 A;  1RTN A;  1XMQ L;  1S5F D;  3S1R B;  3S1N B;  3VR4 A;  1ENC A;  5C0X G;  2PI2 E;  4CKE A;  4X62 Q;  2BOS A;  2KUM A;  1NR4 A;  4BBS B;  1VQA A;  5C3W A;  1D1K A;  1H9R A;  1CZW A;  1Q46 A;  2EVB A;  2K14 A;  3QOJ A;  4H7B A;  3HOZ B;  1FL0 A;  3R2T A;  2KEC A;  1XNQ Q;  3S17 B;  2VW9 A;  5NUC A;  4HTH A;  1TWF H;  4BBR H;  5IYD H;  1AE2 A;  1ESR A;  3SK4 A;  2MJ8 A;  4JC0 A;  2KCN A;  1LTR D;  2EYF A;  2PMZ E;  2WFW A;  4M1U B;  3KK7 A;  1I4H A;  2L12 A;  5C4X G;  2JN4 A;  4UP7 A;  1TWG H;  1ESF A;  5KND A;  3M4Q A;  4G4K A;  4JPB W;  4CKB A;  5JPM C;  1HH2 P;  1IHZ A;  4Y52 H;  2K4K A;  2PZW A;  2IT1 A;  1SNQ A;  5LMU Q;  4GOP A;  1XX8 A;  2GVB A;  3DM3 A;  5C44 H;  4DR5 Q;  2PW5 A;  4YCW A;  2A6H D;  4JI7 Q;  3MXG A;  4H13 C;  1L2F A;  1K28 A;  5A35 A;  2F0T A;  3TDQ A;  3I90 A;  2KOL A;  5JEA H;  2RBM A;  1D5Z C;  3QIA A;  2UUA L;  4RHR A;  4AH6 A;  2Z4H A;  3QOL A;  3OW7 A;  2R7Z H;  1HNW Q;  2UXB Q;  3HS0 C;  4PG3 A;  5LL6 S;  3M4O B;  4C3I B;  1YVC A;  2K5W A;  4JI6 Q;  2AKW B;  1AFP A;  3NEN A;  4RHS A;  4JI5 Q;  4BXX G;  2RCN A;  5IOD A;  3PQI A;  5C3E G;  3HOW H;  1KLG D;  1V1O A;  4MNO A;  5D14 A;  4JW0 A;  3GTG H;  1L0X B;  5C0X H;  1HA5 A;  2Z8L A;  3CRK C;  1EY0 A;  4DR3 Q;  3CQZ B;  4EQP A;  5FO7 B;  1SFO B;  1HR0 L;  1KDC A;  1S5D D;  2JA9 A;  4HCE A;  2F0M A;  3CME A;  3TP7 A;  1BBU A;  2AQ2 B;  1NJI C;  3HOV G;  5CV4 A;  4M8A A;  4C3H G;  2F0U A;  1VQ5 A;  3I4N G;  4GKK L;  3TP8 A;  1HZA A;  3GO5 A;  4UAI A;  4O2D A;  1R4P B;  4DR1 Q;  5DAU A;  2XN9 C;  4DV4 L;  1I94 Q;  2A5H A;  2RQX A;  1D5M C;  5COR A;  2B8F A;  1J9O A;  2QW7 A;  2DY7 A;  1W2B A;  3CP0 A;  1C48 A;  2HQE A;  2BCO A;  1JMC A;  4DNR B;  4ZUI A;  2GVA A;  1S5E D;  3VR6 A;  1YIT A;  3GD7 A;  2KA7 A;  3OOC A;  3KLS A;  1E1T A;  4X3S A;  3H3V C;  3I4O A;  1ZYR D;  2VUM G;  3I4M G;  4J8Q A;  4N8X 1;  3TN2 A;  1N8R C;  1BCP F;  3CF5 A;  4R4O A;  3I2Z A;  3PO3 B;  4DR7 L;  1H9S B;  4G7Z C;  1HTP A;  4A3E B;  2YTV A;  4OO1 I;  3GTL B;  1LTL A;  3T1H Q;  1EFW A;  5CV9 A;  2ZT9 C;  4N9T A;  1VQ4 A;  1G6Z A;  2PQA A;  3K57 A;  4LF5 Q;  1B50 A;  5AJ3 L;  2WAQ E;  3I4L A;  5M3F G;  3C1F A;  1SLJ A;  3KJO A;  1JQY D;  4L5S A;  4KHP Q;  2D9U A;  2BH8 A;  1PH2 A;  1WTR A;  1U9R A;  2SDF A;  3WDN A;  5IP9 G;  1CKN B;  1QUQ B;  2O5I C;  4WOR A;  2PZU A;  3Q0A A;  1LAB A;  2A68 D;  1NE3 A;  2VQF Q;  4HIM A;  3EIV A;  3SEB A;  1PH8 A;  4K6D A;  2HHH Q;  2OT2 A;  1D7Q A;  1R9T B;  3TRE A;  2ES2 A;  5M5Y H;  4KI0 A;  1VQC A;  2R7D A;  4I65 A;  4PMW A;  4OX9 L;  3FDT A;  4AQY L;  2K52 A;  4JI2 L;  4I7Z C;  3HOV H;  1S5B D;  4C3H H;  5LMN W;  3IAY A;  3H09 A;  4RGN A;  1AZQ A;  1TKW B;  2AMC B;  4R9W A;  5IWA Q;  3F2D A;  2PPB C;  1U4P A;  1SE8 A;  3KLS X;  3PUZ A;  1DD2 A;  3I56 A;  1Z7T A;  1G2T A;  4NPS A;  2E2J H;  1YIJ A;  1YNJ D;  4ALP A;  4BS9 A;  1SNC A;  4BBS G;  4CHT B;  4HMI A;  3A7L A;  4B9X A;  4DV1 Q;  3R2I A;  1XWE A;  1VQJ A;  4A3I B;  2SEB D;  1B4O A;  3D3R A;  5IGB A;  1CA5 A;  1N33 Q;  1DOM A;  1GHJ A;  3SK8 A;  4DK1 A;  1Q1E A;  2E5L Q;  1TVX A;  1KHI A;  2L11 A;  2F3I A;  1BKB A;  2CWA A;  2JEB I;  4A3K H;  3KJP A;  4DR4 Q;  2RDG A;  4V19 0;  2EY1 A;  3EJI A;  4IUQ A;  1KIX A;  4A3G G;  4FF2 A;  4LFB Q;  3S16 H;  2LXK A;  4MN3 A;  1Q3L A;  1TS4 A;  4OL7 A;  1B1Z A;  1GVP A;  2F0Q A;  1V1P B;  1SYD A;  1Z47 A;  2JJQ A;  5M3F H;  1IBM L;  4X65 L;  1IYV A;  3L0O A;  1BF4 A;  2R92 G;  2PNR C;  3TME A;  4HJ7 A;  3HOY B;  5IP9 H;  3NEL A;  3BZD B;  2NVX H;  1STB A;  2R6G A;  1QG7 A;  4UHV A;  4ZKB B;  3MZ5 A;  5GAH C;  4QIW B;  4B3M L;  4DR6 Q;  1OTC A;  2I5H A;  1DOL A;  1WCM B;  2DY8 A;  3D4R A;  4C3I G;  1LTT D;  4DUZ Q;  1D8L A;  4X3U A;  2F0W A;  1JOR A;  1X3F A;  5FJ8 G;  3D0F A;  2M00 A;  4A76 A;  1VQL A;  3F8T A;  2F0I A;  1WI5 A;  2DNE A;  2Y0S B;  1IL8 A;  2ENB A;  1A2T A;  4NXN Q;  3DMU A;  1Q82 C;  4XYQ A;  1HZB A;  3KFU A;  5EBC A;  3JAM c;  2BDO A;  4LUZ A;  4L5Q A;  1KRS A;  2E8G A;  3DWA A;  1Y69 U;  3S1R H;  3S1N H;  1G29 1;  4X62 L;  4K8J A;  4B3T Q;  2CCZ A;  4BBS H;  2MQH A;  3LX0 A;  2F0O A;  1TY0 A;  2HQL A;  1UAP A;  3RD4 A;  3OW2 A;  1MKH A;  1S4Z A;  3PMF A;  4RA8 A;  3HOZ H;  1SYC A;  1STA A;  1I50 B;  3M9B A;  3X3M A;  4HID A;  1XNQ L;  3S17 H;  4APV A;  1IKM A;  4YWL A;  1NBW A;  1C9O A;  1NTG A;  1LV9 A;  4A93 B;  2A19 A;  3H0G B;  3NUC A;  2JQO A;  2JA7 B;  1JJC B;  5D65 A;  5IGG A;  4OWW B;  5CC4 A;  1L0W A;  2DN8 A;  1PFN A;  4TVA B;  5FK9 C;  1EZ6 A;  2F0S A;  4A3J H;  1F2Z A;  3FP9 A;  3PIO 3; 
#chains in the Genus database with same CATH homology
 5BN5 A;  2NZ1 D;  2ZXR A;  2VNU D;  1AZP A;  1K83 B;  3S2D B;  1SE4 A;  3J81 L;  1BCP C;  1BDO A;  1DON A;  4EVO A;  1D6E C;  4F87 A;  4PNY A;  1EWH A;  5KIX A;  1ROD A;  1CQV A;  2RSN A;  1VMC A;  5C4J B;  3HZX A;  1S5C D;  1QNK A;  1O7Y A;  4ME5 A;  1EU4 A;  1ZKO A;  4DGZ A;  5EPL A;  2MP1 A;  4OIK A;  2IX0 A;  5EKI A;  1SMY D;  2VXW A;  1W6K A;  4C56 C;  3RLF A;  1EZ8 A;  3FVQ A;  4WJW A;  3L9A X;  5KRU A;  1AP0 A;  2QIL A;  4C1N K;  1CA6 A;  2WB1 B;  1EYA A;  4KHV A;  2FFK B;  3BVG A;  2O2L D;  1SYG A;  4DF7 A;  2IWH A;  2N88 A;  3RMH A;  5TSS A;  3CRL C;  1JIC A;  4DU9 A;  2NN6 G;  2VB3 X;  1KDB A;  1CHQ D;  5DM7 3;  1ZEQ X;  5COY A;  4HR7 B;  1O7L A;  3S1M B;  4XDX A;  2XNA C;  4ZUJ A;  5KYI A;  3CU7 A;  3NP8 A;  1HRJ A;  2J0T D;  3I72 A;  1I4X A;  2K03 A;  4NKL A;  3A56 A;  3QWN A;  2NTT A;  3BG3 A;  2QKI C;  3C1E A;  4C3J G;  2EY6 A;  4FXK C;  5HUR A;  5FO9 B;  4S3S A;  1PMR A;  3E0J A;  5IGE A;  2B63 B;  3VYU A;  1OXU A;  2KVM A;  2XSC A;  1XYI A;  3QB3 A;  1BXT A;  1L0Y B;  3HP3 A;  1OXS C;  2EDG A;  4MIU A;  2E75 C;  5M5Y B;  4L63 B;  3K58 A;  4ULL A;  5I2Y A;  2RA4 A;  2EYP A;  2F0L A;  5CV8 A;  5FLX E;  4RKB A;  5CV6 A;  4YIJ A;  5JAV A;  1WVL A;  2EY5 A;  2GA4 B;  5CR3 A;  1A6X A;  2NN6 H;  1NUC A;  1STH A;  4U68 A;  1Q12 A;  3E6Z X;  1II3 A;  1SNO A;  1IYU A;  1Z6H A;  2CW0 D;  1G91 A;  2R61 A;  2MUY A;  3D8G A;  2WKD A;  3BS1 A;  4O42 A;  2OXP A;  4FP5 D;  1PRT C;  1Y1W B;  4TQU S;  1B9M A;  1SE2 A;  2L55 A;  4CKC A;  1VDZ A;  3G6J B;  3FEW X;  1PTO B;  4WFN 3;  4DFA A;  5EQ0 A;  5LL6 X;  4N9P A;  3BVM A;  5AFW A;  3GTQ B;  3H6M A;  4KN7 C;  3TBI B;  5FKA C;  1JWM D;  2RSO A;  1SJH D;  4B08 A;  5JEA G;  1BUV T;  4HCS A;  4RGT A;  1F9P A;  2K33 A;  5J1Z A;  3M85 A;  1RJT A;  1BBX C;  4A3B B;  1DZ1 A;  3D6C A;  1XXG A;  5LHY 1;  3NBH A;  1A3T A;  1GHK A;  3SVM A;  3VYT A;  3C2P A;  2QCP X;  2XWJ B;  2EJG C;  1EFI D;  4C2M B;  3FRP B;  1FNV A;  1SE3 A;  5CV5 A;  1TS5 A;  4LMQ D;  2FMM A;  4U67 3;  1TS2 A;  4FF1 A;  1LTB D;  3KLR A;  2IX1 A;  2D62 A;  3HG9 A;  3MXN A;  3T16 A;  3AB9 A;  4RCN A;  5G3L F;  1A3V A;  3KBG A;  4BWG B;  2K04 A;  4IUP A;  3C3L A;  4HMJ A;  5C0X J;  1F9R A;  1CI3 M;  2K5Q A;  4XIG S;  4A3J B;  1CFM A;  2F03 A;  5EPJ A;  4HN7 A;  4K5X A;  3FKI B;  1QE6 A;  3S2H B;  2F0N A;  4IN3 A;  1MSH A;  4RAU C;  5KNC A;  3ERQ A;  1SBB B;  4QMG A;  1GUO A;  2AWN A;  1CTM A;  2AWO A;  2PO4 A;  4GZY C;  3SE0 A;  3KUP A;  3DHQ A;  1H9J A;  5C0X I;  4HSV A;  1LAC A;  2CVR A;  4CGY B;  3R3O A;  4XQN A;  4L8J A;  4AYB B;  2F0K A;  1KDA A;  2A69 C;  2EE1 A;  1STN A;  5KNB A;  4Y7N B;  3K59 A;  2F3W A;  2IPK D;  3A7A B;  2LY7 A;  3PV0 A;  1WD1 A;  1E0B A;  2C9O A;  2EYJ A;  1QOH A;  1BNZ A;  3NQT A;  2K05 A;  3J7Y W;  2F0E A;  3A54 A;  3Q22 A;  1WTP A;  5T1G A;  4KHZ A;  1B3A A;  3U9O A;  1SJE D;  1R4Q B;  1O80 A;  2YYZ A;  3T13 A;  1CM9 A;  4XT1 B;  3A55 A;  1VF7 A;  3CKI B;  1W6J A;  2OF1 A;  4LK1 C;  1PTO D;  3P1H A;  1RKN A;  1U4L A;  3K5O A;  4ILW A;  3K7A B;  4FF3 A;  3FPU B;  2JA6 B;  3OIP A;  1LTA D;  4QUC A;  4ZLT F;  4A3M B;  1Q90 A;  1C8C A;  1KNE A;  2E2D C;  3OPO A;  3T56 B;  4Q5V A;  4K2K A;  1SNP A;  5BN3 A;  3N6R A;  4IAL A;  3T4A C;  1CT1 D;  1RF2 D;  3VYS A;  4QB4 A;  3M3Y B;  3RUZ A;  2ID0 A;  4TRD A;  2KJX A;  3I70 A;  1GUS A;  3LWE A;  1YNN D;  3MXU A;  2QEJ C;  2NUC A;  2EYO A;  2L9H A;  3NK9 A;  4KN4 C;  4CBV A;  1ZYR C;  3IL8 A;  3KF8 A;  1I3Q B;  2Z4I A;  5J39 A;  2H1E A;  1EL0 A;  2ZXP A;  4K2L A;  2TMP A;  3GV3 A;  3URY A;  3GTK B;  3U9S A;  1Y8N B;  4A3D B;  4NP5 A;  2X6G A;  2YU9 B;  1IW7 C;  1U4R A;  5CGK A;  1STG A;  4IFD G;  3S15 B;  4DK0 A;  2I07 B;  3NTH A;  1MGS A;  1U4M A;  2E76 C;  1HFG A;  3MHB A;  1MD2 D;  1PYW D;  1PZI D;  1QCB D;  4FVM A;  4EQO A;  1PTO H;  4K14 A;  1RDP D;  3K5N A;  3WOE A;  5BN4 A;  1HFN A;  2PCF B;  1EEF D;  1ET6 A;  4FYD A;  4RCO A;  1FNU A;  2R3Z A;  4H44 C;  3OHX C;  2RVL A;  3TSS A;  3S14 B;  2L5T A;  4QF4 A;  4UDU C;  1GXD C;  2SOB A;  3D4D A;  1JWU D;  3GP7 A;  2PW7 A;  1NAP A;  5D3I B;  2BE5 C;  4KJO A;  1LO5 D;  3DWQ A;  2CHB D;  3EFX D;  1ENA A;  2B2U A;  5I6W A;  3BYT B;  2KQ3 A;  5M5W B;  1TU2 B;  3DWP A;  2K32 A;  3MWY W;  5JPN C;  5KEE A;  4PMB A;  1EQT A;  2O5J C;  5JVH 3;  1F2L A;  2QF7 A;  1F9Q A;  3L3O C;  5EPK A;  4X3K A;  4BA2 I;  5M5X B;  1BCP D;  3MFG A;  1G8Z D;  1HPC A;  1O78 A;  1MBY A;  3VR3 A;  1OXT A;  5IGF A;  4KY7 A;  4Q0F A;  5EGT A;  1PRT F;  4OHJ A;  5EBD A;  3HGB A;  4IFD H;  3MFY A;  3HOX B;  1MI2 A;  5JJZ A;  1BR9 A;  3J81 E;  2F0J A;  1X3P A;  3HOU B;  1CQF A;  1WTW A;  2JP1 A;  2K28 A;  1EY7 A;  1FYC A;  1Y8P B;  2WP8 J;  3EVQ A;  2PQE A;  2A6E D;  3ERO A;  3EA6 A;  3HKZ B;  1DM0 B;  3PUX A;  1GUT A;  5CV7 A;  1E2W A;  1GUW A;  5KYL A;  2G9D A;  1LTS D;  2LMC B;  2F1M A;  3UI2 A;  3N52 A;  1DOK A;  4NDX A;  4CJ1 B;  4ZK9 B;  1FR3 A;  4KTA A;  1QNU A;  3A8K E;  3AMU A;  5I9P A;  4IZ8 A;  2JSO A;  1SXT A;  5K5P A;  3BDC A;  1M8A A;  3NE5 B;  3A8J E;  4F7X A;  1PFB A;  2WIN B;  3DEP A;  4FXG C;  1EYC A;  2M2L A;  2MHV A;  4L6T B;  3HEJ A;  1EIH A;  1ICW A;  2NVY B;  5C4X B;  1VMP A;  2JA5 B;  1RCV D;  2IW3 A;  2EYL A;  4PQX A;  4RFB A;  1I4R A;  1TII D;  2K1B A;  5M9O A;  1I6V C;  1JOK A;  1LTG D;  2D2C C;  2ZXO A;  4F88 A;  4E6I A;  1FNW A;  4C1N I;  3LWU A;  3JAM E;  3K5M A;  2AQ1 B;  2NVQ B;  4RKL A;  2R93 B;  2B2W C;  3MEH A;  3IFD A;  1SND A;  4KKS A;  1SMY C;  3J7A F;  1PFM A;  2X69 A;  3O13 A;  1MSG A;  1TY2 A;  3JAM L;  4TKO B;  4IUR A;  2BA0 A;  4RGO S;  1SAP A;  2RDH A;  3ITP A;  2XWB B;  3CHB D;  5C3E B;  5I6Y A;  2NWG A;  1EYD A;  2SNS A;  1LT6 D;  2FMC A;  2KHS A;  1FD7 D;  3DM1 A;  4FXD A;  4ZYS A;  5E4W C;  3NBI A;  5C4H A;  2JE6 I;  4FO2 A;  2NN6 I;  4RH6 A;  5M3M B;  2B2Y C;  2WAC A;  3NTI A;  1RTO A;  1OXV A;  3MTS A;  3I4N B;  3EQL C;  1LT4 D;  4KK7 A;  1NR2 A;  1K8O A;  2EOT A;  3M7G A;  4XTC S;  2EPB A;  4K8I A;  3M7N A;  2HDM A;  3PO2 B;  2EYH A;  2B2W A;  1SDF A;  4KD3 A;  3C46 A;  1X32 A;  3I4M B;  2VUM B;  4V0B A;  3P20 A;  3Q6S A;  2Q8R E;  4KD4 A;  2RKS A;  2A74 C;  2JA8 B;  1RHP A;  1UUP A;  3P7J A;  1HUM A;  3W2D A;  3SDZ A;  1G2S A;  1EU3 A;  4OGQ C;  3L7Z C;  3QJY A;  2RDF A;  1TWC B;  4ZKC B;  2FHT A;  1TWA B;  2B2Y A;  4MHE A;  1V1P A;  4DXG A;  5JEA J;  4G57 A;  4XYO A;  5FO8 B;  1RD9 D;  2CW0 C;  2O4X A;  3MC0 B;  5C5L A;  2H4O A;  1QJO A;  2WII B;  2MGS A;  4TSS A;  5CBE E;  2NBF A;  1O7Z A;  4B9W A;  3OMC A;  2HUG A;  1JOQ A;  3ZYY X;  1WD0 A;  1WTV A;  1JC7 A;  4P2C B;  2LFN A;  3V2T A;  3GTP B;  1QB5 D;  1JWS D;  5ELE A;  3KBX A;  3J80 E;  4DN4 M;  2PZT A;  2FIN B;  2A69 D;  4G7O C;  4A3G B;  3VYR A;  1GUG A;  2EYM A;  1JB3 A;  1AEX A;  1QWY A;  5ELC A;  1HXY D;  5F2D A;  3Q24 A;  3NXW A;  4PV1 C;  3J80 L;  1E2Z A;  1F2M A;  2L0C A;  2Q8I B;  5A2Q E;  2R92 B;  1HA6 A;  2E2H B;  1B9N A;  1I4Q A;  5K36 G;  2HDL A;  5ELD A;  1ILP A;  1SYE A;  4XXE A;  4OIJ A;  4IUN A;  3HRZ C;  1OO9 B;  5IGC A;  3R8B A;  2LKV A;  5A2Q L;  4X3T A;  1PXU A;  2F4I A;  5C5M A;  3PUV A;  4QCL A;  5HGT A;  4IUV A;  3PIP 3;  2XIW A;  4OO1 G;  2D5D A;  1A3U A;  1B44 D;  2IX3 A;  2AUK A;  3D6W A;  3TP6 A;  4WRD A;  3S1Q B;  3V05 A;  2A6H C;  2E74 C;  2ICE C;  5D3D A;  2C5C A;  1HTL D;  3QG1 A;  1BCP B;  4BY7 B;  2CQA A;  3J7A V;  1EY5 A;  1Y1V B;  4KV6 A;  5EJW A;  3RZO B;  3FMC A;  5ELB A;  4ID6 A;  3AU7 A;  4DAY A;  3PUY A;  5J22 A;  1H9K A;  3OWE B;  5ISR A;  1AN8 A;  1UNS A;  4ODG A;  5DEH A;  3VA7 A;  1EWC A;  3MAQ A;  1X3Q A;  1XTC D;  2K01 A;  1Y8O B;  1T5E A;  3K5L A;  4RWS C;  1GOZ A;  3GTM B;  5K36 H;  1FGB D;  4XQQ A;  1ZXT A;  4HED A;  1H9M A;  4NMZ A;  4BY1 B;  1SYF A;  3RZD B;  2NVT B;  3DEO A;  3TZU A;  2HCI A;  4QUF A;  4XT3 B;  2B8G A;  4KMU C;  4O1N A;  5G3L D;  2I46 A;  1IW7 D;  2F0D A;  1B2T A;  4OO1 H;  1JOO A;  3I3C A;  2EY2 A;  3NTK A;  3G7L A;  3F2U A;  3OIQ A;  5I4D A;  1I6H B;  1PTO C;  5EKK A;  1OXX K;  3DUZ A;  4J6H A;  3MA2 B;  4KKT A;  2JYO A;  4K5V A;  1WTO A;  2B2U C;  2L4N A;  1ONL A;  3TP5 A;  1PDQ A;  5C4Z A;  4EQN A;  1STE A;  5IOC A;  1LT5 D;  1JCK B;  4KY6 A;  3SK5 A;  1F9S A;  2AQ3 B;  5I2X A;  2BE5 D;  1HQM C;  1WTX A;  5I9O A;  2F0G A;  3TZD A;  2WV6 D;  3T53 B;  1BQQ T;  2A68 C;  3OWF A;  3H94 A;  4CJ2 C;  2E2I B;  4R8I A;  1YNN C;  4R8N A;  4IFD J;  1VCI A;  1DJR D;  2A73 B;  1D2B A;  1CZG A;  4C3J B;  1TQO A;  3GV6 A;  4KY5 A;  3FPP A;  1TWH B;  4CJ0 B;  1SSO A;  4A3F B;  3NSW A;  2NTS A;  2V4D A;  4K5W A;  1YNJ C;  4FF4 A;  2XRQ D;  4JK1 C;  4DXF A;  1BOS A;  2KEE A;  3GTO B;  1ENF A;  4XQJ A;  4KJN A;  3K6O A;  1PRT B;  2B2T C;  4IQZ A;  3IKJ A;  2M9V A;  4BA1 I;  2F0V A;  1LLR D;  4IFD I;  1C4Q A;  3E5S A;  1J8I A;  1EOT A;  2K7V A;  1DCZ A;  2AUJ D;  4ABN A;  5CYU A;  3Q23 A;  1BO0 A;  3BVZ A;  4ZRZ A;  1E2V A;  3A8I E;  3WOF A;  3NWS A;  1TWF B;  4BBR B;  5CMD A;  2PMZ B;  1TWG B;  3V96 A;  1KAB A;  1LTI D;  3T51 B;  1HQR D;  2TSS A;  2KED A;  4IUU A;  3NWT A;  1ET9 A;  3NQI A;  5T1I A;  3VR2 A;  2J4X A;  5C44 B;  1QIL A;  4ZQ3 A;  2F0F A;  5CBA E;  1GJX A;  3SR1 A;  1IKL A;  2BA1 A;  1A15 A;  4PMC A;  3I8Z A;  2F0P A;  2B2V C;  2JXM B;  2EZV A;  3I73 A;  2R7Z B;  1F77 A;  2B2T A;  2XRS D;  2PYK A;  2G9H D;  4KKU A;  1I4G A;  1PZK D;  3GQB A;  1F2Y A;  4Z9C B;  3PUW A;  4K6L A;  4ZAI A;  3LNN A;  4LAA A;  3OSO A;  3HOW B;  2F0H A;  1KLU D;  3GTG B;  3QO2 A;  3VA5 A;  4G7H C;  5DNF A;  4FNF A;  2DNC A;  5ELF A;  3M4Y A;  4DA2 A;  1T5X D;  3X3N A;  5JOB A;  3SK6 A;  4LJZ C;  2EXZ A;  4F8M A;  1KNA A;  1M4V A;  2A6E C;  3R93 A;  3SHL A;  1KAA A;  2JEA I;  5E3F A;  4H0L C;  1SYB A;  5JVG 3;  2N55 A;  5FOB B;  2WKC A;  1Q1B A;  5DM6 3;  2BDN A;  4J1M A;  3ND9 A;  2B2V A;  1DYQ A;  2L1B A;  5EKL A;  1ILQ A;  2IL8 A;  1HHV A;  3P75 A;  1EEI D;  1D5X C;  3D31 A;  2Q8T A;  3S9W A;  1JE4 A;  1HCZ A;  1EY9 A;  3OMG A;  2X6L A;  4RGM A;  4NW2 A;  4EGV A;  1VF5 C;  1H9S A;  2WAQ B;  2HCC A;  3BDL A;  1EIG A;  2OEO A;  1NCV A;  3ND8 A;  5IIF A;  3DXJ C;  3MXP A;  1PRT D;  2KCC A;  2K6A A;  2NYZ D;  1TR5 A;  3BYY B;  1V43 A;  2IJ0 A;  3NHH A;  1LT3 D;  5IT9 E;  4DAP A;  2LS0 1;  3MVV A;  1KTK A;  3SXH A;  5KGU A;  2B39 A;  1Q8I A;  1TS3 A;  3HOV B;  4C3H B;  3H91 A;  2EJM A;  1NSN S;  4HAE A;  2J7Z A;  3IFT A;  2NB0 A;  1WTQ A;  5IT9 L;  2EJF C;  2E2J B;  1GUN A;  3VR5 A;  2MPM A;  2VB2 X;  4DNT B;  2QDB A;  1EY4 A;  1V8Q A;  1UEA B;  4HSP A;  1ML0 D;  2XVS A;  2F3V A;  3I91 A;  1HUN A;  2Z1C A;  5FLX L;  1CHP D;  5C6A A;  1TT2 A;  4A3K B;  5IGD A;  3GTJ B;  1SNM A;  3BDO A;  3S16 B;  1EY8 A;  1SEB D;  3W3A A;  2SNM A;  3NPP A;  5M3F B;  5E4X A;  1JR0 D;  1D1I A;  3K0Y A;  5C3X A;  2FJ2 A;  4DAV A;  4IUT A;  1CK1 A;  5E1F A;  3ONA B;  2NVX B;  2ICI A;  1STY A;  4JBW A;  1EQV A;  1PTO F;  1PZJ D;  1B53 A;  1A2U A;  1DXM A;  1I4P A;  1AW7 A;  1PLF A;  3D4W A;  2K5D A;  1K8M A;  1EY6 A;  1RTN A;  1S5F D;  3S1R B;  3S1N B;  3VR4 A;  1ENC A;  5C0X G;  4CKE A;  2BOS A;  2KUM A;  1NR4 A;  4BBS B;  5C3W A;  1D1K A;  1H9R A;  1CZW A;  2EVB A;  3QOJ A;  4H7B A;  3HOZ B;  3R2T A;  2KEC A;  3S17 B;  5NUC A;  4HTH A;  1ESR A;  3SK4 A;  2MJ8 A;  2KCN A;  1LTR D;  2EYF A;  4M1U B;  3KK7 A;  1I4H A;  2L12 A;  1ESF A;  5KND A;  4G4K A;  4CKB A;  5JPM C;  1IHZ A;  2PZW A;  2IT1 A;  1SNQ A;  1XX8 A;  2PW5 A;  2A6H D;  3MXG A;  4H13 C;  5A35 A;  2F0T A;  3TDQ A;  3I90 A;  2KOL A;  5JEA H;  2RBM A;  1D5Z C;  3QIA A;  4RHR A;  2Z4H A;  3QOL A;  3OW7 A;  3HS0 C;  5LL6 S;  3M4O B;  4C3I B;  2K5W A;  1AFP A;  4RHS A;  5IOD A;  1KLG D;  1V1O A;  5D14 A;  1L0X B;  5C0X H;  1HA5 A;  2Z8L A;  3CRK C;  1EY0 A;  3CQZ B;  4EQP A;  5FO7 B;  1SFO B;  1KDC A;  1S5D D;  4HCE A;  2F0M A;  3TP7 A;  2AQ2 B;  5CV4 A;  4M8A A;  4C3H G;  2F0U A;  3TP8 A;  3GO5 A;  4UAI A;  1R4P B;  5DAU A;  2XN9 C;  2A5H A;  1D5M C;  2RQX A;  5COR A;  2B8F A;  1J9O A;  2DY7 A;  1C48 A;  2HQE A;  2BCO A;  4DNR B;  4ZUI A;  1S5E D;  3VR6 A;  3GD7 A;  2KA7 A;  3OOC A;  3KLS A;  4X3S A;  3H3V C;  1ZYR D;  4J8Q A;  3TN2 A;  1BCP F;  3PO3 B;  1H9S B;  4G7Z C;  1HTP A;  4A3E B;  4OO1 I;  3GTL B;  5CV9 A;  2ZT9 C;  4N9T A;  1G6Z A;  3K57 A;  1B50 A;  3I4L A;  3C1F A;  1JQY D;  2D9U A;  1WTR A;  1U9R A;  2SDF A;  3WDN A;  2O5I C;  4WOR A;  2PZU A;  3Q0A A;  1LAB A;  2A68 D;  3SEB A;  4K6D A;  2OT2 A;  1R9T B;  4KI0 A;  4I65 A;  4PMW A;  3FDT A;  4I7Z C;  1S5B D;  3IAY A;  3H09 A;  4RGN A;  1AZQ A;  1TKW B;  4R9W A;  2PPB C;  1U4P A;  3KLS X;  3PUZ A;  1DD2 A;  1Z7T A;  1G2T A;  1YNJ D;  4BS9 A;  1SNC A;  4CHT B;  4HMI A;  3A7L A;  4B9X A;  3R2I A;  1XWE A;  4A3I B;  2SEB D;  1B4O A;  3D3R A;  5IGB A;  1CA5 A;  1DOM A;  1GHJ A;  3SK8 A;  4DK1 A;  1Q1E A;  1TVX A;  2L11 A;  2JEB I;  2RDG A;  4V19 0;  2EY1 A;  3EJI A;  4IUQ A;  4FF2 A;  4MN3 A;  1Q3L A;  1TS4 A;  4OL7 A;  1B1Z A;  2F0Q A;  1V1P B;  1SYD A;  1Z47 A;  1IYV A;  1BF4 A;  2PNR C;  3TME A;  3HOY B;  3BZD B;  1STB A;  2R6G A;  1QG7 A;  4ZKB B;  3MZ5 A;  4QIW B;  1DOL A;  1WCM B;  2DY8 A;  3D4R A;  4C3I G;  1LTT D;  4X3U A;  2F0W A;  1JOR A;  2M00 A;  2F0I A;  2DNE A;  2Y0S B;  1IL8 A;  2ENB A;  1A2T A;  3DMU A;  4XYQ A;  5EBC A;  2BDO A;  3DWA A;  1Y69 U;  1G29 1;  4K8J A;  3LX0 A;  2F0O A;  1TY0 A;  1UAP A;  3RD4 A;  1S4Z A;  3PMF A;  4RA8 A;  1SYC A;  1STA A;  1I50 B;  3X3M A;  1IKM A;  1LV9 A;  4A93 B;  3H0G B;  3NUC A;  2JA7 B;  5D65 A;  5IGG A;  5CC4 A;  2DN8 A;  1PFN A;  5FK9 C;  1EZ6 A;  2F0S A;  1F2Z A;  3PIO 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...