4JOIA

Crystal structure of the human telomeric stn1-ten1 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
160
structure length
141
Chain Sequence
LAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKVYDQPFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CST complex subunit STN1
publication title Structure of the human telomeric stn1-ten1 capping complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 39
structure length 141
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4joiA00
2RCNA 4MZ9A 2OCEA 4HJ5A 4BBSG 1SROA 3Q8DA 4GNXC 3HOWG 4JYAL 5IWAL 2D62A 2XTIA 1O7IA 4AIMA 1CKNA 3S1MH 4RG1A 1IZ6A 4YY3Q 1E1TA 4POFA 3J80c 5E7NA 2MFIA 3K7UC 4BXXG 3RZDH 4DV2Q 3M85A 1B8AA 1LTLA 5FLXc 1P16A 5IYBH 1PH3A 4JI1Q 3RZOH 1N32L 4UP7A 2NVTH 1EYGA 3HOUH 1U5KA 4LW1A 5IY0A 1Y1WG 3U50C 5LMUQ 2GN5A 4BA2I 4IOAA 1X56A 4A3CG 1CKMA 3U4ZA 3S14H 4JI6Q 3I4NG 2VQEL 5M5WH 2Y0SG 3I4MH 1Q12A 3E9HA 4DR7Q 1MIUA 2D0OA 3KOJA 4DNIA 3CAMA 4DV6Q 1TWFH 1BKBA 3H0GH 3WWVA 2PMZE 4YCUA 4L5RC 4JV5Q 4YCVA 2VUMH 3RN5A 1VQ8A 4DV5L 3K0XA 2FXQA 2WB1E 1YHQA 5H1SE 2E5LQ 4HJ7A 1QVFA 4NB3A 4AQYQ 1KHIA 2ZTEA 3D0FA 1NMGA 1HZBA 2VQFL 1BBUA 5JJKA 3PUYA 1VQ9A 4B3SL 2H5XA 4JI3Q 2HQLA 2UXCQ 4X66L 4LF5Q 2B63H 3S16H 2BA0A 4DV4Q 3FKIG 2DUDA 4HIMA 3G6EA 1WYDA 3H3VI 4DR5Q 3S2DH 1N9WA 5K36G 2JEBI 1B7YB 1HNZQ 1D8LA 1Q86C 1EUJA 3CQZH 3KF6B 4A3JH 1PV4A 2UUCQ 1I6HH 3GTGH 4JOIC 3CCQA 1GM5A 3PIPA 4OWWB 4RMFA 1Y14B 3CCLA 1XPUA 4JI5L 5BR8Q 2ZJPA 1XNRQ 4A3BH 3F1ZA 3HFZB 5C3EG 2JA6G 2BA1A 1VQ6A 4JI2Q 3KFUA 2I5HA 3AQQA 2NN6G 1YJ9A 5GAGC 3CCVA 2XGTA 5C4XH 3CCUA 4KHPL 2DGYA 1OXSC 1K8GA 2D0PA 4JI8L 3PO3H 1Y1VG 1JMCA 4C2MH 4C3JH 1W3SA 5C4JH 4LF4Q 2E8GA 4A93G 4IJHA 3ZJYC 3RR5A 1N34L 4QL5A 2UUAQ 1EIFA 4BBSH 1CSPA 4KI0A 4P75A 1DGSA 3HOWH 1HH2P 3STBC 1JT8A 4JI7Q 1VQIA 1Z9FA 4DR1L 2OTJA 4OO1I 3OTOQ 2LXJA 4B3TL 4H02A 5C44G 1XNQQ 3RLNA 4BXXH 4LFBL 3GTKH 4DR6Q 3T1HL 2HT1A 1VQBA 1VQNA 4WJ3M 3GTPH 3S15H 3KDFB 2E2IH 1I94Q 1YHAA 1A63A 1QUQB 5J3BA 1Y1WH 2NN6I 3I55A 4R4OA 1KXLA 2MO0A 5AJ3L 1I5FA 4L5QA 1HR0Q 4J15A 2HIVA 1V1QA 1X6OA 4A3CH 4B3ML 3I4NH 2Q2HA 4X64Q 4YWLA 2CFMA 1VQOA 2EXDA 3BU2A 4YY3L 1PH2A 4DUYQ 1ASZA 4OONA 1XTDA 4GKKQ 2ALYB 4DV2L 1VQLA 4P72A 4B3RQ 3J81i 4A3GG 1W2BA 2YTXA 4JBMA 3F2DA 2MNAA 4A75A 2IY5B 3M3YH 5LMUL 3HOVG 3A74A 2Q2UA 1EQRA 1UEBA 2N3SA 3I56A 4P71A 4HJAA 1SR3A 5M3FG 2BH2A 3S2HH 4Y7NH 3JAMi 4OXPA 1E24A 3EN2A 4LFCL 1Q1BA 1AE2A 1HNXQ 1X3EA 1XMOQ 3NBHB 1WOCA 2PQAA 4IFDI 2V1CC 5JJIA 4HIKA 2KHJA 3FKIH 3L2PA 1WCMG 1CUKA 2PI2A 1Q81C 4GN4B 3CCEA 1IYJB 3AFQA 2JE6I 1CKOA 3PCOB 4DV6L 1J5EQ 4LF7Q 3UE0A 1G6PA 2K75A 3CCJA 1PH7A 1IBLQ 4JV5L 5EAYA 2K14A 4TQUS 1L1OA 3M9BA 2JA5G 2QEXA 3UE1A 4DV7Q 4NXNQ 4MTNA 1JB7A 2CWPA 2IT1A 4DR3Q 4AQYL 1XMQQ 2UUBQ 2AWOA 2Q2IA 1JE5A 3S17H 2IHFA 1PH4A 1HNWL 5C3EH 3U58A 4JI3L 5DLQE 1X9NA 2JA6H 2UXCL 1YJNA 4LF6Q 1WFQA 2WP8J 1OTCA 2YU9H 1HZ9A 4UPAA 2AMCB 3DM3A 4GOPA 4DR5L 3CP0A 1Q82C 4O0AA 1VQFA 3OW2A 1VQDA 2PI2E 1Y1VH 4GNXA 5JEAG 1L2FA 4A3FG 2A19A 4A3EG 4A93H 3W5OA 5BR8L 3M4OH 5GQOA 3VDYA 4DV0Q 3G4SA 1XNRL 4HJ8A 4OX9Q 2KCTA 1BBWA 3GTLH 4JI2L 1N33Q 4K0KL 4LNQA 4DR4L 3T1YL 4GLVB 4X62L 5C44H 1VQ5A 1NBWA 1PH1A 1VQEA 2OTLA 4LF9Q 1IXRA 1VQ4A 4JC0A 3NELA 1J6QA 2UXBL 4A3MG 3K80C 1A8VA 3MEFA 2KCMA 1LUZA 2ZM6Q 5M5XH 1K9MC 3PF4A 2C35B 2UUAL 2AKWB 3ULLA 4OWXB 2YTVA 1HJPA 3BZKA 1E22A 1JJCB 2EIFA 3HOXG 1S72A 4C3HH 2WAQE 3B6YA 4GKJQ 1PVOA 4DR2Q 1L0WA 4DK6C 3CC7A 4BY7G 3NENA 3F2BA 3AFPA 2E2HH 2A1AA 1E3PA 5HY6A 1IBMQ 2PNHA 5JEAJ 1KC8C 1N36L 1R9TH 4JI0Q 4QGUA 2R7DA 4GS3A 1K73C 3M7NA 4DR6L 1UE7A 4IPGA 4A3GH 1B70B 3PF5A 3CC2A 2R92G 3ICEA 1NTGA 1I94L 4LF8L 1KAWA 1GKHA 3W1BA 3HOVH 5M3FH 3CXCA 2LXKA 1TWCH 1X65A 1Q8KA 4A3IG 3TS2A 1SMXA 4HIOA 3KYHC 1A62A 4X64L 2CKZB 1VQHA 2GVBA 2JA9A 1PYSB 2AHOB 3D31A 1SLJA 5LMNW 1QZHA 3HKZG 4A76A 1WCMH 5LMNL 2ATWA 4B3RL 2R6GA 3CCSA 3F8TA 2Z6KA 1G291 2N49A 2HHHQ 2ZTCA 3J7ZC 3CCMA 4UY8C 2VQEQ 3U4VA 4X65Q 3AEVA 3S1QH 2JA5H 3CCRA 1AH9A 2B3GA 1FVIA 1VQ7A 1PH5A 1X55A 2VZAA 3A0JA 1Q46A 4WJ4A 4EX5A 1FL0A 2Y0SE 3L7ZC 4IPDA 3KF8B 1IBKL 1D7QA 4DV5Q 1IL2A 1VQCA 3KJOA 3ULJA 2K4KA 2KENA 1YI2A 1FJGL 1XPOA 5IP9G 4X65L 1N8RC 4LF7L 3I4OA 3CPWA 4XIGS 4BY1G 3CPFA 2VQFQ 1HZAA 1FGUA 4DUZQ 1S3OA 4A3FH 1YJWA 4NXNL 3UDXA 4A3EH 4X66Q 3BJUA 3HKSA 5C0XG 4LFAQ 1XMQL 2UUBL 4POGA 4NPSA 3J7A5 4O2DA 3STBD 1AE3A 1X3FA 5IYCG 2JA7H 3PUZA 4DV1Q 4LF6L 3G71A 2YV5A 4JI1L 4UP8A 3IRBA 3S1NH 4JI4Q 1YNXA 5FLMG 4TVAB 3CW2C 1G51A 2KBNA 1NE3A 3CMAA 4A3LG 3UDIA 1GVPA 1NJIC 2AWNA 3M4PA 3CC4A 1PA6A 4YHHQ 4P73A 4PZ7A 4A3MH 1VS0A 3DLLA 4QQBX 4JI6L 1KL9A 4ME3A 3K81C 3KDFA 4QIWE 3HOZG 4QY7A 2F4VQ 3GTMH 1PH9A 4DR7L 4R4TA 3TREA 4DV0L 2NZHA 3ERSX 3HOXH 3RN2A 4OX9L 5FJ8G 2WB1G 4IOCA 1L1OB 2LSSA 2RHQB 1OXXK 4JI8Q 4R4IA 4A3KG 3W1GA 4R4CA 1MJEA 3HOYG 4BY7H 1VCIA 1CKNB 5C0XI 3H15A 4IO9A 1N34Q 3ULPA 2ID0A 3HKZE 1UWVA 4LF9L 4R1JA 3J80i 4DAYB 3J81c 1QZGA 5C0XJ 1HZCA 1VQGA 1L1OC 4LUZA 1EFWA 2E5LL 2R92H 3TS0A 1KIXA 2CQOA 4GOPB 1Q7YC 1PHJA 3PV0A 4P74A 3GTQH 4B3TQ 5GAEC 4JG2A 3GO5A 4LF5L 1JJ2A 4DV4L 4A3IH 4GNXB 5IE8A 4LFBQ 1PH6A 4GKJL 1WJJA 2K52A 4GN3B 4DR2L 2QA4A 1QVGA 1ASYA 4DK3C 3RLFA 1HNZL 4GOPC 3KJPA 2IX0A 1KD1C 2JA8G 1EOVA 5IP7G 2ZJRA 2UUCL 1SRUA 4JI0L 2MO1A 5AJ3Q 3CD6A 1C0AA 1VQAA 2VS1A 5IYDG 4B3MQ 4GLXA 4A4IA 5IT9c 1CSQA 2CWAA 3S24A 4DV3Q 1QVCA 1TXYA 2ASBA 4A3DG 4YCWA 4APVA 3A5ZB 4LWCA 2ZTDA 2F3IA 3L0OA 2JK8A 1VQKA 3ER0A 2OQ0A 2K5VA 2R93G 3E9IA 1TWAH 4BA1I 1LYLA 5JJLA 4JCVE 2UU9Q 2NVYH 3TQYA 1Q1EA 5IP9H 2OWOA 4NXMQ 2HHHL 4GN5A 4PZ8A 1OXUA 4LF4L 1KRSA 4BY1H 4LFCQ 1H95A 1MKHA 4X6AH 3PUWA 1RL2A 1PFSA 3EIVA 4BBRG 4XTCS 4LUOA 5ELOA 4JI7L 4ALPA 3TRZA 3OTOL 1GO3E 3UDFA 1VQJA 1XJVA 1U0LA 3K8AA 1KQSA 1XNQL 3PO2G 2QGQA 3BZCA 4KLKA 5GROA 4HJ9A 5IYCH 1E7ZA 1YHBA 2IHEA 3FHWA 1VQPA 1YBYA 3LGJA 2KHIA 2NVQH 1K83H 1RIPA 4L5SA 1EQQA 4JYAQ 5IWAQ 1P8LA 5FLMH 2R7ZG 4JBWA 4A3LH 1HR0W 2K5NA 1I50H 2Q2TA 4PG3A 2N8NA 1HNWQ 2WFWA 4DUZL 1HR0L 2JEAI 3PUVA 1Z47A 3HOZH 2NVXH 2ZJQA 4LFAL 1N32Q 1JJGA 1SN8A 3AYHB 3J81j 1E1OA 4DUYL 1M1KC 5M3MG 4YWKA 4GKKL 4QJFA 5FJ8H 2JA7G 4JOIA 4A3KH 2JQOA 4DV1L 2ES2A 3HOYH 3NEMA 4JBJA 2YYZA 3PSIA 4OO1G 3KLWA 4JI4L 4C3IH 5HGQA 1PH8A 2I0QA 2Z6KC 1SE8A 3GDEA 1C7YA 4AYBG 3KF6A 2VNUD 2A8VA 1MJCA 1UE1A 3EBEA 4YHHL 3CMEA 1C9OA 1T9HA 4K0KQ 4JBKA 3I7FA 5ELNA 5IYBG 1XMOL 1HNXL 4DR4Q 3T1YQ 1K3RA 4X62Q 2F4VL 4L5TA 2L15A 4HIDA 3HOUG 2UXDQ 3RNUA 1EWIA 3MXNB 1J5EL 1PYBA 3PGZA 1V43A 2UXBQ 1M90C 3PIOA 1IBLL 2JA8H 2VY3A 5IP7H 2HIXA 4B3SQ 3I4MG 3TEHB 2GVAA 2VW9A 2K50A 4DV7L 1YITA 2UXDL 1NMFA 4DR3L 5IYDH 4IPHA 3UDGA 2I5LX 1VQMA 3H0GG 1NY4A 2EQSA 2F52A 3JC66 4UP9A 1IBML 4A3DH 2VUMG 1TWGH 3GTJH 3SGIA 1N36Q 4DPGA 4PMWA 4FDBA 4OWTB 3CF5A 1KRTA 1LM0A 3PUXA 4IPCA 4PZ6A 2JJQA 4KHZA 2PQAB 4JI5Q 4IFDG 2R93H 4LF8Q 1OXVA 5GADC 5M5YH 3H3VH 3F2CA 2YTYA 1BVSA 2K5HA 3I2ZA 3M4QA 5GAHC 1EIYB 2B63G 3A5UA 1X3GA 1S40A 1QUQA 2IX1A 4DV3L 1A0IA 3RLOA 1V9PA 4BBRH 4KHPQ 4Y52H 2R7FA 1WI5A 4AH6A 1N33L 2BH8A 4IJLA 4A3JG 2B29A 5LMNQ 3PO2H 2E2JH 1K8AC 2RF4A 4R4QA 3OYYA 2OQKA 2VL6A 3S1RH 1UE5A 2N78A 1IBKQ 3GTOH 4EQ5A 2MQHA 4A3BG 2Z0SA 2R7ZH 2WAQG 2UU9L 4NXML 1X54A 1YEZA 2ZM6L 1XPRA 4DKAC 4DR1Q 3GD7A 3E0EA 3FP9A 2RHSB 4MNOA 4YWMA 4LUVA 3K7AH 4DAMA 3JAMc 1I3QH 1YVCA 4GLAC 1K0RA 3PO3G 4AYBE 5C4XG 1UE6A 1YZ6A 2I5MX 3T1HQ 2CCZA 3G48A 4IFDJ 2NZOA 1YIJA 5M3MH 1SFOH 1TWHH 1GD7A 1FJGQ 1OXTA
chains in the Genus database with same CATH superfamily
2ENBA 1SROA 3BVMA 1EQTA 4R9WA 4GNXC 2MJ8A 4AIMA 1IZ6A 1WCMB 2DN8A 3RUZA 1Y8PB 5E7NA 3K7UC 4BXXG 4DAYA 1B8AA 1LTLA 4JI1Q 5CYUA 3D6WA 3IFTA 2JA5B 1EYGA 3HOUH 4LW1A 3TZUA 4HEDA 2QW7A 3A55A 2GN5A 1X56A 3S14H 3EVQA 3E9HA 5EKLA 5JPMC 1J9OA 4DFAA 3D4DA 5E4WC 3LNNA 1MIUA 3KOJA 4DNIA 3I91A 2PMZE 4YCUA 4YCVA 2B2YA 4ABNA 3PIP3 2KEEA 3QJYA 5H1SE 4DXFA 3T53B 4G4KA 2RKSA 4ZLTF 1HZBA 1BBUA 5JJKA 3PUYA 3S9WA 4JI3Q 2H5XA 4RAUC 2UXCQ 5HGTA 3S16H 2BA0A 3FKIG 5FO8B 4HIMA 1WYDA 3S2DH 1N9WA 5K36G 1UNSA 1D8LA 5EKIA 4CDEC 1S5DD 3KF6B 2UUCQ 1I6HH 4RCNA 2D5DA 4JOIC 5JAVA 1ZKOA 3CRLC 2ZJPA 3SK5A 5KYIA 2JA6G 2BA1A 4UAIA 1A2UA 3WOEA 4BY7B 3LX0A 2F0HA 5C4XH 2QDLA 3OIPA 3PO3H 4JI8L 2R7ZB 1IHZA 1JMCA 4C3JH 1W3SA 1QB5D 5C4JH 3H09A 1N34L 4QL5A 3SK8A 4P75A 4JI7Q 3SVMA 3L3OC 4OO1I 2LXJA 1KNAA 4BXXH 3SXHA 2F0LA 4DR6Q 2E2IH 1STAA 4L63B 1EY7A 1YHAA 4AYBB 3TP8A 3I55A 1K0SA 1FYCA 3OIQA 4L5QA 3NHHA 3A8IE 4L6TB 1V1QA 2C5CA 5CV9A 4C3HG 4X64Q 2A69D 1TWAB 4Q5VA 1CA6A 1C48A 3DWAA 2KJXA 3W3AA 4DU9A 4DV2L 2EY6A 4B3RQ 1C8CA 1DCZA 3S14B 4MHEA 5LL6S 4MIUA 3HEJA 1EQRA 2N3SA 2M00A 1E24A 4LFCL 1XMOQ 3VA7A 3E3XA 3FKIH 1CUKA 4M1UB 5K36H 1ONLA 2JE6I 1CKOA 5KNBA 1G6PA 3UE0A 1TQOA 3H6MA 1PH7A 1Q90A 1L1OA 1JWMD 2PMZB 3S16B 4DV7Q 4NXNQ 1QJOA 1JB7A 2NVXB 3MA2B 3CRKC 2C9OA 2Q2IA 1AW7A 2IHFA 4A3KB 1IYUA 2N55A 3U58A 2JA6H 1X9NA 1OTCA 4RH6A 1TS5A 2ICEC 4UPAA 1O78A 1D6EC 4DR5L 3MXUA 4O0AA 1F77A 1VQDA 1L2FA 4A3FG 2A19A 4CKCA 4DK0A 3PO3B 1XNRL 3G4SA 3CU7A 4HJ8A 1BBWA 1R4PB 3ITPA 1TVXA 1RF2D 1GHKA 4X62L 1K8OA 1NBWA 1U9RA 4IQZA 5TSSA 1PH1A 3IFDA 2OTLA 4JVZA 1IXRA 1ZXTA 4A3MG 3K80C 3NP8A 1A2TA 1LUZA 1HPCA 2F0NA 3NSWA 4PV1C 2G5DA 1SYBA 2EPBA 2YTVA 2EIFA 4C3HH 1PVOA 1KLGD 2I07B 4DA2A 4HMIA 2E2HH 1T5XD 1E3PA 3C2PA 1N36L 1R9TH 1B70B 3CC2A 3QIAA 1RODA 3BVGA 3NQTA 4BBRB 1NTGA 1I94L 2D2CC 1VMPA 1HQRD 4XT3B 3H3VC 3NBIA 1EZ8A 3CXCA 2E2JB 1TWCH 4O42A 2HUGA 2EJMA 4HIOA 3KYHC 2CKZB 1EU4A 2JA9A 1PYSB 1KAAA 1S5ED 2K1BA 3DMUA 1H9JA 5I2YA 3DEPA 4X3SA 3VYRA 1WTWA 3F8TA 2ZTCA 3CCMA 3GP7A 2NB0A 3AEVA 1IL8A 1B4OA 1SYDA 2G9DA 1SJED 1X55A 3VR3A 5ISRA 2Z6BA 3OW7A 1IBKL 1D7QA 1LT5D 4DV5Q 1PTOC 1IL2A 1A3UA 5IP9G 3SK6A 1N8RC 3I4OA 2QDBA 4XIGS 3A56A 3CPWA 2VQFQ 3RZDB 1HZAA 1FGUA 3E6ZX 1S3OA 4A3FH 4KK7A 1F2MA 3UDXA 3RZOB 5IGBA 3MC0B 2VB2X 1SYCA 4POGA 5NUCA 4KY6A 4O2DA 3STBD 1AE3A 1X3FA 2KCNA 3PUZA 4DV1Q 3J7AV 1EWCA 1E2ZA 1NE3A 3U9SA 5I9OA 3CMAA 3UDIA 3M4PA 1PA6A 4B9XA 4A3MH 5C3XA 2Z8LA 4K6LA 3K81C 4QIWE 4ZKBB 3GTMH 4DR7L 3RN2A 4DV0L 3QG1A 2WB1G 1MJEA 5K5PA 1SEBD 4R4CA 3HOYG 2FJ2A 1VCIA 5C0XI 1VF7A 2PW7A 5DEHA 3ULPA 2UXDQ 4LF9L 4R1JA 3J80i 2E5LL 1HZCA 1WTHA 5CGKA 4GOPB 1Q7YC 2E2HB 2FMMA 4O1NA 1VF5C 4Z9CB 1R9TB 5C3WA 2KOLA 4R8IA 4ZUIA 1EIHA 2M2LA 5IE8A 4GKJL 1WJJA 1TS3A 4KV6A 2BCOA 1KD1C 2TMPA 2A6HD 4KY5A 5EGTA 5AJ3Q 3CD6A 1B3AA 2VS1A 4B3MQ 3KBGA 1CSQA 3K5MA 2F3WA 4DV3Q 3Q24A 1QVCA 4A3DG 4LWCA 2JK8A 2GA4B 3ER0A 2K5VA 5L37A 4OL7A 1B50A 4HAEA 5JJLA 4JCVE 1BUVT 5IP9H 2HHHL 4GN5A 4LF4L 1OXUA 4XYOA 1EWHA 3VYUA 5D3DA 2LFNA 4TKOB 3GTKB 4X6AH 1GJXA 3S15B 2F0EA 1LTBD 1PZID 1NUCA 1CFMA 1GO3E 1VQJA 1XJVA 1U0LA 2J7ZA 3BZCA 1MSHA 5GROA 1YHBA 2IHEA 1SNOA 3FHWA 3I4NB 2L1BA 1P8LA 2XVSA 1HR0W 4B08A 5I6WA 2N8NA 1HNWQ 1JWUD 4CJ2C 4DUZL 1HR0L 4J1MA 2JEAI 3MTSA 4N8FA 1SMYC 3OMCA 2LS01 3S2HB 2KECA 4JOIA 2JQOA 3KLRA 3FPPA 3HOYH 3U9OA 4OO1G 3MEHA 4C3IH 1PH8A 2Z6KC 1TKWB 1MJCA 3EBEA 4YHHL 1A6XA 1WTQA 4K0KQ 1I4QA 5IYBG 4JBKA 4CDFC 1B3QA 3BS1A 4QIWB 3MXNB 3PGZA 4HTHA 2UXBQ 1CTMA 1IBLL 4CBVA 2VY3A 3I4MG 1QOHA 2MUYA 2K50A 1O80A 1NMFA 1HFNA 4IPHA 2RDGA 2I5LX 2H4OA 1Y1VB 1ET6A 2K03A 4EQNA 4A3DH 2VUMG 4OWTB 5EPLA 3PUXA 4LF8Q 3AB9A 2RCFA 3GTLB 1RTOA 2K5HA 5CV5A 3I2ZA 1EIYB 1X3GA 1BOSA 1XTCD 3RLOA 4KHPQ 3HP3A 1EEFD 2R7FA 3G7LA 4U673 1N33L 4A3JG 5M5XB 4R4QA 2B2TA 2F0UA 3BG3A 2CH4W 5KRUA 2WAQG 3R2IA 4NXML 1ICWA 2ZM6L 1Q3LA 4DR1Q 3MWYW 3E0EA 3MFYA 3FP9A 1I3QH 4GLAC 1K0RA 4QMGA 2I5MX 1YZ6A 2EJFC 1S5FD 4IFDJ 3HOVB 2NZOA 1BR9A 2J0TD 3NBHA 4X65Q 1OXTA 1O7IA 1IBML 4BBSG 3UI2A 4HJ5A 1JORA 4S3SA 4OO1H 4JYAL 4K8IA 1I4HA 2NWGA 2XTIA 4YY3Q 2MFIA 1BF4A 3M85A 1U4MA 1MD2D 1P16A 2MGSA 5IYBH 4C3IB 1PH3A 3S1QB 1U5KA 5IY0A 5LMUQ 3HZXA 1EY9A 4IUVA 5IIFA 2BOSA 2DY8A 4JI6Q 2VQEL 2Y0SG 3I4MH 2PO4A 1L0XB 4DV6Q 1TWFH 1BKBA 4KD3A 4ZQ3A 3WWVA 1HRJA 2RQXA 3OSOA 3RN5A 1VQ8A 2VUMH 2FINB 4IUUA 5C5MA 4OEMB 3QOLA 4NB3A 1VQ9A 2HQLA 2E76C 2F03A 4LF5Q 5JVH3 3H91A 5LL6X 3H3VI 2PW5A 4DNTB 1B7YB 1HNZQ 1EUJA 3CQZH 4A3JH 3GTGH 3CCQA 1GM5A 2K5WA 4FP5D 1PMRA 1F9PA 4JI5L 5BR8Q 5J39A 2F0TA 3F1ZA 4ILWA 5C3EG 2I5HA 1CQFA 1XXGA 3AQQA 1YJ9A 3T56B 1KDAA 3DM1A 3I72A 1K8GA 4HSVA 2D0PA 1EEID 1F9QA 4ODGA 4C1NI 3FVQA 2E8GA 2F1MA 3NK9A 2UUAQ 1EIFA 4BBSH 3D6CA 4KI0A 3K0YA 1S5CD 4EQOA 3GV6A 4YIJA 1ESRA 1SSOA 3TMEA 1IKLA 4B3TL 2EZVA 5C44G 1XNQQ 5EQ0A 3I4LA 4LFBL 3T1HL 2HT1A 1VQBA 1VQNA 5IGDA 3GTPH 1YNJD 3QB3A 2NN6I 1STYA 3H94A 3EJIA 2KA7A 3TP6A 1PFMA 3MXNA 1UAPA 2Q2HA 1SNMA 2CFMA 4YWLA 1VQOA 1JB3A 1FNUA 3J7YW 4IUNA 1EIGA 4A3GG 1W2BA 2YTXA 3K58A 3I4MB 2MNAA 4A75A 1UEBA 5IGCA 4HJAA 2F0QA 4P71A 1DXMA 1EL0A 1Q1BA 1WOCA 1WTOA 2NVQB 5CMDA 5M9OA 4HIKA 3R8BA 3L2PA 1QG7A 4GN4B 3C3LA 1IYJB 3PCOB 5CV6A 1EY8A 1J5EQ 4LF7Q 2K75A 3CCJA 4TQUS 2EYJA 1MBYA 4MTNA 2UUBQ 1JE5A 3S17H 3R3OA 1Q8IA 3ZYYX 1PH4A 4RFBA 3CQZB 5C3EH 4JI3L 4A3JB 3I73A 2UXCL 3GTGB 2B2VA 1WFQA 4I65A 2YU9H 2KCCA 1SAPA 1NNXA 1VQFA 3PQIA 2PI2E 3FPUB 1PRTD 5JEAG 3Q23A 5IGFA 5D14A 3ND8A 4A3EG 3W5OA 2RDHA 5KEEA 2J4XA 1YNNC 4LNQA 1BCPB 2CW0C 5C44H 2X6LA 2F0MA 2B8GA 3K57A 4IFDH 2QCPX 4V0BA 1G6ZA 1A8VA 2AQ3B 2JN4A 2KCMA 4RA8A 3NTHA 3GTJB 2C35B 3BZKA 2HCCA 2R93B 4CDCC 4DR2Q 1SDFA 3AFPA 2A1AA 1D5MC 1KC8C 4QGUA 1K73C 4GS3A 4DR6L 3M7NA 4A3GH 1UE7A 2R92G 3VYSA 1PYWD 3ICEA 3W1BA 1IYVA 1SE2A 4XQQA 1X65A 1Q8KA 3S1RB 1A3TA 1JE4A 1A62A 2JP1A 4X64L 1VQHA 3K5LA 3GTOB 1AP0A 2HD3A 1QZHA 3HKZG 1EY5A 4A76A 2A68C 1I4PA 4HCEA 1EYAA 1EOTA 1HFGA 4B3RL 2Z6KA 3J7ZC 3I90A 1LO5D 5DNFA 2EYOA 3CHBD 4FF3A 2B3GA 5M3MB 1PH5A 2N88A 2OT2A 3A0JA 2L12A 2PNRC 3KJOA 3ULJA 1BBXC 1TU2B 2KENA 1CZWA 2NTTA 1BCPF 4BY1G 5JEAH 1YJWA 4NXNL 4HCSA 1PLFA 4A3EH 2YU9B 3HKSA 3P75A 3HOUB 2BE5C 4NMZA 2Q8TA 5DM73 2CVRA 2L4NA 1IKMA 1BDOA 1CM9A 2YV5A 3S1NH 3IRBA 4JI4Q 3I8ZA 3CW2C 1G51A 2B2TC 1CI3M 1NJIC 3SEBA 1XX8A 4PZ7A 3HOZG 5FK9C 3QR8A 2OF1A 4QY7A 3TREA 4IOCA 2O4XA 2LSSA 4JI8Q 2NVTH 5EPKA 1PZJD 3AMUA 4TSSA 4XYQA 4DN4M 2Q8RE 1N34Q 3HKZE 1VQ7A 3J81c 1OO9B 2L9HA 2R92H 3S2DB 1SNCA 1KIXA 1PHJA 4IUPA 4KD4A 3GTQH 1I6HB 5GAEC 4DV4L 3MHBA 4GNXB 1PH6A 1G2SA 2QA4A 1ASYA 4GOPC 2K6AA 1EOVA 1SRUA 3P1HA 5C4XB 1HUNA 4C3JB 4YCWA 3Q6SA 5EBDA 5C4JB 3L9AX 2ZTDA 3L0OA 1VQKA 1A15A 2SNMA 2OQ0A 3E9IA 2EY1A 4BA1I 4KJOA 2NVYH 2ZXRA 3TQYA 5KNCA 2WIIB 4TRDA 5FO9B 4BY1H 2NBFA 2F0OA 4LFCQ 3EIVA 4NW2A 1SNPA 3IL8A 2E2IB 3M7GA 2PYKA 4WJWA 4ALPA 2QKIC 3OTOL 3PO2G 3GV3A 3NWSA 1E0BA 4C1NK 1VQPA 1YBYA 2RA4A 3OPOA 1K83H 1RIPA 4XQNA 1RTNA 1HA6A 5IWAQ 1H9RA 1SNQA 1I50H 1STNA 5C6AA 3BDLA 2F0PA 3SDZA 4XQJA 3S1NB 3HOZH 2ZJQA 1N32Q 4K8JA 2BDOA 4DUYL 1D1IA 1TS4A 1H9SB 4GKKL 2Z4HA 5G3LD 4DV1L 2YYZA 3PSIA 3KLWA 3Q0AA 4HMJA 5HGQA 1CHPD 3GDEA 3FKIB 3KF6A 2VNUD 2L5TA 3NUCA 3QWNA 1UE1A 4PNYA 1JQYD 1HNXL 2XSCA 2AQ1B 4X62Q 2L0CA 4I7ZC 1AZQA 3RNUA 1EWIA 4X3UA 2R92B 2O5IC 2JA6B 3PIOA 3GTQB 5FKAC 2DNCA 4B3SQ 1WTVA 1JC7A 2GVAA 2VW9A 2UXDL 4DR3L 1AFPA 3HKZB 4N8X1 3H0GG 2F52A 1TWGH 1N36Q 3PMFA 1SXTA 4PMWA 4IPCA 2PQAB 1PTOD 3NE5B 1K28A 2Z9HA 2H1EA 5M5YH 3H3VH 2MP1A 5KIXA 3MAQA 2B63G 4ID6A 2IX1A 4DV3L 3A7LA 2RVLA 4Y52H 1K8MA 2A5HA 3BZDB 2BH8A 2F4IA 3PO2H 1EYDA 2RF4A 1UE5A 2N78A 4EQ5A 4C3HB 4HSPA 3J81L 4A3BG 4KKUA 3Q22A 1XPRA 1WVLA 2PZWA 1IBKQ 4YWMA 3K7AH 2EJGC 3JAMc 1K83B 1PTOH 2CCZA 2B2VC 4ZKCB 1SFOH 1TWCB 2RCNA 4MZ9A 1BXTA 1I6VC 3Q8DA 1GHJA 3HOWG 1KDCA 3HOZB 1TR5A 4RG1A 3S1MH 1E1TA 4POFA 1D5XC 3KLSA 5FLXc 5LHY1 1GUOA 4UP7A 1Y1WG 3U50C 2PZTA 3C1FA 4BA2I 4IOAA 4A3CG 1CKMA 2HDLA 1STHA 5M5WH 1Q12A 4J6HA 3C46A 4DR7Q 4MN3A 2D0OA 3CAMA 3H0GH 5BN3A 4L5RC 4JV5Q 4A3FB 2F0FA 2EY2A 1V1OA 2FXQA 2WB1E 3X3NA 1YHQA 3VYTA 2E5LQ 1KTKA 4HJ7A 4FF4A 1QVFA 4AQYQ 2XRQD 3N6RA 1KHIA 2ZTEA 3D0FA 3EQLC 2EYPA 3NPPA 5A35A 1JOQA 4X66L 1STBA 2B63H 2DUDA 2F0SA 3G6EA 4F7XA 2JEBI 5A2QL 1WTPA 2WACA 5T1GA 4LAAA 4A3MB 1PV4A 1B53A 4K5XA 3PIPA 4OWWB 3GTMB 4RMFA 1Y14B 3CCLA 1XPUA 4A3BH 3OHXC 1SYEA 1O7YA 1VQ6A 4JI2Q 3KFUA 3TZDA 1U4RA 3CCVA 1QILA 3A7AB 2XGTA 4KHPL 2PQEA 2DGYA 1OXSC 5IGGA 4EVOA 1SMYD 4CGYB 3HG9A 4OIKA 5FOBB 1S5BD 5FO7B 4LF4Q 2K33A 4IJHA 4A93G 4FXGC 1AZPA 1CSPA 3HOWH 1LTTD 1JT8A 1Z9FA 5IODA 4DR1L 1RJTA 2OTJA 1D1KA 1MHWC 1E2WA 4DF7A 1TY2A 2NUCA 4R8NA 3RLNA 4WORA 1B9MA 3S1MB 1QUQB 1Y1WH 3EA6A 1IW7C 4ZCKA 1HR0Q 4A3CH 4J15A 5BN5A 3J81E 4B9WA 4YY3L 1XTDA 2FHTA 4H0LC 1VQLA 4QCLA 3KUPA 1ET9A 4JBMA 1EFID 2F0VA 1LTRD 3M3YH 5LMUL 1K3BC 2BH2A 2HQEA 1SBBB 1SR3A 2JXMB 3T13A 2CQAA 5M3FG 3NXWA 1F2LA 3JAMi 3EN2A 3X3MA 1X3EA 2EYHA 2IW3A 2PQAA 2RBMA 2V1CC 3JAML 2EYLA 5JJZA 4UHVA 2KHJA 1WCMG 1GOZA 3CCEA 3AFQA 4DV6L 4BS9A 1IBLQ 5EAYA 2K14A 2XIWA 5E4XA 3M9BA 2JA5G 2QEXA 3UE1A 4BWGB 2CWPA 2IT1A 4KJNA 1XMQQ 2WB1B 3HOYB 2P5ZX 1W6JA 5FLXL 4LF6Q 4EQPA 1HQMC 2AMCB 3BDCA 4GOPA 1I4RA 4A3BB 3W2DA 3ONAB 5DM63 3OW2A 4LJZC 1JOKA 1UEAB 5ELBA 2XNAC 4NP5A 2DJFC 2EOTA 3MXGA 4A93H 2WV6D 2RDFA 3A8KE 5BR8L 3M4OH 4H13C 4OX9Q 2B39A 2KCTA 3T51B 1N33Q 4ZUJA 4DR4L 3T1YL 2NTSA 3HOWB 2E75C 3BDOA 3NELA 4QF4A 5A2QE 4FVMA 5C5LA 4MTKA 2ZM6Q 1K9MC 4A3DB 3AU7A 1BCPC 3QOJA 2UUAL 4RGOS 1VMCA 2AKWB 3ULLA 4QB4A 4DAVA 1HJPA 1X32A 4OGQC 1JJCB 2A6EC 2PZUA 2WAQE 3B6YA 4KN7C 2K01A 1L0WA 1STGA 4DK6C 3CC7A 4BY7G 3F2BA 1KLUD 1IBMQ 1GUNA 1RKNA 2PNHA 5JEAJ 4JI0Q 3WDNA 2R7DA 2PPBC 3FMCA 1GKHA 3LWUA 4WFN3 5M3FH 4L8JA 1SMXA 2AHOB 3D31A 1LV9A 1FGBD 5LMNW 2IJ0A 2Q8IB 1DOKA 2DJGC 1WCMH 5LMNL 3D4WA 2R6GA 4JW0A 4ZRZA 1BNZA 3CCSA 1G291 2EXZA 2F0DA 2N49A 1CHQD 4UY8C 1I3QB 2VQEQ 2XRSD 2JA5H 3CCRA 1CZGA 1AH9A 1FVIA 2AQ2B 2EE1A 2OEOA 2VZAA 1Q46A 4WJ4A 2Y0SE 4IPDA 2B2WC 3KF8B 4CHTB 1VQCA 2K4KA 1FJGL 1R4QB 4LF7L 1LACA 4WRDA 4PMCA 4X3KA 1UUPA 3V05A 3CPFA 2JYOA 1CT1D 1V1PB 3A8JE 5C0XG 4LFAQ 1F2YA 2UUBL 3J7A5 4ME5A 3GQBA 5IYCG 1LTGD 2NZ1D 3TDQA 4V190 4JI1L 1PZKD 3JAME 4FYDA 1YNXA 5FLMG 2KBNA 4H7BA 1GVPA 4IALA 3CC4A 1TWFB 2K5DA 1JOOA 1VS0A 3DLLA 1SNDA 2VUMB 2F4VQ 5ELFA 2EVBA 5JJIA 2NZHA 2F0IA 3ERSX 1ZYRC 1L1OB 3NQIA 1L0YB 4A3KG 3W1GA 4BY7H 3DEOA 1CKNB 5FLXE 1ENAA 3H15A 2ID0A 4NDXA 1QZGA 4K6DA 1JICA 1EFWA 2K05A 3DUZA 3TS0A 4B3TQ 4JG2A 1V8QA 3GO5A 1JJ2A 4LFBQ 1JWSD 4GN3B 4DR2L 1WTXA 4KKSA 1QVGA 3RLFA 3KJPA 3VR2A 2WAQB 2JA8G 2ZJRA 5M3FB 2UUCL 2MO1A 3R2TA 1C0AA 2ZT9C 1VQAA 1E2VA 5IYDG 1U4LA 4A4IA 5IT9c 2CWAA 3S24A 1TXYA 3V96A 4APVA 3IKJA 2F3IA 4U68A 5J1ZA 5F2DA 5I2XA 4BBSB 1TWAH 1STEA 3MFGA 1LYLA 4FO2A 2EYMA 4KTAA 2UU9Q 4KY7A 4PZ8A 1QE6A 4FF2A 1H95A 1RL2A 4BBRG 4N9TA 4XTCS 3GTPB 5C0XH 4RGMA 4JI7L 3TRZA 4RGTA 3D3RA 5AFWA 4KLKA 4HJ9A 1YNND 5IYCH 1G91A 3NWTA 2CW0D 2KHIA 4L5SA 2Y0SB 1EQQA 2A74C 3V2TA 5HURA 5FLMH 4JBWA 2D9UA 3WOFA 2B2UA 2WFWA 5I6YA 3PUVA 1HCZA 1Z47A 2NVXH 1JJGA 3HGBA 1SN8A 3AYHB 1M1KC 1E1OA 4RGNA 4YWKA 3E0JA 2JA7G 4A3KH 4Q0FA 2ES2A 3LWEA 3NEMA 4JBJA 4JI4L 1MI2A 1Y8OB 2HCIA 1FNVA 1GUGA 2A8VA 4M8AA 4PQXA 1C9OA 1XWEA 3TSSA 1T9HA 2G9HD 4DGZA 3I7FA 1XMOL 1I4GA 4L5TA 4G7HC 3S17B 1V43A 2A68D 5C3EB 4KN4C 2JA8H 1HXYD 2IL8A 2O5JC 2LY7A 3TEHB 4FF1A 2A69C 4DV7L 1GUTA 5ELCA 4CDDC 5IYDH 3UDGA 1QNKA 1LT4D 1NY4A 1RHPA 4C56C 3SGIA 4DAPA 3VR5A 4FDBA 1FD7D 1LM0A 4KMUC 1KRTA 5C4ZA 2R61A 4PZ6A 4KHZA 3KF8A 1OXVA 5GADC 2XWBB 2K04A 2YTYA 1DYQA 2IX3A 5GAHC 5EBCA 5C44B 2E74C 3A5UA 4IN3A 1S40A 4F88A 2HDMA 2WKDA 1A0IA 1V9PA 4BBRH 1ENFA 1SJHD 1WI5A 2BE5D 5ELEA 1V1PA 3K5OA 2E2JH 2CHBD 1K8AC 2OQKA 5CC4A 2MQHA 3I3CA 1JR0D 1HHVA 1PRTB 1C4QA 3OWEB 1YEZA 3N52A 4DKAC 3GD7A 1M8AA 4MNOA 1PDQA 2SNSA 4LUVA 5ELDA 4A3GB 4CJ0B 1F9SA 1LLRD 1UE6A 3G48A 3TN2A 1GUSA 1YIJA 1TWHH 1GD7A 2JA7H 2K32A 1DOMA 1NR4A 1LABA 2BDNA 2NYZD 2OCEA 1Y8NB 5IWAL 5IT9L 2D62A 1CKNA 4ULLA 3J80c 1SE3A 3RZDH 4DV2Q 1XYIA 3SE0A 1FNWA 4GZYC 3RZOH 1N32L 1BO0A 1TY0A 3U4ZA 4RHRA 3I4NG 1M4VA 1TT2A 2EDGA 1X3QA 1CK1A 1DD2A 3DWPA 1VDZA 2JA8B 4LMQD 1ENCA 2K5QA 5JVG3 2K28A 3FEWX 4DV5L 3K0XA 4A3EB 1X3PA 4XT1B 5CR3A 1NMGA 2WKCA 2VQFL 2AUJD 2QF7A 4B3SL 1Y69U 4DV4Q 1PXUA 1KABA 1PRTF 4DR5Q 2F3VA 1ICFB 3OMGA 1Q86C 5J22A 1QWYA 4CKEA 4JK1C 3TP5A 5CV8A 1XNRQ 2NVTB 2WINB 3HFZB 2SDFA 2Z1CA 1QCBD 2NN6G 3FRPB 4E6IA 3CKIB 3E5SA 5GAGC 1ZEQX 3MZ5A 1S4ZA 3CCUA 5EJWA 4QUFA 1QNUA 4EGVA 1Y1VG 2E2DC 4C2MH 5BN4A 2A73B 4OELB 3ZJYC 3RR5A 2FFKB 1DGSA 1HH2P 4HR7B 3STBC 2DNEA 2CH4A 1VQIA 1TWHB 2B2WA 1EZ6A 4NKLA 2JA7B 3OTOQ 3QO2A 4H02A 3GTKH 1B44D 4WJ3M 3S15H 3KDFB 1I94Q 1A63A 1A3VA 5J3BA 1KXLA 4R4OA 1CA5A 4RHSA 3IAYA 2MO0A 5AJ3L 4KKTA 1I5FA 1O7ZA 2HIVA 1X6OA 2EYFA 4B3ML 3I4NH 2ZXOA 4RWSC 1O7LA 4K5VA 2XWJB 2EXDA 3BU2A 1B9NA 3P20A 4DUYQ 1PH2A 1ASZA 4OONA 2ZXPA 3J7AF 4GKKQ 2NVYB 2ALYB 4F87A 4P72A 3ERQA 5E1FA 4BY1B 3J81i 1WD0A 2LKVA 3F2DA 2IY5B 3NTIA 3HOVG 3A74A 2Q2UA 3I56A 3S2HH 4Y7NH 1HUMA 1KDBA 4OXPA 5IGEA 2KQ3A 1AE2A 1Z6HA 1HNXQ 3NBHB 1SYFA 3OOCA 4IFDI 1DONA 5IT9E 1GXDC 5CBAE 3HS0C 3O13A 1MSGA 1I50B 2A6HC 2PI2A 3KK7A 5CV4A 1Q81C 1NR2A 4JV5L 1ILPA 4C3IG 2X6GA 3BYTB 5E3FA 1EQVA 4DR3Q 4AQYL 4J8QA 2AWOA 2F0JA 3VR4A 3J80L 1HNWL 4K14A 3KBXA 5DLQE 1YJNA 1EYCA 2OXPA 2NN6H 1G8ZD 1JCKB 2WP8J 1HZ9A 2MPMA 3SR1A 3DM3A 1F2ZA 4OHJA 1J8IA 3CP0A 1Q82C 1RCVD 4IUTA 1Y1VH 2F0GA 4GNXA 1LTID 2IWHA 3NTKA 5GQOA 3VDYA 4DV0Q 2XN9C 1TIID 4C2MB 3TP7A 3DXJC 3GTLH 2SEBD 4PMBA 4JI2L 4K0KL 4CJ1B 4GLVB 1DZ1A 1VQ5A 1G2TA 3VA5A 1VQEA 4LF9Q 1VQ4A 2B2YC 4JC0A 1J6QA 2UXBL 3MEFA 3TBIB 5M5XH 1TWGB 3PF4A 1TS2A 4DNRB 2B2UC 3A54A 4OWXB 1E22A 1FR3A 3HOXG 2ICIA 1S72A 4GKJQ 3I70A 5KYLA 1II3A 3NENA 3FDTA 1NCVA 5M5YB 5HY6A 1CQVA 2Z4IA 2VB3X 4IPGA 3PF5A 4ZK9B 3DWQA 4LF8L 4XDXA 1KAWA 3HOVH 3PO2B 2LXKA 4A3IG 3TS2A 2RSOA 2VXWA 1Z7TA 1WTRA 2GVBA 1SLJA 1ESFA 4G7ZC 4Y7NB 2ATWA 5EPJA 4K2KA 5COYA 2HHHQ 3K7AB 1H9SA 3U4VA 1LTAD 3S1QH 1PTOB 4KHVA 1F9RA 1D2BA 4DXGA 1SFOB 1EU3A 4EX5A 1FL0A 3L7ZC 3R93A 2JSOA 3MVVA 2L55A 1YI2A 1XPOA 1AEXA 4X65L 1B2TA 1MGSA 2X69A 2KVMA 2V4DA 3BYYB 4DUZQ 2FMCA 4X66Q 3BJUA 2KUMA 1XMQL 1H9KA 4ZAIA 4NPSA 5G3LF 1PFNA 4LF6L 3G71A 1DOLA 5M5WB 4X3TA 4UP8A 1ML0D 1DM0B 2M9VA 4OIJA 4TVAB 4A3LG 4G57A 5KNDA 3OWFA 4RCOA 1U4PA 2AWNA 3H0GB 4YHHQ 4P73A 4QQBX 4JI6L 1KL9A 2I46A 4ME3A 1IW7D 3KDFA 1W6KA 1PH9A 4R4TA 1AN8A 3D4RA 3HOXH 4OX9L 2EY5A 5FJ8G 2RHQB 1OXXK 3J80E 4R4IA 5DAUA 1B1ZA 2B63B 4IO9A 3BVZA 1UWVA 4DAYB 5C0XJ 1VQGA 5I4DA 1L1OC 4LUZA 2CQOA 3PV0A 4P74A 1SYGA 4LF5L 3P7JA 4A3IH 1PTOF 5T1IA 2DY7A 2K52A 1NSNS 3MXPA 4DK3C 4FNFA 2IPKD 4I7AA 4XXEA 1HNZL 2F0KA 2IX0A 2TSSA 4UDUC 5IP7G 4JI0L 5CORA 4GLXA 4F8MA 5JPNC 5CBEE 2ASBA 2R3ZA 3A5ZB 1HA5A 1WD1A 2RSNA 3SHLA 3T16A 3SK4A 1LT6D 1KNEA 2R93G 1T5EA 2B8FA 3K6OA 4NXMQ 1Q1EA 2OWOA 1KRSA 3EFXD 1MKHA 3PUWA 1PFSA 1DJRD 4LUOA 1I4XA 4K5WA 1HTLD 5ELOA 1SE4A 2LMCB 5I9PA 2KHSA 1Y1WB 3UDFA 4LK1C 3K8AA 1KQSA 1XNQL 1D5ZC 2QGQA 1E7ZA 3LGJA 2NVQH 4JYAQ 2R7ZG 5C4HA 2QILA 4A3LH 2K5NA 4P2CB 4PG3A 2Q2TA 1ILQA 3ND9A 1EY4A 5IOCA 3D8GA 1BCPD 1BQQT 4LFAL 3M4YA 3VR6A 2KEDA 2L11A 3J81j 3M3YB 5M3MG 2A6ED 4QJFA 5FJ8H 4QUCA 3PIO3 4DK1A 4CKBA 2PCFB 1RD9D 3G6JB 2I0QA 4FXDA 1NAPA 1SE8A 3HOXB 1C7YA 4AYBG 1H9MA 3F2UA 3CMEA 5ELNA 4DR4Q 3T1YQ 1K3RA 5D65A 3RD4A 2F4VL 3HOUG 2L15A 2QEJC 4HIDA 1YNJC 4K2LA 4FXKC 2MHVA 1J5EL 1EY6A 1PYBA 2F0WA 3C1EA 3HRZC 1M90C 5IP7H 2HIXA 4IURA 4RKBA 4A3IB 1YITA 3DHQA 4H44C 4ZYSA 5EKKA 3T4AC 4IUQA 4IZ8A 1VQMA 2EQSA 3JC66 4UP9A 3GTJH 2K7VA 4A93B 4DPGA 3CF5A 3M4OB 4G7OC 2R93H 4IFDG 2JJQA 4JI5Q 3URYA 3F2CA 1BVSA 5CV7A 3M4QA 5JOBA 1RDPD 1GUWA 1QUQA 3KLSX 1HTPA 3K5NA 2SOBA 4N9PA 4AH6A 4HN7A 4IJLA 2B29A 3RMHA 5LMNQ 3EROA 3OYYA 2VL6A 3S1RH 3GTOH 1EY0A 2Z0SA 5KGUA 2AUKA 2R7ZH 2UU9L 2O2LD 1X54A 4RKLA 1PFBA 3K59A 2RHSB 4DAMA 5C4XG 1YVCA 3PO3G 5D3IB 4AYBE 3T1HQ 1PRTC 4C3JG 4JPBW 1LT3D 1LTSD 1ZYRD 5M3MH 1FJGQ
chains in the Genus database with same CATH topology
2RCNA 4MZ9A 2OCEA 4HJ5A 4BBSG 1SROA 3Q8DA 4GNXC 3HOWG 4JYAL 5IWAL 2D62A 2XTIA 1O7IA 4AIMA 1CKNA 3S1MH 4RG1A 1IZ6A 4YY3Q 1E1TA 4POFA 3J80c 5E7NA 2MFIA 3K7UC 4BXXG 3RZDH 4DV2Q 3M85A 1B8AA 1LTLA 5FLXc 1P16A 5IYBH 1PH3A 4JI1Q 3RZOH 1N32L 4UP7A 2NVTH 1EYGA 3HOUH 1U5KA 4LW1A 5IY0A 1Y1WG 3U50C 5LMUQ 2GN5A 4BA2I 4IOAA 1X56A 4A3CG 1CKMA 3U4ZA 3S14H 4JI6Q 3I4NG 2VQEL 5M5WH 2Y0SG 3I4MH 1Q12A 3E9HA 4DR7Q 1MIUA 2D0OA 3KOJA 4DNIA 3CAMA 4DV6Q 1TWFH 1BKBA 3H0GH 3WWVA 2PMZE 4YCUA 4L5RC 4JV5Q 4YCVA 2VUMH 3RN5A 1VQ8A 4DV5L 3K0XA 2FXQA 2WB1E 1YHQA 5H1SE 2E5LQ 4HJ7A 1QVFA 4NB3A 4AQYQ 1KHIA 2ZTEA 3D0FA 1NMGA 1HZBA 2VQFL 1BBUA 5JJKA 3PUYA 1VQ9A 4B3SL 2H5XA 4JI3Q 2HQLA 2UXCQ 4X66L 4LF5Q 2B63H 3S16H 2BA0A 4DV4Q 3FKIG 2DUDA 4HIMA 3G6EA 1WYDA 3H3VI 4DR5Q 3S2DH 1N9WA 5K36G 2JEBI 1B7YB 1HNZQ 1D8LA 1Q86C 1EUJA 3CQZH 3KF6B 4A3JH 1PV4A 2UUCQ 1I6HH 3GTGH 4JOIC 3CCQA 1GM5A 3PIPA 4OWWB 4RMFA 1Y14B 3CCLA 1XPUA 4JI5L 5BR8Q 2ZJPA 1XNRQ 4A3BH 3F1ZA 3HFZB 5C3EG 2JA6G 2BA1A 1VQ6A 4JI2Q 3KFUA 2I5HA 3AQQA 2NN6G 1YJ9A 5GAGC 3CCVA 2XGTA 5C4XH 3CCUA 4KHPL 2DGYA 1OXSC 1K8GA 2D0PA 4JI8L 3PO3H 1Y1VG 1JMCA 4C2MH 4C3JH 1W3SA 5C4JH 4LF4Q 2E8GA 4A93G 4IJHA 3ZJYC 3RR5A 1N34L 4QL5A 2UUAQ 1EIFA 4BBSH 1CSPA 4KI0A 4P75A 1DGSA 3HOWH 1HH2P 3STBC 1JT8A 4JI7Q 1VQIA 1Z9FA 4DR1L 2OTJA 4OO1I 3OTOQ 2LXJA 4B3TL 4H02A 5C44G 1XNQQ 3RLNA 4BXXH 4LFBL 3GTKH 4DR6Q 3T1HL 2HT1A 1VQBA 1VQNA 4WJ3M 3GTPH 3S15H 3KDFB 2E2IH 1I94Q 1YHAA 1A63A 1QUQB 5J3BA 1Y1WH 2NN6I 3I55A 4R4OA 1KXLA 2MO0A 5AJ3L 1I5FA 4L5QA 1HR0Q 4J15A 2HIVA 1V1QA 1X6OA 4A3CH 4B3ML 3I4NH 2Q2HA 4X64Q 4YWLA 2CFMA 1VQOA 2EXDA 3BU2A 4YY3L 1PH2A 4DUYQ 1ASZA 4OONA 1XTDA 4GKKQ 2ALYB 4DV2L 1VQLA 4P72A 4B3RQ 3J81i 4A3GG 1W2BA 2YTXA 4JBMA 3F2DA 2MNAA 4A75A 2IY5B 3M3YH 5LMUL 3HOVG 3A74A 2Q2UA 1EQRA 1UEBA 2N3SA 3I56A 4P71A 4HJAA 1SR3A 5M3FG 2BH2A 3S2HH 4Y7NH 3JAMi 4OXPA 1E24A 3EN2A 4LFCL 1Q1BA 1AE2A 1HNXQ 1X3EA 1XMOQ 3NBHB 1WOCA 2PQAA 4IFDI 2V1CC 5JJIA 4HIKA 2KHJA 3FKIH 3L2PA 1WCMG 1CUKA 2PI2A 1Q81C 4GN4B 3CCEA 1IYJB 3AFQA 2JE6I 1CKOA 3PCOB 4DV6L 1J5EQ 4LF7Q 3UE0A 1G6PA 2K75A 3CCJA 1PH7A 1IBLQ 4JV5L 5EAYA 2K14A 4TQUS 1L1OA 3M9BA 2JA5G 2QEXA 3UE1A 4DV7Q 4NXNQ 4MTNA 1JB7A 2CWPA 2IT1A 4DR3Q 4AQYL 1XMQQ 2UUBQ 2AWOA 2Q2IA 1JE5A 3S17H 2IHFA 1PH4A 1HNWL 5C3EH 3U58A 4JI3L 5DLQE 1X9NA 2JA6H 2UXCL 1YJNA 4LF6Q 1WFQA 2WP8J 1OTCA 2YU9H 1HZ9A 4UPAA 2AMCB 3DM3A 4GOPA 4DR5L 3CP0A 1Q82C 4O0AA 1VQFA 3OW2A 1VQDA 2PI2E 1Y1VH 4GNXA 5JEAG 1L2FA 4A3FG 2A19A 4A3EG 4A93H 3W5OA 5BR8L 3M4OH 5GQOA 3VDYA 4DV0Q 3G4SA 1XNRL 4HJ8A 4OX9Q 2KCTA 1BBWA 3GTLH 4JI2L 1N33Q 4K0KL 4LNQA 4DR4L 3T1YL 4GLVB 4X62L 5C44H 1VQ5A 1NBWA 1PH1A 1VQEA 2OTLA 4LF9Q 1IXRA 1VQ4A 4JC0A 3NELA 1J6QA 2UXBL 4A3MG 3K80C 1A8VA 3MEFA 2KCMA 1LUZA 2ZM6Q 5M5XH 1K9MC 3PF4A 2C35B 2UUAL 2AKWB 3ULLA 4OWXB 2YTVA 1HJPA 3BZKA 1E22A 1JJCB 2EIFA 3HOXG 1S72A 4C3HH 2WAQE 3B6YA 4GKJQ 1PVOA 4DR2Q 1L0WA 4DK6C 3CC7A 4BY7G 3NENA 3F2BA 3AFPA 2E2HH 2A1AA 1E3PA 5HY6A 1IBMQ 2PNHA 5JEAJ 1KC8C 1N36L 1R9TH 4JI0Q 4QGUA 2R7DA 4GS3A 1K73C 3M7NA 4DR6L 1UE7A 4IPGA 4A3GH 1B70B 3PF5A 3CC2A 2R92G 3ICEA 1NTGA 1I94L 4LF8L 1KAWA 1GKHA 3W1BA 3HOVH 5M3FH 3CXCA 2LXKA 1TWCH 1X65A 1Q8KA 4A3IG 3TS2A 1SMXA 4HIOA 3KYHC 1A62A 4X64L 2CKZB 1VQHA 2GVBA 2JA9A 1PYSB 2AHOB 3D31A 1SLJA 5LMNW 1QZHA 3HKZG 4A76A 1WCMH 5LMNL 2ATWA 4B3RL 2R6GA 3CCSA 3F8TA 2Z6KA 1G291 2N49A 2HHHQ 2ZTCA 3J7ZC 3CCMA 4UY8C 2VQEQ 3U4VA 4X65Q 3AEVA 3S1QH 2JA5H 3CCRA 1AH9A 2B3GA 1FVIA 1VQ7A 1PH5A 1X55A 2VZAA 3A0JA 1Q46A 4WJ4A 4EX5A 1FL0A 2Y0SE 3L7ZC 4IPDA 3KF8B 1IBKL 1D7QA 4DV5Q 1IL2A 1VQCA 3KJOA 3ULJA 2K4KA 2KENA 1YI2A 1FJGL 1XPOA 5IP9G 4X65L 1N8RC 4LF7L 3I4OA 3CPWA 4XIGS 4BY1G 3CPFA 2VQFQ 1HZAA 1FGUA 4DUZQ 1S3OA 4A3FH 1YJWA 4NXNL 3UDXA 4A3EH 4X66Q 3BJUA 3HKSA 5C0XG 4LFAQ 1XMQL 2UUBL 4POGA 4NPSA 3J7A5 4O2DA 3STBD 1AE3A 1X3FA 5IYCG 2JA7H 3PUZA 4DV1Q 4LF6L 3G71A 2YV5A 4JI1L 4UP8A 3IRBA 3S1NH 4JI4Q 1YNXA 5FLMG 4TVAB 3CW2C 1G51A 2KBNA 1NE3A 3CMAA 4A3LG 3UDIA 1GVPA 1NJIC 2AWNA 3M4PA 3CC4A 1PA6A 4YHHQ 4P73A 4PZ7A 4A3MH 1VS0A 3DLLA 4QQBX 4JI6L 1KL9A 4ME3A 3K81C 3KDFA 4QIWE 3HOZG 4QY7A 2F4VQ 3GTMH 1PH9A 4DR7L 4R4TA 3TREA 4DV0L 2NZHA 3ERSX 3HOXH 3RN2A 4OX9L 5FJ8G 2WB1G 4IOCA 1L1OB 2LSSA 2RHQB 1OXXK 4JI8Q 4R4IA 4A3KG 3W1GA 4R4CA 1MJEA 3HOYG 4BY7H 1VCIA 1CKNB 5C0XI 3H15A 4IO9A 1N34Q 3ULPA 2ID0A 3HKZE 1UWVA 4LF9L 4R1JA 3J80i 4DAYB 3J81c 1QZGA 5C0XJ 1HZCA 1VQGA 1L1OC 4LUZA 1EFWA 2E5LL 2R92H 3TS0A 1KIXA 2CQOA 4GOPB 1Q7YC 1PHJA 3PV0A 4P74A 3GTQH 4B3TQ 5GAEC 4JG2A 3GO5A 4LF5L 1JJ2A 4DV4L 4A3IH 4GNXB 5IE8A 4LFBQ 1PH6A 4GKJL 1WJJA 2K52A 4GN3B 4DR2L 2QA4A 1QVGA 1ASYA 4DK3C 3RLFA 1HNZL 4GOPC 3KJPA 2IX0A 1KD1C 2JA8G 1EOVA 5IP7G 2ZJRA 2UUCL 1SRUA 4JI0L 2MO1A 5AJ3Q 3CD6A 1C0AA 1VQAA 2VS1A 5IYDG 4B3MQ 4GLXA 4A4IA 5IT9c 1CSQA 2CWAA 3S24A 4DV3Q 1QVCA 1TXYA 2ASBA 4A3DG 4YCWA 4APVA 3A5ZB 4LWCA 2ZTDA 2F3IA 3L0OA 2JK8A 1VQKA 3ER0A 2OQ0A 2K5VA 2R93G 3E9IA 1TWAH 4BA1I 1LYLA 5JJLA 4JCVE 2UU9Q 2NVYH 3TQYA 1Q1EA 5IP9H 2OWOA 4NXMQ 2HHHL 4GN5A 4PZ8A 1OXUA 4LF4L 1KRSA 4BY1H 4LFCQ 1H95A 1MKHA 4X6AH 3PUWA 1RL2A 1PFSA 3EIVA 4BBRG 4XTCS 4LUOA 5ELOA 4JI7L 4ALPA 3TRZA 3OTOL 1GO3E 3UDFA 1VQJA 1XJVA 1U0LA 3K8AA 1KQSA 1XNQL 3PO2G 2QGQA 3BZCA 4KLKA 5GROA 4HJ9A 5IYCH 1E7ZA 1YHBA 2IHEA 3FHWA 1VQPA 1YBYA 3LGJA 2KHIA 2NVQH 1K83H 1RIPA 4L5SA 1EQQA 4JYAQ 5IWAQ 1P8LA 5FLMH 2R7ZG 4JBWA 4A3LH 1HR0W 2K5NA 1I50H 2Q2TA 4PG3A 2N8NA 1HNWQ 2WFWA 4DUZL 1HR0L 2JEAI 3PUVA 1Z47A 3HOZH 2NVXH 2ZJQA 4LFAL 1N32Q 1JJGA 1SN8A 3AYHB 3J81j 1E1OA 4DUYL 1M1KC 5M3MG 4YWKA 4GKKL 4QJFA 5FJ8H 2JA7G 4JOIA 4A3KH 2JQOA 4DV1L 2ES2A 3HOYH 3NEMA 4JBJA 2YYZA 3PSIA 4OO1G 3KLWA 4JI4L 4C3IH 5HGQA 1PH8A 2I0QA 2Z6KC 1SE8A 3GDEA 1C7YA 4AYBG 3KF6A 2VNUD 2A8VA 1MJCA 1UE1A 3EBEA 4YHHL 3CMEA 1C9OA 1T9HA 4K0KQ 4JBKA 3I7FA 5ELNA 5IYBG 1XMOL 1HNXL 4DR4Q 3T1YQ 1K3RA 4X62Q 2F4VL 4L5TA 2L15A 4HIDA 3HOUG 2UXDQ 3RNUA 1EWIA 3MXNB 1J5EL 1PYBA 3PGZA 1V43A 2UXBQ 1M90C 3PIOA 1IBLL 2JA8H 2VY3A 5IP7H 2HIXA 4B3SQ 3I4MG 3TEHB 2GVAA 2VW9A 2K50A 4DV7L 1YITA 2UXDL 1NMFA 4DR3L 5IYDH 4IPHA 3UDGA 2I5LX 1VQMA 3H0GG 1NY4A 2EQSA 2F52A 3JC66 4UP9A 1IBML 4A3DH 2VUMG 1TWGH 3GTJH 3SGIA 1N36Q 4DPGA 4PMWA 4FDBA 4OWTB 3CF5A 1KRTA 1LM0A 3PUXA 4IPCA 4PZ6A 2JJQA 4KHZA 2PQAB 4JI5Q 4IFDG 2R93H 4LF8Q 1OXVA 5GADC 5M5YH 3H3VH 3F2CA 2YTYA 1BVSA 2K5HA 3I2ZA 3M4QA 5GAHC 1EIYB 2B63G 3A5UA 1X3GA 1S40A 1QUQA 2IX1A 4DV3L 1A0IA 3RLOA 1V9PA 4BBRH 4KHPQ 4Y52H 2R7FA 1WI5A 4AH6A 1N33L 2BH8A 4IJLA 4A3JG 2B29A 5LMNQ 3PO2H 2E2JH 1K8AC 2RF4A 4R4QA 3OYYA 2OQKA 2VL6A 3S1RH 1UE5A 2N78A 1IBKQ 3GTOH 4EQ5A 2MQHA 4A3BG 2Z0SA 2R7ZH 2WAQG 2UU9L 4NXML 1X54A 1YEZA 2ZM6L 1XPRA 4DKAC 4DR1Q 3GD7A 3E0EA 3FP9A 2RHSB 4MNOA 4YWMA 4LUVA 3K7AH 4DAMA 3JAMc 1I3QH 1YVCA 4GLAC 1K0RA 3PO3G 4AYBE 5C4XG 1UE6A 1YZ6A 2I5MX 3T1HQ 2CCZA 3G48A 4IFDJ 2NZOA 1YIJA 5M3MH 1SFOH 1TWHH 1GD7A 1FJGQ 1OXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RCN A;  4MZ9 A;  2OCE A;  4HJ5 A;  4BBS G;  1SRO A;  3Q8D A;  4GNX C;  3HOW G;  4JYA L;  5IWA L;  2D62 A;  2XTI A;  1O7I A;  4AIM A;  1CKN A;  3S1M H;  4RG1 A;  1IZ6 A;  4YY3 Q;  1E1T A;  4POF A;  3J80 c;  5E7N A;  2MFI A;  3K7U C;  4BXX G;  3RZD H;  4DV2 Q;  3M85 A;  1B8A A;  1LTL A;  5FLX c;  1P16 A;  5IYB H;  1PH3 A;  4JI1 Q;  3RZO H;  1N32 L;  4UP7 A;  2NVT H;  1EYG A;  3HOU H;  1U5K A;  4LW1 A;  5IY0 A;  1Y1W G;  3U50 C;  5LMU Q;  2GN5 A;  4BA2 I;  4IOA A;  1X56 A;  4A3C G;  1CKM A;  3U4Z A;  3S14 H;  4JI6 Q;  3I4N G;  2VQE L;  5M5W H;  2Y0S G;  3I4M H;  1Q12 A;  3E9H A;  4DR7 Q;  1MIU A;  2D0O A;  3KOJ A;  4DNI A;  3CAM A;  4DV6 Q;  1TWF H;  1BKB A;  3H0G H;  3WWV A;  2PMZ E;  4YCU A;  4L5R C;  4JV5 Q;  4YCV A;  2VUM H;  3RN5 A;  1VQ8 A;  4DV5 L;  3K0X A;  2FXQ A;  2WB1 E;  1YHQ A;  5H1S E;  2E5L Q;  4HJ7 A;  1QVF A;  4NB3 A;  4AQY Q;  1KHI A;  2ZTE A;  3D0F A;  1NMG A;  1HZB A;  2VQF L;  1BBU A;  5JJK A;  3PUY A;  1VQ9 A;  4B3S L;  2H5X A;  4JI3 Q;  2HQL A;  2UXC Q;  4X66 L;  4LF5 Q;  2B63 H;  3S16 H;  2BA0 A;  4DV4 Q;  3FKI G;  2DUD A;  4HIM A;  3G6E A;  1WYD A;  3H3V I;  4DR5 Q;  3S2D H;  1N9W A;  5K36 G;  2JEB I;  1B7Y B;  1HNZ Q;  1D8L A;  1Q86 C;  1EUJ A;  3CQZ H;  3KF6 B;  4A3J H;  1PV4 A;  2UUC Q;  1I6H H;  3GTG H;  4JOI C;  3CCQ A;  1GM5 A;  3PIP A;  4OWW B;  4RMF A;  1Y14 B;  3CCL A;  1XPU A;  4JI5 L;  5BR8 Q;  2ZJP A;  1XNR Q;  4A3B H;  3F1Z A;  3HFZ B;  5C3E G;  2JA6 G;  2BA1 A;  1VQ6 A;  4JI2 Q;  3KFU A;  2I5H A;  3AQQ A;  2NN6 G;  1YJ9 A;  5GAG C;  3CCV A;  2XGT A;  5C4X H;  3CCU A;  4KHP L;  2DGY A;  1OXS C;  1K8G A;  2D0P A;  4JI8 L;  3PO3 H;  1Y1V G;  1JMC A;  4C2M H;  4C3J H;  1W3S A;  5C4J H;  4LF4 Q;  2E8G A;  4A93 G;  4IJH A;  3ZJY C;  3RR5 A;  1N34 L;  4QL5 A;  2UUA Q;  1EIF A;  4BBS H;  1CSP A;  4KI0 A;  4P75 A;  1DGS A;  3HOW H;  1HH2 P;  3STB C;  1JT8 A;  4JI7 Q;  1VQI A;  1Z9F A;  4DR1 L;  2OTJ A;  4OO1 I;  3OTO Q;  2LXJ A;  4B3T L;  4H02 A;  5C44 G;  1XNQ Q;  3RLN A;  4BXX H;  4LFB L;  3GTK H;  4DR6 Q;  3T1H L;  2HT1 A;  1VQB A;  1VQN A;  4WJ3 M;  3GTP H;  3S15 H;  3KDF B;  2E2I H;  1I94 Q;  1YHA A;  1A63 A;  1QUQ B;  5J3B A;  1Y1W H;  2NN6 I;  3I55 A;  4R4O A;  1KXL A;  2MO0 A;  5AJ3 L;  1I5F A;  4L5Q A;  1HR0 Q;  4J15 A;  2HIV A;  1V1Q A;  1X6O A;  4A3C H;  4B3M L;  3I4N H;  2Q2H A;  4X64 Q;  4YWL A;  2CFM A;  1VQO A;  2EXD A;  3BU2 A;  4YY3 L;  1PH2 A;  4DUY Q;  1ASZ A;  4OON A;  1XTD A;  4GKK Q;  2ALY B;  4DV2 L;  1VQL A;  4P72 A;  4B3R Q;  3J81 i;  4A3G G;  1W2B A;  2YTX A;  4JBM A;  3F2D A;  2MNA A;  4A75 A;  2IY5 B;  3M3Y H;  5LMU L;  3HOV G;  3A74 A;  2Q2U A;  1EQR A;  1UEB A;  2N3S A;  3I56 A;  4P71 A;  4HJA A;  1SR3 A;  5M3F G;  2BH2 A;  3S2H H;  4Y7N H;  3JAM i;  4OXP A;  1E24 A;  3EN2 A;  4LFC L;  1Q1B A;  1AE2 A;  1HNX Q;  1X3E A;  1XMO Q;  3NBH B;  1WOC A;  2PQA A;  4IFD I;  2V1C C;  5JJI A;  4HIK A;  2KHJ A;  3FKI H;  3L2P A;  1WCM G;  1CUK A;  2PI2 A;  1Q81 C;  4GN4 B;  3CCE A;  1IYJ B;  3AFQ A;  2JE6 I;  1CKO A;  3PCO B;  4DV6 L;  1J5E Q;  4LF7 Q;  3UE0 A;  1G6P A;  2K75 A;  3CCJ A;  1PH7 A;  1IBL Q;  4JV5 L;  5EAY A;  2K14 A;  4TQU S;  1L1O A;  3M9B A;  2JA5 G;  2QEX A;  3UE1 A;  4DV7 Q;  4NXN Q;  4MTN A;  1JB7 A;  2CWP A;  2IT1 A;  4DR3 Q;  4AQY L;  1XMQ Q;  2UUB Q;  2AWO A;  2Q2I A;  1JE5 A;  3S17 H;  2IHF A;  1PH4 A;  1HNW L;  5C3E H;  3U58 A;  4JI3 L;  5DLQ E;  1X9N A;  2JA6 H;  2UXC L;  1YJN A;  4LF6 Q;  1WFQ A;  2WP8 J;  1OTC A;  2YU9 H;  1HZ9 A;  4UPA A;  2AMC B;  3DM3 A;  4GOP A;  4DR5 L;  3CP0 A;  1Q82 C;  4O0A A;  1VQF A;  3OW2 A;  1VQD A;  2PI2 E;  1Y1V H;  4GNX A;  5JEA G;  1L2F A;  4A3F G;  2A19 A;  4A3E G;  4A93 H;  3W5O A;  5BR8 L;  3M4O H;  5GQO A;  3VDY A;  4DV0 Q;  3G4S A;  1XNR L;  4HJ8 A;  4OX9 Q;  2KCT A;  1BBW A;  3GTL H;  4JI2 L;  1N33 Q;  4K0K L;  4LNQ A;  4DR4 L;  3T1Y L;  4GLV B;  4X62 L;  5C44 H;  1VQ5 A;  1NBW A;  1PH1 A;  1VQE A;  2OTL A;  4LF9 Q;  1IXR A;  1VQ4 A;  4JC0 A;  3NEL A;  1J6Q A;  2UXB L;  4A3M G;  3K80 C;  1A8V A;  3MEF A;  2KCM A;  1LUZ A;  2ZM6 Q;  5M5X H;  1K9M C;  3PF4 A;  2C35 B;  2UUA L;  2AKW B;  3ULL A;  4OWX B;  2YTV A;  1HJP A;  3BZK A;  1E22 A;  1JJC B;  2EIF A;  3HOX G;  1S72 A;  4C3H H;  2WAQ E;  3B6Y A;  4GKJ Q;  1PVO A;  4DR2 Q;  1L0W A;  4DK6 C;  3CC7 A;  4BY7 G;  3NEN A;  3F2B A;  3AFP A;  2E2H H;  2A1A A;  1E3P A;  5HY6 A;  1IBM Q;  2PNH A;  5JEA J;  1KC8 C;  1N36 L;  1R9T H;  4JI0 Q;  4QGU A;  2R7D A;  4GS3 A;  1K73 C;  3M7N A;  4DR6 L;  1UE7 A;  4IPG A;  4A3G H;  1B70 B;  3PF5 A;  3CC2 A;  2R92 G;  3ICE A;  1NTG A;  1I94 L;  4LF8 L;  1KAW A;  1GKH A;  3W1B A;  3HOV H;  5M3F H;  3CXC A;  2LXK A;  1TWC H;  1X65 A;  1Q8K A;  4A3I G;  3TS2 A;  1SMX A;  4HIO A;  3KYH C;  1A62 A;  4X64 L;  2CKZ B;  1VQH A;  2GVB A;  2JA9 A;  1PYS B;  2AHO B;  3D31 A;  1SLJ A;  5LMN W;  1QZH A;  3HKZ G;  4A76 A;  1WCM H;  5LMN L;  2ATW A;  4B3R L;  2R6G A;  3CCS A;  3F8T A;  2Z6K A;  1G29 1;  2N49 A;  2HHH Q;  2ZTC A;  3J7Z C;  3CCM A;  4UY8 C;  2VQE Q;  3U4V A;  4X65 Q;  3AEV A;  3S1Q H;  2JA5 H;  3CCR A;  1AH9 A;  2B3G A;  1FVI A;  1VQ7 A;  1PH5 A;  1X55 A;  2VZA A;  3A0J A;  1Q46 A;  4WJ4 A;  4EX5 A;  1FL0 A;  2Y0S E;  3L7Z C;  4IPD A;  3KF8 B;  1IBK L;  1D7Q A;  4DV5 Q;  1IL2 A;  1VQC A;  3KJO A;  3ULJ A;  2K4K A;  2KEN A;  1YI2 A;  1FJG L;  1XPO A;  5IP9 G;  4X65 L;  1N8R C;  4LF7 L;  3I4O A;  3CPW A;  4XIG S;  4BY1 G;  3CPF A;  2VQF Q;  1HZA A;  1FGU A;  4DUZ Q;  1S3O A;  4A3F H;  1YJW A;  4NXN L;  3UDX A;  4A3E H;  4X66 Q;  3BJU A;  3HKS A;  5C0X G;  4LFA Q;  1XMQ L;  2UUB L;  4POG A;  4NPS A;  3J7A 5;  4O2D A;  3STB D;  1AE3 A;  1X3F A;  5IYC G;  2JA7 H;  3PUZ A;  4DV1 Q;  4LF6 L;  3G71 A;  2YV5 A;  4JI1 L;  4UP8 A;  3IRB A;  3S1N H;  4JI4 Q;  1YNX A;  5FLM G;  4TVA B;  3CW2 C;  1G51 A;  2KBN A;  1NE3 A;  3CMA A;  4A3L G;  3UDI A;  1GVP A;  1NJI C;  2AWN A;  3M4P A;  3CC4 A;  1PA6 A;  4YHH Q;  4P73 A;  4PZ7 A;  4A3M H;  1VS0 A;  3DLL A;  4QQB X;  4JI6 L;  1KL9 A;  4ME3 A;  3K81 C;  3KDF A;  4QIW E;  3HOZ G;  4QY7 A;  2F4V Q;  3GTM H;  1PH9 A;  4DR7 L;  4R4T A;  3TRE A;  4DV0 L;  2NZH A;  3ERS X;  3HOX H;  3RN2 A;  4OX9 L;  5FJ8 G;  2WB1 G;  4IOC A;  1L1O B;  2LSS A;  2RHQ B;  1OXX K;  4JI8 Q;  4R4I A;  4A3K G;  3W1G A;  4R4C A;  1MJE A;  3HOY G;  4BY7 H;  1VCI A;  1CKN B;  5C0X I;  3H15 A;  4IO9 A;  1N34 Q;  3ULP A;  2ID0 A;  3HKZ E;  1UWV A;  4LF9 L;  4R1J A;  3J80 i;  4DAY B;  3J81 c;  1QZG A;  5C0X J;  1HZC A;  1VQG A;  1L1O C;  4LUZ A;  1EFW A;  2E5L L;  2R92 H;  3TS0 A;  1KIX A;  2CQO A;  4GOP B;  1Q7Y C;  1PHJ A;  3PV0 A;  4P74 A;  3GTQ H;  4B3T Q;  5GAE C;  4JG2 A;  3GO5 A;  4LF5 L;  1JJ2 A;  4DV4 L;  4A3I H;  4GNX B;  5IE8 A;  4LFB Q;  1PH6 A;  4GKJ L;  1WJJ A;  2K52 A;  4GN3 B;  4DR2 L;  2QA4 A;  1QVG A;  1ASY A;  4DK3 C;  3RLF A;  1HNZ L;  4GOP C;  3KJP A;  2IX0 A;  1KD1 C;  2JA8 G;  1EOV A;  5IP7 G;  2ZJR A;  2UUC L;  1SRU A;  4JI0 L;  2MO1 A;  5AJ3 Q;  3CD6 A;  1C0A A;  1VQA A;  2VS1 A;  5IYD G;  4B3M Q;  4GLX A;  4A4I A;  5IT9 c;  1CSQ A;  2CWA A;  3S24 A;  4DV3 Q;  1QVC A;  1TXY A;  2ASB A;  4A3D G;  4YCW A;  4APV A;  3A5Z B;  4LWC A;  2ZTD A;  2F3I A;  3L0O A;  2JK8 A;  1VQK A;  3ER0 A;  2OQ0 A;  2K5V A;  2R93 G;  3E9I A;  1TWA H;  4BA1 I;  1LYL A;  5JJL A;  4JCV E;  2UU9 Q;  2NVY H;  3TQY A;  1Q1E A;  5IP9 H;  2OWO A;  4NXM Q;  2HHH L;  4GN5 A;  4PZ8 A;  1OXU A;  4LF4 L;  1KRS A;  4BY1 H;  4LFC Q;  1H95 A;  1MKH A;  4X6A H;  3PUW A;  1RL2 A;  1PFS A;  3EIV A;  4BBR G;  4XTC S;  4LUO A;  5ELO A;  4JI7 L;  4ALP A;  3TRZ A;  3OTO L;  1GO3 E;  3UDF A;  1VQJ A;  1XJV A;  1U0L A;  3K8A A;  1KQS A;  1XNQ L;  3PO2 G;  2QGQ A;  3BZC A;  4KLK A;  5GRO A;  4HJ9 A;  5IYC H;  1E7Z A;  1YHB A;  2IHE A;  3FHW A;  1VQP A;  1YBY A;  3LGJ A;  2KHI A;  2NVQ H;  1K83 H;  1RIP A;  4L5S A;  1EQQ A;  4JYA Q;  5IWA Q;  1P8L A;  5FLM H;  2R7Z G;  4JBW A;  4A3L H;  1HR0 W;  2K5N A;  1I50 H;  2Q2T A;  4PG3 A;  2N8N A;  1HNW Q;  2WFW A;  4DUZ L;  1HR0 L;  2JEA I;  3PUV A;  1Z47 A;  3HOZ H;  2NVX H;  2ZJQ A;  4LFA L;  1N32 Q;  1JJG A;  1SN8 A;  3AYH B;  3J81 j;  1E1O A;  4DUY L;  1M1K C;  5M3M G;  4YWK A;  4GKK L;  4QJF A;  5FJ8 H;  2JA7 G;  4JOI A;  4A3K H;  2JQO A;  4DV1 L;  2ES2 A;  3HOY H;  3NEM A;  4JBJ A;  2YYZ A;  3PSI A;  4OO1 G;  3KLW A;  4JI4 L;  4C3I H;  5HGQ A;  1PH8 A;  2I0Q A;  2Z6K C;  1SE8 A;  3GDE A;  1C7Y A;  4AYB G;  3KF6 A;  2VNU D;  2A8V A;  1MJC A;  1UE1 A;  3EBE A;  4YHH L;  3CME A;  1C9O A;  1T9H A;  4K0K Q;  4JBK A;  3I7F A;  5ELN A;  5IYB G;  1XMO L;  1HNX L;  4DR4 Q;  3T1Y Q;  1K3R A;  4X62 Q;  2F4V L;  4L5T A;  2L15 A;  4HID A;  3HOU G;  2UXD Q;  3RNU A;  1EWI A;  3MXN B;  1J5E L;  1PYB A;  3PGZ A;  1V43 A;  2UXB Q;  1M90 C;  3PIO A;  1IBL L;  2JA8 H;  2VY3 A;  5IP7 H;  2HIX A;  4B3S Q;  3I4M G;  3TEH B;  2GVA A;  2VW9 A;  2K50 A;  4DV7 L;  1YIT A;  2UXD L;  1NMF A;  4DR3 L;  5IYD H;  4IPH A;  3UDG A;  2I5L X;  1VQM A;  3H0G G;  1NY4 A;  2EQS A;  2F52 A;  3JC6 6;  4UP9 A;  1IBM L;  4A3D H;  2VUM G;  1TWG H;  3GTJ H;  3SGI A;  1N36 Q;  4DPG A;  4PMW A;  4FDB A;  4OWT B;  3CF5 A;  1KRT A;  1LM0 A;  3PUX A;  4IPC A;  4PZ6 A;  2JJQ A;  4KHZ A;  2PQA B;  4JI5 Q;  4IFD G;  2R93 H;  4LF8 Q;  1OXV A;  5GAD C;  5M5Y H;  3H3V H;  3F2C A;  2YTY A;  1BVS A;  2K5H A;  3I2Z A;  3M4Q A;  5GAH C;  1EIY B;  2B63 G;  3A5U A;  1X3G A;  1S40 A;  1QUQ A;  2IX1 A;  4DV3 L;  1A0I A;  3RLO A;  1V9P A;  4BBR H;  4KHP Q;  4Y52 H;  2R7F A;  1WI5 A;  4AH6 A;  1N33 L;  2BH8 A;  4IJL A;  4A3J G;  2B29 A;  5LMN Q;  3PO2 H;  2E2J H;  1K8A C;  2RF4 A;  4R4Q A;  3OYY A;  2OQK A;  2VL6 A;  3S1R H;  1UE5 A;  2N78 A;  1IBK Q;  3GTO H;  4EQ5 A;  2MQH A;  4A3B G;  2Z0S A;  2R7Z H;  2WAQ G;  2UU9 L;  4NXM L;  1X54 A;  1YEZ A;  2ZM6 L;  1XPR A;  4DKA C;  4DR1 Q;  3GD7 A;  3E0E A;  3FP9 A;  2RHS B;  4MNO A;  4YWM A;  4LUV A;  3K7A H;  4DAM A;  3JAM c;  1I3Q H;  1YVC A;  4GLA C;  1K0R A;  3PO3 G;  4AYB E;  5C4X G;  1UE6 A;  1YZ6 A;  2I5M X;  3T1H Q;  2CCZ A;  3G48 A;  4IFD J;  2NZO A;  1YIJ A;  5M3M H;  1SFO H;  1TWH H;  1GD7 A;  1FJG Q;  1OXT A; 
#chains in the Genus database with same CATH topology
 2ENB A;  1SRO A;  3BVM A;  1EQT A;  4R9W A;  4GNX C;  2MJ8 A;  4AIM A;  1IZ6 A;  1WCM B;  2DN8 A;  3RUZ A;  1Y8P B;  5E7N A;  3K7U C;  4BXX G;  4DAY A;  1B8A A;  1LTL A;  4JI1 Q;  5CYU A;  3D6W A;  3IFT A;  2JA5 B;  1EYG A;  3HOU H;  4LW1 A;  3TZU A;  4HED A;  2QW7 A;  3A55 A;  2GN5 A;  1X56 A;  3S14 H;  3EVQ A;  3E9H A;  5EKL A;  5JPM C;  1J9O A;  4DFA A;  3D4D A;  5E4W C;  3LNN A;  1MIU A;  3KOJ A;  4DNI A;  3I91 A;  2PMZ E;  4YCU A;  4YCV A;  2B2Y A;  4ABN A;  3PIP 3;  2KEE A;  3QJY A;  5H1S E;  4DXF A;  3T53 B;  4G4K A;  2RKS A;  4ZLT F;  1HZB A;  1BBU A;  5JJK A;  3PUY A;  3S9W A;  4JI3 Q;  2H5X A;  4RAU C;  2UXC Q;  5HGT A;  3S16 H;  2BA0 A;  3FKI G;  5FO8 B;  4HIM A;  1WYD A;  3S2D H;  1N9W A;  5K36 G;  1UNS A;  1D8L A;  5EKI A;  4CDE C;  1S5D D;  3KF6 B;  2UUC Q;  1I6H H;  4RCN A;  2D5D A;  4JOI C;  5JAV A;  1ZKO A;  3CRL C;  2ZJP A;  3SK5 A;  5KYI A;  2JA6 G;  2BA1 A;  4UAI A;  1A2U A;  3WOE A;  4BY7 B;  3LX0 A;  2F0H A;  5C4X H;  2QDL A;  3OIP A;  3PO3 H;  4JI8 L;  2R7Z B;  1IHZ A;  1JMC A;  4C3J H;  1W3S A;  1QB5 D;  5C4J H;  3H09 A;  1N34 L;  4QL5 A;  3SK8 A;  4P75 A;  4JI7 Q;  3SVM A;  3L3O C;  4OO1 I;  2LXJ A;  1KNA A;  4BXX H;  3SXH A;  2F0L A;  4DR6 Q;  2E2I H;  1STA A;  4L63 B;  1EY7 A;  1YHA A;  4AYB B;  3TP8 A;  3I55 A;  1K0S A;  1FYC A;  3OIQ A;  4L5Q A;  3NHH A;  3A8I E;  4L6T B;  1V1Q A;  2C5C A;  5CV9 A;  4C3H G;  4X64 Q;  2A69 D;  1TWA B;  4Q5V A;  1CA6 A;  1C48 A;  3DWA A;  2KJX A;  3W3A A;  4DU9 A;  4DV2 L;  2EY6 A;  4B3R Q;  1C8C A;  1DCZ A;  3S14 B;  4MHE A;  5LL6 S;  4MIU A;  3HEJ A;  1EQR A;  2N3S A;  2M00 A;  1E24 A;  4LFC L;  1XMO Q;  3VA7 A;  3E3X A;  3FKI H;  1CUK A;  4M1U B;  5K36 H;  1ONL A;  2JE6 I;  1CKO A;  5KNB A;  1G6P A;  3UE0 A;  1TQO A;  3H6M A;  1PH7 A;  1Q90 A;  1L1O A;  1JWM D;  2PMZ B;  3S16 B;  4DV7 Q;  4NXN Q;  1QJO A;  1JB7 A;  2NVX B;  3MA2 B;  3CRK C;  2C9O A;  2Q2I A;  1AW7 A;  2IHF A;  4A3K B;  1IYU A;  2N55 A;  3U58 A;  2JA6 H;  1X9N A;  1OTC A;  4RH6 A;  1TS5 A;  2ICE C;  4UPA A;  1O78 A;  1D6E C;  4DR5 L;  3MXU A;  4O0A A;  1F77 A;  1VQD A;  1L2F A;  4A3F G;  2A19 A;  4CKC A;  4DK0 A;  3PO3 B;  1XNR L;  3G4S A;  3CU7 A;  4HJ8 A;  1BBW A;  1R4P B;  3ITP A;  1TVX A;  1RF2 D;  1GHK A;  4X62 L;  1K8O A;  1NBW A;  1U9R A;  4IQZ A;  5TSS A;  1PH1 A;  3IFD A;  2OTL A;  4JVZ A;  1IXR A;  1ZXT A;  4A3M G;  3K80 C;  3NP8 A;  1A2T A;  1LUZ A;  1HPC A;  2F0N A;  3NSW A;  4PV1 C;  2G5D A;  1SYB A;  2EPB A;  2YTV A;  2EIF A;  4C3H H;  1PVO A;  1KLG D;  2I07 B;  4DA2 A;  4HMI A;  2E2H H;  1T5X D;  1E3P A;  3C2P A;  1N36 L;  1R9T H;  1B70 B;  3CC2 A;  3QIA A;  1ROD A;  3BVG A;  3NQT A;  4BBR B;  1NTG A;  1I94 L;  2D2C C;  1VMP A;  1HQR D;  4XT3 B;  3H3V C;  3NBI A;  1EZ8 A;  3CXC A;  2E2J B;  1TWC H;  4O42 A;  2HUG A;  2EJM A;  4HIO A;  3KYH C;  2CKZ B;  1EU4 A;  2JA9 A;  1PYS B;  1KAA A;  1S5E D;  2K1B A;  3DMU A;  1H9J A;  5I2Y A;  3DEP A;  4X3S A;  3VYR A;  1WTW A;  3F8T A;  2ZTC A;  3CCM A;  3GP7 A;  2NB0 A;  3AEV A;  1IL8 A;  1B4O A;  1SYD A;  2G9D A;  1SJE D;  1X55 A;  3VR3 A;  5ISR A;  2Z6B A;  3OW7 A;  1IBK L;  1D7Q A;  1LT5 D;  4DV5 Q;  1PTO C;  1IL2 A;  1A3U A;  5IP9 G;  3SK6 A;  1N8R C;  3I4O A;  2QDB A;  4XIG S;  3A56 A;  3CPW A;  2VQF Q;  3RZD B;  1HZA A;  1FGU A;  3E6Z X;  1S3O A;  4A3F H;  4KK7 A;  1F2M A;  3UDX A;  3RZO B;  5IGB A;  3MC0 B;  2VB2 X;  1SYC A;  4POG A;  5NUC A;  4KY6 A;  4O2D A;  3STB D;  1AE3 A;  1X3F A;  2KCN A;  3PUZ A;  4DV1 Q;  3J7A V;  1EWC A;  1E2Z A;  1NE3 A;  3U9S A;  5I9O A;  3CMA A;  3UDI A;  3M4P A;  1PA6 A;  4B9X A;  4A3M H;  5C3X A;  2Z8L A;  4K6L A;  3K81 C;  4QIW E;  4ZKB B;  3GTM H;  4DR7 L;  3RN2 A;  4DV0 L;  3QG1 A;  2WB1 G;  1MJE A;  5K5P A;  1SEB D;  4R4C A;  3HOY G;  2FJ2 A;  1VCI A;  5C0X I;  1VF7 A;  2PW7 A;  5DEH A;  3ULP A;  2UXD Q;  4LF9 L;  4R1J A;  3J80 i;  2E5L L;  1HZC A;  1WTH A;  5CGK A;  4GOP B;  1Q7Y C;  2E2H B;  2FMM A;  4O1N A;  1VF5 C;  4Z9C B;  1R9T B;  5C3W A;  2KOL A;  4R8I A;  4ZUI A;  1EIH A;  2M2L A;  5IE8 A;  4GKJ L;  1WJJ A;  1TS3 A;  4KV6 A;  2BCO A;  1KD1 C;  2TMP A;  2A6H D;  4KY5 A;  5EGT A;  5AJ3 Q;  3CD6 A;  1B3A A;  2VS1 A;  4B3M Q;  3KBG A;  1CSQ A;  3K5M A;  2F3W A;  4DV3 Q;  3Q24 A;  1QVC A;  4A3D G;  4LWC A;  2JK8 A;  2GA4 B;  3ER0 A;  2K5V A;  5L37 A;  4OL7 A;  1B50 A;  4HAE A;  5JJL A;  4JCV E;  1BUV T;  5IP9 H;  2HHH L;  4GN5 A;  4LF4 L;  1OXU A;  4XYO A;  1EWH A;  3VYU A;  5D3D A;  2LFN A;  4TKO B;  3GTK B;  4X6A H;  1GJX A;  3S15 B;  2F0E A;  1LTB D;  1PZI D;  1NUC A;  1CFM A;  1GO3 E;  1VQJ A;  1XJV A;  1U0L A;  2J7Z A;  3BZC A;  1MSH A;  5GRO A;  1YHB A;  2IHE A;  1SNO A;  3FHW A;  3I4N B;  2L1B A;  1P8L A;  2XVS A;  1HR0 W;  4B08 A;  5I6W A;  2N8N A;  1HNW Q;  1JWU D;  4CJ2 C;  4DUZ L;  1HR0 L;  4J1M A;  2JEA I;  3MTS A;  4N8F A;  1SMY C;  3OMC A;  2LS0 1;  3S2H B;  2KEC A;  4JOI A;  2JQO A;  3KLR A;  3FPP A;  3HOY H;  3U9O A;  4OO1 G;  3MEH A;  4C3I H;  1PH8 A;  2Z6K C;  1TKW B;  1MJC A;  3EBE A;  4YHH L;  1A6X A;  1WTQ A;  4K0K Q;  1I4Q A;  5IYB G;  4JBK A;  4CDF C;  1B3Q A;  3BS1 A;  4QIW B;  3MXN B;  3PGZ A;  4HTH A;  2UXB Q;  1CTM A;  1IBL L;  4CBV A;  2VY3 A;  3I4M G;  1QOH A;  2MUY A;  2K50 A;  1O80 A;  1NMF A;  1HFN A;  4IPH A;  2RDG A;  2I5L X;  2H4O A;  1Y1V B;  1ET6 A;  2K03 A;  4EQN A;  4A3D H;  2VUM G;  4OWT B;  5EPL A;  3PUX A;  4LF8 Q;  3AB9 A;  2RCF A;  3GTL B;  1RTO A;  2K5H A;  5CV5 A;  3I2Z A;  1EIY B;  1X3G A;  1BOS A;  1XTC D;  3RLO A;  4KHP Q;  3HP3 A;  1EEF D;  2R7F A;  3G7L A;  4U67 3;  1N33 L;  4A3J G;  5M5X B;  4R4Q A;  2B2T A;  2F0U A;  3BG3 A;  2CH4 W;  5KRU A;  2WAQ G;  3R2I A;  4NXM L;  1ICW A;  2ZM6 L;  1Q3L A;  4DR1 Q;  3MWY W;  3E0E A;  3MFY A;  3FP9 A;  1I3Q H;  4GLA C;  1K0R A;  4QMG A;  2I5M X;  1YZ6 A;  2EJF C;  1S5F D;  4IFD J;  3HOV B;  2NZO A;  1BR9 A;  2J0T D;  3NBH A;  4X65 Q;  1OXT A;  1O7I A;  1IBM L;  4BBS G;  3UI2 A;  4HJ5 A;  1JOR A;  4S3S A;  4OO1 H;  4JYA L;  4K8I A;  1I4H A;  2NWG A;  2XTI A;  4YY3 Q;  2MFI A;  1BF4 A;  3M85 A;  1U4M A;  1MD2 D;  1P16 A;  2MGS A;  5IYB H;  4C3I B;  1PH3 A;  3S1Q B;  1U5K A;  5IY0 A;  5LMU Q;  3HZX A;  1EY9 A;  4IUV A;  5IIF A;  2BOS A;  2DY8 A;  4JI6 Q;  2VQE L;  2Y0S G;  3I4M H;  2PO4 A;  1L0X B;  4DV6 Q;  1TWF H;  1BKB A;  4KD3 A;  4ZQ3 A;  3WWV A;  1HRJ A;  2RQX A;  3OSO A;  3RN5 A;  1VQ8 A;  2VUM H;  2FIN B;  4IUU A;  5C5M A;  4OEM B;  3QOL A;  4NB3 A;  1VQ9 A;  2HQL A;  2E76 C;  2F03 A;  4LF5 Q;  5JVH 3;  3H91 A;  5LL6 X;  3H3V I;  2PW5 A;  4DNT B;  1B7Y B;  1HNZ Q;  1EUJ A;  3CQZ H;  4A3J H;  3GTG H;  3CCQ A;  1GM5 A;  2K5W A;  4FP5 D;  1PMR A;  1F9P A;  4JI5 L;  5BR8 Q;  5J39 A;  2F0T A;  3F1Z A;  4ILW A;  5C3E G;  2I5H A;  1CQF A;  1XXG A;  3AQQ A;  1YJ9 A;  3T56 B;  1KDA A;  3DM1 A;  3I72 A;  1K8G A;  4HSV A;  2D0P A;  1EEI D;  1F9Q A;  4ODG A;  4C1N I;  3FVQ A;  2E8G A;  2F1M A;  3NK9 A;  2UUA Q;  1EIF A;  4BBS H;  3D6C A;  4KI0 A;  3K0Y A;  1S5C D;  4EQO A;  3GV6 A;  4YIJ A;  1ESR A;  1SSO A;  3TME A;  1IKL A;  4B3T L;  2EZV A;  5C44 G;  1XNQ Q;  5EQ0 A;  3I4L A;  4LFB L;  3T1H L;  2HT1 A;  1VQB A;  1VQN A;  5IGD A;  3GTP H;  1YNJ D;  3QB3 A;  2NN6 I;  1STY A;  3H94 A;  3EJI A;  2KA7 A;  3TP6 A;  1PFM A;  3MXN A;  1UAP A;  2Q2H A;  1SNM A;  2CFM A;  4YWL A;  1VQO A;  1JB3 A;  1FNU A;  3J7Y W;  4IUN A;  1EIG A;  4A3G G;  1W2B A;  2YTX A;  3K58 A;  3I4M B;  2MNA A;  4A75 A;  1UEB A;  5IGC A;  4HJA A;  2F0Q A;  4P71 A;  1DXM A;  1EL0 A;  1Q1B A;  1WOC A;  1WTO A;  2NVQ B;  5CMD A;  5M9O A;  4HIK A;  3R8B A;  3L2P A;  1QG7 A;  4GN4 B;  3C3L A;  1IYJ B;  3PCO B;  5CV6 A;  1EY8 A;  1J5E Q;  4LF7 Q;  2K75 A;  3CCJ A;  4TQU S;  2EYJ A;  1MBY A;  4MTN A;  2UUB Q;  1JE5 A;  3S17 H;  3R3O A;  1Q8I A;  3ZYY X;  1PH4 A;  4RFB A;  3CQZ B;  5C3E H;  4JI3 L;  4A3J B;  3I73 A;  2UXC L;  3GTG B;  2B2V A;  1WFQ A;  4I65 A;  2YU9 H;  2KCC A;  1SAP A;  1NNX A;  1VQF A;  3PQI A;  2PI2 E;  3FPU B;  1PRT D;  5JEA G;  3Q23 A;  5IGF A;  5D14 A;  3ND8 A;  4A3E G;  3W5O A;  2RDH A;  5KEE A;  2J4X A;  1YNN C;  4LNQ A;  1BCP B;  2CW0 C;  5C44 H;  2X6L A;  2F0M A;  2B8G A;  3K57 A;  4IFD H;  2QCP X;  4V0B A;  1G6Z A;  1A8V A;  2AQ3 B;  2JN4 A;  2KCM A;  4RA8 A;  3NTH A;  3GTJ B;  2C35 B;  3BZK A;  2HCC A;  2R93 B;  4CDC C;  4DR2 Q;  1SDF A;  3AFP A;  2A1A A;  1D5M C;  1KC8 C;  4QGU A;  1K73 C;  4GS3 A;  4DR6 L;  3M7N A;  4A3G H;  1UE7 A;  2R92 G;  3VYS A;  1PYW D;  3ICE A;  3W1B A;  1IYV A;  1SE2 A;  4XQQ A;  1X65 A;  1Q8K A;  3S1R B;  1A3T A;  1JE4 A;  1A62 A;  2JP1 A;  4X64 L;  1VQH A;  3K5L A;  3GTO B;  1AP0 A;  2HD3 A;  1QZH A;  3HKZ G;  1EY5 A;  4A76 A;  2A68 C;  1I4P A;  4HCE A;  1EYA A;  1EOT A;  1HFG A;  4B3R L;  2Z6K A;  3J7Z C;  3I90 A;  1LO5 D;  5DNF A;  2EYO A;  3CHB D;  4FF3 A;  2B3G A;  5M3M B;  1PH5 A;  2N88 A;  2OT2 A;  3A0J A;  2L12 A;  2PNR C;  3KJO A;  3ULJ A;  1BBX C;  1TU2 B;  2KEN A;  1CZW A;  2NTT A;  1BCP F;  4BY1 G;  5JEA H;  1YJW A;  4NXN L;  4HCS A;  1PLF A;  4A3E H;  2YU9 B;  3HKS A;  3P75 A;  3HOU B;  2BE5 C;  4NMZ A;  2Q8T A;  5DM7 3;  2CVR A;  2L4N A;  1IKM A;  1BDO A;  1CM9 A;  2YV5 A;  3S1N H;  3IRB A;  4JI4 Q;  3I8Z A;  3CW2 C;  1G51 A;  2B2T C;  1CI3 M;  1NJI C;  3SEB A;  1XX8 A;  4PZ7 A;  3HOZ G;  5FK9 C;  3QR8 A;  2OF1 A;  4QY7 A;  3TRE A;  4IOC A;  2O4X A;  2LSS A;  4JI8 Q;  2NVT H;  5EPK A;  1PZJ D;  3AMU A;  4TSS A;  4XYQ A;  4DN4 M;  2Q8R E;  1N34 Q;  3HKZ E;  1VQ7 A;  3J81 c;  1OO9 B;  2L9H A;  2R92 H;  3S2D B;  1SNC A;  1KIX A;  1PHJ A;  4IUP A;  4KD4 A;  3GTQ H;  1I6H B;  5GAE C;  4DV4 L;  3MHB A;  4GNX B;  1PH6 A;  1G2S A;  2QA4 A;  1ASY A;  4GOP C;  2K6A A;  1EOV A;  1SRU A;  3P1H A;  5C4X B;  1HUN A;  4C3J B;  4YCW A;  3Q6S A;  5EBD A;  5C4J B;  3L9A X;  2ZTD A;  3L0O A;  1VQK A;  1A15 A;  2SNM A;  2OQ0 A;  3E9I A;  2EY1 A;  4BA1 I;  4KJO A;  2NVY H;  2ZXR A;  3TQY A;  5KNC A;  2WII B;  4TRD A;  5FO9 B;  4BY1 H;  2NBF A;  2F0O A;  4LFC Q;  3EIV A;  4NW2 A;  1SNP A;  3IL8 A;  2E2I B;  3M7G A;  2PYK A;  4WJW A;  4ALP A;  2QKI C;  3OTO L;  3PO2 G;  3GV3 A;  3NWS A;  1E0B A;  4C1N K;  1VQP A;  1YBY A;  2RA4 A;  3OPO A;  1K83 H;  1RIP A;  4XQN A;  1RTN A;  1HA6 A;  5IWA Q;  1H9R A;  1SNQ A;  1I50 H;  1STN A;  5C6A A;  3BDL A;  2F0P A;  3SDZ A;  4XQJ A;  3S1N B;  3HOZ H;  2ZJQ A;  1N32 Q;  4K8J A;  2BDO A;  4DUY L;  1D1I A;  1TS4 A;  1H9S B;  4GKK L;  2Z4H A;  5G3L D;  4DV1 L;  2YYZ A;  3PSI A;  3KLW A;  3Q0A A;  4HMJ A;  5HGQ A;  1CHP D;  3GDE A;  3FKI B;  3KF6 A;  2VNU D;  2L5T A;  3NUC A;  3QWN A;  1UE1 A;  4PNY A;  1JQY D;  1HNX L;  2XSC A;  2AQ1 B;  4X62 Q;  2L0C A;  4I7Z C;  1AZQ A;  3RNU A;  1EWI A;  4X3U A;  2R92 B;  2O5I C;  2JA6 B;  3PIO A;  3GTQ B;  5FKA C;  2DNC A;  4B3S Q;  1WTV A;  1JC7 A;  2GVA A;  2VW9 A;  2UXD L;  4DR3 L;  1AFP A;  3HKZ B;  4N8X 1;  3H0G G;  2F52 A;  1TWG H;  1N36 Q;  3PMF A;  1SXT A;  4PMW A;  4IPC A;  2PQA B;  1PTO D;  3NE5 B;  1K28 A;  2Z9H A;  2H1E A;  5M5Y H;  3H3V H;  2MP1 A;  5KIX A;  3MAQ A;  2B63 G;  4ID6 A;  2IX1 A;  4DV3 L;  3A7L A;  2RVL A;  4Y52 H;  1K8M A;  2A5H A;  3BZD B;  2BH8 A;  2F4I A;  3PO2 H;  1EYD A;  2RF4 A;  1UE5 A;  2N78 A;  4EQ5 A;  4C3H B;  4HSP A;  3J81 L;  4A3B G;  4KKU A;  3Q22 A;  1XPR A;  1WVL A;  2PZW A;  1IBK Q;  4YWM A;  3K7A H;  2EJG C;  3JAM c;  1K83 B;  1PTO H;  2CCZ A;  2B2V C;  4ZKC B;  1SFO H;  1TWC B;  2RCN A;  4MZ9 A;  1BXT A;  1I6V C;  3Q8D A;  1GHJ A;  3HOW G;  1KDC A;  3HOZ B;  1TR5 A;  4RG1 A;  3S1M H;  1E1T A;  4POF A;  1D5X C;  3KLS A;  5FLX c;  5LHY 1;  1GUO A;  4UP7 A;  1Y1W G;  3U50 C;  2PZT A;  3C1F A;  4BA2 I;  4IOA A;  4A3C G;  1CKM A;  2HDL A;  1STH A;  5M5W H;  1Q12 A;  4J6H A;  3C46 A;  4DR7 Q;  4MN3 A;  2D0O A;  3CAM A;  3H0G H;  5BN3 A;  4L5R C;  4JV5 Q;  4A3F B;  2F0F A;  2EY2 A;  1V1O A;  2FXQ A;  2WB1 E;  3X3N A;  1YHQ A;  3VYT A;  2E5L Q;  1KTK A;  4HJ7 A;  4FF4 A;  1QVF A;  4AQY Q;  2XRQ D;  3N6R A;  1KHI A;  2ZTE A;  3D0F A;  3EQL C;  2EYP A;  3NPP A;  5A35 A;  1JOQ A;  4X66 L;  1STB A;  2B63 H;  2DUD A;  2F0S A;  3G6E A;  4F7X A;  2JEB I;  5A2Q L;  1WTP A;  2WAC A;  5T1G A;  4LAA A;  4A3M B;  1PV4 A;  1B53 A;  4K5X A;  3PIP A;  4OWW B;  3GTM B;  4RMF A;  1Y14 B;  3CCL A;  1XPU A;  4A3B H;  3OHX C;  1SYE A;  1O7Y A;  1VQ6 A;  4JI2 Q;  3KFU A;  3TZD A;  1U4R A;  3CCV A;  1QIL A;  3A7A B;  2XGT A;  4KHP L;  2PQE A;  2DGY A;  1OXS C;  5IGG A;  4EVO A;  1SMY D;  4CGY B;  3HG9 A;  4OIK A;  5FOB B;  1S5B D;  5FO7 B;  4LF4 Q;  2K33 A;  4IJH A;  4A93 G;  4FXG C;  1AZP A;  1CSP A;  3HOW H;  1LTT D;  1JT8 A;  1Z9F A;  5IOD A;  4DR1 L;  1RJT A;  2OTJ A;  1D1K A;  1MHW C;  1E2W A;  4DF7 A;  1TY2 A;  2NUC A;  4R8N A;  3RLN A;  4WOR A;  1B9M A;  3S1M B;  1QUQ B;  1Y1W H;  3EA6 A;  1IW7 C;  4ZCK A;  1HR0 Q;  4A3C H;  4J15 A;  5BN5 A;  3J81 E;  4B9W A;  4YY3 L;  1XTD A;  2FHT A;  4H0L C;  1VQL A;  4QCL A;  3KUP A;  1ET9 A;  4JBM A;  1EFI D;  2F0V A;  1LTR D;  3M3Y H;  5LMU L;  1K3B C;  2BH2 A;  2HQE A;  1SBB B;  1SR3 A;  2JXM B;  3T13 A;  2CQA A;  5M3F G;  3NXW A;  1F2L A;  3JAM i;  3EN2 A;  3X3M A;  1X3E A;  2EYH A;  2IW3 A;  2PQA A;  2RBM A;  2V1C C;  3JAM L;  2EYL A;  5JJZ A;  4UHV A;  2KHJ A;  1WCM G;  1GOZ A;  3CCE A;  3AFQ A;  4DV6 L;  4BS9 A;  1IBL Q;  5EAY A;  2K14 A;  2XIW A;  5E4X A;  3M9B A;  2JA5 G;  2QEX A;  3UE1 A;  4BWG B;  2CWP A;  2IT1 A;  4KJN A;  1XMQ Q;  2WB1 B;  3HOY B;  2P5Z X;  1W6J A;  5FLX L;  4LF6 Q;  4EQP A;  1HQM C;  2AMC B;  3BDC A;  4GOP A;  1I4R A;  4A3B B;  3W2D A;  3ONA B;  5DM6 3;  3OW2 A;  4LJZ C;  1JOK A;  1UEA B;  5ELB A;  2XNA C;  4NP5 A;  2DJF C;  2EOT A;  3MXG A;  4A93 H;  2WV6 D;  2RDF A;  3A8K E;  5BR8 L;  3M4O H;  4H13 C;  4OX9 Q;  2B39 A;  2KCT A;  3T51 B;  1N33 Q;  4ZUJ A;  4DR4 L;  3T1Y L;  2NTS A;  3HOW B;  2E75 C;  3BDO A;  3NEL A;  4QF4 A;  5A2Q E;  4FVM A;  5C5L A;  4MTK A;  2ZM6 Q;  1K9M C;  4A3D B;  3AU7 A;  1BCP C;  3QOJ A;  2UUA L;  4RGO S;  1VMC A;  2AKW B;  3ULL A;  4QB4 A;  4DAV A;  1HJP A;  1X32 A;  4OGQ C;  1JJC B;  2A6E C;  2PZU A;  2WAQ E;  3B6Y A;  4KN7 C;  2K01 A;  1L0W A;  1STG A;  4DK6 C;  3CC7 A;  4BY7 G;  3F2B A;  1KLU D;  1IBM Q;  1GUN A;  1RKN A;  2PNH A;  5JEA J;  4JI0 Q;  3WDN A;  2R7D A;  2PPB C;  3FMC A;  1GKH A;  3LWU A;  4WFN 3;  5M3F H;  4L8J A;  1SMX A;  2AHO B;  3D31 A;  1LV9 A;  1FGB D;  5LMN W;  2IJ0 A;  2Q8I B;  1DOK A;  2DJG C;  1WCM H;  5LMN L;  3D4W A;  2R6G A;  4JW0 A;  4ZRZ A;  1BNZ A;  3CCS A;  1G29 1;  2EXZ A;  2F0D A;  2N49 A;  1CHQ D;  4UY8 C;  1I3Q B;  2VQE Q;  2XRS D;  2JA5 H;  3CCR A;  1CZG A;  1AH9 A;  1FVI A;  2AQ2 B;  2EE1 A;  2OEO A;  2VZA A;  1Q46 A;  4WJ4 A;  2Y0S E;  4IPD A;  2B2W C;  3KF8 B;  4CHT B;  1VQC A;  2K4K A;  1FJG L;  1R4Q B;  4LF7 L;  1LAC A;  4WRD A;  4PMC A;  4X3K A;  1UUP A;  3V05 A;  3CPF A;  2JYO A;  1CT1 D;  1V1P B;  3A8J E;  5C0X G;  4LFA Q;  1F2Y A;  2UUB L;  3J7A 5;  4ME5 A;  3GQB A;  5IYC G;  1LTG D;  2NZ1 D;  3TDQ A;  4V19 0;  4JI1 L;  1PZK D;  3JAM E;  4FYD A;  1YNX A;  5FLM G;  2KBN A;  4H7B A;  1GVP A;  4IAL A;  3CC4 A;  1TWF B;  2K5D A;  1JOO A;  1VS0 A;  3DLL A;  1SND A;  2VUM B;  2F4V Q;  5ELF A;  2EVB A;  5JJI A;  2NZH A;  2F0I A;  3ERS X;  1ZYR C;  1L1O B;  3NQI A;  1L0Y B;  4A3K G;  3W1G A;  4BY7 H;  3DEO A;  1CKN B;  5FLX E;  1ENA A;  3H15 A;  2ID0 A;  4NDX A;  1QZG A;  4K6D A;  1JIC A;  1EFW A;  2K05 A;  3DUZ A;  3TS0 A;  4B3T Q;  4JG2 A;  1V8Q A;  3GO5 A;  1JJ2 A;  4LFB Q;  1JWS D;  4GN3 B;  4DR2 L;  1WTX A;  4KKS A;  1QVG A;  3RLF A;  3KJP A;  3VR2 A;  2WAQ B;  2JA8 G;  2ZJR A;  5M3F B;  2UUC L;  2MO1 A;  3R2T A;  1C0A A;  2ZT9 C;  1VQA A;  1E2V A;  5IYD G;  1U4L A;  4A4I A;  5IT9 c;  2CWA A;  3S24 A;  1TXY A;  3V96 A;  4APV A;  3IKJ A;  2F3I A;  4U68 A;  5J1Z A;  5F2D A;  5I2X A;  4BBS B;  1TWA H;  1STE A;  3MFG A;  1LYL A;  4FO2 A;  2EYM A;  4KTA A;  2UU9 Q;  4KY7 A;  4PZ8 A;  1QE6 A;  4FF2 A;  1H95 A;  1RL2 A;  4BBR G;  4N9T A;  4XTC S;  3GTP B;  5C0X H;  4RGM A;  4JI7 L;  3TRZ A;  4RGT A;  3D3R A;  5AFW A;  4KLK A;  4HJ9 A;  1YNN D;  5IYC H;  1G91 A;  3NWT A;  2CW0 D;  2KHI A;  4L5S A;  2Y0S B;  1EQQ A;  2A74 C;  3V2T A;  5HUR A;  5FLM H;  4JBW A;  2D9U A;  3WOF A;  2B2U A;  2WFW A;  5I6Y A;  3PUV A;  1HCZ A;  1Z47 A;  2NVX H;  1JJG A;  3HGB A;  1SN8 A;  3AYH B;  1M1K C;  1E1O A;  4RGN A;  4YWK A;  3E0J A;  2JA7 G;  4A3K H;  4Q0F A;  2ES2 A;  3LWE A;  3NEM A;  4JBJ A;  4JI4 L;  1MI2 A;  1Y8O B;  2HCI A;  1FNV A;  1GUG A;  2A8V A;  4M8A A;  4PQX A;  1C9O A;  1XWE A;  3TSS A;  1T9H A;  2G9H D;  4DGZ A;  3I7F A;  1XMO L;  1I4G A;  4L5T A;  4G7H C;  3S17 B;  1V43 A;  2A68 D;  5C3E B;  4KN4 C;  2JA8 H;  1HXY D;  2IL8 A;  2O5J C;  2LY7 A;  3TEH B;  4FF1 A;  2A69 C;  4DV7 L;  1GUT A;  5ELC A;  4CDD C;  5IYD H;  3UDG A;  1QNK A;  1LT4 D;  1NY4 A;  1RHP A;  4C56 C;  3SGI A;  4DAP A;  3VR5 A;  4FDB A;  1FD7 D;  1LM0 A;  4KMU C;  1KRT A;  5C4Z A;  2R61 A;  4PZ6 A;  4KHZ A;  3KF8 A;  1OXV A;  5GAD C;  2XWB B;  2K04 A;  2YTY A;  1DYQ A;  2IX3 A;  5GAH C;  5EBC A;  5C44 B;  2E74 C;  3A5U A;  4IN3 A;  1S40 A;  4F88 A;  2HDM A;  2WKD A;  1A0I A;  1V9P A;  4BBR H;  1ENF A;  1SJH D;  1WI5 A;  2BE5 D;  5ELE A;  1V1P A;  3K5O A;  2E2J H;  2CHB D;  1K8A C;  2OQK A;  5CC4 A;  2MQH A;  3I3C A;  1JR0 D;  1HHV A;  1PRT B;  1C4Q A;  3OWE B;  1YEZ A;  3N52 A;  4DKA C;  3GD7 A;  1M8A A;  4MNO A;  1PDQ A;  2SNS A;  4LUV A;  5ELD A;  4A3G B;  4CJ0 B;  1F9S A;  1LLR D;  1UE6 A;  3G48 A;  3TN2 A;  1GUS A;  1YIJ A;  1TWH H;  1GD7 A;  2JA7 H;  2K32 A;  1DOM A;  1NR4 A;  1LAB A;  2BDN A;  2NYZ D;  2OCE A;  1Y8N B;  5IWA L;  5IT9 L;  2D62 A;  1CKN A;  4ULL A;  3J80 c;  1SE3 A;  3RZD H;  4DV2 Q;  1XYI A;  3SE0 A;  1FNW A;  4GZY C;  3RZO H;  1N32 L;  1BO0 A;  1TY0 A;  3U4Z A;  4RHR A;  3I4N G;  1M4V A;  1TT2 A;  2EDG A;  1X3Q A;  1CK1 A;  1DD2 A;  3DWP A;  1VDZ A;  2JA8 B;  4LMQ D;  1ENC A;  2K5Q A;  5JVG 3;  2K28 A;  3FEW X;  4DV5 L;  3K0X A;  4A3E B;  1X3P A;  4XT1 B;  5CR3 A;  1NMG A;  2WKC A;  2VQF L;  2AUJ D;  2QF7 A;  4B3S L;  1Y69 U;  4DV4 Q;  1PXU A;  1KAB A;  1PRT F;  4DR5 Q;  2F3V A;  1ICF B;  3OMG A;  1Q86 C;  5J22 A;  1QWY A;  4CKE A;  4JK1 C;  3TP5 A;  5CV8 A;  1XNR Q;  2NVT B;  2WIN B;  3HFZ B;  2SDF A;  2Z1C A;  1QCB D;  2NN6 G;  3FRP B;  4E6I A;  3CKI B;  3E5S A;  5GAG C;  1ZEQ X;  3MZ5 A;  1S4Z A;  3CCU A;  5EJW A;  4QUF A;  1QNU A;  4EGV A;  1Y1V G;  2E2D C;  4C2M H;  5BN4 A;  2A73 B;  4OEL B;  3ZJY C;  3RR5 A;  2FFK B;  1DGS A;  1HH2 P;  4HR7 B;  3STB C;  2DNE A;  2CH4 A;  1VQI A;  1TWH B;  2B2W A;  1EZ6 A;  4NKL A;  2JA7 B;  3OTO Q;  3QO2 A;  4H02 A;  3GTK H;  1B44 D;  4WJ3 M;  3S15 H;  3KDF B;  1I94 Q;  1A63 A;  1A3V A;  5J3B A;  1KXL A;  4R4O A;  1CA5 A;  4RHS A;  3IAY A;  2MO0 A;  5AJ3 L;  4KKT A;  1I5F A;  1O7Z A;  2HIV A;  1X6O A;  2EYF A;  4B3M L;  3I4N H;  2ZXO A;  4RWS C;  1O7L A;  4K5V A;  2XWJ B;  2EXD A;  3BU2 A;  1B9N A;  3P20 A;  4DUY Q;  1PH2 A;  1ASZ A;  4OON A;  2ZXP A;  3J7A F;  4GKK Q;  2NVY B;  2ALY B;  4F87 A;  4P72 A;  3ERQ A;  5E1F A;  4BY1 B;  3J81 i;  1WD0 A;  2LKV A;  3F2D A;  2IY5 B;  3NTI A;  3HOV G;  3A74 A;  2Q2U A;  3I56 A;  3S2H H;  4Y7N H;  1HUM A;  1KDB A;  4OXP A;  5IGE A;  2KQ3 A;  1AE2 A;  1Z6H A;  1HNX Q;  3NBH B;  1SYF A;  3OOC A;  4IFD I;  1DON A;  5IT9 E;  1GXD C;  5CBA E;  3HS0 C;  3O13 A;  1MSG A;  1I50 B;  2A6H C;  2PI2 A;  3KK7 A;  5CV4 A;  1Q81 C;  1NR2 A;  4JV5 L;  1ILP A;  4C3I G;  2X6G A;  3BYT B;  5E3F A;  1EQV A;  4DR3 Q;  4AQY L;  4J8Q A;  2AWO A;  2F0J A;  3VR4 A;  3J80 L;  1HNW L;  4K14 A;  3KBX A;  5DLQ E;  1YJN A;  1EYC A;  2OXP A;  2NN6 H;  1G8Z D;  1JCK B;  2WP8 J;  1HZ9 A;  2MPM A;  3SR1 A;  3DM3 A;  1F2Z A;  4OHJ A;  1J8I A;  3CP0 A;  1Q82 C;  1RCV D;  4IUT A;  1Y1V H;  2F0G A;  4GNX A;  1LTI D;  2IWH A;  3NTK A;  5GQO A;  3VDY A;  4DV0 Q;  2XN9 C;  1TII D;  4C2M B;  3TP7 A;  3DXJ C;  3GTL H;  2SEB D;  4PMB A;  4JI2 L;  4K0K L;  4CJ1 B;  4GLV B;  1DZ1 A;  1VQ5 A;  1G2T A;  3VA5 A;  1VQE A;  4LF9 Q;  1VQ4 A;  2B2Y C;  4JC0 A;  1J6Q A;  2UXB L;  3MEF A;  3TBI B;  5M5X H;  1TWG B;  3PF4 A;  1TS2 A;  4DNR B;  2B2U C;  3A54 A;  4OWX B;  1E22 A;  1FR3 A;  3HOX G;  2ICI A;  1S72 A;  4GKJ Q;  3I70 A;  5KYL A;  1II3 A;  3NEN A;  3FDT A;  1NCV A;  5M5Y B;  5HY6 A;  1CQV A;  2Z4I A;  2VB3 X;  4IPG A;  3PF5 A;  4ZK9 B;  3DWQ A;  4LF8 L;  4XDX A;  1KAW A;  3HOV H;  3PO2 B;  2LXK A;  4A3I G;  3TS2 A;  2RSO A;  2VXW A;  1Z7T A;  1WTR A;  2GVB A;  1SLJ A;  1ESF A;  4G7Z C;  4Y7N B;  2ATW A;  5EPJ A;  4K2K A;  5COY A;  2HHH Q;  3K7A B;  1H9S A;  3U4V A;  1LTA D;  3S1Q H;  1PTO B;  4KHV A;  1F9R A;  1D2B A;  4DXG A;  1SFO B;  1EU3 A;  4EX5 A;  1FL0 A;  3L7Z C;  3R93 A;  2JSO A;  3MVV A;  2L55 A;  1YI2 A;  1XPO A;  1AEX A;  4X65 L;  1B2T A;  1MGS A;  2X69 A;  2KVM A;  2V4D A;  3BYY B;  4DUZ Q;  2FMC A;  4X66 Q;  3BJU A;  2KUM A;  1XMQ L;  1H9K A;  4ZAI A;  4NPS A;  5G3L F;  1PFN A;  4LF6 L;  3G71 A;  1DOL A;  5M5W B;  4X3T A;  4UP8 A;  1ML0 D;  1DM0 B;  2M9V A;  4OIJ A;  4TVA B;  4A3L G;  4G57 A;  5KND A;  3OWF A;  4RCO A;  1U4P A;  2AWN A;  3H0G B;  4YHH Q;  4P73 A;  4QQB X;  4JI6 L;  1KL9 A;  2I46 A;  4ME3 A;  1IW7 D;  3KDF A;  1W6K A;  1PH9 A;  4R4T A;  1AN8 A;  3D4R A;  3HOX H;  4OX9 L;  2EY5 A;  5FJ8 G;  2RHQ B;  1OXX K;  3J80 E;  4R4I A;  5DAU A;  1B1Z A;  2B63 B;  4IO9 A;  3BVZ A;  1UWV A;  4DAY B;  5C0X J;  1VQG A;  5I4D A;  1L1O C;  4LUZ A;  2CQO A;  3PV0 A;  4P74 A;  1SYG A;  4LF5 L;  3P7J A;  4A3I H;  1PTO F;  5T1I A;  2DY7 A;  2K52 A;  1NSN S;  3MXP A;  4DK3 C;  4FNF A;  2IPK D;  4I7A A;  4XXE A;  1HNZ L;  2F0K A;  2IX0 A;  2TSS A;  4UDU C;  5IP7 G;  4JI0 L;  5COR A;  4GLX A;  4F8M A;  5JPN C;  5CBE E;  2ASB A;  2R3Z A;  3A5Z B;  1HA5 A;  1WD1 A;  2RSN A;  3SHL A;  3T16 A;  3SK4 A;  1LT6 D;  1KNE A;  2R93 G;  1T5E A;  2B8F A;  3K6O A;  4NXM Q;  1Q1E A;  2OWO A;  1KRS A;  3EFX D;  1MKH A;  3PUW A;  1PFS A;  1DJR D;  4LUO A;  1I4X A;  4K5W A;  1HTL D;  5ELO A;  1SE4 A;  2LMC B;  5I9P A;  2KHS A;  1Y1W B;  3UDF A;  4LK1 C;  3K8A A;  1KQS A;  1XNQ L;  1D5Z C;  2QGQ A;  1E7Z A;  3LGJ A;  2NVQ H;  4JYA Q;  2R7Z G;  5C4H A;  2QIL A;  4A3L H;  2K5N A;  4P2C B;  4PG3 A;  2Q2T A;  1ILQ A;  3ND9 A;  1EY4 A;  5IOC A;  3D8G A;  1BCP D;  1BQQ T;  4LFA L;  3M4Y A;  3VR6 A;  2KED A;  2L11 A;  3J81 j;  3M3Y B;  5M3M G;  2A6E D;  4QJF A;  5FJ8 H;  4QUC A;  3PIO 3;  4DK1 A;  4CKB A;  2PCF B;  1RD9 D;  3G6J B;  2I0Q A;  4FXD A;  1NAP A;  1SE8 A;  3HOX B;  1C7Y A;  4AYB G;  1H9M A;  3F2U A;  3CME A;  5ELN A;  4DR4 Q;  3T1Y Q;  1K3R A;  5D65 A;  3RD4 A;  2F4V L;  3HOU G;  2L15 A;  2QEJ C;  4HID A;  1YNJ C;  4K2L A;  4FXK C;  2MHV A;  1J5E L;  1EY6 A;  1PYB A;  2F0W A;  3C1E A;  3HRZ C;  1M90 C;  5IP7 H;  2HIX A;  4IUR A;  4RKB A;  4A3I B;  1YIT A;  3DHQ A;  4H44 C;  4ZYS A;  5EKK A;  3T4A C;  4IUQ A;  4IZ8 A;  1VQM A;  2EQS A;  3JC6 6;  4UP9 A;  3GTJ H;  2K7V A;  4A93 B;  4DPG A;  3CF5 A;  3M4O B;  4G7O C;  2R93 H;  4IFD G;  2JJQ A;  4JI5 Q;  3URY A;  3F2C A;  1BVS A;  5CV7 A;  3M4Q A;  5JOB A;  1RDP D;  1GUW A;  1QUQ A;  3KLS X;  1HTP A;  3K5N A;  2SOB A;  4N9P A;  4AH6 A;  4HN7 A;  4IJL A;  2B29 A;  3RMH A;  5LMN Q;  3ERO A;  3OYY A;  2VL6 A;  3S1R H;  3GTO H;  1EY0 A;  2Z0S A;  5KGU A;  2AUK A;  2R7Z H;  2UU9 L;  2O2L D;  1X54 A;  4RKL A;  1PFB A;  3K59 A;  2RHS B;  4DAM A;  5C4X G;  1YVC A;  3PO3 G;  5D3I B;  4AYB E;  3T1H Q;  1PRT C;  4C3J G;  4JPB W;  1LT3 D;  1LTS D;  1ZYR D;  5M3M H;  1FJG Q; 
#chains in the Genus database with same CATH homology
 2RCN A;  4MZ9 A;  2OCE A;  4HJ5 A;  4BBS G;  1SRO A;  3Q8D A;  4GNX C;  3HOW G;  4JYA L;  5IWA L;  2D62 A;  2XTI A;  1O7I A;  4AIM A;  1CKN A;  3S1M H;  4RG1 A;  1IZ6 A;  4YY3 Q;  1E1T A;  4POF A;  3J80 c;  5E7N A;  2MFI A;  3K7U C;  4BXX G;  3RZD H;  4DV2 Q;  3M85 A;  1B8A A;  1LTL A;  5FLX c;  1P16 A;  5IYB H;  1PH3 A;  4JI1 Q;  3RZO H;  1N32 L;  4UP7 A;  2NVT H;  1EYG A;  3HOU H;  1U5K A;  4LW1 A;  5IY0 A;  1Y1W G;  3U50 C;  5LMU Q;  2GN5 A;  4BA2 I;  4IOA A;  1X56 A;  4A3C G;  1CKM A;  3U4Z A;  3S14 H;  4JI6 Q;  3I4N G;  2VQE L;  5M5W H;  2Y0S G;  3I4M H;  1Q12 A;  3E9H A;  4DR7 Q;  1MIU A;  2D0O A;  3KOJ A;  4DNI A;  3CAM A;  4DV6 Q;  1TWF H;  1BKB A;  3H0G H;  3WWV A;  2PMZ E;  4YCU A;  4L5R C;  4JV5 Q;  4YCV A;  2VUM H;  3RN5 A;  1VQ8 A;  4DV5 L;  3K0X A;  2FXQ A;  2WB1 E;  1YHQ A;  5H1S E;  2E5L Q;  4HJ7 A;  1QVF A;  4NB3 A;  4AQY Q;  1KHI A;  2ZTE A;  3D0F A;  1NMG A;  1HZB A;  2VQF L;  1BBU A;  5JJK A;  3PUY A;  1VQ9 A;  4B3S L;  2H5X A;  4JI3 Q;  2HQL A;  2UXC Q;  4X66 L;  4LF5 Q;  2B63 H;  3S16 H;  2BA0 A;  4DV4 Q;  3FKI G;  2DUD A;  4HIM A;  3G6E A;  1WYD A;  3H3V I;  4DR5 Q;  3S2D H;  1N9W A;  5K36 G;  2JEB I;  1B7Y B;  1HNZ Q;  1D8L A;  1Q86 C;  1EUJ A;  3CQZ H;  3KF6 B;  4A3J H;  1PV4 A;  2UUC Q;  1I6H H;  3GTG H;  4JOI C;  3CCQ A;  1GM5 A;  3PIP A;  4OWW B;  4RMF A;  1Y14 B;  3CCL A;  1XPU A;  4JI5 L;  5BR8 Q;  2ZJP A;  1XNR Q;  4A3B H;  3F1Z A;  3HFZ B;  5C3E G;  2JA6 G;  2BA1 A;  1VQ6 A;  4JI2 Q;  3KFU A;  2I5H A;  3AQQ A;  2NN6 G;  1YJ9 A;  5GAG C;  3CCV A;  2XGT A;  5C4X H;  3CCU A;  4KHP L;  2DGY A;  1OXS C;  1K8G A;  2D0P A;  4JI8 L;  3PO3 H;  1Y1V G;  1JMC A;  4C2M H;  4C3J H;  1W3S A;  5C4J H;  4LF4 Q;  2E8G A;  4A93 G;  4IJH A;  3ZJY C;  3RR5 A;  1N34 L;  4QL5 A;  2UUA Q;  1EIF A;  4BBS H;  1CSP A;  4KI0 A;  4P75 A;  1DGS A;  3HOW H;  1HH2 P;  3STB C;  1JT8 A;  4JI7 Q;  1VQI A;  1Z9F A;  4DR1 L;  2OTJ A;  4OO1 I;  3OTO Q;  2LXJ A;  4B3T L;  4H02 A;  5C44 G;  1XNQ Q;  3RLN A;  4BXX H;  4LFB L;  3GTK H;  4DR6 Q;  3T1H L;  2HT1 A;  1VQB A;  1VQN A;  4WJ3 M;  3GTP H;  3S15 H;  3KDF B;  2E2I H;  1I94 Q;  1YHA A;  1A63 A;  1QUQ B;  5J3B A;  1Y1W H;  2NN6 I;  3I55 A;  4R4O A;  1KXL A;  2MO0 A;  5AJ3 L;  1I5F A;  4L5Q A;  1HR0 Q;  4J15 A;  2HIV A;  1V1Q A;  1X6O A;  4A3C H;  4B3M L;  3I4N H;  2Q2H A;  4X64 Q;  4YWL A;  2CFM A;  1VQO A;  2EXD A;  3BU2 A;  4YY3 L;  1PH2 A;  4DUY Q;  1ASZ A;  4OON A;  1XTD A;  4GKK Q;  2ALY B;  4DV2 L;  1VQL A;  4P72 A;  4B3R Q;  3J81 i;  4A3G G;  1W2B A;  2YTX A;  4JBM A;  3F2D A;  2MNA A;  4A75 A;  2IY5 B;  3M3Y H;  5LMU L;  3HOV G;  3A74 A;  2Q2U A;  1EQR A;  1UEB A;  2N3S A;  3I56 A;  4P71 A;  4HJA A;  1SR3 A;  5M3F G;  2BH2 A;  3S2H H;  4Y7N H;  3JAM i;  4OXP A;  1E24 A;  3EN2 A;  4LFC L;  1Q1B A;  1AE2 A;  1HNX Q;  1X3E A;  1XMO Q;  3NBH B;  1WOC A;  2PQA A;  4IFD I;  2V1C C;  5JJI A;  4HIK A;  2KHJ A;  3FKI H;  3L2P A;  1WCM G;  1CUK A;  2PI2 A;  1Q81 C;  4GN4 B;  3CCE A;  1IYJ B;  3AFQ A;  2JE6 I;  1CKO A;  3PCO B;  4DV6 L;  1J5E Q;  4LF7 Q;  3UE0 A;  1G6P A;  2K75 A;  3CCJ A;  1PH7 A;  1IBL Q;  4JV5 L;  5EAY A;  2K14 A;  4TQU S;  1L1O A;  3M9B A;  2JA5 G;  2QEX A;  3UE1 A;  4DV7 Q;  4NXN Q;  4MTN A;  1JB7 A;  2CWP A;  2IT1 A;  4DR3 Q;  4AQY L;  1XMQ Q;  2UUB Q;  2AWO A;  2Q2I A;  1JE5 A;  3S17 H;  2IHF A;  1PH4 A;  1HNW L;  5C3E H;  3U58 A;  4JI3 L;  5DLQ E;  1X9N A;  2JA6 H;  2UXC L;  1YJN A;  4LF6 Q;  1WFQ A;  2WP8 J;  1OTC A;  2YU9 H;  1HZ9 A;  4UPA A;  2AMC B;  3DM3 A;  4GOP A;  4DR5 L;  3CP0 A;  1Q82 C;  4O0A A;  1VQF A;  3OW2 A;  1VQD A;  2PI2 E;  1Y1V H;  4GNX A;  5JEA G;  1L2F A;  4A3F G;  2A19 A;  4A3E G;  4A93 H;  3W5O A;  5BR8 L;  3M4O H;  5GQO A;  3VDY A;  4DV0 Q;  3G4S A;  1XNR L;  4HJ8 A;  4OX9 Q;  2KCT A;  1BBW A;  3GTL H;  4JI2 L;  1N33 Q;  4K0K L;  4LNQ A;  4DR4 L;  3T1Y L;  4GLV B;  4X62 L;  5C44 H;  1VQ5 A;  1NBW A;  1PH1 A;  1VQE A;  2OTL A;  4LF9 Q;  1IXR A;  1VQ4 A;  4JC0 A;  3NEL A;  1J6Q A;  2UXB L;  4A3M G;  3K80 C;  1A8V A;  3MEF A;  2KCM A;  1LUZ A;  2ZM6 Q;  5M5X H;  1K9M C;  3PF4 A;  2C35 B;  2UUA L;  2AKW B;  3ULL A;  4OWX B;  2YTV A;  1HJP A;  3BZK A;  1E22 A;  1JJC B;  2EIF A;  3HOX G;  1S72 A;  4C3H H;  2WAQ E;  3B6Y A;  4GKJ Q;  1PVO A;  4DR2 Q;  1L0W A;  4DK6 C;  3CC7 A;  4BY7 G;  3NEN A;  3F2B A;  3AFP A;  2E2H H;  2A1A A;  1E3P A;  5HY6 A;  1IBM Q;  2PNH A;  5JEA J;  1KC8 C;  1N36 L;  1R9T H;  4JI0 Q;  4QGU A;  2R7D A;  4GS3 A;  1K73 C;  3M7N A;  4DR6 L;  1UE7 A;  4IPG A;  4A3G H;  1B70 B;  3PF5 A;  3CC2 A;  2R92 G;  3ICE A;  1NTG A;  1I94 L;  4LF8 L;  1KAW A;  1GKH A;  3W1B A;  3HOV H;  5M3F H;  3CXC A;  2LXK A;  1TWC H;  1X65 A;  1Q8K A;  4A3I G;  3TS2 A;  1SMX A;  4HIO A;  3KYH C;  1A62 A;  4X64 L;  2CKZ B;  1VQH A;  2GVB A;  2JA9 A;  1PYS B;  2AHO B;  3D31 A;  1SLJ A;  5LMN W;  1QZH A;  3HKZ G;  4A76 A;  1WCM H;  5LMN L;  2ATW A;  4B3R L;  2R6G A;  3CCS A;  3F8T A;  2Z6K A;  1G29 1;  2N49 A;  2HHH Q;  2ZTC A;  3J7Z C;  3CCM A;  4UY8 C;  2VQE Q;  3U4V A;  4X65 Q;  3AEV A;  3S1Q H;  2JA5 H;  3CCR A;  1AH9 A;  2B3G A;  1FVI A;  1VQ7 A;  1PH5 A;  1X55 A;  2VZA A;  3A0J A;  1Q46 A;  4WJ4 A;  4EX5 A;  1FL0 A;  2Y0S E;  3L7Z C;  4IPD A;  3KF8 B;  1IBK L;  1D7Q A;  4DV5 Q;  1IL2 A;  1VQC A;  3KJO A;  3ULJ A;  2K4K A;  2KEN A;  1YI2 A;  1FJG L;  1XPO A;  5IP9 G;  4X65 L;  1N8R C;  4LF7 L;  3I4O A;  3CPW A;  4XIG S;  4BY1 G;  3CPF A;  2VQF Q;  1HZA A;  1FGU A;  4DUZ Q;  1S3O A;  4A3F H;  1YJW A;  4NXN L;  3UDX A;  4A3E H;  4X66 Q;  3BJU A;  3HKS A;  5C0X G;  4LFA Q;  1XMQ L;  2UUB L;  4POG A;  4NPS A;  3J7A 5;  4O2D A;  3STB D;  1AE3 A;  1X3F A;  5IYC G;  2JA7 H;  3PUZ A;  4DV1 Q;  4LF6 L;  3G71 A;  2YV5 A;  4JI1 L;  4UP8 A;  3IRB A;  3S1N H;  4JI4 Q;  1YNX A;  5FLM G;  4TVA B;  3CW2 C;  1G51 A;  2KBN A;  1NE3 A;  3CMA A;  4A3L G;  3UDI A;  1GVP A;  1NJI C;  2AWN A;  3M4P A;  3CC4 A;  1PA6 A;  4YHH Q;  4P73 A;  4PZ7 A;  4A3M H;  1VS0 A;  3DLL A;  4QQB X;  4JI6 L;  1KL9 A;  4ME3 A;  3K81 C;  3KDF A;  4QIW E;  3HOZ G;  4QY7 A;  2F4V Q;  3GTM H;  1PH9 A;  4DR7 L;  4R4T A;  3TRE A;  4DV0 L;  2NZH A;  3ERS X;  3HOX H;  3RN2 A;  4OX9 L;  5FJ8 G;  2WB1 G;  4IOC A;  1L1O B;  2LSS A;  2RHQ B;  1OXX K;  4JI8 Q;  4R4I A;  4A3K G;  3W1G A;  4R4C A;  1MJE A;  3HOY G;  4BY7 H;  1VCI A;  1CKN B;  5C0X I;  3H15 A;  4IO9 A;  1N34 Q;  3ULP A;  2ID0 A;  3HKZ E;  1UWV A;  4LF9 L;  4R1J A;  3J80 i;  4DAY B;  3J81 c;  1QZG A;  5C0X J;  1HZC A;  1VQG A;  1L1O C;  4LUZ A;  1EFW A;  2E5L L;  2R92 H;  3TS0 A;  1KIX A;  2CQO A;  4GOP B;  1Q7Y C;  1PHJ A;  3PV0 A;  4P74 A;  3GTQ H;  4B3T Q;  5GAE C;  4JG2 A;  3GO5 A;  4LF5 L;  1JJ2 A;  4DV4 L;  4A3I H;  4GNX B;  5IE8 A;  4LFB Q;  1PH6 A;  4GKJ L;  1WJJ A;  2K52 A;  4GN3 B;  4DR2 L;  2QA4 A;  1QVG A;  1ASY A;  4DK3 C;  3RLF A;  1HNZ L;  4GOP C;  3KJP A;  2IX0 A;  1KD1 C;  2JA8 G;  1EOV A;  5IP7 G;  2ZJR A;  2UUC L;  1SRU A;  4JI0 L;  2MO1 A;  5AJ3 Q;  3CD6 A;  1C0A A;  1VQA A;  2VS1 A;  5IYD G;  4B3M Q;  4GLX A;  4A4I A;  5IT9 c;  1CSQ A;  2CWA A;  3S24 A;  4DV3 Q;  1QVC A;  1TXY A;  2ASB A;  4A3D G;  4YCW A;  4APV A;  3A5Z B;  4LWC A;  2ZTD A;  2F3I A;  3L0O A;  2JK8 A;  1VQK A;  3ER0 A;  2OQ0 A;  2K5V A;  2R93 G;  3E9I A;  1TWA H;  4BA1 I;  1LYL A;  5JJL A;  4JCV E;  2UU9 Q;  2NVY H;  3TQY A;  1Q1E A;  5IP9 H;  2OWO A;  4NXM Q;  2HHH L;  4GN5 A;  4PZ8 A;  1OXU A;  4LF4 L;  1KRS A;  4BY1 H;  4LFC Q;  1H95 A;  1MKH A;  4X6A H;  3PUW A;  1RL2 A;  1PFS A;  3EIV A;  4BBR G;  4XTC S;  4LUO A;  5ELO A;  4JI7 L;  4ALP A;  3TRZ A;  3OTO L;  1GO3 E;  3UDF A;  1VQJ A;  1XJV A;  1U0L A;  3K8A A;  1KQS A;  1XNQ L;  3PO2 G;  2QGQ A;  3BZC A;  4KLK A;  5GRO A;  4HJ9 A;  5IYC H;  1E7Z A;  1YHB A;  2IHE A;  3FHW A;  1VQP A;  1YBY A;  3LGJ A;  2KHI A;  2NVQ H;  1K83 H;  1RIP A;  4L5S A;  1EQQ A;  4JYA Q;  5IWA Q;  1P8L A;  5FLM H;  2R7Z G;  4JBW A;  4A3L H;  1HR0 W;  2K5N A;  1I50 H;  2Q2T A;  4PG3 A;  2N8N A;  1HNW Q;  2WFW A;  4DUZ L;  1HR0 L;  2JEA I;  3PUV A;  1Z47 A;  3HOZ H;  2NVX H;  2ZJQ A;  4LFA L;  1N32 Q;  1JJG A;  1SN8 A;  3AYH B;  3J81 j;  1E1O A;  4DUY L;  1M1K C;  5M3M G;  4YWK A;  4GKK L;  4QJF A;  5FJ8 H;  2JA7 G;  4JOI A;  4A3K H;  2JQO A;  4DV1 L;  2ES2 A;  3HOY H;  3NEM A;  4JBJ A;  2YYZ A;  3PSI A;  4OO1 G;  3KLW A;  4JI4 L;  4C3I H;  5HGQ A;  1PH8 A;  2I0Q A;  2Z6K C;  1SE8 A;  3GDE A;  1C7Y A;  4AYB G;  3KF6 A;  2VNU D;  2A8V A;  1MJC A;  1UE1 A;  3EBE A;  4YHH L;  3CME A;  1C9O A;  1T9H A;  4K0K Q;  4JBK A;  3I7F A;  5ELN A;  5IYB G;  1XMO L;  1HNX L;  4DR4 Q;  3T1Y Q;  1K3R A;  4X62 Q;  2F4V L;  4L5T A;  2L15 A;  4HID A;  3HOU G;  2UXD Q;  3RNU A;  1EWI A;  3MXN B;  1J5E L;  1PYB A;  3PGZ A;  1V43 A;  2UXB Q;  1M90 C;  3PIO A;  1IBL L;  2JA8 H;  2VY3 A;  5IP7 H;  2HIX A;  4B3S Q;  3I4M G;  3TEH B;  2GVA A;  2VW9 A;  2K50 A;  4DV7 L;  1YIT A;  2UXD L;  1NMF A;  4DR3 L;  5IYD H;  4IPH A;  3UDG A;  2I5L X;  1VQM A;  3H0G G;  1NY4 A;  2EQS A;  2F52 A;  3JC6 6;  4UP9 A;  1IBM L;  4A3D H;  2VUM G;  1TWG H;  3GTJ H;  3SGI A;  1N36 Q;  4DPG A;  4PMW A;  4FDB A;  4OWT B;  3CF5 A;  1KRT A;  1LM0 A;  3PUX A;  4IPC A;  4PZ6 A;  2JJQ A;  4KHZ A;  2PQA B;  4JI5 Q;  4IFD G;  2R93 H;  4LF8 Q;  1OXV A;  5GAD C;  5M5Y H;  3H3V H;  3F2C A;  2YTY A;  1BVS A;  2K5H A;  3I2Z A;  3M4Q A;  5GAH C;  1EIY B;  2B63 G;  3A5U A;  1X3G A;  1S40 A;  1QUQ A;  2IX1 A;  4DV3 L;  1A0I A;  3RLO A;  1V9P A;  4BBR H;  4KHP Q;  4Y52 H;  2R7F A;  1WI5 A;  4AH6 A;  1N33 L;  2BH8 A;  4IJL A;  4A3J G;  2B29 A;  5LMN Q;  3PO2 H;  2E2J H;  1K8A C;  2RF4 A;  4R4Q A;  3OYY A;  2OQK A;  2VL6 A;  3S1R H;  1UE5 A;  2N78 A;  1IBK Q;  3GTO H;  4EQ5 A;  2MQH A;  4A3B G;  2Z0S A;  2R7Z H;  2WAQ G;  2UU9 L;  4NXM L;  1X54 A;  1YEZ A;  2ZM6 L;  1XPR A;  4DKA C;  4DR1 Q;  3GD7 A;  3E0E A;  3FP9 A;  2RHS B;  4MNO A;  4YWM A;  4LUV A;  3K7A H;  4DAM A;  3JAM c;  1I3Q H;  1YVC A;  4GLA C;  1K0R A;  3PO3 G;  4AYB E;  5C4X G;  1UE6 A;  1YZ6 A;  2I5M X;  3T1H Q;  2CCZ A;  3G48 A;  4IFD J;  2NZO A;  1YIJ A;  5M3M H;  1SFO H;  1TWH H;  1GD7 A;  1FJG Q;  1OXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...