4JOIA

Crystal structure of the human telomeric stn1-ten1 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
160
structure length
141
Chain Sequence
LAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKVYDQPFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human telomeric stn1-ten1 capping complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords CST complex subunit STN1
total genus 39
structure length 141
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4joiA00
2PI2E 4L5SA 2JA5H 1HZ9A 1SLJA 3L0OA 4LF8L 2Z6KC 4YHHL 3KLWA 5HY6A 3UDIA 4JI1Q 4Y52H 2BH2A 4A3JG 1HNWL 3WWVA 4GS3A 2ZM6Q 5GQOA 5C0XI 3CAMA 2K5NA 4IO9A 2NVTH 3E9HA 2NZOA 3KFUA 4LF4Q 3K7AH 3GO5A 5FJ8H 3S24A 4B3SL 3ZJYC 1HZBA 1FVIA 4QGUA 4A3EG 1X56A 3KJPA 4R4QA 4O2DA 4IOCA 1ASYA 4DV5L 1X3EA 2E2HH 5LMNL 4JI6L 4BY7G 1XMQQ 5M3FH 1N8RC 4JI8Q 1DGSA 4GLAC 4AIMA 1XPOA 1K0RA 2UUBL 3I7FA 1TWAH 4KI0A 4BXXG 2ZTDA 5IYCG 1K73C 4GKKL 3L7ZC 4DV1L 1X3GA 3MEFA 4HIDA 4DV2L 4JI3Q 4OO1I 5DLQE 4LUZA 4AYBG 1VQ4A 2EXDA 1TWFH 1L0WA 3H15A 3T1YL 2UU9Q 4A3EH 1FJGQ 3CD6A 3J81c 4GLXA 3I55A 3T1HQ 4LFCL 3ULJA 1NBWA 3UDFA 4APVA 3TRZA 5GAEC 1L1OC 1OXVA 4NB3A 2JA8H 3GTJH 4DV4Q 1HJPA 4DV6Q 3ERSX 4DR7L 4JV5Q 4A3MH 5JEAJ 4P71A 4P72A 4BBRH 2K5VA 3EN2A 3I56A 2IX0A 1PV4A 2AHOB 4DUYQ 1HH2P 3U4VA 3JAMi 2HHHL 1X6OA 4HJ5A 4JBJA 4A3CH 2CQOA 1N9WA 3CQZH 1E7ZA 2VUMH 4A3CG 1A0IA 2UXCL 3G6EA 1QVCA 5M5WH 2VL6A 4XIGS 4OX9L 3TQYA 1PH1A 2NZHA 1XNRQ 4LFBL 3CCSA 5IWAL 4DV3Q 3OW2A 1CSPA 1N33L 1Y14B 4K0KL 1QUQB 4DR3Q 5M3FG 2JA8G 3J7ZC 4YCUA 1M1KC 4L5RC 4R4OA 5C4JH 4C2MH 3I2ZA 4LWCA 3VDYA 1K8GA 4LF7Q 4X64L 1R9TH 1YITA 3S14H 3M85A 4IFDI 1WI5A 4JI1L 4HJ7A 2IY5B 2WB1G 3UDXA 2JA7H 2WP8J 2JK8A 5AJ3L 4DV0Q 4A3FH 3GTQH 2UXBQ 4A3FG 1YJ9A 1M90C 4JBMA 4XTCS 1MJCA 3KJOA 3UE1A 1EYGA 2R92H 2JEAI 3HOYG 2NN6G 1HZCA 1VQMA 1IBML 2Q2TA 3M7NA 1QZHA 4JI7L 3PGZA 2YTXA 2F4VL 5JJIA 4GN4B 3FKIH 1FL0A 1TXYA 3KDFB 5M5XH 1K3RA 1W2BA 2A8VA 4TVAB 3A5UA 4FDBA 2QA4A 1HR0Q 3PO2G 1SRUA 2VUMG 1PH7A 1X9NA 3I4NH 1N32Q 3PUYA 4GNXA 1VQBA 2GVAA 1EQQA 2NVXH 3CCRA 5C0XJ 2PMZE 3CMAA 3KDFA 1XNQQ 1BBWA 4EQ5A 2UXDQ 2L15A 3G48A 4QIWE 1N34Q 1Y1VH 2RHQB 3I4MH 3PSIA 2A1AA 3RLFA 3KF8B 3H0GG 2YTVA 1PHJA 2BH8A 3TS0A 4BBRG 3J80i 4AYBE 1BBUA 1G291 5LMUQ 4B3RQ 3GDEA 2QEXA 3F8TA 1I94Q 1YNXA 4JC0A 4A3BH 2WAQE 4BBSG 3CC2A 5IT9c 1ASZA 2Q2IA 4P75A 4BBSH 1OXXK 4LF6L 1LTLA 1N36L 4HJAA 1IBLL 5C44H 4UPAA 2H5XA 1EIYB 1TWCH 2KENA 4POGA 3GTLH 2FXQA 1YJNA 2ZTCA 1XMOL 1TWGH 2B63H 1U5KA 4X65L 4LF5Q 3KF6B 1YEZA 4BXXH 1PH3A 3M3YH 4GN3B 2KBNA 3GTKH 4H02A 4GOPB 3J81i 1YIJA 2PI2A 5FLMH 4HIMA 3K7UC 5C3EG 5AJ3Q 4DV0L 2Y0SG 1B70B 2VQFL 1HNWQ 4AQYQ 1HZAA 2ID0A 5FJ8G 2EIFA 4LF4L 1YZ6A 4GOPA 3F2DA 2ZJPA 2NVYH 4RMFA 2XTIA 4JG2A 3W1GA 2Q2UA 1PFSA 3CCQA 5BR8Q 4Y7NH 4PMWA 1IBMQ 1J5EQ 3K81C 1XMQL 2OTLA 1NTGA 4OWWB 3PUXA 5K36G 3M4OH 1A8VA 4JI2L 2UUBQ 1C9OA 1D8LA 2JE6I 1OTCA 3UDGA 3GTMH 4GLVB 4YWLA 2E2IH 4AH6A 3HOXG 2EQSA 4JI3L 5JEAG 1IXRA 3AFQA 4DR1L 3CCLA 2R7ZG 2F52A 3EBEA 3I4MG 4X62Q 4X66Q 4JCVE 3PO3G 3T1YQ 1SE8A 2JJQA 4A3LH 3HOWG 3CF5A 2ATWA 1NMFA 4DR6Q 2R93G 1L2FA 4JI5Q 3CCJA 3RLOA 1HNZQ 1XJVA 3S2HH 3HOZG 2HIVA 4C3JH 3PUZA 4PZ7A 4DV4L 4YWMA 4LW1A 1LM0A 1UE1A 1XTDA 4KLKA 3HOYH 4DK6C 4NXML 4QY7A 2OTJA 4LFAL 2E2JH 4LF8Q 4MNOA 1Q86C 1EIFA 1NE3A 2ES2A 4JI0Q 1KRSA 2ZTEA 3U50C 4DR4L 3HOXH 2VY3A 2ZM6L 3CPFA 1G6PA 4A3GG 3M9BA 1KC8C 4DR2Q 1IZ6A 1QZGA 3HOUG 4POFA 4MZ9A 1C7YA 4B3SQ 1X54A 1NJIC 3S17H 4A3IG 2R93H 2GN5A 2XGTA 1KAWA 3PV0A 1Q1EA 5LMNQ 1RL2A 3CCUA 4JI8L 5HGQA 1JJCB 2NVQH 2K4KA 3RLNA 2B63G 1MIUA 4A3KH 4GNXC 4BY1G 4DR5Q 3CP0A 3HOVH 4LF7L 2CCZA 2IHFA 3S1MH 5M3MH 2UUAL 4JOIA 1WFQA 1IBKL 2Q2HA 2PQAA 3ULLA 4DV2Q 1Y1WG 3PUWA 5C3EH 1IYJB 4AQYL 1S72A 3RN5A 1JT8A 3FHWA 2UXBL 1HNXL 2VQEL 2CKZB 2CWPA 2N8NA 5IYBG 4A3BG 4HJ8A 4L5TA 2DUDA 2JQOA 3H3VH 5ELOA 4B3TL 1XPRA 1P16A 3F1ZA 1GD7A 5C44G 4HIKA 2MO1A 1X65A 4QJFA 3NELA 1CKNB 1QVGA 2E5LQ 3STBC 1KIXA 4IPCA 4PZ6A 4YY3L 4LNQA 3FP9A 1VQIA 1WCMG 1S3OA 4BY1H 3PF4A 3L2PA 5FLMG 2AKWB 2HHHQ 3PO2H 1E1TA 3M4PA 1CKNA 2MNAA 1LYLA 4X66L 4X62L 2UXCQ 1YI2A 1N32L 3PIPA 1WJJA 2D0OA 1VQJA 1PA6A 3Q8DA 1AH9A 4OX9Q 4GKJL 3CC4A 4R4IA 1HNZL 3A0JA 3CW2C 4A3IH 1FJGL 3JC66 3RZOH 4DR3L 1B8AA 2VNUD 3HOZH 3AYHB 4P74A 1E22A 3ICEA 4MTNA 4LFAQ 2UUCQ 5GAGC 1KL9A 4IPDA 1J5EL 1VQEA 4LUOA 1GO3E 4GOPC 4B3ML 3D0FA 2YTYA 3S16H 4B3RL 2ASBA 1GVPA 2OQ0A 2JA7G 1K9MC 1JJ2A 2R7FA 4A3JH 4DAMA 3CPWA 3K80C 4JI4L 4LF6Q 5C4XH 3CCMA 4UY8C 1A63A 1N36Q 2HIXA 3CXCA 4UP8A 1VQ5A 4A3LG 5C4XG 2K52A 4DV7Q 1EQRA 1EUJA 4BY7H 1LUZA 2CWAA 3OYYA 1PH8A 1MJEA 4JYAL 2MQHA 4KHPL 2GVBA 1X55A 4BA1I 4NXNL 5IP9H 2QGQA 2ZJRA 2JA6H 4DPGA 2KHJA 1EWIA 5IYDH 5LMNW 3PIOA 1OXTA 1YVCA 1VQPA 1IBKQ 1XPUA 3BZKA 2VW9A 3ULPA 4DV1Q 3GTPH 1SROA 2K75A 1PVOA 1JMCA 3PF5A 2MFIA 4DUZL 4OWTB 3E9IA 3M4QA 3LGJA 1AE3A 1Q46A 2B3GA 4J15A 2UXDL 3J80c 1EFWA 1V1QA 2Y0SE 3HOWH 1S40A 3NBHB 4LFCQ 2BA0A 2RF4A 1PH2A 1Q1BA 5IYDG 5M5YH 4PZ8A 2ZJQA 4YY3Q 1VQCA 2E8GA 4DV5Q 1E24A 3HKZG 4JBKA 3DLLA 3KOJA 1EOVA 4HIOA 2KCTA 1JB7A 4JI7Q 4IFDJ 1WCMH 4IPGA 5LMUL 3U58A 4OWXB 2Z6KA 3F2BA 3CCEA 1Q82C 1K8AC 3SGIA 5GADC 1PH5A 1QUQA 4ALPA 4C3IH 4A75A 2RHSB 1U0LA 2R6GA 1IBLQ 4UP9A 2IHEA 2JEBI 4IPHA 3AEVA 3NEMA 1UE7A 2Z0SA 1XNQL 2UU9L 2YV5A 1SR3A 2C35B 1YHBA 4LFBQ 4JBWA 1TWHH 1Y1VG 2OCEA 2V1CC 3NENA 1PH4A 2I0QA 1Z9FA 2WFWA 1VQ7A 4OO1G 2WAQG 3BJUA 4GNXB 1RIPA 4DR7Q 2NN6I 1P8LA 3HFZB 1YHAA 5M3MG 1JE5A 3CC7A 1SFOH 1NY4A 4LF9Q 3TS2A 4YHHQ 4QQBX 1I94L 4JI4Q 3HKSA 5GROA 3TREA 1CSQA 5JJKA 2VZAA 3F2CA 4DKAC 1KQSA 1HR0W 4DV7L 2K50A 1VQGA 1KRTA 5IYBH 2YU9H 1UWVA 2WB1E 1SN8A 1FGUA 4JOIC 5BR8L 2IT1A 1H95A 1XNRL 1K83H 1V9PA 3AQQA 4GN5A 1L1OB 1V43A 3S2DH 4JI2Q 4K0KQ 3FKIG 4X65Q 4LF5L 3PCOB 3RN2A 1PH6A 4IJHA 1T9HA 3E0EA 4DNIA 3KYHC 3A5ZB 5IY0A 4DUZQ 1L1OA 2VQFQ 3RZDH 3GD7A 2AMCB 2BA1A 2PNHA 3KF6A 4JI5L 1WYDA 1E3PA 1VQLA 2HT1A 1QVFA 2AWOA 4A3DG 2N49A 1NMGA 3T1HL 1D7QA 4L5QA 3CCVA 2JA6G 4DK3C 1PYSB 2I5MX 4DV6L 2IX1A 4JV5L 3AFPA 1SMXA 4LUVA 3OTOL 2ALYB 1W3SA 5H1SE 3EIVA 3PO3H 1CKMA 1KHIA 1AE2A 1VQDA 3U4ZA 4PG3A 1CUKA 4UP7A 1J6QA 3DM3A 3RR5A 2JA9A 3IRBA 2R92G 1UE6A 3H3VI 1UE5A 4OONA 1X3FA 4IJLA 1IL2A 4R4TA 1I6HH 1N33Q 4RG1A 4A93G 1G51A 4R1JA 2UUCL 2B29A 3B6YA 2KHIA 2UUAQ 2OQKA 4LF9L 3ER0A 4B3MQ 1VQHA 1GKHA 4X64Q 2A19A 2RCNA 4WJ4A 2R7DA 2YYZA 4DR4Q 4ME3A 5EAYA 5GAHC 2K14A 5IP7G 2VQEQ 5C0XG 3S1RH 1C0AA 3G71A 2R7ZH 1YJWA 3I4OA 4DR2L 4OXPA 3UE0A 4B3TQ 1MKHA 4JYAQ 1VS0A 2E5LL 1UEBA 4A93H 5J3BA 3MXNB 4NXNQ 1O7IA 1VQAA 4JI6Q 5E7NA 5IE8A 3W1BA 1Q8KA 3GTGH 1I3QH 4A3MG 4KHZA 3HOVG 4YCVA 1E1OA 4TQUS 5IYCH 2F4VQ 5JJLA 4DAYB 1OXUA 2OWOA 4NPSA 5IP7H 4GKKQ 3PUVA 3A74A 3K8AA 3BZCA 3G4SA 1HR0L 1OXSC 4IFDG 3STBD 4IOAA 3RNUA 2LXKA 1GM5A 2N78A 1HNXQ 4P73A 2D62A 2DGYA 1YHQA 1Q7YC 1VCIA 1JJGA 4DR6L 3J7A5 1VQ8A 2MO0A 1VQNA 4C3HH 1VQ6A 3J81j 4WJ3M 1VQOA 4QL5A 5FLXc 4HJ9A 1N34L 4R4CA 4A3KG 1PH9A 4X6AH 3W5OA 2D0PA 2N3SA 2AWNA 1VQ9A 3CMEA 4NXMQ 3S15H 3OTOQ 2CFMA 2JA5G 1BVSA 1A62A 3BU2A 1CKOA 4JI0L 3S1NH 4O0AA 3JAMc 1BKBA 2F3IA 4DUYL 4A3GH 1I50H 1Y1WH 1WOCA 3HKZE 3I4NG 4BA2I 2VS1A 1KXLA 3TEHB 1B7YB 4A76A 4DR1Q 1I5FA 3HOUH 4A4IA 2I5LX 3GTOH 4KHPQ 4GKJQ 1VQKA 2I5HA 3S1QH 2PQAB 2KCMA 4EX5A 1YBYA 3D31A 1PYBA 2LSSA 3K0XA 4YCWA 2K5HA 5ELNA 2LXJA 1VQFA 3H0GH 5IWAQ 4DV3L 4A3DH 5IP9G 1XMOQ 1KD1C 1Q81C 1Z47A 2HQLA 4YWKA 4DR5L 1Q12A
chains in the Genus database with same CATH superfamily
4ULLA 2Z4IA 2FINB 1SNMA 4L5SA 1X32A 4LF8L 2Z6KC 3E5SA 3HOYB 1DONA 2A68D 2L1BA 5ELFA 1HNWL 4I7AA 4GS3A 4IO9A 3KFUA 3K7AH 5FJ8H 1LTGD 3ZJYC 4RGMA 1FVIA 4A3EG 1ASYA 2O2LD 1STYA 3TN2A 4K8IA 4BY7G 5M3FH 1SYFA 3A7LA 4ZKCB 3J81E 1XPOA 5ELDA 2ZTDA 1TT2A 4A93B 1X3GA 4HIDA 1RKNA 2HCIA 1STBA 3H15A 1FJGQ 4GLXA 3BG3A 4KY5A 4YIJA 1NBWA 3TRZA 4ZCKA 4QF4A 1AW7A 1NCVA 2L0CA 4DV6Q 4C1NI 4A3MH 4P71A 4P72A 3T51B 3W2DA 4BBRH 2IX0A 2QF7A 2AHOB 4JBJA 1F2YA 1STEA 2UXCL 1HUNA 3TZDA 2NB0A 1F9PA 3HP3A 4JVZA 4U68A 4HCEA 2NZHA 4LFBL 2VB2X 5J22A 5IWAL 2PCFB 1A3TA 4FF3A 1N33L 2QCPX 4B9WA 2JA8G 3J7ZC 1SNOA 1M1KC 4L5RC 4HN7A 4C2MH 1EL0A 4LWCA 1Y8OB 2F4IA 4JI1L 4HJ7A 2IY5B 2A6EC 2WB1G 2JA7H 2WP8J 1RTOA 5AJ3L 4DV0Q 1YJ9A 3S14B 2A74C 1PMRA 1F9SA 1LT5D 3UE1A 4K5VA 2BOSA 2NVXB 2NN6G 1HZCA 4NDXA 1QZHA 4JI7L 3TP5A 3IFDA 1BQQT 4KMUC 1SNQA 2F4VL 5JJIA 1ZYRD 1DOKA 2X6LA 5M5XH 1W2BA 4TVAB 4FDBA 3V05A 2VUMG 3I4NH 1N32Q 4GNXA 1VQBA 2BE5D 1SDFA 1PFNA 1YNND 1TIID 4A3MB 4IUNA 4G4KA 1N34Q 2GA4B 2F0FA 5IT9E 4RWSC 4FXKC 3G7LA 4TSSA 1G6ZA 4A3EB 3J80i 1G291 1TS5A 4XDXA 4F87A 1SAPA 2I07B 2EY2A 2WAQE 4XYOA 3QG1A 1N36L 4UPAA 1X3QA 4XT1B 3R3OA 2FXQA 1TS3A 2ZTCA 1XMOL 5DNFA 2CHBD 4LF5Q 4BXXH 5G3LD 4GN3B 5JPMC 3GTJB 5FLMH 3K5MA 3K7UC 1LABA 5C3EG 3MAQA 2Y0SG 1HNWQ 1GOZA 3D4DA 5FJ8G 1Y8NB 3F2DA 1CA6A 2XTIA 1ML0D 3TP8A 3W1GA 2KJXA 5I9PA 4H0LC 4J1MA 5BR8Q 4PMWA 3S1QB 1V1PA 2UUBQ 1OTCA 3UDGA 2E2IH 4AH6A 3HOXG 1EYAA 1A6XA 2B8GA 1NMFA 1CQFA 1L2FA 1E2WA 1K28A 1PTOH 1XJVA 3F2UA 3JAML 4LW1A 3URYA 2P5ZX 2MJ8A 3NUCA 4QY7A 4LFAL 2OTJA 1O7ZA 1NE3A 4H44C 1FNWA 2VY3A 3CPFA 1G6PA 4A3GG 1KC8C 3HOUG 1QZGA 2JA6B 4POFA 4MZ9A 1G91A 3N52A 5EGTA 1NJIC 4RHSA 3S17H 4A3IG 4OHJA 1PTOC 5NUCA 5LMNQ 2JN4A 2NVQH 2RA4A 1I50B 1QILA 4A3KH 2NZ1D 4GNXC 1JOOA 3DEPA 3IKJA 4I65A 5TSSA 4BY1G 3HOVH 2IHFA 1GUOA 3X3NA 2JP1A 2PQAA 2Q2HA 1Y1WG 1S72A 5E4WC 4P2CB 4ZKBB 2N8NA 2X69A 4HJ8A 4L5TA 2B2VC 4FP5D 3P20A 2F0NA 1GD7A 1SNDA 5E4XA 2MO1A 1XPRA 1QVGA 1J5EL 1PRTF 4FF2A 3STBC 2EYHA 4IPCA 4A3KB 2DY8A 5ELEA 3PF4A 1Q90A 3NTIA 2SEBD 1G2SA 5EPLA 1WJJA 1RTNA 3OW7A 3BS1A 4R4IA 1HNZL 3CW2C 2QEJC 3I72A 3EFXD 4DR3L 2NN6H 3HOZH 3AYHB 3K58A 1E22A 3E0JA 1C48A 1AZPA 5GAGC 4IPDA 2CW0D 4GOPC 4B3RL 1WTHA 2ASBA 2E2DC 1GVPA 3DEOA 4DXGA 4LMQD 5C6AA 3SK5A 5M3MB 1JJ2A 2G9DA 4LF6Q 2IJ0A 3CCMA 2EOTA 4A3LG 2HIXA 4O1NA 4UP8A 2K52A 4H7BA 4DV7Q 4JYAL 2MQHA 4BA1I 4XQQA 5IP9H 2ZJRA 2Q8IB 2CQAA 5LHY1 2JA6H 2KHJA 2V4DA 5LMNW 1OXTA 1Y1WB 1HFGA 2VW9A 2F0DA 4ZK9B 3GTPH 1QB5D 1PVOA 4PMBA 3SK6A 1KDBA 3OWFA 2MFIA 1HA5A 4OWTB 4G7HC 3M4QA 3LGJA 3QWNA 4XQJA 4J15A 2N55A 1DYQA 2F0LA 2EYJA 1PH2A 4JW0A 4YY3Q 4KJNA 3HKZG 4JBKA 4HIOA 1Q3LA 4IPGA 1JWUD 4KKUA 5FO7B 5HURA 3F2BA 1Q82C 2B63B 3GTMB 3CQZB 2PYKA 3DXJC 1KAAA 4ALPA 2R6GA 2IHEA 3AEVA 1KNAA 1YHBA 3J80L 4EQPA 1PH4A 1JQYD 3EJIA 1VQ7A 4OO1G 3BJUA 1RIPA 3VR2A 3D8GA 3LWEA 1YHAA 2C5CA 3NSWA 4IUQA 5GROA 5IGDA 4EQNA 5JJKA 2VZAA 3K5LA 3M3YB 4DKAC 1WD1A 1KQSA 1F2LA 1VQGA 4HTHA 3GTLB 1CZGA 1V43A 4DFAA 4K0KQ 3FKIG 1BOSA 4LF5L 3PCOB 4L63B 1D1KA 4FXGC 2F0KA 1SYGA 4IJHA 3RD4A 3KYHC 3ND8A 4DUZQ 3AB9A 3KF6A 2JA5B 2JA7B 4WORA 5CV7A 4V190 2AWOA 1PFBA 1NMGA 3BDCA 2RCFA 2IX1A 4DV6L 1GHJA 4A3IB 1V1OA 4ZAIA 1SMXA 1U4RA 4LUVA 3OTOL 1EQVA 5A2QL 3H3VC 2F0OA 1GJXA 1KHIA 1MHWC 1UEAB 5M5WB 3HEJA 2R92G 1UE6A 5C3XA 1R4QB 1UE5A 1I6HH 2IL8A 4A93G 1G51A 2O4XA 5JPNC 3FDTA 1H9RA 2OQKA 4PV1C 4LF9L 1MBYA 3HGBA 2A19A 2RCNA 4X64Q 2YYZA 2VQEQ 1C0AA 3G71A 2R7ZH 3VYSA 1YJWA 3I4OA 3T4AC 3UE0A 1VS0A 1UEBA 5CV4A 3MXNB 3ZYYX 5LL6X 3QOJA 5E7NA 5IE8A 4S3SA 1Q8KA 3HOVG 1E1OA 5IYCH 2F4VQ 1STNA 2ZXOA 3J7AF 1A3VA 2SDFA 2OT2A 2NTTA 3TP6A 3K8AA 4IFDG 1NR4A 3STBD 3A8JE 2LXKA 2NVTB 1BXTA 2KECA 2KUMA 4DR6L 4C3HH 1VQOA 1N34L 4A3KG 4FF1A 2D0PA 1VQ9A 3CMEA 1B9MA 3S15H 3NQIA 1K3BC 2JA5G 2AQ1B 1Y69U 1D5XC 1WVLA 1EWCA 1BBXC 1QJOA 3GTOH 3TZUA 1B1ZA 4CDEC 1VQKA 5JVH3 2KCMA 1PYBA 3D31A 2K5HA 2ZXPA 5ELNA 1HTLD 5IWAQ 3H0GH 4A3DH 1XMOQ 3MVVA 2HQLA 2PI2E 1WTQA 2Z4HA 1ZEQX 1WTPA 1SNCA 3KLWA 5HY6A 2AUKA 3Q24A 2SNSA 3SR1A 2ZM6Q 5GQOA 5C0XI 2K5NA 4LF4Q 1EU4A 4B3SL 4CBVA 1C8CA 1HTPA 4QGUA 2E2IB 3KJPA 4IOCA 2E2HH 4K14A 1X3EA 2IW3A 5K36H 1XMQQ 2XNAC 2UUBL 3I7FA 1TWAH 3KLSA 3SE0A 4KKSA 4CDFC 2JYOA 4B9XA 4DV2L 1B44D 3TMEA 5E3FA 4IALA 4AYBG 1VF5C 1TWFH 3FMCA 2UU9Q 5I9OA 3J81c 1O78A 1U4LA 3ULJA 4EGVA 2L12A 3GTJH 3ERSX 4DR7L 4DNTB 2A68C 1EY4A 4RFBA 3I56A 4DUYQ 3U4VA 3JAMi 2HHHL 1X6OA 2EXZA 3FVQA 1JC7A 2CH4A 4IN3A 4A3CH 3G6EA 2VL6A 1A2UA 5T1IA 1WCMB 2L9HA 2K01A 5C4ZA 4DV3Q 4CDCC 1TU2B 5M3FG 5IGEA 4RCOA 3VR3A 5JJZA 2PW5A 3I2ZA 2EY6A 3WOFA 4X64L 4IFDI 5FLXE 2F0IA 3M85A 1PYWD 3UDXA 3VR5A 1ESFA 2SNMA 4A3FG 5KNCA 2K5DA 2R92H 1EZ6A 3HOYG 2F0VA 3MFGA 1IYUA 3BVGA 1X3PA 3MZ5A 2E76C 2YTXA 4GN4B 3FKIH 2A69C 5C4XB 2A8VA 4HAEA 5JEAH 1HR0Q 1SRUA 1X9NA 3I70A 2KEEA 5C0XJ 2MHVA 2PMZE 1BBWA 4EQ5A 2UXDQ 4QIWE 3I4MH 3BDLA 2JSOA 3RLFA 1V8QA 5A2QE 4AYBE 4G7OC 1JORA 4B3RQ 1LT6D 3GDEA 3PQIA 4BBSG 3M7GA 3CC2A 1ASZA 2Q2IA 4DA2A 4LF6L 1IBLL 1EIYB 5C44H 1I4RA 2H5XA 4POGA 2BDNA 2KENA 2WKCA 1CZWA 1S5FD 3BVMA 5KNDA 1U4PA 1CK1A 1TWGH 4V0BA 1U5KA 4X65L 2E75C 2KBNA 4RA8A 1CA5A 2FMMA 4HIMA 5ELBA 1B70B 4AQYQ 1HZAA 3NTHA 2EIFA 4LF4L 1YZ6A 2K5WA 2F0MA 1L0XB 4FYDA 1B3QA 1PFSA 3CCQA 2OTLA 1IBMQ 1J5EQ 3K81C 1XMQL 1NTGA 1QNUA 5K36G 3M4OH 1A8VA 1D8LA 2XIWA 1CI3M 1W6JA 2JE6I 1T5XD 1GUNA 4X3UA 2N88A 4GLVB 3CCLA 4DR1L 2R7ZG 1H95A 2A6HC 2K7VA 3CRLC 4JCVE 4X62Q 1I6VC 3T1YQ 1SE8A 3HOWG 2ATWA 4DR6Q 2R93G 4JI5Q 4DAYA 3RLOA 3S16B 3A8IE 3S2HH 1LTSD 4YWMA 1UE1A 1XTDA 4C3HB 4ZQ3A 1PZID 4NXML 1F2ZA 4MNOA 4JI0Q 1EIFA 3C1FA 2F0PA 1KRSA 4DR4L 3HOXH 1ZKOA 3VA5A 1FD7D 1BCPB 2RDFA 1CTMA 2MPMA 4EVOA 1C7YA 1RL2A 1XX8A 4JI8L 5HGQA 1JJCB 3RLNA 2B63G 1NSNS 4DR5Q 3S1MH 2R61A 4JOIA 3MA2B 1TS4A 1CHPD 2VB3X 3V96A 4DGZA 1JT8A 2Q8RE 2UXBL 2CKZB 2JA8B 1GXDC 3FRPB 1GUGA 2DUDA 2JQOA 3BDOA 1P16A 1S5CD 4HIKA 1X65A 4QJFA 2E5LQ 3RZOB 1B4OA 1KIXA 2A5HA 4YY3L 4HSVA 4WFN3 1WCMG 1S3OA 1BF4A 4BY1H 3HKZB 5FLMG 3PO3B 2MNAA 1JWMD 4X66L 5G3LF 2UXCQ 1YI2A 3GV3A 1DD2A 2WAQB 2D0OA 1BCPC 1AH9A 3NXWA 1HXYD 3A0JA 4A3IH 1FJGL 3JC66 3RZOH 1PFMA 4CGYB 1E2ZA 1B8AA 1EIGA 3ICEA 4Z9CB 4LUOA 3I4LA 5CBAE 1DJRD 2JA7G 1K9MC 2EJGC 3KLSX 4C3IG 3DMUA 3CPWA 4JI4L 4UY8C 5C4XG 3OMCA 1G8ZD 2CWAA 1PH8A 1MJEA 4NXNL 1RDPD 2QGQA 1QOHA 3NWSA 1EWIA 3L9AX 4IQZA 5IYDH 1PRTD 1YVCA 4Y7NB 4DV1Q 4WRDA 1JMCA 4R9WA 3VA7A 4A3FB 2VXWA 1RODA 4DUZL 2NVYB 1FYCA 1Q46A 1VMPA 1EFWA 1S40A 3NBHB 2BA0A 2RF4A 5ELCA 1Q1BA 5M5YH 2QDBA 1VQCA 1E24A 4JI7Q 1JB7A 2KCTA 4ME5A 2RBMA 4R8IA 5LMUL 1D5ZC 4RCNA 4OWXB 4KK7A 2B2WC 3SGIA 5COYA 5DM63 2VUMB 3I73A 1SYEA 3X3MA 2RHSB 5C0XH 2JEBI 3I3CA 1AZQA 2Z0SA 2YV5A 2C35B 3D6WA 4JBWA 1TWHH 2I0QA 2EYFA 2FJ2A 2ICEC 3I4MB 1DCZA 1UNSA 4XQNA 2LS01 3HFZB 4LF9Q 1JE5A 1LTRD 5FO9B 5LL6S 4M8AA 1CSQA 4UHVA 2A6HD 3F2CA 1WTWA 3MXGA 1HR0W 2K50A 1KRTA 2R3ZA 1I6HB 2WB1E 2EJFC 2EPBA 2G9HD 2K5QA 3H94A 3R2IA 2K6AA 2DN8A 2EYMA 1K83H 3S2DH 1B50A 3D6CA 3C3LA 2PZWA 2OF1A 2LY7A 1WTRA 4X65Q 1PDQA 1SE2A 3RN2A 5ISRA 1T9HA 3E0EA 3U9OA 4DNIA 2B39A 3GD7A 4FO2A 3NWTA 1E0BA 4JK1C 1H9MA 1STHA 1VQLA 5BN5A 2EZVA 4L5QA 5CV5A 2JA6G 3L3OC 4DK3C 1DM0B 2G5DA 2IWHA 1FR3A 4K2KA 2QKIC 3GTOB 1DXMA 5EPKA 1H9SB 2X6GA 1M4VA 2AQ3B 3DM3A 2JA9A 4I7ZC 1X3FA 5KNBA 4R4TA 4A3JB 2KHIA 3NP8A 2ICIA 4B3MQ 1VQHA 1GKHA 2JXMB 4F8MA 2DNEA 3ND9A 2XWBB 2D5DA 2KHSA 5GAHC 3S1RH 2K14A 1V1PB 2PW7A 3M4YA 4B3TQ 4NXNQ 1O7IA 4BY1B 1PTOD 4HEDA 2PPBC 3GTGH 4XT3B 1I3QH 2EVBA 5JJLA 1ZYRC 2C9OA 1OXUA 2OWOA 4QCLA 4CKEA 2PQEA 5IP7H 3NE5B 1LT3D 3BZCA 1HR0L 1JR0D 2HUGA 4P73A 2D62A 4IZ8A 1KTKA 2OEOA 3DM1A 1YHQA 1VCIA 3K7AB 1Q7YC 2MO0A 4NW2A 1VQ6A 1PLFA 4CJ1B 4QL5A 2EE1A 4ZUJA 3W5OA 3NK9A 4KN7C 3GTPB 2H4OA 3S1NH 4O0AA 1BKBA 2F3IA 4DUYL 4BA2I 3P75A 1A15A 3TEHB 4A76A 1EQTA 1KDCA 2A73B 3C1EA 5CV6A 4KHPQ 4OIKA 5EPJA 3S1QH 2PQAB 5CV9A 4EX5A 1YBYA 2LSSA 3TP7A 5CYUA 1G2TA 2LXJA 4DV3L 5IP9G 3BYYB 3GP7A 2RDHA 4C3JB 2JA5H 1HZ9A 3EROA 3L0OA 2F0EA 3EA6A 3K59A 4LK1C 5I6YA 4JI1Q 3Q22A 2NVTH 5FOBB 3CAMA 3OIPA 3NQTA 1Q8IA 3GO5A 3H0GB 2HDMA 1LTID 2XRSD 1X56A 4R4QA 4JI6L 4DV5L 5J39A 3CKIB 4ZUIA 1DGSA 4GLAC 1TWCB 1K0RA 4KI0A 4DV1L 2TSSA 5FLXL 1UAPA 3MEHA 3MXPA 2F0TA 1JWSD 4LUZA 2XRQD 2EXDA 2J7ZA 3T1YL 3CD6A 4A3EH 3P1HA 1HQRD 2LKVA 3I55A 1L1OC 4J8QA 1HJPA 4XXEA 4JV5Q 4K5XA 5JEAJ 1FGBD 3EN2A 1PV4A 3GTKB 5KYLA 4TKOB 3V2TA 3I4NB 1EFID 2OXPA 1N9WA 3CQZH 5KIXA 1A0IA 3Q6SA 4OX9L 3TQYA 1XNRQ 2B2TC 3OW2A 3S17B 1Y14B 4K0KL 1QUQB 4DR3Q 4O42A 1NUCA 4R4OA 2J0TD 5IGBA 3D4WA 1K8GA 3S14H 1YITA 3DWPA 4KD4A 1LACA 2DY7A 3IAYA 3GTQH 2UXBQ 2EYOA 3MTSA 5CMDA 1I4PA 1M90C 4KV6A 4C3HG 4XTCS 3KJOA 1EYGA 4KHVA 3GV6A 1PZKD 4C3JG 2JEAI 3RZDB 3FKIB 3VR4A 3KBGA 1IBML 2Q2TA 3OHXC 4B08A 5IGCA 1FL0A 2ZXRA 2EJMA 1K3RA 2YU9B 4L6TB 1TR5A 3PUYA 4RGOS 2NVXH 1TKWB 2GVAA 1EYDA 3CMAA 4G57A 3Q23A 2L15A 3G48A 2H1EA 3VYTA 3J81L 2F03A 2RHQB 1S5DD 2TMPA 3EVQA 3PSIA 2A1AA 3HOZB 3KF8B 3H0GG 2YTVA 1PHJA 3TS0A 2IX3A 4BBRG 3A55A 2QEXA 3F8TA 1I94Q 1BUVT 1YNXA 3TDQA 4A3BH 1L0YB 4P75A 1OXXK 1LTLA 5FO8B 1LO5D 1IL8A 1TWCH 2HD3A 4FVMA 3GTLH 4ZRZA 1H9KA 1YJNA 1QE6A 4QB4A 3C2PA 3KF6B 1YEZA 1ILPA 1PH3A 3M3YH 4NMZA 3GTKH 4ILWA 3J81i 1STAA 3KBXA 1LTAD 2PI2A 3BVZA 3RMHA 3MHBA 2VQFL 2WV6D 5M5YB 2RQXA 4KY7A 4OELB 4BWGB 5C3EB 1KNEA 2RKSA 3CHBD 4QUCA 3VYUA 2NVYH 4JG2A 2Q2UA 4OWWB 3PUXA 2L55A 4N8FA 1SMYD 4JI2L 4DK0A 3OSOA 3QO2A 1C9OA 2F0SA 5D3IB 4OGQC 3GTMH 1CFMA 4YWLA 3MFYA 1PTOF 3AFQA 3EBEA 3PO3G 2DNCA 4BY7B 4N8X1 1A3UA 1MSGA 1JOQA 1HNZQ 3HOZG 2HIVA 3PUZA 2F1MA 4PMCA 2FMCA 4KLKA 3HOYH 4DK6C 5KRUA 4LF8Q 1KLUD 2K33A 1BO0A 4C2MB 5J1ZA 4KTAA 4DR2Q 1IZ6A 2R93H 1D5MC 2GN5A 4X3SA 4DAPA 1DOLA 2RSNA 3HOUB 2XGTA 1KAWA 3DUZA 1TS2A 4KY6A 1MIUA 1EY0A 5A35A 3CP0A 4LF7L 3R8BA 1SJHD 2FHTA 5M3MH 2UUAL 3E6ZX 4DV2Q 1SMYC 3ULLA 5C3EH 1MD2D 3RN5A 3FHWA 4OL7A 1EWHA 4BBRB 1HNXL 2VQEL 5IYBG 2PNRC 1IW7D 3O13A 2CW0C 3KK7A 5KYIA 2HDLA 3I4MG 3F1ZA 5C44G 1CKNB 1TY2A 5EQ0A 5BN4A 1EEID 4TRDA 3L2PA 2AKWB 1F77A 4N9TA 3GTGB 1HPCA 3IL8A 2LFNA 3M4PA 1CKNA 1W6KA 1BNZA 3SDZA 4KJOA 1PA6A 3NPPA 3CC4A 1ENAA 2F0GA 4JPBW 4ODGA 5C5LA 1C4QA 4LFAQ 1AP0A 3HS0C 1JB3A 4MTKA 1KL9A 3FPPA 1VQEA 3J7AV 4B3ML 2RVLA 1PTOB 2YTYA 3D0FA 1JCKB 1SYBA 2OQ0A 1BCPD 2R7FA 4HMJA 4A3JH 3HOVB 1S5ED 3K80C 5DAUA 1A63A 3CXCA 1VQ5A 3A8KE 3NTKA 2NVQB 1EUJA 1LUZA 3OYYA 2L4NA 1X55A 3HRZC 4DPGA 1PXUA 3J80E 1S5BD 1VQPA 1IBKQ 1XPUA 3BZKA 4ABNA 2WKDA 3GTQB 4LJZC 1WD0A 3QR8A 1DOMA 1AE3A 3J80c 1H9JA 2Y0SE 3HOWH 4LFCQ 2B2YA 3WDNA 3OIQA 2ZJQA 4PZ8A 3FPUB 3G6JB 2E8GA 1FNUA 3KOJA 1EOVA 1Z6HA 4OO1H 2PZUA 3U58A 4C1NK 5BN3A 2Z6KA 1TWGB 1K8AC 5GADC 1PH5A 4C3IH 4A75A 5DM73 1IBLQ 4IUTA 4IPHA 2XN9C 4BS9A 1MSHA 1UE7A 3NEMA 3NHHA 1LTBD 1XXGA 3QOLA 2NTSA 2OCEA 4Q0FA 2WFWA 1F2MA 2BDOA 2WAQG 4GNXB 3BYTB 4DR7Q 4WJWA 3HG9A 1GHKA 4K2LA 3CC7A 4IUUA 4QQBX 3TS2A 3VYRA 1MI2A 3HKSA 3TREA 1SBBB 4LAAA 4KKTA 2WIIB 4DF7A 2YU9H 4JOIC 5BR8L 2IT1A 3SK8A 3C46A 2EDGA 5L37A 5M3FB 1XYIA 4GN5A 1L1OB 5DEHA 1TY0A 2KQ3A 2O5IC 2E74C 2K28A 1IHZA 3K5OA 3A5ZB 4IUVA 5IY0A 1L1OA 4RHRA 2VQFQ 4Q5VA 1YNNC 2BA1A 2PNHA 5IOCA 4ZLTF 3T13A 3E3XA 1WYDA 4X3TA 1EY8A 3T1HL 1D7QA 3CCVA 1T5EA 1PYSB 1WTXA 4JV5L 2KCNA 4U673 4MIUA 5EKIA 3PO3H 1VQDA 3U4ZA 1SSOA 1QNKA 4PG3A 1CUKA 4UP7A 1DZ1A 1J6QA 2B2WA 4IURA 3H3VI 4IJLA 4DAVA 4G7ZC 1IL2A 4R1JA 2NWGA 5CV8A 2B29A 3T53B 5AFWA 4J6HA 4MHEA 3ER0A 3NBIA 1EZ8A 4WJ4A 2R7DA 4DR4Q 4ME3A 1SNPA 3ITPA 5C0XG 4RAUC 1M8AA 1SJED 3DWAA 4OXPA 3S1MB 1MKHA 1TWHB 1YNJD 1I3QB 1HHVA 4A93H 5J3BA 2DJFC 1EY6A 3AU7A 5IT9L 1K0SA 4C56C 3W1BA 4RKLA 1KDAA 4A3MG 4KHZA 4YCVA 2XWJB 3LNNA 4DAYB 1B3AA 5IGFA 3PUVA 4GZYC 3A74A 4KD3A 4IOAA 1HNXQ 2DGYA 3OWEB 1JJGA 3J7A5 2NUCA 5KGUA 3K57A 1VQ8A 3J81j 2M2LA 1PZJD 5FLXc 4HJ9A 4R4CA 2FFKB 1I4QA 2K1BA 1CKOA 2K04A 1JOKA 3HKZE 5CC4A 5K5PA 3I4NG 1KXLA 2NYZD 2Q8TA 1GUWA 2I5LX 3ONAB 4A3GB 1CHQD 2QILA 2O5JC 4YCWA 4DN4M 2HCCA 4DNRB 3HOXB 1Q81C 4YWKA 1EY9A 1Q12A 1QG7A 1BCPF 2PZTA 5C5MA 1SLJA 2XVSA 4YHHL 3UDIA 4Y52H 2BH2A 4A3JG 3WWVA 1E2VA 1ICFB 3S2HB 2Z6BA 3E9HA 1RCVD 2NZOA 4DK1A 3S24A 2M9VA 1SEBD 2J4XA 1HZBA 1I4HA 4O2DA 5EJWA 5LMNL 1LT4D 1N8RC 4JI8Q 4AIMA 2B2UC 3QB3A 4BXXG 2MP1A 2L11A 1A2TA 3DWQA 5IYCG 1K73C 4GKKL 3L7ZC 3R2TA 3MEFA 1PRTC 2M00A 4JI3Q 4OO1I 5DLQE 1VQ4A 1L0WA 3MXUA 2A6ED 3S1RB 1TVXA 3UI2A 1RD9D 3T1HQ 4LFCL 1NNXA 3UDFA 4APVA 4RGTA 1OXVA 4FNFA 4NB3A 5GAEC 2JA8H 4DV4Q 4F7XA 4RKBA 2K5VA 2Z8LA 1HH2P 3FEWX 4HJ5A 2CQOA 1Y8PB 2VUMH 1E7ZA 4A3CG 4F88A 1QVCA 5M5WH 4XIGS 1K8OA 2A69D 1PH1A 3CCSA 1CSPA 4N9PA 5FKAC 4L8JA 3OOCA 3DHQA 4YCUA 5C4JH 1ENCA 2WB1B 3VDYA 4LF7Q 1U4MA 1R9TH 3NBHA 1WI5A 3I90A 2LMCB 4K5WA 4FXDA 2JK8A 2E2JB 4A3FH 3TBIB 2XSCA 3BZDB 3K6OA 4JBMA 1Z7TA 1HQMC 1MJCA 3HZXA 1SYDA 2QDLA 4HR7B 2EYLA 1VQMA 3VR6A 3H6MA 4RH6A 3M7NA 2F0JA 3PGZA 3CRKC 3S2DB 2AQ2B 1STGA 4OIJA 1AEXA 4K8JA 1TXYA 5EBCA 3KDFB 5D65A 3A5UA 2QA4A 3PO2G 1VF7A 1PH7A 4OEMB 1EQQA 3CCRA 1XNQQ 3KDFA 2K03A 1YNJC 4QIWB 1Y1VH 1ZXTA 4H13C 1XTCD 3SEBA 2BH8A 2WACA 5HGTA 5JAVA 3PIP3 1BBUA 5LMUQ 3D4RA 4JC0A 1F9RA 5IT9c 5C4HA 4BBSH 1BR9A 4FF4A 4HJAA 3A54A 1K83B 1XWEA 2HQEA 1ONLA 2B63H 1RJTA 3D3RA 1WTOA 4CHTB 1EY7A 4H02A 4GOPB 1YIJA 2K32A 1K8MA 1SFOB 5AJ3Q 4DV0L 1O7LA 3PMFA 2ID0A 4QMGA 4GOPA 2ZJPA 4RMFA 4Y7NH 1H9SA 5E1FA 3I8ZA 1BDOA 1TWAB 5IGGA 2F0UA 1AN8A 2Z9HA 1I4GA 2EQSA 3MXNA 4JI3L 1IXRA 1EOTA 3H09A 4ID6A 5JEAG 2F52A 2NBFA 4X66Q 5I6WA 2JJQA 4A3LH 3CF5A 1II3A 5D14A 3CCJA 5T1GA 2F3VA 2R92B 4C3JH 1EYCA 2WINB 4PZ7A 4DV4L 1LM0A 5EKLA 3P7JA 1HRJA 2B8FA 2E2JH 1ESRA 1ENFA 1ICWA 1Q86C 2ES2A 3U9SA 2ZTEA 3U50C 4A3DB 2KOLA 3MC0B 5F2DA 2ZM6L 4R8NA 5C4JB 1ET6A 3M9BA 1J9OA 1TQOA 4X3KA 5CBEE 4B3SQ 1X54A 2KA7A 2KCCA 1B53A 2EYPA 4EQOA 3PO2B 3PV0A 1Q1EA 1RHPA 5D3DA 3S1NB 3CCUA 2K4KA 2B2UA 5IODA 1NR2A 1S4ZA 1CM9A 2CCZA 3PIO3 2PO4A 1WFQA 1IBKL 1SE4A 3PUWA 4AQYL 1IYJB 2RSOA 3OMGA 1ET9A 2CWPA 4A3BG 4DXFA 2DJGC 4RGNA 5KEEA 1D6EC 5ELOA 3H3VH 4B3TL 2QW7A 3NELA 4QUFA 2ENBA 4PZ6A 4LNQA 3FP9A 1VQIA 3TSSA 1SYCA 5JOBA 2HHHQ 3EQLC 3PO2H 3ERQA 1E1TA 1LYLA 4X62L 1N32L 3PIPA 4CKCA 1VQJA 3Q8DA 4OX9Q 4GKJL 2Y0SB 2VNUD 4P74A 3GQBA 3LX0A 4ZYSA 3SXHA 1Y1VB 4MTNA 3I91A 5I2YA 2UUCQ 4HCSA 1HUMA 1VDZA 1GO3E 3S16H 1IW7C 1D2BA 1O7YA 2Z1CA 1D1IA 3WOEA 4DAMA 1LLRD 1AFPA 1EU3A 3K0YA 5C4XH 1N36Q 4E6IA 1QCBD 2K05A 1EQRA 3J7YW 4BY7H 4CDDC 2B2VA 4KHPL 2EY1A 2GVBA 1U9RA 1WTVA 1NAPA 4IUPA 3R93A 5IIFA 3PIOA 3KUPA 3ULPA 1VMCA 4CJ2C 1SROA 2K75A 3RUZA 3PF5A 2F3WA 3KLRA 3QJYA 3A7AB 3E9IA 3T16A 5CGKA 4AYBB 2B3GA 2UXDL 4DU9A 1V1QA 5IYDG 3LWUA 4DV5Q 3DLLA 1B2TA 4IFDJ 2PMZB 1WCMH 1EIHA 1J8IA 3CCEA 4IFDH 1QUQA 5C44B 1KABA 2RDGA 3SHLA 1IYVA 1B9NA 1RF2D 2ZT9C 4BBSB 1U0LA 3M4OB 4UP9A 3W3AA 1XNQL 2UU9L 4LFBQ 1SR3A 3MWYW 1HCZA 1Y1VG 2I46A 4A3BB 2V1CC 3NENA 5EKKA 2EY5A 1Z9FA 1IKLA 4HSPA 2R7ZB 2NN6I 1P8LA 2MGSA 5M3MG 1SFOH 1NY4A 4YHHQ 3Q0AA 3A56A 3S9WA 1I94L 4JI4Q 1QWYA 3CU7A 5C3WA 4DV7L 5IYBH 2L5TA 1UWVA 1SN8A 1FGUA 1XNRL 1V9PA 3AQQA 3JAME 4JI2Q 2BCOA 4K6DA 2F0HA 5M5XB 1CQVA 1SE3A 1GUSA 1PH6A 5CR3A 1MGSA 3RZDH 1HA6A 2AMCB 1HFNA 3KF8A 4JI5L 4CKBA 1E3PA 2HT1A 1QVFA 1F9QA 4A3DG 2KEDA 2N49A 3IFTA 1FNVA 1ILQA 4M1UB 1JE4A 2BE5C 2I5MX 4PQXA 3AFPA 5EBDA 4NP5A 4UDUC 3SK4A 2ALYB 1W3SA 5H1SE 2AUJD 3EIVA 1CKMA 1AE2A 2KVMA 3RR5A 3IRBA 3K5NA 4OONA 1N33Q 4UAIA 4RG1A 2UUCL 3B6YA 2UUAQ 3AMUA 4KN4C 2IPKD 2B2YC 5M9OA 1R9TB 1IKMA 5EAYA 1LTTD 5IP7G 1OO9B 1TWFB 2F0QA 4K6LA 1CT1D 4DR2L 5I2XA 2CH4W 4JYAQ 2E5LL 3SVMA 1UUPA 1VQAA 3OPOA 4JI6Q 1I4XA 4C3IB 4TQUS 3T56B 4NKLA 2D9UA 4NPSA 4GKKQ 3G4SA 1OXSC 1EEFD 1EY5A 3RNUA 1GM5A 2N78A 3N6RA 1O80A 3H91A 1KLGD 1VQNA 2B2TA 3HOWB 5FK9C 5JVG3 4WJ3M 1PRTB 4X6AH 1PH9A 2N3SA 2AWNA 4NXMQ 2CVRA 1JICA 3OTOQ 4PNYA 2CFMA 1R4PB 1A62A 1BVSA 3BU2A 4JI0L 3JAMc 4HMIA 4A3GH 1I50H 1Y1WH 1WOCA 5CORA 4XYQA 2VS1A 1SXTA 1B7YB 1GUTA 4DR1Q 1I5FA 3HOUH 4MN3A 4A4IA 2D2CC 2R93B 5I4DA 2F0WA 4GKJQ 3QIAA 2MUYA 2I5HA 2E2HB 2SOBA 3K0XA 1VQFA 4CJ0B 3S15B 1LV9A 1KD1C 1Z47A 4DR5L
chains in the Genus database with same CATH topology
2PI2E 4L5SA 2JA5H 1HZ9A 1SLJA 3L0OA 4LF8L 2Z6KC 4YHHL 3KLWA 5HY6A 3UDIA 4JI1Q 4Y52H 2BH2A 4A3JG 1HNWL 3WWVA 4GS3A 2ZM6Q 5GQOA 5C0XI 3CAMA 2K5NA 4IO9A 2NVTH 3E9HA 2NZOA 3KFUA 4LF4Q 3K7AH 3GO5A 5FJ8H 3S24A 4B3SL 3ZJYC 1HZBA 1FVIA 4QGUA 4A3EG 1X56A 3KJPA 4R4QA 4O2DA 4IOCA 1ASYA 4DV5L 1X3EA 2E2HH 5LMNL 4JI6L 4BY7G 1XMQQ 5M3FH 1N8RC 4JI8Q 1DGSA 4GLAC 4AIMA 1XPOA 1K0RA 2UUBL 3I7FA 1TWAH 4KI0A 4BXXG 2ZTDA 5IYCG 1K73C 4GKKL 3L7ZC 4DV1L 1X3GA 3MEFA 4HIDA 4DV2L 4JI3Q 4OO1I 5DLQE 4LUZA 4AYBG 1VQ4A 2EXDA 1TWFH 1L0WA 3H15A 3T1YL 2UU9Q 4A3EH 1FJGQ 3CD6A 3J81c 4GLXA 3I55A 3T1HQ 4LFCL 3ULJA 1NBWA 3UDFA 4APVA 3TRZA 5GAEC 1L1OC 1OXVA 4NB3A 2JA8H 3GTJH 4DV4Q 1HJPA 4DV6Q 3ERSX 4DR7L 4JV5Q 4A3MH 5JEAJ 4P71A 4P72A 4BBRH 2K5VA 3EN2A 3I56A 2IX0A 1PV4A 2AHOB 4DUYQ 1HH2P 3U4VA 3JAMi 2HHHL 1X6OA 4HJ5A 4JBJA 4A3CH 2CQOA 1N9WA 3CQZH 1E7ZA 2VUMH 4A3CG 1A0IA 2UXCL 3G6EA 1QVCA 5M5WH 2VL6A 4XIGS 4OX9L 3TQYA 1PH1A 2NZHA 1XNRQ 4LFBL 3CCSA 5IWAL 4DV3Q 3OW2A 1CSPA 1N33L 1Y14B 4K0KL 1QUQB 4DR3Q 5M3FG 2JA8G 3J7ZC 4YCUA 1M1KC 4L5RC 4R4OA 5C4JH 4C2MH 3I2ZA 4LWCA 3VDYA 1K8GA 4LF7Q 4X64L 1R9TH 1YITA 3S14H 3M85A 4IFDI 1WI5A 4JI1L 4HJ7A 2IY5B 2WB1G 3UDXA 2JA7H 2WP8J 2JK8A 5AJ3L 4DV0Q 4A3FH 3GTQH 2UXBQ 4A3FG 1YJ9A 1M90C 4JBMA 4XTCS 1MJCA 3KJOA 3UE1A 1EYGA 2R92H 2JEAI 3HOYG 2NN6G 1HZCA 1VQMA 1IBML 2Q2TA 3M7NA 1QZHA 4JI7L 3PGZA 2YTXA 2F4VL 5JJIA 4GN4B 3FKIH 1FL0A 1TXYA 3KDFB 5M5XH 1K3RA 1W2BA 2A8VA 4TVAB 3A5UA 4FDBA 2QA4A 1HR0Q 3PO2G 1SRUA 2VUMG 1PH7A 1X9NA 3I4NH 1N32Q 3PUYA 4GNXA 1VQBA 2GVAA 1EQQA 2NVXH 3CCRA 5C0XJ 2PMZE 3CMAA 3KDFA 1XNQQ 1BBWA 4EQ5A 2UXDQ 2L15A 3G48A 4QIWE 1N34Q 1Y1VH 2RHQB 3I4MH 3PSIA 2A1AA 3RLFA 3KF8B 3H0GG 2YTVA 1PHJA 2BH8A 3TS0A 4BBRG 3J80i 4AYBE 1BBUA 1G291 5LMUQ 4B3RQ 3GDEA 2QEXA 3F8TA 1I94Q 1YNXA 4JC0A 4A3BH 2WAQE 4BBSG 3CC2A 5IT9c 1ASZA 2Q2IA 4P75A 4BBSH 1OXXK 4LF6L 1LTLA 1N36L 4HJAA 1IBLL 5C44H 4UPAA 2H5XA 1EIYB 1TWCH 2KENA 4POGA 3GTLH 2FXQA 1YJNA 2ZTCA 1XMOL 1TWGH 2B63H 1U5KA 4X65L 4LF5Q 3KF6B 1YEZA 4BXXH 1PH3A 3M3YH 4GN3B 2KBNA 3GTKH 4H02A 4GOPB 3J81i 1YIJA 2PI2A 5FLMH 4HIMA 3K7UC 5C3EG 5AJ3Q 4DV0L 2Y0SG 1B70B 2VQFL 1HNWQ 4AQYQ 1HZAA 2ID0A 5FJ8G 2EIFA 4LF4L 1YZ6A 4GOPA 3F2DA 2ZJPA 2NVYH 4RMFA 2XTIA 4JG2A 3W1GA 2Q2UA 1PFSA 3CCQA 5BR8Q 4Y7NH 4PMWA 1IBMQ 1J5EQ 3K81C 1XMQL 2OTLA 1NTGA 4OWWB 3PUXA 5K36G 3M4OH 1A8VA 4JI2L 2UUBQ 1C9OA 1D8LA 2JE6I 1OTCA 3UDGA 3GTMH 4GLVB 4YWLA 2E2IH 4AH6A 3HOXG 2EQSA 4JI3L 5JEAG 1IXRA 3AFQA 4DR1L 3CCLA 2R7ZG 2F52A 3EBEA 3I4MG 4X62Q 4X66Q 4JCVE 3PO3G 3T1YQ 1SE8A 2JJQA 4A3LH 3HOWG 3CF5A 2ATWA 1NMFA 4DR6Q 2R93G 1L2FA 4JI5Q 3CCJA 3RLOA 1HNZQ 1XJVA 3S2HH 3HOZG 2HIVA 4C3JH 3PUZA 4PZ7A 4DV4L 4YWMA 4LW1A 1LM0A 1UE1A 1XTDA 4KLKA 3HOYH 4DK6C 4NXML 4QY7A 2OTJA 4LFAL 2E2JH 4LF8Q 4MNOA 1Q86C 1EIFA 1NE3A 2ES2A 4JI0Q 1KRSA 2ZTEA 3U50C 4DR4L 3HOXH 2VY3A 2ZM6L 3CPFA 1G6PA 4A3GG 3M9BA 1KC8C 4DR2Q 1IZ6A 1QZGA 3HOUG 4POFA 4MZ9A 1C7YA 4B3SQ 1X54A 1NJIC 3S17H 4A3IG 2R93H 2GN5A 2XGTA 1KAWA 3PV0A 1Q1EA 5LMNQ 1RL2A 3CCUA 4JI8L 5HGQA 1JJCB 2NVQH 2K4KA 3RLNA 2B63G 1MIUA 4A3KH 4GNXC 4BY1G 4DR5Q 3CP0A 3HOVH 4LF7L 2CCZA 2IHFA 3S1MH 5M3MH 2UUAL 4JOIA 1WFQA 1IBKL 2Q2HA 2PQAA 3ULLA 4DV2Q 1Y1WG 3PUWA 5C3EH 1IYJB 4AQYL 1S72A 3RN5A 1JT8A 3FHWA 2UXBL 1HNXL 2VQEL 2CKZB 2CWPA 2N8NA 5IYBG 4A3BG 4HJ8A 4L5TA 2DUDA 2JQOA 3H3VH 5ELOA 4B3TL 1XPRA 1P16A 3F1ZA 1GD7A 5C44G 4HIKA 2MO1A 1X65A 4QJFA 3NELA 1CKNB 1QVGA 2E5LQ 3STBC 1KIXA 4IPCA 4PZ6A 4YY3L 4LNQA 3FP9A 1VQIA 1WCMG 1S3OA 4BY1H 3PF4A 3L2PA 5FLMG 2AKWB 2HHHQ 3PO2H 1E1TA 3M4PA 1CKNA 2MNAA 1LYLA 4X66L 4X62L 2UXCQ 1YI2A 1N32L 3PIPA 1WJJA 2D0OA 1VQJA 1PA6A 3Q8DA 1AH9A 4OX9Q 4GKJL 3CC4A 4R4IA 1HNZL 3A0JA 3CW2C 4A3IH 1FJGL 3JC66 3RZOH 4DR3L 1B8AA 2VNUD 3HOZH 3AYHB 4P74A 1E22A 3ICEA 4MTNA 4LFAQ 2UUCQ 5GAGC 1KL9A 4IPDA 1J5EL 1VQEA 4LUOA 1GO3E 4GOPC 4B3ML 3D0FA 2YTYA 3S16H 4B3RL 2ASBA 1GVPA 2OQ0A 2JA7G 1K9MC 1JJ2A 2R7FA 4A3JH 4DAMA 3CPWA 3K80C 4JI4L 4LF6Q 5C4XH 3CCMA 4UY8C 1A63A 1N36Q 2HIXA 3CXCA 4UP8A 1VQ5A 4A3LG 5C4XG 2K52A 4DV7Q 1EQRA 1EUJA 4BY7H 1LUZA 2CWAA 3OYYA 1PH8A 1MJEA 4JYAL 2MQHA 4KHPL 2GVBA 1X55A 4BA1I 4NXNL 5IP9H 2QGQA 2ZJRA 2JA6H 4DPGA 2KHJA 1EWIA 5IYDH 5LMNW 3PIOA 1OXTA 1YVCA 1VQPA 1IBKQ 1XPUA 3BZKA 2VW9A 3ULPA 4DV1Q 3GTPH 1SROA 2K75A 1PVOA 1JMCA 3PF5A 2MFIA 4DUZL 4OWTB 3E9IA 3M4QA 3LGJA 1AE3A 1Q46A 2B3GA 4J15A 2UXDL 3J80c 1EFWA 1V1QA 2Y0SE 3HOWH 1S40A 3NBHB 4LFCQ 2BA0A 2RF4A 1PH2A 1Q1BA 5IYDG 5M5YH 4PZ8A 2ZJQA 4YY3Q 1VQCA 2E8GA 4DV5Q 1E24A 3HKZG 4JBKA 3DLLA 3KOJA 1EOVA 4HIOA 2KCTA 1JB7A 4JI7Q 4IFDJ 1WCMH 4IPGA 5LMUL 3U58A 4OWXB 2Z6KA 3F2BA 3CCEA 1Q82C 1K8AC 3SGIA 5GADC 1PH5A 1QUQA 4ALPA 4C3IH 4A75A 2RHSB 1U0LA 2R6GA 1IBLQ 4UP9A 2IHEA 2JEBI 4IPHA 3AEVA 3NEMA 1UE7A 2Z0SA 1XNQL 2UU9L 2YV5A 1SR3A 2C35B 1YHBA 4LFBQ 4JBWA 1TWHH 1Y1VG 2OCEA 2V1CC 3NENA 1PH4A 2I0QA 1Z9FA 2WFWA 1VQ7A 4OO1G 2WAQG 3BJUA 4GNXB 1RIPA 4DR7Q 2NN6I 1P8LA 3HFZB 1YHAA 5M3MG 1JE5A 3CC7A 1SFOH 1NY4A 4LF9Q 3TS2A 4YHHQ 4QQBX 1I94L 4JI4Q 3HKSA 5GROA 3TREA 1CSQA 5JJKA 2VZAA 3F2CA 4DKAC 1KQSA 1HR0W 4DV7L 2K50A 1VQGA 1KRTA 5IYBH 2YU9H 1UWVA 2WB1E 1SN8A 1FGUA 4JOIC 5BR8L 2IT1A 1H95A 1XNRL 1K83H 1V9PA 3AQQA 4GN5A 1L1OB 1V43A 3S2DH 4JI2Q 4K0KQ 3FKIG 4X65Q 4LF5L 3PCOB 3RN2A 1PH6A 4IJHA 1T9HA 3E0EA 4DNIA 3KYHC 3A5ZB 5IY0A 4DUZQ 1L1OA 2VQFQ 3RZDH 3GD7A 2AMCB 2BA1A 2PNHA 3KF6A 4JI5L 1WYDA 1E3PA 1VQLA 2HT1A 1QVFA 2AWOA 4A3DG 2N49A 1NMGA 3T1HL 1D7QA 4L5QA 3CCVA 2JA6G 4DK3C 1PYSB 2I5MX 4DV6L 2IX1A 4JV5L 3AFPA 1SMXA 4LUVA 3OTOL 2ALYB 1W3SA 5H1SE 3EIVA 3PO3H 1CKMA 1KHIA 1AE2A 1VQDA 3U4ZA 4PG3A 1CUKA 4UP7A 1J6QA 3DM3A 3RR5A 2JA9A 3IRBA 2R92G 1UE6A 3H3VI 1UE5A 4OONA 1X3FA 4IJLA 1IL2A 4R4TA 1I6HH 1N33Q 4RG1A 4A93G 1G51A 4R1JA 2UUCL 2B29A 3B6YA 2KHIA 2UUAQ 2OQKA 4LF9L 3ER0A 4B3MQ 1VQHA 1GKHA 4X64Q 2A19A 2RCNA 4WJ4A 2R7DA 2YYZA 4DR4Q 4ME3A 5EAYA 5GAHC 2K14A 5IP7G 2VQEQ 5C0XG 3S1RH 1C0AA 3G71A 2R7ZH 1YJWA 3I4OA 4DR2L 4OXPA 3UE0A 4B3TQ 1MKHA 4JYAQ 1VS0A 2E5LL 1UEBA 4A93H 5J3BA 3MXNB 4NXNQ 1O7IA 1VQAA 4JI6Q 5E7NA 5IE8A 3W1BA 1Q8KA 3GTGH 1I3QH 4A3MG 4KHZA 3HOVG 4YCVA 1E1OA 4TQUS 5IYCH 2F4VQ 5JJLA 4DAYB 1OXUA 2OWOA 4NPSA 5IP7H 4GKKQ 3PUVA 3A74A 3K8AA 3BZCA 3G4SA 1HR0L 1OXSC 4IFDG 3STBD 4IOAA 3RNUA 2LXKA 1GM5A 2N78A 1HNXQ 4P73A 2D62A 2DGYA 1YHQA 1Q7YC 1VCIA 1JJGA 4DR6L 3J7A5 1VQ8A 2MO0A 1VQNA 4C3HH 1VQ6A 3J81j 4WJ3M 1VQOA 4QL5A 5FLXc 4HJ9A 1N34L 4R4CA 4A3KG 1PH9A 4X6AH 3W5OA 2D0PA 2N3SA 2AWNA 1VQ9A 3CMEA 4NXMQ 3S15H 3OTOQ 2CFMA 2JA5G 1BVSA 1A62A 3BU2A 1CKOA 4JI0L 3S1NH 4O0AA 3JAMc 1BKBA 2F3IA 4DUYL 4A3GH 1I50H 1Y1WH 1WOCA 3HKZE 3I4NG 4BA2I 2VS1A 1KXLA 3TEHB 1B7YB 4A76A 4DR1Q 1I5FA 3HOUH 4A4IA 2I5LX 3GTOH 4KHPQ 4GKJQ 1VQKA 2I5HA 3S1QH 2PQAB 2KCMA 4EX5A 1YBYA 3D31A 1PYBA 2LSSA 3K0XA 4YCWA 2K5HA 5ELNA 2LXJA 1VQFA 3H0GH 5IWAQ 4DV3L 4A3DH 5IP9G 1XMOQ 1KD1C 1Q81C 1Z47A 2HQLA 4YWKA 4DR5L 1Q12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PI2 E;  4L5S A;  2JA5 H;  1HZ9 A;  1SLJ A;  3L0O A;  4LF8 L;  2Z6K C;  4YHH L;  3KLW A;  5HY6 A;  3UDI A;  4JI1 Q;  4Y52 H;  2BH2 A;  4A3J G;  1HNW L;  3WWV A;  4GS3 A;  2ZM6 Q;  5GQO A;  5C0X I;  3CAM A;  2K5N A;  4IO9 A;  2NVT H;  3E9H A;  2NZO A;  3KFU A;  4LF4 Q;  3K7A H;  3GO5 A;  5FJ8 H;  3S24 A;  4B3S L;  3ZJY C;  1HZB A;  1FVI A;  4QGU A;  4A3E G;  1X56 A;  3KJP A;  4R4Q A;  4O2D A;  4IOC A;  1ASY A;  4DV5 L;  1X3E A;  2E2H H;  5LMN L;  4JI6 L;  4BY7 G;  1XMQ Q;  5M3F H;  1N8R C;  4JI8 Q;  1DGS A;  4GLA C;  4AIM A;  1XPO A;  1K0R A;  2UUB L;  3I7F A;  1TWA H;  4KI0 A;  4BXX G;  2ZTD A;  5IYC G;  1K73 C;  4GKK L;  3L7Z C;  4DV1 L;  1X3G A;  3MEF A;  4HID A;  4DV2 L;  4JI3 Q;  4OO1 I;  5DLQ E;  4LUZ A;  4AYB G;  1VQ4 A;  2EXD A;  1TWF H;  1L0W A;  3H15 A;  3T1Y L;  2UU9 Q;  4A3E H;  1FJG Q;  3CD6 A;  3J81 c;  4GLX A;  3I55 A;  3T1H Q;  4LFC L;  3ULJ A;  1NBW A;  3UDF A;  4APV A;  3TRZ A;  5GAE C;  1L1O C;  1OXV A;  4NB3 A;  2JA8 H;  3GTJ H;  4DV4 Q;  1HJP A;  4DV6 Q;  3ERS X;  4DR7 L;  4JV5 Q;  4A3M H;  5JEA J;  4P71 A;  4P72 A;  4BBR H;  2K5V A;  3EN2 A;  3I56 A;  2IX0 A;  1PV4 A;  2AHO B;  4DUY Q;  1HH2 P;  3U4V A;  3JAM i;  2HHH L;  1X6O A;  4HJ5 A;  4JBJ A;  4A3C H;  2CQO A;  1N9W A;  3CQZ H;  1E7Z A;  2VUM H;  4A3C G;  1A0I A;  2UXC L;  3G6E A;  1QVC A;  5M5W H;  2VL6 A;  4XIG S;  4OX9 L;  3TQY A;  1PH1 A;  2NZH A;  1XNR Q;  4LFB L;  3CCS A;  5IWA L;  4DV3 Q;  3OW2 A;  1CSP A;  1N33 L;  1Y14 B;  4K0K L;  1QUQ B;  4DR3 Q;  5M3F G;  2JA8 G;  3J7Z C;  4YCU A;  1M1K C;  4L5R C;  4R4O A;  5C4J H;  4C2M H;  3I2Z A;  4LWC A;  3VDY A;  1K8G A;  4LF7 Q;  4X64 L;  1R9T H;  1YIT A;  3S14 H;  3M85 A;  4IFD I;  1WI5 A;  4JI1 L;  4HJ7 A;  2IY5 B;  2WB1 G;  3UDX A;  2JA7 H;  2WP8 J;  2JK8 A;  5AJ3 L;  4DV0 Q;  4A3F H;  3GTQ H;  2UXB Q;  4A3F G;  1YJ9 A;  1M90 C;  4JBM A;  4XTC S;  1MJC A;  3KJO A;  3UE1 A;  1EYG A;  2R92 H;  2JEA I;  3HOY G;  2NN6 G;  1HZC A;  1VQM A;  1IBM L;  2Q2T A;  3M7N A;  1QZH A;  4JI7 L;  3PGZ A;  2YTX A;  2F4V L;  5JJI A;  4GN4 B;  3FKI H;  1FL0 A;  1TXY A;  3KDF B;  5M5X H;  1K3R A;  1W2B A;  2A8V A;  4TVA B;  3A5U A;  4FDB A;  2QA4 A;  1HR0 Q;  3PO2 G;  1SRU A;  2VUM G;  1PH7 A;  1X9N A;  3I4N H;  1N32 Q;  3PUY A;  4GNX A;  1VQB A;  2GVA A;  1EQQ A;  2NVX H;  3CCR A;  5C0X J;  2PMZ E;  3CMA A;  3KDF A;  1XNQ Q;  1BBW A;  4EQ5 A;  2UXD Q;  2L15 A;  3G48 A;  4QIW E;  1N34 Q;  1Y1V H;  2RHQ B;  3I4M H;  3PSI A;  2A1A A;  3RLF A;  3KF8 B;  3H0G G;  2YTV A;  1PHJ A;  2BH8 A;  3TS0 A;  4BBR G;  3J80 i;  4AYB E;  1BBU A;  1G29 1;  5LMU Q;  4B3R Q;  3GDE A;  2QEX A;  3F8T A;  1I94 Q;  1YNX A;  4JC0 A;  4A3B H;  2WAQ E;  4BBS G;  3CC2 A;  5IT9 c;  1ASZ A;  2Q2I A;  4P75 A;  4BBS H;  1OXX K;  4LF6 L;  1LTL A;  1N36 L;  4HJA A;  1IBL L;  5C44 H;  4UPA A;  2H5X A;  1EIY B;  1TWC H;  2KEN A;  4POG A;  3GTL H;  2FXQ A;  1YJN A;  2ZTC A;  1XMO L;  1TWG H;  2B63 H;  1U5K A;  4X65 L;  4LF5 Q;  3KF6 B;  1YEZ A;  4BXX H;  1PH3 A;  3M3Y H;  4GN3 B;  2KBN A;  3GTK H;  4H02 A;  4GOP B;  3J81 i;  1YIJ A;  2PI2 A;  5FLM H;  4HIM A;  3K7U C;  5C3E G;  5AJ3 Q;  4DV0 L;  2Y0S G;  1B70 B;  2VQF L;  1HNW Q;  4AQY Q;  1HZA A;  2ID0 A;  5FJ8 G;  2EIF A;  4LF4 L;  1YZ6 A;  4GOP A;  3F2D A;  2ZJP A;  2NVY H;  4RMF A;  2XTI A;  4JG2 A;  3W1G A;  2Q2U A;  1PFS A;  3CCQ A;  5BR8 Q;  4Y7N H;  4PMW A;  1IBM Q;  1J5E Q;  3K81 C;  1XMQ L;  2OTL A;  1NTG A;  4OWW B;  3PUX A;  5K36 G;  3M4O H;  1A8V A;  4JI2 L;  2UUB Q;  1C9O A;  1D8L A;  2JE6 I;  1OTC A;  3UDG A;  3GTM H;  4GLV B;  4YWL A;  2E2I H;  4AH6 A;  3HOX G;  2EQS A;  4JI3 L;  5JEA G;  1IXR A;  3AFQ A;  4DR1 L;  3CCL A;  2R7Z G;  2F52 A;  3EBE A;  3I4M G;  4X62 Q;  4X66 Q;  4JCV E;  3PO3 G;  3T1Y Q;  1SE8 A;  2JJQ A;  4A3L H;  3HOW G;  3CF5 A;  2ATW A;  1NMF A;  4DR6 Q;  2R93 G;  1L2F A;  4JI5 Q;  3CCJ A;  3RLO A;  1HNZ Q;  1XJV A;  3S2H H;  3HOZ G;  2HIV A;  4C3J H;  3PUZ A;  4PZ7 A;  4DV4 L;  4YWM A;  4LW1 A;  1LM0 A;  1UE1 A;  1XTD A;  4KLK A;  3HOY H;  4DK6 C;  4NXM L;  4QY7 A;  2OTJ A;  4LFA L;  2E2J H;  4LF8 Q;  4MNO A;  1Q86 C;  1EIF A;  1NE3 A;  2ES2 A;  4JI0 Q;  1KRS A;  2ZTE A;  3U50 C;  4DR4 L;  3HOX H;  2VY3 A;  2ZM6 L;  3CPF A;  1G6P A;  4A3G G;  3M9B A;  1KC8 C;  4DR2 Q;  1IZ6 A;  1QZG A;  3HOU G;  4POF A;  4MZ9 A;  1C7Y A;  4B3S Q;  1X54 A;  1NJI C;  3S17 H;  4A3I G;  2R93 H;  2GN5 A;  2XGT A;  1KAW A;  3PV0 A;  1Q1E A;  5LMN Q;  1RL2 A;  3CCU A;  4JI8 L;  5HGQ A;  1JJC B;  2NVQ H;  2K4K A;  3RLN A;  2B63 G;  1MIU A;  4A3K H;  4GNX C;  4BY1 G;  4DR5 Q;  3CP0 A;  3HOV H;  4LF7 L;  2CCZ A;  2IHF A;  3S1M H;  5M3M H;  2UUA L;  4JOI A;  1WFQ A;  1IBK L;  2Q2H A;  2PQA A;  3ULL A;  4DV2 Q;  1Y1W G;  3PUW A;  5C3E H;  1IYJ B;  4AQY L;  1S72 A;  3RN5 A;  1JT8 A;  3FHW A;  2UXB L;  1HNX L;  2VQE L;  2CKZ B;  2CWP A;  2N8N A;  5IYB G;  4A3B G;  4HJ8 A;  4L5T A;  2DUD A;  2JQO A;  3H3V H;  5ELO A;  4B3T L;  1XPR A;  1P16 A;  3F1Z A;  1GD7 A;  5C44 G;  4HIK A;  2MO1 A;  1X65 A;  4QJF A;  3NEL A;  1CKN B;  1QVG A;  2E5L Q;  3STB C;  1KIX A;  4IPC A;  4PZ6 A;  4YY3 L;  4LNQ A;  3FP9 A;  1VQI A;  1WCM G;  1S3O A;  4BY1 H;  3PF4 A;  3L2P A;  5FLM G;  2AKW B;  2HHH Q;  3PO2 H;  1E1T A;  3M4P A;  1CKN A;  2MNA A;  1LYL A;  4X66 L;  4X62 L;  2UXC Q;  1YI2 A;  1N32 L;  3PIP A;  1WJJ A;  2D0O A;  1VQJ A;  1PA6 A;  3Q8D A;  1AH9 A;  4OX9 Q;  4GKJ L;  3CC4 A;  4R4I A;  1HNZ L;  3A0J A;  3CW2 C;  4A3I H;  1FJG L;  3JC6 6;  3RZO H;  4DR3 L;  1B8A A;  2VNU D;  3HOZ H;  3AYH B;  4P74 A;  1E22 A;  3ICE A;  4MTN A;  4LFA Q;  2UUC Q;  5GAG C;  1KL9 A;  4IPD A;  1J5E L;  1VQE A;  4LUO A;  1GO3 E;  4GOP C;  4B3M L;  3D0F A;  2YTY A;  3S16 H;  4B3R L;  2ASB A;  1GVP A;  2OQ0 A;  2JA7 G;  1K9M C;  1JJ2 A;  2R7F A;  4A3J H;  4DAM A;  3CPW A;  3K80 C;  4JI4 L;  4LF6 Q;  5C4X H;  3CCM A;  4UY8 C;  1A63 A;  1N36 Q;  2HIX A;  3CXC A;  4UP8 A;  1VQ5 A;  4A3L G;  5C4X G;  2K52 A;  4DV7 Q;  1EQR A;  1EUJ A;  4BY7 H;  1LUZ A;  2CWA A;  3OYY A;  1PH8 A;  1MJE A;  4JYA L;  2MQH A;  4KHP L;  2GVB A;  1X55 A;  4BA1 I;  4NXN L;  5IP9 H;  2QGQ A;  2ZJR A;  2JA6 H;  4DPG A;  2KHJ A;  1EWI A;  5IYD H;  5LMN W;  3PIO A;  1OXT A;  1YVC A;  1VQP A;  1IBK Q;  1XPU A;  3BZK A;  2VW9 A;  3ULP A;  4DV1 Q;  3GTP H;  1SRO A;  2K75 A;  1PVO A;  1JMC A;  3PF5 A;  2MFI A;  4DUZ L;  4OWT B;  3E9I A;  3M4Q A;  3LGJ A;  1AE3 A;  1Q46 A;  2B3G A;  4J15 A;  2UXD L;  3J80 c;  1EFW A;  1V1Q A;  2Y0S E;  3HOW H;  1S40 A;  3NBH B;  4LFC Q;  2BA0 A;  2RF4 A;  1PH2 A;  1Q1B A;  5IYD G;  5M5Y H;  4PZ8 A;  2ZJQ A;  4YY3 Q;  1VQC A;  2E8G A;  4DV5 Q;  1E24 A;  3HKZ G;  4JBK A;  3DLL A;  3KOJ A;  1EOV A;  4HIO A;  2KCT A;  1JB7 A;  4JI7 Q;  4IFD J;  1WCM H;  4IPG A;  5LMU L;  3U58 A;  4OWX B;  2Z6K A;  3F2B A;  3CCE A;  1Q82 C;  1K8A C;  3SGI A;  5GAD C;  1PH5 A;  1QUQ A;  4ALP A;  4C3I H;  4A75 A;  2RHS B;  1U0L A;  2R6G A;  1IBL Q;  4UP9 A;  2IHE A;  2JEB I;  4IPH A;  3AEV A;  3NEM A;  1UE7 A;  2Z0S A;  1XNQ L;  2UU9 L;  2YV5 A;  1SR3 A;  2C35 B;  1YHB A;  4LFB Q;  4JBW A;  1TWH H;  1Y1V G;  2OCE A;  2V1C C;  3NEN A;  1PH4 A;  2I0Q A;  1Z9F A;  2WFW A;  1VQ7 A;  4OO1 G;  2WAQ G;  3BJU A;  4GNX B;  1RIP A;  4DR7 Q;  2NN6 I;  1P8L A;  3HFZ B;  1YHA A;  5M3M G;  1JE5 A;  3CC7 A;  1SFO H;  1NY4 A;  4LF9 Q;  3TS2 A;  4YHH Q;  4QQB X;  1I94 L;  4JI4 Q;  3HKS A;  5GRO A;  3TRE A;  1CSQ A;  5JJK A;  2VZA A;  3F2C A;  4DKA C;  1KQS A;  1HR0 W;  4DV7 L;  2K50 A;  1VQG A;  1KRT A;  5IYB H;  2YU9 H;  1UWV A;  2WB1 E;  1SN8 A;  1FGU A;  4JOI C;  5BR8 L;  2IT1 A;  1H95 A;  1XNR L;  1K83 H;  1V9P A;  3AQQ A;  4GN5 A;  1L1O B;  1V43 A;  3S2D H;  4JI2 Q;  4K0K Q;  3FKI G;  4X65 Q;  4LF5 L;  3PCO B;  3RN2 A;  1PH6 A;  4IJH A;  1T9H A;  3E0E A;  4DNI A;  3KYH C;  3A5Z B;  5IY0 A;  4DUZ Q;  1L1O A;  2VQF Q;  3RZD H;  3GD7 A;  2AMC B;  2BA1 A;  2PNH A;  3KF6 A;  4JI5 L;  1WYD A;  1E3P A;  1VQL A;  2HT1 A;  1QVF A;  2AWO A;  4A3D G;  2N49 A;  1NMG A;  3T1H L;  1D7Q A;  4L5Q A;  3CCV A;  2JA6 G;  4DK3 C;  1PYS B;  2I5M X;  4DV6 L;  2IX1 A;  4JV5 L;  3AFP A;  1SMX A;  4LUV A;  3OTO L;  2ALY B;  1W3S A;  5H1S E;  3EIV A;  3PO3 H;  1CKM A;  1KHI A;  1AE2 A;  1VQD A;  3U4Z A;  4PG3 A;  1CUK A;  4UP7 A;  1J6Q A;  3DM3 A;  3RR5 A;  2JA9 A;  3IRB A;  2R92 G;  1UE6 A;  3H3V I;  1UE5 A;  4OON A;  1X3F A;  4IJL A;  1IL2 A;  4R4T A;  1I6H H;  1N33 Q;  4RG1 A;  4A93 G;  1G51 A;  4R1J A;  2UUC L;  2B29 A;  3B6Y A;  2KHI A;  2UUA Q;  2OQK A;  4LF9 L;  3ER0 A;  4B3M Q;  1VQH A;  1GKH A;  4X64 Q;  2A19 A;  2RCN A;  4WJ4 A;  2R7D A;  2YYZ A;  4DR4 Q;  4ME3 A;  5EAY A;  5GAH C;  2K14 A;  5IP7 G;  2VQE Q;  5C0X G;  3S1R H;  1C0A A;  3G71 A;  2R7Z H;  1YJW A;  3I4O A;  4DR2 L;  4OXP A;  3UE0 A;  4B3T Q;  1MKH A;  4JYA Q;  1VS0 A;  2E5L L;  1UEB A;  4A93 H;  5J3B A;  3MXN B;  4NXN Q;  1O7I A;  1VQA A;  4JI6 Q;  5E7N A;  5IE8 A;  3W1B A;  1Q8K A;  3GTG H;  1I3Q H;  4A3M G;  4KHZ A;  3HOV G;  4YCV A;  1E1O A;  4TQU S;  5IYC H;  2F4V Q;  5JJL A;  4DAY B;  1OXU A;  2OWO A;  4NPS A;  5IP7 H;  4GKK Q;  3PUV A;  3A74 A;  3K8A A;  3BZC A;  3G4S A;  1HR0 L;  1OXS C;  4IFD G;  3STB D;  4IOA A;  3RNU A;  2LXK A;  1GM5 A;  2N78 A;  1HNX Q;  4P73 A;  2D62 A;  2DGY A;  1YHQ A;  1Q7Y C;  1VCI A;  1JJG A;  4DR6 L;  3J7A 5;  1VQ8 A;  2MO0 A;  1VQN A;  4C3H H;  1VQ6 A;  3J81 j;  4WJ3 M;  1VQO A;  4QL5 A;  5FLX c;  4HJ9 A;  1N34 L;  4R4C A;  4A3K G;  1PH9 A;  4X6A H;  3W5O A;  2D0P A;  2N3S A;  2AWN A;  1VQ9 A;  3CME A;  4NXM Q;  3S15 H;  3OTO Q;  2CFM A;  2JA5 G;  1BVS A;  1A62 A;  3BU2 A;  1CKO A;  4JI0 L;  3S1N H;  4O0A A;  3JAM c;  1BKB A;  2F3I A;  4DUY L;  4A3G H;  1I50 H;  1Y1W H;  1WOC A;  3HKZ E;  3I4N G;  4BA2 I;  2VS1 A;  1KXL A;  3TEH B;  1B7Y B;  4A76 A;  4DR1 Q;  1I5F A;  3HOU H;  4A4I A;  2I5L X;  3GTO H;  4KHP Q;  4GKJ Q;  1VQK A;  2I5H A;  3S1Q H;  2PQA B;  2KCM A;  4EX5 A;  1YBY A;  3D31 A;  1PYB A;  2LSS A;  3K0X A;  4YCW A;  2K5H A;  5ELN A;  2LXJ A;  1VQF A;  3H0G H;  5IWA Q;  4DV3 L;  4A3D H;  5IP9 G;  1XMO Q;  1KD1 C;  1Q81 C;  1Z47 A;  2HQL A;  4YWK A;  4DR5 L;  1Q12 A; 
#chains in the Genus database with same CATH topology
 4ULL A;  2Z4I A;  2FIN B;  1SNM A;  4L5S A;  1X32 A;  4LF8 L;  2Z6K C;  3E5S A;  3HOY B;  1DON A;  2A68 D;  2L1B A;  5ELF A;  1HNW L;  4I7A A;  4GS3 A;  4IO9 A;  3KFU A;  3K7A H;  5FJ8 H;  1LTG D;  3ZJY C;  4RGM A;  1FVI A;  4A3E G;  1ASY A;  2O2L D;  1STY A;  3TN2 A;  4K8I A;  4BY7 G;  5M3F H;  1SYF A;  3A7L A;  4ZKC B;  3J81 E;  1XPO A;  5ELD A;  2ZTD A;  1TT2 A;  4A93 B;  1X3G A;  4HID A;  1RKN A;  2HCI A;  1STB A;  3H15 A;  1FJG Q;  4GLX A;  3BG3 A;  4KY5 A;  4YIJ A;  1NBW A;  3TRZ A;  4ZCK A;  4QF4 A;  1AW7 A;  1NCV A;  2L0C A;  4DV6 Q;  4C1N I;  4A3M H;  4P71 A;  4P72 A;  3T51 B;  3W2D A;  4BBR H;  2IX0 A;  2QF7 A;  2AHO B;  4JBJ A;  1F2Y A;  1STE A;  2UXC L;  1HUN A;  3TZD A;  2NB0 A;  1F9P A;  3HP3 A;  4JVZ A;  4U68 A;  4HCE A;  2NZH A;  4LFB L;  2VB2 X;  5J22 A;  5IWA L;  2PCF B;  1A3T A;  4FF3 A;  1N33 L;  2QCP X;  4B9W A;  2JA8 G;  3J7Z C;  1SNO A;  1M1K C;  4L5R C;  4HN7 A;  4C2M H;  1EL0 A;  4LWC A;  1Y8O B;  2F4I A;  4JI1 L;  4HJ7 A;  2IY5 B;  2A6E C;  2WB1 G;  2JA7 H;  2WP8 J;  1RTO A;  5AJ3 L;  4DV0 Q;  1YJ9 A;  3S14 B;  2A74 C;  1PMR A;  1F9S A;  1LT5 D;  3UE1 A;  4K5V A;  2BOS A;  2NVX B;  2NN6 G;  1HZC A;  4NDX A;  1QZH A;  4JI7 L;  3TP5 A;  3IFD A;  1BQQ T;  4KMU C;  1SNQ A;  2F4V L;  5JJI A;  1ZYR D;  1DOK A;  2X6L A;  5M5X H;  1W2B A;  4TVA B;  4FDB A;  3V05 A;  2VUM G;  3I4N H;  1N32 Q;  4GNX A;  1VQB A;  2BE5 D;  1SDF A;  1PFN A;  1YNN D;  1TII D;  4A3M B;  4IUN A;  4G4K A;  1N34 Q;  2GA4 B;  2F0F A;  5IT9 E;  4RWS C;  4FXK C;  3G7L A;  4TSS A;  1G6Z A;  4A3E B;  3J80 i;  1G29 1;  1TS5 A;  4XDX A;  4F87 A;  1SAP A;  2I07 B;  2EY2 A;  2WAQ E;  4XYO A;  3QG1 A;  1N36 L;  4UPA A;  1X3Q A;  4XT1 B;  3R3O A;  2FXQ A;  1TS3 A;  2ZTC A;  1XMO L;  5DNF A;  2CHB D;  4LF5 Q;  4BXX H;  5G3L D;  4GN3 B;  5JPM C;  3GTJ B;  5FLM H;  3K5M A;  3K7U C;  1LAB A;  5C3E G;  3MAQ A;  2Y0S G;  1HNW Q;  1GOZ A;  3D4D A;  5FJ8 G;  1Y8N B;  3F2D A;  1CA6 A;  2XTI A;  1ML0 D;  3TP8 A;  3W1G A;  2KJX A;  5I9P A;  4H0L C;  4J1M A;  5BR8 Q;  4PMW A;  3S1Q B;  1V1P A;  2UUB Q;  1OTC A;  3UDG A;  2E2I H;  4AH6 A;  3HOX G;  1EYA A;  1A6X A;  2B8G A;  1NMF A;  1CQF A;  1L2F A;  1E2W A;  1K28 A;  1PTO H;  1XJV A;  3F2U A;  3JAM L;  4LW1 A;  3URY A;  2P5Z X;  2MJ8 A;  3NUC A;  4QY7 A;  4LFA L;  2OTJ A;  1O7Z A;  1NE3 A;  4H44 C;  1FNW A;  2VY3 A;  3CPF A;  1G6P A;  4A3G G;  1KC8 C;  3HOU G;  1QZG A;  2JA6 B;  4POF A;  4MZ9 A;  1G91 A;  3N52 A;  5EGT A;  1NJI C;  4RHS A;  3S17 H;  4A3I G;  4OHJ A;  1PTO C;  5NUC A;  5LMN Q;  2JN4 A;  2NVQ H;  2RA4 A;  1I50 B;  1QIL A;  4A3K H;  2NZ1 D;  4GNX C;  1JOO A;  3DEP A;  3IKJ A;  4I65 A;  5TSS A;  4BY1 G;  3HOV H;  2IHF A;  1GUO A;  3X3N A;  2JP1 A;  2PQA A;  2Q2H A;  1Y1W G;  1S72 A;  5E4W C;  4P2C B;  4ZKB B;  2N8N A;  2X69 A;  4HJ8 A;  4L5T A;  2B2V C;  4FP5 D;  3P20 A;  2F0N A;  1GD7 A;  1SND A;  5E4X A;  2MO1 A;  1XPR A;  1QVG A;  1J5E L;  1PRT F;  4FF2 A;  3STB C;  2EYH A;  4IPC A;  4A3K B;  2DY8 A;  5ELE A;  3PF4 A;  1Q90 A;  3NTI A;  2SEB D;  1G2S A;  5EPL A;  1WJJ A;  1RTN A;  3OW7 A;  3BS1 A;  4R4I A;  1HNZ L;  3CW2 C;  2QEJ C;  3I72 A;  3EFX D;  4DR3 L;  2NN6 H;  3HOZ H;  3AYH B;  3K58 A;  1E22 A;  3E0J A;  1C48 A;  1AZP A;  5GAG C;  4IPD A;  2CW0 D;  4GOP C;  4B3R L;  1WTH A;  2ASB A;  2E2D C;  1GVP A;  3DEO A;  4DXG A;  4LMQ D;  5C6A A;  3SK5 A;  5M3M B;  1JJ2 A;  2G9D A;  4LF6 Q;  2IJ0 A;  3CCM A;  2EOT A;  4A3L G;  2HIX A;  4O1N A;  4UP8 A;  2K52 A;  4H7B A;  4DV7 Q;  4JYA L;  2MQH A;  4BA1 I;  4XQQ A;  5IP9 H;  2ZJR A;  2Q8I B;  2CQA A;  5LHY 1;  2JA6 H;  2KHJ A;  2V4D A;  5LMN W;  1OXT A;  1Y1W B;  1HFG A;  2VW9 A;  2F0D A;  4ZK9 B;  3GTP H;  1QB5 D;  1PVO A;  4PMB A;  3SK6 A;  1KDB A;  3OWF A;  2MFI A;  1HA5 A;  4OWT B;  4G7H C;  3M4Q A;  3LGJ A;  3QWN A;  4XQJ A;  4J15 A;  2N55 A;  1DYQ A;  2F0L A;  2EYJ A;  1PH2 A;  4JW0 A;  4YY3 Q;  4KJN A;  3HKZ G;  4JBK A;  4HIO A;  1Q3L A;  4IPG A;  1JWU D;  4KKU A;  5FO7 B;  5HUR A;  3F2B A;  1Q82 C;  2B63 B;  3GTM B;  3CQZ B;  2PYK A;  3DXJ C;  1KAA A;  4ALP A;  2R6G A;  2IHE A;  3AEV A;  1KNA A;  1YHB A;  3J80 L;  4EQP A;  1PH4 A;  1JQY D;  3EJI A;  1VQ7 A;  4OO1 G;  3BJU A;  1RIP A;  3VR2 A;  3D8G A;  3LWE A;  1YHA A;  2C5C A;  3NSW A;  4IUQ A;  5GRO A;  5IGD A;  4EQN A;  5JJK A;  2VZA A;  3K5L A;  3M3Y B;  4DKA C;  1WD1 A;  1KQS A;  1F2L A;  1VQG A;  4HTH A;  3GTL B;  1CZG A;  1V43 A;  4DFA A;  4K0K Q;  3FKI G;  1BOS A;  4LF5 L;  3PCO B;  4L63 B;  1D1K A;  4FXG C;  2F0K A;  1SYG A;  4IJH A;  3RD4 A;  3KYH C;  3ND8 A;  4DUZ Q;  3AB9 A;  3KF6 A;  2JA5 B;  2JA7 B;  4WOR A;  5CV7 A;  4V19 0;  2AWO A;  1PFB A;  1NMG A;  3BDC A;  2RCF A;  2IX1 A;  4DV6 L;  1GHJ A;  4A3I B;  1V1O A;  4ZAI A;  1SMX A;  1U4R A;  4LUV A;  3OTO L;  1EQV A;  5A2Q L;  3H3V C;  2F0O A;  1GJX A;  1KHI A;  1MHW C;  1UEA B;  5M5W B;  3HEJ A;  2R92 G;  1UE6 A;  5C3X A;  1R4Q B;  1UE5 A;  1I6H H;  2IL8 A;  4A93 G;  1G51 A;  2O4X A;  5JPN C;  3FDT A;  1H9R A;  2OQK A;  4PV1 C;  4LF9 L;  1MBY A;  3HGB A;  2A19 A;  2RCN A;  4X64 Q;  2YYZ A;  2VQE Q;  1C0A A;  3G71 A;  2R7Z H;  3VYS A;  1YJW A;  3I4O A;  3T4A C;  3UE0 A;  1VS0 A;  1UEB A;  5CV4 A;  3MXN B;  3ZYY X;  5LL6 X;  3QOJ A;  5E7N A;  5IE8 A;  4S3S A;  1Q8K A;  3HOV G;  1E1O A;  5IYC H;  2F4V Q;  1STN A;  2ZXO A;  3J7A F;  1A3V A;  2SDF A;  2OT2 A;  2NTT A;  3TP6 A;  3K8A A;  4IFD G;  1NR4 A;  3STB D;  3A8J E;  2LXK A;  2NVT B;  1BXT A;  2KEC A;  2KUM A;  4DR6 L;  4C3H H;  1VQO A;  1N34 L;  4A3K G;  4FF1 A;  2D0P A;  1VQ9 A;  3CME A;  1B9M A;  3S15 H;  3NQI A;  1K3B C;  2JA5 G;  2AQ1 B;  1Y69 U;  1D5X C;  1WVL A;  1EWC A;  1BBX C;  1QJO A;  3GTO H;  3TZU A;  1B1Z A;  4CDE C;  1VQK A;  5JVH 3;  2KCM A;  1PYB A;  3D31 A;  2K5H A;  2ZXP A;  5ELN A;  1HTL D;  5IWA Q;  3H0G H;  4A3D H;  1XMO Q;  3MVV A;  2HQL A;  2PI2 E;  1WTQ A;  2Z4H A;  1ZEQ X;  1WTP A;  1SNC A;  3KLW A;  5HY6 A;  2AUK A;  3Q24 A;  2SNS A;  3SR1 A;  2ZM6 Q;  5GQO A;  5C0X I;  2K5N A;  4LF4 Q;  1EU4 A;  4B3S L;  4CBV A;  1C8C A;  1HTP A;  4QGU A;  2E2I B;  3KJP A;  4IOC A;  2E2H H;  4K14 A;  1X3E A;  2IW3 A;  5K36 H;  1XMQ Q;  2XNA C;  2UUB L;  3I7F A;  1TWA H;  3KLS A;  3SE0 A;  4KKS A;  4CDF C;  2JYO A;  4B9X A;  4DV2 L;  1B44 D;  3TME A;  5E3F A;  4IAL A;  4AYB G;  1VF5 C;  1TWF H;  3FMC A;  2UU9 Q;  5I9O A;  3J81 c;  1O78 A;  1U4L A;  3ULJ A;  4EGV A;  2L12 A;  3GTJ H;  3ERS X;  4DR7 L;  4DNT B;  2A68 C;  1EY4 A;  4RFB A;  3I56 A;  4DUY Q;  3U4V A;  3JAM i;  2HHH L;  1X6O A;  2EXZ A;  3FVQ A;  1JC7 A;  2CH4 A;  4IN3 A;  4A3C H;  3G6E A;  2VL6 A;  1A2U A;  5T1I A;  1WCM B;  2L9H A;  2K01 A;  5C4Z A;  4DV3 Q;  4CDC C;  1TU2 B;  5M3F G;  5IGE A;  4RCO A;  3VR3 A;  5JJZ A;  2PW5 A;  3I2Z A;  2EY6 A;  3WOF A;  4X64 L;  4IFD I;  5FLX E;  2F0I A;  3M85 A;  1PYW D;  3UDX A;  3VR5 A;  1ESF A;  2SNM A;  4A3F G;  5KNC A;  2K5D A;  2R92 H;  1EZ6 A;  3HOY G;  2F0V A;  3MFG A;  1IYU A;  3BVG A;  1X3P A;  3MZ5 A;  2E76 C;  2YTX A;  4GN4 B;  3FKI H;  2A69 C;  5C4X B;  2A8V A;  4HAE A;  5JEA H;  1HR0 Q;  1SRU A;  1X9N A;  3I70 A;  2KEE A;  5C0X J;  2MHV A;  2PMZ E;  1BBW A;  4EQ5 A;  2UXD Q;  4QIW E;  3I4M H;  3BDL A;  2JSO A;  3RLF A;  1V8Q A;  5A2Q E;  4AYB E;  4G7O C;  1JOR A;  4B3R Q;  1LT6 D;  3GDE A;  3PQI A;  4BBS G;  3M7G A;  3CC2 A;  1ASZ A;  2Q2I A;  4DA2 A;  4LF6 L;  1IBL L;  1EIY B;  5C44 H;  1I4R A;  2H5X A;  4POG A;  2BDN A;  2KEN A;  2WKC A;  1CZW A;  1S5F D;  3BVM A;  5KND A;  1U4P A;  1CK1 A;  1TWG H;  4V0B A;  1U5K A;  4X65 L;  2E75 C;  2KBN A;  4RA8 A;  1CA5 A;  2FMM A;  4HIM A;  5ELB A;  1B70 B;  4AQY Q;  1HZA A;  3NTH A;  2EIF A;  4LF4 L;  1YZ6 A;  2K5W A;  2F0M A;  1L0X B;  4FYD A;  1B3Q A;  1PFS A;  3CCQ A;  2OTL A;  1IBM Q;  1J5E Q;  3K81 C;  1XMQ L;  1NTG A;  1QNU A;  5K36 G;  3M4O H;  1A8V A;  1D8L A;  2XIW A;  1CI3 M;  1W6J A;  2JE6 I;  1T5X D;  1GUN A;  4X3U A;  2N88 A;  4GLV B;  3CCL A;  4DR1 L;  2R7Z G;  1H95 A;  2A6H C;  2K7V A;  3CRL C;  4JCV E;  4X62 Q;  1I6V C;  3T1Y Q;  1SE8 A;  3HOW G;  2ATW A;  4DR6 Q;  2R93 G;  4JI5 Q;  4DAY A;  3RLO A;  3S16 B;  3A8I E;  3S2H H;  1LTS D;  4YWM A;  1UE1 A;  1XTD A;  4C3H B;  4ZQ3 A;  1PZI D;  4NXM L;  1F2Z A;  4MNO A;  4JI0 Q;  1EIF A;  3C1F A;  2F0P A;  1KRS A;  4DR4 L;  3HOX H;  1ZKO A;  3VA5 A;  1FD7 D;  1BCP B;  2RDF A;  1CTM A;  2MPM A;  4EVO A;  1C7Y A;  1RL2 A;  1XX8 A;  4JI8 L;  5HGQ A;  1JJC B;  3RLN A;  2B63 G;  1NSN S;  4DR5 Q;  3S1M H;  2R61 A;  4JOI A;  3MA2 B;  1TS4 A;  1CHP D;  2VB3 X;  3V96 A;  4DGZ A;  1JT8 A;  2Q8R E;  2UXB L;  2CKZ B;  2JA8 B;  1GXD C;  3FRP B;  1GUG A;  2DUD A;  2JQO A;  3BDO A;  1P16 A;  1S5C D;  4HIK A;  1X65 A;  4QJF A;  2E5L Q;  3RZO B;  1B4O A;  1KIX A;  2A5H A;  4YY3 L;  4HSV A;  4WFN 3;  1WCM G;  1S3O A;  1BF4 A;  4BY1 H;  3HKZ B;  5FLM G;  3PO3 B;  2MNA A;  1JWM D;  4X66 L;  5G3L F;  2UXC Q;  1YI2 A;  3GV3 A;  1DD2 A;  2WAQ B;  2D0O A;  1BCP C;  1AH9 A;  3NXW A;  1HXY D;  3A0J A;  4A3I H;  1FJG L;  3JC6 6;  3RZO H;  1PFM A;  4CGY B;  1E2Z A;  1B8A A;  1EIG A;  3ICE A;  4Z9C B;  4LUO A;  3I4L A;  5CBA E;  1DJR D;  2JA7 G;  1K9M C;  2EJG C;  3KLS X;  4C3I G;  3DMU A;  3CPW A;  4JI4 L;  4UY8 C;  5C4X G;  3OMC A;  1G8Z D;  2CWA A;  1PH8 A;  1MJE A;  4NXN L;  1RDP D;  2QGQ A;  1QOH A;  3NWS A;  1EWI A;  3L9A X;  4IQZ A;  5IYD H;  1PRT D;  1YVC A;  4Y7N B;  4DV1 Q;  4WRD A;  1JMC A;  4R9W A;  3VA7 A;  4A3F B;  2VXW A;  1ROD A;  4DUZ L;  2NVY B;  1FYC A;  1Q46 A;  1VMP A;  1EFW A;  1S40 A;  3NBH B;  2BA0 A;  2RF4 A;  5ELC A;  1Q1B A;  5M5Y H;  2QDB A;  1VQC A;  1E24 A;  4JI7 Q;  1JB7 A;  2KCT A;  4ME5 A;  2RBM A;  4R8I A;  5LMU L;  1D5Z C;  4RCN A;  4OWX B;  4KK7 A;  2B2W C;  3SGI A;  5COY A;  5DM6 3;  2VUM B;  3I73 A;  1SYE A;  3X3M A;  2RHS B;  5C0X H;  2JEB I;  3I3C A;  1AZQ A;  2Z0S A;  2YV5 A;  2C35 B;  3D6W A;  4JBW A;  1TWH H;  2I0Q A;  2EYF A;  2FJ2 A;  2ICE C;  3I4M B;  1DCZ A;  1UNS A;  4XQN A;  2LS0 1;  3HFZ B;  4LF9 Q;  1JE5 A;  1LTR D;  5FO9 B;  5LL6 S;  4M8A A;  1CSQ A;  4UHV A;  2A6H D;  3F2C A;  1WTW A;  3MXG A;  1HR0 W;  2K50 A;  1KRT A;  2R3Z A;  1I6H B;  2WB1 E;  2EJF C;  2EPB A;  2G9H D;  2K5Q A;  3H94 A;  3R2I A;  2K6A A;  2DN8 A;  2EYM A;  1K83 H;  3S2D H;  1B50 A;  3D6C A;  3C3L A;  2PZW A;  2OF1 A;  2LY7 A;  1WTR A;  4X65 Q;  1PDQ A;  1SE2 A;  3RN2 A;  5ISR A;  1T9H A;  3E0E A;  3U9O A;  4DNI A;  2B39 A;  3GD7 A;  4FO2 A;  3NWT A;  1E0B A;  4JK1 C;  1H9M A;  1STH A;  1VQL A;  5BN5 A;  2EZV A;  4L5Q A;  5CV5 A;  2JA6 G;  3L3O C;  4DK3 C;  1DM0 B;  2G5D A;  2IWH A;  1FR3 A;  4K2K A;  2QKI C;  3GTO B;  1DXM A;  5EPK A;  1H9S B;  2X6G A;  1M4V A;  2AQ3 B;  3DM3 A;  2JA9 A;  4I7Z C;  1X3F A;  5KNB A;  4R4T A;  4A3J B;  2KHI A;  3NP8 A;  2ICI A;  4B3M Q;  1VQH A;  1GKH A;  2JXM B;  4F8M A;  2DNE A;  3ND9 A;  2XWB B;  2D5D A;  2KHS A;  5GAH C;  3S1R H;  2K14 A;  1V1P B;  2PW7 A;  3M4Y A;  4B3T Q;  4NXN Q;  1O7I A;  4BY1 B;  1PTO D;  4HED A;  2PPB C;  3GTG H;  4XT3 B;  1I3Q H;  2EVB A;  5JJL A;  1ZYR C;  2C9O A;  1OXU A;  2OWO A;  4QCL A;  4CKE A;  2PQE A;  5IP7 H;  3NE5 B;  1LT3 D;  3BZC A;  1HR0 L;  1JR0 D;  2HUG A;  4P73 A;  2D62 A;  4IZ8 A;  1KTK A;  2OEO A;  3DM1 A;  1YHQ A;  1VCI A;  3K7A B;  1Q7Y C;  2MO0 A;  4NW2 A;  1VQ6 A;  1PLF A;  4CJ1 B;  4QL5 A;  2EE1 A;  4ZUJ A;  3W5O A;  3NK9 A;  4KN7 C;  3GTP B;  2H4O A;  3S1N H;  4O0A A;  1BKB A;  2F3I A;  4DUY L;  4BA2 I;  3P75 A;  1A15 A;  3TEH B;  4A76 A;  1EQT A;  1KDC A;  2A73 B;  3C1E A;  5CV6 A;  4KHP Q;  4OIK A;  5EPJ A;  3S1Q H;  2PQA B;  5CV9 A;  4EX5 A;  1YBY A;  2LSS A;  3TP7 A;  5CYU A;  1G2T A;  2LXJ A;  4DV3 L;  5IP9 G;  3BYY B;  3GP7 A;  2RDH A;  4C3J B;  2JA5 H;  1HZ9 A;  3ERO A;  3L0O A;  2F0E A;  3EA6 A;  3K59 A;  4LK1 C;  5I6Y A;  4JI1 Q;  3Q22 A;  2NVT H;  5FOB B;  3CAM A;  3OIP A;  3NQT A;  1Q8I A;  3GO5 A;  3H0G B;  2HDM A;  1LTI D;  2XRS D;  1X56 A;  4R4Q A;  4JI6 L;  4DV5 L;  5J39 A;  3CKI B;  4ZUI A;  1DGS A;  4GLA C;  1TWC B;  1K0R A;  4KI0 A;  4DV1 L;  2TSS A;  5FLX L;  1UAP A;  3MEH A;  3MXP A;  2F0T A;  1JWS D;  4LUZ A;  2XRQ D;  2EXD A;  2J7Z A;  3T1Y L;  3CD6 A;  4A3E H;  3P1H A;  1HQR D;  2LKV A;  3I55 A;  1L1O C;  4J8Q A;  1HJP A;  4XXE A;  4JV5 Q;  4K5X A;  5JEA J;  1FGB D;  3EN2 A;  1PV4 A;  3GTK B;  5KYL A;  4TKO B;  3V2T A;  3I4N B;  1EFI D;  2OXP A;  1N9W A;  3CQZ H;  5KIX A;  1A0I A;  3Q6S A;  4OX9 L;  3TQY A;  1XNR Q;  2B2T C;  3OW2 A;  3S17 B;  1Y14 B;  4K0K L;  1QUQ B;  4DR3 Q;  4O42 A;  1NUC A;  4R4O A;  2J0T D;  5IGB A;  3D4W A;  1K8G A;  3S14 H;  1YIT A;  3DWP A;  4KD4 A;  1LAC A;  2DY7 A;  3IAY A;  3GTQ H;  2UXB Q;  2EYO A;  3MTS A;  5CMD A;  1I4P A;  1M90 C;  4KV6 A;  4C3H G;  4XTC S;  3KJO A;  1EYG A;  4KHV A;  3GV6 A;  1PZK D;  4C3J G;  2JEA I;  3RZD B;  3FKI B;  3VR4 A;  3KBG A;  1IBM L;  2Q2T A;  3OHX C;  4B08 A;  5IGC A;  1FL0 A;  2ZXR A;  2EJM A;  1K3R A;  2YU9 B;  4L6T B;  1TR5 A;  3PUY A;  4RGO S;  2NVX H;  1TKW B;  2GVA A;  1EYD A;  3CMA A;  4G57 A;  3Q23 A;  2L15 A;  3G48 A;  2H1E A;  3VYT A;  3J81 L;  2F03 A;  2RHQ B;  1S5D D;  2TMP A;  3EVQ A;  3PSI A;  2A1A A;  3HOZ B;  3KF8 B;  3H0G G;  2YTV A;  1PHJ A;  3TS0 A;  2IX3 A;  4BBR G;  3A55 A;  2QEX A;  3F8T A;  1I94 Q;  1BUV T;  1YNX A;  3TDQ A;  4A3B H;  1L0Y B;  4P75 A;  1OXX K;  1LTL A;  5FO8 B;  1LO5 D;  1IL8 A;  1TWC H;  2HD3 A;  4FVM A;  3GTL H;  4ZRZ A;  1H9K A;  1YJN A;  1QE6 A;  4QB4 A;  3C2P A;  3KF6 B;  1YEZ A;  1ILP A;  1PH3 A;  3M3Y H;  4NMZ A;  3GTK H;  4ILW A;  3J81 i;  1STA A;  3KBX A;  1LTA D;  2PI2 A;  3BVZ A;  3RMH A;  3MHB A;  2VQF L;  2WV6 D;  5M5Y B;  2RQX A;  4KY7 A;  4OEL B;  4BWG B;  5C3E B;  1KNE A;  2RKS A;  3CHB D;  4QUC A;  3VYU A;  2NVY H;  4JG2 A;  2Q2U A;  4OWW B;  3PUX A;  2L55 A;  4N8F A;  1SMY D;  4JI2 L;  4DK0 A;  3OSO A;  3QO2 A;  1C9O A;  2F0S A;  5D3I B;  4OGQ C;  3GTM H;  1CFM A;  4YWL A;  3MFY A;  1PTO F;  3AFQ A;  3EBE A;  3PO3 G;  2DNC A;  4BY7 B;  4N8X 1;  1A3U A;  1MSG A;  1JOQ A;  1HNZ Q;  3HOZ G;  2HIV A;  3PUZ A;  2F1M A;  4PMC A;  2FMC A;  4KLK A;  3HOY H;  4DK6 C;  5KRU A;  4LF8 Q;  1KLU D;  2K33 A;  1BO0 A;  4C2M B;  5J1Z A;  4KTA A;  4DR2 Q;  1IZ6 A;  2R93 H;  1D5M C;  2GN5 A;  4X3S A;  4DAP A;  1DOL A;  2RSN A;  3HOU B;  2XGT A;  1KAW A;  3DUZ A;  1TS2 A;  4KY6 A;  1MIU A;  1EY0 A;  5A35 A;  3CP0 A;  4LF7 L;  3R8B A;  1SJH D;  2FHT A;  5M3M H;  2UUA L;  3E6Z X;  4DV2 Q;  1SMY C;  3ULL A;  5C3E H;  1MD2 D;  3RN5 A;  3FHW A;  4OL7 A;  1EWH A;  4BBR B;  1HNX L;  2VQE L;  5IYB G;  2PNR C;  1IW7 D;  3O13 A;  2CW0 C;  3KK7 A;  5KYI A;  2HDL A;  3I4M G;  3F1Z A;  5C44 G;  1CKN B;  1TY2 A;  5EQ0 A;  5BN4 A;  1EEI D;  4TRD A;  3L2P A;  2AKW B;  1F77 A;  4N9T A;  3GTG B;  1HPC A;  3IL8 A;  2LFN A;  3M4P A;  1CKN A;  1W6K A;  1BNZ A;  3SDZ A;  4KJO A;  1PA6 A;  3NPP A;  3CC4 A;  1ENA A;  2F0G A;  4JPB W;  4ODG A;  5C5L A;  1C4Q A;  4LFA Q;  1AP0 A;  3HS0 C;  1JB3 A;  4MTK A;  1KL9 A;  3FPP A;  1VQE A;  3J7A V;  4B3M L;  2RVL A;  1PTO B;  2YTY A;  3D0F A;  1JCK B;  1SYB A;  2OQ0 A;  1BCP D;  2R7F A;  4HMJ A;  4A3J H;  3HOV B;  1S5E D;  3K80 C;  5DAU A;  1A63 A;  3CXC A;  1VQ5 A;  3A8K E;  3NTK A;  2NVQ B;  1EUJ A;  1LUZ A;  3OYY A;  2L4N A;  1X55 A;  3HRZ C;  4DPG A;  1PXU A;  3J80 E;  1S5B D;  1VQP A;  1IBK Q;  1XPU A;  3BZK A;  4ABN A;  2WKD A;  3GTQ B;  4LJZ C;  1WD0 A;  3QR8 A;  1DOM A;  1AE3 A;  3J80 c;  1H9J A;  2Y0S E;  3HOW H;  4LFC Q;  2B2Y A;  3WDN A;  3OIQ A;  2ZJQ A;  4PZ8 A;  3FPU B;  3G6J B;  2E8G A;  1FNU A;  3KOJ A;  1EOV A;  1Z6H A;  4OO1 H;  2PZU A;  3U58 A;  4C1N K;  5BN3 A;  2Z6K A;  1TWG B;  1K8A C;  5GAD C;  1PH5 A;  4C3I H;  4A75 A;  5DM7 3;  1IBL Q;  4IUT A;  4IPH A;  2XN9 C;  4BS9 A;  1MSH A;  1UE7 A;  3NEM A;  3NHH A;  1LTB D;  1XXG A;  3QOL A;  2NTS A;  2OCE A;  4Q0F A;  2WFW A;  1F2M A;  2BDO A;  2WAQ G;  4GNX B;  3BYT B;  4DR7 Q;  4WJW A;  3HG9 A;  1GHK A;  4K2L A;  3CC7 A;  4IUU A;  4QQB X;  3TS2 A;  3VYR A;  1MI2 A;  3HKS A;  3TRE A;  1SBB B;  4LAA A;  4KKT A;  2WII B;  4DF7 A;  2YU9 H;  4JOI C;  5BR8 L;  2IT1 A;  3SK8 A;  3C46 A;  2EDG A;  5L37 A;  5M3F B;  1XYI A;  4GN5 A;  1L1O B;  5DEH A;  1TY0 A;  2KQ3 A;  2O5I C;  2E74 C;  2K28 A;  1IHZ A;  3K5O A;  3A5Z B;  4IUV A;  5IY0 A;  1L1O A;  4RHR A;  2VQF Q;  4Q5V A;  1YNN C;  2BA1 A;  2PNH A;  5IOC A;  4ZLT F;  3T13 A;  3E3X A;  1WYD A;  4X3T A;  1EY8 A;  3T1H L;  1D7Q A;  3CCV A;  1T5E A;  1PYS B;  1WTX A;  4JV5 L;  2KCN A;  4U67 3;  4MIU A;  5EKI A;  3PO3 H;  1VQD A;  3U4Z A;  1SSO A;  1QNK A;  4PG3 A;  1CUK A;  4UP7 A;  1DZ1 A;  1J6Q A;  2B2W A;  4IUR A;  3H3V I;  4IJL A;  4DAV A;  4G7Z C;  1IL2 A;  4R1J A;  2NWG A;  5CV8 A;  2B29 A;  3T53 B;  5AFW A;  4J6H A;  4MHE A;  3ER0 A;  3NBI A;  1EZ8 A;  4WJ4 A;  2R7D A;  4DR4 Q;  4ME3 A;  1SNP A;  3ITP A;  5C0X G;  4RAU C;  1M8A A;  1SJE D;  3DWA A;  4OXP A;  3S1M B;  1MKH A;  1TWH B;  1YNJ D;  1I3Q B;  1HHV A;  4A93 H;  5J3B A;  2DJF C;  1EY6 A;  3AU7 A;  5IT9 L;  1K0S A;  4C56 C;  3W1B A;  4RKL A;  1KDA A;  4A3M G;  4KHZ A;  4YCV A;  2XWJ B;  3LNN A;  4DAY B;  1B3A A;  5IGF A;  3PUV A;  4GZY C;  3A74 A;  4KD3 A;  4IOA A;  1HNX Q;  2DGY A;  3OWE B;  1JJG A;  3J7A 5;  2NUC A;  5KGU A;  3K57 A;  1VQ8 A;  3J81 j;  2M2L A;  1PZJ D;  5FLX c;  4HJ9 A;  4R4C A;  2FFK B;  1I4Q A;  2K1B A;  1CKO A;  2K04 A;  1JOK A;  3HKZ E;  5CC4 A;  5K5P A;  3I4N G;  1KXL A;  2NYZ D;  2Q8T A;  1GUW A;  2I5L X;  3ONA B;  4A3G B;  1CHQ D;  2QIL A;  2O5J C;  4YCW A;  4DN4 M;  2HCC A;  4DNR B;  3HOX B;  1Q81 C;  4YWK A;  1EY9 A;  1Q12 A;  1QG7 A;  1BCP F;  2PZT A;  5C5M A;  1SLJ A;  2XVS A;  4YHH L;  3UDI A;  4Y52 H;  2BH2 A;  4A3J G;  3WWV A;  1E2V A;  1ICF B;  3S2H B;  2Z6B A;  3E9H A;  1RCV D;  2NZO A;  4DK1 A;  3S24 A;  2M9V A;  1SEB D;  2J4X A;  1HZB A;  1I4H A;  4O2D A;  5EJW A;  5LMN L;  1LT4 D;  1N8R C;  4JI8 Q;  4AIM A;  2B2U C;  3QB3 A;  4BXX G;  2MP1 A;  2L11 A;  1A2T A;  3DWQ A;  5IYC G;  1K73 C;  4GKK L;  3L7Z C;  3R2T A;  3MEF A;  1PRT C;  2M00 A;  4JI3 Q;  4OO1 I;  5DLQ E;  1VQ4 A;  1L0W A;  3MXU A;  2A6E D;  3S1R B;  1TVX A;  3UI2 A;  1RD9 D;  3T1H Q;  4LFC L;  1NNX A;  3UDF A;  4APV A;  4RGT A;  1OXV A;  4FNF A;  4NB3 A;  5GAE C;  2JA8 H;  4DV4 Q;  4F7X A;  4RKB A;  2K5V A;  2Z8L A;  1HH2 P;  3FEW X;  4HJ5 A;  2CQO A;  1Y8P B;  2VUM H;  1E7Z A;  4A3C G;  4F88 A;  1QVC A;  5M5W H;  4XIG S;  1K8O A;  2A69 D;  1PH1 A;  3CCS A;  1CSP A;  4N9P A;  5FKA C;  4L8J A;  3OOC A;  3DHQ A;  4YCU A;  5C4J H;  1ENC A;  2WB1 B;  3VDY A;  4LF7 Q;  1U4M A;  1R9T H;  3NBH A;  1WI5 A;  3I90 A;  2LMC B;  4K5W A;  4FXD A;  2JK8 A;  2E2J B;  4A3F H;  3TBI B;  2XSC A;  3BZD B;  3K6O A;  4JBM A;  1Z7T A;  1HQM C;  1MJC A;  3HZX A;  1SYD A;  2QDL A;  4HR7 B;  2EYL A;  1VQM A;  3VR6 A;  3H6M A;  4RH6 A;  3M7N A;  2F0J A;  3PGZ A;  3CRK C;  3S2D B;  2AQ2 B;  1STG A;  4OIJ A;  1AEX A;  4K8J A;  1TXY A;  5EBC A;  3KDF B;  5D65 A;  3A5U A;  2QA4 A;  3PO2 G;  1VF7 A;  1PH7 A;  4OEM B;  1EQQ A;  3CCR A;  1XNQ Q;  3KDF A;  2K03 A;  1YNJ C;  4QIW B;  1Y1V H;  1ZXT A;  4H13 C;  1XTC D;  3SEB A;  2BH8 A;  2WAC A;  5HGT A;  5JAV A;  3PIP 3;  1BBU A;  5LMU Q;  3D4R A;  4JC0 A;  1F9R A;  5IT9 c;  5C4H A;  4BBS H;  1BR9 A;  4FF4 A;  4HJA A;  3A54 A;  1K83 B;  1XWE A;  2HQE A;  1ONL A;  2B63 H;  1RJT A;  3D3R A;  1WTO A;  4CHT B;  1EY7 A;  4H02 A;  4GOP B;  1YIJ A;  2K32 A;  1K8M A;  1SFO B;  5AJ3 Q;  4DV0 L;  1O7L A;  3PMF A;  2ID0 A;  4QMG A;  4GOP A;  2ZJP A;  4RMF A;  4Y7N H;  1H9S A;  5E1F A;  3I8Z A;  1BDO A;  1TWA B;  5IGG A;  2F0U A;  1AN8 A;  2Z9H A;  1I4G A;  2EQS A;  3MXN A;  4JI3 L;  1IXR A;  1EOT A;  3H09 A;  4ID6 A;  5JEA G;  2F52 A;  2NBF A;  4X66 Q;  5I6W A;  2JJQ A;  4A3L H;  3CF5 A;  1II3 A;  5D14 A;  3CCJ A;  5T1G A;  2F3V A;  2R92 B;  4C3J H;  1EYC A;  2WIN B;  4PZ7 A;  4DV4 L;  1LM0 A;  5EKL A;  3P7J A;  1HRJ A;  2B8F A;  2E2J H;  1ESR A;  1ENF A;  1ICW A;  1Q86 C;  2ES2 A;  3U9S A;  2ZTE A;  3U50 C;  4A3D B;  2KOL A;  3MC0 B;  5F2D A;  2ZM6 L;  4R8N A;  5C4J B;  1ET6 A;  3M9B A;  1J9O A;  1TQO A;  4X3K A;  5CBE E;  4B3S Q;  1X54 A;  2KA7 A;  2KCC A;  1B53 A;  2EYP A;  4EQO A;  3PO2 B;  3PV0 A;  1Q1E A;  1RHP A;  5D3D A;  3S1N B;  3CCU A;  2K4K A;  2B2U A;  5IOD A;  1NR2 A;  1S4Z A;  1CM9 A;  2CCZ A;  3PIO 3;  2PO4 A;  1WFQ A;  1IBK L;  1SE4 A;  3PUW A;  4AQY L;  1IYJ B;  2RSO A;  3OMG A;  1ET9 A;  2CWP A;  4A3B G;  4DXF A;  2DJG C;  4RGN A;  5KEE A;  1D6E C;  5ELO A;  3H3V H;  4B3T L;  2QW7 A;  3NEL A;  4QUF A;  2ENB A;  4PZ6 A;  4LNQ A;  3FP9 A;  1VQI A;  3TSS A;  1SYC A;  5JOB A;  2HHH Q;  3EQL C;  3PO2 H;  3ERQ A;  1E1T A;  1LYL A;  4X62 L;  1N32 L;  3PIP A;  4CKC A;  1VQJ A;  3Q8D A;  4OX9 Q;  4GKJ L;  2Y0S B;  2VNU D;  4P74 A;  3GQB A;  3LX0 A;  4ZYS A;  3SXH A;  1Y1V B;  4MTN A;  3I91 A;  5I2Y A;  2UUC Q;  4HCS A;  1HUM A;  1VDZ A;  1GO3 E;  3S16 H;  1IW7 C;  1D2B A;  1O7Y A;  2Z1C A;  1D1I A;  3WOE A;  4DAM A;  1LLR D;  1AFP A;  1EU3 A;  3K0Y A;  5C4X H;  1N36 Q;  4E6I A;  1QCB D;  2K05 A;  1EQR A;  3J7Y W;  4BY7 H;  4CDD C;  2B2V A;  4KHP L;  2EY1 A;  2GVB A;  1U9R A;  1WTV A;  1NAP A;  4IUP A;  3R93 A;  5IIF A;  3PIO A;  3KUP A;  3ULP A;  1VMC A;  4CJ2 C;  1SRO A;  2K75 A;  3RUZ A;  3PF5 A;  2F3W A;  3KLR A;  3QJY A;  3A7A B;  3E9I A;  3T16 A;  5CGK A;  4AYB B;  2B3G A;  2UXD L;  4DU9 A;  1V1Q A;  5IYD G;  3LWU A;  4DV5 Q;  3DLL A;  1B2T A;  4IFD J;  2PMZ B;  1WCM H;  1EIH A;  1J8I A;  3CCE A;  4IFD H;  1QUQ A;  5C44 B;  1KAB A;  2RDG A;  3SHL A;  1IYV A;  1B9N A;  1RF2 D;  2ZT9 C;  4BBS B;  1U0L A;  3M4O B;  4UP9 A;  3W3A A;  1XNQ L;  2UU9 L;  4LFB Q;  1SR3 A;  3MWY W;  1HCZ A;  1Y1V G;  2I46 A;  4A3B B;  2V1C C;  3NEN A;  5EKK A;  2EY5 A;  1Z9F A;  1IKL A;  4HSP A;  2R7Z B;  2NN6 I;  1P8L A;  2MGS A;  5M3M G;  1SFO H;  1NY4 A;  4YHH Q;  3Q0A A;  3A56 A;  3S9W A;  1I94 L;  4JI4 Q;  1QWY A;  3CU7 A;  5C3W A;  4DV7 L;  5IYB H;  2L5T A;  1UWV A;  1SN8 A;  1FGU A;  1XNR L;  1V9P A;  3AQQ A;  3JAM E;  4JI2 Q;  2BCO A;  4K6D A;  2F0H A;  5M5X B;  1CQV A;  1SE3 A;  1GUS A;  1PH6 A;  5CR3 A;  1MGS A;  3RZD H;  1HA6 A;  2AMC B;  1HFN A;  3KF8 A;  4JI5 L;  4CKB A;  1E3P A;  2HT1 A;  1QVF A;  1F9Q A;  4A3D G;  2KED A;  2N49 A;  3IFT A;  1FNV A;  1ILQ A;  4M1U B;  1JE4 A;  2BE5 C;  2I5M X;  4PQX A;  3AFP A;  5EBD A;  4NP5 A;  4UDU C;  3SK4 A;  2ALY B;  1W3S A;  5H1S E;  2AUJ D;  3EIV A;  1CKM A;  1AE2 A;  2KVM A;  3RR5 A;  3IRB A;  3K5N A;  4OON A;  1N33 Q;  4UAI A;  4RG1 A;  2UUC L;  3B6Y A;  2UUA Q;  3AMU A;  4KN4 C;  2IPK D;  2B2Y C;  5M9O A;  1R9T B;  1IKM A;  5EAY A;  1LTT D;  5IP7 G;  1OO9 B;  1TWF B;  2F0Q A;  4K6L A;  1CT1 D;  4DR2 L;  5I2X A;  2CH4 W;  4JYA Q;  2E5L L;  3SVM A;  1UUP A;  1VQA A;  3OPO A;  4JI6 Q;  1I4X A;  4C3I B;  4TQU S;  3T56 B;  4NKL A;  2D9U A;  4NPS A;  4GKK Q;  3G4S A;  1OXS C;  1EEF D;  1EY5 A;  3RNU A;  1GM5 A;  2N78 A;  3N6R A;  1O80 A;  3H91 A;  1KLG D;  1VQN A;  2B2T A;  3HOW B;  5FK9 C;  5JVG 3;  4WJ3 M;  1PRT B;  4X6A H;  1PH9 A;  2N3S A;  2AWN A;  4NXM Q;  2CVR A;  1JIC A;  3OTO Q;  4PNY A;  2CFM A;  1R4P B;  1A62 A;  1BVS A;  3BU2 A;  4JI0 L;  3JAM c;  4HMI A;  4A3G H;  1I50 H;  1Y1W H;  1WOC A;  5COR A;  4XYQ A;  2VS1 A;  1SXT A;  1B7Y B;  1GUT A;  4DR1 Q;  1I5F A;  3HOU H;  4MN3 A;  4A4I A;  2D2C C;  2R93 B;  5I4D A;  2F0W A;  4GKJ Q;  3QIA A;  2MUY A;  2I5H A;  2E2H B;  2SOB A;  3K0X A;  1VQF A;  4CJ0 B;  3S15 B;  1LV9 A;  1KD1 C;  1Z47 A;  4DR5 L; 
#chains in the Genus database with same CATH homology
 2PI2 E;  4L5S A;  2JA5 H;  1HZ9 A;  1SLJ A;  3L0O A;  4LF8 L;  2Z6K C;  4YHH L;  3KLW A;  5HY6 A;  3UDI A;  4JI1 Q;  4Y52 H;  2BH2 A;  4A3J G;  1HNW L;  3WWV A;  4GS3 A;  2ZM6 Q;  5GQO A;  5C0X I;  3CAM A;  2K5N A;  4IO9 A;  2NVT H;  3E9H A;  2NZO A;  3KFU A;  4LF4 Q;  3K7A H;  3GO5 A;  5FJ8 H;  3S24 A;  4B3S L;  3ZJY C;  1HZB A;  1FVI A;  4QGU A;  4A3E G;  1X56 A;  3KJP A;  4R4Q A;  4O2D A;  4IOC A;  1ASY A;  4DV5 L;  1X3E A;  2E2H H;  5LMN L;  4JI6 L;  4BY7 G;  1XMQ Q;  5M3F H;  1N8R C;  4JI8 Q;  1DGS A;  4GLA C;  4AIM A;  1XPO A;  1K0R A;  2UUB L;  3I7F A;  1TWA H;  4KI0 A;  4BXX G;  2ZTD A;  5IYC G;  1K73 C;  4GKK L;  3L7Z C;  4DV1 L;  1X3G A;  3MEF A;  4HID A;  4DV2 L;  4JI3 Q;  4OO1 I;  5DLQ E;  4LUZ A;  4AYB G;  1VQ4 A;  2EXD A;  1TWF H;  1L0W A;  3H15 A;  3T1Y L;  2UU9 Q;  4A3E H;  1FJG Q;  3CD6 A;  3J81 c;  4GLX A;  3I55 A;  3T1H Q;  4LFC L;  3ULJ A;  1NBW A;  3UDF A;  4APV A;  3TRZ A;  5GAE C;  1L1O C;  1OXV A;  4NB3 A;  2JA8 H;  3GTJ H;  4DV4 Q;  1HJP A;  4DV6 Q;  3ERS X;  4DR7 L;  4JV5 Q;  4A3M H;  5JEA J;  4P71 A;  4P72 A;  4BBR H;  2K5V A;  3EN2 A;  3I56 A;  2IX0 A;  1PV4 A;  2AHO B;  4DUY Q;  1HH2 P;  3U4V A;  3JAM i;  2HHH L;  1X6O A;  4HJ5 A;  4JBJ A;  4A3C H;  2CQO A;  1N9W A;  3CQZ H;  1E7Z A;  2VUM H;  4A3C G;  1A0I A;  2UXC L;  3G6E A;  1QVC A;  5M5W H;  2VL6 A;  4XIG S;  4OX9 L;  3TQY A;  1PH1 A;  2NZH A;  1XNR Q;  4LFB L;  3CCS A;  5IWA L;  4DV3 Q;  3OW2 A;  1CSP A;  1N33 L;  1Y14 B;  4K0K L;  1QUQ B;  4DR3 Q;  5M3F G;  2JA8 G;  3J7Z C;  4YCU A;  1M1K C;  4L5R C;  4R4O A;  5C4J H;  4C2M H;  3I2Z A;  4LWC A;  3VDY A;  1K8G A;  4LF7 Q;  4X64 L;  1R9T H;  1YIT A;  3S14 H;  3M85 A;  4IFD I;  1WI5 A;  4JI1 L;  4HJ7 A;  2IY5 B;  2WB1 G;  3UDX A;  2JA7 H;  2WP8 J;  2JK8 A;  5AJ3 L;  4DV0 Q;  4A3F H;  3GTQ H;  2UXB Q;  4A3F G;  1YJ9 A;  1M90 C;  4JBM A;  4XTC S;  1MJC A;  3KJO A;  3UE1 A;  1EYG A;  2R92 H;  2JEA I;  3HOY G;  2NN6 G;  1HZC A;  1VQM A;  1IBM L;  2Q2T A;  3M7N A;  1QZH A;  4JI7 L;  3PGZ A;  2YTX A;  2F4V L;  5JJI A;  4GN4 B;  3FKI H;  1FL0 A;  1TXY A;  3KDF B;  5M5X H;  1K3R A;  1W2B A;  2A8V A;  4TVA B;  3A5U A;  4FDB A;  2QA4 A;  1HR0 Q;  3PO2 G;  1SRU A;  2VUM G;  1PH7 A;  1X9N A;  3I4N H;  1N32 Q;  3PUY A;  4GNX A;  1VQB A;  2GVA A;  1EQQ A;  2NVX H;  3CCR A;  5C0X J;  2PMZ E;  3CMA A;  3KDF A;  1XNQ Q;  1BBW A;  4EQ5 A;  2UXD Q;  2L15 A;  3G48 A;  4QIW E;  1N34 Q;  1Y1V H;  2RHQ B;  3I4M H;  3PSI A;  2A1A A;  3RLF A;  3KF8 B;  3H0G G;  2YTV A;  1PHJ A;  2BH8 A;  3TS0 A;  4BBR G;  3J80 i;  4AYB E;  1BBU A;  1G29 1;  5LMU Q;  4B3R Q;  3GDE A;  2QEX A;  3F8T A;  1I94 Q;  1YNX A;  4JC0 A;  4A3B H;  2WAQ E;  4BBS G;  3CC2 A;  5IT9 c;  1ASZ A;  2Q2I A;  4P75 A;  4BBS H;  1OXX K;  4LF6 L;  1LTL A;  1N36 L;  4HJA A;  1IBL L;  5C44 H;  4UPA A;  2H5X A;  1EIY B;  1TWC H;  2KEN A;  4POG A;  3GTL H;  2FXQ A;  1YJN A;  2ZTC A;  1XMO L;  1TWG H;  2B63 H;  1U5K A;  4X65 L;  4LF5 Q;  3KF6 B;  1YEZ A;  4BXX H;  1PH3 A;  3M3Y H;  4GN3 B;  2KBN A;  3GTK H;  4H02 A;  4GOP B;  3J81 i;  1YIJ A;  2PI2 A;  5FLM H;  4HIM A;  3K7U C;  5C3E G;  5AJ3 Q;  4DV0 L;  2Y0S G;  1B70 B;  2VQF L;  1HNW Q;  4AQY Q;  1HZA A;  2ID0 A;  5FJ8 G;  2EIF A;  4LF4 L;  1YZ6 A;  4GOP A;  3F2D A;  2ZJP A;  2NVY H;  4RMF A;  2XTI A;  4JG2 A;  3W1G A;  2Q2U A;  1PFS A;  3CCQ A;  5BR8 Q;  4Y7N H;  4PMW A;  1IBM Q;  1J5E Q;  3K81 C;  1XMQ L;  2OTL A;  1NTG A;  4OWW B;  3PUX A;  5K36 G;  3M4O H;  1A8V A;  4JI2 L;  2UUB Q;  1C9O A;  1D8L A;  2JE6 I;  1OTC A;  3UDG A;  3GTM H;  4GLV B;  4YWL A;  2E2I H;  4AH6 A;  3HOX G;  2EQS A;  4JI3 L;  5JEA G;  1IXR A;  3AFQ A;  4DR1 L;  3CCL A;  2R7Z G;  2F52 A;  3EBE A;  3I4M G;  4X62 Q;  4X66 Q;  4JCV E;  3PO3 G;  3T1Y Q;  1SE8 A;  2JJQ A;  4A3L H;  3HOW G;  3CF5 A;  2ATW A;  1NMF A;  4DR6 Q;  2R93 G;  1L2F A;  4JI5 Q;  3CCJ A;  3RLO A;  1HNZ Q;  1XJV A;  3S2H H;  3HOZ G;  2HIV A;  4C3J H;  3PUZ A;  4PZ7 A;  4DV4 L;  4YWM A;  4LW1 A;  1LM0 A;  1UE1 A;  1XTD A;  4KLK A;  3HOY H;  4DK6 C;  4NXM L;  4QY7 A;  2OTJ A;  4LFA L;  2E2J H;  4LF8 Q;  4MNO A;  1Q86 C;  1EIF A;  1NE3 A;  2ES2 A;  4JI0 Q;  1KRS A;  2ZTE A;  3U50 C;  4DR4 L;  3HOX H;  2VY3 A;  2ZM6 L;  3CPF A;  1G6P A;  4A3G G;  3M9B A;  1KC8 C;  4DR2 Q;  1IZ6 A;  1QZG A;  3HOU G;  4POF A;  4MZ9 A;  1C7Y A;  4B3S Q;  1X54 A;  1NJI C;  3S17 H;  4A3I G;  2R93 H;  2GN5 A;  2XGT A;  1KAW A;  3PV0 A;  1Q1E A;  5LMN Q;  1RL2 A;  3CCU A;  4JI8 L;  5HGQ A;  1JJC B;  2NVQ H;  2K4K A;  3RLN A;  2B63 G;  1MIU A;  4A3K H;  4GNX C;  4BY1 G;  4DR5 Q;  3CP0 A;  3HOV H;  4LF7 L;  2CCZ A;  2IHF A;  3S1M H;  5M3M H;  2UUA L;  4JOI A;  1WFQ A;  1IBK L;  2Q2H A;  2PQA A;  3ULL A;  4DV2 Q;  1Y1W G;  3PUW A;  5C3E H;  1IYJ B;  4AQY L;  1S72 A;  3RN5 A;  1JT8 A;  3FHW A;  2UXB L;  1HNX L;  2VQE L;  2CKZ B;  2CWP A;  2N8N A;  5IYB G;  4A3B G;  4HJ8 A;  4L5T A;  2DUD A;  2JQO A;  3H3V H;  5ELO A;  4B3T L;  1XPR A;  1P16 A;  3F1Z A;  1GD7 A;  5C44 G;  4HIK A;  2MO1 A;  1X65 A;  4QJF A;  3NEL A;  1CKN B;  1QVG A;  2E5L Q;  3STB C;  1KIX A;  4IPC A;  4PZ6 A;  4YY3 L;  4LNQ A;  3FP9 A;  1VQI A;  1WCM G;  1S3O A;  4BY1 H;  3PF4 A;  3L2P A;  5FLM G;  2AKW B;  2HHH Q;  3PO2 H;  1E1T A;  3M4P A;  1CKN A;  2MNA A;  1LYL A;  4X66 L;  4X62 L;  2UXC Q;  1YI2 A;  1N32 L;  3PIP A;  1WJJ A;  2D0O A;  1VQJ A;  1PA6 A;  3Q8D A;  1AH9 A;  4OX9 Q;  4GKJ L;  3CC4 A;  4R4I A;  1HNZ L;  3A0J A;  3CW2 C;  4A3I H;  1FJG L;  3JC6 6;  3RZO H;  4DR3 L;  1B8A A;  2VNU D;  3HOZ H;  3AYH B;  4P74 A;  1E22 A;  3ICE A;  4MTN A;  4LFA Q;  2UUC Q;  5GAG C;  1KL9 A;  4IPD A;  1J5E L;  1VQE A;  4LUO A;  1GO3 E;  4GOP C;  4B3M L;  3D0F A;  2YTY A;  3S16 H;  4B3R L;  2ASB A;  1GVP A;  2OQ0 A;  2JA7 G;  1K9M C;  1JJ2 A;  2R7F A;  4A3J H;  4DAM A;  3CPW A;  3K80 C;  4JI4 L;  4LF6 Q;  5C4X H;  3CCM A;  4UY8 C;  1A63 A;  1N36 Q;  2HIX A;  3CXC A;  4UP8 A;  1VQ5 A;  4A3L G;  5C4X G;  2K52 A;  4DV7 Q;  1EQR A;  1EUJ A;  4BY7 H;  1LUZ A;  2CWA A;  3OYY A;  1PH8 A;  1MJE A;  4JYA L;  2MQH A;  4KHP L;  2GVB A;  1X55 A;  4BA1 I;  4NXN L;  5IP9 H;  2QGQ A;  2ZJR A;  2JA6 H;  4DPG A;  2KHJ A;  1EWI A;  5IYD H;  5LMN W;  3PIO A;  1OXT A;  1YVC A;  1VQP A;  1IBK Q;  1XPU A;  3BZK A;  2VW9 A;  3ULP A;  4DV1 Q;  3GTP H;  1SRO A;  2K75 A;  1PVO A;  1JMC A;  3PF5 A;  2MFI A;  4DUZ L;  4OWT B;  3E9I A;  3M4Q A;  3LGJ A;  1AE3 A;  1Q46 A;  2B3G A;  4J15 A;  2UXD L;  3J80 c;  1EFW A;  1V1Q A;  2Y0S E;  3HOW H;  1S40 A;  3NBH B;  4LFC Q;  2BA0 A;  2RF4 A;  1PH2 A;  1Q1B A;  5IYD G;  5M5Y H;  4PZ8 A;  2ZJQ A;  4YY3 Q;  1VQC A;  2E8G A;  4DV5 Q;  1E24 A;  3HKZ G;  4JBK A;  3DLL A;  3KOJ A;  1EOV A;  4HIO A;  2KCT A;  1JB7 A;  4JI7 Q;  4IFD J;  1WCM H;  4IPG A;  5LMU L;  3U58 A;  4OWX B;  2Z6K A;  3F2B A;  3CCE A;  1Q82 C;  1K8A C;  3SGI A;  5GAD C;  1PH5 A;  1QUQ A;  4ALP A;  4C3I H;  4A75 A;  2RHS B;  1U0L A;  2R6G A;  1IBL Q;  4UP9 A;  2IHE A;  2JEB I;  4IPH A;  3AEV A;  3NEM A;  1UE7 A;  2Z0S A;  1XNQ L;  2UU9 L;  2YV5 A;  1SR3 A;  2C35 B;  1YHB A;  4LFB Q;  4JBW A;  1TWH H;  1Y1V G;  2OCE A;  2V1C C;  3NEN A;  1PH4 A;  2I0Q A;  1Z9F A;  2WFW A;  1VQ7 A;  4OO1 G;  2WAQ G;  3BJU A;  4GNX B;  1RIP A;  4DR7 Q;  2NN6 I;  1P8L A;  3HFZ B;  1YHA A;  5M3M G;  1JE5 A;  3CC7 A;  1SFO H;  1NY4 A;  4LF9 Q;  3TS2 A;  4YHH Q;  4QQB X;  1I94 L;  4JI4 Q;  3HKS A;  5GRO A;  3TRE A;  1CSQ A;  5JJK A;  2VZA A;  3F2C A;  4DKA C;  1KQS A;  1HR0 W;  4DV7 L;  2K50 A;  1VQG A;  1KRT A;  5IYB H;  2YU9 H;  1UWV A;  2WB1 E;  1SN8 A;  1FGU A;  4JOI C;  5BR8 L;  2IT1 A;  1H95 A;  1XNR L;  1K83 H;  1V9P A;  3AQQ A;  4GN5 A;  1L1O B;  1V43 A;  3S2D H;  4JI2 Q;  4K0K Q;  3FKI G;  4X65 Q;  4LF5 L;  3PCO B;  3RN2 A;  1PH6 A;  4IJH A;  1T9H A;  3E0E A;  4DNI A;  3KYH C;  3A5Z B;  5IY0 A;  4DUZ Q;  1L1O A;  2VQF Q;  3RZD H;  3GD7 A;  2AMC B;  2BA1 A;  2PNH A;  3KF6 A;  4JI5 L;  1WYD A;  1E3P A;  1VQL A;  2HT1 A;  1QVF A;  2AWO A;  4A3D G;  2N49 A;  1NMG A;  3T1H L;  1D7Q A;  4L5Q A;  3CCV A;  2JA6 G;  4DK3 C;  1PYS B;  2I5M X;  4DV6 L;  2IX1 A;  4JV5 L;  3AFP A;  1SMX A;  4LUV A;  3OTO L;  2ALY B;  1W3S A;  5H1S E;  3EIV A;  3PO3 H;  1CKM A;  1KHI A;  1AE2 A;  1VQD A;  3U4Z A;  4PG3 A;  1CUK A;  4UP7 A;  1J6Q A;  3DM3 A;  3RR5 A;  2JA9 A;  3IRB A;  2R92 G;  1UE6 A;  3H3V I;  1UE5 A;  4OON A;  1X3F A;  4IJL A;  1IL2 A;  4R4T A;  1I6H H;  1N33 Q;  4RG1 A;  4A93 G;  1G51 A;  4R1J A;  2UUC L;  2B29 A;  3B6Y A;  2KHI A;  2UUA Q;  2OQK A;  4LF9 L;  3ER0 A;  4B3M Q;  1VQH A;  1GKH A;  4X64 Q;  2A19 A;  2RCN A;  4WJ4 A;  2R7D A;  2YYZ A;  4DR4 Q;  4ME3 A;  5EAY A;  5GAH C;  2K14 A;  5IP7 G;  2VQE Q;  5C0X G;  3S1R H;  1C0A A;  3G71 A;  2R7Z H;  1YJW A;  3I4O A;  4DR2 L;  4OXP A;  3UE0 A;  4B3T Q;  1MKH A;  4JYA Q;  1VS0 A;  2E5L L;  1UEB A;  4A93 H;  5J3B A;  3MXN B;  4NXN Q;  1O7I A;  1VQA A;  4JI6 Q;  5E7N A;  5IE8 A;  3W1B A;  1Q8K A;  3GTG H;  1I3Q H;  4A3M G;  4KHZ A;  3HOV G;  4YCV A;  1E1O A;  4TQU S;  5IYC H;  2F4V Q;  5JJL A;  4DAY B;  1OXU A;  2OWO A;  4NPS A;  5IP7 H;  4GKK Q;  3PUV A;  3A74 A;  3K8A A;  3BZC A;  3G4S A;  1HR0 L;  1OXS C;  4IFD G;  3STB D;  4IOA A;  3RNU A;  2LXK A;  1GM5 A;  2N78 A;  1HNX Q;  4P73 A;  2D62 A;  2DGY A;  1YHQ A;  1Q7Y C;  1VCI A;  1JJG A;  4DR6 L;  3J7A 5;  1VQ8 A;  2MO0 A;  1VQN A;  4C3H H;  1VQ6 A;  3J81 j;  4WJ3 M;  1VQO A;  4QL5 A;  5FLX c;  4HJ9 A;  1N34 L;  4R4C A;  4A3K G;  1PH9 A;  4X6A H;  3W5O A;  2D0P A;  2N3S A;  2AWN A;  1VQ9 A;  3CME A;  4NXM Q;  3S15 H;  3OTO Q;  2CFM A;  2JA5 G;  1BVS A;  1A62 A;  3BU2 A;  1CKO A;  4JI0 L;  3S1N H;  4O0A A;  3JAM c;  1BKB A;  2F3I A;  4DUY L;  4A3G H;  1I50 H;  1Y1W H;  1WOC A;  3HKZ E;  3I4N G;  4BA2 I;  2VS1 A;  1KXL A;  3TEH B;  1B7Y B;  4A76 A;  4DR1 Q;  1I5F A;  3HOU H;  4A4I A;  2I5L X;  3GTO H;  4KHP Q;  4GKJ Q;  1VQK A;  2I5H A;  3S1Q H;  2PQA B;  2KCM A;  4EX5 A;  1YBY A;  3D31 A;  1PYB A;  2LSS A;  3K0X A;  4YCW A;  2K5H A;  5ELN A;  2LXJ A;  1VQF A;  3H0G H;  5IWA Q;  4DV3 L;  4A3D H;  5IP9 G;  1XMO Q;  1KD1 C;  1Q81 C;  1Z47 A;  2HQL A;  4YWK A;  4DR5 L;  1Q12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...