4JOIA

Crystal structure of the human telomeric stn1-ten1 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
160
structure length
141
Chain Sequence
b'LAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKVYDQPFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CST complex subunit STN1
molecule tags Dna binding protein
source organism Homo sapiens
publication title Structure of the human telomeric stn1-ten1 capping complex.
pubmed doi rcsb
total genus 39
structure length 141
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4joiA00
2OQ0A 3K8AA 4L5TA 2ZM6L 4A3IG 3RLOA 2E2IH 1HZ9A 1DGSA 1K9MC 3HOZH 4KHZA 3K80C 4JI6L 2Q2UA 5M5WH 1CSQA 4QY7A 4DK6C 1HZBA 4Y52H 1GVPA 4XTCS 5M3FG 2A19A 2MQHA 1WJJA 1IBML 1VQ7A 3GTKH 3CQZH 3RN5A 3G71A 3ER0A 4JBKA 3KF8B 5C44H 4DR5Q 2UUBQ 4X65L 1IBKL 2MO1A 2IX1A 2RF4A 2K5VA 4GLVB 3DLLA 2L15A 3AFPA 1KXLA 5IYCH 3BU2A 1I94L 3K7UC 3FKIG 4AQYL 1PH6A 2PMZE 4NPSA 1YBYA 3RZDH 1VQIA 2EIFA 3UDIA 5IYCG 1TWHH 2A8VA 1X56A 1SRUA 1HZCA 4J15A 2N8NA 3PV0A 1N36L 3CMEA 1JT8A 1WFQA 3STBD 4K0KL 5IYBH 5C44G 4IJHA 3I4NG 4YY3L 5C0XJ 4A3FH 3G4SA 4JV5Q 4A3LG 3AYHB 1EOVA 1VQHA 1GD7A 2WB1E 4UP9A 4LF7Q 2OCEA 1IYJB 1N33L 1CSPA 1CUKA 1QUQA 2XTIA 3KOJA 4P74A 1NJIC 4LF8Q 3G6EA 3CCLA 3S1MH 4KHPL 1MJEA 4QQBX 1ASYA 2LXKA 3HOZG 3TQYA 3IRBA 1N32Q 2Z0SA 2R7ZH 5C0XG 1IBLQ 2E8GA 2QGQA 2PNHA 4DR1L 4X66L 1RL2A 2NVXH 4PG3A 1EWIA 4IPCA 5EAYA 3OYYA 2PI2E 4HJ7A 4DV0Q 4A3JG 1UE6A 1XPRA 1EFWA 2VQEQ 3I4MH 1BBWA 3KLWA 3ULLA 3I4OA 3E0EA 1CKNA 3UE1A 1QVFA 4A3KH 4LF5L 3GTMH 4LF4Q 4GKJQ 2UXCQ 3A0JA 1H95A 2Z6KC 3L0OA 1VS0A 1IBKQ 3CXCA 1K73C 1XPOA 3W1BA 3H3VI 3J80i 2K50A 2R7DA 4DV2L 1HNZQ 2VUMG 1EUJA 2OQKA 3E9HA 1OXVA 1Q8KA 3NEMA 2WAQG 2QEXA 3CCEA 2YU9H 1HNXQ 3PF4A 1UWVA 4ME3A 3CAMA 4DR4Q 2UU9Q 2AWOA 3A74A 4HIMA 3PCOB 4YY3Q 1PH8A 3J7A5 1YEZA 4KLKA 2UXBL 1BVSA 1C9OA 4LW1A 4K0KQ 4A3BH 3DM3A 4DV6Q 4LF9Q 5LMNQ 1YI2A 1PV4A 4EX5A 2CCZA 1G291 3M4QA 2ES2A 4BY7H 1A8VA 1XNRL 4NXML 2PI2A 2YYZA 4JI4Q 2R93H 4GKKL 3U4VA 1YJWA 2Q2IA 3CC7A 5HGQA 5AJ3Q 3RN2A 1XPUA 3CCUA 1PFSA 2JK8A 2IY5B 4DUZL 4DR5L 4MTNA 4AQYQ 2GVBA 2R6GA 4R4OA 1V43A 4QL5A 5J3BA 4JYAL 2VL6A 2E2JH 1UE1A 5M3FH 4GNXB 2VZAA 4R4TA 2XGTA 3A5ZB 2DUDA 1A63A 4A3IH 4YHHL 4DV5L 1AE3A 3TEHB 1LM0A 3HOXH 4OX9Q 1UE7A 4HIOA 5E7NA 1HNZL 1JB7A 5IYDG 4JI1Q 3Q8DA 4AYBG 1IXRA 2CFMA 4BY1G 4LF8L 3HOWH 1Q46A 1VQFA 3OW2A 3HOYH 2UXDQ 2YTYA 4DAMA 2JA6G 4PMWA 3I56A 4A3MG 4IJLA 4PZ8A 4MNOA 4TQUS 2FXQA 4DR1Q 4JBJA 2F4VQ 1FVIA 1WOCA 4A93H 4C3HH 4B3TL 1EIYB 2R92G 3JAMc 3GTJH 4B3ML 4A3DG 5C4XG 4DR3Q 1X54A 5FJ8G 5AJ3L 1GKHA 1PH2A 2ID0A 4DV7Q 4A3CG 1VQBA 2LXJA 3FHWA 5HY6A 4DR4L 2B3GA 2IX0A 4YCUA 5M3MH 5IP9H 1M1KC 4R4CA 5GADC 3E9IA 2HIXA 1PHJA 3U4ZA 4LFAL 1E1OA 4OXPA 4X62L 4A93G 1Q1EA 2CQOA 4L5QA 4YCWA 1HZAA 1KD1C 4JI3Q 4L5SA 4BBRG 1TWFH 1KIXA 3S15H 2VQEL 1RIPA 3RZOH 4LF5Q 2CKZB 2KCTA 4A3MH 2R7FA 2WB1G 4PZ7A 3RLFA 3H3VH 4LFBQ 4JI5Q 1L1OB 5IP7H 4NB3A 4GOPB 1VQLA 3JC66 3CMAA 2DGYA 1NMFA 4UP8A 4HIKA 3EBEA 2IT1A 4QIWE 3KF6B 1Q1BA 2ATWA 4P72A 4R4IA 2Z6KA 2H5XA 3F2BA 2YTVA 1JJ2A 1Y14B 2BH2A 1JE5A 5IP7G 4P73A 2JA5H 1L2FA 1GM5A 4UP7A 3B6YA 4X64Q 2HHHL 3CF5A 1HJPA 1OXSC 3PUWA 2OWOA 1EIFA 1Q7YC 1YHBA 1NBWA 4A76A 4JI2Q 1R9TH 4DV3L 4BXXG 4YWMA 4DUYQ 2E5LL 1G6PA 1N8RC 2KHJA 1XJVA 1PH9A 4A3GH 3CP0A 4POFA 4HIDA 5IE8A 1D7QA 1FGUA 2I5LX 4APVA 4HJAA 5C0XI 2Q2TA 4KI0A 4ALPA 1MIUA 4RMFA 5M5YH 5IP9G 4X64L 2WFWA 3CC2A 3PO3G 2BH8A 3PUXA 4YWKA 3OTOL 3M4PA 2YV5A 4JI8Q 3G48A 1YNXA 3S16H 5BR8Q 4A3EH 3M3YH 4JBWA 4X65Q 2MNAA 4DR2L 1VQNA 1X55A 1XNQL 4KHPQ 5C4XH 1N32L 1NE3A 2Y0SE 4GLAC 3CCVA 4YCVA 3UDXA 3J80c 4HJ5A 4DR7L 2AWNA 2K4KA 2KENA 4GLXA 4B3SQ 1SR3A 3F2DA 4JBMA 1Y1WG 2CWAA 1TWGH 1FL0A 2JE6I 3NBHB 4RG1A 1HNWL 1XNRQ 2HIVA 1VQEA 3CCMA 2RHQB 4TVAB 4GN5A 2F52A 4A3KG 4OWTB 1S72A 2YTXA 2HT1A 4B3SL 4JI2L 3I4MG 1VQPA 4X6AH 3M9BA 1I3QH 4QJFA 4DR7Q 4O0AA 1YIJA 3KFUA 1LUZA 1MJCA 1JMCA 4BY1H 4DAYB 4IO9A 3CCRA 4HJ9A 1YHQA 4GN4B 3A5UA 5LMNW 1VCIA 3KDFA 4DV2Q 1FJGQ 4L5RC 1SN8A 1B7YB 3J81c 3GTQH 3ICEA 1XTDA 3VDYA 1QZHA 4JI7Q 4A4IA 3GTLH 4LWCA 3W5OA 4BA2I 4DK3C 1KL9A 2UUBL 2LSSA 1PVOA 1L0WA 4DPGA 1VQ6A 3HOVG 1SROA 3CCJA 4DV6L 1SFOH 4LF9L 4GKKQ 3PO2H 4A3LH 1IZ6A 2KHIA 2NVQH 4A3FG 1I5FA 3BZKA 3CC4A 2UXDL 2UUCL 2KBNA 5IYBG 3I4NH 5K36G 1L1OA 1XMQL 4C3IH 4GNXC 1BBUA 3KDFB 3J81j 1Q86C 3S24A 1CKNB 2R93G 2BA1A 2JA9A 1CKMA 1K83H 2VQFL 3BJUA 3CPFA 2Q2HA 3EIVA 3FKIH 1PH5A 1SE8A 4BY7G 2JJQA 4IFDI 4B3RQ 1PH3A 4A3BG 1Y1VH 3I2ZA 4P75A 3K81C 3T1YL 4O2DA 1KRTA 4DV7L 3S1QH 1VQGA 4JI5L 4PZ6A 3T1HL 1J5EQ 1O7IA 4C3JH 3TREA 3JAMi 4HJ8A 1FJGL 3HOVH 3PUVA 1G51A 3GD7A 4NXNL 2JEBI 2ASBA 2K5NA 4DUZQ 2HQLA 1X3FA 1E3PA 3U50C 4X62Q 2UUAL 3NELA 5LMUL 1XMOL 4A3JH 2AKWB 2K14A 4AH6A 5JJKA 4IPDA 3D0FA 2C35B 1KRSA 1WYDA 2QA4A 1V1QA 4JI3L 3M7NA 1KHIA 1VQOA 3GO5A 2JA7G 2VS1A 4GN3B 3RR5A 4JOIC 4UPAA 3NENA 4DV5Q 1WCMH 4R4QA 1T9HA 3STBC 3S14H 2OTJA 1LYLA 2ZTCA 4MZ9A 1YHAA 3PIOA 1QZGA 1Z9FA 1Q12A 3CW2C 1CKOA 3EN2A 4IPHA 5IWAL 4OX9L 2N3SA 3HKZE 1XMOQ 4GOPC 3PGZA 3GTPH 1Y1WH 2ZJRA 1PYSB 2VW9A 3S1NH 1LTLA 1OXXK 2PQAB 1SLJA 5GROA 3RLNA 4JI7L 1XNQQ 4GKJL 2K75A 1P8LA 1QUQB 1EYGA 3K7AH 1VQDA 4LUVA 4H02A 4AYBE 1Y1VG 5JJLA 1A62A 1TWCH 1J5EL 1IBMQ 2IHFA 1Q81C 3S2DH 1J6QA 1X6OA 3PUZA 2B63G 1I6HH 1PH7A 1L1OC 3PO3H 3HKSA 2B29A 3TRZA 4FDBA 4DKAC 3D31A 4JI0Q 4LFCQ 2PQAA 2UU9L 4LF6L 1VQAA 1TXYA 4OO1G 4WJ3M 2VQFQ 2RHSB 1YITA 3H15A 4IOAA 1S40A 4A3GG 5FLMG 2UUAQ 3BZCA 1AE2A 1SMXA 3PO2G 4BBSH 5JEAJ 1S3OA 4OWXB 4BXXH 2Y0SG 4UY8C 2NZOA 3GTOH 1K3RA 1B8AA 3CCSA 2NZHA 1X9NA 3AQQA 3F1ZA 5GAEC 1NY4A 1X65A 1KAWA 2D0PA 3H0GG 4JOIA 5ELNA 3ULJA 5GAGC 1VQ5A 1N34Q 5H1SE 4LUOA 3HFZB 1N9WA 4DV4Q 1IL2A 3FP9A 3T1HQ 4JYAQ 1TWAH 3KJOA 1UEBA 4OO1I 2GN5A 4LUZA 2ZTDA 3CPWA 1EQRA 1X3EA 1JJCB 4A75A 5LMNL 1YJNA 1VQJA 5C3EG 3UDFA 4JI1L 1QVCA 1HH2P 1V9PA 2EQSA 4R1JA 4DV1Q 1NMGA 4GNXA 3UDGA 1U5KA 2A1AA 2K52A 4JG2A 4AIMA 5IY0A 2ZM6Q 1JJGA 3AEVA 3GDEA 3PUYA 1AH9A 4Y7NH 2V1CC 1A0IA 4DR2Q 1N36Q 3M85A 1E7ZA 4C2MH 1B70B 1I50H 4A3EG 2UXCL 3TS2A 2K5HA 4YWLA 2JA8H 2NVYH 3F2CA 3HOUG 3MXNB 3HOUH 1OXTA 3ZJYC 3M4OH 3CD6A 4A3CH 1OTCA 2EXDA 2F4VL 4NXNQ 2I5HA 1W3SA 2CWPA 2NN6I 5FJ8H 3UE0A 3U58A 4BA1I 4GS3A 4B3MQ 4IOCA 1QVGA 4A3DH 1I94Q 2R92H 5GQOA 1EQQA 1M90C 4LFBL 2N49A 4LNQA 2ZJQA 4POGA 5C4JH 5ELOA 2D0OA 1P16A 2AMCB 1IBLL 1VQCA 2NN6G 5IT9c 3ULPA 2E2HH 4LFCL 2RCNA 4JI0L 1PH4A 3CCQA 4JI4L 4OONA 4B3RL 4JI6Q 2D62A 1U0LA 3SGIA 3KYHC 3TS0A 1K8GA 2JA5G 2HHHQ 4DR6L 3RNUA 3WWVA 4LF6Q 1C0AA 1E22A 1YZ6A 3K0XA 1MKHA 3HOWG 2N78A 1HNXL 2IHEA 4LF7L 2BA0A 3H0GH 1VQMA 3HOXG 3ERSX 4XIGS 4B3TQ 2AHOB 3F8TA 5GAHC 2I0QA 3LGJA 3PIPA 3PSIA 4JC0A 2MO0A 4IFDJ 4BBRH 4BBSG 5BR8L 4WJ4A 1HR0W 5FLMH 4JI8L 4DV4L 1BKBA 4NXMQ 1VQKA 5JJIA 3GTGH 5FLXc 3T1YQ 2MFIA 1PH1A 3HKZG 2ZJPA 1YJ9A 1K8AC 3S17H 4LFAQ 5IWAQ 1ASZA 5M3MG 1HR0Q 2NVTH 4P71A 2OTLA 1Q82C 5M5XH 4JCVE 4IPGA 4DV1L 2WP8J 2JQOA 3W1GA 1E1TA 2B63H 4JV5L 4DV3Q 4EQ5A 3KF6A 2VY3A 1OXUA 3J7ZC 1NTGA 4DUYL 2E5LQ 3MEFA 2JA8G 2UXBQ 1WI5A 1N33Q 2I5MX 5JEAG 1XMQQ 1HNWQ 1GO3E 3I55A 1D8LA 4GOPA 1VQ8A 3S2HH 4OWWB 4DR6Q 2VNUD 5LMUQ 2UUCQ 2ALYB 4IFDG 5DLQE 3KJPA 1X3GA 4DR3L 1Z47A 4YHHQ 1N34L 2KCMA 1HR0L 1E24A 1PYBA 2VUMH 2JEAI 1UE5A 3OTOQ 4DV0L 2WAQE 1K0RA 4X66Q 1C7YA 2F3IA 1YVCA 5C3EH 1KQSA 4LF4L 3L7ZC 1W2BA 2ZTEA 4QGUA 1WCMG 3I7FA 2JA6H 2JA7H 3S1RH 1VQ4A 1PA6A 3AFQA 3HOYG 3J81i 3PF5A 5IYDH 2R7ZG 4DNIA 2GVAA 3L2PA 1KC8C 1VQ9A
chains in the Genus database with same CATH superfamily
1HZ9A 5E3FA 5M5WH 5C3XA 1DONA 1TQOA 1GVPA 1WJJA 1X32A 1U4MA 1VQ7A 2ZXRA 4X65L 1RKNA 4MIUA 3DEPA 2RF4A 2L15A 1KXLA 1DXMA 3BU2A 4CDDC 5C3WA 5IYCH 1E2ZA 4AQYL 4NPSA 3RZDH 2R93B 4N9TA 5IYCG 4RFBA 1SRUA 1HZCA 1JOKA 3STBD 2RSOA 3A7AB 3HOUB 4DK0A 3D4DA 4C1NK 2HD3A 1SNQA 3G4SA 4A3LG 1EOVA 3AYHB 4XT3B 2OCEA 5CBAE 4P74A 4CDFC 1MJEA 5EBDA 1ASYA 4KKSA 3IRBA 3RD4A 2EVBA 3NP8A 1JB3A 2PNHA 2F3VA 4A3JG 1EFWA 1UE6A 3KLWA 4NW2A 3MTSA 3GTMH 3NPPA 2Z6KC 3E0JA 3H0GB 2A6HD 3K59A 2K50A 3HRZC 2VUMG 1EUJA 3E9HA 1OXVA 2WAQG 5I9OA 1STHA 4EQPA 2F0KA 3GTOB 2UXBL 1A3VA 3A74A 4YY3Q 1PH8A 1YEZA 4EQOA 2K5DA 3DM3A 2CCZA 1G291 3M4QA 3TP6A 4BY7H 2R61A 4GKKL 2Q2IA 2O5JC 1G8ZD 5FK9C 1PFSA 2D5DA 2JK8A 2XNAC 2L5TA 4MTNA 2GVBA 4ILWA 4R4OA 1ILQA 3GTKB 2K28A 2PZWA 1C8CA 1UE1A 1RTNA 2R3ZA 1F2YA 1TU2B 5C6AA 5M5WB 1STYA 2VZAA 3A5ZB 3C3LA 1AW7A 4A3IH 3A54A 4DV5L 1LM0A 3MXNA 1HNZL 2EYHA 1IXRA 4LF8L 1Q46A 4DAMA 4G57A 4A3MG 3BDCA 3SEBA 1NSNS 4ZAIA 2NN6H 5IGGA 1BR9A 4K8IA 2F4VQ 4MN3A 4B3TL 1EIYB 4HSPA 4NKLA 5FJ8G 1ML0D 4DXFA 3S2HB 4DV7Q 3MAQA 1HXYD 1F9PA 1TY2A 2Z8LA 1L0XB 1M1KC 4R4CA 2DY8A 2E2IB 3U4ZA 4OXPA 4X62L 3CKIB 4A93G 5EQ0A 4YCWA 3X3MA 1KD1C 3TZDA 1CQFA 1KIXA 4ME5A 3DEOA 2K04A 2KCTA 3FDTA 2MGSA 2GA4B 1L1OB 5IP7H 3JC66 5C3EB 2DGYA 4UP8A 4HIKA 3I4LA 2IT1A 4HEDA 4QIWE 1BF4A 2J4XA 2NTTA 4R4IA 2Z4IA 2H4OA 3I8ZA 4ZYSA 4UP7A 1CM9A 2OWOA 1EIFA 5K5PA 1SE3A 1ENAA 4QIWB 4A76A 4DV3L 2KHJA 4K14A 2EYFA 1QB5D 3CP0A 1Y8PB 4PQXA 5IE8A 1Z6HA 2I5LX 5CGKA 5C0XI 1K0SA 1MIUA 3MC0B 2WACA 5IP9G 1UEAB 3FEWX 1TS5A 3I70A 3URYA 3CC2A 3PO3G 2EY6A 2A69C 2YV5A 3S2DB 2WAQB 2JA8B 3M3YH 2NVXB 4M1UB 1VQNA 3DXJC 4ZUIA 4GLAC 3CCVA 4DR7L 1HUNA 3J80c 2K4KA 3F2DA 4XYOA 2E74C 2CWAA 2JE6I 1XTCD 4RG1A 5CV8A 4WORA 1D5MC 2F52A 2YTXA 1VQPA 1I3QH 4DR7Q 3KFUA 1LUZA 1JMCA 2AQ3B 1JCKB 1STEA 4X3SA 5LMNW 4DV2Q 4NDXA 1GUOA 1SN8A 2KUMA 3J81c 3GTQH 3ICEA 3EQLC 1TVXA 4LWCA 3W5OA 1KL9A 1EY4A 2B2VA 1L0WA 4DPGA 1SE2A 4DV6L 1SFOH 4LF9L 3PO2H 3WOEA 1I5FA 3BZKA 1L1OA 1BBUA 5M5XB 2EY2A 4CDCC 2R93G 2BA1A 2VQFL 2AUKA 1I4XA 1V1OA 4RWSC 3P7JA 5D3IB 4IFDI 4JVZA 4B08A 1PH3A 2A68C 3NWSA 4A3BG 2L55A 4P75A 3N6RA 4O2DA 3OMGA 1KRTA 4DV7L 1O7IA 2P5ZX 1LT5D 4FXGC 3HOVH 3PUVA 3R3OA 4IUTA 1PTOC 1UUPA 2JEBI 1LO5D 1TY0A 1FYCA 2LMCB 4DUZQ 1BOSA 1Q3LA 1B4OA 4X62Q 1X3FA 3T4AC 2UUAL 1XMOL 3A7LA 4KKTA 2XVSA 3F2UA 4IPDA 1KRSA 2QA4A 4JI3L 1KHIA 3VR4A 1SNMA 2KCCA 3S14H 1YHAA 4X3TA 4ULLA 1QILA 1ENFA 1XMOQ 3HOXB 3GTPH 2PQEA 5A2QE 1J8IA 1EU4A 2HUGA 1BNZA 1OXXK 4DAPA 1P8LA 2RA4A 1QUQB 2LKVA 1QOHA 1MSGA 4LUVA 2KQ3A 4HAEA 1Y1VG 2R7ZB 1TWCH 1MHWC 1IBMQ 1J6QA 4LK1C 2B2UC 1NR4A 5I9PA 3HKSA 2B29A 4DKAC 4JI0Q 4LAAA 2UU9L 1WCMB 1TXYA 4WJ3M 1CTMA 2RHSB 3H15A 4L6TB 4A3GG 2UUAQ 1S5FD 1AE2A 3PO2G 1S3OA 4UY8C 1S5ED 1DCZA 2BDOA 2NZHA 2QCPX 2AQ2B 1LTRD 4PMCA 2K6AA 4FYDA 3F1ZA 1JR0D 1X65A 2PMZB 1KAWA 3H0GG 5EKLA 3ULJA 2B8FA 5GAGC 3V96A 1WTRA 3HFZB 1IL2A 3T1HQ 1UEBA 1RDPD 2L11A 1KNEA 2K1BA 4LUZA 4RKBA 1B9NA 2NVYB 3CPWA 3BG3A 3SVMA 1NCVA 4JI1L 3T16A 1QVCA 1V9PA 2Z1CA 1U5KA 2ZM6Q 3OWFA 3AEVA 3PUYA 1A2UA 1AH9A 1GUSA 2EDGA 1PTOF 3A8KE 1K28A 4DR2Q 1E7ZA 2CW0D 2UXCL 4YWLA 1UAPA 2NVYH 3HOUG 3MXNB 2JXMB 1MI2A 3HOUH 3M4OH 2WKCA 5F2DA 3ZJYC 3MWYW 3CD6A 3D4RA 1LACA 1VF7A 3U9OA 4BA1I 1SNCA 4B3MQ 3I90A 1X3PA 1I94Q 5GQOA 1M90C 3DWQA 5C4JH 1VQCA 1FNUA 1PRTD 4RGTA 4LFCL 4ZKBB 4KKUA 2JN4A 3NTHA 1ET9A 2RDFA 1MD2D 1YZ6A 5CORA 3HOWG 1O7ZA 1H9SB 3HOZB 3H0GH 3ERSX 4XIGS 1EY9A 3F8TA 5GAHC 2CH4W 2NB0A 4DU9A 3K7AB 3PSIA 4JC0A 2MO0A 2JA7B 4UAIA 4WJ4A 1SYDA 1HR0W 4KD3A 2EY5A 4L63B 3T1YQ 1Y1WB 2F0DA 3HKZG 5IWAQ 2L4NA 1ASZA 3R2IA 2OTLA 1Q82C 1ZXTA 4J6HA 2JQOA 2TSSA 4DXGA 1SDFA 3VR6A 2JA8G 4DUYL 2E5LQ 1WI5A 5JEAG 1SFOB 2VNUD 1VF5C 5LMUQ 4IFDG 4YIJA 1Q8IA 3KJPA 1X3GA 1KTKA 3QB3A 2KCMA 1CZGA 2NVTB 4X3KA 2JEAI 2ICIA 4DV0L 1K0RA 4LF4L 3L7ZC 1W2BA 2EPBA 3I7FA 4Z9CB 1VQ4A 1PA6A 3AFQA 4H13C 3A55A 5CMDA 2RVLA 2WIIB 1F2MA 1KC8C 4TSSA 5KNCA 1GOZA 4L5TA 3VA7A 1IHZA 3RLOA 3HOZH 4JI6L 2VXWA 1IKMA 3FVQA 2BE5C 4XTCS 1IBML 2XWJB 5KEEA 2DJFC 3GTKH 3CQZH 3G71A 1SAPA 3KF8B 3DUZA 2UUBQ 5CV4A 1IBKL 2MO1A 5C4JB 4GLVB 3AFPA 4DAYA 3FKIG 1PH6A 2PMZE 1YBYA 2A6EC 1KAAA 1AFPA 1TWHH 3E6ZX 5IT9L 4TRDA 4J15A 5EBCA 4OHJA 3N52A 3MEHA 1EWCA 4IJHA 5C44G 1LTSD 4BBSB 4A3FH 4EQNA 3RMHA 4JV5Q 1VQHA 1GD7A 1N33L 1NJIC 3S1MH 1G6ZA 4QQBX 3TQYA 2PYKA 1I4HA 4U673 2Q8IB 5C0XG 2E8GA 1SNDA 2F0QA 5D14A 3OOCA 4IPCA 5EAYA 2PI2E 4HJ7A 3I4MH 2VQEQ 5I2YA 1BBWA 4A3KH 1H95A 3A0JA 2F0JA 1SSOA 2MPMA 3H3VI 3SK8A 2R7DA 1V1PB 4DV2L 2B39A 2OQKA 1Q8KA 3NEMA 1DOLA 1FNVA 3CCEA 2YU9H 1HNXQ 3PF4A 4ME3A 3BVGA 4DR4Q 2AWOA 2OXPA 4KLKA 2E2HB 1BVSA 3ND9A 4QMGA 4DV6Q 4LF9Q 1STAA 2Z9HA 3QO2A 2YYZA 1EIHA 2L9HA 3U4VA 1YJWA 3CC7A 3RN2A 1XPUA 3CCUA 5K36H 1KABA 1V43A 1F9QA 1WD1A 4JYAL 2VL6A 2E2JH 3I73A 3K0YA 3MHBA 1S4ZA 3FKIB 4YHHL 1AE3A 1PZJD 3TEHB 3HOXH 1LLRD 4HIOA 5E7NA 5M3MB 2CFMA 1B53A 4K2LA 1DM0B 2YTYA 1SYEA 3OIPA 3I56A 4PZ8A 4MNOA 4DA2A 3SK5A 1TWHB 1FGBD 4RCOA 1WOCA 4C3HH 2E76C 4ABNA 3CRLC 2R92G 4A3DG 1OO9B 1RF2D 4DR3Q 4ZUJA 1IYVA 1IW7C 4C3JB 5C44B 3FPUB 1PXUA 3D6CA 3FHWA 1YNNC 2EJGC 3SK4A 1CHPD 3QG1A 1FNWA 2B3GA 2IW3A 4G4KA 4ODGA 5M3MH 4S3SA 2M2LA 4LMQD 5ELFA 4C1NI 1PHJA 1I4GA 1Q1EA 4JI3Q 2K03A 4L5SA 4BBRG 5EPLA 3I4MB 1TS2A 1V1PA 5EJWA 1RIPA 3RZOH 4LF5Q 1VMCA 2F0IA 1HFNA 4A3MH 2R7FA 2WB1G 3RLFA 4JI5Q 1DZ1A 4NB3A 3SE0A 1E0BA 4GOPB 1VQLA 4KJNA 3EBEA 3OHXC 3K5LA 3F2BA 2D2CC 2L0CA 3QOLA 1JJ2A 2BH2A 1CQVA 2X69A 4DN4M 1GM5A 1BUVT 3B6YA 4IURA 3CF5A 3PUWA 3IFDA 3E3XA 3J80E 1R9TB 5KYLA 4BXXG 5I2XA 1G6PA 1A2TA 1D7QA 1FGUA 3NUCA 4APVA 4HJAA 1DD2A 3GTMB 2NTSA 1HQMC 1D5XC 4JI8Q 4RH6A 3G48A 3NBHA 5BR8Q 4A3EH 4ID6A 5CV9A 4JBWA 3LNNA 3WDNA 4DR2L 2IWHA 1S5DD 2ZXPA 2OEOA 4YCVA 3UDXA 4HJ5A 2AWNA 2KENA 4GLXA 4B3SQ 1DYQA 5ELBA 4JBMA 3W3AA 2O4XA 2LS01 1F2LA 1Y1WG 1FL0A 3NBHB 4BS9A 1HNWL 2B2WC 2HIVA 1XNRQ 2WINB 3QJYA 2RHQB 4J8QA 1AN8A 4A3KG 1JICA 2HT1A 4B3SL 4JI2L 3I4MG 2JA6B 1RTOA 4BY1H 4IO9A 4HMJA 2OT2A 3CCRA 1YHQA 4V190 4GN4B 3A5UA 3KDFA 4KJOA 1FJGQ 4K5WA 1B7YB 3GTLH 1BCPC 2FMCA 4BA2I 4DK3C 2NYZD 2UUBL 3PIP3 1PFMA 4G7HC 2WKDA 4KHVA 1I4PA 5D3DA 1SROA 4GKKQ 4H7BA 4C3JG 1LTTD 2PO4A 2KHIA 3M4YA 5DEHA 3MVVA 4A3FG 3CC4A 5JAVA 3C46A 1I50B 2F0LA 1XMQL 4C3IH 1Q86C 1LTBD 4KMUC 1CKMA 1K83H 3S17B 3BJUA 3C1FA 3FKIH 4K5XA 1SE8A 2JJQA 3D4WA 3LX0A 1V8QA 4FXKC 1Y1VH 2IJ0A 2L12A 5A2QL 1PRTB 2QF7A 3QWNA 4A3EB 2EJFC 2N55A 5HGTA 3S1NB 3J7AV 1SMYC 3JAMi 2A69D 3GTPB 2NUCA 2BCOA 2QEJC 3KF8A 2MUYA 2HQLA 3U50C 4AH6A 3D0FA 1SXTA 5C0XH 1V1QA 1VQOA 2JA7G 3DM1A 4GN3B 5T1GA 3GV3A 3NENA 2OTJA 1T9HA 4MZ9A 1U4PA 2KEEA 3CW2C 1CKOA 3EVQA 5IIFA 5IWAL 4A3DB 3HG9A 2N3SA 3HKZE 5CV7A 4TKOB 1ESFA 1EYDA 2VW9A 5J1ZA 3RLNA 1XNQQ 4GKJL 4K6LA 1TWCB 4IFDH 5D65A 4H02A 4AYBE 5JPNC 4N8X1 1A62A 3OMCA 1J5EL 2OF1A 1Q81C 3S2DH 3PUZA 1MGSA 2B63G 4QB4A 4ZRZA 4RGOS 5E4XA 4HR7B 2QILA 3A8IE 4CGYB 4LFCQ 5KGUA 2PQAA 4LF6L 4IOAA 5FLMG 3BZCA 1SMXA 2VB2X 5JEAJ 4OWXB 4BXXH 2XSCA 1WTQA 3GTOH 1K3RA 2YU9B 2F0EA 2F03A 5GAEC 1CK1A 5G3LF 1VQ5A 1N34Q 5H1SE 4LUOA 4DV4Q 1HA6A 3KJOA 2B2TA 3K5OA 1U4LA 5J39A 3J81E 2GN5A 2K33A 2O5IC 4RA8A 2PCFB 3DWPA 1YJNA 1VQJA 3S15B 2EQSA 4DV1Q 1NMGA 4GNXA 1H9RA 1C4QA 5ISRA 2A1AA 2K52A 3J7YW 5ELEA 1CA5A 1A0IA 1EY8A 1T5EA 4C2MH 2JA8H 4F88A 3F2CA 2LY7A 1OXTA 2RKSA 1KLGD 2EXDA 2F4VL 1W3SA 3DHQA 3VR5A 4GS3A 4A3DH 1QVGA 2SOBA 1JQYD 2R92H 3UI2A 4OELB 1IBLL 1SYBA 2E2HH 4JI4L 2RCNA 3CCQA 4B3RL 1YNJC 3VYRA 5KRUA 3KYHC 2JA5G 4DR6L 3D6WA 3WWVA 1C0AA 2X6GA 1GUGA 2KJXA 5EKIA 3O13A 4B3TQ 4OL7A 2I0QA 4IUVA 1KDCA 2J7ZA 3S16B 3ND8A 1VQKA 3HKZB 5IGFA 4OO1H 3GTGH 3S17H 2F0UA 4E6IA 2NVTH 5DM63 4IPGA 4KY7A 3G6JB 4WFN3 1E1TA 3KF6A 1NTGA 3MEFA 2UXBQ 2I5MX 3CRKC 1ET6A 3S2HH 5CBEE 4OWWB 3H3VC 2UUCQ 3MXUA 2ALYB 4JK1C 4YHHQ 1QNKA 1E24A 1PYBA 4M8AA 1XXGA 2EYOA 2K05A 3J80L 3OTOQ 1ILPA 1JOQA 4FF1A 1C7YA 1AZQA 3EA6A 1BDOA 1B50A 1ZKOA 2JA6H 4HSVA 1QWYA 3MA2B 1TKWB 4C2MB 1D1IA 1M8AA 1EZ8A 3PIO3 5FO8B 2Q8RE 1PTOH 3L2PA 2B8GA 2IL8A 3K8AA 4A3IG 1FR3A 3ZYYX 1D5ZC 4KHZA 1R4PB 1EY6A 3K58A 1CSQA 5LHY1 1YNND 1NR2A 5C4HA 3Q6SA 1F9SA 3RN5A 3IL8A 5FLXE 1LABA 4DR5Q 4QUCA 1WTXA 1I94L 1BXTA 2A6HC 2KECA 3UDIA 2DNCA 2A8VA 4BY7B 1HCZA 5I6YA 2N8NA 3PV0A 1N36L 1JT8A 3H09A 4K0KL 2K5WA 5IYBH 1GHKA 5C0XJ 1D2BA 2WB1E 4LF7Q 2KHSA 2XTIA 3KOJA 1QUQA 4L8JA 4RGNA 4LF8Q 4KHPL 4IZ8A 1GHJA 2LXKA 3GTGB 3NQTA 2QDBA 2MP1A 1N32Q 3NXWA 1NAPA 1IBLQ 5C5MA 4X66L 4HCSA 3OYYA 2SNSA 4U68A 5KIXA 1XPRA 3TZUA 1ONLA 4IUPA 3I4OA 4O42A 1CKNA 3UE1A 1QVFA 3L3OC 4LF4Q 2UXCQ 2KA7A 1VS0A 5C4ZA 1IBKQ 3CXCA 1K73C 1ICFB 1EQVA 3C2PA 1STNA 3W1BA 1O80A 1F77A 4I7AA 4DGZA 5DM73 2UU9Q 1YNJD 3J7A5 2EJMA 1C9OA 5JEAH 4ZCKA 4A3BH 1EL0A 1YI2A 2F4IA 1PV4A 3V2TA 4EX5A 2ES2A 2RBMA 1XNRL 4JI4Q 3FRPB 4XQQA 4Q0FA 3T51B 4FO2A 2HCCA 4IQZA 3CHBD 5AJ3Q 2A74C 2EYLA 4C3IG 5JPMC 1PYWD 2IY5B 4DUZL 3DMUA 2R6GA 4QL5A 5EPJA 5J3BA 4XT1B 5M3FH 3RZOB 4CKEA 4GNXB 1BCPF 1PLFA 1BO0A 5IGEA 4EGVA 4R4TA 1A63A 2DUDA 2PZUA 1JB7A 4JI1Q 3ONAB 3Q8DA 4AYBG 4BY1G 3HOWH 1QG7A 1VQFA 1QNUA 4PMWA 4IJLA 4LJZC 2F0MA 1A15A 4G7ZC 4DR1Q 3KLSX 4JBJA 4OGQC 4A93H 4RKLA 2HDLA 5BN4A 4B3ML 1EZ6A 2RSNA 1X54A 3H91A 4CDEC 5AJ3L 5NUCA 4FF4A 1EY7A 1GKHA 1VQBA 5IT9E 3K6OA 2LXJA 5HY6A 2IX0A 4YCUA 3HOWB 3OPOA 4DNRB 1HFGA 3E9IA 1JOOA 1E1OA 2E75C 3R8BA 4L5QA 1HZAA 1PZID 4BBRB 3TP5A 3AB9A 1CT1D 3I4NB 3Q22A 1IW7D 4CBVA 2CKZB 3H3VH 5T1IA 3PO2B 5LL6S 5FO9B 3CMAA 1NMFA 4HTHA 3KF6B 1SNOA 2H5XA 4KY6A 4IUQA 2VUMB 2YTVA 1JE5A 5IP7G 4P73A 4X64Q 1AZPA 1HJPA 1Q7YC 5KNBA 3JAML 4YWMA 1EFID 4A3JB 1E2WA 1PH9A 1HUMA 4CJ0B 2Q8TA 4WRDA 4RMFA 5M5YH 4X64L 3C1EA 1E2VA 2BH8A 3CU7A 1SMYD 2A5HA 5EKKA 3IKJA 1YNXA 3S16H 2G5DA 3IFTA 4BWGB 4X65Q 2MNAA 3P20A 1XNQL 4KHPQ 3T56B 2SNMA 4KD4A 1N32L 3BYTB 3BVZA 4C3HG 4DNTB 2A6ED 2RCFA 5M5YB 4H44C 1PDQA 4TVAB 3WOFA 3VR2A 4OWTB 1S72A 4X6AH 2EYPA 4QJFA 1YIJA 1D6EC 1TWAB 4DAYB 5LL6X 4L5RC 1CZWA 3VDYA 1QZHA 4A4IA 3GTQB 2Z6BA 2A73B 2LSSA 4IUNA 3QR8A 3CCJA 1H9SA 4A3LH 1SE4A 1XWEA 4B9WA 2UXDL 2UUCL 4CJ1B 3I4NH 5K36G 2KCNA 1X3QA 2XRQD 2PNRC 4GNXC 1TWGB 4R8IA 5I6WA 3CPFA 2Q2HA 3A8JE 3EIVA 4BY7G 4B3RQ 1Y69U 3I2ZA 3TSSA 3K81C 3P75A 4CKBA 2E2JB 2FMMA 2A68D 4HN7A 3T1HL 4C3JH 2PW7A 4HJ8A 1FJGL 4NXNL 1EWHA 3RUZA 2ASBA 4XQNA 2K5NA 3D3RA 2Z4HA 1RODA 1E3PA 4A3GB 4H0LC 4A3JH 2AKWB 1STBA 5JJKA 1LT4D 1AEXA 2C35B 3EROA 1B9MA 1WYDA 1HA5A 1TS4A 5IGBA 5CYUA 3M7NA 1JORA 2VS1A 3RR5A 4JOIC 4UPAA 4DV5Q 1WCMH 4R4QA 3HOYB 3MZ5A 1LYLA 3PIOA 4O1NA 1QZGA 3EN2A 3KK7A 3VYTA 1PFBA 1DJRD 3K5NA 1KLUD 3E5SA 3NTIA 2BDNA 3L9AX 4GOPC 3PGZA 1Y1WH 5IOCA 1EQTA 1LTLA 5GROA 4JI7L 3VYSA 1B3QA 1PMRA 2K75A 1GXDC 3S1QB 4RHRA 1X6OA 4KN7C 3KBXA 5FO7B 1ZYRD 2PPBC 1PZKD 1BBXC 5FLXL 2D9UA 3AMUA 3TRZA 4FDBA 3D31A 2B2WA 1WTWA 2F0TA 2VQFQ 1YITA 4K2KA 1FD7D 2NZ1D 4DFAA 1MBYA 3NWTA 1ESRA 1B8AA 3AQQA 1NY4A 1SJED 5ELDA 4GZYC 5JJZA 1A3TA 2D0PA 4JOIA 5ELNA 2F0FA 2O2LD 2NWGA 1WTHA 1N9WA 1H9MA 4JYAQ 1TWAH 1HTPA 4P2CB 3NK9A 1SEBD 2IPKD 1TS3A 1X3EA 1JJCB 4A75A 3NSWA 1Y8NB 3TP8A 3UDFA 1HH2P 3K57A 3UDGA 4AIMA 1K83B 5IY0A 1JJGA 1QJOA 4KY5A 3GDEA 4Y7NH 1N36Q 2B2TC 1LTID 5M3FB 2K5HA 4WJWA 5HURA 4J1MA 3BZDB 1OTCA 2C9OA 4EVOA 2I5HA 2CWPA 4FVMA 5FJ8H 3U58A 3TBIB 3UE0A 5AFWA 4IOCA 1S5BD 2N49A 1F9RA 1L0YB 4FP5D 5FKAC 2ZJQA 4PMBA 5ELOA 1P16A 3Q23A 3A56A 3VA5A 2NN6G 2CW0C 1PH4A 2D62A 3SGIA 3TS0A 1PRTC 1EIGA 3RNUA 1WVLA 1MKHA 2N78A 1HNXL 3Q24A 3HOXG 1SYGA 2K01A 2XN9C 1F2ZA 1KDBA 3BVMA 2K32A 4IFDJ 4B9XA 4BBSG 5BR8L 1Y1VB 4JI8L 1BKBA 4NXMQ 5JJIA 3TDQA 1SBBB 2J0TD 2MFIA 1K8AC 1A3UA 2F0GA 4AYBB 5M5XH 3KBGA 1G2SA 3M7GA 4JV5L 4DV3Q 4EQ5A 4G7OC 2VY3A 1OXUA 4A3FB 1N33Q 1XMQQ 3EFXD 1GO3E 4GOPA 1WD0A 1VQ8A 1HNWQ 4DR6Q 2AUJD 4DF7A 5DLQE 2E2DC 3HP3A 1Z47A 3GTJB 1HR0L 2VUMH 4RGMA 3GTLB 1UNSA 4UHVA 1BQQT 1YVCA 2F3IA 3JAME 5C3EH 1KQSA 3HOVB 1K8OA 4BY1B 2PW5A 2ZTEA 1B1ZA 2XWBB 1WCMG 4RHSA 3CQZB 3S1RH 3HOYG 3J81L 2CQAA 3PF5A 1LV9A 5IYDH 4DNIA 4Y7NB 2GVAA 1I4QA 2LFNA 2M00A 1DOKA 2AQ1B 2OQ0A 2ZM6L 3BS1A 2E2IH 1DGSA 1K9MC 3K80C 5FOBB 2Q2UA 4DAVA 1HRJA 1LT6D 4QY7A 3ITPA 1HZBA 3W2DA 4DK6C 4Y52H 4KV6A 5M3FG 4OIKA 2A19A 2MQHA 4XXEA 1TT2A 3TMEA 3ER0A 1EY0A 5BN5A 4JBKA 5C44H 3BDOA 3I91A 2IX1A 1J9OA 2K5VA 3SR1A 2MHVA 3DLLA 1PTOD 5E1FA 3TN2A 3K7UC 2JSOA 2PZTA 2R92B 1NUCA 1VQIA 2EIFA 4I7ZC 3MXPA 5CV5A 1X56A 5JOBA 5IGDA 3CMEA 1WFQA 1O7YA 1GUNA 2TMPA 3I4NG 2F0PA 2EXZA 4YY3L 2B63B 4UP9A 5IODA 1IYJB 1AP0A 1CSPA 1CUKA 3ERQA 3G6EA 2FHTA 3CCLA 5DNFA 3SK6A 4OIJA 1PRTF 3HOZG 1WTVA 1PTOB 4XYQA 4F87A 2Z0SA 4N8FA 4RCNA 2R7ZH 2QGQA 4DR1L 1RL2A 2NVXH 3M3YB 1S5CD 1EWIA 4PG3A 4DV0Q 1TWFB 3ULLA 4GKJQ 1U9RA 3E0EA 4KN4C 3Q0AA 4V0BA 4CHTB 5C5LA 4LF5L 3S9WA 1MSHA 3L0OA 1ZYRC 2JP1A 1XPOA 3S1MB 3J80i 1HNZQ 4NMZA 2QEXA 1UWVA 3CAMA 3IAYA 4A3BB 3MFGA 1LT3D 4HIMA 3LWUA 3PCOB 2M9VA 4LW1A 1VDZA 4K0KQ 5LMNQ 2JYOA 1A8VA 1KNAA 1SJHD 2PI2A 3I3CA 4NXML 1GJXA 3RZDB 2R93H 2BE5D 2CVRA 5HGQA 3AU7A 1HQRD 4I65A 1H9JA 4K8JA 4DR5L 4R8NA 4AQYQ 2KOLA 3M4OB 4A3MB 4IALA 3SXHA 3R93A 2KVMA 1IKLA 2F1MA 1T5XD 1W6KA 1RHPA 2SEBD 2XGTA 2EE1A 4OX9Q 1UE7A 2X6LA 1HPCA 2ZT9C 5IYDG 5IGCA 3DWAA 3OW2A 3HOYH 2UXDQ 3H6MA 2WB1B 2JA6G 3GV6A 4TQUS 1TR5A 2FXQA 3OSOA 1I4RA 1A6XA 1FVIA 2DJGC 3JAMc 2B2VC 3GTJH 5C4XG 2H1EA 3R2TA 4N9PA 4QCLA 1B3AA 2BOSA 1EOTA 1PH2A 1R4QB 2ID0A 4A3CG 5I4DA 1XYIA 3BYYB 4DR4L 1O7LA 3P1HA 2EZVA 1WTPA 2EYMA 5IP9H 4X3UA 1B44D 2K7VA 5GADC 2HIXA 4LFAL 4A3IB 2CQOA 1TWFH 1JWUD 2ICEC 1GUWA 3S15H 3HGBA 2VQEL 5G3LD 1K8MA 3NTKA 3PMFA 4PZ7A 4LFBQ 1C48A 1LTAD 3BDLA 1XX8A 1Q1BA 2ATWA 4P72A 2Z6KA 3VR3A 1QCBD 1Y14B 1B2TA 2JA5H 3KLRA 1L2FA 4ZLTF 3HS0C 4MHEA 2I07B 2HHHL 1OXSC 1YHBA 1NBWA 4JI2Q 1SYCA 2SDFA 1R9TH 2B2YC 4IUUA 4KTAA 4DUYQ 2E5LL 1N8RC 2ENBA 3OWEB 1IYUA 1XJVA 4A3GH 4POFA 4HIDA 2IX3A 4XQJA 2KEDA 2L1BA 5J22A 2Q2TA 4KI0A 4ALPA 4ZQ3A 2WFWA 3PUXA 4YWKA 3OTOL 1I6HB 3M4PA 5CR3A 4PNYA 1I6VC 5COYA 1X55A 2F0VA 5C4XH 1NE3A 2Y0SE 4DK1A 3T53B 1SR3A 3VYUA 2RQXA 1TWGH 1VQEA 3CCMA 3J7AF 4GN5A 5CC4A 2F0HA 2EYJA 1IL8A 1W6JA 1VMPA 3K5MA 3M9BA 4O0AA 1MJCA 4CJ2C 5A35A 1JE4A 4HJ9A 1VCIA 1G2TA 2DNEA 2FINB 1XTDA 4JI7Q 5BN3A 3I72A 1PVOA 1VQ6A 3HOVG 4ZK9B 3HEJA 1I3QB 1IZ6A 2NVQH 3PQIA 1Q90A 2KBNA 3TP7A 5IYBG 2B2UA 4KK7A 3KDFB 3J81j 3S24A 2QKIC 4CKCA 1CKNB 3PO3B 2JA9A 1DOMA 1PH5A 3GQBA 2ZXOA 3H94A 1EYAA 5KNDA 4C3IB 3NHHA 3X3NA 5C4XB 3OIQA 3T1YL 3S1RB 2DN8A 3GP7A 2NBFA 3S1QH 1VQGA 4JI5L 4PZ6A 3FPPA 1CHQD 1J5EQ 3TREA 1G51A 1KDAA 3GD7A 2DY7A 4C56C 1BCPB 3NELA 5LMUL 5EGTA 2I46A 2K14A 4FXDA 1QE6A 1RD9D 5JVG3 1G91A 3GO5A 1K3BC 3STBC 2JA5B 2RDGA 2ZTCA 4K6DA 1Z9FA 1Q12A 4IPHA 4OX9L 2QW7A 2FFKB 1PYSB 2ZJRA 4A3KB 3NQIA 4MTKA 3S1NH 3D8GA 2PQAB 1SLJA 2F0WA 2C5CA 4XDXA 1EYGA 3K7AH 1VQDA 4PV1C 1HHVA 1JC7A 2XRSD 5JJLA 1ZEQX 2F3WA 1WTOA 2IHFA 4R9WA 1I6HH 1PH7A 1L1OC 3PO3H 2WV6D 3FMCA 2HQEA 2B2YA 5TSSA 1CA6A 1VQAA 4OO1G 1EEFD 3EJIA 1Z7TA 1S40A 2NVQB 3MFYA 4BBSH 3T13A 2Y0SG 4JPBW 2NZOA 4RAUC 2XIWA 4FF3A 1HTLD 3CCSA 1X9NA 1STGA 4A93B 3HZXA 3MXGA 3G7LA 5DAUA 3NE5B 3OW7A 3FP9A 1SYFA 4OO1I 2ZTDA 2CH4A 1EQRA 4QF4A 3SDZA 1EU3A 5LMNL 5C3EG 1Y8OB 2K5QA 1EEID 4R1JA 1ENCA 4JG2A 2QDLA 1U4RA 2V1CC 4JW0A 3M85A 2RDHA 1B70B 1I50H 4OEMB 4A3EG 2MJ8A 3TS2A 1JWSD 2N88A 5CV6A 1ICWA 5JVH3 5L37A 4A3CH 1RJTA 5E4WC 1EY5A 1JWMD 4NXNQ 2NN6I 1BCPD 1SNPA 4C3HB 2CHBD 1EQQA 4LFBL 4LNQA 4POGA 2HDMA 2D0OA 2AMCB 5IT9c 3ULPA 4JI0L 1CFMA 4OONA 4JI6Q 1EYCA 3U9SA 1U0LA 1K8GA 2F0NA 2HHHQ 4LF6Q 1O78A 1E22A 3K0XA 2IHEA 1RCVD 2BA0A 3V05A 4LF7L 1VQMA 2VB3X 4FF2A 3LWEA 4HCEA 4ZKCB 2AHOB 2F0SA 2Y0SB 3LGJA 3PIPA 4BBRH 2F0OA 2HCIA 5FLMH 3QIAA 4DV4L 4F7XA 5FLXc 1PH1A 4HMIA 3QOJA 2ZJPA 1GUTA 1YJ9A 4LFAQ 4F8MA 4FNFA 5M3MG 1HR0Q 4P71A 1II3A 3SHLA 4DV1L 4JCVE 2WP8J 3S14B 3W1GA 4Q5VA 3KLSA 2B63H 1CI3M 3J7ZC 4K5VA 3I55A 1D8LA 2EOTA 2G9DA 4NP5A 1NNXA 4QUFA 1H9KA 4DR3L 1TIID 1N34L 5EPKA 2FJ2A 1UE5A 2WAQE 4X66Q 2G9HD 5ELCA 3NBIA 2V4DA 4QGUA 1D1KA 5M9OA 3KUPA 2JA7H 1PFNA 4UDUC 4IN3A 3J81i 1LTGD 2R7ZG 5KYIA 1M4VA 1VQ9A 2EY1A
chains in the Genus database with same CATH topology
2OQ0A 3K8AA 4L5TA 2ZM6L 4A3IG 3RLOA 2E2IH 1HZ9A 1DGSA 1K9MC 3HOZH 4KHZA 3K80C 4JI6L 2Q2UA 5M5WH 1CSQA 4QY7A 4DK6C 1HZBA 4Y52H 1GVPA 4XTCS 5M3FG 2A19A 2MQHA 1WJJA 1IBML 1VQ7A 3GTKH 3CQZH 3RN5A 3G71A 3ER0A 4JBKA 3KF8B 5C44H 4DR5Q 2UUBQ 4X65L 1IBKL 2MO1A 2IX1A 2RF4A 2K5VA 4GLVB 3DLLA 2L15A 3AFPA 1KXLA 5IYCH 3BU2A 1I94L 3K7UC 3FKIG 4AQYL 1PH6A 2PMZE 4NPSA 1YBYA 3RZDH 1VQIA 2EIFA 3UDIA 5IYCG 1TWHH 2A8VA 1X56A 1SRUA 1HZCA 4J15A 2N8NA 3PV0A 1N36L 3CMEA 1JT8A 1WFQA 3STBD 4K0KL 5IYBH 5C44G 4IJHA 3I4NG 4YY3L 5C0XJ 4A3FH 3G4SA 4JV5Q 4A3LG 3AYHB 1EOVA 1VQHA 1GD7A 2WB1E 4UP9A 4LF7Q 2OCEA 1IYJB 1N33L 1CSPA 1CUKA 1QUQA 2XTIA 3KOJA 4P74A 1NJIC 4LF8Q 3G6EA 3CCLA 3S1MH 4KHPL 1MJEA 4QQBX 1ASYA 2LXKA 3HOZG 3TQYA 3IRBA 1N32Q 2Z0SA 2R7ZH 5C0XG 1IBLQ 2E8GA 2QGQA 2PNHA 4DR1L 4X66L 1RL2A 2NVXH 4PG3A 1EWIA 4IPCA 5EAYA 3OYYA 2PI2E 4HJ7A 4DV0Q 4A3JG 1UE6A 1XPRA 1EFWA 2VQEQ 3I4MH 1BBWA 3KLWA 3ULLA 3I4OA 3E0EA 1CKNA 3UE1A 1QVFA 4A3KH 4LF5L 3GTMH 4LF4Q 4GKJQ 2UXCQ 3A0JA 1H95A 2Z6KC 3L0OA 1VS0A 1IBKQ 3CXCA 1K73C 1XPOA 3W1BA 3H3VI 3J80i 2K50A 2R7DA 4DV2L 1HNZQ 2VUMG 1EUJA 2OQKA 3E9HA 1OXVA 1Q8KA 3NEMA 2WAQG 2QEXA 3CCEA 2YU9H 1HNXQ 3PF4A 1UWVA 4ME3A 3CAMA 4DR4Q 2UU9Q 2AWOA 3A74A 4HIMA 3PCOB 4YY3Q 1PH8A 3J7A5 1YEZA 4KLKA 2UXBL 1BVSA 1C9OA 4LW1A 4K0KQ 4A3BH 3DM3A 4DV6Q 4LF9Q 5LMNQ 1YI2A 1PV4A 4EX5A 2CCZA 1G291 3M4QA 2ES2A 4BY7H 1A8VA 1XNRL 4NXML 2PI2A 2YYZA 4JI4Q 2R93H 4GKKL 3U4VA 1YJWA 2Q2IA 3CC7A 5HGQA 5AJ3Q 3RN2A 1XPUA 3CCUA 1PFSA 2JK8A 2IY5B 4DUZL 4DR5L 4MTNA 4AQYQ 2GVBA 2R6GA 4R4OA 1V43A 4QL5A 5J3BA 4JYAL 2VL6A 2E2JH 1UE1A 5M3FH 4GNXB 2VZAA 4R4TA 2XGTA 3A5ZB 2DUDA 1A63A 4A3IH 4YHHL 4DV5L 1AE3A 3TEHB 1LM0A 3HOXH 4OX9Q 1UE7A 4HIOA 5E7NA 1HNZL 1JB7A 5IYDG 4JI1Q 3Q8DA 4AYBG 1IXRA 2CFMA 4BY1G 4LF8L 3HOWH 1Q46A 1VQFA 3OW2A 3HOYH 2UXDQ 2YTYA 4DAMA 2JA6G 4PMWA 3I56A 4A3MG 4IJLA 4PZ8A 4MNOA 4TQUS 2FXQA 4DR1Q 4JBJA 2F4VQ 1FVIA 1WOCA 4A93H 4C3HH 4B3TL 1EIYB 2R92G 3JAMc 3GTJH 4B3ML 4A3DG 5C4XG 4DR3Q 1X54A 5FJ8G 5AJ3L 1GKHA 1PH2A 2ID0A 4DV7Q 4A3CG 1VQBA 2LXJA 3FHWA 5HY6A 4DR4L 2B3GA 2IX0A 4YCUA 5M3MH 5IP9H 1M1KC 4R4CA 5GADC 3E9IA 2HIXA 1PHJA 3U4ZA 4LFAL 1E1OA 4OXPA 4X62L 4A93G 1Q1EA 2CQOA 4L5QA 4YCWA 1HZAA 1KD1C 4JI3Q 4L5SA 4BBRG 1TWFH 1KIXA 3S15H 2VQEL 1RIPA 3RZOH 4LF5Q 2CKZB 2KCTA 4A3MH 2R7FA 2WB1G 4PZ7A 3RLFA 3H3VH 4LFBQ 4JI5Q 1L1OB 5IP7H 4NB3A 4GOPB 1VQLA 3JC66 3CMAA 2DGYA 1NMFA 4UP8A 4HIKA 3EBEA 2IT1A 4QIWE 3KF6B 1Q1BA 2ATWA 4P72A 4R4IA 2Z6KA 2H5XA 3F2BA 2YTVA 1JJ2A 1Y14B 2BH2A 1JE5A 5IP7G 4P73A 2JA5H 1L2FA 1GM5A 4UP7A 3B6YA 4X64Q 2HHHL 3CF5A 1HJPA 1OXSC 3PUWA 2OWOA 1EIFA 1Q7YC 1YHBA 1NBWA 4A76A 4JI2Q 1R9TH 4DV3L 4BXXG 4YWMA 4DUYQ 2E5LL 1G6PA 1N8RC 2KHJA 1XJVA 1PH9A 4A3GH 3CP0A 4POFA 4HIDA 5IE8A 1D7QA 1FGUA 2I5LX 4APVA 4HJAA 5C0XI 2Q2TA 4KI0A 4ALPA 1MIUA 4RMFA 5M5YH 5IP9G 4X64L 2WFWA 3CC2A 3PO3G 2BH8A 3PUXA 4YWKA 3OTOL 3M4PA 2YV5A 4JI8Q 3G48A 1YNXA 3S16H 5BR8Q 4A3EH 3M3YH 4JBWA 4X65Q 2MNAA 4DR2L 1VQNA 1X55A 1XNQL 4KHPQ 5C4XH 1N32L 1NE3A 2Y0SE 4GLAC 3CCVA 4YCVA 3UDXA 3J80c 4HJ5A 4DR7L 2AWNA 2K4KA 2KENA 4GLXA 4B3SQ 1SR3A 3F2DA 4JBMA 1Y1WG 2CWAA 1TWGH 1FL0A 2JE6I 3NBHB 4RG1A 1HNWL 1XNRQ 2HIVA 1VQEA 3CCMA 2RHQB 4TVAB 4GN5A 2F52A 4A3KG 4OWTB 1S72A 2YTXA 2HT1A 4B3SL 4JI2L 3I4MG 1VQPA 4X6AH 3M9BA 1I3QH 4QJFA 4DR7Q 4O0AA 1YIJA 3KFUA 1LUZA 1MJCA 1JMCA 4BY1H 4DAYB 4IO9A 3CCRA 4HJ9A 1YHQA 4GN4B 3A5UA 5LMNW 1VCIA 3KDFA 4DV2Q 1FJGQ 4L5RC 1SN8A 1B7YB 3J81c 3GTQH 3ICEA 1XTDA 3VDYA 1QZHA 4JI7Q 4A4IA 3GTLH 4LWCA 3W5OA 4BA2I 4DK3C 1KL9A 2UUBL 2LSSA 1PVOA 1L0WA 4DPGA 1VQ6A 3HOVG 1SROA 3CCJA 4DV6L 1SFOH 4LF9L 4GKKQ 3PO2H 4A3LH 1IZ6A 2KHIA 2NVQH 4A3FG 1I5FA 3BZKA 3CC4A 2UXDL 2UUCL 2KBNA 5IYBG 3I4NH 5K36G 1L1OA 1XMQL 4C3IH 4GNXC 1BBUA 3KDFB 3J81j 1Q86C 3S24A 1CKNB 2R93G 2BA1A 2JA9A 1CKMA 1K83H 2VQFL 3BJUA 3CPFA 2Q2HA 3EIVA 3FKIH 1PH5A 1SE8A 4BY7G 2JJQA 4IFDI 4B3RQ 1PH3A 4A3BG 1Y1VH 3I2ZA 4P75A 3K81C 3T1YL 4O2DA 1KRTA 4DV7L 3S1QH 1VQGA 4JI5L 4PZ6A 3T1HL 1J5EQ 1O7IA 4C3JH 3TREA 3JAMi 4HJ8A 1FJGL 3HOVH 3PUVA 1G51A 3GD7A 4NXNL 2JEBI 2ASBA 2K5NA 4DUZQ 2HQLA 1X3FA 1E3PA 3U50C 4X62Q 2UUAL 3NELA 5LMUL 1XMOL 4A3JH 2AKWB 2K14A 4AH6A 5JJKA 4IPDA 3D0FA 2C35B 1KRSA 1WYDA 2QA4A 1V1QA 4JI3L 3M7NA 1KHIA 1VQOA 3GO5A 2JA7G 2VS1A 4GN3B 3RR5A 4JOIC 4UPAA 3NENA 4DV5Q 1WCMH 4R4QA 1T9HA 3STBC 3S14H 2OTJA 1LYLA 2ZTCA 4MZ9A 1YHAA 3PIOA 1QZGA 1Z9FA 1Q12A 3CW2C 1CKOA 3EN2A 4IPHA 5IWAL 4OX9L 2N3SA 3HKZE 1XMOQ 4GOPC 3PGZA 3GTPH 1Y1WH 2ZJRA 1PYSB 2VW9A 3S1NH 1LTLA 1OXXK 2PQAB 1SLJA 5GROA 3RLNA 4JI7L 1XNQQ 4GKJL 2K75A 1P8LA 1QUQB 1EYGA 3K7AH 1VQDA 4LUVA 4H02A 4AYBE 1Y1VG 5JJLA 1A62A 1TWCH 1J5EL 1IBMQ 2IHFA 1Q81C 3S2DH 1J6QA 1X6OA 3PUZA 2B63G 1I6HH 1PH7A 1L1OC 3PO3H 3HKSA 2B29A 3TRZA 4FDBA 4DKAC 3D31A 4JI0Q 4LFCQ 2PQAA 2UU9L 4LF6L 1VQAA 1TXYA 4OO1G 4WJ3M 2VQFQ 2RHSB 1YITA 3H15A 4IOAA 1S40A 4A3GG 5FLMG 2UUAQ 3BZCA 1AE2A 1SMXA 3PO2G 4BBSH 5JEAJ 1S3OA 4OWXB 4BXXH 2Y0SG 4UY8C 2NZOA 3GTOH 1K3RA 1B8AA 3CCSA 2NZHA 1X9NA 3AQQA 3F1ZA 5GAEC 1NY4A 1X65A 1KAWA 2D0PA 3H0GG 4JOIA 5ELNA 3ULJA 5GAGC 1VQ5A 1N34Q 5H1SE 4LUOA 3HFZB 1N9WA 4DV4Q 1IL2A 3FP9A 3T1HQ 4JYAQ 1TWAH 3KJOA 1UEBA 4OO1I 2GN5A 4LUZA 2ZTDA 3CPWA 1EQRA 1X3EA 1JJCB 4A75A 5LMNL 1YJNA 1VQJA 5C3EG 3UDFA 4JI1L 1QVCA 1HH2P 1V9PA 2EQSA 4R1JA 4DV1Q 1NMGA 4GNXA 3UDGA 1U5KA 2A1AA 2K52A 4JG2A 4AIMA 5IY0A 2ZM6Q 1JJGA 3AEVA 3GDEA 3PUYA 1AH9A 4Y7NH 2V1CC 1A0IA 4DR2Q 1N36Q 3M85A 1E7ZA 4C2MH 1B70B 1I50H 4A3EG 2UXCL 3TS2A 2K5HA 4YWLA 2JA8H 2NVYH 3F2CA 3HOUG 3MXNB 3HOUH 1OXTA 3ZJYC 3M4OH 3CD6A 4A3CH 1OTCA 2EXDA 2F4VL 4NXNQ 2I5HA 1W3SA 2CWPA 2NN6I 5FJ8H 3UE0A 3U58A 4BA1I 4GS3A 4B3MQ 4IOCA 1QVGA 4A3DH 1I94Q 2R92H 5GQOA 1EQQA 1M90C 4LFBL 2N49A 4LNQA 2ZJQA 4POGA 5C4JH 5ELOA 2D0OA 1P16A 2AMCB 1IBLL 1VQCA 2NN6G 5IT9c 3ULPA 2E2HH 4LFCL 2RCNA 4JI0L 1PH4A 3CCQA 4JI4L 4OONA 4B3RL 4JI6Q 2D62A 1U0LA 3SGIA 3KYHC 3TS0A 1K8GA 2JA5G 2HHHQ 4DR6L 3RNUA 3WWVA 4LF6Q 1C0AA 1E22A 1YZ6A 3K0XA 1MKHA 3HOWG 2N78A 1HNXL 2IHEA 4LF7L 2BA0A 3H0GH 1VQMA 3HOXG 3ERSX 4XIGS 4B3TQ 2AHOB 3F8TA 5GAHC 2I0QA 3LGJA 3PIPA 3PSIA 4JC0A 2MO0A 4IFDJ 4BBRH 4BBSG 5BR8L 4WJ4A 1HR0W 5FLMH 4JI8L 4DV4L 1BKBA 4NXMQ 1VQKA 5JJIA 3GTGH 5FLXc 3T1YQ 2MFIA 1PH1A 3HKZG 2ZJPA 1YJ9A 1K8AC 3S17H 4LFAQ 5IWAQ 1ASZA 5M3MG 1HR0Q 2NVTH 4P71A 2OTLA 1Q82C 5M5XH 4JCVE 4IPGA 4DV1L 2WP8J 2JQOA 3W1GA 1E1TA 2B63H 4JV5L 4DV3Q 4EQ5A 3KF6A 2VY3A 1OXUA 3J7ZC 1NTGA 4DUYL 2E5LQ 3MEFA 2JA8G 2UXBQ 1WI5A 1N33Q 2I5MX 5JEAG 1XMQQ 1HNWQ 1GO3E 3I55A 1D8LA 4GOPA 1VQ8A 3S2HH 4OWWB 4DR6Q 2VNUD 5LMUQ 2UUCQ 2ALYB 4IFDG 5DLQE 3KJPA 1X3GA 4DR3L 1Z47A 4YHHQ 1N34L 2KCMA 1HR0L 1E24A 1PYBA 2VUMH 2JEAI 1UE5A 3OTOQ 4DV0L 2WAQE 1K0RA 4X66Q 1C7YA 2F3IA 1YVCA 5C3EH 1KQSA 4LF4L 3L7ZC 1W2BA 2ZTEA 4QGUA 1WCMG 3I7FA 2JA6H 2JA7H 3S1RH 1VQ4A 1PA6A 3AFQA 3HOYG 3J81i 3PF5A 5IYDH 2R7ZG 4DNIA 2GVAA 3L2PA 1KC8C 1VQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQ0 A;  3K8A A;  4L5T A;  2ZM6 L;  4A3I G;  3RLO A;  2E2I H;  1HZ9 A;  1DGS A;  1K9M C;  3HOZ H;  4KHZ A;  3K80 C;  4JI6 L;  2Q2U A;  5M5W H;  1CSQ A;  4QY7 A;  4DK6 C;  1HZB A;  4Y52 H;  1GVP A;  4XTC S;  5M3F G;  2A19 A;  2MQH A;  1WJJ A;  1IBM L;  1VQ7 A;  3GTK H;  3CQZ H;  3RN5 A;  3G71 A;  3ER0 A;  4JBK A;  3KF8 B;  5C44 H;  4DR5 Q;  2UUB Q;  4X65 L;  1IBK L;  2MO1 A;  2IX1 A;  2RF4 A;  2K5V A;  4GLV B;  3DLL A;  2L15 A;  3AFP A;  1KXL A;  5IYC H;  3BU2 A;  1I94 L;  3K7U C;  3FKI G;  4AQY L;  1PH6 A;  2PMZ E;  4NPS A;  1YBY A;  3RZD H;  1VQI A;  2EIF A;  3UDI A;  5IYC G;  1TWH H;  2A8V A;  1X56 A;  1SRU A;  1HZC A;  4J15 A;  2N8N A;  3PV0 A;  1N36 L;  3CME A;  1JT8 A;  1WFQ A;  3STB D;  4K0K L;  5IYB H;  5C44 G;  4IJH A;  3I4N G;  4YY3 L;  5C0X J;  4A3F H;  3G4S A;  4JV5 Q;  4A3L G;  3AYH B;  1EOV A;  1VQH A;  1GD7 A;  2WB1 E;  4UP9 A;  4LF7 Q;  2OCE A;  1IYJ B;  1N33 L;  1CSP A;  1CUK A;  1QUQ A;  2XTI A;  3KOJ A;  4P74 A;  1NJI C;  4LF8 Q;  3G6E A;  3CCL A;  3S1M H;  4KHP L;  1MJE A;  4QQB X;  1ASY A;  2LXK A;  3HOZ G;  3TQY A;  3IRB A;  1N32 Q;  2Z0S A;  2R7Z H;  5C0X G;  1IBL Q;  2E8G A;  2QGQ A;  2PNH A;  4DR1 L;  4X66 L;  1RL2 A;  2NVX H;  4PG3 A;  1EWI A;  4IPC A;  5EAY A;  3OYY A;  2PI2 E;  4HJ7 A;  4DV0 Q;  4A3J G;  1UE6 A;  1XPR A;  1EFW A;  2VQE Q;  3I4M H;  1BBW A;  3KLW A;  3ULL A;  3I4O A;  3E0E A;  1CKN A;  3UE1 A;  1QVF A;  4A3K H;  4LF5 L;  3GTM H;  4LF4 Q;  4GKJ Q;  2UXC Q;  3A0J A;  1H95 A;  2Z6K C;  3L0O A;  1VS0 A;  1IBK Q;  3CXC A;  1K73 C;  1XPO A;  3W1B A;  3H3V I;  3J80 i;  2K50 A;  2R7D A;  4DV2 L;  1HNZ Q;  2VUM G;  1EUJ A;  2OQK A;  3E9H A;  1OXV A;  1Q8K A;  3NEM A;  2WAQ G;  2QEX A;  3CCE A;  2YU9 H;  1HNX Q;  3PF4 A;  1UWV A;  4ME3 A;  3CAM A;  4DR4 Q;  2UU9 Q;  2AWO A;  3A74 A;  4HIM A;  3PCO B;  4YY3 Q;  1PH8 A;  3J7A 5;  1YEZ A;  4KLK A;  2UXB L;  1BVS A;  1C9O A;  4LW1 A;  4K0K Q;  4A3B H;  3DM3 A;  4DV6 Q;  4LF9 Q;  5LMN Q;  1YI2 A;  1PV4 A;  4EX5 A;  2CCZ A;  1G29 1;  3M4Q A;  2ES2 A;  4BY7 H;  1A8V A;  1XNR L;  4NXM L;  2PI2 A;  2YYZ A;  4JI4 Q;  2R93 H;  4GKK L;  3U4V A;  1YJW A;  2Q2I A;  3CC7 A;  5HGQ A;  5AJ3 Q;  3RN2 A;  1XPU A;  3CCU A;  1PFS A;  2JK8 A;  2IY5 B;  4DUZ L;  4DR5 L;  4MTN A;  4AQY Q;  2GVB A;  2R6G A;  4R4O A;  1V43 A;  4QL5 A;  5J3B A;  4JYA L;  2VL6 A;  2E2J H;  1UE1 A;  5M3F H;  4GNX B;  2VZA A;  4R4T A;  2XGT A;  3A5Z B;  2DUD A;  1A63 A;  4A3I H;  4YHH L;  4DV5 L;  1AE3 A;  3TEH B;  1LM0 A;  3HOX H;  4OX9 Q;  1UE7 A;  4HIO A;  5E7N A;  1HNZ L;  1JB7 A;  5IYD G;  4JI1 Q;  3Q8D A;  4AYB G;  1IXR A;  2CFM A;  4BY1 G;  4LF8 L;  3HOW H;  1Q46 A;  1VQF A;  3OW2 A;  3HOY H;  2UXD Q;  2YTY A;  4DAM A;  2JA6 G;  4PMW A;  3I56 A;  4A3M G;  4IJL A;  4PZ8 A;  4MNO A;  4TQU S;  2FXQ A;  4DR1 Q;  4JBJ A;  2F4V Q;  1FVI A;  1WOC A;  4A93 H;  4C3H H;  4B3T L;  1EIY B;  2R92 G;  3JAM c;  3GTJ H;  4B3M L;  4A3D G;  5C4X G;  4DR3 Q;  1X54 A;  5FJ8 G;  5AJ3 L;  1GKH A;  1PH2 A;  2ID0 A;  4DV7 Q;  4A3C G;  1VQB A;  2LXJ A;  3FHW A;  5HY6 A;  4DR4 L;  2B3G A;  2IX0 A;  4YCU A;  5M3M H;  5IP9 H;  1M1K C;  4R4C A;  5GAD C;  3E9I A;  2HIX A;  1PHJ A;  3U4Z A;  4LFA L;  1E1O A;  4OXP A;  4X62 L;  4A93 G;  1Q1E A;  2CQO A;  4L5Q A;  4YCW A;  1HZA A;  1KD1 C;  4JI3 Q;  4L5S A;  4BBR G;  1TWF H;  1KIX A;  3S15 H;  2VQE L;  1RIP A;  3RZO H;  4LF5 Q;  2CKZ B;  2KCT A;  4A3M H;  2R7F A;  2WB1 G;  4PZ7 A;  3RLF A;  3H3V H;  4LFB Q;  4JI5 Q;  1L1O B;  5IP7 H;  4NB3 A;  4GOP B;  1VQL A;  3JC6 6;  3CMA A;  2DGY A;  1NMF A;  4UP8 A;  4HIK A;  3EBE A;  2IT1 A;  4QIW E;  3KF6 B;  1Q1B A;  2ATW A;  4P72 A;  4R4I A;  2Z6K A;  2H5X A;  3F2B A;  2YTV A;  1JJ2 A;  1Y14 B;  2BH2 A;  1JE5 A;  5IP7 G;  4P73 A;  2JA5 H;  1L2F A;  1GM5 A;  4UP7 A;  3B6Y A;  4X64 Q;  2HHH L;  3CF5 A;  1HJP A;  1OXS C;  3PUW A;  2OWO A;  1EIF A;  1Q7Y C;  1YHB A;  1NBW A;  4A76 A;  4JI2 Q;  1R9T H;  4DV3 L;  4BXX G;  4YWM A;  4DUY Q;  2E5L L;  1G6P A;  1N8R C;  2KHJ A;  1XJV A;  1PH9 A;  4A3G H;  3CP0 A;  4POF A;  4HID A;  5IE8 A;  1D7Q A;  1FGU A;  2I5L X;  4APV A;  4HJA A;  5C0X I;  2Q2T A;  4KI0 A;  4ALP A;  1MIU A;  4RMF A;  5M5Y H;  5IP9 G;  4X64 L;  2WFW A;  3CC2 A;  3PO3 G;  2BH8 A;  3PUX A;  4YWK A;  3OTO L;  3M4P A;  2YV5 A;  4JI8 Q;  3G48 A;  1YNX A;  3S16 H;  5BR8 Q;  4A3E H;  3M3Y H;  4JBW A;  4X65 Q;  2MNA A;  4DR2 L;  1VQN A;  1X55 A;  1XNQ L;  4KHP Q;  5C4X H;  1N32 L;  1NE3 A;  2Y0S E;  4GLA C;  3CCV A;  4YCV A;  3UDX A;  3J80 c;  4HJ5 A;  4DR7 L;  2AWN A;  2K4K A;  2KEN A;  4GLX A;  4B3S Q;  1SR3 A;  3F2D A;  4JBM A;  1Y1W G;  2CWA A;  1TWG H;  1FL0 A;  2JE6 I;  3NBH B;  4RG1 A;  1HNW L;  1XNR Q;  2HIV A;  1VQE A;  3CCM A;  2RHQ B;  4TVA B;  4GN5 A;  2F52 A;  4A3K G;  4OWT B;  1S72 A;  2YTX A;  2HT1 A;  4B3S L;  4JI2 L;  3I4M G;  1VQP A;  4X6A H;  3M9B A;  1I3Q H;  4QJF A;  4DR7 Q;  4O0A A;  1YIJ A;  3KFU A;  1LUZ A;  1MJC A;  1JMC A;  4BY1 H;  4DAY B;  4IO9 A;  3CCR A;  4HJ9 A;  1YHQ A;  4GN4 B;  3A5U A;  5LMN W;  1VCI A;  3KDF A;  4DV2 Q;  1FJG Q;  4L5R C;  1SN8 A;  1B7Y B;  3J81 c;  3GTQ H;  3ICE A;  1XTD A;  3VDY A;  1QZH A;  4JI7 Q;  4A4I A;  3GTL H;  4LWC A;  3W5O A;  4BA2 I;  4DK3 C;  1KL9 A;  2UUB L;  2LSS A;  1PVO A;  1L0W A;  4DPG A;  1VQ6 A;  3HOV G;  1SRO A;  3CCJ A;  4DV6 L;  1SFO H;  4LF9 L;  4GKK Q;  3PO2 H;  4A3L H;  1IZ6 A;  2KHI A;  2NVQ H;  4A3F G;  1I5F A;  3BZK A;  3CC4 A;  2UXD L;  2UUC L;  2KBN A;  5IYB G;  3I4N H;  5K36 G;  1L1O A;  1XMQ L;  4C3I H;  4GNX C;  1BBU A;  3KDF B;  3J81 j;  1Q86 C;  3S24 A;  1CKN B;  2R93 G;  2BA1 A;  2JA9 A;  1CKM A;  1K83 H;  2VQF L;  3BJU A;  3CPF A;  2Q2H A;  3EIV A;  3FKI H;  1PH5 A;  1SE8 A;  4BY7 G;  2JJQ A;  4IFD I;  4B3R Q;  1PH3 A;  4A3B G;  1Y1V H;  3I2Z A;  4P75 A;  3K81 C;  3T1Y L;  4O2D A;  1KRT A;  4DV7 L;  3S1Q H;  1VQG A;  4JI5 L;  4PZ6 A;  3T1H L;  1J5E Q;  1O7I A;  4C3J H;  3TRE A;  3JAM i;  4HJ8 A;  1FJG L;  3HOV H;  3PUV A;  1G51 A;  3GD7 A;  4NXN L;  2JEB I;  2ASB A;  2K5N A;  4DUZ Q;  2HQL A;  1X3F A;  1E3P A;  3U50 C;  4X62 Q;  2UUA L;  3NEL A;  5LMU L;  1XMO L;  4A3J H;  2AKW B;  2K14 A;  4AH6 A;  5JJK A;  4IPD A;  3D0F A;  2C35 B;  1KRS A;  1WYD A;  2QA4 A;  1V1Q A;  4JI3 L;  3M7N A;  1KHI A;  1VQO A;  3GO5 A;  2JA7 G;  2VS1 A;  4GN3 B;  3RR5 A;  4JOI C;  4UPA A;  3NEN A;  4DV5 Q;  1WCM H;  4R4Q A;  1T9H A;  3STB C;  3S14 H;  2OTJ A;  1LYL A;  2ZTC A;  4MZ9 A;  1YHA A;  3PIO A;  1QZG A;  1Z9F A;  1Q12 A;  3CW2 C;  1CKO A;  3EN2 A;  4IPH A;  5IWA L;  4OX9 L;  2N3S A;  3HKZ E;  1XMO Q;  4GOP C;  3PGZ A;  3GTP H;  1Y1W H;  2ZJR A;  1PYS B;  2VW9 A;  3S1N H;  1LTL A;  1OXX K;  2PQA B;  1SLJ A;  5GRO A;  3RLN A;  4JI7 L;  1XNQ Q;  4GKJ L;  2K75 A;  1P8L A;  1QUQ B;  1EYG A;  3K7A H;  1VQD A;  4LUV A;  4H02 A;  4AYB E;  1Y1V G;  5JJL A;  1A62 A;  1TWC H;  1J5E L;  1IBM Q;  2IHF A;  1Q81 C;  3S2D H;  1J6Q A;  1X6O A;  3PUZ A;  2B63 G;  1I6H H;  1PH7 A;  1L1O C;  3PO3 H;  3HKS A;  2B29 A;  3TRZ A;  4FDB A;  4DKA C;  3D31 A;  4JI0 Q;  4LFC Q;  2PQA A;  2UU9 L;  4LF6 L;  1VQA A;  1TXY A;  4OO1 G;  4WJ3 M;  2VQF Q;  2RHS B;  1YIT A;  3H15 A;  4IOA A;  1S40 A;  4A3G G;  5FLM G;  2UUA Q;  3BZC A;  1AE2 A;  1SMX A;  3PO2 G;  4BBS H;  5JEA J;  1S3O A;  4OWX B;  4BXX H;  2Y0S G;  4UY8 C;  2NZO A;  3GTO H;  1K3R A;  1B8A A;  3CCS A;  2NZH A;  1X9N A;  3AQQ A;  3F1Z A;  5GAE C;  1NY4 A;  1X65 A;  1KAW A;  2D0P A;  3H0G G;  4JOI A;  5ELN A;  3ULJ A;  5GAG C;  1VQ5 A;  1N34 Q;  5H1S E;  4LUO A;  3HFZ B;  1N9W A;  4DV4 Q;  1IL2 A;  3FP9 A;  3T1H Q;  4JYA Q;  1TWA H;  3KJO A;  1UEB A;  4OO1 I;  2GN5 A;  4LUZ A;  2ZTD A;  3CPW A;  1EQR A;  1X3E A;  1JJC B;  4A75 A;  5LMN L;  1YJN A;  1VQJ A;  5C3E G;  3UDF A;  4JI1 L;  1QVC A;  1HH2 P;  1V9P A;  2EQS A;  4R1J A;  4DV1 Q;  1NMG A;  4GNX A;  3UDG A;  1U5K A;  2A1A A;  2K52 A;  4JG2 A;  4AIM A;  5IY0 A;  2ZM6 Q;  1JJG A;  3AEV A;  3GDE A;  3PUY A;  1AH9 A;  4Y7N H;  2V1C C;  1A0I A;  4DR2 Q;  1N36 Q;  3M85 A;  1E7Z A;  4C2M H;  1B70 B;  1I50 H;  4A3E G;  2UXC L;  3TS2 A;  2K5H A;  4YWL A;  2JA8 H;  2NVY H;  3F2C A;  3HOU G;  3MXN B;  3HOU H;  1OXT A;  3ZJY C;  3M4O H;  3CD6 A;  4A3C H;  1OTC A;  2EXD A;  2F4V L;  4NXN Q;  2I5H A;  1W3S A;  2CWP A;  2NN6 I;  5FJ8 H;  3UE0 A;  3U58 A;  4BA1 I;  4GS3 A;  4B3M Q;  4IOC A;  1QVG A;  4A3D H;  1I94 Q;  2R92 H;  5GQO A;  1EQQ A;  1M90 C;  4LFB L;  2N49 A;  4LNQ A;  2ZJQ A;  4POG A;  5C4J H;  5ELO A;  2D0O A;  1P16 A;  2AMC B;  1IBL L;  1VQC A;  2NN6 G;  5IT9 c;  3ULP A;  2E2H H;  4LFC L;  2RCN A;  4JI0 L;  1PH4 A;  3CCQ A;  4JI4 L;  4OON A;  4B3R L;  4JI6 Q;  2D62 A;  1U0L A;  3SGI A;  3KYH C;  3TS0 A;  1K8G A;  2JA5 G;  2HHH Q;  4DR6 L;  3RNU A;  3WWV A;  4LF6 Q;  1C0A A;  1E22 A;  1YZ6 A;  3K0X A;  1MKH A;  3HOW G;  2N78 A;  1HNX L;  2IHE A;  4LF7 L;  2BA0 A;  3H0G H;  1VQM A;  3HOX G;  3ERS X;  4XIG S;  4B3T Q;  2AHO B;  3F8T A;  5GAH C;  2I0Q A;  3LGJ A;  3PIP A;  3PSI A;  4JC0 A;  2MO0 A;  4IFD J;  4BBR H;  4BBS G;  5BR8 L;  4WJ4 A;  1HR0 W;  5FLM H;  4JI8 L;  4DV4 L;  1BKB A;  4NXM Q;  1VQK A;  5JJI A;  3GTG H;  5FLX c;  3T1Y Q;  2MFI A;  1PH1 A;  3HKZ G;  2ZJP A;  1YJ9 A;  1K8A C;  3S17 H;  4LFA Q;  5IWA Q;  1ASZ A;  5M3M G;  1HR0 Q;  2NVT H;  4P71 A;  2OTL A;  1Q82 C;  5M5X H;  4JCV E;  4IPG A;  4DV1 L;  2WP8 J;  2JQO A;  3W1G A;  1E1T A;  2B63 H;  4JV5 L;  4DV3 Q;  4EQ5 A;  3KF6 A;  2VY3 A;  1OXU A;  3J7Z C;  1NTG A;  4DUY L;  2E5L Q;  3MEF A;  2JA8 G;  2UXB Q;  1WI5 A;  1N33 Q;  2I5M X;  5JEA G;  1XMQ Q;  1HNW Q;  1GO3 E;  3I55 A;  1D8L A;  4GOP A;  1VQ8 A;  3S2H H;  4OWW B;  4DR6 Q;  2VNU D;  5LMU Q;  2UUC Q;  2ALY B;  4IFD G;  5DLQ E;  3KJP A;  1X3G A;  4DR3 L;  1Z47 A;  4YHH Q;  1N34 L;  2KCM A;  1HR0 L;  1E24 A;  1PYB A;  2VUM H;  2JEA I;  1UE5 A;  3OTO Q;  4DV0 L;  2WAQ E;  1K0R A;  4X66 Q;  1C7Y A;  2F3I A;  1YVC A;  5C3E H;  1KQS A;  4LF4 L;  3L7Z C;  1W2B A;  2ZTE A;  4QGU A;  1WCM G;  3I7F A;  2JA6 H;  2JA7 H;  3S1R H;  1VQ4 A;  1PA6 A;  3AFQ A;  3HOY G;  3J81 i;  3PF5 A;  5IYD H;  2R7Z G;  4DNI A;  2GVA A;  3L2P A;  1KC8 C;  1VQ9 A; 
#chains in the Genus database with same CATH topology
 1HZ9 A;  5E3F A;  5M5W H;  5C3X A;  1DON A;  1TQO A;  1GVP A;  1WJJ A;  1X32 A;  1U4M A;  1VQ7 A;  2ZXR A;  4X65 L;  1RKN A;  4MIU A;  3DEP A;  2RF4 A;  2L15 A;  1KXL A;  1DXM A;  3BU2 A;  4CDD C;  5C3W A;  5IYC H;  1E2Z A;  4AQY L;  4NPS A;  3RZD H;  2R93 B;  4N9T A;  5IYC G;  4RFB A;  1SRU A;  1HZC A;  1JOK A;  3STB D;  2RSO A;  3A7A B;  3HOU B;  4DK0 A;  3D4D A;  4C1N K;  2HD3 A;  1SNQ A;  3G4S A;  4A3L G;  1EOV A;  3AYH B;  4XT3 B;  2OCE A;  5CBA E;  4P74 A;  4CDF C;  1MJE A;  5EBD A;  1ASY A;  4KKS A;  3IRB A;  3RD4 A;  2EVB A;  3NP8 A;  1JB3 A;  2PNH A;  2F3V A;  4A3J G;  1EFW A;  1UE6 A;  3KLW A;  4NW2 A;  3MTS A;  3GTM H;  3NPP A;  2Z6K C;  3E0J A;  3H0G B;  2A6H D;  3K59 A;  2K50 A;  3HRZ C;  2VUM G;  1EUJ A;  3E9H A;  1OXV A;  2WAQ G;  5I9O A;  1STH A;  4EQP A;  2F0K A;  3GTO B;  2UXB L;  1A3V A;  3A74 A;  4YY3 Q;  1PH8 A;  1YEZ A;  4EQO A;  2K5D A;  3DM3 A;  2CCZ A;  1G29 1;  3M4Q A;  3TP6 A;  4BY7 H;  2R61 A;  4GKK L;  2Q2I A;  2O5J C;  1G8Z D;  5FK9 C;  1PFS A;  2D5D A;  2JK8 A;  2XNA C;  2L5T A;  4MTN A;  2GVB A;  4ILW A;  4R4O A;  1ILQ A;  3GTK B;  2K28 A;  2PZW A;  1C8C A;  1UE1 A;  1RTN A;  2R3Z A;  1F2Y A;  1TU2 B;  5C6A A;  5M5W B;  1STY A;  2VZA A;  3A5Z B;  3C3L A;  1AW7 A;  4A3I H;  3A54 A;  4DV5 L;  1LM0 A;  3MXN A;  1HNZ L;  2EYH A;  1IXR A;  4LF8 L;  1Q46 A;  4DAM A;  4G57 A;  4A3M G;  3BDC A;  3SEB A;  1NSN S;  4ZAI A;  2NN6 H;  5IGG A;  1BR9 A;  4K8I A;  2F4V Q;  4MN3 A;  4B3T L;  1EIY B;  4HSP A;  4NKL A;  5FJ8 G;  1ML0 D;  4DXF A;  3S2H B;  4DV7 Q;  3MAQ A;  1HXY D;  1F9P A;  1TY2 A;  2Z8L A;  1L0X B;  1M1K C;  4R4C A;  2DY8 A;  2E2I B;  3U4Z A;  4OXP A;  4X62 L;  3CKI B;  4A93 G;  5EQ0 A;  4YCW A;  3X3M A;  1KD1 C;  3TZD A;  1CQF A;  1KIX A;  4ME5 A;  3DEO A;  2K04 A;  2KCT A;  3FDT A;  2MGS A;  2GA4 B;  1L1O B;  5IP7 H;  3JC6 6;  5C3E B;  2DGY A;  4UP8 A;  4HIK A;  3I4L A;  2IT1 A;  4HED A;  4QIW E;  1BF4 A;  2J4X A;  2NTT A;  4R4I A;  2Z4I A;  2H4O A;  3I8Z A;  4ZYS A;  4UP7 A;  1CM9 A;  2OWO A;  1EIF A;  5K5P A;  1SE3 A;  1ENA A;  4QIW B;  4A76 A;  4DV3 L;  2KHJ A;  4K14 A;  2EYF A;  1QB5 D;  3CP0 A;  1Y8P B;  4PQX A;  5IE8 A;  1Z6H A;  2I5L X;  5CGK A;  5C0X I;  1K0S A;  1MIU A;  3MC0 B;  2WAC A;  5IP9 G;  1UEA B;  3FEW X;  1TS5 A;  3I70 A;  3URY A;  3CC2 A;  3PO3 G;  2EY6 A;  2A69 C;  2YV5 A;  3S2D B;  2WAQ B;  2JA8 B;  3M3Y H;  2NVX B;  4M1U B;  1VQN A;  3DXJ C;  4ZUI A;  4GLA C;  3CCV A;  4DR7 L;  1HUN A;  3J80 c;  2K4K A;  3F2D A;  4XYO A;  2E74 C;  2CWA A;  2JE6 I;  1XTC D;  4RG1 A;  5CV8 A;  4WOR A;  1D5M C;  2F52 A;  2YTX A;  1VQP A;  1I3Q H;  4DR7 Q;  3KFU A;  1LUZ A;  1JMC A;  2AQ3 B;  1JCK B;  1STE A;  4X3S A;  5LMN W;  4DV2 Q;  4NDX A;  1GUO A;  1SN8 A;  2KUM A;  3J81 c;  3GTQ H;  3ICE A;  3EQL C;  1TVX A;  4LWC A;  3W5O A;  1KL9 A;  1EY4 A;  2B2V A;  1L0W A;  4DPG A;  1SE2 A;  4DV6 L;  1SFO H;  4LF9 L;  3PO2 H;  3WOE A;  1I5F A;  3BZK A;  1L1O A;  1BBU A;  5M5X B;  2EY2 A;  4CDC C;  2R93 G;  2BA1 A;  2VQF L;  2AUK A;  1I4X A;  1V1O A;  4RWS C;  3P7J A;  5D3I B;  4IFD I;  4JVZ A;  4B08 A;  1PH3 A;  2A68 C;  3NWS A;  4A3B G;  2L55 A;  4P75 A;  3N6R A;  4O2D A;  3OMG A;  1KRT A;  4DV7 L;  1O7I A;  2P5Z X;  1LT5 D;  4FXG C;  3HOV H;  3PUV A;  3R3O A;  4IUT A;  1PTO C;  1UUP A;  2JEB I;  1LO5 D;  1TY0 A;  1FYC A;  2LMC B;  4DUZ Q;  1BOS A;  1Q3L A;  1B4O A;  4X62 Q;  1X3F A;  3T4A C;  2UUA L;  1XMO L;  3A7L A;  4KKT A;  2XVS A;  3F2U A;  4IPD A;  1KRS A;  2QA4 A;  4JI3 L;  1KHI A;  3VR4 A;  1SNM A;  2KCC A;  3S14 H;  1YHA A;  4X3T A;  4ULL A;  1QIL A;  1ENF A;  1XMO Q;  3HOX B;  3GTP H;  2PQE A;  5A2Q E;  1J8I A;  1EU4 A;  2HUG A;  1BNZ A;  1OXX K;  4DAP A;  1P8L A;  2RA4 A;  1QUQ B;  2LKV A;  1QOH A;  1MSG A;  4LUV A;  2KQ3 A;  4HAE A;  1Y1V G;  2R7Z B;  1TWC H;  1MHW C;  1IBM Q;  1J6Q A;  4LK1 C;  2B2U C;  1NR4 A;  5I9P A;  3HKS A;  2B29 A;  4DKA C;  4JI0 Q;  4LAA A;  2UU9 L;  1WCM B;  1TXY A;  4WJ3 M;  1CTM A;  2RHS B;  3H15 A;  4L6T B;  4A3G G;  2UUA Q;  1S5F D;  1AE2 A;  3PO2 G;  1S3O A;  4UY8 C;  1S5E D;  1DCZ A;  2BDO A;  2NZH A;  2QCP X;  2AQ2 B;  1LTR D;  4PMC A;  2K6A A;  4FYD A;  3F1Z A;  1JR0 D;  1X65 A;  2PMZ B;  1KAW A;  3H0G G;  5EKL A;  3ULJ A;  2B8F A;  5GAG C;  3V96 A;  1WTR A;  3HFZ B;  1IL2 A;  3T1H Q;  1UEB A;  1RDP D;  2L11 A;  1KNE A;  2K1B A;  4LUZ A;  4RKB A;  1B9N A;  2NVY B;  3CPW A;  3BG3 A;  3SVM A;  1NCV A;  4JI1 L;  3T16 A;  1QVC A;  1V9P A;  2Z1C A;  1U5K A;  2ZM6 Q;  3OWF A;  3AEV A;  3PUY A;  1A2U A;  1AH9 A;  1GUS A;  2EDG A;  1PTO F;  3A8K E;  1K28 A;  4DR2 Q;  1E7Z A;  2CW0 D;  2UXC L;  4YWL A;  1UAP A;  2NVY H;  3HOU G;  3MXN B;  2JXM B;  1MI2 A;  3HOU H;  3M4O H;  2WKC A;  5F2D A;  3ZJY C;  3MWY W;  3CD6 A;  3D4R A;  1LAC A;  1VF7 A;  3U9O A;  4BA1 I;  1SNC A;  4B3M Q;  3I90 A;  1X3P A;  1I94 Q;  5GQO A;  1M90 C;  3DWQ A;  5C4J H;  1VQC A;  1FNU A;  1PRT D;  4RGT A;  4LFC L;  4ZKB B;  4KKU A;  2JN4 A;  3NTH A;  1ET9 A;  2RDF A;  1MD2 D;  1YZ6 A;  5COR A;  3HOW G;  1O7Z A;  1H9S B;  3HOZ B;  3H0G H;  3ERS X;  4XIG S;  1EY9 A;  3F8T A;  5GAH C;  2CH4 W;  2NB0 A;  4DU9 A;  3K7A B;  3PSI A;  4JC0 A;  2MO0 A;  2JA7 B;  4UAI A;  4WJ4 A;  1SYD A;  1HR0 W;  4KD3 A;  2EY5 A;  4L63 B;  3T1Y Q;  1Y1W B;  2F0D A;  3HKZ G;  5IWA Q;  2L4N A;  1ASZ A;  3R2I A;  2OTL A;  1Q82 C;  1ZXT A;  4J6H A;  2JQO A;  2TSS A;  4DXG A;  1SDF A;  3VR6 A;  2JA8 G;  4DUY L;  2E5L Q;  1WI5 A;  5JEA G;  1SFO B;  2VNU D;  1VF5 C;  5LMU Q;  4IFD G;  4YIJ A;  1Q8I A;  3KJP A;  1X3G A;  1KTK A;  3QB3 A;  2KCM A;  1CZG A;  2NVT B;  4X3K A;  2JEA I;  2ICI A;  4DV0 L;  1K0R A;  4LF4 L;  3L7Z C;  1W2B A;  2EPB A;  3I7F A;  4Z9C B;  1VQ4 A;  1PA6 A;  3AFQ A;  4H13 C;  3A55 A;  5CMD A;  2RVL A;  2WII B;  1F2M A;  1KC8 C;  4TSS A;  5KNC A;  1GOZ A;  4L5T A;  3VA7 A;  1IHZ A;  3RLO A;  3HOZ H;  4JI6 L;  2VXW A;  1IKM A;  3FVQ A;  2BE5 C;  4XTC S;  1IBM L;  2XWJ B;  5KEE A;  2DJF C;  3GTK H;  3CQZ H;  3G71 A;  1SAP A;  3KF8 B;  3DUZ A;  2UUB Q;  5CV4 A;  1IBK L;  2MO1 A;  5C4J B;  4GLV B;  3AFP A;  4DAY A;  3FKI G;  1PH6 A;  2PMZ E;  1YBY A;  2A6E C;  1KAA A;  1AFP A;  1TWH H;  3E6Z X;  5IT9 L;  4TRD A;  4J15 A;  5EBC A;  4OHJ A;  3N52 A;  3MEH A;  1EWC A;  4IJH A;  5C44 G;  1LTS D;  4BBS B;  4A3F H;  4EQN A;  3RMH A;  4JV5 Q;  1VQH A;  1GD7 A;  1N33 L;  1NJI C;  3S1M H;  1G6Z A;  4QQB X;  3TQY A;  2PYK A;  1I4H A;  4U67 3;  2Q8I B;  5C0X G;  2E8G A;  1SND A;  2F0Q A;  5D14 A;  3OOC A;  4IPC A;  5EAY A;  2PI2 E;  4HJ7 A;  3I4M H;  2VQE Q;  5I2Y A;  1BBW A;  4A3K H;  1H95 A;  3A0J A;  2F0J A;  1SSO A;  2MPM A;  3H3V I;  3SK8 A;  2R7D A;  1V1P B;  4DV2 L;  2B39 A;  2OQK A;  1Q8K A;  3NEM A;  1DOL A;  1FNV A;  3CCE A;  2YU9 H;  1HNX Q;  3PF4 A;  4ME3 A;  3BVG A;  4DR4 Q;  2AWO A;  2OXP A;  4KLK A;  2E2H B;  1BVS A;  3ND9 A;  4QMG A;  4DV6 Q;  4LF9 Q;  1STA A;  2Z9H A;  3QO2 A;  2YYZ A;  1EIH A;  2L9H A;  3U4V A;  1YJW A;  3CC7 A;  3RN2 A;  1XPU A;  3CCU A;  5K36 H;  1KAB A;  1V43 A;  1F9Q A;  1WD1 A;  4JYA L;  2VL6 A;  2E2J H;  3I73 A;  3K0Y A;  3MHB A;  1S4Z A;  3FKI B;  4YHH L;  1AE3 A;  1PZJ D;  3TEH B;  3HOX H;  1LLR D;  4HIO A;  5E7N A;  5M3M B;  2CFM A;  1B53 A;  4K2L A;  1DM0 B;  2YTY A;  1SYE A;  3OIP A;  3I56 A;  4PZ8 A;  4MNO A;  4DA2 A;  3SK5 A;  1TWH B;  1FGB D;  4RCO A;  1WOC A;  4C3H H;  2E76 C;  4ABN A;  3CRL C;  2R92 G;  4A3D G;  1OO9 B;  1RF2 D;  4DR3 Q;  4ZUJ A;  1IYV A;  1IW7 C;  4C3J B;  5C44 B;  3FPU B;  1PXU A;  3D6C A;  3FHW A;  1YNN C;  2EJG C;  3SK4 A;  1CHP D;  3QG1 A;  1FNW A;  2B3G A;  2IW3 A;  4G4K A;  4ODG A;  5M3M H;  4S3S A;  2M2L A;  4LMQ D;  5ELF A;  4C1N I;  1PHJ A;  1I4G A;  1Q1E A;  4JI3 Q;  2K03 A;  4L5S A;  4BBR G;  5EPL A;  3I4M B;  1TS2 A;  1V1P A;  5EJW A;  1RIP A;  3RZO H;  4LF5 Q;  1VMC A;  2F0I A;  1HFN A;  4A3M H;  2R7F A;  2WB1 G;  3RLF A;  4JI5 Q;  1DZ1 A;  4NB3 A;  3SE0 A;  1E0B A;  4GOP B;  1VQL A;  4KJN A;  3EBE A;  3OHX C;  3K5L A;  3F2B A;  2D2C C;  2L0C A;  3QOL A;  1JJ2 A;  2BH2 A;  1CQV A;  2X69 A;  4DN4 M;  1GM5 A;  1BUV T;  3B6Y A;  4IUR A;  3CF5 A;  3PUW A;  3IFD A;  3E3X A;  3J80 E;  1R9T B;  5KYL A;  4BXX G;  5I2X A;  1G6P A;  1A2T A;  1D7Q A;  1FGU A;  3NUC A;  4APV A;  4HJA A;  1DD2 A;  3GTM B;  2NTS A;  1HQM C;  1D5X C;  4JI8 Q;  4RH6 A;  3G48 A;  3NBH A;  5BR8 Q;  4A3E H;  4ID6 A;  5CV9 A;  4JBW A;  3LNN A;  3WDN A;  4DR2 L;  2IWH A;  1S5D D;  2ZXP A;  2OEO A;  4YCV A;  3UDX A;  4HJ5 A;  2AWN A;  2KEN A;  4GLX A;  4B3S Q;  1DYQ A;  5ELB A;  4JBM A;  3W3A A;  2O4X A;  2LS0 1;  1F2L A;  1Y1W G;  1FL0 A;  3NBH B;  4BS9 A;  1HNW L;  2B2W C;  2HIV A;  1XNR Q;  2WIN B;  3QJY A;  2RHQ B;  4J8Q A;  1AN8 A;  4A3K G;  1JIC A;  2HT1 A;  4B3S L;  4JI2 L;  3I4M G;  2JA6 B;  1RTO A;  4BY1 H;  4IO9 A;  4HMJ A;  2OT2 A;  3CCR A;  1YHQ A;  4V19 0;  4GN4 B;  3A5U A;  3KDF A;  4KJO A;  1FJG Q;  4K5W A;  1B7Y B;  3GTL H;  1BCP C;  2FMC A;  4BA2 I;  4DK3 C;  2NYZ D;  2UUB L;  3PIP 3;  1PFM A;  4G7H C;  2WKD A;  4KHV A;  1I4P A;  5D3D A;  1SRO A;  4GKK Q;  4H7B A;  4C3J G;  1LTT D;  2PO4 A;  2KHI A;  3M4Y A;  5DEH A;  3MVV A;  4A3F G;  3CC4 A;  5JAV A;  3C46 A;  1I50 B;  2F0L A;  1XMQ L;  4C3I H;  1Q86 C;  1LTB D;  4KMU C;  1CKM A;  1K83 H;  3S17 B;  3BJU A;  3C1F A;  3FKI H;  4K5X A;  1SE8 A;  2JJQ A;  3D4W A;  3LX0 A;  1V8Q A;  4FXK C;  1Y1V H;  2IJ0 A;  2L12 A;  5A2Q L;  1PRT B;  2QF7 A;  3QWN A;  4A3E B;  2EJF C;  2N55 A;  5HGT A;  3S1N B;  3J7A V;  1SMY C;  3JAM i;  2A69 D;  3GTP B;  2NUC A;  2BCO A;  2QEJ C;  3KF8 A;  2MUY A;  2HQL A;  3U50 C;  4AH6 A;  3D0F A;  1SXT A;  5C0X H;  1V1Q A;  1VQO A;  2JA7 G;  3DM1 A;  4GN3 B;  5T1G A;  3GV3 A;  3NEN A;  2OTJ A;  1T9H A;  4MZ9 A;  1U4P A;  2KEE A;  3CW2 C;  1CKO A;  3EVQ A;  5IIF A;  5IWA L;  4A3D B;  3HG9 A;  2N3S A;  3HKZ E;  5CV7 A;  4TKO B;  1ESF A;  1EYD A;  2VW9 A;  5J1Z A;  3RLN A;  1XNQ Q;  4GKJ L;  4K6L A;  1TWC B;  4IFD H;  5D65 A;  4H02 A;  4AYB E;  5JPN C;  4N8X 1;  1A62 A;  3OMC A;  1J5E L;  2OF1 A;  1Q81 C;  3S2D H;  3PUZ A;  1MGS A;  2B63 G;  4QB4 A;  4ZRZ A;  4RGO S;  5E4X A;  4HR7 B;  2QIL A;  3A8I E;  4CGY B;  4LFC Q;  5KGU A;  2PQA A;  4LF6 L;  4IOA A;  5FLM G;  3BZC A;  1SMX A;  2VB2 X;  5JEA J;  4OWX B;  4BXX H;  2XSC A;  1WTQ A;  3GTO H;  1K3R A;  2YU9 B;  2F0E A;  2F03 A;  5GAE C;  1CK1 A;  5G3L F;  1VQ5 A;  1N34 Q;  5H1S E;  4LUO A;  4DV4 Q;  1HA6 A;  3KJO A;  2B2T A;  3K5O A;  1U4L A;  5J39 A;  3J81 E;  2GN5 A;  2K33 A;  2O5I C;  4RA8 A;  2PCF B;  3DWP A;  1YJN A;  1VQJ A;  3S15 B;  2EQS A;  4DV1 Q;  1NMG A;  4GNX A;  1H9R A;  1C4Q A;  5ISR A;  2A1A A;  2K52 A;  3J7Y W;  5ELE A;  1CA5 A;  1A0I A;  1EY8 A;  1T5E A;  4C2M H;  2JA8 H;  4F88 A;  3F2C A;  2LY7 A;  1OXT A;  2RKS A;  1KLG D;  2EXD A;  2F4V L;  1W3S A;  3DHQ A;  3VR5 A;  4GS3 A;  4A3D H;  1QVG A;  2SOB A;  1JQY D;  2R92 H;  3UI2 A;  4OEL B;  1IBL L;  1SYB A;  2E2H H;  4JI4 L;  2RCN A;  3CCQ A;  4B3R L;  1YNJ C;  3VYR A;  5KRU A;  3KYH C;  2JA5 G;  4DR6 L;  3D6W A;  3WWV A;  1C0A A;  2X6G A;  1GUG A;  2KJX A;  5EKI A;  3O13 A;  4B3T Q;  4OL7 A;  2I0Q A;  4IUV A;  1KDC A;  2J7Z A;  3S16 B;  3ND8 A;  1VQK A;  3HKZ B;  5IGF A;  4OO1 H;  3GTG H;  3S17 H;  2F0U A;  4E6I A;  2NVT H;  5DM6 3;  4IPG A;  4KY7 A;  3G6J B;  4WFN 3;  1E1T A;  3KF6 A;  1NTG A;  3MEF A;  2UXB Q;  2I5M X;  3CRK C;  1ET6 A;  3S2H H;  5CBE E;  4OWW B;  3H3V C;  2UUC Q;  3MXU A;  2ALY B;  4JK1 C;  4YHH Q;  1QNK A;  1E24 A;  1PYB A;  4M8A A;  1XXG A;  2EYO A;  2K05 A;  3J80 L;  3OTO Q;  1ILP A;  1JOQ A;  4FF1 A;  1C7Y A;  1AZQ A;  3EA6 A;  1BDO A;  1B50 A;  1ZKO A;  2JA6 H;  4HSV A;  1QWY A;  3MA2 B;  1TKW B;  4C2M B;  1D1I A;  1M8A A;  1EZ8 A;  3PIO 3;  5FO8 B;  2Q8R E;  1PTO H;  3L2P A;  2B8G A;  2IL8 A;  3K8A A;  4A3I G;  1FR3 A;  3ZYY X;  1D5Z C;  4KHZ A;  1R4P B;  1EY6 A;  3K58 A;  1CSQ A;  5LHY 1;  1YNN D;  1NR2 A;  5C4H A;  3Q6S A;  1F9S A;  3RN5 A;  3IL8 A;  5FLX E;  1LAB A;  4DR5 Q;  4QUC A;  1WTX A;  1I94 L;  1BXT A;  2A6H C;  2KEC A;  3UDI A;  2DNC A;  2A8V A;  4BY7 B;  1HCZ A;  5I6Y A;  2N8N A;  3PV0 A;  1N36 L;  1JT8 A;  3H09 A;  4K0K L;  2K5W A;  5IYB H;  1GHK A;  5C0X J;  1D2B A;  2WB1 E;  4LF7 Q;  2KHS A;  2XTI A;  3KOJ A;  1QUQ A;  4L8J A;  4RGN A;  4LF8 Q;  4KHP L;  4IZ8 A;  1GHJ A;  2LXK A;  3GTG B;  3NQT A;  2QDB A;  2MP1 A;  1N32 Q;  3NXW A;  1NAP A;  1IBL Q;  5C5M A;  4X66 L;  4HCS A;  3OYY A;  2SNS A;  4U68 A;  5KIX A;  1XPR A;  3TZU A;  1ONL A;  4IUP A;  3I4O A;  4O42 A;  1CKN A;  3UE1 A;  1QVF A;  3L3O C;  4LF4 Q;  2UXC Q;  2KA7 A;  1VS0 A;  5C4Z A;  1IBK Q;  3CXC A;  1K73 C;  1ICF B;  1EQV A;  3C2P A;  1STN A;  3W1B A;  1O80 A;  1F77 A;  4I7A A;  4DGZ A;  5DM7 3;  2UU9 Q;  1YNJ D;  3J7A 5;  2EJM A;  1C9O A;  5JEA H;  4ZCK A;  4A3B H;  1EL0 A;  1YI2 A;  2F4I A;  1PV4 A;  3V2T A;  4EX5 A;  2ES2 A;  2RBM A;  1XNR L;  4JI4 Q;  3FRP B;  4XQQ A;  4Q0F A;  3T51 B;  4FO2 A;  2HCC A;  4IQZ A;  3CHB D;  5AJ3 Q;  2A74 C;  2EYL A;  4C3I G;  5JPM C;  1PYW D;  2IY5 B;  4DUZ L;  3DMU A;  2R6G A;  4QL5 A;  5EPJ A;  5J3B A;  4XT1 B;  5M3F H;  3RZO B;  4CKE A;  4GNX B;  1BCP F;  1PLF A;  1BO0 A;  5IGE A;  4EGV A;  4R4T A;  1A63 A;  2DUD A;  2PZU A;  1JB7 A;  4JI1 Q;  3ONA B;  3Q8D A;  4AYB G;  4BY1 G;  3HOW H;  1QG7 A;  1VQF A;  1QNU A;  4PMW A;  4IJL A;  4LJZ C;  2F0M A;  1A15 A;  4G7Z C;  4DR1 Q;  3KLS X;  4JBJ A;  4OGQ C;  4A93 H;  4RKL A;  2HDL A;  5BN4 A;  4B3M L;  1EZ6 A;  2RSN A;  1X54 A;  3H91 A;  4CDE C;  5AJ3 L;  5NUC A;  4FF4 A;  1EY7 A;  1GKH A;  1VQB A;  5IT9 E;  3K6O A;  2LXJ A;  5HY6 A;  2IX0 A;  4YCU A;  3HOW B;  3OPO A;  4DNR B;  1HFG A;  3E9I A;  1JOO A;  1E1O A;  2E75 C;  3R8B A;  4L5Q A;  1HZA A;  1PZI D;  4BBR B;  3TP5 A;  3AB9 A;  1CT1 D;  3I4N B;  3Q22 A;  1IW7 D;  4CBV A;  2CKZ B;  3H3V H;  5T1I A;  3PO2 B;  5LL6 S;  5FO9 B;  3CMA A;  1NMF A;  4HTH A;  3KF6 B;  1SNO A;  2H5X A;  4KY6 A;  4IUQ A;  2VUM B;  2YTV A;  1JE5 A;  5IP7 G;  4P73 A;  4X64 Q;  1AZP A;  1HJP A;  1Q7Y C;  5KNB A;  3JAM L;  4YWM A;  1EFI D;  4A3J B;  1E2W A;  1PH9 A;  1HUM A;  4CJ0 B;  2Q8T A;  4WRD A;  4RMF A;  5M5Y H;  4X64 L;  3C1E A;  1E2V A;  2BH8 A;  3CU7 A;  1SMY D;  2A5H A;  5EKK A;  3IKJ A;  1YNX A;  3S16 H;  2G5D A;  3IFT A;  4BWG B;  4X65 Q;  2MNA A;  3P20 A;  1XNQ L;  4KHP Q;  3T56 B;  2SNM A;  4KD4 A;  1N32 L;  3BYT B;  3BVZ A;  4C3H G;  4DNT B;  2A6E D;  2RCF A;  5M5Y B;  4H44 C;  1PDQ A;  4TVA B;  3WOF A;  3VR2 A;  4OWT B;  1S72 A;  4X6A H;  2EYP A;  4QJF A;  1YIJ A;  1D6E C;  1TWA B;  4DAY B;  5LL6 X;  4L5R C;  1CZW A;  3VDY A;  1QZH A;  4A4I A;  3GTQ B;  2Z6B A;  2A73 B;  2LSS A;  4IUN A;  3QR8 A;  3CCJ A;  1H9S A;  4A3L H;  1SE4 A;  1XWE A;  4B9W A;  2UXD L;  2UUC L;  4CJ1 B;  3I4N H;  5K36 G;  2KCN A;  1X3Q A;  2XRQ D;  2PNR C;  4GNX C;  1TWG B;  4R8I A;  5I6W A;  3CPF A;  2Q2H A;  3A8J E;  3EIV A;  4BY7 G;  4B3R Q;  1Y69 U;  3I2Z A;  3TSS A;  3K81 C;  3P75 A;  4CKB A;  2E2J B;  2FMM A;  2A68 D;  4HN7 A;  3T1H L;  4C3J H;  2PW7 A;  4HJ8 A;  1FJG L;  4NXN L;  1EWH A;  3RUZ A;  2ASB A;  4XQN A;  2K5N A;  3D3R A;  2Z4H A;  1ROD A;  1E3P A;  4A3G B;  4H0L C;  4A3J H;  2AKW B;  1STB A;  5JJK A;  1LT4 D;  1AEX A;  2C35 B;  3ERO A;  1B9M A;  1WYD A;  1HA5 A;  1TS4 A;  5IGB A;  5CYU A;  3M7N A;  1JOR A;  2VS1 A;  3RR5 A;  4JOI C;  4UPA A;  4DV5 Q;  1WCM H;  4R4Q A;  3HOY B;  3MZ5 A;  1LYL A;  3PIO A;  4O1N A;  1QZG A;  3EN2 A;  3KK7 A;  3VYT A;  1PFB A;  1DJR D;  3K5N A;  1KLU D;  3E5S A;  3NTI A;  2BDN A;  3L9A X;  4GOP C;  3PGZ A;  1Y1W H;  5IOC A;  1EQT A;  1LTL A;  5GRO A;  4JI7 L;  3VYS A;  1B3Q A;  1PMR A;  2K75 A;  1GXD C;  3S1Q B;  4RHR A;  1X6O A;  4KN7 C;  3KBX A;  5FO7 B;  1ZYR D;  2PPB C;  1PZK D;  1BBX C;  5FLX L;  2D9U A;  3AMU A;  3TRZ A;  4FDB A;  3D31 A;  2B2W A;  1WTW A;  2F0T A;  2VQF Q;  1YIT A;  4K2K A;  1FD7 D;  2NZ1 D;  4DFA A;  1MBY A;  3NWT A;  1ESR A;  1B8A A;  3AQQ A;  1NY4 A;  1SJE D;  5ELD A;  4GZY C;  5JJZ A;  1A3T A;  2D0P A;  4JOI A;  5ELN A;  2F0F A;  2O2L D;  2NWG A;  1WTH A;  1N9W A;  1H9M A;  4JYA Q;  1TWA H;  1HTP A;  4P2C B;  3NK9 A;  1SEB D;  2IPK D;  1TS3 A;  1X3E A;  1JJC B;  4A75 A;  3NSW A;  1Y8N B;  3TP8 A;  3UDF A;  1HH2 P;  3K57 A;  3UDG A;  4AIM A;  1K83 B;  5IY0 A;  1JJG A;  1QJO A;  4KY5 A;  3GDE A;  4Y7N H;  1N36 Q;  2B2T C;  1LTI D;  5M3F B;  2K5H A;  4WJW A;  5HUR A;  4J1M A;  3BZD B;  1OTC A;  2C9O A;  4EVO A;  2I5H A;  2CWP A;  4FVM A;  5FJ8 H;  3U58 A;  3TBI B;  3UE0 A;  5AFW A;  4IOC A;  1S5B D;  2N49 A;  1F9R A;  1L0Y B;  4FP5 D;  5FKA C;  2ZJQ A;  4PMB A;  5ELO A;  1P16 A;  3Q23 A;  3A56 A;  3VA5 A;  2NN6 G;  2CW0 C;  1PH4 A;  2D62 A;  3SGI A;  3TS0 A;  1PRT C;  1EIG A;  3RNU A;  1WVL A;  1MKH A;  2N78 A;  1HNX L;  3Q24 A;  3HOX G;  1SYG A;  2K01 A;  2XN9 C;  1F2Z A;  1KDB A;  3BVM A;  2K32 A;  4IFD J;  4B9X A;  4BBS G;  5BR8 L;  1Y1V B;  4JI8 L;  1BKB A;  4NXM Q;  5JJI A;  3TDQ A;  1SBB B;  2J0T D;  2MFI A;  1K8A C;  1A3U A;  2F0G A;  4AYB B;  5M5X H;  3KBG A;  1G2S A;  3M7G A;  4JV5 L;  4DV3 Q;  4EQ5 A;  4G7O C;  2VY3 A;  1OXU A;  4A3F B;  1N33 Q;  1XMQ Q;  3EFX D;  1GO3 E;  4GOP A;  1WD0 A;  1VQ8 A;  1HNW Q;  4DR6 Q;  2AUJ D;  4DF7 A;  5DLQ E;  2E2D C;  3HP3 A;  1Z47 A;  3GTJ B;  1HR0 L;  2VUM H;  4RGM A;  3GTL B;  1UNS A;  4UHV A;  1BQQ T;  1YVC A;  2F3I A;  3JAM E;  5C3E H;  1KQS A;  3HOV B;  1K8O A;  4BY1 B;  2PW5 A;  2ZTE A;  1B1Z A;  2XWB B;  1WCM G;  4RHS A;  3CQZ B;  3S1R H;  3HOY G;  3J81 L;  2CQA A;  3PF5 A;  1LV9 A;  5IYD H;  4DNI A;  4Y7N B;  2GVA A;  1I4Q A;  2LFN A;  2M00 A;  1DOK A;  2AQ1 B;  2OQ0 A;  2ZM6 L;  3BS1 A;  2E2I H;  1DGS A;  1K9M C;  3K80 C;  5FOB B;  2Q2U A;  4DAV A;  1HRJ A;  1LT6 D;  4QY7 A;  3ITP A;  1HZB A;  3W2D A;  4DK6 C;  4Y52 H;  4KV6 A;  5M3F G;  4OIK A;  2A19 A;  2MQH A;  4XXE A;  1TT2 A;  3TME A;  3ER0 A;  1EY0 A;  5BN5 A;  4JBK A;  5C44 H;  3BDO A;  3I91 A;  2IX1 A;  1J9O A;  2K5V A;  3SR1 A;  2MHV A;  3DLL A;  1PTO D;  5E1F A;  3TN2 A;  3K7U C;  2JSO A;  2PZT A;  2R92 B;  1NUC A;  1VQI A;  2EIF A;  4I7Z C;  3MXP A;  5CV5 A;  1X56 A;  5JOB A;  5IGD A;  3CME A;  1WFQ A;  1O7Y A;  1GUN A;  2TMP A;  3I4N G;  2F0P A;  2EXZ A;  4YY3 L;  2B63 B;  4UP9 A;  5IOD A;  1IYJ B;  1AP0 A;  1CSP A;  1CUK A;  3ERQ A;  3G6E A;  2FHT A;  3CCL A;  5DNF A;  3SK6 A;  4OIJ A;  1PRT F;  3HOZ G;  1WTV A;  1PTO B;  4XYQ A;  4F87 A;  2Z0S A;  4N8F A;  4RCN A;  2R7Z H;  2QGQ A;  4DR1 L;  1RL2 A;  2NVX H;  3M3Y B;  1S5C D;  1EWI A;  4PG3 A;  4DV0 Q;  1TWF B;  3ULL A;  4GKJ Q;  1U9R A;  3E0E A;  4KN4 C;  3Q0A A;  4V0B A;  4CHT B;  5C5L A;  4LF5 L;  3S9W A;  1MSH A;  3L0O A;  1ZYR C;  2JP1 A;  1XPO A;  3S1M B;  3J80 i;  1HNZ Q;  4NMZ A;  2QEX A;  1UWV A;  3CAM A;  3IAY A;  4A3B B;  3MFG A;  1LT3 D;  4HIM A;  3LWU A;  3PCO B;  2M9V A;  4LW1 A;  1VDZ A;  4K0K Q;  5LMN Q;  2JYO A;  1A8V A;  1KNA A;  1SJH D;  2PI2 A;  3I3C A;  4NXM L;  1GJX A;  3RZD B;  2R93 H;  2BE5 D;  2CVR A;  5HGQ A;  3AU7 A;  1HQR D;  4I65 A;  1H9J A;  4K8J A;  4DR5 L;  4R8N A;  4AQY Q;  2KOL A;  3M4O B;  4A3M B;  4IAL A;  3SXH A;  3R93 A;  2KVM A;  1IKL A;  2F1M A;  1T5X D;  1W6K A;  1RHP A;  2SEB D;  2XGT A;  2EE1 A;  4OX9 Q;  1UE7 A;  2X6L A;  1HPC A;  2ZT9 C;  5IYD G;  5IGC A;  3DWA A;  3OW2 A;  3HOY H;  2UXD Q;  3H6M A;  2WB1 B;  2JA6 G;  3GV6 A;  4TQU S;  1TR5 A;  2FXQ A;  3OSO A;  1I4R A;  1A6X A;  1FVI A;  2DJG C;  3JAM c;  2B2V C;  3GTJ H;  5C4X G;  2H1E A;  3R2T A;  4N9P A;  4QCL A;  1B3A A;  2BOS A;  1EOT A;  1PH2 A;  1R4Q B;  2ID0 A;  4A3C G;  5I4D A;  1XYI A;  3BYY B;  4DR4 L;  1O7L A;  3P1H A;  2EZV A;  1WTP A;  2EYM A;  5IP9 H;  4X3U A;  1B44 D;  2K7V A;  5GAD C;  2HIX A;  4LFA L;  4A3I B;  2CQO A;  1TWF H;  1JWU D;  2ICE C;  1GUW A;  3S15 H;  3HGB A;  2VQE L;  5G3L D;  1K8M A;  3NTK A;  3PMF A;  4PZ7 A;  4LFB Q;  1C48 A;  1LTA D;  3BDL A;  1XX8 A;  1Q1B A;  2ATW A;  4P72 A;  2Z6K A;  3VR3 A;  1QCB D;  1Y14 B;  1B2T A;  2JA5 H;  3KLR A;  1L2F A;  4ZLT F;  3HS0 C;  4MHE A;  2I07 B;  2HHH L;  1OXS C;  1YHB A;  1NBW A;  4JI2 Q;  1SYC A;  2SDF A;  1R9T H;  2B2Y C;  4IUU A;  4KTA A;  4DUY Q;  2E5L L;  1N8R C;  2ENB A;  3OWE B;  1IYU A;  1XJV A;  4A3G H;  4POF A;  4HID A;  2IX3 A;  4XQJ A;  2KED A;  2L1B A;  5J22 A;  2Q2T A;  4KI0 A;  4ALP A;  4ZQ3 A;  2WFW A;  3PUX A;  4YWK A;  3OTO L;  1I6H B;  3M4P A;  5CR3 A;  4PNY A;  1I6V C;  5COY A;  1X55 A;  2F0V A;  5C4X H;  1NE3 A;  2Y0S E;  4DK1 A;  3T53 B;  1SR3 A;  3VYU A;  2RQX A;  1TWG H;  1VQE A;  3CCM A;  3J7A F;  4GN5 A;  5CC4 A;  2F0H A;  2EYJ A;  1IL8 A;  1W6J A;  1VMP A;  3K5M A;  3M9B A;  4O0A A;  1MJC A;  4CJ2 C;  5A35 A;  1JE4 A;  4HJ9 A;  1VCI A;  1G2T A;  2DNE A;  2FIN B;  1XTD A;  4JI7 Q;  5BN3 A;  3I72 A;  1PVO A;  1VQ6 A;  3HOV G;  4ZK9 B;  3HEJ A;  1I3Q B;  1IZ6 A;  2NVQ H;  3PQI A;  1Q90 A;  2KBN A;  3TP7 A;  5IYB G;  2B2U A;  4KK7 A;  3KDF B;  3J81 j;  3S24 A;  2QKI C;  4CKC A;  1CKN B;  3PO3 B;  2JA9 A;  1DOM A;  1PH5 A;  3GQB A;  2ZXO A;  3H94 A;  1EYA A;  5KND A;  4C3I B;  3NHH A;  3X3N A;  5C4X B;  3OIQ A;  3T1Y L;  3S1R B;  2DN8 A;  3GP7 A;  2NBF A;  3S1Q H;  1VQG A;  4JI5 L;  4PZ6 A;  3FPP A;  1CHQ D;  1J5E Q;  3TRE A;  1G51 A;  1KDA A;  3GD7 A;  2DY7 A;  4C56 C;  1BCP B;  3NEL A;  5LMU L;  5EGT A;  2I46 A;  2K14 A;  4FXD A;  1QE6 A;  1RD9 D;  5JVG 3;  1G91 A;  3GO5 A;  1K3B C;  3STB C;  2JA5 B;  2RDG A;  2ZTC A;  4K6D A;  1Z9F A;  1Q12 A;  4IPH A;  4OX9 L;  2QW7 A;  2FFK B;  1PYS B;  2ZJR A;  4A3K B;  3NQI A;  4MTK A;  3S1N H;  3D8G A;  2PQA B;  1SLJ A;  2F0W A;  2C5C A;  4XDX A;  1EYG A;  3K7A H;  1VQD A;  4PV1 C;  1HHV A;  1JC7 A;  2XRS D;  5JJL A;  1ZEQ X;  2F3W A;  1WTO A;  2IHF A;  4R9W A;  1I6H H;  1PH7 A;  1L1O C;  3PO3 H;  2WV6 D;  3FMC A;  2HQE A;  2B2Y A;  5TSS A;  1CA6 A;  1VQA A;  4OO1 G;  1EEF D;  3EJI A;  1Z7T A;  1S40 A;  2NVQ B;  3MFY A;  4BBS H;  3T13 A;  2Y0S G;  4JPB W;  2NZO A;  4RAU C;  2XIW A;  4FF3 A;  1HTL D;  3CCS A;  1X9N A;  1STG A;  4A93 B;  3HZX A;  3MXG A;  3G7L A;  5DAU A;  3NE5 B;  3OW7 A;  3FP9 A;  1SYF A;  4OO1 I;  2ZTD A;  2CH4 A;  1EQR A;  4QF4 A;  3SDZ A;  1EU3 A;  5LMN L;  5C3E G;  1Y8O B;  2K5Q A;  1EEI D;  4R1J A;  1ENC A;  4JG2 A;  2QDL A;  1U4R A;  2V1C C;  4JW0 A;  3M85 A;  2RDH A;  1B70 B;  1I50 H;  4OEM B;  4A3E G;  2MJ8 A;  3TS2 A;  1JWS D;  2N88 A;  5CV6 A;  1ICW A;  5JVH 3;  5L37 A;  4A3C H;  1RJT A;  5E4W C;  1EY5 A;  1JWM D;  4NXN Q;  2NN6 I;  1BCP D;  1SNP A;  4C3H B;  2CHB D;  1EQQ A;  4LFB L;  4LNQ A;  4POG A;  2HDM A;  2D0O A;  2AMC B;  5IT9 c;  3ULP A;  4JI0 L;  1CFM A;  4OON A;  4JI6 Q;  1EYC A;  3U9S A;  1U0L A;  1K8G A;  2F0N A;  2HHH Q;  4LF6 Q;  1O78 A;  1E22 A;  3K0X A;  2IHE A;  1RCV D;  2BA0 A;  3V05 A;  4LF7 L;  1VQM A;  2VB3 X;  4FF2 A;  3LWE A;  4HCE A;  4ZKC B;  2AHO B;  2F0S A;  2Y0S B;  3LGJ A;  3PIP A;  4BBR H;  2F0O A;  2HCI A;  5FLM H;  3QIA A;  4DV4 L;  4F7X A;  5FLX c;  1PH1 A;  4HMI A;  3QOJ A;  2ZJP A;  1GUT A;  1YJ9 A;  4LFA Q;  4F8M A;  4FNF A;  5M3M G;  1HR0 Q;  4P71 A;  1II3 A;  3SHL A;  4DV1 L;  4JCV E;  2WP8 J;  3S14 B;  3W1G A;  4Q5V A;  3KLS A;  2B63 H;  1CI3 M;  3J7Z C;  4K5V A;  3I55 A;  1D8L A;  2EOT A;  2G9D A;  4NP5 A;  1NNX A;  4QUF A;  1H9K A;  4DR3 L;  1TII D;  1N34 L;  5EPK A;  2FJ2 A;  1UE5 A;  2WAQ E;  4X66 Q;  2G9H D;  5ELC A;  3NBI A;  2V4D A;  4QGU A;  1D1K A;  5M9O A;  3KUP A;  2JA7 H;  1PFN A;  4UDU C;  4IN3 A;  3J81 i;  1LTG D;  2R7Z G;  5KYI A;  1M4V A;  1VQ9 A;  2EY1 A; 
#chains in the Genus database with same CATH homology
 2OQ0 A;  3K8A A;  4L5T A;  2ZM6 L;  4A3I G;  3RLO A;  2E2I H;  1HZ9 A;  1DGS A;  1K9M C;  3HOZ H;  4KHZ A;  3K80 C;  4JI6 L;  2Q2U A;  5M5W H;  1CSQ A;  4QY7 A;  4DK6 C;  1HZB A;  4Y52 H;  1GVP A;  4XTC S;  5M3F G;  2A19 A;  2MQH A;  1WJJ A;  1IBM L;  1VQ7 A;  3GTK H;  3CQZ H;  3RN5 A;  3G71 A;  3ER0 A;  4JBK A;  3KF8 B;  5C44 H;  4DR5 Q;  2UUB Q;  4X65 L;  1IBK L;  2MO1 A;  2IX1 A;  2RF4 A;  2K5V A;  4GLV B;  3DLL A;  2L15 A;  3AFP A;  1KXL A;  5IYC H;  3BU2 A;  1I94 L;  3K7U C;  3FKI G;  4AQY L;  1PH6 A;  2PMZ E;  4NPS A;  1YBY A;  3RZD H;  1VQI A;  2EIF A;  3UDI A;  5IYC G;  1TWH H;  2A8V A;  1X56 A;  1SRU A;  1HZC A;  4J15 A;  2N8N A;  3PV0 A;  1N36 L;  3CME A;  1JT8 A;  1WFQ A;  3STB D;  4K0K L;  5IYB H;  5C44 G;  4IJH A;  3I4N G;  4YY3 L;  5C0X J;  4A3F H;  3G4S A;  4JV5 Q;  4A3L G;  3AYH B;  1EOV A;  1VQH A;  1GD7 A;  2WB1 E;  4UP9 A;  4LF7 Q;  2OCE A;  1IYJ B;  1N33 L;  1CSP A;  1CUK A;  1QUQ A;  2XTI A;  3KOJ A;  4P74 A;  1NJI C;  4LF8 Q;  3G6E A;  3CCL A;  3S1M H;  4KHP L;  1MJE A;  4QQB X;  1ASY A;  2LXK A;  3HOZ G;  3TQY A;  3IRB A;  1N32 Q;  2Z0S A;  2R7Z H;  5C0X G;  1IBL Q;  2E8G A;  2QGQ A;  2PNH A;  4DR1 L;  4X66 L;  1RL2 A;  2NVX H;  4PG3 A;  1EWI A;  4IPC A;  5EAY A;  3OYY A;  2PI2 E;  4HJ7 A;  4DV0 Q;  4A3J G;  1UE6 A;  1XPR A;  1EFW A;  2VQE Q;  3I4M H;  1BBW A;  3KLW A;  3ULL A;  3I4O A;  3E0E A;  1CKN A;  3UE1 A;  1QVF A;  4A3K H;  4LF5 L;  3GTM H;  4LF4 Q;  4GKJ Q;  2UXC Q;  3A0J A;  1H95 A;  2Z6K C;  3L0O A;  1VS0 A;  1IBK Q;  3CXC A;  1K73 C;  1XPO A;  3W1B A;  3H3V I;  3J80 i;  2K50 A;  2R7D A;  4DV2 L;  1HNZ Q;  2VUM G;  1EUJ A;  2OQK A;  3E9H A;  1OXV A;  1Q8K A;  3NEM A;  2WAQ G;  2QEX A;  3CCE A;  2YU9 H;  1HNX Q;  3PF4 A;  1UWV A;  4ME3 A;  3CAM A;  4DR4 Q;  2UU9 Q;  2AWO A;  3A74 A;  4HIM A;  3PCO B;  4YY3 Q;  1PH8 A;  3J7A 5;  1YEZ A;  4KLK A;  2UXB L;  1BVS A;  1C9O A;  4LW1 A;  4K0K Q;  4A3B H;  3DM3 A;  4DV6 Q;  4LF9 Q;  5LMN Q;  1YI2 A;  1PV4 A;  4EX5 A;  2CCZ A;  1G29 1;  3M4Q A;  2ES2 A;  4BY7 H;  1A8V A;  1XNR L;  4NXM L;  2PI2 A;  2YYZ A;  4JI4 Q;  2R93 H;  4GKK L;  3U4V A;  1YJW A;  2Q2I A;  3CC7 A;  5HGQ A;  5AJ3 Q;  3RN2 A;  1XPU A;  3CCU A;  1PFS A;  2JK8 A;  2IY5 B;  4DUZ L;  4DR5 L;  4MTN A;  4AQY Q;  2GVB A;  2R6G A;  4R4O A;  1V43 A;  4QL5 A;  5J3B A;  4JYA L;  2VL6 A;  2E2J H;  1UE1 A;  5M3F H;  4GNX B;  2VZA A;  4R4T A;  2XGT A;  3A5Z B;  2DUD A;  1A63 A;  4A3I H;  4YHH L;  4DV5 L;  1AE3 A;  3TEH B;  1LM0 A;  3HOX H;  4OX9 Q;  1UE7 A;  4HIO A;  5E7N A;  1HNZ L;  1JB7 A;  5IYD G;  4JI1 Q;  3Q8D A;  4AYB G;  1IXR A;  2CFM A;  4BY1 G;  4LF8 L;  3HOW H;  1Q46 A;  1VQF A;  3OW2 A;  3HOY H;  2UXD Q;  2YTY A;  4DAM A;  2JA6 G;  4PMW A;  3I56 A;  4A3M G;  4IJL A;  4PZ8 A;  4MNO A;  4TQU S;  2FXQ A;  4DR1 Q;  4JBJ A;  2F4V Q;  1FVI A;  1WOC A;  4A93 H;  4C3H H;  4B3T L;  1EIY B;  2R92 G;  3JAM c;  3GTJ H;  4B3M L;  4A3D G;  5C4X G;  4DR3 Q;  1X54 A;  5FJ8 G;  5AJ3 L;  1GKH A;  1PH2 A;  2ID0 A;  4DV7 Q;  4A3C G;  1VQB A;  2LXJ A;  3FHW A;  5HY6 A;  4DR4 L;  2B3G A;  2IX0 A;  4YCU A;  5M3M H;  5IP9 H;  1M1K C;  4R4C A;  5GAD C;  3E9I A;  2HIX A;  1PHJ A;  3U4Z A;  4LFA L;  1E1O A;  4OXP A;  4X62 L;  4A93 G;  1Q1E A;  2CQO A;  4L5Q A;  4YCW A;  1HZA A;  1KD1 C;  4JI3 Q;  4L5S A;  4BBR G;  1TWF H;  1KIX A;  3S15 H;  2VQE L;  1RIP A;  3RZO H;  4LF5 Q;  2CKZ B;  2KCT A;  4A3M H;  2R7F A;  2WB1 G;  4PZ7 A;  3RLF A;  3H3V H;  4LFB Q;  4JI5 Q;  1L1O B;  5IP7 H;  4NB3 A;  4GOP B;  1VQL A;  3JC6 6;  3CMA A;  2DGY A;  1NMF A;  4UP8 A;  4HIK A;  3EBE A;  2IT1 A;  4QIW E;  3KF6 B;  1Q1B A;  2ATW A;  4P72 A;  4R4I A;  2Z6K A;  2H5X A;  3F2B A;  2YTV A;  1JJ2 A;  1Y14 B;  2BH2 A;  1JE5 A;  5IP7 G;  4P73 A;  2JA5 H;  1L2F A;  1GM5 A;  4UP7 A;  3B6Y A;  4X64 Q;  2HHH L;  3CF5 A;  1HJP A;  1OXS C;  3PUW A;  2OWO A;  1EIF A;  1Q7Y C;  1YHB A;  1NBW A;  4A76 A;  4JI2 Q;  1R9T H;  4DV3 L;  4BXX G;  4YWM A;  4DUY Q;  2E5L L;  1G6P A;  1N8R C;  2KHJ A;  1XJV A;  1PH9 A;  4A3G H;  3CP0 A;  4POF A;  4HID A;  5IE8 A;  1D7Q A;  1FGU A;  2I5L X;  4APV A;  4HJA A;  5C0X I;  2Q2T A;  4KI0 A;  4ALP A;  1MIU A;  4RMF A;  5M5Y H;  5IP9 G;  4X64 L;  2WFW A;  3CC2 A;  3PO3 G;  2BH8 A;  3PUX A;  4YWK A;  3OTO L;  3M4P A;  2YV5 A;  4JI8 Q;  3G48 A;  1YNX A;  3S16 H;  5BR8 Q;  4A3E H;  3M3Y H;  4JBW A;  4X65 Q;  2MNA A;  4DR2 L;  1VQN A;  1X55 A;  1XNQ L;  4KHP Q;  5C4X H;  1N32 L;  1NE3 A;  2Y0S E;  4GLA C;  3CCV A;  4YCV A;  3UDX A;  3J80 c;  4HJ5 A;  4DR7 L;  2AWN A;  2K4K A;  2KEN A;  4GLX A;  4B3S Q;  1SR3 A;  3F2D A;  4JBM A;  1Y1W G;  2CWA A;  1TWG H;  1FL0 A;  2JE6 I;  3NBH B;  4RG1 A;  1HNW L;  1XNR Q;  2HIV A;  1VQE A;  3CCM A;  2RHQ B;  4TVA B;  4GN5 A;  2F52 A;  4A3K G;  4OWT B;  1S72 A;  2YTX A;  2HT1 A;  4B3S L;  4JI2 L;  3I4M G;  1VQP A;  4X6A H;  3M9B A;  1I3Q H;  4QJF A;  4DR7 Q;  4O0A A;  1YIJ A;  3KFU A;  1LUZ A;  1MJC A;  1JMC A;  4BY1 H;  4DAY B;  4IO9 A;  3CCR A;  4HJ9 A;  1YHQ A;  4GN4 B;  3A5U A;  5LMN W;  1VCI A;  3KDF A;  4DV2 Q;  1FJG Q;  4L5R C;  1SN8 A;  1B7Y B;  3J81 c;  3GTQ H;  3ICE A;  1XTD A;  3VDY A;  1QZH A;  4JI7 Q;  4A4I A;  3GTL H;  4LWC A;  3W5O A;  4BA2 I;  4DK3 C;  1KL9 A;  2UUB L;  2LSS A;  1PVO A;  1L0W A;  4DPG A;  1VQ6 A;  3HOV G;  1SRO A;  3CCJ A;  4DV6 L;  1SFO H;  4LF9 L;  4GKK Q;  3PO2 H;  4A3L H;  1IZ6 A;  2KHI A;  2NVQ H;  4A3F G;  1I5F A;  3BZK A;  3CC4 A;  2UXD L;  2UUC L;  2KBN A;  5IYB G;  3I4N H;  5K36 G;  1L1O A;  1XMQ L;  4C3I H;  4GNX C;  1BBU A;  3KDF B;  3J81 j;  1Q86 C;  3S24 A;  1CKN B;  2R93 G;  2BA1 A;  2JA9 A;  1CKM A;  1K83 H;  2VQF L;  3BJU A;  3CPF A;  2Q2H A;  3EIV A;  3FKI H;  1PH5 A;  1SE8 A;  4BY7 G;  2JJQ A;  4IFD I;  4B3R Q;  1PH3 A;  4A3B G;  1Y1V H;  3I2Z A;  4P75 A;  3K81 C;  3T1Y L;  4O2D A;  1KRT A;  4DV7 L;  3S1Q H;  1VQG A;  4JI5 L;  4PZ6 A;  3T1H L;  1J5E Q;  1O7I A;  4C3J H;  3TRE A;  3JAM i;  4HJ8 A;  1FJG L;  3HOV H;  3PUV A;  1G51 A;  3GD7 A;  4NXN L;  2JEB I;  2ASB A;  2K5N A;  4DUZ Q;  2HQL A;  1X3F A;  1E3P A;  3U50 C;  4X62 Q;  2UUA L;  3NEL A;  5LMU L;  1XMO L;  4A3J H;  2AKW B;  2K14 A;  4AH6 A;  5JJK A;  4IPD A;  3D0F A;  2C35 B;  1KRS A;  1WYD A;  2QA4 A;  1V1Q A;  4JI3 L;  3M7N A;  1KHI A;  1VQO A;  3GO5 A;  2JA7 G;  2VS1 A;  4GN3 B;  3RR5 A;  4JOI C;  4UPA A;  3NEN A;  4DV5 Q;  1WCM H;  4R4Q A;  1T9H A;  3STB C;  3S14 H;  2OTJ A;  1LYL A;  2ZTC A;  4MZ9 A;  1YHA A;  3PIO A;  1QZG A;  1Z9F A;  1Q12 A;  3CW2 C;  1CKO A;  3EN2 A;  4IPH A;  5IWA L;  4OX9 L;  2N3S A;  3HKZ E;  1XMO Q;  4GOP C;  3PGZ A;  3GTP H;  1Y1W H;  2ZJR A;  1PYS B;  2VW9 A;  3S1N H;  1LTL A;  1OXX K;  2PQA B;  1SLJ A;  5GRO A;  3RLN A;  4JI7 L;  1XNQ Q;  4GKJ L;  2K75 A;  1P8L A;  1QUQ B;  1EYG A;  3K7A H;  1VQD A;  4LUV A;  4H02 A;  4AYB E;  1Y1V G;  5JJL A;  1A62 A;  1TWC H;  1J5E L;  1IBM Q;  2IHF A;  1Q81 C;  3S2D H;  1J6Q A;  1X6O A;  3PUZ A;  2B63 G;  1I6H H;  1PH7 A;  1L1O C;  3PO3 H;  3HKS A;  2B29 A;  3TRZ A;  4FDB A;  4DKA C;  3D31 A;  4JI0 Q;  4LFC Q;  2PQA A;  2UU9 L;  4LF6 L;  1VQA A;  1TXY A;  4OO1 G;  4WJ3 M;  2VQF Q;  2RHS B;  1YIT A;  3H15 A;  4IOA A;  1S40 A;  4A3G G;  5FLM G;  2UUA Q;  3BZC A;  1AE2 A;  1SMX A;  3PO2 G;  4BBS H;  5JEA J;  1S3O A;  4OWX B;  4BXX H;  2Y0S G;  4UY8 C;  2NZO A;  3GTO H;  1K3R A;  1B8A A;  3CCS A;  2NZH A;  1X9N A;  3AQQ A;  3F1Z A;  5GAE C;  1NY4 A;  1X65 A;  1KAW A;  2D0P A;  3H0G G;  4JOI A;  5ELN A;  3ULJ A;  5GAG C;  1VQ5 A;  1N34 Q;  5H1S E;  4LUO A;  3HFZ B;  1N9W A;  4DV4 Q;  1IL2 A;  3FP9 A;  3T1H Q;  4JYA Q;  1TWA H;  3KJO A;  1UEB A;  4OO1 I;  2GN5 A;  4LUZ A;  2ZTD A;  3CPW A;  1EQR A;  1X3E A;  1JJC B;  4A75 A;  5LMN L;  1YJN A;  1VQJ A;  5C3E G;  3UDF A;  4JI1 L;  1QVC A;  1HH2 P;  1V9P A;  2EQS A;  4R1J A;  4DV1 Q;  1NMG A;  4GNX A;  3UDG A;  1U5K A;  2A1A A;  2K52 A;  4JG2 A;  4AIM A;  5IY0 A;  2ZM6 Q;  1JJG A;  3AEV A;  3GDE A;  3PUY A;  1AH9 A;  4Y7N H;  2V1C C;  1A0I A;  4DR2 Q;  1N36 Q;  3M85 A;  1E7Z A;  4C2M H;  1B70 B;  1I50 H;  4A3E G;  2UXC L;  3TS2 A;  2K5H A;  4YWL A;  2JA8 H;  2NVY H;  3F2C A;  3HOU G;  3MXN B;  3HOU H;  1OXT A;  3ZJY C;  3M4O H;  3CD6 A;  4A3C H;  1OTC A;  2EXD A;  2F4V L;  4NXN Q;  2I5H A;  1W3S A;  2CWP A;  2NN6 I;  5FJ8 H;  3UE0 A;  3U58 A;  4BA1 I;  4GS3 A;  4B3M Q;  4IOC A;  1QVG A;  4A3D H;  1I94 Q;  2R92 H;  5GQO A;  1EQQ A;  1M90 C;  4LFB L;  2N49 A;  4LNQ A;  2ZJQ A;  4POG A;  5C4J H;  5ELO A;  2D0O A;  1P16 A;  2AMC B;  1IBL L;  1VQC A;  2NN6 G;  5IT9 c;  3ULP A;  2E2H H;  4LFC L;  2RCN A;  4JI0 L;  1PH4 A;  3CCQ A;  4JI4 L;  4OON A;  4B3R L;  4JI6 Q;  2D62 A;  1U0L A;  3SGI A;  3KYH C;  3TS0 A;  1K8G A;  2JA5 G;  2HHH Q;  4DR6 L;  3RNU A;  3WWV A;  4LF6 Q;  1C0A A;  1E22 A;  1YZ6 A;  3K0X A;  1MKH A;  3HOW G;  2N78 A;  1HNX L;  2IHE A;  4LF7 L;  2BA0 A;  3H0G H;  1VQM A;  3HOX G;  3ERS X;  4XIG S;  4B3T Q;  2AHO B;  3F8T A;  5GAH C;  2I0Q A;  3LGJ A;  3PIP A;  3PSI A;  4JC0 A;  2MO0 A;  4IFD J;  4BBR H;  4BBS G;  5BR8 L;  4WJ4 A;  1HR0 W;  5FLM H;  4JI8 L;  4DV4 L;  1BKB A;  4NXM Q;  1VQK A;  5JJI A;  3GTG H;  5FLX c;  3T1Y Q;  2MFI A;  1PH1 A;  3HKZ G;  2ZJP A;  1YJ9 A;  1K8A C;  3S17 H;  4LFA Q;  5IWA Q;  1ASZ A;  5M3M G;  1HR0 Q;  2NVT H;  4P71 A;  2OTL A;  1Q82 C;  5M5X H;  4JCV E;  4IPG A;  4DV1 L;  2WP8 J;  2JQO A;  3W1G A;  1E1T A;  2B63 H;  4JV5 L;  4DV3 Q;  4EQ5 A;  3KF6 A;  2VY3 A;  1OXU A;  3J7Z C;  1NTG A;  4DUY L;  2E5L Q;  3MEF A;  2JA8 G;  2UXB Q;  1WI5 A;  1N33 Q;  2I5M X;  5JEA G;  1XMQ Q;  1HNW Q;  1GO3 E;  3I55 A;  1D8L A;  4GOP A;  1VQ8 A;  3S2H H;  4OWW B;  4DR6 Q;  2VNU D;  5LMU Q;  2UUC Q;  2ALY B;  4IFD G;  5DLQ E;  3KJP A;  1X3G A;  4DR3 L;  1Z47 A;  4YHH Q;  1N34 L;  2KCM A;  1HR0 L;  1E24 A;  1PYB A;  2VUM H;  2JEA I;  1UE5 A;  3OTO Q;  4DV0 L;  2WAQ E;  1K0R A;  4X66 Q;  1C7Y A;  2F3I A;  1YVC A;  5C3E H;  1KQS A;  4LF4 L;  3L7Z C;  1W2B A;  2ZTE A;  4QGU A;  1WCM G;  3I7F A;  2JA6 H;  2JA7 H;  3S1R H;  1VQ4 A;  1PA6 A;  3AFQ A;  3HOY G;  3J81 i;  3PF5 A;  5IYD H;  2R7Z G;  4DNI A;  2GVA A;  3L2P A;  1KC8 C;  1VQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...