4JOIA

Crystal structure of the human telomeric stn1-ten1 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
160
structure length
141
Chain Sequence
b'LAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKVYDQPFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CST complex subunit STN1
publication title Structure of the human telomeric stn1-ten1 capping complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 39
structure length 141
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4joiA00
4UY8C 4WJ3M 1VQ6A 1L1OB 4A3EH 5IY0A 3I2ZA 2K5VA 4OX9L 2HIVA 4DKAC 5GAEC 4BXXH 3OTOQ 1E22A 4O2DA 1IBLQ 4JI0L 4JBKA 4DR7Q 1IYJB 2UXCQ 1SRUA 1E1TA 2YYZA 3TREA 2KHJA 1HNZQ 5IYDH 2CWAA 4JI2L 3TS0A 2I0QA 3PUVA 4JI7Q 1G291 4YCUA 1IBMQ 3CPWA 2YTXA 2JE6I 4WJ4A 2ATWA 1LM0A 2JJQA 4BBRH 5C4XG 1X9NA 2HIXA 2BA0A 1JT8A 4A3BG 1N9WA 2QEXA 4IO9A 1PH8A 1WJJA 2AWNA 3GTPH 1YZ6A 5IYCH 1Q7YC 3UDGA 1NJIC 2K50A 2PNHA 1AE3A 3CC7A 1UE7A 1HNWL 3F2BA 5LMNQ 4OWWB 5FJ8G 1D8LA 4UPAA 4PZ7A 1YEZA 4LFAL 4DR6L 4JYAQ 4DR5L 1VQMA 3E9IA 3AYHB 5C0XG 3HOXG 1C0AA 3M7NA 1K9MC 4A93H 2A1AA 2AMCB 5GQOA 1Q1EA 1SLJA 2IX0A 2K4KA 3KF8B 4BY1G 3U4ZA 3S15H 4YHHQ 3KYHC 1C7YA 4HIDA 2IY5B 3AFPA 3NENA 3STBC 2VQFQ 3CMEA 2H5XA 1KL9A 3PF5A 4LNQA 1XPRA 3HOWG 1WCMG 3L0OA 1SR3A 1AE2A 3PUZA 1E24A 1Z47A 1PH1A 1HZCA 3CAMA 4A3JH 4NXNL 3RR5A 3K80C 3KOJA 3KJPA 2E2HH 4OO1G 4DR1Q 4LF8L 2WB1E 3G48A 4GN3B 4R4CA 4AIMA 5EAYA 4DV5Q 3CCSA 1YITA 5J3BA 2NVTH 4JI6L 1S72A 2R7ZG 3KDFB 3H3VI 3TQYA 3E9HA 1JJ2A 2NN6I 4QIWE 4YY3Q 2UU9Q 1CKNB 1CSPA 4JBJA 2OWOA 3STBD 1V1QA 3ULPA 1HNXL 4JI4Q 4GN5A 4A3FG 2R93G 1TWGH 1YJWA 3EBEA 4DK3C 5IP9H 3I4NH 1VQ9A 4DNIA 2UXCL 1K8GA 2VZAA 4OX9Q 3FP9A 2K14A 5IT9c 3S1NH 3L7ZC 1WFQA 2OQ0A 5LMUL 4YWKA 1E3PA 1K0RA 1X3EA 4RG1A 3CC4A 4JI7L 4P73A 2AHOB 3NEMA 4B3RL 4JI2Q 3I4MH 4A3KG 4IJLA 5AJ3Q 1YJNA 1PV4A 2N49A 1YI2A 2Q2HA 5IYBH 1VQ8A 2F4VQ 1IXRA 3KFUA 3EN2A 1HZ9A 4BA2I 4AYBG 4A3GH 5JEAG 3M4OH 2N78A 2JQOA 2LXJA 1KAWA 4UP7A 1I5FA 1Q46A 5C4JH 2JEBI 1YJ9A 1EFWA 3S1MH 1XPOA 1K8AC 2ZJQA 5BR8Q 4OWTB 4JYAL 1JJGA 1HNWQ 1YHAA 4DV1L 4A3DH 4JV5Q 3H0GH 4R1JA 4DUZQ 2UUBL 1N32L 1EOVA 4LFAQ 4DR6Q 4DR5Q 2DGYA 1TWAH 3T1HQ 1AH9A 1H95A 5GAGC 5M5XH 3ER0A 4QY7A 4L5SA 2YTVA 3UDIA 1YHQA 2D0PA 5M5YH 4LFBQ 1WOCA 1Y1VG 2JA6G 2QGQA 2N8NA 5LMNW 5C3EG 3S1RH 3S17H 5C44G 1TWHH 4LWCA 1IBKL 2NVQH 4JI5Q 2BH8A 4A75A 4P71A 1VQHA 3MEFA 4DR1L 3HKSA 1L2FA 4DV5L 1HR0L 2CCZA 1XNQL 2EIFA 4NPSA 1RL2A 1P8LA 4RMFA 4LF8Q 5DLQE 1PH4A 5K36G 4B3TL 1MKHA 4A3EG 3UDXA 3CCJA 4JI6Q 1OXXK 4H02A 4B3SQ 2JA7H 3PO3G 5H1SE 1Q12A 4R4QA 4YY3L 2UU9L 2NVYH 2HT1A 3J80i 3GTKH 1QUQA 2MO0A 3GO5A 3CCUA 2L15A 3KLWA 3PUYA 4GOPC 4UP9A 1VQFA 4OWXB 4DK6C 1VQNA 1HNXQ 3EIVA 4GOPA 1T9HA 5M3FH 3HOZG 5IP7G 3ZJYC 4X62L 4KHZA 3I56A 4MZ9A 3U4VA 2VQEL 1HZBA 2E5LQ 1JB7A 3AQQA 5M5WH 5LMUQ 2C35B 2NZHA 3D0FA 1Y14B 5JJIA 4POGA 4X6AH 1IZ6A 2IHEA 3BZCA 4JBWA 5AJ3L 1UWVA 3CCLA 4B3RQ 4A3MH 2F4VL 2I5HA 2B3GA 1NE3A 2ES2A 1B7YB 4IJHA 4LF6L 1KRSA 5FLMH 2Z6KA 4A3LH 2JA9A 1CSQA 3AFQA 5BR8L 3HOUG 3U50C 1YHBA 4HJ5A 4JV5L 4Y7NH 4DUZL 4ALPA 1WYDA 1QZHA 4GNXA 1YVCA 4DAMA 1SFOH 4LF9Q 1EQRA 2B63G 4DV1Q 1W2BA 3CCEA 2NN6G 1GD7A 3CCQA 3T1HL 1I94Q 2UUBQ 4LF7L 1N32Q 3CP0A 4XIGS 1VQCA 1B70B 1PH2A 3G4SA 4AQYQ 4LFBL 4IFDJ 4YCWA 1XMOQ 4L5QA 4DV6Q 2WB1G 4IOAA 1VQKA 3HOVG 3I55A 2UUAL 1FGUA 1Q1BA 3RLOA 2NZOA 4JI5L 1VQ4A 3CCVA 3BJUA 2Q2UA 4JI1Q 1SMXA 1IBKQ 3G6EA 1X6OA 2K5HA 2I5MX 1VQ5A 4GKJQ 2VS1A 4QQBX 3M4PA 2GN5A 1S3OA 2LXKA 2JA8G 4EQ5A 5M3MG 4DUYQ 3CW2C 2CFMA 1HR0Q 1XNQQ 3PCOB 1PH9A 5IP9G 2K52A 3F2CA 4DV4L 4B3SL 3I4NG 4B3TQ 4JI3L 1SE8A 1XNRQ 1IL2A 4A3BH 1X55A 2KHIA 1VQDA 2YTYA 4C2MH 5IWAQ 2JA5G 2QA4A 3Q8DA 1KRTA 2R92G 1KXLA 3CCMA 2ZTCA 4BY7G 2K75A 3NELA 2RCNA 2GVBA 5FJ8H 2PI2A 4C3IH 3FKIG 1QUQB 2E2IH 3I4MG 1ASYA 3K81C 2ASBA 2GVAA 3W1GA 2VW9A 5IYBG 1VQJA 1G51A 1X56A 1OXSC 2R7FA 2Y0SE 4X62Q 3HOXH 1U5KA 1A62A 2RHSB 4DV3Q 3J81i 4DPGA 1VQIA 2V1CC 2ZTEA 3M4QA 1OTCA 2E5LL 2HHHQ 4BY1H 1QVFA 4PG3A 4GOPB 3GTOH 1N36L 3HOWH 1PVOA 2VQEQ 3HOYH 1WCMH 2RF4A 1GKHA 2E8GA 3HKZE 1X65A 3H0GG 1VS0A 2XTIA 2F3IA 4DV2Q 3A0JA 2A8VA 2IHFA 1JMCA 2E2JH 3W5OA 1XMQQ 1KQSA 3PUXA 1VQGA 4TVAB 4B3MQ 2MNAA 1UEBA 4LF6Q 1XPUA 2A19A 3S1QH 4PMWA 4A3CG 1NMFA 4HJ8A 4HJ7A 2KBNA 5GROA 4HIMA 4L5RC 4JBMA 2R7ZH 1CKOA 4LF9L 2YV5A 2VUMG 1P16A 4LUVA 3PV0A 4PZ6A 1MJCA 1I94L 3CQZH 1UE6A 1J5EL 2WFWA 3H15A 3K0XA 4LF7Q 4AQYL 4QL5A 2VL6A 4LW1A 3PIOA 4GNXB 2D62A 1XMOL 5HGQA 1S40A 4DV6L 4BBSG 2I5LX 1VQBA 1Y1WG 4A3FH 3LGJA 1FL0A 2FXQA 1O7IA 4QGUA 3CMAA 3BZKA 1N8RC 2JA7G 2UUAQ 3J81c 3E0EA 4JI1L 1KIXA 3KJOA 2D0OA 4NXML 3ICEA 3GD7A 3A74A 4GKJL 3FHWA 1LTLA 2XGTA 2JEAI 4UP8A 1ASZA 4FDBA 4DUYL 5ELNA 4LF5L 1VQEA 2KCTA 3BU2A 4OONA 1OXVA 2BH2A 1XNRL 4GLXA 4DV4Q 4BXXG 1UE1A 4JI3Q 2B29A 5IWAL 4GS3A 4R4IA 2Q2IA 3CPFA 3JC66 4POFA 4DAYB 5IYDG 4TQUS 2BA1A 3TEHB 1A0IA 4A4IA 1EIYB 4LF4L 3B6YA 1HR0W 4DV3L 4BBRG 1VQPA 1N34Q 1LUZA 4DV7L 2HHHL 4A3IH 1CKMA 2DUDA 4IPHA 4PZ8A 1XTDA 4JC0A 5FLMG 3PF4A 4GKKQ 4DR4Q 5IYCG 3PO2H 1Q82C 2RHQB 3T1YQ 1Y1VH 1C9OA 3RN2A 4JI8Q 2JA6H 1N36Q 1BKBA 1KHIA 1I50H 4YWLA 5C44H 2R6GA 2F52A 4DV2L 1E7ZA 1TXYA 1NY4A 3W1BA 1XMQL 1QVGA 2Z6KC 4HIKA 4B3ML 4A93G 3M9BA 2NVXH 2EXDA 2ID0A 1L0WA 2KCMA 1JJCB 4P74A 3CD6A 1EWIA 3CXCA 4GNXC 1GVPA 4IFDG 1N33Q 2N3SA 4EX5A 1PH6A 3PO3H 3WWVA 3J80c 2PI2E 4KI0A 5FLXc 3PIPA 1YNXA 2WAQE 4YWMA 3ULJA 3RN5A 4A3JG 5E7NA 3U58A 2ALYB 3CCRA 1J5EQ 1K83H 4GLAC 3GTQH 1VQLA 1A63A 4C3HH 5ELOA 3D31A 3PUWA 4X65Q 1Z9FA 3GTMH 4GLVB 3RLFA 1NMGA 4DV0Q 3KF6A 3HOZH 3K7UC 5IP7H 1K3RA 3M85A 4IPDA 4GN4B 5GAHC 1NTGA 4HIOA 1D7QA 2JK8A 1HJPA 3AEVA 1VQ7A 1RIPA 3JAMi 4NXMQ 4MTNA 2K5NA 1FJGL 1FVIA 2AKWB 4APVA 2OCEA 2PQAA 3RLNA 4HJAA 1A8VA 4IFDI 3A5UA 1M90C 4BA1I 1PYSB 3I4OA 1PFSA 4LF5Q 5C4XH 2UXBQ 2CKZB 2WP8J 2Y0SG 1OXUA 2LSSA 4AH6A 1W3SA 3HOYG 2Z0SA 3HOUH 3S24A 1I6HH 1PYBA 1PH7A 4X66L 3CF5A 3F2DA 4P72A 4K0KQ 1HZAA 3G71A 2VNUD 3RNUA 3PSIA 5C0XJ 4DR3L 3H3VH 3DLLA 3HKZG 1N34L 2B63H 4NB3A 4LF4Q 1PH5A 4JG2A 2OQKA 2UUCL 4GKKL 4YCVA 4A3GG 4DR4L 4DV7Q 4QJFA 3UE1A 3T1YL 1KC8C 3MXNB 4JI8L 2ZM6Q 4IOCA 3TS2A 1SN8A 3HOVH 1UE5A 1M1KC 1MJEA 4DR2Q 4A3DG 3NBHB 3OYYA 1GM5A 3UDFA 1L1OC 4O0AA 4XTCS 5IE8A 1EUJA 3IRBA 4J15A 3JAMc 5C0XI 2OTLA 2YU9H 1E1OA 1L1OA 1BBWA 3RZDH 3GTLH 4X64Q 1N33L 3I7FA 2JA8H 5M3MH 4LFCQ 3L2PA 2UXDQ 2AWOA 2OTJA 1BBUA 4KHPQ 4DR7L 3OTOL 1QVCA 1IBLL 3S2HH 3F1ZA 1BVSA 1OXTA 1CUKA 4JI0Q 1TWFH 1X3FA 1EQQA 1HNZL 1YIJA 3J7ZC 3J7A5 3VDYA 4ME3A 1X3GA 2ZJRA 2JA5H 2R92H 1J6QA 4OO1I 1IBML 3TRZA 1NBWA 4X65L 4IPCA 3J81j 4BY7H 4DV0L 3FKIH 4MNOA 1U0LA 5JJKA 2R93H 1TWCH 2R7DA 1GO3E 5HY6A 2IX1A 5JJLA 1DGSA 2CWPA 3UE0A 3ULLA 4HJ9A 2VY3A 1K73C 4LUZA 1Q81C 1KD1C 3KF6B 2UXDL 5LMNL 1WI5A 1VCIA 3M3YH 1B8AA 3K8AA 1FJGQ 3CC2A 1YBYA 4P75A 4A3KH 2ZJPA 2ZTDA 5M3FG 2UXBL 1V43A 5JEAJ 4AYBE 4A3IG 4YHHL 4C3JH 2PQAB 1Q86C 1HH2P 2CQOA 3K7AH 2VQFL 2Q2TA 3PO2G 1G6PA 1PA6A 3RZOH 3S14H 1PH3A 2IT1A 4A3CH 2PMZE 1VQOA 3S2DH 4LUOA 4K0KL 2HQLA 3ERSX 3SGIA 2VUMH 3GTGH 3PGZA 4X66Q 1X54A 3OW2A 2MQHA 4A3MG 4DR3Q 1Q8KA 4NXNQ 4R4OA 3F8TA 2KENA 1LYLA 4KLKA 1QZGA 3KDFA 4L5TA 4Y52H 1PHJA 2UUCQ 1MIUA 4BBSH 2ZM6L 3DM3A 4A3LG 1V9PA 3S16H 1Y1WH 1CKNA 4R4TA 3GTJH 4DR2L 3GDEA 1VQAA 5GADC 5C3EH 1XJVA 4JCVE 3HFZB 4IPGA 2MFIA 2WAQG 2EQSA 1EYGA 3A5ZB 1R9TH 4JI4L 4JOIC 1EIFA 1SROA 1I3QH 4X64L 4LFCL 4OXPA 2MO1A 4A76A 1JE5A 4JOIA 4KHPL
chains in the Genus database with same CATH superfamily
2K5VA 5I2YA 5CR3A 1IYJB 2YYZA 3OW7A 5G3LF 3RD4A 2F0OA 4C2MB 1HNZQ 2CWAA 1KDCA 4JI2L 3TS0A 3A54A 3PUVA 5D3DA 2I0QA 1I6HB 2JE6I 1LTAD 2E2IB 2ZXRA 3NK9A 1X9NA 5F2DA 4IO9A 2AWNA 3G6JB 1YZ6A 1DYQA 1SE3A 1Q7YC 3P7JA 5KRUA 1AE3A 2K01A 4OWWB 5FJ8G 4UPAA 4ME5A 4DR5L 4HMJA 1E2ZA 3E9IA 2A6EC 1C0AA 1RTOA 1SFOH 2K4KA 3ZYYX 3AFPA 2VQFQ 4IUTA 4H7BA 3PUZA 2JA8B 1Z47A 1PH1A 1L0YB 2SNMA 3EFXD 4X3KA 3RR5A 3KJPA 3CQZB 1H9JA 3MHBA 4LF8L 1UNSA 5FO7B 4DV5Q 3CCSA 1YITA 4JI6L 4ZKBB 1S72A 4A3FB 1D5ZC 2NN6I 4KN4C 2B2WA 3ULPA 4JI4Q 4A3FG 5FLXL 3J80E 2UXCL 4IUNA 1K8GA 2VZAA 3FP9A 2K14A 4KV6A 3K7AB 1X3EA 1LV9A 2K5QA 3NEMA 1EY5A 4JI2Q 3I4MH 1B3AA 4R8NA 1STHA 4ZUJA 4IJLA 2N49A 3NWSA 2Q2HA 5IYBH 4BA2I 4PMCA 1KABA 5JEAG 1DCZA 1KAWA 4UP7A 5JVH3 3R8BA 3OMGA 2IWHA 5BR8Q 4OWTB 2Z4IA 1JJGA 2JA6B 2Z4HA 4JV5Q 2UUBL 1HTLD 1N32L 1EOVA 4ZCKA 5C3EB 2O2LD 4DR5Q 3T1HQ 1B53A 1MHWC 3NUCA 5M5XH 3ER0A 2EJFC 4L5SA 1SNMA 3UDIA 1R9TB 2A69D 2PZUA 2JA6G 4IUVA 5C3EG 5CGKA 3U9OA 2Q8IB 3R2IA 1IBKL 4JI5Q 4P71A 3HKSA 3BZDB 2EJGC 4NPSA 4LF8Q 1P8LA 4RMFA 5DLQE 4JI6Q 2XN9C 3GTMB 2EY5A 3PO3G 2WACA 4R4QA 2UU9L 3KLRA 2HT1A 3J80i 1QUQA 2L15A 3PUYA 4UP9A 1VQFA 4DK6C 4FF3A 4IALA 2CW0C 3EIVA 1F9SA 5CV6A 2F0JA 1SFOB 3URYA 1HZBA 4RKLA 2DJFC 2C35B 5JJIA 4POGA 2A68C 2F0EA 3TZDA 1IZ6A 5EBDA 3W2DA 5AJ3L 1EEFD 4JBWA 1NNXA 3SK4A 5DAUA 4BWGB 2F4VL 1STNA 4L63B 4LF6L 5KNDA 1KRSA 2Z6KA 4A3LH 2JA9A 3AFQA 3CHBD 5K5PA 3TP6A 3HS0C 4Y7NH 1DD2A 1WYDA 4QUCA 4Q5VA 2G5DA 4GNXA 4LAAA 2B63G 2UUBQ 1GD7A 1N32Q 3ONAB 3CP0A 3O13A 1PH2A 1F9RA 4LFBL 4IFDJ 4L5QA 2JN4A 1VQKA 2OF1A 2EYMA 2K28A 3IAYA 2HQEA 1D5XC 4K6DA 3CCVA 4JI1Q 1UUPA 1SMXA 1SDFA 4H13C 4WRDA 1IBKQ 1X6OA 2B2VC 4GKJQ 3HEJA 4CKEA 5EKKA 3M4PA 2GN5A 2R92B 3A8KE 3KLSA 4N8FA 3K5LA 1TS3A 2CFMA 3I4MB 3PCOB 2J4XA 3FKIB 4DV4L 1TWCB 1IL2A 5CORA 1F2YA 4KJOA 4A3BH 2EYOA 1VQDA 1HQRD 3MFGA 1BCPC 2R92G 1KRTA 3CCMA 3SK6A 1A63A 3I4MG 3FKIG 1DOLA 2ASBA 3W1GA 5IYBG 3HOXH 2Y0SE 1QVFA 3M4QA 1AZPA 2E5LL 4GOPB 2N88A 3GTOH 2RF4A 2F0DA 3RZOB 1GUSA 3HKZE 5HGTA 4KN7C 1MGSA 5I6YA 4DV2Q 3A0JA 2IHFA 1SNPA 2E2JH 3WDNA 4KY6A 5DNFA 4LF6Q 1XPUA 1I4XA 2G9HD 1NMFA 1SE4A 2KBNA 5GROA 4LF9L 2WFWA 1DJRD 3HGBA 3K0XA 4DU9A 2VL6A 1F2ZA 2D62A 2I5LX 2EYLA 3BVGA 2FXQA 2M00A 1SSOA 3X3NA 3J81c 2F0NA 2Q8TA 1KIXA 2E75C 5JVG3 3GQBA 3A74A 3FHWA 2J0TD 1LTLA 2XGTA 3I91A 3X3MA 2KEEA 1JOOA 1VQEA 4KHVA 1O7ZA 4DV4Q 4DAVA 4R4IA 3NQTA 1DZ1A 2BA1A 1FYCA 2LY7A 2PYKA 1A0IA 3B6YA 5IT9L 1CM9A 2JXMB 1BO0A 2HHHL 4LMQD 1EU4A 2FMMA 4PZ8A 4XQNA 1YNNC 4EQOA 4A93B 2RHQB 3S15B 1PFMA 2RDHA 1KHIA 4DNTB 3R2TA 2F52A 1IW7D 5NUCA 1TXYA 1QVGA 1D2BA 4HIKA 4B3ML 4A93G 2KCMA 2E2HB 1STGA 1EWIA 1NAPA 4EX5A 1PH6A 3J80c 4DXFA 1YNXA 4YWMA 1PTOB 3VR3A 3K59A 3NHHA 1K83H 4EQNA 3ND8A 3D31A 1LT5D 1Z9FA 2B39A 1A2TA 2B8GA 4DV0Q 3MTSA 2SEBD 3M85A 1Y69U 1NTGA 3AEVA 2NWGA 3S1NB 2BE5D 4APVA 4DNRB 2OCEA 2L55A 3QG1A 4HJAA 3A5UA 3I4OA 1U4RA 2UXBQ 4PV1C 1DOMA 4AH6A 4A3GB 2NUCA 3S24A 1PH7A 5ELBA 1I4QA 3G71A 2MUYA 2HCIA 3PSIA 3H6MA 1TQOA 1AZQA 2H1EA 4GKKL 4YCVA 2IW3A 4A3GG 4DR4L 4RH6A 1TWAB 2KJXA 3MXNB 2B2UC 2ZM6Q 5M5YB 1UE5A 5DM63 1GHJA 3MXGA 3NBHB 1GM5A 2O5JC 1MBYA 1L1OC 3OHXC 4RWSC 3VYUA 4PQXA 4O0AA 4MN3A 5IE8A 3JAMc 2K7VA 1EQTA 3Q0AA 1BNZA 2YU9H 3DHQA 1PTOC 1EY9A 4FF1A 3KK7A 3GV6A 1N33L 4CDCC 5M3MH 4DR7L 3OTOL 1IBLL 4YIJA 3UI2A 1FNUA 3S2HH 1II3A 3F1ZA 1BVSA 3BVMA 1X3FA 1KNAA 2NVYB 3WOFA 3OIPA 4ME3A 1X3GA 5JPNC 3TRZA 1NBWA 5D14A 3FMCA 2RSNA 4BY7H 1CZWA 2R93H 2R7DA 5HY6A 1HUMA 1A2UA 3ULLA 3IKJA 1WI5A 2K05A 3K5NA 1CA6A 5M5WB 1YBYA 4N9TA 5JEAJ 1U4PA 4L8JA 1K8MA 2PQAB 1VDZA 1Q86C 2R3ZA 1WTVA 1PA6A 1CTMA 3ND9A 3FPUB 2QEJC 4K0KL 2IT1A 3ERSX 3GTGH 2VXWA 2VUMH 3PGZA 2XWJB 3OW2A 1YNJC 2MQHA 2K1BA 1LYLA 4L5TA 1MIUA 3V96A 1EZ6A 4BBSH 2WAQB 3S16H 1Y1WH 4IUQA 2AQ2B 2D5DA 2DJGC 3FPPA 5C4HA 1VQAA 1QG7A 3VYRA 4ZYSA 2WAQG 3A5ZB 2VB3X 4RGMA 1I3QH 1QILA 4LFCL 4OXPA 2UXDL 2N55A 4JOIA 5ELFA 4KKSA 4UY8C 1BOSA 5GAEC 4DKAC 3VR6A 3OTOQ 4DR7Q 4JI0L 1IBLQ 4X3UA 4ZUIA 2KHJA 4ZQ3A 5IGDA 3BDOA 2YTXA 2MPMA 2ATWA 2JJQA 4BBRH 3DEOA 2QEXA 3OIQA 1JORA 2L0CA 4BY1B 4ODGA 5A2QE 3SXHA 3HOWB 1ET6A 4JYAQ 1C4QA 1XWEA 5IIFA 1CT1D 2DY8A 4MHEA 1IKMA 3OSOA 4HSVA 1K9MC 5CV5A 3KF8B 1SLJA 3U4ZA 4BY1G 1X3PA 2JYOA 3NENA 3STBC 3HOWG 3CMEA 3PF5A 1KL9A 3S1QB 2PO4A 1SR3A 3N52A 4G7ZC 4RAUC 4A3JH 3S2HB 1IL8A 1IYVA 1NR2A 2G9DA 2WB1E 4J1MA 4JVZA 1K0SA 2R93B 1W6KA 2A6ED 1XX8A 4H0LC 2EJMA 4ZKCB 4YY3Q 5LHY1 1CKNB 1FNVA 1E2VA 2F0PA 1RCVD 2LS01 5JOBA 5BN5A 2LFNA 2ZT9C 4KKTA 2R93G 1TWGH 1PYWD 5IP9H 3I4NH 1VQ9A 1EYCA 2Z8LA 1G2TA 2L9HA 4B08A 1CHPD 5LMUL 3MEHA 4AYBB 1CI3M 2F0MA 2EVBA 4YWKA 1E3PA 3GTGB 4CJ1B 2VUMB 2F4IA 1PV4A 2A6HC 1RF2D 1STEA 1VQ8A 1KTKA 1HZ9A 1WD0A 4AYBG 3M4OH 1YJ9A 5C4JH 1Q46A 3S1MH 4BBSB 1Q8IA 2IJ0A 1YHAA 3T13A 4OELB 4A3DH 4DUZQ 4FF2A 1EY8A 4K6LA 1WVLA 5GAGC 4FNFA 3M4YA 5FKAC 1PRTF 4NMZA 4K2KA 1I3QB 5ISRA 5LMNW 3S1RH 3S17H 3J7AV 4LWCA 4JK1C 4A75A 2L5TA 3NPPA 2PW7A 1L2FA 4DFAA 4DV5L 1BQQT 1TR5A 1HR0L 2CCZA 3DWQA 3NTKA 4C3HB 3SK5A 5K36G 1PH4A 4B3TL 1LTSD 1OXXK 4H02A 4B3SQ 2JA7H 2C5CA 1EY7A 1Q12A 3IFDA 1HFGA 4K8JA 2ZXPA 2MO0A 2F1MA 2XWBB 3GO5A 1HTPA 3KLWA 4RKBA 4C3HG 4OWXB 1VQNA 3VR2A 1B9MA 2QDLA 5C6AA 4X62L 5M3FH 3LX0A 4KHZA 1S5CD 4G7HC 3U4VA 1JB7A 5LMUQ 3L9AX 1L0XB 2EOTA 3HOUB 2IHEA 2QDBA 4XT1B 1UWVA 3J81E 5KGUA 4A3MH 2PNRC 2B3GA 1NE3A 1DOKA 1B7YB 1VMPA 4DN4M 5J39A 2F0QA 2FFKB 5JAVA 5BR8L 4DXGA 3HOUG 1K28A 3V2TA 4JV5L 1ZXTA 3Q23A 1QZHA 3HOVB 4DAMA 1DONA 1EQRA 1U4MA 3OMCA 3CCEA 2NN6G 3T1HL 3CCQA 3C2PA 4XIGS 1EYAA 2DNCA 2EYPA 4C56C 2F0TA 4AQYQ 1H9SA 4DV6Q 4IOAA 3HOVG 3GTLB 1GXDC 1FGUA 1Q1BA 2NZOA 1S4ZA 4JI5L 3I4NB 1Z7TA 2NB0A 3G6EA 1TWFB 2VS1A 1GHKA 2IX3A 1CFMA 3AB9A 4L6TB 2LXKA 2JA8G 5C5MA 4EQ5A 4F7XA 4DUYQ 1HR0Q 5IP9G 2K52A 4U673 3F2CA 3I4NG 1QOHA 4B3TQ 2FINB 2CH4A 1XNRQ 2K33A 2YTYA 5IWAQ 3QIAA 4K14A 1V1PA 2BCOA 5C4JB 5ELDA 4WFN3 4C3IH 2PI2A 1EWCA 4KKUA 4DV3Q 1ILPA 4X62Q 1PH9A 2FHTA 1FNWA 5CC4A 3J81i 1VQIA 2ZTEA 3M7GA 1OTCA 4I65A 4PG3A 3NE5B 2F3VA 1WCMH 2XSCA 4CKCA 4UHVA 3S2DB 5I9OA 1VS0A 2SOBA 3TZUA 1XMQQ 3PUXA 3D3RA 1UEBA 2F3WA 4PMWA 4A3CG 1GUTA 3I90A 2P5ZX 2R7ZH 3GTJB 2YV5A 1P16A 3PV0A 2JA7B 4XQJA 1A15A 2E76C 4QL5A 3MWYW 1SYFA 1TS5A 2DY7A 1S40A 1Y8NB 1F9PA 3LGJA 4QGUA 3CMAA 2JA7G 4FXKC 4JI1L 2WV6D 1F2MA 4GKJL 1ZKOA 3GD7A 5C5LA 1STYA 5JPMC 5ELNA 1OXVA 4GLXA 3JAME 1UE1A 1QCBD 3EROA 2B29A 4RA8A 3JC66 4DAYB 1HUNA 1ML0D 1V1OA 1G6ZA 4LF4L 2SDFA 3AMUA 1N34Q 1A3UA 4R8IA 1LUZA 1TU2B 2B2YA 1BCPB 2DUDA 2PZTA 2NZ1D 1UEAB 1Y1VH 1C9OA 5CBAE 4JI8Q 1BKBA 1I50H 5C44H 2R6GA 3CRKC 4DV2L 2F0UA 1QWYA 1E7ZA 1NR4A 1TIID 1TS2A 2RSOA 4NP5A 3M9BA 3VA5A 3DUZA 1SMYD 3CXCA 2N3SA 4M1UB 4FVMA 1JOKA 4FO2A 3WWVA 3RN5A 1B4OA 1YNND 2FMCA 5E7NA 2E2DC 4XQQA 1EY0A 1ENCA 3BDCA 4C3IB 3HOZH 5IP7H 2SNSA 4MIUA 2JK8A 4WJWA 4KY7A 1VQ7A 1RIPA 2Y0SB 3JAMi 4S3SA 2K5NA 1FJGL 1FVIA 3A8JE 4F87A 1O7YA 3QWNA 1A8VA 2X6LA 1AW7A 1PYSB 4K5WA 3HKZB 2B8FA 2X6GA 2Y0SG 2LSSA 3SR1A 1CHQD 4F8MA 2VNUD 3SHLA 1JOQA 4P72A 3L3OC 3RNUA 1TT2A 5ELEA 3H3VH 2D9UA 3HKZG 1RJTA 4C1NI 4ZLTF 4LF4Q 5LL6X 1UAPA 2AQ3B 4HTHA 4IZ8A 4Z9CB 1KC8C 1RDPD 2XNAC 5M5XB 3TS2A 1SN8A 1TS4A 5J1ZA 4OIKA 4DR2Q 3UDFA 5C0XI 2OTLA 5JJZA 3E0JA 1E1OA 4NKLA 1ENFA 2D2CC 4X64Q 3ERQA 2F0VA 1NCVA 3LWUA 4KHPQ 2RA4A 1OXTA 1NSNS 3A7AB 4OO1I 4ZRZA 3T53B 2ZJRA 2JA5H 1EIHA 1IBML 1PFBA 2BDNA 4DV0L 3VR4A 2KOLA 3HG9A 3HRZC 2E74C 2IX1A 4IN3A 1SNQA 2CWPA 5D65A 3NP8A 2Z9HA 1PTOD 4HJ9A 1K73C 1JICA 3KF6B 1GUNA 5EJWA 3KLSX 4HAEA 3EVQA 3K8AA 3SVMA 1FJGQ 1D6EC 2ZTDA 2ZJPA 2UXBL 1LTTD 3BDLA 4C3JH 1STBA 2CVRA 4PNYA 3HZXA 3S14H 2PMZE 2F0KA 4LUOA 2HQLA 3SGIA 4Y7NB 1Q8KA 4NXNQ 4KLKA 1QZGA 1SYDA 2Z1CA 1NUCA 4A3LG 2ZM6L 3DM3A 2KECA 2EXZA 1XJVA 3I73A 1IHZA 1HA5A 2MFIA 4XXEA 2KA7A 1HFNA 4JOIC 3H91A 1SROA 1QNUA 2MO1A 3I8ZA 1JE5A 4WJ3M 3MXUA 1L1OB 4A3EH 3I2ZA 4OX9L 3I70A 4BXXH 2F03A 2QKIC 3TREA 4A3BB 1R4QB 3D8GA 1SJED 4XDXA 5IYDH 4ZK9B 4JI7Q 3J81L 2AUJD 1IBMQ 3CPWA 4ILWA 3D6WA 1E0BA 3GP7A 2HIXA 2AUKA 2BA0A 4RCOA 4A3BG 1EEID 3HOXB 3GTPH 5IYCH 3UDGA 1NJIC 3PIP3 2K50A 3CC7A 3GTOB 2Q8RE 3F2BA 2KEDA 4PZ7A 4LFAL 5IOCA 2A73B 3R93A 3HOXG 3M7NA 1Q1EA 2IX0A 2E2JB 5IGEA 5EKLA 3KYHC 1SYCA 4I7ZC 1C7YA 2IY5B 2B2TA 1AP0A 4LNQA 1XPRA 3RMHA 4RHSA 2OEOA 1ICFB 1D5MC 1HZCA 1XTCD 3CAMA 2MGSA 3AU7A 3K80C 2KQ3A 1JB3A 4DR1Q 1GUWA 1PRTB 2IPKD 2B2VA 3G48A 4GN3B 4R4CA 4AIMA 5EAYA 4ULLA 3P75A 3KDFB 2PQEA 3H3VI 3TQYA 2C9OA 4QIWE 1CSPA 4JBJA 3K58A 3STBD 2EE1A 1HNXL 1MSHA 3TN2A 1SNOA 3J80L 4GN5A 4HSPA 4IUUA 4DK3C 5I4DA 4OX9Q 3L7ZC 4C3JB 2OQ0A 1AEXA 4HR7B 3S14B 1WTOA 2AHOB 3OPOA 3TP7A 1YJNA 4FYDA 4ZAIA 3EN2A 3KFUA 1PZKD 4H44C 2LXJA 1I5FA 1DM0B 3DEPA 1XPOA 1K8AC 2ZJQA 4JYAL 3H0GH 1KNEA 4OHJA 4LFAQ 5I9PA 3SE0A 2MP1A 1AH9A 1H95A 4QY7A 1YHQA 3MZ5A 2QGQA 1PRTC 3ITPA 2A6HD 3NQIA 2R61A 4A3EB 1PFNA 2BH8A 3T4AC 1VQHA 1K83B 2QILA 2WKCA 4NW2A 4A3EG 1SNCA 2X69A 4YY3L 4CDDC 2WKDA 1WTQA 3MXPA 4RFBA 4UDUC 1HNXQ 1HCZA 4GOPA 1RKNA 2EY2A 1EYDA 3I56A 2DN8A 2I46A 2VQEL 1GUOA 3PMFA 2NZHA 1Y14B 4CDFC 1AFPA 4X6AH 5BN3A 3BZCA 4R9WA 4FF4A 3Q22A 2ES2A 1RODA 4IJHA 3DWAA 1KLUD 3C46A 3T56B 3GV3A 1X32A 1CSQA 2EY1A 2NBFA 4DA2A 2BE5C 2EYFA 3U50C 3VR5A 3NWTA 1YHBA 4HJ5A 4DUZL 2WB1B 1YVCA 1W2BA 1A3TA 2F0IA 1I94Q 5IGGA 4LF7L 5KNBA 5EQ0A 3G4SA 3FRPB 3A7LA 4YCWA 1XMOQ 2YU9B 2WB1G 3I55A 2AQ1B 1ONLA 3RLOA 5M3MB 2CQAA 4XYQA 1VQ4A 3BJUA 2Q2UA 1B2TA 4DF7A 1KDBA 1VMCA 4QQBX 4RGOS 4CHTB 1S3OA 1EIGA 2TMPA 5M3MG 3IFTA 4BY7B 4B3SL 4JI3L 1SE8A 1QNKA 1X55A 2B2WC 4C2MH 3Q8DA 4WORA 4BY7G 2K75A 3NELA 2RCNA 2GVBA 5FK9C 5FJ8H 2E2IH 1QUQB 1ASYA 3K81C 3H0GB 1X56A 3SEBA 2R7FA 3CCLA 1C8CA 1A62A 2RHSB 4HMIA 2V1CC 2Z6BA 1R4PB 1N36L 1PVOA 1LACA 1PLFA 1BDOA 2VQEQ 3HOYH 1B3QA 1H9MA 3H0GG 1KLGD 2XTIA 3V05A 1RTNA 1JWSD 3W5OA 5E3FA 1PTOF 2KVMA 3C1FA 4TVAB 1RD9D 5FOBB 4QF4A 3E6ZX 1SE2A 3OOCA 4HJ7A 3S16B 2VUMG 1Y1WB 4JBMA 1CKOA 3QOLA 4LUVA 2F0SA 3TP5A 1MJCA 2L1BA 3CQZH 2L4NA 3H15A 3J7AF 3PQIA 3D4DA 4LF7Q 4AQYL 2RBMA 2LKVA 4HEDA 3LWEA 4O1NA 4GNXB 4BBSG 5HGQA 4DV6L 1Y1WG 4A3FH 1EY4A 1FL0A 4Q0FA 5T1GA 3BZKA 1N8RC 4K8IA 1S5BD 3E0EA 1FR3A 1LT4D 3A8IE 3ICEA 3FVQA 4UAIA 1ASZA 4FDBA 4DUYL 1HA6A 5DEHA 2J7ZA 1PZJD 1I4HA 2KCTA 3BU2A 4OONA 5CBEE 5IGFA 2BH2A 1XNRL 1STAA 4F88A 4BBRB 4JI3Q 1T5XD 5IWAL 1AN8A 1DXMA 3CPFA 4POFA 1QJOA 4TQUS 4B9WA 4QCLA 3K5MA 3TEHB 4A4IA 2B2YC 3EA6A 3MXNA 4DV3L 4BBRG 2ICEC 5CYUA 4A3IH 4FXGC 1G2SA 1XTDA 2PCFB 4JC0A 3NBHA 3PF4A 3PO2H 3T1YQ 3RN2A 4EQPA 2JA6H 1N36Q 1XXGA 5CMDA 1ESRA 1F9QA 1NY4A 4DK0A 1XMQL 2Z6KC 4A3JB 4O42A 1JJCB 4P74A 4GNXC 2CW0D 1BR9A 2GA4B 1JR0D 5C3XA 3PO3H 1LTGD 1H9RA 4KI0A 5FLXc 3PIPA 4A3JG 3CCRA 1VQLA 2CH4W 4J6HA 3TMEA 2EZVA 1ET9A 4V190 3PUWA 1MD2D 1O7LA 2A68D 4V0BA 4X65Q 3GTMH 4KD3A 5EBCA 1NMGA 3K7UC 5COYA 4IPDA 1TWGB 4GN4B 5GAHC 1TVXA 4HIOA 2RVLA 1HJPA 3G7LA 1SBBB 3EJIA 1GJXA 3HOYB 1U4LA 2PQAA 3D4RA 3RLNA 1KDAA 1LTRD 2JSOA 1M90C 4TSSA 4BA1I 1PFSA 5C4XH 2CKZB 2WP8J 2HCCA 3HOYG 3K5OA 3M4OB 3HP3A 4B9XA 3S1MB 3R3OA 1MSGA 1N34L 2B63H 2ZXOA 4NB3A 4A3DB 1ZEQX 4JG2A 3VYSA 5C0XH 4CKBA 3UE1A 2A74C 2EY6A 4JI8L 4IOCA 3BVZA 1M1KC 3H09A 2KCNA 4A3DG 3OYYA 3S1RB 4ID6A 1PDQA 4JW0A 3S17B 4XTCS 1EL0A 1EUJA 1BCPD 4OO1H 2JP1A 1BBWA 1U9RA 3RZDH 4FXDA 3L2PA 1LTID 4J8QA 1BBUA 1O78A 1BUVT 1TY2A 2XRQD 1CUKA 1EQQA 3J7ZC 2R92H 1FD7D 1LT6D 3FKIH 1U0LA 4XYOA 1TWCH 5A35A 5M3FB 5IODA 2HDMA 4A3IB 2VY3A 4LUZA 1FGBD 1M8AA 5LMNL 3PO2B 1CA5A 3M3YH 2L12A 1B8AA 2M2LA 3KF8A 4X3SA 3PIO3 4M8AA 4P75A 4A3KH 5M3FG 4K5XA 1ZYRC 4A3IG 3K0YA 4A3MB 4YHHL 1HH2P 2CQOA 2Q2TA 3PO2G 1G6PA 1CQVA 1ILQA 4KK7A 3RZOH 1PH3A 4N8X1 4X3TA 1X54A 3A55A 1JE4A 4A3MG 3PO3B 3QB3A 4R4OA 3F8TA 2KENA 1PHJA 1HPCA 1Z6HA 4NDXA 1V9PA 4KD4A 1CKNA 3D6CA 4DR2L 4HCEA 3GDEA 1HQMC 2F0FA 2FJ2A 4IPGA 1IYUA 2K5WA 3N6RA 5E1FA 5C3WA 1EYGA 4X64L 4KHPL 1VQ6A 1MI2A 4HN7A 5IY0A 4KTAA 4LK1C 2HIVA 1E22A 4O2DA 5DM73 4JBKA 2UXCQ 5C4XB 1SRUA 1E1TA 1BXTA 3SDZA 2OT2A 1G291 4YCUA 2K04A 2M9VA 4WJ4A 1SJHD 1LM0A 5C4XG 2B63B 5I2XA 2PZWA 2BDOA 1JT8A 1N9WA 1PH8A 1WJJA 4DAPA 1HXYD 5LL6S 5A2QL 1VF7A 2PNHA 1UE7A 1HNWL 2RDFA 5EPKA 5LMNQ 1D8LA 4C3IG 1YEZA 1WCMB 4DR6L 2VB2X 1VQMA 3AYHB 5C0XG 2B2TC 4A93H 2A1AA 2AMCB 4KY5A 5GQOA 3S15H 4YHHQ 1JCKB 4HIDA 3RZDB 2H5XA 1WCMG 2LMCB 3L0OA 4HCSA 1AE2A 1E24A 4KMUC 3NTIA 2EYHA 2R7ZB 4NXNL 1D1IA 3P1HA 1B9NA 3KOJA 4EGVA 2E2HH 4OO1G 2ENBA 2F0HA 3QO2A 2NVTH 5J3BA 4PMBA 2R7ZG 2RDGA 1GUGA 1CK1A 3NSWA 1PTOH 4KJNA 1JQYD 3E9HA 4E6IA 1JJ2A 2UU9Q 3CKIB 5EPLA 2OWOA 3WOEA 1V1QA 1S5DD 1S5FD 3M3YB 2QW7A 4BS9A 3MFYA 1I4PA 5AFWA 1YJWA 3EBEA 4A3KB 1Y8PB 4DNIA 1M4VA 5EGTA 4CGYB 2CHBD 3SK8A 1T5EA 5IT9c 3S1NH 1WFQA 5L37A 3K6OA 1K0RA 4RG1A 3CC4A 4JI7L 4P73A 2A69C 3W3AA 4B3RL 1WTXA 4A3KG 1EU3A 5AJ3Q 2PMZB 1YI2A 2TSSA 1TKWB 2F4VQ 4TKOB 1IXRA 4A3GH 2N78A 2JQOA 1EFWA 2JEBI 3NTHA 1Y1VB 3S9WA 1HNWQ 2I07B 4DV1L 4R1JA 4DR6Q 1G91A 1I50B 2RCFA 5C44B 2DGYA 1TWAH 2MJ8A 1EWHA 4GZYC 2YTVA 3DM1A 2D0PA 5M5YH 4LFBQ 1WOCA 1Y1VG 4QMGA 3KUPA 2K5DA 2A5HA 2N8NA 5C44G 1JC7A 1TWHH 2NVQH 4EVOA 3MEFA 4TRDA 4DR1L 1SYBA 1XNQL 1ENAA 2EIFA 1RL2A 1EOTA 3MVVA 5CV4A 1MKHA 3UDXA 3CCJA 3CRLC 2WINB 4CJ0B 5H1SE 3HOZB 2NVYH 3TSSA 3GTKH 2EDGA 2PPBC 3KBXA 5I6WA 3CCUA 4GOPC 1PRTD 1SMYC 1JWMD 3DXJC 1T9HA 1YNJD 1EQVA 3HOZG 5IP7G 3ZJYC 1ICWA 1LO5D 1WTPA 5EPJA 4MZ9A 5IGBA 2E5LQ 4C1NK 2HDLA 4CJ2C 3AQQA 5M5WH 3D0FA 1TY0A 3NBIA 3QOJA 1XYIA 4RHRA 4U68A 4B3RQ 1EY6A 2I5HA 3BG3A 1I4RA 5FLMH 3RUZA 2XIWA 1BBXC 2O5IC 4N9PA 1G8ZD 2NVTB 4ALPA 2V4DA 5T1IA 4LF9Q 3NXWA 3D4WA 4DV1Q 3IL8A 3U9SA 1VQCA 1B70B 1ESFA 3E5SA 4QIWB 5G3LD 3I4LA 3J7YW 4G4KA 2UUAL 4IFDH 1PZID 1LABA 2IL8A 1KAAA 2XVSA 2ICIA 1Q3LA 2K5HA 4I7AA 2I5MX 1VQ5A 2JA5B 4XT3B 3CW2C 1XNQQ 4DAYA 1BCPF 2KHIA 1WTWA 1A3VA 2NTTA 2QA4A 2JA5G 1KXLA 4JPBW 4IURA 3BS1A 2ZTCA 5KEEA 2GVAA 2VW9A 3VYTA 1VQJA 5FLXE 1G51A 1OXSC 1U5KA 4DPGA 2HHHQ 3H3VC 4BY1H 1HRJA 2KUMA 3HOWH 1GKHA 2E8GA 1X65A 5FO9B 2F3IA 2A8VA 1B44D 1D1KA 3T51B 1TWHB 2RKSA 1JMCA 2NVQB 1KQSA 1VQGA 4C3JG 2KHSA 5IGCA 4B3MQ 3C1EA 2MNAA 3MC0B 2A19A 3S1QH 4HJ8A 4HIMA 4L5RC 3E3XA 4PZ6A 1I94L 1UE6A 2DNEA 1Y8OB 3TP8A 1J5EL 4QB4A 3GTKB 1W6JA 4FP5D 4LW1A 1I4GA 3PIOA 1XMOL 4G7OC 1VQBA 1SYEA 1O7IA 2UUAQ 5KIXA 1JWUD 4OL7A 1BF4A 1H9SB 3KJOA 1C48A 1S5ED 2D0OA 5J22A 3H94A 4NXML 1B1ZA 3A56A 2F0LA 4MTKA 2F0GA 3Q6SA 2JEAI 4ABNA 4UP8A 1A6XA 2WIIB 3T16A 2QF7A 4LF5L 5KYLA 3F2UA 3JAML 4RCNA 4BXXG 1IW7C 5EKIA 4GS3A 2Q2IA 1GOZA 2MHVA 3GTPB 5IYDG 5CV8A 5KNCA 2K32A 3C3LA 2HUGA 1PXUA 2PW5A 1EIYB 1HR0W 1F77A 1V1PB 3QR8A 1VQPA 1SEBD 4DV7L 1CKMA 4IPHA 4OEMB 5FLMG 4GKKQ 4IQZA 4DR4Q 5IYCG 1Q82C 1CZGA 2OXPA 3K57A 5HURA 1RHPA 1PMRA 4YWLA 2K03A 1X3QA 3W1BA 2F0WA 4OGQC 1O80A 2NVXH 2EXDA 2ID0A 1L0WA 3CD6A 5K36H 1GVPA 4IFDG 1N33Q 2EYJA 3DWPA 3BYYB 4LJZC 2PI2E 2WAQE 3ULJA 1LT3D 3U58A 2ALYB 3I3CA 1J5EQ 4GLAC 3GTQH 4C3HH 5ELOA 1CQFA 4OIJA 2KCCA 2RQXA 4G57A 4GLVB 3RLFA 3KF6A 3LNNA 1K3RA 4IUPA 1SYGA 1D7QA 3OWFA 1VF5C 5CV7A 3FEWX 1WD1A 4NXMQ 4MTNA 2AKWB 4IFDI 2O4XA 4LF5Q 2EPBA 3CU7A 1K3BC 5KYIA 1OXUA 1W3SA 1WTRA 2Z0SA 1EFID 3I72A 3HOUH 1I6HH 1PYBA 4X66L 3CF5A 3F2DA 4K0KQ 1SNDA 1HZAA 4K2LA 5FO8B 1QE6A 5C0XJ 4DR3L 3DLLA 3MA2B 5ELCA 5BN4A 1F2LA 2NN6H 3MAQA 1PH5A 2OQKA 2UUCL 2NTSA 4DV7Q 4QJFA 3T1YL 2XRSD 3BYTB 5TSSA 3HOVH 1QB5D 1MJEA 2B2UA 1I6VC 3IRBA 4J15A 1WTHA 1L1OA 2HD3A 5M9OA 1IKLA 3GTLH 3KBGA 4CBVA 4DGZA 3I7FA 2JA8H 4LFCQ 3VA7A 2AWOA 2OTJA 2UXDQ 4RGTA 1QVCA 4JI0Q 1TWFH 3FDTA 1HNZL 1YIJA 1SXTA 3QJYA 3J7A5 3VDYA 1J6QA 3TDQA 1LLRD 4X65L 4IPCA 3J81j 3DMUA 1V8QA 4MNOA 5JJKA 1GO3E 3EQLC 2BOSA 5E4WC 5JJLA 1DGSA 2H4OA 4RGNA 3UE0A 1Q81C 1KD1C 1VCIA 5E4XA 1Q90A 3CC2A 2L11A 2K6AA 5C4ZA 4DK1A 1H9KA 1V43A 4AYBE 1SAPA 3K7AH 2VQFL 5JEAH 2NVXB 1J9OA 2QCPX 4CDEC 4A3CH 1VQOA 3S2DH 1K8OA 4X66Q 4K5VA 4P2CB 4DR3Q 1LTBD 5IT9E 4QUFA 3KDFA 5D3IB 4Y52H 2UUCQ 1E2WA 3GTQB 1HHVA 4R4TA 3GTJH 1J8IA 2NYZD 3P20A 1ZYRD 5GADC 5C3EH 3Q24A 4JCVE 3TBIB 3HFZB 1B50A 1EZ8A 3OWEB 2EQSA 1R9TH 4JI4L 1EIFA 5CV9A 4A76A 1OO9B
chains in the Genus database with same CATH topology
4UY8C 4WJ3M 1VQ6A 1L1OB 4A3EH 5IY0A 3I2ZA 2K5VA 4OX9L 2HIVA 4DKAC 5GAEC 4BXXH 3OTOQ 1E22A 4O2DA 1IBLQ 4JI0L 4JBKA 4DR7Q 1IYJB 2UXCQ 1SRUA 1E1TA 2YYZA 3TREA 2KHJA 1HNZQ 5IYDH 2CWAA 4JI2L 3TS0A 2I0QA 3PUVA 4JI7Q 1G291 4YCUA 1IBMQ 3CPWA 2YTXA 2JE6I 4WJ4A 2ATWA 1LM0A 2JJQA 4BBRH 5C4XG 1X9NA 2HIXA 2BA0A 1JT8A 4A3BG 1N9WA 2QEXA 4IO9A 1PH8A 1WJJA 2AWNA 3GTPH 1YZ6A 5IYCH 1Q7YC 3UDGA 1NJIC 2K50A 2PNHA 1AE3A 3CC7A 1UE7A 1HNWL 3F2BA 5LMNQ 4OWWB 5FJ8G 1D8LA 4UPAA 4PZ7A 1YEZA 4LFAL 4DR6L 4JYAQ 4DR5L 1VQMA 3E9IA 3AYHB 5C0XG 3HOXG 1C0AA 3M7NA 1K9MC 4A93H 2A1AA 2AMCB 5GQOA 1Q1EA 1SLJA 2IX0A 2K4KA 3KF8B 4BY1G 3U4ZA 3S15H 4YHHQ 3KYHC 1C7YA 4HIDA 2IY5B 3AFPA 3NENA 3STBC 2VQFQ 3CMEA 2H5XA 1KL9A 3PF5A 4LNQA 1XPRA 3HOWG 1WCMG 3L0OA 1SR3A 1AE2A 3PUZA 1E24A 1Z47A 1PH1A 1HZCA 3CAMA 4A3JH 4NXNL 3RR5A 3K80C 3KOJA 3KJPA 2E2HH 4OO1G 4DR1Q 4LF8L 2WB1E 3G48A 4GN3B 4R4CA 4AIMA 5EAYA 4DV5Q 3CCSA 1YITA 5J3BA 2NVTH 4JI6L 1S72A 2R7ZG 3KDFB 3H3VI 3TQYA 3E9HA 1JJ2A 2NN6I 4QIWE 4YY3Q 2UU9Q 1CKNB 1CSPA 4JBJA 2OWOA 3STBD 1V1QA 3ULPA 1HNXL 4JI4Q 4GN5A 4A3FG 2R93G 1TWGH 1YJWA 3EBEA 4DK3C 5IP9H 3I4NH 1VQ9A 4DNIA 2UXCL 1K8GA 2VZAA 4OX9Q 3FP9A 2K14A 5IT9c 3S1NH 3L7ZC 1WFQA 2OQ0A 5LMUL 4YWKA 1E3PA 1K0RA 1X3EA 4RG1A 3CC4A 4JI7L 4P73A 2AHOB 3NEMA 4B3RL 4JI2Q 3I4MH 4A3KG 4IJLA 5AJ3Q 1YJNA 1PV4A 2N49A 1YI2A 2Q2HA 5IYBH 1VQ8A 2F4VQ 1IXRA 3KFUA 3EN2A 1HZ9A 4BA2I 4AYBG 4A3GH 5JEAG 3M4OH 2N78A 2JQOA 2LXJA 1KAWA 4UP7A 1I5FA 1Q46A 5C4JH 2JEBI 1YJ9A 1EFWA 3S1MH 1XPOA 1K8AC 2ZJQA 5BR8Q 4OWTB 4JYAL 1JJGA 1HNWQ 1YHAA 4DV1L 4A3DH 4JV5Q 3H0GH 4R1JA 4DUZQ 2UUBL 1N32L 1EOVA 4LFAQ 4DR6Q 4DR5Q 2DGYA 1TWAH 3T1HQ 1AH9A 1H95A 5GAGC 5M5XH 3ER0A 4QY7A 4L5SA 2YTVA 3UDIA 1YHQA 2D0PA 5M5YH 4LFBQ 1WOCA 1Y1VG 2JA6G 2QGQA 2N8NA 5LMNW 5C3EG 3S1RH 3S17H 5C44G 1TWHH 4LWCA 1IBKL 2NVQH 4JI5Q 2BH8A 4A75A 4P71A 1VQHA 3MEFA 4DR1L 3HKSA 1L2FA 4DV5L 1HR0L 2CCZA 1XNQL 2EIFA 4NPSA 1RL2A 1P8LA 4RMFA 4LF8Q 5DLQE 1PH4A 5K36G 4B3TL 1MKHA 4A3EG 3UDXA 3CCJA 4JI6Q 1OXXK 4H02A 4B3SQ 2JA7H 3PO3G 5H1SE 1Q12A 4R4QA 4YY3L 2UU9L 2NVYH 2HT1A 3J80i 3GTKH 1QUQA 2MO0A 3GO5A 3CCUA 2L15A 3KLWA 3PUYA 4GOPC 4UP9A 1VQFA 4OWXB 4DK6C 1VQNA 1HNXQ 3EIVA 4GOPA 1T9HA 5M3FH 3HOZG 5IP7G 3ZJYC 4X62L 4KHZA 3I56A 4MZ9A 3U4VA 2VQEL 1HZBA 2E5LQ 1JB7A 3AQQA 5M5WH 5LMUQ 2C35B 2NZHA 3D0FA 1Y14B 5JJIA 4POGA 4X6AH 1IZ6A 2IHEA 3BZCA 4JBWA 5AJ3L 1UWVA 3CCLA 4B3RQ 4A3MH 2F4VL 2I5HA 2B3GA 1NE3A 2ES2A 1B7YB 4IJHA 4LF6L 1KRSA 5FLMH 2Z6KA 4A3LH 2JA9A 1CSQA 3AFQA 5BR8L 3HOUG 3U50C 1YHBA 4HJ5A 4JV5L 4Y7NH 4DUZL 4ALPA 1WYDA 1QZHA 4GNXA 1YVCA 4DAMA 1SFOH 4LF9Q 1EQRA 2B63G 4DV1Q 1W2BA 3CCEA 2NN6G 1GD7A 3CCQA 3T1HL 1I94Q 2UUBQ 4LF7L 1N32Q 3CP0A 4XIGS 1VQCA 1B70B 1PH2A 3G4SA 4AQYQ 4LFBL 4IFDJ 4YCWA 1XMOQ 4L5QA 4DV6Q 2WB1G 4IOAA 1VQKA 3HOVG 3I55A 2UUAL 1FGUA 1Q1BA 3RLOA 2NZOA 4JI5L 1VQ4A 3CCVA 3BJUA 2Q2UA 4JI1Q 1SMXA 1IBKQ 3G6EA 1X6OA 2K5HA 2I5MX 1VQ5A 4GKJQ 2VS1A 4QQBX 3M4PA 2GN5A 1S3OA 2LXKA 2JA8G 4EQ5A 5M3MG 4DUYQ 3CW2C 2CFMA 1HR0Q 1XNQQ 3PCOB 1PH9A 5IP9G 2K52A 3F2CA 4DV4L 4B3SL 3I4NG 4B3TQ 4JI3L 1SE8A 1XNRQ 1IL2A 4A3BH 1X55A 2KHIA 1VQDA 2YTYA 4C2MH 5IWAQ 2JA5G 2QA4A 3Q8DA 1KRTA 2R92G 1KXLA 3CCMA 2ZTCA 4BY7G 2K75A 3NELA 2RCNA 2GVBA 5FJ8H 2PI2A 4C3IH 3FKIG 1QUQB 2E2IH 3I4MG 1ASYA 3K81C 2ASBA 2GVAA 3W1GA 2VW9A 5IYBG 1VQJA 1G51A 1X56A 1OXSC 2R7FA 2Y0SE 4X62Q 3HOXH 1U5KA 1A62A 2RHSB 4DV3Q 3J81i 4DPGA 1VQIA 2V1CC 2ZTEA 3M4QA 1OTCA 2E5LL 2HHHQ 4BY1H 1QVFA 4PG3A 4GOPB 3GTOH 1N36L 3HOWH 1PVOA 2VQEQ 3HOYH 1WCMH 2RF4A 1GKHA 2E8GA 3HKZE 1X65A 3H0GG 1VS0A 2XTIA 2F3IA 4DV2Q 3A0JA 2A8VA 2IHFA 1JMCA 2E2JH 3W5OA 1XMQQ 1KQSA 3PUXA 1VQGA 4TVAB 4B3MQ 2MNAA 1UEBA 4LF6Q 1XPUA 2A19A 3S1QH 4PMWA 4A3CG 1NMFA 4HJ8A 4HJ7A 2KBNA 5GROA 4HIMA 4L5RC 4JBMA 2R7ZH 1CKOA 4LF9L 2YV5A 2VUMG 1P16A 4LUVA 3PV0A 4PZ6A 1MJCA 1I94L 3CQZH 1UE6A 1J5EL 2WFWA 3H15A 3K0XA 4LF7Q 4AQYL 4QL5A 2VL6A 4LW1A 3PIOA 4GNXB 2D62A 1XMOL 5HGQA 1S40A 4DV6L 4BBSG 2I5LX 1VQBA 1Y1WG 4A3FH 3LGJA 1FL0A 2FXQA 1O7IA 4QGUA 3CMAA 3BZKA 1N8RC 2JA7G 2UUAQ 3J81c 3E0EA 4JI1L 1KIXA 3KJOA 2D0OA 4NXML 3ICEA 3GD7A 3A74A 4GKJL 3FHWA 1LTLA 2XGTA 2JEAI 4UP8A 1ASZA 4FDBA 4DUYL 5ELNA 4LF5L 1VQEA 2KCTA 3BU2A 4OONA 1OXVA 2BH2A 1XNRL 4GLXA 4DV4Q 4BXXG 1UE1A 4JI3Q 2B29A 5IWAL 4GS3A 4R4IA 2Q2IA 3CPFA 3JC66 4POFA 4DAYB 5IYDG 4TQUS 2BA1A 3TEHB 1A0IA 4A4IA 1EIYB 4LF4L 3B6YA 1HR0W 4DV3L 4BBRG 1VQPA 1N34Q 1LUZA 4DV7L 2HHHL 4A3IH 1CKMA 2DUDA 4IPHA 4PZ8A 1XTDA 4JC0A 5FLMG 3PF4A 4GKKQ 4DR4Q 5IYCG 3PO2H 1Q82C 2RHQB 3T1YQ 1Y1VH 1C9OA 3RN2A 4JI8Q 2JA6H 1N36Q 1BKBA 1KHIA 1I50H 4YWLA 5C44H 2R6GA 2F52A 4DV2L 1E7ZA 1TXYA 1NY4A 3W1BA 1XMQL 1QVGA 2Z6KC 4HIKA 4B3ML 4A93G 3M9BA 2NVXH 2EXDA 2ID0A 1L0WA 2KCMA 1JJCB 4P74A 3CD6A 1EWIA 3CXCA 4GNXC 1GVPA 4IFDG 1N33Q 2N3SA 4EX5A 1PH6A 3PO3H 3WWVA 3J80c 2PI2E 4KI0A 5FLXc 3PIPA 1YNXA 2WAQE 4YWMA 3ULJA 3RN5A 4A3JG 5E7NA 3U58A 2ALYB 3CCRA 1J5EQ 1K83H 4GLAC 3GTQH 1VQLA 1A63A 4C3HH 5ELOA 3D31A 3PUWA 4X65Q 1Z9FA 3GTMH 4GLVB 3RLFA 1NMGA 4DV0Q 3KF6A 3HOZH 3K7UC 5IP7H 1K3RA 3M85A 4IPDA 4GN4B 5GAHC 1NTGA 4HIOA 1D7QA 2JK8A 1HJPA 3AEVA 1VQ7A 1RIPA 3JAMi 4NXMQ 4MTNA 2K5NA 1FJGL 1FVIA 2AKWB 4APVA 2OCEA 2PQAA 3RLNA 4HJAA 1A8VA 4IFDI 3A5UA 1M90C 4BA1I 1PYSB 3I4OA 1PFSA 4LF5Q 5C4XH 2UXBQ 2CKZB 2WP8J 2Y0SG 1OXUA 2LSSA 4AH6A 1W3SA 3HOYG 2Z0SA 3HOUH 3S24A 1I6HH 1PYBA 1PH7A 4X66L 3CF5A 3F2DA 4P72A 4K0KQ 1HZAA 3G71A 2VNUD 3RNUA 3PSIA 5C0XJ 4DR3L 3H3VH 3DLLA 3HKZG 1N34L 2B63H 4NB3A 4LF4Q 1PH5A 4JG2A 2OQKA 2UUCL 4GKKL 4YCVA 4A3GG 4DR4L 4DV7Q 4QJFA 3UE1A 3T1YL 1KC8C 3MXNB 4JI8L 2ZM6Q 4IOCA 3TS2A 1SN8A 3HOVH 1UE5A 1M1KC 1MJEA 4DR2Q 4A3DG 3NBHB 3OYYA 1GM5A 3UDFA 1L1OC 4O0AA 4XTCS 5IE8A 1EUJA 3IRBA 4J15A 3JAMc 5C0XI 2OTLA 2YU9H 1E1OA 1L1OA 1BBWA 3RZDH 3GTLH 4X64Q 1N33L 3I7FA 2JA8H 5M3MH 4LFCQ 3L2PA 2UXDQ 2AWOA 2OTJA 1BBUA 4KHPQ 4DR7L 3OTOL 1QVCA 1IBLL 3S2HH 3F1ZA 1BVSA 1OXTA 1CUKA 4JI0Q 1TWFH 1X3FA 1EQQA 1HNZL 1YIJA 3J7ZC 3J7A5 3VDYA 4ME3A 1X3GA 2ZJRA 2JA5H 2R92H 1J6QA 4OO1I 1IBML 3TRZA 1NBWA 4X65L 4IPCA 3J81j 4BY7H 4DV0L 3FKIH 4MNOA 1U0LA 5JJKA 2R93H 1TWCH 2R7DA 1GO3E 5HY6A 2IX1A 5JJLA 1DGSA 2CWPA 3UE0A 3ULLA 4HJ9A 2VY3A 1K73C 4LUZA 1Q81C 1KD1C 3KF6B 2UXDL 5LMNL 1WI5A 1VCIA 3M3YH 1B8AA 3K8AA 1FJGQ 3CC2A 1YBYA 4P75A 4A3KH 2ZJPA 2ZTDA 5M3FG 2UXBL 1V43A 5JEAJ 4AYBE 4A3IG 4YHHL 4C3JH 2PQAB 1Q86C 1HH2P 2CQOA 3K7AH 2VQFL 2Q2TA 3PO2G 1G6PA 1PA6A 3RZOH 3S14H 1PH3A 2IT1A 4A3CH 2PMZE 1VQOA 3S2DH 4LUOA 4K0KL 2HQLA 3ERSX 3SGIA 2VUMH 3GTGH 3PGZA 4X66Q 1X54A 3OW2A 2MQHA 4A3MG 4DR3Q 1Q8KA 4NXNQ 4R4OA 3F8TA 2KENA 1LYLA 4KLKA 1QZGA 3KDFA 4L5TA 4Y52H 1PHJA 2UUCQ 1MIUA 4BBSH 2ZM6L 3DM3A 4A3LG 1V9PA 3S16H 1Y1WH 1CKNA 4R4TA 3GTJH 4DR2L 3GDEA 1VQAA 5GADC 5C3EH 1XJVA 4JCVE 3HFZB 4IPGA 2MFIA 2WAQG 2EQSA 1EYGA 3A5ZB 1R9TH 4JI4L 4JOIC 1EIFA 1SROA 1I3QH 4X64L 4LFCL 4OXPA 2MO1A 4A76A 1JE5A 4JOIA 4KHPL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UY8 C;  4WJ3 M;  1VQ6 A;  1L1O B;  4A3E H;  5IY0 A;  3I2Z A;  2K5V A;  4OX9 L;  2HIV A;  4DKA C;  5GAE C;  4BXX H;  3OTO Q;  1E22 A;  4O2D A;  1IBL Q;  4JI0 L;  4JBK A;  4DR7 Q;  1IYJ B;  2UXC Q;  1SRU A;  1E1T A;  2YYZ A;  3TRE A;  2KHJ A;  1HNZ Q;  5IYD H;  2CWA A;  4JI2 L;  3TS0 A;  2I0Q A;  3PUV A;  4JI7 Q;  1G29 1;  4YCU A;  1IBM Q;  3CPW A;  2YTX A;  2JE6 I;  4WJ4 A;  2ATW A;  1LM0 A;  2JJQ A;  4BBR H;  5C4X G;  1X9N A;  2HIX A;  2BA0 A;  1JT8 A;  4A3B G;  1N9W A;  2QEX A;  4IO9 A;  1PH8 A;  1WJJ A;  2AWN A;  3GTP H;  1YZ6 A;  5IYC H;  1Q7Y C;  3UDG A;  1NJI C;  2K50 A;  2PNH A;  1AE3 A;  3CC7 A;  1UE7 A;  1HNW L;  3F2B A;  5LMN Q;  4OWW B;  5FJ8 G;  1D8L A;  4UPA A;  4PZ7 A;  1YEZ A;  4LFA L;  4DR6 L;  4JYA Q;  4DR5 L;  1VQM A;  3E9I A;  3AYH B;  5C0X G;  3HOX G;  1C0A A;  3M7N A;  1K9M C;  4A93 H;  2A1A A;  2AMC B;  5GQO A;  1Q1E A;  1SLJ A;  2IX0 A;  2K4K A;  3KF8 B;  4BY1 G;  3U4Z A;  3S15 H;  4YHH Q;  3KYH C;  1C7Y A;  4HID A;  2IY5 B;  3AFP A;  3NEN A;  3STB C;  2VQF Q;  3CME A;  2H5X A;  1KL9 A;  3PF5 A;  4LNQ A;  1XPR A;  3HOW G;  1WCM G;  3L0O A;  1SR3 A;  1AE2 A;  3PUZ A;  1E24 A;  1Z47 A;  1PH1 A;  1HZC A;  3CAM A;  4A3J H;  4NXN L;  3RR5 A;  3K80 C;  3KOJ A;  3KJP A;  2E2H H;  4OO1 G;  4DR1 Q;  4LF8 L;  2WB1 E;  3G48 A;  4GN3 B;  4R4C A;  4AIM A;  5EAY A;  4DV5 Q;  3CCS A;  1YIT A;  5J3B A;  2NVT H;  4JI6 L;  1S72 A;  2R7Z G;  3KDF B;  3H3V I;  3TQY A;  3E9H A;  1JJ2 A;  2NN6 I;  4QIW E;  4YY3 Q;  2UU9 Q;  1CKN B;  1CSP A;  4JBJ A;  2OWO A;  3STB D;  1V1Q A;  3ULP A;  1HNX L;  4JI4 Q;  4GN5 A;  4A3F G;  2R93 G;  1TWG H;  1YJW A;  3EBE A;  4DK3 C;  5IP9 H;  3I4N H;  1VQ9 A;  4DNI A;  2UXC L;  1K8G A;  2VZA A;  4OX9 Q;  3FP9 A;  2K14 A;  5IT9 c;  3S1N H;  3L7Z C;  1WFQ A;  2OQ0 A;  5LMU L;  4YWK A;  1E3P A;  1K0R A;  1X3E A;  4RG1 A;  3CC4 A;  4JI7 L;  4P73 A;  2AHO B;  3NEM A;  4B3R L;  4JI2 Q;  3I4M H;  4A3K G;  4IJL A;  5AJ3 Q;  1YJN A;  1PV4 A;  2N49 A;  1YI2 A;  2Q2H A;  5IYB H;  1VQ8 A;  2F4V Q;  1IXR A;  3KFU A;  3EN2 A;  1HZ9 A;  4BA2 I;  4AYB G;  4A3G H;  5JEA G;  3M4O H;  2N78 A;  2JQO A;  2LXJ A;  1KAW A;  4UP7 A;  1I5F A;  1Q46 A;  5C4J H;  2JEB I;  1YJ9 A;  1EFW A;  3S1M H;  1XPO A;  1K8A C;  2ZJQ A;  5BR8 Q;  4OWT B;  4JYA L;  1JJG A;  1HNW Q;  1YHA A;  4DV1 L;  4A3D H;  4JV5 Q;  3H0G H;  4R1J A;  4DUZ Q;  2UUB L;  1N32 L;  1EOV A;  4LFA Q;  4DR6 Q;  4DR5 Q;  2DGY A;  1TWA H;  3T1H Q;  1AH9 A;  1H95 A;  5GAG C;  5M5X H;  3ER0 A;  4QY7 A;  4L5S A;  2YTV A;  3UDI A;  1YHQ A;  2D0P A;  5M5Y H;  4LFB Q;  1WOC A;  1Y1V G;  2JA6 G;  2QGQ A;  2N8N A;  5LMN W;  5C3E G;  3S1R H;  3S17 H;  5C44 G;  1TWH H;  4LWC A;  1IBK L;  2NVQ H;  4JI5 Q;  2BH8 A;  4A75 A;  4P71 A;  1VQH A;  3MEF A;  4DR1 L;  3HKS A;  1L2F A;  4DV5 L;  1HR0 L;  2CCZ A;  1XNQ L;  2EIF A;  4NPS A;  1RL2 A;  1P8L A;  4RMF A;  4LF8 Q;  5DLQ E;  1PH4 A;  5K36 G;  4B3T L;  1MKH A;  4A3E G;  3UDX A;  3CCJ A;  4JI6 Q;  1OXX K;  4H02 A;  4B3S Q;  2JA7 H;  3PO3 G;  5H1S E;  1Q12 A;  4R4Q A;  4YY3 L;  2UU9 L;  2NVY H;  2HT1 A;  3J80 i;  3GTK H;  1QUQ A;  2MO0 A;  3GO5 A;  3CCU A;  2L15 A;  3KLW A;  3PUY A;  4GOP C;  4UP9 A;  1VQF A;  4OWX B;  4DK6 C;  1VQN A;  1HNX Q;  3EIV A;  4GOP A;  1T9H A;  5M3F H;  3HOZ G;  5IP7 G;  3ZJY C;  4X62 L;  4KHZ A;  3I56 A;  4MZ9 A;  3U4V A;  2VQE L;  1HZB A;  2E5L Q;  1JB7 A;  3AQQ A;  5M5W H;  5LMU Q;  2C35 B;  2NZH A;  3D0F A;  1Y14 B;  5JJI A;  4POG A;  4X6A H;  1IZ6 A;  2IHE A;  3BZC A;  4JBW A;  5AJ3 L;  1UWV A;  3CCL A;  4B3R Q;  4A3M H;  2F4V L;  2I5H A;  2B3G A;  1NE3 A;  2ES2 A;  1B7Y B;  4IJH A;  4LF6 L;  1KRS A;  5FLM H;  2Z6K A;  4A3L H;  2JA9 A;  1CSQ A;  3AFQ A;  5BR8 L;  3HOU G;  3U50 C;  1YHB A;  4HJ5 A;  4JV5 L;  4Y7N H;  4DUZ L;  4ALP A;  1WYD A;  1QZH A;  4GNX A;  1YVC A;  4DAM A;  1SFO H;  4LF9 Q;  1EQR A;  2B63 G;  4DV1 Q;  1W2B A;  3CCE A;  2NN6 G;  1GD7 A;  3CCQ A;  3T1H L;  1I94 Q;  2UUB Q;  4LF7 L;  1N32 Q;  3CP0 A;  4XIG S;  1VQC A;  1B70 B;  1PH2 A;  3G4S A;  4AQY Q;  4LFB L;  4IFD J;  4YCW A;  1XMO Q;  4L5Q A;  4DV6 Q;  2WB1 G;  4IOA A;  1VQK A;  3HOV G;  3I55 A;  2UUA L;  1FGU A;  1Q1B A;  3RLO A;  2NZO A;  4JI5 L;  1VQ4 A;  3CCV A;  3BJU A;  2Q2U A;  4JI1 Q;  1SMX A;  1IBK Q;  3G6E A;  1X6O A;  2K5H A;  2I5M X;  1VQ5 A;  4GKJ Q;  2VS1 A;  4QQB X;  3M4P A;  2GN5 A;  1S3O A;  2LXK A;  2JA8 G;  4EQ5 A;  5M3M G;  4DUY Q;  3CW2 C;  2CFM A;  1HR0 Q;  1XNQ Q;  3PCO B;  1PH9 A;  5IP9 G;  2K52 A;  3F2C A;  4DV4 L;  4B3S L;  3I4N G;  4B3T Q;  4JI3 L;  1SE8 A;  1XNR Q;  1IL2 A;  4A3B H;  1X55 A;  2KHI A;  1VQD A;  2YTY A;  4C2M H;  5IWA Q;  2JA5 G;  2QA4 A;  3Q8D A;  1KRT A;  2R92 G;  1KXL A;  3CCM A;  2ZTC A;  4BY7 G;  2K75 A;  3NEL A;  2RCN A;  2GVB A;  5FJ8 H;  2PI2 A;  4C3I H;  3FKI G;  1QUQ B;  2E2I H;  3I4M G;  1ASY A;  3K81 C;  2ASB A;  2GVA A;  3W1G A;  2VW9 A;  5IYB G;  1VQJ A;  1G51 A;  1X56 A;  1OXS C;  2R7F A;  2Y0S E;  4X62 Q;  3HOX H;  1U5K A;  1A62 A;  2RHS B;  4DV3 Q;  3J81 i;  4DPG A;  1VQI A;  2V1C C;  2ZTE A;  3M4Q A;  1OTC A;  2E5L L;  2HHH Q;  4BY1 H;  1QVF A;  4PG3 A;  4GOP B;  3GTO H;  1N36 L;  3HOW H;  1PVO A;  2VQE Q;  3HOY H;  1WCM H;  2RF4 A;  1GKH A;  2E8G A;  3HKZ E;  1X65 A;  3H0G G;  1VS0 A;  2XTI A;  2F3I A;  4DV2 Q;  3A0J A;  2A8V A;  2IHF A;  1JMC A;  2E2J H;  3W5O A;  1XMQ Q;  1KQS A;  3PUX A;  1VQG A;  4TVA B;  4B3M Q;  2MNA A;  1UEB A;  4LF6 Q;  1XPU A;  2A19 A;  3S1Q H;  4PMW A;  4A3C G;  1NMF A;  4HJ8 A;  4HJ7 A;  2KBN A;  5GRO A;  4HIM A;  4L5R C;  4JBM A;  2R7Z H;  1CKO A;  4LF9 L;  2YV5 A;  2VUM G;  1P16 A;  4LUV A;  3PV0 A;  4PZ6 A;  1MJC A;  1I94 L;  3CQZ H;  1UE6 A;  1J5E L;  2WFW A;  3H15 A;  3K0X A;  4LF7 Q;  4AQY L;  4QL5 A;  2VL6 A;  4LW1 A;  3PIO A;  4GNX B;  2D62 A;  1XMO L;  5HGQ A;  1S40 A;  4DV6 L;  4BBS G;  2I5L X;  1VQB A;  1Y1W G;  4A3F H;  3LGJ A;  1FL0 A;  2FXQ A;  1O7I A;  4QGU A;  3CMA A;  3BZK A;  1N8R C;  2JA7 G;  2UUA Q;  3J81 c;  3E0E A;  4JI1 L;  1KIX A;  3KJO A;  2D0O A;  4NXM L;  3ICE A;  3GD7 A;  3A74 A;  4GKJ L;  3FHW A;  1LTL A;  2XGT A;  2JEA I;  4UP8 A;  1ASZ A;  4FDB A;  4DUY L;  5ELN A;  4LF5 L;  1VQE A;  2KCT A;  3BU2 A;  4OON A;  1OXV A;  2BH2 A;  1XNR L;  4GLX A;  4DV4 Q;  4BXX G;  1UE1 A;  4JI3 Q;  2B29 A;  5IWA L;  4GS3 A;  4R4I A;  2Q2I A;  3CPF A;  3JC6 6;  4POF A;  4DAY B;  5IYD G;  4TQU S;  2BA1 A;  3TEH B;  1A0I A;  4A4I A;  1EIY B;  4LF4 L;  3B6Y A;  1HR0 W;  4DV3 L;  4BBR G;  1VQP A;  1N34 Q;  1LUZ A;  4DV7 L;  2HHH L;  4A3I H;  1CKM A;  2DUD A;  4IPH A;  4PZ8 A;  1XTD A;  4JC0 A;  5FLM G;  3PF4 A;  4GKK Q;  4DR4 Q;  5IYC G;  3PO2 H;  1Q82 C;  2RHQ B;  3T1Y Q;  1Y1V H;  1C9O A;  3RN2 A;  4JI8 Q;  2JA6 H;  1N36 Q;  1BKB A;  1KHI A;  1I50 H;  4YWL A;  5C44 H;  2R6G A;  2F52 A;  4DV2 L;  1E7Z A;  1TXY A;  1NY4 A;  3W1B A;  1XMQ L;  1QVG A;  2Z6K C;  4HIK A;  4B3M L;  4A93 G;  3M9B A;  2NVX H;  2EXD A;  2ID0 A;  1L0W A;  2KCM A;  1JJC B;  4P74 A;  3CD6 A;  1EWI A;  3CXC A;  4GNX C;  1GVP A;  4IFD G;  1N33 Q;  2N3S A;  4EX5 A;  1PH6 A;  3PO3 H;  3WWV A;  3J80 c;  2PI2 E;  4KI0 A;  5FLX c;  3PIP A;  1YNX A;  2WAQ E;  4YWM A;  3ULJ A;  3RN5 A;  4A3J G;  5E7N A;  3U58 A;  2ALY B;  3CCR A;  1J5E Q;  1K83 H;  4GLA C;  3GTQ H;  1VQL A;  1A63 A;  4C3H H;  5ELO A;  3D31 A;  3PUW A;  4X65 Q;  1Z9F A;  3GTM H;  4GLV B;  3RLF A;  1NMG A;  4DV0 Q;  3KF6 A;  3HOZ H;  3K7U C;  5IP7 H;  1K3R A;  3M85 A;  4IPD A;  4GN4 B;  5GAH C;  1NTG A;  4HIO A;  1D7Q A;  2JK8 A;  1HJP A;  3AEV A;  1VQ7 A;  1RIP A;  3JAM i;  4NXM Q;  4MTN A;  2K5N A;  1FJG L;  1FVI A;  2AKW B;  4APV A;  2OCE A;  2PQA A;  3RLN A;  4HJA A;  1A8V A;  4IFD I;  3A5U A;  1M90 C;  4BA1 I;  1PYS B;  3I4O A;  1PFS A;  4LF5 Q;  5C4X H;  2UXB Q;  2CKZ B;  2WP8 J;  2Y0S G;  1OXU A;  2LSS A;  4AH6 A;  1W3S A;  3HOY G;  2Z0S A;  3HOU H;  3S24 A;  1I6H H;  1PYB A;  1PH7 A;  4X66 L;  3CF5 A;  3F2D A;  4P72 A;  4K0K Q;  1HZA A;  3G71 A;  2VNU D;  3RNU A;  3PSI A;  5C0X J;  4DR3 L;  3H3V H;  3DLL A;  3HKZ G;  1N34 L;  2B63 H;  4NB3 A;  4LF4 Q;  1PH5 A;  4JG2 A;  2OQK A;  2UUC L;  4GKK L;  4YCV A;  4A3G G;  4DR4 L;  4DV7 Q;  4QJF A;  3UE1 A;  3T1Y L;  1KC8 C;  3MXN B;  4JI8 L;  2ZM6 Q;  4IOC A;  3TS2 A;  1SN8 A;  3HOV H;  1UE5 A;  1M1K C;  1MJE A;  4DR2 Q;  4A3D G;  3NBH B;  3OYY A;  1GM5 A;  3UDF A;  1L1O C;  4O0A A;  4XTC S;  5IE8 A;  1EUJ A;  3IRB A;  4J15 A;  3JAM c;  5C0X I;  2OTL A;  2YU9 H;  1E1O A;  1L1O A;  1BBW A;  3RZD H;  3GTL H;  4X64 Q;  1N33 L;  3I7F A;  2JA8 H;  5M3M H;  4LFC Q;  3L2P A;  2UXD Q;  2AWO A;  2OTJ A;  1BBU A;  4KHP Q;  4DR7 L;  3OTO L;  1QVC A;  1IBL L;  3S2H H;  3F1Z A;  1BVS A;  1OXT A;  1CUK A;  4JI0 Q;  1TWF H;  1X3F A;  1EQQ A;  1HNZ L;  1YIJ A;  3J7Z C;  3J7A 5;  3VDY A;  4ME3 A;  1X3G A;  2ZJR A;  2JA5 H;  2R92 H;  1J6Q A;  4OO1 I;  1IBM L;  3TRZ A;  1NBW A;  4X65 L;  4IPC A;  3J81 j;  4BY7 H;  4DV0 L;  3FKI H;  4MNO A;  1U0L A;  5JJK A;  2R93 H;  1TWC H;  2R7D A;  1GO3 E;  5HY6 A;  2IX1 A;  5JJL A;  1DGS A;  2CWP A;  3UE0 A;  3ULL A;  4HJ9 A;  2VY3 A;  1K73 C;  4LUZ A;  1Q81 C;  1KD1 C;  3KF6 B;  2UXD L;  5LMN L;  1WI5 A;  1VCI A;  3M3Y H;  1B8A A;  3K8A A;  1FJG Q;  3CC2 A;  1YBY A;  4P75 A;  4A3K H;  2ZJP A;  2ZTD A;  5M3F G;  2UXB L;  1V43 A;  5JEA J;  4AYB E;  4A3I G;  4YHH L;  4C3J H;  2PQA B;  1Q86 C;  1HH2 P;  2CQO A;  3K7A H;  2VQF L;  2Q2T A;  3PO2 G;  1G6P A;  1PA6 A;  3RZO H;  3S14 H;  1PH3 A;  2IT1 A;  4A3C H;  2PMZ E;  1VQO A;  3S2D H;  4LUO A;  4K0K L;  2HQL A;  3ERS X;  3SGI A;  2VUM H;  3GTG H;  3PGZ A;  4X66 Q;  1X54 A;  3OW2 A;  2MQH A;  4A3M G;  4DR3 Q;  1Q8K A;  4NXN Q;  4R4O A;  3F8T A;  2KEN A;  1LYL A;  4KLK A;  1QZG A;  3KDF A;  4L5T A;  4Y52 H;  1PHJ A;  2UUC Q;  1MIU A;  4BBS H;  2ZM6 L;  3DM3 A;  4A3L G;  1V9P A;  3S16 H;  1Y1W H;  1CKN A;  4R4T A;  3GTJ H;  4DR2 L;  3GDE A;  1VQA A;  5GAD C;  5C3E H;  1XJV A;  4JCV E;  3HFZ B;  4IPG A;  2MFI A;  2WAQ G;  2EQS A;  1EYG A;  3A5Z B;  1R9T H;  4JI4 L;  4JOI C;  1EIF A;  1SRO A;  1I3Q H;  4X64 L;  4LFC L;  4OXP A;  2MO1 A;  4A76 A;  1JE5 A;  4JOI A;  4KHP L; 
#chains in the Genus database with same CATH topology
 2K5V A;  5I2Y A;  5CR3 A;  1IYJ B;  2YYZ A;  3OW7 A;  5G3L F;  3RD4 A;  2F0O A;  4C2M B;  1HNZ Q;  2CWA A;  1KDC A;  4JI2 L;  3TS0 A;  3A54 A;  3PUV A;  5D3D A;  2I0Q A;  1I6H B;  2JE6 I;  1LTA D;  2E2I B;  2ZXR A;  3NK9 A;  1X9N A;  5F2D A;  4IO9 A;  2AWN A;  3G6J B;  1YZ6 A;  1DYQ A;  1SE3 A;  1Q7Y C;  3P7J A;  5KRU A;  1AE3 A;  2K01 A;  4OWW B;  5FJ8 G;  4UPA A;  4ME5 A;  4DR5 L;  4HMJ A;  1E2Z A;  3E9I A;  2A6E C;  1C0A A;  1RTO A;  1SFO H;  2K4K A;  3ZYY X;  3AFP A;  2VQF Q;  4IUT A;  4H7B A;  3PUZ A;  2JA8 B;  1Z47 A;  1PH1 A;  1L0Y B;  2SNM A;  3EFX D;  4X3K A;  3RR5 A;  3KJP A;  3CQZ B;  1H9J A;  3MHB A;  4LF8 L;  1UNS A;  5FO7 B;  4DV5 Q;  3CCS A;  1YIT A;  4JI6 L;  4ZKB B;  1S72 A;  4A3F B;  1D5Z C;  2NN6 I;  4KN4 C;  2B2W A;  3ULP A;  4JI4 Q;  4A3F G;  5FLX L;  3J80 E;  2UXC L;  4IUN A;  1K8G A;  2VZA A;  3FP9 A;  2K14 A;  4KV6 A;  3K7A B;  1X3E A;  1LV9 A;  2K5Q A;  3NEM A;  1EY5 A;  4JI2 Q;  3I4M H;  1B3A A;  4R8N A;  1STH A;  4ZUJ A;  4IJL A;  2N49 A;  3NWS A;  2Q2H A;  5IYB H;  4BA2 I;  4PMC A;  1KAB A;  5JEA G;  1DCZ A;  1KAW A;  4UP7 A;  5JVH 3;  3R8B A;  3OMG A;  2IWH A;  5BR8 Q;  4OWT B;  2Z4I A;  1JJG A;  2JA6 B;  2Z4H A;  4JV5 Q;  2UUB L;  1HTL D;  1N32 L;  1EOV A;  4ZCK A;  5C3E B;  2O2L D;  4DR5 Q;  3T1H Q;  1B53 A;  1MHW C;  3NUC A;  5M5X H;  3ER0 A;  2EJF C;  4L5S A;  1SNM A;  3UDI A;  1R9T B;  2A69 D;  2PZU A;  2JA6 G;  4IUV A;  5C3E G;  5CGK A;  3U9O A;  2Q8I B;  3R2I A;  1IBK L;  4JI5 Q;  4P71 A;  3HKS A;  3BZD B;  2EJG C;  4NPS A;  4LF8 Q;  1P8L A;  4RMF A;  5DLQ E;  4JI6 Q;  2XN9 C;  3GTM B;  2EY5 A;  3PO3 G;  2WAC A;  4R4Q A;  2UU9 L;  3KLR A;  2HT1 A;  3J80 i;  1QUQ A;  2L15 A;  3PUY A;  4UP9 A;  1VQF A;  4DK6 C;  4FF3 A;  4IAL A;  2CW0 C;  3EIV A;  1F9S A;  5CV6 A;  2F0J A;  1SFO B;  3URY A;  1HZB A;  4RKL A;  2DJF C;  2C35 B;  5JJI A;  4POG A;  2A68 C;  2F0E A;  3TZD A;  1IZ6 A;  5EBD A;  3W2D A;  5AJ3 L;  1EEF D;  4JBW A;  1NNX A;  3SK4 A;  5DAU A;  4BWG B;  2F4V L;  1STN A;  4L63 B;  4LF6 L;  5KND A;  1KRS A;  2Z6K A;  4A3L H;  2JA9 A;  3AFQ A;  3CHB D;  5K5P A;  3TP6 A;  3HS0 C;  4Y7N H;  1DD2 A;  1WYD A;  4QUC A;  4Q5V A;  2G5D A;  4GNX A;  4LAA A;  2B63 G;  2UUB Q;  1GD7 A;  1N32 Q;  3ONA B;  3CP0 A;  3O13 A;  1PH2 A;  1F9R A;  4LFB L;  4IFD J;  4L5Q A;  2JN4 A;  1VQK A;  2OF1 A;  2EYM A;  2K28 A;  3IAY A;  2HQE A;  1D5X C;  4K6D A;  3CCV A;  4JI1 Q;  1UUP A;  1SMX A;  1SDF A;  4H13 C;  4WRD A;  1IBK Q;  1X6O A;  2B2V C;  4GKJ Q;  3HEJ A;  4CKE A;  5EKK A;  3M4P A;  2GN5 A;  2R92 B;  3A8K E;  3KLS A;  4N8F A;  3K5L A;  1TS3 A;  2CFM A;  3I4M B;  3PCO B;  2J4X A;  3FKI B;  4DV4 L;  1TWC B;  1IL2 A;  5COR A;  1F2Y A;  4KJO A;  4A3B H;  2EYO A;  1VQD A;  1HQR D;  3MFG A;  1BCP C;  2R92 G;  1KRT A;  3CCM A;  3SK6 A;  1A63 A;  3I4M G;  3FKI G;  1DOL A;  2ASB A;  3W1G A;  5IYB G;  3HOX H;  2Y0S E;  1QVF A;  3M4Q A;  1AZP A;  2E5L L;  4GOP B;  2N88 A;  3GTO H;  2RF4 A;  2F0D A;  3RZO B;  1GUS A;  3HKZ E;  5HGT A;  4KN7 C;  1MGS A;  5I6Y A;  4DV2 Q;  3A0J A;  2IHF A;  1SNP A;  2E2J H;  3WDN A;  4KY6 A;  5DNF A;  4LF6 Q;  1XPU A;  1I4X A;  2G9H D;  1NMF A;  1SE4 A;  2KBN A;  5GRO A;  4LF9 L;  2WFW A;  1DJR D;  3HGB A;  3K0X A;  4DU9 A;  2VL6 A;  1F2Z A;  2D62 A;  2I5L X;  2EYL A;  3BVG A;  2FXQ A;  2M00 A;  1SSO A;  3X3N A;  3J81 c;  2F0N A;  2Q8T A;  1KIX A;  2E75 C;  5JVG 3;  3GQB A;  3A74 A;  3FHW A;  2J0T D;  1LTL A;  2XGT A;  3I91 A;  3X3M A;  2KEE A;  1JOO A;  1VQE A;  4KHV A;  1O7Z A;  4DV4 Q;  4DAV A;  4R4I A;  3NQT A;  1DZ1 A;  2BA1 A;  1FYC A;  2LY7 A;  2PYK A;  1A0I A;  3B6Y A;  5IT9 L;  1CM9 A;  2JXM B;  1BO0 A;  2HHH L;  4LMQ D;  1EU4 A;  2FMM A;  4PZ8 A;  4XQN A;  1YNN C;  4EQO A;  4A93 B;  2RHQ B;  3S15 B;  1PFM A;  2RDH A;  1KHI A;  4DNT B;  3R2T A;  2F52 A;  1IW7 D;  5NUC A;  1TXY A;  1QVG A;  1D2B A;  4HIK A;  4B3M L;  4A93 G;  2KCM A;  2E2H B;  1STG A;  1EWI A;  1NAP A;  4EX5 A;  1PH6 A;  3J80 c;  4DXF A;  1YNX A;  4YWM A;  1PTO B;  3VR3 A;  3K59 A;  3NHH A;  1K83 H;  4EQN A;  3ND8 A;  3D31 A;  1LT5 D;  1Z9F A;  2B39 A;  1A2T A;  2B8G A;  4DV0 Q;  3MTS A;  2SEB D;  3M85 A;  1Y69 U;  1NTG A;  3AEV A;  2NWG A;  3S1N B;  2BE5 D;  4APV A;  4DNR B;  2OCE A;  2L55 A;  3QG1 A;  4HJA A;  3A5U A;  3I4O A;  1U4R A;  2UXB Q;  4PV1 C;  1DOM A;  4AH6 A;  4A3G B;  2NUC A;  3S24 A;  1PH7 A;  5ELB A;  1I4Q A;  3G71 A;  2MUY A;  2HCI A;  3PSI A;  3H6M A;  1TQO A;  1AZQ A;  2H1E A;  4GKK L;  4YCV A;  2IW3 A;  4A3G G;  4DR4 L;  4RH6 A;  1TWA B;  2KJX A;  3MXN B;  2B2U C;  2ZM6 Q;  5M5Y B;  1UE5 A;  5DM6 3;  1GHJ A;  3MXG A;  3NBH B;  1GM5 A;  2O5J C;  1MBY A;  1L1O C;  3OHX C;  4RWS C;  3VYU A;  4PQX A;  4O0A A;  4MN3 A;  5IE8 A;  3JAM c;  2K7V A;  1EQT A;  3Q0A A;  1BNZ A;  2YU9 H;  3DHQ A;  1PTO C;  1EY9 A;  4FF1 A;  3KK7 A;  3GV6 A;  1N33 L;  4CDC C;  5M3M H;  4DR7 L;  3OTO L;  1IBL L;  4YIJ A;  3UI2 A;  1FNU A;  3S2H H;  1II3 A;  3F1Z A;  1BVS A;  3BVM A;  1X3F A;  1KNA A;  2NVY B;  3WOF A;  3OIP A;  4ME3 A;  1X3G A;  5JPN C;  3TRZ A;  1NBW A;  5D14 A;  3FMC A;  2RSN A;  4BY7 H;  1CZW A;  2R93 H;  2R7D A;  5HY6 A;  1HUM A;  1A2U A;  3ULL A;  3IKJ A;  1WI5 A;  2K05 A;  3K5N A;  1CA6 A;  5M5W B;  1YBY A;  4N9T A;  5JEA J;  1U4P A;  4L8J A;  1K8M A;  2PQA B;  1VDZ A;  1Q86 C;  2R3Z A;  1WTV A;  1PA6 A;  1CTM A;  3ND9 A;  3FPU B;  2QEJ C;  4K0K L;  2IT1 A;  3ERS X;  3GTG H;  2VXW A;  2VUM H;  3PGZ A;  2XWJ B;  3OW2 A;  1YNJ C;  2MQH A;  2K1B A;  1LYL A;  4L5T A;  1MIU A;  3V96 A;  1EZ6 A;  4BBS H;  2WAQ B;  3S16 H;  1Y1W H;  4IUQ A;  2AQ2 B;  2D5D A;  2DJG C;  3FPP A;  5C4H A;  1VQA A;  1QG7 A;  3VYR A;  4ZYS A;  2WAQ G;  3A5Z B;  2VB3 X;  4RGM A;  1I3Q H;  1QIL A;  4LFC L;  4OXP A;  2UXD L;  2N55 A;  4JOI A;  5ELF A;  4KKS A;  4UY8 C;  1BOS A;  5GAE C;  4DKA C;  3VR6 A;  3OTO Q;  4DR7 Q;  4JI0 L;  1IBL Q;  4X3U A;  4ZUI A;  2KHJ A;  4ZQ3 A;  5IGD A;  3BDO A;  2YTX A;  2MPM A;  2ATW A;  2JJQ A;  4BBR H;  3DEO A;  2QEX A;  3OIQ A;  1JOR A;  2L0C A;  4BY1 B;  4ODG A;  5A2Q E;  3SXH A;  3HOW B;  1ET6 A;  4JYA Q;  1C4Q A;  1XWE A;  5IIF A;  1CT1 D;  2DY8 A;  4MHE A;  1IKM A;  3OSO A;  4HSV A;  1K9M C;  5CV5 A;  3KF8 B;  1SLJ A;  3U4Z A;  4BY1 G;  1X3P A;  2JYO A;  3NEN A;  3STB C;  3HOW G;  3CME A;  3PF5 A;  1KL9 A;  3S1Q B;  2PO4 A;  1SR3 A;  3N52 A;  4G7Z C;  4RAU C;  4A3J H;  3S2H B;  1IL8 A;  1IYV A;  1NR2 A;  2G9D A;  2WB1 E;  4J1M A;  4JVZ A;  1K0S A;  2R93 B;  1W6K A;  2A6E D;  1XX8 A;  4H0L C;  2EJM A;  4ZKC B;  4YY3 Q;  5LHY 1;  1CKN B;  1FNV A;  1E2V A;  2F0P A;  1RCV D;  2LS0 1;  5JOB A;  5BN5 A;  2LFN A;  2ZT9 C;  4KKT A;  2R93 G;  1TWG H;  1PYW D;  5IP9 H;  3I4N H;  1VQ9 A;  1EYC A;  2Z8L A;  1G2T A;  2L9H A;  4B08 A;  1CHP D;  5LMU L;  3MEH A;  4AYB B;  1CI3 M;  2F0M A;  2EVB A;  4YWK A;  1E3P A;  3GTG B;  4CJ1 B;  2VUM B;  2F4I A;  1PV4 A;  2A6H C;  1RF2 D;  1STE A;  1VQ8 A;  1KTK A;  1HZ9 A;  1WD0 A;  4AYB G;  3M4O H;  1YJ9 A;  5C4J H;  1Q46 A;  3S1M H;  4BBS B;  1Q8I A;  2IJ0 A;  1YHA A;  3T13 A;  4OEL B;  4A3D H;  4DUZ Q;  4FF2 A;  1EY8 A;  4K6L A;  1WVL A;  5GAG C;  4FNF A;  3M4Y A;  5FKA C;  1PRT F;  4NMZ A;  4K2K A;  1I3Q B;  5ISR A;  5LMN W;  3S1R H;  3S17 H;  3J7A V;  4LWC A;  4JK1 C;  4A75 A;  2L5T A;  3NPP A;  2PW7 A;  1L2F A;  4DFA A;  4DV5 L;  1BQQ T;  1TR5 A;  1HR0 L;  2CCZ A;  3DWQ A;  3NTK A;  4C3H B;  3SK5 A;  5K36 G;  1PH4 A;  4B3T L;  1LTS D;  1OXX K;  4H02 A;  4B3S Q;  2JA7 H;  2C5C A;  1EY7 A;  1Q12 A;  3IFD A;  1HFG A;  4K8J A;  2ZXP A;  2MO0 A;  2F1M A;  2XWB B;  3GO5 A;  1HTP A;  3KLW A;  4RKB A;  4C3H G;  4OWX B;  1VQN A;  3VR2 A;  1B9M A;  2QDL A;  5C6A A;  4X62 L;  5M3F H;  3LX0 A;  4KHZ A;  1S5C D;  4G7H C;  3U4V A;  1JB7 A;  5LMU Q;  3L9A X;  1L0X B;  2EOT A;  3HOU B;  2IHE A;  2QDB A;  4XT1 B;  1UWV A;  3J81 E;  5KGU A;  4A3M H;  2PNR C;  2B3G A;  1NE3 A;  1DOK A;  1B7Y B;  1VMP A;  4DN4 M;  5J39 A;  2F0Q A;  2FFK B;  5JAV A;  5BR8 L;  4DXG A;  3HOU G;  1K28 A;  3V2T A;  4JV5 L;  1ZXT A;  3Q23 A;  1QZH A;  3HOV B;  4DAM A;  1DON A;  1EQR A;  1U4M A;  3OMC A;  3CCE A;  2NN6 G;  3T1H L;  3CCQ A;  3C2P A;  4XIG S;  1EYA A;  2DNC A;  2EYP A;  4C56 C;  2F0T A;  4AQY Q;  1H9S A;  4DV6 Q;  4IOA A;  3HOV G;  3GTL B;  1GXD C;  1FGU A;  1Q1B A;  2NZO A;  1S4Z A;  4JI5 L;  3I4N B;  1Z7T A;  2NB0 A;  3G6E A;  1TWF B;  2VS1 A;  1GHK A;  2IX3 A;  1CFM A;  3AB9 A;  4L6T B;  2LXK A;  2JA8 G;  5C5M A;  4EQ5 A;  4F7X A;  4DUY Q;  1HR0 Q;  5IP9 G;  2K52 A;  4U67 3;  3F2C A;  3I4N G;  1QOH A;  4B3T Q;  2FIN B;  2CH4 A;  1XNR Q;  2K33 A;  2YTY A;  5IWA Q;  3QIA A;  4K14 A;  1V1P A;  2BCO A;  5C4J B;  5ELD A;  4WFN 3;  4C3I H;  2PI2 A;  1EWC A;  4KKU A;  4DV3 Q;  1ILP A;  4X62 Q;  1PH9 A;  2FHT A;  1FNW A;  5CC4 A;  3J81 i;  1VQI A;  2ZTE A;  3M7G A;  1OTC A;  4I65 A;  4PG3 A;  3NE5 B;  2F3V A;  1WCM H;  2XSC A;  4CKC A;  4UHV A;  3S2D B;  5I9O A;  1VS0 A;  2SOB A;  3TZU A;  1XMQ Q;  3PUX A;  3D3R A;  1UEB A;  2F3W A;  4PMW A;  4A3C G;  1GUT A;  3I90 A;  2P5Z X;  2R7Z H;  3GTJ B;  2YV5 A;  1P16 A;  3PV0 A;  2JA7 B;  4XQJ A;  1A15 A;  2E76 C;  4QL5 A;  3MWY W;  1SYF A;  1TS5 A;  2DY7 A;  1S40 A;  1Y8N B;  1F9P A;  3LGJ A;  4QGU A;  3CMA A;  2JA7 G;  4FXK C;  4JI1 L;  2WV6 D;  1F2M A;  4GKJ L;  1ZKO A;  3GD7 A;  5C5L A;  1STY A;  5JPM C;  5ELN A;  1OXV A;  4GLX A;  3JAM E;  1UE1 A;  1QCB D;  3ERO A;  2B29 A;  4RA8 A;  3JC6 6;  4DAY B;  1HUN A;  1ML0 D;  1V1O A;  1G6Z A;  4LF4 L;  2SDF A;  3AMU A;  1N34 Q;  1A3U A;  4R8I A;  1LUZ A;  1TU2 B;  2B2Y A;  1BCP B;  2DUD A;  2PZT A;  2NZ1 D;  1UEA B;  1Y1V H;  1C9O A;  5CBA E;  4JI8 Q;  1BKB A;  1I50 H;  5C44 H;  2R6G A;  3CRK C;  4DV2 L;  2F0U A;  1QWY A;  1E7Z A;  1NR4 A;  1TII D;  1TS2 A;  2RSO A;  4NP5 A;  3M9B A;  3VA5 A;  3DUZ A;  1SMY D;  3CXC A;  2N3S A;  4M1U B;  4FVM A;  1JOK A;  4FO2 A;  3WWV A;  3RN5 A;  1B4O A;  1YNN D;  2FMC A;  5E7N A;  2E2D C;  4XQQ A;  1EY0 A;  1ENC A;  3BDC A;  4C3I B;  3HOZ H;  5IP7 H;  2SNS A;  4MIU A;  2JK8 A;  4WJW A;  4KY7 A;  1VQ7 A;  1RIP A;  2Y0S B;  3JAM i;  4S3S A;  2K5N A;  1FJG L;  1FVI A;  3A8J E;  4F87 A;  1O7Y A;  3QWN A;  1A8V A;  2X6L A;  1AW7 A;  1PYS B;  4K5W A;  3HKZ B;  2B8F A;  2X6G A;  2Y0S G;  2LSS A;  3SR1 A;  1CHQ D;  4F8M A;  2VNU D;  3SHL A;  1JOQ A;  4P72 A;  3L3O C;  3RNU A;  1TT2 A;  5ELE A;  3H3V H;  2D9U A;  3HKZ G;  1RJT A;  4C1N I;  4ZLT F;  4LF4 Q;  5LL6 X;  1UAP A;  2AQ3 B;  4HTH A;  4IZ8 A;  4Z9C B;  1KC8 C;  1RDP D;  2XNA C;  5M5X B;  3TS2 A;  1SN8 A;  1TS4 A;  5J1Z A;  4OIK A;  4DR2 Q;  3UDF A;  5C0X I;  2OTL A;  5JJZ A;  3E0J A;  1E1O A;  4NKL A;  1ENF A;  2D2C C;  4X64 Q;  3ERQ A;  2F0V A;  1NCV A;  3LWU A;  4KHP Q;  2RA4 A;  1OXT A;  1NSN S;  3A7A B;  4OO1 I;  4ZRZ A;  3T53 B;  2ZJR A;  2JA5 H;  1EIH A;  1IBM L;  1PFB A;  2BDN A;  4DV0 L;  3VR4 A;  2KOL A;  3HG9 A;  3HRZ C;  2E74 C;  2IX1 A;  4IN3 A;  1SNQ A;  2CWP A;  5D65 A;  3NP8 A;  2Z9H A;  1PTO D;  4HJ9 A;  1K73 C;  1JIC A;  3KF6 B;  1GUN A;  5EJW A;  3KLS X;  4HAE A;  3EVQ A;  3K8A A;  3SVM A;  1FJG Q;  1D6E C;  2ZTD A;  2ZJP A;  2UXB L;  1LTT D;  3BDL A;  4C3J H;  1STB A;  2CVR A;  4PNY A;  3HZX A;  3S14 H;  2PMZ E;  2F0K A;  4LUO A;  2HQL A;  3SGI A;  4Y7N B;  1Q8K A;  4NXN Q;  4KLK A;  1QZG A;  1SYD A;  2Z1C A;  1NUC A;  4A3L G;  2ZM6 L;  3DM3 A;  2KEC A;  2EXZ A;  1XJV A;  3I73 A;  1IHZ A;  1HA5 A;  2MFI A;  4XXE A;  2KA7 A;  1HFN A;  4JOI C;  3H91 A;  1SRO A;  1QNU A;  2MO1 A;  3I8Z A;  1JE5 A;  4WJ3 M;  3MXU A;  1L1O B;  4A3E H;  3I2Z A;  4OX9 L;  3I70 A;  4BXX H;  2F03 A;  2QKI C;  3TRE A;  4A3B B;  1R4Q B;  3D8G A;  1SJE D;  4XDX A;  5IYD H;  4ZK9 B;  4JI7 Q;  3J81 L;  2AUJ D;  1IBM Q;  3CPW A;  4ILW A;  3D6W A;  1E0B A;  3GP7 A;  2HIX A;  2AUK A;  2BA0 A;  4RCO A;  4A3B G;  1EEI D;  3HOX B;  3GTP H;  5IYC H;  3UDG A;  1NJI C;  3PIP 3;  2K50 A;  3CC7 A;  3GTO B;  2Q8R E;  3F2B A;  2KED A;  4PZ7 A;  4LFA L;  5IOC A;  2A73 B;  3R93 A;  3HOX G;  3M7N A;  1Q1E A;  2IX0 A;  2E2J B;  5IGE A;  5EKL A;  3KYH C;  1SYC A;  4I7Z C;  1C7Y A;  2IY5 B;  2B2T A;  1AP0 A;  4LNQ A;  1XPR A;  3RMH A;  4RHS A;  2OEO A;  1ICF B;  1D5M C;  1HZC A;  1XTC D;  3CAM A;  2MGS A;  3AU7 A;  3K80 C;  2KQ3 A;  1JB3 A;  4DR1 Q;  1GUW A;  1PRT B;  2IPK D;  2B2V A;  3G48 A;  4GN3 B;  4R4C A;  4AIM A;  5EAY A;  4ULL A;  3P75 A;  3KDF B;  2PQE A;  3H3V I;  3TQY A;  2C9O A;  4QIW E;  1CSP A;  4JBJ A;  3K58 A;  3STB D;  2EE1 A;  1HNX L;  1MSH A;  3TN2 A;  1SNO A;  3J80 L;  4GN5 A;  4HSP A;  4IUU A;  4DK3 C;  5I4D A;  4OX9 Q;  3L7Z C;  4C3J B;  2OQ0 A;  1AEX A;  4HR7 B;  3S14 B;  1WTO A;  2AHO B;  3OPO A;  3TP7 A;  1YJN A;  4FYD A;  4ZAI A;  3EN2 A;  3KFU A;  1PZK D;  4H44 C;  2LXJ A;  1I5F A;  1DM0 B;  3DEP A;  1XPO A;  1K8A C;  2ZJQ A;  4JYA L;  3H0G H;  1KNE A;  4OHJ A;  4LFA Q;  5I9P A;  3SE0 A;  2MP1 A;  1AH9 A;  1H95 A;  4QY7 A;  1YHQ A;  3MZ5 A;  2QGQ A;  1PRT C;  3ITP A;  2A6H D;  3NQI A;  2R61 A;  4A3E B;  1PFN A;  2BH8 A;  3T4A C;  1VQH A;  1K83 B;  2QIL A;  2WKC A;  4NW2 A;  4A3E G;  1SNC A;  2X69 A;  4YY3 L;  4CDD C;  2WKD A;  1WTQ A;  3MXP A;  4RFB A;  4UDU C;  1HNX Q;  1HCZ A;  4GOP A;  1RKN A;  2EY2 A;  1EYD A;  3I56 A;  2DN8 A;  2I46 A;  2VQE L;  1GUO A;  3PMF A;  2NZH A;  1Y14 B;  4CDF C;  1AFP A;  4X6A H;  5BN3 A;  3BZC A;  4R9W A;  4FF4 A;  3Q22 A;  2ES2 A;  1ROD A;  4IJH A;  3DWA A;  1KLU D;  3C46 A;  3T56 B;  3GV3 A;  1X32 A;  1CSQ A;  2EY1 A;  2NBF A;  4DA2 A;  2BE5 C;  2EYF A;  3U50 C;  3VR5 A;  3NWT A;  1YHB A;  4HJ5 A;  4DUZ L;  2WB1 B;  1YVC A;  1W2B A;  1A3T A;  2F0I A;  1I94 Q;  5IGG A;  4LF7 L;  5KNB A;  5EQ0 A;  3G4S A;  3FRP B;  3A7L A;  4YCW A;  1XMO Q;  2YU9 B;  2WB1 G;  3I55 A;  2AQ1 B;  1ONL A;  3RLO A;  5M3M B;  2CQA A;  4XYQ A;  1VQ4 A;  3BJU A;  2Q2U A;  1B2T A;  4DF7 A;  1KDB A;  1VMC A;  4QQB X;  4RGO S;  4CHT B;  1S3O A;  1EIG A;  2TMP A;  5M3M G;  3IFT A;  4BY7 B;  4B3S L;  4JI3 L;  1SE8 A;  1QNK A;  1X55 A;  2B2W C;  4C2M H;  3Q8D A;  4WOR A;  4BY7 G;  2K75 A;  3NEL A;  2RCN A;  2GVB A;  5FK9 C;  5FJ8 H;  2E2I H;  1QUQ B;  1ASY A;  3K81 C;  3H0G B;  1X56 A;  3SEB A;  2R7F A;  3CCL A;  1C8C A;  1A62 A;  2RHS B;  4HMI A;  2V1C C;  2Z6B A;  1R4P B;  1N36 L;  1PVO A;  1LAC A;  1PLF A;  1BDO A;  2VQE Q;  3HOY H;  1B3Q A;  1H9M A;  3H0G G;  1KLG D;  2XTI A;  3V05 A;  1RTN A;  1JWS D;  3W5O A;  5E3F A;  1PTO F;  2KVM A;  3C1F A;  4TVA B;  1RD9 D;  5FOB B;  4QF4 A;  3E6Z X;  1SE2 A;  3OOC A;  4HJ7 A;  3S16 B;  2VUM G;  1Y1W B;  4JBM A;  1CKO A;  3QOL A;  4LUV A;  2F0S A;  3TP5 A;  1MJC A;  2L1B A;  3CQZ H;  2L4N A;  3H15 A;  3J7A F;  3PQI A;  3D4D A;  4LF7 Q;  4AQY L;  2RBM A;  2LKV A;  4HED A;  3LWE A;  4O1N A;  4GNX B;  4BBS G;  5HGQ A;  4DV6 L;  1Y1W G;  4A3F H;  1EY4 A;  1FL0 A;  4Q0F A;  5T1G A;  3BZK A;  1N8R C;  4K8I A;  1S5B D;  3E0E A;  1FR3 A;  1LT4 D;  3A8I E;  3ICE A;  3FVQ A;  4UAI A;  1ASZ A;  4FDB A;  4DUY L;  1HA6 A;  5DEH A;  2J7Z A;  1PZJ D;  1I4H A;  2KCT A;  3BU2 A;  4OON A;  5CBE E;  5IGF A;  2BH2 A;  1XNR L;  1STA A;  4F88 A;  4BBR B;  4JI3 Q;  1T5X D;  5IWA L;  1AN8 A;  1DXM A;  3CPF A;  4POF A;  1QJO A;  4TQU S;  4B9W A;  4QCL A;  3K5M A;  3TEH B;  4A4I A;  2B2Y C;  3EA6 A;  3MXN A;  4DV3 L;  4BBR G;  2ICE C;  5CYU A;  4A3I H;  4FXG C;  1G2S A;  1XTD A;  2PCF B;  4JC0 A;  3NBH A;  3PF4 A;  3PO2 H;  3T1Y Q;  3RN2 A;  4EQP A;  2JA6 H;  1N36 Q;  1XXG A;  5CMD A;  1ESR A;  1F9Q A;  1NY4 A;  4DK0 A;  1XMQ L;  2Z6K C;  4A3J B;  4O42 A;  1JJC B;  4P74 A;  4GNX C;  2CW0 D;  1BR9 A;  2GA4 B;  1JR0 D;  5C3X A;  3PO3 H;  1LTG D;  1H9R A;  4KI0 A;  5FLX c;  3PIP A;  4A3J G;  3CCR A;  1VQL A;  2CH4 W;  4J6H A;  3TME A;  2EZV A;  1ET9 A;  4V19 0;  3PUW A;  1MD2 D;  1O7L A;  2A68 D;  4V0B A;  4X65 Q;  3GTM H;  4KD3 A;  5EBC A;  1NMG A;  3K7U C;  5COY A;  4IPD A;  1TWG B;  4GN4 B;  5GAH C;  1TVX A;  4HIO A;  2RVL A;  1HJP A;  3G7L A;  1SBB B;  3EJI A;  1GJX A;  3HOY B;  1U4L A;  2PQA A;  3D4R A;  3RLN A;  1KDA A;  1LTR D;  2JSO A;  1M90 C;  4TSS A;  4BA1 I;  1PFS A;  5C4X H;  2CKZ B;  2WP8 J;  2HCC A;  3HOY G;  3K5O A;  3M4O B;  3HP3 A;  4B9X A;  3S1M B;  3R3O A;  1MSG A;  1N34 L;  2B63 H;  2ZXO A;  4NB3 A;  4A3D B;  1ZEQ X;  4JG2 A;  3VYS A;  5C0X H;  4CKB A;  3UE1 A;  2A74 C;  2EY6 A;  4JI8 L;  4IOC A;  3BVZ A;  1M1K C;  3H09 A;  2KCN A;  4A3D G;  3OYY A;  3S1R B;  4ID6 A;  1PDQ A;  4JW0 A;  3S17 B;  4XTC S;  1EL0 A;  1EUJ A;  1BCP D;  4OO1 H;  2JP1 A;  1BBW A;  1U9R A;  3RZD H;  4FXD A;  3L2P A;  1LTI D;  4J8Q A;  1BBU A;  1O78 A;  1BUV T;  1TY2 A;  2XRQ D;  1CUK A;  1EQQ A;  3J7Z C;  2R92 H;  1FD7 D;  1LT6 D;  3FKI H;  1U0L A;  4XYO A;  1TWC H;  5A35 A;  5M3F B;  5IOD A;  2HDM A;  4A3I B;  2VY3 A;  4LUZ A;  1FGB D;  1M8A A;  5LMN L;  3PO2 B;  1CA5 A;  3M3Y H;  2L12 A;  1B8A A;  2M2L A;  3KF8 A;  4X3S A;  3PIO 3;  4M8A A;  4P75 A;  4A3K H;  5M3F G;  4K5X A;  1ZYR C;  4A3I G;  3K0Y A;  4A3M B;  4YHH L;  1HH2 P;  2CQO A;  2Q2T A;  3PO2 G;  1G6P A;  1CQV A;  1ILQ A;  4KK7 A;  3RZO H;  1PH3 A;  4N8X 1;  4X3T A;  1X54 A;  3A55 A;  1JE4 A;  4A3M G;  3PO3 B;  3QB3 A;  4R4O A;  3F8T A;  2KEN A;  1PHJ A;  1HPC A;  1Z6H A;  4NDX A;  1V9P A;  4KD4 A;  1CKN A;  3D6C A;  4DR2 L;  4HCE A;  3GDE A;  1HQM C;  2F0F A;  2FJ2 A;  4IPG A;  1IYU A;  2K5W A;  3N6R A;  5E1F A;  5C3W A;  1EYG A;  4X64 L;  4KHP L;  1VQ6 A;  1MI2 A;  4HN7 A;  5IY0 A;  4KTA A;  4LK1 C;  2HIV A;  1E22 A;  4O2D A;  5DM7 3;  4JBK A;  2UXC Q;  5C4X B;  1SRU A;  1E1T A;  1BXT A;  3SDZ A;  2OT2 A;  1G29 1;  4YCU A;  2K04 A;  2M9V A;  4WJ4 A;  1SJH D;  1LM0 A;  5C4X G;  2B63 B;  5I2X A;  2PZW A;  2BDO A;  1JT8 A;  1N9W A;  1PH8 A;  1WJJ A;  4DAP A;  1HXY D;  5LL6 S;  5A2Q L;  1VF7 A;  2PNH A;  1UE7 A;  1HNW L;  2RDF A;  5EPK A;  5LMN Q;  1D8L A;  4C3I G;  1YEZ A;  1WCM B;  4DR6 L;  2VB2 X;  1VQM A;  3AYH B;  5C0X G;  2B2T C;  4A93 H;  2A1A A;  2AMC B;  4KY5 A;  5GQO A;  3S15 H;  4YHH Q;  1JCK B;  4HID A;  3RZD B;  2H5X A;  1WCM G;  2LMC B;  3L0O A;  4HCS A;  1AE2 A;  1E24 A;  4KMU C;  3NTI A;  2EYH A;  2R7Z B;  4NXN L;  1D1I A;  3P1H A;  1B9N A;  3KOJ A;  4EGV A;  2E2H H;  4OO1 G;  2ENB A;  2F0H A;  3QO2 A;  2NVT H;  5J3B A;  4PMB A;  2R7Z G;  2RDG A;  1GUG A;  1CK1 A;  3NSW A;  1PTO H;  4KJN A;  1JQY D;  3E9H A;  4E6I A;  1JJ2 A;  2UU9 Q;  3CKI B;  5EPL A;  2OWO A;  3WOE A;  1V1Q A;  1S5D D;  1S5F D;  3M3Y B;  2QW7 A;  4BS9 A;  3MFY A;  1I4P A;  5AFW A;  1YJW A;  3EBE A;  4A3K B;  1Y8P B;  4DNI A;  1M4V A;  5EGT A;  4CGY B;  2CHB D;  3SK8 A;  1T5E A;  5IT9 c;  3S1N H;  1WFQ A;  5L37 A;  3K6O A;  1K0R A;  4RG1 A;  3CC4 A;  4JI7 L;  4P73 A;  2A69 C;  3W3A A;  4B3R L;  1WTX A;  4A3K G;  1EU3 A;  5AJ3 Q;  2PMZ B;  1YI2 A;  2TSS A;  1TKW B;  2F4V Q;  4TKO B;  1IXR A;  4A3G H;  2N78 A;  2JQO A;  1EFW A;  2JEB I;  3NTH A;  1Y1V B;  3S9W A;  1HNW Q;  2I07 B;  4DV1 L;  4R1J A;  4DR6 Q;  1G91 A;  1I50 B;  2RCF A;  5C44 B;  2DGY A;  1TWA H;  2MJ8 A;  1EWH A;  4GZY C;  2YTV A;  3DM1 A;  2D0P A;  5M5Y H;  4LFB Q;  1WOC A;  1Y1V G;  4QMG A;  3KUP A;  2K5D A;  2A5H A;  2N8N A;  5C44 G;  1JC7 A;  1TWH H;  2NVQ H;  4EVO A;  3MEF A;  4TRD A;  4DR1 L;  1SYB A;  1XNQ L;  1ENA A;  2EIF A;  1RL2 A;  1EOT A;  3MVV A;  5CV4 A;  1MKH A;  3UDX A;  3CCJ A;  3CRL C;  2WIN B;  4CJ0 B;  5H1S E;  3HOZ B;  2NVY H;  3TSS A;  3GTK H;  2EDG A;  2PPB C;  3KBX A;  5I6W A;  3CCU A;  4GOP C;  1PRT D;  1SMY C;  1JWM D;  3DXJ C;  1T9H A;  1YNJ D;  1EQV A;  3HOZ G;  5IP7 G;  3ZJY C;  1ICW A;  1LO5 D;  1WTP A;  5EPJ A;  4MZ9 A;  5IGB A;  2E5L Q;  4C1N K;  2HDL A;  4CJ2 C;  3AQQ A;  5M5W H;  3D0F A;  1TY0 A;  3NBI A;  3QOJ A;  1XYI A;  4RHR A;  4U68 A;  4B3R Q;  1EY6 A;  2I5H A;  3BG3 A;  1I4R A;  5FLM H;  3RUZ A;  2XIW A;  1BBX C;  2O5I C;  4N9P A;  1G8Z D;  2NVT B;  4ALP A;  2V4D A;  5T1I A;  4LF9 Q;  3NXW A;  3D4W A;  4DV1 Q;  3IL8 A;  3U9S A;  1VQC A;  1B70 B;  1ESF A;  3E5S A;  4QIW B;  5G3L D;  3I4L A;  3J7Y W;  4G4K A;  2UUA L;  4IFD H;  1PZI D;  1LAB A;  2IL8 A;  1KAA A;  2XVS A;  2ICI A;  1Q3L A;  2K5H A;  4I7A A;  2I5M X;  1VQ5 A;  2JA5 B;  4XT3 B;  3CW2 C;  1XNQ Q;  4DAY A;  1BCP F;  2KHI A;  1WTW A;  1A3V A;  2NTT A;  2QA4 A;  2JA5 G;  1KXL A;  4JPB W;  4IUR A;  3BS1 A;  2ZTC A;  5KEE A;  2GVA A;  2VW9 A;  3VYT A;  1VQJ A;  5FLX E;  1G51 A;  1OXS C;  1U5K A;  4DPG A;  2HHH Q;  3H3V C;  4BY1 H;  1HRJ A;  2KUM A;  3HOW H;  1GKH A;  2E8G A;  1X65 A;  5FO9 B;  2F3I A;  2A8V A;  1B44 D;  1D1K A;  3T51 B;  1TWH B;  2RKS A;  1JMC A;  2NVQ B;  1KQS A;  1VQG A;  4C3J G;  2KHS A;  5IGC A;  4B3M Q;  3C1E A;  2MNA A;  3MC0 B;  2A19 A;  3S1Q H;  4HJ8 A;  4HIM A;  4L5R C;  3E3X A;  4PZ6 A;  1I94 L;  1UE6 A;  2DNE A;  1Y8O B;  3TP8 A;  1J5E L;  4QB4 A;  3GTK B;  1W6J A;  4FP5 D;  4LW1 A;  1I4G A;  3PIO A;  1XMO L;  4G7O C;  1VQB A;  1SYE A;  1O7I A;  2UUA Q;  5KIX A;  1JWU D;  4OL7 A;  1BF4 A;  1H9S B;  3KJO A;  1C48 A;  1S5E D;  2D0O A;  5J22 A;  3H94 A;  4NXM L;  1B1Z A;  3A56 A;  2F0L A;  4MTK A;  2F0G A;  3Q6S A;  2JEA I;  4ABN A;  4UP8 A;  1A6X A;  2WII B;  3T16 A;  2QF7 A;  4LF5 L;  5KYL A;  3F2U A;  3JAM L;  4RCN A;  4BXX G;  1IW7 C;  5EKI A;  4GS3 A;  2Q2I A;  1GOZ A;  2MHV A;  3GTP B;  5IYD G;  5CV8 A;  5KNC A;  2K32 A;  3C3L A;  2HUG A;  1PXU A;  2PW5 A;  1EIY B;  1HR0 W;  1F77 A;  1V1P B;  3QR8 A;  1VQP A;  1SEB D;  4DV7 L;  1CKM A;  4IPH A;  4OEM B;  5FLM G;  4GKK Q;  4IQZ A;  4DR4 Q;  5IYC G;  1Q82 C;  1CZG A;  2OXP A;  3K57 A;  5HUR A;  1RHP A;  1PMR A;  4YWL A;  2K03 A;  1X3Q A;  3W1B A;  2F0W A;  4OGQ C;  1O80 A;  2NVX H;  2EXD A;  2ID0 A;  1L0W A;  3CD6 A;  5K36 H;  1GVP A;  4IFD G;  1N33 Q;  2EYJ A;  3DWP A;  3BYY B;  4LJZ C;  2PI2 E;  2WAQ E;  3ULJ A;  1LT3 D;  3U58 A;  2ALY B;  3I3C A;  1J5E Q;  4GLA C;  3GTQ H;  4C3H H;  5ELO A;  1CQF A;  4OIJ A;  2KCC A;  2RQX A;  4G57 A;  4GLV B;  3RLF A;  3KF6 A;  3LNN A;  1K3R A;  4IUP A;  1SYG A;  1D7Q A;  3OWF A;  1VF5 C;  5CV7 A;  3FEW X;  1WD1 A;  4NXM Q;  4MTN A;  2AKW B;  4IFD I;  2O4X A;  4LF5 Q;  2EPB A;  3CU7 A;  1K3B C;  5KYI A;  1OXU A;  1W3S A;  1WTR A;  2Z0S A;  1EFI D;  3I72 A;  3HOU H;  1I6H H;  1PYB A;  4X66 L;  3CF5 A;  3F2D A;  4K0K Q;  1SND A;  1HZA A;  4K2L A;  5FO8 B;  1QE6 A;  5C0X J;  4DR3 L;  3DLL A;  3MA2 B;  5ELC A;  5BN4 A;  1F2L A;  2NN6 H;  3MAQ A;  1PH5 A;  2OQK A;  2UUC L;  2NTS A;  4DV7 Q;  4QJF A;  3T1Y L;  2XRS D;  3BYT B;  5TSS A;  3HOV H;  1QB5 D;  1MJE A;  2B2U A;  1I6V C;  3IRB A;  4J15 A;  1WTH A;  1L1O A;  2HD3 A;  5M9O A;  1IKL A;  3GTL H;  3KBG A;  4CBV A;  4DGZ A;  3I7F A;  2JA8 H;  4LFC Q;  3VA7 A;  2AWO A;  2OTJ A;  2UXD Q;  4RGT A;  1QVC A;  4JI0 Q;  1TWF H;  3FDT A;  1HNZ L;  1YIJ A;  1SXT A;  3QJY A;  3J7A 5;  3VDY A;  1J6Q A;  3TDQ A;  1LLR D;  4X65 L;  4IPC A;  3J81 j;  3DMU A;  1V8Q A;  4MNO A;  5JJK A;  1GO3 E;  3EQL C;  2BOS A;  5E4W C;  5JJL A;  1DGS A;  2H4O A;  4RGN A;  3UE0 A;  1Q81 C;  1KD1 C;  1VCI A;  5E4X A;  1Q90 A;  3CC2 A;  2L11 A;  2K6A A;  5C4Z A;  4DK1 A;  1H9K A;  1V43 A;  4AYB E;  1SAP A;  3K7A H;  2VQF L;  5JEA H;  2NVX B;  1J9O A;  2QCP X;  4CDE C;  4A3C H;  1VQO A;  3S2D H;  1K8O A;  4X66 Q;  4K5V A;  4P2C B;  4DR3 Q;  1LTB D;  5IT9 E;  4QUF A;  3KDF A;  5D3I B;  4Y52 H;  2UUC Q;  1E2W A;  3GTQ B;  1HHV A;  4R4T A;  3GTJ H;  1J8I A;  2NYZ D;  3P20 A;  1ZYR D;  5GAD C;  5C3E H;  3Q24 A;  4JCV E;  3TBI B;  3HFZ B;  1B50 A;  1EZ8 A;  3OWE B;  2EQS A;  1R9T H;  4JI4 L;  1EIF A;  5CV9 A;  4A76 A;  1OO9 B; 
#chains in the Genus database with same CATH homology
 4UY8 C;  4WJ3 M;  1VQ6 A;  1L1O B;  4A3E H;  5IY0 A;  3I2Z A;  2K5V A;  4OX9 L;  2HIV A;  4DKA C;  5GAE C;  4BXX H;  3OTO Q;  1E22 A;  4O2D A;  1IBL Q;  4JI0 L;  4JBK A;  4DR7 Q;  1IYJ B;  2UXC Q;  1SRU A;  1E1T A;  2YYZ A;  3TRE A;  2KHJ A;  1HNZ Q;  5IYD H;  2CWA A;  4JI2 L;  3TS0 A;  2I0Q A;  3PUV A;  4JI7 Q;  1G29 1;  4YCU A;  1IBM Q;  3CPW A;  2YTX A;  2JE6 I;  4WJ4 A;  2ATW A;  1LM0 A;  2JJQ A;  4BBR H;  5C4X G;  1X9N A;  2HIX A;  2BA0 A;  1JT8 A;  4A3B G;  1N9W A;  2QEX A;  4IO9 A;  1PH8 A;  1WJJ A;  2AWN A;  3GTP H;  1YZ6 A;  5IYC H;  1Q7Y C;  3UDG A;  1NJI C;  2K50 A;  2PNH A;  1AE3 A;  3CC7 A;  1UE7 A;  1HNW L;  3F2B A;  5LMN Q;  4OWW B;  5FJ8 G;  1D8L A;  4UPA A;  4PZ7 A;  1YEZ A;  4LFA L;  4DR6 L;  4JYA Q;  4DR5 L;  1VQM A;  3E9I A;  3AYH B;  5C0X G;  3HOX G;  1C0A A;  3M7N A;  1K9M C;  4A93 H;  2A1A A;  2AMC B;  5GQO A;  1Q1E A;  1SLJ A;  2IX0 A;  2K4K A;  3KF8 B;  4BY1 G;  3U4Z A;  3S15 H;  4YHH Q;  3KYH C;  1C7Y A;  4HID A;  2IY5 B;  3AFP A;  3NEN A;  3STB C;  2VQF Q;  3CME A;  2H5X A;  1KL9 A;  3PF5 A;  4LNQ A;  1XPR A;  3HOW G;  1WCM G;  3L0O A;  1SR3 A;  1AE2 A;  3PUZ A;  1E24 A;  1Z47 A;  1PH1 A;  1HZC A;  3CAM A;  4A3J H;  4NXN L;  3RR5 A;  3K80 C;  3KOJ A;  3KJP A;  2E2H H;  4OO1 G;  4DR1 Q;  4LF8 L;  2WB1 E;  3G48 A;  4GN3 B;  4R4C A;  4AIM A;  5EAY A;  4DV5 Q;  3CCS A;  1YIT A;  5J3B A;  2NVT H;  4JI6 L;  1S72 A;  2R7Z G;  3KDF B;  3H3V I;  3TQY A;  3E9H A;  1JJ2 A;  2NN6 I;  4QIW E;  4YY3 Q;  2UU9 Q;  1CKN B;  1CSP A;  4JBJ A;  2OWO A;  3STB D;  1V1Q A;  3ULP A;  1HNX L;  4JI4 Q;  4GN5 A;  4A3F G;  2R93 G;  1TWG H;  1YJW A;  3EBE A;  4DK3 C;  5IP9 H;  3I4N H;  1VQ9 A;  4DNI A;  2UXC L;  1K8G A;  2VZA A;  4OX9 Q;  3FP9 A;  2K14 A;  5IT9 c;  3S1N H;  3L7Z C;  1WFQ A;  2OQ0 A;  5LMU L;  4YWK A;  1E3P A;  1K0R A;  1X3E A;  4RG1 A;  3CC4 A;  4JI7 L;  4P73 A;  2AHO B;  3NEM A;  4B3R L;  4JI2 Q;  3I4M H;  4A3K G;  4IJL A;  5AJ3 Q;  1YJN A;  1PV4 A;  2N49 A;  1YI2 A;  2Q2H A;  5IYB H;  1VQ8 A;  2F4V Q;  1IXR A;  3KFU A;  3EN2 A;  1HZ9 A;  4BA2 I;  4AYB G;  4A3G H;  5JEA G;  3M4O H;  2N78 A;  2JQO A;  2LXJ A;  1KAW A;  4UP7 A;  1I5F A;  1Q46 A;  5C4J H;  2JEB I;  1YJ9 A;  1EFW A;  3S1M H;  1XPO A;  1K8A C;  2ZJQ A;  5BR8 Q;  4OWT B;  4JYA L;  1JJG A;  1HNW Q;  1YHA A;  4DV1 L;  4A3D H;  4JV5 Q;  3H0G H;  4R1J A;  4DUZ Q;  2UUB L;  1N32 L;  1EOV A;  4LFA Q;  4DR6 Q;  4DR5 Q;  2DGY A;  1TWA H;  3T1H Q;  1AH9 A;  1H95 A;  5GAG C;  5M5X H;  3ER0 A;  4QY7 A;  4L5S A;  2YTV A;  3UDI A;  1YHQ A;  2D0P A;  5M5Y H;  4LFB Q;  1WOC A;  1Y1V G;  2JA6 G;  2QGQ A;  2N8N A;  5LMN W;  5C3E G;  3S1R H;  3S17 H;  5C44 G;  1TWH H;  4LWC A;  1IBK L;  2NVQ H;  4JI5 Q;  2BH8 A;  4A75 A;  4P71 A;  1VQH A;  3MEF A;  4DR1 L;  3HKS A;  1L2F A;  4DV5 L;  1HR0 L;  2CCZ A;  1XNQ L;  2EIF A;  4NPS A;  1RL2 A;  1P8L A;  4RMF A;  4LF8 Q;  5DLQ E;  1PH4 A;  5K36 G;  4B3T L;  1MKH A;  4A3E G;  3UDX A;  3CCJ A;  4JI6 Q;  1OXX K;  4H02 A;  4B3S Q;  2JA7 H;  3PO3 G;  5H1S E;  1Q12 A;  4R4Q A;  4YY3 L;  2UU9 L;  2NVY H;  2HT1 A;  3J80 i;  3GTK H;  1QUQ A;  2MO0 A;  3GO5 A;  3CCU A;  2L15 A;  3KLW A;  3PUY A;  4GOP C;  4UP9 A;  1VQF A;  4OWX B;  4DK6 C;  1VQN A;  1HNX Q;  3EIV A;  4GOP A;  1T9H A;  5M3F H;  3HOZ G;  5IP7 G;  3ZJY C;  4X62 L;  4KHZ A;  3I56 A;  4MZ9 A;  3U4V A;  2VQE L;  1HZB A;  2E5L Q;  1JB7 A;  3AQQ A;  5M5W H;  5LMU Q;  2C35 B;  2NZH A;  3D0F A;  1Y14 B;  5JJI A;  4POG A;  4X6A H;  1IZ6 A;  2IHE A;  3BZC A;  4JBW A;  5AJ3 L;  1UWV A;  3CCL A;  4B3R Q;  4A3M H;  2F4V L;  2I5H A;  2B3G A;  1NE3 A;  2ES2 A;  1B7Y B;  4IJH A;  4LF6 L;  1KRS A;  5FLM H;  2Z6K A;  4A3L H;  2JA9 A;  1CSQ A;  3AFQ A;  5BR8 L;  3HOU G;  3U50 C;  1YHB A;  4HJ5 A;  4JV5 L;  4Y7N H;  4DUZ L;  4ALP A;  1WYD A;  1QZH A;  4GNX A;  1YVC A;  4DAM A;  1SFO H;  4LF9 Q;  1EQR A;  2B63 G;  4DV1 Q;  1W2B A;  3CCE A;  2NN6 G;  1GD7 A;  3CCQ A;  3T1H L;  1I94 Q;  2UUB Q;  4LF7 L;  1N32 Q;  3CP0 A;  4XIG S;  1VQC A;  1B70 B;  1PH2 A;  3G4S A;  4AQY Q;  4LFB L;  4IFD J;  4YCW A;  1XMO Q;  4L5Q A;  4DV6 Q;  2WB1 G;  4IOA A;  1VQK A;  3HOV G;  3I55 A;  2UUA L;  1FGU A;  1Q1B A;  3RLO A;  2NZO A;  4JI5 L;  1VQ4 A;  3CCV A;  3BJU A;  2Q2U A;  4JI1 Q;  1SMX A;  1IBK Q;  3G6E A;  1X6O A;  2K5H A;  2I5M X;  1VQ5 A;  4GKJ Q;  2VS1 A;  4QQB X;  3M4P A;  2GN5 A;  1S3O A;  2LXK A;  2JA8 G;  4EQ5 A;  5M3M G;  4DUY Q;  3CW2 C;  2CFM A;  1HR0 Q;  1XNQ Q;  3PCO B;  1PH9 A;  5IP9 G;  2K52 A;  3F2C A;  4DV4 L;  4B3S L;  3I4N G;  4B3T Q;  4JI3 L;  1SE8 A;  1XNR Q;  1IL2 A;  4A3B H;  1X55 A;  2KHI A;  1VQD A;  2YTY A;  4C2M H;  5IWA Q;  2JA5 G;  2QA4 A;  3Q8D A;  1KRT A;  2R92 G;  1KXL A;  3CCM A;  2ZTC A;  4BY7 G;  2K75 A;  3NEL A;  2RCN A;  2GVB A;  5FJ8 H;  2PI2 A;  4C3I H;  3FKI G;  1QUQ B;  2E2I H;  3I4M G;  1ASY A;  3K81 C;  2ASB A;  2GVA A;  3W1G A;  2VW9 A;  5IYB G;  1VQJ A;  1G51 A;  1X56 A;  1OXS C;  2R7F A;  2Y0S E;  4X62 Q;  3HOX H;  1U5K A;  1A62 A;  2RHS B;  4DV3 Q;  3J81 i;  4DPG A;  1VQI A;  2V1C C;  2ZTE A;  3M4Q A;  1OTC A;  2E5L L;  2HHH Q;  4BY1 H;  1QVF A;  4PG3 A;  4GOP B;  3GTO H;  1N36 L;  3HOW H;  1PVO A;  2VQE Q;  3HOY H;  1WCM H;  2RF4 A;  1GKH A;  2E8G A;  3HKZ E;  1X65 A;  3H0G G;  1VS0 A;  2XTI A;  2F3I A;  4DV2 Q;  3A0J A;  2A8V A;  2IHF A;  1JMC A;  2E2J H;  3W5O A;  1XMQ Q;  1KQS A;  3PUX A;  1VQG A;  4TVA B;  4B3M Q;  2MNA A;  1UEB A;  4LF6 Q;  1XPU A;  2A19 A;  3S1Q H;  4PMW A;  4A3C G;  1NMF A;  4HJ8 A;  4HJ7 A;  2KBN A;  5GRO A;  4HIM A;  4L5R C;  4JBM A;  2R7Z H;  1CKO A;  4LF9 L;  2YV5 A;  2VUM G;  1P16 A;  4LUV A;  3PV0 A;  4PZ6 A;  1MJC A;  1I94 L;  3CQZ H;  1UE6 A;  1J5E L;  2WFW A;  3H15 A;  3K0X A;  4LF7 Q;  4AQY L;  4QL5 A;  2VL6 A;  4LW1 A;  3PIO A;  4GNX B;  2D62 A;  1XMO L;  5HGQ A;  1S40 A;  4DV6 L;  4BBS G;  2I5L X;  1VQB A;  1Y1W G;  4A3F H;  3LGJ A;  1FL0 A;  2FXQ A;  1O7I A;  4QGU A;  3CMA A;  3BZK A;  1N8R C;  2JA7 G;  2UUA Q;  3J81 c;  3E0E A;  4JI1 L;  1KIX A;  3KJO A;  2D0O A;  4NXM L;  3ICE A;  3GD7 A;  3A74 A;  4GKJ L;  3FHW A;  1LTL A;  2XGT A;  2JEA I;  4UP8 A;  1ASZ A;  4FDB A;  4DUY L;  5ELN A;  4LF5 L;  1VQE A;  2KCT A;  3BU2 A;  4OON A;  1OXV A;  2BH2 A;  1XNR L;  4GLX A;  4DV4 Q;  4BXX G;  1UE1 A;  4JI3 Q;  2B29 A;  5IWA L;  4GS3 A;  4R4I A;  2Q2I A;  3CPF A;  3JC6 6;  4POF A;  4DAY B;  5IYD G;  4TQU S;  2BA1 A;  3TEH B;  1A0I A;  4A4I A;  1EIY B;  4LF4 L;  3B6Y A;  1HR0 W;  4DV3 L;  4BBR G;  1VQP A;  1N34 Q;  1LUZ A;  4DV7 L;  2HHH L;  4A3I H;  1CKM A;  2DUD A;  4IPH A;  4PZ8 A;  1XTD A;  4JC0 A;  5FLM G;  3PF4 A;  4GKK Q;  4DR4 Q;  5IYC G;  3PO2 H;  1Q82 C;  2RHQ B;  3T1Y Q;  1Y1V H;  1C9O A;  3RN2 A;  4JI8 Q;  2JA6 H;  1N36 Q;  1BKB A;  1KHI A;  1I50 H;  4YWL A;  5C44 H;  2R6G A;  2F52 A;  4DV2 L;  1E7Z A;  1TXY A;  1NY4 A;  3W1B A;  1XMQ L;  1QVG A;  2Z6K C;  4HIK A;  4B3M L;  4A93 G;  3M9B A;  2NVX H;  2EXD A;  2ID0 A;  1L0W A;  2KCM A;  1JJC B;  4P74 A;  3CD6 A;  1EWI A;  3CXC A;  4GNX C;  1GVP A;  4IFD G;  1N33 Q;  2N3S A;  4EX5 A;  1PH6 A;  3PO3 H;  3WWV A;  3J80 c;  2PI2 E;  4KI0 A;  5FLX c;  3PIP A;  1YNX A;  2WAQ E;  4YWM A;  3ULJ A;  3RN5 A;  4A3J G;  5E7N A;  3U58 A;  2ALY B;  3CCR A;  1J5E Q;  1K83 H;  4GLA C;  3GTQ H;  1VQL A;  1A63 A;  4C3H H;  5ELO A;  3D31 A;  3PUW A;  4X65 Q;  1Z9F A;  3GTM H;  4GLV B;  3RLF A;  1NMG A;  4DV0 Q;  3KF6 A;  3HOZ H;  3K7U C;  5IP7 H;  1K3R A;  3M85 A;  4IPD A;  4GN4 B;  5GAH C;  1NTG A;  4HIO A;  1D7Q A;  2JK8 A;  1HJP A;  3AEV A;  1VQ7 A;  1RIP A;  3JAM i;  4NXM Q;  4MTN A;  2K5N A;  1FJG L;  1FVI A;  2AKW B;  4APV A;  2OCE A;  2PQA A;  3RLN A;  4HJA A;  1A8V A;  4IFD I;  3A5U A;  1M90 C;  4BA1 I;  1PYS B;  3I4O A;  1PFS A;  4LF5 Q;  5C4X H;  2UXB Q;  2CKZ B;  2WP8 J;  2Y0S G;  1OXU A;  2LSS A;  4AH6 A;  1W3S A;  3HOY G;  2Z0S A;  3HOU H;  3S24 A;  1I6H H;  1PYB A;  1PH7 A;  4X66 L;  3CF5 A;  3F2D A;  4P72 A;  4K0K Q;  1HZA A;  3G71 A;  2VNU D;  3RNU A;  3PSI A;  5C0X J;  4DR3 L;  3H3V H;  3DLL A;  3HKZ G;  1N34 L;  2B63 H;  4NB3 A;  4LF4 Q;  1PH5 A;  4JG2 A;  2OQK A;  2UUC L;  4GKK L;  4YCV A;  4A3G G;  4DR4 L;  4DV7 Q;  4QJF A;  3UE1 A;  3T1Y L;  1KC8 C;  3MXN B;  4JI8 L;  2ZM6 Q;  4IOC A;  3TS2 A;  1SN8 A;  3HOV H;  1UE5 A;  1M1K C;  1MJE A;  4DR2 Q;  4A3D G;  3NBH B;  3OYY A;  1GM5 A;  3UDF A;  1L1O C;  4O0A A;  4XTC S;  5IE8 A;  1EUJ A;  3IRB A;  4J15 A;  3JAM c;  5C0X I;  2OTL A;  2YU9 H;  1E1O A;  1L1O A;  1BBW A;  3RZD H;  3GTL H;  4X64 Q;  1N33 L;  3I7F A;  2JA8 H;  5M3M H;  4LFC Q;  3L2P A;  2UXD Q;  2AWO A;  2OTJ A;  1BBU A;  4KHP Q;  4DR7 L;  3OTO L;  1QVC A;  1IBL L;  3S2H H;  3F1Z A;  1BVS A;  1OXT A;  1CUK A;  4JI0 Q;  1TWF H;  1X3F A;  1EQQ A;  1HNZ L;  1YIJ A;  3J7Z C;  3J7A 5;  3VDY A;  4ME3 A;  1X3G A;  2ZJR A;  2JA5 H;  2R92 H;  1J6Q A;  4OO1 I;  1IBM L;  3TRZ A;  1NBW A;  4X65 L;  4IPC A;  3J81 j;  4BY7 H;  4DV0 L;  3FKI H;  4MNO A;  1U0L A;  5JJK A;  2R93 H;  1TWC H;  2R7D A;  1GO3 E;  5HY6 A;  2IX1 A;  5JJL A;  1DGS A;  2CWP A;  3UE0 A;  3ULL A;  4HJ9 A;  2VY3 A;  1K73 C;  4LUZ A;  1Q81 C;  1KD1 C;  3KF6 B;  2UXD L;  5LMN L;  1WI5 A;  1VCI A;  3M3Y H;  1B8A A;  3K8A A;  1FJG Q;  3CC2 A;  1YBY A;  4P75 A;  4A3K H;  2ZJP A;  2ZTD A;  5M3F G;  2UXB L;  1V43 A;  5JEA J;  4AYB E;  4A3I G;  4YHH L;  4C3J H;  2PQA B;  1Q86 C;  1HH2 P;  2CQO A;  3K7A H;  2VQF L;  2Q2T A;  3PO2 G;  1G6P A;  1PA6 A;  3RZO H;  3S14 H;  1PH3 A;  2IT1 A;  4A3C H;  2PMZ E;  1VQO A;  3S2D H;  4LUO A;  4K0K L;  2HQL A;  3ERS X;  3SGI A;  2VUM H;  3GTG H;  3PGZ A;  4X66 Q;  1X54 A;  3OW2 A;  2MQH A;  4A3M G;  4DR3 Q;  1Q8K A;  4NXN Q;  4R4O A;  3F8T A;  2KEN A;  1LYL A;  4KLK A;  1QZG A;  3KDF A;  4L5T A;  4Y52 H;  1PHJ A;  2UUC Q;  1MIU A;  4BBS H;  2ZM6 L;  3DM3 A;  4A3L G;  1V9P A;  3S16 H;  1Y1W H;  1CKN A;  4R4T A;  3GTJ H;  4DR2 L;  3GDE A;  1VQA A;  5GAD C;  5C3E H;  1XJV A;  4JCV E;  3HFZ B;  4IPG A;  2MFI A;  2WAQ G;  2EQS A;  1EYG A;  3A5Z B;  1R9T H;  4JI4 L;  4JOI C;  1EIF A;  1SRO A;  1I3Q H;  4X64 L;  4LFC L;  4OXP A;  2MO1 A;  4A76 A;  1JE5 A;  4JOI A;  4KHP L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...