4JOIA

Crystal structure of the human telomeric stn1-ten1 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
160
structure length
141
Chain Sequence
LAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKVYDQPFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human telomeric stn1-ten1 capping complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords CST complex subunit STN1
total genus 39
structure length 141
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4joiA00
5JEAJ 1EIYB 2RCNA 2NZOA 5IY0A 4B3RL 4JI0Q 4GN3B 4B3TL 2EQSA 3T1YL 2YV5A 1HZCA 1FVIA 3PV0A 1K83H 2BA1A 4IPCA 4A4IA 5BR8Q 1HR0L 5IWAL 4JBMA 1P8LA 1TWFH 1CSPA 2K50A 3BU2A 3TS0A 4R4TA 4LF8Q 5ELOA 4LF9L 3PUWA 1YBYA 4MTNA 4Y7NH 2FXQA 2JJQA 1VQJA 3BJUA 3CC2A 1UE1A 4A3JG 3LGJA 5IYDG 2UUBL 3TRZA 5IP7G 4JI6Q 5C0XI 2PQAB 4P74A 5GADC 3F2CA 1XMOQ 2JA8G 3S16H 2ID0A 2Q2IA 2AHOB 2YYZA 3ERSX 3KF6B 4LF4L 2UXCL 4LUVA 4APVA 4O0AA 3H0GH 4A3DH 4IPDA 3W5OA 1PH6A 3D31A 3HOVG 1N32Q 2V1CC 4YHHQ 1SROA 2IHFA 4MZ9A 4HIOA 2UU9Q 1YHQA 4A3MG 4X6AH 4DV3Q 2JA6H 4A93H 3K0XA 3I7FA 1VQOA 4GNXA 5GQOA 4A3IH 2IY5B 3S17H 2HT1A 4LW1A 2RHSB 1PH5A 4HJ9A 2ES2A 2UUCL 2KHIA 4AH6A 2MO0A 3CAMA 5EAYA 1I94L 3PIPA 3I55A 3H15A 1HNXQ 1K0RA 4JV5Q 4X65Q 4GNXB 2A8VA 1Q46A 2QGQA 4DV4Q 3STBD 4LF7L 3CCSA 3HOZG 1KAWA 2LXJA 3S1MH 4L5SA 1TWAH 1VQGA 5H1SE 1PFSA 4BBRH 4QGUA 1XMQQ 4LF8L 4LF9Q 2PQAA 4DR6Q 4LFBQ 1X56A 4X62Q 3UDGA 2JA7H 1PYBA 5LMNL 1W3SA 1YHBA 1Q1BA 3HOUH 1BBUA 1HJPA 4A3KG 1SLJA 1D7QA 1E1TA 1E24A 3M4OH 2E5LL 3UDFA 1LUZA 3NENA 1I3QH 4POGA 3GTMH 1HNXL 1EOVA 2GN5A 1J5EL 2YTYA 1YHAA 4L5RC 1G51A 5M5WH 3PCOB 4X62L 4DV3L 4NB3A 1VQLA 1HNWL 4QL5A 1UWVA 2QA4A 1XMQL 3MEFA 4LFBL 1PH3A 2CWAA 5GAGC 1Q86C 3A74A 3PF4A 1Q82C 5C4XG 3K80C 5C0XJ 4P73A 4JI5L 1TXYA 2LSSA 4BBSG 1E22A 1HZAA 3J7ZC 2R7ZH 2DGYA 3S1NH 4A3BH 3S24A 4GOPC 3PSIA 5C44G 4B3SQ 3U4VA 2A19A 4YWLA 4DR5Q 4JI7L 2QEXA 2DUDA 3RN5A 1YVCA 3A5UA 1PH9A 1NMFA 1WCMG 5M3FH 3J80c 2NVQH 1Z9FA 1CSQA 2VL6A 1X55A 1HR0W 1A62A 3WWVA 4PG3A 3I56A 1VQMA 1Z47A 1KRSA 1PYSB 3CC4A 4H02A 3JAMi 2KCTA 4BY1G 4DV6L 1C7YA 1Y1WG 4KLKA 3CCMA 2JA5G 4JI2L 4A3CG 4IJHA 4JV5L 5IYCH 1VQ4A 4DR5L 3A0JA 2CCZA 4LNQA 2OTJA 4GKJQ 1N33L 3M4QA 2B29A 4DUYQ 1VQ6A 1VQIA 1EIFA 3ICEA 4GKJL 1A63A 3HKZE 1TWGH 1FJGQ 3J81j 4HIMA 1KHIA 4POFA 1RL2A 2ZJRA 3CCJA 4JI1L 1S72A 1I5FA 4JBWA 1H95A 5HY6A 4IO9A 1XPRA 5AJ3L 1X3GA 2K5HA 2KENA 2ALYB 3AYHB 4JOIA 3UE1A 1NMGA 4DV0Q 4GKKL 3U4ZA 4X66L 3KJPA 2VW9A 1TWHH 2NN6G 4DR1Q 2ZJQA 4DR4Q 1D8LA 3CCUA 4UP8A 4DUZL 3GTLH 4DV4L 4LF7Q 4QQBX 3PO3G 1VQKA 4PZ8A 4LF4Q 1FJGL 1PVOA 1IBLQ 2BA0A 2UXDL 1VQCA 1EQQA 2AMCB 4C3IH 1NBWA 1WJJA 3ULJA 4HIKA 1GKHA 2Q2TA 1M90C 2YU9H 2NVYH 1HZBA 4IPGA 2I5MX 1XNQQ 2BH8A 2AWNA 1YITA 4IOAA 1KRTA 3E0EA 1IL2A 1E7ZA 4JBJA 3CCVA 1XPUA 5AJ3Q 1QUQA 1UEBA 3GO5A 1W2BA 1EWIA 3RZDH 4YCVA 4A3JH 4AQYL 4JC0A 2JEAI 4BY7G 4IFDG 4DNIA 1XTDA 3L0OA 4AYBG 4DUYL 4B3RQ 4X65L 1VQ7A 2ZTCA 1X54A 2KHJA 1XJVA 1MJEA 3RZOH 4GS3A 5IE8A 1C0AA 3GTQH 2E2JH 1KL9A 1LM0A 4KHPQ 2UUAQ 1X3FA 4GLXA 4A3DG 1JE5A 3T1HQ 5GAHC 2R93G 1GD7A 2K4KA 4P72A 3CW2C 5IYBH 3CXCA 4DV2L 4DV5Q 1CUKA 4A3EH 4LUZA 1KD1C 4O2DA 3VDYA 4KI0A 3UE0A 4X64Q 1VQFA 3I4OA 3AQQA 2JA6G 2R92H 1MJCA 3AFQA 2UXBL 1EYGA 3T1YQ 1KC8C 3CP0A 3FKIH 4UY8C 1IBKL 4BXXG 1V43A 2NVXH 3L7ZC 1KIXA 2R7FA 3F8TA 4TVAB 4IFDJ 5J3BA 3KOJA 2UXDQ 3J7A5 3PF5A 3M7NA 4LF5Q 1NY4A 4TQUS 4A3BG 1WFQA 4OXPA 1YZ6A 4AYBE 1N9WA 1K8GA 1P16A 3GTJH 1VQHA 1PA6A 3KLWA 2EIFA 3PIOA 1GM5A 1N36L 3S1RH 3EN2A 1Q81C 4L5QA 4JI3Q 1Q12A 2VQFL 1UE6A 4B3MQ 5C0XG 4GN4B 1SMXA 4JCVE 4BA2I 4P71A 1L0WA 4A3KH 2VNUD 2ASBA 4DPGA 1Y1WH 5M3MG 1QVCA 3F2DA 2RHQB 2XTIA 1Q7YC 1T9HA 3PUXA 3JC66 1U0LA 4LFCL 3U50C 3J81c 3GDEA 3CMAA 4NXMQ 1U5KA 3CPWA 1R9TH 2WAQE 5FJ8H 4GOPB 3TEHB 4X64L 2IX1A 4X66Q 1JJ2A 4LF6Q 2L15A 2EXDA 1VQ5A 2OWOA 4NXNQ 3FHWA 3RLOA 2WB1G 3HOYH 3I4MG 4XIGS 5IWAQ 1OXXK 3DLLA 2MQHA 1WI5A 2I5HA 3B6YA 4A3FH 1V9PA 2B63H 1VQ9A 5FLMH 3CPFA 1X9NA 3W1GA 3HFZB 5C44H 4YY3Q 3NEMA 4DV7L 3HOXH 4A76A 3CCLA 1YNXA 4QIWE 3RN2A 4PZ6A 3PO2H 1BBWA 1Q1EA 1A8VA 2IX0A 2ZTDA 3CF5A 4DR2Q 3KFUA 1BVSA 1EUJA 4LF6L 3PUVA 4OX9L 2VQEL 3CCEA 4A3LG 4C2MH 5M5XH 4ME3A 2IHEA 3K7UC 4LFAQ 4JBKA 3CD6A 1X6OA 4JYAQ 4OONA 2UXCQ 2E2HH 1HR0Q 5HGQA 5LMUQ 4R4OA 4JI0L 4BA1I 3OYYA 1Y1VG 4LF5L 4LFCQ 4JI7Q 3HOVH 2N49A 2K52A 3NELA 1NJIC 3S1QH 1VQBA 4DV1Q 1XMOL 1XNRQ 4A3MH 4DR4L 3E9IA 4YWMA 2UXBQ 1PH1A 1MKHA 4JG2A 4OWTB 2LXKA 2Z6KA 3KDFB 4DR3L 4JI3L 1QZHA 3F1ZA 1N34Q 2H5XA 4DR7L 2F4VQ 5C3EH 3AFPA 1JT8A 3K8AA 1AH9A 1YEZA 3PGZA 3HOWH 4FDBA 2XGTA 1SR3A 2CQOA 3FKIG 1VQDA 4QY7A 4AIMA 3PO3H 4BXXH 2YTVA 2Z6KC 2RF4A 4EX5A 2N3SA 3NBHB 2K5VA 2OQ0A 3RLNA 4HJAA 2HIVA 4LUOA 3KDFA 5GAEC 3U58A 5LMNQ 3GD7A 4JI2Q 1CKOA 1OXVA 2VQFQ 1AE2A 1YJ9A 4C3HH 5JJIA 3RR5A 1B70B 2HIXA 2F4VL 5JJLA 3ULLA 1A0IA 3HOZH 2PI2A 4YCWA 4NXNL 2MFIA 4J15A 4HJ7A 2JA5H 4BY1H 3K7AH 1JB7A 4BY7H 1PH4A 2ATWA 2E2IH 4B3SL 3OW2A 3I4NH 2PNHA 5GROA 5IP7H 1K73C 1I6HH 1IBLL 3MXNB 3S2DH 2AWOA 5M3MH 3HOUG 2A1AA 3KF6A 3S14H 5JJKA 3GTKH 3AEVA 1G6PA 3FP9A 2ZM6L 3S15H 3BZCA 2UUBQ 1VS0A 4DV6Q 4JYAL 3SGIA 1LYLA 5JEAG 1OXUA 4HIDA 4AQYQ 1HNZL 4A3GH 5LMNW 4ALPA 4OX9Q 1IYJB 2WAQG 1VQEA 1YI2A 1QVFA 2JA9A 4DR6L 4GLAC 4BBSH 3EIVA 1S3OA 3HOYG 1V1QA 1J5EQ 2I0QA 1QVGA 3TS2A 2OCEA 4KHPL 1G291 3M85A 2CWPA 4P75A 1NE3A 2KBNA 1FGUA 4DV1L 4JI4Q 4KHZA 4A3FG 1RIPA 3RLFA 3OTOQ 4JI8Q 2PMZE 4R1JA 1E3PA 1UE5A 1M1KC 2VY3A 1TWCH 2ZTEA 3M4PA 5M5YH 2UUCQ 4R4CA 2PI2E 4RG1A 1N34L 4GOPA 4GKKQ 2HHHQ 1VQAA 2UU9L 1HZ9A 2F52A 4BBRG 4A3CH 1C9OA 1WOCA 5IYCG 5IP9G 1OXTA 1I50H 1QZGA 1N8RC 3T1HL 4UP7A 5M3FG 2K75A 4B3TQ 1JMCA 2JA7G 2JA8H 2D0PA 3STBC 1GO3E 4JI8L 1WYDA 4UPAA 4IPHA 4K0KQ 4GNXC 3UDXA 2VZAA 1SFOH 2JE6I 4NPSA 4JI4L 3GTPH 1LTLA 4JI5Q 4GN5A 3TQYA 4R4IA 4DUZQ 4PZ7A 4JI6L 3H0GG 4EQ5A 3PUYA 4DV0L 5FLXc 3HKZG 2N8NA 5IT9c 2R7DA 2WB1E 2Q2HA 1L2FA 2C35B 1N36Q 1OXSC 4DR2L 4QJFA 1PHJA 2VUMH 4A93G 1GVPA 4Y52H 2Z0SA 4A3IG 1UE7A 3JAMc 5C3EG 2MNAA 1N32L 2JQOA 1CKMA 4GLVB 1L1OA 3IRBA 4UP9A 3HOWG 1SE8A 3G4SA 1DGSA 3GTOH 2NN6I 3J80i 4K0KL 4YWKA 1IXRA 1PH2A 2E5LQ 1NTGA 2Y0SE 4NXML 4OO1G 3ER0A 5ELNA 1S40A 5DLQE 1X65A 4DR1L 1JJCB 2I5LX 1VQ8A 4YCUA 2D0OA 4L5TA 3ULPA 3E9HA 3A5ZB 3H3VI 4XTCS 1HH2P 2R6GA 4JI1Q 4RMFA 4A3LH 4YHHL 5IYDH 3CQZH 3KJOA 4DV2Q 4DV5L 1XNQL 1CKNA 4DV7Q 3F2BA 2ZM6Q 2VS1A 3ZJYC 3I4NG 1L1OB 1EQRA 2K14A 4YY3L 1EFWA 3S2HH 2R93H 5IYBG 1K3RA 4DKAC 2N78A 4IJLA 5FJ8G 1Y14B 1QUQB 4OWWB 2OQKA 3UDIA 3I2ZA 4LFAL 2NVTH 2HHHL 2YTXA 1PH8A 2IT1A 4B3ML 1CKNB 1SN8A 2JEBI 3J81i 2VQEQ 5C4JH 1IBMQ 2OTLA 3I4MH 3M3YH 4OO1I 4A3EG 3Q8DA 4C3JH 4DAYB 1PH7A 4PMWA 1L1OC 4WJ3M 2B63G 1ASYA 3M9BA 4DAMA 3OTOL 5C4XH 2UUAL 2KCMA 3L2PA 5E7NA 3G6EA 2CFMA 1VCIA 2R7ZG 3RNUA 3HOXG 1B8AA 1O7IA 4R4QA 3CCRA 4IOCA 1IZ6A 4HJ8A 1I94Q 4DK3C 2F3IA 1YJWA 5K36G 1AE3A 1YJNA 3BZKA 1BKBA 1WCMH 3KF8B 4OWXB 4DR3Q 1OTCA 1HNZQ 1SRUA 1Q8KA 4MNOA 4DR7Q 4A75A 1X3EA 2BH2A 1HNWQ 1YIJA 1J6QA 5IP9H 2GVAA 1Y1VH 3D0FA 3GTGH 3G48A 2B3GA 2Y0SG 2AKWB 1KXLA 1KQSA 2MO1A 3HKSA 4WJ4A 3CCQA 2D62A 2CKZB 4LWCA 2K5NA 1PV4A 1ASZA 1IBKQ 3CC7A 4HJ5A 3TREA 3K81C 5LMUL 1IBML 4A3GG 2NZHA 3H3VH 1MIUA 3KYHC 1VQPA 2GVBA 2E8GA 3G71A 2Q2UA 5BR8L 3DM3A 1XPOA 3W1BA 1VQNA 1B7YB 3EBEA 2R92G 2VUMG 2WP8J 5FLMG 1K9MC 1FL0A 4JOIC 1XNRL 1E1OA 2WFWA 2ZJPA 1K8AC 4DK6C 2JK8A 1N33Q 3PO2G 4IFDI 3CMEA 3PUZA 2HQLA 1JJGA
chains in the Genus database with same CATH superfamily
1EIYB 1U9RA 4C3IB 4GN3B 5A2QL 4DAVA 3T1YL 2YV5A 1HZCA 4IPCA 5CV5A 1K83H 1C4QA 2BA1A 2ZXOA 4JBMA 3HP3A 2K50A 3BU2A 4G7OC 3P20A 3H3VC 3PUWA 1YBYA 2G9HD 4RCOA 3BJUA 3WDNA 1EY9A 2UUBL 5IP7G 5GADC 1GUSA 4K6DA 2ID0A 3J80L 2Q2IA 2YYZA 2VB2X 3KF6B 4LF4L 3PO2B 3SK8A 2DJFC 1N32Q 4MZ9A 4A3MG 4RKBA 4A93H 3I7FA 2C5CA 2H1EA 2KJXA 5T1IA 3S17H 2ES2A 2UUCL 1L0YB 2E2IB 4AH6A 5C4XB 1MI2A 5ELDA 1ESFA 4RCNA 3NK9A 1K0RA 3A7LA 2QGQA 1LV9A 1KAWA 2LXJA 2F0KA 1TY0A 5H1SE 1PFSA 4LF8L 2PQAA 4LFBQ 3OMGA 1X56A 4XT3B 1U4RA 3K5MA 2B2YC 1HRJA 5LMNL 3S17B 1H9SB 1YHBA 4KJNA 3HOUH 1BBUA 4A3KG 3PMFA 2R93B 1K8OA 1LUZA 3AMUA 3Q0AA 4CKCA 2GN5A 5HURA 2Q8RE 2A6HD 1G51A 2B2TC 1TKWB 1VQLA 1XMQL 5JJZA 2Z1CA 1D1IA 1QNUA 5C0XJ 1TXYA 3P75A 4BBSG 1E22A 2FHTA 1HZAA 3A7AB 1TY2A 3ONAB 4DR5Q 4YWLA 5CYUA 3J81E 3MEHA 1YVCA 3A5UA 1JOQA 1NR4A 5IGDA 1VF5C 2PQEA 5F2DA 2NVQH 4C3HG 2VL6A 1CSQA 1PZJD 2F0WA 3WWVA 1HR0W 4PG3A 5DNFA 1VQMA 4KJOA 2JSOA 4H02A 4WJWA 3JAMi 2KCTA 2JA5G 1Y1WG 2ICEC 2TMPA 5IYCH 1WTRA 1VQ4A 2PW5A 2B29A 1EIFA 1CZWA 1R4QB 2OXPA 2SDFA 5LHY1 3VR6A 1S72A 5E4XA 4IO9A 1XPRA 2F0EA 2K6AA 5C4ZA 5AJ3L 1ZXTA 1X3GA 2EJFC 1D5MC 3CQZB 1NMGA 1GUTA 3KJPA 1TWHH 3ND8A 4DUZL 2M00A 4QQBX 4PZ8A 4LF4Q 2K33A 3VYUA 2BA0A 1VQCA 2F0UA 2E2JB 2AMCB 1NBWA 3QJYA 5K36H 1WJJA 1H9MA 1FNVA 4HIKA 2YU9H 1SNPA 3NUCA 3VYSA 1CQVA 2KEDA 4DGZA 3A54A 1KTKA 3SHLA 3CCVA 1XPUA 5AJ3Q 2ENBA 1UEBA 3K7AB 3RZDH 1TWHB 4AQYL 3OWEB 4IFDG 3DEPA 4B9XA 4B3RQ 4X65L 2KHJA 1XJVA 3QG1A 4GS3A 3GTQH 2E2JH 2UUAQ 5C3WA 3BVGA 5GAHC 2R93G 4KY7A 1GD7A 2K4KA 2IX3A 3TBIB 3IKJA 2R92H 3K0YA 1MJCA 2OEOA 4ZK9B 3D4WA 2D9UA 1GHJA 3T1YQ 3K5LA 5J3BA 3KOJA 2UXDQ 3GTGB 1KAAA 3J7A5 2RSNA 2Z9HA 3M7NA 3HG9A 4TQUS 4A3BG 1PFNA 4AYBE 4YIJA 1TWCB 2BOSA 1P16A 4KTAA 3X3MA 2A73B 2LS01 3PIOA 1N36L 4XQJA 1Q12A 1UE6A 3TZUA 2RQXA 1SXTA 4RKLA 4JCVE 1IYUA 4P71A 3X3NA 3OIPA 3TP6A 5M3MG 1PZKD 3F2DA 1LT6D 5M3MB 2RHQB 1Q7YC 3J81c 4LFCL 3U50C 1DOKA 1TWGB 3GDEA 1SNDA 1PRTB 2WAQE 2AQ2B 1A6XA 3TEHB 4QUCA 2X6GA 1PRTD 2PZWA 3GV3A 2OWOA 5M5XB 5DAUA 2EYMA 3VYRA 3DLLA 3SK4A 2NN6H 3B6YA 2X69A 5EPKA 3CPFA 1X9NA 3W1GA 5C44H 3LNNA 1EQTA 3KK7A 4QIWE 3PO2H 2DJGC 4KN7C 1Q1EA 4KKUA 3MZ5A 3K6OA 3MXGA 3CF5A 4OX9L 2PZTA 5M5XH 1I50B 3SDZA 2Z4IA 5FO7B 3K7UC 4RH6A 5I6YA 1HR0Q 1CHPD 2F0QA 3OYYA 5J22A 3HOVH 2K52A 4NMZA 4K5WA 3PIO3 1XMOL 1XNRQ 4A3MH 4YWMA 3T4AC 1JICA 1MKHA 2WV6D 2Z6KA 1RODA 1QZHA 1N34Q 4DR7L 3HGBA 1JT8A 3AFPA 4K6LA 2NYZD 2F1MA 3MVVA 3FKIG 4QY7A 1DCZA 5JVH3 4AIMA 4EX5A 2Z6BA 2KUMA 4UDUC 2HIVA 5LMNQ 2B2WC 3CRLC 1YJ9A 2K03A 1BCPF 3HOZH 1A0IA 1EEID 4NXNL 1NUCA 3EFXD 4XQQA 1AP0A 5ISRA 1SE4A 1PH4A 2ATWA 3I3CA 5IP7H 1K73C 2RDGA 1PRTC 2A1AA 3KF6A 5JJKA 4HEDA 2ICIA 1C48A 3VYTA 3FP9A 3BZCA 4X3TA 1DZ1A 2QW7A 4HIDA 1LYLA 1OXUA 3BDOA 1HNZL 4HMIA 4HSVA 1AW7A 1YI2A 1QVFA 1STBA 4BBSH 3EIVA 3VA5A 3HOYG 1V1QA 1J5EQ 1HPCA 4NW2A 1NE3A 2K7VA 1VMCA 4A3FG 3N52A 4JVZA 3OTOQ 4R1JA 3SVMA 4K5XA 1WVLA 2VY3A 1K8MA 2PI2E 1EYDA 4DA2A 4GKKQ 2UU9L 4R8NA 1HXYD 2EPBA 1OXTA 3T1HL 1LTTD 5C6AA 4N8X1 1KDAA 2JA8H 1H9JA 4JI8L 4GNXC 3UDXA 4N9TA 2JE6I 1LTLA 4GN5A 3TQYA 1MBYA 4WRDA 1F9SA 4IUNA 2C35B 1EZ6A 3DHQA 1PHJA 2VUMH 1X3PA 1GVPA 4Y52H 2G9DA 5J1ZA 1UE7A 3JAMc 2MNAA 2JQOA 2JA8B 2QDLA 1LO5D 1HTLD 2EDGA 4UP9A 1CHQD 1A3TA 4CDCC 5E4WC 2K04A 3ER0A 1S40A 3NBIA 4OIKA 1X65A 1EL0A 1JJCB 4H44C 4QB4A 4J8QA 4L5TA 4ZUIA 3H3VI 4XTCS 3H09A 3E0JA 1Q3LA 4JI1Q 4C2MB 1U4PA 4DV2Q 1XNQL 1CKNA 4B08A 1HQRD 1CI3M 3S2HH 3MXPA 1L1OB 1EQRA 1EFWA 2OF1A 2N78A 4DU9A 1LABA 2KVMA 1YNJD 1F9QA 4LFAL 1QE6A 5TSSA 5HGTA 2YTXA 3GTJB 5KNCA 4KHVA 2OTLA 3I4MH 4PNYA 2RDHA 1NCVA 3Q8DA 3CU7A 1G8ZD 4ZAIA 1PH7A 3HOWB 4WJ3M 1AN8A 1DM0B 5C4XH 1HA6A 1M4VA 3NPPA 5E7NA 5M9OA 2RKSA 2R7ZG 4R4QA 4KKTA 5K36G 1YJNA 2PYKA 1A2UA 1WCMH 4DR7Q 5I2YA 2BDOA 1SNQA 1HNWQ 2JXMB 5IP9H 2CW0C 1Y1VH 1J8IA 3S2DB 1ONLA 3R2IA 5JPMC 5K5PA 2KECA 2HCCA 4LWCA 4OL7A 5ELCA 3A8IE 1IBKQ 1SE3A 4HJ5A 1DXMA 3K81C 4DAPA 1CFMA 1IBML 1ZYRD 2NZHA 1MIUA 2F0OA 2NWGA 5CMDA 1B7YB 4RHRA 3EBEA 4CBVA 5FLMG 3DM1A 5CV8A 1XNRL 5A35A 2WFWA 2ZJPA 3FPPA 4DK6C 3PO2G 2GA4B 2HQLA 4ZCKA 5JEAJ 4IALA 3QB3A 2NZOA 4B3RL 4JI0Q 5M5YB 4B3TL 1B9MA 1HR0L 2JN4A 4R9WA 1P8LA 5BN5A 1K0SA 3J81L 4R4TA 3D4DA 3TS0A 4LF8Q 2FXQA 2JJQA 1VQJA 3BDLA 4KN4C 4A3JG 2JA8G 4CDDC 2VXWA 3F2CA 1EIHA 1JC7A 1HTPA 5CBEE 3W5OA 5I9PA 2ZT9C 3J80E 2V1CC 1SROA 3MA2B 4HIOA 1MD2D 1GUWA 1YHQA 1IW7C 1VQOA 5GQOA 5JPNC 4LW1A 2RHSB 2MO0A 1I94L 4HCSA 1HNXQ 1HFGA 2F0FA 2A8VA 1JB3A 4PMCA 4DV4Q 2HDMA 4XT1B 1STNA 5CC4A 1GUOA 4L5SA 1E2ZA 1VQGA 4BBRH 4QGUA 3N6RA 2SOBA 2KEEA 2F0PA 3D6WA 2D2CC 1Q1BA 3I72A 1ICWA 1HJPA 1JOKA 4A3KB 2E5LL 3UDFA 3NHHA 3GTMH 1HNXL 1EOVA 1A2TA 1QB5D 4L8JA 4L5RC 4IUQA 5M5WH 3PCOB 4BBRB 4DV3L 1HNWL 1H9KA 5M3FB 4QL5A 1UWVA 5G3LD 2K5QA 2V4DA 5GAGC 1Q86C 3DMUA 4BY7B 2A69D 2A6HC 1D5XC 3K80C 3LWEA 1S5CD 2LSSA 1D1KA 3J7ZC 4ZQ3A 1FD7D 2A19A 3U4VA 4JI7L 2QEXA 3FPUB 3RN5A 1RJTA 5KNBA 3TN2A 1NMFA 1WCMG 5D3IB 2E74C 1Z9FA 1X55A 1A62A 1LLRD 2A6ED 3OMCA 1PYSB 1W6JA 2XNAC 4DV6L 3CCMA 4JV5L 4IJHA 5T1GA 2EXZA 3W2DA 4LNQA 5J39A 4GKJQ 1VQ6A 1VQIA 1V1PA 1Y8NB 1A63A 2A5HA 1TWGH 3J81j 1KDBA 3NTHA 4HIMA 2AUKA 2ZJRA 1I5FA 4C1NI 2JP1A 4JOIA 2ALYB 3TSSA 4DR4Q 2NN6G 1HHVA 4UP8A 4LF7Q 1S5FD 3PO3G 4M8AA 5EQ0A 3J7YW 1SFOB 4UHVA 2UXDL 4RGOS 1M90C 2NVYH 1XNQQ 2XWBB 1TT2A 1ZEQX 1PZID 3I4LA 1TWFB 1KRTA 1JE4A 1EU4A 2MHVA 4JBJA 4ZYSA 1EYCA 3GO5A 1LT5D 1XWEA 4BY7G 2JEAI 4AYBB 4DNIA 2RBMA 4AYBG 4CHTB 4DUYL 1SMYC 3D8GA 1BCPD 1MJEA 3KBGA 1KL9A 1LM0A 1X3FA 4GLXA 1TS3A 4P72A 2O4XA 3VR5A 3CXCA 4MN3A 4TKOB 1JWUD 3CKIB 4O2DA 1YNNC 4X64Q 1VQFA 3AQQA 2JA6G 1SMYD 4I7AA 2EYOA 3FKIH 5EPJA 4UY8C 1V43A 2NVXH 4QIWB 2R7FA 4JK1C 1NY4A 4P2CB 2N88A 1N9WA 3NE5B 2NVTB 4N8FA 1VQHA 3KLWA 1NAPA 4I65A 3J7AV 1Q81C 3G7LA 2VQFL 4JI3Q 1BO0A 2PCFB 4GN4B 1STGA 3BVZA 1K28A 2Z4HA 2ASBA 1Y1WH 2NB0A 1EZ8A 3SXHA 5KYLA 4DFAA 1DD2A 1U4LA 1T9HA 4NXMQ 4Q0FA 4GOPB 2IX1A 4HAEA 2TSSA 1JJ2A 2F0IA 5CR3A 4FVMA 4NXNQ 3FHWA 2WB1G 3HOYH 1AZQA 2EY2A 3Q22A 3OOCA 4G57A 2CHBD 3OPOA 4A3FH 2B63H 2D5DA 2O5JC 1SNOA 4QF4A 4A76A 3NP8A 3CCLA 1YNXA 3V96A 3RN2A 4HR7B 2AUJD 1WTHA 2F0MA 2HQEA 4S3SA 2ZTDA 4OEMB 3KFUA 4LF6L 2F03A 2VQEL 4O42A 4C2MH 2JA6B 1W6KA 2XWJB 4HTHA 3CD6A 1LT4D 4JYAQ 2E2HH 5LMUQ 4JI0L 4IFDH 3R2TA 3PO3B 4LF5L 3SE0A 4B9WA 3RZOB 2K01A 3NELA 3WOEA 1ML0D 4DV1Q 4HN7A 2LXKA 2KOLA 3ITPA 5I9OA 2WB1B 1LTBD 3PIP3 2H5XA 3EA6A 4Y7NB 1G91A 3CRKC 3K8AA 1YEZA 1EFID 3HOWH 1RTOA 4FDBA 3A56A 1SR3A 2CQOA 1A3UA 1VQDA 2VB3X 4ODGA 3PO3H 2YTVA 3RD4A 3NBHB 5E3FA 4NKLA 2L9HA 3KDFA 1ILQA 4LUOA 4K2LA 1CKOA 1OXVA 2VQFQ 1AE2A 3UI2A 5COYA 3RR5A 1RKNA 2F4VL 4U673 3ULLA 1VF7A 5JVG3 2PI2A 3P7JA 2MFIA 2JA5H 1Z7TA 3F2UA 4BY7H 4B3SL 3OW2A 3I4NH 4XYOA 4OELB 2AWOA 3HOUG 1OO9B 2J0TD 1MGSA 2EJMA 3GTKH 3S15H 2UUBQ 1VS0A 4DV6Q 5EBCA 4JYAL 3SGIA 1PMRA 4A3GH 5LMNW 4ALPA 1IYJB 1DOMA 2LKVA 4C3JG 2DY8A 2JA9A 1UEAB 4GLAC 4DR6L 2B2UC 1S3OA 1LTID 1DONA 4DV1L 2KBNA 3TDQA 1FGUA 1I4PA 2F0TA 3AB9A 4JI8Q 5C44B 2PMZE 1Y8PB 3S15B 3GP7A 1M1KC 2ZTEA 3E5SA 1N34L 2HHHQ 1VQAA 1F2ZA 1HZ9A 1C9OA 1WOCA 1I50H 1MSHA 4UP7A 1JMCA 3STBC 3WOFA 3GTLB 1GO3E 4IPHA 2VZAA 1SFOH 4NPSA 5ELFA 4JI5Q 4DUZQ 5IOCA 1R9TB 3O13A 4A3MB 5FLXc 2WAQB 4DNRB 4X3KA 2BE5D 5IIFA 1EY6A 4QJFA 1KNAA 1PTOC 2Z0SA 1F9RA 2QF7A 5C3EG 1WTPA 2FMCA 3IRBA 4PV1C 1ET6A 4CDFC 2IJ0A 4K0KL 4NXML 2Y0SE 3T53B 3OW7A 3T51B 3MXNA 4TRDA 1VQ8A 2D0OA 3QOLA 3V05A 3A5ZB 4A3LH 5FO9B 2SEBD 2I46A 4BY1B 3KJOA 5DM63 4DV5L 2K28A 4DV7Q 3DUZA 2NVXB 2ZM6Q 3ZJYC 4RFBA 2CQAA 4DKAC 1EOTA 5FJ8G 1Y14B 1QUQB 4TSSA 3EVQA 1SYGA 4PQXA 3I2ZA 1FNWA 3ZYYX 2Q8TA 1PH8A 2NVTH 2IT1A 2SNSA 2MUYA 1IBMQ 5CBAE 1SJED 2XRSD 3MXUA 4A3EG 4OO1I 1TS5A 1U4MA 5IGEA 1L1OC 3Q23A 4DAMA 2KCMA 4DN4M 1VCIA 4HSPA 3RNUA 1BNZA 3E6ZX 1O7IA 3CCRA 4IOCA 3OHXC 3FVQA 2B2WA 1G2TA 2F0LA 1D2BA 3H91A 1QOHA 1EYAA 3D6CA 2F3IA 2BDNA 4CJ0B 2L11A 3BZKA 1Q8KA 2R92B 2LMCB 1X3EA 2BH2A 2JA7B 4FF3A 1YIJA 4DNTB 4FP5D 3TP7A 3VR2A 2X6LA 3D0FA 2B2VA 3NWSA 3G48A 2PMZB 2AKWB 3KBXA 4ULLA 1I3QB 2MO1A 3SK6A 2A68C 1ASZA 2DN8A 1HUNA 3BYYB 4KD4A 4A3GG 4C1NK 2KCCA 3AU7A 1F2YA 1SYFA 1II3A 3G71A 1AZPA 2AQ1B 4G4KA 5ELBA 3W1BA 1XPOA 1VQNA 1FL0A 4JOIC 3CHBD 2F4IA 1E1OA 2JK8A 1G2SA 4ME5A 2RCNA 5IY0A 3PV0A 1FVIA 1V1OA 3LX0A 5BR8Q 1TWFH 1ICFB 1JORA 2FINB 1CTMA 4MTNA 4Y7NH 3LGJA 5IYDG 1WTQA 5C0XI 4P74A 1G6ZA 4F7XA 3S16H 4OHJA 2A68D 2KHSA 2AHOB 1XTCD 3ERSX 1VDZA 2UXCL 2ZXPA 1SYEA 4LUVA 4A3DH 4DXGA 1X3QA 3DWAA 2XVSA 4IPDA 1PH6A 3D31A 3HOVG 4C3HB 1DOLA 4YHHQ 3HZXA 1JQYD 1KLGD 4QCLA 4X6AH 2F0SA 4DV3Q 1TIID 4GNXA 2FFKB 2IY5B 2HT1A 3C1EA 4L6TB 1RHPA 3KLRA 5EAYA 1I6HB 3PIPA 3I55A 4CKBA 4X65Q 4GNXB 1Q46A 2M2LA 3U9OA 3NTKA 3S1MH 3I70A 4F8MA 1TWAH 2NTSA 4LF9Q 1XMQQ 4A93B 3JAME 1PYBA 2EZVA 1W3SA 1TS2A 1D7QA 1SLJA 2L55A 1E24A 5KEEA 1T5XD 2WIIB 4POGA 1J5EL 1FR3A 5KGUA 3FRPB 1UUPA 3NQTA 4X62L 4NB3A 3HOZB 3KLSA 2QA4A 4LFBL 3ND9A 3U9SA 2CWAA 3HOUB 1SE2A 2MPMA 3PF4A 1Q82C 4P73A 4A3FB 4OO1H 1NR2A 2DGYA 4KD3A 4XQNA 4B3SQ 1O7LA 3PSIA 5C44G 2DUDA 1F9PA 1PH9A 1S5DD 3J80c 5AFWA 1TS4A 5C4HA 1Z47A 2RVLA 1KRSA 3CC4A 1EY8A 1B2TA 1C7YA 4A3CG 1V8QA 3A0JA 2CCZA 1Y8OB 4QUFA 4DUYQ 3D4RA 1H9SA 1I4RA 2B8FA 3HKZE 5CV4A 4POFA 4JI1L 1HUMA 3A8JE 2KENA 3AYHB 4A3IB 3U4ZA 4X66L 4DR1Q 3RZDB 1BOSA 3NWTA 1VQKA 1FJGL 1IBLQ 4KKSA 1EQQA 3S9WA 3A55A 3R8BA 3ULJA 1GKHA 2Q2TA 1BDOA 1HZBA 3LWUA 2I5MX 1YITA 4G7HC 1QUQA 3GQBA 1W2BA 3Q24A 2F0GA 1PLFA 3L0OA 2ZTCA 1X54A 2H4OA 5D65A 4ZKBB 3RZOH 1C0AA 1QWYA 3S1QB 4MHEA 4A3DG 1IHZA 1JE5A 3T1HQ 3H94A 2YU9B 3CW2C 2IWHA 4DV5Q 4A3EH 1CUKA 2PZUA 4LUZA 1KD1C 3VDYA 3I4OA 2UXBL 1EYGA 1NNXA 3CP0A 4IFDJ 3L7ZC 3F8TA 1STYA 2EYPA 3PF5A 4LF5Q 3GTQB 2CH4W 5IGCA 1WFQA 1YZ6A 1RD9D 4HMJA 2OT2A 1K8GA 4RA8A 4A3EB 3GTJH 1IL8A 5LL6X 1PA6A 2EIFA 4O1NA 2F0HA 3K57A 1GM5A 3EN2A 4B3MQ 1D5ZC 5C0XG 1SMXA 2A69C 4BA2I 1Q90A 1TVXA 4A3KH 1AFPA 1PTOD 3R93A 4J1MA 3DWPA 5CORA 3PUXA 3JC66 1S5BD 5I2XA 3CMAA 4K8JA 3CPWA 1R9TH 5FJ8H 5JEAH 4XYQA 4Z9CB 4X64L 1GOZA 1CK1A 4X66Q 2L15A 2EXDA 1VQ5A 3C3LA 2KQ3A 4XIGS 3MHBA 5IWAQ 3VA7A 1BQQT 1WI5A 2I5HA 3MC0B 1V9PA 5FLMH 1F77A 4YY3Q 4DV7L 4DAYA 4DXFA 1PDQA 4PZ6A 4C3IG 1B50A 1A8VA 1QILA 4H0LC 1BVSA 3BDCA 4K8IA 3PUVA 1O7ZA 5D3DA 1ILPA 2IHEA 4JBKA 2O5IC 4OONA 2UXCQ 2EYHA 4FO2A 2R61A 3MFYA 1LTAD 5IT9L 4FXDA 4FXGC 4DR4L 3E9IA 1GUNA 2UXBQ 1PH1A 1TWAB 3KDFB 2F3VA 2XN9C 4JI3L 4DR3L 1UNSA 4IUPA 2F4VQ 5C3EH 4N9PA 1BCPB 4IQZA 2EVBA 4BXXH 1FYCA 5FKAC 2HD3A 1EQVA 1X32A 2OQ0A 1SNMA 1B4OA 2M9VA 2NVYB 1B70B 2HIXA 5IGFA 2B8GA 4YCWA 4I7ZC 2K5DA 4HJ7A 4BY1H 1JCKB 4A3JB 4BBSB 2HUGA 1IBLL 1STHA 4X3SA 1B3QA 4X3UA 3S14H 4F88A 1G6PA 5CV6A 2CVRA 4DF7A 2PPBC 1QG7A 2L0CA 5IT9E 4CGYB 3HRZC 3FKIB 1QVGA 1BBXC 2OCEA 3TS2A 4KHPL 3M85A 2CH4A 2CWPA 4P75A 4KHZA 3S14B 1RIPA 4ZUJA 4RGMA 4R4CA 4DK1A 5EPLA 4GOPA 4V190 2F52A 3S1RB 4A3CH 1GHKA 5IYCG 1QZGA 1N8RC 1TQOA 2MJ8A 2EJGC 2Y0SB 5C0XH 5M3FG 2E2HB 4LAAA 4F87A 1WYDA 4UAIA 4HCEA 1YNND 3MAQA 4R4IA 1EY7A 3I90A 4PZ7A 2L1BA 3H0GG 4EQ5A 2QILA 5KYIA 3HKZG 2N8NA 5CV7A 2WB1E 1IW7D 2Q2HA 1N36Q 1JOOA 1OXSC 4DR2L 1BCPC 4A3IG 1BXTA 1N32L 4MTKA 1CKMA 1LT3D 2L5TA 3KF8A 2B63B 4RGTA 1LTRD 1SE8A 3HOWG 3L9AX 3G4SA 3RUZA 3GTOH 3S2HB 3J80i 1PH2A 1IXRA 2E5LQ 1NTGA 4OO1G 2G5DA 2F0NA 3ERQA 4XXEA 5ELEA 3S1MB 1I6VC 4YCUA 1WD0A 3IFDA 3OIQA 4OGQC 1HH2P 2R6GA 4FF1A 5IYDH 2MP1A 2P5ZX 2JA5B 4C3JB 2EYFA 1PFMA 3SK5A 3F2BA 2C9OA 3KLSX 3I4NG 2K14A 4YY3L 4KY5A 1B53A 2R93H 1K3RA 3P1HA 3QR8A 4IJLA 4RGNA 4A3DB 1ENFA 4OWWB 5I6WA 3UDIA 2HHHL 3MWYW 4A3GB 3J81i 2JEBI 1BUVT 3IL8A 3M3YH 4C3JH 4PMWA 2B63G 1Y69U 3OTOL 3FDTA 2UUAL 3L2PA 1Y1VB 3SEBA 2B2UA 3HOXG 1SEBD 1ZKOA 1IZ6A 2FJ2A 4HJ8A 1I94Q 2EOTA 1AE3A 5A2QE 3IAYA 2RSOA 4OWXB 5FLXE 4DR3Q 1OTCA 4G7ZC 1GUGA 1J6QA 2BCOA 5BN4A 3HS0C 2LY7A 1K3BC 2Y0SG 1KXLA 4LMQD 1TR5A 1KQSA 4WJ4A 3HKSA 3FMCA 2D62A 3D3RA 2CKZB 1CA6A 4WORA 2K5NA 3CC7A 3TREA 1RTNA 1VQPA 3KYHC 5BR8L 4IUTA 5LL6S 1XYIA 2R92G 1K9MC 3JAML 1ET9A 1YNJC 3A8KE 1JJGA 3HOVB 3SR1A 3TZDA 2AQ3B 5FLXL 1CA5A 1E2WA 2EQSA 4A4IA 1F2LA 5IWAL 1CSPA 4KV6A 4LK1C 1PTOF 4LF9L 5ELOA 1ZYRC 3CC2A 1UE1A 3TRZA 4U68A 1WTOA 4JI6Q 2PQAB 1XMOQ 1J9OA 1B44D 4APVA 4O0AA 3H0GH 1IKLA 3VR4A 1PTOH 2UU9Q 2IHFA 4H7BA 1Z6HA 2JA6H 2A74C 3K0XA 4A3IH 2XRQD 1PH5A 4HJ9A 2DY7A 2KHIA 3T16A 2NUCA 3CAMA 4BWGB 3H15A 5EKIA 1I4HA 5JOBA 4JV5Q 5C3XA 4LF7L 3STBD 3CCSA 3HOZG 3VR3A 2QKIC 5EBDA 2K32A 3NXWA 5M5WB 4DR6Q 3UDGA 4ABNA 4X62Q 2JA7H 4IZ8A 1B9NA 1S5ED 1STEA 4K5VA 4EVOA 1KNEA 3DXJC 1E1TA 3M4OH 3NENA 1I3QH 4L63B 4CKEA 2PW7A 2YTYA 2KCNA 1YHAA 1WTXA 1RF2D 2FMMA 5C4JB 2J7ZA 1STAA 5KRUA 3MEFA 3BG3A 1PH3A 5CV9A 2WACA 4ID6A 3A74A 1T5EA 5C4XG 3QWNA 4JI5L 2R7ZH 4A3BH 3S1NH 1UAPA 3S24A 4GOPC 3GTKB 1SJHD 3DEOA 3M7GA 1SYDA 1MSGA 4QMGA 4K2KA 5M3FH 4Q5VA 3I56A 1SYCA 4BS9A 1A3VA 2JYOA 2VUMB 2SNMA 4RWSC 1SYBA 2F3WA 4BY1G 1F2MA 4KLKA 4JI2L 3EROA 4DR5L 3BVMA 1CQFA 1EIGA 2OTJA 1PRTF 1S4ZA 3S1NB 3QOJA 1N33L 3M4QA 3C2PA 5E1FA 3ICEA 4MIUA 4GKJL 1FJGQ 2J4XA 2PNRC 5EGTA 1WTWA 1KHIA 1RL2A 3CCJA 2LFNA 4JBWA 1H95A 5HY6A 1EY4A 4DK0A 2K5HA 5C3EB 2DNCA 3UE1A 4GKKL 4DV0Q 2VW9A 2ZJQA 2WKDA 1D8LA 3CCUA 3GTLH 4DV4L 3R3OA 4E6IA 1PVOA 3J7AF 4C3IH 4RHSA 4M1UB 4IPGA 2BH8A 3V2TA 2AWNA 4IOAA 2EY6A 3E0EA 1IL2A 1E7ZA 4EQNA 3E3XA 2K05A 2L4NA 2QDBA 1EWIA 4YCVA 4A3JH 4JC0A 3GV6A 3M4YA 1XTDA 1VQ7A 3I73A 1ENCA 5IE8A 2BE5C 4KHPQ 1O7YA 5IYBH 4DV2L 3URYA 1CZGA 4KI0A 3UE0A 2F0DA 3AFQA 4V0BA 1KC8C 1QJOA 3TP8A 4BXXG 4IUVA 1IBKL 1KIXA 4TVAB 2Q8IB 2WINB 4XDXA 3W3AA 1CM9A 4OXPA 3L3OC 4FF2A 1EU3A 4KY6A 2I07B 1A15A 2NVQB 4H13C 5C5LA 3S1RH 1IKMA 4L5QA 3RMHA 3QIAA 1E0BA 5C5MA 4GZYC 1L0WA 5EKLA 2VNUD 4DPGA 1QVCA 4C56C 1SNCA 2NTTA 2XTIA 2EYLA 5JJLA 1U0LA 1U5KA 5KNDA 3MFGA 4IUUA 1PYWD 1TU2B 2HCIA 4LF6Q 3RLOA 3T56B 3I4MG 1HQMC 4RAUC 4FNFA 1OXXK 3EJIA 2MQHA 1IYVA 4NP5A 1VQ9A 1EY5A 1QNKA 3HFZB 4JW0A 2B2TA 3NEMA 3HOXH 2R3ZA 1O80A 3HKZB 1BBWA 2IPKD 1PTOB 1CT1D 2EYJA 2IX0A 4DR2Q 4OIJA 1HCZA 1EUJA 3QO2A 3CCEA 4A3LG 5BN3A 3HOYB 4ME3A 4LFAQ 4CJ1B 1LTGD 1X6OA 5HGQA 4R4OA 3T13A 1R4PB 4BA1I 1HFNA 1Y1VG 4LFCQ 2NBFA 2QCPX 3K58A 4JI7Q 2N49A 1SBBB 2K1BA 3HOXB 1AEXA 1NJIC 1ESRA 1EWHA 4JPBW 1JR0D 1VQBA 5EKKA 3S1QH 4NDXA 1K83B 4EGVA 1I4QA 4JG2A 4OWTB 5KIXA 3HEJA 5NUCA 3I4MB 1WTVA 3F1ZA 2DNEA 1LACA 1AH9A 1LTSD 3PGZA 2XGTA 1B3AA 3I4NB 5G3LF 2Z6KC 2RF4A 1BF4A 1EEFD 2N3SA 1XXGA 2K5VA 3G6JB 3RLNA 4HJAA 5GAEC 3U58A 3GD7A 4JI2Q 1HA5A 3BS1A 1DJRD 1ENAA 4C3HH 5JJIA 1WCMB 3NQIA 2F0VA 4K14A 3K5NA 2E76C 4J15A 4LJZC 3K7AH 4EQPA 1JB7A 5DM73 2E2IH 2PNHA 5GROA 1I6HH 3PQIA 3NTIA 3MXNB 3S2DH 4A3BB 5M3MH 3FEWX 3AEVA 2ZM6L 3NSWA 2QEJC 1SAPA 3I8ZA 2O2LD 2Z8LA 5JEAG 4AQYQ 4OX9Q 2WAQG 1SSOA 1VQEA 3M3YB 2XIWA 4IURA 1XX8A 5JAVA 4FF4A 2I0QA 1L0XB 1KDCA 4IN3A 1G291 5I4DA 1RDPD 1QCBD 4JI4Q 3IFTA 3RLFA 4R8IA 1E3PA 1O78A 2HDLA 1UE5A 1D6EC 3K59A 3BYTB 5FOBB 1TWCH 3M4PA 5M5YH 2UUCQ 1BR9A 4PMBA 4RG1A 1FNUA 5CGKA 4BBRG 2IL8A 5IP9G 2B2VC 4B3TQ 2K75A 5L37A 2JA7G 2RDFA 2D0PA 4ZLTF 2N55A 4UPAA 4K0KQ 4EQOA 1RCVD 3OWFA 5DEHA 4JI4L 1I4XA 3GTPH 2NZ1D 2ZXRA 4JI6L 2EE1A 3H0GB 3KUPA 3PUYA 4DV0L 1GJXA 4FYDA 5IT9c 2R7DA 1KABA 1L2FA 2KA7A 4ZRZA 2K5WA 4A93G 3TMEA 3BZDB 2MGSA 2L12A 4GLVB 1L1OA 1NSNS 1EWCA 1DGSA 1E2VA 2NN6I 1MHWC 4YWKA 3GTPB 4ILWA 1FGBD 2XSCA 5ELNA 5DLQE 4DR1L 1I4GA 2I5LX 3I91A 3C46A 3OSOA 3EQLC 3ULPA 3E9HA 4WFN3 4KMUC 4RMFA 4KK7A 4YHHL 1GXDC 3CQZH 1Q8IA 3C1FA 3DWQA 2F0JA 1VMPA 1JWMD 5FO8B 2VS1A 3M4OB 2PO4A 1EY0A 4CJ2C 5IYBG 3NBHA 4FXKC 3GTMB 5D14A 2OQKA 2WKCA 4B3ML 1CKNB 1SDFA 1SN8A 2VQEQ 5C4JH 4ZKCB 5FK9C 4DAYB 1C8CA 1ASYA 3M9BA 2B2YA 1JWSD 1PXUA 3G6EA 1KLUD 2CFMA 1Y1WB 1B1ZA 1B8AA 3K5OA 5EJWA 2IW3A 1PFBA 5IGGA 1V1PB 2CW0D 4DK3C 1YJWA 1BKBA 3KF8B 1HNZQ 1SRUA 3MTSA 4MNOA 4A75A 3Q6SA 2GVAA 2B39A 2EY5A 3GTGH 2B3GA 4CDEC 3CCQA 5IODA 1PV4A 2E75C 2EY1A 5LMUL 2RCFA 3H3VH 1H9RA 2RA4A 2GVBA 1DYQA 2E8GA 2Q2UA 3DM3A 1M8AA 2VUMG 2WP8J 5IGBA 2E2DC 3TP5A 3H6MA 1K8AC 2A6EC 3S16B 2R7ZB 1WD1A 1N33Q 3GTOB 4IFDI 3CMEA 3PUZA 4J6HA
chains in the Genus database with same CATH topology
5JEAJ 1EIYB 2RCNA 2NZOA 5IY0A 4B3RL 4JI0Q 4GN3B 4B3TL 2EQSA 3T1YL 2YV5A 1HZCA 1FVIA 3PV0A 1K83H 2BA1A 4IPCA 4A4IA 5BR8Q 1HR0L 5IWAL 4JBMA 1P8LA 1TWFH 1CSPA 2K50A 3BU2A 3TS0A 4R4TA 4LF8Q 5ELOA 4LF9L 3PUWA 1YBYA 4MTNA 4Y7NH 2FXQA 2JJQA 1VQJA 3BJUA 3CC2A 1UE1A 4A3JG 3LGJA 5IYDG 2UUBL 3TRZA 5IP7G 4JI6Q 5C0XI 2PQAB 4P74A 5GADC 3F2CA 1XMOQ 2JA8G 3S16H 2ID0A 2Q2IA 2AHOB 2YYZA 3ERSX 3KF6B 4LF4L 2UXCL 4LUVA 4APVA 4O0AA 3H0GH 4A3DH 4IPDA 3W5OA 1PH6A 3D31A 3HOVG 1N32Q 2V1CC 4YHHQ 1SROA 2IHFA 4MZ9A 4HIOA 2UU9Q 1YHQA 4A3MG 4X6AH 4DV3Q 2JA6H 4A93H 3K0XA 3I7FA 1VQOA 4GNXA 5GQOA 4A3IH 2IY5B 3S17H 2HT1A 4LW1A 2RHSB 1PH5A 4HJ9A 2ES2A 2UUCL 2KHIA 4AH6A 2MO0A 3CAMA 5EAYA 1I94L 3PIPA 3I55A 3H15A 1HNXQ 1K0RA 4JV5Q 4X65Q 4GNXB 2A8VA 1Q46A 2QGQA 4DV4Q 3STBD 4LF7L 3CCSA 3HOZG 1KAWA 2LXJA 3S1MH 4L5SA 1TWAH 1VQGA 5H1SE 1PFSA 4BBRH 4QGUA 1XMQQ 4LF8L 4LF9Q 2PQAA 4DR6Q 4LFBQ 1X56A 4X62Q 3UDGA 2JA7H 1PYBA 5LMNL 1W3SA 1YHBA 1Q1BA 3HOUH 1BBUA 1HJPA 4A3KG 1SLJA 1D7QA 1E1TA 1E24A 3M4OH 2E5LL 3UDFA 1LUZA 3NENA 1I3QH 4POGA 3GTMH 1HNXL 1EOVA 2GN5A 1J5EL 2YTYA 1YHAA 4L5RC 1G51A 5M5WH 3PCOB 4X62L 4DV3L 4NB3A 1VQLA 1HNWL 4QL5A 1UWVA 2QA4A 1XMQL 3MEFA 4LFBL 1PH3A 2CWAA 5GAGC 1Q86C 3A74A 3PF4A 1Q82C 5C4XG 3K80C 5C0XJ 4P73A 4JI5L 1TXYA 2LSSA 4BBSG 1E22A 1HZAA 3J7ZC 2R7ZH 2DGYA 3S1NH 4A3BH 3S24A 4GOPC 3PSIA 5C44G 4B3SQ 3U4VA 2A19A 4YWLA 4DR5Q 4JI7L 2QEXA 2DUDA 3RN5A 1YVCA 3A5UA 1PH9A 1NMFA 1WCMG 5M3FH 3J80c 2NVQH 1Z9FA 1CSQA 2VL6A 1X55A 1HR0W 1A62A 3WWVA 4PG3A 3I56A 1VQMA 1Z47A 1KRSA 1PYSB 3CC4A 4H02A 3JAMi 2KCTA 4BY1G 4DV6L 1C7YA 1Y1WG 4KLKA 3CCMA 2JA5G 4JI2L 4A3CG 4IJHA 4JV5L 5IYCH 1VQ4A 4DR5L 3A0JA 2CCZA 4LNQA 2OTJA 4GKJQ 1N33L 3M4QA 2B29A 4DUYQ 1VQ6A 1VQIA 1EIFA 3ICEA 4GKJL 1A63A 3HKZE 1TWGH 1FJGQ 3J81j 4HIMA 1KHIA 4POFA 1RL2A 2ZJRA 3CCJA 4JI1L 1S72A 1I5FA 4JBWA 1H95A 5HY6A 4IO9A 1XPRA 5AJ3L 1X3GA 2K5HA 2KENA 2ALYB 3AYHB 4JOIA 3UE1A 1NMGA 4DV0Q 4GKKL 3U4ZA 4X66L 3KJPA 2VW9A 1TWHH 2NN6G 4DR1Q 2ZJQA 4DR4Q 1D8LA 3CCUA 4UP8A 4DUZL 3GTLH 4DV4L 4LF7Q 4QQBX 3PO3G 1VQKA 4PZ8A 4LF4Q 1FJGL 1PVOA 1IBLQ 2BA0A 2UXDL 1VQCA 1EQQA 2AMCB 4C3IH 1NBWA 1WJJA 3ULJA 4HIKA 1GKHA 2Q2TA 1M90C 2YU9H 2NVYH 1HZBA 4IPGA 2I5MX 1XNQQ 2BH8A 2AWNA 1YITA 4IOAA 1KRTA 3E0EA 1IL2A 1E7ZA 4JBJA 3CCVA 1XPUA 5AJ3Q 1QUQA 1UEBA 3GO5A 1W2BA 1EWIA 3RZDH 4YCVA 4A3JH 4AQYL 4JC0A 2JEAI 4BY7G 4IFDG 4DNIA 1XTDA 3L0OA 4AYBG 4DUYL 4B3RQ 4X65L 1VQ7A 2ZTCA 1X54A 2KHJA 1XJVA 1MJEA 3RZOH 4GS3A 5IE8A 1C0AA 3GTQH 2E2JH 1KL9A 1LM0A 4KHPQ 2UUAQ 1X3FA 4GLXA 4A3DG 1JE5A 3T1HQ 5GAHC 2R93G 1GD7A 2K4KA 4P72A 3CW2C 5IYBH 3CXCA 4DV2L 4DV5Q 1CUKA 4A3EH 4LUZA 1KD1C 4O2DA 3VDYA 4KI0A 3UE0A 4X64Q 1VQFA 3I4OA 3AQQA 2JA6G 2R92H 1MJCA 3AFQA 2UXBL 1EYGA 3T1YQ 1KC8C 3CP0A 3FKIH 4UY8C 1IBKL 4BXXG 1V43A 2NVXH 3L7ZC 1KIXA 2R7FA 3F8TA 4TVAB 4IFDJ 5J3BA 3KOJA 2UXDQ 3J7A5 3PF5A 3M7NA 4LF5Q 1NY4A 4TQUS 4A3BG 1WFQA 4OXPA 1YZ6A 4AYBE 1N9WA 1K8GA 1P16A 3GTJH 1VQHA 1PA6A 3KLWA 2EIFA 3PIOA 1GM5A 1N36L 3S1RH 3EN2A 1Q81C 4L5QA 4JI3Q 1Q12A 2VQFL 1UE6A 4B3MQ 5C0XG 4GN4B 1SMXA 4JCVE 4BA2I 4P71A 1L0WA 4A3KH 2VNUD 2ASBA 4DPGA 1Y1WH 5M3MG 1QVCA 3F2DA 2RHQB 2XTIA 1Q7YC 1T9HA 3PUXA 3JC66 1U0LA 4LFCL 3U50C 3J81c 3GDEA 3CMAA 4NXMQ 1U5KA 3CPWA 1R9TH 2WAQE 5FJ8H 4GOPB 3TEHB 4X64L 2IX1A 4X66Q 1JJ2A 4LF6Q 2L15A 2EXDA 1VQ5A 2OWOA 4NXNQ 3FHWA 3RLOA 2WB1G 3HOYH 3I4MG 4XIGS 5IWAQ 1OXXK 3DLLA 2MQHA 1WI5A 2I5HA 3B6YA 4A3FH 1V9PA 2B63H 1VQ9A 5FLMH 3CPFA 1X9NA 3W1GA 3HFZB 5C44H 4YY3Q 3NEMA 4DV7L 3HOXH 4A76A 3CCLA 1YNXA 4QIWE 3RN2A 4PZ6A 3PO2H 1BBWA 1Q1EA 1A8VA 2IX0A 2ZTDA 3CF5A 4DR2Q 3KFUA 1BVSA 1EUJA 4LF6L 3PUVA 4OX9L 2VQEL 3CCEA 4A3LG 4C2MH 5M5XH 4ME3A 2IHEA 3K7UC 4LFAQ 4JBKA 3CD6A 1X6OA 4JYAQ 4OONA 2UXCQ 2E2HH 1HR0Q 5HGQA 5LMUQ 4R4OA 4JI0L 4BA1I 3OYYA 1Y1VG 4LF5L 4LFCQ 4JI7Q 3HOVH 2N49A 2K52A 3NELA 1NJIC 3S1QH 1VQBA 4DV1Q 1XMOL 1XNRQ 4A3MH 4DR4L 3E9IA 4YWMA 2UXBQ 1PH1A 1MKHA 4JG2A 4OWTB 2LXKA 2Z6KA 3KDFB 4DR3L 4JI3L 1QZHA 3F1ZA 1N34Q 2H5XA 4DR7L 2F4VQ 5C3EH 3AFPA 1JT8A 3K8AA 1AH9A 1YEZA 3PGZA 3HOWH 4FDBA 2XGTA 1SR3A 2CQOA 3FKIG 1VQDA 4QY7A 4AIMA 3PO3H 4BXXH 2YTVA 2Z6KC 2RF4A 4EX5A 2N3SA 3NBHB 2K5VA 2OQ0A 3RLNA 4HJAA 2HIVA 4LUOA 3KDFA 5GAEC 3U58A 5LMNQ 3GD7A 4JI2Q 1CKOA 1OXVA 2VQFQ 1AE2A 1YJ9A 4C3HH 5JJIA 3RR5A 1B70B 2HIXA 2F4VL 5JJLA 3ULLA 1A0IA 3HOZH 2PI2A 4YCWA 4NXNL 2MFIA 4J15A 4HJ7A 2JA5H 4BY1H 3K7AH 1JB7A 4BY7H 1PH4A 2ATWA 2E2IH 4B3SL 3OW2A 3I4NH 2PNHA 5GROA 5IP7H 1K73C 1I6HH 1IBLL 3MXNB 3S2DH 2AWOA 5M3MH 3HOUG 2A1AA 3KF6A 3S14H 5JJKA 3GTKH 3AEVA 1G6PA 3FP9A 2ZM6L 3S15H 3BZCA 2UUBQ 1VS0A 4DV6Q 4JYAL 3SGIA 1LYLA 5JEAG 1OXUA 4HIDA 4AQYQ 1HNZL 4A3GH 5LMNW 4ALPA 4OX9Q 1IYJB 2WAQG 1VQEA 1YI2A 1QVFA 2JA9A 4DR6L 4GLAC 4BBSH 3EIVA 1S3OA 3HOYG 1V1QA 1J5EQ 2I0QA 1QVGA 3TS2A 2OCEA 4KHPL 1G291 3M85A 2CWPA 4P75A 1NE3A 2KBNA 1FGUA 4DV1L 4JI4Q 4KHZA 4A3FG 1RIPA 3RLFA 3OTOQ 4JI8Q 2PMZE 4R1JA 1E3PA 1UE5A 1M1KC 2VY3A 1TWCH 2ZTEA 3M4PA 5M5YH 2UUCQ 4R4CA 2PI2E 4RG1A 1N34L 4GOPA 4GKKQ 2HHHQ 1VQAA 2UU9L 1HZ9A 2F52A 4BBRG 4A3CH 1C9OA 1WOCA 5IYCG 5IP9G 1OXTA 1I50H 1QZGA 1N8RC 3T1HL 4UP7A 5M3FG 2K75A 4B3TQ 1JMCA 2JA7G 2JA8H 2D0PA 3STBC 1GO3E 4JI8L 1WYDA 4UPAA 4IPHA 4K0KQ 4GNXC 3UDXA 2VZAA 1SFOH 2JE6I 4NPSA 4JI4L 3GTPH 1LTLA 4JI5Q 4GN5A 3TQYA 4R4IA 4DUZQ 4PZ7A 4JI6L 3H0GG 4EQ5A 3PUYA 4DV0L 5FLXc 3HKZG 2N8NA 5IT9c 2R7DA 2WB1E 2Q2HA 1L2FA 2C35B 1N36Q 1OXSC 4DR2L 4QJFA 1PHJA 2VUMH 4A93G 1GVPA 4Y52H 2Z0SA 4A3IG 1UE7A 3JAMc 5C3EG 2MNAA 1N32L 2JQOA 1CKMA 4GLVB 1L1OA 3IRBA 4UP9A 3HOWG 1SE8A 3G4SA 1DGSA 3GTOH 2NN6I 3J80i 4K0KL 4YWKA 1IXRA 1PH2A 2E5LQ 1NTGA 2Y0SE 4NXML 4OO1G 3ER0A 5ELNA 1S40A 5DLQE 1X65A 4DR1L 1JJCB 2I5LX 1VQ8A 4YCUA 2D0OA 4L5TA 3ULPA 3E9HA 3A5ZB 3H3VI 4XTCS 1HH2P 2R6GA 4JI1Q 4RMFA 4A3LH 4YHHL 5IYDH 3CQZH 3KJOA 4DV2Q 4DV5L 1XNQL 1CKNA 4DV7Q 3F2BA 2ZM6Q 2VS1A 3ZJYC 3I4NG 1L1OB 1EQRA 2K14A 4YY3L 1EFWA 3S2HH 2R93H 5IYBG 1K3RA 4DKAC 2N78A 4IJLA 5FJ8G 1Y14B 1QUQB 4OWWB 2OQKA 3UDIA 3I2ZA 4LFAL 2NVTH 2HHHL 2YTXA 1PH8A 2IT1A 4B3ML 1CKNB 1SN8A 2JEBI 3J81i 2VQEQ 5C4JH 1IBMQ 2OTLA 3I4MH 3M3YH 4OO1I 4A3EG 3Q8DA 4C3JH 4DAYB 1PH7A 4PMWA 1L1OC 4WJ3M 2B63G 1ASYA 3M9BA 4DAMA 3OTOL 5C4XH 2UUAL 2KCMA 3L2PA 5E7NA 3G6EA 2CFMA 1VCIA 2R7ZG 3RNUA 3HOXG 1B8AA 1O7IA 4R4QA 3CCRA 4IOCA 1IZ6A 4HJ8A 1I94Q 4DK3C 2F3IA 1YJWA 5K36G 1AE3A 1YJNA 3BZKA 1BKBA 1WCMH 3KF8B 4OWXB 4DR3Q 1OTCA 1HNZQ 1SRUA 1Q8KA 4MNOA 4DR7Q 4A75A 1X3EA 2BH2A 1HNWQ 1YIJA 1J6QA 5IP9H 2GVAA 1Y1VH 3D0FA 3GTGH 3G48A 2B3GA 2Y0SG 2AKWB 1KXLA 1KQSA 2MO1A 3HKSA 4WJ4A 3CCQA 2D62A 2CKZB 4LWCA 2K5NA 1PV4A 1ASZA 1IBKQ 3CC7A 4HJ5A 3TREA 3K81C 5LMUL 1IBML 4A3GG 2NZHA 3H3VH 1MIUA 3KYHC 1VQPA 2GVBA 2E8GA 3G71A 2Q2UA 5BR8L 3DM3A 1XPOA 3W1BA 1VQNA 1B7YB 3EBEA 2R92G 2VUMG 2WP8J 5FLMG 1K9MC 1FL0A 4JOIC 1XNRL 1E1OA 2WFWA 2ZJPA 1K8AC 4DK6C 2JK8A 1N33Q 3PO2G 4IFDI 3CMEA 3PUZA 2HQLA 1JJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEA J;  1EIY B;  2RCN A;  2NZO A;  5IY0 A;  4B3R L;  4JI0 Q;  4GN3 B;  4B3T L;  2EQS A;  3T1Y L;  2YV5 A;  1HZC A;  1FVI A;  3PV0 A;  1K83 H;  2BA1 A;  4IPC A;  4A4I A;  5BR8 Q;  1HR0 L;  5IWA L;  4JBM A;  1P8L A;  1TWF H;  1CSP A;  2K50 A;  3BU2 A;  3TS0 A;  4R4T A;  4LF8 Q;  5ELO A;  4LF9 L;  3PUW A;  1YBY A;  4MTN A;  4Y7N H;  2FXQ A;  2JJQ A;  1VQJ A;  3BJU A;  3CC2 A;  1UE1 A;  4A3J G;  3LGJ A;  5IYD G;  2UUB L;  3TRZ A;  5IP7 G;  4JI6 Q;  5C0X I;  2PQA B;  4P74 A;  5GAD C;  3F2C A;  1XMO Q;  2JA8 G;  3S16 H;  2ID0 A;  2Q2I A;  2AHO B;  2YYZ A;  3ERS X;  3KF6 B;  4LF4 L;  2UXC L;  4LUV A;  4APV A;  4O0A A;  3H0G H;  4A3D H;  4IPD A;  3W5O A;  1PH6 A;  3D31 A;  3HOV G;  1N32 Q;  2V1C C;  4YHH Q;  1SRO A;  2IHF A;  4MZ9 A;  4HIO A;  2UU9 Q;  1YHQ A;  4A3M G;  4X6A H;  4DV3 Q;  2JA6 H;  4A93 H;  3K0X A;  3I7F A;  1VQO A;  4GNX A;  5GQO A;  4A3I H;  2IY5 B;  3S17 H;  2HT1 A;  4LW1 A;  2RHS B;  1PH5 A;  4HJ9 A;  2ES2 A;  2UUC L;  2KHI A;  4AH6 A;  2MO0 A;  3CAM A;  5EAY A;  1I94 L;  3PIP A;  3I55 A;  3H15 A;  1HNX Q;  1K0R A;  4JV5 Q;  4X65 Q;  4GNX B;  2A8V A;  1Q46 A;  2QGQ A;  4DV4 Q;  3STB D;  4LF7 L;  3CCS A;  3HOZ G;  1KAW A;  2LXJ A;  3S1M H;  4L5S A;  1TWA H;  1VQG A;  5H1S E;  1PFS A;  4BBR H;  4QGU A;  1XMQ Q;  4LF8 L;  4LF9 Q;  2PQA A;  4DR6 Q;  4LFB Q;  1X56 A;  4X62 Q;  3UDG A;  2JA7 H;  1PYB A;  5LMN L;  1W3S A;  1YHB A;  1Q1B A;  3HOU H;  1BBU A;  1HJP A;  4A3K G;  1SLJ A;  1D7Q A;  1E1T A;  1E24 A;  3M4O H;  2E5L L;  3UDF A;  1LUZ A;  3NEN A;  1I3Q H;  4POG A;  3GTM H;  1HNX L;  1EOV A;  2GN5 A;  1J5E L;  2YTY A;  1YHA A;  4L5R C;  1G51 A;  5M5W H;  3PCO B;  4X62 L;  4DV3 L;  4NB3 A;  1VQL A;  1HNW L;  4QL5 A;  1UWV A;  2QA4 A;  1XMQ L;  3MEF A;  4LFB L;  1PH3 A;  2CWA A;  5GAG C;  1Q86 C;  3A74 A;  3PF4 A;  1Q82 C;  5C4X G;  3K80 C;  5C0X J;  4P73 A;  4JI5 L;  1TXY A;  2LSS A;  4BBS G;  1E22 A;  1HZA A;  3J7Z C;  2R7Z H;  2DGY A;  3S1N H;  4A3B H;  3S24 A;  4GOP C;  3PSI A;  5C44 G;  4B3S Q;  3U4V A;  2A19 A;  4YWL A;  4DR5 Q;  4JI7 L;  2QEX A;  2DUD A;  3RN5 A;  1YVC A;  3A5U A;  1PH9 A;  1NMF A;  1WCM G;  5M3F H;  3J80 c;  2NVQ H;  1Z9F A;  1CSQ A;  2VL6 A;  1X55 A;  1HR0 W;  1A62 A;  3WWV A;  4PG3 A;  3I56 A;  1VQM A;  1Z47 A;  1KRS A;  1PYS B;  3CC4 A;  4H02 A;  3JAM i;  2KCT A;  4BY1 G;  4DV6 L;  1C7Y A;  1Y1W G;  4KLK A;  3CCM A;  2JA5 G;  4JI2 L;  4A3C G;  4IJH A;  4JV5 L;  5IYC H;  1VQ4 A;  4DR5 L;  3A0J A;  2CCZ A;  4LNQ A;  2OTJ A;  4GKJ Q;  1N33 L;  3M4Q A;  2B29 A;  4DUY Q;  1VQ6 A;  1VQI A;  1EIF A;  3ICE A;  4GKJ L;  1A63 A;  3HKZ E;  1TWG H;  1FJG Q;  3J81 j;  4HIM A;  1KHI A;  4POF A;  1RL2 A;  2ZJR A;  3CCJ A;  4JI1 L;  1S72 A;  1I5F A;  4JBW A;  1H95 A;  5HY6 A;  4IO9 A;  1XPR A;  5AJ3 L;  1X3G A;  2K5H A;  2KEN A;  2ALY B;  3AYH B;  4JOI A;  3UE1 A;  1NMG A;  4DV0 Q;  4GKK L;  3U4Z A;  4X66 L;  3KJP A;  2VW9 A;  1TWH H;  2NN6 G;  4DR1 Q;  2ZJQ A;  4DR4 Q;  1D8L A;  3CCU A;  4UP8 A;  4DUZ L;  3GTL H;  4DV4 L;  4LF7 Q;  4QQB X;  3PO3 G;  1VQK A;  4PZ8 A;  4LF4 Q;  1FJG L;  1PVO A;  1IBL Q;  2BA0 A;  2UXD L;  1VQC A;  1EQQ A;  2AMC B;  4C3I H;  1NBW A;  1WJJ A;  3ULJ A;  4HIK A;  1GKH A;  2Q2T A;  1M90 C;  2YU9 H;  2NVY H;  1HZB A;  4IPG A;  2I5M X;  1XNQ Q;  2BH8 A;  2AWN A;  1YIT A;  4IOA A;  1KRT A;  3E0E A;  1IL2 A;  1E7Z A;  4JBJ A;  3CCV A;  1XPU A;  5AJ3 Q;  1QUQ A;  1UEB A;  3GO5 A;  1W2B A;  1EWI A;  3RZD H;  4YCV A;  4A3J H;  4AQY L;  4JC0 A;  2JEA I;  4BY7 G;  4IFD G;  4DNI A;  1XTD A;  3L0O A;  4AYB G;  4DUY L;  4B3R Q;  4X65 L;  1VQ7 A;  2ZTC A;  1X54 A;  2KHJ A;  1XJV A;  1MJE A;  3RZO H;  4GS3 A;  5IE8 A;  1C0A A;  3GTQ H;  2E2J H;  1KL9 A;  1LM0 A;  4KHP Q;  2UUA Q;  1X3F A;  4GLX A;  4A3D G;  1JE5 A;  3T1H Q;  5GAH C;  2R93 G;  1GD7 A;  2K4K A;  4P72 A;  3CW2 C;  5IYB H;  3CXC A;  4DV2 L;  4DV5 Q;  1CUK A;  4A3E H;  4LUZ A;  1KD1 C;  4O2D A;  3VDY A;  4KI0 A;  3UE0 A;  4X64 Q;  1VQF A;  3I4O A;  3AQQ A;  2JA6 G;  2R92 H;  1MJC A;  3AFQ A;  2UXB L;  1EYG A;  3T1Y Q;  1KC8 C;  3CP0 A;  3FKI H;  4UY8 C;  1IBK L;  4BXX G;  1V43 A;  2NVX H;  3L7Z C;  1KIX A;  2R7F A;  3F8T A;  4TVA B;  4IFD J;  5J3B A;  3KOJ A;  2UXD Q;  3J7A 5;  3PF5 A;  3M7N A;  4LF5 Q;  1NY4 A;  4TQU S;  4A3B G;  1WFQ A;  4OXP A;  1YZ6 A;  4AYB E;  1N9W A;  1K8G A;  1P16 A;  3GTJ H;  1VQH A;  1PA6 A;  3KLW A;  2EIF A;  3PIO A;  1GM5 A;  1N36 L;  3S1R H;  3EN2 A;  1Q81 C;  4L5Q A;  4JI3 Q;  1Q12 A;  2VQF L;  1UE6 A;  4B3M Q;  5C0X G;  4GN4 B;  1SMX A;  4JCV E;  4BA2 I;  4P71 A;  1L0W A;  4A3K H;  2VNU D;  2ASB A;  4DPG A;  1Y1W H;  5M3M G;  1QVC A;  3F2D A;  2RHQ B;  2XTI A;  1Q7Y C;  1T9H A;  3PUX A;  3JC6 6;  1U0L A;  4LFC L;  3U50 C;  3J81 c;  3GDE A;  3CMA A;  4NXM Q;  1U5K A;  3CPW A;  1R9T H;  2WAQ E;  5FJ8 H;  4GOP B;  3TEH B;  4X64 L;  2IX1 A;  4X66 Q;  1JJ2 A;  4LF6 Q;  2L15 A;  2EXD A;  1VQ5 A;  2OWO A;  4NXN Q;  3FHW A;  3RLO A;  2WB1 G;  3HOY H;  3I4M G;  4XIG S;  5IWA Q;  1OXX K;  3DLL A;  2MQH A;  1WI5 A;  2I5H A;  3B6Y A;  4A3F H;  1V9P A;  2B63 H;  1VQ9 A;  5FLM H;  3CPF A;  1X9N A;  3W1G A;  3HFZ B;  5C44 H;  4YY3 Q;  3NEM A;  4DV7 L;  3HOX H;  4A76 A;  3CCL A;  1YNX A;  4QIW E;  3RN2 A;  4PZ6 A;  3PO2 H;  1BBW A;  1Q1E A;  1A8V A;  2IX0 A;  2ZTD A;  3CF5 A;  4DR2 Q;  3KFU A;  1BVS A;  1EUJ A;  4LF6 L;  3PUV A;  4OX9 L;  2VQE L;  3CCE A;  4A3L G;  4C2M H;  5M5X H;  4ME3 A;  2IHE A;  3K7U C;  4LFA Q;  4JBK A;  3CD6 A;  1X6O A;  4JYA Q;  4OON A;  2UXC Q;  2E2H H;  1HR0 Q;  5HGQ A;  5LMU Q;  4R4O A;  4JI0 L;  4BA1 I;  3OYY A;  1Y1V G;  4LF5 L;  4LFC Q;  4JI7 Q;  3HOV H;  2N49 A;  2K52 A;  3NEL A;  1NJI C;  3S1Q H;  1VQB A;  4DV1 Q;  1XMO L;  1XNR Q;  4A3M H;  4DR4 L;  3E9I A;  4YWM A;  2UXB Q;  1PH1 A;  1MKH A;  4JG2 A;  4OWT B;  2LXK A;  2Z6K A;  3KDF B;  4DR3 L;  4JI3 L;  1QZH A;  3F1Z A;  1N34 Q;  2H5X A;  4DR7 L;  2F4V Q;  5C3E H;  3AFP A;  1JT8 A;  3K8A A;  1AH9 A;  1YEZ A;  3PGZ A;  3HOW H;  4FDB A;  2XGT A;  1SR3 A;  2CQO A;  3FKI G;  1VQD A;  4QY7 A;  4AIM A;  3PO3 H;  4BXX H;  2YTV A;  2Z6K C;  2RF4 A;  4EX5 A;  2N3S A;  3NBH B;  2K5V A;  2OQ0 A;  3RLN A;  4HJA A;  2HIV A;  4LUO A;  3KDF A;  5GAE C;  3U58 A;  5LMN Q;  3GD7 A;  4JI2 Q;  1CKO A;  1OXV A;  2VQF Q;  1AE2 A;  1YJ9 A;  4C3H H;  5JJI A;  3RR5 A;  1B70 B;  2HIX A;  2F4V L;  5JJL A;  3ULL A;  1A0I A;  3HOZ H;  2PI2 A;  4YCW A;  4NXN L;  2MFI A;  4J15 A;  4HJ7 A;  2JA5 H;  4BY1 H;  3K7A H;  1JB7 A;  4BY7 H;  1PH4 A;  2ATW A;  2E2I H;  4B3S L;  3OW2 A;  3I4N H;  2PNH A;  5GRO A;  5IP7 H;  1K73 C;  1I6H H;  1IBL L;  3MXN B;  3S2D H;  2AWO A;  5M3M H;  3HOU G;  2A1A A;  3KF6 A;  3S14 H;  5JJK A;  3GTK H;  3AEV A;  1G6P A;  3FP9 A;  2ZM6 L;  3S15 H;  3BZC A;  2UUB Q;  1VS0 A;  4DV6 Q;  4JYA L;  3SGI A;  1LYL A;  5JEA G;  1OXU A;  4HID A;  4AQY Q;  1HNZ L;  4A3G H;  5LMN W;  4ALP A;  4OX9 Q;  1IYJ B;  2WAQ G;  1VQE A;  1YI2 A;  1QVF A;  2JA9 A;  4DR6 L;  4GLA C;  4BBS H;  3EIV A;  1S3O A;  3HOY G;  1V1Q A;  1J5E Q;  2I0Q A;  1QVG A;  3TS2 A;  2OCE A;  4KHP L;  1G29 1;  3M85 A;  2CWP A;  4P75 A;  1NE3 A;  2KBN A;  1FGU A;  4DV1 L;  4JI4 Q;  4KHZ A;  4A3F G;  1RIP A;  3RLF A;  3OTO Q;  4JI8 Q;  2PMZ E;  4R1J A;  1E3P A;  1UE5 A;  1M1K C;  2VY3 A;  1TWC H;  2ZTE A;  3M4P A;  5M5Y H;  2UUC Q;  4R4C A;  2PI2 E;  4RG1 A;  1N34 L;  4GOP A;  4GKK Q;  2HHH Q;  1VQA A;  2UU9 L;  1HZ9 A;  2F52 A;  4BBR G;  4A3C H;  1C9O A;  1WOC A;  5IYC G;  5IP9 G;  1OXT A;  1I50 H;  1QZG A;  1N8R C;  3T1H L;  4UP7 A;  5M3F G;  2K75 A;  4B3T Q;  1JMC A;  2JA7 G;  2JA8 H;  2D0P A;  3STB C;  1GO3 E;  4JI8 L;  1WYD A;  4UPA A;  4IPH A;  4K0K Q;  4GNX C;  3UDX A;  2VZA A;  1SFO H;  2JE6 I;  4NPS A;  4JI4 L;  3GTP H;  1LTL A;  4JI5 Q;  4GN5 A;  3TQY A;  4R4I A;  4DUZ Q;  4PZ7 A;  4JI6 L;  3H0G G;  4EQ5 A;  3PUY A;  4DV0 L;  5FLX c;  3HKZ G;  2N8N A;  5IT9 c;  2R7D A;  2WB1 E;  2Q2H A;  1L2F A;  2C35 B;  1N36 Q;  1OXS C;  4DR2 L;  4QJF A;  1PHJ A;  2VUM H;  4A93 G;  1GVP A;  4Y52 H;  2Z0S A;  4A3I G;  1UE7 A;  3JAM c;  5C3E G;  2MNA A;  1N32 L;  2JQO A;  1CKM A;  4GLV B;  1L1O A;  3IRB A;  4UP9 A;  3HOW G;  1SE8 A;  3G4S A;  1DGS A;  3GTO H;  2NN6 I;  3J80 i;  4K0K L;  4YWK A;  1IXR A;  1PH2 A;  2E5L Q;  1NTG A;  2Y0S E;  4NXM L;  4OO1 G;  3ER0 A;  5ELN A;  1S40 A;  5DLQ E;  1X65 A;  4DR1 L;  1JJC B;  2I5L X;  1VQ8 A;  4YCU A;  2D0O A;  4L5T A;  3ULP A;  3E9H A;  3A5Z B;  3H3V I;  4XTC S;  1HH2 P;  2R6G A;  4JI1 Q;  4RMF A;  4A3L H;  4YHH L;  5IYD H;  3CQZ H;  3KJO A;  4DV2 Q;  4DV5 L;  1XNQ L;  1CKN A;  4DV7 Q;  3F2B A;  2ZM6 Q;  2VS1 A;  3ZJY C;  3I4N G;  1L1O B;  1EQR A;  2K14 A;  4YY3 L;  1EFW A;  3S2H H;  2R93 H;  5IYB G;  1K3R A;  4DKA C;  2N78 A;  4IJL A;  5FJ8 G;  1Y14 B;  1QUQ B;  4OWW B;  2OQK A;  3UDI A;  3I2Z A;  4LFA L;  2NVT H;  2HHH L;  2YTX A;  1PH8 A;  2IT1 A;  4B3M L;  1CKN B;  1SN8 A;  2JEB I;  3J81 i;  2VQE Q;  5C4J H;  1IBM Q;  2OTL A;  3I4M H;  3M3Y H;  4OO1 I;  4A3E G;  3Q8D A;  4C3J H;  4DAY B;  1PH7 A;  4PMW A;  1L1O C;  4WJ3 M;  2B63 G;  1ASY A;  3M9B A;  4DAM A;  3OTO L;  5C4X H;  2UUA L;  2KCM A;  3L2P A;  5E7N A;  3G6E A;  2CFM A;  1VCI A;  2R7Z G;  3RNU A;  3HOX G;  1B8A A;  1O7I A;  4R4Q A;  3CCR A;  4IOC A;  1IZ6 A;  4HJ8 A;  1I94 Q;  4DK3 C;  2F3I A;  1YJW A;  5K36 G;  1AE3 A;  1YJN A;  3BZK A;  1BKB A;  1WCM H;  3KF8 B;  4OWX B;  4DR3 Q;  1OTC A;  1HNZ Q;  1SRU A;  1Q8K A;  4MNO A;  4DR7 Q;  4A75 A;  1X3E A;  2BH2 A;  1HNW Q;  1YIJ A;  1J6Q A;  5IP9 H;  2GVA A;  1Y1V H;  3D0F A;  3GTG H;  3G48 A;  2B3G A;  2Y0S G;  2AKW B;  1KXL A;  1KQS A;  2MO1 A;  3HKS A;  4WJ4 A;  3CCQ A;  2D62 A;  2CKZ B;  4LWC A;  2K5N A;  1PV4 A;  1ASZ A;  1IBK Q;  3CC7 A;  4HJ5 A;  3TRE A;  3K81 C;  5LMU L;  1IBM L;  4A3G G;  2NZH A;  3H3V H;  1MIU A;  3KYH C;  1VQP A;  2GVB A;  2E8G A;  3G71 A;  2Q2U A;  5BR8 L;  3DM3 A;  1XPO A;  3W1B A;  1VQN A;  1B7Y B;  3EBE A;  2R92 G;  2VUM G;  2WP8 J;  5FLM G;  1K9M C;  1FL0 A;  4JOI C;  1XNR L;  1E1O A;  2WFW A;  2ZJP A;  1K8A C;  4DK6 C;  2JK8 A;  1N33 Q;  3PO2 G;  4IFD I;  3CME A;  3PUZ A;  2HQL A;  1JJG A; 
#chains in the Genus database with same CATH topology
 1EIY B;  1U9R A;  4C3I B;  4GN3 B;  5A2Q L;  4DAV A;  3T1Y L;  2YV5 A;  1HZC A;  4IPC A;  5CV5 A;  1K83 H;  1C4Q A;  2BA1 A;  2ZXO A;  4JBM A;  3HP3 A;  2K50 A;  3BU2 A;  4G7O C;  3P20 A;  3H3V C;  3PUW A;  1YBY A;  2G9H D;  4RCO A;  3BJU A;  3WDN A;  1EY9 A;  2UUB L;  5IP7 G;  5GAD C;  1GUS A;  4K6D A;  2ID0 A;  3J80 L;  2Q2I A;  2YYZ A;  2VB2 X;  3KF6 B;  4LF4 L;  3PO2 B;  3SK8 A;  2DJF C;  1N32 Q;  4MZ9 A;  4A3M G;  4RKB A;  4A93 H;  3I7F A;  2C5C A;  2H1E A;  2KJX A;  5T1I A;  3S17 H;  2ES2 A;  2UUC L;  1L0Y B;  2E2I B;  4AH6 A;  5C4X B;  1MI2 A;  5ELD A;  1ESF A;  4RCN A;  3NK9 A;  1K0R A;  3A7L A;  2QGQ A;  1LV9 A;  1KAW A;  2LXJ A;  2F0K A;  1TY0 A;  5H1S E;  1PFS A;  4LF8 L;  2PQA A;  4LFB Q;  3OMG A;  1X56 A;  4XT3 B;  1U4R A;  3K5M A;  2B2Y C;  1HRJ A;  5LMN L;  3S17 B;  1H9S B;  1YHB A;  4KJN A;  3HOU H;  1BBU A;  4A3K G;  3PMF A;  2R93 B;  1K8O A;  1LUZ A;  3AMU A;  3Q0A A;  4CKC A;  2GN5 A;  5HUR A;  2Q8R E;  2A6H D;  1G51 A;  2B2T C;  1TKW B;  1VQL A;  1XMQ L;  5JJZ A;  2Z1C A;  1D1I A;  1QNU A;  5C0X J;  1TXY A;  3P75 A;  4BBS G;  1E22 A;  2FHT A;  1HZA A;  3A7A B;  1TY2 A;  3ONA B;  4DR5 Q;  4YWL A;  5CYU A;  3J81 E;  3MEH A;  1YVC A;  3A5U A;  1JOQ A;  1NR4 A;  5IGD A;  1VF5 C;  2PQE A;  5F2D A;  2NVQ H;  4C3H G;  2VL6 A;  1CSQ A;  1PZJ D;  2F0W A;  3WWV A;  1HR0 W;  4PG3 A;  5DNF A;  1VQM A;  4KJO A;  2JSO A;  4H02 A;  4WJW A;  3JAM i;  2KCT A;  2JA5 G;  1Y1W G;  2ICE C;  2TMP A;  5IYC H;  1WTR A;  1VQ4 A;  2PW5 A;  2B29 A;  1EIF A;  1CZW A;  1R4Q B;  2OXP A;  2SDF A;  5LHY 1;  3VR6 A;  1S72 A;  5E4X A;  4IO9 A;  1XPR A;  2F0E A;  2K6A A;  5C4Z A;  5AJ3 L;  1ZXT A;  1X3G A;  2EJF C;  1D5M C;  3CQZ B;  1NMG A;  1GUT A;  3KJP A;  1TWH H;  3ND8 A;  4DUZ L;  2M00 A;  4QQB X;  4PZ8 A;  4LF4 Q;  2K33 A;  3VYU A;  2BA0 A;  1VQC A;  2F0U A;  2E2J B;  2AMC B;  1NBW A;  3QJY A;  5K36 H;  1WJJ A;  1H9M A;  1FNV A;  4HIK A;  2YU9 H;  1SNP A;  3NUC A;  3VYS A;  1CQV A;  2KED A;  4DGZ A;  3A54 A;  1KTK A;  3SHL A;  3CCV A;  1XPU A;  5AJ3 Q;  2ENB A;  1UEB A;  3K7A B;  3RZD H;  1TWH B;  4AQY L;  3OWE B;  4IFD G;  3DEP A;  4B9X A;  4B3R Q;  4X65 L;  2KHJ A;  1XJV A;  3QG1 A;  4GS3 A;  3GTQ H;  2E2J H;  2UUA Q;  5C3W A;  3BVG A;  5GAH C;  2R93 G;  4KY7 A;  1GD7 A;  2K4K A;  2IX3 A;  3TBI B;  3IKJ A;  2R92 H;  3K0Y A;  1MJC A;  2OEO A;  4ZK9 B;  3D4W A;  2D9U A;  1GHJ A;  3T1Y Q;  3K5L A;  5J3B A;  3KOJ A;  2UXD Q;  3GTG B;  1KAA A;  3J7A 5;  2RSN A;  2Z9H A;  3M7N A;  3HG9 A;  4TQU S;  4A3B G;  1PFN A;  4AYB E;  4YIJ A;  1TWC B;  2BOS A;  1P16 A;  4KTA A;  3X3M A;  2A73 B;  2LS0 1;  3PIO A;  1N36 L;  4XQJ A;  1Q12 A;  1UE6 A;  3TZU A;  2RQX A;  1SXT A;  4RKL A;  4JCV E;  1IYU A;  4P71 A;  3X3N A;  3OIP A;  3TP6 A;  5M3M G;  1PZK D;  3F2D A;  1LT6 D;  5M3M B;  2RHQ B;  1Q7Y C;  3J81 c;  4LFC L;  3U50 C;  1DOK A;  1TWG B;  3GDE A;  1SND A;  1PRT B;  2WAQ E;  2AQ2 B;  1A6X A;  3TEH B;  4QUC A;  2X6G A;  1PRT D;  2PZW A;  3GV3 A;  2OWO A;  5M5X B;  5DAU A;  2EYM A;  3VYR A;  3DLL A;  3SK4 A;  2NN6 H;  3B6Y A;  2X69 A;  5EPK A;  3CPF A;  1X9N A;  3W1G A;  5C44 H;  3LNN A;  1EQT A;  3KK7 A;  4QIW E;  3PO2 H;  2DJG C;  4KN7 C;  1Q1E A;  4KKU A;  3MZ5 A;  3K6O A;  3MXG A;  3CF5 A;  4OX9 L;  2PZT A;  5M5X H;  1I50 B;  3SDZ A;  2Z4I A;  5FO7 B;  3K7U C;  4RH6 A;  5I6Y A;  1HR0 Q;  1CHP D;  2F0Q A;  3OYY A;  5J22 A;  3HOV H;  2K52 A;  4NMZ A;  4K5W A;  3PIO 3;  1XMO L;  1XNR Q;  4A3M H;  4YWM A;  3T4A C;  1JIC A;  1MKH A;  2WV6 D;  2Z6K A;  1ROD A;  1QZH A;  1N34 Q;  4DR7 L;  3HGB A;  1JT8 A;  3AFP A;  4K6L A;  2NYZ D;  2F1M A;  3MVV A;  3FKI G;  4QY7 A;  1DCZ A;  5JVH 3;  4AIM A;  4EX5 A;  2Z6B A;  2KUM A;  4UDU C;  2HIV A;  5LMN Q;  2B2W C;  3CRL C;  1YJ9 A;  2K03 A;  1BCP F;  3HOZ H;  1A0I A;  1EEI D;  4NXN L;  1NUC A;  3EFX D;  4XQQ A;  1AP0 A;  5ISR A;  1SE4 A;  1PH4 A;  2ATW A;  3I3C A;  5IP7 H;  1K73 C;  2RDG A;  1PRT C;  2A1A A;  3KF6 A;  5JJK A;  4HED A;  2ICI A;  1C48 A;  3VYT A;  3FP9 A;  3BZC A;  4X3T A;  1DZ1 A;  2QW7 A;  4HID A;  1LYL A;  1OXU A;  3BDO A;  1HNZ L;  4HMI A;  4HSV A;  1AW7 A;  1YI2 A;  1QVF A;  1STB A;  4BBS H;  3EIV A;  3VA5 A;  3HOY G;  1V1Q A;  1J5E Q;  1HPC A;  4NW2 A;  1NE3 A;  2K7V A;  1VMC A;  4A3F G;  3N52 A;  4JVZ A;  3OTO Q;  4R1J A;  3SVM A;  4K5X A;  1WVL A;  2VY3 A;  1K8M A;  2PI2 E;  1EYD A;  4DA2 A;  4GKK Q;  2UU9 L;  4R8N A;  1HXY D;  2EPB A;  1OXT A;  3T1H L;  1LTT D;  5C6A A;  4N8X 1;  1KDA A;  2JA8 H;  1H9J A;  4JI8 L;  4GNX C;  3UDX A;  4N9T A;  2JE6 I;  1LTL A;  4GN5 A;  3TQY A;  1MBY A;  4WRD A;  1F9S A;  4IUN A;  2C35 B;  1EZ6 A;  3DHQ A;  1PHJ A;  2VUM H;  1X3P A;  1GVP A;  4Y52 H;  2G9D A;  5J1Z A;  1UE7 A;  3JAM c;  2MNA A;  2JQO A;  2JA8 B;  2QDL A;  1LO5 D;  1HTL D;  2EDG A;  4UP9 A;  1CHQ D;  1A3T A;  4CDC C;  5E4W C;  2K04 A;  3ER0 A;  1S40 A;  3NBI A;  4OIK A;  1X65 A;  1EL0 A;  1JJC B;  4H44 C;  4QB4 A;  4J8Q A;  4L5T A;  4ZUI A;  3H3V I;  4XTC S;  3H09 A;  3E0J A;  1Q3L A;  4JI1 Q;  4C2M B;  1U4P A;  4DV2 Q;  1XNQ L;  1CKN A;  4B08 A;  1HQR D;  1CI3 M;  3S2H H;  3MXP A;  1L1O B;  1EQR A;  1EFW A;  2OF1 A;  2N78 A;  4DU9 A;  1LAB A;  2KVM A;  1YNJ D;  1F9Q A;  4LFA L;  1QE6 A;  5TSS A;  5HGT A;  2YTX A;  3GTJ B;  5KNC A;  4KHV A;  2OTL A;  3I4M H;  4PNY A;  2RDH A;  1NCV A;  3Q8D A;  3CU7 A;  1G8Z D;  4ZAI A;  1PH7 A;  3HOW B;  4WJ3 M;  1AN8 A;  1DM0 B;  5C4X H;  1HA6 A;  1M4V A;  3NPP A;  5E7N A;  5M9O A;  2RKS A;  2R7Z G;  4R4Q A;  4KKT A;  5K36 G;  1YJN A;  2PYK A;  1A2U A;  1WCM H;  4DR7 Q;  5I2Y A;  2BDO A;  1SNQ A;  1HNW Q;  2JXM B;  5IP9 H;  2CW0 C;  1Y1V H;  1J8I A;  3S2D B;  1ONL A;  3R2I A;  5JPM C;  5K5P A;  2KEC A;  2HCC A;  4LWC A;  4OL7 A;  5ELC A;  3A8I E;  1IBK Q;  1SE3 A;  4HJ5 A;  1DXM A;  3K81 C;  4DAP A;  1CFM A;  1IBM L;  1ZYR D;  2NZH A;  1MIU A;  2F0O A;  2NWG A;  5CMD A;  1B7Y B;  4RHR A;  3EBE A;  4CBV A;  5FLM G;  3DM1 A;  5CV8 A;  1XNR L;  5A35 A;  2WFW A;  2ZJP A;  3FPP A;  4DK6 C;  3PO2 G;  2GA4 B;  2HQL A;  4ZCK A;  5JEA J;  4IAL A;  3QB3 A;  2NZO A;  4B3R L;  4JI0 Q;  5M5Y B;  4B3T L;  1B9M A;  1HR0 L;  2JN4 A;  4R9W A;  1P8L A;  5BN5 A;  1K0S A;  3J81 L;  4R4T A;  3D4D A;  3TS0 A;  4LF8 Q;  2FXQ A;  2JJQ A;  1VQJ A;  3BDL A;  4KN4 C;  4A3J G;  2JA8 G;  4CDD C;  2VXW A;  3F2C A;  1EIH A;  1JC7 A;  1HTP A;  5CBE E;  3W5O A;  5I9P A;  2ZT9 C;  3J80 E;  2V1C C;  1SRO A;  3MA2 B;  4HIO A;  1MD2 D;  1GUW A;  1YHQ A;  1IW7 C;  1VQO A;  5GQO A;  5JPN C;  4LW1 A;  2RHS B;  2MO0 A;  1I94 L;  4HCS A;  1HNX Q;  1HFG A;  2F0F A;  2A8V A;  1JB3 A;  4PMC A;  4DV4 Q;  2HDM A;  4XT1 B;  1STN A;  5CC4 A;  1GUO A;  4L5S A;  1E2Z A;  1VQG A;  4BBR H;  4QGU A;  3N6R A;  2SOB A;  2KEE A;  2F0P A;  3D6W A;  2D2C C;  1Q1B A;  3I72 A;  1ICW A;  1HJP A;  1JOK A;  4A3K B;  2E5L L;  3UDF A;  3NHH A;  3GTM H;  1HNX L;  1EOV A;  1A2T A;  1QB5 D;  4L8J A;  4L5R C;  4IUQ A;  5M5W H;  3PCO B;  4BBR B;  4DV3 L;  1HNW L;  1H9K A;  5M3F B;  4QL5 A;  1UWV A;  5G3L D;  2K5Q A;  2V4D A;  5GAG C;  1Q86 C;  3DMU A;  4BY7 B;  2A69 D;  2A6H C;  1D5X C;  3K80 C;  3LWE A;  1S5C D;  2LSS A;  1D1K A;  3J7Z C;  4ZQ3 A;  1FD7 D;  2A19 A;  3U4V A;  4JI7 L;  2QEX A;  3FPU B;  3RN5 A;  1RJT A;  5KNB A;  3TN2 A;  1NMF A;  1WCM G;  5D3I B;  2E74 C;  1Z9F A;  1X55 A;  1A62 A;  1LLR D;  2A6E D;  3OMC A;  1PYS B;  1W6J A;  2XNA C;  4DV6 L;  3CCM A;  4JV5 L;  4IJH A;  5T1G A;  2EXZ A;  3W2D A;  4LNQ A;  5J39 A;  4GKJ Q;  1VQ6 A;  1VQI A;  1V1P A;  1Y8N B;  1A63 A;  2A5H A;  1TWG H;  3J81 j;  1KDB A;  3NTH A;  4HIM A;  2AUK A;  2ZJR A;  1I5F A;  4C1N I;  2JP1 A;  4JOI A;  2ALY B;  3TSS A;  4DR4 Q;  2NN6 G;  1HHV A;  4UP8 A;  4LF7 Q;  1S5F D;  3PO3 G;  4M8A A;  5EQ0 A;  3J7Y W;  1SFO B;  4UHV A;  2UXD L;  4RGO S;  1M90 C;  2NVY H;  1XNQ Q;  2XWB B;  1TT2 A;  1ZEQ X;  1PZI D;  3I4L A;  1TWF B;  1KRT A;  1JE4 A;  1EU4 A;  2MHV A;  4JBJ A;  4ZYS A;  1EYC A;  3GO5 A;  1LT5 D;  1XWE A;  4BY7 G;  2JEA I;  4AYB B;  4DNI A;  2RBM A;  4AYB G;  4CHT B;  4DUY L;  1SMY C;  3D8G A;  1BCP D;  1MJE A;  3KBG A;  1KL9 A;  1LM0 A;  1X3F A;  4GLX A;  1TS3 A;  4P72 A;  2O4X A;  3VR5 A;  3CXC A;  4MN3 A;  4TKO B;  1JWU D;  3CKI B;  4O2D A;  1YNN C;  4X64 Q;  1VQF A;  3AQQ A;  2JA6 G;  1SMY D;  4I7A A;  2EYO A;  3FKI H;  5EPJ A;  4UY8 C;  1V43 A;  2NVX H;  4QIW B;  2R7F A;  4JK1 C;  1NY4 A;  4P2C B;  2N88 A;  1N9W A;  3NE5 B;  2NVT B;  4N8F A;  1VQH A;  3KLW A;  1NAP A;  4I65 A;  3J7A V;  1Q81 C;  3G7L A;  2VQF L;  4JI3 Q;  1BO0 A;  2PCF B;  4GN4 B;  1STG A;  3BVZ A;  1K28 A;  2Z4H A;  2ASB A;  1Y1W H;  2NB0 A;  1EZ8 A;  3SXH A;  5KYL A;  4DFA A;  1DD2 A;  1U4L A;  1T9H A;  4NXM Q;  4Q0F A;  4GOP B;  2IX1 A;  4HAE A;  2TSS A;  1JJ2 A;  2F0I A;  5CR3 A;  4FVM A;  4NXN Q;  3FHW A;  2WB1 G;  3HOY H;  1AZQ A;  2EY2 A;  3Q22 A;  3OOC A;  4G57 A;  2CHB D;  3OPO A;  4A3F H;  2B63 H;  2D5D A;  2O5J C;  1SNO A;  4QF4 A;  4A76 A;  3NP8 A;  3CCL A;  1YNX A;  3V96 A;  3RN2 A;  4HR7 B;  2AUJ D;  1WTH A;  2F0M A;  2HQE A;  4S3S A;  2ZTD A;  4OEM B;  3KFU A;  4LF6 L;  2F03 A;  2VQE L;  4O42 A;  4C2M H;  2JA6 B;  1W6K A;  2XWJ B;  4HTH A;  3CD6 A;  1LT4 D;  4JYA Q;  2E2H H;  5LMU Q;  4JI0 L;  4IFD H;  3R2T A;  3PO3 B;  4LF5 L;  3SE0 A;  4B9W A;  3RZO B;  2K01 A;  3NEL A;  3WOE A;  1ML0 D;  4DV1 Q;  4HN7 A;  2LXK A;  2KOL A;  3ITP A;  5I9O A;  2WB1 B;  1LTB D;  3PIP 3;  2H5X A;  3EA6 A;  4Y7N B;  1G91 A;  3CRK C;  3K8A A;  1YEZ A;  1EFI D;  3HOW H;  1RTO A;  4FDB A;  3A56 A;  1SR3 A;  2CQO A;  1A3U A;  1VQD A;  2VB3 X;  4ODG A;  3PO3 H;  2YTV A;  3RD4 A;  3NBH B;  5E3F A;  4NKL A;  2L9H A;  3KDF A;  1ILQ A;  4LUO A;  4K2L A;  1CKO A;  1OXV A;  2VQF Q;  1AE2 A;  3UI2 A;  5COY A;  3RR5 A;  1RKN A;  2F4V L;  4U67 3;  3ULL A;  1VF7 A;  5JVG 3;  2PI2 A;  3P7J A;  2MFI A;  2JA5 H;  1Z7T A;  3F2U A;  4BY7 H;  4B3S L;  3OW2 A;  3I4N H;  4XYO A;  4OEL B;  2AWO A;  3HOU G;  1OO9 B;  2J0T D;  1MGS A;  2EJM A;  3GTK H;  3S15 H;  2UUB Q;  1VS0 A;  4DV6 Q;  5EBC A;  4JYA L;  3SGI A;  1PMR A;  4A3G H;  5LMN W;  4ALP A;  1IYJ B;  1DOM A;  2LKV A;  4C3J G;  2DY8 A;  2JA9 A;  1UEA B;  4GLA C;  4DR6 L;  2B2U C;  1S3O A;  1LTI D;  1DON A;  4DV1 L;  2KBN A;  3TDQ A;  1FGU A;  1I4P A;  2F0T A;  3AB9 A;  4JI8 Q;  5C44 B;  2PMZ E;  1Y8P B;  3S15 B;  3GP7 A;  1M1K C;  2ZTE A;  3E5S A;  1N34 L;  2HHH Q;  1VQA A;  1F2Z A;  1HZ9 A;  1C9O A;  1WOC A;  1I50 H;  1MSH A;  4UP7 A;  1JMC A;  3STB C;  3WOF A;  3GTL B;  1GO3 E;  4IPH A;  2VZA A;  1SFO H;  4NPS A;  5ELF A;  4JI5 Q;  4DUZ Q;  5IOC A;  1R9T B;  3O13 A;  4A3M B;  5FLX c;  2WAQ B;  4DNR B;  4X3K A;  2BE5 D;  5IIF A;  1EY6 A;  4QJF A;  1KNA A;  1PTO C;  2Z0S A;  1F9R A;  2QF7 A;  5C3E G;  1WTP A;  2FMC A;  3IRB A;  4PV1 C;  1ET6 A;  4CDF C;  2IJ0 A;  4K0K L;  4NXM L;  2Y0S E;  3T53 B;  3OW7 A;  3T51 B;  3MXN A;  4TRD A;  1VQ8 A;  2D0O A;  3QOL A;  3V05 A;  3A5Z B;  4A3L H;  5FO9 B;  2SEB D;  2I46 A;  4BY1 B;  3KJO A;  5DM6 3;  4DV5 L;  2K28 A;  4DV7 Q;  3DUZ A;  2NVX B;  2ZM6 Q;  3ZJY C;  4RFB A;  2CQA A;  4DKA C;  1EOT A;  5FJ8 G;  1Y14 B;  1QUQ B;  4TSS A;  3EVQ A;  1SYG A;  4PQX A;  3I2Z A;  1FNW A;  3ZYY X;  2Q8T A;  1PH8 A;  2NVT H;  2IT1 A;  2SNS A;  2MUY A;  1IBM Q;  5CBA E;  1SJE D;  2XRS D;  3MXU A;  4A3E G;  4OO1 I;  1TS5 A;  1U4M A;  5IGE A;  1L1O C;  3Q23 A;  4DAM A;  2KCM A;  4DN4 M;  1VCI A;  4HSP A;  3RNU A;  1BNZ A;  3E6Z X;  1O7I A;  3CCR A;  4IOC A;  3OHX C;  3FVQ A;  2B2W A;  1G2T A;  2F0L A;  1D2B A;  3H91 A;  1QOH A;  1EYA A;  3D6C A;  2F3I A;  2BDN A;  4CJ0 B;  2L11 A;  3BZK A;  1Q8K A;  2R92 B;  2LMC B;  1X3E A;  2BH2 A;  2JA7 B;  4FF3 A;  1YIJ A;  4DNT B;  4FP5 D;  3TP7 A;  3VR2 A;  2X6L A;  3D0F A;  2B2V A;  3NWS A;  3G48 A;  2PMZ B;  2AKW B;  3KBX A;  4ULL A;  1I3Q B;  2MO1 A;  3SK6 A;  2A68 C;  1ASZ A;  2DN8 A;  1HUN A;  3BYY B;  4KD4 A;  4A3G G;  4C1N K;  2KCC A;  3AU7 A;  1F2Y A;  1SYF A;  1II3 A;  3G71 A;  1AZP A;  2AQ1 B;  4G4K A;  5ELB A;  3W1B A;  1XPO A;  1VQN A;  1FL0 A;  4JOI C;  3CHB D;  2F4I A;  1E1O A;  2JK8 A;  1G2S A;  4ME5 A;  2RCN A;  5IY0 A;  3PV0 A;  1FVI A;  1V1O A;  3LX0 A;  5BR8 Q;  1TWF H;  1ICF B;  1JOR A;  2FIN B;  1CTM A;  4MTN A;  4Y7N H;  3LGJ A;  5IYD G;  1WTQ A;  5C0X I;  4P74 A;  1G6Z A;  4F7X A;  3S16 H;  4OHJ A;  2A68 D;  2KHS A;  2AHO B;  1XTC D;  3ERS X;  1VDZ A;  2UXC L;  2ZXP A;  1SYE A;  4LUV A;  4A3D H;  4DXG A;  1X3Q A;  3DWA A;  2XVS A;  4IPD A;  1PH6 A;  3D31 A;  3HOV G;  4C3H B;  1DOL A;  4YHH Q;  3HZX A;  1JQY D;  1KLG D;  4QCL A;  4X6A H;  2F0S A;  4DV3 Q;  1TII D;  4GNX A;  2FFK B;  2IY5 B;  2HT1 A;  3C1E A;  4L6T B;  1RHP A;  3KLR A;  5EAY A;  1I6H B;  3PIP A;  3I55 A;  4CKB A;  4X65 Q;  4GNX B;  1Q46 A;  2M2L A;  3U9O A;  3NTK A;  3S1M H;  3I70 A;  4F8M A;  1TWA H;  2NTS A;  4LF9 Q;  1XMQ Q;  4A93 B;  3JAM E;  1PYB A;  2EZV A;  1W3S A;  1TS2 A;  1D7Q A;  1SLJ A;  2L55 A;  1E24 A;  5KEE A;  1T5X D;  2WII B;  4POG A;  1J5E L;  1FR3 A;  5KGU A;  3FRP B;  1UUP A;  3NQT A;  4X62 L;  4NB3 A;  3HOZ B;  3KLS A;  2QA4 A;  4LFB L;  3ND9 A;  3U9S A;  2CWA A;  3HOU B;  1SE2 A;  2MPM A;  3PF4 A;  1Q82 C;  4P73 A;  4A3F B;  4OO1 H;  1NR2 A;  2DGY A;  4KD3 A;  4XQN A;  4B3S Q;  1O7L A;  3PSI A;  5C44 G;  2DUD A;  1F9P A;  1PH9 A;  1S5D D;  3J80 c;  5AFW A;  1TS4 A;  5C4H A;  1Z47 A;  2RVL A;  1KRS A;  3CC4 A;  1EY8 A;  1B2T A;  1C7Y A;  4A3C G;  1V8Q A;  3A0J A;  2CCZ A;  1Y8O B;  4QUF A;  4DUY Q;  3D4R A;  1H9S A;  1I4R A;  2B8F A;  3HKZ E;  5CV4 A;  4POF A;  4JI1 L;  1HUM A;  3A8J E;  2KEN A;  3AYH B;  4A3I B;  3U4Z A;  4X66 L;  4DR1 Q;  3RZD B;  1BOS A;  3NWT A;  1VQK A;  1FJG L;  1IBL Q;  4KKS A;  1EQQ A;  3S9W A;  3A55 A;  3R8B A;  3ULJ A;  1GKH A;  2Q2T A;  1BDO A;  1HZB A;  3LWU A;  2I5M X;  1YIT A;  4G7H C;  1QUQ A;  3GQB A;  1W2B A;  3Q24 A;  2F0G A;  1PLF A;  3L0O A;  2ZTC A;  1X54 A;  2H4O A;  5D65 A;  4ZKB B;  3RZO H;  1C0A A;  1QWY A;  3S1Q B;  4MHE A;  4A3D G;  1IHZ A;  1JE5 A;  3T1H Q;  3H94 A;  2YU9 B;  3CW2 C;  2IWH A;  4DV5 Q;  4A3E H;  1CUK A;  2PZU A;  4LUZ A;  1KD1 C;  3VDY A;  3I4O A;  2UXB L;  1EYG A;  1NNX A;  3CP0 A;  4IFD J;  3L7Z C;  3F8T A;  1STY A;  2EYP A;  3PF5 A;  4LF5 Q;  3GTQ B;  2CH4 W;  5IGC A;  1WFQ A;  1YZ6 A;  1RD9 D;  4HMJ A;  2OT2 A;  1K8G A;  4RA8 A;  4A3E B;  3GTJ H;  1IL8 A;  5LL6 X;  1PA6 A;  2EIF A;  4O1N A;  2F0H A;  3K57 A;  1GM5 A;  3EN2 A;  4B3M Q;  1D5Z C;  5C0X G;  1SMX A;  2A69 C;  4BA2 I;  1Q90 A;  1TVX A;  4A3K H;  1AFP A;  1PTO D;  3R93 A;  4J1M A;  3DWP A;  5COR A;  3PUX A;  3JC6 6;  1S5B D;  5I2X A;  3CMA A;  4K8J A;  3CPW A;  1R9T H;  5FJ8 H;  5JEA H;  4XYQ A;  4Z9C B;  4X64 L;  1GOZ A;  1CK1 A;  4X66 Q;  2L15 A;  2EXD A;  1VQ5 A;  3C3L A;  2KQ3 A;  4XIG S;  3MHB A;  5IWA Q;  3VA7 A;  1BQQ T;  1WI5 A;  2I5H A;  3MC0 B;  1V9P A;  5FLM H;  1F77 A;  4YY3 Q;  4DV7 L;  4DAY A;  4DXF A;  1PDQ A;  4PZ6 A;  4C3I G;  1B50 A;  1A8V A;  1QIL A;  4H0L C;  1BVS A;  3BDC A;  4K8I A;  3PUV A;  1O7Z A;  5D3D A;  1ILP A;  2IHE A;  4JBK A;  2O5I C;  4OON A;  2UXC Q;  2EYH A;  4FO2 A;  2R61 A;  3MFY A;  1LTA D;  5IT9 L;  4FXD A;  4FXG C;  4DR4 L;  3E9I A;  1GUN A;  2UXB Q;  1PH1 A;  1TWA B;  3KDF B;  2F3V A;  2XN9 C;  4JI3 L;  4DR3 L;  1UNS A;  4IUP A;  2F4V Q;  5C3E H;  4N9P A;  1BCP B;  4IQZ A;  2EVB A;  4BXX H;  1FYC A;  5FKA C;  2HD3 A;  1EQV A;  1X32 A;  2OQ0 A;  1SNM A;  1B4O A;  2M9V A;  2NVY B;  1B70 B;  2HIX A;  5IGF A;  2B8G A;  4YCW A;  4I7Z C;  2K5D A;  4HJ7 A;  4BY1 H;  1JCK B;  4A3J B;  4BBS B;  2HUG A;  1IBL L;  1STH A;  4X3S A;  1B3Q A;  4X3U A;  3S14 H;  4F88 A;  1G6P A;  5CV6 A;  2CVR A;  4DF7 A;  2PPB C;  1QG7 A;  2L0C A;  5IT9 E;  4CGY B;  3HRZ C;  3FKI B;  1QVG A;  1BBX C;  2OCE A;  3TS2 A;  4KHP L;  3M85 A;  2CH4 A;  2CWP A;  4P75 A;  4KHZ A;  3S14 B;  1RIP A;  4ZUJ A;  4RGM A;  4R4C A;  4DK1 A;  5EPL A;  4GOP A;  4V19 0;  2F52 A;  3S1R B;  4A3C H;  1GHK A;  5IYC G;  1QZG A;  1N8R C;  1TQO A;  2MJ8 A;  2EJG C;  2Y0S B;  5C0X H;  5M3F G;  2E2H B;  4LAA A;  4F87 A;  1WYD A;  4UAI A;  4HCE A;  1YNN D;  3MAQ A;  4R4I A;  1EY7 A;  3I90 A;  4PZ7 A;  2L1B A;  3H0G G;  4EQ5 A;  2QIL A;  5KYI A;  3HKZ G;  2N8N A;  5CV7 A;  2WB1 E;  1IW7 D;  2Q2H A;  1N36 Q;  1JOO A;  1OXS C;  4DR2 L;  1BCP C;  4A3I G;  1BXT A;  1N32 L;  4MTK A;  1CKM A;  1LT3 D;  2L5T A;  3KF8 A;  2B63 B;  4RGT A;  1LTR D;  1SE8 A;  3HOW G;  3L9A X;  3G4S A;  3RUZ A;  3GTO H;  3S2H B;  3J80 i;  1PH2 A;  1IXR A;  2E5L Q;  1NTG A;  4OO1 G;  2G5D A;  2F0N A;  3ERQ A;  4XXE A;  5ELE A;  3S1M B;  1I6V C;  4YCU A;  1WD0 A;  3IFD A;  3OIQ A;  4OGQ C;  1HH2 P;  2R6G A;  4FF1 A;  5IYD H;  2MP1 A;  2P5Z X;  2JA5 B;  4C3J B;  2EYF A;  1PFM A;  3SK5 A;  3F2B A;  2C9O A;  3KLS X;  3I4N G;  2K14 A;  4YY3 L;  4KY5 A;  1B53 A;  2R93 H;  1K3R A;  3P1H A;  3QR8 A;  4IJL A;  4RGN A;  4A3D B;  1ENF A;  4OWW B;  5I6W A;  3UDI A;  2HHH L;  3MWY W;  4A3G B;  3J81 i;  2JEB I;  1BUV T;  3IL8 A;  3M3Y H;  4C3J H;  4PMW A;  2B63 G;  1Y69 U;  3OTO L;  3FDT A;  2UUA L;  3L2P A;  1Y1V B;  3SEB A;  2B2U A;  3HOX G;  1SEB D;  1ZKO A;  1IZ6 A;  2FJ2 A;  4HJ8 A;  1I94 Q;  2EOT A;  1AE3 A;  5A2Q E;  3IAY A;  2RSO A;  4OWX B;  5FLX E;  4DR3 Q;  1OTC A;  4G7Z C;  1GUG A;  1J6Q A;  2BCO A;  5BN4 A;  3HS0 C;  2LY7 A;  1K3B C;  2Y0S G;  1KXL A;  4LMQ D;  1TR5 A;  1KQS A;  4WJ4 A;  3HKS A;  3FMC A;  2D62 A;  3D3R A;  2CKZ B;  1CA6 A;  4WOR A;  2K5N A;  3CC7 A;  3TRE A;  1RTN A;  1VQP A;  3KYH C;  5BR8 L;  4IUT A;  5LL6 S;  1XYI A;  2R92 G;  1K9M C;  3JAM L;  1ET9 A;  1YNJ C;  3A8K E;  1JJG A;  3HOV B;  3SR1 A;  3TZD A;  2AQ3 B;  5FLX L;  1CA5 A;  1E2W A;  2EQS A;  4A4I A;  1F2L A;  5IWA L;  1CSP A;  4KV6 A;  4LK1 C;  1PTO F;  4LF9 L;  5ELO A;  1ZYR C;  3CC2 A;  1UE1 A;  3TRZ A;  4U68 A;  1WTO A;  4JI6 Q;  2PQA B;  1XMO Q;  1J9O A;  1B44 D;  4APV A;  4O0A A;  3H0G H;  1IKL A;  3VR4 A;  1PTO H;  2UU9 Q;  2IHF A;  4H7B A;  1Z6H A;  2JA6 H;  2A74 C;  3K0X A;  4A3I H;  2XRQ D;  1PH5 A;  4HJ9 A;  2DY7 A;  2KHI A;  3T16 A;  2NUC A;  3CAM A;  4BWG B;  3H15 A;  5EKI A;  1I4H A;  5JOB A;  4JV5 Q;  5C3X A;  4LF7 L;  3STB D;  3CCS A;  3HOZ G;  3VR3 A;  2QKI C;  5EBD A;  2K32 A;  3NXW A;  5M5W B;  4DR6 Q;  3UDG A;  4ABN A;  4X62 Q;  2JA7 H;  4IZ8 A;  1B9N A;  1S5E D;  1STE A;  4K5V A;  4EVO A;  1KNE A;  3DXJ C;  1E1T A;  3M4O H;  3NEN A;  1I3Q H;  4L63 B;  4CKE A;  2PW7 A;  2YTY A;  2KCN A;  1YHA A;  1WTX A;  1RF2 D;  2FMM A;  5C4J B;  2J7Z A;  1STA A;  5KRU A;  3MEF A;  3BG3 A;  1PH3 A;  5CV9 A;  2WAC A;  4ID6 A;  3A74 A;  1T5E A;  5C4X G;  3QWN A;  4JI5 L;  2R7Z H;  4A3B H;  3S1N H;  1UAP A;  3S24 A;  4GOP C;  3GTK B;  1SJH D;  3DEO A;  3M7G A;  1SYD A;  1MSG A;  4QMG A;  4K2K A;  5M3F H;  4Q5V A;  3I56 A;  1SYC A;  4BS9 A;  1A3V A;  2JYO A;  2VUM B;  2SNM A;  4RWS C;  1SYB A;  2F3W A;  4BY1 G;  1F2M A;  4KLK A;  4JI2 L;  3ERO A;  4DR5 L;  3BVM A;  1CQF A;  1EIG A;  2OTJ A;  1PRT F;  1S4Z A;  3S1N B;  3QOJ A;  1N33 L;  3M4Q A;  3C2P A;  5E1F A;  3ICE A;  4MIU A;  4GKJ L;  1FJG Q;  2J4X A;  2PNR C;  5EGT A;  1WTW A;  1KHI A;  1RL2 A;  3CCJ A;  2LFN A;  4JBW A;  1H95 A;  5HY6 A;  1EY4 A;  4DK0 A;  2K5H A;  5C3E B;  2DNC A;  3UE1 A;  4GKK L;  4DV0 Q;  2VW9 A;  2ZJQ A;  2WKD A;  1D8L A;  3CCU A;  3GTL H;  4DV4 L;  3R3O A;  4E6I A;  1PVO A;  3J7A F;  4C3I H;  4RHS A;  4M1U B;  4IPG A;  2BH8 A;  3V2T A;  2AWN A;  4IOA A;  2EY6 A;  3E0E A;  1IL2 A;  1E7Z A;  4EQN A;  3E3X A;  2K05 A;  2L4N A;  2QDB A;  1EWI A;  4YCV A;  4A3J H;  4JC0 A;  3GV6 A;  3M4Y A;  1XTD A;  1VQ7 A;  3I73 A;  1ENC A;  5IE8 A;  2BE5 C;  4KHP Q;  1O7Y A;  5IYB H;  4DV2 L;  3URY A;  1CZG A;  4KI0 A;  3UE0 A;  2F0D A;  3AFQ A;  4V0B A;  1KC8 C;  1QJO A;  3TP8 A;  4BXX G;  4IUV A;  1IBK L;  1KIX A;  4TVA B;  2Q8I B;  2WIN B;  4XDX A;  3W3A A;  1CM9 A;  4OXP A;  3L3O C;  4FF2 A;  1EU3 A;  4KY6 A;  2I07 B;  1A15 A;  2NVQ B;  4H13 C;  5C5L A;  3S1R H;  1IKM A;  4L5Q A;  3RMH A;  3QIA A;  1E0B A;  5C5M A;  4GZY C;  1L0W A;  5EKL A;  2VNU D;  4DPG A;  1QVC A;  4C56 C;  1SNC A;  2NTT A;  2XTI A;  2EYL A;  5JJL A;  1U0L A;  1U5K A;  5KND A;  3MFG A;  4IUU A;  1PYW D;  1TU2 B;  2HCI A;  4LF6 Q;  3RLO A;  3T56 B;  3I4M G;  1HQM C;  4RAU C;  4FNF A;  1OXX K;  3EJI A;  2MQH A;  1IYV A;  4NP5 A;  1VQ9 A;  1EY5 A;  1QNK A;  3HFZ B;  4JW0 A;  2B2T A;  3NEM A;  3HOX H;  2R3Z A;  1O80 A;  3HKZ B;  1BBW A;  2IPK D;  1PTO B;  1CT1 D;  2EYJ A;  2IX0 A;  4DR2 Q;  4OIJ A;  1HCZ A;  1EUJ A;  3QO2 A;  3CCE A;  4A3L G;  5BN3 A;  3HOY B;  4ME3 A;  4LFA Q;  4CJ1 B;  1LTG D;  1X6O A;  5HGQ A;  4R4O A;  3T13 A;  1R4P B;  4BA1 I;  1HFN A;  1Y1V G;  4LFC Q;  2NBF A;  2QCP X;  3K58 A;  4JI7 Q;  2N49 A;  1SBB B;  2K1B A;  3HOX B;  1AEX A;  1NJI C;  1ESR A;  1EWH A;  4JPB W;  1JR0 D;  1VQB A;  5EKK A;  3S1Q H;  4NDX A;  1K83 B;  4EGV A;  1I4Q A;  4JG2 A;  4OWT B;  5KIX A;  3HEJ A;  5NUC A;  3I4M B;  1WTV A;  3F1Z A;  2DNE A;  1LAC A;  1AH9 A;  1LTS D;  3PGZ A;  2XGT A;  1B3A A;  3I4N B;  5G3L F;  2Z6K C;  2RF4 A;  1BF4 A;  1EEF D;  2N3S A;  1XXG A;  2K5V A;  3G6J B;  3RLN A;  4HJA A;  5GAE C;  3U58 A;  3GD7 A;  4JI2 Q;  1HA5 A;  3BS1 A;  1DJR D;  1ENA A;  4C3H H;  5JJI A;  1WCM B;  3NQI A;  2F0V A;  4K14 A;  3K5N A;  2E76 C;  4J15 A;  4LJZ C;  3K7A H;  4EQP A;  1JB7 A;  5DM7 3;  2E2I H;  2PNH A;  5GRO A;  1I6H H;  3PQI A;  3NTI A;  3MXN B;  3S2D H;  4A3B B;  5M3M H;  3FEW X;  3AEV A;  2ZM6 L;  3NSW A;  2QEJ C;  1SAP A;  3I8Z A;  2O2L D;  2Z8L A;  5JEA G;  4AQY Q;  4OX9 Q;  2WAQ G;  1SSO A;  1VQE A;  3M3Y B;  2XIW A;  4IUR A;  1XX8 A;  5JAV A;  4FF4 A;  2I0Q A;  1L0X B;  1KDC A;  4IN3 A;  1G29 1;  5I4D A;  1RDP D;  1QCB D;  4JI4 Q;  3IFT A;  3RLF A;  4R8I A;  1E3P A;  1O78 A;  2HDL A;  1UE5 A;  1D6E C;  3K59 A;  3BYT B;  5FOB B;  1TWC H;  3M4P A;  5M5Y H;  2UUC Q;  1BR9 A;  4PMB A;  4RG1 A;  1FNU A;  5CGK A;  4BBR G;  2IL8 A;  5IP9 G;  2B2V C;  4B3T Q;  2K75 A;  5L37 A;  2JA7 G;  2RDF A;  2D0P A;  4ZLT F;  2N55 A;  4UPA A;  4K0K Q;  4EQO A;  1RCV D;  3OWF A;  5DEH A;  4JI4 L;  1I4X A;  3GTP H;  2NZ1 D;  2ZXR A;  4JI6 L;  2EE1 A;  3H0G B;  3KUP A;  3PUY A;  4DV0 L;  1GJX A;  4FYD A;  5IT9 c;  2R7D A;  1KAB A;  1L2F A;  2KA7 A;  4ZRZ A;  2K5W A;  4A93 G;  3TME A;  3BZD B;  2MGS A;  2L12 A;  4GLV B;  1L1O A;  1NSN S;  1EWC A;  1DGS A;  1E2V A;  2NN6 I;  1MHW C;  4YWK A;  3GTP B;  4ILW A;  1FGB D;  2XSC A;  5ELN A;  5DLQ E;  4DR1 L;  1I4G A;  2I5L X;  3I91 A;  3C46 A;  3OSO A;  3EQL C;  3ULP A;  3E9H A;  4WFN 3;  4KMU C;  4RMF A;  4KK7 A;  4YHH L;  1GXD C;  3CQZ H;  1Q8I A;  3C1F A;  3DWQ A;  2F0J A;  1VMP A;  1JWM D;  5FO8 B;  2VS1 A;  3M4O B;  2PO4 A;  1EY0 A;  4CJ2 C;  5IYB G;  3NBH A;  4FXK C;  3GTM B;  5D14 A;  2OQK A;  2WKC A;  4B3M L;  1CKN B;  1SDF A;  1SN8 A;  2VQE Q;  5C4J H;  4ZKC B;  5FK9 C;  4DAY B;  1C8C A;  1ASY A;  3M9B A;  2B2Y A;  1JWS D;  1PXU A;  3G6E A;  1KLU D;  2CFM A;  1Y1W B;  1B1Z A;  1B8A A;  3K5O A;  5EJW A;  2IW3 A;  1PFB A;  5IGG A;  1V1P B;  2CW0 D;  4DK3 C;  1YJW A;  1BKB A;  3KF8 B;  1HNZ Q;  1SRU A;  3MTS A;  4MNO A;  4A75 A;  3Q6S A;  2GVA A;  2B39 A;  2EY5 A;  3GTG H;  2B3G A;  4CDE C;  3CCQ A;  5IOD A;  1PV4 A;  2E75 C;  2EY1 A;  5LMU L;  2RCF A;  3H3V H;  1H9R A;  2RA4 A;  2GVB A;  1DYQ A;  2E8G A;  2Q2U A;  3DM3 A;  1M8A A;  2VUM G;  2WP8 J;  5IGB A;  2E2D C;  3TP5 A;  3H6M A;  1K8A C;  2A6E C;  3S16 B;  2R7Z B;  1WD1 A;  1N33 Q;  3GTO B;  4IFD I;  3CME A;  3PUZ A;  4J6H A; 
#chains in the Genus database with same CATH homology
 5JEA J;  1EIY B;  2RCN A;  2NZO A;  5IY0 A;  4B3R L;  4JI0 Q;  4GN3 B;  4B3T L;  2EQS A;  3T1Y L;  2YV5 A;  1HZC A;  1FVI A;  3PV0 A;  1K83 H;  2BA1 A;  4IPC A;  4A4I A;  5BR8 Q;  1HR0 L;  5IWA L;  4JBM A;  1P8L A;  1TWF H;  1CSP A;  2K50 A;  3BU2 A;  3TS0 A;  4R4T A;  4LF8 Q;  5ELO A;  4LF9 L;  3PUW A;  1YBY A;  4MTN A;  4Y7N H;  2FXQ A;  2JJQ A;  1VQJ A;  3BJU A;  3CC2 A;  1UE1 A;  4A3J G;  3LGJ A;  5IYD G;  2UUB L;  3TRZ A;  5IP7 G;  4JI6 Q;  5C0X I;  2PQA B;  4P74 A;  5GAD C;  3F2C A;  1XMO Q;  2JA8 G;  3S16 H;  2ID0 A;  2Q2I A;  2AHO B;  2YYZ A;  3ERS X;  3KF6 B;  4LF4 L;  2UXC L;  4LUV A;  4APV A;  4O0A A;  3H0G H;  4A3D H;  4IPD A;  3W5O A;  1PH6 A;  3D31 A;  3HOV G;  1N32 Q;  2V1C C;  4YHH Q;  1SRO A;  2IHF A;  4MZ9 A;  4HIO A;  2UU9 Q;  1YHQ A;  4A3M G;  4X6A H;  4DV3 Q;  2JA6 H;  4A93 H;  3K0X A;  3I7F A;  1VQO A;  4GNX A;  5GQO A;  4A3I H;  2IY5 B;  3S17 H;  2HT1 A;  4LW1 A;  2RHS B;  1PH5 A;  4HJ9 A;  2ES2 A;  2UUC L;  2KHI A;  4AH6 A;  2MO0 A;  3CAM A;  5EAY A;  1I94 L;  3PIP A;  3I55 A;  3H15 A;  1HNX Q;  1K0R A;  4JV5 Q;  4X65 Q;  4GNX B;  2A8V A;  1Q46 A;  2QGQ A;  4DV4 Q;  3STB D;  4LF7 L;  3CCS A;  3HOZ G;  1KAW A;  2LXJ A;  3S1M H;  4L5S A;  1TWA H;  1VQG A;  5H1S E;  1PFS A;  4BBR H;  4QGU A;  1XMQ Q;  4LF8 L;  4LF9 Q;  2PQA A;  4DR6 Q;  4LFB Q;  1X56 A;  4X62 Q;  3UDG A;  2JA7 H;  1PYB A;  5LMN L;  1W3S A;  1YHB A;  1Q1B A;  3HOU H;  1BBU A;  1HJP A;  4A3K G;  1SLJ A;  1D7Q A;  1E1T A;  1E24 A;  3M4O H;  2E5L L;  3UDF A;  1LUZ A;  3NEN A;  1I3Q H;  4POG A;  3GTM H;  1HNX L;  1EOV A;  2GN5 A;  1J5E L;  2YTY A;  1YHA A;  4L5R C;  1G51 A;  5M5W H;  3PCO B;  4X62 L;  4DV3 L;  4NB3 A;  1VQL A;  1HNW L;  4QL5 A;  1UWV A;  2QA4 A;  1XMQ L;  3MEF A;  4LFB L;  1PH3 A;  2CWA A;  5GAG C;  1Q86 C;  3A74 A;  3PF4 A;  1Q82 C;  5C4X G;  3K80 C;  5C0X J;  4P73 A;  4JI5 L;  1TXY A;  2LSS A;  4BBS G;  1E22 A;  1HZA A;  3J7Z C;  2R7Z H;  2DGY A;  3S1N H;  4A3B H;  3S24 A;  4GOP C;  3PSI A;  5C44 G;  4B3S Q;  3U4V A;  2A19 A;  4YWL A;  4DR5 Q;  4JI7 L;  2QEX A;  2DUD A;  3RN5 A;  1YVC A;  3A5U A;  1PH9 A;  1NMF A;  1WCM G;  5M3F H;  3J80 c;  2NVQ H;  1Z9F A;  1CSQ A;  2VL6 A;  1X55 A;  1HR0 W;  1A62 A;  3WWV A;  4PG3 A;  3I56 A;  1VQM A;  1Z47 A;  1KRS A;  1PYS B;  3CC4 A;  4H02 A;  3JAM i;  2KCT A;  4BY1 G;  4DV6 L;  1C7Y A;  1Y1W G;  4KLK A;  3CCM A;  2JA5 G;  4JI2 L;  4A3C G;  4IJH A;  4JV5 L;  5IYC H;  1VQ4 A;  4DR5 L;  3A0J A;  2CCZ A;  4LNQ A;  2OTJ A;  4GKJ Q;  1N33 L;  3M4Q A;  2B29 A;  4DUY Q;  1VQ6 A;  1VQI A;  1EIF A;  3ICE A;  4GKJ L;  1A63 A;  3HKZ E;  1TWG H;  1FJG Q;  3J81 j;  4HIM A;  1KHI A;  4POF A;  1RL2 A;  2ZJR A;  3CCJ A;  4JI1 L;  1S72 A;  1I5F A;  4JBW A;  1H95 A;  5HY6 A;  4IO9 A;  1XPR A;  5AJ3 L;  1X3G A;  2K5H A;  2KEN A;  2ALY B;  3AYH B;  4JOI A;  3UE1 A;  1NMG A;  4DV0 Q;  4GKK L;  3U4Z A;  4X66 L;  3KJP A;  2VW9 A;  1TWH H;  2NN6 G;  4DR1 Q;  2ZJQ A;  4DR4 Q;  1D8L A;  3CCU A;  4UP8 A;  4DUZ L;  3GTL H;  4DV4 L;  4LF7 Q;  4QQB X;  3PO3 G;  1VQK A;  4PZ8 A;  4LF4 Q;  1FJG L;  1PVO A;  1IBL Q;  2BA0 A;  2UXD L;  1VQC A;  1EQQ A;  2AMC B;  4C3I H;  1NBW A;  1WJJ A;  3ULJ A;  4HIK A;  1GKH A;  2Q2T A;  1M90 C;  2YU9 H;  2NVY H;  1HZB A;  4IPG A;  2I5M X;  1XNQ Q;  2BH8 A;  2AWN A;  1YIT A;  4IOA A;  1KRT A;  3E0E A;  1IL2 A;  1E7Z A;  4JBJ A;  3CCV A;  1XPU A;  5AJ3 Q;  1QUQ A;  1UEB A;  3GO5 A;  1W2B A;  1EWI A;  3RZD H;  4YCV A;  4A3J H;  4AQY L;  4JC0 A;  2JEA I;  4BY7 G;  4IFD G;  4DNI A;  1XTD A;  3L0O A;  4AYB G;  4DUY L;  4B3R Q;  4X65 L;  1VQ7 A;  2ZTC A;  1X54 A;  2KHJ A;  1XJV A;  1MJE A;  3RZO H;  4GS3 A;  5IE8 A;  1C0A A;  3GTQ H;  2E2J H;  1KL9 A;  1LM0 A;  4KHP Q;  2UUA Q;  1X3F A;  4GLX A;  4A3D G;  1JE5 A;  3T1H Q;  5GAH C;  2R93 G;  1GD7 A;  2K4K A;  4P72 A;  3CW2 C;  5IYB H;  3CXC A;  4DV2 L;  4DV5 Q;  1CUK A;  4A3E H;  4LUZ A;  1KD1 C;  4O2D A;  3VDY A;  4KI0 A;  3UE0 A;  4X64 Q;  1VQF A;  3I4O A;  3AQQ A;  2JA6 G;  2R92 H;  1MJC A;  3AFQ A;  2UXB L;  1EYG A;  3T1Y Q;  1KC8 C;  3CP0 A;  3FKI H;  4UY8 C;  1IBK L;  4BXX G;  1V43 A;  2NVX H;  3L7Z C;  1KIX A;  2R7F A;  3F8T A;  4TVA B;  4IFD J;  5J3B A;  3KOJ A;  2UXD Q;  3J7A 5;  3PF5 A;  3M7N A;  4LF5 Q;  1NY4 A;  4TQU S;  4A3B G;  1WFQ A;  4OXP A;  1YZ6 A;  4AYB E;  1N9W A;  1K8G A;  1P16 A;  3GTJ H;  1VQH A;  1PA6 A;  3KLW A;  2EIF A;  3PIO A;  1GM5 A;  1N36 L;  3S1R H;  3EN2 A;  1Q81 C;  4L5Q A;  4JI3 Q;  1Q12 A;  2VQF L;  1UE6 A;  4B3M Q;  5C0X G;  4GN4 B;  1SMX A;  4JCV E;  4BA2 I;  4P71 A;  1L0W A;  4A3K H;  2VNU D;  2ASB A;  4DPG A;  1Y1W H;  5M3M G;  1QVC A;  3F2D A;  2RHQ B;  2XTI A;  1Q7Y C;  1T9H A;  3PUX A;  3JC6 6;  1U0L A;  4LFC L;  3U50 C;  3J81 c;  3GDE A;  3CMA A;  4NXM Q;  1U5K A;  3CPW A;  1R9T H;  2WAQ E;  5FJ8 H;  4GOP B;  3TEH B;  4X64 L;  2IX1 A;  4X66 Q;  1JJ2 A;  4LF6 Q;  2L15 A;  2EXD A;  1VQ5 A;  2OWO A;  4NXN Q;  3FHW A;  3RLO A;  2WB1 G;  3HOY H;  3I4M G;  4XIG S;  5IWA Q;  1OXX K;  3DLL A;  2MQH A;  1WI5 A;  2I5H A;  3B6Y A;  4A3F H;  1V9P A;  2B63 H;  1VQ9 A;  5FLM H;  3CPF A;  1X9N A;  3W1G A;  3HFZ B;  5C44 H;  4YY3 Q;  3NEM A;  4DV7 L;  3HOX H;  4A76 A;  3CCL A;  1YNX A;  4QIW E;  3RN2 A;  4PZ6 A;  3PO2 H;  1BBW A;  1Q1E A;  1A8V A;  2IX0 A;  2ZTD A;  3CF5 A;  4DR2 Q;  3KFU A;  1BVS A;  1EUJ A;  4LF6 L;  3PUV A;  4OX9 L;  2VQE L;  3CCE A;  4A3L G;  4C2M H;  5M5X H;  4ME3 A;  2IHE A;  3K7U C;  4LFA Q;  4JBK A;  3CD6 A;  1X6O A;  4JYA Q;  4OON A;  2UXC Q;  2E2H H;  1HR0 Q;  5HGQ A;  5LMU Q;  4R4O A;  4JI0 L;  4BA1 I;  3OYY A;  1Y1V G;  4LF5 L;  4LFC Q;  4JI7 Q;  3HOV H;  2N49 A;  2K52 A;  3NEL A;  1NJI C;  3S1Q H;  1VQB A;  4DV1 Q;  1XMO L;  1XNR Q;  4A3M H;  4DR4 L;  3E9I A;  4YWM A;  2UXB Q;  1PH1 A;  1MKH A;  4JG2 A;  4OWT B;  2LXK A;  2Z6K A;  3KDF B;  4DR3 L;  4JI3 L;  1QZH A;  3F1Z A;  1N34 Q;  2H5X A;  4DR7 L;  2F4V Q;  5C3E H;  3AFP A;  1JT8 A;  3K8A A;  1AH9 A;  1YEZ A;  3PGZ A;  3HOW H;  4FDB A;  2XGT A;  1SR3 A;  2CQO A;  3FKI G;  1VQD A;  4QY7 A;  4AIM A;  3PO3 H;  4BXX H;  2YTV A;  2Z6K C;  2RF4 A;  4EX5 A;  2N3S A;  3NBH B;  2K5V A;  2OQ0 A;  3RLN A;  4HJA A;  2HIV A;  4LUO A;  3KDF A;  5GAE C;  3U58 A;  5LMN Q;  3GD7 A;  4JI2 Q;  1CKO A;  1OXV A;  2VQF Q;  1AE2 A;  1YJ9 A;  4C3H H;  5JJI A;  3RR5 A;  1B70 B;  2HIX A;  2F4V L;  5JJL A;  3ULL A;  1A0I A;  3HOZ H;  2PI2 A;  4YCW A;  4NXN L;  2MFI A;  4J15 A;  4HJ7 A;  2JA5 H;  4BY1 H;  3K7A H;  1JB7 A;  4BY7 H;  1PH4 A;  2ATW A;  2E2I H;  4B3S L;  3OW2 A;  3I4N H;  2PNH A;  5GRO A;  5IP7 H;  1K73 C;  1I6H H;  1IBL L;  3MXN B;  3S2D H;  2AWO A;  5M3M H;  3HOU G;  2A1A A;  3KF6 A;  3S14 H;  5JJK A;  3GTK H;  3AEV A;  1G6P A;  3FP9 A;  2ZM6 L;  3S15 H;  3BZC A;  2UUB Q;  1VS0 A;  4DV6 Q;  4JYA L;  3SGI A;  1LYL A;  5JEA G;  1OXU A;  4HID A;  4AQY Q;  1HNZ L;  4A3G H;  5LMN W;  4ALP A;  4OX9 Q;  1IYJ B;  2WAQ G;  1VQE A;  1YI2 A;  1QVF A;  2JA9 A;  4DR6 L;  4GLA C;  4BBS H;  3EIV A;  1S3O A;  3HOY G;  1V1Q A;  1J5E Q;  2I0Q A;  1QVG A;  3TS2 A;  2OCE A;  4KHP L;  1G29 1;  3M85 A;  2CWP A;  4P75 A;  1NE3 A;  2KBN A;  1FGU A;  4DV1 L;  4JI4 Q;  4KHZ A;  4A3F G;  1RIP A;  3RLF A;  3OTO Q;  4JI8 Q;  2PMZ E;  4R1J A;  1E3P A;  1UE5 A;  1M1K C;  2VY3 A;  1TWC H;  2ZTE A;  3M4P A;  5M5Y H;  2UUC Q;  4R4C A;  2PI2 E;  4RG1 A;  1N34 L;  4GOP A;  4GKK Q;  2HHH Q;  1VQA A;  2UU9 L;  1HZ9 A;  2F52 A;  4BBR G;  4A3C H;  1C9O A;  1WOC A;  5IYC G;  5IP9 G;  1OXT A;  1I50 H;  1QZG A;  1N8R C;  3T1H L;  4UP7 A;  5M3F G;  2K75 A;  4B3T Q;  1JMC A;  2JA7 G;  2JA8 H;  2D0P A;  3STB C;  1GO3 E;  4JI8 L;  1WYD A;  4UPA A;  4IPH A;  4K0K Q;  4GNX C;  3UDX A;  2VZA A;  1SFO H;  2JE6 I;  4NPS A;  4JI4 L;  3GTP H;  1LTL A;  4JI5 Q;  4GN5 A;  3TQY A;  4R4I A;  4DUZ Q;  4PZ7 A;  4JI6 L;  3H0G G;  4EQ5 A;  3PUY A;  4DV0 L;  5FLX c;  3HKZ G;  2N8N A;  5IT9 c;  2R7D A;  2WB1 E;  2Q2H A;  1L2F A;  2C35 B;  1N36 Q;  1OXS C;  4DR2 L;  4QJF A;  1PHJ A;  2VUM H;  4A93 G;  1GVP A;  4Y52 H;  2Z0S A;  4A3I G;  1UE7 A;  3JAM c;  5C3E G;  2MNA A;  1N32 L;  2JQO A;  1CKM A;  4GLV B;  1L1O A;  3IRB A;  4UP9 A;  3HOW G;  1SE8 A;  3G4S A;  1DGS A;  3GTO H;  2NN6 I;  3J80 i;  4K0K L;  4YWK A;  1IXR A;  1PH2 A;  2E5L Q;  1NTG A;  2Y0S E;  4NXM L;  4OO1 G;  3ER0 A;  5ELN A;  1S40 A;  5DLQ E;  1X65 A;  4DR1 L;  1JJC B;  2I5L X;  1VQ8 A;  4YCU A;  2D0O A;  4L5T A;  3ULP A;  3E9H A;  3A5Z B;  3H3V I;  4XTC S;  1HH2 P;  2R6G A;  4JI1 Q;  4RMF A;  4A3L H;  4YHH L;  5IYD H;  3CQZ H;  3KJO A;  4DV2 Q;  4DV5 L;  1XNQ L;  1CKN A;  4DV7 Q;  3F2B A;  2ZM6 Q;  2VS1 A;  3ZJY C;  3I4N G;  1L1O B;  1EQR A;  2K14 A;  4YY3 L;  1EFW A;  3S2H H;  2R93 H;  5IYB G;  1K3R A;  4DKA C;  2N78 A;  4IJL A;  5FJ8 G;  1Y14 B;  1QUQ B;  4OWW B;  2OQK A;  3UDI A;  3I2Z A;  4LFA L;  2NVT H;  2HHH L;  2YTX A;  1PH8 A;  2IT1 A;  4B3M L;  1CKN B;  1SN8 A;  2JEB I;  3J81 i;  2VQE Q;  5C4J H;  1IBM Q;  2OTL A;  3I4M H;  3M3Y H;  4OO1 I;  4A3E G;  3Q8D A;  4C3J H;  4DAY B;  1PH7 A;  4PMW A;  1L1O C;  4WJ3 M;  2B63 G;  1ASY A;  3M9B A;  4DAM A;  3OTO L;  5C4X H;  2UUA L;  2KCM A;  3L2P A;  5E7N A;  3G6E A;  2CFM A;  1VCI A;  2R7Z G;  3RNU A;  3HOX G;  1B8A A;  1O7I A;  4R4Q A;  3CCR A;  4IOC A;  1IZ6 A;  4HJ8 A;  1I94 Q;  4DK3 C;  2F3I A;  1YJW A;  5K36 G;  1AE3 A;  1YJN A;  3BZK A;  1BKB A;  1WCM H;  3KF8 B;  4OWX B;  4DR3 Q;  1OTC A;  1HNZ Q;  1SRU A;  1Q8K A;  4MNO A;  4DR7 Q;  4A75 A;  1X3E A;  2BH2 A;  1HNW Q;  1YIJ A;  1J6Q A;  5IP9 H;  2GVA A;  1Y1V H;  3D0F A;  3GTG H;  3G48 A;  2B3G A;  2Y0S G;  2AKW B;  1KXL A;  1KQS A;  2MO1 A;  3HKS A;  4WJ4 A;  3CCQ A;  2D62 A;  2CKZ B;  4LWC A;  2K5N A;  1PV4 A;  1ASZ A;  1IBK Q;  3CC7 A;  4HJ5 A;  3TRE A;  3K81 C;  5LMU L;  1IBM L;  4A3G G;  2NZH A;  3H3V H;  1MIU A;  3KYH C;  1VQP A;  2GVB A;  2E8G A;  3G71 A;  2Q2U A;  5BR8 L;  3DM3 A;  1XPO A;  3W1B A;  1VQN A;  1B7Y B;  3EBE A;  2R92 G;  2VUM G;  2WP8 J;  5FLM G;  1K9M C;  1FL0 A;  4JOI C;  1XNR L;  1E1O A;  2WFW A;  2ZJP A;  1K8A C;  4DK6 C;  2JK8 A;  1N33 Q;  3PO2 G;  4IFD I;  3CME A;  3PUZ A;  2HQL A;  1JJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...