4JOIA

Crystal structure of the human telomeric stn1-ten1 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
160
structure length
141
Chain Sequence
LAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKVYDQPFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords CST complex subunit STN1
publication title Structure of the human telomeric stn1-ten1 capping complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 141
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4joiA00
5M5YH 3K80C 4A3LG 2NN6G 4LFAQ 4DR2Q 1NMFA 4NXNL 2NVTH 4HIKA 4L5RC 3J81j 3PUVA 2IT1A 4IO9A 4IPCA 4OWWB 1UE6A 3J80i 5M3MG 2CWPA 2B29A 3HFZB 5BR8Q 1Z9FA 3M4OH 4BXXH 4GOPB 4POGA 1MJEA 1YNXA 4BY1H 1WFQA 4A93H 4YCWA 1B70B 4HIDA 4AQYL 1CSQA 4DR6L 3BZKA 5ELNA 1IYJB 1UEBA 3H0GH 1SFOH 1EIYB 3K7UC 1KIXA 3A5ZB 3PO2H 3T1YQ 4JI6L 3G6EA 3HOZG 1X65A 1YEZA 1X55A 3STBD 2JA8H 4IOAA 3J80c 4YY3Q 4QL5A 4HJ7A 1IBKL 3KFUA 4DV5L 1SN8A 2D0OA 1L1OC 4HJ5A 3I4NH 2MO1A 3CAMA 5IYBG 2JA6G 3UDFA 5IP9H 1RIPA 2MNAA 1W2BA 2EIFA 2E8GA 4YHHL 1VQAA 3AQQA 1XPRA 3TS0A 3NENA 4X64Q 4BBSH 1VQHA 1IBMQ 2LSSA 1PH6A 1VQ4A 4A3BH 4KHPL 3OW2A 1YBYA 4DV3L 3K8AA 3OTOQ 4IOCA 1QVFA 2Z6KC 2VZAA 4JV5Q 3RLFA 1M1KC 2YTYA 4JYAQ 1G291 3J81c 5LMNL 3S15H 4DV4L 1KQSA 1JJ2A 5C0XJ 3PV0A 2R93H 1VQFA 3K81C 4LF7Q 2KHIA 3HOVH 4B3RL 1T9HA 3GTLH 2UUAQ 1KAWA 4LF8L 2DGYA 2WFWA 1NBWA 4DV1L 1PH2A 1JE5A 4A3KG 4A3CH 1YZ6A 1X3GA 3PUXA 2EXDA 5GAHC 3GTOH 5JEAJ 3W1GA 1EQQA 2BA1A 4A76A 1IL2A 3ICEA 1PHJA 4C3JH 4DV2L 4JI7L 2NZOA 3FP9A 2UXBL 1UE5A 3BU2A 4LF4Q 2I5HA 4JI1Q 4PZ7A 3S1QH 2HQLA 3W1BA 1HH2P 1LYLA 4MZ9A 3H0GG 2HHHL 4LF9Q 4LFBQ 4UP8A 1V1QA 3AFPA 3PCOB 1I3QH 2HIXA 3KF6A 5AJ3Q 4JI5Q 3CPWA 4NXML 3PO2G 3U4ZA 4C3IH 2IY5B 4MNOA 4YCUA 1YVCA 2F52A 4JI2L 4YCVA 2JK8A 4A3JH 1V9PA 1Q1EA 3S24A 1X6OA 4AH6A 1CKOA 1IBLQ 4A3LH 2ASBA 3I4NG 2ZM6Q 2JA5G 4GN3B 2N78A 4K0KL 2YYZA 1VQPA 2B63G 3D31A 2K5HA 4GLVB 1N34Q 3CMEA 1TWFH 4ALPA 1GO3E 4DV6Q 4DV7Q 1N36Q 5M3MH 4JBKA 1VQDA 4NB3A 4X65Q 5E7NA 2JE6I 3T1HQ 4BXXG 3NEMA 4L5TA 1TWHH 1SE8A 4R4IA 1N32L 4X6AH 1VQEA 2OCEA 5IYCG 1EQRA 3PUWA 4OXPA 2H5XA 3GDEA 3U58A 1KHIA 2RHQB 3RZDH 4LFCQ 1XMQQ 4B3MQ 1BBWA 3PUYA 2VQFL 1XMOQ 2NVYH 3KYHC 2VUMH 1PYSB 2E2JH 2CKZB 4DKAC 1FL0A 4P73A 4AIMA 2ES2A 2YU9H 3HOZH 4A3CG 3F2DA 2JEAI 4RG1A 1L0WA 1WOCA 2HIVA 1A0IA 4GOPC 1LUZA 2UUCL 3M85A 4NXNQ 3A74A 3S14H 4UP9A 4BY7H 1XJVA 5IYBH 3AEVA 2JA6H 4A3GG 4OO1I 3NELA 2BH8A 4IPGA 4LUZA 3S1MH 1NJIC 1I6HH 4P72A 2N8NA 2QA4A 4WJ3M 3F8TA 3JAMc 1D8LA 1BVSA 4A3JG 1TWGH 1UE7A 4AQYQ 1L2FA 4DR6Q 5C3EH 3L0OA 1DGSA 1EUJA 4UY8C 3U50C 2ZJRA 3CPFA 2FXQA 1Q82C 3CC4A 1Q1BA 4MTNA 1X56A 4R4CA 4JI6Q 5K36G 3RNUA 4P74A 4X66L 1VQGA 2Q2IA 5M3FH 4A3KH 1IBKQ 4DV5Q 1HNZL 1VQ6A 4P71A 4L5QA 4APVA 4A3DH 3HOUG 1HZBA 4DR4L 3B6YA 3GD7A 1IZ6A 4JI0L 4YHHQ 2VNUD 1S72A 2WB1G 3S1NH 4R4OA 1YHBA 4KHPQ 5C0XI 3KLWA 1Y1VG 4EQ5A 4DV3Q 2VQEL 2VUMG 2A19A 2PNHA 2YTVA 1YHQA 4P75A 5LMNQ 4GNXA 3K0XA 5IWAL 2PQAA 4DV4Q 1N9WA 2UXCL 1A8VA 2K50A 3J81i 2Q2TA 4B3RQ 1YHAA 4A3IG 4BY7G 2JA5H 4LF8Q 3H3VH 4DV1Q 1I94L 2B63H 1PV4A 2BA0A 3MEFA 4DNIA 2NVXH 2RF4A 2K52A 3M7NA 1PYBA 4BBRG 2AWOA 2WAQG 1OXSC 3ULJA 4R4TA 2JEBI 1LM0A 1OXXK 1X54A 2K14A 3KF6B 1QUQA 3NBHB 4DV2Q 1EYGA 1X9NA 1HR0L 2AWNA 4JI7Q 2UXBQ 2Y0SE 4YWMA 5FLMG 4LF6L 4R1JA 5M5XH 1HNXL 5IYCH 3I55A 5C3EG 4IFDI 1C0AA 2HHHQ 1E1TA 3CCVA 2UUBL 1JB7A 4DK6C 1AH9A 4NXMQ 2NVQH 2NN6I 4GS3A 4DAYB 1PH9A 3G71A 1OXUA 3KF8B 4O0AA 2AKWB 4JI2Q 1Q8KA 3KJOA 1CKMA 5FLXc 5M3FG 1ASYA 2UU9L 3CC2A 3PGZA 3ULLA 4B3SL 4A3DG 1Q46A 3HOWG 4UPAA 2E2IH 3GO5A 4PZ6A 5IE8A 4LF5L 3IRBA 2MQHA 2ALYB 5ELOA 1D7QA 1C9OA 3CC7A 1GD7A 2PI2A 1VQCA 4A3GH 3G48A 2IHFA 4L5SA 2WB1E 2F4VL 2K75A 2CQOA 4PZ8A 4IFDG 3DM3A 2CFMA 4X62L 4JI4L 1G51A 2VS1A 3TREA 4IFDJ 3VDYA 1N32Q 1LTLA 2RHSB 4JOIA 2LXKA 4LNQA 2ZJPA 4DR7L 1U0LA 4WJ4A 1IXRA 3CW2C 2B3GA 2R7FA 3I4MG 5JJIA 2GVBA 3GTKH 3CXCA 4DUYL 2VQFQ 3BJUA 1PFSA 3S17H 1VS0A 4DR5L 2VL6A 4A3FG 1JJGA 4JBJA 4A3EG 1PA6A 4JG2A 3JC66 1OTCA 1XPOA 5GAGC 4OONA 2I5MX 1FGUA 3SGIA 2WAQE 4Y52H 2KBNA 3KDFA 2UUCQ 3HOUH 2XGTA 1A63A 1KXLA 1SROA 2KCTA 4H02A 1SMXA 3DLLA 5LMUL 2VY3A 1TWAH 5H1SE 1VQNA 2Q2HA 3LGJA 1KRSA 5GADC 1VQIA 4IPDA 2AHOB 3D0FA 3CCSA 2KCMA 2YTXA 2CCZA 2PI2E 1YJNA 1PH3A 1KRTA 1I50H 1RL2A 1Y1VH 4YWKA 3S2DH 2R7ZG 5C44G 4DR3L 3JAMi 1XNRL 2CWAA 4IJHA 3J7A5 4GN4B 3HOXG 5HY6A 1NTGA 3EBEA 4LUVA 2OQKA 3RN2A 2E2HH 2NZHA 3AFQA 4LW1A 2UXDL 1L1OA 1Z47A 3E9IA 2QEXA 4A3IH 1QVGA 1EFWA 1VQOA 3STBC 3PSIA 4C2MH 4X66Q 2L15A 1HNZQ 4XTCS 1WYDA 4K0KQ 3L7ZC 3GTQH 5LMNW 4KLKA 4DR4Q 4JI3L 2OQ0A 1Q81C 1B7YB 1M90C 5J3BA 1N33L 4BBRH 4AYBG 4QQBX 4Y7NH 4JI8L 1K0RA 1VCIA 3OYYA 5C0XG 3W5OA 4JI0Q 2XTIA 2KENA 1SR3A 1UE1A 2Y0SG 2PQAB 3F2CA 4GNXB 2Z6KA 5FLMH 1YITA 1VQ7A 1G6PA 3HKZG 1Y14B 1Q12A 4RMFA 2DUDA 1XTDA 3ER0A 5GAEC 1K8AC 1VQBA 2VQEQ 3M4QA 1PH7A 3CCRA 5M5WH 1FVIA 3Q8DA 5IWAQ 4HJ8A 2UXCQ 5JEAG 3RR5A 1QZGA 5C4JH 3S2HH 3G4SA 3M3YH 3GTMH 1J6QA 1OXTA 3HOYG 3HOWH 4LWCA 4GKJL 3CP0A 3I56A 1QUQB 1MJCA 4LUOA 1I94Q 1V43A 3PIPA 1FJGL 4PG3A 1S40A 1E7ZA 3UDIA 4HIMA 2GVAA 5DLQE 2R7DA 1XNQL 2GN5A 4DV0L 3M4PA 1WI5A 2E5LL 4DUZL 1E1OA 1VQMA 1HR0Q 2QGQA 2AMCB 3KOJA 4UP7A 3L2PA 1Q7YC 1HNXQ 2ZTDA 1E3PA 1OXVA 2OTLA 4LF6Q 1X3EA 4JCVE 1NMGA 4QY7A 2UUBQ 3UDXA 3CCLA 1CUKA 3F2BA 3I4MH 1BKBA 1PH8A 2VW9A 2N3SA 2R6GA 1S3OA 4A3MG 1JT8A 1HZAA 2ZTCA 1AE3A 4A3FH 2UU9Q 2ID0A 4B3SQ 5JJLA 1E24A 4A3EH 4B3TL 3GTPH 4HJAA 3GTJH 1HNWL 4GKKL 2WP8J 1W3SA 3UDGA 4AYBE 1WJJA 3CCMA 1J5EL 4LF5Q 1N8RC 1WCMG 1VQJA 4JBWA 1KL9A 4BA2I 2I0QA 2OWOA 2R92H 2JA7G 5HGQA 4DR2L 2RCNA 1YIJA 4LFAL 2F4VQ 2HT1A 1NY4A 3HKZE 5IYDG 1YJWA 2ZJQA 3H15A 3FKIG 5GROA 3EN2A 4X62Q 2JJQA 1C7YA 3I4OA 4JI4Q 4BA1I 1HZ9A 4DK3C 5BR8L 1R9TH 1PH1A 1VQLA 1CSPA 1K83H 4DAMA 5C44H 1JMCA 1XPUA 2IHEA 1VQ5A 2R7ZH 1PVOA 4PMWA 4DR7Q 5IY0A 4IJLA 3HOXH 2V1CC 1P8LA 2PMZE 4GLAC 4DUYQ 3KDFB 1VQ8A 3PO3G 1H95A 3ZJYC 4DR5Q 4GOPA 3S16H 4TVAB 4QJFA 1E22A 3T1YL 2OTJA 1HZCA 3CCUA 5FJ8G 1CKNB 1HJPA 3U4VA 3CMAA 1GKHA 1VQKA 1ASZA 2MFIA 3J7ZC 4YY3L 1SLJA 5LMUQ 4J15A 1NE3A 4DR1Q 5IP7H 4GN5A 3K7AH 1Y1WH 4QGUA 1K3RA 1O7IA 3ERSX 3KJPA 4X64L 4HJ9A 3UE0A 4OX9Q 4A4IA 4OWTB 1L1OB 4DR3Q 1TWCH 5GQOA 1K8GA 1IBML 1XNRQ 3GTGH 1EIFA 1UWVA 3PF5A 4BY1G 2N49A 3OTOL 3A5UA 4JV5L 4OO1G 4A93G 3BZCA 4JYAL 1YJ9A 3AYHB 4KHZA 2UXDQ 4GLXA 3HOYH 1QZHA 3ULPA 1MKHA 3RLNA 2ATWA 4NPSA 3CCQA 5C4XH 4LF7L 2R92G 4DR1L 3EIVA 4GNXC 2UUAL 3RLOA 1U5KA 3CCJA 1K9MC 5IT9c 1KD1C 4A75A 2JA8G 1A62A 2Z0SA 3I7FA 1CKNA 4JI3Q 1N33Q 4OWXB 2EQSA 4JI8Q 3TS2A 1K73C 3TRZA 2F3IA 3CD6A 3PF4A 1VQ9A 4QIWE 5IP9G 1QVCA 2Q2UA 1EOVA 1YI2A 4FDBA 4KI0A 1SRUA 4YWLA 4LF4L 4BBSG 4JI1L 2I5LX 3M9BA 4LF9L 2IX1A 4A3BG 4LFBL 5JJKA 4XIGS 4JI5L 2A1AA 2LXJA 5AJ3L 3PIOA 4A3MH 4ME3A 1HR0W 4DPGA 3E0EA 1GM5A 3RZOH 1X3FA 4R4QA 2R93G 4GKJQ 2JA9A 3CF5A 2A8VA 3CQZH 3HOVG 2K5NA 4C3HH 1WCMH 5IP7G 3TQYA 1Y1WG 1IBLL 1BBUA 2K4KA 1PH4A 2KHJA 2ZM6L 1FJGQ 3CCEA 5EAYA 3I2ZA 1B8AA 2C35B 1AE2A 4TQUS 2IX0A 1XNQQ 2JA7H 4POFA 4DV0Q 3TEHB 5IYDH 3F1ZA 3WWVA 2E5LQ 3FKIH 4DUZQ 1N34L 2K5VA 3RN5A 1PH5A 2JQOA 3UE1A 4DV7L 4DV6L 1N36L 4JBMA 4OX9L 4O2DA 3H3VI 4X65L 3T1HL 1KC8C 3A0JA 3HKSA 3E9HA 2ZTEA 3FHWA 2BH2A 3S1RH 2D62A 4JC0A 4HIOA 4IPHA 2MO0A 5C4XG 1JJCB 1TXYA 1P16A 1I5FA 3PO3H 1GVPA 1MIUA 3PUZA 4LFCL 1XMQL 4B3ML 4JOIC 2YV5A 1XMOL 1Q86C 2D0PA 4B3TQ 3MXNB 1HNWQ 4GKKQ 4EX5A 5FJ8H 1J5EQ 1EWIA
chains in the Genus database with same CATH superfamily
4CGYB 2EYHA 1HTLD 4DR2Q 4HIKA 3QJYA 1S5FD 4C3HB 4IO9A 1M8AA 2B29A 2HUGA 3HFZB 4ZKBB 4POGA 3CU7A 1MJEA 1YNXA 2H4OA 3DWPA 2DJFC 3X3MA 3AB9A 1PZID 1ICWA 4AQYL 4DR6L 5ELNA 1B50A 4QIWB 1IYJB 3S9WA 3OHXC 3PO2H 3T1YQ 5L37A 1X55A 2JA8H 3QB3A 1CI3M 1B3AA 5FK9C 1EOTA 2MO1A 3CAMA 3DXJC 4L6TB 1HQMC 2E8GA 4WRDA 4UDUC 4PQXA 4TRDA 1VQHA 1IBMQ 4RHSA 2ZXRA 2ZXOA 3M4YA 2MPMA 4JV5Q 1ZXTA 1JJ2A 2FMMA 3PV0A 5LL6X 4WJWA 4CKBA 5ELBA 5IT9L 3A8IE 1B9NA 2DGYA 2TMPA 4DV1L 2D5DA 4O42A 1AZQA 2EXDA 4DXGA 3D4DA 1PTOF 1EQQA 2BA1A 1F2MA 4HCSA 1B2TA 1PHJA 1XTCD 4XT1B 3BU2A 4LF4Q 3S1QH 3I4NB 2PQEA 1BCPF 3H0GG 4LFBQ 4UP8A 1V1QA 3PCOB 5KYLA 3CPWA 3CRKC 4V190 4KN7C 4YCUA 2F52A 2JK8A 5JJZA 1MD2D 4IUPA 4IURA 2N78A 4MHEA 3PMFA 2IWHA 1VQPA 2B63G 3D31A 2NVQB 3CMEA 1TWFH 3OMGA 1GO3E 2L55A 4NB3A 2JE6I 3T1HQ 2G9HD 3NHHA 4R4IA 4OXPA 3Q23A 1NSNS 2H5XA 3TZDA 5IGBA 2F0VA 3MTSA 4C3JB 2FFKB 4B3MQ 4KKUA 4FF4A 3S1MH 2E2JH 4RGNA 4P73A 4AIMA 1HPCA 2YU9H 3SHLA 1M4VA 1Y8PB 3VR6A 1JOKA 2NB0A 1SDFA 1LUZA 2A6ED 3S14H 4K14A 1XJVA 4OO1I 2Z6BA 3W3AA 3GTKB 4LMQD 2N8NA 4XQNA 3JAMc 1D8LA 3D3RA 1VMCA 4OIKA 1B9MA 1DGSA 3BYTB 2FXQA 1Q1BA 1X56A 4HMJA 3FMCA 1G6ZA 5BN4A 3J80L 2MP1A 1PRTB 2Q2IA 1Y1VB 4K0KL 4N9TA 4L5QA 2NVYB 1SNPA 4P71A 4APVA 3HOUG 4DR4L 2VUMB 2N55A 2SOBA 4KV6A 5COYA 2VNUD 3ONAB 2J7ZA 1UUPA 2WB1G 1PRTD 1KNEA 3KLWA 1EFID 2QDBA 5LMNQ 4DV4Q 2M2LA 1A8VA 2DNEA 4Y7NB 2L9HA 1PYWD 4XDXA 1ZEQX 1TWGB 4A3IG 4BY7G 5C3EB 2A6HD 2B63H 5K5PA 2F4IA 2K52A 4K2LA 2AWOA 1OXSC 2K14A 3NBHB 4FXDA 4DV2Q 4JI7Q 3VR5A 3KLSX 2AWNA 2UXBQ 4A3DB 2IJ0A 1TS4A 1EY4A 5CORA 3SK6A 5J39A 4GS3A 3KK7A 1SNOA 2B2WC 4O0AA 2AKWB 4JI2Q 3KJOA 2UU9L 5CR3A 4UPAA 4EQPA 3GO5A 4DAVA 5IE8A 3IRBA 1FGBD 1ESFA 2F0HA 1H9MA 2WB1E 2F4VL 4HN7A 2CQOA 4PZ8A 2CFMA 4JI4L 4A3FB 2NWGA 1G51A 2VS1A 1CTMA 5CBEE 4LK1C 2K32A 1LTLA 2EY1A 1JICA 2F0EA 2QF7A 4LNQA 4DR7L 1SMYC 1H9RA 3VA5A 4ZYSA 3CXCA 2VQFQ 3SK4A 1TS2A 3KF8A 3N52A 2RA4A 4JG2A 2N88A 1OTCA 3K59A 3SGIA 2R7ZB 5C44B 4IUQA 3KDFA 3HOUH 4H02A 3DLLA 2RCFA 3HOXB 1JOOA 2BCOA 1KRSA 2CCZA 1LTRD 2O2LD 2F03A 2YTXA 1PH3A 2V4DA 3D6CA 5G3LF 3OMCA 4YWKA 3URYA 5HY6A 1NTGA 4LUVA 2OQKA 3RN2A 2A73B 1VDZA 3OWEB 2B8GA 2RVLA 2M00A 1STYA 4LW1A 2QEXA 4A3IH 1QVGA 1ILQA 3STBC 3X3NA 4X66Q 1STNA 1WYDA 5JPMC 1EYAA 3ERQA 1RDPD 2B2TC 3OYYA 5C0XG 4OHJA 2XTIA 2Y0SG 5CYUA 4GNXB 4LJZC 1TY2A 4PMBA 1PRTF 1YITA 3HKZG 4FXKC 1TWAB 5GAEC 1K8AC 3A7LA 3M4QA 3MEHA 3CCRA 5M5WH 1FVIA 1HXYD 3DUZA 3M3YH 2OEOA 5E1FA 3TP5A 1I94Q 1PFMA 1FJGL 3T4AC 1E7ZA 5IODA 5CV5A 3M4PA 1CZGA 1WI5A 1SEBD 2E5LL 4UHVA 1VQMA 1EEID 2AMCB 4BA2I 1OXVA 3CQZB 1X3EA 4JCVE 1NMGA 1WCMB 1TKWB 2KEDA 5I4DA 2F0GA 2ZTCA 2KECA 4B3SQ 3GP7A 3GTPH 4HJAA 1TR5A 4GKKL 1HNWL 2CHBD 1PMRA 1VQJA 5C4JB 3S2HB 1O78A 1PXUA 5EPKA 2JA7G 1L0XB 2RCNA 4DR2L 3HKZE 3MXNA 3PO3B 3FKIG 5GROA 3EN2A 3N6RA 2F0PA 1R9TH 1VQLA 2IHEA 1VQ5A 1PVOA 2A68D 1LABA 1O80A 1HRJA 1D6EC 5EKIA 3ZJYC 4UAIA 3T1YL 5C5MA 3CCUA 3CMAA 2GA4B 1CM9A 1VQKA 1SLJA 2JP1A 3HG9A 4DR1Q 2DY8A 5C0XH 1NNXA 3KJPA 2R92B 5C4HA 2B2UA 4HJ9A 1SXTA 1L1OB 1LT5D 1IBML 1UWVA 4BY1G 4JV5L 3H09A 3HS0C 1QZHA 2B2YA 3ULPA 1MSHA 4NPSA 3CCQA 1WTWA 1CFMA 4X3KA 3EIVA 2B2VA 1U5KA 3CCJA 1WTQA 3FPPA 5KRUA 4A75A 1DONA 4OWXB 2KUMA 2E74C 3U9SA 3GV3A 5CC4A 1EOVA 1SRUA 4DXFA 3VYUA 4LF4L 3K7AB 1Y1WB 1K0SA 4DN4M 2IX1A 4LFBL 5JJKA 1HHVA 3MAQA 3QWNA 2A1AA 5JAVA 4ME3A 4DPGA 3E0EA 3CF5A 3RD4A 3HOVG 2K5NA 1BBUA 3S1QB 5EAYA 2C35B 5I2XA 1AE2A 2JA7H 4POFA 4B9WA 2F0TA 3FKIH 2EYMA 2K5VA 1E2WA 3T1HL 3V2TA 1KC8C 3CHBD 3E9HA 2I07B 3HKSA 1UNSA 4JC0A 4HIOA 4IPHA 4L8JA 5C4XG 2F0OA 1KLGD 1P16A 4WFN3 1O7ZA 1GVPA 4B3ML 1TWFB 1A2UA 5ELEA 4B3TQ 2O4XA 1LO5D 2K05A 2EOTA 1J5EQ 5M5YH 4FO2A 3K80C 1CHQD 1LTAD 1SJED 2NN6G 2NVTH 3O13A 3PUVA 4U673 4IALA 5E4WC 4ZAIA 3J80i 3S1MB 5BR8Q 2E2JB 1H9SA 4PV1C 2YU9B 3MFGA 2F0FA 5DM63 4ZUIA 3QOLA 4BY1H 1A6XA 4YCWA 2EE1A 1EYDA 3SXHA 1EY9A 1DZ1A 1UEBA 3I90A 3ND8A 1SFOH 4Q0FA 1BXTA 1KIXA 1JC7A 2XWJB 4TSSA 5FO9B 4KKSA 3HOZG 3G6EA 1X65A 2PYKA 1Q8IA 2Z1CA 4QUCA 3MXPA 1EIGA 1SYEA 3KFUA 4HJ5A 3TBIB 1D2BA 1XPRA 3TS0A 4FF1A 3FPUB 2NYZD 1PTOC 1LACA 3ITPA 3OW2A 1F9QA 4IOCA 2VZAA 3RLFA 1M1KC 2YTYA 5LMNL 3S15H 4DV4L 2Q8TA 4BWGB 4O1NA 1BCPC 1B44D 3HOVH 1T9HA 2ICEC 3DM1A 2KCCA 1BUVT 1U9RA 3H0GB 1W6JA 1FNUA 1PH2A 4A3KG 4A3CH 4KK7A 1X3GA 2EXZA 2OXPA 2F0IA 2A69D 1AN8A 4A76A 3HRZC 3R93A 4DF7A 1STHA 4DV2L 4JI7L 5KEEA 2UXBL 3L9AX 4K5VA 4LF9Q 4DNRB 2B63B 1I3QH 2HIXA 3NBHA 3PO2G 3SK8A 3MWYW 3U4ZA 2Q8IB 1ZYRD 4JI2L 4TKOB 4YCVA 4A3JH 1V9PA 1Q1EA 2F0QA 2K04A 1RTNA 4DK1A 1B53A 1X6OA 2ZM6Q 2JA5G 1KDCA 1PZJD 4GLVB 3FVQA 4DV7Q 1ICFB 1SNDA 4DV6Q 4X65Q 2RSOA 4L5TA 1SE8A 2Q8RE 3GTOB 3KBXA 4K8IA 1RKNA 1KHIA 2RHQB 2WV6D 1SSOA 1TS3A 3PIO3 2VQFL 3KYHC 2ES2A 1FL0A 3NXWA 3HOZH 4C3IB 5EQ0A 1WOCA 2MHVA 1OO9B 1A0IA 5CV6A 4NXNQ 3M85A 3A74A 4UP9A 4H44C 1IKLA 1QNKA 4IPGA 3NSWA 1NJIC 3UI2A 1I6HH 4P72A 1TU2B 1JE4A 1SE4A 5AFWA 1BVSA 3H94A 3MFYA 4FNFA 1UE7A 3HOUB 2B2UC 2LFNA 5A2QE 3CPFA 5ELFA 3CC4A 1PZKD 1SAPA 2WB1B 5CV4A 4KD4A 3RNUA 3GQBA 4X66L 5M3FH 4A3KH 1IBKQ 4DV5Q 1X3QA 2B2YC 2L4NA 4XQJA 3B6YA 2B2VC 1LLRD 4Z9CB 1UEAB 2PZWA 4YHHQ 1S72A 3KLRA 4A3IB 4BY7B 4I7ZC 3EVQA 3S1NH 4KHPQ 2F0JA 1EY7A 2A74C 2A19A 4P75A 4GNXA 4DU9A 2K50A 4H13C 2AUKA 3J81i 3J7YW 4G7ZC 1DYQA 3C1EA 2JA5H 4LF8Q 4JVZA 1U4PA 1I94L 1PV4A 1IHZA 2NVXH 1D1IA 3MA2B 5M5WB 4BBRG 3FEWX 2WAQG 3KF6B 1EYGA 1EQTA 1OXXK 1JJGA 4HMIA 1X9NA 1IW7C 3DHQA 4H7BA 5FLMG 1MI2A 1HA5A 3I55A 3CCVA 2R3ZA 4DK6C 1JCKB 2NN6I 1PH9A 2B2TA 1OXUA 2XRSD 4R8NA 1KABA 1Q8KA 1R4QB 4F7XA 1CKMA 2OF1A 3P20A 1IYUA 1ASYA 4B3SL 3PGZA 1EZ8A 3HOWG 1CA6A 2MQHA 5ELOA 1DXMA 4M1UB 2D9UA 2PI2A 1DJRD 1VQCA 3EQLC 1WVLA 3MXUA 4K8JA 1GOZA 4DFAA 2CQAA 5E3FA 1WTHA 4JOIA 1TY0A 2ZJPA 1U0LA 2HCCA 3NWSA 4ID6A 3I4MG 1ILPA 5JJIA 1LV9A 1BQQT 5M5XB 4DAYA 3BJUA 1S4ZA 3S17H 5J1ZA 3QOJA 4JBJA 4DK0A 4A3EG 2RBMA 3JC66 3T56B 3OIQA 1XPOA 4OONA 1BNZA 2WAQE 4Y52H 4KHVA 1SROA 5H1SE 2KA7A 1SJHD 1VQNA 5D3IB 2WKDA 3LGJA 3CCSA 1QB5D 4IPDA 5KNDA 3D0FA 1ESRA 2AHOB 3K6OA 2J4XA 4HSPA 1YJNA 1KRTA 3JAML 1BO0A 5BN3A 1G91A 3SVMA 4OL7A 2CWAA 4ZCKA 3J7A5 2LMCB 5C3WA 4R8IA 2K5QA 4GN4B 1PRTC 1STAA 3MHBA 4CHTB 1F2YA 2NTSA 5C3XA 2P5ZX 2C9OA 2Y0SB 5E4XA 1NUCA 1L1OA 1STBA 3HKZB 3PSIA 3R8BA 1HNZQ 4XTCS 1IKMA 3DEOA 2QCPX 4KLKA 2OQ0A 2ZT9C 3PQIA 1Q81C 1SE2A 1H9KA 4AYBG 4BBRH 3W5OA 4JI0Q 3F2CA 4HSVA 1UE1A 1LTBD 2PQAB 2XRQD 2SDFA 5FLMH 3J81E 1L0YB 1VQ7A 4GZYC 1G6PA 1Y14B 1Q12A 2AQ2B 4RMFA 2F1MA 3IAYA 5C5LA 1PH7A 3GTLB 2WIIB 1UAPA 5IWAQ 4HJ8A 2UXCQ 1I50B 3RR5A 5JEAG 2EYLA 3GTMH 3S2DB 1S5DD 3GV6A 3HOYG 3QR8A 3HOWH 2BE5C 4LUOA 1B1ZA 2E2HB 4PG3A 1LT6D 5FO8B 2R7DA 1Q90A 2EJMA 4CKEA 5EPJA 4G57A 4C2MB 2QGQA 3GTQB 3L2PA 4UP7A 1Q7YC 2OTLA 3PIP3 1HNXQ 3BDCA 4ZQ3A 4IN3A 3UDXA 3KLSA 3I4MH 5F2DA 1PH8A 2N3SA 2R6GA 1ZKOA 1HZAA 3FKIB 5JJLA 1E24A 4A3EH 4B3TL 3GTJH 5D3DA 3H3VC 1W3SA 2WACA 3UDGA 4AYBE 2EZVA 1J5EL 4LF5Q 4C3HG 1FYCA 5HGQA 2HT1A 5EBDA 1NY4A 1YJWA 5A2QL 4FYDA 1VMPA 4J8QA 1Z7TA 4X62Q 3I4OA 1DCZA 4KN4C 4DK3C 5BR8L 1PH1A 1CSPA 1K83H 4X6AH 3FDTA 5IY0A 3MC0B 1PTOH 1P8LA 2PMZE 4GLAC 1JWMD 1H95A 1G8ZD 3D4RA 2EY2A 4QJFA 2OTJA 1GUGA 1HZCA 3D6WA 5FJ8G 1VF7A 1HJPA 3U4VA 1GUNA 3MXGA 5LMUQ 4M8AA 5IP7H 4GN5A 2F0DA 4QGUA 1JB3A 4QMGA 2F0UA 3IKJA 5I6YA 4BXXG 4A4IA 4OWTB 4DR3Q 4CDCC 1TWCH 5GQOA 1K8GA 1EIFA 2DN8A 2QKIC 1Q3LA 5DEHA 2N49A 5JEAH 3A55A 3A54A 3HOYH 1K3BC 3BVGA 2IW3A 2F0MA 4GNXC 3RLOA 2SEBD 1CKNA 3S16B 2EQSA 2FJ2A 4C56C 2B39A 3CD6A 3KBGA 4QIWE 3WOEA 1QVCA 2Q2UA 4FDBA 3HOVB 3OW7A 4L63B 4BBSG 3BVZA 1G2TA 4Q5VA 2I5LX 4LF9L 4A3BG 3C1FA 3PIOA 5CGKA 1HR0W 2K03A 1S5CD 3RZOH 1X3FA 3GTGB 4R4QA 2R93G 2F3WA 4IQZA 1EQVA 1T5EA 2KVMA 5M9OA 4C3HH 2K28A 3Q22A 3HP3A 4JW0A 2ATWA 1PH4A 2KHJA 2ZM6L 3I2ZA 2IX0A 3MZ5A 4QCLA 4DV0Q 3TEHB 5C4XB 3WWVA 1I3QB 2XWBB 1YNJC 1LT4D 4CJ0B 3T13A 4DUZQ 4I65A 3UE1A 4DV7L 4DV6L 1O7YA 4O2DA 4X65L 4C3JG 5KYIA 2JN4A 3I4LA 2O5JC 5FLXE 1EY0A 4ZUJA 2MO0A 3BYYB 1SMYD 1JJCB 1ENCA 3A56A 4OGQC 4XYOA 5KGUA 2PNRC 3K5NA 4WORA 4JOIC 2YV5A 1Q86C 1QJOA 2D0PA 1C48A 5FJ8H 3L3OC 4IFDG 4A3LG 2CH4A 1F9PA 1NMFA 2JYOA 4NXNL 4ILWA 3TDQA 3VR4A 1WTPA 3NTIA 1E2VA 4OWWB 1UE6A 3IL8A 1A3TA 3HOZB 4BXXH 4GOPB 5EGTA 5CMDA 2EYOA 4K6DA 1WFQA 3OOCA 1STGA 1CSQA 4ZKCB 2XNAC 1LTGD 1EIYB 4XQQA 2HDLA 1GHJA 1LTTD 3K5MA 2ZXPA 1YEZA 1CT1D 4U68A 3STBD 4IOAA 4YY3Q 2KEEA 4HJ7A 1IBKL 4DV5L 4J6HA 1L1OC 1B3QA 3I4NH 5IYBG 3HZXA 2JA6G 4FP5D 2MNAA 1W2BA 2EIFA 4YHHL 3AQQA 1SE3A 3G7LA 4BBSH 1HFGA 1I4XA 5IGEA 1HUMA 5C6AA 4A3BH 4KHPL 1YBYA 2EVBA 2G5DA 3K8AA 3Q6SA 3OTOQ 1GUOA 1G291 3J81c 1KQSA 5C0XJ 4K6LA 2R93H 3K58A 2ICIA 1I4RA 3WOFA 4LF7Q 1MSGA 1KAWA 1D1KA 1DOKA 1FR3A 4LF8L 1KDAA 2CW0C 1EWHA 1NBWA 1YZ6A 3PO2B 2KCNA 1NR2A 3W1GA 3ICEA 2JA8B 4C3JH 3FP9A 1UE5A 1WD0A 2QDLA 4JI1Q 3W1BA 2JA5B 1HH2P 4MZ9A 2BDNA 3AFPA 3KF6A 2RDHA 2NVXB 4MNOA 1YVCA 1STEA 1QG7A 1XWEA 1RD9D 4IFDH 3S24A 2A5HA 2Z4IA 1IBLQ 4A3LH 1O7LA 1CK1A 3ZYYX 2J0TD 2HD3A 5NUCA 1FNVA 1QCBD 2K5HA 1YNNC 3DMUA 3KUPA 2D2CC 1VQDA 5E7NA 2RDFA 4EGVA 4BS9A 1TWHH 2LKVA 1GXDC 1VQEA 5IYCG 4HTHA 1EQRA 3GDEA 3RZDH 1FNWA 3PUYA 4KY7A 2NVYH 2VUMH 1PYSB 2F3VA 2CKZB 4DKAC 3FRPB 4A3CG 5I2YA 3F2DA 2JEAI 5DM73 4RG1A 1L0WA 2HIVA 1JWSD 3P7JA 1U4MA 2EYFA 3AEVA 5IYBH 4A3GG 2JA6H 1AP0A 5FOBB 3NELA 1SNQA 1DOMA 1I6VC 1AEXA 2E76C 3S17B 4WJ3M 1EU4A 4J1MA 3C3LA 4RWSC 3WDNA 3F8TA 1J9OA 4RGTA 5D14A 4A3JG 1TWGH 1L2FA 4ZLTF 5C3EH 3SK5A 5CV9A 4NW2A 4UY8C 4NKLA 3U50C 3K0YA 4R4CA 4JI6Q 2MJ8A 3NBIA 2NZ1D 3NQTA 1EIHA 2XSCA 1VQGA 4XXEA 1HNZL 1VQ6A 2VB2X 4A3DH 1KLUD 3GD7A 1AZPA 4JI0L 4EQOA 3S14B 1NR4A 4R4OA 1YHBA 3Q24A 5C0XI 4EQ5A 4DV3Q 4CDDC 3LNNA 2YTVA 1NCVA 2KJXA 5IWAL 2PQAA 3P75A 4BBRB 2UXCL 2WAQB 1XYIA 1XXGA 1KTKA 4EVOA 4B3RQ 1EEFD 1ZYRC 3H3VH 5IOCA 2BA0A 3MEFA 2RF4A 4PNYA 1GJXA 3E5SA 4R4TA 1X54A 3K57A 2PCFB 3HOWB 4IUTA 4R1JA 1HNXL 4IFDI 1CQFA 5IYCH 2HHHQ 4F88A 1WD1A 1AH9A 4NXMQ 3C2PA 2PZUA 1V8QA 2RSNA 3KF8B 3G71A 2JXMB 1BR9A 4X3UA 1DOLA 4NMZA 4N8X1 5FLXc 5M3FG 3ULLA 1Q46A 2E2IH 3BDLA 4JK1C 4PZ6A 4LF5L 4I7AA 2ALYB 3NK9A 3CC7A 3LX0A 1GD7A 4A3GH 3I4MB 1EWCA 1AFPA 3G48A 5CV8A 2K5DA 5HURA 3DM3A 4X62L 1MGSA 2AQ3B 4KTAA 2L5TA 5EJWA 4A3EB 3VDYA 1N32Q 2X69A 2AQ1B 3GTJB 4ODGA 2RHSB 2K6AA 1IYVA 4WJ4A 2R7FA 3TSSA 2GVBA 4RKLA 3R2TA 2VL6A 3VYTA 3LWUA 4KY6A 1FGUA 4RHRA 1K83B 4YIJA 1X32A 2KBNA 2UUCQ 1A63A 5LMUL 2VY3A 1TWAH 5JOBA 2Q2HA 1VQIA 2LY7A 3E3XA 1C4QA 1CZWA 2PI2E 2F0KA 1ET6A 1RL2A 1I4PA 1W6KA 4DR3L 1Z6HA 4IJHA 1PTOD 1TIID 5C4ZA 3EBEA 3J80E 4XT3B 3A7AB 3AFQA 4RKBA 1BCPD 5ISRA 4CDEC 3L7ZC 1B4OA 3T51B 1B7YB 4ZRZA 1SYDA 5J3BA 2ENBA 4QQBX 1K0RA 1EWIA 1SR3A 2PMZB 4RCOA 3TP6A 2Z6KA 3HOYB 3Q0AA 1D5XC 4ZK9B 1PLFA 2DUDA 1VQBA 2VQEQ 1VF5C 3Q8DA 1S5BD 4KD3A 5D65A 4IZ8A 5I9OA 5C4JH 1QZGA 3G4SA 4JPBW 2X6GA 1BBXC 3S2HH 1J6QA 4LAAA 2RDGA 3I56A 1QUQB 1MJCA 4V0BA 1V43A 4DNTB 4FF2A 1JORA 1S40A 3UDIA 4HIMA 2GVAA 1LTID 4DV0L 2EYPA 4DUZL 1E1OA 1HR0Q 3RZOB 4LF6Q 2ZTDA 3E6ZX 2SNSA 5J22A 1SNCA 2UUBQ 4KJNA 1CUKA 3F2BA 1BKBA 2EJGC 4A3MG 1JT8A 4OELB 2E2DC 4OO1H 3CCMA 1N8RC 3M7GA 2F0NA 2I0QA 3J7AF 3M3YB 2XN9C 2R92H 2MGSA 1EY8A 3H15A 4HCEA 4BA1I 1HZ9A 4RFBA 1A3UA 1JMCA 4DAMA 2HCIA 4PMWA 1F2ZA 4IJLA 4G7HC 1V1PB 4DUYQ 1VQ8A 5A35A 4DR5Q 4GOPA 2JSOA 1GKHA 1ASZA 2A6EC 2MFIA 4DAPA 3QIAA 4YY3L 4J15A 3GTPB 3K7AH 1WTVA 1Y1WH 3LWEA 3I72A 5FO7B 4HR7B 3VR2A 5CBAE 1ENAA 4OIJA 1NAPA 3UE0A 2F0LA 3DEPA 4N8FA 1XNRQ 4DGZA 3A5UA 3OTOL 3TN2A 4A93G 3NE5B 3BS1A 1R9TB 1D5ZC 2UXDQ 4LF7L 3A8JE 4DR1L 3D8GA 1K9MC 4BBSB 5IGCA 5IT9c 1KD1C 2K1BA 1A62A 4JI3Q 3I7FA 4A3BB 1N33Q 2PO4A 4JI8Q 1K73C 3TRZA 2F3IA 2PW5A 4KKTA 1VQ9A 2WKCA 5IP9G 2R93B 1SNMA 3H91A 1RTOA 4E6IA 1YI2A 4KI0A 1IW7D 1CQVA 4YWLA 4ULLA 2L0CA 4JI1L 3M9BA 4XIGS 4A3MH 2LXJA 3SR1A 1MBYA 5DAUA 3TZUA 4GKJQ 2JA9A 1Y8NB 1WTXA 2A6HC 1RODA 5IP7G 1PFNA 3TQYA 1IBLL 1XPUA 1GUWA 4HAEA 1C8CA 2EDGA 3CCEA 1B8AA 1XNQQ 3HGBA 3SE0A 3F1ZA 1BOSA 1CHPD 3RN5A 1PH5A 1H9SB 2JQOA 2K33A 2QILA 3NPPA 3OWFA 5JVG3 3A0JA 2ZTEA 3FHWA 2BH2A 1T5XD 1HA6A 4CBVA 3S1RH 2D62A 5T1GA 4B9XA 5IGFA 1I5FA 1MIUA 4ME5A 4C3IG 5G3LD 1EY5A 5HGTA 2EY5A 1II3A 2DY7A 3AMUA 1TWHB 3EA6A 4B08A 4LFAQ 4L5RC 1JOQA 3J81j 1Y69U 3RZDB 5EKKA 2IT1A 3I91A 5IGGA 4IPCA 5M3MG 2CWPA 2JA7B 1Z9FA 3M4OH 3G6JB 2DJGC 3IFTA 4A93H 1B70B 5DNFA 4HIDA 5JPNC 5LL6S 3BZKA 4XYQA 3H0GH 2JA6B 4EQNA 3K7UC 3A5ZB 1QNUA 4JI6L 5EKLA 3J80c 2PPBC 4QL5A 5KNBA 4QUFA 1SN8A 2D0OA 3RMHA 2BOSA 3UDFA 5M5YB 5IP9H 1RIPA 3VA7A 1VQAA 3NENA 4X64Q 2NVTB 3CKIB 2LSSA 1PH6A 1VQ4A 4DV3L 1QVFA 2Z6KC 3BVMA 4JYAQ 3V05A 1MHWC 2L12A 3HEJA 2AUJD 2Z4HA 1VQFA 3K81C 5T1IA 2KHIA 4K5WA 3VYRA 4BY1B 4B3RL 1F9SA 2UUAQ 2BE5D 2WFWA 3P1HA 1SFOB 1F9RA 1JE5A 5GAHC 3PUXA 1TT2A 5EBCA 3GTOH 5JEAJ 1IL2A 3VR3A 2NZOA 1QWYA 2I5HA 4PZ7A 1EL0A 2HQLA 4KJOA 1LYLA 2HHHL 3VYSA 1R4PB 4JI5Q 2L11A 5AJ3Q 4NXML 4C3IH 2IY5B 3OSOA 1QILA 1A15A 2DNCA 4AH6A 1CKOA 2ASBA 3I4NG 3EFXD 3S15B 4GN3B 2YYZA 1EYCA 1A3VA 5KNCA 1N34Q 4ALPA 1HFNA 4JBKA 4OX9Q 1N36Q 5M3MH 2VB3X 3NEMA 4MIUA 1N32L 2E2IB 2OCEA 3PUWA 3U58A 5I6WA 4A3GB 4LFCQ 1XMQQ 1BBWA 2Z8LA 1XMOQ 3OIPA 5BN5A 2H1EA 4K2KA 3SDZA 2HDMA 3W2DA 4IUNA 4GOPC 4A3JB 2UUCL 4BY7H 4KMUC 2BH8A 4HEDA 4LUZA 2G9DA 1H9JA 1HCZA 4MN3A 1KNAA 2L1BA 2QA4A 2EJFC 3NTHA 2A68C 5LHY1 5IGDA 1LTSD 1ET9A 4AQYQ 1KDBA 4DR6Q 1SYCA 1LT3D 3L0OA 5KIXA 1E2ZA 1EUJA 4CJ2C 3T16A 2ZJRA 1Q82C 4MTNA 5K36G 3NTKA 1SYBA 2CH4W 4CJ1B 1DD2A 2KOLA 4RH6A 3QG1A 2QEJC 4P74A 4K5XA 1X3PA 3A8KE 2EPBA 1HZBA 2O5IC 1IZ6A 1QOHA 2WINB 1K8MA 3T53B 4PMCA 5EPLA 4X3TA 2K7VA 1Y1VG 2VQEL 2VUMG 3J81L 2PNHA 1YHQA 1I6HB 2PZTA 1SBBB 3K0XA 1N9WA 2HQEA 3I70A 2Q2TA 2R61A 1F2LA 1YHAA 3NQIA 2IL8A 3U9OA 3R2IA 4DV1Q 4DNIA 1RJTA 3M7NA 1PYBA 3ULJA 1YNJD 1LM0A 2JEBI 4F8MA 1QUQA 1HR0L 5M3FB 1QE6A 4A3KB 3C46A 2Y0SE 4YWMA 4LF6L 5M5XH 1C0AA 4NDXA 4X3SA 5C3EG 1WTRA 1E1TA 2NUCA 2UUBL 1JB7A 2NVQH 3NUCA 4DAYB 3S1NB 2XIWA 1A2TA 3CC2A 1GUTA 2B8FA 4A3DG 1J8IA 1HQRD 2MUYA 3QO2A 5FKAC 1F77A 1C9OA 1D7QA 2IHFA 4DA2A 4L5SA 2K75A 5TSSA 4ABNA 2EY6A 3TREA 4IFDJ 1TQOA 1SYFA 2Z9HA 2LXKA 1CA5A 1IXRA 3CW2C 2B3GA 1PFBA 3GTKH 4DUYL 2PW7A 1V1OA 3F2UA 1PFSA 3IFDA 1VS0A 4DR5L 5K36H 4A3FG 2TSSA 3NP8A 1PA6A 1K28A 4CKCA 5GAGC 1V1PA 2I5MX 4CDFC 3I8ZA 4FVMA 2XGTA 1SYGA 1KAAA 1SMXA 2KCTA 5GADC 3GTLH 3OPOA 2KCMA 1I50H 1Y1VH 3S2DH 2R7ZG 5C44G 2I46A 3JAMi 1XNRL 1BDOA 2FHTA 2OT2A 4S3SA 3HOXG 3D4WA 2E2HH 1FD7D 2NZHA 3TP7A 2UXDL 3E9IA 1Z47A 2K5WA 2NTTA 2FMCA 1EFWA 5JVH3 1VQOA 4C2MH 2L15A 4K0KQ 3GTQH 1GUSA 2CW0D 5LMNW 4DR4Q 4JI3L 1S5ED 1M90C 1N33L 4Y7NH 4JI8L 1VCIA 3BZDB 2KENA 1BF4A 3NWTA 2BDOA 1XX8A 2IX3A 4MTKA 1XTDA 3EJIA 3ER0A 3H6MA 4QF4A 4R9WA 1TVXA 4RCNA 1K8OA 1IL8A 1OXTA 1TS5A 2VXWA 4LWCA 4GKJL 3CP0A 2RKSA 3DWQA 4RA8A 2QW7A 3PIPA 3K5LA 4G4KA 5DLQE 1XNQL 2GN5A 2A69C 4A3MB 1ML0D 1YNND 2X6LA 4P2CB 3BDOA 1PDQA 3KOJA 1Y8OB 1E3PA 5IT9E 4IUVA 4QY7A 3CCLA 2VW9A 1S3OA 5FLXL 2RQXA 1AE3A 4A3FH 2UU9Q 2ID0A 4RAUC 2WP8J 1WJJA 1WCMG 4JBWA 1KL9A 2OWOA 3GTMB 3S1RB 1YIJA 4LFAL 2F4VQ 2ZJQA 2KQ3A 5IYDG 3R3OA 4JI4Q 2JJQA 1C7YA 1I4HA 4H0LC 2R7ZH 5C44H 4KY5A 4NP5A 4C1NI 4QB4A 4DR7Q 3HOXH 2V1CC 5ELDA 5CV7A 3KDFB 3PO3G 3S16H 4TVAB 1DM0B 1E22A 3K5OA 4OEMB 1CKNB 3M4OB 2FINB 3J7ZC 1NE3A 4A93B 2KHSA 3JAME 4RGOS 2C5CA 2SNMA 4RGMA 1K3RA 3RUZA 1O7IA 2EYJA 3ERSX 2XVSA 4X64L 4FF3A 3GTGH 1I4GA 3PF5A 1I4QA 3SEBA 4OO1G 3BZCA 4JYAL 1RHPA 3E0JA 1YJ9A 3V96A 1JR0D 3AYHB 2E75C 4KHZA 4GLXA 1MKHA 3RLNA 3I3CA 5C4XH 5IIFA 4G7OC 2R92G 1PTOB 1U4LA 1EY6A 2UUAL 2JA8G 1ONLA 3CRLC 2Z0SA 2IPKD 3EROA 1BCPB 3TS2A 3PF4A 1HTPA 4N9PA 3TP8A 4IUUA 2NN6H 3MVVA 1JQYD 4AYBB 3ND9A 4FXGC 3TMEA 1E0BA 4JI5L 5AJ3L 2NBFA 2M9VA 1GM5A 1TWCB 2A8VA 3CQZH 1ENFA 3BG3A 2K01A 1WCMH 1KXLA 3I73A 2F0SA 1Y1WG 2K4KA 1FJGQ 1RF2D 4TQUS 2CVRA 2LS01 5IYDH 1G2SA 3AU7A 2E5LQ 3J7AV 1N34L 4C1NK 3H3VI 4OX9L 3DWAA 1N36L 4JBMA 1EU3A 1EZ6A 1JWUD 2B2WA 1AW7A 1D5MC 1RCVD 5ELCA 5I9PA 1TXYA 3PO3H 3PUZA 4LFCL 1XMQL 1WTOA 1U4RA 1XMOL 4F87A 3MXNB 5M3MB 4GKKQ 1HNWQ 4EX5A 1HUNA 1GHKA 2F0WA
chains in the Genus database with same CATH topology
5M5YH 3K80C 4A3LG 2NN6G 4LFAQ 4DR2Q 1NMFA 4NXNL 2NVTH 4HIKA 4L5RC 3J81j 3PUVA 2IT1A 4IO9A 4IPCA 4OWWB 1UE6A 3J80i 5M3MG 2CWPA 2B29A 3HFZB 5BR8Q 1Z9FA 3M4OH 4BXXH 4GOPB 4POGA 1MJEA 1YNXA 4BY1H 1WFQA 4A93H 4YCWA 1B70B 4HIDA 4AQYL 1CSQA 4DR6L 3BZKA 5ELNA 1IYJB 1UEBA 3H0GH 1SFOH 1EIYB 3K7UC 1KIXA 3A5ZB 3PO2H 3T1YQ 4JI6L 3G6EA 3HOZG 1X65A 1YEZA 1X55A 3STBD 2JA8H 4IOAA 3J80c 4YY3Q 4QL5A 4HJ7A 1IBKL 3KFUA 4DV5L 1SN8A 2D0OA 1L1OC 4HJ5A 3I4NH 2MO1A 3CAMA 5IYBG 2JA6G 3UDFA 5IP9H 1RIPA 2MNAA 1W2BA 2EIFA 2E8GA 4YHHL 1VQAA 3AQQA 1XPRA 3TS0A 3NENA 4X64Q 4BBSH 1VQHA 1IBMQ 2LSSA 1PH6A 1VQ4A 4A3BH 4KHPL 3OW2A 1YBYA 4DV3L 3K8AA 3OTOQ 4IOCA 1QVFA 2Z6KC 2VZAA 4JV5Q 3RLFA 1M1KC 2YTYA 4JYAQ 1G291 3J81c 5LMNL 3S15H 4DV4L 1KQSA 1JJ2A 5C0XJ 3PV0A 2R93H 1VQFA 3K81C 4LF7Q 2KHIA 3HOVH 4B3RL 1T9HA 3GTLH 2UUAQ 1KAWA 4LF8L 2DGYA 2WFWA 1NBWA 4DV1L 1PH2A 1JE5A 4A3KG 4A3CH 1YZ6A 1X3GA 3PUXA 2EXDA 5GAHC 3GTOH 5JEAJ 3W1GA 1EQQA 2BA1A 4A76A 1IL2A 3ICEA 1PHJA 4C3JH 4DV2L 4JI7L 2NZOA 3FP9A 2UXBL 1UE5A 3BU2A 4LF4Q 2I5HA 4JI1Q 4PZ7A 3S1QH 2HQLA 3W1BA 1HH2P 1LYLA 4MZ9A 3H0GG 2HHHL 4LF9Q 4LFBQ 4UP8A 1V1QA 3AFPA 3PCOB 1I3QH 2HIXA 3KF6A 5AJ3Q 4JI5Q 3CPWA 4NXML 3PO2G 3U4ZA 4C3IH 2IY5B 4MNOA 4YCUA 1YVCA 2F52A 4JI2L 4YCVA 2JK8A 4A3JH 1V9PA 1Q1EA 3S24A 1X6OA 4AH6A 1CKOA 1IBLQ 4A3LH 2ASBA 3I4NG 2ZM6Q 2JA5G 4GN3B 2N78A 4K0KL 2YYZA 1VQPA 2B63G 3D31A 2K5HA 4GLVB 1N34Q 3CMEA 1TWFH 4ALPA 1GO3E 4DV6Q 4DV7Q 1N36Q 5M3MH 4JBKA 1VQDA 4NB3A 4X65Q 5E7NA 2JE6I 3T1HQ 4BXXG 3NEMA 4L5TA 1TWHH 1SE8A 4R4IA 1N32L 4X6AH 1VQEA 2OCEA 5IYCG 1EQRA 3PUWA 4OXPA 2H5XA 3GDEA 3U58A 1KHIA 2RHQB 3RZDH 4LFCQ 1XMQQ 4B3MQ 1BBWA 3PUYA 2VQFL 1XMOQ 2NVYH 3KYHC 2VUMH 1PYSB 2E2JH 2CKZB 4DKAC 1FL0A 4P73A 4AIMA 2ES2A 2YU9H 3HOZH 4A3CG 3F2DA 2JEAI 4RG1A 1L0WA 1WOCA 2HIVA 1A0IA 4GOPC 1LUZA 2UUCL 3M85A 4NXNQ 3A74A 3S14H 4UP9A 4BY7H 1XJVA 5IYBH 3AEVA 2JA6H 4A3GG 4OO1I 3NELA 2BH8A 4IPGA 4LUZA 3S1MH 1NJIC 1I6HH 4P72A 2N8NA 2QA4A 4WJ3M 3F8TA 3JAMc 1D8LA 1BVSA 4A3JG 1TWGH 1UE7A 4AQYQ 1L2FA 4DR6Q 5C3EH 3L0OA 1DGSA 1EUJA 4UY8C 3U50C 2ZJRA 3CPFA 2FXQA 1Q82C 3CC4A 1Q1BA 4MTNA 1X56A 4R4CA 4JI6Q 5K36G 3RNUA 4P74A 4X66L 1VQGA 2Q2IA 5M3FH 4A3KH 1IBKQ 4DV5Q 1HNZL 1VQ6A 4P71A 4L5QA 4APVA 4A3DH 3HOUG 1HZBA 4DR4L 3B6YA 3GD7A 1IZ6A 4JI0L 4YHHQ 2VNUD 1S72A 2WB1G 3S1NH 4R4OA 1YHBA 4KHPQ 5C0XI 3KLWA 1Y1VG 4EQ5A 4DV3Q 2VQEL 2VUMG 2A19A 2PNHA 2YTVA 1YHQA 4P75A 5LMNQ 4GNXA 3K0XA 5IWAL 2PQAA 4DV4Q 1N9WA 2UXCL 1A8VA 2K50A 3J81i 2Q2TA 4B3RQ 1YHAA 4A3IG 4BY7G 2JA5H 4LF8Q 3H3VH 4DV1Q 1I94L 2B63H 1PV4A 2BA0A 3MEFA 4DNIA 2NVXH 2RF4A 2K52A 3M7NA 1PYBA 4BBRG 2AWOA 2WAQG 1OXSC 3ULJA 4R4TA 2JEBI 1LM0A 1OXXK 1X54A 2K14A 3KF6B 1QUQA 3NBHB 4DV2Q 1EYGA 1X9NA 1HR0L 2AWNA 4JI7Q 2UXBQ 2Y0SE 4YWMA 5FLMG 4LF6L 4R1JA 5M5XH 1HNXL 5IYCH 3I55A 5C3EG 4IFDI 1C0AA 2HHHQ 1E1TA 3CCVA 2UUBL 1JB7A 4DK6C 1AH9A 4NXMQ 2NVQH 2NN6I 4GS3A 4DAYB 1PH9A 3G71A 1OXUA 3KF8B 4O0AA 2AKWB 4JI2Q 1Q8KA 3KJOA 1CKMA 5FLXc 5M3FG 1ASYA 2UU9L 3CC2A 3PGZA 3ULLA 4B3SL 4A3DG 1Q46A 3HOWG 4UPAA 2E2IH 3GO5A 4PZ6A 5IE8A 4LF5L 3IRBA 2MQHA 2ALYB 5ELOA 1D7QA 1C9OA 3CC7A 1GD7A 2PI2A 1VQCA 4A3GH 3G48A 2IHFA 4L5SA 2WB1E 2F4VL 2K75A 2CQOA 4PZ8A 4IFDG 3DM3A 2CFMA 4X62L 4JI4L 1G51A 2VS1A 3TREA 4IFDJ 3VDYA 1N32Q 1LTLA 2RHSB 4JOIA 2LXKA 4LNQA 2ZJPA 4DR7L 1U0LA 4WJ4A 1IXRA 3CW2C 2B3GA 2R7FA 3I4MG 5JJIA 2GVBA 3GTKH 3CXCA 4DUYL 2VQFQ 3BJUA 1PFSA 3S17H 1VS0A 4DR5L 2VL6A 4A3FG 1JJGA 4JBJA 4A3EG 1PA6A 4JG2A 3JC66 1OTCA 1XPOA 5GAGC 4OONA 2I5MX 1FGUA 3SGIA 2WAQE 4Y52H 2KBNA 3KDFA 2UUCQ 3HOUH 2XGTA 1A63A 1KXLA 1SROA 2KCTA 4H02A 1SMXA 3DLLA 5LMUL 2VY3A 1TWAH 5H1SE 1VQNA 2Q2HA 3LGJA 1KRSA 5GADC 1VQIA 4IPDA 2AHOB 3D0FA 3CCSA 2KCMA 2YTXA 2CCZA 2PI2E 1YJNA 1PH3A 1KRTA 1I50H 1RL2A 1Y1VH 4YWKA 3S2DH 2R7ZG 5C44G 4DR3L 3JAMi 1XNRL 2CWAA 4IJHA 3J7A5 4GN4B 3HOXG 5HY6A 1NTGA 3EBEA 4LUVA 2OQKA 3RN2A 2E2HH 2NZHA 3AFQA 4LW1A 2UXDL 1L1OA 1Z47A 3E9IA 2QEXA 4A3IH 1QVGA 1EFWA 1VQOA 3STBC 3PSIA 4C2MH 4X66Q 2L15A 1HNZQ 4XTCS 1WYDA 4K0KQ 3L7ZC 3GTQH 5LMNW 4KLKA 4DR4Q 4JI3L 2OQ0A 1Q81C 1B7YB 1M90C 5J3BA 1N33L 4BBRH 4AYBG 4QQBX 4Y7NH 4JI8L 1K0RA 1VCIA 3OYYA 5C0XG 3W5OA 4JI0Q 2XTIA 2KENA 1SR3A 1UE1A 2Y0SG 2PQAB 3F2CA 4GNXB 2Z6KA 5FLMH 1YITA 1VQ7A 1G6PA 3HKZG 1Y14B 1Q12A 4RMFA 2DUDA 1XTDA 3ER0A 5GAEC 1K8AC 1VQBA 2VQEQ 3M4QA 1PH7A 3CCRA 5M5WH 1FVIA 3Q8DA 5IWAQ 4HJ8A 2UXCQ 5JEAG 3RR5A 1QZGA 5C4JH 3S2HH 3G4SA 3M3YH 3GTMH 1J6QA 1OXTA 3HOYG 3HOWH 4LWCA 4GKJL 3CP0A 3I56A 1QUQB 1MJCA 4LUOA 1I94Q 1V43A 3PIPA 1FJGL 4PG3A 1S40A 1E7ZA 3UDIA 4HIMA 2GVAA 5DLQE 2R7DA 1XNQL 2GN5A 4DV0L 3M4PA 1WI5A 2E5LL 4DUZL 1E1OA 1VQMA 1HR0Q 2QGQA 2AMCB 3KOJA 4UP7A 3L2PA 1Q7YC 1HNXQ 2ZTDA 1E3PA 1OXVA 2OTLA 4LF6Q 1X3EA 4JCVE 1NMGA 4QY7A 2UUBQ 3UDXA 3CCLA 1CUKA 3F2BA 3I4MH 1BKBA 1PH8A 2VW9A 2N3SA 2R6GA 1S3OA 4A3MG 1JT8A 1HZAA 2ZTCA 1AE3A 4A3FH 2UU9Q 2ID0A 4B3SQ 5JJLA 1E24A 4A3EH 4B3TL 3GTPH 4HJAA 3GTJH 1HNWL 4GKKL 2WP8J 1W3SA 3UDGA 4AYBE 1WJJA 3CCMA 1J5EL 4LF5Q 1N8RC 1WCMG 1VQJA 4JBWA 1KL9A 4BA2I 2I0QA 2OWOA 2R92H 2JA7G 5HGQA 4DR2L 2RCNA 1YIJA 4LFAL 2F4VQ 2HT1A 1NY4A 3HKZE 5IYDG 1YJWA 2ZJQA 3H15A 3FKIG 5GROA 3EN2A 4X62Q 2JJQA 1C7YA 3I4OA 4JI4Q 4BA1I 1HZ9A 4DK3C 5BR8L 1R9TH 1PH1A 1VQLA 1CSPA 1K83H 4DAMA 5C44H 1JMCA 1XPUA 2IHEA 1VQ5A 2R7ZH 1PVOA 4PMWA 4DR7Q 5IY0A 4IJLA 3HOXH 2V1CC 1P8LA 2PMZE 4GLAC 4DUYQ 3KDFB 1VQ8A 3PO3G 1H95A 3ZJYC 4DR5Q 4GOPA 3S16H 4TVAB 4QJFA 1E22A 3T1YL 2OTJA 1HZCA 3CCUA 5FJ8G 1CKNB 1HJPA 3U4VA 3CMAA 1GKHA 1VQKA 1ASZA 2MFIA 3J7ZC 4YY3L 1SLJA 5LMUQ 4J15A 1NE3A 4DR1Q 5IP7H 4GN5A 3K7AH 1Y1WH 4QGUA 1K3RA 1O7IA 3ERSX 3KJPA 4X64L 4HJ9A 3UE0A 4OX9Q 4A4IA 4OWTB 1L1OB 4DR3Q 1TWCH 5GQOA 1K8GA 1IBML 1XNRQ 3GTGH 1EIFA 1UWVA 3PF5A 4BY1G 2N49A 3OTOL 3A5UA 4JV5L 4OO1G 4A93G 3BZCA 4JYAL 1YJ9A 3AYHB 4KHZA 2UXDQ 4GLXA 3HOYH 1QZHA 3ULPA 1MKHA 3RLNA 2ATWA 4NPSA 3CCQA 5C4XH 4LF7L 2R92G 4DR1L 3EIVA 4GNXC 2UUAL 3RLOA 1U5KA 3CCJA 1K9MC 5IT9c 1KD1C 4A75A 2JA8G 1A62A 2Z0SA 3I7FA 1CKNA 4JI3Q 1N33Q 4OWXB 2EQSA 4JI8Q 3TS2A 1K73C 3TRZA 2F3IA 3CD6A 3PF4A 1VQ9A 4QIWE 5IP9G 1QVCA 2Q2UA 1EOVA 1YI2A 4FDBA 4KI0A 1SRUA 4YWLA 4LF4L 4BBSG 4JI1L 2I5LX 3M9BA 4LF9L 2IX1A 4A3BG 4LFBL 5JJKA 4XIGS 4JI5L 2A1AA 2LXJA 5AJ3L 3PIOA 4A3MH 4ME3A 1HR0W 4DPGA 3E0EA 1GM5A 3RZOH 1X3FA 4R4QA 2R93G 4GKJQ 2JA9A 3CF5A 2A8VA 3CQZH 3HOVG 2K5NA 4C3HH 1WCMH 5IP7G 3TQYA 1Y1WG 1IBLL 1BBUA 2K4KA 1PH4A 2KHJA 2ZM6L 1FJGQ 3CCEA 5EAYA 3I2ZA 1B8AA 2C35B 1AE2A 4TQUS 2IX0A 1XNQQ 2JA7H 4POFA 4DV0Q 3TEHB 5IYDH 3F1ZA 3WWVA 2E5LQ 3FKIH 4DUZQ 1N34L 2K5VA 3RN5A 1PH5A 2JQOA 3UE1A 4DV7L 4DV6L 1N36L 4JBMA 4OX9L 4O2DA 3H3VI 4X65L 3T1HL 1KC8C 3A0JA 3HKSA 3E9HA 2ZTEA 3FHWA 2BH2A 3S1RH 2D62A 4JC0A 4HIOA 4IPHA 2MO0A 5C4XG 1JJCB 1TXYA 1P16A 1I5FA 3PO3H 1GVPA 1MIUA 3PUZA 4LFCL 1XMQL 4B3ML 4JOIC 2YV5A 1XMOL 1Q86C 2D0PA 4B3TQ 3MXNB 1HNWQ 4GKKQ 4EX5A 5FJ8H 1J5EQ 1EWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5Y H;  3K80 C;  4A3L G;  2NN6 G;  4LFA Q;  4DR2 Q;  1NMF A;  4NXN L;  2NVT H;  4HIK A;  4L5R C;  3J81 j;  3PUV A;  2IT1 A;  4IO9 A;  4IPC A;  4OWW B;  1UE6 A;  3J80 i;  5M3M G;  2CWP A;  2B29 A;  3HFZ B;  5BR8 Q;  1Z9F A;  3M4O H;  4BXX H;  4GOP B;  4POG A;  1MJE A;  1YNX A;  4BY1 H;  1WFQ A;  4A93 H;  4YCW A;  1B70 B;  4HID A;  4AQY L;  1CSQ A;  4DR6 L;  3BZK A;  5ELN A;  1IYJ B;  1UEB A;  3H0G H;  1SFO H;  1EIY B;  3K7U C;  1KIX A;  3A5Z B;  3PO2 H;  3T1Y Q;  4JI6 L;  3G6E A;  3HOZ G;  1X65 A;  1YEZ A;  1X55 A;  3STB D;  2JA8 H;  4IOA A;  3J80 c;  4YY3 Q;  4QL5 A;  4HJ7 A;  1IBK L;  3KFU A;  4DV5 L;  1SN8 A;  2D0O A;  1L1O C;  4HJ5 A;  3I4N H;  2MO1 A;  3CAM A;  5IYB G;  2JA6 G;  3UDF A;  5IP9 H;  1RIP A;  2MNA A;  1W2B A;  2EIF A;  2E8G A;  4YHH L;  1VQA A;  3AQQ A;  1XPR A;  3TS0 A;  3NEN A;  4X64 Q;  4BBS H;  1VQH A;  1IBM Q;  2LSS A;  1PH6 A;  1VQ4 A;  4A3B H;  4KHP L;  3OW2 A;  1YBY A;  4DV3 L;  3K8A A;  3OTO Q;  4IOC A;  1QVF A;  2Z6K C;  2VZA A;  4JV5 Q;  3RLF A;  1M1K C;  2YTY A;  4JYA Q;  1G29 1;  3J81 c;  5LMN L;  3S15 H;  4DV4 L;  1KQS A;  1JJ2 A;  5C0X J;  3PV0 A;  2R93 H;  1VQF A;  3K81 C;  4LF7 Q;  2KHI A;  3HOV H;  4B3R L;  1T9H A;  3GTL H;  2UUA Q;  1KAW A;  4LF8 L;  2DGY A;  2WFW A;  1NBW A;  4DV1 L;  1PH2 A;  1JE5 A;  4A3K G;  4A3C H;  1YZ6 A;  1X3G A;  3PUX A;  2EXD A;  5GAH C;  3GTO H;  5JEA J;  3W1G A;  1EQQ A;  2BA1 A;  4A76 A;  1IL2 A;  3ICE A;  1PHJ A;  4C3J H;  4DV2 L;  4JI7 L;  2NZO A;  3FP9 A;  2UXB L;  1UE5 A;  3BU2 A;  4LF4 Q;  2I5H A;  4JI1 Q;  4PZ7 A;  3S1Q H;  2HQL A;  3W1B A;  1HH2 P;  1LYL A;  4MZ9 A;  3H0G G;  2HHH L;  4LF9 Q;  4LFB Q;  4UP8 A;  1V1Q A;  3AFP A;  3PCO B;  1I3Q H;  2HIX A;  3KF6 A;  5AJ3 Q;  4JI5 Q;  3CPW A;  4NXM L;  3PO2 G;  3U4Z A;  4C3I H;  2IY5 B;  4MNO A;  4YCU A;  1YVC A;  2F52 A;  4JI2 L;  4YCV A;  2JK8 A;  4A3J H;  1V9P A;  1Q1E A;  3S24 A;  1X6O A;  4AH6 A;  1CKO A;  1IBL Q;  4A3L H;  2ASB A;  3I4N G;  2ZM6 Q;  2JA5 G;  4GN3 B;  2N78 A;  4K0K L;  2YYZ A;  1VQP A;  2B63 G;  3D31 A;  2K5H A;  4GLV B;  1N34 Q;  3CME A;  1TWF H;  4ALP A;  1GO3 E;  4DV6 Q;  4DV7 Q;  1N36 Q;  5M3M H;  4JBK A;  1VQD A;  4NB3 A;  4X65 Q;  5E7N A;  2JE6 I;  3T1H Q;  4BXX G;  3NEM A;  4L5T A;  1TWH H;  1SE8 A;  4R4I A;  1N32 L;  4X6A H;  1VQE A;  2OCE A;  5IYC G;  1EQR A;  3PUW A;  4OXP A;  2H5X A;  3GDE A;  3U58 A;  1KHI A;  2RHQ B;  3RZD H;  4LFC Q;  1XMQ Q;  4B3M Q;  1BBW A;  3PUY A;  2VQF L;  1XMO Q;  2NVY H;  3KYH C;  2VUM H;  1PYS B;  2E2J H;  2CKZ B;  4DKA C;  1FL0 A;  4P73 A;  4AIM A;  2ES2 A;  2YU9 H;  3HOZ H;  4A3C G;  3F2D A;  2JEA I;  4RG1 A;  1L0W A;  1WOC A;  2HIV A;  1A0I A;  4GOP C;  1LUZ A;  2UUC L;  3M85 A;  4NXN Q;  3A74 A;  3S14 H;  4UP9 A;  4BY7 H;  1XJV A;  5IYB H;  3AEV A;  2JA6 H;  4A3G G;  4OO1 I;  3NEL A;  2BH8 A;  4IPG A;  4LUZ A;  3S1M H;  1NJI C;  1I6H H;  4P72 A;  2N8N A;  2QA4 A;  4WJ3 M;  3F8T A;  3JAM c;  1D8L A;  1BVS A;  4A3J G;  1TWG H;  1UE7 A;  4AQY Q;  1L2F A;  4DR6 Q;  5C3E H;  3L0O A;  1DGS A;  1EUJ A;  4UY8 C;  3U50 C;  2ZJR A;  3CPF A;  2FXQ A;  1Q82 C;  3CC4 A;  1Q1B A;  4MTN A;  1X56 A;  4R4C A;  4JI6 Q;  5K36 G;  3RNU A;  4P74 A;  4X66 L;  1VQG A;  2Q2I A;  5M3F H;  4A3K H;  1IBK Q;  4DV5 Q;  1HNZ L;  1VQ6 A;  4P71 A;  4L5Q A;  4APV A;  4A3D H;  3HOU G;  1HZB A;  4DR4 L;  3B6Y A;  3GD7 A;  1IZ6 A;  4JI0 L;  4YHH Q;  2VNU D;  1S72 A;  2WB1 G;  3S1N H;  4R4O A;  1YHB A;  4KHP Q;  5C0X I;  3KLW A;  1Y1V G;  4EQ5 A;  4DV3 Q;  2VQE L;  2VUM G;  2A19 A;  2PNH A;  2YTV A;  1YHQ A;  4P75 A;  5LMN Q;  4GNX A;  3K0X A;  5IWA L;  2PQA A;  4DV4 Q;  1N9W A;  2UXC L;  1A8V A;  2K50 A;  3J81 i;  2Q2T A;  4B3R Q;  1YHA A;  4A3I G;  4BY7 G;  2JA5 H;  4LF8 Q;  3H3V H;  4DV1 Q;  1I94 L;  2B63 H;  1PV4 A;  2BA0 A;  3MEF A;  4DNI A;  2NVX H;  2RF4 A;  2K52 A;  3M7N A;  1PYB A;  4BBR G;  2AWO A;  2WAQ G;  1OXS C;  3ULJ A;  4R4T A;  2JEB I;  1LM0 A;  1OXX K;  1X54 A;  2K14 A;  3KF6 B;  1QUQ A;  3NBH B;  4DV2 Q;  1EYG A;  1X9N A;  1HR0 L;  2AWN A;  4JI7 Q;  2UXB Q;  2Y0S E;  4YWM A;  5FLM G;  4LF6 L;  4R1J A;  5M5X H;  1HNX L;  5IYC H;  3I55 A;  5C3E G;  4IFD I;  1C0A A;  2HHH Q;  1E1T A;  3CCV A;  2UUB L;  1JB7 A;  4DK6 C;  1AH9 A;  4NXM Q;  2NVQ H;  2NN6 I;  4GS3 A;  4DAY B;  1PH9 A;  3G71 A;  1OXU A;  3KF8 B;  4O0A A;  2AKW B;  4JI2 Q;  1Q8K A;  3KJO A;  1CKM A;  5FLX c;  5M3F G;  1ASY A;  2UU9 L;  3CC2 A;  3PGZ A;  3ULL A;  4B3S L;  4A3D G;  1Q46 A;  3HOW G;  4UPA A;  2E2I H;  3GO5 A;  4PZ6 A;  5IE8 A;  4LF5 L;  3IRB A;  2MQH A;  2ALY B;  5ELO A;  1D7Q A;  1C9O A;  3CC7 A;  1GD7 A;  2PI2 A;  1VQC A;  4A3G H;  3G48 A;  2IHF A;  4L5S A;  2WB1 E;  2F4V L;  2K75 A;  2CQO A;  4PZ8 A;  4IFD G;  3DM3 A;  2CFM A;  4X62 L;  4JI4 L;  1G51 A;  2VS1 A;  3TRE A;  4IFD J;  3VDY A;  1N32 Q;  1LTL A;  2RHS B;  4JOI A;  2LXK A;  4LNQ A;  2ZJP A;  4DR7 L;  1U0L A;  4WJ4 A;  1IXR A;  3CW2 C;  2B3G A;  2R7F A;  3I4M G;  5JJI A;  2GVB A;  3GTK H;  3CXC A;  4DUY L;  2VQF Q;  3BJU A;  1PFS A;  3S17 H;  1VS0 A;  4DR5 L;  2VL6 A;  4A3F G;  1JJG A;  4JBJ A;  4A3E G;  1PA6 A;  4JG2 A;  3JC6 6;  1OTC A;  1XPO A;  5GAG C;  4OON A;  2I5M X;  1FGU A;  3SGI A;  2WAQ E;  4Y52 H;  2KBN A;  3KDF A;  2UUC Q;  3HOU H;  2XGT A;  1A63 A;  1KXL A;  1SRO A;  2KCT A;  4H02 A;  1SMX A;  3DLL A;  5LMU L;  2VY3 A;  1TWA H;  5H1S E;  1VQN A;  2Q2H A;  3LGJ A;  1KRS A;  5GAD C;  1VQI A;  4IPD A;  2AHO B;  3D0F A;  3CCS A;  2KCM A;  2YTX A;  2CCZ A;  2PI2 E;  1YJN A;  1PH3 A;  1KRT A;  1I50 H;  1RL2 A;  1Y1V H;  4YWK A;  3S2D H;  2R7Z G;  5C44 G;  4DR3 L;  3JAM i;  1XNR L;  2CWA A;  4IJH A;  3J7A 5;  4GN4 B;  3HOX G;  5HY6 A;  1NTG A;  3EBE A;  4LUV A;  2OQK A;  3RN2 A;  2E2H H;  2NZH A;  3AFQ A;  4LW1 A;  2UXD L;  1L1O A;  1Z47 A;  3E9I A;  2QEX A;  4A3I H;  1QVG A;  1EFW A;  1VQO A;  3STB C;  3PSI A;  4C2M H;  4X66 Q;  2L15 A;  1HNZ Q;  4XTC S;  1WYD A;  4K0K Q;  3L7Z C;  3GTQ H;  5LMN W;  4KLK A;  4DR4 Q;  4JI3 L;  2OQ0 A;  1Q81 C;  1B7Y B;  1M90 C;  5J3B A;  1N33 L;  4BBR H;  4AYB G;  4QQB X;  4Y7N H;  4JI8 L;  1K0R A;  1VCI A;  3OYY A;  5C0X G;  3W5O A;  4JI0 Q;  2XTI A;  2KEN A;  1SR3 A;  1UE1 A;  2Y0S G;  2PQA B;  3F2C A;  4GNX B;  2Z6K A;  5FLM H;  1YIT A;  1VQ7 A;  1G6P A;  3HKZ G;  1Y14 B;  1Q12 A;  4RMF A;  2DUD A;  1XTD A;  3ER0 A;  5GAE C;  1K8A C;  1VQB A;  2VQE Q;  3M4Q A;  1PH7 A;  3CCR A;  5M5W H;  1FVI A;  3Q8D A;  5IWA Q;  4HJ8 A;  2UXC Q;  5JEA G;  3RR5 A;  1QZG A;  5C4J H;  3S2H H;  3G4S A;  3M3Y H;  3GTM H;  1J6Q A;  1OXT A;  3HOY G;  3HOW H;  4LWC A;  4GKJ L;  3CP0 A;  3I56 A;  1QUQ B;  1MJC A;  4LUO A;  1I94 Q;  1V43 A;  3PIP A;  1FJG L;  4PG3 A;  1S40 A;  1E7Z A;  3UDI A;  4HIM A;  2GVA A;  5DLQ E;  2R7D A;  1XNQ L;  2GN5 A;  4DV0 L;  3M4P A;  1WI5 A;  2E5L L;  4DUZ L;  1E1O A;  1VQM A;  1HR0 Q;  2QGQ A;  2AMC B;  3KOJ A;  4UP7 A;  3L2P A;  1Q7Y C;  1HNX Q;  2ZTD A;  1E3P A;  1OXV A;  2OTL A;  4LF6 Q;  1X3E A;  4JCV E;  1NMG A;  4QY7 A;  2UUB Q;  3UDX A;  3CCL A;  1CUK A;  3F2B A;  3I4M H;  1BKB A;  1PH8 A;  2VW9 A;  2N3S A;  2R6G A;  1S3O A;  4A3M G;  1JT8 A;  1HZA A;  2ZTC A;  1AE3 A;  4A3F H;  2UU9 Q;  2ID0 A;  4B3S Q;  5JJL A;  1E24 A;  4A3E H;  4B3T L;  3GTP H;  4HJA A;  3GTJ H;  1HNW L;  4GKK L;  2WP8 J;  1W3S A;  3UDG A;  4AYB E;  1WJJ A;  3CCM A;  1J5E L;  4LF5 Q;  1N8R C;  1WCM G;  1VQJ A;  4JBW A;  1KL9 A;  4BA2 I;  2I0Q A;  2OWO A;  2R92 H;  2JA7 G;  5HGQ A;  4DR2 L;  2RCN A;  1YIJ A;  4LFA L;  2F4V Q;  2HT1 A;  1NY4 A;  3HKZ E;  5IYD G;  1YJW A;  2ZJQ A;  3H15 A;  3FKI G;  5GRO A;  3EN2 A;  4X62 Q;  2JJQ A;  1C7Y A;  3I4O A;  4JI4 Q;  4BA1 I;  1HZ9 A;  4DK3 C;  5BR8 L;  1R9T H;  1PH1 A;  1VQL A;  1CSP A;  1K83 H;  4DAM A;  5C44 H;  1JMC A;  1XPU A;  2IHE A;  1VQ5 A;  2R7Z H;  1PVO A;  4PMW A;  4DR7 Q;  5IY0 A;  4IJL A;  3HOX H;  2V1C C;  1P8L A;  2PMZ E;  4GLA C;  4DUY Q;  3KDF B;  1VQ8 A;  3PO3 G;  1H95 A;  3ZJY C;  4DR5 Q;  4GOP A;  3S16 H;  4TVA B;  4QJF A;  1E22 A;  3T1Y L;  2OTJ A;  1HZC A;  3CCU A;  5FJ8 G;  1CKN B;  1HJP A;  3U4V A;  3CMA A;  1GKH A;  1VQK A;  1ASZ A;  2MFI A;  3J7Z C;  4YY3 L;  1SLJ A;  5LMU Q;  4J15 A;  1NE3 A;  4DR1 Q;  5IP7 H;  4GN5 A;  3K7A H;  1Y1W H;  4QGU A;  1K3R A;  1O7I A;  3ERS X;  3KJP A;  4X64 L;  4HJ9 A;  3UE0 A;  4OX9 Q;  4A4I A;  4OWT B;  1L1O B;  4DR3 Q;  1TWC H;  5GQO A;  1K8G A;  1IBM L;  1XNR Q;  3GTG H;  1EIF A;  1UWV A;  3PF5 A;  4BY1 G;  2N49 A;  3OTO L;  3A5U A;  4JV5 L;  4OO1 G;  4A93 G;  3BZC A;  4JYA L;  1YJ9 A;  3AYH B;  4KHZ A;  2UXD Q;  4GLX A;  3HOY H;  1QZH A;  3ULP A;  1MKH A;  3RLN A;  2ATW A;  4NPS A;  3CCQ A;  5C4X H;  4LF7 L;  2R92 G;  4DR1 L;  3EIV A;  4GNX C;  2UUA L;  3RLO A;  1U5K A;  3CCJ A;  1K9M C;  5IT9 c;  1KD1 C;  4A75 A;  2JA8 G;  1A62 A;  2Z0S A;  3I7F A;  1CKN A;  4JI3 Q;  1N33 Q;  4OWX B;  2EQS A;  4JI8 Q;  3TS2 A;  1K73 C;  3TRZ A;  2F3I A;  3CD6 A;  3PF4 A;  1VQ9 A;  4QIW E;  5IP9 G;  1QVC A;  2Q2U A;  1EOV A;  1YI2 A;  4FDB A;  4KI0 A;  1SRU A;  4YWL A;  4LF4 L;  4BBS G;  4JI1 L;  2I5L X;  3M9B A;  4LF9 L;  2IX1 A;  4A3B G;  4LFB L;  5JJK A;  4XIG S;  4JI5 L;  2A1A A;  2LXJ A;  5AJ3 L;  3PIO A;  4A3M H;  4ME3 A;  1HR0 W;  4DPG A;  3E0E A;  1GM5 A;  3RZO H;  1X3F A;  4R4Q A;  2R93 G;  4GKJ Q;  2JA9 A;  3CF5 A;  2A8V A;  3CQZ H;  3HOV G;  2K5N A;  4C3H H;  1WCM H;  5IP7 G;  3TQY A;  1Y1W G;  1IBL L;  1BBU A;  2K4K A;  1PH4 A;  2KHJ A;  2ZM6 L;  1FJG Q;  3CCE A;  5EAY A;  3I2Z A;  1B8A A;  2C35 B;  1AE2 A;  4TQU S;  2IX0 A;  1XNQ Q;  2JA7 H;  4POF A;  4DV0 Q;  3TEH B;  5IYD H;  3F1Z A;  3WWV A;  2E5L Q;  3FKI H;  4DUZ Q;  1N34 L;  2K5V A;  3RN5 A;  1PH5 A;  2JQO A;  3UE1 A;  4DV7 L;  4DV6 L;  1N36 L;  4JBM A;  4OX9 L;  4O2D A;  3H3V I;  4X65 L;  3T1H L;  1KC8 C;  3A0J A;  3HKS A;  3E9H A;  2ZTE A;  3FHW A;  2BH2 A;  3S1R H;  2D62 A;  4JC0 A;  4HIO A;  4IPH A;  2MO0 A;  5C4X G;  1JJC B;  1TXY A;  1P16 A;  1I5F A;  3PO3 H;  1GVP A;  1MIU A;  3PUZ A;  4LFC L;  1XMQ L;  4B3M L;  4JOI C;  2YV5 A;  1XMO L;  1Q86 C;  2D0P A;  4B3T Q;  3MXN B;  1HNW Q;  4GKK Q;  4EX5 A;  5FJ8 H;  1J5E Q;  1EWI A; 
#chains in the Genus database with same CATH topology
 4CGY B;  2EYH A;  1HTL D;  4DR2 Q;  4HIK A;  3QJY A;  1S5F D;  4C3H B;  4IO9 A;  1M8A A;  2B29 A;  2HUG A;  3HFZ B;  4ZKB B;  4POG A;  3CU7 A;  1MJE A;  1YNX A;  2H4O A;  3DWP A;  2DJF C;  3X3M A;  3AB9 A;  1PZI D;  1ICW A;  4AQY L;  4DR6 L;  5ELN A;  1B50 A;  4QIW B;  1IYJ B;  3S9W A;  3OHX C;  3PO2 H;  3T1Y Q;  5L37 A;  1X55 A;  2JA8 H;  3QB3 A;  1CI3 M;  1B3A A;  5FK9 C;  1EOT A;  2MO1 A;  3CAM A;  3DXJ C;  4L6T B;  1HQM C;  2E8G A;  4WRD A;  4UDU C;  4PQX A;  4TRD A;  1VQH A;  1IBM Q;  4RHS A;  2ZXR A;  2ZXO A;  3M4Y A;  2MPM A;  4JV5 Q;  1ZXT A;  1JJ2 A;  2FMM A;  3PV0 A;  5LL6 X;  4WJW A;  4CKB A;  5ELB A;  5IT9 L;  3A8I E;  1B9N A;  2DGY A;  2TMP A;  4DV1 L;  2D5D A;  4O42 A;  1AZQ A;  2EXD A;  4DXG A;  3D4D A;  1PTO F;  1EQQ A;  2BA1 A;  1F2M A;  4HCS A;  1B2T A;  1PHJ A;  1XTC D;  4XT1 B;  3BU2 A;  4LF4 Q;  3S1Q H;  3I4N B;  2PQE A;  1BCP F;  3H0G G;  4LFB Q;  4UP8 A;  1V1Q A;  3PCO B;  5KYL A;  3CPW A;  3CRK C;  4V19 0;  4KN7 C;  4YCU A;  2F52 A;  2JK8 A;  5JJZ A;  1MD2 D;  4IUP A;  4IUR A;  2N78 A;  4MHE A;  3PMF A;  2IWH A;  1VQP A;  2B63 G;  3D31 A;  2NVQ B;  3CME A;  1TWF H;  3OMG A;  1GO3 E;  2L55 A;  4NB3 A;  2JE6 I;  3T1H Q;  2G9H D;  3NHH A;  4R4I A;  4OXP A;  3Q23 A;  1NSN S;  2H5X A;  3TZD A;  5IGB A;  2F0V A;  3MTS A;  4C3J B;  2FFK B;  4B3M Q;  4KKU A;  4FF4 A;  3S1M H;  2E2J H;  4RGN A;  4P73 A;  4AIM A;  1HPC A;  2YU9 H;  3SHL A;  1M4V A;  1Y8P B;  3VR6 A;  1JOK A;  2NB0 A;  1SDF A;  1LUZ A;  2A6E D;  3S14 H;  4K14 A;  1XJV A;  4OO1 I;  2Z6B A;  3W3A A;  3GTK B;  4LMQ D;  2N8N A;  4XQN A;  3JAM c;  1D8L A;  3D3R A;  1VMC A;  4OIK A;  1B9M A;  1DGS A;  3BYT B;  2FXQ A;  1Q1B A;  1X56 A;  4HMJ A;  3FMC A;  1G6Z A;  5BN4 A;  3J80 L;  2MP1 A;  1PRT B;  2Q2I A;  1Y1V B;  4K0K L;  4N9T A;  4L5Q A;  2NVY B;  1SNP A;  4P71 A;  4APV A;  3HOU G;  4DR4 L;  2VUM B;  2N55 A;  2SOB A;  4KV6 A;  5COY A;  2VNU D;  3ONA B;  2J7Z A;  1UUP A;  2WB1 G;  1PRT D;  1KNE A;  3KLW A;  1EFI D;  2QDB A;  5LMN Q;  4DV4 Q;  2M2L A;  1A8V A;  2DNE A;  4Y7N B;  2L9H A;  1PYW D;  4XDX A;  1ZEQ X;  1TWG B;  4A3I G;  4BY7 G;  5C3E B;  2A6H D;  2B63 H;  5K5P A;  2F4I A;  2K52 A;  4K2L A;  2AWO A;  1OXS C;  2K14 A;  3NBH B;  4FXD A;  4DV2 Q;  4JI7 Q;  3VR5 A;  3KLS X;  2AWN A;  2UXB Q;  4A3D B;  2IJ0 A;  1TS4 A;  1EY4 A;  5COR A;  3SK6 A;  5J39 A;  4GS3 A;  3KK7 A;  1SNO A;  2B2W C;  4O0A A;  2AKW B;  4JI2 Q;  3KJO A;  2UU9 L;  5CR3 A;  4UPA A;  4EQP A;  3GO5 A;  4DAV A;  5IE8 A;  3IRB A;  1FGB D;  1ESF A;  2F0H A;  1H9M A;  2WB1 E;  2F4V L;  4HN7 A;  2CQO A;  4PZ8 A;  2CFM A;  4JI4 L;  4A3F B;  2NWG A;  1G51 A;  2VS1 A;  1CTM A;  5CBE E;  4LK1 C;  2K32 A;  1LTL A;  2EY1 A;  1JIC A;  2F0E A;  2QF7 A;  4LNQ A;  4DR7 L;  1SMY C;  1H9R A;  3VA5 A;  4ZYS A;  3CXC A;  2VQF Q;  3SK4 A;  1TS2 A;  3KF8 A;  3N52 A;  2RA4 A;  4JG2 A;  2N88 A;  1OTC A;  3K59 A;  3SGI A;  2R7Z B;  5C44 B;  4IUQ A;  3KDF A;  3HOU H;  4H02 A;  3DLL A;  2RCF A;  3HOX B;  1JOO A;  2BCO A;  1KRS A;  2CCZ A;  1LTR D;  2O2L D;  2F03 A;  2YTX A;  1PH3 A;  2V4D A;  3D6C A;  5G3L F;  3OMC A;  4YWK A;  3URY A;  5HY6 A;  1NTG A;  4LUV A;  2OQK A;  3RN2 A;  2A73 B;  1VDZ A;  3OWE B;  2B8G A;  2RVL A;  2M00 A;  1STY A;  4LW1 A;  2QEX A;  4A3I H;  1QVG A;  1ILQ A;  3STB C;  3X3N A;  4X66 Q;  1STN A;  1WYD A;  5JPM C;  1EYA A;  3ERQ A;  1RDP D;  2B2T C;  3OYY A;  5C0X G;  4OHJ A;  2XTI A;  2Y0S G;  5CYU A;  4GNX B;  4LJZ C;  1TY2 A;  4PMB A;  1PRT F;  1YIT A;  3HKZ G;  4FXK C;  1TWA B;  5GAE C;  1K8A C;  3A7L A;  3M4Q A;  3MEH A;  3CCR A;  5M5W H;  1FVI A;  1HXY D;  3DUZ A;  3M3Y H;  2OEO A;  5E1F A;  3TP5 A;  1I94 Q;  1PFM A;  1FJG L;  3T4A C;  1E7Z A;  5IOD A;  5CV5 A;  3M4P A;  1CZG A;  1WI5 A;  1SEB D;  2E5L L;  4UHV A;  1VQM A;  1EEI D;  2AMC B;  4BA2 I;  1OXV A;  3CQZ B;  1X3E A;  4JCV E;  1NMG A;  1WCM B;  1TKW B;  2KED A;  5I4D A;  2F0G A;  2ZTC A;  2KEC A;  4B3S Q;  3GP7 A;  3GTP H;  4HJA A;  1TR5 A;  4GKK L;  1HNW L;  2CHB D;  1PMR A;  1VQJ A;  5C4J B;  3S2H B;  1O78 A;  1PXU A;  5EPK A;  2JA7 G;  1L0X B;  2RCN A;  4DR2 L;  3HKZ E;  3MXN A;  3PO3 B;  3FKI G;  5GRO A;  3EN2 A;  3N6R A;  2F0P A;  1R9T H;  1VQL A;  2IHE A;  1VQ5 A;  1PVO A;  2A68 D;  1LAB A;  1O80 A;  1HRJ A;  1D6E C;  5EKI A;  3ZJY C;  4UAI A;  3T1Y L;  5C5M A;  3CCU A;  3CMA A;  2GA4 B;  1CM9 A;  1VQK A;  1SLJ A;  2JP1 A;  3HG9 A;  4DR1 Q;  2DY8 A;  5C0X H;  1NNX A;  3KJP A;  2R92 B;  5C4H A;  2B2U A;  4HJ9 A;  1SXT A;  1L1O B;  1LT5 D;  1IBM L;  1UWV A;  4BY1 G;  4JV5 L;  3H09 A;  3HS0 C;  1QZH A;  2B2Y A;  3ULP A;  1MSH A;  4NPS A;  3CCQ A;  1WTW A;  1CFM A;  4X3K A;  3EIV A;  2B2V A;  1U5K A;  3CCJ A;  1WTQ A;  3FPP A;  5KRU A;  4A75 A;  1DON A;  4OWX B;  2KUM A;  2E74 C;  3U9S A;  3GV3 A;  5CC4 A;  1EOV A;  1SRU A;  4DXF A;  3VYU A;  4LF4 L;  3K7A B;  1Y1W B;  1K0S A;  4DN4 M;  2IX1 A;  4LFB L;  5JJK A;  1HHV A;  3MAQ A;  3QWN A;  2A1A A;  5JAV A;  4ME3 A;  4DPG A;  3E0E A;  3CF5 A;  3RD4 A;  3HOV G;  2K5N A;  1BBU A;  3S1Q B;  5EAY A;  2C35 B;  5I2X A;  1AE2 A;  2JA7 H;  4POF A;  4B9W A;  2F0T A;  3FKI H;  2EYM A;  2K5V A;  1E2W A;  3T1H L;  3V2T A;  1KC8 C;  3CHB D;  3E9H A;  2I07 B;  3HKS A;  1UNS A;  4JC0 A;  4HIO A;  4IPH A;  4L8J A;  5C4X G;  2F0O A;  1KLG D;  1P16 A;  4WFN 3;  1O7Z A;  1GVP A;  4B3M L;  1TWF B;  1A2U A;  5ELE A;  4B3T Q;  2O4X A;  1LO5 D;  2K05 A;  2EOT A;  1J5E Q;  5M5Y H;  4FO2 A;  3K80 C;  1CHQ D;  1LTA D;  1SJE D;  2NN6 G;  2NVT H;  3O13 A;  3PUV A;  4U67 3;  4IAL A;  5E4W C;  4ZAI A;  3J80 i;  3S1M B;  5BR8 Q;  2E2J B;  1H9S A;  4PV1 C;  2YU9 B;  3MFG A;  2F0F A;  5DM6 3;  4ZUI A;  3QOL A;  4BY1 H;  1A6X A;  4YCW A;  2EE1 A;  1EYD A;  3SXH A;  1EY9 A;  1DZ1 A;  1UEB A;  3I90 A;  3ND8 A;  1SFO H;  4Q0F A;  1BXT A;  1KIX A;  1JC7 A;  2XWJ B;  4TSS A;  5FO9 B;  4KKS A;  3HOZ G;  3G6E A;  1X65 A;  2PYK A;  1Q8I A;  2Z1C A;  4QUC A;  3MXP A;  1EIG A;  1SYE A;  3KFU A;  4HJ5 A;  3TBI B;  1D2B A;  1XPR A;  3TS0 A;  4FF1 A;  3FPU B;  2NYZ D;  1PTO C;  1LAC A;  3ITP A;  3OW2 A;  1F9Q A;  4IOC A;  2VZA A;  3RLF A;  1M1K C;  2YTY A;  5LMN L;  3S15 H;  4DV4 L;  2Q8T A;  4BWG B;  4O1N A;  1BCP C;  1B44 D;  3HOV H;  1T9H A;  2ICE C;  3DM1 A;  2KCC A;  1BUV T;  1U9R A;  3H0G B;  1W6J A;  1FNU A;  1PH2 A;  4A3K G;  4A3C H;  4KK7 A;  1X3G A;  2EXZ A;  2OXP A;  2F0I A;  2A69 D;  1AN8 A;  4A76 A;  3HRZ C;  3R93 A;  4DF7 A;  1STH A;  4DV2 L;  4JI7 L;  5KEE A;  2UXB L;  3L9A X;  4K5V A;  4LF9 Q;  4DNR B;  2B63 B;  1I3Q H;  2HIX A;  3NBH A;  3PO2 G;  3SK8 A;  3MWY W;  3U4Z A;  2Q8I B;  1ZYR D;  4JI2 L;  4TKO B;  4YCV A;  4A3J H;  1V9P A;  1Q1E A;  2F0Q A;  2K04 A;  1RTN A;  4DK1 A;  1B53 A;  1X6O A;  2ZM6 Q;  2JA5 G;  1KDC A;  1PZJ D;  4GLV B;  3FVQ A;  4DV7 Q;  1ICF B;  1SND A;  4DV6 Q;  4X65 Q;  2RSO A;  4L5T A;  1SE8 A;  2Q8R E;  3GTO B;  3KBX A;  4K8I A;  1RKN A;  1KHI A;  2RHQ B;  2WV6 D;  1SSO A;  1TS3 A;  3PIO 3;  2VQF L;  3KYH C;  2ES2 A;  1FL0 A;  3NXW A;  3HOZ H;  4C3I B;  5EQ0 A;  1WOC A;  2MHV A;  1OO9 B;  1A0I A;  5CV6 A;  4NXN Q;  3M85 A;  3A74 A;  4UP9 A;  4H44 C;  1IKL A;  1QNK A;  4IPG A;  3NSW A;  1NJI C;  3UI2 A;  1I6H H;  4P72 A;  1TU2 B;  1JE4 A;  1SE4 A;  5AFW A;  1BVS A;  3H94 A;  3MFY A;  4FNF A;  1UE7 A;  3HOU B;  2B2U C;  2LFN A;  5A2Q E;  3CPF A;  5ELF A;  3CC4 A;  1PZK D;  1SAP A;  2WB1 B;  5CV4 A;  4KD4 A;  3RNU A;  3GQB A;  4X66 L;  5M3F H;  4A3K H;  1IBK Q;  4DV5 Q;  1X3Q A;  2B2Y C;  2L4N A;  4XQJ A;  3B6Y A;  2B2V C;  1LLR D;  4Z9C B;  1UEA B;  2PZW A;  4YHH Q;  1S72 A;  3KLR A;  4A3I B;  4BY7 B;  4I7Z C;  3EVQ A;  3S1N H;  4KHP Q;  2F0J A;  1EY7 A;  2A74 C;  2A19 A;  4P75 A;  4GNX A;  4DU9 A;  2K50 A;  4H13 C;  2AUK A;  3J81 i;  3J7Y W;  4G7Z C;  1DYQ A;  3C1E A;  2JA5 H;  4LF8 Q;  4JVZ A;  1U4P A;  1I94 L;  1PV4 A;  1IHZ A;  2NVX H;  1D1I A;  3MA2 B;  5M5W B;  4BBR G;  3FEW X;  2WAQ G;  3KF6 B;  1EYG A;  1EQT A;  1OXX K;  1JJG A;  4HMI A;  1X9N A;  1IW7 C;  3DHQ A;  4H7B A;  5FLM G;  1MI2 A;  1HA5 A;  3I55 A;  3CCV A;  2R3Z A;  4DK6 C;  1JCK B;  2NN6 I;  1PH9 A;  2B2T A;  1OXU A;  2XRS D;  4R8N A;  1KAB A;  1Q8K A;  1R4Q B;  4F7X A;  1CKM A;  2OF1 A;  3P20 A;  1IYU A;  1ASY A;  4B3S L;  3PGZ A;  1EZ8 A;  3HOW G;  1CA6 A;  2MQH A;  5ELO A;  1DXM A;  4M1U B;  2D9U A;  2PI2 A;  1DJR D;  1VQC A;  3EQL C;  1WVL A;  3MXU A;  4K8J A;  1GOZ A;  4DFA A;  2CQA A;  5E3F A;  1WTH A;  4JOI A;  1TY0 A;  2ZJP A;  1U0L A;  2HCC A;  3NWS A;  4ID6 A;  3I4M G;  1ILP A;  5JJI A;  1LV9 A;  1BQQ T;  5M5X B;  4DAY A;  3BJU A;  1S4Z A;  3S17 H;  5J1Z A;  3QOJ A;  4JBJ A;  4DK0 A;  4A3E G;  2RBM A;  3JC6 6;  3T56 B;  3OIQ A;  1XPO A;  4OON A;  1BNZ A;  2WAQ E;  4Y52 H;  4KHV A;  1SRO A;  5H1S E;  2KA7 A;  1SJH D;  1VQN A;  5D3I B;  2WKD A;  3LGJ A;  3CCS A;  1QB5 D;  4IPD A;  5KND A;  3D0F A;  1ESR A;  2AHO B;  3K6O A;  2J4X A;  4HSP A;  1YJN A;  1KRT A;  3JAM L;  1BO0 A;  5BN3 A;  1G91 A;  3SVM A;  4OL7 A;  2CWA A;  4ZCK A;  3J7A 5;  2LMC B;  5C3W A;  4R8I A;  2K5Q A;  4GN4 B;  1PRT C;  1STA A;  3MHB A;  4CHT B;  1F2Y A;  2NTS A;  5C3X A;  2P5Z X;  2C9O A;  2Y0S B;  5E4X A;  1NUC A;  1L1O A;  1STB A;  3HKZ B;  3PSI A;  3R8B A;  1HNZ Q;  4XTC S;  1IKM A;  3DEO A;  2QCP X;  4KLK A;  2OQ0 A;  2ZT9 C;  3PQI A;  1Q81 C;  1SE2 A;  1H9K A;  4AYB G;  4BBR H;  3W5O A;  4JI0 Q;  3F2C A;  4HSV A;  1UE1 A;  1LTB D;  2PQA B;  2XRQ D;  2SDF A;  5FLM H;  3J81 E;  1L0Y B;  1VQ7 A;  4GZY C;  1G6P A;  1Y14 B;  1Q12 A;  2AQ2 B;  4RMF A;  2F1M A;  3IAY A;  5C5L A;  1PH7 A;  3GTL B;  2WII B;  1UAP A;  5IWA Q;  4HJ8 A;  2UXC Q;  1I50 B;  3RR5 A;  5JEA G;  2EYL A;  3GTM H;  3S2D B;  1S5D D;  3GV6 A;  3HOY G;  3QR8 A;  3HOW H;  2BE5 C;  4LUO A;  1B1Z A;  2E2H B;  4PG3 A;  1LT6 D;  5FO8 B;  2R7D A;  1Q90 A;  2EJM A;  4CKE A;  5EPJ A;  4G57 A;  4C2M B;  2QGQ A;  3GTQ B;  3L2P A;  4UP7 A;  1Q7Y C;  2OTL A;  3PIP 3;  1HNX Q;  3BDC A;  4ZQ3 A;  4IN3 A;  3UDX A;  3KLS A;  3I4M H;  5F2D A;  1PH8 A;  2N3S A;  2R6G A;  1ZKO A;  1HZA A;  3FKI B;  5JJL A;  1E24 A;  4A3E H;  4B3T L;  3GTJ H;  5D3D A;  3H3V C;  1W3S A;  2WAC A;  3UDG A;  4AYB E;  2EZV A;  1J5E L;  4LF5 Q;  4C3H G;  1FYC A;  5HGQ A;  2HT1 A;  5EBD A;  1NY4 A;  1YJW A;  5A2Q L;  4FYD A;  1VMP A;  4J8Q A;  1Z7T A;  4X62 Q;  3I4O A;  1DCZ A;  4KN4 C;  4DK3 C;  5BR8 L;  1PH1 A;  1CSP A;  1K83 H;  4X6A H;  3FDT A;  5IY0 A;  3MC0 B;  1PTO H;  1P8L A;  2PMZ E;  4GLA C;  1JWM D;  1H95 A;  1G8Z D;  3D4R A;  2EY2 A;  4QJF A;  2OTJ A;  1GUG A;  1HZC A;  3D6W A;  5FJ8 G;  1VF7 A;  1HJP A;  3U4V A;  1GUN A;  3MXG A;  5LMU Q;  4M8A A;  5IP7 H;  4GN5 A;  2F0D A;  4QGU A;  1JB3 A;  4QMG A;  2F0U A;  3IKJ A;  5I6Y A;  4BXX G;  4A4I A;  4OWT B;  4DR3 Q;  4CDC C;  1TWC H;  5GQO A;  1K8G A;  1EIF A;  2DN8 A;  2QKI C;  1Q3L A;  5DEH A;  2N49 A;  5JEA H;  3A55 A;  3A54 A;  3HOY H;  1K3B C;  3BVG A;  2IW3 A;  2F0M A;  4GNX C;  3RLO A;  2SEB D;  1CKN A;  3S16 B;  2EQS A;  2FJ2 A;  4C56 C;  2B39 A;  3CD6 A;  3KBG A;  4QIW E;  3WOE A;  1QVC A;  2Q2U A;  4FDB A;  3HOV B;  3OW7 A;  4L63 B;  4BBS G;  3BVZ A;  1G2T A;  4Q5V A;  2I5L X;  4LF9 L;  4A3B G;  3C1F A;  3PIO A;  5CGK A;  1HR0 W;  2K03 A;  1S5C D;  3RZO H;  1X3F A;  3GTG B;  4R4Q A;  2R93 G;  2F3W A;  4IQZ A;  1EQV A;  1T5E A;  2KVM A;  5M9O A;  4C3H H;  2K28 A;  3Q22 A;  3HP3 A;  4JW0 A;  2ATW A;  1PH4 A;  2KHJ A;  2ZM6 L;  3I2Z A;  2IX0 A;  3MZ5 A;  4QCL A;  4DV0 Q;  3TEH B;  5C4X B;  3WWV A;  1I3Q B;  2XWB B;  1YNJ C;  1LT4 D;  4CJ0 B;  3T13 A;  4DUZ Q;  4I65 A;  3UE1 A;  4DV7 L;  4DV6 L;  1O7Y A;  4O2D A;  4X65 L;  4C3J G;  5KYI A;  2JN4 A;  3I4L A;  2O5J C;  5FLX E;  1EY0 A;  4ZUJ A;  2MO0 A;  3BYY B;  1SMY D;  1JJC B;  1ENC A;  3A56 A;  4OGQ C;  4XYO A;  5KGU A;  2PNR C;  3K5N A;  4WOR A;  4JOI C;  2YV5 A;  1Q86 C;  1QJO A;  2D0P A;  1C48 A;  5FJ8 H;  3L3O C;  4IFD G;  4A3L G;  2CH4 A;  1F9P A;  1NMF A;  2JYO A;  4NXN L;  4ILW A;  3TDQ A;  3VR4 A;  1WTP A;  3NTI A;  1E2V A;  4OWW B;  1UE6 A;  3IL8 A;  1A3T A;  3HOZ B;  4BXX H;  4GOP B;  5EGT A;  5CMD A;  2EYO A;  4K6D A;  1WFQ A;  3OOC A;  1STG A;  1CSQ A;  4ZKC B;  2XNA C;  1LTG D;  1EIY B;  4XQQ A;  2HDL A;  1GHJ A;  1LTT D;  3K5M A;  2ZXP A;  1YEZ A;  1CT1 D;  4U68 A;  3STB D;  4IOA A;  4YY3 Q;  2KEE A;  4HJ7 A;  1IBK L;  4DV5 L;  4J6H A;  1L1O C;  1B3Q A;  3I4N H;  5IYB G;  3HZX A;  2JA6 G;  4FP5 D;  2MNA A;  1W2B A;  2EIF A;  4YHH L;  3AQQ A;  1SE3 A;  3G7L A;  4BBS H;  1HFG A;  1I4X A;  5IGE A;  1HUM A;  5C6A A;  4A3B H;  4KHP L;  1YBY A;  2EVB A;  2G5D A;  3K8A A;  3Q6S A;  3OTO Q;  1GUO A;  1G29 1;  3J81 c;  1KQS A;  5C0X J;  4K6L A;  2R93 H;  3K58 A;  2ICI A;  1I4R A;  3WOF A;  4LF7 Q;  1MSG A;  1KAW A;  1D1K A;  1DOK A;  1FR3 A;  4LF8 L;  1KDA A;  2CW0 C;  1EWH A;  1NBW A;  1YZ6 A;  3PO2 B;  2KCN A;  1NR2 A;  3W1G A;  3ICE A;  2JA8 B;  4C3J H;  3FP9 A;  1UE5 A;  1WD0 A;  2QDL A;  4JI1 Q;  3W1B A;  2JA5 B;  1HH2 P;  4MZ9 A;  2BDN A;  3AFP A;  3KF6 A;  2RDH A;  2NVX B;  4MNO A;  1YVC A;  1STE A;  1QG7 A;  1XWE A;  1RD9 D;  4IFD H;  3S24 A;  2A5H A;  2Z4I A;  1IBL Q;  4A3L H;  1O7L A;  1CK1 A;  3ZYY X;  2J0T D;  2HD3 A;  5NUC A;  1FNV A;  1QCB D;  2K5H A;  1YNN C;  3DMU A;  3KUP A;  2D2C C;  1VQD A;  5E7N A;  2RDF A;  4EGV A;  4BS9 A;  1TWH H;  2LKV A;  1GXD C;  1VQE A;  5IYC G;  4HTH A;  1EQR A;  3GDE A;  3RZD H;  1FNW A;  3PUY A;  4KY7 A;  2NVY H;  2VUM H;  1PYS B;  2F3V A;  2CKZ B;  4DKA C;  3FRP B;  4A3C G;  5I2Y A;  3F2D A;  2JEA I;  5DM7 3;  4RG1 A;  1L0W A;  2HIV A;  1JWS D;  3P7J A;  1U4M A;  2EYF A;  3AEV A;  5IYB H;  4A3G G;  2JA6 H;  1AP0 A;  5FOB B;  3NEL A;  1SNQ A;  1DOM A;  1I6V C;  1AEX A;  2E76 C;  3S17 B;  4WJ3 M;  1EU4 A;  4J1M A;  3C3L A;  4RWS C;  3WDN A;  3F8T A;  1J9O A;  4RGT A;  5D14 A;  4A3J G;  1TWG H;  1L2F A;  4ZLT F;  5C3E H;  3SK5 A;  5CV9 A;  4NW2 A;  4UY8 C;  4NKL A;  3U50 C;  3K0Y A;  4R4C A;  4JI6 Q;  2MJ8 A;  3NBI A;  2NZ1 D;  3NQT A;  1EIH A;  2XSC A;  1VQG A;  4XXE A;  1HNZ L;  1VQ6 A;  2VB2 X;  4A3D H;  1KLU D;  3GD7 A;  1AZP A;  4JI0 L;  4EQO A;  3S14 B;  1NR4 A;  4R4O A;  1YHB A;  3Q24 A;  5C0X I;  4EQ5 A;  4DV3 Q;  4CDD C;  3LNN A;  2YTV A;  1NCV A;  2KJX A;  5IWA L;  2PQA A;  3P75 A;  4BBR B;  2UXC L;  2WAQ B;  1XYI A;  1XXG A;  1KTK A;  4EVO A;  4B3R Q;  1EEF D;  1ZYR C;  3H3V H;  5IOC A;  2BA0 A;  3MEF A;  2RF4 A;  4PNY A;  1GJX A;  3E5S A;  4R4T A;  1X54 A;  3K57 A;  2PCF B;  3HOW B;  4IUT A;  4R1J A;  1HNX L;  4IFD I;  1CQF A;  5IYC H;  2HHH Q;  4F88 A;  1WD1 A;  1AH9 A;  4NXM Q;  3C2P A;  2PZU A;  1V8Q A;  2RSN A;  3KF8 B;  3G71 A;  2JXM B;  1BR9 A;  4X3U A;  1DOL A;  4NMZ A;  4N8X 1;  5FLX c;  5M3F G;  3ULL A;  1Q46 A;  2E2I H;  3BDL A;  4JK1 C;  4PZ6 A;  4LF5 L;  4I7A A;  2ALY B;  3NK9 A;  3CC7 A;  3LX0 A;  1GD7 A;  4A3G H;  3I4M B;  1EWC A;  1AFP A;  3G48 A;  5CV8 A;  2K5D A;  5HUR A;  3DM3 A;  4X62 L;  1MGS A;  2AQ3 B;  4KTA A;  2L5T A;  5EJW A;  4A3E B;  3VDY A;  1N32 Q;  2X69 A;  2AQ1 B;  3GTJ B;  4ODG A;  2RHS B;  2K6A A;  1IYV A;  4WJ4 A;  2R7F A;  3TSS A;  2GVB A;  4RKL A;  3R2T A;  2VL6 A;  3VYT A;  3LWU A;  4KY6 A;  1FGU A;  4RHR A;  1K83 B;  4YIJ A;  1X32 A;  2KBN A;  2UUC Q;  1A63 A;  5LMU L;  2VY3 A;  1TWA H;  5JOB A;  2Q2H A;  1VQI A;  2LY7 A;  3E3X A;  1C4Q A;  1CZW A;  2PI2 E;  2F0K A;  1ET6 A;  1RL2 A;  1I4P A;  1W6K A;  4DR3 L;  1Z6H A;  4IJH A;  1PTO D;  1TII D;  5C4Z A;  3EBE A;  3J80 E;  4XT3 B;  3A7A B;  3AFQ A;  4RKB A;  1BCP D;  5ISR A;  4CDE C;  3L7Z C;  1B4O A;  3T51 B;  1B7Y B;  4ZRZ A;  1SYD A;  5J3B A;  2ENB A;  4QQB X;  1K0R A;  1EWI A;  1SR3 A;  2PMZ B;  4RCO A;  3TP6 A;  2Z6K A;  3HOY B;  3Q0A A;  1D5X C;  4ZK9 B;  1PLF A;  2DUD A;  1VQB A;  2VQE Q;  1VF5 C;  3Q8D A;  1S5B D;  4KD3 A;  5D65 A;  4IZ8 A;  5I9O A;  5C4J H;  1QZG A;  3G4S A;  4JPB W;  2X6G A;  1BBX C;  3S2H H;  1J6Q A;  4LAA A;  2RDG A;  3I56 A;  1QUQ B;  1MJC A;  4V0B A;  1V43 A;  4DNT B;  4FF2 A;  1JOR A;  1S40 A;  3UDI A;  4HIM A;  2GVA A;  1LTI D;  4DV0 L;  2EYP A;  4DUZ L;  1E1O A;  1HR0 Q;  3RZO B;  4LF6 Q;  2ZTD A;  3E6Z X;  2SNS A;  5J22 A;  1SNC A;  2UUB Q;  4KJN A;  1CUK A;  3F2B A;  1BKB A;  2EJG C;  4A3M G;  1JT8 A;  4OEL B;  2E2D C;  4OO1 H;  3CCM A;  1N8R C;  3M7G A;  2F0N A;  2I0Q A;  3J7A F;  3M3Y B;  2XN9 C;  2R92 H;  2MGS A;  1EY8 A;  3H15 A;  4HCE A;  4BA1 I;  1HZ9 A;  4RFB A;  1A3U A;  1JMC A;  4DAM A;  2HCI A;  4PMW A;  1F2Z A;  4IJL A;  4G7H C;  1V1P B;  4DUY Q;  1VQ8 A;  5A35 A;  4DR5 Q;  4GOP A;  2JSO A;  1GKH A;  1ASZ A;  2A6E C;  2MFI A;  4DAP A;  3QIA A;  4YY3 L;  4J15 A;  3GTP B;  3K7A H;  1WTV A;  1Y1W H;  3LWE A;  3I72 A;  5FO7 B;  4HR7 B;  3VR2 A;  5CBA E;  1ENA A;  4OIJ A;  1NAP A;  3UE0 A;  2F0L A;  3DEP A;  4N8F A;  1XNR Q;  4DGZ A;  3A5U A;  3OTO L;  3TN2 A;  4A93 G;  3NE5 B;  3BS1 A;  1R9T B;  1D5Z C;  2UXD Q;  4LF7 L;  3A8J E;  4DR1 L;  3D8G A;  1K9M C;  4BBS B;  5IGC A;  5IT9 c;  1KD1 C;  2K1B A;  1A62 A;  4JI3 Q;  3I7F A;  4A3B B;  1N33 Q;  2PO4 A;  4JI8 Q;  1K73 C;  3TRZ A;  2F3I A;  2PW5 A;  4KKT A;  1VQ9 A;  2WKC A;  5IP9 G;  2R93 B;  1SNM A;  3H91 A;  1RTO A;  4E6I A;  1YI2 A;  4KI0 A;  1IW7 D;  1CQV A;  4YWL A;  4ULL A;  2L0C A;  4JI1 L;  3M9B A;  4XIG S;  4A3M H;  2LXJ A;  3SR1 A;  1MBY A;  5DAU A;  3TZU A;  4GKJ Q;  2JA9 A;  1Y8N B;  1WTX A;  2A6H C;  1ROD A;  5IP7 G;  1PFN A;  3TQY A;  1IBL L;  1XPU A;  1GUW A;  4HAE A;  1C8C A;  2EDG A;  3CCE A;  1B8A A;  1XNQ Q;  3HGB A;  3SE0 A;  3F1Z A;  1BOS A;  1CHP D;  3RN5 A;  1PH5 A;  1H9S B;  2JQO A;  2K33 A;  2QIL A;  3NPP A;  3OWF A;  5JVG 3;  3A0J A;  2ZTE A;  3FHW A;  2BH2 A;  1T5X D;  1HA6 A;  4CBV A;  3S1R H;  2D62 A;  5T1G A;  4B9X A;  5IGF A;  1I5F A;  1MIU A;  4ME5 A;  4C3I G;  5G3L D;  1EY5 A;  5HGT A;  2EY5 A;  1II3 A;  2DY7 A;  3AMU A;  1TWH B;  3EA6 A;  4B08 A;  4LFA Q;  4L5R C;  1JOQ A;  3J81 j;  1Y69 U;  3RZD B;  5EKK A;  2IT1 A;  3I91 A;  5IGG A;  4IPC A;  5M3M G;  2CWP A;  2JA7 B;  1Z9F A;  3M4O H;  3G6J B;  2DJG C;  3IFT A;  4A93 H;  1B70 B;  5DNF A;  4HID A;  5JPN C;  5LL6 S;  3BZK A;  4XYQ A;  3H0G H;  2JA6 B;  4EQN A;  3K7U C;  3A5Z B;  1QNU A;  4JI6 L;  5EKL A;  3J80 c;  2PPB C;  4QL5 A;  5KNB A;  4QUF A;  1SN8 A;  2D0O A;  3RMH A;  2BOS A;  3UDF A;  5M5Y B;  5IP9 H;  1RIP A;  3VA7 A;  1VQA A;  3NEN A;  4X64 Q;  2NVT B;  3CKI B;  2LSS A;  1PH6 A;  1VQ4 A;  4DV3 L;  1QVF A;  2Z6K C;  3BVM A;  4JYA Q;  3V05 A;  1MHW C;  2L12 A;  3HEJ A;  2AUJ D;  2Z4H A;  1VQF A;  3K81 C;  5T1I A;  2KHI A;  4K5W A;  3VYR A;  4BY1 B;  4B3R L;  1F9S A;  2UUA Q;  2BE5 D;  2WFW A;  3P1H A;  1SFO B;  1F9R A;  1JE5 A;  5GAH C;  3PUX A;  1TT2 A;  5EBC A;  3GTO H;  5JEA J;  1IL2 A;  3VR3 A;  2NZO A;  1QWY A;  2I5H A;  4PZ7 A;  1EL0 A;  2HQL A;  4KJO A;  1LYL A;  2HHH L;  3VYS A;  1R4P B;  4JI5 Q;  2L11 A;  5AJ3 Q;  4NXM L;  4C3I H;  2IY5 B;  3OSO A;  1QIL A;  1A15 A;  2DNC A;  4AH6 A;  1CKO A;  2ASB A;  3I4N G;  3EFX D;  3S15 B;  4GN3 B;  2YYZ A;  1EYC A;  1A3V A;  5KNC A;  1N34 Q;  4ALP A;  1HFN A;  4JBK A;  4OX9 Q;  1N36 Q;  5M3M H;  2VB3 X;  3NEM A;  4MIU A;  1N32 L;  2E2I B;  2OCE A;  3PUW A;  3U58 A;  5I6W A;  4A3G B;  4LFC Q;  1XMQ Q;  1BBW A;  2Z8L A;  1XMO Q;  3OIP A;  5BN5 A;  2H1E A;  4K2K A;  3SDZ A;  2HDM A;  3W2D A;  4IUN A;  4GOP C;  4A3J B;  2UUC L;  4BY7 H;  4KMU C;  2BH8 A;  4HED A;  4LUZ A;  2G9D A;  1H9J A;  1HCZ A;  4MN3 A;  1KNA A;  2L1B A;  2QA4 A;  2EJF C;  3NTH A;  2A68 C;  5LHY 1;  5IGD A;  1LTS D;  1ET9 A;  4AQY Q;  1KDB A;  4DR6 Q;  1SYC A;  1LT3 D;  3L0O A;  5KIX A;  1E2Z A;  1EUJ A;  4CJ2 C;  3T16 A;  2ZJR A;  1Q82 C;  4MTN A;  5K36 G;  3NTK A;  1SYB A;  2CH4 W;  4CJ1 B;  1DD2 A;  2KOL A;  4RH6 A;  3QG1 A;  2QEJ C;  4P74 A;  4K5X A;  1X3P A;  3A8K E;  2EPB A;  1HZB A;  2O5I C;  1IZ6 A;  1QOH A;  2WIN B;  1K8M A;  3T53 B;  4PMC A;  5EPL A;  4X3T A;  2K7V A;  1Y1V G;  2VQE L;  2VUM G;  3J81 L;  2PNH A;  1YHQ A;  1I6H B;  2PZT A;  1SBB B;  3K0X A;  1N9W A;  2HQE A;  3I70 A;  2Q2T A;  2R61 A;  1F2L A;  1YHA A;  3NQI A;  2IL8 A;  3U9O A;  3R2I A;  4DV1 Q;  4DNI A;  1RJT A;  3M7N A;  1PYB A;  3ULJ A;  1YNJ D;  1LM0 A;  2JEB I;  4F8M A;  1QUQ A;  1HR0 L;  5M3F B;  1QE6 A;  4A3K B;  3C46 A;  2Y0S E;  4YWM A;  4LF6 L;  5M5X H;  1C0A A;  4NDX A;  4X3S A;  5C3E G;  1WTR A;  1E1T A;  2NUC A;  2UUB L;  1JB7 A;  2NVQ H;  3NUC A;  4DAY B;  3S1N B;  2XIW A;  1A2T A;  3CC2 A;  1GUT A;  2B8F A;  4A3D G;  1J8I A;  1HQR D;  2MUY A;  3QO2 A;  5FKA C;  1F77 A;  1C9O A;  1D7Q A;  2IHF A;  4DA2 A;  4L5S A;  2K75 A;  5TSS A;  4ABN A;  2EY6 A;  3TRE A;  4IFD J;  1TQO A;  1SYF A;  2Z9H A;  2LXK A;  1CA5 A;  1IXR A;  3CW2 C;  2B3G A;  1PFB A;  3GTK H;  4DUY L;  2PW7 A;  1V1O A;  3F2U A;  1PFS A;  3IFD A;  1VS0 A;  4DR5 L;  5K36 H;  4A3F G;  2TSS A;  3NP8 A;  1PA6 A;  1K28 A;  4CKC A;  5GAG C;  1V1P A;  2I5M X;  4CDF C;  3I8Z A;  4FVM A;  2XGT A;  1SYG A;  1KAA A;  1SMX A;  2KCT A;  5GAD C;  3GTL H;  3OPO A;  2KCM A;  1I50 H;  1Y1V H;  3S2D H;  2R7Z G;  5C44 G;  2I46 A;  3JAM i;  1XNR L;  1BDO A;  2FHT A;  2OT2 A;  4S3S A;  3HOX G;  3D4W A;  2E2H H;  1FD7 D;  2NZH A;  3TP7 A;  2UXD L;  3E9I A;  1Z47 A;  2K5W A;  2NTT A;  2FMC A;  1EFW A;  5JVH 3;  1VQO A;  4C2M H;  2L15 A;  4K0K Q;  3GTQ H;  1GUS A;  2CW0 D;  5LMN W;  4DR4 Q;  4JI3 L;  1S5E D;  1M90 C;  1N33 L;  4Y7N H;  4JI8 L;  1VCI A;  3BZD B;  2KEN A;  1BF4 A;  3NWT A;  2BDO A;  1XX8 A;  2IX3 A;  4MTK A;  1XTD A;  3EJI A;  3ER0 A;  3H6M A;  4QF4 A;  4R9W A;  1TVX A;  4RCN A;  1K8O A;  1IL8 A;  1OXT A;  1TS5 A;  2VXW A;  4LWC A;  4GKJ L;  3CP0 A;  2RKS A;  3DWQ A;  4RA8 A;  2QW7 A;  3PIP A;  3K5L A;  4G4K A;  5DLQ E;  1XNQ L;  2GN5 A;  2A69 C;  4A3M B;  1ML0 D;  1YNN D;  2X6L A;  4P2C B;  3BDO A;  1PDQ A;  3KOJ A;  1Y8O B;  1E3P A;  5IT9 E;  4IUV A;  4QY7 A;  3CCL A;  2VW9 A;  1S3O A;  5FLX L;  2RQX A;  1AE3 A;  4A3F H;  2UU9 Q;  2ID0 A;  4RAU C;  2WP8 J;  1WJJ A;  1WCM G;  4JBW A;  1KL9 A;  2OWO A;  3GTM B;  3S1R B;  1YIJ A;  4LFA L;  2F4V Q;  2ZJQ A;  2KQ3 A;  5IYD G;  3R3O A;  4JI4 Q;  2JJQ A;  1C7Y A;  1I4H A;  4H0L C;  2R7Z H;  5C44 H;  4KY5 A;  4NP5 A;  4C1N I;  4QB4 A;  4DR7 Q;  3HOX H;  2V1C C;  5ELD A;  5CV7 A;  3KDF B;  3PO3 G;  3S16 H;  4TVA B;  1DM0 B;  1E22 A;  3K5O A;  4OEM B;  1CKN B;  3M4O B;  2FIN B;  3J7Z C;  1NE3 A;  4A93 B;  2KHS A;  3JAM E;  4RGO S;  2C5C A;  2SNM A;  4RGM A;  1K3R A;  3RUZ A;  1O7I A;  2EYJ A;  3ERS X;  2XVS A;  4X64 L;  4FF3 A;  3GTG H;  1I4G A;  3PF5 A;  1I4Q A;  3SEB A;  4OO1 G;  3BZC A;  4JYA L;  1RHP A;  3E0J A;  1YJ9 A;  3V96 A;  1JR0 D;  3AYH B;  2E75 C;  4KHZ A;  4GLX A;  1MKH A;  3RLN A;  3I3C A;  5C4X H;  5IIF A;  4G7O C;  2R92 G;  1PTO B;  1U4L A;  1EY6 A;  2UUA L;  2JA8 G;  1ONL A;  3CRL C;  2Z0S A;  2IPK D;  3ERO A;  1BCP B;  3TS2 A;  3PF4 A;  1HTP A;  4N9P A;  3TP8 A;  4IUU A;  2NN6 H;  3MVV A;  1JQY D;  4AYB B;  3ND9 A;  4FXG C;  3TME A;  1E0B A;  4JI5 L;  5AJ3 L;  2NBF A;  2M9V A;  1GM5 A;  1TWC B;  2A8V A;  3CQZ H;  1ENF A;  3BG3 A;  2K01 A;  1WCM H;  1KXL A;  3I73 A;  2F0S A;  1Y1W G;  2K4K A;  1FJG Q;  1RF2 D;  4TQU S;  2CVR A;  2LS0 1;  5IYD H;  1G2S A;  3AU7 A;  2E5L Q;  3J7A V;  1N34 L;  4C1N K;  3H3V I;  4OX9 L;  3DWA A;  1N36 L;  4JBM A;  1EU3 A;  1EZ6 A;  1JWU D;  2B2W A;  1AW7 A;  1D5M C;  1RCV D;  5ELC A;  5I9P A;  1TXY A;  3PO3 H;  3PUZ A;  4LFC L;  1XMQ L;  1WTO A;  1U4R A;  1XMO L;  4F87 A;  3MXN B;  5M3M B;  4GKK Q;  1HNW Q;  4EX5 A;  1HUN A;  1GHK A;  2F0W A; 
#chains in the Genus database with same CATH homology
 5M5Y H;  3K80 C;  4A3L G;  2NN6 G;  4LFA Q;  4DR2 Q;  1NMF A;  4NXN L;  2NVT H;  4HIK A;  4L5R C;  3J81 j;  3PUV A;  2IT1 A;  4IO9 A;  4IPC A;  4OWW B;  1UE6 A;  3J80 i;  5M3M G;  2CWP A;  2B29 A;  3HFZ B;  5BR8 Q;  1Z9F A;  3M4O H;  4BXX H;  4GOP B;  4POG A;  1MJE A;  1YNX A;  4BY1 H;  1WFQ A;  4A93 H;  4YCW A;  1B70 B;  4HID A;  4AQY L;  1CSQ A;  4DR6 L;  3BZK A;  5ELN A;  1IYJ B;  1UEB A;  3H0G H;  1SFO H;  1EIY B;  3K7U C;  1KIX A;  3A5Z B;  3PO2 H;  3T1Y Q;  4JI6 L;  3G6E A;  3HOZ G;  1X65 A;  1YEZ A;  1X55 A;  3STB D;  2JA8 H;  4IOA A;  3J80 c;  4YY3 Q;  4QL5 A;  4HJ7 A;  1IBK L;  3KFU A;  4DV5 L;  1SN8 A;  2D0O A;  1L1O C;  4HJ5 A;  3I4N H;  2MO1 A;  3CAM A;  5IYB G;  2JA6 G;  3UDF A;  5IP9 H;  1RIP A;  2MNA A;  1W2B A;  2EIF A;  2E8G A;  4YHH L;  1VQA A;  3AQQ A;  1XPR A;  3TS0 A;  3NEN A;  4X64 Q;  4BBS H;  1VQH A;  1IBM Q;  2LSS A;  1PH6 A;  1VQ4 A;  4A3B H;  4KHP L;  3OW2 A;  1YBY A;  4DV3 L;  3K8A A;  3OTO Q;  4IOC A;  1QVF A;  2Z6K C;  2VZA A;  4JV5 Q;  3RLF A;  1M1K C;  2YTY A;  4JYA Q;  1G29 1;  3J81 c;  5LMN L;  3S15 H;  4DV4 L;  1KQS A;  1JJ2 A;  5C0X J;  3PV0 A;  2R93 H;  1VQF A;  3K81 C;  4LF7 Q;  2KHI A;  3HOV H;  4B3R L;  1T9H A;  3GTL H;  2UUA Q;  1KAW A;  4LF8 L;  2DGY A;  2WFW A;  1NBW A;  4DV1 L;  1PH2 A;  1JE5 A;  4A3K G;  4A3C H;  1YZ6 A;  1X3G A;  3PUX A;  2EXD A;  5GAH C;  3GTO H;  5JEA J;  3W1G A;  1EQQ A;  2BA1 A;  4A76 A;  1IL2 A;  3ICE A;  1PHJ A;  4C3J H;  4DV2 L;  4JI7 L;  2NZO A;  3FP9 A;  2UXB L;  1UE5 A;  3BU2 A;  4LF4 Q;  2I5H A;  4JI1 Q;  4PZ7 A;  3S1Q H;  2HQL A;  3W1B A;  1HH2 P;  1LYL A;  4MZ9 A;  3H0G G;  2HHH L;  4LF9 Q;  4LFB Q;  4UP8 A;  1V1Q A;  3AFP A;  3PCO B;  1I3Q H;  2HIX A;  3KF6 A;  5AJ3 Q;  4JI5 Q;  3CPW A;  4NXM L;  3PO2 G;  3U4Z A;  4C3I H;  2IY5 B;  4MNO A;  4YCU A;  1YVC A;  2F52 A;  4JI2 L;  4YCV A;  2JK8 A;  4A3J H;  1V9P A;  1Q1E A;  3S24 A;  1X6O A;  4AH6 A;  1CKO A;  1IBL Q;  4A3L H;  2ASB A;  3I4N G;  2ZM6 Q;  2JA5 G;  4GN3 B;  2N78 A;  4K0K L;  2YYZ A;  1VQP A;  2B63 G;  3D31 A;  2K5H A;  4GLV B;  1N34 Q;  3CME A;  1TWF H;  4ALP A;  1GO3 E;  4DV6 Q;  4DV7 Q;  1N36 Q;  5M3M H;  4JBK A;  1VQD A;  4NB3 A;  4X65 Q;  5E7N A;  2JE6 I;  3T1H Q;  4BXX G;  3NEM A;  4L5T A;  1TWH H;  1SE8 A;  4R4I A;  1N32 L;  4X6A H;  1VQE A;  2OCE A;  5IYC G;  1EQR A;  3PUW A;  4OXP A;  2H5X A;  3GDE A;  3U58 A;  1KHI A;  2RHQ B;  3RZD H;  4LFC Q;  1XMQ Q;  4B3M Q;  1BBW A;  3PUY A;  2VQF L;  1XMO Q;  2NVY H;  3KYH C;  2VUM H;  1PYS B;  2E2J H;  2CKZ B;  4DKA C;  1FL0 A;  4P73 A;  4AIM A;  2ES2 A;  2YU9 H;  3HOZ H;  4A3C G;  3F2D A;  2JEA I;  4RG1 A;  1L0W A;  1WOC A;  2HIV A;  1A0I A;  4GOP C;  1LUZ A;  2UUC L;  3M85 A;  4NXN Q;  3A74 A;  3S14 H;  4UP9 A;  4BY7 H;  1XJV A;  5IYB H;  3AEV A;  2JA6 H;  4A3G G;  4OO1 I;  3NEL A;  2BH8 A;  4IPG A;  4LUZ A;  3S1M H;  1NJI C;  1I6H H;  4P72 A;  2N8N A;  2QA4 A;  4WJ3 M;  3F8T A;  3JAM c;  1D8L A;  1BVS A;  4A3J G;  1TWG H;  1UE7 A;  4AQY Q;  1L2F A;  4DR6 Q;  5C3E H;  3L0O A;  1DGS A;  1EUJ A;  4UY8 C;  3U50 C;  2ZJR A;  3CPF A;  2FXQ A;  1Q82 C;  3CC4 A;  1Q1B A;  4MTN A;  1X56 A;  4R4C A;  4JI6 Q;  5K36 G;  3RNU A;  4P74 A;  4X66 L;  1VQG A;  2Q2I A;  5M3F H;  4A3K H;  1IBK Q;  4DV5 Q;  1HNZ L;  1VQ6 A;  4P71 A;  4L5Q A;  4APV A;  4A3D H;  3HOU G;  1HZB A;  4DR4 L;  3B6Y A;  3GD7 A;  1IZ6 A;  4JI0 L;  4YHH Q;  2VNU D;  1S72 A;  2WB1 G;  3S1N H;  4R4O A;  1YHB A;  4KHP Q;  5C0X I;  3KLW A;  1Y1V G;  4EQ5 A;  4DV3 Q;  2VQE L;  2VUM G;  2A19 A;  2PNH A;  2YTV A;  1YHQ A;  4P75 A;  5LMN Q;  4GNX A;  3K0X A;  5IWA L;  2PQA A;  4DV4 Q;  1N9W A;  2UXC L;  1A8V A;  2K50 A;  3J81 i;  2Q2T A;  4B3R Q;  1YHA A;  4A3I G;  4BY7 G;  2JA5 H;  4LF8 Q;  3H3V H;  4DV1 Q;  1I94 L;  2B63 H;  1PV4 A;  2BA0 A;  3MEF A;  4DNI A;  2NVX H;  2RF4 A;  2K52 A;  3M7N A;  1PYB A;  4BBR G;  2AWO A;  2WAQ G;  1OXS C;  3ULJ A;  4R4T A;  2JEB I;  1LM0 A;  1OXX K;  1X54 A;  2K14 A;  3KF6 B;  1QUQ A;  3NBH B;  4DV2 Q;  1EYG A;  1X9N A;  1HR0 L;  2AWN A;  4JI7 Q;  2UXB Q;  2Y0S E;  4YWM A;  5FLM G;  4LF6 L;  4R1J A;  5M5X H;  1HNX L;  5IYC H;  3I55 A;  5C3E G;  4IFD I;  1C0A A;  2HHH Q;  1E1T A;  3CCV A;  2UUB L;  1JB7 A;  4DK6 C;  1AH9 A;  4NXM Q;  2NVQ H;  2NN6 I;  4GS3 A;  4DAY B;  1PH9 A;  3G71 A;  1OXU A;  3KF8 B;  4O0A A;  2AKW B;  4JI2 Q;  1Q8K A;  3KJO A;  1CKM A;  5FLX c;  5M3F G;  1ASY A;  2UU9 L;  3CC2 A;  3PGZ A;  3ULL A;  4B3S L;  4A3D G;  1Q46 A;  3HOW G;  4UPA A;  2E2I H;  3GO5 A;  4PZ6 A;  5IE8 A;  4LF5 L;  3IRB A;  2MQH A;  2ALY B;  5ELO A;  1D7Q A;  1C9O A;  3CC7 A;  1GD7 A;  2PI2 A;  1VQC A;  4A3G H;  3G48 A;  2IHF A;  4L5S A;  2WB1 E;  2F4V L;  2K75 A;  2CQO A;  4PZ8 A;  4IFD G;  3DM3 A;  2CFM A;  4X62 L;  4JI4 L;  1G51 A;  2VS1 A;  3TRE A;  4IFD J;  3VDY A;  1N32 Q;  1LTL A;  2RHS B;  4JOI A;  2LXK A;  4LNQ A;  2ZJP A;  4DR7 L;  1U0L A;  4WJ4 A;  1IXR A;  3CW2 C;  2B3G A;  2R7F A;  3I4M G;  5JJI A;  2GVB A;  3GTK H;  3CXC A;  4DUY L;  2VQF Q;  3BJU A;  1PFS A;  3S17 H;  1VS0 A;  4DR5 L;  2VL6 A;  4A3F G;  1JJG A;  4JBJ A;  4A3E G;  1PA6 A;  4JG2 A;  3JC6 6;  1OTC A;  1XPO A;  5GAG C;  4OON A;  2I5M X;  1FGU A;  3SGI A;  2WAQ E;  4Y52 H;  2KBN A;  3KDF A;  2UUC Q;  3HOU H;  2XGT A;  1A63 A;  1KXL A;  1SRO A;  2KCT A;  4H02 A;  1SMX A;  3DLL A;  5LMU L;  2VY3 A;  1TWA H;  5H1S E;  1VQN A;  2Q2H A;  3LGJ A;  1KRS A;  5GAD C;  1VQI A;  4IPD A;  2AHO B;  3D0F A;  3CCS A;  2KCM A;  2YTX A;  2CCZ A;  2PI2 E;  1YJN A;  1PH3 A;  1KRT A;  1I50 H;  1RL2 A;  1Y1V H;  4YWK A;  3S2D H;  2R7Z G;  5C44 G;  4DR3 L;  3JAM i;  1XNR L;  2CWA A;  4IJH A;  3J7A 5;  4GN4 B;  3HOX G;  5HY6 A;  1NTG A;  3EBE A;  4LUV A;  2OQK A;  3RN2 A;  2E2H H;  2NZH A;  3AFQ A;  4LW1 A;  2UXD L;  1L1O A;  1Z47 A;  3E9I A;  2QEX A;  4A3I H;  1QVG A;  1EFW A;  1VQO A;  3STB C;  3PSI A;  4C2M H;  4X66 Q;  2L15 A;  1HNZ Q;  4XTC S;  1WYD A;  4K0K Q;  3L7Z C;  3GTQ H;  5LMN W;  4KLK A;  4DR4 Q;  4JI3 L;  2OQ0 A;  1Q81 C;  1B7Y B;  1M90 C;  5J3B A;  1N33 L;  4BBR H;  4AYB G;  4QQB X;  4Y7N H;  4JI8 L;  1K0R A;  1VCI A;  3OYY A;  5C0X G;  3W5O A;  4JI0 Q;  2XTI A;  2KEN A;  1SR3 A;  1UE1 A;  2Y0S G;  2PQA B;  3F2C A;  4GNX B;  2Z6K A;  5FLM H;  1YIT A;  1VQ7 A;  1G6P A;  3HKZ G;  1Y14 B;  1Q12 A;  4RMF A;  2DUD A;  1XTD A;  3ER0 A;  5GAE C;  1K8A C;  1VQB A;  2VQE Q;  3M4Q A;  1PH7 A;  3CCR A;  5M5W H;  1FVI A;  3Q8D A;  5IWA Q;  4HJ8 A;  2UXC Q;  5JEA G;  3RR5 A;  1QZG A;  5C4J H;  3S2H H;  3G4S A;  3M3Y H;  3GTM H;  1J6Q A;  1OXT A;  3HOY G;  3HOW H;  4LWC A;  4GKJ L;  3CP0 A;  3I56 A;  1QUQ B;  1MJC A;  4LUO A;  1I94 Q;  1V43 A;  3PIP A;  1FJG L;  4PG3 A;  1S40 A;  1E7Z A;  3UDI A;  4HIM A;  2GVA A;  5DLQ E;  2R7D A;  1XNQ L;  2GN5 A;  4DV0 L;  3M4P A;  1WI5 A;  2E5L L;  4DUZ L;  1E1O A;  1VQM A;  1HR0 Q;  2QGQ A;  2AMC B;  3KOJ A;  4UP7 A;  3L2P A;  1Q7Y C;  1HNX Q;  2ZTD A;  1E3P A;  1OXV A;  2OTL A;  4LF6 Q;  1X3E A;  4JCV E;  1NMG A;  4QY7 A;  2UUB Q;  3UDX A;  3CCL A;  1CUK A;  3F2B A;  3I4M H;  1BKB A;  1PH8 A;  2VW9 A;  2N3S A;  2R6G A;  1S3O A;  4A3M G;  1JT8 A;  1HZA A;  2ZTC A;  1AE3 A;  4A3F H;  2UU9 Q;  2ID0 A;  4B3S Q;  5JJL A;  1E24 A;  4A3E H;  4B3T L;  3GTP H;  4HJA A;  3GTJ H;  1HNW L;  4GKK L;  2WP8 J;  1W3S A;  3UDG A;  4AYB E;  1WJJ A;  3CCM A;  1J5E L;  4LF5 Q;  1N8R C;  1WCM G;  1VQJ A;  4JBW A;  1KL9 A;  4BA2 I;  2I0Q A;  2OWO A;  2R92 H;  2JA7 G;  5HGQ A;  4DR2 L;  2RCN A;  1YIJ A;  4LFA L;  2F4V Q;  2HT1 A;  1NY4 A;  3HKZ E;  5IYD G;  1YJW A;  2ZJQ A;  3H15 A;  3FKI G;  5GRO A;  3EN2 A;  4X62 Q;  2JJQ A;  1C7Y A;  3I4O A;  4JI4 Q;  4BA1 I;  1HZ9 A;  4DK3 C;  5BR8 L;  1R9T H;  1PH1 A;  1VQL A;  1CSP A;  1K83 H;  4DAM A;  5C44 H;  1JMC A;  1XPU A;  2IHE A;  1VQ5 A;  2R7Z H;  1PVO A;  4PMW A;  4DR7 Q;  5IY0 A;  4IJL A;  3HOX H;  2V1C C;  1P8L A;  2PMZ E;  4GLA C;  4DUY Q;  3KDF B;  1VQ8 A;  3PO3 G;  1H95 A;  3ZJY C;  4DR5 Q;  4GOP A;  3S16 H;  4TVA B;  4QJF A;  1E22 A;  3T1Y L;  2OTJ A;  1HZC A;  3CCU A;  5FJ8 G;  1CKN B;  1HJP A;  3U4V A;  3CMA A;  1GKH A;  1VQK A;  1ASZ A;  2MFI A;  3J7Z C;  4YY3 L;  1SLJ A;  5LMU Q;  4J15 A;  1NE3 A;  4DR1 Q;  5IP7 H;  4GN5 A;  3K7A H;  1Y1W H;  4QGU A;  1K3R A;  1O7I A;  3ERS X;  3KJP A;  4X64 L;  4HJ9 A;  3UE0 A;  4OX9 Q;  4A4I A;  4OWT B;  1L1O B;  4DR3 Q;  1TWC H;  5GQO A;  1K8G A;  1IBM L;  1XNR Q;  3GTG H;  1EIF A;  1UWV A;  3PF5 A;  4BY1 G;  2N49 A;  3OTO L;  3A5U A;  4JV5 L;  4OO1 G;  4A93 G;  3BZC A;  4JYA L;  1YJ9 A;  3AYH B;  4KHZ A;  2UXD Q;  4GLX A;  3HOY H;  1QZH A;  3ULP A;  1MKH A;  3RLN A;  2ATW A;  4NPS A;  3CCQ A;  5C4X H;  4LF7 L;  2R92 G;  4DR1 L;  3EIV A;  4GNX C;  2UUA L;  3RLO A;  1U5K A;  3CCJ A;  1K9M C;  5IT9 c;  1KD1 C;  4A75 A;  2JA8 G;  1A62 A;  2Z0S A;  3I7F A;  1CKN A;  4JI3 Q;  1N33 Q;  4OWX B;  2EQS A;  4JI8 Q;  3TS2 A;  1K73 C;  3TRZ A;  2F3I A;  3CD6 A;  3PF4 A;  1VQ9 A;  4QIW E;  5IP9 G;  1QVC A;  2Q2U A;  1EOV A;  1YI2 A;  4FDB A;  4KI0 A;  1SRU A;  4YWL A;  4LF4 L;  4BBS G;  4JI1 L;  2I5L X;  3M9B A;  4LF9 L;  2IX1 A;  4A3B G;  4LFB L;  5JJK A;  4XIG S;  4JI5 L;  2A1A A;  2LXJ A;  5AJ3 L;  3PIO A;  4A3M H;  4ME3 A;  1HR0 W;  4DPG A;  3E0E A;  1GM5 A;  3RZO H;  1X3F A;  4R4Q A;  2R93 G;  4GKJ Q;  2JA9 A;  3CF5 A;  2A8V A;  3CQZ H;  3HOV G;  2K5N A;  4C3H H;  1WCM H;  5IP7 G;  3TQY A;  1Y1W G;  1IBL L;  1BBU A;  2K4K A;  1PH4 A;  2KHJ A;  2ZM6 L;  1FJG Q;  3CCE A;  5EAY A;  3I2Z A;  1B8A A;  2C35 B;  1AE2 A;  4TQU S;  2IX0 A;  1XNQ Q;  2JA7 H;  4POF A;  4DV0 Q;  3TEH B;  5IYD H;  3F1Z A;  3WWV A;  2E5L Q;  3FKI H;  4DUZ Q;  1N34 L;  2K5V A;  3RN5 A;  1PH5 A;  2JQO A;  3UE1 A;  4DV7 L;  4DV6 L;  1N36 L;  4JBM A;  4OX9 L;  4O2D A;  3H3V I;  4X65 L;  3T1H L;  1KC8 C;  3A0J A;  3HKS A;  3E9H A;  2ZTE A;  3FHW A;  2BH2 A;  3S1R H;  2D62 A;  4JC0 A;  4HIO A;  4IPH A;  2MO0 A;  5C4X G;  1JJC B;  1TXY A;  1P16 A;  1I5F A;  3PO3 H;  1GVP A;  1MIU A;  3PUZ A;  4LFC L;  1XMQ L;  4B3M L;  4JOI C;  2YV5 A;  1XMO L;  1Q86 C;  2D0P A;  4B3T Q;  3MXN B;  1HNW Q;  4GKK Q;  4EX5 A;  5FJ8 H;  1J5E Q;  1EWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...