2AUJD

Structure of thermus aquaticus rna polymerase beta'-subunit insert
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
298
structure length
298
Chain Sequence
LTDEEYRELRYGKQETYPLPAGVDALVKDGEEVVKGQELAPGVVSRMDGVALYRFPRRVRVDYLRKERAALRIPLSAWVEKEAYRPGEVLAELSEPYLFRAEESGVVELKDLAEGHLIYLRQEEEVVARYFLPAGMTPLVVEGEIVEVGQPLAEGKGLLRLPRHMTAKEVEAEEEGDSVHLTLFLEWTEPKDYKVAPHMNVIVPEGAKVQAGEKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVTTGDRVAPGDVLADGGKVKSEIYGRVEVDLVRNVVRVVESY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase beta' chain
publication title Structure and Function of Lineage-specific Sequence Insertions in the Bacterial RNA Polymerase beta' Subunit
pubmed doi rcsb
source organism Thermus aquaticus
total genus 53
structure length 298
sequence length 298
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aujD03
2.40.50.410 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aujD04
2.40.50.410 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aujD01
1IYUA 1HCZA 1V43A 1H9SA 3H94A 2D2CC 2D62A 4HR7B 5KNBA 1IYVA 2A69C 2AWOA 1TKWB 2DNEA 3LWUA 3VR4A 2NN6I 1VCIA 1I6VC 2K7VA 1YNND 2QF7A 1ZKOA 2BDOA 2PCFB 4IQZA 2NN6H 2BA1A 3GQBA 3PUYA 4PV1C 5BN3A 5K36G 1O78A 4IFDH 1Q1BA 2EJGC 3GD7A 3PUXA 4KN4C 2AUKA 2BE5C 3QIAA 4KKUA 1OXTA 4KKTA 2CW0C 4G7OC 1DCZA 3QG1A 1Q90A 2R6GA 4DNRB 1VF5C 1HPCA 1QJOA 3FPPA 3CRKC 2E76C 1TU2B 2DNCA 2IT1A 2JEBI 4DNTB 3WDNA 4G7HC 1H9JA 1GUGA 2E74C 5K36H 3TZUA 1H9SB 3NE5B 5JEAG 3PUWA 3VR6A 3M85A 3W3AA 1FR3A 4H0LC 3A7AB 4JBWA 1IW7C 1H9KA 4LK1C 5BN5A 1PMRA 2D5DA 2YYZA 3RLFA 4DK0A 1GHKA 1Q12A 3LNNA 3VR5A 3BG3A 5JEAH 2A6HC 5KNDA 1BDOA 1B9MA 3PUZA 3BDOA 3ND9A 2KA7A 3VR2A 3I73A 2CW0D 1G291 1OXXK 4OGQC 2PPBC 1FYCA 1B9NA 4GZYC 1SMYC 1T5EA 2EJFC 3SE0A 4I7ZC 2B8FA 1GUNA 1LACA 3MXUA 4DK1A 2A68C 2JE6I 3MFYA 1E2VA 2NN6G 1YNJC 1ZYRC 1IW7D 3VA7A 5KNCA 3SDZA 4JK1C 1V8QA 2PNRC 1VF7A 3DXJC 2DN8A 4OO1G 1OXSC 2A69D 3A8IE 4RCNA 2EDGA 3IFTA 2A6EC 3EQLC 3P20A 2Q8IB 1CTMA 2AUJD 4KI0A 2EVBA 1YNNC 4TQUS 4G7ZC 1Y69U 2LMCB 3D4RA 1EWHA 1GUOA 4BA1I 1H9MA 3VR3A 2BE5D 4TKOB 3IKJA 1SMYD 3OW7A 2JXMB 3AB9A 1H9RA 2L5TA 2JEAI 2K32A 2V4DA 3CRLC 4H13C 3A8KE 3M4YA 2A68D 3A7LA 3ND8A 1O7LA 4KKSA 4XIGS 3T53B 1YNJD 3I4LA 2E75C 1E2ZA 1A6XA 1CFMA 3OPOA 4IFDG 1CI3M 2B8GA 4KN7C 3T56B 4L8JA 3T51B 2A6ED 4BA2I 1GUSA 3L7ZC 5C0XG 2K33A 1DD2A 3QJYA 1K8OA 1OXUA 1Z6HA 4LJZC 3U9SA 1Y8OB 2A6HD 1LABA 3A8JE 1OXVA 3FMCA 3HGBA 1GUTA 3PUVA 3M7NA 3PV0A 1DXMA 2O5IC 3N6RA 2BA0A 2KCCA 3I72A 2ZT9C 2O5JC 2F1MA 1HQMC 5C0XH 4OO1H 1HTPA 1K8MA 1Q1EA 5A35A 1VDZA 3D31A 4KHZA 1GJXA 1Z7TA 1GHJA 4H44C 3OOCA 1Y8NB 1E2WA 1ONLA 4KMUC 4XTCS 3KLRA 1ZYRD 5BN4A 1Y8PB 2EJMA
chains in the Genus database with same CATH superfamily
4DR7Q 4QGUA 1EIFA 3FKIB 4CDDC 2RVLA 4ZKCB 4A3JG 2DY7A 3BZDB 3G71A 1KLGD 5JJIA 1WTWA 3H3VH 1DGSA 2JYOA 2B63B 4CDEC 3STBC 1PH3A 1STBA 2Q2HA 3D6CA 2B39A 1F9QA 2OXPA 2IT1A 1QVCA 1ET9A 3RUZA 1WI5A 2TSSA 4BBRG 1ASZA 4UP8A 3HOWH 1FR3A 2VNUD 1X3PA 1TS2A 1EYGA 4A4IA 4A3MG 4JG2A 1QVGA 4ZQ3A 2KCNA 1EQQA 2E5LL 2PPBC 2Z9HA 4GZYC 3F1ZA 4EX5A 1LT3D 4IUPA 5AJ3L 3K0XA 3ONAB 2IL8A 4IN3A 3PSIA 1LV9A 1EZ6A 1ZYRC 4A3KB 2IHEA 2EY2A 3CCRA 4OO1G 1PTOH 3K5MA 4B3MQ 3FHWA 2F0EA 2Z6KA 2Q8IB 1D5ZC 2Y0SB 4HCSA 1VQ4A 3C3LA 1SMYD 3IKJA 1CZGA 1LTRD 1LTID 3TS0A 1ET6A 2EZVA 1G91A 4BBSG 4XYQA 4IOCA 4P74A 3I4LA 1A2UA 4X65L 5C0XJ 4UP9A 1KXLA 1B8AA 2B2VC 2IX0A 5IGGA 3PIOA 4ZLTF 4POGA 4CKCA 4RA8A 2K5DA 2QEXA 3S15B 4CDCC 2AQ2B 3QJYA 1Y1WB 4YHHL 4C2MH 2IY5B 2WIIB 5C44G 4LFBL 2EYOA 2A6HD 1LABA 3M7NA 3S1QH 2I5LX 3I70A 5A35A 3PO3H 1QZHA 4DR1Q 2IW3A 5J3BA 4OEMB 3BJUA 4HJAA 2NN6G 1I6HH 3I4NH 4PMBA 5IP7H 1BCPC 4A3GB 4RAUC 2EYJA 3G48A 1IYVA 4U673 1B53A 2AWOA 1S5CD 2HDLA 4RWSC 2F52A 2OWOA 4LF4L 1XMOQ 3J7AF 1FVIA 3EJIA 5CBEE 4X3SA 1X65A 1U5KA 4IFDH 2K4KA 1PRTF 3R2TA 4IO9A 2G5DA 2XN9C 4A3DH 1P16A 1EUJA 2WAQB 1PH5A 3DLLA 3GTGB 5HGTA 2KHJA 1GD7A 3WDNA 1D5XC 1Z47A 2F0DA 2CWPA 4JI5Q 1LTLA 1ESRA 4JCVE 4AH6A 2FMMA 3IL8A 4DR6L 2D5DA 4DAYA 3RLFA 3LNNA 1M90C 5G3LF 1PZID 3PUZA 1LO5D 1GUWA 1E24A 4DK3C 4ME5A 5FJ8H 2OEOA 3MXPA 4X62L 4ALPA 1KRTA 5M3MH 1N33Q 4J15A 2ATWA 4DK1A 3SEBA 5M3FG 2PQEA 1W6KA 3W5OA 1N34L 3CC4A 3DWPA 4PZ8A 2MJ8A 1TS3A 4HMJA 2A69D 4O42A 4LF8Q 5C4HA 1LTGD 4G57A 4A3BG 4BY7B 3SK4A 3UDFA 1Y69U 1WCMB 5IYDG 3I8ZA 2B2YC 4IALA 1S72A 4LFAQ 1D6EC 1JOQA 4LWCA 4C1NK 1V9PA 4NXNQ 2F4IA 2PI2E 4QB4A 1AP0A 1UE5A 3GTQH 1BBUA 2F0JA 2B2TC 4RGMA 3RN5A 1AE2A 2EPBA 3F8TA 1B3AA 1N9WA 2H4OA 1K8OA 3OWEB 3HEJA 4JI2Q 4NDXA 2Z0SA 3O13A 3CF5A 4JI4Q 1JT8A 1RTNA 5F2DA 4DR4L 1DXMA 3RZDB 3TP8A 4LF7L 4DV7Q 3W2DA 2F0MA 3ER0A 3K5NA 3L3OC 1K8AC 3U58A 1Z7TA 3SK5A 1YZ6A 2ID0A 4IPCA 4B9WA 3I3CA 1VQ6A 1EL0A 3BDLA 4C3HG 1L0XB 5IT9L 2HUGA 1STEA 2NZHA 2D62A 3QWNA 2L12A 2PZUA 1TWGB 1YHBA 1VCIA 1I6VC 2BDOA 4A3JB 4L5SA 2F0PA 2K5NA 1JR0D 4R4TA 4GNXB 3HKSA 3U4VA 5C0XI 2CW0C 1Q90A 4A3IB 1VF5C 2OTJA 1EY0A 2QILA 1WTPA 5FLMG 1I3QB 4JI7Q 2Q8TA 3KBXA 3MZ5A 2RDGA 3M85A 5JOBA 4HIMA 3KJPA 1K9MC 2UUCQ 4K14A 4B3TQ 5ELFA 3BVGA 3D0FA 2Q2UA 4BBRB 5JJLA 4JVZA 1JC7A 4X64Q 4A75A 3H0GG 2I5HA 2JSOA 1EEFD 4JW0A 3T1YL 2B2YA 4PZ6A 5LMUQ 4A3MB 2K05A 3DM3A 2E2JB 4H02A 2M00A 3SE0A 1F2YA 4OIKA 2B8FA 1VQDA 3K81C 1F9PA 4DV4L 1YNJC 3BVZA 2PZWA 5JVG3 2B2TA 3LGJA 2Z4HA 1IKLA 2N3SA 4NPSA 4A3KH 5CV5A 1SE2A 3M3YB 3IFDA 4G7ZC 2RQXA 1PVOA 3R93A 1I4PA 3S2DH 1EOTA 1QCBD 2BE5D 3GV3A 3C1FA 2QA4A 2JA7G 4QF4A 2R7DA 2K32A 5C5LA 4FVMA 1VQIA 4F88A 1BOSA 2VUMG 4BBSB 5CV9A 1YJWA 4GKJQ 1PH1A 4R1JA 3D8GA 1NSNS 1PTOD 3AFPA 2Z6BA 2PNHA 1HNWL 3S1NB 5LL6X 2IPKD 2NWGA 1R9TH 4OIJA 4ZYSA 1HFGA 2CKZB 5JVH3 3A56A 3HGBA 2VB3X 1VQ7A 3MEFA 1QUQA 3N6RA 3I72A 1QE6A 2ZT9C 1U0LA 5C44B 5KYIA 5ISRA 3L2PA 4BXXG 2YTYA 4DR7L 1A62A 1PFNA 1TS5A 4EVOA 1SNMA 1NJIC 3I4OA 4BY1G 4K5XA 2F0GA 4XQJA 1U4PA 3HOVG 3HOZG 4CJ2C 2KJXA 5GAGC 2DGYA 5KNBA 1KHIA 3E6ZX 2L4NA 3J81j 1KRSA 2X6GA 4F87A 1YNND 4DK6C 4B3SQ 3K7AH 2MO1A 2QF7A 3RNUA 4A3GH 5BN3A 5K36G 3C46A 4YHHQ 5M5WB 1BXTA 3HOUH 4GLVB 4RHSA 5EPKA 3NWSA 2MNAA 1MSHA 1TU2B 2DJFC 2JEBI 5FOBB 3NE5B 4R9WA 3GTGH 4RMFA 3NUCA 5KRUA 1IW7C 1LTTD 2NB0A 2Q2TA 1AEXA 2VZAA 1NMFA 2RF4A 4FXDA 3PIPA 1YBYA 2WAQE 5CYUA 3UI2A 5GAEC 3AQQA 2XRSD 3F2CA 1STNA 1MBYA 1AFPA 1HR0W 1HJPA 4B3ML 1STHA 3KLWA 1CQFA 2LKVA 1ZEQX 1TWHB 5GAHC 1Y14B 5M3FB 4DV2L 5FLXE 5GQOA 1U4RA 2A6EC 1HNZQ 3ICEA 1LTSD 5HURA 1F2MA 2FFKB 2DJGC 2WP8J 2JQOA 4FXKC 1EZ8A 4A3BB 3URYA 1B70B 4FF2A 1Y1VH 4M8AA 5I9OA 2QW7A 2A68D 2LY7A 2XGTA 3CKIB 1GXDC 1V1QA 2RCFA 4MIUA 3GV6A 1FNWA 1BO0A 5IWAL 2KBNA 3KF6B 4L5QA 4PQXA 1XTDA 1WVLA 1UE6A 2Y0SG 1GUSA 5C0XG 4HJ5A 1E7ZA 2K33A 5EKLA 4DR5Q 3BYTB 1NNXA 1N34Q 5I2YA 4IUUA 1X56A 4KD3A 1CKMA 3NSWA 1CHPD 1N36L 1VS0A 3AYHB 3RZDH 2L1BA 3A54A 5IT9c 5ELOA 4Q0FA 3KLSX 3QO2A 3BS1A 1BCPB 1PRTD 2EJMA 1XMOL 4GLXA 1XNQL 1SYCA 4DUZQ 4P73A 1I94Q 5EKIA 3CCJA 4C3HB 4KV6A 2ASBA 1K0RA 1CSQA 5C5MA 2JA8H 1NY4A 2FHTA 1MKHA 3GDEA 4A76A 5KYLA 2EY6A 3NQIA 4LNQA 3S1MB 4PNYA 2RSOA 1Q86C 1CSPA 1SFOH 4JI5L 3CD6A 5C3EG 3FPPA 4J1MA 4MTKA 1BBXC 1IYJB 5LHY1 4LF7Q 3I91A 1CK1A 2UXDQ 1I3QH 4KHVA 1BR9A 3P1HA 1H9KA 4LK1C 1VQLA 5E4XA 4CHTB 3OSOA 3GTOB 1KLUD 1IL2A 2A6HC 1EQVA 1F77A 1PFMA 1FL0A 3H0GB 3VYSA 4DAPA 3PMFA 2K5QA 4RKLA 3M4PA 3NEMA 4GNXC 2LXJA 4YY3L 2A74C 2EQSA 4RKBA 3AMUA 4LF8L 1XYIA 3CPWA 3NBHA 2JA6H 5KNCA 3JC66 4QUCA 4IUTA 1MJEA 4LFAL 1AW7A 1PFSA 4IJHA 4JI1Q 4KI0A 4NXNL 3PCOB 3M3YH 3OWFA 3EN2A 4IFDJ 1EFID 2OQ0A 1VQCA 4KKSA 3T1YQ 2EYLA 1DJRD 3R2IA 5J22A 1VMCA 2JA7B 1NCVA 1A6XA 3S24A 4JI2L 2OTLA 3UDIA 4YWLA 2CCZA 1VQMA 4BBSH 2VUMB 5CC4A 2TMPA 2QKIC 3SHLA 3TZDA 1HR0L 1B50A 4Y52H 4DV4Q 2MUYA 5DM73 1QNKA 3S1NH 3QB3A 2K5VA 1I4GA 3K5LA 1VQEA 2XTIA 1V1PB 3TEHB 3W1BA 4HMIA 1WTQA 2K5WA 1ESFA 5M5XH 1JWUD 2IX1A 2PQAA 1IKMA 2IHFA 4BY1B 1KAWA 4QQBX 3HOZB 5JPMC 3HOVB 2A69C 4N8X1 1Q7YC 2F3VA 5FO9B 2PO4A 3H3VI 3S2HB 5C4XG 2RBMA 2NN6H 1B7YB 1JQYD 1UEBA 1CKOA 5CR3A 1Q1BA 1II3A 5JPNC 3TRZA 3W1GA 4QIWB 4B3TL 1CHQD 1D8LA 1QJOA 4GNXA 4EQPA 5M5WH 3TDQA 1N8RC 3TQYA 2N78A 2B2UA 2E74C 5I6YA 1EY5A 3TZUA 4LUVA 3T1HQ 4UY8C 5EKKA 4A3EG 4I7AA 5EJWA 2QDLA 1HZCA 5LMUL 1AH9A 4ZKBB 2M9VA 1ILQA 3U4ZA 3NQTA 3GTMB 3I73A 3D3RA 2F0IA 2VS1A 4V0BA 1MJCA 4A3IG 4JI6Q 4Z9CB 1LT5D 5E7NA 1T5EA 4IJLA 3CXCA 2L55A 2A8VA 4TRDA 4ZRZA 1L2FA 2JE6I 2NVQB 1QOHA 5M5YH 1E3PA 1EYDA 4Q5VA 1HUNA 3SDZA 1WTXA 3KOJA 1WD0A 2PNRC 4K5WA 1VF7A 4XT3B 2K5HA 5IGFA 3IFTA 3P20A 2YV5A 3Q23A 5M3FH 1J5EL 5ELCA 1LT6D 2VQFL 4JV5L 3FRPB 3VR3A 1YNXA 5DAUA 3M4OH 4GN5A 4GKJL 3G7LA 3HRZC 5EPLA 2R7ZG 4A3BH 2KUMA 1KD1C 4JBJA 2R92H 1QNUA 3FPUB 4L8JA 3T51B 1FNVA 3DEOA 1DD2A 2BH2A 3VYRA 5DM63 3H3VC 3J80c 5IYBG 4RFBA 2WB1E 1PYBA 4DV2Q 2XRQD 1B2TA 1SROA 2KENA 3J81E 5CV8A 1TS4A 4GN4B 4NP5A 4DUYQ 2HCIA 3MA2B 1SN8A 2GN5A 4QUFA 1I50B 1E2WA 3LX0A 2KCTA 3OW7A 4B3SL 5FLXL 1WTRA 5L37A 4Y7NB 1KQSA 5BR8L 1N32L 1TKWB 4ZAIA 1TWAH 3WOFA 4IFDI 2R7FA 5IWAQ 1SJED 5IE8A 1EIYB 1JOOA 1K0SA 3R3OA 1C0AA 2BE5C 2FINB 2HD3A 2ZXPA 3QIAA 4DF7A 1S40A 4KKTA 3GTJB 4G7OC 2PMZB 1ENAA 5JEAJ 4F8MA 1JE5A 1TQOA 3GTPB 2O4XA 4G7HC 2WKDA 3CP0A 3PUWA 1N36Q 5C3EB 3N52A 1PTOC 1PH7A 4OONA 5T1IA 1VQ9A 4GOPC 5CV7A 1HZBA 2D9UA 3E9HA 4N9PA 2J0TD 2ZM6L 3TP6A 1XNQQ 4RG1A 4A3LG 1LLRD 1SJHD 2GA4B 2RHQB 3V05A 1UNSA 3SK6A 4NMZA 4K6DA 3CU7A 4JI0L 4XQQA 1HNZL 1NUCA 4KJNA 4CGYB 1CA6A 2LXKA 1PHJA 5KEEA 4JK1C 1JCKB 2AUJD 1YNNC 5FKAC 1SE4A 4WFN3 3RLNA 2QEJC 2XWJB 3HG9A 4TKOB 2BCOA 3B6YA 2RCNA 5AFWA 3NELA 3SR1A 4X66L 2NZ1D 3NBHB 2R93B 4ABNA 3QR8A 1YJ9A 1TWFB 4PG3A 3OIQA 4YCWA 4DR5L 1NE3A 3OPOA 1M4VA 1CI3M 1JB7A 2NVTH 2K01A 2B8GA 4WRDA 1JJ2A 2JA7H 2B2VA 4YY3Q 4UAIA 3G6EA 1HRJA 3KF6A 2VUMH 3DEPA 2BDNA 2O5IC 2XIWA 2F0TA 2BA0A 3HOWG 4WJWA 2ES2A 3HS0C 4A3FB 1YITA 3HKZE 2AKWB 2VW9A 4DUZL 1I94L 4R4CA 2CHBD 5HGQA 2UUAL 3Q22A 3GTKH 1G8ZD 5J39A 1K73C 1SMXA 3S9WA 4GOPA 4LMQD 2SNMA 4O1NA 3F2DA 3A5UA 3HOVH 3HOZH 4QMGA 4DV5L 4PV1C 1YJNA 3GD7A 5C4XB 1A2TA 3NTHA 1HR0Q 2UXDL 2R6GA 3HFZB 2F0FA 2I07B 2PQAB 4MNOA 4DNTB 5K36H 4KLKA 3VR6A 5IGCA 5C4JB 3S14B 3MC0B 4LFCQ 3S1RH 3PO2H 1VQHA 4A3EB 2EYHA 1E0BA 3OHXC 1G2TA 1D2BA 3FKIH 1O7IA 1MIUA 1YI2A 2KA7A 1LTAD 1OXXK 3RZOB 5I2XA 4FDBA 4YCVA 2B63H 1QILA 5COYA 1BNZA 4DKAC 3TMEA 1X9NA 4JI1L 1H95A 1G2SA 4E6IA 3HOYG 1PRTC 2EY1A 1TY2A 4XXEA 1V8QA 2EE1A 4C3JG 5JJKA 2LFNA 3PO3G 1GVPA 2AHOB 3D4WA 1CQVA 3EFXD 2F4VL 3GTLB 2ICIA 1W2BA 2HIVA 2JXMB 1UEAB 3J7YW 4S3SA 2K04A 2UXCL 3A7LA 5EAYA 1E2ZA 1T9HA 1VQBA 4IFDG 1D1KA 2R7ZB 4QJFA 4KN7C 1X54A 4C3IG 5E3FA 1A3TA 1SNQA 1F2LA 1L1OC 2NZOA 1GUTA 1U4MA 3PV0A 4J8QA 2F1MA 1L0YB 5C0XH 4YCUA 2O2LD 1E1TA 3DMUA 1V1OA 2R3ZA 1J5EQ 2K6AA 2VQFQ 1CM9A 4JV5Q 1Y8NB 2WACA 4KHPL 2Z1CA 1PLFA 3TS2A 1HA5A 1V1PA 5KGUA 2Y0SE 1U4LA 4V190 4X3UA 2PI2A 3S16B 3UDGA 4K5VA 4AIMA 2YU9B 3S15H 3A55A 1R4QB 4TSSA 5C4ZA 3PF4A 1O78A 1Y1WH 1W3SA 1KDAA 2BOSA 3T1HL 3JAME 4KKUA 1OXTA 1IL8A 3BZKA 3QG1A 3KUPA 1F9RA 3GTJH 2HQLA 1AE3A 1X32A 1FNUA 1QB5D 1WYDA 3G4SA 1ENFA 4K6LA 4UPAA 1XJVA 4J6HA 2SDFA 1HA6A 4JI6L 5IP9G 2HQEA 1Q12A 5K5PA 3VR5A 4HJ9A 1EWCA 1BVSA 1EY8A 3FP9A 5BR8Q 4ZUJA 1EYCA 3J81L 3FEWX 3H15A 1VQ5A 1N32Q 4IUQA 3SK8A 1Q46A 1S3OA 4R8NA 5IODA 4FF1A 1E2VA 1HH2P 1A3UA 3VA7A 3ERQA 5CBAE 4OX9Q 1OXSC 1O80A 3S17B 1L1OA 3M4QA 5J1ZA 4LF6Q 5DLQE 4K0KL 1RIPA 3D4RA 4PMWA 1K83B 1VQJA 3J7A5 4A93G 3EVQA 3U9OA 1PA6A 2ZM6Q 1F2ZA 1O7LA 4RGOS 1Q3LA 4ULLA 3K57A 1E1OA 2H5XA 1SYGA 3DWQA 4LW1A 4JI3Q 1Z9FA 1O7YA 4YIJA 3L7ZC 1MD2D 4JI0Q 4NB3A 4JPBW 5GADC 3U9SA 2CH4A 1JJCB 2L9HA 4A3CH 4DUYL 4DGZA 1ASYA 1FGBD 4BY7H 1U9RA 1WCMH 4KHZA 4KY6A 1YEZA 3HOWB 1IXRA 4CJ1B 3KLRA 1SYDA 2E2DC 3HOXG 3VDYA 3ZYYX 1IYUA 4X66Q 4OXPA 5CV4A 3H94A 4HR7B 3KYHC 1BKBA 3SVMA 2PCFB 2A19A 2BA1A 2HCCA 4IPGA 2L11A 1MHWC 3PUXA 4DPGA 1QWYA 2C35B 3J7AV 2YTXA 3K6OA 5C4XH 1QVFA 4P75A 2PYKA 1H9JA 1DOKA 1PTOB 2B2WC 5JEAG 4AYBG 4GOPB 3W3AA 3A7AB 1B44D 2SEBD 3NBIA 3GP7A 5C4JH 1EYAA 3L9AX 3ULJA 2UUAQ 2C9OA 4CJ0B 1WFQA 2F0VA 2JA9A 3CHBD 3PGZA 3RLOA 1WTOA 3U50C 2MO0A 4JYAL 4R4OA 4A3EH 2UUBL 5IYCH 1IBLL 1JWSD 1TWGH 2CW0D 2HT1A 1HZ9A 1PZKD 2RKSA 1FYCA 1SMYC 3RN2A 1BUVT 4A3JH 3DWAA 3Q0AA 4C1NI 2F0KA 2A73B 4DV5Q 3MFGA 1FJGQ 5KIXA 4FXGC 1XMQL 4JOIC 1A8VA 4A3IH 1EU4A 1VQFA 4DV1L 5GROA 4DV6L 5JAVA 4RGTA 4LF5Q 1PH4A 3A0JA 1YVCA 3HOYB 3J81i 3F2UA 4ILWA 4C3JB 1FD7D 1HHVA 3OIPA 4BBRH 4F7XA 4MHEA 1I4XA 1SSOA 3PO3B 1RL2A 4BA1I 2GVBA 1B3QA 5FO8B 1C7YA 5ELNA 2L15A 3GTLH 2NTSA 3AB9A 4R4QA 2L5TA 1KABA 4RCOA 4NW2A 5M9OA 3M4YA 4A3MH 3ND8A 2E2JH 1YNJD 3MWYW 4FO2A 2RDHA 1EOVA 3EROA 3CCQA 3NHHA 2EY5A 1SYBA 1STAA 1SRUA 1Y8OB 3DHQA 3A8JE 1TWCB 2CWAA 4IURA 4C3IB 2WKCA 1K8GA 4OO1H 2R93G 1C4QA 4YWKA 2F4VQ 4H44C 5I6WA 2VXWA 3E0JA 5IYBH 1ONLA 2WINB 4XTCS 4DFAA 3OMGA 2M2LA 2ZTCA 1ML0D 1HCZA 2UXCQ 2K75A 2DNEA 4JC0A 3I2ZA 1Q8KA 2A1AA 1PYWD 2NN6I 1UUPA 1ZKOA 3CC2A 3R8BA 1D5MC 3GQBA 1B4OA 4MZ9A 2I46A 5M3MB 3Q24A 4A3FG 3TP7A 1KTKA 4KN4C 5EBDA 2KOLA 2YU9H 1XWEA 3RR5A 1W6JA 3A5ZB 4ZCKA 4LFCL 4TVAB 2NUCA 4DV3Q 2ZXRA 1YHAA 5C44H 1SAPA 2QDBA 1XPUA 3OTOQ 4JOIA 1EFWA 2B3GA 2K28A 2E2HB 3J81c 4X6AH 1GHKA 1ENCA 1OO9B 4HEDA 4KHPQ 4HJ7A 1CUKA 2XNAC 3MHBA 5EGTA 5IGEA 3I90A 2NYZD 4B3RQ 4DNIA 3GTQB 1L0WA 2JK8A 2ZXOA 3MXUA 2VQEQ 1PRTB 2Q2IA 2Z8LA 4A3LH 1J9OA 3OYYA 3T16A 1IW7D 1CA5A 4DR2L 1XX8A 1A15A 1STGA 2Z6KC 3P7JA 2EXDA 3BU2A 1CTMA 1VQAA 3NXWA 1IBKQ 2F3IA 2UU9L 1LUZA 1Q8IA 2EYPA 2EIFA 3JAML 4AQYQ 3S17H 2RSNA 4WORA 4NXMQ 1BCPF 1EY9A 3CRLC 1NAPA 3T53B 2K1BA 3HZXA 4EQNA 1GO3E 2E75C 4A93B 5T1GA 1ICFB 5EQ0A 3MEHA 1JICA 4HSPA 4LF9Q 1M1KC 1L1OB 3NPPA 2NVXB 2A6ED 1TWHH 1OXUA 1Z6HA 2EOTA 3H09A 1WOCA 3KBGA 1SYEA 3PQIA 3E3XA 4HN7A 3EBEA 5E1FA 2PW7A 1K8MA 2JN4A 4B9XA 1TT2A 4N8FA 4K0KQ 2UXBQ 2LSSA 3I56A 4WJ4A 3OOCA 3FVQA 2X6LA 3DM1A 3T13A 5IYDH 2K14A 4DV0Q 3HP3A 1NMGA 3VYTA 3HOXB 3I4MG 1JORA 3VR4A 1A63A 2K7VA 4EQOA 4IQZA 1K3BC 3PUYA 3MXGA 3V96A 3KDFA 2JA5G 1X6OA 2JA6G 3T4AC 4P72A 2K50A 3H91A 1LM0A 4ZK9B 4DNRB 4IPDA 2CQOA 3CCLA 1RD9D 1VQGA 3CC7A 4MN3A 3D4DA 5HY6A 1WTHA 2V1CC 4ODGA 2F0UA 1XPRA 4H0LC 4GLAC 1XTCD 4XYOA 1SLJA 5EPJA 5BN5A 4AYBB 3S2DB 4GN3B 4HIDA 1MI2A 3BG3A 4U68A 3CCSA 4X3TA 1I4HA 1UWVA 2JJQA 3EA6A 3KLSA 3GO5A 5FK9C 5LMNQ 3VR2A 1Q82C 3CCEA 4C3HH 1SDFA 4KTAA 1GKHA 3RD4A 2X69A 1YHQA 1KDCA 2WFWA 2PZTA 2ZTEA 4OX9L 4FP5D 3S1MH 2MFIA 1EY7A 1R9TB 1GM5A 2H1EA 4BS9A 4LF6L 1NBWA 3DXJC 1DM0B 2DN8A 4NKLA 1NTGA 3A8IE 4IOAA 4I65A 5IOCA 1A0IA 3EQLC 5FLMH 5ELBA 2NBFA 1VQNA 3NTIA 4H7BA 1J6QA 1JJGA 3HOYH 4HTHA 1Q81C 1RODA 3MXNA 1PH9A 1H9MA 4ID6A 4C3JH 3GTOH 1S5BD 4HCEA 4UDUC 2DY8A 1UE7A 4OWWB 3M7GA 2J4XA 1NR2A 3H0GH 4JI3L 3F2BA 4JYAQ 2UUBQ 1RDPD 1IBLQ 1CFMA 2ZJPA 3I55A 1JMCA 3K7AB 3JAMi 1PYSB 3NWTA 1XMQQ 5D65A 1LT4D 5FO7B 1XNRL 1OXVA 1TIID 4LAAA 3HOUB 4DV1Q 5CMDA 4R8IA 4DV6Q 1BQQT 1BF4A 1TWCH 1TXYA 1DYQA 4DXGA 1VQPA 4C3IH 1RF2D 1YIJA 2L0CA 4FYDA 1BBWA 3M9BA 3Q8DA 3WWVA 2AQ3B 5BN4A 1Y8PB 1IZ6A 1CT1D 3KK7A 2R61A 1F9SA 1JOKA 2VL6A 3KF8B 4JI8L 5I4DA 2KVMA 4K2LA 1VQOA 2KQ3A 1JB3A 4KY7A 3J80E 2E76C 4CKBA 1EY4A 2E2IB 3VA5A 1X55A 2MPMA 1VQ8A 5LL6S 1PV4A 4R4IA 4BXXH 3BYYB 5A2QE 2E2HH 3NTKA 4BY1H 1MGSA 1KIXA 2R92G 1Y1VB 4IPHA 1FJGL 2WB1G 3ND9A 3OW2A 1C8CA 3S2HH 3K58A 2FJ2A 3MAQA 5IP9H 1S5DD 2F0WA 4LF5L 1SE8A 2A68C 5TSSA 5C3XA 3CMEA 3LWEA 3JAMc 2HHHL 1EU3A 1SNPA 2EDGA 2Z4IA 4QCLA 2EVBA 3E0EA 4K8IA 3BDCA 2RA4A 1X3GA 4QIWE 3STBD 1GOZA 1NR4A 5CORA 1B1ZA 3GTMH 2V4DA 4H13C 5D3DA 3WOEA 4EGVA 3C1EA 3EIVA 5CGKA 1C9OA 2ICEC 4FF4A 1CZWA 3CAMA 5C6AA 3P75A 2RDFA 5CV6A 2FXQA 3NK9A 1EIGA 3AFQA 1JE4A 2BH8A 2NVQH 2JA8B 4A93H 4BA2I 3L0OA 2EYMA 3IRBA 5IGBA 2IJ0A 3A74A 4GKKQ 2NVXH 4DR2Q 4JBMA 1SFOB 5I9PA 2CQAA 1SEBD 2F0QA 3I4NG 5IP7G 1Q1EA 1VMPA 5LMNW 1GJXA 4RGNA 3AEVA 1PFBA 1D1IA 2F3WA 2UU9Q 1ZYRD 3IAYA 3BDOA 1S5ED 3TREA 1V43A 1RCVD 1DOMA 2HIXA 1H9SA 5D3IB 4A3DG 4P71A 1WTVA 1UAPA 2F0SA 4RH6A 3HOXH 4C56C 4DV3L 1SNCA 4P2CB 3I4MB 2NTTA 3UE1A 2E8GA 4DN4M 3OTOL 2D0PA 3I7FA 3VYUA 5FLXc 2JA5B 1PH6A 1R4PB 2JA6B 3CRKC 4G4KA 2KHSA 1EQTA 1HNXL 5IY0A 4JBWA 1PDQA 1FGUA 1I50H 2YTVA 5FJ8G 1K28A 2VY3A 3E5SA 5M3MG 4ME3A 2MP1A 3PIP3 4B3RL 3KDFB 4Y7NH 2OF1A 5H1SE 5JEAH 2ZJQA 3K59A 2N8NA 2ZTDA 1CKNA 2N49A 2VQEL 3J7ZC 4OGQC 3K7UC 4ZUIA 1DONA 3HKZG 4KJOA 3MVVA 4I7ZC 4DR3L 4WJ3M 4HIKA 5JJZA 1QZGA 4OL7A 2E5LQ 4RHRA 4AYBE 1MSGA 1G6PA 4M1UB 1IBML 5AJ3Q 1G6ZA 2MGSA 1IBKL 3GTPH 1BCPD 1IHZA 4AQYL 3K8AA 5C3EH 3V2TA 2KEDA 4NXML 3NP8A 4KD4A 2PMZE 4DAMA 3CQZB 4DAVA 5M5XB 4LF9L 4XIGS 5NUCA 4IZ8A 1X3FA 4K8JA 4FNFA 2NVYB 4IUNA 3K5OA 2OCEA 2F03A 1KC8C 1J8IA 2PW5A 4X65Q 3MXNB 1KL9A 4LJZC 4HAEA 1SR3A 3KFUA 2IX3A 3PUVA 1SE3A 2UXBL 2O5JC 2HDMA 3PO2G 4DV0L 1O7ZA 1P8LA 4LFBQ 1VDZA 3H6MA 1GHJA 5ELDA 2N88A 3FKIG 2I5MX 1I5FA 2GVAA 4XQNA 1RKNA 2R93H 1TWFH 5C3WA 2D2CC 3AU7A 3ERSX 4GS3A 2B63G 1JWMD 4JBKA 2XWBB 5D14A 3FDTA 1SNOA 3BZCA 4PZ7A 2P5ZX 4L5RC 2EJGC 2AUKA 4LF4Q 3ZJYC 1DCZA 5M5YB 2J7ZA 2EYFA 2RHSB 1HZAA 1C48A 1HPCA 2AQ1B 2KECA 1XNRQ 2XVSA 3UE0A 1EIHA 4A3FH 1GUGA 5ELEA 3SGIA 3ULLA 3X3NA 1LTBD 4DAYB 3OMCA 5LMNL 1DOLA 2E2IH 1PMRA 2YYZA 3M4OB 4DXFA 2CH4W 1TVXA 1BDOA 4POFA 4FF3A 1G291 4DR6Q 1B9NA 1PZJD 4JI8Q 2R92B 2ALYB 2EJFC 2WB1B 1LYLA 4N9TA 1SYFA 4KY5A 4A3KG 4CKEA 1XPOA 4X62Q 3UDXA 4APVA 1A3VA 1HUMA 2K52A 3S14H 3G6JB 1ZXTA 4L63B 4DR1L 4TQUS 2LMCB 1EWHA 3QOLA 1AZQA 3K0YA 1AN8A 3CW2C 2Q8RE 4HSVA 2G9DA 2JEAI 3J80L 3A8KE 2AMCB 3TP5A 3RZOH 1HXYD 3TBIB 1UE1A 1TR5A 3CCMA 3CPFA 1Y1WG 4C2MB 1KNEA 3Q6SA 1TWAB 4QY7A 5A2QL 1WJJA 1X3QA 2N55A 3S1QB 1T5XD 3TSSA 1S5FD 3NENA 3FMCA 3BVMA 2DUDA 1SNDA 1STYA 5DEHA 2HHHQ 4OO1I 1HQMC 4LUZA 1HTPA 1HFNA 3ITPA 4DR4Q 5G3LD 1I6HB 2VB2X 3QOJA 1EY6A 4EQ5A 4MTNA 3I4NB 4A3GG 3CCVA 4XT1B 4DU9A 5IGDA 3ULPA 2F0LA 2F0HA 5DNFA 1RHPA 2R7ZH 1N33L 3LWUA 3SXHA 4UP7A 3HOUG 4O0AA 4K2KA 1WD1A 1OTCA 3C2PA 4A3DB 4CDFC 2WAQG 1RJTA 2KHIA 3KF8A 3CCUA 3PF5A 1X3EA 4DA2A 1XXGA 3I4MH 4LUOA 1D7QA 1EQRA 1PXUA 1TY0A 4L6TB 2EXZA 1ICWA 2B2UC 2DNCA 1RTOA 1H9SB 2JA5H 2KEEA 2B2WA 1HQRD 2A5HA 3X3MA 4UHVA 3E9IA 2AWNA 1EWIA 4DK0A 3CMAA 4O2DA 4XDXA 1B9MA 5KNDA 1SBBB 2G9HD 4QL5A 1S4ZA 3S16H 4OELB 5EBCA 1ILPA 2ENBA 4IUVA 2C5CA 5E4WC 2OQKA 2NVTB 1GUNA 1LACA 3MFYA 3HKZB 4A3CG 4OWXB 1I4QA 3DUZA 4JI4L 2F0OA 2CVRA 5IIFA 4X3KA 2WV6D 4L5TA 1KNAA 4BWGB 4BY7G 2FMCA 4DV7L 2K03A 5IT9E 4RCNA 1WCMG 1Y1VG 2SOBA 2ZJRA 1CKNB 4HJ8A 2D0OA 1HNXQ 2I0QA 4KK7A 4HIOA 4CBVA 4YWMA 4B08A 1GUOA 1I4RA 1E22A 2QCPX 2IWHA 1QG7A 1HTLD 3D6WA 3MTSA 1H9RA 3KJOA 3CQZH 2B29A 1VQKA 3RMHA 2KCMA 3GTKB 2SNSA 1EEID 1DZ1A 4GKKL 2MQHA 2CFMA 3T56B 1M8AA 4PMCA 4DR3Q 1G51A 1QUQB 1PH8A 2NVYH 2XSCA 1K3RA 2LS01 2MHVA 3J80i 3TN2A 1IBMQ 1AZPA 4JI7L 1HNWQ 2KCCA 1PTOF 3K80C 1SXTA 2UUCL 2JP1A 2QGQA 1KAAA 4OWTB 3D31A 2OT2A 2F0NA 1KDBA 1K83H 3S1RB 4OHJA 3PO2B 4X64L 1PH2A 4KMUC 2JA8G 5IYCG 3PIO3
chains in the Genus database with same CATH topology
3FKIB 2RVLA 4ZKCB 2DY7A 3BZDB 1KLGD 1WTWA 2JYOA 2B63B 1STBA 3D6CA 2B39A 1F9QA 2OXPA 2IT1A 1ET9A 3RUZA 2TSSA 1FR3A 2VNUD 1X3PA 1TS2A 4ZQ3A 2KCNA 2PPBC 4GZYC 1LT3D 4IUPA 3ONAB 2IL8A 4IN3A 1LV9A 1EZ6A 1ZYRC 4A3KB 2EY2A 4OO1G 1PTOH 3K5MA 2F0EA 2Q8IB 1D5ZC 2Y0SB 4HCSA 3C3LA 1SMYD 3IKJA 1CZGA 1LTRD 1LTID 2EZVA 1ET6A 1G91A 4XYQA 3I4LA 1A2UA 5C0XJ 5IGGA 2B2VC 2IX0A 4ZLTF 4CKCA 4RA8A 2K5DA 3S15B 2AQ2B 3QJYA 1Y1WB 2WIIB 2EYOA 2A6HD 1LABA 3M7NA 3I70A 5A35A 2IW3A 2NN6G 4PMBA 1BCPC 4A3GB 4RAUC 2EYJA 1IYVA 4U673 1B53A 2AWOA 1S5CD 2HDLA 4RWSC 3J7AF 3EJIA 5CBEE 4X3SA 4IFDH 1PRTF 3R2TA 2XN9C 2WAQB 3GTGB 5HGTA 3WDNA 1D5XC 1Z47A 2F0DA 1ESRA 2FMMA 3IL8A 2D5DA 4DAYA 3RLFA 3LNNA 5G3LF 1PZID 3PUZA 1LO5D 1GUWA 4ME5A 2OEOA 3MXPA 4DK1A 3SEBA 2PQEA 1W6KA 3DWPA 2MJ8A 1TS3A 4HMJA 2A69D 4O42A 5C4HA 1LTGD 4G57A 4BY7B 3SK4A 1Y69U 1WCMB 3I8ZA 2B2YC 4IALA 1D6EC 1JOQA 4C1NK 2F4IA 4QB4A 1AP0A 2F0JA 2B2TC 4RGMA 2EPBA 1B3AA 2H4OA 1K8OA 3OWEB 3HEJA 4NDXA 3O13A 1RTNA 5F2DA 1DXMA 3RZDB 3TP8A 3W2DA 2F0MA 3K5NA 3L3OC 1Z7TA 3SK5A 2ID0A 4B9WA 3I3CA 1EL0A 3BDLA 4C3HG 1L0XB 5IT9L 2HUGA 1STEA 2D62A 3QWNA 2L12A 2PZUA 1TWGB 1VCIA 1I6VC 2BDOA 4A3JB 2F0PA 1JR0D 5C0XI 2CW0C 1Q90A 4A3IB 1VF5C 1EY0A 2QILA 1WTPA 1I3QB 2Q8TA 3KBXA 3MZ5A 2RDGA 3M85A 5JOBA 4K14A 5ELFA 3BVGA 4BBRB 1JC7A 2JSOA 1EEFD 2B2YA 4A3MB 2K05A 2E2JB 2M00A 3SE0A 1F2YA 4OIKA 2B8FA 1F9PA 1YNJC 3BVZA 2PZWA 5JVG3 2B2TA 2Z4HA 1IKLA 5CV5A 1SE2A 3M3YB 3IFDA 4G7ZC 2RQXA 3R93A 1I4PA 1EOTA 1QCBD 2BE5D 3GV3A 3C1FA 4QF4A 2K32A 5C5LA 4FVMA 4F88A 1BOSA 4BBSB 5CV9A 3D8GA 1NSNS 1PTOD 3S1NB 5LL6X 2IPKD 2NWGA 4OIJA 4ZYSA 1HFGA 5JVH3 3A56A 3HGBA 2VB3X 3N6RA 3I72A 1QE6A 2ZT9C 5C44B 5KYIA 5ISRA 1PFNA 1TS5A 4EVOA 1SNMA 4K5XA 2F0GA 4XQJA 1U4PA 4CJ2C 2KJXA 5KNBA 3E6ZX 2L4NA 2X6GA 4F87A 1YNND 2QF7A 5BN3A 5K36G 3C46A 5M5WB 1BXTA 4RHSA 5EPKA 3NWSA 1MSHA 1TU2B 2JEBI 5FOBB 3NE5B 4R9WA 3NUCA 5KRUA 1IW7C 1LTTD 2NB0A 1AEXA 4FXDA 5CYUA 3UI2A 2XRSD 1STNA 1MBYA 1AFPA 1STHA 1CQFA 2LKVA 1ZEQX 1TWHB 5M3FB 5FLXE 1U4RA 2A6EC 5HURA 1LTSD 1F2MA 2FFKB 2WP8J 4FXKC 1EZ8A 4A3BB 3URYA 4FF2A 5I9OA 4M8AA 2A68D 2LY7A 3CKIB 1GXDC 4MIUA 3GV6A 1FNWA 1BO0A 4PQXA 1WVLA 1GUSA 5C0XG 2K33A 5EKLA 3BYTB 5I2YA 4IUUA 4KD3A 3NSWA 1CHPD 2L1BA 3A54A 4Q0FA 3KLSX 3QO2A 3BS1A 1BCPB 1PRTD 2EJMA 1SYCA 5EKIA 4C3HB 4KV6A 5C5MA 2FHTA 5KYLA 2EY6A 3NQIA 3S1MB 4PNYA 2RSOA 3FPPA 4J1MA 1BBXC 5LHY1 3I91A 1CK1A 4KHVA 1BR9A 3P1HA 1H9KA 4LK1C 5E4XA 4CHTB 3OSOA 3GTOB 1KLUD 2A6HC 1EQVA 1F77A 1PFMA 3H0GB 3VYSA 4DAPA 3PMFA 2K5QA 4RKLA 2A74C 3AMUA 4RKBA 1XYIA 3NBHA 5KNCA 4QUCA 4IUTA 1AW7A 4KI0A 3OWFA 4IFDJ 1EFID 4KKSA 2EYLA 1DJRD 3R2IA 5J22A 1VMCA 2JA7B 1NCVA 1A6XA 2VUMB 5CC4A 2TMPA 2QKIC 3SHLA 3TZDA 1B50A 2MUYA 5DM73 1QNKA 3QB3A 1I4GA 3K5LA 1V1PB 1WTQA 4HMIA 2K5WA 1ESFA 1JWUD 2IX1A 1IKMA 4BY1B 3HOZB 5JPMC 3HOVB 2A69C 2F3VA 5FO9B 2PO4A 3S2HB 2RBMA 2NN6H 1JQYD 5CR3A 1Q1BA 1II3A 5JPNC 4QIWB 1CHQD 1QJOA 4EQPA 3TDQA 2B2UA 2E74C 5I6YA 1EY5A 3TZUA 5EKKA 5EJWA 4ZKBB 2M9VA 1ILQA 3NQTA 3GTMB 3I73A 3D3RA 2F0IA 4V0BA 4Z9CB 1LT5D 1T5EA 2L55A 4TRDA 4ZRZA 2JE6I 2NVQB 1QOHA 1EYDA 4Q5VA 1HUNA 3SDZA 1WTXA 1WD0A 2PNRC 4K5WA 1VF7A 4XT3B 5IGFA 3IFTA 3P20A 3Q23A 5ELCA 1LT6D 3FRPB 3VR3A 5DAUA 3G7LA 3HRZC 5EPLA 2KUMA 1QNUA 3FPUB 4L8JA 3T51B 1FNVA 3DEOA 1DD2A 3VYRA 5DM63 3H3VC 4RFBA 2XRQD 1B2TA 3J81E 5CV8A 1TS4A 4NP5A 2HCIA 3MA2B 4QUFA 1I50B 1E2WA 3LX0A 3OW7A 5FLXL 1WTRA 4Y7NB 1TKWB 4ZAIA 3WOFA 4IFDI 1SJED 1JOOA 3R3OA 2BE5C 2FINB 2ZXPA 3QIAA 4DF7A 3GTJB 4KKTA 4G7OC 2PMZB 1ENAA 5JEAJ 4F8MA 1TQOA 3GTPB 2O4XA 4G7HC 2WKDA 3PUWA 5C3EB 3N52A 1PTOC 5T1IA 5CV7A 2D9UA 4N9PA 2J0TD 3TP6A 1LLRD 1SJHD 2GA4B 3V05A 1UNSA 3SK6A 4NMZA 4K6DA 3CU7A 4XQQA 1NUCA 4KJNA 4CGYB 1CA6A 5KEEA 4JK1C 1JCKB 2AUJD 1YNNC 5FKAC 1SE4A 4WFN3 2QEJC 2XWJB 3HG9A 4TKOB 2BCOA 5AFWA 3SR1A 2NZ1D 2R93B 4ABNA 1TWFB 3OIQA 3OPOA 1M4VA 1CI3M 2K01A 2B8GA 4WRDA 2B2VA 4UAIA 1HRJA 3DEPA 2BDNA 2O5IC 2XIWA 2F0TA 2BA0A 4WJWA 3HS0C 4A3FB 2CHBD 3Q22A 1G8ZD 5J39A 3S9WA 4LMQD 2SNMA 4O1NA 4QMGA 4PV1C 3GD7A 5C4XB 1A2TA 3NTHA 2R6GA 2F0FA 2I07B 4DNTB 5K36H 3VR6A 5IGCA 5C4JB 3S14B 3MC0B 4A3EB 2EYHA 1E0BA 3OHXC 1G2TA 1D2BA 2KA7A 1LTAD 1OXXK 3RZOB 5I2XA 1QILA 5COYA 1BNZA 3TMEA 1G2SA 4E6IA 1PRTC 2EY1A 1TY2A 4XXEA 4C3JG 1V8QA 2EE1A 2LFNA 3D4WA 1CQVA 3EFXD 3GTLB 2ICIA 2JXMB 1UEAB 3J7YW 4S3SA 2K04A 3A7LA 1E2ZA 4IFDG 1D1KA 2R7ZB 4KN7C 4C3IG 5E3FA 1A3TA 1SNQA 1F2LA 1GUTA 1U4MA 3PV0A 4J8QA 2F1MA 1L0YB 5C0XH 2O2LD 1V1OA 2R3ZA 3DMUA 2K6AA 1CM9A 1Y8NB 2WACA 2Z1CA 1PLFA 1HA5A 1V1PA 5KGUA 1U4LA 4V190 4X3UA 3S16B 4K5VA 2YU9B 3A55A 1R4QB 4TSSA 5C4ZA 1O78A 1KDAA 2BOSA 3JAME 4KKUA 1OXTA 1IL8A 3QG1A 3KUPA 1F9RA 1X32A 1FNUA 1QB5D 1ENFA 4K6LA 4J6HA 2SDFA 1HA6A 2HQEA 1Q12A 5K5PA 3VR5A 1EWCA 1EY8A 4ZUJA 1EYCA 3J81L 3FEWX 4IUQA 3SK8A 4R8NA 5IODA 4FF1A 1E2VA 1A3UA 3VA7A 3ERQA 5CBAE 1OXSC 1O80A 3S17B 5J1ZA 3D4RA 4PMWA 1K83B 3EVQA 3U9OA 1F2ZA 1O7LA 4RGOS 1Q3LA 4ULLA 3K57A 1SYGA 3DWQA 1O7YA 4YIJA 3L7ZC 1MD2D 3U9SA 2L9HA 4DGZA 1FGBD 1U9RA 4KHZA 4KY6A 3HOWB 4CJ1B 3KLRA 1SYDA 2E2DC 3ZYYX 1IYUA 5CV4A 3H94A 4HR7B 3SVMA 2PCFB 2BA1A 2HCCA 2L11A 3PUXA 1QWYA 3J7AV 3K6OA 2PYKA 1H9JA 1DOKA 1PTOB 2B2WC 5JEAG 3W3AA 3A7AB 1B44D 2SEBD 3NBIA 3GP7A 1EYAA 3L9AX 2C9OA 4CJ0B 2F0VA 3CHBD 1WTOA 1JWSD 2CW0D 1PZKD 2RKSA 1FYCA 1SMYC 1BUVT 3DWAA 3Q0AA 4C1NI 2F0KA 2A73B 3MFGA 5KIXA 4FXGC 1EU4A 5JAVA 4RGTA 3HOYB 3F2UA 4ILWA 4C3JB 1FD7D 1HHVA 3OIPA 4F7XA 4MHEA 1I4XA 1SSOA 3PO3B 4BA1I 5FO8B 2NTSA 3AB9A 2L5TA 1KABA 4RCOA 4NW2A 5M9OA 3M4YA 3ND8A 1YNJD 3MWYW 4FO2A 2RDHA 3EROA 3NHHA 2EY5A 1SYBA 1STAA 1Y8OB 3DHQA 3A8JE 1TWCB 4IURA 4C3IB 2WKCA 4OO1H 1C4QA 4H44C 5I6WA 2VXWA 3E0JA 1ONLA 2WINB 4XTCS 4DFAA 3OMGA 2M2LA 1ML0D 1HCZA 2DNEA 2NN6I 1PYWD 1UUPA 1ZKOA 3R8BA 1D5MC 3GQBA 1B4OA 3Q24A 2I46A 5M3MB 3TP7A 1KTKA 4KN4C 5EBDA 2KOLA 1XWEA 1W6JA 2NUCA 2ZXRA 1SAPA 2QDBA 2K28A 2E2HB 1GHKA 1ENCA 1OO9B 4HEDA 2XNAC 3MHBA 5EGTA 5IGEA 3I90A 2NYZD 3GTQB 2ZXOA 3MXUA 1PRTB 2Z8LA 1J9OA 3T16A 1IW7D 1CA5A 1XX8A 1A15A 1STGA 3P7JA 1CTMA 3NXWA 2EYPA 1Q8IA 3JAML 2RSNA 4WORA 1BCPF 1EY9A 3CRLC 1NAPA 3T53B 2K1BA 3HZXA 4EQNA 2E75C 4A93B 5T1GA 5EQ0A 3MEHA 1JICA 4HSPA 3NPPA 2NVXB 2A6ED 1OXUA 1Z6HA 2EOTA 3H09A 3KBGA 1SYEA 4HN7A 5E1FA 2PW7A 1K8MA 4B9XA 1TT2A 3OOCA 3FVQA 2X6LA 3DM1A 3T13A 3HP3A 3VYTA 3HOXB 1JORA 3VR4A 2K7VA 4EQOA 4IQZA 3PUYA 3MXGA 3V96A 3T4AC 3H91A 4ZK9B 4DNRB 1RD9D 4MN3A 3D4DA 4ODGA 2F0UA 4H0LC 1XTCD 4XYOA 5EPJA 5BN5A 4AYBB 3S2DB 1MI2A 3BG3A 4U68A 4X3TA 1I4HA 3EA6A 3KLSA 3GO5A 5FK9C 3VR2A 1SDFA 4KTAA 3RD4A 2X69A 1KDCA 2PZTA 4FP5D 1EY7A 1R9TB 2H1EA 4BS9A 3DXJC 1DM0B 2DN8A 4NKLA 3A8IE 4I65A 5IOCA 3EQLC 5ELBA 2NBFA 3NTIA 4H7BA 4HTHA 1RODA 3MXNA 1H9MA 4ID6A 1S5BD 4HCEA 4UDUC 2DY8A 3M7GA 2J4XA 1NR2A 1RDPD 1CFMA 3K7AB 3NWTA 5D65A 1LT4D 5FO7B 1OXVA 1TIID 4LAAA 3HOUB 5CMDA 4R8IA 1BQQT 1BF4A 1DYQA 4DXGA 1RF2D 2L0CA 4FYDA 2AQ3B 5BN4A 1Y8PB 1CT1D 3KK7A 2R61A 1F9SA 1JOKA 5I4DA 2KVMA 4K2LA 2KQ3A 1JB3A 4KY7A 3J80E 2E76C 4CKBA 1EY4A 2E2IB 3VA5A 2MPMA 5LL6S 3BYYB 5A2QE 3NTKA 1MGSA 1Y1VB 3ND9A 1C8CA 3K58A 2FJ2A 3MAQA 1S5DD 2F0WA 2A68C 5TSSA 5C3XA 3LWEA 1EU3A 1SNPA 2EDGA 2Z4IA 4QCLA 2EVBA 4K8IA 3BDCA 2RA4A 1GOZA 1NR4A 5CORA 1B1ZA 2V4DA 4H13C 5D3DA 3WOEA 4EGVA 3C1EA 5CGKA 2ICEC 4FF4A 1CZWA 5C6AA 3P75A 2RDFA 5CV6A 3NK9A 1EIGA 2JA8B 1JE4A 4BA2I 2EYMA 5IGBA 2IJ0A 1SFOB 5I9PA 2CQAA 1SEBD 2F0QA 1Q1EA 1VMPA 1GJXA 4RGNA 1PFBA 1D1IA 2F3WA 1ZYRD 3IAYA 3BDOA 1S5ED 1V43A 1RCVD 1DOMA 1H9SA 5D3IB 1WTVA 1UAPA 2F0SA 4RH6A 4C56C 1SNCA 4P2CB 3I4MB 2NTTA 4DN4M 3VYUA 2JA5B 1R4PB 2JA6B 3CRKC 4G4KA 2KHSA 1EQTA 4JBWA 1PDQA 3E5SA 2MP1A 3PIP3 2OF1A 5JEAH 3K59A 4OGQC 4ZUIA 1DONA 4KJOA 3MVVA 4I7ZC 5JJZA 4OL7A 4RHRA 1MSGA 4M1UB 1G6ZA 2MGSA 1BCPD 1IHZA 3V2TA 2KEDA 3NP8A 4KD4A 3CQZB 4DAVA 5M5XB 4XIGS 5NUCA 4IZ8A 4K8JA 4FNFA 2NVYB 4IUNA 3K5OA 2F03A 1J8IA 2PW5A 4LJZC 4HAEA 2IX3A 3PUVA 1SE3A 2O5JC 2HDMA 1O7ZA 1VDZA 3H6MA 1GHJA 5ELDA 2N88A 4XQNA 1RKNA 5C3WA 2D2CC 3AU7A 1JWMD 2XWBB 5D14A 3FDTA 1SNOA 2EJGC 2AUKA 1DCZA 5M5YB 2J7ZA 2EYFA 2AQ1B 1C48A 1HPCA 2KECA 2XVSA 1EIHA 1GUGA 5ELEA 3X3NA 1LTBD 3OMCA 1DOLA 1PMRA 2YYZA 3M4OB 4DXFA 1TVXA 1BDOA 4FF3A 1G291 1B9NA 1PZJD 2R92B 2EJFC 2WB1B 4N9TA 1SYFA 4KY5A 4CKEA 1A3VA 1HUMA 3G6JB 1ZXTA 4L63B 4TQUS 2LMCB 1EWHA 3QOLA 1AZQA 1AN8A 3K0YA 2Q8RE 4HSVA 2G9DA 2JEAI 3J80L 3A8KE 3TP5A 1HXYD 3TBIB 1TR5A 4C2MB 1KNEA 3Q6SA 1TWAB 5A2QL 1X3QA 2N55A 3S1QB 1T5XD 3TSSA 1S5FD 3FMCA 3BVMA 1SNDA 1STYA 5DEHA 4OO1I 1HQMC 1HTPA 1HFNA 3ITPA 5G3LD 1I6HB 2VB2X 3QOJA 1EY6A 3I4NB 4XT1B 4DU9A 5IGDA 2F0LA 2F0HA 5DNFA 1RHPA 3LWUA 3SXHA 4K2KA 1WD1A 3C2PA 4A3DB 1RJTA 3KF8A 4DA2A 1XXGA 1TY0A 1PXUA 4L6TB 2EXZA 1ICWA 2B2UC 2DNCA 1RTOA 1H9SB 2KEEA 2B2WA 1HQRD 2A5HA 3X3MA 2AWNA 4DK0A 5KNDA 4XDXA 1B9MA 1SBBB 2G9HD 1S4ZA 5EBCA 1ILPA 2ENBA 4IUVA 2C5CA 5E4WC 2NVTB 1GUNA 1LACA 3MFYA 3HKZB 1I4QA 3DUZA 5IIFA 2CVRA 2F0OA 4X3KA 2WV6D 1KNAA 4BWGB 2FMCA 2K03A 5IT9E 4RCNA 2SOBA 4KK7A 4CBVA 4B08A 1GUOA 1I4RA 2QCPX 2IWHA 1QG7A 1HTLD 3D6WA 3MTSA 1H9RA 3RMHA 3GTKB 2SNSA 1EEID 1DZ1A 3T56B 1M8AA 4PMCA 2XSCA 2LS01 2MHVA 3TN2A 1AZPA 2KCCA 1PTOF 1SXTA 2JP1A 1KAAA 3D31A 2OT2A 2F0NA 1KDBA 3S1RB 4OHJA 3PO2B 4KMUC 3PIO3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYU A;  1HCZ A;  1V43 A;  1H9S A;  3H94 A;  2D2C C;  2D62 A;  4HR7 B;  5KNB A;  1IYV A;  2A69 C;  2AWO A;  1TKW B;  2DNE A;  3LWU A;  3VR4 A;  2NN6 I;  1VCI A;  1I6V C;  2K7V A;  1YNN D;  2QF7 A;  1ZKO A;  2BDO A;  2PCF B;  4IQZ A;  2NN6 H;  2BA1 A;  3GQB A;  3PUY A;  4PV1 C;  5BN3 A;  5K36 G;  1O78 A;  4IFD H;  1Q1B A;  2EJG C;  3GD7 A;  3PUX A;  4KN4 C;  2AUK A;  2BE5 C;  3QIA A;  4KKU A;  1OXT A;  4KKT A;  2CW0 C;  4G7O C;  1DCZ A;  3QG1 A;  1Q90 A;  2R6G A;  4DNR B;  1VF5 C;  1HPC A;  1QJO A;  3FPP A;  3CRK C;  2E76 C;  1TU2 B;  2DNC A;  2IT1 A;  2JEB I;  4DNT B;  3WDN A;  4G7H C;  1H9J A;  1GUG A;  2E74 C;  5K36 H;  3TZU A;  1H9S B;  3NE5 B;  5JEA G;  3PUW A;  3VR6 A;  3M85 A;  3W3A A;  1FR3 A;  4H0L C;  3A7A B;  4JBW A;  1IW7 C;  1H9K A;  4LK1 C;  5BN5 A;  1PMR A;  2D5D A;  2YYZ A;  3RLF A;  4DK0 A;  1GHK A;  1Q12 A;  3LNN A;  3VR5 A;  3BG3 A;  5JEA H;  2A6H C;  5KND A;  1BDO A;  1B9M A;  3PUZ A;  3BDO A;  3ND9 A;  2KA7 A;  3VR2 A;  3I73 A;  2CW0 D;  1G29 1;  1OXX K;  4OGQ C;  2PPB C;  1FYC A;  1B9N A;  4GZY C;  1SMY C;  1T5E A;  2EJF C;  3SE0 A;  4I7Z C;  2B8F A;  1GUN A;  1LAC A;  3MXU A;  4DK1 A;  2A68 C;  2JE6 I;  3MFY A;  1E2V A;  2NN6 G;  1YNJ C;  1ZYR C;  1IW7 D;  3VA7 A;  5KNC A;  3SDZ A;  4JK1 C;  1V8Q A;  2PNR C;  1VF7 A;  3DXJ C;  2DN8 A;  4OO1 G;  1OXS C;  2A69 D;  3A8I E;  4RCN A;  2EDG A;  3IFT A;  2A6E C;  3EQL C;  3P20 A;  2Q8I B;  1CTM A;  2AUJ D;  4KI0 A;  2EVB A;  1YNN C;  4TQU S;  4G7Z C;  1Y69 U;  2LMC B;  3D4R A;  1EWH A;  1GUO A;  4BA1 I;  1H9M A;  3VR3 A;  2BE5 D;  4TKO B;  3IKJ A;  1SMY D;  3OW7 A;  2JXM B;  3AB9 A;  1H9R A;  2L5T A;  2JEA I;  2K32 A;  2V4D A;  3CRL C;  4H13 C;  3A8K E;  3M4Y A;  2A68 D;  3A7L A;  3ND8 A;  1O7L A;  4KKS A;  4XIG S;  3T53 B;  1YNJ D;  3I4L A;  2E75 C;  1E2Z A;  1A6X A;  1CFM A;  3OPO A;  4IFD G;  1CI3 M;  2B8G A;  4KN7 C;  3T56 B;  4L8J A;  3T51 B;  2A6E D;  4BA2 I;  1GUS A;  3L7Z C;  5C0X G;  2K33 A;  1DD2 A;  3QJY A;  1K8O A;  1OXU A;  1Z6H A;  4LJZ C;  3U9S A;  1Y8O B;  2A6H D;  1LAB A;  3A8J E;  1OXV A;  3FMC A;  3HGB A;  1GUT A;  3PUV A;  3M7N A;  3PV0 A;  1DXM A;  2O5I C;  3N6R A;  2BA0 A;  2KCC A;  3I72 A;  2ZT9 C;  2O5J C;  2F1M A;  1HQM C;  5C0X H;  4OO1 H;  1HTP A;  1K8M A;  1Q1E A;  5A35 A;  1VDZ A;  3D31 A;  4KHZ A;  1GJX A;  1Z7T A;  1GHJ A;  4H44 C;  3OOC A;  1Y8N B;  1E2W A;  1ONL A;  4KMU C;  4XTC S;  3KLR A;  1ZYR D;  5BN4 A;  1Y8P B;  2EJM A; 
#chains in the Genus database with same CATH topology
 4DR7 Q;  4QGU A;  1EIF A;  3FKI B;  4CDD C;  2RVL A;  4ZKC B;  4A3J G;  2DY7 A;  3BZD B;  3G71 A;  1KLG D;  5JJI A;  1WTW A;  3H3V H;  1DGS A;  2JYO A;  2B63 B;  4CDE C;  3STB C;  1PH3 A;  1STB A;  2Q2H A;  3D6C A;  2B39 A;  1F9Q A;  2OXP A;  2IT1 A;  1QVC A;  1ET9 A;  3RUZ A;  1WI5 A;  2TSS A;  4BBR G;  1ASZ A;  4UP8 A;  3HOW H;  1FR3 A;  2VNU D;  1X3P A;  1TS2 A;  1EYG A;  4A4I A;  4A3M G;  4JG2 A;  1QVG A;  4ZQ3 A;  2KCN A;  1EQQ A;  2E5L L;  2PPB C;  2Z9H A;  4GZY C;  3F1Z A;  4EX5 A;  1LT3 D;  4IUP A;  5AJ3 L;  3K0X A;  3ONA B;  2IL8 A;  4IN3 A;  3PSI A;  1LV9 A;  1EZ6 A;  1ZYR C;  4A3K B;  2IHE A;  2EY2 A;  3CCR A;  4OO1 G;  1PTO H;  3K5M A;  4B3M Q;  3FHW A;  2F0E A;  2Z6K A;  2Q8I B;  1D5Z C;  2Y0S B;  4HCS A;  1VQ4 A;  3C3L A;  1SMY D;  3IKJ A;  1CZG A;  1LTR D;  1LTI D;  3TS0 A;  1ET6 A;  2EZV A;  1G91 A;  4BBS G;  4XYQ A;  4IOC A;  4P74 A;  3I4L A;  1A2U A;  4X65 L;  5C0X J;  4UP9 A;  1KXL A;  1B8A A;  2B2V C;  2IX0 A;  5IGG A;  3PIO A;  4ZLT F;  4POG A;  4CKC A;  4RA8 A;  2K5D A;  2QEX A;  3S15 B;  4CDC C;  2AQ2 B;  3QJY A;  1Y1W B;  4YHH L;  4C2M H;  2IY5 B;  2WII B;  5C44 G;  4LFB L;  2EYO A;  2A6H D;  1LAB A;  3M7N A;  3S1Q H;  2I5L X;  3I70 A;  5A35 A;  3PO3 H;  1QZH A;  4DR1 Q;  2IW3 A;  5J3B A;  4OEM B;  3BJU A;  4HJA A;  2NN6 G;  1I6H H;  3I4N H;  4PMB A;  5IP7 H;  1BCP C;  4A3G B;  4RAU C;  2EYJ A;  3G48 A;  1IYV A;  4U67 3;  1B53 A;  2AWO A;  1S5C D;  2HDL A;  4RWS C;  2F52 A;  2OWO A;  4LF4 L;  1XMO Q;  3J7A F;  1FVI A;  3EJI A;  5CBE E;  4X3S A;  1X65 A;  1U5K A;  4IFD H;  2K4K A;  1PRT F;  3R2T A;  4IO9 A;  2G5D A;  2XN9 C;  4A3D H;  1P16 A;  1EUJ A;  2WAQ B;  1PH5 A;  3DLL A;  3GTG B;  5HGT A;  2KHJ A;  1GD7 A;  3WDN A;  1D5X C;  1Z47 A;  2F0D A;  2CWP A;  4JI5 Q;  1LTL A;  1ESR A;  4JCV E;  4AH6 A;  2FMM A;  3IL8 A;  4DR6 L;  2D5D A;  4DAY A;  3RLF A;  3LNN A;  1M90 C;  5G3L F;  1PZI D;  3PUZ A;  1LO5 D;  1GUW A;  1E24 A;  4DK3 C;  4ME5 A;  5FJ8 H;  2OEO A;  3MXP A;  4X62 L;  4ALP A;  1KRT A;  5M3M H;  1N33 Q;  4J15 A;  2ATW A;  4DK1 A;  3SEB A;  5M3F G;  2PQE A;  1W6K A;  3W5O A;  1N34 L;  3CC4 A;  3DWP A;  4PZ8 A;  2MJ8 A;  1TS3 A;  4HMJ A;  2A69 D;  4O42 A;  4LF8 Q;  5C4H A;  1LTG D;  4G57 A;  4A3B G;  4BY7 B;  3SK4 A;  3UDF A;  1Y69 U;  1WCM B;  5IYD G;  3I8Z A;  2B2Y C;  4IAL A;  1S72 A;  4LFA Q;  1D6E C;  1JOQ A;  4LWC A;  4C1N K;  1V9P A;  4NXN Q;  2F4I A;  2PI2 E;  4QB4 A;  1AP0 A;  1UE5 A;  3GTQ H;  1BBU A;  2F0J A;  2B2T C;  4RGM A;  3RN5 A;  1AE2 A;  2EPB A;  3F8T A;  1B3A A;  1N9W A;  2H4O A;  1K8O A;  3OWE B;  3HEJ A;  4JI2 Q;  4NDX A;  2Z0S A;  3O13 A;  3CF5 A;  4JI4 Q;  1JT8 A;  1RTN A;  5F2D A;  4DR4 L;  1DXM A;  3RZD B;  3TP8 A;  4LF7 L;  4DV7 Q;  3W2D A;  2F0M A;  3ER0 A;  3K5N A;  3L3O C;  1K8A C;  3U58 A;  1Z7T A;  3SK5 A;  1YZ6 A;  2ID0 A;  4IPC A;  4B9W A;  3I3C A;  1VQ6 A;  1EL0 A;  3BDL A;  4C3H G;  1L0X B;  5IT9 L;  2HUG A;  1STE A;  2NZH A;  2D62 A;  3QWN A;  2L12 A;  2PZU A;  1TWG B;  1YHB A;  1VCI A;  1I6V C;  2BDO A;  4A3J B;  4L5S A;  2F0P A;  2K5N A;  1JR0 D;  4R4T A;  4GNX B;  3HKS A;  3U4V A;  5C0X I;  2CW0 C;  1Q90 A;  4A3I B;  1VF5 C;  2OTJ A;  1EY0 A;  2QIL A;  1WTP A;  5FLM G;  1I3Q B;  4JI7 Q;  2Q8T A;  3KBX A;  3MZ5 A;  2RDG A;  3M85 A;  5JOB A;  4HIM A;  3KJP A;  1K9M C;  2UUC Q;  4K14 A;  4B3T Q;  5ELF A;  3BVG A;  3D0F A;  2Q2U A;  4BBR B;  5JJL A;  4JVZ A;  1JC7 A;  4X64 Q;  4A75 A;  3H0G G;  2I5H A;  2JSO A;  1EEF D;  4JW0 A;  3T1Y L;  2B2Y A;  4PZ6 A;  5LMU Q;  4A3M B;  2K05 A;  3DM3 A;  2E2J B;  4H02 A;  2M00 A;  3SE0 A;  1F2Y A;  4OIK A;  2B8F A;  1VQD A;  3K81 C;  1F9P A;  4DV4 L;  1YNJ C;  3BVZ A;  2PZW A;  5JVG 3;  2B2T A;  3LGJ A;  2Z4H A;  1IKL A;  2N3S A;  4NPS A;  4A3K H;  5CV5 A;  1SE2 A;  3M3Y B;  3IFD A;  4G7Z C;  2RQX A;  1PVO A;  3R93 A;  1I4P A;  3S2D H;  1EOT A;  1QCB D;  2BE5 D;  3GV3 A;  3C1F A;  2QA4 A;  2JA7 G;  4QF4 A;  2R7D A;  2K32 A;  5C5L A;  4FVM A;  1VQI A;  4F88 A;  1BOS A;  2VUM G;  4BBS B;  5CV9 A;  1YJW A;  4GKJ Q;  1PH1 A;  4R1J A;  3D8G A;  1NSN S;  1PTO D;  3AFP A;  2Z6B A;  2PNH A;  1HNW L;  3S1N B;  5LL6 X;  2IPK D;  2NWG A;  1R9T H;  4OIJ A;  4ZYS A;  1HFG A;  2CKZ B;  5JVH 3;  3A56 A;  3HGB A;  2VB3 X;  1VQ7 A;  3MEF A;  1QUQ A;  3N6R A;  3I72 A;  1QE6 A;  2ZT9 C;  1U0L A;  5C44 B;  5KYI A;  5ISR A;  3L2P A;  4BXX G;  2YTY A;  4DR7 L;  1A62 A;  1PFN A;  1TS5 A;  4EVO A;  1SNM A;  1NJI C;  3I4O A;  4BY1 G;  4K5X A;  2F0G A;  4XQJ A;  1U4P A;  3HOV G;  3HOZ G;  4CJ2 C;  2KJX A;  5GAG C;  2DGY A;  5KNB A;  1KHI A;  3E6Z X;  2L4N A;  3J81 j;  1KRS A;  2X6G A;  4F87 A;  1YNN D;  4DK6 C;  4B3S Q;  3K7A H;  2MO1 A;  2QF7 A;  3RNU A;  4A3G H;  5BN3 A;  5K36 G;  3C46 A;  4YHH Q;  5M5W B;  1BXT A;  3HOU H;  4GLV B;  4RHS A;  5EPK A;  3NWS A;  2MNA A;  1MSH A;  1TU2 B;  2DJF C;  2JEB I;  5FOB B;  3NE5 B;  4R9W A;  3GTG H;  4RMF A;  3NUC A;  5KRU A;  1IW7 C;  1LTT D;  2NB0 A;  2Q2T A;  1AEX A;  2VZA A;  1NMF A;  2RF4 A;  4FXD A;  3PIP A;  1YBY A;  2WAQ E;  5CYU A;  3UI2 A;  5GAE C;  3AQQ A;  2XRS D;  3F2C A;  1STN A;  1MBY A;  1AFP A;  1HR0 W;  1HJP A;  4B3M L;  1STH A;  3KLW A;  1CQF A;  2LKV A;  1ZEQ X;  1TWH B;  5GAH C;  1Y14 B;  5M3F B;  4DV2 L;  5FLX E;  5GQO A;  1U4R A;  2A6E C;  1HNZ Q;  3ICE A;  1LTS D;  5HUR A;  1F2M A;  2FFK B;  2DJG C;  2WP8 J;  2JQO A;  4FXK C;  1EZ8 A;  4A3B B;  3URY A;  1B70 B;  4FF2 A;  1Y1V H;  4M8A A;  5I9O A;  2QW7 A;  2A68 D;  2LY7 A;  2XGT A;  3CKI B;  1GXD C;  1V1Q A;  2RCF A;  4MIU A;  3GV6 A;  1FNW A;  1BO0 A;  5IWA L;  2KBN A;  3KF6 B;  4L5Q A;  4PQX A;  1XTD A;  1WVL A;  1UE6 A;  2Y0S G;  1GUS A;  5C0X G;  4HJ5 A;  1E7Z A;  2K33 A;  5EKL A;  4DR5 Q;  3BYT B;  1NNX A;  1N34 Q;  5I2Y A;  4IUU A;  1X56 A;  4KD3 A;  1CKM A;  3NSW A;  1CHP D;  1N36 L;  1VS0 A;  3AYH B;  3RZD H;  2L1B A;  3A54 A;  5IT9 c;  5ELO A;  4Q0F A;  3KLS X;  3QO2 A;  3BS1 A;  1BCP B;  1PRT D;  2EJM A;  1XMO L;  4GLX A;  1XNQ L;  1SYC A;  4DUZ Q;  4P73 A;  1I94 Q;  5EKI A;  3CCJ A;  4C3H B;  4KV6 A;  2ASB A;  1K0R A;  1CSQ A;  5C5M A;  2JA8 H;  1NY4 A;  2FHT A;  1MKH A;  3GDE A;  4A76 A;  5KYL A;  2EY6 A;  3NQI A;  4LNQ A;  3S1M B;  4PNY A;  2RSO A;  1Q86 C;  1CSP A;  1SFO H;  4JI5 L;  3CD6 A;  5C3E G;  3FPP A;  4J1M A;  4MTK A;  1BBX C;  1IYJ B;  5LHY 1;  4LF7 Q;  3I91 A;  1CK1 A;  2UXD Q;  1I3Q H;  4KHV A;  1BR9 A;  3P1H A;  1H9K A;  4LK1 C;  1VQL A;  5E4X A;  4CHT B;  3OSO A;  3GTO B;  1KLU D;  1IL2 A;  2A6H C;  1EQV A;  1F77 A;  1PFM A;  1FL0 A;  3H0G B;  3VYS A;  4DAP A;  3PMF A;  2K5Q A;  4RKL A;  3M4P A;  3NEM A;  4GNX C;  2LXJ A;  4YY3 L;  2A74 C;  2EQS A;  4RKB A;  3AMU A;  4LF8 L;  1XYI A;  3CPW A;  3NBH A;  2JA6 H;  5KNC A;  3JC6 6;  4QUC A;  4IUT A;  1MJE A;  4LFA L;  1AW7 A;  1PFS A;  4IJH A;  4JI1 Q;  4KI0 A;  4NXN L;  3PCO B;  3M3Y H;  3OWF A;  3EN2 A;  4IFD J;  1EFI D;  2OQ0 A;  1VQC A;  4KKS A;  3T1Y Q;  2EYL A;  1DJR D;  3R2I A;  5J22 A;  1VMC A;  2JA7 B;  1NCV A;  1A6X A;  3S24 A;  4JI2 L;  2OTL A;  3UDI A;  4YWL A;  2CCZ A;  1VQM A;  4BBS H;  2VUM B;  5CC4 A;  2TMP A;  2QKI C;  3SHL A;  3TZD A;  1HR0 L;  1B50 A;  4Y52 H;  4DV4 Q;  2MUY A;  5DM7 3;  1QNK A;  3S1N H;  3QB3 A;  2K5V A;  1I4G A;  3K5L A;  1VQE A;  2XTI A;  1V1P B;  3TEH B;  3W1B A;  4HMI A;  1WTQ A;  2K5W A;  1ESF A;  5M5X H;  1JWU D;  2IX1 A;  2PQA A;  1IKM A;  2IHF A;  4BY1 B;  1KAW A;  4QQB X;  3HOZ B;  5JPM C;  3HOV B;  2A69 C;  4N8X 1;  1Q7Y C;  2F3V A;  5FO9 B;  2PO4 A;  3H3V I;  3S2H B;  5C4X G;  2RBM A;  2NN6 H;  1B7Y B;  1JQY D;  1UEB A;  1CKO A;  5CR3 A;  1Q1B A;  1II3 A;  5JPN C;  3TRZ A;  3W1G A;  4QIW B;  4B3T L;  1CHQ D;  1D8L A;  1QJO A;  4GNX A;  4EQP A;  5M5W H;  3TDQ A;  1N8R C;  3TQY A;  2N78 A;  2B2U A;  2E74 C;  5I6Y A;  1EY5 A;  3TZU A;  4LUV A;  3T1H Q;  4UY8 C;  5EKK A;  4A3E G;  4I7A A;  5EJW A;  2QDL A;  1HZC A;  5LMU L;  1AH9 A;  4ZKB B;  2M9V A;  1ILQ A;  3U4Z A;  3NQT A;  3GTM B;  3I73 A;  3D3R A;  2F0I A;  2VS1 A;  4V0B A;  1MJC A;  4A3I G;  4JI6 Q;  4Z9C B;  1LT5 D;  5E7N A;  1T5E A;  4IJL A;  3CXC A;  2L55 A;  2A8V A;  4TRD A;  4ZRZ A;  1L2F A;  2JE6 I;  2NVQ B;  1QOH A;  5M5Y H;  1E3P A;  1EYD A;  4Q5V A;  1HUN A;  3SDZ A;  1WTX A;  3KOJ A;  1WD0 A;  2PNR C;  4K5W A;  1VF7 A;  4XT3 B;  2K5H A;  5IGF A;  3IFT A;  3P20 A;  2YV5 A;  3Q23 A;  5M3F H;  1J5E L;  5ELC A;  1LT6 D;  2VQF L;  4JV5 L;  3FRP B;  3VR3 A;  1YNX A;  5DAU A;  3M4O H;  4GN5 A;  4GKJ L;  3G7L A;  3HRZ C;  5EPL A;  2R7Z G;  4A3B H;  2KUM A;  1KD1 C;  4JBJ A;  2R92 H;  1QNU A;  3FPU B;  4L8J A;  3T51 B;  1FNV A;  3DEO A;  1DD2 A;  2BH2 A;  3VYR A;  5DM6 3;  3H3V C;  3J80 c;  5IYB G;  4RFB A;  2WB1 E;  1PYB A;  4DV2 Q;  2XRQ D;  1B2T A;  1SRO A;  2KEN A;  3J81 E;  5CV8 A;  1TS4 A;  4GN4 B;  4NP5 A;  4DUY Q;  2HCI A;  3MA2 B;  1SN8 A;  2GN5 A;  4QUF A;  1I50 B;  1E2W A;  3LX0 A;  2KCT A;  3OW7 A;  4B3S L;  5FLX L;  1WTR A;  5L37 A;  4Y7N B;  1KQS A;  5BR8 L;  1N32 L;  1TKW B;  4ZAI A;  1TWA H;  3WOF A;  4IFD I;  2R7F A;  5IWA Q;  1SJE D;  5IE8 A;  1EIY B;  1JOO A;  1K0S A;  3R3O A;  1C0A A;  2BE5 C;  2FIN B;  2HD3 A;  2ZXP A;  3QIA A;  4DF7 A;  1S40 A;  4KKT A;  3GTJ B;  4G7O C;  2PMZ B;  1ENA A;  5JEA J;  4F8M A;  1JE5 A;  1TQO A;  3GTP B;  2O4X A;  4G7H C;  2WKD A;  3CP0 A;  3PUW A;  1N36 Q;  5C3E B;  3N52 A;  1PTO C;  1PH7 A;  4OON A;  5T1I A;  1VQ9 A;  4GOP C;  5CV7 A;  1HZB A;  2D9U A;  3E9H A;  4N9P A;  2J0T D;  2ZM6 L;  3TP6 A;  1XNQ Q;  4RG1 A;  4A3L G;  1LLR D;  1SJH D;  2GA4 B;  2RHQ B;  3V05 A;  1UNS A;  3SK6 A;  4NMZ A;  4K6D A;  3CU7 A;  4JI0 L;  4XQQ A;  1HNZ L;  1NUC A;  4KJN A;  4CGY B;  1CA6 A;  2LXK A;  1PHJ A;  5KEE A;  4JK1 C;  1JCK B;  2AUJ D;  1YNN C;  5FKA C;  1SE4 A;  4WFN 3;  3RLN A;  2QEJ C;  2XWJ B;  3HG9 A;  4TKO B;  2BCO A;  3B6Y A;  2RCN A;  5AFW A;  3NEL A;  3SR1 A;  4X66 L;  2NZ1 D;  3NBH B;  2R93 B;  4ABN A;  3QR8 A;  1YJ9 A;  1TWF B;  4PG3 A;  3OIQ A;  4YCW A;  4DR5 L;  1NE3 A;  3OPO A;  1M4V A;  1CI3 M;  1JB7 A;  2NVT H;  2K01 A;  2B8G A;  4WRD A;  1JJ2 A;  2JA7 H;  2B2V A;  4YY3 Q;  4UAI A;  3G6E A;  1HRJ A;  3KF6 A;  2VUM H;  3DEP A;  2BDN A;  2O5I C;  2XIW A;  2F0T A;  2BA0 A;  3HOW G;  4WJW A;  2ES2 A;  3HS0 C;  4A3F B;  1YIT A;  3HKZ E;  2AKW B;  2VW9 A;  4DUZ L;  1I94 L;  4R4C A;  2CHB D;  5HGQ A;  2UUA L;  3Q22 A;  3GTK H;  1G8Z D;  5J39 A;  1K73 C;  1SMX A;  3S9W A;  4GOP A;  4LMQ D;  2SNM A;  4O1N A;  3F2D A;  3A5U A;  3HOV H;  3HOZ H;  4QMG A;  4DV5 L;  4PV1 C;  1YJN A;  3GD7 A;  5C4X B;  1A2T A;  3NTH A;  1HR0 Q;  2UXD L;  2R6G A;  3HFZ B;  2F0F A;  2I07 B;  2PQA B;  4MNO A;  4DNT B;  5K36 H;  4KLK A;  3VR6 A;  5IGC A;  5C4J B;  3S14 B;  3MC0 B;  4LFC Q;  3S1R H;  3PO2 H;  1VQH A;  4A3E B;  2EYH A;  1E0B A;  3OHX C;  1G2T A;  1D2B A;  3FKI H;  1O7I A;  1MIU A;  1YI2 A;  2KA7 A;  1LTA D;  1OXX K;  3RZO B;  5I2X A;  4FDB A;  4YCV A;  2B63 H;  1QIL A;  5COY A;  1BNZ A;  4DKA C;  3TME A;  1X9N A;  4JI1 L;  1H95 A;  1G2S A;  4E6I A;  3HOY G;  1PRT C;  2EY1 A;  1TY2 A;  4XXE A;  1V8Q A;  2EE1 A;  4C3J G;  5JJK A;  2LFN A;  3PO3 G;  1GVP A;  2AHO B;  3D4W A;  1CQV A;  3EFX D;  2F4V L;  3GTL B;  2ICI A;  1W2B A;  2HIV A;  2JXM B;  1UEA B;  3J7Y W;  4S3S A;  2K04 A;  2UXC L;  3A7L A;  5EAY A;  1E2Z A;  1T9H A;  1VQB A;  4IFD G;  1D1K A;  2R7Z B;  4QJF A;  4KN7 C;  1X54 A;  4C3I G;  5E3F A;  1A3T A;  1SNQ A;  1F2L A;  1L1O C;  2NZO A;  1GUT A;  1U4M A;  3PV0 A;  4J8Q A;  2F1M A;  1L0Y B;  5C0X H;  4YCU A;  2O2L D;  1E1T A;  3DMU A;  1V1O A;  2R3Z A;  1J5E Q;  2K6A A;  2VQF Q;  1CM9 A;  4JV5 Q;  1Y8N B;  2WAC A;  4KHP L;  2Z1C A;  1PLF A;  3TS2 A;  1HA5 A;  1V1P A;  5KGU A;  2Y0S E;  1U4L A;  4V19 0;  4X3U A;  2PI2 A;  3S16 B;  3UDG A;  4K5V A;  4AIM A;  2YU9 B;  3S15 H;  3A55 A;  1R4Q B;  4TSS A;  5C4Z A;  3PF4 A;  1O78 A;  1Y1W H;  1W3S A;  1KDA A;  2BOS A;  3T1H L;  3JAM E;  4KKU A;  1OXT A;  1IL8 A;  3BZK A;  3QG1 A;  3KUP A;  1F9R A;  3GTJ H;  2HQL A;  1AE3 A;  1X32 A;  1FNU A;  1QB5 D;  1WYD A;  3G4S A;  1ENF A;  4K6L A;  4UPA A;  1XJV A;  4J6H A;  2SDF A;  1HA6 A;  4JI6 L;  5IP9 G;  2HQE A;  1Q12 A;  5K5P A;  3VR5 A;  4HJ9 A;  1EWC A;  1BVS A;  1EY8 A;  3FP9 A;  5BR8 Q;  4ZUJ A;  1EYC A;  3J81 L;  3FEW X;  3H15 A;  1VQ5 A;  1N32 Q;  4IUQ A;  3SK8 A;  1Q46 A;  1S3O A;  4R8N A;  5IOD A;  4FF1 A;  1E2V A;  1HH2 P;  1A3U A;  3VA7 A;  3ERQ A;  5CBA E;  4OX9 Q;  1OXS C;  1O80 A;  3S17 B;  1L1O A;  3M4Q A;  5J1Z A;  4LF6 Q;  5DLQ E;  4K0K L;  1RIP A;  3D4R A;  4PMW A;  1K83 B;  1VQJ A;  3J7A 5;  4A93 G;  3EVQ A;  3U9O A;  1PA6 A;  2ZM6 Q;  1F2Z A;  1O7L A;  4RGO S;  1Q3L A;  4ULL A;  3K57 A;  1E1O A;  2H5X A;  1SYG A;  3DWQ A;  4LW1 A;  4JI3 Q;  1Z9F A;  1O7Y A;  4YIJ A;  3L7Z C;  1MD2 D;  4JI0 Q;  4NB3 A;  4JPB W;  5GAD C;  3U9S A;  2CH4 A;  1JJC B;  2L9H A;  4A3C H;  4DUY L;  4DGZ A;  1ASY A;  1FGB D;  4BY7 H;  1U9R A;  1WCM H;  4KHZ A;  4KY6 A;  1YEZ A;  3HOW B;  1IXR A;  4CJ1 B;  3KLR A;  1SYD A;  2E2D C;  3HOX G;  3VDY A;  3ZYY X;  1IYU A;  4X66 Q;  4OXP A;  5CV4 A;  3H94 A;  4HR7 B;  3KYH C;  1BKB A;  3SVM A;  2PCF B;  2A19 A;  2BA1 A;  2HCC A;  4IPG A;  2L11 A;  1MHW C;  3PUX A;  4DPG A;  1QWY A;  2C35 B;  3J7A V;  2YTX A;  3K6O A;  5C4X H;  1QVF A;  4P75 A;  2PYK A;  1H9J A;  1DOK A;  1PTO B;  2B2W C;  5JEA G;  4AYB G;  4GOP B;  3W3A A;  3A7A B;  1B44 D;  2SEB D;  3NBI A;  3GP7 A;  5C4J H;  1EYA A;  3L9A X;  3ULJ A;  2UUA Q;  2C9O A;  4CJ0 B;  1WFQ A;  2F0V A;  2JA9 A;  3CHB D;  3PGZ A;  3RLO A;  1WTO A;  3U50 C;  2MO0 A;  4JYA L;  4R4O A;  4A3E H;  2UUB L;  5IYC H;  1IBL L;  1JWS D;  1TWG H;  2CW0 D;  2HT1 A;  1HZ9 A;  1PZK D;  2RKS A;  1FYC A;  1SMY C;  3RN2 A;  1BUV T;  4A3J H;  3DWA A;  3Q0A A;  4C1N I;  2F0K A;  2A73 B;  4DV5 Q;  3MFG A;  1FJG Q;  5KIX A;  4FXG C;  1XMQ L;  4JOI C;  1A8V A;  4A3I H;  1EU4 A;  1VQF A;  4DV1 L;  5GRO A;  4DV6 L;  5JAV A;  4RGT A;  4LF5 Q;  1PH4 A;  3A0J A;  1YVC A;  3HOY B;  3J81 i;  3F2U A;  4ILW A;  4C3J B;  1FD7 D;  1HHV A;  3OIP A;  4BBR H;  4F7X A;  4MHE A;  1I4X A;  1SSO A;  3PO3 B;  1RL2 A;  4BA1 I;  2GVB A;  1B3Q A;  5FO8 B;  1C7Y A;  5ELN A;  2L15 A;  3GTL H;  2NTS A;  3AB9 A;  4R4Q A;  2L5T A;  1KAB A;  4RCO A;  4NW2 A;  5M9O A;  3M4Y A;  4A3M H;  3ND8 A;  2E2J H;  1YNJ D;  3MWY W;  4FO2 A;  2RDH A;  1EOV A;  3ERO A;  3CCQ A;  3NHH A;  2EY5 A;  1SYB A;  1STA A;  1SRU A;  1Y8O B;  3DHQ A;  3A8J E;  1TWC B;  2CWA A;  4IUR A;  4C3I B;  2WKC A;  1K8G A;  4OO1 H;  2R93 G;  1C4Q A;  4YWK A;  2F4V Q;  4H44 C;  5I6W A;  2VXW A;  3E0J A;  5IYB H;  1ONL A;  2WIN B;  4XTC S;  4DFA A;  3OMG A;  2M2L A;  2ZTC A;  1ML0 D;  1HCZ A;  2UXC Q;  2K75 A;  2DNE A;  4JC0 A;  3I2Z A;  1Q8K A;  2A1A A;  1PYW D;  2NN6 I;  1UUP A;  1ZKO A;  3CC2 A;  3R8B A;  1D5M C;  3GQB A;  1B4O A;  4MZ9 A;  2I46 A;  5M3M B;  3Q24 A;  4A3F G;  3TP7 A;  1KTK A;  4KN4 C;  5EBD A;  2KOL A;  2YU9 H;  1XWE A;  3RR5 A;  1W6J A;  3A5Z B;  4ZCK A;  4LFC L;  4TVA B;  2NUC A;  4DV3 Q;  2ZXR A;  1YHA A;  5C44 H;  1SAP A;  2QDB A;  1XPU A;  3OTO Q;  4JOI A;  1EFW A;  2B3G A;  2K28 A;  2E2H B;  3J81 c;  4X6A H;  1GHK A;  1ENC A;  1OO9 B;  4HED A;  4KHP Q;  4HJ7 A;  1CUK A;  2XNA C;  3MHB A;  5EGT A;  5IGE A;  3I90 A;  2NYZ D;  4B3R Q;  4DNI A;  3GTQ B;  1L0W A;  2JK8 A;  2ZXO A;  3MXU A;  2VQE Q;  1PRT B;  2Q2I A;  2Z8L A;  4A3L H;  1J9O A;  3OYY A;  3T16 A;  1IW7 D;  1CA5 A;  4DR2 L;  1XX8 A;  1A15 A;  1STG A;  2Z6K C;  3P7J A;  2EXD A;  3BU2 A;  1CTM A;  1VQA A;  3NXW A;  1IBK Q;  2F3I A;  2UU9 L;  1LUZ A;  1Q8I A;  2EYP A;  2EIF A;  3JAM L;  4AQY Q;  3S17 H;  2RSN A;  4WOR A;  4NXM Q;  1BCP F;  1EY9 A;  3CRL C;  1NAP A;  3T53 B;  2K1B A;  3HZX A;  4EQN A;  1GO3 E;  2E75 C;  4A93 B;  5T1G A;  1ICF B;  5EQ0 A;  3MEH A;  1JIC A;  4HSP A;  4LF9 Q;  1M1K C;  1L1O B;  3NPP A;  2NVX B;  2A6E D;  1TWH H;  1OXU A;  1Z6H A;  2EOT A;  3H09 A;  1WOC A;  3KBG A;  1SYE A;  3PQI A;  3E3X A;  4HN7 A;  3EBE A;  5E1F A;  2PW7 A;  1K8M A;  2JN4 A;  4B9X A;  1TT2 A;  4N8F A;  4K0K Q;  2UXB Q;  2LSS A;  3I56 A;  4WJ4 A;  3OOC A;  3FVQ A;  2X6L A;  3DM1 A;  3T13 A;  5IYD H;  2K14 A;  4DV0 Q;  3HP3 A;  1NMG A;  3VYT A;  3HOX B;  3I4M G;  1JOR A;  3VR4 A;  1A63 A;  2K7V A;  4EQO A;  4IQZ A;  1K3B C;  3PUY A;  3MXG A;  3V96 A;  3KDF A;  2JA5 G;  1X6O A;  2JA6 G;  3T4A C;  4P72 A;  2K50 A;  3H91 A;  1LM0 A;  4ZK9 B;  4DNR B;  4IPD A;  2CQO A;  3CCL A;  1RD9 D;  1VQG A;  3CC7 A;  4MN3 A;  3D4D A;  5HY6 A;  1WTH A;  2V1C C;  4ODG A;  2F0U A;  1XPR A;  4H0L C;  4GLA C;  1XTC D;  4XYO A;  1SLJ A;  5EPJ A;  5BN5 A;  4AYB B;  3S2D B;  4GN3 B;  4HID A;  1MI2 A;  3BG3 A;  4U68 A;  3CCS A;  4X3T A;  1I4H A;  1UWV A;  2JJQ A;  3EA6 A;  3KLS A;  3GO5 A;  5FK9 C;  5LMN Q;  3VR2 A;  1Q82 C;  3CCE A;  4C3H H;  1SDF A;  4KTA A;  1GKH A;  3RD4 A;  2X69 A;  1YHQ A;  1KDC A;  2WFW A;  2PZT A;  2ZTE A;  4OX9 L;  4FP5 D;  3S1M H;  2MFI A;  1EY7 A;  1R9T B;  1GM5 A;  2H1E A;  4BS9 A;  4LF6 L;  1NBW A;  3DXJ C;  1DM0 B;  2DN8 A;  4NKL A;  1NTG A;  3A8I E;  4IOA A;  4I65 A;  5IOC A;  1A0I A;  3EQL C;  5FLM H;  5ELB A;  2NBF A;  1VQN A;  3NTI A;  4H7B A;  1J6Q A;  1JJG A;  3HOY H;  4HTH A;  1Q81 C;  1ROD A;  3MXN A;  1PH9 A;  1H9M A;  4ID6 A;  4C3J H;  3GTO H;  1S5B D;  4HCE A;  4UDU C;  2DY8 A;  1UE7 A;  4OWW B;  3M7G A;  2J4X A;  1NR2 A;  3H0G H;  4JI3 L;  3F2B A;  4JYA Q;  2UUB Q;  1RDP D;  1IBL Q;  1CFM A;  2ZJP A;  3I55 A;  1JMC A;  3K7A B;  3JAM i;  1PYS B;  3NWT A;  1XMQ Q;  5D65 A;  1LT4 D;  5FO7 B;  1XNR L;  1OXV A;  1TII D;  4LAA A;  3HOU B;  4DV1 Q;  5CMD A;  4R8I A;  4DV6 Q;  1BQQ T;  1BF4 A;  1TWC H;  1TXY A;  1DYQ A;  4DXG A;  1VQP A;  4C3I H;  1RF2 D;  1YIJ A;  2L0C A;  4FYD A;  1BBW A;  3M9B A;  3Q8D A;  3WWV A;  2AQ3 B;  5BN4 A;  1Y8P B;  1IZ6 A;  1CT1 D;  3KK7 A;  2R61 A;  1F9S A;  1JOK A;  2VL6 A;  3KF8 B;  4JI8 L;  5I4D A;  2KVM A;  4K2L A;  1VQO A;  2KQ3 A;  1JB3 A;  4KY7 A;  3J80 E;  2E76 C;  4CKB A;  1EY4 A;  2E2I B;  3VA5 A;  1X55 A;  2MPM A;  1VQ8 A;  5LL6 S;  1PV4 A;  4R4I A;  4BXX H;  3BYY B;  5A2Q E;  2E2H H;  3NTK A;  4BY1 H;  1MGS A;  1KIX A;  2R92 G;  1Y1V B;  4IPH A;  1FJG L;  2WB1 G;  3ND9 A;  3OW2 A;  1C8C A;  3S2H H;  3K58 A;  2FJ2 A;  3MAQ A;  5IP9 H;  1S5D D;  2F0W A;  4LF5 L;  1SE8 A;  2A68 C;  5TSS A;  5C3X A;  3CME A;  3LWE A;  3JAM c;  2HHH L;  1EU3 A;  1SNP A;  2EDG A;  2Z4I A;  4QCL A;  2EVB A;  3E0E A;  4K8I A;  3BDC A;  2RA4 A;  1X3G A;  4QIW E;  3STB D;  1GOZ A;  1NR4 A;  5COR A;  1B1Z A;  3GTM H;  2V4D A;  4H13 C;  5D3D A;  3WOE A;  4EGV A;  3C1E A;  3EIV A;  5CGK A;  1C9O A;  2ICE C;  4FF4 A;  1CZW A;  3CAM A;  5C6A A;  3P75 A;  2RDF A;  5CV6 A;  2FXQ A;  3NK9 A;  1EIG A;  3AFQ A;  1JE4 A;  2BH8 A;  2NVQ H;  2JA8 B;  4A93 H;  4BA2 I;  3L0O A;  2EYM A;  3IRB A;  5IGB A;  2IJ0 A;  3A74 A;  4GKK Q;  2NVX H;  4DR2 Q;  4JBM A;  1SFO B;  5I9P A;  2CQA A;  1SEB D;  2F0Q A;  3I4N G;  5IP7 G;  1Q1E A;  1VMP A;  5LMN W;  1GJX A;  4RGN A;  3AEV A;  1PFB A;  1D1I A;  2F3W A;  2UU9 Q;  1ZYR D;  3IAY A;  3BDO A;  1S5E D;  3TRE A;  1V43 A;  1RCV D;  1DOM A;  2HIX A;  1H9S A;  5D3I B;  4A3D G;  4P71 A;  1WTV A;  1UAP A;  2F0S A;  4RH6 A;  3HOX H;  4C56 C;  4DV3 L;  1SNC A;  4P2C B;  3I4M B;  2NTT A;  3UE1 A;  2E8G A;  4DN4 M;  3OTO L;  2D0P A;  3I7F A;  3VYU A;  5FLX c;  2JA5 B;  1PH6 A;  1R4P B;  2JA6 B;  3CRK C;  4G4K A;  2KHS A;  1EQT A;  1HNX L;  5IY0 A;  4JBW A;  1PDQ A;  1FGU A;  1I50 H;  2YTV A;  5FJ8 G;  1K28 A;  2VY3 A;  3E5S A;  5M3M G;  4ME3 A;  2MP1 A;  3PIP 3;  4B3R L;  3KDF B;  4Y7N H;  2OF1 A;  5H1S E;  5JEA H;  2ZJQ A;  3K59 A;  2N8N A;  2ZTD A;  1CKN A;  2N49 A;  2VQE L;  3J7Z C;  4OGQ C;  3K7U C;  4ZUI A;  1DON A;  3HKZ G;  4KJO A;  3MVV A;  4I7Z C;  4DR3 L;  4WJ3 M;  4HIK A;  5JJZ A;  1QZG A;  4OL7 A;  2E5L Q;  4RHR A;  4AYB E;  1MSG A;  1G6P A;  4M1U B;  1IBM L;  5AJ3 Q;  1G6Z A;  2MGS A;  1IBK L;  3GTP H;  1BCP D;  1IHZ A;  4AQY L;  3K8A A;  5C3E H;  3V2T A;  2KED A;  4NXM L;  3NP8 A;  4KD4 A;  2PMZ E;  4DAM A;  3CQZ B;  4DAV A;  5M5X B;  4LF9 L;  4XIG S;  5NUC A;  4IZ8 A;  1X3F A;  4K8J A;  4FNF A;  2NVY B;  4IUN A;  3K5O A;  2OCE A;  2F03 A;  1KC8 C;  1J8I A;  2PW5 A;  4X65 Q;  3MXN B;  1KL9 A;  4LJZ C;  4HAE A;  1SR3 A;  3KFU A;  2IX3 A;  3PUV A;  1SE3 A;  2UXB L;  2O5J C;  2HDM A;  3PO2 G;  4DV0 L;  1O7Z A;  1P8L A;  4LFB Q;  1VDZ A;  3H6M A;  1GHJ A;  5ELD A;  2N88 A;  3FKI G;  2I5M X;  1I5F A;  2GVA A;  4XQN A;  1RKN A;  2R93 H;  1TWF H;  5C3W A;  2D2C C;  3AU7 A;  3ERS X;  4GS3 A;  2B63 G;  1JWM D;  4JBK A;  2XWB B;  5D14 A;  3FDT A;  1SNO A;  3BZC A;  4PZ7 A;  2P5Z X;  4L5R C;  2EJG C;  2AUK A;  4LF4 Q;  3ZJY C;  1DCZ A;  5M5Y B;  2J7Z A;  2EYF A;  2RHS B;  1HZA A;  1C48 A;  1HPC A;  2AQ1 B;  2KEC A;  1XNR Q;  2XVS A;  3UE0 A;  1EIH A;  4A3F H;  1GUG A;  5ELE A;  3SGI A;  3ULL A;  3X3N A;  1LTB D;  4DAY B;  3OMC A;  5LMN L;  1DOL A;  2E2I H;  1PMR A;  2YYZ A;  3M4O B;  4DXF A;  2CH4 W;  1TVX A;  1BDO A;  4POF A;  4FF3 A;  1G29 1;  4DR6 Q;  1B9N A;  1PZJ D;  4JI8 Q;  2R92 B;  2ALY B;  2EJF C;  2WB1 B;  1LYL A;  4N9T A;  1SYF A;  4KY5 A;  4A3K G;  4CKE A;  1XPO A;  4X62 Q;  3UDX A;  4APV A;  1A3V A;  1HUM A;  2K52 A;  3S14 H;  3G6J B;  1ZXT A;  4L63 B;  4DR1 L;  4TQU S;  2LMC B;  1EWH A;  3QOL A;  1AZQ A;  3K0Y A;  1AN8 A;  3CW2 C;  2Q8R E;  4HSV A;  2G9D A;  2JEA I;  3J80 L;  3A8K E;  2AMC B;  3TP5 A;  3RZO H;  1HXY D;  3TBI B;  1UE1 A;  1TR5 A;  3CCM A;  3CPF A;  1Y1W G;  4C2M B;  1KNE A;  3Q6S A;  1TWA B;  4QY7 A;  5A2Q L;  1WJJ A;  1X3Q A;  2N55 A;  3S1Q B;  1T5X D;  3TSS A;  1S5F D;  3NEN A;  3FMC A;  3BVM A;  2DUD A;  1SND A;  1STY A;  5DEH A;  2HHH Q;  4OO1 I;  1HQM C;  4LUZ A;  1HTP A;  1HFN A;  3ITP A;  4DR4 Q;  5G3L D;  1I6H B;  2VB2 X;  3QOJ A;  1EY6 A;  4EQ5 A;  4MTN A;  3I4N B;  4A3G G;  3CCV A;  4XT1 B;  4DU9 A;  5IGD A;  3ULP A;  2F0L A;  2F0H A;  5DNF A;  1RHP A;  2R7Z H;  1N33 L;  3LWU A;  3SXH A;  4UP7 A;  3HOU G;  4O0A A;  4K2K A;  1WD1 A;  1OTC A;  3C2P A;  4A3D B;  4CDF C;  2WAQ G;  1RJT A;  2KHI A;  3KF8 A;  3CCU A;  3PF5 A;  1X3E A;  4DA2 A;  1XXG A;  3I4M H;  4LUO A;  1D7Q A;  1EQR A;  1PXU A;  1TY0 A;  4L6T B;  2EXZ A;  1ICW A;  2B2U C;  2DNC A;  1RTO A;  1H9S B;  2JA5 H;  2KEE A;  2B2W A;  1HQR D;  2A5H A;  3X3M A;  4UHV A;  3E9I A;  2AWN A;  1EWI A;  4DK0 A;  3CMA A;  4O2D A;  4XDX A;  1B9M A;  5KND A;  1SBB B;  2G9H D;  4QL5 A;  1S4Z A;  3S16 H;  4OEL B;  5EBC A;  1ILP A;  2ENB A;  4IUV A;  2C5C A;  5E4W C;  2OQK A;  2NVT B;  1GUN A;  1LAC A;  3MFY A;  3HKZ B;  4A3C G;  4OWX B;  1I4Q A;  3DUZ A;  4JI4 L;  2F0O A;  2CVR A;  5IIF A;  4X3K A;  2WV6 D;  4L5T A;  1KNA A;  4BWG B;  4BY7 G;  2FMC A;  4DV7 L;  2K03 A;  5IT9 E;  4RCN A;  1WCM G;  1Y1V G;  2SOB A;  2ZJR A;  1CKN B;  4HJ8 A;  2D0O A;  1HNX Q;  2I0Q A;  4KK7 A;  4HIO A;  4CBV A;  4YWM A;  4B08 A;  1GUO A;  1I4R A;  1E22 A;  2QCP X;  2IWH A;  1QG7 A;  1HTL D;  3D6W A;  3MTS A;  1H9R A;  3KJO A;  3CQZ H;  2B29 A;  1VQK A;  3RMH A;  2KCM A;  3GTK B;  2SNS A;  1EEI D;  1DZ1 A;  4GKK L;  2MQH A;  2CFM A;  3T56 B;  1M8A A;  4PMC A;  4DR3 Q;  1G51 A;  1QUQ B;  1PH8 A;  2NVY H;  2XSC A;  1K3R A;  2LS0 1;  2MHV A;  3J80 i;  3TN2 A;  1IBM Q;  1AZP A;  4JI7 L;  1HNW Q;  2KCC A;  1PTO F;  3K80 C;  1SXT A;  2UUC L;  2JP1 A;  2QGQ A;  1KAA A;  4OWT B;  3D31 A;  2OT2 A;  2F0N A;  1KDB A;  1K83 H;  3S1R B;  4OHJ A;  3PO2 B;  4X64 L;  1PH2 A;  4KMU C;  2JA8 G;  5IYC G;  3PIO 3; 
#chains in the Genus database with same CATH homology
 3FKI B;  2RVL A;  4ZKC B;  2DY7 A;  3BZD B;  1KLG D;  1WTW A;  2JYO A;  2B63 B;  1STB A;  3D6C A;  2B39 A;  1F9Q A;  2OXP A;  2IT1 A;  1ET9 A;  3RUZ A;  2TSS A;  1FR3 A;  2VNU D;  1X3P A;  1TS2 A;  4ZQ3 A;  2KCN A;  2PPB C;  4GZY C;  1LT3 D;  4IUP A;  3ONA B;  2IL8 A;  4IN3 A;  1LV9 A;  1EZ6 A;  1ZYR C;  4A3K B;  2EY2 A;  4OO1 G;  1PTO H;  3K5M A;  2F0E A;  2Q8I B;  1D5Z C;  2Y0S B;  4HCS A;  3C3L A;  1SMY D;  3IKJ A;  1CZG A;  1LTR D;  1LTI D;  2EZV A;  1ET6 A;  1G91 A;  4XYQ A;  3I4L A;  1A2U A;  5C0X J;  5IGG A;  2B2V C;  2IX0 A;  4ZLT F;  4CKC A;  4RA8 A;  2K5D A;  3S15 B;  2AQ2 B;  3QJY A;  1Y1W B;  2WII B;  2EYO A;  2A6H D;  1LAB A;  3M7N A;  3I70 A;  5A35 A;  2IW3 A;  2NN6 G;  4PMB A;  1BCP C;  4A3G B;  4RAU C;  2EYJ A;  1IYV A;  4U67 3;  1B53 A;  2AWO A;  1S5C D;  2HDL A;  4RWS C;  3J7A F;  3EJI A;  5CBE E;  4X3S A;  4IFD H;  1PRT F;  3R2T A;  2XN9 C;  2WAQ B;  3GTG B;  5HGT A;  3WDN A;  1D5X C;  1Z47 A;  2F0D A;  1ESR A;  2FMM A;  3IL8 A;  2D5D A;  4DAY A;  3RLF A;  3LNN A;  5G3L F;  1PZI D;  3PUZ A;  1LO5 D;  1GUW A;  4ME5 A;  2OEO A;  3MXP A;  4DK1 A;  3SEB A;  2PQE A;  1W6K A;  3DWP A;  2MJ8 A;  1TS3 A;  4HMJ A;  2A69 D;  4O42 A;  5C4H A;  1LTG D;  4G57 A;  4BY7 B;  3SK4 A;  1Y69 U;  1WCM B;  3I8Z A;  2B2Y C;  4IAL A;  1D6E C;  1JOQ A;  4C1N K;  2F4I A;  4QB4 A;  1AP0 A;  2F0J A;  2B2T C;  4RGM A;  2EPB A;  1B3A A;  2H4O A;  1K8O A;  3OWE B;  3HEJ A;  4NDX A;  3O13 A;  1RTN A;  5F2D A;  1DXM A;  3RZD B;  3TP8 A;  3W2D A;  2F0M A;  3K5N A;  3L3O C;  1Z7T A;  3SK5 A;  2ID0 A;  4B9W A;  3I3C A;  1EL0 A;  3BDL A;  4C3H G;  1L0X B;  5IT9 L;  2HUG A;  1STE A;  2D62 A;  3QWN A;  2L12 A;  2PZU A;  1TWG B;  1VCI A;  1I6V C;  2BDO A;  4A3J B;  2F0P A;  1JR0 D;  5C0X I;  2CW0 C;  1Q90 A;  4A3I B;  1VF5 C;  1EY0 A;  2QIL A;  1WTP A;  1I3Q B;  2Q8T A;  3KBX A;  3MZ5 A;  2RDG A;  3M85 A;  5JOB A;  4K14 A;  5ELF A;  3BVG A;  4BBR B;  1JC7 A;  2JSO A;  1EEF D;  2B2Y A;  4A3M B;  2K05 A;  2E2J B;  2M00 A;  3SE0 A;  1F2Y A;  4OIK A;  2B8F A;  1F9P A;  1YNJ C;  3BVZ A;  2PZW A;  5JVG 3;  2B2T A;  2Z4H A;  1IKL A;  5CV5 A;  1SE2 A;  3M3Y B;  3IFD A;  4G7Z C;  2RQX A;  3R93 A;  1I4P A;  1EOT A;  1QCB D;  2BE5 D;  3GV3 A;  3C1F A;  4QF4 A;  2K32 A;  5C5L A;  4FVM A;  4F88 A;  1BOS A;  4BBS B;  5CV9 A;  3D8G A;  1NSN S;  1PTO D;  3S1N B;  5LL6 X;  2IPK D;  2NWG A;  4OIJ A;  4ZYS A;  1HFG A;  5JVH 3;  3A56 A;  3HGB A;  2VB3 X;  3N6R A;  3I72 A;  1QE6 A;  2ZT9 C;  5C44 B;  5KYI A;  5ISR A;  1PFN A;  1TS5 A;  4EVO A;  1SNM A;  4K5X A;  2F0G A;  4XQJ A;  1U4P A;  4CJ2 C;  2KJX A;  5KNB A;  3E6Z X;  2L4N A;  2X6G A;  4F87 A;  1YNN D;  2QF7 A;  5BN3 A;  5K36 G;  3C46 A;  5M5W B;  1BXT A;  4RHS A;  5EPK A;  3NWS A;  1MSH A;  1TU2 B;  2JEB I;  5FOB B;  3NE5 B;  4R9W A;  3NUC A;  5KRU A;  1IW7 C;  1LTT D;  2NB0 A;  1AEX A;  4FXD A;  5CYU A;  3UI2 A;  2XRS D;  1STN A;  1MBY A;  1AFP A;  1STH A;  1CQF A;  2LKV A;  1ZEQ X;  1TWH B;  5M3F B;  5FLX E;  1U4R A;  2A6E C;  5HUR A;  1LTS D;  1F2M A;  2FFK B;  2WP8 J;  4FXK C;  1EZ8 A;  4A3B B;  3URY A;  4FF2 A;  5I9O A;  4M8A A;  2A68 D;  2LY7 A;  3CKI B;  1GXD C;  4MIU A;  3GV6 A;  1FNW A;  1BO0 A;  4PQX A;  1WVL A;  1GUS A;  5C0X G;  2K33 A;  5EKL A;  3BYT B;  5I2Y A;  4IUU A;  4KD3 A;  3NSW A;  1CHP D;  2L1B A;  3A54 A;  4Q0F A;  3KLS X;  3QO2 A;  3BS1 A;  1BCP B;  1PRT D;  2EJM A;  1SYC A;  5EKI A;  4C3H B;  4KV6 A;  5C5M A;  2FHT A;  5KYL A;  2EY6 A;  3NQI A;  3S1M B;  4PNY A;  2RSO A;  3FPP A;  4J1M A;  1BBX C;  5LHY 1;  3I91 A;  1CK1 A;  4KHV A;  1BR9 A;  3P1H A;  1H9K A;  4LK1 C;  5E4X A;  4CHT B;  3OSO A;  3GTO B;  1KLU D;  2A6H C;  1EQV A;  1F77 A;  1PFM A;  3H0G B;  3VYS A;  4DAP A;  3PMF A;  2K5Q A;  4RKL A;  2A74 C;  3AMU A;  4RKB A;  1XYI A;  3NBH A;  5KNC A;  4QUC A;  4IUT A;  1AW7 A;  4KI0 A;  3OWF A;  4IFD J;  1EFI D;  4KKS A;  2EYL A;  1DJR D;  3R2I A;  5J22 A;  1VMC A;  2JA7 B;  1NCV A;  1A6X A;  2VUM B;  5CC4 A;  2TMP A;  2QKI C;  3SHL A;  3TZD A;  1B50 A;  2MUY A;  5DM7 3;  1QNK A;  3QB3 A;  1I4G A;  3K5L A;  1V1P B;  1WTQ A;  4HMI A;  2K5W A;  1ESF A;  1JWU D;  2IX1 A;  1IKM A;  4BY1 B;  3HOZ B;  5JPM C;  3HOV B;  2A69 C;  2F3V A;  5FO9 B;  2PO4 A;  3S2H B;  2RBM A;  2NN6 H;  1JQY D;  5CR3 A;  1Q1B A;  1II3 A;  5JPN C;  4QIW B;  1CHQ D;  1QJO A;  4EQP A;  3TDQ A;  2B2U A;  2E74 C;  5I6Y A;  1EY5 A;  3TZU A;  5EKK A;  5EJW A;  4ZKB B;  2M9V A;  1ILQ A;  3NQT A;  3GTM B;  3I73 A;  3D3R A;  2F0I A;  4V0B A;  4Z9C B;  1LT5 D;  1T5E A;  2L55 A;  4TRD A;  4ZRZ A;  2JE6 I;  2NVQ B;  1QOH A;  1EYD A;  4Q5V A;  1HUN A;  3SDZ A;  1WTX A;  1WD0 A;  2PNR C;  4K5W A;  1VF7 A;  4XT3 B;  5IGF A;  3IFT A;  3P20 A;  3Q23 A;  5ELC A;  1LT6 D;  3FRP B;  3VR3 A;  5DAU A;  3G7L A;  3HRZ C;  5EPL A;  2KUM A;  1QNU A;  3FPU B;  4L8J A;  3T51 B;  1FNV A;  3DEO A;  1DD2 A;  3VYR A;  5DM6 3;  3H3V C;  4RFB A;  2XRQ D;  1B2T A;  3J81 E;  5CV8 A;  1TS4 A;  4NP5 A;  2HCI A;  3MA2 B;  4QUF A;  1I50 B;  1E2W A;  3LX0 A;  3OW7 A;  5FLX L;  1WTR A;  4Y7N B;  1TKW B;  4ZAI A;  3WOF A;  4IFD I;  1SJE D;  1JOO A;  3R3O A;  2BE5 C;  2FIN B;  2ZXP A;  3QIA A;  4DF7 A;  3GTJ B;  4KKT A;  4G7O C;  2PMZ B;  1ENA A;  5JEA J;  4F8M A;  1TQO A;  3GTP B;  2O4X A;  4G7H C;  2WKD A;  3PUW A;  5C3E B;  3N52 A;  1PTO C;  5T1I A;  5CV7 A;  2D9U A;  4N9P A;  2J0T D;  3TP6 A;  1LLR D;  1SJH D;  2GA4 B;  3V05 A;  1UNS A;  3SK6 A;  4NMZ A;  4K6D A;  3CU7 A;  4XQQ A;  1NUC A;  4KJN A;  4CGY B;  1CA6 A;  5KEE A;  4JK1 C;  1JCK B;  2AUJ D;  1YNN C;  5FKA C;  1SE4 A;  4WFN 3;  2QEJ C;  2XWJ B;  3HG9 A;  4TKO B;  2BCO A;  5AFW A;  3SR1 A;  2NZ1 D;  2R93 B;  4ABN A;  1TWF B;  3OIQ A;  3OPO A;  1M4V A;  1CI3 M;  2K01 A;  2B8G A;  4WRD A;  2B2V A;  4UAI A;  1HRJ A;  3DEP A;  2BDN A;  2O5I C;  2XIW A;  2F0T A;  2BA0 A;  4WJW A;  3HS0 C;  4A3F B;  2CHB D;  3Q22 A;  1G8Z D;  5J39 A;  3S9W A;  4LMQ D;  2SNM A;  4O1N A;  4QMG A;  4PV1 C;  3GD7 A;  5C4X B;  1A2T A;  3NTH A;  2R6G A;  2F0F A;  2I07 B;  4DNT B;  5K36 H;  3VR6 A;  5IGC A;  5C4J B;  3S14 B;  3MC0 B;  4A3E B;  2EYH A;  1E0B A;  3OHX C;  1G2T A;  1D2B A;  2KA7 A;  1LTA D;  1OXX K;  3RZO B;  5I2X A;  1QIL A;  5COY A;  1BNZ A;  3TME A;  1G2S A;  4E6I A;  1PRT C;  2EY1 A;  1TY2 A;  4XXE A;  4C3J G;  1V8Q A;  2EE1 A;  2LFN A;  3D4W A;  1CQV A;  3EFX D;  3GTL B;  2ICI A;  2JXM B;  1UEA B;  3J7Y W;  4S3S A;  2K04 A;  3A7L A;  1E2Z A;  4IFD G;  1D1K A;  2R7Z B;  4KN7 C;  4C3I G;  5E3F A;  1A3T A;  1SNQ A;  1F2L A;  1GUT A;  1U4M A;  3PV0 A;  4J8Q A;  2F1M A;  1L0Y B;  5C0X H;  2O2L D;  1V1O A;  2R3Z A;  3DMU A;  2K6A A;  1CM9 A;  1Y8N B;  2WAC A;  2Z1C A;  1PLF A;  1HA5 A;  1V1P A;  5KGU A;  1U4L A;  4V19 0;  4X3U A;  3S16 B;  4K5V A;  2YU9 B;  3A55 A;  1R4Q B;  4TSS A;  5C4Z A;  1O78 A;  1KDA A;  2BOS A;  3JAM E;  4KKU A;  1OXT A;  1IL8 A;  3QG1 A;  3KUP A;  1F9R A;  1X32 A;  1FNU A;  1QB5 D;  1ENF A;  4K6L A;  4J6H A;  2SDF A;  1HA6 A;  2HQE A;  1Q12 A;  5K5P A;  3VR5 A;  1EWC A;  1EY8 A;  4ZUJ A;  1EYC A;  3J81 L;  3FEW X;  4IUQ A;  3SK8 A;  4R8N A;  5IOD A;  4FF1 A;  1E2V A;  1A3U A;  3VA7 A;  3ERQ A;  5CBA E;  1OXS C;  1O80 A;  3S17 B;  5J1Z A;  3D4R A;  4PMW A;  1K83 B;  3EVQ A;  3U9O A;  1F2Z A;  1O7L A;  4RGO S;  1Q3L A;  4ULL A;  3K57 A;  1SYG A;  3DWQ A;  1O7Y A;  4YIJ A;  3L7Z C;  1MD2 D;  3U9S A;  2L9H A;  4DGZ A;  1FGB D;  1U9R A;  4KHZ A;  4KY6 A;  3HOW B;  4CJ1 B;  3KLR A;  1SYD A;  2E2D C;  3ZYY X;  1IYU A;  5CV4 A;  3H94 A;  4HR7 B;  3SVM A;  2PCF B;  2BA1 A;  2HCC A;  2L11 A;  3PUX A;  1QWY A;  3J7A V;  3K6O A;  2PYK A;  1H9J A;  1DOK A;  1PTO B;  2B2W C;  5JEA G;  3W3A A;  3A7A B;  1B44 D;  2SEB D;  3NBI A;  3GP7 A;  1EYA A;  3L9A X;  2C9O A;  4CJ0 B;  2F0V A;  3CHB D;  1WTO A;  1JWS D;  2CW0 D;  1PZK D;  2RKS A;  1FYC A;  1SMY C;  1BUV T;  3DWA A;  3Q0A A;  4C1N I;  2F0K A;  2A73 B;  3MFG A;  5KIX A;  4FXG C;  1EU4 A;  5JAV A;  4RGT A;  3HOY B;  3F2U A;  4ILW A;  4C3J B;  1FD7 D;  1HHV A;  3OIP A;  4F7X A;  4MHE A;  1I4X A;  1SSO A;  3PO3 B;  4BA1 I;  5FO8 B;  2NTS A;  3AB9 A;  2L5T A;  1KAB A;  4RCO A;  4NW2 A;  5M9O A;  3M4Y A;  3ND8 A;  1YNJ D;  3MWY W;  4FO2 A;  2RDH A;  3ERO A;  3NHH A;  2EY5 A;  1SYB A;  1STA A;  1Y8O B;  3DHQ A;  3A8J E;  1TWC B;  4IUR A;  4C3I B;  2WKC A;  4OO1 H;  1C4Q A;  4H44 C;  5I6W A;  2VXW A;  3E0J A;  1ONL A;  2WIN B;  4XTC S;  4DFA A;  3OMG A;  2M2L A;  1ML0 D;  1HCZ A;  2DNE A;  2NN6 I;  1PYW D;  1UUP A;  1ZKO A;  3R8B A;  1D5M C;  3GQB A;  1B4O A;  3Q24 A;  2I46 A;  5M3M B;  3TP7 A;  1KTK A;  4KN4 C;  5EBD A;  2KOL A;  1XWE A;  1W6J A;  2NUC A;  2ZXR A;  1SAP A;  2QDB A;  2K28 A;  2E2H B;  1GHK A;  1ENC A;  1OO9 B;  4HED A;  2XNA C;  3MHB A;  5EGT A;  5IGE A;  3I90 A;  2NYZ D;  3GTQ B;  2ZXO A;  3MXU A;  1PRT B;  2Z8L A;  1J9O A;  3T16 A;  1IW7 D;  1CA5 A;  1XX8 A;  1A15 A;  1STG A;  3P7J A;  1CTM A;  3NXW A;  2EYP A;  1Q8I A;  3JAM L;  2RSN A;  4WOR A;  1BCP F;  1EY9 A;  3CRL C;  1NAP A;  3T53 B;  2K1B A;  3HZX A;  4EQN A;  2E75 C;  4A93 B;  5T1G A;  5EQ0 A;  3MEH A;  1JIC A;  4HSP A;  3NPP A;  2NVX B;  2A6E D;  1OXU A;  1Z6H A;  2EOT A;  3H09 A;  3KBG A;  1SYE A;  4HN7 A;  5E1F A;  2PW7 A;  1K8M A;  4B9X A;  1TT2 A;  3OOC A;  3FVQ A;  2X6L A;  3DM1 A;  3T13 A;  3HP3 A;  3VYT A;  3HOX B;  1JOR A;  3VR4 A;  2K7V A;  4EQO A;  4IQZ A;  3PUY A;  3MXG A;  3V96 A;  3T4A C;  3H91 A;  4ZK9 B;  4DNR B;  1RD9 D;  4MN3 A;  3D4D A;  4ODG A;  2F0U A;  4H0L C;  1XTC D;  4XYO A;  5EPJ A;  5BN5 A;  4AYB B;  3S2D B;  1MI2 A;  3BG3 A;  4U68 A;  4X3T A;  1I4H A;  3EA6 A;  3KLS A;  3GO5 A;  5FK9 C;  3VR2 A;  1SDF A;  4KTA A;  3RD4 A;  2X69 A;  1KDC A;  2PZT A;  4FP5 D;  1EY7 A;  1R9T B;  2H1E A;  4BS9 A;  3DXJ C;  1DM0 B;  2DN8 A;  4NKL A;  3A8I E;  4I65 A;  5IOC A;  3EQL C;  5ELB A;  2NBF A;  3NTI A;  4H7B A;  4HTH A;  1ROD A;  3MXN A;  1H9M A;  4ID6 A;  1S5B D;  4HCE A;  4UDU C;  2DY8 A;  3M7G A;  2J4X A;  1NR2 A;  1RDP D;  1CFM A;  3K7A B;  3NWT A;  5D65 A;  1LT4 D;  5FO7 B;  1OXV A;  1TII D;  4LAA A;  3HOU B;  5CMD A;  4R8I A;  1BQQ T;  1BF4 A;  1DYQ A;  4DXG A;  1RF2 D;  2L0C A;  4FYD A;  2AQ3 B;  5BN4 A;  1Y8P B;  1CT1 D;  3KK7 A;  2R61 A;  1F9S A;  1JOK A;  5I4D A;  2KVM A;  4K2L A;  2KQ3 A;  1JB3 A;  4KY7 A;  3J80 E;  2E76 C;  4CKB A;  1EY4 A;  2E2I B;  3VA5 A;  2MPM A;  5LL6 S;  3BYY B;  5A2Q E;  3NTK A;  1MGS A;  1Y1V B;  3ND9 A;  1C8C A;  3K58 A;  2FJ2 A;  3MAQ A;  1S5D D;  2F0W A;  2A68 C;  5TSS A;  5C3X A;  3LWE A;  1EU3 A;  1SNP A;  2EDG A;  2Z4I A;  4QCL A;  2EVB A;  4K8I A;  3BDC A;  2RA4 A;  1GOZ A;  1NR4 A;  5COR A;  1B1Z A;  2V4D A;  4H13 C;  5D3D A;  3WOE A;  4EGV A;  3C1E A;  5CGK A;  2ICE C;  4FF4 A;  1CZW A;  5C6A A;  3P75 A;  2RDF A;  5CV6 A;  3NK9 A;  1EIG A;  2JA8 B;  1JE4 A;  4BA2 I;  2EYM A;  5IGB A;  2IJ0 A;  1SFO B;  5I9P A;  2CQA A;  1SEB D;  2F0Q A;  1Q1E A;  1VMP A;  1GJX A;  4RGN A;  1PFB A;  1D1I A;  2F3W A;  1ZYR D;  3IAY A;  3BDO A;  1S5E D;  1V43 A;  1RCV D;  1DOM A;  1H9S A;  5D3I B;  1WTV A;  1UAP A;  2F0S A;  4RH6 A;  4C56 C;  1SNC A;  4P2C B;  3I4M B;  2NTT A;  4DN4 M;  3VYU A;  2JA5 B;  1R4P B;  2JA6 B;  3CRK C;  4G4K A;  2KHS A;  1EQT A;  4JBW A;  1PDQ A;  3E5S A;  2MP1 A;  3PIP 3;  2OF1 A;  5JEA H;  3K59 A;  4OGQ C;  4ZUI A;  1DON A;  4KJO A;  3MVV A;  4I7Z C;  5JJZ A;  4OL7 A;  4RHR A;  1MSG A;  4M1U B;  1G6Z A;  2MGS A;  1BCP D;  1IHZ A;  3V2T A;  2KED A;  3NP8 A;  4KD4 A;  3CQZ B;  4DAV A;  5M5X B;  4XIG S;  5NUC A;  4IZ8 A;  4K8J A;  4FNF A;  2NVY B;  4IUN A;  3K5O A;  2F03 A;  1J8I A;  2PW5 A;  4LJZ C;  4HAE A;  2IX3 A;  3PUV A;  1SE3 A;  2O5J C;  2HDM A;  1O7Z A;  1VDZ A;  3H6M A;  1GHJ A;  5ELD A;  2N88 A;  4XQN A;  1RKN A;  5C3W A;  2D2C C;  3AU7 A;  1JWM D;  2XWB B;  5D14 A;  3FDT A;  1SNO A;  2EJG C;  2AUK A;  1DCZ A;  5M5Y B;  2J7Z A;  2EYF A;  2AQ1 B;  1C48 A;  1HPC A;  2KEC A;  2XVS A;  1EIH A;  1GUG A;  5ELE A;  3X3N A;  1LTB D;  3OMC A;  1DOL A;  1PMR A;  2YYZ A;  3M4O B;  4DXF A;  1TVX A;  1BDO A;  4FF3 A;  1G29 1;  1B9N A;  1PZJ D;  2R92 B;  2EJF C;  2WB1 B;  4N9T A;  1SYF A;  4KY5 A;  4CKE A;  1A3V A;  1HUM A;  3G6J B;  1ZXT A;  4L63 B;  4TQU S;  2LMC B;  1EWH A;  3QOL A;  1AZQ A;  1AN8 A;  3K0Y A;  2Q8R E;  4HSV A;  2G9D A;  2JEA I;  3J80 L;  3A8K E;  3TP5 A;  1HXY D;  3TBI B;  1TR5 A;  4C2M B;  1KNE A;  3Q6S A;  1TWA B;  5A2Q L;  1X3Q A;  2N55 A;  3S1Q B;  1T5X D;  3TSS A;  1S5F D;  3FMC A;  3BVM A;  1SND A;  1STY A;  5DEH A;  4OO1 I;  1HQM C;  1HTP A;  1HFN A;  3ITP A;  5G3L D;  1I6H B;  2VB2 X;  3QOJ A;  1EY6 A;  3I4N B;  4XT1 B;  4DU9 A;  5IGD A;  2F0L A;  2F0H A;  5DNF A;  1RHP A;  3LWU A;  3SXH A;  4K2K A;  1WD1 A;  3C2P A;  4A3D B;  1RJT A;  3KF8 A;  4DA2 A;  1XXG A;  1TY0 A;  1PXU A;  4L6T B;  2EXZ A;  1ICW A;  2B2U C;  2DNC A;  1RTO A;  1H9S B;  2KEE A;  2B2W A;  1HQR D;  2A5H A;  3X3M A;  2AWN A;  4DK0 A;  5KND A;  4XDX A;  1B9M A;  1SBB B;  2G9H D;  1S4Z A;  5EBC A;  1ILP A;  2ENB A;  4IUV A;  2C5C A;  5E4W C;  2NVT B;  1GUN A;  1LAC A;  3MFY A;  3HKZ B;  1I4Q A;  3DUZ A;  5IIF A;  2CVR A;  2F0O A;  4X3K A;  2WV6 D;  1KNA A;  4BWG B;  2FMC A;  2K03 A;  5IT9 E;  4RCN A;  2SOB A;  4KK7 A;  4CBV A;  4B08 A;  1GUO A;  1I4R A;  2QCP X;  2IWH A;  1QG7 A;  1HTL D;  3D6W A;  3MTS A;  1H9R A;  3RMH A;  3GTK B;  2SNS A;  1EEI D;  1DZ1 A;  3T56 B;  1M8A A;  4PMC A;  2XSC A;  2LS0 1;  2MHV A;  3TN2 A;  1AZP A;  2KCC A;  1PTO F;  1SXT A;  2JP1 A;  1KAA A;  3D31 A;  2OT2 A;  2F0N A;  1KDB A;  3S1R B;  4OHJ A;  3PO2 B;  4KMU C;  3PIO 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...