3OSOA

Crystal structure of staphylococcal nuclease variant delta+phs l25a at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKAMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3osoA00
4KY5A 1SNCA 3ERQA 5KIXA 2PQEA 2PYKA 3PMFA 1EY8A 5IOCA 1SYBA 3C1FA 1A3TA 4HTHA 1STAA 3MHBA 4KY6A 2M00A 1NUCA 3QOJA 5I6YA 2F0KA 5IGDA 2KQ3A 5IODA 1EYDA 4N9PA 4H7BA 5C4HA 4KTAA 5KRUA 4EQNA 2PZUA 3MXPA 4IZ8A 1EQVA 4HMIA 5KYLA 2EYMA 3MVVA 1ENAA 2F0JA 4NMZA 5IGCA 5CV9A 1ENCA 2PW7A 5EGTA 1A2UA 4KD4A 4ZQ3A 1SYEA 2EYHA 5DAUA 3NXWA 2F0NA 2EY2A 1EY7A 5HURA 1KABA 4ZUIA 2F0DA 4J6HA 1SYGA 2RKSA 1SNDA 2EYJA 1EYAA 3R3OA 4TRDA 4N9TA 3MZ5A 5CC4A 4RKLA 2F0HA 1SNOA 4B9XA 3D8GA 2F0TA 2EXZA 1JOOA 4K14A 5JAVA 3EJIA 1JOKA 5HGTA 2HQEA 1EY4A 4G57A 4K2LA 2RDFA 2F0OA 2F0IA 2EY6A 3DMUA 4WORA 4YIJA 4DGZA 2EYOA 3DHQA 2NUCA 1EY9A 5C3WA 1TQOA 1A2TA 3NK9A 4F7XA 5C3XA 1KDBA 4DF7A 5KYIA 1SNQA 4EQPA 2EY5A 4K5VA 4K5XA 5IGGA 1EZ6A 1II3A 1SYCA 4NP5A 4R8NA 3VA5A 4EVOA 3OMGA 5I9OA 4RKBA 5EKKA 5K5PA 3S9WA 4HMJA 3QOLA 2EYFA 2F0PA 5IGEA 1RKNA 3NHHA 2F0VA 4IUNA 4NKLA 4DU9A 1SYFA 2OF1A 5J39A 1F2ZA 2WACA 3LX0A 4KY7A 1SYDA 3EROA 5CV7A 5CV8A 5DEHA 1EZ8A 5E3FA 1EY0A 5F2DA 3ITPA 5IGFA 5KEEA 3RUZA 4KHVA 5EKLA 1STNA 1STHA 3EVQA 4I65A 4QF4A 2SNMA 1F2MA 4IALA 2F0FA 1EY5A 4ZUJA 3TP5A 4ME5A 3SR1A 1AEXA 1STBA 4ID6A 4WRDA 5NUCA 1KAAA 3SK6A 4QMGA 2PW5A 3NUCA 4K8IA 4LAAA 2F0SA 4K2KA 4DFAA 2QDBA 3OMCA 2SNSA 5E1FA 3TP6A 4F8MA 3H6MA 2EYPA 4KV6A 4NDXA 3SK4A 5IIFA 2F0EA 1A3UA 2KHSA 1JORA 3BDCA 3T16A 2F3WA 1KDCA 1EYCA 2F0LA 1TT2A 2SOBA 5C5LA 2F0MA 1U9RA 5IGBA 2LKVA 3NQTA 4KJNA 5JOBA 3D4DA 3TP8A 5KGUA 1STGA 2O4XA 1EY6A 3E5SA 4K5WA 1IHZA 2EY1A 3P1HA 4E6IA 5CV6A 4B9WA 3HZXA 3OWFA 4KD3A 4EQOA 5CV4A 1A3VA 5C5MA 3P75A 3TP7A 3V2TA 5C6AA 2F0GA 2EYLA 3QB3A 5C4ZA 4PMCA 2ENBA 1TR5A 5CR3A 5I9PA 4PMBA 4K6DA 3BDLA 4KJOA 5J1ZA 2RBMA 3MEHA 4PNYA 2PZTA 1KDAA 5CV5A 1SNMA 3D4WA 5J22A 1SNPA 2OEOA 2F3VA 4OL7A 3SHLA 5CGKA 5ISRA 2F0WA 4MIUA 4J1MA 1F2YA 4QB4A 3SK8A 3SXHA 2F0UA 3T13A 3TMEA 5M9OA 4K8JA 2PZWA 3HEJA 3NP8A 2F0QA 3D6CA 4ODGA 1STYA 4S3SA 1NSNS 5I6WA 2OXPA 3OSOA 3U9OA 1JOQA 3SK5A 3C1EA
chains in the Genus database with same CATH superfamily
1T5EA 4R1JA 1UE5A 3BS1A 4DUZL 2A74C 2K7VA 5I2XA 4C3HB 3HOUH 2G5DA 2RA4A 1B50A 3SDZA 2IY5B 1GUTA 4KTAA 2Z8LA 3G6JB 4HMIA 2J7ZA 1VS0A 4EX5A 1G6ZA 1ENCA 1Q46A 2WV6D 1YVCA 1QJOA 3FRPB 1CUKA 3H0GB 4CDCC 1HNZQ 5HURA 5JVH3 3W1GA 5CMDA 4DV1L 1SNDA 4A3CG 3MZ5A 1PRTC 2F0HA 4UDUC 1P8LA 2WB1B 3GP7A 4LF7Q 1QOHA 1IXRA 3TSSA 1TS4A 4H02A 1A15A 2WFWA 2NUCA 4XT1B 5M5XB 1HPCA 1T9HA 3IAYA 1B8AA 4HCEA 4AH6A 4DR7Q 5IP7G 4RMFA 1CZGA 4LFCL 1TXYA 4BBRG 1AE3A 3VR4A 4XQJA 1BBWA 3NBHB 1QB5D 3X3NA 4A3GH 5KEEA 2UUCQ 5D14A 3GTKH 4IALA 2Y0SG 1HTPA 2B8FA 1TS2A 4IUPA 3WOFA 5M3FB 3HOXB 4GKKL 4F8MA 2R7ZH 5EQ0A 4DXFA 3K5MA 1Y8NB 2B8GA 2SEBD 3NEMA 4G7OC 1KDCA 4NXNL 4IPHA 2E8GA 2JSOA 1MI2A 1GM5A 3ICEA 3S1NH 5IYBH 3CW2C 3S1QH 3EA6A 3PCOB 2KJXA 2J0TD 2NB0A 4H13C 3MFGA 4OEMB 4EQOA 1QWYA 3M3YB 5LMNL 1HH2P 4A3BG 1FGUA 3S1RH 2ENBA 4K0KL 3BZDB 4DV2Q 2DNCA 4AYBE 1W6JA 2O2LD 2ZTEA 5J22A 5JJZA 5LHY1 2OEOA 2N55A 1JB7A 2FMCA 1F2YA 1LTRD 4CKEA 1D5XC 3R2IA 1BCPD 4YY3Q 2Q2HA 1WD0A 1QUQB 1I6HH 4JI5L 1LTBD 2B2YA 1SMXA 3QOJA 5IGDA 3I3CA 2KCMA 1V1OA 4YWKA 3PO3H 1YJ9A 5HGQA 1AH9A 2DJGC 3K8AA 1DOLA 4P74A 2NVYB 5IGCA 2H4OA 5FKAC 1A2UA 4DV5L 1IKLA 3CXCA 3NXWA 2Q8RE 2QDLA 1O7IA 3CU7A 4UPAA 2VB2X 1SYGA 5EAYA 2LS01 3IFDA 2HIVA 1I4QA 1KAWA 3W2DA 1SNOA 3NTHA 4QY7A 2EXZA 4RCOA 1HR0W 1H9SB 1PDQA 2B2TC 5ELFA 3KOJA 1BOSA 2XN9C 2IT1A 1NE3A 2EOTA 4F7XA 2MGSA 2JEAI 2EY5A 1A8VA 4NP5A 1IKMA 1XTDA 3S24A 4IPCA 3D3RA 2F0PA 3A0JA 1ICFB 5IGEA 3FKIH 4DU9A 2L4NA 1JJCB 2YV5A 4BA1I 4PZ7A 2VW9A 2ZXPA 5FLXE 2JA8H 4ABNA 1E1OA 4I65A 2GVAA 2B2TA 1Y1WB 4DR3L 5EJWA 1ZXTA 2A73B 4A3MG 4ULLA 1KLGD 1AW7A 2F0SA 1VQEA 4BBSG 3HOVB 3H6MA 4GN4B 1EYGA 2C35B 4J15A 4QIWE 3D0FA 2ZXOA 4P71A 3TP8A 1LTSD 3HOUG 1HFNA 1VQGA 3T53B 2R92B 2IW3A 2AWOA 5JEAH 4DV2L 2EYLA 1Q82C 3RZOH 4JI6L 1Q1BA 4LF8Q 3KBGA 1AP0A 2HCCA 1VQNA 3MEHA 1SMYC 1S5FD 2K5WA 1GUGA 1U4LA 4DR2Q 1PTOB 1VQDA 1ZYRC 4AYBG 2Z9HA 1IZ6A 1MD2D 4L5QA 3GTLH 3NBIA 3M85A 1CA5A 2K04A 1JOQA 4QGUA 2NTTA 3PO2G 2B2VC 2ICEC 1WYDA 1PTOH 1R4QB 1D7QA 5KNDA 3BZCA 4APVA 2KQ3A 4A75A 1EYDA 4DNIA 2HDLA 5H1SE 1E3PA 3FHWA 3VYSA 3MVVA 4FF1A 2E75C 2K5NA 4UP9A 1R4PB 4XYQA 4HN7A 1RHPA 2PMZB 1J9OA 1W3SA 5M3FH 4HJ7A 2A6HC 3E3XA 4GOPC 3H3VI 1EWCA 5EBDA 1X3GA 3UE1A 4LFBL 2R3ZA 3CF5A 1LT4D 4YIJA 1SE8A 3B6YA 5C3EH 1R9TH 2BOSA 1B53A 2NZ1D 5C3EG 1GUOA 4NXML 4JI2L 1OXUA 4DV1Q 2XSCA 5E4WC 3PO3G 1U4MA 1SE2A 2IX0A 3K5OA 3K58A 1ESRA 2FHTA 2JN4A 1S40A 4UP7A 5DM73 2QEXA 4KHVA 1VQ9A 3KLSA 3UDGA 3DUZA 4GKJL 1F2MA 1B1ZA 2K14A 5IWAL 4TQUS 2PPBC 2N49A 1HNXQ 1XNRL 2K01A 2RSNA 1E2VA 2ZT9C 3PF5A 4K8IA 1VQ8A 1YHAA 2QDBA 3GO5A 3S17H 2DNEA 2O5IC 3T16A 2LXKA 4DR6L 1TWCH 4LMQD 2JA7G 3S1MB 3LGJA 2VXWA 1ILQA 4NXMQ 1PFNA 1B9MA 1SFOH 4A3DG 3P1HA 4FO2A 2BDOA 2M9VA 1VF5C 1K3BC 2IPKD 5C44B 2C9OA 5IE8A 4HIMA 4FF4A 1O7ZA 5C4XB 5FJ8G 1CSPA 2RBMA 2PNRC 1KDAA 5FO8B 3A8KE 2MPMA 4OELB 4OO1I 2A6EC 4OL7A 1G2SA 4FXDA 4IO9A 2X6LA 2XGTA 1QE6A 1DONA 3CAMA 1L2FA 1GO3E 2L5TA 4C3IH 2BH2A 3M4OB 1KLUD 5IOCA 3A5ZB 1PA6A 2M00A 1NUCA 5C0XI 5I6YA 4ZKBB 5IYCH 1MJEA 1YNNC 4IZ8A 1Q90A 3I4OA 2EYMA 3MC0B 2QGQA 2Y0SE 2OWOA 4V190 1AE2A 3KJOA 4ZQ3A 1SYEA 1HNWL 4L5RC 2F0NA 3STBC 3HOYG 1F77A 3AFQA 1KABA 1L1OB 2CW0C 4KKSA 1EYAA 1ASYA 4CKCA 2UXCQ 3J81c 5FO7B 4C1NI 1JOOA 2IL8A 2L15A 2RDHA 2WAQB 3HFZB 2D2CC 2P5ZX 2JEBI 4YHHQ 4GLXA 3S9WA 1F9PA 5A2QL 4OHJA 1TWHH 3HOWG 4PG3A 3J80E 1B3AA 2RCNA 4X66Q 1N33L 3OW7A 1IYUA 1L0XB 2K33A 1E0BA 5IP9G 5KNBA 1F2ZA 5CV8A 3ZJYC 5IYCG 2Q8IB 5F2DA 1HA6A 4GZYC 2BE5D 2KUMA 4QF4A 3BU2A 1IL8A 3HOYH 1NCVA 2N8NA 5JEAJ 2XRQD 2OTJA 3IFTA 1EEID 1ZYRD 2YU9H 2LY7A 3RZDH 3GTGH 4N8X1 4JI1Q 1WTRA 2KA7A 2PO4A 3KLWA 1QG7A 1EWIA 4LF5L 2B63B 1TU2B 2O5JC 1C0AA 3HZXA 1PYSB 3CPFA 4A76A 4H44C 2A1AA 2KHIA 3FVQA 1YZ6A 2V1CC 1CZWA 3E9HA 3I4NG 2MQHA 3WWVA 1E2WA 1HJPA 1KRTA 1KIXA 2JA7H 5CV5A 3K6OA 2L0CA 2B2UA 3T13A 1VF7A 1PTOF 3HEJA 3CQZH 3I4NH 5I4DA 1NSNS 2JQOA 2I5MX 2NVYH 2VB3X 5FLXc 2PQEA 3RR5A 1R9TB 3DEPA 3PIP3 1S5DD 4XQNA 4DV4Q 1TWFB 4A3DH 3MTSA 3BVZA 4LF6L 1K8MA 2I5LX 3FPUB 1J5EQ 2K4KA 2K05A 5CGKA 5ISRA 5I2YA 4B3SL 4KMUC 1HUMA 1EY7A 3A55A 5M3MB 3T1YL 2F0DA 1H9JA 4HSVA 3KFUA 1EOVA 2RKSA 1PRTF 1BNZA 4HIKA 1WTOA 2XTIA 3K57A 3KF8A 4B3RQ 3J80i 1JWMD 2UXDL 4A3GG 2CHBD 4DNRB 4XYOA 1ESFA 5LMUQ 4K2LA 1EY4A 1U5KA 2F0IA 4KI0A 2EY6A 4U673 3KBXA 1PRTD 1A2TA 3HOWH 2UXBQ 1D1KA 4BY7B 1H95A 3VA7A 3DLLA 1RODA 3N52A 4A93G 3TS0A 5J39A 1HZCA 2VS1A 4CKBA 3GTMH 4QJFA 4YWLA 3HOVH 1FNVA 3EVQA 1EFWA 3KLRA 2CKZB 1TWAB 1MBYA 1SMYD 3VYTA 4DR5L 5NUCA 4QMGA 2PW5A 4WJWA 2J4XA 4XIGS 2VUMB 3G7LA 3RLFA 2RHQB 1HHVA 3NBHA 4IUTA 3C3LA 2EIFA 3UE0A 4CJ0B 2QCPX 3M4QA 1K73C 2R6GA 5CV6A 3A5UA 5CV4A 3HGBA 3KYHC 3P75A 2JA6H 1CQFA 3FPPA 2RVLA 1IW7C 4A3IG 4FF3A 5CYUA 5C4ZA 2OTLA 4LFAL 3I8ZA 1YNND 2KECA 1STEA 2JYOA 2JA8B 3SVMA 4LF4Q 3KJPA 1JE4A 2ICIA 4MNOA 5HY6A 5FLMH 3SHLA 1ASZA 3TMEA 1I94L 4OIKA 4R9WA 1KXLA 2PZWA 3T1HL 3D6CA 1BDOA 3SK5A 3TZUA 1CKNB 2NVTH 5JEAG 4DR4L 3BJUA 3CCJA 2JA8G 4LK1C 3CCQA 2UXBL 5IODA 5LMUL 2AWNA 4JI3L 5ELNA 4Z9CB 1KNAA 1ENAA 1YBYA 1NY4A 2XWJB 4KD4A 1UEBA 5DAUA 1V8QA 4JOIC 4YCWA 4C3HH 2MO0A 4KHZA 4A3MH 1Q3LA 3S16H 3T1YQ 1V9PA 4K14A 2ES2A 1JWUD 2E2DC 2HQEA 3GTPB 1LT3D 4M1UB 3V96A 1J5EL 1F9SA 1E22A 1KDBA 1SNQA 5ELDA 4V0BA 1RTOA 3CC7A 1HFGA 2HT1A 1PH7A 3KK7A 4HMJA 4YY3L 3S15B 4C56C 2ZTDA 4XT3B 3UDIA 2VNUD 4XQQA 1Q12A 2F52A 3MEFA 4A93B 4CDEC 1EY0A 2D5DA 4RCNA 5E7NA 4BY7G 4CDFC 3A56A 4C3IG 2XIWA 1KAAA 4JI0Q 4Y52H 1FYCA 1G6PA 1UUPA 4A3GB 1FGBD 4R4TA 3WOEA 1B4OA 1X32A 1EYCA 5C5LA 3U58A 1DCZA 3GTJH 1ILPA 4F88A 4KJNA 1GUSA 3D4DA 1Z9FA 3EIVA 5BR8L 1ZEQX 4DK3C 4KD3A 3S2DH 4UP8A 2E2IB 1QNKA 1VDZA 4RG1A 1JJGA 1DGSA 3FP9A 4C3IB 2TSSA 4JC0A 2F4VQ 2G9DA 1RIPA 2VQEL 3VYUA 3BDOA 2F0UA 4K8JA 4GS3A 4NB3A 5I6WA 3CPWA 4DAYA 2MHVA 3MXGA 4TKOB 1OO9B 3ERQA 1TWGB 1VQ4A 3PMFA 1XYIA 2NN6G 4X66L 1BCPF 1MHWC 4BA2I 4DPGA 5BN5A 4UY8C 2Z1CA 1I6VC 3L0OA 2F0KA 2KCTA 3I4NB 1CKMA 5EPKA 3JAMc 1UAPA 5KYLA 1GUNA 3NWSA 5BR8Q 4DA2A 3R8BA 4B3ML 2K28A 1PTOC 1AFPA 4DR1Q 2B63G 4LUVA 4BS9A 1D1IA 4G4KA 1T5XD 4J6HA 1E7ZA 4CDDC 1CTMA 4PZ8A 4RKLA 2IJ0A 2Z4HA 2KBNA 3D8GA 3UI2A 1XNRQ 3N6RA 1PHJA 2AKWB 5IP9H 4OGQC 2BH8A 5T1IA 1PZID 1BCPB 4HJ8A 5KYIA 5C3XA 3U50C 3L9AX 4ALPA 5G3LD 3CCVA 4IJHA 5IYDH 1SE4A 1SYCA 1K83H 4ZYSA 3TREA 2KEDA 3IL8A 4RGNA 4EVOA 2ZJRA 1M1KC 3F2CA 2K50A 2EVBA 4YWMA 4JOIA 2WACA 4ZCKA 4KY7A 1NJIC 2LFNA 1YNJC 2Z0SA 3BYTB 3BYYB 5IGFA 2YU9B 1IW7D 4A3CH 1EY5A 1C4QA 1EQRA 4DUYQ 1STBA 2MP1A 4ZKCB 2IX3A 2F4VL 4LFBQ 3F8TA 4IUUA 4G7HC 3TS2A 3ULJA 4LAAA 1XMQQ 2SNSA 3OPOA 4UAIA 5E1FA 4A3IB 4JW0A 1FNUA 2N78A 1A3UA 2KHSA 3IKJA 1KQSA 2UUAL 3VR5A 4LW1A 3RZOB 1TY2A 2E2HH 3PUXA 4CHTB 2LKVA 1KRSA 5ELOA 3E5SA 2B2VA 2EY1A 3HOYB 2JXMB 1TWHB 1L0WA 3Q6SA 2ZJQA 4FF2A 3K0YA 4WFN3 4P2CB 2VUMG 4PMCA 1HTLD 3NELA 4PMBA 1ONLA 3STBD 3J81i 5M5WH 3S16B 2QA4A 1SNMA 1VQFA 2XWBB 2K5VA 4U68A 2HCIA 4S3SA 1HXYD 4A3BH 1S5BD 1GXDC 1JJ2A 2EQSA 1SNCA 3GQBA 1NNXA 5GAHC 1XMOQ 1CK1A 5C4XG 3K0XA 2UU9L 1FJGL 4LFAQ 4Q5VA 3OYYA 4AQYL 4A93H 2NZHA 2NYZD 1JT8A 1ZKOA 1RCVD 2PW7A 5EGTA 4ME3A 5C44G 1X3FA 1CSQA 5T1GA 3D6WA 4AIMA 5JJIA 1HQRD 4JK1C 1VQ5A 4QIWB 4A3JH 5M3MG 2KOLA 3I4LA 4TRDA 4B9XA 4DV6Q 4O42A 4DR5Q 5JAVA 2I46A 4IFDJ 5HGTA 3S1MH 1QCBD 2B29A 2EE1A 5ELEA 3J7ZC 1D6EC 2HHHL 1I50B 1WTWA 2VZAA 4DAMA 2RQXA 2F3IA 1LUZA 1VMCA 2OF1A 3PO3B 4XXEA 5C4XH 3SGIA 1KC8C 4KN7C 1X9NA 4JCVE 1KL9A 3DWQA 4LUOA 3T4AC 1N8RC 4L6TB 3PIOA 4CJ1B 1I50H 3A54A 3J7A5 2VQFL 3NTIA 4WRDA 1OXTA 4CGYB 5GQOA 1LYLA 5IT9E 2QKIC 4JI6Q 5M5YH 3I73A 3K7AB 4NDXA 4RAUC 4PMWA 1JORA 2X6GA 1V1PB 3NE5B 4L8JA 1QVFA 2H1EA 1D5MC 5IGBA 1GJXA 1IHZA 4E6IA 1X3QA 1K8AC 2IHFA 2ZXRA 3V2TA 3CMEA 2OQ0A 5IT9L 3QB3A 1KHIA 4FNFA 3L3OC 3H09A 1IBKL 4DV4L 5EBCA 3I7FA 2A68C 2K1BA 4QCLA 4HEDA 3VR3A 4J1MA 3NENA 1SJHD 2WKDA 3M7NA 1HQMC 1I5FA 4PV1C 1FL0A 2FINB 5IY0A 3OSOA 1JB3A 3ONAB 2CQAA 2EJFC 3DM3A 2K32A 1W2BA 4UHVA 5A2QE 3HOWB 1GD7A 3GV6A 3J80L 1SYBA 1L1OC 3ER0A 4N9PA 4L63B 2WAQG 3A8IE 1A0IA 2PZUA 1XWEA 1H9KA 2R92G 3G71A 3OIQA 3CCEA 1VMPA 4LF5Q 4KHPQ 5C4JB 4A3FH 3MFYA 1OXSC 3S14H 3MXUA 2DY8A 4Y7NB 4MN3A 3AMUA 1RJTA 2ATWA 3HOVG 4BBSB 4GKKQ 4GN3B 3OTOL 3A7AB 1IBML 4O2DA 4X3KA 3H91A 4DXGA 1XPUA 3S14B 3NK9A 1EIFA 4JI5Q 4JV5Q 3VA5A 3LWEA 1TWFH 1M90C 2QILA 3F2BA 4GOPA 4J8QA 1SR3A 3NHHA 3GTPH 5JPMC 3EROA 1EZ8A 1OTCA 3GTQB 3V05A 1STHA 4QUCA 2NN6H 1TWCB 1PYWD 4P73A 1K9MC 4ME5A 2R7DA 4BY1H 1PVOA 2B2UC 1JQYD 4IFDI 1X54A 2KCNA 3T56B 4JI4L 2NVTB 4GNXC 3SK4A 2IHEA 4IFDH 2F3WA 5GADC 1BQQT 3RD4A 2DY7A 1U9RA 1WFQA 4A3DB 4ZAIA 4RFBA 3ULLA 1HNWQ 2YTYA 2L55A 2JA7B 2PMZE 4B3MQ 4NXNQ 2A69C 5C5MA 1PZJD 2Q2IA 4BXXG 1EIGA 1I4GA 1X55A 2AHOB 4IUVA 4X3UA 4OO1G 5EKIA 4GNXA 3X3MA 1I4HA 1SXTA 4DKAC 1YHBA 3SE0A 3S2DB 1IYJB 1I6HB 2X69A 1U0LA 5JPNC 3E6ZX 4JBKA 3EFXD 3L7ZC 2UUCL 2FJ2A 5COYA 4DV6L 2H5XA 3UDFA 4BXXH 1SAPA 1ML0D 3KF6B 5KIXA 2RF4A 3DWAA 3QWNA 1TKWB 4HCSA 5C3EB 2FXQA 4LFCQ 1N33Q 4RGOS 1Q8KA 2GVBA 1LT5D 3EN2A 5C4HA 4RWSC 4LF7L 4A3BB 3JAMi 1EIHA 4JYAL 1MIUA 3R93A 2R61A 3D31A 1TWAH 2NVQH 1YNJD 1UWVA 4TSSA 3VR6A 4OONA 2YYZA 4BY7H 1HNZL 4F87A 4HSPA 2PQAA 4BBRH 4DN4M 1VQLA 1VQBA 1S4ZA 1NTGA 3HOXG 5M3FG 5IP7H 2NVQB 1PYBA 3KDFB 2Y0SB 4DF7A 3CCRA 4R8NA 3PO2B 3VR2A 3QJYA 2E2IH 2NVXH 3OOCA 3U4VA 4BBRB 4FVMA 5CV7A 1E2ZA 2A8VA 2V4DA 4AYBB 3ND8A 3M9BA 3HG9A 2E2HB 3DEOA 3K81C 3TP5A 1N32L 3H0GH 2F1MA 2CW0D 1EU3A 2LSSA 1GVPA 2UUAQ 3GDEA 1Y8OB 3CCSA 3MAQA 4POFA 3HKSA 1PV4A 3QO2A 3U4ZA 4K2KA 1GHJA 3NTKA 2WB1G 4LF9Q 2EYPA 1CFMA 5IIFA 2PI2A 1Y1WH 2F03A 3M7GA 4DAPA 3HOUB 5JOBA 4JV5L 3I91A 1S5CD 3CCUA 4B9WA 5E4XA 2CVRA 4JI7Q 2I5HA 5C6AA 1PH5A 2WP8J 1UE7A 1XNQQ 3RNUA 5CR3A 1HCZA 3MWYW 4A3MB 4OX9Q 4PNYA 1EQTA 1C48A 3D4WA 4YCVA 5FLXL 3TZDA 1Y1WG 1IBLQ 4ILWA 3GTKB 5IWAQ 1BR9A 2L12A 5D3IB 4HIOA 5K36G 1VQ7A 3U9SA 4A3LG 4LUZA 2F0QA 1TS5A 4A4IA 4A3KG 3QIAA 3C1EA 4RHRA 3AQQA 2PYKA 3GTGB 3S2HB 4WJ3M 1EWHA 1Y8PB 2MFIA 2NZOA 3C1FA 3MHBA 1S5ED 4JI0L 4JI4Q 2VY3A 3H94A 4C3JH 2D62A 1YJWA 1X65A 2NN6I 5IT9c 5KRUA 2AQ3B 4QL5A 1FNWA 2B3GA 1LM0A 2OT2A 1MSGA 1C9OA 3W3AA 1QNUA 5IYDG 3GTQH 2WKCA 3CRKC 4X64Q 2EY2A 1K0SA 4IOCA 5BN4A 1SE3A 2DUDA 3G48A 1XPRA 1WD1A 1GUWA 4PQXA 3QR8A 1LTGD 3AB9A 4DAYB 2MO1A 2OQKA 3A8JE 1PH9A 3I72A 1Y69U 3NQIA 1LTTD 3RLOA 3URYA 1EL0A 5AJ3L 2RDFA 1PMRA 2B39A 2SDFA 1UEAB 4K5XA 3HS0C 3P20A 1G51A 5IGGA 1EFID 1WJJA 3I2ZA 2KCCA 5EKKA 2Z6BA 4MZ9A 3PQIA 1HRJA 1HZBA 4IUNA 1BBUA 3LX0A 5DEHA 1I4XA 1STNA 3TRZA 1NBWA 1LT6D 3HKZG 1EEFD 1I4RA 1O7YA 1PH1A 3CQZB 4QQBX 1VQAA 4LWCA 1Z7TA 2BA1A 2K5HA 1E24A 1EU4A 4LF8L 1VQKA 3KF6A 4M8AA 2E76C 5LMNW 3A7LA 2E2JH 3J81E 1EQQA 2CWAA 3KF8B 4ZLTF 3Q22A 4A3EH 3EBEA 1STGA 4I7ZC 2AMCB 1HZAA 2Z6KC 4DNTB 3OWFA 1IYVA 1A3VA 4L5TA 2ZJPA 1A6XA 2CWPA 4YCUA 3NWTA 3OIPA 4X65L 4LF6Q 3TBIB 1YIJA 3L2PA 2R7FA 3GTOH 4PZ6A 3BDLA 3BVMA 1HA5A 2PI2E 2XRSD 3Q24A 3BVGA 3JAML 1IBMQ 5DNFA 3M3YH 3SXHA 3G6EA 5BN3A 1DM0B 4KY5A 1N36Q 1XX8A 2UU9Q 2JA6G 2I07B 4KHPL 1JR0D 4WJ4A 2WB1E 4HTHA 2RDGA 2K75A 4FP5D 4MTNA 2FFKB 2RSOA 4EQNA 3O13A 2VQFQ 4POGA 3RN2A 4NMZA 4FXKC 2F4IA 5C0XG 1TVXA 4EGVA 1HR0L 1LTLA 5AFWA 1PXUA 3H0GG 3R3OA 1YJNA 1JCKB 4JI1L 2BE5C 5CC4A 4DK6C 2HQLA 3T1HQ 5FO9B 1N9WA 2L11A 4WORA 4DGZA 4IPDA 4A3FG 2EYOA 2JP1A 2B2WC 3AU7A 3W5OA 5C4JH 1VQIA 5C3WA 4C3HG 2D9UA 4JI8L 3S2HH 3CHBD 4C2MB 1CKOA 5C0XH 1IBKQ 4JBJA 1A62A 2DJFC 5JJLA 1BVSA 2I0QA 3I90A 1RKNA 1KD1C 1W6KA 2CFMA 2F0VA 4DV0L 2Z4IA 5CBEE 1WTXA 1BKBA 1LABA 1AN8A 3LNNA 1TIID 4K6LA 5GAGC 3ITPA 2G9HD 2AQ1B 3E0EA 2KVMA 4ZK9B 1FJGQ 1SBBB 3J81L 3GTLB 4NW2A 4AQYQ 3W1BA 2B63H 1XXGA 4DFAA 4G7ZC 3AFPA 4X65Q 2AQ2B 1VCIA 4K0KQ 2F0EA 1E1TA 2D0OA 3ERSX 1WVLA 2F0LA 4I7AA 1G91A 2MNAA 2MUYA 1EY6A 5FJ8H 3J7YW 2JA5H 3MXNB 1BXTA 3K7UC 1QZGA 3I4MH 1Q86C 2R7ZB 4A3IH 3KLSX 3KDFA 3PUVA 3PGZA 1TR5A 3CC2A 5I9PA 3BZKA 2HHHQ 3SEBA 4A3JB 2DGYA 2PZTA 1XNQL 1SLJA 4Y7NH 2L1BA 1WTVA 1LACA 2BCOA 2KHJA 3S1RB 1EOTA 4ODGA 5FOBB 3PSIA 3UDXA 4HJ9A 3K80C 2KENA 1YEZA 2QW7A 4HIDA 2AUKA 5M5XH 1NMFA 3F2DA 3I4MG 2HDMA 3WDNA 1STAA 4LF9L 3HOZB 3MA2B 3Q23A 3S15H 4B3SQ 4A3EG 4EQ5A 2BDNA 3K5NA 5AJ3Q 3TQYA 1EQVA 2A6HD 1YHQA 2CH4W 1YNXA 1I3QH 3G4SA 2R93H 4ZUIA 4C3JB 5JVG3 3NPPA 4HJAA 3J7AF 4LNQA 4DR6Q 1SSOA 4DV3L 4O0AA 1K83B 3I56A 1Y1VB 1UNSA 1Q1EA 3EJIA 2ZM6Q 1K3RA 4R4QA 4OXPA 1X3EA 1SFOB 1LTID 3DHQA 1L0YB 3Q8DA 1TQOA 1PFSA 1TWGH 4EQPA 5I9OA 2EJGC 2YTVA 1PH4A 1X56A 3DM1A 4P72A 1QUQA 3TEHB 1KTKA 1SYDA 3F1ZA 5EPLA 5E3FA 4DR1L 1K8OA 1WCMB 4KKTA 2F0FA 3FEWX 3DWPA 1AEXA 1I4PA 4ID6A 5LL6S 3AYHB 4RGMA 1VQHA 1NMGA 2B2WA 4GOPB 3BDCA 1ICWA 2OCEA 1NR2A 2RHSB 1XJVA 1PFBA 4HJ5A 5KGUA 3CD6A 1OXVA 4IN3A 5G3LF 2VQEQ 2EJMA 3TDQA 1M8AA 1PH6A 2VUMH 1D2BA 1ENFA 3OTOQ 4HAEA 1C7YA 1Q7YC 2XNAC 4A3KH 1C8CA 1GOZA 1G2TA 1VQCA 2ASBA 2JA5G 2NTSA 1BO0A 3AEVA 1XPOA 1A63A 5J3BA 2F3VA 1PH8A 1O78A 4MIUA 3SK8A 4BBSH 2L9HA 1DJRD 3M4PA 3NP8A 4QUFA 4JBMA 1HZ9A 4KN4C 5CORA 3M4YA 2FMMA 2PQAB 3S1NB 4DK1A 1EIYB 4R4IA 3S1QB 1M4VA 1BCPC 2EPBA 3FKIB 1PLFA 3E9IA 4KK7A 3MXPA 4GKJQ 1U4PA 2ID0A 1G291 1DZ1A 2WAQE 1BF4A 1JMCA 3HKZE 5TSSA 1CT1D 5CV9A 2EYHA 1HUNA 4DV3Q 1ET6A 3CCMA 4IURA 2TMPA 2PCFB 1RTNA 1MGSA 2KEEA 4N9TA 3BG3A 3RN5A 1UE1A 1FVIA 2F0TA 2ZTCA 4JYAQ 1F9QA 4OWWB 3DMUA 2Q8TA 4CJ2C 2N88A 2LXJA 4DR3Q 4X3SA 3LWUA 1N34L 2UUBQ 1NAPA 1J6QA 4BWGB 1EZ6A 4DV0Q 4NPSA 3C2PA 1B7YB 3R2TA 5GAEC 4BY1B 2K5DA 3HRZC 3PUYA 2CH4A 3JC66 1SYFA 1GHKA 5M5YB 5M5WB 3S17B 3K7AH 1U4RA 5EKLA 4IUQA 4IPGA 2Z6KA 4JI3Q 2R93G 2RCFA 1PH3A 1CKNA 3NSWA 1VQMA 3SK6A 5CBAE 4P75A 2CCZA 1RF2D 2E5LQ 3PF4A 3TP6A 1Y1VH 1HNXL 1YITA 1ET9A 1SDFA 1TT2A 2GA4B 3ZYYX 4DR4Q 2LMCB 3C46A 4C3JG 1YI2A 3T51B 4OO1H 1K28A 1I94Q 4X3TA 1EUJA 2QEJC 1UE6A 3PO2H 4OWTB 4GLAC 3F2UA 4X62L 3FMCA 4DV7Q 1H9RA 1QVGA 2IX1A 4LF4L 2WINB 5JJKA 4JI2Q 2PNHA 1JC7A 4JPBW 3IRBA 2R93B 4K6DA 2B2YC 1S72A 4A3LH 1QVCA 5IYBG 5J1ZA 1SJED 3D4RA 1NR4A 3I4MB 1CQVA 1SNPA 1P16A 5L37A 1RDPD 1Q81C 3PIO3 1AZPA 4QB4A 3I55A 2C5CA 4BY1G 3U9OA 2NBFA 2DN8A 1PH2A 3FDTA 1FR3A 1A3TA 4JI8Q 4FDBA 4KY6A 3VYRA 5C0XJ 5LL6X 4IJLA 4X62Q 2HIXA 4H7BA 1SN8A 4CBVA 4KLKA 1IL2A 4DV7L 1BUVT 1DOKA 3A74A 4OIJA 3RLNA 1CI3M 2A68D 2F0JA 1PFMA 3KUPA 3J7AV 5ELBA 2R7ZG 1LLRD 2JJQA 2MJ8A 3K59A 1O7LA 2ALYB 4N8FA 1LV9A 3GTOB 1HR0Q 1CA6A 2Q2UA 4C2MH 1L1OA 4R4OA 4R8IA 1WTQA 1S3OA 2CQOA 3VDYA 1JOKA 2E5LL 2F0OA 3FKIG 1RD9D 1JE5A 4XDXA 5M3MH 4DR2L 1V1QA 2UXDQ 1K8GA 2EDGA 3P7JA 2YTXA 4K5VA 1WOCA 3PIPA 4HR7B 1N36L 1Z6HA 4O1NA 4GNXB 3QOLA 1JWSD 2EYFA 1K0RA 3PV0A 3HOXH 3J80c 3HP3A 1QILA 3K5LA 4IOAA 3GV3A 4JVZA 3OW2A 4DR7L 3PUWA 4JG2A 1X6OA 2IWHA 4RA8A 3H3VH 3PUZA 1CHPD 3RMHA 4A3FB 2JA5B 1MSHA 2E74C 4B08A 1V43A 4R4CA 1XMOL 3OMCA 1O80A 1PRTB 4MHEA 5K36H 2Q2TA 5FLMG 2JE6I 1WTPA 2SOBA 2F0MA 2NWGA 3NQTA 2HUGA 4XTCS 2JK8A 2BA0A 4OWXB 1AZQA 1DYQA 4FYDA 1DOMA 4YHHL 2D0PA 3TP7A 2F0GA 5KNCA 2A6ED 1B9NA 1DD2A 4KKUA 4MTKA 1SROA 1MJCA 1Y14B 5LMNQ 4TVAB 1PZKD 2A69D 1WI5A 1WCMG 1PTOD 1VQOA 1CHQD 2JA6B 4GN5A 1OXXK 3J81j 5ELCA 1H9SA 3EQLC 3H15A 2GN5A 4B3RL 4JBWA 3ULPA 5FK9C 3RZDB 4DK0A 1EY8A 4ZRZA 2N3SA 3OHXC 4B3TQ 5D3DA 1XMQL 1N34Q 2UUBL 4DV5Q 1CM9A 3CCLA 4JI7L 4L5SA 1B44D 3DXJC 4IFDG 1B2TA 1D5ZC 1Y1VG 4LJZC 4Q0FA 4X6AH 2EYJA 4X64L 3CRLC 4IQZA 1BBXC 3Q0AA 2EXDA 2NVXB 1RL2A 1JICA 4G57A 3GTJB 2E2JB 2VL6A 4RH6A 1N32Q 4A3EB 3GTMB 1SRUA 3HKZB 3HOZG 1EY9A 1WTHA 2M2LA 1Q8IA 1LTAD 1VQPA 3M4OH 1TS3A 1GKHA 4DAVA 2A5HA 3CP0A 1II3A 5K5PA 2HD3A 3OMGA 3HOZH 4RKBA 2K5QA 1LO5D 5DLQE 5GROA 4NKLA 2QF7A 5D65A 2K52A 2EZVA 3RUZA 3H3VC 1B70B 1D8LA 1I3QB 4H0LC 2SNMA 2K6AA 2WIIB 3OWEB 3CKIB 4ZUJA 3MXNA 4GLVB 3SR1A 4OX9L 4A3JG 3I70A 4FXGC 1IBLL 2K03A 1B3QA 3NUCA 1KNEA 2ZM6L 4DUZQ 1V1PA 1G8ZD 4RGTA 5C44H 2R92H 4KV6A 2XVSA 3ND9A 1FD7D 1WCMH 5DM63 1Z47A 2JA9A 2O4XA 5EPJA 4K5WA 4C1NK 1VQJA 1F9RA 1MKHA 1TY0A 1J8IA 4RHSA 1F2LA 3TN2A 3E0JA 2A19A 1H9MA 1QZHA 1SEBD 5A35A 4KJOA 1X3PA 4DUYL 4B3TL 1DXMA 2F0WA 1XTCD 5M9OA 4A3KB 1STYA 3QG1A 2AUJD 3JAME 3CMAA 2OXPA 2UXCL 3CC4A 1VQ6A 3GD7A
chains in the Genus database with same CATH topology
1T5EA 3BS1A 2A74C 2K7VA 5I2XA 4C3HB 1B50A 2RA4A 3SDZA 1GUTA 4KTAA 2Z8LA 3G6JB 4HMIA 2J7ZA 1G6ZA 1ENCA 2WV6D 1QJOA 3FRPB 3H0GB 5HURA 5JVH3 5CMDA 1SNDA 3MZ5A 1PRTC 2F0HA 4UDUC 2WB1B 3GP7A 1QOHA 3TSSA 1TS4A 1A15A 2NUCA 4XT1B 5M5XB 1HPCA 3IAYA 4HCEA 1CZGA 3VR4A 4XQJA 3X3NA 1QB5D 5KEEA 5D14A 4IALA 1HTPA 2B8FA 1TS2A 4IUPA 3WOFA 5M3FB 3HOXB 4F8MA 5EQ0A 4DXFA 3K5MA 1Y8NB 2B8GA 2SEBD 4G7OC 1KDCA 2JSOA 1MI2A 3EA6A 2KJXA 2J0TD 2NB0A 4H13C 3MFGA 4EQOA 1QWYA 3M3YB 2ENBA 3BZDB 2DNCA 1W6JA 2O2LD 5J22A 5JJZA 5LHY1 2OEOA 2N55A 2FMCA 1F2YA 1LTRD 4CKEA 1D5XC 3R2IA 1BCPD 1WD0A 1LTBD 2B2YA 3QOJA 5IGDA 3I3CA 1V1OA 1DOLA 2NVYB 5IGCA 2H4OA 5FKAC 1A2UA 1IKLA 3NXWA 2Q8RE 3CU7A 2VB2X 1SYGA 2LS01 3IFDA 1I4QA 3W2DA 1SNOA 3NTHA 2EXZA 4RCOA 1H9SB 1PDQA 2B2TC 5ELFA 1BOSA 2XN9C 2IT1A 2EOTA 4F7XA 2MGSA 2JEAI 2EY5A 4NP5A 1IKMA 3D3RA 2F0PA 5IGEA 4DU9A 2L4NA 4BA1I 2ZXPA 5FLXE 4ABNA 4I65A 2B2TA 1Y1WB 5EJWA 1ZXTA 2A73B 4ULLA 1KLGD 1AW7A 2F0SA 3HOVB 3H6MA 2ZXOA 3TP8A 1LTSD 1HFNA 3T53B 2R92B 2IW3A 2AWOA 5JEAH 2EYLA 1Q1BA 3KBGA 1AP0A 2HCCA 3MEHA 1SMYC 1S5FD 2K5WA 1GUGA 1U4LA 1PTOB 1ZYRC 1MD2D 3NBIA 3M85A 1CA5A 2K04A 1JOQA 2NTTA 2B2VC 2ICEC 1PTOH 1R4QB 5KNDA 2KQ3A 1EYDA 2HDLA 4FF1A 3VYSA 3MVVA 2E75C 1R4PB 4XYQA 4HN7A 1RHPA 2PMZB 1J9OA 2A6HC 1EWCA 5EBDA 2R3ZA 1LT4D 4YIJA 2BOSA 1B53A 2NZ1D 1GUOA 1OXUA 2XSCA 5E4WC 1U4MA 1SE2A 2IX0A 3K5OA 3K58A 1ESRA 2FHTA 5DM73 4KHVA 3KLSA 3DUZA 1F2MA 1B1ZA 4TQUS 2PPBC 2K01A 2RSNA 1E2VA 2ZT9C 4K8IA 2QDBA 3GO5A 2DNEA 2O5IC 3T16A 4LMQD 3S1MB 2VXWA 1ILQA 1PFNA 1B9MA 3P1HA 4FO2A 2BDOA 2M9VA 1VF5C 2IPKD 5C44B 2C9OA 4FF4A 1O7ZA 5C4XB 2RBMA 2PNRC 1KDAA 5FO8B 3A8KE 2MPMA 4OO1I 2A6EC 4OL7A 1G2SA 4FXDA 2X6LA 1QE6A 1DONA 2L5TA 3M4OB 1KLUD 5IOCA 2M00A 1NUCA 5C0XI 5I6YA 4ZKBB 1YNNC 4IZ8A 1Q90A 2EYMA 3MC0B 4V190 4ZQ3A 1SYEA 2F0NA 1F77A 1KABA 2CW0C 4KKSA 1EYAA 4CKCA 5FO7B 4C1NI 1JOOA 2IL8A 2RDHA 2WAQB 2D2CC 2JEBI 3S9WA 1F9PA 5A2QL 4OHJA 3J80E 1B3AA 3OW7A 1IYUA 1L0XB 2K33A 5KNBA 1E0BA 1F2ZA 5CV8A 2Q8IB 5F2DA 1HA6A 4GZYC 2BE5D 2KUMA 4QF4A 1IL8A 1NCVA 5JEAJ 2XRQD 3IFTA 1EEID 1ZYRD 2LY7A 1WTRA 2KA7A 2PO4A 1QG7A 2B63B 1TU2B 2O5JC 3HZXA 4H44C 3FVQA 1CZWA 1E2WA 5CV5A 3K6OA 2L0CA 2B2UA 3T13A 1VF7A 1PTOF 3HEJA 5I4DA 1NSNS 2VB3X 2PQEA 1R9TB 3DEPA 3PIP3 1S5DD 4XQNA 1TWFB 3MTSA 3BVZA 1K8MA 3FPUB 2K05A 5CGKA 5ISRA 5I2YA 4KMUC 1HUMA 1EY7A 3A55A 5M3MB 2F0DA 1H9JA 4HSVA 2RKSA 1PRTF 1BNZA 1WTOA 3K57A 3KF8A 1JWMD 2CHBD 4DNRB 4XYOA 1ESFA 4K2LA 1EY4A 2F0IA 4KI0A 2EY6A 4U673 3KBXA 1A2TA 1PRTD 1D1KA 4BY7B 3VA7A 1RODA 3N52A 5J39A 4CKBA 1FNVA 3EVQA 3KLRA 1TWAB 1MBYA 1SMYD 3VYTA 5NUCA 4QMGA 2PW5A 4WJWA 2J4XA 4XIGS 2VUMB 3G7LA 3RLFA 1HHVA 3NBHA 4IUTA 3C3LA 4CJ0B 2QCPX 2R6GA 5CV6A 5CV4A 3HGBA 3P75A 1CQFA 3FPPA 2RVLA 1IW7C 4FF3A 5CYUA 5C4ZA 3I8ZA 1YNND 2KECA 1STEA 2JYOA 2JA8B 3SVMA 1JE4A 2ICIA 3SHLA 3TMEA 4OIKA 4R9WA 2PZWA 3D6CA 1BDOA 3SK5A 3TZUA 5JEAG 4LK1C 5IODA 2AWNA 4Z9CB 1KNAA 1ENAA 2XWJB 4KD4A 5DAUA 1V8QA 4KHZA 1Q3LA 4K14A 1JWUD 2E2DC 2HQEA 3GTPB 1LT3D 4M1UB 3V96A 1F9SA 1KDBA 1SNQA 5ELDA 4V0BA 1RTOA 1HFGA 3KK7A 4HMJA 3S15B 4C56C 4XT3B 2VNUD 4XQQA 1Q12A 4A93B 1EY0A 2D5DA 4RCNA 3A56A 4C3IG 2XIWA 1KAAA 1FYCA 1UUPA 4A3GB 1FGBD 3WOEA 1B4OA 1X32A 1EYCA 5C5LA 1DCZA 1ILPA 4F88A 4KJNA 1GUSA 3D4DA 1ZEQX 4KD3A 2E2IB 1QNKA 1VDZA 4C3IB 2TSSA 2G9DA 3VYUA 3BDOA 2F0UA 4K8JA 5I6WA 4DAYA 2MHVA 3MXGA 4TKOB 1OO9B 3ERQA 1TWGB 1XYIA 3PMFA 2NN6G 1BCPF 4BA2I 5BN5A 2Z1CA 1I6VC 2F0KA 3I4NB 5EPKA 1UAPA 5KYLA 1GUNA 3NWSA 4DA2A 3R8BA 2K28A 1PTOC 1AFPA 4BS9A 1D1IA 4G4KA 1T5XD 4J6HA 1CTMA 4RKLA 2IJ0A 2Z4HA 3D8GA 3UI2A 3N6RA 4OGQC 5T1IA 1PZID 1BCPB 5KYIA 5C3XA 3L9AX 5G3LD 1SE4A 4ZYSA 1SYCA 2KEDA 3IL8A 4RGNA 4EVOA 2EVBA 2WACA 4KY7A 2LFNA 1YNJC 3BYTB 3BYYB 5IGFA 2YU9B 1IW7D 1EY5A 1C4QA 1STBA 2MP1A 4ZKCB 2IX3A 4IUUA 4G7HC 4LAAA 2SNSA 3OPOA 4UAIA 5E1FA 4A3IB 1FNUA 1A3UA 2KHSA 3IKJA 3VR5A 3RZOB 1TY2A 3PUXA 4CHTB 2LKVA 3E5SA 2B2VA 2EY1A 3HOYB 2JXMB 1TWHB 4FF2A 3Q6SA 3K0YA 4WFN3 4P2CB 4PMCA 1HTLD 4PMBA 1ONLA 3S16B 1SNMA 2XWBB 4U68A 2HCIA 4S3SA 1HXYD 1S5BD 1GXDC 1SNCA 3GQBA 1CK1A 4Q5VA 2NYZD 1ZKOA 1RCVD 2PW7A 5EGTA 5T1GA 3D6WA 1HQRD 4JK1C 4QIWB 2KOLA 3I4LA 4TRDA 4B9XA 4O42A 5JAVA 2I46A 4IFDJ 5HGTA 1QCBD 2EE1A 5ELEA 1D6EC 1I50B 1WTWA 2RQXA 1VMCA 2OF1A 3PO3B 4XXEA 4KN7C 3DWQA 3T4AC 4L6TB 4CJ1B 3A54A 3NTIA 4WRDA 1OXTA 4CGYB 5IT9E 2QKIC 3I73A 3K7AB 4NDXA 4RAUC 4PMWA 1JORA 2X6GA 1V1PB 3NE5B 4L8JA 2H1EA 1D5MC 5IGBA 1GJXA 1IHZA 4E6IA 1X3QA 2ZXRA 3V2TA 5IT9L 3QB3A 4FNFA 3L3OC 3H09A 5EBCA 2A68C 2K1BA 4QCLA 4HEDA 3VR3A 4J1MA 1SJHD 2WKDA 3M7NA 1HQMC 4PV1C 2FINB 3OSOA 1JB3A 3ONAB 2CQAA 2EJFC 2K32A 5A2QE 3HOWB 3GV6A 3J80L 1SYBA 4N9PA 4L63B 3A8IE 2PZUA 1XWEA 1H9KA 3OIQA 1VMPA 5C4JB 3MFYA 1OXSC 3MXUA 2DY8A 4Y7NB 4MN3A 3AMUA 1RJTA 4BBSB 3A7AB 4X3KA 3H91A 4DXGA 3S14B 3NK9A 3VA5A 3LWEA 2QILA 4J8QA 3NHHA 5JPMC 3EROA 1EZ8A 3GTQB 3V05A 1STHA 4QUCA 2NN6H 1TWCB 1PYWD 4ME5A 2B2UC 1JQYD 4IFDI 2KCNA 3T56B 2NVTB 3SK4A 4IFDH 2F3WA 1BQQT 3RD4A 2DY7A 1U9RA 4A3DB 4ZAIA 4RFBA 2L55A 2JA7B 2A69C 5C5MA 1PZJD 1EIGA 1I4GA 4IUVA 4X3UA 4OO1G 5EKIA 3X3MA 1I4HA 1SXTA 3SE0A 3S2DB 1I6HB 2X69A 5JPNC 3E6ZX 3EFXD 3L7ZC 2FJ2A 5COYA 1SAPA 1ML0D 5KIXA 3DWAA 3QWNA 1TKWB 4HCSA 5C3EB 4RGOS 1LT5D 5C4HA 4RWSC 4A3BB 1EIHA 3R93A 2R61A 3D31A 1YNJD 4TSSA 3VR6A 2YYZA 4F87A 4HSPA 4DN4M 1S4ZA 2NVQB 2Y0SB 4DF7A 4R8NA 3PO2B 3VR2A 3QJYA 3OOCA 4BBRB 4FVMA 5CV7A 1E2ZA 2V4DA 4AYBB 3ND8A 3HG9A 2E2HB 3DEOA 3TP5A 2F1MA 2CW0D 1EU3A 1Y8OB 3MAQA 3QO2A 4K2KA 1GHJA 3NTKA 2EYPA 1CFMA 5IIFA 2F03A 3M7GA 4DAPA 3HOUB 5JOBA 3I91A 1S5CD 4B9WA 5E4XA 2CVRA 5C6AA 2WP8J 5CR3A 1HCZA 3MWYW 4A3MB 4PNYA 1EQTA 1C48A 3D4WA 5FLXL 3TZDA 4ILWA 3GTKB 1BR9A 2L12A 5D3IB 5K36G 3U9SA 2F0QA 1TS5A 3QIAA 3C1EA 4RHRA 2PYKA 3GTGB 3S2HB 1EWHA 1Y8PB 3C1FA 3MHBA 1S5ED 3H94A 2D62A 2NN6I 5KRUA 2AQ3B 1FNWA 2OT2A 1MSGA 3W3AA 1QNUA 2WKCA 3CRKC 2EY2A 5BN4A 1SE3A 1WD1A 1GUWA 4PQXA 1LTGD 3AB9A 3A8JE 3I72A 1Y69U 3NQIA 1LTTD 3URYA 1EL0A 2RDFA 1PMRA 2B39A 2SDFA 1UEAB 3HS0C 3P20A 4K5XA 5IGGA 1EFID 2KCCA 5EKKA 1HRJA 4IUNA 3LX0A 5DEHA 1I4XA 1STNA 1LT6D 1EEFD 1I4RA 1O7YA 3CQZB 1Z7TA 2BA1A 1EU4A 4M8AA 2E76C 3A7LA 3J81E 4ZLTF 3Q22A 1STGA 4I7ZC 4DNTB 3OWFA 1IYVA 1A3VA 1A6XA 3NWTA 3OIPA 3TBIB 3BDLA 3BVMA 1HA5A 2XRSD 3Q24A 3JAML 3BVGA 5DNFA 3SXHA 5BN3A 1DM0B 4KY5A 1XX8A 2I07B 1JR0D 4HTHA 2RDGA 4FP5D 2FFKB 2RSOA 4EQNA 3O13A 4NMZA 4FXKC 2F4IA 5C0XG 1TVXA 4EGVA 5AFWA 1PXUA 3R3OA 1JCKB 2BE5C 5CC4A 5FO9B 2L11A 4WORA 4DGZA 2EYOA 2JP1A 2B2WC 3AU7A 5C3WA 4C3HG 2D9UA 3CHBD 4C2MB 5C0XH 3I90A 1RKNA 1W6KA 2F0VA 1WTXA 2Z4IA 5CBEE 1LABA 1AN8A 3LNNA 1TIID 4K6LA 3ITPA 2G9HD 2AQ1B 2KVMA 4ZK9B 1SBBB 3J81L 3GTLB 4NW2A 1XXGA 4DFAA 4G7ZC 2AQ2B 1VCIA 2F0EA 1WVLA 2F0LA 1G91A 2MUYA 1EY6A 3J7YW 1BXTA 2R7ZB 3KLSX 3PUVA 1TR5A 5I9PA 3SEBA 4A3JB 2PZTA 2L1BA 1WTVA 1LACA 2BCOA 3S1RB 1EOTA 4ODGA 5FOBB 2AUKA 2HDMA 3WDNA 1STAA 3HOZB 3MA2B 3Q23A 2BDNA 3K5NA 1EQVA 2A6HD 4ZUIA 4C3JB 5JVG3 3NPPA 3J7AF 1SSOA 1K83B 1Y1VB 1UNSA 1Q1EA 3EJIA 1SFOB 1LTID 3DHQA 1L0YB 1TQOA 4EQPA 5I9OA 2EJGC 3DM1A 1KTKA 1SYDA 5EPLA 5E3FA 1K8OA 1WCMB 4KKTA 2F0FA 3FEWX 3DWPA 1AEXA 1I4PA 4ID6A 5LL6S 4RGMA 2B2WA 3BDCA 1ICWA 1NR2A 1PFBA 5KGUA 1OXVA 4IN3A 5G3LF 2EJMA 3TDQA 1M8AA 1D2BA 1ENFA 4HAEA 2XNAC 1C8CA 1GOZA 1G2TA 2NTSA 1BO0A 2F3VA 1O78A 4MIUA 3SK8A 2L9HA 1DJRD 3NP8A 4QUFA 4KN4C 5CORA 3M4YA 2FMMA 3S1NB 4DK1A 3S1QB 1M4VA 1BCPC 2EPBA 3FKIB 1PLFA 4KK7A 3MXPA 1U4PA 2ID0A 1G291 1DZ1A 1BF4A 5TSSA 1CT1D 5CV9A 2EYHA 1HUNA 1ET6A 4IURA 2TMPA 2PCFB 1RTNA 1MGSA 2KEEA 4N9TA 3BG3A 2F0TA 1F9QA 3DMUA 2Q8TA 4CJ2C 2N88A 4X3SA 3LWUA 1NAPA 4BWGB 1EZ6A 3C2PA 3R2TA 4BY1B 2K5DA 3HRZC 3PUYA 1SYFA 1GHKA 5M5YB 5M5WB 3S17B 1U4RA 5EKLA 4IUQA 3NSWA 3SK6A 5CBAE 1RF2D 3TP6A 1ET9A 1SDFA 1TT2A 2GA4B 3ZYYX 2LMCB 3C46A 4C3JG 3T51B 4OO1H 4X3TA 2QEJC 3F2UA 2IX1A 3FMCA 1H9RA 2WINB 1JC7A 2R93B 4K6DA 2B2YC 5J1ZA 1SJED 3D4RA 1NR4A 3I4MB 1CQVA 1SNPA 1RDPD 3PIO3 1AZPA 4QB4A 2C5CA 3U9OA 2NBFA 2DN8A 3FDTA 1FR3A 1A3TA 4KY6A 3VYRA 5C0XJ 5LL6X 4H7BA 4CBVA 1BUVT 1DOKA 4OIJA 1CI3M 2A68D 2F0JA 1PFMA 3KUPA 3J7AV 5ELBA 1LLRD 2MJ8A 3K59A 1O7LA 1LV9A 3GTOB 1CA6A 4R8IA 1WTQA 1JOKA 2F0OA 1RD9D 4XDXA 2EDGA 3P7JA 4K5VA 4HR7B 1Z6HA 4O1NA 1JWSD 3QOLA 2EYFA 3PV0A 3HP3A 1QILA 3K5LA 3GV3A 3PUWA 2IWHA 4RA8A 3PUZA 4A3FB 1CHPD 3RMHA 2JA5B 1MSHA 2E74C 4B08A 1V43A 3OMCA 1O80A 1PRTB 4MHEA 5K36H 2JE6I 1WTPA 2SOBA 2F0MA 2NWGA 3NQTA 2HUGA 4XTCS 2BA0A 1AZQA 1DYQA 4FYDA 1DOMA 3TP7A 2F0GA 5KNCA 2A6ED 1B9NA 1DD2A 4KKUA 1PZKD 2A69D 1PTOD 2JA6B 1CHQD 1OXXK 5ELCA 1H9SA 3EQLC 4JBWA 5FK9C 3RZDB 4DK0A 1EY8A 4ZRZA 3OHXC 5D3DA 1CM9A 1B44D 3DXJC 4IFDG 1B2TA 1D5ZC 4LJZC 4Q0FA 2EYJA 3CRLC 4IQZA 1BBXC 3Q0AA 2NVXB 1JICA 4G57A 3GTJB 2E2JB 4RH6A 4A3EB 3GTMB 3HKZB 1EY9A 2M2LA 1Q8IA 1LTAD 1TS3A 4DAVA 2A5HA 1II3A 5K5PA 3OMGA 4RKBA 2K5QA 1LO5D 2QF7A 4NKLA 5D65A 2EZVA 3RUZA 3H3VC 1I3QB 2SNMA 2WIIB 2K6AA 4H0LC 3OWEB 3CKIB 4ZUJA 3MXNA 3SR1A 3I70A 4FXGC 2K03A 3NUCA 1KNEA 1V1PA 1G8ZD 4RGTA 4KV6A 2XVSA 3ND9A 1FD7D 5DM63 1Z47A 2O4XA 5EPJA 4K5WA 4C1NK 1F9RA 1TY0A 1J8IA 4RHSA 1F2LA 3TN2A 3E0JA 1H9MA 1SEBD 5A35A 4KJOA 1X3PA 1DXMA 2F0WA 1XTCD 5M9OA 4A3KB 3JAME 1STYA 3QG1A 2AUJD 2OXPA 3GD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KY5 A;  1SNC A;  3ERQ A;  5KIX A;  2PQE A;  2PYK A;  3PMF A;  1EY8 A;  5IOC A;  1SYB A;  3C1F A;  1A3T A;  4HTH A;  1STA A;  3MHB A;  4KY6 A;  2M00 A;  1NUC A;  3QOJ A;  5I6Y A;  2F0K A;  5IGD A;  2KQ3 A;  5IOD A;  1EYD A;  4N9P A;  4H7B A;  5C4H A;  4KTA A;  5KRU A;  4EQN A;  2PZU A;  3MXP A;  4IZ8 A;  1EQV A;  4HMI A;  5KYL A;  2EYM A;  3MVV A;  1ENA A;  2F0J A;  4NMZ A;  5IGC A;  5CV9 A;  1ENC A;  2PW7 A;  5EGT A;  1A2U A;  4KD4 A;  4ZQ3 A;  1SYE A;  2EYH A;  5DAU A;  3NXW A;  2F0N A;  2EY2 A;  1EY7 A;  5HUR A;  1KAB A;  4ZUI A;  2F0D A;  4J6H A;  1SYG A;  2RKS A;  1SND A;  2EYJ A;  1EYA A;  3R3O A;  4TRD A;  4N9T A;  3MZ5 A;  5CC4 A;  4RKL A;  2F0H A;  1SNO A;  4B9X A;  3D8G A;  2F0T A;  2EXZ A;  1JOO A;  4K14 A;  5JAV A;  3EJI A;  1JOK A;  5HGT A;  2HQE A;  1EY4 A;  4G57 A;  4K2L A;  2RDF A;  2F0O A;  2F0I A;  2EY6 A;  3DMU A;  4WOR A;  4YIJ A;  4DGZ A;  2EYO A;  3DHQ A;  2NUC A;  1EY9 A;  5C3W A;  1TQO A;  1A2T A;  3NK9 A;  4F7X A;  5C3X A;  1KDB A;  4DF7 A;  5KYI A;  1SNQ A;  4EQP A;  2EY5 A;  4K5V A;  4K5X A;  5IGG A;  1EZ6 A;  1II3 A;  1SYC A;  4NP5 A;  4R8N A;  3VA5 A;  4EVO A;  3OMG A;  5I9O A;  4RKB A;  5EKK A;  5K5P A;  3S9W A;  4HMJ A;  3QOL A;  2EYF A;  2F0P A;  5IGE A;  1RKN A;  3NHH A;  2F0V A;  4IUN A;  4NKL A;  4DU9 A;  1SYF A;  2OF1 A;  5J39 A;  1F2Z A;  2WAC A;  3LX0 A;  4KY7 A;  1SYD A;  3ERO A;  5CV7 A;  5CV8 A;  5DEH A;  1EZ8 A;  5E3F A;  1EY0 A;  5F2D A;  3ITP A;  5IGF A;  5KEE A;  3RUZ A;  4KHV A;  5EKL A;  1STN A;  1STH A;  3EVQ A;  4I65 A;  4QF4 A;  2SNM A;  1F2M A;  4IAL A;  2F0F A;  1EY5 A;  4ZUJ A;  3TP5 A;  4ME5 A;  3SR1 A;  1AEX A;  1STB A;  4ID6 A;  4WRD A;  5NUC A;  1KAA A;  3SK6 A;  4QMG A;  2PW5 A;  3NUC A;  4K8I A;  4LAA A;  2F0S A;  4K2K A;  4DFA A;  2QDB A;  3OMC A;  2SNS A;  5E1F A;  3TP6 A;  4F8M A;  3H6M A;  2EYP A;  4KV6 A;  4NDX A;  3SK4 A;  5IIF A;  2F0E A;  1A3U A;  2KHS A;  1JOR A;  3BDC A;  3T16 A;  2F3W A;  1KDC A;  1EYC A;  2F0L A;  1TT2 A;  2SOB A;  5C5L A;  2F0M A;  1U9R A;  5IGB A;  2LKV A;  3NQT A;  4KJN A;  5JOB A;  3D4D A;  3TP8 A;  5KGU A;  1STG A;  2O4X A;  1EY6 A;  3E5S A;  4K5W A;  1IHZ A;  2EY1 A;  3P1H A;  4E6I A;  5CV6 A;  4B9W A;  3HZX A;  3OWF A;  4KD3 A;  4EQO A;  5CV4 A;  1A3V A;  5C5M A;  3P75 A;  3TP7 A;  3V2T A;  5C6A A;  2F0G A;  2EYL A;  3QB3 A;  5C4Z A;  4PMC A;  2ENB A;  1TR5 A;  5CR3 A;  5I9P A;  4PMB A;  4K6D A;  3BDL A;  4KJO A;  5J1Z A;  2RBM A;  3MEH A;  4PNY A;  2PZT A;  1KDA A;  5CV5 A;  1SNM A;  3D4W A;  5J22 A;  1SNP A;  2OEO A;  2F3V A;  4OL7 A;  3SHL A;  5CGK A;  5ISR A;  2F0W A;  4MIU A;  4J1M A;  1F2Y A;  4QB4 A;  3SK8 A;  3SXH A;  2F0U A;  3T13 A;  3TME A;  5M9O A;  4K8J A;  2PZW A;  3HEJ A;  3NP8 A;  2F0Q A;  3D6C A;  4ODG A;  1STY A;  4S3S A;  1NSN S;  5I6W A;  2OXP A;  3OSO A;  3U9O A;  1JOQ A;  3SK5 A;  3C1E A; 
#chains in the Genus database with same CATH topology
 1T5E A;  4R1J A;  1UE5 A;  3BS1 A;  4DUZ L;  2A74 C;  2K7V A;  5I2X A;  4C3H B;  3HOU H;  2G5D A;  2RA4 A;  1B50 A;  3SDZ A;  2IY5 B;  1GUT A;  4KTA A;  2Z8L A;  3G6J B;  4HMI A;  2J7Z A;  1VS0 A;  4EX5 A;  1G6Z A;  1ENC A;  1Q46 A;  2WV6 D;  1YVC A;  1QJO A;  3FRP B;  1CUK A;  3H0G B;  4CDC C;  1HNZ Q;  5HUR A;  5JVH 3;  3W1G A;  5CMD A;  4DV1 L;  1SND A;  4A3C G;  3MZ5 A;  1PRT C;  2F0H A;  4UDU C;  1P8L A;  2WB1 B;  3GP7 A;  4LF7 Q;  1QOH A;  1IXR A;  3TSS A;  1TS4 A;  4H02 A;  1A15 A;  2WFW A;  2NUC A;  4XT1 B;  5M5X B;  1HPC A;  1T9H A;  3IAY A;  1B8A A;  4HCE A;  4AH6 A;  4DR7 Q;  5IP7 G;  4RMF A;  1CZG A;  4LFC L;  1TXY A;  4BBR G;  1AE3 A;  3VR4 A;  4XQJ A;  1BBW A;  3NBH B;  1QB5 D;  3X3N A;  4A3G H;  5KEE A;  2UUC Q;  5D14 A;  3GTK H;  4IAL A;  2Y0S G;  1HTP A;  2B8F A;  1TS2 A;  4IUP A;  3WOF A;  5M3F B;  3HOX B;  4GKK L;  4F8M A;  2R7Z H;  5EQ0 A;  4DXF A;  3K5M A;  1Y8N B;  2B8G A;  2SEB D;  3NEM A;  4G7O C;  1KDC A;  4NXN L;  4IPH A;  2E8G A;  2JSO A;  1MI2 A;  1GM5 A;  3ICE A;  3S1N H;  5IYB H;  3CW2 C;  3S1Q H;  3EA6 A;  3PCO B;  2KJX A;  2J0T D;  2NB0 A;  4H13 C;  3MFG A;  4OEM B;  4EQO A;  1QWY A;  3M3Y B;  5LMN L;  1HH2 P;  4A3B G;  1FGU A;  3S1R H;  2ENB A;  4K0K L;  3BZD B;  4DV2 Q;  2DNC A;  4AYB E;  1W6J A;  2O2L D;  2ZTE A;  5J22 A;  5JJZ A;  5LHY 1;  2OEO A;  2N55 A;  1JB7 A;  2FMC A;  1F2Y A;  1LTR D;  4CKE A;  1D5X C;  3R2I A;  1BCP D;  4YY3 Q;  2Q2H A;  1WD0 A;  1QUQ B;  1I6H H;  4JI5 L;  1LTB D;  2B2Y A;  1SMX A;  3QOJ A;  5IGD A;  3I3C A;  2KCM A;  1V1O A;  4YWK A;  3PO3 H;  1YJ9 A;  5HGQ A;  1AH9 A;  2DJG C;  3K8A A;  1DOL A;  4P74 A;  2NVY B;  5IGC A;  2H4O A;  5FKA C;  1A2U A;  4DV5 L;  1IKL A;  3CXC A;  3NXW A;  2Q8R E;  2QDL A;  1O7I A;  3CU7 A;  4UPA A;  2VB2 X;  1SYG A;  5EAY A;  2LS0 1;  3IFD A;  2HIV A;  1I4Q A;  1KAW A;  3W2D A;  1SNO A;  3NTH A;  4QY7 A;  2EXZ A;  4RCO A;  1HR0 W;  1H9S B;  1PDQ A;  2B2T C;  5ELF A;  3KOJ A;  1BOS A;  2XN9 C;  2IT1 A;  1NE3 A;  2EOT A;  4F7X A;  2MGS A;  2JEA I;  2EY5 A;  1A8V A;  4NP5 A;  1IKM A;  1XTD A;  3S24 A;  4IPC A;  3D3R A;  2F0P A;  3A0J A;  1ICF B;  5IGE A;  3FKI H;  4DU9 A;  2L4N A;  1JJC B;  2YV5 A;  4BA1 I;  4PZ7 A;  2VW9 A;  2ZXP A;  5FLX E;  2JA8 H;  4ABN A;  1E1O A;  4I65 A;  2GVA A;  2B2T A;  1Y1W B;  4DR3 L;  5EJW A;  1ZXT A;  2A73 B;  4A3M G;  4ULL A;  1KLG D;  1AW7 A;  2F0S A;  1VQE A;  4BBS G;  3HOV B;  3H6M A;  4GN4 B;  1EYG A;  2C35 B;  4J15 A;  4QIW E;  3D0F A;  2ZXO A;  4P71 A;  3TP8 A;  1LTS D;  3HOU G;  1HFN A;  1VQG A;  3T53 B;  2R92 B;  2IW3 A;  2AWO A;  5JEA H;  4DV2 L;  2EYL A;  1Q82 C;  3RZO H;  4JI6 L;  1Q1B A;  4LF8 Q;  3KBG A;  1AP0 A;  2HCC A;  1VQN A;  3MEH A;  1SMY C;  1S5F D;  2K5W A;  1GUG A;  1U4L A;  4DR2 Q;  1PTO B;  1VQD A;  1ZYR C;  4AYB G;  2Z9H A;  1IZ6 A;  1MD2 D;  4L5Q A;  3GTL H;  3NBI A;  3M85 A;  1CA5 A;  2K04 A;  1JOQ A;  4QGU A;  2NTT A;  3PO2 G;  2B2V C;  2ICE C;  1WYD A;  1PTO H;  1R4Q B;  1D7Q A;  5KND A;  3BZC A;  4APV A;  2KQ3 A;  4A75 A;  1EYD A;  4DNI A;  2HDL A;  5H1S E;  1E3P A;  3FHW A;  3VYS A;  3MVV A;  4FF1 A;  2E75 C;  2K5N A;  4UP9 A;  1R4P B;  4XYQ A;  4HN7 A;  1RHP A;  2PMZ B;  1J9O A;  1W3S A;  5M3F H;  4HJ7 A;  2A6H C;  3E3X A;  4GOP C;  3H3V I;  1EWC A;  5EBD A;  1X3G A;  3UE1 A;  4LFB L;  2R3Z A;  3CF5 A;  1LT4 D;  4YIJ A;  1SE8 A;  3B6Y A;  5C3E H;  1R9T H;  2BOS A;  1B53 A;  2NZ1 D;  5C3E G;  1GUO A;  4NXM L;  4JI2 L;  1OXU A;  4DV1 Q;  2XSC A;  5E4W C;  3PO3 G;  1U4M A;  1SE2 A;  2IX0 A;  3K5O A;  3K58 A;  1ESR A;  2FHT A;  2JN4 A;  1S40 A;  4UP7 A;  5DM7 3;  2QEX A;  4KHV A;  1VQ9 A;  3KLS A;  3UDG A;  3DUZ A;  4GKJ L;  1F2M A;  1B1Z A;  2K14 A;  5IWA L;  4TQU S;  2PPB C;  2N49 A;  1HNX Q;  1XNR L;  2K01 A;  2RSN A;  1E2V A;  2ZT9 C;  3PF5 A;  4K8I A;  1VQ8 A;  1YHA A;  2QDB A;  3GO5 A;  3S17 H;  2DNE A;  2O5I C;  3T16 A;  2LXK A;  4DR6 L;  1TWC H;  4LMQ D;  2JA7 G;  3S1M B;  3LGJ A;  2VXW A;  1ILQ A;  4NXM Q;  1PFN A;  1B9M A;  1SFO H;  4A3D G;  3P1H A;  4FO2 A;  2BDO A;  2M9V A;  1VF5 C;  1K3B C;  2IPK D;  5C44 B;  2C9O A;  5IE8 A;  4HIM A;  4FF4 A;  1O7Z A;  5C4X B;  5FJ8 G;  1CSP A;  2RBM A;  2PNR C;  1KDA A;  5FO8 B;  3A8K E;  2MPM A;  4OEL B;  4OO1 I;  2A6E C;  4OL7 A;  1G2S A;  4FXD A;  4IO9 A;  2X6L A;  2XGT A;  1QE6 A;  1DON A;  3CAM A;  1L2F A;  1GO3 E;  2L5T A;  4C3I H;  2BH2 A;  3M4O B;  1KLU D;  5IOC A;  3A5Z B;  1PA6 A;  2M00 A;  1NUC A;  5C0X I;  5I6Y A;  4ZKB B;  5IYC H;  1MJE A;  1YNN C;  4IZ8 A;  1Q90 A;  3I4O A;  2EYM A;  3MC0 B;  2QGQ A;  2Y0S E;  2OWO A;  4V19 0;  1AE2 A;  3KJO A;  4ZQ3 A;  1SYE A;  1HNW L;  4L5R C;  2F0N A;  3STB C;  3HOY G;  1F77 A;  3AFQ A;  1KAB A;  1L1O B;  2CW0 C;  4KKS A;  1EYA A;  1ASY A;  4CKC A;  2UXC Q;  3J81 c;  5FO7 B;  4C1N I;  1JOO A;  2IL8 A;  2L15 A;  2RDH A;  2WAQ B;  3HFZ B;  2D2C C;  2P5Z X;  2JEB I;  4YHH Q;  4GLX A;  3S9W A;  1F9P A;  5A2Q L;  4OHJ A;  1TWH H;  3HOW G;  4PG3 A;  3J80 E;  1B3A A;  2RCN A;  4X66 Q;  1N33 L;  3OW7 A;  1IYU A;  1L0X B;  2K33 A;  1E0B A;  5IP9 G;  5KNB A;  1F2Z A;  5CV8 A;  3ZJY C;  5IYC G;  2Q8I B;  5F2D A;  1HA6 A;  4GZY C;  2BE5 D;  2KUM A;  4QF4 A;  3BU2 A;  1IL8 A;  3HOY H;  1NCV A;  2N8N A;  5JEA J;  2XRQ D;  2OTJ A;  3IFT A;  1EEI D;  1ZYR D;  2YU9 H;  2LY7 A;  3RZD H;  3GTG H;  4N8X 1;  4JI1 Q;  1WTR A;  2KA7 A;  2PO4 A;  3KLW A;  1QG7 A;  1EWI A;  4LF5 L;  2B63 B;  1TU2 B;  2O5J C;  1C0A A;  3HZX A;  1PYS B;  3CPF A;  4A76 A;  4H44 C;  2A1A A;  2KHI A;  3FVQ A;  1YZ6 A;  2V1C C;  1CZW A;  3E9H A;  3I4N G;  2MQH A;  3WWV A;  1E2W A;  1HJP A;  1KRT A;  1KIX A;  2JA7 H;  5CV5 A;  3K6O A;  2L0C A;  2B2U A;  3T13 A;  1VF7 A;  1PTO F;  3HEJ A;  3CQZ H;  3I4N H;  5I4D A;  1NSN S;  2JQO A;  2I5M X;  2NVY H;  2VB3 X;  5FLX c;  2PQE A;  3RR5 A;  1R9T B;  3DEP A;  3PIP 3;  1S5D D;  4XQN A;  4DV4 Q;  1TWF B;  4A3D H;  3MTS A;  3BVZ A;  4LF6 L;  1K8M A;  2I5L X;  3FPU B;  1J5E Q;  2K4K A;  2K05 A;  5CGK A;  5ISR A;  5I2Y A;  4B3S L;  4KMU C;  1HUM A;  1EY7 A;  3A55 A;  5M3M B;  3T1Y L;  2F0D A;  1H9J A;  4HSV A;  3KFU A;  1EOV A;  2RKS A;  1PRT F;  1BNZ A;  4HIK A;  1WTO A;  2XTI A;  3K57 A;  3KF8 A;  4B3R Q;  3J80 i;  1JWM D;  2UXD L;  4A3G G;  2CHB D;  4DNR B;  4XYO A;  1ESF A;  5LMU Q;  4K2L A;  1EY4 A;  1U5K A;  2F0I A;  4KI0 A;  2EY6 A;  4U67 3;  3KBX A;  1PRT D;  1A2T A;  3HOW H;  2UXB Q;  1D1K A;  4BY7 B;  1H95 A;  3VA7 A;  3DLL A;  1ROD A;  3N52 A;  4A93 G;  3TS0 A;  5J39 A;  1HZC A;  2VS1 A;  4CKB A;  3GTM H;  4QJF A;  4YWL A;  3HOV H;  1FNV A;  3EVQ A;  1EFW A;  3KLR A;  2CKZ B;  1TWA B;  1MBY A;  1SMY D;  3VYT A;  4DR5 L;  5NUC A;  4QMG A;  2PW5 A;  4WJW A;  2J4X A;  4XIG S;  2VUM B;  3G7L A;  3RLF A;  2RHQ B;  1HHV A;  3NBH A;  4IUT A;  3C3L A;  2EIF A;  3UE0 A;  4CJ0 B;  2QCP X;  3M4Q A;  1K73 C;  2R6G A;  5CV6 A;  3A5U A;  5CV4 A;  3HGB A;  3KYH C;  3P75 A;  2JA6 H;  1CQF A;  3FPP A;  2RVL A;  1IW7 C;  4A3I G;  4FF3 A;  5CYU A;  5C4Z A;  2OTL A;  4LFA L;  3I8Z A;  1YNN D;  2KEC A;  1STE A;  2JYO A;  2JA8 B;  3SVM A;  4LF4 Q;  3KJP A;  1JE4 A;  2ICI A;  4MNO A;  5HY6 A;  5FLM H;  3SHL A;  1ASZ A;  3TME A;  1I94 L;  4OIK A;  4R9W A;  1KXL A;  2PZW A;  3T1H L;  3D6C A;  1BDO A;  3SK5 A;  3TZU A;  1CKN B;  2NVT H;  5JEA G;  4DR4 L;  3BJU A;  3CCJ A;  2JA8 G;  4LK1 C;  3CCQ A;  2UXB L;  5IOD A;  5LMU L;  2AWN A;  4JI3 L;  5ELN A;  4Z9C B;  1KNA A;  1ENA A;  1YBY A;  1NY4 A;  2XWJ B;  4KD4 A;  1UEB A;  5DAU A;  1V8Q A;  4JOI C;  4YCW A;  4C3H H;  2MO0 A;  4KHZ A;  4A3M H;  1Q3L A;  3S16 H;  3T1Y Q;  1V9P A;  4K14 A;  2ES2 A;  1JWU D;  2E2D C;  2HQE A;  3GTP B;  1LT3 D;  4M1U B;  3V96 A;  1J5E L;  1F9S A;  1E22 A;  1KDB A;  1SNQ A;  5ELD A;  4V0B A;  1RTO A;  3CC7 A;  1HFG A;  2HT1 A;  1PH7 A;  3KK7 A;  4HMJ A;  4YY3 L;  3S15 B;  4C56 C;  2ZTD A;  4XT3 B;  3UDI A;  2VNU D;  4XQQ A;  1Q12 A;  2F52 A;  3MEF A;  4A93 B;  4CDE C;  1EY0 A;  2D5D A;  4RCN A;  5E7N A;  4BY7 G;  4CDF C;  3A56 A;  4C3I G;  2XIW A;  1KAA A;  4JI0 Q;  4Y52 H;  1FYC A;  1G6P A;  1UUP A;  4A3G B;  1FGB D;  4R4T A;  3WOE A;  1B4O A;  1X32 A;  1EYC A;  5C5L A;  3U58 A;  1DCZ A;  3GTJ H;  1ILP A;  4F88 A;  4KJN A;  1GUS A;  3D4D A;  1Z9F A;  3EIV A;  5BR8 L;  1ZEQ X;  4DK3 C;  4KD3 A;  3S2D H;  4UP8 A;  2E2I B;  1QNK A;  1VDZ A;  4RG1 A;  1JJG A;  1DGS A;  3FP9 A;  4C3I B;  2TSS A;  4JC0 A;  2F4V Q;  2G9D A;  1RIP A;  2VQE L;  3VYU A;  3BDO A;  2F0U A;  4K8J A;  4GS3 A;  4NB3 A;  5I6W A;  3CPW A;  4DAY A;  2MHV A;  3MXG A;  4TKO B;  1OO9 B;  3ERQ A;  1TWG B;  1VQ4 A;  3PMF A;  1XYI A;  2NN6 G;  4X66 L;  1BCP F;  1MHW C;  4BA2 I;  4DPG A;  5BN5 A;  4UY8 C;  2Z1C A;  1I6V C;  3L0O A;  2F0K A;  2KCT A;  3I4N B;  1CKM A;  5EPK A;  3JAM c;  1UAP A;  5KYL A;  1GUN A;  3NWS A;  5BR8 Q;  4DA2 A;  3R8B A;  4B3M L;  2K28 A;  1PTO C;  1AFP A;  4DR1 Q;  2B63 G;  4LUV A;  4BS9 A;  1D1I A;  4G4K A;  1T5X D;  4J6H A;  1E7Z A;  4CDD C;  1CTM A;  4PZ8 A;  4RKL A;  2IJ0 A;  2Z4H A;  2KBN A;  3D8G A;  3UI2 A;  1XNR Q;  3N6R A;  1PHJ A;  2AKW B;  5IP9 H;  4OGQ C;  2BH8 A;  5T1I A;  1PZI D;  1BCP B;  4HJ8 A;  5KYI A;  5C3X A;  3U50 C;  3L9A X;  4ALP A;  5G3L D;  3CCV A;  4IJH A;  5IYD H;  1SE4 A;  1SYC A;  1K83 H;  4ZYS A;  3TRE A;  2KED A;  3IL8 A;  4RGN A;  4EVO A;  2ZJR A;  1M1K C;  3F2C A;  2K50 A;  2EVB A;  4YWM A;  4JOI A;  2WAC A;  4ZCK A;  4KY7 A;  1NJI C;  2LFN A;  1YNJ C;  2Z0S A;  3BYT B;  3BYY B;  5IGF A;  2YU9 B;  1IW7 D;  4A3C H;  1EY5 A;  1C4Q A;  1EQR A;  4DUY Q;  1STB A;  2MP1 A;  4ZKC B;  2IX3 A;  2F4V L;  4LFB Q;  3F8T A;  4IUU A;  4G7H C;  3TS2 A;  3ULJ A;  4LAA A;  1XMQ Q;  2SNS A;  3OPO A;  4UAI A;  5E1F A;  4A3I B;  4JW0 A;  1FNU A;  2N78 A;  1A3U A;  2KHS A;  3IKJ A;  1KQS A;  2UUA L;  3VR5 A;  4LW1 A;  3RZO B;  1TY2 A;  2E2H H;  3PUX A;  4CHT B;  2LKV A;  1KRS A;  5ELO A;  3E5S A;  2B2V A;  2EY1 A;  3HOY B;  2JXM B;  1TWH B;  1L0W A;  3Q6S A;  2ZJQ A;  4FF2 A;  3K0Y A;  4WFN 3;  4P2C B;  2VUM G;  4PMC A;  1HTL D;  3NEL A;  4PMB A;  1ONL A;  3STB D;  3J81 i;  5M5W H;  3S16 B;  2QA4 A;  1SNM A;  1VQF A;  2XWB B;  2K5V A;  4U68 A;  2HCI A;  4S3S A;  1HXY D;  4A3B H;  1S5B D;  1GXD C;  1JJ2 A;  2EQS A;  1SNC A;  3GQB A;  1NNX A;  5GAH C;  1XMO Q;  1CK1 A;  5C4X G;  3K0X A;  2UU9 L;  1FJG L;  4LFA Q;  4Q5V A;  3OYY A;  4AQY L;  4A93 H;  2NZH A;  2NYZ D;  1JT8 A;  1ZKO A;  1RCV D;  2PW7 A;  5EGT A;  4ME3 A;  5C44 G;  1X3F A;  1CSQ A;  5T1G A;  3D6W A;  4AIM A;  5JJI A;  1HQR D;  4JK1 C;  1VQ5 A;  4QIW B;  4A3J H;  5M3M G;  2KOL A;  3I4L A;  4TRD A;  4B9X A;  4DV6 Q;  4O42 A;  4DR5 Q;  5JAV A;  2I46 A;  4IFD J;  5HGT A;  3S1M H;  1QCB D;  2B29 A;  2EE1 A;  5ELE A;  3J7Z C;  1D6E C;  2HHH L;  1I50 B;  1WTW A;  2VZA A;  4DAM A;  2RQX A;  2F3I A;  1LUZ A;  1VMC A;  2OF1 A;  3PO3 B;  4XXE A;  5C4X H;  3SGI A;  1KC8 C;  4KN7 C;  1X9N A;  4JCV E;  1KL9 A;  3DWQ A;  4LUO A;  3T4A C;  1N8R C;  4L6T B;  3PIO A;  4CJ1 B;  1I50 H;  3A54 A;  3J7A 5;  2VQF L;  3NTI A;  4WRD A;  1OXT A;  4CGY B;  5GQO A;  1LYL A;  5IT9 E;  2QKI C;  4JI6 Q;  5M5Y H;  3I73 A;  3K7A B;  4NDX A;  4RAU C;  4PMW A;  1JOR A;  2X6G A;  1V1P B;  3NE5 B;  4L8J A;  1QVF A;  2H1E A;  1D5M C;  5IGB A;  1GJX A;  1IHZ A;  4E6I A;  1X3Q A;  1K8A C;  2IHF A;  2ZXR A;  3V2T A;  3CME A;  2OQ0 A;  5IT9 L;  3QB3 A;  1KHI A;  4FNF A;  3L3O C;  3H09 A;  1IBK L;  4DV4 L;  5EBC A;  3I7F A;  2A68 C;  2K1B A;  4QCL A;  4HED A;  3VR3 A;  4J1M A;  3NEN A;  1SJH D;  2WKD A;  3M7N A;  1HQM C;  1I5F A;  4PV1 C;  1FL0 A;  2FIN B;  5IY0 A;  3OSO A;  1JB3 A;  3ONA B;  2CQA A;  2EJF C;  3DM3 A;  2K32 A;  1W2B A;  4UHV A;  5A2Q E;  3HOW B;  1GD7 A;  3GV6 A;  3J80 L;  1SYB A;  1L1O C;  3ER0 A;  4N9P A;  4L63 B;  2WAQ G;  3A8I E;  1A0I A;  2PZU A;  1XWE A;  1H9K A;  2R92 G;  3G71 A;  3OIQ A;  3CCE A;  1VMP A;  4LF5 Q;  4KHP Q;  5C4J B;  4A3F H;  3MFY A;  1OXS C;  3S14 H;  3MXU A;  2DY8 A;  4Y7N B;  4MN3 A;  3AMU A;  1RJT A;  2ATW A;  3HOV G;  4BBS B;  4GKK Q;  4GN3 B;  3OTO L;  3A7A B;  1IBM L;  4O2D A;  4X3K A;  3H91 A;  4DXG A;  1XPU A;  3S14 B;  3NK9 A;  1EIF A;  4JI5 Q;  4JV5 Q;  3VA5 A;  3LWE A;  1TWF H;  1M90 C;  2QIL A;  3F2B A;  4GOP A;  4J8Q A;  1SR3 A;  3NHH A;  3GTP H;  5JPM C;  3ERO A;  1EZ8 A;  1OTC A;  3GTQ B;  3V05 A;  1STH A;  4QUC A;  2NN6 H;  1TWC B;  1PYW D;  4P73 A;  1K9M C;  4ME5 A;  2R7D A;  4BY1 H;  1PVO A;  2B2U C;  1JQY D;  4IFD I;  1X54 A;  2KCN A;  3T56 B;  4JI4 L;  2NVT B;  4GNX C;  3SK4 A;  2IHE A;  4IFD H;  2F3W A;  5GAD C;  1BQQ T;  3RD4 A;  2DY7 A;  1U9R A;  1WFQ A;  4A3D B;  4ZAI A;  4RFB A;  3ULL A;  1HNW Q;  2YTY A;  2L55 A;  2JA7 B;  2PMZ E;  4B3M Q;  4NXN Q;  2A69 C;  5C5M A;  1PZJ D;  2Q2I A;  4BXX G;  1EIG A;  1I4G A;  1X55 A;  2AHO B;  4IUV A;  4X3U A;  4OO1 G;  5EKI A;  4GNX A;  3X3M A;  1I4H A;  1SXT A;  4DKA C;  1YHB A;  3SE0 A;  3S2D B;  1IYJ B;  1I6H B;  2X69 A;  1U0L A;  5JPN C;  3E6Z X;  4JBK A;  3EFX D;  3L7Z C;  2UUC L;  2FJ2 A;  5COY A;  4DV6 L;  2H5X A;  3UDF A;  4BXX H;  1SAP A;  1ML0 D;  3KF6 B;  5KIX A;  2RF4 A;  3DWA A;  3QWN A;  1TKW B;  4HCS A;  5C3E B;  2FXQ A;  4LFC Q;  1N33 Q;  4RGO S;  1Q8K A;  2GVB A;  1LT5 D;  3EN2 A;  5C4H A;  4RWS C;  4LF7 L;  4A3B B;  3JAM i;  1EIH A;  4JYA L;  1MIU A;  3R93 A;  2R61 A;  3D31 A;  1TWA H;  2NVQ H;  1YNJ D;  1UWV A;  4TSS A;  3VR6 A;  4OON A;  2YYZ A;  4BY7 H;  1HNZ L;  4F87 A;  4HSP A;  2PQA A;  4BBR H;  4DN4 M;  1VQL A;  1VQB A;  1S4Z A;  1NTG A;  3HOX G;  5M3F G;  5IP7 H;  2NVQ B;  1PYB A;  3KDF B;  2Y0S B;  4DF7 A;  3CCR A;  4R8N A;  3PO2 B;  3VR2 A;  3QJY A;  2E2I H;  2NVX H;  3OOC A;  3U4V A;  4BBR B;  4FVM A;  5CV7 A;  1E2Z A;  2A8V A;  2V4D A;  4AYB B;  3ND8 A;  3M9B A;  3HG9 A;  2E2H B;  3DEO A;  3K81 C;  3TP5 A;  1N32 L;  3H0G H;  2F1M A;  2CW0 D;  1EU3 A;  2LSS A;  1GVP A;  2UUA Q;  3GDE A;  1Y8O B;  3CCS A;  3MAQ A;  4POF A;  3HKS A;  1PV4 A;  3QO2 A;  3U4Z A;  4K2K A;  1GHJ A;  3NTK A;  2WB1 G;  4LF9 Q;  2EYP A;  1CFM A;  5IIF A;  2PI2 A;  1Y1W H;  2F03 A;  3M7G A;  4DAP A;  3HOU B;  5JOB A;  4JV5 L;  3I91 A;  1S5C D;  3CCU A;  4B9W A;  5E4X A;  2CVR A;  4JI7 Q;  2I5H A;  5C6A A;  1PH5 A;  2WP8 J;  1UE7 A;  1XNQ Q;  3RNU A;  5CR3 A;  1HCZ A;  3MWY W;  4A3M B;  4OX9 Q;  4PNY A;  1EQT A;  1C48 A;  3D4W A;  4YCV A;  5FLX L;  3TZD A;  1Y1W G;  1IBL Q;  4ILW A;  3GTK B;  5IWA Q;  1BR9 A;  2L12 A;  5D3I B;  4HIO A;  5K36 G;  1VQ7 A;  3U9S A;  4A3L G;  4LUZ A;  2F0Q A;  1TS5 A;  4A4I A;  4A3K G;  3QIA A;  3C1E A;  4RHR A;  3AQQ A;  2PYK A;  3GTG B;  3S2H B;  4WJ3 M;  1EWH A;  1Y8P B;  2MFI A;  2NZO A;  3C1F A;  3MHB A;  1S5E D;  4JI0 L;  4JI4 Q;  2VY3 A;  3H94 A;  4C3J H;  2D62 A;  1YJW A;  1X65 A;  2NN6 I;  5IT9 c;  5KRU A;  2AQ3 B;  4QL5 A;  1FNW A;  2B3G A;  1LM0 A;  2OT2 A;  1MSG A;  1C9O A;  3W3A A;  1QNU A;  5IYD G;  3GTQ H;  2WKC A;  3CRK C;  4X64 Q;  2EY2 A;  1K0S A;  4IOC A;  5BN4 A;  1SE3 A;  2DUD A;  3G48 A;  1XPR A;  1WD1 A;  1GUW A;  4PQX A;  3QR8 A;  1LTG D;  3AB9 A;  4DAY B;  2MO1 A;  2OQK A;  3A8J E;  1PH9 A;  3I72 A;  1Y69 U;  3NQI A;  1LTT D;  3RLO A;  3URY A;  1EL0 A;  5AJ3 L;  2RDF A;  1PMR A;  2B39 A;  2SDF A;  1UEA B;  4K5X A;  3HS0 C;  3P20 A;  1G51 A;  5IGG A;  1EFI D;  1WJJ A;  3I2Z A;  2KCC A;  5EKK A;  2Z6B A;  4MZ9 A;  3PQI A;  1HRJ A;  1HZB A;  4IUN A;  1BBU A;  3LX0 A;  5DEH A;  1I4X A;  1STN A;  3TRZ A;  1NBW A;  1LT6 D;  3HKZ G;  1EEF D;  1I4R A;  1O7Y A;  1PH1 A;  3CQZ B;  4QQB X;  1VQA A;  4LWC A;  1Z7T A;  2BA1 A;  2K5H A;  1E24 A;  1EU4 A;  4LF8 L;  1VQK A;  3KF6 A;  4M8A A;  2E76 C;  5LMN W;  3A7L A;  2E2J H;  3J81 E;  1EQQ A;  2CWA A;  3KF8 B;  4ZLT F;  3Q22 A;  4A3E H;  3EBE A;  1STG A;  4I7Z C;  2AMC B;  1HZA A;  2Z6K C;  4DNT B;  3OWF A;  1IYV A;  1A3V A;  4L5T A;  2ZJP A;  1A6X A;  2CWP A;  4YCU A;  3NWT A;  3OIP A;  4X65 L;  4LF6 Q;  3TBI B;  1YIJ A;  3L2P A;  2R7F A;  3GTO H;  4PZ6 A;  3BDL A;  3BVM A;  1HA5 A;  2PI2 E;  2XRS D;  3Q24 A;  3BVG A;  3JAM L;  1IBM Q;  5DNF A;  3M3Y H;  3SXH A;  3G6E A;  5BN3 A;  1DM0 B;  4KY5 A;  1N36 Q;  1XX8 A;  2UU9 Q;  2JA6 G;  2I07 B;  4KHP L;  1JR0 D;  4WJ4 A;  2WB1 E;  4HTH A;  2RDG A;  2K75 A;  4FP5 D;  4MTN A;  2FFK B;  2RSO A;  4EQN A;  3O13 A;  2VQF Q;  4POG A;  3RN2 A;  4NMZ A;  4FXK C;  2F4I A;  5C0X G;  1TVX A;  4EGV A;  1HR0 L;  1LTL A;  5AFW A;  1PXU A;  3H0G G;  3R3O A;  1YJN A;  1JCK B;  4JI1 L;  2BE5 C;  5CC4 A;  4DK6 C;  2HQL A;  3T1H Q;  5FO9 B;  1N9W A;  2L11 A;  4WOR A;  4DGZ A;  4IPD A;  4A3F G;  2EYO A;  2JP1 A;  2B2W C;  3AU7 A;  3W5O A;  5C4J H;  1VQI A;  5C3W A;  4C3H G;  2D9U A;  4JI8 L;  3S2H H;  3CHB D;  4C2M B;  1CKO A;  5C0X H;  1IBK Q;  4JBJ A;  1A62 A;  2DJF C;  5JJL A;  1BVS A;  2I0Q A;  3I90 A;  1RKN A;  1KD1 C;  1W6K A;  2CFM A;  2F0V A;  4DV0 L;  2Z4I A;  5CBE E;  1WTX A;  1BKB A;  1LAB A;  1AN8 A;  3LNN A;  1TII D;  4K6L A;  5GAG C;  3ITP A;  2G9H D;  2AQ1 B;  3E0E A;  2KVM A;  4ZK9 B;  1FJG Q;  1SBB B;  3J81 L;  3GTL B;  4NW2 A;  4AQY Q;  3W1B A;  2B63 H;  1XXG A;  4DFA A;  4G7Z C;  3AFP A;  4X65 Q;  2AQ2 B;  1VCI A;  4K0K Q;  2F0E A;  1E1T A;  2D0O A;  3ERS X;  1WVL A;  2F0L A;  4I7A A;  1G91 A;  2MNA A;  2MUY A;  1EY6 A;  5FJ8 H;  3J7Y W;  2JA5 H;  3MXN B;  1BXT A;  3K7U C;  1QZG A;  3I4M H;  1Q86 C;  2R7Z B;  4A3I H;  3KLS X;  3KDF A;  3PUV A;  3PGZ A;  1TR5 A;  3CC2 A;  5I9P A;  3BZK A;  2HHH Q;  3SEB A;  4A3J B;  2DGY A;  2PZT A;  1XNQ L;  1SLJ A;  4Y7N H;  2L1B A;  1WTV A;  1LAC A;  2BCO A;  2KHJ A;  3S1R B;  1EOT A;  4ODG A;  5FOB B;  3PSI A;  3UDX A;  4HJ9 A;  3K80 C;  2KEN A;  1YEZ A;  2QW7 A;  4HID A;  2AUK A;  5M5X H;  1NMF A;  3F2D A;  3I4M G;  2HDM A;  3WDN A;  1STA A;  4LF9 L;  3HOZ B;  3MA2 B;  3Q23 A;  3S15 H;  4B3S Q;  4A3E G;  4EQ5 A;  2BDN A;  3K5N A;  5AJ3 Q;  3TQY A;  1EQV A;  2A6H D;  1YHQ A;  2CH4 W;  1YNX A;  1I3Q H;  3G4S A;  2R93 H;  4ZUI A;  4C3J B;  5JVG 3;  3NPP A;  4HJA A;  3J7A F;  4LNQ A;  4DR6 Q;  1SSO A;  4DV3 L;  4O0A A;  1K83 B;  3I56 A;  1Y1V B;  1UNS A;  1Q1E A;  3EJI A;  2ZM6 Q;  1K3R A;  4R4Q A;  4OXP A;  1X3E A;  1SFO B;  1LTI D;  3DHQ A;  1L0Y B;  3Q8D A;  1TQO A;  1PFS A;  1TWG H;  4EQP A;  5I9O A;  2EJG C;  2YTV A;  1PH4 A;  1X56 A;  3DM1 A;  4P72 A;  1QUQ A;  3TEH B;  1KTK A;  1SYD A;  3F1Z A;  5EPL A;  5E3F A;  4DR1 L;  1K8O A;  1WCM B;  4KKT A;  2F0F A;  3FEW X;  3DWP A;  1AEX A;  1I4P A;  4ID6 A;  5LL6 S;  3AYH B;  4RGM A;  1VQH A;  1NMG A;  2B2W A;  4GOP B;  3BDC A;  1ICW A;  2OCE A;  1NR2 A;  2RHS B;  1XJV A;  1PFB A;  4HJ5 A;  5KGU A;  3CD6 A;  1OXV A;  4IN3 A;  5G3L F;  2VQE Q;  2EJM A;  3TDQ A;  1M8A A;  1PH6 A;  2VUM H;  1D2B A;  1ENF A;  3OTO Q;  4HAE A;  1C7Y A;  1Q7Y C;  2XNA C;  4A3K H;  1C8C A;  1GOZ A;  1G2T A;  1VQC A;  2ASB A;  2JA5 G;  2NTS A;  1BO0 A;  3AEV A;  1XPO A;  1A63 A;  5J3B A;  2F3V A;  1PH8 A;  1O78 A;  4MIU A;  3SK8 A;  4BBS H;  2L9H A;  1DJR D;  3M4P A;  3NP8 A;  4QUF A;  4JBM A;  1HZ9 A;  4KN4 C;  5COR A;  3M4Y A;  2FMM A;  2PQA B;  3S1N B;  4DK1 A;  1EIY B;  4R4I A;  3S1Q B;  1M4V A;  1BCP C;  2EPB A;  3FKI B;  1PLF A;  3E9I A;  4KK7 A;  3MXP A;  4GKJ Q;  1U4P A;  2ID0 A;  1G29 1;  1DZ1 A;  2WAQ E;  1BF4 A;  1JMC A;  3HKZ E;  5TSS A;  1CT1 D;  5CV9 A;  2EYH A;  1HUN A;  4DV3 Q;  1ET6 A;  3CCM A;  4IUR A;  2TMP A;  2PCF B;  1RTN A;  1MGS A;  2KEE A;  4N9T A;  3BG3 A;  3RN5 A;  1UE1 A;  1FVI A;  2F0T A;  2ZTC A;  4JYA Q;  1F9Q A;  4OWW B;  3DMU A;  2Q8T A;  4CJ2 C;  2N88 A;  2LXJ A;  4DR3 Q;  4X3S A;  3LWU A;  1N34 L;  2UUB Q;  1NAP A;  1J6Q A;  4BWG B;  1EZ6 A;  4DV0 Q;  4NPS A;  3C2P A;  1B7Y B;  3R2T A;  5GAE C;  4BY1 B;  2K5D A;  3HRZ C;  3PUY A;  2CH4 A;  3JC6 6;  1SYF A;  1GHK A;  5M5Y B;  5M5W B;  3S17 B;  3K7A H;  1U4R A;  5EKL A;  4IUQ A;  4IPG A;  2Z6K A;  4JI3 Q;  2R93 G;  2RCF A;  1PH3 A;  1CKN A;  3NSW A;  1VQM A;  3SK6 A;  5CBA E;  4P75 A;  2CCZ A;  1RF2 D;  2E5L Q;  3PF4 A;  3TP6 A;  1Y1V H;  1HNX L;  1YIT A;  1ET9 A;  1SDF A;  1TT2 A;  2GA4 B;  3ZYY X;  4DR4 Q;  2LMC B;  3C46 A;  4C3J G;  1YI2 A;  3T51 B;  4OO1 H;  1K28 A;  1I94 Q;  4X3T A;  1EUJ A;  2QEJ C;  1UE6 A;  3PO2 H;  4OWT B;  4GLA C;  3F2U A;  4X62 L;  3FMC A;  4DV7 Q;  1H9R A;  1QVG A;  2IX1 A;  4LF4 L;  2WIN B;  5JJK A;  4JI2 Q;  2PNH A;  1JC7 A;  4JPB W;  3IRB A;  2R93 B;  4K6D A;  2B2Y C;  1S72 A;  4A3L H;  1QVC A;  5IYB G;  5J1Z A;  1SJE D;  3D4R A;  1NR4 A;  3I4M B;  1CQV A;  1SNP A;  1P16 A;  5L37 A;  1RDP D;  1Q81 C;  3PIO 3;  1AZP A;  4QB4 A;  3I55 A;  2C5C A;  4BY1 G;  3U9O A;  2NBF A;  2DN8 A;  1PH2 A;  3FDT A;  1FR3 A;  1A3T A;  4JI8 Q;  4FDB A;  4KY6 A;  3VYR A;  5C0X J;  5LL6 X;  4IJL A;  4X62 Q;  2HIX A;  4H7B A;  1SN8 A;  4CBV A;  4KLK A;  1IL2 A;  4DV7 L;  1BUV T;  1DOK A;  3A74 A;  4OIJ A;  3RLN A;  1CI3 M;  2A68 D;  2F0J A;  1PFM A;  3KUP A;  3J7A V;  5ELB A;  2R7Z G;  1LLR D;  2JJQ A;  2MJ8 A;  3K59 A;  1O7L A;  2ALY B;  4N8F A;  1LV9 A;  3GTO B;  1HR0 Q;  1CA6 A;  2Q2U A;  4C2M H;  1L1O A;  4R4O A;  4R8I A;  1WTQ A;  1S3O A;  2CQO A;  3VDY A;  1JOK A;  2E5L L;  2F0O A;  3FKI G;  1RD9 D;  1JE5 A;  4XDX A;  5M3M H;  4DR2 L;  1V1Q A;  2UXD Q;  1K8G A;  2EDG A;  3P7J A;  2YTX A;  4K5V A;  1WOC A;  3PIP A;  4HR7 B;  1N36 L;  1Z6H A;  4O1N A;  4GNX B;  3QOL A;  1JWS D;  2EYF A;  1K0R A;  3PV0 A;  3HOX H;  3J80 c;  3HP3 A;  1QIL A;  3K5L A;  4IOA A;  3GV3 A;  4JVZ A;  3OW2 A;  4DR7 L;  3PUW A;  4JG2 A;  1X6O A;  2IWH A;  4RA8 A;  3H3V H;  3PUZ A;  1CHP D;  3RMH A;  4A3F B;  2JA5 B;  1MSH A;  2E74 C;  4B08 A;  1V43 A;  4R4C A;  1XMO L;  3OMC A;  1O80 A;  1PRT B;  4MHE A;  5K36 H;  2Q2T A;  5FLM G;  2JE6 I;  1WTP A;  2SOB A;  2F0M A;  2NWG A;  3NQT A;  2HUG A;  4XTC S;  2JK8 A;  2BA0 A;  4OWX B;  1AZQ A;  1DYQ A;  4FYD A;  1DOM A;  4YHH L;  2D0P A;  3TP7 A;  2F0G A;  5KNC A;  2A6E D;  1B9N A;  1DD2 A;  4KKU A;  4MTK A;  1SRO A;  1MJC A;  1Y14 B;  5LMN Q;  4TVA B;  1PZK D;  2A69 D;  1WI5 A;  1WCM G;  1PTO D;  1VQO A;  1CHQ D;  2JA6 B;  4GN5 A;  1OXX K;  3J81 j;  5ELC A;  1H9S A;  3EQL C;  3H15 A;  2GN5 A;  4B3R L;  4JBW A;  3ULP A;  5FK9 C;  3RZD B;  4DK0 A;  1EY8 A;  4ZRZ A;  2N3S A;  3OHX C;  4B3T Q;  5D3D A;  1XMQ L;  1N34 Q;  2UUB L;  4DV5 Q;  1CM9 A;  3CCL A;  4JI7 L;  4L5S A;  1B44 D;  3DXJ C;  4IFD G;  1B2T A;  1D5Z C;  1Y1V G;  4LJZ C;  4Q0F A;  4X6A H;  2EYJ A;  4X64 L;  3CRL C;  4IQZ A;  1BBX C;  3Q0A A;  2EXD A;  2NVX B;  1RL2 A;  1JIC A;  4G57 A;  3GTJ B;  2E2J B;  2VL6 A;  4RH6 A;  1N32 Q;  4A3E B;  3GTM B;  1SRU A;  3HKZ B;  3HOZ G;  1EY9 A;  1WTH A;  2M2L A;  1Q8I A;  1LTA D;  1VQP A;  3M4O H;  1TS3 A;  1GKH A;  4DAV A;  2A5H A;  3CP0 A;  1II3 A;  5K5P A;  2HD3 A;  3OMG A;  3HOZ H;  4RKB A;  2K5Q A;  1LO5 D;  5DLQ E;  5GRO A;  4NKL A;  2QF7 A;  5D65 A;  2K52 A;  2EZV A;  3RUZ A;  3H3V C;  1B70 B;  1D8L A;  1I3Q B;  4H0L C;  2SNM A;  2K6A A;  2WII B;  3OWE B;  3CKI B;  4ZUJ A;  3MXN A;  4GLV B;  3SR1 A;  4OX9 L;  4A3J G;  3I70 A;  4FXG C;  1IBL L;  2K03 A;  1B3Q A;  3NUC A;  1KNE A;  2ZM6 L;  4DUZ Q;  1V1P A;  1G8Z D;  4RGT A;  5C44 H;  2R92 H;  4KV6 A;  2XVS A;  3ND9 A;  1FD7 D;  1WCM H;  5DM6 3;  1Z47 A;  2JA9 A;  2O4X A;  5EPJ A;  4K5W A;  4C1N K;  1VQJ A;  1F9R A;  1MKH A;  1TY0 A;  1J8I A;  4RHS A;  1F2L A;  3TN2 A;  3E0J A;  2A19 A;  1H9M A;  1QZH A;  1SEB D;  5A35 A;  4KJO A;  1X3P A;  4DUY L;  4B3T L;  1DXM A;  2F0W A;  1XTC D;  5M9O A;  4A3K B;  1STY A;  3QG1 A;  2AUJ D;  3JAM E;  3CMA A;  2OXP A;  2UXC L;  3CC4 A;  1VQ6 A;  3GD7 A; 
#chains in the Genus database with same CATH homology
 1T5E A;  3BS1 A;  2A74 C;  2K7V A;  5I2X A;  4C3H B;  1B50 A;  2RA4 A;  3SDZ A;  1GUT A;  4KTA A;  2Z8L A;  3G6J B;  4HMI A;  2J7Z A;  1G6Z A;  1ENC A;  2WV6 D;  1QJO A;  3FRP B;  3H0G B;  5HUR A;  5JVH 3;  5CMD A;  1SND A;  3MZ5 A;  1PRT C;  2F0H A;  4UDU C;  2WB1 B;  3GP7 A;  1QOH A;  3TSS A;  1TS4 A;  1A15 A;  2NUC A;  4XT1 B;  5M5X B;  1HPC A;  3IAY A;  4HCE A;  1CZG A;  3VR4 A;  4XQJ A;  3X3N A;  1QB5 D;  5KEE A;  5D14 A;  4IAL A;  1HTP A;  2B8F A;  1TS2 A;  4IUP A;  3WOF A;  5M3F B;  3HOX B;  4F8M A;  5EQ0 A;  4DXF A;  3K5M A;  1Y8N B;  2B8G A;  2SEB D;  4G7O C;  1KDC A;  2JSO A;  1MI2 A;  3EA6 A;  2KJX A;  2J0T D;  2NB0 A;  4H13 C;  3MFG A;  4EQO A;  1QWY A;  3M3Y B;  2ENB A;  3BZD B;  2DNC A;  1W6J A;  2O2L D;  5J22 A;  5JJZ A;  5LHY 1;  2OEO A;  2N55 A;  2FMC A;  1F2Y A;  1LTR D;  4CKE A;  1D5X C;  3R2I A;  1BCP D;  1WD0 A;  1LTB D;  2B2Y A;  3QOJ A;  5IGD A;  3I3C A;  1V1O A;  1DOL A;  2NVY B;  5IGC A;  2H4O A;  5FKA C;  1A2U A;  1IKL A;  3NXW A;  2Q8R E;  3CU7 A;  2VB2 X;  1SYG A;  2LS0 1;  3IFD A;  1I4Q A;  3W2D A;  1SNO A;  3NTH A;  2EXZ A;  4RCO A;  1H9S B;  1PDQ A;  2B2T C;  5ELF A;  1BOS A;  2XN9 C;  2IT1 A;  2EOT A;  4F7X A;  2MGS A;  2JEA I;  2EY5 A;  4NP5 A;  1IKM A;  3D3R A;  2F0P A;  5IGE A;  4DU9 A;  2L4N A;  4BA1 I;  2ZXP A;  5FLX E;  4ABN A;  4I65 A;  2B2T A;  1Y1W B;  5EJW A;  1ZXT A;  2A73 B;  4ULL A;  1KLG D;  1AW7 A;  2F0S A;  3HOV B;  3H6M A;  2ZXO A;  3TP8 A;  1LTS D;  1HFN A;  3T53 B;  2R92 B;  2IW3 A;  2AWO A;  5JEA H;  2EYL A;  1Q1B A;  3KBG A;  1AP0 A;  2HCC A;  3MEH A;  1SMY C;  1S5F D;  2K5W A;  1GUG A;  1U4L A;  1PTO B;  1ZYR C;  1MD2 D;  3NBI A;  3M85 A;  1CA5 A;  2K04 A;  1JOQ A;  2NTT A;  2B2V C;  2ICE C;  1PTO H;  1R4Q B;  5KND A;  2KQ3 A;  1EYD A;  2HDL A;  4FF1 A;  3VYS A;  3MVV A;  2E75 C;  1R4P B;  4XYQ A;  4HN7 A;  1RHP A;  2PMZ B;  1J9O A;  2A6H C;  1EWC A;  5EBD A;  2R3Z A;  1LT4 D;  4YIJ A;  2BOS A;  1B53 A;  2NZ1 D;  1GUO A;  1OXU A;  2XSC A;  5E4W C;  1U4M A;  1SE2 A;  2IX0 A;  3K5O A;  3K58 A;  1ESR A;  2FHT A;  5DM7 3;  4KHV A;  3KLS A;  3DUZ A;  1F2M A;  1B1Z A;  4TQU S;  2PPB C;  2K01 A;  2RSN A;  1E2V A;  2ZT9 C;  4K8I A;  2QDB A;  3GO5 A;  2DNE A;  2O5I C;  3T16 A;  4LMQ D;  3S1M B;  2VXW A;  1ILQ A;  1PFN A;  1B9M A;  3P1H A;  4FO2 A;  2BDO A;  2M9V A;  1VF5 C;  2IPK D;  5C44 B;  2C9O A;  4FF4 A;  1O7Z A;  5C4X B;  2RBM A;  2PNR C;  1KDA A;  5FO8 B;  3A8K E;  2MPM A;  4OO1 I;  2A6E C;  4OL7 A;  1G2S A;  4FXD A;  2X6L A;  1QE6 A;  1DON A;  2L5T A;  3M4O B;  1KLU D;  5IOC A;  2M00 A;  1NUC A;  5C0X I;  5I6Y A;  4ZKB B;  1YNN C;  4IZ8 A;  1Q90 A;  2EYM A;  3MC0 B;  4V19 0;  4ZQ3 A;  1SYE A;  2F0N A;  1F77 A;  1KAB A;  2CW0 C;  4KKS A;  1EYA A;  4CKC A;  5FO7 B;  4C1N I;  1JOO A;  2IL8 A;  2RDH A;  2WAQ B;  2D2C C;  2JEB I;  3S9W A;  1F9P A;  5A2Q L;  4OHJ A;  3J80 E;  1B3A A;  3OW7 A;  1IYU A;  1L0X B;  2K33 A;  5KNB A;  1E0B A;  1F2Z A;  5CV8 A;  2Q8I B;  5F2D A;  1HA6 A;  4GZY C;  2BE5 D;  2KUM A;  4QF4 A;  1IL8 A;  1NCV A;  5JEA J;  2XRQ D;  3IFT A;  1EEI D;  1ZYR D;  2LY7 A;  1WTR A;  2KA7 A;  2PO4 A;  1QG7 A;  2B63 B;  1TU2 B;  2O5J C;  3HZX A;  4H44 C;  3FVQ A;  1CZW A;  1E2W A;  5CV5 A;  3K6O A;  2L0C A;  2B2U A;  3T13 A;  1VF7 A;  1PTO F;  3HEJ A;  5I4D A;  1NSN S;  2VB3 X;  2PQE A;  1R9T B;  3DEP A;  3PIP 3;  1S5D D;  4XQN A;  1TWF B;  3MTS A;  3BVZ A;  1K8M A;  3FPU B;  2K05 A;  5CGK A;  5ISR A;  5I2Y A;  4KMU C;  1HUM A;  1EY7 A;  3A55 A;  5M3M B;  2F0D A;  1H9J A;  4HSV A;  2RKS A;  1PRT F;  1BNZ A;  1WTO A;  3K57 A;  3KF8 A;  1JWM D;  2CHB D;  4DNR B;  4XYO A;  1ESF A;  4K2L A;  1EY4 A;  2F0I A;  4KI0 A;  2EY6 A;  4U67 3;  3KBX A;  1A2T A;  1PRT D;  1D1K A;  4BY7 B;  3VA7 A;  1ROD A;  3N52 A;  5J39 A;  4CKB A;  1FNV A;  3EVQ A;  3KLR A;  1TWA B;  1MBY A;  1SMY D;  3VYT A;  5NUC A;  4QMG A;  2PW5 A;  4WJW A;  2J4X A;  4XIG S;  2VUM B;  3G7L A;  3RLF A;  1HHV A;  3NBH A;  4IUT A;  3C3L A;  4CJ0 B;  2QCP X;  2R6G A;  5CV6 A;  5CV4 A;  3HGB A;  3P75 A;  1CQF A;  3FPP A;  2RVL A;  1IW7 C;  4FF3 A;  5CYU A;  5C4Z A;  3I8Z A;  1YNN D;  2KEC A;  1STE A;  2JYO A;  2JA8 B;  3SVM A;  1JE4 A;  2ICI A;  3SHL A;  3TME A;  4OIK A;  4R9W A;  2PZW A;  3D6C A;  1BDO A;  3SK5 A;  3TZU A;  5JEA G;  4LK1 C;  5IOD A;  2AWN A;  4Z9C B;  1KNA A;  1ENA A;  2XWJ B;  4KD4 A;  5DAU A;  1V8Q A;  4KHZ A;  1Q3L A;  4K14 A;  1JWU D;  2E2D C;  2HQE A;  3GTP B;  1LT3 D;  4M1U B;  3V96 A;  1F9S A;  1KDB A;  1SNQ A;  5ELD A;  4V0B A;  1RTO A;  1HFG A;  3KK7 A;  4HMJ A;  3S15 B;  4C56 C;  4XT3 B;  2VNU D;  4XQQ A;  1Q12 A;  4A93 B;  1EY0 A;  2D5D A;  4RCN A;  3A56 A;  4C3I G;  2XIW A;  1KAA A;  1FYC A;  1UUP A;  4A3G B;  1FGB D;  3WOE A;  1B4O A;  1X32 A;  1EYC A;  5C5L A;  1DCZ A;  1ILP A;  4F88 A;  4KJN A;  1GUS A;  3D4D A;  1ZEQ X;  4KD3 A;  2E2I B;  1QNK A;  1VDZ A;  4C3I B;  2TSS A;  2G9D A;  3VYU A;  3BDO A;  2F0U A;  4K8J A;  5I6W A;  4DAY A;  2MHV A;  3MXG A;  4TKO B;  1OO9 B;  3ERQ A;  1TWG B;  1XYI A;  3PMF A;  2NN6 G;  1BCP F;  4BA2 I;  5BN5 A;  2Z1C A;  1I6V C;  2F0K A;  3I4N B;  5EPK A;  1UAP A;  5KYL A;  1GUN A;  3NWS A;  4DA2 A;  3R8B A;  2K28 A;  1PTO C;  1AFP A;  4BS9 A;  1D1I A;  4G4K A;  1T5X D;  4J6H A;  1CTM A;  4RKL A;  2IJ0 A;  2Z4H A;  3D8G A;  3UI2 A;  3N6R A;  4OGQ C;  5T1I A;  1PZI D;  1BCP B;  5KYI A;  5C3X A;  3L9A X;  5G3L D;  1SE4 A;  4ZYS A;  1SYC A;  2KED A;  3IL8 A;  4RGN A;  4EVO A;  2EVB A;  2WAC A;  4KY7 A;  2LFN A;  1YNJ C;  3BYT B;  3BYY B;  5IGF A;  2YU9 B;  1IW7 D;  1EY5 A;  1C4Q A;  1STB A;  2MP1 A;  4ZKC B;  2IX3 A;  4IUU A;  4G7H C;  4LAA A;  2SNS A;  3OPO A;  4UAI A;  5E1F A;  4A3I B;  1FNU A;  1A3U A;  2KHS A;  3IKJ A;  3VR5 A;  3RZO B;  1TY2 A;  3PUX A;  4CHT B;  2LKV A;  3E5S A;  2B2V A;  2EY1 A;  3HOY B;  2JXM B;  1TWH B;  4FF2 A;  3Q6S A;  3K0Y A;  4WFN 3;  4P2C B;  4PMC A;  1HTL D;  4PMB A;  1ONL A;  3S16 B;  1SNM A;  2XWB B;  4U68 A;  2HCI A;  4S3S A;  1HXY D;  1S5B D;  1GXD C;  1SNC A;  3GQB A;  1CK1 A;  4Q5V A;  2NYZ D;  1ZKO A;  1RCV D;  2PW7 A;  5EGT A;  5T1G A;  3D6W A;  1HQR D;  4JK1 C;  4QIW B;  2KOL A;  3I4L A;  4TRD A;  4B9X A;  4O42 A;  5JAV A;  2I46 A;  4IFD J;  5HGT A;  1QCB D;  2EE1 A;  5ELE A;  1D6E C;  1I50 B;  1WTW A;  2RQX A;  1VMC A;  2OF1 A;  3PO3 B;  4XXE A;  4KN7 C;  3DWQ A;  3T4A C;  4L6T B;  4CJ1 B;  3A54 A;  3NTI A;  4WRD A;  1OXT A;  4CGY B;  5IT9 E;  2QKI C;  3I73 A;  3K7A B;  4NDX A;  4RAU C;  4PMW A;  1JOR A;  2X6G A;  1V1P B;  3NE5 B;  4L8J A;  2H1E A;  1D5M C;  5IGB A;  1GJX A;  1IHZ A;  4E6I A;  1X3Q A;  2ZXR A;  3V2T A;  5IT9 L;  3QB3 A;  4FNF A;  3L3O C;  3H09 A;  5EBC A;  2A68 C;  2K1B A;  4QCL A;  4HED A;  3VR3 A;  4J1M A;  1SJH D;  2WKD A;  3M7N A;  1HQM C;  4PV1 C;  2FIN B;  3OSO A;  1JB3 A;  3ONA B;  2CQA A;  2EJF C;  2K32 A;  5A2Q E;  3HOW B;  3GV6 A;  3J80 L;  1SYB A;  4N9P A;  4L63 B;  3A8I E;  2PZU A;  1XWE A;  1H9K A;  3OIQ A;  1VMP A;  5C4J B;  3MFY A;  1OXS C;  3MXU A;  2DY8 A;  4Y7N B;  4MN3 A;  3AMU A;  1RJT A;  4BBS B;  3A7A B;  4X3K A;  3H91 A;  4DXG A;  3S14 B;  3NK9 A;  3VA5 A;  3LWE A;  2QIL A;  4J8Q A;  3NHH A;  5JPM C;  3ERO A;  1EZ8 A;  3GTQ B;  3V05 A;  1STH A;  4QUC A;  2NN6 H;  1TWC B;  1PYW D;  4ME5 A;  2B2U C;  1JQY D;  4IFD I;  2KCN A;  3T56 B;  2NVT B;  3SK4 A;  4IFD H;  2F3W A;  1BQQ T;  3RD4 A;  2DY7 A;  1U9R A;  4A3D B;  4ZAI A;  4RFB A;  2L55 A;  2JA7 B;  2A69 C;  5C5M A;  1PZJ D;  1EIG A;  1I4G A;  4IUV A;  4X3U A;  4OO1 G;  5EKI A;  3X3M A;  1I4H A;  1SXT A;  3SE0 A;  3S2D B;  1I6H B;  2X69 A;  5JPN C;  3E6Z X;  3EFX D;  3L7Z C;  2FJ2 A;  5COY A;  1SAP A;  1ML0 D;  5KIX A;  3DWA A;  3QWN A;  1TKW B;  4HCS A;  5C3E B;  4RGO S;  1LT5 D;  5C4H A;  4RWS C;  4A3B B;  1EIH A;  3R93 A;  2R61 A;  3D31 A;  1YNJ D;  4TSS A;  3VR6 A;  2YYZ A;  4F87 A;  4HSP A;  4DN4 M;  1S4Z A;  2NVQ B;  2Y0S B;  4DF7 A;  4R8N A;  3PO2 B;  3VR2 A;  3QJY A;  3OOC A;  4BBR B;  4FVM A;  5CV7 A;  1E2Z A;  2V4D A;  4AYB B;  3ND8 A;  3HG9 A;  2E2H B;  3DEO A;  3TP5 A;  2F1M A;  2CW0 D;  1EU3 A;  1Y8O B;  3MAQ A;  3QO2 A;  4K2K A;  1GHJ A;  3NTK A;  2EYP A;  1CFM A;  5IIF A;  2F03 A;  3M7G A;  4DAP A;  3HOU B;  5JOB A;  3I91 A;  1S5C D;  4B9W A;  5E4X A;  2CVR A;  5C6A A;  2WP8 J;  5CR3 A;  1HCZ A;  3MWY W;  4A3M B;  4PNY A;  1EQT A;  1C48 A;  3D4W A;  5FLX L;  3TZD A;  4ILW A;  3GTK B;  1BR9 A;  2L12 A;  5D3I B;  5K36 G;  3U9S A;  2F0Q A;  1TS5 A;  3QIA A;  3C1E A;  4RHR A;  2PYK A;  3GTG B;  3S2H B;  1EWH A;  1Y8P B;  3C1F A;  3MHB A;  1S5E D;  3H94 A;  2D62 A;  2NN6 I;  5KRU A;  2AQ3 B;  1FNW A;  2OT2 A;  1MSG A;  3W3A A;  1QNU A;  2WKC A;  3CRK C;  2EY2 A;  5BN4 A;  1SE3 A;  1WD1 A;  1GUW A;  4PQX A;  1LTG D;  3AB9 A;  3A8J E;  3I72 A;  1Y69 U;  3NQI A;  1LTT D;  3URY A;  1EL0 A;  2RDF A;  1PMR A;  2B39 A;  2SDF A;  1UEA B;  3HS0 C;  3P20 A;  4K5X A;  5IGG A;  1EFI D;  2KCC A;  5EKK A;  1HRJ A;  4IUN A;  3LX0 A;  5DEH A;  1I4X A;  1STN A;  1LT6 D;  1EEF D;  1I4R A;  1O7Y A;  3CQZ B;  1Z7T A;  2BA1 A;  1EU4 A;  4M8A A;  2E76 C;  3A7L A;  3J81 E;  4ZLT F;  3Q22 A;  1STG A;  4I7Z C;  4DNT B;  3OWF A;  1IYV A;  1A3V A;  1A6X A;  3NWT A;  3OIP A;  3TBI B;  3BDL A;  3BVM A;  1HA5 A;  2XRS D;  3Q24 A;  3JAM L;  3BVG A;  5DNF A;  3SXH A;  5BN3 A;  1DM0 B;  4KY5 A;  1XX8 A;  2I07 B;  1JR0 D;  4HTH A;  2RDG A;  4FP5 D;  2FFK B;  2RSO A;  4EQN A;  3O13 A;  4NMZ A;  4FXK C;  2F4I A;  5C0X G;  1TVX A;  4EGV A;  5AFW A;  1PXU A;  3R3O A;  1JCK B;  2BE5 C;  5CC4 A;  5FO9 B;  2L11 A;  4WOR A;  4DGZ A;  2EYO A;  2JP1 A;  2B2W C;  3AU7 A;  5C3W A;  4C3H G;  2D9U A;  3CHB D;  4C2M B;  5C0X H;  3I90 A;  1RKN A;  1W6K A;  2F0V A;  1WTX A;  2Z4I A;  5CBE E;  1LAB A;  1AN8 A;  3LNN A;  1TII D;  4K6L A;  3ITP A;  2G9H D;  2AQ1 B;  2KVM A;  4ZK9 B;  1SBB B;  3J81 L;  3GTL B;  4NW2 A;  1XXG A;  4DFA A;  4G7Z C;  2AQ2 B;  1VCI A;  2F0E A;  1WVL A;  2F0L A;  1G91 A;  2MUY A;  1EY6 A;  3J7Y W;  1BXT A;  2R7Z B;  3KLS X;  3PUV A;  1TR5 A;  5I9P A;  3SEB A;  4A3J B;  2PZT A;  2L1B A;  1WTV A;  1LAC A;  2BCO A;  3S1R B;  1EOT A;  4ODG A;  5FOB B;  2AUK A;  2HDM A;  3WDN A;  1STA A;  3HOZ B;  3MA2 B;  3Q23 A;  2BDN A;  3K5N A;  1EQV A;  2A6H D;  4ZUI A;  4C3J B;  5JVG 3;  3NPP A;  3J7A F;  1SSO A;  1K83 B;  1Y1V B;  1UNS A;  1Q1E A;  3EJI A;  1SFO B;  1LTI D;  3DHQ A;  1L0Y B;  1TQO A;  4EQP A;  5I9O A;  2EJG C;  3DM1 A;  1KTK A;  1SYD A;  5EPL A;  5E3F A;  1K8O A;  1WCM B;  4KKT A;  2F0F A;  3FEW X;  3DWP A;  1AEX A;  1I4P A;  4ID6 A;  5LL6 S;  4RGM A;  2B2W A;  3BDC A;  1ICW A;  1NR2 A;  1PFB A;  5KGU A;  1OXV A;  4IN3 A;  5G3L F;  2EJM A;  3TDQ A;  1M8A A;  1D2B A;  1ENF A;  4HAE A;  2XNA C;  1C8C A;  1GOZ A;  1G2T A;  2NTS A;  1BO0 A;  2F3V A;  1O78 A;  4MIU A;  3SK8 A;  2L9H A;  1DJR D;  3NP8 A;  4QUF A;  4KN4 C;  5COR A;  3M4Y A;  2FMM A;  3S1N B;  4DK1 A;  3S1Q B;  1M4V A;  1BCP C;  2EPB A;  3FKI B;  1PLF A;  4KK7 A;  3MXP A;  1U4P A;  2ID0 A;  1G29 1;  1DZ1 A;  1BF4 A;  5TSS A;  1CT1 D;  5CV9 A;  2EYH A;  1HUN A;  1ET6 A;  4IUR A;  2TMP A;  2PCF B;  1RTN A;  1MGS A;  2KEE A;  4N9T A;  3BG3 A;  2F0T A;  1F9Q A;  3DMU A;  2Q8T A;  4CJ2 C;  2N88 A;  4X3S A;  3LWU A;  1NAP A;  4BWG B;  1EZ6 A;  3C2P A;  3R2T A;  4BY1 B;  2K5D A;  3HRZ C;  3PUY A;  1SYF A;  1GHK A;  5M5Y B;  5M5W B;  3S17 B;  1U4R A;  5EKL A;  4IUQ A;  3NSW A;  3SK6 A;  5CBA E;  1RF2 D;  3TP6 A;  1ET9 A;  1SDF A;  1TT2 A;  2GA4 B;  3ZYY X;  2LMC B;  3C46 A;  4C3J G;  3T51 B;  4OO1 H;  4X3T A;  2QEJ C;  3F2U A;  2IX1 A;  3FMC A;  1H9R A;  2WIN B;  1JC7 A;  2R93 B;  4K6D A;  2B2Y C;  5J1Z A;  1SJE D;  3D4R A;  1NR4 A;  3I4M B;  1CQV A;  1SNP A;  1RDP D;  3PIO 3;  1AZP A;  4QB4 A;  2C5C A;  3U9O A;  2NBF A;  2DN8 A;  3FDT A;  1FR3 A;  1A3T A;  4KY6 A;  3VYR A;  5C0X J;  5LL6 X;  4H7B A;  4CBV A;  1BUV T;  1DOK A;  4OIJ A;  1CI3 M;  2A68 D;  2F0J A;  1PFM A;  3KUP A;  3J7A V;  5ELB A;  1LLR D;  2MJ8 A;  3K59 A;  1O7L A;  1LV9 A;  3GTO B;  1CA6 A;  4R8I A;  1WTQ A;  1JOK A;  2F0O A;  1RD9 D;  4XDX A;  2EDG A;  3P7J A;  4K5V A;  4HR7 B;  1Z6H A;  4O1N A;  1JWS D;  3QOL A;  2EYF A;  3PV0 A;  3HP3 A;  1QIL A;  3K5L A;  3GV3 A;  3PUW A;  2IWH A;  4RA8 A;  3PUZ A;  4A3F B;  1CHP D;  3RMH A;  2JA5 B;  1MSH A;  2E74 C;  4B08 A;  1V43 A;  3OMC A;  1O80 A;  1PRT B;  4MHE A;  5K36 H;  2JE6 I;  1WTP A;  2SOB A;  2F0M A;  2NWG A;  3NQT A;  2HUG A;  4XTC S;  2BA0 A;  1AZQ A;  1DYQ A;  4FYD A;  1DOM A;  3TP7 A;  2F0G A;  5KNC A;  2A6E D;  1B9N A;  1DD2 A;  4KKU A;  1PZK D;  2A69 D;  1PTO D;  2JA6 B;  1CHQ D;  1OXX K;  5ELC A;  1H9S A;  3EQL C;  4JBW A;  5FK9 C;  3RZD B;  4DK0 A;  1EY8 A;  4ZRZ A;  3OHX C;  5D3D A;  1CM9 A;  1B44 D;  3DXJ C;  4IFD G;  1B2T A;  1D5Z C;  4LJZ C;  4Q0F A;  2EYJ A;  3CRL C;  4IQZ A;  1BBX C;  3Q0A A;  2NVX B;  1JIC A;  4G57 A;  3GTJ B;  2E2J B;  4RH6 A;  4A3E B;  3GTM B;  3HKZ B;  1EY9 A;  2M2L A;  1Q8I A;  1LTA D;  1TS3 A;  4DAV A;  2A5H A;  1II3 A;  5K5P A;  3OMG A;  4RKB A;  2K5Q A;  1LO5 D;  2QF7 A;  4NKL A;  5D65 A;  2EZV A;  3RUZ A;  3H3V C;  1I3Q B;  2SNM A;  2WII B;  2K6A A;  4H0L C;  3OWE B;  3CKI B;  4ZUJ A;  3MXN A;  3SR1 A;  3I70 A;  4FXG C;  2K03 A;  3NUC A;  1KNE A;  1V1P A;  1G8Z D;  4RGT A;  4KV6 A;  2XVS A;  3ND9 A;  1FD7 D;  5DM6 3;  1Z47 A;  2O4X A;  5EPJ A;  4K5W A;  4C1N K;  1F9R A;  1TY0 A;  1J8I A;  4RHS A;  1F2L A;  3TN2 A;  3E0J A;  1H9M A;  1SEB D;  5A35 A;  4KJO A;  1X3P A;  1DXM A;  2F0W A;  1XTC D;  5M9O A;  4A3K B;  3JAM E;  1STY A;  3QG1 A;  2AUJ D;  2OXP A;  3GD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...