3OSOA

Crystal structure of staphylococcal nuclease variant delta+phs l25a at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKAMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3osoA00
3HEJA 3BDLA 4EQNA 4NDXA 1U9RA 5CC4A 5IGFA 4ZUIA 2PW5A 5I6WA 4TRDA 3VA5A 5CGKA 5KYLA 2EXZA 3TP7A 5J22A 4K8IA 1JOKA 2F0LA 5DAUA 5NUCA 4DF7A 3SHLA 5KEEA 3ITPA 1STYA 3R3OA 5IGBA 2F0EA 1EYCA 2F0DA 4K14A 4DFAA 3MZ5A 2F0NA 3D8GA 2PQEA 3EROA 3D6CA 2EY5A 4KJOA 2PZUA 3D4DA 3NP8A 4HMJA 4E6IA 4KHVA 3SXHA 4K8JA 1SNCA 1ENCA 2HQEA 4S3SA 5E3FA 4EVOA 2F0WA 2O4XA 2OEOA 4N9PA 4ZUJA 3SK8A 5HGTA 5IIFA 3QB3A 4DGZA 3TMEA 5M9OA 1SYFA 4J1MA 5JOBA 1EY4A 2EYOA 3NK9A 4KY7A 2F3VA 2RKSA 4NMZA 3NXWA 4PMBA 1EZ8A 3EJIA 1A3UA 5C6AA 5I9PA 5C4ZA 2KHSA 1EY7A 2EYHA 4YIJA 2QDBA 1F2YA 1SNPA 2PZTA 4OL7A 2EYFA 4K2KA 5C5MA 2PZWA 2ENBA 3SK5A 3SR1A 5CV4A 1SNDA 2RBMA 2F0VA 4RKLA 5C3WA 2WACA 1SYGA 4HTHA 5C4HA 2F0KA 1EY0A 4K6DA 2F0FA 2F0TA 5I9OA 1JORA 4B9XA 3TP6A 2F0SA 1EZ6A 5J39A 1SYCA 4NP5A 5EKLA 5KGUA 4KY5A 5CV5A 5HURA 4ID6A 4KTAA 5KIXA 1SYDA 4IUNA 1SNMA 1IHZA 3E5SA 4KV6A 2F0IA 1F2ZA 2EY1A 2F0UA 5I6YA 2EYMA 1A3VA 4F8MA 1EY9A 4MIUA 2F0PA 1EQVA 1KABA 2F0HA 5CV7A 5KYIA 4IZ8A 5EKKA 3OWFA 1SNOA 2KQ3A 2OF1A 1JOOA 3MHBA 5K5PA 3ERQA 5IGEA 3T13A 1NUCA 1F2MA 3PMFA 4R8NA 3NQTA 4QMGA 5JAVA 1STNA 2F0QA 3DHQA 3EVQA 3MXPA 4KD4A 1AEXA 4J6HA 1TT2A 4KJNA 3H6MA 2OXPA 5IODA 3RUZA 4K5VA 3TP5A 1RKNA 3BDCA 1KDCA 3DMUA 3OMCA 3QOLA 4EQPA 5IOCA 1SNQA 5C3XA 2SOBA 5EGTA 1SYBA 3C1FA 4IALA 2EYLA 1KDBA 1A2UA 1STHA 2F0MA 1A3TA 1STBA 4KD3A 4WRDA 5C5LA 3T16A 3TP8A 1KDAA 3MEHA 5F2DA 3V2TA 1TR5A 1NSNS 5CV8A 3NUCA 4PNYA 4F7XA 4K2LA 3SK6A 3SK4A 4DU9A 5ISRA 5J1ZA 1EY5A 2EYJA 1SYEA 4HMIA 1EY8A 1STAA 2F0GA 3C1EA 3S9WA 3U9OA 2LKVA 4H7BA 4QB4A 3P75A 4RKBA 5E1FA 5IGCA 1STGA 2EYPA 4LAAA 4B9WA 4ODGA 3OSOA 4KY6A 1II3A 2PYKA 3MVVA 4QF4A 1ENAA 1EYDA 3LX0A 3P1HA 4WORA 2PW7A 1EY6A 5DEHA 1JOQA 5CV9A 4PMCA 4G57A 5KRUA 4I65A 2SNMA 4NKLA 4K5XA 4K5WA 2EY2A 4EQOA 5IGGA 2EY6A 4N9TA 3QOJA 5IGDA 5CR3A 3OMGA 2SNSA 1A2TA 3NHHA 1KAAA 3HZXA 4ZQ3A 2M00A 2NUCA 2RDFA 2F0OA 2F0JA 5CV6A 3D4WA 1TQOA 4ME5A 2F3WA 1EYAA
chains in the Genus database with same CATH superfamily
4CDDC 1SDFA 2NZOA 2JJQA 4JBWA 5IP9H 2E2HH 2NN6G 1XMOL 3MXGA 5DNFA 1D6EC 4H44C 4O2DA 4X66L 3R3OA 4CBVA 1I4PA 3CCJA 2F0DA 3I90A 1PH9A 1Z6HA 4KHZA 4HMJA 1S5ED 3GTGH 3PSIA 2LXKA 5C44G 2CWPA 2B63H 2UUBQ 4L63B 3K5LA 4KY7A 3S16H 1O78A 2QDBA 5IWAL 3S1QB 3M3YH 4A3FH 4TSSA 5C0XG 1ICFB 5IODA 3TN2A 5CBEE 1VQCA 5DLQE 4LFBL 5HGQA 2E2JB 3M7GA 4MN3A 3TS0A 1ZYRD 3I2ZA 1SYDA 1IBLQ 4IUNA 4A3BH 1SNMA 1HA6A 3MAQA 1HNXL 1F2ZA 1QG7A 2OCEA 1GKHA 4UP8A 2EYMA 2VUMB 1CI3M 3S14H 2R7DA 2F0HA 4JK1C 1BF4A 2E5LL 1RHPA 2AQ3B 3TREA 1K8GA 1QUQA 2F1MA 1BCPD 3U50C 3RUZA 4G7OC 1TWFH 1I4GA 1WD0A 3HOVH 3NENA 4BWGB 4EQPA 3RZOB 1IW7C 1KNEA 3PV0A 3QG1A 2K1BA 3K5NA 1D1IA 3S2HH 5FJ8G 2K50A 3KDFB 3FDTA 3CPFA 3PIOA 4GOPB 4UDUC 3KUPA 1Q1EA 3KK7A 4H02A 4Q5VA 2EVBA 4B3TQ 1A8VA 4CJ2C 4A3MG 1K73C 3GTLH 4HEDA 4JI6Q 2WB1E 1D2BA 4XDXA 4CDEC 3S9WA 4GNXC 3TSSA 3P75A 1ZYRC 2JEAI 2NVXB 2UU9L 4DAYA 1YITA 4BY7G 2I07B 4IFDG 2OT2A 5IY0A 4K5XA 2XVSA 1QE6A 3KLSX 2SEBD 4ZKBB 1L0YB 1LTRD 3M4OB 4X6AH 3A56A 3HOYH 2NUCA 5AJ3L 4LF9L 4FVMA 2F0JA 4B3ML 1BCPC 5KYIA 4HIOA 5E7NA 3R2TA 5M3MB 5CGKA 3I55A 1K83B 4N8X1 2IT1A 4ZLTF 4QCLA 3K7AB 1STYA 4LF5L 4GN3B 2HT1A 4JYAL 1BVSA 1VQNA 1HTLD 4KHVA 1HXYD 4A3GH 4TVAB 4A76A 2J4XA 3KBGA 1VQMA 1AE2A 1VQ7A 3NK9A 1GHKA 1VMCA 4TQUS 3I4OA 3AQQA 4WJ4A 4OL7A 4CJ0B 4OEMB 1SBBB 1U0LA 5COYA 2F0VA 3W1BA 3U58A 4DV5Q 4WJWA 2AKWB 4IO9A 5FLXL 1JJGA 4XQQA 1PH2A 2Q2TA 4NP5A 4OX9Q 3VR4A 2ATWA 3NE5B 3JAMc 5EJWA 1FGBD 2KVMA 5IYCH 3EIVA 4YHHL 3V05A 2EY1A 1PZKD 4FP5D 3CW2C 4EQ5A 1SN8A 4C3HH 5C3EH 3J80E 2K4KA 5BR8L 3E0EA 1BR9A 1JC7A 1O7LA 5CYUA 2L9HA 2CQAA 1QZHA 3C3LA 1SJED 1KDCA 2Y0SB 3OMCA 1WCMB 4HJ8A 4LF7L 3WOEA 5G3LF 3CP0A 2PO4A 2YTVA 3KF8B 4R4QA 3O13A 3SE0A 2F0MA 1XPOA 2Z6BA 4GKKQ 1DGSA 1LT4D 1O7ZA 1YNND 4FF1A 5ISRA 3HOXH 2WINB 2JA6H 1YHAA 3G7LA 1G2SA 3VR3A 5IGCA 5E1FA 1GHJA 1VF5C 2NZHA 2WKDA 3S1MH 3Q22A 4R9WA 3CAMA 4DAYB 1HZAA 1SE8A 4IN3A 2HCCA 2DY8A 3BU2A 3K0YA 1PVOA 1B1ZA 3NHHA 2K5HA 1F9SA 1V1PA 2RDFA 1DXMA 4YY3Q 1VQDA 1YNXA 2JEBI 3ND9A 4Q0FA 4HJAA 1VQGA 2PMZE 3FKIB 5IGFA 4ZUIA 3FVQA 1KLUD 1M1KC 2HD3A 3HFZB 1KRTA 2UXCQ 4PZ7A 4DF7A 5KEEA 2NVQH 1K8OA 1B8AA 1JT8A 4CGYB 2XRSD 2F4VQ 1F9QA 1YNNC 1ET9A 4A3LG 4FDBA 4B3SQ 3R93A 1UUPA 1Q1BA 4O1NA 4ME3A 2EYOA 2RKSA 3HOZB 5I9PA 2QCPX 5M5YB 1K8MA 4OONA 1R9TB 1F2YA 3OTOQ 2R92B 3NEMA 2WB1G 2PCFB 3D31A 4LW1A 1MHWC 4WFN3 4DNTB 4ABNA 1LT6D 3RLFA 1HNWQ 3L7ZC 3K58A 4DV2L 1BXTA 3E9HA 3NSWA 1HJPA 3JC66 4GKJQ 2B2WC 2PNRC 1HUMA 1Y1VH 4DR4L 2JP1A 1H95A 1ZEQX 1BUVT 2HDLA 3OWFA 1UE7A 4JG2A 1TWGB 5IGEA 5TSSA 4X65L 1H9SB 1F2MA 4R8NA 4MTNA 2BH2A 1F2LA 2HHHQ 1AEXA 1OXUA 2L0CA 4DA2A 4PZ6A 3DMUA 4LF8Q 1TKWB 3FMCA 3GV6A 4DN4M 4UP9A 3S17B 4IOCA 2B2VA 1V43A 3NQIA 4A3KG 1S5BD 1SYBA 2K52A 5K36H 1CKNB 3NTIA 2DJFC 2RSOA 2PQAA 3URYA 4BBRH 1GJXA 4FXKC 4XIGS 4NXML 5E4WC 1TWCB 3RZDB 2CKZB 4JI7Q 4KMUC 2K05A 3HOUH 4DV3Q 2IHFA 2WAQE 3C1EA 4G7HC 3U9OA 1XMQQ 5ELFA 2NZ1D 3HOWH 3G48A 3CU7A 4L5RC 2ZT9C 4KHPL 3I3CA 1XX8A 4ODGA 5LL6X 2PYKA 1I4HA 4DUZQ 4WORA 1IKLA 2IL8A 2OQ0A 5DEHA 2TSSA 3HGBA 1X56A 1FR3A 4JBKA 3MEFA 3R8BA 4A3FG 5BN5A 2Z6KA 3I4LA 4XYQA 2ID0A 4A3JB 2K01A 1EFID 4MNOA 2B2YC 1U9RA 4M8AA 4UP7A 4Y52H 1A15A 1YI2A 3HOVB 4A3BG 1JOKA 4YWMA 5JJZA 3A74A 2N8NA 5IGBA 2F0EA 1EYCA 1XPUA 2C9OA 3S1QH 1X32A 1Q81C 2JA7B 2E74C 2EY5A 4HR7B 1MSGA 4X3TA 4G4KA 5E3FA 3J81j 1PH8A 2E2JH 1W6JA 3TMEA 1N8RC 2P5ZX 1TIID 1VQOA 3EJIA 3IRBA 2IX1A 2EYHA 2A8VA 4XQJA 1N33Q 3PO2G 3PO3G 1I5FA 2BA0A 2K33A 1RIPA 3J80c 2VUMH 1EWIA 3CCLA 3RNUA 3Q6SA 1O80A 5GAHC 1SE4A 1S40A 3GTQB 1K3BC 4DV7Q 2NTSA 2WIIB 4C3JG 3T4AC 4KN7C 2NBFA 5CV5A 2PI2A 1ICWA 3BVZA 1XPRA 1PTOF 2A5HA 1D1KA 3H3VC 2IHEA 3RZOH 1A0IA 1A3VA 1I94Q 5C4XG 3BYYB 1IBMQ 2EIFA 5GAEC 1TY2A 1CUKA 1H9RA 3E6ZX 1KXLA 1QVCA 4I7ZC 4OXPA 1VQLA 4R4IA 2L12A 3CRKC 2ZJRA 5DM63 3M7NA 5FKAC 4A3DB 1A62A 2CW0D 4R4CA 2NVXH 3I4NG 1RDPD 3S2DB 3CCVA 1SR3A 1STHA 4DK6C 5AFWA 4PQXA 2HCIA 3M4PA 4A3IB 1LTSD 3PCOB 4YWLA 3SK4A 3M4OH 3A7LA 2KEEA 2O5JC 4HMIA 1EU3A 2WKCA 4A3EB 1WFQA 4A93G 1STGA 2KECA 3GTJB 2K5DA 5JEAJ 1X55A 1K83H 4IJHA 3TRZA 2B3GA 4DV0L 1I6HB 2RQXA 3K7AH 1UE5A 2NB0A 1CTMA 3CMAA 1SE2A 2MPMA 3Q0AA 4GNXA 5KNBA 2BOSA 1HCZA 2YV5A 3H0GB 3L2PA 5IT9E 1HZBA 3HEJA 5CC4A 5HY6A 1PH1A 5I6WA 4LNQA 2CW0C 2R7ZB 4YCUA 3LNNA 3CD6A 1PH6A 3L9AX 2VNUD 3M4QA 3ULPA 4BBSG 2K14A 2UXDQ 2RSNA 3NELA 4DUYL 4P73A 3VDYA 1K0SA 3EN2A 5HGTA 3AMUA 2ZM6L 5M3FG 1KNAA 2B8GA 4PMBA 3NXWA 2KCTA 1A3UA 5C6AA 1J9OA 1W2BA 2TMPA 3K80C 3S1NB 2WAQG 1HH2P 2ENBA 3J81L 1Y1WG 2HQLA 4IFDI 4B9XA 3GDEA 4P74A 1N36L 4IPDA 4RHRA 5J39A 2XTIA 3HOXG 4GZYC 2FFKB 3RLOA 2I46A 2JA6G 4KTAA 1UNSA 2Q2IA 5LMNW 2L15A 4HIKA 4QGUA 3J81i 2UUAL 1WCMH 4FF2A 3SVMA 2D62A 2F0PA 1EQVA 1LYLA 3TDQA 1ZKOA 4JW0A 5LMUL 3CMEA 4HCSA 2BDOA 1SEBD 1HA5A 1VDZA 2KHJA 1HR0Q 1DD2A 1VQKA 1J5EL 5LMNL 3GTKB 2JSOA 2R6GA 1RCVD 1GM5A 4C3IG 3K5OA 1KTKA 2X6LA 1CZGA 1JE4A 3C1FA 3EFXD 5E4XA 4PG3A 4DV4Q 1PRTF 5H1SE 1KDAA 5F2DA 1PFNA 4U68A 1XNRL 4X64L 3CCUA 1QILA 1EY5A 5FO8B 1F77A 1STAA 1U4PA 5FO9B 1RL2A 4BA2I 2M9VA 3KF6B 4KKUA 2LXJA 3FKIH 4HSPA 3MVVA 5FO7B 1GUGA 1PTOB 1IKMA 4HJ5A 1XMOQ 4DR6L 4K5WA 1PDQA 4X66Q 3QR8A 3U9SA 5CV6A 1TQOA 4ME5A 3H3VH 4C1NI 3BZKA 3VR2A 2F3IA 2CFMA 2L11A 3UE1A 2EXZA 5J22A 2F0LA 2AUKA 3HOZH 3IFTA 4JI2L 4H0LC 5M5YH 4JI8L 1Y1VG 3CRLC 4KKSA 1R9TH 1KC8C 2R92H 2GN5A 1VQEA 3TZDA 3NP8A 2JA5B 1IXRA 3ER0A 3SXHA 3NBHA 4S3SA 4LFBQ 2O4XA 2DNEA 3A7AB 3NTHA 4BXXH 2DJGC 1EZ8A 1XNQL 3UE0A 5C4ZA 4RA8A 1SNPA 2R7FA 2RHSB 1HNXQ 5D3IB 4B08A 5K36G 1FJGQ 3F2CA 3HKZB 1ONLA 1PYWD 2F0FA 5I9OA 2E5LQ 1TWGH 3GD7A 4OWXB 3HP3A 3FPPA 4KY5A 3HOUG 5C4JB 1JE5A 1XYIA 2XIWA 4FXDA 3DEPA 3E5SA 4K0KL 3UDXA 3V96A 3S17H 3AEVA 1HQMC 3LWEA 4JI5Q 1IW7D 1FL0A 1LO5D 1LACA 2VQFL 1PLFA 3RN2A 4DR7L 1XJVA 2HIVA 1TWCH 3RZDH 3EVQA 2VW9A 5M5XB 2B2WA 2OXPA 1B9MA 4L6TB 2JXMB 5FOBB 2B2UC 2AHOB 3PUYA 1W3SA 4DR5L 1W6KA 3PIP3 4DR1L 4DR2L 5FLXE 4AQYL 3IKJA 4GN5A 4WRDA 1L2FA 1STBA 3SDZA 1DYQA 1EL0A 3VYRA 5EQ0A 1BBXC 2R93G 4F88A 5AJ3Q 4LF9Q 5GQOA 5IT9c 4RKBA 2CH4W 5DM73 4A3JH 1HPCA 3LX0A 3P1HA 4GLAC 5ELBA 4B3RL 2V1CC 1LTID 4G7ZC 5IYDH 2UXBL 1FD7D 3MFGA 4C56C 3BDOA 2Z8LA 4LF5Q 4QIWB 2VUMG 1J6QA 3GTOB 2JA7H 1E1TA 3GO5A 3U4ZA 2IW3A 4DAVA 4HIMA 1XTCD 3BS1A 1PH7A 5D3DA 1WI5A 3T1HQ 5NUCA 4KI0A 3ITPA 4U673 1CZWA 4IUQA 3I72A 2XWBB 1DJRD 1HNZL 4DV6L 1PRTB 3D4DA 1NJIC 1MSHA 1RF2D 4BY7B 1PTOC 4PZ8A 4EX5A 2F4IA 4EVOA 3SK8A 3GTQH 1S5DD 1Z47A 4DNRB 2NVTB 4NMZA 4X3UA 4YHHQ 1PZJD 1I3QB 2ZXOA 1CKOA 4P75A 1HFGA 2J0TD 2PPBC 3SR1A 1SNDA 2FJ2A 2RBMA 2VQEL 2CVRA 5BR8Q 4RCOA 1LABA 1EZ6A 3OYYA 4Z9CB 2E75C 4X62Q 3NWTA 3ONAB 4JOIC 3J7AF 4A3DH 4J15A 5M3MG 4LF7Q 5J3BA 1UWVA 1L1OA 3S2DH 4A3CH 2N55A 3F2BA 3RLNA 1Z7TA 2A74C 2OF1A 4JI0L 4A3IH 5ELOA 4QMGA 4C2MB 4J6HA 4O42A 3KJOA 4A3EH 3BDCA 4IJLA 1A63A 1CQFA 4R4OA 3GTJH 2BE5D 4IPGA 1WOCA 1GUOA 4NXNL 4LUVA 1K0RA 1E22A 1I6HH 3J7A5 2IJ0A 3MEHA 2BA1A 4JI1L 2WV6D 1NSNS 2NVYB 5A2QL 4R1JA 3SK6A 3D6WA 5J1ZA 2EYJA 1XWEA 3H0GH 2AQ1B 2LKVA 1CHQD 2RA4A 1VS0A 1WD1A 1K28A 4QF4A 4CDCC 3KFUA 1OO9B 1QUQB 2PW7A 2R7ZH 1JOQA 5CV9A 2EJMA 1RD9D 3CXCA 4L5TA 4RMFA 5FLMG 1YVCA 3Q8DA 2XSCA 1BBWA 3NPPA 4H13C 4MZ9A 5CMDA 3I4MB 1CKMA 3HKSA 2E76C 2ALYB 2A73B 2XN9C 4RFBA 4TKOB 3AFPA 3SHLA 2BE5C 5JVH3 1OTCA 3IAYA 1ET6A 4IUUA 2RVLA 2F0NA 3S1NH 2FMMA 2KENA 2RHQB 2FHTA 4KJOA 2JA9A 1O7IA 1EIYB 2O5IC 4OELB 1LLRD 3A8KE 1GD7A 3OIPA 1VQHA 2MHVA 5EBCA 4DV2Q 1VQPA 1I4QA 3UDFA 1SSOA 1J8IA 1WTPA 1S5FD 1EY7A 2I5LX 2PZTA 4GOPC 2EYFA 1H9MA 2OTJA 3P7JA 4JPBW 5JEAG 4BY1B 4R8IA 4QL5A 3FRPB 2DGYA 2DNCA 2F0SA 1PMRA 1UEBA 2FINB 5LL6S 1N34L 1PRTC 5EBDA 4XXEA 2X6GA 3GTKH 3FKIG 1Q82C 4AIMA 3MA2B 1ML0D 2QDLA 4F8MA 5FLXc 1L0WA 4L5QA 3N6RA 1V1QA 1CHPD 1EIGA 1HZ9A 2K5NA 5EKKA 5EPKA 1JOOA 5K5PA 3I7FA 1B2TA 1X9NA 4ZCKA 4NXMQ 1U4LA 5BN3A 5JAVA 3CQZB 5D65A 4KJNA 2IWHA 2B39A 1JB7A 1TXYA 3C2PA 2QKIC 2L1BA 2EYLA 1NE3A 4V190 3G4SA 1PTOH 3TP8A 3GTMB 2R92G 3W1GA 1TR5A 2AUJD 1DCZA 4K2LA 2ZTDA 1VQBA 1M8AA 1ASZA 3F2UA 2CCZA 3CC7A 1B70B 4ZRZA 1SRUA 4BXXG 3OOCA 3S1RB 2D5DA 4JBMA 2EY6A 1E3PA 5IP9G 3E0JA 1JWMD 1AE3A 1LV9A 4A3KB 2JA5H 1V8QA 1VQ4A 3BDLA 4LF4L 3KOJA 2EJFC 4LF6L 3PUZA 1BBUA 1QVFA 2LSSA 2B63G 3MC0B 3X3NA 1RTOA 3EROA 1SFOB 2DUDA 4LUOA 1WYDA 2H1EA 2IX0A 2YTXA 1XTDA 2NN6H 2OEOA 2YYZA 3A54A 1HUNA 2NWGA 3S15B 5C4JH 1V1PB 4IOAA 5A35A 3U4VA 2KHSA 3E3XA 1I4XA 3NBIA 1HNWL 2UUCQ 4K2KA 4CHTB 1PHJA 5CV4A 1UEAB 4RKLA 3UDGA 4HTHA 3TBIB 5FK9C 3T56B 4APVA 1ESRA 4J8QA 4OO1H 1WTHA 1KLGD 5M5XH 2MNAA 1C4QA 5KIXA 5C0XH 1STEA 1L0XB 2BDNA 4DXGA 4JI3L 2EOTA 2F0UA 2KJXA 1E2ZA 3STBD 1CA5A 2HHHL 3HOVG 3I73A 5IYDG 1B3AA 1RJTA 2VXWA 2Z9HA 5D14A 5GAGC 1CSPA 3PIPA 2JA7G 1FGUA 5M5WB 4JV5L 3PO2B 2Z4HA 4CKCA 4DR3L 1WTWA 3PO3B 4UHVA 3J81E 4BS9A 1D8LA 2K75A 4DV1Q 1DOLA 3CKIB 4C3JB 3DM1A 4DV0Q 1IYUA 1P8LA 3UDIA 3N52A 1Y8NB 2A6ED 3GTOH 2K7VA 2B2UA 1SMXA 3CCRA 3OIQA 5ELCA 5FJ8H 2PMZB 2EE1A 1X3EA 3ZJYC 5BN4A 1SAPA 4KY6A 1II3A 3HOYG 2IX3A 2ICIA 4NPSA 4JI4L 3F8TA 4I65A 1FYCA 2SNMA 3STBC 3ERSX 1ESFA 4NB3A 2UXBQ 3OMGA 3TZUA 1A2TA 3W3AA 5EKIA 2Q2UA 2VY3A 1Q86C 3I4NB 2G5DA 4YCWA 2F0OA 4PNYA 2QILA 2PQAB 2QF7A 4BY7H 4DUYQ 3QJYA 1QCBD 2ZM6Q 3FPUB 4FYDA 2NVTH 3DWQA 3ULLA 4A3GG 4K8IA 4A3DG 5DAUA 4AYBB 4IUVA 1QB5D 1I3QH 2QW7A 3GQBA 4A93B 4XQNA 1WVLA 5I2XA 2NYZD 1YNJD 2A6EC 4XT1B 4L5SA 1N36Q 2QEJC 4DXFA 1IZ6A 5JOBA 1T5XD 4A3EG 5G3LD 2EJGC 1YJNA 1T5EA 1EYGA 3HKZE 4HJ9A 2UUAQ 1TVXA 5IYCG 2D9UA 4HCEA 1CT1D 1PFSA 3D4RA 4QUCA 5LMUQ 4P2CB 1JORA 4O0AA 1VQ9A 3PQIA 1D5XC 4C3HG 1SYCA 5C3EG 1Z9FA 4C2MH 4DPGA 4LFCQ 3G6JB 4BBSB 3DM3A 5LMNQ 1H9KA 2EPBA 3D3RA 1JMCA 2EDGA 1JR0D 3K8AA 3FP9A 3J7ZC 2EXDA 1EQTA 4C1NK 5M3FB 1ENFA 4FNFA 4JCVE 4RAUC 4GN4B 4GLVB 2Z4IA 1I4RA 4IQZA 1YNJC 1XNRQ 3NQTA 2NVYH 3DHQA 3AB9A 4HJ7A 1TT2A 2KCCA 2WAQB 1LT3D 4RWSC 1Y1WB 3SGIA 1S4ZA 3KJPA 3DWAA 3AYHB 3BYTB 2LY7A 2N88A 4JBJA 1SNQA 2K32A 3PUVA 1R4QB 5LHY1 1MBYA 2JQOA 4DK0A 4GS3A 3T16A 3GTPB 4DR6Q 2C5CA 3NUCA 2AWNA 1Q8KA 3T53B 3A8JE 3HG9A 3T1YQ 3K7UC 2QA4A 1X6OA 2MFIA 1TWAB 3I4MH 1HFNA 3EQLC 1C8CA 4B9WA 1X3GA 3K81C 4FXGC 3Q24A 1PH4A 1EY6A 4G57A 5KRUA 1IBKL 2ZJQA 4LMQD 4JI2Q 1K3RA 2WFWA 4DNIA 2SNSA 1PFBA 3HZXA 2BCOA 4C3IB 2Q2HA 3MXNA 1EYAA 3VYTA 4NDXA 3RR5A 4TRDA 3VA5A 1ASYA 3TP7A 3PF5A 1KD1C 1XNQQ 5JJLA 1N32L 3RD4A 1GUTA 1AH9A 4RG1A 3CCEA 3GP7A 3AU7A 3K5MA 4BY1H 1E2VA 2F0WA 3QB3A 5M9OA 4RGNA 5JPNC 1BQQT 4GNXB 2JA8B 2B2VC 1WTRA 1JWSD 4XTCS 4K0KQ 1U4MA 4A3LH 2ZXPA 3SK5A 5KGUA 1KRSA 1SYGA 3CCSA 2EQSA 3A0JA 4CKEA 2VQFQ 2K03A 5IWAQ 4DKAC 1VCIA 2BH8A 2KBNA 3CQZH 1EIHA 1PH3A 1E24A 3KDFA 2XRQD 3J81c 1B3QA 3MWYW 1BCPB 4GOPA 2FXQA 3G71A 1WTQA 4KV6A 2F0IA 1X3PA 1HQRD 2E2DC 2KEDA 1SMYD 4DR1Q 1EY9A 4MIUA 4DR2Q 2I5HA 4AQYQ 2GVAA 2OWOA 2G9HD 1XXGA 2Z6KC 2RF4A 1NMGA 1OXXK 1VQ6A 2HUGA 3GTMH 1EUJA 1CSQA 3MXPA 1B50A 5ELNA 4BBRG 2VS1A 1EQRA 1FNVA 3ZYYX 1LUZA 3EA6A 3TS2A 3CC4A 5C3XA 4B3RQ 4HIDA 3S1RH 3KLWA 1KDBA 3HOWG 3TEHB 3A5UA 1AFPA 2L55A 1P16A 2MO0A 3CF5A 2B2TC 5C44B 3A8IE 3HKZG 5ELEA 3ULJA 1E0BA 4A3KH 2Y0SE 4IUTA 2EYPA 3ND8A 2CH4A 3OSOA 1X3FA 2Q8IB 4LFAL 1MI2A 1SMYC 4EQOA 4HN7A 2UU9Q 1HNZQ 4DV6Q 1YZ6A 1SFOH 4OO1G 5GADC 3IFDA 4EQNA 3MXNB 4OWWB 1RTNA 1PTOD 1R4PB 5A2QE 2V4DA 2R93B 1I50B 2VZAA 3S15H 4B3MQ 5JVG3 3H3VI 1NCVA 2CHBD 1UAPA 4OGQC 3F1ZA 4FF3A 1SLJA 2PZUA 1AW7A 2VQEQ 2PNHA 2F52A 4ZYSA 2I5MX 2A69D 2HQEA 1YJWA 1BNZA 4ZUJA 2RCNA 2N49A 1U5KA 4JYAQ 1Y8PB 1N9WA 3S24A 1EY4A 1UE6A 1FJGL 2E8GA 2LS01 1GO3E 1G6PA 1KIXA 1Q3LA 3BG3A 3CHBD 3QWNA 3BZCA 3JAML 1MGSA 4A3MB 2F0KA 1EY0A 4POFA 4JI0Q 5EPLA 2X69A 5T1GA 1EIFA 5EAYA 3KF8A 1NY4A 2UUBL 5M5WH 3PO2H 1JJCB 4ID6A 3JAMi 3PO3H 3MXUA 4JI5L 2B2YA 1DOKA 3NBHB 2RCFA 4CJ1B 5CV7A 4NXNQ 4IZ8A 4C3JH 2AQ2B 1LTAD 3T13A 4JI1Q 3CC2A 1CQVA 3K59A 2A69C 3I70A 1FNUA 3TP5A 4RGOS 1MJEA 1IBLL 5C4XH 1CM9A 2AWOA 5IYBH 3NTKA 1TWHB 5EGTA 3OWEB 4KD3A 1A2UA 1A3TA 3HRZC 4RHSA 2A19A 3VA7A 2DY7A 3E9IA 4DU9A 3I4NH 3P20A 4LAAA 1ENAA 4P71A 2JN4A 4XYOA 3WWVA 1M90C 1GUNA 4MTKA 4BA1I 4B3TL 4A93H 4JI6L 3T1HL 1E2WA 1TU2B 3I56A 2Z1CA 2F3WA 2ICEC 4LWCA 3K0XA 2YTYA 2ZTCA 1HRJA 1EWHA 2KA7A 1CA6A 1KAWA 2DN8A 2A68D 1WTOA 1PA6A 3D0FA 3D6CA 3BVGA 2FMCA 2KHIA 2LFNA 3CPWA 1EOTA 2QGQA 1ENCA 4Y7NB 4J1MA 1JB3A 1QNKA 1YHBA 1N34Q 2R3ZA 4BBSH 1H9SA 1NNXA 4DAMA 3K6OA 4F87A 4JC0A 1PRTD 1Y69U 2MQHA 4X62L 4N8FA 5C4HA 2C35B 5M3FH 2Y0SG 1OXVA 1WCMG 5IP7H 4ZAIA 2MO1A 1NTGA 4YWKA 1WJJA 4IUPA 1JCKB 1EOVA 1QOHA 1CKNA 1ZXTA 2SDFA 3I4MG 4X3KA 1Y1WH 5JJIA 4KN4C 3FEWX 3B6YA 3C46A 1ILPA 1NMFA 3F2DA 2YU9B 4HAEA 2A68C 3H15A 5KNCA 2KQ3A 3MHBA 4DV5L 2A1AA 2D0PA 3H91A 3J7AV 3GTPH 1VQAA 1SXTA 4DR4Q 2IPKD 1C0AA 1TS2A 4OX9L 5L37A 2ZJPA 1LTLA 2JE6I 4CDFC 4V0BA 4X65Q 1TWAH 3I91A 2EZVA 1PV4A 2GA4B 4CKBA 2SOBA 1KL9A 2ZTEA 1AN8A 1B53A 3NWSA 3RN5A 5EPJA 1VQ8A 4LK1C 1DONA 3RMHA 1FVIA 5CV8A 3LGJA 2CWAA 4F7XA 1L1OB 2XGTA 1SYEA 4C3IH 4BY1G 1Q7YC 4LUZA 1QVGA 5C0XJ 1PYSB 4LF4Q 4MHEA 1IL2A 1IYVA 4R4TA 1EYDA 1SJHD 2WB1B 4LF6Q 4UPAA 2K5QA 1SROA 1VQFA 4GKKL 5IGGA 3QOJA 4KHPQ 1KQSA 2H5XA 1JQYD 4DAPA 3HOZG 2A6HD 1TS3A 4AYBE 1VF7A 1G51A 2JYOA 1AZQA 1LTBD 3J7YW 2E2IB 1B44D 1UE1A 2JA8H 1G8ZD 5GROA 4DFAA 2MP1A 2K5WA 4YY3L 2KOLA 1GOZA 2B29A 4N9PA 2XNAC 3J80L 3L3OC 1EQQA 3SEBA 2UXCL 2F3VA 1BO0A 2E2HB 2R61A 4YIJA 1MD2D 1Q46A 1U4RA 4JI3Q 2VL6A 1G91A 5C5MA 1E1OA 4ULLA 1NBWA 2F4VL 5C3WA 1PXUA 2WACA 3J80i 1A6XA 4K6DA 2F0TA 4B3SL 2D2CC 2A6HC 3TP6A 3DXJC 3GTGB 3GV3A 1DZ1A 2B63B 4JV5Q 4IFDJ 3S16B 4I7AA 4DR3Q 3DLLA 3W2DA 1BDOA 3OTOL 3M3YB 1VMPA 4A3FB 1EU4A 4ILWA 2H4OA 1SNOA 3ERQA 1LT5D 3LWUA 1NUCA 5JJKA 4KLKA 4DK3C 1STNA 1EWCA 4LJZC 3H6MA 1C9OA 2MGSA 5C44H 4GKJL 1JICA 5CORA 1EEID 4A3BB 1VQJA 1HHVA 2PI2E 1DM0B 1TS4A 1VQ5A 5IOCA 1MKHA 3W5OA 4QY7A 5ELDA 3PF4A 3S14B 4HSVA 4JI4Q 4A3JG 1QNUA 1EFWA 4OWTB 2ZXRA 1QZGA 3V2TA 1BKBA 1FNWA 2HDMA 1G291 1TWFB 3QIAA 2F0GA 1GUSA 4LF8L 3UI2A 1PH5A 1GVPA 3PIO3 4POGA 1G6ZA 3S2HB 4QQBX 4PMCA 2R93H 1I50H 2AMCB 2RDHA 2B2TA 4M1UB 5IGDA 2MJ8A 1KAAA 2D0OA 4ZQ3A 1S3OA 4JI7L 3GTLB 1GXDC 2WP8J 4DV3L 1GUWA 2K6AA 3BVMA 1XMQL 3TQYA 2ES2A 1X65A 2PW5A 4DUZL 2NTTA 3DWPA 1IYJB 5C4XB 1L1OC 2O2LD 2LMCB 4AH6A 2QEXA 4P72A 4KK7A 1CFMA 4ZK9B 2Q8RE 4QJFA 4K14A 3MZ5A 3D8GA 4RH6A 2PQEA 2I0QA 3HOYB 2ASBA 3K57A 4A3MH 3Q23A 1M4VA 4K8JA 2IY5B 1SNCA 3A5ZB 2UUCL 4OIJA 5JPMC 1SYFA 2N3SA 4ALPA 1B9NA 1HTPA 3BJUA 5IYBG 2NN6I 2KCMA 2OTLA 3BZDB 1BCPF 1PYBA 4IFDH 3OW2A 1B4OA 5CBAE 3PUWA 1IL8A 3ICEA 4A3GB 4RCNA 4A3CG 2JK8A 3DUZA 1JWUD 4DK1A 5HURA 1D5ZC 1I6VC 4JVZA 2K5VA 2Q8TA 4A3IG 4EGVA 3WDNA 4OO1I 1N33L 2VB3X 1LM0A 5C0XI 1WTXA 1TWHH 1KABA 4AYBG 3KF6A 1HZCA 4DV7L 1Q90A 4DV1L 4ZKCB 3KBXA 2F0QA 5M3MH 4KD4A 1V1OA 5I2YA 4GLXA 1RKNA 4YCVA 5IE8A 4PV1C 3A55A 3X3MA 4A4IA 2B8FA 3H0GG 3VR6A 4C3HB 5C3EB 1I94L 1PFMA 3FHWA 5C5LA 1J5EQ 1IBKQ 1IBML 1MJCA 1Y8OB 1B7YB 1K9MC 2R7ZG 1KHIA 3OW7A 4IURA 1PZID 5I4DA 3G6EA 1X3QA 1O7YA 2XWJB 4X64Q 2KCNA 4JOIA 4XT3B 1YIJA 1MIUA 3OHXC 1N32Q 1CK1A 3PUXA 1S72A 3HOXB 4UAIA 1OXSC 1WTVA 5IP7G 3WOFA 2M00A 2JA6B 4FO2A 1F9RA 1X54A 1T9HA 2K28A 3HS0C 1H9JA 1NAPA 1ILQA 3KLRA 4OIKA 3VYSA 4Y7NH 4FF4A 3S1MB 3T51B 5KYLA 5FLMH 3M4YA 2L4NA 1K8AC 3L0OA 1D7QA 3M9BA 1LTTD 4PMWA 4QIWE 2OQKA 4E6IA 1S5CD 4NW2A 1QJOA 1D5MC 3MFYA 4JI8Q 4IPHA 5IIFA 1RODA 4DGZA 3EBEA 4WJ3M 1V9PA 1TS5A 3M85A 2NVQB 1BOSA 1VQIA 2VB2X 1YJ9A 2PZWA 2F03A 1YHQA 2YU9H 2UXDL 4LFCL 2KUMA 1NR2A 1YBYA 5EKLA 2G9DA 1E7ZA 1C48A 2J7ZA 4RGTA 3QO2A 1IHZA 2GVBA 1QWYA 3AFQA 5JEAH 2HIXA 5T1IA 5I6YA 3CCQA 1SE3A 2N78A 1LTGD 3PMFA 2L5TA 1HR0W 1G2TA 4X3SA 4IPCA 2MUYA 3JAME 3H09A 4K5VA 3CCMA 2RDGA 3QOLA 3VYUA 4DR7Q 3MTSA 1AP0A 1Y1VB 1AZPA 3I8ZA 3KLSA 1EEFD 1Y14B 2JA8G 4IALA 5IT9L 3T1YL 4LFAQ 3KYHC 4RGMA 4DR5Q 3H94A 1HR0L 4UY8C 3R2IA 1EY8A 1YEZA 4H7BA 4QB4A 1Q8IA 4QUFA 4OHJA 4K6LA 1DOMA 2JA5G 2E2IH 3VR5A 2K04A 4A75A 1TY0A 4BBRB 2CQOA 4DV4L 4NKLA 2EY2A 3IL8A 4N9TA 1Q12A 2Z0SA 5CR3A 3OPOA 1C7YA 1NR4A 3HOUB 4KKTA 1OXTA 3PGZA 1JJ2A 3DEOA 2M2LA 3D4WA 3HOWB 5KNDA 1F9PA 4L8JA
chains in the Genus database with same CATH topology
1SDFA 4JBWA 2NN6G 3MXGA 5DNFA 1D6EC 4H44C 3R3OA 4CBVA 1I4PA 2F0DA 3I90A 1Z6HA 4KHZA 4HMJA 1S5ED 4L63B 3K5LA 4KY7A 1O78A 2QDBA 3S1QB 4TSSA 5C0XG 5IODA 3TN2A 5CBEE 2E2JB 3M7GA 4MN3A 1ZYRD 1SYDA 4IUNA 1SNMA 1HA6A 3MAQA 1F2ZA 1QG7A 2EYMA 2VUMB 1CI3M 1BF4A 2F0HA 4JK1C 1RHPA 2AQ3B 2F1MA 1BCPD 3RUZA 4G7OC 1WD0A 1I4GA 4BWGB 4EQPA 3RZOB 1IW7C 1KNEA 3PV0A 3QG1A 2K1BA 3K5NA 1D1IA 3FDTA 4UDUC 3KUPA 1Q1EA 3KK7A 4Q5VA 2EVBA 4CJ2C 4HEDA 1D2BA 4XDXA 3S9WA 3TSSA 3P75A 1ZYRC 2JEAI 2NVXB 4DAYA 2I07B 4IFDG 2OT2A 4K5XA 2XVSA 1QE6A 3KLSX 2SEBD 4ZKBB 1L0YB 1LTRD 3M4OB 3A56A 2NUCA 4FVMA 2F0JA 1BCPC 5KYIA 3R2TA 5M3MB 5CGKA 1K83B 2IT1A 4ZLTF 4QCLA 3K7AB 1STYA 1HTLD 4KHVA 1HXYD 2J4XA 3KBGA 3NK9A 1GHKA 1VMCA 4TQUS 4OL7A 4CJ0B 1SBBB 5COYA 2F0VA 4WJWA 5FLXL 4XQQA 4NP5A 3VR4A 3NE5B 5EJWA 1FGBD 2KVMA 3V05A 2EY1A 1PZKD 4FP5D 3J80E 1BR9A 1JC7A 1O7LA 5CYUA 2L9HA 2CQAA 3C3LA 1SJED 1KDCA 2Y0SB 3OMCA 1WCMB 3WOEA 5G3LF 2PO4A 3O13A 3SE0A 2F0MA 1LT4D 1O7ZA 1YNND 4FF1A 5ISRA 2WINB 3G7LA 1G2SA 3VR3A 5IGCA 5E1FA 1GHJA 1VF5C 2WKDA 3Q22A 4R9WA 4IN3A 2HCCA 2DY8A 3K0YA 1B1ZA 3NHHA 1F9SA 1V1PA 2RDFA 1DXMA 2JEBI 3ND9A 4Q0FA 3FKIB 5IGFA 4ZUIA 3FVQA 1KLUD 4DF7A 5KEEA 1K8OA 4CGYB 2XRSD 1F9QA 1YNNC 1ET9A 3R93A 1UUPA 1Q1BA 4O1NA 2EYOA 2RKSA 3HOZB 5I9PA 2QCPX 5M5YB 1K8MA 1R9TB 1F2YA 2R92B 2PCFB 3D31A 4WFN3 4DNTB 4ABNA 1LT6D 3RLFA 3L7ZC 3K58A 1BXTA 3NSWA 2B2WC 2PNRC 1HUMA 2JP1A 1ZEQX 1BUVT 2HDLA 3OWFA 1TWGB 5IGEA 5TSSA 1H9SB 1F2MA 4R8NA 1F2LA 1AEXA 1OXUA 2L0CA 4DA2A 3DMUA 1TKWB 3FMCA 3GV6A 4DN4M 3S17B 2B2VA 1V43A 3NQIA 1SYBA 1S5BD 5K36H 3URYA 3NTIA 2RSOA 1GJXA 4FXKC 4XIGS 5E4WC 1TWCB 3RZDB 4KMUC 2K05A 3C1EA 4G7HC 3U9OA 5ELFA 2NZ1D 3CU7A 2ZT9C 3I3CA 1XX8A 4ODGA 5LL6X 2PYKA 1I4HA 4WORA 1IKLA 2IL8A 5DEHA 2TSSA 3HGBA 1FR3A 3R8BA 5BN5A 3I4LA 4XYQA 2ID0A 4A3JB 2K01A 1EFID 2B2YC 1U9RA 4M8AA 1A15A 3HOVB 1JOKA 5JJZA 5IGBA 2F0EA 1EYCA 2C9OA 1X32A 2JA7B 2E74C 2EY5A 4HR7B 1MSGA 4X3TA 4G4KA 5E3FA 1W6JA 3TMEA 1TIID 3EJIA 2IX1A 2EYHA 4XQJA 2BA0A 2K33A 3Q6SA 1O80A 1SE4A 3GTQB 2NTSA 2WIIB 4C3JG 3T4AC 4KN7C 2NBFA 5CV5A 1ICWA 3BVZA 1PTOF 2A5HA 1D1KA 3H3VC 1A3VA 3BYYB 1TY2A 1H9RA 3E6ZX 4I7ZC 2L12A 3CRKC 3M7NA 5DM63 5FKAC 4A3DB 2CW0D 1RDPD 3S2DB 1STHA 5AFWA 4PQXA 2HCIA 4A3IB 1LTSD 3SK4A 3A7LA 2KEEA 2O5JC 4HMIA 1EU3A 2WKCA 4A3EB 1STGA 2KECA 3GTJB 2K5DA 5JEAJ 1I6HB 2RQXA 2NB0A 1CTMA 1SE2A 2MPMA 3Q0AA 5KNBA 2BOSA 1HCZA 3H0GB 5IT9E 3HEJA 5CC4A 5I6WA 2CW0C 2R7ZB 3LNNA 3L9AX 2VNUD 2RSNA 5HGTA 3AMUA 1KNAA 2B8GA 4PMBA 3NXWA 1A3UA 5C6AA 1J9OA 2TMPA 3S1NB 2ENBA 3J81L 4IFDI 4B9XA 4GZYC 4RHRA 5J39A 2FFKB 2I46A 4KTAA 1UNSA 4FF2A 3SVMA 2D62A 2F0PA 1EQVA 3TDQA 1ZKOA 4HCSA 2BDOA 1SEBD 1HA5A 1VDZA 1DD2A 3GTKB 2JSOA 2R6GA 1RCVD 4C3IG 3K5OA 1KTKA 2X6LA 1CZGA 1JE4A 3C1FA 3EFXD 5E4XA 1PRTF 1KDAA 5F2DA 1PFNA 4U68A 1QILA 1EY5A 5FO8B 1F77A 1STAA 1U4PA 5FO9B 4BA2I 2M9VA 4KKUA 4HSPA 3MVVA 5FO7B 1GUGA 1PTOB 1IKMA 4K5WA 1PDQA 3U9SA 5CV6A 1TQOA 4ME5A 4C1NI 3VR2A 2L11A 2EXZA 5J22A 2F0LA 2AUKA 3IFTA 4H0LC 3CRLC 4KKSA 3TZDA 3NP8A 2JA5B 3SXHA 3NBHA 4S3SA 2O4XA 2DNEA 3A7AB 3NTHA 1EZ8A 5C4ZA 4RA8A 1SNPA 5D3IB 4B08A 5K36G 3HKZB 1ONLA 1PYWD 2F0FA 5I9OA 3GD7A 3HP3A 3FPPA 4KY5A 5C4JB 1XYIA 2XIWA 4FXDA 3DEPA 3E5SA 3V96A 1HQMC 3LWEA 1IW7D 1LO5D 1LACA 1PLFA 3EVQA 5M5XB 2B2WA 2OXPA 1B9MA 4L6TB 2JXMB 5FOBB 2B2UC 3PUYA 1W6KA 3PIP3 5FLXE 3IKJA 4WRDA 3SDZA 1STBA 1EL0A 1DYQA 3VYRA 5EQ0A 1BBXC 4F88A 4RKBA 5DM73 1HPCA 3LX0A 3P1HA 5ELBA 1LTID 4G7ZC 1FD7D 3MFGA 4C56C 3BDOA 2Z8LA 4QIWB 3GTOB 3GO5A 2IW3A 4DAVA 1XTCD 3BS1A 5D3DA 5NUCA 4KI0A 3ITPA 4U673 1CZWA 4IUQA 3I72A 2XWBB 1DJRD 1PRTB 3D4DA 1MSHA 1RF2D 4BY7B 1PTOC 2F4IA 4EVOA 3SK8A 1S5DD 1Z47A 4DNRB 2NVTB 4NMZA 4X3UA 1PZJD 1I3QB 2ZXOA 1HFGA 2J0TD 2PPBC 3SR1A 1SNDA 2FJ2A 2RBMA 2CVRA 4RCOA 1LABA 1EZ6A 4Z9CB 2E75C 3NWTA 3ONAB 3J7AF 2N55A 1Z7TA 2A74C 2OF1A 4QMGA 4C2MB 4J6HA 4O42A 3BDCA 1CQFA 2BE5D 1GUOA 2IJ0A 3MEHA 2BA1A 2WV6D 1NSNS 2NVYB 5A2QL 3SK6A 3D6WA 5J1ZA 2EYJA 1XWEA 2AQ1B 2LKVA 1CHQD 2RA4A 1WD1A 4QF4A 1OO9B 2PW7A 1JOQA 5CV9A 2EJMA 1RD9D 2XSCA 3NPPA 4H13C 5CMDA 3I4MB 2E76C 2A73B 2XN9C 4RFBA 4TKOB 3SHLA 5JVH3 2BE5C 3IAYA 1ET6A 4IUUA 2RVLA 2F0NA 2FMMA 2FHTA 4KJOA 2O5IC 1LLRD 3A8KE 3OIPA 2MHVA 5EBCA 1I4QA 1SSOA 1J8IA 1WTPA 1S5FD 1EY7A 2PZTA 2EYFA 1H9MA 3P7JA 5JEAG 4BY1B 4R8IA 3FRPB 2DNCA 2F0SA 1PMRA 2FINB 5LL6S 1PRTC 5EBDA 4XXEA 2X6GA 3MA2B 1ML0D 4F8MA 3N6RA 1CHPD 1EIGA 5EKKA 5EPKA 1JOOA 5K5PA 1B2TA 1U4LA 5BN3A 5JAVA 3CQZB 5D65A 4KJNA 2IWHA 2B39A 3C2PA 2QKIC 2L1BA 2EYLA 4V190 1PTOH 3TP8A 3GTMB 1TR5A 2AUJD 1DCZA 4K2LA 1M8AA 3F2UA 4ZRZA 3OOCA 3S1RB 2D5DA 2EY6A 3E0JA 1JWMD 1LV9A 4A3KB 1V8QA 3BDLA 2EJFC 3PUZA 3MC0B 3X3NA 1RTOA 3EROA 1SFOB 2H1EA 2IX0A 2YYZA 2NN6H 2OEOA 3A54A 1HUNA 2NWGA 3S15B 1V1PB 5A35A 2KHSA 1I4XA 3NBIA 4K2KA 4CHTB 5CV4A 1UEAB 4RKLA 4HTHA 3TBIB 5FK9C 3T56B 1ESRA 4J8QA 4OO1H 1KLGD 1C4QA 5KIXA 5C0XH 1STEA 1L0XB 2BDNA 4DXGA 2EOTA 2F0UA 2KJXA 1E2ZA 1CA5A 3I73A 1B3AA 1RJTA 2VXWA 5D14A 5M5WB 3PO2B 2Z4HA 4CKCA 1WTWA 3PO3B 3J81E 4BS9A 1DOLA 3CKIB 4C3JB 3DM1A 1IYUA 3N52A 1Y8NB 2A6ED 2K7VA 2B2UA 3OIQA 5ELCA 2PMZB 2EE1A 5BN4A 1SAPA 4KY6A 1II3A 2IX3A 2ICIA 4I65A 1FYCA 2SNMA 1ESFA 3OMGA 3TZUA 1A2TA 3W3AA 5EKIA 3I4NB 2F0OA 4PNYA 2QILA 2QF7A 3QJYA 1QCBD 3FPUB 4FYDA 3DWQA 4K8IA 5DAUA 4AYBB 4IUVA 1QB5D 3GQBA 4A93B 4XQNA 1WVLA 5I2XA 2NYZD 1YNJD 2A6EC 4XT1B 2QEJC 4DXFA 5JOBA 1T5XD 5G3LD 2EJGC 1T5EA 1TVXA 2D9UA 4HCEA 1CT1D 3D4RA 4QUCA 1JORA 4P2CB 1D5XC 4C3HG 1SYCA 3G6JB 4BBSB 1H9KA 2EPBA 3D3RA 2EDGA 1JR0D 1EQTA 4C1NK 5M3FB 1ENFA 4FNFA 4RAUC 2Z4IA 1I4RA 4IQZA 1YNJC 3NQTA 3DHQA 3AB9A 1TT2A 2KCCA 2WAQB 1LT3D 4RWSC 1Y1WB 1S4ZA 3DWAA 3BYTB 2LY7A 2N88A 1SNQA 2K32A 3PUVA 1R4QB 5LHY1 1MBYA 4DK0A 3T16A 3GTPB 2C5CA 3NUCA 2AWNA 3T53B 3A8JE 3HG9A 1TWAB 1HFNA 3EQLC 1C8CA 4B9WA 3Q24A 4FXGC 1EY6A 4G57A 5KRUA 4LMQD 2SNSA 1PFBA 3HZXA 2BCOA 4C3IB 3MXNA 1EYAA 3VYTA 4NDXA 4TRDA 3VA5A 3TP7A 3RD4A 1GUTA 3GP7A 3AU7A 3K5MA 1E2VA 2F0WA 3QB3A 5M9OA 4RGNA 5JPNC 1BQQT 2JA8B 2B2VC 1WTRA 1JWSD 4XTCS 1U4MA 2ZXPA 3SK5A 5KGUA 1SYGA 4CKEA 2K03A 1VCIA 1EIHA 2XRQD 3MWYW 1BCPB 1WTQA 4KV6A 2F0IA 1X3PA 1HQRD 2E2DC 2KEDA 1SMYD 1EY9A 4MIUA 2G9HD 1XXGA 1OXXK 2HUGA 3MXPA 1B50A 1FNVA 3ZYYX 3EA6A 5C3XA 1KDBA 1AFPA 2L55A 2B2TC 5C44B 3A8IE 5ELEA 1E0BA 4IUTA 2EYPA 3ND8A 3OSOA 2Q8IB 1MI2A 1SMYC 4EQOA 4HN7A 4OO1G 3IFDA 4EQNA 1RTNA 1PTOD 1R4PB 5A2QE 2V4DA 2R93B 1I50B 5JVG3 1NCVA 2CHBD 1UAPA 4OGQC 4FF3A 2PZUA 1AW7A 4ZYSA 2A69D 2HQEA 1BNZA 4ZUJA 1Y8PB 1EY4A 2LS01 1Q3LA 3BG3A 3CHBD 3QWNA 3JAML 1MGSA 4A3MB 2F0KA 1EY0A 5EPLA 2X69A 5T1GA 3KF8A 4ID6A 3MXUA 2B2YA 1DOKA 4CJ1B 5CV7A 4IZ8A 2AQ2B 1LTAD 3T13A 1CQVA 3K59A 2A69C 3I70A 1FNUA 3TP5A 4RGOS 1CM9A 2AWOA 3NTKA 1TWHB 5EGTA 3OWEB 4KD3A 1A2UA 1A3TA 3HRZC 4RHSA 3VA7A 2DY7A 4DU9A 3P20A 4LAAA 1ENAA 4XYOA 1GUNA 4BA1I 1E2WA 1TU2B 2Z1CA 2F3WA 2ICEC 1HRJA 1EWHA 2KA7A 1CA6A 2DN8A 2A68D 1WTOA 3D6CA 3BVGA 2FMCA 2LFNA 1EOTA 1ENCA 4Y7NB 4J1MA 1JB3A 1QNKA 2R3ZA 1H9SA 3K6OA 4F87A 1Y69U 1PRTD 5C4HA 1OXVA 4ZAIA 4IUPA 1JCKB 1QOHA 1ZXTA 2SDFA 4X3KA 4KN4C 3FEWX 3C46A 1ILPA 2YU9B 4HAEA 2A68C 5KNCA 2KQ3A 3MHBA 3H91A 3J7AV 1SXTA 2IPKD 1TS2A 2JE6I 4V0BA 3I91A 2EZVA 2GA4B 4CKBA 2SOBA 3NWSA 1AN8A 1B53A 5EPJA 4LK1C 1DONA 3RMHA 5CV8A 4F7XA 1SYEA 5C0XJ 4MHEA 1IYVA 1EYDA 1SJHD 2WB1B 2K5QA 5IGGA 3QOJA 1JQYD 4DAPA 2A6HD 1TS3A 1VF7A 2JYOA 1AZQA 1LTBD 3J7YW 2E2IB 1B44D 1G8ZD 4DFAA 2MP1A 2K5WA 2KOLA 1GOZA 4N9PA 2XNAC 3J80L 3L3OC 3SEBA 2F3VA 1BO0A 2E2HB 2R61A 4YIJA 1MD2D 1U4RA 1G91A 5C5MA 4ULLA 5C3WA 1PXUA 2WACA 1A6XA 4K6DA 2F0TA 2D2CC 2A6HC 3TP6A 3DXJC 3GTGB 3GV3A 1DZ1A 2B63B 4IFDJ 3S16B 3W2DA 1BDOA 3M3YB 1VMPA 4A3FB 1EU4A 4ILWA 2H4OA 1SNOA 3ERQA 1LT5D 3LWUA 1NUCA 1STNA 1EWCA 4LJZC 3H6MA 2MGSA 1JICA 5CORA 1EEID 4A3BB 1HHVA 1DM0B 1TS4A 5IOCA 5ELDA 3S14B 4HSVA 1QNUA 2ZXRA 3V2TA 1FNWA 2HDMA 1G291 1TWFB 3QIAA 2F0GA 1GUSA 3UI2A 3PIO3 1G6ZA 3S2HB 4PMCA 2RDHA 2B2TA 4M1UB 5IGDA 2MJ8A 1KAAA 4ZQ3A 3GTLB 1GXDC 2WP8J 1GUWA 2K6AA 3BVMA 2PW5A 2NTTA 3DWPA 5C4XB 2O2LD 2LMCB 4KK7A 1CFMA 4ZK9B 2Q8RE 4K14A 3MZ5A 3D8GA 4RH6A 2PQEA 3HOYB 3K57A 3Q23A 1M4VA 4K8JA 1SNCA 4OIJA 5JPMC 1SYFA 1B9NA 1HTPA 2NN6I 3BZDB 1BCPF 4IFDH 1B4OA 5CBAE 3PUWA 1IL8A 4A3GB 4RCNA 3DUZA 1JWUD 4DK1A 5HURA 1D5ZC 1I6VC 2Q8TA 4EGVA 3WDNA 4OO1I 2VB3X 1WTXA 5C0XI 1KABA 1Q90A 4ZKCB 3KBXA 2F0QA 4KD4A 1V1OA 5I2YA 1RKNA 4PV1C 3A55A 3X3MA 2B8FA 3VR6A 4C3HB 5C3EB 1PFMA 5C5LA 1Y8OB 3OW7A 4IURA 1PZID 5I4DA 1X3QA 1O7YA 2XWJB 2KCNA 4XT3B 3OHXC 1CK1A 3PUXA 3HOXB 4UAIA 1OXSC 1WTVA 3WOFA 2M00A 2JA6B 4FO2A 1F9RA 2K28A 3HS0C 1H9JA 1NAPA 1ILQA 3KLRA 4OIKA 3VYSA 4FF4A 3S1MB 3T51B 5KYLA 3M4YA 2L4NA 1LTTD 4PMWA 4E6IA 1S5CD 4NW2A 1QJOA 1D5MC 3MFYA 5IIFA 1RODA 4DGZA 1TS5A 3M85A 2NVQB 1BOSA 2VB2X 2PZWA 2F03A 2KUMA 1NR2A 5EKLA 2G9DA 1C48A 2J7ZA 4RGTA 3QO2A 1IHZA 1QWYA 5JEAH 5T1IA 5I6YA 1SE3A 1LTGD 3PMFA 2L5TA 1G2TA 4X3SA 2MUYA 3JAME 3H09A 4K5VA 2RDGA 3QOLA 3VYUA 3MTSA 1AP0A 1Y1VB 1AZPA 3I8ZA 3KLSA 1EEFD 4IALA 5IT9L 4RGMA 3H94A 3R2IA 1EY8A 4H7BA 4QB4A 1Q8IA 4QUFA 4OHJA 4K6LA 1DOMA 3VR5A 2K04A 1TY0A 4BBRB 4NKLA 2EY2A 3IL8A 4N9TA 1Q12A 5CR3A 3OPOA 1NR4A 3HOUB 4KKTA 1OXTA 3DEOA 2M2LA 3D4WA 3HOWB 5KNDA 1F9PA 4L8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HEJ A;  3BDL A;  4EQN A;  4NDX A;  1U9R A;  5CC4 A;  5IGF A;  4ZUI A;  2PW5 A;  5I6W A;  4TRD A;  3VA5 A;  5CGK A;  5KYL A;  2EXZ A;  3TP7 A;  5J22 A;  4K8I A;  1JOK A;  2F0L A;  5DAU A;  5NUC A;  4DF7 A;  3SHL A;  5KEE A;  3ITP A;  1STY A;  3R3O A;  5IGB A;  2F0E A;  1EYC A;  2F0D A;  4K14 A;  4DFA A;  3MZ5 A;  2F0N A;  3D8G A;  2PQE A;  3ERO A;  3D6C A;  2EY5 A;  4KJO A;  2PZU A;  3D4D A;  3NP8 A;  4HMJ A;  4E6I A;  4KHV A;  3SXH A;  4K8J A;  1SNC A;  1ENC A;  2HQE A;  4S3S A;  5E3F A;  4EVO A;  2F0W A;  2O4X A;  2OEO A;  4N9P A;  4ZUJ A;  3SK8 A;  5HGT A;  5IIF A;  3QB3 A;  4DGZ A;  3TME A;  5M9O A;  1SYF A;  4J1M A;  5JOB A;  1EY4 A;  2EYO A;  3NK9 A;  4KY7 A;  2F3V A;  2RKS A;  4NMZ A;  3NXW A;  4PMB A;  1EZ8 A;  3EJI A;  1A3U A;  5C6A A;  5I9P A;  5C4Z A;  2KHS A;  1EY7 A;  2EYH A;  4YIJ A;  2QDB A;  1F2Y A;  1SNP A;  2PZT A;  4OL7 A;  2EYF A;  4K2K A;  5C5M A;  2PZW A;  2ENB A;  3SK5 A;  3SR1 A;  5CV4 A;  1SND A;  2RBM A;  2F0V A;  4RKL A;  5C3W A;  2WAC A;  1SYG A;  4HTH A;  5C4H A;  2F0K A;  1EY0 A;  4K6D A;  2F0F A;  2F0T A;  5I9O A;  1JOR A;  4B9X A;  3TP6 A;  2F0S A;  1EZ6 A;  5J39 A;  1SYC A;  4NP5 A;  5EKL A;  5KGU A;  4KY5 A;  5CV5 A;  5HUR A;  4ID6 A;  4KTA A;  5KIX A;  1SYD A;  4IUN A;  1SNM A;  1IHZ A;  3E5S A;  4KV6 A;  2F0I A;  1F2Z A;  2EY1 A;  2F0U A;  5I6Y A;  2EYM A;  1A3V A;  4F8M A;  1EY9 A;  4MIU A;  2F0P A;  1EQV A;  1KAB A;  2F0H A;  5CV7 A;  5KYI A;  4IZ8 A;  5EKK A;  3OWF A;  1SNO A;  2KQ3 A;  2OF1 A;  1JOO A;  3MHB A;  5K5P A;  3ERQ A;  5IGE A;  3T13 A;  1NUC A;  1F2M A;  3PMF A;  4R8N A;  3NQT A;  4QMG A;  5JAV A;  1STN A;  2F0Q A;  3DHQ A;  3EVQ A;  3MXP A;  4KD4 A;  1AEX A;  4J6H A;  1TT2 A;  4KJN A;  3H6M A;  2OXP A;  5IOD A;  3RUZ A;  4K5V A;  3TP5 A;  1RKN A;  3BDC A;  1KDC A;  3DMU A;  3OMC A;  3QOL A;  4EQP A;  5IOC A;  1SNQ A;  5C3X A;  2SOB A;  5EGT A;  1SYB A;  3C1F A;  4IAL A;  2EYL A;  1KDB A;  1A2U A;  1STH A;  2F0M A;  1A3T A;  1STB A;  4KD3 A;  4WRD A;  5C5L A;  3T16 A;  3TP8 A;  1KDA A;  3MEH A;  5F2D A;  3V2T A;  1TR5 A;  1NSN S;  5CV8 A;  3NUC A;  4PNY A;  4F7X A;  4K2L A;  3SK6 A;  3SK4 A;  4DU9 A;  5ISR A;  5J1Z A;  1EY5 A;  2EYJ A;  1SYE A;  4HMI A;  1EY8 A;  1STA A;  2F0G A;  3C1E A;  3S9W A;  3U9O A;  2LKV A;  4H7B A;  4QB4 A;  3P75 A;  4RKB A;  5E1F A;  5IGC A;  1STG A;  2EYP A;  4LAA A;  4B9W A;  4ODG A;  3OSO A;  4KY6 A;  1II3 A;  2PYK A;  3MVV A;  4QF4 A;  1ENA A;  1EYD A;  3LX0 A;  3P1H A;  4WOR A;  2PW7 A;  1EY6 A;  5DEH A;  1JOQ A;  5CV9 A;  4PMC A;  4G57 A;  5KRU A;  4I65 A;  2SNM A;  4NKL A;  4K5X A;  4K5W A;  2EY2 A;  4EQO A;  5IGG A;  2EY6 A;  4N9T A;  3QOJ A;  5IGD A;  5CR3 A;  3OMG A;  2SNS A;  1A2T A;  3NHH A;  1KAA A;  3HZX A;  4ZQ3 A;  2M00 A;  2NUC A;  2RDF A;  2F0O A;  2F0J A;  5CV6 A;  3D4W A;  1TQO A;  4ME5 A;  2F3W A;  1EYA A; 
#chains in the Genus database with same CATH topology
 4CDD C;  1SDF A;  2NZO A;  2JJQ A;  4JBW A;  5IP9 H;  2E2H H;  2NN6 G;  1XMO L;  3MXG A;  5DNF A;  1D6E C;  4H44 C;  4O2D A;  4X66 L;  3R3O A;  4CBV A;  1I4P A;  3CCJ A;  2F0D A;  3I90 A;  1PH9 A;  1Z6H A;  4KHZ A;  4HMJ A;  1S5E D;  3GTG H;  3PSI A;  2LXK A;  5C44 G;  2CWP A;  2B63 H;  2UUB Q;  4L63 B;  3K5L A;  4KY7 A;  3S16 H;  1O78 A;  2QDB A;  5IWA L;  3S1Q B;  3M3Y H;  4A3F H;  4TSS A;  5C0X G;  1ICF B;  5IOD A;  3TN2 A;  5CBE E;  1VQC A;  5DLQ E;  4LFB L;  5HGQ A;  2E2J B;  3M7G A;  4MN3 A;  3TS0 A;  1ZYR D;  3I2Z A;  1SYD A;  1IBL Q;  4IUN A;  4A3B H;  1SNM A;  1HA6 A;  3MAQ A;  1HNX L;  1F2Z A;  1QG7 A;  2OCE A;  1GKH A;  4UP8 A;  2EYM A;  2VUM B;  1CI3 M;  3S14 H;  2R7D A;  2F0H A;  4JK1 C;  1BF4 A;  2E5L L;  1RHP A;  2AQ3 B;  3TRE A;  1K8G A;  1QUQ A;  2F1M A;  1BCP D;  3U50 C;  3RUZ A;  4G7O C;  1TWF H;  1I4G A;  1WD0 A;  3HOV H;  3NEN A;  4BWG B;  4EQP A;  3RZO B;  1IW7 C;  1KNE A;  3PV0 A;  3QG1 A;  2K1B A;  3K5N A;  1D1I A;  3S2H H;  5FJ8 G;  2K50 A;  3KDF B;  3FDT A;  3CPF A;  3PIO A;  4GOP B;  4UDU C;  3KUP A;  1Q1E A;  3KK7 A;  4H02 A;  4Q5V A;  2EVB A;  4B3T Q;  1A8V A;  4CJ2 C;  4A3M G;  1K73 C;  3GTL H;  4HED A;  4JI6 Q;  2WB1 E;  1D2B A;  4XDX A;  4CDE C;  3S9W A;  4GNX C;  3TSS A;  3P75 A;  1ZYR C;  2JEA I;  2NVX B;  2UU9 L;  4DAY A;  1YIT A;  4BY7 G;  2I07 B;  4IFD G;  2OT2 A;  5IY0 A;  4K5X A;  2XVS A;  1QE6 A;  3KLS X;  2SEB D;  4ZKB B;  1L0Y B;  1LTR D;  3M4O B;  4X6A H;  3A56 A;  3HOY H;  2NUC A;  5AJ3 L;  4LF9 L;  4FVM A;  2F0J A;  4B3M L;  1BCP C;  5KYI A;  4HIO A;  5E7N A;  3R2T A;  5M3M B;  5CGK A;  3I55 A;  1K83 B;  4N8X 1;  2IT1 A;  4ZLT F;  4QCL A;  3K7A B;  1STY A;  4LF5 L;  4GN3 B;  2HT1 A;  4JYA L;  1BVS A;  1VQN A;  1HTL D;  4KHV A;  1HXY D;  4A3G H;  4TVA B;  4A76 A;  2J4X A;  3KBG A;  1VQM A;  1AE2 A;  1VQ7 A;  3NK9 A;  1GHK A;  1VMC A;  4TQU S;  3I4O A;  3AQQ A;  4WJ4 A;  4OL7 A;  4CJ0 B;  4OEM B;  1SBB B;  1U0L A;  5COY A;  2F0V A;  3W1B A;  3U58 A;  4DV5 Q;  4WJW A;  2AKW B;  4IO9 A;  5FLX L;  1JJG A;  4XQQ A;  1PH2 A;  2Q2T A;  4NP5 A;  4OX9 Q;  3VR4 A;  2ATW A;  3NE5 B;  3JAM c;  5EJW A;  1FGB D;  2KVM A;  5IYC H;  3EIV A;  4YHH L;  3V05 A;  2EY1 A;  1PZK D;  4FP5 D;  3CW2 C;  4EQ5 A;  1SN8 A;  4C3H H;  5C3E H;  3J80 E;  2K4K A;  5BR8 L;  3E0E A;  1BR9 A;  1JC7 A;  1O7L A;  5CYU A;  2L9H A;  2CQA A;  1QZH A;  3C3L A;  1SJE D;  1KDC A;  2Y0S B;  3OMC A;  1WCM B;  4HJ8 A;  4LF7 L;  3WOE A;  5G3L F;  3CP0 A;  2PO4 A;  2YTV A;  3KF8 B;  4R4Q A;  3O13 A;  3SE0 A;  2F0M A;  1XPO A;  2Z6B A;  4GKK Q;  1DGS A;  1LT4 D;  1O7Z A;  1YNN D;  4FF1 A;  5ISR A;  3HOX H;  2WIN B;  2JA6 H;  1YHA A;  3G7L A;  1G2S A;  3VR3 A;  5IGC A;  5E1F A;  1GHJ A;  1VF5 C;  2NZH A;  2WKD A;  3S1M H;  3Q22 A;  4R9W A;  3CAM A;  4DAY B;  1HZA A;  1SE8 A;  4IN3 A;  2HCC A;  2DY8 A;  3BU2 A;  3K0Y A;  1PVO A;  1B1Z A;  3NHH A;  2K5H A;  1F9S A;  1V1P A;  2RDF A;  1DXM A;  4YY3 Q;  1VQD A;  1YNX A;  2JEB I;  3ND9 A;  4Q0F A;  4HJA A;  1VQG A;  2PMZ E;  3FKI B;  5IGF A;  4ZUI A;  3FVQ A;  1KLU D;  1M1K C;  2HD3 A;  3HFZ B;  1KRT A;  2UXC Q;  4PZ7 A;  4DF7 A;  5KEE A;  2NVQ H;  1K8O A;  1B8A A;  1JT8 A;  4CGY B;  2XRS D;  2F4V Q;  1F9Q A;  1YNN C;  1ET9 A;  4A3L G;  4FDB A;  4B3S Q;  3R93 A;  1UUP A;  1Q1B A;  4O1N A;  4ME3 A;  2EYO A;  2RKS A;  3HOZ B;  5I9P A;  2QCP X;  5M5Y B;  1K8M A;  4OON A;  1R9T B;  1F2Y A;  3OTO Q;  2R92 B;  3NEM A;  2WB1 G;  2PCF B;  3D31 A;  4LW1 A;  1MHW C;  4WFN 3;  4DNT B;  4ABN A;  1LT6 D;  3RLF A;  1HNW Q;  3L7Z C;  3K58 A;  4DV2 L;  1BXT A;  3E9H A;  3NSW A;  1HJP A;  3JC6 6;  4GKJ Q;  2B2W C;  2PNR C;  1HUM A;  1Y1V H;  4DR4 L;  2JP1 A;  1H95 A;  1ZEQ X;  1BUV T;  2HDL A;  3OWF A;  1UE7 A;  4JG2 A;  1TWG B;  5IGE A;  5TSS A;  4X65 L;  1H9S B;  1F2M A;  4R8N A;  4MTN A;  2BH2 A;  1F2L A;  2HHH Q;  1AEX A;  1OXU A;  2L0C A;  4DA2 A;  4PZ6 A;  3DMU A;  4LF8 Q;  1TKW B;  3FMC A;  3GV6 A;  4DN4 M;  4UP9 A;  3S17 B;  4IOC A;  2B2V A;  1V43 A;  3NQI A;  4A3K G;  1S5B D;  1SYB A;  2K52 A;  5K36 H;  1CKN B;  3NTI A;  2DJF C;  2RSO A;  2PQA A;  3URY A;  4BBR H;  1GJX A;  4FXK C;  4XIG S;  4NXM L;  5E4W C;  1TWC B;  3RZD B;  2CKZ B;  4JI7 Q;  4KMU C;  2K05 A;  3HOU H;  4DV3 Q;  2IHF A;  2WAQ E;  3C1E A;  4G7H C;  3U9O A;  1XMQ Q;  5ELF A;  2NZ1 D;  3HOW H;  3G48 A;  3CU7 A;  4L5R C;  2ZT9 C;  4KHP L;  3I3C A;  1XX8 A;  4ODG A;  5LL6 X;  2PYK A;  1I4H A;  4DUZ Q;  4WOR A;  1IKL A;  2IL8 A;  2OQ0 A;  5DEH A;  2TSS A;  3HGB A;  1X56 A;  1FR3 A;  4JBK A;  3MEF A;  3R8B A;  4A3F G;  5BN5 A;  2Z6K A;  3I4L A;  4XYQ A;  2ID0 A;  4A3J B;  2K01 A;  1EFI D;  4MNO A;  2B2Y C;  1U9R A;  4M8A A;  4UP7 A;  4Y52 H;  1A15 A;  1YI2 A;  3HOV B;  4A3B G;  1JOK A;  4YWM A;  5JJZ A;  3A74 A;  2N8N A;  5IGB A;  2F0E A;  1EYC A;  1XPU A;  2C9O A;  3S1Q H;  1X32 A;  1Q81 C;  2JA7 B;  2E74 C;  2EY5 A;  4HR7 B;  1MSG A;  4X3T A;  4G4K A;  5E3F A;  3J81 j;  1PH8 A;  2E2J H;  1W6J A;  3TME A;  1N8R C;  2P5Z X;  1TII D;  1VQO A;  3EJI A;  3IRB A;  2IX1 A;  2EYH A;  2A8V A;  4XQJ A;  1N33 Q;  3PO2 G;  3PO3 G;  1I5F A;  2BA0 A;  2K33 A;  1RIP A;  3J80 c;  2VUM H;  1EWI A;  3CCL A;  3RNU A;  3Q6S A;  1O80 A;  5GAH C;  1SE4 A;  1S40 A;  3GTQ B;  1K3B C;  4DV7 Q;  2NTS A;  2WII B;  4C3J G;  3T4A C;  4KN7 C;  2NBF A;  5CV5 A;  2PI2 A;  1ICW A;  3BVZ A;  1XPR A;  1PTO F;  2A5H A;  1D1K A;  3H3V C;  2IHE A;  3RZO H;  1A0I A;  1A3V A;  1I94 Q;  5C4X G;  3BYY B;  1IBM Q;  2EIF A;  5GAE C;  1TY2 A;  1CUK A;  1H9R A;  3E6Z X;  1KXL A;  1QVC A;  4I7Z C;  4OXP A;  1VQL A;  4R4I A;  2L12 A;  3CRK C;  2ZJR A;  5DM6 3;  3M7N A;  5FKA C;  4A3D B;  1A62 A;  2CW0 D;  4R4C A;  2NVX H;  3I4N G;  1RDP D;  3S2D B;  3CCV A;  1SR3 A;  1STH A;  4DK6 C;  5AFW A;  4PQX A;  2HCI A;  3M4P A;  4A3I B;  1LTS D;  3PCO B;  4YWL A;  3SK4 A;  3M4O H;  3A7L A;  2KEE A;  2O5J C;  4HMI A;  1EU3 A;  2WKC A;  4A3E B;  1WFQ A;  4A93 G;  1STG A;  2KEC A;  3GTJ B;  2K5D A;  5JEA J;  1X55 A;  1K83 H;  4IJH A;  3TRZ A;  2B3G A;  4DV0 L;  1I6H B;  2RQX A;  3K7A H;  1UE5 A;  2NB0 A;  1CTM A;  3CMA A;  1SE2 A;  2MPM A;  3Q0A A;  4GNX A;  5KNB A;  2BOS A;  1HCZ A;  2YV5 A;  3H0G B;  3L2P A;  5IT9 E;  1HZB A;  3HEJ A;  5CC4 A;  5HY6 A;  1PH1 A;  5I6W A;  4LNQ A;  2CW0 C;  2R7Z B;  4YCU A;  3LNN A;  3CD6 A;  1PH6 A;  3L9A X;  2VNU D;  3M4Q A;  3ULP A;  4BBS G;  2K14 A;  2UXD Q;  2RSN A;  3NEL A;  4DUY L;  4P73 A;  3VDY A;  1K0S A;  3EN2 A;  5HGT A;  3AMU A;  2ZM6 L;  5M3F G;  1KNA A;  2B8G A;  4PMB A;  3NXW A;  2KCT A;  1A3U A;  5C6A A;  1J9O A;  1W2B A;  2TMP A;  3K80 C;  3S1N B;  2WAQ G;  1HH2 P;  2ENB A;  3J81 L;  1Y1W G;  2HQL A;  4IFD I;  4B9X A;  3GDE A;  4P74 A;  1N36 L;  4IPD A;  4RHR A;  5J39 A;  2XTI A;  3HOX G;  4GZY C;  2FFK B;  3RLO A;  2I46 A;  2JA6 G;  4KTA A;  1UNS A;  2Q2I A;  5LMN W;  2L15 A;  4HIK A;  4QGU A;  3J81 i;  2UUA L;  1WCM H;  4FF2 A;  3SVM A;  2D62 A;  2F0P A;  1EQV A;  1LYL A;  3TDQ A;  1ZKO A;  4JW0 A;  5LMU L;  3CME A;  4HCS A;  2BDO A;  1SEB D;  1HA5 A;  1VDZ A;  2KHJ A;  1HR0 Q;  1DD2 A;  1VQK A;  1J5E L;  5LMN L;  3GTK B;  2JSO A;  2R6G A;  1RCV D;  1GM5 A;  4C3I G;  3K5O A;  1KTK A;  2X6L A;  1CZG A;  1JE4 A;  3C1F A;  3EFX D;  5E4X A;  4PG3 A;  4DV4 Q;  1PRT F;  5H1S E;  1KDA A;  5F2D A;  1PFN A;  4U68 A;  1XNR L;  4X64 L;  3CCU A;  1QIL A;  1EY5 A;  5FO8 B;  1F77 A;  1STA A;  1U4P A;  5FO9 B;  1RL2 A;  4BA2 I;  2M9V A;  3KF6 B;  4KKU A;  2LXJ A;  3FKI H;  4HSP A;  3MVV A;  5FO7 B;  1GUG A;  1PTO B;  1IKM A;  4HJ5 A;  1XMO Q;  4DR6 L;  4K5W A;  1PDQ A;  4X66 Q;  3QR8 A;  3U9S A;  5CV6 A;  1TQO A;  4ME5 A;  3H3V H;  4C1N I;  3BZK A;  3VR2 A;  2F3I A;  2CFM A;  2L11 A;  3UE1 A;  2EXZ A;  5J22 A;  2F0L A;  2AUK A;  3HOZ H;  3IFT A;  4JI2 L;  4H0L C;  5M5Y H;  4JI8 L;  1Y1V G;  3CRL C;  4KKS A;  1R9T H;  1KC8 C;  2R92 H;  2GN5 A;  1VQE A;  3TZD A;  3NP8 A;  2JA5 B;  1IXR A;  3ER0 A;  3SXH A;  3NBH A;  4S3S A;  4LFB Q;  2O4X A;  2DNE A;  3A7A B;  3NTH A;  4BXX H;  2DJG C;  1EZ8 A;  1XNQ L;  3UE0 A;  5C4Z A;  4RA8 A;  1SNP A;  2R7F A;  2RHS B;  1HNX Q;  5D3I B;  4B08 A;  5K36 G;  1FJG Q;  3F2C A;  3HKZ B;  1ONL A;  1PYW D;  2F0F A;  5I9O A;  2E5L Q;  1TWG H;  3GD7 A;  4OWX B;  3HP3 A;  3FPP A;  4KY5 A;  3HOU G;  5C4J B;  1JE5 A;  1XYI A;  2XIW A;  4FXD A;  3DEP A;  3E5S A;  4K0K L;  3UDX A;  3V96 A;  3S17 H;  3AEV A;  1HQM C;  3LWE A;  4JI5 Q;  1IW7 D;  1FL0 A;  1LO5 D;  1LAC A;  2VQF L;  1PLF A;  3RN2 A;  4DR7 L;  1XJV A;  2HIV A;  1TWC H;  3RZD H;  3EVQ A;  2VW9 A;  5M5X B;  2B2W A;  2OXP A;  1B9M A;  4L6T B;  2JXM B;  5FOB B;  2B2U C;  2AHO B;  3PUY A;  1W3S A;  4DR5 L;  1W6K A;  3PIP 3;  4DR1 L;  4DR2 L;  5FLX E;  4AQY L;  3IKJ A;  4GN5 A;  4WRD A;  1L2F A;  1STB A;  3SDZ A;  1DYQ A;  1EL0 A;  3VYR A;  5EQ0 A;  1BBX C;  2R93 G;  4F88 A;  5AJ3 Q;  4LF9 Q;  5GQO A;  5IT9 c;  4RKB A;  2CH4 W;  5DM7 3;  4A3J H;  1HPC A;  3LX0 A;  3P1H A;  4GLA C;  5ELB A;  4B3R L;  2V1C C;  1LTI D;  4G7Z C;  5IYD H;  2UXB L;  1FD7 D;  3MFG A;  4C56 C;  3BDO A;  2Z8L A;  4LF5 Q;  4QIW B;  2VUM G;  1J6Q A;  3GTO B;  2JA7 H;  1E1T A;  3GO5 A;  3U4Z A;  2IW3 A;  4DAV A;  4HIM A;  1XTC D;  3BS1 A;  1PH7 A;  5D3D A;  1WI5 A;  3T1H Q;  5NUC A;  4KI0 A;  3ITP A;  4U67 3;  1CZW A;  4IUQ A;  3I72 A;  2XWB B;  1DJR D;  1HNZ L;  4DV6 L;  1PRT B;  3D4D A;  1NJI C;  1MSH A;  1RF2 D;  4BY7 B;  1PTO C;  4PZ8 A;  4EX5 A;  2F4I A;  4EVO A;  3SK8 A;  3GTQ H;  1S5D D;  1Z47 A;  4DNR B;  2NVT B;  4NMZ A;  4X3U A;  4YHH Q;  1PZJ D;  1I3Q B;  2ZXO A;  1CKO A;  4P75 A;  1HFG A;  2J0T D;  2PPB C;  3SR1 A;  1SND A;  2FJ2 A;  2RBM A;  2VQE L;  2CVR A;  5BR8 Q;  4RCO A;  1LAB A;  1EZ6 A;  3OYY A;  4Z9C B;  2E75 C;  4X62 Q;  3NWT A;  3ONA B;  4JOI C;  3J7A F;  4A3D H;  4J15 A;  5M3M G;  4LF7 Q;  5J3B A;  1UWV A;  1L1O A;  3S2D H;  4A3C H;  2N55 A;  3F2B A;  3RLN A;  1Z7T A;  2A74 C;  2OF1 A;  4JI0 L;  4A3I H;  5ELO A;  4QMG A;  4C2M B;  4J6H A;  4O42 A;  3KJO A;  4A3E H;  3BDC A;  4IJL A;  1A63 A;  1CQF A;  4R4O A;  3GTJ H;  2BE5 D;  4IPG A;  1WOC A;  1GUO A;  4NXN L;  4LUV A;  1K0R A;  1E22 A;  1I6H H;  3J7A 5;  2IJ0 A;  3MEH A;  2BA1 A;  4JI1 L;  2WV6 D;  1NSN S;  2NVY B;  5A2Q L;  4R1J A;  3SK6 A;  3D6W A;  5J1Z A;  2EYJ A;  1XWE A;  3H0G H;  2AQ1 B;  2LKV A;  1CHQ D;  2RA4 A;  1VS0 A;  1WD1 A;  1K28 A;  4QF4 A;  4CDC C;  3KFU A;  1OO9 B;  1QUQ B;  2PW7 A;  2R7Z H;  1JOQ A;  5CV9 A;  2EJM A;  1RD9 D;  3CXC A;  4L5T A;  4RMF A;  5FLM G;  1YVC A;  3Q8D A;  2XSC A;  1BBW A;  3NPP A;  4H13 C;  4MZ9 A;  5CMD A;  3I4M B;  1CKM A;  3HKS A;  2E76 C;  2ALY B;  2A73 B;  2XN9 C;  4RFB A;  4TKO B;  3AFP A;  3SHL A;  2BE5 C;  5JVH 3;  1OTC A;  3IAY A;  1ET6 A;  4IUU A;  2RVL A;  2F0N A;  3S1N H;  2FMM A;  2KEN A;  2RHQ B;  2FHT A;  4KJO A;  2JA9 A;  1O7I A;  1EIY B;  2O5I C;  4OEL B;  1LLR D;  3A8K E;  1GD7 A;  3OIP A;  1VQH A;  2MHV A;  5EBC A;  4DV2 Q;  1VQP A;  1I4Q A;  3UDF A;  1SSO A;  1J8I A;  1WTP A;  1S5F D;  1EY7 A;  2I5L X;  2PZT A;  4GOP C;  2EYF A;  1H9M A;  2OTJ A;  3P7J A;  4JPB W;  5JEA G;  4BY1 B;  4R8I A;  4QL5 A;  3FRP B;  2DGY A;  2DNC A;  2F0S A;  1PMR A;  1UEB A;  2FIN B;  5LL6 S;  1N34 L;  1PRT C;  5EBD A;  4XXE A;  2X6G A;  3GTK H;  3FKI G;  1Q82 C;  4AIM A;  3MA2 B;  1ML0 D;  2QDL A;  4F8M A;  5FLX c;  1L0W A;  4L5Q A;  3N6R A;  1V1Q A;  1CHP D;  1EIG A;  1HZ9 A;  2K5N A;  5EKK A;  5EPK A;  1JOO A;  5K5P A;  3I7F A;  1B2T A;  1X9N A;  4ZCK A;  4NXM Q;  1U4L A;  5BN3 A;  5JAV A;  3CQZ B;  5D65 A;  4KJN A;  2IWH A;  2B39 A;  1JB7 A;  1TXY A;  3C2P A;  2QKI C;  2L1B A;  2EYL A;  1NE3 A;  4V19 0;  3G4S A;  1PTO H;  3TP8 A;  3GTM B;  2R92 G;  3W1G A;  1TR5 A;  2AUJ D;  1DCZ A;  4K2L A;  2ZTD A;  1VQB A;  1M8A A;  1ASZ A;  3F2U A;  2CCZ A;  3CC7 A;  1B70 B;  4ZRZ A;  1SRU A;  4BXX G;  3OOC A;  3S1R B;  2D5D A;  4JBM A;  2EY6 A;  1E3P A;  5IP9 G;  3E0J A;  1JWM D;  1AE3 A;  1LV9 A;  4A3K B;  2JA5 H;  1V8Q A;  1VQ4 A;  3BDL A;  4LF4 L;  3KOJ A;  2EJF C;  4LF6 L;  3PUZ A;  1BBU A;  1QVF A;  2LSS A;  2B63 G;  3MC0 B;  3X3N A;  1RTO A;  3ERO A;  1SFO B;  2DUD A;  4LUO A;  1WYD A;  2H1E A;  2IX0 A;  2YTX A;  1XTD A;  2NN6 H;  2OEO A;  2YYZ A;  3A54 A;  1HUN A;  2NWG A;  3S15 B;  5C4J H;  1V1P B;  4IOA A;  5A35 A;  3U4V A;  2KHS A;  3E3X A;  1I4X A;  3NBI A;  1HNW L;  2UUC Q;  4K2K A;  4CHT B;  1PHJ A;  5CV4 A;  1UEA B;  4RKL A;  3UDG A;  4HTH A;  3TBI B;  5FK9 C;  3T56 B;  4APV A;  1ESR A;  4J8Q A;  4OO1 H;  1WTH A;  1KLG D;  5M5X H;  2MNA A;  1C4Q A;  5KIX A;  5C0X H;  1STE A;  1L0X B;  2BDN A;  4DXG A;  4JI3 L;  2EOT A;  2F0U A;  2KJX A;  1E2Z A;  3STB D;  1CA5 A;  2HHH L;  3HOV G;  3I73 A;  5IYD G;  1B3A A;  1RJT A;  2VXW A;  2Z9H A;  5D14 A;  5GAG C;  1CSP A;  3PIP A;  2JA7 G;  1FGU A;  5M5W B;  4JV5 L;  3PO2 B;  2Z4H A;  4CKC A;  4DR3 L;  1WTW A;  3PO3 B;  4UHV A;  3J81 E;  4BS9 A;  1D8L A;  2K75 A;  4DV1 Q;  1DOL A;  3CKI B;  4C3J B;  3DM1 A;  4DV0 Q;  1IYU A;  1P8L A;  3UDI A;  3N52 A;  1Y8N B;  2A6E D;  3GTO H;  2K7V A;  2B2U A;  1SMX A;  3CCR A;  3OIQ A;  5ELC A;  5FJ8 H;  2PMZ B;  2EE1 A;  1X3E A;  3ZJY C;  5BN4 A;  1SAP A;  4KY6 A;  1II3 A;  3HOY G;  2IX3 A;  2ICI A;  4NPS A;  4JI4 L;  3F8T A;  4I65 A;  1FYC A;  2SNM A;  3STB C;  3ERS X;  1ESF A;  4NB3 A;  2UXB Q;  3OMG A;  3TZU A;  1A2T A;  3W3A A;  5EKI A;  2Q2U A;  2VY3 A;  1Q86 C;  3I4N B;  2G5D A;  4YCW A;  2F0O A;  4PNY A;  2QIL A;  2PQA B;  2QF7 A;  4BY7 H;  4DUY Q;  3QJY A;  1QCB D;  2ZM6 Q;  3FPU B;  4FYD A;  2NVT H;  3DWQ A;  3ULL A;  4A3G G;  4K8I A;  4A3D G;  5DAU A;  4AYB B;  4IUV A;  1QB5 D;  1I3Q H;  2QW7 A;  3GQB A;  4A93 B;  4XQN A;  1WVL A;  5I2X A;  2NYZ D;  1YNJ D;  2A6E C;  4XT1 B;  4L5S A;  1N36 Q;  2QEJ C;  4DXF A;  1IZ6 A;  5JOB A;  1T5X D;  4A3E G;  5G3L D;  2EJG C;  1YJN A;  1T5E A;  1EYG A;  3HKZ E;  4HJ9 A;  2UUA Q;  1TVX A;  5IYC G;  2D9U A;  4HCE A;  1CT1 D;  1PFS A;  3D4R A;  4QUC A;  5LMU Q;  4P2C B;  1JOR A;  4O0A A;  1VQ9 A;  3PQI A;  1D5X C;  4C3H G;  1SYC A;  5C3E G;  1Z9F A;  4C2M H;  4DPG A;  4LFC Q;  3G6J B;  4BBS B;  3DM3 A;  5LMN Q;  1H9K A;  2EPB A;  3D3R A;  1JMC A;  2EDG A;  1JR0 D;  3K8A A;  3FP9 A;  3J7Z C;  2EXD A;  1EQT A;  4C1N K;  5M3F B;  1ENF A;  4FNF A;  4JCV E;  4RAU C;  4GN4 B;  4GLV B;  2Z4I A;  1I4R A;  4IQZ A;  1YNJ C;  1XNR Q;  3NQT A;  2NVY H;  3DHQ A;  3AB9 A;  4HJ7 A;  1TT2 A;  2KCC A;  2WAQ B;  1LT3 D;  4RWS C;  1Y1W B;  3SGI A;  1S4Z A;  3KJP A;  3DWA A;  3AYH B;  3BYT B;  2LY7 A;  2N88 A;  4JBJ A;  1SNQ A;  2K32 A;  3PUV A;  1R4Q B;  5LHY 1;  1MBY A;  2JQO A;  4DK0 A;  4GS3 A;  3T16 A;  3GTP B;  4DR6 Q;  2C5C A;  3NUC A;  2AWN A;  1Q8K A;  3T53 B;  3A8J E;  3HG9 A;  3T1Y Q;  3K7U C;  2QA4 A;  1X6O A;  2MFI A;  1TWA B;  3I4M H;  1HFN A;  3EQL C;  1C8C A;  4B9W A;  1X3G A;  3K81 C;  4FXG C;  3Q24 A;  1PH4 A;  1EY6 A;  4G57 A;  5KRU A;  1IBK L;  2ZJQ A;  4LMQ D;  4JI2 Q;  1K3R A;  2WFW A;  4DNI A;  2SNS A;  1PFB A;  3HZX A;  2BCO A;  4C3I B;  2Q2H A;  3MXN A;  1EYA A;  3VYT A;  4NDX A;  3RR5 A;  4TRD A;  3VA5 A;  1ASY A;  3TP7 A;  3PF5 A;  1KD1 C;  1XNQ Q;  5JJL A;  1N32 L;  3RD4 A;  1GUT A;  1AH9 A;  4RG1 A;  3CCE A;  3GP7 A;  3AU7 A;  3K5M A;  4BY1 H;  1E2V A;  2F0W A;  3QB3 A;  5M9O A;  4RGN A;  5JPN C;  1BQQ T;  4GNX B;  2JA8 B;  2B2V C;  1WTR A;  1JWS D;  4XTC S;  4K0K Q;  1U4M A;  4A3L H;  2ZXP A;  3SK5 A;  5KGU A;  1KRS A;  1SYG A;  3CCS A;  2EQS A;  3A0J A;  4CKE A;  2VQF Q;  2K03 A;  5IWA Q;  4DKA C;  1VCI A;  2BH8 A;  2KBN A;  3CQZ H;  1EIH A;  1PH3 A;  1E24 A;  3KDF A;  2XRQ D;  3J81 c;  1B3Q A;  3MWY W;  1BCP B;  4GOP A;  2FXQ A;  3G71 A;  1WTQ A;  4KV6 A;  2F0I A;  1X3P A;  1HQR D;  2E2D C;  2KED A;  1SMY D;  4DR1 Q;  1EY9 A;  4MIU A;  4DR2 Q;  2I5H A;  4AQY Q;  2GVA A;  2OWO A;  2G9H D;  1XXG A;  2Z6K C;  2RF4 A;  1NMG A;  1OXX K;  1VQ6 A;  2HUG A;  3GTM H;  1EUJ A;  1CSQ A;  3MXP A;  1B50 A;  5ELN A;  4BBR G;  2VS1 A;  1EQR A;  1FNV A;  3ZYY X;  1LUZ A;  3EA6 A;  3TS2 A;  3CC4 A;  5C3X A;  4B3R Q;  4HID A;  3S1R H;  3KLW A;  1KDB A;  3HOW G;  3TEH B;  3A5U A;  1AFP A;  2L55 A;  1P16 A;  2MO0 A;  3CF5 A;  2B2T C;  5C44 B;  3A8I E;  3HKZ G;  5ELE A;  3ULJ A;  1E0B A;  4A3K H;  2Y0S E;  4IUT A;  2EYP A;  3ND8 A;  2CH4 A;  3OSO A;  1X3F A;  2Q8I B;  4LFA L;  1MI2 A;  1SMY C;  4EQO A;  4HN7 A;  2UU9 Q;  1HNZ Q;  4DV6 Q;  1YZ6 A;  1SFO H;  4OO1 G;  5GAD C;  3IFD A;  4EQN A;  3MXN B;  4OWW B;  1RTN A;  1PTO D;  1R4P B;  5A2Q E;  2V4D A;  2R93 B;  1I50 B;  2VZA A;  3S15 H;  4B3M Q;  5JVG 3;  3H3V I;  1NCV A;  2CHB D;  1UAP A;  4OGQ C;  3F1Z A;  4FF3 A;  1SLJ A;  2PZU A;  1AW7 A;  2VQE Q;  2PNH A;  2F52 A;  4ZYS A;  2I5M X;  2A69 D;  2HQE A;  1YJW A;  1BNZ A;  4ZUJ A;  2RCN A;  2N49 A;  1U5K A;  4JYA Q;  1Y8P B;  1N9W A;  3S24 A;  1EY4 A;  1UE6 A;  1FJG L;  2E8G A;  2LS0 1;  1GO3 E;  1G6P A;  1KIX A;  1Q3L A;  3BG3 A;  3CHB D;  3QWN A;  3BZC A;  3JAM L;  1MGS A;  4A3M B;  2F0K A;  1EY0 A;  4POF A;  4JI0 Q;  5EPL A;  2X69 A;  5T1G A;  1EIF A;  5EAY A;  3KF8 A;  1NY4 A;  2UUB L;  5M5W H;  3PO2 H;  1JJC B;  4ID6 A;  3JAM i;  3PO3 H;  3MXU A;  4JI5 L;  2B2Y A;  1DOK A;  3NBH B;  2RCF A;  4CJ1 B;  5CV7 A;  4NXN Q;  4IZ8 A;  4C3J H;  2AQ2 B;  1LTA D;  3T13 A;  4JI1 Q;  3CC2 A;  1CQV A;  3K59 A;  2A69 C;  3I70 A;  1FNU A;  3TP5 A;  4RGO S;  1MJE A;  1IBL L;  5C4X H;  1CM9 A;  2AWO A;  5IYB H;  3NTK A;  1TWH B;  5EGT A;  3OWE B;  4KD3 A;  1A2U A;  1A3T A;  3HRZ C;  4RHS A;  2A19 A;  3VA7 A;  2DY7 A;  3E9I A;  4DU9 A;  3I4N H;  3P20 A;  4LAA A;  1ENA A;  4P71 A;  2JN4 A;  4XYO A;  3WWV A;  1M90 C;  1GUN A;  4MTK A;  4BA1 I;  4B3T L;  4A93 H;  4JI6 L;  3T1H L;  1E2W A;  1TU2 B;  3I56 A;  2Z1C A;  2F3W A;  2ICE C;  4LWC A;  3K0X A;  2YTY A;  2ZTC A;  1HRJ A;  1EWH A;  2KA7 A;  1CA6 A;  1KAW A;  2DN8 A;  2A68 D;  1WTO A;  1PA6 A;  3D0F A;  3D6C A;  3BVG A;  2FMC A;  2KHI A;  2LFN A;  3CPW A;  1EOT A;  2QGQ A;  1ENC A;  4Y7N B;  4J1M A;  1JB3 A;  1QNK A;  1YHB A;  1N34 Q;  2R3Z A;  4BBS H;  1H9S A;  1NNX A;  4DAM A;  3K6O A;  4F87 A;  4JC0 A;  1PRT D;  1Y69 U;  2MQH A;  4X62 L;  4N8F A;  5C4H A;  2C35 B;  5M3F H;  2Y0S G;  1OXV A;  1WCM G;  5IP7 H;  4ZAI A;  2MO1 A;  1NTG A;  4YWK A;  1WJJ A;  4IUP A;  1JCK B;  1EOV A;  1QOH A;  1CKN A;  1ZXT A;  2SDF A;  3I4M G;  4X3K A;  1Y1W H;  5JJI A;  4KN4 C;  3FEW X;  3B6Y A;  3C46 A;  1ILP A;  1NMF A;  3F2D A;  2YU9 B;  4HAE A;  2A68 C;  3H15 A;  5KNC A;  2KQ3 A;  3MHB A;  4DV5 L;  2A1A A;  2D0P A;  3H91 A;  3J7A V;  3GTP H;  1VQA A;  1SXT A;  4DR4 Q;  2IPK D;  1C0A A;  1TS2 A;  4OX9 L;  5L37 A;  2ZJP A;  1LTL A;  2JE6 I;  4CDF C;  4V0B A;  4X65 Q;  1TWA H;  3I91 A;  2EZV A;  1PV4 A;  2GA4 B;  4CKB A;  2SOB A;  1KL9 A;  2ZTE A;  1AN8 A;  1B53 A;  3NWS A;  3RN5 A;  5EPJ A;  1VQ8 A;  4LK1 C;  1DON A;  3RMH A;  1FVI A;  5CV8 A;  3LGJ A;  2CWA A;  4F7X A;  1L1O B;  2XGT A;  1SYE A;  4C3I H;  4BY1 G;  1Q7Y C;  4LUZ A;  1QVG A;  5C0X J;  1PYS B;  4LF4 Q;  4MHE A;  1IL2 A;  1IYV A;  4R4T A;  1EYD A;  1SJH D;  2WB1 B;  4LF6 Q;  4UPA A;  2K5Q A;  1SRO A;  1VQF A;  4GKK L;  5IGG A;  3QOJ A;  4KHP Q;  1KQS A;  2H5X A;  1JQY D;  4DAP A;  3HOZ G;  2A6H D;  1TS3 A;  4AYB E;  1VF7 A;  1G51 A;  2JYO A;  1AZQ A;  1LTB D;  3J7Y W;  2E2I B;  1B44 D;  1UE1 A;  2JA8 H;  1G8Z D;  5GRO A;  4DFA A;  2MP1 A;  2K5W A;  4YY3 L;  2KOL A;  1GOZ A;  2B29 A;  4N9P A;  2XNA C;  3J80 L;  3L3O C;  1EQQ A;  3SEB A;  2UXC L;  2F3V A;  1BO0 A;  2E2H B;  2R61 A;  4YIJ A;  1MD2 D;  1Q46 A;  1U4R A;  4JI3 Q;  2VL6 A;  1G91 A;  5C5M A;  1E1O A;  4ULL A;  1NBW A;  2F4V L;  5C3W A;  1PXU A;  2WAC A;  3J80 i;  1A6X A;  4K6D A;  2F0T A;  4B3S L;  2D2C C;  2A6H C;  3TP6 A;  3DXJ C;  3GTG B;  3GV3 A;  1DZ1 A;  2B63 B;  4JV5 Q;  4IFD J;  3S16 B;  4I7A A;  4DR3 Q;  3DLL A;  3W2D A;  1BDO A;  3OTO L;  3M3Y B;  1VMP A;  4A3F B;  1EU4 A;  4ILW A;  2H4O A;  1SNO A;  3ERQ A;  1LT5 D;  3LWU A;  1NUC A;  5JJK A;  4KLK A;  4DK3 C;  1STN A;  1EWC A;  4LJZ C;  3H6M A;  1C9O A;  2MGS A;  5C44 H;  4GKJ L;  1JIC A;  5COR A;  1EEI D;  4A3B B;  1VQJ A;  1HHV A;  2PI2 E;  1DM0 B;  1TS4 A;  1VQ5 A;  5IOC A;  1MKH A;  3W5O A;  4QY7 A;  5ELD A;  3PF4 A;  3S14 B;  4HSV A;  4JI4 Q;  4A3J G;  1QNU A;  1EFW A;  4OWT B;  2ZXR A;  1QZG A;  3V2T A;  1BKB A;  1FNW A;  2HDM A;  1G29 1;  1TWF B;  3QIA A;  2F0G A;  1GUS A;  4LF8 L;  3UI2 A;  1PH5 A;  1GVP A;  3PIO 3;  4POG A;  1G6Z A;  3S2H B;  4QQB X;  4PMC A;  2R93 H;  1I50 H;  2AMC B;  2RDH A;  2B2T A;  4M1U B;  5IGD A;  2MJ8 A;  1KAA A;  2D0O A;  4ZQ3 A;  1S3O A;  4JI7 L;  3GTL B;  1GXD C;  2WP8 J;  4DV3 L;  1GUW A;  2K6A A;  3BVM A;  1XMQ L;  3TQY A;  2ES2 A;  1X65 A;  2PW5 A;  4DUZ L;  2NTT A;  3DWP A;  1IYJ B;  5C4X B;  1L1O C;  2O2L D;  2LMC B;  4AH6 A;  2QEX A;  4P72 A;  4KK7 A;  1CFM A;  4ZK9 B;  2Q8R E;  4QJF A;  4K14 A;  3MZ5 A;  3D8G A;  4RH6 A;  2PQE A;  2I0Q A;  3HOY B;  2ASB A;  3K57 A;  4A3M H;  3Q23 A;  1M4V A;  4K8J A;  2IY5 B;  1SNC A;  3A5Z B;  2UUC L;  4OIJ A;  5JPM C;  1SYF A;  2N3S A;  4ALP A;  1B9N A;  1HTP A;  3BJU A;  5IYB G;  2NN6 I;  2KCM A;  2OTL A;  3BZD B;  1BCP F;  1PYB A;  4IFD H;  3OW2 A;  1B4O A;  5CBA E;  3PUW A;  1IL8 A;  3ICE A;  4A3G B;  4RCN A;  4A3C G;  2JK8 A;  3DUZ A;  1JWU D;  4DK1 A;  5HUR A;  1D5Z C;  1I6V C;  4JVZ A;  2K5V A;  2Q8T A;  4A3I G;  4EGV A;  3WDN A;  4OO1 I;  1N33 L;  2VB3 X;  1LM0 A;  5C0X I;  1WTX A;  1TWH H;  1KAB A;  4AYB G;  3KF6 A;  1HZC A;  4DV7 L;  1Q90 A;  4DV1 L;  4ZKC B;  3KBX A;  2F0Q A;  5M3M H;  4KD4 A;  1V1O A;  5I2Y A;  4GLX A;  1RKN A;  4YCV A;  5IE8 A;  4PV1 C;  3A55 A;  3X3M A;  4A4I A;  2B8F A;  3H0G G;  3VR6 A;  4C3H B;  5C3E B;  1I94 L;  1PFM A;  3FHW A;  5C5L A;  1J5E Q;  1IBK Q;  1IBM L;  1MJC A;  1Y8O B;  1B7Y B;  1K9M C;  2R7Z G;  1KHI A;  3OW7 A;  4IUR A;  1PZI D;  5I4D A;  3G6E A;  1X3Q A;  1O7Y A;  2XWJ B;  4X64 Q;  2KCN A;  4JOI A;  4XT3 B;  1YIJ A;  1MIU A;  3OHX C;  1N32 Q;  1CK1 A;  3PUX A;  1S72 A;  3HOX B;  4UAI A;  1OXS C;  1WTV A;  5IP7 G;  3WOF A;  2M00 A;  2JA6 B;  4FO2 A;  1F9R A;  1X54 A;  1T9H A;  2K28 A;  3HS0 C;  1H9J A;  1NAP A;  1ILQ A;  3KLR A;  4OIK A;  3VYS A;  4Y7N H;  4FF4 A;  3S1M B;  3T51 B;  5KYL A;  5FLM H;  3M4Y A;  2L4N A;  1K8A C;  3L0O A;  1D7Q A;  3M9B A;  1LTT D;  4PMW A;  4QIW E;  2OQK A;  4E6I A;  1S5C D;  4NW2 A;  1QJO A;  1D5M C;  3MFY A;  4JI8 Q;  4IPH A;  5IIF A;  1ROD A;  4DGZ A;  3EBE A;  4WJ3 M;  1V9P A;  1TS5 A;  3M85 A;  2NVQ B;  1BOS A;  1VQI A;  2VB2 X;  1YJ9 A;  2PZW A;  2F03 A;  1YHQ A;  2YU9 H;  2UXD L;  4LFC L;  2KUM A;  1NR2 A;  1YBY A;  5EKL A;  2G9D A;  1E7Z A;  1C48 A;  2J7Z A;  4RGT A;  3QO2 A;  1IHZ A;  2GVB A;  1QWY A;  3AFQ A;  5JEA H;  2HIX A;  5T1I A;  5I6Y A;  3CCQ A;  1SE3 A;  2N78 A;  1LTG D;  3PMF A;  2L5T A;  1HR0 W;  1G2T A;  4X3S A;  4IPC A;  2MUY A;  3JAM E;  3H09 A;  4K5V A;  3CCM A;  2RDG A;  3QOL A;  3VYU A;  4DR7 Q;  3MTS A;  1AP0 A;  1Y1V B;  1AZP A;  3I8Z A;  3KLS A;  1EEF D;  1Y14 B;  2JA8 G;  4IAL A;  5IT9 L;  3T1Y L;  4LFA Q;  3KYH C;  4RGM A;  4DR5 Q;  3H94 A;  1HR0 L;  4UY8 C;  3R2I A;  1EY8 A;  1YEZ A;  4H7B A;  4QB4 A;  1Q8I A;  4QUF A;  4OHJ A;  4K6L A;  1DOM A;  2JA5 G;  2E2I H;  3VR5 A;  2K04 A;  4A75 A;  1TY0 A;  4BBR B;  2CQO A;  4DV4 L;  4NKL A;  2EY2 A;  3IL8 A;  4N9T A;  1Q12 A;  2Z0S A;  5CR3 A;  3OPO A;  1C7Y A;  1NR4 A;  3HOU B;  4KKT A;  1OXT A;  3PGZ A;  1JJ2 A;  3DEO A;  2M2L A;  3D4W A;  3HOW B;  5KND A;  1F9P A;  4L8J A; 
#chains in the Genus database with same CATH homology
 1SDF A;  4JBW A;  2NN6 G;  3MXG A;  5DNF A;  1D6E C;  4H44 C;  3R3O A;  4CBV A;  1I4P A;  2F0D A;  3I90 A;  1Z6H A;  4KHZ A;  4HMJ A;  1S5E D;  4L63 B;  3K5L A;  4KY7 A;  1O78 A;  2QDB A;  3S1Q B;  4TSS A;  5C0X G;  5IOD A;  3TN2 A;  5CBE E;  2E2J B;  3M7G A;  4MN3 A;  1ZYR D;  1SYD A;  4IUN A;  1SNM A;  1HA6 A;  3MAQ A;  1F2Z A;  1QG7 A;  2EYM A;  2VUM B;  1CI3 M;  1BF4 A;  2F0H A;  4JK1 C;  1RHP A;  2AQ3 B;  2F1M A;  1BCP D;  3RUZ A;  4G7O C;  1WD0 A;  1I4G A;  4BWG B;  4EQP A;  3RZO B;  1IW7 C;  1KNE A;  3PV0 A;  3QG1 A;  2K1B A;  3K5N A;  1D1I A;  3FDT A;  4UDU C;  3KUP A;  1Q1E A;  3KK7 A;  4Q5V A;  2EVB A;  4CJ2 C;  4HED A;  1D2B A;  4XDX A;  3S9W A;  3TSS A;  3P75 A;  1ZYR C;  2JEA I;  2NVX B;  4DAY A;  2I07 B;  4IFD G;  2OT2 A;  4K5X A;  2XVS A;  1QE6 A;  3KLS X;  2SEB D;  4ZKB B;  1L0Y B;  1LTR D;  3M4O B;  3A56 A;  2NUC A;  4FVM A;  2F0J A;  1BCP C;  5KYI A;  3R2T A;  5M3M B;  5CGK A;  1K83 B;  2IT1 A;  4ZLT F;  4QCL A;  3K7A B;  1STY A;  1HTL D;  4KHV A;  1HXY D;  2J4X A;  3KBG A;  3NK9 A;  1GHK A;  1VMC A;  4TQU S;  4OL7 A;  4CJ0 B;  1SBB B;  5COY A;  2F0V A;  4WJW A;  5FLX L;  4XQQ A;  4NP5 A;  3VR4 A;  3NE5 B;  5EJW A;  1FGB D;  2KVM A;  3V05 A;  2EY1 A;  1PZK D;  4FP5 D;  3J80 E;  1BR9 A;  1JC7 A;  1O7L A;  5CYU A;  2L9H A;  2CQA A;  3C3L A;  1SJE D;  1KDC A;  2Y0S B;  3OMC A;  1WCM B;  3WOE A;  5G3L F;  2PO4 A;  3O13 A;  3SE0 A;  2F0M A;  1LT4 D;  1O7Z A;  1YNN D;  4FF1 A;  5ISR A;  2WIN B;  3G7L A;  1G2S A;  3VR3 A;  5IGC A;  5E1F A;  1GHJ A;  1VF5 C;  2WKD A;  3Q22 A;  4R9W A;  4IN3 A;  2HCC A;  2DY8 A;  3K0Y A;  1B1Z A;  3NHH A;  1F9S A;  1V1P A;  2RDF A;  1DXM A;  2JEB I;  3ND9 A;  4Q0F A;  3FKI B;  5IGF A;  4ZUI A;  3FVQ A;  1KLU D;  4DF7 A;  5KEE A;  1K8O A;  4CGY B;  2XRS D;  1F9Q A;  1YNN C;  1ET9 A;  3R93 A;  1UUP A;  1Q1B A;  4O1N A;  2EYO A;  2RKS A;  3HOZ B;  5I9P A;  2QCP X;  5M5Y B;  1K8M A;  1R9T B;  1F2Y A;  2R92 B;  2PCF B;  3D31 A;  4WFN 3;  4DNT B;  4ABN A;  1LT6 D;  3RLF A;  3L7Z C;  3K58 A;  1BXT A;  3NSW A;  2B2W C;  2PNR C;  1HUM A;  2JP1 A;  1ZEQ X;  1BUV T;  2HDL A;  3OWF A;  1TWG B;  5IGE A;  5TSS A;  1H9S B;  1F2M A;  4R8N A;  1F2L A;  1AEX A;  1OXU A;  2L0C A;  4DA2 A;  3DMU A;  1TKW B;  3FMC A;  3GV6 A;  4DN4 M;  3S17 B;  2B2V A;  1V43 A;  3NQI A;  1SYB A;  1S5B D;  5K36 H;  3URY A;  3NTI A;  2RSO A;  1GJX A;  4FXK C;  4XIG S;  5E4W C;  1TWC B;  3RZD B;  4KMU C;  2K05 A;  3C1E A;  4G7H C;  3U9O A;  5ELF A;  2NZ1 D;  3CU7 A;  2ZT9 C;  3I3C A;  1XX8 A;  4ODG A;  5LL6 X;  2PYK A;  1I4H A;  4WOR A;  1IKL A;  2IL8 A;  5DEH A;  2TSS A;  3HGB A;  1FR3 A;  3R8B A;  5BN5 A;  3I4L A;  4XYQ A;  2ID0 A;  4A3J B;  2K01 A;  1EFI D;  2B2Y C;  1U9R A;  4M8A A;  1A15 A;  3HOV B;  1JOK A;  5JJZ A;  5IGB A;  2F0E A;  1EYC A;  2C9O A;  1X32 A;  2JA7 B;  2E74 C;  2EY5 A;  4HR7 B;  1MSG A;  4X3T A;  4G4K A;  5E3F A;  1W6J A;  3TME A;  1TII D;  3EJI A;  2IX1 A;  2EYH A;  4XQJ A;  2BA0 A;  2K33 A;  3Q6S A;  1O80 A;  1SE4 A;  3GTQ B;  2NTS A;  2WII B;  4C3J G;  3T4A C;  4KN7 C;  2NBF A;  5CV5 A;  1ICW A;  3BVZ A;  1PTO F;  2A5H A;  1D1K A;  3H3V C;  1A3V A;  3BYY B;  1TY2 A;  1H9R A;  3E6Z X;  4I7Z C;  2L12 A;  3CRK C;  3M7N A;  5DM6 3;  5FKA C;  4A3D B;  2CW0 D;  1RDP D;  3S2D B;  1STH A;  5AFW A;  4PQX A;  2HCI A;  4A3I B;  1LTS D;  3SK4 A;  3A7L A;  2KEE A;  2O5J C;  4HMI A;  1EU3 A;  2WKC A;  4A3E B;  1STG A;  2KEC A;  3GTJ B;  2K5D A;  5JEA J;  1I6H B;  2RQX A;  2NB0 A;  1CTM A;  1SE2 A;  2MPM A;  3Q0A A;  5KNB A;  2BOS A;  1HCZ A;  3H0G B;  5IT9 E;  3HEJ A;  5CC4 A;  5I6W A;  2CW0 C;  2R7Z B;  3LNN A;  3L9A X;  2VNU D;  2RSN A;  5HGT A;  3AMU A;  1KNA A;  2B8G A;  4PMB A;  3NXW A;  1A3U A;  5C6A A;  1J9O A;  2TMP A;  3S1N B;  2ENB A;  3J81 L;  4IFD I;  4B9X A;  4GZY C;  4RHR A;  5J39 A;  2FFK B;  2I46 A;  4KTA A;  1UNS A;  4FF2 A;  3SVM A;  2D62 A;  2F0P A;  1EQV A;  3TDQ A;  1ZKO A;  4HCS A;  2BDO A;  1SEB D;  1HA5 A;  1VDZ A;  1DD2 A;  3GTK B;  2JSO A;  2R6G A;  1RCV D;  4C3I G;  3K5O A;  1KTK A;  2X6L A;  1CZG A;  1JE4 A;  3C1F A;  3EFX D;  5E4X A;  1PRT F;  1KDA A;  5F2D A;  1PFN A;  4U68 A;  1QIL A;  1EY5 A;  5FO8 B;  1F77 A;  1STA A;  1U4P A;  5FO9 B;  4BA2 I;  2M9V A;  4KKU A;  4HSP A;  3MVV A;  5FO7 B;  1GUG A;  1PTO B;  1IKM A;  4K5W A;  1PDQ A;  3U9S A;  5CV6 A;  1TQO A;  4ME5 A;  4C1N I;  3VR2 A;  2L11 A;  2EXZ A;  5J22 A;  2F0L A;  2AUK A;  3IFT A;  4H0L C;  3CRL C;  4KKS A;  3TZD A;  3NP8 A;  2JA5 B;  3SXH A;  3NBH A;  4S3S A;  2O4X A;  2DNE A;  3A7A B;  3NTH A;  1EZ8 A;  5C4Z A;  4RA8 A;  1SNP A;  5D3I B;  4B08 A;  5K36 G;  3HKZ B;  1ONL A;  1PYW D;  2F0F A;  5I9O A;  3GD7 A;  3HP3 A;  3FPP A;  4KY5 A;  5C4J B;  1XYI A;  2XIW A;  4FXD A;  3DEP A;  3E5S A;  3V96 A;  1HQM C;  3LWE A;  1IW7 D;  1LO5 D;  1LAC A;  1PLF A;  3EVQ A;  5M5X B;  2B2W A;  2OXP A;  1B9M A;  4L6T B;  2JXM B;  5FOB B;  2B2U C;  3PUY A;  1W6K A;  3PIP 3;  5FLX E;  3IKJ A;  4WRD A;  3SDZ A;  1STB A;  1EL0 A;  1DYQ A;  3VYR A;  5EQ0 A;  1BBX C;  4F88 A;  4RKB A;  5DM7 3;  1HPC A;  3LX0 A;  3P1H A;  5ELB A;  1LTI D;  4G7Z C;  1FD7 D;  3MFG A;  4C56 C;  3BDO A;  2Z8L A;  4QIW B;  3GTO B;  3GO5 A;  2IW3 A;  4DAV A;  1XTC D;  3BS1 A;  5D3D A;  5NUC A;  4KI0 A;  3ITP A;  4U67 3;  1CZW A;  4IUQ A;  3I72 A;  2XWB B;  1DJR D;  1PRT B;  3D4D A;  1MSH A;  1RF2 D;  4BY7 B;  1PTO C;  2F4I A;  4EVO A;  3SK8 A;  1S5D D;  1Z47 A;  4DNR B;  2NVT B;  4NMZ A;  4X3U A;  1PZJ D;  1I3Q B;  2ZXO A;  1HFG A;  2J0T D;  2PPB C;  3SR1 A;  1SND A;  2FJ2 A;  2RBM A;  2CVR A;  4RCO A;  1LAB A;  1EZ6 A;  4Z9C B;  2E75 C;  3NWT A;  3ONA B;  3J7A F;  2N55 A;  1Z7T A;  2A74 C;  2OF1 A;  4QMG A;  4C2M B;  4J6H A;  4O42 A;  3BDC A;  1CQF A;  2BE5 D;  1GUO A;  2IJ0 A;  3MEH A;  2BA1 A;  2WV6 D;  1NSN S;  2NVY B;  5A2Q L;  3SK6 A;  3D6W A;  5J1Z A;  2EYJ A;  1XWE A;  2AQ1 B;  2LKV A;  1CHQ D;  2RA4 A;  1WD1 A;  4QF4 A;  1OO9 B;  2PW7 A;  1JOQ A;  5CV9 A;  2EJM A;  1RD9 D;  2XSC A;  3NPP A;  4H13 C;  5CMD A;  3I4M B;  2E76 C;  2A73 B;  2XN9 C;  4RFB A;  4TKO B;  3SHL A;  5JVH 3;  2BE5 C;  3IAY A;  1ET6 A;  4IUU A;  2RVL A;  2F0N A;  2FMM A;  2FHT A;  4KJO A;  2O5I C;  1LLR D;  3A8K E;  3OIP A;  2MHV A;  5EBC A;  1I4Q A;  1SSO A;  1J8I A;  1WTP A;  1S5F D;  1EY7 A;  2PZT A;  2EYF A;  1H9M A;  3P7J A;  5JEA G;  4BY1 B;  4R8I A;  3FRP B;  2DNC A;  2F0S A;  1PMR A;  2FIN B;  5LL6 S;  1PRT C;  5EBD A;  4XXE A;  2X6G A;  3MA2 B;  1ML0 D;  4F8M A;  3N6R A;  1CHP D;  1EIG A;  5EKK A;  5EPK A;  1JOO A;  5K5P A;  1B2T A;  1U4L A;  5BN3 A;  5JAV A;  3CQZ B;  5D65 A;  4KJN A;  2IWH A;  2B39 A;  3C2P A;  2QKI C;  2L1B A;  2EYL A;  4V19 0;  1PTO H;  3TP8 A;  3GTM B;  1TR5 A;  2AUJ D;  1DCZ A;  4K2L A;  1M8A A;  3F2U A;  4ZRZ A;  3OOC A;  3S1R B;  2D5D A;  2EY6 A;  3E0J A;  1JWM D;  1LV9 A;  4A3K B;  1V8Q A;  3BDL A;  2EJF C;  3PUZ A;  3MC0 B;  3X3N A;  1RTO A;  3ERO A;  1SFO B;  2H1E A;  2IX0 A;  2YYZ A;  2NN6 H;  2OEO A;  3A54 A;  1HUN A;  2NWG A;  3S15 B;  1V1P B;  5A35 A;  2KHS A;  1I4X A;  3NBI A;  4K2K A;  4CHT B;  5CV4 A;  1UEA B;  4RKL A;  4HTH A;  3TBI B;  5FK9 C;  3T56 B;  1ESR A;  4J8Q A;  4OO1 H;  1KLG D;  1C4Q A;  5KIX A;  5C0X H;  1STE A;  1L0X B;  2BDN A;  4DXG A;  2EOT A;  2F0U A;  2KJX A;  1E2Z A;  1CA5 A;  3I73 A;  1B3A A;  1RJT A;  2VXW A;  5D14 A;  5M5W B;  3PO2 B;  2Z4H A;  4CKC A;  1WTW A;  3PO3 B;  3J81 E;  4BS9 A;  1DOL A;  3CKI B;  4C3J B;  3DM1 A;  1IYU A;  3N52 A;  1Y8N B;  2A6E D;  2K7V A;  2B2U A;  3OIQ A;  5ELC A;  2PMZ B;  2EE1 A;  5BN4 A;  1SAP A;  4KY6 A;  1II3 A;  2IX3 A;  2ICI A;  4I65 A;  1FYC A;  2SNM A;  1ESF A;  3OMG A;  3TZU A;  1A2T A;  3W3A A;  5EKI A;  3I4N B;  2F0O A;  4PNY A;  2QIL A;  2QF7 A;  3QJY A;  1QCB D;  3FPU B;  4FYD A;  3DWQ A;  4K8I A;  5DAU A;  4AYB B;  4IUV A;  1QB5 D;  3GQB A;  4A93 B;  4XQN A;  1WVL A;  5I2X A;  2NYZ D;  1YNJ D;  2A6E C;  4XT1 B;  2QEJ C;  4DXF A;  5JOB A;  1T5X D;  5G3L D;  2EJG C;  1T5E A;  1TVX A;  2D9U A;  4HCE A;  1CT1 D;  3D4R A;  4QUC A;  1JOR A;  4P2C B;  1D5X C;  4C3H G;  1SYC A;  3G6J B;  4BBS B;  1H9K A;  2EPB A;  3D3R A;  2EDG A;  1JR0 D;  1EQT A;  4C1N K;  5M3F B;  1ENF A;  4FNF A;  4RAU C;  2Z4I A;  1I4R A;  4IQZ A;  1YNJ C;  3NQT A;  3DHQ A;  3AB9 A;  1TT2 A;  2KCC A;  2WAQ B;  1LT3 D;  4RWS C;  1Y1W B;  1S4Z A;  3DWA A;  3BYT B;  2LY7 A;  2N88 A;  1SNQ A;  2K32 A;  3PUV A;  1R4Q B;  5LHY 1;  1MBY A;  4DK0 A;  3T16 A;  3GTP B;  2C5C A;  3NUC A;  2AWN A;  3T53 B;  3A8J E;  3HG9 A;  1TWA B;  1HFN A;  3EQL C;  1C8C A;  4B9W A;  3Q24 A;  4FXG C;  1EY6 A;  4G57 A;  5KRU A;  4LMQ D;  2SNS A;  1PFB A;  3HZX A;  2BCO A;  4C3I B;  3MXN A;  1EYA A;  3VYT A;  4NDX A;  4TRD A;  3VA5 A;  3TP7 A;  3RD4 A;  1GUT A;  3GP7 A;  3AU7 A;  3K5M A;  1E2V A;  2F0W A;  3QB3 A;  5M9O A;  4RGN A;  5JPN C;  1BQQ T;  2JA8 B;  2B2V C;  1WTR A;  1JWS D;  4XTC S;  1U4M A;  2ZXP A;  3SK5 A;  5KGU A;  1SYG A;  4CKE A;  2K03 A;  1VCI A;  1EIH A;  2XRQ D;  3MWY W;  1BCP B;  1WTQ A;  4KV6 A;  2F0I A;  1X3P A;  1HQR D;  2E2D C;  2KED A;  1SMY D;  1EY9 A;  4MIU A;  2G9H D;  1XXG A;  1OXX K;  2HUG A;  3MXP A;  1B50 A;  1FNV A;  3ZYY X;  3EA6 A;  5C3X A;  1KDB A;  1AFP A;  2L55 A;  2B2T C;  5C44 B;  3A8I E;  5ELE A;  1E0B A;  4IUT A;  2EYP A;  3ND8 A;  3OSO A;  2Q8I B;  1MI2 A;  1SMY C;  4EQO A;  4HN7 A;  4OO1 G;  3IFD A;  4EQN A;  1RTN A;  1PTO D;  1R4P B;  5A2Q E;  2V4D A;  2R93 B;  1I50 B;  5JVG 3;  1NCV A;  2CHB D;  1UAP A;  4OGQ C;  4FF3 A;  2PZU A;  1AW7 A;  4ZYS A;  2A69 D;  2HQE A;  1BNZ A;  4ZUJ A;  1Y8P B;  1EY4 A;  2LS0 1;  1Q3L A;  3BG3 A;  3CHB D;  3QWN A;  3JAM L;  1MGS A;  4A3M B;  2F0K A;  1EY0 A;  5EPL A;  2X69 A;  5T1G A;  3KF8 A;  4ID6 A;  3MXU A;  2B2Y A;  1DOK A;  4CJ1 B;  5CV7 A;  4IZ8 A;  2AQ2 B;  1LTA D;  3T13 A;  1CQV A;  3K59 A;  2A69 C;  3I70 A;  1FNU A;  3TP5 A;  4RGO S;  1CM9 A;  2AWO A;  3NTK A;  1TWH B;  5EGT A;  3OWE B;  4KD3 A;  1A2U A;  1A3T A;  3HRZ C;  4RHS A;  3VA7 A;  2DY7 A;  4DU9 A;  3P20 A;  4LAA A;  1ENA A;  4XYO A;  1GUN A;  4BA1 I;  1E2W A;  1TU2 B;  2Z1C A;  2F3W A;  2ICE C;  1HRJ A;  1EWH A;  2KA7 A;  1CA6 A;  2DN8 A;  2A68 D;  1WTO A;  3D6C A;  3BVG A;  2FMC A;  2LFN A;  1EOT A;  1ENC A;  4Y7N B;  4J1M A;  1JB3 A;  1QNK A;  2R3Z A;  1H9S A;  3K6O A;  4F87 A;  1Y69 U;  1PRT D;  5C4H A;  1OXV A;  4ZAI A;  4IUP A;  1JCK B;  1QOH A;  1ZXT A;  2SDF A;  4X3K A;  4KN4 C;  3FEW X;  3C46 A;  1ILP A;  2YU9 B;  4HAE A;  2A68 C;  5KNC A;  2KQ3 A;  3MHB A;  3H91 A;  3J7A V;  1SXT A;  2IPK D;  1TS2 A;  2JE6 I;  4V0B A;  3I91 A;  2EZV A;  2GA4 B;  4CKB A;  2SOB A;  3NWS A;  1AN8 A;  1B53 A;  5EPJ A;  4LK1 C;  1DON A;  3RMH A;  5CV8 A;  4F7X A;  1SYE A;  5C0X J;  4MHE A;  1IYV A;  1EYD A;  1SJH D;  2WB1 B;  2K5Q A;  5IGG A;  3QOJ A;  1JQY D;  4DAP A;  2A6H D;  1TS3 A;  1VF7 A;  2JYO A;  1AZQ A;  1LTB D;  3J7Y W;  2E2I B;  1B44 D;  1G8Z D;  4DFA A;  2MP1 A;  2K5W A;  2KOL A;  1GOZ A;  4N9P A;  2XNA C;  3J80 L;  3L3O C;  3SEB A;  2F3V A;  1BO0 A;  2E2H B;  2R61 A;  4YIJ A;  1MD2 D;  1U4R A;  1G91 A;  5C5M A;  4ULL A;  5C3W A;  1PXU A;  2WAC A;  1A6X A;  4K6D A;  2F0T A;  2D2C C;  2A6H C;  3TP6 A;  3DXJ C;  3GTG B;  3GV3 A;  1DZ1 A;  2B63 B;  4IFD J;  3S16 B;  3W2D A;  1BDO A;  3M3Y B;  1VMP A;  4A3F B;  1EU4 A;  4ILW A;  2H4O A;  1SNO A;  3ERQ A;  1LT5 D;  3LWU A;  1NUC A;  1STN A;  1EWC A;  4LJZ C;  3H6M A;  2MGS A;  1JIC A;  5COR A;  1EEI D;  4A3B B;  1HHV A;  1DM0 B;  1TS4 A;  5IOC A;  5ELD A;  3S14 B;  4HSV A;  1QNU A;  2ZXR A;  3V2T A;  1FNW A;  2HDM A;  1G29 1;  1TWF B;  3QIA A;  2F0G A;  1GUS A;  3UI2 A;  3PIO 3;  1G6Z A;  3S2H B;  4PMC A;  2RDH A;  2B2T A;  4M1U B;  5IGD A;  2MJ8 A;  1KAA A;  4ZQ3 A;  3GTL B;  1GXD C;  2WP8 J;  1GUW A;  2K6A A;  3BVM A;  2PW5 A;  2NTT A;  3DWP A;  5C4X B;  2O2L D;  2LMC B;  4KK7 A;  1CFM A;  4ZK9 B;  2Q8R E;  4K14 A;  3MZ5 A;  3D8G A;  4RH6 A;  2PQE A;  3HOY B;  3K57 A;  3Q23 A;  1M4V A;  4K8J A;  1SNC A;  4OIJ A;  5JPM C;  1SYF A;  1B9N A;  1HTP A;  2NN6 I;  3BZD B;  1BCP F;  4IFD H;  1B4O A;  5CBA E;  3PUW A;  1IL8 A;  4A3G B;  4RCN A;  3DUZ A;  1JWU D;  4DK1 A;  5HUR A;  1D5Z C;  1I6V C;  2Q8T A;  4EGV A;  3WDN A;  4OO1 I;  2VB3 X;  1WTX A;  5C0X I;  1KAB A;  1Q90 A;  4ZKC B;  3KBX A;  2F0Q A;  4KD4 A;  1V1O A;  5I2Y A;  1RKN A;  4PV1 C;  3A55 A;  3X3M A;  2B8F A;  3VR6 A;  4C3H B;  5C3E B;  1PFM A;  5C5L A;  1Y8O B;  3OW7 A;  4IUR A;  1PZI D;  5I4D A;  1X3Q A;  1O7Y A;  2XWJ B;  2KCN A;  4XT3 B;  3OHX C;  1CK1 A;  3PUX A;  3HOX B;  4UAI A;  1OXS C;  1WTV A;  3WOF A;  2M00 A;  2JA6 B;  4FO2 A;  1F9R A;  2K28 A;  3HS0 C;  1H9J A;  1NAP A;  1ILQ A;  3KLR A;  4OIK A;  3VYS A;  4FF4 A;  3S1M B;  3T51 B;  5KYL A;  3M4Y A;  2L4N A;  1LTT D;  4PMW A;  4E6I A;  1S5C D;  4NW2 A;  1QJO A;  1D5M C;  3MFY A;  5IIF A;  1ROD A;  4DGZ A;  1TS5 A;  3M85 A;  2NVQ B;  1BOS A;  2VB2 X;  2PZW A;  2F03 A;  2KUM A;  1NR2 A;  5EKL A;  2G9D A;  1C48 A;  2J7Z A;  4RGT A;  3QO2 A;  1IHZ A;  1QWY A;  5JEA H;  5T1I A;  5I6Y A;  1SE3 A;  1LTG D;  3PMF A;  2L5T A;  1G2T A;  4X3S A;  2MUY A;  3JAM E;  3H09 A;  4K5V A;  2RDG A;  3QOL A;  3VYU A;  3MTS A;  1AP0 A;  1Y1V B;  1AZP A;  3I8Z A;  3KLS A;  1EEF D;  4IAL A;  5IT9 L;  4RGM A;  3H94 A;  3R2I A;  1EY8 A;  4H7B A;  4QB4 A;  1Q8I A;  4QUF A;  4OHJ A;  4K6L A;  1DOM A;  3VR5 A;  2K04 A;  1TY0 A;  4BBR B;  4NKL A;  2EY2 A;  3IL8 A;  4N9T A;  1Q12 A;  5CR3 A;  3OPO A;  1NR4 A;  3HOU B;  4KKT A;  1OXT A;  3DEO A;  2M2L A;  3D4W A;  3HOW B;  5KND A;  1F9P A;  4L8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...