3OSOA

Crystal structure of staphylococcal nuclease variant delta+phs l25a at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKAMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3osoA00
3HEJA 3SHLA 3SR1A 5KYIA 4HTHA 3D4WA 2OXPA 3RUZA 3D8GA 4S3SA 2F3WA 5J1ZA 2QDBA 2F0IA 4ODGA 4K6DA 3SK5A 1A3UA 4K14A 5KYLA 4ME5A 1SNCA 4EQOA 1SNOA 5J22A 3MZ5A 2F0WA 2PW7A 1EYCA 5CV8A 2RBMA 3SK6A 3NP8A 4F7XA 4RKBA 5ISRA 2PZUA 5I6YA 2PYKA 1A3VA 5KGUA 1NSNS 2EY2A 2F0MA 5IODA 2EYJA 1EZ8A 5IIFA 2F0UA 1EYDA 1STAA 5C3XA 1KAAA 2KQ3A 2F0TA 4ZUJA 1EZ6A 1AEXA 1F2YA 3PMFA 1RKNA 1STHA 3C1EA 5IGFA 5KRUA 1SNDA 1EY6A 2EYFA 2KHSA 4WORA 5IGEA 5IOCA 2O4XA 2EYPA 1SYDA 3TMEA 1EY9A 5I6WA 5K5PA 1U9RA 3DHQA 1IHZA 2EY5A 2ENBA 4PMBA 4J6HA 1EY7A 5IGDA 4K2KA 2PZWA 4NKLA 3TP6A 4F8MA 3OSOA 2F3VA 3P75A 5NUCA 2EY6A 1EY5A 2F0PA 3QOLA 5E1FA 2EY1A 3NQTA 4LAAA 2LKVA 1KDAA 2RDFA 3OMGA 4YIJA 4DF7A 2PQEA 2PW5A 2F0GA 1EYAA 4EVOA 3C1FA 4NMZA 3VA5A 4R8NA 1TQOA 4NP5A 5CGKA 3QB3A 4KY6A 5CR3A 4KY5A 4K5VA 5EKKA 5C5MA 3R3OA 2EXZA 2SOBA 3MVVA 2RKSA 1STNA 4KD4A 5CV6A 1KABA 1SNQA 2F0SA 5F2DA 5C5LA 4DFAA 4KJOA 5I9OA 2F0VA 1STBA 2F0OA 5CV4A 3TP7A 4TRDA 1STGA 3QOJA 4G57A 1KDCA 5KEEA 4NDXA 1ENAA 3MHBA 3U9OA 3ITPA 4ZUIA 2F0FA 5C3WA 4B9WA 4KD3A 5EKLA 3T16A 4EQPA 3NHHA 4K5XA 2EYHA 1KDBA 2F0HA 4KHVA 2OEOA 4KTAA 3SXHA 3V2TA 2F0EA 5C6AA 1SNMA 5CV5A 3BDLA 1EY0A 1JORA 3P1HA 2F0KA 4IALA 4RKLA 4DGZA 5IGGA 5HGTA 3EROA 1SYEA 5IGBA 4K8JA 1SYBA 4KY7A 4ZQ3A 4IUNA 4EQNA 3TP8A 5CV7A 3H6MA 2WACA 5C4HA 5E3FA 2HQEA 1TR5A 5M9OA 1A2UA 1II3A 2F0DA 3LX0A 3MXPA 5CV9A 5DEHA 3ERQA 4N9PA 1F2MA 4K5WA 3D4DA 4KJNA 2EYLA 3OMCA 4KV6A 5C4ZA 4ID6A 3SK4A 2M00A 1ENCA 2F0QA 4QB4A 4PNYA 4WRDA 5EGTA 3BDCA 2F0LA 2SNMA 3D6CA 4H7BA 3MEHA 1A2TA 4HMJA 3NUCA 1NUCA 4QF4A 1A3TA 1SYCA 3EVQA 4HMIA 2F0JA 3SK8A 5HURA 4DU9A 2NUCA 1JOKA 3E5SA 5DAUA 3DMUA 1SNPA 4I65A 4N9TA 1SYFA 5KIXA 3S9WA 5IGCA 2F0NA 4B9XA 5J39A 1EY8A 1JOQA 2PZTA 3TP5A 5CC4A 5JOBA 3T13A 4PMCA 4QMGA 4MIUA 2EYMA 4K8IA 4OL7A 3NK9A 2EYOA 1JOOA 1EQVA 4E6IA 1TT2A 3OWFA 4IZ8A 3EJIA 1SYGA 1STYA 5JAVA 5I9PA 2SNSA 3NXWA 3HZXA 2OF1A 4J1MA 4K2LA 1F2ZA 1EY4A
chains in the Genus database with same CATH superfamily
1I4HA 1STEA 3J7YW 3RUZA 4DR3Q 2F0IA 2NTSA 5E4WC 4GNXA 4H44C 1SNCA 5J22A 1SE4A 2Z4HA 1SEBD 2UXDL 3KDFB 4RKBA 4DV0Q 3TQYA 5IIFA 1STAA 2N3SA 2HIXA 4UDUC 2KBNA 2B2UA 2BE5D 2GN5A 4DV4Q 1XPUA 2Z6KA 4X3UA 3NWSA 2EY5A 1F9QA 2H1EA 3TP6A 4IPDA 3OSOA 2QCPX 1I5FA 3FPPA 3HG9A 4A3JH 1TS3A 2A6HC 4CDDC 2JP1A 3PUYA 2K5VA 4NP5A 1AW7A 4X65L 3IFDA 2RCFA 1KNAA 3HS0C 1T5XD 2X6LA 5F2DA 1I6HH 5I9OA 1SRUA 4GN3B 3RZOB 4Z9CB 4A3JG 3W5OA 5DM63 5C3EH 5C3WA 3T16A 1Y1WH 3C46A 3SXHA 4A3GH 2IL8A 3JAML 2VS1A 2HCIA 5D3IB 3HOZH 4L8JA 4IALA 2E2JB 2AHOB 3GTGB 2LSSA 5HGTA 3EROA 1WFQA 5LMUQ 4XDXA 5C3EG 4QIWB 4A3EH 3VR2A 2V4DA 5GAEC 1BF4A 4A3GG 1F2MA 2NVQH 3CKIB 2DJGC 4DV1L 3HOZG 1EEID 2M00A 1ENCA 1NBWA 1X55A 4QB4A 3D6CA 1EQRA 3MEHA 1IYVA 4LF6L 4A3EG 4HMIA 1UE5A 3WDNA 3SK8A 4HN7A 2G5DA 3DMUA 3DWQA 1CSQA 4PZ6A 3G7LA 1YJ9A 1ENFA 3M4PA 1IBKQ 1UNSA 5C44H 1TWAB 2D62A 4MIUA 4P71A 3I2ZA 1LUZA 2CVRA 2E5LQ 1LTRD 1ML0D 4R1JA 1BNZA 3HZXA 1PH1A 2HD3A 3DUZA 3NHHA 3HEJA 2OTJA 5KYIA 4DAYB 4HTHA 2EQSA 5IWAL 2R92H 1E1TA 4EQ5A 5C44G 4DV5L 2JXMB 4ZK9B 1MIUA 2I07B 5M5YB 1C0AA 3F8TA 2PW7A 1EYCA 1VQNA 1F77A 1FNUA 5FLXE 2UUBL 2B2UC 2XTIA 2JEAI 3S1MH 5EKIA 1EYDA 4JI7Q 3MWYW 2YTVA 5C3XA 2Z6KC 3OYYA 2AWOA 2R92G 3T53B 1LTGD 1CFMA 2G9DA 3G6JB 1HH2P 4RCNA 1YHAA 1YZ6A 3A74A 5GADC 3OTOQ 1R9TB 1RTOA 3CCUA 2NN6I 4ILWA 4NXMQ 2E2IH 2K5WA 5H1SE 1KDAA 4DR2L 3S1QB 1I94Q 3J7AF 3SE0A 3KF6B 4QJFA 1YHBA 2WB1E 1LV9A 4YWKA 1Q46A 1S5CD 1PXUA 3H0GB 4C3HH 1SNQA 3S16H 2KUMA 4LFAQ 4C2MB 1ESFA 3AEVA 1BBUA 1JE5A 5ELOA 1K0SA 2WAQE 4EQPA 3HOYB 1FYCA 2EYHA 3K7AB 4RMFA 1M4VA 4X64L 5CBEE 1Q7YC 1PH5A 4IURA 4A3MH 2WIIB 2WACA 2NVYH 3I72A 2DN8A 3LX0A 1BO0A 5K36G 1WI5A 2RA4A 1KQSA 1FNVA 1PDQA 4DR5Q 4NW2A 4ZYSA 3J81c 3G71A 3S1NH 2JA7H 4ID6A 1XTCD 3CF5A 4H7BA 4WJWA 5JPMC 1PH9A 2XNAC 3HOUG 1VQMA 3TS2A 2DNEA 3EQLC 4CGYB 3I8ZA 1A63A 2A74C 1CK1A 3TZUA 4DA2A 1DOLA 2PMZB 2JA7G 3ZYYX 1Q1EA 4BA2I 1PRTC 2FMCA 2ZJQA 4DAPA 4DV2Q 3F1ZA 1EQVA 1SFOH 3ND9A 4JI6Q 2BDOA 2OF1A 3PUZA 1G6ZA 1HHVA 3QJYA 2CH4W 2OXPA 4AIMA 4DV3Q 1SMXA 1F9RA 4OHJA 2L0CA 5JVG3 5C4XB 3VA7A 3GTPB 4LUZA 2E2HH 4FF1A 1RHPA 3W3AA 2KJXA 1BXTA 5KGUA 1NSNS 2N78A 2IT1A 1B3AA 4PZ7A 1LM0A 1EEFD 1VQ4A 3RMHA 1S5BD 1X3PA 1DD2A 2KHSA 1SJHD 1AZQA 4G7OC 1TS5A 2A68D 4TSSA 1CA6A 5LL6X 1TWCH 3RLOA 4K2KA 1Y1VH 1PTOB 3P75A 4RFBA 4UP8A 1XMQQ 3QOLA 4LAAA 4BBSH 4JYAQ 1S5DD 5GAGC 2IHEA 3M4QA 3QWNA 2CHBD 1SJED 2F0SA 1HUMA 4JC0A 4ULLA 4OGQC 2RDHA 2ZM6L 4UY8C 1M8AA 1VMPA 4IUVA 3N52A 4NDXA 3S2DB 5LMNQ 1EOVA 4BBSG 2NVTH 2PI2A 4K5XA 3V05A 1X56A 2F0HA 2K03A 3S14H 2Q2IA 1QUQB 1YI2A 3J80E 1KLUD 1HA6A 1M90C 4XIGS 1N36L 3D3RA 1JB7A 4HCSA 1D1KA 2MUYA 1OO9B 1EOTA 3NQIA 1C9OA 1VF7A 2GVBA 2IHFA 4GNXB 1I4QA 3HOWB 4LW1A 1II3A 2WAQG 3G48A 3GQBA 3MXGA 4JI2L 1G2SA 2QILA 4XQJA 4AYBE 1X3FA 2IJ0A 4DNTB 1E0BA 3M4YA 4G7ZC 1QG7A 2O5IC 3KDFA 4YHHQ 1DZ1A 5FLMH 1XNQQ 4OEMB 2MO0A 2R7DA 2Z1CA 1CTMA 3FEWX 4B3TQ 4LF7Q 3G4SA 1QVGA 2PNRC 5EBCA 3KBGA 3S9WA 4LF8L 3U9SA 3I91A 1BBWA 1YVCA 2EPBA 3B6YA 1QWYA 1GUNA 1LT6D 4K8IA 5FLMG 3JAMc 1X32A 3D4WA 3H94A 1RF2D 1EY4A 2VQFQ 4R4QA 2ASBA 5C4HA 2JA5H 5A2QE 2QDBA 1AP0A 2BOSA 1H9MA 1GOZA 2Y0SB 3PSIA 3W1BA 3CRLC 5I4DA 1KRSA 4GKJL 1UE1A 2PYKA 3JC66 1EZ8A 2JA5G 1IW7D 2KQ3A 3FHWA 1LT5D 2B2WA 2RCNA 4K6LA 3K0YA 3NENA 4LMQD 2JA9A 1SNDA 1Q1BA 4P74A 5AJ3Q 1O7YA 4AQYQ 2A8VA 2EYPA 3MEFA 2QDLA 2A68C 2OT2A 4HSPA 2NN6G 1VS0A 2IPKD 2Q2UA 2OTLA 2L12A 2SEBD 1QB5D 2I5MX 3AQQA 4DUYL 1EYGA 3NQTA 5LL6S 3UDGA 3AB9A 2F0GA 1HQMC 3OIPA 4JV5L 4OO1H 2D5DA 2VL6A 4FXKC 3VR3A 1EWIA 2RSNA 2EXZA 3RZDB 1Q90A 2NBFA 4ZKCB 4XYOA 1N33Q 1ENAA 3NTHA 4LFCQ 5C6AA 4MZ9A 3BDLA 2F0KA 1S5FD 3I56A 3A7LA 3DEPA 1HZ9A 1MBYA 2RQXA 1SMYC 3OPOA 1HNWQ 2ZTEA 4IUNA 3VYRA 4IOAA 2R61A 4N8X1 4OXPA 1VQKA 4DAYA 3RLFA 1SDFA 5IYCH 3Q0AA 5AFWA 5IP7G 3S24A 3OWEB 1GHKA 3E6ZX 5T1IA 1WJJA 3M3YB 1N32L 3UDFA 2F0QA 2BA1A 2H5XA 4IO9A 1S40A 1XXGA 3EVQA 1PTOF 3KFUA 4JI4Q 4L5QA 3E9IA 1QOHA 4OX9L 1CUKA 2AQ1B 3HKZB 5EPJA 2I5LX 2J0TD 5HGQA 3GTLH 1IYJB 4F87A 3T13A 3H3VC 4DR6L 4OL7A 1B8AA 1TWHB 2JA6B 1WCMB 3LWUA 2EZVA 4XYQA 3PF4A 2VUMB 1JJGA 1F2ZA 2L5TA 1JICA 4JI5L 1UUPA 2F3WA 5EJWA 3ULLA 1YNND 1HNXL 3F2BA 4EQOA 3KF6A 4RAUC 3VR6A 4NPSA 3MZ5A 2B2WC 4ME3A 4BBRB 3IRBA 3CW2C 4L5RC 4GKKL 1YHQA 1XNRL 5IODA 4GLXA 2UUAQ 2R93H 2YV5A 3K5OA 1IW7C 3D31A 4QIWE 2HT1A 3UE0A 1QZHA 1HR0L 1SE2A 1WTPA 4A3LG 1RIPA 4QGUA 1GUGA 1IXRA 3BZCA 3TREA 1PYWD 2R93G 1Z9FA 4JI0L 3Q23A 1O78A 4NXNQ 1S72A 2RDFA 1U4MA 1PZKD 4LF4Q 1LTBD 1PFMA 2AWNA 3R8BA 1A8VA 4KY5A 5C5MA 4IPHA 2HDLA 4MNOA 3SVMA 2UXBQ 1SN8A 5M3FB 2ATWA 4U673 4KD4A 3RR5A 1KABA 5J3BA 5JJLA 1STGA 2F4IA 2JSOA 4A3BB 1C8CA 1DGSA 1ZYRD 1Q8KA 1E2VA 4KTAA 3OOCA 2HIVA 3KJPA 1EY0A 3P1HA 2XWBB 4Y7NB 1J5EQ 3R93A 2IX1A 3I4NB 5IGBA 2A6HD 3BG3A 4ZQ3A 1NR4A 3RN5A 1HRJA 1W2BA 1B4OA 3MFGA 5DEHA 3MXPA 1KAWA 3S15H 1IBLL 4IQZA 2EYLA 4L5SA 2AMCB 1IKMA 2YTXA 1I3QB 4Y52H 2R7ZH 1JJCB 4TQUS 2KHJA 3F2UA 4A3IB 1IBMQ 1CSPA 1EU3A 5ELEA 1A62A 1VQFA 2NUCA 3N6RA 3E5SA 3GTJB 3K6OA 4BS9A 1WTRA 2NTTA 5KIXA 1RTNA 4DR4Q 1JR0D 1PTOD 2XRQD 5IT9L 4KHPQ 2R7ZG 4IUQA 4JW0A 2NWGA 3QR8A 1AH9A 4DV7Q 1DOKA 5I9PA 1UE6A 1QILA 2K5HA 2K5NA 3SHLA 1QVCA 1UEAB 2K52A 2F3IA 2NZ1D 3D8GA 3FKIB 4S3SA 1YNNC 2K01A 1LTID 1Q12A 5ELNA 4A3FH 1DCZA 3GP7A 1PRTF 4XT3B 3A55A 1HA5A 2EDGA 3GTQH 2CWAA 3CMAA 1WTOA 1BCPB 1VQIA 4LF5Q 4DUZQ 1GXDC 2E2JH 2B63B 4FYDA 3PMFA 4A3FG 4KKSA 3GTGH 2KOLA 4O1NA 4F88A 1QUQA 2MNAA 4GS3A 5IGEA 3U50C 1SYDA 4A3KH 1SAPA 1HFGA 5I6WA 4K0KL 1QNKA 4F8MA 2KECA 3PO3B 4O2DA 3T1HL 5EBDA 4CKBA 5NUCA 1EY5A 2EY1A 4YIJA 1X6OA 1EYAA 2TSSA 1R4QB 2UU9Q 3L3OC 4A3KG 4A93B 1XMOL 5M5XH 2PMZE 3VYUA 1KRTA 2NVXB 2ZXRA 4B3RL 2NZHA 1XYIA 1Y8OB 3E9HA 5IT9E 3TBIB 4P73A 4HIMA 3CCRA 2VZAA 1UAPA 1JE4A 1TWAH 1ZYRC 1P8LA 1D1IA 4DXFA 2F0EA 1HZAA 1FJGL 5JPNC 5M5WB 1TU2B 3NELA 2XSCA 4MTKA 2WP8J 3NTKA 5L37A 4B3SL 3CRKC 4FP5D 3TP8A 4DK3C 3K0XA 4C3IH 3M4OB 1K3BC 3CQZH 2Q2TA 4FVMA 4HJ9A 1NAPA 1HNZL 1LTLA 1LTTD 4K5WA 4POFA 3TZDA 3MAQA 1E2WA 2A19A 3SK4A 1V1PB 2PQAA 3HOXH 3GTOB 2ICIA 1SYCA 4C3IG 2MPMA 4BY1B 5FLXL 4O0AA 4A3DB 1PV4A 4JI1Q 2BDNA 3PO2H 3HOVH 3LGJA 1XJVA 5ELFA 1SLJA 5IGCA 1R9TH 3J80i 1PTOC 3VYTA 1Y1WG 3HOXG 2EYMA 5CORA 4IZ8A 2MO1A 2K14A 2LXKA 1BR9A 1SYGA 1QCBD 3CCSA 3PO2G 1W6KA 4AH6A 3HOVG 5IYDH 1EWHA 5J1ZA 3VDYA 1AZPA 3NTIA 5JEAH 1A3UA 3S1RB 5KYLA 3CCLA 1SNOA 3DEOA 4RGMA 1ZKOA 3T4AC 1VQ5A 1MHWC 1JWSD 1HXYD 1B70B 5CV8A 1TWFH 3X3NA 2X69A 4DR3L 1PRTD 2UXCQ 1K8AC 5JEAG 1YNXA 3KLSX 1I50H 1I4GA 4GNXC 2O4XA 4QY7A 3CC2A 1IHZA 4PMBA 3VR4A 2XRSD 1EY7A 2PZWA 3GDEA 1V1OA 1GUWA 1C7YA 3DWPA 1Q86C 2A5HA 2LKVA 4DV4L 2OWOA 2N55A 1EUJA 1TQOA 5CGKA 4KY6A 4V0BA 1T5EA 2LMCB 2CKZB 4DFAA 1RD9D 4DNRB 1J6QA 1SROA 3EBEA 4A3JB 2F52A 4X3KA 2JA8H 4X66Q 4UPAA 1MSGA 2C9OA 1I6HB 2KCNA 1CHQD 2K4KA 1SYEA 5C3EB 2Y0SE 1U4LA 2QGQA 2JA8G 3GTPH 4A3GB 1Y69U 2Z8LA 1W3SA 3T1YQ 3HOZB 3D4DA 5LMUL 4BXXH 5JAVA 1HTPA 3J7AV 2RHSB 1OXTA 2EJFC 2QEJC 4A3EB 4OO1I 1E7ZA 3PUVA 1JT8A 4C3HG 1PYBA 2NVQB 4G4KA 1B2TA 1SNPA 4BXXG 1C48A 4B9XA 5J39A 2PZTA 5CC4A 4A75A 3OIQA 1PTOH 4JBMA 2LFNA 1XTDA 1H9JA 1SE8A 3AYHB 4O42A 4JOIA 2SNSA 4N8FA 2YYZA 2EXDA 4YWLA 3KJOA 4A3MG 4ZKBB 1IBKL 1IYUA 1RODA 5C44B 1UWVA 1L0XB 2E5LL 1LTSD 5FOBB 1YJWA 1PFBA 4UP9A 2MJ8A 1CQVA 1U4PA 4U68A 3T51B 3TN2A 4LF9Q 3A7AB 1AEXA 3A0JA 2R92B 4JCVE 4GOPB 4M1UB 1N36Q 1EY6A 5IOCA 3KLRA 3J80L 3TMEA 1OTCA 1U4RA 4JI7L 5TSSA 1EFWA 3HOWH 4LFBL 1IL2A 4IOCA 1E2ZA 4RCOA 1PH8A 2CW0D 4QL5A 4DF7A 2EJMA 1YBYA 3BS1A 2D2CC 3OTOL 4BY7H 4DR7Q 1VQ7A 4DR1L 1Y8NB 3HKZE 4JBWA 1WD0A 3QOJA 2E2IB 1CKOA 4OELB 1CI3M 1I94L 4LF8Q 1D2BA 3URYA 4KHVA 1KD1C 4BY7G 2IW3A 2OQ0A 3K7UC 4IN3A 5EAYA 3GV3A 4LFAL 3S16B 4HJAA 2SDFA 1VQHA 5FJ8H 1N34Q 4KN7C 3GTMH 1ESRA 1SR3A 3GTKB 3D4RA 5M9OA 4WJ4A 5CYUA 4L5TA 5A2QL 3IAYA 1Y1VG 2E74C 3OMCA 5C4ZA 1I4RA 1PLFA 1FD7D 4OONA 1LT4D 1RDPD 3HOUB 5EPLA 2VY3A 1CKNA 4POGA 2Q2HA 1SXTA 2OCEA 1A3TA 1PFNA 1PFSA 4DR5L 3X3MA 2F1MA 2WB1G 1EIYB 4B3MQ 3S1NB 1SMYD 2JA7B 5M3MH 4JOIC 4HAEA 4MN3A 2AQ3B 4PMCA 4QMGA 1L0WA 3J81j 4KKTA 3PUXA 4FXDA 3CHBD 4A3CH 1TWGH 3SR1A 3CCEA 1CZWA 3CD6A 5M3MG 3RZDH 1X54A 1AE3A 2BA0A 3SK5A 4I7AA 4DV2L 3M7GA 4JI6L 2L9HA 1GJXA 1SFOB 1VQGA 2PO4A 4OWXB 3F2DA 4A3CG 3CCJA 4DV3L 1DJRD 3KF8B 2Z4IA 1KAAA 3BYYB 3D6WA 5D3DA 4ZUJA 1F2YA 3EFXD 1QNUA 3V96A 3C1EA 5FLXc 2VB3X 2ID0A 1M1KC 4KHZA 3S17H 2VQEQ 2JK8A 4WJ3M 4DN4M 2CW0C 5E1FA 2IWHA 2QEXA 1O7ZA 2BH8A 2PQAB 3Q6SA 1N32Q 4RGTA 1K73C 5FO7B 1XPRA 1NJIC 3C2PA 2LS01 4FF3A 1YJNA 1CQFA 2ICEC 3R3OA 2K33A 1TWCB 1V1PA 1XMQL 4IFDH 2I5HA 4RG1A 1HJPA 5JJKA 1VQ8A 4BBSB 1K28A 5EKLA 4GN4B 1JQYD 4RHRA 3DLLA 1YEZA 5LMNW 4KI0A 5CV5A 4JBJA 2JA6H 1WCMH 1QVFA 2VUMH 4IFDG 4UP7A 4X62Q 1Z6HA 5I2YA 4C3JH 3MFYA 4JI5Q 1NY4A 3BVGA 3I3CA 4KKUA 2FMMA 1NMFA 2PI2E 3I73A 2HQEA 1TR5A 3G6EA 2WAQB 5FO9B 3J81i 2B2VA 3O13A 1BCPC 3A8JE 4KV6A 4C3JG 4ZLTF 1IL8A 4OO1G 2F0JA 2KCMA 1F9PA 2MGSA 4RHSA 1HZCA 3A5ZB 3H09A 1GHJA 4YHHL 4OWWB 1VQEA 1GUOA 2QW7A 2BCOA 1XNQL 4JI0Q 1HFNA 1D5ZC 4B3TL 4LF7L 3OWFA 5DM73 3NXWA 2PPBC 3I4MB 3FVQA 2M9VA 3BJUA 3HP3A 5BN3A 4K6DA 1A15A 4YY3Q 2UUCL 1V8QA 1SE3A 2F0WA 2L11A 4F7XA 1K3RA 5IYCG 5ISRA 2B2YA 1Q3LA 2VQFL 3TRZA 2KENA 2ALYB 2JA5B 4AYBG 3W2DA 1EZ6A 1TXYA 4DV6Q 2D0PA 1ET9A 1VQJA 2IX0A 2NYZD 2JE6I 3BU2A 3GD7A 5GROA 4A4IA 4C56C 3LWEA 1E22A 2LXJA 5EQ0A 5LHY1 2K6AA 2YU9H 3SDZA 5IGDA 4CJ1B 2F3VA 5AJ3L 4AQYL 1KHIA 4RGNA 1BUVT 1TS2A 3QB3A 5EKKA 3M85A 1V9PA 3GTJH 4JI8Q 1VQOA 1SBBB 4ALPA 2JYOA 3BZKA 4XQNA 4ZUIA 1XX8A 3STBD 1FL0A 4IJLA 4DKAC 1GUTA 4CDFC 2L1BA 1VQ6A 3IL8A 2HCCA 4KLKA 2KVMA 1HZBA 3FPUB 1BDOA 1K83H 1N33L 5C0XH 5IGGA 2B2VC 1JB3A 4LFCL 4BA1I 4KY7A 4XQQA 1BBXC 3NBHB 1O7IA 1EIFA 2L55A 3MA2B 2F4VQ 4KJNA 3TS0A 1HNWL 5C0XG 2B2TA 2Z6BA 2FJ2A 4PNYA 4WRDA 1JORA 1EIGA 3NPPA 2B63H 2WKCA 4J8QA 3WOEA 5BR8Q 4PMWA 1JOKA 5DAUA 4RWSC 4JI3Q 4I65A 1A0IA 2Z9HA 4GOPA 3DM1A 1UEBA 3L2PA 1JOQA 4XT1B 3FMCA 3ULJA 4P75A 3K5LA 1EU4A 1C4QA 1MSHA 3JAMi 4LWCA 3AFPA 2H4OA 1JOOA 1WTWA 1WTQA 3CU7A 1H95A 3K81C 2UXDQ 2B2YC 1XMOQ 2NVXH 4BWGB 4IUTA 3I7FA 2HHHL 2L4NA 2QA4A 2K50A 3EN2A 4YCVA 3OHXC 5I6YA 1A3VA 2ZTCA 3PIO3 1TS4A 1YNJD 3MXUA 3R2IA 2K1BA 2N8NA 1FJGQ 4H02A 4TVAB 1XPOA 4HEDA 1STHA 4NB3A 3H3VH 3PQIA 2FXQA 4B3SQ 1EY9A 1L0YB 2UUAL 4FF4A 1BQQT 2ENBA 2R93B 4X65Q 4FDBA 2EIFA 3RZOH 2F0PA 1NR2A 4HIOA 2B8FA 4NMZA 3GTOH 1CKNB 3U58A 3CC4A 4K5VA 3LNNA 5D14A 1NCVA 4GLAC 2SOBA 4LK1C 4NXNL 3EIVA 2ZJRA 1NTGA 2F0VA 3TP7A 3UDIA 4TRDA 3I4OA 2K7VA 1KDCA 4G57A 4JG2A 4LF4L 3GO5A 2N88A 4KD3A 3STBC 4B9WA 4HIKA 2UXBL 1RL2A 2OEOA 3CXCA 4KK7A 2ZXPA 3KUPA 2P5ZX 1B44D 1MI2A 4DV1Q 4QCLA 3J81E 4CJ2C 3S1RH 2B2TC 1WD1A 1OXXK 2WV6D 4LF6Q 3SGIA 3CCVA 4IPGA 3E0JA 2RHQB 1PH4A 4HJ5A 2SNMA 1A2TA 1IKLA 2HDMA 4GOPC 3HGBA 4QF4A 5JJZA 1PH2A 4FNFA 2A6ED 3KF8A 4J15A 4IFDJ 3KOJA 2A69D 3S15B 4IUPA 1DYQA 1OXSC 4N9TA 1ASZA 4X6AH 4X3SA 4CBVA 1OXVA 2R7ZB 1LYLA 1IBML 5ELCA 5IWAQ 2ZXOA 3PGZA 2EJGC 2OQKA 5M5YH 1Y8PB 4DV5Q 1J8IA 1TT2A 2K04A 1PMRA 4IJHA 3S2HB 4DR4L 2JJQA 1V43A 3KYHC 2UUBQ 5KNCA 1B1ZA 2V1CC 4KHPL 1VQCA 5IE8A 2CWPA 1SSOA 4ME5A 4KMUC 1EQTA 4DV7L 3KLWA 1B9NA 1KLGD 5T1GA 2PZUA 4L63B 1LACA 3TDQA 1KL9A 2ZTDA 5C4JB 1D8LA 2EY2A 1YNJC 2F0TA 2NB0A 4A3FB 1E1OA 4WORA 3S1QH 2R6GA 3CPFA 4DR2Q 3GTQB 4LF5L 1WTXA 4DUZL 3H0GH 1VMCA 1AN8A 4HJ8A 1QE6A 4C2MH 2LY7A 4LJZC 5FO8B 1H9RA 2AUKA 2IX3A 2PQEA 2PW5A 4EVOA 3HOYH 3C1FA 5D65A 2PNHA 4A3KB 2MFIA 1OXUA 3L0OA 3K7AH 3CPWA 4GN5A 5IYDG 3H0GG 4X64Q 4GLVB 1I4PA 3IKJA 3ONAB 3PIOA 2DY8A 4R4TA 1V1QA 3U9OA 2I46A 3ITPA 4DV0L 2UU9L 1MJCA 2MP1A 3HOYG 1HPCA 3CC7A 1N8RC 2EE1A 2E76C 3R2TA 4OWTB 4CHTB 5M5XB 2JN4A 1E24A 2DGYA 1ILPA 1MGSA 4LUVA 4RKLA 4DK1A 3PIP3 1ICWA 1PHJA 2KEDA 1I6VC 5CV7A 3H6MA 1P16A 3A5UA 4V190 3Q24A 1KTKA 2IY5B 4ZCKA 4HJ7A 4HMJA 5FKAC 3PV0A 2DY7A 4CDEC 2G9HD 4C3IB 1PYSB 1FNWA 4CKCA 3BDOA 3CQZB 2A6EC 3KBXA 2A69C 2K5QA 3MXNA 3JAME 2KCTA 4IFDI 4LFBQ 1BCPF 3BZDB 2M2LA 2WKDA 1Y1WB 3HOXB 4I7ZC 5C4XH 1VQ9A 4JI1L 4B08A 4DNIA 1TY2A 1W6JA 2BE5C 4J1MA 3PO2B 2WINB 4R4IA 5C0XJ 1YIJA 3HOVB 2PCFB 4R9WA 3TEHB 1DOMA 2TMPA 1S3OA 4DR1Q 3H91A 4M8AA 2GA4B 4H0LC 2ZT9C 3W1GA 4HIDA 5C4XG 3K5MA 2AQ2B 1LT3D 4Q0FA 2F0MA 4XXEA 4PZ8A 2DJFC 2FHTA 3RNUA 2B8GA 1F9SA 1GO3E 1RKNA 4DAVA 3K57A 1TWFB 2CFMA 5E4XA 3GTKH 5K5PA 2UXCL 1U9RA 4QUFA 4P2CB 5K36H 1UE7A 1JWUD 1Z47A 4FXGC 1D5XC 1KXLA 1I50B 3NBHA 3S2DH 1EIHA 2ZM6Q 4IUUA 3HOUH 1X3EA 1L1OB 4L6TB 1G8ZD 4JBKA 5CR3A 3MVVA 2RKSA 5DNFA 1CKMA 5C5LA 4X3TA 1HCZA 1STBA 4CDCC 1TVXA 1WTVA 1KIXA 5KNBA 3SEBA 4C1NK 2VNUD 4DK0A 2CH4A 3V2TA 3S1MB 1WTHA 5GAHC 5IT9c 4XTCS 4JI2Q 1K0RA 1DM0B 3MTSA 2QKIC 1Z7TA 3NEMA 4X66L 4EQNA 1U0LA 2CQAA 3UI2A 1ET6A 2JA8B 4MTNA 3HOWG 4P72A 1A2UA 4LUOA 5CV9A 4NXML 1TKWB 2Q8TA 1H9SA 4PG3A 2KEEA 4QUCA 1VQDA 3K58A 3OW7A 1LLRD 2D9UA 3GV6A 2KCCA 4MHEA 3T1YL 4C3HB 1X3GA 4C1NI 4WFN3 5E7NA 1ILQA 2F0NA 5IP9H 5IY0A 5JOBA 1JCKB 4DK6C 3PIPA 5JJIA 5KNDA 3NK9A 2X6GA 2Z0SA 1VF5C 1J9OA 3L9AX 4YCWA 1A6XA 1BCPD 4RH6A 5FJ8G 4A3MB 4GKJQ 1PZID 3DM3A 4ODGA 5IP9G 1G91A 5C0XI 1X3QA 3RD4A 2NVYB 1TY0A 2Y0SG 3QG1A 3NE5B 3NP8A 3U4ZA 3NWTA 2RSOA 1O80A 2F0UA 3NSWA 2E2DC 2QF7A 1RJTA 3I70A 4EX5A 1MJEA 5IGFA 3ERSX 4DUYQ 3K59A 2RF4A 4RGOS 3ICEA 3BVZA 3I55A 1D5MC 3KK7A 4LF9L 4JV5Q 3K8AA 1EL0A 3T56B 4NKLA 3UE1A 1O7LA 3DWAA 1VQAA 1JC7A 1F2LA 1MKHA 3AMUA 3OMGA 1K8GA 3FRPB 3VYSA 2B3GA 1ICFB 5CV6A 1AE2A 2EOTA 3QIAA 2YTYA 2RDGA 5IYBH 1FR3A 3MHBA 4A76A 2N49A 1BVSA 2E2HB 2F0FA 4DR7L 5DLQE 1D6EC 4TKOB 2D0OA 4BY7B 1G2TA 1VQBA 5ELBA 4IPCA 1G291 3HFZB 3I4MH 1HUNA 3M3YH 5IYBG 1B3QA 1SYBA 5EPKA 5JVH3 3H3VI 4APVA 1MD2D 1PVOA 4ZAIA 2A1AA 2UUCQ 2B39A 5JEAJ 1WVLA 4N9PA 3RN2A 1GUSA 1Y1VB 1N34L 4OX9Q 3I4MG 1RCVD 2VXWA 1G6PA 3PUWA 3J7ZC 2I0QA 4JYAL 1AFPA 5EGTA 3BDCA 3GTMB 3NUCA 3Q8DA 2XWJB 3ND8A 1VQPA 1N9WA 2JEBI 3CAMA 1TWHH 3P20A 4R4OA 4DR6Q 4H13C 3A8IE 3U4VA 2XVSA 2WB1B 3IFTA 1CZGA 5G3LF 4R8IA 2NN6H 1SYFA 3ZJYC 4ABNA 4JK1C 5LMNL 3HKZG 5CBAE 3TP5A 1HNXQ 1Q81C 2NVTB 4RA8A 3CCMA 3S14B 3CCQA 1EQQA 3EJIA 4BBRH 2JA6G 1WCMG 4B3ML 1KNEA 2VUMG 1HTLD 4GKKQ 5M3MB 1XNRQ 4UHVA 4FO2A 4HR7B 4K14A 3EA6A 1VCIA 1QZGA 2RBMA 1HR0Q 4BBRG 1KC8C 3OW2A 1TWGB 4HCEA 1NNXA 1LTAD 1BOSA 1DXMA 3HRZC 4DXGA 2HUGA 5BN4A 2HQLA 1LO5D 1NE3A 1U5KA 5I2XA 1EWCA 3K5NA 2B29A 3FP9A 3WWVA 4KN4C 1PH7A 4DAMA 5M3FH 5ELDA 4J6HA 5IP7H 3J7A5 2AKWB 2RVLA 1CM9A 1PRTB 3PCOB 1WOCA 2EY6A 4A3BH 1FVIA 1ZXTA 1Q8IA 2VW9A 2DUDA 3VA5A 2VQEL 2XN9C 3WOFA 2FINB 1Q82C 3S17B 5M3FG 2Q8IB 3AU7A 1EFID 4Y7NH 3MXNB 2F0OA 3I4NH 3L7ZC 4PV1C 4A3BG 4GZYC 4LNQA 2XIWA 1PA6A 1IZ6A 2WFWA 5COYA 3VR5A 1GD7A 2DNCA 4JPBW 1SNMA 2KHIA 2CQOA 3BYTB 1QJOA 3A54A 1IBLQ 1H9KA 3I4NG 1I3QH 1FGUA 1XWEA 3M9BA 2E75C 4A3IH 3RLNA 1ONLA 1NMGA 5E3FA 1GM5A 3KLSA 2HHHQ 2F0DA 2O2LD 3ERQA 4X62L 4FF2A 3PF5A 4C3JB 3I4LA 1CA5A 1PH6A 1YITA 4A3IG 4DPGA 1GKHA 2K05A 1GVPA 4DU9A 2K28A 3UDXA 5HURA 3HKSA 4A3LH 1K8OA 2ZJPA 2XGTA 1JJ2A 3TSSA 1HR0W 3FKIH 2BH2A 2KA7A 1K9MC 1E3PA 3J80c 2C35B 1JMCA 3P7JA 2R7FA 2K75A 5G3LD 4Q5VA 1LABA 2K32A 1STYA 2EVBA 1D7QA 4K2LA 3M7NA 2J7ZA 3D0FA 3C3LA 4QQBX 3FKIG 4YCUA 3E3XA 1L1OA 1L2FA 2JQOA 1CHPD 4JVZA 2Q8RE 2AUJD 1I4XA 3SK6A 5BN5A 4OIKA 1PH3A 2EYJA 4AYBB 4ZRZA 4YY3L 4R4CA 4K0KQ 3PO3H 1JWMD 3I90A 2B63G 3F2CA 1VDZA 4JI4L 3T1HQ 2K5DA 5KRUA 3MC0B 2EYFA 2E8GA 4A93H 3H15A 3CP0A 1DONA 3DHQA 4PQXA 2MHVA 3GTLB 1G51A 2R3ZA 4DV6L 3J81L 1H9SB 3PO3G 3K80C 4B3RQ 4EGVA 4HSVA 1X9NA 4R8NA 5FK9C 4A93G 3A8KE 4CJ0B 3QO2A 5M5WH 2YU9B 2J4XA 1STNA 1K8MA 4KJOA 1T9HA 5CV4A 5KEEA 3CMEA 3DXJC 3M4OH 2ES2A 5CMDA 1R4PB 1KDBA 1Y14B 3A56A 1TIID 4JI8L 2FFKB 3Q22A 3E0EA 3S2HH 1HNZQ 3ULPA 2MQHA 4DGZA 4G7HC 5A35A 3BVMA 1ZEQX 1PZJD 2CCZA 4K8JA 1B50A 3NBIA 4CKEA 2F03A 4BY1H 4A3DH 2GVAA 1X65A 1ASYA 1B53A 5C4JH 1K83B 4UAIA 2C5CA 2NZOA 2F0LA 1HQRD 3FDTA 2O5JC 5HY6A 1NUCA 5GQOA 2VB2X 4BY1G 2A73B 4A3DG 2F4VL 1S5ED 1B7YB 1WYDA 1VQLA 1CT1D 1EY8A 3AFQA 1S4ZA 4YWMA 5BR8L 2L15A 2EYOA 1L1OC 4E6IA 1BKBA 4JI3L 3ER0A 4OIJA 1B9MA 1J5EL 1FGBD
chains in the Genus database with same CATH topology
1I4HA 1STEA 3J7YW 3RUZA 2F0IA 2NTSA 5E4WC 4H44C 1SNCA 5J22A 1SE4A 2Z4HA 1SEBD 4RKBA 5IIFA 1STAA 4UDUC 2B2UA 2BE5D 4X3UA 3NWSA 2EY5A 1F9QA 2H1EA 3TP6A 3OSOA 2QCPX 3FPPA 3HG9A 1TS3A 2A6HC 2JP1A 3PUYA 4NP5A 1AW7A 3IFDA 1KNAA 3HS0C 1T5XD 2X6LA 5F2DA 5I9OA 3RZOB 4Z9CB 5DM63 5C3WA 3T16A 3C46A 3SXHA 2IL8A 3JAML 5D3IB 2HCIA 4L8JA 4IALA 2E2JB 3GTGB 5HGTA 3EROA 4XDXA 4QIWB 3VR2A 2V4DA 1BF4A 1F2MA 3CKIB 1EEID 2M00A 1ENCA 4QB4A 3D6CA 3MEHA 1IYVA 4HMIA 3WDNA 3SK8A 4HN7A 3DMUA 3DWQA 3G7LA 1ENFA 1UNSA 1TWAB 2D62A 4MIUA 2CVRA 1LTRD 1ML0D 1BNZA 3HZXA 3DUZA 3NHHA 3HEJA 5KYIA 4HTHA 2JXMB 4ZK9B 2I07B 5M5YB 2PW7A 1EYCA 1F77A 1FNUA 5FLXE 2B2UC 2JEAI 5EKIA 1EYDA 3MWYW 5C3XA 2AWOA 3T53B 1LTGD 1CFMA 2G9DA 3G6JB 4RCNA 1R9TB 1RTOA 2NN6I 4ILWA 2K5WA 1KDAA 3S1QB 3J7AF 3SE0A 1LV9A 1S5CD 1PXUA 3H0GB 1SNQA 2KUMA 4C2MB 1ESFA 4EQPA 3HOYB 1FYCA 2EYHA 3K7AB 1M4VA 5CBEE 4IURA 2WIIB 2WACA 3I72A 2DN8A 3LX0A 1BO0A 5K36G 2RA4A 1FNVA 1PDQA 4NW2A 4ZYSA 4ID6A 1XTCD 4H7BA 4WJWA 5JPMC 2XNAC 2DNEA 3EQLC 4CGYB 3I8ZA 2A74C 1CK1A 3TZUA 4DA2A 1DOLA 2PMZB 3ZYYX 1Q1EA 4BA2I 1PRTC 2FMCA 4DAPA 1EQVA 3ND9A 2BDOA 2OF1A 3PUZA 1G6ZA 1HHVA 3QJYA 2OXPA 1F9RA 4OHJA 2L0CA 5JVG3 5C4XB 3VA7A 3GTPB 4FF1A 1RHPA 3W3AA 2KJXA 1BXTA 5KGUA 1NSNS 2IT1A 1B3AA 1EEFD 3RMHA 1S5BD 1X3PA 1DD2A 2KHSA 1SJHD 1AZQA 4G7OC 1TS5A 2A68D 4TSSA 1CA6A 5LL6X 4K2KA 1PTOB 3P75A 4RFBA 3QOLA 4LAAA 1S5DD 3QWNA 2CHBD 1SJED 2F0SA 1HUMA 4ULLA 4OGQC 2RDHA 1M8AA 1VMPA 4IUVA 3N52A 4NDXA 3S2DB 4K5XA 3V05A 2F0HA 2K03A 3J80E 1KLUD 1HA6A 4XIGS 3D3RA 4HCSA 1D1KA 2MUYA 1OO9B 1EOTA 3NQIA 1VF7A 1I4QA 3HOWB 1II3A 3GQBA 3MXGA 1G2SA 2QILA 4XQJA 2IJ0A 4DNTB 1E0BA 3M4YA 4G7ZC 1QG7A 2O5IC 1DZ1A 2Z1CA 3FEWX 1CTMA 2PNRC 5EBCA 3KBGA 3S9WA 3U9SA 3I91A 2EPBA 1QWYA 1GUNA 1LT6D 4K8IA 1X32A 3D4WA 3H94A 1RF2D 1EY4A 5C4HA 5A2QE 2QDBA 1AP0A 2BOSA 1H9MA 1GOZA 2Y0SB 3CRLC 5I4DA 2PYKA 1EZ8A 1IW7D 2KQ3A 1LT5D 2B2WA 4K6LA 3K0YA 4LMQD 1SNDA 1Q1BA 1O7YA 2EYPA 2A68C 2OT2A 4HSPA 2NN6G 2IPKD 2L12A 2SEBD 1QB5D 3NQTA 5LL6S 3AB9A 2F0GA 1HQMC 3OIPA 4OO1H 2D5DA 4FXKC 3VR3A 2RSNA 2EXZA 3RZDB 1Q90A 2NBFA 4ZKCB 4XYOA 1ENAA 3NTHA 5C6AA 3BDLA 2F0KA 1S5FD 3A7LA 3DEPA 1MBYA 2RQXA 1SMYC 3OPOA 4IUNA 3VYRA 2R61A 4DAYA 3RLFA 1SDFA 3Q0AA 5AFWA 3OWEB 1GHKA 3E6ZX 5T1IA 3M3YB 2F0QA 2BA1A 1XXGA 3EVQA 1PTOF 1QOHA 2AQ1B 3HKZB 5EPJA 2J0TD 4F87A 3T13A 3H3VC 4OL7A 1TWHB 2JA6B 1WCMB 3LWUA 2EZVA 4XYQA 2VUMB 1F2ZA 2L5TA 1JICA 1UUPA 2F3WA 5EJWA 1YNND 4EQOA 4RAUC 3VR6A 3MZ5A 2B2WC 4BBRB 5IODA 3K5OA 1IW7C 3D31A 1SE2A 1WTPA 1GUGA 1PYWD 3Q23A 1O78A 2RDFA 1U4MA 1PZKD 1LTBD 1PFMA 2AWNA 3R8BA 4KY5A 5C5MA 3SVMA 2HDLA 5M3FB 4U673 4KD4A 1KABA 1STGA 2F4IA 2JSOA 4A3BB 1C8CA 1ZYRD 1E2VA 4KTAA 3OOCA 1EY0A 3P1HA 2XWBB 4Y7NB 3R93A 2IX1A 3I4NB 5IGBA 2A6HD 3BG3A 4ZQ3A 1NR4A 1HRJA 1B4OA 3MFGA 5DEHA 3MXPA 4IQZA 2EYLA 1IKMA 1I3QB 4TQUS 3F2UA 4A3IB 1EU3A 5ELEA 2NUCA 3N6RA 3E5SA 3GTJB 3K6OA 4BS9A 1WTRA 2NTTA 5KIXA 1RTNA 1JR0D 1PTOD 2XRQD 5IT9L 4IUQA 2NWGA 1DOKA 5I9PA 1QILA 3SHLA 1UEAB 2NZ1D 3D8GA 3FKIB 4S3SA 1YNNC 2K01A 1LTID 1Q12A 1DCZA 3GP7A 1PRTF 4XT3B 3A55A 1HA5A 2EDGA 1WTOA 1BCPB 1GXDC 2B63B 4FYDA 3PMFA 4KKSA 2KOLA 4O1NA 4F88A 5IGEA 1SYDA 1SAPA 1HFGA 5I6WA 1QNKA 4F8MA 2KECA 3PO3B 5EBDA 4CKBA 5NUCA 1EY5A 2EY1A 4YIJA 1EYAA 2TSSA 1R4QB 3L3OC 4A93B 3VYUA 2NVXB 2ZXRA 1XYIA 1Y8OB 5IT9E 3TBIB 1UAPA 1JE4A 1ZYRC 1D1IA 4DXFA 2F0EA 5JPNC 5M5WB 1TU2B 2XSCA 2WP8J 3NTKA 3CRKC 4FP5D 3TP8A 3M4OB 4FVMA 1NAPA 1LTTD 4K5WA 3TZDA 3MAQA 1E2WA 3SK4A 1V1PB 3GTOB 2ICIA 1SYCA 4C3IG 2MPMA 4BY1B 5FLXL 4A3DB 2BDNA 5ELFA 5IGCA 1PTOC 3VYTA 2EYMA 5CORA 4IZ8A 1BR9A 1SYGA 1QCBD 1W6KA 1EWHA 5J1ZA 1AZPA 3NTIA 5JEAH 1A3UA 3S1RB 5KYLA 1SNOA 3DEOA 4RGMA 1ZKOA 3T4AC 1JWSD 1HXYD 5CV8A 3X3NA 2X69A 1PRTD 5JEAG 3KLSX 1I4GA 2O4XA 1IHZA 4PMBA 3VR4A 2XRSD 1EY7A 2PZWA 1V1OA 1GUWA 3DWPA 2A5HA 2LKVA 2N55A 1TQOA 5CGKA 4KY6A 4V0BA 1T5EA 2LMCB 4DFAA 1RD9D 4DNRB 4A3JB 4X3KA 1MSGA 2C9OA 1I6HB 2KCNA 1CHQD 1SYEA 5C3EB 1U4LA 4A3GB 1Y69U 2Z8LA 3HOZB 3D4DA 5JAVA 1HTPA 3J7AV 1OXTA 2EJFC 2QEJC 4A3EB 4OO1I 3PUVA 4C3HG 2NVQB 4G4KA 1B2TA 1SNPA 1C48A 4B9XA 5J39A 2PZTA 5CC4A 3OIQA 1PTOH 2LFNA 1H9JA 4O42A 2SNSA 2YYZA 4ZKBB 1IYUA 1RODA 5C44B 1L0XB 1LTSD 5FOBB 1PFBA 2MJ8A 1CQVA 1U4PA 4U68A 3T51B 3TN2A 3A7AB 1AEXA 2R92B 4M1UB 1EY6A 5IOCA 3KLRA 3J80L 3TMEA 1U4RA 5TSSA 1E2ZA 4RCOA 2CW0D 4DF7A 2EJMA 3BS1A 2D2CC 1Y8NB 4JBWA 1WD0A 3QOJA 2E2IB 1CI3M 1D2BA 3URYA 4KHVA 2IW3A 4IN3A 3GV3A 3S16B 2SDFA 4KN7C 1ESRA 3GTKB 3D4RA 5M9OA 5CYUA 5A2QL 3IAYA 2E74C 3OMCA 5C4ZA 1I4RA 1PLFA 1FD7D 1LT4D 1RDPD 3HOUB 5EPLA 1SXTA 1A3TA 1PFNA 3X3MA 2F1MA 3S1NB 1SMYD 2JA7B 4HAEA 4MN3A 2AQ3B 4PMCA 4QMGA 4KKTA 3PUXA 4FXDA 3CHBD 3SR1A 1CZWA 2BA0A 3SK5A 3M7GA 2L9HA 1GJXA 1SFOB 2PO4A 1DJRD 2Z4IA 1KAAA 3BYYB 3D6WA 5D3DA 4ZUJA 1F2YA 3EFXD 1QNUA 3V96A 3C1EA 2VB3X 2ID0A 4KHZA 4DN4M 2CW0C 5E1FA 2IWHA 1O7ZA 3Q6SA 4RGTA 5FO7B 3C2PA 2LS01 4FF3A 1CQFA 2ICEC 3R3OA 2K33A 1TWCB 1V1PA 4IFDH 4BBSB 5EKLA 1JQYD 4RHRA 4KI0A 5CV5A 4IFDG 1Z6HA 5I2YA 3MFYA 3BVGA 3I3CA 4KKUA 2FMMA 3I73A 2HQEA 1TR5A 2WAQB 5FO9B 2B2VA 3O13A 1BCPC 3A8JE 4KV6A 4C3JG 4ZLTF 1IL8A 4OO1G 2F0JA 1F9PA 2MGSA 4RHSA 3H09A 1GHJA 1GUOA 2BCOA 1HFNA 1D5ZC 3OWFA 5DM73 3NXWA 2PPBC 3I4MB 3FVQA 2M9VA 3HP3A 5BN3A 4K6DA 1A15A 1V8QA 1SE3A 2F0WA 2L11A 4F7XA 5ISRA 2B2YA 1Q3LA 2JA5B 3W2DA 1EZ6A 1ET9A 2IX0A 2NYZD 3GD7A 2JE6I 4C56C 3LWEA 5EQ0A 5LHY1 2K6AA 3SDZA 5IGDA 4CJ1B 2F3VA 4RGNA 1BUVT 1TS2A 3QB3A 5EKKA 3M85A 1SBBB 2JYOA 4XQNA 4ZUIA 1XX8A 1GUTA 2L1BA 3IL8A 2HCCA 2KVMA 3FPUB 1BDOA 5C0XH 5IGGA 2B2VC 1JB3A 4BA1I 4KY7A 4XQQA 1BBXC 2L55A 3MA2B 4KJNA 5C0XG 2B2TA 1JORA 2FJ2A 4PNYA 4WRDA 1EIGA 3NPPA 2WKCA 4J8QA 3WOEA 4PMWA 1JOKA 5DAUA 4RWSC 4I65A 3DM1A 1JOQA 4XT1B 3FMCA 3K5LA 1EU4A 1C4QA 1MSHA 2H4OA 1JOOA 1WTWA 1WTQA 3CU7A 2B2YC 4BWGB 4IUTA 2L4NA 3OHXC 5I6YA 1A3VA 3PIO3 1TS4A 1YNJD 3MXUA 3R2IA 2K1BA 4HEDA 1STHA 1EY9A 1L0YB 4FF4A 1BQQT 2ENBA 2R93B 2F0PA 1NR2A 2B8FA 4NMZA 4K5VA 3LNNA 5D14A 1NCVA 2SOBA 4LK1C 2F0VA 3TP7A 4TRDA 4G57A 2K7VA 1KDCA 3GO5A 2N88A 4KD3A 4B9WA 2OEOA 4KK7A 2ZXPA 3KUPA 1B44D 1MI2A 4QCLA 3J81E 4CJ2C 2B2TC 1WD1A 1OXXK 2WV6D 3E0JA 2SNMA 1A2TA 1IKLA 2HDMA 3HGBA 4QF4A 5JJZA 4FNFA 2A6ED 3KF8A 4IFDJ 2A69D 3S15B 4IUPA 1DYQA 1OXSC 4N9TA 4X3SA 4CBVA 1OXVA 2R7ZB 5ELCA 2ZXOA 2EJGC 1Y8PB 1J8IA 1TT2A 2K04A 1PMRA 3S2HB 1V43A 5KNCA 1B1ZA 1SSOA 4ME5A 4KMUC 1EQTA 1B9NA 1KLGD 5T1GA 2PZUA 4L63B 1LACA 3TDQA 5C4JB 2EY2A 1YNJC 2F0TA 2NB0A 4A3FB 4WORA 2R6GA 3GTQB 1WTXA 1VMCA 1AN8A 1QE6A 2LY7A 4LJZC 5FO8B 1H9RA 2AUKA 2IX3A 2PQEA 2PW5A 4EVOA 3C1FA 5D65A 4A3KB 1OXUA 1I4PA 3IKJA 3ONAB 2DY8A 3U9OA 2I46A 3ITPA 2MP1A 1HPCA 2EE1A 2E76C 3R2TA 4CHTB 5M5XB 1ILPA 1MGSA 4RKLA 4DK1A 3PIP3 1ICWA 2KEDA 1I6VC 5CV7A 3H6MA 4V190 3Q24A 1KTKA 5FKAC 4HMJA 3PV0A 2DY7A 2G9HD 4C3IB 1FNWA 4CKCA 3BDOA 3CQZB 2A6EC 3KBXA 2A69C 2K5QA 3MXNA 3JAME 4IFDI 1BCPF 3BZDB 2M2LA 2WKDA 1Y1WB 3HOXB 4I7ZC 4B08A 1TY2A 1W6JA 2BE5C 4J1MA 3PO2B 2WINB 3HOVB 5C0XJ 2PCFB 4R9WA 1DOMA 2TMPA 3H91A 4M8AA 2GA4B 4H0LC 2ZT9C 3K5MA 2AQ2B 1LT3D 4Q0FA 2F0MA 4XXEA 2FHTA 2B8GA 1F9SA 1RKNA 4DAVA 3K57A 1TWFB 5E4XA 5K5PA 1U9RA 4QUFA 4P2CB 5K36H 1JWUD 1Z47A 4FXGC 1D5XC 1I50B 3NBHA 1EIHA 4IUUA 4L6TB 1G8ZD 5CR3A 3MVVA 2RKSA 5DNFA 5C5LA 4X3TA 1HCZA 1STBA 1TVXA 1WTVA 5KNBA 3SEBA 4C1NK 2VNUD 4DK0A 3V2TA 3S1MB 4XTCS 1DM0B 3MTSA 2QKIC 1Z7TA 4EQNA 3UI2A 2CQAA 1ET6A 2JA8B 1A2UA 5CV9A 1TKWB 2Q8TA 1H9SA 2KEEA 4QUCA 3K58A 3OW7A 1LLRD 2D9UA 3GV6A 2KCCA 4MHEA 4C3HB 4C1NI 4WFN3 1ILQA 2F0NA 5JOBA 1JCKB 5KNDA 3NK9A 2X6GA 1VF5C 1J9OA 3L9AX 1A6XA 1BCPD 4RH6A 4A3MB 1PZID 4ODGA 1G91A 5C0XI 1X3QA 3RD4A 2NVYB 1TY0A 3QG1A 3NE5B 3NP8A 3NWTA 2RSOA 1O80A 2F0UA 3NSWA 2E2DC 2QF7A 1RJTA 3I70A 5IGFA 3K59A 4RGOS 3BVZA 1D5MC 3KK7A 1EL0A 3T56B 4NKLA 1O7LA 3DWAA 1JC7A 1F2LA 3AMUA 3OMGA 3FRPB 3VYSA 5CV6A 2EOTA 3QIAA 2RDGA 1FR3A 3MHBA 2E2HB 2F0FA 1D6EC 4TKOB 4BY7B 1G2TA 5ELBA 1G291 1HUNA 1SYBA 5EPKA 5JVH3 1MD2D 4ZAIA 2B39A 5JEAJ 1WVLA 4N9PA 1GUSA 1Y1VB 1RCVD 2VXWA 3PUWA 1AFPA 5EGTA 3BDCA 3GTMB 3NUCA 2XWJB 3ND8A 2JEBI 3P20A 4H13C 3A8IE 2XVSA 2WB1B 3IFTA 1CZGA 5G3LF 4R8IA 2NN6H 1SYFA 4ABNA 4JK1C 5CBAE 3TP5A 2NVTB 4RA8A 3S14B 3EJIA 1KNEA 1HTLD 5M3MB 4FO2A 4HR7B 4K14A 3EA6A 1VCIA 2RBMA 1TWGB 4HCEA 1LTAD 1BOSA 1DXMA 3HRZC 4DXGA 2HUGA 5BN4A 1LO5D 5I2XA 1EWCA 3K5NA 4KN4C 5ELDA 4J6HA 2RVLA 1CM9A 1PRTB 2EY6A 1ZXTA 1Q8IA 3VA5A 2XN9C 3WOFA 2FINB 3S17B 2Q8IB 3AU7A 1EFID 2F0OA 3L7ZC 4PV1C 4GZYC 2XIWA 5COYA 3VR5A 2DNCA 1SNMA 3BYTB 1QJOA 3A54A 1H9KA 1XWEA 2E75C 1ONLA 5E3FA 3KLSA 2F0DA 2O2LD 3ERQA 4FF2A 4C3JB 3I4LA 1CA5A 2K05A 4DU9A 5HURA 2K28A 1K8OA 3TSSA 2KA7A 3P7JA 5G3LD 4Q5VA 1LABA 2K32A 1STYA 2EVBA 4K2LA 3M7NA 2J7ZA 3C3LA 1CHPD 2Q8RE 2AUJD 1I4XA 3SK6A 5BN5A 4OIKA 2EYJA 4AYBB 4ZRZA 1JWMD 3I90A 1VDZA 2K5DA 5KRUA 3MC0B 2EYFA 1DONA 3DHQA 4PQXA 2MHVA 3GTLB 2R3ZA 3J81L 1H9SB 4EGVA 4HSVA 4R8NA 5FK9C 3A8KE 4CJ0B 3QO2A 2YU9B 2J4XA 1STNA 1K8MA 4KJOA 5CV4A 5KEEA 3DXJC 5CMDA 1R4PB 1KDBA 3A56A 1TIID 3Q22A 2FFKB 4DGZA 4G7HC 5A35A 3BVMA 1ZEQX 1PZJD 4K8JA 1B50A 3NBIA 4CKEA 2F03A 1B53A 1K83B 4UAIA 2C5CA 2F0LA 1HQRD 3FDTA 2O5JC 1NUCA 2VB2X 2A73B 1S5ED 1CT1D 1EY8A 1S4ZA 2EYOA 4E6IA 4OIJA 1B9MA 1FGBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HEJ A;  3SHL A;  3SR1 A;  5KYI A;  4HTH A;  3D4W A;  2OXP A;  3RUZ A;  3D8G A;  4S3S A;  2F3W A;  5J1Z A;  2QDB A;  2F0I A;  4ODG A;  4K6D A;  3SK5 A;  1A3U A;  4K14 A;  5KYL A;  4ME5 A;  1SNC A;  4EQO A;  1SNO A;  5J22 A;  3MZ5 A;  2F0W A;  2PW7 A;  1EYC A;  5CV8 A;  2RBM A;  3SK6 A;  3NP8 A;  4F7X A;  4RKB A;  5ISR A;  2PZU A;  5I6Y A;  2PYK A;  1A3V A;  5KGU A;  1NSN S;  2EY2 A;  2F0M A;  5IOD A;  2EYJ A;  1EZ8 A;  5IIF A;  2F0U A;  1EYD A;  1STA A;  5C3X A;  1KAA A;  2KQ3 A;  2F0T A;  4ZUJ A;  1EZ6 A;  1AEX A;  1F2Y A;  3PMF A;  1RKN A;  1STH A;  3C1E A;  5IGF A;  5KRU A;  1SND A;  1EY6 A;  2EYF A;  2KHS A;  4WOR A;  5IGE A;  5IOC A;  2O4X A;  2EYP A;  1SYD A;  3TME A;  1EY9 A;  5I6W A;  5K5P A;  1U9R A;  3DHQ A;  1IHZ A;  2EY5 A;  2ENB A;  4PMB A;  4J6H A;  1EY7 A;  5IGD A;  4K2K A;  2PZW A;  4NKL A;  3TP6 A;  4F8M A;  3OSO A;  2F3V A;  3P75 A;  5NUC A;  2EY6 A;  1EY5 A;  2F0P A;  3QOL A;  5E1F A;  2EY1 A;  3NQT A;  4LAA A;  2LKV A;  1KDA A;  2RDF A;  3OMG A;  4YIJ A;  4DF7 A;  2PQE A;  2PW5 A;  2F0G A;  1EYA A;  4EVO A;  3C1F A;  4NMZ A;  3VA5 A;  4R8N A;  1TQO A;  4NP5 A;  5CGK A;  3QB3 A;  4KY6 A;  5CR3 A;  4KY5 A;  4K5V A;  5EKK A;  5C5M A;  3R3O A;  2EXZ A;  2SOB A;  3MVV A;  2RKS A;  1STN A;  4KD4 A;  5CV6 A;  1KAB A;  1SNQ A;  2F0S A;  5F2D A;  5C5L A;  4DFA A;  4KJO A;  5I9O A;  2F0V A;  1STB A;  2F0O A;  5CV4 A;  3TP7 A;  4TRD A;  1STG A;  3QOJ A;  4G57 A;  1KDC A;  5KEE A;  4NDX A;  1ENA A;  3MHB A;  3U9O A;  3ITP A;  4ZUI A;  2F0F A;  5C3W A;  4B9W A;  4KD3 A;  5EKL A;  3T16 A;  4EQP A;  3NHH A;  4K5X A;  2EYH A;  1KDB A;  2F0H A;  4KHV A;  2OEO A;  4KTA A;  3SXH A;  3V2T A;  2F0E A;  5C6A A;  1SNM A;  5CV5 A;  3BDL A;  1EY0 A;  1JOR A;  3P1H A;  2F0K A;  4IAL A;  4RKL A;  4DGZ A;  5IGG A;  5HGT A;  3ERO A;  1SYE A;  5IGB A;  4K8J A;  1SYB A;  4KY7 A;  4ZQ3 A;  4IUN A;  4EQN A;  3TP8 A;  5CV7 A;  3H6M A;  2WAC A;  5C4H A;  5E3F A;  2HQE A;  1TR5 A;  5M9O A;  1A2U A;  1II3 A;  2F0D A;  3LX0 A;  3MXP A;  5CV9 A;  5DEH A;  3ERQ A;  4N9P A;  1F2M A;  4K5W A;  3D4D A;  4KJN A;  2EYL A;  3OMC A;  4KV6 A;  5C4Z A;  4ID6 A;  3SK4 A;  2M00 A;  1ENC A;  2F0Q A;  4QB4 A;  4PNY A;  4WRD A;  5EGT A;  3BDC A;  2F0L A;  2SNM A;  3D6C A;  4H7B A;  3MEH A;  1A2T A;  4HMJ A;  3NUC A;  1NUC A;  4QF4 A;  1A3T A;  1SYC A;  3EVQ A;  4HMI A;  2F0J A;  3SK8 A;  5HUR A;  4DU9 A;  2NUC A;  1JOK A;  3E5S A;  5DAU A;  3DMU A;  1SNP A;  4I65 A;  4N9T A;  1SYF A;  5KIX A;  3S9W A;  5IGC A;  2F0N A;  4B9X A;  5J39 A;  1EY8 A;  1JOQ A;  2PZT A;  3TP5 A;  5CC4 A;  5JOB A;  3T13 A;  4PMC A;  4QMG A;  4MIU A;  2EYM A;  4K8I A;  4OL7 A;  3NK9 A;  2EYO A;  1JOO A;  1EQV A;  4E6I A;  1TT2 A;  3OWF A;  4IZ8 A;  3EJI A;  1SYG A;  1STY A;  5JAV A;  5I9P A;  2SNS A;  3NXW A;  3HZX A;  2OF1 A;  4J1M A;  4K2L A;  1F2Z A;  1EY4 A; 
#chains in the Genus database with same CATH topology
 1I4H A;  1STE A;  3J7Y W;  3RUZ A;  4DR3 Q;  2F0I A;  2NTS A;  5E4W C;  4GNX A;  4H44 C;  1SNC A;  5J22 A;  1SE4 A;  2Z4H A;  1SEB D;  2UXD L;  3KDF B;  4RKB A;  4DV0 Q;  3TQY A;  5IIF A;  1STA A;  2N3S A;  2HIX A;  4UDU C;  2KBN A;  2B2U A;  2BE5 D;  2GN5 A;  4DV4 Q;  1XPU A;  2Z6K A;  4X3U A;  3NWS A;  2EY5 A;  1F9Q A;  2H1E A;  3TP6 A;  4IPD A;  3OSO A;  2QCP X;  1I5F A;  3FPP A;  3HG9 A;  4A3J H;  1TS3 A;  2A6H C;  4CDD C;  2JP1 A;  3PUY A;  2K5V A;  4NP5 A;  1AW7 A;  4X65 L;  3IFD A;  2RCF A;  1KNA A;  3HS0 C;  1T5X D;  2X6L A;  5F2D A;  1I6H H;  5I9O A;  1SRU A;  4GN3 B;  3RZO B;  4Z9C B;  4A3J G;  3W5O A;  5DM6 3;  5C3E H;  5C3W A;  3T16 A;  1Y1W H;  3C46 A;  3SXH A;  4A3G H;  2IL8 A;  3JAM L;  2VS1 A;  2HCI A;  5D3I B;  3HOZ H;  4L8J A;  4IAL A;  2E2J B;  2AHO B;  3GTG B;  2LSS A;  5HGT A;  3ERO A;  1WFQ A;  5LMU Q;  4XDX A;  5C3E G;  4QIW B;  4A3E H;  3VR2 A;  2V4D A;  5GAE C;  1BF4 A;  4A3G G;  1F2M A;  2NVQ H;  3CKI B;  2DJG C;  4DV1 L;  3HOZ G;  1EEI D;  2M00 A;  1ENC A;  1NBW A;  1X55 A;  4QB4 A;  3D6C A;  1EQR A;  3MEH A;  1IYV A;  4LF6 L;  4A3E G;  4HMI A;  1UE5 A;  3WDN A;  3SK8 A;  4HN7 A;  2G5D A;  3DMU A;  3DWQ A;  1CSQ A;  4PZ6 A;  3G7L A;  1YJ9 A;  1ENF A;  3M4P A;  1IBK Q;  1UNS A;  5C44 H;  1TWA B;  2D62 A;  4MIU A;  4P71 A;  3I2Z A;  1LUZ A;  2CVR A;  2E5L Q;  1LTR D;  1ML0 D;  4R1J A;  1BNZ A;  3HZX A;  1PH1 A;  2HD3 A;  3DUZ A;  3NHH A;  3HEJ A;  2OTJ A;  5KYI A;  4DAY B;  4HTH A;  2EQS A;  5IWA L;  2R92 H;  1E1T A;  4EQ5 A;  5C44 G;  4DV5 L;  2JXM B;  4ZK9 B;  1MIU A;  2I07 B;  5M5Y B;  1C0A A;  3F8T A;  2PW7 A;  1EYC A;  1VQN A;  1F77 A;  1FNU A;  5FLX E;  2UUB L;  2B2U C;  2XTI A;  2JEA I;  3S1M H;  5EKI A;  1EYD A;  4JI7 Q;  3MWY W;  2YTV A;  5C3X A;  2Z6K C;  3OYY A;  2AWO A;  2R92 G;  3T53 B;  1LTG D;  1CFM A;  2G9D A;  3G6J B;  1HH2 P;  4RCN A;  1YHA A;  1YZ6 A;  3A74 A;  5GAD C;  3OTO Q;  1R9T B;  1RTO A;  3CCU A;  2NN6 I;  4ILW A;  4NXM Q;  2E2I H;  2K5W A;  5H1S E;  1KDA A;  4DR2 L;  3S1Q B;  1I94 Q;  3J7A F;  3SE0 A;  3KF6 B;  4QJF A;  1YHB A;  2WB1 E;  1LV9 A;  4YWK A;  1Q46 A;  1S5C D;  1PXU A;  3H0G B;  4C3H H;  1SNQ A;  3S16 H;  2KUM A;  4LFA Q;  4C2M B;  1ESF A;  3AEV A;  1BBU A;  1JE5 A;  5ELO A;  1K0S A;  2WAQ E;  4EQP A;  3HOY B;  1FYC A;  2EYH A;  3K7A B;  4RMF A;  1M4V A;  4X64 L;  5CBE E;  1Q7Y C;  1PH5 A;  4IUR A;  4A3M H;  2WII B;  2WAC A;  2NVY H;  3I72 A;  2DN8 A;  3LX0 A;  1BO0 A;  5K36 G;  1WI5 A;  2RA4 A;  1KQS A;  1FNV A;  1PDQ A;  4DR5 Q;  4NW2 A;  4ZYS A;  3J81 c;  3G71 A;  3S1N H;  2JA7 H;  4ID6 A;  1XTC D;  3CF5 A;  4H7B A;  4WJW A;  5JPM C;  1PH9 A;  2XNA C;  3HOU G;  1VQM A;  3TS2 A;  2DNE A;  3EQL C;  4CGY B;  3I8Z A;  1A63 A;  2A74 C;  1CK1 A;  3TZU A;  4DA2 A;  1DOL A;  2PMZ B;  2JA7 G;  3ZYY X;  1Q1E A;  4BA2 I;  1PRT C;  2FMC A;  2ZJQ A;  4DAP A;  4DV2 Q;  3F1Z A;  1EQV A;  1SFO H;  3ND9 A;  4JI6 Q;  2BDO A;  2OF1 A;  3PUZ A;  1G6Z A;  1HHV A;  3QJY A;  2CH4 W;  2OXP A;  4AIM A;  4DV3 Q;  1SMX A;  1F9R A;  4OHJ A;  2L0C A;  5JVG 3;  5C4X B;  3VA7 A;  3GTP B;  4LUZ A;  2E2H H;  4FF1 A;  1RHP A;  3W3A A;  2KJX A;  1BXT A;  5KGU A;  1NSN S;  2N78 A;  2IT1 A;  1B3A A;  4PZ7 A;  1LM0 A;  1EEF D;  1VQ4 A;  3RMH A;  1S5B D;  1X3P A;  1DD2 A;  2KHS A;  1SJH D;  1AZQ A;  4G7O C;  1TS5 A;  2A68 D;  4TSS A;  1CA6 A;  5LL6 X;  1TWC H;  3RLO A;  4K2K A;  1Y1V H;  1PTO B;  3P75 A;  4RFB A;  4UP8 A;  1XMQ Q;  3QOL A;  4LAA A;  4BBS H;  4JYA Q;  1S5D D;  5GAG C;  2IHE A;  3M4Q A;  3QWN A;  2CHB D;  1SJE D;  2F0S A;  1HUM A;  4JC0 A;  4ULL A;  4OGQ C;  2RDH A;  2ZM6 L;  4UY8 C;  1M8A A;  1VMP A;  4IUV A;  3N52 A;  4NDX A;  3S2D B;  5LMN Q;  1EOV A;  4BBS G;  2NVT H;  2PI2 A;  4K5X A;  3V05 A;  1X56 A;  2F0H A;  2K03 A;  3S14 H;  2Q2I A;  1QUQ B;  1YI2 A;  3J80 E;  1KLU D;  1HA6 A;  1M90 C;  4XIG S;  1N36 L;  3D3R A;  1JB7 A;  4HCS A;  1D1K A;  2MUY A;  1OO9 B;  1EOT A;  3NQI A;  1C9O A;  1VF7 A;  2GVB A;  2IHF A;  4GNX B;  1I4Q A;  3HOW B;  4LW1 A;  1II3 A;  2WAQ G;  3G48 A;  3GQB A;  3MXG A;  4JI2 L;  1G2S A;  2QIL A;  4XQJ A;  4AYB E;  1X3F A;  2IJ0 A;  4DNT B;  1E0B A;  3M4Y A;  4G7Z C;  1QG7 A;  2O5I C;  3KDF A;  4YHH Q;  1DZ1 A;  5FLM H;  1XNQ Q;  4OEM B;  2MO0 A;  2R7D A;  2Z1C A;  1CTM A;  3FEW X;  4B3T Q;  4LF7 Q;  3G4S A;  1QVG A;  2PNR C;  5EBC A;  3KBG A;  3S9W A;  4LF8 L;  3U9S A;  3I91 A;  1BBW A;  1YVC A;  2EPB A;  3B6Y A;  1QWY A;  1GUN A;  1LT6 D;  4K8I A;  5FLM G;  3JAM c;  1X32 A;  3D4W A;  3H94 A;  1RF2 D;  1EY4 A;  2VQF Q;  4R4Q A;  2ASB A;  5C4H A;  2JA5 H;  5A2Q E;  2QDB A;  1AP0 A;  2BOS A;  1H9M A;  1GOZ A;  2Y0S B;  3PSI A;  3W1B A;  3CRL C;  5I4D A;  1KRS A;  4GKJ L;  1UE1 A;  2PYK A;  3JC6 6;  1EZ8 A;  2JA5 G;  1IW7 D;  2KQ3 A;  3FHW A;  1LT5 D;  2B2W A;  2RCN A;  4K6L A;  3K0Y A;  3NEN A;  4LMQ D;  2JA9 A;  1SND A;  1Q1B A;  4P74 A;  5AJ3 Q;  1O7Y A;  4AQY Q;  2A8V A;  2EYP A;  3MEF A;  2QDL A;  2A68 C;  2OT2 A;  4HSP A;  2NN6 G;  1VS0 A;  2IPK D;  2Q2U A;  2OTL A;  2L12 A;  2SEB D;  1QB5 D;  2I5M X;  3AQQ A;  4DUY L;  1EYG A;  3NQT A;  5LL6 S;  3UDG A;  3AB9 A;  2F0G A;  1HQM C;  3OIP A;  4JV5 L;  4OO1 H;  2D5D A;  2VL6 A;  4FXK C;  3VR3 A;  1EWI A;  2RSN A;  2EXZ A;  3RZD B;  1Q90 A;  2NBF A;  4ZKC B;  4XYO A;  1N33 Q;  1ENA A;  3NTH A;  4LFC Q;  5C6A A;  4MZ9 A;  3BDL A;  2F0K A;  1S5F D;  3I56 A;  3A7L A;  3DEP A;  1HZ9 A;  1MBY A;  2RQX A;  1SMY C;  3OPO A;  1HNW Q;  2ZTE A;  4IUN A;  3VYR A;  4IOA A;  2R61 A;  4N8X 1;  4OXP A;  1VQK A;  4DAY A;  3RLF A;  1SDF A;  5IYC H;  3Q0A A;  5AFW A;  5IP7 G;  3S24 A;  3OWE B;  1GHK A;  3E6Z X;  5T1I A;  1WJJ A;  3M3Y B;  1N32 L;  3UDF A;  2F0Q A;  2BA1 A;  2H5X A;  4IO9 A;  1S40 A;  1XXG A;  3EVQ A;  1PTO F;  3KFU A;  4JI4 Q;  4L5Q A;  3E9I A;  1QOH A;  4OX9 L;  1CUK A;  2AQ1 B;  3HKZ B;  5EPJ A;  2I5L X;  2J0T D;  5HGQ A;  3GTL H;  1IYJ B;  4F87 A;  3T13 A;  3H3V C;  4DR6 L;  4OL7 A;  1B8A A;  1TWH B;  2JA6 B;  1WCM B;  3LWU A;  2EZV A;  4XYQ A;  3PF4 A;  2VUM B;  1JJG A;  1F2Z A;  2L5T A;  1JIC A;  4JI5 L;  1UUP A;  2F3W A;  5EJW A;  3ULL A;  1YNN D;  1HNX L;  3F2B A;  4EQO A;  3KF6 A;  4RAU C;  3VR6 A;  4NPS A;  3MZ5 A;  2B2W C;  4ME3 A;  4BBR B;  3IRB A;  3CW2 C;  4L5R C;  4GKK L;  1YHQ A;  1XNR L;  5IOD A;  4GLX A;  2UUA Q;  2R93 H;  2YV5 A;  3K5O A;  1IW7 C;  3D31 A;  4QIW E;  2HT1 A;  3UE0 A;  1QZH A;  1HR0 L;  1SE2 A;  1WTP A;  4A3L G;  1RIP A;  4QGU A;  1GUG A;  1IXR A;  3BZC A;  3TRE A;  1PYW D;  2R93 G;  1Z9F A;  4JI0 L;  3Q23 A;  1O78 A;  4NXN Q;  1S72 A;  2RDF A;  1U4M A;  1PZK D;  4LF4 Q;  1LTB D;  1PFM A;  2AWN A;  3R8B A;  1A8V A;  4KY5 A;  5C5M A;  4IPH A;  2HDL A;  4MNO A;  3SVM A;  2UXB Q;  1SN8 A;  5M3F B;  2ATW A;  4U67 3;  4KD4 A;  3RR5 A;  1KAB A;  5J3B A;  5JJL A;  1STG A;  2F4I A;  2JSO A;  4A3B B;  1C8C A;  1DGS A;  1ZYR D;  1Q8K A;  1E2V A;  4KTA A;  3OOC A;  2HIV A;  3KJP A;  1EY0 A;  3P1H A;  2XWB B;  4Y7N B;  1J5E Q;  3R93 A;  2IX1 A;  3I4N B;  5IGB A;  2A6H D;  3BG3 A;  4ZQ3 A;  1NR4 A;  3RN5 A;  1HRJ A;  1W2B A;  1B4O A;  3MFG A;  5DEH A;  3MXP A;  1KAW A;  3S15 H;  1IBL L;  4IQZ A;  2EYL A;  4L5S A;  2AMC B;  1IKM A;  2YTX A;  1I3Q B;  4Y52 H;  2R7Z H;  1JJC B;  4TQU S;  2KHJ A;  3F2U A;  4A3I B;  1IBM Q;  1CSP A;  1EU3 A;  5ELE A;  1A62 A;  1VQF A;  2NUC A;  3N6R A;  3E5S A;  3GTJ B;  3K6O A;  4BS9 A;  1WTR A;  2NTT A;  5KIX A;  1RTN A;  4DR4 Q;  1JR0 D;  1PTO D;  2XRQ D;  5IT9 L;  4KHP Q;  2R7Z G;  4IUQ A;  4JW0 A;  2NWG A;  3QR8 A;  1AH9 A;  4DV7 Q;  1DOK A;  5I9P A;  1UE6 A;  1QIL A;  2K5H A;  2K5N A;  3SHL A;  1QVC A;  1UEA B;  2K52 A;  2F3I A;  2NZ1 D;  3D8G A;  3FKI B;  4S3S A;  1YNN C;  2K01 A;  1LTI D;  1Q12 A;  5ELN A;  4A3F H;  1DCZ A;  3GP7 A;  1PRT F;  4XT3 B;  3A55 A;  1HA5 A;  2EDG A;  3GTQ H;  2CWA A;  3CMA A;  1WTO A;  1BCP B;  1VQI A;  4LF5 Q;  4DUZ Q;  1GXD C;  2E2J H;  2B63 B;  4FYD A;  3PMF A;  4A3F G;  4KKS A;  3GTG H;  2KOL A;  4O1N A;  4F88 A;  1QUQ A;  2MNA A;  4GS3 A;  5IGE A;  3U50 C;  1SYD A;  4A3K H;  1SAP A;  1HFG A;  5I6W A;  4K0K L;  1QNK A;  4F8M A;  2KEC A;  3PO3 B;  4O2D A;  3T1H L;  5EBD A;  4CKB A;  5NUC A;  1EY5 A;  2EY1 A;  4YIJ A;  1X6O A;  1EYA A;  2TSS A;  1R4Q B;  2UU9 Q;  3L3O C;  4A3K G;  4A93 B;  1XMO L;  5M5X H;  2PMZ E;  3VYU A;  1KRT A;  2NVX B;  2ZXR A;  4B3R L;  2NZH A;  1XYI A;  1Y8O B;  3E9H A;  5IT9 E;  3TBI B;  4P73 A;  4HIM A;  3CCR A;  2VZA A;  1UAP A;  1JE4 A;  1TWA H;  1ZYR C;  1P8L A;  1D1I A;  4DXF A;  2F0E A;  1HZA A;  1FJG L;  5JPN C;  5M5W B;  1TU2 B;  3NEL A;  2XSC A;  4MTK A;  2WP8 J;  3NTK A;  5L37 A;  4B3S L;  3CRK C;  4FP5 D;  3TP8 A;  4DK3 C;  3K0X A;  4C3I H;  3M4O B;  1K3B C;  3CQZ H;  2Q2T A;  4FVM A;  4HJ9 A;  1NAP A;  1HNZ L;  1LTL A;  1LTT D;  4K5W A;  4POF A;  3TZD A;  3MAQ A;  1E2W A;  2A19 A;  3SK4 A;  1V1P B;  2PQA A;  3HOX H;  3GTO B;  2ICI A;  1SYC A;  4C3I G;  2MPM A;  4BY1 B;  5FLX L;  4O0A A;  4A3D B;  1PV4 A;  4JI1 Q;  2BDN A;  3PO2 H;  3HOV H;  3LGJ A;  1XJV A;  5ELF A;  1SLJ A;  5IGC A;  1R9T H;  3J80 i;  1PTO C;  3VYT A;  1Y1W G;  3HOX G;  2EYM A;  5COR A;  4IZ8 A;  2MO1 A;  2K14 A;  2LXK A;  1BR9 A;  1SYG A;  1QCB D;  3CCS A;  3PO2 G;  1W6K A;  4AH6 A;  3HOV G;  5IYD H;  1EWH A;  5J1Z A;  3VDY A;  1AZP A;  3NTI A;  5JEA H;  1A3U A;  3S1R B;  5KYL A;  3CCL A;  1SNO A;  3DEO A;  4RGM A;  1ZKO A;  3T4A C;  1VQ5 A;  1MHW C;  1JWS D;  1HXY D;  1B70 B;  5CV8 A;  1TWF H;  3X3N A;  2X69 A;  4DR3 L;  1PRT D;  2UXC Q;  1K8A C;  5JEA G;  1YNX A;  3KLS X;  1I50 H;  1I4G A;  4GNX C;  2O4X A;  4QY7 A;  3CC2 A;  1IHZ A;  4PMB A;  3VR4 A;  2XRS D;  1EY7 A;  2PZW A;  3GDE A;  1V1O A;  1GUW A;  1C7Y A;  3DWP A;  1Q86 C;  2A5H A;  2LKV A;  4DV4 L;  2OWO A;  2N55 A;  1EUJ A;  1TQO A;  5CGK A;  4KY6 A;  4V0B A;  1T5E A;  2LMC B;  2CKZ B;  4DFA A;  1RD9 D;  4DNR B;  1J6Q A;  1SRO A;  3EBE A;  4A3J B;  2F52 A;  4X3K A;  2JA8 H;  4X66 Q;  4UPA A;  1MSG A;  2C9O A;  1I6H B;  2KCN A;  1CHQ D;  2K4K A;  1SYE A;  5C3E B;  2Y0S E;  1U4L A;  2QGQ A;  2JA8 G;  3GTP H;  4A3G B;  1Y69 U;  2Z8L A;  1W3S A;  3T1Y Q;  3HOZ B;  3D4D A;  5LMU L;  4BXX H;  5JAV A;  1HTP A;  3J7A V;  2RHS B;  1OXT A;  2EJF C;  2QEJ C;  4A3E B;  4OO1 I;  1E7Z A;  3PUV A;  1JT8 A;  4C3H G;  1PYB A;  2NVQ B;  4G4K A;  1B2T A;  1SNP A;  4BXX G;  1C48 A;  4B9X A;  5J39 A;  2PZT A;  5CC4 A;  4A75 A;  3OIQ A;  1PTO H;  4JBM A;  2LFN A;  1XTD A;  1H9J A;  1SE8 A;  3AYH B;  4O42 A;  4JOI A;  2SNS A;  4N8F A;  2YYZ A;  2EXD A;  4YWL A;  3KJO A;  4A3M G;  4ZKB B;  1IBK L;  1IYU A;  1ROD A;  5C44 B;  1UWV A;  1L0X B;  2E5L L;  1LTS D;  5FOB B;  1YJW A;  1PFB A;  4UP9 A;  2MJ8 A;  1CQV A;  1U4P A;  4U68 A;  3T51 B;  3TN2 A;  4LF9 Q;  3A7A B;  1AEX A;  3A0J A;  2R92 B;  4JCV E;  4GOP B;  4M1U B;  1N36 Q;  1EY6 A;  5IOC A;  3KLR A;  3J80 L;  3TME A;  1OTC A;  1U4R A;  4JI7 L;  5TSS A;  1EFW A;  3HOW H;  4LFB L;  1IL2 A;  4IOC A;  1E2Z A;  4RCO A;  1PH8 A;  2CW0 D;  4QL5 A;  4DF7 A;  2EJM A;  1YBY A;  3BS1 A;  2D2C C;  3OTO L;  4BY7 H;  4DR7 Q;  1VQ7 A;  4DR1 L;  1Y8N B;  3HKZ E;  4JBW A;  1WD0 A;  3QOJ A;  2E2I B;  1CKO A;  4OEL B;  1CI3 M;  1I94 L;  4LF8 Q;  1D2B A;  3URY A;  4KHV A;  1KD1 C;  4BY7 G;  2IW3 A;  2OQ0 A;  3K7U C;  4IN3 A;  5EAY A;  3GV3 A;  4LFA L;  3S16 B;  4HJA A;  2SDF A;  1VQH A;  5FJ8 H;  1N34 Q;  4KN7 C;  3GTM H;  1ESR A;  1SR3 A;  3GTK B;  3D4R A;  5M9O A;  4WJ4 A;  5CYU A;  4L5T A;  5A2Q L;  3IAY A;  1Y1V G;  2E74 C;  3OMC A;  5C4Z A;  1I4R A;  1PLF A;  1FD7 D;  4OON A;  1LT4 D;  1RDP D;  3HOU B;  5EPL A;  2VY3 A;  1CKN A;  4POG A;  2Q2H A;  1SXT A;  2OCE A;  1A3T A;  1PFN A;  1PFS A;  4DR5 L;  3X3M A;  2F1M A;  2WB1 G;  1EIY B;  4B3M Q;  3S1N B;  1SMY D;  2JA7 B;  5M3M H;  4JOI C;  4HAE A;  4MN3 A;  2AQ3 B;  4PMC A;  4QMG A;  1L0W A;  3J81 j;  4KKT A;  3PUX A;  4FXD A;  3CHB D;  4A3C H;  1TWG H;  3SR1 A;  3CCE A;  1CZW A;  3CD6 A;  5M3M G;  3RZD H;  1X54 A;  1AE3 A;  2BA0 A;  3SK5 A;  4I7A A;  4DV2 L;  3M7G A;  4JI6 L;  2L9H A;  1GJX A;  1SFO B;  1VQG A;  2PO4 A;  4OWX B;  3F2D A;  4A3C G;  3CCJ A;  4DV3 L;  1DJR D;  3KF8 B;  2Z4I A;  1KAA A;  3BYY B;  3D6W A;  5D3D A;  4ZUJ A;  1F2Y A;  3EFX D;  1QNU A;  3V96 A;  3C1E A;  5FLX c;  2VB3 X;  2ID0 A;  1M1K C;  4KHZ A;  3S17 H;  2VQE Q;  2JK8 A;  4WJ3 M;  4DN4 M;  2CW0 C;  5E1F A;  2IWH A;  2QEX A;  1O7Z A;  2BH8 A;  2PQA B;  3Q6S A;  1N32 Q;  4RGT A;  1K73 C;  5FO7 B;  1XPR A;  1NJI C;  3C2P A;  2LS0 1;  4FF3 A;  1YJN A;  1CQF A;  2ICE C;  3R3O A;  2K33 A;  1TWC B;  1V1P A;  1XMQ L;  4IFD H;  2I5H A;  4RG1 A;  1HJP A;  5JJK A;  1VQ8 A;  4BBS B;  1K28 A;  5EKL A;  4GN4 B;  1JQY D;  4RHR A;  3DLL A;  1YEZ A;  5LMN W;  4KI0 A;  5CV5 A;  4JBJ A;  2JA6 H;  1WCM H;  1QVF A;  2VUM H;  4IFD G;  4UP7 A;  4X62 Q;  1Z6H A;  5I2Y A;  4C3J H;  3MFY A;  4JI5 Q;  1NY4 A;  3BVG A;  3I3C A;  4KKU A;  2FMM A;  1NMF A;  2PI2 E;  3I73 A;  2HQE A;  1TR5 A;  3G6E A;  2WAQ B;  5FO9 B;  3J81 i;  2B2V A;  3O13 A;  1BCP C;  3A8J E;  4KV6 A;  4C3J G;  4ZLT F;  1IL8 A;  4OO1 G;  2F0J A;  2KCM A;  1F9P A;  2MGS A;  4RHS A;  1HZC A;  3A5Z B;  3H09 A;  1GHJ A;  4YHH L;  4OWW B;  1VQE A;  1GUO A;  2QW7 A;  2BCO A;  1XNQ L;  4JI0 Q;  1HFN A;  1D5Z C;  4B3T L;  4LF7 L;  3OWF A;  5DM7 3;  3NXW A;  2PPB C;  3I4M B;  3FVQ A;  2M9V A;  3BJU A;  3HP3 A;  5BN3 A;  4K6D A;  1A15 A;  4YY3 Q;  2UUC L;  1V8Q A;  1SE3 A;  2F0W A;  2L11 A;  4F7X A;  1K3R A;  5IYC G;  5ISR A;  2B2Y A;  1Q3L A;  2VQF L;  3TRZ A;  2KEN A;  2ALY B;  2JA5 B;  4AYB G;  3W2D A;  1EZ6 A;  1TXY A;  4DV6 Q;  2D0P A;  1ET9 A;  1VQJ A;  2IX0 A;  2NYZ D;  2JE6 I;  3BU2 A;  3GD7 A;  5GRO A;  4A4I A;  4C56 C;  3LWE A;  1E22 A;  2LXJ A;  5EQ0 A;  5LHY 1;  2K6A A;  2YU9 H;  3SDZ A;  5IGD A;  4CJ1 B;  2F3V A;  5AJ3 L;  4AQY L;  1KHI A;  4RGN A;  1BUV T;  1TS2 A;  3QB3 A;  5EKK A;  3M85 A;  1V9P A;  3GTJ H;  4JI8 Q;  1VQO A;  1SBB B;  4ALP A;  2JYO A;  3BZK A;  4XQN A;  4ZUI A;  1XX8 A;  3STB D;  1FL0 A;  4IJL A;  4DKA C;  1GUT A;  4CDF C;  2L1B A;  1VQ6 A;  3IL8 A;  2HCC A;  4KLK A;  2KVM A;  1HZB A;  3FPU B;  1BDO A;  1K83 H;  1N33 L;  5C0X H;  5IGG A;  2B2V C;  1JB3 A;  4LFC L;  4BA1 I;  4KY7 A;  4XQQ A;  1BBX C;  3NBH B;  1O7I A;  1EIF A;  2L55 A;  3MA2 B;  2F4V Q;  4KJN A;  3TS0 A;  1HNW L;  5C0X G;  2B2T A;  2Z6B A;  2FJ2 A;  4PNY A;  4WRD A;  1JOR A;  1EIG A;  3NPP A;  2B63 H;  2WKC A;  4J8Q A;  3WOE A;  5BR8 Q;  4PMW A;  1JOK A;  5DAU A;  4RWS C;  4JI3 Q;  4I65 A;  1A0I A;  2Z9H A;  4GOP A;  3DM1 A;  1UEB A;  3L2P A;  1JOQ A;  4XT1 B;  3FMC A;  3ULJ A;  4P75 A;  3K5L A;  1EU4 A;  1C4Q A;  1MSH A;  3JAM i;  4LWC A;  3AFP A;  2H4O A;  1JOO A;  1WTW A;  1WTQ A;  3CU7 A;  1H95 A;  3K81 C;  2UXD Q;  2B2Y C;  1XMO Q;  2NVX H;  4BWG B;  4IUT A;  3I7F A;  2HHH L;  2L4N A;  2QA4 A;  2K50 A;  3EN2 A;  4YCV A;  3OHX C;  5I6Y A;  1A3V A;  2ZTC A;  3PIO 3;  1TS4 A;  1YNJ D;  3MXU A;  3R2I A;  2K1B A;  2N8N A;  1FJG Q;  4H02 A;  4TVA B;  1XPO A;  4HED A;  1STH A;  4NB3 A;  3H3V H;  3PQI A;  2FXQ A;  4B3S Q;  1EY9 A;  1L0Y B;  2UUA L;  4FF4 A;  1BQQ T;  2ENB A;  2R93 B;  4X65 Q;  4FDB A;  2EIF A;  3RZO H;  2F0P A;  1NR2 A;  4HIO A;  2B8F A;  4NMZ A;  3GTO H;  1CKN B;  3U58 A;  3CC4 A;  4K5V A;  3LNN A;  5D14 A;  1NCV A;  4GLA C;  2SOB A;  4LK1 C;  4NXN L;  3EIV A;  2ZJR A;  1NTG A;  2F0V A;  3TP7 A;  3UDI A;  4TRD A;  3I4O A;  2K7V A;  1KDC A;  4G57 A;  4JG2 A;  4LF4 L;  3GO5 A;  2N88 A;  4KD3 A;  3STB C;  4B9W A;  4HIK A;  2UXB L;  1RL2 A;  2OEO A;  3CXC A;  4KK7 A;  2ZXP A;  3KUP A;  2P5Z X;  1B44 D;  1MI2 A;  4DV1 Q;  4QCL A;  3J81 E;  4CJ2 C;  3S1R H;  2B2T C;  1WD1 A;  1OXX K;  2WV6 D;  4LF6 Q;  3SGI A;  3CCV A;  4IPG A;  3E0J A;  2RHQ B;  1PH4 A;  4HJ5 A;  2SNM A;  1A2T A;  1IKL A;  2HDM A;  4GOP C;  3HGB A;  4QF4 A;  5JJZ A;  1PH2 A;  4FNF A;  2A6E D;  3KF8 A;  4J15 A;  4IFD J;  3KOJ A;  2A69 D;  3S15 B;  4IUP A;  1DYQ A;  1OXS C;  4N9T A;  1ASZ A;  4X6A H;  4X3S A;  4CBV A;  1OXV A;  2R7Z B;  1LYL A;  1IBM L;  5ELC A;  5IWA Q;  2ZXO A;  3PGZ A;  2EJG C;  2OQK A;  5M5Y H;  1Y8P B;  4DV5 Q;  1J8I A;  1TT2 A;  2K04 A;  1PMR A;  4IJH A;  3S2H B;  4DR4 L;  2JJQ A;  1V43 A;  3KYH C;  2UUB Q;  5KNC A;  1B1Z A;  2V1C C;  4KHP L;  1VQC A;  5IE8 A;  2CWP A;  1SSO A;  4ME5 A;  4KMU C;  1EQT A;  4DV7 L;  3KLW A;  1B9N A;  1KLG D;  5T1G A;  2PZU A;  4L63 B;  1LAC A;  3TDQ A;  1KL9 A;  2ZTD A;  5C4J B;  1D8L A;  2EY2 A;  1YNJ C;  2F0T A;  2NB0 A;  4A3F B;  1E1O A;  4WOR A;  3S1Q H;  2R6G A;  3CPF A;  4DR2 Q;  3GTQ B;  4LF5 L;  1WTX A;  4DUZ L;  3H0G H;  1VMC A;  1AN8 A;  4HJ8 A;  1QE6 A;  4C2M H;  2LY7 A;  4LJZ C;  5FO8 B;  1H9R A;  2AUK A;  2IX3 A;  2PQE A;  2PW5 A;  4EVO A;  3HOY H;  3C1F A;  5D65 A;  2PNH A;  4A3K B;  2MFI A;  1OXU A;  3L0O A;  3K7A H;  3CPW A;  4GN5 A;  5IYD G;  3H0G G;  4X64 Q;  4GLV B;  1I4P A;  3IKJ A;  3ONA B;  3PIO A;  2DY8 A;  4R4T A;  1V1Q A;  3U9O A;  2I46 A;  3ITP A;  4DV0 L;  2UU9 L;  1MJC A;  2MP1 A;  3HOY G;  1HPC A;  3CC7 A;  1N8R C;  2EE1 A;  2E76 C;  3R2T A;  4OWT B;  4CHT B;  5M5X B;  2JN4 A;  1E24 A;  2DGY A;  1ILP A;  1MGS A;  4LUV A;  4RKL A;  4DK1 A;  3PIP 3;  1ICW A;  1PHJ A;  2KED A;  1I6V C;  5CV7 A;  3H6M A;  1P16 A;  3A5U A;  4V19 0;  3Q24 A;  1KTK A;  2IY5 B;  4ZCK A;  4HJ7 A;  4HMJ A;  5FKA C;  3PV0 A;  2DY7 A;  4CDE C;  2G9H D;  4C3I B;  1PYS B;  1FNW A;  4CKC A;  3BDO A;  3CQZ B;  2A6E C;  3KBX A;  2A69 C;  2K5Q A;  3MXN A;  3JAM E;  2KCT A;  4IFD I;  4LFB Q;  1BCP F;  3BZD B;  2M2L A;  2WKD A;  1Y1W B;  3HOX B;  4I7Z C;  5C4X H;  1VQ9 A;  4JI1 L;  4B08 A;  4DNI A;  1TY2 A;  1W6J A;  2BE5 C;  4J1M A;  3PO2 B;  2WIN B;  4R4I A;  5C0X J;  1YIJ A;  3HOV B;  2PCF B;  4R9W A;  3TEH B;  1DOM A;  2TMP A;  1S3O A;  4DR1 Q;  3H91 A;  4M8A A;  2GA4 B;  4H0L C;  2ZT9 C;  3W1G A;  4HID A;  5C4X G;  3K5M A;  2AQ2 B;  1LT3 D;  4Q0F A;  2F0M A;  4XXE A;  4PZ8 A;  2DJF C;  2FHT A;  3RNU A;  2B8G A;  1F9S A;  1GO3 E;  1RKN A;  4DAV A;  3K57 A;  1TWF B;  2CFM A;  5E4X A;  3GTK H;  5K5P A;  2UXC L;  1U9R A;  4QUF A;  4P2C B;  5K36 H;  1UE7 A;  1JWU D;  1Z47 A;  4FXG C;  1D5X C;  1KXL A;  1I50 B;  3NBH A;  3S2D H;  1EIH A;  2ZM6 Q;  4IUU A;  3HOU H;  1X3E A;  1L1O B;  4L6T B;  1G8Z D;  4JBK A;  5CR3 A;  3MVV A;  2RKS A;  5DNF A;  1CKM A;  5C5L A;  4X3T A;  1HCZ A;  1STB A;  4CDC C;  1TVX A;  1WTV A;  1KIX A;  5KNB A;  3SEB A;  4C1N K;  2VNU D;  4DK0 A;  2CH4 A;  3V2T A;  3S1M B;  1WTH A;  5GAH C;  5IT9 c;  4XTC S;  4JI2 Q;  1K0R A;  1DM0 B;  3MTS A;  2QKI C;  1Z7T A;  3NEM A;  4X66 L;  4EQN A;  1U0L A;  2CQA A;  3UI2 A;  1ET6 A;  2JA8 B;  4MTN A;  3HOW G;  4P72 A;  1A2U A;  4LUO A;  5CV9 A;  4NXM L;  1TKW B;  2Q8T A;  1H9S A;  4PG3 A;  2KEE A;  4QUC A;  1VQD A;  3K58 A;  3OW7 A;  1LLR D;  2D9U A;  3GV6 A;  2KCC A;  4MHE A;  3T1Y L;  4C3H B;  1X3G A;  4C1N I;  4WFN 3;  5E7N A;  1ILQ A;  2F0N A;  5IP9 H;  5IY0 A;  5JOB A;  1JCK B;  4DK6 C;  3PIP A;  5JJI A;  5KND A;  3NK9 A;  2X6G A;  2Z0S A;  1VF5 C;  1J9O A;  3L9A X;  4YCW A;  1A6X A;  1BCP D;  4RH6 A;  5FJ8 G;  4A3M B;  4GKJ Q;  1PZI D;  3DM3 A;  4ODG A;  5IP9 G;  1G91 A;  5C0X I;  1X3Q A;  3RD4 A;  2NVY B;  1TY0 A;  2Y0S G;  3QG1 A;  3NE5 B;  3NP8 A;  3U4Z A;  3NWT A;  2RSO A;  1O80 A;  2F0U A;  3NSW A;  2E2D C;  2QF7 A;  1RJT A;  3I70 A;  4EX5 A;  1MJE A;  5IGF A;  3ERS X;  4DUY Q;  3K59 A;  2RF4 A;  4RGO S;  3ICE A;  3BVZ A;  3I55 A;  1D5M C;  3KK7 A;  4LF9 L;  4JV5 Q;  3K8A A;  1EL0 A;  3T56 B;  4NKL A;  3UE1 A;  1O7L A;  3DWA A;  1VQA A;  1JC7 A;  1F2L A;  1MKH A;  3AMU A;  3OMG A;  1K8G A;  3FRP B;  3VYS A;  2B3G A;  1ICF B;  5CV6 A;  1AE2 A;  2EOT A;  3QIA A;  2YTY A;  2RDG A;  5IYB H;  1FR3 A;  3MHB A;  4A76 A;  2N49 A;  1BVS A;  2E2H B;  2F0F A;  4DR7 L;  5DLQ E;  1D6E C;  4TKO B;  2D0O A;  4BY7 B;  1G2T A;  1VQB A;  5ELB A;  4IPC A;  1G29 1;  3HFZ B;  3I4M H;  1HUN A;  3M3Y H;  5IYB G;  1B3Q A;  1SYB A;  5EPK A;  5JVH 3;  3H3V I;  4APV A;  1MD2 D;  1PVO A;  4ZAI A;  2A1A A;  2UUC Q;  2B39 A;  5JEA J;  1WVL A;  4N9P A;  3RN2 A;  1GUS A;  1Y1V B;  1N34 L;  4OX9 Q;  3I4M G;  1RCV D;  2VXW A;  1G6P A;  3PUW A;  3J7Z C;  2I0Q A;  4JYA L;  1AFP A;  5EGT A;  3BDC A;  3GTM B;  3NUC A;  3Q8D A;  2XWJ B;  3ND8 A;  1VQP A;  1N9W A;  2JEB I;  3CAM A;  1TWH H;  3P20 A;  4R4O A;  4DR6 Q;  4H13 C;  3A8I E;  3U4V A;  2XVS A;  2WB1 B;  3IFT A;  1CZG A;  5G3L F;  4R8I A;  2NN6 H;  1SYF A;  3ZJY C;  4ABN A;  4JK1 C;  5LMN L;  3HKZ G;  5CBA E;  3TP5 A;  1HNX Q;  1Q81 C;  2NVT B;  4RA8 A;  3CCM A;  3S14 B;  3CCQ A;  1EQQ A;  3EJI A;  4BBR H;  2JA6 G;  1WCM G;  4B3M L;  1KNE A;  2VUM G;  1HTL D;  4GKK Q;  5M3M B;  1XNR Q;  4UHV A;  4FO2 A;  4HR7 B;  4K14 A;  3EA6 A;  1VCI A;  1QZG A;  2RBM A;  1HR0 Q;  4BBR G;  1KC8 C;  3OW2 A;  1TWG B;  4HCE A;  1NNX A;  1LTA D;  1BOS A;  1DXM A;  3HRZ C;  4DXG A;  2HUG A;  5BN4 A;  2HQL A;  1LO5 D;  1NE3 A;  1U5K A;  5I2X A;  1EWC A;  3K5N A;  2B29 A;  3FP9 A;  3WWV A;  4KN4 C;  1PH7 A;  4DAM A;  5M3F H;  5ELD A;  4J6H A;  5IP7 H;  3J7A 5;  2AKW B;  2RVL A;  1CM9 A;  1PRT B;  3PCO B;  1WOC A;  2EY6 A;  4A3B H;  1FVI A;  1ZXT A;  1Q8I A;  2VW9 A;  2DUD A;  3VA5 A;  2VQE L;  2XN9 C;  3WOF A;  2FIN B;  1Q82 C;  3S17 B;  5M3F G;  2Q8I B;  3AU7 A;  1EFI D;  4Y7N H;  3MXN B;  2F0O A;  3I4N H;  3L7Z C;  4PV1 C;  4A3B G;  4GZY C;  4LNQ A;  2XIW A;  1PA6 A;  1IZ6 A;  2WFW A;  5COY A;  3VR5 A;  1GD7 A;  2DNC A;  4JPB W;  1SNM A;  2KHI A;  2CQO A;  3BYT B;  1QJO A;  3A54 A;  1IBL Q;  1H9K A;  3I4N G;  1I3Q H;  1FGU A;  1XWE A;  3M9B A;  2E75 C;  4A3I H;  3RLN A;  1ONL A;  1NMG A;  5E3F A;  1GM5 A;  3KLS A;  2HHH Q;  2F0D A;  2O2L D;  3ERQ A;  4X62 L;  4FF2 A;  3PF5 A;  4C3J B;  3I4L A;  1CA5 A;  1PH6 A;  1YIT A;  4A3I G;  4DPG A;  1GKH A;  2K05 A;  1GVP A;  4DU9 A;  2K28 A;  3UDX A;  5HUR A;  3HKS A;  4A3L H;  1K8O A;  2ZJP A;  2XGT A;  1JJ2 A;  3TSS A;  1HR0 W;  3FKI H;  2BH2 A;  2KA7 A;  1K9M C;  1E3P A;  3J80 c;  2C35 B;  1JMC A;  3P7J A;  2R7F A;  2K75 A;  5G3L D;  4Q5V A;  1LAB A;  2K32 A;  1STY A;  2EVB A;  1D7Q A;  4K2L A;  3M7N A;  2J7Z A;  3D0F A;  3C3L A;  4QQB X;  3FKI G;  4YCU A;  3E3X A;  1L1O A;  1L2F A;  2JQO A;  1CHP D;  4JVZ A;  2Q8R E;  2AUJ D;  1I4X A;  3SK6 A;  5BN5 A;  4OIK A;  1PH3 A;  2EYJ A;  4AYB B;  4ZRZ A;  4YY3 L;  4R4C A;  4K0K Q;  3PO3 H;  1JWM D;  3I90 A;  2B63 G;  3F2C A;  1VDZ A;  4JI4 L;  3T1H Q;  2K5D A;  5KRU A;  3MC0 B;  2EYF A;  2E8G A;  4A93 H;  3H15 A;  3CP0 A;  1DON A;  3DHQ A;  4PQX A;  2MHV A;  3GTL B;  1G51 A;  2R3Z A;  4DV6 L;  3J81 L;  1H9S B;  3PO3 G;  3K80 C;  4B3R Q;  4EGV A;  4HSV A;  1X9N A;  4R8N A;  5FK9 C;  4A93 G;  3A8K E;  4CJ0 B;  3QO2 A;  5M5W H;  2YU9 B;  2J4X A;  1STN A;  1K8M A;  4KJO A;  1T9H A;  5CV4 A;  5KEE A;  3CME A;  3DXJ C;  3M4O H;  2ES2 A;  5CMD A;  1R4P B;  1KDB A;  1Y14 B;  3A56 A;  1TII D;  4JI8 L;  2FFK B;  3Q22 A;  3E0E A;  3S2H H;  1HNZ Q;  3ULP A;  2MQH A;  4DGZ A;  4G7H C;  5A35 A;  3BVM A;  1ZEQ X;  1PZJ D;  2CCZ A;  4K8J A;  1B50 A;  3NBI A;  4CKE A;  2F03 A;  4BY1 H;  4A3D H;  2GVA A;  1X65 A;  1ASY A;  1B53 A;  5C4J H;  1K83 B;  4UAI A;  2C5C A;  2NZO A;  2F0L A;  1HQR D;  3FDT A;  2O5J C;  5HY6 A;  1NUC A;  5GQO A;  2VB2 X;  4BY1 G;  2A73 B;  4A3D G;  2F4V L;  1S5E D;  1B7Y B;  1WYD A;  1VQL A;  1CT1 D;  1EY8 A;  3AFQ A;  1S4Z A;  4YWM A;  5BR8 L;  2L15 A;  2EYO A;  1L1O C;  4E6I A;  1BKB A;  4JI3 L;  3ER0 A;  4OIJ A;  1B9M A;  1J5E L;  1FGB D; 
#chains in the Genus database with same CATH homology
 1I4H A;  1STE A;  3J7Y W;  3RUZ A;  2F0I A;  2NTS A;  5E4W C;  4H44 C;  1SNC A;  5J22 A;  1SE4 A;  2Z4H A;  1SEB D;  4RKB A;  5IIF A;  1STA A;  4UDU C;  2B2U A;  2BE5 D;  4X3U A;  3NWS A;  2EY5 A;  1F9Q A;  2H1E A;  3TP6 A;  3OSO A;  2QCP X;  3FPP A;  3HG9 A;  1TS3 A;  2A6H C;  2JP1 A;  3PUY A;  4NP5 A;  1AW7 A;  3IFD A;  1KNA A;  3HS0 C;  1T5X D;  2X6L A;  5F2D A;  5I9O A;  3RZO B;  4Z9C B;  5DM6 3;  5C3W A;  3T16 A;  3C46 A;  3SXH A;  2IL8 A;  3JAM L;  5D3I B;  2HCI A;  4L8J A;  4IAL A;  2E2J B;  3GTG B;  5HGT A;  3ERO A;  4XDX A;  4QIW B;  3VR2 A;  2V4D A;  1BF4 A;  1F2M A;  3CKI B;  1EEI D;  2M00 A;  1ENC A;  4QB4 A;  3D6C A;  3MEH A;  1IYV A;  4HMI A;  3WDN A;  3SK8 A;  4HN7 A;  3DMU A;  3DWQ A;  3G7L A;  1ENF A;  1UNS A;  1TWA B;  2D62 A;  4MIU A;  2CVR A;  1LTR D;  1ML0 D;  1BNZ A;  3HZX A;  3DUZ A;  3NHH A;  3HEJ A;  5KYI A;  4HTH A;  2JXM B;  4ZK9 B;  2I07 B;  5M5Y B;  2PW7 A;  1EYC A;  1F77 A;  1FNU A;  5FLX E;  2B2U C;  2JEA I;  5EKI A;  1EYD A;  3MWY W;  5C3X A;  2AWO A;  3T53 B;  1LTG D;  1CFM A;  2G9D A;  3G6J B;  4RCN A;  1R9T B;  1RTO A;  2NN6 I;  4ILW A;  2K5W A;  1KDA A;  3S1Q B;  3J7A F;  3SE0 A;  1LV9 A;  1S5C D;  1PXU A;  3H0G B;  1SNQ A;  2KUM A;  4C2M B;  1ESF A;  4EQP A;  3HOY B;  1FYC A;  2EYH A;  3K7A B;  1M4V A;  5CBE E;  4IUR A;  2WII B;  2WAC A;  3I72 A;  2DN8 A;  3LX0 A;  1BO0 A;  5K36 G;  2RA4 A;  1FNV A;  1PDQ A;  4NW2 A;  4ZYS A;  4ID6 A;  1XTC D;  4H7B A;  4WJW A;  5JPM C;  2XNA C;  2DNE A;  3EQL C;  4CGY B;  3I8Z A;  2A74 C;  1CK1 A;  3TZU A;  4DA2 A;  1DOL A;  2PMZ B;  3ZYY X;  1Q1E A;  4BA2 I;  1PRT C;  2FMC A;  4DAP A;  1EQV A;  3ND9 A;  2BDO A;  2OF1 A;  3PUZ A;  1G6Z A;  1HHV A;  3QJY A;  2OXP A;  1F9R A;  4OHJ A;  2L0C A;  5JVG 3;  5C4X B;  3VA7 A;  3GTP B;  4FF1 A;  1RHP A;  3W3A A;  2KJX A;  1BXT A;  5KGU A;  1NSN S;  2IT1 A;  1B3A A;  1EEF D;  3RMH A;  1S5B D;  1X3P A;  1DD2 A;  2KHS A;  1SJH D;  1AZQ A;  4G7O C;  1TS5 A;  2A68 D;  4TSS A;  1CA6 A;  5LL6 X;  4K2K A;  1PTO B;  3P75 A;  4RFB A;  3QOL A;  4LAA A;  1S5D D;  3QWN A;  2CHB D;  1SJE D;  2F0S A;  1HUM A;  4ULL A;  4OGQ C;  2RDH A;  1M8A A;  1VMP A;  4IUV A;  3N52 A;  4NDX A;  3S2D B;  4K5X A;  3V05 A;  2F0H A;  2K03 A;  3J80 E;  1KLU D;  1HA6 A;  4XIG S;  3D3R A;  4HCS A;  1D1K A;  2MUY A;  1OO9 B;  1EOT A;  3NQI A;  1VF7 A;  1I4Q A;  3HOW B;  1II3 A;  3GQB A;  3MXG A;  1G2S A;  2QIL A;  4XQJ A;  2IJ0 A;  4DNT B;  1E0B A;  3M4Y A;  4G7Z C;  1QG7 A;  2O5I C;  1DZ1 A;  2Z1C A;  3FEW X;  1CTM A;  2PNR C;  5EBC A;  3KBG A;  3S9W A;  3U9S A;  3I91 A;  2EPB A;  1QWY A;  1GUN A;  1LT6 D;  4K8I A;  1X32 A;  3D4W A;  3H94 A;  1RF2 D;  1EY4 A;  5C4H A;  5A2Q E;  2QDB A;  1AP0 A;  2BOS A;  1H9M A;  1GOZ A;  2Y0S B;  3CRL C;  5I4D A;  2PYK A;  1EZ8 A;  1IW7 D;  2KQ3 A;  1LT5 D;  2B2W A;  4K6L A;  3K0Y A;  4LMQ D;  1SND A;  1Q1B A;  1O7Y A;  2EYP A;  2A68 C;  2OT2 A;  4HSP A;  2NN6 G;  2IPK D;  2L12 A;  2SEB D;  1QB5 D;  3NQT A;  5LL6 S;  3AB9 A;  2F0G A;  1HQM C;  3OIP A;  4OO1 H;  2D5D A;  4FXK C;  3VR3 A;  2RSN A;  2EXZ A;  3RZD B;  1Q90 A;  2NBF A;  4ZKC B;  4XYO A;  1ENA A;  3NTH A;  5C6A A;  3BDL A;  2F0K A;  1S5F D;  3A7L A;  3DEP A;  1MBY A;  2RQX A;  1SMY C;  3OPO A;  4IUN A;  3VYR A;  2R61 A;  4DAY A;  3RLF A;  1SDF A;  3Q0A A;  5AFW A;  3OWE B;  1GHK A;  3E6Z X;  5T1I A;  3M3Y B;  2F0Q A;  2BA1 A;  1XXG A;  3EVQ A;  1PTO F;  1QOH A;  2AQ1 B;  3HKZ B;  5EPJ A;  2J0T D;  4F87 A;  3T13 A;  3H3V C;  4OL7 A;  1TWH B;  2JA6 B;  1WCM B;  3LWU A;  2EZV A;  4XYQ A;  2VUM B;  1F2Z A;  2L5T A;  1JIC A;  1UUP A;  2F3W A;  5EJW A;  1YNN D;  4EQO A;  4RAU C;  3VR6 A;  3MZ5 A;  2B2W C;  4BBR B;  5IOD A;  3K5O A;  1IW7 C;  3D31 A;  1SE2 A;  1WTP A;  1GUG A;  1PYW D;  3Q23 A;  1O78 A;  2RDF A;  1U4M A;  1PZK D;  1LTB D;  1PFM A;  2AWN A;  3R8B A;  4KY5 A;  5C5M A;  3SVM A;  2HDL A;  5M3F B;  4U67 3;  4KD4 A;  1KAB A;  1STG A;  2F4I A;  2JSO A;  4A3B B;  1C8C A;  1ZYR D;  1E2V A;  4KTA A;  3OOC A;  1EY0 A;  3P1H A;  2XWB B;  4Y7N B;  3R93 A;  2IX1 A;  3I4N B;  5IGB A;  2A6H D;  3BG3 A;  4ZQ3 A;  1NR4 A;  1HRJ A;  1B4O A;  3MFG A;  5DEH A;  3MXP A;  4IQZ A;  2EYL A;  1IKM A;  1I3Q B;  4TQU S;  3F2U A;  4A3I B;  1EU3 A;  5ELE A;  2NUC A;  3N6R A;  3E5S A;  3GTJ B;  3K6O A;  4BS9 A;  1WTR A;  2NTT A;  5KIX A;  1RTN A;  1JR0 D;  1PTO D;  2XRQ D;  5IT9 L;  4IUQ A;  2NWG A;  1DOK A;  5I9P A;  1QIL A;  3SHL A;  1UEA B;  2NZ1 D;  3D8G A;  3FKI B;  4S3S A;  1YNN C;  2K01 A;  1LTI D;  1Q12 A;  1DCZ A;  3GP7 A;  1PRT F;  4XT3 B;  3A55 A;  1HA5 A;  2EDG A;  1WTO A;  1BCP B;  1GXD C;  2B63 B;  4FYD A;  3PMF A;  4KKS A;  2KOL A;  4O1N A;  4F88 A;  5IGE A;  1SYD A;  1SAP A;  1HFG A;  5I6W A;  1QNK A;  4F8M A;  2KEC A;  3PO3 B;  5EBD A;  4CKB A;  5NUC A;  1EY5 A;  2EY1 A;  4YIJ A;  1EYA A;  2TSS A;  1R4Q B;  3L3O C;  4A93 B;  3VYU A;  2NVX B;  2ZXR A;  1XYI A;  1Y8O B;  5IT9 E;  3TBI B;  1UAP A;  1JE4 A;  1ZYR C;  1D1I A;  4DXF A;  2F0E A;  5JPN C;  5M5W B;  1TU2 B;  2XSC A;  2WP8 J;  3NTK A;  3CRK C;  4FP5 D;  3TP8 A;  3M4O B;  4FVM A;  1NAP A;  1LTT D;  4K5W A;  3TZD A;  3MAQ A;  1E2W A;  3SK4 A;  1V1P B;  3GTO B;  2ICI A;  1SYC A;  4C3I G;  2MPM A;  4BY1 B;  5FLX L;  4A3D B;  2BDN A;  5ELF A;  5IGC A;  1PTO C;  3VYT A;  2EYM A;  5COR A;  4IZ8 A;  1BR9 A;  1SYG A;  1QCB D;  1W6K A;  1EWH A;  5J1Z A;  1AZP A;  3NTI A;  5JEA H;  1A3U A;  3S1R B;  5KYL A;  1SNO A;  3DEO A;  4RGM A;  1ZKO A;  3T4A C;  1JWS D;  1HXY D;  5CV8 A;  3X3N A;  2X69 A;  1PRT D;  5JEA G;  3KLS X;  1I4G A;  2O4X A;  1IHZ A;  4PMB A;  3VR4 A;  2XRS D;  1EY7 A;  2PZW A;  1V1O A;  1GUW A;  3DWP A;  2A5H A;  2LKV A;  2N55 A;  1TQO A;  5CGK A;  4KY6 A;  4V0B A;  1T5E A;  2LMC B;  4DFA A;  1RD9 D;  4DNR B;  4A3J B;  4X3K A;  1MSG A;  2C9O A;  1I6H B;  2KCN A;  1CHQ D;  1SYE A;  5C3E B;  1U4L A;  4A3G B;  1Y69 U;  2Z8L A;  3HOZ B;  3D4D A;  5JAV A;  1HTP A;  3J7A V;  1OXT A;  2EJF C;  2QEJ C;  4A3E B;  4OO1 I;  3PUV A;  4C3H G;  2NVQ B;  4G4K A;  1B2T A;  1SNP A;  1C48 A;  4B9X A;  5J39 A;  2PZT A;  5CC4 A;  3OIQ A;  1PTO H;  2LFN A;  1H9J A;  4O42 A;  2SNS A;  2YYZ A;  4ZKB B;  1IYU A;  1ROD A;  5C44 B;  1L0X B;  1LTS D;  5FOB B;  1PFB A;  2MJ8 A;  1CQV A;  1U4P A;  4U68 A;  3T51 B;  3TN2 A;  3A7A B;  1AEX A;  2R92 B;  4M1U B;  1EY6 A;  5IOC A;  3KLR A;  3J80 L;  3TME A;  1U4R A;  5TSS A;  1E2Z A;  4RCO A;  2CW0 D;  4DF7 A;  2EJM A;  3BS1 A;  2D2C C;  1Y8N B;  4JBW A;  1WD0 A;  3QOJ A;  2E2I B;  1CI3 M;  1D2B A;  3URY A;  4KHV A;  2IW3 A;  4IN3 A;  3GV3 A;  3S16 B;  2SDF A;  4KN7 C;  1ESR A;  3GTK B;  3D4R A;  5M9O A;  5CYU A;  5A2Q L;  3IAY A;  2E74 C;  3OMC A;  5C4Z A;  1I4R A;  1PLF A;  1FD7 D;  1LT4 D;  1RDP D;  3HOU B;  5EPL A;  1SXT A;  1A3T A;  1PFN A;  3X3M A;  2F1M A;  3S1N B;  1SMY D;  2JA7 B;  4HAE A;  4MN3 A;  2AQ3 B;  4PMC A;  4QMG A;  4KKT A;  3PUX A;  4FXD A;  3CHB D;  3SR1 A;  1CZW A;  2BA0 A;  3SK5 A;  3M7G A;  2L9H A;  1GJX A;  1SFO B;  2PO4 A;  1DJR D;  2Z4I A;  1KAA A;  3BYY B;  3D6W A;  5D3D A;  4ZUJ A;  1F2Y A;  3EFX D;  1QNU A;  3V96 A;  3C1E A;  2VB3 X;  2ID0 A;  4KHZ A;  4DN4 M;  2CW0 C;  5E1F A;  2IWH A;  1O7Z A;  3Q6S A;  4RGT A;  5FO7 B;  3C2P A;  2LS0 1;  4FF3 A;  1CQF A;  2ICE C;  3R3O A;  2K33 A;  1TWC B;  1V1P A;  4IFD H;  4BBS B;  5EKL A;  1JQY D;  4RHR A;  4KI0 A;  5CV5 A;  4IFD G;  1Z6H A;  5I2Y A;  3MFY A;  3BVG A;  3I3C A;  4KKU A;  2FMM A;  3I73 A;  2HQE A;  1TR5 A;  2WAQ B;  5FO9 B;  2B2V A;  3O13 A;  1BCP C;  3A8J E;  4KV6 A;  4C3J G;  4ZLT F;  1IL8 A;  4OO1 G;  2F0J A;  1F9P A;  2MGS A;  4RHS A;  3H09 A;  1GHJ A;  1GUO A;  2BCO A;  1HFN A;  1D5Z C;  3OWF A;  5DM7 3;  3NXW A;  2PPB C;  3I4M B;  3FVQ A;  2M9V A;  3HP3 A;  5BN3 A;  4K6D A;  1A15 A;  1V8Q A;  1SE3 A;  2F0W A;  2L11 A;  4F7X A;  5ISR A;  2B2Y A;  1Q3L A;  2JA5 B;  3W2D A;  1EZ6 A;  1ET9 A;  2IX0 A;  2NYZ D;  3GD7 A;  2JE6 I;  4C56 C;  3LWE A;  5EQ0 A;  5LHY 1;  2K6A A;  3SDZ A;  5IGD A;  4CJ1 B;  2F3V A;  4RGN A;  1BUV T;  1TS2 A;  3QB3 A;  5EKK A;  3M85 A;  1SBB B;  2JYO A;  4XQN A;  4ZUI A;  1XX8 A;  1GUT A;  2L1B A;  3IL8 A;  2HCC A;  2KVM A;  3FPU B;  1BDO A;  5C0X H;  5IGG A;  2B2V C;  1JB3 A;  4BA1 I;  4KY7 A;  4XQQ A;  1BBX C;  2L55 A;  3MA2 B;  4KJN A;  5C0X G;  2B2T A;  1JOR A;  2FJ2 A;  4PNY A;  4WRD A;  1EIG A;  3NPP A;  2WKC A;  4J8Q A;  3WOE A;  4PMW A;  1JOK A;  5DAU A;  4RWS C;  4I65 A;  3DM1 A;  1JOQ A;  4XT1 B;  3FMC A;  3K5L A;  1EU4 A;  1C4Q A;  1MSH A;  2H4O A;  1JOO A;  1WTW A;  1WTQ A;  3CU7 A;  2B2Y C;  4BWG B;  4IUT A;  2L4N A;  3OHX C;  5I6Y A;  1A3V A;  3PIO 3;  1TS4 A;  1YNJ D;  3MXU A;  3R2I A;  2K1B A;  4HED A;  1STH A;  1EY9 A;  1L0Y B;  4FF4 A;  1BQQ T;  2ENB A;  2R93 B;  2F0P A;  1NR2 A;  2B8F A;  4NMZ A;  4K5V A;  3LNN A;  5D14 A;  1NCV A;  2SOB A;  4LK1 C;  2F0V A;  3TP7 A;  4TRD A;  4G57 A;  2K7V A;  1KDC A;  3GO5 A;  2N88 A;  4KD3 A;  4B9W A;  2OEO A;  4KK7 A;  2ZXP A;  3KUP A;  1B44 D;  1MI2 A;  4QCL A;  3J81 E;  4CJ2 C;  2B2T C;  1WD1 A;  1OXX K;  2WV6 D;  3E0J A;  2SNM A;  1A2T A;  1IKL A;  2HDM A;  3HGB A;  4QF4 A;  5JJZ A;  4FNF A;  2A6E D;  3KF8 A;  4IFD J;  2A69 D;  3S15 B;  4IUP A;  1DYQ A;  1OXS C;  4N9T A;  4X3S A;  4CBV A;  1OXV A;  2R7Z B;  5ELC A;  2ZXO A;  2EJG C;  1Y8P B;  1J8I A;  1TT2 A;  2K04 A;  1PMR A;  3S2H B;  1V43 A;  5KNC A;  1B1Z A;  1SSO A;  4ME5 A;  4KMU C;  1EQT A;  1B9N A;  1KLG D;  5T1G A;  2PZU A;  4L63 B;  1LAC A;  3TDQ A;  5C4J B;  2EY2 A;  1YNJ C;  2F0T A;  2NB0 A;  4A3F B;  4WOR A;  2R6G A;  3GTQ B;  1WTX A;  1VMC A;  1AN8 A;  1QE6 A;  2LY7 A;  4LJZ C;  5FO8 B;  1H9R A;  2AUK A;  2IX3 A;  2PQE A;  2PW5 A;  4EVO A;  3C1F A;  5D65 A;  4A3K B;  1OXU A;  1I4P A;  3IKJ A;  3ONA B;  2DY8 A;  3U9O A;  2I46 A;  3ITP A;  2MP1 A;  1HPC A;  2EE1 A;  2E76 C;  3R2T A;  4CHT B;  5M5X B;  1ILP A;  1MGS A;  4RKL A;  4DK1 A;  3PIP 3;  1ICW A;  2KED A;  1I6V C;  5CV7 A;  3H6M A;  4V19 0;  3Q24 A;  1KTK A;  5FKA C;  4HMJ A;  3PV0 A;  2DY7 A;  2G9H D;  4C3I B;  1FNW A;  4CKC A;  3BDO A;  3CQZ B;  2A6E C;  3KBX A;  2A69 C;  2K5Q A;  3MXN A;  3JAM E;  4IFD I;  1BCP F;  3BZD B;  2M2L A;  2WKD A;  1Y1W B;  3HOX B;  4I7Z C;  4B08 A;  1TY2 A;  1W6J A;  2BE5 C;  4J1M A;  3PO2 B;  2WIN B;  3HOV B;  5C0X J;  2PCF B;  4R9W A;  1DOM A;  2TMP A;  3H91 A;  4M8A A;  2GA4 B;  4H0L C;  2ZT9 C;  3K5M A;  2AQ2 B;  1LT3 D;  4Q0F A;  2F0M A;  4XXE A;  2FHT A;  2B8G A;  1F9S A;  1RKN A;  4DAV A;  3K57 A;  1TWF B;  5E4X A;  5K5P A;  1U9R A;  4QUF A;  4P2C B;  5K36 H;  1JWU D;  1Z47 A;  4FXG C;  1D5X C;  1I50 B;  3NBH A;  1EIH A;  4IUU A;  4L6T B;  1G8Z D;  5CR3 A;  3MVV A;  2RKS A;  5DNF A;  5C5L A;  4X3T A;  1HCZ A;  1STB A;  1TVX A;  1WTV A;  5KNB A;  3SEB A;  4C1N K;  2VNU D;  4DK0 A;  3V2T A;  3S1M B;  4XTC S;  1DM0 B;  3MTS A;  2QKI C;  1Z7T A;  4EQN A;  3UI2 A;  2CQA A;  1ET6 A;  2JA8 B;  1A2U A;  5CV9 A;  1TKW B;  2Q8T A;  1H9S A;  2KEE A;  4QUC A;  3K58 A;  3OW7 A;  1LLR D;  2D9U A;  3GV6 A;  2KCC A;  4MHE A;  4C3H B;  4C1N I;  4WFN 3;  1ILQ A;  2F0N A;  5JOB A;  1JCK B;  5KND A;  3NK9 A;  2X6G A;  1VF5 C;  1J9O A;  3L9A X;  1A6X A;  1BCP D;  4RH6 A;  4A3M B;  1PZI D;  4ODG A;  1G91 A;  5C0X I;  1X3Q A;  3RD4 A;  2NVY B;  1TY0 A;  3QG1 A;  3NE5 B;  3NP8 A;  3NWT A;  2RSO A;  1O80 A;  2F0U A;  3NSW A;  2E2D C;  2QF7 A;  1RJT A;  3I70 A;  5IGF A;  3K59 A;  4RGO S;  3BVZ A;  1D5M C;  3KK7 A;  1EL0 A;  3T56 B;  4NKL A;  1O7L A;  3DWA A;  1JC7 A;  1F2L A;  3AMU A;  3OMG A;  3FRP B;  3VYS A;  5CV6 A;  2EOT A;  3QIA A;  2RDG A;  1FR3 A;  3MHB A;  2E2H B;  2F0F A;  1D6E C;  4TKO B;  4BY7 B;  1G2T A;  5ELB A;  1G29 1;  1HUN A;  1SYB A;  5EPK A;  5JVH 3;  1MD2 D;  4ZAI A;  2B39 A;  5JEA J;  1WVL A;  4N9P A;  1GUS A;  1Y1V B;  1RCV D;  2VXW A;  3PUW A;  1AFP A;  5EGT A;  3BDC A;  3GTM B;  3NUC A;  2XWJ B;  3ND8 A;  2JEB I;  3P20 A;  4H13 C;  3A8I E;  2XVS A;  2WB1 B;  3IFT A;  1CZG A;  5G3L F;  4R8I A;  2NN6 H;  1SYF A;  4ABN A;  4JK1 C;  5CBA E;  3TP5 A;  2NVT B;  4RA8 A;  3S14 B;  3EJI A;  1KNE A;  1HTL D;  5M3M B;  4FO2 A;  4HR7 B;  4K14 A;  3EA6 A;  1VCI A;  2RBM A;  1TWG B;  4HCE A;  1LTA D;  1BOS A;  1DXM A;  3HRZ C;  4DXG A;  2HUG A;  5BN4 A;  1LO5 D;  5I2X A;  1EWC A;  3K5N A;  4KN4 C;  5ELD A;  4J6H A;  2RVL A;  1CM9 A;  1PRT B;  2EY6 A;  1ZXT A;  1Q8I A;  3VA5 A;  2XN9 C;  3WOF A;  2FIN B;  3S17 B;  2Q8I B;  3AU7 A;  1EFI D;  2F0O A;  3L7Z C;  4PV1 C;  4GZY C;  2XIW A;  5COY A;  3VR5 A;  2DNC A;  1SNM A;  3BYT B;  1QJO A;  3A54 A;  1H9K A;  1XWE A;  2E75 C;  1ONL A;  5E3F A;  3KLS A;  2F0D A;  2O2L D;  3ERQ A;  4FF2 A;  4C3J B;  3I4L A;  1CA5 A;  2K05 A;  4DU9 A;  5HUR A;  2K28 A;  1K8O A;  3TSS A;  2KA7 A;  3P7J A;  5G3L D;  4Q5V A;  1LAB A;  2K32 A;  1STY A;  2EVB A;  4K2L A;  3M7N A;  2J7Z A;  3C3L A;  1CHP D;  2Q8R E;  2AUJ D;  1I4X A;  3SK6 A;  5BN5 A;  4OIK A;  2EYJ A;  4AYB B;  4ZRZ A;  1JWM D;  3I90 A;  1VDZ A;  2K5D A;  5KRU A;  3MC0 B;  2EYF A;  1DON A;  3DHQ A;  4PQX A;  2MHV A;  3GTL B;  2R3Z A;  3J81 L;  1H9S B;  4EGV A;  4HSV A;  4R8N A;  5FK9 C;  3A8K E;  4CJ0 B;  3QO2 A;  2YU9 B;  2J4X A;  1STN A;  1K8M A;  4KJO A;  5CV4 A;  5KEE A;  3DXJ C;  5CMD A;  1R4P B;  1KDB A;  3A56 A;  1TII D;  3Q22 A;  2FFK B;  4DGZ A;  4G7H C;  5A35 A;  3BVM A;  1ZEQ X;  1PZJ D;  4K8J A;  1B50 A;  3NBI A;  4CKE A;  2F03 A;  1B53 A;  1K83 B;  4UAI A;  2C5C A;  2F0L A;  1HQR D;  3FDT A;  2O5J C;  1NUC A;  2VB2 X;  2A73 B;  1S5E D;  1CT1 D;  1EY8 A;  1S4Z A;  2EYO A;  4E6I A;  4OIJ A;  1B9M A;  1FGB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...