5BR8Q

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5br8Q00
4JI6L 3JAMi 2VZAA 2B63G 4A3BG 5LMNQ 4AQYL 3M4OH 2JEAI 2IX0A 1V43A 2UUBQ 3OTOQ 3PGZA 3A5UA 4A3DH 1NMFA 3MXNB 5IYDG 3EIVA 1PYBA 3K0XA 2KCMA 2UXCL 2RHQB 4GNXB 1X9NA 1NMGA 2LXKA 4Y7NH 4JI5L 1KD1C 4EQ5A 2Q2HA 4DR5Q 3RN5A 3GTGH 2UUAL 1IBML 2HIVA 1VQKA 3HOUH 3I4MH 3VDYA 1Q12A 3KDFA 3F2CA 1SR3A 1XTDA 1HZCA 5IWAL 1HNZL 1Y1VG 1XNRQ 2IHEA 4HIMA 3K8AA 5GROA 4LFBQ 1YNXA 2HQLA 1CUKA 1N32Q 3S1NH 1WI5A 2WP8J 5GAHC 2AHOB 3OYYA 2PI2E 4LFAQ 4P74A 3UDGA 1CKNA 4JI1L 1KHIA 1Q8KA 4AYBE 1HNXL 1OXUA 4DV0L 4DR4L 1E3PA 4L5TA 1L2FA 1E24A 2CKZB 3CCSA 4OWXB 1PV4A 4YCUA 3KJPA 1KL9A 1X54A 1FJGQ 2E2JH 1YBYA 3GTLH 3HOZH 1VQJA 1NJIC 3K7UC 5C4XH 1UE1A 2K5VA 2NVTH 1TWHH 3PO3H 1VQDA 3AFQA 1I94L 4A3CH 1S40A 3JC66 1I50H 3S1RH 1XMOQ 4H02A 2EIFA 1Q1BA 2Q2IA 3D0FA 4X65L 5C44G 4DUYQ 1N34Q 1YJ9A 4BY1H 4GKKQ 2UXBQ 4P75A 5JJKA 2LXJA 1K83H 4PZ8A 4QJFA 3I4MG 3TRZA 3EN2A 2GN5A 4DUZL 2WB1E 2KBNA 4JCVE 1EYGA 1MIUA 3RNUA 2JA8G 3W1BA 4QIWE 4ALPA 2R93H 2VUMG 1EIFA 5IP7G 4LF5L 5LMNL 3RN2A 4A3CG 3RLFA 3E9HA 1J6QA 1WJJA 4MNOA 3AYHB 2QA4A 4A3JH 3HOWG 4JYAQ 4KHPL 4A3BH 3I55A 1G51A 1QUQA 5M5WH 4B3ML 1VS0A 3CCLA 1ASYA 5C0XJ 1EIYB 3BJUA 3NELA 4X62Q 4LUVA 3S16H 3AFPA 1SFOH 3PO2G 4K0KQ 2KHJA 5IWAQ 1VQGA 3J7A5 3CW2C 1IBKQ 3H0GH 2GVBA 4BBRH 1ASZA 4NXNL 1GVPA 4LNQA 1PH5A 4DNIA 1N32L 4OX9Q 1B7YB 4A3GG 3KF8B 2PQAB 1QZGA 1XNQQ 5GAGC 4Y52H 1RL2A 4A3MH 3GTKH 1E1OA 4ME3A 1C7YA 4JI0Q 2KCTA 1PVOA 4LF7L 1PH7A 5M3MG 4BY1G 2K5NA 5FLMH 1VQLA 4IPGA 4HJAA 4JI4Q 2UXDQ 4DV0Q 3EBEA 4OWTB 3M85A 4UP8A 1PH9A 4PMWA 4P73A 1JJGA 2YV5A 4BXXH 4JI8Q 2B63H 1K0RA 2JJQA 1Q81C 5IY0A 2YU9H 4LUZA 5AJ3L 3JAMc 2OQ0A 3BZKA 4LFCL 3CC2A 4GOPB 1YHBA 2RCNA 4GKJL 2C35B 2BH8A 2ASBA 4LWCA 3S14H 2MFIA 5GADC 3ERSX 5FLXc 2R93G 3CP0A 3S1QH 1EQRA 3HOVG 1CSQA 1N34L 4B3TQ 2A8VA 1UWVA 1YI2A 2UXBL 3U4VA 3U58A 1Y1WH 4B3SQ 3DLLA 3T1HL 1L1OC 1VQIA 2N8NA 5DLQE 4DUZQ 2Y0SE 4DV6L 4DV4L 1U5KA 3G6EA 3PIPA 4X66Q 1HZBA 5ELOA 4QL5A 4A3IG 2PNHA 3L2PA 1DGSA 2N3SA 4DV3Q 4A3KH 1UEBA 4A3MG 4JC0A 2HIXA 2UU9Q 4R4TA 4DV1L 2BA1A 4DR3L 3UDXA 4TQUS 1X65A 2V1CC 4LF6L 2BH2A 3HFZB 2UUBL 1OXTA 3CD6A 1A63A 1L1OB 1X55A 1GKHA 5C4JH 1X6OA 5LMUQ 2VY3A 3CMEA 3HOUG 2CFMA 4DAYB 5C0XG 4DV7Q 1K8AC 4HIOA 4OWWB 2WB1G 1K8GA 1Y14B 1KRTA 3CCEA 4O0AA 1J5EQ 4FDBA 3TEHB 3TQYA 1LUZA 1IBMQ 3PSIA 4JBJA 2K75A 3J7ZC 4JI6Q 5M3FG 4KI0A 2GVAA 1PFSA 4POFA 1RIPA 1JE5A 3HOXG 1HNZQ 3OTOL 1VQEA 1XNRL 2ZM6Q 3F2DA 1G6PA 1EWIA 1LTLA 2OCEA 2Z6KA 4IPCA 4YY3L 2KHIA 3S2DH 1UE7A 4A3FG 4DK6C 3CPWA 1QVCA 2UXDL 4JI5Q 5J3BA 4LF8L 1VCIA 4DR6Q 2VQFQ 2I5LX 1FVIA 3FKIG 4X64L 4JI7L 2R7ZH 3HKZG 1Y1WG 3H3VH 2F4VQ 1B70B 2E5LQ 3CF5A 4A3EH 3U4ZA 4A93H 5AJ3Q 3BU2A 4BY7H 2B29A 1VQ9A 4YCWA 2ATWA 4HJ7A 3M7NA 4X6AH 4GKJQ 4MTNA 3I56A 2PQAA 3E9IA 2I5HA 2OTLA 5C3EG 5H1SE 1I94Q 3S1MH 2K52A 4B3SL 3UE0A 2I5MX 1OTCA 1LYLA 1YVCA 4YWKA 4DV6Q 1VQMA 4DR4Q 2AWNA 2ZJPA 2F52A 4C2MH 2JA7G 1AE3A 2VNUD 2HHHL 1O7IA 2NVXH 1HNWL 4IPHA 2E2IH 2VQEQ 2QGQA 4LW1A 2DUDA 1IZ6A 4IO9A 5FJ8H 2EQSA 1VQPA 2N49A 3HOWH 5JEAG 4UP9A 5GAEC 4A3FH 4LF9Q 1BVSA 1W2BA 1XMOL 4DKAC 1IBKL 4JI2L 4BA2I 4KHPQ 2ZTDA 3G71A 2MQHA 2ZTCA 1NBWA 2JK8A 1N33Q 2RF4A 2N78A 3K80C 1VQNA 4GLAC 2ID0A 1VQ7A 4L5QA 4JI3L 3M3YH 1SMXA 3CQZH 4AIMA 2VS1A 1WCMH 2ZM6L 1XMQL 3F1ZA 1GO3E 2KENA 2CCZA 3ULLA 5IT9c 4B3MQ 2IHFA 5IYCG 2IX1A 4R4OA 2Q2TA 2VQFL 1Q7YC 1I3QH 5K36G 2JEBI 1M1KC 2JA5H 2AKWB 3M4QA 2K4KA 4DR1Q 1KRSA 1H95A 2NN6G 3G4SA 5C0XI 4IJLA 4PZ6A 4IOAA 3AQQA 2Z0SA 4OO1G 3K81C 4PG3A 3ICEA 1KAWA 2OWOA 1MKHA 1OXSC 4IJHA 4R4QA 4P71A 5JJLA 1D7QA 1PH8A 1VQBA 4DPGA 4DR5L 3CC7A 1VQOA 1BBUA 1AE2A 3SGIA 4QY7A 4HJ9A 1EQQA 1PH2A 3CCRA 4QGUA 4JI4L 1EOVA 2R92H 4IPDA 1HJPA 2PI2A 3KJOA 1XPOA 1KQSA 4KLKA 1XPRA 3HKZE 4YWMA 2HHHQ 3KYHC 3HOYH 3T1HQ 3IRBA 3NEMA 1YZ6A 1QZHA 1HR0W 1HNXQ 3PF4A 4IFDI 2D62A 3UDIA 3TS2A 3I4NH 5IYDH 1U0LA 1S3OA 4YHHQ 1EUJA 2MNAA 4UY8C 4DV3L 1PHJA 3KDFB 1UE6A 3OW2A 5BR8L 2NZHA 4A4IA 1C9OA 4YCVA 4B3TL 4GLXA 4DV1Q 2I0QA 3T1YQ 1A62A 4NXMQ 1Q82C 1VQCA 3CCQA 4LFAL 4DV4Q 3CCUA 3PUWA 3WWVA 1IBLL 4DK3C 4IFDJ 5LMUL 4YWLA 3W1GA 1PA6A 3I4NG 3Q8DA 1YEZA 2K50A 1PYSB 4OONA 3GTQH 1HR0Q 2B3GA 4GLVB 4A3DG 1NY4A 4A76A 3STBC 1B8AA 2E2HH 1NE3A 2JQOA 3F2BA 1Q86C 4O2DA 5C4XG 3S15H 1KC8C 5E7NA 2L15A 1SROA 3KOJA 3LGJA 4BA1I 1E1TA 4B3RL 2VW9A 1IYJB 4YY3Q 1PH6A 1YHAA 2OTJA 4HJ8A 2R7FA 3GDEA 1MJCA 1Z47A 4JOIA 1YITA 3HOZG 4DUYL 2CWAA 4PZ7A 2R7ZG 2E8GA 4A3EG 2CWPA 3CAMA 4BXXG 1OXVA 4JG2A 4MZ9A 1OXXK 2LSSA 3S24A 4X62L 1V1QA 1N9WA 2WAQG 4A3GH 4JBKA 4K0KL 5M5YH 1QUQB 3L0OA 4DR2L 5C44H 2HT1A 2NVQH 3RZOH 1YJWA 3M9BA 1K73C 2K5HA 4DAMA 1WYDA 5M3MH 1BKBA 1L0WA 4LF4L 4DV2L 1W3SA 3GTPH 4JYAL 1YJNA 1XNQL 4A3LH 4LF8Q 1JB7A 5M3FH 1NTGA 2PMZE 2R6GA 1I6HH 4XIGS 1TXYA 4A3IH 2F4VL 4WJ4A 1X3EA 1VQFA 2AWOA 1CKNB 2JA6G 3CXCA 4UPAA 4GNXA 2DGYA 2UUCL 4JI8L 1IL2A 4RMFA 2VQEL 3GTOH 1AH9A 1QVFA 1X56A 5IYBG 3T1YL 1D8LA 4R4CA 3PF5A 4LF9L 2IY5B 3W5OA 3I2ZA 5EAYA 4JI0L 5IP7H 3PUXA 3A5ZB 1IBLQ 1A8VA 2BA0A 3B6YA 4GN5A 5JJIA 2QEXA 3J80c 1PH1A 1Z9FA 1CKOA 3CCMA 1HR0L 2UUAQ 4R4IA 3RLNA 4C3JH 4HIKA 4P72A 4JI1Q 4APVA 2MO1A 1P16A 1VQ4A 5GQOA 3ZJYC 4IFDG 4JV5Q 3CCJA 2ALYB 4LFBL 1BBWA 4JI2Q 4LUOA 2UU9L 3KF6A 4B3RQ 1I5FA 2YTVA 5IYCH 1TWGH 1M90C 4TVAB 2NVYH 4POGA 1UE5A 3GTMH 4L5RC 4LF6Q 1G291 2XTIA 3I4OA 3HOYG 3HKSA 4IOCA 4BBSG 3H15A 3UE1A 2FXQA 3A0JA 4BY7G 5IP9H 3BZCA 4L5SA 4DR7Q 4DR2Q 1N36L 3UDFA 2NN6I 1E22A 1L1OA 1A0IA 2ZTEA 4J15A 3STBD 1PH4A 3CC4A 2A19A 2Z6KC 1HZ9A 4NPSA 3PO3G 4LF4Q 4GOPC 2JA6H 1C0AA 3PV0A 5HGQA 3S17H 1E7ZA 1GM5A 2ZJRA 3J80i 3RZDH 2R92G 5FLMG 4DR3Q 4OO1I 3H3VI 4A3KG 2JE6I 2EXDA 2OQKA 4QQBX 2JA9A 2WFWA 1Y1VH 1GD7A 2WAQE 1P8LA 1N8RC 1FL0A 1JJ2A 3PO2H 4GKKL 4DR6L 5IP9G 4DV7L 1CSPA 2A1AA 2RHSB 3ER0A 5FJ8G 1SN8A 3CMAA 2IT1A 2CQOA 3HOVH 1FGUA 1JMCA 2JA5G 3DM3A 4NB3A 3S2HH 4LF5Q 1VQHA 4OXPA 4GN3B 4EX5A 3NBHB 5BR8Q 1QVGA 1SRUA 1X3FA 4XTCS 3J81i 4NXNQ 2JA8H 4DV5L 2VUMH 4OX9L 1HZAA 3K7AH 4AQYQ 4A3JG 4NXML 4KHZA 3J81c 4RG1A 3KFUA 1VQ6A 4WJ3M 1KXLA 1SE8A 4LF7Q 3PIOA 5JEAJ 1VQAA 2UXCQ 4X64Q 3ULPA 4JI7Q 4YHHL 2H5XA 3KLWA 4GOPA 2E5LL 4AH6A 2Y0SG 4JV5L 1HNWQ 3RLOA 3D31A 4AYBG 1VQ8A 2F3IA 3FKIH 4GN4B 2MO0A 1TWCH 5LMNW 1HH2P 1WFQA 4GS3A 4JOIC 1R9TH 5HY6A 4C3HH 2R7DA 1PH3A 3PUYA 4BBRG 4C3IH 5M5XH 1S72A 3FHWA 2NZOA 1IXRA 3H0GG 3PUZA 4HJ5A 3GTJH 3HOXH 1YIJA 4LFCQ 1JT8A 1MJEA 3A74A 3GO5A 3L7ZC 2D0PA 3E0EA 2XGTA 1N33L 4A75A 1JJCB 3KF6B 1N36Q 4DR7L 4R1JA 3FP9A 1YHQA 4BBSH 3GD7A 3J81j 3MEFA 2ZJQA 1WCMG 4HIDA 1Q1EA 1WOCA 2YTXA 2Q2UA 4JI3Q 3NENA 1XPUA 2JA7H 1VQ5A 4A3LG 1V9PA 3M4PA 3U50C 1FJGL 1Q46A 4DV2Q 2ES2A 4JBMA 3ULJA 1X3GA 3RR5A 3F8TA 1LM0A 1K9MC 2D0OA 1TWFH 4A93G 3CCVA 2YTYA 3PCOB 1EFWA 2YYZA 4UP7A 2AMCB 4X65Q 4GNXC 4DR1L 4X66L 5ELNA 1TWAH 3PUVA 1XJVA 3I7FA 5IE8A 1CKMA 1SLJA 1J5EL 3AEVA 2UUCQ 2K14A 5IYBH 4JBWA 1K3RA 3G48A 3TREA 5C3EH 1T9HA 3TS0A 1XMQQ 1KIXA 3CPFA 2VL6A 4DV5Q
chains in the Genus database with same CATH superfamily
4JI6L 2VZAA 3VR6A 1IKLA 3M4OH 2JEAI 2IX0A 3OTOQ 1JORA 3IL8A 5IYDG 2UXCL 2RHQB 2BDOA 1TS2A 2FFKB 1VF5C 1SYEA 1KD1C 4EQ5A 1LT6D 1VQKA 3S1NB 2C9OA 3QOJA 3BDOA 3F2CA 1SR3A 5IWAL 1Y1VG 2SNMA 4FP5D 2XWBB 4LFBQ 3PO2B 1CUKA 4R9WA 1PYWD 3K57A 1SNCA 1WI5A 5GAHC 1FR3A 4LFAQ 4ME5A 4QIWB 4IUPA 5IOCA 3UDGA 1CKNA 1ILQA 1HNXL 1OXUA 4DV0L 1HUMA 5COYA 1R4PB 4OWXB 4YCUA 1O7YA 2KCNA 1X54A 1FJGQ 2E2JH 1ML0D 5C4XH 1I94L 1PTOF 2RDGA 5DEHA 3S1MB 1XMOQ 1IBKQ 4GKKQ 3I70A 4BY1H 4K5WA 2UXBQ 5JJKA 2LXJA 1EU3A 2KBNA 3S1RB 3W1BA 2VUMG 1B1ZA 1EIFA 4LF5L 3SE0A 3S16B 3RLFA 4IALA 1J6QA 4JYAQ 1G51A 1ASYA 5DM73 1EIYB 3BJUA 3NELA 1UUPA 3OIPA 2KHJA 3DWPA 4BBRH 1GVPA 1YNJC 1PH5A 4OX9Q 1GUWA 3KF8B 2PQAB 4DU9A 5GAGC 3MFGA 1RL2A 1K28A 4JVZA 2QF7A 4XQJA 1PH7A 4LF7L 3X3MA 5M3MG 2L12A 4AYBB 4FXGC 2EZVA 4DV0Q 1PH9A 4KJOA 4HMJA 4P73A 3K58A 2B63H 1LO5D 4CBVA 5IY0A 2OQ0A 3BZKA 4GOPB 4XYOA 1TS5A 1K3BC 4LWCA 2MFIA 3CP0A 1D6EC 1N34L 4DFAA 1EYDA 4B3TQ 2EJMA 3U4VA 1VQIA 3VR2A 4DV6L 1HCZA 2PZUA 3IAYA 1HZBA 2MP1A 3GP7A 1DM0B 2N3SA 4JC0A 3I8ZA 5DAUA 4DNRB 1BQQT 3FKIB 4WJWA 1CTMA 5CV7A 4G4KA 4IURA 2Q8IB 2BH2A 1A63A 1WTQA 1L1OB 1GKHA 2EYLA 1Y1VB 3VA7A 1U4RA 2JN4A 5EKIA 3SEBA 5LMUQ 2CFMA 1K8AC 4HIOA 3SK6A 4C3IB 3HOUB 3M3YB 1LUZA 4RFBA 1ENAA 3HOVB 3C1EA 5M3FG 4KI0A 2GVAA 1PFSA 4POFA 1E2WA 1VQEA 3OTOL 1EWIA 1IKMA 5CV4A 4A3FG 1B53A 1DOKA 2VQFQ 5KYLA 3H3VH 1PZJD 3NBHA 4OHJA 5EJWA 5AJ3Q 3BU2A 4BY7H 4F87A 2SNSA 1PLFA 3I56A 4XDXA 4BY1B 3NP8A 2OTLA 3S1MH 2WAQB 3HP3A 3UE0A 4B3SL 2I5MX 1G2SA 4YWKA 4DV6Q 2N55A 2KEEA 3LX0A 2IWHA 5J22A 2DUDA 5FK9C 2EQSA 2N49A 3BYYB 5JEAG 4KMUC 5EBDA 4ZKBB 3J7AF 1YNNC 3AU7A 4JK1C 2ZTCA 5EPKA 3CQZB 1N33Q 4WFN3 3BZDB 3K80C 2EY5A 3A56A 1VQNA 2ID0A 2HCIA 4JI3L 2LFNA 3JAME 3CQZH 1HFNA 3EA6A 2CCZA 2KENA 4QUCA 4B3MQ 2IHFA 2IX1A 3A7AB 3IFDA 3SK4A 2JEBI 1M1KC 2NYZD 3M4QA 1FNUA 1KRSA 1ENFA 3CHBD 2AUJD 4PZ6A 3L9AX 2B2VA 3MA2B 2CVRA 3ICEA 1F9SA 4B9WA 1OXSC 1BCPC 4R4QA 5ELEA 4DPGA 3CC7A 5EPLA 1EQQA 2JXMB 4NMZA 3CCRA 4JI4L 4N9PA 1XPOA 3J81L 2HHHQ 3HOYH 3T1HQ 3IRBA 3MTSA 4HTHA 5D3IB 1HNXQ 2MJ8A 3NHHA 1D1IA 1TT2A 2RDFA 3UDIA 3I4NH 5IYDH 1S3OA 4YHHQ 2EJFC 2F0UA 4A4IA 1C9OA 1JC7A 2FINB 4DV1Q 2I0QA 1A62A 4NXMQ 1EY5A 2KHSA 3CCQA 3CCUA 1Q90A 1IBLL 2ZXRA 2WIIB 4DK3C 4C3JG 1IW7D 4RKBA 4YWLA 1I4PA 1PA6A 3Q8DA 2K50A 1PYSB 4A3DG 2B3GA 4KY6A 1NY4A 2IPKD 3STBC 4RA8A 2E2HH 1WTRA 1Q86C 2ZXPA 4KN4C 3I91A 4XT3B 3F2UA 1EYCA 3LWUA 1E1TA 4C1NK 4HJ8A 1MJCA 1SE3A 4DUYL 1EY0A 2E8GA 3CAMA 4BXXG 4MZ9A 1OXXK 2WAQG 2G5DA 4K0KL 2NVQH 3RZOH 3M9BA 2K5HA 4DAMA 4K6LA 5M3MH 1L0WA 4DNTB 4DV2L 3GTPH 3OMGA 1XNQL 1H9SB 2PYKA 4JYAL 2ENBA 3FPPA 5M3FH 3H3VC 1M4VA 3GTKB 2R6GA 1I6HH 1TXYA 4WJ4A 2SDFA 1RF2D 1VQFA 3SK8A 3QR8A 2B2YA 2VQEL 3GTOH 3R3OA 2DY7A 2F0KA 3MAQA 1TIID 2IY5B 1HA5A 3FMCA 1BUVT 1NCVA 2NN6H 3ONAB 1WTPA 1IBLQ 2BA0A 3B6YA 3TP7A 5KYIA 1TWGB 1CKOA 3KLRA 1JWUD 2EYHA 4JV5Q 3EQLC 2OEOA 4JI2Q 4B3RQ 1GHJA 1I5FA 1I50B 1M90C 3GTMH 3HOWB 2L1BA 4LF6Q 1I4XA 5C6AA 3HOYG 3HKSA 3I4NB 3T51B 2FXQA 1PZID 1X3QA 4DR2Q 2NN6I 1L1OA 1VDZA 4R8IA 3CC4A 2Z6KC 2ZXOA 3TP8A 2D2CC 3PV0A 3C46A 2JE6I 2L55A 2NTSA 2WFWA 1GD7A 2WAQE 3P20A 1O80A 4F7XA 2HUGA 3MXUA 3JAML 2CQOA 3HOVH 2ICIA 1LTAD 4NB3A 5F2DA 1SSOA 4LF5Q 1VQHA 3HS0C 2A68C 4PMCA 2PCFB 3S1QB 4EX5A 3KLSX 3NBHB 3V05A 1QVGA 2VUMH 1KLGD 4C3HG 4DV5L 4OX9L 2QDLA 1HZAA 1B44D 1TY2A 1SE8A 3SHLA 1VQAA 4X64Q 3ULPA 4JI7Q 4AH6A 3MVVA 1HNWQ 4AYBG 5IIFA 2MO0A 1TWCH 4UHVA 5L37A 1HH2P 1R9TH 2DY8A 3H0GG 2CH4A 3GTJH 1JT8A 4B08A 1J9OA 4KK7A 4R1JA 3J81j 1WCMG 4CJ1B 1Q1EA 2X6GA 2K5WA 5JAVA 4A3LG 4J8QA 3O13A 1V9PA 1HRJA 4ZUJA 2HDMA 5JOBA 4DV2Q 1PTOH 3I73A 2WINB 4BY7B 1I4GA 1WTWA 1TWFH 4A93G 2XSCA 1QNKA 3CCVA 1CA6A 5ELFA 1TWAH 3PUVA 1CKMA 1ET6A 5EBCA 5J39A 1JWSD 5C4XG 5IYBH 3TREA 1KIXA 4DR5Q 1JOOA 4ABNA 3JAMi 4AQYL 1TWAB 2KJXA 4XQNA 5JVH3 4A3DH 1LTRD 3MXNB 3EIVA 1ZYRC 4GNXB 1S4ZA 1HHVA 2LXKA 4Y7NH 1LTGD 4JI5L 2Q2HA 4ID6A 2UUAL 2HIVA 4BBSB 3KDFA 4MHEA 5CORA 1XTDA 3P1HA 4L6TB 2IHEA 4HIMA 1YNXA 3S1NH 1SYFA 3G7LA 3OYYA 2OF1A 1DOLA 3EVQA 2EOTA 4JI1L 1KHIA 1ZYRD 4RHRA 1E3PA 1SFOB 1L2FA 4U68A 1PV4A 3DHQA 1YBYA 2Q8TA 2K5VA 1TWHH 3U9SA 1I50H 1VMPA 4H02A 1LTTD 4X65L 4P75A 5M9OA 5EQ0A 3I4MG 2TMPA 1EYGA 1C4QA 1LTBD 1MIUA 2VUMB 2JA8G 4QIWE 1GUGA 3RN2A 4MNOA 3HOWG 2A6HC 3AYHB 5C4ZA 4KHPL 4A3BH 5IGBA 3EROA 1V1PB 5I2XA 3D4DA 1EY4A 3S17B 1RCVD 3CCLA 1ET9A 3IFTA 5C0XJ 1CA5A 3NXWA 4FNFA 3TBIB 4DK1A 4X62Q 2DJFC 4Q5VA 1JE4A 3SR1A 3PO2G 1UAPA 1PRTD 2HDLA 4HMIA 1N32L 1B7YB 1S5BD 3QB3A 4J1MA 4A3GG 1QZGA 4IUNA 1G8ZD 3GTKH 1TKWB 4JI0Q 2KCTA 1MBYA 3NTHA 4BY1G 1VQLA 4IPGA 2UXDQ 3M85A 2EYMA 3BVGA 4PMWA 1B4OA 1F2ZA 2YV5A 2NB0A 4YIJA 1Q81C 3JAMc 3MXPA 4LFCL 2RCNA 2C35B 2ASBA 2R93G 2K33A 5GADC 1BBXC 3PO3B 5IT9E 1YI2A 3U58A 3DLLA 1L1OC 4ILWA 1LABA 5C3EB 5M5YB 4DUZQ 5C0XH 1U5KA 3G6EA 4X66Q 3LNNA 4QL5A 1JOKA 2PNHA 3L2PA 1XXGA 4A3KH 4CDCC 5KRUA 1Z7TA 5FOBB 4FYDA 2A73B 4DR3L 2RSNA 3UI2A 5T1IA 1X55A 3HRZC 5C4JH 2KEDA 1X6OA 3CMEA 1DOMA 3HOUG 1NAPA 2B39A 4OWWB 1NNXA 2WB1G 4O0AA 1MSGA 4OL7A 5M3FB 1GXDC 4H0LC 2G9DA 1IBMQ 4JBJA 5A2QE 3T4AC 3MZ5A 3J7ZC 2Z8LA 2NVTB 1RIPA 1JE5A 3HOXG 2JA7B 1LTLA 2Z6KA 2OCEA 1UE7A 4IFDH 1NR4A 5KNBA 3CPWA 1QVCA 4JI5Q 5J3BA 4LF8L 1VCIA 1LACA 5A2QL 2F0GA 4PV1C 1FVIA 2B2UC 4OO1H 1I4QA 1Y1WG 3D6WA 4A93H 1QOHA 1MD2D 4GKJQ 1SYGA 4XYQA 2I5HA 1PFNA 2Z6BA 3OWEB 4RAUC 2K52A 4DXGA 2B2UA 2JA8B 1OTCA 2RSOA 5FLXL 2AUKA 2HHHL 2AQ3B 3E3XA 2NVXH 4IPHA 2KOLA 4XQQA 2E2IH 1TWCB 5JPNC 1W6KA 4LW1A 3EFXD 1IZ6A 3V2TA 5FJ8H 1ESFA 2B8GA 4F88A 3HOWH 3OW7A 4UP9A 5GAEC 4V190 2MPMA 2EXZA 1VMCA 1W2BA 4RKLA 2J4XA 3A54A 2MQHA 2F0VA 3SVMA 4GZYC 4CKBA 3K5MA 4ODGA 2RF4A 5D14A 2N78A 1ESRA 5CMDA 4R8NA 3BS1A 4L5QA 1EYAA 1XMQL 2L11A 3F1ZA 4KY5A 5CBEE 2F4IA 1MGSA 5IT9c 5IYCG 3GTOB 2VQFL 2Q8RE 1Q7YC 1TS4A 5K36G 4KN7C 2AKWB 1XWEA 1JR0D 5HURA 1O7LA 2K4KA 4UDUC 1BOSA 2NN6G 3G4SA 1RKNA 4CHTB 4IOAA 2H1EA 1KAWA 1LT5D 2OWOA 1HUNA 1JQYD 1MKHA 2G9HD 3KK7A 5JJLA 2SOBA 1GJXA 1AE2A 4HJ9A 1PH2A 4QGUA 1QCBD 2F0LA 5TSSA 1HJPA 2PI2A 3KJOA 2DNCA 3MHBA 4ZRZA 3E6ZX 3Q6SA 3GTMB 3NEMA 3BDCA 1YZ6A 1HR0W 2D62A 5CC4A 1EUJA 4UY8C 3K0YA 4DV3L 2L4NA 1UE6A 5BR8L 2NZHA 4LMQD 4H44C 4GLXA 4MIUA 1F9RA 1SBBB 4HN7A 1EZ6A 2J0TD 3WWVA 1E2VA 5LMUL 3I4NG 1YEZA 2VB2X 1PXUA 4OONA 4C3JB 1HR0Q 1EFID 3D8GA 1LV9A 4A76A 1U9RA 5CV6A 1D2BA 2JQOA 4QUFA 1KC8C 3S2HB 2PO4A 1L0YB 1IW7C 2L15A 1SROA 3KOJA 1EWHA 1C8CA 2VW9A 4YY3Q 2LMCB 1Z47A 4P2CB 3HOZG 2CWAA 4PZ7A 2R7ZG 1OXVA 4JG2A 4F8MA 3GTJB 2I07B 1EU4A 4A3GH 1A2TA 3VYSA 5G3LD 1CHQD 1WYDA 1BKBA 4LF4L 4X3SA 1YJNA 5BN5A 3MXNA 1JB7A 4LF8Q 3VR5A 1SYDA 2F4VL 1X3EA 1Q3LA 4O1NA 4IUUA 3P75A 1R4QB 5C3XA 4JI8L 4RMFA 1RTOA 4DGZA 1WTHA 2B2TA 3BVMA 5IYBG 3PF5A 3W5OA 3I2ZA 4JI0L 2BOSA 3A5ZB 1SNOA 5BN3A 5JJIA 3HKZB 1PH1A 3V96A 1HR0L 3CCMA 4JW0A 4R4IA 4C3JH 3URYA 3U9OA 4HIKA 1F9PA 2B8FA 1P16A 1VQ4A 3OSOA 4DAPA 2ALYB 1BF4A 1SEBD 1BBWA 2WACA 4LUOA 3KLSA 5IYCH 1HQMC 5DNFA 2F0HA 3HOYB 4L5RC 1DONA 1EZ8A 2NBFA 3SDZA 3H15A 5KEEA 3KUPA 1UEAB 4BY7G 5IP9H 2R3ZA 1DJRD 2A6HD 4L5SA 5D65A 4DR7Q 1N36L 4J15A 1HZ9A 4N9TA 2PZTA 4QB4A 4OELB 1E7ZA 3J80i 4OO1I 5FLMG 3CU7A 2K04A 2OQKA 4QQBX 2JA9A 2XIWA 1Y1VH 1WTVA 2FJ2A 2QEJC 3S2DB 1CZGA 1J8IA 1JJ2A 3PO2H 4GKKL 1NSNS 1BCPB 3CMAA 3ER0A 1SN8A 2F0PA 3HG9A 1U4LA 3HGBA 3SXHA 2K7VA 5C5LA 3S2HH 5NUCA 4OXPA 1SNMA 1TQOA 1B3AA 2TSSA 3OPOA 1X3FA 4TRDA 3J81i 1JOQA 3PMFA 4FF3A 3BYTB 1UNSA 3J81c 1JB3A 3K5NA 4A3BB 1R9TB 1VQ6A 4WJ3M 2EYFA 3PIOA 5JEAJ 5G3LF 2UXCQ 4E6IA 2K1BA 3KLWA 4IUTA 1STGA 4GOPA 2Y0SG 4JV5L 3D31A 3GTPB 1VQ8A 5LL6X 1NR2A 1K8MA 4GN4B 1WFQA 4K6DA 1CK1A 3H0GB 3NBIA 3I3CA 4C3HH 1PH3A 5M5XH 3FHWA 3L7ZC 3RUZA 2XGTA 1N33L 4A75A 1N36Q 2HD3A 3GD7A 2KA7A 4BS9A 2ZJQA 1V8QA 4HIDA 2Q2UA 2NVXB 3HEJA 4OEMB 4NW2A 2XRQD 2RBMA 2C5CA 2B2TC 5T1GA 1XPUA 2JA7H 1ONLA 4S3SA 1FJGL 2ES2A 3ND9A 3RR5A 1LM0A 1K9MC 4X3TA 2B2YC 2MGSA 1HXYD 3PCOB 1EFWA 4UP7A 4GNXC 4DR1L 3DWAA 4ZYSA 5CR3A 4KHVA 1FD7D 3I7FA 3M4OB 1J5EL 1K3RA 1T9HA 3CPFA 2VXWA 4HSVA 2B63G 5FO9B 5LMNQ 2KCCA 2UUBQ 4X3KA 4EVOA 3PGZA 2R7ZB 1NMFA 1F2YA 3K0XA 1T5EA 1QE6A 5IGFA 3S9WA 1DZ1A 1KLUD 3DMUA 3VDYA 1RJTA 1II3A 1HZCA 1HNZL 5GROA 4EGVA 2A69C 1AN8A 1EY6A 3KBXA 3A8KE 2AHOB 2PI2E 4O42A 1GUSA 3D6CA 3OMCA 4P74A 5I2YA 1PTOB 4MTKA 4AYBE 4L5TA 4K2KA 1E24A 2CKZB 4PQXA 2NTTA 3CCSA 1KL9A 4KV6A 1STHA 3FRPB 1WD1A 4IUQA 3HOZH 2F0NA 1VQJA 3K7UC 1RODA 2QILA 3PO3H 1UE1A 1VQDA 3AFQA 4A93B 4A3CH 1S40A 2CQAA 3JC66 2M00A 4I65A 3S1RH 4DUYQ 2Q2IA 5C44G 4DK0A 1N34Q 3H09A 3A8JE 3L3OC 4QJFA 4X3UA 3EN2A 2NVQB 2GN5A 4DUZL 2WB1E 4K8JA 5I6WA 1QJOA 4G57A 3RNUA 1HTPA 1QB5D 4ALPA 2R93H 5KIXA 5IP7G 4CJ2C 2K01A 2X69A 4DN4M 1WJJA 2QA4A 3AMUA 2GA4B 1YNND 3FDTA 3I55A 3RMHA 5M5WH 2F0QA 2IW3A 4G7ZC 4J6HA 3T16A 1A15A 3S16H 4LUVA 2D9UA 1GUOA 1Y8PB 5IWAQ 1VQGA 1TS3A 3C1FA 3J7A5 2K28A 3CW2C 2GVBA 5C44B 4NXNL 4NDXA 1AW7A 4DNIA 5CV9A 4Y52H 1HPCA 5CV5A 1X32A 4A3MH 1C7YA 1EEID 2B2WA 2K5NA 5FLMH 4JI4Q 4HJAA 1I4HA 2F0DA 4OWTB 5I9PA 1DCZA 3BG3A 4ZCKA 1WVLA 4BXXH 4JI8Q 1SE2A 3QG1A 5AJ3L 5AFWA 3GV6A 1BCPD 3CC2A 2R93B 1YHBA 1PRTB 3WOEA 1B3QA 3S14H 1M8AA 4RGOS 2EPBA 5FLXc 3S1QH 2BDNA 3W3AA 1EQRA 3NWTA 3HOVG 1CSQA 2MUYA 1UWVA 2UXBL 4V0BA 1Y1WH 4B3SQ 4LJZC 3T1HL 3S15B 3S14B 2N8NA 1KDAA 2EVBA 3NWSA 4A3IG 1DGSA 1E2ZA 1UEBA 4A3MG 1VF7A 2RDHA 2UU9Q 4KD3A 2BA1A 3DXJC 2PQEA 1X65A 1QWYA 4LF6L 3BDLA 2UUBL 3CD6A 3I4MB 5I9OA 3HZXA 2VY3A 2KECA 4JPBW 4CDFC 4DAYB 4DV7Q 2PMZB 1J5EQ 4RHSA 3TEHB 3TQYA 3CKIB 1CZWA 3PSIA 1O78A 2K75A 4ULLA 4JI6Q 2O2LD 3NTIA 3Q0AA 1HFGA 1XNRL 3F2DA 3NQIA 4YY3L 2KHIA 3EJIA 4DK6C 2UXDL 2I5LX 1F9QA 2A74C 3WOFA 3FKIG 2R7ZH 3N6RA 4HR7B 1B70B 2E5LQ 5FO7B 3U4ZA 2EJGC 2O5IC 1VQ9A 4YCWA 2ATWA 3M7NA 1F2LA 4X6AH 2CW0C 2PQAA 3E9IA 4IUVA 4CDEC 5C3EG 3TP5A 4QCLA 4MN3A 5HGTA 1YVCA 2BE5C 4DR4Q 4ZQ3A 2K5DA 4KKSA 1S5DD 4C2MH 1AE3A 2VNUD 1O7IA 1HNWL 4A3FB 1EY7A 1KABA 2VQEQ 2QGQA 1AEXA 4IO9A 1VQPA 2AQ2B 2Z9HA 4IZ8A 4A3FH 4LF9Q 2EY6A 3MC0B 1PMRA 4I7ZC 4C2MB 1XMOL 4DKAC 1IBKL 3FEWX 4BA2I 4KHPQ 2ZTDA 3G71A 2PPBC 1A2UA 1NBWA 2JK8A 3I72A 1RD9D 4GLAC 1VQ7A 3SK5A 3M3YH 4L63B 3FVQA 2WKCA 1YNJD 3Q22A 4AIMA 2VS1A 1WCMH 1B50A 4KKUA 1HQRD 5KGUA 2Q2TA 1FNVA 5DM63 1I3QH 5FLXE 1PTOC 4IJLA 3TMEA 1SJHD 3AQQA 2Z0SA 4IJHA 1D7QA 1VQBA 2E2IB 3SGIA 4QY7A 5JJZA 3NPPA 1PRTC 1EOVA 2R92H 3E5SA 2NZ1D 1I6HB 3HKZE 2NVYB 4TKOB 1QZHA 1MSHA 2R92B 3PF4A 3A8IE 4IFDI 2PW7A 3KDFB 3OW2A 4DA2A 5JEAH 4U673 1VQCA 5BN4A 5I4DA 4HCEA 1B2TA 4DV4Q 2F3WA 3PUWA 2K5QA 4IFDJ 2JSOA 1CQVA 1WTOA 2CHBD 3GTQH 4EQOA 1NE3A 2LS01 1B9NA 1PTOD 3GTGB 3VR4A 4B3RL 1IYJB 4A3EB 2OTJA 2R7FA 3GDEA 2EYOA 1GOZA 2CWPA 1SNQA 5IGEA 1EQTA 3HOXB 5ELDA 3S24A 4X62L 1V1QA 1N9WA 4JBKA 3L0OA 4DR2L 5C44H 3NE5B 2ZT9C 1K73C 4K8IA 3K5LA 1AP0A 4Y7NB 4A3LH 1NTGA 2F0IA 1EY8A 2PMZE 1EOTA 2KUMA 2L0CA 4XIGS 1LT3D 2RVLA 1AFPA 4HEDA 3I90A 2AWOA 2XWJB 2UUCL 3A7LA 2DNEA 5C4JB 1QVFA 1RHPA 1D8LA 4R4CA 4LF9L 2PZWA 2K32A 5EAYA 3DUZA 4ZLTF 2P5ZX 3DEPA 1A8VA 4GN5A 5A35A 4I7AA 4FXKC 5ISRA 3RLNA 4P72A 4JI1Q 4APVA 3NUCA 2MO1A 5GQOA 3ZJYC 4IFDG 3CCJA 3OIQA 4LFBL 3K6OA 1KTKA 2KQ3A 3KF6A 1Q8IA 3DEOA 1STYA 4TVAB 1D5MC 1STAA 1UE5A 4POGA 3I4OA 1G91A 1EL0A 4IOCA 3N52A 4BBSG 2B2VC 1G2TA 3UE1A 5C3WA 1PZKD 5IT9L 3BZCA 3KBGA 4WORA 1E22A 2ZTEA 3J7AV 1PH4A 2A19A 4NPSA 2JA6H 3Q23A 2ZJRA 3RZOB 4N8X1 2R92G 4A3KG 2EYJA 2Z4IA 1RDPD 1CHPD 1FL0A 3H6MA 1BXTA 1PFBA 4DV7L 1CSPA 5FJ8G 2RHSB 2KVMA 2QKIC 4G7OC 1JMCA 2JA5G 3DM3A 4XXEA 3QJYA 3QIAA 5E1FA 2MHVA 3WDNA 3Q24A 1ICWA 1SRUA 4NXNQ 1Y8NB 2JA8H 1WCMB 2O4XA 4AQYQ 4A3JG 4NXML 4KHZA 4RG1A 1KXLA 2M2LA 4LF7Q 4YHHL 2E5LL 1F77A 1S5CD 3RLOA 4DAYA 3OHXC 1CI3M 4EQPA 3OOCA 4JOIC 1T5XD 5HY6A 4RH6A 4C3IH 1S72A 1O7ZA 1D1KA 3PUZA 2D5DA 4KY7A 4ZUIA 4BBRB 3GO5A 3NSWA 3KF6B 4DR7L 5M5WB 3C2PA 3FP9A 1YHQA 2WB1B 1ZKOA 4C3HB 2E2JB 1WOCA 4JI3Q 1Z6HA 2E74C 3KF8A 4L8JA 1H9SA 3M4PA 3ERQA 1H9RA 4CGYB 3I4LA 2RA4A 3BVZA 2A68D 4HAEA 1X3GA 4A3MB 1K8OA 2YTYA 5FKAC 4WRDA 4X66L 5ELNA 1STBA 3MEHA 2I46A 1SLJA 2CH4W 4H13C 3TP6A 2UUCQ 3PO3G 5C3EH 3TS0A 3G48A 2B63B 1OO9B 4CKEA 3J80E 4DV5Q 4A3BG 2Z4HA 1V43A 2YU9B 3A5UA 1PYBA 2KCMA 1H9JA 1X9NA 1NMGA 1SNPA 3RN5A 3GTGH 1IBML 3GV3A 1NUCA 4TSSA 3I4MH 3HOUH 2A6ED 1ICFB 1Q12A 2BE5D 1IL8A 1XNRQ 3K8AA 1MHWC 2HQLA 4QF4A 4B9XA 1SAPA 2E75C 2VB3X 1N32Q 2WP8J 2F0SA 5LHY1 1EQVA 4OIJA 4FF2A 3C3LA 4RCOA 1JICA 1KAAA 1L0XB 1Q8KA 1IYUA 4DR4L 4NKLA 1U4MA 4KJNA 3PQIA 3KJPA 2F0FA 3GTLH 1NJIC 4PNYA 2NVTH 2LY7A 2A69D 4FVMA 4UAIA 2A5HA 2EIFA 1Q1BA 2RKSA 3D0FA 2K6AA 3D4WA 1SDFA 5EKKA 1YJ9A 1KDCA 1K83H 4PZ8A 5IGDA 4JCVE 1FGBD 1QILA 4DXFA 5LMNL 4A3CG 3G6JB 1S5ED 4HSPA 3E9HA 2F1MA 4A3JH 5J1ZA 1AZPA 2H4OA 1CM9A 1QUQA 2IL8A 4B3ML 1VS0A 4A3DB 1QG7A 1GUTA 3AFPA 1SFOH 4K0KQ 2L9HA 4ZKCB 1BCPF 3H0GH 3T13A 4C3IG 1ASZA 4LNQA 2R61A 1XNQQ 1E1OA 5CV8A 4ME3A 3W2DA 3NTKA 2IX3A 1PVOA 2E2DC 1SE4A 2EY1A 2IJ0A 3CRKC 1XYIA 2FMMA 3EBEA 4UP8A 3NK9A 3ZYYX 5FO8B 1BDOA 1ENCA 1ZEQX 1JJGA 3K5OA 3R8BA 1SJED 1WTXA 1K0RA 2JJQA 2YU9H 4LUZA 4GKJL 2BH8A 3TSSA 3ERSX 4K2LA 4NP5A 1S5FD 5C4XB 2PW5A 4IQZA 2A8VA 2F03A 1GHKA 2LKVA 3X3NA 1IHZA 5DLQE 2Y0SE 4DV4L 2BCOA 3OWFA 3PIPA 5ELOA 2K05A 1FNWA 2QW7A 4DV3Q 3DWQA 1QNUA 1A3UA 2HIXA 4Q0FA 4R4TA 4DV1L 5EKLA 1KDBA 3UDXA 3RZDB 5LL6S 4TQUS 1Y8OB 1I6VC 2V1CC 3HFZB 1OXTA 3VYRA 3TZUA 5C0XG 1K8GA 1Y14B 1KRTA 3CCEA 3MWYW 4FDBA 3T56B 2JA6B 3ITPA 4K14A 4C56C 2NUCA 3VYUA 1SMYC 3D3RA 4H7BA 1HNZQ 5E3FA 1G6PA 1E0BA 2FMCA 2ZM6Q 4IPCA 3S2DH 2F0MA 3FPUB 4M1UB 3J7YW 1CQFA 3QOLA 3K7AB 4DR6Q 5KNCA 4X64L 1CT1D 4JI7L 3HKZG 2F4VQ 4K5VA 3CF5A 4A3EH 2B29A 4HJ7A 1EEFD 4MTNA 1H9KA 3GQBA 2L5TA 1EIHA 1TU2B 1I3QB 5EGTA 3H94A 4Z9CB 5H1SE 1I94Q 2DJGC 5E4WC 2QDBA 1LYLA 1HA6A 1VQMA 2AWNA 2HCCA 2ZJPA 2F52A 2JA7G 2EYPA 2Z1CA 1K0SA 1F2MA 5JPMC 4FF4A 4RWSC 1HTLD 2E76C 5M5XB 1Y69U 4QMGA 1BVSA 1EIGA 1PRTF 2CW0D 4JI2L 1V1PA 4CKCA 5C5MA 3P7JA 1BO0A 3A55A 5I6YA 1SMXA 2ZM6L 5EPJA 2B2WC 1GO3E 5CGKA 3CRLC 2NWGA 3ULLA 1W6JA 4R4OA 2QCPX 1A6XA 5IGCA 2JA5H 2DN8A 1V1OA 3E0JA 4DR1Q 3VR3A 1D5ZC 1H95A 4M8AA 5C0XI 4OO1G 3K81C 4PG3A 2AQ1B 4P71A 5M3MB 1PH8A 4DR5L 4KTAA 1VQOA 1BBUA 3TDQA 3T53B 2A6EC 2EDGA 2SEBD 5ELBA 1IYVA 4CDDC 3J80L 1C48A 1XX8A 4IPDA 1KQSA 2X6LA 3H91A 4KLKA 1XPRA 2EY2A 4YWMA 3KYHC 4HCSA 3IKJA 3NQTA 3R2TA 1SYBA 3TS2A 4KD4A 5CYUA 1U0LA 2MNAA 3HOZB 1PHJA 3D4RA 1XTCD 1GUNA 1LLRD 4YCVA 4B3TL 1TR5A 3T1YQ 1Q82C 5JVG3 4LFAL 2XN9C 3ND8A 3R2IA 2M9VA 4A3IB 2PNRC 1X3PA 3W1GA 4DF7A 5K36H 2OT2A 1ZXTA 4GLVB 4RCNA 5IODA 1B8AA 2F0EA 3F2BA 4O2DA 2RCFA 3S15H 2F0WA 5E7NA 3LGJA 2F0TA 4BA1I 1PFMA 1PH6A 1YHAA 1YITA 4RGTA 4JOIA 1DYQA 4A3KB 4PMBA 4A3EG 2V4DA 2XRSD 2LSSA 1SXTA 5M5YH 1QUQB 3VYTA 2HT1A 1BNZA 1YJWA 4BWGB 1G6ZA 1W3SA 3DM1A 3PIP3 1LT4D 1BR9A 4IN3A 2XVSA 4A3IH 2JYOA 3GTLB 1CKNB 2JA6G 3CXCA 4UPAA 4GNXA 2DGYA 2JP1A 5C4HA 1IL2A 1AH9A 3GTQB 1X56A 1B9MA 1DD2A 3MXGA 3T1YL 1DXMA 5IP7H 3PUXA 2N88A 2QEXA 1Y1WB 3J80c 3QO2A 1Z9FA 2UUAQ 1TWHB 1KNAA 4RGNA 2O5JC 2OXPA 2RQXA 2J7ZA 4A3GB 1JCKB 2UU9L 1AZQA 2YTVA 2E2HB 1TWGH 2NVYH 1G291 1H9MA 2XTIA 2XNAC 4ZK9B 3A0JA 4ZAIA 3TN2A 2WV6D 2FHTA 3UDFA 1A0IA 3STBD 4XT1B 4LF4Q 4GOPC 4CJ0B 1C0AA 5HGQA 5D3DA 1TVXA 3S17H 1GM5A 4FO2A 3RZDH 4LAAA 4OIKA 4DR3Q 3H3VI 3TZDA 2EXDA 3MFYA 1N8RC 1P8LA 1SMYD 2HQEA 4KKTA 3J81E 4DR6L 5IP9G 3R93A 2A1AA 2IT1A 1PDQA 1FGUA 5IGGA 1A3VA 1ILPA 5KNDA 2JA5B 4GN3B 4FXDA 5BR8Q 3M4YA 4XTCS 3QWNA 2K03A 1KNEA 1RTNA 3K7AH 3KFUA 2EE1A 4A3JB 4RGMA 2H5XA 1I4RA 4G7HC 5ELCA 2ICEC 1A3TA 2F3IA 3FKIH 4OGQC 4EQNA 5LMNW 3AB9A 4GS3A 4FF1A 1JWMD 2R7DA 3PUYA 4BBRG 3PIO3 4LFCQ 2NZOA 1IXRA 4C1NI 4HJ5A 1YIJA 3HOXH 1MJEA 1STNA 3A74A 1FYCA 2D0PA 3E0EA 4DAVA 1JJCB 1LTSD 1LTID 4BBSH 3MEFA 1STEA 2YTXA 3NENA 1TWFB 1VQ5A 1CFMA 2F3VA 4K5XA 1SNDA 1MI2A 3U50C 3RD4A 1Q46A 2WKDA 2Y0SB 5CBAE 1TY0A 4JBMA 3ULJA 5E4XA 3K59A 1WD0A 3F8TA 2F0OA 3M7GA 4N8FA 2D0OA 2YYZA 3VA5A 4LK1C 1SYCA 2AMCB 5K5PA 4X65Q 1EY9A 1K83B 2F0JA 1EWCA 1XJVA 5IE8A 1U4PA 3AEVA 2K14A 1D5XC 4JBWA 1XMQQ 3LWEA 2VL6A 3TRZA
chains in the Genus database with same CATH topology
4JI6L 3JAMi 2VZAA 2B63G 4A3BG 5LMNQ 4AQYL 3M4OH 2JEAI 2IX0A 1V43A 2UUBQ 3OTOQ 3PGZA 3A5UA 4A3DH 1NMFA 3MXNB 5IYDG 3EIVA 1PYBA 3K0XA 2KCMA 2UXCL 2RHQB 4GNXB 1X9NA 1NMGA 2LXKA 4Y7NH 4JI5L 1KD1C 4EQ5A 2Q2HA 4DR5Q 3RN5A 3GTGH 2UUAL 1IBML 2HIVA 1VQKA 3HOUH 3I4MH 3VDYA 1Q12A 3KDFA 3F2CA 1SR3A 1XTDA 1HZCA 5IWAL 1HNZL 1Y1VG 1XNRQ 2IHEA 4HIMA 3K8AA 5GROA 4LFBQ 1YNXA 2HQLA 1CUKA 1N32Q 3S1NH 1WI5A 2WP8J 5GAHC 2AHOB 3OYYA 2PI2E 4LFAQ 4P74A 3UDGA 1CKNA 4JI1L 1KHIA 1Q8KA 4AYBE 1HNXL 1OXUA 4DV0L 4DR4L 1E3PA 4L5TA 1L2FA 1E24A 2CKZB 3CCSA 4OWXB 1PV4A 4YCUA 3KJPA 1KL9A 1X54A 1FJGQ 2E2JH 1YBYA 3GTLH 3HOZH 1VQJA 1NJIC 3K7UC 5C4XH 1UE1A 2K5VA 2NVTH 1TWHH 3PO3H 1VQDA 3AFQA 1I94L 4A3CH 1S40A 3JC66 1I50H 3S1RH 1XMOQ 4H02A 2EIFA 1Q1BA 2Q2IA 3D0FA 4X65L 5C44G 4DUYQ 1N34Q 1YJ9A 4BY1H 4GKKQ 2UXBQ 4P75A 5JJKA 2LXJA 1K83H 4PZ8A 4QJFA 3I4MG 3TRZA 3EN2A 2GN5A 4DUZL 2WB1E 2KBNA 4JCVE 1EYGA 1MIUA 3RNUA 2JA8G 3W1BA 4QIWE 4ALPA 2R93H 2VUMG 1EIFA 5IP7G 4LF5L 5LMNL 3RN2A 4A3CG 3RLFA 3E9HA 1J6QA 1WJJA 4MNOA 3AYHB 2QA4A 4A3JH 3HOWG 4JYAQ 4KHPL 4A3BH 3I55A 1G51A 1QUQA 5M5WH 4B3ML 1VS0A 3CCLA 1ASYA 5C0XJ 1EIYB 3BJUA 3NELA 4X62Q 4LUVA 3S16H 3AFPA 1SFOH 3PO2G 4K0KQ 2KHJA 5IWAQ 1VQGA 3J7A5 3CW2C 1IBKQ 3H0GH 2GVBA 4BBRH 1ASZA 4NXNL 1GVPA 4LNQA 1PH5A 4DNIA 1N32L 4OX9Q 1B7YB 4A3GG 3KF8B 2PQAB 1QZGA 1XNQQ 5GAGC 4Y52H 1RL2A 4A3MH 3GTKH 1E1OA 4ME3A 1C7YA 4JI0Q 2KCTA 1PVOA 4LF7L 1PH7A 5M3MG 4BY1G 2K5NA 5FLMH 1VQLA 4IPGA 4HJAA 4JI4Q 2UXDQ 4DV0Q 3EBEA 4OWTB 3M85A 4UP8A 1PH9A 4PMWA 4P73A 1JJGA 2YV5A 4BXXH 4JI8Q 2B63H 1K0RA 2JJQA 1Q81C 5IY0A 2YU9H 4LUZA 5AJ3L 3JAMc 2OQ0A 3BZKA 4LFCL 3CC2A 4GOPB 1YHBA 2RCNA 4GKJL 2C35B 2BH8A 2ASBA 4LWCA 3S14H 2MFIA 5GADC 3ERSX 5FLXc 2R93G 3CP0A 3S1QH 1EQRA 3HOVG 1CSQA 1N34L 4B3TQ 2A8VA 1UWVA 1YI2A 2UXBL 3U4VA 3U58A 1Y1WH 4B3SQ 3DLLA 3T1HL 1L1OC 1VQIA 2N8NA 5DLQE 4DUZQ 2Y0SE 4DV6L 4DV4L 1U5KA 3G6EA 3PIPA 4X66Q 1HZBA 5ELOA 4QL5A 4A3IG 2PNHA 3L2PA 1DGSA 2N3SA 4DV3Q 4A3KH 1UEBA 4A3MG 4JC0A 2HIXA 2UU9Q 4R4TA 4DV1L 2BA1A 4DR3L 3UDXA 4TQUS 1X65A 2V1CC 4LF6L 2BH2A 3HFZB 2UUBL 1OXTA 3CD6A 1A63A 1L1OB 1X55A 1GKHA 5C4JH 1X6OA 5LMUQ 2VY3A 3CMEA 3HOUG 2CFMA 4DAYB 5C0XG 4DV7Q 1K8AC 4HIOA 4OWWB 2WB1G 1K8GA 1Y14B 1KRTA 3CCEA 4O0AA 1J5EQ 4FDBA 3TEHB 3TQYA 1LUZA 1IBMQ 3PSIA 4JBJA 2K75A 3J7ZC 4JI6Q 5M3FG 4KI0A 2GVAA 1PFSA 4POFA 1RIPA 1JE5A 3HOXG 1HNZQ 3OTOL 1VQEA 1XNRL 2ZM6Q 3F2DA 1G6PA 1EWIA 1LTLA 2OCEA 2Z6KA 4IPCA 4YY3L 2KHIA 3S2DH 1UE7A 4A3FG 4DK6C 3CPWA 1QVCA 2UXDL 4JI5Q 5J3BA 4LF8L 1VCIA 4DR6Q 2VQFQ 2I5LX 1FVIA 3FKIG 4X64L 4JI7L 2R7ZH 3HKZG 1Y1WG 3H3VH 2F4VQ 1B70B 2E5LQ 3CF5A 4A3EH 3U4ZA 4A93H 5AJ3Q 3BU2A 4BY7H 2B29A 1VQ9A 4YCWA 2ATWA 4HJ7A 3M7NA 4X6AH 4GKJQ 4MTNA 3I56A 2PQAA 3E9IA 2I5HA 2OTLA 5C3EG 5H1SE 1I94Q 3S1MH 2K52A 4B3SL 3UE0A 2I5MX 1OTCA 1LYLA 1YVCA 4YWKA 4DV6Q 1VQMA 4DR4Q 2AWNA 2ZJPA 2F52A 4C2MH 2JA7G 1AE3A 2VNUD 2HHHL 1O7IA 2NVXH 1HNWL 4IPHA 2E2IH 2VQEQ 2QGQA 4LW1A 2DUDA 1IZ6A 4IO9A 5FJ8H 2EQSA 1VQPA 2N49A 3HOWH 5JEAG 4UP9A 5GAEC 4A3FH 4LF9Q 1BVSA 1W2BA 1XMOL 4DKAC 1IBKL 4JI2L 4BA2I 4KHPQ 2ZTDA 3G71A 2MQHA 2ZTCA 1NBWA 2JK8A 1N33Q 2RF4A 2N78A 3K80C 1VQNA 4GLAC 2ID0A 1VQ7A 4L5QA 4JI3L 3M3YH 1SMXA 3CQZH 4AIMA 2VS1A 1WCMH 2ZM6L 1XMQL 3F1ZA 1GO3E 2KENA 2CCZA 3ULLA 5IT9c 4B3MQ 2IHFA 5IYCG 2IX1A 4R4OA 2Q2TA 2VQFL 1Q7YC 1I3QH 5K36G 2JEBI 1M1KC 2JA5H 2AKWB 3M4QA 2K4KA 4DR1Q 1KRSA 1H95A 2NN6G 3G4SA 5C0XI 4IJLA 4PZ6A 4IOAA 3AQQA 2Z0SA 4OO1G 3K81C 4PG3A 3ICEA 1KAWA 2OWOA 1MKHA 1OXSC 4IJHA 4R4QA 4P71A 5JJLA 1D7QA 1PH8A 1VQBA 4DPGA 4DR5L 3CC7A 1VQOA 1BBUA 1AE2A 3SGIA 4QY7A 4HJ9A 1EQQA 1PH2A 3CCRA 4QGUA 4JI4L 1EOVA 2R92H 4IPDA 1HJPA 2PI2A 3KJOA 1XPOA 1KQSA 4KLKA 1XPRA 3HKZE 4YWMA 2HHHQ 3KYHC 3HOYH 3T1HQ 3IRBA 3NEMA 1YZ6A 1QZHA 1HR0W 1HNXQ 3PF4A 4IFDI 2D62A 3UDIA 3TS2A 3I4NH 5IYDH 1U0LA 1S3OA 4YHHQ 1EUJA 2MNAA 4UY8C 4DV3L 1PHJA 3KDFB 1UE6A 3OW2A 5BR8L 2NZHA 4A4IA 1C9OA 4YCVA 4B3TL 4GLXA 4DV1Q 2I0QA 3T1YQ 1A62A 4NXMQ 1Q82C 1VQCA 3CCQA 4LFAL 4DV4Q 3CCUA 3PUWA 3WWVA 1IBLL 4DK3C 4IFDJ 5LMUL 4YWLA 3W1GA 1PA6A 3I4NG 3Q8DA 1YEZA 2K50A 1PYSB 4OONA 3GTQH 1HR0Q 2B3GA 4GLVB 4A3DG 1NY4A 4A76A 3STBC 1B8AA 2E2HH 1NE3A 2JQOA 3F2BA 1Q86C 4O2DA 5C4XG 3S15H 1KC8C 5E7NA 2L15A 1SROA 3KOJA 3LGJA 4BA1I 1E1TA 4B3RL 2VW9A 1IYJB 4YY3Q 1PH6A 1YHAA 2OTJA 4HJ8A 2R7FA 3GDEA 1MJCA 1Z47A 4JOIA 1YITA 3HOZG 4DUYL 2CWAA 4PZ7A 2R7ZG 2E8GA 4A3EG 2CWPA 3CAMA 4BXXG 1OXVA 4JG2A 4MZ9A 1OXXK 2LSSA 3S24A 4X62L 1V1QA 1N9WA 2WAQG 4A3GH 4JBKA 4K0KL 5M5YH 1QUQB 3L0OA 4DR2L 5C44H 2HT1A 2NVQH 3RZOH 1YJWA 3M9BA 1K73C 2K5HA 4DAMA 1WYDA 5M3MH 1BKBA 1L0WA 4LF4L 4DV2L 1W3SA 3GTPH 4JYAL 1YJNA 1XNQL 4A3LH 4LF8Q 1JB7A 5M3FH 1NTGA 2PMZE 2R6GA 1I6HH 4XIGS 1TXYA 4A3IH 2F4VL 4WJ4A 1X3EA 1VQFA 2AWOA 1CKNB 2JA6G 3CXCA 4UPAA 4GNXA 2DGYA 2UUCL 4JI8L 1IL2A 4RMFA 2VQEL 3GTOH 1AH9A 1QVFA 1X56A 5IYBG 3T1YL 1D8LA 4R4CA 3PF5A 4LF9L 2IY5B 3W5OA 3I2ZA 5EAYA 4JI0L 5IP7H 3PUXA 3A5ZB 1IBLQ 1A8VA 2BA0A 3B6YA 4GN5A 5JJIA 2QEXA 3J80c 1PH1A 1Z9FA 1CKOA 3CCMA 1HR0L 2UUAQ 4R4IA 3RLNA 4C3JH 4HIKA 4P72A 4JI1Q 4APVA 2MO1A 1P16A 1VQ4A 5GQOA 3ZJYC 4IFDG 4JV5Q 3CCJA 2ALYB 4LFBL 1BBWA 4JI2Q 4LUOA 2UU9L 3KF6A 4B3RQ 1I5FA 2YTVA 5IYCH 1TWGH 1M90C 4TVAB 2NVYH 4POGA 1UE5A 3GTMH 4L5RC 4LF6Q 1G291 2XTIA 3I4OA 3HOYG 3HKSA 4IOCA 4BBSG 3H15A 3UE1A 2FXQA 3A0JA 4BY7G 5IP9H 3BZCA 4L5SA 4DR7Q 4DR2Q 1N36L 3UDFA 2NN6I 1E22A 1L1OA 1A0IA 2ZTEA 4J15A 3STBD 1PH4A 3CC4A 2A19A 2Z6KC 1HZ9A 4NPSA 3PO3G 4LF4Q 4GOPC 2JA6H 1C0AA 3PV0A 5HGQA 3S17H 1E7ZA 1GM5A 2ZJRA 3J80i 3RZDH 2R92G 5FLMG 4DR3Q 4OO1I 3H3VI 4A3KG 2JE6I 2EXDA 2OQKA 4QQBX 2JA9A 2WFWA 1Y1VH 1GD7A 2WAQE 1P8LA 1N8RC 1FL0A 1JJ2A 3PO2H 4GKKL 4DR6L 5IP9G 4DV7L 1CSPA 2A1AA 2RHSB 3ER0A 5FJ8G 1SN8A 3CMAA 2IT1A 2CQOA 3HOVH 1FGUA 1JMCA 2JA5G 3DM3A 4NB3A 3S2HH 4LF5Q 1VQHA 4OXPA 4GN3B 4EX5A 3NBHB 5BR8Q 1QVGA 1SRUA 1X3FA 4XTCS 3J81i 4NXNQ 2JA8H 4DV5L 2VUMH 4OX9L 1HZAA 3K7AH 4AQYQ 4A3JG 4NXML 4KHZA 3J81c 4RG1A 3KFUA 1VQ6A 4WJ3M 1KXLA 1SE8A 4LF7Q 3PIOA 5JEAJ 1VQAA 2UXCQ 4X64Q 3ULPA 4JI7Q 4YHHL 2H5XA 3KLWA 4GOPA 2E5LL 4AH6A 2Y0SG 4JV5L 1HNWQ 3RLOA 3D31A 4AYBG 1VQ8A 2F3IA 3FKIH 4GN4B 2MO0A 1TWCH 5LMNW 1HH2P 1WFQA 4GS3A 4JOIC 1R9TH 5HY6A 4C3HH 2R7DA 1PH3A 3PUYA 4BBRG 4C3IH 5M5XH 1S72A 3FHWA 2NZOA 1IXRA 3H0GG 3PUZA 4HJ5A 3GTJH 3HOXH 1YIJA 4LFCQ 1JT8A 1MJEA 3A74A 3GO5A 3L7ZC 2D0PA 3E0EA 2XGTA 1N33L 4A75A 1JJCB 3KF6B 1N36Q 4DR7L 4R1JA 3FP9A 1YHQA 4BBSH 3GD7A 3J81j 3MEFA 2ZJQA 1WCMG 4HIDA 1Q1EA 1WOCA 2YTXA 2Q2UA 4JI3Q 3NENA 1XPUA 2JA7H 1VQ5A 4A3LG 1V9PA 3M4PA 3U50C 1FJGL 1Q46A 4DV2Q 2ES2A 4JBMA 3ULJA 1X3GA 3RR5A 3F8TA 1LM0A 1K9MC 2D0OA 1TWFH 4A93G 3CCVA 2YTYA 3PCOB 1EFWA 2YYZA 4UP7A 2AMCB 4X65Q 4GNXC 4DR1L 4X66L 5ELNA 1TWAH 3PUVA 1XJVA 3I7FA 5IE8A 1CKMA 1SLJA 1J5EL 3AEVA 2UUCQ 2K14A 5IYBH 4JBWA 1K3RA 3G48A 3TREA 5C3EH 1T9HA 3TS0A 1XMQQ 1KIXA 3CPFA 2VL6A 4DV5Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 L;  3JAM i;  2VZA A;  2B63 G;  4A3B G;  5LMN Q;  4AQY L;  3M4O H;  2JEA I;  2IX0 A;  1V43 A;  2UUB Q;  3OTO Q;  3PGZ A;  3A5U A;  4A3D H;  1NMF A;  3MXN B;  5IYD G;  3EIV A;  1PYB A;  3K0X A;  2KCM A;  2UXC L;  2RHQ B;  4GNX B;  1X9N A;  1NMG A;  2LXK A;  4Y7N H;  4JI5 L;  1KD1 C;  4EQ5 A;  2Q2H A;  4DR5 Q;  3RN5 A;  3GTG H;  2UUA L;  1IBM L;  2HIV A;  1VQK A;  3HOU H;  3I4M H;  3VDY A;  1Q12 A;  3KDF A;  3F2C A;  1SR3 A;  1XTD A;  1HZC A;  5IWA L;  1HNZ L;  1Y1V G;  1XNR Q;  2IHE A;  4HIM A;  3K8A A;  5GRO A;  4LFB Q;  1YNX A;  2HQL A;  1CUK A;  1N32 Q;  3S1N H;  1WI5 A;  2WP8 J;  5GAH C;  2AHO B;  3OYY A;  2PI2 E;  4LFA Q;  4P74 A;  3UDG A;  1CKN A;  4JI1 L;  1KHI A;  1Q8K A;  4AYB E;  1HNX L;  1OXU A;  4DV0 L;  4DR4 L;  1E3P A;  4L5T A;  1L2F A;  1E24 A;  2CKZ B;  3CCS A;  4OWX B;  1PV4 A;  4YCU A;  3KJP A;  1KL9 A;  1X54 A;  1FJG Q;  2E2J H;  1YBY A;  3GTL H;  3HOZ H;  1VQJ A;  1NJI C;  3K7U C;  5C4X H;  1UE1 A;  2K5V A;  2NVT H;  1TWH H;  3PO3 H;  1VQD A;  3AFQ A;  1I94 L;  4A3C H;  1S40 A;  3JC6 6;  1I50 H;  3S1R H;  1XMO Q;  4H02 A;  2EIF A;  1Q1B A;  2Q2I A;  3D0F A;  4X65 L;  5C44 G;  4DUY Q;  1N34 Q;  1YJ9 A;  4BY1 H;  4GKK Q;  2UXB Q;  4P75 A;  5JJK A;  2LXJ A;  1K83 H;  4PZ8 A;  4QJF A;  3I4M G;  3TRZ A;  3EN2 A;  2GN5 A;  4DUZ L;  2WB1 E;  2KBN A;  4JCV E;  1EYG A;  1MIU A;  3RNU A;  2JA8 G;  3W1B A;  4QIW E;  4ALP A;  2R93 H;  2VUM G;  1EIF A;  5IP7 G;  4LF5 L;  5LMN L;  3RN2 A;  4A3C G;  3RLF A;  3E9H A;  1J6Q A;  1WJJ A;  4MNO A;  3AYH B;  2QA4 A;  4A3J H;  3HOW G;  4JYA Q;  4KHP L;  4A3B H;  3I55 A;  1G51 A;  1QUQ A;  5M5W H;  4B3M L;  1VS0 A;  3CCL A;  1ASY A;  5C0X J;  1EIY B;  3BJU A;  3NEL A;  4X62 Q;  4LUV A;  3S16 H;  3AFP A;  1SFO H;  3PO2 G;  4K0K Q;  2KHJ A;  5IWA Q;  1VQG A;  3J7A 5;  3CW2 C;  1IBK Q;  3H0G H;  2GVB A;  4BBR H;  1ASZ A;  4NXN L;  1GVP A;  4LNQ A;  1PH5 A;  4DNI A;  1N32 L;  4OX9 Q;  1B7Y B;  4A3G G;  3KF8 B;  2PQA B;  1QZG A;  1XNQ Q;  5GAG C;  4Y52 H;  1RL2 A;  4A3M H;  3GTK H;  1E1O A;  4ME3 A;  1C7Y A;  4JI0 Q;  2KCT A;  1PVO A;  4LF7 L;  1PH7 A;  5M3M G;  4BY1 G;  2K5N A;  5FLM H;  1VQL A;  4IPG A;  4HJA A;  4JI4 Q;  2UXD Q;  4DV0 Q;  3EBE A;  4OWT B;  3M85 A;  4UP8 A;  1PH9 A;  4PMW A;  4P73 A;  1JJG A;  2YV5 A;  4BXX H;  4JI8 Q;  2B63 H;  1K0R A;  2JJQ A;  1Q81 C;  5IY0 A;  2YU9 H;  4LUZ A;  5AJ3 L;  3JAM c;  2OQ0 A;  3BZK A;  4LFC L;  3CC2 A;  4GOP B;  1YHB A;  2RCN A;  4GKJ L;  2C35 B;  2BH8 A;  2ASB A;  4LWC A;  3S14 H;  2MFI A;  5GAD C;  3ERS X;  5FLX c;  2R93 G;  3CP0 A;  3S1Q H;  1EQR A;  3HOV G;  1CSQ A;  1N34 L;  4B3T Q;  2A8V A;  1UWV A;  1YI2 A;  2UXB L;  3U4V A;  3U58 A;  1Y1W H;  4B3S Q;  3DLL A;  3T1H L;  1L1O C;  1VQI A;  2N8N A;  5DLQ E;  4DUZ Q;  2Y0S E;  4DV6 L;  4DV4 L;  1U5K A;  3G6E A;  3PIP A;  4X66 Q;  1HZB A;  5ELO A;  4QL5 A;  4A3I G;  2PNH A;  3L2P A;  1DGS A;  2N3S A;  4DV3 Q;  4A3K H;  1UEB A;  4A3M G;  4JC0 A;  2HIX A;  2UU9 Q;  4R4T A;  4DV1 L;  2BA1 A;  4DR3 L;  3UDX A;  4TQU S;  1X65 A;  2V1C C;  4LF6 L;  2BH2 A;  3HFZ B;  2UUB L;  1OXT A;  3CD6 A;  1A63 A;  1L1O B;  1X55 A;  1GKH A;  5C4J H;  1X6O A;  5LMU Q;  2VY3 A;  3CME A;  3HOU G;  2CFM A;  4DAY B;  5C0X G;  4DV7 Q;  1K8A C;  4HIO A;  4OWW B;  2WB1 G;  1K8G A;  1Y14 B;  1KRT A;  3CCE A;  4O0A A;  1J5E Q;  4FDB A;  3TEH B;  3TQY A;  1LUZ A;  1IBM Q;  3PSI A;  4JBJ A;  2K75 A;  3J7Z C;  4JI6 Q;  5M3F G;  4KI0 A;  2GVA A;  1PFS A;  4POF A;  1RIP A;  1JE5 A;  3HOX G;  1HNZ Q;  3OTO L;  1VQE A;  1XNR L;  2ZM6 Q;  3F2D A;  1G6P A;  1EWI A;  1LTL A;  2OCE A;  2Z6K A;  4IPC A;  4YY3 L;  2KHI A;  3S2D H;  1UE7 A;  4A3F G;  4DK6 C;  3CPW A;  1QVC A;  2UXD L;  4JI5 Q;  5J3B A;  4LF8 L;  1VCI A;  4DR6 Q;  2VQF Q;  2I5L X;  1FVI A;  3FKI G;  4X64 L;  4JI7 L;  2R7Z H;  3HKZ G;  1Y1W G;  3H3V H;  2F4V Q;  1B70 B;  2E5L Q;  3CF5 A;  4A3E H;  3U4Z A;  4A93 H;  5AJ3 Q;  3BU2 A;  4BY7 H;  2B29 A;  1VQ9 A;  4YCW A;  2ATW A;  4HJ7 A;  3M7N A;  4X6A H;  4GKJ Q;  4MTN A;  3I56 A;  2PQA A;  3E9I A;  2I5H A;  2OTL A;  5C3E G;  5H1S E;  1I94 Q;  3S1M H;  2K52 A;  4B3S L;  3UE0 A;  2I5M X;  1OTC A;  1LYL A;  1YVC A;  4YWK A;  4DV6 Q;  1VQM A;  4DR4 Q;  2AWN A;  2ZJP A;  2F52 A;  4C2M H;  2JA7 G;  1AE3 A;  2VNU D;  2HHH L;  1O7I A;  2NVX H;  1HNW L;  4IPH A;  2E2I H;  2VQE Q;  2QGQ A;  4LW1 A;  2DUD A;  1IZ6 A;  4IO9 A;  5FJ8 H;  2EQS A;  1VQP A;  2N49 A;  3HOW H;  5JEA G;  4UP9 A;  5GAE C;  4A3F H;  4LF9 Q;  1BVS A;  1W2B A;  1XMO L;  4DKA C;  1IBK L;  4JI2 L;  4BA2 I;  4KHP Q;  2ZTD A;  3G71 A;  2MQH A;  2ZTC A;  1NBW A;  2JK8 A;  1N33 Q;  2RF4 A;  2N78 A;  3K80 C;  1VQN A;  4GLA C;  2ID0 A;  1VQ7 A;  4L5Q A;  4JI3 L;  3M3Y H;  1SMX A;  3CQZ H;  4AIM A;  2VS1 A;  1WCM H;  2ZM6 L;  1XMQ L;  3F1Z A;  1GO3 E;  2KEN A;  2CCZ A;  3ULL A;  5IT9 c;  4B3M Q;  2IHF A;  5IYC G;  2IX1 A;  4R4O A;  2Q2T A;  2VQF L;  1Q7Y C;  1I3Q H;  5K36 G;  2JEB I;  1M1K C;  2JA5 H;  2AKW B;  3M4Q A;  2K4K A;  4DR1 Q;  1KRS A;  1H95 A;  2NN6 G;  3G4S A;  5C0X I;  4IJL A;  4PZ6 A;  4IOA A;  3AQQ A;  2Z0S A;  4OO1 G;  3K81 C;  4PG3 A;  3ICE A;  1KAW A;  2OWO A;  1MKH A;  1OXS C;  4IJH A;  4R4Q A;  4P71 A;  5JJL A;  1D7Q A;  1PH8 A;  1VQB A;  4DPG A;  4DR5 L;  3CC7 A;  1VQO A;  1BBU A;  1AE2 A;  3SGI A;  4QY7 A;  4HJ9 A;  1EQQ A;  1PH2 A;  3CCR A;  4QGU A;  4JI4 L;  1EOV A;  2R92 H;  4IPD A;  1HJP A;  2PI2 A;  3KJO A;  1XPO A;  1KQS A;  4KLK A;  1XPR A;  3HKZ E;  4YWM A;  2HHH Q;  3KYH C;  3HOY H;  3T1H Q;  3IRB A;  3NEM A;  1YZ6 A;  1QZH A;  1HR0 W;  1HNX Q;  3PF4 A;  4IFD I;  2D62 A;  3UDI A;  3TS2 A;  3I4N H;  5IYD H;  1U0L A;  1S3O A;  4YHH Q;  1EUJ A;  2MNA A;  4UY8 C;  4DV3 L;  1PHJ A;  3KDF B;  1UE6 A;  3OW2 A;  5BR8 L;  2NZH A;  4A4I A;  1C9O A;  4YCV A;  4B3T L;  4GLX A;  4DV1 Q;  2I0Q A;  3T1Y Q;  1A62 A;  4NXM Q;  1Q82 C;  1VQC A;  3CCQ A;  4LFA L;  4DV4 Q;  3CCU A;  3PUW A;  3WWV A;  1IBL L;  4DK3 C;  4IFD J;  5LMU L;  4YWL A;  3W1G A;  1PA6 A;  3I4N G;  3Q8D A;  1YEZ A;  2K50 A;  1PYS B;  4OON A;  3GTQ H;  1HR0 Q;  2B3G A;  4GLV B;  4A3D G;  1NY4 A;  4A76 A;  3STB C;  1B8A A;  2E2H H;  1NE3 A;  2JQO A;  3F2B A;  1Q86 C;  4O2D A;  5C4X G;  3S15 H;  1KC8 C;  5E7N A;  2L15 A;  1SRO A;  3KOJ A;  3LGJ A;  4BA1 I;  1E1T A;  4B3R L;  2VW9 A;  1IYJ B;  4YY3 Q;  1PH6 A;  1YHA A;  2OTJ A;  4HJ8 A;  2R7F A;  3GDE A;  1MJC A;  1Z47 A;  4JOI A;  1YIT A;  3HOZ G;  4DUY L;  2CWA A;  4PZ7 A;  2R7Z G;  2E8G A;  4A3E G;  2CWP A;  3CAM A;  4BXX G;  1OXV A;  4JG2 A;  4MZ9 A;  1OXX K;  2LSS A;  3S24 A;  4X62 L;  1V1Q A;  1N9W A;  2WAQ G;  4A3G H;  4JBK A;  4K0K L;  5M5Y H;  1QUQ B;  3L0O A;  4DR2 L;  5C44 H;  2HT1 A;  2NVQ H;  3RZO H;  1YJW A;  3M9B A;  1K73 C;  2K5H A;  4DAM A;  1WYD A;  5M3M H;  1BKB A;  1L0W A;  4LF4 L;  4DV2 L;  1W3S A;  3GTP H;  4JYA L;  1YJN A;  1XNQ L;  4A3L H;  4LF8 Q;  1JB7 A;  5M3F H;  1NTG A;  2PMZ E;  2R6G A;  1I6H H;  4XIG S;  1TXY A;  4A3I H;  2F4V L;  4WJ4 A;  1X3E A;  1VQF A;  2AWO A;  1CKN B;  2JA6 G;  3CXC A;  4UPA A;  4GNX A;  2DGY A;  2UUC L;  4JI8 L;  1IL2 A;  4RMF A;  2VQE L;  3GTO H;  1AH9 A;  1QVF A;  1X56 A;  5IYB G;  3T1Y L;  1D8L A;  4R4C A;  3PF5 A;  4LF9 L;  2IY5 B;  3W5O A;  3I2Z A;  5EAY A;  4JI0 L;  5IP7 H;  3PUX A;  3A5Z B;  1IBL Q;  1A8V A;  2BA0 A;  3B6Y A;  4GN5 A;  5JJI A;  2QEX A;  3J80 c;  1PH1 A;  1Z9F A;  1CKO A;  3CCM A;  1HR0 L;  2UUA Q;  4R4I A;  3RLN A;  4C3J H;  4HIK A;  4P72 A;  4JI1 Q;  4APV A;  2MO1 A;  1P16 A;  1VQ4 A;  5GQO A;  3ZJY C;  4IFD G;  4JV5 Q;  3CCJ A;  2ALY B;  4LFB L;  1BBW A;  4JI2 Q;  4LUO A;  2UU9 L;  3KF6 A;  4B3R Q;  1I5F A;  2YTV A;  5IYC H;  1TWG H;  1M90 C;  4TVA B;  2NVY H;  4POG A;  1UE5 A;  3GTM H;  4L5R C;  4LF6 Q;  1G29 1;  2XTI A;  3I4O A;  3HOY G;  3HKS A;  4IOC A;  4BBS G;  3H15 A;  3UE1 A;  2FXQ A;  3A0J A;  4BY7 G;  5IP9 H;  3BZC A;  4L5S A;  4DR7 Q;  4DR2 Q;  1N36 L;  3UDF A;  2NN6 I;  1E22 A;  1L1O A;  1A0I A;  2ZTE A;  4J15 A;  3STB D;  1PH4 A;  3CC4 A;  2A19 A;  2Z6K C;  1HZ9 A;  4NPS A;  3PO3 G;  4LF4 Q;  4GOP C;  2JA6 H;  1C0A A;  3PV0 A;  5HGQ A;  3S17 H;  1E7Z A;  1GM5 A;  2ZJR A;  3J80 i;  3RZD H;  2R92 G;  5FLM G;  4DR3 Q;  4OO1 I;  3H3V I;  4A3K G;  2JE6 I;  2EXD A;  2OQK A;  4QQB X;  2JA9 A;  2WFW A;  1Y1V H;  1GD7 A;  2WAQ E;  1P8L A;  1N8R C;  1FL0 A;  1JJ2 A;  3PO2 H;  4GKK L;  4DR6 L;  5IP9 G;  4DV7 L;  1CSP A;  2A1A A;  2RHS B;  3ER0 A;  5FJ8 G;  1SN8 A;  3CMA A;  2IT1 A;  2CQO A;  3HOV H;  1FGU A;  1JMC A;  2JA5 G;  3DM3 A;  4NB3 A;  3S2H H;  4LF5 Q;  1VQH A;  4OXP A;  4GN3 B;  4EX5 A;  3NBH B;  5BR8 Q;  1QVG A;  1SRU A;  1X3F A;  4XTC S;  3J81 i;  4NXN Q;  2JA8 H;  4DV5 L;  2VUM H;  4OX9 L;  1HZA A;  3K7A H;  4AQY Q;  4A3J G;  4NXM L;  4KHZ A;  3J81 c;  4RG1 A;  3KFU A;  1VQ6 A;  4WJ3 M;  1KXL A;  1SE8 A;  4LF7 Q;  3PIO A;  5JEA J;  1VQA A;  2UXC Q;  4X64 Q;  3ULP A;  4JI7 Q;  4YHH L;  2H5X A;  3KLW A;  4GOP A;  2E5L L;  4AH6 A;  2Y0S G;  4JV5 L;  1HNW Q;  3RLO A;  3D31 A;  4AYB G;  1VQ8 A;  2F3I A;  3FKI H;  4GN4 B;  2MO0 A;  1TWC H;  5LMN W;  1HH2 P;  1WFQ A;  4GS3 A;  4JOI C;  1R9T H;  5HY6 A;  4C3H H;  2R7D A;  1PH3 A;  3PUY A;  4BBR G;  4C3I H;  5M5X H;  1S72 A;  3FHW A;  2NZO A;  1IXR A;  3H0G G;  3PUZ A;  4HJ5 A;  3GTJ H;  3HOX H;  1YIJ A;  4LFC Q;  1JT8 A;  1MJE A;  3A74 A;  3GO5 A;  3L7Z C;  2D0P A;  3E0E A;  2XGT A;  1N33 L;  4A75 A;  1JJC B;  3KF6 B;  1N36 Q;  4DR7 L;  4R1J A;  3FP9 A;  1YHQ A;  4BBS H;  3GD7 A;  3J81 j;  3MEF A;  2ZJQ A;  1WCM G;  4HID A;  1Q1E A;  1WOC A;  2YTX A;  2Q2U A;  4JI3 Q;  3NEN A;  1XPU A;  2JA7 H;  1VQ5 A;  4A3L G;  1V9P A;  3M4P A;  3U50 C;  1FJG L;  1Q46 A;  4DV2 Q;  2ES2 A;  4JBM A;  3ULJ A;  1X3G A;  3RR5 A;  3F8T A;  1LM0 A;  1K9M C;  2D0O A;  1TWF H;  4A93 G;  3CCV A;  2YTY A;  3PCO B;  1EFW A;  2YYZ A;  4UP7 A;  2AMC B;  4X65 Q;  4GNX C;  4DR1 L;  4X66 L;  5ELN A;  1TWA H;  3PUV A;  1XJV A;  3I7F A;  5IE8 A;  1CKM A;  1SLJ A;  1J5E L;  3AEV A;  2UUC Q;  2K14 A;  5IYB H;  4JBW A;  1K3R A;  3G48 A;  3TRE A;  5C3E H;  1T9H A;  3TS0 A;  1XMQ Q;  1KIX A;  3CPF A;  2VL6 A;  4DV5 Q; 
#chains in the Genus database with same CATH topology
 4JI6 L;  2VZA A;  3VR6 A;  1IKL A;  3M4O H;  2JEA I;  2IX0 A;  3OTO Q;  1JOR A;  3IL8 A;  5IYD G;  2UXC L;  2RHQ B;  2BDO A;  1TS2 A;  2FFK B;  1VF5 C;  1SYE A;  1KD1 C;  4EQ5 A;  1LT6 D;  1VQK A;  3S1N B;  2C9O A;  3QOJ A;  3BDO A;  3F2C A;  1SR3 A;  5IWA L;  1Y1V G;  2SNM A;  4FP5 D;  2XWB B;  4LFB Q;  3PO2 B;  1CUK A;  4R9W A;  1PYW D;  3K57 A;  1SNC A;  1WI5 A;  5GAH C;  1FR3 A;  4LFA Q;  4ME5 A;  4QIW B;  4IUP A;  5IOC A;  3UDG A;  1CKN A;  1ILQ A;  1HNX L;  1OXU A;  4DV0 L;  1HUM A;  5COY A;  1R4P B;  4OWX B;  4YCU A;  1O7Y A;  2KCN A;  1X54 A;  1FJG Q;  2E2J H;  1ML0 D;  5C4X H;  1I94 L;  1PTO F;  2RDG A;  5DEH A;  3S1M B;  1XMO Q;  1IBK Q;  4GKK Q;  3I70 A;  4BY1 H;  4K5W A;  2UXB Q;  5JJK A;  2LXJ A;  1EU3 A;  2KBN A;  3S1R B;  3W1B A;  2VUM G;  1B1Z A;  1EIF A;  4LF5 L;  3SE0 A;  3S16 B;  3RLF A;  4IAL A;  1J6Q A;  4JYA Q;  1G51 A;  1ASY A;  5DM7 3;  1EIY B;  3BJU A;  3NEL A;  1UUP A;  3OIP A;  2KHJ A;  3DWP A;  4BBR H;  1GVP A;  1YNJ C;  1PH5 A;  4OX9 Q;  1GUW A;  3KF8 B;  2PQA B;  4DU9 A;  5GAG C;  3MFG A;  1RL2 A;  1K28 A;  4JVZ A;  2QF7 A;  4XQJ A;  1PH7 A;  4LF7 L;  3X3M A;  5M3M G;  2L12 A;  4AYB B;  4FXG C;  2EZV A;  4DV0 Q;  1PH9 A;  4KJO A;  4HMJ A;  4P73 A;  3K58 A;  2B63 H;  1LO5 D;  4CBV A;  5IY0 A;  2OQ0 A;  3BZK A;  4GOP B;  4XYO A;  1TS5 A;  1K3B C;  4LWC A;  2MFI A;  3CP0 A;  1D6E C;  1N34 L;  4DFA A;  1EYD A;  4B3T Q;  2EJM A;  3U4V A;  1VQI A;  3VR2 A;  4DV6 L;  1HCZ A;  2PZU A;  3IAY A;  1HZB A;  2MP1 A;  3GP7 A;  1DM0 B;  2N3S A;  4JC0 A;  3I8Z A;  5DAU A;  4DNR B;  1BQQ T;  3FKI B;  4WJW A;  1CTM A;  5CV7 A;  4G4K A;  4IUR A;  2Q8I B;  2BH2 A;  1A63 A;  1WTQ A;  1L1O B;  1GKH A;  2EYL A;  1Y1V B;  3VA7 A;  1U4R A;  2JN4 A;  5EKI A;  3SEB A;  5LMU Q;  2CFM A;  1K8A C;  4HIO A;  3SK6 A;  4C3I B;  3HOU B;  3M3Y B;  1LUZ A;  4RFB A;  1ENA A;  3HOV B;  3C1E A;  5M3F G;  4KI0 A;  2GVA A;  1PFS A;  4POF A;  1E2W A;  1VQE A;  3OTO L;  1EWI A;  1IKM A;  5CV4 A;  4A3F G;  1B53 A;  1DOK A;  2VQF Q;  5KYL A;  3H3V H;  1PZJ D;  3NBH A;  4OHJ A;  5EJW A;  5AJ3 Q;  3BU2 A;  4BY7 H;  4F87 A;  2SNS A;  1PLF A;  3I56 A;  4XDX A;  4BY1 B;  3NP8 A;  2OTL A;  3S1M H;  2WAQ B;  3HP3 A;  3UE0 A;  4B3S L;  2I5M X;  1G2S A;  4YWK A;  4DV6 Q;  2N55 A;  2KEE A;  3LX0 A;  2IWH A;  5J22 A;  2DUD A;  5FK9 C;  2EQS A;  2N49 A;  3BYY B;  5JEA G;  4KMU C;  5EBD A;  4ZKB B;  3J7A F;  1YNN C;  3AU7 A;  4JK1 C;  2ZTC A;  5EPK A;  3CQZ B;  1N33 Q;  4WFN 3;  3BZD B;  3K80 C;  2EY5 A;  3A56 A;  1VQN A;  2ID0 A;  2HCI A;  4JI3 L;  2LFN A;  3JAM E;  3CQZ H;  1HFN A;  3EA6 A;  2CCZ A;  2KEN A;  4QUC A;  4B3M Q;  2IHF A;  2IX1 A;  3A7A B;  3IFD A;  3SK4 A;  2JEB I;  1M1K C;  2NYZ D;  3M4Q A;  1FNU A;  1KRS A;  1ENF A;  3CHB D;  2AUJ D;  4PZ6 A;  3L9A X;  2B2V A;  3MA2 B;  2CVR A;  3ICE A;  1F9S A;  4B9W A;  1OXS C;  1BCP C;  4R4Q A;  5ELE A;  4DPG A;  3CC7 A;  5EPL A;  1EQQ A;  2JXM B;  4NMZ A;  3CCR A;  4JI4 L;  4N9P A;  1XPO A;  3J81 L;  2HHH Q;  3HOY H;  3T1H Q;  3IRB A;  3MTS A;  4HTH A;  5D3I B;  1HNX Q;  2MJ8 A;  3NHH A;  1D1I A;  1TT2 A;  2RDF A;  3UDI A;  3I4N H;  5IYD H;  1S3O A;  4YHH Q;  2EJF C;  2F0U A;  4A4I A;  1C9O A;  1JC7 A;  2FIN B;  4DV1 Q;  2I0Q A;  1A62 A;  4NXM Q;  1EY5 A;  2KHS A;  3CCQ A;  3CCU A;  1Q90 A;  1IBL L;  2ZXR A;  2WII B;  4DK3 C;  4C3J G;  1IW7 D;  4RKB A;  4YWL A;  1I4P A;  1PA6 A;  3Q8D A;  2K50 A;  1PYS B;  4A3D G;  2B3G A;  4KY6 A;  1NY4 A;  2IPK D;  3STB C;  4RA8 A;  2E2H H;  1WTR A;  1Q86 C;  2ZXP A;  4KN4 C;  3I91 A;  4XT3 B;  3F2U A;  1EYC A;  3LWU A;  1E1T A;  4C1N K;  4HJ8 A;  1MJC A;  1SE3 A;  4DUY L;  1EY0 A;  2E8G A;  3CAM A;  4BXX G;  4MZ9 A;  1OXX K;  2WAQ G;  2G5D A;  4K0K L;  2NVQ H;  3RZO H;  3M9B A;  2K5H A;  4DAM A;  4K6L A;  5M3M H;  1L0W A;  4DNT B;  4DV2 L;  3GTP H;  3OMG A;  1XNQ L;  1H9S B;  2PYK A;  4JYA L;  2ENB A;  3FPP A;  5M3F H;  3H3V C;  1M4V A;  3GTK B;  2R6G A;  1I6H H;  1TXY A;  4WJ4 A;  2SDF A;  1RF2 D;  1VQF A;  3SK8 A;  3QR8 A;  2B2Y A;  2VQE L;  3GTO H;  3R3O A;  2DY7 A;  2F0K A;  3MAQ A;  1TII D;  2IY5 B;  1HA5 A;  3FMC A;  1BUV T;  1NCV A;  2NN6 H;  3ONA B;  1WTP A;  1IBL Q;  2BA0 A;  3B6Y A;  3TP7 A;  5KYI A;  1TWG B;  1CKO A;  3KLR A;  1JWU D;  2EYH A;  4JV5 Q;  3EQL C;  2OEO A;  4JI2 Q;  4B3R Q;  1GHJ A;  1I5F A;  1I50 B;  1M90 C;  3GTM H;  3HOW B;  2L1B A;  4LF6 Q;  1I4X A;  5C6A A;  3HOY G;  3HKS A;  3I4N B;  3T51 B;  2FXQ A;  1PZI D;  1X3Q A;  4DR2 Q;  2NN6 I;  1L1O A;  1VDZ A;  4R8I A;  3CC4 A;  2Z6K C;  2ZXO A;  3TP8 A;  2D2C C;  3PV0 A;  3C46 A;  2JE6 I;  2L55 A;  2NTS A;  2WFW A;  1GD7 A;  2WAQ E;  3P20 A;  1O80 A;  4F7X A;  2HUG A;  3MXU A;  3JAM L;  2CQO A;  3HOV H;  2ICI A;  1LTA D;  4NB3 A;  5F2D A;  1SSO A;  4LF5 Q;  1VQH A;  3HS0 C;  2A68 C;  4PMC A;  2PCF B;  3S1Q B;  4EX5 A;  3KLS X;  3NBH B;  3V05 A;  1QVG A;  2VUM H;  1KLG D;  4C3H G;  4DV5 L;  4OX9 L;  2QDL A;  1HZA A;  1B44 D;  1TY2 A;  1SE8 A;  3SHL A;  1VQA A;  4X64 Q;  3ULP A;  4JI7 Q;  4AH6 A;  3MVV A;  1HNW Q;  4AYB G;  5IIF A;  2MO0 A;  1TWC H;  4UHV A;  5L37 A;  1HH2 P;  1R9T H;  2DY8 A;  3H0G G;  2CH4 A;  3GTJ H;  1JT8 A;  4B08 A;  1J9O A;  4KK7 A;  4R1J A;  3J81 j;  1WCM G;  4CJ1 B;  1Q1E A;  2X6G A;  2K5W A;  5JAV A;  4A3L G;  4J8Q A;  3O13 A;  1V9P A;  1HRJ A;  4ZUJ A;  2HDM A;  5JOB A;  4DV2 Q;  1PTO H;  3I73 A;  2WIN B;  4BY7 B;  1I4G A;  1WTW A;  1TWF H;  4A93 G;  2XSC A;  1QNK A;  3CCV A;  1CA6 A;  5ELF A;  1TWA H;  3PUV A;  1CKM A;  1ET6 A;  5EBC A;  5J39 A;  1JWS D;  5C4X G;  5IYB H;  3TRE A;  1KIX A;  4DR5 Q;  1JOO A;  4ABN A;  3JAM i;  4AQY L;  1TWA B;  2KJX A;  4XQN A;  5JVH 3;  4A3D H;  1LTR D;  3MXN B;  3EIV A;  1ZYR C;  4GNX B;  1S4Z A;  1HHV A;  2LXK A;  4Y7N H;  1LTG D;  4JI5 L;  2Q2H A;  4ID6 A;  2UUA L;  2HIV A;  4BBS B;  3KDF A;  4MHE A;  5COR A;  1XTD A;  3P1H A;  4L6T B;  2IHE A;  4HIM A;  1YNX A;  3S1N H;  1SYF A;  3G7L A;  3OYY A;  2OF1 A;  1DOL A;  3EVQ A;  2EOT A;  4JI1 L;  1KHI A;  1ZYR D;  4RHR A;  1E3P A;  1SFO B;  1L2F A;  4U68 A;  1PV4 A;  3DHQ A;  1YBY A;  2Q8T A;  2K5V A;  1TWH H;  3U9S A;  1I50 H;  1VMP A;  4H02 A;  1LTT D;  4X65 L;  4P75 A;  5M9O A;  5EQ0 A;  3I4M G;  2TMP A;  1EYG A;  1C4Q A;  1LTB D;  1MIU A;  2VUM B;  2JA8 G;  4QIW E;  1GUG A;  3RN2 A;  4MNO A;  3HOW G;  2A6H C;  3AYH B;  5C4Z A;  4KHP L;  4A3B H;  5IGB A;  3ERO A;  1V1P B;  5I2X A;  3D4D A;  1EY4 A;  3S17 B;  1RCV D;  3CCL A;  1ET9 A;  3IFT A;  5C0X J;  1CA5 A;  3NXW A;  4FNF A;  3TBI B;  4DK1 A;  4X62 Q;  2DJF C;  4Q5V A;  1JE4 A;  3SR1 A;  3PO2 G;  1UAP A;  1PRT D;  2HDL A;  4HMI A;  1N32 L;  1B7Y B;  1S5B D;  3QB3 A;  4J1M A;  4A3G G;  1QZG A;  4IUN A;  1G8Z D;  3GTK H;  1TKW B;  4JI0 Q;  2KCT A;  1MBY A;  3NTH A;  4BY1 G;  1VQL A;  4IPG A;  2UXD Q;  3M85 A;  2EYM A;  3BVG A;  4PMW A;  1B4O A;  1F2Z A;  2YV5 A;  2NB0 A;  4YIJ A;  1Q81 C;  3JAM c;  3MXP A;  4LFC L;  2RCN A;  2C35 B;  2ASB A;  2R93 G;  2K33 A;  5GAD C;  1BBX C;  3PO3 B;  5IT9 E;  1YI2 A;  3U58 A;  3DLL A;  1L1O C;  4ILW A;  1LAB A;  5C3E B;  5M5Y B;  4DUZ Q;  5C0X H;  1U5K A;  3G6E A;  4X66 Q;  3LNN A;  4QL5 A;  1JOK A;  2PNH A;  3L2P A;  1XXG A;  4A3K H;  4CDC C;  5KRU A;  1Z7T A;  5FOB B;  4FYD A;  2A73 B;  4DR3 L;  2RSN A;  3UI2 A;  5T1I A;  1X55 A;  3HRZ C;  5C4J H;  2KED A;  1X6O A;  3CME A;  1DOM A;  3HOU G;  1NAP A;  2B39 A;  4OWW B;  1NNX A;  2WB1 G;  4O0A A;  1MSG A;  4OL7 A;  5M3F B;  1GXD C;  4H0L C;  2G9D A;  1IBM Q;  4JBJ A;  5A2Q E;  3T4A C;  3MZ5 A;  3J7Z C;  2Z8L A;  2NVT B;  1RIP A;  1JE5 A;  3HOX G;  2JA7 B;  1LTL A;  2Z6K A;  2OCE A;  1UE7 A;  4IFD H;  1NR4 A;  5KNB A;  3CPW A;  1QVC A;  4JI5 Q;  5J3B A;  4LF8 L;  1VCI A;  1LAC A;  5A2Q L;  2F0G A;  4PV1 C;  1FVI A;  2B2U C;  4OO1 H;  1I4Q A;  1Y1W G;  3D6W A;  4A93 H;  1QOH A;  1MD2 D;  4GKJ Q;  1SYG A;  4XYQ A;  2I5H A;  1PFN A;  2Z6B A;  3OWE B;  4RAU C;  2K52 A;  4DXG A;  2B2U A;  2JA8 B;  1OTC A;  2RSO A;  5FLX L;  2AUK A;  2HHH L;  2AQ3 B;  3E3X A;  2NVX H;  4IPH A;  2KOL A;  4XQQ A;  2E2I H;  1TWC B;  5JPN C;  1W6K A;  4LW1 A;  3EFX D;  1IZ6 A;  3V2T A;  5FJ8 H;  1ESF A;  2B8G A;  4F88 A;  3HOW H;  3OW7 A;  4UP9 A;  5GAE C;  4V19 0;  2MPM A;  2EXZ A;  1VMC A;  1W2B A;  4RKL A;  2J4X A;  3A54 A;  2MQH A;  2F0V A;  3SVM A;  4GZY C;  4CKB A;  3K5M A;  4ODG A;  2RF4 A;  5D14 A;  2N78 A;  1ESR A;  5CMD A;  4R8N A;  3BS1 A;  4L5Q A;  1EYA A;  1XMQ L;  2L11 A;  3F1Z A;  4KY5 A;  5CBE E;  2F4I A;  1MGS A;  5IT9 c;  5IYC G;  3GTO B;  2VQF L;  2Q8R E;  1Q7Y C;  1TS4 A;  5K36 G;  4KN7 C;  2AKW B;  1XWE A;  1JR0 D;  5HUR A;  1O7L A;  2K4K A;  4UDU C;  1BOS A;  2NN6 G;  3G4S A;  1RKN A;  4CHT B;  4IOA A;  2H1E A;  1KAW A;  1LT5 D;  2OWO A;  1HUN A;  1JQY D;  1MKH A;  2G9H D;  3KK7 A;  5JJL A;  2SOB A;  1GJX A;  1AE2 A;  4HJ9 A;  1PH2 A;  4QGU A;  1QCB D;  2F0L A;  5TSS A;  1HJP A;  2PI2 A;  3KJO A;  2DNC A;  3MHB A;  4ZRZ A;  3E6Z X;  3Q6S A;  3GTM B;  3NEM A;  3BDC A;  1YZ6 A;  1HR0 W;  2D62 A;  5CC4 A;  1EUJ A;  4UY8 C;  3K0Y A;  4DV3 L;  2L4N A;  1UE6 A;  5BR8 L;  2NZH A;  4LMQ D;  4H44 C;  4GLX A;  4MIU A;  1F9R A;  1SBB B;  4HN7 A;  1EZ6 A;  2J0T D;  3WWV A;  1E2V A;  5LMU L;  3I4N G;  1YEZ A;  2VB2 X;  1PXU A;  4OON A;  4C3J B;  1HR0 Q;  1EFI D;  3D8G A;  1LV9 A;  4A76 A;  1U9R A;  5CV6 A;  1D2B A;  2JQO A;  4QUF A;  1KC8 C;  3S2H B;  2PO4 A;  1L0Y B;  1IW7 C;  2L15 A;  1SRO A;  3KOJ A;  1EWH A;  1C8C A;  2VW9 A;  4YY3 Q;  2LMC B;  1Z47 A;  4P2C B;  3HOZ G;  2CWA A;  4PZ7 A;  2R7Z G;  1OXV A;  4JG2 A;  4F8M A;  3GTJ B;  2I07 B;  1EU4 A;  4A3G H;  1A2T A;  3VYS A;  5G3L D;  1CHQ D;  1WYD A;  1BKB A;  4LF4 L;  4X3S A;  1YJN A;  5BN5 A;  3MXN A;  1JB7 A;  4LF8 Q;  3VR5 A;  1SYD A;  2F4V L;  1X3E A;  1Q3L A;  4O1N A;  4IUU A;  3P75 A;  1R4Q B;  5C3X A;  4JI8 L;  4RMF A;  1RTO A;  4DGZ A;  1WTH A;  2B2T A;  3BVM A;  5IYB G;  3PF5 A;  3W5O A;  3I2Z A;  4JI0 L;  2BOS A;  3A5Z B;  1SNO A;  5BN3 A;  5JJI A;  3HKZ B;  1PH1 A;  3V96 A;  1HR0 L;  3CCM A;  4JW0 A;  4R4I A;  4C3J H;  3URY A;  3U9O A;  4HIK A;  1F9P A;  2B8F A;  1P16 A;  1VQ4 A;  3OSO A;  4DAP A;  2ALY B;  1BF4 A;  1SEB D;  1BBW A;  2WAC A;  4LUO A;  3KLS A;  5IYC H;  1HQM C;  5DNF A;  2F0H A;  3HOY B;  4L5R C;  1DON A;  1EZ8 A;  2NBF A;  3SDZ A;  3H15 A;  5KEE A;  3KUP A;  1UEA B;  4BY7 G;  5IP9 H;  2R3Z A;  1DJR D;  2A6H D;  4L5S A;  5D65 A;  4DR7 Q;  1N36 L;  4J15 A;  1HZ9 A;  4N9T A;  2PZT A;  4QB4 A;  4OEL B;  1E7Z A;  3J80 i;  4OO1 I;  5FLM G;  3CU7 A;  2K04 A;  2OQK A;  4QQB X;  2JA9 A;  2XIW A;  1Y1V H;  1WTV A;  2FJ2 A;  2QEJ C;  3S2D B;  1CZG A;  1J8I A;  1JJ2 A;  3PO2 H;  4GKK L;  1NSN S;  1BCP B;  3CMA A;  3ER0 A;  1SN8 A;  2F0P A;  3HG9 A;  1U4L A;  3HGB A;  3SXH A;  2K7V A;  5C5L A;  3S2H H;  5NUC A;  4OXP A;  1SNM A;  1TQO A;  1B3A A;  2TSS A;  3OPO A;  1X3F A;  4TRD A;  3J81 i;  1JOQ A;  3PMF A;  4FF3 A;  3BYT B;  1UNS A;  3J81 c;  1JB3 A;  3K5N A;  4A3B B;  1R9T B;  1VQ6 A;  4WJ3 M;  2EYF A;  3PIO A;  5JEA J;  5G3L F;  2UXC Q;  4E6I A;  2K1B A;  3KLW A;  4IUT A;  1STG A;  4GOP A;  2Y0S G;  4JV5 L;  3D31 A;  3GTP B;  1VQ8 A;  5LL6 X;  1NR2 A;  1K8M A;  4GN4 B;  1WFQ A;  4K6D A;  1CK1 A;  3H0G B;  3NBI A;  3I3C A;  4C3H H;  1PH3 A;  5M5X H;  3FHW A;  3L7Z C;  3RUZ A;  2XGT A;  1N33 L;  4A75 A;  1N36 Q;  2HD3 A;  3GD7 A;  2KA7 A;  4BS9 A;  2ZJQ A;  1V8Q A;  4HID A;  2Q2U A;  2NVX B;  3HEJ A;  4OEM B;  4NW2 A;  2XRQ D;  2RBM A;  2C5C A;  2B2T C;  5T1G A;  1XPU A;  2JA7 H;  1ONL A;  4S3S A;  1FJG L;  2ES2 A;  3ND9 A;  3RR5 A;  1LM0 A;  1K9M C;  4X3T A;  2B2Y C;  2MGS A;  1HXY D;  3PCO B;  1EFW A;  4UP7 A;  4GNX C;  4DR1 L;  3DWA A;  4ZYS A;  5CR3 A;  4KHV A;  1FD7 D;  3I7F A;  3M4O B;  1J5E L;  1K3R A;  1T9H A;  3CPF A;  2VXW A;  4HSV A;  2B63 G;  5FO9 B;  5LMN Q;  2KCC A;  2UUB Q;  4X3K A;  4EVO A;  3PGZ A;  2R7Z B;  1NMF A;  1F2Y A;  3K0X A;  1T5E A;  1QE6 A;  5IGF A;  3S9W A;  1DZ1 A;  1KLU D;  3DMU A;  3VDY A;  1RJT A;  1II3 A;  1HZC A;  1HNZ L;  5GRO A;  4EGV A;  2A69 C;  1AN8 A;  1EY6 A;  3KBX A;  3A8K E;  2AHO B;  2PI2 E;  4O42 A;  1GUS A;  3D6C A;  3OMC A;  4P74 A;  5I2Y A;  1PTO B;  4MTK A;  4AYB E;  4L5T A;  4K2K A;  1E24 A;  2CKZ B;  4PQX A;  2NTT A;  3CCS A;  1KL9 A;  4KV6 A;  1STH A;  3FRP B;  1WD1 A;  4IUQ A;  3HOZ H;  2F0N A;  1VQJ A;  3K7U C;  1ROD A;  2QIL A;  3PO3 H;  1UE1 A;  1VQD A;  3AFQ A;  4A93 B;  4A3C H;  1S40 A;  2CQA A;  3JC6 6;  2M00 A;  4I65 A;  3S1R H;  4DUY Q;  2Q2I A;  5C44 G;  4DK0 A;  1N34 Q;  3H09 A;  3A8J E;  3L3O C;  4QJF A;  4X3U A;  3EN2 A;  2NVQ B;  2GN5 A;  4DUZ L;  2WB1 E;  4K8J A;  5I6W A;  1QJO A;  4G57 A;  3RNU A;  1HTP A;  1QB5 D;  4ALP A;  2R93 H;  5KIX A;  5IP7 G;  4CJ2 C;  2K01 A;  2X69 A;  4DN4 M;  1WJJ A;  2QA4 A;  3AMU A;  2GA4 B;  1YNN D;  3FDT A;  3I55 A;  3RMH A;  5M5W H;  2F0Q A;  2IW3 A;  4G7Z C;  4J6H A;  3T16 A;  1A15 A;  3S16 H;  4LUV A;  2D9U A;  1GUO A;  1Y8P B;  5IWA Q;  1VQG A;  1TS3 A;  3C1F A;  3J7A 5;  2K28 A;  3CW2 C;  2GVB A;  5C44 B;  4NXN L;  4NDX A;  1AW7 A;  4DNI A;  5CV9 A;  4Y52 H;  1HPC A;  5CV5 A;  1X32 A;  4A3M H;  1C7Y A;  1EEI D;  2B2W A;  2K5N A;  5FLM H;  4JI4 Q;  4HJA A;  1I4H A;  2F0D A;  4OWT B;  5I9P A;  1DCZ A;  3BG3 A;  4ZCK A;  1WVL A;  4BXX H;  4JI8 Q;  1SE2 A;  3QG1 A;  5AJ3 L;  5AFW A;  3GV6 A;  1BCP D;  3CC2 A;  2R93 B;  1YHB A;  1PRT B;  3WOE A;  1B3Q A;  3S14 H;  1M8A A;  4RGO S;  2EPB A;  5FLX c;  3S1Q H;  2BDN A;  3W3A A;  1EQR A;  3NWT A;  3HOV G;  1CSQ A;  2MUY A;  1UWV A;  2UXB L;  4V0B A;  1Y1W H;  4B3S Q;  4LJZ C;  3T1H L;  3S15 B;  3S14 B;  2N8N A;  1KDA A;  2EVB A;  3NWS A;  4A3I G;  1DGS A;  1E2Z A;  1UEB A;  4A3M G;  1VF7 A;  2RDH A;  2UU9 Q;  4KD3 A;  2BA1 A;  3DXJ C;  2PQE A;  1X65 A;  1QWY A;  4LF6 L;  3BDL A;  2UUB L;  3CD6 A;  3I4M B;  5I9O A;  3HZX A;  2VY3 A;  2KEC A;  4JPB W;  4CDF C;  4DAY B;  4DV7 Q;  2PMZ B;  1J5E Q;  4RHS A;  3TEH B;  3TQY A;  3CKI B;  1CZW A;  3PSI A;  1O78 A;  2K75 A;  4ULL A;  4JI6 Q;  2O2L D;  3NTI A;  3Q0A A;  1HFG A;  1XNR L;  3F2D A;  3NQI A;  4YY3 L;  2KHI A;  3EJI A;  4DK6 C;  2UXD L;  2I5L X;  1F9Q A;  2A74 C;  3WOF A;  3FKI G;  2R7Z H;  3N6R A;  4HR7 B;  1B70 B;  2E5L Q;  5FO7 B;  3U4Z A;  2EJG C;  2O5I C;  1VQ9 A;  4YCW A;  2ATW A;  3M7N A;  1F2L A;  4X6A H;  2CW0 C;  2PQA A;  3E9I A;  4IUV A;  4CDE C;  5C3E G;  3TP5 A;  4QCL A;  4MN3 A;  5HGT A;  1YVC A;  2BE5 C;  4DR4 Q;  4ZQ3 A;  2K5D A;  4KKS A;  1S5D D;  4C2M H;  1AE3 A;  2VNU D;  1O7I A;  1HNW L;  4A3F B;  1EY7 A;  1KAB A;  2VQE Q;  2QGQ A;  1AEX A;  4IO9 A;  1VQP A;  2AQ2 B;  2Z9H A;  4IZ8 A;  4A3F H;  4LF9 Q;  2EY6 A;  3MC0 B;  1PMR A;  4I7Z C;  4C2M B;  1XMO L;  4DKA C;  1IBK L;  3FEW X;  4BA2 I;  4KHP Q;  2ZTD A;  3G71 A;  2PPB C;  1A2U A;  1NBW A;  2JK8 A;  3I72 A;  1RD9 D;  4GLA C;  1VQ7 A;  3SK5 A;  3M3Y H;  4L63 B;  3FVQ A;  2WKC A;  1YNJ D;  3Q22 A;  4AIM A;  2VS1 A;  1WCM H;  1B50 A;  4KKU A;  1HQR D;  5KGU A;  2Q2T A;  1FNV A;  5DM6 3;  1I3Q H;  5FLX E;  1PTO C;  4IJL A;  3TME A;  1SJH D;  3AQQ A;  2Z0S A;  4IJH A;  1D7Q A;  1VQB A;  2E2I B;  3SGI A;  4QY7 A;  5JJZ A;  3NPP A;  1PRT C;  1EOV A;  2R92 H;  3E5S A;  2NZ1 D;  1I6H B;  3HKZ E;  2NVY B;  4TKO B;  1QZH A;  1MSH A;  2R92 B;  3PF4 A;  3A8I E;  4IFD I;  2PW7 A;  3KDF B;  3OW2 A;  4DA2 A;  5JEA H;  4U67 3;  1VQC A;  5BN4 A;  5I4D A;  4HCE A;  1B2T A;  4DV4 Q;  2F3W A;  3PUW A;  2K5Q A;  4IFD J;  2JSO A;  1CQV A;  1WTO A;  2CHB D;  3GTQ H;  4EQO A;  1NE3 A;  2LS0 1;  1B9N A;  1PTO D;  3GTG B;  3VR4 A;  4B3R L;  1IYJ B;  4A3E B;  2OTJ A;  2R7F A;  3GDE A;  2EYO A;  1GOZ A;  2CWP A;  1SNQ A;  5IGE A;  1EQT A;  3HOX B;  5ELD A;  3S24 A;  4X62 L;  1V1Q A;  1N9W A;  4JBK A;  3L0O A;  4DR2 L;  5C44 H;  3NE5 B;  2ZT9 C;  1K73 C;  4K8I A;  3K5L A;  1AP0 A;  4Y7N B;  4A3L H;  1NTG A;  2F0I A;  1EY8 A;  2PMZ E;  1EOT A;  2KUM A;  2L0C A;  4XIG S;  1LT3 D;  2RVL A;  1AFP A;  4HED A;  3I90 A;  2AWO A;  2XWJ B;  2UUC L;  3A7L A;  2DNE A;  5C4J B;  1QVF A;  1RHP A;  1D8L A;  4R4C A;  4LF9 L;  2PZW A;  2K32 A;  5EAY A;  3DUZ A;  4ZLT F;  2P5Z X;  3DEP A;  1A8V A;  4GN5 A;  5A35 A;  4I7A A;  4FXK C;  5ISR A;  3RLN A;  4P72 A;  4JI1 Q;  4APV A;  3NUC A;  2MO1 A;  5GQO A;  3ZJY C;  4IFD G;  3CCJ A;  3OIQ A;  4LFB L;  3K6O A;  1KTK A;  2KQ3 A;  3KF6 A;  1Q8I A;  3DEO A;  1STY A;  4TVA B;  1D5M C;  1STA A;  1UE5 A;  4POG A;  3I4O A;  1G91 A;  1EL0 A;  4IOC A;  3N52 A;  4BBS G;  2B2V C;  1G2T A;  3UE1 A;  5C3W A;  1PZK D;  5IT9 L;  3BZC A;  3KBG A;  4WOR A;  1E22 A;  2ZTE A;  3J7A V;  1PH4 A;  2A19 A;  4NPS A;  2JA6 H;  3Q23 A;  2ZJR A;  3RZO B;  4N8X 1;  2R92 G;  4A3K G;  2EYJ A;  2Z4I A;  1RDP D;  1CHP D;  1FL0 A;  3H6M A;  1BXT A;  1PFB A;  4DV7 L;  1CSP A;  5FJ8 G;  2RHS B;  2KVM A;  2QKI C;  4G7O C;  1JMC A;  2JA5 G;  3DM3 A;  4XXE A;  3QJY A;  3QIA A;  5E1F A;  2MHV A;  3WDN A;  3Q24 A;  1ICW A;  1SRU A;  4NXN Q;  1Y8N B;  2JA8 H;  1WCM B;  2O4X A;  4AQY Q;  4A3J G;  4NXM L;  4KHZ A;  4RG1 A;  1KXL A;  2M2L A;  4LF7 Q;  4YHH L;  2E5L L;  1F77 A;  1S5C D;  3RLO A;  4DAY A;  3OHX C;  1CI3 M;  4EQP A;  3OOC A;  4JOI C;  1T5X D;  5HY6 A;  4RH6 A;  4C3I H;  1S72 A;  1O7Z A;  1D1K A;  3PUZ A;  2D5D A;  4KY7 A;  4ZUI A;  4BBR B;  3GO5 A;  3NSW A;  3KF6 B;  4DR7 L;  5M5W B;  3C2P A;  3FP9 A;  1YHQ A;  2WB1 B;  1ZKO A;  4C3H B;  2E2J B;  1WOC A;  4JI3 Q;  1Z6H A;  2E74 C;  3KF8 A;  4L8J A;  1H9S A;  3M4P A;  3ERQ A;  1H9R A;  4CGY B;  3I4L A;  2RA4 A;  3BVZ A;  2A68 D;  4HAE A;  1X3G A;  4A3M B;  1K8O A;  2YTY A;  5FKA C;  4WRD A;  4X66 L;  5ELN A;  1STB A;  3MEH A;  2I46 A;  1SLJ A;  2CH4 W;  4H13 C;  3TP6 A;  2UUC Q;  3PO3 G;  5C3E H;  3TS0 A;  3G48 A;  2B63 B;  1OO9 B;  4CKE A;  3J80 E;  4DV5 Q;  4A3B G;  2Z4H A;  1V43 A;  2YU9 B;  3A5U A;  1PYB A;  2KCM A;  1H9J A;  1X9N A;  1NMG A;  1SNP A;  3RN5 A;  3GTG H;  1IBM L;  3GV3 A;  1NUC A;  4TSS A;  3I4M H;  3HOU H;  2A6E D;  1ICF B;  1Q12 A;  2BE5 D;  1IL8 A;  1XNR Q;  3K8A A;  1MHW C;  2HQL A;  4QF4 A;  4B9X A;  1SAP A;  2E75 C;  2VB3 X;  1N32 Q;  2WP8 J;  2F0S A;  5LHY 1;  1EQV A;  4OIJ A;  4FF2 A;  3C3L A;  4RCO A;  1JIC A;  1KAA A;  1L0X B;  1Q8K A;  1IYU A;  4DR4 L;  4NKL A;  1U4M A;  4KJN A;  3PQI A;  3KJP A;  2F0F A;  3GTL H;  1NJI C;  4PNY A;  2NVT H;  2LY7 A;  2A69 D;  4FVM A;  4UAI A;  2A5H A;  2EIF A;  1Q1B A;  2RKS A;  3D0F A;  2K6A A;  3D4W A;  1SDF A;  5EKK A;  1YJ9 A;  1KDC A;  1K83 H;  4PZ8 A;  5IGD A;  4JCV E;  1FGB D;  1QIL A;  4DXF A;  5LMN L;  4A3C G;  3G6J B;  1S5E D;  4HSP A;  3E9H A;  2F1M A;  4A3J H;  5J1Z A;  1AZP A;  2H4O A;  1CM9 A;  1QUQ A;  2IL8 A;  4B3M L;  1VS0 A;  4A3D B;  1QG7 A;  1GUT A;  3AFP A;  1SFO H;  4K0K Q;  2L9H A;  4ZKC B;  1BCP F;  3H0G H;  3T13 A;  4C3I G;  1ASZ A;  4LNQ A;  2R61 A;  1XNQ Q;  1E1O A;  5CV8 A;  4ME3 A;  3W2D A;  3NTK A;  2IX3 A;  1PVO A;  2E2D C;  1SE4 A;  2EY1 A;  2IJ0 A;  3CRK C;  1XYI A;  2FMM A;  3EBE A;  4UP8 A;  3NK9 A;  3ZYY X;  5FO8 B;  1BDO A;  1ENC A;  1ZEQ X;  1JJG A;  3K5O A;  3R8B A;  1SJE D;  1WTX A;  1K0R A;  2JJQ A;  2YU9 H;  4LUZ A;  4GKJ L;  2BH8 A;  3TSS A;  3ERS X;  4K2L A;  4NP5 A;  1S5F D;  5C4X B;  2PW5 A;  4IQZ A;  2A8V A;  2F03 A;  1GHK A;  2LKV A;  3X3N A;  1IHZ A;  5DLQ E;  2Y0S E;  4DV4 L;  2BCO A;  3OWF A;  3PIP A;  5ELO A;  2K05 A;  1FNW A;  2QW7 A;  4DV3 Q;  3DWQ A;  1QNU A;  1A3U A;  2HIX A;  4Q0F A;  4R4T A;  4DV1 L;  5EKL A;  1KDB A;  3UDX A;  3RZD B;  5LL6 S;  4TQU S;  1Y8O B;  1I6V C;  2V1C C;  3HFZ B;  1OXT A;  3VYR A;  3TZU A;  5C0X G;  1K8G A;  1Y14 B;  1KRT A;  3CCE A;  3MWY W;  4FDB A;  3T56 B;  2JA6 B;  3ITP A;  4K14 A;  4C56 C;  2NUC A;  3VYU A;  1SMY C;  3D3R A;  4H7B A;  1HNZ Q;  5E3F A;  1G6P A;  1E0B A;  2FMC A;  2ZM6 Q;  4IPC A;  3S2D H;  2F0M A;  3FPU B;  4M1U B;  3J7Y W;  1CQF A;  3QOL A;  3K7A B;  4DR6 Q;  5KNC A;  4X64 L;  1CT1 D;  4JI7 L;  3HKZ G;  2F4V Q;  4K5V A;  3CF5 A;  4A3E H;  2B29 A;  4HJ7 A;  1EEF D;  4MTN A;  1H9K A;  3GQB A;  2L5T A;  1EIH A;  1TU2 B;  1I3Q B;  5EGT A;  3H94 A;  4Z9C B;  5H1S E;  1I94 Q;  2DJG C;  5E4W C;  2QDB A;  1LYL A;  1HA6 A;  1VQM A;  2AWN A;  2HCC A;  2ZJP A;  2F52 A;  2JA7 G;  2EYP A;  2Z1C A;  1K0S A;  1F2M A;  5JPM C;  4FF4 A;  4RWS C;  1HTL D;  2E76 C;  5M5X B;  1Y69 U;  4QMG A;  1BVS A;  1EIG A;  1PRT F;  2CW0 D;  4JI2 L;  1V1P A;  4CKC A;  5C5M A;  3P7J A;  1BO0 A;  3A55 A;  5I6Y A;  1SMX A;  2ZM6 L;  5EPJ A;  2B2W C;  1GO3 E;  5CGK A;  3CRL C;  2NWG A;  3ULL A;  1W6J A;  4R4O A;  2QCP X;  1A6X A;  5IGC A;  2JA5 H;  2DN8 A;  1V1O A;  3E0J A;  4DR1 Q;  3VR3 A;  1D5Z C;  1H95 A;  4M8A A;  5C0X I;  4OO1 G;  3K81 C;  4PG3 A;  2AQ1 B;  4P71 A;  5M3M B;  1PH8 A;  4DR5 L;  4KTA A;  1VQO A;  1BBU A;  3TDQ A;  3T53 B;  2A6E C;  2EDG A;  2SEB D;  5ELB A;  1IYV A;  4CDD C;  3J80 L;  1C48 A;  1XX8 A;  4IPD A;  1KQS A;  2X6L A;  3H91 A;  4KLK A;  1XPR A;  2EY2 A;  4YWM A;  3KYH C;  4HCS A;  3IKJ A;  3NQT A;  3R2T A;  1SYB A;  3TS2 A;  4KD4 A;  5CYU A;  1U0L A;  2MNA A;  3HOZ B;  1PHJ A;  3D4R A;  1XTC D;  1GUN A;  1LLR D;  4YCV A;  4B3T L;  1TR5 A;  3T1Y Q;  1Q82 C;  5JVG 3;  4LFA L;  2XN9 C;  3ND8 A;  3R2I A;  2M9V A;  4A3I B;  2PNR C;  1X3P A;  3W1G A;  4DF7 A;  5K36 H;  2OT2 A;  1ZXT A;  4GLV B;  4RCN A;  5IOD A;  1B8A A;  2F0E A;  3F2B A;  4O2D A;  2RCF A;  3S15 H;  2F0W A;  5E7N A;  3LGJ A;  2F0T A;  4BA1 I;  1PFM A;  1PH6 A;  1YHA A;  1YIT A;  4RGT A;  4JOI A;  1DYQ A;  4A3K B;  4PMB A;  4A3E G;  2V4D A;  2XRS D;  2LSS A;  1SXT A;  5M5Y H;  1QUQ B;  3VYT A;  2HT1 A;  1BNZ A;  1YJW A;  4BWG B;  1G6Z A;  1W3S A;  3DM1 A;  3PIP 3;  1LT4 D;  1BR9 A;  4IN3 A;  2XVS A;  4A3I H;  2JYO A;  3GTL B;  1CKN B;  2JA6 G;  3CXC A;  4UPA A;  4GNX A;  2DGY A;  2JP1 A;  5C4H A;  1IL2 A;  1AH9 A;  3GTQ B;  1X56 A;  1B9M A;  1DD2 A;  3MXG A;  3T1Y L;  1DXM A;  5IP7 H;  3PUX A;  2N88 A;  2QEX A;  1Y1W B;  3J80 c;  3QO2 A;  1Z9F A;  2UUA Q;  1TWH B;  1KNA A;  4RGN A;  2O5J C;  2OXP A;  2RQX A;  2J7Z A;  4A3G B;  1JCK B;  2UU9 L;  1AZQ A;  2YTV A;  2E2H B;  1TWG H;  2NVY H;  1G29 1;  1H9M A;  2XTI A;  2XNA C;  4ZK9 B;  3A0J A;  4ZAI A;  3TN2 A;  2WV6 D;  2FHT A;  3UDF A;  1A0I A;  3STB D;  4XT1 B;  4LF4 Q;  4GOP C;  4CJ0 B;  1C0A A;  5HGQ A;  5D3D A;  1TVX A;  3S17 H;  1GM5 A;  4FO2 A;  3RZD H;  4LAA A;  4OIK A;  4DR3 Q;  3H3V I;  3TZD A;  2EXD A;  3MFY A;  1N8R C;  1P8L A;  1SMY D;  2HQE A;  4KKT A;  3J81 E;  4DR6 L;  5IP9 G;  3R93 A;  2A1A A;  2IT1 A;  1PDQ A;  1FGU A;  5IGG A;  1A3V A;  1ILP A;  5KND A;  2JA5 B;  4GN3 B;  4FXD A;  5BR8 Q;  3M4Y A;  4XTC S;  3QWN A;  2K03 A;  1KNE A;  1RTN A;  3K7A H;  3KFU A;  2EE1 A;  4A3J B;  4RGM A;  2H5X A;  1I4R A;  4G7H C;  5ELC A;  2ICE C;  1A3T A;  2F3I A;  3FKI H;  4OGQ C;  4EQN A;  5LMN W;  3AB9 A;  4GS3 A;  4FF1 A;  1JWM D;  2R7D A;  3PUY A;  4BBR G;  3PIO 3;  4LFC Q;  2NZO A;  1IXR A;  4C1N I;  4HJ5 A;  1YIJ A;  3HOX H;  1MJE A;  1STN A;  3A74 A;  1FYC A;  2D0P A;  3E0E A;  4DAV A;  1JJC B;  1LTS D;  1LTI D;  4BBS H;  3MEF A;  1STE A;  2YTX A;  3NEN A;  1TWF B;  1VQ5 A;  1CFM A;  2F3V A;  4K5X A;  1SND A;  1MI2 A;  3U50 C;  3RD4 A;  1Q46 A;  2WKD A;  2Y0S B;  5CBA E;  1TY0 A;  4JBM A;  3ULJ A;  5E4X A;  3K59 A;  1WD0 A;  3F8T A;  2F0O A;  3M7G A;  4N8F A;  2D0O A;  2YYZ A;  3VA5 A;  4LK1 C;  1SYC A;  2AMC B;  5K5P A;  4X65 Q;  1EY9 A;  1K83 B;  2F0J A;  1EWC A;  1XJV A;  5IE8 A;  1U4P A;  3AEV A;  2K14 A;  1D5X C;  4JBW A;  1XMQ Q;  3LWE A;  2VL6 A;  3TRZ A; 
#chains in the Genus database with same CATH homology
 4JI6 L;  3JAM i;  2VZA A;  2B63 G;  4A3B G;  5LMN Q;  4AQY L;  3M4O H;  2JEA I;  2IX0 A;  1V43 A;  2UUB Q;  3OTO Q;  3PGZ A;  3A5U A;  4A3D H;  1NMF A;  3MXN B;  5IYD G;  3EIV A;  1PYB A;  3K0X A;  2KCM A;  2UXC L;  2RHQ B;  4GNX B;  1X9N A;  1NMG A;  2LXK A;  4Y7N H;  4JI5 L;  1KD1 C;  4EQ5 A;  2Q2H A;  4DR5 Q;  3RN5 A;  3GTG H;  2UUA L;  1IBM L;  2HIV A;  1VQK A;  3HOU H;  3I4M H;  3VDY A;  1Q12 A;  3KDF A;  3F2C A;  1SR3 A;  1XTD A;  1HZC A;  5IWA L;  1HNZ L;  1Y1V G;  1XNR Q;  2IHE A;  4HIM A;  3K8A A;  5GRO A;  4LFB Q;  1YNX A;  2HQL A;  1CUK A;  1N32 Q;  3S1N H;  1WI5 A;  2WP8 J;  5GAH C;  2AHO B;  3OYY A;  2PI2 E;  4LFA Q;  4P74 A;  3UDG A;  1CKN A;  4JI1 L;  1KHI A;  1Q8K A;  4AYB E;  1HNX L;  1OXU A;  4DV0 L;  4DR4 L;  1E3P A;  4L5T A;  1L2F A;  1E24 A;  2CKZ B;  3CCS A;  4OWX B;  1PV4 A;  4YCU A;  3KJP A;  1KL9 A;  1X54 A;  1FJG Q;  2E2J H;  1YBY A;  3GTL H;  3HOZ H;  1VQJ A;  1NJI C;  3K7U C;  5C4X H;  1UE1 A;  2K5V A;  2NVT H;  1TWH H;  3PO3 H;  1VQD A;  3AFQ A;  1I94 L;  4A3C H;  1S40 A;  3JC6 6;  1I50 H;  3S1R H;  1XMO Q;  4H02 A;  2EIF A;  1Q1B A;  2Q2I A;  3D0F A;  4X65 L;  5C44 G;  4DUY Q;  1N34 Q;  1YJ9 A;  4BY1 H;  4GKK Q;  2UXB Q;  4P75 A;  5JJK A;  2LXJ A;  1K83 H;  4PZ8 A;  4QJF A;  3I4M G;  3TRZ A;  3EN2 A;  2GN5 A;  4DUZ L;  2WB1 E;  2KBN A;  4JCV E;  1EYG A;  1MIU A;  3RNU A;  2JA8 G;  3W1B A;  4QIW E;  4ALP A;  2R93 H;  2VUM G;  1EIF A;  5IP7 G;  4LF5 L;  5LMN L;  3RN2 A;  4A3C G;  3RLF A;  3E9H A;  1J6Q A;  1WJJ A;  4MNO A;  3AYH B;  2QA4 A;  4A3J H;  3HOW G;  4JYA Q;  4KHP L;  4A3B H;  3I55 A;  1G51 A;  1QUQ A;  5M5W H;  4B3M L;  1VS0 A;  3CCL A;  1ASY A;  5C0X J;  1EIY B;  3BJU A;  3NEL A;  4X62 Q;  4LUV A;  3S16 H;  3AFP A;  1SFO H;  3PO2 G;  4K0K Q;  2KHJ A;  5IWA Q;  1VQG A;  3J7A 5;  3CW2 C;  1IBK Q;  3H0G H;  2GVB A;  4BBR H;  1ASZ A;  4NXN L;  1GVP A;  4LNQ A;  1PH5 A;  4DNI A;  1N32 L;  4OX9 Q;  1B7Y B;  4A3G G;  3KF8 B;  2PQA B;  1QZG A;  1XNQ Q;  5GAG C;  4Y52 H;  1RL2 A;  4A3M H;  3GTK H;  1E1O A;  4ME3 A;  1C7Y A;  4JI0 Q;  2KCT A;  1PVO A;  4LF7 L;  1PH7 A;  5M3M G;  4BY1 G;  2K5N A;  5FLM H;  1VQL A;  4IPG A;  4HJA A;  4JI4 Q;  2UXD Q;  4DV0 Q;  3EBE A;  4OWT B;  3M85 A;  4UP8 A;  1PH9 A;  4PMW A;  4P73 A;  1JJG A;  2YV5 A;  4BXX H;  4JI8 Q;  2B63 H;  1K0R A;  2JJQ A;  1Q81 C;  5IY0 A;  2YU9 H;  4LUZ A;  5AJ3 L;  3JAM c;  2OQ0 A;  3BZK A;  4LFC L;  3CC2 A;  4GOP B;  1YHB A;  2RCN A;  4GKJ L;  2C35 B;  2BH8 A;  2ASB A;  4LWC A;  3S14 H;  2MFI A;  5GAD C;  3ERS X;  5FLX c;  2R93 G;  3CP0 A;  3S1Q H;  1EQR A;  3HOV G;  1CSQ A;  1N34 L;  4B3T Q;  2A8V A;  1UWV A;  1YI2 A;  2UXB L;  3U4V A;  3U58 A;  1Y1W H;  4B3S Q;  3DLL A;  3T1H L;  1L1O C;  1VQI A;  2N8N A;  5DLQ E;  4DUZ Q;  2Y0S E;  4DV6 L;  4DV4 L;  1U5K A;  3G6E A;  3PIP A;  4X66 Q;  1HZB A;  5ELO A;  4QL5 A;  4A3I G;  2PNH A;  3L2P A;  1DGS A;  2N3S A;  4DV3 Q;  4A3K H;  1UEB A;  4A3M G;  4JC0 A;  2HIX A;  2UU9 Q;  4R4T A;  4DV1 L;  2BA1 A;  4DR3 L;  3UDX A;  4TQU S;  1X65 A;  2V1C C;  4LF6 L;  2BH2 A;  3HFZ B;  2UUB L;  1OXT A;  3CD6 A;  1A63 A;  1L1O B;  1X55 A;  1GKH A;  5C4J H;  1X6O A;  5LMU Q;  2VY3 A;  3CME A;  3HOU G;  2CFM A;  4DAY B;  5C0X G;  4DV7 Q;  1K8A C;  4HIO A;  4OWW B;  2WB1 G;  1K8G A;  1Y14 B;  1KRT A;  3CCE A;  4O0A A;  1J5E Q;  4FDB A;  3TEH B;  3TQY A;  1LUZ A;  1IBM Q;  3PSI A;  4JBJ A;  2K75 A;  3J7Z C;  4JI6 Q;  5M3F G;  4KI0 A;  2GVA A;  1PFS A;  4POF A;  1RIP A;  1JE5 A;  3HOX G;  1HNZ Q;  3OTO L;  1VQE A;  1XNR L;  2ZM6 Q;  3F2D A;  1G6P A;  1EWI A;  1LTL A;  2OCE A;  2Z6K A;  4IPC A;  4YY3 L;  2KHI A;  3S2D H;  1UE7 A;  4A3F G;  4DK6 C;  3CPW A;  1QVC A;  2UXD L;  4JI5 Q;  5J3B A;  4LF8 L;  1VCI A;  4DR6 Q;  2VQF Q;  2I5L X;  1FVI A;  3FKI G;  4X64 L;  4JI7 L;  2R7Z H;  3HKZ G;  1Y1W G;  3H3V H;  2F4V Q;  1B70 B;  2E5L Q;  3CF5 A;  4A3E H;  3U4Z A;  4A93 H;  5AJ3 Q;  3BU2 A;  4BY7 H;  2B29 A;  1VQ9 A;  4YCW A;  2ATW A;  4HJ7 A;  3M7N A;  4X6A H;  4GKJ Q;  4MTN A;  3I56 A;  2PQA A;  3E9I A;  2I5H A;  2OTL A;  5C3E G;  5H1S E;  1I94 Q;  3S1M H;  2K52 A;  4B3S L;  3UE0 A;  2I5M X;  1OTC A;  1LYL A;  1YVC A;  4YWK A;  4DV6 Q;  1VQM A;  4DR4 Q;  2AWN A;  2ZJP A;  2F52 A;  4C2M H;  2JA7 G;  1AE3 A;  2VNU D;  2HHH L;  1O7I A;  2NVX H;  1HNW L;  4IPH A;  2E2I H;  2VQE Q;  2QGQ A;  4LW1 A;  2DUD A;  1IZ6 A;  4IO9 A;  5FJ8 H;  2EQS A;  1VQP A;  2N49 A;  3HOW H;  5JEA G;  4UP9 A;  5GAE C;  4A3F H;  4LF9 Q;  1BVS A;  1W2B A;  1XMO L;  4DKA C;  1IBK L;  4JI2 L;  4BA2 I;  4KHP Q;  2ZTD A;  3G71 A;  2MQH A;  2ZTC A;  1NBW A;  2JK8 A;  1N33 Q;  2RF4 A;  2N78 A;  3K80 C;  1VQN A;  4GLA C;  2ID0 A;  1VQ7 A;  4L5Q A;  4JI3 L;  3M3Y H;  1SMX A;  3CQZ H;  4AIM A;  2VS1 A;  1WCM H;  2ZM6 L;  1XMQ L;  3F1Z A;  1GO3 E;  2KEN A;  2CCZ A;  3ULL A;  5IT9 c;  4B3M Q;  2IHF A;  5IYC G;  2IX1 A;  4R4O A;  2Q2T A;  2VQF L;  1Q7Y C;  1I3Q H;  5K36 G;  2JEB I;  1M1K C;  2JA5 H;  2AKW B;  3M4Q A;  2K4K A;  4DR1 Q;  1KRS A;  1H95 A;  2NN6 G;  3G4S A;  5C0X I;  4IJL A;  4PZ6 A;  4IOA A;  3AQQ A;  2Z0S A;  4OO1 G;  3K81 C;  4PG3 A;  3ICE A;  1KAW A;  2OWO A;  1MKH A;  1OXS C;  4IJH A;  4R4Q A;  4P71 A;  5JJL A;  1D7Q A;  1PH8 A;  1VQB A;  4DPG A;  4DR5 L;  3CC7 A;  1VQO A;  1BBU A;  1AE2 A;  3SGI A;  4QY7 A;  4HJ9 A;  1EQQ A;  1PH2 A;  3CCR A;  4QGU A;  4JI4 L;  1EOV A;  2R92 H;  4IPD A;  1HJP A;  2PI2 A;  3KJO A;  1XPO A;  1KQS A;  4KLK A;  1XPR A;  3HKZ E;  4YWM A;  2HHH Q;  3KYH C;  3HOY H;  3T1H Q;  3IRB A;  3NEM A;  1YZ6 A;  1QZH A;  1HR0 W;  1HNX Q;  3PF4 A;  4IFD I;  2D62 A;  3UDI A;  3TS2 A;  3I4N H;  5IYD H;  1U0L A;  1S3O A;  4YHH Q;  1EUJ A;  2MNA A;  4UY8 C;  4DV3 L;  1PHJ A;  3KDF B;  1UE6 A;  3OW2 A;  5BR8 L;  2NZH A;  4A4I A;  1C9O A;  4YCV A;  4B3T L;  4GLX A;  4DV1 Q;  2I0Q A;  3T1Y Q;  1A62 A;  4NXM Q;  1Q82 C;  1VQC A;  3CCQ A;  4LFA L;  4DV4 Q;  3CCU A;  3PUW A;  3WWV A;  1IBL L;  4DK3 C;  4IFD J;  5LMU L;  4YWL A;  3W1G A;  1PA6 A;  3I4N G;  3Q8D A;  1YEZ A;  2K50 A;  1PYS B;  4OON A;  3GTQ H;  1HR0 Q;  2B3G A;  4GLV B;  4A3D G;  1NY4 A;  4A76 A;  3STB C;  1B8A A;  2E2H H;  1NE3 A;  2JQO A;  3F2B A;  1Q86 C;  4O2D A;  5C4X G;  3S15 H;  1KC8 C;  5E7N A;  2L15 A;  1SRO A;  3KOJ A;  3LGJ A;  4BA1 I;  1E1T A;  4B3R L;  2VW9 A;  1IYJ B;  4YY3 Q;  1PH6 A;  1YHA A;  2OTJ A;  4HJ8 A;  2R7F A;  3GDE A;  1MJC A;  1Z47 A;  4JOI A;  1YIT A;  3HOZ G;  4DUY L;  2CWA A;  4PZ7 A;  2R7Z G;  2E8G A;  4A3E G;  2CWP A;  3CAM A;  4BXX G;  1OXV A;  4JG2 A;  4MZ9 A;  1OXX K;  2LSS A;  3S24 A;  4X62 L;  1V1Q A;  1N9W A;  2WAQ G;  4A3G H;  4JBK A;  4K0K L;  5M5Y H;  1QUQ B;  3L0O A;  4DR2 L;  5C44 H;  2HT1 A;  2NVQ H;  3RZO H;  1YJW A;  3M9B A;  1K73 C;  2K5H A;  4DAM A;  1WYD A;  5M3M H;  1BKB A;  1L0W A;  4LF4 L;  4DV2 L;  1W3S A;  3GTP H;  4JYA L;  1YJN A;  1XNQ L;  4A3L H;  4LF8 Q;  1JB7 A;  5M3F H;  1NTG A;  2PMZ E;  2R6G A;  1I6H H;  4XIG S;  1TXY A;  4A3I H;  2F4V L;  4WJ4 A;  1X3E A;  1VQF A;  2AWO A;  1CKN B;  2JA6 G;  3CXC A;  4UPA A;  4GNX A;  2DGY A;  2UUC L;  4JI8 L;  1IL2 A;  4RMF A;  2VQE L;  3GTO H;  1AH9 A;  1QVF A;  1X56 A;  5IYB G;  3T1Y L;  1D8L A;  4R4C A;  3PF5 A;  4LF9 L;  2IY5 B;  3W5O A;  3I2Z A;  5EAY A;  4JI0 L;  5IP7 H;  3PUX A;  3A5Z B;  1IBL Q;  1A8V A;  2BA0 A;  3B6Y A;  4GN5 A;  5JJI A;  2QEX A;  3J80 c;  1PH1 A;  1Z9F A;  1CKO A;  3CCM A;  1HR0 L;  2UUA Q;  4R4I A;  3RLN A;  4C3J H;  4HIK A;  4P72 A;  4JI1 Q;  4APV A;  2MO1 A;  1P16 A;  1VQ4 A;  5GQO A;  3ZJY C;  4IFD G;  4JV5 Q;  3CCJ A;  2ALY B;  4LFB L;  1BBW A;  4JI2 Q;  4LUO A;  2UU9 L;  3KF6 A;  4B3R Q;  1I5F A;  2YTV A;  5IYC H;  1TWG H;  1M90 C;  4TVA B;  2NVY H;  4POG A;  1UE5 A;  3GTM H;  4L5R C;  4LF6 Q;  1G29 1;  2XTI A;  3I4O A;  3HOY G;  3HKS A;  4IOC A;  4BBS G;  3H15 A;  3UE1 A;  2FXQ A;  3A0J A;  4BY7 G;  5IP9 H;  3BZC A;  4L5S A;  4DR7 Q;  4DR2 Q;  1N36 L;  3UDF A;  2NN6 I;  1E22 A;  1L1O A;  1A0I A;  2ZTE A;  4J15 A;  3STB D;  1PH4 A;  3CC4 A;  2A19 A;  2Z6K C;  1HZ9 A;  4NPS A;  3PO3 G;  4LF4 Q;  4GOP C;  2JA6 H;  1C0A A;  3PV0 A;  5HGQ A;  3S17 H;  1E7Z A;  1GM5 A;  2ZJR A;  3J80 i;  3RZD H;  2R92 G;  5FLM G;  4DR3 Q;  4OO1 I;  3H3V I;  4A3K G;  2JE6 I;  2EXD A;  2OQK A;  4QQB X;  2JA9 A;  2WFW A;  1Y1V H;  1GD7 A;  2WAQ E;  1P8L A;  1N8R C;  1FL0 A;  1JJ2 A;  3PO2 H;  4GKK L;  4DR6 L;  5IP9 G;  4DV7 L;  1CSP A;  2A1A A;  2RHS B;  3ER0 A;  5FJ8 G;  1SN8 A;  3CMA A;  2IT1 A;  2CQO A;  3HOV H;  1FGU A;  1JMC A;  2JA5 G;  3DM3 A;  4NB3 A;  3S2H H;  4LF5 Q;  1VQH A;  4OXP A;  4GN3 B;  4EX5 A;  3NBH B;  5BR8 Q;  1QVG A;  1SRU A;  1X3F A;  4XTC S;  3J81 i;  4NXN Q;  2JA8 H;  4DV5 L;  2VUM H;  4OX9 L;  1HZA A;  3K7A H;  4AQY Q;  4A3J G;  4NXM L;  4KHZ A;  3J81 c;  4RG1 A;  3KFU A;  1VQ6 A;  4WJ3 M;  1KXL A;  1SE8 A;  4LF7 Q;  3PIO A;  5JEA J;  1VQA A;  2UXC Q;  4X64 Q;  3ULP A;  4JI7 Q;  4YHH L;  2H5X A;  3KLW A;  4GOP A;  2E5L L;  4AH6 A;  2Y0S G;  4JV5 L;  1HNW Q;  3RLO A;  3D31 A;  4AYB G;  1VQ8 A;  2F3I A;  3FKI H;  4GN4 B;  2MO0 A;  1TWC H;  5LMN W;  1HH2 P;  1WFQ A;  4GS3 A;  4JOI C;  1R9T H;  5HY6 A;  4C3H H;  2R7D A;  1PH3 A;  3PUY A;  4BBR G;  4C3I H;  5M5X H;  1S72 A;  3FHW A;  2NZO A;  1IXR A;  3H0G G;  3PUZ A;  4HJ5 A;  3GTJ H;  3HOX H;  1YIJ A;  4LFC Q;  1JT8 A;  1MJE A;  3A74 A;  3GO5 A;  3L7Z C;  2D0P A;  3E0E A;  2XGT A;  1N33 L;  4A75 A;  1JJC B;  3KF6 B;  1N36 Q;  4DR7 L;  4R1J A;  3FP9 A;  1YHQ A;  4BBS H;  3GD7 A;  3J81 j;  3MEF A;  2ZJQ A;  1WCM G;  4HID A;  1Q1E A;  1WOC A;  2YTX A;  2Q2U A;  4JI3 Q;  3NEN A;  1XPU A;  2JA7 H;  1VQ5 A;  4A3L G;  1V9P A;  3M4P A;  3U50 C;  1FJG L;  1Q46 A;  4DV2 Q;  2ES2 A;  4JBM A;  3ULJ A;  1X3G A;  3RR5 A;  3F8T A;  1LM0 A;  1K9M C;  2D0O A;  1TWF H;  4A93 G;  3CCV A;  2YTY A;  3PCO B;  1EFW A;  2YYZ A;  4UP7 A;  2AMC B;  4X65 Q;  4GNX C;  4DR1 L;  4X66 L;  5ELN A;  1TWA H;  3PUV A;  1XJV A;  3I7F A;  5IE8 A;  1CKM A;  1SLJ A;  1J5E L;  3AEV A;  2UUC Q;  2K14 A;  5IYB H;  4JBW A;  1K3R A;  3G48 A;  3TRE A;  5C3E H;  1T9H A;  3TS0 A;  1XMQ Q;  1KIX A;  3CPF A;  2VL6 A;  4DV5 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...