5BR8Q

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5br8Q00
3T1HL 4DUZQ 4A76A 1VS0A 2KHJA 4DV0Q 2F4VQ 1UE1A 2AWNA 3CQZH 3ULPA 2UXDQ 2LSSA 3TEHB 1JJ2A 3GTGH 4P73A 5M5YH 5IWAQ 3S17H 3CMAA 4EQ5A 4BBSG 4JI2Q 1PH5A 1VQ5A 3FHWA 3W5OA 3WWVA 4DR3Q 2AWOA 1D8LA 4UPAA 1VQBA 4DV7L 3HOWH 3K7AH 4KHZA 4LF6Q 1UWVA 4QJFA 3GTLH 1EQQA 1X56A 4HIMA 2E2IH 4HJ9A 1XMQQ 2PQAA 3ZJYC 4YWLA 1VQHA 4A3DH 3I4NG 5HGQA 3NENA 3PO2G 1EQRA 4A3DG 4FDBA 1EWIA 3H0GH 4DR7Q 4JCVE 1X9NA 4LUZA 2UUCL 3CPFA 2UU9Q 4UP7A 3CC2A 5M5WH 1YHQA 2E8GA 3CCLA 3RLFA 4A4IA 1VQOA 3S15H 3BZKA 2E2HH 4GKKQ 4LFBL 4RG1A 2JA7G 3UDXA 4A93G 3T1HQ 5M3FH 4BBRH 3CCUA 4DR4L 1KRTA 1VQAA 1KC8C 3S1QH 4IPHA 4Y52H 2NVQH 3PF5A 3HKSA 2OQ0A 3ER0A 2R93H 1HJPA 5ELOA 2I5HA 4MNOA 5GAGC 1K8AC 2HIXA 3M3YH 3S24A 3M4QA 2JA5H 4A3LH 1K0RA 2Q2HA 3CC7A 4A3KH 1KIXA 1KQSA 1CSPA 1E7ZA 2YTVA 4YCWA 1IBKQ 2BH2A 4DV7Q 3KJOA 3NBHB 4GOPC 2Y0SG 1R9TH 1K9MC 1TWFH 1U0LA 1M90C 4B3MQ 4A3BH 3CCEA 2WAQE 1PV4A 1VQMA 3RZDH 3AFPA 5M3MG 2KHIA 3PUVA 3PV0A 1Z9FA 1JJCB 3UE1A 1XPOA 3T1YL 1L1OB 5FJ8G 2GVAA 4HIKA 3F2DA 2RHSB 2JK8A 3RLOA 3M7NA 5M5XH 4C3IH 4PG3A 2D62A 1HZ9A 2JQOA 3RN5A 2UUCQ 4OO1I 1X6OA 1I50H 4HJ7A 3K0XA 1W2BA 1NJIC 1O7IA 3A74A 4MZ9A 1VQNA 2ZTDA 3J81c 4YWMA 3Q8DA 2NVYH 4NB3A 3FKIH 1P8LA 1WCMG 3KOJA 1YI2A 4BA2I 3HFZB 4JI4L 3MEFA 2Q2IA 1IYJB 1BBWA 5IY0A 3PIOA 3RNUA 1L0WA 5LMUL 1BBUA 2R6GA 4AIMA 4JBWA 4O0AA 3B6YA 1SFOH 1PH2A 4NXNQ 1SRUA 4MTNA 5JEAJ 4AYBE 2KCMA 3H15A 5IYBG 1UE7A 5FLXc 3G48A 3L7ZC 2K14A 1JB7A 2F4VL 3HOYG 4DV0L 4IFDG 1K73C 1MJCA 3PF4A 1KAWA 1OXTA 2UXDL 3AFQA 3A0JA 4DV5L 3CCMA 3HOVG 4EX5A 1K83H 5IWAL 3T1YQ 5JJLA 1IL2A 4L5QA 4UP9A 5H1SE 5IP7G 2LXKA 2RF4A 1SE8A 3L0OA 3ULLA 4DR3L 4LF9Q 2KBNA 2K75A 3OYYA 1X55A 1FJGL 5GROA 1AE2A 1L1OA 2VZAA 1YNXA 3GTJH 2IT1A 1PA6A 2ASBA 2C35B 2QEXA 1V9PA 1IBLQ 4NPSA 2Q2UA 2IX0A 5C3EH 1VQ8A 5BR8Q 1EFWA 2CQOA 1KL9A 1X3EA 2EQSA 2BA0A 2ZJPA 2OWOA 3GTPH 5IYDH 1Q8KA 1I6HH 3M85A 3G4SA 2VUMH 4YY3Q 3U58A 3HOUG 4LFCL 4A3GG 3GO5A 5FLMG 4QQBX 1B70B 1YITA 4DR1Q 3CCQA 3PGZA 1YIJA 4JI0L 4YHHL 3GTMH 4A3MG 4BY7H 1XTDA 4C3JH 3M9BA 3M4OH 4DR2L 2ZTCA 5J3BA 1VQLA 4GKJQ 3UDFA 2A19A 1LYLA 4LWCA 1ASZA 2VNUD 3DM3A 4P71A 1FL0A 4DV5Q 2NVTH 5GAHC 2YTXA 4NXML 1C7YA 2DUDA 4DAYB 2YV5A 1C0AA 2R7FA 2NN6G 4DR5L 4AQYL 5GQOA 2UUAL 1N9WA 4X65L 3GTQH 1L2FA 1GVPA 2Z6KA 1EIFA 2OCEA 3JAMi 1IBKL 1FJGQ 1HNXL 1VQEA 2N49A 2N78A 3HOXG 1I94Q 4B3ML 1S40A 1U5KA 4JOIC 1OTCA 2R7ZG 3I4MG 3KF8B 4JG2A 4DV1L 2VUMG 2ES2A 1HNWL 3EN2A 3F2CA 1VQ7A 5JJKA 3J80c 4A3CH 1CKNB 5AJ3L 1JMCA 2B29A 4KLKA 4A3LG 1IZ6A 4BY7G 4KHPL 1CKOA 2JJQA 1A0IA 3TS2A 1OXXK 1LTLA 3CCRA 3S2HH 4JBJA 4LFCQ 1XPUA 4OX9Q 1WOCA 1G51A 3D0FA 4JI5L 4HIOA 2I5MX 1S72A 4LUOA 4YHHQ 2I0QA 1N8RC 4JI0Q 3PO3H 4IO9A 4DR2Q 1NMFA 1NTGA 3GTKH 1G6PA 3BU2A 2WB1E 3HOWG 4POGA 4R4CA 4B3TL 2K5HA 4DK3C 4NXMQ 1YHBA 1VQCA 4JI6Q 3S14H 4NXNL 1X54A 3NELA 4DR5Q 4AQYQ 4X62Q 3G6EA 2UUAQ 2B3GA 1T9HA 5IE8A 4TVAB 5C4JH 4X65Q 2YU9H 1SMXA 2Z0SA 3CXCA 5C0XI 2GVBA 3AQQA 3TRZA 3I4OA 1N34L 1HNXQ 1VQDA 3CW2C 3VDYA 3I56A 2N8NA 4HIDA 3K8AA 2VL6A 3EBEA 4JBMA 1SN8A 2DGYA 3H0GG 1V43A 4DV1Q 1HNWQ 2MFIA 1GKHA 2JA6H 1HR0Q 5C4XH 3KDFB 3OW2A 3UDGA 1Q82C 2A8VA 2B63H 1A63A 3J7ZC 2Y0SE 5AJ3Q 4LF9L 5JEAG 3M4PA 5M3FG 4BBRG 5HY6A 4KHPQ 3J7A5 5GAEC 3PIPA 1FGUA 1VQGA 3CF5A 1VQKA 4GLXA 1FVIA 4K0KL 3TS0A 4JI3Q 3BZCA 1AH9A 2ZTEA 2CFMA 1CKNA 3E9IA 3HOZH 2R93G 1MJEA 4JI5Q 1PVOA 1IBML 2I5LX 3JC66 4YWKA 1K8GA 1YVCA 1IBLL 1CUKA 2JA5G 2PNHA 1TXYA 2UXCQ 4A3KG 1EIYB 2JEAI 5BR8L 1PH9A 1SR3A 1VCIA 3KF6B 4P72A 3G71A 1TWGH 3PUZA 5IYCH 1ASYA 4QIWE 3EIVA 4R4OA 4B3TQ 4A3BG 4DV2L 4YY3L 1W3SA 3CP0A 4BXXH 4XTCS 4JYAQ 4DR1L 4JBKA 2GN5A 1VQIA 3U4ZA 3PSIA 1HR0W 4LF7Q 4A75A 2IX1A 4L5SA 5C4XG 4PMWA 1XNRQ 1N34Q 3KFUA 4JI8Q 1JT8A 2QGQA 1BVSA 1Y1VH 1XMOL 4GS3A 4GKJL 3RN2A 4HJ5A 2R92H 4A3IH 4C2MH 1HNZQ 1E22A 2IY5B 2MO0A 5GADC 2CCZA 5IP9H 3KLWA 1G291 5E7NA 2K5NA 2JE6I 3E0EA 1NBWA 2BA1A 2MO1A 2XGTA 4LF5Q 3ICEA 4X6AH 1GO3E 3A5UA 2JA8H 4YCUA 4A3EH 2IHEA 3FKIG 2EXDA 4R4IA 3ULJA 4R1JA 1QVCA 1AE3A 1I94L 4K0KQ 2AHOB 4APVA 3KDFA 2ZJRA 1VQ4A 1YZ6A 4LF4Q 1IBMQ 1S3OA 4DR6L 1Y14B 4B3RL 4IOAA 2AKWB 2L15A 1Y1WH 1N33Q 2ZM6L 3I7FA 2VQEL 1XPRA 5C44H 2N3SA 2RCNA 2D0PA 2V1CC 1QVFA 4P75A 2FXQA 1I5FA 1PFSA 4DV2Q 1KD1C 1P16A 3LGJA 3MXNB 3KJPA 4GOPB 4OX9L 3PCOB 3FP9A 3KF6A 4DV4Q 5K36G 3HKZG 1JJGA 3E9HA 4BBSH 3GTOH 2UXBL 1XMOQ 1TWHH 2PI2A 1NY4A 4GLVB 3KYHC 4L5RC 1YJWA 2Q2TA 1N36L 4JI6L 4IPDA 5ELNA 4X62L 1Q12A 1L1OC 4QY7A 5LMNW 2F3IA 2AMCB 4BY1H 4X64L 1HH2P 3CD6A 4OO1G 2VW9A 4DV3L 1DGSA 2ID0A 5C3EG 5C0XJ 1NMGA 4BA1I 1E3PA 4OXPA 1EOVA 4C3HH 4OWWB 3I4NH 4KI0A 2K5VA 4POFA 3D31A 3K81C 5IYDG 1YJ9A 4UP8A 4DPGA 2ZJQA 1Q46A 4ALPA 3PO2H 3NEMA 4GN4B 2PMZE 1SLJA 4OWXB 1RL2A 1HR0L 3RZOH 4DR6Q 2A1AA 4DUYL 4B3RQ 2VS1A 1KHIA 2OTLA 2ZM6Q 2VQEQ 4LFAL 4LNQA 4PZ7A 4A93H 2JA7H 1E1TA 1HZAA 1UE5A 5IT9c 3F2BA 4R4TA 1UE6A 4JI3L 2NZOA 1PH6A 1I3QH 4IOCA 2HQLA 4J15A 1RIPA 2UXCL 2KENA 4JV5L 3H3VI 3CC4A 3CAMA 3S2DH 4BY1G 2UXBQ 4HJ8A 3TREA 4IFDI 4IJHA 4X66L 4AH6A 4GOPA 2HHHQ 2Z6KC 2YYZA 1N36Q 3CCVA 1CSQA 4JYAL 1XNQQ 4LW1A 1A8VA 4GN3B 4GNXB 4O2DA 5M3MH 4X64Q 3J80i 4DV3Q 1XNRL 4GN5A 2MQHA 3OTOL 2QA4A 1X65A 2WB1G 4JI8L 5FJ8H 4A3CG 1M1KC 4H02A 2E5LL 4R4QA 1NE3A 2UUBL 3IRBA 1YHAA 3U4VA 4A3JH 1HZCA 1OXSC 1XJVA 1EYGA 1HNZL 1PH3A 4DAMA 4DUYQ 1X3GA 3BJUA 2ATWA 2JEBI 1OXUA 2EIFA 2KCTA 3PUYA 4LFAQ 2MNAA 1VQJA 3W1GA 3GD7A 4DV6L 1PYBA 1QZHA 4LUVA 1K3RA 4LF5L 2WAQG 4LF8L 1A62A 3PO3G 4DKAC 1LM0A 1KXLA 2HIVA 4JC0A 3DLLA 1J5EL 1WCMH 3CCJA 1TWCH 3STBC 2NVXH 1WYDA 1MKHA 5LMNL 4LF4L 4PZ6A 1WI5A 4JV5Q 4QL5A 3ERSX 4L5TA 2NZHA 4JI1L 2CWAA 4IJLA 4DNIA 1N33L 2XTIA 1C9OA 1CKMA 4X66Q 5IYBH 3H3VH 1PH4A 1OXVA 3I55A 1Z47A 3AYHB 3HOYH 2OTJA 4RMFA 5JJIA 1LUZA 1QUQB 1KRSA 3CCSA 4A3JG 2NN6I 1QZGA 4DV4L 2JA6G 4A3FH 3HOVH 3S1NH 2B63G 3OTOQ 1EUJA 2WFWA 3I2ZA 2CWPA 5IP7H 4YCVA 3STBD 3S1RH 2E5LQ 4LFBQ 1TWAH 1YBYA 2UUBQ 4GNXA 3A5ZB 1B7YB 4DR4Q 2R7DA 4UY8C 1IXRA 3PUXA 1PH7A 4DK6C 4AYBG 4QGUA 1PYSB 3K7UC 3HOZG 1Q1EA 1E1OA 3J81i 2D0OA 4DV6Q 1PH8A 2HT1A 2VQFL 4LF8Q 4B3SL 4JI7L 1Q7YC 1PHJA 2BH8A 5EAYA 3UDIA 2CKZB 2K50A 3GDEA 4LF7L 1J5EQ 5DLQE 1N32L 1VQ9A 2HHHL 5IYCG 1PH1A 1VQ6A 4XIGS 5LMNQ 4DUZL 3S16H 3TQYA 4BXXG 2LXJA 4Y7NH 2F52A 1BKBA 3HOUH 1D7QA 1VQFA 4JI1Q 3AEVA 5FLMH 4A3GH 3UE0A 2PI2E 2K52A 4A3FG 1VQPA 1Q86C 1J6QA 2OQKA 3U50C 4A3MH 3K80C 4ME3A 3SGIA 4JI2L 5C0XG 2YTYA 1MIUA 4WJ4A 1Y1VG 2PQAB 4HJAA 2R92G 4A3IG 2JA9A 3F8TA 1X3FA 1JE5A 4GNXC 5IP9G 1QVGA 2E2JH 4GLAC 4LF6L 3RLNA 1HZBA 3F1ZA 4IPCA 2K4KA 2ALYB 1XMQL 4PZ8A 3CMEA 2JA8G 4A3EG 3J81j 1QUQA 4IFDJ 1GD7A 1GM5A 2RHQB 1Q81C 1WFQA 4JOIA 1YEZA 4OONA 3RR5A 1E24A 3JAMc 1Q1BA 3HKZE 3W1BA 3HOXH 1YJNA 1WJJA 1XNQL 4JI4Q 1SROA 1H95A 2R7ZH 1UEBA 3I4MH 2H5XA 4DR7L 1B8AA 2VQFQ 4P74A 5LMUQ 4B3SQ 2WP8J 1V1QA 3CPWA 4JI7Q 3PUWA 4OWTB 4WJ3M 2UU9L 1Y1WG 4TQUS 3L2PA 2VY3A 4IPGA 5C44G 3S1MH 4GKKL 1N32Q 2IHFA
chains in the Genus database with same CATH superfamily
1VS0A 1I4HA 1SXTA 1UE1A 2LSSA 2MGSA 1MHWC 3TEHB 3GTGH 2QDBA 3CMAA 3NWTA 1UUPA 1JC7A 1WTVA 1YNND 3RUZA 4R9WA 1XXGA 4DV7L 1MBYA 2JA7B 3K7AH 4JVZA 1LABA 1XMQQ 2PQAA 2M2LA 3ZJYC 1B4OA 2Z6BA 4C3HG 3I4NG 1SYBA 1XX8A 5HGQA 3IAYA 4WORA 3NENA 1EQRA 4LUZA 1EY6A 3CPFA 4UP7A 3GTPH 1FNUA 1BCPB 5M5WH 1VQOA 2JA7G 1JCKB 5F2DA 2L11A 5EPKA 1KRTA 1PRTB 2RSNA 4IPHA 4Y52H 1LLRD 1H9RA 1GUOA 3E6ZX 4HMJA 2R93H 2HIXA 3S24A 3CC7A 4OHJA 1OO9B 1KQSA 3GV3A 1BR9A 5DM73 1K9MC 3M3YB 1TWFH 1U0LA 2WAQE 3AFPA 1Z9FA 1JJCB 5FJ8G 2O5JC 1PZJD 1U4RA 3RLOA 1WD1A 1F2ZA 3AMUA 3RN5A 1G91A 2UUCQ 4OO1I 1DOKA 1X6OA 1NJIC 1W2BA 1LT6D 1WTPA 3A7AB 2XSCA 4KY5A 3GQBA 2BDNA 5EKLA 1DONA 5C4ZA 4YWMA 3FKIH 3JAME 3MZ5A 1A15A 3MEFA 2Q2IA 1IYJB 1TWAB 5IY0A 1KDBA 3RNUA 1L0WA 2R6GA 2AUKA 2I07B 3BZDB 4XDXA 1PH2A 5JEAJ 2FFKB 5COYA 3H91A 4BS9A 3G48A 2K14A 1JB7A 3HOYG 2BE5C 2PO4A 2UXDL 2EY5A 1NR2A 2OEOA 3QIAA 5IWAL 1IL2A 3NBHA 4UP9A 2HD3A 4I7ZC 2LXKA 3QWNA 3ULLA 5I2XA 2KBNA 2XRSD 3OYYA 1X55A 5LL6S 5GROA 1AE2A 1L1OA 3GTJH 2DNEA 2IT1A 1GOZA 2QEXA 4UAIA 1VQ8A 5BR8Q 4DXGA 2EQSA 2OWOA 2F0IA 1CTMA 2VUMH 4YY3Q 4LFCL 3HOXB 4QQBX 4YHHL 3GTMH 5HURA 2F0PA 4BWGB 3CU7A 3C46A 3NQIA 2VNUD 4J1MA 1S5CD 1FL0A 4P71A 2PNRC 4DV5Q 5GAHC 3OIPA 4DAYB 2YV5A 3M4OB 1TS2A 4DR5L 2WKCA 4AQYL 2UUAL 1FGBD 3T56B 1EIFA 2CW0D 1EY5A 3R8BA 2N78A 3HOXG 5AFWA 3AB9A 2R7ZG 3PQIA 4HMIA 1QNUA 2K03A 3J80c 3MFGA 3VR2A 5IGBA 3D4RA 1IZ6A 3L9AX 4KHPL 1A0IA 4CJ0B 1XPUA 3GTLH 1G51A 1S72A 4JI5L 2F0HA 3H0GB 3S2HB 2WACA 4EQPA 2E2HB 2AQ2B 4KJNA 1CZWA 4NXMQ 1VQCA 2XWJB 4NXNL 1G2TA 1O78A 1U4MA 2B3GA 5IE8A 1IL8A 2NVQB 4X65Q 1SMXA 5C0XI 1SNQA 4PNYA 2EVBA 2A6HC 1HNXQ 3CW2C 2JA5B 4OIKA 3I56A 2EPBA 4XT3B 2N8NA 4HIDA 4MTKA 1SN8A 3H0GG 3VA7A 1V43A 4DV1Q 1ESRA 2F0GA 3DMUA 2JA6H 1GKHA 3BDLA 1R9TB 3OW2A 2DNCA 3EJIA 3M4PA 5JEAG 1TS5A 1SSOA 5M3FG 1EY4A 3FDTA 3PIPA 4JW0A 1HPCA 1MSHA 4GLXA 2B63B 3GV6A 1CKNA 2EY6A 1DOLA 1MJEA 4C3IB 3C1EA 1PVOA 1IBML 4YWKA 1K8GA 1IBLL 2JA5G 1CUKA 3R2IA 2M00A 1TXYA 5CBAE 1SR3A 3TSSA 3G71A 1TWGH 1Z7TA 3IKJA 5FLXL 3P20A 4QIWE 3A55A 3EIVA 4B3TQ 4A3BG 5FO7B 4C1NI 2DN8A 3I8ZA 2RKSA 3HS0C 4K5VA 4HTHA 5D3IB 1UEAB 1VQIA 1CT1D 1EY8A 2IX3A 4PMWA 3MHBA 1N34Q 2AUJD 1PMRA 4C3IG 1EY7A 4A3IH 1BNZA 1E22A 2CCZA 4DK1A 2RQXA 3ZYYX 1KABA 3KLWA 5E7NA 4QB4A 2JE6I 1NBWA 1I4PA 2R92B 4ZAIA 2JA8H 4A3EH 2IHEA 2A68D 2JN4A 1AE3A 1K8MA 1F2MA 2ZJRA 2ENBA 5J1ZA 1DD2A 4RH6A 1N33Q 2VQEL 3MA2B 5KRUA 1RTNA 2N3SA 1RF2D 2RCNA 2V1CC 1RDPD 4P75A 2KEEA 5C3EB 4DV2Q 1KD1C 3LGJA 3KJPA 4OX9L 2F0NA 4DV4Q 5K36G 2K32A 4BBSH 5JAVA 1XMOQ 1TWHH 1PTOD 1IYUA 4JI6L 5ELNA 1II3A 2A69D 4X62L 1L1OC 2F3IA 3CD6A 2VW9A 1DGSA 2ID0A 5C3EG 4BA1I 4KN7C 2K5VA 3K59A 4ZCKA 1YJ9A 3GTQB 1EU4A 4TSSA 1Q46A 4ALPA 3NEMA 4GN4B 1B3QA 1RL2A 1HR0L 4DUYL 4B3RQ 2OTLA 4N9PA 2ZM6Q 4LNQA 4A93H 1E1TA 4A3DB 3F2BA 4G4KA 5IOCA 3BG3A 2WB1B 5E3FA 4JI3L 3UI2A 2OF1A 4IOCA 1V1PA 4J15A 3FPPA 4N8FA 4JV5L 2UXCL 1Z6HA 3S2DH 2EOTA 2FINB 2N88A 3NE5B 2F0VA 4GOPA 2YYZA 2CHBD 2NZ1D 2B2YA 1PTOH 3WDNA 3GTKB 4GN3B 4X64Q 3S14B 5FLXE 5E4XA 1HFNA 2KOLA 2QA4A 1DZ1A 1X65A 2WB1G 1M1KC 4H02A 1PYWD 1RCVD 4ZUJA 1NE3A 2YU9B 4O1NA 1SMYD 2B2VA 1YHAA 3U4VA 4KKTA 1HZCA 4A3JH 1XJVA 1EYGA 1M4VA 1B9NA 4LFAQ 2MNAA 1VQJA 4LF5L 3GD7A 3SXHA 4CJ1B 3H09A 4PMBA 2IL8A 4JC0A 3DLLA 1J5EL 2PZWA 3N6RA 2NVXH 4LF4L 2WV6D 4L5TA 2RDGA 2ZXPA 2CWAA 4IJLA 2XTIA 1GUNA 3S1QB 3I55A 4PV1C 1FYCA 1TY0A 4CJ2C 4RMFA 3HOVH 1VF7A 3PIO3 3S1NH 3OTOQ 4ZKCB 3SHLA 5IP7H 2PYKA 3RMHA 3STBD 1STBA 2UUBQ 2A6ED 2K01A 1DM0B 3SK4A 1SYFA 3MXPA 4C2MB 4IURA 3TBIB 2VQFL 4B3SL 4JI7L 1D2BA 1Q7YC 1PHJA 4OELB 1FNWA 1VQ9A 2HHHL 1VQ6A 2EYOA 4XIGS 5LMNQ 2QILA 4RCOA 3HOUH 1WTXA 1D7QA 2B2WA 1FNVA 1AZPA 2K52A 2NYZD 3VR3A 2OQKA 1LT4D 5IT9E 2L0CA 4A3MH 2ZXRA 1I4RA 2F0TA 2PQAB 1X3FA 2K28A 1JE5A 5IP9G 1GUGA 2NN6H 3F1ZA 4IPCA 2K4KA 5KEEA 1XMQL 3CMEA 3J81j 3J7AV 2I46A 4IFDJ 1GUTA 4OONA 3RR5A 1PZID 5BN3A 3J7AF 1YJNA 1WJJA 2KCCA 3I4MH 1B8AA 2DJFC 3CPWA 4OWTB 2B2UA 3I4LA 1STAA 4HCEA 4ZRZA 2F4VQ 4DV0Q 2AWNA 3ULPA 4K5XA 3S1MB 5DAUA 5KYIA 1PFMA 4P73A 5M5YH 4J8QA 3S17H 2KA7A 1QG7A 1VQ5A 1ET6A 2AWOA 1D8LA 1MGSA 4QUFA 4KHZA 1IHZA 3A54A 1UWVA 4QJFA 1X56A 4HIMA 4G7OC 5EKIA 2E2IH 1JR0D 2JXMB 5FO8B 1I3QB 3K7AB 2LS01 1VQHA 3NP8A 3X3MA 2PCFB 5JJZA 4DK0A 2Q8IB 5C5MA 2LMCB 4FDBA 2UUCL 1GJXA 2Y0SB 3P75A 2UU9Q 1YHQA 4A4IA 5CMDA 2EJFC 4LFBL 5M3MB 1MD2D 2DJGC 4RCNA 4BBRH 3CCUA 4DR4L 1HFGA 2OT2A 3PF5A 1HQRD 3ER0A 3NTIA 4H13C 4MNOA 4F8MA 4A3LH 3DUZA 2PZTA 3M4QA 1K0RA 2Q2HA 4A3KH 2R93B 1E7ZA 2YTVA 2R61A 3NBHB 4GOPC 4ME5A 2Y0SG 4B9XA 4B3MQ 4CGYB 3CCEA 4OEMB 1PV4A 3RZDH 5M3MG 2B2YC 3IL8A 2ZT9C 3UE1A 1LTBD 1L1OB 3ND8A 1PTOF 2GVAA 4HIKA 2RHSB 4LK1C 3M7NA 5M5XH 1EZ6A 1TU2B 2B2VC 2TMPA 4HJ7A 1I50H 1STEA 1SE3A 3HZXA 4WRDA 3Q8DA 3D8GA 2F0WA 4PQXA 1QE6A 3S1RB 1SDFA 4JI4L 1BBWA 1J9OA 1SE2A 3A8KE 5LMUL 1BBUA 1SFOH 2XN9C 3BS1A 2LKVA 5C5LA 2XIWA 5IYBG 5FLXc 4QMGA 4UHVA 5CORA 4IFDG 1DXMA 4OL7A 3AFQA 4DV5L 3DWAA 1FD7D 4ULLA 1AN8A 1KDAA 4R8NA 2RF4A 4A3GB 2HUGA 4DR3L 2DY8A 1G6ZA 3HKZB 2IPKD 2VZAA 1YNXA 4ZYSA 2C35B 4N9TA 1DOMA 4OO1H 1V9PA 1W6KA 3ND9A 4NPSA 2E2JB 1Y69U 1ICFB 3SEBA 2KQ3A 4K6LA 3I91A 1KL9A 4NP5A 2ZJPA 5IYDH 3DHQA 4HSVA 4A3GG 3GO5A 1B70B 4J6HA 2B2WC 4Q5VA 4BY7H 4C3JH 2VUMB 2WINB 1G2SA 3M9BA 2ZTCA 2TSSA 2F0LA 5FOBB 2NWGA 3VR4A 1VQLA 4F88A 4FP5D 1ASZA 4GKJQ 2H1EA 2YTXA 3KK7A 4NXML 1C7YA 2DUDA 4OGQC 3Q24A 3CQZB 2LY7A 4H44C 4RHSA 1N9WA 4TRDA 4X65L 4O42A 2J4XA 1IBKL 2OCEA 1I4XA 1HNXL 3TP7A 4HEDA 4JG2A 4DV1L 3HOWB 2VUMG 1D5XC 1ICWA 1CKNB 2B29A 1HXYD 1RKNA 2B2UC 4L6TB 1EQVA 1KLUD 3KBGA 3TS2A 1LTLA 3CCRA 2X69A 3NPPA 2D5DA 1WOCA 3ERQA 4HIOA 4K6DA 4LUOA 2I0QA 4JI0Q 3PO3H 3J81E 3G7LA 3I70A 1KNEA 4F87A 1QWYA 2PPBC 5I6YA 1C4QA 3S15B 3T16A 3HOWG 4B3TL 1YHBA 1BOSA 4HN7A 5I9OA 1T9HA 5C4JH 4TVAB 3TRZA 5DEHA 2EDGA 1N34L 3EROA 4QCLA 3VDYA 1DCZA 2MFIA 5C4XH 1Q82C 5EBCA 3J7ZC 2B8FA 5AJ3Q 4LF9L 3QOLA 3K57A 1VQKA 5IGCA 3TS0A 3BYYB 5CV6A 2CFMA 3E9IA 5KIXA 1ML0D 4S3SA 4M8AA 1JWSD 1RODA 1FR3A 1T5XD 1AFPA 3QB3A 3DEOA 1EIYB 3VYSA 1PH9A 1E2VA 5IYCH 3TMEA 4R4OA 4TKOB 2NVYB 4DV2L 4GZYC 4BXXH 2A74C 1HUNA 5I9PA 4DR1L 4JBKA 2GN5A 3NUCA 2JP1A 3PSIA 2IX1A 4L5SA 4KD3A 1JT8A 5C0XH 4B9WA 1Y1VH 1XMOL 2NTTA 1HNZQ 2IY5B 4K2KA 1EWCA 1F9QA 1G291 2C9OA 3HRZC 5CC4A 2Z8LA 2XGTA 3HGBA 3ICEA 1GO3E 3A5UA 4YCUA 1K83B 2C5CA 1F2LA 1QVCA 1I94L 2SOBA 4K0KQ 2AHOB 2XNAC 1VQ4A 2BDOA 2EE1A 4A3EB 4B3RL 1UAPA 1EFID 4IOAA 2L15A 2ZM6L 3I7FA 5C44H 1V1PB 2F0OA 1QNKA 1BXTA 1I5FA 2FXQA 4DFAA 2IJ0A 3LWEA 3SDZA 4X3TA 4GOPB 5NUCA 3PCOB 4EVOA 4G7ZC 1L0XB 1CA5A 1I6HB 3E9HA 3SVMA 4CDCC 3GTOH 1BCPD 1BDOA 2F0UA 1TR5A 1YJWA 1DYQA 1Q8IA 4IUUA 1PRTD 4BY1H 4X64L 2D9UA 1HUMA 2MJ8A 4C3HH 3I4NH 3OW7A 3AU7A 4UP8A 4YIJA 4DPGA 1JORA 4OWXB 2PMZE 3NHHA 4DA2A 3RZOH 2QF7A 1SYCA 4LFAL 1H9SA 2JA7H 1UE5A 4X3SA 1CHPD 4R4TA 1UE6A 4FXDA 5EKKA 4IN3A 1PH6A 2HCCA 1VF5C 2KENA 3H3VI 1F77A 3TREA 4IFDI 3MXNA 4RHRA 3DM1A 2J7ZA 1B1ZA 1KAAA 1N36Q 3S2DB 3K5OA 4JYAL 4LW1A 4QF4A 2L12A 2CH4A 3J80i 4DV3Q 1XNRL 2MQHA 3OTOL 4LJZC 4A3CG 5FJ8H 4JI8L 4FXKC 4KKUA 4R4QA 1TVXA 2UUBL 4KN4C 1HQMC 2N55A 1F2YA 1I6VC 1XYIA 1PH3A 1GHJA 2EZVA 3W1GA 1PYBA 4A3JB 1A62A 3DEPA 2B8GA 3K0YA 4QIWB 1O80A 4K5WA 5JPMC 5LMNL 3OWEB 1BBXC 2FMMA 2NZHA 4AYBB 3HOZB 2NVXB 4X66Q 1OXVA 1VDZA 1Z47A 3HOYH 3DXJC 4CHTB 1TT2A 2NBFA 1KRSA 4A3JG 3FMCA 1QZGA 4KTAA 1KNAA 2K5WA 2B63G 1EUJA 3A7LA 3I2ZA 1SYGA 3KLRA 5KNCA 1YNJD 2F3WA 1TWAH 1BQQT 5IODA 2R7DA 4UY8C 3S1NB 4AYBG 3TZUA 1ILPA 3K7UC 3HOZG 2Z1CA 1E1OA 3J81i 2L4NA 3X3NA 4LF8Q 3UDIA 2JSOA 2D2CC 1WVLA 2E76C 2KVMA 1MI2A 3Q22A 4JI1Q 3AEVA 3TP6A 2PI2E 1VQPA 1B2TA 1J6QA 3TP8A 1IKMA 4WJ4A 2Z9HA 1Y1WB 1EU3A 1B9MA 2R92G 1B44D 3F8TA 3EQLC 1BF4A 1A2TA 4GNXC 3R3OA 1QVGA 1QILA 1S5FD 2JYOA 4GLAC 3SK8A 5CGKA 2OXPA 1D5MC 1ONLA 4PZ8A 2EYPA 1QUQA 1GD7A 1GM5A 1QCBD 1Q81C 3NXWA 3JAMc 3HOXH 5FK9C 1XNQL 1YNNC 3URYA 1ZYRD 1UEBA 2R7ZH 4K8JA 4OIJA 2VXWA 2WP8J 3A8JE 3PUWA 1EYCA 3KLSA 4XT1B 1Y1WG 4TQUS 3L2PA 2UU9L 4IPGA 4LF7Q 1N32Q 1M8AA 5IT9L 5IGGA 4K14A 2KHJA 1XTCD 3MWYW 2UXDQ 3WOEA 1JJ2A 1SBBB 4DNTB 3PO2B 5IWAQ 1PH5A 5KNBA 3W5OA 3WWVA 2HCIA 1H9JA 4UPAA 1VQBA 1LTGD 3S17B 4LF6Q 2RVLA 1EQQA 4DU9A 2L9HA 3OMGA 4CDEC 3TDQA 4YWLA 3E5SA 5J39A 2BOSA 2F0MA 1EWHA 5CV5A 4G7HC 3PO2G 4A3DG 5T1GA 4DR7Q 3H0GH 4JCVE 1X9NA 3CC2A 3CCLA 3S9WA 2E2HH 5JEAH 3T1HQ 5M3FH 4CKCA 4XXEA 1VQAA 5FKAC 1JQYD 2NVQH 5ELOA 2I5HA 2RA4A 1K8AC 2JA5H 1BUVT 1EY0A 1KIXA 4G57A 4YCWA 2BH2A 3KJOA 2MPMA 3P7JA 1R9TH 4A3BH 1VQMA 1WCMB 1TWCB 2KHIA 3PUVA 4RGOS 1XPOA 1SNPA 1BCPF 3QOJA 3F2DA 5I6WA 2JK8A 3TN2A 4ID6A 4C3IH 4PG3A 2D62A 2JQOA 1PRTF 5HGTA 1VMCA 1O7IA 3QG1A 4MZ9A 5M5XB 1AP0A 2ZTDA 1QOHA 5IGFA 4NB3A 2X6LA 5CV4A 1JE4A 1WCMG 3KOJA 3HFZB 3PIOA 4KMUC 1GUWA 3FPUB 2EYJA 4AIMA 4JBWA 4O0AA 3B6YA 4NXNQ 4MTNA 4JPBW 3H15A 1UE7A 3L7ZC 3O13A 1PFNA 3SK5A 1JICA 1WTRA 1K73C 4KJOA 3PF4A 1KAWA 1OXTA 4HR7B 3A0JA 4RWSC 3A56A 4EX5A 3T1YQ 5K36H 4L5QA 5C3XA 3IFTA 5EGTA 5H1SE 4Y7NB 4L63B 1SE8A 4ZLTF 4FF1A 2O4XA 1K8OA 2SNMA 4EQNA 1LO5D 2RBMA 1PA6A 4FYDA 1IBLQ 2Q2UA 1G8ZD 2IX0A 5C3EH 1EFWA 2CQOA 4KKSA 1NCVA 2BA0A 1SYDA 1AZQA 3SE0A 3G4SA 2CW0C 4P2CB 1LTID 2Z4IA 5FLMG 1YITA 4ILWA 4IQZA 3CCQA 1AEXA 2QDLA 3PGZA 3D6CA 2KEDA 4JI0L 5BN5A 4RKBA 1C48A 5J3BA 4CKBA 2A19A 1LYLA 3NTHA 3DM3A 2NVTH 4BY7B 2F0JA 2PW7A 5GQOA 1Y8PB 3NSWA 4Q0FA 3GTQH 3TZDA 1L2FA 1GVPA 3GTGB 1FJGQ 4L8JA 3J80L 2DY7A 3A8IE 1S40A 1Q3LA 1SJED 1LT5D 3EN2A 1VQ7A 5JJKA 5AJ3L 1HA5A 4BY7G 1CKOA 2JJQA 1EQTA 4JBJA 4OX9Q 1ILQA 2MUYA 3D0FA 4RGMA 2I5MX 3V96A 1CA6A 1N8RC 5ELFA 1Y8NB 4DR2Q 3GTPB 5M5WB 1U4PA 1NMFA 1SNCA 2CQAA 5J22A 3GTKH 1ENAA 5ELBA 3FRPB 4R4CA 3T13A 3S14H 2K5HA 4DK3C 4JI6Q 1X54A 3NELA 4X62Q 4U673 2YU9H 3CXCA 2EYFA 3AQQA 1F9RA 1EEID 3SR1A 5E4WC 3R93A 4HCSA 2X6GA 3EBEA 3K8AA 2L1BA 4U68A 4JBMA 2DGYA 3GP7A 1KTKA 2HQEA 2F0EA 4M1UB 1HNWQ 2K33A 1HR0Q 1TWFB 2A8VA 1NR4A 1A63A 2WIIB 2Y0SE 1EOTA 3M4YA 3R2TA 2BCOA 3D4DA 3J81L 3KF8A 3J7A5 5GAEC 1VQGA 3CF5A 5C4XB 1FVIA 4K0KL 4JI3Q 3BZCA 1AH9A 2ZTEA 2R93G 2LFNA 4RKLA 2A6HD 1EIHA 3S1QH 3JC66 3MTSA 2UXCQ 2QKIC 2PNHA 5DM63 2NUCA 5BR8L 1VCIA 3PUZA 1HHVA 4YY3L 3FKIB 3CP0A 2A68C 4XTCS 3E3XA 3I3CA 2IWHA 1HR0W 4A75A 5C4XG 5KGUA 2AQ3B 3ONAB 2QGQA 1BVSA 3RN2A 1R4QB 4C2MH 2MO0A 5IP9H 2K5NA 2XVSA 1JOQA 2MO1A 4LF5Q 1WTOA 1E0BA 3FKIG 2EXDA 4R4IA 3ULJA 4R1JA 1JB3A 4APVA 3KDFA 1H9SB 1TS4A 3FEWX 2FMCA 1PTOC 4KHVA 4LF4Q 2FHTA 1B50A 1S3OA 4N8X1 2AKWB 3J80E 3LNNA 3N52A 3GTJB 1LT3D 1XPRA 2A69C 2XRQD 1H9KA 1D1IA 3Q6SA 1P16A 2HDMA 4E6IA 3MXNB 2IW3A 3KF6A 3LX0A 3HKZG 1O7LA 3WOFA 1SNDA 4IUVA 4B08A 3GTMB 1ENFA 4DAPA 2Q2TA 1N36L 1A3VA 4DNRB 1J8IA 2G9HD 2AMCB 4DV3L 2B39A 1E3PA 4OWWB 1EOVA 5CR3A 4BY1B 3D31A 2KJXA 2ZJQA 2K5DA 4FVMA 2E75C 3Q0AA 4DR6Q 4C3HB 3I4NB 2VS1A 1KHIA 5EQ0A 3MAQA 4PZ7A 1HZAA 5IT9c 1HA6A 5BN4A 4NMZA 3RZOB 1HTPA 1LTAD 2NZOA 1GHKA 1A6XA 1JWUD 1I3QH 1TQOA 3I72A 1SMYC 1RIPA 4I7AA 3CC4A 2UXBQ 4BY1G 3GTLB 4X66L 1JWMD 3BYTB 2WAQB 2F0KA 1CSQA 2F0DA 4MHEA 4ZK9B 3D6WA 1A8VA 5M3MH 5ELCA 1CM9A 1K28A 4GN5A 2Q8TA 4V190 2E2DC 3MXGA 2PQEA 4CKEA 2EYHA 3IRBA 3J7YW 2KUMA 2O2LD 1OXSC 3W2DA 3BDOA 3BJUA 2ATWA 3PUYA 4LUVA 1K3RA 4LF8L 2WAQG 2JA6B 1LM0A 4IUTA 1KXLA 3CHBD 2RDHA 3CCJA 3STBC 2A6EC 4IZ8A 1WI5A 2F3VA 4QL5A 2F03A 4JI1L 5EBDA 1N33L 1CKMA 4DGZA 2RCFA 4ZKBB 5IYBH 3H3VH 1PH4A 3K5LA 4IFDH 4C1NK 5JJIA 1QUQB 1TWGB 3CCSA 1IW7D 4DV4L 2JA6G 4A3FH 2AQ1B 3HOYB 1JOOA 2WFWA 2QW7A 3S1RH 2E5LQ 4LFBQ 1EY9A 4C56C 4GNXA 4DR4Q 1PYSB 1ENCA 4H0LC 1Q1EA 4DV6Q 2D0OA 4CDFC 4ABNA 4A3IB 5EAYA 5LL6X 3NQTA 2CKZB 2K50A 4LF7L 1N32L 1PH1A 1S5BD 2NB0A 2JA8B 3S16H 4NDXA 1ET9A 4IUQA 5ISRA 2LXJA 5CV9A 3G6JB 1W6JA 4KD4A 2EY2A 1CFMA 3UE0A 4A3GH 4RGTA 3K80C 2YTYA 2SNSA 2K05A 1CI3M 5T1IA 3I90A 4HJAA 4A3IG 4MIUA 2Q8RE 2E2JH 3MXUA 4LF6L 2XWBB 1V1OA 3RLNA 2CH4W 1HZBA 5JOBA 4QUCA 2ALYB 2P5ZX 3VYUA 2JA8G 4A3EG 4XQQA 2RHQB 4JOIA 4BBSB 1E24A 1PLFA 1Q1BA 1TWHB 4JI4Q 1SROA 2PMZB 2F0FA 2H5XA 4DR7L 4P74A 1D6EC 5LMUQ 1ESFA 1V1QA 1R4PB 3TP5A 2VY3A 3H6MA 4FF4A 2R7ZB 3T1HL 3EFXD 4FO2A 5EPLA 4DUZQ 1EEFD 3T4AC 4A76A 3VR5A 3CQZH 3CRLC 2M9VA 5ELDA 1S4ZA 4BBSG 4EQ5A 3KUPA 4WJWA 5A2QL 4JI2Q 3FHWA 4DR3Q 4A93B 3HOWH 4KY7A 2SDFA 4XYOA 3NK9A 2QEJC 3NWSA 4HJ9A 2VB3X 3K5NA 2A73B 4XYQA 1A3UA 3DWPA 1L0YB 2H4OA 3E0JA 1EWIA 2E8GA 3RLFA 1PTOB 1WD0A 3S15H 3BZKA 4GKKQ 4RG1A 4A93G 3UDXA 1KC8C 5JVH3 5C6AA 3HKSA 2OQ0A 1HJPA 5M3FB 2EYLA 5GAGC 3M3YH 3BVGA 1UNSA 1U9RA 1CSPA 2MP1A 1IBKQ 4DV7Q 3BVMA 1RTOA 3P1HA 1M90C 3PIP3 5EJWA 3H94A 3PV0A 1HTLD 3T1YL 4UDUC 4A3BB 1Y8OB 1HZ9A 2QCPX 1A2UA 3VYTA 3K0XA 3T53B 3A74A 3U9OA 4EGVA 1VQNA 3J81c 3HOVB 2NVYH 1P8LA 1YI2A 4BA2I 3SK6A 2MHVA 1Q90A 5ELEA 5KNDA 4R8IA 1WTQA 4DXFA 1SRUA 4AYBE 2KCMA 5JPNC 2CVRA 1XWEA 2F4VL 4DV0L 5IIFA 1MJCA 4NKLA 1I4GA 1IKLA 1A3TA 3CCMA 3HOVG 1K83H 3D4WA 5JJLA 3QJYA 4K8IA 2ICEC 5IP7G 3HOUB 3L0OA 4LF9Q 1D5ZC 2K75A 2VB2X 5CV7A 2RSOA 1FJGL 2EYMA 4A3MB 4EQOA 1PXUA 1F9PA 5A2QE 1SEBD 2ASBA 4XQNA 2GA4B 2O5IC 3CRKC 2L5TA 1E2ZA 5CYUA 1X3EA 3OWFA 2WKDA 1Q8KA 1I6HH 3M85A 3HOUG 3U58A 1SYEA 1QB5D 3F2UA 4DR1Q 1D1KA 1H9MA 1YIJA 3I4MB 3C3LA 3IFDA 4A3MG 1XTDA 3M4OH 4DR2L 3UDFA 4LWCA 1S5DD 1X3QA 1SJHD 3EVQA 1EYDA 2R7FA 2NTSA 2NN6G 1BO0A 3OSOA 2NVTB 2K6AA 2Z6KA 4HAEA 3JAMi 5M5YB 1NAPA 1VQEA 2N49A 4B3ML 1I94Q 3H3VC 1U5KA 4JOIC 1OTCA 5EPJA 3I4MG 3KF8B 4KV6A 2ES2A 1HNWL 3F2CA 4Z9CB 1C8CA 1DJRD 4IALA 3C2PA 4A3CH 1JMCA 4KLKA 2E2IB 1EZ8A 3MFYA 3MC0B 4RFBA 1OXXK 3S2HH 4LFCQ 4ODGA 2ZXOA 4YHHQ 1WTHA 1ZEQX 2ICIA 4IO9A 1NTGA 1G6PA 3BU2A 2WB1E 4WFN3 4POGA 5I4DA 4BBRB 1O7ZA 3OPOA 1CQFA 4DR5Q 5G3LD 4ZQ3A 4MN3A 1STHA 2R3ZA 3G6EA 4AQYQ 2UUAQ 2HDLA 2F4IA 2Z0SA 2GVBA 3I4OA 1VQDA 4DAYA 1KDCA 4LMQD 4A3KB 2K7VA 2VL6A 4X3UA 4IUNA 2K04A 2EY1A 2G5DA 3KDFB 3UDGA 1AW7A 2B63H 3OHXC 3K5MA 3RZDB 2B2TA 4BBRG 5HY6A 4KHPQ 1IW7C 1FGUA 1WTWA 3RD4A 3HOZH 3DWQA 4JI5Q 2I5LX 4A3LG 1NSNS 1YVCA 1O7YA 5I2YA 1NNXA 4A3KG 1I50B 2JEAI 3KF6B 4P72A 4DN4M 5M9OA 5E1FA 3MEHA 1ASYA 1RD9D 5JVG3 1W3SA 3L3OC 4JYAQ 1SNMA 4FXGC 3U4ZA 4KK7A 1XNRQ 1RJTA 3KFUA 1SFOB 5CBEE 4JI8Q 1STNA 4GKJL 4GS3A 1PDQA 3BDCA 4HJ5A 4DF7A 2R92H 2RDFA 5GADC 1NUCA 5CV8A 1TY2A 4JK1C 3E0EA 2BA1A 4X6AH 5LHY1 3HP3A 4V0BA 3OMCA 2L55A 1BCPC 1YZ6A 1IBMQ 2BE5D 1ZXTA 4FF2A 4DR6L 1Y14B 4CDDC 1Y1WH 1PRTC 2D0PA 1QVFA 1PFSA 5A35A 2EXZA 3D3RA 5D3DA 3FP9A 1CK1A 1JJGA 3M7GA 2KECA 2UXBL 1CHQD 1K3BC 1STYA 2PI2A 1NY4A 4GLVB 3KYHC 4L5RC 4C3JB 4I65A 2KCNA 3K6OA 4IPDA 2FJ2A 4DAVA 1Q12A 4QY7A 5LMNW 1V8QA 4RGNA 4OO1G 1HH2P 3MVVA 1B53A 4FNFA 5C0XJ 1NMGA 3KLSX 4OXPA 4KI0A 4POFA 3K81C 5IYDG 1HCZA 3PMFA 3PO2H 1EIGA 3V05A 4A3DH 1SLJA 2A1AA 3OIQA 2V4DA 2KHSA 2PZUA 4LAAA 2VQEQ 4C3JG 3HEJA 1T5EA 4XQJA 1U4LA 3W3AA 2HQLA 5D14A 5IGDA 4F7XA 3CAMA 4KY6A 5IGEA 4HJ8A 3VYRA 4IJHA 4AH6A 1CZGA 3U9SA 2HHHQ 3PO3B 2Z6KC 3CCVA 3T51B 1XNQQ 3EA6A 4GNXB 4O2DA 4RA8A 4ZUIA 1EL0A 3CKIB 1SE4A 5TSSA 5K5PA 2E5LL 5C4JB 3ITPA 5KYLA 1E2WA 1CQVA 1HNZL 1LTTD 1QJOA 4NW2A 4DAMA 4DUYQ 1X3GA 2JEBI 1OXUA 1SAPA 2EIFA 2KCTA 5C4HA 4DV6L 1C0AA 1QZHA 3PO3G 2E74C 1F9SA 3I73A 4DKAC 5D65A 2HIVA 1KLGD 1K0SA 1WCMH 1TWCH 1PZKD 1WYDA 1YNJC 2F0QA 1MKHA 2SEBD 1B3AA 1TIID 4PZ6A 4JV5Q 3ERSX 1HRJA 4PMCA 1MSGA 3V2TA 4IUPA 4DNIA 1C9OA 1JOKA 3NBIA 5C3WA 3AYHB 3HG9A 4HSPA 3FVQA 2OTJA 2Z4HA 1LUZA 2NN6I 3K58A 2CWPA 1IYVA 4YCVA 2F1MA 1YBYA 2B2TC 3A5ZB 1B7YB 2F0SA 4A3FB 1IXRA 2A5HA 3PUXA 4DK6C 1PH7A 1LV9A 1TKWB 4QGUA 1Y1VB 2K1BA 2G9DA 1PFBA 2EJMA 1RHPA 2HT1A 1PH8A 4K2LA 2BH8A 1X3PA 1LTSD 2K5QA 3VA5A 2EJGC 3GDEA 3NTKA 1J5EQ 5DLQE 5IYCG 4DUZL 1S5ED 3TQYA 4BXXG 4Y7NH 2F52A 1BKBA 1LTRD 5FO9B 1VQFA 1TS3A 5FLMH 1LACA 1SNOA 4A3FG 1I4QA 1Q86C 3S16B 1ZYRC 3U50C 4ME3A 3SGIA 4JI2L 5C0XG 1MIUA 1Y1VG 4X3KA 3C1FA 3KBXA 5C44B 2JA9A 4FF3A 5G3LF 3QO2A 3JAML 4CBVA 1STGA 3Q23A 1GXDC 3QR8A 1VMPA 5DNFA 2PW5A 1WFQA 1YEZA 3GTOB 3HKZE 3W1BA 1EYAA 3VR6A 3OOCA 1H95A 1ZKOA 2VQFQ 4B3SQ 3LWUA 4JI7Q 1X32A 5L37A 4WJ3M 1GUSA 3BVZA 4H7BA 4RAUC 5C44G 3S1MH 4GKKL 2J0TD 2IHFA
chains in the Genus database with same CATH topology
3T1HL 4DUZQ 4A76A 1VS0A 2KHJA 4DV0Q 2F4VQ 1UE1A 2AWNA 3CQZH 3ULPA 2UXDQ 2LSSA 3TEHB 1JJ2A 3GTGH 4P73A 5M5YH 5IWAQ 3S17H 3CMAA 4EQ5A 4BBSG 4JI2Q 1PH5A 1VQ5A 3FHWA 3W5OA 3WWVA 4DR3Q 2AWOA 1D8LA 4UPAA 1VQBA 4DV7L 3HOWH 3K7AH 4KHZA 4LF6Q 1UWVA 4QJFA 3GTLH 1EQQA 1X56A 4HIMA 2E2IH 4HJ9A 1XMQQ 2PQAA 3ZJYC 4YWLA 1VQHA 4A3DH 3I4NG 5HGQA 3NENA 3PO2G 1EQRA 4A3DG 4FDBA 1EWIA 3H0GH 4DR7Q 4JCVE 1X9NA 4LUZA 2UUCL 3CPFA 2UU9Q 4UP7A 3CC2A 5M5WH 1YHQA 2E8GA 3CCLA 3RLFA 4A4IA 1VQOA 3S15H 3BZKA 2E2HH 4GKKQ 4LFBL 4RG1A 2JA7G 3UDXA 4A93G 3T1HQ 5M3FH 4BBRH 3CCUA 4DR4L 1KRTA 1VQAA 1KC8C 3S1QH 4IPHA 4Y52H 2NVQH 3PF5A 3HKSA 2OQ0A 3ER0A 2R93H 1HJPA 5ELOA 2I5HA 4MNOA 5GAGC 1K8AC 2HIXA 3M3YH 3S24A 3M4QA 2JA5H 4A3LH 1K0RA 2Q2HA 3CC7A 4A3KH 1KIXA 1KQSA 1CSPA 1E7ZA 2YTVA 4YCWA 1IBKQ 2BH2A 4DV7Q 3KJOA 3NBHB 4GOPC 2Y0SG 1R9TH 1K9MC 1TWFH 1U0LA 1M90C 4B3MQ 4A3BH 3CCEA 2WAQE 1PV4A 1VQMA 3RZDH 3AFPA 5M3MG 2KHIA 3PUVA 3PV0A 1Z9FA 1JJCB 3UE1A 1XPOA 3T1YL 1L1OB 5FJ8G 2GVAA 4HIKA 3F2DA 2RHSB 2JK8A 3RLOA 3M7NA 5M5XH 4C3IH 4PG3A 2D62A 1HZ9A 2JQOA 3RN5A 2UUCQ 4OO1I 1X6OA 1I50H 4HJ7A 3K0XA 1W2BA 1NJIC 1O7IA 3A74A 4MZ9A 1VQNA 2ZTDA 3J81c 4YWMA 3Q8DA 2NVYH 4NB3A 3FKIH 1P8LA 1WCMG 3KOJA 1YI2A 4BA2I 3HFZB 4JI4L 3MEFA 2Q2IA 1IYJB 1BBWA 5IY0A 3PIOA 3RNUA 1L0WA 5LMUL 1BBUA 2R6GA 4AIMA 4JBWA 4O0AA 3B6YA 1SFOH 1PH2A 4NXNQ 1SRUA 4MTNA 5JEAJ 4AYBE 2KCMA 3H15A 5IYBG 1UE7A 5FLXc 3G48A 3L7ZC 2K14A 1JB7A 2F4VL 3HOYG 4DV0L 4IFDG 1K73C 1MJCA 3PF4A 1KAWA 1OXTA 2UXDL 3AFQA 3A0JA 4DV5L 3CCMA 3HOVG 4EX5A 1K83H 5IWAL 3T1YQ 5JJLA 1IL2A 4L5QA 4UP9A 5H1SE 5IP7G 2LXKA 2RF4A 1SE8A 3L0OA 3ULLA 4DR3L 4LF9Q 2KBNA 2K75A 3OYYA 1X55A 1FJGL 5GROA 1AE2A 1L1OA 2VZAA 1YNXA 3GTJH 2IT1A 1PA6A 2ASBA 2C35B 2QEXA 1V9PA 1IBLQ 4NPSA 2Q2UA 2IX0A 5C3EH 1VQ8A 5BR8Q 1EFWA 2CQOA 1KL9A 1X3EA 2EQSA 2BA0A 2ZJPA 2OWOA 3GTPH 5IYDH 1Q8KA 1I6HH 3M85A 3G4SA 2VUMH 4YY3Q 3U58A 3HOUG 4LFCL 4A3GG 3GO5A 5FLMG 4QQBX 1B70B 1YITA 4DR1Q 3CCQA 3PGZA 1YIJA 4JI0L 4YHHL 3GTMH 4A3MG 4BY7H 1XTDA 4C3JH 3M9BA 3M4OH 4DR2L 2ZTCA 5J3BA 1VQLA 4GKJQ 3UDFA 2A19A 1LYLA 4LWCA 1ASZA 2VNUD 3DM3A 4P71A 1FL0A 4DV5Q 2NVTH 5GAHC 2YTXA 4NXML 1C7YA 2DUDA 4DAYB 2YV5A 1C0AA 2R7FA 2NN6G 4DR5L 4AQYL 5GQOA 2UUAL 1N9WA 4X65L 3GTQH 1L2FA 1GVPA 2Z6KA 1EIFA 2OCEA 3JAMi 1IBKL 1FJGQ 1HNXL 1VQEA 2N49A 2N78A 3HOXG 1I94Q 4B3ML 1S40A 1U5KA 4JOIC 1OTCA 2R7ZG 3I4MG 3KF8B 4JG2A 4DV1L 2VUMG 2ES2A 1HNWL 3EN2A 3F2CA 1VQ7A 5JJKA 3J80c 4A3CH 1CKNB 5AJ3L 1JMCA 2B29A 4KLKA 4A3LG 1IZ6A 4BY7G 4KHPL 1CKOA 2JJQA 1A0IA 3TS2A 1OXXK 1LTLA 3CCRA 3S2HH 4JBJA 4LFCQ 1XPUA 4OX9Q 1WOCA 1G51A 3D0FA 4JI5L 4HIOA 2I5MX 1S72A 4LUOA 4YHHQ 2I0QA 1N8RC 4JI0Q 3PO3H 4IO9A 4DR2Q 1NMFA 1NTGA 3GTKH 1G6PA 3BU2A 2WB1E 3HOWG 4POGA 4R4CA 4B3TL 2K5HA 4DK3C 4NXMQ 1YHBA 1VQCA 4JI6Q 3S14H 4NXNL 1X54A 3NELA 4DR5Q 4AQYQ 4X62Q 3G6EA 2UUAQ 2B3GA 1T9HA 5IE8A 4TVAB 5C4JH 4X65Q 2YU9H 1SMXA 2Z0SA 3CXCA 5C0XI 2GVBA 3AQQA 3TRZA 3I4OA 1N34L 1HNXQ 1VQDA 3CW2C 3VDYA 3I56A 2N8NA 4HIDA 3K8AA 2VL6A 3EBEA 4JBMA 1SN8A 2DGYA 3H0GG 1V43A 4DV1Q 1HNWQ 2MFIA 1GKHA 2JA6H 1HR0Q 5C4XH 3KDFB 3OW2A 3UDGA 1Q82C 2A8VA 2B63H 1A63A 3J7ZC 2Y0SE 5AJ3Q 4LF9L 5JEAG 3M4PA 5M3FG 4BBRG 5HY6A 4KHPQ 3J7A5 5GAEC 3PIPA 1FGUA 1VQGA 3CF5A 1VQKA 4GLXA 1FVIA 4K0KL 3TS0A 4JI3Q 3BZCA 1AH9A 2ZTEA 2CFMA 1CKNA 3E9IA 3HOZH 2R93G 1MJEA 4JI5Q 1PVOA 1IBML 2I5LX 3JC66 4YWKA 1K8GA 1YVCA 1IBLL 1CUKA 2JA5G 2PNHA 1TXYA 2UXCQ 4A3KG 1EIYB 2JEAI 5BR8L 1PH9A 1SR3A 1VCIA 3KF6B 4P72A 3G71A 1TWGH 3PUZA 5IYCH 1ASYA 4QIWE 3EIVA 4R4OA 4B3TQ 4A3BG 4DV2L 4YY3L 1W3SA 3CP0A 4BXXH 4XTCS 4JYAQ 4DR1L 4JBKA 2GN5A 1VQIA 3U4ZA 3PSIA 1HR0W 4LF7Q 4A75A 2IX1A 4L5SA 5C4XG 4PMWA 1XNRQ 1N34Q 3KFUA 4JI8Q 1JT8A 2QGQA 1BVSA 1Y1VH 1XMOL 4GS3A 4GKJL 3RN2A 4HJ5A 2R92H 4A3IH 4C2MH 1HNZQ 1E22A 2IY5B 2MO0A 5GADC 2CCZA 5IP9H 3KLWA 1G291 5E7NA 2K5NA 2JE6I 3E0EA 1NBWA 2BA1A 2MO1A 2XGTA 4LF5Q 3ICEA 4X6AH 1GO3E 3A5UA 2JA8H 4YCUA 4A3EH 2IHEA 3FKIG 2EXDA 4R4IA 3ULJA 4R1JA 1QVCA 1AE3A 1I94L 4K0KQ 2AHOB 4APVA 3KDFA 2ZJRA 1VQ4A 1YZ6A 4LF4Q 1IBMQ 1S3OA 4DR6L 1Y14B 4B3RL 4IOAA 2AKWB 2L15A 1Y1WH 1N33Q 2ZM6L 3I7FA 2VQEL 1XPRA 5C44H 2N3SA 2RCNA 2D0PA 2V1CC 1QVFA 4P75A 2FXQA 1I5FA 1PFSA 4DV2Q 1KD1C 1P16A 3LGJA 3MXNB 3KJPA 4GOPB 4OX9L 3PCOB 3FP9A 3KF6A 4DV4Q 5K36G 3HKZG 1JJGA 3E9HA 4BBSH 3GTOH 2UXBL 1XMOQ 1TWHH 2PI2A 1NY4A 4GLVB 3KYHC 4L5RC 1YJWA 2Q2TA 1N36L 4JI6L 4IPDA 5ELNA 4X62L 1Q12A 1L1OC 4QY7A 5LMNW 2F3IA 2AMCB 4BY1H 4X64L 1HH2P 3CD6A 4OO1G 2VW9A 4DV3L 1DGSA 2ID0A 5C3EG 5C0XJ 1NMGA 4BA1I 1E3PA 4OXPA 1EOVA 4C3HH 4OWWB 3I4NH 4KI0A 2K5VA 4POFA 3D31A 3K81C 5IYDG 1YJ9A 4UP8A 4DPGA 2ZJQA 1Q46A 4ALPA 3PO2H 3NEMA 4GN4B 2PMZE 1SLJA 4OWXB 1RL2A 1HR0L 3RZOH 4DR6Q 2A1AA 4DUYL 4B3RQ 2VS1A 1KHIA 2OTLA 2ZM6Q 2VQEQ 4LFAL 4LNQA 4PZ7A 4A93H 2JA7H 1E1TA 1HZAA 1UE5A 5IT9c 3F2BA 4R4TA 1UE6A 4JI3L 2NZOA 1PH6A 1I3QH 4IOCA 2HQLA 4J15A 1RIPA 2UXCL 2KENA 4JV5L 3H3VI 3CC4A 3CAMA 3S2DH 4BY1G 2UXBQ 4HJ8A 3TREA 4IFDI 4IJHA 4X66L 4AH6A 4GOPA 2HHHQ 2Z6KC 2YYZA 1N36Q 3CCVA 1CSQA 4JYAL 1XNQQ 4LW1A 1A8VA 4GN3B 4GNXB 4O2DA 5M3MH 4X64Q 3J80i 4DV3Q 1XNRL 4GN5A 2MQHA 3OTOL 2QA4A 1X65A 2WB1G 4JI8L 5FJ8H 4A3CG 1M1KC 4H02A 2E5LL 4R4QA 1NE3A 2UUBL 3IRBA 1YHAA 3U4VA 4A3JH 1HZCA 1OXSC 1XJVA 1EYGA 1HNZL 1PH3A 4DAMA 4DUYQ 1X3GA 3BJUA 2ATWA 2JEBI 1OXUA 2EIFA 2KCTA 3PUYA 4LFAQ 2MNAA 1VQJA 3W1GA 3GD7A 4DV6L 1PYBA 1QZHA 4LUVA 1K3RA 4LF5L 2WAQG 4LF8L 1A62A 3PO3G 4DKAC 1LM0A 1KXLA 2HIVA 4JC0A 3DLLA 1J5EL 1WCMH 3CCJA 1TWCH 3STBC 2NVXH 1WYDA 1MKHA 5LMNL 4LF4L 4PZ6A 1WI5A 4JV5Q 4QL5A 3ERSX 4L5TA 2NZHA 4JI1L 2CWAA 4IJLA 4DNIA 1N33L 2XTIA 1C9OA 1CKMA 4X66Q 5IYBH 3H3VH 1PH4A 1OXVA 3I55A 1Z47A 3AYHB 3HOYH 2OTJA 4RMFA 5JJIA 1LUZA 1QUQB 1KRSA 3CCSA 4A3JG 2NN6I 1QZGA 4DV4L 2JA6G 4A3FH 3HOVH 3S1NH 2B63G 3OTOQ 1EUJA 2WFWA 3I2ZA 2CWPA 5IP7H 4YCVA 3STBD 3S1RH 2E5LQ 4LFBQ 1TWAH 1YBYA 2UUBQ 4GNXA 3A5ZB 1B7YB 4DR4Q 2R7DA 4UY8C 1IXRA 3PUXA 1PH7A 4DK6C 4AYBG 4QGUA 1PYSB 3K7UC 3HOZG 1Q1EA 1E1OA 3J81i 2D0OA 4DV6Q 1PH8A 2HT1A 2VQFL 4LF8Q 4B3SL 4JI7L 1Q7YC 1PHJA 2BH8A 5EAYA 3UDIA 2CKZB 2K50A 3GDEA 4LF7L 1J5EQ 5DLQE 1N32L 1VQ9A 2HHHL 5IYCG 1PH1A 1VQ6A 4XIGS 5LMNQ 4DUZL 3S16H 3TQYA 4BXXG 2LXJA 4Y7NH 2F52A 1BKBA 3HOUH 1D7QA 1VQFA 4JI1Q 3AEVA 5FLMH 4A3GH 3UE0A 2PI2E 2K52A 4A3FG 1VQPA 1Q86C 1J6QA 2OQKA 3U50C 4A3MH 3K80C 4ME3A 3SGIA 4JI2L 5C0XG 2YTYA 1MIUA 4WJ4A 1Y1VG 2PQAB 4HJAA 2R92G 4A3IG 2JA9A 3F8TA 1X3FA 1JE5A 4GNXC 5IP9G 1QVGA 2E2JH 4GLAC 4LF6L 3RLNA 1HZBA 3F1ZA 4IPCA 2K4KA 2ALYB 1XMQL 4PZ8A 3CMEA 2JA8G 4A3EG 3J81j 1QUQA 4IFDJ 1GD7A 1GM5A 2RHQB 1Q81C 1WFQA 4JOIA 1YEZA 4OONA 3RR5A 1E24A 3JAMc 1Q1BA 3HKZE 3W1BA 3HOXH 1YJNA 1WJJA 1XNQL 4JI4Q 1SROA 1H95A 2R7ZH 1UEBA 3I4MH 2H5XA 4DR7L 1B8AA 2VQFQ 4P74A 5LMUQ 4B3SQ 2WP8J 1V1QA 3CPWA 4JI7Q 3PUWA 4OWTB 4WJ3M 2UU9L 1Y1WG 4TQUS 3L2PA 2VY3A 4IPGA 5C44G 3S1MH 4GKKL 1N32Q 2IHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H L;  4DUZ Q;  4A76 A;  1VS0 A;  2KHJ A;  4DV0 Q;  2F4V Q;  1UE1 A;  2AWN A;  3CQZ H;  3ULP A;  2UXD Q;  2LSS A;  3TEH B;  1JJ2 A;  3GTG H;  4P73 A;  5M5Y H;  5IWA Q;  3S17 H;  3CMA A;  4EQ5 A;  4BBS G;  4JI2 Q;  1PH5 A;  1VQ5 A;  3FHW A;  3W5O A;  3WWV A;  4DR3 Q;  2AWO A;  1D8L A;  4UPA A;  1VQB A;  4DV7 L;  3HOW H;  3K7A H;  4KHZ A;  4LF6 Q;  1UWV A;  4QJF A;  3GTL H;  1EQQ A;  1X56 A;  4HIM A;  2E2I H;  4HJ9 A;  1XMQ Q;  2PQA A;  3ZJY C;  4YWL A;  1VQH A;  4A3D H;  3I4N G;  5HGQ A;  3NEN A;  3PO2 G;  1EQR A;  4A3D G;  4FDB A;  1EWI A;  3H0G H;  4DR7 Q;  4JCV E;  1X9N A;  4LUZ A;  2UUC L;  3CPF A;  2UU9 Q;  4UP7 A;  3CC2 A;  5M5W H;  1YHQ A;  2E8G A;  3CCL A;  3RLF A;  4A4I A;  1VQO A;  3S15 H;  3BZK A;  2E2H H;  4GKK Q;  4LFB L;  4RG1 A;  2JA7 G;  3UDX A;  4A93 G;  3T1H Q;  5M3F H;  4BBR H;  3CCU A;  4DR4 L;  1KRT A;  1VQA A;  1KC8 C;  3S1Q H;  4IPH A;  4Y52 H;  2NVQ H;  3PF5 A;  3HKS A;  2OQ0 A;  3ER0 A;  2R93 H;  1HJP A;  5ELO A;  2I5H A;  4MNO A;  5GAG C;  1K8A C;  2HIX A;  3M3Y H;  3S24 A;  3M4Q A;  2JA5 H;  4A3L H;  1K0R A;  2Q2H A;  3CC7 A;  4A3K H;  1KIX A;  1KQS A;  1CSP A;  1E7Z A;  2YTV A;  4YCW A;  1IBK Q;  2BH2 A;  4DV7 Q;  3KJO A;  3NBH B;  4GOP C;  2Y0S G;  1R9T H;  1K9M C;  1TWF H;  1U0L A;  1M90 C;  4B3M Q;  4A3B H;  3CCE A;  2WAQ E;  1PV4 A;  1VQM A;  3RZD H;  3AFP A;  5M3M G;  2KHI A;  3PUV A;  3PV0 A;  1Z9F A;  1JJC B;  3UE1 A;  1XPO A;  3T1Y L;  1L1O B;  5FJ8 G;  2GVA A;  4HIK A;  3F2D A;  2RHS B;  2JK8 A;  3RLO A;  3M7N A;  5M5X H;  4C3I H;  4PG3 A;  2D62 A;  1HZ9 A;  2JQO A;  3RN5 A;  2UUC Q;  4OO1 I;  1X6O A;  1I50 H;  4HJ7 A;  3K0X A;  1W2B A;  1NJI C;  1O7I A;  3A74 A;  4MZ9 A;  1VQN A;  2ZTD A;  3J81 c;  4YWM A;  3Q8D A;  2NVY H;  4NB3 A;  3FKI H;  1P8L A;  1WCM G;  3KOJ A;  1YI2 A;  4BA2 I;  3HFZ B;  4JI4 L;  3MEF A;  2Q2I A;  1IYJ B;  1BBW A;  5IY0 A;  3PIO A;  3RNU A;  1L0W A;  5LMU L;  1BBU A;  2R6G A;  4AIM A;  4JBW A;  4O0A A;  3B6Y A;  1SFO H;  1PH2 A;  4NXN Q;  1SRU A;  4MTN A;  5JEA J;  4AYB E;  2KCM A;  3H15 A;  5IYB G;  1UE7 A;  5FLX c;  3G48 A;  3L7Z C;  2K14 A;  1JB7 A;  2F4V L;  3HOY G;  4DV0 L;  4IFD G;  1K73 C;  1MJC A;  3PF4 A;  1KAW A;  1OXT A;  2UXD L;  3AFQ A;  3A0J A;  4DV5 L;  3CCM A;  3HOV G;  4EX5 A;  1K83 H;  5IWA L;  3T1Y Q;  5JJL A;  1IL2 A;  4L5Q A;  4UP9 A;  5H1S E;  5IP7 G;  2LXK A;  2RF4 A;  1SE8 A;  3L0O A;  3ULL A;  4DR3 L;  4LF9 Q;  2KBN A;  2K75 A;  3OYY A;  1X55 A;  1FJG L;  5GRO A;  1AE2 A;  1L1O A;  2VZA A;  1YNX A;  3GTJ H;  2IT1 A;  1PA6 A;  2ASB A;  2C35 B;  2QEX A;  1V9P A;  1IBL Q;  4NPS A;  2Q2U A;  2IX0 A;  5C3E H;  1VQ8 A;  5BR8 Q;  1EFW A;  2CQO A;  1KL9 A;  1X3E A;  2EQS A;  2BA0 A;  2ZJP A;  2OWO A;  3GTP H;  5IYD H;  1Q8K A;  1I6H H;  3M85 A;  3G4S A;  2VUM H;  4YY3 Q;  3U58 A;  3HOU G;  4LFC L;  4A3G G;  3GO5 A;  5FLM G;  4QQB X;  1B70 B;  1YIT A;  4DR1 Q;  3CCQ A;  3PGZ A;  1YIJ A;  4JI0 L;  4YHH L;  3GTM H;  4A3M G;  4BY7 H;  1XTD A;  4C3J H;  3M9B A;  3M4O H;  4DR2 L;  2ZTC A;  5J3B A;  1VQL A;  4GKJ Q;  3UDF A;  2A19 A;  1LYL A;  4LWC A;  1ASZ A;  2VNU D;  3DM3 A;  4P71 A;  1FL0 A;  4DV5 Q;  2NVT H;  5GAH C;  2YTX A;  4NXM L;  1C7Y A;  2DUD A;  4DAY B;  2YV5 A;  1C0A A;  2R7F A;  2NN6 G;  4DR5 L;  4AQY L;  5GQO A;  2UUA L;  1N9W A;  4X65 L;  3GTQ H;  1L2F A;  1GVP A;  2Z6K A;  1EIF A;  2OCE A;  3JAM i;  1IBK L;  1FJG Q;  1HNX L;  1VQE A;  2N49 A;  2N78 A;  3HOX G;  1I94 Q;  4B3M L;  1S40 A;  1U5K A;  4JOI C;  1OTC A;  2R7Z G;  3I4M G;  3KF8 B;  4JG2 A;  4DV1 L;  2VUM G;  2ES2 A;  1HNW L;  3EN2 A;  3F2C A;  1VQ7 A;  5JJK A;  3J80 c;  4A3C H;  1CKN B;  5AJ3 L;  1JMC A;  2B29 A;  4KLK A;  4A3L G;  1IZ6 A;  4BY7 G;  4KHP L;  1CKO A;  2JJQ A;  1A0I A;  3TS2 A;  1OXX K;  1LTL A;  3CCR A;  3S2H H;  4JBJ A;  4LFC Q;  1XPU A;  4OX9 Q;  1WOC A;  1G51 A;  3D0F A;  4JI5 L;  4HIO A;  2I5M X;  1S72 A;  4LUO A;  4YHH Q;  2I0Q A;  1N8R C;  4JI0 Q;  3PO3 H;  4IO9 A;  4DR2 Q;  1NMF A;  1NTG A;  3GTK H;  1G6P A;  3BU2 A;  2WB1 E;  3HOW G;  4POG A;  4R4C A;  4B3T L;  2K5H A;  4DK3 C;  4NXM Q;  1YHB A;  1VQC A;  4JI6 Q;  3S14 H;  4NXN L;  1X54 A;  3NEL A;  4DR5 Q;  4AQY Q;  4X62 Q;  3G6E A;  2UUA Q;  2B3G A;  1T9H A;  5IE8 A;  4TVA B;  5C4J H;  4X65 Q;  2YU9 H;  1SMX A;  2Z0S A;  3CXC A;  5C0X I;  2GVB A;  3AQQ A;  3TRZ A;  3I4O A;  1N34 L;  1HNX Q;  1VQD A;  3CW2 C;  3VDY A;  3I56 A;  2N8N A;  4HID A;  3K8A A;  2VL6 A;  3EBE A;  4JBM A;  1SN8 A;  2DGY A;  3H0G G;  1V43 A;  4DV1 Q;  1HNW Q;  2MFI A;  1GKH A;  2JA6 H;  1HR0 Q;  5C4X H;  3KDF B;  3OW2 A;  3UDG A;  1Q82 C;  2A8V A;  2B63 H;  1A63 A;  3J7Z C;  2Y0S E;  5AJ3 Q;  4LF9 L;  5JEA G;  3M4P A;  5M3F G;  4BBR G;  5HY6 A;  4KHP Q;  3J7A 5;  5GAE C;  3PIP A;  1FGU A;  1VQG A;  3CF5 A;  1VQK A;  4GLX A;  1FVI A;  4K0K L;  3TS0 A;  4JI3 Q;  3BZC A;  1AH9 A;  2ZTE A;  2CFM A;  1CKN A;  3E9I A;  3HOZ H;  2R93 G;  1MJE A;  4JI5 Q;  1PVO A;  1IBM L;  2I5L X;  3JC6 6;  4YWK A;  1K8G A;  1YVC A;  1IBL L;  1CUK A;  2JA5 G;  2PNH A;  1TXY A;  2UXC Q;  4A3K G;  1EIY B;  2JEA I;  5BR8 L;  1PH9 A;  1SR3 A;  1VCI A;  3KF6 B;  4P72 A;  3G71 A;  1TWG H;  3PUZ A;  5IYC H;  1ASY A;  4QIW E;  3EIV A;  4R4O A;  4B3T Q;  4A3B G;  4DV2 L;  4YY3 L;  1W3S A;  3CP0 A;  4BXX H;  4XTC S;  4JYA Q;  4DR1 L;  4JBK A;  2GN5 A;  1VQI A;  3U4Z A;  3PSI A;  1HR0 W;  4LF7 Q;  4A75 A;  2IX1 A;  4L5S A;  5C4X G;  4PMW A;  1XNR Q;  1N34 Q;  3KFU A;  4JI8 Q;  1JT8 A;  2QGQ A;  1BVS A;  1Y1V H;  1XMO L;  4GS3 A;  4GKJ L;  3RN2 A;  4HJ5 A;  2R92 H;  4A3I H;  4C2M H;  1HNZ Q;  1E22 A;  2IY5 B;  2MO0 A;  5GAD C;  2CCZ A;  5IP9 H;  3KLW A;  1G29 1;  5E7N A;  2K5N A;  2JE6 I;  3E0E A;  1NBW A;  2BA1 A;  2MO1 A;  2XGT A;  4LF5 Q;  3ICE A;  4X6A H;  1GO3 E;  3A5U A;  2JA8 H;  4YCU A;  4A3E H;  2IHE A;  3FKI G;  2EXD A;  4R4I A;  3ULJ A;  4R1J A;  1QVC A;  1AE3 A;  1I94 L;  4K0K Q;  2AHO B;  4APV A;  3KDF A;  2ZJR A;  1VQ4 A;  1YZ6 A;  4LF4 Q;  1IBM Q;  1S3O A;  4DR6 L;  1Y14 B;  4B3R L;  4IOA A;  2AKW B;  2L15 A;  1Y1W H;  1N33 Q;  2ZM6 L;  3I7F A;  2VQE L;  1XPR A;  5C44 H;  2N3S A;  2RCN A;  2D0P A;  2V1C C;  1QVF A;  4P75 A;  2FXQ A;  1I5F A;  1PFS A;  4DV2 Q;  1KD1 C;  1P16 A;  3LGJ A;  3MXN B;  3KJP A;  4GOP B;  4OX9 L;  3PCO B;  3FP9 A;  3KF6 A;  4DV4 Q;  5K36 G;  3HKZ G;  1JJG A;  3E9H A;  4BBS H;  3GTO H;  2UXB L;  1XMO Q;  1TWH H;  2PI2 A;  1NY4 A;  4GLV B;  3KYH C;  4L5R C;  1YJW A;  2Q2T A;  1N36 L;  4JI6 L;  4IPD A;  5ELN A;  4X62 L;  1Q12 A;  1L1O C;  4QY7 A;  5LMN W;  2F3I A;  2AMC B;  4BY1 H;  4X64 L;  1HH2 P;  3CD6 A;  4OO1 G;  2VW9 A;  4DV3 L;  1DGS A;  2ID0 A;  5C3E G;  5C0X J;  1NMG A;  4BA1 I;  1E3P A;  4OXP A;  1EOV A;  4C3H H;  4OWW B;  3I4N H;  4KI0 A;  2K5V A;  4POF A;  3D31 A;  3K81 C;  5IYD G;  1YJ9 A;  4UP8 A;  4DPG A;  2ZJQ A;  1Q46 A;  4ALP A;  3PO2 H;  3NEM A;  4GN4 B;  2PMZ E;  1SLJ A;  4OWX B;  1RL2 A;  1HR0 L;  3RZO H;  4DR6 Q;  2A1A A;  4DUY L;  4B3R Q;  2VS1 A;  1KHI A;  2OTL A;  2ZM6 Q;  2VQE Q;  4LFA L;  4LNQ A;  4PZ7 A;  4A93 H;  2JA7 H;  1E1T A;  1HZA A;  1UE5 A;  5IT9 c;  3F2B A;  4R4T A;  1UE6 A;  4JI3 L;  2NZO A;  1PH6 A;  1I3Q H;  4IOC A;  2HQL A;  4J15 A;  1RIP A;  2UXC L;  2KEN A;  4JV5 L;  3H3V I;  3CC4 A;  3CAM A;  3S2D H;  4BY1 G;  2UXB Q;  4HJ8 A;  3TRE A;  4IFD I;  4IJH A;  4X66 L;  4AH6 A;  4GOP A;  2HHH Q;  2Z6K C;  2YYZ A;  1N36 Q;  3CCV A;  1CSQ A;  4JYA L;  1XNQ Q;  4LW1 A;  1A8V A;  4GN3 B;  4GNX B;  4O2D A;  5M3M H;  4X64 Q;  3J80 i;  4DV3 Q;  1XNR L;  4GN5 A;  2MQH A;  3OTO L;  2QA4 A;  1X65 A;  2WB1 G;  4JI8 L;  5FJ8 H;  4A3C G;  1M1K C;  4H02 A;  2E5L L;  4R4Q A;  1NE3 A;  2UUB L;  3IRB A;  1YHA A;  3U4V A;  4A3J H;  1HZC A;  1OXS C;  1XJV A;  1EYG A;  1HNZ L;  1PH3 A;  4DAM A;  4DUY Q;  1X3G A;  3BJU A;  2ATW A;  2JEB I;  1OXU A;  2EIF A;  2KCT A;  3PUY A;  4LFA Q;  2MNA A;  1VQJ A;  3W1G A;  3GD7 A;  4DV6 L;  1PYB A;  1QZH A;  4LUV A;  1K3R A;  4LF5 L;  2WAQ G;  4LF8 L;  1A62 A;  3PO3 G;  4DKA C;  1LM0 A;  1KXL A;  2HIV A;  4JC0 A;  3DLL A;  1J5E L;  1WCM H;  3CCJ A;  1TWC H;  3STB C;  2NVX H;  1WYD A;  1MKH A;  5LMN L;  4LF4 L;  4PZ6 A;  1WI5 A;  4JV5 Q;  4QL5 A;  3ERS X;  4L5T A;  2NZH A;  4JI1 L;  2CWA A;  4IJL A;  4DNI A;  1N33 L;  2XTI A;  1C9O A;  1CKM A;  4X66 Q;  5IYB H;  3H3V H;  1PH4 A;  1OXV A;  3I55 A;  1Z47 A;  3AYH B;  3HOY H;  2OTJ A;  4RMF A;  5JJI A;  1LUZ A;  1QUQ B;  1KRS A;  3CCS A;  4A3J G;  2NN6 I;  1QZG A;  4DV4 L;  2JA6 G;  4A3F H;  3HOV H;  3S1N H;  2B63 G;  3OTO Q;  1EUJ A;  2WFW A;  3I2Z A;  2CWP A;  5IP7 H;  4YCV A;  3STB D;  3S1R H;  2E5L Q;  4LFB Q;  1TWA H;  1YBY A;  2UUB Q;  4GNX A;  3A5Z B;  1B7Y B;  4DR4 Q;  2R7D A;  4UY8 C;  1IXR A;  3PUX A;  1PH7 A;  4DK6 C;  4AYB G;  4QGU A;  1PYS B;  3K7U C;  3HOZ G;  1Q1E A;  1E1O A;  3J81 i;  2D0O A;  4DV6 Q;  1PH8 A;  2HT1 A;  2VQF L;  4LF8 Q;  4B3S L;  4JI7 L;  1Q7Y C;  1PHJ A;  2BH8 A;  5EAY A;  3UDI A;  2CKZ B;  2K50 A;  3GDE A;  4LF7 L;  1J5E Q;  5DLQ E;  1N32 L;  1VQ9 A;  2HHH L;  5IYC G;  1PH1 A;  1VQ6 A;  4XIG S;  5LMN Q;  4DUZ L;  3S16 H;  3TQY A;  4BXX G;  2LXJ A;  4Y7N H;  2F52 A;  1BKB A;  3HOU H;  1D7Q A;  1VQF A;  4JI1 Q;  3AEV A;  5FLM H;  4A3G H;  3UE0 A;  2PI2 E;  2K52 A;  4A3F G;  1VQP A;  1Q86 C;  1J6Q A;  2OQK A;  3U50 C;  4A3M H;  3K80 C;  4ME3 A;  3SGI A;  4JI2 L;  5C0X G;  2YTY A;  1MIU A;  4WJ4 A;  1Y1V G;  2PQA B;  4HJA A;  2R92 G;  4A3I G;  2JA9 A;  3F8T A;  1X3F A;  1JE5 A;  4GNX C;  5IP9 G;  1QVG A;  2E2J H;  4GLA C;  4LF6 L;  3RLN A;  1HZB A;  3F1Z A;  4IPC A;  2K4K A;  2ALY B;  1XMQ L;  4PZ8 A;  3CME A;  2JA8 G;  4A3E G;  3J81 j;  1QUQ A;  4IFD J;  1GD7 A;  1GM5 A;  2RHQ B;  1Q81 C;  1WFQ A;  4JOI A;  1YEZ A;  4OON A;  3RR5 A;  1E24 A;  3JAM c;  1Q1B A;  3HKZ E;  3W1B A;  3HOX H;  1YJN A;  1WJJ A;  1XNQ L;  4JI4 Q;  1SRO A;  1H95 A;  2R7Z H;  1UEB A;  3I4M H;  2H5X A;  4DR7 L;  1B8A A;  2VQF Q;  4P74 A;  5LMU Q;  4B3S Q;  2WP8 J;  1V1Q A;  3CPW A;  4JI7 Q;  3PUW A;  4OWT B;  4WJ3 M;  2UU9 L;  1Y1W G;  4TQU S;  3L2P A;  2VY3 A;  4IPG A;  5C44 G;  3S1M H;  4GKK L;  1N32 Q;  2IHF A; 
#chains in the Genus database with same CATH topology
 1VS0 A;  1I4H A;  1SXT A;  1UE1 A;  2LSS A;  2MGS A;  1MHW C;  3TEH B;  3GTG H;  2QDB A;  3CMA A;  3NWT A;  1UUP A;  1JC7 A;  1WTV A;  1YNN D;  3RUZ A;  4R9W A;  1XXG A;  4DV7 L;  1MBY A;  2JA7 B;  3K7A H;  4JVZ A;  1LAB A;  1XMQ Q;  2PQA A;  2M2L A;  3ZJY C;  1B4O A;  2Z6B A;  4C3H G;  3I4N G;  1SYB A;  1XX8 A;  5HGQ A;  3IAY A;  4WOR A;  3NEN A;  1EQR A;  4LUZ A;  1EY6 A;  3CPF A;  4UP7 A;  3GTP H;  1FNU A;  1BCP B;  5M5W H;  1VQO A;  2JA7 G;  1JCK B;  5F2D A;  2L11 A;  5EPK A;  1KRT A;  1PRT B;  2RSN A;  4IPH A;  4Y52 H;  1LLR D;  1H9R A;  1GUO A;  3E6Z X;  4HMJ A;  2R93 H;  2HIX A;  3S24 A;  3CC7 A;  4OHJ A;  1OO9 B;  1KQS A;  3GV3 A;  1BR9 A;  5DM7 3;  1K9M C;  3M3Y B;  1TWF H;  1U0L A;  2WAQ E;  3AFP A;  1Z9F A;  1JJC B;  5FJ8 G;  2O5J C;  1PZJ D;  1U4R A;  3RLO A;  1WD1 A;  1F2Z A;  3AMU A;  3RN5 A;  1G91 A;  2UUC Q;  4OO1 I;  1DOK A;  1X6O A;  1NJI C;  1W2B A;  1LT6 D;  1WTP A;  3A7A B;  2XSC A;  4KY5 A;  3GQB A;  2BDN A;  5EKL A;  1DON A;  5C4Z A;  4YWM A;  3FKI H;  3JAM E;  3MZ5 A;  1A15 A;  3MEF A;  2Q2I A;  1IYJ B;  1TWA B;  5IY0 A;  1KDB A;  3RNU A;  1L0W A;  2R6G A;  2AUK A;  2I07 B;  3BZD B;  4XDX A;  1PH2 A;  5JEA J;  2FFK B;  5COY A;  3H91 A;  4BS9 A;  3G48 A;  2K14 A;  1JB7 A;  3HOY G;  2BE5 C;  2PO4 A;  2UXD L;  2EY5 A;  1NR2 A;  2OEO A;  3QIA A;  5IWA L;  1IL2 A;  3NBH A;  4UP9 A;  2HD3 A;  4I7Z C;  2LXK A;  3QWN A;  3ULL A;  5I2X A;  2KBN A;  2XRS D;  3OYY A;  1X55 A;  5LL6 S;  5GRO A;  1AE2 A;  1L1O A;  3GTJ H;  2DNE A;  2IT1 A;  1GOZ A;  2QEX A;  4UAI A;  1VQ8 A;  5BR8 Q;  4DXG A;  2EQS A;  2OWO A;  2F0I A;  1CTM A;  2VUM H;  4YY3 Q;  4LFC L;  3HOX B;  4QQB X;  4YHH L;  3GTM H;  5HUR A;  2F0P A;  4BWG B;  3CU7 A;  3C46 A;  3NQI A;  2VNU D;  4J1M A;  1S5C D;  1FL0 A;  4P71 A;  2PNR C;  4DV5 Q;  5GAH C;  3OIP A;  4DAY B;  2YV5 A;  3M4O B;  1TS2 A;  4DR5 L;  2WKC A;  4AQY L;  2UUA L;  1FGB D;  3T56 B;  1EIF A;  2CW0 D;  1EY5 A;  3R8B A;  2N78 A;  3HOX G;  5AFW A;  3AB9 A;  2R7Z G;  3PQI A;  4HMI A;  1QNU A;  2K03 A;  3J80 c;  3MFG A;  3VR2 A;  5IGB A;  3D4R A;  1IZ6 A;  3L9A X;  4KHP L;  1A0I A;  4CJ0 B;  1XPU A;  3GTL H;  1G51 A;  1S72 A;  4JI5 L;  2F0H A;  3H0G B;  3S2H B;  2WAC A;  4EQP A;  2E2H B;  2AQ2 B;  4KJN A;  1CZW A;  4NXM Q;  1VQC A;  2XWJ B;  4NXN L;  1G2T A;  1O78 A;  1U4M A;  2B3G A;  5IE8 A;  1IL8 A;  2NVQ B;  4X65 Q;  1SMX A;  5C0X I;  1SNQ A;  4PNY A;  2EVB A;  2A6H C;  1HNX Q;  3CW2 C;  2JA5 B;  4OIK A;  3I56 A;  2EPB A;  4XT3 B;  2N8N A;  4HID A;  4MTK A;  1SN8 A;  3H0G G;  3VA7 A;  1V43 A;  4DV1 Q;  1ESR A;  2F0G A;  3DMU A;  2JA6 H;  1GKH A;  3BDL A;  1R9T B;  3OW2 A;  2DNC A;  3EJI A;  3M4P A;  5JEA G;  1TS5 A;  1SSO A;  5M3F G;  1EY4 A;  3FDT A;  3PIP A;  4JW0 A;  1HPC A;  1MSH A;  4GLX A;  2B63 B;  3GV6 A;  1CKN A;  2EY6 A;  1DOL A;  1MJE A;  4C3I B;  3C1E A;  1PVO A;  1IBM L;  4YWK A;  1K8G A;  1IBL L;  2JA5 G;  1CUK A;  3R2I A;  2M00 A;  1TXY A;  5CBA E;  1SR3 A;  3TSS A;  3G71 A;  1TWG H;  1Z7T A;  3IKJ A;  5FLX L;  3P20 A;  4QIW E;  3A55 A;  3EIV A;  4B3T Q;  4A3B G;  5FO7 B;  4C1N I;  2DN8 A;  3I8Z A;  2RKS A;  3HS0 C;  4K5V A;  4HTH A;  5D3I B;  1UEA B;  1VQI A;  1CT1 D;  1EY8 A;  2IX3 A;  4PMW A;  3MHB A;  1N34 Q;  2AUJ D;  1PMR A;  4C3I G;  1EY7 A;  4A3I H;  1BNZ A;  1E22 A;  2CCZ A;  4DK1 A;  2RQX A;  3ZYY X;  1KAB A;  3KLW A;  5E7N A;  4QB4 A;  2JE6 I;  1NBW A;  1I4P A;  2R92 B;  4ZAI A;  2JA8 H;  4A3E H;  2IHE A;  2A68 D;  2JN4 A;  1AE3 A;  1K8M A;  1F2M A;  2ZJR A;  2ENB A;  5J1Z A;  1DD2 A;  4RH6 A;  1N33 Q;  2VQE L;  3MA2 B;  5KRU A;  1RTN A;  2N3S A;  1RF2 D;  2RCN A;  2V1C C;  1RDP D;  4P75 A;  2KEE A;  5C3E B;  4DV2 Q;  1KD1 C;  3LGJ A;  3KJP A;  4OX9 L;  2F0N A;  4DV4 Q;  5K36 G;  2K32 A;  4BBS H;  5JAV A;  1XMO Q;  1TWH H;  1PTO D;  1IYU A;  4JI6 L;  5ELN A;  1II3 A;  2A69 D;  4X62 L;  1L1O C;  2F3I A;  3CD6 A;  2VW9 A;  1DGS A;  2ID0 A;  5C3E G;  4BA1 I;  4KN7 C;  2K5V A;  3K59 A;  4ZCK A;  1YJ9 A;  3GTQ B;  1EU4 A;  4TSS A;  1Q46 A;  4ALP A;  3NEM A;  4GN4 B;  1B3Q A;  1RL2 A;  1HR0 L;  4DUY L;  4B3R Q;  2OTL A;  4N9P A;  2ZM6 Q;  4LNQ A;  4A93 H;  1E1T A;  4A3D B;  3F2B A;  4G4K A;  5IOC A;  3BG3 A;  2WB1 B;  5E3F A;  4JI3 L;  3UI2 A;  2OF1 A;  4IOC A;  1V1P A;  4J15 A;  3FPP A;  4N8F A;  4JV5 L;  2UXC L;  1Z6H A;  3S2D H;  2EOT A;  2FIN B;  2N88 A;  3NE5 B;  2F0V A;  4GOP A;  2YYZ A;  2CHB D;  2NZ1 D;  2B2Y A;  1PTO H;  3WDN A;  3GTK B;  4GN3 B;  4X64 Q;  3S14 B;  5FLX E;  5E4X A;  1HFN A;  2KOL A;  2QA4 A;  1DZ1 A;  1X65 A;  2WB1 G;  1M1K C;  4H02 A;  1PYW D;  1RCV D;  4ZUJ A;  1NE3 A;  2YU9 B;  4O1N A;  1SMY D;  2B2V A;  1YHA A;  3U4V A;  4KKT A;  1HZC A;  4A3J H;  1XJV A;  1EYG A;  1M4V A;  1B9N A;  4LFA Q;  2MNA A;  1VQJ A;  4LF5 L;  3GD7 A;  3SXH A;  4CJ1 B;  3H09 A;  4PMB A;  2IL8 A;  4JC0 A;  3DLL A;  1J5E L;  2PZW A;  3N6R A;  2NVX H;  4LF4 L;  2WV6 D;  4L5T A;  2RDG A;  2ZXP A;  2CWA A;  4IJL A;  2XTI A;  1GUN A;  3S1Q B;  3I55 A;  4PV1 C;  1FYC A;  1TY0 A;  4CJ2 C;  4RMF A;  3HOV H;  1VF7 A;  3PIO 3;  3S1N H;  3OTO Q;  4ZKC B;  3SHL A;  5IP7 H;  2PYK A;  3RMH A;  3STB D;  1STB A;  2UUB Q;  2A6E D;  2K01 A;  1DM0 B;  3SK4 A;  1SYF A;  3MXP A;  4C2M B;  4IUR A;  3TBI B;  2VQF L;  4B3S L;  4JI7 L;  1D2B A;  1Q7Y C;  1PHJ A;  4OEL B;  1FNW A;  1VQ9 A;  2HHH L;  1VQ6 A;  2EYO A;  4XIG S;  5LMN Q;  2QIL A;  4RCO A;  3HOU H;  1WTX A;  1D7Q A;  2B2W A;  1FNV A;  1AZP A;  2K52 A;  2NYZ D;  3VR3 A;  2OQK A;  1LT4 D;  5IT9 E;  2L0C A;  4A3M H;  2ZXR A;  1I4R A;  2F0T A;  2PQA B;  1X3F A;  2K28 A;  1JE5 A;  5IP9 G;  1GUG A;  2NN6 H;  3F1Z A;  4IPC A;  2K4K A;  5KEE A;  1XMQ L;  3CME A;  3J81 j;  3J7A V;  2I46 A;  4IFD J;  1GUT A;  4OON A;  3RR5 A;  1PZI D;  5BN3 A;  3J7A F;  1YJN A;  1WJJ A;  2KCC A;  3I4M H;  1B8A A;  2DJF C;  3CPW A;  4OWT B;  2B2U A;  3I4L A;  1STA A;  4HCE A;  4ZRZ A;  2F4V Q;  4DV0 Q;  2AWN A;  3ULP A;  4K5X A;  3S1M B;  5DAU A;  5KYI A;  1PFM A;  4P73 A;  5M5Y H;  4J8Q A;  3S17 H;  2KA7 A;  1QG7 A;  1VQ5 A;  1ET6 A;  2AWO A;  1D8L A;  1MGS A;  4QUF A;  4KHZ A;  1IHZ A;  3A54 A;  1UWV A;  4QJF A;  1X56 A;  4HIM A;  4G7O C;  5EKI A;  2E2I H;  1JR0 D;  2JXM B;  5FO8 B;  1I3Q B;  3K7A B;  2LS0 1;  1VQH A;  3NP8 A;  3X3M A;  2PCF B;  5JJZ A;  4DK0 A;  2Q8I B;  5C5M A;  2LMC B;  4FDB A;  2UUC L;  1GJX A;  2Y0S B;  3P75 A;  2UU9 Q;  1YHQ A;  4A4I A;  5CMD A;  2EJF C;  4LFB L;  5M3M B;  1MD2 D;  2DJG C;  4RCN A;  4BBR H;  3CCU A;  4DR4 L;  1HFG A;  2OT2 A;  3PF5 A;  1HQR D;  3ER0 A;  3NTI A;  4H13 C;  4MNO A;  4F8M A;  4A3L H;  3DUZ A;  2PZT A;  3M4Q A;  1K0R A;  2Q2H A;  4A3K H;  2R93 B;  1E7Z A;  2YTV A;  2R61 A;  3NBH B;  4GOP C;  4ME5 A;  2Y0S G;  4B9X A;  4B3M Q;  4CGY B;  3CCE A;  4OEM B;  1PV4 A;  3RZD H;  5M3M G;  2B2Y C;  3IL8 A;  2ZT9 C;  3UE1 A;  1LTB D;  1L1O B;  3ND8 A;  1PTO F;  2GVA A;  4HIK A;  2RHS B;  4LK1 C;  3M7N A;  5M5X H;  1EZ6 A;  1TU2 B;  2B2V C;  2TMP A;  4HJ7 A;  1I50 H;  1STE A;  1SE3 A;  3HZX A;  4WRD A;  3Q8D A;  3D8G A;  2F0W A;  4PQX A;  1QE6 A;  3S1R B;  1SDF A;  4JI4 L;  1BBW A;  1J9O A;  1SE2 A;  3A8K E;  5LMU L;  1BBU A;  1SFO H;  2XN9 C;  3BS1 A;  2LKV A;  5C5L A;  2XIW A;  5IYB G;  5FLX c;  4QMG A;  4UHV A;  5COR A;  4IFD G;  1DXM A;  4OL7 A;  3AFQ A;  4DV5 L;  3DWA A;  1FD7 D;  4ULL A;  1AN8 A;  1KDA A;  4R8N A;  2RF4 A;  4A3G B;  2HUG A;  4DR3 L;  2DY8 A;  1G6Z A;  3HKZ B;  2IPK D;  2VZA A;  1YNX A;  4ZYS A;  2C35 B;  4N9T A;  1DOM A;  4OO1 H;  1V9P A;  1W6K A;  3ND9 A;  4NPS A;  2E2J B;  1Y69 U;  1ICF B;  3SEB A;  2KQ3 A;  4K6L A;  3I91 A;  1KL9 A;  4NP5 A;  2ZJP A;  5IYD H;  3DHQ A;  4HSV A;  4A3G G;  3GO5 A;  1B70 B;  4J6H A;  2B2W C;  4Q5V A;  4BY7 H;  4C3J H;  2VUM B;  2WIN B;  1G2S A;  3M9B A;  2ZTC A;  2TSS A;  2F0L A;  5FOB B;  2NWG A;  3VR4 A;  1VQL A;  4F88 A;  4FP5 D;  1ASZ A;  4GKJ Q;  2H1E A;  2YTX A;  3KK7 A;  4NXM L;  1C7Y A;  2DUD A;  4OGQ C;  3Q24 A;  3CQZ B;  2LY7 A;  4H44 C;  4RHS A;  1N9W A;  4TRD A;  4X65 L;  4O42 A;  2J4X A;  1IBK L;  2OCE A;  1I4X A;  1HNX L;  3TP7 A;  4HED A;  4JG2 A;  4DV1 L;  3HOW B;  2VUM G;  1D5X C;  1ICW A;  1CKN B;  2B29 A;  1HXY D;  1RKN A;  2B2U C;  4L6T B;  1EQV A;  1KLU D;  3KBG A;  3TS2 A;  1LTL A;  3CCR A;  2X69 A;  3NPP A;  2D5D A;  1WOC A;  3ERQ A;  4HIO A;  4K6D A;  4LUO A;  2I0Q A;  4JI0 Q;  3PO3 H;  3J81 E;  3G7L A;  3I70 A;  1KNE A;  4F87 A;  1QWY A;  2PPB C;  5I6Y A;  1C4Q A;  3S15 B;  3T16 A;  3HOW G;  4B3T L;  1YHB A;  1BOS A;  4HN7 A;  5I9O A;  1T9H A;  5C4J H;  4TVA B;  3TRZ A;  5DEH A;  2EDG A;  1N34 L;  3ERO A;  4QCL A;  3VDY A;  1DCZ A;  2MFI A;  5C4X H;  1Q82 C;  5EBC A;  3J7Z C;  2B8F A;  5AJ3 Q;  4LF9 L;  3QOL A;  3K57 A;  1VQK A;  5IGC A;  3TS0 A;  3BYY B;  5CV6 A;  2CFM A;  3E9I A;  5KIX A;  1ML0 D;  4S3S A;  4M8A A;  1JWS D;  1ROD A;  1FR3 A;  1T5X D;  1AFP A;  3QB3 A;  3DEO A;  1EIY B;  3VYS A;  1PH9 A;  1E2V A;  5IYC H;  3TME A;  4R4O A;  4TKO B;  2NVY B;  4DV2 L;  4GZY C;  4BXX H;  2A74 C;  1HUN A;  5I9P A;  4DR1 L;  4JBK A;  2GN5 A;  3NUC A;  2JP1 A;  3PSI A;  2IX1 A;  4L5S A;  4KD3 A;  1JT8 A;  5C0X H;  4B9W A;  1Y1V H;  1XMO L;  2NTT A;  1HNZ Q;  2IY5 B;  4K2K A;  1EWC A;  1F9Q A;  1G29 1;  2C9O A;  3HRZ C;  5CC4 A;  2Z8L A;  2XGT A;  3HGB A;  3ICE A;  1GO3 E;  3A5U A;  4YCU A;  1K83 B;  2C5C A;  1F2L A;  1QVC A;  1I94 L;  2SOB A;  4K0K Q;  2AHO B;  2XNA C;  1VQ4 A;  2BDO A;  2EE1 A;  4A3E B;  4B3R L;  1UAP A;  1EFI D;  4IOA A;  2L15 A;  2ZM6 L;  3I7F A;  5C44 H;  1V1P B;  2F0O A;  1QNK A;  1BXT A;  1I5F A;  2FXQ A;  4DFA A;  2IJ0 A;  3LWE A;  3SDZ A;  4X3T A;  4GOP B;  5NUC A;  3PCO B;  4EVO A;  4G7Z C;  1L0X B;  1CA5 A;  1I6H B;  3E9H A;  3SVM A;  4CDC C;  3GTO H;  1BCP D;  1BDO A;  2F0U A;  1TR5 A;  1YJW A;  1DYQ A;  1Q8I A;  4IUU A;  1PRT D;  4BY1 H;  4X64 L;  2D9U A;  1HUM A;  2MJ8 A;  4C3H H;  3I4N H;  3OW7 A;  3AU7 A;  4UP8 A;  4YIJ A;  4DPG A;  1JOR A;  4OWX B;  2PMZ E;  3NHH A;  4DA2 A;  3RZO H;  2QF7 A;  1SYC A;  4LFA L;  1H9S A;  2JA7 H;  1UE5 A;  4X3S A;  1CHP D;  4R4T A;  1UE6 A;  4FXD A;  5EKK A;  4IN3 A;  1PH6 A;  2HCC A;  1VF5 C;  2KEN A;  3H3V I;  1F77 A;  3TRE A;  4IFD I;  3MXN A;  4RHR A;  3DM1 A;  2J7Z A;  1B1Z A;  1KAA A;  1N36 Q;  3S2D B;  3K5O A;  4JYA L;  4LW1 A;  4QF4 A;  2L12 A;  2CH4 A;  3J80 i;  4DV3 Q;  1XNR L;  2MQH A;  3OTO L;  4LJZ C;  4A3C G;  5FJ8 H;  4JI8 L;  4FXK C;  4KKU A;  4R4Q A;  1TVX A;  2UUB L;  4KN4 C;  1HQM C;  2N55 A;  1F2Y A;  1I6V C;  1XYI A;  1PH3 A;  1GHJ A;  2EZV A;  3W1G A;  1PYB A;  4A3J B;  1A62 A;  3DEP A;  2B8G A;  3K0Y A;  4QIW B;  1O80 A;  4K5W A;  5JPM C;  5LMN L;  3OWE B;  1BBX C;  2FMM A;  2NZH A;  4AYB B;  3HOZ B;  2NVX B;  4X66 Q;  1OXV A;  1VDZ A;  1Z47 A;  3HOY H;  3DXJ C;  4CHT B;  1TT2 A;  2NBF A;  1KRS A;  4A3J G;  3FMC A;  1QZG A;  4KTA A;  1KNA A;  2K5W A;  2B63 G;  1EUJ A;  3A7L A;  3I2Z A;  1SYG A;  3KLR A;  5KNC A;  1YNJ D;  2F3W A;  1TWA H;  1BQQ T;  5IOD A;  2R7D A;  4UY8 C;  3S1N B;  4AYB G;  3TZU A;  1ILP A;  3K7U C;  3HOZ G;  2Z1C A;  1E1O A;  3J81 i;  2L4N A;  3X3N A;  4LF8 Q;  3UDI A;  2JSO A;  2D2C C;  1WVL A;  2E76 C;  2KVM A;  1MI2 A;  3Q22 A;  4JI1 Q;  3AEV A;  3TP6 A;  2PI2 E;  1VQP A;  1B2T A;  1J6Q A;  3TP8 A;  1IKM A;  4WJ4 A;  2Z9H A;  1Y1W B;  1EU3 A;  1B9M A;  2R92 G;  1B44 D;  3F8T A;  3EQL C;  1BF4 A;  1A2T A;  4GNX C;  3R3O A;  1QVG A;  1QIL A;  1S5F D;  2JYO A;  4GLA C;  3SK8 A;  5CGK A;  2OXP A;  1D5M C;  1ONL A;  4PZ8 A;  2EYP A;  1QUQ A;  1GD7 A;  1GM5 A;  1QCB D;  1Q81 C;  3NXW A;  3JAM c;  3HOX H;  5FK9 C;  1XNQ L;  1YNN C;  3URY A;  1ZYR D;  1UEB A;  2R7Z H;  4K8J A;  4OIJ A;  2VXW A;  2WP8 J;  3A8J E;  3PUW A;  1EYC A;  3KLS A;  4XT1 B;  1Y1W G;  4TQU S;  3L2P A;  2UU9 L;  4IPG A;  4LF7 Q;  1N32 Q;  1M8A A;  5IT9 L;  5IGG A;  4K14 A;  2KHJ A;  1XTC D;  3MWY W;  2UXD Q;  3WOE A;  1JJ2 A;  1SBB B;  4DNT B;  3PO2 B;  5IWA Q;  1PH5 A;  5KNB A;  3W5O A;  3WWV A;  2HCI A;  1H9J A;  4UPA A;  1VQB A;  1LTG D;  3S17 B;  4LF6 Q;  2RVL A;  1EQQ A;  4DU9 A;  2L9H A;  3OMG A;  4CDE C;  3TDQ A;  4YWL A;  3E5S A;  5J39 A;  2BOS A;  2F0M A;  1EWH A;  5CV5 A;  4G7H C;  3PO2 G;  4A3D G;  5T1G A;  4DR7 Q;  3H0G H;  4JCV E;  1X9N A;  3CC2 A;  3CCL A;  3S9W A;  2E2H H;  5JEA H;  3T1H Q;  5M3F H;  4CKC A;  4XXE A;  1VQA A;  5FKA C;  1JQY D;  2NVQ H;  5ELO A;  2I5H A;  2RA4 A;  1K8A C;  2JA5 H;  1BUV T;  1EY0 A;  1KIX A;  4G57 A;  4YCW A;  2BH2 A;  3KJO A;  2MPM A;  3P7J A;  1R9T H;  4A3B H;  1VQM A;  1WCM B;  1TWC B;  2KHI A;  3PUV A;  4RGO S;  1XPO A;  1SNP A;  1BCP F;  3QOJ A;  3F2D A;  5I6W A;  2JK8 A;  3TN2 A;  4ID6 A;  4C3I H;  4PG3 A;  2D62 A;  2JQO A;  1PRT F;  5HGT A;  1VMC A;  1O7I A;  3QG1 A;  4MZ9 A;  5M5X B;  1AP0 A;  2ZTD A;  1QOH A;  5IGF A;  4NB3 A;  2X6L A;  5CV4 A;  1JE4 A;  1WCM G;  3KOJ A;  3HFZ B;  3PIO A;  4KMU C;  1GUW A;  3FPU B;  2EYJ A;  4AIM A;  4JBW A;  4O0A A;  3B6Y A;  4NXN Q;  4MTN A;  4JPB W;  3H15 A;  1UE7 A;  3L7Z C;  3O13 A;  1PFN A;  3SK5 A;  1JIC A;  1WTR A;  1K73 C;  4KJO A;  3PF4 A;  1KAW A;  1OXT A;  4HR7 B;  3A0J A;  4RWS C;  3A56 A;  4EX5 A;  3T1Y Q;  5K36 H;  4L5Q A;  5C3X A;  3IFT A;  5EGT A;  5H1S E;  4Y7N B;  4L63 B;  1SE8 A;  4ZLT F;  4FF1 A;  2O4X A;  1K8O A;  2SNM A;  4EQN A;  1LO5 D;  2RBM A;  1PA6 A;  4FYD A;  1IBL Q;  2Q2U A;  1G8Z D;  2IX0 A;  5C3E H;  1EFW A;  2CQO A;  4KKS A;  1NCV A;  2BA0 A;  1SYD A;  1AZQ A;  3SE0 A;  3G4S A;  2CW0 C;  4P2C B;  1LTI D;  2Z4I A;  5FLM G;  1YIT A;  4ILW A;  4IQZ A;  3CCQ A;  1AEX A;  2QDL A;  3PGZ A;  3D6C A;  2KED A;  4JI0 L;  5BN5 A;  4RKB A;  1C48 A;  5J3B A;  4CKB A;  2A19 A;  1LYL A;  3NTH A;  3DM3 A;  2NVT H;  4BY7 B;  2F0J A;  2PW7 A;  5GQO A;  1Y8P B;  3NSW A;  4Q0F A;  3GTQ H;  3TZD A;  1L2F A;  1GVP A;  3GTG B;  1FJG Q;  4L8J A;  3J80 L;  2DY7 A;  3A8I E;  1S40 A;  1Q3L A;  1SJE D;  1LT5 D;  3EN2 A;  1VQ7 A;  5JJK A;  5AJ3 L;  1HA5 A;  4BY7 G;  1CKO A;  2JJQ A;  1EQT A;  4JBJ A;  4OX9 Q;  1ILQ A;  2MUY A;  3D0F A;  4RGM A;  2I5M X;  3V96 A;  1CA6 A;  1N8R C;  5ELF A;  1Y8N B;  4DR2 Q;  3GTP B;  5M5W B;  1U4P A;  1NMF A;  1SNC A;  2CQA A;  5J22 A;  3GTK H;  1ENA A;  5ELB A;  3FRP B;  4R4C A;  3T13 A;  3S14 H;  2K5H A;  4DK3 C;  4JI6 Q;  1X54 A;  3NEL A;  4X62 Q;  4U67 3;  2YU9 H;  3CXC A;  2EYF A;  3AQQ A;  1F9R A;  1EEI D;  3SR1 A;  5E4W C;  3R93 A;  4HCS A;  2X6G A;  3EBE A;  3K8A A;  2L1B A;  4U68 A;  4JBM A;  2DGY A;  3GP7 A;  1KTK A;  2HQE A;  2F0E A;  4M1U B;  1HNW Q;  2K33 A;  1HR0 Q;  1TWF B;  2A8V A;  1NR4 A;  1A63 A;  2WII B;  2Y0S E;  1EOT A;  3M4Y A;  3R2T A;  2BCO A;  3D4D A;  3J81 L;  3KF8 A;  3J7A 5;  5GAE C;  1VQG A;  3CF5 A;  5C4X B;  1FVI A;  4K0K L;  4JI3 Q;  3BZC A;  1AH9 A;  2ZTE A;  2R93 G;  2LFN A;  4RKL A;  2A6H D;  1EIH A;  3S1Q H;  3JC6 6;  3MTS A;  2UXC Q;  2QKI C;  2PNH A;  5DM6 3;  2NUC A;  5BR8 L;  1VCI A;  3PUZ A;  1HHV A;  4YY3 L;  3FKI B;  3CP0 A;  2A68 C;  4XTC S;  3E3X A;  3I3C A;  2IWH A;  1HR0 W;  4A75 A;  5C4X G;  5KGU A;  2AQ3 B;  3ONA B;  2QGQ A;  1BVS A;  3RN2 A;  1R4Q B;  4C2M H;  2MO0 A;  5IP9 H;  2K5N A;  2XVS A;  1JOQ A;  2MO1 A;  4LF5 Q;  1WTO A;  1E0B A;  3FKI G;  2EXD A;  4R4I A;  3ULJ A;  4R1J A;  1JB3 A;  4APV A;  3KDF A;  1H9S B;  1TS4 A;  3FEW X;  2FMC A;  1PTO C;  4KHV A;  4LF4 Q;  2FHT A;  1B50 A;  1S3O A;  4N8X 1;  2AKW B;  3J80 E;  3LNN A;  3N52 A;  3GTJ B;  1LT3 D;  1XPR A;  2A69 C;  2XRQ D;  1H9K A;  1D1I A;  3Q6S A;  1P16 A;  2HDM A;  4E6I A;  3MXN B;  2IW3 A;  3KF6 A;  3LX0 A;  3HKZ G;  1O7L A;  3WOF A;  1SND A;  4IUV A;  4B08 A;  3GTM B;  1ENF A;  4DAP A;  2Q2T A;  1N36 L;  1A3V A;  4DNR B;  1J8I A;  2G9H D;  2AMC B;  4DV3 L;  2B39 A;  1E3P A;  4OWW B;  1EOV A;  5CR3 A;  4BY1 B;  3D31 A;  2KJX A;  2ZJQ A;  2K5D A;  4FVM A;  2E75 C;  3Q0A A;  4DR6 Q;  4C3H B;  3I4N B;  2VS1 A;  1KHI A;  5EQ0 A;  3MAQ A;  4PZ7 A;  1HZA A;  5IT9 c;  1HA6 A;  5BN4 A;  4NMZ A;  3RZO B;  1HTP A;  1LTA D;  2NZO A;  1GHK A;  1A6X A;  1JWU D;  1I3Q H;  1TQO A;  3I72 A;  1SMY C;  1RIP A;  4I7A A;  3CC4 A;  2UXB Q;  4BY1 G;  3GTL B;  4X66 L;  1JWM D;  3BYT B;  2WAQ B;  2F0K A;  1CSQ A;  2F0D A;  4MHE A;  4ZK9 B;  3D6W A;  1A8V A;  5M3M H;  5ELC A;  1CM9 A;  1K28 A;  4GN5 A;  2Q8T A;  4V19 0;  2E2D C;  3MXG A;  2PQE A;  4CKE A;  2EYH A;  3IRB A;  3J7Y W;  2KUM A;  2O2L D;  1OXS C;  3W2D A;  3BDO A;  3BJU A;  2ATW A;  3PUY A;  4LUV A;  1K3R A;  4LF8 L;  2WAQ G;  2JA6 B;  1LM0 A;  4IUT A;  1KXL A;  3CHB D;  2RDH A;  3CCJ A;  3STB C;  2A6E C;  4IZ8 A;  1WI5 A;  2F3V A;  4QL5 A;  2F03 A;  4JI1 L;  5EBD A;  1N33 L;  1CKM A;  4DGZ A;  2RCF A;  4ZKB B;  5IYB H;  3H3V H;  1PH4 A;  3K5L A;  4IFD H;  4C1N K;  5JJI A;  1QUQ B;  1TWG B;  3CCS A;  1IW7 D;  4DV4 L;  2JA6 G;  4A3F H;  2AQ1 B;  3HOY B;  1JOO A;  2WFW A;  2QW7 A;  3S1R H;  2E5L Q;  4LFB Q;  1EY9 A;  4C56 C;  4GNX A;  4DR4 Q;  1PYS B;  1ENC A;  4H0L C;  1Q1E A;  4DV6 Q;  2D0O A;  4CDF C;  4ABN A;  4A3I B;  5EAY A;  5LL6 X;  3NQT A;  2CKZ B;  2K50 A;  4LF7 L;  1N32 L;  1PH1 A;  1S5B D;  2NB0 A;  2JA8 B;  3S16 H;  4NDX A;  1ET9 A;  4IUQ A;  5ISR A;  2LXJ A;  5CV9 A;  3G6J B;  1W6J A;  4KD4 A;  2EY2 A;  1CFM A;  3UE0 A;  4A3G H;  4RGT A;  3K80 C;  2YTY A;  2SNS A;  2K05 A;  1CI3 M;  5T1I A;  3I90 A;  4HJA A;  4A3I G;  4MIU A;  2Q8R E;  2E2J H;  3MXU A;  4LF6 L;  2XWB B;  1V1O A;  3RLN A;  2CH4 W;  1HZB A;  5JOB A;  4QUC A;  2ALY B;  2P5Z X;  3VYU A;  2JA8 G;  4A3E G;  4XQQ A;  2RHQ B;  4JOI A;  4BBS B;  1E24 A;  1PLF A;  1Q1B A;  1TWH B;  4JI4 Q;  1SRO A;  2PMZ B;  2F0F A;  2H5X A;  4DR7 L;  4P74 A;  1D6E C;  5LMU Q;  1ESF A;  1V1Q A;  1R4P B;  3TP5 A;  2VY3 A;  3H6M A;  4FF4 A;  2R7Z B;  3T1H L;  3EFX D;  4FO2 A;  5EPL A;  4DUZ Q;  1EEF D;  3T4A C;  4A76 A;  3VR5 A;  3CQZ H;  3CRL C;  2M9V A;  5ELD A;  1S4Z A;  4BBS G;  4EQ5 A;  3KUP A;  4WJW A;  5A2Q L;  4JI2 Q;  3FHW A;  4DR3 Q;  4A93 B;  3HOW H;  4KY7 A;  2SDF A;  4XYO A;  3NK9 A;  2QEJ C;  3NWS A;  4HJ9 A;  2VB3 X;  3K5N A;  2A73 B;  4XYQ A;  1A3U A;  3DWP A;  1L0Y B;  2H4O A;  3E0J A;  1EWI A;  2E8G A;  3RLF A;  1PTO B;  1WD0 A;  3S15 H;  3BZK A;  4GKK Q;  4RG1 A;  4A93 G;  3UDX A;  1KC8 C;  5JVH 3;  5C6A A;  3HKS A;  2OQ0 A;  1HJP A;  5M3F B;  2EYL A;  5GAG C;  3M3Y H;  3BVG A;  1UNS A;  1U9R A;  1CSP A;  2MP1 A;  1IBK Q;  4DV7 Q;  3BVM A;  1RTO A;  3P1H A;  1M90 C;  3PIP 3;  5EJW A;  3H94 A;  3PV0 A;  1HTL D;  3T1Y L;  4UDU C;  4A3B B;  1Y8O B;  1HZ9 A;  2QCP X;  1A2U A;  3VYT A;  3K0X A;  3T53 B;  3A74 A;  3U9O A;  4EGV A;  1VQN A;  3J81 c;  3HOV B;  2NVY H;  1P8L A;  1YI2 A;  4BA2 I;  3SK6 A;  2MHV A;  1Q90 A;  5ELE A;  5KND A;  4R8I A;  1WTQ A;  4DXF A;  1SRU A;  4AYB E;  2KCM A;  5JPN C;  2CVR A;  1XWE A;  2F4V L;  4DV0 L;  5IIF A;  1MJC A;  4NKL A;  1I4G A;  1IKL A;  1A3T A;  3CCM A;  3HOV G;  1K83 H;  3D4W A;  5JJL A;  3QJY A;  4K8I A;  2ICE C;  5IP7 G;  3HOU B;  3L0O A;  4LF9 Q;  1D5Z C;  2K75 A;  2VB2 X;  5CV7 A;  2RSO A;  1FJG L;  2EYM A;  4A3M B;  4EQO A;  1PXU A;  1F9P A;  5A2Q E;  1SEB D;  2ASB A;  4XQN A;  2GA4 B;  2O5I C;  3CRK C;  2L5T A;  1E2Z A;  5CYU A;  1X3E A;  3OWF A;  2WKD A;  1Q8K A;  1I6H H;  3M85 A;  3HOU G;  3U58 A;  1SYE A;  1QB5 D;  3F2U A;  4DR1 Q;  1D1K A;  1H9M A;  1YIJ A;  3I4M B;  3C3L A;  3IFD A;  4A3M G;  1XTD A;  3M4O H;  4DR2 L;  3UDF A;  4LWC A;  1S5D D;  1X3Q A;  1SJH D;  3EVQ A;  1EYD A;  2R7F A;  2NTS A;  2NN6 G;  1BO0 A;  3OSO A;  2NVT B;  2K6A A;  2Z6K A;  4HAE A;  3JAM i;  5M5Y B;  1NAP A;  1VQE A;  2N49 A;  4B3M L;  1I94 Q;  3H3V C;  1U5K A;  4JOI C;  1OTC A;  5EPJ A;  3I4M G;  3KF8 B;  4KV6 A;  2ES2 A;  1HNW L;  3F2C A;  4Z9C B;  1C8C A;  1DJR D;  4IAL A;  3C2P A;  4A3C H;  1JMC A;  4KLK A;  2E2I B;  1EZ8 A;  3MFY A;  3MC0 B;  4RFB A;  1OXX K;  3S2H H;  4LFC Q;  4ODG A;  2ZXO A;  4YHH Q;  1WTH A;  1ZEQ X;  2ICI A;  4IO9 A;  1NTG A;  1G6P A;  3BU2 A;  2WB1 E;  4WFN 3;  4POG A;  5I4D A;  4BBR B;  1O7Z A;  3OPO A;  1CQF A;  4DR5 Q;  5G3L D;  4ZQ3 A;  4MN3 A;  1STH A;  2R3Z A;  3G6E A;  4AQY Q;  2UUA Q;  2HDL A;  2F4I A;  2Z0S A;  2GVB A;  3I4O A;  1VQD A;  4DAY A;  1KDC A;  4LMQ D;  4A3K B;  2K7V A;  2VL6 A;  4X3U A;  4IUN A;  2K04 A;  2EY1 A;  2G5D A;  3KDF B;  3UDG A;  1AW7 A;  2B63 H;  3OHX C;  3K5M A;  3RZD B;  2B2T A;  4BBR G;  5HY6 A;  4KHP Q;  1IW7 C;  1FGU A;  1WTW A;  3RD4 A;  3HOZ H;  3DWQ A;  4JI5 Q;  2I5L X;  4A3L G;  1NSN S;  1YVC A;  1O7Y A;  5I2Y A;  1NNX A;  4A3K G;  1I50 B;  2JEA I;  3KF6 B;  4P72 A;  4DN4 M;  5M9O A;  5E1F A;  3MEH A;  1ASY A;  1RD9 D;  5JVG 3;  1W3S A;  3L3O C;  4JYA Q;  1SNM A;  4FXG C;  3U4Z A;  4KK7 A;  1XNR Q;  1RJT A;  3KFU A;  1SFO B;  5CBE E;  4JI8 Q;  1STN A;  4GKJ L;  4GS3 A;  1PDQ A;  3BDC A;  4HJ5 A;  4DF7 A;  2R92 H;  2RDF A;  5GAD C;  1NUC A;  5CV8 A;  1TY2 A;  4JK1 C;  3E0E A;  2BA1 A;  4X6A H;  5LHY 1;  3HP3 A;  4V0B A;  3OMC A;  2L55 A;  1BCP C;  1YZ6 A;  1IBM Q;  2BE5 D;  1ZXT A;  4FF2 A;  4DR6 L;  1Y14 B;  4CDD C;  1Y1W H;  1PRT C;  2D0P A;  1QVF A;  1PFS A;  5A35 A;  2EXZ A;  3D3R A;  5D3D A;  3FP9 A;  1CK1 A;  1JJG A;  3M7G A;  2KEC A;  2UXB L;  1CHQ D;  1K3B C;  1STY A;  2PI2 A;  1NY4 A;  4GLV B;  3KYH C;  4L5R C;  4C3J B;  4I65 A;  2KCN A;  3K6O A;  4IPD A;  2FJ2 A;  4DAV A;  1Q12 A;  4QY7 A;  5LMN W;  1V8Q A;  4RGN A;  4OO1 G;  1HH2 P;  3MVV A;  1B53 A;  4FNF A;  5C0X J;  1NMG A;  3KLS X;  4OXP A;  4KI0 A;  4POF A;  3K81 C;  5IYD G;  1HCZ A;  3PMF A;  3PO2 H;  1EIG A;  3V05 A;  4A3D H;  1SLJ A;  2A1A A;  3OIQ A;  2V4D A;  2KHS A;  2PZU A;  4LAA A;  2VQE Q;  4C3J G;  3HEJ A;  1T5E A;  4XQJ A;  1U4L A;  3W3A A;  2HQL A;  5D14 A;  5IGD A;  4F7X A;  3CAM A;  4KY6 A;  5IGE A;  4HJ8 A;  3VYR A;  4IJH A;  4AH6 A;  1CZG A;  3U9S A;  2HHH Q;  3PO3 B;  2Z6K C;  3CCV A;  3T51 B;  1XNQ Q;  3EA6 A;  4GNX B;  4O2D A;  4RA8 A;  4ZUI A;  1EL0 A;  3CKI B;  1SE4 A;  5TSS A;  5K5P A;  2E5L L;  5C4J B;  3ITP A;  5KYL A;  1E2W A;  1CQV A;  1HNZ L;  1LTT D;  1QJO A;  4NW2 A;  4DAM A;  4DUY Q;  1X3G A;  2JEB I;  1OXU A;  1SAP A;  2EIF A;  2KCT A;  5C4H A;  4DV6 L;  1C0A A;  1QZH A;  3PO3 G;  2E74 C;  1F9S A;  3I73 A;  4DKA C;  5D65 A;  2HIV A;  1KLG D;  1K0S A;  1WCM H;  1TWC H;  1PZK D;  1WYD A;  1YNJ C;  2F0Q A;  1MKH A;  2SEB D;  1B3A A;  1TII D;  4PZ6 A;  4JV5 Q;  3ERS X;  1HRJ A;  4PMC A;  1MSG A;  3V2T A;  4IUP A;  4DNI A;  1C9O A;  1JOK A;  3NBI A;  5C3W A;  3AYH B;  3HG9 A;  4HSP A;  3FVQ A;  2OTJ A;  2Z4H A;  1LUZ A;  2NN6 I;  3K58 A;  2CWP A;  1IYV A;  4YCV A;  2F1M A;  1YBY A;  2B2T C;  3A5Z B;  1B7Y B;  2F0S A;  4A3F B;  1IXR A;  2A5H A;  3PUX A;  4DK6 C;  1PH7 A;  1LV9 A;  1TKW B;  4QGU A;  1Y1V B;  2K1B A;  2G9D A;  1PFB A;  2EJM A;  1RHP A;  2HT1 A;  1PH8 A;  4K2L A;  2BH8 A;  1X3P A;  1LTS D;  2K5Q A;  3VA5 A;  2EJG C;  3GDE A;  3NTK A;  1J5E Q;  5DLQ E;  5IYC G;  4DUZ L;  1S5E D;  3TQY A;  4BXX G;  4Y7N H;  2F52 A;  1BKB A;  1LTR D;  5FO9 B;  1VQF A;  1TS3 A;  5FLM H;  1LAC A;  1SNO A;  4A3F G;  1I4Q A;  1Q86 C;  3S16 B;  1ZYR C;  3U50 C;  4ME3 A;  3SGI A;  4JI2 L;  5C0X G;  1MIU A;  1Y1V G;  4X3K A;  3C1F A;  3KBX A;  5C44 B;  2JA9 A;  4FF3 A;  5G3L F;  3QO2 A;  3JAM L;  4CBV A;  1STG A;  3Q23 A;  1GXD C;  3QR8 A;  1VMP A;  5DNF A;  2PW5 A;  1WFQ A;  1YEZ A;  3GTO B;  3HKZ E;  3W1B A;  1EYA A;  3VR6 A;  3OOC A;  1H95 A;  1ZKO A;  2VQF Q;  4B3S Q;  3LWU A;  4JI7 Q;  1X32 A;  5L37 A;  4WJ3 M;  1GUS A;  3BVZ A;  4H7B A;  4RAU C;  5C44 G;  3S1M H;  4GKK L;  2J0T D;  2IHF A; 
#chains in the Genus database with same CATH homology
 3T1H L;  4DUZ Q;  4A76 A;  1VS0 A;  2KHJ A;  4DV0 Q;  2F4V Q;  1UE1 A;  2AWN A;  3CQZ H;  3ULP A;  2UXD Q;  2LSS A;  3TEH B;  1JJ2 A;  3GTG H;  4P73 A;  5M5Y H;  5IWA Q;  3S17 H;  3CMA A;  4EQ5 A;  4BBS G;  4JI2 Q;  1PH5 A;  1VQ5 A;  3FHW A;  3W5O A;  3WWV A;  4DR3 Q;  2AWO A;  1D8L A;  4UPA A;  1VQB A;  4DV7 L;  3HOW H;  3K7A H;  4KHZ A;  4LF6 Q;  1UWV A;  4QJF A;  3GTL H;  1EQQ A;  1X56 A;  4HIM A;  2E2I H;  4HJ9 A;  1XMQ Q;  2PQA A;  3ZJY C;  4YWL A;  1VQH A;  4A3D H;  3I4N G;  5HGQ A;  3NEN A;  3PO2 G;  1EQR A;  4A3D G;  4FDB A;  1EWI A;  3H0G H;  4DR7 Q;  4JCV E;  1X9N A;  4LUZ A;  2UUC L;  3CPF A;  2UU9 Q;  4UP7 A;  3CC2 A;  5M5W H;  1YHQ A;  2E8G A;  3CCL A;  3RLF A;  4A4I A;  1VQO A;  3S15 H;  3BZK A;  2E2H H;  4GKK Q;  4LFB L;  4RG1 A;  2JA7 G;  3UDX A;  4A93 G;  3T1H Q;  5M3F H;  4BBR H;  3CCU A;  4DR4 L;  1KRT A;  1VQA A;  1KC8 C;  3S1Q H;  4IPH A;  4Y52 H;  2NVQ H;  3PF5 A;  3HKS A;  2OQ0 A;  3ER0 A;  2R93 H;  1HJP A;  5ELO A;  2I5H A;  4MNO A;  5GAG C;  1K8A C;  2HIX A;  3M3Y H;  3S24 A;  3M4Q A;  2JA5 H;  4A3L H;  1K0R A;  2Q2H A;  3CC7 A;  4A3K H;  1KIX A;  1KQS A;  1CSP A;  1E7Z A;  2YTV A;  4YCW A;  1IBK Q;  2BH2 A;  4DV7 Q;  3KJO A;  3NBH B;  4GOP C;  2Y0S G;  1R9T H;  1K9M C;  1TWF H;  1U0L A;  1M90 C;  4B3M Q;  4A3B H;  3CCE A;  2WAQ E;  1PV4 A;  1VQM A;  3RZD H;  3AFP A;  5M3M G;  2KHI A;  3PUV A;  3PV0 A;  1Z9F A;  1JJC B;  3UE1 A;  1XPO A;  3T1Y L;  1L1O B;  5FJ8 G;  2GVA A;  4HIK A;  3F2D A;  2RHS B;  2JK8 A;  3RLO A;  3M7N A;  5M5X H;  4C3I H;  4PG3 A;  2D62 A;  1HZ9 A;  2JQO A;  3RN5 A;  2UUC Q;  4OO1 I;  1X6O A;  1I50 H;  4HJ7 A;  3K0X A;  1W2B A;  1NJI C;  1O7I A;  3A74 A;  4MZ9 A;  1VQN A;  2ZTD A;  3J81 c;  4YWM A;  3Q8D A;  2NVY H;  4NB3 A;  3FKI H;  1P8L A;  1WCM G;  3KOJ A;  1YI2 A;  4BA2 I;  3HFZ B;  4JI4 L;  3MEF A;  2Q2I A;  1IYJ B;  1BBW A;  5IY0 A;  3PIO A;  3RNU A;  1L0W A;  5LMU L;  1BBU A;  2R6G A;  4AIM A;  4JBW A;  4O0A A;  3B6Y A;  1SFO H;  1PH2 A;  4NXN Q;  1SRU A;  4MTN A;  5JEA J;  4AYB E;  2KCM A;  3H15 A;  5IYB G;  1UE7 A;  5FLX c;  3G48 A;  3L7Z C;  2K14 A;  1JB7 A;  2F4V L;  3HOY G;  4DV0 L;  4IFD G;  1K73 C;  1MJC A;  3PF4 A;  1KAW A;  1OXT A;  2UXD L;  3AFQ A;  3A0J A;  4DV5 L;  3CCM A;  3HOV G;  4EX5 A;  1K83 H;  5IWA L;  3T1Y Q;  5JJL A;  1IL2 A;  4L5Q A;  4UP9 A;  5H1S E;  5IP7 G;  2LXK A;  2RF4 A;  1SE8 A;  3L0O A;  3ULL A;  4DR3 L;  4LF9 Q;  2KBN A;  2K75 A;  3OYY A;  1X55 A;  1FJG L;  5GRO A;  1AE2 A;  1L1O A;  2VZA A;  1YNX A;  3GTJ H;  2IT1 A;  1PA6 A;  2ASB A;  2C35 B;  2QEX A;  1V9P A;  1IBL Q;  4NPS A;  2Q2U A;  2IX0 A;  5C3E H;  1VQ8 A;  5BR8 Q;  1EFW A;  2CQO A;  1KL9 A;  1X3E A;  2EQS A;  2BA0 A;  2ZJP A;  2OWO A;  3GTP H;  5IYD H;  1Q8K A;  1I6H H;  3M85 A;  3G4S A;  2VUM H;  4YY3 Q;  3U58 A;  3HOU G;  4LFC L;  4A3G G;  3GO5 A;  5FLM G;  4QQB X;  1B70 B;  1YIT A;  4DR1 Q;  3CCQ A;  3PGZ A;  1YIJ A;  4JI0 L;  4YHH L;  3GTM H;  4A3M G;  4BY7 H;  1XTD A;  4C3J H;  3M9B A;  3M4O H;  4DR2 L;  2ZTC A;  5J3B A;  1VQL A;  4GKJ Q;  3UDF A;  2A19 A;  1LYL A;  4LWC A;  1ASZ A;  2VNU D;  3DM3 A;  4P71 A;  1FL0 A;  4DV5 Q;  2NVT H;  5GAH C;  2YTX A;  4NXM L;  1C7Y A;  2DUD A;  4DAY B;  2YV5 A;  1C0A A;  2R7F A;  2NN6 G;  4DR5 L;  4AQY L;  5GQO A;  2UUA L;  1N9W A;  4X65 L;  3GTQ H;  1L2F A;  1GVP A;  2Z6K A;  1EIF A;  2OCE A;  3JAM i;  1IBK L;  1FJG Q;  1HNX L;  1VQE A;  2N49 A;  2N78 A;  3HOX G;  1I94 Q;  4B3M L;  1S40 A;  1U5K A;  4JOI C;  1OTC A;  2R7Z G;  3I4M G;  3KF8 B;  4JG2 A;  4DV1 L;  2VUM G;  2ES2 A;  1HNW L;  3EN2 A;  3F2C A;  1VQ7 A;  5JJK A;  3J80 c;  4A3C H;  1CKN B;  5AJ3 L;  1JMC A;  2B29 A;  4KLK A;  4A3L G;  1IZ6 A;  4BY7 G;  4KHP L;  1CKO A;  2JJQ A;  1A0I A;  3TS2 A;  1OXX K;  1LTL A;  3CCR A;  3S2H H;  4JBJ A;  4LFC Q;  1XPU A;  4OX9 Q;  1WOC A;  1G51 A;  3D0F A;  4JI5 L;  4HIO A;  2I5M X;  1S72 A;  4LUO A;  4YHH Q;  2I0Q A;  1N8R C;  4JI0 Q;  3PO3 H;  4IO9 A;  4DR2 Q;  1NMF A;  1NTG A;  3GTK H;  1G6P A;  3BU2 A;  2WB1 E;  3HOW G;  4POG A;  4R4C A;  4B3T L;  2K5H A;  4DK3 C;  4NXM Q;  1YHB A;  1VQC A;  4JI6 Q;  3S14 H;  4NXN L;  1X54 A;  3NEL A;  4DR5 Q;  4AQY Q;  4X62 Q;  3G6E A;  2UUA Q;  2B3G A;  1T9H A;  5IE8 A;  4TVA B;  5C4J H;  4X65 Q;  2YU9 H;  1SMX A;  2Z0S A;  3CXC A;  5C0X I;  2GVB A;  3AQQ A;  3TRZ A;  3I4O A;  1N34 L;  1HNX Q;  1VQD A;  3CW2 C;  3VDY A;  3I56 A;  2N8N A;  4HID A;  3K8A A;  2VL6 A;  3EBE A;  4JBM A;  1SN8 A;  2DGY A;  3H0G G;  1V43 A;  4DV1 Q;  1HNW Q;  2MFI A;  1GKH A;  2JA6 H;  1HR0 Q;  5C4X H;  3KDF B;  3OW2 A;  3UDG A;  1Q82 C;  2A8V A;  2B63 H;  1A63 A;  3J7Z C;  2Y0S E;  5AJ3 Q;  4LF9 L;  5JEA G;  3M4P A;  5M3F G;  4BBR G;  5HY6 A;  4KHP Q;  3J7A 5;  5GAE C;  3PIP A;  1FGU A;  1VQG A;  3CF5 A;  1VQK A;  4GLX A;  1FVI A;  4K0K L;  3TS0 A;  4JI3 Q;  3BZC A;  1AH9 A;  2ZTE A;  2CFM A;  1CKN A;  3E9I A;  3HOZ H;  2R93 G;  1MJE A;  4JI5 Q;  1PVO A;  1IBM L;  2I5L X;  3JC6 6;  4YWK A;  1K8G A;  1YVC A;  1IBL L;  1CUK A;  2JA5 G;  2PNH A;  1TXY A;  2UXC Q;  4A3K G;  1EIY B;  2JEA I;  5BR8 L;  1PH9 A;  1SR3 A;  1VCI A;  3KF6 B;  4P72 A;  3G71 A;  1TWG H;  3PUZ A;  5IYC H;  1ASY A;  4QIW E;  3EIV A;  4R4O A;  4B3T Q;  4A3B G;  4DV2 L;  4YY3 L;  1W3S A;  3CP0 A;  4BXX H;  4XTC S;  4JYA Q;  4DR1 L;  4JBK A;  2GN5 A;  1VQI A;  3U4Z A;  3PSI A;  1HR0 W;  4LF7 Q;  4A75 A;  2IX1 A;  4L5S A;  5C4X G;  4PMW A;  1XNR Q;  1N34 Q;  3KFU A;  4JI8 Q;  1JT8 A;  2QGQ A;  1BVS A;  1Y1V H;  1XMO L;  4GS3 A;  4GKJ L;  3RN2 A;  4HJ5 A;  2R92 H;  4A3I H;  4C2M H;  1HNZ Q;  1E22 A;  2IY5 B;  2MO0 A;  5GAD C;  2CCZ A;  5IP9 H;  3KLW A;  1G29 1;  5E7N A;  2K5N A;  2JE6 I;  3E0E A;  1NBW A;  2BA1 A;  2MO1 A;  2XGT A;  4LF5 Q;  3ICE A;  4X6A H;  1GO3 E;  3A5U A;  2JA8 H;  4YCU A;  4A3E H;  2IHE A;  3FKI G;  2EXD A;  4R4I A;  3ULJ A;  4R1J A;  1QVC A;  1AE3 A;  1I94 L;  4K0K Q;  2AHO B;  4APV A;  3KDF A;  2ZJR A;  1VQ4 A;  1YZ6 A;  4LF4 Q;  1IBM Q;  1S3O A;  4DR6 L;  1Y14 B;  4B3R L;  4IOA A;  2AKW B;  2L15 A;  1Y1W H;  1N33 Q;  2ZM6 L;  3I7F A;  2VQE L;  1XPR A;  5C44 H;  2N3S A;  2RCN A;  2D0P A;  2V1C C;  1QVF A;  4P75 A;  2FXQ A;  1I5F A;  1PFS A;  4DV2 Q;  1KD1 C;  1P16 A;  3LGJ A;  3MXN B;  3KJP A;  4GOP B;  4OX9 L;  3PCO B;  3FP9 A;  3KF6 A;  4DV4 Q;  5K36 G;  3HKZ G;  1JJG A;  3E9H A;  4BBS H;  3GTO H;  2UXB L;  1XMO Q;  1TWH H;  2PI2 A;  1NY4 A;  4GLV B;  3KYH C;  4L5R C;  1YJW A;  2Q2T A;  1N36 L;  4JI6 L;  4IPD A;  5ELN A;  4X62 L;  1Q12 A;  1L1O C;  4QY7 A;  5LMN W;  2F3I A;  2AMC B;  4BY1 H;  4X64 L;  1HH2 P;  3CD6 A;  4OO1 G;  2VW9 A;  4DV3 L;  1DGS A;  2ID0 A;  5C3E G;  5C0X J;  1NMG A;  4BA1 I;  1E3P A;  4OXP A;  1EOV A;  4C3H H;  4OWW B;  3I4N H;  4KI0 A;  2K5V A;  4POF A;  3D31 A;  3K81 C;  5IYD G;  1YJ9 A;  4UP8 A;  4DPG A;  2ZJQ A;  1Q46 A;  4ALP A;  3PO2 H;  3NEM A;  4GN4 B;  2PMZ E;  1SLJ A;  4OWX B;  1RL2 A;  1HR0 L;  3RZO H;  4DR6 Q;  2A1A A;  4DUY L;  4B3R Q;  2VS1 A;  1KHI A;  2OTL A;  2ZM6 Q;  2VQE Q;  4LFA L;  4LNQ A;  4PZ7 A;  4A93 H;  2JA7 H;  1E1T A;  1HZA A;  1UE5 A;  5IT9 c;  3F2B A;  4R4T A;  1UE6 A;  4JI3 L;  2NZO A;  1PH6 A;  1I3Q H;  4IOC A;  2HQL A;  4J15 A;  1RIP A;  2UXC L;  2KEN A;  4JV5 L;  3H3V I;  3CC4 A;  3CAM A;  3S2D H;  4BY1 G;  2UXB Q;  4HJ8 A;  3TRE A;  4IFD I;  4IJH A;  4X66 L;  4AH6 A;  4GOP A;  2HHH Q;  2Z6K C;  2YYZ A;  1N36 Q;  3CCV A;  1CSQ A;  4JYA L;  1XNQ Q;  4LW1 A;  1A8V A;  4GN3 B;  4GNX B;  4O2D A;  5M3M H;  4X64 Q;  3J80 i;  4DV3 Q;  1XNR L;  4GN5 A;  2MQH A;  3OTO L;  2QA4 A;  1X65 A;  2WB1 G;  4JI8 L;  5FJ8 H;  4A3C G;  1M1K C;  4H02 A;  2E5L L;  4R4Q A;  1NE3 A;  2UUB L;  3IRB A;  1YHA A;  3U4V A;  4A3J H;  1HZC A;  1OXS C;  1XJV A;  1EYG A;  1HNZ L;  1PH3 A;  4DAM A;  4DUY Q;  1X3G A;  3BJU A;  2ATW A;  2JEB I;  1OXU A;  2EIF A;  2KCT A;  3PUY A;  4LFA Q;  2MNA A;  1VQJ A;  3W1G A;  3GD7 A;  4DV6 L;  1PYB A;  1QZH A;  4LUV A;  1K3R A;  4LF5 L;  2WAQ G;  4LF8 L;  1A62 A;  3PO3 G;  4DKA C;  1LM0 A;  1KXL A;  2HIV A;  4JC0 A;  3DLL A;  1J5E L;  1WCM H;  3CCJ A;  1TWC H;  3STB C;  2NVX H;  1WYD A;  1MKH A;  5LMN L;  4LF4 L;  4PZ6 A;  1WI5 A;  4JV5 Q;  4QL5 A;  3ERS X;  4L5T A;  2NZH A;  4JI1 L;  2CWA A;  4IJL A;  4DNI A;  1N33 L;  2XTI A;  1C9O A;  1CKM A;  4X66 Q;  5IYB H;  3H3V H;  1PH4 A;  1OXV A;  3I55 A;  1Z47 A;  3AYH B;  3HOY H;  2OTJ A;  4RMF A;  5JJI A;  1LUZ A;  1QUQ B;  1KRS A;  3CCS A;  4A3J G;  2NN6 I;  1QZG A;  4DV4 L;  2JA6 G;  4A3F H;  3HOV H;  3S1N H;  2B63 G;  3OTO Q;  1EUJ A;  2WFW A;  3I2Z A;  2CWP A;  5IP7 H;  4YCV A;  3STB D;  3S1R H;  2E5L Q;  4LFB Q;  1TWA H;  1YBY A;  2UUB Q;  4GNX A;  3A5Z B;  1B7Y B;  4DR4 Q;  2R7D A;  4UY8 C;  1IXR A;  3PUX A;  1PH7 A;  4DK6 C;  4AYB G;  4QGU A;  1PYS B;  3K7U C;  3HOZ G;  1Q1E A;  1E1O A;  3J81 i;  2D0O A;  4DV6 Q;  1PH8 A;  2HT1 A;  2VQF L;  4LF8 Q;  4B3S L;  4JI7 L;  1Q7Y C;  1PHJ A;  2BH8 A;  5EAY A;  3UDI A;  2CKZ B;  2K50 A;  3GDE A;  4LF7 L;  1J5E Q;  5DLQ E;  1N32 L;  1VQ9 A;  2HHH L;  5IYC G;  1PH1 A;  1VQ6 A;  4XIG S;  5LMN Q;  4DUZ L;  3S16 H;  3TQY A;  4BXX G;  2LXJ A;  4Y7N H;  2F52 A;  1BKB A;  3HOU H;  1D7Q A;  1VQF A;  4JI1 Q;  3AEV A;  5FLM H;  4A3G H;  3UE0 A;  2PI2 E;  2K52 A;  4A3F G;  1VQP A;  1Q86 C;  1J6Q A;  2OQK A;  3U50 C;  4A3M H;  3K80 C;  4ME3 A;  3SGI A;  4JI2 L;  5C0X G;  2YTY A;  1MIU A;  4WJ4 A;  1Y1V G;  2PQA B;  4HJA A;  2R92 G;  4A3I G;  2JA9 A;  3F8T A;  1X3F A;  1JE5 A;  4GNX C;  5IP9 G;  1QVG A;  2E2J H;  4GLA C;  4LF6 L;  3RLN A;  1HZB A;  3F1Z A;  4IPC A;  2K4K A;  2ALY B;  1XMQ L;  4PZ8 A;  3CME A;  2JA8 G;  4A3E G;  3J81 j;  1QUQ A;  4IFD J;  1GD7 A;  1GM5 A;  2RHQ B;  1Q81 C;  1WFQ A;  4JOI A;  1YEZ A;  4OON A;  3RR5 A;  1E24 A;  3JAM c;  1Q1B A;  3HKZ E;  3W1B A;  3HOX H;  1YJN A;  1WJJ A;  1XNQ L;  4JI4 Q;  1SRO A;  1H95 A;  2R7Z H;  1UEB A;  3I4M H;  2H5X A;  4DR7 L;  1B8A A;  2VQF Q;  4P74 A;  5LMU Q;  4B3S Q;  2WP8 J;  1V1Q A;  3CPW A;  4JI7 Q;  3PUW A;  4OWT B;  4WJ3 M;  2UU9 L;  1Y1W G;  4TQU S;  3L2P A;  2VY3 A;  4IPG A;  5C44 G;  3S1M H;  4GKK L;  1N32 Q;  2IHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...