5BR8Q

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5br8Q00
3I4NG 1HZ9A 3PO3G 1CUKA 3W1GA 3I4MG 4DKAC 3JAMc 5IP9H 3RLOA 4B3TL 3TEHB 2PI2E 1S72A 1QVGA 5AJ3L 2JE6I 1IBKQ 4A3MG 1XNRQ 1LM0A 3AEVA 2ZTCA 5M3MH 2D0OA 2VQEL 5C44G 1S40A 3PSIA 4JI8L 1G51A 1O7IA 3CCMA 4DR5Q 4JBKA 4IOCA 3K8AA 2BH2A 5HY6A 2UUAL 1VQHA 3J80c 4JI0Q 2Y0SE 5C3EH 3PO2H 4JI1L 1Q1EA 1CKNA 1XNQL 3G6EA 2YU9H 1PYSB 3Q8DA 4NXNL 4RMFA 2VZAA 4DK6C 5BR8L 1HR0W 4JI3L 3J7ZC 2VUMG 4DAYB 3FHWA 3M9BA 3G4SA 3CCSA 4HJ7A 1PH7A 5EAYA 4A75A 4QQBX 4AQYL 4JBWA 2N49A 1OXXK 1KIXA 3KDFA 4BY1G 4B3SQ 1ASYA 2I5HA 3PIPA 1Y1VG 3PV0A 2JEAI 3PO3H 4DV3Q 4ALPA 2YYZA 5IWAL 4DR1Q 4BBRG 4DV2Q 3I4MH 4GKKQ 4OO1G 1ASZA 4C2MH 4HIKA 2C35B 3UDGA 2AWOA 1NJIC 1OXSC 3NEMA 3S2HH 5IYBG 1N36Q 1XJVA 4A3MH 1NY4A 4R4CA 4OX9Q 2F4VQ 1IZ6A 2Z6KC 4K0KQ 1KL9A 2L15A 3KF8B 5IE8A 2Q2IA 3OTOL 5C44H 2K5VA 1C7YA 2BH8A 3J81c 4DR3Q 2B3GA 3RN5A 2NVXH 4LUZA 3PUZA 3DLLA 1HR0L 1Q81C 4JCVE 1PH9A 2UUBL 4JOIC 4OONA 4C3HH 1HNZQ 4DV7L 4X66Q 2VQFL 1PH1A 5FJ8G 3CXCA 4DR6L 4LW1A 1L1OC 3RLFA 4JV5L 1VQMA 3HOVG 4LWCA 1YI2A 3KFUA 4BA2I 4QL5A 3A5UA 4A3GG 4LFAQ 3SGIA 2VUMH 4X64L 4DV6Q 2UXDL 1XMOQ 3CPFA 4LF5Q 1K3RA 1NTGA 2MFIA 1PH2A 1L1OA 4GOPC 1PH5A 1BVSA 3S2DH 4BY1H 4GKJL 1TXYA 1CKMA 2IHFA 1WYDA 1OXVA 1IBKL 4R4OA 1TWHH 1Y1VH 4HJAA 1J5EQ 1XNRL 2K5HA 1NE3A 3OW2A 1SMXA 1YITA 4A3EH 1AE2A 4BBRH 4O2DA 1XMQL 1EIYB 3H3VI 4R4IA 4DR5L 3GTOH 1QVCA 3EIVA 2LXJA 2PI2A 5IYBH 4JI0L 4LUOA 4JI6Q 1VQ6A 3PIOA 3I55A 4A4IA 3CCVA 2CWAA 2GVBA 2IY5B 3HOXH 3IRBA 5ELOA 1I5FA 3K7UC 2B29A 3F2BA 1N32Q 2EXDA 2UXCQ 1YBYA 1AE3A 1E7ZA 2JQOA 3PUVA 1KRTA 3CCUA 3K80C 2KCTA 4UPAA 1VQOA 4GN3B 1VQLA 4JG2A 3VDYA 2RCNA 3HOYG 4POGA 5FJ8H 3CCRA 3CD6A 4B3SL 4IPHA 4O0AA 3HOVH 2QGQA 4A3GH 4NPSA 3T1YQ 3U4VA 2CKZB 1PVOA 4HIDA 4B3MQ 2WB1E 3ICEA 2JA7G 1A0IA 2E5LQ 4DV3L 4DR1L 1HJPA 1X56A 4GKKL 4DV2L 3KYHC 3AQQA 3ZJYC 3UDXA 5LMNW 3CF5A 4A3FG 1YIJA 1B70B 3GTJH 1VQAA 1VQ4A 2Q2UA 2K4KA 1N36L 2UU9Q 4OX9L 2RHSB 1WI5A 2F4VL 4K0KL 5IP7H 2XGTA 4JYAQ 3E9HA 4GLAC 2AWNA 4P71A 4P74A 1Q82C 4L5RC 5K36G 3CP0A 3MXNB 4DR3L 3CW2C 4OXPA 4HJ5A 3PF5A 2A8VA 2V1CC 3U4ZA 1IYJB 4YCWA 4DK3C 1X9NA 1VS0A 1VQEA 3AYHB 2WAQG 1IBLQ 1VQGA 1XPRA 3S1RH 1K8AC 4X66L 1HNZL 1EFWA 4R4QA 4GLXA 1K8GA 3I56A 1XPUA 4WJ3M 1EYGA 2GN5A 4YHHQ 3CMAA 4AYBE 4LFAL 1IL2A 3KF6B 1BBUA 1S3OA 1HNWQ 1XMOL 2UXBQ 4PG3A 1VQ9A 2JA5G 4LF5L 3HOYH 3CC7A 3G48A 3GTLH 1VQJA 3EBEA 5M3FG 1N33L 4IOAA 3D0FA 1Q46A 4JBJA 3F8TA 1X3EA 2HT1A 1MJCA 5M5XH 1Y14B 2NVYH 1J5EL 3L0OA 1E22A 3KDFB 2JA7H 4JC0A 1VQ8A 1QVFA 2F52A 2R6GA 2VS1A 1UE5A 2CWPA 4YCVA 2ZTEA 3J7A5 4A3FH 3LGJA 1PA6A 2KENA 1T9HA 4JI5Q 4IPGA 4JI7Q 2D62A 3ULLA 4BXXG 1CSQA 4C3IH 4JI6L 1WCMG 3ULPA 4QJFA 1LTLA 3KF6A 2QA4A 1U0LA 4A76A 2KHJA 1YZ6A 4XIGS 2KBNA 5HGQA 1N32L 2UXCL 1KAWA 4GN5A 2HIXA 3D31A 1JJCB 3PGZA 4H02A 4KLKA 4UP9A 1YJWA 3HKSA 1M1KC 3CMEA 2R7ZG 5DLQE 4DUYQ 2ES2A 3TS2A 3S1MH 4Y52H 4AH6A 2DUDA 4UP7A 1MIUA 1E3PA 2HIVA 1X65A 3T1YL 4A3KG 1KHIA 4B3ML 4A3EG 3M4PA 2OQKA 1A62A 4OWTB 2E5LL 5IYDG 2JA5H 3A0JA 3BZCA 2ZJQA 3B6YA 1JE5A 4IJLA 5M3FH 1WJJA 2PMZE 4QY7A 3CPWA 2UU9L 5J3BA 1JB7A 2YTXA 1L1OB 3PUXA 4MNOA 2MQHA 3HOXG 1VQNA 4YWKA 4JYAL 2YTVA 5LMUQ 1X6OA 2K14A 2LSSA 2UUCQ 4LF6Q 4L5QA 3STBC 4BXXH 2Z6KA 2HQLA 1N34Q 1WCMH 4YY3L 1IBLL 3HFZB 3K81C 3L2PA 1B8AA 3CAMA 5M5YH 3JAMi 4JI2Q 4HJ9A 2N8NA 1VQKA 4DNIA 4JI4Q 1W2BA 2AMCB 2IX1A 4GS3A 1EQQA 3RLNA 4OWXB 4YHHL 2K5NA 4WJ4A 4JOIA 4DR4Q 1Q86C 4YCUA 1Q1BA 2R92G 2R7ZH 1HNWL 2NN6I 2UXBL 1SR3A 1UEBA 2MNAA 2K50A 5LMNQ 4L5SA 1D8LA 1A8VA 1GKHA 3M4QA 4NB3A 3I2ZA 3J80i 3WWVA 3F1ZA 2VW9A 5IP7G 4RG1A 4P72A 4A3KH 4LF4Q 1MKHA 2N78A 1FJGQ 3PF4A 2Y0SG 3U58A 3M7NA 1V1QA 2OQ0A 4GOPA 3GTPH 5IYDH 1A63A 4BA1I 1YHQA 4IO9A 2B63G 1G291 3H15A 1L2FA 2E2JH 3S1QH 3GTGH 1VQ5A 4JI5L 4TVAB 2F3IA 1N9WA 4JI7L 1XPOA 3H3VH 1RIPA 1OXTA 1DGSA 3GD7A 2DGYA 1R9TH 1HZCA 2ASBA 4FDBA 3HOWG 5AJ3Q 2I5MX 3A5ZB 1GM5A 4BY7G 3JC66 4DUYL 3AFQA 4P73A 2OCEA 3UDIA 1JMCA 2JA8G 3F2DA 1QZHA 1VQIA 4EX5A 2H5XA 4A3CG 1UE7A 1X54A 3T1HQ 1LYLA 3M85A 4IPDA 1Z9FA 1JJ2A 3W5OA 2IHEA 2JK8A 2R92H 5GQOA 1KRSA 4X62Q 1EIFA 3RZOH 3I7FA 1E24A 4HIOA 3J81i 1I94Q 3PUWA 5H1SE 1YJNA 1B7YB 3RR5A 5IYCH 2JA9A 4LF8Q 1UWVA 5E7NA 1YJ9A 3HOZH 2NZOA 1HNXQ 5JEAJ 5LMUL 1FVIA 2NZHA 1KXLA 3FKIG 1SE8A 2CCZA 3AFPA 4C3JH 4P75A 2B63H 3KLWA 5C4XH 2UUCL 4LF6L 2NVQH 2E2HH 4A3DG 1C0AA 1N34L 3HOUG 4GNXC 3STBD 5IWAQ 2ID0A 4JI2L 1E1OA 4GLVB 4NXMQ 2PQAA 1YHBA 4PZ7A 4JI4L 4LF7Q 3H0GG 3BU2A 3NELA 3GTKH 4MTNA 2KCMA 3HOWH 3E0EA 2AHOB 4DV6L 4GN4B 4DR4L 1TWAH 4A3JG 2ZJPA 4KI0A 4GNXA 4KHZA 1SROA 4AIMA 4BY7H 3CCJA 5LMNL 1NBWA 3CCEA 2JA8H 4LNQA 2MO0A 2MO1A 4A3CH 4A93G 2LXKA 2CQOA 4LFCQ 1KQSA 1X55A 1Z47A 4LF4L 2OWOA 1FJGL 3DM3A 1L0WA 1KC8C 4LF9Q 2KHIA 1OTCA 3CCLA 3L7ZC 4LFBQ 3S15H 2YV5A 4DV4Q 1KD1C 1W3SA 4DR7Q 3ERSX 1K0RA 1J6QA 4DPGA 2UXDQ 4IFDI 4DV5Q 5IY0A 3RNUA 1X3GA 1YHAA 2XTIA 3E9IA 3PUYA 1TWGH 4JBMA 2R7FA 4IJHA 2YTYA 3FKIH 5C4JH 4GKJQ 2A1AA 2OTJA 5C0XI 1HZAA 4KHPQ 2VNUD 1RL2A 4DUZQ 4A3DH 3HOUH 1VQCA 2WFWA 4R4TA 1FL0A 1Q12A 1C9OA 2GVAA 3RZDH 1SLJA 3FP9A 2WB1G 3ER0A 1WOCA 1V9PA 4UP8A 1XMQQ 3H0GH 1TWFH 3KJOA 2NN6G 3T1HL 1VQPA 2QEXA 4ME3A 4PMWA 4Y7NH 1U5KA 1VQFA 4A3JH 1M90C 1IBMQ 1EUJA 4X62L 1N8RC 4OWWB 1YNXA 3CQZH 3I4OA 5GAGC 1I94L 4QGUA 1PHJA 1YEZA 3BZKA 3S17H 4DV0Q 4A93H 1Y1WG 5JJIA 1P8LA 3U50C 3CCQA 4LF8L 4DR2Q 1EOVA 1SRUA 4R1JA 4XTCS 2Z0SA 3MEFA 1X3FA 1HNXL 1GVPA 1PV4A 2K75A 1SN8A 4X6AH 1VQBA 3K7AH 4GOPB 2Q2TA 1AH9A 3I4NH 4AYBG 1TWCH 1P16A 5M5WH 4NXML 2I5LX 4LF7L 1I50H 1HZBA 3ULJA 4A3LG 2HHHQ 4TQUS 1H95A 5FLXc 1OXUA 3KOJA 1EQRA 1PH3A 3A74A 4POFA 3TRZA 1CKOA 4A3IG 2WP8J 3K0XA 2ATWA 2JA6G 4DV1Q 5IYCG 4LFCL 3HKZE 2R93G 3HOZG 2ZM6Q 2E8GA 4APVA 4X65Q 1NMGA 3NBHB 3CC4A 2NVTH 4LF9L 1PH4A 1EWIA 1G6PA 5C4XG 2A19A 5GROA 4LFBL 2WAQE 3F2CA 4DV4L 2RHQB 2BA1A 4DR7L 4B3RQ 1Y1WH 3GO5A 1QZGA 3OYYA 4UY8C 1PYBA 3TS0A 2EQSA 5FLMG 1K83H 4DV5L 1D7QA 4B3TQ 4PZ6A 1HH2P 4BBSG 1Q7YC 1N33Q 2Q2HA 4OO1I 4KHPL 4HJ8A 1GD7A 4DUZL 3GTMH 2VQEQ 1JT8A 5GAHC 4JI8Q 2JEBI 3GDEA 4HIMA 1CSPA 2FXQA 1VCIA 1IXRA 4PZ8A 1VQ7A 2UUAQ 3CC2A 1SFOH 4A3LH 1NMFA 4JI1Q 1BKBA 2IT1A 1XNQQ 2ZJRA 2PQAB 5GADC 3RN2A 1IBML 3UE0A 3TREA 2E2IH 4A3BG 1BBWA 4NXNQ 1QUQB 2EIFA 4J15A 5BR8Q 5IT9c 2I0QA 2K52A 2ZTDA 5JEAG 1V43A 4A3IH 4JI3Q 2JA6H 4GNXB 1I6HH 4MZ9A 4DV0L 2R93H 2D0PA 3GTQH 1I3QH 4L5TA 5IP9G 4EQ5A 4DR2L 4AQYQ 1MJEA 1PH8A 2BA0A 3TQYA 3M3YH 4YWLA 3S1NH 4IFDG 2N3SA 3EN2A 3PCOB 5M3MG 2R7DA 3M4OH 5FLMH 4LUVA 1XTDA 3S14H 4IPCA 5C0XG 1PFSA 4IFDJ 1FGUA 1E1TA 4YWMA 3S16H 3UDFA 3NENA 4BBSH 1QUQA 2IX0A 1K73C 2VY3A 5C3EG 3PO2G 2HHHL 1VQDA 5C0XJ 3S24A 3OTOQ 3KJPA 2CFMA 1UE1A 1Q8KA 1WFQA 1YVCA 2AKWB 4DAMA 3HKZG 1LUZA 1HR0Q 2OTLA 2VL6A 1GO3E 2JJQA 4DV1L 5JJLA 1K9MC 2UUBQ 3UE1A 5JJKA 2ALYB 4DV7Q 2VQFQ 4YY3Q 2ZM6L 4X65L 3J81j 4A3BH 4DR6Q 3W1BA 5GAEC 1UE6A 4JV5Q 5ELNA 3G71A 1PH6A 1JJGA 2RF4A 3BJUA 1CKNB 2PNHA 4X64Q 4QIWE 4B3RL
chains in the Genus database with same CATH superfamily
3PO3G 1CUKA 4E6IA 4FVMA 5EPKA 3MXUA 1KDCA 2PI2E 1TS3A 1SBBB 3MXNA 1UNSA 1JWSD 1XNRQ 1LM0A 1GUWA 5M3MH 2VQEL 2C9OA 4RCNA 5C44G 1S40A 1TS4A 3BDCA 4DR5Q 3K8AA 2NVTB 5C3EH 5KNCA 3G6EA 2F03A 1K83B 4JI3L 1EIHA 1EEFD 3M9BA 3G4SA 3CCSA 1F9RA 2F3WA 4QQBX 4LK1C 4RKBA 1KLUD 2B2UA 4AQYL 2PW5A 2N49A 1IW7D 2F4IA 4BY1G 4AYBB 4WORA 3PIPA 5FKAC 3C46A 4NW2A 5EKKA 2YYZA 5IWAL 5JVG3 4DV2Q 3CRKC 4K8IA 2DNCA 2E76C 3UDGA 4DU9A 2RDGA 5ELFA 2F0FA 4A3MH 1I6HB 2F4VQ 1IZ6A 2Z6KC 2JA6B 1E2WA 2L15A 5IE8A 4K0KQ 2R93B 3MZ5A 1EY7A 2EOTA 4DR3Q 1Q81C 3ITPA 1IYUA 2B2VC 2UUBL 4OONA 1STHA 1PH1A 3CXCA 5LL6X 4LW1A 1L1OC 4R8IA 3RLFA 3S14B 3HOVG 3SGIA 4JK1C 2UXDL 5I6YA 1B3QA 2VXWA 1S5ED 1PH5A 4KV6A 1EY5A 1EY0A 1TXYA 5D14A 3RMHA 3AMUA 1A3UA 1LT4D 2K5HA 4HTHA 1AE2A 5C3WA 4OO1H 2K03A 3GTOH 1XWEA 2PI2A 4P2CB 1VQ6A 2CWAA 5KNBA 2IY5B 1BBXC 1I5FA 4HR7B 5A35A 5EBDA 1YBYA 3PUVA 2JQOA 2AQ3B 3K80C 3N6RA 3BDOA 2K04A 4QB4A 3BG3A 4B3SL 4O0AA 5CYUA 2RVLA 1LLRD 3G7LA 1PVOA 1SE2A 1KNAA 4DV3L 4DR1L 1X56A 4GKKL 1S5DD 3ZJYC 4F7XA 5HURA 3CF5A 3OWEB 4IN3A 1N36L 2RHSB 2XGTA 1A15A 5C6AA 3OOCA 4P71A 1RHPA 1JOKA 1PZKD 1GUTA 4G7OC 1I4HA 2A8VA 1IYJB 4DK3C 1X9NA 1M4VA 1K8AC 3S1RH 4X66L 3TP6A 1FGBD 4R4QA 3ND9A 4WJ3M 1EYGA 1WVLA 3CMAA 1ILQA 4AYBE 4ZLTF 1B44D 4N8FA 3HZXA 3NXWA 1H9RA 3P7JA 4PG3A 1VQ9A 4LF5L 5DM63 4IOAA 4RGNA 3D0FA 1Q46A 2B2YC 3HG9A 2NVXB 3TZUA 5M5XH 1CQFA 3KDFB 1QWYA 1ZYRD 2KCNA 2R6GA 4C3HB 2ZTEA 1T9HA 4I7AA 4JI5Q 1YNNC 1CSQA 4QJFA 2VUMB 3KF6A 1BO0A 1U0LA 2NB0A 2ZXRA 5K36H 3CU7A 5HGQA 1BF4A 4G7ZC 5CC4A 2QKIC 3D31A 4H02A 3S2DB 1F2LA 1M1KC 1A3TA 1Y1VB 3TS2A 3S1MH 1MIUA 4BBRB 3QG1A 3T1YL 3OMCA 1KHIA 3DM1A 1WTPA 4OWTB 2E5LL 1GHKA 3A0JA 1JE5A 4IJLA 3HOXB 2A69D 4FXGC 5KYLA 1L1OB 4FP5D 3HOXG 1I3QB 1BNZA 4UHVA 3H3VC 4ZUJA 4A3GB 4K8JA 2LS01 3PMFA 5M5YH 1VQKA 4JI2Q 4ABNA 2XWBB 3P1HA 1EQQA 3PIO3 1H9SA 2R7ZH 2NN6I 5J22A 4EQNA 1DZ1A 1PTOC 1GKHA 3EJIA 3F1ZA 2IPKD 1FJGQ 3PF4A 4IO9A 2B63G 2E2JH 2K5WA 2NYZD 2A6EC 5CBAE 2F3IA 1L0YB 3I8ZA 1XPOA 2ZT9C 4YIJA 2RKSA 2EJMA 1MD2D 1RIPA 5CMDA 3NTIA 3VR4A 3D6WA 1R9TH 3HOYB 1VMPA 1HZCA 2B8FA 5EPJA 5EBCA 1IL8A 4BY7G 2K5QA 3JC66 4K5VA 3F2DA 1QZHA 4PQXA 4A3CG 4FYDA 1PZID 1JJ2A 1CI3M 2F0TA 4A3FB 2R92H 5GQOA 1KRSA 1EIFA 5NUCA 5IT9E 3RZOH 3KK7A 3DEOA 1RTNA 1YJNA 2OT2A 5IYCH 4DXFA 3OIPA 2JA9A 4LF8Q 1OO9B 5E7NA 4EQOA 3HOZH 5JEAJ 5LMUL 4ZCKA 1DD2A 2WAQB 1U4LA 3FKIG 2CCZA 3AFPA 4C3JH 4P75A 5ISRA 2UUCL 3J7YW 1EFID 3BZDB 2HCCA 1B1ZA 1C0AA 3MC0B 1N34L 4GNXC 3STBD 2ID0A 2IL8A 5JOBA 2PQAA 1YHBA 4PZ7A 4JI4L 4LF7Q 3H0GG 2JA5B 4C2MB 5M3FB 1CK1A 4ID6A 1TWAH 4KI0A 3CCJA 2JA8H 3CCEA 2MO0A 2PZTA 1CZWA 4LFCQ 3K5OA 3DM3A 1L0WA 1DCZA 1SYFA 3L7ZC 3S15H 4FXDA 5J39A 4DR7Q 1RTOA 4DPGA 1Z6HA 3PUYA 3BVZA 4IJHA 2YTYA 2K01A 4GKJQ 2A1AA 2EZVA 3NE5B 3NWTA 1R4PB 1HTLD 3NTHA 4DUZQ 1Q12A 2GVAA 4A3KB 1MHWC 1XMQQ 4F87A 2FHTA 2AUJD 1VQPA 1EL0A 2RQXA 3BVMA 4HCEA 4RA8A 4MTKA 1SNMA 3VYUA 4OWWB 2B2UC 3I91A 5GAGC 4KN4C 4NDXA 4QGUA 3BZKA 4A93H 4DGZA 5C5LA 1I4QA 1Y1WG 1UAPA 3U50C 5J1ZA 1EOVA 1SRUA 4XTCS 1VF5C 2EJFC 3K7AH 2QCPX 4GOPB 2RDHA 2Q2TA 1PTOB 1AN8A 1DJRD 3LX0A 1TWCH 3MVVA 4DXGA 1O7YA 2F0UA 4DN4M 2K7VA 3MAQA 4TQUS 1OXUA 4DAYA 1FNVA 2K05A 2ATWA 1EY9A 3HKZE 3K0YA 1EWIA 4XYOA 1BDOA 4L63B 4LFBL 5C4XG 2WAQE 1RCVD 1G8ZD 2G5DA 1ENFA 3OYYA 3A54A 3HOWB 3KF8A 1Q7YC 2Q2HA 2MP1A 1TR5A 4KHPL 1CTMA 1GD7A 4KKUA 3GTMH 2VQEQ 1T5EA 2JEBI 1CSPA 1VCIA 1IXRA 4CJ0B 2D9UA 1SFOH 4A3LH 2EDGA 2KUMA 3BVGA 3RN2A 1IBML 3UE0A 4A3BG 1BBWA 1QUQB 4DK0A 4RWSC 2ZTDA 4JI3Q 4A3IH 4GNXB 1JORA 4XXEA 5C4JB 1AZPA 1A6XA 4H0LC 4H44C 3DXJC 1I3QH 4L5TA 1MJEA 4QF4A 1QNUA 3MEHA 3ND8A 4AQYQ 3HOUB 4YWLA 2L4NA 3RZDB 2PW7A 1Q3LA 3PCOB 1TY0A 5M3MG 3A55A 4LUVA 4A3JB 1F9SA 3S16H 4BBSH 3S9WA 3P75A 3CQZB 1YNJD 2VY3A 5C3EG 3J80L 3WOFA 1K73C 3E6ZX 1VQDA 3R2IA 5TSSA 2HHHL 3S17B 3W3AA 1SYGA 3MFYA 3KJPA 1WFQA 1Q8KA 1STEA 1LUZA 2OTLA 2VL6A 4DV1L 1K9MC 3IFTA 2UUBQ 1STYA 2ALYB 2ZM6L 4CJ1B 3TP7A 1WTQA 3I4NB 2L1BA 5JEAH 3BJUA 2PNHA 4WJWA 1PFNA 3D8GA 3I4NG 1JCKB 1IHZA 3OMGA 4G57A 3RLOA 2HDLA 2JSOA 2WB1B 4RAUC 4A3MG 3IAYA 2Z1CA 3K5MA 3CCMA 4JBKA 1HUNA 2UUAL 1VQHA 2L12A 3J80c 5C5MA 3E3XA 1CKNA 3Q8DA 4XQQA 3TMEA 2A68C 5FK9C 4HJ7A 1PH7A 2MHVA 2EXZA 1D6EC 2K33A 4JBWA 1KIXA 4B3SQ 1ASYA 1D5XC 3PV0A 1B9NA 4DV3Q 4DR1Q 3I4MH 4GKKQ 4OO1G 5K5PA 1HTPA 3MTSA 4C2MH 1NJIC 5G3LD 1N36Q 3IKJA 1KNEA 1JE4A 4IQZA 2K5VA 1SNDA 5C4ZA 3GTQB 3J81c 2B3GA 4HSVA 4JCVE 3M3YB 3E0JA 3C3LA 3VA7A 1EQVA 3FPUB 4X66Q 4ZQ3A 2VQFL 2Z4IA 4JV5L 3KFUA 4LWCA 1YI2A 3D4RA 4BA2I 4QL5A 3A5UA 3OSOA 4X64L 2PYKA 4DV6Q 1O7LA 4LF5Q 4TSSA 2EYMA 4GKJL 1WYDA 1OXVA 1IBKL 1LTBD 4R4OA 1CZGA 1NE3A 1YITA 3HRZC 3BDLA 2L55A 2A6HC 4O2DA 1XMQL 3H3VI 1H9MA 1IYVA 1QVCA 5IYBH 1EQTA 3FEWX 4A4IA 2E2DC 2EY6A 3MFGA 1QCBD 5ELOA 2B29A 1E7ZA 1SMYC 3TP5A 2KCTA 1SJED 3KLSX 4POGA 2F0SA 1LTAD 1F9QA 2BDNA 2ICEC 2NTTA 5BN4A 4NPSA 3T1YQ 5FOBB 2WB1E 3KUPA 1A2TA 2E5LQ 1ZXTA 3PO2B 1PTOF 3KYHC 3AQQA 5LMNW 3VR5A 2YU9B 1YIJA 1B70B 3EFXD 2H1EA 2NBFA 1TY2A 2AWNA 5K36G 3CP0A 2F0LA 3CW2C 3H6MA 3PF5A 1BCPD 2QDBA 4YCWA 2L5TA 3AYHB 1PRTC 1HNZL 1K8GA 1NCVA 1XPUA 3PO3B 1ONLA 2RDFA 2J4XA 5M9OA 1IL2A 3KF6B 1S3OA 4IZ8A 2B2WC 3S2HB 1XMOL 5KNDA 5IGEA 1PMRA 4CDFC 3EBEA 5C3XA 4K2LA 5C44B 2ZXOA 2X69A 1X3EA 1HCZA 2NVYH 3G6JB 2F0KA 1E22A 2JA7H 4JC0A 1VQ8A 1QVFA 2QW7A 4YCVA 3J7A5 1RODA 5EKLA 1S5BD 3FRPB 4A76A 1GXDC 2KBNA 3GV3A 2UXCL 3WOEA 1KAWA 1XTCD 2Z9HA 4GN5A 4UP9A 4BY1B 2R7ZG 3CMEA 5KRUA 2ES2A 1TWHB 4Y52H 2DUDA 4A3EB 2EYJA 5IODA 2HIVA 5CV6A 2LFNA 2F0HA 4A3EG 3M4PA 2OQKA 2ZJQA 1K0SA 1WJJA 4CGYB 2UU9L 4CDDC 4RCOA 5LMUQ 4F88A 1SXTA 4ILWA 2UUCQ 1PFBA 3R2TA 4L5QA 4BXXH 3HOVB 1N34Q 1WCMH 3HFZB 3TSSA 1B8AA 3CAMA 1EZ8A 4CKCA 4DNIA 1GJXA 4JI4Q 4OL7A 1W2BA 3X3NA 2IX1A 4GS3A 3RLNA 3R3OA 4OWXB 4YHHL 2K5NA 2KQ3A 3I3CA 4WJ4A 1QJOA 1SAPA 4YCUA 1VDZA 5ELCA 3GTJB 2R92G 2UXBL 3MWYW 2MNAA 5D3IB 5KYIA 2B8GA 4KD3A 3M4QA 3MXPA 1EY4A 2Y0SB 3J80i 2DY8A 5IP7G 2VW9A 1V8QA 4P72A 1V1PA 2Y0SG 1XXGA 1V1QA 2OQ0A 3H91A 3VYSA 4BA1I 2ENBA 4C3JG 3S1QH 1G291 1KAAA 1L2FA 3GTGH 2AUKA 1VQ5A 2NUCA 2LKVA 1LABA 2F0QA 3K6OA 2EJGC 4FDBA 3GTLB 4X3SA 5AJ3Q 2V4DA 4L6TB 3A5ZB 5IIFA 4N9TA 2SNMA 3AFQA 2OCEA 2JA8G 3QJYA 2B2TC 4EX5A 1X54A 5DEHA 2WKCA 3W5OA 1II3A 4C3IB 3I7FA 1QILA 4X3UA 4HIOA 3J81i 1C48A 2BOSA 3X3MA 1PRTB 1B7YB 2XIWA 4C3IG 3RR5A 1CFMA 2DN8A 2WINB 2PPBC 1STNA 1SE8A 3KLWA 4LF6L 4XYQA 3EROA 5IGDA 3GTKH 1DOLA 1LV9A 2AQ1B 2KCMA 4OIJA 3NQTA 4DV6L 4DR4L 4GN4B 3URYA 3TN2A 2ZJPA 3Q23A 1EY6A 5LMNL 4LNQA 1MGSA 2MO1A 4A93G 1LT6D 5JAVA 1C4QA 3VA5A 1KC8C 2BE5C 4MHEA 2KHIA 1SJHD 2TMPA 1PDQA 4LFBQ 2YV5A 3A7AB 5D3DA 1K0RA 3D4WA 3NHHA 5AFWA 2F3VA 4IFDI 1YHAA 3E9IA 2F0PA 5C0XI 1E0BA 4KHPQ 2N88A 2VNUD 1RL2A 4A3DH 3L9AX 5FLXL 2WFWA 4R4TA 5D65A 1EZ6A 4UP8A 3K5LA 3GTPB 1TWFH 3T1HL 4XDXA 2QEXA 2RSOA 2F0MA 2CW0C 1U5KA 1VQFA 2M2LA 2XNAC 3IFDA 1M90C 1IBMQ 4X62L 2SEBD 1WTWA 1W6KA 3I4OA 1YEZA 3GQBA 2R3ZA 1S5CD 3CCQA 4K2KA 4R1JA 1HNXL 2Z0SA 4QIWB 1D2BA 2DNEA 3FPPA 3SDZA 4V0BA 1AH9A 4IUVA 4FO2A 5JJZA 1F77A 1MI2A 2C5CA 5M5WH 1HUMA 1HZBA 3ULJA 4A3LG 4H13C 2HHHQ 1H95A 5FLXc 4B9XA 3A74A 1CKOA 1KABA 4A3IG 2WP8J 4DV1Q 2NN6H 3SEBA 3CKIB 2B63B 2NVQB 4HN7A 2KEEA 2L9HA 2ZM6Q 3NBHB 2E2HB 1SDFA 2NVTH 4KKSA 2XRQD 3T56B 3TS0A 1AW7A 3C2PA 1K83H 4PZ6A 1B4OA 3R93A 4BY7B 4BBSG 1N33Q 4KJOA 1EEID 1EU4A 1FR3A 3CRLC 2M00A 4HJ8A 3BYTB 2KCCA 2P5ZX 5E4XA 4NKLA 2O5JC 4PZ8A 2PMZB 2UUAQ 3CHBD 4ZK9B 2IT1A 4HSPA 4IUPA 3TREA 4DNTB 4KD4A 1SNCA 4J15A 4Q0FA 1M8AA 1RD9D 4Q5VA 2K52A 5JEAG 3QR8A 1V43A 1I6HH 1TWGB 2JA6H 4EVOA 4MZ9A 4DV0L 3FKIB 4OELB 2R93H 4X3KA 1IW7C 4RFBA 4EQ5A 2N55A 3OWFA 2BA0A 2OXPA 3TQYA 1O80A 2RCFA 3H0GB 4ME5A 2R7DA 4XT1B 5FLMH 5KGUA 4IPCA 3S14H 4Y7NB 1E1TA 4YWMA 3UDFA 3NENA 5A2QL 5FO8B 3QWNA 2IX0A 5DNFA 1YVCA 3HKZG 5JJLA 1GO3E 2JJQA 5JJKA 2KEDA 2VQFQ 3Q22A 3W1BA 1UE6A 4J6HA 4JV5Q 5ELNA 1XX8A 2RF4A 4RGMA 1CKNB 4X64Q 4QIWE 4B3RL 1I50B 2Q8IB 2J0TD 5LHY1 3I4MG 1NNXA 5IP9H 3TEHB 1VF7A 1K28A 2G9DA 4JVZA 1S72A 1JB3A 2FMMA 2SNSA 5AJ3L 1IBKQ 4KY7A 1SYDA 2ZTCA 2D0OA 2E74C 3PSIA 4JI8L 4DA2A 2ZXPA 5DM73 4IOCA 1ICFB 3HS0C 5E1FA 4LJZC 1Q1EA 1XNQL 2K5DA 1Y1WB 1PYSB 4NXNL 4DK6C 2VZAA 3A8KE 5BR8L 1WTVA 3QOLA 1E2VA 3FHWA 5I6WA 1PRTF 4U673 5EAYA 4A75A 1JWMD 3NTKA 1OXXK 3KDFA 1WTRA 2JEAI 4ALPA 4ZKBB 1CHQD 1ASZA 4HIKA 2FJ2A 2E2IB 1OXSC 5IYBG 2EYOA 1NY4A 4R4CA 2Q2IA 5ELBA 3OTOL 2EYHA 1C7YA 2BH8A 3T53B 2NVXH 5JPNC 4RKLA 3O13A 3SXHA 3HEJA 1HR0L 1PH9A 3S1NB 3KLSA 5C4XB 1G2TA 1ENCA 4C3HH 1HNZQ 3ZYYX 3DWPA 4LAAA 4DR6L 3M4OB 2WACA 1VQMA 2VUMH 4QMGA 2EYPA 1XMOQ 3CPFA 1K3RA 1SYEA 1L1OA 3S2DH 1CKMA 4X3TA 1Y1VH 2F0EA 4ZAIA 1ZYRC 3HP3A 4BBRH 4R4IA 4A3BB 1KLGD 3EIVA 4LMQD 1EWCA 4JI0L 2PQEA 1GUNA 3PIOA 3I55A 4K6LA 1H9JA 4OGQC 3HOXH 2I46A 3IRBA 3F2BA 2UXCQ 2EXDA 1KRTA 5FO9B 1D5MC 1F9PA 3VDYA 3HGBA 1NAPA 1CA5A 5FJ8H 5M3MB 2EYFA 4IPHA 3T13A 1HA6A 1ESRA 2PCFB 2QGQA 4A3GH 2CKZB 1D1KA 2VB2X 2JA7G 3ICEA 4FXKC 1A0IA 1FYCA 2HUGA 2SDFA 1HJPA 5C3EB 4U68A 1W6JA 4J1MA 2A69C 4M1UB 5I9OA 4K5XA 2Q2UA 1VQAA 4Z9CB 5IGCA 2K4KA 2UU9Q 3QO2A 4OX9L 1SYBA 1WI5A 4GZYC 1WTHA 1TS2A 4GLAC 1I4XA 4R8NA 1TKWB 1Q82C 3MXNB 2EY2A 4G7HC 5CV5A 4HJ5A 2V1CC 1O78A 4NMZA 4F8MA 1VQGA 1XPRA 1HPCA 4GLXA 1UEAB 4YHHQ 1V1OA 5IGGA 4LFAL 3UI2A 2UXBQ 1Q90A 4A3MB 3HOYH 2OF1A 4XT3B 1N33L 2KHSA 4JBJA 3F8TA 1MJCA 1Y14B 1J5EL 4QUFA 3PIP3 1MSGA 3J81L 4C56C 2Z4HA 4A3FH 3LGJA 1PA6A 2KENA 2B2YA 1J9OA 4IPGA 4BXXG 2D62A 2H4OA 1QE6A 4G4KA 4JI6L 1WCMG 3ULPA 4I7ZC 1EYCA 2KHJA 4XIGS 4ZYSA 1WTOA 1NR2A 1GUSA 1N32L 2KVMA 1QNKA 3PGZA 1JJCB 1YJWA 5KIXA 1LACA 3KBXA 1TU2B 4DNRB 2F0DA 1ESFA 1X65A 3GTOB 4B3ML 4MIUA 1B2TA 4CDEC 4CKEA 2JA5H 3BZCA 3B6YA 4J8QA 5M3FH 5IOCA 4FF1A 1VMCA 1I4PA 3CPWA 1JB7A 4ZUIA 1VQNA 4JYAL 4YWKA 2YTVA 1X6OA 2K14A 1Y8PB 4LF6Q 1DOKA 1SYCA 3STBC 2HQLA 3DWQA 1LTTD 2O2LD 1NR4A 1IBLL 3CD6A 1PH6A 1HRJA 2XN9C 1EIGA 2N8NA 2NZ1D 3OIQA 4B9WA 4JOIA 4DR4Q 1SNPA 1Q86C 5FLXE 1Q1BA 2F1MA 1HXYD 5CV8A 1HNWL 2CH4W 5CV4A 3K5NA 1UEBA 5LMNQ 2K50A 1WD1A 1D8LA 1A8VA 2DY7A 3VYRA 4A3KH 4CJ2C 3I72A 3M7NA 1A63A 4GOPA 5IYDH 3S1RB 1YHQA 1C8CA 1FNUA 3H15A 1JICA 4JI7L 1B9MA 3H3VH 1JOQA 1RJTA 4WRDA 1YNND 5CR3A 1OXTA 1DGSA 4CKBA 3GD7A 3GP7A 2CHBD 1X3PA 4N8X1 2PNRC 4MN3A 2HDMA 4DUYL 5M5XB 4M8AA 3V96A 1VQIA 1RKNA 2H5XA 3T1HQ 1PTOH 3M85A 4IPDA 1Z9FA 3SHLA 4X62Q 2F0JA 3LWEA 1BCPF 2FMCA 1KTKA 5H1SE 1GUGA 3H94A 1ILPA 1YJ9A 1HNXQ 3R8BA 2NZHA 1KXLA 3S1MB 2CVRA 1S4ZA 5C4XH 3DHQA 4A3DG 4O42A 1B3AA 5E4WC 1LTID 1E1OA 3A7LA 3HOWH 2AHOB 4GNXA 4AIMA 1SROA 1I4RA 2LY7A 1PTOD 4N9PA 1TVXA 1AP0A 1KQSA 1Z47A 1SNOA 1LO5D 4LF4L 1WTXA 5M5YB 2CQAA 1W3SA 1KDBA 3ERSX 4QUCA 2EYLA 4OEMB 2A6ED 5IY0A 3RNUA 2XTIA 4NP5A 2R7FA 2R7ZB 1D1IA 3N52A 5C4JH 3OHXC 2MGSA 2OTJA 1HZAA 2JN4A 4IUUA 1F2YA 3HOUH 1VQCA 1FL0A 1C9OA 5A2QE 3RZDH 3F2UA 5I4DA 2M9VA 1LTSD 3KJOA 2EPBA 2NN6G 4ME3A 5EGTA 2E2JB 4ODGA 4A3JH 3U9OA 1EUJA 3CQZH 1H9SB 1L0XB 1I94L 1GOZA 4HMJA 2GA4B 3S17H 4DV0Q 1R9TB 2EE1A 1TT2A 3NSWA 2EY1A 3MEFA 1X3FA 5BN5A 1GVPA 3SK8A 2K75A 1SN8A 4PMBA 4X6AH 1LT5D 3I4NH 4AYBG 5T1IA 1P16A 2IJ0A 1YNJC 4NXML 2R92B 3RZOB 4ZKCB 2Z6BA 2I07B 2RBMA 3KOJA 1PH3A 5F2DA 4POFA 3HOZB 2JA6G 3K0XA 1DOMA 1H9KA 5IYCG 3MA2B 4C3JB 3TP8A 3HOZG 2R93G 1X32A 3FDTA 2E8GA 1K3BC 5DAUA 3CC4A 4LF9L 1JWUD 2RHQB 4DV4L 2BA1A 3WDNA 3I4LA 1WD0A 4B3RQ 3GO5A 1QZGA 3QIAA 4UY8C 3TDQA 5FLMG 4DV5L 3NK9A 3QB3A 1D7QA 1TWAB 2X6LA 2HQEA 1EWHA 1QOHA 4V190 4OO1I 2JA8B 3ONAB 1XYIA 2JP1A 4QCLA 1JT8A 1EYAA 2KJXA 4HAEA 3SE0A 4JI8Q 1BQQT 5GAHC 3GDEA 1LTRD 1NMFA 3S15B 1BKBA 1XNQQ 2PQAB 4NXNQ 5BR8Q 2FFKB 2KA7A 3GTQH 2K1BA 3I70A 5IP9G 4DR2L 3JAML 3NPPA 4K6DA 3M3YH 1STGA 3LNNA 2N3SA 3M7GA 3EN2A 4RHRA 1GHJA 1SE3A 4B08A 4PMCA 1XTDA 3T16A 5CBEE 1HA5A 2WKDA 2O5IC 3T4AC 4FF2A 1GUOA 5I2XA 2QDLA 4A93B 4BWGB 3OTOQ 2CFMA 4O1NA 5CGKA 1HR0Q 4UDUC 4PNYA 3NP8A 4YY3Q 4X65L 3K7AB 5COYA 1G6ZA 4DF7A 4DR6Q 3KBGA 1TWCB 3G71A 1JJGA 1S5FD 1DONA 1HZ9A 3W1GA 4DKAC 3JAMc 2QF7A 4B3TL 4K5WA 2XWJB 1AFPA 1MBYA 1QVGA 4IFDH 2JE6I 4H7BA 3LWUA 3AEVA 4C1NI 2QILA 4FF3A 5C0XH 1G51A 3DUZA 1O7IA 3J80E 2F0WA 2BH2A 5HY6A 4JI0Q 2Y0SE 4XQNA 3PO2H 4JI1L 4C3HG 2YU9H 4RMFA 3U9SA 3OW7A 1HR0W 1FD7D 1BUVT 3J7ZC 2VUMG 1LT3D 3KLRA 4DAYB 5LL6S 3GTMB 5ELDA 4HCSA 2I5HA 1Y1VG 2RSNA 5T1GA 1SFOB 3M4YA 3PO3H 4IUNA 4BBRG 2MPMA 4KTAA 1ML0D 2AQ2B 2C35B 2AWOA 2Q8RE 4C1NK 2B39A 3NEMA 3S2HH 5CORA 1XJVA 4OX9Q 4A3IB 1ENAA 1K8OA 4KKTA 1KL9A 3KF8B 1U4RA 5C44H 3J81E 1BCPC 5I9PA 3RN5A 4LUZA 3PUZA 3DLLA 1NUCA 1B53A 2PZUA 4JOIC 2K32A 1RDPD 4DV7L 2BCOA 3NWSA 5FJ8G 5JVH3 3P20A 4A3GG 4LFAQ 3S16B 1HFNA 4BBSB 2F0IA 3VR3A 1A3VA 1EOTA 1NTGA 1SNQA 2MFIA 1PH2A 4GOPC 1BVSA 4BY1H 4TRDA 4RGOS 2IHFA 1TWHH 4HJAA 1J5EQ 1XNRL 3OW2A 2IW3A 1SMXA 4A3EH 4CBVA 3J7AV 1EIYB 4DR5L 4DAVA 2LXJA 4LUOA 1E2ZA 4JI6Q 4EGVA 3CCVA 2GVBA 2DJGC 1ZKOA 1CQVA 3K7UC 1N32Q 4OHJA 2JYOA 1O7ZA 1AE3A 3CCUA 3NUCA 4UPAA 1VQOA 4GN3B 1VQLA 4JG2A 2A68D 2RCNA 2BDOA 3HOYG 2HCIA 2L11A 4KN7C 1JR0D 3CCRA 1IKMA 3HOVH 1K8MA 2KECA 1MSHA 3U4VA 4HIDA 4B3MQ 4DV2L 3UDXA 3ERQA 3NBIA 3PQIA 2LMCB 4A3FG 5C4HA 3GTJH 3Q6SA 4KY5A 1Y8NB 3HKZB 1VQ4A 2F4VL 4DAPA 1PXUA 5IP7H 4K0KL 3J7AF 4JYAQ 1BOSA 1TS5A 1SE4A 3E9HA 5EKIA 4P74A 4L5RC 4DR3L 2SOBA 1SSOA 4OXPA 3U4ZA 2XVSA 1VS0A 1VQEA 1ET9A 2WAQG 1IBLQ 1EFWA 3I56A 3I4MB 2A74C 2GN5A 1TIID 2WIIB 1BBUA 1HNWQ 5BN3A 1STBA 2JA5G 4RGTA 1PFMA 3CC7A 1T5XD 3G48A 4FF4A 3GTLH 1VQJA 5M3FG 1UUPA 1Z7TA 4UAIA 2HT1A 3QOJA 3K57A 4PV1C 2B2WA 1DM0B 3L0OA 1JOOA 1I6VC 3I73A 4IALA 1R4QB 2F52A 4DK1A 2VS1A 3V2TA 1UE5A 2CWPA 2A6HD 4K14A 1FNWA 3ULLA 4JI7Q 4C3IH 3A56A 2QEJC 2IWHA 1LTLA 2QA4A 1YZ6A 3SVMA 3SK5A 3GV6A 2WV6D 2HIXA 4KLKA 2IX3A 3SK6A 3HKSA 1SMYD 5DLQE 2O4XA 4DUYQ 1ZEQX 4AH6A 4UP7A 2NWGA 1A2UA 1E3PA 3V05A 4A3KG 2VB3X 3W2DA 1BCPB 4RHSA 1TQOA 1A62A 4TKOB 4KY6A 5IYDG 2PMZE 4IUTA 4QY7A 2PZWA 5J3BA 2FINB 2YTXA 3PUXA 4MNOA 2MQHA 4IURA 4I65A 4L8JA 2LSSA 1DYQA 2RA4A 3AU7A 1PYWD 2F0VA 1LTGD 2Z6KA 4KJNA 4YY3L 3K81C 3L2PA 3JAMi 4HJ9A 1PRTD 2AMCB 1Y8OB 1ICWA 2B2VA 4ULLA 1SR3A 4CHTB 4L5SA 2EVBA 2XRSD 2NTSA 4NB3A 3I2ZA 1Y69U 2E75C 2DJFC 3MXGA 3WWVA 1G2SA 3D6CA 4RG1A 1DXMA 2F0NA 4LF4Q 1MKHA 2N78A 5IGFA 3U58A 3GTPH 2F0GA 3BS1A 3L3OC 4JI5L 4TVAB 1N9WA 2R61A 1D5ZC 4FNFA 4BS9A 1B50A 2DGYA 3H09A 3A8IE 2ASBA 3BYYB 3HOWG 1X3QA 2I5MX 1GM5A 4P73A 3UDIA 2NVYB 1JMCA 2JA7B 1UE7A 2PO4A 3NBHA 1LYLA 5HGTA 4JW0A 1CHPD 1G91A 2IHEA 1F2ZA 2JK8A 1E24A 2B2TA 1I94Q 3PUWA 3I90A 3SR1A 1CT1D 4KMUC 1UWVA 3NQIA 5E3FA 2NZOA 1FVIA 4KHVA 4HEDA 2B63H 2NVQH 1J8IA 1QB5D 2E2HH 3HOUG 4DFAA 5IWAQ 1U4MA 4WFN3 4GLVB 4JI2L 4NXMQ 3BU2A 3NELA 4MTNA 3VR2A 3E0EA 4A3JG 3EQLC 3VYTA 4KHZA 4EQPA 4BY7H 2Z8LA 2MUYA 1NBWA 4A3CH 3RD4A 1QG7A 2LXKA 2CQOA 3K58A 2J7ZA 1X55A 2F0OA 2OWOA 1FJGL 4LF9Q 1WCMB 1HQMC 2JXMB 1OTCA 3CCLA 1EY8A 4DV4Q 1KD1C 5FO7B 2A73B 1J6QA 3SK4A 2UXDQ 1HQRD 2G9HD 3JAME 4DV5Q 1X3GA 1TWGH 1PLFA 4JBMA 3FKIH 4XQJA 2HD3A 2D2CC 3C1EA 5G3LF 2A5HA 1SLJA 3FP9A 2WB1G 3ER0A 1WOCA 1V9PA 3FVQA 3H0GH 2TSSA 4PMWA 3S1QB 4Y7NH 3GTGB 5EJWA 1AZQA 1N8RC 1YNXA 1JQYD 1PZJD 1PHJA 3AB9A 5JJIA 1P8LA 3TZDA 3D3RA 5CV7A 4LF8L 4DR2Q 3C1FA 5KEEA 3Q24A 3FMCA 5ELEA 3DMUA 1PV4A 1V1PB 4KK7A 1VQBA 2K28A 1BR9A 2I5LX 3IL8A 4LF7L 1I50H 1BXTA 3D4DA 1JC7A 3K59A 3EA6A 1EQRA 4RH6A 3TRZA 5IT9L 4OIKA 5EQ0A 4LFCL 4IUQA 4CDCC 2K6AA 3EVQA 4X65Q 2CH4A 4APVA 1NMGA 1CM9A 2ICIA 3MHBA 1PH4A 1G6PA 2A19A 1U4PA 5GROA 3F2CA 2BE5D 1IKLA 4DR7L 3GTKB 1Y1WH 3E5SA 1PYBA 5I2YA 2EQSA 2X6GA 4B3TQ 1HH2P 3Q0AA 1SEBD 2L0CA 4DUZL 1EYDA 4S3SA 1I4GA 4HIMA 3OPOA 3CC2A 2FXQA 1VQ7A 4ZRZA 4JI1Q 1CA6A 2ZJRA 5IGBA 5GADC 2E2IH 2EIFA 2CW0D 5IT9c 2I0QA 2OEOA 1ET6A 2D5DA 1HHVA 3DWAA 2D0PA 1KDAA 2KOLA 1HFGA 1PH8A 4A3DB 1RF2D 3S1NH 4IFDG 3DEPA 1NSNS 2MJ8A 5JPMC 1TWFB 5CV9A 3M4OH 3TBIB 4HMIA 5C0XG 1PFSA 4IFDJ 1FGUA 1U9RA 2EY5A 1QUQA 1AEXA 3PO2G 5C0XJ 3S24A 1EU3A 1UE1A 2AKWB 4JPBW 3T51B 4DAMA 5EPLA 1STAA 3UE1A 4R9WA 3VR6A 1F2MA 4DV7Q 3J81j 4A3BH 5GAEC 3A8JE 3RUZA 5M5WB 2Q8TA 2XSCA 1Q8IA 5L37A
chains in the Genus database with same CATH topology
3I4NG 1HZ9A 3PO3G 1CUKA 3W1GA 3I4MG 4DKAC 3JAMc 5IP9H 3RLOA 4B3TL 3TEHB 2PI2E 1S72A 1QVGA 5AJ3L 2JE6I 1IBKQ 4A3MG 1XNRQ 1LM0A 3AEVA 2ZTCA 5M3MH 2D0OA 2VQEL 5C44G 1S40A 3PSIA 4JI8L 1G51A 1O7IA 3CCMA 4DR5Q 4JBKA 4IOCA 3K8AA 2BH2A 5HY6A 2UUAL 1VQHA 3J80c 4JI0Q 2Y0SE 5C3EH 3PO2H 4JI1L 1Q1EA 1CKNA 1XNQL 3G6EA 2YU9H 1PYSB 3Q8DA 4NXNL 4RMFA 2VZAA 4DK6C 5BR8L 1HR0W 4JI3L 3J7ZC 2VUMG 4DAYB 3FHWA 3M9BA 3G4SA 3CCSA 4HJ7A 1PH7A 5EAYA 4A75A 4QQBX 4AQYL 4JBWA 2N49A 1OXXK 1KIXA 3KDFA 4BY1G 4B3SQ 1ASYA 2I5HA 3PIPA 1Y1VG 3PV0A 2JEAI 3PO3H 4DV3Q 4ALPA 2YYZA 5IWAL 4DR1Q 4BBRG 4DV2Q 3I4MH 4GKKQ 4OO1G 1ASZA 4C2MH 4HIKA 2C35B 3UDGA 2AWOA 1NJIC 1OXSC 3NEMA 3S2HH 5IYBG 1N36Q 1XJVA 4A3MH 1NY4A 4R4CA 4OX9Q 2F4VQ 1IZ6A 2Z6KC 4K0KQ 1KL9A 2L15A 3KF8B 5IE8A 2Q2IA 3OTOL 5C44H 2K5VA 1C7YA 2BH8A 3J81c 4DR3Q 2B3GA 3RN5A 2NVXH 4LUZA 3PUZA 3DLLA 1HR0L 1Q81C 4JCVE 1PH9A 2UUBL 4JOIC 4OONA 4C3HH 1HNZQ 4DV7L 4X66Q 2VQFL 1PH1A 5FJ8G 3CXCA 4DR6L 4LW1A 1L1OC 3RLFA 4JV5L 1VQMA 3HOVG 4LWCA 1YI2A 3KFUA 4BA2I 4QL5A 3A5UA 4A3GG 4LFAQ 3SGIA 2VUMH 4X64L 4DV6Q 2UXDL 1XMOQ 3CPFA 4LF5Q 1K3RA 1NTGA 2MFIA 1PH2A 1L1OA 4GOPC 1PH5A 1BVSA 3S2DH 4BY1H 4GKJL 1TXYA 1CKMA 2IHFA 1WYDA 1OXVA 1IBKL 4R4OA 1TWHH 1Y1VH 4HJAA 1J5EQ 1XNRL 2K5HA 1NE3A 3OW2A 1SMXA 1YITA 4A3EH 1AE2A 4BBRH 4O2DA 1XMQL 1EIYB 3H3VI 4R4IA 4DR5L 3GTOH 1QVCA 3EIVA 2LXJA 2PI2A 5IYBH 4JI0L 4LUOA 4JI6Q 1VQ6A 3PIOA 3I55A 4A4IA 3CCVA 2CWAA 2GVBA 2IY5B 3HOXH 3IRBA 5ELOA 1I5FA 3K7UC 2B29A 3F2BA 1N32Q 2EXDA 2UXCQ 1YBYA 1AE3A 1E7ZA 2JQOA 3PUVA 1KRTA 3CCUA 3K80C 2KCTA 4UPAA 1VQOA 4GN3B 1VQLA 4JG2A 3VDYA 2RCNA 3HOYG 4POGA 5FJ8H 3CCRA 3CD6A 4B3SL 4IPHA 4O0AA 3HOVH 2QGQA 4A3GH 4NPSA 3T1YQ 3U4VA 2CKZB 1PVOA 4HIDA 4B3MQ 2WB1E 3ICEA 2JA7G 1A0IA 2E5LQ 4DV3L 4DR1L 1HJPA 1X56A 4GKKL 4DV2L 3KYHC 3AQQA 3ZJYC 3UDXA 5LMNW 3CF5A 4A3FG 1YIJA 1B70B 3GTJH 1VQAA 1VQ4A 2Q2UA 2K4KA 1N36L 2UU9Q 4OX9L 2RHSB 1WI5A 2F4VL 4K0KL 5IP7H 2XGTA 4JYAQ 3E9HA 4GLAC 2AWNA 4P71A 4P74A 1Q82C 4L5RC 5K36G 3CP0A 3MXNB 4DR3L 3CW2C 4OXPA 4HJ5A 3PF5A 2A8VA 2V1CC 3U4ZA 1IYJB 4YCWA 4DK3C 1X9NA 1VS0A 1VQEA 3AYHB 2WAQG 1IBLQ 1VQGA 1XPRA 3S1RH 1K8AC 4X66L 1HNZL 1EFWA 4R4QA 4GLXA 1K8GA 3I56A 1XPUA 4WJ3M 1EYGA 2GN5A 4YHHQ 3CMAA 4AYBE 4LFAL 1IL2A 3KF6B 1BBUA 1S3OA 1HNWQ 1XMOL 2UXBQ 4PG3A 1VQ9A 2JA5G 4LF5L 3HOYH 3CC7A 3G48A 3GTLH 1VQJA 3EBEA 5M3FG 1N33L 4IOAA 3D0FA 1Q46A 4JBJA 3F8TA 1X3EA 2HT1A 1MJCA 5M5XH 1Y14B 2NVYH 1J5EL 3L0OA 1E22A 3KDFB 2JA7H 4JC0A 1VQ8A 1QVFA 2F52A 2R6GA 2VS1A 1UE5A 2CWPA 4YCVA 2ZTEA 3J7A5 4A3FH 3LGJA 1PA6A 2KENA 1T9HA 4JI5Q 4IPGA 4JI7Q 2D62A 3ULLA 4BXXG 1CSQA 4C3IH 4JI6L 1WCMG 3ULPA 4QJFA 1LTLA 3KF6A 2QA4A 1U0LA 4A76A 2KHJA 1YZ6A 4XIGS 2KBNA 5HGQA 1N32L 2UXCL 1KAWA 4GN5A 2HIXA 3D31A 1JJCB 3PGZA 4H02A 4KLKA 4UP9A 1YJWA 3HKSA 1M1KC 3CMEA 2R7ZG 5DLQE 4DUYQ 2ES2A 3TS2A 3S1MH 4Y52H 4AH6A 2DUDA 4UP7A 1MIUA 1E3PA 2HIVA 1X65A 3T1YL 4A3KG 1KHIA 4B3ML 4A3EG 3M4PA 2OQKA 1A62A 4OWTB 2E5LL 5IYDG 2JA5H 3A0JA 3BZCA 2ZJQA 3B6YA 1JE5A 4IJLA 5M3FH 1WJJA 2PMZE 4QY7A 3CPWA 2UU9L 5J3BA 1JB7A 2YTXA 1L1OB 3PUXA 4MNOA 2MQHA 3HOXG 1VQNA 4YWKA 4JYAL 2YTVA 5LMUQ 1X6OA 2K14A 2LSSA 2UUCQ 4LF6Q 4L5QA 3STBC 4BXXH 2Z6KA 2HQLA 1N34Q 1WCMH 4YY3L 1IBLL 3HFZB 3K81C 3L2PA 1B8AA 3CAMA 5M5YH 3JAMi 4JI2Q 4HJ9A 2N8NA 1VQKA 4DNIA 4JI4Q 1W2BA 2AMCB 2IX1A 4GS3A 1EQQA 3RLNA 4OWXB 4YHHL 2K5NA 4WJ4A 4JOIA 4DR4Q 1Q86C 4YCUA 1Q1BA 2R92G 2R7ZH 1HNWL 2NN6I 2UXBL 1SR3A 1UEBA 2MNAA 2K50A 5LMNQ 4L5SA 1D8LA 1A8VA 1GKHA 3M4QA 4NB3A 3I2ZA 3J80i 3WWVA 3F1ZA 2VW9A 5IP7G 4RG1A 4P72A 4A3KH 4LF4Q 1MKHA 2N78A 1FJGQ 3PF4A 2Y0SG 3U58A 3M7NA 1V1QA 2OQ0A 4GOPA 3GTPH 5IYDH 1A63A 4BA1I 1YHQA 4IO9A 2B63G 1G291 3H15A 1L2FA 2E2JH 3S1QH 3GTGH 1VQ5A 4JI5L 4TVAB 2F3IA 1N9WA 4JI7L 1XPOA 3H3VH 1RIPA 1OXTA 1DGSA 3GD7A 2DGYA 1R9TH 1HZCA 2ASBA 4FDBA 3HOWG 5AJ3Q 2I5MX 3A5ZB 1GM5A 4BY7G 3JC66 4DUYL 3AFQA 4P73A 2OCEA 3UDIA 1JMCA 2JA8G 3F2DA 1QZHA 1VQIA 4EX5A 2H5XA 4A3CG 1UE7A 1X54A 3T1HQ 1LYLA 3M85A 4IPDA 1Z9FA 1JJ2A 3W5OA 2IHEA 2JK8A 2R92H 5GQOA 1KRSA 4X62Q 1EIFA 3RZOH 3I7FA 1E24A 4HIOA 3J81i 1I94Q 3PUWA 5H1SE 1YJNA 1B7YB 3RR5A 5IYCH 2JA9A 4LF8Q 1UWVA 5E7NA 1YJ9A 3HOZH 2NZOA 1HNXQ 5JEAJ 5LMUL 1FVIA 2NZHA 1KXLA 3FKIG 1SE8A 2CCZA 3AFPA 4C3JH 4P75A 2B63H 3KLWA 5C4XH 2UUCL 4LF6L 2NVQH 2E2HH 4A3DG 1C0AA 1N34L 3HOUG 4GNXC 3STBD 5IWAQ 2ID0A 4JI2L 1E1OA 4GLVB 4NXMQ 2PQAA 1YHBA 4PZ7A 4JI4L 4LF7Q 3H0GG 3BU2A 3NELA 3GTKH 4MTNA 2KCMA 3HOWH 3E0EA 2AHOB 4DV6L 4GN4B 4DR4L 1TWAH 4A3JG 2ZJPA 4KI0A 4GNXA 4KHZA 1SROA 4AIMA 4BY7H 3CCJA 5LMNL 1NBWA 3CCEA 2JA8H 4LNQA 2MO0A 2MO1A 4A3CH 4A93G 2LXKA 2CQOA 4LFCQ 1KQSA 1X55A 1Z47A 4LF4L 2OWOA 1FJGL 3DM3A 1L0WA 1KC8C 4LF9Q 2KHIA 1OTCA 3CCLA 3L7ZC 4LFBQ 3S15H 2YV5A 4DV4Q 1KD1C 1W3SA 4DR7Q 3ERSX 1K0RA 1J6QA 4DPGA 2UXDQ 4IFDI 4DV5Q 5IY0A 3RNUA 1X3GA 1YHAA 2XTIA 3E9IA 3PUYA 1TWGH 4JBMA 2R7FA 4IJHA 2YTYA 3FKIH 5C4JH 4GKJQ 2A1AA 2OTJA 5C0XI 1HZAA 4KHPQ 2VNUD 1RL2A 4DUZQ 4A3DH 3HOUH 1VQCA 2WFWA 4R4TA 1FL0A 1Q12A 1C9OA 2GVAA 3RZDH 1SLJA 3FP9A 2WB1G 3ER0A 1WOCA 1V9PA 4UP8A 1XMQQ 3H0GH 1TWFH 3KJOA 2NN6G 3T1HL 1VQPA 2QEXA 4ME3A 4PMWA 4Y7NH 1U5KA 1VQFA 4A3JH 1M90C 1IBMQ 1EUJA 4X62L 1N8RC 4OWWB 1YNXA 3CQZH 3I4OA 5GAGC 1I94L 4QGUA 1PHJA 1YEZA 3BZKA 3S17H 4DV0Q 4A93H 1Y1WG 5JJIA 1P8LA 3U50C 3CCQA 4LF8L 4DR2Q 1EOVA 1SRUA 4R1JA 4XTCS 2Z0SA 3MEFA 1X3FA 1HNXL 1GVPA 1PV4A 2K75A 1SN8A 4X6AH 1VQBA 3K7AH 4GOPB 2Q2TA 1AH9A 3I4NH 4AYBG 1TWCH 1P16A 5M5WH 4NXML 2I5LX 4LF7L 1I50H 1HZBA 3ULJA 4A3LG 2HHHQ 4TQUS 1H95A 5FLXc 1OXUA 3KOJA 1EQRA 1PH3A 3A74A 4POFA 3TRZA 1CKOA 4A3IG 2WP8J 3K0XA 2ATWA 2JA6G 4DV1Q 5IYCG 4LFCL 3HKZE 2R93G 3HOZG 2ZM6Q 2E8GA 4APVA 4X65Q 1NMGA 3NBHB 3CC4A 2NVTH 4LF9L 1PH4A 1EWIA 1G6PA 5C4XG 2A19A 5GROA 4LFBL 2WAQE 3F2CA 4DV4L 2RHQB 2BA1A 4DR7L 4B3RQ 1Y1WH 3GO5A 1QZGA 3OYYA 4UY8C 1PYBA 3TS0A 2EQSA 5FLMG 1K83H 4DV5L 1D7QA 4B3TQ 4PZ6A 1HH2P 4BBSG 1Q7YC 1N33Q 2Q2HA 4OO1I 4KHPL 4HJ8A 1GD7A 4DUZL 3GTMH 2VQEQ 1JT8A 5GAHC 4JI8Q 2JEBI 3GDEA 4HIMA 1CSPA 2FXQA 1VCIA 1IXRA 4PZ8A 1VQ7A 2UUAQ 3CC2A 1SFOH 4A3LH 1NMFA 4JI1Q 1BKBA 2IT1A 1XNQQ 2ZJRA 2PQAB 5GADC 3RN2A 1IBML 3UE0A 3TREA 2E2IH 4A3BG 1BBWA 4NXNQ 1QUQB 2EIFA 4J15A 5BR8Q 5IT9c 2I0QA 2K52A 2ZTDA 5JEAG 1V43A 4A3IH 4JI3Q 2JA6H 4GNXB 1I6HH 4MZ9A 4DV0L 2R93H 2D0PA 3GTQH 1I3QH 4L5TA 5IP9G 4EQ5A 4DR2L 4AQYQ 1MJEA 1PH8A 2BA0A 3TQYA 3M3YH 4YWLA 3S1NH 4IFDG 2N3SA 3EN2A 3PCOB 5M3MG 2R7DA 3M4OH 5FLMH 4LUVA 1XTDA 3S14H 4IPCA 5C0XG 1PFSA 4IFDJ 1FGUA 1E1TA 4YWMA 3S16H 3UDFA 3NENA 4BBSH 1QUQA 2IX0A 1K73C 2VY3A 5C3EG 3PO2G 2HHHL 1VQDA 5C0XJ 3S24A 3OTOQ 3KJPA 2CFMA 1UE1A 1Q8KA 1WFQA 1YVCA 2AKWB 4DAMA 3HKZG 1LUZA 1HR0Q 2OTLA 2VL6A 1GO3E 2JJQA 4DV1L 5JJLA 1K9MC 2UUBQ 3UE1A 5JJKA 2ALYB 4DV7Q 2VQFQ 4YY3Q 2ZM6L 4X65L 3J81j 4A3BH 4DR6Q 3W1BA 5GAEC 1UE6A 4JV5Q 5ELNA 3G71A 1PH6A 1JJGA 2RF4A 3BJUA 1CKNB 2PNHA 4X64Q 4QIWE 4B3RL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N G;  1HZ9 A;  3PO3 G;  1CUK A;  3W1G A;  3I4M G;  4DKA C;  3JAM c;  5IP9 H;  3RLO A;  4B3T L;  3TEH B;  2PI2 E;  1S72 A;  1QVG A;  5AJ3 L;  2JE6 I;  1IBK Q;  4A3M G;  1XNR Q;  1LM0 A;  3AEV A;  2ZTC A;  5M3M H;  2D0O A;  2VQE L;  5C44 G;  1S40 A;  3PSI A;  4JI8 L;  1G51 A;  1O7I A;  3CCM A;  4DR5 Q;  4JBK A;  4IOC A;  3K8A A;  2BH2 A;  5HY6 A;  2UUA L;  1VQH A;  3J80 c;  4JI0 Q;  2Y0S E;  5C3E H;  3PO2 H;  4JI1 L;  1Q1E A;  1CKN A;  1XNQ L;  3G6E A;  2YU9 H;  1PYS B;  3Q8D A;  4NXN L;  4RMF A;  2VZA A;  4DK6 C;  5BR8 L;  1HR0 W;  4JI3 L;  3J7Z C;  2VUM G;  4DAY B;  3FHW A;  3M9B A;  3G4S A;  3CCS A;  4HJ7 A;  1PH7 A;  5EAY A;  4A75 A;  4QQB X;  4AQY L;  4JBW A;  2N49 A;  1OXX K;  1KIX A;  3KDF A;  4BY1 G;  4B3S Q;  1ASY A;  2I5H A;  3PIP A;  1Y1V G;  3PV0 A;  2JEA I;  3PO3 H;  4DV3 Q;  4ALP A;  2YYZ A;  5IWA L;  4DR1 Q;  4BBR G;  4DV2 Q;  3I4M H;  4GKK Q;  4OO1 G;  1ASZ A;  4C2M H;  4HIK A;  2C35 B;  3UDG A;  2AWO A;  1NJI C;  1OXS C;  3NEM A;  3S2H H;  5IYB G;  1N36 Q;  1XJV A;  4A3M H;  1NY4 A;  4R4C A;  4OX9 Q;  2F4V Q;  1IZ6 A;  2Z6K C;  4K0K Q;  1KL9 A;  2L15 A;  3KF8 B;  5IE8 A;  2Q2I A;  3OTO L;  5C44 H;  2K5V A;  1C7Y A;  2BH8 A;  3J81 c;  4DR3 Q;  2B3G A;  3RN5 A;  2NVX H;  4LUZ A;  3PUZ A;  3DLL A;  1HR0 L;  1Q81 C;  4JCV E;  1PH9 A;  2UUB L;  4JOI C;  4OON A;  4C3H H;  1HNZ Q;  4DV7 L;  4X66 Q;  2VQF L;  1PH1 A;  5FJ8 G;  3CXC A;  4DR6 L;  4LW1 A;  1L1O C;  3RLF A;  4JV5 L;  1VQM A;  3HOV G;  4LWC A;  1YI2 A;  3KFU A;  4BA2 I;  4QL5 A;  3A5U A;  4A3G G;  4LFA Q;  3SGI A;  2VUM H;  4X64 L;  4DV6 Q;  2UXD L;  1XMO Q;  3CPF A;  4LF5 Q;  1K3R A;  1NTG A;  2MFI A;  1PH2 A;  1L1O A;  4GOP C;  1PH5 A;  1BVS A;  3S2D H;  4BY1 H;  4GKJ L;  1TXY A;  1CKM A;  2IHF A;  1WYD A;  1OXV A;  1IBK L;  4R4O A;  1TWH H;  1Y1V H;  4HJA A;  1J5E Q;  1XNR L;  2K5H A;  1NE3 A;  3OW2 A;  1SMX A;  1YIT A;  4A3E H;  1AE2 A;  4BBR H;  4O2D A;  1XMQ L;  1EIY B;  3H3V I;  4R4I A;  4DR5 L;  3GTO H;  1QVC A;  3EIV A;  2LXJ A;  2PI2 A;  5IYB H;  4JI0 L;  4LUO A;  4JI6 Q;  1VQ6 A;  3PIO A;  3I55 A;  4A4I A;  3CCV A;  2CWA A;  2GVB A;  2IY5 B;  3HOX H;  3IRB A;  5ELO A;  1I5F A;  3K7U C;  2B29 A;  3F2B A;  1N32 Q;  2EXD A;  2UXC Q;  1YBY A;  1AE3 A;  1E7Z A;  2JQO A;  3PUV A;  1KRT A;  3CCU A;  3K80 C;  2KCT A;  4UPA A;  1VQO A;  4GN3 B;  1VQL A;  4JG2 A;  3VDY A;  2RCN A;  3HOY G;  4POG A;  5FJ8 H;  3CCR A;  3CD6 A;  4B3S L;  4IPH A;  4O0A A;  3HOV H;  2QGQ A;  4A3G H;  4NPS A;  3T1Y Q;  3U4V A;  2CKZ B;  1PVO A;  4HID A;  4B3M Q;  2WB1 E;  3ICE A;  2JA7 G;  1A0I A;  2E5L Q;  4DV3 L;  4DR1 L;  1HJP A;  1X56 A;  4GKK L;  4DV2 L;  3KYH C;  3AQQ A;  3ZJY C;  3UDX A;  5LMN W;  3CF5 A;  4A3F G;  1YIJ A;  1B70 B;  3GTJ H;  1VQA A;  1VQ4 A;  2Q2U A;  2K4K A;  1N36 L;  2UU9 Q;  4OX9 L;  2RHS B;  1WI5 A;  2F4V L;  4K0K L;  5IP7 H;  2XGT A;  4JYA Q;  3E9H A;  4GLA C;  2AWN A;  4P71 A;  4P74 A;  1Q82 C;  4L5R C;  5K36 G;  3CP0 A;  3MXN B;  4DR3 L;  3CW2 C;  4OXP A;  4HJ5 A;  3PF5 A;  2A8V A;  2V1C C;  3U4Z A;  1IYJ B;  4YCW A;  4DK3 C;  1X9N A;  1VS0 A;  1VQE A;  3AYH B;  2WAQ G;  1IBL Q;  1VQG A;  1XPR A;  3S1R H;  1K8A C;  4X66 L;  1HNZ L;  1EFW A;  4R4Q A;  4GLX A;  1K8G A;  3I56 A;  1XPU A;  4WJ3 M;  1EYG A;  2GN5 A;  4YHH Q;  3CMA A;  4AYB E;  4LFA L;  1IL2 A;  3KF6 B;  1BBU A;  1S3O A;  1HNW Q;  1XMO L;  2UXB Q;  4PG3 A;  1VQ9 A;  2JA5 G;  4LF5 L;  3HOY H;  3CC7 A;  3G48 A;  3GTL H;  1VQJ A;  3EBE A;  5M3F G;  1N33 L;  4IOA A;  3D0F A;  1Q46 A;  4JBJ A;  3F8T A;  1X3E A;  2HT1 A;  1MJC A;  5M5X H;  1Y14 B;  2NVY H;  1J5E L;  3L0O A;  1E22 A;  3KDF B;  2JA7 H;  4JC0 A;  1VQ8 A;  1QVF A;  2F52 A;  2R6G A;  2VS1 A;  1UE5 A;  2CWP A;  4YCV A;  2ZTE A;  3J7A 5;  4A3F H;  3LGJ A;  1PA6 A;  2KEN A;  1T9H A;  4JI5 Q;  4IPG A;  4JI7 Q;  2D62 A;  3ULL A;  4BXX G;  1CSQ A;  4C3I H;  4JI6 L;  1WCM G;  3ULP A;  4QJF A;  1LTL A;  3KF6 A;  2QA4 A;  1U0L A;  4A76 A;  2KHJ A;  1YZ6 A;  4XIG S;  2KBN A;  5HGQ A;  1N32 L;  2UXC L;  1KAW A;  4GN5 A;  2HIX A;  3D31 A;  1JJC B;  3PGZ A;  4H02 A;  4KLK A;  4UP9 A;  1YJW A;  3HKS A;  1M1K C;  3CME A;  2R7Z G;  5DLQ E;  4DUY Q;  2ES2 A;  3TS2 A;  3S1M H;  4Y52 H;  4AH6 A;  2DUD A;  4UP7 A;  1MIU A;  1E3P A;  2HIV A;  1X65 A;  3T1Y L;  4A3K G;  1KHI A;  4B3M L;  4A3E G;  3M4P A;  2OQK A;  1A62 A;  4OWT B;  2E5L L;  5IYD G;  2JA5 H;  3A0J A;  3BZC A;  2ZJQ A;  3B6Y A;  1JE5 A;  4IJL A;  5M3F H;  1WJJ A;  2PMZ E;  4QY7 A;  3CPW A;  2UU9 L;  5J3B A;  1JB7 A;  2YTX A;  1L1O B;  3PUX A;  4MNO A;  2MQH A;  3HOX G;  1VQN A;  4YWK A;  4JYA L;  2YTV A;  5LMU Q;  1X6O A;  2K14 A;  2LSS A;  2UUC Q;  4LF6 Q;  4L5Q A;  3STB C;  4BXX H;  2Z6K A;  2HQL A;  1N34 Q;  1WCM H;  4YY3 L;  1IBL L;  3HFZ B;  3K81 C;  3L2P A;  1B8A A;  3CAM A;  5M5Y H;  3JAM i;  4JI2 Q;  4HJ9 A;  2N8N A;  1VQK A;  4DNI A;  4JI4 Q;  1W2B A;  2AMC B;  2IX1 A;  4GS3 A;  1EQQ A;  3RLN A;  4OWX B;  4YHH L;  2K5N A;  4WJ4 A;  4JOI A;  4DR4 Q;  1Q86 C;  4YCU A;  1Q1B A;  2R92 G;  2R7Z H;  1HNW L;  2NN6 I;  2UXB L;  1SR3 A;  1UEB A;  2MNA A;  2K50 A;  5LMN Q;  4L5S A;  1D8L A;  1A8V A;  1GKH A;  3M4Q A;  4NB3 A;  3I2Z A;  3J80 i;  3WWV A;  3F1Z A;  2VW9 A;  5IP7 G;  4RG1 A;  4P72 A;  4A3K H;  4LF4 Q;  1MKH A;  2N78 A;  1FJG Q;  3PF4 A;  2Y0S G;  3U58 A;  3M7N A;  1V1Q A;  2OQ0 A;  4GOP A;  3GTP H;  5IYD H;  1A63 A;  4BA1 I;  1YHQ A;  4IO9 A;  2B63 G;  1G29 1;  3H15 A;  1L2F A;  2E2J H;  3S1Q H;  3GTG H;  1VQ5 A;  4JI5 L;  4TVA B;  2F3I A;  1N9W A;  4JI7 L;  1XPO A;  3H3V H;  1RIP A;  1OXT A;  1DGS A;  3GD7 A;  2DGY A;  1R9T H;  1HZC A;  2ASB A;  4FDB A;  3HOW G;  5AJ3 Q;  2I5M X;  3A5Z B;  1GM5 A;  4BY7 G;  3JC6 6;  4DUY L;  3AFQ A;  4P73 A;  2OCE A;  3UDI A;  1JMC A;  2JA8 G;  3F2D A;  1QZH A;  1VQI A;  4EX5 A;  2H5X A;  4A3C G;  1UE7 A;  1X54 A;  3T1H Q;  1LYL A;  3M85 A;  4IPD A;  1Z9F A;  1JJ2 A;  3W5O A;  2IHE A;  2JK8 A;  2R92 H;  5GQO A;  1KRS A;  4X62 Q;  1EIF A;  3RZO H;  3I7F A;  1E24 A;  4HIO A;  3J81 i;  1I94 Q;  3PUW A;  5H1S E;  1YJN A;  1B7Y B;  3RR5 A;  5IYC H;  2JA9 A;  4LF8 Q;  1UWV A;  5E7N A;  1YJ9 A;  3HOZ H;  2NZO A;  1HNX Q;  5JEA J;  5LMU L;  1FVI A;  2NZH A;  1KXL A;  3FKI G;  1SE8 A;  2CCZ A;  3AFP A;  4C3J H;  4P75 A;  2B63 H;  3KLW A;  5C4X H;  2UUC L;  4LF6 L;  2NVQ H;  2E2H H;  4A3D G;  1C0A A;  1N34 L;  3HOU G;  4GNX C;  3STB D;  5IWA Q;  2ID0 A;  4JI2 L;  1E1O A;  4GLV B;  4NXM Q;  2PQA A;  1YHB A;  4PZ7 A;  4JI4 L;  4LF7 Q;  3H0G G;  3BU2 A;  3NEL A;  3GTK H;  4MTN A;  2KCM A;  3HOW H;  3E0E A;  2AHO B;  4DV6 L;  4GN4 B;  4DR4 L;  1TWA H;  4A3J G;  2ZJP A;  4KI0 A;  4GNX A;  4KHZ A;  1SRO A;  4AIM A;  4BY7 H;  3CCJ A;  5LMN L;  1NBW A;  3CCE A;  2JA8 H;  4LNQ A;  2MO0 A;  2MO1 A;  4A3C H;  4A93 G;  2LXK A;  2CQO A;  4LFC Q;  1KQS A;  1X55 A;  1Z47 A;  4LF4 L;  2OWO A;  1FJG L;  3DM3 A;  1L0W A;  1KC8 C;  4LF9 Q;  2KHI A;  1OTC A;  3CCL A;  3L7Z C;  4LFB Q;  3S15 H;  2YV5 A;  4DV4 Q;  1KD1 C;  1W3S A;  4DR7 Q;  3ERS X;  1K0R A;  1J6Q A;  4DPG A;  2UXD Q;  4IFD I;  4DV5 Q;  5IY0 A;  3RNU A;  1X3G A;  1YHA A;  2XTI A;  3E9I A;  3PUY A;  1TWG H;  4JBM A;  2R7F A;  4IJH A;  2YTY A;  3FKI H;  5C4J H;  4GKJ Q;  2A1A A;  2OTJ A;  5C0X I;  1HZA A;  4KHP Q;  2VNU D;  1RL2 A;  4DUZ Q;  4A3D H;  3HOU H;  1VQC A;  2WFW A;  4R4T A;  1FL0 A;  1Q12 A;  1C9O A;  2GVA A;  3RZD H;  1SLJ A;  3FP9 A;  2WB1 G;  3ER0 A;  1WOC A;  1V9P A;  4UP8 A;  1XMQ Q;  3H0G H;  1TWF H;  3KJO A;  2NN6 G;  3T1H L;  1VQP A;  2QEX A;  4ME3 A;  4PMW A;  4Y7N H;  1U5K A;  1VQF A;  4A3J H;  1M90 C;  1IBM Q;  1EUJ A;  4X62 L;  1N8R C;  4OWW B;  1YNX A;  3CQZ H;  3I4O A;  5GAG C;  1I94 L;  4QGU A;  1PHJ A;  1YEZ A;  3BZK A;  3S17 H;  4DV0 Q;  4A93 H;  1Y1W G;  5JJI A;  1P8L A;  3U50 C;  3CCQ A;  4LF8 L;  4DR2 Q;  1EOV A;  1SRU A;  4R1J A;  4XTC S;  2Z0S A;  3MEF A;  1X3F A;  1HNX L;  1GVP A;  1PV4 A;  2K75 A;  1SN8 A;  4X6A H;  1VQB A;  3K7A H;  4GOP B;  2Q2T A;  1AH9 A;  3I4N H;  4AYB G;  1TWC H;  1P16 A;  5M5W H;  4NXM L;  2I5L X;  4LF7 L;  1I50 H;  1HZB A;  3ULJ A;  4A3L G;  2HHH Q;  4TQU S;  1H95 A;  5FLX c;  1OXU A;  3KOJ A;  1EQR A;  1PH3 A;  3A74 A;  4POF A;  3TRZ A;  1CKO A;  4A3I G;  2WP8 J;  3K0X A;  2ATW A;  2JA6 G;  4DV1 Q;  5IYC G;  4LFC L;  3HKZ E;  2R93 G;  3HOZ G;  2ZM6 Q;  2E8G A;  4APV A;  4X65 Q;  1NMG A;  3NBH B;  3CC4 A;  2NVT H;  4LF9 L;  1PH4 A;  1EWI A;  1G6P A;  5C4X G;  2A19 A;  5GRO A;  4LFB L;  2WAQ E;  3F2C A;  4DV4 L;  2RHQ B;  2BA1 A;  4DR7 L;  4B3R Q;  1Y1W H;  3GO5 A;  1QZG A;  3OYY A;  4UY8 C;  1PYB A;  3TS0 A;  2EQS A;  5FLM G;  1K83 H;  4DV5 L;  1D7Q A;  4B3T Q;  4PZ6 A;  1HH2 P;  4BBS G;  1Q7Y C;  1N33 Q;  2Q2H A;  4OO1 I;  4KHP L;  4HJ8 A;  1GD7 A;  4DUZ L;  3GTM H;  2VQE Q;  1JT8 A;  5GAH C;  4JI8 Q;  2JEB I;  3GDE A;  4HIM A;  1CSP A;  2FXQ A;  1VCI A;  1IXR A;  4PZ8 A;  1VQ7 A;  2UUA Q;  3CC2 A;  1SFO H;  4A3L H;  1NMF A;  4JI1 Q;  1BKB A;  2IT1 A;  1XNQ Q;  2ZJR A;  2PQA B;  5GAD C;  3RN2 A;  1IBM L;  3UE0 A;  3TRE A;  2E2I H;  4A3B G;  1BBW A;  4NXN Q;  1QUQ B;  2EIF A;  4J15 A;  5BR8 Q;  5IT9 c;  2I0Q A;  2K52 A;  2ZTD A;  5JEA G;  1V43 A;  4A3I H;  4JI3 Q;  2JA6 H;  4GNX B;  1I6H H;  4MZ9 A;  4DV0 L;  2R93 H;  2D0P A;  3GTQ H;  1I3Q H;  4L5T A;  5IP9 G;  4EQ5 A;  4DR2 L;  4AQY Q;  1MJE A;  1PH8 A;  2BA0 A;  3TQY A;  3M3Y H;  4YWL A;  3S1N H;  4IFD G;  2N3S A;  3EN2 A;  3PCO B;  5M3M G;  2R7D A;  3M4O H;  5FLM H;  4LUV A;  1XTD A;  3S14 H;  4IPC A;  5C0X G;  1PFS A;  4IFD J;  1FGU A;  1E1T A;  4YWM A;  3S16 H;  3UDF A;  3NEN A;  4BBS H;  1QUQ A;  2IX0 A;  1K73 C;  2VY3 A;  5C3E G;  3PO2 G;  2HHH L;  1VQD A;  5C0X J;  3S24 A;  3OTO Q;  3KJP A;  2CFM A;  1UE1 A;  1Q8K A;  1WFQ A;  1YVC A;  2AKW B;  4DAM A;  3HKZ G;  1LUZ A;  1HR0 Q;  2OTL A;  2VL6 A;  1GO3 E;  2JJQ A;  4DV1 L;  5JJL A;  1K9M C;  2UUB Q;  3UE1 A;  5JJK A;  2ALY B;  4DV7 Q;  2VQF Q;  4YY3 Q;  2ZM6 L;  4X65 L;  3J81 j;  4A3B H;  4DR6 Q;  3W1B A;  5GAE C;  1UE6 A;  4JV5 Q;  5ELN A;  3G71 A;  1PH6 A;  1JJG A;  2RF4 A;  3BJU A;  1CKN B;  2PNH A;  4X64 Q;  4QIW E;  4B3R L; 
#chains in the Genus database with same CATH topology
 3PO3 G;  1CUK A;  4E6I A;  4FVM A;  5EPK A;  3MXU A;  1KDC A;  2PI2 E;  1TS3 A;  1SBB B;  3MXN A;  1UNS A;  1JWS D;  1XNR Q;  1LM0 A;  1GUW A;  5M3M H;  2VQE L;  2C9O A;  4RCN A;  5C44 G;  1S40 A;  1TS4 A;  3BDC A;  4DR5 Q;  3K8A A;  2NVT B;  5C3E H;  5KNC A;  3G6E A;  2F03 A;  1K83 B;  4JI3 L;  1EIH A;  1EEF D;  3M9B A;  3G4S A;  3CCS A;  1F9R A;  2F3W A;  4QQB X;  4LK1 C;  4RKB A;  1KLU D;  2B2U A;  4AQY L;  2PW5 A;  2N49 A;  1IW7 D;  2F4I A;  4BY1 G;  4AYB B;  4WOR A;  3PIP A;  5FKA C;  3C46 A;  4NW2 A;  5EKK A;  2YYZ A;  5IWA L;  5JVG 3;  4DV2 Q;  3CRK C;  4K8I A;  2DNC A;  2E76 C;  3UDG A;  4DU9 A;  2RDG A;  5ELF A;  2F0F A;  4A3M H;  1I6H B;  2F4V Q;  1IZ6 A;  2Z6K C;  2JA6 B;  1E2W A;  2L15 A;  5IE8 A;  4K0K Q;  2R93 B;  3MZ5 A;  1EY7 A;  2EOT A;  4DR3 Q;  1Q81 C;  3ITP A;  1IYU A;  2B2V C;  2UUB L;  4OON A;  1STH A;  1PH1 A;  3CXC A;  5LL6 X;  4LW1 A;  1L1O C;  4R8I A;  3RLF A;  3S14 B;  3HOV G;  3SGI A;  4JK1 C;  2UXD L;  5I6Y A;  1B3Q A;  2VXW A;  1S5E D;  1PH5 A;  4KV6 A;  1EY5 A;  1EY0 A;  1TXY A;  5D14 A;  3RMH A;  3AMU A;  1A3U A;  1LT4 D;  2K5H A;  4HTH A;  1AE2 A;  5C3W A;  4OO1 H;  2K03 A;  3GTO H;  1XWE A;  2PI2 A;  4P2C B;  1VQ6 A;  2CWA A;  5KNB A;  2IY5 B;  1BBX C;  1I5F A;  4HR7 B;  5A35 A;  5EBD A;  1YBY A;  3PUV A;  2JQO A;  2AQ3 B;  3K80 C;  3N6R A;  3BDO A;  2K04 A;  4QB4 A;  3BG3 A;  4B3S L;  4O0A A;  5CYU A;  2RVL A;  1LLR D;  3G7L A;  1PVO A;  1SE2 A;  1KNA A;  4DV3 L;  4DR1 L;  1X56 A;  4GKK L;  1S5D D;  3ZJY C;  4F7X A;  5HUR A;  3CF5 A;  3OWE B;  4IN3 A;  1N36 L;  2RHS B;  2XGT A;  1A15 A;  5C6A A;  3OOC A;  4P71 A;  1RHP A;  1JOK A;  1PZK D;  1GUT A;  4G7O C;  1I4H A;  2A8V A;  1IYJ B;  4DK3 C;  1X9N A;  1M4V A;  1K8A C;  3S1R H;  4X66 L;  3TP6 A;  1FGB D;  4R4Q A;  3ND9 A;  4WJ3 M;  1EYG A;  1WVL A;  3CMA A;  1ILQ A;  4AYB E;  4ZLT F;  1B44 D;  4N8F A;  3HZX A;  3NXW A;  1H9R A;  3P7J A;  4PG3 A;  1VQ9 A;  4LF5 L;  5DM6 3;  4IOA A;  4RGN A;  3D0F A;  1Q46 A;  2B2Y C;  3HG9 A;  2NVX B;  3TZU A;  5M5X H;  1CQF A;  3KDF B;  1QWY A;  1ZYR D;  2KCN A;  2R6G A;  4C3H B;  2ZTE A;  1T9H A;  4I7A A;  4JI5 Q;  1YNN C;  1CSQ A;  4QJF A;  2VUM B;  3KF6 A;  1BO0 A;  1U0L A;  2NB0 A;  2ZXR A;  5K36 H;  3CU7 A;  5HGQ A;  1BF4 A;  4G7Z C;  5CC4 A;  2QKI C;  3D31 A;  4H02 A;  3S2D B;  1F2L A;  1M1K C;  1A3T A;  1Y1V B;  3TS2 A;  3S1M H;  1MIU A;  4BBR B;  3QG1 A;  3T1Y L;  3OMC A;  1KHI A;  3DM1 A;  1WTP A;  4OWT B;  2E5L L;  1GHK A;  3A0J A;  1JE5 A;  4IJL A;  3HOX B;  2A69 D;  4FXG C;  5KYL A;  1L1O B;  4FP5 D;  3HOX G;  1I3Q B;  1BNZ A;  4UHV A;  3H3V C;  4ZUJ A;  4A3G B;  4K8J A;  2LS0 1;  3PMF A;  5M5Y H;  1VQK A;  4JI2 Q;  4ABN A;  2XWB B;  3P1H A;  1EQQ A;  3PIO 3;  1H9S A;  2R7Z H;  2NN6 I;  5J22 A;  4EQN A;  1DZ1 A;  1PTO C;  1GKH A;  3EJI A;  3F1Z A;  2IPK D;  1FJG Q;  3PF4 A;  4IO9 A;  2B63 G;  2E2J H;  2K5W A;  2NYZ D;  2A6E C;  5CBA E;  2F3I A;  1L0Y B;  3I8Z A;  1XPO A;  2ZT9 C;  4YIJ A;  2RKS A;  2EJM A;  1MD2 D;  1RIP A;  5CMD A;  3NTI A;  3VR4 A;  3D6W A;  1R9T H;  3HOY B;  1VMP A;  1HZC A;  2B8F A;  5EPJ A;  5EBC A;  1IL8 A;  4BY7 G;  2K5Q A;  3JC6 6;  4K5V A;  3F2D A;  1QZH A;  4PQX A;  4A3C G;  4FYD A;  1PZI D;  1JJ2 A;  1CI3 M;  2F0T A;  4A3F B;  2R92 H;  5GQO A;  1KRS A;  1EIF A;  5NUC A;  5IT9 E;  3RZO H;  3KK7 A;  3DEO A;  1RTN A;  1YJN A;  2OT2 A;  5IYC H;  4DXF A;  3OIP A;  2JA9 A;  4LF8 Q;  1OO9 B;  5E7N A;  4EQO A;  3HOZ H;  5JEA J;  5LMU L;  4ZCK A;  1DD2 A;  2WAQ B;  1U4L A;  3FKI G;  2CCZ A;  3AFP A;  4C3J H;  4P75 A;  5ISR A;  2UUC L;  3J7Y W;  1EFI D;  3BZD B;  2HCC A;  1B1Z A;  1C0A A;  3MC0 B;  1N34 L;  4GNX C;  3STB D;  2ID0 A;  2IL8 A;  5JOB A;  2PQA A;  1YHB A;  4PZ7 A;  4JI4 L;  4LF7 Q;  3H0G G;  2JA5 B;  4C2M B;  5M3F B;  1CK1 A;  4ID6 A;  1TWA H;  4KI0 A;  3CCJ A;  2JA8 H;  3CCE A;  2MO0 A;  2PZT A;  1CZW A;  4LFC Q;  3K5O A;  3DM3 A;  1L0W A;  1DCZ A;  1SYF A;  3L7Z C;  3S15 H;  4FXD A;  5J39 A;  4DR7 Q;  1RTO A;  4DPG A;  1Z6H A;  3PUY A;  3BVZ A;  4IJH A;  2YTY A;  2K01 A;  4GKJ Q;  2A1A A;  2EZV A;  3NE5 B;  3NWT A;  1R4P B;  1HTL D;  3NTH A;  4DUZ Q;  1Q12 A;  2GVA A;  4A3K B;  1MHW C;  1XMQ Q;  4F87 A;  2FHT A;  2AUJ D;  1VQP A;  1EL0 A;  2RQX A;  3BVM A;  4HCE A;  4RA8 A;  4MTK A;  1SNM A;  3VYU A;  4OWW B;  2B2U C;  3I91 A;  5GAG C;  4KN4 C;  4NDX A;  4QGU A;  3BZK A;  4A93 H;  4DGZ A;  5C5L A;  1I4Q A;  1Y1W G;  1UAP A;  3U50 C;  5J1Z A;  1EOV A;  1SRU A;  4XTC S;  1VF5 C;  2EJF C;  3K7A H;  2QCP X;  4GOP B;  2RDH A;  2Q2T A;  1PTO B;  1AN8 A;  1DJR D;  3LX0 A;  1TWC H;  3MVV A;  4DXG A;  1O7Y A;  2F0U A;  4DN4 M;  2K7V A;  3MAQ A;  4TQU S;  1OXU A;  4DAY A;  1FNV A;  2K05 A;  2ATW A;  1EY9 A;  3HKZ E;  3K0Y A;  1EWI A;  4XYO A;  1BDO A;  4L63 B;  4LFB L;  5C4X G;  2WAQ E;  1RCV D;  1G8Z D;  2G5D A;  1ENF A;  3OYY A;  3A54 A;  3HOW B;  3KF8 A;  1Q7Y C;  2Q2H A;  2MP1 A;  1TR5 A;  4KHP L;  1CTM A;  1GD7 A;  4KKU A;  3GTM H;  2VQE Q;  1T5E A;  2JEB I;  1CSP A;  1VCI A;  1IXR A;  4CJ0 B;  2D9U A;  1SFO H;  4A3L H;  2EDG A;  2KUM A;  3BVG A;  3RN2 A;  1IBM L;  3UE0 A;  4A3B G;  1BBW A;  1QUQ B;  4DK0 A;  4RWS C;  2ZTD A;  4JI3 Q;  4A3I H;  4GNX B;  1JOR A;  4XXE A;  5C4J B;  1AZP A;  1A6X A;  4H0L C;  4H44 C;  3DXJ C;  1I3Q H;  4L5T A;  1MJE A;  4QF4 A;  1QNU A;  3MEH A;  3ND8 A;  4AQY Q;  3HOU B;  4YWL A;  2L4N A;  3RZD B;  2PW7 A;  1Q3L A;  3PCO B;  1TY0 A;  5M3M G;  3A55 A;  4LUV A;  4A3J B;  1F9S A;  3S16 H;  4BBS H;  3S9W A;  3P75 A;  3CQZ B;  1YNJ D;  2VY3 A;  5C3E G;  3J80 L;  3WOF A;  1K73 C;  3E6Z X;  1VQD A;  3R2I A;  5TSS A;  2HHH L;  3S17 B;  3W3A A;  1SYG A;  3MFY A;  3KJP A;  1WFQ A;  1Q8K A;  1STE A;  1LUZ A;  2OTL A;  2VL6 A;  4DV1 L;  1K9M C;  3IFT A;  2UUB Q;  1STY A;  2ALY B;  2ZM6 L;  4CJ1 B;  3TP7 A;  1WTQ A;  3I4N B;  2L1B A;  5JEA H;  3BJU A;  2PNH A;  4WJW A;  1PFN A;  3D8G A;  3I4N G;  1JCK B;  1IHZ A;  3OMG A;  4G57 A;  3RLO A;  2HDL A;  2JSO A;  2WB1 B;  4RAU C;  4A3M G;  3IAY A;  2Z1C A;  3K5M A;  3CCM A;  4JBK A;  1HUN A;  2UUA L;  1VQH A;  2L12 A;  3J80 c;  5C5M A;  3E3X A;  1CKN A;  3Q8D A;  4XQQ A;  3TME A;  2A68 C;  5FK9 C;  4HJ7 A;  1PH7 A;  2MHV A;  2EXZ A;  1D6E C;  2K33 A;  4JBW A;  1KIX A;  4B3S Q;  1ASY A;  1D5X C;  3PV0 A;  1B9N A;  4DV3 Q;  4DR1 Q;  3I4M H;  4GKK Q;  4OO1 G;  5K5P A;  1HTP A;  3MTS A;  4C2M H;  1NJI C;  5G3L D;  1N36 Q;  3IKJ A;  1KNE A;  1JE4 A;  4IQZ A;  2K5V A;  1SND A;  5C4Z A;  3GTQ B;  3J81 c;  2B3G A;  4HSV A;  4JCV E;  3M3Y B;  3E0J A;  3C3L A;  3VA7 A;  1EQV A;  3FPU B;  4X66 Q;  4ZQ3 A;  2VQF L;  2Z4I A;  4JV5 L;  3KFU A;  4LWC A;  1YI2 A;  3D4R A;  4BA2 I;  4QL5 A;  3A5U A;  3OSO A;  4X64 L;  2PYK A;  4DV6 Q;  1O7L A;  4LF5 Q;  4TSS A;  2EYM A;  4GKJ L;  1WYD A;  1OXV A;  1IBK L;  1LTB D;  4R4O A;  1CZG A;  1NE3 A;  1YIT A;  3HRZ C;  3BDL A;  2L55 A;  2A6H C;  4O2D A;  1XMQ L;  3H3V I;  1H9M A;  1IYV A;  1QVC A;  5IYB H;  1EQT A;  3FEW X;  4A4I A;  2E2D C;  2EY6 A;  3MFG A;  1QCB D;  5ELO A;  2B29 A;  1E7Z A;  1SMY C;  3TP5 A;  2KCT A;  1SJE D;  3KLS X;  4POG A;  2F0S A;  1LTA D;  1F9Q A;  2BDN A;  2ICE C;  2NTT A;  5BN4 A;  4NPS A;  3T1Y Q;  5FOB B;  2WB1 E;  3KUP A;  1A2T A;  2E5L Q;  1ZXT A;  3PO2 B;  1PTO F;  3KYH C;  3AQQ A;  5LMN W;  3VR5 A;  2YU9 B;  1YIJ A;  1B70 B;  3EFX D;  2H1E A;  2NBF A;  1TY2 A;  2AWN A;  5K36 G;  3CP0 A;  2F0L A;  3CW2 C;  3H6M A;  3PF5 A;  1BCP D;  2QDB A;  4YCW A;  2L5T A;  3AYH B;  1PRT C;  1HNZ L;  1K8G A;  1NCV A;  1XPU A;  3PO3 B;  1ONL A;  2RDF A;  2J4X A;  5M9O A;  1IL2 A;  3KF6 B;  1S3O A;  4IZ8 A;  2B2W C;  3S2H B;  1XMO L;  5KND A;  5IGE A;  1PMR A;  4CDF C;  3EBE A;  5C3X A;  4K2L A;  5C44 B;  2ZXO A;  2X69 A;  1X3E A;  1HCZ A;  2NVY H;  3G6J B;  2F0K A;  1E22 A;  2JA7 H;  4JC0 A;  1VQ8 A;  1QVF A;  2QW7 A;  4YCV A;  3J7A 5;  1ROD A;  5EKL A;  1S5B D;  3FRP B;  4A76 A;  1GXD C;  2KBN A;  3GV3 A;  2UXC L;  3WOE A;  1KAW A;  1XTC D;  2Z9H A;  4GN5 A;  4UP9 A;  4BY1 B;  2R7Z G;  3CME A;  5KRU A;  2ES2 A;  1TWH B;  4Y52 H;  2DUD A;  4A3E B;  2EYJ A;  5IOD A;  2HIV A;  5CV6 A;  2LFN A;  2F0H A;  4A3E G;  3M4P A;  2OQK A;  2ZJQ A;  1K0S A;  1WJJ A;  4CGY B;  2UU9 L;  4CDD C;  4RCO A;  5LMU Q;  4F88 A;  1SXT A;  4ILW A;  2UUC Q;  1PFB A;  3R2T A;  4L5Q A;  4BXX H;  3HOV B;  1N34 Q;  1WCM H;  3HFZ B;  3TSS A;  1B8A A;  3CAM A;  1EZ8 A;  4CKC A;  4DNI A;  1GJX A;  4JI4 Q;  4OL7 A;  1W2B A;  3X3N A;  2IX1 A;  4GS3 A;  3RLN A;  3R3O A;  4OWX B;  4YHH L;  2K5N A;  2KQ3 A;  3I3C A;  4WJ4 A;  1QJO A;  1SAP A;  4YCU A;  1VDZ A;  5ELC A;  3GTJ B;  2R92 G;  2UXB L;  3MWY W;  2MNA A;  5D3I B;  5KYI A;  2B8G A;  4KD3 A;  3M4Q A;  3MXP A;  1EY4 A;  2Y0S B;  3J80 i;  2DY8 A;  5IP7 G;  2VW9 A;  1V8Q A;  4P72 A;  1V1P A;  2Y0S G;  1XXG A;  1V1Q A;  2OQ0 A;  3H91 A;  3VYS A;  4BA1 I;  2ENB A;  4C3J G;  3S1Q H;  1G29 1;  1KAA A;  1L2F A;  3GTG H;  2AUK A;  1VQ5 A;  2NUC A;  2LKV A;  1LAB A;  2F0Q A;  3K6O A;  2EJG C;  4FDB A;  3GTL B;  4X3S A;  5AJ3 Q;  2V4D A;  4L6T B;  3A5Z B;  5IIF A;  4N9T A;  2SNM A;  3AFQ A;  2OCE A;  2JA8 G;  3QJY A;  2B2T C;  4EX5 A;  1X54 A;  5DEH A;  2WKC A;  3W5O A;  1II3 A;  4C3I B;  3I7F A;  1QIL A;  4X3U A;  4HIO A;  3J81 i;  1C48 A;  2BOS A;  3X3M A;  1PRT B;  1B7Y B;  2XIW A;  4C3I G;  3RR5 A;  1CFM A;  2DN8 A;  2WIN B;  2PPB C;  1STN A;  1SE8 A;  3KLW A;  4LF6 L;  4XYQ A;  3ERO A;  5IGD A;  3GTK H;  1DOL A;  1LV9 A;  2AQ1 B;  2KCM A;  4OIJ A;  3NQT A;  4DV6 L;  4DR4 L;  4GN4 B;  3URY A;  3TN2 A;  2ZJP A;  3Q23 A;  1EY6 A;  5LMN L;  4LNQ A;  1MGS A;  2MO1 A;  4A93 G;  1LT6 D;  5JAV A;  1C4Q A;  3VA5 A;  1KC8 C;  2BE5 C;  4MHE A;  2KHI A;  1SJH D;  2TMP A;  1PDQ A;  4LFB Q;  2YV5 A;  3A7A B;  5D3D A;  1K0R A;  3D4W A;  3NHH A;  5AFW A;  2F3V A;  4IFD I;  1YHA A;  3E9I A;  2F0P A;  5C0X I;  1E0B A;  4KHP Q;  2N88 A;  2VNU D;  1RL2 A;  4A3D H;  3L9A X;  5FLX L;  2WFW A;  4R4T A;  5D65 A;  1EZ6 A;  4UP8 A;  3K5L A;  3GTP B;  1TWF H;  3T1H L;  4XDX A;  2QEX A;  2RSO A;  2F0M A;  2CW0 C;  1U5K A;  1VQF A;  2M2L A;  2XNA C;  3IFD A;  1M90 C;  1IBM Q;  4X62 L;  2SEB D;  1WTW A;  1W6K A;  3I4O A;  1YEZ A;  3GQB A;  2R3Z A;  1S5C D;  3CCQ A;  4K2K A;  4R1J A;  1HNX L;  2Z0S A;  4QIW B;  1D2B A;  2DNE A;  3FPP A;  3SDZ A;  4V0B A;  1AH9 A;  4IUV A;  4FO2 A;  5JJZ A;  1F77 A;  1MI2 A;  2C5C A;  5M5W H;  1HUM A;  1HZB A;  3ULJ A;  4A3L G;  4H13 C;  2HHH Q;  1H95 A;  5FLX c;  4B9X A;  3A74 A;  1CKO A;  1KAB A;  4A3I G;  2WP8 J;  4DV1 Q;  2NN6 H;  3SEB A;  3CKI B;  2B63 B;  2NVQ B;  4HN7 A;  2KEE A;  2L9H A;  2ZM6 Q;  3NBH B;  2E2H B;  1SDF A;  2NVT H;  4KKS A;  2XRQ D;  3T56 B;  3TS0 A;  1AW7 A;  3C2P A;  1K83 H;  4PZ6 A;  1B4O A;  3R93 A;  4BY7 B;  4BBS G;  1N33 Q;  4KJO A;  1EEI D;  1EU4 A;  1FR3 A;  3CRL C;  2M00 A;  4HJ8 A;  3BYT B;  2KCC A;  2P5Z X;  5E4X A;  4NKL A;  2O5J C;  4PZ8 A;  2PMZ B;  2UUA Q;  3CHB D;  4ZK9 B;  2IT1 A;  4HSP A;  4IUP A;  3TRE A;  4DNT B;  4KD4 A;  1SNC A;  4J15 A;  4Q0F A;  1M8A A;  1RD9 D;  4Q5V A;  2K52 A;  5JEA G;  3QR8 A;  1V43 A;  1I6H H;  1TWG B;  2JA6 H;  4EVO A;  4MZ9 A;  4DV0 L;  3FKI B;  4OEL B;  2R93 H;  4X3K A;  1IW7 C;  4RFB A;  4EQ5 A;  2N55 A;  3OWF A;  2BA0 A;  2OXP A;  3TQY A;  1O80 A;  2RCF A;  3H0G B;  4ME5 A;  2R7D A;  4XT1 B;  5FLM H;  5KGU A;  4IPC A;  3S14 H;  4Y7N B;  1E1T A;  4YWM A;  3UDF A;  3NEN A;  5A2Q L;  5FO8 B;  3QWN A;  2IX0 A;  5DNF A;  1YVC A;  3HKZ G;  5JJL A;  1GO3 E;  2JJQ A;  5JJK A;  2KED A;  2VQF Q;  3Q22 A;  3W1B A;  1UE6 A;  4J6H A;  4JV5 Q;  5ELN A;  1XX8 A;  2RF4 A;  4RGM A;  1CKN B;  4X64 Q;  4QIW E;  4B3R L;  1I50 B;  2Q8I B;  2J0T D;  5LHY 1;  3I4M G;  1NNX A;  5IP9 H;  3TEH B;  1VF7 A;  1K28 A;  2G9D A;  4JVZ A;  1S72 A;  1JB3 A;  2FMM A;  2SNS A;  5AJ3 L;  1IBK Q;  4KY7 A;  1SYD A;  2ZTC A;  2D0O A;  2E74 C;  3PSI A;  4JI8 L;  4DA2 A;  2ZXP A;  5DM7 3;  4IOC A;  1ICF B;  3HS0 C;  5E1F A;  4LJZ C;  1Q1E A;  1XNQ L;  2K5D A;  1Y1W B;  1PYS B;  4NXN L;  4DK6 C;  2VZA A;  3A8K E;  5BR8 L;  1WTV A;  3QOL A;  1E2V A;  3FHW A;  5I6W A;  1PRT F;  4U67 3;  5EAY A;  4A75 A;  1JWM D;  3NTK A;  1OXX K;  3KDF A;  1WTR A;  2JEA I;  4ALP A;  4ZKB B;  1CHQ D;  1ASZ A;  4HIK A;  2FJ2 A;  2E2I B;  1OXS C;  5IYB G;  2EYO A;  1NY4 A;  4R4C A;  2Q2I A;  5ELB A;  3OTO L;  2EYH A;  1C7Y A;  2BH8 A;  3T53 B;  2NVX H;  5JPN C;  4RKL A;  3O13 A;  3SXH A;  3HEJ A;  1HR0 L;  1PH9 A;  3S1N B;  3KLS A;  5C4X B;  1G2T A;  1ENC A;  4C3H H;  1HNZ Q;  3ZYY X;  3DWP A;  4LAA A;  4DR6 L;  3M4O B;  2WAC A;  1VQM A;  2VUM H;  4QMG A;  2EYP A;  1XMO Q;  3CPF A;  1K3R A;  1SYE A;  1L1O A;  3S2D H;  1CKM A;  4X3T A;  1Y1V H;  2F0E A;  4ZAI A;  1ZYR C;  3HP3 A;  4BBR H;  4R4I A;  4A3B B;  1KLG D;  3EIV A;  4LMQ D;  1EWC A;  4JI0 L;  2PQE A;  1GUN A;  3PIO A;  3I55 A;  4K6L A;  1H9J A;  4OGQ C;  3HOX H;  2I46 A;  3IRB A;  3F2B A;  2UXC Q;  2EXD A;  1KRT A;  5FO9 B;  1D5M C;  1F9P A;  3VDY A;  3HGB A;  1NAP A;  1CA5 A;  5FJ8 H;  5M3M B;  2EYF A;  4IPH A;  3T13 A;  1HA6 A;  1ESR A;  2PCF B;  2QGQ A;  4A3G H;  2CKZ B;  1D1K A;  2VB2 X;  2JA7 G;  3ICE A;  4FXK C;  1A0I A;  1FYC A;  2HUG A;  2SDF A;  1HJP A;  5C3E B;  4U68 A;  1W6J A;  4J1M A;  2A69 C;  4M1U B;  5I9O A;  4K5X A;  2Q2U A;  1VQA A;  4Z9C B;  5IGC A;  2K4K A;  2UU9 Q;  3QO2 A;  4OX9 L;  1SYB A;  1WI5 A;  4GZY C;  1WTH A;  1TS2 A;  4GLA C;  1I4X A;  4R8N A;  1TKW B;  1Q82 C;  3MXN B;  2EY2 A;  4G7H C;  5CV5 A;  4HJ5 A;  2V1C C;  1O78 A;  4NMZ A;  4F8M A;  1VQG A;  1XPR A;  1HPC A;  4GLX A;  1UEA B;  4YHH Q;  1V1O A;  5IGG A;  4LFA L;  3UI2 A;  2UXB Q;  1Q90 A;  4A3M B;  3HOY H;  2OF1 A;  4XT3 B;  1N33 L;  2KHS A;  4JBJ A;  3F8T A;  1MJC A;  1Y14 B;  1J5E L;  4QUF A;  3PIP 3;  1MSG A;  3J81 L;  4C56 C;  2Z4H A;  4A3F H;  3LGJ A;  1PA6 A;  2KEN A;  2B2Y A;  1J9O A;  4IPG A;  4BXX G;  2D62 A;  2H4O A;  1QE6 A;  4G4K A;  4JI6 L;  1WCM G;  3ULP A;  4I7Z C;  1EYC A;  2KHJ A;  4XIG S;  4ZYS A;  1WTO A;  1NR2 A;  1GUS A;  1N32 L;  2KVM A;  1QNK A;  3PGZ A;  1JJC B;  1YJW A;  5KIX A;  1LAC A;  3KBX A;  1TU2 B;  4DNR B;  2F0D A;  1ESF A;  1X65 A;  3GTO B;  4B3M L;  4MIU A;  1B2T A;  4CDE C;  4CKE A;  2JA5 H;  3BZC A;  3B6Y A;  4J8Q A;  5M3F H;  5IOC A;  4FF1 A;  1VMC A;  1I4P A;  3CPW A;  1JB7 A;  4ZUI A;  1VQN A;  4JYA L;  4YWK A;  2YTV A;  1X6O A;  2K14 A;  1Y8P B;  4LF6 Q;  1DOK A;  1SYC A;  3STB C;  2HQL A;  3DWQ A;  1LTT D;  2O2L D;  1NR4 A;  1IBL L;  3CD6 A;  1PH6 A;  1HRJ A;  2XN9 C;  1EIG A;  2N8N A;  2NZ1 D;  3OIQ A;  4B9W A;  4JOI A;  4DR4 Q;  1SNP A;  1Q86 C;  5FLX E;  1Q1B A;  2F1M A;  1HXY D;  5CV8 A;  1HNW L;  2CH4 W;  5CV4 A;  3K5N A;  1UEB A;  5LMN Q;  2K50 A;  1WD1 A;  1D8L A;  1A8V A;  2DY7 A;  3VYR A;  4A3K H;  4CJ2 C;  3I72 A;  3M7N A;  1A63 A;  4GOP A;  5IYD H;  3S1R B;  1YHQ A;  1C8C A;  1FNU A;  3H15 A;  1JIC A;  4JI7 L;  1B9M A;  3H3V H;  1JOQ A;  1RJT A;  4WRD A;  1YNN D;  5CR3 A;  1OXT A;  1DGS A;  4CKB A;  3GD7 A;  3GP7 A;  2CHB D;  1X3P A;  4N8X 1;  2PNR C;  4MN3 A;  2HDM A;  4DUY L;  5M5X B;  4M8A A;  3V96 A;  1VQI A;  1RKN A;  2H5X A;  3T1H Q;  1PTO H;  3M85 A;  4IPD A;  1Z9F A;  3SHL A;  4X62 Q;  2F0J A;  3LWE A;  1BCP F;  2FMC A;  1KTK A;  5H1S E;  1GUG A;  3H94 A;  1ILP A;  1YJ9 A;  1HNX Q;  3R8B A;  2NZH A;  1KXL A;  3S1M B;  2CVR A;  1S4Z A;  5C4X H;  3DHQ A;  4A3D G;  4O42 A;  1B3A A;  5E4W C;  1LTI D;  1E1O A;  3A7L A;  3HOW H;  2AHO B;  4GNX A;  4AIM A;  1SRO A;  1I4R A;  2LY7 A;  1PTO D;  4N9P A;  1TVX A;  1AP0 A;  1KQS A;  1Z47 A;  1SNO A;  1LO5 D;  4LF4 L;  1WTX A;  5M5Y B;  2CQA A;  1W3S A;  1KDB A;  3ERS X;  4QUC A;  2EYL A;  4OEM B;  2A6E D;  5IY0 A;  3RNU A;  2XTI A;  4NP5 A;  2R7F A;  2R7Z B;  1D1I A;  3N52 A;  5C4J H;  3OHX C;  2MGS A;  2OTJ A;  1HZA A;  2JN4 A;  4IUU A;  1F2Y A;  3HOU H;  1VQC A;  1FL0 A;  1C9O A;  5A2Q E;  3RZD H;  3F2U A;  5I4D A;  2M9V A;  1LTS D;  3KJO A;  2EPB A;  2NN6 G;  4ME3 A;  5EGT A;  2E2J B;  4ODG A;  4A3J H;  3U9O A;  1EUJ A;  3CQZ H;  1H9S B;  1L0X B;  1I94 L;  1GOZ A;  4HMJ A;  2GA4 B;  3S17 H;  4DV0 Q;  1R9T B;  2EE1 A;  1TT2 A;  3NSW A;  2EY1 A;  3MEF A;  1X3F A;  5BN5 A;  1GVP A;  3SK8 A;  2K75 A;  1SN8 A;  4PMB A;  4X6A H;  1LT5 D;  3I4N H;  4AYB G;  5T1I A;  1P16 A;  2IJ0 A;  1YNJ C;  4NXM L;  2R92 B;  3RZO B;  4ZKC B;  2Z6B A;  2I07 B;  2RBM A;  3KOJ A;  1PH3 A;  5F2D A;  4POF A;  3HOZ B;  2JA6 G;  3K0X A;  1DOM A;  1H9K A;  5IYC G;  3MA2 B;  4C3J B;  3TP8 A;  3HOZ G;  2R93 G;  1X32 A;  3FDT A;  2E8G A;  1K3B C;  5DAU A;  3CC4 A;  4LF9 L;  1JWU D;  2RHQ B;  4DV4 L;  2BA1 A;  3WDN A;  3I4L A;  1WD0 A;  4B3R Q;  3GO5 A;  1QZG A;  3QIA A;  4UY8 C;  3TDQ A;  5FLM G;  4DV5 L;  3NK9 A;  3QB3 A;  1D7Q A;  1TWA B;  2X6L A;  2HQE A;  1EWH A;  1QOH A;  4V19 0;  4OO1 I;  2JA8 B;  3ONA B;  1XYI A;  2JP1 A;  4QCL A;  1JT8 A;  1EYA A;  2KJX A;  4HAE A;  3SE0 A;  4JI8 Q;  1BQQ T;  5GAH C;  3GDE A;  1LTR D;  1NMF A;  3S15 B;  1BKB A;  1XNQ Q;  2PQA B;  4NXN Q;  5BR8 Q;  2FFK B;  2KA7 A;  3GTQ H;  2K1B A;  3I70 A;  5IP9 G;  4DR2 L;  3JAM L;  3NPP A;  4K6D A;  3M3Y H;  1STG A;  3LNN A;  2N3S A;  3M7G A;  3EN2 A;  4RHR A;  1GHJ A;  1SE3 A;  4B08 A;  4PMC A;  1XTD A;  3T16 A;  5CBE E;  1HA5 A;  2WKD A;  2O5I C;  3T4A C;  4FF2 A;  1GUO A;  5I2X A;  2QDL A;  4A93 B;  4BWG B;  3OTO Q;  2CFM A;  4O1N A;  5CGK A;  1HR0 Q;  4UDU C;  4PNY A;  3NP8 A;  4YY3 Q;  4X65 L;  3K7A B;  5COY A;  1G6Z A;  4DF7 A;  4DR6 Q;  3KBG A;  1TWC B;  3G71 A;  1JJG A;  1S5F D;  1DON A;  1HZ9 A;  3W1G A;  4DKA C;  3JAM c;  2QF7 A;  4B3T L;  4K5W A;  2XWJ B;  1AFP A;  1MBY A;  1QVG A;  4IFD H;  2JE6 I;  4H7B A;  3LWU A;  3AEV A;  4C1N I;  2QIL A;  4FF3 A;  5C0X H;  1G51 A;  3DUZ A;  1O7I A;  3J80 E;  2F0W A;  2BH2 A;  5HY6 A;  4JI0 Q;  2Y0S E;  4XQN A;  3PO2 H;  4JI1 L;  4C3H G;  2YU9 H;  4RMF A;  3U9S A;  3OW7 A;  1HR0 W;  1FD7 D;  1BUV T;  3J7Z C;  2VUM G;  1LT3 D;  3KLR A;  4DAY B;  5LL6 S;  3GTM B;  5ELD A;  4HCS A;  2I5H A;  1Y1V G;  2RSN A;  5T1G A;  1SFO B;  3M4Y A;  3PO3 H;  4IUN A;  4BBR G;  2MPM A;  4KTA A;  1ML0 D;  2AQ2 B;  2C35 B;  2AWO A;  2Q8R E;  4C1N K;  2B39 A;  3NEM A;  3S2H H;  5COR A;  1XJV A;  4OX9 Q;  4A3I B;  1ENA A;  1K8O A;  4KKT A;  1KL9 A;  3KF8 B;  1U4R A;  5C44 H;  3J81 E;  1BCP C;  5I9P A;  3RN5 A;  4LUZ A;  3PUZ A;  3DLL A;  1NUC A;  1B53 A;  2PZU A;  4JOI C;  2K32 A;  1RDP D;  4DV7 L;  2BCO A;  3NWS A;  5FJ8 G;  5JVH 3;  3P20 A;  4A3G G;  4LFA Q;  3S16 B;  1HFN A;  4BBS B;  2F0I A;  3VR3 A;  1A3V A;  1EOT A;  1NTG A;  1SNQ A;  2MFI A;  1PH2 A;  4GOP C;  1BVS A;  4BY1 H;  4TRD A;  4RGO S;  2IHF A;  1TWH H;  4HJA A;  1J5E Q;  1XNR L;  3OW2 A;  2IW3 A;  1SMX A;  4A3E H;  4CBV A;  3J7A V;  1EIY B;  4DR5 L;  4DAV A;  2LXJ A;  4LUO A;  1E2Z A;  4JI6 Q;  4EGV A;  3CCV A;  2GVB A;  2DJG C;  1ZKO A;  1CQV A;  3K7U C;  1N32 Q;  4OHJ A;  2JYO A;  1O7Z A;  1AE3 A;  3CCU A;  3NUC A;  4UPA A;  1VQO A;  4GN3 B;  1VQL A;  4JG2 A;  2A68 D;  2RCN A;  2BDO A;  3HOY G;  2HCI A;  2L11 A;  4KN7 C;  1JR0 D;  3CCR A;  1IKM A;  3HOV H;  1K8M A;  2KEC A;  1MSH A;  3U4V A;  4HID A;  4B3M Q;  4DV2 L;  3UDX A;  3ERQ A;  3NBI A;  3PQI A;  2LMC B;  4A3F G;  5C4H A;  3GTJ H;  3Q6S A;  4KY5 A;  1Y8N B;  3HKZ B;  1VQ4 A;  2F4V L;  4DAP A;  1PXU A;  5IP7 H;  4K0K L;  3J7A F;  4JYA Q;  1BOS A;  1TS5 A;  1SE4 A;  3E9H A;  5EKI A;  4P74 A;  4L5R C;  4DR3 L;  2SOB A;  1SSO A;  4OXP A;  3U4Z A;  2XVS A;  1VS0 A;  1VQE A;  1ET9 A;  2WAQ G;  1IBL Q;  1EFW A;  3I56 A;  3I4M B;  2A74 C;  2GN5 A;  1TII D;  2WII B;  1BBU A;  1HNW Q;  5BN3 A;  1STB A;  2JA5 G;  4RGT A;  1PFM A;  3CC7 A;  1T5X D;  3G48 A;  4FF4 A;  3GTL H;  1VQJ A;  5M3F G;  1UUP A;  1Z7T A;  4UAI A;  2HT1 A;  3QOJ A;  3K57 A;  4PV1 C;  2B2W A;  1DM0 B;  3L0O A;  1JOO A;  1I6V C;  3I73 A;  4IAL A;  1R4Q B;  2F52 A;  4DK1 A;  2VS1 A;  3V2T A;  1UE5 A;  2CWP A;  2A6H D;  4K14 A;  1FNW A;  3ULL A;  4JI7 Q;  4C3I H;  3A56 A;  2QEJ C;  2IWH A;  1LTL A;  2QA4 A;  1YZ6 A;  3SVM A;  3SK5 A;  3GV6 A;  2WV6 D;  2HIX A;  4KLK A;  2IX3 A;  3SK6 A;  3HKS A;  1SMY D;  5DLQ E;  2O4X A;  4DUY Q;  1ZEQ X;  4AH6 A;  4UP7 A;  2NWG A;  1A2U A;  1E3P A;  3V05 A;  4A3K G;  2VB3 X;  3W2D A;  1BCP B;  4RHS A;  1TQO A;  1A62 A;  4TKO B;  4KY6 A;  5IYD G;  2PMZ E;  4IUT A;  4QY7 A;  2PZW A;  5J3B A;  2FIN B;  2YTX A;  3PUX A;  4MNO A;  2MQH A;  4IUR A;  4I65 A;  4L8J A;  2LSS A;  1DYQ A;  2RA4 A;  3AU7 A;  1PYW D;  2F0V A;  1LTG D;  2Z6K A;  4KJN A;  4YY3 L;  3K81 C;  3L2P A;  3JAM i;  4HJ9 A;  1PRT D;  2AMC B;  1Y8O B;  1ICW A;  2B2V A;  4ULL A;  1SR3 A;  4CHT B;  4L5S A;  2EVB A;  2XRS D;  2NTS A;  4NB3 A;  3I2Z A;  1Y69 U;  2E75 C;  2DJF C;  3MXG A;  3WWV A;  1G2S A;  3D6C A;  4RG1 A;  1DXM A;  2F0N A;  4LF4 Q;  1MKH A;  2N78 A;  5IGF A;  3U58 A;  3GTP H;  2F0G A;  3BS1 A;  3L3O C;  4JI5 L;  4TVA B;  1N9W A;  2R61 A;  1D5Z C;  4FNF A;  4BS9 A;  1B50 A;  2DGY A;  3H09 A;  3A8I E;  2ASB A;  3BYY B;  3HOW G;  1X3Q A;  2I5M X;  1GM5 A;  4P73 A;  3UDI A;  2NVY B;  1JMC A;  2JA7 B;  1UE7 A;  2PO4 A;  3NBH A;  1LYL A;  5HGT A;  4JW0 A;  1CHP D;  1G91 A;  2IHE A;  1F2Z A;  2JK8 A;  1E24 A;  2B2T A;  1I94 Q;  3PUW A;  3I90 A;  3SR1 A;  1CT1 D;  4KMU C;  1UWV A;  3NQI A;  5E3F A;  2NZO A;  1FVI A;  4KHV A;  4HED A;  2B63 H;  2NVQ H;  1J8I A;  1QB5 D;  2E2H H;  3HOU G;  4DFA A;  5IWA Q;  1U4M A;  4WFN 3;  4GLV B;  4JI2 L;  4NXM Q;  3BU2 A;  3NEL A;  4MTN A;  3VR2 A;  3E0E A;  4A3J G;  3EQL C;  3VYT A;  4KHZ A;  4EQP A;  4BY7 H;  2Z8L A;  2MUY A;  1NBW A;  4A3C H;  3RD4 A;  1QG7 A;  2LXK A;  2CQO A;  3K58 A;  2J7Z A;  1X55 A;  2F0O A;  2OWO A;  1FJG L;  4LF9 Q;  1WCM B;  1HQM C;  2JXM B;  1OTC A;  3CCL A;  1EY8 A;  4DV4 Q;  1KD1 C;  5FO7 B;  2A73 B;  1J6Q A;  3SK4 A;  2UXD Q;  1HQR D;  2G9H D;  3JAM E;  4DV5 Q;  1X3G A;  1TWG H;  1PLF A;  4JBM A;  3FKI H;  4XQJ A;  2HD3 A;  2D2C C;  3C1E A;  5G3L F;  2A5H A;  1SLJ A;  3FP9 A;  2WB1 G;  3ER0 A;  1WOC A;  1V9P A;  3FVQ A;  3H0G H;  2TSS A;  4PMW A;  3S1Q B;  4Y7N H;  3GTG B;  5EJW A;  1AZQ A;  1N8R C;  1YNX A;  1JQY D;  1PZJ D;  1PHJ A;  3AB9 A;  5JJI A;  1P8L A;  3TZD A;  3D3R A;  5CV7 A;  4LF8 L;  4DR2 Q;  3C1F A;  5KEE A;  3Q24 A;  3FMC A;  5ELE A;  3DMU A;  1PV4 A;  1V1P B;  4KK7 A;  1VQB A;  2K28 A;  1BR9 A;  2I5L X;  3IL8 A;  4LF7 L;  1I50 H;  1BXT A;  3D4D A;  1JC7 A;  3K59 A;  3EA6 A;  1EQR A;  4RH6 A;  3TRZ A;  5IT9 L;  4OIK A;  5EQ0 A;  4LFC L;  4IUQ A;  4CDC C;  2K6A A;  3EVQ A;  4X65 Q;  2CH4 A;  4APV A;  1NMG A;  1CM9 A;  2ICI A;  3MHB A;  1PH4 A;  1G6P A;  2A19 A;  1U4P A;  5GRO A;  3F2C A;  2BE5 D;  1IKL A;  4DR7 L;  3GTK B;  1Y1W H;  3E5S A;  1PYB A;  5I2Y A;  2EQS A;  2X6G A;  4B3T Q;  1HH2 P;  3Q0A A;  1SEB D;  2L0C A;  4DUZ L;  1EYD A;  4S3S A;  1I4G A;  4HIM A;  3OPO A;  3CC2 A;  2FXQ A;  1VQ7 A;  4ZRZ A;  4JI1 Q;  1CA6 A;  2ZJR A;  5IGB A;  5GAD C;  2E2I H;  2EIF A;  2CW0 D;  5IT9 c;  2I0Q A;  2OEO A;  1ET6 A;  2D5D A;  1HHV A;  3DWA A;  2D0P A;  1KDA A;  2KOL A;  1HFG A;  1PH8 A;  4A3D B;  1RF2 D;  3S1N H;  4IFD G;  3DEP A;  1NSN S;  2MJ8 A;  5JPM C;  1TWF B;  5CV9 A;  3M4O H;  3TBI B;  4HMI A;  5C0X G;  1PFS A;  4IFD J;  1FGU A;  1U9R A;  2EY5 A;  1QUQ A;  1AEX A;  3PO2 G;  5C0X J;  3S24 A;  1EU3 A;  1UE1 A;  2AKW B;  4JPB W;  3T51 B;  4DAM A;  5EPL A;  1STA A;  3UE1 A;  4R9W A;  3VR6 A;  1F2M A;  4DV7 Q;  3J81 j;  4A3B H;  5GAE C;  3A8J E;  3RUZ A;  5M5W B;  2Q8T A;  2XSC A;  1Q8I A;  5L37 A; 
#chains in the Genus database with same CATH homology
 3I4N G;  1HZ9 A;  3PO3 G;  1CUK A;  3W1G A;  3I4M G;  4DKA C;  3JAM c;  5IP9 H;  3RLO A;  4B3T L;  3TEH B;  2PI2 E;  1S72 A;  1QVG A;  5AJ3 L;  2JE6 I;  1IBK Q;  4A3M G;  1XNR Q;  1LM0 A;  3AEV A;  2ZTC A;  5M3M H;  2D0O A;  2VQE L;  5C44 G;  1S40 A;  3PSI A;  4JI8 L;  1G51 A;  1O7I A;  3CCM A;  4DR5 Q;  4JBK A;  4IOC A;  3K8A A;  2BH2 A;  5HY6 A;  2UUA L;  1VQH A;  3J80 c;  4JI0 Q;  2Y0S E;  5C3E H;  3PO2 H;  4JI1 L;  1Q1E A;  1CKN A;  1XNQ L;  3G6E A;  2YU9 H;  1PYS B;  3Q8D A;  4NXN L;  4RMF A;  2VZA A;  4DK6 C;  5BR8 L;  1HR0 W;  4JI3 L;  3J7Z C;  2VUM G;  4DAY B;  3FHW A;  3M9B A;  3G4S A;  3CCS A;  4HJ7 A;  1PH7 A;  5EAY A;  4A75 A;  4QQB X;  4AQY L;  4JBW A;  2N49 A;  1OXX K;  1KIX A;  3KDF A;  4BY1 G;  4B3S Q;  1ASY A;  2I5H A;  3PIP A;  1Y1V G;  3PV0 A;  2JEA I;  3PO3 H;  4DV3 Q;  4ALP A;  2YYZ A;  5IWA L;  4DR1 Q;  4BBR G;  4DV2 Q;  3I4M H;  4GKK Q;  4OO1 G;  1ASZ A;  4C2M H;  4HIK A;  2C35 B;  3UDG A;  2AWO A;  1NJI C;  1OXS C;  3NEM A;  3S2H H;  5IYB G;  1N36 Q;  1XJV A;  4A3M H;  1NY4 A;  4R4C A;  4OX9 Q;  2F4V Q;  1IZ6 A;  2Z6K C;  4K0K Q;  1KL9 A;  2L15 A;  3KF8 B;  5IE8 A;  2Q2I A;  3OTO L;  5C44 H;  2K5V A;  1C7Y A;  2BH8 A;  3J81 c;  4DR3 Q;  2B3G A;  3RN5 A;  2NVX H;  4LUZ A;  3PUZ A;  3DLL A;  1HR0 L;  1Q81 C;  4JCV E;  1PH9 A;  2UUB L;  4JOI C;  4OON A;  4C3H H;  1HNZ Q;  4DV7 L;  4X66 Q;  2VQF L;  1PH1 A;  5FJ8 G;  3CXC A;  4DR6 L;  4LW1 A;  1L1O C;  3RLF A;  4JV5 L;  1VQM A;  3HOV G;  4LWC A;  1YI2 A;  3KFU A;  4BA2 I;  4QL5 A;  3A5U A;  4A3G G;  4LFA Q;  3SGI A;  2VUM H;  4X64 L;  4DV6 Q;  2UXD L;  1XMO Q;  3CPF A;  4LF5 Q;  1K3R A;  1NTG A;  2MFI A;  1PH2 A;  1L1O A;  4GOP C;  1PH5 A;  1BVS A;  3S2D H;  4BY1 H;  4GKJ L;  1TXY A;  1CKM A;  2IHF A;  1WYD A;  1OXV A;  1IBK L;  4R4O A;  1TWH H;  1Y1V H;  4HJA A;  1J5E Q;  1XNR L;  2K5H A;  1NE3 A;  3OW2 A;  1SMX A;  1YIT A;  4A3E H;  1AE2 A;  4BBR H;  4O2D A;  1XMQ L;  1EIY B;  3H3V I;  4R4I A;  4DR5 L;  3GTO H;  1QVC A;  3EIV A;  2LXJ A;  2PI2 A;  5IYB H;  4JI0 L;  4LUO A;  4JI6 Q;  1VQ6 A;  3PIO A;  3I55 A;  4A4I A;  3CCV A;  2CWA A;  2GVB A;  2IY5 B;  3HOX H;  3IRB A;  5ELO A;  1I5F A;  3K7U C;  2B29 A;  3F2B A;  1N32 Q;  2EXD A;  2UXC Q;  1YBY A;  1AE3 A;  1E7Z A;  2JQO A;  3PUV A;  1KRT A;  3CCU A;  3K80 C;  2KCT A;  4UPA A;  1VQO A;  4GN3 B;  1VQL A;  4JG2 A;  3VDY A;  2RCN A;  3HOY G;  4POG A;  5FJ8 H;  3CCR A;  3CD6 A;  4B3S L;  4IPH A;  4O0A A;  3HOV H;  2QGQ A;  4A3G H;  4NPS A;  3T1Y Q;  3U4V A;  2CKZ B;  1PVO A;  4HID A;  4B3M Q;  2WB1 E;  3ICE A;  2JA7 G;  1A0I A;  2E5L Q;  4DV3 L;  4DR1 L;  1HJP A;  1X56 A;  4GKK L;  4DV2 L;  3KYH C;  3AQQ A;  3ZJY C;  3UDX A;  5LMN W;  3CF5 A;  4A3F G;  1YIJ A;  1B70 B;  3GTJ H;  1VQA A;  1VQ4 A;  2Q2U A;  2K4K A;  1N36 L;  2UU9 Q;  4OX9 L;  2RHS B;  1WI5 A;  2F4V L;  4K0K L;  5IP7 H;  2XGT A;  4JYA Q;  3E9H A;  4GLA C;  2AWN A;  4P71 A;  4P74 A;  1Q82 C;  4L5R C;  5K36 G;  3CP0 A;  3MXN B;  4DR3 L;  3CW2 C;  4OXP A;  4HJ5 A;  3PF5 A;  2A8V A;  2V1C C;  3U4Z A;  1IYJ B;  4YCW A;  4DK3 C;  1X9N A;  1VS0 A;  1VQE A;  3AYH B;  2WAQ G;  1IBL Q;  1VQG A;  1XPR A;  3S1R H;  1K8A C;  4X66 L;  1HNZ L;  1EFW A;  4R4Q A;  4GLX A;  1K8G A;  3I56 A;  1XPU A;  4WJ3 M;  1EYG A;  2GN5 A;  4YHH Q;  3CMA A;  4AYB E;  4LFA L;  1IL2 A;  3KF6 B;  1BBU A;  1S3O A;  1HNW Q;  1XMO L;  2UXB Q;  4PG3 A;  1VQ9 A;  2JA5 G;  4LF5 L;  3HOY H;  3CC7 A;  3G48 A;  3GTL H;  1VQJ A;  3EBE A;  5M3F G;  1N33 L;  4IOA A;  3D0F A;  1Q46 A;  4JBJ A;  3F8T A;  1X3E A;  2HT1 A;  1MJC A;  5M5X H;  1Y14 B;  2NVY H;  1J5E L;  3L0O A;  1E22 A;  3KDF B;  2JA7 H;  4JC0 A;  1VQ8 A;  1QVF A;  2F52 A;  2R6G A;  2VS1 A;  1UE5 A;  2CWP A;  4YCV A;  2ZTE A;  3J7A 5;  4A3F H;  3LGJ A;  1PA6 A;  2KEN A;  1T9H A;  4JI5 Q;  4IPG A;  4JI7 Q;  2D62 A;  3ULL A;  4BXX G;  1CSQ A;  4C3I H;  4JI6 L;  1WCM G;  3ULP A;  4QJF A;  1LTL A;  3KF6 A;  2QA4 A;  1U0L A;  4A76 A;  2KHJ A;  1YZ6 A;  4XIG S;  2KBN A;  5HGQ A;  1N32 L;  2UXC L;  1KAW A;  4GN5 A;  2HIX A;  3D31 A;  1JJC B;  3PGZ A;  4H02 A;  4KLK A;  4UP9 A;  1YJW A;  3HKS A;  1M1K C;  3CME A;  2R7Z G;  5DLQ E;  4DUY Q;  2ES2 A;  3TS2 A;  3S1M H;  4Y52 H;  4AH6 A;  2DUD A;  4UP7 A;  1MIU A;  1E3P A;  2HIV A;  1X65 A;  3T1Y L;  4A3K G;  1KHI A;  4B3M L;  4A3E G;  3M4P A;  2OQK A;  1A62 A;  4OWT B;  2E5L L;  5IYD G;  2JA5 H;  3A0J A;  3BZC A;  2ZJQ A;  3B6Y A;  1JE5 A;  4IJL A;  5M3F H;  1WJJ A;  2PMZ E;  4QY7 A;  3CPW A;  2UU9 L;  5J3B A;  1JB7 A;  2YTX A;  1L1O B;  3PUX A;  4MNO A;  2MQH A;  3HOX G;  1VQN A;  4YWK A;  4JYA L;  2YTV A;  5LMU Q;  1X6O A;  2K14 A;  2LSS A;  2UUC Q;  4LF6 Q;  4L5Q A;  3STB C;  4BXX H;  2Z6K A;  2HQL A;  1N34 Q;  1WCM H;  4YY3 L;  1IBL L;  3HFZ B;  3K81 C;  3L2P A;  1B8A A;  3CAM A;  5M5Y H;  3JAM i;  4JI2 Q;  4HJ9 A;  2N8N A;  1VQK A;  4DNI A;  4JI4 Q;  1W2B A;  2AMC B;  2IX1 A;  4GS3 A;  1EQQ A;  3RLN A;  4OWX B;  4YHH L;  2K5N A;  4WJ4 A;  4JOI A;  4DR4 Q;  1Q86 C;  4YCU A;  1Q1B A;  2R92 G;  2R7Z H;  1HNW L;  2NN6 I;  2UXB L;  1SR3 A;  1UEB A;  2MNA A;  2K50 A;  5LMN Q;  4L5S A;  1D8L A;  1A8V A;  1GKH A;  3M4Q A;  4NB3 A;  3I2Z A;  3J80 i;  3WWV A;  3F1Z A;  2VW9 A;  5IP7 G;  4RG1 A;  4P72 A;  4A3K H;  4LF4 Q;  1MKH A;  2N78 A;  1FJG Q;  3PF4 A;  2Y0S G;  3U58 A;  3M7N A;  1V1Q A;  2OQ0 A;  4GOP A;  3GTP H;  5IYD H;  1A63 A;  4BA1 I;  1YHQ A;  4IO9 A;  2B63 G;  1G29 1;  3H15 A;  1L2F A;  2E2J H;  3S1Q H;  3GTG H;  1VQ5 A;  4JI5 L;  4TVA B;  2F3I A;  1N9W A;  4JI7 L;  1XPO A;  3H3V H;  1RIP A;  1OXT A;  1DGS A;  3GD7 A;  2DGY A;  1R9T H;  1HZC A;  2ASB A;  4FDB A;  3HOW G;  5AJ3 Q;  2I5M X;  3A5Z B;  1GM5 A;  4BY7 G;  3JC6 6;  4DUY L;  3AFQ A;  4P73 A;  2OCE A;  3UDI A;  1JMC A;  2JA8 G;  3F2D A;  1QZH A;  1VQI A;  4EX5 A;  2H5X A;  4A3C G;  1UE7 A;  1X54 A;  3T1H Q;  1LYL A;  3M85 A;  4IPD A;  1Z9F A;  1JJ2 A;  3W5O A;  2IHE A;  2JK8 A;  2R92 H;  5GQO A;  1KRS A;  4X62 Q;  1EIF A;  3RZO H;  3I7F A;  1E24 A;  4HIO A;  3J81 i;  1I94 Q;  3PUW A;  5H1S E;  1YJN A;  1B7Y B;  3RR5 A;  5IYC H;  2JA9 A;  4LF8 Q;  1UWV A;  5E7N A;  1YJ9 A;  3HOZ H;  2NZO A;  1HNX Q;  5JEA J;  5LMU L;  1FVI A;  2NZH A;  1KXL A;  3FKI G;  1SE8 A;  2CCZ A;  3AFP A;  4C3J H;  4P75 A;  2B63 H;  3KLW A;  5C4X H;  2UUC L;  4LF6 L;  2NVQ H;  2E2H H;  4A3D G;  1C0A A;  1N34 L;  3HOU G;  4GNX C;  3STB D;  5IWA Q;  2ID0 A;  4JI2 L;  1E1O A;  4GLV B;  4NXM Q;  2PQA A;  1YHB A;  4PZ7 A;  4JI4 L;  4LF7 Q;  3H0G G;  3BU2 A;  3NEL A;  3GTK H;  4MTN A;  2KCM A;  3HOW H;  3E0E A;  2AHO B;  4DV6 L;  4GN4 B;  4DR4 L;  1TWA H;  4A3J G;  2ZJP A;  4KI0 A;  4GNX A;  4KHZ A;  1SRO A;  4AIM A;  4BY7 H;  3CCJ A;  5LMN L;  1NBW A;  3CCE A;  2JA8 H;  4LNQ A;  2MO0 A;  2MO1 A;  4A3C H;  4A93 G;  2LXK A;  2CQO A;  4LFC Q;  1KQS A;  1X55 A;  1Z47 A;  4LF4 L;  2OWO A;  1FJG L;  3DM3 A;  1L0W A;  1KC8 C;  4LF9 Q;  2KHI A;  1OTC A;  3CCL A;  3L7Z C;  4LFB Q;  3S15 H;  2YV5 A;  4DV4 Q;  1KD1 C;  1W3S A;  4DR7 Q;  3ERS X;  1K0R A;  1J6Q A;  4DPG A;  2UXD Q;  4IFD I;  4DV5 Q;  5IY0 A;  3RNU A;  1X3G A;  1YHA A;  2XTI A;  3E9I A;  3PUY A;  1TWG H;  4JBM A;  2R7F A;  4IJH A;  2YTY A;  3FKI H;  5C4J H;  4GKJ Q;  2A1A A;  2OTJ A;  5C0X I;  1HZA A;  4KHP Q;  2VNU D;  1RL2 A;  4DUZ Q;  4A3D H;  3HOU H;  1VQC A;  2WFW A;  4R4T A;  1FL0 A;  1Q12 A;  1C9O A;  2GVA A;  3RZD H;  1SLJ A;  3FP9 A;  2WB1 G;  3ER0 A;  1WOC A;  1V9P A;  4UP8 A;  1XMQ Q;  3H0G H;  1TWF H;  3KJO A;  2NN6 G;  3T1H L;  1VQP A;  2QEX A;  4ME3 A;  4PMW A;  4Y7N H;  1U5K A;  1VQF A;  4A3J H;  1M90 C;  1IBM Q;  1EUJ A;  4X62 L;  1N8R C;  4OWW B;  1YNX A;  3CQZ H;  3I4O A;  5GAG C;  1I94 L;  4QGU A;  1PHJ A;  1YEZ A;  3BZK A;  3S17 H;  4DV0 Q;  4A93 H;  1Y1W G;  5JJI A;  1P8L A;  3U50 C;  3CCQ A;  4LF8 L;  4DR2 Q;  1EOV A;  1SRU A;  4R1J A;  4XTC S;  2Z0S A;  3MEF A;  1X3F A;  1HNX L;  1GVP A;  1PV4 A;  2K75 A;  1SN8 A;  4X6A H;  1VQB A;  3K7A H;  4GOP B;  2Q2T A;  1AH9 A;  3I4N H;  4AYB G;  1TWC H;  1P16 A;  5M5W H;  4NXM L;  2I5L X;  4LF7 L;  1I50 H;  1HZB A;  3ULJ A;  4A3L G;  2HHH Q;  4TQU S;  1H95 A;  5FLX c;  1OXU A;  3KOJ A;  1EQR A;  1PH3 A;  3A74 A;  4POF A;  3TRZ A;  1CKO A;  4A3I G;  2WP8 J;  3K0X A;  2ATW A;  2JA6 G;  4DV1 Q;  5IYC G;  4LFC L;  3HKZ E;  2R93 G;  3HOZ G;  2ZM6 Q;  2E8G A;  4APV A;  4X65 Q;  1NMG A;  3NBH B;  3CC4 A;  2NVT H;  4LF9 L;  1PH4 A;  1EWI A;  1G6P A;  5C4X G;  2A19 A;  5GRO A;  4LFB L;  2WAQ E;  3F2C A;  4DV4 L;  2RHQ B;  2BA1 A;  4DR7 L;  4B3R Q;  1Y1W H;  3GO5 A;  1QZG A;  3OYY A;  4UY8 C;  1PYB A;  3TS0 A;  2EQS A;  5FLM G;  1K83 H;  4DV5 L;  1D7Q A;  4B3T Q;  4PZ6 A;  1HH2 P;  4BBS G;  1Q7Y C;  1N33 Q;  2Q2H A;  4OO1 I;  4KHP L;  4HJ8 A;  1GD7 A;  4DUZ L;  3GTM H;  2VQE Q;  1JT8 A;  5GAH C;  4JI8 Q;  2JEB I;  3GDE A;  4HIM A;  1CSP A;  2FXQ A;  1VCI A;  1IXR A;  4PZ8 A;  1VQ7 A;  2UUA Q;  3CC2 A;  1SFO H;  4A3L H;  1NMF A;  4JI1 Q;  1BKB A;  2IT1 A;  1XNQ Q;  2ZJR A;  2PQA B;  5GAD C;  3RN2 A;  1IBM L;  3UE0 A;  3TRE A;  2E2I H;  4A3B G;  1BBW A;  4NXN Q;  1QUQ B;  2EIF A;  4J15 A;  5BR8 Q;  5IT9 c;  2I0Q A;  2K52 A;  2ZTD A;  5JEA G;  1V43 A;  4A3I H;  4JI3 Q;  2JA6 H;  4GNX B;  1I6H H;  4MZ9 A;  4DV0 L;  2R93 H;  2D0P A;  3GTQ H;  1I3Q H;  4L5T A;  5IP9 G;  4EQ5 A;  4DR2 L;  4AQY Q;  1MJE A;  1PH8 A;  2BA0 A;  3TQY A;  3M3Y H;  4YWL A;  3S1N H;  4IFD G;  2N3S A;  3EN2 A;  3PCO B;  5M3M G;  2R7D A;  3M4O H;  5FLM H;  4LUV A;  1XTD A;  3S14 H;  4IPC A;  5C0X G;  1PFS A;  4IFD J;  1FGU A;  1E1T A;  4YWM A;  3S16 H;  3UDF A;  3NEN A;  4BBS H;  1QUQ A;  2IX0 A;  1K73 C;  2VY3 A;  5C3E G;  3PO2 G;  2HHH L;  1VQD A;  5C0X J;  3S24 A;  3OTO Q;  3KJP A;  2CFM A;  1UE1 A;  1Q8K A;  1WFQ A;  1YVC A;  2AKW B;  4DAM A;  3HKZ G;  1LUZ A;  1HR0 Q;  2OTL A;  2VL6 A;  1GO3 E;  2JJQ A;  4DV1 L;  5JJL A;  1K9M C;  2UUB Q;  3UE1 A;  5JJK A;  2ALY B;  4DV7 Q;  2VQF Q;  4YY3 Q;  2ZM6 L;  4X65 L;  3J81 j;  4A3B H;  4DR6 Q;  3W1B A;  5GAE C;  1UE6 A;  4JV5 Q;  5ELN A;  3G71 A;  1PH6 A;  1JJG A;  2RF4 A;  3BJU A;  1CKN B;  2PNH A;  4X64 Q;  4QIW E;  4B3R L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...