1AP0A

Structure of the chromatin binding (chromo) domain from mouse modifier protein 1, nmr, 26 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
b'HMVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFIER PROTEIN 1
publication title Structure of the chromatin binding (chromo) domain from mouse modifier protein 1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Chromatin-binding
total genus 5
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1997-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ap0A00
3F2UA 1PFBA 3ONAB 1NR2A 1SDFA 1DOLA 2KECA 2DY8A 4RWSC 1G2TA 1GUWA 2L12A 1B4OA 2HDMA 2B2UA 2Q8RE 3I8ZA 3I91A 3MWYW 4ZAIA 4HCSA 2KEEA 1PDQA 2SDFA 3P7JA 1EIHA 1VMPA 1F9SA 4ZLTF 1QNKA 1TVXA 1F9RA 2KOLA 2B2UC 5T1GA 2B2TC 3N52A 2EE1A 1WTRA 2MPMA 2FJ2A 1EQTA 1RTNA 1ICWA 1HRJA 1VMCA 3KBXA 1RTOA 1WTQA 5D14A 5EPJA 3SVMA 4HSVA 1HFGA 1IKLA 3H91A 1BNZA 1QG7A 4UAIA 1PFNA 4X3TA 2NYZD 3DM1A 5E4WC 2L4NA 4RA8A 1CA6A 4OIKA 4ZK9B 1XX8A 4IURA 5D65A 1EIGA 1KNAA 2RA4A 2K03A 1RJTA 1RODA 1NR4A 4CJ0B 1G91A 1HHVA 4CJ2C 2K05A 2B2VA 3I3CA 1ILQA 4NW2A 1F2LA 1ZXTA 4CJ1B 1DZ1A 4X3UA 2JYOA 2VXWA 1RHPA 1O80A 2NWGA 3GV3A 1IKMA 5CMDA 1WTWA 1U4PA 2B2VC 3I90A 2FFKB 3QO2A 1B2TA 1G2SA 1JE4A 2DY7A 2IL8A 1SAPA 3GV6A 5CORA 4DN4M 4IUQA 1KNEA 4ZKBB 1BBXC 3UI2A 1AP0A 4XT3B 2HDLA 1HA6A 2HCCA 1O7YA 1WTVA 4XDXA 1O7ZA 3TN2A 1JICA 2K04A 5DNFA 5COYA 1WD1A 2EOTA 1DOKA 2RVLA 2X6GA 3LWEA 1WD0A 1HUNA 4HAEA 5CBEE 1X3PA 3DEPA 4XT1B 1AZPA 1C8CA 4R9WA 4U68A 2KUMA 4X3KA 1ILPA 4QUFA 1ML0D 1SSOA 4LMQD 2EPBA 3DEOA 5CBAE 2L1BA 2N88A 1CM9A 1F9PA 1IL8A 2FMMA 2HCIA 2MJ8A 3HP3A 5JJZA 4IUUA 1G6ZA 2K1BA 4HEDA 1E0BA 1F9QA 2D9UA 2K01A 4RAUC 1J9OA 1DONA 1EOTA 1ESRA 2XIWA 1EL0A 2FHTA 2J7ZA 5E4XA 4X3SA 2B2YA 2BDNA 1Q3LA 4MN3A 1B3AA 2L9HA 1M8AA 2B2YC 2MGSA 2M2LA 1WVLA 2H1EA 1X3QA 2HUGA 2RSOA 2L11A 1NCVA 2R3ZA 2X6LA 3IFDA 4IUPA 2KVMA 1QE6A 2B2TA 2N55A 3Q6SA 3FDTA 1WTPA 1CA5A 1B50A 1MI2A 2MP1A 3FPUB 5EKIA 2FINB 1B53A 1S4ZA 2B2WA 4IUTA 1MGSA 4IUVA 4ZKCB 2CVRA 2K28A 3KUPA 2Q8TA 1MSHA 3G7LA 1U4MA 1U4LA 3D6WA 5EQ0A 2B2WC 1BO0A 1LV9A 1HUMA 2X69A 3TZDA 5EJWA 4MHEA 4QUCA 5T1IA 1MSGA 2JP1A 4O42A 1AZQA 1NAPA 1HFNA 1A15A 1BF4A 3MTSA 1XYIA 4OIJA 1DOMA 2RSNA 3R93A 2KEDA 3IL8A 1PLFA 2NZ1D 4R8IA 1WTXA 5EPLA 5AFWA 1WTOA 1J8IA 1U4RA 5EPKA 1X32A 1PFMA
chains in the Genus database with same CATH superfamily
3DMUA 1G2TA 1U9RA 2ZT9C 4DK1A 2B2UA 4C3IH 2EIFA 3P7JA 4LF5Q 1F2YA 5C5LA 1VQBA 2ZXRA 3OMGA 4JI2Q 1YJNA 4DR1Q 4KK7A 1C7YA 2LKVA 3U4VA 1SNCA 3RZOB 3CP0A 4R4TA 1PTOD 3MXNB 2IX1A 5C4XH 3L9AX 1LT4D 4DR6Q 1D1KA 1M4VA 2GVAA 4WJWA 3DUZA 4OXPA 1F2ZA 5FO8B 2RBMA 4CJ0B 5LMUQ 5CV9A 3DXJC 3RZOH 1EYAA 4DV6Q 4O2DA 3A5UA 3FRPB 1SAPA 5EKKA 4L6TB 2ALYB 1TY2A 4KN7C 4JW0A 4JBMA 4DK6C 2R7ZG 1IYJB 1PVOA 4B9WA 4N9PA 2JEAI 2EOTA 2TMPA 2JSOA 3G48A 1AZPA 1XNRQ 3E0EA 1I94Q 2OF1A 1K0SA 1LO5D 1TQOA 2HCIA 4JBWA 1ASZA 4LF7Q 1SNDA 1PRTD 1ONLA 2A6HD 1DD2A 5C4HA 1I50B 1S3OA 5E4XA 4X3SA 1YIJA 2NTTA 3RLFA 1NBWA 2BDNA 2VQEQ 1B3AA 2MUYA 3I70A 1K9MC 1YHBA 1LM0A 3U9SA 2EXDA 4B3ML 2ENBA 1BQQT 4GLXA 5CV8A 5DM73 3SGIA 3HRZC 1RCVD 1WOCA 3EFXD 5IP9G 4LFCQ 1XPUA 3CU7A 3M4QA 3KFUA 3V96A 2PI2A 2UXBL 2I07B 3IFTA 1A63A 4DR3L 2F0DA 4EQNA 4FXDA 4U673 3H3VH 2KEDA 3S1QB 2R7ZB 1PLFA 1J8IA 2WINB 2D2CC 3K7AB 1XXGA 3CCSA 3MWYW 2BOSA 4LFAL 4C1NK 2ZM6L 1JE5A 4EGVA 1AEXA 1F2MA 4X6AH 2MPMA 3JAML 5G3LD 3S1QH 2R7ZH 1EQTA 3A5ZB 3NWSA 1RTOA 3TREA 4WJ3M 3K7AH 4BBSG 4X62Q 2PMZE 5A35A 1EFWA 1KNAA 4IUNA 1A2TA 1HNZQ 2WP8J 4HN7A 3QR8A 1IHZA 2SNSA 4IN3A 4B3RQ 1Q90A 4GKKL 1VQFA 1G2SA 3GV6A 4B3SQ 1UEAB 2NB0A 4XT3B 1I4XA 2UU9L 5TSSA 1AFPA 4JI3Q 4K6DA 2K04A 2R7DA 3KF8A 1D5ZC 4RHRA 2K7VA 3BU2A 5IT9E 4TVAB 4WORA 5CC4A 4X65Q 4G57A 1PH4A 1C8CA 4RH6A 5IP9H 1TWFH 1XMQQ 2QEXA 2A6ED 4KD4A 2LY7A 1HNXQ 4K2KA 2KCTA 2GA4B 1ET9A 5GADC 2ASBA 4IUUA 4YWLA 1G6ZA 1N34L 1KD1C 1JWMD 3R2IA 2RDGA 4LF9L 1Y8PB 1JB3A 2KHIA 1D7QA 1S5DD 3J7ZC 1Y1VG 1DONA 1O7IA 4JI8Q 2XIWA 2A6HC 3VR4A 2RCNA 2E5LL 1EFID 1VQ7A 1GD7A 5IGFA 4BBSB 2JJQA 2L9HA 1SNQA 3TP6A 3VYUA 2B2YC 1H9JA 2M2LA 1KHIA 2RSOA 1XJVA 3BYTB 4RCNA 3IRBA 3U58A 4ILWA 5EKIA 4ZKCB 1U0LA 4JI1Q 4YHHL 2Q2UA 1CHQD 2EYFA 3S14B 4BBSH 2ICEC 4JOIA 3J7AV 4IJLA 4FNFA 5ELNA 5C0XJ 2LXJA 3MTSA 4NXNL 3FKIG 1R9TB 5CV4A 1GUGA 2Z4IA 1BDOA 2NZ1D 3S1NB 1SXTA 1UE5A 2IX0A 2ZXOA 3TMEA 3K80C 1K83B 1B8AA 3OSOA 4LUOA 5BR8Q 3S14H 1EIHA 3F1ZA 3EQLC 3WDNA 4PZ7A 2ZXPA 1Q7YC 2RF4A 1JWSD 1O7LA 4YWMA 1R9TH 1L0WA 3S15B 1YEZA 1M1KC 1Y1VB 1J5EL 3S1NH 2H4OA 4F7XA 2PO4A 5EPJA 1JOQA 2UUCL 1K83H 1PYBA 4DAYB 1V1OA 1I6VC 4IPDA 2DJFC 1PXUA 4OX9L 4UDUC 1ENFA 1G91A 3NP8A 1QILA 2EY5A 4NDXA 3S15H 2OQKA 2JA5G 1DZ1A 1Y1VH 4YCWA 1GO3E 3PO2G 1ET6A 1YNXA 1X3FA 2FFKB 5C3EG 4Z9CB 1Q1BA 2KJXA 3S1MB 2JA8G 2ZTEA 1B9MA 3ICEA 1PV4A 3FKIB 1V9PA 4JYAL 1KDCA 1VQMA 3LWEA 1X3PA 4XT1B 2NN6I 2KUMA 4IFDJ 4JI0L 3MZ5A 2XWBB 2IWHA 1SSOA 3CQZB 3K6OA 5IIFA 4XYOA 4B3MQ 1K3RA 3HFZB 3IKJA 3S1MH 3HZXA 4M1UB 5EBDA 1E0BA 2ICIA 1F9QA 3CMEA 3FKIH 3PIPA 3K5OA 1SBBB 5FLXL 2UXBQ 1IL2A 4DR3Q 3CQZH 1LTBD 4A3FG 2CW0D 3TZUA 3DWAA 1JR0D 5KYIA 3D4DA 3NE5B 3DWQA 3NUCA 3Q23A 1CA5A 4MTNA 1OO9B 1YNJD 2JA5B 2DNCA 1N36Q 3P20A 3PO2B 2ZM6Q 5FLXc 5C3EB 3VA7A 4OL7A 2JA8B 1XYIA 1Z9FA 1DOMA 1BCPD 3IL8A 5AFWA 4N9TA 1HZCA 2LMCB 2JA5H 1EQRA 3QJYA 1SDFA 1NNXA 2RCFA 3I91A 4HCEA 3PO2H 3PIO3 4IOCA 4CDCC 4RMFA 1W2BA 5C3EH 1F9SA 1QNKA 3C1EA 4BA2I 1I4PA 2JA8H 2F3WA 1KIXA 2F0OA 1A62A 4P71A 4B08A 4DV4L 3RZDB 2D0OA 1E7ZA 1JT8A 4GKKQ 3M4OH 1HFGA 4DV7L 2G9DA 1VF5C 4A3FB 3CCJA 5LHY1 4YWKA 5JEAG 1XMOL 1HTPA 5E3FA 1ESFA 3MFYA 1JQYD 1HUNA 2CWAA 2IL8A 2QDLA 4RFBA 2P5ZX 2EY6A 4A3FH 1C0AA 1VQOA 2A68D 2HCCA 2XRQD 1FYCA 1GXDC 1TR5A 1N8RC 2N78A 4HTHA 4K14A 3KK7A 3NTIA 4GN4B 3DEPA 4U68A 1S40A 4DAMA 5KEEA 2R7FA 2WKDA 1Y14B 5KRUA 1HJPA 4WJ4A 4JI5Q 3U4ZA 1FNVA 4P75A 4YY3Q 3BZDB 5M3MG 5JEAJ 3A56A 5J3BA 4PNYA 3VR5A 4FYDA 3SK8A 5CGKA 1VQ4A 1TY0A 5GROA 5FKAC 2PMZB 3IFDA 4H7BA 4DR7L 1BBUA 2R61A 4KMUC 1B9NA 2WACA 1Q8IA 4V190 1YJ9A 5EAYA 1S4ZA 2NVYB 3F2BA 3D4RA 2YU9B 3STBD 3TP7A 2X69A 4F8MA 5T1IA 5IWAL 4IZ8A 1YHQA 2OTLA 1BF4A 4H44C 1FVIA 5JEAH 4HMIA 3MEFA 2F0JA 4L5RC 1Y1WG 4K5VA 3T1HQ 1PFBA 2NVYH 3EROA 3LWUA 1EU4A 1TT2A 3K5MA 2YU9H 2Q8RE 2BCOA 1EY7A 2KEEA 1JJGA 1G51A 1TIID 2RHSB 3PSIA 1TVXA 2UXCQ 1F9RA 2B2UC 1BOSA 5IY0A 3CCLA 1TU2B 4LF4L 2IHFA 4DA2A 3BJUA 4JV5Q 2XGTA 4CKCA 4IPGA 5JPNC 1QUQB 5M3MB 1WTQA 5IYCG 4WRDA 1L0YB 2N3SA 2L4NA 1STYA 2HHHQ 1PH3A 4JI6Q 1LTLA 5LL6S 5D65A 3Q24A 1LTSD 4ZQ3A 4HJ5A 3K0XA 1K8MA 4AQYQ 4CJ2C 3GTLB 1NTGA 2K05A 2PNHA 4JI0Q 1HR0Q 4HJ9A 3A74A 1VQKA 2Z1CA 5M3MH 5M5XB 1SYCA 5CR3A 4FF2A 3KJPA 3SK6A 3W2DA 1BBXC 2AUJD 4HJAA 5KNCA 3GTOB 2JE6I 4OHJA 1HR0W 2VQFL 1Q8KA 4R8NA 4X66L 1X55A 4A76A 1VQ8A 2F0QA 3S1RB 1JICA 4LF8Q 3ZJYC 4JI7Q 1VQGA 1Y1WB 1UAPA 4GOPA 4KI0A 5CBEE 1TS5A 1VQEA 5M5XH 1CUKA 4QMGA 2N88A 1GUTA 1GHKA 4HJ7A 2OEOA 3U9OA 3S1RH 1KRSA 4C3IG 3C2PA 3M7NA 1Y1WH 2EVBA 1KABA 1FD7D 3S2HB 3D31A 3R2TA 1H95A 1X65A 5M9OA 4OONA 3GTQB 3T56B 1X3EA 1MHWC 3A8KE 1SYBA 4DAPA 5I2XA 5C4XG 5AJ3L 1B50A 4FDBA 1KTKA 1K8GA 3C1FA 4NKLA 3S2HH 3NBHA 3O13A 5IYCH 3M9BA 1EEID 4P74A 2SEBD 3H6MA 3EIVA 3GTQH 2D0PA 3TSSA 4L5TA 1FJGL 1NAPA 1SE3A 2F0IA 1HFNA 2B29A 3K0YA 3NPPA 4R4QA 3HOWG 3EN2A 5IODA 1WTXA 1STGA 4I7ZC 3H0GG 3GTMB 1YITA 1KQSA 2F0KA 1W3SA 2NVTH 2KCNA 4I65A 1UWVA 4PMWA 1SYEA 1P16A 4DV5L 1XMOQ 3TP8A 1NUCA 4HMJA 4ID6A 1X3GA 2YV5A 3CW2C 5J22A 4C3IB 3I55A 4NXML 2WB1E 3NK9A 3GTMH 2MO1A 3KLWA 1IKLA 2UUAL 3KYHC 1IW7C 1KC8C 4GKJL 4X64L 4DR5L 3NENA 5C4XB 1H9SB 4FXKC 1ZXTA 5I2YA 4HIMA 2E76C 4PMCA 1M90C 4KY5A 4GNXA 1PH1A 1QOHA 4DN4M 1Q1EA 1OXVA 5JJIA 3UDIA 4OWXB 2YTVA 4XYQA 1CZWA 1WTVA 4DKAC 5JPMC 3A8IE 5CV7A 3HOWB 5IYDG 3D6CA 1DOKA 2X6GA 3T4AC 3H0GB 3J80E 1EY9A 1PHJA 2AKWB 4KHPQ 4R4CA 3M3YH 1SEBD 2K52A 3MC0B 3QB3A 4XQJA 5I4DA 4K5XA 1FGBD 3NEMA 5K36G 1IZ6A 1OXSC 1EEFD 2OCEA 1LT3D 1E2WA 5FO9B 1HPCA 4PZ8A 1IBLL 2F0PA 3OTOQ 2A1AA 2K01A 2QKIC 4RAUC 2MQHA 3HOWH 1PFSA 1JMCA 3KF8B 4A3BG 2R6GA 3H0GH 4K0KL 1DYQA 4HSPA 2G9HD 3L0OA 1Q3LA 1WFQA 2F1MA 4MN3A 4QCLA 3EVQA 3OWFA 2MGSA 1PRTF 4RGOS 1EOVA 3HOXG 1EYDA 2A69C 2KVMA 3BYYB 1ENCA 4K2LA 1WTPA 5FLMG 3J7YW 1SE4A 3TEHB 4DUYQ 3KLRA 2AQ2B 2EYHA 1BO0A 3H3VC 1IXRA 1ZYRD 3PO3H 2N8NA 2NN6G 1AE3A 3KDFA 4DXFA 1UNSA 4WFN3 5FOBB 4QQBX 5EPLA 1PZKD 3KF6A 3F2UA 2F0UA 4A4IA 2DY8A 3E6ZX 2J0TD 2HDMA 1IBMQ 2CHBD 1C48A 2MNAA 3L2PA 4IALA 1Y8NB 2AWNA 5IYDH 4A3BB 1JOKA 3SVMA 4KKUA 2WFWA 2RHQB 3HOUG 4C3HB 3BG3A 1SE2A 1CKNB 5LMNQ 5G3LF 4RA8A 5K36H 1SYGA 2PZTA 3VR3A 2EZVA 1MJEA 3HOXB 5DM63 2K5NA 2KCCA 2RA4A 1RJTA 1C4QA 2V1CC 3FMCA 2NVXB 3QOLA 1K0RA 5LMNW 2IHEA 2HD3A 2K5QA 2K5WA 4A3BH 3HOYB 3SHLA 4K6LA 1B2TA 1H9SA 4ABNA 4C3HH 2E2HB 4IUQA 1AP0A 1VQPA 3TS2A 1O7YA 3HOXH 2NVXH 4YIJA 1HTLD 4KHVA 4PV1C 5FLMH 2OWOA 3NTKA 4A3GG 4A3MG 1Z47A 2AQ3B 3HOYH 2QF7A 3HOZG 4DV1L 4XIGS 2E2HH 2ID0A 5JJLA 3ITPA 4J8QA 2Z6BA 4HJ8A 1PH9A 4J1MA 1MD2D 4B3TL 1TWFB 3P75A 2NN6H 4JI4L 1J9OA 4OEMB 4DV0Q 1MKHA 3BDLA 1SYFA 4O0AA 2EYMA 3HOUB 3CC4A 1JORA 4DR2L 4BY7G 4IO9A 4DV3Q 3GTGB 2NZOA 1JC7A 1E3PA 4AIMA 4R4IA 3RLNA 2VY3A 1TS3A 3BS1A 2B2WA 1KRTA 4H02A 5I6YA 3ULJA 3HOUH 1A3TA 5HGTA 3D6WA 5EQ0A 1LV9A 4EQPA 1R4QB 2Y0SE 3GTGH 4OO1I 3AEVA 3H94A 1ZYRC 1PH8A 3KOJA 3OPOA 1U4RA 3PIP3 1PTOH 2TSSA 1STBA 4UY8C 4UHVA 4ZRZA 3BZKA 4A3GB 4A3MB 3CMAA 4ULLA 4GKJQ 4R4OA 3HOZB 1LYLA 4ME3A 1NMFA 3FPPA 3WOEA 2K5VA 2KOLA 1SRUA 2B2TC 4BXXG 1UE7A 1AH9A 2ZTDA 3TRZA 4RGMA 2EQSA 4DV2L 1BNZA 4A3GH 4A3MH 4LUZA 2GN5A 4LW1A 3HOZH 4L8JA 1XNQL 1I3QB 4BY7B 5JJKA 4KY7A 1PRTB 4CHTB 1EWIA 1RODA 3HKZE 1CKNA 2V4DA 4O1NA 3ND8A 1X54A 4CDEC 1IBKL 3K7UC 2JYOA 2NWGA 5IGEA 2YTYA 4XTCS 1K73C 2B8GA 1RIPA 1ICFB 1TS4A 3CC2A 1A3UA 1I3QH 4BY7H 4A3IG 1XWEA 4N8X1 2BH2A 5A2QE 5DNFA 5FJ8G 4LK1C 4K0KQ 2XTIA 2ATWA 1T9HA 4EVOA 3HG9A 1LUZA 4QF4A 5CBAE 1NSNS 4R1JA 2MHVA 4NP5A 4HEDA 1A8VA 4A3KG 4MNOA 1Z7TA 4G7HC 4LF6L 3RR5A 3W3AA 4OWTB 5JVH3 2HUGA 2O5IC 1HNWL 2VNUD 3WOFA 1Y69U 2XVSA 2FXQA 2SNMA 1B70B 3A0JA 4J6HA 1PH5A 1T5XD 4TSSA 4BXXH 4FF1A 3FPUB 1N33L 1E1TA 1FR3A 3UE1A 1VQ6A 4RGNA 3G71A 5ELBA 3K5LA 5M3FG 1N32L 2F4VL 4Y7NB 2ZTCA 3I4OA 1UE1A 3S9WA 3S2DB 4A3IB 4F87A 1XTDA 1V1PA 4EQ5A 4MIUA 5EPKA 4B9XA 1EQQA 3HOVG 2ES2A 5ELOA 5C6AA 1YJWA 2KECA 1XTCD 3NELA 1A3VA 4H13C 4Y7NH 1PDQA 4HIKA 3SXHA 4QIWE 1QVCA 2XSCA 4UPAA 3S2DH 3QIAA 1EUJA 4A3IH 3CAMA 1B3QA 3K81C 4LFAQ 4LAAA 4A3KB 1CHPD 1ICWA 2F0HA 5FJ8H 2EJMA 5D14A 1O78A 1PYSB 1PFNA 3N6RA 3VYTA 1QCBD 1H9MA 4KKSA 5JOBA 2R93G 1WJJA 3DLLA 1CA6A 3M4OB 4A3KH 2B2VA 3I3CA 4XXEA 4KV6A 4P73A 1ENAA 1IKMA 2PQAA 5IGDA 1S5ED 1Q12A 2K14A 2VB3X 3I90A 4RGTA 2A5HA 3OWEB 2KHJA 5M3FB 5FK9C 1KAAA 4XQNA 3VDYA 4B3TQ 1A6XA 3CCVA 1VQAA 4KHZA 4GLAC 2EYJA 1SNMA 1NMGA 2B8FA 2E2DC 4JCVE 4DNTB 1BBWA 3D4WA 4K8JA 2UU9Q 3AYHB 3HOVB 3I4MG 1GKHA 4IPHA 4IPCA 4QUFA 5M3FH 4GOPC 3ND9A 1STEA 2UUBL 4GZYC 3E5SA 5C5MA 2K1BA 3TBIB 3JAME 3CKIB 3BVMA 2A19A 1EWHA 2NTSA 1N34Q 3PUYA 3HOVH 4LF9Q 3CRLC 3OHXC 4GOPB 3GTJH 1SLJA 1STAA 2F0VA 3UDXA 2E5LQ 2R93B 2UXDL 1G6PA 4Q0FA 2H1EA 4C56C 2A74C 4ZCKA 1Q46A 4EQOA 3HEJA 1MI2A 5C0XI 1CI3M 3RN2A 4LFBL 3KUPA 4J15A 2E8GA 4YHHQ 4MHEA 4G7ZC 2R93H 2JP1A 3CF5A 3DHQA 3TQYA 3G6EA 3CCEA 5EGTA 3RN5A 4LF5L 2I5LX 1VQDA 3ONAB 4NXNQ 2HQLA 3I4MB 1CQVA 1B4OA 2FMCA 2YYZA 3K57A 3G4SA 1XNQQ 3NBHB 5IYBG 4ZAIA 1VS0A 2XRSD 4CKEA 1VMPA 4JI2L 4DR1L 1LT5D 3EA6A 2EE1A 4OELB 3BVZA 1RKNA 3LGJA 3D0FA 3NXWA 4DR6L 3PF5A 3MAQA 5D3DA 3I4MH 2B63H 1QG7A 1PMRA 1VQIA 2PPBC 1J5EQ 5LMUL 2QCPX 2UUCQ 1RF2D 1GVPA 2Z6KA 3M85A 3HKZG 4DK0A 2BA0A 3EJIA 2VXWA 4OX9Q 1RHPA 2F0GA 5I9PA 3SDZA 2CQAA 2HDLA 3VR2A 4IFDI 2F0WA 3PMFA 2ZJRA 3H09A 1EWCA 1XNRL 1IW7D 2AWOA 2IPKD 1I94L 3SR1A 1WD0A 3OOCA 1LABA 2IW3A 4JYAQ 4LF7L 2BA1A 2CH4W 3DEOA 3UDGA 2AQ1B 2QGQA 2L1BA 4GNXB 1R4PB 1SE8A 4MZ9A 3J80i 4BY1G 4HR7B 5NUCA 3AFQA 2VQEL 2RKSA 1OXXK 1CQFA 2JQOA 1QVGA 3RD4A 3ERSX 1GJXA 2IY5B 5IYBH 1B7YB 1F77A 1M8AA 1JJCB 3OMCA 4HIOA 1A2UA 2D62A 2L11A 2F0NA 3Q6SA 4LFCL 2RDHA 1KAWA 3HKZB 3W5OA 4RHSA 3J7AF 2O5JC 1KL9A 5D3IB 2F0TA 4L5SA 4POFA 3BZCA 1X56A 3AMUA 1U4MA 1S5CD 4F88A 3TZDA 5EJWA 2Q8IB 2ZJQA 1XPRA 5CV6A 5IT9L 1L1OB 4PMBA 4DR4L 3MXPA 1WTOA 1K28A 2D5DA 2A69D 1TS2A 3GP7A 2BE5C 4KKTA 3T1YL 2PQEA 1XPOA 2XWJB 2ZJPA 3RNUA 3NBIA 3SE0A 3VA5A 4BY1B 2NVTB 4JPBW 5EKLA 2CCZA 3KDFB 3M4YA 1RTNA 1UUPA 4JVZA 3X3NA 4X62L 3T13A 1K8AC 5IT9c 3L3OC 2MFIA 3KF6B 1CKOA 1W6KA 4HSVA 4DV4Q 3E0JA 1KLGD 3DM1A 3J81i 4LWCA 4DV7Q 1G291 1TWGB 4BY1H 2K03A 1HHVA 1B44D 1QZHA 3GTKB 1CSQA 2WV6D 3UDFA 1VQ9A 4CJ1B 4B3SL 3Q0AA 4X3UA 2F03A 1O80A 4NB3A 2WAQE 1SMYC 5KYLA 4OO1G 4JI3L 1JWUD 1V1QA 4S3SA 3AB9A 4QY7A 1A0IA 3RUZA 2Q2TA 4X65L 1O7ZA 1TWGH 3D8GA 1BVSA 1I4GA 1XMQL 2M00A 3GTKH 1HNXL 3PO3G 3WWVA 3SEBA 2QDBA 1ILPA 4GLVB 5KGUA 1VQJA 3TP5A 1E24A 1PTOF 1CM9A 3EBEA 4QIWB 4JI8L 2QILA 3ULLA 3M3YB 2D9UA 2F0FA 3HS0C 2VZAA 4DU9A 1EOTA 1ESRA 3QOJA 3HKSA 2J7ZA 4KLKA 1TXYA 5K5PA 2O4XA 2H5XA 1KDBA 1PZJD 1WVLA 1VQHA 1X3QA 3MA2B 1MIUA 1NY4A 1SJED 4JI1L 4NPSA 2PNRC 3K58A 4DPGA 5GAHC 4DR7Q 1MGSA 3CCUA 2Q2IA 1ZEQX 2K4KA 4AH6A 4M8AA 4P2CB 1U4LA 2B2WC 2K32A 3NSWA 5J1ZA 4ZUIA 4DNIA 4PG3A 1PH2A 3RMHA 4C3HG 3S17B 5IWAQ 5BR8L 3ERQA 1E2VA 4DF7A 2VUMG 1V8QA 5FO7B 4RWSC 1DOLA 4UP7A 3PO3B 1L1OA 1D8LA 3I8ZA 3DM3A 3BDCA 3ZYYX 4OO1H 1EZ6A 4LJZC 4ZLTF 1SFOB 1CKMA 3N52A 3HOYG 1WCMG 2KQ3A 3S17H 1Y8OB 3E9IA 5F2DA 2A8VA 2C9OA 2WIIB 3R3OA 1AE2A 4LF4Q 3H91A 1TKWB 5E4WC 4JOIC 1C9OA 4FP5D 1SFOH 4RKLA 4ZK9B 3S16B 3VR6A 1EIGA 1OXUA 1S5FD 3E3XA 4NW2A 1F2LA 5C44G 3W1BA 5IP7G 1QZGA 4JC0A 1GUOA 5CMDA 3QO2A 1SR3A 1JE4A 1EY8A 4POGA 4A75A 1KNEA 3J81E 3UI2A 4KN4C 3B6YA 3S16H 4DFAA 2GVBA 3URYA 2I46A 5BN3A 1EIYB 2VQFQ 1E22A 4X66Q 3LX0A 2VUMB 4X3KA 4PZ6A 5GAEC 2Z8LA 3PCOB 5L37A 2EY2A 1I50H 1CK1A 1EY5A 3X3MA 3PQIA 5CYUA 1Z6HA 2Z4HA 1AN8A 1WCMB 2E74C 3A8JE 1OTCA 1HH2P 1EL0A 1L0XB 1I4RA 1B1ZA 4G4KA 2VUMH 3OIPA 1QWYA 2EXZA 3KLSX 2IT1A 2F4IA 2B3GA 4QB4A 3CCRA 1EU3A 2K6AA 2A73B 5JVG3 4DR4Q 2N55A 2JXMB 1N36L 1WCMH 3PUVA 3AU7A 4ME5A 3T1YQ 5C44B 4A3CG 4IUVA 2K50A 2VL6A 3PV0A 5AJ3Q 4K8IA 2QW7A 4A3JG 1GOZA 4QUCA 5EBCA 2KCMA 3SK5A 1PTOC 4PQXA 4R8IA 1FJGQ 2JA7G 3MXNA 3MHBA 2F52A 1PFMA 5C44H 5IP7H 3F2DA 3VYSA 2L12A 5IGBA 4DK3C 4HCSA 3SK4A 3JAMc 1EYCA 4CGYB 1TWCB 2DGYA 1YVCA 1PTOB 1I5FA 4JK1C 1HZBA 1II3A 4DV5Q 2F3VA 3GO5A 3F2CA 1I4HA 1HCZA 1HRJA 3H15A 1V1PB 3KBXA 3CCMA 2KHSA 1WI5A 4X3TA 4NXMQ 2NUCA 4MTKA 2PZWA 3BVGA 4L63B 5ELCA 1TWCH 3Q22A 5C0XG 2UUAQ 1WTHA 1G8ZD 5C3XA 2LSSA 2Z9HA 3NWTA 3V2TA 3K5NA 4X64Q 4DR5Q 2WAQG 1Q82C 1WTWA 1U4PA 2B2VC 1DJRD 4L5QA 2DY7A 5C4JB 4A3EG 1PRTC 4A3JB 1VQLA 3PUXA 1HA6A 4GS3A 4C1NI 2WB1G 1LLRD 2E75C 1BR9A 2OTJA 5COYA 1WD1A 1LTAD 2JA7B 2HIXA 4CDFC 1MBYA 4A3CH 2PW7A 4FXGC 2NZHA 4JI5L 2PQAB 2HT1A 5C4JH 1HXYD 1QVFA 2JN4A 4YY3L 4A3JH 2EDGA 1J6QA 4DGZA 1H9RA 1GM5A 3PUZA 1CZGA 2JA7H 4K5WA 1IBLQ 4JBJA 2I5MX 1IYVA 4P72A 1EY0A 5CV5A 5H1SE 2HQEA 5GAGC 5C4ZA 3JAMi 2QA4A 1HZAA 3PGZA 5IGCA 1SYDA 2Q2HA 1QNUA 2R3ZA 4QGUA 4IUPA 3T51B 1SN8A 1NE3A 4LUVA 4TRDA 3IAYA 2LFNA 2FINB 3K59A 3H3VI 2OT2A 4Y52H 2CVRA 4IFDG 2I5HA 1RD9D 2OXPA 2WAQB 5IOCA 2CFMA 1I6HB 3G7LA 5DAUA 3VYRA 4A3EB 3M4PA 4KJOA 5E7NA 3T1HL 1A15A 3J81j 5C0XH 2WB1B 4CKBA 1TWAB 2F0MA 1LACA 4FO2A 3CRKC 1YI2A 1X32A 2LXKA 3UE0A 4NMZA 3CCQA 2UXCL 5ISRA 3KLSA 1I6HH 5I9OA 4A3EH 4JV5L 5ELDA 1T5EA 1JJ2A 1TWAH 1WYDA 2DNEA 3KBGA 3CD6A 5ELFA 3A54A 5GQOA 1SNPA 2DUDA 2HHHL 4KY6A 4JI6L 2EY1A 3CPFA 4XQQA 1CT1D 1UEBA 2JEBI 4EX5A 5I6WA 4AQYL 4OIKA 3CHBD 3MFGA 3OW2A 4ZYSA 1HR0L 2PI2E 1EY4A 1NR4A 1D5XC 2EYOA 1LTTD 5HURA 1S72A 2CKZB 1ILQA 2A6EC 2JA9A 4QL5A 1STHA 1BCPF 3GV3A 4OWWB 2Z6KC 1N9WA 1GUNA 2QEJC 1KLUD 5CORA 4LF8L 2AMCB 2Z0SA 1FL0A 4JI7L 2PW5A 4IJHA 2NVQB 3KJOA 2K5HA 4XDXA 1PA6A 3TN2A 4AYBE 1RDPD 2CH4A 2RVLA 1ZKOA 4R9WA 3JC66 4IFDH 3T16A 3U50C 1ASYA 1SROA 2MJ8A 2I0QA 3HP3A 1QB5D 2NVQH 4DV1Q 3OW7A 2EJGC 1JOOA 4N8FA 1HA5A 2B2YA 2SOBA 5ELEA 1E1OA 4JI4Q 2JK8A 2BDOA 2NBFA 5DLQE 3I56A 3DWPA 3I2ZA 4DAVA 4RG1A 4UAIA 2X6LA 5LL6X 1U5KA 2B2TA 3NTHA 2B63G 1H9KA 4DR2Q 3GTJB 2KBNA 3FDTA 4DUZL 3I72A 3D3RA 1B53A 2AHOB 4A3LG 2KENA 4Q5VA 3GD7A 1K3BC 1OXTA 3FP9A 4A3DG 1MSHA 4CBVA 3PUWA 2L55A 5M5WB 1HUMA 3CC7A 2F3IA 2E2JB 4O42A 2YTXA 3BDOA 5IGGA 4OIJA 2RSNA 4HIDA 4JBKA 2DN8A 3MXUA 3J80L 2XN9C 4I7AA 5M5YB 1NR2A 4JG2A 1GUWA 4DAYA 2L5TA 3RZDH 1CFMA 5M5WH 4APVA 1JCKB 2E2JH 2PCFB 4RKBA 5T1GA 2O2LD 1WTRA 2CWPA 2R92G 2FJ2A 3I7FA 1EYGA 4ODGA 5KIXA 3QWNA 2OQ0A 5E1FA 1BKBA 5M5YH 2LS01 3Q8DA 1SMXA 1EQVA 1DM0B 2Y0SG 5HY6A 3J80c 3RLOA 3I73A 2F0SA 3M7GA 2BE5D 1KDAA 4BS9A 4DV2Q 1XX8A 1W6JA 3FVQA 1QJOA 2M9VA 2B63B 4BWGB 1PH7A 5KNBA 3AQQA 4IQZA 5JAVA 4C3JG 4A3DB 4ZKBB 1IBKQ 1CSPA 1GUSA 2KA7A 4FVMA 1D5MC 4BA1I 1DCZA 1D6EC 1D2BA 3TS0A 4KHPL 3CXCA 3A7AB 1KXLA 1CTMA 2CW0C 1LTID 4A3LH 2JA6G 3L7ZC 1ML0D 3W1GA 3OTOL 4DV6L 3I4NG 1YNND 3K8AA 4TKOB 4A3DH 1D1IA 2C35B 3MEHA 1RL2A 1SMYD 1SNOA 1YNJC 3J81L 1HQRD 1K8OA 4ZUJA 2R92B 4CDDC 1X9NA 2AUKA 2FHTA 2PZUA 4GNXC 4IOAA 2Y0SB 3PIOA 1HQMC 3T53B 1EY6A 4LF6Q 4GN5A 1BCPC 1FNUA 4GN3B 1DXMA 1NCVA 3GQBA 1QE6A 4A93G 3NHHA 1P8LA 4DUYL 2L0CA 1E2ZA 5BN4A 1HZ9A 4KTAA 2R92H 2EYLA 3R8BA 4IUTA 1HNWQ 1FNWA 2N49A 3J81c 3G6JB 4E6IA 2K28A 4V0BA 1BCPB 4BBRG 1LTGD 5BN5A 3NQTA 1VQ5A 1N33Q 4C3JB 1AZQA 1S5BD 4DNRB 1N32Q 2F4VQ 4RCOA 5C3WA 1PH6A 3MXGA 3MVVA 1IBML 3FHWA 4TQUS 1VDZA 2E2IB 2XNAC 2C5CA 2JA6B 3I4NB 1X6OA 1VCIA 2SDFA 2CQOA 3A7LA 4C3JH 3S24A 1I4QA 3J7A5 1L1OC 4C2MB 2VS1A 4FF4A 1BUVT 5DEHA 2IJ0A 1VMCA 5LMNL 5HGQA 2E2IH 2A68C 3A55A 4UP9A 3GTLH 1LTRD 2NYZD 2JA6H 1FGUA 3I4NH 3I4LA 4YCUA 3P1HA 1Q81C 3V05A 3FEWX 4C2MH 4IURA 2F0EA 2VW9A 4QJFA 1V43A 4A93B 3ULPA 4LNQA 1BXTA 1GHJA 3GTOH 2WKCA 2F0LA 3ER0A 1JB7A 2RDFA 2G5DA 1Q86C 4BBRB 1SJHD 3GDEA 1IYUA 4OGQC 3CPWA 2K5DA 5FLXE 4A93H 4AYBG 2L15A 1LT6D 4H0LC 4HAEA 3C3LA 1HNZL 1VF7A 3E9HA 1NJIC 1PZID 1UE6A 4LMQD 5IE8A 3PF4A 2EPBA 4B3RL 4BBRH 2RQXA 1F9PA 1IL8A 2FMMA 1YNNC 5JJZA 4DV0L 2VB2X 3OYYA 3TDQA 2UUBQ 4DUZQ 2MO0A 3STBC 1YBYA 4DV3L 5KNDA 2BH8A 4G7OC 3F8TA 2IX3A 1DGSA 2J4XA 3OIQA 1YZ6A 3C46A 4FF3A 2HIVA 3GTPB 2K33A 2UXDQ 1EZ8A 1VQNA 2B39A 2MP1A 1TWHB 1EIFA 3AFPA 1AW7A 1VQCA 2EYPA 4YCVA 2DJGC 2EJFC 3NQIA 2K75A 4KJNA 4UP8A 2Q8TA 3LNNA 1L2FA 4ALPA 1PYWD 4DXGA 1YHAA 1MSGA 4LFBQ 5A2QL 3R93A 5J39A 3QG1A 3GTPH 2PYKA 1MJCA 1QUQA 4AYBB 1STNA 4KD3A 3HGBA 1TWHH
chains in the Genus database with same CATH topology
3DMUA 1G2TA 1U9RA 2ZT9C 4DK1A 2B2UA 3P7JA 1F2YA 5C5LA 2ZXRA 3OMGA 4KK7A 2LKVA 1SNCA 3RZOB 1PTOD 2IX1A 3L9AX 1LT4D 1D1KA 1M4VA 4WJWA 3DUZA 1F2ZA 5FO8B 2RBMA 4CJ0B 5CV9A 3DXJC 1EYAA 3FRPB 1SAPA 5EKKA 4L6TB 1TY2A 4KN7C 4B9WA 4N9PA 2JEAI 2EOTA 2TMPA 2JSOA 1AZPA 2OF1A 1LO5D 1TQOA 2HCIA 4JBWA 1SNDA 1PRTD 1ONLA 2A6HD 1DD2A 5C4HA 1I50B 5E4XA 4X3SA 2NTTA 3RLFA 2BDNA 1B3AA 2MUYA 3I70A 3U9SA 2ENBA 1BQQT 5CV8A 5DM73 3HRZC 1RCVD 3EFXD 3CU7A 3V96A 2I07B 3IFTA 2F0DA 4EQNA 4FXDA 4U673 2KEDA 3S1QB 2R7ZB 1PLFA 1J8IA 2WINB 2D2CC 3K7AB 1XXGA 3MWYW 2BOSA 4C1NK 4EGVA 1AEXA 1F2MA 2MPMA 3JAML 5G3LD 1EQTA 3NWSA 1RTOA 5A35A 1KNAA 4IUNA 1A2TA 2WP8J 4HN7A 1IHZA 2SNSA 4IN3A 1Q90A 1G2SA 3GV6A 1UEAB 2NB0A 4XT3B 1I4XA 5TSSA 1AFPA 4K6DA 2K04A 3KF8A 1D5ZC 4RHRA 2K7VA 5IT9E 4WORA 5CC4A 4G57A 1C8CA 4RH6A 2A6ED 4KD4A 2LY7A 4K2KA 2GA4B 1ET9A 4IUUA 1G6ZA 1JWMD 3R2IA 2RDGA 1Y8PB 1JB3A 1S5DD 1DONA 2XIWA 2A6HC 3VR4A 1EFID 5IGFA 4BBSB 2L9HA 1SNQA 3TP6A 3VYUA 2B2YC 1H9JA 2M2LA 2RSOA 3BYTB 4RCNA 4ILWA 5EKIA 4ZKCB 1CHQD 2EYFA 3S14B 2ICEC 3J7AV 4FNFA 5C0XJ 3MTSA 1R9TB 5CV4A 1GUGA 2Z4IA 1BDOA 2NZ1D 3S1NB 1SXTA 2IX0A 2ZXOA 3TMEA 1K83B 3OSOA 1EIHA 3EQLC 3WDNA 2ZXPA 1JWSD 1O7LA 3S15B 1Y1VB 2H4OA 4F7XA 2PO4A 5EPJA 1JOQA 1V1OA 1I6VC 1PXUA 4UDUC 1ENFA 1G91A 3NP8A 1QILA 2EY5A 4NDXA 1DZ1A 1ET6A 2FFKB 4Z9CB 1Q1BA 2KJXA 3S1MB 1B9MA 3FKIB 1KDCA 3LWEA 1X3PA 4XT1B 2NN6I 2KUMA 4IFDJ 3MZ5A 2XWBB 2IWHA 1SSOA 3CQZB 3K6OA 5IIFA 4XYOA 3IKJA 3HZXA 4M1UB 5EBDA 1E0BA 2ICIA 1F9QA 3K5OA 1SBBB 5FLXL 1LTBD 2CW0D 3TZUA 3DWAA 1JR0D 5KYIA 3D4DA 3NE5B 3DWQA 3NUCA 3Q23A 1CA5A 1OO9B 1YNJD 2JA5B 2DNCA 3P20A 3PO2B 5C3EB 3VA7A 4OL7A 2JA8B 1XYIA 1DOMA 1BCPD 3IL8A 5AFWA 4N9TA 2LMCB 1SDFA 3QJYA 3I91A 4HCEA 3PIO3 1F9SA 1QNKA 3C1EA 4BA2I 1I4PA 2F3WA 2F0OA 4B08A 3RZDB 1HFGA 2G9DA 1VF5C 4A3FB 5LHY1 5JEAG 1HTPA 5E3FA 1ESFA 3MFYA 1JQYD 1HUNA 2IL8A 4RFBA 2EY6A 2A68D 2HCCA 2XRQD 1FYCA 1GXDC 1TR5A 4HTHA 4K14A 3KK7A 3NTIA 3DEPA 4U68A 5KEEA 2WKDA 5KRUA 1FNVA 3BZDB 5JEAJ 3A56A 4PNYA 3VR5A 4FYDA 3SK8A 5CGKA 1TY0A 5FKAC 2PMZB 3IFDA 4H7BA 2R61A 4KMUC 1B9NA 2WACA 1Q8IA 4V190 1S4ZA 2NVYB 3D4RA 2YU9B 3TP7A 2X69A 4F8MA 5T1IA 4IZ8A 1BF4A 4H44C 5JEAH 4HMIA 2F0JA 4K5VA 1PFBA 3EROA 3LWUA 1EU4A 1TT2A 3K5MA 2Q8RE 2BCOA 1EY7A 2KEEA 1TIID 1TVXA 1F9RA 2B2UC 1BOSA 1TU2B 4DA2A 4CKCA 5JPNC 5M3MB 1WTQA 4WRDA 1L0YB 2L4NA 1STYA 5LL6S 5D65A 3Q24A 1LTSD 4ZQ3A 1K8MA 3GTLB 4CJ2C 2K05A 2Z1CA 5M5XB 1SYCA 5CR3A 4FF2A 3SK6A 3W2DA 1BBXC 2AUJD 5KNCA 3GTOB 2JE6I 4OHJA 4R8NA 2F0QA 3S1RB 1JICA 1Y1WB 1UAPA 4KI0A 5CBEE 1TS5A 4QMGA 2N88A 1GUTA 1GHKA 2OEOA 3U9OA 4C3IG 3C2PA 3M7NA 2EVBA 1KABA 1FD7D 3S2HB 3D31A 3R2TA 5M9OA 3GTQB 3T56B 3A8KE 1SYBA 4DAPA 5I2XA 1B50A 1KTKA 3C1FA 4NKLA 3NBHA 3O13A 1EEID 2SEBD 3H6MA 3TSSA 1NAPA 1SE3A 2F0IA 1HFNA 3K0YA 3NPPA 5IODA 1WTXA 1STGA 4I7ZC 3GTMB 2F0KA 2KCNA 4I65A 4PMWA 1SYEA 3TP8A 1NUCA 4HMJA 4ID6A 5J22A 4C3IB 3NK9A 1IKLA 1IW7C 5C4XB 1H9SB 4FXKC 1ZXTA 5I2YA 2E76C 4PMCA 4KY5A 1QOHA 4DN4M 1Q1EA 1OXVA 4XYQA 1CZWA 1WTVA 5JPMC 3A8IE 5CV7A 3HOWB 3D6CA 1DOKA 2X6GA 3T4AC 3H0GB 3J80E 1EY9A 1SEBD 3MC0B 4XQJA 3QB3A 5I4DA 4K5XA 1FGBD 5K36G 1OXSC 1EEFD 1LT3D 1E2WA 5FO9B 1HPCA 2F0PA 2K01A 2QKIC 4RAUC 2R6GA 1DYQA 4HSPA 2G9HD 1Q3LA 2F1MA 4MN3A 4QCLA 3EVQA 3OWFA 2MGSA 1PRTF 4RGOS 1EYDA 2A69C 2KVMA 3BYYB 1ENCA 4K2LA 1WTPA 3J7YW 1SE4A 3KLRA 2AQ2B 2EYHA 1BO0A 3H3VC 1ZYRD 2NN6G 4DXFA 1UNSA 4WFN3 5FOBB 5EPLA 1PZKD 3F2UA 2F0UA 2DY8A 3E6ZX 2J0TD 2HDMA 2CHBD 1C48A 4IALA 1Y8NB 2AWNA 4A3BB 1JOKA 3SVMA 4KKUA 4C3HB 3BG3A 1SE2A 5G3LF 4RA8A 5K36H 1SYGA 2PZTA 3VR3A 2EZVA 3HOXB 5DM63 2KCCA 2RA4A 1RJTA 1C4QA 2NVXB 3FMCA 3QOLA 2K5QA 2K5WA 3HOYB 3SHLA 4K6LA 1B2TA 1H9SA 4ABNA 2E2HB 4IUQA 1AP0A 1O7YA 4YIJA 1HTLD 4KHVA 4PV1C 3NTKA 1Z47A 2AQ3B 2QF7A 4XIGS 2ID0A 3ITPA 4J8QA 4J1MA 1MD2D 1TWFB 3P75A 2NN6H 1J9OA 3BDLA 1SYFA 2EYMA 3HOUB 1JORA 3GTGB 1JC7A 1TS3A 3BS1A 2B2WA 5I6YA 1A3TA 5HGTA 3D6WA 5EQ0A 1LV9A 4EQPA 1R4QB 4OO1I 3H94A 1ZYRC 3OPOA 1U4RA 3PIP3 1PTOH 2TSSA 1STBA 4ZRZA 4A3GB 4A3MB 4ULLA 3HOZB 3FPPA 3WOEA 2KOLA 2B2TC 4RGMA 1BNZA 4L8JA 1I3QB 4BY7B 4KY7A 1PRTB 4CHTB 1RODA 2V4DA 4O1NA 3ND8A 2JYOA 2NWGA 5IGEA 4XTCS 2B8GA 1TS4A 1A3UA 1XWEA 5A2QE 5DNFA 4LK1C 4EVOA 3HG9A 4QF4A 5CBAE 1NSNS 2MHVA 4NP5A 4HEDA 1Z7TA 4G7HC 3W3AA 5JVH3 2HUGA 2O5IC 2VNUD 3WOFA 1Y69U 2XVSA 2SNMA 4J6HA 1T5XD 4TSSA 4FF1A 3FPUB 1FR3A 4RGNA 5ELBA 3K5LA 4Y7NB 3S9WA 3S2DB 4A3IB 4F87A 1V1PA 4MIUA 5EPKA 4B9XA 5C6AA 2KECA 1XTCD 1A3VA 4H13C 1PDQA 3SXHA 2XSCA 3QIAA 4LAAA 4A3KB 1CHPD 1ICWA 2F0HA 2EJMA 5D14A 1O78A 1PFNA 3N6RA 3VYTA 1QCBD 1H9MA 4KKSA 5JOBA 1CA6A 3M4OB 2B2VA 3I3CA 4XXEA 4KV6A 1ENAA 1IKMA 5IGDA 1S5ED 1Q12A 2VB3X 3I90A 4RGTA 2A5HA 3OWEB 5M3FB 5FK9C 1KAAA 4XQNA 1A6XA 4KHZA 2EYJA 1SNMA 2B8FA 2E2DC 4DNTB 3D4WA 4K8JA 3HOVB 4QUFA 3ND9A 1STEA 4GZYC 3E5SA 5C5MA 2K1BA 3TBIB 3JAME 3CKIB 3BVMA 1EWHA 2NTSA 3PUYA 3CRLC 3OHXC 1STAA 2F0VA 2R93B 4Q0FA 2H1EA 4C56C 2A74C 4EQOA 3HEJA 1MI2A 5C0XI 1CI3M 3KUPA 4MHEA 4G7ZC 2JP1A 3DHQA 5EGTA 3ONAB 3I4MB 1CQVA 1B4OA 2FMCA 2YYZA 3K57A 4ZAIA 2XRSD 4CKEA 1VMPA 1LT5D 3EA6A 2EE1A 3BVZA 1RKNA 3NXWA 3MAQA 5D3DA 1QG7A 1PMRA 2PPBC 2QCPX 1RF2D 3M85A 4DK0A 2BA0A 3EJIA 2VXWA 1RHPA 2F0GA 5I9PA 3SDZA 2CQAA 2HDLA 3VR2A 4IFDI 2F0WA 3PMFA 3H09A 1EWCA 1IW7D 2AWOA 2IPKD 3SR1A 1WD0A 3OOCA 1LABA 2IW3A 2BA1A 3DEOA 2AQ1B 2L1BA 1R4PB 4HR7B 5NUCA 2RKSA 1OXXK 1CQFA 3RD4A 1GJXA 1F77A 1M8AA 3OMCA 1A2UA 2D62A 2L11A 2F0NA 3Q6SA 2RDHA 3HKZB 4RHSA 3J7AF 2O5JC 5D3IB 2F0TA 3AMUA 1U4MA 1S5CD 4F88A 3TZDA 5EJWA 2Q8IB 5CV6A 5IT9L 4PMBA 3MXPA 1WTOA 2D5DA 2A69D 1TS2A 3GP7A 2BE5C 4KKTA 2PQEA 2XWJB 3NBIA 3SE0A 3VA5A 4BY1B 2NVTB 5EKLA 3M4YA 1RTNA 1UUPA 3X3NA 3T13A 3L3OC 1W6KA 4HSVA 3E0JA 1KLGD 3DM1A 1G291 1TWGB 2K03A 1HHVA 1B44D 3GTKB 2WV6D 4CJ1B 3Q0AA 4X3UA 2F03A 1O80A 1SMYC 5KYLA 4OO1G 1JWUD 4S3SA 3AB9A 3RUZA 1O7ZA 3D8GA 1I4GA 2M00A 3SEBA 2QDBA 1ILPA 5KGUA 3TP5A 1PTOF 1CM9A 4QIWB 2QILA 3M3YB 2D9UA 2F0FA 3HS0C 4DU9A 1EOTA 1ESRA 3QOJA 2J7ZA 5K5PA 2O4XA 1KDBA 1PZJD 1WVLA 1X3QA 3MA2B 1SJED 2PNRC 3K58A 1MGSA 1ZEQX 4M8AA 4P2CB 1U4LA 2B2WC 2K32A 3NSWA 5J1ZA 4ZUIA 3RMHA 4C3HG 3S17B 3ERQA 1E2VA 4DF7A 1V8QA 5FO7B 4RWSC 1DOLA 3PO3B 3I8ZA 3BDCA 3ZYYX 4OO1H 1EZ6A 4LJZC 4ZLTF 1SFOB 3N52A 2KQ3A 1Y8OB 5F2DA 2C9OA 2WIIB 3R3OA 3H91A 1TKWB 5E4WC 4FP5D 4RKLA 4ZK9B 3S16B 3VR6A 1EIGA 1OXUA 1S5FD 4NW2A 1F2LA 1GUOA 5CMDA 3QO2A 1JE4A 1EY8A 1KNEA 3J81E 3UI2A 4KN4C 4DFAA 3URYA 2I46A 5BN3A 3LX0A 2VUMB 4X3KA 2Z8LA 2EY2A 1CK1A 1EY5A 3X3MA 5CYUA 1Z6HA 2Z4HA 1AN8A 1WCMB 2E74C 3A8JE 1EL0A 1L0XB 1I4RA 1B1ZA 4G4KA 3OIPA 1QWYA 2EXZA 3KLSX 2IT1A 2F4IA 4QB4A 1EU3A 2K6AA 2A73B 5JVG3 2N55A 2JXMB 3PUVA 3AU7A 4ME5A 5C44B 4IUVA 3PV0A 4K8IA 1GOZA 4QUCA 5EBCA 3SK5A 1PTOC 4PQXA 4R8IA 3MXNA 3MHBA 1PFMA 3VYSA 2L12A 5IGBA 4HCSA 3SK4A 1EYCA 4CGYB 1TWCB 1PTOB 4JK1C 1II3A 2F3VA 3GO5A 1I4HA 1HCZA 1HRJA 1V1PB 3KBXA 2KHSA 4X3TA 2NUCA 2PZWA 3BVGA 4L63B 5ELCA 3Q22A 5C0XG 1G8ZD 5C3XA 3NWTA 3V2TA 3K5NA 1WTWA 1U4PA 2B2VC 1DJRD 2DY7A 5C4JB 1PRTC 4A3JB 1HA6A 3PUXA 4C1NI 1LLRD 2E75C 1BR9A 5COYA 1WD1A 1LTAD 2JA7B 1MBYA 2PW7A 4FXGC 1HXYD 2EDGA 4DGZA 1H9RA 3PUZA 1CZGA 4K5WA 1IYVA 1EY0A 5CV5A 2HQEA 5C4ZA 5IGCA 1SYDA 1QNUA 2R3ZA 4IUPA 3T51B 4TRDA 3IAYA 2LFNA 2FINB 3K59A 2OT2A 2CVRA 4IFDG 1RD9D 2OXPA 2WAQB 5IOCA 1I6HB 3G7LA 5DAUA 3VYRA 4A3EB 4KJOA 1A15A 5C0XH 2WB1B 4CKBA 1TWAB 2F0MA 1LACA 4FO2A 3CRKC 1X32A 4NMZA 5ISRA 3KLSA 5I9OA 5ELDA 1T5EA 2DNEA 3KBGA 5ELFA 3A54A 1SNPA 4KY6A 2EY1A 4XQQA 1CT1D 2JEBI 5I6WA 4OIKA 3CHBD 3MFGA 4ZYSA 1EY4A 1NR4A 1D5XC 2EYOA 1LTTD 5HURA 1ILQA 2A6EC 1STHA 1BCPF 3GV3A 1GUNA 2QEJC 1KLUD 5CORA 2PW5A 2NVQB 4XDXA 3TN2A 1RDPD 2RVLA 1ZKOA 4R9WA 4IFDH 3T16A 2MJ8A 3HP3A 1QB5D 3OW7A 2EJGC 1JOOA 1HA5A 2B2YA 2SOBA 5ELEA 2BDOA 2NBFA 3DWPA 4DAVA 4UAIA 2X6LA 5LL6X 2B2TA 3NTHA 1H9KA 3GTJB 3FDTA 3I72A 3D3RA 1B53A 4Q5VA 3GD7A 1OXTA 1MSHA 4CBVA 3PUWA 2L55A 5M5WB 1HUMA 2E2JB 4O42A 3BDOA 5IGGA 4OIJA 2RSNA 2DN8A 3MXUA 3J80L 2XN9C 5M5YB 1NR2A 1GUWA 4DAYA 2L5TA 1CFMA 1JCKB 2PCFB 4RKBA 5T1GA 2O2LD 1WTRA 2FJ2A 4ODGA 5KIXA 3QWNA 5E1FA 2LS01 1EQVA 1DM0B 3I73A 2F0SA 3M7GA 2BE5D 1KDAA 4BS9A 1XX8A 1W6JA 3FVQA 1QJOA 2M9VA 2B63B 4BWGB 5KNBA 4IQZA 5JAVA 4C3JG 4A3DB 4ZKBB 1GUSA 4FVMA 2KA7A 1D5MC 4BA1I 1DCZA 1D6EC 1D2BA 3A7AB 1CTMA 2CW0C 1LTID 3L7ZC 1ML0D 1YNND 4TKOB 1D1IA 3MEHA 1SMYD 1SNOA 1YNJC 3J81L 1HQRD 1K8OA 4ZUJA 2R92B 2AUKA 2FHTA 2PZUA 2Y0SB 1HQMC 3T53B 1EY6A 1BCPC 1FNUA 1DXMA 1NCVA 3GQBA 1QE6A 3NHHA 2L0CA 1E2ZA 5BN4A 4KTAA 2EYLA 3R8BA 4IUTA 1FNWA 3G6JB 4E6IA 2K28A 4V0BA 1BCPB 1LTGD 5BN5A 3NQTA 4C3JB 1AZQA 1S5BD 4DNRB 4RCOA 5C3WA 3MXGA 3MVVA 4TQUS 1VDZA 2E2IB 2XNAC 2C5CA 2JA6B 3I4NB 1VCIA 2SDFA 3A7LA 1I4QA 4C2MB 4FF4A 1BUVT 5DEHA 2IJ0A 1VMCA 2A68C 3A55A 1LTRD 2NYZD 3I4LA 3P1HA 3V05A 3FEWX 4IURA 2F0EA 1V43A 4A93B 1BXTA 1GHJA 2WKCA 2F0LA 2RDFA 4BBRB 1SJHD 1IYUA 4OGQC 2K5DA 5FLXE 1LT6D 4H0LC 4HAEA 3C3LA 1VF7A 1PZID 4LMQD 2EPBA 2RQXA 1F9PA 1IL8A 2FMMA 1YNNC 5JJZA 2VB2X 3TDQA 5KNDA 4G7OC 2IX3A 2J4XA 3OIQA 3C46A 4FF3A 3GTPB 2K33A 1EZ8A 2B39A 2MP1A 1TWHB 1AW7A 2EYPA 3NQIA 2EJFC 4KJNA 2Q8TA 3LNNA 1PYWD 4DXGA 1MSGA 5A2QL 3R93A 5J39A 3QG1A 2PYKA 4AYBB 1STNA 4KD3A 3HGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F2U A;  1PFB A;  3ONA B;  1NR2 A;  1SDF A;  1DOL A;  2KEC A;  2DY8 A;  4RWS C;  1G2T A;  1GUW A;  2L12 A;  1B4O A;  2HDM A;  2B2U A;  2Q8R E;  3I8Z A;  3I91 A;  3MWY W;  4ZAI A;  4HCS A;  2KEE A;  1PDQ A;  2SDF A;  3P7J A;  1EIH A;  1VMP A;  1F9S A;  4ZLT F;  1QNK A;  1TVX A;  1F9R A;  2KOL A;  2B2U C;  5T1G A;  2B2T C;  3N52 A;  2EE1 A;  1WTR A;  2MPM A;  2FJ2 A;  1EQT A;  1RTN A;  1ICW A;  1HRJ A;  1VMC A;  3KBX A;  1RTO A;  1WTQ A;  5D14 A;  5EPJ A;  3SVM A;  4HSV A;  1HFG A;  1IKL A;  3H91 A;  1BNZ A;  1QG7 A;  4UAI A;  1PFN A;  4X3T A;  2NYZ D;  3DM1 A;  5E4W C;  2L4N A;  4RA8 A;  1CA6 A;  4OIK A;  4ZK9 B;  1XX8 A;  4IUR A;  5D65 A;  1EIG A;  1KNA A;  2RA4 A;  2K03 A;  1RJT A;  1ROD A;  1NR4 A;  4CJ0 B;  1G91 A;  1HHV A;  4CJ2 C;  2K05 A;  2B2V A;  3I3C A;  1ILQ A;  4NW2 A;  1F2L A;  1ZXT A;  4CJ1 B;  1DZ1 A;  4X3U A;  2JYO A;  2VXW A;  1RHP A;  1O80 A;  2NWG A;  3GV3 A;  1IKM A;  5CMD A;  1WTW A;  1U4P A;  2B2V C;  3I90 A;  2FFK B;  3QO2 A;  1B2T A;  1G2S A;  1JE4 A;  2DY7 A;  2IL8 A;  1SAP A;  3GV6 A;  5COR A;  4DN4 M;  4IUQ A;  1KNE A;  4ZKB B;  1BBX C;  3UI2 A;  1AP0 A;  4XT3 B;  2HDL A;  1HA6 A;  2HCC A;  1O7Y A;  1WTV A;  4XDX A;  1O7Z A;  3TN2 A;  1JIC A;  2K04 A;  5DNF A;  5COY A;  1WD1 A;  2EOT A;  1DOK A;  2RVL A;  2X6G A;  3LWE A;  1WD0 A;  1HUN A;  4HAE A;  5CBE E;  1X3P A;  3DEP A;  4XT1 B;  1AZP A;  1C8C A;  4R9W A;  4U68 A;  2KUM A;  4X3K A;  1ILP A;  4QUF A;  1ML0 D;  1SSO A;  4LMQ D;  2EPB A;  3DEO A;  5CBA E;  2L1B A;  2N88 A;  1CM9 A;  1F9P A;  1IL8 A;  2FMM A;  2HCI A;  2MJ8 A;  3HP3 A;  5JJZ A;  4IUU A;  1G6Z A;  2K1B A;  4HED A;  1E0B A;  1F9Q A;  2D9U A;  2K01 A;  4RAU C;  1J9O A;  1DON A;  1EOT A;  1ESR A;  2XIW A;  1EL0 A;  2FHT A;  2J7Z A;  5E4X A;  4X3S A;  2B2Y A;  2BDN A;  1Q3L A;  4MN3 A;  1B3A A;  2L9H A;  1M8A A;  2B2Y C;  2MGS A;  2M2L A;  1WVL A;  2H1E A;  1X3Q A;  2HUG A;  2RSO A;  2L11 A;  1NCV A;  2R3Z A;  2X6L A;  3IFD A;  4IUP A;  2KVM A;  1QE6 A;  2B2T A;  2N55 A;  3Q6S A;  3FDT A;  1WTP A;  1CA5 A;  1B50 A;  1MI2 A;  2MP1 A;  3FPU B;  5EKI A;  2FIN B;  1B53 A;  1S4Z A;  2B2W A;  4IUT A;  1MGS A;  4IUV A;  4ZKC B;  2CVR A;  2K28 A;  3KUP A;  2Q8T A;  1MSH A;  3G7L A;  1U4M A;  1U4L A;  3D6W A;  5EQ0 A;  2B2W C;  1BO0 A;  1LV9 A;  1HUM A;  2X69 A;  3TZD A;  5EJW A;  4MHE A;  4QUC A;  5T1I A;  1MSG A;  2JP1 A;  4O42 A;  1AZQ A;  1NAP A;  1HFN A;  1A15 A;  1BF4 A;  3MTS A;  1XYI A;  4OIJ A;  1DOM A;  2RSN A;  3R93 A;  2KED A;  3IL8 A;  1PLF A;  2NZ1 D;  4R8I A;  1WTX A;  5EPL A;  5AFW A;  1WTO A;  1J8I A;  1U4R A;  5EPK A;  1X32 A;  1PFM A; 
#chains in the Genus database with same CATH topology
 3DMU A;  1G2T A;  1U9R A;  2ZT9 C;  4DK1 A;  2B2U A;  4C3I H;  2EIF A;  3P7J A;  4LF5 Q;  1F2Y A;  5C5L A;  1VQB A;  2ZXR A;  3OMG A;  4JI2 Q;  1YJN A;  4DR1 Q;  4KK7 A;  1C7Y A;  2LKV A;  3U4V A;  1SNC A;  3RZO B;  3CP0 A;  4R4T A;  1PTO D;  3MXN B;  2IX1 A;  5C4X H;  3L9A X;  1LT4 D;  4DR6 Q;  1D1K A;  1M4V A;  2GVA A;  4WJW A;  3DUZ A;  4OXP A;  1F2Z A;  5FO8 B;  2RBM A;  4CJ0 B;  5LMU Q;  5CV9 A;  3DXJ C;  3RZO H;  1EYA A;  4DV6 Q;  4O2D A;  3A5U A;  3FRP B;  1SAP A;  5EKK A;  4L6T B;  2ALY B;  1TY2 A;  4KN7 C;  4JW0 A;  4JBM A;  4DK6 C;  2R7Z G;  1IYJ B;  1PVO A;  4B9W A;  4N9P A;  2JEA I;  2EOT A;  2TMP A;  2JSO A;  3G48 A;  1AZP A;  1XNR Q;  3E0E A;  1I94 Q;  2OF1 A;  1K0S A;  1LO5 D;  1TQO A;  2HCI A;  4JBW A;  1ASZ A;  4LF7 Q;  1SND A;  1PRT D;  1ONL A;  2A6H D;  1DD2 A;  5C4H A;  1I50 B;  1S3O A;  5E4X A;  4X3S A;  1YIJ A;  2NTT A;  3RLF A;  1NBW A;  2BDN A;  2VQE Q;  1B3A A;  2MUY A;  3I70 A;  1K9M C;  1YHB A;  1LM0 A;  3U9S A;  2EXD A;  4B3M L;  2ENB A;  1BQQ T;  4GLX A;  5CV8 A;  5DM7 3;  3SGI A;  3HRZ C;  1RCV D;  1WOC A;  3EFX D;  5IP9 G;  4LFC Q;  1XPU A;  3CU7 A;  3M4Q A;  3KFU A;  3V96 A;  2PI2 A;  2UXB L;  2I07 B;  3IFT A;  1A63 A;  4DR3 L;  2F0D A;  4EQN A;  4FXD A;  4U67 3;  3H3V H;  2KED A;  3S1Q B;  2R7Z B;  1PLF A;  1J8I A;  2WIN B;  2D2C C;  3K7A B;  1XXG A;  3CCS A;  3MWY W;  2BOS A;  4LFA L;  4C1N K;  2ZM6 L;  1JE5 A;  4EGV A;  1AEX A;  1F2M A;  4X6A H;  2MPM A;  3JAM L;  5G3L D;  3S1Q H;  2R7Z H;  1EQT A;  3A5Z B;  3NWS A;  1RTO A;  3TRE A;  4WJ3 M;  3K7A H;  4BBS G;  4X62 Q;  2PMZ E;  5A35 A;  1EFW A;  1KNA A;  4IUN A;  1A2T A;  1HNZ Q;  2WP8 J;  4HN7 A;  3QR8 A;  1IHZ A;  2SNS A;  4IN3 A;  4B3R Q;  1Q90 A;  4GKK L;  1VQF A;  1G2S A;  3GV6 A;  4B3S Q;  1UEA B;  2NB0 A;  4XT3 B;  1I4X A;  2UU9 L;  5TSS A;  1AFP A;  4JI3 Q;  4K6D A;  2K04 A;  2R7D A;  3KF8 A;  1D5Z C;  4RHR A;  2K7V A;  3BU2 A;  5IT9 E;  4TVA B;  4WOR A;  5CC4 A;  4X65 Q;  4G57 A;  1PH4 A;  1C8C A;  4RH6 A;  5IP9 H;  1TWF H;  1XMQ Q;  2QEX A;  2A6E D;  4KD4 A;  2LY7 A;  1HNX Q;  4K2K A;  2KCT A;  2GA4 B;  1ET9 A;  5GAD C;  2ASB A;  4IUU A;  4YWL A;  1G6Z A;  1N34 L;  1KD1 C;  1JWM D;  3R2I A;  2RDG A;  4LF9 L;  1Y8P B;  1JB3 A;  2KHI A;  1D7Q A;  1S5D D;  3J7Z C;  1Y1V G;  1DON A;  1O7I A;  4JI8 Q;  2XIW A;  2A6H C;  3VR4 A;  2RCN A;  2E5L L;  1EFI D;  1VQ7 A;  1GD7 A;  5IGF A;  4BBS B;  2JJQ A;  2L9H A;  1SNQ A;  3TP6 A;  3VYU A;  2B2Y C;  1H9J A;  2M2L A;  1KHI A;  2RSO A;  1XJV A;  3BYT B;  4RCN A;  3IRB A;  3U58 A;  4ILW A;  5EKI A;  4ZKC B;  1U0L A;  4JI1 Q;  4YHH L;  2Q2U A;  1CHQ D;  2EYF A;  3S14 B;  4BBS H;  2ICE C;  4JOI A;  3J7A V;  4IJL A;  4FNF A;  5ELN A;  5C0X J;  2LXJ A;  3MTS A;  4NXN L;  3FKI G;  1R9T B;  5CV4 A;  1GUG A;  2Z4I A;  1BDO A;  2NZ1 D;  3S1N B;  1SXT A;  1UE5 A;  2IX0 A;  2ZXO A;  3TME A;  3K80 C;  1K83 B;  1B8A A;  3OSO A;  4LUO A;  5BR8 Q;  3S14 H;  1EIH A;  3F1Z A;  3EQL C;  3WDN A;  4PZ7 A;  2ZXP A;  1Q7Y C;  2RF4 A;  1JWS D;  1O7L A;  4YWM A;  1R9T H;  1L0W A;  3S15 B;  1YEZ A;  1M1K C;  1Y1V B;  1J5E L;  3S1N H;  2H4O A;  4F7X A;  2PO4 A;  5EPJ A;  1JOQ A;  2UUC L;  1K83 H;  1PYB A;  4DAY B;  1V1O A;  1I6V C;  4IPD A;  2DJF C;  1PXU A;  4OX9 L;  4UDU C;  1ENF A;  1G91 A;  3NP8 A;  1QIL A;  2EY5 A;  4NDX A;  3S15 H;  2OQK A;  2JA5 G;  1DZ1 A;  1Y1V H;  4YCW A;  1GO3 E;  3PO2 G;  1ET6 A;  1YNX A;  1X3F A;  2FFK B;  5C3E G;  4Z9C B;  1Q1B A;  2KJX A;  3S1M B;  2JA8 G;  2ZTE A;  1B9M A;  3ICE A;  1PV4 A;  3FKI B;  1V9P A;  4JYA L;  1KDC A;  1VQM A;  3LWE A;  1X3P A;  4XT1 B;  2NN6 I;  2KUM A;  4IFD J;  4JI0 L;  3MZ5 A;  2XWB B;  2IWH A;  1SSO A;  3CQZ B;  3K6O A;  5IIF A;  4XYO A;  4B3M Q;  1K3R A;  3HFZ B;  3IKJ A;  3S1M H;  3HZX A;  4M1U B;  5EBD A;  1E0B A;  2ICI A;  1F9Q A;  3CME A;  3FKI H;  3PIP A;  3K5O A;  1SBB B;  5FLX L;  2UXB Q;  1IL2 A;  4DR3 Q;  3CQZ H;  1LTB D;  4A3F G;  2CW0 D;  3TZU A;  3DWA A;  1JR0 D;  5KYI A;  3D4D A;  3NE5 B;  3DWQ A;  3NUC A;  3Q23 A;  1CA5 A;  4MTN A;  1OO9 B;  1YNJ D;  2JA5 B;  2DNC A;  1N36 Q;  3P20 A;  3PO2 B;  2ZM6 Q;  5FLX c;  5C3E B;  3VA7 A;  4OL7 A;  2JA8 B;  1XYI A;  1Z9F A;  1DOM A;  1BCP D;  3IL8 A;  5AFW A;  4N9T A;  1HZC A;  2LMC B;  2JA5 H;  1EQR A;  3QJY A;  1SDF A;  1NNX A;  2RCF A;  3I91 A;  4HCE A;  3PO2 H;  3PIO 3;  4IOC A;  4CDC C;  4RMF A;  1W2B A;  5C3E H;  1F9S A;  1QNK A;  3C1E A;  4BA2 I;  1I4P A;  2JA8 H;  2F3W A;  1KIX A;  2F0O A;  1A62 A;  4P71 A;  4B08 A;  4DV4 L;  3RZD B;  2D0O A;  1E7Z A;  1JT8 A;  4GKK Q;  3M4O H;  1HFG A;  4DV7 L;  2G9D A;  1VF5 C;  4A3F B;  3CCJ A;  5LHY 1;  4YWK A;  5JEA G;  1XMO L;  1HTP A;  5E3F A;  1ESF A;  3MFY A;  1JQY D;  1HUN A;  2CWA A;  2IL8 A;  2QDL A;  4RFB A;  2P5Z X;  2EY6 A;  4A3F H;  1C0A A;  1VQO A;  2A68 D;  2HCC A;  2XRQ D;  1FYC A;  1GXD C;  1TR5 A;  1N8R C;  2N78 A;  4HTH A;  4K14 A;  3KK7 A;  3NTI A;  4GN4 B;  3DEP A;  4U68 A;  1S40 A;  4DAM A;  5KEE A;  2R7F A;  2WKD A;  1Y14 B;  5KRU A;  1HJP A;  4WJ4 A;  4JI5 Q;  3U4Z A;  1FNV A;  4P75 A;  4YY3 Q;  3BZD B;  5M3M G;  5JEA J;  3A56 A;  5J3B A;  4PNY A;  3VR5 A;  4FYD A;  3SK8 A;  5CGK A;  1VQ4 A;  1TY0 A;  5GRO A;  5FKA C;  2PMZ B;  3IFD A;  4H7B A;  4DR7 L;  1BBU A;  2R61 A;  4KMU C;  1B9N A;  2WAC A;  1Q8I A;  4V19 0;  1YJ9 A;  5EAY A;  1S4Z A;  2NVY B;  3F2B A;  3D4R A;  2YU9 B;  3STB D;  3TP7 A;  2X69 A;  4F8M A;  5T1I A;  5IWA L;  4IZ8 A;  1YHQ A;  2OTL A;  1BF4 A;  4H44 C;  1FVI A;  5JEA H;  4HMI A;  3MEF A;  2F0J A;  4L5R C;  1Y1W G;  4K5V A;  3T1H Q;  1PFB A;  2NVY H;  3ERO A;  3LWU A;  1EU4 A;  1TT2 A;  3K5M A;  2YU9 H;  2Q8R E;  2BCO A;  1EY7 A;  2KEE A;  1JJG A;  1G51 A;  1TII D;  2RHS B;  3PSI A;  1TVX A;  2UXC Q;  1F9R A;  2B2U C;  1BOS A;  5IY0 A;  3CCL A;  1TU2 B;  4LF4 L;  2IHF A;  4DA2 A;  3BJU A;  4JV5 Q;  2XGT A;  4CKC A;  4IPG A;  5JPN C;  1QUQ B;  5M3M B;  1WTQ A;  5IYC G;  4WRD A;  1L0Y B;  2N3S A;  2L4N A;  1STY A;  2HHH Q;  1PH3 A;  4JI6 Q;  1LTL A;  5LL6 S;  5D65 A;  3Q24 A;  1LTS D;  4ZQ3 A;  4HJ5 A;  3K0X A;  1K8M A;  4AQY Q;  4CJ2 C;  3GTL B;  1NTG A;  2K05 A;  2PNH A;  4JI0 Q;  1HR0 Q;  4HJ9 A;  3A74 A;  1VQK A;  2Z1C A;  5M3M H;  5M5X B;  1SYC A;  5CR3 A;  4FF2 A;  3KJP A;  3SK6 A;  3W2D A;  1BBX C;  2AUJ D;  4HJA A;  5KNC A;  3GTO B;  2JE6 I;  4OHJ A;  1HR0 W;  2VQF L;  1Q8K A;  4R8N A;  4X66 L;  1X55 A;  4A76 A;  1VQ8 A;  2F0Q A;  3S1R B;  1JIC A;  4LF8 Q;  3ZJY C;  4JI7 Q;  1VQG A;  1Y1W B;  1UAP A;  4GOP A;  4KI0 A;  5CBE E;  1TS5 A;  1VQE A;  5M5X H;  1CUK A;  4QMG A;  2N88 A;  1GUT A;  1GHK A;  4HJ7 A;  2OEO A;  3U9O A;  3S1R H;  1KRS A;  4C3I G;  3C2P A;  3M7N A;  1Y1W H;  2EVB A;  1KAB A;  1FD7 D;  3S2H B;  3D31 A;  3R2T A;  1H95 A;  1X65 A;  5M9O A;  4OON A;  3GTQ B;  3T56 B;  1X3E A;  1MHW C;  3A8K E;  1SYB A;  4DAP A;  5I2X A;  5C4X G;  5AJ3 L;  1B50 A;  4FDB A;  1KTK A;  1K8G A;  3C1F A;  4NKL A;  3S2H H;  3NBH A;  3O13 A;  5IYC H;  3M9B A;  1EEI D;  4P74 A;  2SEB D;  3H6M A;  3EIV A;  3GTQ H;  2D0P A;  3TSS A;  4L5T A;  1FJG L;  1NAP A;  1SE3 A;  2F0I A;  1HFN A;  2B29 A;  3K0Y A;  3NPP A;  4R4Q A;  3HOW G;  3EN2 A;  5IOD A;  1WTX A;  1STG A;  4I7Z C;  3H0G G;  3GTM B;  1YIT A;  1KQS A;  2F0K A;  1W3S A;  2NVT H;  2KCN A;  4I65 A;  1UWV A;  4PMW A;  1SYE A;  1P16 A;  4DV5 L;  1XMO Q;  3TP8 A;  1NUC A;  4HMJ A;  4ID6 A;  1X3G A;  2YV5 A;  3CW2 C;  5J22 A;  4C3I B;  3I55 A;  4NXM L;  2WB1 E;  3NK9 A;  3GTM H;  2MO1 A;  3KLW A;  1IKL A;  2UUA L;  3KYH C;  1IW7 C;  1KC8 C;  4GKJ L;  4X64 L;  4DR5 L;  3NEN A;  5C4X B;  1H9S B;  4FXK C;  1ZXT A;  5I2Y A;  4HIM A;  2E76 C;  4PMC A;  1M90 C;  4KY5 A;  4GNX A;  1PH1 A;  1QOH A;  4DN4 M;  1Q1E A;  1OXV A;  5JJI A;  3UDI A;  4OWX B;  2YTV A;  4XYQ A;  1CZW A;  1WTV A;  4DKA C;  5JPM C;  3A8I E;  5CV7 A;  3HOW B;  5IYD G;  3D6C A;  1DOK A;  2X6G A;  3T4A C;  3H0G B;  3J80 E;  1EY9 A;  1PHJ A;  2AKW B;  4KHP Q;  4R4C A;  3M3Y H;  1SEB D;  2K52 A;  3MC0 B;  3QB3 A;  4XQJ A;  5I4D A;  4K5X A;  1FGB D;  3NEM A;  5K36 G;  1IZ6 A;  1OXS C;  1EEF D;  2OCE A;  1LT3 D;  1E2W A;  5FO9 B;  1HPC A;  4PZ8 A;  1IBL L;  2F0P A;  3OTO Q;  2A1A A;  2K01 A;  2QKI C;  4RAU C;  2MQH A;  3HOW H;  1PFS A;  1JMC A;  3KF8 B;  4A3B G;  2R6G A;  3H0G H;  4K0K L;  1DYQ A;  4HSP A;  2G9H D;  3L0O A;  1Q3L A;  1WFQ A;  2F1M A;  4MN3 A;  4QCL A;  3EVQ A;  3OWF A;  2MGS A;  1PRT F;  4RGO S;  1EOV A;  3HOX G;  1EYD A;  2A69 C;  2KVM A;  3BYY B;  1ENC A;  4K2L A;  1WTP A;  5FLM G;  3J7Y W;  1SE4 A;  3TEH B;  4DUY Q;  3KLR A;  2AQ2 B;  2EYH A;  1BO0 A;  3H3V C;  1IXR A;  1ZYR D;  3PO3 H;  2N8N A;  2NN6 G;  1AE3 A;  3KDF A;  4DXF A;  1UNS A;  4WFN 3;  5FOB B;  4QQB X;  5EPL A;  1PZK D;  3KF6 A;  3F2U A;  2F0U A;  4A4I A;  2DY8 A;  3E6Z X;  2J0T D;  2HDM A;  1IBM Q;  2CHB D;  1C48 A;  2MNA A;  3L2P A;  4IAL A;  1Y8N B;  2AWN A;  5IYD H;  4A3B B;  1JOK A;  3SVM A;  4KKU A;  2WFW A;  2RHQ B;  3HOU G;  4C3H B;  3BG3 A;  1SE2 A;  1CKN B;  5LMN Q;  5G3L F;  4RA8 A;  5K36 H;  1SYG A;  2PZT A;  3VR3 A;  2EZV A;  1MJE A;  3HOX B;  5DM6 3;  2K5N A;  2KCC A;  2RA4 A;  1RJT A;  1C4Q A;  2V1C C;  3FMC A;  2NVX B;  3QOL A;  1K0R A;  5LMN W;  2IHE A;  2HD3 A;  2K5Q A;  2K5W A;  4A3B H;  3HOY B;  3SHL A;  4K6L A;  1B2T A;  1H9S A;  4ABN A;  4C3H H;  2E2H B;  4IUQ A;  1AP0 A;  1VQP A;  3TS2 A;  1O7Y A;  3HOX H;  2NVX H;  4YIJ A;  1HTL D;  4KHV A;  4PV1 C;  5FLM H;  2OWO A;  3NTK A;  4A3G G;  4A3M G;  1Z47 A;  2AQ3 B;  3HOY H;  2QF7 A;  3HOZ G;  4DV1 L;  4XIG S;  2E2H H;  2ID0 A;  5JJL A;  3ITP A;  4J8Q A;  2Z6B A;  4HJ8 A;  1PH9 A;  4J1M A;  1MD2 D;  4B3T L;  1TWF B;  3P75 A;  2NN6 H;  4JI4 L;  1J9O A;  4OEM B;  4DV0 Q;  1MKH A;  3BDL A;  1SYF A;  4O0A A;  2EYM A;  3HOU B;  3CC4 A;  1JOR A;  4DR2 L;  4BY7 G;  4IO9 A;  4DV3 Q;  3GTG B;  2NZO A;  1JC7 A;  1E3P A;  4AIM A;  4R4I A;  3RLN A;  2VY3 A;  1TS3 A;  3BS1 A;  2B2W A;  1KRT A;  4H02 A;  5I6Y A;  3ULJ A;  3HOU H;  1A3T A;  5HGT A;  3D6W A;  5EQ0 A;  1LV9 A;  4EQP A;  1R4Q B;  2Y0S E;  3GTG H;  4OO1 I;  3AEV A;  3H94 A;  1ZYR C;  1PH8 A;  3KOJ A;  3OPO A;  1U4R A;  3PIP 3;  1PTO H;  2TSS A;  1STB A;  4UY8 C;  4UHV A;  4ZRZ A;  3BZK A;  4A3G B;  4A3M B;  3CMA A;  4ULL A;  4GKJ Q;  4R4O A;  3HOZ B;  1LYL A;  4ME3 A;  1NMF A;  3FPP A;  3WOE A;  2K5V A;  2KOL A;  1SRU A;  2B2T C;  4BXX G;  1UE7 A;  1AH9 A;  2ZTD A;  3TRZ A;  4RGM A;  2EQS A;  4DV2 L;  1BNZ A;  4A3G H;  4A3M H;  4LUZ A;  2GN5 A;  4LW1 A;  3HOZ H;  4L8J A;  1XNQ L;  1I3Q B;  4BY7 B;  5JJK A;  4KY7 A;  1PRT B;  4CHT B;  1EWI A;  1ROD A;  3HKZ E;  1CKN A;  2V4D A;  4O1N A;  3ND8 A;  1X54 A;  4CDE C;  1IBK L;  3K7U C;  2JYO A;  2NWG A;  5IGE A;  2YTY A;  4XTC S;  1K73 C;  2B8G A;  1RIP A;  1ICF B;  1TS4 A;  3CC2 A;  1A3U A;  1I3Q H;  4BY7 H;  4A3I G;  1XWE A;  4N8X 1;  2BH2 A;  5A2Q E;  5DNF A;  5FJ8 G;  4LK1 C;  4K0K Q;  2XTI A;  2ATW A;  1T9H A;  4EVO A;  3HG9 A;  1LUZ A;  4QF4 A;  5CBA E;  1NSN S;  4R1J A;  2MHV A;  4NP5 A;  4HED A;  1A8V A;  4A3K G;  4MNO A;  1Z7T A;  4G7H C;  4LF6 L;  3RR5 A;  3W3A A;  4OWT B;  5JVH 3;  2HUG A;  2O5I C;  1HNW L;  2VNU D;  3WOF A;  1Y69 U;  2XVS A;  2FXQ A;  2SNM A;  1B70 B;  3A0J A;  4J6H A;  1PH5 A;  1T5X D;  4TSS A;  4BXX H;  4FF1 A;  3FPU B;  1N33 L;  1E1T A;  1FR3 A;  3UE1 A;  1VQ6 A;  4RGN A;  3G71 A;  5ELB A;  3K5L A;  5M3F G;  1N32 L;  2F4V L;  4Y7N B;  2ZTC A;  3I4O A;  1UE1 A;  3S9W A;  3S2D B;  4A3I B;  4F87 A;  1XTD A;  1V1P A;  4EQ5 A;  4MIU A;  5EPK A;  4B9X A;  1EQQ A;  3HOV G;  2ES2 A;  5ELO A;  5C6A A;  1YJW A;  2KEC A;  1XTC D;  3NEL A;  1A3V A;  4H13 C;  4Y7N H;  1PDQ A;  4HIK A;  3SXH A;  4QIW E;  1QVC A;  2XSC A;  4UPA A;  3S2D H;  3QIA A;  1EUJ A;  4A3I H;  3CAM A;  1B3Q A;  3K81 C;  4LFA Q;  4LAA A;  4A3K B;  1CHP D;  1ICW A;  2F0H A;  5FJ8 H;  2EJM A;  5D14 A;  1O78 A;  1PYS B;  1PFN A;  3N6R A;  3VYT A;  1QCB D;  1H9M A;  4KKS A;  5JOB A;  2R93 G;  1WJJ A;  3DLL A;  1CA6 A;  3M4O B;  4A3K H;  2B2V A;  3I3C A;  4XXE A;  4KV6 A;  4P73 A;  1ENA A;  1IKM A;  2PQA A;  5IGD A;  1S5E D;  1Q12 A;  2K14 A;  2VB3 X;  3I90 A;  4RGT A;  2A5H A;  3OWE B;  2KHJ A;  5M3F B;  5FK9 C;  1KAA A;  4XQN A;  3VDY A;  4B3T Q;  1A6X A;  3CCV A;  1VQA A;  4KHZ A;  4GLA C;  2EYJ A;  1SNM A;  1NMG A;  2B8F A;  2E2D C;  4JCV E;  4DNT B;  1BBW A;  3D4W A;  4K8J A;  2UU9 Q;  3AYH B;  3HOV B;  3I4M G;  1GKH A;  4IPH A;  4IPC A;  4QUF A;  5M3F H;  4GOP C;  3ND9 A;  1STE A;  2UUB L;  4GZY C;  3E5S A;  5C5M A;  2K1B A;  3TBI B;  3JAM E;  3CKI B;  3BVM A;  2A19 A;  1EWH A;  2NTS A;  1N34 Q;  3PUY A;  3HOV H;  4LF9 Q;  3CRL C;  3OHX C;  4GOP B;  3GTJ H;  1SLJ A;  1STA A;  2F0V A;  3UDX A;  2E5L Q;  2R93 B;  2UXD L;  1G6P A;  4Q0F A;  2H1E A;  4C56 C;  2A74 C;  4ZCK A;  1Q46 A;  4EQO A;  3HEJ A;  1MI2 A;  5C0X I;  1CI3 M;  3RN2 A;  4LFB L;  3KUP A;  4J15 A;  2E8G A;  4YHH Q;  4MHE A;  4G7Z C;  2R93 H;  2JP1 A;  3CF5 A;  3DHQ A;  3TQY A;  3G6E A;  3CCE A;  5EGT A;  3RN5 A;  4LF5 L;  2I5L X;  1VQD A;  3ONA B;  4NXN Q;  2HQL A;  3I4M B;  1CQV A;  1B4O A;  2FMC A;  2YYZ A;  3K57 A;  3G4S A;  1XNQ Q;  3NBH B;  5IYB G;  4ZAI A;  1VS0 A;  2XRS D;  4CKE A;  1VMP A;  4JI2 L;  4DR1 L;  1LT5 D;  3EA6 A;  2EE1 A;  4OEL B;  3BVZ A;  1RKN A;  3LGJ A;  3D0F A;  3NXW A;  4DR6 L;  3PF5 A;  3MAQ A;  5D3D A;  3I4M H;  2B63 H;  1QG7 A;  1PMR A;  1VQI A;  2PPB C;  1J5E Q;  5LMU L;  2QCP X;  2UUC Q;  1RF2 D;  1GVP A;  2Z6K A;  3M85 A;  3HKZ G;  4DK0 A;  2BA0 A;  3EJI A;  2VXW A;  4OX9 Q;  1RHP A;  2F0G A;  5I9P A;  3SDZ A;  2CQA A;  2HDL A;  3VR2 A;  4IFD I;  2F0W A;  3PMF A;  2ZJR A;  3H09 A;  1EWC A;  1XNR L;  1IW7 D;  2AWO A;  2IPK D;  1I94 L;  3SR1 A;  1WD0 A;  3OOC A;  1LAB A;  2IW3 A;  4JYA Q;  4LF7 L;  2BA1 A;  2CH4 W;  3DEO A;  3UDG A;  2AQ1 B;  2QGQ A;  2L1B A;  4GNX B;  1R4P B;  1SE8 A;  4MZ9 A;  3J80 i;  4BY1 G;  4HR7 B;  5NUC A;  3AFQ A;  2VQE L;  2RKS A;  1OXX K;  1CQF A;  2JQO A;  1QVG A;  3RD4 A;  3ERS X;  1GJX A;  2IY5 B;  5IYB H;  1B7Y B;  1F77 A;  1M8A A;  1JJC B;  3OMC A;  4HIO A;  1A2U A;  2D62 A;  2L11 A;  2F0N A;  3Q6S A;  4LFC L;  2RDH A;  1KAW A;  3HKZ B;  3W5O A;  4RHS A;  3J7A F;  2O5J C;  1KL9 A;  5D3I B;  2F0T A;  4L5S A;  4POF A;  3BZC A;  1X56 A;  3AMU A;  1U4M A;  1S5C D;  4F88 A;  3TZD A;  5EJW A;  2Q8I B;  2ZJQ A;  1XPR A;  5CV6 A;  5IT9 L;  1L1O B;  4PMB A;  4DR4 L;  3MXP A;  1WTO A;  1K28 A;  2D5D A;  2A69 D;  1TS2 A;  3GP7 A;  2BE5 C;  4KKT A;  3T1Y L;  2PQE A;  1XPO A;  2XWJ B;  2ZJP A;  3RNU A;  3NBI A;  3SE0 A;  3VA5 A;  4BY1 B;  2NVT B;  4JPB W;  5EKL A;  2CCZ A;  3KDF B;  3M4Y A;  1RTN A;  1UUP A;  4JVZ A;  3X3N A;  4X62 L;  3T13 A;  1K8A C;  5IT9 c;  3L3O C;  2MFI A;  3KF6 B;  1CKO A;  1W6K A;  4HSV A;  4DV4 Q;  3E0J A;  1KLG D;  3DM1 A;  3J81 i;  4LWC A;  4DV7 Q;  1G29 1;  1TWG B;  4BY1 H;  2K03 A;  1HHV A;  1B44 D;  1QZH A;  3GTK B;  1CSQ A;  2WV6 D;  3UDF A;  1VQ9 A;  4CJ1 B;  4B3S L;  3Q0A A;  4X3U A;  2F03 A;  1O80 A;  4NB3 A;  2WAQ E;  1SMY C;  5KYL A;  4OO1 G;  4JI3 L;  1JWU D;  1V1Q A;  4S3S A;  3AB9 A;  4QY7 A;  1A0I A;  3RUZ A;  2Q2T A;  4X65 L;  1O7Z A;  1TWG H;  3D8G A;  1BVS A;  1I4G A;  1XMQ L;  2M00 A;  3GTK H;  1HNX L;  3PO3 G;  3WWV A;  3SEB A;  2QDB A;  1ILP A;  4GLV B;  5KGU A;  1VQJ A;  3TP5 A;  1E24 A;  1PTO F;  1CM9 A;  3EBE A;  4QIW B;  4JI8 L;  2QIL A;  3ULL A;  3M3Y B;  2D9U A;  2F0F A;  3HS0 C;  2VZA A;  4DU9 A;  1EOT A;  1ESR A;  3QOJ A;  3HKS A;  2J7Z A;  4KLK A;  1TXY A;  5K5P A;  2O4X A;  2H5X A;  1KDB A;  1PZJ D;  1WVL A;  1VQH A;  1X3Q A;  3MA2 B;  1MIU A;  1NY4 A;  1SJE D;  4JI1 L;  4NPS A;  2PNR C;  3K58 A;  4DPG A;  5GAH C;  4DR7 Q;  1MGS A;  3CCU A;  2Q2I A;  1ZEQ X;  2K4K A;  4AH6 A;  4M8A A;  4P2C B;  1U4L A;  2B2W C;  2K32 A;  3NSW A;  5J1Z A;  4ZUI A;  4DNI A;  4PG3 A;  1PH2 A;  3RMH A;  4C3H G;  3S17 B;  5IWA Q;  5BR8 L;  3ERQ A;  1E2V A;  4DF7 A;  2VUM G;  1V8Q A;  5FO7 B;  4RWS C;  1DOL A;  4UP7 A;  3PO3 B;  1L1O A;  1D8L A;  3I8Z A;  3DM3 A;  3BDC A;  3ZYY X;  4OO1 H;  1EZ6 A;  4LJZ C;  4ZLT F;  1SFO B;  1CKM A;  3N52 A;  3HOY G;  1WCM G;  2KQ3 A;  3S17 H;  1Y8O B;  3E9I A;  5F2D A;  2A8V A;  2C9O A;  2WII B;  3R3O A;  1AE2 A;  4LF4 Q;  3H91 A;  1TKW B;  5E4W C;  4JOI C;  1C9O A;  4FP5 D;  1SFO H;  4RKL A;  4ZK9 B;  3S16 B;  3VR6 A;  1EIG A;  1OXU A;  1S5F D;  3E3X A;  4NW2 A;  1F2L A;  5C44 G;  3W1B A;  5IP7 G;  1QZG A;  4JC0 A;  1GUO A;  5CMD A;  3QO2 A;  1SR3 A;  1JE4 A;  1EY8 A;  4POG A;  4A75 A;  1KNE A;  3J81 E;  3UI2 A;  4KN4 C;  3B6Y A;  3S16 H;  4DFA A;  2GVB A;  3URY A;  2I46 A;  5BN3 A;  1EIY B;  2VQF Q;  1E22 A;  4X66 Q;  3LX0 A;  2VUM B;  4X3K A;  4PZ6 A;  5GAE C;  2Z8L A;  3PCO B;  5L37 A;  2EY2 A;  1I50 H;  1CK1 A;  1EY5 A;  3X3M A;  3PQI A;  5CYU A;  1Z6H A;  2Z4H A;  1AN8 A;  1WCM B;  2E74 C;  3A8J E;  1OTC A;  1HH2 P;  1EL0 A;  1L0X B;  1I4R A;  1B1Z A;  4G4K A;  2VUM H;  3OIP A;  1QWY A;  2EXZ A;  3KLS X;  2IT1 A;  2F4I A;  2B3G A;  4QB4 A;  3CCR A;  1EU3 A;  2K6A A;  2A73 B;  5JVG 3;  4DR4 Q;  2N55 A;  2JXM B;  1N36 L;  1WCM H;  3PUV A;  3AU7 A;  4ME5 A;  3T1Y Q;  5C44 B;  4A3C G;  4IUV A;  2K50 A;  2VL6 A;  3PV0 A;  5AJ3 Q;  4K8I A;  2QW7 A;  4A3J G;  1GOZ A;  4QUC A;  5EBC A;  2KCM A;  3SK5 A;  1PTO C;  4PQX A;  4R8I A;  1FJG Q;  2JA7 G;  3MXN A;  3MHB A;  2F52 A;  1PFM A;  5C44 H;  5IP7 H;  3F2D A;  3VYS A;  2L12 A;  5IGB A;  4DK3 C;  4HCS A;  3SK4 A;  3JAM c;  1EYC A;  4CGY B;  1TWC B;  2DGY A;  1YVC A;  1PTO B;  1I5F A;  4JK1 C;  1HZB A;  1II3 A;  4DV5 Q;  2F3V A;  3GO5 A;  3F2C A;  1I4H A;  1HCZ A;  1HRJ A;  3H15 A;  1V1P B;  3KBX A;  3CCM A;  2KHS A;  1WI5 A;  4X3T A;  4NXM Q;  2NUC A;  4MTK A;  2PZW A;  3BVG A;  4L63 B;  5ELC A;  1TWC H;  3Q22 A;  5C0X G;  2UUA Q;  1WTH A;  1G8Z D;  5C3X A;  2LSS A;  2Z9H A;  3NWT A;  3V2T A;  3K5N A;  4X64 Q;  4DR5 Q;  2WAQ G;  1Q82 C;  1WTW A;  1U4P A;  2B2V C;  1DJR D;  4L5Q A;  2DY7 A;  5C4J B;  4A3E G;  1PRT C;  4A3J B;  1VQL A;  3PUX A;  1HA6 A;  4GS3 A;  4C1N I;  2WB1 G;  1LLR D;  2E75 C;  1BR9 A;  2OTJ A;  5COY A;  1WD1 A;  1LTA D;  2JA7 B;  2HIX A;  4CDF C;  1MBY A;  4A3C H;  2PW7 A;  4FXG C;  2NZH A;  4JI5 L;  2PQA B;  2HT1 A;  5C4J H;  1HXY D;  1QVF A;  2JN4 A;  4YY3 L;  4A3J H;  2EDG A;  1J6Q A;  4DGZ A;  1H9R A;  1GM5 A;  3PUZ A;  1CZG A;  2JA7 H;  4K5W A;  1IBL Q;  4JBJ A;  2I5M X;  1IYV A;  4P72 A;  1EY0 A;  5CV5 A;  5H1S E;  2HQE A;  5GAG C;  5C4Z A;  3JAM i;  2QA4 A;  1HZA A;  3PGZ A;  5IGC A;  1SYD A;  2Q2H A;  1QNU A;  2R3Z A;  4QGU A;  4IUP A;  3T51 B;  1SN8 A;  1NE3 A;  4LUV A;  4TRD A;  3IAY A;  2LFN A;  2FIN B;  3K59 A;  3H3V I;  2OT2 A;  4Y52 H;  2CVR A;  4IFD G;  2I5H A;  1RD9 D;  2OXP A;  2WAQ B;  5IOC A;  2CFM A;  1I6H B;  3G7L A;  5DAU A;  3VYR A;  4A3E B;  3M4P A;  4KJO A;  5E7N A;  3T1H L;  1A15 A;  3J81 j;  5C0X H;  2WB1 B;  4CKB A;  1TWA B;  2F0M A;  1LAC A;  4FO2 A;  3CRK C;  1YI2 A;  1X32 A;  2LXK A;  3UE0 A;  4NMZ A;  3CCQ A;  2UXC L;  5ISR A;  3KLS A;  1I6H H;  5I9O A;  4A3E H;  4JV5 L;  5ELD A;  1T5E A;  1JJ2 A;  1TWA H;  1WYD A;  2DNE A;  3KBG A;  3CD6 A;  5ELF A;  3A54 A;  5GQO A;  1SNP A;  2DUD A;  2HHH L;  4KY6 A;  4JI6 L;  2EY1 A;  3CPF A;  4XQQ A;  1CT1 D;  1UEB A;  2JEB I;  4EX5 A;  5I6W A;  4AQY L;  4OIK A;  3CHB D;  3MFG A;  3OW2 A;  4ZYS A;  1HR0 L;  2PI2 E;  1EY4 A;  1NR4 A;  1D5X C;  2EYO A;  1LTT D;  5HUR A;  1S72 A;  2CKZ B;  1ILQ A;  2A6E C;  2JA9 A;  4QL5 A;  1STH A;  1BCP F;  3GV3 A;  4OWW B;  2Z6K C;  1N9W A;  1GUN A;  2QEJ C;  1KLU D;  5COR A;  4LF8 L;  2AMC B;  2Z0S A;  1FL0 A;  4JI7 L;  2PW5 A;  4IJH A;  2NVQ B;  3KJO A;  2K5H A;  4XDX A;  1PA6 A;  3TN2 A;  4AYB E;  1RDP D;  2CH4 A;  2RVL A;  1ZKO A;  4R9W A;  3JC6 6;  4IFD H;  3T16 A;  3U50 C;  1ASY A;  1SRO A;  2MJ8 A;  2I0Q A;  3HP3 A;  1QB5 D;  2NVQ H;  4DV1 Q;  3OW7 A;  2EJG C;  1JOO A;  4N8F A;  1HA5 A;  2B2Y A;  2SOB A;  5ELE A;  1E1O A;  4JI4 Q;  2JK8 A;  2BDO A;  2NBF A;  5DLQ E;  3I56 A;  3DWP A;  3I2Z A;  4DAV A;  4RG1 A;  4UAI A;  2X6L A;  5LL6 X;  1U5K A;  2B2T A;  3NTH A;  2B63 G;  1H9K A;  4DR2 Q;  3GTJ B;  2KBN A;  3FDT A;  4DUZ L;  3I72 A;  3D3R A;  1B53 A;  2AHO B;  4A3L G;  2KEN A;  4Q5V A;  3GD7 A;  1K3B C;  1OXT A;  3FP9 A;  4A3D G;  1MSH A;  4CBV A;  3PUW A;  2L55 A;  5M5W B;  1HUM A;  3CC7 A;  2F3I A;  2E2J B;  4O42 A;  2YTX A;  3BDO A;  5IGG A;  4OIJ A;  2RSN A;  4HID A;  4JBK A;  2DN8 A;  3MXU A;  3J80 L;  2XN9 C;  4I7A A;  5M5Y B;  1NR2 A;  4JG2 A;  1GUW A;  4DAY A;  2L5T A;  3RZD H;  1CFM A;  5M5W H;  4APV A;  1JCK B;  2E2J H;  2PCF B;  4RKB A;  5T1G A;  2O2L D;  1WTR A;  2CWP A;  2R92 G;  2FJ2 A;  3I7F A;  1EYG A;  4ODG A;  5KIX A;  3QWN A;  2OQ0 A;  5E1F A;  1BKB A;  5M5Y H;  2LS0 1;  3Q8D A;  1SMX A;  1EQV A;  1DM0 B;  2Y0S G;  5HY6 A;  3J80 c;  3RLO A;  3I73 A;  2F0S A;  3M7G A;  2BE5 D;  1KDA A;  4BS9 A;  4DV2 Q;  1XX8 A;  1W6J A;  3FVQ A;  1QJO A;  2M9V A;  2B63 B;  4BWG B;  1PH7 A;  5KNB A;  3AQQ A;  4IQZ A;  5JAV A;  4C3J G;  4A3D B;  4ZKB B;  1IBK Q;  1CSP A;  1GUS A;  2KA7 A;  4FVM A;  1D5M C;  4BA1 I;  1DCZ A;  1D6E C;  1D2B A;  3TS0 A;  4KHP L;  3CXC A;  3A7A B;  1KXL A;  1CTM A;  2CW0 C;  1LTI D;  4A3L H;  2JA6 G;  3L7Z C;  1ML0 D;  3W1G A;  3OTO L;  4DV6 L;  3I4N G;  1YNN D;  3K8A A;  4TKO B;  4A3D H;  1D1I A;  2C35 B;  3MEH A;  1RL2 A;  1SMY D;  1SNO A;  1YNJ C;  3J81 L;  1HQR D;  1K8O A;  4ZUJ A;  2R92 B;  4CDD C;  1X9N A;  2AUK A;  2FHT A;  2PZU A;  4GNX C;  4IOA A;  2Y0S B;  3PIO A;  1HQM C;  3T53 B;  1EY6 A;  4LF6 Q;  4GN5 A;  1BCP C;  1FNU A;  4GN3 B;  1DXM A;  1NCV A;  3GQB A;  1QE6 A;  4A93 G;  3NHH A;  1P8L A;  4DUY L;  2L0C A;  1E2Z A;  5BN4 A;  1HZ9 A;  4KTA A;  2R92 H;  2EYL A;  3R8B A;  4IUT A;  1HNW Q;  1FNW A;  2N49 A;  3J81 c;  3G6J B;  4E6I A;  2K28 A;  4V0B A;  1BCP B;  4BBR G;  1LTG D;  5BN5 A;  3NQT A;  1VQ5 A;  1N33 Q;  4C3J B;  1AZQ A;  1S5B D;  4DNR B;  1N32 Q;  2F4V Q;  4RCO A;  5C3W A;  1PH6 A;  3MXG A;  3MVV A;  1IBM L;  3FHW A;  4TQU S;  1VDZ A;  2E2I B;  2XNA C;  2C5C A;  2JA6 B;  3I4N B;  1X6O A;  1VCI A;  2SDF A;  2CQO A;  3A7L A;  4C3J H;  3S24 A;  1I4Q A;  3J7A 5;  1L1O C;  4C2M B;  2VS1 A;  4FF4 A;  1BUV T;  5DEH A;  2IJ0 A;  1VMC A;  5LMN L;  5HGQ A;  2E2I H;  2A68 C;  3A55 A;  4UP9 A;  3GTL H;  1LTR D;  2NYZ D;  2JA6 H;  1FGU A;  3I4N H;  3I4L A;  4YCU A;  3P1H A;  1Q81 C;  3V05 A;  3FEW X;  4C2M H;  4IUR A;  2F0E A;  2VW9 A;  4QJF A;  1V43 A;  4A93 B;  3ULP A;  4LNQ A;  1BXT A;  1GHJ A;  3GTO H;  2WKC A;  2F0L A;  3ER0 A;  1JB7 A;  2RDF A;  2G5D A;  1Q86 C;  4BBR B;  1SJH D;  3GDE A;  1IYU A;  4OGQ C;  3CPW A;  2K5D A;  5FLX E;  4A93 H;  4AYB G;  2L15 A;  1LT6 D;  4H0L C;  4HAE A;  3C3L A;  1HNZ L;  1VF7 A;  3E9H A;  1NJI C;  1PZI D;  1UE6 A;  4LMQ D;  5IE8 A;  3PF4 A;  2EPB A;  4B3R L;  4BBR H;  2RQX A;  1F9P A;  1IL8 A;  2FMM A;  1YNN C;  5JJZ A;  4DV0 L;  2VB2 X;  3OYY A;  3TDQ A;  2UUB Q;  4DUZ Q;  2MO0 A;  3STB C;  1YBY A;  4DV3 L;  5KND A;  2BH8 A;  4G7O C;  3F8T A;  2IX3 A;  1DGS A;  2J4X A;  3OIQ A;  1YZ6 A;  3C46 A;  4FF3 A;  2HIV A;  3GTP B;  2K33 A;  2UXD Q;  1EZ8 A;  1VQN A;  2B39 A;  2MP1 A;  1TWH B;  1EIF A;  3AFP A;  1AW7 A;  1VQC A;  2EYP A;  4YCV A;  2DJG C;  2EJF C;  3NQI A;  2K75 A;  4KJN A;  4UP8 A;  2Q8T A;  3LNN A;  1L2F A;  4ALP A;  1PYW D;  4DXG A;  1YHA A;  1MSG A;  4LFB Q;  5A2Q L;  3R93 A;  5J39 A;  3QG1 A;  3GTP H;  2PYK A;  1MJC A;  1QUQ A;  4AYB B;  1STN A;  4KD3 A;  3HGB A;  1TWH H; 
#chains in the Genus database with same CATH homology
 3DMU A;  1G2T A;  1U9R A;  2ZT9 C;  4DK1 A;  2B2U A;  3P7J A;  1F2Y A;  5C5L A;  2ZXR A;  3OMG A;  4KK7 A;  2LKV A;  1SNC A;  3RZO B;  1PTO D;  2IX1 A;  3L9A X;  1LT4 D;  1D1K A;  1M4V A;  4WJW A;  3DUZ A;  1F2Z A;  5FO8 B;  2RBM A;  4CJ0 B;  5CV9 A;  3DXJ C;  1EYA A;  3FRP B;  1SAP A;  5EKK A;  4L6T B;  1TY2 A;  4KN7 C;  4B9W A;  4N9P A;  2JEA I;  2EOT A;  2TMP A;  2JSO A;  1AZP A;  2OF1 A;  1LO5 D;  1TQO A;  2HCI A;  4JBW A;  1SND A;  1PRT D;  1ONL A;  2A6H D;  1DD2 A;  5C4H A;  1I50 B;  5E4X A;  4X3S A;  2NTT A;  3RLF A;  2BDN A;  1B3A A;  2MUY A;  3I70 A;  3U9S A;  2ENB A;  1BQQ T;  5CV8 A;  5DM7 3;  3HRZ C;  1RCV D;  3EFX D;  3CU7 A;  3V96 A;  2I07 B;  3IFT A;  2F0D A;  4EQN A;  4FXD A;  4U67 3;  2KED A;  3S1Q B;  2R7Z B;  1PLF A;  1J8I A;  2WIN B;  2D2C C;  3K7A B;  1XXG A;  3MWY W;  2BOS A;  4C1N K;  4EGV A;  1AEX A;  1F2M A;  2MPM A;  3JAM L;  5G3L D;  1EQT A;  3NWS A;  1RTO A;  5A35 A;  1KNA A;  4IUN A;  1A2T A;  2WP8 J;  4HN7 A;  1IHZ A;  2SNS A;  4IN3 A;  1Q90 A;  1G2S A;  3GV6 A;  1UEA B;  2NB0 A;  4XT3 B;  1I4X A;  5TSS A;  1AFP A;  4K6D A;  2K04 A;  3KF8 A;  1D5Z C;  4RHR A;  2K7V A;  5IT9 E;  4WOR A;  5CC4 A;  4G57 A;  1C8C A;  4RH6 A;  2A6E D;  4KD4 A;  2LY7 A;  4K2K A;  2GA4 B;  1ET9 A;  4IUU A;  1G6Z A;  1JWM D;  3R2I A;  2RDG A;  1Y8P B;  1JB3 A;  1S5D D;  1DON A;  2XIW A;  2A6H C;  3VR4 A;  1EFI D;  5IGF A;  4BBS B;  2L9H A;  1SNQ A;  3TP6 A;  3VYU A;  2B2Y C;  1H9J A;  2M2L A;  2RSO A;  3BYT B;  4RCN A;  4ILW A;  5EKI A;  4ZKC B;  1CHQ D;  2EYF A;  3S14 B;  2ICE C;  3J7A V;  4FNF A;  5C0X J;  3MTS A;  1R9T B;  5CV4 A;  1GUG A;  2Z4I A;  1BDO A;  2NZ1 D;  3S1N B;  1SXT A;  2IX0 A;  2ZXO A;  3TME A;  1K83 B;  3OSO A;  1EIH A;  3EQL C;  3WDN A;  2ZXP A;  1JWS D;  1O7L A;  3S15 B;  1Y1V B;  2H4O A;  4F7X A;  2PO4 A;  5EPJ A;  1JOQ A;  1V1O A;  1I6V C;  1PXU A;  4UDU C;  1ENF A;  1G91 A;  3NP8 A;  1QIL A;  2EY5 A;  4NDX A;  1DZ1 A;  1ET6 A;  2FFK B;  4Z9C B;  1Q1B A;  2KJX A;  3S1M B;  1B9M A;  3FKI B;  1KDC A;  3LWE A;  1X3P A;  4XT1 B;  2NN6 I;  2KUM A;  4IFD J;  3MZ5 A;  2XWB B;  2IWH A;  1SSO A;  3CQZ B;  3K6O A;  5IIF A;  4XYO A;  3IKJ A;  3HZX A;  4M1U B;  5EBD A;  1E0B A;  2ICI A;  1F9Q A;  3K5O A;  1SBB B;  5FLX L;  1LTB D;  2CW0 D;  3TZU A;  3DWA A;  1JR0 D;  5KYI A;  3D4D A;  3NE5 B;  3DWQ A;  3NUC A;  3Q23 A;  1CA5 A;  1OO9 B;  1YNJ D;  2JA5 B;  2DNC A;  3P20 A;  3PO2 B;  5C3E B;  3VA7 A;  4OL7 A;  2JA8 B;  1XYI A;  1DOM A;  1BCP D;  3IL8 A;  5AFW A;  4N9T A;  2LMC B;  1SDF A;  3QJY A;  3I91 A;  4HCE A;  3PIO 3;  1F9S A;  1QNK A;  3C1E A;  4BA2 I;  1I4P A;  2F3W A;  2F0O A;  4B08 A;  3RZD B;  1HFG A;  2G9D A;  1VF5 C;  4A3F B;  5LHY 1;  5JEA G;  1HTP A;  5E3F A;  1ESF A;  3MFY A;  1JQY D;  1HUN A;  2IL8 A;  4RFB A;  2EY6 A;  2A68 D;  2HCC A;  2XRQ D;  1FYC A;  1GXD C;  1TR5 A;  4HTH A;  4K14 A;  3KK7 A;  3NTI A;  3DEP A;  4U68 A;  5KEE A;  2WKD A;  5KRU A;  1FNV A;  3BZD B;  5JEA J;  3A56 A;  4PNY A;  3VR5 A;  4FYD A;  3SK8 A;  5CGK A;  1TY0 A;  5FKA C;  2PMZ B;  3IFD A;  4H7B A;  2R61 A;  4KMU C;  1B9N A;  2WAC A;  1Q8I A;  4V19 0;  1S4Z A;  2NVY B;  3D4R A;  2YU9 B;  3TP7 A;  2X69 A;  4F8M A;  5T1I A;  4IZ8 A;  1BF4 A;  4H44 C;  5JEA H;  4HMI A;  2F0J A;  4K5V A;  1PFB A;  3ERO A;  3LWU A;  1EU4 A;  1TT2 A;  3K5M A;  2Q8R E;  2BCO A;  1EY7 A;  2KEE A;  1TII D;  1TVX A;  1F9R A;  2B2U C;  1BOS A;  1TU2 B;  4DA2 A;  4CKC A;  5JPN C;  5M3M B;  1WTQ A;  4WRD A;  1L0Y B;  2L4N A;  1STY A;  5LL6 S;  5D65 A;  3Q24 A;  1LTS D;  4ZQ3 A;  1K8M A;  3GTL B;  4CJ2 C;  2K05 A;  2Z1C A;  5M5X B;  1SYC A;  5CR3 A;  4FF2 A;  3SK6 A;  3W2D A;  1BBX C;  2AUJ D;  5KNC A;  3GTO B;  2JE6 I;  4OHJ A;  4R8N A;  2F0Q A;  3S1R B;  1JIC A;  1Y1W B;  1UAP A;  4KI0 A;  5CBE E;  1TS5 A;  4QMG A;  2N88 A;  1GUT A;  1GHK A;  2OEO A;  3U9O A;  4C3I G;  3C2P A;  3M7N A;  2EVB A;  1KAB A;  1FD7 D;  3S2H B;  3D31 A;  3R2T A;  5M9O A;  3GTQ B;  3T56 B;  3A8K E;  1SYB A;  4DAP A;  5I2X A;  1B50 A;  1KTK A;  3C1F A;  4NKL A;  3NBH A;  3O13 A;  1EEI D;  2SEB D;  3H6M A;  3TSS A;  1NAP A;  1SE3 A;  2F0I A;  1HFN A;  3K0Y A;  3NPP A;  5IOD A;  1WTX A;  1STG A;  4I7Z C;  3GTM B;  2F0K A;  2KCN A;  4I65 A;  4PMW A;  1SYE A;  3TP8 A;  1NUC A;  4HMJ A;  4ID6 A;  5J22 A;  4C3I B;  3NK9 A;  1IKL A;  1IW7 C;  5C4X B;  1H9S B;  4FXK C;  1ZXT A;  5I2Y A;  2E76 C;  4PMC A;  4KY5 A;  1QOH A;  4DN4 M;  1Q1E A;  1OXV A;  4XYQ A;  1CZW A;  1WTV A;  5JPM C;  3A8I E;  5CV7 A;  3HOW B;  3D6C A;  1DOK A;  2X6G A;  3T4A C;  3H0G B;  3J80 E;  1EY9 A;  1SEB D;  3MC0 B;  4XQJ A;  3QB3 A;  5I4D A;  4K5X A;  1FGB D;  5K36 G;  1OXS C;  1EEF D;  1LT3 D;  1E2W A;  5FO9 B;  1HPC A;  2F0P A;  2K01 A;  2QKI C;  4RAU C;  2R6G A;  1DYQ A;  4HSP A;  2G9H D;  1Q3L A;  2F1M A;  4MN3 A;  4QCL A;  3EVQ A;  3OWF A;  2MGS A;  1PRT F;  4RGO S;  1EYD A;  2A69 C;  2KVM A;  3BYY B;  1ENC A;  4K2L A;  1WTP A;  3J7Y W;  1SE4 A;  3KLR A;  2AQ2 B;  2EYH A;  1BO0 A;  3H3V C;  1ZYR D;  2NN6 G;  4DXF A;  1UNS A;  4WFN 3;  5FOB B;  5EPL A;  1PZK D;  3F2U A;  2F0U A;  2DY8 A;  3E6Z X;  2J0T D;  2HDM A;  2CHB D;  1C48 A;  4IAL A;  1Y8N B;  2AWN A;  4A3B B;  1JOK A;  3SVM A;  4KKU A;  4C3H B;  3BG3 A;  1SE2 A;  5G3L F;  4RA8 A;  5K36 H;  1SYG A;  2PZT A;  3VR3 A;  2EZV A;  3HOX B;  5DM6 3;  2KCC A;  2RA4 A;  1RJT A;  1C4Q A;  2NVX B;  3FMC A;  3QOL A;  2K5Q A;  2K5W A;  3HOY B;  3SHL A;  4K6L A;  1B2T A;  1H9S A;  4ABN A;  2E2H B;  4IUQ A;  1AP0 A;  1O7Y A;  4YIJ A;  1HTL D;  4KHV A;  4PV1 C;  3NTK A;  1Z47 A;  2AQ3 B;  2QF7 A;  4XIG S;  2ID0 A;  3ITP A;  4J8Q A;  4J1M A;  1MD2 D;  1TWF B;  3P75 A;  2NN6 H;  1J9O A;  3BDL A;  1SYF A;  2EYM A;  3HOU B;  1JOR A;  3GTG B;  1JC7 A;  1TS3 A;  3BS1 A;  2B2W A;  5I6Y A;  1A3T A;  5HGT A;  3D6W A;  5EQ0 A;  1LV9 A;  4EQP A;  1R4Q B;  4OO1 I;  3H94 A;  1ZYR C;  3OPO A;  1U4R A;  3PIP 3;  1PTO H;  2TSS A;  1STB A;  4ZRZ A;  4A3G B;  4A3M B;  4ULL A;  3HOZ B;  3FPP A;  3WOE A;  2KOL A;  2B2T C;  4RGM A;  1BNZ A;  4L8J A;  1I3Q B;  4BY7 B;  4KY7 A;  1PRT B;  4CHT B;  1ROD A;  2V4D A;  4O1N A;  3ND8 A;  2JYO A;  2NWG A;  5IGE A;  4XTC S;  2B8G A;  1TS4 A;  1A3U A;  1XWE A;  5A2Q E;  5DNF A;  4LK1 C;  4EVO A;  3HG9 A;  4QF4 A;  5CBA E;  1NSN S;  2MHV A;  4NP5 A;  4HED A;  1Z7T A;  4G7H C;  3W3A A;  5JVH 3;  2HUG A;  2O5I C;  2VNU D;  3WOF A;  1Y69 U;  2XVS A;  2SNM A;  4J6H A;  1T5X D;  4TSS A;  4FF1 A;  3FPU B;  1FR3 A;  4RGN A;  5ELB A;  3K5L A;  4Y7N B;  3S9W A;  3S2D B;  4A3I B;  4F87 A;  1V1P A;  4MIU A;  5EPK A;  4B9X A;  5C6A A;  2KEC A;  1XTC D;  1A3V A;  4H13 C;  1PDQ A;  3SXH A;  2XSC A;  3QIA A;  4LAA A;  4A3K B;  1CHP D;  1ICW A;  2F0H A;  2EJM A;  5D14 A;  1O78 A;  1PFN A;  3N6R A;  3VYT A;  1QCB D;  1H9M A;  4KKS A;  5JOB A;  1CA6 A;  3M4O B;  2B2V A;  3I3C A;  4XXE A;  4KV6 A;  1ENA A;  1IKM A;  5IGD A;  1S5E D;  1Q12 A;  2VB3 X;  3I90 A;  4RGT A;  2A5H A;  3OWE B;  5M3F B;  5FK9 C;  1KAA A;  4XQN A;  1A6X A;  4KHZ A;  2EYJ A;  1SNM A;  2B8F A;  2E2D C;  4DNT B;  3D4W A;  4K8J A;  3HOV B;  4QUF A;  3ND9 A;  1STE A;  4GZY C;  3E5S A;  5C5M A;  2K1B A;  3TBI B;  3JAM E;  3CKI B;  3BVM A;  1EWH A;  2NTS A;  3PUY A;  3CRL C;  3OHX C;  1STA A;  2F0V A;  2R93 B;  4Q0F A;  2H1E A;  4C56 C;  2A74 C;  4EQO A;  3HEJ A;  1MI2 A;  5C0X I;  1CI3 M;  3KUP A;  4MHE A;  4G7Z C;  2JP1 A;  3DHQ A;  5EGT A;  3ONA B;  3I4M B;  1CQV A;  1B4O A;  2FMC A;  2YYZ A;  3K57 A;  4ZAI A;  2XRS D;  4CKE A;  1VMP A;  1LT5 D;  3EA6 A;  2EE1 A;  3BVZ A;  1RKN A;  3NXW A;  3MAQ A;  5D3D A;  1QG7 A;  1PMR A;  2PPB C;  2QCP X;  1RF2 D;  3M85 A;  4DK0 A;  2BA0 A;  3EJI A;  2VXW A;  1RHP A;  2F0G A;  5I9P A;  3SDZ A;  2CQA A;  2HDL A;  3VR2 A;  4IFD I;  2F0W A;  3PMF A;  3H09 A;  1EWC A;  1IW7 D;  2AWO A;  2IPK D;  3SR1 A;  1WD0 A;  3OOC A;  1LAB A;  2IW3 A;  2BA1 A;  3DEO A;  2AQ1 B;  2L1B A;  1R4P B;  4HR7 B;  5NUC A;  2RKS A;  1OXX K;  1CQF A;  3RD4 A;  1GJX A;  1F77 A;  1M8A A;  3OMC A;  1A2U A;  2D62 A;  2L11 A;  2F0N A;  3Q6S A;  2RDH A;  3HKZ B;  4RHS A;  3J7A F;  2O5J C;  5D3I B;  2F0T A;  3AMU A;  1U4M A;  1S5C D;  4F88 A;  3TZD A;  5EJW A;  2Q8I B;  5CV6 A;  5IT9 L;  4PMB A;  3MXP A;  1WTO A;  2D5D A;  2A69 D;  1TS2 A;  3GP7 A;  2BE5 C;  4KKT A;  2PQE A;  2XWJ B;  3NBI A;  3SE0 A;  3VA5 A;  4BY1 B;  2NVT B;  5EKL A;  3M4Y A;  1RTN A;  1UUP A;  3X3N A;  3T13 A;  3L3O C;  1W6K A;  4HSV A;  3E0J A;  1KLG D;  3DM1 A;  1G29 1;  1TWG B;  2K03 A;  1HHV A;  1B44 D;  3GTK B;  2WV6 D;  4CJ1 B;  3Q0A A;  4X3U A;  2F03 A;  1O80 A;  1SMY C;  5KYL A;  4OO1 G;  1JWU D;  4S3S A;  3AB9 A;  3RUZ A;  1O7Z A;  3D8G A;  1I4G A;  2M00 A;  3SEB A;  2QDB A;  1ILP A;  5KGU A;  3TP5 A;  1PTO F;  1CM9 A;  4QIW B;  2QIL A;  3M3Y B;  2D9U A;  2F0F A;  3HS0 C;  4DU9 A;  1EOT A;  1ESR A;  3QOJ A;  2J7Z A;  5K5P A;  2O4X A;  1KDB A;  1PZJ D;  1WVL A;  1X3Q A;  3MA2 B;  1SJE D;  2PNR C;  3K58 A;  1MGS A;  1ZEQ X;  4M8A A;  4P2C B;  1U4L A;  2B2W C;  2K32 A;  3NSW A;  5J1Z A;  4ZUI A;  3RMH A;  4C3H G;  3S17 B;  3ERQ A;  1E2V A;  4DF7 A;  1V8Q A;  5FO7 B;  4RWS C;  1DOL A;  3PO3 B;  3I8Z A;  3BDC A;  3ZYY X;  4OO1 H;  1EZ6 A;  4LJZ C;  4ZLT F;  1SFO B;  3N52 A;  2KQ3 A;  1Y8O B;  5F2D A;  2C9O A;  2WII B;  3R3O A;  3H91 A;  1TKW B;  5E4W C;  4FP5 D;  4RKL A;  4ZK9 B;  3S16 B;  3VR6 A;  1EIG A;  1OXU A;  1S5F D;  4NW2 A;  1F2L A;  1GUO A;  5CMD A;  3QO2 A;  1JE4 A;  1EY8 A;  1KNE A;  3J81 E;  3UI2 A;  4KN4 C;  4DFA A;  3URY A;  2I46 A;  5BN3 A;  3LX0 A;  2VUM B;  4X3K A;  2Z8L A;  2EY2 A;  1CK1 A;  1EY5 A;  3X3M A;  5CYU A;  1Z6H A;  2Z4H A;  1AN8 A;  1WCM B;  2E74 C;  3A8J E;  1EL0 A;  1L0X B;  1I4R A;  1B1Z A;  4G4K A;  3OIP A;  1QWY A;  2EXZ A;  3KLS X;  2IT1 A;  2F4I A;  4QB4 A;  1EU3 A;  2K6A A;  2A73 B;  5JVG 3;  2N55 A;  2JXM B;  3PUV A;  3AU7 A;  4ME5 A;  5C44 B;  4IUV A;  3PV0 A;  4K8I A;  1GOZ A;  4QUC A;  5EBC A;  3SK5 A;  1PTO C;  4PQX A;  4R8I A;  3MXN A;  3MHB A;  1PFM A;  3VYS A;  2L12 A;  5IGB A;  4HCS A;  3SK4 A;  1EYC A;  4CGY B;  1TWC B;  1PTO B;  4JK1 C;  1II3 A;  2F3V A;  3GO5 A;  1I4H A;  1HCZ A;  1HRJ A;  1V1P B;  3KBX A;  2KHS A;  4X3T A;  2NUC A;  2PZW A;  3BVG A;  4L63 B;  5ELC A;  3Q22 A;  5C0X G;  1G8Z D;  5C3X A;  3NWT A;  3V2T A;  3K5N A;  1WTW A;  1U4P A;  2B2V C;  1DJR D;  2DY7 A;  5C4J B;  1PRT C;  4A3J B;  1HA6 A;  3PUX A;  4C1N I;  1LLR D;  2E75 C;  1BR9 A;  5COY A;  1WD1 A;  1LTA D;  2JA7 B;  1MBY A;  2PW7 A;  4FXG C;  1HXY D;  2EDG A;  4DGZ A;  1H9R A;  3PUZ A;  1CZG A;  4K5W A;  1IYV A;  1EY0 A;  5CV5 A;  2HQE A;  5C4Z A;  5IGC A;  1SYD A;  1QNU A;  2R3Z A;  4IUP A;  3T51 B;  4TRD A;  3IAY A;  2LFN A;  2FIN B;  3K59 A;  2OT2 A;  2CVR A;  4IFD G;  1RD9 D;  2OXP A;  2WAQ B;  5IOC A;  1I6H B;  3G7L A;  5DAU A;  3VYR A;  4A3E B;  4KJO A;  1A15 A;  5C0X H;  2WB1 B;  4CKB A;  1TWA B;  2F0M A;  1LAC A;  4FO2 A;  3CRK C;  1X32 A;  4NMZ A;  5ISR A;  3KLS A;  5I9O A;  5ELD A;  1T5E A;  2DNE A;  3KBG A;  5ELF A;  3A54 A;  1SNP A;  4KY6 A;  2EY1 A;  4XQQ A;  1CT1 D;  2JEB I;  5I6W A;  4OIK A;  3CHB D;  3MFG A;  4ZYS A;  1EY4 A;  1NR4 A;  1D5X C;  2EYO A;  1LTT D;  5HUR A;  1ILQ A;  2A6E C;  1STH A;  1BCP F;  3GV3 A;  1GUN A;  2QEJ C;  1KLU D;  5COR A;  2PW5 A;  2NVQ B;  4XDX A;  3TN2 A;  1RDP D;  2RVL A;  1ZKO A;  4R9W A;  4IFD H;  3T16 A;  2MJ8 A;  3HP3 A;  1QB5 D;  3OW7 A;  2EJG C;  1JOO A;  1HA5 A;  2B2Y A;  2SOB A;  5ELE A;  2BDO A;  2NBF A;  3DWP A;  4DAV A;  4UAI A;  2X6L A;  5LL6 X;  2B2T A;  3NTH A;  1H9K A;  3GTJ B;  3FDT A;  3I72 A;  3D3R A;  1B53 A;  4Q5V A;  3GD7 A;  1OXT A;  1MSH A;  4CBV A;  3PUW A;  2L55 A;  5M5W B;  1HUM A;  2E2J B;  4O42 A;  3BDO A;  5IGG A;  4OIJ A;  2RSN A;  2DN8 A;  3MXU A;  3J80 L;  2XN9 C;  5M5Y B;  1NR2 A;  1GUW A;  4DAY A;  2L5T A;  1CFM A;  1JCK B;  2PCF B;  4RKB A;  5T1G A;  2O2L D;  1WTR A;  2FJ2 A;  4ODG A;  5KIX A;  3QWN A;  5E1F A;  2LS0 1;  1EQV A;  1DM0 B;  3I73 A;  2F0S A;  3M7G A;  2BE5 D;  1KDA A;  4BS9 A;  1XX8 A;  1W6J A;  3FVQ A;  1QJO A;  2M9V A;  2B63 B;  4BWG B;  5KNB A;  4IQZ A;  5JAV A;  4C3J G;  4A3D B;  4ZKB B;  1GUS A;  4FVM A;  2KA7 A;  1D5M C;  4BA1 I;  1DCZ A;  1D6E C;  1D2B A;  3A7A B;  1CTM A;  2CW0 C;  1LTI D;  3L7Z C;  1ML0 D;  1YNN D;  4TKO B;  1D1I A;  3MEH A;  1SMY D;  1SNO A;  1YNJ C;  3J81 L;  1HQR D;  1K8O A;  4ZUJ A;  2R92 B;  2AUK A;  2FHT A;  2PZU A;  2Y0S B;  1HQM C;  3T53 B;  1EY6 A;  1BCP C;  1FNU A;  1DXM A;  1NCV A;  3GQB A;  1QE6 A;  3NHH A;  2L0C A;  1E2Z A;  5BN4 A;  4KTA A;  2EYL A;  3R8B A;  4IUT A;  1FNW A;  3G6J B;  4E6I A;  2K28 A;  4V0B A;  1BCP B;  1LTG D;  5BN5 A;  3NQT A;  4C3J B;  1AZQ A;  1S5B D;  4DNR B;  4RCO A;  5C3W A;  3MXG A;  3MVV A;  4TQU S;  1VDZ A;  2E2I B;  2XNA C;  2C5C A;  2JA6 B;  3I4N B;  1VCI A;  2SDF A;  3A7L A;  1I4Q A;  4C2M B;  4FF4 A;  1BUV T;  5DEH A;  2IJ0 A;  1VMC A;  2A68 C;  3A55 A;  1LTR D;  2NYZ D;  3I4L A;  3P1H A;  3V05 A;  3FEW X;  4IUR A;  2F0E A;  1V43 A;  4A93 B;  1BXT A;  1GHJ A;  2WKC A;  2F0L A;  2RDF A;  4BBR B;  1SJH D;  1IYU A;  4OGQ C;  2K5D A;  5FLX E;  1LT6 D;  4H0L C;  4HAE A;  3C3L A;  1VF7 A;  1PZI D;  4LMQ D;  2EPB A;  2RQX A;  1F9P A;  1IL8 A;  2FMM A;  1YNN C;  5JJZ A;  2VB2 X;  3TDQ A;  5KND A;  4G7O C;  2IX3 A;  2J4X A;  3OIQ A;  3C46 A;  4FF3 A;  3GTP B;  2K33 A;  1EZ8 A;  2B39 A;  2MP1 A;  1TWH B;  1AW7 A;  2EYP A;  3NQI A;  2EJF C;  4KJN A;  2Q8T A;  3LNN A;  1PYW D;  4DXG A;  1MSG A;  5A2Q L;  3R93 A;  5J39 A;  3QG1 A;  2PYK A;  4AYB B;  1STN A;  4KD3 A;  3HGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...