1G2TA

Solution structure of eotaxin-3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
b'TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EOTAXIN-3
publication title NMR solution structure and backbone dynamics of the CC chemokine eotaxin-3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1g2tA00
2N55A 4DN4M 1EIHA 1U4RA 5E4WC 2DY7A 1HUMA 1G2TA 1F2LA 2J7ZA 3I3CA 1DZ1A 1CM9A 1Q3LA 2CVRA 2RVLA 1DOLA 3I90A 3ONAB 1WTXA 1SAPA 1LV9A 2EE1A 3TN2A 1HHVA 1ICWA 3I8ZA 2KEDA 1RTNA 1GUWA 2SDFA 3N52A 1MSHA 1U4PA 1HRJA 3I91A 1X32A 1PFNA 1NCVA 2X6LA 1CA6A 1EIGA 4IURA 2B2TA 3DM1A 3UI2A 2B2VC 2K04A 5D14A 1RHPA 3KUPA 1NR4A 4IUVA 4LMQD 2D9UA 1F9RA 1B53A 2X69A 3MWYW 1J9OA 2MGSA 1WTWA 3IL8A 3MTSA 5JJZA 1TVXA 1MI2A 1XYIA 1ESRA 2K01A 2FINB 2R3ZA 1CA5A 1M8AA 1IKLA 2B2TC 1HFGA 4CJ0B 1E0BA 2DY8A 4XDXA 2L4NA 1B3AA 1IKMA 2L12A 2JP1A 3DEPA 5CBEE 4X3SA 4IUQA 1RODA 2RA4A 1SSOA 2B2YC 1G91A 4X3TA 4X3KA 1EQTA 1B4OA 1PFMA 2FJ2A 2K28A 5CORA 4XT3B 2B2UC 4ZKBB 1EL0A 1DOMA 2L9HA 3Q6SA 2FHTA 1AP0A 2K1BA 1RTOA 2IL8A 4IUPA 4XT1B 1WTRA 3KBXA 1C8CA 1DONA 4UAIA 5T1GA 1WTVA 1S4ZA 1ILQA 3SVMA 4IUTA 2Q8RE 1BO0A 3HP3A 1BF4A 4MN3A 5T1IA 2MPMA 4HCSA 2BDNA 1F9SA 2HCIA 4HSVA 1BBXC 2NZ1D 4OIJA 5EPLA 2B2WA 2KEEA 2NWGA 1DOKA 2K05A 3FPUB 4R9WA 1U4MA 2HCCA 1JE4A 3H91A 1KNAA 1BNZA 3DEOA 5CMDA 2N88A 3QO2A 1X3QA 1EOTA 1WTPA 1F9QA 5EKIA 1IL8A 1VMCA 1ILPA 4CJ2C 1HFNA 1ZXTA 2HUGA 4X3UA 1MGSA 4NW2A 4OIKA 2HDLA 4CJ1B 1O7ZA 4MHEA 4QUFA 1HA6A 1U4LA 1O7YA 2EOTA 1WVLA 1QE6A 3GV6A 3LWEA 5EPJA 1MSGA 4R8IA 1ML0D 2XIWA 3R93A 1HUNA 1VMPA 4HAEA 5AFWA 2H1EA 1NAPA 4RWSC 1JICA 1RJTA 2EPBA 1QG7A 2KECA 5EJWA 1SDFA 2RSNA 2B2VA 1F9PA 2MJ8A 1NR2A 4ZK9B 1O80A 1X3PA 2M2LA 3F2UA 5EQ0A 4ZKCB 2MP1A 3IFDA 1PFBA 5E4XA 1A15A 1G6ZA 2RSOA 1B2TA 1G2SA 1KNEA 1WD0A 2JYOA 2KUMA 1AZPA 4RAUC 4IUUA 1WTOA 4ZLTF 5COYA 1J8IA 5D65A 1QNKA 3G7LA 4QUCA 1XX8A 1B50A 2B2WC 2NYZD 3GV3A 4ZAIA 1PDQA 2FFKB 2K03A 2L11A 2KVMA 4RA8A 3FDTA 3TZDA 1AZQA 4U68A 5EPKA 4HEDA 4O42A 2X6GA 2B2YA 2KOLA 2L1BA 5DNFA 2Q8TA 3D6WA 1WD1A 1PLFA 3P7JA 1WTQA 2B2UA 5CBAE 2HDMA 2FMMA 2VXWA
chains in the Genus database with same CATH superfamily
1FD7D 2MFIA 3NE5B 2Z4HA 2K5HA 2E2DC 3S1RH 5C3WA 1CM9A 1EEID 2RVLA 4LUOA 2EE1A 1GUWA 2SDFA 4N9PA 1Q90A 3GTMH 4G7OC 4QQBX 3PIO3 4PV1C 3QB3A 2KHIA 4FXKC 4HIMA 3MA2B 3R8BA 3MZ5A 5CV9A 1G51A 1HZ9A 4L5QA 3CCJA 4JI8Q 1X54A 4A3GG 4A3MH 4DXFA 1M8AA 2J0TD 1B3AA 2H5XA 1FNUA 2K4KA 1QVCA 4K2KA 2I46A 4POFA 1VQCA 1HQRD 4C3HH 1OXUA 3F2BA 4X3TA 3NQTA 4I65A 4M1UB 4BXXG 5I4DA 1GUOA 1EWCA 3HOXB 5AJ3Q 2QILA 2B39A 4DFAA 3PSIA 5CV4A 4HJ5A 3SE0A 1TWAH 3I4MB 5IWAL 4DK1A 1BKBA 2RHSB 4K14A 4JI1L 1E1TA 1YNJD 4DNRB 4DV6Q 4DR2Q 3HRZC 2HT1A 3IFTA 2N88A 2O5JC 1F2MA 3EVQA 4I7ZC 4R4CA 2I0QA 3CQZH 4H13C 1HNZQ 1ILPA 4RCOA 3H0GG 2A74C 1HNWL 1VQJA 4CJ1B 3KDFA 2CQOA 2Z6BA 4B3ML 4JW0A 1X6OA 3MC0B 1ASZA 4IPGA 4RWSC 2JK8A 3HOYB 2E2JH 4LF4L 3CCUA 5IP9H 2AUKA 3FKIG 3BG3A 4BA1I 2M2LA 5EQ0A 2VW9A 3HOWB 3R2TA 1I50B 2Z1CA 2EY6A 1LTAD 1XWEA 2A68C 2YTYA 3G6JB 4L6TB 3T1HL 1ZKOA 4ZAIA 1P8LA 1PDQA 4A3IB 2UU9L 4MTNA 1PYWD 3I4LA 4IJHA 3C1EA 1KABA 1V1PA 5M3MH 1IYJB 4LFCQ 4K5XA 3EA6A 4A3CG 4G4KA 2JEAI 1PTOB 4TQUS 1EZ6A 1SN8A 1PTOF 5C0XJ 1H9JA 5LMNL 1Y1VH 4BY7B 3TDQA 4OWXB 3Q24A 4OO1I 4BY1G 3STBC 3I70A 5LMUQ 4X65Q 2FMCA 3OMGA 1HNXL 3MFGA 5KYIA 3EN2A 4C2MH 2K75A 2C9OA 1BUVT 1G6PA 4JBWA 1HR0W 2NZHA 3F2DA 1E0BA 3NUCA 1XNQL 2QEJC 1EY0A 3CW2C 1Q81C 3HOVB 1FJGL 4JV5L 1RODA 2RDHA 2SNMA 4A3KH 2GN5A 1Y1WG 4UPAA 1STEA 3ZYYX 4A3BG 1MD2D 3E0EA 1I4XA 1AN8A 3RR5A 1VQMA 4G57A 1VQOA 4JI3Q 1XPOA 3TP6A 2IX3A 3RZDB 2B8GA 2EQSA 3KJPA 1S5DD 1MJEA 1VQLA 1OTCA 3GQBA 1VQDA 1TWFB 2VQFL 2HUGA 2YTVA 3DWQA 2B63G 4C1NI 4OONA 1JC7A 1HA6A 1O7YA 2P5ZX 1Q1BA 4JBJA 4RKBA 1JCKB 4O2DA 2KCMA 3S1RB 1H95A 2XWBB 4NMZA 1NUCA 2I5HA 4LF8L 4N8X1 4O0AA 4EX5A 4H0LC 3KLRA 3GTMB 4KHVA 5ELFA 4ZKCB 1I5FA 3G71A 3F2CA 5JEAJ 4B3SQ 4FNFA 3J7ZC 4DR3Q 4ZLTF 3J81c 4LF5L 1ET6A 5D65A 2NYZD 5I6YA 1F77A 1YBYA 2TMPA 1LYLA 5FO8B 4A3EG 1VQAA 3I4MG 4X64L 5KIXA 1PH8A 4NXMQ 3HKSA 5C44H 4GNXB 1VQPA 1T5XD 4OELB 2WACA 3RN2A 1HHVA 3E9IA 4KHPL 4GLXA 4RH6A 2EXZA 4M8AA 3M4QA 4FXDA 1GUGA 4LFAQ 3HOZB 2R61A 5DLQE 2NUCA 5LL6S 3SDZA 5IP7G 4K6LA 1PVOA 4JYAL 3PO3B 2IHEA 5BR8L 3JAME 1GUSA 2EJMA 3KLWA 1CQFA 3CQZB 1BCPF 4HIKA 3K59A 5GADC 4J1MA 4P73A 1A8VA 5FO7B 2NB0A 1DYQA 4A3GH 3HOWG 4AQYL 1Y8OB 3U50C 4HIOA 2DUDA 2FJ2A 5J39A 3I73A 1SE2A 1SYEA 1N36Q 3J7AV 4LF7Q 3S1MH 5C5LA 4DV1L 2Q8RE 4BXXH 4V0BA 1HTLD 1EUJA 1S5ED 2LY7A 4JCVE 2NZ1D 1SYDA 4OWWB 2UUAL 3SK6A 3MFYA 1X3QA 1STAA 3KF6B 5FLMG 1IBLL 4BY7G 4OIKA 4NW2A 5IGFA 1VQ7A 3OW7A 3QJYA 4DR4L 1O7ZA 2GA4B 3NTIA 4X66Q 2KCTA 3LWEA 3GV6A 4RGNA 5BN4A 3H0GH 2MQHA 1NAPA 2WKCA 1JICA 1RJTA 1CFMA 3Q22A 1Y1VB 3BDOA 5EJWA 4DK3C 2D62A 4F88A 3F2UA 4KHZA 2QW7A 1G2SA 3HOVG 1S5CD 3MXUA 4GLAC 4R4QA 4GOPC 2DJFC 2MHVA 4IQZA 4HJAA 3OSOA 3FKIH 2F4IA 4GN4B 2MUYA 2RF4A 4C2MB 3C46A 4HIDA 5HGQA 2FFKB 4DV2L 1I4PA 3ICEA 2KVMA 3CCEA 1AZQA 4ULLA 2X6GA 1QVGA 4A93G 2ALYB 4G7HC 4JI7Q 4JI6Q 2CKZB 4QIWE 1T5EA 4A3KB 5E4WC 3S2DB 2UXBL 1GHKA 3ULJA 5C0XH 1X3FA 4IFDG 1CZWA 1N32L 2NVQH 1SAPA 3V2TA 5C4JH 2KEDA 5E7NA 3RMHA 4KY5A 4A3CH 1U4PA 4IO9A 1JJGA 3NTHA 4C3JB 1KHIA 4CDDC 3KLSA 3BDCA 2IHFA 4ME5A 2ENBA 5KGUA 2WV6D 4UP8A 4LFBQ 1K3BC 1WTWA 4BY1H 4XYOA 4J6HA 3J81E 2UXCQ 2EDGA 2A1AA 2KCCA 4B9WA 4L5RC 2G9HD 1B9NA 2PZUA 2L15A 1SSOA 2RDFA 2Q2IA 1B1ZA 3Q6SA 2BE5D 2K1BA 3F1ZA 3KBXA 1RD9D 5GAGC 4HJ7A 3A7AB 2HQEA 4HN7A 2Z6KC 1LT5D 2CW0D 2BA1A 2ID0A 1VQBA 4OEMB 1K0RA 1Y1WH 3H3VH 4A3BH 4C3IG 4OIJA 3RD4A 1QZGA 2NWGA 1U4MA 3GTKH 1WCMB 3H91A 1JOQA 3CRLC 4A3JG 1O78A 4JPBW 1Q7YC 1PV4A 4FF3A 3HOZG 4XIGS 4GKKQ 1K73C 5CV6A 5LMNW 3PV0A 2AQ1B 5C44B 5FKAC 3WDNA 3PO3G 1L1OC 1FNVA 5J22A 1PRTF 3I7FA 4QCLA 1V1OA 3K80C 5JEAH 1A3VA 4DV3Q 1O7IA 3TS0A 1AH9A 3I72A 1A63A 4XQNA 1WTOA 1EYDA 1STHA 3G7LA 1EU4A 1SXTA 5D3DA 3DUZA 1EY7A 4CHTB 4U68A 2E5LQ 1ENFA 4O42A 4K8JA 3RNUA 1Y8NB 4A3GB 1A3UA 2E76C 1EIHA 2DY7A 4A3EH 1FGBD 2J7ZA 3I3CA 4YHHL 3I4MH 3I4NG 5IGCA 3I56A 3ONAB 3S1MB 3S9WA 1GXDC 3A54A 2VQEQ 4DV5L 1MSHA 3Q0AA 3CCLA 3H09A 3T53B 1QVFA 2A19A 1TQOA 1PH5A 4NKLA 3K58A 1KAWA 3L2PA 2L0CA 4YCVA 2YU9B 1GUNA 1RHPA 3GTQH 1XTCD 3TSSA 4QIWB 1HTPA 3IL8A 2F0QA 4A76A 1YVCA 5IP7H 3OOCA 2A68D 4XXEA 1LT3D 2PMZB 1IKMA 2EY1A 3AB9A 5CBEE 2Y0SB 3VA7A 3GTLB 5DAUA 4YCWA 5JAVA 4UP7A 3PF4A 2OEOA 3H0GB 1EL0A 1DOMA 1CTMA 5IYDG 3VYRA 1VQKA 3HOWH 3HEJA 5J1ZA 1DONA 2G9DA 1Y69U 1I50H 3DM3A 1TXYA 1KAAA 2RKSA 2CWAA 2MO1A 1F9SA 1PYBA 4HSVA 3K5OA 3FPUB 3G4SA 1LTGD 3FKIB 3TMEA 1I94Q 1E7ZA 5DEHA 1BNZA 5IYBG 5IE8A 1SLJA 2Q2TA 1F9QA 3SK5A 3J81i 1NMFA 1E1OA 3V96A 2EYPA 4DAYB 2KCNA 1EQRA 3M3YB 2OXPA 4RMFA 4QUFA 1CKMA 1CQVA 4C3JG 5FLMH 2ZM6Q 4H44C 5TSSA 4BBSG 3U58A 4BY7H 2XIWA 5C3EG 2EYMA 1JJ2A 1QNUA 5C4JB 3UE0A 3AU7A 1I6VC 3CF5A 3PGZA 1BBWA 1SNOA 4R1JA 3U9SA 4P72A 3T1YL 1EFWA 2JYOA 3K8AA 3M4PA 2KJXA 4BY1B 2JA5G 4DV7L 2UXDQ 3HOVH 3TZDA 1GD7A 1LABA 1W3SA 1AFPA 2EJFC 4CDCC 1Z47A 4MNOA 2KA7A 4DR5Q 4A93H 5GAEC 1WCMG 3R3OA 1LV9A 3C3LA 2YTXA 2QF7A 1OXVA 4Y7NH 1HJPA 2HD3A 5NUCA 4IFDH 4A3BB 1A2UA 4IURA 3TBIB 4DR6L 4OX9L 1K8OA 2I07B 1TWFH 5IT9c 3GTKB 1CT1D 4ME3A 1NTGA 3UDGA 4QB4A 5JJZA 2LXKA 1BBUA 2FINB 3AYHB 3SK4A 2B2TC 1U5KA 3TEHB 2CW0C 1JMCA 1MHWC 5JOBA 4DF7A 1KL9A 4JI5L 4FF1A 4A4IA 4X3KA 1EQTA 2K28A 2B63B 1UE5A 2NVTB 1HPCA 5FLXE 3X3NA 5CC4A 1LM0A 1P16A 1IBKQ 4FXGC 4DUZQ 2N3SA 1ESFA 4K0KQ 2HCIA 3CP0A 4F87A 1K83B 1W6JA 4YY3Q 4L5TA 1SYBA 2WIIB 4L63B 1EZ8A 4C3IH 1M1KC 1HH2P 4A75A 1ZXTA 4GNXC 1SMXA 2F0HA 4H7BA 1AE2A 2HDLA 1TY0A 3T13A 4A3JH 3NPPA 1XPUA 2WFWA 4Q5VA 1WVLA 1FL0A 4B3RQ 1EIFA 1MSGA 1UE1A 4A3EB 2LMCB 4MTKA 3W3AA 3HOZH 1TIID 3CKIB 3IRBA 1A62A 5JJLA 1TS2A 4WJWA 1N33L 5JVH3 2RSNA 1GVPA 2K52A 4ZK9B 3PO3H 5G3LD 2JA7B 2EZVA 3ND8A 3QIAA 2Y0SG 5ELOA 3GTQB 2GVAA 1AZPA 3BYTB 2F0GA 3G48A 1LTTD 4PG3A 4GKJL 2R6GA 5I2YA 5EPKA 2F0IA 2IX1A 3A74A 3D6WA 1EY9A 3RLFA 1STYA 4DK0A 2JE6I 2F0MA 3P7JA 4YIJA 4KJOA 5CBAE 4XQJA 3K7UC 4LAAA 2NTTA 1G2TA 1VF5C 4MZ9A 1TWHH 4DUYQ 1H9KA 1EIYB 4S3SA 3CMEA 4Y52H 3SEBA 3S1NB 3I4NH 2B2TA 4PZ7A 5C3XA 2F0TA 5JJKA 3J7A5 1L2FA 4B08A 1D1KA 4JI8L 2CQAA 3KUPA 1A2TA 2Q2UA 1KD1C 2D9UA 5EBCA 4CKCA 1W2BA 4TRDA 1ESRA 5GAHC 1PZKD 2K7VA 1S3OA 1EYAA 3HS0C 2L4NA 2G5DA 2OF1A 4UY8C 2EYFA 3DWPA 1CKOA 4TKOB 3H15A 4LF6Q 5IT9L 4DV0L 4IZ8A 2LFNA 1U0LA 3NENA 3P1HA 5AJ3L 1PHJA 5CORA 4ZKBB 4R4OA 1Q8KA 4NP5A 1SNCA 2RHQB 3KF8B 1RTOA 2CFMA 2PQEA 3C2PA 5EAYA 5K5PA 3D4RA 3NBHB 4C56C 4GNXA 1HXYD 4DV6L 4DR2L 2A6HC 4BBRG 5DM73 1LACA 3W5OA 1HNZL 1MJCA 3ULLA 1KDCA 1BVSA 3UDXA 1HZBA 3S2DH 3FHWA 4K6DA 3RUZA 5IYBH 3CCRA 2IJ0A 3M7GA 2B3GA 4A93B 3CPWA 1VMPA 1Z6HA 5AFWA 2V4DA 2F3IA 3HOUB 2F0VA 5C0XI 4C3JH 4X64Q 2D2CC 1QG7A 4B9XA 4DR1Q 1YHAA 2JA6G 4BBSH 4WJ3M 3K7AH 2B2VA 4Y7NB 5C3EH 2VUMG 3K5NA 4FF2A 1G6ZA 3H6MA 2IY5B 1HQMC 1KNEA 4KHPQ 2NBFA 4KTAA 3GV3A 1SJED 4RA8A 1HCZA 2B2YA 2L1BA 4LFCL 4IOCA 2PNRC 2JA5H 2XSCA 3RN5A 3OTOQ 4DV4Q 3KF6A 1YEZA 3NWSA 1HUMA 4HTHA 5IODA 3NELA 2PZTA 4LW1A 1D5ZC 1XTDA 3BYYB 4L8JA 5LMUL 2XRQD 4AIMA 3I91A 2X6LA 4X65L 1K8GA 1CA6A 1WCMH 1EIGA 3H3VI 2F0WA 4PZ8A 1EY4A 2WB1B 1PH3A 2F0UA 3ULPA 5DM63 3MWYW 3HGBA 4GLVB 4C3IB 5FK9C 2OQKA 1J5EL 4FYDA 4LF9Q 2F3WA 4XDXA 4ZCKA 1IL2A 2O5IC 2N78A 3DEPA 1CSQA 4A3JB 2JA7G 1PA6A 1IBLQ 1EY6A 4JI0Q 5C4XB 1CHQD 4OXPA 5FO9B 1WYDA 3VR4A 1S4ZA 3J7YW 4PMBA 1BO0A 1VCIA 1IBMQ 3GDEA 2QEXA 2K5WA 3BDLA 1BCPB 5CV5A 3RZOH 1FR3A 5IGEA 1YIJA 2B2WA 1SNMA 1V43A 4R9WA 4LUZA 2NN6G 4DK6C 4JI2Q 1K8AC 2K5DA 4X3UA 1HZAA 5IOCA 2ZJPA 4KJNA 1H9MA 1I4HA 2QDLA 3D0FA 4DV2Q 1QUQB 1OO9B 1KLGD 4TSSA 1XMOQ 1TWHB 1FVIA 1S5BD 2A69C 2LS01 2KECA 4A3LG 1A0IA 2YU9H 3I4NB 1LTLA 4B3SL 2UXBQ 3BZKA 1JOOA 2RSOA 2Q8IB 4AYBG 4DR3L 1Q86C 2DJGC 1TKWB 2KUMA 5ISRA 1YHBA 4IUUA 2NVXH 5FOBB 1JORA 5HY6A 1H9SB 5A35A 2A73B 1XX8A 3JC66 1LTID 4YCUA 3GTLH 3J80c 3M7NA 2L55A 3QG1A 3KK7A 5A2QL 3P20A 2B2UA 4NXML 2FMMA 1CKNB 4PNYA 3A55A 4DN4M 3MHBA 1PTOD 5L37A 2L5TA 4DR7Q 1F2LA 1DZ1A 2RBMA 1SE8A 4EQ5A 1VQ8A 1JWSD 2ASBA 3I90A 3CU7A 4ID6A 4LFAL 1PZJD 4HMIA 1NBWA 3K5MA 1HRJA 1I4QA 3BZCA 1BXTA 2SNSA 3HKZG 1YNND 3NTKA 2AHOB 1E2ZA 4Z9CB 5D14A 2K50A 1YITA 4IUVA 3CCQA 3CCSA 5I6WA 1XYIA 3M3YH 3EQLC 3HOUG 4UDUC 1TWCH 4QF4A 2VB3X 1D1IA 4XQQA 5ELNA 1PYSB 5ELBA 4JOIA 4IUQA 1TT2A 5D3IB 1N36L 2PMZE 4LF7L 4X62Q 4OWTB 1EOVA 2Y0SE 2FHTA 1AP0A 5EBDA 1UEBA 2K33A 1PH9A 4NPSA 4BBSB 2F0OA 1ILQA 1K28A 2XVSA 3K7AB 3MXPA 4IFDJ 5C3EB 3VYUA 2F3VA 1PH7A 1CI3M 3GTPH 1K3RA 2XGTA 1C7YA 5M5YB 1X65A 4KY6A 1JB7A 3E5SA 4BBRH 3OWFA 2RCFA 4X66L 1SEBD 2BOSA 4KN7C 3S14B 2JA5B 1A6XA 3KJOA 1KC8C 1YNXA 4OGQC 5GROA 2WB1G 2B29A 3OIQA 1HR0Q 1QZHA 4HAEA 2AQ3B 1UE6A 3VR6A 1SE3A 2NTSA 1SDFA 4K5VA 1KDAA 2OQ0A 1O80A 1X3PA 5GQOA 1SFOH 3IFDA 4DPGA 1VF7A 2PZWA 4IFDI 1KRSA 4LWCA 3NBIA 3NXWA 1K9MC 2VZAA 4KLKA 5IGDA 1WD0A 2JA6H 2F52A 4K5WA 1JOKA 2VUMH 1J8IA 2ZJRA 4A3MG 5C4XG 3WOEA 5BN3A 4JI7L 4LNQA 1YJ9A 3J81j 4JI6L 2UUBQ 2B63H 2NVTH 3A0JA 5J3BA 3K57A 2PQAB 4RHSA 1PRTB 4F8MA 2AWOA 4RCNA 1N9WA 1WJJA 1K8MA 2F1MA 4DAYA 1VQNA 3J80L 2NVYB 2ICEC 2JJQA 4H02A 3CRKC 2N8NA 4HMJA 4HJ9A 1EY8A 1Q46A 1PH1A 1SMYD 1CUKA 1K83H 1PFNA 4HCEA 2AQ2B 4LFBL 3UDIA 3EROA 3G6EA 3RZOB 4NXNL 3UE1A 5K36G 4F7XA 2UXCL 1SNPA 4BA2I 1J9OA 2SOBA 2HIVA 1CA5A 2R3ZA 1VQ5A 2GVBA 4JYAQ 2F4VQ 1TWGB 2JP1A 5M3FG 1XMQQ 2C5CA 1GM5A 3W1BA 4CKEA 4R4TA 3NSWA 2KQ3A 3MXNB 3CXCA 3M85A 2L9HA 5JPMC 3F8TA 3GTJB 4KI0A 1C8CA 1LT4D 4A3FG 3FMCA 2JA7H 2EY5A 1XNRQ 4IUNA 2F0SA 3TP7A 2ATWA 3VA5A 1TS3A 1MIUA 2Q2HA 3BJUA 2VB2X 2KEEA 2EYHA 1F2YA 5CR3A 1WI5A 2DNEA 4DGZA 2NVXB 1YJWA 2JA8B 2ZXPA 2K14A 1KNAA 2ZXOA 3DEOA 5HURA 4YWLA 1B3QA 1HFNA 1VMCA 4GKKL 4JVZA 1WFQA 3T1YQ 2NN6H 1SR3A 4IPHA 1O7LA 3IKJA 4DKAC 1CHPD 2R7ZB 1RL2A 1BQQT 4APVA 2FXQA 3OPOA 3S1NH 1B9MA 4DV3L 1V8QA 4QY7A 5M5WH 2WAQB 3GO5A 1RF2D 1F9PA 2MJ8A 4NDXA 3E6ZX 2HHHQ 5KEEA 4RAUC 4A3LH 1HZCA 1PTOC 5COYA 1Y14B 3N6RA 1TS4A 2E5LL 3A56A 1TWCB 2A6HD 2YYZA 5ELCA 2PO4A 4G7ZC 1XPRA 3D3RA 3DWAA 1N34Q 1JWUD 1YNNC 4UP9A 1PFSA 4GOPB 1B7YB 4POGA 4B3TQ 1Y8PB 2IW3A 2E2HH 1NY4A 2VQEL 1H9RA 1DOLA 3I8ZA 4CKBA 3PUXA 3GTPB 3K5LA 2RQXA 3UI2A 2BH2A 1KLUD 2O2LD 1SRUA 4A3DG 2D5DA 3TP8A 1F9RA 2H4OA 1I6HH 1B53A 2MGSA 4IOAA 5KNCA 2R92G 4KV6A 4BBRB 2D0PA 2DY8A 3T4AC 1DD2A 1GKHA 3CC2A 3RLNA 3HOUH 4QL5A 2F0LA 1RCVD 1G91A 4LUVA 4YWMA 5ELDA 2EVBA 4AYBE 2KBNA 3S17H 1R4QB 2UUCL 1SBBB 2N49A 3FRPB 1ENCA 4EVOA 3A8IE 1SFOB 3TRZA 5IWAQ 5CYUA 1I94L 4KN4C 5EPLA 4J8QA 2JA6B 1DOKA 1ENAA 4JI1Q 4ZQ3A 1N33Q 2VUMB 1JE4A 4J15A 5CMDA 1S5FD 3BU2A 3S24A 3V05A 4QJFA 3QOJA 3C1FA 2TSSA 3MEHA 3S15B 2CCZA 3SXHA 4N8FA 2R7DA 3GP7A 1HNWQ 1BR9A 3EJIA 1ML0D 4B3MQ 3H94A 3GTGH 3AFPA 4GZYC 3MAQA 4JG2A 2JSOA 4LF4Q 3O13A 2R93B 4WFN3 3KF8A 3A8JE 1Q1EA 3DMUA 1YI2A 1BOSA 4MIUA 2AMCB 5I9PA 2UXDL 1D5XC 5IYCG 4WORA 1L1OB 1GUTA 3NBHA 3E9HA 2L11A 3T1HQ 3NK9A 4O1NA 5KRUA 3FEWX 2UU9Q 1SMYC 1PLFA 4DR5L 2KHJA 1WTQA 5LL6X 1D6EC 5C4XH 2I5MX 1AEXA 1PZID 4KKUA 1KQSA 3PUZA 4C1NK 1Q3LA 1OXSC 3PMFA 2CVRA 2JA8G 4PMCA 1BCPC 1WTXA 1UUPA 3S16H 2IWHA 1ZYRD 1RTNA 3N52A 4DV0Q 1GO3E 5LMNQ 1R9TB 3DM1A 2B2VC 2A69D 2R7ZG 4JI4L 1HNXQ 1IXRA 2X69A 3U9OA 4CDEC 2WB1E 4ZUIA 4GN3B 2AKWB 3A8KE 5I9OA 3KFUA 5K36H 2WAQG 2EJGC 1G291 4JBMA 1SNDA 1EU3A 5M9OA 4FF4A 1XNQQ 3ERQA 3FVQA 2B2YC 5M5XB 1B4OA 3GTOB 2NZOA 1IHZA 1FJGQ 4JV5Q 4OO1G 1IBKL 2LSSA 3DLLA 2ZTEA 4DUZL 3AFQA 5M3FH 3VR5A 2CH4W 3DXJC 4UAIA 2PW5A 1SNQA 5T1GA 5M5WB 3SVMA 2OCEA 3VR2A 4K0KL 4GN5A 1CK1A 2BDNA 2QDBA 5IGBA 3S2HB 4A3FH 4FVMA 5IGGA 4YY3L 4CDFC 2K05A 1FNWA 1UNSA 4XYQA 4U673 1BDOA 3M4OH 4BWGB 4ZYSA 1I4RA 4R4IA 4AYBB 2IPKD 3JAMc 3DHQA 5KYLA 1VQEA 2VQFQ 3OW2A 3SR1A 4B3RL 1U4LA 2K32A 5EKLA 1QE6A 5EPJA 3VR3A 2ZXRA 2E2HB 5C0XG 3Q23A 1J6QA 2E8GA 1D5MC 2H1EA 3PO2B 5IYDH 3NEMA 2C35B 2EPBA 3EBEA 1SYFA 5E1FA 1IW7C 4LF8Q 3U4ZA 1GHJA 1V9PA 5IT9E 3PUVA 1Q12A 4K8IA 4N9TA 1D8LA 5EGTA 2XRSD 3W1GA 4RHRA 3B6YA 1I6HB 3HFZB 3A5ZB 3HKZB 1SYGA 3M9BA 2B2WC 3D4WA 4LF5Q 4I7AA 1II3A 5IIFA 1G8ZD 5CV8A 5ELEA 1N8RC 1WTHA 2Z8LA 1LUZA 5CGKA 2F03A 2VXWA 3PIPA 1U9RA 1KDBA 3FPPA 1J5EQ 2YV5A 3L7ZC 3SHLA 3VYTA 3S17B 4DUYL 3BS1A 3L9AX 1OXXK 1ICWA 4PMWA 5M5YH 4KKSA 1B70B 4DU9A 1X32A 2K5QA 5C4HA 2MO0A 4IPCA 1X3EA 1QUQA 1KXLA 4HR7B 5LHY1 1KIXA 2QCPX 3KDFB 1VQ9A 1I3QH 4EQOA 2PYKA 3CCVA 3S14H 1TVXA 4KD4A 2ZJQA 2OT2A 5BR8Q 3AQQA 4IALA 3NHHA 1CZGA 1EY5A 1HFGA 2RCNA 4AH6A 2A8VA 4LF6L 4A3DH 1XXGA 4JC0A 3IAYA 2ZTCA 3OWEB 3QR8A 1H9SA 4DA2A 2ZTDA 5F2DA 2R92H 2R93G 1YHQA 1PFMA 4XT3B 1B44D 2B2UC 2WP8J 4AQYQ 4EQPA 3GTGB 1IYVA 1WTRA 5JEAG 3HZXA 1CKNA 2MNAA 3LWUA 2MPMA 4DV1Q 4FP5D 1V1PB 2EYOA 4IPDA 2D0OA 4HJ8A 1L0YB 2K6AA 5E3FA 2AWNA 1PRTC 2UUAQ 1LTRD 4WJ4A 4CJ2C 1EWIA 1YZ6A 2WKDA 3NP8A 5BN5A 3HOXG 4A3MB 3BZDB 1LTBD 2NVYH 3FP9A 4DR4Q 1NSNS 1W6KA 1Z7TA 4R8IA 4JI3L 4JOIC 4OHJA 3R93A 3JAML 4DR1L 3K81C 4C3HB 4QMGA 3NWTA 2ZT9C 4BS9A 3S16B 1KTKA 4PQXA 1NJIC 1DGSA 3OMCA 1MBYA 3EIVA 2JQOA 1PXUA 2F0EA 3QOLA 3R2IA 4XTCS 1QILA 3MEFA 5FJ8G 1TWAB 4ALPA 2XN9C 4ZRZA 2CHBD 3KLSX 3K0YA 4RFBA 1QNKA 1TWGH 3PCOB 1QWYA 1ZYRC 2E2IH 1ZEQX 3CD6A 5IYCH 3OTOL 4DV4L 1ICFB 2F0PA 2LKVA 3GTJH 4ABNA 3PF5A 3HOYG 3TREA 2VNUD 1SROA 4RKLA 1RKNA 5M3FB 2F0FA 5CV7A 2XWJB 2JXMB 3TN2A 5I2XA 3S1QH 1EEFD 5JJIA 2WINB 1N32Q 1YNJC 5HGTA 3GD7A 1FYCA 2R7FA 2JA8H 3CAMA 1JJCB 4A3FB 2E2JB 2F0NA 4A3IG 3UDFA 2BCOA 4LMQD 3M4OB 2LXJA 3L0OA 3ITPA 4LF9L 1MI2A 3ER0A 2IX0A 3PO2G 2AUJD 2R7ZH 1PMRA 3K6OA 1QCBD 2L12A 2NN6I 4KMUC 2A5HA 2PI2E 4V190 1X3GA 2RA4A 5IY0A 4JI0L 3D4DA 5M3MB 1SYCA 2IL8A 4XT1B 1IBML 4L5SA 3AEVA 2PQAA 3T51B 2OTLA 3HP3A 5KNDA 3CC4A 4OO1H 4MN3A 5A2QE 1BBXC 3D6CA 4UHVA 3T56B 5C4ZA 2EYJA 2EXDA 3CMAA 2HCCA 1MKHA 2PW7A 1SJHD 4JI2L 3QO2A 1WTPA 1VDZA 1E3PA 4ILWA 1STBA 1JE5A 1DJRD 4MHEA 4GS3A 3OIPA 1XMOL 4EQNA 3VYSA 1EWHA 1C4QA 3TS2A 1R4PB 2PI2A 1V1QA 2F0JA 2O4XA 3J81L 2A6ED 3QWNA 2VY3A 3PIOA 5E4XA 2PPBC 3MXNA 4PZ6A 5C5MA 2K5NA 1Q82C 2WAQE 4P75A 3J7AF 1EYGA 1EQVA 5EKKA 2XTIA 1DXMA 1C48A 3TZUA 1I3QB 2F0KA 3SK8A 3E3XA 2K03A 1PH2A 1DM0B 4A3DB 1M4VA 1VS0A 4HEDA 3H3VC 2KOLA 4NXNQ 1QB5D 2EIFA 4DR7L 1E22A 3A7LA 2HDMA 1ET9A 4DAMA 2R92B 1VQHA 1CSPA 3KBGA 4RGOS 1U4RA 4IN3A 1S72A 4YHHQ 4KKTA 4OL7A 2JEBI 1OXTA 4NB3A 4DNTB 1TS5A 1X55A 2ICIA 1L0XB 4DNIA 1NCVA 4DV5Q 1PH6A 3LGJA 2QKIC 1STNA 1NR4A 2DGYA 2VS1A 2XNAC 1LT6D 4DXGA 2RDGA 3MTSA 3BVMA 4C3HG 3S15H 1VQIA 4FDBA 1IKLA 3PUWA 3CHBD 4JBKA 1IYUA 1KRTA 3VDYA 4E6IA 3JAMi 1SE4A 1M90C 1K0SA 4X62L 2OTJA 4X3SA 2SEBD 3PIP3 2QGQA 2V1CC 1C9OA 1LLRD 2R93H 4IUTA 1TR5A 1BF4A 4GOPA 3SGIA 3Q8DA 1PH4A 3X3MA 1BCPD 1LO5D 1RDPD 4LK1C 1UWVA 1WOCA 3CCMA 2VL6A 2ES2A 1JR0D 1Z9FA 1XJVA 4YWKA 3J80E 3U4VA 4DAPA 2K5VA 5EKIA 1EYCA 1X56A 2E2IB 1JB3A 1NMGA 1MGSA 4EGVA 3BVGA 4P74A 1L0WA 1HR0L 3AMUA 1E2WA 3ND9A 5IP9G 1VQFA 1T9HA 2CH4A 1HUNA 3MVVA 3L3OC 3HOXH 1R9TH 5FLXc 5C6AA 3S1QB 4TVAB 2Z0SA 4K2LA 1NR2A 4X6AH 2JA9A 2Z4IA 1PFBA 5G3LF 3LNNA 3KOJA 5M3MG 1E24A 3CPFA 2BA0A 2JN4A 1B50A 1B8AA 4P2CB 5FJ8H 1ASYA 2UUBL 5M5XH 4DV7Q 2F0DA 1FGUA 5DNFA 3TP5A 4P71A 3I55A 3GTOH 2Q8TA 3I2ZA 5H1SE 2N55A 1Y1VG 3M4YA 2DN8A 4RG1A 4CGYB 2Z6KA 4IJLA 4CBVA 3S2HH 3HOYH 1EQQA 4LJZC 5JVG3 3E0JA 1VQGA 4KD3A 2UUCQ 2OWOA 1EFID 2K04A 1UE7A 2B8FA 1IZ6A 2M00A 4DR6Q 1NNXA 1IW7D 4OX9Q 3WOFA 2EY2A 2Z9HA 2K01A 2CWPA 4A3IH 2IT1A 3NQIA 2BH8A 2E74C 4KY7A 4Q0FA 4RGTA 4RGMA 2F4VL 4CJ0B 4A3KG 1XMQL 3OYYA 1AE3A 5KNBA 2QA4A 1GJXA 3STBD 1D2BA 2DNCA 3PO2H 3PQIA 3K0XA 1L1OA 1Q8IA 4KK7A 2HQLA 3URYA 3I4OA 4JK1C 1PTOH 4JI5Q 1JT8A 1A3TA 4IUPA 1XNRL 4ODGA 1UAPA 3TQYA 4HSPA 1DCZA 2PCFB 1WTVA 5T1IA 1ONLA 4HCSA 2NVQB 3WWVA 1QJOA 1X9NA 1HA5A 3LX0A 1JQYD 3HG9A 1TU2B 1S40A 3CC7A 5JPNC 1EOTA 1C0AA 3D8GA 3RLOA 1IL8A 2A6EC 1YJNA 3D31A 2J4XA 2M9VA 2I5LX 1VQ6A 3A5UA 2BDOA 4FO2A 2E75C 2EOTA 3BVZA 1AW7A 1I4GA 3P75A 1TY2A 1E2VA 3T16A 1STGA 1NE3A 4WRDA 3ERSX 1VQ4A 4R8NA 2HHHL 2MP1A 4DAVA 1A15A 3PUYA 1B2TA 3MXGA 2PNHA 4ZUJA 3RZDH 1LTSD 1Y1WB 3EFXD 1JWMD 1F2ZA 5FLXL 2ZM6L 1UEAB 4QUCA 3W2DA 1D7QA 3J80i 1GOZA 2KHSA 2EYLA 3FDTA 3KYHC 1QOHA 2KENA 3ZJYC 1N34L 1RIPA 3HKZE 3OHXC 5C44G 4GKJQ 1WD1A 2BE5C 2HIXA 4B3TL 1PRTD 4JI4Q 4QGUA
chains in the Genus database with same CATH topology
1FD7D 3NE5B 2Z4HA 2E2DC 5C3WA 1CM9A 1EEID 2RVLA 2EE1A 1GUWA 2SDFA 4N9PA 1Q90A 4G7OC 3PIO3 4PV1C 3QB3A 4FXKC 3MA2B 3R8BA 3MZ5A 5CV9A 4DXFA 1M8AA 2J0TD 1B3AA 1FNUA 4K2KA 2I46A 1HQRD 1OXUA 4X3TA 3NQTA 4I65A 4M1UB 5I4DA 1GUOA 1EWCA 3HOXB 2QILA 2B39A 4DFAA 5CV4A 3SE0A 3I4MB 4DK1A 4K14A 1YNJD 4DNRB 3HRZC 3IFTA 2N88A 2O5JC 1F2MA 3EVQA 4I7ZC 4H13C 1ILPA 4RCOA 2A74C 4CJ1B 3MC0B 4RWSC 3HOYB 2AUKA 3BG3A 4BA1I 2M2LA 5EQ0A 3HOWB 3R2TA 1I50B 2Z1CA 2EY6A 1LTAD 1XWEA 2A68C 3G6JB 4L6TB 1ZKOA 4ZAIA 1PDQA 4A3IB 1PYWD 3I4LA 3C1EA 1KABA 1V1PA 4K5XA 3EA6A 4G4KA 2JEAI 1PTOB 4TQUS 1EZ6A 1PTOF 5C0XJ 1H9JA 4BY7B 3TDQA 3Q24A 4OO1I 3I70A 2FMCA 3OMGA 3MFGA 5KYIA 2C9OA 1BUVT 4JBWA 1E0BA 3NUCA 2QEJC 1EY0A 3HOVB 1RODA 2RDHA 2SNMA 1STEA 3ZYYX 1MD2D 1I4XA 1AN8A 4G57A 3TP6A 2IX3A 3RZDB 2B8GA 1S5DD 3GQBA 1TWFB 2HUGA 3DWQA 4C1NI 1JC7A 1HA6A 1O7YA 4RKBA 1Q1BA 1JCKB 3S1RB 2XWBB 4NMZA 1NUCA 4H0LC 3KLRA 3GTMB 4KHVA 5ELFA 4ZKCB 5JEAJ 4FNFA 4ZLTF 1ET6A 5D65A 2NYZD 5I6YA 1F77A 2TMPA 5FO8B 5KIXA 1T5XD 2WACA 1HHVA 4RH6A 2EXZA 4M8AA 4FXDA 1GUGA 3HOZB 2R61A 2NUCA 5LL6S 3SDZA 4K6LA 3PO3B 3JAME 1GUSA 2EJMA 1CQFA 3CQZB 1BCPF 3K59A 4J1MA 5FO7B 2NB0A 1DYQA 1Y8OB 2FJ2A 5J39A 3I73A 1SE2A 1SYEA 3J7AV 5C5LA 2Q8RE 4V0BA 1HTLD 1S5ED 2LY7A 2NZ1D 1SYDA 3SK6A 3MFYA 1X3QA 1STAA 4OIKA 4NW2A 5IGFA 3OW7A 3QJYA 1O7ZA 2GA4B 3NTIA 3LWEA 3GV6A 4RGNA 5BN4A 1NAPA 2WKCA 1JICA 1RJTA 1CFMA 3Q22A 1Y1VB 3BDOA 5EJWA 2D62A 4F88A 3F2UA 4KHZA 1G2SA 1S5CD 3MXUA 2MHVA 4IQZA 3OSOA 2F4IA 2MUYA 4C2MB 3C46A 2FFKB 1I4PA 2KVMA 1AZQA 4ULLA 2X6GA 4G7HC 1T5EA 4A3KB 5E4WC 3S2DB 1GHKA 5C0XH 4IFDG 1CZWA 1SAPA 3V2TA 2KEDA 3RMHA 4KY5A 1U4PA 3NTHA 4C3JB 3KLSA 3BDCA 4ME5A 2ENBA 5KGUA 2WV6D 1WTWA 4XYOA 4J6HA 3J81E 2EDGA 2KCCA 4B9WA 2G9HD 1B9NA 2PZUA 1SSOA 2RDFA 1B1ZA 3Q6SA 2BE5D 2K1BA 3KBXA 1RD9D 3A7AB 2HQEA 4HN7A 1LT5D 2CW0D 2BA1A 2ID0A 4C3IG 4OIJA 3RD4A 2NWGA 1U4MA 1WCMB 3H91A 1JOQA 3CRLC 1O78A 4FF3A 4XIGS 5CV6A 3PV0A 2AQ1B 5C44B 5FKAC 3WDNA 1FNVA 5J22A 1PRTF 4QCLA 1V1OA 5JEAH 1A3VA 3I72A 4XQNA 1WTOA 1EYDA 1STHA 3G7LA 1EU4A 1SXTA 5D3DA 3DUZA 1EY7A 4CHTB 4U68A 1ENFA 4O42A 4K8JA 1Y8NB 4A3GB 1A3UA 2E76C 1EIHA 2DY7A 1FGBD 2J7ZA 3I3CA 5IGCA 3ONAB 3S1MB 3S9WA 1GXDC 3A54A 1MSHA 3Q0AA 3H09A 3T53B 1TQOA 4NKLA 3K58A 2L0CA 2YU9B 1GUNA 1RHPA 1XTCD 3TSSA 4QIWB 1HTPA 3IL8A 2F0QA 3OOCA 2A68D 4XXEA 1LT3D 2PMZB 1IKMA 2EY1A 3AB9A 5CBEE 2Y0SB 3VA7A 3GTLB 5DAUA 5JAVA 2OEOA 3H0GB 1EL0A 1DOMA 1CTMA 3VYRA 1DONA 3HEJA 5J1ZA 2G9DA 1Y69U 1KAAA 2RKSA 1F9SA 4HSVA 3K5OA 3FPUB 1LTGD 3FKIB 3TMEA 5DEHA 1BNZA 1F9QA 3SK5A 3V96A 2EYPA 2KCNA 3M3YB 2OXPA 4QUFA 1CQVA 4C3JG 4H44C 5TSSA 2XIWA 2EYMA 1QNUA 5C4JB 3AU7A 1I6VC 1SNOA 3U9SA 2JYOA 2KJXA 4BY1B 3TZDA 1LABA 1AFPA 2EJFC 1Z47A 2KA7A 3R3OA 1LV9A 3C3LA 2QF7A 1OXVA 5NUCA 4IFDH 4A3BB 1A2UA 4IURA 3TBIB 1K8OA 2I07B 3GTKB 1CT1D 4QB4A 5JJZA 2FINB 3SK4A 2B2TC 2CW0C 5JOBA 4DF7A 4FF1A 4X3KA 1EQTA 2K28A 2B63B 2NVTB 1HPCA 5FLXE 3X3NA 5CC4A 4FXGC 1ESFA 2HCIA 4F87A 1K83B 1W6JA 1SYBA 2WIIB 4L63B 1EZ8A 1ZXTA 2F0HA 4H7BA 2HDLA 1TY0A 3T13A 3NPPA 4Q5VA 1WVLA 1MSGA 4A3EB 2LMCB 3W3AA 1TIID 3CKIB 1TS2A 4WJWA 5JVH3 2RSNA 4ZK9B 5G3LD 2JA7B 2EZVA 3ND8A 3QIAA 3GTQB 1AZPA 3BYTB 2F0GA 1LTTD 2R6GA 5I2YA 5EPKA 2F0IA 2IX1A 3RLFA 3D6WA 1EY9A 4DK0A 1STYA 2JE6I 2F0MA 3P7JA 4YIJA 4KJOA 5CBAE 4XQJA 4LAAA 2NTTA 1G2TA 1VF5C 1H9KA 4S3SA 3SEBA 3S1NB 2B2TA 5C3XA 2F0TA 4B08A 1D1KA 2CQAA 3KUPA 1A2TA 2D9UA 5EBCA 4CKCA 4TRDA 1ESRA 1PZKD 2K7VA 1EYAA 3HS0C 2L4NA 2OF1A 2EYFA 3DWPA 4TKOB 5IT9L 4IZ8A 2LFNA 3P1HA 5CORA 4ZKBB 4NP5A 1SNCA 1RTOA 2PQEA 3C2PA 5K5PA 3D4RA 4C56C 1HXYD 2A6HC 5DM73 1LACA 1KDCA 4K6DA 3RUZA 2IJ0A 3M7GA 4A93B 1VMPA 1Z6HA 5AFWA 2V4DA 3HOUB 2F0VA 5C0XI 2D2CC 1QG7A 4B9XA 2B2VA 4Y7NB 3K5NA 4FF2A 1G6ZA 3H6MA 1HQMC 1KNEA 2NBFA 4KTAA 3GV3A 1SJED 4RA8A 1HCZA 2B2YA 2L1BA 2PNRC 2XSCA 3NWSA 1HUMA 4HTHA 5IODA 2PZTA 1D5ZC 3BYYB 4L8JA 2XRQD 3I91A 2X6LA 1CA6A 1EIGA 2F0WA 1EY4A 2WB1B 2F0UA 5DM63 3MWYW 3HGBA 4C3IB 5FK9C 4FYDA 2F3WA 4XDXA 2O5IC 3DEPA 4A3JB 1EY6A 5C4XB 1CHQD 5FO9B 3VR4A 1S4ZA 3J7YW 4PMBA 1BO0A 1VCIA 2K5WA 3BDLA 1BCPB 5CV5A 1FR3A 5IGEA 2B2WA 1SNMA 4R9WA 1V43A 2NN6G 2K5DA 4X3UA 5IOCA 4KJNA 1H9MA 1I4HA 1OO9B 1KLGD 4TSSA 1TWHB 1S5BD 2A69C 2LS01 2KECA 3I4NB 1JOOA 2RSOA 2Q8IB 1TKWB 2KUMA 5ISRA 4IUUA 1JORA 5FOBB 1H9SB 5A35A 2A73B 1XX8A 1LTID 3M7NA 2L55A 3QG1A 3KK7A 5A2QL 3P20A 2B2UA 2FMMA 4PNYA 3A55A 4DN4M 3MHBA 1PTOD 2L5TA 1F2LA 1DZ1A 2RBMA 1JWSD 3I90A 3CU7A 4ID6A 1PZJD 4HMIA 3K5MA 1HRJA 1I4QA 1BXTA 2SNSA 1YNND 3NTKA 1E2ZA 4Z9CB 5D14A 4IUVA 5I6WA 1XYIA 3EQLC 4UDUC 4QF4A 2VB3X 1D1IA 4XQQA 5ELBA 4IUQA 1TT2A 5D3IB 2FHTA 1AP0A 5EBDA 2K33A 4BBSB 2F0OA 1ILQA 2XVSA 3K7AB 3MXPA 4IFDJ 5C3EB 3VYUA 2F3VA 1CI3M 5M5YB 4KY6A 3E5SA 3OWFA 1SEBD 2BOSA 4KN7C 3S14B 2JA5B 1A6XA 4OGQC 3OIQA 4HAEA 2AQ3B 3VR6A 1SE3A 2NTSA 1SDFA 4K5VA 1KDAA 1O80A 1X3PA 3IFDA 1VF7A 2PZWA 4IFDI 3NBIA 3NXWA 5IGDA 1WD0A 4K5WA 1JOKA 1J8IA 3WOEA 5BN3A 3K57A 4RHSA 1PRTB 4F8MA 2AWOA 4RCNA 1K8MA 2F1MA 4DAYA 3J80L 2NVYB 2ICEC 3CRKC 4HMJA 1EY8A 1SMYD 1PFNA 4HCEA 2AQ2B 3EROA 3RZOB 5K36G 4F7XA 1SNPA 4BA2I 1J9OA 2SOBA 1CA5A 2R3ZA 1TWGB 2JP1A 2C5CA 4CKEA 3NSWA 2KQ3A 3M85A 2L9HA 5JPMC 3GTJB 4KI0A 1C8CA 1LT4D 3FMCA 2EY5A 4IUNA 2F0SA 3TP7A 3VA5A 1TS3A 2VB2X 5CR3A 2KEEA 2EYHA 1F2YA 4DGZA 2DNEA 2NVXB 2JA8B 2ZXPA 2ZXOA 1KNAA 3DEOA 5HURA 1HFNA 1VMCA 2NN6H 1O7LA 3IKJA 1CHPD 2R7ZB 1BQQT 3OPOA 1B9MA 1V8QA 2WAQB 3GO5A 1RF2D 1F9PA 2MJ8A 4NDXA 3E6ZX 5KEEA 4RAUC 1PTOC 5COYA 3N6RA 1TS4A 3A56A 1TWCB 2A6HD 2YYZA 5ELCA 2PO4A 4G7ZC 3D3RA 3DWAA 1JWUD 1YNNC 1Y8PB 2IW3A 1H9RA 1DOLA 3I8ZA 4CKBA 3PUXA 3GTPB 3K5LA 2RQXA 3UI2A 1KLUD 2O2LD 2D5DA 3TP8A 1F9RA 2H4OA 1B53A 2MGSA 5KNCA 4KV6A 4BBRB 2DY8A 3T4AC 1DD2A 2F0LA 1RCVD 1G91A 5ELDA 2EVBA 1R4QB 1SBBB 3FRPB 1ENCA 4EVOA 3A8IE 1SFOB 5CYUA 4KN4C 5EPLA 4J8QA 2JA6B 1DOKA 1ENAA 4ZQ3A 2VUMB 1JE4A 5CMDA 1S5FD 3V05A 3QOJA 3C1FA 2TSSA 3MEHA 3S15B 3SXHA 3GP7A 1BR9A 3EJIA 1ML0D 3H94A 4GZYC 3MAQA 2JSOA 3O13A 2R93B 4WFN3 3KF8A 3A8JE 1Q1EA 3DMUA 1BOSA 4MIUA 5I9PA 1D5XC 4WORA 1GUTA 3NBHA 2L11A 3NK9A 4O1NA 5KRUA 3FEWX 1SMYC 1PLFA 1WTQA 5LL6X 1D6EC 1AEXA 1PZID 4KKUA 3PUZA 4C1NK 1Q3LA 1OXSC 3PMFA 2CVRA 4PMCA 1BCPC 1WTXA 1UUPA 2IWHA 1ZYRD 1RTNA 3N52A 1R9TB 3DM1A 2B2VC 2A69D 3U9OA 2X69A 4ZUIA 3A8KE 5I9OA 5K36H 2EJGC 1G291 1SNDA 1EU3A 5M9OA 4FF4A 3ERQA 3FVQA 2B2YC 5M5XB 1B4OA 3GTOB 1IHZA 4OO1G 3VR5A 3DXJC 4UAIA 2PW5A 1SNQA 5T1GA 5M5WB 3SVMA 3VR2A 1CK1A 2BDNA 2QDBA 5IGBA 3S2HB 4FVMA 5IGGA 2K05A 1FNWA 1UNSA 4XYQA 4U673 1BDOA 4BWGB 4ZYSA 1I4RA 4AYBB 2IPKD 3DHQA 5KYLA 3SR1A 1U4LA 2K32A 5EKLA 1QE6A 5EPJA 3VR3A 2ZXRA 2E2HB 5C0XG 3Q23A 1D5MC 2H1EA 3PO2B 2EPBA 1SYFA 5E1FA 1IW7C 1GHJA 5IT9E 3PUVA 1Q12A 4K8IA 4N9TA 5EGTA 2XRSD 4RHRA 1I6HB 3HKZB 1SYGA 2B2WC 3D4WA 1II3A 5IIFA 1G8ZD 5CV8A 5ELEA 2Z8LA 5CGKA 2F03A 2VXWA 1U9RA 1KDBA 3FPPA 3L7ZC 3SHLA 3VYTA 3S17B 3BS1A 3L9AX 1OXXK 1ICWA 4PMWA 4KKSA 4DU9A 1X32A 2K5QA 5C4HA 4HR7B 5LHY1 2QCPX 4EQOA 2PYKA 1TVXA 4KD4A 2OT2A 4IALA 3NHHA 1CZGA 1EY5A 1HFGA 1XXGA 3IAYA 3OWEB 1H9SA 4DA2A 5F2DA 1PFMA 4XT3B 1B44D 2B2UC 2WP8J 4EQPA 3GTGB 1IYVA 1WTRA 5JEAG 3HZXA 3LWUA 2MPMA 4FP5D 1V1PB 2EYOA 1L0YB 2K6AA 5E3FA 2AWNA 1PRTC 1LTRD 4CJ2C 2WKDA 3NP8A 5BN5A 4A3MB 3BZDB 1LTBD 1NSNS 1W6KA 1Z7TA 4R8IA 3R93A 4OHJA 3JAML 4C3HB 4QMGA 3NWTA 2ZT9C 4BS9A 3S16B 1KTKA 4PQXA 3OMCA 1MBYA 1PXUA 2F0EA 3QOLA 3R2IA 4XTCS 1QILA 1TWAB 2XN9C 4ZRZA 2CHBD 3KLSX 3K0YA 4RFBA 1QNKA 1QWYA 1ZYRC 1ZEQX 2F0PA 2LKVA 4ABNA 2VNUD 4RKLA 1RKNA 5M3FB 2F0FA 5CV7A 2XWJB 2JXMB 3TN2A 5I2XA 1EEFD 2WINB 1YNJC 5HGTA 3GD7A 1FYCA 4A3FB 2E2JB 2F0NA 2BCOA 4LMQD 3M4OB 3ITPA 1MI2A 2IX0A 2AUJD 1PMRA 3K6OA 1QCBD 2L12A 2NN6I 4KMUC 2A5HA 4V190 2RA4A 3D4DA 5M3MB 1SYCA 2IL8A 4XT1B 3T51B 3HP3A 5KNDA 4OO1H 4MN3A 5A2QE 1BBXC 3D6CA 3T56B 5C4ZA 2EYJA 2HCCA 2PW7A 1SJHD 3QO2A 1WTPA 1VDZA 4ILWA 1STBA 1DJRD 4MHEA 3OIPA 4EQNA 3VYSA 1EWHA 1C4QA 1R4PB 2F0JA 2O4XA 3J81L 2A6ED 3QWNA 5E4XA 2PPBC 3MXNA 5C5MA 3J7AF 1EQVA 5EKKA 1DXMA 1C48A 3TZUA 1I3QB 2F0KA 3SK8A 2K03A 1DM0B 4A3DB 1M4VA 4HEDA 3H3VC 2KOLA 1QB5D 3A7LA 2HDMA 1ET9A 2R92B 3KBGA 4RGOS 1U4RA 4IN3A 4KKTA 4OL7A 2JEBI 1OXTA 4DNTB 1TS5A 2ICIA 1L0XB 1NCVA 2QKIC 1STNA 1NR4A 2XNAC 1LT6D 4DXGA 2RDGA 3MTSA 3BVMA 4C3HG 1IKLA 3PUWA 3CHBD 1IYUA 4E6IA 1SE4A 4X3SA 2SEBD 3PIP3 1LLRD 4IUTA 1TR5A 1BF4A 3X3MA 1BCPD 1LO5D 1RDPD 4LK1C 1JR0D 3J80E 4DAPA 5EKIA 1EYCA 2E2IB 1JB3A 1MGSA 4EGVA 3BVGA 3AMUA 1E2WA 3ND9A 1HUNA 3MVVA 3L3OC 5C6AA 3S1QB 4K2LA 1NR2A 2Z4IA 1PFBA 5G3LF 3LNNA 2BA0A 1B50A 4P2CB 2F0DA 5DNFA 3TP5A 2Q8TA 2N55A 3M4YA 2DN8A 4CGYB 4CBVA 4LJZC 5JVG3 3E0JA 4KD3A 1EFID 2K04A 2B8FA 2M00A 1IW7D 3WOFA 2EY2A 2K01A 2IT1A 3NQIA 4KY7A 2E74C 4Q0FA 4RGTA 4RGMA 4CJ0B 5KNBA 1GJXA 1D2BA 2DNCA 1Q8IA 4KK7A 3URYA 4JK1C 1PTOH 1A3TA 4IUPA 4ODGA 1UAPA 4HSPA 1DCZA 2PCFB 1WTVA 5T1IA 1ONLA 4HCSA 2NVQB 1QJOA 1HA5A 3LX0A 1JQYD 3HG9A 1TU2B 5JPNC 1EOTA 3D8GA 1IL8A 2A6EC 3D31A 2J4XA 2M9VA 2BDOA 4FO2A 2E75C 2EOTA 3BVZA 1AW7A 1I4GA 3P75A 1TY2A 1E2VA 3T16A 1STGA 4WRDA 4R8NA 2MP1A 4DAVA 1A15A 3PUYA 1B2TA 3MXGA 4ZUJA 1LTSD 1Y1WB 3EFXD 1JWMD 1F2ZA 5FLXL 1UEAB 4QUCA 3W2DA 1GOZA 2KHSA 2EYLA 3FDTA 1QOHA 3OHXC 1WD1A 2BE5C 1PRTD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N55 A;  4DN4 M;  1EIH A;  1U4R A;  5E4W C;  2DY7 A;  1HUM A;  1G2T A;  1F2L A;  2J7Z A;  3I3C A;  1DZ1 A;  1CM9 A;  1Q3L A;  2CVR A;  2RVL A;  1DOL A;  3I90 A;  3ONA B;  1WTX A;  1SAP A;  1LV9 A;  2EE1 A;  3TN2 A;  1HHV A;  1ICW A;  3I8Z A;  2KED A;  1RTN A;  1GUW A;  2SDF A;  3N52 A;  1MSH A;  1U4P A;  1HRJ A;  3I91 A;  1X32 A;  1PFN A;  1NCV A;  2X6L A;  1CA6 A;  1EIG A;  4IUR A;  2B2T A;  3DM1 A;  3UI2 A;  2B2V C;  2K04 A;  5D14 A;  1RHP A;  3KUP A;  1NR4 A;  4IUV A;  4LMQ D;  2D9U A;  1F9R A;  1B53 A;  2X69 A;  3MWY W;  1J9O A;  2MGS A;  1WTW A;  3IL8 A;  3MTS A;  5JJZ A;  1TVX A;  1MI2 A;  1XYI A;  1ESR A;  2K01 A;  2FIN B;  2R3Z A;  1CA5 A;  1M8A A;  1IKL A;  2B2T C;  1HFG A;  4CJ0 B;  1E0B A;  2DY8 A;  4XDX A;  2L4N A;  1B3A A;  1IKM A;  2L12 A;  2JP1 A;  3DEP A;  5CBE E;  4X3S A;  4IUQ A;  1ROD A;  2RA4 A;  1SSO A;  2B2Y C;  1G91 A;  4X3T A;  4X3K A;  1EQT A;  1B4O A;  1PFM A;  2FJ2 A;  2K28 A;  5COR A;  4XT3 B;  2B2U C;  4ZKB B;  1EL0 A;  1DOM A;  2L9H A;  3Q6S A;  2FHT A;  1AP0 A;  2K1B A;  1RTO A;  2IL8 A;  4IUP A;  4XT1 B;  1WTR A;  3KBX A;  1C8C A;  1DON A;  4UAI A;  5T1G A;  1WTV A;  1S4Z A;  1ILQ A;  3SVM A;  4IUT A;  2Q8R E;  1BO0 A;  3HP3 A;  1BF4 A;  4MN3 A;  5T1I A;  2MPM A;  4HCS A;  2BDN A;  1F9S A;  2HCI A;  4HSV A;  1BBX C;  2NZ1 D;  4OIJ A;  5EPL A;  2B2W A;  2KEE A;  2NWG A;  1DOK A;  2K05 A;  3FPU B;  4R9W A;  1U4M A;  2HCC A;  1JE4 A;  3H91 A;  1KNA A;  1BNZ A;  3DEO A;  5CMD A;  2N88 A;  3QO2 A;  1X3Q A;  1EOT A;  1WTP A;  1F9Q A;  5EKI A;  1IL8 A;  1VMC A;  1ILP A;  4CJ2 C;  1HFN A;  1ZXT A;  2HUG A;  4X3U A;  1MGS A;  4NW2 A;  4OIK A;  2HDL A;  4CJ1 B;  1O7Z A;  4MHE A;  4QUF A;  1HA6 A;  1U4L A;  1O7Y A;  2EOT A;  1WVL A;  1QE6 A;  3GV6 A;  3LWE A;  5EPJ A;  1MSG A;  4R8I A;  1ML0 D;  2XIW A;  3R93 A;  1HUN A;  1VMP A;  4HAE A;  5AFW A;  2H1E A;  1NAP A;  4RWS C;  1JIC A;  1RJT A;  2EPB A;  1QG7 A;  2KEC A;  5EJW A;  1SDF A;  2RSN A;  2B2V A;  1F9P A;  2MJ8 A;  1NR2 A;  4ZK9 B;  1O80 A;  1X3P A;  2M2L A;  3F2U A;  5EQ0 A;  4ZKC B;  2MP1 A;  3IFD A;  1PFB A;  5E4X A;  1A15 A;  1G6Z A;  2RSO A;  1B2T A;  1G2S A;  1KNE A;  1WD0 A;  2JYO A;  2KUM A;  1AZP A;  4RAU C;  4IUU A;  1WTO A;  4ZLT F;  5COY A;  1J8I A;  5D65 A;  1QNK A;  3G7L A;  4QUC A;  1XX8 A;  1B50 A;  2B2W C;  2NYZ D;  3GV3 A;  4ZAI A;  1PDQ A;  2FFK B;  2K03 A;  2L11 A;  2KVM A;  4RA8 A;  3FDT A;  3TZD A;  1AZQ A;  4U68 A;  5EPK A;  4HED A;  4O42 A;  2X6G A;  2B2Y A;  2KOL A;  2L1B A;  5DNF A;  2Q8T A;  3D6W A;  1WD1 A;  1PLF A;  3P7J A;  1WTQ A;  2B2U A;  5CBA E;  2HDM A;  2FMM A;  2VXW A; 
#chains in the Genus database with same CATH topology
 1FD7 D;  2MFI A;  3NE5 B;  2Z4H A;  2K5H A;  2E2D C;  3S1R H;  5C3W A;  1CM9 A;  1EEI D;  2RVL A;  4LUO A;  2EE1 A;  1GUW A;  2SDF A;  4N9P A;  1Q90 A;  3GTM H;  4G7O C;  4QQB X;  3PIO 3;  4PV1 C;  3QB3 A;  2KHI A;  4FXK C;  4HIM A;  3MA2 B;  3R8B A;  3MZ5 A;  5CV9 A;  1G51 A;  1HZ9 A;  4L5Q A;  3CCJ A;  4JI8 Q;  1X54 A;  4A3G G;  4A3M H;  4DXF A;  1M8A A;  2J0T D;  1B3A A;  2H5X A;  1FNU A;  2K4K A;  1QVC A;  4K2K A;  2I46 A;  4POF A;  1VQC A;  1HQR D;  4C3H H;  1OXU A;  3F2B A;  4X3T A;  3NQT A;  4I65 A;  4M1U B;  4BXX G;  5I4D A;  1GUO A;  1EWC A;  3HOX B;  5AJ3 Q;  2QIL A;  2B39 A;  4DFA A;  3PSI A;  5CV4 A;  4HJ5 A;  3SE0 A;  1TWA H;  3I4M B;  5IWA L;  4DK1 A;  1BKB A;  2RHS B;  4K14 A;  4JI1 L;  1E1T A;  1YNJ D;  4DNR B;  4DV6 Q;  4DR2 Q;  3HRZ C;  2HT1 A;  3IFT A;  2N88 A;  2O5J C;  1F2M A;  3EVQ A;  4I7Z C;  4R4C A;  2I0Q A;  3CQZ H;  4H13 C;  1HNZ Q;  1ILP A;  4RCO A;  3H0G G;  2A74 C;  1HNW L;  1VQJ A;  4CJ1 B;  3KDF A;  2CQO A;  2Z6B A;  4B3M L;  4JW0 A;  1X6O A;  3MC0 B;  1ASZ A;  4IPG A;  4RWS C;  2JK8 A;  3HOY B;  2E2J H;  4LF4 L;  3CCU A;  5IP9 H;  2AUK A;  3FKI G;  3BG3 A;  4BA1 I;  2M2L A;  5EQ0 A;  2VW9 A;  3HOW B;  3R2T A;  1I50 B;  2Z1C A;  2EY6 A;  1LTA D;  1XWE A;  2A68 C;  2YTY A;  3G6J B;  4L6T B;  3T1H L;  1ZKO A;  4ZAI A;  1P8L A;  1PDQ A;  4A3I B;  2UU9 L;  4MTN A;  1PYW D;  3I4L A;  4IJH A;  3C1E A;  1KAB A;  1V1P A;  5M3M H;  1IYJ B;  4LFC Q;  4K5X A;  3EA6 A;  4A3C G;  4G4K A;  2JEA I;  1PTO B;  4TQU S;  1EZ6 A;  1SN8 A;  1PTO F;  5C0X J;  1H9J A;  5LMN L;  1Y1V H;  4BY7 B;  3TDQ A;  4OWX B;  3Q24 A;  4OO1 I;  4BY1 G;  3STB C;  3I70 A;  5LMU Q;  4X65 Q;  2FMC A;  3OMG A;  1HNX L;  3MFG A;  5KYI A;  3EN2 A;  4C2M H;  2K75 A;  2C9O A;  1BUV T;  1G6P A;  4JBW A;  1HR0 W;  2NZH A;  3F2D A;  1E0B A;  3NUC A;  1XNQ L;  2QEJ C;  1EY0 A;  3CW2 C;  1Q81 C;  3HOV B;  1FJG L;  4JV5 L;  1ROD A;  2RDH A;  2SNM A;  4A3K H;  2GN5 A;  1Y1W G;  4UPA A;  1STE A;  3ZYY X;  4A3B G;  1MD2 D;  3E0E A;  1I4X A;  1AN8 A;  3RR5 A;  1VQM A;  4G57 A;  1VQO A;  4JI3 Q;  1XPO A;  3TP6 A;  2IX3 A;  3RZD B;  2B8G A;  2EQS A;  3KJP A;  1S5D D;  1MJE A;  1VQL A;  1OTC A;  3GQB A;  1VQD A;  1TWF B;  2VQF L;  2HUG A;  2YTV A;  3DWQ A;  2B63 G;  4C1N I;  4OON A;  1JC7 A;  1HA6 A;  1O7Y A;  2P5Z X;  1Q1B A;  4JBJ A;  4RKB A;  1JCK B;  4O2D A;  2KCM A;  3S1R B;  1H95 A;  2XWB B;  4NMZ A;  1NUC A;  2I5H A;  4LF8 L;  4N8X 1;  4O0A A;  4EX5 A;  4H0L C;  3KLR A;  3GTM B;  4KHV A;  5ELF A;  4ZKC B;  1I5F A;  3G71 A;  3F2C A;  5JEA J;  4B3S Q;  4FNF A;  3J7Z C;  4DR3 Q;  4ZLT F;  3J81 c;  4LF5 L;  1ET6 A;  5D65 A;  2NYZ D;  5I6Y A;  1F77 A;  1YBY A;  2TMP A;  1LYL A;  5FO8 B;  4A3E G;  1VQA A;  3I4M G;  4X64 L;  5KIX A;  1PH8 A;  4NXM Q;  3HKS A;  5C44 H;  4GNX B;  1VQP A;  1T5X D;  4OEL B;  2WAC A;  3RN2 A;  1HHV A;  3E9I A;  4KHP L;  4GLX A;  4RH6 A;  2EXZ A;  4M8A A;  3M4Q A;  4FXD A;  1GUG A;  4LFA Q;  3HOZ B;  2R61 A;  5DLQ E;  2NUC A;  5LL6 S;  3SDZ A;  5IP7 G;  4K6L A;  1PVO A;  4JYA L;  3PO3 B;  2IHE A;  5BR8 L;  3JAM E;  1GUS A;  2EJM A;  3KLW A;  1CQF A;  3CQZ B;  1BCP F;  4HIK A;  3K59 A;  5GAD C;  4J1M A;  4P73 A;  1A8V A;  5FO7 B;  2NB0 A;  1DYQ A;  4A3G H;  3HOW G;  4AQY L;  1Y8O B;  3U50 C;  4HIO A;  2DUD A;  2FJ2 A;  5J39 A;  3I73 A;  1SE2 A;  1SYE A;  1N36 Q;  3J7A V;  4LF7 Q;  3S1M H;  5C5L A;  4DV1 L;  2Q8R E;  4BXX H;  4V0B A;  1HTL D;  1EUJ A;  1S5E D;  2LY7 A;  4JCV E;  2NZ1 D;  1SYD A;  4OWW B;  2UUA L;  3SK6 A;  3MFY A;  1X3Q A;  1STA A;  3KF6 B;  5FLM G;  1IBL L;  4BY7 G;  4OIK A;  4NW2 A;  5IGF A;  1VQ7 A;  3OW7 A;  3QJY A;  4DR4 L;  1O7Z A;  2GA4 B;  3NTI A;  4X66 Q;  2KCT A;  3LWE A;  3GV6 A;  4RGN A;  5BN4 A;  3H0G H;  2MQH A;  1NAP A;  2WKC A;  1JIC A;  1RJT A;  1CFM A;  3Q22 A;  1Y1V B;  3BDO A;  5EJW A;  4DK3 C;  2D62 A;  4F88 A;  3F2U A;  4KHZ A;  2QW7 A;  1G2S A;  3HOV G;  1S5C D;  3MXU A;  4GLA C;  4R4Q A;  4GOP C;  2DJF C;  2MHV A;  4IQZ A;  4HJA A;  3OSO A;  3FKI H;  2F4I A;  4GN4 B;  2MUY A;  2RF4 A;  4C2M B;  3C46 A;  4HID A;  5HGQ A;  2FFK B;  4DV2 L;  1I4P A;  3ICE A;  2KVM A;  3CCE A;  1AZQ A;  4ULL A;  2X6G A;  1QVG A;  4A93 G;  2ALY B;  4G7H C;  4JI7 Q;  4JI6 Q;  2CKZ B;  4QIW E;  1T5E A;  4A3K B;  5E4W C;  3S2D B;  2UXB L;  1GHK A;  3ULJ A;  5C0X H;  1X3F A;  4IFD G;  1CZW A;  1N32 L;  2NVQ H;  1SAP A;  3V2T A;  5C4J H;  2KED A;  5E7N A;  3RMH A;  4KY5 A;  4A3C H;  1U4P A;  4IO9 A;  1JJG A;  3NTH A;  4C3J B;  1KHI A;  4CDD C;  3KLS A;  3BDC A;  2IHF A;  4ME5 A;  2ENB A;  5KGU A;  2WV6 D;  4UP8 A;  4LFB Q;  1K3B C;  1WTW A;  4BY1 H;  4XYO A;  4J6H A;  3J81 E;  2UXC Q;  2EDG A;  2A1A A;  2KCC A;  4B9W A;  4L5R C;  2G9H D;  1B9N A;  2PZU A;  2L15 A;  1SSO A;  2RDF A;  2Q2I A;  1B1Z A;  3Q6S A;  2BE5 D;  2K1B A;  3F1Z A;  3KBX A;  1RD9 D;  5GAG C;  4HJ7 A;  3A7A B;  2HQE A;  4HN7 A;  2Z6K C;  1LT5 D;  2CW0 D;  2BA1 A;  2ID0 A;  1VQB A;  4OEM B;  1K0R A;  1Y1W H;  3H3V H;  4A3B H;  4C3I G;  4OIJ A;  3RD4 A;  1QZG A;  2NWG A;  1U4M A;  3GTK H;  1WCM B;  3H91 A;  1JOQ A;  3CRL C;  4A3J G;  1O78 A;  4JPB W;  1Q7Y C;  1PV4 A;  4FF3 A;  3HOZ G;  4XIG S;  4GKK Q;  1K73 C;  5CV6 A;  5LMN W;  3PV0 A;  2AQ1 B;  5C44 B;  5FKA C;  3WDN A;  3PO3 G;  1L1O C;  1FNV A;  5J22 A;  1PRT F;  3I7F A;  4QCL A;  1V1O A;  3K80 C;  5JEA H;  1A3V A;  4DV3 Q;  1O7I A;  3TS0 A;  1AH9 A;  3I72 A;  1A63 A;  4XQN A;  1WTO A;  1EYD A;  1STH A;  3G7L A;  1EU4 A;  1SXT A;  5D3D A;  3DUZ A;  1EY7 A;  4CHT B;  4U68 A;  2E5L Q;  1ENF A;  4O42 A;  4K8J A;  3RNU A;  1Y8N B;  4A3G B;  1A3U A;  2E76 C;  1EIH A;  2DY7 A;  4A3E H;  1FGB D;  2J7Z A;  3I3C A;  4YHH L;  3I4M H;  3I4N G;  5IGC A;  3I56 A;  3ONA B;  3S1M B;  3S9W A;  1GXD C;  3A54 A;  2VQE Q;  4DV5 L;  1MSH A;  3Q0A A;  3CCL A;  3H09 A;  3T53 B;  1QVF A;  2A19 A;  1TQO A;  1PH5 A;  4NKL A;  3K58 A;  1KAW A;  3L2P A;  2L0C A;  4YCV A;  2YU9 B;  1GUN A;  1RHP A;  3GTQ H;  1XTC D;  3TSS A;  4QIW B;  1HTP A;  3IL8 A;  2F0Q A;  4A76 A;  1YVC A;  5IP7 H;  3OOC A;  2A68 D;  4XXE A;  1LT3 D;  2PMZ B;  1IKM A;  2EY1 A;  3AB9 A;  5CBE E;  2Y0S B;  3VA7 A;  3GTL B;  5DAU A;  4YCW A;  5JAV A;  4UP7 A;  3PF4 A;  2OEO A;  3H0G B;  1EL0 A;  1DOM A;  1CTM A;  5IYD G;  3VYR A;  1VQK A;  3HOW H;  3HEJ A;  5J1Z A;  1DON A;  2G9D A;  1Y69 U;  1I50 H;  3DM3 A;  1TXY A;  1KAA A;  2RKS A;  2CWA A;  2MO1 A;  1F9S A;  1PYB A;  4HSV A;  3K5O A;  3FPU B;  3G4S A;  1LTG D;  3FKI B;  3TME A;  1I94 Q;  1E7Z A;  5DEH A;  1BNZ A;  5IYB G;  5IE8 A;  1SLJ A;  2Q2T A;  1F9Q A;  3SK5 A;  3J81 i;  1NMF A;  1E1O A;  3V96 A;  2EYP A;  4DAY B;  2KCN A;  1EQR A;  3M3Y B;  2OXP A;  4RMF A;  4QUF A;  1CKM A;  1CQV A;  4C3J G;  5FLM H;  2ZM6 Q;  4H44 C;  5TSS A;  4BBS G;  3U58 A;  4BY7 H;  2XIW A;  5C3E G;  2EYM A;  1JJ2 A;  1QNU A;  5C4J B;  3UE0 A;  3AU7 A;  1I6V C;  3CF5 A;  3PGZ A;  1BBW A;  1SNO A;  4R1J A;  3U9S A;  4P72 A;  3T1Y L;  1EFW A;  2JYO A;  3K8A A;  3M4P A;  2KJX A;  4BY1 B;  2JA5 G;  4DV7 L;  2UXD Q;  3HOV H;  3TZD A;  1GD7 A;  1LAB A;  1W3S A;  1AFP A;  2EJF C;  4CDC C;  1Z47 A;  4MNO A;  2KA7 A;  4DR5 Q;  4A93 H;  5GAE C;  1WCM G;  3R3O A;  1LV9 A;  3C3L A;  2YTX A;  2QF7 A;  1OXV A;  4Y7N H;  1HJP A;  2HD3 A;  5NUC A;  4IFD H;  4A3B B;  1A2U A;  4IUR A;  3TBI B;  4DR6 L;  4OX9 L;  1K8O A;  2I07 B;  1TWF H;  5IT9 c;  3GTK B;  1CT1 D;  4ME3 A;  1NTG A;  3UDG A;  4QB4 A;  5JJZ A;  2LXK A;  1BBU A;  2FIN B;  3AYH B;  3SK4 A;  2B2T C;  1U5K A;  3TEH B;  2CW0 C;  1JMC A;  1MHW C;  5JOB A;  4DF7 A;  1KL9 A;  4JI5 L;  4FF1 A;  4A4I A;  4X3K A;  1EQT A;  2K28 A;  2B63 B;  1UE5 A;  2NVT B;  1HPC A;  5FLX E;  3X3N A;  5CC4 A;  1LM0 A;  1P16 A;  1IBK Q;  4FXG C;  4DUZ Q;  2N3S A;  1ESF A;  4K0K Q;  2HCI A;  3CP0 A;  4F87 A;  1K83 B;  1W6J A;  4YY3 Q;  4L5T A;  1SYB A;  2WII B;  4L63 B;  1EZ8 A;  4C3I H;  1M1K C;  1HH2 P;  4A75 A;  1ZXT A;  4GNX C;  1SMX A;  2F0H A;  4H7B A;  1AE2 A;  2HDL A;  1TY0 A;  3T13 A;  4A3J H;  3NPP A;  1XPU A;  2WFW A;  4Q5V A;  1WVL A;  1FL0 A;  4B3R Q;  1EIF A;  1MSG A;  1UE1 A;  4A3E B;  2LMC B;  4MTK A;  3W3A A;  3HOZ H;  1TII D;  3CKI B;  3IRB A;  1A62 A;  5JJL A;  1TS2 A;  4WJW A;  1N33 L;  5JVH 3;  2RSN A;  1GVP A;  2K52 A;  4ZK9 B;  3PO3 H;  5G3L D;  2JA7 B;  2EZV A;  3ND8 A;  3QIA A;  2Y0S G;  5ELO A;  3GTQ B;  2GVA A;  1AZP A;  3BYT B;  2F0G A;  3G48 A;  1LTT D;  4PG3 A;  4GKJ L;  2R6G A;  5I2Y A;  5EPK A;  2F0I A;  2IX1 A;  3A74 A;  3D6W A;  1EY9 A;  3RLF A;  1STY A;  4DK0 A;  2JE6 I;  2F0M A;  3P7J A;  4YIJ A;  4KJO A;  5CBA E;  4XQJ A;  3K7U C;  4LAA A;  2NTT A;  1G2T A;  1VF5 C;  4MZ9 A;  1TWH H;  4DUY Q;  1H9K A;  1EIY B;  4S3S A;  3CME A;  4Y52 H;  3SEB A;  3S1N B;  3I4N H;  2B2T A;  4PZ7 A;  5C3X A;  2F0T A;  5JJK A;  3J7A 5;  1L2F A;  4B08 A;  1D1K A;  4JI8 L;  2CQA A;  3KUP A;  1A2T A;  2Q2U A;  1KD1 C;  2D9U A;  5EBC A;  4CKC A;  1W2B A;  4TRD A;  1ESR A;  5GAH C;  1PZK D;  2K7V A;  1S3O A;  1EYA A;  3HS0 C;  2L4N A;  2G5D A;  2OF1 A;  4UY8 C;  2EYF A;  3DWP A;  1CKO A;  4TKO B;  3H15 A;  4LF6 Q;  5IT9 L;  4DV0 L;  4IZ8 A;  2LFN A;  1U0L A;  3NEN A;  3P1H A;  5AJ3 L;  1PHJ A;  5COR A;  4ZKB B;  4R4O A;  1Q8K A;  4NP5 A;  1SNC A;  2RHQ B;  3KF8 B;  1RTO A;  2CFM A;  2PQE A;  3C2P A;  5EAY A;  5K5P A;  3D4R A;  3NBH B;  4C56 C;  4GNX A;  1HXY D;  4DV6 L;  4DR2 L;  2A6H C;  4BBR G;  5DM7 3;  1LAC A;  3W5O A;  1HNZ L;  1MJC A;  3ULL A;  1KDC A;  1BVS A;  3UDX A;  1HZB A;  3S2D H;  3FHW A;  4K6D A;  3RUZ A;  5IYB H;  3CCR A;  2IJ0 A;  3M7G A;  2B3G A;  4A93 B;  3CPW A;  1VMP A;  1Z6H A;  5AFW A;  2V4D A;  2F3I A;  3HOU B;  2F0V A;  5C0X I;  4C3J H;  4X64 Q;  2D2C C;  1QG7 A;  4B9X A;  4DR1 Q;  1YHA A;  2JA6 G;  4BBS H;  4WJ3 M;  3K7A H;  2B2V A;  4Y7N B;  5C3E H;  2VUM G;  3K5N A;  4FF2 A;  1G6Z A;  3H6M A;  2IY5 B;  1HQM C;  1KNE A;  4KHP Q;  2NBF A;  4KTA A;  3GV3 A;  1SJE D;  4RA8 A;  1HCZ A;  2B2Y A;  2L1B A;  4LFC L;  4IOC A;  2PNR C;  2JA5 H;  2XSC A;  3RN5 A;  3OTO Q;  4DV4 Q;  3KF6 A;  1YEZ A;  3NWS A;  1HUM A;  4HTH A;  5IOD A;  3NEL A;  2PZT A;  4LW1 A;  1D5Z C;  1XTD A;  3BYY B;  4L8J A;  5LMU L;  2XRQ D;  4AIM A;  3I91 A;  2X6L A;  4X65 L;  1K8G A;  1CA6 A;  1WCM H;  1EIG A;  3H3V I;  2F0W A;  4PZ8 A;  1EY4 A;  2WB1 B;  1PH3 A;  2F0U A;  3ULP A;  5DM6 3;  3MWY W;  3HGB A;  4GLV B;  4C3I B;  5FK9 C;  2OQK A;  1J5E L;  4FYD A;  4LF9 Q;  2F3W A;  4XDX A;  4ZCK A;  1IL2 A;  2O5I C;  2N78 A;  3DEP A;  1CSQ A;  4A3J B;  2JA7 G;  1PA6 A;  1IBL Q;  1EY6 A;  4JI0 Q;  5C4X B;  1CHQ D;  4OXP A;  5FO9 B;  1WYD A;  3VR4 A;  1S4Z A;  3J7Y W;  4PMB A;  1BO0 A;  1VCI A;  1IBM Q;  3GDE A;  2QEX A;  2K5W A;  3BDL A;  1BCP B;  5CV5 A;  3RZO H;  1FR3 A;  5IGE A;  1YIJ A;  2B2W A;  1SNM A;  1V43 A;  4R9W A;  4LUZ A;  2NN6 G;  4DK6 C;  4JI2 Q;  1K8A C;  2K5D A;  4X3U A;  1HZA A;  5IOC A;  2ZJP A;  4KJN A;  1H9M A;  1I4H A;  2QDL A;  3D0F A;  4DV2 Q;  1QUQ B;  1OO9 B;  1KLG D;  4TSS A;  1XMO Q;  1TWH B;  1FVI A;  1S5B D;  2A69 C;  2LS0 1;  2KEC A;  4A3L G;  1A0I A;  2YU9 H;  3I4N B;  1LTL A;  4B3S L;  2UXB Q;  3BZK A;  1JOO A;  2RSO A;  2Q8I B;  4AYB G;  4DR3 L;  1Q86 C;  2DJG C;  1TKW B;  2KUM A;  5ISR A;  1YHB A;  4IUU A;  2NVX H;  5FOB B;  1JOR A;  5HY6 A;  1H9S B;  5A35 A;  2A73 B;  1XX8 A;  3JC6 6;  1LTI D;  4YCU A;  3GTL H;  3J80 c;  3M7N A;  2L55 A;  3QG1 A;  3KK7 A;  5A2Q L;  3P20 A;  2B2U A;  4NXM L;  2FMM A;  1CKN B;  4PNY A;  3A55 A;  4DN4 M;  3MHB A;  1PTO D;  5L37 A;  2L5T A;  4DR7 Q;  1F2L A;  1DZ1 A;  2RBM A;  1SE8 A;  4EQ5 A;  1VQ8 A;  1JWS D;  2ASB A;  3I90 A;  3CU7 A;  4ID6 A;  4LFA L;  1PZJ D;  4HMI A;  1NBW A;  3K5M A;  1HRJ A;  1I4Q A;  3BZC A;  1BXT A;  2SNS A;  3HKZ G;  1YNN D;  3NTK A;  2AHO B;  1E2Z A;  4Z9C B;  5D14 A;  2K50 A;  1YIT A;  4IUV A;  3CCQ A;  3CCS A;  5I6W A;  1XYI A;  3M3Y H;  3EQL C;  3HOU G;  4UDU C;  1TWC H;  4QF4 A;  2VB3 X;  1D1I A;  4XQQ A;  5ELN A;  1PYS B;  5ELB A;  4JOI A;  4IUQ A;  1TT2 A;  5D3I B;  1N36 L;  2PMZ E;  4LF7 L;  4X62 Q;  4OWT B;  1EOV A;  2Y0S E;  2FHT A;  1AP0 A;  5EBD A;  1UEB A;  2K33 A;  1PH9 A;  4NPS A;  4BBS B;  2F0O A;  1ILQ A;  1K28 A;  2XVS A;  3K7A B;  3MXP A;  4IFD J;  5C3E B;  3VYU A;  2F3V A;  1PH7 A;  1CI3 M;  3GTP H;  1K3R A;  2XGT A;  1C7Y A;  5M5Y B;  1X65 A;  4KY6 A;  1JB7 A;  3E5S A;  4BBR H;  3OWF A;  2RCF A;  4X66 L;  1SEB D;  2BOS A;  4KN7 C;  3S14 B;  2JA5 B;  1A6X A;  3KJO A;  1KC8 C;  1YNX A;  4OGQ C;  5GRO A;  2WB1 G;  2B29 A;  3OIQ A;  1HR0 Q;  1QZH A;  4HAE A;  2AQ3 B;  1UE6 A;  3VR6 A;  1SE3 A;  2NTS A;  1SDF A;  4K5V A;  1KDA A;  2OQ0 A;  1O80 A;  1X3P A;  5GQO A;  1SFO H;  3IFD A;  4DPG A;  1VF7 A;  2PZW A;  4IFD I;  1KRS A;  4LWC A;  3NBI A;  3NXW A;  1K9M C;  2VZA A;  4KLK A;  5IGD A;  1WD0 A;  2JA6 H;  2F52 A;  4K5W A;  1JOK A;  2VUM H;  1J8I A;  2ZJR A;  4A3M G;  5C4X G;  3WOE A;  5BN3 A;  4JI7 L;  4LNQ A;  1YJ9 A;  3J81 j;  4JI6 L;  2UUB Q;  2B63 H;  2NVT H;  3A0J A;  5J3B A;  3K57 A;  2PQA B;  4RHS A;  1PRT B;  4F8M A;  2AWO A;  4RCN A;  1N9W A;  1WJJ A;  1K8M A;  2F1M A;  4DAY A;  1VQN A;  3J80 L;  2NVY B;  2ICE C;  2JJQ A;  4H02 A;  3CRK C;  2N8N A;  4HMJ A;  4HJ9 A;  1EY8 A;  1Q46 A;  1PH1 A;  1SMY D;  1CUK A;  1K83 H;  1PFN A;  4HCE A;  2AQ2 B;  4LFB L;  3UDI A;  3ERO A;  3G6E A;  3RZO B;  4NXN L;  3UE1 A;  5K36 G;  4F7X A;  2UXC L;  1SNP A;  4BA2 I;  1J9O A;  2SOB A;  2HIV A;  1CA5 A;  2R3Z A;  1VQ5 A;  2GVB A;  4JYA Q;  2F4V Q;  1TWG B;  2JP1 A;  5M3F G;  1XMQ Q;  2C5C A;  1GM5 A;  3W1B A;  4CKE A;  4R4T A;  3NSW A;  2KQ3 A;  3MXN B;  3CXC A;  3M85 A;  2L9H A;  5JPM C;  3F8T A;  3GTJ B;  4KI0 A;  1C8C A;  1LT4 D;  4A3F G;  3FMC A;  2JA7 H;  2EY5 A;  1XNR Q;  4IUN A;  2F0S A;  3TP7 A;  2ATW A;  3VA5 A;  1TS3 A;  1MIU A;  2Q2H A;  3BJU A;  2VB2 X;  2KEE A;  2EYH A;  1F2Y A;  5CR3 A;  1WI5 A;  2DNE A;  4DGZ A;  2NVX B;  1YJW A;  2JA8 B;  2ZXP A;  2K14 A;  1KNA A;  2ZXO A;  3DEO A;  5HUR A;  4YWL A;  1B3Q A;  1HFN A;  1VMC A;  4GKK L;  4JVZ A;  1WFQ A;  3T1Y Q;  2NN6 H;  1SR3 A;  4IPH A;  1O7L A;  3IKJ A;  4DKA C;  1CHP D;  2R7Z B;  1RL2 A;  1BQQ T;  4APV A;  2FXQ A;  3OPO A;  3S1N H;  1B9M A;  4DV3 L;  1V8Q A;  4QY7 A;  5M5W H;  2WAQ B;  3GO5 A;  1RF2 D;  1F9P A;  2MJ8 A;  4NDX A;  3E6Z X;  2HHH Q;  5KEE A;  4RAU C;  4A3L H;  1HZC A;  1PTO C;  5COY A;  1Y14 B;  3N6R A;  1TS4 A;  2E5L L;  3A56 A;  1TWC B;  2A6H D;  2YYZ A;  5ELC A;  2PO4 A;  4G7Z C;  1XPR A;  3D3R A;  3DWA A;  1N34 Q;  1JWU D;  1YNN C;  4UP9 A;  1PFS A;  4GOP B;  1B7Y B;  4POG A;  4B3T Q;  1Y8P B;  2IW3 A;  2E2H H;  1NY4 A;  2VQE L;  1H9R A;  1DOL A;  3I8Z A;  4CKB A;  3PUX A;  3GTP B;  3K5L A;  2RQX A;  3UI2 A;  2BH2 A;  1KLU D;  2O2L D;  1SRU A;  4A3D G;  2D5D A;  3TP8 A;  1F9R A;  2H4O A;  1I6H H;  1B53 A;  2MGS A;  4IOA A;  5KNC A;  2R92 G;  4KV6 A;  4BBR B;  2D0P A;  2DY8 A;  3T4A C;  1DD2 A;  1GKH A;  3CC2 A;  3RLN A;  3HOU H;  4QL5 A;  2F0L A;  1RCV D;  1G91 A;  4LUV A;  4YWM A;  5ELD A;  2EVB A;  4AYB E;  2KBN A;  3S17 H;  1R4Q B;  2UUC L;  1SBB B;  2N49 A;  3FRP B;  1ENC A;  4EVO A;  3A8I E;  1SFO B;  3TRZ A;  5IWA Q;  5CYU A;  1I94 L;  4KN4 C;  5EPL A;  4J8Q A;  2JA6 B;  1DOK A;  1ENA A;  4JI1 Q;  4ZQ3 A;  1N33 Q;  2VUM B;  1JE4 A;  4J15 A;  5CMD A;  1S5F D;  3BU2 A;  3S24 A;  3V05 A;  4QJF A;  3QOJ A;  3C1F A;  2TSS A;  3MEH A;  3S15 B;  2CCZ A;  3SXH A;  4N8F A;  2R7D A;  3GP7 A;  1HNW Q;  1BR9 A;  3EJI A;  1ML0 D;  4B3M Q;  3H94 A;  3GTG H;  3AFP A;  4GZY C;  3MAQ A;  4JG2 A;  2JSO A;  4LF4 Q;  3O13 A;  2R93 B;  4WFN 3;  3KF8 A;  3A8J E;  1Q1E A;  3DMU A;  1YI2 A;  1BOS A;  4MIU A;  2AMC B;  5I9P A;  2UXD L;  1D5X C;  5IYC G;  4WOR A;  1L1O B;  1GUT A;  3NBH A;  3E9H A;  2L11 A;  3T1H Q;  3NK9 A;  4O1N A;  5KRU A;  3FEW X;  2UU9 Q;  1SMY C;  1PLF A;  4DR5 L;  2KHJ A;  1WTQ A;  5LL6 X;  1D6E C;  5C4X H;  2I5M X;  1AEX A;  1PZI D;  4KKU A;  1KQS A;  3PUZ A;  4C1N K;  1Q3L A;  1OXS C;  3PMF A;  2CVR A;  2JA8 G;  4PMC A;  1BCP C;  1WTX A;  1UUP A;  3S16 H;  2IWH A;  1ZYR D;  1RTN A;  3N52 A;  4DV0 Q;  1GO3 E;  5LMN Q;  1R9T B;  3DM1 A;  2B2V C;  2A69 D;  2R7Z G;  4JI4 L;  1HNX Q;  1IXR A;  2X69 A;  3U9O A;  4CDE C;  2WB1 E;  4ZUI A;  4GN3 B;  2AKW B;  3A8K E;  5I9O A;  3KFU A;  5K36 H;  2WAQ G;  2EJG C;  1G29 1;  4JBM A;  1SND A;  1EU3 A;  5M9O A;  4FF4 A;  1XNQ Q;  3ERQ A;  3FVQ A;  2B2Y C;  5M5X B;  1B4O A;  3GTO B;  2NZO A;  1IHZ A;  1FJG Q;  4JV5 Q;  4OO1 G;  1IBK L;  2LSS A;  3DLL A;  2ZTE A;  4DUZ L;  3AFQ A;  5M3F H;  3VR5 A;  2CH4 W;  3DXJ C;  4UAI A;  2PW5 A;  1SNQ A;  5T1G A;  5M5W B;  3SVM A;  2OCE A;  3VR2 A;  4K0K L;  4GN5 A;  1CK1 A;  2BDN A;  2QDB A;  5IGB A;  3S2H B;  4A3F H;  4FVM A;  5IGG A;  4YY3 L;  4CDF C;  2K05 A;  1FNW A;  1UNS A;  4XYQ A;  4U67 3;  1BDO A;  3M4O H;  4BWG B;  4ZYS A;  1I4R A;  4R4I A;  4AYB B;  2IPK D;  3JAM c;  3DHQ A;  5KYL A;  1VQE A;  2VQF Q;  3OW2 A;  3SR1 A;  4B3R L;  1U4L A;  2K32 A;  5EKL A;  1QE6 A;  5EPJ A;  3VR3 A;  2ZXR A;  2E2H B;  5C0X G;  3Q23 A;  1J6Q A;  2E8G A;  1D5M C;  2H1E A;  3PO2 B;  5IYD H;  3NEM A;  2C35 B;  2EPB A;  3EBE A;  1SYF A;  5E1F A;  1IW7 C;  4LF8 Q;  3U4Z A;  1GHJ A;  1V9P A;  5IT9 E;  3PUV A;  1Q12 A;  4K8I A;  4N9T A;  1D8L A;  5EGT A;  2XRS D;  3W1G A;  4RHR A;  3B6Y A;  1I6H B;  3HFZ B;  3A5Z B;  3HKZ B;  1SYG A;  3M9B A;  2B2W C;  3D4W A;  4LF5 Q;  4I7A A;  1II3 A;  5IIF A;  1G8Z D;  5CV8 A;  5ELE A;  1N8R C;  1WTH A;  2Z8L A;  1LUZ A;  5CGK A;  2F03 A;  2VXW A;  3PIP A;  1U9R A;  1KDB A;  3FPP A;  1J5E Q;  2YV5 A;  3L7Z C;  3SHL A;  3VYT A;  3S17 B;  4DUY L;  3BS1 A;  3L9A X;  1OXX K;  1ICW A;  4PMW A;  5M5Y H;  4KKS A;  1B70 B;  4DU9 A;  1X32 A;  2K5Q A;  5C4H A;  2MO0 A;  4IPC A;  1X3E A;  1QUQ A;  1KXL A;  4HR7 B;  5LHY 1;  1KIX A;  2QCP X;  3KDF B;  1VQ9 A;  1I3Q H;  4EQO A;  2PYK A;  3CCV A;  3S14 H;  1TVX A;  4KD4 A;  2ZJQ A;  2OT2 A;  5BR8 Q;  3AQQ A;  4IAL A;  3NHH A;  1CZG A;  1EY5 A;  1HFG A;  2RCN A;  4AH6 A;  2A8V A;  4LF6 L;  4A3D H;  1XXG A;  4JC0 A;  3IAY A;  2ZTC A;  3OWE B;  3QR8 A;  1H9S A;  4DA2 A;  2ZTD A;  5F2D A;  2R92 H;  2R93 G;  1YHQ A;  1PFM A;  4XT3 B;  1B44 D;  2B2U C;  2WP8 J;  4AQY Q;  4EQP A;  3GTG B;  1IYV A;  1WTR A;  5JEA G;  3HZX A;  1CKN A;  2MNA A;  3LWU A;  2MPM A;  4DV1 Q;  4FP5 D;  1V1P B;  2EYO A;  4IPD A;  2D0O A;  4HJ8 A;  1L0Y B;  2K6A A;  5E3F A;  2AWN A;  1PRT C;  2UUA Q;  1LTR D;  4WJ4 A;  4CJ2 C;  1EWI A;  1YZ6 A;  2WKD A;  3NP8 A;  5BN5 A;  3HOX G;  4A3M B;  3BZD B;  1LTB D;  2NVY H;  3FP9 A;  4DR4 Q;  1NSN S;  1W6K A;  1Z7T A;  4R8I A;  4JI3 L;  4JOI C;  4OHJ A;  3R93 A;  3JAM L;  4DR1 L;  3K81 C;  4C3H B;  4QMG A;  3NWT A;  2ZT9 C;  4BS9 A;  3S16 B;  1KTK A;  4PQX A;  1NJI C;  1DGS A;  3OMC A;  1MBY A;  3EIV A;  2JQO A;  1PXU A;  2F0E A;  3QOL A;  3R2I A;  4XTC S;  1QIL A;  3MEF A;  5FJ8 G;  1TWA B;  4ALP A;  2XN9 C;  4ZRZ A;  2CHB D;  3KLS X;  3K0Y A;  4RFB A;  1QNK A;  1TWG H;  3PCO B;  1QWY A;  1ZYR C;  2E2I H;  1ZEQ X;  3CD6 A;  5IYC H;  3OTO L;  4DV4 L;  1ICF B;  2F0P A;  2LKV A;  3GTJ H;  4ABN A;  3PF5 A;  3HOY G;  3TRE A;  2VNU D;  1SRO A;  4RKL A;  1RKN A;  5M3F B;  2F0F A;  5CV7 A;  2XWJ B;  2JXM B;  3TN2 A;  5I2X A;  3S1Q H;  1EEF D;  5JJI A;  2WIN B;  1N32 Q;  1YNJ C;  5HGT A;  3GD7 A;  1FYC A;  2R7F A;  2JA8 H;  3CAM A;  1JJC B;  4A3F B;  2E2J B;  2F0N A;  4A3I G;  3UDF A;  2BCO A;  4LMQ D;  3M4O B;  2LXJ A;  3L0O A;  3ITP A;  4LF9 L;  1MI2 A;  3ER0 A;  2IX0 A;  3PO2 G;  2AUJ D;  2R7Z H;  1PMR A;  3K6O A;  1QCB D;  2L12 A;  2NN6 I;  4KMU C;  2A5H A;  2PI2 E;  4V19 0;  1X3G A;  2RA4 A;  5IY0 A;  4JI0 L;  3D4D A;  5M3M B;  1SYC A;  2IL8 A;  4XT1 B;  1IBM L;  4L5S A;  3AEV A;  2PQA A;  3T51 B;  2OTL A;  3HP3 A;  5KND A;  3CC4 A;  4OO1 H;  4MN3 A;  5A2Q E;  1BBX C;  3D6C A;  4UHV A;  3T56 B;  5C4Z A;  2EYJ A;  2EXD A;  3CMA A;  2HCC A;  1MKH A;  2PW7 A;  1SJH D;  4JI2 L;  3QO2 A;  1WTP A;  1VDZ A;  1E3P A;  4ILW A;  1STB A;  1JE5 A;  1DJR D;  4MHE A;  4GS3 A;  3OIP A;  1XMO L;  4EQN A;  3VYS A;  1EWH A;  1C4Q A;  3TS2 A;  1R4P B;  2PI2 A;  1V1Q A;  2F0J A;  2O4X A;  3J81 L;  2A6E D;  3QWN A;  2VY3 A;  3PIO A;  5E4X A;  2PPB C;  3MXN A;  4PZ6 A;  5C5M A;  2K5N A;  1Q82 C;  2WAQ E;  4P75 A;  3J7A F;  1EYG A;  1EQV A;  5EKK A;  2XTI A;  1DXM A;  1C48 A;  3TZU A;  1I3Q B;  2F0K A;  3SK8 A;  3E3X A;  2K03 A;  1PH2 A;  1DM0 B;  4A3D B;  1M4V A;  1VS0 A;  4HED A;  3H3V C;  2KOL A;  4NXN Q;  1QB5 D;  2EIF A;  4DR7 L;  1E22 A;  3A7L A;  2HDM A;  1ET9 A;  4DAM A;  2R92 B;  1VQH A;  1CSP A;  3KBG A;  4RGO S;  1U4R A;  4IN3 A;  1S72 A;  4YHH Q;  4KKT A;  4OL7 A;  2JEB I;  1OXT A;  4NB3 A;  4DNT B;  1TS5 A;  1X55 A;  2ICI A;  1L0X B;  4DNI A;  1NCV A;  4DV5 Q;  1PH6 A;  3LGJ A;  2QKI C;  1STN A;  1NR4 A;  2DGY A;  2VS1 A;  2XNA C;  1LT6 D;  4DXG A;  2RDG A;  3MTS A;  3BVM A;  4C3H G;  3S15 H;  1VQI A;  4FDB A;  1IKL A;  3PUW A;  3CHB D;  4JBK A;  1IYU A;  1KRT A;  3VDY A;  4E6I A;  3JAM i;  1SE4 A;  1M90 C;  1K0S A;  4X62 L;  2OTJ A;  4X3S A;  2SEB D;  3PIP 3;  2QGQ A;  2V1C C;  1C9O A;  1LLR D;  2R93 H;  4IUT A;  1TR5 A;  1BF4 A;  4GOP A;  3SGI A;  3Q8D A;  1PH4 A;  3X3M A;  1BCP D;  1LO5 D;  1RDP D;  4LK1 C;  1UWV A;  1WOC A;  3CCM A;  2VL6 A;  2ES2 A;  1JR0 D;  1Z9F A;  1XJV A;  4YWK A;  3J80 E;  3U4V A;  4DAP A;  2K5V A;  5EKI A;  1EYC A;  1X56 A;  2E2I B;  1JB3 A;  1NMG A;  1MGS A;  4EGV A;  3BVG A;  4P74 A;  1L0W A;  1HR0 L;  3AMU A;  1E2W A;  3ND9 A;  5IP9 G;  1VQF A;  1T9H A;  2CH4 A;  1HUN A;  3MVV A;  3L3O C;  3HOX H;  1R9T H;  5FLX c;  5C6A A;  3S1Q B;  4TVA B;  2Z0S A;  4K2L A;  1NR2 A;  4X6A H;  2JA9 A;  2Z4I A;  1PFB A;  5G3L F;  3LNN A;  3KOJ A;  5M3M G;  1E24 A;  3CPF A;  2BA0 A;  2JN4 A;  1B50 A;  1B8A A;  4P2C B;  5FJ8 H;  1ASY A;  2UUB L;  5M5X H;  4DV7 Q;  2F0D A;  1FGU A;  5DNF A;  3TP5 A;  4P71 A;  3I55 A;  3GTO H;  2Q8T A;  3I2Z A;  5H1S E;  2N55 A;  1Y1V G;  3M4Y A;  2DN8 A;  4RG1 A;  4CGY B;  2Z6K A;  4IJL A;  4CBV A;  3S2H H;  3HOY H;  1EQQ A;  4LJZ C;  5JVG 3;  3E0J A;  1VQG A;  4KD3 A;  2UUC Q;  2OWO A;  1EFI D;  2K04 A;  1UE7 A;  2B8F A;  1IZ6 A;  2M00 A;  4DR6 Q;  1NNX A;  1IW7 D;  4OX9 Q;  3WOF A;  2EY2 A;  2Z9H A;  2K01 A;  2CWP A;  4A3I H;  2IT1 A;  3NQI A;  2BH8 A;  2E74 C;  4KY7 A;  4Q0F A;  4RGT A;  4RGM A;  2F4V L;  4CJ0 B;  4A3K G;  1XMQ L;  3OYY A;  1AE3 A;  5KNB A;  2QA4 A;  1GJX A;  3STB D;  1D2B A;  2DNC A;  3PO2 H;  3PQI A;  3K0X A;  1L1O A;  1Q8I A;  4KK7 A;  2HQL A;  3URY A;  3I4O A;  4JK1 C;  1PTO H;  4JI5 Q;  1JT8 A;  1A3T A;  4IUP A;  1XNR L;  4ODG A;  1UAP A;  3TQY A;  4HSP A;  1DCZ A;  2PCF B;  1WTV A;  5T1I A;  1ONL A;  4HCS A;  2NVQ B;  3WWV A;  1QJO A;  1X9N A;  1HA5 A;  3LX0 A;  1JQY D;  3HG9 A;  1TU2 B;  1S40 A;  3CC7 A;  5JPN C;  1EOT A;  1C0A A;  3D8G A;  3RLO A;  1IL8 A;  2A6E C;  1YJN A;  3D31 A;  2J4X A;  2M9V A;  2I5L X;  1VQ6 A;  3A5U A;  2BDO A;  4FO2 A;  2E75 C;  2EOT A;  3BVZ A;  1AW7 A;  1I4G A;  3P75 A;  1TY2 A;  1E2V A;  3T16 A;  1STG A;  1NE3 A;  4WRD A;  3ERS X;  1VQ4 A;  4R8N A;  2HHH L;  2MP1 A;  4DAV A;  1A15 A;  3PUY A;  1B2T A;  3MXG A;  2PNH A;  4ZUJ A;  3RZD H;  1LTS D;  1Y1W B;  3EFX D;  1JWM D;  1F2Z A;  5FLX L;  2ZM6 L;  1UEA B;  4QUC A;  3W2D A;  1D7Q A;  3J80 i;  1GOZ A;  2KHS A;  2EYL A;  3FDT A;  3KYH C;  1QOH A;  2KEN A;  3ZJY C;  1N34 L;  1RIP A;  3HKZ E;  3OHX C;  5C44 G;  4GKJ Q;  1WD1 A;  2BE5 C;  2HIX A;  4B3T L;  1PRT D;  4JI4 Q;  4QGU A; 
#chains in the Genus database with same CATH homology
 1FD7 D;  3NE5 B;  2Z4H A;  2E2D C;  5C3W A;  1CM9 A;  1EEI D;  2RVL A;  2EE1 A;  1GUW A;  2SDF A;  4N9P A;  1Q90 A;  4G7O C;  3PIO 3;  4PV1 C;  3QB3 A;  4FXK C;  3MA2 B;  3R8B A;  3MZ5 A;  5CV9 A;  4DXF A;  1M8A A;  2J0T D;  1B3A A;  1FNU A;  4K2K A;  2I46 A;  1HQR D;  1OXU A;  4X3T A;  3NQT A;  4I65 A;  4M1U B;  5I4D A;  1GUO A;  1EWC A;  3HOX B;  2QIL A;  2B39 A;  4DFA A;  5CV4 A;  3SE0 A;  3I4M B;  4DK1 A;  4K14 A;  1YNJ D;  4DNR B;  3HRZ C;  3IFT A;  2N88 A;  2O5J C;  1F2M A;  3EVQ A;  4I7Z C;  4H13 C;  1ILP A;  4RCO A;  2A74 C;  4CJ1 B;  3MC0 B;  4RWS C;  3HOY B;  2AUK A;  3BG3 A;  4BA1 I;  2M2L A;  5EQ0 A;  3HOW B;  3R2T A;  1I50 B;  2Z1C A;  2EY6 A;  1LTA D;  1XWE A;  2A68 C;  3G6J B;  4L6T B;  1ZKO A;  4ZAI A;  1PDQ A;  4A3I B;  1PYW D;  3I4L A;  3C1E A;  1KAB A;  1V1P A;  4K5X A;  3EA6 A;  4G4K A;  2JEA I;  1PTO B;  4TQU S;  1EZ6 A;  1PTO F;  5C0X J;  1H9J A;  4BY7 B;  3TDQ A;  3Q24 A;  4OO1 I;  3I70 A;  2FMC A;  3OMG A;  3MFG A;  5KYI A;  2C9O A;  1BUV T;  4JBW A;  1E0B A;  3NUC A;  2QEJ C;  1EY0 A;  3HOV B;  1ROD A;  2RDH A;  2SNM A;  1STE A;  3ZYY X;  1MD2 D;  1I4X A;  1AN8 A;  4G57 A;  3TP6 A;  2IX3 A;  3RZD B;  2B8G A;  1S5D D;  3GQB A;  1TWF B;  2HUG A;  3DWQ A;  4C1N I;  1JC7 A;  1HA6 A;  1O7Y A;  4RKB A;  1Q1B A;  1JCK B;  3S1R B;  2XWB B;  4NMZ A;  1NUC A;  4H0L C;  3KLR A;  3GTM B;  4KHV A;  5ELF A;  4ZKC B;  5JEA J;  4FNF A;  4ZLT F;  1ET6 A;  5D65 A;  2NYZ D;  5I6Y A;  1F77 A;  2TMP A;  5FO8 B;  5KIX A;  1T5X D;  2WAC A;  1HHV A;  4RH6 A;  2EXZ A;  4M8A A;  4FXD A;  1GUG A;  3HOZ B;  2R61 A;  2NUC A;  5LL6 S;  3SDZ A;  4K6L A;  3PO3 B;  3JAM E;  1GUS A;  2EJM A;  1CQF A;  3CQZ B;  1BCP F;  3K59 A;  4J1M A;  5FO7 B;  2NB0 A;  1DYQ A;  1Y8O B;  2FJ2 A;  5J39 A;  3I73 A;  1SE2 A;  1SYE A;  3J7A V;  5C5L A;  2Q8R E;  4V0B A;  1HTL D;  1S5E D;  2LY7 A;  2NZ1 D;  1SYD A;  3SK6 A;  3MFY A;  1X3Q A;  1STA A;  4OIK A;  4NW2 A;  5IGF A;  3OW7 A;  3QJY A;  1O7Z A;  2GA4 B;  3NTI A;  3LWE A;  3GV6 A;  4RGN A;  5BN4 A;  1NAP A;  2WKC A;  1JIC A;  1RJT A;  1CFM A;  3Q22 A;  1Y1V B;  3BDO A;  5EJW A;  2D62 A;  4F88 A;  3F2U A;  4KHZ A;  1G2S A;  1S5C D;  3MXU A;  2MHV A;  4IQZ A;  3OSO A;  2F4I A;  2MUY A;  4C2M B;  3C46 A;  2FFK B;  1I4P A;  2KVM A;  1AZQ A;  4ULL A;  2X6G A;  4G7H C;  1T5E A;  4A3K B;  5E4W C;  3S2D B;  1GHK A;  5C0X H;  4IFD G;  1CZW A;  1SAP A;  3V2T A;  2KED A;  3RMH A;  4KY5 A;  1U4P A;  3NTH A;  4C3J B;  3KLS A;  3BDC A;  4ME5 A;  2ENB A;  5KGU A;  2WV6 D;  1WTW A;  4XYO A;  4J6H A;  3J81 E;  2EDG A;  2KCC A;  4B9W A;  2G9H D;  1B9N A;  2PZU A;  1SSO A;  2RDF A;  1B1Z A;  3Q6S A;  2BE5 D;  2K1B A;  3KBX A;  1RD9 D;  3A7A B;  2HQE A;  4HN7 A;  1LT5 D;  2CW0 D;  2BA1 A;  2ID0 A;  4C3I G;  4OIJ A;  3RD4 A;  2NWG A;  1U4M A;  1WCM B;  3H91 A;  1JOQ A;  3CRL C;  1O78 A;  4FF3 A;  4XIG S;  5CV6 A;  3PV0 A;  2AQ1 B;  5C44 B;  5FKA C;  3WDN A;  1FNV A;  5J22 A;  1PRT F;  4QCL A;  1V1O A;  5JEA H;  1A3V A;  3I72 A;  4XQN A;  1WTO A;  1EYD A;  1STH A;  3G7L A;  1EU4 A;  1SXT A;  5D3D A;  3DUZ A;  1EY7 A;  4CHT B;  4U68 A;  1ENF A;  4O42 A;  4K8J A;  1Y8N B;  4A3G B;  1A3U A;  2E76 C;  1EIH A;  2DY7 A;  1FGB D;  2J7Z A;  3I3C A;  5IGC A;  3ONA B;  3S1M B;  3S9W A;  1GXD C;  3A54 A;  1MSH A;  3Q0A A;  3H09 A;  3T53 B;  1TQO A;  4NKL A;  3K58 A;  2L0C A;  2YU9 B;  1GUN A;  1RHP A;  1XTC D;  3TSS A;  4QIW B;  1HTP A;  3IL8 A;  2F0Q A;  3OOC A;  2A68 D;  4XXE A;  1LT3 D;  2PMZ B;  1IKM A;  2EY1 A;  3AB9 A;  5CBE E;  2Y0S B;  3VA7 A;  3GTL B;  5DAU A;  5JAV A;  2OEO A;  3H0G B;  1EL0 A;  1DOM A;  1CTM A;  3VYR A;  1DON A;  3HEJ A;  5J1Z A;  2G9D A;  1Y69 U;  1KAA A;  2RKS A;  1F9S A;  4HSV A;  3K5O A;  3FPU B;  1LTG D;  3FKI B;  3TME A;  5DEH A;  1BNZ A;  1F9Q A;  3SK5 A;  3V96 A;  2EYP A;  2KCN A;  3M3Y B;  2OXP A;  4QUF A;  1CQV A;  4C3J G;  4H44 C;  5TSS A;  2XIW A;  2EYM A;  1QNU A;  5C4J B;  3AU7 A;  1I6V C;  1SNO A;  3U9S A;  2JYO A;  2KJX A;  4BY1 B;  3TZD A;  1LAB A;  1AFP A;  2EJF C;  1Z47 A;  2KA7 A;  3R3O A;  1LV9 A;  3C3L A;  2QF7 A;  1OXV A;  5NUC A;  4IFD H;  4A3B B;  1A2U A;  4IUR A;  3TBI B;  1K8O A;  2I07 B;  3GTK B;  1CT1 D;  4QB4 A;  5JJZ A;  2FIN B;  3SK4 A;  2B2T C;  2CW0 C;  5JOB A;  4DF7 A;  4FF1 A;  4X3K A;  1EQT A;  2K28 A;  2B63 B;  2NVT B;  1HPC A;  5FLX E;  3X3N A;  5CC4 A;  4FXG C;  1ESF A;  2HCI A;  4F87 A;  1K83 B;  1W6J A;  1SYB A;  2WII B;  4L63 B;  1EZ8 A;  1ZXT A;  2F0H A;  4H7B A;  2HDL A;  1TY0 A;  3T13 A;  3NPP A;  4Q5V A;  1WVL A;  1MSG A;  4A3E B;  2LMC B;  3W3A A;  1TII D;  3CKI B;  1TS2 A;  4WJW A;  5JVH 3;  2RSN A;  4ZK9 B;  5G3L D;  2JA7 B;  2EZV A;  3ND8 A;  3QIA A;  3GTQ B;  1AZP A;  3BYT B;  2F0G A;  1LTT D;  2R6G A;  5I2Y A;  5EPK A;  2F0I A;  2IX1 A;  3RLF A;  3D6W A;  1EY9 A;  4DK0 A;  1STY A;  2JE6 I;  2F0M A;  3P7J A;  4YIJ A;  4KJO A;  5CBA E;  4XQJ A;  4LAA A;  2NTT A;  1G2T A;  1VF5 C;  1H9K A;  4S3S A;  3SEB A;  3S1N B;  2B2T A;  5C3X A;  2F0T A;  4B08 A;  1D1K A;  2CQA A;  3KUP A;  1A2T A;  2D9U A;  5EBC A;  4CKC A;  4TRD A;  1ESR A;  1PZK D;  2K7V A;  1EYA A;  3HS0 C;  2L4N A;  2OF1 A;  2EYF A;  3DWP A;  4TKO B;  5IT9 L;  4IZ8 A;  2LFN A;  3P1H A;  5COR A;  4ZKB B;  4NP5 A;  1SNC A;  1RTO A;  2PQE A;  3C2P A;  5K5P A;  3D4R A;  4C56 C;  1HXY D;  2A6H C;  5DM7 3;  1LAC A;  1KDC A;  4K6D A;  3RUZ A;  2IJ0 A;  3M7G A;  4A93 B;  1VMP A;  1Z6H A;  5AFW A;  2V4D A;  3HOU B;  2F0V A;  5C0X I;  2D2C C;  1QG7 A;  4B9X A;  2B2V A;  4Y7N B;  3K5N A;  4FF2 A;  1G6Z A;  3H6M A;  1HQM C;  1KNE A;  2NBF A;  4KTA A;  3GV3 A;  1SJE D;  4RA8 A;  1HCZ A;  2B2Y A;  2L1B A;  2PNR C;  2XSC A;  3NWS A;  1HUM A;  4HTH A;  5IOD A;  2PZT A;  1D5Z C;  3BYY B;  4L8J A;  2XRQ D;  3I91 A;  2X6L A;  1CA6 A;  1EIG A;  2F0W A;  1EY4 A;  2WB1 B;  2F0U A;  5DM6 3;  3MWY W;  3HGB A;  4C3I B;  5FK9 C;  4FYD A;  2F3W A;  4XDX A;  2O5I C;  3DEP A;  4A3J B;  1EY6 A;  5C4X B;  1CHQ D;  5FO9 B;  3VR4 A;  1S4Z A;  3J7Y W;  4PMB A;  1BO0 A;  1VCI A;  2K5W A;  3BDL A;  1BCP B;  5CV5 A;  1FR3 A;  5IGE A;  2B2W A;  1SNM A;  4R9W A;  1V43 A;  2NN6 G;  2K5D A;  4X3U A;  5IOC A;  4KJN A;  1H9M A;  1I4H A;  1OO9 B;  1KLG D;  4TSS A;  1TWH B;  1S5B D;  2A69 C;  2LS0 1;  2KEC A;  3I4N B;  1JOO A;  2RSO A;  2Q8I B;  1TKW B;  2KUM A;  5ISR A;  4IUU A;  1JOR A;  5FOB B;  1H9S B;  5A35 A;  2A73 B;  1XX8 A;  1LTI D;  3M7N A;  2L55 A;  3QG1 A;  3KK7 A;  5A2Q L;  3P20 A;  2B2U A;  2FMM A;  4PNY A;  3A55 A;  4DN4 M;  3MHB A;  1PTO D;  2L5T A;  1F2L A;  1DZ1 A;  2RBM A;  1JWS D;  3I90 A;  3CU7 A;  4ID6 A;  1PZJ D;  4HMI A;  3K5M A;  1HRJ A;  1I4Q A;  1BXT A;  2SNS A;  1YNN D;  3NTK A;  1E2Z A;  4Z9C B;  5D14 A;  4IUV A;  5I6W A;  1XYI A;  3EQL C;  4UDU C;  4QF4 A;  2VB3 X;  1D1I A;  4XQQ A;  5ELB A;  4IUQ A;  1TT2 A;  5D3I B;  2FHT A;  1AP0 A;  5EBD A;  2K33 A;  4BBS B;  2F0O A;  1ILQ A;  2XVS A;  3K7A B;  3MXP A;  4IFD J;  5C3E B;  3VYU A;  2F3V A;  1CI3 M;  5M5Y B;  4KY6 A;  3E5S A;  3OWF A;  1SEB D;  2BOS A;  4KN7 C;  3S14 B;  2JA5 B;  1A6X A;  4OGQ C;  3OIQ A;  4HAE A;  2AQ3 B;  3VR6 A;  1SE3 A;  2NTS A;  1SDF A;  4K5V A;  1KDA A;  1O80 A;  1X3P A;  3IFD A;  1VF7 A;  2PZW A;  4IFD I;  3NBI A;  3NXW A;  5IGD A;  1WD0 A;  4K5W A;  1JOK A;  1J8I A;  3WOE A;  5BN3 A;  3K57 A;  4RHS A;  1PRT B;  4F8M A;  2AWO A;  4RCN A;  1K8M A;  2F1M A;  4DAY A;  3J80 L;  2NVY B;  2ICE C;  3CRK C;  4HMJ A;  1EY8 A;  1SMY D;  1PFN A;  4HCE A;  2AQ2 B;  3ERO A;  3RZO B;  5K36 G;  4F7X A;  1SNP A;  4BA2 I;  1J9O A;  2SOB A;  1CA5 A;  2R3Z A;  1TWG B;  2JP1 A;  2C5C A;  4CKE A;  3NSW A;  2KQ3 A;  3M85 A;  2L9H A;  5JPM C;  3GTJ B;  4KI0 A;  1C8C A;  1LT4 D;  3FMC A;  2EY5 A;  4IUN A;  2F0S A;  3TP7 A;  3VA5 A;  1TS3 A;  2VB2 X;  5CR3 A;  2KEE A;  2EYH A;  1F2Y A;  4DGZ A;  2DNE A;  2NVX B;  2JA8 B;  2ZXP A;  2ZXO A;  1KNA A;  3DEO A;  5HUR A;  1HFN A;  1VMC A;  2NN6 H;  1O7L A;  3IKJ A;  1CHP D;  2R7Z B;  1BQQ T;  3OPO A;  1B9M A;  1V8Q A;  2WAQ B;  3GO5 A;  1RF2 D;  1F9P A;  2MJ8 A;  4NDX A;  3E6Z X;  5KEE A;  4RAU C;  1PTO C;  5COY A;  3N6R A;  1TS4 A;  3A56 A;  1TWC B;  2A6H D;  2YYZ A;  5ELC A;  2PO4 A;  4G7Z C;  3D3R A;  3DWA A;  1JWU D;  1YNN C;  1Y8P B;  2IW3 A;  1H9R A;  1DOL A;  3I8Z A;  4CKB A;  3PUX A;  3GTP B;  3K5L A;  2RQX A;  3UI2 A;  1KLU D;  2O2L D;  2D5D A;  3TP8 A;  1F9R A;  2H4O A;  1B53 A;  2MGS A;  5KNC A;  4KV6 A;  4BBR B;  2DY8 A;  3T4A C;  1DD2 A;  2F0L A;  1RCV D;  1G91 A;  5ELD A;  2EVB A;  1R4Q B;  1SBB B;  3FRP B;  1ENC A;  4EVO A;  3A8I E;  1SFO B;  5CYU A;  4KN4 C;  5EPL A;  4J8Q A;  2JA6 B;  1DOK A;  1ENA A;  4ZQ3 A;  2VUM B;  1JE4 A;  5CMD A;  1S5F D;  3V05 A;  3QOJ A;  3C1F A;  2TSS A;  3MEH A;  3S15 B;  3SXH A;  3GP7 A;  1BR9 A;  3EJI A;  1ML0 D;  3H94 A;  4GZY C;  3MAQ A;  2JSO A;  3O13 A;  2R93 B;  4WFN 3;  3KF8 A;  3A8J E;  1Q1E A;  3DMU A;  1BOS A;  4MIU A;  5I9P A;  1D5X C;  4WOR A;  1GUT A;  3NBH A;  2L11 A;  3NK9 A;  4O1N A;  5KRU A;  3FEW X;  1SMY C;  1PLF A;  1WTQ A;  5LL6 X;  1D6E C;  1AEX A;  1PZI D;  4KKU A;  3PUZ A;  4C1N K;  1Q3L A;  1OXS C;  3PMF A;  2CVR A;  4PMC A;  1BCP C;  1WTX A;  1UUP A;  2IWH A;  1ZYR D;  1RTN A;  3N52 A;  1R9T B;  3DM1 A;  2B2V C;  2A69 D;  3U9O A;  2X69 A;  4ZUI A;  3A8K E;  5I9O A;  5K36 H;  2EJG C;  1G29 1;  1SND A;  1EU3 A;  5M9O A;  4FF4 A;  3ERQ A;  3FVQ A;  2B2Y C;  5M5X B;  1B4O A;  3GTO B;  1IHZ A;  4OO1 G;  3VR5 A;  3DXJ C;  4UAI A;  2PW5 A;  1SNQ A;  5T1G A;  5M5W B;  3SVM A;  3VR2 A;  1CK1 A;  2BDN A;  2QDB A;  5IGB A;  3S2H B;  4FVM A;  5IGG A;  2K05 A;  1FNW A;  1UNS A;  4XYQ A;  4U67 3;  1BDO A;  4BWG B;  4ZYS A;  1I4R A;  4AYB B;  2IPK D;  3DHQ A;  5KYL A;  3SR1 A;  1U4L A;  2K32 A;  5EKL A;  1QE6 A;  5EPJ A;  3VR3 A;  2ZXR A;  2E2H B;  5C0X G;  3Q23 A;  1D5M C;  2H1E A;  3PO2 B;  2EPB A;  1SYF A;  5E1F A;  1IW7 C;  1GHJ A;  5IT9 E;  3PUV A;  1Q12 A;  4K8I A;  4N9T A;  5EGT A;  2XRS D;  4RHR A;  1I6H B;  3HKZ B;  1SYG A;  2B2W C;  3D4W A;  1II3 A;  5IIF A;  1G8Z D;  5CV8 A;  5ELE A;  2Z8L A;  5CGK A;  2F03 A;  2VXW A;  1U9R A;  1KDB A;  3FPP A;  3L7Z C;  3SHL A;  3VYT A;  3S17 B;  3BS1 A;  3L9A X;  1OXX K;  1ICW A;  4PMW A;  4KKS A;  4DU9 A;  1X32 A;  2K5Q A;  5C4H A;  4HR7 B;  5LHY 1;  2QCP X;  4EQO A;  2PYK A;  1TVX A;  4KD4 A;  2OT2 A;  4IAL A;  3NHH A;  1CZG A;  1EY5 A;  1HFG A;  1XXG A;  3IAY A;  3OWE B;  1H9S A;  4DA2 A;  5F2D A;  1PFM A;  4XT3 B;  1B44 D;  2B2U C;  2WP8 J;  4EQP A;  3GTG B;  1IYV A;  1WTR A;  5JEA G;  3HZX A;  3LWU A;  2MPM A;  4FP5 D;  1V1P B;  2EYO A;  1L0Y B;  2K6A A;  5E3F A;  2AWN A;  1PRT C;  1LTR D;  4CJ2 C;  2WKD A;  3NP8 A;  5BN5 A;  4A3M B;  3BZD B;  1LTB D;  1NSN S;  1W6K A;  1Z7T A;  4R8I A;  3R93 A;  4OHJ A;  3JAM L;  4C3H B;  4QMG A;  3NWT A;  2ZT9 C;  4BS9 A;  3S16 B;  1KTK A;  4PQX A;  3OMC A;  1MBY A;  1PXU A;  2F0E A;  3QOL A;  3R2I A;  4XTC S;  1QIL A;  1TWA B;  2XN9 C;  4ZRZ A;  2CHB D;  3KLS X;  3K0Y A;  4RFB A;  1QNK A;  1QWY A;  1ZYR C;  1ZEQ X;  2F0P A;  2LKV A;  4ABN A;  2VNU D;  4RKL A;  1RKN A;  5M3F B;  2F0F A;  5CV7 A;  2XWJ B;  2JXM B;  3TN2 A;  5I2X A;  1EEF D;  2WIN B;  1YNJ C;  5HGT A;  3GD7 A;  1FYC A;  4A3F B;  2E2J B;  2F0N A;  2BCO A;  4LMQ D;  3M4O B;  3ITP A;  1MI2 A;  2IX0 A;  2AUJ D;  1PMR A;  3K6O A;  1QCB D;  2L12 A;  2NN6 I;  4KMU C;  2A5H A;  4V19 0;  2RA4 A;  3D4D A;  5M3M B;  1SYC A;  2IL8 A;  4XT1 B;  3T51 B;  3HP3 A;  5KND A;  4OO1 H;  4MN3 A;  5A2Q E;  1BBX C;  3D6C A;  3T56 B;  5C4Z A;  2EYJ A;  2HCC A;  2PW7 A;  1SJH D;  3QO2 A;  1WTP A;  1VDZ A;  4ILW A;  1STB A;  1DJR D;  4MHE A;  3OIP A;  4EQN A;  3VYS A;  1EWH A;  1C4Q A;  1R4P B;  2F0J A;  2O4X A;  3J81 L;  2A6E D;  3QWN A;  5E4X A;  2PPB C;  3MXN A;  5C5M A;  3J7A F;  1EQV A;  5EKK A;  1DXM A;  1C48 A;  3TZU A;  1I3Q B;  2F0K A;  3SK8 A;  2K03 A;  1DM0 B;  4A3D B;  1M4V A;  4HED A;  3H3V C;  2KOL A;  1QB5 D;  3A7L A;  2HDM A;  1ET9 A;  2R92 B;  3KBG A;  4RGO S;  1U4R A;  4IN3 A;  4KKT A;  4OL7 A;  2JEB I;  1OXT A;  4DNT B;  1TS5 A;  2ICI A;  1L0X B;  1NCV A;  2QKI C;  1STN A;  1NR4 A;  2XNA C;  1LT6 D;  4DXG A;  2RDG A;  3MTS A;  3BVM A;  4C3H G;  1IKL A;  3PUW A;  3CHB D;  1IYU A;  4E6I A;  1SE4 A;  4X3S A;  2SEB D;  3PIP 3;  1LLR D;  4IUT A;  1TR5 A;  1BF4 A;  3X3M A;  1BCP D;  1LO5 D;  1RDP D;  4LK1 C;  1JR0 D;  3J80 E;  4DAP A;  5EKI A;  1EYC A;  2E2I B;  1JB3 A;  1MGS A;  4EGV A;  3BVG A;  3AMU A;  1E2W A;  3ND9 A;  1HUN A;  3MVV A;  3L3O C;  5C6A A;  3S1Q B;  4K2L A;  1NR2 A;  2Z4I A;  1PFB A;  5G3L F;  3LNN A;  2BA0 A;  1B50 A;  4P2C B;  2F0D A;  5DNF A;  3TP5 A;  2Q8T A;  2N55 A;  3M4Y A;  2DN8 A;  4CGY B;  4CBV A;  4LJZ C;  5JVG 3;  3E0J A;  4KD3 A;  1EFI D;  2K04 A;  2B8F A;  2M00 A;  1IW7 D;  3WOF A;  2EY2 A;  2K01 A;  2IT1 A;  3NQI A;  4KY7 A;  2E74 C;  4Q0F A;  4RGT A;  4RGM A;  4CJ0 B;  5KNB A;  1GJX A;  1D2B A;  2DNC A;  1Q8I A;  4KK7 A;  3URY A;  4JK1 C;  1PTO H;  1A3T A;  4IUP A;  4ODG A;  1UAP A;  4HSP A;  1DCZ A;  2PCF B;  1WTV A;  5T1I A;  1ONL A;  4HCS A;  2NVQ B;  1QJO A;  1HA5 A;  3LX0 A;  1JQY D;  3HG9 A;  1TU2 B;  5JPN C;  1EOT A;  3D8G A;  1IL8 A;  2A6E C;  3D31 A;  2J4X A;  2M9V A;  2BDO A;  4FO2 A;  2E75 C;  2EOT A;  3BVZ A;  1AW7 A;  1I4G A;  3P75 A;  1TY2 A;  1E2V A;  3T16 A;  1STG A;  4WRD A;  4R8N A;  2MP1 A;  4DAV A;  1A15 A;  3PUY A;  1B2T A;  3MXG A;  4ZUJ A;  1LTS D;  1Y1W B;  3EFX D;  1JWM D;  1F2Z A;  5FLX L;  1UEA B;  4QUC A;  3W2D A;  1GOZ A;  2KHS A;  2EYL A;  3FDT A;  1QOH A;  3OHX C;  1WD1 A;  2BE5 C;  1PRT D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...