1JORA

Ensemble structures for unligated staphylococcal nuclease-h124l
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
149
structure length
149
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords staphylococcal nuclease
publication title Solution structures of staphylococcal nuclease from multidimensional, multinuclear NMR: nuclease-H124L and its ternary complex with Ca2+ and thymidine-3',5'-bisphosphate.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 25
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jorA00
3NHHA 1EYCA 1STAA 1KDCA 2KQ3A 5M9OA 1KDBA 1TQOA 1EZ8A 4KV6A 5EKLA 5HGTA 4KY6A 5KRUA 1EY8A 2F0SA 4HTHA 2F0LA 2OXPA 4K2LA 4ZQ3A 4QF4A 3P75A 1SYFA 2F0KA 4NMZA 4K5XA 5CV9A 2NUCA 4IZ8A 5CV8A 2F0IA 5DAUA 5IIFA 1KDAA 5IGDA 1SYDA 1EZ6A 2SNMA 2PZWA 2F3VA 3SHLA 1JOQA 3QOJA 1SNCA 2EYOA 3BDLA 3RUZA 2F0QA 2PW5A 2EYFA 5J22A 4ODGA 1EY0A 2F0NA 3NQTA 5EKKA 4EVOA 4EQPA 2EYHA 1NSNS 5KIXA 1SNMA 3NUCA 1JOOA 4HMIA 5CV4A 2ENBA 1JOKA 5CV5A 4RKLA 5C5LA 4DU9A 5IGCA 1SYCA 5IGEA 3SK6A 3SK4A 4IUNA 3U9OA 5C3WA 1EY6A 5C6AA 2EY1A 5E3FA 1STHA 2PQEA 3SK8A 2OEOA 4K8IA 4KJNA 2M00A 2PZTA 3D4DA 4NKLA 5CV6A 3D6CA 5J39A 1KAAA 3V2TA 5NUCA 3TP6A 4KHVA 3MEHA 4NP5A 4QB4A 5I6YA 5I9OA 2F0FA 1STNA 4DFAA 4E6IA 1U9RA 5E1FA 2F0WA 3QOLA 3TP8A 4F8MA 5I9PA 2EY6A 2F3WA 3DMUA 4KY7A 4ZUJA 2F0GA 3SK5A 2QDBA 1ENCA 4NDXA 2EYPA 5C4ZA 2KHSA 3MXPA 1F2ZA 4PNYA 5J1ZA 5KGUA 3NP8A 2F0HA 5CV7A 4DF7A 4KJOA 1JORA 1EY4A 3QB3A 1RKNA 1SNPA 3TP5A 4EQOA 5C3XA 1SYEA 3OSOA 3MZ5A 4PMCA 2SNSA 3T13A 1STBA 1STYA 1A3UA 2HQEA 1EYDA 2EY2A 1STGA 4N9TA 2EYLA 4QMGA 1EQVA 1F2YA 5K5PA 2F0VA 2F0DA 2PZUA 3E5SA 4LAAA 1A2UA 4K8JA 3C1FA 1EY5A 3OWFA 4KD3A 2LKVA 4OL7A 5IOCA 4YIJA 5HURA 1ENAA 3DHQA 4MIUA 5KEEA 1A3TA 4IALA 3VA5A 4B9WA 4K5WA 1SNDA 3PMFA 4H7BA 3H6MA 3NK9A 5DEHA 5C5MA 4ME5A 1A2TA 2F0TA 1A3VA 4ID6A 4J1MA 3ERQA 5EGTA 4F7XA 2EXZA 5CGKA 4G57A 5I6WA 4KD4A 5F2DA 1IHZA 5C4HA 3EVQA 4KTAA 3C1EA 4WORA 1EYAA 4R8NA 4WRDA 4DGZA 3EJIA 1NUCA 1SYBA 4J6HA 3HZXA 4PMBA 4I65A 3MVVA 3SR1A 4N9PA 5ISRA 3TMEA 3HEJA 2RKSA 5IGGA 1TR5A 1KABA 3D8GA 3SXHA 5IGBA 3OMCA 1F2MA 1AEXA 4K2KA 1TT2A 3D4WA 5CC4A 3EROA 2F0MA 1SNQA 4KY5A 3ITPA 3MHBA 2O4XA 3BDCA 1EY9A 4HMJA 4K5VA 4S3SA 2RDFA 3P1HA 3R3OA 2WACA 2F0EA 3LX0A 1EY7A 2EY5A 2F0OA 2RBMA 2OF1A 3T16A 2F0JA 3TP7A 1II3A 3NXWA 2SOBA 4ZUIA 3S9WA 5KYLA 4K6DA 2PYKA 5JAVA 2EYJA 2PW7A 3OMGA 4B9XA 5IGFA 2F0PA 4K14A 5IODA 5CR3A 4TRDA 2F0UA 4EQNA 1SYGA 5KYIA 1SNOA 5JOBA 2EYMA 4RKBA
chains in the Genus database with same CATH superfamily
3NHHA 4OX9L 4L5RC 3NENA 3WDNA 3NBIA 1V1PB 3A56A 4QUFA 1B3AA 1XXGA 2WP8J 4RCNA 4LK1C 1SE2A 2IX1A 3I4MG 1N32Q 3PO3B 2B2UA 3HGBA 5IP7G 3HOYG 3VYRA 4MTNA 3ZJYC 1SMXA 2J4XA 4HIMA 4FF3A 2UXDL 3KLWA 2B29A 1MSGA 1PFSA 2PI2E 1P16A 2XRQD 2EJGC 5IGEA 2EJMA 1Y1WH 4DAPA 4FXGC 4POGA 2AMCB 1PH9A 1QWYA 3K81C 1Z6HA 4MTKA 4YHHQ 2PQAA 4DV5Q 2UUBQ 3DLLA 3GTMH 3K80C 1FNUA 3TZUA 4NXMQ 4DR2Q 1F2LA 1KD1C 1F2ZA 4ZKBB 5JJLA 5J1ZA 1WD1A 5IYCH 4JV5L 1AE2A 4GN5A 1JORA 4KJOA 5LMNQ 3NTIA 3IKJA 5A2QL 4RHSA 3T13A 5JPNC 2ALYB 2E5LL 3OW2A 2K32A 1CKNB 2ZXRA 4IUTA 2KHJA 1CKMA 1GXDC 3GTJH 4DNIA 3I4NH 3J7AV 1GHKA 3ERQA 1ENFA 4F7XA 1FJGL 2VQFL 4KD4A 3EJIA 4DAMA 1NR4A 3HZXA 4PMBA 1DONA 1I6VC 4R4OA 4KHPQ 3BDOA 3D4WA 2AHOB 1T5EA 1IYUA 2JK8A 1E0BA 4X62L 2OQ0A 1VF5C 4B3MQ 5T1GA 2F03A 3RN2A 4DAYB 2JE6I 1IL2A 2EXDA 3A54A 2F0PA 4K14A 4IFDH 1OXSC 1SRUA 1SYGA 1VQKA 3PQIA 4A3LG 2ICEC 4QY7A 4C3HG 1I3QB 1VQNA 4OO1I 4KV6A 4UP7A 1N34L 5D14A 1BF4A 1BCPB 4HCEA 3RZDH 3JAMi 1S72A 1SYFA 2EZVA 3EFXD 1VQLA 1BDOA 2VQEQ 5IT9L 4YCWA 5CBAE 2ZJPA 1FGUA 3G71A 5L37A 4A93B 3HOUB 1PTOF 4K6LA 3PIPA 1XPRA 2EYHA 4HJ7A 2B2UC 1RD9D 1TS2A 4L5QA 5CV4A 1TWFH 4AIMA 2NWGA 5IGCA 2IY5B 4AQYL 3SK6A 4IUNA 1SDFA 3U9OA 1D1IA 4XQNA 1GM5A 5C0XG 3M3YB 2OEOA 1PRTC 3D6CA 3I4OA 3V2TA 1ESFA 1MGSA 4KHVA 2NZOA 4DR7Q 1PZJD 3OWEB 1HCZA 1G8ZD 2JJQA 1PFMA 4NDXA 5C4ZA 3F1ZA 1YNND 1YHQA 1CQVA 1L2FA 3CPWA 1XMQL 3ICEA 2ZTDA 2IWHA 4X64Q 5C3XA 4EQOA 4F88A 3ND8A 1BCPF 1XJVA 2A6HD 1LTRD 3E5SA 5JEAG 2CW0C 3S1MB 1QCBD 3GTGB 5K36H 3HOVB 4MIUA 2AQ3B 1A3TA 1JWMD 2B8GA 4B9WA 4K5WA 2MQHA 1JE5A 3U9SA 4DV3L 4BY7G 5BR8Q 2JA8B 4EX5A 1CZGA 1I4QA 4CDEC 3T1HL 2BE5C 1YNJD 1GUWA 2UUAQ 4R8NA 2LXKA 4DGZA 3M7GA 1GHJA 2A69D 4PV1C 5ISRA 1WJJA 2RCNA 3PUYA 5BN5A 3OMCA 5AFWA 4YWKA 4DR4L 5C4JH 1GUNA 1C0AA 2EE1A 1X56A 3LWEA 4UP9A 3HOZH 3PIO3 1TWCB 4P73A 2EYMA 3R93A 1I5FA 2XVSA 4GKKQ 2KA7A 5C3EG 4UY8C 4G4KA 4IUQA 1IW7D 1VQ6A 2F0LA 3MXNA 1WTQA 1HNZQ 1JCKB 4QIWB 4HJAA 4IZ8A 5CV8A 2O5JC 4X6AH 2H1EA 1PVOA 1MJCA 3T53B 3VYUA 5J22A 1Q81C 3FKIH 3PIP3 1L1OA 4GOPA 3DXJC 1TIID 4OWTB 2VB3X 2Z6KA 1EY6A 4JG2A 4QIWE 4DV6L 4HJ8A 3PUZA 4KJNA 1OO9B 2M00A 3I2ZA 2N8NA 1G51A 5G3LF 1SR3A 3MEHA 4DXGA 1W6KA 2HHHQ 2F0FA 3C2PA 5E7NA 1J5EQ 4JOIA 4LF6Q 3EQLC 4F8MA 4B3TQ 3S1NB 4G7HC 4RGNA 4CKEA 4FXDA 3HP3A 5TSSA 3GDEA 5GROA 4CHTB 1PDQA 2JA5H 1NNXA 3KYHC 3TP5A 3CW2C 4H02A 3MWYW 4PMCA 1QVFA 3AFQA 1STBA 2EY2A 2KBNA 1GVPA 4J15A 4X66Q 1V43A 1HRJA 4C1NI 1ENAA 2DY7A 4JBJA 2R7ZG 1H9MA 4BY1G 3K8AA 4IOAA 4G7OC 2RSOA 4A4IA 1H9SA 1SNDA 3DWQA 3TS0A 4JK1C 1E3PA 2KHIA 2YTYA 2DN8A 2I07B 3CCVA 1I6HH 4G57A 5IYBH 2EPBA 4ZAIA 2NN6H 2Q8RE 2E75C 3SEBA 1E22A 4JI0L 1H9JA 2K5VA 4OIKA 2WIIB 3U4ZA 4LF8L 3VYSA 3UE0A 1WTPA 1KABA 3AMUA 2XTIA 5JJZA 1XNQL 3ERSX 1IBMQ 5CC4A 2R6GA 2O4XA 3S16B 1E2WA 3PUWA 1HZAA 1CM9A 2G5DA 3JAMc 3I8ZA 4C2MH 2F0JA 1HNXQ 1YNXA 2CQAA 1WTVA 1LT5D 1J6QA 1SN8A 4FVMA 3S1RH 2R93H 1JB3A 2HIXA 3G6JB 2D62A 3D3RA 3FDTA 3L2PA 4A3KH 4ABNA 2L11A 3GTOH 3GO5A 5KRUA 1SEBD 4IPHA 5IYBG 3KJPA 2D0PA 4LF7Q 4BXXH 2NTSA 2QEJC 2DUDA 4OONA 1VQPA 2XRSD 2PZWA 2PQAB 4AYBG 1XYIA 4HIOA 2F0NA 4LJZC 5FLMG 1HUNA 4DV0Q 1JOOA 2NVQB 1TY2A 1IZ6A 3IFDA 5D3IB 3GV3A 3S14H 4AYBB 1L1OC 4GN3B 5C3WA 4O2DA 1HJPA 5EPLA 2NVXB 4PMWA 4GOPC 3C46A 2K01A 3G6EA 3FPUB 2YYZA 3TP6A 2UXBL 2Z6KC 2QKIC 5LMNW 5IT9E 2FXQA 1YJNA 5KNDA 3K7AB 2F4VL 3KUPA 3L7ZC 4TKOB 4XQQA 1Z47A 3ZYYX 2WAQG 1SFOB 2GN5A 3CMAA 2NVTH 3NP8A 4AYBE 4JI6L 2IT1A 4JI4L 1JWUD 2DY8A 3H0GB 4HIDA 3HKSA 1PYBA 1T5XD 4M8AA 4A3GG 2F0VA 5M5WH 4GKJL 2L55A 1A0IA 3C1FA 1Z7TA 3GTPB 4LWCA 1CFMA 4J8QA 1Y8OB 4YIJA 1BXTA 4PQXA 1Q8IA 3TS2A 2WB1G 1CKOA 2Q8TA 4A3GB 2JQOA 3VR5A 1A3VA 1B3QA 3TBIB 5C0XJ 4LFCL 3ULLA 2MNAA 4KLKA 4IFDI 2WB1B 2DJGC 1O7LA 3NTHA 4RH6A 1XWEA 3NEMA 1DZ1A 1VQIA 4K2KA 3J7ZC 4WJ4A 1U0LA 4HSVA 3ITPA 3MHBA 1KXLA 1QNUA 1B53A 2EY5A 1M90C 4DUZL 1CK1A 3FP9A 4C3JB 1WCMB 3TP7A 1NBWA 2BH2A 1BBUA 1JB7A 5JAVA 1O78A 4IUPA 5FJ8G 2QCPX 3HOXG 2WB1E 3LGJA 1D5MC 5JEAJ 5C4XH 2MUYA 4QUCA 5M9OA 1KHIA 1ET9A 3CCQA 1LTLA 1LUZA 4HTHA 3HOXB 3VR3A 4JYAL 1FL0A 4JI5Q 1FD7D 1WTHA 3CF5A 1IBKQ 1UEAB 4LW1A 4DA2A 1B9NA 4ILWA 4BBRB 4XQJA 1I4XA 2F3VA 4DR5Q 1RJTA 3RUZA 1YBYA 4LF9Q 1A6XA 3NQTA 1VQ4A 3A8JE 4HMIA 3B6YA 1VQBA 2HIVA 3L9AX 5GAGC 1SYCA 1L0XB 3I55A 1PH6A 2B8FA 5ELFA 1BBXC 4P71A 5C6AA 4X3UA 2RF4A 1PXUA 3T4AC 3I90A 1LM0A 4V0BA 2VUMG 1QILA 4CJ2C 2NYZD 2D9UA 4LF5Q 4RWSC 3CCLA 2L0CA 2KUMA 1M4VA 1U9RA 2JA6G 4R4TA 2A5HA 2F3WA 5EBDA 1V9PA 4KKUA 1ENCA 3TZDA 2EYPA 4A3MG 3D4RA 4PNYA 5ELDA 1YNNC 1HPCA 2SEBD 3QB3A 4IUUA 2JA6B 1Q3LA 3A0JA 2ES2A 1HXYD 4A3EH 1EYDA 3H3VH 4A3MB 4HIKA 2A6HC 2L5TA 2UUCQ 4GLXA 4H44C 1VF7A 1N32L 1W3SA 1Y1VB 1S4ZA 4FF4A 5C44B 3URYA 3OTOQ 3NK9A 4KI0A 3U50C 4OWXB 5ELEA 1O7IA 3T56B 3HOWG 1YNJC 4MHEA 1VQMA 1JE4A 1H9RA 1EYAA 3U58A 3K6OA 1PA6A 1BBWA 4I65A 3SR1A 2A69C 4DV4L 1UE7A 4A3FG 2K1BA 1BQQT 4X65L 5LMUQ 4PZ8A 4HSPA 3KJOA 3PUVA 5EBCA 1IKLA 4NXNL 2VW9A 3PV0A 4IURA 1ILQA 4ZUIA 2PNRC 1UWVA 2YU9B 1YJWA 1X3EA 2XWBB 2C9OA 3R2IA 1ET6A 1VQ8A 1SNOA 4OIJA 4CBVA 5LMNL 1G91A 2P5ZX 4DV7Q 2MGSA 2JA7B 1K0SA 2EJFC 4NW2A 1D1KA 1WTXA 3JAML 1XMOQ 4FDBA 1L1OB 3RLOA 4FO2A 1VQAA 1O7YA 1ZKOA 1IW7C 3L3OC 4GNXB 2K50A 1EZ6A 1FVIA 2JP1A 3PO3H 1QE6A 3KF8B 3UDFA 2PNHA 4A3DH 1HA5A 4A3BB 1NTGA 1DOMA 4O42A 4DU9A 3VA7A 3AQQA 4DV1Q 4DNTB 2XN9C 1ASYA 5EQ0A 1FR3A 3NTKA 3K57A 3CD6A 1GJXA 2E2IB 4XT3B 5I2YA 4NKLA 3ULPA 4A3JG 2K5NA 2FINB 1LTID 4OXPA 2JEBI 1CTMA 4B3ML 1IYJB 2KVMA 1JR0D 2B63G 2HD3A 2ZJRA 5LL6X 1PZKD 3U4VA 1QUQA 2R92G 2ZM6Q 4KY7A 2E2HB 4A3JB 2OT2A 1K3RA 4BA1I 2K28A 3I4MB 2A6ED 2QA4A 4QCLA 3J81c 1N36L 1B4OA 3HOYB 4A3DG 1I94Q 1KLUD 2F0DA 5T1IA 4JCVE 1HZBA 1EQQA 1SLJA 2VQEL 3DHQA 2AUKA 4ME3A 3X3MA 1KRSA 4X3TA 3UDXA 1IBLQ 1Y8PB 5AJ3L 4ID6A 1U4LA 3EVQA 4U673 1CUKA 4LFAQ 3ND9A 2E2JB 1W6JA 3D8GA 3S2HH 2N3SA 4GN4B 4KY5A 1X3GA 4B9XA 1Y1WG 4K5VA 2WACA 3NQIA 3LX0A 2CWAA 1LTSD 3OOCA 3MEFA 2ID0A 2XSCA 2CQOA 3KFUA 3S9WA 1ML0D 4FF1A 2MPMA 1PTOB 3BJUA 1Y1WB 3GV6A 2L15A 5IOCA 4X64L 3V96A 2K33A 1HQRD 3GTKB 1Q82C 2ZTCA 2K5HA 5M3FH 5IYCG 3C3LA 1B44D 5IIFA 3H15A 1RTNA 3SHLA 2GA4B 1EQTA 1JMCA 3KK7A 3RNUA 2PW5A 4JBWA 1WFQA 2C35B 4C1NK 5BR8L 3PIOA 4YY3Q 4A93H 3HOUH 3CCSA 1K8MA 3NELA 2BDNA 2IW3A 1K3BC 1CA5A 4DK6C 1IXRA 3G7LA 4K0KQ 1NMGA 3I4NG 4IOCA 2FHTA 3PSIA 2ZT9C 1PV4A 2EY1A 1STHA 4PZ6A 1ESRA 1KAAA 3M3YH 1GOZA 3AEVA 2KCTA 2NVYH 5I6YA 4C3HB 4DFAA 2UU9Q 5FO9B 1EWHA 5IWAL 1Q12A 2KHSA 4JI8Q 4LF4L 1QVCA 2ATWA 2MP1A 3TREA 4GKKL 4L6TB 3D6WA 3OSOA 4IPGA 4IFDG 2NZ1D 3W1BA 1STGA 1UE6A 1HNZL 4LFBL 4KD3A 3A8KE 1VMPA 1G6ZA 3S1MH 2VZAA 3GTGH 3BVGA 4N8X1 5C5MA 2IHFA 4HJ9A 2L12A 5EGTA 1LV9A 2EVBA 2EXZA 1ZEQX 2LFNA 4B08A 4JV5Q 5ELNA 2JA8H 5DM63 2B2TA 4ZYSA 1E24A 3W2DA 4CDDC 5DNFA 1EWCA 4Q5VA 5IGBA 2E5LQ 4AH6A 3S2DB 4OHJA 1LT3D 3CRKC 1EFID 3J80i 3CC7A 2HHHL 1SXTA 1J5EL 2RBMA 2UXCL 1NY4A 4JBKA 2V1CC 3J7A5 3IFTA 5KYLA 2AQ2B 5CR3A 1FJGQ 1N33Q 2VQFQ 4DK1A 1TWCH 1PYSB 1GD7A 4KN4C 1HZ9A 2Z9HA 1R4QB 2N78A 1KDCA 4L5SA 1XTDA 1ZXTA 3BVZA 4G7ZC 4BY7B 1B8AA 3DEOA 3DUZA 2D2CC 4RA8A 4X66L 5EAYA 2F0KA 5CV9A 2F0IA 4X62Q 2XGTA 2SNMA 1JOQA 2EYOA 5IE8A 1S5CD 1B9MA 3FHWA 5K36G 2PO4A 5EKKA 3KLSA 2B2WA 2NZHA 3LNNA 3ULJA 1VQJA 1JWSD 2A8VA 2BOSA 3GTQB 2CFMA 1E1OA 4BBSH 3CXCA 3MA2B 2BCOA 5E3FA 3MC0B 3E0JA 3NBHB 4KMUC 3JAME 1IBML 1OXXK 2OWOA 3GTLB 1O80A 3EA6A 1V8QA 3E0EA 2I46A 1N9WA 4R8IA 5C3EB 5JVH3 3JC66 5I9PA 2XWJB 4H0LC 1E2ZA 4OGQC 3TN2A 2QDBA 5LHY1 3A55A 2LSSA 4IN3A 4DF7A 1DCZA 1MD2D 4IJHA 3HOZG 1WD0A 1D5ZC 1VMCA 1FNVA 5CV7A 2EQSA 5C4JB 3M4YA 4R4CA 4JI1L 4IO9A 3S17H 1DM0B 4HCSA 4DV2L 3A7AB 4K8JA 1G291 4DUYL 1CSQA 1TWAB 4IJLA 3CCRA 3I3CA 3PF5A 1VQFA 3J81L 2K05A 4ME5A 2F0TA 3MAQA 1Q86C 3BZKA 2RSNA 4Q0FA 2HT1A 1A8VA 2M2LA 1EIYB 5F2DA 3BYTB 2F4IA 3FKIG 4A3IH 2E76C 3HEJA 3V05A 5IGGA 4FNFA 3NPPA 3SXHA 1F2MA 1TT2A 3EROA 1SNQA 4DR6Q 1JJ2A 2B2TC 1ILPA 1KAWA 5FLXc 1UEBA 3A7LA 1CHQD 2OF1A 2EDGA 4Y7NH 2FMMA 4DV3Q 1PH3A 3S1QB 4HEDA 4UDUC 1Q1BA 2A19A 2JYOA 2R7ZB 4BY1B 5HGTA 3PO2H 2JN4A 4K2LA 5A2QE 2JA5G 3CAMA 4LMQD 1C48A 3EBEA 3F2DA 4DR4Q 4K5XA 4A3IG 4L8JA 5ELCA 4HJ5A 1LYLA 3BS1A 1XNRQ 3T1YL 1EIGA 1L0YB 1A15A 5I2XA 1PH1A 3TDQA 1NSNS 4FP5D 1EIFA 2OTLA 3NUCA 3CQZH 1LTAD 4JW0A 2I0QA 1SJHD 1QUQB 2B2WC 4EGVA 3CHBD 4TVAB 1D7QA 2NN6G 1HR0Q 3X3NA 1ASZA 2KENA 1PRTB 5E4XA 1X3PA 5D65A 1Y8NB 1ZYRD 1DYQA 4XYQA 3M4PA 3G48A 4JI7L 5M5YB 1CKNA 2J7ZA 3K7AH 5KGUA 1WI5A 1TS3A 3F2UA 3H3VC 2OTJA 2A6EC 2Z6BA 1SFOH 1RKNA 2FMCA 1SAPA 2R93G 3HS0C 4HAEA 4QMGA 2EYLA 1E2VA 3H0GH 4B3RL 4A3KG 4QGUA 4JI5L 4OL7A 2PPBC 4DR5L 5KEEA 3F8TA 4JI2L 4BXXG 1H95A 5KNBA 3J80c 3G4SA 1FGBD 4A3KB 1K83B 1LT6D 4KKTA 1SSOA 2MFIA 1AFPA 4YWMA 3GTOB 3I70A 4GLAC 4ULLA 2I5MX 3BZCA 1YI2A 4XYOA 3ER0A 3RZOH 1NUCA 1SYBA 1AZPA 1LABA 4DAYA 1TWGH 1UE1A 2QF7A 4R4QA 1PRTF 1AEXA 2WAQB 4EQNA 4LF5L 3CCEA 3P1HA 1OXTA 2F0EA 2LY7A 4JBMA 1EY7A 2F0OA 1VQHA 2YV5A 3CCMA 2BA1A 2CH4W 2EYJA 4R9WA 4C3JH 4IFDJ 1WCMH 2FJ2A 2Q8IB 1OTCA 4OO1H 4CKCA 4JI0Q 1RHPA 3K0XA 1HFNA 3E6ZX 2K75A 2CCZA 1KQSA 3BZDB 3AFPA 2WAQE 4CJ0B 1LTGD 4MZ9A 4LF8Q 2UUCL 5E4WC 3K5OA 3BU2A 3WOFA 1D8LA 1DXMA 2Q2IA 1XNQQ 4QF4A 1X3QA 1F9RA 2Z0SA 4X3SA 2B3GA 3RN5A 4APVA 3TRZA 1SJED 1SNCA 1QOHA 3S15B 1CT1D 1VQDA 3QO2A 4BBRH 5A35A 4ZCKA 5IY0A 1STEA 2K5WA 1K28A 1E1TA 5IP9H 1NJIC 4CDCC 4DR1L 4JI3Q 3SK4A 5M5WB 1PLFA 1EWIA 2Z4IA 3A74A 4GLVB 5CV6A 5LMUL 1NR2A 1EEFD 3WOEA 1WVLA 2HDLA 1RF2D 3AB9A 4A76A 4WJWA 4B3SL 1HHVA 1CI3M 2AWNA 1XTCD 1CHPD 2OCEA 1XPOA 1EY4A 3RD4A 1AH9A 4DN4M 3VR6A 2N55A 5FO8B 3LWUA 3I4LA 5C4XG 3OWFA 3PUXA 4QQBX 2K7VA 4C3IH 2C5CA 1Y1VH 4X3KA 1VQCA 3VR4A 2VUMB 1I50H 5C44H 4JI6Q 1IHZA 4KTAA 5M3MH 4DV1L 1BOSA 4JI4Q 4O1NA 4RCOA 1NAPA 2G9HD 4EQ5A 3TQYA 1A63A 4RGOS 5IYDH 3CU7A 1MSHA 4GKJQ 3FEWX 5D3DA 2WKDA 4A3CH 2JXMB 5KNCA 1TWHB 1S5FD 3T16A 1YEZA 2LXJA 1V1QA 3J81E 3QWNA 1KNAA 1TXYA 2F0UA 4TRDA 1EOVA 4LFCQ 4C3IG 5JOBA 1KIXA 1YZ6A 3O13A 3SVMA 3HKZG 4F87A 4ZRZA 5FLXL 1SE3A 1BCPC 3NWSA 2JA7H 4YHHL 5M3MG 4DV5L 2UUBL 1MI2A 2X6LA 5HGQA 3HOWB 1X54A 2VB2X 1BR9A 4DAVA 3MFGA 4A3EG 2K5QA 2YTVA 1SMYD 1IBLL 3FVQA 1EQRA 2D5DA 1O7ZA 4WFN3 3HG9A 1E7ZA 3MXNB 4NXML 4DR2L 3M4OH 4A3FB 1EOTA 2QW7A 3UDIA 3E3XA 5JJIA 1I4PA 1TS5A 4RKLA 1PZID 3A5ZB 2DNEA 4A3BH 4NPSA 2B2YC 1VQOA 2PQEA 1C8CA 1JQYD 4JYAQ 5JVG3 2PZTA 2Q2TA 4GOPB 1WTOA 1YHBA 3KF6A 4M1UB 5CORA 4LNQA 1RDPD 2E2IH 3IAYA 1STNA 4L63B 2VL6A 2AUJD 1R9TB 4RHRA 4FYDA 1DJRD 4RAUC 4KKSA 2E2HH 1PMRA 1M8AA 3CCJA 1SNPA 1IYVA 3I4MH 4FF2A 1T9HA 4JPBW 3MZ5A 1KTKA 4KHPL 5IP7H 1G2TA 3HOYH 3QG1A 2TSSA 5BN4A 1VQ9A 1Y69U 4RFBA 1YIJA 2JEAI 1F77A 2CHBD 1S5ED 3VA5A 4R4IA 3PMFA 3DWAA 2WINB 3KOJA 1M1KC 1KL9A 4ZLTF 2RHQB 1GUTA 3FRPB 1EFWA 2BH8A 3PO3G 2L4NA 5M5XB 5COYA 1KRTA 1H9SB 2B63B 4WJ3M 2NN6I 1QJOA 2R92B 3J80L 4UHVA 2H5XA 5FO7B 2E2JH 3BDCA 1SE8A 3GP7A 1FNWA 4JC0A 4DNRB 1X32A 2J0TD 2UU9L 4A3DB 1B2TA 4K6DA 2PYKA 4JI8L 2R7DA 1JICA 1BNZA 3A8IE 1PTOH 2QEXA 1WOCA 3KBXA 3DM3A 1H9KA 1KDBA 1QZHA 1NE3A 1P8LA 4DV4Q 3H94A 2F0SA 1I4GA 3GTKH 3K5MA 2PCFB 3P75A 4NMZA 2QGQA 3L0OA 4X65Q 5DAUA 4NXNQ 1KDAA 5IGDA 2IJ0A 4O0AA 4A75A 4DR7L 4XIGS 3Q8DA 3HRZC 1K0RA 2KCCA 4EQPA 3MXGA 1HR0W 1YJ9A 1JOKA 2R61A 1C9OA 1PHJA 2TMPA 4XXEA 1WTRA 3SDZA 1EIHA 5J3BA 1HH2P 1I3QH 3GTMB 1DOKA 1HNWQ 1AW7A 3K58A 4DR3Q 1ZYRC 4E6IA 4A3LH 2PMZB 1U4MA 3D31A 4C3HH 3DMUA 3I91A 2E8GA 1N33L 1AZQA 4MNOA 1OXVA 1K8OA 4CGYB 4GZYC 2UUAL 2ZJQA 3UI2A 2XNAC 1SYEA 4Z9CB 4OX9Q 3S2HB 2E74C 4CDFC 2PZUA 1SBBB 3GTJB 4UP8A 2LKVA 4FXKC 5JJKA 2PMZE 2VS1A 3I4NB 2GVAA 5M3FG 4PG3A 5BN3A 1QZGA 2JSOA 2UXDQ 2RVLA 5C0XH 2R3ZA 2IX0A 4R1JA 4LUOA 3C1EA 5M3FB 2LS01 3QR8A 1AE3A 1I4RA 1S5DD 1Z9FA 1N36Q 1QG7A 2GVBA 4A93G 3HOUG 4UAIA 1TR5A 4QL5A 2RDHA 1F9PA 4HMJA 3S2DH 1ICWA 1HFGA 5GAEC 3OIQA 4HR7B 1HTLD 5AJ3Q 3NXWA 1PTOD 1Q7YC 4BWGB 3HOVH 5ELBA 2Z8LA 1MIUA 1RTOA 3MXUA 1YVCA 5JEAH 2O5IC 1EYCA 4CKBA 1NMFA 2KQ3A 2K4KA 3RZDB 1QB5D 1EZ8A 1F9SA 3KDFA 4KY6A 3TSSA 1EY8A 2KJXA 2NVYB 2RQXA 2Z1CA 3RLNA 3SGIA 4BY7H 1RL2A 2NUCA 3M9BA 3NWTA 1YITA 2VXWA 4RG1A 3QOJA 3R8BA 2F0QA 5HY6A 4LF6L 4B3TL 1PFNA 2EYFA 1EY0A 1LO5D 1AN8A 1TWFB 4EVOA 5DLQE 2DGYA 1WYDA 2KEEA 5CV5A 2ENBA 2MO1A 3HOVG 1D2BA 1BCPD 3BG3A 5FLXE 3GTQH 1X55A 1VDZA 3D4DA 4DR6L 2JA8G 3K0YA 1DOLA 2A68D 5NUCA 2NBFA 1R4PB 1B1ZA 5I9OA 1PH5A 3GTLH 2F0WA 3QOLA 1PH2A 5FK9C 2RCFA 5C3EH 2F0GA 3BVMA 1PFBA 3A5UA 1JJCB 2ZTEA 2I5LX 4KK7A 3F2BA 4P74A 1VQGA 1STYA 4N9TA 1JJGA 1N34Q 1MHWC 3H3VI 3F2CA 3Q6SA 1XNRL 4IALA 1DGSA 1C7YA 1HNXL 1UE5A 2YTXA 3IL8A 3UDGA 1TWAH 4J1MA 5IWAQ 2N88A 2ZXPA 4LF4Q 1EU3A 5I6WA 1JC7A 3S1NH 4AQYQ 2K03A 1HR0L 2K6AA 4LF7L 4LFBQ 4DPGA 1GUGA 3K5LA 3R2TA 1Q1EA 5EPJA 4BBSG 3J7YW 3HOZB 1F9QA 4YCVA 2WKCA 1GUSA 1ICFB 4DXFA 3J7AF 2DJFC 2G9DA 5IGFA 2V4DA 2K04A 3E9IA 4IPCA 4DV0L 4BBSB 4IQZA 4GNXA 4RKBA 2EOTA 3S1QH 1XMQQ 2D0OA 1UAPA 5DM73 1TVXA 3SE0A 1GKHA 1PH8A 2B2VA 1EU4A 2R7ZH 1VCIA 1XX8A 4BY1H 1AP0A 1RIPA 2RA4A 3J80E 1QNKA 1K8GA 3KF8A 5G3LD 3S24A 4I7AA 2UXCQ 1SMYC 3FKIB 3DWPA 3S16H 2PI2A 3KF6B 4U68A 4H13C 1V1PA 3VR2A 4UPAA 3BYYB 1SNMA 3T1HQ 5EJWA 3S17B 1GUOA 1U4RA 2SDFA 5CMDA 3FMCA 3TEHB 2I5HA 1C4QA 3MFYA 3GQBA 1K9MC 3I56A 4K8IA 4V190 2H4OA 4L5TA 1J9OA 3DM1A 1YHAA 1KNEA 4QB4A 1TKWB 1VQ5A 3STBC 3QJYA 3TP8A 2CVRA 2Q2UA 4XDXA 2Y0SG 4IUVA 5CBEE 2JA5B 2M9VA 4A3IB 3HFZB 1MKHA 5M5YH 1Q46A 2N49A 4BA2I 3K7UC 1HQMC 2Y0SB 3M4QA 2NVQH 2XIWA 2ZXOA 4ZKCB 1BKBA 2MO0A 3WWVA 1EQVA 1S5BD 4Y7NB 2RHSB 2NVXH 5FLMH 1Y14B 2R7FA 5HURA 3PO2G 2KEDA 3DEPA 1A62A 3H91A 4POFA 4H7BA 1QVGA 5DEHA 1I6HB 1A2TA 5GADC 4MN3A 1B50A 1D6EC 5CGKA 3CC2A 1K83H 2L9HA 4JI3L 2Y0SE 1X9NA 3PO2B 4WRDA 4RGTA 3MVVA 4CJ1B 2RKSA 3NSWA 4JI1Q 4DV6Q 3IRBA 2WFWA 2HCIA 4DV2Q 1UUPA 1LTBD 4C2MB 4DUYQ 2RDFA 3R3OA 1IBKL 1D5XC 2RDGA 2R93B 4YCUA 1RODA 3S1RB 1HUMA 1GO3E 3GTPH 3CKIB 1II3A 1BVSA 3CQZB 4LF9L 4A3GH 3W5OA 5KYIA 3J81j 3Q23A 4P75A 4OEMB 1DD2A 2BDOA 1J8IA 4GNXC 4YWLA 4ZQ3A 5GAHC 3OHXC 2A73B 3RMHA 3D0FA 1S3OA 1TS4A 1U5KA 2B2VC 2BA0A 3GD7A 3H0GG 4QJFA 1N8RC 4ODGA 3P20A 2F1MA 3S15H 5KIXA 3S14B 3AYHB 1EUJA 4JOIC 2IX3A 4NB3A 3OYYA 3M7NA 2ICIA 2HCCA 3W1GA 1PRTD 1B7YB 1K8AC 3CP0A 2F3IA 4TSSA 3T51B 5FJ8H 4KHZA 3HOXH 2KCMA 3AU7A 3OTOL 3T1YQ 2A74C 1PH7A 2NVTB 4OWWB 4GS3A 1SROA 3J81i 1S40A 2X69A 3RZOB 3MXPA 3I73A 5JPMC 1B70B 2K14A 3KLRA 2MJ8A 2B2YA 1TWGB 3CCUA 1ONLA 2X6GA 4N8FA 5C0XI 4C3JG 4ALPA 1WCMG 2SNSA 1TY0A 1HA6A 3M85A 4OO1G 3FPPA 4LAAA 2CW0D 2K52A 4I7ZC 2Z4HA 2VNUD 2VY3A 1IKMA 1TU2B 2EIFA 1VQEA 2FFKB 4JI7Q 2CWPA 3CMEA 2NB0A 2OQKA 4ZK9B 1BUVT 2BE5D 3PGZA 1Q90A 1CZWA 5EKIA 5C4HA 3P7JA 1IL8A 1FYCA 2VUMH 4DV7L 3PCOB 4BBRG 3OIPA 2KCNA 4N9PA 2IL8A 1HNWL 1XMOL 3TMEA 2IHEA 3E9HA 2JA6H 5IP9G 1LACA 3VYTA 4B3RQ 4RMFA 1LTTD 2AKWB 1EY9A 4A3MH 2UXBQ 3KDFB 5H1SE 4JI2Q 5LL6S 2K5DA 4XT1B 3RR5A 2SOBA 1PTOC 1LLRD 1LT4D 2KOLA 1TWHH 2L1BA 2PW7A 3OMGA 2F4VQ 5IODA 2QILA 1MBYA 5C4XB 5IT9c 4HN7A 2B39A 3N6RA 2CH4A 3CC4A 3N52A 4P72A 2HDMA 1STAA 3EN2A 1TQOA 3I7FA 5EKLA 3VDYA 1HZCA 1X3FA 2OXPA 3H09A 2A1AA 3ONAB 4OELB 5ELOA 1OXUA 1VQ7A 3PF4A 1SYDA 4RGMA 2HQLA 1W2BA 3HOWH 3BDLA 1PH4A 3EIVA 2ZM6L 1PYWD 4KN7C 3CPFA 2Q2HA 3NBHA 1EEID 2MHVA 2E2DC 1L0WA 5C5LA 2HUGA 3CRLC 4TQUS 5CYUA 4C56C 4DK0A 4A3FH 1K73C 2YU9H 2LMCB 1Y1VG 1VS0A 4P2CB 1UNSA 3KLSX 1MJEA 5C44G 1KC8C 3SK8A 1I94L 5J39A 1CA6A 1EYGA 2F52A 4C3IB 4XTCS 2A68C 4DKAC 4NP5A 3HKZB 1HTPA 5FOBB 4DUZQ 1I50B 5IYDG 5E1FA 1SE4A 1BO0A 2EY6A 4DK3C 2KECA 3K59A 5GQOA 5M3MB 4ZUJA 3SK5A 2DNCA 1RCVD 1R9TH 1JT8A 4A3CG 2WV6D 2F0HA 3I72A 4A3EB 2AWOA 4DR1Q 2CKZB 4LFAL 2QDLA 3W3AA 1I4HA 1A3UA 2HQEA 1F2YA 5I4DA 5K5PA 1XPUA 1A2UA 1CSPA 4LUVA 3HKZE 4BS9A 1EY5A 2AQ1B 3RLFA 1CQFA 5EPKA 2NTTA 2JA7G 1G2SA 1KLGD 4JVZA 3STBD 1X6OA 3H6MA 1G6PA 4B3SQ 2JA9A 1X65A 3MTSA 1WTWA 5FKAC 4IPDA 4WORA 4A3JH 3OW7A 3NE5B 1EL0A 1Q8KA 4J6HA 1V1OA 1NCVA 2O2LD 5M5XH 4Y52H 3QIAA 2B63H 2IPKD 4PZ7A 2F0MA 3Q22A 1U4PA 2R92H 3OPOA 3Q0AA 4A3BG 4S3SA 4DR3L 4LUZA 3M4OB 3KBGA 3K5NA 3Q24A 4YY3L 3UE1A 4K0KL 2ASBA
chains in the Genus database with same CATH topology
3NHHA 3WDNA 3NBIA 1V1PB 3A56A 4QUFA 1B3AA 1XXGA 2WP8J 4RCNA 4LK1C 1SE2A 2IX1A 3PO3B 2B2UA 3HGBA 3VYRA 2J4XA 4FF3A 1MSGA 2XRQD 2EJGC 5IGEA 2EJMA 4DAPA 4FXGC 1QWYA 1Z6HA 1FNUA 3TZUA 1F2LA 1F2ZA 4ZKBB 5J1ZA 1WD1A 1JORA 4KJOA 3NTIA 3IKJA 5A2QL 4RHSA 3T13A 5JPNC 2K32A 2ZXRA 4IUTA 1GXDC 3J7AV 1GHKA 3ERQA 1ENFA 4F7XA 4KD4A 3EJIA 1NR4A 3HZXA 4PMBA 1DONA 1I6VC 3BDOA 3D4WA 1T5EA 1IYUA 1E0BA 1VF5C 5T1GA 2F03A 2JE6I 3A54A 2F0PA 4K14A 4IFDH 1OXSC 1SYGA 2ICEC 4C3HG 1I3QB 4OO1I 4KV6A 5D14A 1BF4A 1BCPB 4HCEA 1SYFA 2EZVA 3EFXD 1BDOA 5IT9L 5CBAE 4A93B 3HOUB 1PTOF 4K6LA 2EYHA 2B2UC 1RD9D 1TS2A 5CV4A 2NWGA 5IGCA 3SK6A 4IUNA 1SDFA 3U9OA 1D1IA 4XQNA 5C0XG 3M3YB 2OEOA 1PRTC 3D6CA 3V2TA 1ESFA 1MGSA 4KHVA 1PZJD 3OWEB 1HCZA 1G8ZD 1PFMA 4NDXA 5C4ZA 1YNND 1CQVA 2IWHA 5C3XA 4EQOA 4F88A 3ND8A 1BCPF 2A6HD 1LTRD 3E5SA 5JEAG 2CW0C 3S1MB 1QCBD 3GTGB 5K36H 3HOVB 4MIUA 2AQ3B 1A3TA 1JWMD 2B8GA 4B9WA 4K5WA 3U9SA 2JA8B 1CZGA 1I4QA 2BE5C 1YNJD 1GUWA 4R8NA 4DGZA 3M7GA 1GHJA 2A69D 4PV1C 5ISRA 3PUYA 5BN5A 3OMCA 5AFWA 1GUNA 2EE1A 3LWEA 3PIO3 1TWCB 2EYMA 3R93A 2XVSA 2KA7A 4G4KA 4IUQA 1IW7D 2F0LA 3MXNA 1WTQA 1JCKB 4QIWB 4IZ8A 5CV8A 2O5JC 2H1EA 3T53B 3VYUA 5J22A 3PIP3 3DXJC 1TIID 2VB3X 1EY6A 3PUZA 4KJNA 1OO9B 2M00A 5G3LF 3MEHA 4DXGA 1W6KA 2F0FA 3C2PA 3EQLC 4F8MA 3S1NB 4G7HC 4RGNA 4CKEA 4FXDA 3HP3A 5TSSA 4CHTB 1PDQA 3TP5A 3MWYW 4PMCA 1STBA 2EY2A 1HRJA 1V43A 4C1NI 1ENAA 2DY7A 1H9MA 4G7OC 2RSOA 1H9SA 1SNDA 3DWQA 4JK1C 2DN8A 2I07B 4G57A 4ZAIA 2EPBA 2NN6H 2Q8RE 2E75C 3SEBA 1H9JA 4OIKA 2WIIB 3VYSA 1WTPA 1KABA 3AMUA 5JJZA 5CC4A 2R6GA 2O4XA 3S16B 1E2WA 3PUWA 1CM9A 3I8ZA 2F0JA 2CQAA 1WTVA 1LT5D 4FVMA 1JB3A 3G6JB 2D62A 3D3RA 3FDTA 4ABNA 2L11A 3GO5A 5KRUA 1SEBD 2NTSA 2QEJC 2XRSD 2PZWA 1XYIA 2F0NA 4LJZC 1HUNA 1JOOA 2NVQB 5D3IB 1TY2A 3IFDA 3GV3A 4AYBB 5C3WA 5EPLA 2NVXB 4PMWA 3C46A 2K01A 3FPUB 2YYZA 3TP6A 2QKIC 5IT9E 5KNDA 3K7AB 3KUPA 3L7ZC 4XQQA 4TKOB 1Z47A 3ZYYX 1SFOB 3NP8A 2IT1A 1JWUD 2DY8A 3H0GB 1T5XD 4M8AA 2F0VA 2L55A 3C1FA 1Z7TA 3GTPB 1CFMA 4J8QA 1Y8OB 4YIJA 1BXTA 4PQXA 1Q8IA 4A3GB 2Q8TA 3VR5A 1A3VA 3TBIB 5C0XJ 4IFDI 2WB1B 1O7LA 3NTHA 4RH6A 1XWEA 1DZ1A 4K2KA 4HSVA 3ITPA 3MHBA 1QNUA 1B53A 2EY5A 1CK1A 4C3JB 1WCMB 3TP7A 5JAVA 1O78A 4IUPA 2QCPX 1D5MC 5JEAJ 2MUYA 4QUCA 5M9OA 1ET9A 4HTHA 3HOXB 3VR3A 1FD7D 1UEAB 4DA2A 1B9NA 4ILWA 4BBRB 4XQJA 1I4XA 2F3VA 1RJTA 3RUZA 1A6XA 3NQTA 3A8JE 4HMIA 3L9AX 1SYCA 1L0XB 2B8FA 5ELFA 1BBXC 5C6AA 4X3UA 1PXUA 3T4AC 3I90A 4V0BA 1QILA 4CJ2C 2NYZD 2D9UA 4RWSC 2L0CA 2KUMA 1M4VA 1U9RA 2A5HA 2F3WA 5EBDA 4KKUA 1ENCA 3TZDA 2EYPA 3D4RA 4PNYA 5ELDA 1YNNC 1HPCA 2SEBD 3QB3A 4IUUA 2JA6B 1Q3LA 1HXYD 1EYDA 4A3MB 2A6HC 2L5TA 4H44C 1VF7A 1Y1VB 1S4ZA 4FF4A 5C44B 3URYA 3NK9A 4KI0A 5ELEA 3T56B 1YNJC 4MHEA 1JE4A 1H9RA 1EYAA 3K6OA 4I65A 3SR1A 2A69C 2K1BA 1BQQT 4HSPA 3PUVA 5EBCA 1IKLA 3PV0A 4IURA 1ILQA 4ZUIA 2PNRC 2YU9B 2XWBB 2C9OA 3R2IA 1ET6A 1SNOA 4OIJA 4CBVA 1G91A 2JA7B 2MGSA 2EJFC 4NW2A 1D1KA 1WTXA 3JAML 4FO2A 1O7YA 1ZKOA 1IW7C 3L3OC 1EZ6A 2JP1A 1QE6A 1HA5A 4A3BB 1DOMA 4O42A 4DU9A 3VA7A 4DNTB 2XN9C 5EQ0A 1FR3A 3NTKA 3K57A 1GJXA 2E2IB 4XT3B 5I2YA 4NKLA 2FINB 1LTID 2JEBI 1CTMA 2KVMA 1JR0D 5LL6X 1PZKD 4KY7A 2E2HB 4A3JB 2OT2A 4BA1I 2K28A 3I4MB 2A6ED 4QCLA 1B4OA 3HOYB 1KLUD 2F0DA 5T1IA 3DHQA 2AUKA 3X3MA 4X3TA 1Y8PB 4ID6A 1U4LA 3EVQA 4U673 3ND9A 2E2JB 1W6JA 3D8GA 4KY5A 4B9XA 4K5VA 2WACA 3NQIA 3LX0A 3OOCA 1LTSD 2ID0A 2XSCA 3S9WA 1ML0D 4FF1A 2MPMA 1PTOB 1Y1WB 3GV6A 5IOCA 3V96A 2K33A 1HQRD 3GTKB 3C3LA 1B44D 5IIFA 1RTNA 3SHLA 2GA4B 1EQTA 3KK7A 2PW5A 4JBWA 4C1NK 1K8MA 2BDNA 2IW3A 1CA5A 3G7LA 2FHTA 2ZT9C 2EY1A 1STHA 1ESRA 1KAAA 1GOZA 5I6YA 4C3HB 4DFAA 5FO9B 1EWHA 1Q12A 2KHSA 2MP1A 4L6TB 3D6WA 3OSOA 4IFDG 2NZ1D 1STGA 4KD3A 3A8KE 1VMPA 1G6ZA 3BVGA 5C5MA 2L12A 5EGTA 1LV9A 2EVBA 2EXZA 1ZEQX 4B08A 2LFNA 5DM63 2B2TA 4ZYSA 3W2DA 5DNFA 1EWCA 4Q5VA 5IGBA 3S2DB 4OHJA 1LT3D 3CRKC 1EFID 1SXTA 2RBMA 3IFTA 5KYLA 2AQ2B 5CR3A 4DK1A 4KN4C 1R4QB 1KDCA 1ZXTA 3BVZA 4G7ZC 4BY7B 3DEOA 3DUZA 2D2CC 4RA8A 2F0KA 5CV9A 2F0IA 2SNMA 1JOQA 2EYOA 1S5CD 1B9MA 5K36G 2PO4A 5EKKA 2B2WA 3KLSA 3LNNA 1JWSD 2BOSA 3GTQB 3MA2B 2BCOA 5E3FA 3MC0B 3E0JA 3JAME 4KMUC 1OXXK 3GTLB 1O80A 3EA6A 1V8QA 2I46A 4R8IA 5C3EB 5JVH3 5I9PA 2XWJB 4H0LC 1E2ZA 4OGQC 3TN2A 2QDBA 5LHY1 3A55A 4IN3A 4DF7A 1DCZA 1MD2D 1WD0A 1D5ZC 1VMCA 1FNVA 5CV7A 5C4JB 3M4YA 1DM0B 4HCSA 3A7AB 4K8JA 1G291 1TWAB 3I3CA 3J81L 2K05A 4ME5A 2F0TA 3MAQA 2RSNA 4Q0FA 2M2LA 5F2DA 3BYTB 2F4IA 2E76C 3HEJA 3V05A 5IGGA 4FNFA 3NPPA 3SXHA 1F2MA 1TT2A 3EROA 1SNQA 2B2TC 1ILPA 3A7LA 1CHQD 2OF1A 2EDGA 2FMMA 3S1QB 4HEDA 4UDUC 1Q1BA 2JYOA 2R7ZB 4BY1B 5HGTA 4K2LA 5A2QE 4LMQD 1C48A 4K5XA 4L8JA 5ELCA 3BS1A 1EIGA 1L0YB 1A15A 5I2XA 3TDQA 1NSNS 4FP5D 3NUCA 1LTAD 1SJHD 2B2WC 4EGVA 3CHBD 2NN6G 3X3NA 1PRTB 5E4XA 1X3PA 5D65A 1Y8NB 1ZYRD 1DYQA 4XYQA 5M5YB 2J7ZA 5KGUA 1TS3A 3F2UA 3H3VC 2A6EC 1RKNA 2FMCA 1SAPA 3HS0C 4HAEA 4QMGA 2EYLA 1E2VA 4OL7A 2PPBC 5KEEA 5KNBA 1FGBD 4A3KB 1K83B 1LT6D 4KKTA 1SSOA 1AFPA 3GTOB 3I70A 4ULLA 4XYOA 1NUCA 1SYBA 1AZPA 1LABA 4DAYA 2QF7A 1PRTF 1AEXA 2WAQB 4EQNA 3P1HA 1OXTA 2F0EA 2LY7A 1EY7A 2F0OA 2BA1A 2EYJA 4R9WA 4IFDJ 2FJ2A 2Q8IB 4OO1H 4CKCA 1HFNA 1RHPA 3E6ZX 3BZDB 4CJ0B 1LTGD 5E4WC 3K5OA 3WOFA 1DXMA 4QF4A 1X3QA 1F9RA 4X3SA 1SJED 1SNCA 1QOHA 3S15B 1CT1D 3QO2A 5A35A 1STEA 2K5WA 3SK4A 5M5WB 1PLFA 2Z4IA 5CV6A 1NR2A 1EEFD 3WOEA 1WVLA 2HDLA 1RF2D 3AB9A 4WJWA 1HHVA 1CI3M 2AWNA 1XTCD 1CHPD 1EY4A 3RD4A 4DN4M 3VR6A 2N55A 5FO8B 3LWUA 3I4LA 3OWFA 3PUXA 2K7VA 2C5CA 4X3KA 3VR4A 2VUMB 1IHZA 4KTAA 1BOSA 4O1NA 4RCOA 1NAPA 2G9HD 4RGOS 3CU7A 1MSHA 3FEWX 5D3DA 2WKDA 2JXMB 5KNCA 1TWHB 1S5FD 3T16A 3J81E 3QWNA 1KNAA 2F0UA 4TRDA 4C3IG 5JOBA 3O13A 3SVMA 4F87A 4ZRZA 5FLXL 1SE3A 1BCPC 3NWSA 1MI2A 2X6LA 3HOWB 2VB2X 1BR9A 4DAVA 3MFGA 2K5QA 1SMYD 3FVQA 2D5DA 1O7ZA 4WFN3 3HG9A 4A3FB 1EOTA 1I4PA 1TS5A 4RKLA 1PZID 2DNEA 2B2YC 2PQEA 1C8CA 1JQYD 5JVG3 2PZTA 1WTOA 4M1UB 5CORA 1RDPD 3IAYA 1STNA 4L63B 2AUJD 1R9TB 4RHRA 4FYDA 1DJRD 4RAUC 4KKSA 1PMRA 1M8AA 1SNPA 1IYVA 4FF2A 3MZ5A 1KTKA 1G2TA 3QG1A 2TSSA 5BN4A 1Y69U 4RFBA 2JEAI 1F77A 2CHBD 1S5ED 3VA5A 3PMFA 3DWAA 2WINB 4ZLTF 1GUTA 3FRPB 2L4NA 5M5XB 5COYA 1H9SB 2B63B 2NN6I 1QJOA 2R92B 3J80L 5FO7B 3BDCA 3GP7A 1FNWA 4DNRB 1X32A 2J0TD 4A3DB 1B2TA 4K6DA 2PYKA 1JICA 1BNZA 3A8IE 1PTOH 3KBXA 1H9KA 1KDBA 3H94A 2F0SA 1I4GA 3K5MA 2PCFB 3P75A 4NMZA 5DAUA 1KDAA 5IGDA 2IJ0A 4XIGS 3HRZC 2KCCA 4EQPA 3MXGA 1JOKA 2R61A 2TMPA 4XXEA 1WTRA 3SDZA 1EIHA 3GTMB 1DOKA 1AW7A 3K58A 1ZYRC 4E6IA 2PMZB 1U4MA 3D31A 3DMUA 3I91A 1AZQA 1OXVA 1K8OA 4CGYB 4GZYC 3UI2A 2XNAC 1SYEA 4Z9CB 3S2HB 2E74C 2PZUA 1SBBB 3GTJB 2LKVA 4FXKC 3I4NB 5BN3A 2JSOA 2RVLA 5C0XH 2R3ZA 2IX0A 3C1EA 5M3FB 2LS01 1S5DD 1I4RA 1QG7A 4UAIA 1TR5A 2RDHA 1F9PA 4HMJA 1ICWA 1HFGA 3OIQA 4HR7B 1HTLD 3NXWA 1PTOD 4BWGB 5ELBA 2Z8LA 1RTOA 3MXUA 5JEAH 2O5IC 1EYCA 4CKBA 2KQ3A 3RZDB 1QB5D 1EZ8A 1F9SA 4KY6A 3TSSA 1EY8A 2KJXA 2NVYB 2RQXA 2Z1CA 2NUCA 3NWTA 2VXWA 3QOJA 3R8BA 2F0QA 1PFNA 2EYFA 1EY0A 1LO5D 1AN8A 1TWFB 4EVOA 2KEEA 5CV5A 2ENBA 1D2BA 1BCPD 3BG3A 5FLXE 1VDZA 3D4DA 3K0YA 1DOLA 2A68D 5NUCA 2NBFA 1R4PB 1B1ZA 5I9OA 2F0WA 3QOLA 5FK9C 2F0GA 3BVMA 1PFBA 4KK7A 1STYA 4N9TA 3Q6SA 4IALA 3IL8A 4J1MA 2N88A 2ZXPA 1EU3A 5I6WA 1JC7A 2K03A 2K6AA 1GUGA 3K5LA 3R2TA 1Q1EA 5EPJA 3J7YW 3HOZB 1F9QA 2WKCA 1GUSA 4DXFA 3J7AF 2G9DA 5IGFA 2V4DA 2K04A 4BBSB 4IQZA 4RKBA 2EOTA 1UAPA 5DM73 1TVXA 3SE0A 2B2VA 1EU4A 1VCIA 1XX8A 1AP0A 2RA4A 3J80E 1QNKA 3KF8A 5G3LD 1SMYC 3FKIB 3DWPA 4U68A 4H13C 1V1PA 3VR2A 3BYYB 1SNMA 5EJWA 3S17B 1GUOA 1U4RA 2SDFA 5CMDA 3FMCA 1C4QA 3MFYA 3GQBA 4K8IA 4V190 2H4OA 1J9OA 3DM1A 1KNEA 4QB4A 1TKWB 3QJYA 3TP8A 2CVRA 4XDXA 4IUVA 5CBEE 2JA5B 2M9VA 4A3IB 4BA2I 1HQMC 2Y0SB 2XIWA 2ZXOA 4ZKCB 1EQVA 1S5BD 4Y7NB 5HURA 2KEDA 3DEPA 3H91A 4H7BA 5DEHA 1I6HB 1A2TA 4MN3A 1B50A 1D6EC 5CGKA 2L9HA 3PO2B 4WRDA 4RGTA 3MVVA 4CJ1B 2RKSA 3NSWA 2HCIA 1UUPA 1LTBD 4C2MB 2RDFA 3R3OA 1D5XC 2RDGA 2R93B 3S1RB 1RODA 1HUMA 3CKIB 1II3A 3CQZB 5KYIA 3Q23A 1DD2A 2BDOA 1J8IA 4ZQ3A 3OHXC 2A73B 3RMHA 1TS4A 3GD7A 2B2VC 2BA0A 4ODGA 3P20A 2F1MA 5KIXA 3S14B 2IX3A 3M7NA 2ICIA 2HCCA 1PRTD 4TSSA 3T51B 4KHZA 3AU7A 2A74C 2NVTB 2X69A 3RZOB 3MXPA 3I73A 5JPMC 3KLRA 2MJ8A 2B2YA 1TWGB 1ONLA 2X6GA 5C0XI 4C3JG 2SNSA 1TY0A 1HA6A 3M85A 4OO1G 3FPPA 4LAAA 2CW0D 4I7ZC 2Z4HA 2VNUD 1IKMA 1TU2B 2FFKB 2NB0A 4ZK9B 1BUVT 2BE5D 1Q90A 1CZWA 5EKIA 5C4HA 3P7JA 1IL8A 1FYCA 3OIPA 2KCNA 4N9PA 2IL8A 3TMEA 1LACA 3VYTA 1LTTD 1EY9A 5LL6S 2K5DA 4XT1B 2SOBA 1PTOC 1LLRD 1LT4D 2KOLA 2L1BA 2PW7A 3OMGA 5IODA 2QILA 1MBYA 5C4XB 4HN7A 2B39A 3N6RA 3N52A 2HDMA 1STAA 1TQOA 5EKLA 2OXPA 3H09A 3ONAB 1OXUA 1SYDA 4RGMA 3BDLA 1PYWD 4KN7C 3NBHA 1EEID 2MHVA 2E2DC 5C5LA 2HUGA 3CRLC 4TQUS 5CYUA 4DK0A 4C56C 2LMCB 4P2CB 1UNSA 3KLSX 3SK8A 5J39A 1CA6A 4C3IB 4XTCS 2A68C 4NP5A 3HKZB 1HTPA 5FOBB 1I50B 5E1FA 1SE4A 1BO0A 2EY6A 2KECA 3K59A 5M3MB 4ZUJA 3SK5A 2DNCA 1RCVD 2WV6D 2F0HA 3I72A 4A3EB 2AWOA 3W3AA 1I4HA 1A3UA 2HQEA 1F2YA 5I4DA 5K5PA 1A2UA 4BS9A 1EY5A 2AQ1B 3RLFA 1CQFA 5EPKA 2NTTA 1G2SA 1KLGD 3H6MA 3MTSA 1WTWA 5FKAC 4WORA 3OW7A 3NE5B 1EL0A 4J6HA 1V1OA 1NCVA 2O2LD 3QIAA 2IPKD 2F0MA 3Q22A 1U4PA 3OPOA 3Q0AA 4S3SA 3M4OB 3KBGA 3K5NA 3Q24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHH A;  1EYC A;  1STA A;  1KDC A;  2KQ3 A;  5M9O A;  1KDB A;  1TQO A;  1EZ8 A;  4KV6 A;  5EKL A;  5HGT A;  4KY6 A;  5KRU A;  1EY8 A;  2F0S A;  4HTH A;  2F0L A;  2OXP A;  4K2L A;  4ZQ3 A;  4QF4 A;  3P75 A;  1SYF A;  2F0K A;  4NMZ A;  4K5X A;  5CV9 A;  2NUC A;  4IZ8 A;  5CV8 A;  2F0I A;  5DAU A;  5IIF A;  1KDA A;  5IGD A;  1SYD A;  1EZ6 A;  2SNM A;  2PZW A;  2F3V A;  3SHL A;  1JOQ A;  3QOJ A;  1SNC A;  2EYO A;  3BDL A;  3RUZ A;  2F0Q A;  2PW5 A;  2EYF A;  5J22 A;  4ODG A;  1EY0 A;  2F0N A;  3NQT A;  5EKK A;  4EVO A;  4EQP A;  2EYH A;  1NSN S;  5KIX A;  1SNM A;  3NUC A;  1JOO A;  4HMI A;  5CV4 A;  2ENB A;  1JOK A;  5CV5 A;  4RKL A;  5C5L A;  4DU9 A;  5IGC A;  1SYC A;  5IGE A;  3SK6 A;  3SK4 A;  4IUN A;  3U9O A;  5C3W A;  1EY6 A;  5C6A A;  2EY1 A;  5E3F A;  1STH A;  2PQE A;  3SK8 A;  2OEO A;  4K8I A;  4KJN A;  2M00 A;  2PZT A;  3D4D A;  4NKL A;  5CV6 A;  3D6C A;  5J39 A;  1KAA A;  3V2T A;  5NUC A;  3TP6 A;  4KHV A;  3MEH A;  4NP5 A;  4QB4 A;  5I6Y A;  5I9O A;  2F0F A;  1STN A;  4DFA A;  4E6I A;  1U9R A;  5E1F A;  2F0W A;  3QOL A;  3TP8 A;  4F8M A;  5I9P A;  2EY6 A;  2F3W A;  3DMU A;  4KY7 A;  4ZUJ A;  2F0G A;  3SK5 A;  2QDB A;  1ENC A;  4NDX A;  2EYP A;  5C4Z A;  2KHS A;  3MXP A;  1F2Z A;  4PNY A;  5J1Z A;  5KGU A;  3NP8 A;  2F0H A;  5CV7 A;  4DF7 A;  4KJO A;  1JOR A;  1EY4 A;  3QB3 A;  1RKN A;  1SNP A;  3TP5 A;  4EQO A;  5C3X A;  1SYE A;  3OSO A;  3MZ5 A;  4PMC A;  2SNS A;  3T13 A;  1STB A;  1STY A;  1A3U A;  2HQE A;  1EYD A;  2EY2 A;  1STG A;  4N9T A;  2EYL A;  4QMG A;  1EQV A;  1F2Y A;  5K5P A;  2F0V A;  2F0D A;  2PZU A;  3E5S A;  4LAA A;  1A2U A;  4K8J A;  3C1F A;  1EY5 A;  3OWF A;  4KD3 A;  2LKV A;  4OL7 A;  5IOC A;  4YIJ A;  5HUR A;  1ENA A;  3DHQ A;  4MIU A;  5KEE A;  1A3T A;  4IAL A;  3VA5 A;  4B9W A;  4K5W A;  1SND A;  3PMF A;  4H7B A;  3H6M A;  3NK9 A;  5DEH A;  5C5M A;  4ME5 A;  1A2T A;  2F0T A;  1A3V A;  4ID6 A;  4J1M A;  3ERQ A;  5EGT A;  4F7X A;  2EXZ A;  5CGK A;  4G57 A;  5I6W A;  4KD4 A;  5F2D A;  1IHZ A;  5C4H A;  3EVQ A;  4KTA A;  3C1E A;  4WOR A;  1EYA A;  4R8N A;  4WRD A;  4DGZ A;  3EJI A;  1NUC A;  1SYB A;  4J6H A;  3HZX A;  4PMB A;  4I65 A;  3MVV A;  3SR1 A;  4N9P A;  5ISR A;  3TME A;  3HEJ A;  2RKS A;  5IGG A;  1TR5 A;  1KAB A;  3D8G A;  3SXH A;  5IGB A;  3OMC A;  1F2M A;  1AEX A;  4K2K A;  1TT2 A;  3D4W A;  5CC4 A;  3ERO A;  2F0M A;  1SNQ A;  4KY5 A;  3ITP A;  3MHB A;  2O4X A;  3BDC A;  1EY9 A;  4HMJ A;  4K5V A;  4S3S A;  2RDF A;  3P1H A;  3R3O A;  2WAC A;  2F0E A;  3LX0 A;  1EY7 A;  2EY5 A;  2F0O A;  2RBM A;  2OF1 A;  3T16 A;  2F0J A;  3TP7 A;  1II3 A;  3NXW A;  2SOB A;  4ZUI A;  3S9W A;  5KYL A;  4K6D A;  2PYK A;  5JAV A;  2EYJ A;  2PW7 A;  3OMG A;  4B9X A;  5IGF A;  2F0P A;  4K14 A;  5IOD A;  5CR3 A;  4TRD A;  2F0U A;  4EQN A;  1SYG A;  5KYI A;  1SNO A;  5JOB A;  2EYM A;  4RKB A; 
#chains in the Genus database with same CATH topology
 3NHH A;  4OX9 L;  4L5R C;  3NEN A;  3WDN A;  3NBI A;  1V1P B;  3A56 A;  4QUF A;  1B3A A;  1XXG A;  2WP8 J;  4RCN A;  4LK1 C;  1SE2 A;  2IX1 A;  3I4M G;  1N32 Q;  3PO3 B;  2B2U A;  3HGB A;  5IP7 G;  3HOY G;  3VYR A;  4MTN A;  3ZJY C;  1SMX A;  2J4X A;  4HIM A;  4FF3 A;  2UXD L;  3KLW A;  2B29 A;  1MSG A;  1PFS A;  2PI2 E;  1P16 A;  2XRQ D;  2EJG C;  5IGE A;  2EJM A;  1Y1W H;  4DAP A;  4FXG C;  4POG A;  2AMC B;  1PH9 A;  1QWY A;  3K81 C;  1Z6H A;  4MTK A;  4YHH Q;  2PQA A;  4DV5 Q;  2UUB Q;  3DLL A;  3GTM H;  3K80 C;  1FNU A;  3TZU A;  4NXM Q;  4DR2 Q;  1F2L A;  1KD1 C;  1F2Z A;  4ZKB B;  5JJL A;  5J1Z A;  1WD1 A;  5IYC H;  4JV5 L;  1AE2 A;  4GN5 A;  1JOR A;  4KJO A;  5LMN Q;  3NTI A;  3IKJ A;  5A2Q L;  4RHS A;  3T13 A;  5JPN C;  2ALY B;  2E5L L;  3OW2 A;  2K32 A;  1CKN B;  2ZXR A;  4IUT A;  2KHJ A;  1CKM A;  1GXD C;  3GTJ H;  4DNI A;  3I4N H;  3J7A V;  1GHK A;  3ERQ A;  1ENF A;  4F7X A;  1FJG L;  2VQF L;  4KD4 A;  3EJI A;  4DAM A;  1NR4 A;  3HZX A;  4PMB A;  1DON A;  1I6V C;  4R4O A;  4KHP Q;  3BDO A;  3D4W A;  2AHO B;  1T5E A;  1IYU A;  2JK8 A;  1E0B A;  4X62 L;  2OQ0 A;  1VF5 C;  4B3M Q;  5T1G A;  2F03 A;  3RN2 A;  4DAY B;  2JE6 I;  1IL2 A;  2EXD A;  3A54 A;  2F0P A;  4K14 A;  4IFD H;  1OXS C;  1SRU A;  1SYG A;  1VQK A;  3PQI A;  4A3L G;  2ICE C;  4QY7 A;  4C3H G;  1I3Q B;  1VQN A;  4OO1 I;  4KV6 A;  4UP7 A;  1N34 L;  5D14 A;  1BF4 A;  1BCP B;  4HCE A;  3RZD H;  3JAM i;  1S72 A;  1SYF A;  2EZV A;  3EFX D;  1VQL A;  1BDO A;  2VQE Q;  5IT9 L;  4YCW A;  5CBA E;  2ZJP A;  1FGU A;  3G71 A;  5L37 A;  4A93 B;  3HOU B;  1PTO F;  4K6L A;  3PIP A;  1XPR A;  2EYH A;  4HJ7 A;  2B2U C;  1RD9 D;  1TS2 A;  4L5Q A;  5CV4 A;  1TWF H;  4AIM A;  2NWG A;  5IGC A;  2IY5 B;  4AQY L;  3SK6 A;  4IUN A;  1SDF A;  3U9O A;  1D1I A;  4XQN A;  1GM5 A;  5C0X G;  3M3Y B;  2OEO A;  1PRT C;  3D6C A;  3I4O A;  3V2T A;  1ESF A;  1MGS A;  4KHV A;  2NZO A;  4DR7 Q;  1PZJ D;  3OWE B;  1HCZ A;  1G8Z D;  2JJQ A;  1PFM A;  4NDX A;  5C4Z A;  3F1Z A;  1YNN D;  1YHQ A;  1CQV A;  1L2F A;  3CPW A;  1XMQ L;  3ICE A;  2ZTD A;  2IWH A;  4X64 Q;  5C3X A;  4EQO A;  4F88 A;  3ND8 A;  1BCP F;  1XJV A;  2A6H D;  1LTR D;  3E5S A;  5JEA G;  2CW0 C;  3S1M B;  1QCB D;  3GTG B;  5K36 H;  3HOV B;  4MIU A;  2AQ3 B;  1A3T A;  1JWM D;  2B8G A;  4B9W A;  4K5W A;  2MQH A;  1JE5 A;  3U9S A;  4DV3 L;  4BY7 G;  5BR8 Q;  2JA8 B;  4EX5 A;  1CZG A;  1I4Q A;  4CDE C;  3T1H L;  2BE5 C;  1YNJ D;  1GUW A;  2UUA Q;  4R8N A;  2LXK A;  4DGZ A;  3M7G A;  1GHJ A;  2A69 D;  4PV1 C;  5ISR A;  1WJJ A;  2RCN A;  3PUY A;  5BN5 A;  3OMC A;  5AFW A;  4YWK A;  4DR4 L;  5C4J H;  1GUN A;  1C0A A;  2EE1 A;  1X56 A;  3LWE A;  4UP9 A;  3HOZ H;  3PIO 3;  1TWC B;  4P73 A;  2EYM A;  3R93 A;  1I5F A;  2XVS A;  4GKK Q;  2KA7 A;  5C3E G;  4UY8 C;  4G4K A;  4IUQ A;  1IW7 D;  1VQ6 A;  2F0L A;  3MXN A;  1WTQ A;  1HNZ Q;  1JCK B;  4QIW B;  4HJA A;  4IZ8 A;  5CV8 A;  2O5J C;  4X6A H;  2H1E A;  1PVO A;  1MJC A;  3T53 B;  3VYU A;  5J22 A;  1Q81 C;  3FKI H;  3PIP 3;  1L1O A;  4GOP A;  3DXJ C;  1TII D;  4OWT B;  2VB3 X;  2Z6K A;  1EY6 A;  4JG2 A;  4QIW E;  4DV6 L;  4HJ8 A;  3PUZ A;  4KJN A;  1OO9 B;  2M00 A;  3I2Z A;  2N8N A;  1G51 A;  5G3L F;  1SR3 A;  3MEH A;  4DXG A;  1W6K A;  2HHH Q;  2F0F A;  3C2P A;  5E7N A;  1J5E Q;  4JOI A;  4LF6 Q;  3EQL C;  4F8M A;  4B3T Q;  3S1N B;  4G7H C;  4RGN A;  4CKE A;  4FXD A;  3HP3 A;  5TSS A;  3GDE A;  5GRO A;  4CHT B;  1PDQ A;  2JA5 H;  1NNX A;  3KYH C;  3TP5 A;  3CW2 C;  4H02 A;  3MWY W;  4PMC A;  1QVF A;  3AFQ A;  1STB A;  2EY2 A;  2KBN A;  1GVP A;  4J15 A;  4X66 Q;  1V43 A;  1HRJ A;  4C1N I;  1ENA A;  2DY7 A;  4JBJ A;  2R7Z G;  1H9M A;  4BY1 G;  3K8A A;  4IOA A;  4G7O C;  2RSO A;  4A4I A;  1H9S A;  1SND A;  3DWQ A;  3TS0 A;  4JK1 C;  1E3P A;  2KHI A;  2YTY A;  2DN8 A;  2I07 B;  3CCV A;  1I6H H;  4G57 A;  5IYB H;  2EPB A;  4ZAI A;  2NN6 H;  2Q8R E;  2E75 C;  3SEB A;  1E22 A;  4JI0 L;  1H9J A;  2K5V A;  4OIK A;  2WII B;  3U4Z A;  4LF8 L;  3VYS A;  3UE0 A;  1WTP A;  1KAB A;  3AMU A;  2XTI A;  5JJZ A;  1XNQ L;  3ERS X;  1IBM Q;  5CC4 A;  2R6G A;  2O4X A;  3S16 B;  1E2W A;  3PUW A;  1HZA A;  1CM9 A;  2G5D A;  3JAM c;  3I8Z A;  4C2M H;  2F0J A;  1HNX Q;  1YNX A;  2CQA A;  1WTV A;  1LT5 D;  1J6Q A;  1SN8 A;  4FVM A;  3S1R H;  2R93 H;  1JB3 A;  2HIX A;  3G6J B;  2D62 A;  3D3R A;  3FDT A;  3L2P A;  4A3K H;  4ABN A;  2L11 A;  3GTO H;  3GO5 A;  5KRU A;  1SEB D;  4IPH A;  5IYB G;  3KJP A;  2D0P A;  4LF7 Q;  4BXX H;  2NTS A;  2QEJ C;  2DUD A;  4OON A;  1VQP A;  2XRS D;  2PZW A;  2PQA B;  4AYB G;  1XYI A;  4HIO A;  2F0N A;  4LJZ C;  5FLM G;  1HUN A;  4DV0 Q;  1JOO A;  2NVQ B;  1TY2 A;  1IZ6 A;  3IFD A;  5D3I B;  3GV3 A;  3S14 H;  4AYB B;  1L1O C;  4GN3 B;  5C3W A;  4O2D A;  1HJP A;  5EPL A;  2NVX B;  4PMW A;  4GOP C;  3C46 A;  2K01 A;  3G6E A;  3FPU B;  2YYZ A;  3TP6 A;  2UXB L;  2Z6K C;  2QKI C;  5LMN W;  5IT9 E;  2FXQ A;  1YJN A;  5KND A;  3K7A B;  2F4V L;  3KUP A;  3L7Z C;  4TKO B;  4XQQ A;  1Z47 A;  3ZYY X;  2WAQ G;  1SFO B;  2GN5 A;  3CMA A;  2NVT H;  3NP8 A;  4AYB E;  4JI6 L;  2IT1 A;  4JI4 L;  1JWU D;  2DY8 A;  3H0G B;  4HID A;  3HKS A;  1PYB A;  1T5X D;  4M8A A;  4A3G G;  2F0V A;  5M5W H;  4GKJ L;  2L55 A;  1A0I A;  3C1F A;  1Z7T A;  3GTP B;  4LWC A;  1CFM A;  4J8Q A;  1Y8O B;  4YIJ A;  1BXT A;  4PQX A;  1Q8I A;  3TS2 A;  2WB1 G;  1CKO A;  2Q8T A;  4A3G B;  2JQO A;  3VR5 A;  1A3V A;  1B3Q A;  3TBI B;  5C0X J;  4LFC L;  3ULL A;  2MNA A;  4KLK A;  4IFD I;  2WB1 B;  2DJG C;  1O7L A;  3NTH A;  4RH6 A;  1XWE A;  3NEM A;  1DZ1 A;  1VQI A;  4K2K A;  3J7Z C;  4WJ4 A;  1U0L A;  4HSV A;  3ITP A;  3MHB A;  1KXL A;  1QNU A;  1B53 A;  2EY5 A;  1M90 C;  4DUZ L;  1CK1 A;  3FP9 A;  4C3J B;  1WCM B;  3TP7 A;  1NBW A;  2BH2 A;  1BBU A;  1JB7 A;  5JAV A;  1O78 A;  4IUP A;  5FJ8 G;  2QCP X;  3HOX G;  2WB1 E;  3LGJ A;  1D5M C;  5JEA J;  5C4X H;  2MUY A;  4QUC A;  5M9O A;  1KHI A;  1ET9 A;  3CCQ A;  1LTL A;  1LUZ A;  4HTH A;  3HOX B;  3VR3 A;  4JYA L;  1FL0 A;  4JI5 Q;  1FD7 D;  1WTH A;  3CF5 A;  1IBK Q;  1UEA B;  4LW1 A;  4DA2 A;  1B9N A;  4ILW A;  4BBR B;  4XQJ A;  1I4X A;  2F3V A;  4DR5 Q;  1RJT A;  3RUZ A;  1YBY A;  4LF9 Q;  1A6X A;  3NQT A;  1VQ4 A;  3A8J E;  4HMI A;  3B6Y A;  1VQB A;  2HIV A;  3L9A X;  5GAG C;  1SYC A;  1L0X B;  3I55 A;  1PH6 A;  2B8F A;  5ELF A;  1BBX C;  4P71 A;  5C6A A;  4X3U A;  2RF4 A;  1PXU A;  3T4A C;  3I90 A;  1LM0 A;  4V0B A;  2VUM G;  1QIL A;  4CJ2 C;  2NYZ D;  2D9U A;  4LF5 Q;  4RWS C;  3CCL A;  2L0C A;  2KUM A;  1M4V A;  1U9R A;  2JA6 G;  4R4T A;  2A5H A;  2F3W A;  5EBD A;  1V9P A;  4KKU A;  1ENC A;  3TZD A;  2EYP A;  4A3M G;  3D4R A;  4PNY A;  5ELD A;  1YNN C;  1HPC A;  2SEB D;  3QB3 A;  4IUU A;  2JA6 B;  1Q3L A;  3A0J A;  2ES2 A;  1HXY D;  4A3E H;  1EYD A;  3H3V H;  4A3M B;  4HIK A;  2A6H C;  2L5T A;  2UUC Q;  4GLX A;  4H44 C;  1VF7 A;  1N32 L;  1W3S A;  1Y1V B;  1S4Z A;  4FF4 A;  5C44 B;  3URY A;  3OTO Q;  3NK9 A;  4KI0 A;  3U50 C;  4OWX B;  5ELE A;  1O7I A;  3T56 B;  3HOW G;  1YNJ C;  4MHE A;  1VQM A;  1JE4 A;  1H9R A;  1EYA A;  3U58 A;  3K6O A;  1PA6 A;  1BBW A;  4I65 A;  3SR1 A;  2A69 C;  4DV4 L;  1UE7 A;  4A3F G;  2K1B A;  1BQQ T;  4X65 L;  5LMU Q;  4PZ8 A;  4HSP A;  3KJO A;  3PUV A;  5EBC A;  1IKL A;  4NXN L;  2VW9 A;  3PV0 A;  4IUR A;  1ILQ A;  4ZUI A;  2PNR C;  1UWV A;  2YU9 B;  1YJW A;  1X3E A;  2XWB B;  2C9O A;  3R2I A;  1ET6 A;  1VQ8 A;  1SNO A;  4OIJ A;  4CBV A;  5LMN L;  1G91 A;  2P5Z X;  4DV7 Q;  2MGS A;  2JA7 B;  1K0S A;  2EJF C;  4NW2 A;  1D1K A;  1WTX A;  3JAM L;  1XMO Q;  4FDB A;  1L1O B;  3RLO A;  4FO2 A;  1VQA A;  1O7Y A;  1ZKO A;  1IW7 C;  3L3O C;  4GNX B;  2K50 A;  1EZ6 A;  1FVI A;  2JP1 A;  3PO3 H;  1QE6 A;  3KF8 B;  3UDF A;  2PNH A;  4A3D H;  1HA5 A;  4A3B B;  1NTG A;  1DOM A;  4O42 A;  4DU9 A;  3VA7 A;  3AQQ A;  4DV1 Q;  4DNT B;  2XN9 C;  1ASY A;  5EQ0 A;  1FR3 A;  3NTK A;  3K57 A;  3CD6 A;  1GJX A;  2E2I B;  4XT3 B;  5I2Y A;  4NKL A;  3ULP A;  4A3J G;  2K5N A;  2FIN B;  1LTI D;  4OXP A;  2JEB I;  1CTM A;  4B3M L;  1IYJ B;  2KVM A;  1JR0 D;  2B63 G;  2HD3 A;  2ZJR A;  5LL6 X;  1PZK D;  3U4V A;  1QUQ A;  2R92 G;  2ZM6 Q;  4KY7 A;  2E2H B;  4A3J B;  2OT2 A;  1K3R A;  4BA1 I;  2K28 A;  3I4M B;  2A6E D;  2QA4 A;  4QCL A;  3J81 c;  1N36 L;  1B4O A;  3HOY B;  4A3D G;  1I94 Q;  1KLU D;  2F0D A;  5T1I A;  4JCV E;  1HZB A;  1EQQ A;  1SLJ A;  2VQE L;  3DHQ A;  2AUK A;  4ME3 A;  3X3M A;  1KRS A;  4X3T A;  3UDX A;  1IBL Q;  1Y8P B;  5AJ3 L;  4ID6 A;  1U4L A;  3EVQ A;  4U67 3;  1CUK A;  4LFA Q;  3ND9 A;  2E2J B;  1W6J A;  3D8G A;  3S2H H;  2N3S A;  4GN4 B;  4KY5 A;  1X3G A;  4B9X A;  1Y1W G;  4K5V A;  2WAC A;  3NQI A;  3LX0 A;  2CWA A;  1LTS D;  3OOC A;  3MEF A;  2ID0 A;  2XSC A;  2CQO A;  3KFU A;  3S9W A;  1ML0 D;  4FF1 A;  2MPM A;  1PTO B;  3BJU A;  1Y1W B;  3GV6 A;  2L15 A;  5IOC A;  4X64 L;  3V96 A;  2K33 A;  1HQR D;  3GTK B;  1Q82 C;  2ZTC A;  2K5H A;  5M3F H;  5IYC G;  3C3L A;  1B44 D;  5IIF A;  3H15 A;  1RTN A;  3SHL A;  2GA4 B;  1EQT A;  1JMC A;  3KK7 A;  3RNU A;  2PW5 A;  4JBW A;  1WFQ A;  2C35 B;  4C1N K;  5BR8 L;  3PIO A;  4YY3 Q;  4A93 H;  3HOU H;  3CCS A;  1K8M A;  3NEL A;  2BDN A;  2IW3 A;  1K3B C;  1CA5 A;  4DK6 C;  1IXR A;  3G7L A;  4K0K Q;  1NMG A;  3I4N G;  4IOC A;  2FHT A;  3PSI A;  2ZT9 C;  1PV4 A;  2EY1 A;  1STH A;  4PZ6 A;  1ESR A;  1KAA A;  3M3Y H;  1GOZ A;  3AEV A;  2KCT A;  2NVY H;  5I6Y A;  4C3H B;  4DFA A;  2UU9 Q;  5FO9 B;  1EWH A;  5IWA L;  1Q12 A;  2KHS A;  4JI8 Q;  4LF4 L;  1QVC A;  2ATW A;  2MP1 A;  3TRE A;  4GKK L;  4L6T B;  3D6W A;  3OSO A;  4IPG A;  4IFD G;  2NZ1 D;  3W1B A;  1STG A;  1UE6 A;  1HNZ L;  4LFB L;  4KD3 A;  3A8K E;  1VMP A;  1G6Z A;  3S1M H;  2VZA A;  3GTG H;  3BVG A;  4N8X 1;  5C5M A;  2IHF A;  4HJ9 A;  2L12 A;  5EGT A;  1LV9 A;  2EVB A;  2EXZ A;  1ZEQ X;  2LFN A;  4B08 A;  4JV5 Q;  5ELN A;  2JA8 H;  5DM6 3;  2B2T A;  4ZYS A;  1E24 A;  3W2D A;  4CDD C;  5DNF A;  1EWC A;  4Q5V A;  5IGB A;  2E5L Q;  4AH6 A;  3S2D B;  4OHJ A;  1LT3 D;  3CRK C;  1EFI D;  3J80 i;  3CC7 A;  2HHH L;  1SXT A;  1J5E L;  2RBM A;  2UXC L;  1NY4 A;  4JBK A;  2V1C C;  3J7A 5;  3IFT A;  5KYL A;  2AQ2 B;  5CR3 A;  1FJG Q;  1N33 Q;  2VQF Q;  4DK1 A;  1TWC H;  1PYS B;  1GD7 A;  4KN4 C;  1HZ9 A;  2Z9H A;  1R4Q B;  2N78 A;  1KDC A;  4L5S A;  1XTD A;  1ZXT A;  3BVZ A;  4G7Z C;  4BY7 B;  1B8A A;  3DEO A;  3DUZ A;  2D2C C;  4RA8 A;  4X66 L;  5EAY A;  2F0K A;  5CV9 A;  2F0I A;  4X62 Q;  2XGT A;  2SNM A;  1JOQ A;  2EYO A;  5IE8 A;  1S5C D;  1B9M A;  3FHW A;  5K36 G;  2PO4 A;  5EKK A;  3KLS A;  2B2W A;  2NZH A;  3LNN A;  3ULJ A;  1VQJ A;  1JWS D;  2A8V A;  2BOS A;  3GTQ B;  2CFM A;  1E1O A;  4BBS H;  3CXC A;  3MA2 B;  2BCO A;  5E3F A;  3MC0 B;  3E0J A;  3NBH B;  4KMU C;  3JAM E;  1IBM L;  1OXX K;  2OWO A;  3GTL B;  1O80 A;  3EA6 A;  1V8Q A;  3E0E A;  2I46 A;  1N9W A;  4R8I A;  5C3E B;  5JVH 3;  3JC6 6;  5I9P A;  2XWJ B;  4H0L C;  1E2Z A;  4OGQ C;  3TN2 A;  2QDB A;  5LHY 1;  3A55 A;  2LSS A;  4IN3 A;  4DF7 A;  1DCZ A;  1MD2 D;  4IJH A;  3HOZ G;  1WD0 A;  1D5Z C;  1VMC A;  1FNV A;  5CV7 A;  2EQS A;  5C4J B;  3M4Y A;  4R4C A;  4JI1 L;  4IO9 A;  3S17 H;  1DM0 B;  4HCS A;  4DV2 L;  3A7A B;  4K8J A;  1G29 1;  4DUY L;  1CSQ A;  1TWA B;  4IJL A;  3CCR A;  3I3C A;  3PF5 A;  1VQF A;  3J81 L;  2K05 A;  4ME5 A;  2F0T A;  3MAQ A;  1Q86 C;  3BZK A;  2RSN A;  4Q0F A;  2HT1 A;  1A8V A;  2M2L A;  1EIY B;  5F2D A;  3BYT B;  2F4I A;  3FKI G;  4A3I H;  2E76 C;  3HEJ A;  3V05 A;  5IGG A;  4FNF A;  3NPP A;  3SXH A;  1F2M A;  1TT2 A;  3ERO A;  1SNQ A;  4DR6 Q;  1JJ2 A;  2B2T C;  1ILP A;  1KAW A;  5FLX c;  1UEB A;  3A7L A;  1CHQ D;  2OF1 A;  2EDG A;  4Y7N H;  2FMM A;  4DV3 Q;  1PH3 A;  3S1Q B;  4HED A;  4UDU C;  1Q1B A;  2A19 A;  2JYO A;  2R7Z B;  4BY1 B;  5HGT A;  3PO2 H;  2JN4 A;  4K2L A;  5A2Q E;  2JA5 G;  3CAM A;  4LMQ D;  1C48 A;  3EBE A;  3F2D A;  4DR4 Q;  4K5X A;  4A3I G;  4L8J A;  5ELC A;  4HJ5 A;  1LYL A;  3BS1 A;  1XNR Q;  3T1Y L;  1EIG A;  1L0Y B;  1A15 A;  5I2X A;  1PH1 A;  3TDQ A;  1NSN S;  4FP5 D;  1EIF A;  2OTL A;  3NUC A;  3CQZ H;  1LTA D;  4JW0 A;  2I0Q A;  1SJH D;  1QUQ B;  2B2W C;  4EGV A;  3CHB D;  4TVA B;  1D7Q A;  2NN6 G;  1HR0 Q;  3X3N A;  1ASZ A;  2KEN A;  1PRT B;  5E4X A;  1X3P A;  5D65 A;  1Y8N B;  1ZYR D;  1DYQ A;  4XYQ A;  3M4P A;  3G48 A;  4JI7 L;  5M5Y B;  1CKN A;  2J7Z A;  3K7A H;  5KGU A;  1WI5 A;  1TS3 A;  3F2U A;  3H3V C;  2OTJ A;  2A6E C;  2Z6B A;  1SFO H;  1RKN A;  2FMC A;  1SAP A;  2R93 G;  3HS0 C;  4HAE A;  4QMG A;  2EYL A;  1E2V A;  3H0G H;  4B3R L;  4A3K G;  4QGU A;  4JI5 L;  4OL7 A;  2PPB C;  4DR5 L;  5KEE A;  3F8T A;  4JI2 L;  4BXX G;  1H95 A;  5KNB A;  3J80 c;  3G4S A;  1FGB D;  4A3K B;  1K83 B;  1LT6 D;  4KKT A;  1SSO A;  2MFI A;  1AFP A;  4YWM A;  3GTO B;  3I70 A;  4GLA C;  4ULL A;  2I5M X;  3BZC A;  1YI2 A;  4XYO A;  3ER0 A;  3RZO H;  1NUC A;  1SYB A;  1AZP A;  1LAB A;  4DAY A;  1TWG H;  1UE1 A;  2QF7 A;  4R4Q A;  1PRT F;  1AEX A;  2WAQ B;  4EQN A;  4LF5 L;  3CCE A;  3P1H A;  1OXT A;  2F0E A;  2LY7 A;  4JBM A;  1EY7 A;  2F0O A;  1VQH A;  2YV5 A;  3CCM A;  2BA1 A;  2CH4 W;  2EYJ A;  4R9W A;  4C3J H;  4IFD J;  1WCM H;  2FJ2 A;  2Q8I B;  1OTC A;  4OO1 H;  4CKC A;  4JI0 Q;  1RHP A;  3K0X A;  1HFN A;  3E6Z X;  2K75 A;  2CCZ A;  1KQS A;  3BZD B;  3AFP A;  2WAQ E;  4CJ0 B;  1LTG D;  4MZ9 A;  4LF8 Q;  2UUC L;  5E4W C;  3K5O A;  3BU2 A;  3WOF A;  1D8L A;  1DXM A;  2Q2I A;  1XNQ Q;  4QF4 A;  1X3Q A;  1F9R A;  2Z0S A;  4X3S A;  2B3G A;  3RN5 A;  4APV A;  3TRZ A;  1SJE D;  1SNC A;  1QOH A;  3S15 B;  1CT1 D;  1VQD A;  3QO2 A;  4BBR H;  5A35 A;  4ZCK A;  5IY0 A;  1STE A;  2K5W A;  1K28 A;  1E1T A;  5IP9 H;  1NJI C;  4CDC C;  4DR1 L;  4JI3 Q;  3SK4 A;  5M5W B;  1PLF A;  1EWI A;  2Z4I A;  3A74 A;  4GLV B;  5CV6 A;  5LMU L;  1NR2 A;  1EEF D;  3WOE A;  1WVL A;  2HDL A;  1RF2 D;  3AB9 A;  4A76 A;  4WJW A;  4B3S L;  1HHV A;  1CI3 M;  2AWN A;  1XTC D;  1CHP D;  2OCE A;  1XPO A;  1EY4 A;  3RD4 A;  1AH9 A;  4DN4 M;  3VR6 A;  2N55 A;  5FO8 B;  3LWU A;  3I4L A;  5C4X G;  3OWF A;  3PUX A;  4QQB X;  2K7V A;  4C3I H;  2C5C A;  1Y1V H;  4X3K A;  1VQC A;  3VR4 A;  2VUM B;  1I50 H;  5C44 H;  4JI6 Q;  1IHZ A;  4KTA A;  5M3M H;  4DV1 L;  1BOS A;  4JI4 Q;  4O1N A;  4RCO A;  1NAP A;  2G9H D;  4EQ5 A;  3TQY A;  1A63 A;  4RGO S;  5IYD H;  3CU7 A;  1MSH A;  4GKJ Q;  3FEW X;  5D3D A;  2WKD A;  4A3C H;  2JXM B;  5KNC A;  1TWH B;  1S5F D;  3T16 A;  1YEZ A;  2LXJ A;  1V1Q A;  3J81 E;  3QWN A;  1KNA A;  1TXY A;  2F0U A;  4TRD A;  1EOV A;  4LFC Q;  4C3I G;  5JOB A;  1KIX A;  1YZ6 A;  3O13 A;  3SVM A;  3HKZ G;  4F87 A;  4ZRZ A;  5FLX L;  1SE3 A;  1BCP C;  3NWS A;  2JA7 H;  4YHH L;  5M3M G;  4DV5 L;  2UUB L;  1MI2 A;  2X6L A;  5HGQ A;  3HOW B;  1X54 A;  2VB2 X;  1BR9 A;  4DAV A;  3MFG A;  4A3E G;  2K5Q A;  2YTV A;  1SMY D;  1IBL L;  3FVQ A;  1EQR A;  2D5D A;  1O7Z A;  4WFN 3;  3HG9 A;  1E7Z A;  3MXN B;  4NXM L;  4DR2 L;  3M4O H;  4A3F B;  1EOT A;  2QW7 A;  3UDI A;  3E3X A;  5JJI A;  1I4P A;  1TS5 A;  4RKL A;  1PZI D;  3A5Z B;  2DNE A;  4A3B H;  4NPS A;  2B2Y C;  1VQO A;  2PQE A;  1C8C A;  1JQY D;  4JYA Q;  5JVG 3;  2PZT A;  2Q2T A;  4GOP B;  1WTO A;  1YHB A;  3KF6 A;  4M1U B;  5COR A;  4LNQ A;  1RDP D;  2E2I H;  3IAY A;  1STN A;  4L63 B;  2VL6 A;  2AUJ D;  1R9T B;  4RHR A;  4FYD A;  1DJR D;  4RAU C;  4KKS A;  2E2H H;  1PMR A;  1M8A A;  3CCJ A;  1SNP A;  1IYV A;  3I4M H;  4FF2 A;  1T9H A;  4JPB W;  3MZ5 A;  1KTK A;  4KHP L;  5IP7 H;  1G2T A;  3HOY H;  3QG1 A;  2TSS A;  5BN4 A;  1VQ9 A;  1Y69 U;  4RFB A;  1YIJ A;  2JEA I;  1F77 A;  2CHB D;  1S5E D;  3VA5 A;  4R4I A;  3PMF A;  3DWA A;  2WIN B;  3KOJ A;  1M1K C;  1KL9 A;  4ZLT F;  2RHQ B;  1GUT A;  3FRP B;  1EFW A;  2BH8 A;  3PO3 G;  2L4N A;  5M5X B;  5COY A;  1KRT A;  1H9S B;  2B63 B;  4WJ3 M;  2NN6 I;  1QJO A;  2R92 B;  3J80 L;  4UHV A;  2H5X A;  5FO7 B;  2E2J H;  3BDC A;  1SE8 A;  3GP7 A;  1FNW A;  4JC0 A;  4DNR B;  1X32 A;  2J0T D;  2UU9 L;  4A3D B;  1B2T A;  4K6D A;  2PYK A;  4JI8 L;  2R7D A;  1JIC A;  1BNZ A;  3A8I E;  1PTO H;  2QEX A;  1WOC A;  3KBX A;  3DM3 A;  1H9K A;  1KDB A;  1QZH A;  1NE3 A;  1P8L A;  4DV4 Q;  3H94 A;  2F0S A;  1I4G A;  3GTK H;  3K5M A;  2PCF B;  3P75 A;  4NMZ A;  2QGQ A;  3L0O A;  4X65 Q;  5DAU A;  4NXN Q;  1KDA A;  5IGD A;  2IJ0 A;  4O0A A;  4A75 A;  4DR7 L;  4XIG S;  3Q8D A;  3HRZ C;  1K0R A;  2KCC A;  4EQP A;  3MXG A;  1HR0 W;  1YJ9 A;  1JOK A;  2R61 A;  1C9O A;  1PHJ A;  2TMP A;  4XXE A;  1WTR A;  3SDZ A;  1EIH A;  5J3B A;  1HH2 P;  1I3Q H;  3GTM B;  1DOK A;  1HNW Q;  1AW7 A;  3K58 A;  4DR3 Q;  1ZYR C;  4E6I A;  4A3L H;  2PMZ B;  1U4M A;  3D31 A;  4C3H H;  3DMU A;  3I91 A;  2E8G A;  1N33 L;  1AZQ A;  4MNO A;  1OXV A;  1K8O A;  4CGY B;  4GZY C;  2UUA L;  2ZJQ A;  3UI2 A;  2XNA C;  1SYE A;  4Z9C B;  4OX9 Q;  3S2H B;  2E74 C;  4CDF C;  2PZU A;  1SBB B;  3GTJ B;  4UP8 A;  2LKV A;  4FXK C;  5JJK A;  2PMZ E;  2VS1 A;  3I4N B;  2GVA A;  5M3F G;  4PG3 A;  5BN3 A;  1QZG A;  2JSO A;  2UXD Q;  2RVL A;  5C0X H;  2R3Z A;  2IX0 A;  4R1J A;  4LUO A;  3C1E A;  5M3F B;  2LS0 1;  3QR8 A;  1AE3 A;  1I4R A;  1S5D D;  1Z9F A;  1N36 Q;  1QG7 A;  2GVB A;  4A93 G;  3HOU G;  4UAI A;  1TR5 A;  4QL5 A;  2RDH A;  1F9P A;  4HMJ A;  3S2D H;  1ICW A;  1HFG A;  5GAE C;  3OIQ A;  4HR7 B;  1HTL D;  5AJ3 Q;  3NXW A;  1PTO D;  1Q7Y C;  4BWG B;  3HOV H;  5ELB A;  2Z8L A;  1MIU A;  1RTO A;  3MXU A;  1YVC A;  5JEA H;  2O5I C;  1EYC A;  4CKB A;  1NMF A;  2KQ3 A;  2K4K A;  3RZD B;  1QB5 D;  1EZ8 A;  1F9S A;  3KDF A;  4KY6 A;  3TSS A;  1EY8 A;  2KJX A;  2NVY B;  2RQX A;  2Z1C A;  3RLN A;  3SGI A;  4BY7 H;  1RL2 A;  2NUC A;  3M9B A;  3NWT A;  1YIT A;  2VXW A;  4RG1 A;  3QOJ A;  3R8B A;  2F0Q A;  5HY6 A;  4LF6 L;  4B3T L;  1PFN A;  2EYF A;  1EY0 A;  1LO5 D;  1AN8 A;  1TWF B;  4EVO A;  5DLQ E;  2DGY A;  1WYD A;  2KEE A;  5CV5 A;  2ENB A;  2MO1 A;  3HOV G;  1D2B A;  1BCP D;  3BG3 A;  5FLX E;  3GTQ H;  1X55 A;  1VDZ A;  3D4D A;  4DR6 L;  2JA8 G;  3K0Y A;  1DOL A;  2A68 D;  5NUC A;  2NBF A;  1R4P B;  1B1Z A;  5I9O A;  1PH5 A;  3GTL H;  2F0W A;  3QOL A;  1PH2 A;  5FK9 C;  2RCF A;  5C3E H;  2F0G A;  3BVM A;  1PFB A;  3A5U A;  1JJC B;  2ZTE A;  2I5L X;  4KK7 A;  3F2B A;  4P74 A;  1VQG A;  1STY A;  4N9T A;  1JJG A;  1N34 Q;  1MHW C;  3H3V I;  3F2C A;  3Q6S A;  1XNR L;  4IAL A;  1DGS A;  1C7Y A;  1HNX L;  1UE5 A;  2YTX A;  3IL8 A;  3UDG A;  1TWA H;  4J1M A;  5IWA Q;  2N88 A;  2ZXP A;  4LF4 Q;  1EU3 A;  5I6W A;  1JC7 A;  3S1N H;  4AQY Q;  2K03 A;  1HR0 L;  2K6A A;  4LF7 L;  4LFB Q;  4DPG A;  1GUG A;  3K5L A;  3R2T A;  1Q1E A;  5EPJ A;  4BBS G;  3J7Y W;  3HOZ B;  1F9Q A;  4YCV A;  2WKC A;  1GUS A;  1ICF B;  4DXF A;  3J7A F;  2DJF C;  2G9D A;  5IGF A;  2V4D A;  2K04 A;  3E9I A;  4IPC A;  4DV0 L;  4BBS B;  4IQZ A;  4GNX A;  4RKB A;  2EOT A;  3S1Q H;  1XMQ Q;  2D0O A;  1UAP A;  5DM7 3;  1TVX A;  3SE0 A;  1GKH A;  1PH8 A;  2B2V A;  1EU4 A;  2R7Z H;  1VCI A;  1XX8 A;  4BY1 H;  1AP0 A;  1RIP A;  2RA4 A;  3J80 E;  1QNK A;  1K8G A;  3KF8 A;  5G3L D;  3S24 A;  4I7A A;  2UXC Q;  1SMY C;  3FKI B;  3DWP A;  3S16 H;  2PI2 A;  3KF6 B;  4U68 A;  4H13 C;  1V1P A;  3VR2 A;  4UPA A;  3BYY B;  1SNM A;  3T1H Q;  5EJW A;  3S17 B;  1GUO A;  1U4R A;  2SDF A;  5CMD A;  3FMC A;  3TEH B;  2I5H A;  1C4Q A;  3MFY A;  3GQB A;  1K9M C;  3I56 A;  4K8I A;  4V19 0;  2H4O A;  4L5T A;  1J9O A;  3DM1 A;  1YHA A;  1KNE A;  4QB4 A;  1TKW B;  1VQ5 A;  3STB C;  3QJY A;  3TP8 A;  2CVR A;  2Q2U A;  4XDX A;  2Y0S G;  4IUV A;  5CBE E;  2JA5 B;  2M9V A;  4A3I B;  3HFZ B;  1MKH A;  5M5Y H;  1Q46 A;  2N49 A;  4BA2 I;  3K7U C;  1HQM C;  2Y0S B;  3M4Q A;  2NVQ H;  2XIW A;  2ZXO A;  4ZKC B;  1BKB A;  2MO0 A;  3WWV A;  1EQV A;  1S5B D;  4Y7N B;  2RHS B;  2NVX H;  5FLM H;  1Y14 B;  2R7F A;  5HUR A;  3PO2 G;  2KED A;  3DEP A;  1A62 A;  3H91 A;  4POF A;  4H7B A;  1QVG A;  5DEH A;  1I6H B;  1A2T A;  5GAD C;  4MN3 A;  1B50 A;  1D6E C;  5CGK A;  3CC2 A;  1K83 H;  2L9H A;  4JI3 L;  2Y0S E;  1X9N A;  3PO2 B;  4WRD A;  4RGT A;  3MVV A;  4CJ1 B;  2RKS A;  3NSW A;  4JI1 Q;  4DV6 Q;  3IRB A;  2WFW A;  2HCI A;  4DV2 Q;  1UUP A;  1LTB D;  4C2M B;  4DUY Q;  2RDF A;  3R3O A;  1IBK L;  1D5X C;  2RDG A;  2R93 B;  4YCU A;  1ROD A;  3S1R B;  1HUM A;  1GO3 E;  3GTP H;  3CKI B;  1II3 A;  1BVS A;  3CQZ B;  4LF9 L;  4A3G H;  3W5O A;  5KYI A;  3J81 j;  3Q23 A;  4P75 A;  4OEM B;  1DD2 A;  2BDO A;  1J8I A;  4GNX C;  4YWL A;  4ZQ3 A;  5GAH C;  3OHX C;  2A73 B;  3RMH A;  3D0F A;  1S3O A;  1TS4 A;  1U5K A;  2B2V C;  2BA0 A;  3GD7 A;  3H0G G;  4QJF A;  1N8R C;  4ODG A;  3P20 A;  2F1M A;  3S15 H;  5KIX A;  3S14 B;  3AYH B;  1EUJ A;  4JOI C;  2IX3 A;  4NB3 A;  3OYY A;  3M7N A;  2ICI A;  2HCC A;  3W1G A;  1PRT D;  1B7Y B;  1K8A C;  3CP0 A;  2F3I A;  4TSS A;  3T51 B;  5FJ8 H;  4KHZ A;  3HOX H;  2KCM A;  3AU7 A;  3OTO L;  3T1Y Q;  2A74 C;  1PH7 A;  2NVT B;  4OWW B;  4GS3 A;  1SRO A;  3J81 i;  1S40 A;  2X69 A;  3RZO B;  3MXP A;  3I73 A;  5JPM C;  1B70 B;  2K14 A;  3KLR A;  2MJ8 A;  2B2Y A;  1TWG B;  3CCU A;  1ONL A;  2X6G A;  4N8F A;  5C0X I;  4C3J G;  4ALP A;  1WCM G;  2SNS A;  1TY0 A;  1HA6 A;  3M85 A;  4OO1 G;  3FPP A;  4LAA A;  2CW0 D;  2K52 A;  4I7Z C;  2Z4H A;  2VNU D;  2VY3 A;  1IKM A;  1TU2 B;  2EIF A;  1VQE A;  2FFK B;  4JI7 Q;  2CWP A;  3CME A;  2NB0 A;  2OQK A;  4ZK9 B;  1BUV T;  2BE5 D;  3PGZ A;  1Q90 A;  1CZW A;  5EKI A;  5C4H A;  3P7J A;  1IL8 A;  1FYC A;  2VUM H;  4DV7 L;  3PCO B;  4BBR G;  3OIP A;  2KCN A;  4N9P A;  2IL8 A;  1HNW L;  1XMO L;  3TME A;  2IHE A;  3E9H A;  2JA6 H;  5IP9 G;  1LAC A;  3VYT A;  4B3R Q;  4RMF A;  1LTT D;  2AKW B;  1EY9 A;  4A3M H;  2UXB Q;  3KDF B;  5H1S E;  4JI2 Q;  5LL6 S;  2K5D A;  4XT1 B;  3RR5 A;  2SOB A;  1PTO C;  1LLR D;  1LT4 D;  2KOL A;  1TWH H;  2L1B A;  2PW7 A;  3OMG A;  2F4V Q;  5IOD A;  2QIL A;  1MBY A;  5C4X B;  5IT9 c;  4HN7 A;  2B39 A;  3N6R A;  2CH4 A;  3CC4 A;  3N52 A;  4P72 A;  2HDM A;  1STA A;  3EN2 A;  1TQO A;  3I7F A;  5EKL A;  3VDY A;  1HZC A;  1X3F A;  2OXP A;  3H09 A;  2A1A A;  3ONA B;  4OEL B;  5ELO A;  1OXU A;  1VQ7 A;  3PF4 A;  1SYD A;  4RGM A;  2HQL A;  1W2B A;  3HOW H;  3BDL A;  1PH4 A;  3EIV A;  2ZM6 L;  1PYW D;  4KN7 C;  3CPF A;  2Q2H A;  3NBH A;  1EEI D;  2MHV A;  2E2D C;  1L0W A;  5C5L A;  2HUG A;  3CRL C;  4TQU S;  5CYU A;  4C56 C;  4DK0 A;  4A3F H;  1K73 C;  2YU9 H;  2LMC B;  1Y1V G;  1VS0 A;  4P2C B;  1UNS A;  3KLS X;  1MJE A;  5C44 G;  1KC8 C;  3SK8 A;  1I94 L;  5J39 A;  1CA6 A;  1EYG A;  2F52 A;  4C3I B;  4XTC S;  2A68 C;  4DKA C;  4NP5 A;  3HKZ B;  1HTP A;  5FOB B;  4DUZ Q;  1I50 B;  5IYD G;  5E1F A;  1SE4 A;  1BO0 A;  2EY6 A;  4DK3 C;  2KEC A;  3K59 A;  5GQO A;  5M3M B;  4ZUJ A;  3SK5 A;  2DNC A;  1RCV D;  1R9T H;  1JT8 A;  4A3C G;  2WV6 D;  2F0H A;  3I72 A;  4A3E B;  2AWO A;  4DR1 Q;  2CKZ B;  4LFA L;  2QDL A;  3W3A A;  1I4H A;  1A3U A;  2HQE A;  1F2Y A;  5I4D A;  5K5P A;  1XPU A;  1A2U A;  1CSP A;  4LUV A;  3HKZ E;  4BS9 A;  1EY5 A;  2AQ1 B;  3RLF A;  1CQF A;  5EPK A;  2NTT A;  2JA7 G;  1G2S A;  1KLG D;  4JVZ A;  3STB D;  1X6O A;  3H6M A;  1G6P A;  4B3S Q;  2JA9 A;  1X65 A;  3MTS A;  1WTW A;  5FKA C;  4IPD A;  4WOR A;  4A3J H;  3OW7 A;  3NE5 B;  1EL0 A;  1Q8K A;  4J6H A;  1V1O A;  1NCV A;  2O2L D;  5M5X H;  4Y52 H;  3QIA A;  2B63 H;  2IPK D;  4PZ7 A;  2F0M A;  3Q22 A;  1U4P A;  2R92 H;  3OPO A;  3Q0A A;  4A3B G;  4S3S A;  4DR3 L;  4LUZ A;  3M4O B;  3KBG A;  3K5N A;  3Q24 A;  4YY3 L;  3UE1 A;  4K0K L;  2ASB A; 
#chains in the Genus database with same CATH homology
 3NHH A;  3WDN A;  3NBI A;  1V1P B;  3A56 A;  4QUF A;  1B3A A;  1XXG A;  2WP8 J;  4RCN A;  4LK1 C;  1SE2 A;  2IX1 A;  3PO3 B;  2B2U A;  3HGB A;  3VYR A;  2J4X A;  4FF3 A;  1MSG A;  2XRQ D;  2EJG C;  5IGE A;  2EJM A;  4DAP A;  4FXG C;  1QWY A;  1Z6H A;  1FNU A;  3TZU A;  1F2L A;  1F2Z A;  4ZKB B;  5J1Z A;  1WD1 A;  1JOR A;  4KJO A;  3NTI A;  3IKJ A;  5A2Q L;  4RHS A;  3T13 A;  5JPN C;  2K32 A;  2ZXR A;  4IUT A;  1GXD C;  3J7A V;  1GHK A;  3ERQ A;  1ENF A;  4F7X A;  4KD4 A;  3EJI A;  1NR4 A;  3HZX A;  4PMB A;  1DON A;  1I6V C;  3BDO A;  3D4W A;  1T5E A;  1IYU A;  1E0B A;  1VF5 C;  5T1G A;  2F03 A;  2JE6 I;  3A54 A;  2F0P A;  4K14 A;  4IFD H;  1OXS C;  1SYG A;  2ICE C;  4C3H G;  1I3Q B;  4OO1 I;  4KV6 A;  5D14 A;  1BF4 A;  1BCP B;  4HCE A;  1SYF A;  2EZV A;  3EFX D;  1BDO A;  5IT9 L;  5CBA E;  4A93 B;  3HOU B;  1PTO F;  4K6L A;  2EYH A;  2B2U C;  1RD9 D;  1TS2 A;  5CV4 A;  2NWG A;  5IGC A;  3SK6 A;  4IUN A;  1SDF A;  3U9O A;  1D1I A;  4XQN A;  5C0X G;  3M3Y B;  2OEO A;  1PRT C;  3D6C A;  3V2T A;  1ESF A;  1MGS A;  4KHV A;  1PZJ D;  3OWE B;  1HCZ A;  1G8Z D;  1PFM A;  4NDX A;  5C4Z A;  1YNN D;  1CQV A;  2IWH A;  5C3X A;  4EQO A;  4F88 A;  3ND8 A;  1BCP F;  2A6H D;  1LTR D;  3E5S A;  5JEA G;  2CW0 C;  3S1M B;  1QCB D;  3GTG B;  5K36 H;  3HOV B;  4MIU A;  2AQ3 B;  1A3T A;  1JWM D;  2B8G A;  4B9W A;  4K5W A;  3U9S A;  2JA8 B;  1CZG A;  1I4Q A;  2BE5 C;  1YNJ D;  1GUW A;  4R8N A;  4DGZ A;  3M7G A;  1GHJ A;  2A69 D;  4PV1 C;  5ISR A;  3PUY A;  5BN5 A;  3OMC A;  5AFW A;  1GUN A;  2EE1 A;  3LWE A;  3PIO 3;  1TWC B;  2EYM A;  3R93 A;  2XVS A;  2KA7 A;  4G4K A;  4IUQ A;  1IW7 D;  2F0L A;  3MXN A;  1WTQ A;  1JCK B;  4QIW B;  4IZ8 A;  5CV8 A;  2O5J C;  2H1E A;  3T53 B;  3VYU A;  5J22 A;  3PIP 3;  3DXJ C;  1TII D;  2VB3 X;  1EY6 A;  3PUZ A;  4KJN A;  1OO9 B;  2M00 A;  5G3L F;  3MEH A;  4DXG A;  1W6K A;  2F0F A;  3C2P A;  3EQL C;  4F8M A;  3S1N B;  4G7H C;  4RGN A;  4CKE A;  4FXD A;  3HP3 A;  5TSS A;  4CHT B;  1PDQ A;  3TP5 A;  3MWY W;  4PMC A;  1STB A;  2EY2 A;  1HRJ A;  1V43 A;  4C1N I;  1ENA A;  2DY7 A;  1H9M A;  4G7O C;  2RSO A;  1H9S A;  1SND A;  3DWQ A;  4JK1 C;  2DN8 A;  2I07 B;  4G57 A;  4ZAI A;  2EPB A;  2NN6 H;  2Q8R E;  2E75 C;  3SEB A;  1H9J A;  4OIK A;  2WII B;  3VYS A;  1WTP A;  1KAB A;  3AMU A;  5JJZ A;  5CC4 A;  2R6G A;  2O4X A;  3S16 B;  1E2W A;  3PUW A;  1CM9 A;  3I8Z A;  2F0J A;  2CQA A;  1WTV A;  1LT5 D;  4FVM A;  1JB3 A;  3G6J B;  2D62 A;  3D3R A;  3FDT A;  4ABN A;  2L11 A;  3GO5 A;  5KRU A;  1SEB D;  2NTS A;  2QEJ C;  2XRS D;  2PZW A;  1XYI A;  2F0N A;  4LJZ C;  1HUN A;  1JOO A;  2NVQ B;  5D3I B;  1TY2 A;  3IFD A;  3GV3 A;  4AYB B;  5C3W A;  5EPL A;  2NVX B;  4PMW A;  3C46 A;  2K01 A;  3FPU B;  2YYZ A;  3TP6 A;  2QKI C;  5IT9 E;  5KND A;  3K7A B;  3KUP A;  3L7Z C;  4XQQ A;  4TKO B;  1Z47 A;  3ZYY X;  1SFO B;  3NP8 A;  2IT1 A;  1JWU D;  2DY8 A;  3H0G B;  1T5X D;  4M8A A;  2F0V A;  2L55 A;  3C1F A;  1Z7T A;  3GTP B;  1CFM A;  4J8Q A;  1Y8O B;  4YIJ A;  1BXT A;  4PQX A;  1Q8I A;  4A3G B;  2Q8T A;  3VR5 A;  1A3V A;  3TBI B;  5C0X J;  4IFD I;  2WB1 B;  1O7L A;  3NTH A;  4RH6 A;  1XWE A;  1DZ1 A;  4K2K A;  4HSV A;  3ITP A;  3MHB A;  1QNU A;  1B53 A;  2EY5 A;  1CK1 A;  4C3J B;  1WCM B;  3TP7 A;  5JAV A;  1O78 A;  4IUP A;  2QCP X;  1D5M C;  5JEA J;  2MUY A;  4QUC A;  5M9O A;  1ET9 A;  4HTH A;  3HOX B;  3VR3 A;  1FD7 D;  1UEA B;  4DA2 A;  1B9N A;  4ILW A;  4BBR B;  4XQJ A;  1I4X A;  2F3V A;  1RJT A;  3RUZ A;  1A6X A;  3NQT A;  3A8J E;  4HMI A;  3L9A X;  1SYC A;  1L0X B;  2B8F A;  5ELF A;  1BBX C;  5C6A A;  4X3U A;  1PXU A;  3T4A C;  3I90 A;  4V0B A;  1QIL A;  4CJ2 C;  2NYZ D;  2D9U A;  4RWS C;  2L0C A;  2KUM A;  1M4V A;  1U9R A;  2A5H A;  2F3W A;  5EBD A;  4KKU A;  1ENC A;  3TZD A;  2EYP A;  3D4R A;  4PNY A;  5ELD A;  1YNN C;  1HPC A;  2SEB D;  3QB3 A;  4IUU A;  2JA6 B;  1Q3L A;  1HXY D;  1EYD A;  4A3M B;  2A6H C;  2L5T A;  4H44 C;  1VF7 A;  1Y1V B;  1S4Z A;  4FF4 A;  5C44 B;  3URY A;  3NK9 A;  4KI0 A;  5ELE A;  3T56 B;  1YNJ C;  4MHE A;  1JE4 A;  1H9R A;  1EYA A;  3K6O A;  4I65 A;  3SR1 A;  2A69 C;  2K1B A;  1BQQ T;  4HSP A;  3PUV A;  5EBC A;  1IKL A;  3PV0 A;  4IUR A;  1ILQ A;  4ZUI A;  2PNR C;  2YU9 B;  2XWB B;  2C9O A;  3R2I A;  1ET6 A;  1SNO A;  4OIJ A;  4CBV A;  1G91 A;  2JA7 B;  2MGS A;  2EJF C;  4NW2 A;  1D1K A;  1WTX A;  3JAM L;  4FO2 A;  1O7Y A;  1ZKO A;  1IW7 C;  3L3O C;  1EZ6 A;  2JP1 A;  1QE6 A;  1HA5 A;  4A3B B;  1DOM A;  4O42 A;  4DU9 A;  3VA7 A;  4DNT B;  2XN9 C;  5EQ0 A;  1FR3 A;  3NTK A;  3K57 A;  1GJX A;  2E2I B;  4XT3 B;  5I2Y A;  4NKL A;  2FIN B;  1LTI D;  2JEB I;  1CTM A;  2KVM A;  1JR0 D;  5LL6 X;  1PZK D;  4KY7 A;  2E2H B;  4A3J B;  2OT2 A;  4BA1 I;  2K28 A;  3I4M B;  2A6E D;  4QCL A;  1B4O A;  3HOY B;  1KLU D;  2F0D A;  5T1I A;  3DHQ A;  2AUK A;  3X3M A;  4X3T A;  1Y8P B;  4ID6 A;  1U4L A;  3EVQ A;  4U67 3;  3ND9 A;  2E2J B;  1W6J A;  3D8G A;  4KY5 A;  4B9X A;  4K5V A;  2WAC A;  3NQI A;  3LX0 A;  3OOC A;  1LTS D;  2ID0 A;  2XSC A;  3S9W A;  1ML0 D;  4FF1 A;  2MPM A;  1PTO B;  1Y1W B;  3GV6 A;  5IOC A;  3V96 A;  2K33 A;  1HQR D;  3GTK B;  3C3L A;  1B44 D;  5IIF A;  1RTN A;  3SHL A;  2GA4 B;  1EQT A;  3KK7 A;  2PW5 A;  4JBW A;  4C1N K;  1K8M A;  2BDN A;  2IW3 A;  1CA5 A;  3G7L A;  2FHT A;  2ZT9 C;  2EY1 A;  1STH A;  1ESR A;  1KAA A;  1GOZ A;  5I6Y A;  4C3H B;  4DFA A;  5FO9 B;  1EWH A;  1Q12 A;  2KHS A;  2MP1 A;  4L6T B;  3D6W A;  3OSO A;  4IFD G;  2NZ1 D;  1STG A;  4KD3 A;  3A8K E;  1VMP A;  1G6Z A;  3BVG A;  5C5M A;  2L12 A;  5EGT A;  1LV9 A;  2EVB A;  2EXZ A;  1ZEQ X;  4B08 A;  2LFN A;  5DM6 3;  2B2T A;  4ZYS A;  3W2D A;  5DNF A;  1EWC A;  4Q5V A;  5IGB A;  3S2D B;  4OHJ A;  1LT3 D;  3CRK C;  1EFI D;  1SXT A;  2RBM A;  3IFT A;  5KYL A;  2AQ2 B;  5CR3 A;  4DK1 A;  4KN4 C;  1R4Q B;  1KDC A;  1ZXT A;  3BVZ A;  4G7Z C;  4BY7 B;  3DEO A;  3DUZ A;  2D2C C;  4RA8 A;  2F0K A;  5CV9 A;  2F0I A;  2SNM A;  1JOQ A;  2EYO A;  1S5C D;  1B9M A;  5K36 G;  2PO4 A;  5EKK A;  2B2W A;  3KLS A;  3LNN A;  1JWS D;  2BOS A;  3GTQ B;  3MA2 B;  2BCO A;  5E3F A;  3MC0 B;  3E0J A;  3JAM E;  4KMU C;  1OXX K;  3GTL B;  1O80 A;  3EA6 A;  1V8Q A;  2I46 A;  4R8I A;  5C3E B;  5JVH 3;  5I9P A;  2XWJ B;  4H0L C;  1E2Z A;  4OGQ C;  3TN2 A;  2QDB A;  5LHY 1;  3A55 A;  4IN3 A;  4DF7 A;  1DCZ A;  1MD2 D;  1WD0 A;  1D5Z C;  1VMC A;  1FNV A;  5CV7 A;  5C4J B;  3M4Y A;  1DM0 B;  4HCS A;  3A7A B;  4K8J A;  1G29 1;  1TWA B;  3I3C A;  3J81 L;  2K05 A;  4ME5 A;  2F0T A;  3MAQ A;  2RSN A;  4Q0F A;  2M2L A;  5F2D A;  3BYT B;  2F4I A;  2E76 C;  3HEJ A;  3V05 A;  5IGG A;  4FNF A;  3NPP A;  3SXH A;  1F2M A;  1TT2 A;  3ERO A;  1SNQ A;  2B2T C;  1ILP A;  3A7L A;  1CHQ D;  2OF1 A;  2EDG A;  2FMM A;  3S1Q B;  4HED A;  4UDU C;  1Q1B A;  2JYO A;  2R7Z B;  4BY1 B;  5HGT A;  4K2L A;  5A2Q E;  4LMQ D;  1C48 A;  4K5X A;  4L8J A;  5ELC A;  3BS1 A;  1EIG A;  1L0Y B;  1A15 A;  5I2X A;  3TDQ A;  1NSN S;  4FP5 D;  3NUC A;  1LTA D;  1SJH D;  2B2W C;  4EGV A;  3CHB D;  2NN6 G;  3X3N A;  1PRT B;  5E4X A;  1X3P A;  5D65 A;  1Y8N B;  1ZYR D;  1DYQ A;  4XYQ A;  5M5Y B;  2J7Z A;  5KGU A;  1TS3 A;  3F2U A;  3H3V C;  2A6E C;  1RKN A;  2FMC A;  1SAP A;  3HS0 C;  4HAE A;  4QMG A;  2EYL A;  1E2V A;  4OL7 A;  2PPB C;  5KEE A;  5KNB A;  1FGB D;  4A3K B;  1K83 B;  1LT6 D;  4KKT A;  1SSO A;  1AFP A;  3GTO B;  3I70 A;  4ULL A;  4XYO A;  1NUC A;  1SYB A;  1AZP A;  1LAB A;  4DAY A;  2QF7 A;  1PRT F;  1AEX A;  2WAQ B;  4EQN A;  3P1H A;  1OXT A;  2F0E A;  2LY7 A;  1EY7 A;  2F0O A;  2BA1 A;  2EYJ A;  4R9W A;  4IFD J;  2FJ2 A;  2Q8I B;  4OO1 H;  4CKC A;  1HFN A;  1RHP A;  3E6Z X;  3BZD B;  4CJ0 B;  1LTG D;  5E4W C;  3K5O A;  3WOF A;  1DXM A;  4QF4 A;  1X3Q A;  1F9R A;  4X3S A;  1SJE D;  1SNC A;  1QOH A;  3S15 B;  1CT1 D;  3QO2 A;  5A35 A;  1STE A;  2K5W A;  3SK4 A;  5M5W B;  1PLF A;  2Z4I A;  5CV6 A;  1NR2 A;  1EEF D;  3WOE A;  1WVL A;  2HDL A;  1RF2 D;  3AB9 A;  4WJW A;  1HHV A;  1CI3 M;  2AWN A;  1XTC D;  1CHP D;  1EY4 A;  3RD4 A;  4DN4 M;  3VR6 A;  2N55 A;  5FO8 B;  3LWU A;  3I4L A;  3OWF A;  3PUX A;  2K7V A;  2C5C A;  4X3K A;  3VR4 A;  2VUM B;  1IHZ A;  4KTA A;  1BOS A;  4O1N A;  4RCO A;  1NAP A;  2G9H D;  4RGO S;  3CU7 A;  1MSH A;  3FEW X;  5D3D A;  2WKD A;  2JXM B;  5KNC A;  1TWH B;  1S5F D;  3T16 A;  3J81 E;  3QWN A;  1KNA A;  2F0U A;  4TRD A;  4C3I G;  5JOB A;  3O13 A;  3SVM A;  4F87 A;  4ZRZ A;  5FLX L;  1SE3 A;  1BCP C;  3NWS A;  1MI2 A;  2X6L A;  3HOW B;  2VB2 X;  1BR9 A;  4DAV A;  3MFG A;  2K5Q A;  1SMY D;  3FVQ A;  2D5D A;  1O7Z A;  4WFN 3;  3HG9 A;  4A3F B;  1EOT A;  1I4P A;  1TS5 A;  4RKL A;  1PZI D;  2DNE A;  2B2Y C;  2PQE A;  1C8C A;  1JQY D;  5JVG 3;  2PZT A;  1WTO A;  4M1U B;  5COR A;  1RDP D;  3IAY A;  1STN A;  4L63 B;  2AUJ D;  1R9T B;  4RHR A;  4FYD A;  1DJR D;  4RAU C;  4KKS A;  1PMR A;  1M8A A;  1SNP A;  1IYV A;  4FF2 A;  3MZ5 A;  1KTK A;  1G2T A;  3QG1 A;  2TSS A;  5BN4 A;  1Y69 U;  4RFB A;  2JEA I;  1F77 A;  2CHB D;  1S5E D;  3VA5 A;  3PMF A;  3DWA A;  2WIN B;  4ZLT F;  1GUT A;  3FRP B;  2L4N A;  5M5X B;  5COY A;  1H9S B;  2B63 B;  2NN6 I;  1QJO A;  2R92 B;  3J80 L;  5FO7 B;  3BDC A;  3GP7 A;  1FNW A;  4DNR B;  1X32 A;  2J0T D;  4A3D B;  1B2T A;  4K6D A;  2PYK A;  1JIC A;  1BNZ A;  3A8I E;  1PTO H;  3KBX A;  1H9K A;  1KDB A;  3H94 A;  2F0S A;  1I4G A;  3K5M A;  2PCF B;  3P75 A;  4NMZ A;  5DAU A;  1KDA A;  5IGD A;  2IJ0 A;  4XIG S;  3HRZ C;  2KCC A;  4EQP A;  3MXG A;  1JOK A;  2R61 A;  2TMP A;  4XXE A;  1WTR A;  3SDZ A;  1EIH A;  3GTM B;  1DOK A;  1AW7 A;  3K58 A;  1ZYR C;  4E6I A;  2PMZ B;  1U4M A;  3D31 A;  3DMU A;  3I91 A;  1AZQ A;  1OXV A;  1K8O A;  4CGY B;  4GZY C;  3UI2 A;  2XNA C;  1SYE A;  4Z9C B;  3S2H B;  2E74 C;  2PZU A;  1SBB B;  3GTJ B;  2LKV A;  4FXK C;  3I4N B;  5BN3 A;  2JSO A;  2RVL A;  5C0X H;  2R3Z A;  2IX0 A;  3C1E A;  5M3F B;  2LS0 1;  1S5D D;  1I4R A;  1QG7 A;  4UAI A;  1TR5 A;  2RDH A;  1F9P A;  4HMJ A;  1ICW A;  1HFG A;  3OIQ A;  4HR7 B;  1HTL D;  3NXW A;  1PTO D;  4BWG B;  5ELB A;  2Z8L A;  1RTO A;  3MXU A;  5JEA H;  2O5I C;  1EYC A;  4CKB A;  2KQ3 A;  3RZD B;  1QB5 D;  1EZ8 A;  1F9S A;  4KY6 A;  3TSS A;  1EY8 A;  2KJX A;  2NVY B;  2RQX A;  2Z1C A;  2NUC A;  3NWT A;  2VXW A;  3QOJ A;  3R8B A;  2F0Q A;  1PFN A;  2EYF A;  1EY0 A;  1LO5 D;  1AN8 A;  1TWF B;  4EVO A;  2KEE A;  5CV5 A;  2ENB A;  1D2B A;  1BCP D;  3BG3 A;  5FLX E;  1VDZ A;  3D4D A;  3K0Y A;  1DOL A;  2A68 D;  5NUC A;  2NBF A;  1R4P B;  1B1Z A;  5I9O A;  2F0W A;  3QOL A;  5FK9 C;  2F0G A;  3BVM A;  1PFB A;  4KK7 A;  1STY A;  4N9T A;  3Q6S A;  4IAL A;  3IL8 A;  4J1M A;  2N88 A;  2ZXP A;  1EU3 A;  5I6W A;  1JC7 A;  2K03 A;  2K6A A;  1GUG A;  3K5L A;  3R2T A;  1Q1E A;  5EPJ A;  3J7Y W;  3HOZ B;  1F9Q A;  2WKC A;  1GUS A;  4DXF A;  3J7A F;  2G9D A;  5IGF A;  2V4D A;  2K04 A;  4BBS B;  4IQZ A;  4RKB A;  2EOT A;  1UAP A;  5DM7 3;  1TVX A;  3SE0 A;  2B2V A;  1EU4 A;  1VCI A;  1XX8 A;  1AP0 A;  2RA4 A;  3J80 E;  1QNK A;  3KF8 A;  5G3L D;  1SMY C;  3FKI B;  3DWP A;  4U68 A;  4H13 C;  1V1P A;  3VR2 A;  3BYY B;  1SNM A;  5EJW A;  3S17 B;  1GUO A;  1U4R A;  2SDF A;  5CMD A;  3FMC A;  1C4Q A;  3MFY A;  3GQB A;  4K8I A;  4V19 0;  2H4O A;  1J9O A;  3DM1 A;  1KNE A;  4QB4 A;  1TKW B;  3QJY A;  3TP8 A;  2CVR A;  4XDX A;  4IUV A;  5CBE E;  2JA5 B;  2M9V A;  4A3I B;  4BA2 I;  1HQM C;  2Y0S B;  2XIW A;  2ZXO A;  4ZKC B;  1EQV A;  1S5B D;  4Y7N B;  5HUR A;  2KED A;  3DEP A;  3H91 A;  4H7B A;  5DEH A;  1I6H B;  1A2T A;  4MN3 A;  1B50 A;  1D6E C;  5CGK A;  2L9H A;  3PO2 B;  4WRD A;  4RGT A;  3MVV A;  4CJ1 B;  2RKS A;  3NSW A;  2HCI A;  1UUP A;  1LTB D;  4C2M B;  2RDF A;  3R3O A;  1D5X C;  2RDG A;  2R93 B;  3S1R B;  1ROD A;  1HUM A;  3CKI B;  1II3 A;  3CQZ B;  5KYI A;  3Q23 A;  1DD2 A;  2BDO A;  1J8I A;  4ZQ3 A;  3OHX C;  2A73 B;  3RMH A;  1TS4 A;  3GD7 A;  2B2V C;  2BA0 A;  4ODG A;  3P20 A;  2F1M A;  5KIX A;  3S14 B;  2IX3 A;  3M7N A;  2ICI A;  2HCC A;  1PRT D;  4TSS A;  3T51 B;  4KHZ A;  3AU7 A;  2A74 C;  2NVT B;  2X69 A;  3RZO B;  3MXP A;  3I73 A;  5JPM C;  3KLR A;  2MJ8 A;  2B2Y A;  1TWG B;  1ONL A;  2X6G A;  5C0X I;  4C3J G;  2SNS A;  1TY0 A;  1HA6 A;  3M85 A;  4OO1 G;  3FPP A;  4LAA A;  2CW0 D;  4I7Z C;  2Z4H A;  2VNU D;  1IKM A;  1TU2 B;  2FFK B;  2NB0 A;  4ZK9 B;  1BUV T;  2BE5 D;  1Q90 A;  1CZW A;  5EKI A;  5C4H A;  3P7J A;  1IL8 A;  1FYC A;  3OIP A;  2KCN A;  4N9P A;  2IL8 A;  3TME A;  1LAC A;  3VYT A;  1LTT D;  1EY9 A;  5LL6 S;  2K5D A;  4XT1 B;  2SOB A;  1PTO C;  1LLR D;  1LT4 D;  2KOL A;  2L1B A;  2PW7 A;  3OMG A;  5IOD A;  2QIL A;  1MBY A;  5C4X B;  4HN7 A;  2B39 A;  3N6R A;  3N52 A;  2HDM A;  1STA A;  1TQO A;  5EKL A;  2OXP A;  3H09 A;  3ONA B;  1OXU A;  1SYD A;  4RGM A;  3BDL A;  1PYW D;  4KN7 C;  3NBH A;  1EEI D;  2MHV A;  2E2D C;  5C5L A;  2HUG A;  3CRL C;  4TQU S;  5CYU A;  4DK0 A;  4C56 C;  2LMC B;  4P2C B;  1UNS A;  3KLS X;  3SK8 A;  5J39 A;  1CA6 A;  4C3I B;  4XTC S;  2A68 C;  4NP5 A;  3HKZ B;  1HTP A;  5FOB B;  1I50 B;  5E1F A;  1SE4 A;  1BO0 A;  2EY6 A;  2KEC A;  3K59 A;  5M3M B;  4ZUJ A;  3SK5 A;  2DNC A;  1RCV D;  2WV6 D;  2F0H A;  3I72 A;  4A3E B;  2AWO A;  3W3A A;  1I4H A;  1A3U A;  2HQE A;  1F2Y A;  5I4D A;  5K5P A;  1A2U A;  4BS9 A;  1EY5 A;  2AQ1 B;  3RLF A;  1CQF A;  5EPK A;  2NTT A;  1G2S A;  1KLG D;  3H6M A;  3MTS A;  1WTW A;  5FKA C;  4WOR A;  3OW7 A;  3NE5 B;  1EL0 A;  4J6H A;  1V1O A;  1NCV A;  2O2L D;  3QIA A;  2IPK D;  2F0M A;  3Q22 A;  1U4P A;  3OPO A;  3Q0A A;  4S3S A;  3M4O B;  3KBG A;  3K5N A;  3Q24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...