1K8OA

Solution structure of the lipoic acid-bearing domain of the e2 component of human, mitochondrial branched-chain alpha-ketoacid dehydrogenase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
87
structure length
87
Chain Sequence
b'MGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E2 component of Branched-Chain alpha-Ketoacid Dehydrogenase
publication title Solution structure and dynamics of the lipoic acid-bearing domain of human mitochondrial branched-chain alpha-keto acid dehydrogenase complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 7
structure length 87
sequence length 87
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2001-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1k8oA00
2JEAI 1HCZA 2BA1A 2A6EC 3A8IE 1CI3M 2JE6I 2ZT9C 3I72A 1O7LA 1DCZA 3VA7A 2KCCA 3RLFA 4KMUC 5BN3A 4XIGS 1K8MA 1Q1BA 2D62A 2K32A 4LK1C 1V8QA 4BA2I 2A6HC 3VR4A 2E76C 1E2WA 3QIAA 4HR7B 1OXSC 1Q1EA 3A8JE 2KA7A 3M4YA 3MXUA 3IFTA 1GUGA 3PUXA 4I7ZC 3VR6A 5KNDA 4OO1H 1K8OA 3NE5B 3BG3A 3M85A 1O78A 2EDGA 2BDOA 1OXTA 3FMCA 3A7LA 2F1MA 3D4RA 1GHJA 1T5EA 2EJFC 2A68C 2JEBI 1ZYRC 2EVBA 3W3AA 2E75C 2D5DA 3MFYA 3T51B 2EJMA 1TU2B 1YNJC 1H9KA 2DNCA 5C0XH 4KKUA 3HGBA 1GUOA 3T56B 2B8GA 5A35A 4RCNA 1DXMA 3PUVA 2EJGC 2AUJD 3I73A 1BDOA 1H9RA 4OO1G 1Y8PB 1CFMA 2O5IC 1E2VA 1Z7TA 4TKOB 3VR2A 2NN6H 2PCFB 1IW7D 2AWOA 1FR3A 4GZYC 4PV1C 1LABA 4L8JA 4G7OC 1H9MA 1GHKA 3OW7A 3QG1A 2BE5D 2DNEA 3FPPA 1HQMC 3L7ZC 1IYVA 4BA1I 5C0XG 3VR3A 4IFDG 3A8KE 1I6VC 4H0LC 3PUYA 4JK1C 4KN7C 2JXMB 2D2CC 2NN6I 3LWUA 4DNRB 5KNCA 1Q90A 2B8FA 4OGQC 5KNBA 4KKTA 3OOCA 3T53B 1EWHA 2QF7A 4KHZA 3IKJA 3KLRA 1Z6HA 2A69C 2CW0C 3LNNA 1H9SB 4H44C 1VDZA 4DNTB 3CRKC 3U9SA 1PMRA 1GUTA 1HPCA 2K7VA 2IT1A 4KKSA 5K36H 1A6XA 4JBWA 1HTPA 2R6GA 2L5TA 2PPBC 3D31A 1OXVA 1V43A 3PUWA 1Y8NB 1Q12A 2A6ED 1IYUA 1Y69U 3ND9A 3H94A 1FYCA 3A7AB 5JEAH 1E2ZA 1Y8OB 1VF7A 1IW7C 2A6HD 2YYZA 3ND8A 3QJYA 3AB9A 5K36G 2BE5C 2NN6G 5BN5A 4G7HC 2PNRC 2DN8A 3I4LA 4DK1A 1H9SA 2LMCB 2BA0A 2V4DA 3OPOA 3PV0A 2A68D 1LACA 3M7NA 1H9JA 2AUKA 1YNNC 1DD2A 2E74C 4LJZC 4H13C 3GQBA 5JEAG 3TZUA 4TQUS 2O5JC 1G291 1TKWB 1ZKOA 1OXUA 3SDZA 1CTMA 1ONLA 2A69D 1GJXA 3CRLC 1QJOA 4KN4C 5BN4A 4KI0A 1B9NA 1OXXK 3GD7A 3N6RA 1VCIA 1GUNA 3BDOA 3DXJC 1GUSA 3PUZA 3SE0A 4G7ZC 1B9MA 1VF5C 4DK0A 3EQLC 4XTCS 2Q8IB 4IFDH 4IQZA 1SMYC 3P20A 2K33A 3VR5A 3WDNA
chains in the Genus database with same CATH superfamily
1TIID 1WD0A 2A6EC 3A8IE 3I72A 3CCSA 1HXYD 3HOZH 3K80C 4R4QA 4ZRZA 1PH5A 1PZKD 1JJGA 1OXSC 3OMGA 1GUGA 2GA4B 3PO2H 4BBSH 2A74C 3VYSA 2RDHA 4QIWE 1CT1D 1T5EA 2HUGA 2EJFC 3GTJB 1BVSA 1B3AA 1I4PA 3W3AA 3J80c 4DV6L 2F4VQ 5IGBA 1K3RA 2B2UC 4JI4L 3BU2A 5G3LD 1GUOA 1TS2A 2F0TA 1A3TA 4AQYL 1O7IA 1Z7TA 2SOBA 1Q46A 4PNYA 2NZOA 1E1OA 3D8GA 2WINB 3NTHA 3KUPA 4KY6A 4RG1A 2E2HH 4BY7H 1SE4A 2HHHL 4A3IH 3NWSA 5KYLA 1I6VC 2ZJRA 4DV7L 2NUCA 5EJWA 4RHSA 3S1QH 4OGQC 1VQHA 1K9MC 4DV6Q 4POGA 5D14A 1Z6HA 2A69C 4H44C 2IL8A 3HOUB 3H15A 2OF1A 5C44H 3CC4A 5FO8B 2EXDA 4AQYQ 2B63H 4JI5Q 5G3LF 2UUBL 3BJUA 1A6XA 2GN5A 2F0QA 2UXBQ 1SAPA 2WB1G 4XYQA 3I4NH 5CV4A 1S5ED 3GTOH 4O0AA 5C5MA 3W2DA 3F2DA 1PTOF 1FYCA 3MZ5A 2EYFA 2HHHQ 5EKKA 2A19A 4ZLTF 1S5DD 4GN5A 1KDBA 4DAPA 2EXZA 4TRDA 2K4KA 4MHEA 3EBEA 1XTDA 3BZDB 1VQFA 1EYCA 1KNEA 4IOCA 1STEA 2FXQA 4JI7L 2TMPA 4DR6Q 1HFNA 4B3ML 3TZUA 4A3FB 1DM0B 2VB3X 3A56A 3SDZA 5M5YH 2UUBQ 1CTMA 3JAMi 1R4QB 1VQ8A 1DOKA 4LFAQ 1DOLA 1YJ9A 5C4JH 1CZGA 1SJHD 2R92G 3PGZA 4IUQA 1WJJA 1RD9D 1EYAA 1W3SA 1ZXTA 3F2BA 3OTOL 5DM63 5BN3A 2NBFA 2EPBA 4BY1G 3JAME 1G2TA 4JI7Q 1HNWQ 3A8JE 3I91A 4KHVA 1TS4A 3CCRA 4RKBA 1RJTA 4B3MQ 2FHTA 3H0GB 1B50A 2VS1A 4KHPL 4OWWB 1F2ZA 4V0BA 4C3JG 1Q82C 2D5DA 4GLXA 2MQHA 3L0OA 5C0XH 1HNZL 5CV8A 3PF5A 1NE3A 2F0HA 4DR4L 3GTGB 4ME3A 3R93A 2O5IC 2VB2X 1LV9A 4K2LA 4GLAC 4DR3L 3NQTA 4OX9Q 4HEDA 2R7ZH 3ULJA 2Y0SB 1PHJA 3H09A 1LTTD 4LFBL 4FF1A 3I55A 3E9IA 2B2VA 2JXMB 3QWNA 3G6JB 3IRBA 1Q90A 3D6CA 4JI6Q 3RZOH 1DOMA 4RWSC 3HKZG 2SEBD 4LNQA 3OW2A 3T1HQ 1H9SB 3AEVA 2ENBA 4CKCA 5KRUA 3D3RA 5ELFA 1TWGB 3C1FA 2K14A 2K28A 1I3QH 4J1MA 5FJ8G 5JJKA 1J5EL 2LFNA 4FO2A 3X3MA 1BNZA 3H94A 3HFZB 3VA5A 2B2TC 5CV7A 1VF7A 4LFBQ 4A3GB 3VYRA 2YYZA 4IJHA 4NDXA 4A75A 4YWMA 4DGZA 4CGYB 1I4XA 1PH9A 3GTPH 2WP8J 1NR2A 3NK9A 4P2CB 3RZDH 1SYDA 3BS1A 4C3HG 5EPJA 1TXYA 2B2YC 2ZTCA 4GOPA 4QUCA 1ONLA 3E0EA 4UY8C 2VL6A 4AH6A 1S5FD 4NXML 3N6RA 2JA6G 3A55A 4KD4A 4XXEA 4YY3L 4L6TB 4G7ZC 1LT3D 1HTLD 2Q8IB 2YTXA 1AW7A 2VQEQ 4LUZA 1RKNA 1YITA 4JI8Q 5FLXE 5COYA 1IBKL 1IXRA 3CMAA 2NVXB 2K32A 3TP5A 2J7ZA 3MEFA 3PO3B 2BDNA 4JBMA 3KF8A 3M4YA 3PUXA 2AWNA 2RSOA 4LF9L 5CR3A 2PMZE 4IZ8A 1Y1WG 3KDFB 4HIOA 5BR8L 1RL2A 4NXMQ 3KBGA 5C3EG 4X3UA 4KKUA 3EA6A 3T56B 3JAMc 5LMNW 1WTQA 1B2TA 2CCZA 1KQSA 2AMCB 3FKIH 5IOCA 5IGDA 1VQPA 1EUJA 4MTNA 1IBKQ 4BY7B 1IW7D 1WCMG 3TP8A 3QG1A 4DAMA 2BE5D 2PQAB 1TWCB 4B3RQ 1MHWC 1UE5A 5IGFA 3S1QB 1PTOC 2H4OA 5GAGC 4LF9Q 2P5ZX 3WOEA 4DV2Q 2ASBA 4A3MH 1EQTA 4LF5L 4IUPA 4C2MB 2DJFC 1W2BA 5JJLA 1DGSA 4PMWA 5C44B 3E9HA 1EL0A 4GKJQ 3CRKC 4LF7Q 3SR1A 1F9PA 4O1NA 2F0DA 4HMIA 3OWFA 3KYHC 5IY0A 3IAYA 2MO0A 4B3TL 3D0FA 2ALYB 3DM3A 2MP1A 3EIVA 3EN2A 4RGMA 1L0YB 3M3YH 3J7AV 4OXPA 3SXHA 4QB4A 4DV0L 1JICA 2K5QA 3TP6A 2LXJA 3U50C 4YHHQ 3J7ZC 4X65L 1B4OA 2RDGA 1MSGA 5E3FA 4UPAA 2NVYH 3HOYH 4A3JB 4LF4Q 2X6GA 5M5YB 1HUMA 4A3KG 4FYDA 5ELOA 1CKMA 2JA5H 3TMEA 3BDCA 3CCVA 1SMYC 1FGUA 2CQOA 3WDNA 4DV0Q 4UP8A 4B3SQ 1ENAA 2NZHA 1C7YA 4J8QA 1EY8A 1LO5D 2UUAL 1X65A 1K0RA 5AFWA 4EQ5A 1E3PA 4DV3Q 1V8QA 1EZ6A 2E2IH 4RGTA 2JA9A 4I7ZC 1ET9A 5TSSA 1TWAH 4AYBE 1PTOB 5FLXc 3KFUA 4LAAA 2K04A 1XMQQ 4XQJA 3P7JA 2K5WA 3D4DA 1Q8IA 4B9XA 2IX1A 3URYA 3MXGA 3I70A 5IT9L 1I94L 1N9WA 3A5ZB 3PUVA 2EJGC 3U4ZA 1PA6A 1IBLQ 1SNCA 2CKZB 1QB5D 2Q2TA 5DM73 2PCFB 1S72A 2KECA 4A3BG 4R4TA 1L0XB 1CA6A 1BCPF 4HIKA 1FJGL 4XDXA 1IKMA 2KEEA 4HIMA 4OL7A 4KN7C 4IJLA 4H02A 3RLOA 2Y0SE 2M9VA 3HOXG 3GTJH 4HMJA 4HJ8A 1CK1A 2KEDA 1QILA 2QF7A 4RGNA 4JYAQ 5CV5A 2Z6KC 4L5SA 1T5XD 1I94Q 3Q22A 2WAQG 1X56A 5D65A 3SHLA 4X64L 2N3SA 1QZGA 4LMQD 1X3PA 1PYBA 3CCQA 1FJGQ 4RMFA 2D0PA 4BBRG 4O42A 5M3MB 4F7XA 1EY9A 3GTPB 1UNSA 2PW7A 2QEJC 2FMCA 4BS9A 2WKDA 5I6WA 2EYMA 4R9WA 1XJVA 1OO9B 3M7NA 4ZKBB 1Y1VG 4B9WA 1AE2A 3J81j 1YNJD 2F0JA 1NUCA 3AQQA 2IY5B 4LF6Q 1XPRA 2A69D 1GJXA 1A2UA 2OT2A 3MEHA 1K8GA 4A3LG 1F2LA 3AFQA 3Q24A 1GD7A 4N8FA 4OO1I 1K73C 4RGOS 1SE3A 3T4AC 5JPMC 1DCZA 5M3FG 4KJNA 1HRJA 3QOLA 3HZXA 5C4ZA 3BYYB 4PMCA 1WFQA 4IOAA 1EY0A 4A3FH 1JQYD 2L1BA 4DV1Q 2F1MA 2NVTB 4L5QA 2A68C 1PH4A 3FHWA 5IYDH 2K6AA 1PLFA 4ID6A 3K7AB 2MO1A 1EWIA 1AE3A 4HCEA 1G2SA 4X66L 1M8AA 1ASYA 4JV5L 4FXGC 4G4KA 2F0FA 3I73A 2E5LL 4HJ5A 1N36L 1SE2A 1PH7A 1A8VA 3RMHA 4IPGA 3PIP3 3ULPA 4M8AA 1T9HA 3L7ZC 3TS0A 1EY6A 4XT3B 1VQKA 4ALPA 2JYOA 3ONAB 2B2TA 4F8MA 5LL6S 1VQMA 2WV6D 2H1EA 3H0GH 1JOOA 2AQ2B 2VZAA 1B7YB 2OTJA 1X3GA 1PH2A 3KLRA 4MTKA 3MFGA 3S14H 3CQZH 1TWFH 2XRSD 4MZ9A 1D7QA 1JJ2A 1HPCA 2KENA 2MPMA 1NJIC 2B2YA 4ZAIA 4A93B 2E2JB 1CQVA 3RN5A 3M3YB 2NZ1D 1IYUA 4BY1H 2LXKA 1XMOL 4P71A 1Y8OB 3Q6SA 3FEWX 3UE1A 3AB9A 1V1PA 4CDDC 4CKEA 1EU3A 3UE0A 3NTIA 3ZJYC 2VUMG 4C3JH 2F0UA 2V4DA 1HR0W 4ZYSA 1D5XC 3L9AX 2E74C 3TSSA 1K0SA 4HTHA 1C8CA 4JVZA 4GNXA 3W1GA 1E24A 2QW7A 2KUMA 5FLMH 3CRLC 1Q7YC 2JA5B 3RR5A 1W6KA 4DV4Q 2LSSA 4NW2A 3EQLC 4EGVA 3KLSA 1E0BA 1EEFD 1TWHB 2F0LA 4Y7NB 2ZT9C 3G71A 2RF4A 1DONA 4RAUC 3RLFA 3DMUA 2XRQD 1SROA 4TVAB 1NNXA 1VQ5A 4YWKA 4ODGA 4DXGA 1BBUA 3K5LA 3MA2B 1F77A 1BCPC 1G6ZA 3M85A 2WACA 5I9OA 1S5CD 2RHQB 4XYOA 5EGTA 4P72A 1BBXC 5CBAE 1U4MA 2Q2UA 5LMNL 5C4XG 2IWHA 5E4WC 3J81i 1NMGA 3WOFA 1O7ZA 1BDOA 5E1FA 1XYIA 1Z9FA 2SDFA 4IUTA 4IN3A 2HIVA 1EQRA 4K0KL 1P16A 4JI3Q 2NVXH 1QWYA 2EQSA 3K0YA 3ICEA 3HKSA 5IYBH 3PO3H 1F9RA 3HS0C 1KAWA 1ICFB 4DUZQ 4JI2L 2Q8TA 3PUYA 3B6YA 3PMFA 4POFA 4OWXB 2D2CC 1F9SA 1NY4A 3FRPB 3GO5A 1K28A 1KRSA 1EY7A 1QG7A 3MXNB 3K57A 1DJRD 3U9SA 2RHSB 4DNIA 2IW3A 3I2ZA 1CKNA 1R9TB 4KKSA 2A73B 1M1KC 4UDUC 5I2YA 3UDXA 1TWCH 3CCEA 1E2ZA 5IODA 2K5DA 3A5UA 4EQPA 2EOTA 1Y1WH 3ER0A 3CD6A 3HOUG 4G7HC 4DXFA 4C2MH 2AKWB 2FMMA 1DYQA 4JI4Q 1PH1A 1STGA 4ZKCB 2EYJA 2UXDL 2BA0A 1JJCB 4C3IG 1H9JA 3GTLB 1YNNC 5E4XA 5JEAG 4X62L 1F9QA 1L1OA 3CAMA 1BCPB 3EVQA 1P8LA 1D5MC 5DNFA 3GDEA 1VCIA 3DXJC 5CV6A 3PUZA 4A3EG 1WOCA 2K5NA 3HOWG 2J4XA 4HJ7A 3OSOA 4XTCS 5IP9H 3S9WA 4DV7Q 2F0PA 3ERSX 2JA7G 2BA1A 3MXPA 3PIOA 5ELBA 1KABA 2N78A 1LTGD 5I4DA 1IL2A 4BA2I 4CJ1B 2PQEA 5C0XI 4HR7B 4FXDA 3MXUA 3VR6A 3CMEA 1U0LA 2K01A 3E5SA 4R1JA 4A3JH 3BG3A 2KHSA 1OXTA 4HCSA 2F0OA 3HRZC 2JEBI 2RA4A 1VQLA 2Z4IA 4K14A 2NTSA 3JAML 2WKCA 2DNCA 4DAYB 3PF4A 1MSHA 1HZAA 2K52A 2KQ3A 3K81C 2HDLA 4OO1G 2IJ0A 4AYBG 4RFBA 2JQOA 5IGEA 2X6LA 4K6LA 1JT8A 4EQNA 1CQFA 3DEOA 4BA1I 3SK8A 2N55A 4KK7A 4JK1C 4DPGA 1XPUA 1A0IA 1XTCD 1BO0A 3S1MH 1KLUD 4R8NA 3C2PA 5IP7H 1PTOH 3L3OC 3NBIA 4IUNA 3S14B 5IWAL 3OIQA 4KKTA 3CQZB 3TP7A 2JA8G 1TWFB 1JE4A 1J8IA 1GUWA 4FF2A 3D4WA 3JC66 1PZID 1SNPA 1D5ZC 2CW0C 2MHVA 1CSQA 2R92B 4GLVB 1PMRA 1ILQA 2F0IA 4OEMB 2K7VA 2IT1A 3OTOQ 2FFKB 2Y0SG 3J81c 2A1AA 2ATWA 1G51A 1X3FA 3OHXC 4A3CG 4EVOA 1OXVA 5JOBA 4BY1B 1N8RC 4B08A 1IL8A 2B39A 4UAIA 4GKKL 2X69A 3R8BA 1UE7A 4KHPQ 2A6HD 3WWVA 1XX8A 1UEBA 3STBC 5FOBB 5K36G 2JSOA 5BN5A 4NPSA 4C3JB 2R93G 1HNZQ 4C1NK 2R61A 3ERQA 1B1ZA 5F2DA 4DR4Q 4PG3A 3A74A 2OWOA 3NSWA 2HCCA 3BZCA 5CBEE 4S3SA 1EY5A 1SRUA 2XWBB 4DR2L 3IL8A 4DR3Q 4WRDA 4A3GG 5E7NA 1PRTD 3GD7A 1GUSA 4DK0A 4DR5L 2RBMA 4TSSA 1E22A 1VMPA 3DWAA 3S1RB 2YU9B 1U4LA 5M3MH 3KK7A 1JWUD 5GROA 2JEAI 4HJ9A 4DA2A 4JI0L 2L4NA 2H5XA 3HKZB 4QJFA 3F2UA 1STNA 4XIGS 2UU9L 4LK1C 4MN3A 3NELA 1QE6A 5DLQE 1EEID 1TY2A 3CF5A 2I0QA 5GADC 5C6AA 5FLXL 5D3DA 1YIJA 4Q0FA 4QF4A 1YI2A 3HOZG 1J5EQ 3NBHA 2K75A 2V1CC 2Z9HA 4OIKA 1D6EC 1NR4A 5I9PA 1HUNA 4IPCA 1PRTF 4RCNA 1N33L 3G48A 1QNKA 1QVCA 2NB0A 1V1OA 3PO2G 1UUPA 4BBSG 4OELB 3S2HH 4L8JA 2ZTDA 2DNEA 4XT1B 2UU9Q 5EPKA 1B53A 1WTPA 5T1GA 1SYFA 1E1TA 4KLKA 2PYKA 2LKVA 2NVTH 1MGSA 1SYBA 4YY3Q 4APVA 2ES2A 3K7AH 3CCJA 2A8VA 3Q8DA 1KTKA 4ZK9B 1Y14B 5C4HA 1N33Q 4A3IG 2RVLA 4GS3A 2L11A 4JBWA 1XPOA 1JB7A 1PZJD 1TY0A 4KV6A 1S4ZA 2F0VA 2QGQA 1GOZA 4RA8A 4A3DG 4JBKA 1X54A 1WTHA 1Y1WB 1LM0A 1SFOB 4P74A 5IYCH 2G9HD 5AJ3L 2B63G 5BR8Q 2F3VA 2UUCL 3RLNA 5C3EB 1KLGD 5HURA 5IGGA 3I4NG 4DK1A 1II3A 2F03A 1ZKOA 2HDMA 3LX0A 2F0GA 1I4GA 4A93H 2E2JH 3CHBD 4KI0A 4BWGB 3HOVG 3L2PA 5EQ0A 4LUOA 3SK4A 1EIYB 4IQZA 1AFPA 2K03A 3VR5A 1EYGA 1JMCA 4LF5Q 5A2QE 1I4HA 2RKSA 2G9DA 1VQGA 1F2MA 3MVVA 1HNXL 2D62A 2F0EA 2I46A 5EPLA 4DUYL 4O2DA 2Q2HA 3W5OA 1S40A 2ZXRA 2RSNA 1JORA 3U4VA 3K59A 1XNQL 1K8OA 3S24A 2OQ0A 3M4OH 2SNMA 1MI2A 5FO9B 3G6EA 3HG9A 4B3TQ 2Z4HA 2B2UA 1H9KA 4QCLA 4IPHA 4J6HA 2WFWA 3KF6B 3TQYA 4R4OA 4QQBX 1TWHH 1RTNA 2YV5A 1E2VA 3NEMA 2KBNA 4X65Q 4Y7NH 2N8NA 1FNVA 5ELDA 2VUMH 5IE8A 1SBBB 4PQXA 4ILWA 1C0AA 5CC4A 3CCMA 5C0XG 4RCOA 2Z0SA 3A8KE 4A3KB 4H0LC 1BF4A 3S1MB 3MC0B 1I4RA 1X9NA 2NN6I 1KD1C 1PYWD 1VQAA 4DAVA 1ASZA 3TRZA 4JI1L 3IKJA 4KJOA 3EFXD 1B3QA 3LNNA 4DR1L 2FJ2A 2R7ZG 3PCOB 2KJXA 1QUQB 4K5VA 1MJCA 3QO2A 1RCVD 3M9BA 2UUAQ 1GXDC 1HQRD 3FDTA 4LF8L 2PW5A 1JOKA 4LFCL 1VQNA 2A6ED 4CDEC 4NMZA 4I65A 3S2DB 1EU4A 1RODA 3ND9A 4HIDA 3A7AB 1WTRA 1LTID 3UI2A 5EAYA 4WJ3M 1TVXA 4QY7A 1A2TA 1U4PA 1FD7D 4J15A 4L63B 3UDFA 1O7YA 3I4LA 1H9SA 2R7FA 4JC0A 4JI1Q 2NTTA 2EY1A 4LJZC 1EY4A 5IT9E 2AHOB 3GQBA 4QIWB 3FPUB 1V1QA 3TDQA 1R9TH 2OEOA 4NXNL 4A3BB 1S3OA 4OONA 1ESRA 3NENA 5H1SE 2IX0A 5BN4A 1QJOA 4LF8Q 4P75A 1KDCA 5NUCA 1GUNA 2NYZD 1IYJB 3H91A 1ILPA 1BUVT 2L12A 1B9MA 1VS0A 1VQ6A 1NBWA 3A0JA 3HOXB 1LT5D 1QCBD 5J39A 3VA7A 5JJZA 1I6HB 1LTRD 3H3VH 2WAQB 3HKZE 2DJGC 1E2WA 2JJQA 3BZKA 4IFDI 3GTLH 4GZYC 2KA7A 5HY6A 5CGKA 1RF2D 4KY5A 2EDGA 4X64Q 1QZHA 4YCWA 1LTAD 2EVBA 4ABNA 1RDPD 1MKHA 4BBRB 2B8GA 3T1YL 5M5WB 1H9RA 4EQOA 3S2HB 3DEPA 1AEXA 4QL5A 4IO9A 3VR2A 5J22A 1LABA 1VQDA 2MNAA 3PQIA 4E6IA 1Y1VB 3KJPA 1A63A 1PH3A 1UAPA 1D1IA 3KDFA 1ENCA 3OMCA 5FK9C 3J80L 4DR7L 4OHJA 1AN8A 3FKIG 4FVMA 2B8FA 1VQ4A 3AYHB 2J0TD 5J1ZA 1EIFA 1QVFA 3OIPA 1X3EA 3BYTB 3C1EA 1JC7A 3NUCA 3DUZA 3I3CA 1I5FA 1N32L 5M3FB 2N49A 2EY2A 1VQ9A 4A3MG 2F0SA 2PQAA 4JOIC 1VQIA 3D31A 4RHRA 1V43A 3GTQB 3DLLA 2MGSA 2RDFA 1E7ZA 1Y69U 3GTMB 1GM5A 1IW7C 2I5LX 4CBVA 4LW1A 1SMXA 2BE5C 5I2XA 1HHVA 2F3IA 5ELEA 1PRTB 1YZ6A 2PO4A 4HN7A 4X66Q 4PZ7A 2BOSA 3I56A 4JV5Q 1HZBA 1DD2A 4GN3B 2R92H 2Z1CA 2XSCA 2YTYA 2E5LQ 1LTBD 1N36Q 3I4MG 1TR5A 1B44D 3EJIA 5FKAC 4GOPC 2CW0D 4DV5L 3KBXA 1EIHA 4I7AA 4FXKC 3K0XA 2EYLA 3AFPA 3FVQA 3HEJA 1K83B 2JP1A 3HOYG 1X32A 1O80A 3NQIA 4JG2A 5IT9c 3CC7A 2JE6I 1K8MA 1SE8A 2VQFL 2JA5G 3M4OB 1VQOA 1Q1EA 1A62A 1TQOA 1VQEA 2UXCL 4DV5Q 1ZYRC 3MFYA 2E8GA 2EJMA 1HJPA 2ZM6L 1XMOQ 3S15H 2EIFA 2AUJD 2DUDA 3AU7A 3S1RH 2YU9H 3H3VC 4TKOB 1BKBA 2VUMB 1IBML 4NB3A 2AWOA 1LYLA 3NPPA 4G7OC 1H9MA 1SLJA 3K5OA 4YIJA 2R93H 1HQMC 2QDBA 2VQFQ 4EX5A 3E3XA 5FO7B 2G5DA 5JEAJ 4NKLA 1XWEA 5FJ8H 1JR0D 1CHPD 1MBYA 4K8JA 1YNXA 1EWHA 4KHZA 1PYSB 4DN4M 1CZWA 3C46A 2CWPA 4WJ4A 3S16B 3BVGA 1YHAA 2VY3A 3F8TA 2L0CA 3ZYYX 3CXCA 3VDYA 1V9PA 1KDAA 1B8AA 4GOPB 1WTVA 3PUWA 3NXWA 2BH8A 4PMBA 4DKAC 4F87A 3KJOA 2F4VL 4CDCC 4C3HH 4DU9A 2EY6A 3J81E 1B70B 2XN9C 2I07B 3QJYA 2NN6G 2JA6H 2PNRC 1SDFA 4UP7A 2IPKD 5C4XB 3OPOA 5LMNQ 1G8ZD 1LACA 2Z6BA 2AQ3B 2PMZB 4H13C 2VW9A 4FP5D 1PVOA 2K50A 4X3TA 3KF8B 2Z8LA 1PFMA 1ET6A 1X55A 2I5HA 3NWTA 4K0KQ 1JOQA 1A15A 3SK5A 4L5RC 1STHA 1FVIA 1HFGA 3S1NB 4JI2Q 1Q8KA 4U673 2K33A 4K6DA 2ZTEA 1SFOH 1YHQA 3S17B 5ELNA 4JI5L 2JN4A 2KCCA 2UXBL 5C3EH 1PTOD 4XQNA 5JJIA 4CJ0B 4A4IA 2MFIA 2E76C 3QIAA 1NTGA 3K7UC 4HSVA 5KNDA 1UE6A 2C9OA 2WAQE 2BDOA 3FMCA 3V96A 4QGUA 2WIIB 1EWCA 2E2DC 2K05A 1WCMH 4N9PA 2KCTA 2NVQH 4K2KA 1YNJC 2F0MA 1HZ9A 1NMFA 3HGBA 4A3DH 1C48A 2PZUA 5A35A 1BR9A 2R7DA 1DXMA 4DR6L 1U4RA 4K8IA 2EYOA 3GTKB 4BXXG 2PI2A 4X6AH 2EZVA 3BDLA 4A3FG 3DWQA 4N9TA 3EROA 3LWEA 4Q5VA 4HJAA 4N8X1 3I90A 4C3IB 5JPNC 2UXDQ 1SNOA 1S5BD 5IYDG 1I50B 2F0WA 3VYUA 2PI2E 1WD1A 3CCUA 3C3LA 4X62Q 4LFAL 3PIO3 2AQ1B 5L37A 4IFDG 2L15A 2PNHA 2WB1B 1JE5A 3N52A 4XQQA 2MJ8A 3T16A 5IGCA 4A3EB 1EZ8A 3HOWB 3OOCA 3HOVH 2Z6KA 4IPDA 2CHBD 1J9OA 2JA7B 1HNWL 3OWEB 1U9RA 1IKLA 1HTPA 2R6GA 1GVPA 1SMYD 3A54A 3H0GG 1SNQA 5JAVA 4AIMA 3W1BA 4A3KH 2K5VA 3ND8A 1Q86C 4NP5A 2DN8A 4IUVA 2LY7A 4OX9L 2LS01 2QA4A 5KIXA 5IIFA 4AYBB 1RHPA 3NP8A 2KVMA 2O5JC 1OXUA 1PV4A 4HAEA 1PFSA 4JI6L 5J3BA 2QEXA 1VF5C 2D0OA 3S2DH 3T1HL 1WTOA 5JVG3 1STAA 1SYCA 1ML0D 2JA8B 5IWAQ 1L0WA 5FLMG 2KHIA 3VR4A 3O13A 1KHIA 5GAEC 1J6QA 3NTKA 1AP0A 3A7LA 4X3KA 5K5PA 3D4RA 4A3BH 4JCVE 2XVSA 1D2BA 1GO3E 3S15B 4WJWA 1SNMA 3CW2C 3P75A 4GKKQ 5DEHA 2B3GA 1TU2B 1WYDA 2IHEA 1AZQA 3M4PA 3I4OA 4LUVA 1K8AC 4K5XA 1FNWA 3TN2A 3HOXH 3CKIB 5CV9A 1M90C 3DM1A 1NCVA 2R93B 1FR3A 1VQBA 1BQQT 2N88A 4JOIA 1CM9A 3SVMA 3RNUA 1I6HH 1GHKA 3TBIB 1SYGA 1IYVA 1KNAA 2ICEC 3P1HA 2F4IA 1A3UA 4H7BA 2VQEL 2D9UA 4DR2Q 4JI8L 3I8ZA 5LMUL 5T1IA 3J7A5 4L5TA 1R4PB 1FNUA 3SGIA 4DR5Q 4BBRH 1UEAB 5IYBG 3PO3G 5LHY1 1EYDA 1YJWA 5M5WH 2M00A 4JI0Q 4A76A 1QNUA 3G4SA 4CHTB 3KOJA 2L5TA 4C3HB 2B2WC 1Y1VH 2ZJQA 2JA6B 3MHBA 1LTLA 3HOZB 5LMUQ 1SXTA 4ZUIA 3MXNA 1SSOA 4BY7G 1KXLA 4A3LH 2SNSA 2CH4A 1ESFA 4MNOA 2A68D 3CP0A 3GV3A 5EKIA 4B3RL 2L55A 1ICWA 3PO2B 4BBSB 5C3WA 2NWGA 1G291 4GNXC 4R8IA 5M3FH 4C56C 4DV2L 3IFDA 4U68A 5GAHC 5M5XH 4C1NI 1CA5A 4R4CA 3GTQH 3SE0A 1K3BC 1JB3A 3GTMH 4K5WA 5C44G 2MUYA 4GKJL 5C0XJ 1C9OA 4UP9A 4LF7L 5HGQA 1CI3M 1KAAA 1PFNA 3D6WA 1HR0L 2E2HB 4KMUC 2VXWA 1QVGA 2F0KA 3OYYA 4A3IB 2HQEA 1WTXA 4V190 3ULLA 4RKLA 3IFTA 5IP9G 2XWJB 4FF3A 5A2QL 1WCMB 2OXPA 4OIJA 1MIUA 2NVQB 1NSNS 1U5KA 3R2TA 4YHHL 2E75C 4A3DB 1HZCA 3V2TA 1PFBA 1FGBD 2ZXOA 2XTIA 1UWVA 2KHJA 3MTSA 1K83H 1EQQA 5M9OA 5ELCA 2HQLA 5AJ3Q 4LF4L 2B63B 1EQVA 2L9HA 4A3JG 2UUCQ 1CFMA 1YVCA 4LWCA 1SYEA 3G7LA 4QMGA 3BVZA 4IUUA 3M4QA 3I4NB 1A3VA 2IHFA 3GTOB 1HR0Q 3OW7A 2ICIA 4OWTB 3CU7A 3I4MH 2TSSA 3J7YW 4DNRB 2B29A 4B3SL 3CPFA 3AMUA 2WB1E 3HOVB 1AZPA 3HP3A 4DAYA 1V1PB 2DY8A 1LTSD 5KNBA 1SNDA 2ZJPA 4DV3L 1ZYRD 4ME5A 5KGUA 4KY7A 3CPWA 1NAPA 2I5MX 2XIWA 3GP7A 3E0JA 4GNXB 1HNXQ 5IP7G 2C35B 4JPBW 1LUZA 4RH6A 1XMQL 4DUYQ 2GVAA 2XGTA 5C4JB 2HT1A 1AH9A 1IHZA 4KD3A 1MJEA 1XNQQ 4QUFA 1D1KA 2QKIC 3NHHA 1IBLL 1BCPD 3BVMA 2DGYA 2LMCB 4DFAA 3PV0A 4FF4A 1STYA 4TQUS 3S16H 1TKWB 1L1OC 2XNAC 1XNRL 1KC8C 4Y52H 1BXTA 3RUZA 2IX3A 3H3VI 1PDQA 4MIUA 4JYAL 3TS2A 4KTAA 2FINB 1LT6D 2QDLA 1SJED 1KRTA 2K5HA 1LT4D 1Q1BA 1XXGA 2R7ZB 4ZCKA 1JWMD 2A6HC 5C4XH 4DR1Q 3J7AF 3QOJA 5EBDA 4DF7A 2ZXPA 3NE5B 1O78A 3T13A 3U58A 3H6MA 5M3MG 3CCLA 4PZ8A 1GHJA 2JK8A 2CVRA 2KCNA 3RZOB 1XNRQ 2A5HA 4LFCQ 3FP9A 1PXUA 2CQAA 2EY5A 5C5LA 1WVLA 1RIPA 1YJNA 3S1NH 1ENFA 4FNFA 5C3XA 2CWAA 1PRTC 1HA5A 3KLWA 1EFWA 2NN6H 1CKNB 1I3QB 1EIGA 2HIXA 3ITPA 3K5NA 3S17H 4LF6L 4X3SA 1H95A 3LGJA 1CHQD 3M7GA 3R3OA 4UHVA 4CKBA 1SEBD 3QB3A 4NXNQ 5LL6X 4HSPA 2KCMA 1YNND 1SN8A 1YHBA 1Z47A 4YCUA 1VQ7A 3VYTA 1C4QA 1QOHA 3RZDB 1Q3LA 3SEBA 4DK3C 5HGTA 2R3ZA 3K5MA 1MD2D 1ZEQX 1PH8A 1KIXA 4DNTB 1GUTA 2ID0A 3U9OA 3HOUH 2BCOA 4ZQ3A 3GTKH 1SR3A 1WI5A 4DV1L 1L1OB 2C5CA 1HA6A 1CKOA 5CORA 3I7FA 1Y8NB 4C3IH 3CC2A 2EE1A 1I50H 1CUKA 2QCPX 5JEAH 1Q81C 3K8AA 4M1UB 2B2VC 3F1ZA 5ISRA 1D8LA 2HCIA 2QILA 2HD3A 4JBJA 3KLSX 3GV6A 4A3EH 4CJ2C 3UDIA 3HOWH 1X6OA 3TEHB 3T1YQ 3TREA 1M4VA 1TS3A 4G57A 2JA7H 2VNUD 1WTWA 5M5XB 3UDGA 4BXXH 3J80i 5IYCG 3F2CA 4GN4B 1BBWA 3SK6A 4WFN3 1VQJA 5KEEA 1EOVA 4JW0A 2RCFA 4IFDH 1JCKB 3PIPA 4DR7Q 3FKIB 2CFMA 1HCZA 4WORA 2CH4W 3J80E 1O7LA 4A93G 3DWPA 4P73A 3R2IA 1YBYA 2F3WA 2K1BA 1N32Q 4F88A 4OO1H 4A3MB 4IURA 3Q0AA 1UE1A 5EBCA 3T51B 4DK6C 2O2LD 2RCNA 2F0NA 4CDFC 3DHQA 1N34L 1W6JA 1Y8PB 1EOTA 5EKLA 3GTGH 4R4IA 2YTVA 2F52A 5KYIA 2BH2A 2JA8H 4PV1C 2OTLA 3STBD 3FPPA 2KOLA 4DV4L 3PSIA 5DAUA 2B2WA 3I4MB 3VR3A 3Q23A 1X3QA 3LWUA 1JWSD 4A3CH 2DY7A 5KNCA 1PH6A 4FDBA 1TT2A 1TS5A 4YCVA 3E6ZX 3T53B 3KF6A 1YEZA 1EFID 3V05A 1CSPA 2NVYB 4IALA 3HOYB 1LLRD 1F2YA 5CMDA 1VDZA 1N34Q 5K36H 5JVH3 1DZ1A 1FL0A 2PPBC 1KL9A 2OQKA 1TWGH 3X3NA 1Q12A 1HH2P 3K6OA 3TZDA 1GKHA 4Z9CB 1STBA 3RN2A 5CYUA 2Q8RE 1L2FA 3RD4A 2UXCQ 2GVBA 4A3GH 1G91A 1OTCA 2O4XA 4ULLA 4YWLA 2RQXA 2ZM6Q 1QUQA 2E2IB 1VMCA 2OCEA 4JI3L 2AUKA 3J81L 2PZWA 1I4QA 4ZUJA 3K58A 2PZTA 1TWAB 4DUZL 4PZ6A 1IBMQ 2EYPA 5D3IB 4KN4C 2M2LA 1B9NA 1OXXK 1RTOA 3BDOA 5I6YA 3QR8A 2EYHA 2Q2IA 1BOSA 1VQCA 3NBHB 5GQOA 3MAQA 3MWYW 1IZ6A 3P20A 4IFDJ 1G6PA
chains in the Genus database with same CATH topology
1TIID 1WD0A 2A6EC 3A8IE 3I72A 1HXYD 4ZRZA 1PZKD 1OXSC 3OMGA 1GUGA 2GA4B 2A74C 3VYSA 2RDHA 1CT1D 1T5EA 2HUGA 2EJFC 3GTJB 1B3AA 1I4PA 3W3AA 5IGBA 2B2UC 5G3LD 1GUOA 1TS2A 2F0TA 1A3TA 1Z7TA 2SOBA 4PNYA 3D8GA 2WINB 3NTHA 3KUPA 4KY6A 1SE4A 3NWSA 5KYLA 1I6VC 2NUCA 5EJWA 4RHSA 4OGQC 5D14A 1Z6HA 2A69C 4H44C 2IL8A 3HOUB 2OF1A 5FO8B 5G3LF 1A6XA 2F0QA 1SAPA 4XYQA 5CV4A 1S5ED 5C5MA 3W2DA 1PTOF 1FYCA 3MZ5A 2EYFA 5EKKA 4ZLTF 1S5DD 1KDBA 4DAPA 2EXZA 4TRDA 4MHEA 3BZDB 1EYCA 1KNEA 1STEA 2TMPA 1HFNA 3TZUA 4A3FB 1DM0B 2VB3X 3A56A 3SDZA 1CTMA 1R4QB 1DOKA 1DOLA 1CZGA 1SJHD 4IUQA 1RD9D 1EYAA 1ZXTA 5DM63 5BN3A 2NBFA 2EPBA 3JAME 1G2TA 3A8JE 3I91A 4KHVA 1TS4A 4RKBA 1RJTA 2FHTA 3H0GB 1B50A 1F2ZA 4V0BA 4C3JG 2D5DA 5C0XH 5CV8A 2F0HA 3GTGB 3R93A 2O5IC 2VB2X 1LV9A 4K2LA 3NQTA 4HEDA 2Y0SB 3H09A 1LTTD 4FF1A 2B2VA 2JXMB 3QWNA 3G6JB 1Q90A 3D6CA 1DOMA 4RWSC 2SEBD 1H9SB 2ENBA 4CKCA 5KRUA 3D3RA 5ELFA 1TWGB 3C1FA 2K28A 4J1MA 2LFNA 4FO2A 3X3MA 1BNZA 3H94A 3VA5A 2B2TC 5CV7A 1VF7A 4A3GB 3VYRA 2YYZA 4NDXA 4DGZA 4CGYB 1I4XA 2WP8J 1NR2A 3NK9A 4P2CB 1SYDA 3BS1A 4C3HG 5EPJA 2B2YC 4QUCA 1ONLA 1S5FD 3N6RA 3A55A 4KD4A 4XXEA 4L6TB 4G7ZC 1LT3D 1HTLD 2Q8IB 1AW7A 1RKNA 5FLXE 5COYA 2NVXB 2K32A 3TP5A 2J7ZA 3PO3B 2BDNA 3KF8A 3M4YA 3PUXA 2AWNA 2RSOA 5CR3A 4IZ8A 3KBGA 4X3UA 4KKUA 3EA6A 3T56B 1WTQA 1B2TA 5IOCA 5IGDA 4BY7B 1IW7D 3TP8A 3QG1A 2BE5D 1TWCB 5IGFA 3S1QB 1PTOC 2H4OA 3WOEA 1EQTA 4IUPA 4C2MB 4PMWA 5C44B 1EL0A 3CRKC 3SR1A 1F9PA 4O1NA 2F0DA 4HMIA 3OWFA 3IAYA 2MP1A 4RGMA 1L0YB 3J7AV 3SXHA 4QB4A 1JICA 2K5QA 3TP6A 1B4OA 2RDGA 1MSGA 5E3FA 4A3JB 2X6GA 5M5YB 1HUMA 4FYDA 3TMEA 3BDCA 1SMYC 3WDNA 1ENAA 4J8QA 1EY8A 1LO5D 5AFWA 1V8QA 1EZ6A 4RGTA 4I7ZC 1ET9A 5TSSA 1PTOB 4LAAA 2K04A 4XQJA 3P7JA 2K5WA 3D4DA 1Q8IA 4B9XA 2IX1A 3URYA 3MXGA 3I70A 5IT9L 3PUVA 2EJGC 1SNCA 1QB5D 5DM73 2PCFB 2KECA 1L0XB 1CA6A 1BCPF 4XDXA 1IKMA 2KEEA 4OL7A 4KN7C 2M9VA 4HMJA 1CK1A 2KEDA 1QILA 2QF7A 4RGNA 5CV5A 1T5XD 3Q22A 5D65A 3SHLA 4LMQD 1X3PA 4O42A 5M3MB 4F7XA 1EY9A 3GTPB 1UNSA 2PW7A 2QEJC 2FMCA 4BS9A 2WKDA 5I6WA 2EYMA 4R9WA 1OO9B 3M7NA 4ZKBB 4B9WA 1YNJD 2F0JA 1NUCA 2A69D 1GJXA 1A2UA 2OT2A 3MEHA 1F2LA 3Q24A 4OO1I 4RGOS 1SE3A 3T4AC 5JPMC 1DCZA 4KJNA 1HRJA 3QOLA 3HZXA 5C4ZA 3BYYB 4PMCA 1EY0A 1JQYD 2L1BA 2F1MA 2NVTB 2A68C 2K6AA 1PLFA 4ID6A 3K7AB 4HCEA 1G2SA 1M8AA 4FXGC 4G4KA 2F0FA 3I73A 1SE2A 3RMHA 3PIP3 4M8AA 3L7ZC 1EY6A 4XT3B 2JYOA 3ONAB 2B2TA 4F8MA 5LL6S 2WV6D 2H1EA 1JOOA 2AQ2B 3KLRA 3MFGA 2XRSD 1HPCA 2MPMA 2B2YA 4ZAIA 4A93B 2E2JB 1CQVA 3M3YB 2NZ1D 1IYUA 1Y8OB 3Q6SA 3FEWX 3AB9A 1V1PA 4CKEA 1EU3A 3NTIA 2F0UA 2V4DA 4ZYSA 1D5XC 3L9AX 2E74C 3TSSA 4HTHA 1C8CA 2KUMA 3CRLC 2JA5B 1W6KA 4NW2A 3EQLC 4EGVA 3KLSA 1E0BA 1EEFD 1TWHB 2F0LA 4Y7NB 2ZT9C 1DONA 4RAUC 3RLFA 3DMUA 2XRQD 4ODGA 4DXGA 3K5LA 3MA2B 1F77A 1BCPC 1G6ZA 3M85A 2WACA 5I9OA 1S5CD 4XYOA 5EGTA 1BBXC 5CBAE 1U4MA 2IWHA 5E4WC 3WOFA 1O7ZA 1BDOA 5E1FA 1XYIA 2SDFA 4IUTA 4IN3A 1QWYA 3K0YA 1F9RA 3HS0C 2Q8TA 3PUYA 3PMFA 2D2CC 1F9SA 3FRPB 3GO5A 1EY7A 1QG7A 3K57A 1DJRD 3U9SA 2IW3A 1R9TB 4KKSA 2A73B 4UDUC 5I2YA 1E2ZA 5IODA 2K5DA 4EQPA 2EOTA 4G7HC 4DXFA 2FMMA 1DYQA 1STGA 4ZKCB 2EYJA 2BA0A 4C3IG 1H9JA 3GTLB 1YNNC 5E4XA 5JEAG 1F9QA 1BCPB 3EVQA 1D5MC 5DNFA 1VCIA 3DXJC 5CV6A 3PUZA 2J4XA 3OSOA 4XTCS 3S9WA 2F0PA 2BA1A 3MXPA 5ELBA 1KABA 1LTGD 5I4DA 4BA2I 4CJ1B 2PQEA 5C0XI 4HR7B 4FXDA 3MXUA 3VR6A 2K01A 3E5SA 3BG3A 2KHSA 1OXTA 4HCSA 2F0OA 3HRZC 2JEBI 2RA4A 2Z4IA 4K14A 2NTSA 3JAML 2WKCA 2DNCA 1MSHA 2KQ3A 2HDLA 4OO1G 2IJ0A 4RFBA 5IGEA 2X6LA 4K6LA 4EQNA 1CQFA 3DEOA 4BA1I 3SK8A 2N55A 4KK7A 4JK1C 1XTCD 1BO0A 1KLUD 4R8NA 3C2PA 1PTOH 3L3OC 3NBIA 4IUNA 3S14B 3OIQA 4KKTA 3CQZB 3TP7A 1J8IA 1TWFB 1JE4A 1GUWA 4FF2A 3D4WA 1PZID 1SNPA 1D5ZC 2CW0C 2MHVA 2R92B 1PMRA 1ILQA 2F0IA 2K7VA 2IT1A 2FFKB 3OHXC 4EVOA 1OXVA 5JOBA 4BY1B 4B08A 1IL8A 2B39A 4UAIA 2X69A 3R8BA 2A6HD 1XX8A 5K36G 5FOBB 2JSOA 5BN5A 4C3JB 4C1NK 2R61A 3ERQA 1B1ZA 5F2DA 3NSWA 2HCCA 5CBEE 4S3SA 1EY5A 2XWBB 3IL8A 4WRDA 1PRTD 3GD7A 1GUSA 4DK0A 2RBMA 4TSSA 1VMPA 3DWAA 3S1RB 2YU9B 1U4LA 3KK7A 1JWUD 2JEAI 4DA2A 2L4NA 3HKZB 3F2UA 1STNA 4XIGS 4LK1C 4MN3A 1QE6A 1EEID 1TY2A 5C6AA 5FLXL 5D3DA 4Q0FA 4QF4A 3NBHA 4OIKA 1D6EC 1NR4A 5I9PA 1HUNA 1PRTF 4RCNA 1QNKA 2NB0A 1V1OA 1UUPA 4L8JA 2DNEA 4XT1B 5EPKA 1B53A 1WTPA 5T1GA 1SYFA 2PYKA 2LKVA 1MGSA 1SYBA 4ZK9B 1KTKA 5C4HA 2RVLA 2L11A 4JBWA 1PZJD 1TY0A 4KV6A 1S4ZA 2F0VA 1GOZA 4RA8A 1Y1WB 1SFOB 2G9HD 2F3VA 5C3EB 1KLGD 5HURA 5IGGA 4DK1A 1II3A 2F03A 1ZKOA 2HDMA 3LX0A 2F0GA 1I4GA 3CHBD 4KI0A 4BWGB 5EQ0A 3SK4A 4IQZA 1AFPA 2K03A 3VR5A 5A2QE 1I4HA 2RKSA 2G9DA 1F2MA 3MVVA 2D62A 2F0EA 2I46A 5EPLA 2ZXRA 2RSNA 1JORA 3K59A 1K8OA 2SNMA 1MI2A 5FO9B 3HG9A 2Z4HA 2B2UA 1H9KA 4QCLA 4J6HA 1RTNA 1E2VA 1FNVA 5ELDA 1SBBB 4PQXA 4ILWA 5CC4A 5C0XG 4RCOA 3A8KE 4A3KB 4H0LC 1BF4A 3S1MB 3MC0B 1I4RA 2NN6I 1PYWD 4DAVA 3IKJA 4KJOA 3EFXD 3LNNA 2FJ2A 2KJXA 4K5VA 3QO2A 1RCVD 1GXDC 1HQRD 3FDTA 2PW5A 1JOKA 2A6ED 4NMZA 4I65A 3S2DB 1EU4A 1RODA 3ND9A 3A7AB 1WTRA 1LTID 3UI2A 1TVXA 1A2TA 1U4PA 1FD7D 4L63B 1O7YA 3I4LA 1H9SA 2NTTA 2EY1A 4LJZC 1EY4A 5IT9E 3GQBA 4QIWB 3FPUB 3TDQA 2OEOA 4A3BB 1ESRA 2IX0A 5BN4A 1QJOA 1KDCA 5NUCA 1GUNA 2NYZD 3H91A 1ILPA 1BUVT 2L12A 1B9MA 3HOXB 1LT5D 1QCBD 5J39A 3VA7A 5JJZA 1I6HB 1LTRD 2WAQB 4IFDI 1E2WA 4GZYC 2KA7A 5CGKA 1RF2D 4KY5A 2EDGA 1LTAD 2EVBA 4ABNA 1RDPD 4BBRB 2B8GA 5M5WB 1H9RA 4EQOA 3S2HB 3DEPA 1AEXA 3VR2A 5J22A 1LABA 4E6IA 1Y1VB 1UAPA 1D1IA 1ENCA 3OMCA 5FK9C 3J80L 4OHJA 1AN8A 4FVMA 2B8FA 2J0TD 5J1ZA 3OIPA 3BYTB 3C1EA 1JC7A 3NUCA 3DUZA 3I3CA 5M3FB 2EY2A 2F0SA 3D31A 4RHRA 1V43A 3GTQB 2MGSA 2RDFA 1Y69U 3GTMB 1IW7C 4CBVA 2BE5C 5I2XA 1HHVA 5ELEA 1PRTB 2PO4A 4HN7A 2BOSA 1DD2A 2Z1CA 2XSCA 1LTBD 1TR5A 1B44D 3EJIA 5FKAC 2CW0D 3KBXA 1EIHA 4FXKC 2EYLA 3FVQA 3HEJA 1K83B 2JP1A 1X32A 1O80A 3NQIA 2JE6I 1K8MA 3M4OB 1Q1EA 1TQOA 1ZYRC 3MFYA 2EJMA 2AUJD 3AU7A 3H3VC 4TKOB 2VUMB 2AWOA 3NPPA 4G7OC 1H9MA 4YIJA 3K5OA 1HQMC 2QDBA 5FO7B 5JEAJ 4NKLA 1XWEA 1JR0D 1CHPD 1MBYA 4K8JA 1EWHA 4KHZA 4DN4M 1CZWA 3C46A 3S16B 3BVGA 2L0CA 3ZYYX 1KDAA 1WTVA 3PUWA 3NXWA 4PMBA 4F87A 4DU9A 2EY6A 3J81E 2XN9C 2I07B 3QJYA 2NN6G 2PNRC 1SDFA 2IPKD 5C4XB 3OPOA 1G8ZD 1LACA 2AQ3B 2PMZB 4H13C 4FP5D 4X3TA 2Z8LA 1PFMA 1ET6A 3NWTA 1JOQA 1A15A 3SK5A 1STHA 3S1NB 1HFGA 4U673 2K33A 4K6DA 3S17B 2KCCA 1PTOD 4XQNA 4CJ0B 2E76C 3QIAA 4HSVA 5KNDA 2C9OA 2BDOA 3FMCA 3V96A 2WIIB 1EWCA 2E2DC 2K05A 4N9PA 4K2KA 1YNJC 2F0MA 3HGBA 1C48A 2PZUA 5A35A 1BR9A 1DXMA 1U4RA 4K8IA 2EYOA 3GTKB 2EZVA 3BDLA 3DWQA 4N9TA 3EROA 3LWEA 4Q5VA 4C3IB 3I90A 5JPNC 1SNOA 1S5BD 1I50B 2F0WA 3VYUA 1WD1A 3C3LA 3PIO3 2AQ1B 4IFDG 2WB1B 3N52A 4XQQA 2MJ8A 3T16A 5IGCA 4A3EB 1EZ8A 3HOWB 3OOCA 2CHBD 1J9OA 2JA7B 3OWEB 1U9RA 1IKLA 1HTPA 2R6GA 1SMYD 3A54A 1SNQA 5JAVA 3ND8A 4NP5A 2DN8A 4IUVA 2LY7A 2LS01 5KIXA 5IIFA 4AYBB 1RHPA 3NP8A 2KVMA 2O5JC 1OXUA 4HAEA 1VF5C 1WTOA 5JVG3 1STAA 1SYCA 1ML0D 2JA8B 3VR4A 3O13A 3NTKA 1AP0A 3A7LA 4X3KA 5K5PA 3D4RA 2XVSA 1D2BA 3S15B 4WJWA 1SNMA 3P75A 5DEHA 1TU2B 1AZQA 4K5XA 1FNWA 3TN2A 3CKIB 5CV9A 3DM1A 1NCVA 2R93B 1FR3A 1BQQT 2N88A 3SVMA 1CM9A 1GHKA 3TBIB 1SYGA 1IYVA 1KNAA 2ICEC 3P1HA 2F4IA 1A3UA 4H7BA 2D9UA 3I8ZA 5T1IA 1R4PB 1FNUA 1UEAB 5LHY1 1EYDA 2M00A 1QNUA 4CHTB 2L5TA 4C3HB 2B2WC 2JA6B 3MHBA 3HOZB 1SXTA 4ZUIA 3MXNA 1SSOA 2SNSA 1ESFA 2A68D 3GV3A 5EKIA 2L55A 1ICWA 3PO2B 4BBSB 5C3WA 2NWGA 1G291 4R8IA 4C56C 3IFDA 4U68A 4C1NI 1CA5A 3SE0A 1JB3A 4K5WA 2MUYA 5C0XJ 1CI3M 1KAAA 1PFNA 3D6WA 2E2HB 4KMUC 2VXWA 2F0KA 4A3IB 2HQEA 1WTXA 4V190 4RKLA 3IFTA 2XWJB 4FF3A 5A2QL 1WCMB 2OXPA 4OIJA 2NVQB 1NSNS 3R2TA 2E75C 4A3DB 3V2TA 1PFBA 1FGBD 2ZXOA 3MTSA 5M9OA 5ELCA 2B63B 1EQVA 2L9HA 1CFMA 1SYEA 3G7LA 4QMGA 3BVZA 4IUUA 3I4NB 1A3VA 3GTOB 3OW7A 2ICIA 3CU7A 2TSSA 3J7YW 4DNRB 3AMUA 3HOVB 1AZPA 3HP3A 4DAYA 5KNBA 1V1PB 2DY8A 1LTSD 1SNDA 1ZYRD 4ME5A 5KGUA 4KY7A 1NAPA 2XIWA 3GP7A 3E0JA 4RH6A 5C4JB 1IHZA 4KD3A 4QUFA 1D1KA 2QKIC 3NHHA 1BCPD 3BVMA 2LMCB 4DFAA 3PV0A 4FF4A 1STYA 4TQUS 1TKWB 2XNAC 1BXTA 3RUZA 2IX3A 1PDQA 4MIUA 4KTAA 2FINB 1LT6D 1SJED 1LT4D 1Q1BA 1XXGA 2R7ZB 3J7AF 1JWMD 2A6HC 3QOJA 5EBDA 4DF7A 2ZXPA 3NE5B 1O78A 3T13A 3H6MA 1GHJA 2CVRA 2KCNA 3RZOB 2A5HA 1PXUA 2CQAA 2EY5A 5C5LA 1WVLA 1ENFA 4FNFA 5C3XA 1PRTC 1HA5A 2NN6H 3K5NA 1I3QB 1EIGA 3ITPA 4X3SA 1CHQD 3M7GA 3R3OA 4CKBA 1SEBD 3QB3A 5LL6X 4HSPA 1YNND 1Z47A 3VYTA 1C4QA 1QOHA 3RZDB 1Q3LA 3SEBA 5HGTA 2R3ZA 3K5MA 1MD2D 1ZEQX 4DNTB 1GUTA 2ID0A 3U9OA 2BCOA 4ZQ3A 2C5CA 1HA6A 5CORA 1Y8NB 2EE1A 2QCPX 5JEAH 4M1UB 2B2VC 5ISRA 2HCIA 2QILA 3KLSX 3GV6A 4CJ2C 1M4VA 1TS3A 4G57A 2VNUD 1WTWA 5M5XB 3SK6A 4WFN3 5KEEA 4IFDH 1JCKB 3FKIB 1HCZA 4WORA 3J80E 1O7LA 3DWPA 3R2IA 2K1BA 2F3WA 4F88A 4OO1H 4A3MB 4IURA 3Q0AA 5EBCA 3T51B 2O2LD 2F0NA 3DHQA 1W6JA 1Y8PB 1EOTA 5EKLA 5KYIA 4PV1C 3FPPA 2KOLA 5DAUA 2B2WA 3I4MB 3VR3A 3Q23A 1X3QA 3LWUA 1JWSD 2DY7A 5KNCA 1TT2A 1TS5A 3E6ZX 3T53B 1EFID 3V05A 2NVYB 4IALA 3HOYB 1LLRD 1F2YA 5CMDA 1VDZA 5K36H 5JVH3 1DZ1A 2PPBC 3X3NA 1Q12A 3K6OA 3TZDA 4Z9CB 1STBA 5CYUA 2Q8RE 3RD4A 1G91A 2O4XA 4ULLA 2RQXA 2E2IB 1VMCA 2AUKA 3J81L 2PZWA 1I4QA 4ZUJA 3K58A 2PZTA 1TWAB 2EYPA 5D3IB 4KN4C 2M2LA 1B9NA 1OXXK 1RTOA 3BDOA 5I6YA 2EYHA 1BOSA 3MAQA 3MWYW 3P20A 4IFDJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEA I;  1HCZ A;  2BA1 A;  2A6E C;  3A8I E;  1CI3 M;  2JE6 I;  2ZT9 C;  3I72 A;  1O7L A;  1DCZ A;  3VA7 A;  2KCC A;  3RLF A;  4KMU C;  5BN3 A;  4XIG S;  1K8M A;  1Q1B A;  2D62 A;  2K32 A;  4LK1 C;  1V8Q A;  4BA2 I;  2A6H C;  3VR4 A;  2E76 C;  1E2W A;  3QIA A;  4HR7 B;  1OXS C;  1Q1E A;  3A8J E;  2KA7 A;  3M4Y A;  3MXU A;  3IFT A;  1GUG A;  3PUX A;  4I7Z C;  3VR6 A;  5KND A;  4OO1 H;  1K8O A;  3NE5 B;  3BG3 A;  3M85 A;  1O78 A;  2EDG A;  2BDO A;  1OXT A;  3FMC A;  3A7L A;  2F1M A;  3D4R A;  1GHJ A;  1T5E A;  2EJF C;  2A68 C;  2JEB I;  1ZYR C;  2EVB A;  3W3A A;  2E75 C;  2D5D A;  3MFY A;  3T51 B;  2EJM A;  1TU2 B;  1YNJ C;  1H9K A;  2DNC A;  5C0X H;  4KKU A;  3HGB A;  1GUO A;  3T56 B;  2B8G A;  5A35 A;  4RCN A;  1DXM A;  3PUV A;  2EJG C;  2AUJ D;  3I73 A;  1BDO A;  1H9R A;  4OO1 G;  1Y8P B;  1CFM A;  2O5I C;  1E2V A;  1Z7T A;  4TKO B;  3VR2 A;  2NN6 H;  2PCF B;  1IW7 D;  2AWO A;  1FR3 A;  4GZY C;  4PV1 C;  1LAB A;  4L8J A;  4G7O C;  1H9M A;  1GHK A;  3OW7 A;  3QG1 A;  2BE5 D;  2DNE A;  3FPP A;  1HQM C;  3L7Z C;  1IYV A;  4BA1 I;  5C0X G;  3VR3 A;  4IFD G;  3A8K E;  1I6V C;  4H0L C;  3PUY A;  4JK1 C;  4KN7 C;  2JXM B;  2D2C C;  2NN6 I;  3LWU A;  4DNR B;  5KNC A;  1Q90 A;  2B8F A;  4OGQ C;  5KNB A;  4KKT A;  3OOC A;  3T53 B;  1EWH A;  2QF7 A;  4KHZ A;  3IKJ A;  3KLR A;  1Z6H A;  2A69 C;  2CW0 C;  3LNN A;  1H9S B;  4H44 C;  1VDZ A;  4DNT B;  3CRK C;  3U9S A;  1PMR A;  1GUT A;  1HPC A;  2K7V A;  2IT1 A;  4KKS A;  5K36 H;  1A6X A;  4JBW A;  1HTP A;  2R6G A;  2L5T A;  2PPB C;  3D31 A;  1OXV A;  1V43 A;  3PUW A;  1Y8N B;  1Q12 A;  2A6E D;  1IYU A;  1Y69 U;  3ND9 A;  3H94 A;  1FYC A;  3A7A B;  5JEA H;  1E2Z A;  1Y8O B;  1VF7 A;  1IW7 C;  2A6H D;  2YYZ A;  3ND8 A;  3QJY A;  3AB9 A;  5K36 G;  2BE5 C;  2NN6 G;  5BN5 A;  4G7H C;  2PNR C;  2DN8 A;  3I4L A;  4DK1 A;  1H9S A;  2LMC B;  2BA0 A;  2V4D A;  3OPO A;  3PV0 A;  2A68 D;  1LAC A;  3M7N A;  1H9J A;  2AUK A;  1YNN C;  1DD2 A;  2E74 C;  4LJZ C;  4H13 C;  3GQB A;  5JEA G;  3TZU A;  4TQU S;  2O5J C;  1G29 1;  1TKW B;  1ZKO A;  1OXU A;  3SDZ A;  1CTM A;  1ONL A;  2A69 D;  1GJX A;  3CRL C;  1QJO A;  4KN4 C;  5BN4 A;  4KI0 A;  1B9N A;  1OXX K;  3GD7 A;  3N6R A;  1VCI A;  1GUN A;  3BDO A;  3DXJ C;  1GUS A;  3PUZ A;  3SE0 A;  4G7Z C;  1B9M A;  1VF5 C;  4DK0 A;  3EQL C;  4XTC S;  2Q8I B;  4IFD H;  4IQZ A;  1SMY C;  3P20 A;  2K33 A;  3VR5 A;  3WDN A; 
#chains in the Genus database with same CATH topology
 1TII D;  1WD0 A;  2A6E C;  3A8I E;  3I72 A;  3CCS A;  1HXY D;  3HOZ H;  3K80 C;  4R4Q A;  4ZRZ A;  1PH5 A;  1PZK D;  1JJG A;  1OXS C;  3OMG A;  1GUG A;  2GA4 B;  3PO2 H;  4BBS H;  2A74 C;  3VYS A;  2RDH A;  4QIW E;  1CT1 D;  1T5E A;  2HUG A;  2EJF C;  3GTJ B;  1BVS A;  1B3A A;  1I4P A;  3W3A A;  3J80 c;  4DV6 L;  2F4V Q;  5IGB A;  1K3R A;  2B2U C;  4JI4 L;  3BU2 A;  5G3L D;  1GUO A;  1TS2 A;  2F0T A;  1A3T A;  4AQY L;  1O7I A;  1Z7T A;  2SOB A;  1Q46 A;  4PNY A;  2NZO A;  1E1O A;  3D8G A;  2WIN B;  3NTH A;  3KUP A;  4KY6 A;  4RG1 A;  2E2H H;  4BY7 H;  1SE4 A;  2HHH L;  4A3I H;  3NWS A;  5KYL A;  1I6V C;  2ZJR A;  4DV7 L;  2NUC A;  5EJW A;  4RHS A;  3S1Q H;  4OGQ C;  1VQH A;  1K9M C;  4DV6 Q;  4POG A;  5D14 A;  1Z6H A;  2A69 C;  4H44 C;  2IL8 A;  3HOU B;  3H15 A;  2OF1 A;  5C44 H;  3CC4 A;  5FO8 B;  2EXD A;  4AQY Q;  2B63 H;  4JI5 Q;  5G3L F;  2UUB L;  3BJU A;  1A6X A;  2GN5 A;  2F0Q A;  2UXB Q;  1SAP A;  2WB1 G;  4XYQ A;  3I4N H;  5CV4 A;  1S5E D;  3GTO H;  4O0A A;  5C5M A;  3W2D A;  3F2D A;  1PTO F;  1FYC A;  3MZ5 A;  2EYF A;  2HHH Q;  5EKK A;  2A19 A;  4ZLT F;  1S5D D;  4GN5 A;  1KDB A;  4DAP A;  2EXZ A;  4TRD A;  2K4K A;  4MHE A;  3EBE A;  1XTD A;  3BZD B;  1VQF A;  1EYC A;  1KNE A;  4IOC A;  1STE A;  2FXQ A;  4JI7 L;  2TMP A;  4DR6 Q;  1HFN A;  4B3M L;  3TZU A;  4A3F B;  1DM0 B;  2VB3 X;  3A56 A;  3SDZ A;  5M5Y H;  2UUB Q;  1CTM A;  3JAM i;  1R4Q B;  1VQ8 A;  1DOK A;  4LFA Q;  1DOL A;  1YJ9 A;  5C4J H;  1CZG A;  1SJH D;  2R92 G;  3PGZ A;  4IUQ A;  1WJJ A;  1RD9 D;  1EYA A;  1W3S A;  1ZXT A;  3F2B A;  3OTO L;  5DM6 3;  5BN3 A;  2NBF A;  2EPB A;  4BY1 G;  3JAM E;  1G2T A;  4JI7 Q;  1HNW Q;  3A8J E;  3I91 A;  4KHV A;  1TS4 A;  3CCR A;  4RKB A;  1RJT A;  4B3M Q;  2FHT A;  3H0G B;  1B50 A;  2VS1 A;  4KHP L;  4OWW B;  1F2Z A;  4V0B A;  4C3J G;  1Q82 C;  2D5D A;  4GLX A;  2MQH A;  3L0O A;  5C0X H;  1HNZ L;  5CV8 A;  3PF5 A;  1NE3 A;  2F0H A;  4DR4 L;  3GTG B;  4ME3 A;  3R93 A;  2O5I C;  2VB2 X;  1LV9 A;  4K2L A;  4GLA C;  4DR3 L;  3NQT A;  4OX9 Q;  4HED A;  2R7Z H;  3ULJ A;  2Y0S B;  1PHJ A;  3H09 A;  1LTT D;  4LFB L;  4FF1 A;  3I55 A;  3E9I A;  2B2V A;  2JXM B;  3QWN A;  3G6J B;  3IRB A;  1Q90 A;  3D6C A;  4JI6 Q;  3RZO H;  1DOM A;  4RWS C;  3HKZ G;  2SEB D;  4LNQ A;  3OW2 A;  3T1H Q;  1H9S B;  3AEV A;  2ENB A;  4CKC A;  5KRU A;  3D3R A;  5ELF A;  1TWG B;  3C1F A;  2K14 A;  2K28 A;  1I3Q H;  4J1M A;  5FJ8 G;  5JJK A;  1J5E L;  2LFN A;  4FO2 A;  3X3M A;  1BNZ A;  3H94 A;  3HFZ B;  3VA5 A;  2B2T C;  5CV7 A;  1VF7 A;  4LFB Q;  4A3G B;  3VYR A;  2YYZ A;  4IJH A;  4NDX A;  4A75 A;  4YWM A;  4DGZ A;  4CGY B;  1I4X A;  1PH9 A;  3GTP H;  2WP8 J;  1NR2 A;  3NK9 A;  4P2C B;  3RZD H;  1SYD A;  3BS1 A;  4C3H G;  5EPJ A;  1TXY A;  2B2Y C;  2ZTC A;  4GOP A;  4QUC A;  1ONL A;  3E0E A;  4UY8 C;  2VL6 A;  4AH6 A;  1S5F D;  4NXM L;  3N6R A;  2JA6 G;  3A55 A;  4KD4 A;  4XXE A;  4YY3 L;  4L6T B;  4G7Z C;  1LT3 D;  1HTL D;  2Q8I B;  2YTX A;  1AW7 A;  2VQE Q;  4LUZ A;  1RKN A;  1YIT A;  4JI8 Q;  5FLX E;  5COY A;  1IBK L;  1IXR A;  3CMA A;  2NVX B;  2K32 A;  3TP5 A;  2J7Z A;  3MEF A;  3PO3 B;  2BDN A;  4JBM A;  3KF8 A;  3M4Y A;  3PUX A;  2AWN A;  2RSO A;  4LF9 L;  5CR3 A;  2PMZ E;  4IZ8 A;  1Y1W G;  3KDF B;  4HIO A;  5BR8 L;  1RL2 A;  4NXM Q;  3KBG A;  5C3E G;  4X3U A;  4KKU A;  3EA6 A;  3T56 B;  3JAM c;  5LMN W;  1WTQ A;  1B2T A;  2CCZ A;  1KQS A;  2AMC B;  3FKI H;  5IOC A;  5IGD A;  1VQP A;  1EUJ A;  4MTN A;  1IBK Q;  4BY7 B;  1IW7 D;  1WCM G;  3TP8 A;  3QG1 A;  4DAM A;  2BE5 D;  2PQA B;  1TWC B;  4B3R Q;  1MHW C;  1UE5 A;  5IGF A;  3S1Q B;  1PTO C;  2H4O A;  5GAG C;  4LF9 Q;  2P5Z X;  3WOE A;  4DV2 Q;  2ASB A;  4A3M H;  1EQT A;  4LF5 L;  4IUP A;  4C2M B;  2DJF C;  1W2B A;  5JJL A;  1DGS A;  4PMW A;  5C44 B;  3E9H A;  1EL0 A;  4GKJ Q;  3CRK C;  4LF7 Q;  3SR1 A;  1F9P A;  4O1N A;  2F0D A;  4HMI A;  3OWF A;  3KYH C;  5IY0 A;  3IAY A;  2MO0 A;  4B3T L;  3D0F A;  2ALY B;  3DM3 A;  2MP1 A;  3EIV A;  3EN2 A;  4RGM A;  1L0Y B;  3M3Y H;  3J7A V;  4OXP A;  3SXH A;  4QB4 A;  4DV0 L;  1JIC A;  2K5Q A;  3TP6 A;  2LXJ A;  3U50 C;  4YHH Q;  3J7Z C;  4X65 L;  1B4O A;  2RDG A;  1MSG A;  5E3F A;  4UPA A;  2NVY H;  3HOY H;  4A3J B;  4LF4 Q;  2X6G A;  5M5Y B;  1HUM A;  4A3K G;  4FYD A;  5ELO A;  1CKM A;  2JA5 H;  3TME A;  3BDC A;  3CCV A;  1SMY C;  1FGU A;  2CQO A;  3WDN A;  4DV0 Q;  4UP8 A;  4B3S Q;  1ENA A;  2NZH A;  1C7Y A;  4J8Q A;  1EY8 A;  1LO5 D;  2UUA L;  1X65 A;  1K0R A;  5AFW A;  4EQ5 A;  1E3P A;  4DV3 Q;  1V8Q A;  1EZ6 A;  2E2I H;  4RGT A;  2JA9 A;  4I7Z C;  1ET9 A;  5TSS A;  1TWA H;  4AYB E;  1PTO B;  5FLX c;  3KFU A;  4LAA A;  2K04 A;  1XMQ Q;  4XQJ A;  3P7J A;  2K5W A;  3D4D A;  1Q8I A;  4B9X A;  2IX1 A;  3URY A;  3MXG A;  3I70 A;  5IT9 L;  1I94 L;  1N9W A;  3A5Z B;  3PUV A;  2EJG C;  3U4Z A;  1PA6 A;  1IBL Q;  1SNC A;  2CKZ B;  1QB5 D;  2Q2T A;  5DM7 3;  2PCF B;  1S72 A;  2KEC A;  4A3B G;  4R4T A;  1L0X B;  1CA6 A;  1BCP F;  4HIK A;  1FJG L;  4XDX A;  1IKM A;  2KEE A;  4HIM A;  4OL7 A;  4KN7 C;  4IJL A;  4H02 A;  3RLO A;  2Y0S E;  2M9V A;  3HOX G;  3GTJ H;  4HMJ A;  4HJ8 A;  1CK1 A;  2KED A;  1QIL A;  2QF7 A;  4RGN A;  4JYA Q;  5CV5 A;  2Z6K C;  4L5S A;  1T5X D;  1I94 Q;  3Q22 A;  2WAQ G;  1X56 A;  5D65 A;  3SHL A;  4X64 L;  2N3S A;  1QZG A;  4LMQ D;  1X3P A;  1PYB A;  3CCQ A;  1FJG Q;  4RMF A;  2D0P A;  4BBR G;  4O42 A;  5M3M B;  4F7X A;  1EY9 A;  3GTP B;  1UNS A;  2PW7 A;  2QEJ C;  2FMC A;  4BS9 A;  2WKD A;  5I6W A;  2EYM A;  4R9W A;  1XJV A;  1OO9 B;  3M7N A;  4ZKB B;  1Y1V G;  4B9W A;  1AE2 A;  3J81 j;  1YNJ D;  2F0J A;  1NUC A;  3AQQ A;  2IY5 B;  4LF6 Q;  1XPR A;  2A69 D;  1GJX A;  1A2U A;  2OT2 A;  3MEH A;  1K8G A;  4A3L G;  1F2L A;  3AFQ A;  3Q24 A;  1GD7 A;  4N8F A;  4OO1 I;  1K73 C;  4RGO S;  1SE3 A;  3T4A C;  5JPM C;  1DCZ A;  5M3F G;  4KJN A;  1HRJ A;  3QOL A;  3HZX A;  5C4Z A;  3BYY B;  4PMC A;  1WFQ A;  4IOA A;  1EY0 A;  4A3F H;  1JQY D;  2L1B A;  4DV1 Q;  2F1M A;  2NVT B;  4L5Q A;  2A68 C;  1PH4 A;  3FHW A;  5IYD H;  2K6A A;  1PLF A;  4ID6 A;  3K7A B;  2MO1 A;  1EWI A;  1AE3 A;  4HCE A;  1G2S A;  4X66 L;  1M8A A;  1ASY A;  4JV5 L;  4FXG C;  4G4K A;  2F0F A;  3I73 A;  2E5L L;  4HJ5 A;  1N36 L;  1SE2 A;  1PH7 A;  1A8V A;  3RMH A;  4IPG A;  3PIP 3;  3ULP A;  4M8A A;  1T9H A;  3L7Z C;  3TS0 A;  1EY6 A;  4XT3 B;  1VQK A;  4ALP A;  2JYO A;  3ONA B;  2B2T A;  4F8M A;  5LL6 S;  1VQM A;  2WV6 D;  2H1E A;  3H0G H;  1JOO A;  2AQ2 B;  2VZA A;  1B7Y B;  2OTJ A;  1X3G A;  1PH2 A;  3KLR A;  4MTK A;  3MFG A;  3S14 H;  3CQZ H;  1TWF H;  2XRS D;  4MZ9 A;  1D7Q A;  1JJ2 A;  1HPC A;  2KEN A;  2MPM A;  1NJI C;  2B2Y A;  4ZAI A;  4A93 B;  2E2J B;  1CQV A;  3RN5 A;  3M3Y B;  2NZ1 D;  1IYU A;  4BY1 H;  2LXK A;  1XMO L;  4P71 A;  1Y8O B;  3Q6S A;  3FEW X;  3UE1 A;  3AB9 A;  1V1P A;  4CDD C;  4CKE A;  1EU3 A;  3UE0 A;  3NTI A;  3ZJY C;  2VUM G;  4C3J H;  2F0U A;  2V4D A;  1HR0 W;  4ZYS A;  1D5X C;  3L9A X;  2E74 C;  3TSS A;  1K0S A;  4HTH A;  1C8C A;  4JVZ A;  4GNX A;  3W1G A;  1E24 A;  2QW7 A;  2KUM A;  5FLM H;  3CRL C;  1Q7Y C;  2JA5 B;  3RR5 A;  1W6K A;  4DV4 Q;  2LSS A;  4NW2 A;  3EQL C;  4EGV A;  3KLS A;  1E0B A;  1EEF D;  1TWH B;  2F0L A;  4Y7N B;  2ZT9 C;  3G71 A;  2RF4 A;  1DON A;  4RAU C;  3RLF A;  3DMU A;  2XRQ D;  1SRO A;  4TVA B;  1NNX A;  1VQ5 A;  4YWK A;  4ODG A;  4DXG A;  1BBU A;  3K5L A;  3MA2 B;  1F77 A;  1BCP C;  1G6Z A;  3M85 A;  2WAC A;  5I9O A;  1S5C D;  2RHQ B;  4XYO A;  5EGT A;  4P72 A;  1BBX C;  5CBA E;  1U4M A;  2Q2U A;  5LMN L;  5C4X G;  2IWH A;  5E4W C;  3J81 i;  1NMG A;  3WOF A;  1O7Z A;  1BDO A;  5E1F A;  1XYI A;  1Z9F A;  2SDF A;  4IUT A;  4IN3 A;  2HIV A;  1EQR A;  4K0K L;  1P16 A;  4JI3 Q;  2NVX H;  1QWY A;  2EQS A;  3K0Y A;  3ICE A;  3HKS A;  5IYB H;  3PO3 H;  1F9R A;  3HS0 C;  1KAW A;  1ICF B;  4DUZ Q;  4JI2 L;  2Q8T A;  3PUY A;  3B6Y A;  3PMF A;  4POF A;  4OWX B;  2D2C C;  1F9S A;  1NY4 A;  3FRP B;  3GO5 A;  1K28 A;  1KRS A;  1EY7 A;  1QG7 A;  3MXN B;  3K57 A;  1DJR D;  3U9S A;  2RHS B;  4DNI A;  2IW3 A;  3I2Z A;  1CKN A;  1R9T B;  4KKS A;  2A73 B;  1M1K C;  4UDU C;  5I2Y A;  3UDX A;  1TWC H;  3CCE A;  1E2Z A;  5IOD A;  2K5D A;  3A5U A;  4EQP A;  2EOT A;  1Y1W H;  3ER0 A;  3CD6 A;  3HOU G;  4G7H C;  4DXF A;  4C2M H;  2AKW B;  2FMM A;  1DYQ A;  4JI4 Q;  1PH1 A;  1STG A;  4ZKC B;  2EYJ A;  2UXD L;  2BA0 A;  1JJC B;  4C3I G;  1H9J A;  3GTL B;  1YNN C;  5E4X A;  5JEA G;  4X62 L;  1F9Q A;  1L1O A;  3CAM A;  1BCP B;  3EVQ A;  1P8L A;  1D5M C;  5DNF A;  3GDE A;  1VCI A;  3DXJ C;  5CV6 A;  3PUZ A;  4A3E G;  1WOC A;  2K5N A;  3HOW G;  2J4X A;  4HJ7 A;  3OSO A;  4XTC S;  5IP9 H;  3S9W A;  4DV7 Q;  2F0P A;  3ERS X;  2JA7 G;  2BA1 A;  3MXP A;  3PIO A;  5ELB A;  1KAB A;  2N78 A;  1LTG D;  5I4D A;  1IL2 A;  4BA2 I;  4CJ1 B;  2PQE A;  5C0X I;  4HR7 B;  4FXD A;  3MXU A;  3VR6 A;  3CME A;  1U0L A;  2K01 A;  3E5S A;  4R1J A;  4A3J H;  3BG3 A;  2KHS A;  1OXT A;  4HCS A;  2F0O A;  3HRZ C;  2JEB I;  2RA4 A;  1VQL A;  2Z4I A;  4K14 A;  2NTS A;  3JAM L;  2WKC A;  2DNC A;  4DAY B;  3PF4 A;  1MSH A;  1HZA A;  2K52 A;  2KQ3 A;  3K81 C;  2HDL A;  4OO1 G;  2IJ0 A;  4AYB G;  4RFB A;  2JQO A;  5IGE A;  2X6L A;  4K6L A;  1JT8 A;  4EQN A;  1CQF A;  3DEO A;  4BA1 I;  3SK8 A;  2N55 A;  4KK7 A;  4JK1 C;  4DPG A;  1XPU A;  1A0I A;  1XTC D;  1BO0 A;  3S1M H;  1KLU D;  4R8N A;  3C2P A;  5IP7 H;  1PTO H;  3L3O C;  3NBI A;  4IUN A;  3S14 B;  5IWA L;  3OIQ A;  4KKT A;  3CQZ B;  3TP7 A;  2JA8 G;  1TWF B;  1JE4 A;  1J8I A;  1GUW A;  4FF2 A;  3D4W A;  3JC6 6;  1PZI D;  1SNP A;  1D5Z C;  2CW0 C;  2MHV A;  1CSQ A;  2R92 B;  4GLV B;  1PMR A;  1ILQ A;  2F0I A;  4OEM B;  2K7V A;  2IT1 A;  3OTO Q;  2FFK B;  2Y0S G;  3J81 c;  2A1A A;  2ATW A;  1G51 A;  1X3F A;  3OHX C;  4A3C G;  4EVO A;  1OXV A;  5JOB A;  4BY1 B;  1N8R C;  4B08 A;  1IL8 A;  2B39 A;  4UAI A;  4GKK L;  2X69 A;  3R8B A;  1UE7 A;  4KHP Q;  2A6H D;  3WWV A;  1XX8 A;  1UEB A;  3STB C;  5FOB B;  5K36 G;  2JSO A;  5BN5 A;  4NPS A;  4C3J B;  2R93 G;  1HNZ Q;  4C1N K;  2R61 A;  3ERQ A;  1B1Z A;  5F2D A;  4DR4 Q;  4PG3 A;  3A74 A;  2OWO A;  3NSW A;  2HCC A;  3BZC A;  5CBE E;  4S3S A;  1EY5 A;  1SRU A;  2XWB B;  4DR2 L;  3IL8 A;  4DR3 Q;  4WRD A;  4A3G G;  5E7N A;  1PRT D;  3GD7 A;  1GUS A;  4DK0 A;  4DR5 L;  2RBM A;  4TSS A;  1E22 A;  1VMP A;  3DWA A;  3S1R B;  2YU9 B;  1U4L A;  5M3M H;  3KK7 A;  1JWU D;  5GRO A;  2JEA I;  4HJ9 A;  4DA2 A;  4JI0 L;  2L4N A;  2H5X A;  3HKZ B;  4QJF A;  3F2U A;  1STN A;  4XIG S;  2UU9 L;  4LK1 C;  4MN3 A;  3NEL A;  1QE6 A;  5DLQ E;  1EEI D;  1TY2 A;  3CF5 A;  2I0Q A;  5GAD C;  5C6A A;  5FLX L;  5D3D A;  1YIJ A;  4Q0F A;  4QF4 A;  1YI2 A;  3HOZ G;  1J5E Q;  3NBH A;  2K75 A;  2V1C C;  2Z9H A;  4OIK A;  1D6E C;  1NR4 A;  5I9P A;  1HUN A;  4IPC A;  1PRT F;  4RCN A;  1N33 L;  3G48 A;  1QNK A;  1QVC A;  2NB0 A;  1V1O A;  3PO2 G;  1UUP A;  4BBS G;  4OEL B;  3S2H H;  4L8J A;  2ZTD A;  2DNE A;  4XT1 B;  2UU9 Q;  5EPK A;  1B53 A;  1WTP A;  5T1G A;  1SYF A;  1E1T A;  4KLK A;  2PYK A;  2LKV A;  2NVT H;  1MGS A;  1SYB A;  4YY3 Q;  4APV A;  2ES2 A;  3K7A H;  3CCJ A;  2A8V A;  3Q8D A;  1KTK A;  4ZK9 B;  1Y14 B;  5C4H A;  1N33 Q;  4A3I G;  2RVL A;  4GS3 A;  2L11 A;  4JBW A;  1XPO A;  1JB7 A;  1PZJ D;  1TY0 A;  4KV6 A;  1S4Z A;  2F0V A;  2QGQ A;  1GOZ A;  4RA8 A;  4A3D G;  4JBK A;  1X54 A;  1WTH A;  1Y1W B;  1LM0 A;  1SFO B;  4P74 A;  5IYC H;  2G9H D;  5AJ3 L;  2B63 G;  5BR8 Q;  2F3V A;  2UUC L;  3RLN A;  5C3E B;  1KLG D;  5HUR A;  5IGG A;  3I4N G;  4DK1 A;  1II3 A;  2F03 A;  1ZKO A;  2HDM A;  3LX0 A;  2F0G A;  1I4G A;  4A93 H;  2E2J H;  3CHB D;  4KI0 A;  4BWG B;  3HOV G;  3L2P A;  5EQ0 A;  4LUO A;  3SK4 A;  1EIY B;  4IQZ A;  1AFP A;  2K03 A;  3VR5 A;  1EYG A;  1JMC A;  4LF5 Q;  5A2Q E;  1I4H A;  2RKS A;  2G9D A;  1VQG A;  1F2M A;  3MVV A;  1HNX L;  2D62 A;  2F0E A;  2I46 A;  5EPL A;  4DUY L;  4O2D A;  2Q2H A;  3W5O A;  1S40 A;  2ZXR A;  2RSN A;  1JOR A;  3U4V A;  3K59 A;  1XNQ L;  1K8O A;  3S24 A;  2OQ0 A;  3M4O H;  2SNM A;  1MI2 A;  5FO9 B;  3G6E A;  3HG9 A;  4B3T Q;  2Z4H A;  2B2U A;  1H9K A;  4QCL A;  4IPH A;  4J6H A;  2WFW A;  3KF6 B;  3TQY A;  4R4O A;  4QQB X;  1TWH H;  1RTN A;  2YV5 A;  1E2V A;  3NEM A;  2KBN A;  4X65 Q;  4Y7N H;  2N8N A;  1FNV A;  5ELD A;  2VUM H;  5IE8 A;  1SBB B;  4PQX A;  4ILW A;  1C0A A;  5CC4 A;  3CCM A;  5C0X G;  4RCO A;  2Z0S A;  3A8K E;  4A3K B;  4H0L C;  1BF4 A;  3S1M B;  3MC0 B;  1I4R A;  1X9N A;  2NN6 I;  1KD1 C;  1PYW D;  1VQA A;  4DAV A;  1ASZ A;  3TRZ A;  4JI1 L;  3IKJ A;  4KJO A;  3EFX D;  1B3Q A;  3LNN A;  4DR1 L;  2FJ2 A;  2R7Z G;  3PCO B;  2KJX A;  1QUQ B;  4K5V A;  1MJC A;  3QO2 A;  1RCV D;  3M9B A;  2UUA Q;  1GXD C;  1HQR D;  3FDT A;  4LF8 L;  2PW5 A;  1JOK A;  4LFC L;  1VQN A;  2A6E D;  4CDE C;  4NMZ A;  4I65 A;  3S2D B;  1EU4 A;  1ROD A;  3ND9 A;  4HID A;  3A7A B;  1WTR A;  1LTI D;  3UI2 A;  5EAY A;  4WJ3 M;  1TVX A;  4QY7 A;  1A2T A;  1U4P A;  1FD7 D;  4J15 A;  4L63 B;  3UDF A;  1O7Y A;  3I4L A;  1H9S A;  2R7F A;  4JC0 A;  4JI1 Q;  2NTT A;  2EY1 A;  4LJZ C;  1EY4 A;  5IT9 E;  2AHO B;  3GQB A;  4QIW B;  3FPU B;  1V1Q A;  3TDQ A;  1R9T H;  2OEO A;  4NXN L;  4A3B B;  1S3O A;  4OON A;  1ESR A;  3NEN A;  5H1S E;  2IX0 A;  5BN4 A;  1QJO A;  4LF8 Q;  4P75 A;  1KDC A;  5NUC A;  1GUN A;  2NYZ D;  1IYJ B;  3H91 A;  1ILP A;  1BUV T;  2L12 A;  1B9M A;  1VS0 A;  1VQ6 A;  1NBW A;  3A0J A;  3HOX B;  1LT5 D;  1QCB D;  5J39 A;  3VA7 A;  5JJZ A;  1I6H B;  1LTR D;  3H3V H;  2WAQ B;  3HKZ E;  2DJG C;  1E2W A;  2JJQ A;  3BZK A;  4IFD I;  3GTL H;  4GZY C;  2KA7 A;  5HY6 A;  5CGK A;  1RF2 D;  4KY5 A;  2EDG A;  4X64 Q;  1QZH A;  4YCW A;  1LTA D;  2EVB A;  4ABN A;  1RDP D;  1MKH A;  4BBR B;  2B8G A;  3T1Y L;  5M5W B;  1H9R A;  4EQO A;  3S2H B;  3DEP A;  1AEX A;  4QL5 A;  4IO9 A;  3VR2 A;  5J22 A;  1LAB A;  1VQD A;  2MNA A;  3PQI A;  4E6I A;  1Y1V B;  3KJP A;  1A63 A;  1PH3 A;  1UAP A;  1D1I A;  3KDF A;  1ENC A;  3OMC A;  5FK9 C;  3J80 L;  4DR7 L;  4OHJ A;  1AN8 A;  3FKI G;  4FVM A;  2B8F A;  1VQ4 A;  3AYH B;  2J0T D;  5J1Z A;  1EIF A;  1QVF A;  3OIP A;  1X3E A;  3BYT B;  3C1E A;  1JC7 A;  3NUC A;  3DUZ A;  3I3C A;  1I5F A;  1N32 L;  5M3F B;  2N49 A;  2EY2 A;  1VQ9 A;  4A3M G;  2F0S A;  2PQA A;  4JOI C;  1VQI A;  3D31 A;  4RHR A;  1V43 A;  3GTQ B;  3DLL A;  2MGS A;  2RDF A;  1E7Z A;  1Y69 U;  3GTM B;  1GM5 A;  1IW7 C;  2I5L X;  4CBV A;  4LW1 A;  1SMX A;  2BE5 C;  5I2X A;  1HHV A;  2F3I A;  5ELE A;  1PRT B;  1YZ6 A;  2PO4 A;  4HN7 A;  4X66 Q;  4PZ7 A;  2BOS A;  3I56 A;  4JV5 Q;  1HZB A;  1DD2 A;  4GN3 B;  2R92 H;  2Z1C A;  2XSC A;  2YTY A;  2E5L Q;  1LTB D;  1N36 Q;  3I4M G;  1TR5 A;  1B44 D;  3EJI A;  5FKA C;  4GOP C;  2CW0 D;  4DV5 L;  3KBX A;  1EIH A;  4I7A A;  4FXK C;  3K0X A;  2EYL A;  3AFP A;  3FVQ A;  3HEJ A;  1K83 B;  2JP1 A;  3HOY G;  1X32 A;  1O80 A;  3NQI A;  4JG2 A;  5IT9 c;  3CC7 A;  2JE6 I;  1K8M A;  1SE8 A;  2VQF L;  2JA5 G;  3M4O B;  1VQO A;  1Q1E A;  1A62 A;  1TQO A;  1VQE A;  2UXC L;  4DV5 Q;  1ZYR C;  3MFY A;  2E8G A;  2EJM A;  1HJP A;  2ZM6 L;  1XMO Q;  3S15 H;  2EIF A;  2AUJ D;  2DUD A;  3AU7 A;  3S1R H;  2YU9 H;  3H3V C;  4TKO B;  1BKB A;  2VUM B;  1IBM L;  4NB3 A;  2AWO A;  1LYL A;  3NPP A;  4G7O C;  1H9M A;  1SLJ A;  3K5O A;  4YIJ A;  2R93 H;  1HQM C;  2QDB A;  2VQF Q;  4EX5 A;  3E3X A;  5FO7 B;  2G5D A;  5JEA J;  4NKL A;  1XWE A;  5FJ8 H;  1JR0 D;  1CHP D;  1MBY A;  4K8J A;  1YNX A;  1EWH A;  4KHZ A;  1PYS B;  4DN4 M;  1CZW A;  3C46 A;  2CWP A;  4WJ4 A;  3S16 B;  3BVG A;  1YHA A;  2VY3 A;  3F8T A;  2L0C A;  3ZYY X;  3CXC A;  3VDY A;  1V9P A;  1KDA A;  1B8A A;  4GOP B;  1WTV A;  3PUW A;  3NXW A;  2BH8 A;  4PMB A;  4DKA C;  4F87 A;  3KJO A;  2F4V L;  4CDC C;  4C3H H;  4DU9 A;  2EY6 A;  3J81 E;  1B70 B;  2XN9 C;  2I07 B;  3QJY A;  2NN6 G;  2JA6 H;  2PNR C;  1SDF A;  4UP7 A;  2IPK D;  5C4X B;  3OPO A;  5LMN Q;  1G8Z D;  1LAC A;  2Z6B A;  2AQ3 B;  2PMZ B;  4H13 C;  2VW9 A;  4FP5 D;  1PVO A;  2K50 A;  4X3T A;  3KF8 B;  2Z8L A;  1PFM A;  1ET6 A;  1X55 A;  2I5H A;  3NWT A;  4K0K Q;  1JOQ A;  1A15 A;  3SK5 A;  4L5R C;  1STH A;  1FVI A;  1HFG A;  3S1N B;  4JI2 Q;  1Q8K A;  4U67 3;  2K33 A;  4K6D A;  2ZTE A;  1SFO H;  1YHQ A;  3S17 B;  5ELN A;  4JI5 L;  2JN4 A;  2KCC A;  2UXB L;  5C3E H;  1PTO D;  4XQN A;  5JJI A;  4CJ0 B;  4A4I A;  2MFI A;  2E76 C;  3QIA A;  1NTG A;  3K7U C;  4HSV A;  5KND A;  1UE6 A;  2C9O A;  2WAQ E;  2BDO A;  3FMC A;  3V96 A;  4QGU A;  2WII B;  1EWC A;  2E2D C;  2K05 A;  1WCM H;  4N9P A;  2KCT A;  2NVQ H;  4K2K A;  1YNJ C;  2F0M A;  1HZ9 A;  1NMF A;  3HGB A;  4A3D H;  1C48 A;  2PZU A;  5A35 A;  1BR9 A;  2R7D A;  1DXM A;  4DR6 L;  1U4R A;  4K8I A;  2EYO A;  3GTK B;  4BXX G;  2PI2 A;  4X6A H;  2EZV A;  3BDL A;  4A3F G;  3DWQ A;  4N9T A;  3ERO A;  3LWE A;  4Q5V A;  4HJA A;  4N8X 1;  3I90 A;  4C3I B;  5JPN C;  2UXD Q;  1SNO A;  1S5B D;  5IYD G;  1I50 B;  2F0W A;  3VYU A;  2PI2 E;  1WD1 A;  3CCU A;  3C3L A;  4X62 Q;  4LFA L;  3PIO 3;  2AQ1 B;  5L37 A;  4IFD G;  2L15 A;  2PNH A;  2WB1 B;  1JE5 A;  3N52 A;  4XQQ A;  2MJ8 A;  3T16 A;  5IGC A;  4A3E B;  1EZ8 A;  3HOW B;  3OOC A;  3HOV H;  2Z6K A;  4IPD A;  2CHB D;  1J9O A;  2JA7 B;  1HNW L;  3OWE B;  1U9R A;  1IKL A;  1HTP A;  2R6G A;  1GVP A;  1SMY D;  3A54 A;  3H0G G;  1SNQ A;  5JAV A;  4AIM A;  3W1B A;  4A3K H;  2K5V A;  3ND8 A;  1Q86 C;  4NP5 A;  2DN8 A;  4IUV A;  2LY7 A;  4OX9 L;  2LS0 1;  2QA4 A;  5KIX A;  5IIF A;  4AYB B;  1RHP A;  3NP8 A;  2KVM A;  2O5J C;  1OXU A;  1PV4 A;  4HAE A;  1PFS A;  4JI6 L;  5J3B A;  2QEX A;  1VF5 C;  2D0O A;  3S2D H;  3T1H L;  1WTO A;  5JVG 3;  1STA A;  1SYC A;  1ML0 D;  2JA8 B;  5IWA Q;  1L0W A;  5FLM G;  2KHI A;  3VR4 A;  3O13 A;  1KHI A;  5GAE C;  1J6Q A;  3NTK A;  1AP0 A;  3A7L A;  4X3K A;  5K5P A;  3D4R A;  4A3B H;  4JCV E;  2XVS A;  1D2B A;  1GO3 E;  3S15 B;  4WJW A;  1SNM A;  3CW2 C;  3P75 A;  4GKK Q;  5DEH A;  2B3G A;  1TU2 B;  1WYD A;  2IHE A;  1AZQ A;  3M4P A;  3I4O A;  4LUV A;  1K8A C;  4K5X A;  1FNW A;  3TN2 A;  3HOX H;  3CKI B;  5CV9 A;  1M90 C;  3DM1 A;  1NCV A;  2R93 B;  1FR3 A;  1VQB A;  1BQQ T;  2N88 A;  4JOI A;  1CM9 A;  3SVM A;  3RNU A;  1I6H H;  1GHK A;  3TBI B;  1SYG A;  1IYV A;  1KNA A;  2ICE C;  3P1H A;  2F4I A;  1A3U A;  4H7B A;  2VQE L;  2D9U A;  4DR2 Q;  4JI8 L;  3I8Z A;  5LMU L;  5T1I A;  3J7A 5;  4L5T A;  1R4P B;  1FNU A;  3SGI A;  4DR5 Q;  4BBR H;  1UEA B;  5IYB G;  3PO3 G;  5LHY 1;  1EYD A;  1YJW A;  5M5W H;  2M00 A;  4JI0 Q;  4A76 A;  1QNU A;  3G4S A;  4CHT B;  3KOJ A;  2L5T A;  4C3H B;  2B2W C;  1Y1V H;  2ZJQ A;  2JA6 B;  3MHB A;  1LTL A;  3HOZ B;  5LMU Q;  1SXT A;  4ZUI A;  3MXN A;  1SSO A;  4BY7 G;  1KXL A;  4A3L H;  2SNS A;  2CH4 A;  1ESF A;  4MNO A;  2A68 D;  3CP0 A;  3GV3 A;  5EKI A;  4B3R L;  2L55 A;  1ICW A;  3PO2 B;  4BBS B;  5C3W A;  2NWG A;  1G29 1;  4GNX C;  4R8I A;  5M3F H;  4C56 C;  4DV2 L;  3IFD A;  4U68 A;  5GAH C;  5M5X H;  4C1N I;  1CA5 A;  4R4C A;  3GTQ H;  3SE0 A;  1K3B C;  1JB3 A;  3GTM H;  4K5W A;  5C44 G;  2MUY A;  4GKJ L;  5C0X J;  1C9O A;  4UP9 A;  4LF7 L;  5HGQ A;  1CI3 M;  1KAA A;  1PFN A;  3D6W A;  1HR0 L;  2E2H B;  4KMU C;  2VXW A;  1QVG A;  2F0K A;  3OYY A;  4A3I B;  2HQE A;  1WTX A;  4V19 0;  3ULL A;  4RKL A;  3IFT A;  5IP9 G;  2XWJ B;  4FF3 A;  5A2Q L;  1WCM B;  2OXP A;  4OIJ A;  1MIU A;  2NVQ B;  1NSN S;  1U5K A;  3R2T A;  4YHH L;  2E75 C;  4A3D B;  1HZC A;  3V2T A;  1PFB A;  1FGB D;  2ZXO A;  2XTI A;  1UWV A;  2KHJ A;  3MTS A;  1K83 H;  1EQQ A;  5M9O A;  5ELC A;  2HQL A;  5AJ3 Q;  4LF4 L;  2B63 B;  1EQV A;  2L9H A;  4A3J G;  2UUC Q;  1CFM A;  1YVC A;  4LWC A;  1SYE A;  3G7L A;  4QMG A;  3BVZ A;  4IUU A;  3M4Q A;  3I4N B;  1A3V A;  2IHF A;  3GTO B;  1HR0 Q;  3OW7 A;  2ICI A;  4OWT B;  3CU7 A;  3I4M H;  2TSS A;  3J7Y W;  4DNR B;  2B29 A;  4B3S L;  3CPF A;  3AMU A;  2WB1 E;  3HOV B;  1AZP A;  3HP3 A;  4DAY A;  1V1P B;  2DY8 A;  1LTS D;  5KNB A;  1SND A;  2ZJP A;  4DV3 L;  1ZYR D;  4ME5 A;  5KGU A;  4KY7 A;  3CPW A;  1NAP A;  2I5M X;  2XIW A;  3GP7 A;  3E0J A;  4GNX B;  1HNX Q;  5IP7 G;  2C35 B;  4JPB W;  1LUZ A;  4RH6 A;  1XMQ L;  4DUY Q;  2GVA A;  2XGT A;  5C4J B;  2HT1 A;  1AH9 A;  1IHZ A;  4KD3 A;  1MJE A;  1XNQ Q;  4QUF A;  1D1K A;  2QKI C;  3NHH A;  1IBL L;  1BCP D;  3BVM A;  2DGY A;  2LMC B;  4DFA A;  3PV0 A;  4FF4 A;  1STY A;  4TQU S;  3S16 H;  1TKW B;  1L1O C;  2XNA C;  1XNR L;  1KC8 C;  4Y52 H;  1BXT A;  3RUZ A;  2IX3 A;  3H3V I;  1PDQ A;  4MIU A;  4JYA L;  3TS2 A;  4KTA A;  2FIN B;  1LT6 D;  2QDL A;  1SJE D;  1KRT A;  2K5H A;  1LT4 D;  1Q1B A;  1XXG A;  2R7Z B;  4ZCK A;  1JWM D;  2A6H C;  5C4X H;  4DR1 Q;  3J7A F;  3QOJ A;  5EBD A;  4DF7 A;  2ZXP A;  3NE5 B;  1O78 A;  3T13 A;  3U58 A;  3H6M A;  5M3M G;  3CCL A;  4PZ8 A;  1GHJ A;  2JK8 A;  2CVR A;  2KCN A;  3RZO B;  1XNR Q;  2A5H A;  4LFC Q;  3FP9 A;  1PXU A;  2CQA A;  2EY5 A;  5C5L A;  1WVL A;  1RIP A;  1YJN A;  3S1N H;  1ENF A;  4FNF A;  5C3X A;  2CWA A;  1PRT C;  1HA5 A;  3KLW A;  1EFW A;  2NN6 H;  1CKN B;  1I3Q B;  1EIG A;  2HIX A;  3ITP A;  3K5N A;  3S17 H;  4LF6 L;  4X3S A;  1H95 A;  3LGJ A;  1CHQ D;  3M7G A;  3R3O A;  4UHV A;  4CKB A;  1SEB D;  3QB3 A;  4NXN Q;  5LL6 X;  4HSP A;  2KCM A;  1YNN D;  1SN8 A;  1YHB A;  1Z47 A;  4YCU A;  1VQ7 A;  3VYT A;  1C4Q A;  1QOH A;  3RZD B;  1Q3L A;  3SEB A;  4DK3 C;  5HGT A;  2R3Z A;  3K5M A;  1MD2 D;  1ZEQ X;  1PH8 A;  1KIX A;  4DNT B;  1GUT A;  2ID0 A;  3U9O A;  3HOU H;  2BCO A;  4ZQ3 A;  3GTK H;  1SR3 A;  1WI5 A;  4DV1 L;  1L1O B;  2C5C A;  1HA6 A;  1CKO A;  5COR A;  3I7F A;  1Y8N B;  4C3I H;  3CC2 A;  2EE1 A;  1I50 H;  1CUK A;  2QCP X;  5JEA H;  1Q81 C;  3K8A A;  4M1U B;  2B2V C;  3F1Z A;  5ISR A;  1D8L A;  2HCI A;  2QIL A;  2HD3 A;  4JBJ A;  3KLS X;  3GV6 A;  4A3E H;  4CJ2 C;  3UDI A;  3HOW H;  1X6O A;  3TEH B;  3T1Y Q;  3TRE A;  1M4V A;  1TS3 A;  4G57 A;  2JA7 H;  2VNU D;  1WTW A;  5M5X B;  3UDG A;  4BXX H;  3J80 i;  5IYC G;  3F2C A;  4GN4 B;  1BBW A;  3SK6 A;  4WFN 3;  1VQJ A;  5KEE A;  1EOV A;  4JW0 A;  2RCF A;  4IFD H;  1JCK B;  3PIP A;  4DR7 Q;  3FKI B;  2CFM A;  1HCZ A;  4WOR A;  2CH4 W;  3J80 E;  1O7L A;  4A93 G;  3DWP A;  4P73 A;  3R2I A;  1YBY A;  2F3W A;  2K1B A;  1N32 Q;  4F88 A;  4OO1 H;  4A3M B;  4IUR A;  3Q0A A;  1UE1 A;  5EBC A;  3T51 B;  4DK6 C;  2O2L D;  2RCN A;  2F0N A;  4CDF C;  3DHQ A;  1N34 L;  1W6J A;  1Y8P B;  1EOT A;  5EKL A;  3GTG H;  4R4I A;  2YTV A;  2F52 A;  5KYI A;  2BH2 A;  2JA8 H;  4PV1 C;  2OTL A;  3STB D;  3FPP A;  2KOL A;  4DV4 L;  3PSI A;  5DAU A;  2B2W A;  3I4M B;  3VR3 A;  3Q23 A;  1X3Q A;  3LWU A;  1JWS D;  4A3C H;  2DY7 A;  5KNC A;  1PH6 A;  4FDB A;  1TT2 A;  1TS5 A;  4YCV A;  3E6Z X;  3T53 B;  3KF6 A;  1YEZ A;  1EFI D;  3V05 A;  1CSP A;  2NVY B;  4IAL A;  3HOY B;  1LLR D;  1F2Y A;  5CMD A;  1VDZ A;  1N34 Q;  5K36 H;  5JVH 3;  1DZ1 A;  1FL0 A;  2PPB C;  1KL9 A;  2OQK A;  1TWG H;  3X3N A;  1Q12 A;  1HH2 P;  3K6O A;  3TZD A;  1GKH A;  4Z9C B;  1STB A;  3RN2 A;  5CYU A;  2Q8R E;  1L2F A;  3RD4 A;  2UXC Q;  2GVB A;  4A3G H;  1G91 A;  1OTC A;  2O4X A;  4ULL A;  4YWL A;  2RQX A;  2ZM6 Q;  1QUQ A;  2E2I B;  1VMC A;  2OCE A;  4JI3 L;  2AUK A;  3J81 L;  2PZW A;  1I4Q A;  4ZUJ A;  3K58 A;  2PZT A;  1TWA B;  4DUZ L;  4PZ6 A;  1IBM Q;  2EYP A;  5D3I B;  4KN4 C;  2M2L A;  1B9N A;  1OXX K;  1RTO A;  3BDO A;  5I6Y A;  3QR8 A;  2EYH A;  2Q2I A;  1BOS A;  1VQC A;  3NBH B;  5GQO A;  3MAQ A;  3MWY W;  1IZ6 A;  3P20 A;  4IFD J;  1G6P A; 
#chains in the Genus database with same CATH homology
 1TII D;  1WD0 A;  2A6E C;  3A8I E;  3I72 A;  1HXY D;  4ZRZ A;  1PZK D;  1OXS C;  3OMG A;  1GUG A;  2GA4 B;  2A74 C;  3VYS A;  2RDH A;  1CT1 D;  1T5E A;  2HUG A;  2EJF C;  3GTJ B;  1B3A A;  1I4P A;  3W3A A;  5IGB A;  2B2U C;  5G3L D;  1GUO A;  1TS2 A;  2F0T A;  1A3T A;  1Z7T A;  2SOB A;  4PNY A;  3D8G A;  2WIN B;  3NTH A;  3KUP A;  4KY6 A;  1SE4 A;  3NWS A;  5KYL A;  1I6V C;  2NUC A;  5EJW A;  4RHS A;  4OGQ C;  5D14 A;  1Z6H A;  2A69 C;  4H44 C;  2IL8 A;  3HOU B;  2OF1 A;  5FO8 B;  5G3L F;  1A6X A;  2F0Q A;  1SAP A;  4XYQ A;  5CV4 A;  1S5E D;  5C5M A;  3W2D A;  1PTO F;  1FYC A;  3MZ5 A;  2EYF A;  5EKK A;  4ZLT F;  1S5D D;  1KDB A;  4DAP A;  2EXZ A;  4TRD A;  4MHE A;  3BZD B;  1EYC A;  1KNE A;  1STE A;  2TMP A;  1HFN A;  3TZU A;  4A3F B;  1DM0 B;  2VB3 X;  3A56 A;  3SDZ A;  1CTM A;  1R4Q B;  1DOK A;  1DOL A;  1CZG A;  1SJH D;  4IUQ A;  1RD9 D;  1EYA A;  1ZXT A;  5DM6 3;  5BN3 A;  2NBF A;  2EPB A;  3JAM E;  1G2T A;  3A8J E;  3I91 A;  4KHV A;  1TS4 A;  4RKB A;  1RJT A;  2FHT A;  3H0G B;  1B50 A;  1F2Z A;  4V0B A;  4C3J G;  2D5D A;  5C0X H;  5CV8 A;  2F0H A;  3GTG B;  3R93 A;  2O5I C;  2VB2 X;  1LV9 A;  4K2L A;  3NQT A;  4HED A;  2Y0S B;  3H09 A;  1LTT D;  4FF1 A;  2B2V A;  2JXM B;  3QWN A;  3G6J B;  1Q90 A;  3D6C A;  1DOM A;  4RWS C;  2SEB D;  1H9S B;  2ENB A;  4CKC A;  5KRU A;  3D3R A;  5ELF A;  1TWG B;  3C1F A;  2K28 A;  4J1M A;  2LFN A;  4FO2 A;  3X3M A;  1BNZ A;  3H94 A;  3VA5 A;  2B2T C;  5CV7 A;  1VF7 A;  4A3G B;  3VYR A;  2YYZ A;  4NDX A;  4DGZ A;  4CGY B;  1I4X A;  2WP8 J;  1NR2 A;  3NK9 A;  4P2C B;  1SYD A;  3BS1 A;  4C3H G;  5EPJ A;  2B2Y C;  4QUC A;  1ONL A;  1S5F D;  3N6R A;  3A55 A;  4KD4 A;  4XXE A;  4L6T B;  4G7Z C;  1LT3 D;  1HTL D;  2Q8I B;  1AW7 A;  1RKN A;  5FLX E;  5COY A;  2NVX B;  2K32 A;  3TP5 A;  2J7Z A;  3PO3 B;  2BDN A;  3KF8 A;  3M4Y A;  3PUX A;  2AWN A;  2RSO A;  5CR3 A;  4IZ8 A;  3KBG A;  4X3U A;  4KKU A;  3EA6 A;  3T56 B;  1WTQ A;  1B2T A;  5IOC A;  5IGD A;  4BY7 B;  1IW7 D;  3TP8 A;  3QG1 A;  2BE5 D;  1TWC B;  5IGF A;  3S1Q B;  1PTO C;  2H4O A;  3WOE A;  1EQT A;  4IUP A;  4C2M B;  4PMW A;  5C44 B;  1EL0 A;  3CRK C;  3SR1 A;  1F9P A;  4O1N A;  2F0D A;  4HMI A;  3OWF A;  3IAY A;  2MP1 A;  4RGM A;  1L0Y B;  3J7A V;  3SXH A;  4QB4 A;  1JIC A;  2K5Q A;  3TP6 A;  1B4O A;  2RDG A;  1MSG A;  5E3F A;  4A3J B;  2X6G A;  5M5Y B;  1HUM A;  4FYD A;  3TME A;  3BDC A;  1SMY C;  3WDN A;  1ENA A;  4J8Q A;  1EY8 A;  1LO5 D;  5AFW A;  1V8Q A;  1EZ6 A;  4RGT A;  4I7Z C;  1ET9 A;  5TSS A;  1PTO B;  4LAA A;  2K04 A;  4XQJ A;  3P7J A;  2K5W A;  3D4D A;  1Q8I A;  4B9X A;  2IX1 A;  3URY A;  3MXG A;  3I70 A;  5IT9 L;  3PUV A;  2EJG C;  1SNC A;  1QB5 D;  5DM7 3;  2PCF B;  2KEC A;  1L0X B;  1CA6 A;  1BCP F;  4XDX A;  1IKM A;  2KEE A;  4OL7 A;  4KN7 C;  2M9V A;  4HMJ A;  1CK1 A;  2KED A;  1QIL A;  2QF7 A;  4RGN A;  5CV5 A;  1T5X D;  3Q22 A;  5D65 A;  3SHL A;  4LMQ D;  1X3P A;  4O42 A;  5M3M B;  4F7X A;  1EY9 A;  3GTP B;  1UNS A;  2PW7 A;  2QEJ C;  2FMC A;  4BS9 A;  2WKD A;  5I6W A;  2EYM A;  4R9W A;  1OO9 B;  3M7N A;  4ZKB B;  4B9W A;  1YNJ D;  2F0J A;  1NUC A;  2A69 D;  1GJX A;  1A2U A;  2OT2 A;  3MEH A;  1F2L A;  3Q24 A;  4OO1 I;  4RGO S;  1SE3 A;  3T4A C;  5JPM C;  1DCZ A;  4KJN A;  1HRJ A;  3QOL A;  3HZX A;  5C4Z A;  3BYY B;  4PMC A;  1EY0 A;  1JQY D;  2L1B A;  2F1M A;  2NVT B;  2A68 C;  2K6A A;  1PLF A;  4ID6 A;  3K7A B;  4HCE A;  1G2S A;  1M8A A;  4FXG C;  4G4K A;  2F0F A;  3I73 A;  1SE2 A;  3RMH A;  3PIP 3;  4M8A A;  3L7Z C;  1EY6 A;  4XT3 B;  2JYO A;  3ONA B;  2B2T A;  4F8M A;  5LL6 S;  2WV6 D;  2H1E A;  1JOO A;  2AQ2 B;  3KLR A;  3MFG A;  2XRS D;  1HPC A;  2MPM A;  2B2Y A;  4ZAI A;  4A93 B;  2E2J B;  1CQV A;  3M3Y B;  2NZ1 D;  1IYU A;  1Y8O B;  3Q6S A;  3FEW X;  3AB9 A;  1V1P A;  4CKE A;  1EU3 A;  3NTI A;  2F0U A;  2V4D A;  4ZYS A;  1D5X C;  3L9A X;  2E74 C;  3TSS A;  4HTH A;  1C8C A;  2KUM A;  3CRL C;  2JA5 B;  1W6K A;  4NW2 A;  3EQL C;  4EGV A;  3KLS A;  1E0B A;  1EEF D;  1TWH B;  2F0L A;  4Y7N B;  2ZT9 C;  1DON A;  4RAU C;  3RLF A;  3DMU A;  2XRQ D;  4ODG A;  4DXG A;  3K5L A;  3MA2 B;  1F77 A;  1BCP C;  1G6Z A;  3M85 A;  2WAC A;  5I9O A;  1S5C D;  4XYO A;  5EGT A;  1BBX C;  5CBA E;  1U4M A;  2IWH A;  5E4W C;  3WOF A;  1O7Z A;  1BDO A;  5E1F A;  1XYI A;  2SDF A;  4IUT A;  4IN3 A;  1QWY A;  3K0Y A;  1F9R A;  3HS0 C;  2Q8T A;  3PUY A;  3PMF A;  2D2C C;  1F9S A;  3FRP B;  3GO5 A;  1EY7 A;  1QG7 A;  3K57 A;  1DJR D;  3U9S A;  2IW3 A;  1R9T B;  4KKS A;  2A73 B;  4UDU C;  5I2Y A;  1E2Z A;  5IOD A;  2K5D A;  4EQP A;  2EOT A;  4G7H C;  4DXF A;  2FMM A;  1DYQ A;  1STG A;  4ZKC B;  2EYJ A;  2BA0 A;  4C3I G;  1H9J A;  3GTL B;  1YNN C;  5E4X A;  5JEA G;  1F9Q A;  1BCP B;  3EVQ A;  1D5M C;  5DNF A;  1VCI A;  3DXJ C;  5CV6 A;  3PUZ A;  2J4X A;  3OSO A;  4XTC S;  3S9W A;  2F0P A;  2BA1 A;  3MXP A;  5ELB A;  1KAB A;  1LTG D;  5I4D A;  4BA2 I;  4CJ1 B;  2PQE A;  5C0X I;  4HR7 B;  4FXD A;  3MXU A;  3VR6 A;  2K01 A;  3E5S A;  3BG3 A;  2KHS A;  1OXT A;  4HCS A;  2F0O A;  3HRZ C;  2JEB I;  2RA4 A;  2Z4I A;  4K14 A;  2NTS A;  3JAM L;  2WKC A;  2DNC A;  1MSH A;  2KQ3 A;  2HDL A;  4OO1 G;  2IJ0 A;  4RFB A;  5IGE A;  2X6L A;  4K6L A;  4EQN A;  1CQF A;  3DEO A;  4BA1 I;  3SK8 A;  2N55 A;  4KK7 A;  4JK1 C;  1XTC D;  1BO0 A;  1KLU D;  4R8N A;  3C2P A;  1PTO H;  3L3O C;  3NBI A;  4IUN A;  3S14 B;  3OIQ A;  4KKT A;  3CQZ B;  3TP7 A;  1J8I A;  1TWF B;  1JE4 A;  1GUW A;  4FF2 A;  3D4W A;  1PZI D;  1SNP A;  1D5Z C;  2CW0 C;  2MHV A;  2R92 B;  1PMR A;  1ILQ A;  2F0I A;  2K7V A;  2IT1 A;  2FFK B;  3OHX C;  4EVO A;  1OXV A;  5JOB A;  4BY1 B;  4B08 A;  1IL8 A;  2B39 A;  4UAI A;  2X69 A;  3R8B A;  2A6H D;  1XX8 A;  5K36 G;  5FOB B;  2JSO A;  5BN5 A;  4C3J B;  4C1N K;  2R61 A;  3ERQ A;  1B1Z A;  5F2D A;  3NSW A;  2HCC A;  5CBE E;  4S3S A;  1EY5 A;  2XWB B;  3IL8 A;  4WRD A;  1PRT D;  3GD7 A;  1GUS A;  4DK0 A;  2RBM A;  4TSS A;  1VMP A;  3DWA A;  3S1R B;  2YU9 B;  1U4L A;  3KK7 A;  1JWU D;  2JEA I;  4DA2 A;  2L4N A;  3HKZ B;  3F2U A;  1STN A;  4XIG S;  4LK1 C;  4MN3 A;  1QE6 A;  1EEI D;  1TY2 A;  5C6A A;  5FLX L;  5D3D A;  4Q0F A;  4QF4 A;  3NBH A;  4OIK A;  1D6E C;  1NR4 A;  5I9P A;  1HUN A;  1PRT F;  4RCN A;  1QNK A;  2NB0 A;  1V1O A;  1UUP A;  4L8J A;  2DNE A;  4XT1 B;  5EPK A;  1B53 A;  1WTP A;  5T1G A;  1SYF A;  2PYK A;  2LKV A;  1MGS A;  1SYB A;  4ZK9 B;  1KTK A;  5C4H A;  2RVL A;  2L11 A;  4JBW A;  1PZJ D;  1TY0 A;  4KV6 A;  1S4Z A;  2F0V A;  1GOZ A;  4RA8 A;  1Y1W B;  1SFO B;  2G9H D;  2F3V A;  5C3E B;  1KLG D;  5HUR A;  5IGG A;  4DK1 A;  1II3 A;  2F03 A;  1ZKO A;  2HDM A;  3LX0 A;  2F0G A;  1I4G A;  3CHB D;  4KI0 A;  4BWG B;  5EQ0 A;  3SK4 A;  4IQZ A;  1AFP A;  2K03 A;  3VR5 A;  5A2Q E;  1I4H A;  2RKS A;  2G9D A;  1F2M A;  3MVV A;  2D62 A;  2F0E A;  2I46 A;  5EPL A;  2ZXR A;  2RSN A;  1JOR A;  3K59 A;  1K8O A;  2SNM A;  1MI2 A;  5FO9 B;  3HG9 A;  2Z4H A;  2B2U A;  1H9K A;  4QCL A;  4J6H A;  1RTN A;  1E2V A;  1FNV A;  5ELD A;  1SBB B;  4PQX A;  4ILW A;  5CC4 A;  5C0X G;  4RCO A;  3A8K E;  4A3K B;  4H0L C;  1BF4 A;  3S1M B;  3MC0 B;  1I4R A;  2NN6 I;  1PYW D;  4DAV A;  3IKJ A;  4KJO A;  3EFX D;  3LNN A;  2FJ2 A;  2KJX A;  4K5V A;  3QO2 A;  1RCV D;  1GXD C;  1HQR D;  3FDT A;  2PW5 A;  1JOK A;  2A6E D;  4NMZ A;  4I65 A;  3S2D B;  1EU4 A;  1ROD A;  3ND9 A;  3A7A B;  1WTR A;  1LTI D;  3UI2 A;  1TVX A;  1A2T A;  1U4P A;  1FD7 D;  4L63 B;  1O7Y A;  3I4L A;  1H9S A;  2NTT A;  2EY1 A;  4LJZ C;  1EY4 A;  5IT9 E;  3GQB A;  4QIW B;  3FPU B;  3TDQ A;  2OEO A;  4A3B B;  1ESR A;  2IX0 A;  5BN4 A;  1QJO A;  1KDC A;  5NUC A;  1GUN A;  2NYZ D;  3H91 A;  1ILP A;  1BUV T;  2L12 A;  1B9M A;  3HOX B;  1LT5 D;  1QCB D;  5J39 A;  3VA7 A;  5JJZ A;  1I6H B;  1LTR D;  2WAQ B;  4IFD I;  1E2W A;  4GZY C;  2KA7 A;  5CGK A;  1RF2 D;  4KY5 A;  2EDG A;  1LTA D;  2EVB A;  4ABN A;  1RDP D;  4BBR B;  2B8G A;  5M5W B;  1H9R A;  4EQO A;  3S2H B;  3DEP A;  1AEX A;  3VR2 A;  5J22 A;  1LAB A;  4E6I A;  1Y1V B;  1UAP A;  1D1I A;  1ENC A;  3OMC A;  5FK9 C;  3J80 L;  4OHJ A;  1AN8 A;  4FVM A;  2B8F A;  2J0T D;  5J1Z A;  3OIP A;  3BYT B;  3C1E A;  1JC7 A;  3NUC A;  3DUZ A;  3I3C A;  5M3F B;  2EY2 A;  2F0S A;  3D31 A;  4RHR A;  1V43 A;  3GTQ B;  2MGS A;  2RDF A;  1Y69 U;  3GTM B;  1IW7 C;  4CBV A;  2BE5 C;  5I2X A;  1HHV A;  5ELE A;  1PRT B;  2PO4 A;  4HN7 A;  2BOS A;  1DD2 A;  2Z1C A;  2XSC A;  1LTB D;  1TR5 A;  1B44 D;  3EJI A;  5FKA C;  2CW0 D;  3KBX A;  1EIH A;  4FXK C;  2EYL A;  3FVQ A;  3HEJ A;  1K83 B;  2JP1 A;  1X32 A;  1O80 A;  3NQI A;  2JE6 I;  1K8M A;  3M4O B;  1Q1E A;  1TQO A;  1ZYR C;  3MFY A;  2EJM A;  2AUJ D;  3AU7 A;  3H3V C;  4TKO B;  2VUM B;  2AWO A;  3NPP A;  4G7O C;  1H9M A;  4YIJ A;  3K5O A;  1HQM C;  2QDB A;  5FO7 B;  5JEA J;  4NKL A;  1XWE A;  1JR0 D;  1CHP D;  1MBY A;  4K8J A;  1EWH A;  4KHZ A;  4DN4 M;  1CZW A;  3C46 A;  3S16 B;  3BVG A;  2L0C A;  3ZYY X;  1KDA A;  1WTV A;  3PUW A;  3NXW A;  4PMB A;  4F87 A;  4DU9 A;  2EY6 A;  3J81 E;  2XN9 C;  2I07 B;  3QJY A;  2NN6 G;  2PNR C;  1SDF A;  2IPK D;  5C4X B;  3OPO A;  1G8Z D;  1LAC A;  2AQ3 B;  2PMZ B;  4H13 C;  4FP5 D;  4X3T A;  2Z8L A;  1PFM A;  1ET6 A;  3NWT A;  1JOQ A;  1A15 A;  3SK5 A;  1STH A;  3S1N B;  1HFG A;  4U67 3;  2K33 A;  4K6D A;  3S17 B;  2KCC A;  1PTO D;  4XQN A;  4CJ0 B;  2E76 C;  3QIA A;  4HSV A;  5KND A;  2C9O A;  2BDO A;  3FMC A;  3V96 A;  2WII B;  1EWC A;  2E2D C;  2K05 A;  4N9P A;  4K2K A;  1YNJ C;  2F0M A;  3HGB A;  1C48 A;  2PZU A;  5A35 A;  1BR9 A;  1DXM A;  1U4R A;  4K8I A;  2EYO A;  3GTK B;  2EZV A;  3BDL A;  3DWQ A;  4N9T A;  3ERO A;  3LWE A;  4Q5V A;  4C3I B;  3I90 A;  5JPN C;  1SNO A;  1S5B D;  1I50 B;  2F0W A;  3VYU A;  1WD1 A;  3C3L A;  3PIO 3;  2AQ1 B;  4IFD G;  2WB1 B;  3N52 A;  4XQQ A;  2MJ8 A;  3T16 A;  5IGC A;  4A3E B;  1EZ8 A;  3HOW B;  3OOC A;  2CHB D;  1J9O A;  2JA7 B;  3OWE B;  1U9R A;  1IKL A;  1HTP A;  2R6G A;  1SMY D;  3A54 A;  1SNQ A;  5JAV A;  3ND8 A;  4NP5 A;  2DN8 A;  4IUV A;  2LY7 A;  2LS0 1;  5KIX A;  5IIF A;  4AYB B;  1RHP A;  3NP8 A;  2KVM A;  2O5J C;  1OXU A;  4HAE A;  1VF5 C;  1WTO A;  5JVG 3;  1STA A;  1SYC A;  1ML0 D;  2JA8 B;  3VR4 A;  3O13 A;  3NTK A;  1AP0 A;  3A7L A;  4X3K A;  5K5P A;  3D4R A;  2XVS A;  1D2B A;  3S15 B;  4WJW A;  1SNM A;  3P75 A;  5DEH A;  1TU2 B;  1AZQ A;  4K5X A;  1FNW A;  3TN2 A;  3CKI B;  5CV9 A;  3DM1 A;  1NCV A;  2R93 B;  1FR3 A;  1BQQ T;  2N88 A;  3SVM A;  1CM9 A;  1GHK A;  3TBI B;  1SYG A;  1IYV A;  1KNA A;  2ICE C;  3P1H A;  2F4I A;  1A3U A;  4H7B A;  2D9U A;  3I8Z A;  5T1I A;  1R4P B;  1FNU A;  1UEA B;  5LHY 1;  1EYD A;  2M00 A;  1QNU A;  4CHT B;  2L5T A;  4C3H B;  2B2W C;  2JA6 B;  3MHB A;  3HOZ B;  1SXT A;  4ZUI A;  3MXN A;  1SSO A;  2SNS A;  1ESF A;  2A68 D;  3GV3 A;  5EKI A;  2L55 A;  1ICW A;  3PO2 B;  4BBS B;  5C3W A;  2NWG A;  1G29 1;  4R8I A;  4C56 C;  3IFD A;  4U68 A;  4C1N I;  1CA5 A;  3SE0 A;  1JB3 A;  4K5W A;  2MUY A;  5C0X J;  1CI3 M;  1KAA A;  1PFN A;  3D6W A;  2E2H B;  4KMU C;  2VXW A;  2F0K A;  4A3I B;  2HQE A;  1WTX A;  4V19 0;  4RKL A;  3IFT A;  2XWJ B;  4FF3 A;  5A2Q L;  1WCM B;  2OXP A;  4OIJ A;  2NVQ B;  1NSN S;  3R2T A;  2E75 C;  4A3D B;  3V2T A;  1PFB A;  1FGB D;  2ZXO A;  3MTS A;  5M9O A;  5ELC A;  2B63 B;  1EQV A;  2L9H A;  1CFM A;  1SYE A;  3G7L A;  4QMG A;  3BVZ A;  4IUU A;  3I4N B;  1A3V A;  3GTO B;  3OW7 A;  2ICI A;  3CU7 A;  2TSS A;  3J7Y W;  4DNR B;  3AMU A;  3HOV B;  1AZP A;  3HP3 A;  4DAY A;  5KNB A;  1V1P B;  2DY8 A;  1LTS D;  1SND A;  1ZYR D;  4ME5 A;  5KGU A;  4KY7 A;  1NAP A;  2XIW A;  3GP7 A;  3E0J A;  4RH6 A;  5C4J B;  1IHZ A;  4KD3 A;  4QUF A;  1D1K A;  2QKI C;  3NHH A;  1BCP D;  3BVM A;  2LMC B;  4DFA A;  3PV0 A;  4FF4 A;  1STY A;  4TQU S;  1TKW B;  2XNA C;  1BXT A;  3RUZ A;  2IX3 A;  1PDQ A;  4MIU A;  4KTA A;  2FIN B;  1LT6 D;  1SJE D;  1LT4 D;  1Q1B A;  1XXG A;  2R7Z B;  3J7A F;  1JWM D;  2A6H C;  3QOJ A;  5EBD A;  4DF7 A;  2ZXP A;  3NE5 B;  1O78 A;  3T13 A;  3H6M A;  1GHJ A;  2CVR A;  2KCN A;  3RZO B;  2A5H A;  1PXU A;  2CQA A;  2EY5 A;  5C5L A;  1WVL A;  1ENF A;  4FNF A;  5C3X A;  1PRT C;  1HA5 A;  2NN6 H;  3K5N A;  1I3Q B;  1EIG A;  3ITP A;  4X3S A;  1CHQ D;  3M7G A;  3R3O A;  4CKB A;  1SEB D;  3QB3 A;  5LL6 X;  4HSP A;  1YNN D;  1Z47 A;  3VYT A;  1C4Q A;  1QOH A;  3RZD B;  1Q3L A;  3SEB A;  5HGT A;  2R3Z A;  3K5M A;  1MD2 D;  1ZEQ X;  4DNT B;  1GUT A;  2ID0 A;  3U9O A;  2BCO A;  4ZQ3 A;  2C5C A;  1HA6 A;  5COR A;  1Y8N B;  2EE1 A;  2QCP X;  5JEA H;  4M1U B;  2B2V C;  5ISR A;  2HCI A;  2QIL A;  3KLS X;  3GV6 A;  4CJ2 C;  1M4V A;  1TS3 A;  4G57 A;  2VNU D;  1WTW A;  5M5X B;  3SK6 A;  4WFN 3;  5KEE A;  4IFD H;  1JCK B;  3FKI B;  1HCZ A;  4WOR A;  3J80 E;  1O7L A;  3DWP A;  3R2I A;  2K1B A;  2F3W A;  4F88 A;  4OO1 H;  4A3M B;  4IUR A;  3Q0A A;  5EBC A;  3T51 B;  2O2L D;  2F0N A;  3DHQ A;  1W6J A;  1Y8P B;  1EOT A;  5EKL A;  5KYI A;  4PV1 C;  3FPP A;  2KOL A;  5DAU A;  2B2W A;  3I4M B;  3VR3 A;  3Q23 A;  1X3Q A;  3LWU A;  1JWS D;  2DY7 A;  5KNC A;  1TT2 A;  1TS5 A;  3E6Z X;  3T53 B;  1EFI D;  3V05 A;  2NVY B;  4IAL A;  3HOY B;  1LLR D;  1F2Y A;  5CMD A;  1VDZ A;  5K36 H;  5JVH 3;  1DZ1 A;  2PPB C;  3X3N A;  1Q12 A;  3K6O A;  3TZD A;  4Z9C B;  1STB A;  5CYU A;  2Q8R E;  3RD4 A;  1G91 A;  2O4X A;  4ULL A;  2RQX A;  2E2I B;  1VMC A;  2AUK A;  3J81 L;  2PZW A;  1I4Q A;  4ZUJ A;  3K58 A;  2PZT A;  1TWA B;  2EYP A;  5D3I B;  4KN4 C;  2M2L A;  1B9N A;  1OXX K;  1RTO A;  3BDO A;  5I6Y A;  2EYH A;  1BOS A;  3MAQ A;  3MWY W;  3P20 A;  4IFD J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...