3BS1A

Structure of the staphylococcus aureus agra lyttr domain bound to dna reveals a beta fold with a novel mode of binding
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
MDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulator
molecule keywords DNA (5'-D(*DTP*DTP*DTP*DAP*DAP*DCP*DAP*DGP*DTP*DTP*DAP*DAP*D
publication title Structure of the Staphylococcus aureus AgrA LytTR Domain Bound to DNA Reveals a Beta Fold with an Unusual Mode of Binding.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 28
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bs1A00
3BS1A 4XXEA 4XQQA 4XYOA 4CBVA 4XQJA 4XQNA 4G4KA 4XYQA
chains in the Genus database with same CATH superfamily
1QILA 1JWMD 4DUYQ 3TMEA 1WI5A 4QF4A 4OX9L 4GN5A 1RD9D 3CPWA 1PH1A 1H9SA 2MGSA 4DR5Q 2PPBC 2WAQG 3S1NB 1PTOH 1A3TA 2DY7A 3HOWG 1Q82C 3GTQH 4WRDA 1RL2A 1K0SA 1A63A 4LF8L 1SROA 1Q86C 3J80i 1YEZA 1U4MA 3FPPA 1V9PA 2B2YC 2AWNA 4DUYL 2BA1A 1IYJB 3GP7A 1O7ZA 1VQ6A 4DR5L 2QDBA 3LX0A 2C5CA 1OXUA 1QCBD 3PUXA 3S1QB 4IUUA 5IGDA 4ABNA 3D0FA 1JJGA 2KHIA 3K59A 3J81c 3Q22A 2E2JB 2EY6A 1EIGA 1K28A 1JWUD 3P7JA 5M3MH 4A3EB 2PI2E 1GVPA 3J7A5 3NQTA 3U50C 3NELA 4KD3A 2ZTDA 3SR1A 1B9NA 5C4HA 3KUPA 2PQAA 1TIID 1D5MC 3E9HA 2Q8IB 1VQMA 1Q1EA 4A3KB 1PYBA 1O7IA 3QJYA 3EA6A 1SNPA 4ZK9B 2J4XA 4RGNA 2QW7A 2NBFA 2F0DA 2K32A 1K73C 2F0PA 4HR7B 1GUTA 3C1FA 3FRPB 2EYFA 3HOZH 3I4NH 5FKAC 4P74A 2HCCA 2VZAA 1U9RA 2QILA 3H3VC 4KTAA 1STAA 2B2UA 1A3UA 3J80L 4IFDI 1EOVA 1W3SA 3ULLA 1SXTA 2MHVA 1GHKA 2K75A 2I0QA 4K5XA 5M5XH 2ZJPA 4KLKA 3I91A 3MXUA 2TMPA 1ET9A 3B6YA 4NMZA 3OYYA 2WKDA 2O2LD 3U4VA 3I4OA 2CHBD 3T53B 3G71A 2JA6G 2RVLA 3KYHC 2E8GA 1B53A 3CU7A 4X62Q 2R7ZG 3R3OA 2NN6G 2M00A 3I8ZA 2RHQB 4TRDA 4B08A 2BOSA 3V2TA 4DNTB 2PCFB 3TN2A 2VQFQ 1HTLD 3D4DA 1N9WA 3V05A 1E22A 4JBKA 1EWHA 2BH2A 4KY5A 4X62L 4KI0A 4AQYQ 1WVLA 1S72A 3GTOH 2PMZE 2KCCA 3UDFA 2PNRC 1DCZA 1PRTB 1WOCA 2R92B 3L0OA 5EPJA 1NUCA 4PZ6A 3M7GA 2JA8G 2VQFL 3P1HA 3OTOQ 2G9DA 4JI4Q 2KUMA 3HOYH 2CFMA 1TWFB 4A93B 5IT9L 3KF6B 4C3HH 1EU4A 4YCUA 4AQYL 1WFQA 3OIQA 4FVMA 1HRJA 4PZ7A 4GNXB 1Y1WG 4R8IA 4RH6A 2XVSA 3KF8B 2VUMG 4C3IG 5JEAH 2F3VA 3OTOL 4JI4L 4LFCQ 3FMCA 2CQAA 1MGSA 5I4DA 3G4SA 1I4GA 2AQ3B 3FDTA 2JN4A 3X3MA 1I50H 1L1OB 1SYEA 3FPUB 4IQZA 3TS2A 2UUAQ 1KRSA 2XTIA 5BN5A 1V8QA 1IXRA 4LFCL 2JA5H 4UP7A 4A3FH 1SJED 3T1YL 2G5DA 4R9WA 5T1GA 3SDZA 3DUZA 4QL5A 4IN3A 1Y14B 4EQNA 5LL6X 2Q8RE 3IRBA 3PIPA 2E2IH 3L2PA 1STGA 1VQCA 2IHEA 1MD2D 1CSPA 1RIPA 1LUZA 2UUAL 4A3CH 4Q5VA 3GO5A 1CKNB 4J6HA 3I7FA 3I4MB 3KLSX 3S14H 1WJJA 1NE3A 3Q6SA 4WJ3M 2UXCL 3RMHA 4C3JB 1SNQA 2IPKD 5D65A 3CP0A 3K81C 4PG3A 4A3DB 1SE4A 4JI5Q 2JA7H 3M4OH 3S15B 3PO3G 1JR0D 3NBHA 4OIKA 4DAMA 2HIXA 1B1ZA 3ICEA 3OIPA 5M3MG 1PRTC 4KY6A 4BY7B 1VQJA 3OW7A 3I70A 4BA2I 2SNMA 3A8IE 1BCPF 1NBWA 3NWSA 4JI5L 3CXCA 3P20A 1TWAH 4C1NI 3KBXA 2VW9A 1PLFA 4IUQA 1ILPA 1AH9A 2Y0SG 2A1AA 1WCMH 4MNOA 5CBAE 1EL0A 1FL0A 1KDBA 4GNXC 1D5ZC 2DGYA 5KYIA 5AFWA 5C4ZA 5FLXc 2KHJA 1O80A 4S3SA 3EVQA 2PW7A 1DD2A 1TQOA 1KL9A 1ENAA 1IYUA 1QVCA 3L9AX 4OHJA 3RZDH 1L1OC 1AE2A 3S16B 3QOLA 1TWGB 3VR3A 3NPPA 4PMBA 1KC8C 1HQMC 3H94A 1EEID 1L0YB 1VQFA 1ML0D 3NTKA 4JBMA 2XSCA 1PTOD 4PNYA 1CI3M 3VYTA 4B3SQ 1X54A 2K5NA 2IY5B 5C44B 1XYIA 3RR5A 1IKLA 4XT1B 4AH6A 2BE5D 3GTPB 2QGQA 4KKUA 4X3KA 4QGUA 4JI1Q 2B29A 2JXMB 2GVBA 3CAMA 1VQOA 4DV1Q 4B3SL 4DNRB 1GKHA 4ZRZA 2PO4A 2A6HC 2KOLA 3FP9A 3J81i 4LFBQ 1G6PA 3ULJA 3AYHB 2B2WA 4C2MH 5M5WB 1Q12A 1TVXA 4JI1L 4HJ7A 4B3TQ 3J7AF 2ZT9C 3V96A 1NSNS 1E3PA 1TU2B 4DV1L 1LTID 4L5SA 4XQNA 1XMOQ 1G2TA 4GLAC 3H0GB 3HOVB 4LFBL 5EBDA 3PIOA 2D5DA 1QNUA 4CDFC 3I4MG 4A3LG 4YWKA 2EIFA 2I46A 4J8QA 4RA8A 4EQ5A 1JMCA 2CWAA 1CSQA 2Z4HA 3NEMA 5C3XA 1SE2A 1C0AA 3PF5A 2UU9Q 2RDGA 3BU2A 2LFNA 2EY2A 1XMOL 1QJOA 3S1RH 2K33A 5J3BA 1F9PA 3VYRA 4K0KQ 2SNSA 3HG9A 5FK9C 4BBRH 4CDDC 4TQUS 1YHBA 2E2HB 3CCSA 2Z8LA 2JP1A 3KJPA 1SYDA 1F77A 2A74C 1Y8PB 5IYBG 4RWSC 1QUQA 1YBYA 2MP1A 1GUGA 2EE1A 2UU9L 5DAUA 3S2DB 3K8AA 5K5PA 4G4KA 2F0EA 5FO8B 3D8GA 3ERSX 4K0KL 4ME5A 1N32Q 1PH9A 1ICFB 3OOCA 1H9SB 2RBMA 5IGCA 4BBSH 4DUZQ 5AJ3Q 5K36H 5I9PA 3TP8A 2M9VA 1E1OA 5IYCG 1EFID 5IP7H 4JBWA 4N9PA 5IP9H 1CHQD 4R4IA 1D1KA 5C6AA 5IIFA 4R4TA 3BS1A 4DFAA 2MFIA 1MHWC 3SK8A 1N32L 3I73A 4LUZA 3NBIA 4ZLTF 1M1KC 4OL7A 1G6ZA 3HEJA 1A6XA 1D1IA 4QUFA 1JOKA 2K4KA 3E9IA 2N78A 1KRTA 4R4QA 4BXXG 4RGMA 3G6JB 3N6RA 1Y1VH 3BG3A 3GV3A 1EQRA 4GN4B 2F0OA 2E75C 4UPAA 2FINB 2EPBA 4LW1A 4AYBG 1HCZA 4CJ1B 3MXNA 1RDPD 2PW5A 3GTMB 1ZXTA 3HGBA 4NW2A 1EY5A 1K8GA 4IPGA 1EU3A 1PZID 2WACA 1BCPB 1JOOA 1RODA 1NMGA 1STHA 3NTHA 3BZKA 1YNNC 1XPOA 4HIKA 1ZYRD 3I56A 2OT2A 5DLQE 1PTOF 4DXGA 1QOHA 2B8GA 3J81E 3PO2B 4X64Q 3H91A 1PDQA 1ESRA 2H4OA 1NNXA 1SFOH 5C3EH 2AKWB 4NXMQ 2WAQB 2A6ED 4MZ9A 3OW2A 1YZ6A 4Y7NB 1VQ5A 1VCIA 2LKVA 1XTCD 3HOWB 3MHBA 4NKLA 5C4XH 4POFA 1T9HA 2K5QA 4EGVA 1XNQQ 3OHXC 4X64L 4UAIA 2KBNA 1F9QA 3HOUG 4MHEA 4DR6Q 4CDEC 1I6HB 4DAYB 3K7AB 5EKLA 4DK0A 3A8JE 1LO5D 3GTLH 4NXML 2UUBQ 5CORA 4CJ2C 1JE4A 2Q2HA 1OO9B 4LWCA 3DXJC 1X32A 1SRUA 1BXTA 1XTDA 2WAQE 1AEXA 1XNQL 1EWIA 4CGYB 4DR6L 1B70B 2F0SA 2K5WA 3P75A 5LMNQ 2BDOA 1EIFA 2UUBL 4APVA 2UXDQ 3TP6A 3FKIB 5CYUA 3HOXH 2OTLA 1BKBA 4K2LA 3JAML 1N33L 1KDAA 1U4RA 4KN4C 1X65A 4HAEA 1JB7A 2IT1A 2VY3A 1GUNA 4A3BH 1V1PA 5LMNL 3J81j 5C0XH 3IL8A 1RTNA 2JEAI 2UXDL 4DKAC 2WP8J 4N8FA 3MAQA 1DJRD 2HCIA 4RMFA 1E7ZA 3NSWA 4AIMA 5IODA 1A0IA 3CHBD 2DUDA 4RGTA 2NVYB 1C8CA 4XQJA 3CMEA 5I2YA 3EJIA 2D0PA 1G8ZD 4DXFA 2B2VA 1I94Q 4A3GB 3GTJH 1SNOA 3AU7A 1C9OA 3OMCA 2DNCA 5M5YH 1L0XB 1PFBA 3NQIA 2R93G 2Z6KA 2L12A 1TY0A 3H3VH 1KAAA 2B2UC 2EYHA 2LXJA 1CKOA 2D9UA 3UDIA 1QVGA 1RHPA 2IX0A 3TS0A 3MFGA 2JA6B 1HH2P 2NB0A 2R7ZB 2PZUA 1I94L 4H0LC 5IYDG 3OWFA 1B50A 4YY3L 1YVCA 2N88A 2CCZA 1U4LA 1NAPA 2AUJD 3K58A 2QF7A 4QQBX 3I90A 1II3A 2HT1A 1QWYA 1DM0B 3GTGB 4OO1H 2FHTA 4L6TB 2X6GA 2IW3A 3S1NH 4LF9Q 1FR3A 1HPCA 2F3IA 1C48A 1UE1A 3E6ZX 4JI7Q 3I2ZA 2JA8B 1TXYA 2IHFA 5FLXL 3CCUA 4DR4Q 2FMCA 1VQ8A 4IFDG 5C4JH 1R4PB 1DOLA 4A3IB 1FJGL 1PYWD 4YIJA 3AFQA 1BBXC 3F2DA 4OELB 3S1QH 4LF9L 2XGTA 1Y1WB 4IOAA 4KHVA 4JI7L 4C3IB 2VUMB 4CDCC 3CC4A 2DJFC 3VA7A 4A3EH 2YTYA 4JC0A 1HXYD 5CV6A 3D4WA 4UP9A 5FLMG 4RHRA 5D3IB 2ID0A 3L3OC 4A3KH 5ISRA 5I9OA 5M3FG 2H1EA 4A3JH 2L9HA 2IWHA 3SHLA 1VQPA 3GTKB 5FJ8G 1IYVA 1AZQA 1JCKB 1BNZA 1HFNA 2VL6A 2LXKA 2ZXRA 1FNVA 3E0JA 1PZKD 3D6WA 5E4WC 3FKIG 2E76C 4JVZA 1D2BA 5EKKA 3AFPA 1PTOB 4X6AH 3MEFA 5C3WA 4QCLA 4UHVA 2F0IA 1YNJC 5C5MA 1VF5C 2L11A 2GA4B 4JI2Q 1EZ8A 1MJEA 2Z1CA 4HJ5A 1STBA 2A68C 3T16A 3TP5A 2I5HA 1JT8A 3PO3B 2HQEA 1LYLA 1G291 4P72A 5M3MB 3NWTA 4A3GG 1B44D 1H9KA 3R2TA 2LSSA 2YV5A 2CQOA 1X56A 5IGGA 2EYOA 1CZGA 1CA5A 4JI2L 4G7ZC 1AW7A 2KEDA 2F0VA 3CPFA 1UNSA 2L5TA 1TS4A 1K3RA 2EJMA 1PH6A 2Y0SB 1O7YA 2NYZD 3D6CA 4JOIA 2B8FA 2R92H 1GOZA 1A8VA 1ENCA 3PUYA 4X3UA 5HURA 2I5LX 3VDYA 2XRSD 1J6QA 1C4QA 4HIOA 1WTRA 3M9BA 5D14A 4B9WA 1TWFH 4A93H 3O13A 2ZTEA 5E1FA 1GUWA 4POGA 2K5DA 5EJWA 2Y0SE 2D0OA 1O78A 1HZ9A 4IFDJ 4ZAIA 1K83B 2CVRA 3A5ZB 1FGUA 2F0HA 3S1MB 1C7YA 3W5OA 1F9SA 2F0QA 4A3IG 4EQOA 1VMCA 2F0FA 3F2BA 2K14A 2K50A 3IFDA 3I55A 3MWYW 3DM1A 3GD7A 1HA6A 1LABA 2HDMA 1PTOC 1R9TB 1MIUA 5HY6A 2EJGC 4Y52H 1SSOA 2Q8TA 3J80E 2AHOB 4MIUA 1HHVA 2JA9A 1BUVT 1FGBD 1JJ2A 2R61A 1PMRA 4GOPA 1SMXA 4ZUJA 2QKIC 3JAMc 5M9OA 3GTOB 5GAHC 5JJZA 4DK3C 2B63G 2AQ2B 2XNAC 3AB9A 3CQZB 3PF4A 5TSSA 4ZUIA 4BA1I 2FFKB 2WB1G 4V190 3S17H 4YHHQ 2Z9HA 1X3PA 2F0TA 3HRZC 4BY1G 4C3JH 3HS0C 4DR7Q 5COYA 2RF4A 4IOCA 4F88A 1MJCA 4JYAQ 3RZOH 4A3DH 2K01A 4N9TA 2LY7A 1A2UA 1STNA 4KKTA 4ZCKA 4OEMB 3S15H 4L5QA 2QDLA 4Q0FA 2Z0SA 1DONA 1MBYA 2AWOA 4YHHL 5CV9A 4LFAQ 3MXNB 4C1NK 3C2PA 4DR7L 4BY7H 3PIP3 3M85A 2MUYA 3H09A 1IZ6A 4IO9A 4XT3B 4JYAL 2RHSB 1NCVA 3F8TA 2EOTA 2IX3A 1KTKA 4DR1Q 2ZJQA 5GAEC 4GLXA 5IT9E 3T51B 3LNNA 1QNKA 3H3VI 2JA5B 3K7UC 2DJGC 4A3MH 1GUOA 3H15A 2KJXA 4IJHA 3D4RA 3VR2A 1Z47A 4LF7Q 1Q8IA 2PQEA 3ITPA 4DR1L 4DA2A 1LT4D 4LJZC 2K04A 5GADC 2K52A 5CV4A 1PYSB 2RCNA 4IPDA 4F8MA 2DY8A 3X3NA 2F0KA 3SK5A 3CCVA 1SEBD 5JPNC 3PUWA 3U58A 3S16H 4OO1I 1AP0A 4LF7L 3HOZG 3I4NG 2VS1A 4ALPA 3FVQA 4M1UB 2PI2A 1X55A 2VB3X 1EFWA 2JA7B 4ZYSA 1IBMQ 2K5HA 5FOBB 4KK7A 4FNFA 4GZYC 2J7ZA 4A4IA 1QG7A 4M8AA 3SK6A 5C44H 1KNEA 1CHPD 1XJVA 2JSOA 1Z7TA 4O0AA 4PZ8A 3GTPH 4F7XA 4AYBB 1JOQA 2OQKA 1IBML 2UUCQ 1IHZA 2V1CC 1I5FA 1S5FD 2EYMA 3STBC 4NXNQ 1PH2A 2NZ1D 3DM3A 4DR3Q 3D3RA 3RLNA 1V1PB 5I2XA 3NENA 2ENBA 1RTOA 4B9XA 5M5WH 3UDXA 4G57A 5E7NA 1Q3LA 2UUCL 1GM5A 4IUNA 2F0UA 1P16A 4K6LA 4AYBE 1Y69U 5KNDA 4NXNL 3DEPA 1ZYRC 3H0GH 4DR3L 3HOVH 5IY0A 1EQTA 3SK4A 4XYOA 4U673 3A55A 1H9MA 3BYYB 5ELFA 1Q7YC 3E0EA 3ND9A 2A73B 5LMNW 3NXWA 3HOYG 1S5CD 1STEA 1HNXQ 4C3HG 3G48A 3CMAA 2RDHA 2A6EC 1LACA 1U4PA 4OONA 3EROA 3HOUB 2NTTA 1S40A 3IKJA 2E2HH 5EBCA 5JVG3 1L2FA 1VQGA 1DXMA 3MTSA 4KJOA 2L1BA 5JEAG 4B3TL 1TWHH 2RSOA 1HNXL 5JAVA 2F0NA 1S3OA 3S2DH 4FXGC 3A7AB 1SJHD 1HNZQ 1LLRD 4DV5Q 1X6OA 4FF4A 2XWBB 1CZWA 2KCMA 3PIO3 4OXPA 3MC0B 2NVTB 2B3GA 3A8KE 3BYTB 1F2LA 1PZJD 3ZYYX 2TSSA 4C2MB 2JA5G 3MZ5A 4A3FG 4NPSA 1MKHA 5CV8A 3NK9A 1LTRD 1VMPA 5DM63 4DV5L 1LTLA 2KHSA 1E2WA 1U0LA 1UE7A 1Q81C 4A3CG 1PRTD 1TWCB 3CKIB 3E3XA 3QOJA 3EBEA 5LMUQ 3CCLA 3BVMA 4OWTB 5FO7B 5KNCA 1SYFA 1LV9A 5KIXA 2F3WA 3KF6A 2MQHA 5JJIA 4EX5A 1VQKA 4KN7C 1YITA 4JW0A 1KLGD 4R8NA 3M3YB 1L0WA 2A69C 1YI2A 2JA7G 3KF8A 4DUZL 5AJ3L 3K0YA 2R93B 1EYAA 4B3MQ 4FP5D 1O7LA 3L7ZC 3GTMH 1ZKOA 1D5XC 4HSPA 1PXUA 1EY6A 4OIJA 3ZJYC 3FEWX 2B2VC 2O5IC 3DMUA 3QO2A 3TZDA 1A15A 1YJ9A 1CQFA 2Z6KC 2FMMA 2PQAB 4JBJA 3M7NA 1WTOA 4ME3A 4K8IA 2RSNA 4UP8A 1TY2A 1N36Q 1HNWQ 4LUVA 5NUCA 1SN8A 1WCMG 3G6EA 1TT2A 3PO2H 2JYOA 1CFMA 4IURA 3RD4A 5GAGC 4H44C 4JG2A 1I3QB 1VQHA 1IW7C 4A75A 1JJCB 3RN5A 1V1OA 3Q0AA 1X3QA 4HJ8A 3HOWH 1FD7D 3JAMi 4B3RQ 4IUTA 1HNWL 2XRQD 5HGTA 3KBGA 5J39A 5ELOA 1EUJA 2KQ3A 3K80C 5T1IA 1ET6A 1EYCA 3K7AH 3DWAA 3U9OA 3TZUA 3U4ZA 4LAAA 1JQYD 1JC7A 2KVMA 4GLVB 5CV5A 1E24A 2A5HA 1SNCA 1W6KA 4B3RL 2EXDA 2A6HD 1S5DD 4WFN3 2RA4A 1E0BA 4DU9A 1EYGA 5ELBA 2CW0D 2F0GA 4A76A 4DK1A 5JEAJ 5EQ0A 4BWGB 2ALYB 4GKJQ 1FYCA 1LTBD 3C3LA 4L5RC 4L8JA 3E5SA 5M3FB 1MI2A 5ELCA 3Q24A 3KLRA 3SGIA 2ES2A 4KHPQ 1DZ1A 5A2QL 3UDGA 1VQAA 4IPCA 1QB5D 2LMCB 4JPBW 4KKSA 4LUOA 2R6GA 1ICWA 1PFNA 1AZPA 4K6DA 2OXPA 3TEHB 3W1GA 2ZM6Q 1PVOA 4KHPL 5E3FA 3TREA 5C4XB 2MO0A 3R93A 3D31A 3VR6A 4WJ4A 3KDFA 2NVQH 4QMGA 1N34Q 2YU9B 3CCQA 1YHQA 4RGOS 3S2HB 1X3GA 4TKOB 2ZM6L 3IAYA 5KYLA 2M2LA 3K5OA 2JA6H 1F2MA 1TKWB 4IJLA 5CV7A 2E74C 2R7ZH 2NN6H 1XPUA 5JOBA 4YCVA 4GOPB 3WDNA 4UY8C 1DYQA 1CQVA 1EY0A 2NVXB 4BBRG 1N34L 2K1BA 1VQNA 1LTAD 5L37A 1YNXA 1D8LA 1Q1BA 1WTQA 3OWEB 4FF3A 3VA5A 1XPRA 1J5EQ 3TSSA 2GN5A 2IL8A 4DAVA 3S24A 3GTGH 1D6EC 4HN7A 4HMIA 2XN9C 4A3BB 2YYZA 2L55A 4XYQA 1WTPA 4I65A 4BBSG 2RDFA 2JA8H 5K36G 2NWGA 4R4OA 1EYDA 5A35A 1BOSA 4XXEA 1J5EL 1BVSA 4HTHA 5IP7G 4JOIC 3VYUA 1OXSC 5IP9G 4GN3B 4E6IA 1PH3A 1VS0A 3MEHA 4JV5Q 1UWVA 1RJTA 1Y1WH 3JAME 3UI2A 4IZ8A 4U68A 2UXBQ 4ZKBB 5I6YA 1SE8A 5M5YB 2VUMH 4C3IH 1ZEQX 1GD7A 4DN4M 1J8IA 2F0JA 3F1ZA 4EVOA 3NBHB 4R1JA 1YNND 5LL6S 1SYCA 4TVAB 1M4VA 4DR2Q 1K8OA 1Y1VG 3TDQA 1GO3E 1PH8A 4JV5L 4KMUC 3PCOB 2IX1A 3QG1A 1SNMA 1SMYD 3T13A 1QE6A 2MO1A 2E2JH 3LGJA 4DR4L 1VQBA 1EIHA 1SYGA 1PH5A 1EOTA 2VXWA 4DR2L 3H6MA 4J15A 4XTCS 4JI8Q 4DGZA 2O4XA 2ZXOA 4JK1C 1V43A 2B63B 1I4HA 3PSIA 2A19A 1G2SA 2WB1B 2DN8A 5EAYA 1WD0A 3KJOA 1F2YA 3AQQA 1TS2A 1VQEA 1GXDC 4KV6A 4BY1B 4GOPC 3DHQA 1E1TA 4JI8L 5C4JB 1N8RC 2ZJRA 1WTHA 1VQ9A 1I4RA 5C3EG 4K14A 1OXTA 5CMDA 1PFMA 2SOBA 1B8AA 3GV6A 2EYPA 3PO3H 3CCJA 2A8VA 3GTQB 5C4XG 4JI3Q 3CRLC 3T4AC 1M8AA 3A54A 2WB1E 5EPLA 2B2TA 2O5JC 5E4XA 3MA2B 5IGBA 3ULPA 5EKIA 1ASZA 5FLXE 2ASBA 5G3LD 2K5VA 2AUKA 3QIAA 4A3JB 1JB3A 4JI3L 1LT5D 3HKZG 4QB4A 4OWXB 3AEVA 2KENA 1IL8A 1EWCA 1CT1D 2PYKA 1B9MA 5KEEA 3M4QA 2C9OA 2RKSA 1OXXK 1Y8OB 1UE6A 5KRUA 4QIWB 1SBBB 1WYDA 2K05A 3F2CA 1ASYA 1BCPD 3HOXG 4MTKA 1VQIA 1GUSA 4FDBA 1BF4A 3TQYA 4N8X1 3J7ZC 3BJUA 2HHHQ 4HEDA 4A3BG 1LT3D 3KK7A 3MFYA 5C0XG 1AFPA 2AQ1B 2NZHA 4NDXA 5BN4A 3HOZB 3I4NB 1K83H 2WFWA 2EZVA 1XWEA 3K5LA 1LTTD 3S1MH 4QIWE 1QZHA 4ID6A 2PMZB 1S5ED 3KFUA 2Q2UA 2HHHL 4HIDA 4XQQA 3QB3A 1J9OA 5CR3A 4DAYA 2KCNA 4O42A 1R9TH 3W3AA 5J22A 5M5XB 1A3VA 4HCSA 5DEHA 1K8AC 1I4PA 3WWVA 1UEAB 2E2DC 2WKCA 4JCVE 4XIGS 3Q23A 2F4IA 1QUQB 2EY5A 1W6JA 2YTXA 3Q8DA 5KGUA 1FNWA 1NJIC 4RAUC 2MPMA 1CK1A 1MSGA 4YWLA 4DPGA 2KECA 3CQZH 3I4LA 3M4YA 1HQRD 1G91A 1T5XD 2CWPA 4KY7A 1STYA 1LTGD 1F2ZA 3BDLA 1FNUA 4V0BA 2BE5C 1NR2A 1VQ4A 4J1MA 4KJNA 1GHJA 5ELEA 3C46A 2B2YA 1WTXA 4KHZA 4OO1G 3K5NA 1TS3A 3I4MH 1VDZA 2ZTCA 4A3LH 2ATWA 3LWUA 4PMWA 2HIVA 3DWPA 3BZDB 3DEOA 3HKSA 4G7OC 4EQPA 1HR0W 2F0MA 2K7VA 3T1YQ 3HOYB 3IFTA 1A2TA 1YJNA 4C3HB 3RLOA 3RN2A 3GQBA 2B2WC 1A62A 2RQXA 2HDLA 5C0XI 1U5KA 2G9HD 1XMQQ 4G7HC 4FF2A 4IALA 3CW2C 1SR3A 5IYBH 2F1MA 1OXVA 4A3EG 4DV7Q 2UXCQ 4ZQ3A 5BR8Q 2CKZB 1JE5A 1MSHA 2NN6I 3J7AV 1EY9A 1EY8A 1I50B 1R4QB 2PNHA 2D2CC 5IWAQ 4X3TA 5BN3A 1XMQL 1IBLQ 4A3KG 1YNJD 4A3JG 4O1NA 4LFAL 3EN2A 3S17B 4CKBA 1K0RA 2MJ8A 4DV7L 3PQIA 4A3FB 5IYCH 1KAWA 4PQXA 3SVMA 1DGSA 4CJ0B 4X66Q 1Q90A 5BR8L 2E2IB 2A68D 4GKKQ 1HZAA 4R4CA 1Q8KA 4IPHA 1XNRQ 2VQEQ 5IWAL 3RZOB 3F2UA 1IBLL 3MVVA 3N52A 2K03A 2YTVA 1DOKA 5G3LF 1F9RA 1P8LA 3S14B 5C0XJ 4BXXH 2MNAA 2BDNA 2QEJC 4X66L 3CD6A 2SEBD 1FVIA 1TWGH 4GKKL 2N3SA 2BCOA 1KDCA 4LF6Q 3PUZA 1XNRL 2VB2X 2VQEL 5DM73 3OPOA 2Z6BA 3SXHA 1SNDA 4CKCA 4DF7A 2CH4A 3M4OB 4Z9CB 2FXQA 1B3QA 4LMQD 4ULLA 1PHJA 3A74A 4A3MB 4DAPA 3AMUA 1RF2D 2N8NA 3BVZA 4LF6L 3KOJA 4K8JA 1NY4A 5LHY1 1K3BC 4DV4Q 1RCVD 1TWAB 1IBKQ 1BR9A 3GDEA 3OMGA 3K6OA 4DV2Q 1WCMB 4JI0Q 4HSVA 5FO9B 1B2TA 3NP8A 2EYJA 3UE1A 2R92G 4KD4A 3KDFB 3CCMA 2QA4A 1AE3A 3ER0A 2EVBA 4DV4L 5IGFA 1D7QA 4QUCA 1I4XA 2DNEA 4PV1C 1WTWA 1BO0A 1IBKL 1PFSA 4YWMA 4A93G 2P5ZX 3S9WA 5EPKA 4DV2L 3KLSA 4JI0L 5IOCA 1UE5A 1B7YB 1BBUA 3RZDB 3HOUH 1VQDA 1HZCA 1VF7A 2KCTA 1SDFA 3BZCA 2HD3A 3CRKC 1CA6A 1YHAA 2AMCB 2JE6I 4K5WA 2NZOA 4MN3A 2V4DA 1PV4A 4P73A 2JJQA 3W1BA 3EIVA 1X3FA 3ND8A 2NVTH 2JEBI 3BDOA 1ENFA 3LWEA 4DV3Q 1AN8A 3CCRA 2CW0C 3WOEA 4RCOA 1BQQT 1CUKA 3VR5A 1WD1A 2N49A 3NHHA 4L63B 1HFGA 4RHSA 1HUMA 1YJWA 3SEBA 1QZGA 1XX8A 1EY7A 2EQSA 1HR0Q 1TWCH 4DV3L 1IKMA 1JWSD 3J80c 1VQ7A 3URYA 1KABA 2F52A 3CF5A 4ILWA 4C3JG 4FF1A 3TP7A 2L4NA 2R3ZA 2Z4IA 1HNZL 2BH8A 4RCNA 1HTPA 3R8BA 3M3YH 4LNQA 4C56C 4A3DG 1H9JA 3MXPA 1HR0L 2PZTA 2R93H 2FJ2A 4CBVA 2WV6D 5GROA 1JICA 4O2DA 2GVAA 1S5BD 2OEOA 2CH4W 4I7ZC 1KHIA 1TWHB 1IL2A 4BY7G 4GNXA 1S4ZA 3S1RB 4FO2A 3J81L 5IYDH 3NTIA 2SDFA 4HJ9A 5LMUL 4BBRB 4DK6C 3DLLA 2ICIA 3HP3A 4K5VA 2R7DA 3W2DA 2IJ0A 1SAPA 3I72A 1ONLA 1Z6HA 3R2IA 2Q2TA 4RFBA 1UUPA 5F2DA 4A3MG 2J0TD 3CC2A 3VR4A 1L1OA 4WJWA 1I3QH 1QVFA 1LM0A 3BDCA 2XIWA 4MTNA 5IT9c 2VNUD 4B3ML 5IGEA 1CKMA 1W2BA 3PUVA 2B39A 5DNFA 4BBSB 4P2CB 1UAPA 3BVGA 3C1EA 2NTSA 3U9SA 1X9NA 2WINB 4IFDH 4HMJA 3QR8A 3CCEA 4BS9A 4CHTB 1LTSD 1CKNA 3STBD 4Y7NH 4PMCA 4K2KA 1N36L 4LK1C 3QWNA 1HZBA 3A7LA 4HCEA 4H7BA 2BA0A 1I6HH 1RKNA 5C44G 5C5LA 3HFZB 2F0WA 3ONAB 1T5EA 1Y1VB 4RG1A 3PMFA 5FLMH 1I6VC 3A0JA 1M90C 4WORA 4X65Q 4OWWB 2ZXPA 4P71A 1E2ZA 1SE3A 1Z9FA 5M3FH 4DV0Q 5JJKA 2X69A 2I07B 5FJ8H 5IE8A 4ODGA 4DV6Q 1ILQA 1NTGA 4FYDA 2R7FA 5CC4A 1Y8NB 2QEXA 4YCWA 1SMYC 1K9MC 1UEBA 3OSOA 1V1QA 3FKIH 2L0CA 4X65L 1E2VA 3RLFA 4LF5Q 3A56A 4DV0L 3TRZA 5H1SE 1CM9A 2EYLA 1H9RA 3RNUA 3PGZA 4DV6L 5KNBA 4TSSA 3K57A 1KQSA 3H0GG 3HOVG 2JK8A 1X3EA 2L15A 1CTMA 4GKJL 2N55A 2Q2IA 3HZXA 5ELNA 3UE0A 3J7YW 1WTVA 1SFOB 5C3EB 2KEEA 3NE5B 3FHWA 2OCEA 5GQOA 1YIJA 2K6AA 2YU9H 4LF5L 4IUPA 4GS3A 4H13C 1PH4A 3S2HH 3EFXD 4F87A 1B4OA 2RCFA 2EDGA 1N33Q 2NVYH 1JORA 2ICEC 2EJFC 2OQ0A 1EEFD 3VYSA 4A3GH 3ERQA 5J1ZA 3EQLC 4I7AA 4FXDA 4L5TA 2OWOA 1EZ6A 2NVXH 1B3AA 1TR5A 3GTLB 2X6LA 1ESFA 1XXGA 3A5UA 4P75A 1KLUD 2EY1A 1SLJA 1EY4A 2OF1A 2B2TC 3HKZB 1HUNA 1KD1C 3T1HQ 3KLWA 3WOFA 5HGQA 2WIIB 4QY7A 1PRTF 5D3DA 4DNIA 1G51A 3HOXB 4FXKC 4UDUC 1KXLA 2F03A 3RUZA 2H5XA 4HIMA 2A69D 4X3SA 1BCPC 2NUCA 1H95A 1K8MA 3T1HL 1VQLA 2K28A 3G7LA 1TS5A 4H02A 2OTJA 3HKZE 3K5MA 2F4VQ 1DOMA 4RKBA 2NVQB 4CKEA 4YY3Q 5A2QE 5ELDA 5JJLA 1I4QA 2XWJB 3JC66 3NUCA 1BBWA 1SYBA 4A3IH 1EQVA 3DWQA 5CGKA 2JQOA 1BDOA 3MXGA 1HA5A 1KIXA 4JI6Q 5EGTA 5JVH3 4QJFA 3GTJB 2HQLA 1NR4A 1EQQA 2E5LQ 2F4VL 2PZWA 5JPMC 1LT6D 5I6WA 2EXZA 4NP5A 4NB3A 4LF4Q 2D62A 3T56B 1HJPA 1IW7D 4RKLA 3PV0A 4IUVA 1EIYB 3TBIB 3CC7A 5CBEE 1KNAA 3K0XA 4JI6L 2C35B 4OX9Q 1FJGQ 2F0LA 1PH7A 2B63H 2E5LL 2UXBL 1GJXA 1OTCA 1NMFA 1Q46A 4ZKCB 2LS01 2HUGA 4LF4L 4XDXA 3GTKH 4OGQC 4HJAA 4BY1H 3SE0A 1PA6A 4LF8Q 2QCPX 3I3CA 3M4PA 3PO2G 2I5MX 2KA7A
chains in the Genus database with same CATH topology
1QILA 1JWMD 3TMEA 4QF4A 1RD9D 1H9SA 2MGSA 2PPBC 3S1NB 1PTOH 1A3TA 2DY7A 4WRDA 1U4MA 3FPPA 2B2YC 2AWNA 2BA1A 3GP7A 1O7ZA 2QDBA 3LX0A 2C5CA 1OXUA 1QCBD 3PUXA 3S1QB 4IUUA 5IGDA 4ABNA 3K59A 3Q22A 2E2JB 2EY6A 1EIGA 1JWUD 3P7JA 4A3EB 3NQTA 3SR1A 4KD3A 5C4HA 1B9NA 3KUPA 1TIID 1D5MC 2Q8IB 1Q1EA 4A3KB 3QJYA 3EA6A 1SNPA 4ZK9B 2J4XA 4RGNA 2NBFA 2F0DA 2K32A 2F0PA 4HR7B 1GUTA 3C1FA 3FRPB 2EYFA 5FKAC 2HCCA 1U9RA 2QILA 3H3VC 4KTAA 1STAA 2B2UA 1A3UA 3J80L 4IFDI 1SXTA 2MHVA 1GHKA 4K5XA 3I91A 3MXUA 2TMPA 1ET9A 4NMZA 2WKDA 2O2LD 2CHBD 3T53B 2RVLA 1B53A 3CU7A 3R3OA 2NN6G 2M00A 3I8ZA 4TRDA 4B08A 2BOSA 3V2TA 4DNTB 2PCFB 3TN2A 1HTLD 3D4DA 3V05A 1EWHA 4KY5A 4KI0A 1WVLA 2KCCA 2PNRC 1DCZA 1PRTB 2R92B 5EPJA 1NUCA 3M7GA 3P1HA 2G9DA 2KUMA 1TWFB 4A93B 5IT9L 1EU4A 1HRJA 3OIQA 4FVMA 4R8IA 4RH6A 2XVSA 4C3IG 5JEAH 2F3VA 3FMCA 2CQAA 1MGSA 5I4DA 1I4GA 2AQ3B 3FDTA 3X3MA 1SYEA 3FPUB 4IQZA 5BN5A 1V8QA 1SJED 5T1GA 4R9WA 3SDZA 3DUZA 4IN3A 4EQNA 5LL6X 2Q8RE 1STGA 1MD2D 4Q5VA 3GO5A 4J6HA 3I4MB 3KLSX 3Q6SA 3RMHA 4C3JB 1SNQA 2IPKD 5D65A 4A3DB 1SE4A 3S15B 1JR0D 3NBHA 4OIKA 1B1ZA 3OIPA 1PRTC 4KY6A 4BY7B 3OW7A 3I70A 4BA2I 2SNMA 3A8IE 1BCPF 3NWSA 3P20A 4C1NI 3KBXA 1PLFA 4IUQA 1ILPA 5CBAE 1EL0A 1KDBA 1D5ZC 5KYIA 5AFWA 5C4ZA 1O80A 4S3SA 3EVQA 2PW7A 1DD2A 1TQOA 1ENAA 1IYUA 3L9AX 4OHJA 3S16B 3QOLA 1TWGB 3VR3A 3NPPA 4PMBA 1HQMC 3H94A 1EEID 1L0YB 1ML0D 3NTKA 2XSCA 1PTOD 4PNYA 1CI3M 3VYTA 5C44B 1XYIA 1IKLA 4XT1B 2BE5D 3GTPB 4KKUA 4X3KA 2JXMB 4DNRB 4ZRZA 2PO4A 2A6HC 2KOLA 2B2WA 5M5WB 1Q12A 1TVXA 3J7AF 2ZT9C 3V96A 1NSNS 1TU2B 1LTID 4XQNA 1G2TA 3H0GB 3HOVB 5EBDA 2D5DA 1QNUA 2I46A 4J8QA 4RA8A 5C3XA 2Z4HA 1SE2A 2RDGA 2LFNA 2EY2A 1QJOA 2K33A 1F9PA 3VYRA 2SNSA 3HG9A 5FK9C 4TQUS 2E2HB 2Z8LA 2JP1A 1SYDA 1F77A 2A74C 1Y8PB 4RWSC 2MP1A 1GUGA 2EE1A 5DAUA 3S2DB 5K5PA 4G4KA 2F0EA 5FO8B 3D8GA 4ME5A 3OOCA 1H9SB 2RBMA 5IGCA 5K36H 5I9PA 3TP8A 2M9VA 1EFID 4JBWA 4N9PA 1CHQD 5C6AA 1D1KA 5IIFA 3BS1A 4DFAA 3SK8A 3I73A 1G6ZA 3NBIA 4ZLTF 4OL7A 3HEJA 1A6XA 1D1IA 4QUFA 1JOKA 4RGMA 3G6JB 3N6RA 3BG3A 3GV3A 2F0OA 2E75C 2FINB 2EPBA 1HCZA 4CJ1B 3MXNA 1RDPD 2PW5A 3GTMB 1ZXTA 3HGBA 4NW2A 1EY5A 1EU3A 1PZID 2WACA 1BCPB 1JOOA 1RODA 1STHA 3NTHA 1YNNC 1ZYRD 2OT2A 1PTOF 4DXGA 2B8GA 1QOHA 3J81E 3PO2B 3H91A 1PDQA 1ESRA 2H4OA 2WAQB 2A6ED 4Y7NB 3HOWB 1VCIA 2LKVA 1XTCD 3MHBA 4NKLA 2K5QA 4EGVA 3OHXC 4UAIA 1F9QA 4MHEA 1I6HB 3K7AB 5EKLA 4DK0A 3A8JE 1LO5D 5CORA 4CJ2C 1JE4A 1OO9B 3DXJC 1X32A 1BXTA 1AEXA 4CGYB 2F0SA 2K5WA 3P75A 2BDOA 3TP6A 3FKIB 5CYUA 4K2LA 3JAML 1KDAA 1U4RA 4KN4C 4HAEA 2IT1A 1GUNA 1V1PA 5C0XH 3IL8A 1RTNA 2JEAI 2WP8J 3MAQA 1DJRD 2HCIA 3NSWA 5IODA 3CHBD 4RGTA 2NVYB 1C8CA 4XQJA 5I2YA 3EJIA 1G8ZD 4DXFA 2B2VA 4A3GB 1SNOA 3AU7A 3OMCA 2DNCA 1L0XB 1PFBA 3NQIA 2L12A 1TY0A 1KAAA 2B2UC 2EYHA 2D9UA 1RHPA 2IX0A 3MFGA 2JA6B 2NB0A 2R7ZB 2PZUA 4H0LC 3OWFA 1B50A 2N88A 1U4LA 1NAPA 2AUJD 3K58A 2QF7A 3I90A 1II3A 1QWYA 1DM0B 3GTGB 4OO1H 2FHTA 4L6TB 2X6GA 2IW3A 1FR3A 1HPCA 1C48A 3E6ZX 2JA8B 5FLXL 2FMCA 4IFDG 1R4PB 1DOLA 4A3IB 1PYWD 4YIJA 1BBXC 1Y1WB 4KHVA 2VUMB 4C3IB 3VA7A 1HXYD 5CV6A 3D4WA 4RHRA 5D3IB 2ID0A 3L3OC 5ISRA 5I9OA 2H1EA 2L9HA 2IWHA 3SHLA 3GTKB 1IYVA 1AZQA 1JCKB 1BNZA 1HFNA 2ZXRA 1FNVA 3E0JA 1PZKD 3D6WA 5E4WC 2E76C 1D2BA 5EKKA 1PTOB 5C3WA 4QCLA 2F0IA 1YNJC 5C5MA 1VF5C 2L11A 2GA4B 1EZ8A 2Z1CA 1STBA 2A68C 3T16A 3TP5A 3PO3B 2HQEA 1G291 5M3MB 3NWTA 1B44D 1H9KA 3R2TA 5IGGA 2EYOA 1CZGA 1CA5A 4G7ZC 1AW7A 2KEDA 2F0VA 1UNSA 2L5TA 1TS4A 2EJMA 2Y0SB 1O7YA 2NYZD 3D6CA 2B8FA 1GOZA 1ENCA 3PUYA 4X3UA 5HURA 2XRSD 1C4QA 1WTRA 5D14A 4B9WA 3O13A 5E1FA 1GUWA 2K5DA 5EJWA 1O78A 4IFDJ 4ZAIA 1K83B 2CVRA 2F0HA 3S1MB 1F9SA 2F0QA 4EQOA 1VMCA 2F0FA 3IFDA 3MWYW 3DM1A 3GD7A 1HA6A 1LABA 2HDMA 1PTOC 1R9TB 2EJGC 1SSOA 2Q8TA 3J80E 4MIUA 1HHVA 1BUVT 1FGBD 2R61A 1PMRA 4ZUJA 2QKIC 5M9OA 3GTOB 5JJZA 2AQ2B 2XNAC 3AB9A 3CQZB 5TSSA 4ZUIA 4BA1I 2FFKB 4V190 1X3PA 2F0TA 3HRZC 3HS0C 5COYA 4F88A 2K01A 4N9TA 2LY7A 1A2UA 1STNA 4KKTA 4Q0FA 1DONA 1MBYA 2AWOA 5CV9A 4C1NK 3C2PA 3PIP3 3M85A 2MUYA 3H09A 4XT3B 1NCVA 2IX3A 2EOTA 1KTKA 5IT9E 3T51B 3LNNA 1QNKA 2JA5B 1GUOA 2KJXA 3D4RA 3VR2A 1Z47A 1Q8IA 2PQEA 3ITPA 4DA2A 1LT4D 4LJZC 2K04A 5CV4A 4F8MA 2DY8A 3X3NA 2F0KA 3SK5A 1SEBD 5JPNC 3PUWA 4OO1I 1AP0A 3FVQA 4M1UB 2VB3X 2JA7B 4ZYSA 5FOBB 4KK7A 4FNFA 4GZYC 2J7ZA 1QG7A 4M8AA 3SK6A 1KNEA 1CHPD 2JSOA 1Z7TA 4F7XA 4AYBB 1JOQA 1IHZA 1S5FD 2EYMA 2NZ1D 3D3RA 1V1PB 5I2XA 2ENBA 1RTOA 4B9XA 4G57A 1Q3LA 4IUNA 2F0UA 4K6LA 1Y69U 5KNDA 3DEPA 1ZYRC 1EQTA 3SK4A 4XYOA 4U673 3A55A 1H9MA 3BYYB 5ELFA 3ND9A 2A73B 3NXWA 1S5CD 1STEA 4C3HG 2RDHA 2A6EC 1LACA 1U4PA 3HOUB 3EROA 2NTTA 3IKJA 5EBCA 5JVG3 1DXMA 3MTSA 4KJOA 2L1BA 5JEAG 2RSOA 5JAVA 2F0NA 4FXGC 3A7AB 1SJHD 1LLRD 4FF4A 2XWBB 1CZWA 3PIO3 3MC0B 2NVTB 3A8KE 3BYTB 1F2LA 1PZJD 3ZYYX 2TSSA 4C2MB 3MZ5A 5CV8A 3NK9A 1LTRD 1VMPA 5DM63 2KHSA 1E2WA 1PRTD 1TWCB 3CKIB 3QOJA 3BVMA 5FO7B 5KNCA 1SYFA 1LV9A 5KIXA 2F3WA 4KN7C 1KLGD 4R8NA 3M3YB 2A69C 3KF8A 3K0YA 2R93B 1EYAA 4FP5D 1O7LA 3L7ZC 1ZKOA 1D5XC 4HSPA 1PXUA 1EY6A 4OIJA 3FEWX 2B2VC 2O5IC 3DMUA 3QO2A 3TZDA 1A15A 1CQFA 2FMMA 3M7NA 1WTOA 4K8IA 2RSNA 1TY2A 5NUCA 1TT2A 2JYOA 1CFMA 4IURA 3RD4A 4H44C 1I3QB 1IW7C 1V1OA 3Q0AA 1X3QA 1FD7D 4IUTA 2XRQD 5HGTA 3KBGA 5J39A 2KQ3A 5T1IA 1ET6A 1EYCA 3DWAA 3U9OA 3TZUA 4LAAA 1JQYD 1JC7A 2KVMA 5CV5A 2A5HA 1SNCA 1W6KA 2A6HD 1S5DD 4WFN3 2RA4A 1E0BA 4DU9A 5ELBA 2CW0D 2F0GA 4DK1A 5JEAJ 5EQ0A 4BWGB 1FYCA 1LTBD 3C3LA 4L8JA 3E5SA 5M3FB 1MI2A 5ELCA 3Q24A 3KLRA 1DZ1A 5A2QL 1QB5D 2LMCB 4KKSA 2R6GA 1ICWA 1PFNA 1AZPA 4K6DA 2OXPA 5E3FA 5C4XB 3R93A 3D31A 3VR6A 4QMGA 2YU9B 4RGOS 3S2HB 4TKOB 3IAYA 5KYLA 2M2LA 3K5OA 1F2MA 1TKWB 5CV7A 2E74C 2NN6H 5JOBA 3WDNA 1DYQA 1CQVA 1EY0A 2NVXB 2K1BA 1LTAD 1Q1BA 1WTQA 3OWEB 4FF3A 3VA5A 3TSSA 2IL8A 4DAVA 1D6EC 4HN7A 4HMIA 2XN9C 4A3BB 2YYZA 2L55A 4XYQA 1WTPA 4I65A 2RDFA 5K36G 2NWGA 1EYDA 5A35A 1BOSA 4XXEA 4HTHA 3VYUA 1OXSC 4E6IA 3MEHA 1RJTA 3JAME 3UI2A 4IZ8A 4U68A 4ZKBB 5I6YA 5M5YB 1ZEQX 4DN4M 1J8IA 2F0JA 4EVOA 1YNND 5LL6S 1SYCA 1K8OA 1M4VA 3TDQA 4KMUC 2IX1A 3QG1A 1SNMA 1SMYD 3T13A 1QE6A 1EIHA 1SYGA 1EOTA 2VXWA 3H6MA 4XTCS 4DGZA 4JK1C 2O4XA 2ZXOA 1V43A 2B63B 1I4HA 1G2SA 2WB1B 2DN8A 1WD0A 1F2YA 1TS2A 4BY1B 1GXDC 4KV6A 3DHQA 5C4JB 1I4RA 4K14A 1OXTA 5CMDA 1PFMA 2SOBA 3GV6A 2EYPA 3GTQB 3CRLC 3T4AC 1M8AA 3A54A 5EPLA 2B2TA 2O5JC 5E4XA 3MA2B 5IGBA 5EKIA 5FLXE 5G3LD 2AUKA 3QIAA 4A3JB 1JB3A 1LT5D 4QB4A 1IL8A 1EWCA 1CT1D 5KEEA 1B9MA 2PYKA 2C9OA 2RKSA 1OXXK 1Y8OB 5KRUA 4QIWB 1SBBB 2K05A 1BCPD 1GUSA 1BF4A 4HEDA 1LT3D 3KK7A 3MFYA 5C0XG 1AFPA 2AQ1B 4NDXA 5BN4A 3HOZB 3I4NB 2EZVA 1XWEA 3K5LA 1LTTD 4ID6A 2PMZB 1S5ED 4XQQA 3QB3A 1J9OA 5CR3A 4DAYA 2KCNA 4O42A 3W3AA 5J22A 5M5XB 1A3VA 4HCSA 5DEHA 1I4PA 1UEAB 2E2DC 2WKCA 4XIGS 3Q23A 2F4IA 5KGUA 1W6JA 2EY5A 1FNWA 4RAUC 2MPMA 1CK1A 1MSGA 2KECA 3I4LA 3M4YA 1HQRD 1G91A 1T5XD 4KY7A 1STYA 1LTGD 1F2ZA 3BDLA 1FNUA 4V0BA 1NR2A 2BE5C 4J1MA 4KJNA 1GHJA 5ELEA 3C46A 2B2YA 1WTXA 4KHZA 4OO1G 3K5NA 1TS3A 1VDZA 3LWUA 4PMWA 3DWPA 3BZDB 3DEOA 4G7OC 4EQPA 2F0MA 2K7VA 3HOYB 3IFTA 1A2TA 4C3HB 3GQBA 2B2WC 2RQXA 5C0XI 2HDLA 2G9HD 4G7HC 4FF2A 4IALA 2F1MA 1OXVA 4ZQ3A 1MSHA 2NN6I 3J7AV 1EY9A 1EY8A 1I50B 1R4QB 2D2CC 4X3TA 5BN3A 1YNJD 4O1NA 3S17B 4CKBA 2MJ8A 4A3FB 4PQXA 3SVMA 4CJ0B 1Q90A 2E2IB 2A68D 3RZOB 3F2UA 3MVVA 3N52A 2K03A 1DOKA 5G3LF 1F9RA 3S14B 5C0XJ 2BDNA 2QEJC 2SEBD 2BCOA 1KDCA 3PUZA 2VB2X 5DM73 3OPOA 3SXHA 1SNDA 4CKCA 4DF7A 3M4OB 4Z9CB 4LMQD 4ULLA 4A3MB 4DAPA 3AMUA 1RF2D 3BVZA 4K8JA 5LHY1 1RCVD 1TWAB 1BR9A 3OMGA 3K6OA 1WCMB 4HSVA 5FO9B 1B2TA 3NP8A 2EYJA 4KD4A 2EVBA 5IGFA 4QUCA 1I4XA 2DNEA 4PV1C 1WTWA 1BO0A 3S9WA 5EPKA 3KLSA 5IOCA 3RZDB 1VF7A 1SDFA 3CRKC 1CA6A 2JE6I 4K5WA 4MN3A 2V4DA 3ND8A 2JEBI 3BDOA 1ENFA 3LWEA 1AN8A 2CW0C 3WOEA 4RCOA 1BQQT 3VR5A 1WD1A 3NHHA 4L63B 1HFGA 4RHSA 1HUMA 3SEBA 1XX8A 1EY7A 1IKMA 1JWSD 3URYA 1KABA 4ILWA 4C3JG 4FF1A 3TP7A 2L4NA 2R3ZA 2Z4IA 4RCNA 1HTPA 3R8BA 4C56C 1H9JA 3MXPA 2PZTA 2FJ2A 4CBVA 2WV6D 1JICA 1S5BD 2OEOA 4I7ZC 1TWHB 1S4ZA 3S1RB 4FO2A 3J81L 3NTIA 2SDFA 4BBRB 2ICIA 3HP3A 4K5VA 3W2DA 2IJ0A 1SAPA 3I72A 1ONLA 1Z6HA 3R2IA 4RFBA 1UUPA 5F2DA 2J0TD 3VR4A 4WJWA 3BDCA 2XIWA 2VNUD 5IGEA 3PUVA 2B39A 5DNFA 4BBSB 4P2CB 1UAPA 3BVGA 3C1EA 2NTSA 3U9SA 2WINB 4IFDH 4HMJA 4BS9A 4CHTB 1LTSD 4PMCA 4K2KA 4LK1C 3QWNA 4HCEA 3A7LA 4H7BA 2BA0A 1RKNA 5C5LA 2F0WA 3ONAB 1T5EA 1Y1VB 3PMFA 1I6VC 4WORA 2ZXPA 1E2ZA 1SE3A 2X69A 2I07B 4ODGA 1ILQA 4FYDA 5CC4A 1Y8NB 1SMYC 3OSOA 2L0CA 1E2VA 3RLFA 3A56A 1CM9A 2EYLA 1H9RA 5KNBA 4TSSA 3K57A 1CTMA 2N55A 1WTVA 3HZXA 3J7YW 1SFOB 5C3EB 2KEEA 3NE5B 2K6AA 4IUPA 4H13C 3EFXD 4F87A 1B4OA 2EDGA 1JORA 2ICEC 2EJFC 1EEFD 3VYSA 3ERQA 5J1ZA 3EQLC 4FXDA 1EZ6A 1B3AA 1TR5A 3GTLB 2X6LA 1ESFA 1XXGA 1KLUD 2EY1A 1EY4A 2OF1A 2B2TC 3HKZB 1HUNA 3WOFA 2WIIB 1PRTF 5D3DA 3HOXB 4FXKC 4UDUC 2F03A 3RUZA 2A69D 4X3SA 1BCPC 2NUCA 1K8MA 2K28A 3G7LA 1TS5A 3K5MA 1DOMA 4RKBA 2NVQB 4CKEA 5A2QE 5ELDA 1I4QA 2XWJB 3NUCA 1SYBA 1EQVA 3DWQA 5CGKA 1BDOA 3MXGA 1HA5A 5EGTA 5JVH3 3GTJB 1NR4A 2PZWA 5JPMC 1LT6D 5I6WA 2EXZA 4NP5A 2D62A 3T56B 1IW7D 4RKLA 3PV0A 4IUVA 3TBIB 5CBEE 1KNAA 2F0LA 1GJXA 4ZKCB 2LS01 2HUGA 4XDXA 4OGQC 3SE0A 2QCPX 3I3CA 2KA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BS1 A;  4XXE A;  4XQQ A;  4XYO A;  4CBV A;  4XQJ A;  4XQN A;  4G4K A;  4XYQ A; 
#chains in the Genus database with same CATH topology
 1QIL A;  1JWM D;  4DUY Q;  3TME A;  1WI5 A;  4QF4 A;  4OX9 L;  4GN5 A;  1RD9 D;  3CPW A;  1PH1 A;  1H9S A;  2MGS A;  4DR5 Q;  2PPB C;  2WAQ G;  3S1N B;  1PTO H;  1A3T A;  2DY7 A;  3HOW G;  1Q82 C;  3GTQ H;  4WRD A;  1RL2 A;  1K0S A;  1A63 A;  4LF8 L;  1SRO A;  1Q86 C;  3J80 i;  1YEZ A;  1U4M A;  3FPP A;  1V9P A;  2B2Y C;  2AWN A;  4DUY L;  2BA1 A;  1IYJ B;  3GP7 A;  1O7Z A;  1VQ6 A;  4DR5 L;  2QDB A;  3LX0 A;  2C5C A;  1OXU A;  1QCB D;  3PUX A;  3S1Q B;  4IUU A;  5IGD A;  4ABN A;  3D0F A;  1JJG A;  2KHI A;  3K59 A;  3J81 c;  3Q22 A;  2E2J B;  2EY6 A;  1EIG A;  1K28 A;  1JWU D;  3P7J A;  5M3M H;  4A3E B;  2PI2 E;  1GVP A;  3J7A 5;  3NQT A;  3U50 C;  3NEL A;  4KD3 A;  2ZTD A;  3SR1 A;  1B9N A;  5C4H A;  3KUP A;  2PQA A;  1TII D;  1D5M C;  3E9H A;  2Q8I B;  1VQM A;  1Q1E A;  4A3K B;  1PYB A;  1O7I A;  3QJY A;  3EA6 A;  1SNP A;  4ZK9 B;  2J4X A;  4RGN A;  2QW7 A;  2NBF A;  2F0D A;  2K32 A;  1K73 C;  2F0P A;  4HR7 B;  1GUT A;  3C1F A;  3FRP B;  2EYF A;  3HOZ H;  3I4N H;  5FKA C;  4P74 A;  2HCC A;  2VZA A;  1U9R A;  2QIL A;  3H3V C;  4KTA A;  1STA A;  2B2U A;  1A3U A;  3J80 L;  4IFD I;  1EOV A;  1W3S A;  3ULL A;  1SXT A;  2MHV A;  1GHK A;  2K75 A;  2I0Q A;  4K5X A;  5M5X H;  2ZJP A;  4KLK A;  3I91 A;  3MXU A;  2TMP A;  1ET9 A;  3B6Y A;  4NMZ A;  3OYY A;  2WKD A;  2O2L D;  3U4V A;  3I4O A;  2CHB D;  3T53 B;  3G71 A;  2JA6 G;  2RVL A;  3KYH C;  2E8G A;  1B53 A;  3CU7 A;  4X62 Q;  2R7Z G;  3R3O A;  2NN6 G;  2M00 A;  3I8Z A;  2RHQ B;  4TRD A;  4B08 A;  2BOS A;  3V2T A;  4DNT B;  2PCF B;  3TN2 A;  2VQF Q;  1HTL D;  3D4D A;  1N9W A;  3V05 A;  1E22 A;  4JBK A;  1EWH A;  2BH2 A;  4KY5 A;  4X62 L;  4KI0 A;  4AQY Q;  1WVL A;  1S72 A;  3GTO H;  2PMZ E;  2KCC A;  3UDF A;  2PNR C;  1DCZ A;  1PRT B;  1WOC A;  2R92 B;  3L0O A;  5EPJ A;  1NUC A;  4PZ6 A;  3M7G A;  2JA8 G;  2VQF L;  3P1H A;  3OTO Q;  2G9D A;  4JI4 Q;  2KUM A;  3HOY H;  2CFM A;  1TWF B;  4A93 B;  5IT9 L;  3KF6 B;  4C3H H;  1EU4 A;  4YCU A;  4AQY L;  1WFQ A;  3OIQ A;  4FVM A;  1HRJ A;  4PZ7 A;  4GNX B;  1Y1W G;  4R8I A;  4RH6 A;  2XVS A;  3KF8 B;  2VUM G;  4C3I G;  5JEA H;  2F3V A;  3OTO L;  4JI4 L;  4LFC Q;  3FMC A;  2CQA A;  1MGS A;  5I4D A;  3G4S A;  1I4G A;  2AQ3 B;  3FDT A;  2JN4 A;  3X3M A;  1I50 H;  1L1O B;  1SYE A;  3FPU B;  4IQZ A;  3TS2 A;  2UUA Q;  1KRS A;  2XTI A;  5BN5 A;  1V8Q A;  1IXR A;  4LFC L;  2JA5 H;  4UP7 A;  4A3F H;  1SJE D;  3T1Y L;  2G5D A;  4R9W A;  5T1G A;  3SDZ A;  3DUZ A;  4QL5 A;  4IN3 A;  1Y14 B;  4EQN A;  5LL6 X;  2Q8R E;  3IRB A;  3PIP A;  2E2I H;  3L2P A;  1STG A;  1VQC A;  2IHE A;  1MD2 D;  1CSP A;  1RIP A;  1LUZ A;  2UUA L;  4A3C H;  4Q5V A;  3GO5 A;  1CKN B;  4J6H A;  3I7F A;  3I4M B;  3KLS X;  3S14 H;  1WJJ A;  1NE3 A;  3Q6S A;  4WJ3 M;  2UXC L;  3RMH A;  4C3J B;  1SNQ A;  2IPK D;  5D65 A;  3CP0 A;  3K81 C;  4PG3 A;  4A3D B;  1SE4 A;  4JI5 Q;  2JA7 H;  3M4O H;  3S15 B;  3PO3 G;  1JR0 D;  3NBH A;  4OIK A;  4DAM A;  2HIX A;  1B1Z A;  3ICE A;  3OIP A;  5M3M G;  1PRT C;  4KY6 A;  4BY7 B;  1VQJ A;  3OW7 A;  3I70 A;  4BA2 I;  2SNM A;  3A8I E;  1BCP F;  1NBW A;  3NWS A;  4JI5 L;  3CXC A;  3P20 A;  1TWA H;  4C1N I;  3KBX A;  2VW9 A;  1PLF A;  4IUQ A;  1ILP A;  1AH9 A;  2Y0S G;  2A1A A;  1WCM H;  4MNO A;  5CBA E;  1EL0 A;  1FL0 A;  1KDB A;  4GNX C;  1D5Z C;  2DGY A;  5KYI A;  5AFW A;  5C4Z A;  5FLX c;  2KHJ A;  1O80 A;  4S3S A;  3EVQ A;  2PW7 A;  1DD2 A;  1TQO A;  1KL9 A;  1ENA A;  1IYU A;  1QVC A;  3L9A X;  4OHJ A;  3RZD H;  1L1O C;  1AE2 A;  3S16 B;  3QOL A;  1TWG B;  3VR3 A;  3NPP A;  4PMB A;  1KC8 C;  1HQM C;  3H94 A;  1EEI D;  1L0Y B;  1VQF A;  1ML0 D;  3NTK A;  4JBM A;  2XSC A;  1PTO D;  4PNY A;  1CI3 M;  3VYT A;  4B3S Q;  1X54 A;  2K5N A;  2IY5 B;  5C44 B;  1XYI A;  3RR5 A;  1IKL A;  4XT1 B;  4AH6 A;  2BE5 D;  3GTP B;  2QGQ A;  4KKU A;  4X3K A;  4QGU A;  4JI1 Q;  2B29 A;  2JXM B;  2GVB A;  3CAM A;  1VQO A;  4DV1 Q;  4B3S L;  4DNR B;  1GKH A;  4ZRZ A;  2PO4 A;  2A6H C;  2KOL A;  3FP9 A;  3J81 i;  4LFB Q;  1G6P A;  3ULJ A;  3AYH B;  2B2W A;  4C2M H;  5M5W B;  1Q12 A;  1TVX A;  4JI1 L;  4HJ7 A;  4B3T Q;  3J7A F;  2ZT9 C;  3V96 A;  1NSN S;  1E3P A;  1TU2 B;  4DV1 L;  1LTI D;  4L5S A;  4XQN A;  1XMO Q;  1G2T A;  4GLA C;  3H0G B;  3HOV B;  4LFB L;  5EBD A;  3PIO A;  2D5D A;  1QNU A;  4CDF C;  3I4M G;  4A3L G;  4YWK A;  2EIF A;  2I46 A;  4J8Q A;  4RA8 A;  4EQ5 A;  1JMC A;  2CWA A;  1CSQ A;  2Z4H A;  3NEM A;  5C3X A;  1SE2 A;  1C0A A;  3PF5 A;  2UU9 Q;  2RDG A;  3BU2 A;  2LFN A;  2EY2 A;  1XMO L;  1QJO A;  3S1R H;  2K33 A;  5J3B A;  1F9P A;  3VYR A;  4K0K Q;  2SNS A;  3HG9 A;  5FK9 C;  4BBR H;  4CDD C;  4TQU S;  1YHB A;  2E2H B;  3CCS A;  2Z8L A;  2JP1 A;  3KJP A;  1SYD A;  1F77 A;  2A74 C;  1Y8P B;  5IYB G;  4RWS C;  1QUQ A;  1YBY A;  2MP1 A;  1GUG A;  2EE1 A;  2UU9 L;  5DAU A;  3S2D B;  3K8A A;  5K5P A;  4G4K A;  2F0E A;  5FO8 B;  3D8G A;  3ERS X;  4K0K L;  4ME5 A;  1N32 Q;  1PH9 A;  1ICF B;  3OOC A;  1H9S B;  2RBM A;  5IGC A;  4BBS H;  4DUZ Q;  5AJ3 Q;  5K36 H;  5I9P A;  3TP8 A;  2M9V A;  1E1O A;  5IYC G;  1EFI D;  5IP7 H;  4JBW A;  4N9P A;  5IP9 H;  1CHQ D;  4R4I A;  1D1K A;  5C6A A;  5IIF A;  4R4T A;  3BS1 A;  4DFA A;  2MFI A;  1MHW C;  3SK8 A;  1N32 L;  3I73 A;  4LUZ A;  3NBI A;  4ZLT F;  1M1K C;  4OL7 A;  1G6Z A;  3HEJ A;  1A6X A;  1D1I A;  4QUF A;  1JOK A;  2K4K A;  3E9I A;  2N78 A;  1KRT A;  4R4Q A;  4BXX G;  4RGM A;  3G6J B;  3N6R A;  1Y1V H;  3BG3 A;  3GV3 A;  1EQR A;  4GN4 B;  2F0O A;  2E75 C;  4UPA A;  2FIN B;  2EPB A;  4LW1 A;  4AYB G;  1HCZ A;  4CJ1 B;  3MXN A;  1RDP D;  2PW5 A;  3GTM B;  1ZXT A;  3HGB A;  4NW2 A;  1EY5 A;  1K8G A;  4IPG A;  1EU3 A;  1PZI D;  2WAC A;  1BCP B;  1JOO A;  1ROD A;  1NMG A;  1STH A;  3NTH A;  3BZK A;  1YNN C;  1XPO A;  4HIK A;  1ZYR D;  3I56 A;  2OT2 A;  5DLQ E;  1PTO F;  4DXG A;  1QOH A;  2B8G A;  3J81 E;  3PO2 B;  4X64 Q;  3H91 A;  1PDQ A;  1ESR A;  2H4O A;  1NNX A;  1SFO H;  5C3E H;  2AKW B;  4NXM Q;  2WAQ B;  2A6E D;  4MZ9 A;  3OW2 A;  1YZ6 A;  4Y7N B;  1VQ5 A;  1VCI A;  2LKV A;  1XTC D;  3HOW B;  3MHB A;  4NKL A;  5C4X H;  4POF A;  1T9H A;  2K5Q A;  4EGV A;  1XNQ Q;  3OHX C;  4X64 L;  4UAI A;  2KBN A;  1F9Q A;  3HOU G;  4MHE A;  4DR6 Q;  4CDE C;  1I6H B;  4DAY B;  3K7A B;  5EKL A;  4DK0 A;  3A8J E;  1LO5 D;  3GTL H;  4NXM L;  2UUB Q;  5COR A;  4CJ2 C;  1JE4 A;  2Q2H A;  1OO9 B;  4LWC A;  3DXJ C;  1X32 A;  1SRU A;  1BXT A;  1XTD A;  2WAQ E;  1AEX A;  1XNQ L;  1EWI A;  4CGY B;  4DR6 L;  1B70 B;  2F0S A;  2K5W A;  3P75 A;  5LMN Q;  2BDO A;  1EIF A;  2UUB L;  4APV A;  2UXD Q;  3TP6 A;  3FKI B;  5CYU A;  3HOX H;  2OTL A;  1BKB A;  4K2L A;  3JAM L;  1N33 L;  1KDA A;  1U4R A;  4KN4 C;  1X65 A;  4HAE A;  1JB7 A;  2IT1 A;  2VY3 A;  1GUN A;  4A3B H;  1V1P A;  5LMN L;  3J81 j;  5C0X H;  3IL8 A;  1RTN A;  2JEA I;  2UXD L;  4DKA C;  2WP8 J;  4N8F A;  3MAQ A;  1DJR D;  2HCI A;  4RMF A;  1E7Z A;  3NSW A;  4AIM A;  5IOD A;  1A0I A;  3CHB D;  2DUD A;  4RGT A;  2NVY B;  1C8C A;  4XQJ A;  3CME A;  5I2Y A;  3EJI A;  2D0P A;  1G8Z D;  4DXF A;  2B2V A;  1I94 Q;  4A3G B;  3GTJ H;  1SNO A;  3AU7 A;  1C9O A;  3OMC A;  2DNC A;  5M5Y H;  1L0X B;  1PFB A;  3NQI A;  2R93 G;  2Z6K A;  2L12 A;  1TY0 A;  3H3V H;  1KAA A;  2B2U C;  2EYH A;  2LXJ A;  1CKO A;  2D9U A;  3UDI A;  1QVG A;  1RHP A;  2IX0 A;  3TS0 A;  3MFG A;  2JA6 B;  1HH2 P;  2NB0 A;  2R7Z B;  2PZU A;  1I94 L;  4H0L C;  5IYD G;  3OWF A;  1B50 A;  4YY3 L;  1YVC A;  2N88 A;  2CCZ A;  1U4L A;  1NAP A;  2AUJ D;  3K58 A;  2QF7 A;  4QQB X;  3I90 A;  1II3 A;  2HT1 A;  1QWY A;  1DM0 B;  3GTG B;  4OO1 H;  2FHT A;  4L6T B;  2X6G A;  2IW3 A;  3S1N H;  4LF9 Q;  1FR3 A;  1HPC A;  2F3I A;  1C48 A;  1UE1 A;  3E6Z X;  4JI7 Q;  3I2Z A;  2JA8 B;  1TXY A;  2IHF A;  5FLX L;  3CCU A;  4DR4 Q;  2FMC A;  1VQ8 A;  4IFD G;  5C4J H;  1R4P B;  1DOL A;  4A3I B;  1FJG L;  1PYW D;  4YIJ A;  3AFQ A;  1BBX C;  3F2D A;  4OEL B;  3S1Q H;  4LF9 L;  2XGT A;  1Y1W B;  4IOA A;  4KHV A;  4JI7 L;  4C3I B;  2VUM B;  4CDC C;  3CC4 A;  2DJF C;  3VA7 A;  4A3E H;  2YTY A;  4JC0 A;  1HXY D;  5CV6 A;  3D4W A;  4UP9 A;  5FLM G;  4RHR A;  5D3I B;  2ID0 A;  3L3O C;  4A3K H;  5ISR A;  5I9O A;  5M3F G;  2H1E A;  4A3J H;  2L9H A;  2IWH A;  3SHL A;  1VQP A;  3GTK B;  5FJ8 G;  1IYV A;  1AZQ A;  1JCK B;  1BNZ A;  1HFN A;  2VL6 A;  2LXK A;  2ZXR A;  1FNV A;  3E0J A;  1PZK D;  3D6W A;  5E4W C;  3FKI G;  2E76 C;  4JVZ A;  1D2B A;  5EKK A;  3AFP A;  1PTO B;  4X6A H;  3MEF A;  5C3W A;  4QCL A;  4UHV A;  2F0I A;  1YNJ C;  5C5M A;  1VF5 C;  2L11 A;  2GA4 B;  4JI2 Q;  1EZ8 A;  1MJE A;  2Z1C A;  4HJ5 A;  1STB A;  2A68 C;  3T16 A;  3TP5 A;  2I5H A;  1JT8 A;  3PO3 B;  2HQE A;  1LYL A;  1G29 1;  4P72 A;  5M3M B;  3NWT A;  4A3G G;  1B44 D;  1H9K A;  3R2T A;  2LSS A;  2YV5 A;  2CQO A;  1X56 A;  5IGG A;  2EYO A;  1CZG A;  1CA5 A;  4JI2 L;  4G7Z C;  1AW7 A;  2KED A;  2F0V A;  3CPF A;  1UNS A;  2L5T A;  1TS4 A;  1K3R A;  2EJM A;  1PH6 A;  2Y0S B;  1O7Y A;  2NYZ D;  3D6C A;  4JOI A;  2B8F A;  2R92 H;  1GOZ A;  1A8V A;  1ENC A;  3PUY A;  4X3U A;  5HUR A;  2I5L X;  3VDY A;  2XRS D;  1J6Q A;  1C4Q A;  4HIO A;  1WTR A;  3M9B A;  5D14 A;  4B9W A;  1TWF H;  4A93 H;  3O13 A;  2ZTE A;  5E1F A;  1GUW A;  4POG A;  2K5D A;  5EJW A;  2Y0S E;  2D0O A;  1O78 A;  1HZ9 A;  4IFD J;  4ZAI A;  1K83 B;  2CVR A;  3A5Z B;  1FGU A;  2F0H A;  3S1M B;  1C7Y A;  3W5O A;  1F9S A;  2F0Q A;  4A3I G;  4EQO A;  1VMC A;  2F0F A;  3F2B A;  2K14 A;  2K50 A;  3IFD A;  3I55 A;  3MWY W;  3DM1 A;  3GD7 A;  1HA6 A;  1LAB A;  2HDM A;  1PTO C;  1R9T B;  1MIU A;  5HY6 A;  2EJG C;  4Y52 H;  1SSO A;  2Q8T A;  3J80 E;  2AHO B;  4MIU A;  1HHV A;  2JA9 A;  1BUV T;  1FGB D;  1JJ2 A;  2R61 A;  1PMR A;  4GOP A;  1SMX A;  4ZUJ A;  2QKI C;  3JAM c;  5M9O A;  3GTO B;  5GAH C;  5JJZ A;  4DK3 C;  2B63 G;  2AQ2 B;  2XNA C;  3AB9 A;  3CQZ B;  3PF4 A;  5TSS A;  4ZUI A;  4BA1 I;  2FFK B;  2WB1 G;  4V19 0;  3S17 H;  4YHH Q;  2Z9H A;  1X3P A;  2F0T A;  3HRZ C;  4BY1 G;  4C3J H;  3HS0 C;  4DR7 Q;  5COY A;  2RF4 A;  4IOC A;  4F88 A;  1MJC A;  4JYA Q;  3RZO H;  4A3D H;  2K01 A;  4N9T A;  2LY7 A;  1A2U A;  1STN A;  4KKT A;  4ZCK A;  4OEM B;  3S15 H;  4L5Q A;  2QDL A;  4Q0F A;  2Z0S A;  1DON A;  1MBY A;  2AWO A;  4YHH L;  5CV9 A;  4LFA Q;  3MXN B;  4C1N K;  3C2P A;  4DR7 L;  4BY7 H;  3PIP 3;  3M85 A;  2MUY A;  3H09 A;  1IZ6 A;  4IO9 A;  4XT3 B;  4JYA L;  2RHS B;  1NCV A;  3F8T A;  2EOT A;  2IX3 A;  1KTK A;  4DR1 Q;  2ZJQ A;  5GAE C;  4GLX A;  5IT9 E;  3T51 B;  3LNN A;  1QNK A;  3H3V I;  2JA5 B;  3K7U C;  2DJG C;  4A3M H;  1GUO A;  3H15 A;  2KJX A;  4IJH A;  3D4R A;  3VR2 A;  1Z47 A;  4LF7 Q;  1Q8I A;  2PQE A;  3ITP A;  4DR1 L;  4DA2 A;  1LT4 D;  4LJZ C;  2K04 A;  5GAD C;  2K52 A;  5CV4 A;  1PYS B;  2RCN A;  4IPD A;  4F8M A;  2DY8 A;  3X3N A;  2F0K A;  3SK5 A;  3CCV A;  1SEB D;  5JPN C;  3PUW A;  3U58 A;  3S16 H;  4OO1 I;  1AP0 A;  4LF7 L;  3HOZ G;  3I4N G;  2VS1 A;  4ALP A;  3FVQ A;  4M1U B;  2PI2 A;  1X55 A;  2VB3 X;  1EFW A;  2JA7 B;  4ZYS A;  1IBM Q;  2K5H A;  5FOB B;  4KK7 A;  4FNF A;  4GZY C;  2J7Z A;  4A4I A;  1QG7 A;  4M8A A;  3SK6 A;  5C44 H;  1KNE A;  1CHP D;  1XJV A;  2JSO A;  1Z7T A;  4O0A A;  4PZ8 A;  3GTP H;  4F7X A;  4AYB B;  1JOQ A;  2OQK A;  1IBM L;  2UUC Q;  1IHZ A;  2V1C C;  1I5F A;  1S5F D;  2EYM A;  3STB C;  4NXN Q;  1PH2 A;  2NZ1 D;  3DM3 A;  4DR3 Q;  3D3R A;  3RLN A;  1V1P B;  5I2X A;  3NEN A;  2ENB A;  1RTO A;  4B9X A;  5M5W H;  3UDX A;  4G57 A;  5E7N A;  1Q3L A;  2UUC L;  1GM5 A;  4IUN A;  2F0U A;  1P16 A;  4K6L A;  4AYB E;  1Y69 U;  5KND A;  4NXN L;  3DEP A;  1ZYR C;  3H0G H;  4DR3 L;  3HOV H;  5IY0 A;  1EQT A;  3SK4 A;  4XYO A;  4U67 3;  3A55 A;  1H9M A;  3BYY B;  5ELF A;  1Q7Y C;  3E0E A;  3ND9 A;  2A73 B;  5LMN W;  3NXW A;  3HOY G;  1S5C D;  1STE A;  1HNX Q;  4C3H G;  3G48 A;  3CMA A;  2RDH A;  2A6E C;  1LAC A;  1U4P A;  4OON A;  3ERO A;  3HOU B;  2NTT A;  1S40 A;  3IKJ A;  2E2H H;  5EBC A;  5JVG 3;  1L2F A;  1VQG A;  1DXM A;  3MTS A;  4KJO A;  2L1B A;  5JEA G;  4B3T L;  1TWH H;  2RSO A;  1HNX L;  5JAV A;  2F0N A;  1S3O A;  3S2D H;  4FXG C;  3A7A B;  1SJH D;  1HNZ Q;  1LLR D;  4DV5 Q;  1X6O A;  4FF4 A;  2XWB B;  1CZW A;  2KCM A;  3PIO 3;  4OXP A;  3MC0 B;  2NVT B;  2B3G A;  3A8K E;  3BYT B;  1F2L A;  1PZJ D;  3ZYY X;  2TSS A;  4C2M B;  2JA5 G;  3MZ5 A;  4A3F G;  4NPS A;  1MKH A;  5CV8 A;  3NK9 A;  1LTR D;  1VMP A;  5DM6 3;  4DV5 L;  1LTL A;  2KHS A;  1E2W A;  1U0L A;  1UE7 A;  1Q81 C;  4A3C G;  1PRT D;  1TWC B;  3CKI B;  3E3X A;  3QOJ A;  3EBE A;  5LMU Q;  3CCL A;  3BVM A;  4OWT B;  5FO7 B;  5KNC A;  1SYF A;  1LV9 A;  5KIX A;  2F3W A;  3KF6 A;  2MQH A;  5JJI A;  4EX5 A;  1VQK A;  4KN7 C;  1YIT A;  4JW0 A;  1KLG D;  4R8N A;  3M3Y B;  1L0W A;  2A69 C;  1YI2 A;  2JA7 G;  3KF8 A;  4DUZ L;  5AJ3 L;  3K0Y A;  2R93 B;  1EYA A;  4B3M Q;  4FP5 D;  1O7L A;  3L7Z C;  3GTM H;  1ZKO A;  1D5X C;  4HSP A;  1PXU A;  1EY6 A;  4OIJ A;  3ZJY C;  3FEW X;  2B2V C;  2O5I C;  3DMU A;  3QO2 A;  3TZD A;  1A15 A;  1YJ9 A;  1CQF A;  2Z6K C;  2FMM A;  2PQA B;  4JBJ A;  3M7N A;  1WTO A;  4ME3 A;  4K8I A;  2RSN A;  4UP8 A;  1TY2 A;  1N36 Q;  1HNW Q;  4LUV A;  5NUC A;  1SN8 A;  1WCM G;  3G6E A;  1TT2 A;  3PO2 H;  2JYO A;  1CFM A;  4IUR A;  3RD4 A;  5GAG C;  4H44 C;  4JG2 A;  1I3Q B;  1VQH A;  1IW7 C;  4A75 A;  1JJC B;  3RN5 A;  1V1O A;  3Q0A A;  1X3Q A;  4HJ8 A;  3HOW H;  1FD7 D;  3JAM i;  4B3R Q;  4IUT A;  1HNW L;  2XRQ D;  5HGT A;  3KBG A;  5J39 A;  5ELO A;  1EUJ A;  2KQ3 A;  3K80 C;  5T1I A;  1ET6 A;  1EYC A;  3K7A H;  3DWA A;  3U9O A;  3TZU A;  3U4Z A;  4LAA A;  1JQY D;  1JC7 A;  2KVM A;  4GLV B;  5CV5 A;  1E24 A;  2A5H A;  1SNC A;  1W6K A;  4B3R L;  2EXD A;  2A6H D;  1S5D D;  4WFN 3;  2RA4 A;  1E0B A;  4DU9 A;  1EYG A;  5ELB A;  2CW0 D;  2F0G A;  4A76 A;  4DK1 A;  5JEA J;  5EQ0 A;  4BWG B;  2ALY B;  4GKJ Q;  1FYC A;  1LTB D;  3C3L A;  4L5R C;  4L8J A;  3E5S A;  5M3F B;  1MI2 A;  5ELC A;  3Q24 A;  3KLR A;  3SGI A;  2ES2 A;  4KHP Q;  1DZ1 A;  5A2Q L;  3UDG A;  1VQA A;  4IPC A;  1QB5 D;  2LMC B;  4JPB W;  4KKS A;  4LUO A;  2R6G A;  1ICW A;  1PFN A;  1AZP A;  4K6D A;  2OXP A;  3TEH B;  3W1G A;  2ZM6 Q;  1PVO A;  4KHP L;  5E3F A;  3TRE A;  5C4X B;  2MO0 A;  3R93 A;  3D31 A;  3VR6 A;  4WJ4 A;  3KDF A;  2NVQ H;  4QMG A;  1N34 Q;  2YU9 B;  3CCQ A;  1YHQ A;  4RGO S;  3S2H B;  1X3G A;  4TKO B;  2ZM6 L;  3IAY A;  5KYL A;  2M2L A;  3K5O A;  2JA6 H;  1F2M A;  1TKW B;  4IJL A;  5CV7 A;  2E74 C;  2R7Z H;  2NN6 H;  1XPU A;  5JOB A;  4YCV A;  4GOP B;  3WDN A;  4UY8 C;  1DYQ A;  1CQV A;  1EY0 A;  2NVX B;  4BBR G;  1N34 L;  2K1B A;  1VQN A;  1LTA D;  5L37 A;  1YNX A;  1D8L A;  1Q1B A;  1WTQ A;  3OWE B;  4FF3 A;  3VA5 A;  1XPR A;  1J5E Q;  3TSS A;  2GN5 A;  2IL8 A;  4DAV A;  3S24 A;  3GTG H;  1D6E C;  4HN7 A;  4HMI A;  2XN9 C;  4A3B B;  2YYZ A;  2L55 A;  4XYQ A;  1WTP A;  4I65 A;  4BBS G;  2RDF A;  2JA8 H;  5K36 G;  2NWG A;  4R4O A;  1EYD A;  5A35 A;  1BOS A;  4XXE A;  1J5E L;  1BVS A;  4HTH A;  5IP7 G;  4JOI C;  3VYU A;  1OXS C;  5IP9 G;  4GN3 B;  4E6I A;  1PH3 A;  1VS0 A;  3MEH A;  4JV5 Q;  1UWV A;  1RJT A;  1Y1W H;  3JAM E;  3UI2 A;  4IZ8 A;  4U68 A;  2UXB Q;  4ZKB B;  5I6Y A;  1SE8 A;  5M5Y B;  2VUM H;  4C3I H;  1ZEQ X;  1GD7 A;  4DN4 M;  1J8I A;  2F0J A;  3F1Z A;  4EVO A;  3NBH B;  4R1J A;  1YNN D;  5LL6 S;  1SYC A;  4TVA B;  1M4V A;  4DR2 Q;  1K8O A;  1Y1V G;  3TDQ A;  1GO3 E;  1PH8 A;  4JV5 L;  4KMU C;  3PCO B;  2IX1 A;  3QG1 A;  1SNM A;  1SMY D;  3T13 A;  1QE6 A;  2MO1 A;  2E2J H;  3LGJ A;  4DR4 L;  1VQB A;  1EIH A;  1SYG A;  1PH5 A;  1EOT A;  2VXW A;  4DR2 L;  3H6M A;  4J15 A;  4XTC S;  4JI8 Q;  4DGZ A;  2O4X A;  2ZXO A;  4JK1 C;  1V43 A;  2B63 B;  1I4H A;  3PSI A;  2A19 A;  1G2S A;  2WB1 B;  2DN8 A;  5EAY A;  1WD0 A;  3KJO A;  1F2Y A;  3AQQ A;  1TS2 A;  1VQE A;  1GXD C;  4KV6 A;  4BY1 B;  4GOP C;  3DHQ A;  1E1T A;  4JI8 L;  5C4J B;  1N8R C;  2ZJR A;  1WTH A;  1VQ9 A;  1I4R A;  5C3E G;  4K14 A;  1OXT A;  5CMD A;  1PFM A;  2SOB A;  1B8A A;  3GV6 A;  2EYP A;  3PO3 H;  3CCJ A;  2A8V A;  3GTQ B;  5C4X G;  4JI3 Q;  3CRL C;  3T4A C;  1M8A A;  3A54 A;  2WB1 E;  5EPL A;  2B2T A;  2O5J C;  5E4X A;  3MA2 B;  5IGB A;  3ULP A;  5EKI A;  1ASZ A;  5FLX E;  2ASB A;  5G3L D;  2K5V A;  2AUK A;  3QIA A;  4A3J B;  1JB3 A;  4JI3 L;  1LT5 D;  3HKZ G;  4QB4 A;  4OWX B;  3AEV A;  2KEN A;  1IL8 A;  1EWC A;  1CT1 D;  2PYK A;  1B9M A;  5KEE A;  3M4Q A;  2C9O A;  2RKS A;  1OXX K;  1Y8O B;  1UE6 A;  5KRU A;  4QIW B;  1SBB B;  1WYD A;  2K05 A;  3F2C A;  1ASY A;  1BCP D;  3HOX G;  4MTK A;  1VQI A;  1GUS A;  4FDB A;  1BF4 A;  3TQY A;  4N8X 1;  3J7Z C;  3BJU A;  2HHH Q;  4HED A;  4A3B G;  1LT3 D;  3KK7 A;  3MFY A;  5C0X G;  1AFP A;  2AQ1 B;  2NZH A;  4NDX A;  5BN4 A;  3HOZ B;  3I4N B;  1K83 H;  2WFW A;  2EZV A;  1XWE A;  3K5L A;  1LTT D;  3S1M H;  4QIW E;  1QZH A;  4ID6 A;  2PMZ B;  1S5E D;  3KFU A;  2Q2U A;  2HHH L;  4HID A;  4XQQ A;  3QB3 A;  1J9O A;  5CR3 A;  4DAY A;  2KCN A;  4O42 A;  1R9T H;  3W3A A;  5J22 A;  5M5X B;  1A3V A;  4HCS A;  5DEH A;  1K8A C;  1I4P A;  3WWV A;  1UEA B;  2E2D C;  2WKC A;  4JCV E;  4XIG S;  3Q23 A;  2F4I A;  1QUQ B;  2EY5 A;  1W6J A;  2YTX A;  3Q8D A;  5KGU A;  1FNW A;  1NJI C;  4RAU C;  2MPM A;  1CK1 A;  1MSG A;  4YWL A;  4DPG A;  2KEC A;  3CQZ H;  3I4L A;  3M4Y A;  1HQR D;  1G91 A;  1T5X D;  2CWP A;  4KY7 A;  1STY A;  1LTG D;  1F2Z A;  3BDL A;  1FNU A;  4V0B A;  2BE5 C;  1NR2 A;  1VQ4 A;  4J1M A;  4KJN A;  1GHJ A;  5ELE A;  3C46 A;  2B2Y A;  1WTX A;  4KHZ A;  4OO1 G;  3K5N A;  1TS3 A;  3I4M H;  1VDZ A;  2ZTC A;  4A3L H;  2ATW A;  3LWU A;  4PMW A;  2HIV A;  3DWP A;  3BZD B;  3DEO A;  3HKS A;  4G7O C;  4EQP A;  1HR0 W;  2F0M A;  2K7V A;  3T1Y Q;  3HOY B;  3IFT A;  1A2T A;  1YJN A;  4C3H B;  3RLO A;  3RN2 A;  3GQB A;  2B2W C;  1A62 A;  2RQX A;  2HDL A;  5C0X I;  1U5K A;  2G9H D;  1XMQ Q;  4G7H C;  4FF2 A;  4IAL A;  3CW2 C;  1SR3 A;  5IYB H;  2F1M A;  1OXV A;  4A3E G;  4DV7 Q;  2UXC Q;  4ZQ3 A;  5BR8 Q;  2CKZ B;  1JE5 A;  1MSH A;  2NN6 I;  3J7A V;  1EY9 A;  1EY8 A;  1I50 B;  1R4Q B;  2PNH A;  2D2C C;  5IWA Q;  4X3T A;  5BN3 A;  1XMQ L;  1IBL Q;  4A3K G;  1YNJ D;  4A3J G;  4O1N A;  4LFA L;  3EN2 A;  3S17 B;  4CKB A;  1K0R A;  2MJ8 A;  4DV7 L;  3PQI A;  4A3F B;  5IYC H;  1KAW A;  4PQX A;  3SVM A;  1DGS A;  4CJ0 B;  4X66 Q;  1Q90 A;  5BR8 L;  2E2I B;  2A68 D;  4GKK Q;  1HZA A;  4R4C A;  1Q8K A;  4IPH A;  1XNR Q;  2VQE Q;  5IWA L;  3RZO B;  3F2U A;  1IBL L;  3MVV A;  3N52 A;  2K03 A;  2YTV A;  1DOK A;  5G3L F;  1F9R A;  1P8L A;  3S14 B;  5C0X J;  4BXX H;  2MNA A;  2BDN A;  2QEJ C;  4X66 L;  3CD6 A;  2SEB D;  1FVI A;  1TWG H;  4GKK L;  2N3S A;  2BCO A;  1KDC A;  4LF6 Q;  3PUZ A;  1XNR L;  2VB2 X;  2VQE L;  5DM7 3;  3OPO A;  2Z6B A;  3SXH A;  1SND A;  4CKC A;  4DF7 A;  2CH4 A;  3M4O B;  4Z9C B;  2FXQ A;  1B3Q A;  4LMQ D;  4ULL A;  1PHJ A;  3A74 A;  4A3M B;  4DAP A;  3AMU A;  1RF2 D;  2N8N A;  3BVZ A;  4LF6 L;  3KOJ A;  4K8J A;  1NY4 A;  5LHY 1;  1K3B C;  4DV4 Q;  1RCV D;  1TWA B;  1IBK Q;  1BR9 A;  3GDE A;  3OMG A;  3K6O A;  4DV2 Q;  1WCM B;  4JI0 Q;  4HSV A;  5FO9 B;  1B2T A;  3NP8 A;  2EYJ A;  3UE1 A;  2R92 G;  4KD4 A;  3KDF B;  3CCM A;  2QA4 A;  1AE3 A;  3ER0 A;  2EVB A;  4DV4 L;  5IGF A;  1D7Q A;  4QUC A;  1I4X A;  2DNE A;  4PV1 C;  1WTW A;  1BO0 A;  1IBK L;  1PFS A;  4YWM A;  4A93 G;  2P5Z X;  3S9W A;  5EPK A;  4DV2 L;  3KLS A;  4JI0 L;  5IOC A;  1UE5 A;  1B7Y B;  1BBU A;  3RZD B;  3HOU H;  1VQD A;  1HZC A;  1VF7 A;  2KCT A;  1SDF A;  3BZC A;  2HD3 A;  3CRK C;  1CA6 A;  1YHA A;  2AMC B;  2JE6 I;  4K5W A;  2NZO A;  4MN3 A;  2V4D A;  1PV4 A;  4P73 A;  2JJQ A;  3W1B A;  3EIV A;  1X3F A;  3ND8 A;  2NVT H;  2JEB I;  3BDO A;  1ENF A;  3LWE A;  4DV3 Q;  1AN8 A;  3CCR A;  2CW0 C;  3WOE A;  4RCO A;  1BQQ T;  1CUK A;  3VR5 A;  1WD1 A;  2N49 A;  3NHH A;  4L63 B;  1HFG A;  4RHS A;  1HUM A;  1YJW A;  3SEB A;  1QZG A;  1XX8 A;  1EY7 A;  2EQS A;  1HR0 Q;  1TWC H;  4DV3 L;  1IKM A;  1JWS D;  3J80 c;  1VQ7 A;  3URY A;  1KAB A;  2F52 A;  3CF5 A;  4ILW A;  4C3J G;  4FF1 A;  3TP7 A;  2L4N A;  2R3Z A;  2Z4I A;  1HNZ L;  2BH8 A;  4RCN A;  1HTP A;  3R8B A;  3M3Y H;  4LNQ A;  4C56 C;  4A3D G;  1H9J A;  3MXP A;  1HR0 L;  2PZT A;  2R93 H;  2FJ2 A;  4CBV A;  2WV6 D;  5GRO A;  1JIC A;  4O2D A;  2GVA A;  1S5B D;  2OEO A;  2CH4 W;  4I7Z C;  1KHI A;  1TWH B;  1IL2 A;  4BY7 G;  4GNX A;  1S4Z A;  3S1R B;  4FO2 A;  3J81 L;  5IYD H;  3NTI A;  2SDF A;  4HJ9 A;  5LMU L;  4BBR B;  4DK6 C;  3DLL A;  2ICI A;  3HP3 A;  4K5V A;  2R7D A;  3W2D A;  2IJ0 A;  1SAP A;  3I72 A;  1ONL A;  1Z6H A;  3R2I A;  2Q2T A;  4RFB A;  1UUP A;  5F2D A;  4A3M G;  2J0T D;  3CC2 A;  3VR4 A;  1L1O A;  4WJW A;  1I3Q H;  1QVF A;  1LM0 A;  3BDC A;  2XIW A;  4MTN A;  5IT9 c;  2VNU D;  4B3M L;  5IGE A;  1CKM A;  1W2B A;  3PUV A;  2B39 A;  5DNF A;  4BBS B;  4P2C B;  1UAP A;  3BVG A;  3C1E A;  2NTS A;  3U9S A;  1X9N A;  2WIN B;  4IFD H;  4HMJ A;  3QR8 A;  3CCE A;  4BS9 A;  4CHT B;  1LTS D;  1CKN A;  3STB D;  4Y7N H;  4PMC A;  4K2K A;  1N36 L;  4LK1 C;  3QWN A;  1HZB A;  3A7L A;  4HCE A;  4H7B A;  2BA0 A;  1I6H H;  1RKN A;  5C44 G;  5C5L A;  3HFZ B;  2F0W A;  3ONA B;  1T5E A;  1Y1V B;  4RG1 A;  3PMF A;  5FLM H;  1I6V C;  3A0J A;  1M90 C;  4WOR A;  4X65 Q;  4OWW B;  2ZXP A;  4P71 A;  1E2Z A;  1SE3 A;  1Z9F A;  5M3F H;  4DV0 Q;  5JJK A;  2X69 A;  2I07 B;  5FJ8 H;  5IE8 A;  4ODG A;  4DV6 Q;  1ILQ A;  1NTG A;  4FYD A;  2R7F A;  5CC4 A;  1Y8N B;  2QEX A;  4YCW A;  1SMY C;  1K9M C;  1UEB A;  3OSO A;  1V1Q A;  3FKI H;  2L0C A;  4X65 L;  1E2V A;  3RLF A;  4LF5 Q;  3A56 A;  4DV0 L;  3TRZ A;  5H1S E;  1CM9 A;  2EYL A;  1H9R A;  3RNU A;  3PGZ A;  4DV6 L;  5KNB A;  4TSS A;  3K57 A;  1KQS A;  3H0G G;  3HOV G;  2JK8 A;  1X3E A;  2L15 A;  1CTM A;  4GKJ L;  2N55 A;  2Q2I A;  3HZX A;  5ELN A;  3UE0 A;  3J7Y W;  1WTV A;  1SFO B;  5C3E B;  2KEE A;  3NE5 B;  3FHW A;  2OCE A;  5GQO A;  1YIJ A;  2K6A A;  2YU9 H;  4LF5 L;  4IUP A;  4GS3 A;  4H13 C;  1PH4 A;  3S2H H;  3EFX D;  4F87 A;  1B4O A;  2RCF A;  2EDG A;  1N33 Q;  2NVY H;  1JOR A;  2ICE C;  2EJF C;  2OQ0 A;  1EEF D;  3VYS A;  4A3G H;  3ERQ A;  5J1Z A;  3EQL C;  4I7A A;  4FXD A;  4L5T A;  2OWO A;  1EZ6 A;  2NVX H;  1B3A A;  1TR5 A;  3GTL B;  2X6L A;  1ESF A;  1XXG A;  3A5U A;  4P75 A;  1KLU D;  2EY1 A;  1SLJ A;  1EY4 A;  2OF1 A;  2B2T C;  3HKZ B;  1HUN A;  1KD1 C;  3T1H Q;  3KLW A;  3WOF A;  5HGQ A;  2WII B;  4QY7 A;  1PRT F;  5D3D A;  4DNI A;  1G51 A;  3HOX B;  4FXK C;  4UDU C;  1KXL A;  2F03 A;  3RUZ A;  2H5X A;  4HIM A;  2A69 D;  4X3S A;  1BCP C;  2NUC A;  1H95 A;  1K8M A;  3T1H L;  1VQL A;  2K28 A;  3G7L A;  1TS5 A;  4H02 A;  2OTJ A;  3HKZ E;  3K5M A;  2F4V Q;  1DOM A;  4RKB A;  2NVQ B;  4CKE A;  4YY3 Q;  5A2Q E;  5ELD A;  5JJL A;  1I4Q A;  2XWJ B;  3JC6 6;  3NUC A;  1BBW A;  1SYB A;  4A3I H;  1EQV A;  3DWQ A;  5CGK A;  2JQO A;  1BDO A;  3MXG A;  1HA5 A;  1KIX A;  4JI6 Q;  5EGT A;  5JVH 3;  4QJF A;  3GTJ B;  2HQL A;  1NR4 A;  1EQQ A;  2E5L Q;  2F4V L;  2PZW A;  5JPM C;  1LT6 D;  5I6W A;  2EXZ A;  4NP5 A;  4NB3 A;  4LF4 Q;  2D62 A;  3T56 B;  1HJP A;  1IW7 D;  4RKL A;  3PV0 A;  4IUV A;  1EIY B;  3TBI B;  3CC7 A;  5CBE E;  1KNA A;  3K0X A;  4JI6 L;  2C35 B;  4OX9 Q;  1FJG Q;  2F0L A;  1PH7 A;  2B63 H;  2E5L L;  2UXB L;  1GJX A;  1OTC A;  1NMF A;  1Q46 A;  4ZKC B;  2LS0 1;  2HUG A;  4LF4 L;  4XDX A;  3GTK H;  4OGQ C;  4HJA A;  4BY1 H;  3SE0 A;  1PA6 A;  4LF8 Q;  2QCP X;  3I3C A;  3M4P A;  3PO2 G;  2I5M X;  2KA7 A; 
#chains in the Genus database with same CATH homology
 1QIL A;  1JWM D;  3TME A;  4QF4 A;  1RD9 D;  1H9S A;  2MGS A;  2PPB C;  3S1N B;  1PTO H;  1A3T A;  2DY7 A;  4WRD A;  1U4M A;  3FPP A;  2B2Y C;  2AWN A;  2BA1 A;  3GP7 A;  1O7Z A;  2QDB A;  3LX0 A;  2C5C A;  1OXU A;  1QCB D;  3PUX A;  3S1Q B;  4IUU A;  5IGD A;  4ABN A;  3K59 A;  3Q22 A;  2E2J B;  2EY6 A;  1EIG A;  1JWU D;  3P7J A;  4A3E B;  3NQT A;  3SR1 A;  4KD3 A;  5C4H A;  1B9N A;  3KUP A;  1TII D;  1D5M C;  2Q8I B;  1Q1E A;  4A3K B;  3QJY A;  3EA6 A;  1SNP A;  4ZK9 B;  2J4X A;  4RGN A;  2NBF A;  2F0D A;  2K32 A;  2F0P A;  4HR7 B;  1GUT A;  3C1F A;  3FRP B;  2EYF A;  5FKA C;  2HCC A;  1U9R A;  2QIL A;  3H3V C;  4KTA A;  1STA A;  2B2U A;  1A3U A;  3J80 L;  4IFD I;  1SXT A;  2MHV A;  1GHK A;  4K5X A;  3I91 A;  3MXU A;  2TMP A;  1ET9 A;  4NMZ A;  2WKD A;  2O2L D;  2CHB D;  3T53 B;  2RVL A;  1B53 A;  3CU7 A;  3R3O A;  2NN6 G;  2M00 A;  3I8Z A;  4TRD A;  4B08 A;  2BOS A;  3V2T A;  4DNT B;  2PCF B;  3TN2 A;  1HTL D;  3D4D A;  3V05 A;  1EWH A;  4KY5 A;  4KI0 A;  1WVL A;  2KCC A;  2PNR C;  1DCZ A;  1PRT B;  2R92 B;  5EPJ A;  1NUC A;  3M7G A;  3P1H A;  2G9D A;  2KUM A;  1TWF B;  4A93 B;  5IT9 L;  1EU4 A;  1HRJ A;  3OIQ A;  4FVM A;  4R8I A;  4RH6 A;  2XVS A;  4C3I G;  5JEA H;  2F3V A;  3FMC A;  2CQA A;  1MGS A;  5I4D A;  1I4G A;  2AQ3 B;  3FDT A;  3X3M A;  1SYE A;  3FPU B;  4IQZ A;  5BN5 A;  1V8Q A;  1SJE D;  5T1G A;  4R9W A;  3SDZ A;  3DUZ A;  4IN3 A;  4EQN A;  5LL6 X;  2Q8R E;  1STG A;  1MD2 D;  4Q5V A;  3GO5 A;  4J6H A;  3I4M B;  3KLS X;  3Q6S A;  3RMH A;  4C3J B;  1SNQ A;  2IPK D;  5D65 A;  4A3D B;  1SE4 A;  3S15 B;  1JR0 D;  3NBH A;  4OIK A;  1B1Z A;  3OIP A;  1PRT C;  4KY6 A;  4BY7 B;  3OW7 A;  3I70 A;  4BA2 I;  2SNM A;  3A8I E;  1BCP F;  3NWS A;  3P20 A;  4C1N I;  3KBX A;  1PLF A;  4IUQ A;  1ILP A;  5CBA E;  1EL0 A;  1KDB A;  1D5Z C;  5KYI A;  5AFW A;  5C4Z A;  1O80 A;  4S3S A;  3EVQ A;  2PW7 A;  1DD2 A;  1TQO A;  1ENA A;  1IYU A;  3L9A X;  4OHJ A;  3S16 B;  3QOL A;  1TWG B;  3VR3 A;  3NPP A;  4PMB A;  1HQM C;  3H94 A;  1EEI D;  1L0Y B;  1ML0 D;  3NTK A;  2XSC A;  1PTO D;  4PNY A;  1CI3 M;  3VYT A;  5C44 B;  1XYI A;  1IKL A;  4XT1 B;  2BE5 D;  3GTP B;  4KKU A;  4X3K A;  2JXM B;  4DNR B;  4ZRZ A;  2PO4 A;  2A6H C;  2KOL A;  2B2W A;  5M5W B;  1Q12 A;  1TVX A;  3J7A F;  2ZT9 C;  3V96 A;  1NSN S;  1TU2 B;  1LTI D;  4XQN A;  1G2T A;  3H0G B;  3HOV B;  5EBD A;  2D5D A;  1QNU A;  2I46 A;  4J8Q A;  4RA8 A;  5C3X A;  2Z4H A;  1SE2 A;  2RDG A;  2LFN A;  2EY2 A;  1QJO A;  2K33 A;  1F9P A;  3VYR A;  2SNS A;  3HG9 A;  5FK9 C;  4TQU S;  2E2H B;  2Z8L A;  2JP1 A;  1SYD A;  1F77 A;  2A74 C;  1Y8P B;  4RWS C;  2MP1 A;  1GUG A;  2EE1 A;  5DAU A;  3S2D B;  5K5P A;  4G4K A;  2F0E A;  5FO8 B;  3D8G A;  4ME5 A;  3OOC A;  1H9S B;  2RBM A;  5IGC A;  5K36 H;  5I9P A;  3TP8 A;  2M9V A;  1EFI D;  4JBW A;  4N9P A;  1CHQ D;  5C6A A;  1D1K A;  5IIF A;  3BS1 A;  4DFA A;  3SK8 A;  3I73 A;  1G6Z A;  3NBI A;  4ZLT F;  4OL7 A;  3HEJ A;  1A6X A;  1D1I A;  4QUF A;  1JOK A;  4RGM A;  3G6J B;  3N6R A;  3BG3 A;  3GV3 A;  2F0O A;  2E75 C;  2FIN B;  2EPB A;  1HCZ A;  4CJ1 B;  3MXN A;  1RDP D;  2PW5 A;  3GTM B;  1ZXT A;  3HGB A;  4NW2 A;  1EY5 A;  1EU3 A;  1PZI D;  2WAC A;  1BCP B;  1JOO A;  1ROD A;  1STH A;  3NTH A;  1YNN C;  1ZYR D;  2OT2 A;  1PTO F;  4DXG A;  2B8G A;  1QOH A;  3J81 E;  3PO2 B;  3H91 A;  1PDQ A;  1ESR A;  2H4O A;  2WAQ B;  2A6E D;  4Y7N B;  3HOW B;  1VCI A;  2LKV A;  1XTC D;  3MHB A;  4NKL A;  2K5Q A;  4EGV A;  3OHX C;  4UAI A;  1F9Q A;  4MHE A;  1I6H B;  3K7A B;  5EKL A;  4DK0 A;  3A8J E;  1LO5 D;  5COR A;  4CJ2 C;  1JE4 A;  1OO9 B;  3DXJ C;  1X32 A;  1BXT A;  1AEX A;  4CGY B;  2F0S A;  2K5W A;  3P75 A;  2BDO A;  3TP6 A;  3FKI B;  5CYU A;  4K2L A;  3JAM L;  1KDA A;  1U4R A;  4KN4 C;  4HAE A;  2IT1 A;  1GUN A;  1V1P A;  5C0X H;  3IL8 A;  1RTN A;  2JEA I;  2WP8 J;  3MAQ A;  1DJR D;  2HCI A;  3NSW A;  5IOD A;  3CHB D;  4RGT A;  2NVY B;  1C8C A;  4XQJ A;  5I2Y A;  3EJI A;  1G8Z D;  4DXF A;  2B2V A;  4A3G B;  1SNO A;  3AU7 A;  3OMC A;  2DNC A;  1L0X B;  1PFB A;  3NQI A;  2L12 A;  1TY0 A;  1KAA A;  2B2U C;  2EYH A;  2D9U A;  1RHP A;  2IX0 A;  3MFG A;  2JA6 B;  2NB0 A;  2R7Z B;  2PZU A;  4H0L C;  3OWF A;  1B50 A;  2N88 A;  1U4L A;  1NAP A;  2AUJ D;  3K58 A;  2QF7 A;  3I90 A;  1II3 A;  1QWY A;  1DM0 B;  3GTG B;  4OO1 H;  2FHT A;  4L6T B;  2X6G A;  2IW3 A;  1FR3 A;  1HPC A;  1C48 A;  3E6Z X;  2JA8 B;  5FLX L;  2FMC A;  4IFD G;  1R4P B;  1DOL A;  4A3I B;  1PYW D;  4YIJ A;  1BBX C;  1Y1W B;  4KHV A;  2VUM B;  4C3I B;  3VA7 A;  1HXY D;  5CV6 A;  3D4W A;  4RHR A;  5D3I B;  2ID0 A;  3L3O C;  5ISR A;  5I9O A;  2H1E A;  2L9H A;  2IWH A;  3SHL A;  3GTK B;  1IYV A;  1AZQ A;  1JCK B;  1BNZ A;  1HFN A;  2ZXR A;  1FNV A;  3E0J A;  1PZK D;  3D6W A;  5E4W C;  2E76 C;  1D2B A;  5EKK A;  1PTO B;  5C3W A;  4QCL A;  2F0I A;  1YNJ C;  5C5M A;  1VF5 C;  2L11 A;  2GA4 B;  1EZ8 A;  2Z1C A;  1STB A;  2A68 C;  3T16 A;  3TP5 A;  3PO3 B;  2HQE A;  1G29 1;  5M3M B;  3NWT A;  1B44 D;  1H9K A;  3R2T A;  5IGG A;  2EYO A;  1CZG A;  1CA5 A;  4G7Z C;  1AW7 A;  2KED A;  2F0V A;  1UNS A;  2L5T A;  1TS4 A;  2EJM A;  2Y0S B;  1O7Y A;  2NYZ D;  3D6C A;  2B8F A;  1GOZ A;  1ENC A;  3PUY A;  4X3U A;  5HUR A;  2XRS D;  1C4Q A;  1WTR A;  5D14 A;  4B9W A;  3O13 A;  5E1F A;  1GUW A;  2K5D A;  5EJW A;  1O78 A;  4IFD J;  4ZAI A;  1K83 B;  2CVR A;  2F0H A;  3S1M B;  1F9S A;  2F0Q A;  4EQO A;  1VMC A;  2F0F A;  3IFD A;  3MWY W;  3DM1 A;  3GD7 A;  1HA6 A;  1LAB A;  2HDM A;  1PTO C;  1R9T B;  2EJG C;  1SSO A;  2Q8T A;  3J80 E;  4MIU A;  1HHV A;  1BUV T;  1FGB D;  2R61 A;  1PMR A;  4ZUJ A;  2QKI C;  5M9O A;  3GTO B;  5JJZ A;  2AQ2 B;  2XNA C;  3AB9 A;  3CQZ B;  5TSS A;  4ZUI A;  4BA1 I;  2FFK B;  4V19 0;  1X3P A;  2F0T A;  3HRZ C;  3HS0 C;  5COY A;  4F88 A;  2K01 A;  4N9T A;  2LY7 A;  1A2U A;  1STN A;  4KKT A;  4Q0F A;  1DON A;  1MBY A;  2AWO A;  5CV9 A;  4C1N K;  3C2P A;  3PIP 3;  3M85 A;  2MUY A;  3H09 A;  4XT3 B;  1NCV A;  2IX3 A;  2EOT A;  1KTK A;  5IT9 E;  3T51 B;  3LNN A;  1QNK A;  2JA5 B;  1GUO A;  2KJX A;  3D4R A;  3VR2 A;  1Z47 A;  1Q8I A;  2PQE A;  3ITP A;  4DA2 A;  1LT4 D;  4LJZ C;  2K04 A;  5CV4 A;  4F8M A;  2DY8 A;  3X3N A;  2F0K A;  3SK5 A;  1SEB D;  5JPN C;  3PUW A;  4OO1 I;  1AP0 A;  3FVQ A;  4M1U B;  2VB3 X;  2JA7 B;  4ZYS A;  5FOB B;  4KK7 A;  4FNF A;  4GZY C;  2J7Z A;  1QG7 A;  4M8A A;  3SK6 A;  1KNE A;  1CHP D;  2JSO A;  1Z7T A;  4F7X A;  4AYB B;  1JOQ A;  1IHZ A;  1S5F D;  2EYM A;  2NZ1 D;  3D3R A;  1V1P B;  5I2X A;  2ENB A;  1RTO A;  4B9X A;  4G57 A;  1Q3L A;  4IUN A;  2F0U A;  4K6L A;  1Y69 U;  5KND A;  3DEP A;  1ZYR C;  1EQT A;  3SK4 A;  4XYO A;  4U67 3;  3A55 A;  1H9M A;  3BYY B;  5ELF A;  3ND9 A;  2A73 B;  3NXW A;  1S5C D;  1STE A;  4C3H G;  2RDH A;  2A6E C;  1LAC A;  1U4P A;  3HOU B;  3ERO A;  2NTT A;  3IKJ A;  5EBC A;  5JVG 3;  1DXM A;  3MTS A;  4KJO A;  2L1B A;  5JEA G;  2RSO A;  5JAV A;  2F0N A;  4FXG C;  3A7A B;  1SJH D;  1LLR D;  4FF4 A;  2XWB B;  1CZW A;  3PIO 3;  3MC0 B;  2NVT B;  3A8K E;  3BYT B;  1F2L A;  1PZJ D;  3ZYY X;  2TSS A;  4C2M B;  3MZ5 A;  5CV8 A;  3NK9 A;  1LTR D;  1VMP A;  5DM6 3;  2KHS A;  1E2W A;  1PRT D;  1TWC B;  3CKI B;  3QOJ A;  3BVM A;  5FO7 B;  5KNC A;  1SYF A;  1LV9 A;  5KIX A;  2F3W A;  4KN7 C;  1KLG D;  4R8N A;  3M3Y B;  2A69 C;  3KF8 A;  3K0Y A;  2R93 B;  1EYA A;  4FP5 D;  1O7L A;  3L7Z C;  1ZKO A;  1D5X C;  4HSP A;  1PXU A;  1EY6 A;  4OIJ A;  3FEW X;  2B2V C;  2O5I C;  3DMU A;  3QO2 A;  3TZD A;  1A15 A;  1CQF A;  2FMM A;  3M7N A;  1WTO A;  4K8I A;  2RSN A;  1TY2 A;  5NUC A;  1TT2 A;  2JYO A;  1CFM A;  4IUR A;  3RD4 A;  4H44 C;  1I3Q B;  1IW7 C;  1V1O A;  3Q0A A;  1X3Q A;  1FD7 D;  4IUT A;  2XRQ D;  5HGT A;  3KBG A;  5J39 A;  2KQ3 A;  5T1I A;  1ET6 A;  1EYC A;  3DWA A;  3U9O A;  3TZU A;  4LAA A;  1JQY D;  1JC7 A;  2KVM A;  5CV5 A;  2A5H A;  1SNC A;  1W6K A;  2A6H D;  1S5D D;  4WFN 3;  2RA4 A;  1E0B A;  4DU9 A;  5ELB A;  2CW0 D;  2F0G A;  4DK1 A;  5JEA J;  5EQ0 A;  4BWG B;  1FYC A;  1LTB D;  3C3L A;  4L8J A;  3E5S A;  5M3F B;  1MI2 A;  5ELC A;  3Q24 A;  3KLR A;  1DZ1 A;  5A2Q L;  1QB5 D;  2LMC B;  4KKS A;  2R6G A;  1ICW A;  1PFN A;  1AZP A;  4K6D A;  2OXP A;  5E3F A;  5C4X B;  3R93 A;  3D31 A;  3VR6 A;  4QMG A;  2YU9 B;  4RGO S;  3S2H B;  4TKO B;  3IAY A;  5KYL A;  2M2L A;  3K5O A;  1F2M A;  1TKW B;  5CV7 A;  2E74 C;  2NN6 H;  5JOB A;  3WDN A;  1DYQ A;  1CQV A;  1EY0 A;  2NVX B;  2K1B A;  1LTA D;  1Q1B A;  1WTQ A;  3OWE B;  4FF3 A;  3VA5 A;  3TSS A;  2IL8 A;  4DAV A;  1D6E C;  4HN7 A;  4HMI A;  2XN9 C;  4A3B B;  2YYZ A;  2L55 A;  4XYQ A;  1WTP A;  4I65 A;  2RDF A;  5K36 G;  2NWG A;  1EYD A;  5A35 A;  1BOS A;  4XXE A;  4HTH A;  3VYU A;  1OXS C;  4E6I A;  3MEH A;  1RJT A;  3JAM E;  3UI2 A;  4IZ8 A;  4U68 A;  4ZKB B;  5I6Y A;  5M5Y B;  1ZEQ X;  4DN4 M;  1J8I A;  2F0J A;  4EVO A;  1YNN D;  5LL6 S;  1SYC A;  1K8O A;  1M4V A;  3TDQ A;  4KMU C;  2IX1 A;  3QG1 A;  1SNM A;  1SMY D;  3T13 A;  1QE6 A;  1EIH A;  1SYG A;  1EOT A;  2VXW A;  3H6M A;  4XTC S;  4DGZ A;  4JK1 C;  2O4X A;  2ZXO A;  1V43 A;  2B63 B;  1I4H A;  1G2S A;  2WB1 B;  2DN8 A;  1WD0 A;  1F2Y A;  1TS2 A;  4BY1 B;  1GXD C;  4KV6 A;  3DHQ A;  5C4J B;  1I4R A;  4K14 A;  1OXT A;  5CMD A;  1PFM A;  2SOB A;  3GV6 A;  2EYP A;  3GTQ B;  3CRL C;  3T4A C;  1M8A A;  3A54 A;  5EPL A;  2B2T A;  2O5J C;  5E4X A;  3MA2 B;  5IGB A;  5EKI A;  5FLX E;  5G3L D;  2AUK A;  3QIA A;  4A3J B;  1JB3 A;  1LT5 D;  4QB4 A;  1IL8 A;  1EWC A;  1CT1 D;  5KEE A;  1B9M A;  2PYK A;  2C9O A;  2RKS A;  1OXX K;  1Y8O B;  5KRU A;  4QIW B;  1SBB B;  2K05 A;  1BCP D;  1GUS A;  1BF4 A;  4HED A;  1LT3 D;  3KK7 A;  3MFY A;  5C0X G;  1AFP A;  2AQ1 B;  4NDX A;  5BN4 A;  3HOZ B;  3I4N B;  2EZV A;  1XWE A;  3K5L A;  1LTT D;  4ID6 A;  2PMZ B;  1S5E D;  4XQQ A;  3QB3 A;  1J9O A;  5CR3 A;  4DAY A;  2KCN A;  4O42 A;  3W3A A;  5J22 A;  5M5X B;  1A3V A;  4HCS A;  5DEH A;  1I4P A;  1UEA B;  2E2D C;  2WKC A;  4XIG S;  3Q23 A;  2F4I A;  5KGU A;  1W6J A;  2EY5 A;  1FNW A;  4RAU C;  2MPM A;  1CK1 A;  1MSG A;  2KEC A;  3I4L A;  3M4Y A;  1HQR D;  1G91 A;  1T5X D;  4KY7 A;  1STY A;  1LTG D;  1F2Z A;  3BDL A;  1FNU A;  4V0B A;  1NR2 A;  2BE5 C;  4J1M A;  4KJN A;  1GHJ A;  5ELE A;  3C46 A;  2B2Y A;  1WTX A;  4KHZ A;  4OO1 G;  3K5N A;  1TS3 A;  1VDZ A;  3LWU A;  4PMW A;  3DWP A;  3BZD B;  3DEO A;  4G7O C;  4EQP A;  2F0M A;  2K7V A;  3HOY B;  3IFT A;  1A2T A;  4C3H B;  3GQB A;  2B2W C;  2RQX A;  5C0X I;  2HDL A;  2G9H D;  4G7H C;  4FF2 A;  4IAL A;  2F1M A;  1OXV A;  4ZQ3 A;  1MSH A;  2NN6 I;  3J7A V;  1EY9 A;  1EY8 A;  1I50 B;  1R4Q B;  2D2C C;  4X3T A;  5BN3 A;  1YNJ D;  4O1N A;  3S17 B;  4CKB A;  2MJ8 A;  4A3F B;  4PQX A;  3SVM A;  4CJ0 B;  1Q90 A;  2E2I B;  2A68 D;  3RZO B;  3F2U A;  3MVV A;  3N52 A;  2K03 A;  1DOK A;  5G3L F;  1F9R A;  3S14 B;  5C0X J;  2BDN A;  2QEJ C;  2SEB D;  2BCO A;  1KDC A;  3PUZ A;  2VB2 X;  5DM7 3;  3OPO A;  3SXH A;  1SND A;  4CKC A;  4DF7 A;  3M4O B;  4Z9C B;  4LMQ D;  4ULL A;  4A3M B;  4DAP A;  3AMU A;  1RF2 D;  3BVZ A;  4K8J A;  5LHY 1;  1RCV D;  1TWA B;  1BR9 A;  3OMG A;  3K6O A;  1WCM B;  4HSV A;  5FO9 B;  1B2T A;  3NP8 A;  2EYJ A;  4KD4 A;  2EVB A;  5IGF A;  4QUC A;  1I4X A;  2DNE A;  4PV1 C;  1WTW A;  1BO0 A;  3S9W A;  5EPK A;  3KLS A;  5IOC A;  3RZD B;  1VF7 A;  1SDF A;  3CRK C;  1CA6 A;  2JE6 I;  4K5W A;  4MN3 A;  2V4D A;  3ND8 A;  2JEB I;  3BDO A;  1ENF A;  3LWE A;  1AN8 A;  2CW0 C;  3WOE A;  4RCO A;  1BQQ T;  3VR5 A;  1WD1 A;  3NHH A;  4L63 B;  1HFG A;  4RHS A;  1HUM A;  3SEB A;  1XX8 A;  1EY7 A;  1IKM A;  1JWS D;  3URY A;  1KAB A;  4ILW A;  4C3J G;  4FF1 A;  3TP7 A;  2L4N A;  2R3Z A;  2Z4I A;  4RCN A;  1HTP A;  3R8B A;  4C56 C;  1H9J A;  3MXP A;  2PZT A;  2FJ2 A;  4CBV A;  2WV6 D;  1JIC A;  1S5B D;  2OEO A;  4I7Z C;  1TWH B;  1S4Z A;  3S1R B;  4FO2 A;  3J81 L;  3NTI A;  2SDF A;  4BBR B;  2ICI A;  3HP3 A;  4K5V A;  3W2D A;  2IJ0 A;  1SAP A;  3I72 A;  1ONL A;  1Z6H A;  3R2I A;  4RFB A;  1UUP A;  5F2D A;  2J0T D;  3VR4 A;  4WJW A;  3BDC A;  2XIW A;  2VNU D;  5IGE A;  3PUV A;  2B39 A;  5DNF A;  4BBS B;  4P2C B;  1UAP A;  3BVG A;  3C1E A;  2NTS A;  3U9S A;  2WIN B;  4IFD H;  4HMJ A;  4BS9 A;  4CHT B;  1LTS D;  4PMC A;  4K2K A;  4LK1 C;  3QWN A;  4HCE A;  3A7L A;  4H7B A;  2BA0 A;  1RKN A;  5C5L A;  2F0W A;  3ONA B;  1T5E A;  1Y1V B;  3PMF A;  1I6V C;  4WOR A;  2ZXP A;  1E2Z A;  1SE3 A;  2X69 A;  2I07 B;  4ODG A;  1ILQ A;  4FYD A;  5CC4 A;  1Y8N B;  1SMY C;  3OSO A;  2L0C A;  1E2V A;  3RLF A;  3A56 A;  1CM9 A;  2EYL A;  1H9R A;  5KNB A;  4TSS A;  3K57 A;  1CTM A;  2N55 A;  1WTV A;  3HZX A;  3J7Y W;  1SFO B;  5C3E B;  2KEE A;  3NE5 B;  2K6A A;  4IUP A;  4H13 C;  3EFX D;  4F87 A;  1B4O A;  2EDG A;  1JOR A;  2ICE C;  2EJF C;  1EEF D;  3VYS A;  3ERQ A;  5J1Z A;  3EQL C;  4FXD A;  1EZ6 A;  1B3A A;  1TR5 A;  3GTL B;  2X6L A;  1ESF A;  1XXG A;  1KLU D;  2EY1 A;  1EY4 A;  2OF1 A;  2B2T C;  3HKZ B;  1HUN A;  3WOF A;  2WII B;  1PRT F;  5D3D A;  3HOX B;  4FXK C;  4UDU C;  2F03 A;  3RUZ A;  2A69 D;  4X3S A;  1BCP C;  2NUC A;  1K8M A;  2K28 A;  3G7L A;  1TS5 A;  3K5M A;  1DOM A;  4RKB A;  2NVQ B;  4CKE A;  5A2Q E;  5ELD A;  1I4Q A;  2XWJ B;  3NUC A;  1SYB A;  1EQV A;  3DWQ A;  5CGK A;  1BDO A;  3MXG A;  1HA5 A;  5EGT A;  5JVH 3;  3GTJ B;  1NR4 A;  2PZW A;  5JPM C;  1LT6 D;  5I6W A;  2EXZ A;  4NP5 A;  2D62 A;  3T56 B;  1IW7 D;  4RKL A;  3PV0 A;  4IUV A;  3TBI B;  5CBE E;  1KNA A;  2F0L A;  1GJX A;  4ZKC B;  2LS0 1;  2HUG A;  4XDX A;  4OGQ C;  3SE0 A;  2QCP X;  3I3C A;  2KA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...