4DU9A

Crystal structure of staphylococcal nuclease variant delta+phs i92a/v74a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEAEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4du9A00
2OF1A 4F8MA 4MIUA 4NP5A 5C5LA 1II3A 1SNDA 1STGA 1AEXA 2F0IA 4ME5A 5IGGA 4KD3A 2EYLA 5IOCA 4IUNA 4ZUIA 1TT2A 2NUCA 5CGKA 3NHHA 5J1ZA 2F0QA 1JOOA 3TP5A 3T16A 2KQ3A 1A3UA 4HTHA 1KABA 1U9RA 4K8JA 2F0GA 4QB4A 4LAAA 3SXHA 3OSOA 5C3XA 3TP7A 3QOLA 1A2TA 3SK6A 1SNOA 2F0DA 2EYMA 1STAA 5I6YA 2F3WA 2SOBA 4G57A 5EKLA 3SK8A 3ERQA 3MVVA 2O4XA 4KJOA 1SYDA 2RDFA 2PYKA 5CV8A 5IGDA 2EY1A 2F0EA 4PMCA 5IIFA 1F2MA 2SNMA 3NXWA 4K8IA 5EGTA 2ENBA 4KV6A 2EXZA 5J22A 1STBA 4NDXA 2PW7A 4ZUJA 4EQNA 4DFAA 4QMGA 5KGUA 5KYIA 5IODA 5I9PA 2F0JA 1EY9A 2F0MA 3D8GA 1STHA 2F0WA 1EYCA 4ID6A 3NP8A 3D4WA 4KD4A 4OL7A 4RKLA 1SYCA 4RKBA 2F0SA 4S3SA 5CV4A 5CV9A 1EYAA 2F0OA 3RUZA 5CC4A 4EQOA 4K5XA 2OEOA 4YIJA 1EY7A 1STNA 2F0KA 4N9TA 4EQPA 4K6DA 3U9OA 1KDCA 1EZ6A 2LKVA 4KTAA 3T13A 5CV7A 3LX0A 1JOQA 4K2LA 4PNYA 3P75A 4QF4A 2F0NA 2RKSA 3BDCA 3OMGA 2EYOA 2EYFA 5DAUA 5I6WA 3NK9A 2EY2A 3SHLA 1TR5A 1SNQA 4TRDA 5JOBA 5C4HA 5JAVA 1SYGA 2PW5A 3D6CA 2EY6A 2OXPA 3MEHA 3MXPA 5DEHA 4KY6A 4ODGA 1IHZA 4B9XA 3SK5A 5EKKA 4EVOA 4J6HA 1EY0A 1ENCA 3DHQA 4DU9A 1EY5A 3EROA 3R3OA 4PMBA 3HZXA 2EY5A 4NMZA 1A2UA 4R8NA 1TQOA 2F3VA 5HURA 4K5WA 4ZQ3A 4H7BA 4F7XA 1ENAA 3OMCA 1SYBA 4HMIA 3V2TA 5C3WA 3NQTA 3MZ5A 1NSNS 1EZ8A 1KDAA 1SNPA 2EYHA 4KY7A 2WACA 5KYLA 5J39A 1EY8A 2F0VA 3OWFA 3C1FA 5E3FA 1F2ZA 4HMJA 4DF7A 5IGFA 5IGEA 3SR1A 4K5VA 1JORA 3E5SA 1EY4A 5M9OA 2RBMA 5KIXA 5KEEA 5IGBA 4N9PA 5KRUA 4KJNA 4DGZA 4J1MA 1EYDA 3PMFA 4KY5A 1KDBA 5C6AA 5IGCA 3C1EA 1EY6A 3EJIA 4E6IA 2PZTA 3H6MA 4WORA 2EYJA 2F0FA 1KAAA 3MHBA 3QOJA 4WRDA 3SK4A 1STYA 5NUCA 1A3TA 2EYPA 1SYEA 2F0UA 2PZWA 4K2KA 3TP6A 3DMUA 5HGTA 3NUCA 2F0LA 5K5PA 5ISRA 2HQEA 4B9WA 2F0HA 1SNCA 2PQEA 4IALA 2M00A 3P1HA 2PZUA 5F2DA 4K14A 5CR3A 3QB3A 1EQVA 5CV5A 1JOKA 1SNMA 3ITPA 5CV6A 3BDLA 3EVQA 3HEJA 2SNSA 4I65A 1NUCA 2F0PA 4KHVA 1RKNA 5C4ZA 3TP8A 3S9WA 2QDBA 2F0TA 3D4DA 1A3VA 2KHSA 5C5MA 3VA5A 1SYFA 5I9OA 1F2YA 4NKLA 5E1FA 4IZ8A 3TMEA
chains in the Genus database with same CATH superfamily
1V43A 3VYSA 1II3A 1WD1A 4IFDG 2BA1A 4H02A 4ME5A 4JI7Q 4LF7L 1J9OA 3AQQA 2EYLA 1BVSA 4OWWB 3NEMA 5K36H 2KEDA 1K3BC 1ZXTA 3Q0AA 4LJZC 4AYBB 3OSOA 2KUMA 2OQKA 3J80E 1X32A 3KOJA 4KHZA 4DR5L 1CZGA 2K5NA 4YCUA 2UXCL 2RDFA 2PYKA 2BE5D 2QA4A 1S5DD 2LXKA 1XJVA 1A8VA 3E9IA 4YHHL 3HOUB 2RSNA 2PW7A 2Z9HA 3TSSA 1BBXC 4DV0L 3S1MH 1N32L 5HY6A 4OL7A 1VQNA 5D3DA 1N36Q 4DNTB 2B2WC 1TWAH 3S1NH 1TVXA 4A4IA 4Z9CB 1K28A 4KTAA 2JE6I 4A3KH 1D5MC 4LUZA 4JBMA 4R4QA 1FL0A 1EWHA 5ELEA 1G8ZD 3GTLB 1ZYRC 2JA8H 1V1PA 1XNRL 2L0CA 2AQ3B 2Z4IA 3NTKA 2DY7A 1KC8C 4B3RQ 2GA4B 4DU9A 1EY5A 3I7FA 4OO1H 3M7GA 2F3VA 1G51A 3S1RH 2E2HB 3I72A 3DLLA 2ZJQA 2OQ0A 2JEAI 4JI6L 2K1BA 3MFYA 4YY3L 3U4ZA 1VQ6A 2Q2TA 4IOAA 5T1GA 4XXEA 2Y0SE 3VYTA 1S40A 2YTYA 2SEBD 2BDOA 3K7UC 1JORA 4XQJA 3PIPA 4RGNA 4FXDA 4FYDA 2NB0A 5C3EH 1UAPA 4DGZA 1M8AA 3KK7A 3EQLC 1KHIA 1W2BA 3MHBA 2BOSA 3PO3G 2EJGC 3NUCA 1G6PA 4QGUA 1GUWA 5LMNL 3BYTB 5C4JH 5F2DA 5CR3A 4B3SQ 1JOKA 4C2MH 2UU9L 3MXNB 2SNSA 1NUCA 1TS5A 3MXUA 1RKNA 1XNQL 3S1QB 3HOUH 1A3VA 3J7AV 5E1FA 2LXJA 1LT4D 4IZ8A 1ICWA 1PDQA 1TWHB 1D7QA 4A3EB 1CQFA 3EA6A 3HOWG 2BCOA 2R7DA 3CP0A 2NUCA 4YCVA 3MFGA 4UY8C 4UP7A 3A5UA 4K8JA 2F0GA 3N6RA 3TEHB 3KDFA 1EEID 3QOLA 1P8LA 3SK6A 4RAUC 4DAPA 2FMMA 3IAYA 1XTCD 4ME3A 3FKIG 3KLRA 2EY1A 5CV8A 5C4XG 4BY7B 2B29A 2PO4A 1D6EC 1TS3A 2ENBA 1HR0L 2KHJA 3K59A 2E2HH 1WJJA 4OWTB 4A3JG 4QMGA 1ESRA 1EY9A 3D8GA 2ZTEA 2Q8RE 4DV1L 1YIJA 1KAWA 1MSHA 2Y0SG 4DK0A 4UP9A 2MJ8A 2B2TC 1RCVD 2MQHA 3BS1A 1Q1EA 1SN8A 2YYZA 1TWFH 3R8BA 4XYQA 4HJ5A 4YWLA 2L5TA 2N55A 2RKSA 5JVG3 3BDCA 2MHVA 3SDZA 3NK9A 4HIDA 3E3XA 3H09A 4ZAIA 3S2HH 4KHPQ 1UUPA 1UE5A 5DNFA 5JEAJ 5I9PA 1QNUA 1PXUA 2ZXPA 4DR7Q 3I4OA 2JA7B 3HFZB 5DM73 1PZKD 4XT3B 4DV4L 1IYUA 4LFBL 2IWHA 4BA1I 5C3WA 3NQTA 4MTNA 1OXTA 2B2VC 4GKKL 3W2DA 5GAGC 3CCQA 2UUAL 1BO0A 4A3EH 3E5SA 2RBMA 4LF7Q 5KRUA 4HCSA 3GTGB 1GUTA 1JT8A 2WAQE 1DOKA 1YNJD 2MP1A 5NUCA 5HGTA 1WTHA 1DGSA 4ZRZA 2F0HA 2RDHA 1H95A 1ET9A 3WWVA 4OEMB 4DR5Q 4K14A 4DV6L 3QB3A 2G5DA 1H9SB 2UXCQ 2DUDA 1KTKA 1KLGD 4IFDJ 4I65A 3MA2B 1HH2P 3D4DA 2L4NA 4YHHQ 1SYFA 1AE3A 1F2YA 1XX8A 3HOXG 1NJIC 4FF2A 1ZYRD 5FLXc 2X6LA 4DNIA 4DV0Q 1PV4A 1T5XD 4P73A 1N32Q 1YHAA 2K33A 4KD3A 1VQPA 1GXDC 4DXGA 1ASYA 1TT2A 4L5TA 2HUGA 4G4KA 2IY5B 3EN2A 4X64L 4FP5D 5C3XA 1NE3A 1C48A 1CUKA 2NN6I 1F2LA 2CQOA 4LFAQ 1WTOA 3MVVA 1GUNA 1XNRQ 3PCOB 4KN4C 1HA6A 3NENA 1UE6A 2WB1E 4WJWA 5C0XG 1QVGA 4PV1C 5GROA 1PRTC 2E74C 5FLXL 3CU7A 2B8FA 4JI6Q 3NSWA 4UDUC 1TS4A 2B2YC 4YY3Q 1Q81C 1ENFA 1RL2A 4RCOA 1BBWA 2B2UA 3CAMA 3LX0A 2R92G 3A56A 1N8RC 3OYYA 1EIGA 2WAQG 3MXPA 1Q12A 3FKIH 4DV2L 4J6HA 1B3QA 3D4RA 4HJ8A 2E2IB 4DR3L 4ULLA 2JXMB 1I6HB 4HMIA 2UU9Q 2CCZA 4RA8A 1XNQQ 4BBRG 1VQBA 1GD7A 4IJLA 5IGFA 1XPOA 2RDGA 4X3TA 2PNHA 3SE0A 2K5VA 5IGBA 4Y7NB 2A5HA 1ESFA 1I4PA 1Q3LA 1E3PA 4A3BG 4KY5A 1IXRA 2Z6KA 4A3GB 3H6MA 1E22A 4A3DG 5IYDH 3KF8A 2EVBA 1WTQA 4C3HB 1IKMA 3Q8DA 1PH7A 1K0SA 1LV9A 4JVZA 2VW9A 2CHBD 3BDLA 1Q90A 3CCVA 5JJKA 2K32A 3A0JA 4C56C 2HD3A 1HR0Q 4IPCA 5M5WB 5I9OA 4NKLA 2ZM6L 3GP7A 3K58A 3TMEA 5IT9E 1SMYC 2DY8A 1QVCA 4CDDC 4DV1Q 2LFNA 2PQAA 1K73C 4RWSC 2H4OA 5E4WC 1O80A 4DUYL 3DUZA 2QDLA 3MEFA 2RCNA 5EKLA 4ZKBB 4APVA 2H5XA 2B63H 2K5QA 1E7ZA 1L0WA 3UDIA 5IIFA 4RFBA 1JWUD 3WOEA 5D65A 1A0IA 5FJ8G 3KLSA 4DV4Q 1I94L 1EYCA 4RKBA 4LFBQ 4FNFA 3RUZA 1W6KA 1CKNB 1SAPA 4N9TA 1BDOA 2R7FA 4GKKQ 3T13A 1WVLA 1YBYA 2UUAQ 2MGSA 4RCNA 2Z1CA 4JI0L 2MO1A 2K6AA 3OMGA 1NMFA 2EYFA 4JI3L 3V96A 5C4HA 2WFWA 4BXXG 4JC0A 1E24A 2EY6A 5EQ0A 4MNOA 3RLOA 1DXMA 3DHQA 3I4LA 1I50H 5HURA 3MC0B 2EY5A 1EL0A 5C0XH 3CC7A 1D1KA 2KCNA 4K5WA 4IPHA 4JBJA 4F7XA 4DV6Q 4F87A 2YTXA 2F3IA 2AMCB 4C3IB 5M3FG 4JI4L 1F2ZA 4OXPA 4IJHA 1VQ4A 1PH3A 2XIWA 4N9PA 4JI8L 4DAYB 3UDXA 4BBSG 2QEJC 5A35A 3GTMB 4U68A 1SLJA 1PRTD 3SK4A 4MN3A 4X64Q 2X6GA 1CA5A 5DM63 2I5MX 1AW7A 1WOCA 2L11A 4RGMA 1WD0A 2ASBA 1HTLD 4IURA 4QIWB 3CRLC 4OIJA 2EJFC 4DK1A 3R2IA 2V4DA 1N9WA 1GHKA 4MIUA 4KKSA 1NMGA 4A76A 5IGGA 5KNDA 1F9RA 1HPCA 1VQLA 1DONA 4OO1I 1FNVA 2CH4W 1AZPA 2F0QA 2Z0SA 4JG2A 2KQ3A 4A3DH 3ZYYX 3PQIA 1PHJA 2N78A 4BY1G 2QW7A 3G7LA 5C44G 5AFWA 4AIMA 1STAA 2B8GA 4B3TL 2AUJD 5C0XJ 1AH9A 3CPWA 4KJOA 3VR6A 4DV2Q 3HKZG 4EQNA 4DFAA 4DR3Q 4HCEA 4QL5A 4A3IB 1VCIA 5IODA 1BCPF 1STEA 4P71A 4GNXC 4RKLA 1EEFD 4C3IH 4NXNQ 4JI1L 4OX9L 2R7ZB 2A1AA 1STNA 2F0KA 1YVCA 3FPPA 4K6DA 3KF6B 4FXGC 3H0GB 3CQZB 5CV7A 3GQBA 5CBEE 3S2DB 3TS2A 4A75A 1YJNA 3OW2A 1NAPA 3IL8A 2R93G 3MXNA 5AJ3L 4UP8A 3NQIA 2XWJB 1S72A 4OO1G 1SMYD 1Z9FA 5J3BA 1CSQA 3M4YA 1RTOA 5M5YB 1PZID 1A63A 3J81E 2D0PA 1HR0W 3K7AB 3AMUA 4FXKC 3MZ5A 2EYHA 1TIID 1KLUD 2XVSA 3TZDA 4MZ9A 4HMJA 2ZM6Q 1IW7C 1X3FA 4JI2L 4O0AA 5M9OA 4UPAA 4OGQC 4JBKA 4KMUC 1IL8A 4AYBG 1PH5A 1PTOF 2KENA 2NVXH 4E6IA 5ELCA 3K0YA 3AFQA 5CMDA 3HOYH 1SYEA 4IFDI 3GD7A 2IX0A 1C0AA 1FNUA 3F1ZA 2V1CC 3T1YL 4CDFC 3HOUG 1MBYA 1RF2D 3K57A 4CDEC 5JJIA 1HXYD 3S14B 1UEAB 1WFQA 4A3IH 2ZTDA 1NR2A 4C1NI 4LW1A 5M3FH 1MJCA 4CGYB 3IFDA 3D31A 1X65A 1I94Q 5E4XA 1FJGQ 4X3UA 2R7ZH 5IYCH 1PH2A 2UXBL 3E0JA 3NHHA 3D0FA 1B9NA 1KRTA 5FO9B 1L1OC 2HT1A 3M4OB 5COYA 4X3KA 3J7A5 3MAQA 2PPBC 4JOIC 1YITA 5EPJA 4JI3Q 5M3MH 5EPLA 1Y1VH 3ICEA 3S17B 1HFGA 5E7NA 1YNXA 1ILQA 4KV6A 3CXCA 4BWGB 1B2TA 3K7AH 2XWBB 2VQEQ 4R4IA 5CV4A 2ZJRA 4DV7L 4CKBA 5ELFA 3GTKB 1Z7TA 1EY7A 2K75A 4B3ML 3VR5A 2DN8A 1Q46A 3UI2A 4JI4Q 3G6JB 5BN3A 3T51B 1R9TB 2IJ0A 1XYIA 4BY1H 4NXML 1JOQA 1PH8A 3G6EA 2KOLA 1S4ZA 5C44H 4JI8Q 1H9SA 1M1KC 2HHHL 1Q86C 4DAVA 3SK5A 1YNJC 3A7LA 3DEPA 2VXWA 3JAML 1O7YA 4AH6A 2CFMA 4R4OA 3OIQA 3VYUA 1BNZA 5KNBA 1ENAA 2WIIB 1OO9B 4DR4Q 2HCCA 3S14H 2WACA 4A3EG 4POGA 2EJMA 1K3RA 1G91A 5ELBA 4ZLTF 2M2LA 5KEEA 1Q82C 1VQKA 4HEDA 2JQOA 3L7ZC 4GKJL 1G6ZA 4J1MA 3RZOB 2RHQB 3K81C 3TZUA 2NYZD 1EUJA 2R93H 3EJIA 3RN5A 2PZTA 3QOJA 3M4OH 4A93H 2L55A 2H1EA 2XRSD 2F0LA 3J80i 4JW0A 4LUOA 3PIO3 4B3TQ 4BY7G 4DV3Q 3GTOH 1SXTA 1B7YB 1LUZA 4EQ5A 3S9WA 2KECA 3VA5A 4LF8L 1X3EA 1VQHA 3CMEA 4CHTB 2O2LD 4J8QA 2N3SA 1NTGA 3GTPB 4JI1Q 4UAIA 2X69A 3BJUA 1LTAD 4OX9Q 3T4AC 1MD2D 1PH6A 1U5KA 1JMCA 3U9SA 5JPNC 4HR7B 1Y1WB 4LMQD 4RHRA 1LT5D 2O4XA 1UEBA 1NR4A 5AJ3Q 2PI2A 1IW7D 1SJED 4XYOA 3BDOA 2KCCA 4K8IA 2JJQA 1B1ZA 3J80c 2FFKB 3KYHC 1KQSA 2AUKA 2VS1A 2JA6B 3HOVB 2WKDA 3IFTA 4XQNA 3SGIA 2D62A 3I90A 3JC66 1WTRA 4YIJA 4XQQA 5EPKA 4YWKA 1SFOB 2J7ZA 2LKVA 3GTLH 4TKOB 4JI2Q 3GV6A 4IUTA 4K2LA 4MTKA 1PTOD 4LWCA 4J15A 4FF3A 1LTLA 1TR5A 4CDCC 3MEHA 4B9XA 4GS3A 3G4SA 3DM3A 2XGTA 1C7YA 2NBFA 2NZ1D 1B44D 3EROA 2PMZE 3J80L 1HFNA 1PH1A 2IPKD 3J81j 3RN2A 4G7HC 5EKIA 2UUCL 3KFUA 3V2TA 3T1YQ 3R2TA 2K01A 1SNPA 1SE2A 3H15A 3GTPH 3CCUA 3FMCA 1W6JA 5IYDG 1EYDA 2UXBQ 4KLKA 2XTIA 1J6QA 1PRTB 3S16B 1KAAA 2CVRA 1TY0A 2F4VL 2PCFB 3TP6A 1A6XA 5ISRA 1XXGA 1XPRA 3PUVA 4NW2A 2K5DA 1VQ8A 3BVMA 2PZUA 3P1HA 4IUUA 1EQVA 4DK3C 3S1QH 3ITPA 3MWYW 3SVMA 3NBHB 1CKNA 1J5EL 1EOTA 2B39A 4IUPA 4YCWA 3I4MB 3ULLA 1TWHH 2KHSA 3DEOA 3CW2C 1VQCA 2A73B 1SDFA 1VQEA 4DV7Q 4I7AA 1SFOH 1B9MA 1PFNA 5C0XI 1VS0A 4B3MQ 2GN5A 3CKIB 4R4CA 5ELOA 4HTHA 1YEZA 5FO7B 1BOSA 3CMAA 2KJXA 2YTVA 3TP7A 4NXMQ 2B63G 4RG1A 4BY7H 3OW7A 1EIHA 4HIKA 1K9MC 4KI0A 1F2MA 4BS9A 4OELB 4N8X1 1F9PA 1RIPA 1QUQB 5KYIA 1GUSA 3K5OA 4DAYA 5FOBB 1B3AA 4GLVB 1STHA 5CYUA 1VQOA 5C4XB 3D4WA 5CC4A 1XWEA 1K8MA 3NPPA 4K5XA 2OEOA 4EX5A 4A3JB 1PA6A 5BN4A 4A3FB 2OCEA 1WTXA 2EQSA 1S3OA 1WCMB 3H3VH 3P75A 4GKJQ 2Y0SB 1FVIA 4QY7A 2VL6A 4C3HG 1N33L 3SHLA 4JI5L 2Q8TA 4ABNA 1D1IA 5CBAE 2PW5A 3RNUA 2JYOA 1I3QB 2JA7H 1ENCA 2IHEA 4LF4L 5JAVA 1VDZA 1TQOA 3UDFA 3PUXA 3GV3A 2NZOA 3I4MH 1X3PA 5G3LF 1EWCA 1DZ1A 4PZ7A 1EY8A 3OWFA 4LF8Q 2RQXA 2BA0A 2CQAA 4K5VA 2M9VA 1F9SA 2IHFA 4R4TA 3GTGH 4C3JB 3GTQB 4HJ9A 3N52A 3K80C 1TWCB 5IGCA 3C1EA 2QCPX 1EYGA 2ID0A 2I46A 2KCMA 3RZDB 4UHVA 5LMNQ 1HRJA 4NB3A 4GN4B 3F2DA 1M4VA 4GOPC 4IPDA 1R4PB 4XDXA 1WTWA 3CC4A 3D3RA 2GVAA 1SE4A 1FGBD 3KF6A 3CC2A 2DJFC 1HNXL 2F0TA 1QCBD 2D2CC 3L3OC 2VUMB 3ND8A 2E2JB 4KN7C 4F8MA 3R93A 3M4PA 1CT1D 1CQVA 1DCZA 4DUZL 4HIOA 5CGKA 3CCEA 1BUVT 4A3FH 1BF4A 5A2QL 2K5WA 1A3UA 2K03A 3GDEA 1KABA 1B8AA 3Q24A 5JVH3 3FDTA 2F0DA 2SOBA 5HGQA 4C1NK 3ERQA 2B3GA 4AQYL 3I4NB 1YZ6A 4PMCA 4TQUS 4IO9A 1N34L 4C3IG 2F0JA 2QILA 2E76C 3UE0A 3UDGA 1LTSD 2F0WA 2LY7A 1PFMA 3OPOA 2UUCQ 4JV5L 1AZQA 1SYCA 4LFCL 2MNAA 2QEXA 1G2SA 2HDMA 4KK7A 2K28A 5I2XA 2B2WA 3KLWA 1MJEA 1U4RA 3GTQH 1LTRD 2Q2HA 1TWCH 2EYOA 3CHBD 1CM9A 4DN4M 4TSSA 1C9OA 3D6CA 1RDPD 4OHJA 4ODGA 1K83B 2E2IH 3RZDH 2F4VQ 3CCMA 4IOCA 2WKCA 2RF4A 1H9JA 1I6HH 4R8NA 3OWEB 5FLMG 4N8FA 2NZHA 3ZJYC 4HJAA 1O78A 2ATWA 3VR4A 1J5EQ 2VQFL 5J39A 3TS0A 3Q23A 1OXUA 2A19A 2K14A 3EIVA 2ALYB 2E2DC 2HDLA 4Y7NH 2K04A 3SR1A 1K8OA 1O7ZA 4IPGA 1HA5A 4CBVA 4A3GH 4BBRB 1V1OA 1JQYD 5IWAL 3E0EA 4H0LC 3HOYG 1EQRA 3A55A 4C3HH 1GUOA 2C5CA 2F0FA 3ER0A 3HKZE 4GNXB 2F0UA 1U4LA 5GAEC 3VA7A 3E6ZX 2ICEC 2A68C 3G48A 3PUZA 4A3BB 4X6AH 1NNXA 1PYSB 3CCRA 3A8JE 1VQ5A 3I4NH 2DNEA 5M5WH 4A3IG 3ONAB 3T1HL 1SEBD 1RJTA 2R7ZG 3TBIB 1ASZA 4LF9L 2I5HA 5IYCG 3HOZB 2F1MA 2WB1B 3H0GG 4IUNA 1AE2A 1FR3A 2IW3A 5J1ZA 4X3SA 1HJPA 2AQ1B 4P74A 5IT9c 3GTJB 2JA9A 3PIP3 1WYDA 2TMPA 5M3MG 1A2TA 1JCKB 3PO2B 1I4RA 1Y1VG 2F3WA 3FRPB 3IRBA 3WOFA 1N33Q 1SR3A 4JI5Q 1HHVA 1HZCA 2F0EA 1YHBA 3NXWA 3I70A 4LF4Q 1ET6A 1SBBB 4NDXA 1AFPA 1HQRD 2HCIA 2IX3A 4AYBE 2E75C 1X9NA 4S3SA 4R9WA 2OTJA 2F0OA 4L5QA 4ZKCB 4OWXB 2HIVA 4EQPA 5DLQE 2NN6H 2L1BA 4DR1L 3LWEA 2R6GA 2IL8A 1VMCA 2YV5A 2F03A 2B2TA 1ICFB 2K4KA 1PFSA 5LMNW 1SNQA 2WV6D 1VQ7A 4R1JA 1U4PA 2O5IC 1LLRD 1EY0A 1QVFA 4B3RL 2K52A 2RSOA 4ZQ3A 1H9KA 1L1OB 4LNQA 3F2UA 4X62L 2AHOB 2Q8IB 4A3CH 1HNXQ 2OT2A 3QJYA 3PGZA 4DF7A 3V05A 3HOZH 2B2VA 1BCPC 3GTMH 4DUZQ 1DD2A 4B08A 1LTBD 4R8IA 2OTLA 2I5LX 4A93G 4WORA 5LMUL 2K7VA 2EXDA 1S5ED 3PO2H 1B50A 2ZJPA 1LABA 1Z47A 4PZ6A 4BBSB 3JAME 5FLMH 2JA5B 2ZXRA 4A3MB 1MIUA 4AQYQ 1VQGA 4BA2I 2NVYB 1JR0D 2Z6BA 1N34Q 4XIGS 4L8JA 1P16A 2L12A 1STGA 4CJ0B 4JV5Q 2A69C 5IOCA 4LFCQ 3J7ZC 3A8KE 4DK6C 3NE5B 4HSPA 1JB3A 1A62A 5IYBH 2E8GA 3QO2A 4DUYQ 4LAAA 4Q0FA 1SNOA 5M5XB 2FMCA 2I0QA 1GUGA 1PTOC 1IBLL 1MHWC 4CJ2C 3Q22A 1GM5A 2WP8J 2UXDL 2VNUD 1TKWB 5J22A 3STBD 4ZUJA 3J81i 4WJ3M 3RR5A 3A5ZB 3QWNA 3H0GH 2NTSA 2A68D 3CQZH 2B2UC 1HCZA 3U9OA 2B2YA 3S2DH 4JI0Q 3C46A 2D9UA 2N8NA 1XMOL 3OTOL 1OXSC 4PNYA 2F0NA 2R3ZA 2ZTCA 4A3KB 2JP1A 3NBHA 3TN2A 2EY2A 4LUVA 4DR2L 1PYWD 1I4XA 3M9BA 5DEHA 5M5YH 1CFMA 1OXVA 2JA8B 4KHPL 2NVQB 3SEBA 4QUFA 2JA5H 4A3MH 1E2WA 1X3QA 1VQFA 2SDFA 4DR6L 3S1RB 2NVYH 1QG7A 3CCSA 5CORA 3T1HQ 3C1FA 3J81c 3W5OA 1QB5D 4DA2A 1I4GA 5I2YA 1EY4A 3I3CA 2Z6KC 5EBDA 3HG9A 5C3EB 4GLAC 2ZT9C 1Y1WG 2EYJA 1BQQT 4K2KA 3PF5A 1C4QA 2E5LL 1Q8IA 1QUQA 2WINB 4LF5L 5M5XH 1E1OA 4P75A 1EFID 2M00A 1EQTA 5CV5A 2DNCA 4H44C 4I7ZC 1O7IA 2JA6G 2LS01 5C4JB 3HOVG 3X3NA 3H3VI 4C2MB 2ICIA 5GADC 2N49A 1T9HA 3J81L 2RCFA 1JJCB 1HUNA 2A6EC 3DWAA 3B6YA 2D0OA 2XN9C 1BBUA 3AB9A 2YU9B 3FP9A 3L9AX 2UUBL 2MFIA 2L9HA 1HZ9A 4DR1Q 4QB4A 3UE1A 3P7JA 2ZXOA 4G57A 4RGOS 3S17H 2BH8A 1DOLA 1JWMD 4P72A 4LFAL 3I91A 2CW0C 2KEEA 4HJ7A 1SE8A 2NVQH 1BCPD 1S5CD 5EGTA 4P2CB 1YNNC 4FF4A 3AEVA 3GTKH 1VQAA 2XNAC 3NP8A 4X62Q 1VQ9A 4CKEA 1TS2A 1UNSA 1R9TH 3K5MA 1F9QA 1EQQA 1Q7YC 1WI5A 1MSGA 4ILWA 1PYBA 2CWPA 1OTCA 1TWFB 4FDBA 1PH9A 4IN3A 5JOBA 2JA7G 1JWSD 5LMUQ 1ML0D 2OXPA 1Y14B 1JC7A 2A69D 4IUQA 3TRZA 3S2HB 1H9RA 3I73A 4LF6L 1HQMC 4FF1A 2O5JC 3RLFA 1HZBA 3I4MG 1SYBA 1W3SA 4MHEA 1GKHA 3KJPA 1KNEA 4PMWA 3TQYA 5JEAH 1LM0A 3DM1A 1EU4A 3CCJA 1KD1C 3RZOH 3NELA 2AQ2B 4X65L 5FK9C 3CF5A 2YU9H 1FNWA 2DGYA 1EY6A 2EOTA 1CTMA 4WRDA 1BKBA 1XMQL 4HSVA 1IKLA 3HRZC 1IBKL 5IP7H 4KKUA 4ZCKA 1BXTA 2PI2E 4B9WA 4JPBW 4G7ZC 5FLXE 1V8QA 1X55A 2CWAA 1ONLA 3L2PA 4M8AA 1IBLQ 4O42A 2KBNA 2AWOA 1TY2A 4DV5L 2UXDQ 2A74C 2PNRC 2KVMA 3OHXC 5IP9H 1I4QA 1RHPA 3RLNA 1TU2B 4IUVA 1SNDA 3M4QA 5I4DA 1EWIA 4A3FG 3W1BA 4IFDH 4ZUIA 1FGUA 4QCLA 1WCMG 5LL6X 3PV0A 1Y1WH 4JK1C 2C9OA 2F52A 1XMOQ 1QOHA 3FHWA 1L2FA 3OTOQ 3PO3B 1BR9A 2IT1A 1X56A 3AFPA 3QIAA 3J7AF 3QG1A 4DR2Q 3CRKC 2CKZB 2ES2A 4DKAC 5IGDA 2JA6H 3HOVH 2VY3A 3BZDB 1E2VA 5EBCA 1E0BA 2TSSA 4V0BA 4QQBX 1DOMA 3ERSX 4DR6Q 2EE1A 1D2BA 1TXYA 4DNRB 3KBGA 4GNXA 4C3JG 4GOPB 3HOWB 1DYQA 3K8AA 5A2QE 2HHHQ 1QE6A 5JJZA 1JE5A 1GHJA 1K0RA 3A7AB 3VYRA 1CKMA 1Z6HA 3C2PA 3M85A 4M1UB 1B4OA 1XPUA 4FO2A 4QJFA 1UE1A 1MKHA 2EIFA 1ZEQX 2A6ED 1I6VC 4EVOA 4HIMA 2E5LQ 3HZXA 4LF5Q 3FKIB 1LTTD 5EJWA 2QF7A 1JJGA 4K6LA 4WFN3 2VUMG 2BDNA 1KDAA 1C8CA 4JYAL 1KIXA 4Q5VA 2N88A 4A3GG 4L5SA 3OOCA 2CW0D 1SJHD 5KIXA 1WTPA 4G7OC 3S16H 3FPUB 2RA4A 3NWTA 1UWVA 2KA7A 1KDBA 2XRQD 2L15A 4TVAB 1YNND 2UUBQ 1GOZA 3AU7A 3G71A 5I6WA 1A3TA 2D5DA 3Q6SA 4NPSA 3I4NG 3PO3H 1PRTF 1SNCA 4IALA 4PZ8A 2MUYA 1VQMA 1V1PB 5ELDA 1FYCA 1GO3E 2QDBA 4X66L 2Z4HA 1AP0A 5BR8L 1A15A 3W1GA 1NBWA 4HN7A 3IKJA 3H3VC 1IBML 3BZCA 5LHY1 1AEXA 3CD6A 4O2DA 3PUWA 1QZHA 1CSPA 1S5FD 3HOWH 1LACA 1JOOA 1CZWA 3T16A 2KCTA 3DXJC 4OIKA 1V1QA 1Y8NB 2QKIC 1CI3M 4QIWE 1SSOA 2F4IA 3LGJA 1PLFA 1YHQA 4A3LG 5GQOA 3F8TA 1L1OA 1LYLA 1OXXK 4JOIA 3I8ZA 1TWGB 1VMPA 2B63B 1PZJD 3F2CA 4LF6Q 5C4XH 1VF5C 5KGUA 4PQXA 3NTIA 3MXGA 2F0MA 4ZYSA 1QNKA 4ID6A 4A3JH 5D3IB 1SROA 3TP5A 4F88A 3RD4A 3HOXB 2NN6G 3KUPA 4DPGA 2PMZB 4NXNL 4EQOA 2NTTA 3TDQA 1YJWA 2Q2UA 1WCMH 1AN8A 4XTCS 4V190 4LK1C 1X54A 4X65Q 3ND9A 3PIOA 2VB2X 3K0XA 1I3QH 1RD9D 1QILA 3VDYA 2C35B 4DAMA 4KY6A 1XMQQ 1IBKQ 1SRUA 2VZAA 1JB7A 3FEWX 1YJ9A 3SK8A 1LT6D 3R3OA 4CKCA 1A2UA 2OWOA 3KDFB 1EOVA 3QR8A 3FVQA 1I50B 4A3CG 2P5ZX 4RMFA 1LTID 1Y8OB 1DM0B 1EZ8A 2VB3X 3VR2A 3HOZG 4RHSA 4K0KL 4DV5Q 2WB1G 4C3JH 1LTGD 3P20A 1U0LA 5H1SE 2A6HC 3BU2A 2LMCB 3U4VA 4PG3A 3W3AA 1HZAA 4XT1B 2R92B 1KRSA 3I56A 3PO2G 1IZ6A 1STYA 3DMUA 4GZYC 3S24A 2LSSA 1V9PA 3I2ZA 2WAQB 1VQIA 1IYVA 1KL9A 3T53B 1HNZL 2PQEA 2JK8A 4L6TB 5CV6A 1CKOA 4EGVA 1TWGH 3H91A 3URYA 3EVQA 4U673 2EPBA 1FD7D 1MGSA 3DWPA 2VUMH 4KHVA 2E2JH 1HNWL 1G2TA 2FJ2A 1UE7A 2OF1A 3HOXH 2F0IA 3STBC 1QWYA 4GN5A 3HP3A 1FJGL 5IYBG 5GAHC 3GO5A 2R61A 1U9RA 3SXHA 3J7YW 2K50A 3BVGA 1ZKOA 4A3DB 2MPMA 2EYMA 3BG3A 3KJOA 1SMXA 1LT3D 5FKAC 2K5HA 1BCPB 2SNMA 1HTPA 1MI2A 5JJLA 3A74A 2Z8LA 2AWNA 1IL2A 2HQLA 2IX1A 1E1TA 5EKKA 4JI7L 4KD4A 2VQEL 2J0TD 1EYAA 3C3LA 4L63B 4JYAQ 4KKTA 1KDCA 2JEBI 1L0YB 4GLXA 3KLSX 3A54A 3H94A 4IQZA 4GN3B 1VQDA 4QF4A 3ULPA 2NVTH 4A3LH 1K83H 5DAUA 2R92H 1PFBA 4QUCA 4TRDA 1EFWA 1SYGA 4POFA 3M7NA 3MTSA 2KHIA 2JA5G 4A3MG 4PMBA 1CHPD 4NMZA 3KBXA 1PVOA 4JCVE 4ALPA 1PMRA 5G3LD 2FXQA 1YI2A 1E2ZA 3K6OA 1N36L 4O1NA 2RVLA 5BN5A 1D8LA 3S15B 4KY7A 1D5ZC 1CA6A 2F0VA 4X66Q 4YWMA 5IT9L 5BR8Q 4DR4L 2EZVA 1XTDA 1PTOB 4BBRH 2BE5C 3K5NA 1IBMQ 3A8IE 1U4MA 5K36G 2HIXA 1JE4A 2GVBA 5IE8A 4A3BH 2EYPA 3EBEA 2PZWA 2NVXB 1T5EA 2HQEA 1CHQD 2FHTA 3HOYB 2JN4A 1IYJB 1G291 3HS0C 4DV3L 1NY4A 1Q8KA 2AKWB 2QGQA 1D5XC 5LL6S 4H13C 2F0PA 2EDGA 3TP8A 3EFXD 2K05A 3AYHB 5C5MA 2JSOA 1JICA 5C5LA 4NP5A 1RTNA 5M3FB 3LNNA 2G9HD 3GTJH 3T56B 1K8AC 3BZKA 1B70B 5TSSA 1DJRD 4A3KG 4ZK9B 3DWQA 5L37A 3PSIA 1O7LA 2J4XA 3F2BA 2RHSB 3NBIA 1X6OA 3RMHA 5I6YA 2JA8G 4OONA 5FO8B 4B3SL 1LO5D 2NWGA 3PF4A 1SYDA 5M3MB 1KNAA 3KF8B 1F77A 1X3GA 1Y1VB 1VF7A 1Q1BA 2EXZA 1RODA 1STBA 3HKSA 1SE3A 2A6HD 1WTVA 3L0OA 3M3YB 2NVTB 2G9DA 5CV9A 3S15H 2F0SA 5FJ8H 3O13A 1H9MA 1EIFA 1KXLA 1PTOH 3LWUA 1M90C 4K0KQ 1EZ6A 4CJ1B 1GVPA 1HUMA 2CH4A 5T1IA 5EAYA 3D6WA 2Q2IA 5C3EG 1L0XB 3TREA 3PUYA 5JPMC 2BH2A 1QZGA 2XSCA 1K8GA 3NTHA 4BY1B 3BVZA 5C44B 2PQAB 3E9HA 1IHZA 1Y8PB 2I07B 2DJGC 1R4QB 3OIPA 4DXFA 4BXXH 1EU3A 3BYYB 1NCVA 3CPFA 1HNZQ 3JAMi 4H7BA 3OMCA 3HKZB 3S1MB 3VR3A 2VQFQ 3NWSA 1EIYB 1NSNS 5JEAG 1ILPA 1QJOA 5KYLA 5D14A 1I5FA 3HGBA 3CCLA 1TWAB 3X3MA 1PH4A 3K5LA 3S1NB 5E3FA 1HNWQ 5IGEA 2FINB 1J8IA 3I55A 4WJ4A 5ELNA 5IWAQ 4RGTA 5IY0A 4KJNA 3PMFA 4FVMA 5C6AA 5IP7G 4HAEA 4BBSH 1JJ2A 3U58A 2R93B 3U50C 3WDNA 5K5PA 1GJXA 1S5BD 4DR7L 4JBWA 1Y69U 4A93B 5KNCA 2A8VA 1VQJA 1SNMA 4Y52H 4L5RC 1CK1A 3HEJA 1B53A 2MO0A 5C4ZA 5IP9G 4GOPA 3GTOB 3ULJA 4RH6A 1I4HA 3M3YH 4LF9Q 3JAMc
chains in the Genus database with same CATH topology
1V43A 3VYSA 1II3A 1WD1A 4IFDG 2BA1A 4ME5A 1J9OA 2EYLA 5K36H 2KEDA 1ZXTA 3Q0AA 4LJZC 4AYBB 3OSOA 2KUMA 3J80E 1X32A 4KHZA 1CZGA 2RDFA 2PYKA 2BE5D 1S5DD 3HOUB 2RSNA 2PW7A 3TSSA 1BBXC 4OL7A 5D3DA 4DNTB 2B2WC 1TVXA 4Z9CB 4KTAA 2JE6I 1D5MC 1EWHA 5ELEA 1G8ZD 3GTLB 1ZYRC 1V1PA 2L0CA 2AQ3B 2Z4IA 3NTKA 2DY7A 2GA4B 4DU9A 1EY5A 4OO1H 3M7GA 2F3VA 2E2HB 3I72A 2JEAI 2K1BA 3MFYA 5T1GA 4XXEA 3VYTA 2SEBD 2BDOA 1JORA 4XQJA 4RGNA 4FXDA 4FYDA 2NB0A 1UAPA 4DGZA 1M8AA 3KK7A 3EQLC 3MHBA 2BOSA 2EJGC 3NUCA 1GUWA 3BYTB 5F2DA 5CR3A 1JOKA 2SNSA 1NUCA 1TS5A 3MXUA 1RKNA 3S1QB 1A3VA 3J7AV 5E1FA 4IZ8A 1LT4D 1ICWA 1PDQA 1TWHB 4A3EB 1CQFA 3EA6A 2BCOA 2NUCA 3MFGA 4K8JA 2F0GA 3N6RA 1EEID 3QOLA 3SK6A 4RAUC 4DAPA 2FMMA 3IAYA 1XTCD 5CV8A 3KLRA 2EY1A 4BY7B 2PO4A 1D6EC 1TS3A 2ENBA 3K59A 4QMGA 1ESRA 1EY9A 3D8GA 2Q8RE 1MSHA 4DK0A 2MJ8A 2B2TC 1RCVD 3BS1A 1Q1EA 2YYZA 3R8BA 4XYQA 2L5TA 2N55A 2RKSA 5JVG3 3BDCA 2MHVA 3SDZA 3NK9A 3H09A 4ZAIA 1UUPA 5DNFA 5JEAJ 5I9PA 1QNUA 1PXUA 2ZXPA 2JA7B 5DM73 1PZKD 4XT3B 1IYUA 2IWHA 4BA1I 5C3WA 3NQTA 1OXTA 2B2VC 3W2DA 1BO0A 3E5SA 2RBMA 5KRUA 4HCSA 3GTGB 1GUTA 1DOKA 1YNJD 2MP1A 5NUCA 5HGTA 4ZRZA 2F0HA 2RDHA 1ET9A 4K14A 3QB3A 1H9SB 1KTKA 1KLGD 4IFDJ 4I65A 3MA2B 3D4DA 2L4NA 1SYFA 1F2YA 1XX8A 4FF2A 1ZYRD 2X6LA 1T5XD 2K33A 4KD3A 1GXDC 4DXGA 1TT2A 2HUGA 4G4KA 4FP5D 5C3XA 1C48A 2NN6I 1F2LA 1WTOA 3MVVA 1GUNA 4KN4C 1HA6A 4WJWA 5C0XG 4PV1C 1PRTC 2E74C 5FLXL 3CU7A 2B8FA 3NSWA 4UDUC 1TS4A 2B2YC 1ENFA 4RCOA 2B2UA 3LX0A 3A56A 1EIGA 3MXPA 1Q12A 4J6HA 3D4RA 2E2IB 4ULLA 2JXMB 1I6HB 4HMIA 4RA8A 5IGFA 2RDGA 4X3TA 3SE0A 5IGBA 4Y7NB 2A5HA 1ESFA 1I4PA 1Q3LA 4KY5A 4A3GB 3H6MA 3KF8A 2EVBA 1WTQA 4C3HB 1IKMA 1LV9A 2CHBD 3BDLA 1Q90A 2K32A 4C56C 5M5WB 5I9OA 4NKLA 3GP7A 3K58A 3TMEA 5IT9E 1SMYC 2DY8A 2LFNA 4RWSC 2H4OA 5E4WC 1O80A 3DUZA 5EKLA 4ZKBB 2K5QA 5IIFA 4RFBA 1JWUD 3WOEA 5D65A 3KLSA 1EYCA 4RKBA 4FNFA 3RUZA 1W6KA 1SAPA 4N9TA 1BDOA 3T13A 1WVLA 2MGSA 4RCNA 2Z1CA 2K6AA 3OMGA 2EYFA 3V96A 5C4HA 2EY6A 5EQ0A 1DXMA 3DHQA 3I4LA 5HURA 3MC0B 2EY5A 1EL0A 5C0XH 1D1KA 2KCNA 4K5WA 4F7XA 4F87A 4C3IB 1F2ZA 2XIWA 4N9PA 2QEJC 5A35A 3GTMB 4U68A 3SK4A 1PRTD 4MN3A 1CA5A 2X6GA 5DM63 1AW7A 2L11A 4RGMA 1WD0A 1HTLD 4IURA 4QIWB 3CRLC 4OIJA 2EJFC 4DK1A 3R2IA 2V4DA 1GHKA 4MIUA 4KKSA 5IGGA 5KNDA 1F9RA 1HPCA 1DONA 4OO1I 1FNVA 1AZPA 2F0QA 2KQ3A 3ZYYX 3G7LA 5AFWA 1STAA 2B8GA 2AUJD 5C0XJ 4KJOA 3VR6A 4EQNA 4DFAA 4HCEA 4A3IB 1VCIA 5IODA 1BCPF 1STEA 4RKLA 1EEFD 2R7ZB 1STNA 2F0KA 3FPPA 4K6DA 4FXGC 3H0GB 3CQZB 5CV7A 3GQBA 5CBEE 3S2DB 1NAPA 3IL8A 3MXNA 3NQIA 2XWJB 4OO1G 1SMYD 3M4YA 1RTOA 5M5YB 1PZID 3J81E 3K7AB 3AMUA 4FXKC 3MZ5A 2EYHA 1TIID 1KLUD 2XVSA 3TZDA 4HMJA 1IW7C 5M9OA 4OGQC 4KMUC 1IL8A 1PTOF 4E6IA 5ELCA 3K0YA 5CMDA 1SYEA 4IFDI 3GD7A 2IX0A 1FNUA 1MBYA 1RF2D 3K57A 1HXYD 3S14B 1UEAB 1NR2A 4C1NI 4CGYB 3IFDA 3D31A 5E4XA 4X3UA 3E0JA 3NHHA 1B9NA 5FO9B 3M4OB 5COYA 4X3KA 3MAQA 2PPBC 5EPJA 5EPLA 3S17B 1HFGA 1ILQA 4KV6A 4BWGB 1B2TA 2XWBB 5CV4A 4CKBA 5ELFA 3GTKB 1Z7TA 1EY7A 3VR5A 2DN8A 3UI2A 3G6JB 5BN3A 3T51B 1R9TB 2IJ0A 1XYIA 1JOQA 2KOLA 1S4ZA 1H9SA 4DAVA 3SK5A 1YNJC 3A7LA 3DEPA 2VXWA 3JAML 1O7YA 3VYUA 3OIQA 1BNZA 5KNBA 1ENAA 2WIIB 1OO9B 2HCCA 2WACA 2EJMA 1G91A 5ELBA 4ZLTF 2M2LA 5KEEA 4HEDA 3L7ZC 1G6ZA 4J1MA 3RZOB 3TZUA 2NYZD 3EJIA 2PZTA 3QOJA 2L55A 2H1EA 2XRSD 2F0LA 3PIO3 1SXTA 3S9WA 2KECA 3VA5A 4CHTB 2O2LD 4J8QA 3GTPB 4UAIA 2X69A 1LTAD 3T4AC 1MD2D 3U9SA 5JPNC 4HR7B 1Y1WB 4LMQD 4RHRA 1LT5D 2O4XA 1NR4A 1IW7D 1SJED 4XYOA 3BDOA 2KCCA 4K8IA 1B1ZA 2FFKB 2AUKA 2JA6B 3HOVB 2WKDA 3IFTA 4XQNA 2D62A 3I90A 1WTRA 4YIJA 4XQQA 5EPKA 1SFOB 2J7ZA 2LKVA 4TKOB 3GV6A 4IUTA 4K2LA 1PTOD 4FF3A 1TR5A 3MEHA 4B9XA 2NBFA 2NZ1D 1B44D 3EROA 3J80L 1HFNA 2IPKD 4G7HC 5EKIA 3V2TA 3R2TA 2K01A 1SNPA 1SE2A 3FMCA 1W6JA 1EYDA 1PRTB 3S16B 1KAAA 2CVRA 1TY0A 2PCFB 3TP6A 1A6XA 5ISRA 1XXGA 3PUVA 4NW2A 2K5DA 3BVMA 2PZUA 3P1HA 4IUUA 1EQVA 3ITPA 3MWYW 3SVMA 1EOTA 2B39A 4IUPA 3I4MB 2KHSA 3DEOA 2A73B 1SDFA 1B9MA 1PFNA 5C0XI 3CKIB 4HTHA 5FO7B 1BOSA 2KJXA 3TP7A 3OW7A 1EIHA 4KI0A 1F2MA 4BS9A 1F9PA 5KYIA 1GUSA 3K5OA 4DAYA 5FOBB 1B3AA 1STHA 5CYUA 5C4XB 3D4WA 5CC4A 1XWEA 1K8MA 3NPPA 4K5XA 2OEOA 4A3JB 5BN4A 4A3FB 1WTXA 1WCMB 3P75A 2Y0SB 4C3HG 3SHLA 2Q8TA 4ABNA 1D1IA 5CBAE 2PW5A 2JYOA 1I3QB 1ENCA 5JAVA 1VDZA 1TQOA 3PUXA 3GV3A 1X3PA 5G3LF 1EWCA 1DZ1A 1EY8A 3OWFA 2RQXA 2BA0A 2CQAA 4K5VA 2M9VA 1F9SA 4C3JB 3GTQB 3N52A 5IGCA 1TWCB 3C1EA 2QCPX 2ID0A 2I46A 3RZDB 1HRJA 1M4VA 4XDXA 1R4PB 1WTWA 3D3RA 1SE4A 1FGBD 2F0TA 1QCBD 2D2CC 3L3OC 2VUMB 3ND8A 2E2JB 4KN7C 4F8MA 3R93A 1CT1D 1CQVA 1DCZA 5CGKA 1BUVT 1BF4A 5A2QL 2K5WA 1A3UA 2K03A 3Q24A 1KABA 5JVH3 3FDTA 2F0DA 2SOBA 4C1NK 3ERQA 3I4NB 4PMCA 4TQUS 4C3IG 2F0JA 2QILA 2E76C 1LTSD 2F0WA 2LY7A 1PFMA 3OPOA 1AZQA 1SYCA 1G2SA 2HDMA 4KK7A 2K28A 5I2XA 2B2WA 1U4RA 1LTRD 2EYOA 3CHBD 1CM9A 4DN4M 4TSSA 3D6CA 1RDPD 4OHJA 4ODGA 1K83B 2WKCA 1H9JA 4R8NA 3OWEB 1O78A 3VR4A 5J39A 3Q23A 1OXUA 2E2DC 2HDLA 2K04A 3SR1A 1K8OA 1O7ZA 1HA5A 4CBVA 4BBRB 1V1OA 1JQYD 4H0LC 3A55A 1GUOA 2C5CA 2F0FA 2F0UA 1U4LA 3VA7A 3E6ZX 2ICEC 2A68C 3PUZA 4A3BB 3A8JE 2DNEA 3ONAB 1SEBD 1RJTA 3TBIB 3HOZB 2F1MA 2WB1B 4IUNA 1FR3A 2IW3A 5J1ZA 4X3SA 2AQ1B 3GTJB 3PIP3 2TMPA 1A2TA 1JCKB 3PO2B 1I4RA 2F3WA 3FRPB 3WOFA 1HHVA 2F0EA 3NXWA 3I70A 1ET6A 1SBBB 4NDXA 1AFPA 1HQRD 2HCIA 2IX3A 2E75C 4S3SA 4R9WA 2F0OA 4ZKCB 4EQPA 2NN6H 2L1BA 3LWEA 2R6GA 2IL8A 1VMCA 2F03A 2B2TA 1SNQA 2WV6D 1U4PA 2O5IC 1LLRD 1EY0A 2RSOA 4ZQ3A 1H9KA 3F2UA 2Q8IB 2OT2A 3QJYA 4DF7A 3V05A 2B2VA 1BCPC 1DD2A 4B08A 1LTBD 4R8IA 4WORA 2K7VA 1S5ED 1B50A 1LABA 1Z47A 4BBSB 3JAME 2JA5B 2ZXRA 4A3MB 4BA2I 2NVYB 1JR0D 4XIGS 4L8JA 2L12A 1STGA 4CJ0B 2A69C 5IOCA 3A8KE 3NE5B 4HSPA 1JB3A 3QO2A 4LAAA 4Q0FA 1SNOA 5M5XB 2FMCA 1GUGA 1PTOC 4CJ2C 3Q22A 2WP8J 2VNUD 1TKWB 5J22A 4ZUJA 3QWNA 2NTSA 2A68D 2B2UC 1HCZA 3U9OA 2B2YA 3C46A 2D9UA 1OXSC 4PNYA 2F0NA 2R3ZA 4A3KB 2JP1A 3NBHA 3TN2A 2EY2A 1PYWD 1I4XA 5DEHA 1CFMA 1OXVA 2JA8B 2NVQB 3SEBA 4QUFA 1E2WA 1X3QA 2SDFA 3S1RB 1QG7A 5CORA 3C1FA 1QB5D 4DA2A 1I4GA 5I2YA 1EY4A 3I3CA 5EBDA 3HG9A 5C3EB 2ZT9C 2EYJA 1BQQT 4K2KA 1C4QA 1Q8IA 2WINB 1EFID 2M00A 1EQTA 5CV5A 2DNCA 4H44C 4I7ZC 2LS01 5C4JB 3X3NA 4C2MB 2ICIA 3J81L 1HUNA 2A6EC 3DWAA 2XN9C 3AB9A 2YU9B 3L9AX 2L9HA 4QB4A 3P7JA 2ZXOA 4G57A 4RGOS 1DOLA 1JWMD 3I91A 2CW0C 2KEEA 1BCPD 1S5CD 5EGTA 4P2CB 1YNNC 4FF4A 2XNAC 3NP8A 4CKEA 1TS2A 1UNSA 3K5MA 1F9QA 1MSGA 4ILWA 1TWFB 4IN3A 5JOBA 1JWSD 1ML0D 2OXPA 1JC7A 2A69D 4IUQA 3S2HB 1H9RA 3I73A 4FF1A 1HQMC 2O5JC 3RLFA 1SYBA 4MHEA 1KNEA 4PMWA 5JEAH 3DM1A 1EU4A 2AQ2B 5FK9C 1FNWA 1EY6A 2EOTA 1CTMA 4WRDA 4HSVA 1IKLA 3HRZC 4KKUA 1BXTA 4B9WA 4G7ZC 5FLXE 1V8QA 1ONLA 4M8AA 4O42A 2AWOA 1TY2A 2A74C 2PNRC 2KVMA 3OHXC 1I4QA 1RHPA 1TU2B 4IUVA 1SNDA 5I4DA 4IFDH 4ZUIA 4QCLA 5LL6X 3PV0A 4JK1C 2C9OA 1QOHA 3PO3B 1BR9A 2IT1A 3QIAA 3J7AF 3QG1A 3CRKC 5IGDA 3BZDB 1E2VA 5EBCA 1E0BA 2TSSA 4V0BA 1DOMA 2EE1A 1D2BA 4DNRB 3KBGA 4C3JG 3HOWB 1DYQA 5A2QE 1QE6A 5JJZA 1GHJA 3A7AB 3VYRA 1Z6HA 3C2PA 3M85A 4M1UB 1B4OA 4FO2A 1ZEQX 2A6ED 1I6VC 4EVOA 3HZXA 3FKIB 1LTTD 5EJWA 2QF7A 4K6LA 4WFN3 2BDNA 1KDAA 1C8CA 4Q5VA 2N88A 3OOCA 2CW0D 1SJHD 5KIXA 1WTPA 4G7OC 3FPUB 2RA4A 3NWTA 2KA7A 1KDBA 2XRQD 1YNND 1GOZA 3AU7A 5I6WA 1A3TA 2D5DA 3Q6SA 1PRTF 1SNCA 4IALA 2MUYA 1V1PB 5ELDA 1FYCA 2QDBA 2Z4HA 1AP0A 1A15A 4HN7A 3H3VC 3IKJA 5LHY1 1AEXA 3PUWA 1S5FD 1LACA 1JOOA 1CZWA 3T16A 3DXJC 4OIKA 1Y8NB 2QKIC 1CI3M 1SSOA 2F4IA 1PLFA 1OXXK 3I8ZA 1TWGB 1VMPA 2B63B 1PZJD 1VF5C 5KGUA 4PQXA 3NTIA 3MXGA 2F0MA 4ZYSA 1QNKA 4ID6A 5D3IB 4F88A 3TP5A 3HOXB 3RD4A 2NN6G 3KUPA 4EQOA 2PMZB 2NTTA 3TDQA 1AN8A 4XTCS 4V190 4LK1C 3ND9A 2VB2X 1RD9D 1QILA 4KY6A 3FEWX 3SK8A 1LT6D 4CKCA 3R3OA 1A2UA 3FVQA 1I50B 1LTID 1Y8OB 1DM0B 1EZ8A 2VB3X 3VR2A 4RHSA 1LTGD 3P20A 2A6HC 2LMCB 3W3AA 4XT1B 2R92B 1STYA 3DMUA 4GZYC 2WAQB 1IYVA 3T53B 2PQEA 4L6TB 5CV6A 4EGVA 3H91A 3URYA 3EVQA 4U673 2EPBA 1FD7D 1MGSA 3DWPA 4KHVA 1G2TA 2FJ2A 2OF1A 2F0IA 1QWYA 3HP3A 3GO5A 2R61A 1U9RA 3SXHA 3J7YW 3BVGA 1ZKOA 4A3DB 2MPMA 2EYMA 3BG3A 1LT3D 5FKAC 1BCPB 2SNMA 1HTPA 1MI2A 2Z8LA 2AWNA 2IX1A 5EKKA 4KD4A 2J0TD 1EYAA 3C3LA 4L63B 4KKTA 1KDCA 2JEBI 1L0YB 3KLSX 3A54A 3H94A 4IQZA 4QF4A 5DAUA 1PFBA 4QUCA 4TRDA 1SYGA 3M7NA 3MTSA 4PMBA 1CHPD 4NMZA 3KBXA 1PMRA 5G3LD 1E2ZA 3K6OA 4O1NA 2RVLA 5BN5A 3S15B 4KY7A 1D5ZC 1CA6A 2F0VA 5IT9L 2EZVA 1PTOB 2BE5C 3K5NA 3A8IE 1U4MA 5K36G 1JE4A 2EYPA 2PZWA 2NVXB 1T5EA 2HQEA 1CHQD 2FHTA 3HOYB 1G291 3HS0C 1D5XC 5LL6S 4H13C 2F0PA 2EDGA 3TP8A 3EFXD 2K05A 5C5MA 2JSOA 1JICA 5C5LA 4NP5A 1RTNA 5M3FB 3LNNA 2G9HD 3T56B 5TSSA 1DJRD 4ZK9B 3DWQA 1O7LA 2J4XA 3NBIA 3RMHA 5I6YA 5FO8B 1LO5D 2NWGA 1SYDA 5M3MB 1KNAA 1F77A 1Y1VB 1VF7A 1Q1BA 2EXZA 1RODA 1STBA 1SE3A 2A6HD 1WTVA 3M3YB 2NVTB 2G9DA 5CV9A 2F0SA 3O13A 1H9MA 1PTOH 3LWUA 1EZ6A 4CJ1B 1HUMA 5T1IA 3D6WA 1L0XB 3PUYA 5JPMC 2XSCA 3NTHA 4BY1B 3BVZA 5C44B 1IHZA 1Y8PB 2I07B 4DXFA 1R4QB 3OIPA 1EU3A 3BYYB 1NCVA 4H7BA 3OMCA 3HKZB 3S1MB 3VR3A 3NWSA 1NSNS 5JEAG 1ILPA 1QJOA 5KYLA 5D14A 3HGBA 1TWAB 3X3MA 3K5LA 3S1NB 5E3FA 5IGEA 2FINB 1J8IA 4RGTA 4KJNA 3PMFA 4FVMA 5C6AA 4HAEA 2R93B 3WDNA 5K5PA 1GJXA 1S5BD 4JBWA 1Y69U 4A93B 5KNCA 1SNMA 1CK1A 3HEJA 1B53A 5C4ZA 3GTOB 4RH6A 1I4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OF1 A;  4F8M A;  4MIU A;  4NP5 A;  5C5L A;  1II3 A;  1SND A;  1STG A;  1AEX A;  2F0I A;  4ME5 A;  5IGG A;  4KD3 A;  2EYL A;  5IOC A;  4IUN A;  4ZUI A;  1TT2 A;  2NUC A;  5CGK A;  3NHH A;  5J1Z A;  2F0Q A;  1JOO A;  3TP5 A;  3T16 A;  2KQ3 A;  1A3U A;  4HTH A;  1KAB A;  1U9R A;  4K8J A;  2F0G A;  4QB4 A;  4LAA A;  3SXH A;  3OSO A;  5C3X A;  3TP7 A;  3QOL A;  1A2T A;  3SK6 A;  1SNO A;  2F0D A;  2EYM A;  1STA A;  5I6Y A;  2F3W A;  2SOB A;  4G57 A;  5EKL A;  3SK8 A;  3ERQ A;  3MVV A;  2O4X A;  4KJO A;  1SYD A;  2RDF A;  2PYK A;  5CV8 A;  5IGD A;  2EY1 A;  2F0E A;  4PMC A;  5IIF A;  1F2M A;  2SNM A;  3NXW A;  4K8I A;  5EGT A;  2ENB A;  4KV6 A;  2EXZ A;  5J22 A;  1STB A;  4NDX A;  2PW7 A;  4ZUJ A;  4EQN A;  4DFA A;  4QMG A;  5KGU A;  5KYI A;  5IOD A;  5I9P A;  2F0J A;  1EY9 A;  2F0M A;  3D8G A;  1STH A;  2F0W A;  1EYC A;  4ID6 A;  3NP8 A;  3D4W A;  4KD4 A;  4OL7 A;  4RKL A;  1SYC A;  4RKB A;  2F0S A;  4S3S A;  5CV4 A;  5CV9 A;  1EYA A;  2F0O A;  3RUZ A;  5CC4 A;  4EQO A;  4K5X A;  2OEO A;  4YIJ A;  1EY7 A;  1STN A;  2F0K A;  4N9T A;  4EQP A;  4K6D A;  3U9O A;  1KDC A;  1EZ6 A;  2LKV A;  4KTA A;  3T13 A;  5CV7 A;  3LX0 A;  1JOQ A;  4K2L A;  4PNY A;  3P75 A;  4QF4 A;  2F0N A;  2RKS A;  3BDC A;  3OMG A;  2EYO A;  2EYF A;  5DAU A;  5I6W A;  3NK9 A;  2EY2 A;  3SHL A;  1TR5 A;  1SNQ A;  4TRD A;  5JOB A;  5C4H A;  5JAV A;  1SYG A;  2PW5 A;  3D6C A;  2EY6 A;  2OXP A;  3MEH A;  3MXP A;  5DEH A;  4KY6 A;  4ODG A;  1IHZ A;  4B9X A;  3SK5 A;  5EKK A;  4EVO A;  4J6H A;  1EY0 A;  1ENC A;  3DHQ A;  4DU9 A;  1EY5 A;  3ERO A;  3R3O A;  4PMB A;  3HZX A;  2EY5 A;  4NMZ A;  1A2U A;  4R8N A;  1TQO A;  2F3V A;  5HUR A;  4K5W A;  4ZQ3 A;  4H7B A;  4F7X A;  1ENA A;  3OMC A;  1SYB A;  4HMI A;  3V2T A;  5C3W A;  3NQT A;  3MZ5 A;  1NSN S;  1EZ8 A;  1KDA A;  1SNP A;  2EYH A;  4KY7 A;  2WAC A;  5KYL A;  5J39 A;  1EY8 A;  2F0V A;  3OWF A;  3C1F A;  5E3F A;  1F2Z A;  4HMJ A;  4DF7 A;  5IGF A;  5IGE A;  3SR1 A;  4K5V A;  1JOR A;  3E5S A;  1EY4 A;  5M9O A;  2RBM A;  5KIX A;  5KEE A;  5IGB A;  4N9P A;  5KRU A;  4KJN A;  4DGZ A;  4J1M A;  1EYD A;  3PMF A;  4KY5 A;  1KDB A;  5C6A A;  5IGC A;  3C1E A;  1EY6 A;  3EJI A;  4E6I A;  2PZT A;  3H6M A;  4WOR A;  2EYJ A;  2F0F A;  1KAA A;  3MHB A;  3QOJ A;  4WRD A;  3SK4 A;  1STY A;  5NUC A;  1A3T A;  2EYP A;  1SYE A;  2F0U A;  2PZW A;  4K2K A;  3TP6 A;  3DMU A;  5HGT A;  3NUC A;  2F0L A;  5K5P A;  5ISR A;  2HQE A;  4B9W A;  2F0H A;  1SNC A;  2PQE A;  4IAL A;  2M00 A;  3P1H A;  2PZU A;  5F2D A;  4K14 A;  5CR3 A;  3QB3 A;  1EQV A;  5CV5 A;  1JOK A;  1SNM A;  3ITP A;  5CV6 A;  3BDL A;  3EVQ A;  3HEJ A;  2SNS A;  4I65 A;  1NUC A;  2F0P A;  4KHV A;  1RKN A;  5C4Z A;  3TP8 A;  3S9W A;  2QDB A;  2F0T A;  3D4D A;  1A3V A;  2KHS A;  5C5M A;  3VA5 A;  1SYF A;  5I9O A;  1F2Y A;  4NKL A;  5E1F A;  4IZ8 A;  3TME A; 
#chains in the Genus database with same CATH topology
 1V43 A;  3VYS A;  1II3 A;  1WD1 A;  4IFD G;  2BA1 A;  4H02 A;  4ME5 A;  4JI7 Q;  4LF7 L;  1J9O A;  3AQQ A;  2EYL A;  1BVS A;  4OWW B;  3NEM A;  5K36 H;  2KED A;  1K3B C;  1ZXT A;  3Q0A A;  4LJZ C;  4AYB B;  3OSO A;  2KUM A;  2OQK A;  3J80 E;  1X32 A;  3KOJ A;  4KHZ A;  4DR5 L;  1CZG A;  2K5N A;  4YCU A;  2UXC L;  2RDF A;  2PYK A;  2BE5 D;  2QA4 A;  1S5D D;  2LXK A;  1XJV A;  1A8V A;  3E9I A;  4YHH L;  3HOU B;  2RSN A;  2PW7 A;  2Z9H A;  3TSS A;  1BBX C;  4DV0 L;  3S1M H;  1N32 L;  5HY6 A;  4OL7 A;  1VQN A;  5D3D A;  1N36 Q;  4DNT B;  2B2W C;  1TWA H;  3S1N H;  1TVX A;  4A4I A;  4Z9C B;  1K28 A;  4KTA A;  2JE6 I;  4A3K H;  1D5M C;  4LUZ A;  4JBM A;  4R4Q A;  1FL0 A;  1EWH A;  5ELE A;  1G8Z D;  3GTL B;  1ZYR C;  2JA8 H;  1V1P A;  1XNR L;  2L0C A;  2AQ3 B;  2Z4I A;  3NTK A;  2DY7 A;  1KC8 C;  4B3R Q;  2GA4 B;  4DU9 A;  1EY5 A;  3I7F A;  4OO1 H;  3M7G A;  2F3V A;  1G51 A;  3S1R H;  2E2H B;  3I72 A;  3DLL A;  2ZJQ A;  2OQ0 A;  2JEA I;  4JI6 L;  2K1B A;  3MFY A;  4YY3 L;  3U4Z A;  1VQ6 A;  2Q2T A;  4IOA A;  5T1G A;  4XXE A;  2Y0S E;  3VYT A;  1S40 A;  2YTY A;  2SEB D;  2BDO A;  3K7U C;  1JOR A;  4XQJ A;  3PIP A;  4RGN A;  4FXD A;  4FYD A;  2NB0 A;  5C3E H;  1UAP A;  4DGZ A;  1M8A A;  3KK7 A;  3EQL C;  1KHI A;  1W2B A;  3MHB A;  2BOS A;  3PO3 G;  2EJG C;  3NUC A;  1G6P A;  4QGU A;  1GUW A;  5LMN L;  3BYT B;  5C4J H;  5F2D A;  5CR3 A;  4B3S Q;  1JOK A;  4C2M H;  2UU9 L;  3MXN B;  2SNS A;  1NUC A;  1TS5 A;  3MXU A;  1RKN A;  1XNQ L;  3S1Q B;  3HOU H;  1A3V A;  3J7A V;  5E1F A;  2LXJ A;  1LT4 D;  4IZ8 A;  1ICW A;  1PDQ A;  1TWH B;  1D7Q A;  4A3E B;  1CQF A;  3EA6 A;  3HOW G;  2BCO A;  2R7D A;  3CP0 A;  2NUC A;  4YCV A;  3MFG A;  4UY8 C;  4UP7 A;  3A5U A;  4K8J A;  2F0G A;  3N6R A;  3TEH B;  3KDF A;  1EEI D;  3QOL A;  1P8L A;  3SK6 A;  4RAU C;  4DAP A;  2FMM A;  3IAY A;  1XTC D;  4ME3 A;  3FKI G;  3KLR A;  2EY1 A;  5CV8 A;  5C4X G;  4BY7 B;  2B29 A;  2PO4 A;  1D6E C;  1TS3 A;  2ENB A;  1HR0 L;  2KHJ A;  3K59 A;  2E2H H;  1WJJ A;  4OWT B;  4A3J G;  4QMG A;  1ESR A;  1EY9 A;  3D8G A;  2ZTE A;  2Q8R E;  4DV1 L;  1YIJ A;  1KAW A;  1MSH A;  2Y0S G;  4DK0 A;  4UP9 A;  2MJ8 A;  2B2T C;  1RCV D;  2MQH A;  3BS1 A;  1Q1E A;  1SN8 A;  2YYZ A;  1TWF H;  3R8B A;  4XYQ A;  4HJ5 A;  4YWL A;  2L5T A;  2N55 A;  2RKS A;  5JVG 3;  3BDC A;  2MHV A;  3SDZ A;  3NK9 A;  4HID A;  3E3X A;  3H09 A;  4ZAI A;  3S2H H;  4KHP Q;  1UUP A;  1UE5 A;  5DNF A;  5JEA J;  5I9P A;  1QNU A;  1PXU A;  2ZXP A;  4DR7 Q;  3I4O A;  2JA7 B;  3HFZ B;  5DM7 3;  1PZK D;  4XT3 B;  4DV4 L;  1IYU A;  4LFB L;  2IWH A;  4BA1 I;  5C3W A;  3NQT A;  4MTN A;  1OXT A;  2B2V C;  4GKK L;  3W2D A;  5GAG C;  3CCQ A;  2UUA L;  1BO0 A;  4A3E H;  3E5S A;  2RBM A;  4LF7 Q;  5KRU A;  4HCS A;  3GTG B;  1GUT A;  1JT8 A;  2WAQ E;  1DOK A;  1YNJ D;  2MP1 A;  5NUC A;  5HGT A;  1WTH A;  1DGS A;  4ZRZ A;  2F0H A;  2RDH A;  1H95 A;  1ET9 A;  3WWV A;  4OEM B;  4DR5 Q;  4K14 A;  4DV6 L;  3QB3 A;  2G5D A;  1H9S B;  2UXC Q;  2DUD A;  1KTK A;  1KLG D;  4IFD J;  4I65 A;  3MA2 B;  1HH2 P;  3D4D A;  2L4N A;  4YHH Q;  1SYF A;  1AE3 A;  1F2Y A;  1XX8 A;  3HOX G;  1NJI C;  4FF2 A;  1ZYR D;  5FLX c;  2X6L A;  4DNI A;  4DV0 Q;  1PV4 A;  1T5X D;  4P73 A;  1N32 Q;  1YHA A;  2K33 A;  4KD3 A;  1VQP A;  1GXD C;  4DXG A;  1ASY A;  1TT2 A;  4L5T A;  2HUG A;  4G4K A;  2IY5 B;  3EN2 A;  4X64 L;  4FP5 D;  5C3X A;  1NE3 A;  1C48 A;  1CUK A;  2NN6 I;  1F2L A;  2CQO A;  4LFA Q;  1WTO A;  3MVV A;  1GUN A;  1XNR Q;  3PCO B;  4KN4 C;  1HA6 A;  3NEN A;  1UE6 A;  2WB1 E;  4WJW A;  5C0X G;  1QVG A;  4PV1 C;  5GRO A;  1PRT C;  2E74 C;  5FLX L;  3CU7 A;  2B8F A;  4JI6 Q;  3NSW A;  4UDU C;  1TS4 A;  2B2Y C;  4YY3 Q;  1Q81 C;  1ENF A;  1RL2 A;  4RCO A;  1BBW A;  2B2U A;  3CAM A;  3LX0 A;  2R92 G;  3A56 A;  1N8R C;  3OYY A;  1EIG A;  2WAQ G;  3MXP A;  1Q12 A;  3FKI H;  4DV2 L;  4J6H A;  1B3Q A;  3D4R A;  4HJ8 A;  2E2I B;  4DR3 L;  4ULL A;  2JXM B;  1I6H B;  4HMI A;  2UU9 Q;  2CCZ A;  4RA8 A;  1XNQ Q;  4BBR G;  1VQB A;  1GD7 A;  4IJL A;  5IGF A;  1XPO A;  2RDG A;  4X3T A;  2PNH A;  3SE0 A;  2K5V A;  5IGB A;  4Y7N B;  2A5H A;  1ESF A;  1I4P A;  1Q3L A;  1E3P A;  4A3B G;  4KY5 A;  1IXR A;  2Z6K A;  4A3G B;  3H6M A;  1E22 A;  4A3D G;  5IYD H;  3KF8 A;  2EVB A;  1WTQ A;  4C3H B;  1IKM A;  3Q8D A;  1PH7 A;  1K0S A;  1LV9 A;  4JVZ A;  2VW9 A;  2CHB D;  3BDL A;  1Q90 A;  3CCV A;  5JJK A;  2K32 A;  3A0J A;  4C56 C;  2HD3 A;  1HR0 Q;  4IPC A;  5M5W B;  5I9O A;  4NKL A;  2ZM6 L;  3GP7 A;  3K58 A;  3TME A;  5IT9 E;  1SMY C;  2DY8 A;  1QVC A;  4CDD C;  4DV1 Q;  2LFN A;  2PQA A;  1K73 C;  4RWS C;  2H4O A;  5E4W C;  1O80 A;  4DUY L;  3DUZ A;  2QDL A;  3MEF A;  2RCN A;  5EKL A;  4ZKB B;  4APV A;  2H5X A;  2B63 H;  2K5Q A;  1E7Z A;  1L0W A;  3UDI A;  5IIF A;  4RFB A;  1JWU D;  3WOE A;  5D65 A;  1A0I A;  5FJ8 G;  3KLS A;  4DV4 Q;  1I94 L;  1EYC A;  4RKB A;  4LFB Q;  4FNF A;  3RUZ A;  1W6K A;  1CKN B;  1SAP A;  4N9T A;  1BDO A;  2R7F A;  4GKK Q;  3T13 A;  1WVL A;  1YBY A;  2UUA Q;  2MGS A;  4RCN A;  2Z1C A;  4JI0 L;  2MO1 A;  2K6A A;  3OMG A;  1NMF A;  2EYF A;  4JI3 L;  3V96 A;  5C4H A;  2WFW A;  4BXX G;  4JC0 A;  1E24 A;  2EY6 A;  5EQ0 A;  4MNO A;  3RLO A;  1DXM A;  3DHQ A;  3I4L A;  1I50 H;  5HUR A;  3MC0 B;  2EY5 A;  1EL0 A;  5C0X H;  3CC7 A;  1D1K A;  2KCN A;  4K5W A;  4IPH A;  4JBJ A;  4F7X A;  4DV6 Q;  4F87 A;  2YTX A;  2F3I A;  2AMC B;  4C3I B;  5M3F G;  4JI4 L;  1F2Z A;  4OXP A;  4IJH A;  1VQ4 A;  1PH3 A;  2XIW A;  4N9P A;  4JI8 L;  4DAY B;  3UDX A;  4BBS G;  2QEJ C;  5A35 A;  3GTM B;  4U68 A;  1SLJ A;  1PRT D;  3SK4 A;  4MN3 A;  4X64 Q;  2X6G A;  1CA5 A;  5DM6 3;  2I5M X;  1AW7 A;  1WOC A;  2L11 A;  4RGM A;  1WD0 A;  2ASB A;  1HTL D;  4IUR A;  4QIW B;  3CRL C;  4OIJ A;  2EJF C;  4DK1 A;  3R2I A;  2V4D A;  1N9W A;  1GHK A;  4MIU A;  4KKS A;  1NMG A;  4A76 A;  5IGG A;  5KND A;  1F9R A;  1HPC A;  1VQL A;  1DON A;  4OO1 I;  1FNV A;  2CH4 W;  1AZP A;  2F0Q A;  2Z0S A;  4JG2 A;  2KQ3 A;  4A3D H;  3ZYY X;  3PQI A;  1PHJ A;  2N78 A;  4BY1 G;  2QW7 A;  3G7L A;  5C44 G;  5AFW A;  4AIM A;  1STA A;  2B8G A;  4B3T L;  2AUJ D;  5C0X J;  1AH9 A;  3CPW A;  4KJO A;  3VR6 A;  4DV2 Q;  3HKZ G;  4EQN A;  4DFA A;  4DR3 Q;  4HCE A;  4QL5 A;  4A3I B;  1VCI A;  5IOD A;  1BCP F;  1STE A;  4P71 A;  4GNX C;  4RKL A;  1EEF D;  4C3I H;  4NXN Q;  4JI1 L;  4OX9 L;  2R7Z B;  2A1A A;  1STN A;  2F0K A;  1YVC A;  3FPP A;  4K6D A;  3KF6 B;  4FXG C;  3H0G B;  3CQZ B;  5CV7 A;  3GQB A;  5CBE E;  3S2D B;  3TS2 A;  4A75 A;  1YJN A;  3OW2 A;  1NAP A;  3IL8 A;  2R93 G;  3MXN A;  5AJ3 L;  4UP8 A;  3NQI A;  2XWJ B;  1S72 A;  4OO1 G;  1SMY D;  1Z9F A;  5J3B A;  1CSQ A;  3M4Y A;  1RTO A;  5M5Y B;  1PZI D;  1A63 A;  3J81 E;  2D0P A;  1HR0 W;  3K7A B;  3AMU A;  4FXK C;  3MZ5 A;  2EYH A;  1TII D;  1KLU D;  2XVS A;  3TZD A;  4MZ9 A;  4HMJ A;  2ZM6 Q;  1IW7 C;  1X3F A;  4JI2 L;  4O0A A;  5M9O A;  4UPA A;  4OGQ C;  4JBK A;  4KMU C;  1IL8 A;  4AYB G;  1PH5 A;  1PTO F;  2KEN A;  2NVX H;  4E6I A;  5ELC A;  3K0Y A;  3AFQ A;  5CMD A;  3HOY H;  1SYE A;  4IFD I;  3GD7 A;  2IX0 A;  1C0A A;  1FNU A;  3F1Z A;  2V1C C;  3T1Y L;  4CDF C;  3HOU G;  1MBY A;  1RF2 D;  3K57 A;  4CDE C;  5JJI A;  1HXY D;  3S14 B;  1UEA B;  1WFQ A;  4A3I H;  2ZTD A;  1NR2 A;  4C1N I;  4LW1 A;  5M3F H;  1MJC A;  4CGY B;  3IFD A;  3D31 A;  1X65 A;  1I94 Q;  5E4X A;  1FJG Q;  4X3U A;  2R7Z H;  5IYC H;  1PH2 A;  2UXB L;  3E0J A;  3NHH A;  3D0F A;  1B9N A;  1KRT A;  5FO9 B;  1L1O C;  2HT1 A;  3M4O B;  5COY A;  4X3K A;  3J7A 5;  3MAQ A;  2PPB C;  4JOI C;  1YIT A;  5EPJ A;  4JI3 Q;  5M3M H;  5EPL A;  1Y1V H;  3ICE A;  3S17 B;  1HFG A;  5E7N A;  1YNX A;  1ILQ A;  4KV6 A;  3CXC A;  4BWG B;  1B2T A;  3K7A H;  2XWB B;  2VQE Q;  4R4I A;  5CV4 A;  2ZJR A;  4DV7 L;  4CKB A;  5ELF A;  3GTK B;  1Z7T A;  1EY7 A;  2K75 A;  4B3M L;  3VR5 A;  2DN8 A;  1Q46 A;  3UI2 A;  4JI4 Q;  3G6J B;  5BN3 A;  3T51 B;  1R9T B;  2IJ0 A;  1XYI A;  4BY1 H;  4NXM L;  1JOQ A;  1PH8 A;  3G6E A;  2KOL A;  1S4Z A;  5C44 H;  4JI8 Q;  1H9S A;  1M1K C;  2HHH L;  1Q86 C;  4DAV A;  3SK5 A;  1YNJ C;  3A7L A;  3DEP A;  2VXW A;  3JAM L;  1O7Y A;  4AH6 A;  2CFM A;  4R4O A;  3OIQ A;  3VYU A;  1BNZ A;  5KNB A;  1ENA A;  2WII B;  1OO9 B;  4DR4 Q;  2HCC A;  3S14 H;  2WAC A;  4A3E G;  4POG A;  2EJM A;  1K3R A;  1G91 A;  5ELB A;  4ZLT F;  2M2L A;  5KEE A;  1Q82 C;  1VQK A;  4HED A;  2JQO A;  3L7Z C;  4GKJ L;  1G6Z A;  4J1M A;  3RZO B;  2RHQ B;  3K81 C;  3TZU A;  2NYZ D;  1EUJ A;  2R93 H;  3EJI A;  3RN5 A;  2PZT A;  3QOJ A;  3M4O H;  4A93 H;  2L55 A;  2H1E A;  2XRS D;  2F0L A;  3J80 i;  4JW0 A;  4LUO A;  3PIO 3;  4B3T Q;  4BY7 G;  4DV3 Q;  3GTO H;  1SXT A;  1B7Y B;  1LUZ A;  4EQ5 A;  3S9W A;  2KEC A;  3VA5 A;  4LF8 L;  1X3E A;  1VQH A;  3CME A;  4CHT B;  2O2L D;  4J8Q A;  2N3S A;  1NTG A;  3GTP B;  4JI1 Q;  4UAI A;  2X69 A;  3BJU A;  1LTA D;  4OX9 Q;  3T4A C;  1MD2 D;  1PH6 A;  1U5K A;  1JMC A;  3U9S A;  5JPN C;  4HR7 B;  1Y1W B;  4LMQ D;  4RHR A;  1LT5 D;  2O4X A;  1UEB A;  1NR4 A;  5AJ3 Q;  2PI2 A;  1IW7 D;  1SJE D;  4XYO A;  3BDO A;  2KCC A;  4K8I A;  2JJQ A;  1B1Z A;  3J80 c;  2FFK B;  3KYH C;  1KQS A;  2AUK A;  2VS1 A;  2JA6 B;  3HOV B;  2WKD A;  3IFT A;  4XQN A;  3SGI A;  2D62 A;  3I90 A;  3JC6 6;  1WTR A;  4YIJ A;  4XQQ A;  5EPK A;  4YWK A;  1SFO B;  2J7Z A;  2LKV A;  3GTL H;  4TKO B;  4JI2 Q;  3GV6 A;  4IUT A;  4K2L A;  4MTK A;  1PTO D;  4LWC A;  4J15 A;  4FF3 A;  1LTL A;  1TR5 A;  4CDC C;  3MEH A;  4B9X A;  4GS3 A;  3G4S A;  3DM3 A;  2XGT A;  1C7Y A;  2NBF A;  2NZ1 D;  1B44 D;  3ERO A;  2PMZ E;  3J80 L;  1HFN A;  1PH1 A;  2IPK D;  3J81 j;  3RN2 A;  4G7H C;  5EKI A;  2UUC L;  3KFU A;  3V2T A;  3T1Y Q;  3R2T A;  2K01 A;  1SNP A;  1SE2 A;  3H15 A;  3GTP H;  3CCU A;  3FMC A;  1W6J A;  5IYD G;  1EYD A;  2UXB Q;  4KLK A;  2XTI A;  1J6Q A;  1PRT B;  3S16 B;  1KAA A;  2CVR A;  1TY0 A;  2F4V L;  2PCF B;  3TP6 A;  1A6X A;  5ISR A;  1XXG A;  1XPR A;  3PUV A;  4NW2 A;  2K5D A;  1VQ8 A;  3BVM A;  2PZU A;  3P1H A;  4IUU A;  1EQV A;  4DK3 C;  3S1Q H;  3ITP A;  3MWY W;  3SVM A;  3NBH B;  1CKN A;  1J5E L;  1EOT A;  2B39 A;  4IUP A;  4YCW A;  3I4M B;  3ULL A;  1TWH H;  2KHS A;  3DEO A;  3CW2 C;  1VQC A;  2A73 B;  1SDF A;  1VQE A;  4DV7 Q;  4I7A A;  1SFO H;  1B9M A;  1PFN A;  5C0X I;  1VS0 A;  4B3M Q;  2GN5 A;  3CKI B;  4R4C A;  5ELO A;  4HTH A;  1YEZ A;  5FO7 B;  1BOS A;  3CMA A;  2KJX A;  2YTV A;  3TP7 A;  4NXM Q;  2B63 G;  4RG1 A;  4BY7 H;  3OW7 A;  1EIH A;  4HIK A;  1K9M C;  4KI0 A;  1F2M A;  4BS9 A;  4OEL B;  4N8X 1;  1F9P A;  1RIP A;  1QUQ B;  5KYI A;  1GUS A;  3K5O A;  4DAY A;  5FOB B;  1B3A A;  4GLV B;  1STH A;  5CYU A;  1VQO A;  5C4X B;  3D4W A;  5CC4 A;  1XWE A;  1K8M A;  3NPP A;  4K5X A;  2OEO A;  4EX5 A;  4A3J B;  1PA6 A;  5BN4 A;  4A3F B;  2OCE A;  1WTX A;  2EQS A;  1S3O A;  1WCM B;  3H3V H;  3P75 A;  4GKJ Q;  2Y0S B;  1FVI A;  4QY7 A;  2VL6 A;  4C3H G;  1N33 L;  3SHL A;  4JI5 L;  2Q8T A;  4ABN A;  1D1I A;  5CBA E;  2PW5 A;  3RNU A;  2JYO A;  1I3Q B;  2JA7 H;  1ENC A;  2IHE A;  4LF4 L;  5JAV A;  1VDZ A;  1TQO A;  3UDF A;  3PUX A;  3GV3 A;  2NZO A;  3I4M H;  1X3P A;  5G3L F;  1EWC A;  1DZ1 A;  4PZ7 A;  1EY8 A;  3OWF A;  4LF8 Q;  2RQX A;  2BA0 A;  2CQA A;  4K5V A;  2M9V A;  1F9S A;  2IHF A;  4R4T A;  3GTG H;  4C3J B;  3GTQ B;  4HJ9 A;  3N52 A;  3K80 C;  1TWC B;  5IGC A;  3C1E A;  2QCP X;  1EYG A;  2ID0 A;  2I46 A;  2KCM A;  3RZD B;  4UHV A;  5LMN Q;  1HRJ A;  4NB3 A;  4GN4 B;  3F2D A;  1M4V A;  4GOP C;  4IPD A;  1R4P B;  4XDX A;  1WTW A;  3CC4 A;  3D3R A;  2GVA A;  1SE4 A;  1FGB D;  3KF6 A;  3CC2 A;  2DJF C;  1HNX L;  2F0T A;  1QCB D;  2D2C C;  3L3O C;  2VUM B;  3ND8 A;  2E2J B;  4KN7 C;  4F8M A;  3R93 A;  3M4P A;  1CT1 D;  1CQV A;  1DCZ A;  4DUZ L;  4HIO A;  5CGK A;  3CCE A;  1BUV T;  4A3F H;  1BF4 A;  5A2Q L;  2K5W A;  1A3U A;  2K03 A;  3GDE A;  1KAB A;  1B8A A;  3Q24 A;  5JVH 3;  3FDT A;  2F0D A;  2SOB A;  5HGQ A;  4C1N K;  3ERQ A;  2B3G A;  4AQY L;  3I4N B;  1YZ6 A;  4PMC A;  4TQU S;  4IO9 A;  1N34 L;  4C3I G;  2F0J A;  2QIL A;  2E76 C;  3UE0 A;  3UDG A;  1LTS D;  2F0W A;  2LY7 A;  1PFM A;  3OPO A;  2UUC Q;  4JV5 L;  1AZQ A;  1SYC A;  4LFC L;  2MNA A;  2QEX A;  1G2S A;  2HDM A;  4KK7 A;  2K28 A;  5I2X A;  2B2W A;  3KLW A;  1MJE A;  1U4R A;  3GTQ H;  1LTR D;  2Q2H A;  1TWC H;  2EYO A;  3CHB D;  1CM9 A;  4DN4 M;  4TSS A;  1C9O A;  3D6C A;  1RDP D;  4OHJ A;  4ODG A;  1K83 B;  2E2I H;  3RZD H;  2F4V Q;  3CCM A;  4IOC A;  2WKC A;  2RF4 A;  1H9J A;  1I6H H;  4R8N A;  3OWE B;  5FLM G;  4N8F A;  2NZH A;  3ZJY C;  4HJA A;  1O78 A;  2ATW A;  3VR4 A;  1J5E Q;  2VQF L;  5J39 A;  3TS0 A;  3Q23 A;  1OXU A;  2A19 A;  2K14 A;  3EIV A;  2ALY B;  2E2D C;  2HDL A;  4Y7N H;  2K04 A;  3SR1 A;  1K8O A;  1O7Z A;  4IPG A;  1HA5 A;  4CBV A;  4A3G H;  4BBR B;  1V1O A;  1JQY D;  5IWA L;  3E0E A;  4H0L C;  3HOY G;  1EQR A;  3A55 A;  4C3H H;  1GUO A;  2C5C A;  2F0F A;  3ER0 A;  3HKZ E;  4GNX B;  2F0U A;  1U4L A;  5GAE C;  3VA7 A;  3E6Z X;  2ICE C;  2A68 C;  3G48 A;  3PUZ A;  4A3B B;  4X6A H;  1NNX A;  1PYS B;  3CCR A;  3A8J E;  1VQ5 A;  3I4N H;  2DNE A;  5M5W H;  4A3I G;  3ONA B;  3T1H L;  1SEB D;  1RJT A;  2R7Z G;  3TBI B;  1ASZ A;  4LF9 L;  2I5H A;  5IYC G;  3HOZ B;  2F1M A;  2WB1 B;  3H0G G;  4IUN A;  1AE2 A;  1FR3 A;  2IW3 A;  5J1Z A;  4X3S A;  1HJP A;  2AQ1 B;  4P74 A;  5IT9 c;  3GTJ B;  2JA9 A;  3PIP 3;  1WYD A;  2TMP A;  5M3M G;  1A2T A;  1JCK B;  3PO2 B;  1I4R A;  1Y1V G;  2F3W A;  3FRP B;  3IRB A;  3WOF A;  1N33 Q;  1SR3 A;  4JI5 Q;  1HHV A;  1HZC A;  2F0E A;  1YHB A;  3NXW A;  3I70 A;  4LF4 Q;  1ET6 A;  1SBB B;  4NDX A;  1AFP A;  1HQR D;  2HCI A;  2IX3 A;  4AYB E;  2E75 C;  1X9N A;  4S3S A;  4R9W A;  2OTJ A;  2F0O A;  4L5Q A;  4ZKC B;  4OWX B;  2HIV A;  4EQP A;  5DLQ E;  2NN6 H;  2L1B A;  4DR1 L;  3LWE A;  2R6G A;  2IL8 A;  1VMC A;  2YV5 A;  2F03 A;  2B2T A;  1ICF B;  2K4K A;  1PFS A;  5LMN W;  1SNQ A;  2WV6 D;  1VQ7 A;  4R1J A;  1U4P A;  2O5I C;  1LLR D;  1EY0 A;  1QVF A;  4B3R L;  2K52 A;  2RSO A;  4ZQ3 A;  1H9K A;  1L1O B;  4LNQ A;  3F2U A;  4X62 L;  2AHO B;  2Q8I B;  4A3C H;  1HNX Q;  2OT2 A;  3QJY A;  3PGZ A;  4DF7 A;  3V05 A;  3HOZ H;  2B2V A;  1BCP C;  3GTM H;  4DUZ Q;  1DD2 A;  4B08 A;  1LTB D;  4R8I A;  2OTL A;  2I5L X;  4A93 G;  4WOR A;  5LMU L;  2K7V A;  2EXD A;  1S5E D;  3PO2 H;  1B50 A;  2ZJP A;  1LAB A;  1Z47 A;  4PZ6 A;  4BBS B;  3JAM E;  5FLM H;  2JA5 B;  2ZXR A;  4A3M B;  1MIU A;  4AQY Q;  1VQG A;  4BA2 I;  2NVY B;  1JR0 D;  2Z6B A;  1N34 Q;  4XIG S;  4L8J A;  1P16 A;  2L12 A;  1STG A;  4CJ0 B;  4JV5 Q;  2A69 C;  5IOC A;  4LFC Q;  3J7Z C;  3A8K E;  4DK6 C;  3NE5 B;  4HSP A;  1JB3 A;  1A62 A;  5IYB H;  2E8G A;  3QO2 A;  4DUY Q;  4LAA A;  4Q0F A;  1SNO A;  5M5X B;  2FMC A;  2I0Q A;  1GUG A;  1PTO C;  1IBL L;  1MHW C;  4CJ2 C;  3Q22 A;  1GM5 A;  2WP8 J;  2UXD L;  2VNU D;  1TKW B;  5J22 A;  3STB D;  4ZUJ A;  3J81 i;  4WJ3 M;  3RR5 A;  3A5Z B;  3QWN A;  3H0G H;  2NTS A;  2A68 D;  3CQZ H;  2B2U C;  1HCZ A;  3U9O A;  2B2Y A;  3S2D H;  4JI0 Q;  3C46 A;  2D9U A;  2N8N A;  1XMO L;  3OTO L;  1OXS C;  4PNY A;  2F0N A;  2R3Z A;  2ZTC A;  4A3K B;  2JP1 A;  3NBH A;  3TN2 A;  2EY2 A;  4LUV A;  4DR2 L;  1PYW D;  1I4X A;  3M9B A;  5DEH A;  5M5Y H;  1CFM A;  1OXV A;  2JA8 B;  4KHP L;  2NVQ B;  3SEB A;  4QUF A;  2JA5 H;  4A3M H;  1E2W A;  1X3Q A;  1VQF A;  2SDF A;  4DR6 L;  3S1R B;  2NVY H;  1QG7 A;  3CCS A;  5COR A;  3T1H Q;  3C1F A;  3J81 c;  3W5O A;  1QB5 D;  4DA2 A;  1I4G A;  5I2Y A;  1EY4 A;  3I3C A;  2Z6K C;  5EBD A;  3HG9 A;  5C3E B;  4GLA C;  2ZT9 C;  1Y1W G;  2EYJ A;  1BQQ T;  4K2K A;  3PF5 A;  1C4Q A;  2E5L L;  1Q8I A;  1QUQ A;  2WIN B;  4LF5 L;  5M5X H;  1E1O A;  4P75 A;  1EFI D;  2M00 A;  1EQT A;  5CV5 A;  2DNC A;  4H44 C;  4I7Z C;  1O7I A;  2JA6 G;  2LS0 1;  5C4J B;  3HOV G;  3X3N A;  3H3V I;  4C2M B;  2ICI A;  5GAD C;  2N49 A;  1T9H A;  3J81 L;  2RCF A;  1JJC B;  1HUN A;  2A6E C;  3DWA A;  3B6Y A;  2D0O A;  2XN9 C;  1BBU A;  3AB9 A;  2YU9 B;  3FP9 A;  3L9A X;  2UUB L;  2MFI A;  2L9H A;  1HZ9 A;  4DR1 Q;  4QB4 A;  3UE1 A;  3P7J A;  2ZXO A;  4G57 A;  4RGO S;  3S17 H;  2BH8 A;  1DOL A;  1JWM D;  4P72 A;  4LFA L;  3I91 A;  2CW0 C;  2KEE A;  4HJ7 A;  1SE8 A;  2NVQ H;  1BCP D;  1S5C D;  5EGT A;  4P2C B;  1YNN C;  4FF4 A;  3AEV A;  3GTK H;  1VQA A;  2XNA C;  3NP8 A;  4X62 Q;  1VQ9 A;  4CKE A;  1TS2 A;  1UNS A;  1R9T H;  3K5M A;  1F9Q A;  1EQQ A;  1Q7Y C;  1WI5 A;  1MSG A;  4ILW A;  1PYB A;  2CWP A;  1OTC A;  1TWF B;  4FDB A;  1PH9 A;  4IN3 A;  5JOB A;  2JA7 G;  1JWS D;  5LMU Q;  1ML0 D;  2OXP A;  1Y14 B;  1JC7 A;  2A69 D;  4IUQ A;  3TRZ A;  3S2H B;  1H9R A;  3I73 A;  4LF6 L;  1HQM C;  4FF1 A;  2O5J C;  3RLF A;  1HZB A;  3I4M G;  1SYB A;  1W3S A;  4MHE A;  1GKH A;  3KJP A;  1KNE A;  4PMW A;  3TQY A;  5JEA H;  1LM0 A;  3DM1 A;  1EU4 A;  3CCJ A;  1KD1 C;  3RZO H;  3NEL A;  2AQ2 B;  4X65 L;  5FK9 C;  3CF5 A;  2YU9 H;  1FNW A;  2DGY A;  1EY6 A;  2EOT A;  1CTM A;  4WRD A;  1BKB A;  1XMQ L;  4HSV A;  1IKL A;  3HRZ C;  1IBK L;  5IP7 H;  4KKU A;  4ZCK A;  1BXT A;  2PI2 E;  4B9W A;  4JPB W;  4G7Z C;  5FLX E;  1V8Q A;  1X55 A;  2CWA A;  1ONL A;  3L2P A;  4M8A A;  1IBL Q;  4O42 A;  2KBN A;  2AWO A;  1TY2 A;  4DV5 L;  2UXD Q;  2A74 C;  2PNR C;  2KVM A;  3OHX C;  5IP9 H;  1I4Q A;  1RHP A;  3RLN A;  1TU2 B;  4IUV A;  1SND A;  3M4Q A;  5I4D A;  1EWI A;  4A3F G;  3W1B A;  4IFD H;  4ZUI A;  1FGU A;  4QCL A;  1WCM G;  5LL6 X;  3PV0 A;  1Y1W H;  4JK1 C;  2C9O A;  2F52 A;  1XMO Q;  1QOH A;  3FHW A;  1L2F A;  3OTO Q;  3PO3 B;  1BR9 A;  2IT1 A;  1X56 A;  3AFP A;  3QIA A;  3J7A F;  3QG1 A;  4DR2 Q;  3CRK C;  2CKZ B;  2ES2 A;  4DKA C;  5IGD A;  2JA6 H;  3HOV H;  2VY3 A;  3BZD B;  1E2V A;  5EBC A;  1E0B A;  2TSS A;  4V0B A;  4QQB X;  1DOM A;  3ERS X;  4DR6 Q;  2EE1 A;  1D2B A;  1TXY A;  4DNR B;  3KBG A;  4GNX A;  4C3J G;  4GOP B;  3HOW B;  1DYQ A;  3K8A A;  5A2Q E;  2HHH Q;  1QE6 A;  5JJZ A;  1JE5 A;  1GHJ A;  1K0R A;  3A7A B;  3VYR A;  1CKM A;  1Z6H A;  3C2P A;  3M85 A;  4M1U B;  1B4O A;  1XPU A;  4FO2 A;  4QJF A;  1UE1 A;  1MKH A;  2EIF A;  1ZEQ X;  2A6E D;  1I6V C;  4EVO A;  4HIM A;  2E5L Q;  3HZX A;  4LF5 Q;  3FKI B;  1LTT D;  5EJW A;  2QF7 A;  1JJG A;  4K6L A;  4WFN 3;  2VUM G;  2BDN A;  1KDA A;  1C8C A;  4JYA L;  1KIX A;  4Q5V A;  2N88 A;  4A3G G;  4L5S A;  3OOC A;  2CW0 D;  1SJH D;  5KIX A;  1WTP A;  4G7O C;  3S16 H;  3FPU B;  2RA4 A;  3NWT A;  1UWV A;  2KA7 A;  1KDB A;  2XRQ D;  2L15 A;  4TVA B;  1YNN D;  2UUB Q;  1GOZ A;  3AU7 A;  3G71 A;  5I6W A;  1A3T A;  2D5D A;  3Q6S A;  4NPS A;  3I4N G;  3PO3 H;  1PRT F;  1SNC A;  4IAL A;  4PZ8 A;  2MUY A;  1VQM A;  1V1P B;  5ELD A;  1FYC A;  1GO3 E;  2QDB A;  4X66 L;  2Z4H A;  1AP0 A;  5BR8 L;  1A15 A;  3W1G A;  1NBW A;  4HN7 A;  3IKJ A;  3H3V C;  1IBM L;  3BZC A;  5LHY 1;  1AEX A;  3CD6 A;  4O2D A;  3PUW A;  1QZH A;  1CSP A;  1S5F D;  3HOW H;  1LAC A;  1JOO A;  1CZW A;  3T16 A;  2KCT A;  3DXJ C;  4OIK A;  1V1Q A;  1Y8N B;  2QKI C;  1CI3 M;  4QIW E;  1SSO A;  2F4I A;  3LGJ A;  1PLF A;  1YHQ A;  4A3L G;  5GQO A;  3F8T A;  1L1O A;  1LYL A;  1OXX K;  4JOI A;  3I8Z A;  1TWG B;  1VMP A;  2B63 B;  1PZJ D;  3F2C A;  4LF6 Q;  5C4X H;  1VF5 C;  5KGU A;  4PQX A;  3NTI A;  3MXG A;  2F0M A;  4ZYS A;  1QNK A;  4ID6 A;  4A3J H;  5D3I B;  1SRO A;  3TP5 A;  4F88 A;  3RD4 A;  3HOX B;  2NN6 G;  3KUP A;  4DPG A;  2PMZ B;  4NXN L;  4EQO A;  2NTT A;  3TDQ A;  1YJW A;  2Q2U A;  1WCM H;  1AN8 A;  4XTC S;  4V19 0;  4LK1 C;  1X54 A;  4X65 Q;  3ND9 A;  3PIO A;  2VB2 X;  3K0X A;  1I3Q H;  1RD9 D;  1QIL A;  3VDY A;  2C35 B;  4DAM A;  4KY6 A;  1XMQ Q;  1IBK Q;  1SRU A;  2VZA A;  1JB7 A;  3FEW X;  1YJ9 A;  3SK8 A;  1LT6 D;  3R3O A;  4CKC A;  1A2U A;  2OWO A;  3KDF B;  1EOV A;  3QR8 A;  3FVQ A;  1I50 B;  4A3C G;  2P5Z X;  4RMF A;  1LTI D;  1Y8O B;  1DM0 B;  1EZ8 A;  2VB3 X;  3VR2 A;  3HOZ G;  4RHS A;  4K0K L;  4DV5 Q;  2WB1 G;  4C3J H;  1LTG D;  3P20 A;  1U0L A;  5H1S E;  2A6H C;  3BU2 A;  2LMC B;  3U4V A;  4PG3 A;  3W3A A;  1HZA A;  4XT1 B;  2R92 B;  1KRS A;  3I56 A;  3PO2 G;  1IZ6 A;  1STY A;  3DMU A;  4GZY C;  3S24 A;  2LSS A;  1V9P A;  3I2Z A;  2WAQ B;  1VQI A;  1IYV A;  1KL9 A;  3T53 B;  1HNZ L;  2PQE A;  2JK8 A;  4L6T B;  5CV6 A;  1CKO A;  4EGV A;  1TWG H;  3H91 A;  3URY A;  3EVQ A;  4U67 3;  2EPB A;  1FD7 D;  1MGS A;  3DWP A;  2VUM H;  4KHV A;  2E2J H;  1HNW L;  1G2T A;  2FJ2 A;  1UE7 A;  2OF1 A;  3HOX H;  2F0I A;  3STB C;  1QWY A;  4GN5 A;  3HP3 A;  1FJG L;  5IYB G;  5GAH C;  3GO5 A;  2R61 A;  1U9R A;  3SXH A;  3J7Y W;  2K50 A;  3BVG A;  1ZKO A;  4A3D B;  2MPM A;  2EYM A;  3BG3 A;  3KJO A;  1SMX A;  1LT3 D;  5FKA C;  2K5H A;  1BCP B;  2SNM A;  1HTP A;  1MI2 A;  5JJL A;  3A74 A;  2Z8L A;  2AWN A;  1IL2 A;  2HQL A;  2IX1 A;  1E1T A;  5EKK A;  4JI7 L;  4KD4 A;  2VQE L;  2J0T D;  1EYA A;  3C3L A;  4L63 B;  4JYA Q;  4KKT A;  1KDC A;  2JEB I;  1L0Y B;  4GLX A;  3KLS X;  3A54 A;  3H94 A;  4IQZ A;  4GN3 B;  1VQD A;  4QF4 A;  3ULP A;  2NVT H;  4A3L H;  1K83 H;  5DAU A;  2R92 H;  1PFB A;  4QUC A;  4TRD A;  1EFW A;  1SYG A;  4POF A;  3M7N A;  3MTS A;  2KHI A;  2JA5 G;  4A3M G;  4PMB A;  1CHP D;  4NMZ A;  3KBX A;  1PVO A;  4JCV E;  4ALP A;  1PMR A;  5G3L D;  2FXQ A;  1YI2 A;  1E2Z A;  3K6O A;  1N36 L;  4O1N A;  2RVL A;  5BN5 A;  1D8L A;  3S15 B;  4KY7 A;  1D5Z C;  1CA6 A;  2F0V A;  4X66 Q;  4YWM A;  5IT9 L;  5BR8 Q;  4DR4 L;  2EZV A;  1XTD A;  1PTO B;  4BBR H;  2BE5 C;  3K5N A;  1IBM Q;  3A8I E;  1U4M A;  5K36 G;  2HIX A;  1JE4 A;  2GVB A;  5IE8 A;  4A3B H;  2EYP A;  3EBE A;  2PZW A;  2NVX B;  1T5E A;  2HQE A;  1CHQ D;  2FHT A;  3HOY B;  2JN4 A;  1IYJ B;  1G29 1;  3HS0 C;  4DV3 L;  1NY4 A;  1Q8K A;  2AKW B;  2QGQ A;  1D5X C;  5LL6 S;  4H13 C;  2F0P A;  2EDG A;  3TP8 A;  3EFX D;  2K05 A;  3AYH B;  5C5M A;  2JSO A;  1JIC A;  5C5L A;  4NP5 A;  1RTN A;  5M3F B;  3LNN A;  2G9H D;  3GTJ H;  3T56 B;  1K8A C;  3BZK A;  1B70 B;  5TSS A;  1DJR D;  4A3K G;  4ZK9 B;  3DWQ A;  5L37 A;  3PSI A;  1O7L A;  2J4X A;  3F2B A;  2RHS B;  3NBI A;  1X6O A;  3RMH A;  5I6Y A;  2JA8 G;  4OON A;  5FO8 B;  4B3S L;  1LO5 D;  2NWG A;  3PF4 A;  1SYD A;  5M3M B;  1KNA A;  3KF8 B;  1F77 A;  1X3G A;  1Y1V B;  1VF7 A;  1Q1B A;  2EXZ A;  1ROD A;  1STB A;  3HKS A;  1SE3 A;  2A6H D;  1WTV A;  3L0O A;  3M3Y B;  2NVT B;  2G9D A;  5CV9 A;  3S15 H;  2F0S A;  5FJ8 H;  3O13 A;  1H9M A;  1EIF A;  1KXL A;  1PTO H;  3LWU A;  1M90 C;  4K0K Q;  1EZ6 A;  4CJ1 B;  1GVP A;  1HUM A;  2CH4 A;  5T1I A;  5EAY A;  3D6W A;  2Q2I A;  5C3E G;  1L0X B;  3TRE A;  3PUY A;  5JPM C;  2BH2 A;  1QZG A;  2XSC A;  1K8G A;  3NTH A;  4BY1 B;  3BVZ A;  5C44 B;  2PQA B;  3E9H A;  1IHZ A;  1Y8P B;  2I07 B;  2DJG C;  1R4Q B;  3OIP A;  4DXF A;  4BXX H;  1EU3 A;  3BYY B;  1NCV A;  3CPF A;  1HNZ Q;  3JAM i;  4H7B A;  3OMC A;  3HKZ B;  3S1M B;  3VR3 A;  2VQF Q;  3NWS A;  1EIY B;  1NSN S;  5JEA G;  1ILP A;  1QJO A;  5KYL A;  5D14 A;  1I5F A;  3HGB A;  3CCL A;  1TWA B;  3X3M A;  1PH4 A;  3K5L A;  3S1N B;  5E3F A;  1HNW Q;  5IGE A;  2FIN B;  1J8I A;  3I55 A;  4WJ4 A;  5ELN A;  5IWA Q;  4RGT A;  5IY0 A;  4KJN A;  3PMF A;  4FVM A;  5C6A A;  5IP7 G;  4HAE A;  4BBS H;  1JJ2 A;  3U58 A;  2R93 B;  3U50 C;  3WDN A;  5K5P A;  1GJX A;  1S5B D;  4DR7 L;  4JBW A;  1Y69 U;  4A93 B;  5KNC A;  2A8V A;  1VQJ A;  1SNM A;  4Y52 H;  4L5R C;  1CK1 A;  3HEJ A;  1B53 A;  2MO0 A;  5C4Z A;  5IP9 G;  4GOP A;  3GTO B;  3ULJ A;  4RH6 A;  1I4H A;  3M3Y H;  4LF9 Q;  3JAM c; 
#chains in the Genus database with same CATH homology
 1V43 A;  3VYS A;  1II3 A;  1WD1 A;  4IFD G;  2BA1 A;  4ME5 A;  1J9O A;  2EYL A;  5K36 H;  2KED A;  1ZXT A;  3Q0A A;  4LJZ C;  4AYB B;  3OSO A;  2KUM A;  3J80 E;  1X32 A;  4KHZ A;  1CZG A;  2RDF A;  2PYK A;  2BE5 D;  1S5D D;  3HOU B;  2RSN A;  2PW7 A;  3TSS A;  1BBX C;  4OL7 A;  5D3D A;  4DNT B;  2B2W C;  1TVX A;  4Z9C B;  4KTA A;  2JE6 I;  1D5M C;  1EWH A;  5ELE A;  1G8Z D;  3GTL B;  1ZYR C;  1V1P A;  2L0C A;  2AQ3 B;  2Z4I A;  3NTK A;  2DY7 A;  2GA4 B;  4DU9 A;  1EY5 A;  4OO1 H;  3M7G A;  2F3V A;  2E2H B;  3I72 A;  2JEA I;  2K1B A;  3MFY A;  5T1G A;  4XXE A;  3VYT A;  2SEB D;  2BDO A;  1JOR A;  4XQJ A;  4RGN A;  4FXD A;  4FYD A;  2NB0 A;  1UAP A;  4DGZ A;  1M8A A;  3KK7 A;  3EQL C;  3MHB A;  2BOS A;  2EJG C;  3NUC A;  1GUW A;  3BYT B;  5F2D A;  5CR3 A;  1JOK A;  2SNS A;  1NUC A;  1TS5 A;  3MXU A;  1RKN A;  3S1Q B;  1A3V A;  3J7A V;  5E1F A;  4IZ8 A;  1LT4 D;  1ICW A;  1PDQ A;  1TWH B;  4A3E B;  1CQF A;  3EA6 A;  2BCO A;  2NUC A;  3MFG A;  4K8J A;  2F0G A;  3N6R A;  1EEI D;  3QOL A;  3SK6 A;  4RAU C;  4DAP A;  2FMM A;  3IAY A;  1XTC D;  5CV8 A;  3KLR A;  2EY1 A;  4BY7 B;  2PO4 A;  1D6E C;  1TS3 A;  2ENB A;  3K59 A;  4QMG A;  1ESR A;  1EY9 A;  3D8G A;  2Q8R E;  1MSH A;  4DK0 A;  2MJ8 A;  2B2T C;  1RCV D;  3BS1 A;  1Q1E A;  2YYZ A;  3R8B A;  4XYQ A;  2L5T A;  2N55 A;  2RKS A;  5JVG 3;  3BDC A;  2MHV A;  3SDZ A;  3NK9 A;  3H09 A;  4ZAI A;  1UUP A;  5DNF A;  5JEA J;  5I9P A;  1QNU A;  1PXU A;  2ZXP A;  2JA7 B;  5DM7 3;  1PZK D;  4XT3 B;  1IYU A;  2IWH A;  4BA1 I;  5C3W A;  3NQT A;  1OXT A;  2B2V C;  3W2D A;  1BO0 A;  3E5S A;  2RBM A;  5KRU A;  4HCS A;  3GTG B;  1GUT A;  1DOK A;  1YNJ D;  2MP1 A;  5NUC A;  5HGT A;  4ZRZ A;  2F0H A;  2RDH A;  1ET9 A;  4K14 A;  3QB3 A;  1H9S B;  1KTK A;  1KLG D;  4IFD J;  4I65 A;  3MA2 B;  3D4D A;  2L4N A;  1SYF A;  1F2Y A;  1XX8 A;  4FF2 A;  1ZYR D;  2X6L A;  1T5X D;  2K33 A;  4KD3 A;  1GXD C;  4DXG A;  1TT2 A;  2HUG A;  4G4K A;  4FP5 D;  5C3X A;  1C48 A;  2NN6 I;  1F2L A;  1WTO A;  3MVV A;  1GUN A;  4KN4 C;  1HA6 A;  4WJW A;  5C0X G;  4PV1 C;  1PRT C;  2E74 C;  5FLX L;  3CU7 A;  2B8F A;  3NSW A;  4UDU C;  1TS4 A;  2B2Y C;  1ENF A;  4RCO A;  2B2U A;  3LX0 A;  3A56 A;  1EIG A;  3MXP A;  1Q12 A;  4J6H A;  3D4R A;  2E2I B;  4ULL A;  2JXM B;  1I6H B;  4HMI A;  4RA8 A;  5IGF A;  2RDG A;  4X3T A;  3SE0 A;  5IGB A;  4Y7N B;  2A5H A;  1ESF A;  1I4P A;  1Q3L A;  4KY5 A;  4A3G B;  3H6M A;  3KF8 A;  2EVB A;  1WTQ A;  4C3H B;  1IKM A;  1LV9 A;  2CHB D;  3BDL A;  1Q90 A;  2K32 A;  4C56 C;  5M5W B;  5I9O A;  4NKL A;  3GP7 A;  3K58 A;  3TME A;  5IT9 E;  1SMY C;  2DY8 A;  2LFN A;  4RWS C;  2H4O A;  5E4W C;  1O80 A;  3DUZ A;  5EKL A;  4ZKB B;  2K5Q A;  5IIF A;  4RFB A;  1JWU D;  3WOE A;  5D65 A;  3KLS A;  1EYC A;  4RKB A;  4FNF A;  3RUZ A;  1W6K A;  1SAP A;  4N9T A;  1BDO A;  3T13 A;  1WVL A;  2MGS A;  4RCN A;  2Z1C A;  2K6A A;  3OMG A;  2EYF A;  3V96 A;  5C4H A;  2EY6 A;  5EQ0 A;  1DXM A;  3DHQ A;  3I4L A;  5HUR A;  3MC0 B;  2EY5 A;  1EL0 A;  5C0X H;  1D1K A;  2KCN A;  4K5W A;  4F7X A;  4F87 A;  4C3I B;  1F2Z A;  2XIW A;  4N9P A;  2QEJ C;  5A35 A;  3GTM B;  4U68 A;  3SK4 A;  1PRT D;  4MN3 A;  1CA5 A;  2X6G A;  5DM6 3;  1AW7 A;  2L11 A;  4RGM A;  1WD0 A;  1HTL D;  4IUR A;  4QIW B;  3CRL C;  4OIJ A;  2EJF C;  4DK1 A;  3R2I A;  2V4D A;  1GHK A;  4MIU A;  4KKS A;  5IGG A;  5KND A;  1F9R A;  1HPC A;  1DON A;  4OO1 I;  1FNV A;  1AZP A;  2F0Q A;  2KQ3 A;  3ZYY X;  3G7L A;  5AFW A;  1STA A;  2B8G A;  2AUJ D;  5C0X J;  4KJO A;  3VR6 A;  4EQN A;  4DFA A;  4HCE A;  4A3I B;  1VCI A;  5IOD A;  1BCP F;  1STE A;  4RKL A;  1EEF D;  2R7Z B;  1STN A;  2F0K A;  3FPP A;  4K6D A;  4FXG C;  3H0G B;  3CQZ B;  5CV7 A;  3GQB A;  5CBE E;  3S2D B;  1NAP A;  3IL8 A;  3MXN A;  3NQI A;  2XWJ B;  4OO1 G;  1SMY D;  3M4Y A;  1RTO A;  5M5Y B;  1PZI D;  3J81 E;  3K7A B;  3AMU A;  4FXK C;  3MZ5 A;  2EYH A;  1TII D;  1KLU D;  2XVS A;  3TZD A;  4HMJ A;  1IW7 C;  5M9O A;  4OGQ C;  4KMU C;  1IL8 A;  1PTO F;  4E6I A;  5ELC A;  3K0Y A;  5CMD A;  1SYE A;  4IFD I;  3GD7 A;  2IX0 A;  1FNU A;  1MBY A;  1RF2 D;  3K57 A;  1HXY D;  3S14 B;  1UEA B;  1NR2 A;  4C1N I;  4CGY B;  3IFD A;  3D31 A;  5E4X A;  4X3U A;  3E0J A;  3NHH A;  1B9N A;  5FO9 B;  3M4O B;  5COY A;  4X3K A;  3MAQ A;  2PPB C;  5EPJ A;  5EPL A;  3S17 B;  1HFG A;  1ILQ A;  4KV6 A;  4BWG B;  1B2T A;  2XWB B;  5CV4 A;  4CKB A;  5ELF A;  3GTK B;  1Z7T A;  1EY7 A;  3VR5 A;  2DN8 A;  3UI2 A;  3G6J B;  5BN3 A;  3T51 B;  1R9T B;  2IJ0 A;  1XYI A;  1JOQ A;  2KOL A;  1S4Z A;  1H9S A;  4DAV A;  3SK5 A;  1YNJ C;  3A7L A;  3DEP A;  2VXW A;  3JAM L;  1O7Y A;  3VYU A;  3OIQ A;  1BNZ A;  5KNB A;  1ENA A;  2WII B;  1OO9 B;  2HCC A;  2WAC A;  2EJM A;  1G91 A;  5ELB A;  4ZLT F;  2M2L A;  5KEE A;  4HED A;  3L7Z C;  1G6Z A;  4J1M A;  3RZO B;  3TZU A;  2NYZ D;  3EJI A;  2PZT A;  3QOJ A;  2L55 A;  2H1E A;  2XRS D;  2F0L A;  3PIO 3;  1SXT A;  3S9W A;  2KEC A;  3VA5 A;  4CHT B;  2O2L D;  4J8Q A;  3GTP B;  4UAI A;  2X69 A;  1LTA D;  3T4A C;  1MD2 D;  3U9S A;  5JPN C;  4HR7 B;  1Y1W B;  4LMQ D;  4RHR A;  1LT5 D;  2O4X A;  1NR4 A;  1IW7 D;  1SJE D;  4XYO A;  3BDO A;  2KCC A;  4K8I A;  1B1Z A;  2FFK B;  2AUK A;  2JA6 B;  3HOV B;  2WKD A;  3IFT A;  4XQN A;  2D62 A;  3I90 A;  1WTR A;  4YIJ A;  4XQQ A;  5EPK A;  1SFO B;  2J7Z A;  2LKV A;  4TKO B;  3GV6 A;  4IUT A;  4K2L A;  1PTO D;  4FF3 A;  1TR5 A;  3MEH A;  4B9X A;  2NBF A;  2NZ1 D;  1B44 D;  3ERO A;  3J80 L;  1HFN A;  2IPK D;  4G7H C;  5EKI A;  3V2T A;  3R2T A;  2K01 A;  1SNP A;  1SE2 A;  3FMC A;  1W6J A;  1EYD A;  1PRT B;  3S16 B;  1KAA A;  2CVR A;  1TY0 A;  2PCF B;  3TP6 A;  1A6X A;  5ISR A;  1XXG A;  3PUV A;  4NW2 A;  2K5D A;  3BVM A;  2PZU A;  3P1H A;  4IUU A;  1EQV A;  3ITP A;  3MWY W;  3SVM A;  1EOT A;  2B39 A;  4IUP A;  3I4M B;  2KHS A;  3DEO A;  2A73 B;  1SDF A;  1B9M A;  1PFN A;  5C0X I;  3CKI B;  4HTH A;  5FO7 B;  1BOS A;  2KJX A;  3TP7 A;  3OW7 A;  1EIH A;  4KI0 A;  1F2M A;  4BS9 A;  1F9P A;  5KYI A;  1GUS A;  3K5O A;  4DAY A;  5FOB B;  1B3A A;  1STH A;  5CYU A;  5C4X B;  3D4W A;  5CC4 A;  1XWE A;  1K8M A;  3NPP A;  4K5X A;  2OEO A;  4A3J B;  5BN4 A;  4A3F B;  1WTX A;  1WCM B;  3P75 A;  2Y0S B;  4C3H G;  3SHL A;  2Q8T A;  4ABN A;  1D1I A;  5CBA E;  2PW5 A;  2JYO A;  1I3Q B;  1ENC A;  5JAV A;  1VDZ A;  1TQO A;  3PUX A;  3GV3 A;  1X3P A;  5G3L F;  1EWC A;  1DZ1 A;  1EY8 A;  3OWF A;  2RQX A;  2BA0 A;  2CQA A;  4K5V A;  2M9V A;  1F9S A;  4C3J B;  3GTQ B;  3N52 A;  5IGC A;  1TWC B;  3C1E A;  2QCP X;  2ID0 A;  2I46 A;  3RZD B;  1HRJ A;  1M4V A;  4XDX A;  1R4P B;  1WTW A;  3D3R A;  1SE4 A;  1FGB D;  2F0T A;  1QCB D;  2D2C C;  3L3O C;  2VUM B;  3ND8 A;  2E2J B;  4KN7 C;  4F8M A;  3R93 A;  1CT1 D;  1CQV A;  1DCZ A;  5CGK A;  1BUV T;  1BF4 A;  5A2Q L;  2K5W A;  1A3U A;  2K03 A;  3Q24 A;  1KAB A;  5JVH 3;  3FDT A;  2F0D A;  2SOB A;  4C1N K;  3ERQ A;  3I4N B;  4PMC A;  4TQU S;  4C3I G;  2F0J A;  2QIL A;  2E76 C;  1LTS D;  2F0W A;  2LY7 A;  1PFM A;  3OPO A;  1AZQ A;  1SYC A;  1G2S A;  2HDM A;  4KK7 A;  2K28 A;  5I2X A;  2B2W A;  1U4R A;  1LTR D;  2EYO A;  3CHB D;  1CM9 A;  4DN4 M;  4TSS A;  3D6C A;  1RDP D;  4OHJ A;  4ODG A;  1K83 B;  2WKC A;  1H9J A;  4R8N A;  3OWE B;  1O78 A;  3VR4 A;  5J39 A;  3Q23 A;  1OXU A;  2E2D C;  2HDL A;  2K04 A;  3SR1 A;  1K8O A;  1O7Z A;  1HA5 A;  4CBV A;  4BBR B;  1V1O A;  1JQY D;  4H0L C;  3A55 A;  1GUO A;  2C5C A;  2F0F A;  2F0U A;  1U4L A;  3VA7 A;  3E6Z X;  2ICE C;  2A68 C;  3PUZ A;  4A3B B;  3A8J E;  2DNE A;  3ONA B;  1SEB D;  1RJT A;  3TBI B;  3HOZ B;  2F1M A;  2WB1 B;  4IUN A;  1FR3 A;  2IW3 A;  5J1Z A;  4X3S A;  2AQ1 B;  3GTJ B;  3PIP 3;  2TMP A;  1A2T A;  1JCK B;  3PO2 B;  1I4R A;  2F3W A;  3FRP B;  3WOF A;  1HHV A;  2F0E A;  3NXW A;  3I70 A;  1ET6 A;  1SBB B;  4NDX A;  1AFP A;  1HQR D;  2HCI A;  2IX3 A;  2E75 C;  4S3S A;  4R9W A;  2F0O A;  4ZKC B;  4EQP A;  2NN6 H;  2L1B A;  3LWE A;  2R6G A;  2IL8 A;  1VMC A;  2F03 A;  2B2T A;  1SNQ A;  2WV6 D;  1U4P A;  2O5I C;  1LLR D;  1EY0 A;  2RSO A;  4ZQ3 A;  1H9K A;  3F2U A;  2Q8I B;  2OT2 A;  3QJY A;  4DF7 A;  3V05 A;  2B2V A;  1BCP C;  1DD2 A;  4B08 A;  1LTB D;  4R8I A;  4WOR A;  2K7V A;  1S5E D;  1B50 A;  1LAB A;  1Z47 A;  4BBS B;  3JAM E;  2JA5 B;  2ZXR A;  4A3M B;  4BA2 I;  2NVY B;  1JR0 D;  4XIG S;  4L8J A;  2L12 A;  1STG A;  4CJ0 B;  2A69 C;  5IOC A;  3A8K E;  3NE5 B;  4HSP A;  1JB3 A;  3QO2 A;  4LAA A;  4Q0F A;  1SNO A;  5M5X B;  2FMC A;  1GUG A;  1PTO C;  4CJ2 C;  3Q22 A;  2WP8 J;  2VNU D;  1TKW B;  5J22 A;  4ZUJ A;  3QWN A;  2NTS A;  2A68 D;  2B2U C;  1HCZ A;  3U9O A;  2B2Y A;  3C46 A;  2D9U A;  1OXS C;  4PNY A;  2F0N A;  2R3Z A;  4A3K B;  2JP1 A;  3NBH A;  3TN2 A;  2EY2 A;  1PYW D;  1I4X A;  5DEH A;  1CFM A;  1OXV A;  2JA8 B;  2NVQ B;  3SEB A;  4QUF A;  1E2W A;  1X3Q A;  2SDF A;  3S1R B;  1QG7 A;  5COR A;  3C1F A;  1QB5 D;  4DA2 A;  1I4G A;  5I2Y A;  1EY4 A;  3I3C A;  5EBD A;  3HG9 A;  5C3E B;  2ZT9 C;  2EYJ A;  1BQQ T;  4K2K A;  1C4Q A;  1Q8I A;  2WIN B;  1EFI D;  2M00 A;  1EQT A;  5CV5 A;  2DNC A;  4H44 C;  4I7Z C;  2LS0 1;  5C4J B;  3X3N A;  4C2M B;  2ICI A;  3J81 L;  1HUN A;  2A6E C;  3DWA A;  2XN9 C;  3AB9 A;  2YU9 B;  3L9A X;  2L9H A;  4QB4 A;  3P7J A;  2ZXO A;  4G57 A;  4RGO S;  1DOL A;  1JWM D;  3I91 A;  2CW0 C;  2KEE A;  1BCP D;  1S5C D;  5EGT A;  4P2C B;  1YNN C;  4FF4 A;  2XNA C;  3NP8 A;  4CKE A;  1TS2 A;  1UNS A;  3K5M A;  1F9Q A;  1MSG A;  4ILW A;  1TWF B;  4IN3 A;  5JOB A;  1JWS D;  1ML0 D;  2OXP A;  1JC7 A;  2A69 D;  4IUQ A;  3S2H B;  1H9R A;  3I73 A;  4FF1 A;  1HQM C;  2O5J C;  3RLF A;  1SYB A;  4MHE A;  1KNE A;  4PMW A;  5JEA H;  3DM1 A;  1EU4 A;  2AQ2 B;  5FK9 C;  1FNW A;  1EY6 A;  2EOT A;  1CTM A;  4WRD A;  4HSV A;  1IKL A;  3HRZ C;  4KKU A;  1BXT A;  4B9W A;  4G7Z C;  5FLX E;  1V8Q A;  1ONL A;  4M8A A;  4O42 A;  2AWO A;  1TY2 A;  2A74 C;  2PNR C;  2KVM A;  3OHX C;  1I4Q A;  1RHP A;  1TU2 B;  4IUV A;  1SND A;  5I4D A;  4IFD H;  4ZUI A;  4QCL A;  5LL6 X;  3PV0 A;  4JK1 C;  2C9O A;  1QOH A;  3PO3 B;  1BR9 A;  2IT1 A;  3QIA A;  3J7A F;  3QG1 A;  3CRK C;  5IGD A;  3BZD B;  1E2V A;  5EBC A;  1E0B A;  2TSS A;  4V0B A;  1DOM A;  2EE1 A;  1D2B A;  4DNR B;  3KBG A;  4C3J G;  3HOW B;  1DYQ A;  5A2Q E;  1QE6 A;  5JJZ A;  1GHJ A;  3A7A B;  3VYR A;  1Z6H A;  3C2P A;  3M85 A;  4M1U B;  1B4O A;  4FO2 A;  1ZEQ X;  2A6E D;  1I6V C;  4EVO A;  3HZX A;  3FKI B;  1LTT D;  5EJW A;  2QF7 A;  4K6L A;  4WFN 3;  2BDN A;  1KDA A;  1C8C A;  4Q5V A;  2N88 A;  3OOC A;  2CW0 D;  1SJH D;  5KIX A;  1WTP A;  4G7O C;  3FPU B;  2RA4 A;  3NWT A;  2KA7 A;  1KDB A;  2XRQ D;  1YNN D;  1GOZ A;  3AU7 A;  5I6W A;  1A3T A;  2D5D A;  3Q6S A;  1PRT F;  1SNC A;  4IAL A;  2MUY A;  1V1P B;  5ELD A;  1FYC A;  2QDB A;  2Z4H A;  1AP0 A;  1A15 A;  4HN7 A;  3H3V C;  3IKJ A;  5LHY 1;  1AEX A;  3PUW A;  1S5F D;  1LAC A;  1JOO A;  1CZW A;  3T16 A;  3DXJ C;  4OIK A;  1Y8N B;  2QKI C;  1CI3 M;  1SSO A;  2F4I A;  1PLF A;  1OXX K;  3I8Z A;  1TWG B;  1VMP A;  2B63 B;  1PZJ D;  1VF5 C;  5KGU A;  4PQX A;  3NTI A;  3MXG A;  2F0M A;  4ZYS A;  1QNK A;  4ID6 A;  5D3I B;  4F88 A;  3TP5 A;  3HOX B;  3RD4 A;  2NN6 G;  3KUP A;  4EQO A;  2PMZ B;  2NTT A;  3TDQ A;  1AN8 A;  4XTC S;  4V19 0;  4LK1 C;  3ND9 A;  2VB2 X;  1RD9 D;  1QIL A;  4KY6 A;  3FEW X;  3SK8 A;  1LT6 D;  4CKC A;  3R3O A;  1A2U A;  3FVQ A;  1I50 B;  1LTI D;  1Y8O B;  1DM0 B;  1EZ8 A;  2VB3 X;  3VR2 A;  4RHS A;  1LTG D;  3P20 A;  2A6H C;  2LMC B;  3W3A A;  4XT1 B;  2R92 B;  1STY A;  3DMU A;  4GZY C;  2WAQ B;  1IYV A;  3T53 B;  2PQE A;  4L6T B;  5CV6 A;  4EGV A;  3H91 A;  3URY A;  3EVQ A;  4U67 3;  2EPB A;  1FD7 D;  1MGS A;  3DWP A;  4KHV A;  1G2T A;  2FJ2 A;  2OF1 A;  2F0I A;  1QWY A;  3HP3 A;  3GO5 A;  2R61 A;  1U9R A;  3SXH A;  3J7Y W;  3BVG A;  1ZKO A;  4A3D B;  2MPM A;  2EYM A;  3BG3 A;  1LT3 D;  5FKA C;  1BCP B;  2SNM A;  1HTP A;  1MI2 A;  2Z8L A;  2AWN A;  2IX1 A;  5EKK A;  4KD4 A;  2J0T D;  1EYA A;  3C3L A;  4L63 B;  4KKT A;  1KDC A;  2JEB I;  1L0Y B;  3KLS X;  3A54 A;  3H94 A;  4IQZ A;  4QF4 A;  5DAU A;  1PFB A;  4QUC A;  4TRD A;  1SYG A;  3M7N A;  3MTS A;  4PMB A;  1CHP D;  4NMZ A;  3KBX A;  1PMR A;  5G3L D;  1E2Z A;  3K6O A;  4O1N A;  2RVL A;  5BN5 A;  3S15 B;  4KY7 A;  1D5Z C;  1CA6 A;  2F0V A;  5IT9 L;  2EZV A;  1PTO B;  2BE5 C;  3K5N A;  3A8I E;  1U4M A;  5K36 G;  1JE4 A;  2EYP A;  2PZW A;  2NVX B;  1T5E A;  2HQE A;  1CHQ D;  2FHT A;  3HOY B;  1G29 1;  3HS0 C;  1D5X C;  5LL6 S;  4H13 C;  2F0P A;  2EDG A;  3TP8 A;  3EFX D;  2K05 A;  5C5M A;  2JSO A;  1JIC A;  5C5L A;  4NP5 A;  1RTN A;  5M3F B;  3LNN A;  2G9H D;  3T56 B;  5TSS A;  1DJR D;  4ZK9 B;  3DWQ A;  1O7L A;  2J4X A;  3NBI A;  3RMH A;  5I6Y A;  5FO8 B;  1LO5 D;  2NWG A;  1SYD A;  5M3M B;  1KNA A;  1F77 A;  1Y1V B;  1VF7 A;  1Q1B A;  2EXZ A;  1ROD A;  1STB A;  1SE3 A;  2A6H D;  1WTV A;  3M3Y B;  2NVT B;  2G9D A;  5CV9 A;  2F0S A;  3O13 A;  1H9M A;  1PTO H;  3LWU A;  1EZ6 A;  4CJ1 B;  1HUM A;  5T1I A;  3D6W A;  1L0X B;  3PUY A;  5JPM C;  2XSC A;  3NTH A;  4BY1 B;  3BVZ A;  5C44 B;  1IHZ A;  1Y8P B;  2I07 B;  4DXF A;  1R4Q B;  3OIP A;  1EU3 A;  3BYY B;  1NCV A;  4H7B A;  3OMC A;  3HKZ B;  3S1M B;  3VR3 A;  3NWS A;  1NSN S;  5JEA G;  1ILP A;  1QJO A;  5KYL A;  5D14 A;  3HGB A;  1TWA B;  3X3M A;  3K5L A;  3S1N B;  5E3F A;  5IGE A;  2FIN B;  1J8I A;  4RGT A;  4KJN A;  3PMF A;  4FVM A;  5C6A A;  4HAE A;  2R93 B;  3WDN A;  5K5P A;  1GJX A;  1S5B D;  4JBW A;  1Y69 U;  4A93 B;  5KNC A;  1SNM A;  1CK1 A;  3HEJ A;  1B53 A;  5C4Z A;  3GTO B;  4RH6 A;  1I4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...