4EQPA

Crystal structure of staphylococcal nuclease variant delta+phs i72d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKDEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I72D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4eqpA00
2F0MA 4WORA 4EQOA 2F0NA 2SNMA 3C1EA 1SNDA 1A2TA 2EYPA 2F0UA 2F0HA 4K8JA 4PMBA 5I9PA 5EKKA 5C5LA 2RBMA 3ITPA 4PMCA 5EGTA 5CV5A 3SR1A 5IGGA 2F0WA 5CGKA 4KY7A 5IOCA 1ENAA 1AEXA 1RKNA 4R8NA 5CV6A 4YIJA 5DEHA 4E6IA 4K5XA 2KQ3A 2HQEA 5J1ZA 4F8MA 1IHZA 5IGEA 4N9TA 2KHSA 5EKLA 5IGFA 1KDBA 1EY6A 1STHA 4KD4A 5DAUA 2EYJA 2EXZA 4DU9A 4K2LA 1EYDA 3R3OA 3DMUA 4K8IA 4KY5A 3SK8A 5IGCA 2PZWA 2EYFA 1A3TA 2RKSA 3BDLA 1NSNS 3EJIA 3NHHA 3P1HA 4ID6A 2OF1A 4K14A 4QB4A 3EVQA 5CC4A 3NQTA 3P75A 5CV8A 4K6DA 5E3FA 1A3UA 2F0PA 5CV9A 3QOJA 5JAVA 4OL7A 1NUCA 2F0SA 1SNMA 3NXWA 3SK6A 1KDAA 5KEEA 5IIFA 2F0EA 3EROA 3MEHA 4RKLA 1F2YA 5KRUA 4NMZA 5F2DA 2OEOA 2F0GA 2F0QA 3MVVA 3U9OA 1EY8A 1KAAA 3QOLA 2PQEA 4J1MA 4K5WA 1SNQA 3E5SA 1JOKA 5M9OA 5C3WA 3HEJA 1KABA 2F0JA 4LAAA 4RKBA 5KIXA 1SNCA 1TT2A 2PW7A 3D8GA 4PNYA 2EY1A 4N9PA 3T16A 3VA5A 1A3VA 4NP5A 1II3A 3HZXA 2PYKA 3MXPA 2EYLA 3TP7A 4KHVA 3C1FA 4DGZA 1EY9A 5C4ZA 2OXPA 3OWFA 3PMFA 1EYCA 5JOBA 3SXHA 3TP8A 3ERQA 1EZ8A 1F2MA 2EYMA 3MZ5A 5KYIA 4KTAA 1SYEA 2O4XA 2SNSA 3NUCA 5CR3A 5NUCA 1SYCA 2EYOA 2F0IA 2EY6A 2F0TA 1JORA 4KY6A 4DFAA 1TQOA 1SYDA 2F3WA 1JOQA 4QF4A 2F0KA 3RUZA 1STBA 2F0VA 5KGUA 2NUCA 5IGBA 1STAA 4G57A 5HURA 1SYGA 2PZTA 3D4DA 3NK9A 1EYAA 3H6MA 3OMGA 4NDXA 4QMGA 3TP5A 4DF7A 4S3SA 4KV6A 5HGTA 2WACA 3V2TA 1EY7A 4WRDA 4ZUIA 2F0DA 3D6CA 1F2ZA 1STNA 5C6AA 5ISRA 5C5MA 5CV7A 3T13A 4IALA 2M00A 3TP6A 4B9XA 2EY2A 2LKVA 4ME5A 2F3VA 4MIUA 5I6YA 4NKLA 4KJOA 4J6HA 5J39A 1KDCA 1A2UA 3OSOA 1SNPA 2ENBA 4KD3A 3SK5A 4IUNA 4EQNA 4K2KA 1EQVA 2PZUA 2EYHA 4KJNA 2RDFA 5E1FA 3S9WA 4EQPA 1ENCA 4IZ8A 4K5VA 4H7BA 1SYBA 5C4HA 4HMJA 1JOOA 2F0LA 3DHQA 3D4WA 1EY5A 1EY0A 5CV4A 5J22A 4TRDA 3QB3A 5KYLA 3BDCA 3OMCA 4ODGA 4F7XA 1STYA 5IODA 3SK4A 1EZ6A 1SYFA 4B9WA 2F0FA 3MHBA 4I65A 5C3XA 4HTHA 1U9RA 5I6WA 5I9OA 1SNOA 2PW5A 4EVOA 5IGDA 5K5PA 4ZUJA 1EY4A 2QDBA 3SHLA 2EY5A 4ZQ3A 3TMEA 3LX0A 2F0OA 1STGA 2SOBA 3NP8A 4HMIA 1TR5A
chains in the Genus database with same CATH superfamily
4I7ZC 2F0NA 1S5ED 2F0UA 4PMBA 5I9PA 1GUNA 4PZ8A 4MZ9A 2VB3X 2FJ2A 5CV5A 1ENAA 2HIXA 4HJ8A 5ELEA 3MFYA 4NXNL 1R9TH 3Q23A 3NQIA 2JSOA 3HOZG 2R92B 1HTPA 1I4PA 3Q22A 2B63B 3R3OA 3D31A 1YBYA 2EYFA 4OONA 1XNRQ 4CKEA 2A73B 4X66Q 1LABA 2DN8A 2F0PA 1K83B 1SXTA 1KNAA 1FGBD 3NXWA 2C5CA 5FK9C 5FO9B 2UXCQ 2LXKA 4IOCA 1F2YA 5F2DA 1B2TA 2K04A 2F52A 4CBVA 2IW3A 1HZ9A 1FJGQ 3K7UC 5EJWA 1J6QA 3HGBA 2JQOA 5KIXA 4LUOA 4PV1C 2PW7A 3S1RH 4DR7L 1QG7A 2FMCA 1BUVT 2UUBL 2VZAA 4A3KH 2B3GA 3K8AA 4OO1H 3K0XA 2EYMA 3CW2C 3NELA 3MZ5A 4C3IG 2E5LL 4BY7G 3IL8A 2UU9Q 3J81L 2OWOA 3NBHA 2B2UA 1W3SA 1OO9B 1KLGD 5M5YB 3EQLC 4JC0A 1W6KA 2LFNA 3RLFA 2NUCA 1XYIA 2WAQG 4G7HC 4BBSG 2CVRA 5IODA 3OOCA 3V2TA 4DV2Q 3NTHA 3HOVH 5FO7B 3I56A 3KK7A 3VR2A 3EIVA 5COYA 2WKDA 4DR2L 1XMOL 3J7AV 3A74A 4MTNA 3L9AX 1A6XA 5GAGC 4KJOA 3TQYA 3HKZE 4IUUA 1A2UA 2Q8RE 3OSOA 1CZGA 2OTJA 1J5EQ 4YCUA 4O0AA 4A3IB 4RFBA 3HOYH 1EIYB 3A54A 4QJFA 3UDXA 3U58A 4A3DB 5JPMC 4FF2A 1PTOD 3KF6B 4JOIC 3FKIH 4DUZQ 3PO2G 5CORA 3NP8A 1F9QA 3H3VC 2DNEA 2NYZD 1I6HB 5AFWA 3EA6A 4B3TL 1EIHA 4CDCC 1EUJA 2VL6A 5IYDG 1C48A 3GTKB 4KN4C 5ELCA 3J81j 2PZWA 4XQJA 3HKSA 5FOBB 4IPDA 3KDFA 2CWAA 3T1HQ 1Z6HA 2QEXA 2VQEQ 4FF3A 1Q86C 3EFXD 3SK6A 3UE1A 4GOPB 3D0FA 1EY8A 1KAAA 2JEBI 1G2TA 1LV9A 2F0JA 1GOZA 3J81E 2EY1A 3LWUA 3T1YQ 2XIWA 1HA5A 4X3KA 1D8LA 4OIJA 3HOWH 3NTIA 3PO2B 2M2LA 1H9MA 3H0GB 1JB3A 3FMCA 1JICA 4DAVA 4A3JG 2IWHA 3RZDH 2Z6KA 5T1GA 3WWVA 5FKAC 4CHTB 3UDIA 2YTXA 4DR4L 2A69D 3M4OH 2K50A 2IHEA 2WACA 2Z6BA 1D5XC 2JA5B 1XNRL 1X56A 1CK1A 5JEAJ 4X66L 3CRLC 2JA7B 4FNFA 4XXEA 5M5XB 2V4DA 4KKSA 3KF6A 2UXCL 2BE5D 3VYUA 1VMPA 4JV5Q 1SNPA 2R6GA 2MP1A 4EQNA 3A56A 4C3JH 4XT1B 5IT9L 1FJGL 2IPKD 5M5WB 4DV1Q 2WV6D 2VY3A 1JOOA 1VQDA 1D6EC 1G91A 2KOLA 1EY5A 1Y1WH 4TRDA 1KTKA 3OMCA 4ODGA 3KFUA 1SYFA 1JWUD 2UU9L 4LF9L 4IFDH 4OHJA 2RCFA 5I6WA 5I9OA 1QOHA 1LTAD 3S2HH 1LT3D 3QO2A 3U4VA 4DNTB 2D0OA 2QDBA 3BS1A 3ULPA 4NB3A 1X3FA 3RZOB 4EQOA 4MHEA 1NAPA 1K28A 1VQ6A 4YWMA 5C5LA 4LF8Q 4DV2L 5C0XJ 3FVQA 4K5XA 2PNHA 5C4JH 5AJ3Q 4BXXG 2R93G 3BU2A 3CAMA 2PI2E 3F2CA 4GOPA 1PV4A 4FF4A 1R9TB 3DMUA 4DGZA 5IP7H 2QF7A 3BDLA 4U68A 5FLXc 3P1HA 4LJZC 3MC0B 1J5EL 1Z47A 4UP7A 1A3UA 4A3EB 4LWCA 4OEMB 4B3RQ 4YWKA 5GROA 3CCEA 1X55A 4OIKA 2F0SA 3J80i 1SNMA 5LMNQ 2JA9A 5JPNC 4OXPA 2I5LX 4JI5L 4HIDA 3KJPA 3BG3A 4J8QA 4IPCA 4H0LC 3CMEA 3PGZA 3JC66 2BA0A 4C3HH 4DUZL 1F9RA 1KABA 4BY1H 1FD7D 1UWVA 3VR4A 3D8GA 2A6EC 1NMFA 1L0WA 3S1NH 3M4YA 4LF6Q 4C1NK 1YZ6A 1SR3A 2DY8A 2UUAQ 2ZXOA 3J7AF 1S72A 3S14H 4Y7NH 5DM73 1Q8IA 4JI8L 4A3KB 1CHPD 1WFQA 1P8LA 1SYCA 2F0IA 3DWAA 1AP0A 1AW7A 4DA2A 2QKIC 2GN5A 3GO5A 1PYBA 4L5QA 5EQ0A 4NDXA 1TY0A 1WD0A 1PH3A 4G7OC 1SMXA 3PQIA 4GZYC 4P73A 2B2WC 2D5DA 3HOVB 3MWYW 1QVCA 1PH8A 2NTTA 3T1HL 3MFGA 4GS3A 4P75A 2LXJA 3B6YA 1EWHA 5ELBA 3I70A 3M7GA 5FLMG 1WTPA 4G4KA 1IL2A 4K2KA 1QUQA 4KJNA 3I7FA 1QCBD 3KOJA 5JJLA 3TREA 5K36H 1Z9FA 2K75A 2JA8G 1QE6A 3SEBA 4C2MB 3HOYB 3T1YL 2RDHA 2BCOA 5G3LD 2WFWA 1R4PB 4BBRG 5LMNW 1Y1VH 1NE3A 3FKIB 2IHFA 2PW5A 1IZ6A 1S5DD 4XT3B 3LGJA 3SHLA 3CCRA 1LM0A 3K0YA 2Y0SB 1GM5A 3IFDA 4K8JA 2EPBA 2HCIA 3DEOA 2RVLA 3PF4A 5ELDA 2VNUD 2BA1A 1XPOA 1CQVA 1AEXA 4YIJA 1RCVD 2K5QA 2ICIA 2VW9A 2KQ3A 4H13C 1HJPA 2I5HA 1MKHA 1JWMD 3L3OC 3HOXG 4A75A 1FNWA 5DAUA 2UUCQ 3SK8A 5IYCG 3CCLA 1UNSA 3EJIA 3RN2A 4QB4A 2XRQD 3NHHA 3EVQA 4JV5L 5E3FA 1FVIA 2I0QA 2J4XA 1B53A 3MA2B 4DV1L 1TS2A 1PRTD 3F2UA 4NMZA 3CC4A 2AKWB 3VYSA 1PYSB 3E3XA 3HKZB 2F4VQ 3GD7A 1SNQA 4EQ5A 3HEJA 4JBMA 3W1GA 2AWNA 1ZYRC 4HEDA 1WTRA 1NR4A 1F9PA 1PVOA 3P7JA 3S24A 3H3VH 5EAYA 1I5FA 1K83H 2G5DA 3H09A 2FINB 4KTAA 1K3RA 1CSQA 2SNSA 4CKBA 1IL8A 4AYBG 2A68C 3HOWB 1ET6A 4LF8L 2HHHQ 1KNEA 3G4SA 1VQ8A 2QA4A 3VR3A 4DV0Q 1CKNA 4Q0FA 2PMZE 3RZDB 5AJ3L 1N8RC 1A0IA 1EYAA 1O78A 3CF5A 1E2WA 2A8VA 3M4PA 4A3FG 1PH4A 1X54A 3M4OB 3T13A 2L15A 4C56C 4NW2A 4B3RL 5LMNL 2Z1CA 4HN7A 4J6HA 5IYBH 3PF5A 1HNWL 3T4AC 1D1IA 2UXDQ 1BQQT 2IX0A 1RD9D 3W1BA 4C3JB 3GDEA 3PO3G 2B2VC 1SDFA 1EY0A 2FFKB 1LT5D 1N33Q 3HOZH 3PUZA 3PIPA 2XSCA 3EN2A 4HAEA 2PQAB 3IRBA 2I5MX 3Q0AA 1Y8PB 4RHSA 5EBDA 1IYVA 1MBYA 1WD1A 3AFPA 3S2HB 4JI3Q 1PRTB 2J7ZA 1I3QH 2R7ZG 1SNDA 1EIFA 1S3OA 1HXYD 1B9NA 5EGTA 4POFA 4X64Q 1MI2A 1QJOA 4F8MA 4I7AA 3U9SA 2OT2A 4HIKA 5EKLA 1KDBA 1L2FA 2NVYH 1XNQQ 3GTPB 2K4KA 5C4JB 4X62Q 3OYYA 1ZEQX 3H15A 4C3IH 4BY7H 4QCLA 3E9HA 1ICFB 1GUGA 2O5JC 1V43A 3VR5A 1VQ4A 4HCSA 4RKLA 1PDQA 1VQEA 5KRUA 2VUMG 1DCZA 4K5WA 2PPBC 4IFDJ 4BBSH 4ALPA 5M9OA 2FMMA 5C3WA 3GTKH 2G9DA 4BWGB 1NJIC 4LFCQ 3LNNA 1TT2A 4C3HB 3PO3B 1A3VA 1JJGA 3HZXA 4BY1B 2AUJD 4TKOB 4O1NA 1MIUA 1F2MA 3F2DA 3BZDB 3T51B 1LT4D 1K8MA 3S17H 4R4CA 2BDOA 3S14B 4Y7NB 4DFAA 5JVH3 3R93A 2N3SA 4L6TB 1EQTA 3TS0A 2E2HH 2EQSA 3AFQA 1EWIA 4A3CG 2Q2TA 2K32A 4KI0A 1EQQA 3TZUA 1LTRD 2WB1G 3D6CA 3JAMi 1CA5A 3RLOA 3SGIA 3PO2H 2EY2A 1GKHA 4ME5A 5A2QL 3H0GH 1UE1A 3CKIB 5J39A 1IBKQ 1L0YB 2F1MA 2CQAA 2DNCA 4FYDA 3K57A 3VR6A 2EYHA 2QDLA 3S9WA 3ND9A 2PQAA 3Q6SA 2CH4W 4IZ8A 4X3TA 4HMJA 2EJMA 3RN5A 2WIIB 2VUMB 1SE4A 1E2VA 3QB3A 3TS2A 5IYDH 5FLXE 4LFBL 4LFAQ 2YU9H 1I4QA 2K5HA 4NPSA 3GP7A 4CJ0B 2HHHL 2PNRC 1VQHA 1Y1VB 1STGA 4HMIA 3K59A 4DV6Q 3I72A 4DV0L 4IALA 2A5HA 2EYPA 4CDEC 1RF2D 2L55A 4PMCA 1O7ZA 5EPLA 1B44D 3CC2A 5J1ZA 2SDFA 3STBD 1YJ9A 4IUVA 1E24A 4HJ7A 2CKZB 2A6HD 3PIOA 1KLUD 1JCKB 3FP9A 1IW7C 2CCZA 2K33A 2ALYB 2OF1A 3E6ZX 2UXDL 3BDOA 1XWEA 4GKJQ 1R4QB 1I4GA 4YCWA 1S5FD 4A3JH 2J0TD 3AU7A 3MXNA 4FXGC 3U9OA 4OWWB 5ELOA 5I2XA 3UDGA 1UEAB 5E7NA 3F1ZA 3BVMA 4PG3A 1WI5A 2E2IH 4X3SA 3HP3A 1QNKA 1ONLA 2JK8A 1HFNA 4GN3B 5D65A 4A3EH 1UE6A 4JI3L 2RF4A 1SYEA 2K5WA 1T5EA 1S40A 3L2PA 2F0TA 4F88A 4GLXA 3R2TA 1D5ZC 4X64L 4A93G 4JK1C 5KGUA 4BA1I 5A2QE 1AE3A 1QWYA 3H6MA 4JBWA 1DONA 4S3SA 1F9SA 3LWEA 2F0DA 4X62L 2KHJA 4DV4L 3PUVA 3C3LA 1HHVA 3I4NG 1MJCA 1D7QA 4L8JA 3KLSX 1GVPA 4IPHA 1X9NA 1BKBA 3KLWA 4DR5Q 2ENBA 4IUNA 4RGOS 4RA8A 2L9HA 4HSVA 4N8X1 2KUMA 1PH6A 1M8AA 5LL6X 3H3VI 4BXXH 1QZGA 1C4QA 5I2YA 2B2UC 3CC7A 1WVLA 2JE6I 3NWTA 1AFPA 1UAPA 3HOZB 5IGDA 1B7YB 2MO1A 3KF8B 2SNMA 4FO2A 2D2CC 1ESRA 1TWHH 5DNFA 4C2MH 5IGGA 1I3QB 1N9WA 4PZ7A 4DUYL 1KXLA 2ZJPA 3V05A 3A8JE 2PCFB 5D3DA 1YITA 2PMZB 1HQMC 4KD4A 3I3CA 1SMYC 3CU7A 4ID6A 3DLLA 4K14A 4JI2Q 1IBKL 2RDGA 2NVYB 1BOSA 4JOIA 5JEAG 3I4NB 1IXRA 4OL7A 4IPGA 1SFOH 3TN2A 4C3IB 3MEHA 4BY7B 4OWXB 4H44C 4ZKBB 2F0GA 4QL5A 4RMFA 3O13A 4RKBA 1DYQA 3MXGA 2WAQB 4PNYA 4LFAL 1P16A 4BBSB 3ULLA 4RHRA 3CCVA 3K7AB 1BR9A 1S4ZA 1Y14B 2C9OA 5IIFA 5KNCA 1XX8A 2ZT9C 3I90A 3VYRA 4DV6L 1BCPC 2RSNA 1GO3E 4DR6L 3MAQA 2EYOA 1WTOA 2QGQA 1SBBB 4FP5D 1TQOA 3S17B 1PLFA 5HURA 2PZTA 3A7LA 2JA8H 2AUKA 5C0XG 2E2HB 2H5XA 1STNA 2LMCB 1HQRD 5LMUL 1IBMQ 3K81C 3J80c 4BBRH 4DAPA 2L0CA 1G8ZD 2Z8LA 5I6YA 2L1BA 4GNXC 1JB7A 4AYBE 4DKAC 1KAWA 2R61A 1EL0A 3TBIB 2GA4B 3KUPA 3Q8DA 3GTOH 1EOVA 4PZ6A 1EU3A 1BF4A 5C4HA 1G6ZA 1ILQA 5GAHC 1TWFH 4RH6A 3BDCA 3HOXH 2ASBA 4F7XA 1IYJB 4LUZA 1D5MC 5IYCH 3CCJA 1U9RA 2L12A 4H02A 1EY4A 5GQOA 3S1MB 1C8CA 1U5KA 2N55A 2YU9B 1EEFD 1IKLA 2E8GA 2E74C 2K7VA 1PH2A 3AEVA 3DM3A 1NCVA 2VS1A 4R4OA 1ZXTA 1VS0A 3BVZA 4KY7A 1ILPA 4E6IA 5CV6A 3ZJYC 4WJWA 4A3GG 1ZYRD 2R3ZA 1F2LA 1X3GA 1Q8KA 4DU9A 2DJFC 1E1OA 1A3TA 1PFSA 1BDOA 4B08A 2OCEA 4HJ9A 5CC4A 4DR5L 5CV8A 3I73A 3TZDA 1VF7A 1Q82C 4QIWE 2AHOB 4LW1A 1NR2A 1AH9A 2E2DC 4ILWA 4P2CB 4JYAQ 4A3JB 2IY5B 2A1AA 5TSSA 1CQFA 4GKKQ 2LSSA 3GTPH 1HPCA 3T16A 4M1UB 4A3FH 5CBEE 2R7FA 4KHPQ 2E2IB 4YY3Q 2CW0D 1PHJA 3PUYA 1MGSA 5C3EG 2N88A 1EU4A 1HZBA 4CJ2C 1N34Q 3QIAA 5IGBA 2NZ1D 2QW7A 4CJ1B 1O7LA 1H9RA 3PO3H 2K03A 4DK0A 3M4QA 4X6AH 5CV7A 3A8KE 2LKVA 4BS9A 1JR0D 1B8AA 1V1OA 4KD3A 5E1FA 2R7ZH 2ID0A 2JA6G 1RODA 2MJ8A 1TS5A 2WINB 1PTOC 1Z7TA 2JN4A 5CV4A 3P20A 2WB1E 4G7ZC 1DGSA 2JYOA 1I94Q 4JI6Q 2YYZA 2KCTA 1GD7A 1WJJA 3G6JB 2F0FA 5IT9E 2QEJC 3L7ZC 5C3XA 1KD1C 2R93B 4AQYQ 4EVOA 4ZYSA 2VQEL 2B2WA 1DXMA 1FYCA 4U673 3LX0A 5BN5A 3CPWA 1JC7A 3C1EA 3M9BA 4LMQD 4XTCS 5CYUA 5GADC 3ITPA 5FO8B 5C3EB 2F0WA 2VUMH 1BVSA 3HOUG 1RKNA 1E1TA 1TWHB 1VQKA 3KBXA 4MNOA 4K2LA 2NN6G 1WOCA 4A76A 2MQHA 1VMCA 1ASYA 1MHWC 5CV9A 1Y8OB 4DR1Q 1HA6A 1TY2A 2VB2X 2A19A 2F0EA 4JW0A 3MVVA 3U50C 1SFOB 4UHVA 3S1QH 3E9IA 1PFBA 3PUWA 4A3CH 1M1KC 4ZK9B 2KENA 4KK7A 4B3MQ 1OXVA 3MXUA 2EYLA 3OWFA 1YNJD 1A8VA 2N78A 2O4XA 3I8ZA 4K6LA 3J80L 4NXMQ 4WJ4A 1H9SB 2K28A 4HJ5A 2NVXB 3RUZA 3GTLH 1TWGH 4V190 2L5TA 1LTTD 4G57A 1SYGA 2A69C 3NPPA 3CCSA 1X3PA 1L1OB 4DF7A 2KVMA 1GUTA 1CHQD 4QGUA 2JA8B 2N49A 5C5MA 5LL6S 5A35A 1JMCA 2G9HD 3NENA 1SAPA 2L11A 2BE5C 4BBRB 5JVG3 1Q3LA 3SVMA 1B1ZA 4JYAL 2JJQA 1NY4A 4JPBW 1MSHA 3W2DA 5KNBA 1UUPA 5M3MG 2K52A 1RJTA 4DNRB 1HZCA 3S2DH 1X32A 2AWOA 2Q2IA 3G71A 3GTOB 3OTOQ 3FHWA 4DAMA 1N36Q 1Y8NB 1TWFB 3GTGH 4C1NI 1YHBA 3HOXB 3QG1A 2GVBA 5C44G 4JBKA 1GHKA 4DAYB 2B39A 3BVGA 2Z4HA 4DV7Q 2RCNA 5BN3A 2ES2A 1VQ5A 3JAMc 5EKKA 1FL0A 1YNNC 2KBNA 2MHVA 1E3PA 4LNQA 1JQYD 1AZPA 5M3FG 4LF6L 4HSPA 2Q8TA 1K73C 5I4DA 4AIMA 5IGFA 4DR3Q 4XQQA 1C0AA 2EXZA 2UUAL 3EBEA 4K8IA 3HS0C 1OXTA 1QVGA 1OXXK 1VQOA 1QVFA 2KJXA 1EWCA 4QY7A 3OIPA 3QOJA 1NUCA 4XQNA 1XMQQ 5KEEA 3VDYA 3URYA 5E4WC 3BJUA 4AYBB 4A93H 4JI0Q 3A55A 4J1MA 3L0OA 4IUQA 1H9SA 2M9VA 1I94L 4JI6L 1TWCH 1L1OC 1YI2A 2B29A 4L63B 5EPKA 3J80E 1KL9A 4N9PA 4NXNQ 1VQIA 4AQYL 3I2ZA 3M7NA 2X69A 3MXPA 1EFWA 4KN7C 3PMFA 3I4NH 5JOBA 4A3FB 1EZ8A 1I6VC 5CR3A 3NSWA 1LACA 4TSSA 5C44B 2WKCA 1ET9A 2F3WA 1T5XD 3NK9A 1HUNA 4A3LG 2CFMA 4KV6A 3E0EA 1WCMG 5JJKA 3K7AH 3D6WA 1J8IA 1SLJA 1F2ZA 2FXQA 3TEHB 3M85A 4DR7Q 2NVTH 4DR1L 1GUSA 1JT8A 2BH8A 2E5LQ 1MSGA 1RIPA 4X65Q 2PZUA 3RNUA 1BBWA 2B2TA 5D3IB 5G3LF 4PQXA 1U4LA 1WYDA 1X6OA 1B3AA 3SDZA 4DAYA 2R7ZB 4QIWB 4B3ML 1O7YA 3CQZB 5J22A 2UUCL 4YHHQ 1K0SA 2CH4A 1EZ6A 3GQBA 4XIGS 2AQ2B 1G291 3KJOA 3PCOB 4AH6A 1T9HA 2RHSB 4A3BG 2F0HA 2RHQB 4RCNA 2F4VL 1OXUA 2YV5A 2BH2A 1YJWA 4FXKC 5CGKA 2Z9HA 4LF5Q 1ML0D 4R8NA 3I4MG 4IJHA 4ME3A 2KHSA 3UI2A 1LLRD 1A62A 1PH5A 3IKJA 2K1BA 5C4XG 2RKSA 1PZJD 1NSNS 3S1MH 1Y69U 2R7DA 1S5CD 4PMWA 3PIP3 2KCNA 1E7ZA 3J81i 4L5TA 1KDAA 3N6RA 2KHIA 4IOAA 2KA7A 3PUXA 5H1SE 1UE5A 5L37A 1EIGA 1SE2A 4GN4B 3OTOL 1I4RA 2OQKA 4MTKA 2R92G 1N36L 2SEBD 2B63G 4R4IA 3NBHB 4O2DA 1D1KA 3S1QB 4DN4M 4KHVA 3C1FA 3FRPB 2B2YC 3GV3A 5KYIA 1E2ZA 1EFID 2WB1B 2E75C 4ZRZA 2K01A 4DV7L 4A3MG 1Q7YC 2EY6A 4WFN3 2NVQH 1JORA 1GUWA 1BXTA 1A63A 1JOQA 4LK1C 1STBA 2HIVA 4CDFC 1OTCA 1PH9A 4WJ3M 3OWEB 3TRZA 3D4DA 3OMGA 4O42A 1U4MA 4ZCKA 4DR3L 3GTLB 1TWGB 1N33L 3ULJA 3RR5A 1DJRD 2HQLA 3CCUA 5KNDA 1WTVA 1XPRA 1Q12A 4MIUA 3I91A 3BZCA 1XMQL 1LT6D 1HCZA 3G6EA 3VA7A 1JE5A 4LF7Q 2F03A 4JI0L 2IJ0A 2PI2A 1PZID 4XYQA 4DK3C 4KKUA 3DHQA 3S2DB 4DR4Q 3JAML 1XNQL 5ELNA 4A3GH 1VCIA 1X3EA 1B70B 5BN4A 1C9OA 4HIMA 1PMRA 4IURA 4JI4Q 1BCPB 5K5PA 4ZUJA 4A3IG 3GTGB 3R2IA 2IT1A 1XTCD 2SOBA 4LUVA 2K5NA 4DV3Q 4A3DG 3RMHA 3GV6A 1A2TA 4A3MB 4POGA 2Z0SA 3DXJC 3QWNA 1QNUA 2RBMA 3R8BA 1CM9A 3NBIA 4LFCL 1LTBD 4J15A 3M3YH 3KDFB 5IP9G 2JEAI 1EY6A 2R93H 3F8TA 2Y0SE 4IQZA 3AMUA 2X6GA 4X65L 4GNXB 4LF9Q 3P75A 1VQ9A 2NTSA 5EBCA 2HDLA 3I4LA 1JJCB 5C3EH 1EOTA 4ULLA 3K5LA 3NEMA 2OEOA 1VQJA 4Q5VA 1KHIA 1Q1BA 4DNIA 4YHHL 2CWPA 3OIQA 4A93B 1VQLA 1HZAA 2K6AA 2PO4A 2A6ED 4UDUC 3A5UA 1TWCB 1II3A 1TIID 5C4ZA 3VYTA 1VF5C 2MGSA 3PIO3 3OPOA 5IE8A 2AQ1B 1SJHD 5NUCA 5DLQE 4KY6A 4LF5L 2XRSD 2ZTDA 2QCPX 1HNZQ 1K9MC 4JI5Q 3U4ZA 2JA6H 2E2JH 1IBLQ 2JXMB 1XXGA 5FJ8G 2O5IC 3TP6A 3CCMA 1ICWA 3H0GG 1BCPF 2TMPA 3J7YW 1AN8A 1HH2P 2NVTB 1XPUA 4JBJA 1VQNA 2NVXH 4JI8Q 1FNVA 3JAME 4JCVE 5FLMH 1VQAA 3ND8A 1ENCA 3OW7A 4K5VA 2JA5G 2K5VA 1RDPD 2ZTEA 3HOUH 1JJ2A 2JA7G 3D4WA 1LUZA 1VQGA 1VDZA 2QILA 5KYLA 2HUGA 5JJIA 1O7IA 2ZTCA 1WTQA 4B9WA 3I55A 1B4OA 4I65A 1SNOA 2EJFC 1VQPA 1Q81C 4GKJL 3Q24A 2NN6H 3W5OA 1FGUA 4DPGA 2YTVA 1OXSC 1KC8C 3K58A 3G48A 4A4IA 3AYHB 4GNXA 2EXDA 4FVMA 3STBC 1VQ7A 1FR3A 3KF8A 3BYTB 5E4XA 1IHZA 5IGEA 2A6HC 3CRKC 5LHY1 1E22A 1MJEA 2VXWA 4EGVA 3QR8A 3IAYA 4LF7L 2F3IA 2RSOA 1AE2A 4FXDA 4K6DA 2Z6KC 2IL8A 4RGMA 1I50H 1CKMA 3X3NA 1GUOA 1TXYA 2F0QA 2MFIA 4UP9A 1PTOB 1HNXQ 2YTYA 1HRJA 1KRSA 4HIOA 1CSPA 3HFZB 4UY8C 5DM63 2DY7A 1M90C 2B8FA 1SRUA 3W3AA 4JI4L 4RGTA 2WP8J 1I4HA 1WTWA 4A3EG 1W6JA 1W2BA 3G7LA 4UAIA 1EY9A 3SXHA 3WOEA 1EYCA 2JP1A 3ERQA 2DGYA 3CMAA 4KKTA 4DV3L 4GLAC 1PXUA 1UEBA 3UE0A 2A68D 2GVAA 1PA6A 4KMUC 3KLSA 4B3SQ 5M3MH 2NVQB 2ZJRA 3F2BA 2E76C 1DOLA 1QILA 2NBFA 1NBWA 4ZUIA 4HR7B 3S16H 3T53B 4DXFA 5CBAE 4A3KG 4L5SA 4TQUS 4OO1G 1QUQB 3GTMH 1LTLA 5C44H 4XYOA 1KDCA 1SEBD 1EQRA 1K0RA 4IO9A 1ZKOA 4EQPA 5HGQA 4GOPC 1YNND 4HJAA 4H7BA 1VQFA 3CPFA 3A8IE 3QJYA 4ZKCB 4P72A 3HOVG 5J3BA 5C0XI 4YCVA 2A74C 5M3FH 5T1IA 4ZLTF 4QUCA 1RL2A 3TSSA 4JI2L 2EZVA 4QUFA 1K8GA 4A3GB 3MHBA 5IWAQ 4HTHA 1KIXA 2HCCA 2EVBA 4ZQ3A 3RLNA 2H1EA 3TMEA 2F0OA 1QB5D 1HNZL 4KLKA 1JWSD 3OHXC 4FDBA 1HNWQ 3HOYG 1CI3M 2UXBQ 1WTHA 4K0KQ 1IBLL 2B8GA 1PTOF 5IOCA 1KQSA 3CQZH 4QQBX 3K5OA 4R4TA 3S15H 4JI7Q 2NWGA 4IUTA 1FNUA 2HD3A 4R8IA 3FKIG 1CTMA 5IGCA 3M3YB 1LTID 2K5DA 3S1RB 1VQBA 2V1CC 4N8FA 2OTLA 2Q2UA 2Y0SG 2AQ3B 1SSOA 4GN5A 1GJXA 3CCQA 2NB0A 1O80A 1TWAH 3NWSA 3J7A5 1XTDA 3CD6A 1BBXC 4R9WA 3ER0A 1G2SA 2FHTA 1AZQA 1A15A 4A3LH 1IBML 3WDNA 3DWQA 1K8AC 1CT1D 1WCMH 2DJGC 2N8NA 3HG9A 4NP5A 4RWSC 4DK1A 1LTGD 1CKNB 3TP8A 2NZOA 1J9OA 3AB9A 2XNAC 3GTQH 2CQOA 1SN8A 3HKZG 2RA4A 1SYDA 1RHPA 4QF4A 1DOMA 2K14A 1SE8A 3GTJH 2XVSA 3TP5A 5HGTA 4JI1Q 3K6OA 1EY7A 2JA6B 1G6PA 2XWBB 1KRTA 4OO1I 1SJED 2E2JB 1I4XA 4YWLA 2M00A 3OW2A 4B9XA 1NMGA 3HOWG 2NZHA 2MPMA 2VQFQ 2C35B 3WOFA 2KEDA 1D2BA 3C2PA 2IX3A 3IFTA 1UE7A 1EQVA 1HNXL 4A3BH 1B50A 3BZKA 4M8AA 4JG2A 1N32Q 4Z9CB 3I4MH 2OQ0A 1CFMA 1K3BC 3HOUB 4LF4Q 1LO5D 2ICEC 2D0PA 5C4XH 1BO0A 1K8OA 1M4VA 2EY5A 3HRZC 2O2LD 5EPJA 4V0BA 4B3SL 1TR5A 1TVXA 1V1QA 3A5ZB 4WORA 4C3JG 2ZXPA 1G51A 2EDGA 1DOKA 1E0BA 1HFGA 2XN9C 3SR1A 1PYWD 4GKKL 4GLVB 2R92H 4P71A 5DEHA 3V96A 1HR0Q 2B63H 1Y1WG 3RD4A 4N9TA 1L0XB 1YNXA 4KHPL 4YY3L 4IFDG 1EYDA 1GHJA 4LFBQ 4UPAA 1IYUA 1IW7D 3NQTA 1CUKA 5JJZA 3H94A 4R1JA 2ZM6Q 4A3MH 2DUDA 2MO0A 3A0JA 5JAVA 1N34L 4F87A 3EROA 1H9JA 4CKCA 4DXGA 1I50B 2BDNA 1HTLD 3C46A 1YIJA 4DV5Q 1V8QA 5BR8Q 4BA2I 3E5SA 1JOKA 3MEFA 1B3QA 4LAAA 1HUMA 1CKOA 5IWAL 1BNZA 3E0JA 4CGYB 4OGQC 4CDDC 3FDTA 3K80C 5IP7G 2PYKA 2NN6I 3TP7A 2OXPA 2CW0C 2B2VA 3K5NA 5M5YH 2TSSA 2I46A 4ABNA 2UXBL 4OX9Q 3ONAB 2IX1A 2D9UA 4K0KL 2D62A 3TDQA 2WAQE 1MD2D 2K05A 4UP8A 3DM1A 4JI7L 2MNAA 4XDXA 1BBUA 4QMGA 4C3HG 4BY1G 4X3UA 5M3MB 2XGTA 2HDMA 1CA6A 1TKWB 2I07B 2KCMA 1C7YA 3PV0A 5C6AA 2Q2HA 3J81c 1DD2A 1Y1WB 3K5MA 1YEZA 2Q8IB 3S16B 3H91A 1TS3A 1L1OA 2F3VA 1SE3A 4A3IH 1QZHA 3SE0A 5FLXL 3GTMB 2ATWA 4JVZA 3FPPA 2P5ZX 1HR0W 2EJGC 3CXCA 4A3DH 2F4IA 5ELFA 1DM0B 1Q46A 1NNXA 2RQXA 1DZ1A 1SYBA 4KHZA 4IJLA 1F77A 2F0LA 2EE1A 1LYLA 1U4PA 1JE4A 1PFMA 1SROA 5IP9H 1STYA 4Y52H 3SK4A 3NTKA 1CZWA 5M3FB 4DV4Q 2UUBQ 1I6HH 3ZYYX 3FPUB 2F0MA 3AQQA 1RTOA 2X6LA 2HT1A 5K36G 5D14A 3X3MA 3KYHC 4JI1L 2L4NA 1V1PB 4APVA 3J7ZC 3A7AB 5HY6A 1NTGA 2EIFA 3D3RA 2HQEA 4IFDI 3UDFA 1V9PA 1Q90A 1STHA 1PH7A 2EYJA 3S15B 1Y1VG 4KY5A 2VQFL 1YVCA 3MXNB 1ASZA 3S1NB 1SMYD 3CP0A 5CMDA 3ICEA 2B2TC 1VQMA 4DR2Q 4NXML 4DK6C 3CHBD 1YHQA 1XMOQ 3ERSX 3BYYB 4IUPA 5JEAH 3PSIA 3DEPA 4MN3A 4R4QA 1ENFA 3DUZA 4EX5A 1N32L 1TWAB 3QOLA 2PQEA 2ZJQA 5IY0A 3D4RA 1EEID 2KCCA 4DUYQ 4LF4L 4TVAB 1SNCA 2KECA 1PH1A 3N52A 1B9MA 3VA5A 5FJ8H 2XTIA 1LTSD 4RCOA 1YNJC 1WCMB 3T56B 1PZKD 1IKMA 3KBGA 3NUCA 1PRTF 1BCPD 5EKIA 1TS4A 4HCEA 1H9KA 1XJVA 3GTQB 4FF1A 1PRTC 2F0KA 1PTOH 2F0VA 3NE5B 1S5BD 1RTNA 2LY7A 1PFNA 1STAA 1HR0L 1U4RA 2LS01 3I4OA 4RGNA 2JA5H 2CHBD 4B3TQ 3GTJB 1X65A 4WRDA 2JA7H 5M5XH 5ISRA 3MTSA 5C0XH 2ZM6L 1EYGA 4OELB 1GXDC 2BOSA 2KEEA 4NKLA 2MUYA 1Q1EA 1H95A 2H4OA 1YHAA 2XWJB 5M5WH 2B2YA 3SK5A 4DR6Q 4DV5L 1WTXA 5BR8L 2RDFA 3DWPA 2ZXRA 4A3BB 4P74A 2EOTA 4RAUC 5GAEC 4RG1A 3FEWX 1V1PA 4ZAIA 3KLRA 3I4MB 4IN3A 4OWTB 5LMUQ 1VQCA 1X3QA 1YJNA 2Z4IA 4OX9L 3RZOH 5IT9c 1U0LA 5IYBG 4L5RC 5C4XB 2AMCB 1STEA 1TU2B 1ESFA
chains in the Genus database with same CATH topology
4I7ZC 2F0NA 1S5ED 2F0UA 4PMBA 5I9PA 1GUNA 2VB3X 2FJ2A 5CV5A 1ENAA 5ELEA 3MFYA 3Q23A 3NQIA 2JSOA 2R92B 1HTPA 1I4PA 3Q22A 2B63B 3R3OA 3D31A 2EYFA 4CKEA 2A73B 1LABA 2DN8A 2F0PA 1K83B 1SXTA 1KNAA 1FGBD 3NXWA 2C5CA 5FK9C 5FO9B 1F2YA 5F2DA 1B2TA 2K04A 4CBVA 2IW3A 5EJWA 3HGBA 5KIXA 4PV1C 2PW7A 1QG7A 2FMCA 1BUVT 4OO1H 2EYMA 3MZ5A 4C3IG 3IL8A 3J81L 3NBHA 2B2UA 1OO9B 1KLGD 5M5YB 3EQLC 1W6KA 2LFNA 3RLFA 2NUCA 1XYIA 4G7HC 2CVRA 5IODA 3OOCA 3V2TA 3NTHA 5FO7B 3KK7A 3VR2A 5COYA 2WKDA 3J7AV 3L9AX 1A6XA 4KJOA 4IUUA 1A2UA 2Q8RE 3OSOA 1CZGA 4A3IB 4RFBA 3A54A 4A3DB 5JPMC 4FF2A 1PTOD 5CORA 3NP8A 1F9QA 3H3VC 2DNEA 2NYZD 1I6HB 5AFWA 3EA6A 1EIHA 1C48A 3GTKB 4KN4C 5ELCA 2PZWA 4XQJA 5FOBB 1Z6HA 4FF3A 3EFXD 3SK6A 1EY8A 1KAAA 2JEBI 1G2TA 1LV9A 2F0JA 1GOZA 3J81E 2EY1A 3LWUA 2XIWA 1HA5A 4X3KA 4OIJA 3NTIA 3PO2B 2M2LA 1H9MA 3H0GB 1JB3A 3FMCA 1JICA 4DAVA 2IWHA 5T1GA 5FKAC 4CHTB 2A69D 2WACA 1D5XC 2JA5B 1CK1A 5JEAJ 3CRLC 2JA7B 4FNFA 4XXEA 5M5XB 2V4DA 4KKSA 2BE5D 3VYUA 1VMPA 1SNPA 2R6GA 2MP1A 4EQNA 3A56A 4XT1B 5IT9L 2IPKD 5M5WB 2WV6D 1JOOA 1D6EC 1G91A 2KOLA 1EY5A 4TRDA 1KTKA 3OMCA 4ODGA 1SYFA 1JWUD 4IFDH 4OHJA 5I9OA 5I6WA 1QOHA 1LTAD 1LT3D 3QO2A 4DNTB 3BS1A 2QDBA 3RZOB 4EQOA 4MHEA 1NAPA 5C5LA 5C0XJ 3FVQA 4K5XA 4FF4A 1R9TB 3DMUA 4DGZA 2QF7A 3BDLA 4U68A 3P1HA 4LJZC 3MC0B 1Z47A 1A3UA 4A3EB 4OIKA 2F0SA 1SNMA 5JPNC 3BG3A 4J8QA 4H0LC 2BA0A 1F9RA 1KABA 1FD7D 3VR4A 3D8GA 2A6EC 3M4YA 4C1NK 2DY8A 2ZXOA 3J7AF 5DM73 1Q8IA 4A3KB 1CHPD 1SYCA 2F0IA 3DWAA 1AP0A 1AW7A 4DA2A 2QKIC 3GO5A 5EQ0A 4NDXA 1TY0A 1WD0A 4G7OC 4GZYC 2B2WC 2D5DA 3HOVB 3MWYW 2NTTA 3MFGA 1EWHA 5ELBA 3I70A 3M7GA 1WTPA 4G4KA 4K2KA 4KJNA 1QCBD 5K36H 1QE6A 3SEBA 4C2MB 3HOYB 2RDHA 2BCOA 5G3LD 1R4PB 3FKIB 2PW5A 1S5DD 4XT3B 3SHLA 3K0YA 2Y0SB 3IFDA 4K8JA 2EPBA 2HCIA 3DEOA 2RVLA 5ELDA 2VNUD 2BA1A 1CQVA 1AEXA 4YIJA 1RCVD 2K5QA 2ICIA 2KQ3A 4H13C 3L3OC 1JWMD 1FNWA 5DAUA 3SK8A 1UNSA 3EJIA 4QB4A 2XRQD 3NHHA 3EVQA 5E3FA 2J4XA 1B53A 3MA2B 1TS2A 1PRTD 3F2UA 4NMZA 3VYSA 3HKZB 3GD7A 1SNQA 3HEJA 2AWNA 1ZYRC 4HEDA 1WTRA 1NR4A 1F9PA 3P7JA 3H09A 2FINB 4KTAA 2SNSA 4CKBA 1IL8A 2A68C 3HOWB 1ET6A 1KNEA 3VR3A 4Q0FA 3RZDB 1EYAA 1O78A 1E2WA 3M4OB 3T13A 4C56C 4NW2A 2Z1CA 4HN7A 4J6HA 3T4AC 1D1IA 1BQQT 2IX0A 1RD9D 4C3JB 2B2VC 1SDFA 1EY0A 2FFKB 1LT5D 3PUZA 2XSCA 4HAEA 3Q0AA 1Y8PB 4RHSA 5EBDA 1IYVA 1MBYA 1WD1A 3S2HB 1PRTB 2J7ZA 1SNDA 1HXYD 1B9NA 5EGTA 1MI2A 1QJOA 4F8MA 3U9SA 2OT2A 5EKLA 1KDBA 3GTPB 5C4JB 1ZEQX 4QCLA 1GUGA 2O5JC 1V43A 3VR5A 4HCSA 4RKLA 1PDQA 5KRUA 1DCZA 4K5WA 2PPBC 4IFDJ 5M9OA 2FMMA 5C3WA 2G9DA 4BWGB 3LNNA 1TT2A 4C3HB 3PO3B 1A3VA 3HZXA 4BY1B 2AUJD 4TKOB 4O1NA 1F2MA 3BZDB 3T51B 1LT4D 1K8MA 2BDOA 3S14B 4Y7NB 4DFAA 5JVH3 3R93A 4L6TB 1EQTA 2K32A 4KI0A 3TZUA 1LTRD 3D6CA 1CA5A 2EY2A 4ME5A 5A2QL 3CKIB 5J39A 1L0YB 2F1MA 2CQAA 2DNCA 4FYDA 3K57A 3VR6A 2EYHA 3S9WA 3ND9A 3Q6SA 4IZ8A 4X3TA 4HMJA 2EJMA 2WIIB 2VUMB 1SE4A 1E2VA 3QB3A 5FLXE 1I4QA 3GP7A 4CJ0B 2PNRC 1Y1VB 1STGA 4HMIA 3K59A 3I72A 4IALA 2A5HA 2EYPA 1RF2D 2L55A 4PMCA 1O7ZA 5EPLA 1B44D 5J1ZA 2SDFA 4IUVA 2A6HD 1KLUD 1JCKB 1IW7C 2K33A 2OF1A 3E6ZX 3BDOA 1XWEA 1R4QB 1I4GA 1S5FD 2J0TD 3AU7A 3MXNA 4FXGC 3U9OA 5I2XA 1UEAB 3BVMA 4X3SA 3HP3A 1QNKA 1ONLA 1HFNA 5D65A 1SYEA 2K5WA 1T5EA 2F0TA 4F88A 3R2TA 1D5ZC 4JK1C 5KGUA 4BA1I 5A2QE 1QWYA 3H6MA 4JBWA 1DONA 4S3SA 1F9SA 3LWEA 2F0DA 3PUVA 3C3LA 1HHVA 4L8JA 3KLSX 2ENBA 4IUNA 4RGOS 4RA8A 2L9HA 4HSVA 2KUMA 1M8AA 5LL6X 1C4QA 5I2YA 2B2UC 1WVLA 2JE6I 3NWTA 1AFPA 1UAPA 3HOZB 5IGDA 2SNMA 4FO2A 2D2CC 1ESRA 5DNFA 5IGGA 1I3QB 3V05A 3A8JE 2PCFB 5D3DA 2PMZB 1HQMC 4KD4A 3I3CA 1SMYC 3CU7A 4ID6A 4K14A 2RDGA 2NVYB 1BOSA 5JEAG 3I4NB 4OL7A 3TN2A 4C3IB 3MEHA 4BY7B 4H44C 4ZKBB 2F0GA 3O13A 4RKBA 1DYQA 3MXGA 2WAQB 4PNYA 4BBSB 4RHRA 3K7AB 5IIFA 1BR9A 1S4ZA 2C9OA 5KNCA 1XX8A 2ZT9C 3I90A 3VYRA 1BCPC 2RSNA 3MAQA 2EYOA 1WTOA 1SBBB 4FP5D 1TQOA 3S17B 1PLFA 5HURA 2PZTA 3A7LA 2AUKA 5C0XG 2E2HB 1STNA 2LMCB 1HQRD 4DAPA 2L0CA 1G8ZD 2Z8LA 5I6YA 2L1BA 2R61A 1EL0A 3TBIB 2GA4B 3KUPA 1EU3A 1BF4A 5C4HA 1G6ZA 1ILQA 4RH6A 3BDCA 4F7XA 1D5MC 1U9RA 2L12A 1EY4A 3S1MB 1C8CA 2YU9B 2N55A 1EEFD 1IKLA 2K7VA 2E74C 1NCVA 1ZXTA 3BVZA 4KY7A 1ILPA 4E6IA 5CV6A 4WJWA 1ZYRD 2R3ZA 1F2LA 4DU9A 1A3TA 1BDOA 4B08A 5CC4A 5CV8A 3I73A 3TZDA 1VF7A 1NR2A 2E2DC 4ILWA 4P2CB 4A3JB 5TSSA 1CQFA 1HPCA 3T16A 4M1UB 5CBEE 2E2IB 2CW0D 3PUYA 1MGSA 2N88A 1EU4A 4CJ2C 3QIAA 5IGBA 2NZ1D 4CJ1B 1O7LA 1H9RA 2K03A 4DK0A 5CV7A 3A8KE 2LKVA 4BS9A 1JR0D 1V1OA 4KD3A 5E1FA 2ID0A 1RODA 2MJ8A 1TS5A 2WINB 1PTOC 1Z7TA 5CV4A 3P20A 4G7ZC 2JYOA 2YYZA 3G6JB 2F0FA 5IT9E 2QEJC 3L7ZC 5C3XA 2R93B 4EVOA 4ZYSA 2B2WA 1DXMA 1FYCA 4U673 3LX0A 5BN5A 1JC7A 3C1EA 4LMQD 4XTCS 5CYUA 3ITPA 5FO8B 5C3EB 2F0WA 1RKNA 1TWHB 3KBXA 4K2LA 2NN6G 1VMCA 5CV9A 1Y8OB 1HA6A 1TY2A 2VB2X 2F0EA 3MVVA 1SFOB 1PFBA 3PUWA 4ZK9B 4KK7A 1OXVA 3MXUA 2EYLA 3OWFA 1YNJD 2O4XA 3I8ZA 4K6LA 3J80L 1H9SB 2K28A 2NVXB 3RUZA 4V190 2L5TA 1LTTD 4G57A 1SYGA 2A69C 3NPPA 1X3PA 4DF7A 2KVMA 1GUTA 1CHQD 2JA8B 5C5MA 5LL6S 5A35A 2G9HD 1SAPA 2L11A 2BE5C 4BBRB 5JVG3 1Q3LA 3SVMA 1B1ZA 1MSHA 3W2DA 5KNBA 1UUPA 1RJTA 4DNRB 1X32A 2AWOA 3GTOB 1Y8NB 1TWFB 4C1NI 3HOXB 3QG1A 1GHKA 2B39A 3BVGA 2Z4HA 5BN3A 5EKKA 1YNNC 2MHVA 1JQYD 1AZPA 4HSPA 2Q8TA 5I4DA 5IGFA 4XQQA 2EXZA 4K8IA 3HS0C 1OXTA 1OXXK 2KJXA 1EWCA 3OIPA 3QOJA 1NUCA 4XQNA 5KEEA 3URYA 5E4WC 4AYBB 3A55A 4J1MA 4IUQA 1H9SA 2M9VA 4L63B 5EPKA 3J80E 4N9PA 3M7NA 2X69A 3MXPA 4KN7C 3PMFA 5JOBA 4A3FB 1EZ8A 1I6VC 5CR3A 3NSWA 1LACA 4TSSA 5C44B 2WKCA 1ET9A 2F3WA 1T5XD 3NK9A 1HUNA 4KV6A 3D6WA 1J8IA 1F2ZA 3M85A 1GUSA 1MSGA 2PZUA 2B2TA 5D3IB 5G3LF 4PQXA 1U4LA 4DAYA 1B3AA 3SDZA 2R7ZB 4QIWB 1O7YA 3CQZB 5J22A 1EZ6A 3GQBA 4XIGS 2AQ2B 1G291 2F0HA 4RCNA 1OXUA 4FXKC 5CGKA 1ML0D 4R8NA 2KHSA 3UI2A 1LLRD 3IKJA 2K1BA 2RKSA 1PZJD 1NSNS 1Y69U 1S5CD 4PMWA 3PIP3 2KCNA 1KDAA 3N6RA 2KA7A 3PUXA 1EIGA 1SE2A 1I4RA 2SEBD 1D1KA 3S1QB 4DN4M 4KHVA 3C1FA 3FRPB 2B2YC 3GV3A 5KYIA 1E2ZA 1EFID 2WB1B 2E75C 4ZRZA 2K01A 2EY6A 4WFN3 1JORA 1GUWA 1BXTA 1JOQA 4LK1C 1STBA 3OWEB 3D4DA 3OMGA 4O42A 1U4MA 3GTLB 1TWGB 1DJRD 5KNDA 1WTVA 1Q12A 4MIUA 3I91A 1LT6D 1HCZA 3VA7A 2F03A 2IJ0A 1PZID 4XYQA 4KKUA 3DHQA 3S2DB 3JAML 1VCIA 5BN4A 1PMRA 4IURA 1BCPB 5K5PA 4ZUJA 3GTGB 3R2IA 2IT1A 1XTCD 2SOBA 3RMHA 3GV6A 1A2TA 4A3MB 3DXJC 3QWNA 1QNUA 2RBMA 3R8BA 1CM9A 3NBIA 1LTBD 2JEAI 1EY6A 4IQZA 3AMUA 2X6GA 3P75A 2NTSA 5EBCA 2HDLA 3I4LA 1EOTA 4ULLA 3K5LA 2OEOA 4Q5VA 1Q1BA 3OIQA 4A93B 2K6AA 2PO4A 2A6ED 4UDUC 1TWCB 1II3A 1TIID 5C4ZA 3VYTA 1VF5C 2MGSA 3PIO3 3OPOA 2AQ1B 1SJHD 5NUCA 4KY6A 2XRSD 2QCPX 2JXMB 1XXGA 2O5IC 3TP6A 1ICWA 1BCPF 2TMPA 3J7YW 1AN8A 2NVTB 1FNVA 3JAME 3ND8A 1ENCA 3OW7A 4K5VA 1RDPD 3D4WA 1VDZA 2QILA 5KYLA 2HUGA 1WTQA 4B9WA 1B4OA 4I65A 1SNOA 2EJFC 3Q24A 2NN6H 1OXSC 3K58A 4FVMA 1FR3A 3KF8A 3BYTB 5E4XA 1IHZA 5IGEA 2A6HC 3CRKC 5LHY1 2VXWA 4EGVA 3IAYA 2RSOA 4FXDA 4K6DA 2IL8A 4RGMA 3X3NA 1GUOA 2F0QA 1PTOB 1HRJA 5DM63 2DY7A 2B8FA 3W3AA 4RGTA 2WP8J 1I4HA 1WTWA 1W6JA 3G7LA 4UAIA 1EY9A 3SXHA 3WOEA 1EYCA 2JP1A 3ERQA 4KKTA 1PXUA 2A68D 4KMUC 3KLSA 2NVQB 2E76C 1DOLA 1QILA 2NBFA 4ZUIA 4HR7B 3T53B 4DXFA 5CBAE 4TQUS 4OO1G 4XYOA 1KDCA 1SEBD 1ZKOA 4EQPA 1YNND 4H7BA 3A8IE 3QJYA 4ZKCB 5C0XI 2A74C 5T1IA 4ZLTF 4QUCA 3TSSA 2EZVA 4QUFA 4A3GB 3MHBA 4HTHA 2HCCA 2EVBA 4ZQ3A 3TMEA 2H1EA 2F0OA 1QB5D 1JWSD 3OHXC 1CI3M 2B8GA 1PTOF 5IOCA 3K5OA 2NWGA 4IUTA 1FNUA 4R8IA 1CTMA 5IGCA 3M3YB 1LTID 2K5DA 3S1RB 2AQ3B 1SSOA 1GJXA 2NB0A 1O80A 3NWSA 1BBXC 4R9WA 1G2SA 2FHTA 1AZQA 1A15A 3WDNA 3DWQA 1CT1D 3HG9A 4NP5A 4RWSC 4DK1A 1LTGD 3TP8A 1J9OA 3AB9A 2XNAC 2RA4A 1SYDA 1RHPA 4QF4A 1DOMA 2XVSA 3TP5A 5HGTA 3K6OA 1EY7A 2JA6B 2XWBB 4OO1I 1SJED 2E2JB 1I4XA 2M00A 4B9XA 2MPMA 3WOFA 2KEDA 1D2BA 3C2PA 2IX3A 3IFTA 1EQVA 1B50A 4M8AA 4Z9CB 1CFMA 3HOUB 1LO5D 2ICEC 1BO0A 1K8OA 1M4VA 2EY5A 3HRZC 2O2LD 5EPJA 4V0BA 1TR5A 1TVXA 4WORA 4C3JG 2ZXPA 2EDGA 1DOKA 1E0BA 1HFGA 2XN9C 3SR1A 1PYWD 5DEHA 3V96A 3RD4A 4N9TA 1L0XB 4IFDG 1EYDA 1GHJA 1IYUA 1IW7D 3NQTA 5JJZA 3H94A 5JAVA 4F87A 3EROA 1H9JA 4CKCA 4DXGA 1I50B 2BDNA 1HTLD 3C46A 1V8QA 4BA2I 3E5SA 1JOKA 4LAAA 1HUMA 1BNZA 3E0JA 4CGYB 4OGQC 3FDTA 2PYKA 3TP7A 2NN6I 2OXPA 2CW0C 2B2VA 3K5NA 2TSSA 2I46A 4ABNA 2IX1A 3ONAB 2D9UA 2D62A 3TDQA 1MD2D 2K05A 3DM1A 4XDXA 4C3HG 4QMGA 4X3UA 5M3MB 2HDMA 1CA6A 1TKWB 2I07B 3PV0A 5C6AA 1DD2A 1Y1WB 3K5MA 2Q8IB 3S16B 3H91A 1TS3A 2F3VA 1SE3A 3SE0A 5FLXL 3GTMB 3FPPA 2EJGC 2F4IA 5ELFA 1DM0B 2RQXA 1DZ1A 1SYBA 4KHZA 1F77A 2F0LA 2EE1A 1U4PA 1JE4A 1PFMA 1STYA 3SK4A 3NTKA 1CZWA 5M3FB 3ZYYX 3FPUB 2F0MA 1RTOA 2X6LA 5K36G 5D14A 3X3MA 2L4NA 1V1PB 3A7AB 3D3RA 2HQEA 4IFDI 1Q90A 1STHA 3S15B 2EYJA 4KY5A 3S1NB 1SMYD 5CMDA 2B2TC 3CHBD 3BYYB 4IUPA 5JEAH 3DEPA 4MN3A 1ENFA 3DUZA 1TWAB 3QOLA 2PQEA 3D4RA 1EEID 2KCCA 1SNCA 2KECA 3N52A 1B9MA 3VA5A 1LTSD 4RCOA 1YNJC 1WCMB 3T56B 1PZKD 1IKMA 3KBGA 3NUCA 1PRTF 1BCPD 5EKIA 1TS4A 4HCEA 1H9KA 3GTQB 4FF1A 1PRTC 2F0KA 1PTOH 2F0VA 3NE5B 1S5BD 1RTNA 2LY7A 1PFNA 1STAA 1U4RA 2LS01 4RGNA 2CHBD 3GTJB 4WRDA 5ISRA 3MTSA 5C0XH 1GXDC 2BOSA 2KEEA 4NKLA 2MUYA 1Q1EA 2H4OA 2XWJB 2B2YA 3SK5A 1WTXA 2RDFA 3DWPA 2ZXRA 4A3BB 2EOTA 4RAUC 3FEWX 1V1PA 4ZAIA 3KLRA 3I4MB 4IN3A 1X3QA 2Z4IA 5C4XB 1STEA 1TU2B 1ESFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0M A;  4WOR A;  4EQO A;  2F0N A;  2SNM A;  3C1E A;  1SND A;  1A2T A;  2EYP A;  2F0U A;  2F0H A;  4K8J A;  4PMB A;  5I9P A;  5EKK A;  5C5L A;  2RBM A;  3ITP A;  4PMC A;  5EGT A;  5CV5 A;  3SR1 A;  5IGG A;  2F0W A;  5CGK A;  4KY7 A;  5IOC A;  1ENA A;  1AEX A;  1RKN A;  4R8N A;  5CV6 A;  4YIJ A;  5DEH A;  4E6I A;  4K5X A;  2KQ3 A;  2HQE A;  5J1Z A;  4F8M A;  1IHZ A;  5IGE A;  4N9T A;  2KHS A;  5EKL A;  5IGF A;  1KDB A;  1EY6 A;  1STH A;  4KD4 A;  5DAU A;  2EYJ A;  2EXZ A;  4DU9 A;  4K2L A;  1EYD A;  3R3O A;  3DMU A;  4K8I A;  4KY5 A;  3SK8 A;  5IGC A;  2PZW A;  2EYF A;  1A3T A;  2RKS A;  3BDL A;  1NSN S;  3EJI A;  3NHH A;  3P1H A;  4ID6 A;  2OF1 A;  4K14 A;  4QB4 A;  3EVQ A;  5CC4 A;  3NQT A;  3P75 A;  5CV8 A;  4K6D A;  5E3F A;  1A3U A;  2F0P A;  5CV9 A;  3QOJ A;  5JAV A;  4OL7 A;  1NUC A;  2F0S A;  1SNM A;  3NXW A;  3SK6 A;  1KDA A;  5KEE A;  5IIF A;  2F0E A;  3ERO A;  3MEH A;  4RKL A;  1F2Y A;  5KRU A;  4NMZ A;  5F2D A;  2OEO A;  2F0G A;  2F0Q A;  3MVV A;  3U9O A;  1EY8 A;  1KAA A;  3QOL A;  2PQE A;  4J1M A;  4K5W A;  1SNQ A;  3E5S A;  1JOK A;  5M9O A;  5C3W A;  3HEJ A;  1KAB A;  2F0J A;  4LAA A;  4RKB A;  5KIX A;  1SNC A;  1TT2 A;  2PW7 A;  3D8G A;  4PNY A;  2EY1 A;  4N9P A;  3T16 A;  3VA5 A;  1A3V A;  4NP5 A;  1II3 A;  3HZX A;  2PYK A;  3MXP A;  2EYL A;  3TP7 A;  4KHV A;  3C1F A;  4DGZ A;  1EY9 A;  5C4Z A;  2OXP A;  3OWF A;  3PMF A;  1EYC A;  5JOB A;  3SXH A;  3TP8 A;  3ERQ A;  1EZ8 A;  1F2M A;  2EYM A;  3MZ5 A;  5KYI A;  4KTA A;  1SYE A;  2O4X A;  2SNS A;  3NUC A;  5CR3 A;  5NUC A;  1SYC A;  2EYO A;  2F0I A;  2EY6 A;  2F0T A;  1JOR A;  4KY6 A;  4DFA A;  1TQO A;  1SYD A;  2F3W A;  1JOQ A;  4QF4 A;  2F0K A;  3RUZ A;  1STB A;  2F0V A;  5KGU A;  2NUC A;  5IGB A;  1STA A;  4G57 A;  5HUR A;  1SYG A;  2PZT A;  3D4D A;  3NK9 A;  1EYA A;  3H6M A;  3OMG A;  4NDX A;  4QMG A;  3TP5 A;  4DF7 A;  4S3S A;  4KV6 A;  5HGT A;  2WAC A;  3V2T A;  1EY7 A;  4WRD A;  4ZUI A;  2F0D A;  3D6C A;  1F2Z A;  1STN A;  5C6A A;  5ISR A;  5C5M A;  5CV7 A;  3T13 A;  4IAL A;  2M00 A;  3TP6 A;  4B9X A;  2EY2 A;  2LKV A;  4ME5 A;  2F3V A;  4MIU A;  5I6Y A;  4NKL A;  4KJO A;  4J6H A;  5J39 A;  1KDC A;  1A2U A;  3OSO A;  1SNP A;  2ENB A;  4KD3 A;  3SK5 A;  4IUN A;  4EQN A;  4K2K A;  1EQV A;  2PZU A;  2EYH A;  4KJN A;  2RDF A;  5E1F A;  3S9W A;  4EQP A;  1ENC A;  4IZ8 A;  4K5V A;  4H7B A;  1SYB A;  5C4H A;  4HMJ A;  1JOO A;  2F0L A;  3DHQ A;  3D4W A;  1EY5 A;  1EY0 A;  5CV4 A;  5J22 A;  4TRD A;  3QB3 A;  5KYL A;  3BDC A;  3OMC A;  4ODG A;  4F7X A;  1STY A;  5IOD A;  3SK4 A;  1EZ6 A;  1SYF A;  4B9W A;  2F0F A;  3MHB A;  4I65 A;  5C3X A;  4HTH A;  1U9R A;  5I6W A;  5I9O A;  1SNO A;  2PW5 A;  4EVO A;  5IGD A;  5K5P A;  4ZUJ A;  1EY4 A;  2QDB A;  3SHL A;  2EY5 A;  4ZQ3 A;  3TME A;  3LX0 A;  2F0O A;  1STG A;  2SOB A;  3NP8 A;  4HMI A;  1TR5 A; 
#chains in the Genus database with same CATH topology
 4I7Z C;  2F0N A;  1S5E D;  2F0U A;  4PMB A;  5I9P A;  1GUN A;  4PZ8 A;  4MZ9 A;  2VB3 X;  2FJ2 A;  5CV5 A;  1ENA A;  2HIX A;  4HJ8 A;  5ELE A;  3MFY A;  4NXN L;  1R9T H;  3Q23 A;  3NQI A;  2JSO A;  3HOZ G;  2R92 B;  1HTP A;  1I4P A;  3Q22 A;  2B63 B;  3R3O A;  3D31 A;  1YBY A;  2EYF A;  4OON A;  1XNR Q;  4CKE A;  2A73 B;  4X66 Q;  1LAB A;  2DN8 A;  2F0P A;  1K83 B;  1SXT A;  1KNA A;  1FGB D;  3NXW A;  2C5C A;  5FK9 C;  5FO9 B;  2UXC Q;  2LXK A;  4IOC A;  1F2Y A;  5F2D A;  1B2T A;  2K04 A;  2F52 A;  4CBV A;  2IW3 A;  1HZ9 A;  1FJG Q;  3K7U C;  5EJW A;  1J6Q A;  3HGB A;  2JQO A;  5KIX A;  4LUO A;  4PV1 C;  2PW7 A;  3S1R H;  4DR7 L;  1QG7 A;  2FMC A;  1BUV T;  2UUB L;  2VZA A;  4A3K H;  2B3G A;  3K8A A;  4OO1 H;  3K0X A;  2EYM A;  3CW2 C;  3NEL A;  3MZ5 A;  4C3I G;  2E5L L;  4BY7 G;  3IL8 A;  2UU9 Q;  3J81 L;  2OWO A;  3NBH A;  2B2U A;  1W3S A;  1OO9 B;  1KLG D;  5M5Y B;  3EQL C;  4JC0 A;  1W6K A;  2LFN A;  3RLF A;  2NUC A;  1XYI A;  2WAQ G;  4G7H C;  4BBS G;  2CVR A;  5IOD A;  3OOC A;  3V2T A;  4DV2 Q;  3NTH A;  3HOV H;  5FO7 B;  3I56 A;  3KK7 A;  3VR2 A;  3EIV A;  5COY A;  2WKD A;  4DR2 L;  1XMO L;  3J7A V;  3A74 A;  4MTN A;  3L9A X;  1A6X A;  5GAG C;  4KJO A;  3TQY A;  3HKZ E;  4IUU A;  1A2U A;  2Q8R E;  3OSO A;  1CZG A;  2OTJ A;  1J5E Q;  4YCU A;  4O0A A;  4A3I B;  4RFB A;  3HOY H;  1EIY B;  3A54 A;  4QJF A;  3UDX A;  3U58 A;  4A3D B;  5JPM C;  4FF2 A;  1PTO D;  3KF6 B;  4JOI C;  3FKI H;  4DUZ Q;  3PO2 G;  5COR A;  3NP8 A;  1F9Q A;  3H3V C;  2DNE A;  2NYZ D;  1I6H B;  5AFW A;  3EA6 A;  4B3T L;  1EIH A;  4CDC C;  1EUJ A;  2VL6 A;  5IYD G;  1C48 A;  3GTK B;  4KN4 C;  5ELC A;  3J81 j;  2PZW A;  4XQJ A;  3HKS A;  5FOB B;  4IPD A;  3KDF A;  2CWA A;  3T1H Q;  1Z6H A;  2QEX A;  2VQE Q;  4FF3 A;  1Q86 C;  3EFX D;  3SK6 A;  3UE1 A;  4GOP B;  3D0F A;  1EY8 A;  1KAA A;  2JEB I;  1G2T A;  1LV9 A;  2F0J A;  1GOZ A;  3J81 E;  2EY1 A;  3LWU A;  3T1Y Q;  2XIW A;  1HA5 A;  4X3K A;  1D8L A;  4OIJ A;  3HOW H;  3NTI A;  3PO2 B;  2M2L A;  1H9M A;  3H0G B;  1JB3 A;  3FMC A;  1JIC A;  4DAV A;  4A3J G;  2IWH A;  3RZD H;  2Z6K A;  5T1G A;  3WWV A;  5FKA C;  4CHT B;  3UDI A;  2YTX A;  4DR4 L;  2A69 D;  3M4O H;  2K50 A;  2IHE A;  2WAC A;  2Z6B A;  1D5X C;  2JA5 B;  1XNR L;  1X56 A;  1CK1 A;  5JEA J;  4X66 L;  3CRL C;  2JA7 B;  4FNF A;  4XXE A;  5M5X B;  2V4D A;  4KKS A;  3KF6 A;  2UXC L;  2BE5 D;  3VYU A;  1VMP A;  4JV5 Q;  1SNP A;  2R6G A;  2MP1 A;  4EQN A;  3A56 A;  4C3J H;  4XT1 B;  5IT9 L;  1FJG L;  2IPK D;  5M5W B;  4DV1 Q;  2WV6 D;  2VY3 A;  1JOO A;  1VQD A;  1D6E C;  1G91 A;  2KOL A;  1EY5 A;  1Y1W H;  4TRD A;  1KTK A;  3OMC A;  4ODG A;  3KFU A;  1SYF A;  1JWU D;  2UU9 L;  4LF9 L;  4IFD H;  4OHJ A;  2RCF A;  5I6W A;  5I9O A;  1QOH A;  1LTA D;  3S2H H;  1LT3 D;  3QO2 A;  3U4V A;  4DNT B;  2D0O A;  2QDB A;  3BS1 A;  3ULP A;  4NB3 A;  1X3F A;  3RZO B;  4EQO A;  4MHE A;  1NAP A;  1K28 A;  1VQ6 A;  4YWM A;  5C5L A;  4LF8 Q;  4DV2 L;  5C0X J;  3FVQ A;  4K5X A;  2PNH A;  5C4J H;  5AJ3 Q;  4BXX G;  2R93 G;  3BU2 A;  3CAM A;  2PI2 E;  3F2C A;  4GOP A;  1PV4 A;  4FF4 A;  1R9T B;  3DMU A;  4DGZ A;  5IP7 H;  2QF7 A;  3BDL A;  4U68 A;  5FLX c;  3P1H A;  4LJZ C;  3MC0 B;  1J5E L;  1Z47 A;  4UP7 A;  1A3U A;  4A3E B;  4LWC A;  4OEM B;  4B3R Q;  4YWK A;  5GRO A;  3CCE A;  1X55 A;  4OIK A;  2F0S A;  3J80 i;  1SNM A;  5LMN Q;  2JA9 A;  5JPN C;  4OXP A;  2I5L X;  4JI5 L;  4HID A;  3KJP A;  3BG3 A;  4J8Q A;  4IPC A;  4H0L C;  3CME A;  3PGZ A;  3JC6 6;  2BA0 A;  4C3H H;  4DUZ L;  1F9R A;  1KAB A;  4BY1 H;  1FD7 D;  1UWV A;  3VR4 A;  3D8G A;  2A6E C;  1NMF A;  1L0W A;  3S1N H;  3M4Y A;  4LF6 Q;  4C1N K;  1YZ6 A;  1SR3 A;  2DY8 A;  2UUA Q;  2ZXO A;  3J7A F;  1S72 A;  3S14 H;  4Y7N H;  5DM7 3;  1Q8I A;  4JI8 L;  4A3K B;  1CHP D;  1WFQ A;  1P8L A;  1SYC A;  2F0I A;  3DWA A;  1AP0 A;  1AW7 A;  4DA2 A;  2QKI C;  2GN5 A;  3GO5 A;  1PYB A;  4L5Q A;  5EQ0 A;  4NDX A;  1TY0 A;  1WD0 A;  1PH3 A;  4G7O C;  1SMX A;  3PQI A;  4GZY C;  4P73 A;  2B2W C;  2D5D A;  3HOV B;  3MWY W;  1QVC A;  1PH8 A;  2NTT A;  3T1H L;  3MFG A;  4GS3 A;  4P75 A;  2LXJ A;  3B6Y A;  1EWH A;  5ELB A;  3I70 A;  3M7G A;  5FLM G;  1WTP A;  4G4K A;  1IL2 A;  4K2K A;  1QUQ A;  4KJN A;  3I7F A;  1QCB D;  3KOJ A;  5JJL A;  3TRE A;  5K36 H;  1Z9F A;  2K75 A;  2JA8 G;  1QE6 A;  3SEB A;  4C2M B;  3HOY B;  3T1Y L;  2RDH A;  2BCO A;  5G3L D;  2WFW A;  1R4P B;  4BBR G;  5LMN W;  1Y1V H;  1NE3 A;  3FKI B;  2IHF A;  2PW5 A;  1IZ6 A;  1S5D D;  4XT3 B;  3LGJ A;  3SHL A;  3CCR A;  1LM0 A;  3K0Y A;  2Y0S B;  1GM5 A;  3IFD A;  4K8J A;  2EPB A;  2HCI A;  3DEO A;  2RVL A;  3PF4 A;  5ELD A;  2VNU D;  2BA1 A;  1XPO A;  1CQV A;  1AEX A;  4YIJ A;  1RCV D;  2K5Q A;  2ICI A;  2VW9 A;  2KQ3 A;  4H13 C;  1HJP A;  2I5H A;  1MKH A;  1JWM D;  3L3O C;  3HOX G;  4A75 A;  1FNW A;  5DAU A;  2UUC Q;  3SK8 A;  5IYC G;  3CCL A;  1UNS A;  3EJI A;  3RN2 A;  4QB4 A;  2XRQ D;  3NHH A;  3EVQ A;  4JV5 L;  5E3F A;  1FVI A;  2I0Q A;  2J4X A;  1B53 A;  3MA2 B;  4DV1 L;  1TS2 A;  1PRT D;  3F2U A;  4NMZ A;  3CC4 A;  2AKW B;  3VYS A;  1PYS B;  3E3X A;  3HKZ B;  2F4V Q;  3GD7 A;  1SNQ A;  4EQ5 A;  3HEJ A;  4JBM A;  3W1G A;  2AWN A;  1ZYR C;  4HED A;  1WTR A;  1NR4 A;  1F9P A;  1PVO A;  3P7J A;  3S24 A;  3H3V H;  5EAY A;  1I5F A;  1K83 H;  2G5D A;  3H09 A;  2FIN B;  4KTA A;  1K3R A;  1CSQ A;  2SNS A;  4CKB A;  1IL8 A;  4AYB G;  2A68 C;  3HOW B;  1ET6 A;  4LF8 L;  2HHH Q;  1KNE A;  3G4S A;  1VQ8 A;  2QA4 A;  3VR3 A;  4DV0 Q;  1CKN A;  4Q0F A;  2PMZ E;  3RZD B;  5AJ3 L;  1N8R C;  1A0I A;  1EYA A;  1O78 A;  3CF5 A;  1E2W A;  2A8V A;  3M4P A;  4A3F G;  1PH4 A;  1X54 A;  3M4O B;  3T13 A;  2L15 A;  4C56 C;  4NW2 A;  4B3R L;  5LMN L;  2Z1C A;  4HN7 A;  4J6H A;  5IYB H;  3PF5 A;  1HNW L;  3T4A C;  1D1I A;  2UXD Q;  1BQQ T;  2IX0 A;  1RD9 D;  3W1B A;  4C3J B;  3GDE A;  3PO3 G;  2B2V C;  1SDF A;  1EY0 A;  2FFK B;  1LT5 D;  1N33 Q;  3HOZ H;  3PUZ A;  3PIP A;  2XSC A;  3EN2 A;  4HAE A;  2PQA B;  3IRB A;  2I5M X;  3Q0A A;  1Y8P B;  4RHS A;  5EBD A;  1IYV A;  1MBY A;  1WD1 A;  3AFP A;  3S2H B;  4JI3 Q;  1PRT B;  2J7Z A;  1I3Q H;  2R7Z G;  1SND A;  1EIF A;  1S3O A;  1HXY D;  1B9N A;  5EGT A;  4POF A;  4X64 Q;  1MI2 A;  1QJO A;  4F8M A;  4I7A A;  3U9S A;  2OT2 A;  4HIK A;  5EKL A;  1KDB A;  1L2F A;  2NVY H;  1XNQ Q;  3GTP B;  2K4K A;  5C4J B;  4X62 Q;  3OYY A;  1ZEQ X;  3H15 A;  4C3I H;  4BY7 H;  4QCL A;  3E9H A;  1ICF B;  1GUG A;  2O5J C;  1V43 A;  3VR5 A;  1VQ4 A;  4HCS A;  4RKL A;  1PDQ A;  1VQE A;  5KRU A;  2VUM G;  1DCZ A;  4K5W A;  2PPB C;  4IFD J;  4BBS H;  4ALP A;  5M9O A;  2FMM A;  5C3W A;  3GTK H;  2G9D A;  4BWG B;  1NJI C;  4LFC Q;  3LNN A;  1TT2 A;  4C3H B;  3PO3 B;  1A3V A;  1JJG A;  3HZX A;  4BY1 B;  2AUJ D;  4TKO B;  4O1N A;  1MIU A;  1F2M A;  3F2D A;  3BZD B;  3T51 B;  1LT4 D;  1K8M A;  3S17 H;  4R4C A;  2BDO A;  3S14 B;  4Y7N B;  4DFA A;  5JVH 3;  3R93 A;  2N3S A;  4L6T B;  1EQT A;  3TS0 A;  2E2H H;  2EQS A;  3AFQ A;  1EWI A;  4A3C G;  2Q2T A;  2K32 A;  4KI0 A;  1EQQ A;  3TZU A;  1LTR D;  2WB1 G;  3D6C A;  3JAM i;  1CA5 A;  3RLO A;  3SGI A;  3PO2 H;  2EY2 A;  1GKH A;  4ME5 A;  5A2Q L;  3H0G H;  1UE1 A;  3CKI B;  5J39 A;  1IBK Q;  1L0Y B;  2F1M A;  2CQA A;  2DNC A;  4FYD A;  3K57 A;  3VR6 A;  2EYH A;  2QDL A;  3S9W A;  3ND9 A;  2PQA A;  3Q6S A;  2CH4 W;  4IZ8 A;  4X3T A;  4HMJ A;  2EJM A;  3RN5 A;  2WII B;  2VUM B;  1SE4 A;  1E2V A;  3QB3 A;  3TS2 A;  5IYD H;  5FLX E;  4LFB L;  4LFA Q;  2YU9 H;  1I4Q A;  2K5H A;  4NPS A;  3GP7 A;  4CJ0 B;  2HHH L;  2PNR C;  1VQH A;  1Y1V B;  1STG A;  4HMI A;  3K59 A;  4DV6 Q;  3I72 A;  4DV0 L;  4IAL A;  2A5H A;  2EYP A;  4CDE C;  1RF2 D;  2L55 A;  4PMC A;  1O7Z A;  5EPL A;  1B44 D;  3CC2 A;  5J1Z A;  2SDF A;  3STB D;  1YJ9 A;  4IUV A;  1E24 A;  4HJ7 A;  2CKZ B;  2A6H D;  3PIO A;  1KLU D;  1JCK B;  3FP9 A;  1IW7 C;  2CCZ A;  2K33 A;  2ALY B;  2OF1 A;  3E6Z X;  2UXD L;  3BDO A;  1XWE A;  4GKJ Q;  1R4Q B;  1I4G A;  4YCW A;  1S5F D;  4A3J H;  2J0T D;  3AU7 A;  3MXN A;  4FXG C;  3U9O A;  4OWW B;  5ELO A;  5I2X A;  3UDG A;  1UEA B;  5E7N A;  3F1Z A;  3BVM A;  4PG3 A;  1WI5 A;  2E2I H;  4X3S A;  3HP3 A;  1QNK A;  1ONL A;  2JK8 A;  1HFN A;  4GN3 B;  5D65 A;  4A3E H;  1UE6 A;  4JI3 L;  2RF4 A;  1SYE A;  2K5W A;  1T5E A;  1S40 A;  3L2P A;  2F0T A;  4F88 A;  4GLX A;  3R2T A;  1D5Z C;  4X64 L;  4A93 G;  4JK1 C;  5KGU A;  4BA1 I;  5A2Q E;  1AE3 A;  1QWY A;  3H6M A;  4JBW A;  1DON A;  4S3S A;  1F9S A;  3LWE A;  2F0D A;  4X62 L;  2KHJ A;  4DV4 L;  3PUV A;  3C3L A;  1HHV A;  3I4N G;  1MJC A;  1D7Q A;  4L8J A;  3KLS X;  1GVP A;  4IPH A;  1X9N A;  1BKB A;  3KLW A;  4DR5 Q;  2ENB A;  4IUN A;  4RGO S;  4RA8 A;  2L9H A;  4HSV A;  4N8X 1;  2KUM A;  1PH6 A;  1M8A A;  5LL6 X;  3H3V I;  4BXX H;  1QZG A;  1C4Q A;  5I2Y A;  2B2U C;  3CC7 A;  1WVL A;  2JE6 I;  3NWT A;  1AFP A;  1UAP A;  3HOZ B;  5IGD A;  1B7Y B;  2MO1 A;  3KF8 B;  2SNM A;  4FO2 A;  2D2C C;  1ESR A;  1TWH H;  5DNF A;  4C2M H;  5IGG A;  1I3Q B;  1N9W A;  4PZ7 A;  4DUY L;  1KXL A;  2ZJP A;  3V05 A;  3A8J E;  2PCF B;  5D3D A;  1YIT A;  2PMZ B;  1HQM C;  4KD4 A;  3I3C A;  1SMY C;  3CU7 A;  4ID6 A;  3DLL A;  4K14 A;  4JI2 Q;  1IBK L;  2RDG A;  2NVY B;  1BOS A;  4JOI A;  5JEA G;  3I4N B;  1IXR A;  4OL7 A;  4IPG A;  1SFO H;  3TN2 A;  4C3I B;  3MEH A;  4BY7 B;  4OWX B;  4H44 C;  4ZKB B;  2F0G A;  4QL5 A;  4RMF A;  3O13 A;  4RKB A;  1DYQ A;  3MXG A;  2WAQ B;  4PNY A;  4LFA L;  1P16 A;  4BBS B;  3ULL A;  4RHR A;  3CCV A;  3K7A B;  1BR9 A;  1S4Z A;  1Y14 B;  2C9O A;  5IIF A;  5KNC A;  1XX8 A;  2ZT9 C;  3I90 A;  3VYR A;  4DV6 L;  1BCP C;  2RSN A;  1GO3 E;  4DR6 L;  3MAQ A;  2EYO A;  1WTO A;  2QGQ A;  1SBB B;  4FP5 D;  1TQO A;  3S17 B;  1PLF A;  5HUR A;  2PZT A;  3A7L A;  2JA8 H;  2AUK A;  5C0X G;  2E2H B;  2H5X A;  1STN A;  2LMC B;  1HQR D;  5LMU L;  1IBM Q;  3K81 C;  3J80 c;  4BBR H;  4DAP A;  2L0C A;  1G8Z D;  2Z8L A;  5I6Y A;  2L1B A;  4GNX C;  1JB7 A;  4AYB E;  4DKA C;  1KAW A;  2R61 A;  1EL0 A;  3TBI B;  2GA4 B;  3KUP A;  3Q8D A;  3GTO H;  1EOV A;  4PZ6 A;  1EU3 A;  1BF4 A;  5C4H A;  1G6Z A;  1ILQ A;  5GAH C;  1TWF H;  4RH6 A;  3BDC A;  3HOX H;  2ASB A;  4F7X A;  1IYJ B;  4LUZ A;  1D5M C;  5IYC H;  3CCJ A;  1U9R A;  2L12 A;  4H02 A;  1EY4 A;  5GQO A;  3S1M B;  1C8C A;  1U5K A;  2N55 A;  2YU9 B;  1EEF D;  1IKL A;  2E8G A;  2E74 C;  2K7V A;  1PH2 A;  3AEV A;  3DM3 A;  1NCV A;  2VS1 A;  4R4O A;  1ZXT A;  1VS0 A;  3BVZ A;  4KY7 A;  1ILP A;  4E6I A;  5CV6 A;  3ZJY C;  4WJW A;  4A3G G;  1ZYR D;  2R3Z A;  1F2L A;  1X3G A;  1Q8K A;  4DU9 A;  2DJF C;  1E1O A;  1A3T A;  1PFS A;  1BDO A;  4B08 A;  2OCE A;  4HJ9 A;  5CC4 A;  4DR5 L;  5CV8 A;  3I73 A;  3TZD A;  1VF7 A;  1Q82 C;  4QIW E;  2AHO B;  4LW1 A;  1NR2 A;  1AH9 A;  2E2D C;  4ILW A;  4P2C B;  4JYA Q;  4A3J B;  2IY5 B;  2A1A A;  5TSS A;  1CQF A;  4GKK Q;  2LSS A;  3GTP H;  1HPC A;  3T16 A;  4M1U B;  4A3F H;  5CBE E;  2R7F A;  4KHP Q;  2E2I B;  4YY3 Q;  2CW0 D;  1PHJ A;  3PUY A;  1MGS A;  5C3E G;  2N88 A;  1EU4 A;  1HZB A;  4CJ2 C;  1N34 Q;  3QIA A;  5IGB A;  2NZ1 D;  2QW7 A;  4CJ1 B;  1O7L A;  1H9R A;  3PO3 H;  2K03 A;  4DK0 A;  3M4Q A;  4X6A H;  5CV7 A;  3A8K E;  2LKV A;  4BS9 A;  1JR0 D;  1B8A A;  1V1O A;  4KD3 A;  5E1F A;  2R7Z H;  2ID0 A;  2JA6 G;  1ROD A;  2MJ8 A;  1TS5 A;  2WIN B;  1PTO C;  1Z7T A;  2JN4 A;  5CV4 A;  3P20 A;  2WB1 E;  4G7Z C;  1DGS A;  2JYO A;  1I94 Q;  4JI6 Q;  2YYZ A;  2KCT A;  1GD7 A;  1WJJ A;  3G6J B;  2F0F A;  5IT9 E;  2QEJ C;  3L7Z C;  5C3X A;  1KD1 C;  2R93 B;  4AQY Q;  4EVO A;  4ZYS A;  2VQE L;  2B2W A;  1DXM A;  1FYC A;  4U67 3;  3LX0 A;  5BN5 A;  3CPW A;  1JC7 A;  3C1E A;  3M9B A;  4LMQ D;  4XTC S;  5CYU A;  5GAD C;  3ITP A;  5FO8 B;  5C3E B;  2F0W A;  2VUM H;  1BVS A;  3HOU G;  1RKN A;  1E1T A;  1TWH B;  1VQK A;  3KBX A;  4MNO A;  4K2L A;  2NN6 G;  1WOC A;  4A76 A;  2MQH A;  1VMC A;  1ASY A;  1MHW C;  5CV9 A;  1Y8O B;  4DR1 Q;  1HA6 A;  1TY2 A;  2VB2 X;  2A19 A;  2F0E A;  4JW0 A;  3MVV A;  3U50 C;  1SFO B;  4UHV A;  3S1Q H;  3E9I A;  1PFB A;  3PUW A;  4A3C H;  1M1K C;  4ZK9 B;  2KEN A;  4KK7 A;  4B3M Q;  1OXV A;  3MXU A;  2EYL A;  3OWF A;  1YNJ D;  1A8V A;  2N78 A;  2O4X A;  3I8Z A;  4K6L A;  3J80 L;  4NXM Q;  4WJ4 A;  1H9S B;  2K28 A;  4HJ5 A;  2NVX B;  3RUZ A;  3GTL H;  1TWG H;  4V19 0;  2L5T A;  1LTT D;  4G57 A;  1SYG A;  2A69 C;  3NPP A;  3CCS A;  1X3P A;  1L1O B;  4DF7 A;  2KVM A;  1GUT A;  1CHQ D;  4QGU A;  2JA8 B;  2N49 A;  5C5M A;  5LL6 S;  5A35 A;  1JMC A;  2G9H D;  3NEN A;  1SAP A;  2L11 A;  2BE5 C;  4BBR B;  5JVG 3;  1Q3L A;  3SVM A;  1B1Z A;  4JYA L;  2JJQ A;  1NY4 A;  4JPB W;  1MSH A;  3W2D A;  5KNB A;  1UUP A;  5M3M G;  2K52 A;  1RJT A;  4DNR B;  1HZC A;  3S2D H;  1X32 A;  2AWO A;  2Q2I A;  3G71 A;  3GTO B;  3OTO Q;  3FHW A;  4DAM A;  1N36 Q;  1Y8N B;  1TWF B;  3GTG H;  4C1N I;  1YHB A;  3HOX B;  3QG1 A;  2GVB A;  5C44 G;  4JBK A;  1GHK A;  4DAY B;  2B39 A;  3BVG A;  2Z4H A;  4DV7 Q;  2RCN A;  5BN3 A;  2ES2 A;  1VQ5 A;  3JAM c;  5EKK A;  1FL0 A;  1YNN C;  2KBN A;  2MHV A;  1E3P A;  4LNQ A;  1JQY D;  1AZP A;  5M3F G;  4LF6 L;  4HSP A;  2Q8T A;  1K73 C;  5I4D A;  4AIM A;  5IGF A;  4DR3 Q;  4XQQ A;  1C0A A;  2EXZ A;  2UUA L;  3EBE A;  4K8I A;  3HS0 C;  1OXT A;  1QVG A;  1OXX K;  1VQO A;  1QVF A;  2KJX A;  1EWC A;  4QY7 A;  3OIP A;  3QOJ A;  1NUC A;  4XQN A;  1XMQ Q;  5KEE A;  3VDY A;  3URY A;  5E4W C;  3BJU A;  4AYB B;  4A93 H;  4JI0 Q;  3A55 A;  4J1M A;  3L0O A;  4IUQ A;  1H9S A;  2M9V A;  1I94 L;  4JI6 L;  1TWC H;  1L1O C;  1YI2 A;  2B29 A;  4L63 B;  5EPK A;  3J80 E;  1KL9 A;  4N9P A;  4NXN Q;  1VQI A;  4AQY L;  3I2Z A;  3M7N A;  2X69 A;  3MXP A;  1EFW A;  4KN7 C;  3PMF A;  3I4N H;  5JOB A;  4A3F B;  1EZ8 A;  1I6V C;  5CR3 A;  3NSW A;  1LAC A;  4TSS A;  5C44 B;  2WKC A;  1ET9 A;  2F3W A;  1T5X D;  3NK9 A;  1HUN A;  4A3L G;  2CFM A;  4KV6 A;  3E0E A;  1WCM G;  5JJK A;  3K7A H;  3D6W A;  1J8I A;  1SLJ A;  1F2Z A;  2FXQ A;  3TEH B;  3M85 A;  4DR7 Q;  2NVT H;  4DR1 L;  1GUS A;  1JT8 A;  2BH8 A;  2E5L Q;  1MSG A;  1RIP A;  4X65 Q;  2PZU A;  3RNU A;  1BBW A;  2B2T A;  5D3I B;  5G3L F;  4PQX A;  1U4L A;  1WYD A;  1X6O A;  1B3A A;  3SDZ A;  4DAY A;  2R7Z B;  4QIW B;  4B3M L;  1O7Y A;  3CQZ B;  5J22 A;  2UUC L;  4YHH Q;  1K0S A;  2CH4 A;  1EZ6 A;  3GQB A;  4XIG S;  2AQ2 B;  1G29 1;  3KJO A;  3PCO B;  4AH6 A;  1T9H A;  2RHS B;  4A3B G;  2F0H A;  2RHQ B;  4RCN A;  2F4V L;  1OXU A;  2YV5 A;  2BH2 A;  1YJW A;  4FXK C;  5CGK A;  2Z9H A;  4LF5 Q;  1ML0 D;  4R8N A;  3I4M G;  4IJH A;  4ME3 A;  2KHS A;  3UI2 A;  1LLR D;  1A62 A;  1PH5 A;  3IKJ A;  2K1B A;  5C4X G;  2RKS A;  1PZJ D;  1NSN S;  3S1M H;  1Y69 U;  2R7D A;  1S5C D;  4PMW A;  3PIP 3;  2KCN A;  1E7Z A;  3J81 i;  4L5T A;  1KDA A;  3N6R A;  2KHI A;  4IOA A;  2KA7 A;  3PUX A;  5H1S E;  1UE5 A;  5L37 A;  1EIG A;  1SE2 A;  4GN4 B;  3OTO L;  1I4R A;  2OQK A;  4MTK A;  2R92 G;  1N36 L;  2SEB D;  2B63 G;  4R4I A;  3NBH B;  4O2D A;  1D1K A;  3S1Q B;  4DN4 M;  4KHV A;  3C1F A;  3FRP B;  2B2Y C;  3GV3 A;  5KYI A;  1E2Z A;  1EFI D;  2WB1 B;  2E75 C;  4ZRZ A;  2K01 A;  4DV7 L;  4A3M G;  1Q7Y C;  2EY6 A;  4WFN 3;  2NVQ H;  1JOR A;  1GUW A;  1BXT A;  1A63 A;  1JOQ A;  4LK1 C;  1STB A;  2HIV A;  4CDF C;  1OTC A;  1PH9 A;  4WJ3 M;  3OWE B;  3TRZ A;  3D4D A;  3OMG A;  4O42 A;  1U4M A;  4ZCK A;  4DR3 L;  3GTL B;  1TWG B;  1N33 L;  3ULJ A;  3RR5 A;  1DJR D;  2HQL A;  3CCU A;  5KND A;  1WTV A;  1XPR A;  1Q12 A;  4MIU A;  3I91 A;  3BZC A;  1XMQ L;  1LT6 D;  1HCZ A;  3G6E A;  3VA7 A;  1JE5 A;  4LF7 Q;  2F03 A;  4JI0 L;  2IJ0 A;  2PI2 A;  1PZI D;  4XYQ A;  4DK3 C;  4KKU A;  3DHQ A;  3S2D B;  4DR4 Q;  3JAM L;  1XNQ L;  5ELN A;  4A3G H;  1VCI A;  1X3E A;  1B70 B;  5BN4 A;  1C9O A;  4HIM A;  1PMR A;  4IUR A;  4JI4 Q;  1BCP B;  5K5P A;  4ZUJ A;  4A3I G;  3GTG B;  3R2I A;  2IT1 A;  1XTC D;  2SOB A;  4LUV A;  2K5N A;  4DV3 Q;  4A3D G;  3RMH A;  3GV6 A;  1A2T A;  4A3M B;  4POG A;  2Z0S A;  3DXJ C;  3QWN A;  1QNU A;  2RBM A;  3R8B A;  1CM9 A;  3NBI A;  4LFC L;  1LTB D;  4J15 A;  3M3Y H;  3KDF B;  5IP9 G;  2JEA I;  1EY6 A;  2R93 H;  3F8T A;  2Y0S E;  4IQZ A;  3AMU A;  2X6G A;  4X65 L;  4GNX B;  4LF9 Q;  3P75 A;  1VQ9 A;  2NTS A;  5EBC A;  2HDL A;  3I4L A;  1JJC B;  5C3E H;  1EOT A;  4ULL A;  3K5L A;  3NEM A;  2OEO A;  1VQJ A;  4Q5V A;  1KHI A;  1Q1B A;  4DNI A;  4YHH L;  2CWP A;  3OIQ A;  4A93 B;  1VQL A;  1HZA A;  2K6A A;  2PO4 A;  2A6E D;  4UDU C;  3A5U A;  1TWC B;  1II3 A;  1TII D;  5C4Z A;  3VYT A;  1VF5 C;  2MGS A;  3PIO 3;  3OPO A;  5IE8 A;  2AQ1 B;  1SJH D;  5NUC A;  5DLQ E;  4KY6 A;  4LF5 L;  2XRS D;  2ZTD A;  2QCP X;  1HNZ Q;  1K9M C;  4JI5 Q;  3U4Z A;  2JA6 H;  2E2J H;  1IBL Q;  2JXM B;  1XXG A;  5FJ8 G;  2O5I C;  3TP6 A;  3CCM A;  1ICW A;  3H0G G;  1BCP F;  2TMP A;  3J7Y W;  1AN8 A;  1HH2 P;  2NVT B;  1XPU A;  4JBJ A;  1VQN A;  2NVX H;  4JI8 Q;  1FNV A;  3JAM E;  4JCV E;  5FLM H;  1VQA A;  3ND8 A;  1ENC A;  3OW7 A;  4K5V A;  2JA5 G;  2K5V A;  1RDP D;  2ZTE A;  3HOU H;  1JJ2 A;  2JA7 G;  3D4W A;  1LUZ A;  1VQG A;  1VDZ A;  2QIL A;  5KYL A;  2HUG A;  5JJI A;  1O7I A;  2ZTC A;  1WTQ A;  4B9W A;  3I55 A;  1B4O A;  4I65 A;  1SNO A;  2EJF C;  1VQP A;  1Q81 C;  4GKJ L;  3Q24 A;  2NN6 H;  3W5O A;  1FGU A;  4DPG A;  2YTV A;  1OXS C;  1KC8 C;  3K58 A;  3G48 A;  4A4I A;  3AYH B;  4GNX A;  2EXD A;  4FVM A;  3STB C;  1VQ7 A;  1FR3 A;  3KF8 A;  3BYT B;  5E4X A;  1IHZ A;  5IGE A;  2A6H C;  3CRK C;  5LHY 1;  1E22 A;  1MJE A;  2VXW A;  4EGV A;  3QR8 A;  3IAY A;  4LF7 L;  2F3I A;  2RSO A;  1AE2 A;  4FXD A;  4K6D A;  2Z6K C;  2IL8 A;  4RGM A;  1I50 H;  1CKM A;  3X3N A;  1GUO A;  1TXY A;  2F0Q A;  2MFI A;  4UP9 A;  1PTO B;  1HNX Q;  2YTY A;  1HRJ A;  1KRS A;  4HIO A;  1CSP A;  3HFZ B;  4UY8 C;  5DM6 3;  2DY7 A;  1M90 C;  2B8F A;  1SRU A;  3W3A A;  4JI4 L;  4RGT A;  2WP8 J;  1I4H A;  1WTW A;  4A3E G;  1W6J A;  1W2B A;  3G7L A;  4UAI A;  1EY9 A;  3SXH A;  3WOE A;  1EYC A;  2JP1 A;  3ERQ A;  2DGY A;  3CMA A;  4KKT A;  4DV3 L;  4GLA C;  1PXU A;  1UEB A;  3UE0 A;  2A68 D;  2GVA A;  1PA6 A;  4KMU C;  3KLS A;  4B3S Q;  5M3M H;  2NVQ B;  2ZJR A;  3F2B A;  2E76 C;  1DOL A;  1QIL A;  2NBF A;  1NBW A;  4ZUI A;  4HR7 B;  3S16 H;  3T53 B;  4DXF A;  5CBA E;  4A3K G;  4L5S A;  4TQU S;  4OO1 G;  1QUQ B;  3GTM H;  1LTL A;  5C44 H;  4XYO A;  1KDC A;  1SEB D;  1EQR A;  1K0R A;  4IO9 A;  1ZKO A;  4EQP A;  5HGQ A;  4GOP C;  1YNN D;  4HJA A;  4H7B A;  1VQF A;  3CPF A;  3A8I E;  3QJY A;  4ZKC B;  4P72 A;  3HOV G;  5J3B A;  5C0X I;  4YCV A;  2A74 C;  5M3F H;  5T1I A;  4ZLT F;  4QUC A;  1RL2 A;  3TSS A;  4JI2 L;  2EZV A;  4QUF A;  1K8G A;  4A3G B;  3MHB A;  5IWA Q;  4HTH A;  1KIX A;  2HCC A;  2EVB A;  4ZQ3 A;  3RLN A;  2H1E A;  3TME A;  2F0O A;  1QB5 D;  1HNZ L;  4KLK A;  1JWS D;  3OHX C;  4FDB A;  1HNW Q;  3HOY G;  1CI3 M;  2UXB Q;  1WTH A;  4K0K Q;  1IBL L;  2B8G A;  1PTO F;  5IOC A;  1KQS A;  3CQZ H;  4QQB X;  3K5O A;  4R4T A;  3S15 H;  4JI7 Q;  2NWG A;  4IUT A;  1FNU A;  2HD3 A;  4R8I A;  3FKI G;  1CTM A;  5IGC A;  3M3Y B;  1LTI D;  2K5D A;  3S1R B;  1VQB A;  2V1C C;  4N8F A;  2OTL A;  2Q2U A;  2Y0S G;  2AQ3 B;  1SSO A;  4GN5 A;  1GJX A;  3CCQ A;  2NB0 A;  1O80 A;  1TWA H;  3NWS A;  3J7A 5;  1XTD A;  3CD6 A;  1BBX C;  4R9W A;  3ER0 A;  1G2S A;  2FHT A;  1AZQ A;  1A15 A;  4A3L H;  1IBM L;  3WDN A;  3DWQ A;  1K8A C;  1CT1 D;  1WCM H;  2DJG C;  2N8N A;  3HG9 A;  4NP5 A;  4RWS C;  4DK1 A;  1LTG D;  1CKN B;  3TP8 A;  2NZO A;  1J9O A;  3AB9 A;  2XNA C;  3GTQ H;  2CQO A;  1SN8 A;  3HKZ G;  2RA4 A;  1SYD A;  1RHP A;  4QF4 A;  1DOM A;  2K14 A;  1SE8 A;  3GTJ H;  2XVS A;  3TP5 A;  5HGT A;  4JI1 Q;  3K6O A;  1EY7 A;  2JA6 B;  1G6P A;  2XWB B;  1KRT A;  4OO1 I;  1SJE D;  2E2J B;  1I4X A;  4YWL A;  2M00 A;  3OW2 A;  4B9X A;  1NMG A;  3HOW G;  2NZH A;  2MPM A;  2VQF Q;  2C35 B;  3WOF A;  2KED A;  1D2B A;  3C2P A;  2IX3 A;  3IFT A;  1UE7 A;  1EQV A;  1HNX L;  4A3B H;  1B50 A;  3BZK A;  4M8A A;  4JG2 A;  1N32 Q;  4Z9C B;  3I4M H;  2OQ0 A;  1CFM A;  1K3B C;  3HOU B;  4LF4 Q;  1LO5 D;  2ICE C;  2D0P A;  5C4X H;  1BO0 A;  1K8O A;  1M4V A;  2EY5 A;  3HRZ C;  2O2L D;  5EPJ A;  4V0B A;  4B3S L;  1TR5 A;  1TVX A;  1V1Q A;  3A5Z B;  4WOR A;  4C3J G;  2ZXP A;  1G51 A;  2EDG A;  1DOK A;  1E0B A;  1HFG A;  2XN9 C;  3SR1 A;  1PYW D;  4GKK L;  4GLV B;  2R92 H;  4P71 A;  5DEH A;  3V96 A;  1HR0 Q;  2B63 H;  1Y1W G;  3RD4 A;  4N9T A;  1L0X B;  1YNX A;  4KHP L;  4YY3 L;  4IFD G;  1EYD A;  1GHJ A;  4LFB Q;  4UPA A;  1IYU A;  1IW7 D;  3NQT A;  1CUK A;  5JJZ A;  3H94 A;  4R1J A;  2ZM6 Q;  4A3M H;  2DUD A;  2MO0 A;  3A0J A;  5JAV A;  1N34 L;  4F87 A;  3ERO A;  1H9J A;  4CKC A;  4DXG A;  1I50 B;  2BDN A;  1HTL D;  3C46 A;  1YIJ A;  4DV5 Q;  1V8Q A;  5BR8 Q;  4BA2 I;  3E5S A;  1JOK A;  3MEF A;  1B3Q A;  4LAA A;  1HUM A;  1CKO A;  5IWA L;  1BNZ A;  3E0J A;  4CGY B;  4OGQ C;  4CDD C;  3FDT A;  3K80 C;  5IP7 G;  2PYK A;  2NN6 I;  3TP7 A;  2OXP A;  2CW0 C;  2B2V A;  3K5N A;  5M5Y H;  2TSS A;  2I46 A;  4ABN A;  2UXB L;  4OX9 Q;  3ONA B;  2IX1 A;  2D9U A;  4K0K L;  2D62 A;  3TDQ A;  2WAQ E;  1MD2 D;  2K05 A;  4UP8 A;  3DM1 A;  4JI7 L;  2MNA A;  4XDX A;  1BBU A;  4QMG A;  4C3H G;  4BY1 G;  4X3U A;  5M3M B;  2XGT A;  2HDM A;  1CA6 A;  1TKW B;  2I07 B;  2KCM A;  1C7Y A;  3PV0 A;  5C6A A;  2Q2H A;  3J81 c;  1DD2 A;  1Y1W B;  3K5M A;  1YEZ A;  2Q8I B;  3S16 B;  3H91 A;  1TS3 A;  1L1O A;  2F3V A;  1SE3 A;  4A3I H;  1QZH A;  3SE0 A;  5FLX L;  3GTM B;  2ATW A;  4JVZ A;  3FPP A;  2P5Z X;  1HR0 W;  2EJG C;  3CXC A;  4A3D H;  2F4I A;  5ELF A;  1DM0 B;  1Q46 A;  1NNX A;  2RQX A;  1DZ1 A;  1SYB A;  4KHZ A;  4IJL A;  1F77 A;  2F0L A;  2EE1 A;  1LYL A;  1U4P A;  1JE4 A;  1PFM A;  1SRO A;  5IP9 H;  1STY A;  4Y52 H;  3SK4 A;  3NTK A;  1CZW A;  5M3F B;  4DV4 Q;  2UUB Q;  1I6H H;  3ZYY X;  3FPU B;  2F0M A;  3AQQ A;  1RTO A;  2X6L A;  2HT1 A;  5K36 G;  5D14 A;  3X3M A;  3KYH C;  4JI1 L;  2L4N A;  1V1P B;  4APV A;  3J7Z C;  3A7A B;  5HY6 A;  1NTG A;  2EIF A;  3D3R A;  2HQE A;  4IFD I;  3UDF A;  1V9P A;  1Q90 A;  1STH A;  1PH7 A;  2EYJ A;  3S15 B;  1Y1V G;  4KY5 A;  2VQF L;  1YVC A;  3MXN B;  1ASZ A;  3S1N B;  1SMY D;  3CP0 A;  5CMD A;  3ICE A;  2B2T C;  1VQM A;  4DR2 Q;  4NXM L;  4DK6 C;  3CHB D;  1YHQ A;  1XMO Q;  3ERS X;  3BYY B;  4IUP A;  5JEA H;  3PSI A;  3DEP A;  4MN3 A;  4R4Q A;  1ENF A;  3DUZ A;  4EX5 A;  1N32 L;  1TWA B;  3QOL A;  2PQE A;  2ZJQ A;  5IY0 A;  3D4R A;  1EEI D;  2KCC A;  4DUY Q;  4LF4 L;  4TVA B;  1SNC A;  2KEC A;  1PH1 A;  3N52 A;  1B9M A;  3VA5 A;  5FJ8 H;  2XTI A;  1LTS D;  4RCO A;  1YNJ C;  1WCM B;  3T56 B;  1PZK D;  1IKM A;  3KBG A;  3NUC A;  1PRT F;  1BCP D;  5EKI A;  1TS4 A;  4HCE A;  1H9K A;  1XJV A;  3GTQ B;  4FF1 A;  1PRT C;  2F0K A;  1PTO H;  2F0V A;  3NE5 B;  1S5B D;  1RTN A;  2LY7 A;  1PFN A;  1STA A;  1HR0 L;  1U4R A;  2LS0 1;  3I4O A;  4RGN A;  2JA5 H;  2CHB D;  4B3T Q;  3GTJ B;  1X65 A;  4WRD A;  2JA7 H;  5M5X H;  5ISR A;  3MTS A;  5C0X H;  2ZM6 L;  1EYG A;  4OEL B;  1GXD C;  2BOS A;  2KEE A;  4NKL A;  2MUY A;  1Q1E A;  1H95 A;  2H4O A;  1YHA A;  2XWJ B;  5M5W H;  2B2Y A;  3SK5 A;  4DR6 Q;  4DV5 L;  1WTX A;  5BR8 L;  2RDF A;  3DWP A;  2ZXR A;  4A3B B;  4P74 A;  2EOT A;  4RAU C;  5GAE C;  4RG1 A;  3FEW X;  1V1P A;  4ZAI A;  3KLR A;  3I4M B;  4IN3 A;  4OWT B;  5LMU Q;  1VQC A;  1X3Q A;  1YJN A;  2Z4I A;  4OX9 L;  3RZO H;  5IT9 c;  1U0L A;  5IYB G;  4L5R C;  5C4X B;  2AMC B;  1STE A;  1TU2 B;  1ESF A; 
#chains in the Genus database with same CATH homology
 4I7Z C;  2F0N A;  1S5E D;  2F0U A;  4PMB A;  5I9P A;  1GUN A;  2VB3 X;  2FJ2 A;  5CV5 A;  1ENA A;  5ELE A;  3MFY A;  3Q23 A;  3NQI A;  2JSO A;  2R92 B;  1HTP A;  1I4P A;  3Q22 A;  2B63 B;  3R3O A;  3D31 A;  2EYF A;  4CKE A;  2A73 B;  1LAB A;  2DN8 A;  2F0P A;  1K83 B;  1SXT A;  1KNA A;  1FGB D;  3NXW A;  2C5C A;  5FK9 C;  5FO9 B;  1F2Y A;  5F2D A;  1B2T A;  2K04 A;  4CBV A;  2IW3 A;  5EJW A;  3HGB A;  5KIX A;  4PV1 C;  2PW7 A;  1QG7 A;  2FMC A;  1BUV T;  4OO1 H;  2EYM A;  3MZ5 A;  4C3I G;  3IL8 A;  3J81 L;  3NBH A;  2B2U A;  1OO9 B;  1KLG D;  5M5Y B;  3EQL C;  1W6K A;  2LFN A;  3RLF A;  2NUC A;  1XYI A;  4G7H C;  2CVR A;  5IOD A;  3OOC A;  3V2T A;  3NTH A;  5FO7 B;  3KK7 A;  3VR2 A;  5COY A;  2WKD A;  3J7A V;  3L9A X;  1A6X A;  4KJO A;  4IUU A;  1A2U A;  2Q8R E;  3OSO A;  1CZG A;  4A3I B;  4RFB A;  3A54 A;  4A3D B;  5JPM C;  4FF2 A;  1PTO D;  5COR A;  3NP8 A;  1F9Q A;  3H3V C;  2DNE A;  2NYZ D;  1I6H B;  5AFW A;  3EA6 A;  1EIH A;  1C48 A;  3GTK B;  4KN4 C;  5ELC A;  2PZW A;  4XQJ A;  5FOB B;  1Z6H A;  4FF3 A;  3EFX D;  3SK6 A;  1EY8 A;  1KAA A;  2JEB I;  1G2T A;  1LV9 A;  2F0J A;  1GOZ A;  3J81 E;  2EY1 A;  3LWU A;  2XIW A;  1HA5 A;  4X3K A;  4OIJ A;  3NTI A;  3PO2 B;  2M2L A;  1H9M A;  3H0G B;  1JB3 A;  3FMC A;  1JIC A;  4DAV A;  2IWH A;  5T1G A;  5FKA C;  4CHT B;  2A69 D;  2WAC A;  1D5X C;  2JA5 B;  1CK1 A;  5JEA J;  3CRL C;  2JA7 B;  4FNF A;  4XXE A;  5M5X B;  2V4D A;  4KKS A;  2BE5 D;  3VYU A;  1VMP A;  1SNP A;  2R6G A;  2MP1 A;  4EQN A;  3A56 A;  4XT1 B;  5IT9 L;  2IPK D;  5M5W B;  2WV6 D;  1JOO A;  1D6E C;  1G91 A;  2KOL A;  1EY5 A;  4TRD A;  1KTK A;  3OMC A;  4ODG A;  1SYF A;  1JWU D;  4IFD H;  4OHJ A;  5I9O A;  5I6W A;  1QOH A;  1LTA D;  1LT3 D;  3QO2 A;  4DNT B;  3BS1 A;  2QDB A;  3RZO B;  4EQO A;  4MHE A;  1NAP A;  5C5L A;  5C0X J;  3FVQ A;  4K5X A;  4FF4 A;  1R9T B;  3DMU A;  4DGZ A;  2QF7 A;  3BDL A;  4U68 A;  3P1H A;  4LJZ C;  3MC0 B;  1Z47 A;  1A3U A;  4A3E B;  4OIK A;  2F0S A;  1SNM A;  5JPN C;  3BG3 A;  4J8Q A;  4H0L C;  2BA0 A;  1F9R A;  1KAB A;  1FD7 D;  3VR4 A;  3D8G A;  2A6E C;  3M4Y A;  4C1N K;  2DY8 A;  2ZXO A;  3J7A F;  5DM7 3;  1Q8I A;  4A3K B;  1CHP D;  1SYC A;  2F0I A;  3DWA A;  1AP0 A;  1AW7 A;  4DA2 A;  2QKI C;  3GO5 A;  5EQ0 A;  4NDX A;  1TY0 A;  1WD0 A;  4G7O C;  4GZY C;  2B2W C;  2D5D A;  3HOV B;  3MWY W;  2NTT A;  3MFG A;  1EWH A;  5ELB A;  3I70 A;  3M7G A;  1WTP A;  4G4K A;  4K2K A;  4KJN A;  1QCB D;  5K36 H;  1QE6 A;  3SEB A;  4C2M B;  3HOY B;  2RDH A;  2BCO A;  5G3L D;  1R4P B;  3FKI B;  2PW5 A;  1S5D D;  4XT3 B;  3SHL A;  3K0Y A;  2Y0S B;  3IFD A;  4K8J A;  2EPB A;  2HCI A;  3DEO A;  2RVL A;  5ELD A;  2VNU D;  2BA1 A;  1CQV A;  1AEX A;  4YIJ A;  1RCV D;  2K5Q A;  2ICI A;  2KQ3 A;  4H13 C;  3L3O C;  1JWM D;  1FNW A;  5DAU A;  3SK8 A;  1UNS A;  3EJI A;  4QB4 A;  2XRQ D;  3NHH A;  3EVQ A;  5E3F A;  2J4X A;  1B53 A;  3MA2 B;  1TS2 A;  1PRT D;  3F2U A;  4NMZ A;  3VYS A;  3HKZ B;  3GD7 A;  1SNQ A;  3HEJ A;  2AWN A;  1ZYR C;  4HED A;  1WTR A;  1NR4 A;  1F9P A;  3P7J A;  3H09 A;  2FIN B;  4KTA A;  2SNS A;  4CKB A;  1IL8 A;  2A68 C;  3HOW B;  1ET6 A;  1KNE A;  3VR3 A;  4Q0F A;  3RZD B;  1EYA A;  1O78 A;  1E2W A;  3M4O B;  3T13 A;  4C56 C;  4NW2 A;  2Z1C A;  4HN7 A;  4J6H A;  3T4A C;  1D1I A;  1BQQ T;  2IX0 A;  1RD9 D;  4C3J B;  2B2V C;  1SDF A;  1EY0 A;  2FFK B;  1LT5 D;  3PUZ A;  2XSC A;  4HAE A;  3Q0A A;  1Y8P B;  4RHS A;  5EBD A;  1IYV A;  1MBY A;  1WD1 A;  3S2H B;  1PRT B;  2J7Z A;  1SND A;  1HXY D;  1B9N A;  5EGT A;  1MI2 A;  1QJO A;  4F8M A;  3U9S A;  2OT2 A;  5EKL A;  1KDB A;  3GTP B;  5C4J B;  1ZEQ X;  4QCL A;  1GUG A;  2O5J C;  1V43 A;  3VR5 A;  4HCS A;  4RKL A;  1PDQ A;  5KRU A;  1DCZ A;  4K5W A;  2PPB C;  4IFD J;  5M9O A;  2FMM A;  5C3W A;  2G9D A;  4BWG B;  3LNN A;  1TT2 A;  4C3H B;  3PO3 B;  1A3V A;  3HZX A;  4BY1 B;  2AUJ D;  4TKO B;  4O1N A;  1F2M A;  3BZD B;  3T51 B;  1LT4 D;  1K8M A;  2BDO A;  3S14 B;  4Y7N B;  4DFA A;  5JVH 3;  3R93 A;  4L6T B;  1EQT A;  2K32 A;  4KI0 A;  3TZU A;  1LTR D;  3D6C A;  1CA5 A;  2EY2 A;  4ME5 A;  5A2Q L;  3CKI B;  5J39 A;  1L0Y B;  2F1M A;  2CQA A;  2DNC A;  4FYD A;  3K57 A;  3VR6 A;  2EYH A;  3S9W A;  3ND9 A;  3Q6S A;  4IZ8 A;  4X3T A;  4HMJ A;  2EJM A;  2WII B;  2VUM B;  1SE4 A;  1E2V A;  3QB3 A;  5FLX E;  1I4Q A;  3GP7 A;  4CJ0 B;  2PNR C;  1Y1V B;  1STG A;  4HMI A;  3K59 A;  3I72 A;  4IAL A;  2A5H A;  2EYP A;  1RF2 D;  2L55 A;  4PMC A;  1O7Z A;  5EPL A;  1B44 D;  5J1Z A;  2SDF A;  4IUV A;  2A6H D;  1KLU D;  1JCK B;  1IW7 C;  2K33 A;  2OF1 A;  3E6Z X;  3BDO A;  1XWE A;  1R4Q B;  1I4G A;  1S5F D;  2J0T D;  3AU7 A;  3MXN A;  4FXG C;  3U9O A;  5I2X A;  1UEA B;  3BVM A;  4X3S A;  3HP3 A;  1QNK A;  1ONL A;  1HFN A;  5D65 A;  1SYE A;  2K5W A;  1T5E A;  2F0T A;  4F88 A;  3R2T A;  1D5Z C;  4JK1 C;  5KGU A;  4BA1 I;  5A2Q E;  1QWY A;  3H6M A;  4JBW A;  1DON A;  4S3S A;  1F9S A;  3LWE A;  2F0D A;  3PUV A;  3C3L A;  1HHV A;  4L8J A;  3KLS X;  2ENB A;  4IUN A;  4RGO S;  4RA8 A;  2L9H A;  4HSV A;  2KUM A;  1M8A A;  5LL6 X;  1C4Q A;  5I2Y A;  2B2U C;  1WVL A;  2JE6 I;  3NWT A;  1AFP A;  1UAP A;  3HOZ B;  5IGD A;  2SNM A;  4FO2 A;  2D2C C;  1ESR A;  5DNF A;  5IGG A;  1I3Q B;  3V05 A;  3A8J E;  2PCF B;  5D3D A;  2PMZ B;  1HQM C;  4KD4 A;  3I3C A;  1SMY C;  3CU7 A;  4ID6 A;  4K14 A;  2RDG A;  2NVY B;  1BOS A;  5JEA G;  3I4N B;  4OL7 A;  3TN2 A;  4C3I B;  3MEH A;  4BY7 B;  4H44 C;  4ZKB B;  2F0G A;  3O13 A;  4RKB A;  1DYQ A;  3MXG A;  2WAQ B;  4PNY A;  4BBS B;  4RHR A;  3K7A B;  5IIF A;  1BR9 A;  1S4Z A;  2C9O A;  5KNC A;  1XX8 A;  2ZT9 C;  3I90 A;  3VYR A;  1BCP C;  2RSN A;  3MAQ A;  2EYO A;  1WTO A;  1SBB B;  4FP5 D;  1TQO A;  3S17 B;  1PLF A;  5HUR A;  2PZT A;  3A7L A;  2AUK A;  5C0X G;  2E2H B;  1STN A;  2LMC B;  1HQR D;  4DAP A;  2L0C A;  1G8Z D;  2Z8L A;  5I6Y A;  2L1B A;  2R61 A;  1EL0 A;  3TBI B;  2GA4 B;  3KUP A;  1EU3 A;  1BF4 A;  5C4H A;  1G6Z A;  1ILQ A;  4RH6 A;  3BDC A;  4F7X A;  1D5M C;  1U9R A;  2L12 A;  1EY4 A;  3S1M B;  1C8C A;  2YU9 B;  2N55 A;  1EEF D;  1IKL A;  2K7V A;  2E74 C;  1NCV A;  1ZXT A;  3BVZ A;  4KY7 A;  1ILP A;  4E6I A;  5CV6 A;  4WJW A;  1ZYR D;  2R3Z A;  1F2L A;  4DU9 A;  1A3T A;  1BDO A;  4B08 A;  5CC4 A;  5CV8 A;  3I73 A;  3TZD A;  1VF7 A;  1NR2 A;  2E2D C;  4ILW A;  4P2C B;  4A3J B;  5TSS A;  1CQF A;  1HPC A;  3T16 A;  4M1U B;  5CBE E;  2E2I B;  2CW0 D;  3PUY A;  1MGS A;  2N88 A;  1EU4 A;  4CJ2 C;  3QIA A;  5IGB A;  2NZ1 D;  4CJ1 B;  1O7L A;  1H9R A;  2K03 A;  4DK0 A;  5CV7 A;  3A8K E;  2LKV A;  4BS9 A;  1JR0 D;  1V1O A;  4KD3 A;  5E1F A;  2ID0 A;  1ROD A;  2MJ8 A;  1TS5 A;  2WIN B;  1PTO C;  1Z7T A;  5CV4 A;  3P20 A;  4G7Z C;  2JYO A;  2YYZ A;  3G6J B;  2F0F A;  5IT9 E;  2QEJ C;  3L7Z C;  5C3X A;  2R93 B;  4EVO A;  4ZYS A;  2B2W A;  1DXM A;  1FYC A;  4U67 3;  3LX0 A;  5BN5 A;  1JC7 A;  3C1E A;  4LMQ D;  4XTC S;  5CYU A;  3ITP A;  5FO8 B;  5C3E B;  2F0W A;  1RKN A;  1TWH B;  3KBX A;  4K2L A;  2NN6 G;  1VMC A;  5CV9 A;  1Y8O B;  1HA6 A;  1TY2 A;  2VB2 X;  2F0E A;  3MVV A;  1SFO B;  1PFB A;  3PUW A;  4ZK9 B;  4KK7 A;  1OXV A;  3MXU A;  2EYL A;  3OWF A;  1YNJ D;  2O4X A;  3I8Z A;  4K6L A;  3J80 L;  1H9S B;  2K28 A;  2NVX B;  3RUZ A;  4V19 0;  2L5T A;  1LTT D;  4G57 A;  1SYG A;  2A69 C;  3NPP A;  1X3P A;  4DF7 A;  2KVM A;  1GUT A;  1CHQ D;  2JA8 B;  5C5M A;  5LL6 S;  5A35 A;  2G9H D;  1SAP A;  2L11 A;  2BE5 C;  4BBR B;  5JVG 3;  1Q3L A;  3SVM A;  1B1Z A;  1MSH A;  3W2D A;  5KNB A;  1UUP A;  1RJT A;  4DNR B;  1X32 A;  2AWO A;  3GTO B;  1Y8N B;  1TWF B;  4C1N I;  3HOX B;  3QG1 A;  1GHK A;  2B39 A;  3BVG A;  2Z4H A;  5BN3 A;  5EKK A;  1YNN C;  2MHV A;  1JQY D;  1AZP A;  4HSP A;  2Q8T A;  5I4D A;  5IGF A;  4XQQ A;  2EXZ A;  4K8I A;  3HS0 C;  1OXT A;  1OXX K;  2KJX A;  1EWC A;  3OIP A;  3QOJ A;  1NUC A;  4XQN A;  5KEE A;  3URY A;  5E4W C;  4AYB B;  3A55 A;  4J1M A;  4IUQ A;  1H9S A;  2M9V A;  4L63 B;  5EPK A;  3J80 E;  4N9P A;  3M7N A;  2X69 A;  3MXP A;  4KN7 C;  3PMF A;  5JOB A;  4A3F B;  1EZ8 A;  1I6V C;  5CR3 A;  3NSW A;  1LAC A;  4TSS A;  5C44 B;  2WKC A;  1ET9 A;  2F3W A;  1T5X D;  3NK9 A;  1HUN A;  4KV6 A;  3D6W A;  1J8I A;  1F2Z A;  3M85 A;  1GUS A;  1MSG A;  2PZU A;  2B2T A;  5D3I B;  5G3L F;  4PQX A;  1U4L A;  4DAY A;  1B3A A;  3SDZ A;  2R7Z B;  4QIW B;  1O7Y A;  3CQZ B;  5J22 A;  1EZ6 A;  3GQB A;  4XIG S;  2AQ2 B;  1G29 1;  2F0H A;  4RCN A;  1OXU A;  4FXK C;  5CGK A;  1ML0 D;  4R8N A;  2KHS A;  3UI2 A;  1LLR D;  3IKJ A;  2K1B A;  2RKS A;  1PZJ D;  1NSN S;  1Y69 U;  1S5C D;  4PMW A;  3PIP 3;  2KCN A;  1KDA A;  3N6R A;  2KA7 A;  3PUX A;  1EIG A;  1SE2 A;  1I4R A;  2SEB D;  1D1K A;  3S1Q B;  4DN4 M;  4KHV A;  3C1F A;  3FRP B;  2B2Y C;  3GV3 A;  5KYI A;  1E2Z A;  1EFI D;  2WB1 B;  2E75 C;  4ZRZ A;  2K01 A;  2EY6 A;  4WFN 3;  1JOR A;  1GUW A;  1BXT A;  1JOQ A;  4LK1 C;  1STB A;  3OWE B;  3D4D A;  3OMG A;  4O42 A;  1U4M A;  3GTL B;  1TWG B;  1DJR D;  5KND A;  1WTV A;  1Q12 A;  4MIU A;  3I91 A;  1LT6 D;  1HCZ A;  3VA7 A;  2F03 A;  2IJ0 A;  1PZI D;  4XYQ A;  4KKU A;  3DHQ A;  3S2D B;  3JAM L;  1VCI A;  5BN4 A;  1PMR A;  4IUR A;  1BCP B;  5K5P A;  4ZUJ A;  3GTG B;  3R2I A;  2IT1 A;  1XTC D;  2SOB A;  3RMH A;  3GV6 A;  1A2T A;  4A3M B;  3DXJ C;  3QWN A;  1QNU A;  2RBM A;  3R8B A;  1CM9 A;  3NBI A;  1LTB D;  2JEA I;  1EY6 A;  4IQZ A;  3AMU A;  2X6G A;  3P75 A;  2NTS A;  5EBC A;  2HDL A;  3I4L A;  1EOT A;  4ULL A;  3K5L A;  2OEO A;  4Q5V A;  1Q1B A;  3OIQ A;  4A93 B;  2K6A A;  2PO4 A;  2A6E D;  4UDU C;  1TWC B;  1II3 A;  1TII D;  5C4Z A;  3VYT A;  1VF5 C;  2MGS A;  3PIO 3;  3OPO A;  2AQ1 B;  1SJH D;  5NUC A;  4KY6 A;  2XRS D;  2QCP X;  2JXM B;  1XXG A;  2O5I C;  3TP6 A;  1ICW A;  1BCP F;  2TMP A;  3J7Y W;  1AN8 A;  2NVT B;  1FNV A;  3JAM E;  3ND8 A;  1ENC A;  3OW7 A;  4K5V A;  1RDP D;  3D4W A;  1VDZ A;  2QIL A;  5KYL A;  2HUG A;  1WTQ A;  4B9W A;  1B4O A;  4I65 A;  1SNO A;  2EJF C;  3Q24 A;  2NN6 H;  1OXS C;  3K58 A;  4FVM A;  1FR3 A;  3KF8 A;  3BYT B;  5E4X A;  1IHZ A;  5IGE A;  2A6H C;  3CRK C;  5LHY 1;  2VXW A;  4EGV A;  3IAY A;  2RSO A;  4FXD A;  4K6D A;  2IL8 A;  4RGM A;  3X3N A;  1GUO A;  2F0Q A;  1PTO B;  1HRJ A;  5DM6 3;  2DY7 A;  2B8F A;  3W3A A;  4RGT A;  2WP8 J;  1I4H A;  1WTW A;  1W6J A;  3G7L A;  4UAI A;  1EY9 A;  3SXH A;  3WOE A;  1EYC A;  2JP1 A;  3ERQ A;  4KKT A;  1PXU A;  2A68 D;  4KMU C;  3KLS A;  2NVQ B;  2E76 C;  1DOL A;  1QIL A;  2NBF A;  4ZUI A;  4HR7 B;  3T53 B;  4DXF A;  5CBA E;  4TQU S;  4OO1 G;  4XYO A;  1KDC A;  1SEB D;  1ZKO A;  4EQP A;  1YNN D;  4H7B A;  3A8I E;  3QJY A;  4ZKC B;  5C0X I;  2A74 C;  5T1I A;  4ZLT F;  4QUC A;  3TSS A;  2EZV A;  4QUF A;  4A3G B;  3MHB A;  4HTH A;  2HCC A;  2EVB A;  4ZQ3 A;  3TME A;  2H1E A;  2F0O A;  1QB5 D;  1JWS D;  3OHX C;  1CI3 M;  2B8G A;  1PTO F;  5IOC A;  3K5O A;  2NWG A;  4IUT A;  1FNU A;  4R8I A;  1CTM A;  5IGC A;  3M3Y B;  1LTI D;  2K5D A;  3S1R B;  2AQ3 B;  1SSO A;  1GJX A;  2NB0 A;  1O80 A;  3NWS A;  1BBX C;  4R9W A;  1G2S A;  2FHT A;  1AZQ A;  1A15 A;  3WDN A;  3DWQ A;  1CT1 D;  3HG9 A;  4NP5 A;  4RWS C;  4DK1 A;  1LTG D;  3TP8 A;  1J9O A;  3AB9 A;  2XNA C;  2RA4 A;  1SYD A;  1RHP A;  4QF4 A;  1DOM A;  2XVS A;  3TP5 A;  5HGT A;  3K6O A;  1EY7 A;  2JA6 B;  2XWB B;  4OO1 I;  1SJE D;  2E2J B;  1I4X A;  2M00 A;  4B9X A;  2MPM A;  3WOF A;  2KED A;  1D2B A;  3C2P A;  2IX3 A;  3IFT A;  1EQV A;  1B50 A;  4M8A A;  4Z9C B;  1CFM A;  3HOU B;  1LO5 D;  2ICE C;  1BO0 A;  1K8O A;  1M4V A;  2EY5 A;  3HRZ C;  2O2L D;  5EPJ A;  4V0B A;  1TR5 A;  1TVX A;  4WOR A;  4C3J G;  2ZXP A;  2EDG A;  1DOK A;  1E0B A;  1HFG A;  2XN9 C;  3SR1 A;  1PYW D;  5DEH A;  3V96 A;  3RD4 A;  4N9T A;  1L0X B;  4IFD G;  1EYD A;  1GHJ A;  1IYU A;  1IW7 D;  3NQT A;  5JJZ A;  3H94 A;  5JAV A;  4F87 A;  3ERO A;  1H9J A;  4CKC A;  4DXG A;  1I50 B;  2BDN A;  1HTL D;  3C46 A;  1V8Q A;  4BA2 I;  3E5S A;  1JOK A;  4LAA A;  1HUM A;  1BNZ A;  3E0J A;  4CGY B;  4OGQ C;  3FDT A;  2PYK A;  3TP7 A;  2NN6 I;  2OXP A;  2CW0 C;  2B2V A;  3K5N A;  2TSS A;  2I46 A;  4ABN A;  2IX1 A;  3ONA B;  2D9U A;  2D62 A;  3TDQ A;  1MD2 D;  2K05 A;  3DM1 A;  4XDX A;  4C3H G;  4QMG A;  4X3U A;  5M3M B;  2HDM A;  1CA6 A;  1TKW B;  2I07 B;  3PV0 A;  5C6A A;  1DD2 A;  1Y1W B;  3K5M A;  2Q8I B;  3S16 B;  3H91 A;  1TS3 A;  2F3V A;  1SE3 A;  3SE0 A;  5FLX L;  3GTM B;  3FPP A;  2EJG C;  2F4I A;  5ELF A;  1DM0 B;  2RQX A;  1DZ1 A;  1SYB A;  4KHZ A;  1F77 A;  2F0L A;  2EE1 A;  1U4P A;  1JE4 A;  1PFM A;  1STY A;  3SK4 A;  3NTK A;  1CZW A;  5M3F B;  3ZYY X;  3FPU B;  2F0M A;  1RTO A;  2X6L A;  5K36 G;  5D14 A;  3X3M A;  2L4N A;  1V1P B;  3A7A B;  3D3R A;  2HQE A;  4IFD I;  1Q90 A;  1STH A;  3S15 B;  2EYJ A;  4KY5 A;  3S1N B;  1SMY D;  5CMD A;  2B2T C;  3CHB D;  3BYY B;  4IUP A;  5JEA H;  3DEP A;  4MN3 A;  1ENF A;  3DUZ A;  1TWA B;  3QOL A;  2PQE A;  3D4R A;  1EEI D;  2KCC A;  1SNC A;  2KEC A;  3N52 A;  1B9M A;  3VA5 A;  1LTS D;  4RCO A;  1YNJ C;  1WCM B;  3T56 B;  1PZK D;  1IKM A;  3KBG A;  3NUC A;  1PRT F;  1BCP D;  5EKI A;  1TS4 A;  4HCE A;  1H9K A;  3GTQ B;  4FF1 A;  1PRT C;  2F0K A;  1PTO H;  2F0V A;  3NE5 B;  1S5B D;  1RTN A;  2LY7 A;  1PFN A;  1STA A;  1U4R A;  2LS0 1;  4RGN A;  2CHB D;  3GTJ B;  4WRD A;  5ISR A;  3MTS A;  5C0X H;  1GXD C;  2BOS A;  2KEE A;  4NKL A;  2MUY A;  1Q1E A;  2H4O A;  2XWJ B;  2B2Y A;  3SK5 A;  1WTX A;  2RDF A;  3DWP A;  2ZXR A;  4A3B B;  2EOT A;  4RAU C;  3FEW X;  1V1P A;  4ZAI A;  3KLR A;  3I4M B;  4IN3 A;  1X3Q A;  2Z4I A;  5C4X B;  1STE A;  1TU2 B;  1ESF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...