4EVOA

Crystal structure of staphylococcal nuclease variant nviaga/e122g at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
124
Chain Sequence
LHKEPATLIKAIDGNTVKLMYKGQPMVFRLLLVDIPYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHGQHLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Local flexibility as a determinant of pKa values of surface ionizable groups in proteins
rcsb
source organism Staphylococcus aureus
total genus 37
structure length 124
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4evoA00
4EQNA 3NP8A 3MEHA 1SNQA 2EY2A 2F0UA 5ISRA 1SYFA 3BDLA 2F0FA 5NUCA 2F0HA 3H6MA 2F0OA 1NUCA 2ENBA 3TP5A 5I9OA 5CV7A 3SXHA 3DMUA 4K6DA 4KHVA 3OMGA 1EQVA 4KD3A 5CC4A 4K2LA 4WORA 5J39A 1II3A 2EXZA 4PNYA 5EGTA 4N9PA 1STYA 5IGDA 4IALA 1A3TA 3QB3A 3QOLA 3V2TA 3OSOA 5IGGA 3D8GA 4K8JA 1STNA 3MXPA 3LX0A 4NP5A 5CR3A 3SHLA 2KHSA 4QMGA 3SK8A 3T13A 1NSNS 3OMCA 5CV5A 4MIUA 4ZQ3A 2PZUA 3D4WA 3SK4A 5J1ZA 3OWFA 3RUZA 2EYPA 3MHBA 4KJOA 3SR1A 5K5PA 3SK6A 1TR5A 2F0SA 4YIJA 5DAUA 2EYHA 1F2YA 2EYFA 3EJIA 1EY6A 4KV6A 2QDBA 2F0GA 4NKLA 4KTAA 1STBA 4TRDA 5DEHA 5F2DA 5CV6A 5IIFA 3TP6A 3D4DA 4KY7A 4DFAA 1TT2A 1A2UA 3D6CA 5CV8A 2F0MA 3HEJA 4E6IA 1RKNA 1EZ6A 1KDBA 2PW5A 3T16A 5C6AA 4IZ8A 2EYJA 4ME5A 4QB4A 4F8MA 4DGZA 1STAA 1A3UA 4PMBA 2F0JA 2OXPA 3R3OA 3EROA 2HQEA 4ID6A 4DU9A 5C3XA 5I6WA 3HZXA 5M9OA 1JOQA 1JOKA 1SYBA 5KGUA 2SNSA 1EY5A 2RBMA 5KEEA 3NK9A 4K14A 4NDXA 3TP8A 2F0QA 5EKKA 4NMZA 3MVVA 5I6YA 5KYIA 5CGKA 5CV4A 1EYDA 2SOBA 4KY5A 5KYLA 1SNCA 5E3FA 4RKLA 2PZTA 4K2KA 5E1FA 2EYMA 2M00A 2F0DA 4G57A 4HMJA 3P75A 3DHQA 1EY8A 1KAAA 2F0WA 1SNPA 3PMFA 4ZUIA 1F2ZA 5IGEA 4K5VA 2F0LA 1SYDA 4LAAA 4QF4A 4S3SA 2EYOA 4HMIA 2EYLA 1TQOA 4HTHA 4K8IA 4N9TA 2OEOA 3P1HA 1KDAA 2F0NA 2EY5A 3NQTA 4K5WA 4OL7A 5J22A 2F3VA 4R8NA 1EY4A 1ENCA 5IGFA 5C3WA 2F0KA 4J6HA 2EY6A 2LKVA 3NHHA 2PQEA 5HGTA 2F0IA 1EYAA 5C5MA 5HURA 5I9PA 3ERQA 5KRUA 1STGA 1SYCA 4KD4A 2OF1A 5IOCA 2KQ3A 2NUCA 1EY0A 2PYKA 3QOJA 2F0PA 3TP7A 4EVOA 2RDFA 3ITPA 1AEXA 5IODA 1A3VA 4KJNA 3NXWA 2F0TA 3NUCA 4ODGA 5IGCA 4J1MA 4ZUJA 3SK5A 5EKLA 1EYCA 4K5XA 5C4HA 2O4XA 3MZ5A 1EY9A 1SYEA 5C4ZA 1JORA 1STHA 1F2MA 2SNMA 5JOBA 4RKBA 5KIXA 4IUNA 1SNDA 5IGBA 3C1EA 1SNMA 4B9XA 4I65A 4H7BA 1JOOA 2F0VA 4F7XA 1SNOA 1U9RA 2F3WA 2PW7A 3BDCA 5JAVA 5C5LA 4KY6A 2WACA 2EY1A 3VA5A 4EQOA 1EZ8A 4DF7A 1KABA 1KDCA 2RKSA 4WRDA 1IHZA 3C1FA 3U9OA 5CV9A 4PMCA 2F0EA 2PZWA 3TMEA 3EVQA 4EQPA 3S9WA 1ENAA 4B9WA 1SYGA 3E5SA 1A2TA 1EY7A
chains in the Genus database with same CATH superfamily
3NP8A 1HQMC 3AFQA 4POGA 2JA9A 1Q82C 4LWCA 5FLXE 4DAVA 3J7A5 1TU2B 2BDOA 1IYJB 4R9WA 3CQZH 2G9HD 4WJWA 2X6GA 2GA4B 3S1MB 3A8IE 4A3BG 2F0SA 4ZYSA 1Y8PB 4GN4B 1TT2A 1KLUD 5CV8A 3WOEA 2WINB 2L11A 1P8LA 1KD1C 1R4PB 2WB1B 1ESRA 2YTXA 1SMXA 1SAPA 4DKAC 3FDTA 5C44H 4QJFA 1BQQT 3I2ZA 2Q2HA 5LL6S 2A73B 3PO2G 4BWGB 2QILA 2R7ZH 1LLRD 1EWIA 1PTOH 4OX9Q 1ASYA 3HKZG 1YEZA 4JI1Q 5CGKA 1SE2A 4LF5Q 5I2XA 2JA5G 1PYBA 4LF4Q 4Z9CB 2F0DA 4OONA 1PHJA 4NXNQ 1F77A 5AJ3L 2F0WA 3RR5A 2LXJA 4LF8L 4J15A 4K5VA 4DPGA 4XXEA 1V1OA 5JEAJ 3OW2A 4UY8C 2J4XA 3GO5A 1J9OA 1SEBD 3PO3B 2F4VQ 3K58A 2RCNA 4H44C 3W5OA 4CKEA 1B3QA 4JI1L 2N3SA 4LF5L 4KD4A 1HTLD 3KUPA 2F4IA 2B29A 4EVOA 4PZ8A 5IYBG 4NXNL 1NY4A 2RSNA 5C3EB 1XMQQ 4R8IA 3MZ5A 3NSWA 1M4VA 5C4ZA 2VXWA 3PUZA 4DR2Q 3C1EA 1SNMA 1E24A 3K80C 2KJXA 3M4YA 3FPPA 3URYA 2K32A 3H94A 3C1FA 2Z4HA 5C4JH 2KA7A 4OO1H 3EVQA 3T1HL 5K36H 1U4MA 3SGIA 4B3TQ 2UXBQ 2E76C 5ELFA 3I91A 4L8JA 2PNRC 1HCZA 1WOCA 4KHVA 3J80c 5GADC 4KD3A 4A3IG 4ABNA 4WORA 2NTSA 4ZKBB 4HJ9A 2CW0C 3H0GH 1G6PA 1EEFD 2VQEQ 3C3LA 2UXDL 5IGBA 4JI6Q 2C9OA 1N32Q 3OMCA 4IFDI 4MIUA 3D4WA 3TZUA 2EJMA 1KXLA 3K7AB 3RMHA 1XNRQ 4UAIA 4DAMA 4FF2A 1Y1VG 5BR8L 1TS2A 3HOUB 4B3TL 5DEHA 4TRDA 4P75A 2UU9L 4BBRG 4HIMA 4CGYB 4KY7A 4HR7B 4UP7A 4DFAA 1A2UA 2AMCB 3U9SA 4OIKA 1NMGA 1KDBA 1NAPA 2DY7A 1Y1WG 1N34L 2HQEA 1LT4D 2NZHA 3R93A 1E1TA 4BY1G 5A2QL 1BCPC 1DM0B 2RBMA 2Z1CA 4GKKQ 2I0QA 2FHTA 3RN2A 3G48A 1O78A 1WTOA 5ELDA 3HGBA 1TWAH 4K2KA 1ML0D 5T1IA 2HDLA 4G57A 3HOWB 5JVG3 2IT1A 4C56C 1KTKA 2D0OA 4DR5L 2EYOA 4HMIA 1GKHA 3M3YB 3I4NH 2E2HH 4HIDA 3GTGH 2R92G 3J81c 2K5WA 4I7ZC 4GKKL 2JSOA 4DAYB 4A3MB 1QE6A 2EJGC 3GD7A 1RHPA 1B8AA 1TIID 1SYCA 4JV5Q 4GNXA 1K8OA 1G2TA 1K0SA 1EIHA 1A3VA 4Y7NH 1GO3E 4O1NA 2RVLA 4K5XA 2JK8A 2VB3X 1NJIC 1I4GA 1PTOF 2B63G 3UDGA 1S5BD 2UXCQ 1KNEA 4IUVA 1WCMH 3CQZB 1NR4A 4CDFC 1J5EL 1B3AA 1PH6A 4LF6L 4RGNA 4X3SA 3TN2A 2UUCL 4BA2I 1YHBA 5ELNA 1LABA 1A2TA 3RLFA 1K8GA 2YTVA 1H9SA 2WKCA 3Q23A 1D8LA 2IWHA 5EPKA 2PCFB 4EGVA 2IL8A 1HUMA 4PZ6A 5C44B 4JI8Q 2ZTEA 3D31A 4RG1A 1EIYB 1RD9D 2R7ZB 4A3BH 1PTOB 4DUZQ 3DM1A 1Q86C 2UUAQ 5AFWA 2ES2A 1EY6A 2GVAA 1STBA 1AW7A 3MEFA 1X3PA 3CC7A 2WAQB 3CAMA 4G4KA 1ILQA 4OIJA 4HIOA 4TSSA 4BA1I 1ONLA 4JI8L 2N88A 1CHPD 4JOIC 4PMBA 3CC2A 4P72A 5C3XA 4ID6A 4DU9A 3ER0A 3ZJYC 4JK1C 2HIVA 1Y8OB 4KN4C 3PO2H 5KEEA 5M3FG 3BZCA 4A3FG 3Q8DA 1IL2A 2BA0A 2Z8LA 4DV5Q 1JB3A 3KDFB 2JA5H 4FF3A 3KLWA 3CF5A 1D5MC 3U4ZA 3GQBA 3M9BA 2GVBA 1LTLA 4AH6A 4JPBW 1I3QH 3FPUB 1IZ6A 3WOFA 3TP5A 4N9TA 3NQTA 3TQYA 1XNQQ 2CQOA 1LT5D 5M5YH 2JXMB 1HR0Q 4LFBQ 1U4RA 4JOIA 4FXDA 2WV6D 2QDLA 2LKVA 5C4JB 1FNUA 3G4SA 4JI5Q 2Y0SB 1DOMA 4A3DB 2NVTH 2ZJQA 3PF5A 2NUCA 2PQAB 5IYBH 4K6LA 1DYQA 2KENA 3NQIA 4AYBG 2K5VA 1FVIA 1X65A 5GQOA 3GTKH 1IYUA 2OT2A 1EY9A 3UE1A 4IUNA 1I4RA 1XNQL 3H0GB 4I65A 4GKJQ 2ZJRA 3KOJA 3KK7A 2AQ1B 1GOZA 4JBJA 4JI5L 2IY5B 4ZK9B 1HNZL 4DV1L 3PUWA 4XYOA 4EQPA 1S40A 1B2TA 1V9PA 2CCZA 4N8X1 2PMZE 1H9JA 4CDCC 1LYLA 4X66Q 2FINB 4EQNA 5I4DA 3MEHA 1SNQA 3DEOA 1VQLA 3NTIA 5JJLA 2F0FA 2RF4A 5EPJA 1NUCA 3Q24A 1VQIA 4GOPC 4K6DA 4EX5A 4A3IH 4MTNA 5JEAG 5J39A 5M3MG 4GKJL 2EXZA 3S1NH 4DV7L 1D1IA 2CHBD 3SK8A 4IPHA 1S72A 1BNZA 1SDFA 4X3KA 3SK4A 2TMPA 3CHBD 4KJOA 4LF7L 1Y1VH 4R4CA 1TWAB 3MWYW 1PH7A 4KTAA 4BBRH 4KKUA 1Q8IA 2BH2A 1AN8A 3L7ZC 1E2VA 3CXCA 1JJCB 1BCPF 2R93G 3I4NB 2M9VA 2L5TA 1HA6A 1Y1WH 2E2HB 3GTGB 1A3UA 4GOPA 4X62L 2IPKD 2OXPA 4BY1H 3KJOA 1SYBA 2EQSA 2C35B 1TXYA 1V8QA 2XGTA 1ASZA 3HRZC 2F03A 5IP7G 1CZWA 1VQHA 3TDQA 3AYHB 1SROA 1OXTA 1SNCA 2XVSA 4TKOB 4Y7NB 2KUMA 1KAAA 4FXKC 2HQLA 4LF9L 4LFCL 1SYDA 4LAAA 2G9DA 4MTKA 4UHVA 1PH4A 1RTOA 2OEOA 3P1HA 5EKIA 2JEBI 1YJ9A 2R92H 1DOLA 3NWSA 4GLVB 2D2CC 5IWAQ 1BBXC 4IN3A 2A69D 5M5XH 2F0IA 2Q8TA 5C5MA 4ZAIA 1XTCD 2N8NA 5COYA 5CBEE 1X6OA 2EJFC 1VQ4A 3FEWX 1F9SA 3TRZA 2B63H 4PZ7A 5JOBA 4JYAL 3M4QA 1GVPA 1CA6A 4B9XA 3TEHB 4F7XA 4U68A 4JC0A 3VA5A 1VS0A 4A3BB 1JR0D 2K7VA 2SEBD 3U9OA 2Q8IB 4X64L 2ID0A 5LMUQ 1VQ9A 3V05A 3KYHC 5GAGC 1K73C 5ELEA 3NTHA 1SE3A 3U4VA 1I4XA 1H9RA 2MGSA 1IBLL 1VQBA 1UE6A 1B53A 5ELCA 3OIQA 3PIPA 1QILA 3MA2B 2LY7A 5C0XJ 1A3TA 3QB3A 4RGTA 3PO2B 1MBYA 5LMUL 1NSNS 1EIGA 1HQRD 5CV5A 3HKZB 3S17H 1HZAA 2JA5B 3BS1A 5DAUA 1X54A 2BE5D 4NKLA 1R4QB 5F2DA 3I55A 2D0PA 1BKBA 2QKIC 1PZKD 3NPPA 3W3AA 2NTTA 2PI2E 1FR3A 4IJHA 3HOXG 1R9TH 1RKNA 2PW5A 3T16A 1GUTA 3KF8B 4DR6Q 3UDXA 5M9OA 1KQSA 2YTYA 5M5YB 4JBKA 4YHHL 5KGUA 4NB3A 5M3FH 4JI4Q 4PG3A 3M4OH 4A3FH 1F9QA 2C5CA 2NVTB 3FMCA 3VYTA 1NBWA 5T1GA 5EAYA 1XPOA 3KF6B 1EYDA 1B1ZA 3STBD 5BN5A 4TQUS 1ESFA 1WD0A 3NBHB 4HCSA 2CKZB 4F88A 3GTKB 2WFWA 3M7GA 4C3HH 1HHVA 5CYUA 5DM63 3VYSA 1LTAD 1L2FA 4LFAQ 2L9HA 4A93G 2UUBQ 3K5LA 1D1KA 5IGFA 3BDOA 2PQEA 1S5ED 5JVH3 5E4XA 1LACA 4WJ3M 4P2CB 3TS2A 5IYDG 3ULJA 4RCOA 2PYKA 2MFIA 3CCVA 1JWUD 4B3ML 2VQFQ 4JI7L 1PFNA 1JORA 4A3IB 1AE3A 3E0JA 3J81E 2ZXRA 1JB7A 1JWSD 3BDCA 2A5HA 4POFA 2KCCA 1WYDA 2E74C 1Y1VB 1ENAA 3CRLC 3HOZG 4RHRA 4BBRB 4XT1B 5FLMG 3BVGA 1I94L 2K5NA 3BDLA 3ND9A 4OWTB 4DA2A 5IP9G 1PH3A 1EFWA 2DNCA 4P71A 3SXHA 4ZLTF 5JEAH 5CC4A 3CP0A 5M3MH 1Y1WB 2D5DA 5EBDA 2A69C 4NXML 4IALA 4LMQD 4BY1B 3L0OA 4K8JA 3DUZA 4KKSA 4CKBA 3MXPA 1I50H 2NB0A 1K83H 2BOSA 2XSCA 3NENA 3PUYA 3I4MB 4YIJA 2EYHA 1F2YA 1AZPA 3F2UA 2VB2X 1GUWA 3CCEA 3R2TA 2B2UA 2R93H 3FHWA 4E6IA 3J7YW 4JBMA 2JA8H 4IQZA 5C6AA 1PFMA 2ZM6L 2R92B 2NBFA 1D7QA 1HR0W 1PDQA 1N33L 3R3OA 4LJZC 1CK1A 4CHTB 4JG2A 4DV3L 5IP7H 3GTQH 3LWEA 1EEID 4HEDA 2SOBA 4RKLA 4QGUA 2EYMA 4LUVA 3EN2A 4HMJA 3P75A 3AFPA 2K5DA 4C2MH 5EJWA 2B63B 2KVMA 5AJ3Q 4LF8Q 4H0LC 3GTMH 1VQFA 5J22A 2XRQD 4C3JH 3QO2A 3CMAA 1EQRA 2E2JH 3OWEB 5IE8A 5A2QE 2BE5C 5A35A 2LXKA 4UP8A 1EYAA 3ERQA 3QOJA 4IFDG 2F0PA 4H02A 4DK0A 2RDFA 2FMMA 2JQOA 1LT6D 3OW7A 3CCUA 2F0TA 4DR1L 1GUGA 3E0EA 3CCMA 5FKAC 4O42A 2AWNA 3RZDH 1EWHA 2MJ8A 4KY6A 1YNXA 5JPMC 3JAML 1BBWA 1S5DD 3STBC 4QUFA 3S17B 2PZWA 5JJZA 4ZCKA 5IGDA 1EY7A 2R3ZA 3T1HQ 3QIAA 4CKCA 4B3SL 1PFSA 1YIJA 3H6MA 4DNTB 1ZYRC 1R9TB 4B3RL 1QB5D 2CQAA 2QF7A 2N55A 1FJGL 2ZXPA 1STYA 3PGZA 2VUMG 5M3FB 1SLJA 3M4OB 4A3FB 1AZQA 2UXDQ 2O5JC 2KCMA 1SFOH 1HTPA 5JJIA 3PQIA 4JCVE 5CV6A 5BR8Q 1DOKA 4OEMB 2UU9Q 1YHAA 4C3HB 3LWUA 3HOXH 2YV5A 1WTRA 3BVZA 1YVCA 1YJWA 2NZ1D 1G8ZD 1JQYD 1UAPA 3NE5B 5CORA 3I8ZA 1G291 5J3BA 3HZXA 3G71A 1N34Q 3J7AF 5I2YA 4AIMA 1Y8NB 3TSSA 3K7UC 4RGOS 2QW7A 1SMYC 4L63B 1HZBA 3GTPB 4AYBB 3PCOB 1CKNB 4KY5A 5E3FA 1I5FA 1IXRA 1UEBA 5FO8B 3CCJA 4HIKA 3W1BA 2OQKA 2HCCA 1CKMA 3QG1A 4CDDC 1CFMA 1TQOA 3SVMA 4A93H 4OL7A 4DR5Q 4A3LG 3AU7A 2N78A 1W3SA 4KHPL 4AQYL 1Q3LA 1CA5A 3UI2A 3UDIA 4DXFA 1UE1A 2WB1E 4GNXC 4DXGA 5IYDH 2J7ZA 2PI2A 5C4XB 4RFBA 1TS3A 1SBBB 4TVAB 3MC0B 2NVXH 2LMCB 3HKSA 4DNRB 2RDHA 3SK5A 1PH8A 2MNAA 1SYEA 5M3MB 1EU3A 1SNDA 3I56A 1EFID 3K81C 2EXDA 1UWVA 1D6EC 1VMCA 3M4PA 1IW7D 4KLKA 3DEPA 1I50B 1EZ8A 1IBKL 2WIIB 1J5EQ 4WRDA 4JI0Q 1K83B 2CWPA 1V1PB 3K5OA 1HNXL 3MXGA 5EBCA 4C3IG 4LF6Q 3CCQA 2JE6I 3HOZH 4Q5VA 1LTBD 2UUCQ 1UNSA 3HFZB 5FLMH 2F0UA 5ISRA 1SYFA 5IP9H 2R93B 1JJGA 2DN8A 2JA8B 2ASBA 1E1OA 3OTOQ 2JYOA 3RZOH 2MPMA 3QWNA 4CDEC 3S2HH 1CUKA 1XJVA 3T1YL 4IO9A 1RF2D 4JI0L 1TY2A 1HXYD 2Q2TA 5D3DA 5K5PA 3GTQB 3SK6A 4A76A 2KECA 2JN4A 3EFXD 1QNUA 3TP6A 3FKIG 4QY7A 2A6ED 4C2MB 1J8IA 1EOTA 1K8MA 3OTOL 3GTMB 5C0XI 2A1AA 5FO7B 3PIOA 2Z9HA 5H1SE 3G6JB 2WB1G 4C3JB 4IURA 1XPUA 1K3RA 5I6WA 2E2JB 1L0XB 1JOKA 3K57A 4EQ5A 1X9NA 3BZDB 3D0FA 3TP8A 4QQBX 3VR2A 1O7ZA 4A3KG 1C8CA 1MD2D 1QZGA 1X55A 5GAEC 1TY0A 3ND8A 1EY8A 3GP7A 1JCKB 1G2SA 2EYLA 3RZDB 2RQXA 1L0YB 1U4LA 5G3LF 4CJ0B 5LMNL 3PO3G 3MXNA 2HHHL 4HJ5A 2RA4A 1CQFA 4OELB 2OF1A 4IFDH 2KQ3A 1CSPA 3TP7A 1KRTA 1QUQA 1DD2A 3AB9A 1VQNA 3A7LA 5IT9L 2O4XA 2J0TD 4RKBA 5KIXA 3RLNA 1MIUA 4ZRZA 1Z9FA 1H95A 2A68D 1XYIA 1F2LA 2ZXOA 4O0AA 1AE2A 3DWQA 1EUJA 1SFOB 1HNZQ 4DV1Q 1QJOA 4DK6C 1QVGA 3C46A 5BN3A 1UE5A 3A56A 4ULLA 1GJXA 3HOXB 2F0HA 1CSQA 3U58A 1HZ9A 3OPOA 4RH6A 1CQVA 1VQGA 1LTSD 1MSHA 3A5ZB 1OXVA 1VQJA 4RCNA 3BVMA 1JJ2A 3S1QH 1EOVA 3GV6A 2VUMH 2NZOA 1ICWA 1FD7D 1STNA 1DGSA 3T13A 2HUGA 4DV7Q 1EQTA 2PZUA 3CCSA 3UE0A 4FO2A 2TSSA 4KV6A 3ONAB 4LF7Q 4YCVA 1XXGA 1O7LA 2HT1A 4P74A 3S2DH 1DONA 1B4OA 1IBMQ 1M1KC 2F0MA 1BOSA 1WI5A 3JAMi 3R2IA 1IW7C 4YY3L 1FL0A 4BBSG 4A93B 1Q12A 3DWPA 4QB4A 5FO9B 2VZAA 3I70A 1BR9A 4JW0A 1ZEQX 1ET6A 1HNWL 1CM9A 1GXDC 1JOQA 4X62Q 3MFGA 4DR4L 4K0KL 1U0LA 3K8AA 4GN3B 3S15H 2B39A 2NN6I 4NMZA 3G6EA 4HN7A 5FK9C 5CV4A 2QA4A 1S5FD 2NVXB 4IUUA 2DY8A 2Z6KC 3S16H 1IBML 1NCVA 4ZUIA 1F2ZA 4A3GG 2K04A 1WTHA 2M2LA 2QCPX 1VF7A 4A3JG 4LFCQ 4LF9Q 4A3LH 1WJJA 3M7NA 4GZYC 2F3VA 3E6ZX 2WAQE 5C3WA 2B2WC 1E2WA 1JE5A 4A3CG 3NHHA 1N9WA 1VMPA 1NTGA 4LW1A 5FJ8G 2A19A 4DR3L 4BY7G 3CPFA 2A6EC 3GDEA 1GHJA 4DV2L 3PIP3 4MHEA 1Q1EA 3NXWA 4MZ9A 1Q90A 3H3VI 2Z6KA 1SJED 1B9NA 4I7AA 3CMEA 1HUNA 3RZOB 2BDNA 2V4DA 4JYAQ 2IX1A 1WCMB 3S2HB 1SNOA 2PW7A 4QIWB 3CRKC 3HG9A 3T56B 4DF7A 5ELBA 4XQNA 2B2WA 5CV9A 2K5QA 3OOCA 1BCPB 4C3IH 2K1BA 2Z0SA 3E9HA 1X3FA 4F87A 4X64Q 1XMOL 4GNXB 3F8TA 4B9WA 2A8VA 4JI3L 1VQ7A 3S14H 1PZID 1UEAB 2Y0SE 4L5RC 2DUDA 1IKMA 4R4IA 1IBLQ 2MO0A 1EQVA 3RN5A 3CU7A 4RAUC 5IGGA 3L3OC 2A6HD 1WTQA 3SHLA 4QMGA 1NNXA 1YBYA 3S1MH 2AKWB 3OWFA 3MHBA 4HAEA 2RHQB 4G7ZC 1PYWD 2QDBA 3CKIB 2MHVA 1CT1D 3FKIH 2B2YA 3V96A 5IIFA 2EOTA 1H9SB 1FYCA 3HEJA 2JA6G 1O7IA 4RA8A 3A8KE 1RL2A 1SE4A 1B44D 2A68C 5D3IB 2CWAA 4LUOA 1SN8A 2JP1A 4YHHQ 2A74C 3NEMA 4K14A 3IL8A 4A3KH 4FVMA 3I90A 2K03A 3U50C 1O7YA 5KYLA 1LTTD 3DWAA 1UUPA 1SNPA 1TS5A 4GS3A 1VQEA 3VR3A 1I3QB 1PV4A 2WP8J 3W2DA 1W6KA 1B9MA 4K5WA 1RTNA 1EY4A 4BXXG 4JBWA 1YNJD 5KNBA 1TVXA 1EYGA 3PO3H 1C4QA 1HH2P 3WDNA 4YWKA 3OIPA 3X3MA 1SXTA 1GUSA 2GN5A 1H9KA 4A3DG 2RCFA 1PH9A 4U673 2HD3A 1C7YA 2H5XA 3GTJH 4FDBA 4B3MQ 1B70B 3ERSX 3VR6A 4FF1A 1UE7A 4JI7Q 4M1UB 3S1QB 1F9RA 1KAWA 1HA5A 2VUMB 1I6HH 3I4LA 3UDFA 1ZYRD 2B2TC 2X6LA 4ILWA 4CJ2C 1XTDA 1A15A 4XT3B 3A7AB 5ELOA 4R1JA 1PH2A 4QL5A 3S2DB 3OHXC 5I9OA 1I94Q 5CV7A 1A8VA 4LUZA 1U5KA 4IOAA 1CI3M 2KHJA 1KHIA 1EU4A 1QG7A 4M8AA 5KNCA 3S1NB 1J6QA 2R7FA 4NXMQ 1MHWC 2DJGC 4DUYL 5CR3A 1ILPA 2B2TA 3S15B 1SR3A 1VQMA 5J1ZA 3RUZA 4BS9A 1RIPA 3SEBA 2R61A 5JPNC 4UDUC 4GLXA 4ZKCB 3AEVA 4KKTA 3S16B 4YWLA 2B2UC 1SMYD 3KLSA 4B08A 4BBSH 1RJTA 1C9OA 3ICEA 1OXSC 2EYJA 2F3IA 2L12A 3ULLA 3KLSX 1PRTD 3IRBA 1K3BC 1DCZA 4WJ4A 1B7YB 3HS0C 2ZM6Q 1MI2A 2B3GA 1N33Q 4OO1I 4X3TA 2EDGA 1XPRA 2K14A 2FXQA 3QJYA 1NR2A 1HRJA 4L6TB 4DV3Q 4XTCS 3KLRA 1QVCA 1OTCA 3MAQA 2PZTA 1I6VC 2QGQA 5E1FA 2PPBC 2L1BA 2HCIA 1VQAA 3HKZE 5TSSA 4A3GH 4A3JH 3HOVG 2A6HC 4GOPB 3H09A 2VY3A 2Z4IA 1ENCA 2F52A 2QEJC 1D5XC 4A3CH 2DNEA 2OQ0A 5M5XB 2LFNA 2ICIA 4HJ7A 5FJ8H 4BY7H 3KFUA 4IUTA 5KRUA 2JJQA 1EIFA 1TWHH 2AQ2B 4J8QA 3T53B 3S14B 4A4IA 5GAHC 1YNND 4ME3A 3CCLA 1E7ZA 3J80L 2V1CC 2E2IH 3Q0AA 4DR1Q 2IHEA 2R7DA 4KHZA 1ENFA 1FGUA 5M5WH 1MGSA 2KOLA 3WWVA 3CC4A 1U9RA 3M85A 4UPAA 1LO5D 2KEDA 1PH5A 4KI0A 3NWTA 3S9WA 4R4TA 1N8RC 3FKIB 3E3XA 3GTOH 2EE1A 4PV1C 3BZKA 2XWBB 1P16A 1N36Q 2F0OA 1Z47A 4DR7Q 4B3SQ 1L1OC 4FXGC 1YNJC 4KK7A 1S5CD 2AUJD 4B3RQ 4PNYA 5CMDA 4DV6Q 3V2TA 4HJAA 3PUXA 1FJGQ 1CHQD 3LX0A 5E7NA 3T51B 4ZQ3A 1VQKA 4YWMA 2MO1A 4A3KB 3KDFA 1SE8A 3LNNA 1JC7A 2K52A 1GUOA 1N36L 4DR7L 5FOBB 3VDYA 1V43A 2ICEC 4FNFA 2JA6H 1HFGA 3K0YA 3J81L 3FRPB 4F8MA 2NVQH 1L1OA 4DV6L 1STAA 2KCTA 1CTMA 1PXUA 3EROA 3TREA 1OO9B 1K0RA 2SNSA 3BYTB 4C1NI 4OX9L 3AQQA 2JA7G 3ZYYX 2KHIA 3P7JA 1CKOA 1T5EA 4LF4L 2PQAA 4IJLA 3Q22A 3F2DA 2O2LD 3GTJB 1VDZA 2M00A 5LL6X 3BJUA 1LUZA 3L2PA 3A74A 3MFYA 3I7FA 3K5MA 4QF4A 4S3SA 1KDAA 1I6HB 4YCUA 3EBEA 3TBIB 3HOYG 4BXXH 2F4VL 4KHPQ 2PNHA 2EY6A 4AQYQ 1TS4A 4L5TA 2MP1A 3I4OA 3K6OA 1LM0A 5HURA 3I3CA 2ZJPA 4A3DH 1XWEA 5E4WC 5IOCA 1K9MC 1GD7A 1VF5C 1XMQL 2O5IC 1MJCA 4ODGA 1HPCA 1PRTC 1EYCA 4LNQA 2K75A 5FLXL 4DR2L 3DLLA 4G7OC 1Q8KA 1L0WA 1A0IA 3PF4A 3CCRA 1TWCH 5C0XG 3KBXA 5C5LA 2H1EA 3PUVA 4EQOA 1STEA 3ULPA 3Q6SA 2Q8RE 1KRSA 1IBKQ 1YHQA 2F0EA 3TMEA 1X3GA 1T9HA 1HNXQ 3AMUA 1YJNA 2UXBL 5C4HA 5IYCG 1JT8A 3PIO3 1AFPA 1ZKOA 1X32A 2I46A 2XNAC 2K6AA 3IFDA 3IKJA 2IJ0A 1TWGH 3P20A 5IT9E 4BBSB 2RHSB 3OMGA 1I4PA 3OYYA 1BVSA 2EIFA 2VQEL 1BO0A 1SSOA 1VQDA 4JI6L 1SRUA 1N32L 3C2PA 3R8BA 1IL8A 1XNRL 3T1YQ 2OTLA 4A3EG 1YNNC 1KNAA 2EYPA 1EL0A 2HIXA 3JAMc 2VL6A 3I4MG 2QEXA 2KBNA 4FF4A 2F0GA 3E9IA 2VS1A 4A3GB 3DM3A 4RHSA 2AWOA 4A3JB 1WTXA 1EZ6A 4ME5A 4DGZA 1NMFA 1Z7TA 4DV4Q 3A55A 5DLQE 1HFNA 3TZDA 3F2BA 3A5UA 4YCWA 2ATWA 1IYVA 3BG3A 1GHKA 4BY7B 3NK9A 2LS01 1PVOA 5EKKA 4PMWA 1TWHB 2XIWA 2Z6BA 3VYRA 3A8JE 1BXTA 2K33A 3G7LA 4CJ1B 1PYSB 3X3NA 2OWOA 2IHFA 2E2IB 1AH9A 3SDZA 3HOVH 4XIGS 1OXUA 4DV4L 2DGYA 3J81j 4K8IA 5M5WB 3CW2C 2LSSA 2PMZB 2AQ3B 4J6HA 1BF4A 4JV5L 5LMNQ 2ZT9C 4DV0Q 4JVZA 1G51A 2HHHQ 1PFBA 1V1QA 4X3UA 3GTOB 1RDPD 4LK1C 3ITPA 4C1NK 4P73A 2PO4A 2NYZD 1EQQA 1WTVA 3QR8A 2UXCL 1STHA 1F2MA 4AYBE 1B50A 1D5ZC 5FLXc 1JWMD 2F3WA 5JAVA 3GTLH 2F1MA 2WACA 1PLFA 2R6GA 3LGJA 1KABA 4DV0L 4FYDA 1E0BA 2DJFC 4NPSA 4R4QA 2NN6G 2EY2A 3IAYA 5NUCA 3A54A 5C3EG 2JA6B 3KJPA 5DM73 1EWCA 1Q1BA 4KN7C 2IW3A 2NVQB 3KF8A 5D65A 2X69A 4DAPA 3QOLA 1MJEA 3OSOA 4RWSC 3J7ZC 4DUZL 2KHSA 3J80i 4OWXB 2UUAL 2I5MX 3I72A 3SR1A 1M8AA 2D62A 4X65Q 4HJ8A 5BN4A 3KF6A 4DN4M 1WTWA 1JICA 1K8AC 1A6XA 3NBHA 2IX0A 4R4OA 4C3HG 3A0JA 1QNKA 1L1OB 5JJKA 4YY3Q 4MN3A 2SDFA 1QOHA 1H9MA 1Y14B 1FGBD 1LTRD 3S24A 1VQ8A 1HNWQ 1EY5A 2JA7H 1TWFH 4DR4Q 4DV5L 4K0KQ 1VQOA 4X65L 1RODA 1Y69U 3IFTA 2G5DA 4NW2A 2CH4A 2XTIA 3T4AC 3HOUG 1AP0A 3PMFA 2BA1A 2K4KA 4APVA 2AUKA 1TWCB 4XYQA 1YI2A 4LFBL 1HR0L 3F2CA 2IX3A 1HZCA 1YITA 3HOYH 3K59A 1Q46A 4L5QA 5HGTA 3CD6A 2L0CA 1PRTF 5C4XG 1QZHA 1STGA 2L55A 2B8GA 3J81i 2OCEA 4DR3Q 1KLGD 2B2VC 2I5LX 1DXMA 3NUCA 4IPDA 4DV2Q 2Q2UA 1KIXA 1TWGB 3HOWG 4V190 3D4RA 1PMRA 2NVYH 2MUYA 2YU9H 3MTSA 1QWYA 4CBVA 1VQ5A 4RMFA 1VQCA 5C0XH 3MXUA 3H91A 3HP3A 3RD4A 2EZVA 2KEEA 1IHZA 1JE4A 5IY0A 4QCLA 2BCOA 2MQHA 4A3MG 4X66L 3HOZB 4IFDJ 5HGQA 1SYGA 2HDMA 5IYCH 3E5SA 1XMOQ 3FVQA 1LT3D 1F9PA 2L15A 1KL9A 4DK3C 4JI3Q 2B2VA 5D14A 2ENBA 1LTID 4L5SA 3S1RH 1PRTB 1KC8C 4DNIA 2RDGA 2JA8G 1LTGD 1WTPA 4K2LA 5EGTA 5IT9c 1G6ZA 4N9PA 4A75A 3D8GA 3KBGA 4NP5A 1FNVA 2P5ZX 4A3EH 2VNUD 3I4MH 4Y52H 2EYFA 2H4OA 2B2YC 3N6RA 5KNDA 3VYUA 4O2DA 5EPLA 2FMCA 1A62A 3BU2A 3EQLC 3D4DA 3VA7A 2E75C 3HOVB 2CFMA 4Q0FA 1S3OA 1X56A 4IZ8A 1WVLA 5CBAE 4IPCA 1T5XD 1I4QA 1M90C 4C3JG 3O13A 1XX8A 3TS0A 5C44G 4DK1A 2VW9A 2JEAI 2K05A 2R7ZG 4NDXA 5KYIA 5I6YA 1Q81C 1PTOD 4IUPA 1ZXTA 1DZ1A 1VQPA 4JI2Q 3DHQA 5IGEA 3EIVA 2WAQG 1E22A 2CH4W 2F0LA 5HY6A 4HTHA 2F0NA 2EY5A 4XQQA 4MNOA 5IWAL 3GTLB 2CVRA 3VR5A 3D6WA 4RGMA 3SE0A 5GROA 2K5HA 1W6JA 2N49A 2K28A 5I9PA 1VQ6A 1HJPA 1G91A 4HSVA 4JI2L 4IUQA 2E2DC 1WFQA 5IODA 5EQ0A 4KJNA 5IGCA 1GM5A 3I73A 1DJRD 4J1MA 4UP9A 4ZUJA 1C0AA 1D2BA 3H3VC 4GN5A 3K5NA 3W1GA 1TKWB 4N8FA 1Q7YC 3NELA 1I4HA 1ET9A 2F0VA 2I5HA 1OXXK 4OXPA 2EY1A 3JC66 3MXNB 2ALYB 3B6YA 2E5LQ 1X3QA 1Z6HA 2YYZA 3EA6A 5LHY1 4OO1G 2Y0SG 1QUQB 1U4PA 2NN6H 4KMUC 5K36G 1IKLA 2XN9C 3J80E 1RCVD 5C3EH 5G3LD 1BUVT 3DXJC 3DMUA 3NTKA 1II3A 2K01A 4WFN3 2OTJA 1YZ6A 1K28A 3H0GG 3BYYB 1C48A 2JA7B 1TWFB 2E5LL 4DUYQ 3N52A 4HCEA 1TR5A 3EJIA 3L9AX 4QIWE 2XRSD 1MKHA 3H15A 1CKNA 3J7AV 2BH8A 1NE3A 1MSGA 3D6CA 3GV3A 4PQXA 4DR6L 3H3VH 4ALPA 3CPWA 1PH1A 3HOYB 3FP9A 3K0XA 1LV9A 1WD1A 2F0JA 2WKDA 1CZGA 4JI4L 3RNUA 4H13C 5LMNW 2RSOA 3JAME 1FNWA 2FFKB 2F0QA 1GUNA 3MVVA 1X3EA 3K7AH 3GTPH 1O80A 1BDOA 4V0BA 3HOUH 4XDXA 2NWGA 1QVFA 3D3RA 2Q2IA 1PZJD 4FP5D 3PSIA 2NVYB 4OHJA 2ZTCA 4XQJA 2YU9B 4LFAL 1A63A 1SJHD 4QUCA 2UUBL 3NBIA 4GLAC 3I4NG 4R8NA 5DNFA 2FJ2A 2ZTDA 1W2BA 2F0KA 2B8FA 1E2ZA 2E8GA 2CW0D 4G7HC 2K50A 5C4XH 1V1PA 1QCBD 4DAYA 1E3PA 3RLOA 4IPGA 1EY0A 3VR4A 2VQFL 1ICFB 1AEXA 2AHOB 2I07B 3HOWH 3F1ZA 4HSPA 5EKLA 3S1RB 2EVBA 2L4NA 1VCIA 2SNMA 2D9UA 4OGQC 1PA6A 3PV0A 3M3YH 5L37A 4OWWB 4H7BA 1JOOA 1WCMG 2KCNA 4X6AH 1S4ZA 2EPBA 1PTOC 1KDCA 2RKSA 4A3EB 2XWJB 1JMCA 4PMCA 4C3IB 4A3MH 4IOCA 1BCPD 1BBUA
chains in the Genus database with same CATH topology
3NP8A 1HQMC 5FLXE 4DAVA 1TU2B 2BDOA 4R9WA 2G9HD 4WJWA 2X6GA 2GA4B 3S1MB 3A8IE 2F0SA 4ZYSA 1Y8PB 1TT2A 1KLUD 5CV8A 3WOEA 2WINB 2L11A 1R4PB 2WB1B 1ESRA 1SAPA 3FDTA 1BQQT 5LL6S 2A73B 4BWGB 2QILA 1LLRD 1PTOH 5CGKA 1SE2A 5I2XA 4Z9CB 2F0DA 1F77A 2F0WA 4K5VA 4XXEA 1V1OA 5JEAJ 2J4XA 3GO5A 1J9OA 1SEBD 3PO3B 3K58A 4H44C 4CKEA 4KD4A 1HTLD 3KUPA 2F4IA 4EVOA 2RSNA 5C3EB 4R8IA 3MZ5A 3NSWA 1M4VA 5C4ZA 2VXWA 3PUZA 3C1EA 1SNMA 3M4YA 2KJXA 3FPPA 3URYA 2K32A 3H94A 3C1FA 2Z4HA 2KA7A 4OO1H 3EVQA 5K36H 1U4MA 2E76C 5ELFA 3I91A 4L8JA 2PNRC 1HCZA 4KHVA 4KD3A 4ABNA 4WORA 2NTSA 4ZKBB 2CW0C 1EEFD 3C3LA 5IGBA 2C9OA 3OMCA 4IFDI 4MIUA 3D4WA 3TZUA 2EJMA 3K7AB 3RMHA 4UAIA 4FF2A 1TS2A 3HOUB 5DEHA 4TRDA 4CGYB 4KY7A 4HR7B 4DFAA 1A2UA 3U9SA 4OIKA 1KDBA 1NAPA 2DY7A 2HQEA 1LT4D 3R93A 5A2QL 1BCPC 1DM0B 2RBMA 2Z1CA 2FHTA 1O78A 1WTOA 5ELDA 3HGBA 4K2KA 1ML0D 5T1IA 2HDLA 4G57A 3HOWB 5JVG3 2IT1A 4C56C 1KTKA 2EYOA 4HMIA 3M3YB 2K5WA 4I7ZC 2JSOA 4A3MB 1QE6A 2EJGC 3GD7A 1RHPA 1TIID 1SYCA 1K8OA 1G2TA 1EIHA 1A3VA 4O1NA 2RVLA 4K5XA 2VB3X 1I4GA 1PTOF 1S5BD 1KNEA 4IUVA 3CQZB 1NR4A 1B3AA 4RGNA 4X3SA 3TN2A 4BA2I 1LABA 1A2TA 3RLFA 1H9SA 2WKCA 3Q23A 2IWHA 5EPKA 2PCFB 4EGVA 2IL8A 1HUMA 5C44B 3D31A 1RD9D 2R7ZB 1PTOB 3DM1A 5AFWA 1EY6A 1STBA 1AW7A 1X3PA 2WAQB 4G4KA 1ILQA 4OIJA 4TSSA 4BA1I 1ONLA 2N88A 1CHPD 4PMBA 5C3XA 4ID6A 4DU9A 4JK1C 1Y8OB 4KN4C 5KEEA 2BA0A 2Z8LA 1JB3A 4FF3A 1D5MC 3GQBA 3FPUB 3WOFA 3TP5A 4N9TA 3NQTA 1LT5D 2JXMB 4FXDA 1U4RA 2WV6D 2LKVA 5C4JB 1FNUA 2Y0SB 1DOMA 4A3DB 2NUCA 4K6LA 1DYQA 3NQIA 1IYUA 2OT2A 1EY9A 4IUNA 1I4RA 3H0GB 4I65A 3KK7A 2AQ1B 1GOZA 4ZK9B 3PUWA 4XYOA 4EQPA 1B2TA 1H9JA 2FINB 4EQNA 5I4DA 3MEHA 1SNQA 3DEOA 3NTIA 2F0FA 5EPJA 1NUCA 3Q24A 4K6DA 5JEAG 5J39A 2EXZA 1D1IA 2CHBD 3SK8A 1BNZA 1SDFA 4X3KA 3SK4A 2TMPA 3CHBD 4KJOA 1TWAB 3MWYW 4KTAA 4KKUA 1Q8IA 1AN8A 3L7ZC 1E2VA 1BCPF 3I4NB 2M9VA 2L5TA 1HA6A 2E2HB 3GTGB 1A3UA 2IPKD 2OXPA 1SYBA 1V8QA 3HRZC 2F03A 1CZWA 3TDQA 1OXTA 1SNCA 2XVSA 4TKOB 4Y7NB 2KUMA 1KAAA 4FXKC 1SYDA 4LAAA 2G9DA 1RTOA 2OEOA 3P1HA 5EKIA 2JEBI 1DOLA 3NWSA 2D2CC 1BBXC 4IN3A 2A69D 2F0IA 2Q8TA 5C5MA 4ZAIA 1XTCD 5COYA 5CBEE 2EJFC 3FEWX 1F9SA 5JOBA 1CA6A 4B9XA 4F7XA 4U68A 3VA5A 4A3BB 1JR0D 2K7VA 2SEBD 3U9OA 2Q8IB 2ID0A 3V05A 5ELEA 3NTHA 1SE3A 1I4XA 1H9RA 2MGSA 1B53A 5ELCA 3OIQA 1QILA 3MA2B 2LY7A 5C0XJ 1A3TA 3QB3A 4RGTA 3PO2B 1MBYA 1NSNS 1EIGA 1HQRD 5CV5A 3HKZB 2JA5B 3BS1A 5DAUA 2BE5D 4NKLA 1R4QB 5F2DA 2QKIC 1PZKD 3NPPA 3W3AA 2NTTA 1FR3A 1RKNA 2PW5A 3T16A 1GUTA 5M9OA 5M5YB 5KGUA 1F9QA 2C5CA 2NVTB 3FMCA 3VYTA 5T1GA 1EYDA 1B1ZA 5BN5A 4TQUS 1ESFA 1WD0A 4HCSA 4F88A 3GTKB 3M7GA 1HHVA 5CYUA 5DM63 3VYSA 1LTAD 2L9HA 3K5LA 1D1KA 5IGFA 3BDOA 2PQEA 1S5ED 5JVH3 5E4XA 1LACA 4P2CB 4RCOA 2PYKA 1JWUD 1PFNA 1JORA 4A3IB 3E0JA 3J81E 2ZXRA 1JWSD 3BDCA 2A5HA 2KCCA 2E74C 1Y1VB 1ENAA 3CRLC 4RHRA 4BBRB 4XT1B 3BVGA 3BDLA 3ND9A 4DA2A 2DNCA 3SXHA 4ZLTF 5JEAH 5CC4A 1Y1WB 2D5DA 5EBDA 2A69C 4IALA 4LMQD 4BY1B 4K8JA 3DUZA 4KKSA 4CKBA 3MXPA 2NB0A 2XSCA 2BOSA 3PUYA 3I4MB 4YIJA 2EYHA 1F2YA 1AZPA 3F2UA 2VB2X 1GUWA 3R2TA 2B2UA 4E6IA 3J7YW 4IQZA 5C6AA 1PFMA 2R92B 2NBFA 1PDQA 3R3OA 4LJZC 1CK1A 4CHTB 3LWEA 1EEID 4HEDA 2SOBA 4RKLA 2EYMA 4HMJA 3P75A 2K5DA 5EJWA 2B63B 2KVMA 4H0LC 5J22A 2XRQD 3QO2A 3OWEB 5A2QE 2BE5C 5A35A 1EYAA 3ERQA 3QOJA 4IFDG 2F0PA 4DK0A 2RDFA 2FMMA 1LT6D 3OW7A 2F0TA 1GUGA 5FKAC 4O42A 2AWNA 1EWHA 2MJ8A 4KY6A 5JPMC 3JAML 1S5DD 4QUFA 3S17B 2PZWA 5JJZA 5IGDA 1EY7A 2R3ZA 3QIAA 4CKCA 3H6MA 4DNTB 1ZYRC 1R9TB 1QB5D 2CQAA 2QF7A 2N55A 2ZXPA 1STYA 5M3FB 3M4OB 4A3FB 1AZQA 2O5JC 1HTPA 5CV6A 1DOKA 4C3HB 3LWUA 1WTRA 3BVZA 2NZ1D 1G8ZD 1JQYD 1UAPA 3NE5B 5CORA 3I8ZA 1G291 3HZXA 3J7AF 5I2YA 1Y8NB 3TSSA 4RGOS 1SMYC 4L63B 3GTPB 4AYBB 4KY5A 5E3FA 5FO8B 2HCCA 3QG1A 3SVMA 1CFMA 1TQOA 4OL7A 3AU7A 1Q3LA 1CA5A 3UI2A 4DXFA 4DXGA 5C4XB 2J7ZA 4RFBA 1TS3A 1SBBB 3MC0B 2LMCB 4DNRB 2RDHA 3SK5A 1SYEA 5M3MB 1EU3A 1SNDA 1EFID 1D6EC 1VMCA 1IW7D 3DEPA 1I50B 1EZ8A 2WIIB 4WRDA 1K83B 3K5OA 1V1PB 3MXGA 5EBCA 4C3IG 2JE6I 4Q5VA 1LTBD 1UNSA 2F0UA 5ISRA 1SYFA 2R93B 2DN8A 2JA8B 2JYOA 2MPMA 3QWNA 1RF2D 1TY2A 1HXYD 5D3DA 5K5PA 3GTQB 3SK6A 2KECA 3EFXD 1QNUA 3TP6A 2A6ED 4C2MB 1J8IA 1EOTA 1K8MA 3GTMB 5C0XI 5FO7B 3G6JB 4C3JB 4IURA 5I6WA 2E2JB 1L0XB 1JOKA 3K57A 3BZDB 3TP8A 3VR2A 1O7ZA 1C8CA 1MD2D 1TY0A 3ND8A 1EY8A 3GP7A 1JCKB 1G2SA 2EYLA 3RZDB 2RQXA 1L0YB 1U4LA 5G3LF 4CJ0B 3MXNA 2RA4A 1CQFA 2OF1A 4IFDH 2KQ3A 3TP7A 1DD2A 3AB9A 3A7LA 5IT9L 2O4XA 2J0TD 4RKBA 5KIXA 4ZRZA 2A68D 1XYIA 1F2LA 2ZXOA 3DWQA 1SFOB 1QJOA 3C46A 5BN3A 3A56A 4ULLA 1GJXA 3HOXB 2F0HA 3OPOA 4RH6A 1CQVA 1LTSD 1MSHA 1OXVA 4RCNA 3BVMA 3GV6A 1ICWA 1FD7D 1STNA 3T13A 2HUGA 1EQTA 2PZUA 4FO2A 2TSSA 4KV6A 3ONAB 1XXGA 1O7LA 1DONA 1B4OA 2F0MA 1BOSA 3R2IA 1IW7C 4A93B 1Q12A 3DWPA 4QB4A 5FO9B 3I70A 1BR9A 1ZEQX 1ET6A 1CM9A 1GXDC 1JOQA 3MFGA 2B39A 2NN6I 4NMZA 4HN7A 5FK9C 5CV4A 1S5FD 2NVXB 4IUUA 2DY8A 1NCVA 4ZUIA 1F2ZA 2K04A 2M2LA 2QCPX 1VF7A 3M7NA 4GZYC 2F3VA 3E6ZX 5C3WA 2B2WC 1E2WA 3NHHA 1VMPA 2A6EC 1GHJA 3PIP3 4MHEA 1Q1EA 3NXWA 1Q90A 1SJED 1B9NA 1HUNA 3RZOB 2BDNA 2V4DA 2IX1A 1WCMB 3S2HB 1SNOA 2PW7A 4QIWB 3CRKC 3HG9A 3T56B 4DF7A 5ELBA 4XQNA 2B2WA 5CV9A 2K5QA 3OOCA 1BCPB 2K1BA 4F87A 4B9WA 1PZID 1UEAB 1IKMA 1EQVA 3CU7A 4RAUC 5IGGA 3L3OC 2A6HD 1WTQA 3SHLA 4QMGA 3OWFA 3MHBA 4HAEA 4G7ZC 1PYWD 2QDBA 3CKIB 2MHVA 1CT1D 2B2YA 3V96A 5IIFA 2EOTA 1H9SB 1FYCA 3HEJA 4RA8A 3A8KE 1SE4A 1B44D 2A68C 5D3IB 2JP1A 2A74C 4K14A 3IL8A 4FVMA 3I90A 2K03A 5KYLA 1O7YA 1LTTD 3DWAA 1UUPA 1SNPA 1TS5A 3VR3A 1I3QB 2WP8J 3W2DA 1W6KA 1B9MA 4K5WA 1RTNA 1EY4A 4JBWA 1YNJD 5KNBA 1TVXA 1C4QA 3WDNA 3OIPA 3X3MA 1SXTA 1GUSA 1H9KA 4U673 3VR6A 4FF1A 4M1UB 3S1QB 1F9RA 1HA5A 2VUMB 3I4LA 1ZYRD 2B2TC 2X6LA 4ILWA 4CJ2C 1A15A 4XT3B 3A7AB 3S2DB 3OHXC 5I9OA 5CV7A 1CI3M 1EU4A 1QG7A 4M8AA 5KNCA 3S1NB 5CR3A 1ILPA 2B2TA 3S15B 5J1ZA 3RUZA 4BS9A 3SEBA 2R61A 5JPNC 4UDUC 4ZKCB 4KKTA 3S16B 2B2UC 1SMYD 3KLSA 4B08A 1RJTA 1OXSC 2EYJA 2L12A 3KLSX 1PRTD 1DCZA 3HS0C 1MI2A 4OO1I 4X3TA 2EDGA 3QJYA 1NR2A 1HRJA 4L6TB 4XTCS 3KLRA 3MAQA 2PZTA 1I6VC 5E1FA 2PPBC 2L1BA 2HCIA 5TSSA 2A6HC 3H09A 2Z4IA 1ENCA 2QEJC 1D5XC 2DNEA 5M5XB 2LFNA 2ICIA 4IUTA 5KRUA 4J8QA 2AQ2B 3T53B 3S14B 1YNND 3J80L 3Q0AA 4KHZA 1ENFA 1MGSA 2KOLA 1U9RA 3M85A 1LO5D 2KEDA 4KI0A 3NWTA 3S9WA 3FKIB 2EE1A 4PV1C 2XWBB 2F0OA 1Z47A 4FXGC 1YNJC 4KK7A 1S5CD 2AUJD 4PNYA 5CMDA 3V2TA 3PUXA 1CHQD 3LX0A 3T51B 4ZQ3A 4A3KB 3LNNA 1JC7A 1GUOA 5FOBB 1V43A 2ICEC 4FNFA 1HFGA 3K0YA 3J81L 3FRPB 4F8MA 1STAA 1CTMA 1PXUA 3EROA 1OO9B 2SNSA 3BYTB 4C1NI 3ZYYX 3P7JA 1T5EA 3Q22A 2O2LD 3GTJB 1VDZA 2M00A 5LL6X 3MFYA 3K5MA 4QF4A 4S3SA 1KDAA 1I6HB 3TBIB 2EY6A 1TS4A 2MP1A 3K6OA 5HURA 3I3CA 1XWEA 5E4WC 5IOCA 1VF5C 2O5IC 4ODGA 1HPCA 1PRTC 1EYCA 5FLXL 4G7OC 5C0XG 3KBXA 5C5LA 2H1EA 3PUVA 4EQOA 1STEA 3Q6SA 2Q8RE 2F0EA 3TMEA 3AMUA 5C4HA 3PIO3 1AFPA 1ZKOA 1X32A 2I46A 2XNAC 2K6AA 3IFDA 3IKJA 2IJ0A 3P20A 5IT9E 4BBSB 3OMGA 1I4PA 1BO0A 1SSOA 3C2PA 3R8BA 1IL8A 1YNNC 1KNAA 2EYPA 1EL0A 4FF4A 2F0GA 4A3GB 4RHSA 2AWOA 4A3JB 1WTXA 1EZ6A 4ME5A 4DGZA 1Z7TA 3A55A 1HFNA 3TZDA 1IYVA 3BG3A 1GHKA 4BY7B 3NK9A 2LS01 5EKKA 4PMWA 1TWHB 2XIWA 3VYRA 3A8JE 1BXTA 2K33A 3G7LA 4CJ1B 3X3NA 2E2IB 3SDZA 4XIGS 1OXUA 5M5WB 4K8IA 2PMZB 2AQ3B 4J6HA 1BF4A 2ZT9C 1PFBA 4X3UA 3GTOB 1RDPD 4LK1C 3ITPA 4C1NK 2PO4A 2NYZD 1WTVA 1STHA 1F2MA 1B50A 1D5ZC 1JWMD 2F3WA 5JAVA 2F1MA 2WACA 1PLFA 2R6GA 1KABA 4FYDA 1E0BA 2NN6G 2EY2A 3IAYA 5NUCA 3A54A 2JA6B 5DM73 1EWCA 1Q1BA 4KN7C 2IW3A 2NVQB 3KF8A 5D65A 2X69A 4DAPA 3QOLA 3OSOA 4RWSC 2KHSA 3I72A 3SR1A 1M8AA 2D62A 5BN4A 4DN4M 1WTWA 1JICA 1A6XA 3NBHA 2IX0A 4C3HG 1QNKA 4MN3A 2SDFA 1QOHA 1H9MA 1FGBD 1LTRD 1EY5A 1RODA 1Y69U 3IFTA 4NW2A 3T4AC 1AP0A 3PMFA 2BA1A 2AUKA 1TWCB 4XYQA 2IX3A 3K59A 5HGTA 2L0CA 1PRTF 1STGA 2L55A 2B8GA 1KLGD 2B2VC 1DXMA 3NUCA 1TWGB 4V190 3D4RA 1PMRA 2MUYA 3MTSA 1QWYA 4CBVA 5C0XH 3MXUA 3H91A 3HP3A 3RD4A 2EZVA 2KEEA 1IHZA 1JE4A 4QCLA 2BCOA 3HOZB 4IFDJ 1SYGA 2HDMA 3E5SA 3FVQA 1LT3D 1F9PA 2B2VA 5D14A 2ENBA 1LTID 1PRTB 2RDGA 1LTGD 1WTPA 4K2LA 5EGTA 1G6ZA 4N9PA 3D8GA 3KBGA 4NP5A 1FNVA 2VNUD 2EYFA 2H4OA 2B2YC 3N6RA 5KNDA 3VYUA 5EPLA 2FMCA 3EQLC 3D4DA 3VA7A 2E75C 3HOVB 4Q0FA 4IZ8A 1WVLA 5CBAE 1T5XD 1I4QA 4C3JG 3O13A 1XX8A 4DK1A 2JEAI 2K05A 4NDXA 5KYIA 5I6YA 1PTOD 4IUPA 1ZXTA 1DZ1A 3DHQA 5IGEA 2F0LA 4HTHA 2F0NA 2EY5A 4XQQA 3GTLB 2CVRA 3VR5A 3D6WA 4RGMA 3SE0A 1W6JA 2K28A 5I9PA 1G91A 4HSVA 4IUQA 2E2DC 5IODA 5EQ0A 4KJNA 5IGCA 3I73A 1DJRD 4J1MA 4ZUJA 1D2BA 3H3VC 3K5NA 1TKWB 1I4HA 1ET9A 2F0VA 1OXXK 2EY1A 1X3QA 1Z6HA 2YYZA 3EA6A 5LHY1 4OO1G 1U4PA 2NN6H 4KMUC 5K36G 1IKLA 2XN9C 3J80E 1RCVD 5G3LD 1BUVT 3DXJC 3DMUA 3NTKA 1II3A 2K01A 4WFN3 3BYYB 1C48A 2JA7B 1TWFB 3N52A 4HCEA 1TR5A 3EJIA 3L9AX 2XRSD 3J7AV 1MSGA 3D6CA 3GV3A 4PQXA 3HOYB 1LV9A 1WD1A 2F0JA 2WKDA 1CZGA 4H13C 2RSOA 3JAME 1FNWA 2FFKB 2F0QA 1GUNA 3MVVA 1O80A 1BDOA 4V0BA 4XDXA 2NWGA 3D3RA 1PZJD 4FP5D 4XQJA 2NVYB 4OHJA 2YU9B 1SJHD 4QUCA 3NBIA 4R8NA 5DNFA 2FJ2A 2F0KA 2B8FA 1E2ZA 2CW0D 4G7HC 1V1PA 1QCBD 4DAYA 1EY0A 3VR4A 1AEXA 2I07B 4HSPA 5EKLA 3S1RB 2EVBA 2L4NA 1VCIA 2SNMA 2D9UA 4OGQC 3PV0A 4H7BA 1JOOA 2KCNA 1S4ZA 2EPBA 1PTOC 1KDCA 2RKSA 4A3EB 2XWJB 4PMCA 4C3IB 1BCPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQN A;  3NP8 A;  3MEH A;  1SNQ A;  2EY2 A;  2F0U A;  5ISR A;  1SYF A;  3BDL A;  2F0F A;  5NUC A;  2F0H A;  3H6M A;  2F0O A;  1NUC A;  2ENB A;  3TP5 A;  5I9O A;  5CV7 A;  3SXH A;  3DMU A;  4K6D A;  4KHV A;  3OMG A;  1EQV A;  4KD3 A;  5CC4 A;  4K2L A;  4WOR A;  5J39 A;  1II3 A;  2EXZ A;  4PNY A;  5EGT A;  4N9P A;  1STY A;  5IGD A;  4IAL A;  1A3T A;  3QB3 A;  3QOL A;  3V2T A;  3OSO A;  5IGG A;  3D8G A;  4K8J A;  1STN A;  3MXP A;  3LX0 A;  4NP5 A;  5CR3 A;  3SHL A;  2KHS A;  4QMG A;  3SK8 A;  3T13 A;  1NSN S;  3OMC A;  5CV5 A;  4MIU A;  4ZQ3 A;  2PZU A;  3D4W A;  3SK4 A;  5J1Z A;  3OWF A;  3RUZ A;  2EYP A;  3MHB A;  4KJO A;  3SR1 A;  5K5P A;  3SK6 A;  1TR5 A;  2F0S A;  4YIJ A;  5DAU A;  2EYH A;  1F2Y A;  2EYF A;  3EJI A;  1EY6 A;  4KV6 A;  2QDB A;  2F0G A;  4NKL A;  4KTA A;  1STB A;  4TRD A;  5DEH A;  5F2D A;  5CV6 A;  5IIF A;  3TP6 A;  3D4D A;  4KY7 A;  4DFA A;  1TT2 A;  1A2U A;  3D6C A;  5CV8 A;  2F0M A;  3HEJ A;  4E6I A;  1RKN A;  1EZ6 A;  1KDB A;  2PW5 A;  3T16 A;  5C6A A;  4IZ8 A;  2EYJ A;  4ME5 A;  4QB4 A;  4F8M A;  4DGZ A;  1STA A;  1A3U A;  4PMB A;  2F0J A;  2OXP A;  3R3O A;  3ERO A;  2HQE A;  4ID6 A;  4DU9 A;  5C3X A;  5I6W A;  3HZX A;  5M9O A;  1JOQ A;  1JOK A;  1SYB A;  5KGU A;  2SNS A;  1EY5 A;  2RBM A;  5KEE A;  3NK9 A;  4K14 A;  4NDX A;  3TP8 A;  2F0Q A;  5EKK A;  4NMZ A;  3MVV A;  5I6Y A;  5KYI A;  5CGK A;  5CV4 A;  1EYD A;  2SOB A;  4KY5 A;  5KYL A;  1SNC A;  5E3F A;  4RKL A;  2PZT A;  4K2K A;  5E1F A;  2EYM A;  2M00 A;  2F0D A;  4G57 A;  4HMJ A;  3P75 A;  3DHQ A;  1EY8 A;  1KAA A;  2F0W A;  1SNP A;  3PMF A;  4ZUI A;  1F2Z A;  5IGE A;  4K5V A;  2F0L A;  1SYD A;  4LAA A;  4QF4 A;  4S3S A;  2EYO A;  4HMI A;  2EYL A;  1TQO A;  4HTH A;  4K8I A;  4N9T A;  2OEO A;  3P1H A;  1KDA A;  2F0N A;  2EY5 A;  3NQT A;  4K5W A;  4OL7 A;  5J22 A;  2F3V A;  4R8N A;  1EY4 A;  1ENC A;  5IGF A;  5C3W A;  2F0K A;  4J6H A;  2EY6 A;  2LKV A;  3NHH A;  2PQE A;  5HGT A;  2F0I A;  1EYA A;  5C5M A;  5HUR A;  5I9P A;  3ERQ A;  5KRU A;  1STG A;  1SYC A;  4KD4 A;  2OF1 A;  5IOC A;  2KQ3 A;  2NUC A;  1EY0 A;  2PYK A;  3QOJ A;  2F0P A;  3TP7 A;  4EVO A;  2RDF A;  3ITP A;  1AEX A;  5IOD A;  1A3V A;  4KJN A;  3NXW A;  2F0T A;  3NUC A;  4ODG A;  5IGC A;  4J1M A;  4ZUJ A;  3SK5 A;  5EKL A;  1EYC A;  4K5X A;  5C4H A;  2O4X A;  3MZ5 A;  1EY9 A;  1SYE A;  5C4Z A;  1JOR A;  1STH A;  1F2M A;  2SNM A;  5JOB A;  4RKB A;  5KIX A;  4IUN A;  1SND A;  5IGB A;  3C1E A;  1SNM A;  4B9X A;  4I65 A;  4H7B A;  1JOO A;  2F0V A;  4F7X A;  1SNO A;  1U9R A;  2F3W A;  2PW7 A;  3BDC A;  5JAV A;  5C5L A;  4KY6 A;  2WAC A;  2EY1 A;  3VA5 A;  4EQO A;  1EZ8 A;  4DF7 A;  1KAB A;  1KDC A;  2RKS A;  4WRD A;  1IHZ A;  3C1F A;  3U9O A;  5CV9 A;  4PMC A;  2F0E A;  2PZW A;  3TME A;  3EVQ A;  4EQP A;  3S9W A;  1ENA A;  4B9W A;  1SYG A;  3E5S A;  1A2T A;  1EY7 A; 
#chains in the Genus database with same CATH topology
 3NP8 A;  1HQM C;  3AFQ A;  4POG A;  2JA9 A;  1Q82 C;  4LWC A;  5FLX E;  4DAV A;  3J7A 5;  1TU2 B;  2BDO A;  1IYJ B;  4R9W A;  3CQZ H;  2G9H D;  4WJW A;  2X6G A;  2GA4 B;  3S1M B;  3A8I E;  4A3B G;  2F0S A;  4ZYS A;  1Y8P B;  4GN4 B;  1TT2 A;  1KLU D;  5CV8 A;  3WOE A;  2WIN B;  2L11 A;  1P8L A;  1KD1 C;  1R4P B;  2WB1 B;  1ESR A;  2YTX A;  1SMX A;  1SAP A;  4DKA C;  3FDT A;  5C44 H;  4QJF A;  1BQQ T;  3I2Z A;  2Q2H A;  5LL6 S;  2A73 B;  3PO2 G;  4BWG B;  2QIL A;  2R7Z H;  1LLR D;  1EWI A;  1PTO H;  4OX9 Q;  1ASY A;  3HKZ G;  1YEZ A;  4JI1 Q;  5CGK A;  1SE2 A;  4LF5 Q;  5I2X A;  2JA5 G;  1PYB A;  4LF4 Q;  4Z9C B;  2F0D A;  4OON A;  1PHJ A;  4NXN Q;  1F77 A;  5AJ3 L;  2F0W A;  3RR5 A;  2LXJ A;  4LF8 L;  4J15 A;  4K5V A;  4DPG A;  4XXE A;  1V1O A;  5JEA J;  3OW2 A;  4UY8 C;  2J4X A;  3GO5 A;  1J9O A;  1SEB D;  3PO3 B;  2F4V Q;  3K58 A;  2RCN A;  4H44 C;  3W5O A;  4CKE A;  1B3Q A;  4JI1 L;  2N3S A;  4LF5 L;  4KD4 A;  1HTL D;  3KUP A;  2F4I A;  2B29 A;  4EVO A;  4PZ8 A;  5IYB G;  4NXN L;  1NY4 A;  2RSN A;  5C3E B;  1XMQ Q;  4R8I A;  3MZ5 A;  3NSW A;  1M4V A;  5C4Z A;  2VXW A;  3PUZ A;  4DR2 Q;  3C1E A;  1SNM A;  1E24 A;  3K80 C;  2KJX A;  3M4Y A;  3FPP A;  3URY A;  2K32 A;  3H94 A;  3C1F A;  2Z4H A;  5C4J H;  2KA7 A;  4OO1 H;  3EVQ A;  3T1H L;  5K36 H;  1U4M A;  3SGI A;  4B3T Q;  2UXB Q;  2E76 C;  5ELF A;  3I91 A;  4L8J A;  2PNR C;  1HCZ A;  1WOC A;  4KHV A;  3J80 c;  5GAD C;  4KD3 A;  4A3I G;  4ABN A;  4WOR A;  2NTS A;  4ZKB B;  4HJ9 A;  2CW0 C;  3H0G H;  1G6P A;  1EEF D;  2VQE Q;  3C3L A;  2UXD L;  5IGB A;  4JI6 Q;  2C9O A;  1N32 Q;  3OMC A;  4IFD I;  4MIU A;  3D4W A;  3TZU A;  2EJM A;  1KXL A;  3K7A B;  3RMH A;  1XNR Q;  4UAI A;  4DAM A;  4FF2 A;  1Y1V G;  5BR8 L;  1TS2 A;  3HOU B;  4B3T L;  5DEH A;  4TRD A;  4P75 A;  2UU9 L;  4BBR G;  4HIM A;  4CGY B;  4KY7 A;  4HR7 B;  4UP7 A;  4DFA A;  1A2U A;  2AMC B;  3U9S A;  4OIK A;  1NMG A;  1KDB A;  1NAP A;  2DY7 A;  1Y1W G;  1N34 L;  2HQE A;  1LT4 D;  2NZH A;  3R93 A;  1E1T A;  4BY1 G;  5A2Q L;  1BCP C;  1DM0 B;  2RBM A;  2Z1C A;  4GKK Q;  2I0Q A;  2FHT A;  3RN2 A;  3G48 A;  1O78 A;  1WTO A;  5ELD A;  3HGB A;  1TWA H;  4K2K A;  1ML0 D;  5T1I A;  2HDL A;  4G57 A;  3HOW B;  5JVG 3;  2IT1 A;  4C56 C;  1KTK A;  2D0O A;  4DR5 L;  2EYO A;  4HMI A;  1GKH A;  3M3Y B;  3I4N H;  2E2H H;  4HID A;  3GTG H;  2R92 G;  3J81 c;  2K5W A;  4I7Z C;  4GKK L;  2JSO A;  4DAY B;  4A3M B;  1QE6 A;  2EJG C;  3GD7 A;  1RHP A;  1B8A A;  1TII D;  1SYC A;  4JV5 Q;  4GNX A;  1K8O A;  1G2T A;  1K0S A;  1EIH A;  1A3V A;  4Y7N H;  1GO3 E;  4O1N A;  2RVL A;  4K5X A;  2JK8 A;  2VB3 X;  1NJI C;  1I4G A;  1PTO F;  2B63 G;  3UDG A;  1S5B D;  2UXC Q;  1KNE A;  4IUV A;  1WCM H;  3CQZ B;  1NR4 A;  4CDF C;  1J5E L;  1B3A A;  1PH6 A;  4LF6 L;  4RGN A;  4X3S A;  3TN2 A;  2UUC L;  4BA2 I;  1YHB A;  5ELN A;  1LAB A;  1A2T A;  3RLF A;  1K8G A;  2YTV A;  1H9S A;  2WKC A;  3Q23 A;  1D8L A;  2IWH A;  5EPK A;  2PCF B;  4EGV A;  2IL8 A;  1HUM A;  4PZ6 A;  5C44 B;  4JI8 Q;  2ZTE A;  3D31 A;  4RG1 A;  1EIY B;  1RD9 D;  2R7Z B;  4A3B H;  1PTO B;  4DUZ Q;  3DM1 A;  1Q86 C;  2UUA Q;  5AFW A;  2ES2 A;  1EY6 A;  2GVA A;  1STB A;  1AW7 A;  3MEF A;  1X3P A;  3CC7 A;  2WAQ B;  3CAM A;  4G4K A;  1ILQ A;  4OIJ A;  4HIO A;  4TSS A;  4BA1 I;  1ONL A;  4JI8 L;  2N88 A;  1CHP D;  4JOI C;  4PMB A;  3CC2 A;  4P72 A;  5C3X A;  4ID6 A;  4DU9 A;  3ER0 A;  3ZJY C;  4JK1 C;  2HIV A;  1Y8O B;  4KN4 C;  3PO2 H;  5KEE A;  5M3F G;  3BZC A;  4A3F G;  3Q8D A;  1IL2 A;  2BA0 A;  2Z8L A;  4DV5 Q;  1JB3 A;  3KDF B;  2JA5 H;  4FF3 A;  3KLW A;  3CF5 A;  1D5M C;  3U4Z A;  3GQB A;  3M9B A;  2GVB A;  1LTL A;  4AH6 A;  4JPB W;  1I3Q H;  3FPU B;  1IZ6 A;  3WOF A;  3TP5 A;  4N9T A;  3NQT A;  3TQY A;  1XNQ Q;  2CQO A;  1LT5 D;  5M5Y H;  2JXM B;  1HR0 Q;  4LFB Q;  1U4R A;  4JOI A;  4FXD A;  2WV6 D;  2QDL A;  2LKV A;  5C4J B;  1FNU A;  3G4S A;  4JI5 Q;  2Y0S B;  1DOM A;  4A3D B;  2NVT H;  2ZJQ A;  3PF5 A;  2NUC A;  2PQA B;  5IYB H;  4K6L A;  1DYQ A;  2KEN A;  3NQI A;  4AYB G;  2K5V A;  1FVI A;  1X65 A;  5GQO A;  3GTK H;  1IYU A;  2OT2 A;  1EY9 A;  3UE1 A;  4IUN A;  1I4R A;  1XNQ L;  3H0G B;  4I65 A;  4GKJ Q;  2ZJR A;  3KOJ A;  3KK7 A;  2AQ1 B;  1GOZ A;  4JBJ A;  4JI5 L;  2IY5 B;  4ZK9 B;  1HNZ L;  4DV1 L;  3PUW A;  4XYO A;  4EQP A;  1S40 A;  1B2T A;  1V9P A;  2CCZ A;  4N8X 1;  2PMZ E;  1H9J A;  4CDC C;  1LYL A;  4X66 Q;  2FIN B;  4EQN A;  5I4D A;  3MEH A;  1SNQ A;  3DEO A;  1VQL A;  3NTI A;  5JJL A;  2F0F A;  2RF4 A;  5EPJ A;  1NUC A;  3Q24 A;  1VQI A;  4GOP C;  4K6D A;  4EX5 A;  4A3I H;  4MTN A;  5JEA G;  5J39 A;  5M3M G;  4GKJ L;  2EXZ A;  3S1N H;  4DV7 L;  1D1I A;  2CHB D;  3SK8 A;  4IPH A;  1S72 A;  1BNZ A;  1SDF A;  4X3K A;  3SK4 A;  2TMP A;  3CHB D;  4KJO A;  4LF7 L;  1Y1V H;  4R4C A;  1TWA B;  3MWY W;  1PH7 A;  4KTA A;  4BBR H;  4KKU A;  1Q8I A;  2BH2 A;  1AN8 A;  3L7Z C;  1E2V A;  3CXC A;  1JJC B;  1BCP F;  2R93 G;  3I4N B;  2M9V A;  2L5T A;  1HA6 A;  1Y1W H;  2E2H B;  3GTG B;  1A3U A;  4GOP A;  4X62 L;  2IPK D;  2OXP A;  4BY1 H;  3KJO A;  1SYB A;  2EQS A;  2C35 B;  1TXY A;  1V8Q A;  2XGT A;  1ASZ A;  3HRZ C;  2F03 A;  5IP7 G;  1CZW A;  1VQH A;  3TDQ A;  3AYH B;  1SRO A;  1OXT A;  1SNC A;  2XVS A;  4TKO B;  4Y7N B;  2KUM A;  1KAA A;  4FXK C;  2HQL A;  4LF9 L;  4LFC L;  1SYD A;  4LAA A;  2G9D A;  4MTK A;  4UHV A;  1PH4 A;  1RTO A;  2OEO A;  3P1H A;  5EKI A;  2JEB I;  1YJ9 A;  2R92 H;  1DOL A;  3NWS A;  4GLV B;  2D2C C;  5IWA Q;  1BBX C;  4IN3 A;  2A69 D;  5M5X H;  2F0I A;  2Q8T A;  5C5M A;  4ZAI A;  1XTC D;  2N8N A;  5COY A;  5CBE E;  1X6O A;  2EJF C;  1VQ4 A;  3FEW X;  1F9S A;  3TRZ A;  2B63 H;  4PZ7 A;  5JOB A;  4JYA L;  3M4Q A;  1GVP A;  1CA6 A;  4B9X A;  3TEH B;  4F7X A;  4U68 A;  4JC0 A;  3VA5 A;  1VS0 A;  4A3B B;  1JR0 D;  2K7V A;  2SEB D;  3U9O A;  2Q8I B;  4X64 L;  2ID0 A;  5LMU Q;  1VQ9 A;  3V05 A;  3KYH C;  5GAG C;  1K73 C;  5ELE A;  3NTH A;  1SE3 A;  3U4V A;  1I4X A;  1H9R A;  2MGS A;  1IBL L;  1VQB A;  1UE6 A;  1B53 A;  5ELC A;  3OIQ A;  3PIP A;  1QIL A;  3MA2 B;  2LY7 A;  5C0X J;  1A3T A;  3QB3 A;  4RGT A;  3PO2 B;  1MBY A;  5LMU L;  1NSN S;  1EIG A;  1HQR D;  5CV5 A;  3HKZ B;  3S17 H;  1HZA A;  2JA5 B;  3BS1 A;  5DAU A;  1X54 A;  2BE5 D;  4NKL A;  1R4Q B;  5F2D A;  3I55 A;  2D0P A;  1BKB A;  2QKI C;  1PZK D;  3NPP A;  3W3A A;  2NTT A;  2PI2 E;  1FR3 A;  4IJH A;  3HOX G;  1R9T H;  1RKN A;  2PW5 A;  3T16 A;  1GUT A;  3KF8 B;  4DR6 Q;  3UDX A;  5M9O A;  1KQS A;  2YTY A;  5M5Y B;  4JBK A;  4YHH L;  5KGU A;  4NB3 A;  5M3F H;  4JI4 Q;  4PG3 A;  3M4O H;  4A3F H;  1F9Q A;  2C5C A;  2NVT B;  3FMC A;  3VYT A;  1NBW A;  5T1G A;  5EAY A;  1XPO A;  3KF6 B;  1EYD A;  1B1Z A;  3STB D;  5BN5 A;  4TQU S;  1ESF A;  1WD0 A;  3NBH B;  4HCS A;  2CKZ B;  4F88 A;  3GTK B;  2WFW A;  3M7G A;  4C3H H;  1HHV A;  5CYU A;  5DM6 3;  3VYS A;  1LTA D;  1L2F A;  4LFA Q;  2L9H A;  4A93 G;  2UUB Q;  3K5L A;  1D1K A;  5IGF A;  3BDO A;  2PQE A;  1S5E D;  5JVH 3;  5E4X A;  1LAC A;  4WJ3 M;  4P2C B;  3TS2 A;  5IYD G;  3ULJ A;  4RCO A;  2PYK A;  2MFI A;  3CCV A;  1JWU D;  4B3M L;  2VQF Q;  4JI7 L;  1PFN A;  1JOR A;  4A3I B;  1AE3 A;  3E0J A;  3J81 E;  2ZXR A;  1JB7 A;  1JWS D;  3BDC A;  2A5H A;  4POF A;  2KCC A;  1WYD A;  2E74 C;  1Y1V B;  1ENA A;  3CRL C;  3HOZ G;  4RHR A;  4BBR B;  4XT1 B;  5FLM G;  3BVG A;  1I94 L;  2K5N A;  3BDL A;  3ND9 A;  4OWT B;  4DA2 A;  5IP9 G;  1PH3 A;  1EFW A;  2DNC A;  4P71 A;  3SXH A;  4ZLT F;  5JEA H;  5CC4 A;  3CP0 A;  5M3M H;  1Y1W B;  2D5D A;  5EBD A;  2A69 C;  4NXM L;  4IAL A;  4LMQ D;  4BY1 B;  3L0O A;  4K8J A;  3DUZ A;  4KKS A;  4CKB A;  3MXP A;  1I50 H;  2NB0 A;  1K83 H;  2BOS A;  2XSC A;  3NEN A;  3PUY A;  3I4M B;  4YIJ A;  2EYH A;  1F2Y A;  1AZP A;  3F2U A;  2VB2 X;  1GUW A;  3CCE A;  3R2T A;  2B2U A;  2R93 H;  3FHW A;  4E6I A;  3J7Y W;  4JBM A;  2JA8 H;  4IQZ A;  5C6A A;  1PFM A;  2ZM6 L;  2R92 B;  2NBF A;  1D7Q A;  1HR0 W;  1PDQ A;  1N33 L;  3R3O A;  4LJZ C;  1CK1 A;  4CHT B;  4JG2 A;  4DV3 L;  5IP7 H;  3GTQ H;  3LWE A;  1EEI D;  4HED A;  2SOB A;  4RKL A;  4QGU A;  2EYM A;  4LUV A;  3EN2 A;  4HMJ A;  3P75 A;  3AFP A;  2K5D A;  4C2M H;  5EJW A;  2B63 B;  2KVM A;  5AJ3 Q;  4LF8 Q;  4H0L C;  3GTM H;  1VQF A;  5J22 A;  2XRQ D;  4C3J H;  3QO2 A;  3CMA A;  1EQR A;  2E2J H;  3OWE B;  5IE8 A;  5A2Q E;  2BE5 C;  5A35 A;  2LXK A;  4UP8 A;  1EYA A;  3ERQ A;  3QOJ A;  4IFD G;  2F0P A;  4H02 A;  4DK0 A;  2RDF A;  2FMM A;  2JQO A;  1LT6 D;  3OW7 A;  3CCU A;  2F0T A;  4DR1 L;  1GUG A;  3E0E A;  3CCM A;  5FKA C;  4O42 A;  2AWN A;  3RZD H;  1EWH A;  2MJ8 A;  4KY6 A;  1YNX A;  5JPM C;  3JAM L;  1BBW A;  1S5D D;  3STB C;  4QUF A;  3S17 B;  2PZW A;  5JJZ A;  4ZCK A;  5IGD A;  1EY7 A;  2R3Z A;  3T1H Q;  3QIA A;  4CKC A;  4B3S L;  1PFS A;  1YIJ A;  3H6M A;  4DNT B;  1ZYR C;  1R9T B;  4B3R L;  1QB5 D;  2CQA A;  2QF7 A;  2N55 A;  1FJG L;  2ZXP A;  1STY A;  3PGZ A;  2VUM G;  5M3F B;  1SLJ A;  3M4O B;  4A3F B;  1AZQ A;  2UXD Q;  2O5J C;  2KCM A;  1SFO H;  1HTP A;  5JJI A;  3PQI A;  4JCV E;  5CV6 A;  5BR8 Q;  1DOK A;  4OEM B;  2UU9 Q;  1YHA A;  4C3H B;  3LWU A;  3HOX H;  2YV5 A;  1WTR A;  3BVZ A;  1YVC A;  1YJW A;  2NZ1 D;  1G8Z D;  1JQY D;  1UAP A;  3NE5 B;  5COR A;  3I8Z A;  1G29 1;  5J3B A;  3HZX A;  3G71 A;  1N34 Q;  3J7A F;  5I2Y A;  4AIM A;  1Y8N B;  3TSS A;  3K7U C;  4RGO S;  2QW7 A;  1SMY C;  4L63 B;  1HZB A;  3GTP B;  4AYB B;  3PCO B;  1CKN B;  4KY5 A;  5E3F A;  1I5F A;  1IXR A;  1UEB A;  5FO8 B;  3CCJ A;  4HIK A;  3W1B A;  2OQK A;  2HCC A;  1CKM A;  3QG1 A;  4CDD C;  1CFM A;  1TQO A;  3SVM A;  4A93 H;  4OL7 A;  4DR5 Q;  4A3L G;  3AU7 A;  2N78 A;  1W3S A;  4KHP L;  4AQY L;  1Q3L A;  1CA5 A;  3UI2 A;  3UDI A;  4DXF A;  1UE1 A;  2WB1 E;  4GNX C;  4DXG A;  5IYD H;  2J7Z A;  2PI2 A;  5C4X B;  4RFB A;  1TS3 A;  1SBB B;  4TVA B;  3MC0 B;  2NVX H;  2LMC B;  3HKS A;  4DNR B;  2RDH A;  3SK5 A;  1PH8 A;  2MNA A;  1SYE A;  5M3M B;  1EU3 A;  1SND A;  3I56 A;  1EFI D;  3K81 C;  2EXD A;  1UWV A;  1D6E C;  1VMC A;  3M4P A;  1IW7 D;  4KLK A;  3DEP A;  1I50 B;  1EZ8 A;  1IBK L;  2WII B;  1J5E Q;  4WRD A;  4JI0 Q;  1K83 B;  2CWP A;  1V1P B;  3K5O A;  1HNX L;  3MXG A;  5EBC A;  4C3I G;  4LF6 Q;  3CCQ A;  2JE6 I;  3HOZ H;  4Q5V A;  1LTB D;  2UUC Q;  1UNS A;  3HFZ B;  5FLM H;  2F0U A;  5ISR A;  1SYF A;  5IP9 H;  2R93 B;  1JJG A;  2DN8 A;  2JA8 B;  2ASB A;  1E1O A;  3OTO Q;  2JYO A;  3RZO H;  2MPM A;  3QWN A;  4CDE C;  3S2H H;  1CUK A;  1XJV A;  3T1Y L;  4IO9 A;  1RF2 D;  4JI0 L;  1TY2 A;  1HXY D;  2Q2T A;  5D3D A;  5K5P A;  3GTQ B;  3SK6 A;  4A76 A;  2KEC A;  2JN4 A;  3EFX D;  1QNU A;  3TP6 A;  3FKI G;  4QY7 A;  2A6E D;  4C2M B;  1J8I A;  1EOT A;  1K8M A;  3OTO L;  3GTM B;  5C0X I;  2A1A A;  5FO7 B;  3PIO A;  2Z9H A;  5H1S E;  3G6J B;  2WB1 G;  4C3J B;  4IUR A;  1XPU A;  1K3R A;  5I6W A;  2E2J B;  1L0X B;  1JOK A;  3K57 A;  4EQ5 A;  1X9N A;  3BZD B;  3D0F A;  3TP8 A;  4QQB X;  3VR2 A;  1O7Z A;  4A3K G;  1C8C A;  1MD2 D;  1QZG A;  1X55 A;  5GAE C;  1TY0 A;  3ND8 A;  1EY8 A;  3GP7 A;  1JCK B;  1G2S A;  2EYL A;  3RZD B;  2RQX A;  1L0Y B;  1U4L A;  5G3L F;  4CJ0 B;  5LMN L;  3PO3 G;  3MXN A;  2HHH L;  4HJ5 A;  2RA4 A;  1CQF A;  4OEL B;  2OF1 A;  4IFD H;  2KQ3 A;  1CSP A;  3TP7 A;  1KRT A;  1QUQ A;  1DD2 A;  3AB9 A;  1VQN A;  3A7L A;  5IT9 L;  2O4X A;  2J0T D;  4RKB A;  5KIX A;  3RLN A;  1MIU A;  4ZRZ A;  1Z9F A;  1H95 A;  2A68 D;  1XYI A;  1F2L A;  2ZXO A;  4O0A A;  1AE2 A;  3DWQ A;  1EUJ A;  1SFO B;  1HNZ Q;  4DV1 Q;  1QJO A;  4DK6 C;  1QVG A;  3C46 A;  5BN3 A;  1UE5 A;  3A56 A;  4ULL A;  1GJX A;  3HOX B;  2F0H A;  1CSQ A;  3U58 A;  1HZ9 A;  3OPO A;  4RH6 A;  1CQV A;  1VQG A;  1LTS D;  1MSH A;  3A5Z B;  1OXV A;  1VQJ A;  4RCN A;  3BVM A;  1JJ2 A;  3S1Q H;  1EOV A;  3GV6 A;  2VUM H;  2NZO A;  1ICW A;  1FD7 D;  1STN A;  1DGS A;  3T13 A;  2HUG A;  4DV7 Q;  1EQT A;  2PZU A;  3CCS A;  3UE0 A;  4FO2 A;  2TSS A;  4KV6 A;  3ONA B;  4LF7 Q;  4YCV A;  1XXG A;  1O7L A;  2HT1 A;  4P74 A;  3S2D H;  1DON A;  1B4O A;  1IBM Q;  1M1K C;  2F0M A;  1BOS A;  1WI5 A;  3JAM i;  3R2I A;  1IW7 C;  4YY3 L;  1FL0 A;  4BBS G;  4A93 B;  1Q12 A;  3DWP A;  4QB4 A;  5FO9 B;  2VZA A;  3I70 A;  1BR9 A;  4JW0 A;  1ZEQ X;  1ET6 A;  1HNW L;  1CM9 A;  1GXD C;  1JOQ A;  4X62 Q;  3MFG A;  4DR4 L;  4K0K L;  1U0L A;  3K8A A;  4GN3 B;  3S15 H;  2B39 A;  2NN6 I;  4NMZ A;  3G6E A;  4HN7 A;  5FK9 C;  5CV4 A;  2QA4 A;  1S5F D;  2NVX B;  4IUU A;  2DY8 A;  2Z6K C;  3S16 H;  1IBM L;  1NCV A;  4ZUI A;  1F2Z A;  4A3G G;  2K04 A;  1WTH A;  2M2L A;  2QCP X;  1VF7 A;  4A3J G;  4LFC Q;  4LF9 Q;  4A3L H;  1WJJ A;  3M7N A;  4GZY C;  2F3V A;  3E6Z X;  2WAQ E;  5C3W A;  2B2W C;  1E2W A;  1JE5 A;  4A3C G;  3NHH A;  1N9W A;  1VMP A;  1NTG A;  4LW1 A;  5FJ8 G;  2A19 A;  4DR3 L;  4BY7 G;  3CPF A;  2A6E C;  3GDE A;  1GHJ A;  4DV2 L;  3PIP 3;  4MHE A;  1Q1E A;  3NXW A;  4MZ9 A;  1Q90 A;  3H3V I;  2Z6K A;  1SJE D;  1B9N A;  4I7A A;  3CME A;  1HUN A;  3RZO B;  2BDN A;  2V4D A;  4JYA Q;  2IX1 A;  1WCM B;  3S2H B;  1SNO A;  2PW7 A;  4QIW B;  3CRK C;  3HG9 A;  3T56 B;  4DF7 A;  5ELB A;  4XQN A;  2B2W A;  5CV9 A;  2K5Q A;  3OOC A;  1BCP B;  4C3I H;  2K1B A;  2Z0S A;  3E9H A;  1X3F A;  4F87 A;  4X64 Q;  1XMO L;  4GNX B;  3F8T A;  4B9W A;  2A8V A;  4JI3 L;  1VQ7 A;  3S14 H;  1PZI D;  1UEA B;  2Y0S E;  4L5R C;  2DUD A;  1IKM A;  4R4I A;  1IBL Q;  2MO0 A;  1EQV A;  3RN5 A;  3CU7 A;  4RAU C;  5IGG A;  3L3O C;  2A6H D;  1WTQ A;  3SHL A;  4QMG A;  1NNX A;  1YBY A;  3S1M H;  2AKW B;  3OWF A;  3MHB A;  4HAE A;  2RHQ B;  4G7Z C;  1PYW D;  2QDB A;  3CKI B;  2MHV A;  1CT1 D;  3FKI H;  2B2Y A;  3V96 A;  5IIF A;  2EOT A;  1H9S B;  1FYC A;  3HEJ A;  2JA6 G;  1O7I A;  4RA8 A;  3A8K E;  1RL2 A;  1SE4 A;  1B44 D;  2A68 C;  5D3I B;  2CWA A;  4LUO A;  1SN8 A;  2JP1 A;  4YHH Q;  2A74 C;  3NEM A;  4K14 A;  3IL8 A;  4A3K H;  4FVM A;  3I90 A;  2K03 A;  3U50 C;  1O7Y A;  5KYL A;  1LTT D;  3DWA A;  1UUP A;  1SNP A;  1TS5 A;  4GS3 A;  1VQE A;  3VR3 A;  1I3Q B;  1PV4 A;  2WP8 J;  3W2D A;  1W6K A;  1B9M A;  4K5W A;  1RTN A;  1EY4 A;  4BXX G;  4JBW A;  1YNJ D;  5KNB A;  1TVX A;  1EYG A;  3PO3 H;  1C4Q A;  1HH2 P;  3WDN A;  4YWK A;  3OIP A;  3X3M A;  1SXT A;  1GUS A;  2GN5 A;  1H9K A;  4A3D G;  2RCF A;  1PH9 A;  4U67 3;  2HD3 A;  1C7Y A;  2H5X A;  3GTJ H;  4FDB A;  4B3M Q;  1B70 B;  3ERS X;  3VR6 A;  4FF1 A;  1UE7 A;  4JI7 Q;  4M1U B;  3S1Q B;  1F9R A;  1KAW A;  1HA5 A;  2VUM B;  1I6H H;  3I4L A;  3UDF A;  1ZYR D;  2B2T C;  2X6L A;  4ILW A;  4CJ2 C;  1XTD A;  1A15 A;  4XT3 B;  3A7A B;  5ELO A;  4R1J A;  1PH2 A;  4QL5 A;  3S2D B;  3OHX C;  5I9O A;  1I94 Q;  5CV7 A;  1A8V A;  4LUZ A;  1U5K A;  4IOA A;  1CI3 M;  2KHJ A;  1KHI A;  1EU4 A;  1QG7 A;  4M8A A;  5KNC A;  3S1N B;  1J6Q A;  2R7F A;  4NXM Q;  1MHW C;  2DJG C;  4DUY L;  5CR3 A;  1ILP A;  2B2T A;  3S15 B;  1SR3 A;  1VQM A;  5J1Z A;  3RUZ A;  4BS9 A;  1RIP A;  3SEB A;  2R61 A;  5JPN C;  4UDU C;  4GLX A;  4ZKC B;  3AEV A;  4KKT A;  3S16 B;  4YWL A;  2B2U C;  1SMY D;  3KLS A;  4B08 A;  4BBS H;  1RJT A;  1C9O A;  3ICE A;  1OXS C;  2EYJ A;  2F3I A;  2L12 A;  3ULL A;  3KLS X;  1PRT D;  3IRB A;  1K3B C;  1DCZ A;  4WJ4 A;  1B7Y B;  3HS0 C;  2ZM6 Q;  1MI2 A;  2B3G A;  1N33 Q;  4OO1 I;  4X3T A;  2EDG A;  1XPR A;  2K14 A;  2FXQ A;  3QJY A;  1NR2 A;  1HRJ A;  4L6T B;  4DV3 Q;  4XTC S;  3KLR A;  1QVC A;  1OTC A;  3MAQ A;  2PZT A;  1I6V C;  2QGQ A;  5E1F A;  2PPB C;  2L1B A;  2HCI A;  1VQA A;  3HKZ E;  5TSS A;  4A3G H;  4A3J H;  3HOV G;  2A6H C;  4GOP B;  3H09 A;  2VY3 A;  2Z4I A;  1ENC A;  2F52 A;  2QEJ C;  1D5X C;  4A3C H;  2DNE A;  2OQ0 A;  5M5X B;  2LFN A;  2ICI A;  4HJ7 A;  5FJ8 H;  4BY7 H;  3KFU A;  4IUT A;  5KRU A;  2JJQ A;  1EIF A;  1TWH H;  2AQ2 B;  4J8Q A;  3T53 B;  3S14 B;  4A4I A;  5GAH C;  1YNN D;  4ME3 A;  3CCL A;  1E7Z A;  3J80 L;  2V1C C;  2E2I H;  3Q0A A;  4DR1 Q;  2IHE A;  2R7D A;  4KHZ A;  1ENF A;  1FGU A;  5M5W H;  1MGS A;  2KOL A;  3WWV A;  3CC4 A;  1U9R A;  3M85 A;  4UPA A;  1LO5 D;  2KED A;  1PH5 A;  4KI0 A;  3NWT A;  3S9W A;  4R4T A;  1N8R C;  3FKI B;  3E3X A;  3GTO H;  2EE1 A;  4PV1 C;  3BZK A;  2XWB B;  1P16 A;  1N36 Q;  2F0O A;  1Z47 A;  4DR7 Q;  4B3S Q;  1L1O C;  4FXG C;  1YNJ C;  4KK7 A;  1S5C D;  2AUJ D;  4B3R Q;  4PNY A;  5CMD A;  4DV6 Q;  3V2T A;  4HJA A;  3PUX A;  1FJG Q;  1CHQ D;  3LX0 A;  5E7N A;  3T51 B;  4ZQ3 A;  1VQK A;  4YWM A;  2MO1 A;  4A3K B;  3KDF A;  1SE8 A;  3LNN A;  1JC7 A;  2K52 A;  1GUO A;  1N36 L;  4DR7 L;  5FOB B;  3VDY A;  1V43 A;  2ICE C;  4FNF A;  2JA6 H;  1HFG A;  3K0Y A;  3J81 L;  3FRP B;  4F8M A;  2NVQ H;  1L1O A;  4DV6 L;  1STA A;  2KCT A;  1CTM A;  1PXU A;  3ERO A;  3TRE A;  1OO9 B;  1K0R A;  2SNS A;  3BYT B;  4C1N I;  4OX9 L;  3AQQ A;  2JA7 G;  3ZYY X;  2KHI A;  3P7J A;  1CKO A;  1T5E A;  4LF4 L;  2PQA A;  4IJL A;  3Q22 A;  3F2D A;  2O2L D;  3GTJ B;  1VDZ A;  2M00 A;  5LL6 X;  3BJU A;  1LUZ A;  3L2P A;  3A74 A;  3MFY A;  3I7F A;  3K5M A;  4QF4 A;  4S3S A;  1KDA A;  1I6H B;  4YCU A;  3EBE A;  3TBI B;  3HOY G;  4BXX H;  2F4V L;  4KHP Q;  2PNH A;  2EY6 A;  4AQY Q;  1TS4 A;  4L5T A;  2MP1 A;  3I4O A;  3K6O A;  1LM0 A;  5HUR A;  3I3C A;  2ZJP A;  4A3D H;  1XWE A;  5E4W C;  5IOC A;  1K9M C;  1GD7 A;  1VF5 C;  1XMQ L;  2O5I C;  1MJC A;  4ODG A;  1HPC A;  1PRT C;  1EYC A;  4LNQ A;  2K75 A;  5FLX L;  4DR2 L;  3DLL A;  4G7O C;  1Q8K A;  1L0W A;  1A0I A;  3PF4 A;  3CCR A;  1TWC H;  5C0X G;  3KBX A;  5C5L A;  2H1E A;  3PUV A;  4EQO A;  1STE A;  3ULP A;  3Q6S A;  2Q8R E;  1KRS A;  1IBK Q;  1YHQ A;  2F0E A;  3TME A;  1X3G A;  1T9H A;  1HNX Q;  3AMU A;  1YJN A;  2UXB L;  5C4H A;  5IYC G;  1JT8 A;  3PIO 3;  1AFP A;  1ZKO A;  1X32 A;  2I46 A;  2XNA C;  2K6A A;  3IFD A;  3IKJ A;  2IJ0 A;  1TWG H;  3P20 A;  5IT9 E;  4BBS B;  2RHS B;  3OMG A;  1I4P A;  3OYY A;  1BVS A;  2EIF A;  2VQE L;  1BO0 A;  1SSO A;  1VQD A;  4JI6 L;  1SRU A;  1N32 L;  3C2P A;  3R8B A;  1IL8 A;  1XNR L;  3T1Y Q;  2OTL A;  4A3E G;  1YNN C;  1KNA A;  2EYP A;  1EL0 A;  2HIX A;  3JAM c;  2VL6 A;  3I4M G;  2QEX A;  2KBN A;  4FF4 A;  2F0G A;  3E9I A;  2VS1 A;  4A3G B;  3DM3 A;  4RHS A;  2AWO A;  4A3J B;  1WTX A;  1EZ6 A;  4ME5 A;  4DGZ A;  1NMF A;  1Z7T A;  4DV4 Q;  3A55 A;  5DLQ E;  1HFN A;  3TZD A;  3F2B A;  3A5U A;  4YCW A;  2ATW A;  1IYV A;  3BG3 A;  1GHK A;  4BY7 B;  3NK9 A;  2LS0 1;  1PVO A;  5EKK A;  4PMW A;  1TWH B;  2XIW A;  2Z6B A;  3VYR A;  3A8J E;  1BXT A;  2K33 A;  3G7L A;  4CJ1 B;  1PYS B;  3X3N A;  2OWO A;  2IHF A;  2E2I B;  1AH9 A;  3SDZ A;  3HOV H;  4XIG S;  1OXU A;  4DV4 L;  2DGY A;  3J81 j;  4K8I A;  5M5W B;  3CW2 C;  2LSS A;  2PMZ B;  2AQ3 B;  4J6H A;  1BF4 A;  4JV5 L;  5LMN Q;  2ZT9 C;  4DV0 Q;  4JVZ A;  1G51 A;  2HHH Q;  1PFB A;  1V1Q A;  4X3U A;  3GTO B;  1RDP D;  4LK1 C;  3ITP A;  4C1N K;  4P73 A;  2PO4 A;  2NYZ D;  1EQQ A;  1WTV A;  3QR8 A;  2UXC L;  1STH A;  1F2M A;  4AYB E;  1B50 A;  1D5Z C;  5FLX c;  1JWM D;  2F3W A;  5JAV A;  3GTL H;  2F1M A;  2WAC A;  1PLF A;  2R6G A;  3LGJ A;  1KAB A;  4DV0 L;  4FYD A;  1E0B A;  2DJF C;  4NPS A;  4R4Q A;  2NN6 G;  2EY2 A;  3IAY A;  5NUC A;  3A54 A;  5C3E G;  2JA6 B;  3KJP A;  5DM7 3;  1EWC A;  1Q1B A;  4KN7 C;  2IW3 A;  2NVQ B;  3KF8 A;  5D65 A;  2X69 A;  4DAP A;  3QOL A;  1MJE A;  3OSO A;  4RWS C;  3J7Z C;  4DUZ L;  2KHS A;  3J80 i;  4OWX B;  2UUA L;  2I5M X;  3I72 A;  3SR1 A;  1M8A A;  2D62 A;  4X65 Q;  4HJ8 A;  5BN4 A;  3KF6 A;  4DN4 M;  1WTW A;  1JIC A;  1K8A C;  1A6X A;  3NBH A;  2IX0 A;  4R4O A;  4C3H G;  3A0J A;  1QNK A;  1L1O B;  5JJK A;  4YY3 Q;  4MN3 A;  2SDF A;  1QOH A;  1H9M A;  1Y14 B;  1FGB D;  1LTR D;  3S24 A;  1VQ8 A;  1HNW Q;  1EY5 A;  2JA7 H;  1TWF H;  4DR4 Q;  4DV5 L;  4K0K Q;  1VQO A;  4X65 L;  1ROD A;  1Y69 U;  3IFT A;  2G5D A;  4NW2 A;  2CH4 A;  2XTI A;  3T4A C;  3HOU G;  1AP0 A;  3PMF A;  2BA1 A;  2K4K A;  4APV A;  2AUK A;  1TWC B;  4XYQ A;  1YI2 A;  4LFB L;  1HR0 L;  3F2C A;  2IX3 A;  1HZC A;  1YIT A;  3HOY H;  3K59 A;  1Q46 A;  4L5Q A;  5HGT A;  3CD6 A;  2L0C A;  1PRT F;  5C4X G;  1QZH A;  1STG A;  2L55 A;  2B8G A;  3J81 i;  2OCE A;  4DR3 Q;  1KLG D;  2B2V C;  2I5L X;  1DXM A;  3NUC A;  4IPD A;  4DV2 Q;  2Q2U A;  1KIX A;  1TWG B;  3HOW G;  4V19 0;  3D4R A;  1PMR A;  2NVY H;  2MUY A;  2YU9 H;  3MTS A;  1QWY A;  4CBV A;  1VQ5 A;  4RMF A;  1VQC A;  5C0X H;  3MXU A;  3H91 A;  3HP3 A;  3RD4 A;  2EZV A;  2KEE A;  1IHZ A;  1JE4 A;  5IY0 A;  4QCL A;  2BCO A;  2MQH A;  4A3M G;  4X66 L;  3HOZ B;  4IFD J;  5HGQ A;  1SYG A;  2HDM A;  5IYC H;  3E5S A;  1XMO Q;  3FVQ A;  1LT3 D;  1F9P A;  2L15 A;  1KL9 A;  4DK3 C;  4JI3 Q;  2B2V A;  5D14 A;  2ENB A;  1LTI D;  4L5S A;  3S1R H;  1PRT B;  1KC8 C;  4DNI A;  2RDG A;  2JA8 G;  1LTG D;  1WTP A;  4K2L A;  5EGT A;  5IT9 c;  1G6Z A;  4N9P A;  4A75 A;  3D8G A;  3KBG A;  4NP5 A;  1FNV A;  2P5Z X;  4A3E H;  2VNU D;  3I4M H;  4Y52 H;  2EYF A;  2H4O A;  2B2Y C;  3N6R A;  5KND A;  3VYU A;  4O2D A;  5EPL A;  2FMC A;  1A62 A;  3BU2 A;  3EQL C;  3D4D A;  3VA7 A;  2E75 C;  3HOV B;  2CFM A;  4Q0F A;  1S3O A;  1X56 A;  4IZ8 A;  1WVL A;  5CBA E;  4IPC A;  1T5X D;  1I4Q A;  1M90 C;  4C3J G;  3O13 A;  1XX8 A;  3TS0 A;  5C44 G;  4DK1 A;  2VW9 A;  2JEA I;  2K05 A;  2R7Z G;  4NDX A;  5KYI A;  5I6Y A;  1Q81 C;  1PTO D;  4IUP A;  1ZXT A;  1DZ1 A;  1VQP A;  4JI2 Q;  3DHQ A;  5IGE A;  3EIV A;  2WAQ G;  1E22 A;  2CH4 W;  2F0L A;  5HY6 A;  4HTH A;  2F0N A;  2EY5 A;  4XQQ A;  4MNO A;  5IWA L;  3GTL B;  2CVR A;  3VR5 A;  3D6W A;  4RGM A;  3SE0 A;  5GRO A;  2K5H A;  1W6J A;  2N49 A;  2K28 A;  5I9P A;  1VQ6 A;  1HJP A;  1G91 A;  4HSV A;  4JI2 L;  4IUQ A;  2E2D C;  1WFQ A;  5IOD A;  5EQ0 A;  4KJN A;  5IGC A;  1GM5 A;  3I73 A;  1DJR D;  4J1M A;  4UP9 A;  4ZUJ A;  1C0A A;  1D2B A;  3H3V C;  4GN5 A;  3K5N A;  3W1G A;  1TKW B;  4N8F A;  1Q7Y C;  3NEL A;  1I4H A;  1ET9 A;  2F0V A;  2I5H A;  1OXX K;  4OXP A;  2EY1 A;  3JC6 6;  3MXN B;  2ALY B;  3B6Y A;  2E5L Q;  1X3Q A;  1Z6H A;  2YYZ A;  3EA6 A;  5LHY 1;  4OO1 G;  2Y0S G;  1QUQ B;  1U4P A;  2NN6 H;  4KMU C;  5K36 G;  1IKL A;  2XN9 C;  3J80 E;  1RCV D;  5C3E H;  5G3L D;  1BUV T;  3DXJ C;  3DMU A;  3NTK A;  1II3 A;  2K01 A;  4WFN 3;  2OTJ A;  1YZ6 A;  1K28 A;  3H0G G;  3BYY B;  1C48 A;  2JA7 B;  1TWF B;  2E5L L;  4DUY Q;  3N52 A;  4HCE A;  1TR5 A;  3EJI A;  3L9A X;  4QIW E;  2XRS D;  1MKH A;  3H15 A;  1CKN A;  3J7A V;  2BH8 A;  1NE3 A;  1MSG A;  3D6C A;  3GV3 A;  4PQX A;  4DR6 L;  3H3V H;  4ALP A;  3CPW A;  1PH1 A;  3HOY B;  3FP9 A;  3K0X A;  1LV9 A;  1WD1 A;  2F0J A;  2WKD A;  1CZG A;  4JI4 L;  3RNU A;  4H13 C;  5LMN W;  2RSO A;  3JAM E;  1FNW A;  2FFK B;  2F0Q A;  1GUN A;  3MVV A;  1X3E A;  3K7A H;  3GTP H;  1O80 A;  1BDO A;  4V0B A;  3HOU H;  4XDX A;  2NWG A;  1QVF A;  3D3R A;  2Q2I A;  1PZJ D;  4FP5 D;  3PSI A;  2NVY B;  4OHJ A;  2ZTC A;  4XQJ A;  2YU9 B;  4LFA L;  1A63 A;  1SJH D;  4QUC A;  2UUB L;  3NBI A;  4GLA C;  3I4N G;  4R8N A;  5DNF A;  2FJ2 A;  2ZTD A;  1W2B A;  2F0K A;  2B8F A;  1E2Z A;  2E8G A;  2CW0 D;  4G7H C;  2K50 A;  5C4X H;  1V1P A;  1QCB D;  4DAY A;  1E3P A;  3RLO A;  4IPG A;  1EY0 A;  3VR4 A;  2VQF L;  1ICF B;  1AEX A;  2AHO B;  2I07 B;  3HOW H;  3F1Z A;  4HSP A;  5EKL A;  3S1R B;  2EVB A;  2L4N A;  1VCI A;  2SNM A;  2D9U A;  4OGQ C;  1PA6 A;  3PV0 A;  3M3Y H;  5L37 A;  4OWW B;  4H7B A;  1JOO A;  1WCM G;  2KCN A;  4X6A H;  1S4Z A;  2EPB A;  1PTO C;  1KDC A;  2RKS A;  4A3E B;  2XWJ B;  1JMC A;  4PMC A;  4C3I B;  4A3M H;  4IOC A;  1BCP D;  1BBU A; 
#chains in the Genus database with same CATH homology
 3NP8 A;  1HQM C;  5FLX E;  4DAV A;  1TU2 B;  2BDO A;  4R9W A;  2G9H D;  4WJW A;  2X6G A;  2GA4 B;  3S1M B;  3A8I E;  2F0S A;  4ZYS A;  1Y8P B;  1TT2 A;  1KLU D;  5CV8 A;  3WOE A;  2WIN B;  2L11 A;  1R4P B;  2WB1 B;  1ESR A;  1SAP A;  3FDT A;  1BQQ T;  5LL6 S;  2A73 B;  4BWG B;  2QIL A;  1LLR D;  1PTO H;  5CGK A;  1SE2 A;  5I2X A;  4Z9C B;  2F0D A;  1F77 A;  2F0W A;  4K5V A;  4XXE A;  1V1O A;  5JEA J;  2J4X A;  3GO5 A;  1J9O A;  1SEB D;  3PO3 B;  3K58 A;  4H44 C;  4CKE A;  4KD4 A;  1HTL D;  3KUP A;  2F4I A;  4EVO A;  2RSN A;  5C3E B;  4R8I A;  3MZ5 A;  3NSW A;  1M4V A;  5C4Z A;  2VXW A;  3PUZ A;  3C1E A;  1SNM A;  3M4Y A;  2KJX A;  3FPP A;  3URY A;  2K32 A;  3H94 A;  3C1F A;  2Z4H A;  2KA7 A;  4OO1 H;  3EVQ A;  5K36 H;  1U4M A;  2E76 C;  5ELF A;  3I91 A;  4L8J A;  2PNR C;  1HCZ A;  4KHV A;  4KD3 A;  4ABN A;  4WOR A;  2NTS A;  4ZKB B;  2CW0 C;  1EEF D;  3C3L A;  5IGB A;  2C9O A;  3OMC A;  4IFD I;  4MIU A;  3D4W A;  3TZU A;  2EJM A;  3K7A B;  3RMH A;  4UAI A;  4FF2 A;  1TS2 A;  3HOU B;  5DEH A;  4TRD A;  4CGY B;  4KY7 A;  4HR7 B;  4DFA A;  1A2U A;  3U9S A;  4OIK A;  1KDB A;  1NAP A;  2DY7 A;  2HQE A;  1LT4 D;  3R93 A;  5A2Q L;  1BCP C;  1DM0 B;  2RBM A;  2Z1C A;  2FHT A;  1O78 A;  1WTO A;  5ELD A;  3HGB A;  4K2K A;  1ML0 D;  5T1I A;  2HDL A;  4G57 A;  3HOW B;  5JVG 3;  2IT1 A;  4C56 C;  1KTK A;  2EYO A;  4HMI A;  3M3Y B;  2K5W A;  4I7Z C;  2JSO A;  4A3M B;  1QE6 A;  2EJG C;  3GD7 A;  1RHP A;  1TII D;  1SYC A;  1K8O A;  1G2T A;  1EIH A;  1A3V A;  4O1N A;  2RVL A;  4K5X A;  2VB3 X;  1I4G A;  1PTO F;  1S5B D;  1KNE A;  4IUV A;  3CQZ B;  1NR4 A;  1B3A A;  4RGN A;  4X3S A;  3TN2 A;  4BA2 I;  1LAB A;  1A2T A;  3RLF A;  1H9S A;  2WKC A;  3Q23 A;  2IWH A;  5EPK A;  2PCF B;  4EGV A;  2IL8 A;  1HUM A;  5C44 B;  3D31 A;  1RD9 D;  2R7Z B;  1PTO B;  3DM1 A;  5AFW A;  1EY6 A;  1STB A;  1AW7 A;  1X3P A;  2WAQ B;  4G4K A;  1ILQ A;  4OIJ A;  4TSS A;  4BA1 I;  1ONL A;  2N88 A;  1CHP D;  4PMB A;  5C3X A;  4ID6 A;  4DU9 A;  4JK1 C;  1Y8O B;  4KN4 C;  5KEE A;  2BA0 A;  2Z8L A;  1JB3 A;  4FF3 A;  1D5M C;  3GQB A;  3FPU B;  3WOF A;  3TP5 A;  4N9T A;  3NQT A;  1LT5 D;  2JXM B;  4FXD A;  1U4R A;  2WV6 D;  2LKV A;  5C4J B;  1FNU A;  2Y0S B;  1DOM A;  4A3D B;  2NUC A;  4K6L A;  1DYQ A;  3NQI A;  1IYU A;  2OT2 A;  1EY9 A;  4IUN A;  1I4R A;  3H0G B;  4I65 A;  3KK7 A;  2AQ1 B;  1GOZ A;  4ZK9 B;  3PUW A;  4XYO A;  4EQP A;  1B2T A;  1H9J A;  2FIN B;  4EQN A;  5I4D A;  3MEH A;  1SNQ A;  3DEO A;  3NTI A;  2F0F A;  5EPJ A;  1NUC A;  3Q24 A;  4K6D A;  5JEA G;  5J39 A;  2EXZ A;  1D1I A;  2CHB D;  3SK8 A;  1BNZ A;  1SDF A;  4X3K A;  3SK4 A;  2TMP A;  3CHB D;  4KJO A;  1TWA B;  3MWY W;  4KTA A;  4KKU A;  1Q8I A;  1AN8 A;  3L7Z C;  1E2V A;  1BCP F;  3I4N B;  2M9V A;  2L5T A;  1HA6 A;  2E2H B;  3GTG B;  1A3U A;  2IPK D;  2OXP A;  1SYB A;  1V8Q A;  3HRZ C;  2F03 A;  1CZW A;  3TDQ A;  1OXT A;  1SNC A;  2XVS A;  4TKO B;  4Y7N B;  2KUM A;  1KAA A;  4FXK C;  1SYD A;  4LAA A;  2G9D A;  1RTO A;  2OEO A;  3P1H A;  5EKI A;  2JEB I;  1DOL A;  3NWS A;  2D2C C;  1BBX C;  4IN3 A;  2A69 D;  2F0I A;  2Q8T A;  5C5M A;  4ZAI A;  1XTC D;  5COY A;  5CBE E;  2EJF C;  3FEW X;  1F9S A;  5JOB A;  1CA6 A;  4B9X A;  4F7X A;  4U68 A;  3VA5 A;  4A3B B;  1JR0 D;  2K7V A;  2SEB D;  3U9O A;  2Q8I B;  2ID0 A;  3V05 A;  5ELE A;  3NTH A;  1SE3 A;  1I4X A;  1H9R A;  2MGS A;  1B53 A;  5ELC A;  3OIQ A;  1QIL A;  3MA2 B;  2LY7 A;  5C0X J;  1A3T A;  3QB3 A;  4RGT A;  3PO2 B;  1MBY A;  1NSN S;  1EIG A;  1HQR D;  5CV5 A;  3HKZ B;  2JA5 B;  3BS1 A;  5DAU A;  2BE5 D;  4NKL A;  1R4Q B;  5F2D A;  2QKI C;  1PZK D;  3NPP A;  3W3A A;  2NTT A;  1FR3 A;  1RKN A;  2PW5 A;  3T16 A;  1GUT A;  5M9O A;  5M5Y B;  5KGU A;  1F9Q A;  2C5C A;  2NVT B;  3FMC A;  3VYT A;  5T1G A;  1EYD A;  1B1Z A;  5BN5 A;  4TQU S;  1ESF A;  1WD0 A;  4HCS A;  4F88 A;  3GTK B;  3M7G A;  1HHV A;  5CYU A;  5DM6 3;  3VYS A;  1LTA D;  2L9H A;  3K5L A;  1D1K A;  5IGF A;  3BDO A;  2PQE A;  1S5E D;  5JVH 3;  5E4X A;  1LAC A;  4P2C B;  4RCO A;  2PYK A;  1JWU D;  1PFN A;  1JOR A;  4A3I B;  3E0J A;  3J81 E;  2ZXR A;  1JWS D;  3BDC A;  2A5H A;  2KCC A;  2E74 C;  1Y1V B;  1ENA A;  3CRL C;  4RHR A;  4BBR B;  4XT1 B;  3BVG A;  3BDL A;  3ND9 A;  4DA2 A;  2DNC A;  3SXH A;  4ZLT F;  5JEA H;  5CC4 A;  1Y1W B;  2D5D A;  5EBD A;  2A69 C;  4IAL A;  4LMQ D;  4BY1 B;  4K8J A;  3DUZ A;  4KKS A;  4CKB A;  3MXP A;  2NB0 A;  2XSC A;  2BOS A;  3PUY A;  3I4M B;  4YIJ A;  2EYH A;  1F2Y A;  1AZP A;  3F2U A;  2VB2 X;  1GUW A;  3R2T A;  2B2U A;  4E6I A;  3J7Y W;  4IQZ A;  5C6A A;  1PFM A;  2R92 B;  2NBF A;  1PDQ A;  3R3O A;  4LJZ C;  1CK1 A;  4CHT B;  3LWE A;  1EEI D;  4HED A;  2SOB A;  4RKL A;  2EYM A;  4HMJ A;  3P75 A;  2K5D A;  5EJW A;  2B63 B;  2KVM A;  4H0L C;  5J22 A;  2XRQ D;  3QO2 A;  3OWE B;  5A2Q E;  2BE5 C;  5A35 A;  1EYA A;  3ERQ A;  3QOJ A;  4IFD G;  2F0P A;  4DK0 A;  2RDF A;  2FMM A;  1LT6 D;  3OW7 A;  2F0T A;  1GUG A;  5FKA C;  4O42 A;  2AWN A;  1EWH A;  2MJ8 A;  4KY6 A;  5JPM C;  3JAM L;  1S5D D;  4QUF A;  3S17 B;  2PZW A;  5JJZ A;  5IGD A;  1EY7 A;  2R3Z A;  3QIA A;  4CKC A;  3H6M A;  4DNT B;  1ZYR C;  1R9T B;  1QB5 D;  2CQA A;  2QF7 A;  2N55 A;  2ZXP A;  1STY A;  5M3F B;  3M4O B;  4A3F B;  1AZQ A;  2O5J C;  1HTP A;  5CV6 A;  1DOK A;  4C3H B;  3LWU A;  1WTR A;  3BVZ A;  2NZ1 D;  1G8Z D;  1JQY D;  1UAP A;  3NE5 B;  5COR A;  3I8Z A;  1G29 1;  3HZX A;  3J7A F;  5I2Y A;  1Y8N B;  3TSS A;  4RGO S;  1SMY C;  4L63 B;  3GTP B;  4AYB B;  4KY5 A;  5E3F A;  5FO8 B;  2HCC A;  3QG1 A;  3SVM A;  1CFM A;  1TQO A;  4OL7 A;  3AU7 A;  1Q3L A;  1CA5 A;  3UI2 A;  4DXF A;  4DXG A;  5C4X B;  2J7Z A;  4RFB A;  1TS3 A;  1SBB B;  3MC0 B;  2LMC B;  4DNR B;  2RDH A;  3SK5 A;  1SYE A;  5M3M B;  1EU3 A;  1SND A;  1EFI D;  1D6E C;  1VMC A;  1IW7 D;  3DEP A;  1I50 B;  1EZ8 A;  2WII B;  4WRD A;  1K83 B;  3K5O A;  1V1P B;  3MXG A;  5EBC A;  4C3I G;  2JE6 I;  4Q5V A;  1LTB D;  1UNS A;  2F0U A;  5ISR A;  1SYF A;  2R93 B;  2DN8 A;  2JA8 B;  2JYO A;  2MPM A;  3QWN A;  1RF2 D;  1TY2 A;  1HXY D;  5D3D A;  5K5P A;  3GTQ B;  3SK6 A;  2KEC A;  3EFX D;  1QNU A;  3TP6 A;  2A6E D;  4C2M B;  1J8I A;  1EOT A;  1K8M A;  3GTM B;  5C0X I;  5FO7 B;  3G6J B;  4C3J B;  4IUR A;  5I6W A;  2E2J B;  1L0X B;  1JOK A;  3K57 A;  3BZD B;  3TP8 A;  3VR2 A;  1O7Z A;  1C8C A;  1MD2 D;  1TY0 A;  3ND8 A;  1EY8 A;  3GP7 A;  1JCK B;  1G2S A;  2EYL A;  3RZD B;  2RQX A;  1L0Y B;  1U4L A;  5G3L F;  4CJ0 B;  3MXN A;  2RA4 A;  1CQF A;  2OF1 A;  4IFD H;  2KQ3 A;  3TP7 A;  1DD2 A;  3AB9 A;  3A7L A;  5IT9 L;  2O4X A;  2J0T D;  4RKB A;  5KIX A;  4ZRZ A;  2A68 D;  1XYI A;  1F2L A;  2ZXO A;  3DWQ A;  1SFO B;  1QJO A;  3C46 A;  5BN3 A;  3A56 A;  4ULL A;  1GJX A;  3HOX B;  2F0H A;  3OPO A;  4RH6 A;  1CQV A;  1LTS D;  1MSH A;  1OXV A;  4RCN A;  3BVM A;  3GV6 A;  1ICW A;  1FD7 D;  1STN A;  3T13 A;  2HUG A;  1EQT A;  2PZU A;  4FO2 A;  2TSS A;  4KV6 A;  3ONA B;  1XXG A;  1O7L A;  1DON A;  1B4O A;  2F0M A;  1BOS A;  3R2I A;  1IW7 C;  4A93 B;  1Q12 A;  3DWP A;  4QB4 A;  5FO9 B;  3I70 A;  1BR9 A;  1ZEQ X;  1ET6 A;  1CM9 A;  1GXD C;  1JOQ A;  3MFG A;  2B39 A;  2NN6 I;  4NMZ A;  4HN7 A;  5FK9 C;  5CV4 A;  1S5F D;  2NVX B;  4IUU A;  2DY8 A;  1NCV A;  4ZUI A;  1F2Z A;  2K04 A;  2M2L A;  2QCP X;  1VF7 A;  3M7N A;  4GZY C;  2F3V A;  3E6Z X;  5C3W A;  2B2W C;  1E2W A;  3NHH A;  1VMP A;  2A6E C;  1GHJ A;  3PIP 3;  4MHE A;  1Q1E A;  3NXW A;  1Q90 A;  1SJE D;  1B9N A;  1HUN A;  3RZO B;  2BDN A;  2V4D A;  2IX1 A;  1WCM B;  3S2H B;  1SNO A;  2PW7 A;  4QIW B;  3CRK C;  3HG9 A;  3T56 B;  4DF7 A;  5ELB A;  4XQN A;  2B2W A;  5CV9 A;  2K5Q A;  3OOC A;  1BCP B;  2K1B A;  4F87 A;  4B9W A;  1PZI D;  1UEA B;  1IKM A;  1EQV A;  3CU7 A;  4RAU C;  5IGG A;  3L3O C;  2A6H D;  1WTQ A;  3SHL A;  4QMG A;  3OWF A;  3MHB A;  4HAE A;  4G7Z C;  1PYW D;  2QDB A;  3CKI B;  2MHV A;  1CT1 D;  2B2Y A;  3V96 A;  5IIF A;  2EOT A;  1H9S B;  1FYC A;  3HEJ A;  4RA8 A;  3A8K E;  1SE4 A;  1B44 D;  2A68 C;  5D3I B;  2JP1 A;  2A74 C;  4K14 A;  3IL8 A;  4FVM A;  3I90 A;  2K03 A;  5KYL A;  1O7Y A;  1LTT D;  3DWA A;  1UUP A;  1SNP A;  1TS5 A;  3VR3 A;  1I3Q B;  2WP8 J;  3W2D A;  1W6K A;  1B9M A;  4K5W A;  1RTN A;  1EY4 A;  4JBW A;  1YNJ D;  5KNB A;  1TVX A;  1C4Q A;  3WDN A;  3OIP A;  3X3M A;  1SXT A;  1GUS A;  1H9K A;  4U67 3;  3VR6 A;  4FF1 A;  4M1U B;  3S1Q B;  1F9R A;  1HA5 A;  2VUM B;  3I4L A;  1ZYR D;  2B2T C;  2X6L A;  4ILW A;  4CJ2 C;  1A15 A;  4XT3 B;  3A7A B;  3S2D B;  3OHX C;  5I9O A;  5CV7 A;  1CI3 M;  1EU4 A;  1QG7 A;  4M8A A;  5KNC A;  3S1N B;  5CR3 A;  1ILP A;  2B2T A;  3S15 B;  5J1Z A;  3RUZ A;  4BS9 A;  3SEB A;  2R61 A;  5JPN C;  4UDU C;  4ZKC B;  4KKT A;  3S16 B;  2B2U C;  1SMY D;  3KLS A;  4B08 A;  1RJT A;  1OXS C;  2EYJ A;  2L12 A;  3KLS X;  1PRT D;  1DCZ A;  3HS0 C;  1MI2 A;  4OO1 I;  4X3T A;  2EDG A;  3QJY A;  1NR2 A;  1HRJ A;  4L6T B;  4XTC S;  3KLR A;  3MAQ A;  2PZT A;  1I6V C;  5E1F A;  2PPB C;  2L1B A;  2HCI A;  5TSS A;  2A6H C;  3H09 A;  2Z4I A;  1ENC A;  2QEJ C;  1D5X C;  2DNE A;  5M5X B;  2LFN A;  2ICI A;  4IUT A;  5KRU A;  4J8Q A;  2AQ2 B;  3T53 B;  3S14 B;  1YNN D;  3J80 L;  3Q0A A;  4KHZ A;  1ENF A;  1MGS A;  2KOL A;  1U9R A;  3M85 A;  1LO5 D;  2KED A;  4KI0 A;  3NWT A;  3S9W A;  3FKI B;  2EE1 A;  4PV1 C;  2XWB B;  2F0O A;  1Z47 A;  4FXG C;  1YNJ C;  4KK7 A;  1S5C D;  2AUJ D;  4PNY A;  5CMD A;  3V2T A;  3PUX A;  1CHQ D;  3LX0 A;  3T51 B;  4ZQ3 A;  4A3K B;  3LNN A;  1JC7 A;  1GUO A;  5FOB B;  1V43 A;  2ICE C;  4FNF A;  1HFG A;  3K0Y A;  3J81 L;  3FRP B;  4F8M A;  1STA A;  1CTM A;  1PXU A;  3ERO A;  1OO9 B;  2SNS A;  3BYT B;  4C1N I;  3ZYY X;  3P7J A;  1T5E A;  3Q22 A;  2O2L D;  3GTJ B;  1VDZ A;  2M00 A;  5LL6 X;  3MFY A;  3K5M A;  4QF4 A;  4S3S A;  1KDA A;  1I6H B;  3TBI B;  2EY6 A;  1TS4 A;  2MP1 A;  3K6O A;  5HUR A;  3I3C A;  1XWE A;  5E4W C;  5IOC A;  1VF5 C;  2O5I C;  4ODG A;  1HPC A;  1PRT C;  1EYC A;  5FLX L;  4G7O C;  5C0X G;  3KBX A;  5C5L A;  2H1E A;  3PUV A;  4EQO A;  1STE A;  3Q6S A;  2Q8R E;  2F0E A;  3TME A;  3AMU A;  5C4H A;  3PIO 3;  1AFP A;  1ZKO A;  1X32 A;  2I46 A;  2XNA C;  2K6A A;  3IFD A;  3IKJ A;  2IJ0 A;  3P20 A;  5IT9 E;  4BBS B;  3OMG A;  1I4P A;  1BO0 A;  1SSO A;  3C2P A;  3R8B A;  1IL8 A;  1YNN C;  1KNA A;  2EYP A;  1EL0 A;  4FF4 A;  2F0G A;  4A3G B;  4RHS A;  2AWO A;  4A3J B;  1WTX A;  1EZ6 A;  4ME5 A;  4DGZ A;  1Z7T A;  3A55 A;  1HFN A;  3TZD A;  1IYV A;  3BG3 A;  1GHK A;  4BY7 B;  3NK9 A;  2LS0 1;  5EKK A;  4PMW A;  1TWH B;  2XIW A;  3VYR A;  3A8J E;  1BXT A;  2K33 A;  3G7L A;  4CJ1 B;  3X3N A;  2E2I B;  3SDZ A;  4XIG S;  1OXU A;  5M5W B;  4K8I A;  2PMZ B;  2AQ3 B;  4J6H A;  1BF4 A;  2ZT9 C;  1PFB A;  4X3U A;  3GTO B;  1RDP D;  4LK1 C;  3ITP A;  4C1N K;  2PO4 A;  2NYZ D;  1WTV A;  1STH A;  1F2M A;  1B50 A;  1D5Z C;  1JWM D;  2F3W A;  5JAV A;  2F1M A;  2WAC A;  1PLF A;  2R6G A;  1KAB A;  4FYD A;  1E0B A;  2NN6 G;  2EY2 A;  3IAY A;  5NUC A;  3A54 A;  2JA6 B;  5DM7 3;  1EWC A;  1Q1B A;  4KN7 C;  2IW3 A;  2NVQ B;  3KF8 A;  5D65 A;  2X69 A;  4DAP A;  3QOL A;  3OSO A;  4RWS C;  2KHS A;  3I72 A;  3SR1 A;  1M8A A;  2D62 A;  5BN4 A;  4DN4 M;  1WTW A;  1JIC A;  1A6X A;  3NBH A;  2IX0 A;  4C3H G;  1QNK A;  4MN3 A;  2SDF A;  1QOH A;  1H9M A;  1FGB D;  1LTR D;  1EY5 A;  1ROD A;  1Y69 U;  3IFT A;  4NW2 A;  3T4A C;  1AP0 A;  3PMF A;  2BA1 A;  2AUK A;  1TWC B;  4XYQ A;  2IX3 A;  3K59 A;  5HGT A;  2L0C A;  1PRT F;  1STG A;  2L55 A;  2B8G A;  1KLG D;  2B2V C;  1DXM A;  3NUC A;  1TWG B;  4V19 0;  3D4R A;  1PMR A;  2MUY A;  3MTS A;  1QWY A;  4CBV A;  5C0X H;  3MXU A;  3H91 A;  3HP3 A;  3RD4 A;  2EZV A;  2KEE A;  1IHZ A;  1JE4 A;  4QCL A;  2BCO A;  3HOZ B;  4IFD J;  1SYG A;  2HDM A;  3E5S A;  3FVQ A;  1LT3 D;  1F9P A;  2B2V A;  5D14 A;  2ENB A;  1LTI D;  1PRT B;  2RDG A;  1LTG D;  1WTP A;  4K2L A;  5EGT A;  1G6Z A;  4N9P A;  3D8G A;  3KBG A;  4NP5 A;  1FNV A;  2VNU D;  2EYF A;  2H4O A;  2B2Y C;  3N6R A;  5KND A;  3VYU A;  5EPL A;  2FMC A;  3EQL C;  3D4D A;  3VA7 A;  2E75 C;  3HOV B;  4Q0F A;  4IZ8 A;  1WVL A;  5CBA E;  1T5X D;  1I4Q A;  4C3J G;  3O13 A;  1XX8 A;  4DK1 A;  2JEA I;  2K05 A;  4NDX A;  5KYI A;  5I6Y A;  1PTO D;  4IUP A;  1ZXT A;  1DZ1 A;  3DHQ A;  5IGE A;  2F0L A;  4HTH A;  2F0N A;  2EY5 A;  4XQQ A;  3GTL B;  2CVR A;  3VR5 A;  3D6W A;  4RGM A;  3SE0 A;  1W6J A;  2K28 A;  5I9P A;  1G91 A;  4HSV A;  4IUQ A;  2E2D C;  5IOD A;  5EQ0 A;  4KJN A;  5IGC A;  3I73 A;  1DJR D;  4J1M A;  4ZUJ A;  1D2B A;  3H3V C;  3K5N A;  1TKW B;  1I4H A;  1ET9 A;  2F0V A;  1OXX K;  2EY1 A;  1X3Q A;  1Z6H A;  2YYZ A;  3EA6 A;  5LHY 1;  4OO1 G;  1U4P A;  2NN6 H;  4KMU C;  5K36 G;  1IKL A;  2XN9 C;  3J80 E;  1RCV D;  5G3L D;  1BUV T;  3DXJ C;  3DMU A;  3NTK A;  1II3 A;  2K01 A;  4WFN 3;  3BYY B;  1C48 A;  2JA7 B;  1TWF B;  3N52 A;  4HCE A;  1TR5 A;  3EJI A;  3L9A X;  2XRS D;  3J7A V;  1MSG A;  3D6C A;  3GV3 A;  4PQX A;  3HOY B;  1LV9 A;  1WD1 A;  2F0J A;  2WKD A;  1CZG A;  4H13 C;  2RSO A;  3JAM E;  1FNW A;  2FFK B;  2F0Q A;  1GUN A;  3MVV A;  1O80 A;  1BDO A;  4V0B A;  4XDX A;  2NWG A;  3D3R A;  1PZJ D;  4FP5 D;  4XQJ A;  2NVY B;  4OHJ A;  2YU9 B;  1SJH D;  4QUC A;  3NBI A;  4R8N A;  5DNF A;  2FJ2 A;  2F0K A;  2B8F A;  1E2Z A;  2CW0 D;  4G7H C;  1V1P A;  1QCB D;  4DAY A;  1EY0 A;  3VR4 A;  1AEX A;  2I07 B;  4HSP A;  5EKL A;  3S1R B;  2EVB A;  2L4N A;  1VCI A;  2SNM A;  2D9U A;  4OGQ C;  3PV0 A;  4H7B A;  1JOO A;  2KCN A;  1S4Z A;  2EPB A;  1PTO C;  1KDC A;  2RKS A;  4A3E B;  2XWJ B;  4PMC A;  4C3I B;  1BCP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...