4F7XA

Crystal structure of staphylococcal nuclease variant delta+phs i92a/l25a at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKAMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4f7xA00
3EROA 3NHHA 2EY6A 1SYDA 4K5VA 5IIFA 4N9PA 2EYLA 2EY1A 3NP8A 1NUCA 4WORA 4ODGA 5EKKA 2PQEA 3EVQA 3TP6A 5KYIA 2SNMA 2PZWA 2F0VA 5KGUA 1EZ8A 4NP5A 3U9OA 5K5PA 1STGA 2OEOA 4K2LA 1SYGA 4WRDA 1A3UA 1EY5A 2F0GA 5NUCA 5C4ZA 1SNOA 5C3WA 4RKBA 2PYKA 4K6DA 2EY5A 1KABA 4EVOA 3QOLA 2F0EA 1EQVA 1F2MA 4KJNA 5KYLA 3T16A 1JOKA 1STAA 3MZ5A 1SNDA 3BDLA 1A3VA 3QB3A 4KTAA 3SHLA 4F8MA 1KAAA 2KHSA 2QDBA 5KRUA 3R3OA 4K5WA 1KDAA 4KD3A 4PMBA 5I9OA 2F0SA 1SYCA 3T13A 1EYAA 4EQNA 4I65A 3PMFA 2EYMA 4KV6A 4PNYA 5J1ZA 1KDBA 4DGZA 4NMZA 2PW5A 4KJOA 1RKNA 4KY7A 4HMIA 3QOJA 2F0UA 5C5MA 5CC4A 4N9TA 3MEHA 2F0WA 5EKLA 3D4DA 5IGDA 1EYDA 2HQEA 2RBMA 3SK8A 3E5SA 4RKLA 2F0OA 4TRDA 1STBA 1KDCA 1ENCA 1TT2A 2EYOA 5IODA 2M00A 2PZTA 2OF1A 4KY6A 2EYHA 5J22A 2KQ3A 5DEHA 3SK5A 5IOCA 4K8IA 1A2UA 2F0PA 3C1FA 4ME5A 2F3WA 5CR3A 5CV4A 1NSNS 4J6HA 4YIJA 1SYFA 1EY9A 4OL7A 1A3TA 1SNPA 5CV9A 5I6YA 5IGCA 2OXPA 2ENBA 5KEEA 2F0MA 3OWFA 5CGKA 2F0KA 2F0LA 5J39A 4ZUJA 4R8NA 4K8JA 1SYBA 4ID6A 4ZUIA 5C5LA 3SK4A 4IUNA 3TP8A 4QF4A 5EGTA 3SK6A 5HURA 1TR5A 4HTHA 4B9WA 2EYJA 1II3A 3OMCA 4DU9A 5IGEA 1JORA 3S9WA 1F2YA 1STNA 1TQOA 3C1EA 3NUCA 5CV7A 3OSOA 1JOOA 1F2ZA 3HZXA 3OMGA 4F7XA 5C4HA 3H6MA 1A2TA 5JOBA 3ITPA 1EY8A 2F0DA 5HGTA 2NUCA 5CV6A 3D8GA 4H7BA 4J1MA 3DHQA 2F0HA 3DMUA 5M9OA 4EQOA 1STYA 2EYFA 4NKLA 5C3XA 1EY7A 2SOBA 4NDXA 5CV8A 1SNQA 2WACA 3MHBA 4ZQ3A 5E1FA 3RUZA 3VA5A 2F0QA 4KD4A 5F2DA 2RDFA 3D4WA 3LX0A 3NQTA 2EY2A 4MIUA 3ERQA 3P75A 3EJIA 5DAUA 4IALA 3SXHA 1U9RA 2RKSA 3TMEA 3TP7A 2F0JA 3TP5A 4E6IA 5IGBA 2F0NA 3BDCA 4PMCA 4IZ8A 5KIXA 4DFAA 1JOQA 2LKVA 1STHA 4DF7A 4HMJA 2EXZA 5IGFA 4QMGA 1EZ6A 1SNCA 2F0FA 3D6CA 3MVVA 5CV5A 5IGGA 1SYEA 1ENAA 3NXWA 4QB4A 4B9XA 5I6WA 1AEXA 1EYCA 2F3VA 3P1HA 2PW7A 1EY6A 3HEJA 3NK9A 4KY5A 4EQPA 2O4XA 5ISRA 1SNMA 3SR1A 4K14A 4KHVA 4K2KA 2PZUA 4G57A 4LAAA 3V2TA 1EY0A 2F0TA 1IHZA 2EYPA 5C6AA 5I9PA 4S3SA 2F0IA 2SNSA 1EY4A 5JAVA 3MXPA 5E3FA 4K5XA
chains in the Genus database with same CATH superfamily
3E9HA 1HUNA 4RGTA 5AFWA 4ODGA 3J80i 2B39A 5JVH3 3KLWA 1F9RA 4NXNL 1LM0A 1T5EA 1R9TB 1ILQA 1VQGA 3OOCA 1XXGA 3VDYA 1B70B 2LS01 2JA5G 5CBAE 1F2MA 1VQ6A 2QGQA 1UNSA 4A3GB 2Y0SB 2JXMB 1EQTA 4DR5L 1JB7A 1TVXA 3R8BA 3K5NA 4A75A 3D0FA 5FJ8G 1SYCA 2RHQB 4J8QA 1PTOF 1E24A 3EN2A 4HAEA 2BCOA 2PW5A 4R4QA 2Z4HA 5FKAC 1LT6D 4CKEA 2F0UA 4ABNA 5CC4A 4JCVE 3H0GB 3F8TA 4CDDC 4A3IH 2ZM6L 1EIYB 2PO4A 1EFID 1TWCH 2EYHA 1EQQA 4GZYC 2B63B 4C3HG 2XN9C 5CV4A 3CCEA 2MPMA 1X65A 5KEEA 4GLVB 5DLQE 1Q90A 2E74C 5C0XG 2VUMB 3CQZB 3HS0C 4YY3Q 3GTKB 3OWFA 3CP0A 1PTOB 1CFMA 2K5VA 2PNHA 3ZJYC 2N88A 2CCZA 1DOKA 3PO2B 2B2VA 2K6AA 3CPWA 1STNA 5I6YA 3T56B 1N9WA 3CC2A 1TWAB 4F7XA 5H1SE 2JA6B 2Z6KA 3S14H 1TWHH 1AE3A 1LV9A 4H7BA 1CK1A 2JK8A 4J1MA 4OGQC 4HIOA 2WKCA 2GVBA 2A68C 2BE5C 1RTNA 4OONA 3VA5A 1QNKA 3RN5A 2F0QA 2QEXA 2E2JH 5K36G 2RDFA 2RVLA 4N8FA 5IP9G 2RA4A 4AQYL 2R93G 1CZGA 2WAQB 3TP7A 4E6IA 3GTGH 4ME3A 1B1ZA 1CZWA 1DGSA 4CHTB 4QIWB 4DV6Q 1IBLL 2A74C 4LF7Q 4OELB 2E5LQ 1CTMA 1HH2P 5C4XB 3KBGA 2QF7A 4O2DA 1Q12A 1HTLD 1S4ZA 1AH9A 2K14A 1YNND 2L9HA 4S3SA 4DAYA 1WTPA 2CQAA 1EL0A 3M85A 1SYDA 3HKZE 2JN4A 3B6YA 4WORA 3EVQA 1PH3A 3KYHC 5L37A 4NP5A 4LF5Q 3S17H 4XYQA 1D8LA 1NNXA 4P73A 4BA1I 1XPOA 4HIDA 1L0YB 1TWGH 2EE1A 1HR0L 4IUTA 4DAPA 4LUZA 4OWWB 4EVOA 1V1QA 2JA7G 2VB3X 4KJNA 3D4RA 4AYBG 5GADC 3EBEA 1HZCA 1IKLA 4DV0L 4UPAA 5CBEE 5J3BA 2R7FA 3T13A 2ZTCA 1I3QH 1QJOA 1VQ9A 4A3IB 4Y52H 1TWCB 2G9HD 3OWEB 1PRTC 5DNFA 1BO0A 4DNTB 1SSOA 3A55A 2F0OA 1I50H 1XPRA 5J22A 1F77A 1W2BA 1S5FD 1PH8A 5CORA 1EOTA 1D5ZC 2E76C 4JG2A 2C35B 2NTTA 4RH6A 4YCWA 1VQOA 4FNFA 1A3TA 1NR4A 3CMAA 1AN8A 3I91A 1ICWA 2VB2X 2F0LA 4UAIA 4DUZQ 2A1AA 3V05A 5C5LA 3H94A 2J4XA 4L8JA 2A69C 1O7IA 3A54A 1TWHB 3W5OA 4DV3Q 3S14B 1PMRA 1BCPF 1DD2A 4JBJA 4BY7H 4JI5L 2NN6G 5TSSA 2E2JB 1OXSC 4YHHL 2ZJRA 2JEAI 3M7NA 1VQ4A 4JI7Q 1UE5A 1GD7A 4ZQ3A 2X6GA 3GTGB 2E8GA 1ESFA 1U5KA 2Z0SA 3A5ZB 5IYDG 1E7ZA 2YYZA 4ILWA 4L5RC 1MJEA 1TY0A 3EA6A 4GLXA 5IY0A 4PZ7A 2F0JA 2KECA 4DPGA 2XSCA 2M2LA 5KIXA 4IZ8A 3PIOA 1BCPB 2F1MA 4DFAA 3GTJH 1VQ8A 1D1IA 3S2HH 3HOUH 1EZ6A 5COYA 1FYCA 4BY1B 3QR8A 1XNRL 1Z7TA 3I73A 1CT1D 3NEMA 3STBD 4LF8Q 3D6WA 4P72A 3S17B 1KRSA 3HOZH 4RHSA 3WOEA 1S40A 3C2PA 1XWEA 3TP6A 3I4MH 2OTJA 1DCZA 3GV6A 3TS0A 4K0KL 1EY5A 4DR3Q 3BZDB 5C44H 2PNRC 5JEAJ 5T1IA 1VQEA 4DUYQ 2F0EA 3PUYA 2UUAL 4KHPL 5LMUQ 1CM9A 1JOKA 1SRUA 3CPFA 4M8AA 4CJ2C 1I3QB 3RLOA 2DN8A 4PZ8A 1Q86C 1ZEQX 1HQRD 4OWXB 1C48A 1DM0B 3CCMA 4PNYA 5J1ZA 2R6GA 1WTXA 4KJOA 4JI6L 1I50B 1I4QA 4KY7A 1G2TA 1KLUD 3D4DA 2K32A 3U50C 5FLMG 1C0AA 2WKDA 4R4TA 5D14A 3IKJA 3CD6A 2B2TC 3C1FA 2F0PA 4ME5A 3FKIG 5A2QE 4YIJA 4U673 1BBWA 5EPJA 4XXEA 1OTCA 1PH6A 1SDFA 4R9WA 1CSPA 4R8NA 1D6EC 3H3VC 1U4PA 2OTLA 4HTHA 4B9WA 3DXJC 1HR0W 4DU9A 4GOPB 4JPBW 1PV4A 3TP8A 3NUCA 3K5MA 4LF4L 1HNXL 5IYBG 1YEZA 3OTOQ 3OW7A 1XYIA 3DHQA 2F0HA 1PH1A 5GAHC 1WTOA 3Q24A 2CW0C 5IYCG 2QCPX 1LTSD 2BDNA 5ELNA 1D7QA 2D62A 2IX0A 4IPCA 3GTJB 2MNAA 2JA9A 3S2HB 1XMQL 3HOUB 5BN4A 1B8AA 1KNAA 2CH4W 4BS9A 5ELFA 4FF1A 1H9SA 2EDGA 1W6JA 1K8OA 3M9BA 3HOWG 3VR2A 1WFQA 4GN5A 5T1GA 1G8ZD 1A62A 2G5DA 1GJXA 4KY5A 1G51A 5IP7G 2UXDQ 2DUDA 2PZUA 1HQMC 1IHZA 1Q8IA 5I9PA 3I4MB 1RCVD 2F0IA 4KKTA 3JC66 3KLSX 4DR4L 1YITA 1E3PA 2KHIA 1JJCB 2NZHA 5EKKA 5KYIA 3KF8B 4C3JH 3IRBA 1EZ8A 5GROA 1SNOA 2PYKA 4K6DA 4LFCL 1VQNA 4DV7Q 2EQSA 3OYYA 2B2TA 1E0BA 4HSVA 1EU4A 4A3MH 4KTAA 4DR2L 1JQYD 4F8MA 3T53B 1CQVA 2KCTA 3H0GG 2A8VA 4XDXA 2I07B 5I9OA 3D3RA 3IL8A 1GHJA 4OXPA 1I4PA 4DV4Q 1VQKA 2B63G 3S15B 3P20A 3AMUA 4X3KA 2VW9A 3KUPA 4X3SA 2HCCA 2JYOA 2DNCA 2VUMG 3M4OH 4A3JH 3RR5A 1B53A 5DEHA 1X3GA 5IOCA 2ZTEA 1WVLA 3L9AX 2RCNA 1IYJB 1IW7C 4UP8A 3VR3A 1MIUA 2A5HA 4LF9Q 1YNJD 5CGKA 5M5XH 2GN5A 2F0KA 2NZOA 4NPSA 1I6HH 2HCIA 2NVXH 2VQEQ 4H13C 4QF4A 4JK1C 1JORA 5D3IB 3S9WA 4A76A 3HZXA 1L1OA 1F2ZA 2DY7A 2NN6I 1Y1VH 3MEFA 4P71A 3JAMi 1A2TA 1XTDA 1EFWA 1CHPD 1B9NA 3LGJA 3VYSA 1SLJA 1VQ5A 4GKJL 3VYUA 3KDFB 1VCIA 3AU7A 5FK9C 2I46A 3EJIA 2EJMA 4QUFA 2RDHA 5EAYA 1I4RA 2UUBL 3BDCA 1JOQA 3T51B 1IBKL 1YJ9A 4A3EG 1JC7A 3D6CA 2UXBQ 1HJPA 2R61A 2UU9L 2HQLA 1EY6A 1H9MA 1YHQA 2WV6D 5ISRA 2PI2E 3Q6SA 2Z9HA 2BA0A 1EY4A 4L5SA 4BXXH 2ZM6Q 5LMNL 3GTQH 1S5ED 2K1BA 2PZWA 1QNUA 2A19A 1WJJA 1SYGA 1A3UA 3NE5B 4JW0A 3GQBA 1A15A 5C0XJ 2NTSA 3VYRA 5BR8L 2F52A 4C3IH 1KABA 1EU3A 1A6XA 1B44D 4B3TQ 4A3IG 4QUCA 4FVMA 4Q0FA 2ICEC 4GKKL 4PMBA 2E75C 1GUSA 3KJOA 3NBHB 3M4OB 4A3JB 1BDOA 5FO9B 2LXJA 4A3LH 1TWFH 4JYAL 2EJFC 5IGDA 3E3XA 3HOVG 3W3AA 4TRDA 4R4IA 2EYOA 1XTCD 2HHHQ 1E2ZA 3FEWX 5M5XB 4K8IA 1SE3A 3E6ZX 2NVXB 1IBML 4QQBX 4XIGS 1PZID 2ENBA 4ZK9B 4X65L 4CDFC 1IBLQ 1DZ1A 4A3GH 4GLAC 1X9NA 3SK4A 5FO8B 5HURA 3G4SA 1X3FA 1I5FA 3U9SA 4YWLA 4GOPC 2EYJA 4L63B 1EWIA 4A3KG 4HJ7A 4A3DB 2EOTA 2N78A 5A2QL 4HJ8A 3TEHB 3FHWA 3DMUA 3EIVA 1SN8A 2L11A 4NKLA 3K0YA 2I5LX 4DXGA 2NB0A 3FPUB 3LX0A 1NTGA 4EQ5A 1HR0Q 3KK7A 4ZCKA 2C9OA 2RQXA 4PMCA 3CQZH 4V0BA 3CMEA 3GTKH 1VQIA 1U4MA 1VS0A 1PTOH 3MWYW 2KUMA 4DV0Q 3HP3A 4QB4A 4LMQD 1TIID 1WCMB 1E1OA 2M9VA 2PW7A 2Q8RE 3PO2H 4EQPA 2ATWA 3UE1A 1S3OA 2HDMA 1JWUD 4H0LC 3GTQB 1VF5C 3HKZB 3W2DA 1G2SA 2SNSA 5KNBA 2Z1CA 4JC0A 4DKAC 2IHFA 1SBBB 1BUVT 1X6OA 4C3IB 3MXGA 4DNIA 3ER0A 4AYBE 3J7AV 3R2IA 4QCLA 4IJHA 4IUQA 1Q82C 3I4NH 3URYA 3K81C 1AFPA 1Q3LA 1HRJA 1QWYA 3F2BA 1STAA 4RCNA 2K01A 1TY2A 1OO9B 1N32L 5C4XH 1TWFB 3CRKC 3DEPA 4X66L 4JI5Q 3QG1A 2WB1B 2RDGA 3A74A 3IFDA 2K5NA 3KF6B 1Y8NB 4YHHQ 4JI8L 4A3CH 4OO1I 3I55A 4RKLA 3I56A 1VDZA 2LXKA 3TQYA 4BY7G 2IX1A 1DYQA 2XTIA 3H3VI 4DR7L 3UDFA 4DA2A 1QG7A 1JMCA 1C8CA 5CV9A 1LABA 1G91A 5M5WB 1J9OA 5LMNW 1EWHA 1I94L 2VL6A 4R8IA 4IPHA 1XNRQ 5EGTA 3PUVA 3K57A 3F2DA 5JPNC 5C3EG 3DLLA 5IT9c 5JOBA 1MKHA 4IFDH 4GN4B 1G6ZA 1S5BD 1UE7A 3NTHA 2KVMA 1EY8A 1PH7A 2KCCA 2KJXA 2FXQA 1KTKA 2EYFA 1VQDA 3A8IE 2WIIB 1VQFA 3DUZA 3ERSX 3TRZA 4K0KQ 4A3BH 3PF5A 3NBIA 3HOZG 2UUAQ 4KHPQ 4BA2I 2LKVA 3W1GA 1JWSD 2N8NA 4AH6A 3NTIA 2A68D 3MVVA 2BE5D 5CV5A 2PQAA 4CKBA 4KK7A 1U4LA 5C44G 5M3FH 4K14A 1JICA 4JI6Q 1XMOL 4MHEA 1SXTA 5E3FA 2EY6A 1V1PA 4IPGA 2B2WC 3I4NB 4CJ0B 1L0XB 4LW1A 4QGUA 2ZXPA 2R7ZH 1VQCA 1KC8C 2KBNA 3FP9A 1Q1BA 5C4JH 4K6LA 4B3RL 4ZAIA 4B3SL 3J7YW 1NCVA 3BG3A 3OIQA 1K3RA 3BDLA 1GUWA 3I4OA 2XRSD 4DK6C 5M5YH 2VZAA 4BY1H 5HY6A 4RWSC 3MC0B 1QZGA 2RSOA 4LF4Q 2E2HH 4TQUS 2JA8B 3AEVA 3PCOB 4A3FG 1WD1A 3GDEA 1GVPA 5EKLA 2RBMA 3LWUA 1QUQA 3S2DH 5KNCA 4DV5Q 5IODA 4RCOA 3WDNA 2AHOB 2BOSA 4FDBA 2MQHA 4JOIC 4KKUA 1SNPA 4LUOA 1PRTD 3NQIA 3I4LA 1U0LA 3SEBA 1CA5A 4ZUIA 3ND8A 4FF3A 1A0IA 3OMCA 2AWOA 3Q0AA 4L6TB 1X3QA 1DJRD 4KI0A 3GTOH 1M4VA 1W3SA 1BOSA 5M3MH 1LTRD 4DR4Q 4X6AH 2CFMA 3Q22A 3FRPB 3CU7A 1JE4A 4A3BB 2QKIC 1PH4A 1CKNB 4IJLA 2A69D 3RLNA 5FLXc 2F4VL 3HOYH 5LL6S 4LF6L 3T1HQ 3AQQA 3MFGA 1XNQL 2VQFL 4LFCQ 2N49A 1HZAA 3SXHA 3E9IA 5GQOA 1SMYC 4A93H 1J5EL 3CXCA 3U58A 1Y1WH 1YJWA 5M3FB 4DF7A 4C3JG 4CDCC 1N34L 2B8FA 2KCNA 1YHBA 2PCFB 2NYZD 1DOLA 1J6QA 1OXUA 3HEJA 3RZDH 2O4XA 1CQFA 2IL8A 2Y0SE 1O80A 3A56A 1VF7A 4A3MG 1V9PA 4JI3L 2R7ZB 1WTRA 1LT3D 1LUZA 5C4JB 3U9OA 4HJ9A 3I72A 5C4ZA 4RMFA 3PQIA 1NMGA 1M90C 1Y8PB 5C3WA 1DXMA 4PQXA 3TZDA 2L12A 4PV1C 3TS2A 5M5YB 2XNAC 2A6EC 4A3JG 3T1YL 2E2HB 1VQLA 3MXNA 1A3VA 2K05A 2QDLA 1KDAA 1UAPA 3L0OA 3PIP3 1KQSA 1GKHA 1HTPA 3DM3A 3S2DB 3FVQA 5G3LD 3K59A 1CSQA 1GXDC 2A6HD 4BWGB 3K5OA 1QILA 4R4CA 3M4PA 5GAEC 2H5XA 1Y1VG 1Z47A 2KQ3A 2E2IH 2ZJQA 4DR1L 1O7YA 2F3WA 2O5JC 1SYFA 2UUBQ 3RN2A 2DNEA 1HNZL 3K7UC 1FNVA 1IBKQ 2ZXRA 5BN5A 3GTOB 4ID6A 1QCBD 1BR9A 1WTWA 3SK6A 2R92B 2EJGC 4GNXB 4JV5Q 5M3MB 1LLRD 2MP1A 4LFAL 1F2YA 3C1EA 1YVCA 1PZJD 4XYOA 1HA5A 1PFMA 2IX3A 1V1OA 4RA8A 1RL2A 2IT1A 3GTLH 1GOZA 2NUCA 3HOYB 3S15H 5LMNQ 3TZUA 4OHJA 1STYA 2DGYA 3SGIA 1VQJA 4LNQA 5C0XI 4A93B 2KOLA 3S1RH 2MO0A 3P75A 1Y1WB 1K0SA 1PTOC 1SJHD 2HIVA 4BXXG 1EIHA 1STHA 3RZDB 1IXRA 1PFSA 2F0FA 2CW0D 4JI0L 4GKKQ 2X6LA 3TDQA 3GO5A 1JJ2A 4P74A 4C3IG 2KCMA 4DV6L 3PO3H 3KBXA 4K2KA 4YCUA 1X56A 4RGNA 3DEOA 4OIJA 2EYLA 1PHJA 1GHKA 3KFUA 1C9OA 1TS2A 2F0GA 4WJ4A 1IBMQ 2I5HA 5LHY1 1FGUA 1H9KA 3D31A 4P75A 2WB1G 4LF5L 2K33A 1RF2D 2I5MX 4DV2L 2OCEA 2TMPA 3FPPA 4IPDA 2Z4IA 4B08A 1PH5A 5EQ0A 4RGMA 4JI4Q 1BBUA 3A7AB 3I70A 3CCSA 3PMFA 3TN2A 3J81i 4A3GG 4GS3A 2Y0SG 2NVQB 2E2IB 5EBCA 2HIXA 3SK8A 1G291 4DV1Q 4KHZA 4TKOB 2M00A 2PZTA 3UI2A 2D5DA 2K04A 4LUVA 5ELOA 2K03A 5DM63 3LWEA 2YV5A 1VMCA 2NZ1D 1KRTA 1F9QA 1GM5A 1Q8KA 1P8LA 2L15A 1EYGA 2WP8J 3HOXH 1FD7D 1E1TA 3GTLB 2AUKA 1PYBA 1YHAA 2D0OA 1FVIA 3NPPA 2LMCB 4PG3A 2B2UC 1F9SA 1N36Q 2AKWB 1IW7D 2F0DA 4C56C 5ELCA 1PYSB 3S1RB 5IYDH 5I2XA 4IUPA 4WJ3M 1Q81C 3MHBA 1JR0D 3PO2G 4GN3B 3J80c 4YCVA 3LNNA 4XQNA 1D2BA 2JA6G 2K4KA 4KN4C 2RKSA 3TMEA 4O1NA 5IGBA 2BDOA 4R1JA 4JBWA 4C2MB 4DR6Q 4QMGA 3PO3B 3WOFA 1N32Q 1ENAA 3ULPA 3I4NG 3K0XA 3ND9A 2XRQD 2WAQG 2ES2A 1I4XA 2CQOA 1PFNA 3M4YA 2Q2UA 5JPMC 4A3DH 4JI8Q 4DAYB 4NXNQ 2AUJD 2K7VA 3NSWA 5JAVA 4HIMA 4C1NI 3EROA 5CMDA 2MGSA 1ET6A 2QILA 2EY1A 3OIPA 4AYBB 5C4XG 1MGSA 3BYYB 1QE6A 2K75A 4QL5A 3KLSA 1BCPC 2NVYH 4O0AA 5CYUA 5EKIA 4DR5Q 1XX8A 4RKBA 4Y7NH 4A3CG 2EVBA 3PV0A 3PGZA 1EQVA 1TKWB 1MSGA 4X64L 2LSSA 3O13A 2ZT9C 1N8RC 2Q2IA 1WCMH 5AJ3L 2QW7A 2D0PA 3J7A5 2F3IA 1S72A 5LMUL 2HT1A 1RD9D 1H95A 1UEBA 2MFIA 3CKIB 1YIJA 1EEFD 3F1ZA 5I2YA 3X3MA 4ALPA 1OXTA 2K5DA 4IFDG 3CF5A 3J81j 1S5CD 3BVGA 4P2CB 4V190 3MTSA 3HOXB 2OXPA 1W6KA 3A7LA 4UY8C 1JJGA 1OXVA 3CRLC 5J39A 4L5QA 4LWCA 4FYDA 3S16H 2Z8LA 3IFTA 4A3BG 4RGOS 1II3A 2NWGA 3X3NA 3H6MA 3A8KE 3ITPA 4X62L 5HGTA 1HPCA 1ENFA 1SAPA 3WWVA 4HSPA 4UDUC 2UXCL 4AQYQ 2SOBA 2B2YC 1SFOH 4XT3B 3NWSA 4X3TA 1BF4A 5JJKA 3ERQA 2K5QA 4RFBA 1EEID 4G4KA 4IALA 2KENA 2PMZE 3K6OA 5M5WH 4HMJA 2A73B 2DJGC 5JJLA 3PIPA 4B9XA 2R7ZG 1C7YA 5IWAL 1R4QB 4G7OC 1FJGL 3NK9A 1DONA 1I4HA 1VQHA 2CWAA 1EWCA 1QB5D 1EY0A 1ZYRC 3EQLC 4OX9L 3SDZA 1LTAD 3NHHA 2NVYB 3J80E 5IIFA 1HA6A 4BBRH 4BY1G 4Y7NB 3I90A 2F0VA 3G6EA 5EPKA 1F9PA 4OEMB 3K80C 1B50A 1VQ7A 3RNUA 2IHEA 4DAVA 3C3LA 1UUPA 3U4VA 3UDIA 2R7DA 2RSNA 2OQKA 4CDEC 5KYLA 1ZXTA 2ZJPA 1KLGD 2WINB 3SHLA 1K3BC 4HEDA 4DK1A 4KD3A 4DV7L 2F0SA 5FOBB 3VR5A 4EQNA 1EIGA 4I65A 2C5CA 1YNXA 3A5UA 4OO1H 3FKIB 2LFNA 1J8IA 1H9JA 1S5DD 4N9TA 3MEHA 2CKZB 1BBXC 2F4VQ 2IW3A 2O2LD 1LO5D 4LF6Q 3TREA 4FO2A 1XNQQ 2VQFQ 4OIKA 3MFYA 1D1KA 1STEA 5M3MG 1VQPA 3S16B 3BYTB 3SVMA 1K8GA 1J5EQ 3M3YH 1IYUA 5E4WC 1LYLA 3K7AB 2KHJA 5HGQA 3AFPA 3HOYG 2H1EA 2CHBD 4ZYSA 1R4PB 2B2VC 3CAMA 1FNUA 4FXKC 3MAQA 4IUVA 4GOPA 2KEEA 1LT5D 1LT4D 2L1BA 1JOOA 3OMGA 4MN3A 3W1BA 1NJIC 2Z6KC 2JA8H 2VQEL 1SFOB 4JI3Q 4TVAB 2MHVA 4EX5A 1BXTA 4ZKBB 1JWMD 5JEAH 5LL6X 2XWBB 5E1FA 1PLFA 2XVSA 3CCVA 1X55A 1HNWL 5F2DA 5EJWA 3NQTA 4HJ5A 1KHIA 1PZKD 1Q1EA 2P5ZX 3ULLA 3AYHB 3PUXA 1K8AC 4A3EH 3TP5A 1H9SB 4CKCA 2L5TA 4XT1B 1PFBA 3T1YQ 2EXZA 1GUTA 1I4GA 1Y8OB 3E0EA 3RLFA 3L2PA 1SYEA 4TSSA 3HOUG 4G7HC 4BBRB 2UXBL 3AB9A 3CCJA 3MXPA 1K83H 1QVGA 4HR7B 3GTPB 3KF8A 4RHRA 1SJED 1LTLA 4XQQA 5K5PA 1IL8A 1STGA 5A35A 4DR1Q 2CH4A 1NAPA 1QVCA 3I4MG 1HNZQ 2XWJB 3C46A 3QOLA 3NELA 5EPLA 2BH8A 1D5MC 1SNDA 3HFZB 4KMUC 3RMHA 3CHBD 3ULJA 1PDQA 2KHSA 4X3UA 4LFAQ 4ZKCB 1BKBA 3L7ZC 1HZ9A 3QO2A 1B3QA 1P16A 4B3TL 1G6PA 4XTCS 1YJNA 2UUCL 3HOVH 4DGZA 5JJZA 1SE4A 2R3ZA 2ID0A 2MUYA 3QOJA 2J7ZA 3KJPA 2ASBA 1JT8A 4LFBL 3BJUA 1EIFA 3GTMB 2B8GA 2NBFA 4IFDI 3M3YB 1LTID 1VQAA 1SR3A 3SK5A 1AZQA 1TS4A 1WI5A 3NENA 2FHTA 2HDLA 1NSNS 4B3ML 1SE2A 3G6JB 1Z6HA 1UE6A 2EZVA 2MO1A 3PF4A 2HHHL 1HCZA 3KOJA 1TS3A 1HNXQ 3BS1A 4JI0Q 4A3KH 4BBSH 3S1NH 4MZ9A 2SEBD 3HG9A 4CJ1B 1X3PA 3M7GA 4JI2L 3OSOA 1L1OB 4CBVA 2FFKB 2DJFC 2KEDA 3K5LA 5CV6A 4HJAA 2FJ2A 2YTXA 2JJQA 5M9OA 1XMQQ 1BQQT 2OWOA 1EY7A 3FMCA 3KDFA 5CV8A 2IPKD 2WACA 1HFNA 4A3EB 4FP5D 3J81c 3PO3G 1IL2A 4ZRZA 1XPUA 1YNNC 4KKSA 3RZOH 4DV2Q 1M1KC 3S1QH 2H4OA 1AEXA 2R92H 4F88A 3DM1A 2YTYA 4FXGC 1K83B 1RIPA 5D3DA 2JE6I 3GV3A 1CKMA 1K0RA 4LAAA 3I8ZA 5C6AA 4Q5VA 1ILPA 3I2ZA 1SMYD 2N3SA 5DM73 1Q46A 1KNEA 3HRZC 3K8AA 1ET9A 2RCFA 1LTBD 2B2WA 3BVZA 3M4QA 1ZKOA 2WB1E 5KGUA 4DN4M 1FNWA 2CWPA 3V96A 2OEOA 4WRDA 5NUCA 2AMCB 3F2UA 4DR2Q 2JP1A 1ESRA 5I4DA 5IT9E 4UHVA 1VQMA 1N33L 1JB3A 3DWQA 4NXML 3FDTA 3J80L 1HFGA 3HGBA 3MZ5A 3TBIB 1KAAA 3S24A 1KD1C 3HOVB 2JEBI 3BDOA 3ICEA 2RF4A 3CW2C 1EYAA 3NBHA 4JI1L 2EYMA 2SDFA 1KDBA 3BU2A 4R4OA 3JAMc 3R2TA 1K8MA 3I3CA 2JA5H 2A6ED 2F0WA 3HOXG 2HQEA 2V4DA 4A4IA 2FMMA 4DAMA 4OWTB 2OF1A 3VR4A 1A2UA 2JSOA 5JVG3 3A0JA 3PUWA 2EPBA 5CR3A 5FJ8H 1RJTA 4J6HA 4A3KB 4BBSB 3S1NB 4JOIA 1GO3E 4F87A 3NTKA 1FL0A 5C3EH 4YWMA 4IUUA 4K8JA 1TR5A 1XJVA 1FGBD 1TQOA 4ZLTF 4GKJQ 2JQOA 3KLRA 4C3HH 2AQ1B 2OT2A 4IQZA 2NVQH 5C0XH 1A63A 2D9UA 3P7JA 2K52A 4NDXA 1KIXA 1SNQA 3CC4A 1E2WA 1CKOA 3RZOB 3D4WA 1V8QA 4A3DG 4MIUA 2XIWA 3S1QB 1TWGB 2HD3A 3STBC 2YTVA 2YU9H 1O7LA 3ONAB 3MA2B 1CI3M 2UU9Q 4X64Q 4ULLA 5E7NA 2WAQE 4WJWA 5GAGC 2EXDA 1GUGA 5IGFA 4YY3L 1EQRA 2QA4A 2ZXOA 2J0TD 1NBWA 1WOCA 4FF2A 4QIWE 4HIKA 5I6WA 5AJ3Q 3OW2A 2F3VA 4XQJA 2A6HC 1Q7YC 1WTVA 2G9DA 1PTOD 1UEAB 1Y14B 2MJ8A 4UP9A 3SR1A 5K36H 4KLKA 5IP9H 3BVMA 3F2CA 2R93H 1PVOA 3J81E 1YI2A 5BR8Q 4IFDJ 3G7LA 1WCMG 2X69A 3U4ZA 1EOVA 4G7ZC 5EBDA 2XGTA 1AP0A 4APVA 3HKZG 1RDPD 1T9HA 2RHSB 4MNOA 2TSSA 4H02A 5ELDA 4I7ZC 4C2MH 1MHWC 2AQ3B 4FF4A 4LF7L 1QVFA 5KRUA 4WFN3 2E5LL 3PUZA 1V43A 4PMWA 4JYAQ 4A3FH 2JA5B 2FINB 5FLXE 4BY7B 2EIFA 4X62Q 2ZTDA 4NMZA 3KF6A 3G48A 2ALYB 5C5MA 2UXCQ 2JA7H 1B4OA 2IJ0A 4A3LG 2BH2A 2D2CC 3EFXD 4X65Q 3MXUA 4KY6A 5C3EB 3I7FA 1HUMA 4DV5L 2IY5B 2L55A 1SYBA 3TSSA 4CGYB 4IN3A 5IWAQ 4C3HB 4IOCA 3RD4A 3T4AC 1FJGQ 1OXXK 3QWNA 3JAME 1L1OC 1JE5A 3GD7A 1K9MC 1E2VA 2GA4B 3IAYA 1WTHA 4OX9Q 1TS5A 2NVTH 2K5HA 3HOZB 2OQ0A 1KXLA 1LACA 4KN7C 4IURA 5C3XA 1PXUA 2YU9B 4Z9CB 2O5IC 1IYVA 3NWTA 4L5TA 1CUKA 4RAUC 2EY2A 2PMZB 3QIAA 1YZ6A 2BA1A 5C44B 5DAUA 2E2DC 1MSHA 3K58A 1O7ZA 2F0NA 2NN6H 1MBYA 1O78A 4BBRG 4JBKA 3T1HL 3R93A 1SNCA 1SEBD 2PQAB 5KNDA 1QZHA 4DUZL 2VXWA 1EYCA 1HZBA 2R93B 4DV3L 1SNMA 4G57A 2F03A 5ELBA 1FR3A 1AW7A 1YBYA 3PSIA 1GUNA 3S1MH 1V1PB 4N9PA 1NE3A 3NP8A 1NUCA 5BN3A 2PQEA 4JI7L 3VYTA 1PYWD 3CCRA 1IKMA 4RG1A 4K2LA 2FMCA 4PZ6A 3CCQA 4MTKA 4OO1G 2EY5A 4X66Q 3T16A 4A3FB 2Z6BA 1MI2A 2K28A 2QDBA 1Y69U 4U68A 1X3EA 3H91A 1BCPD 3N6RA 2JA7B 5IT9L 4LF8L 1RKNA 1YNJC 3QJYA 1AZPA 4DR7Q 2VY3A 1HNWQ 1QUQB 1CA6A 1STBA 1KDCA 4M1UB 1PA6A 3ZYYX 2I0QA 1I94Q 2JA8G 1L2FA 3L3OC 4POGA 4DR3L 3J7AF 1EY9A 4DXFA 5IGCA 1LTTD 1UWVA 1TU2B 1B9MA 5JEAG 4DUYL 2F0MA 1HHVA 4ZUJA 2L0CA 2AWNA 4EGVA 4IUNA 2WFWA 2NVTB 5FLMH 5IGEA 1ASZA 1K28A 1EUJA 5C4HA 4MTNA 2B2UA 2F4IA 1WTQA 3GP7A 5ELEA 3FKIH 4JV5L 1ONLA 3D8GA 5JJIA 2LY7A 4EQOA 1GUOA 3OHXC 3RUZA 1CKNA 1LTGD 4C3JB 2Q2TA 3SE0A 1RTOA 5E4XA 5D65A 2KA7A 1X54A 5IYBH 4GNXC 1CHQD 3OPOA 3K7AH 4A3MB 4DNRB 2K50A 1L0WA 1BNZA 1XMOQ 3NXWA 4QJFA 4JVZA 1WD0A 1KL9A 3Q23A 5IE8A 5IYCH 3P1HA 2DY8A 3S1MB 3UDXA 4HCSA 2UUCQ 2HUGA 2QEJC 2F0TA 4LK1C 5M3FG 4J15A 2VS1A 3OTOL 4K5XA 3V2TA 4LFBQ 4AIMA 4K5VA 2N55A 3J7ZC 1UE1A 4FXDA 1BVSA 1JCKB 4DK3C 2SNMA 4B3RQ 3HOWH 4O42A 3BZKA 4B3SQ 2V1CC 3UDGA 4IO9A 1ML0D 1C4QA 1PRTF 1VQBA 3VA7A 4B3MQ 1K73C 2GVAA 1SROA 4YWKA 1ZYRD 3VR6A 5IP7H 4HN7A 1ICFB 3H09A 4NW2A 4C1NK 2Q8IB 1KAWA 4QY7A 2B29A 1I6HB 3J81L 5FO7B 1R9TH 3PIO3 3MXNB 3QB3A 1T5XD 3DWAA 3HKSA 1NMFA 3R3OA 4K5WA 2ICIA 4JI2Q 4UP7A 1Y1VB 1U4RA 4KV6A 2UXDL 2K5WA 1MD2D 4HMIA 4JI4L 1PRTB 4BBSG 3E0JA 1QOHA 1MJCA 1EYDA 3E5SA 1A8VA 1ENCA 1TT2A 3GTPH 1ASYA 1IZ6A 3N52A 1HXYD 3H0GH 3UE0A 5FLXL 2L4NA 4OL7A 4DV1L 1NR2A 2B3GA 1SE8A 2B63H 4HCEA 3BZCA 4IOAA 2VUMH 4GNXA 1AE2A 1E22A 1TXYA 1SMXA 5CV7A 1PH2A 4I7AA 1B2TA 1X32A 3CC7A 4LJZC 1D5XC 4JBMA 3H3VH 4DV4L 4H44C 2PPBC 1I6VC 1M8AA 1TWAH 4POFA 2R92G 1N36L 2JA6H 3GTMH 3G71A 2B2YA 4KD4A 1RODA 2VNUD 1WYDA 2CVRA 3JAML 1Z9FA 3CCLA 4N8X1 2Q2HA 1N34Q 1N33Q 1U9RA 3Q8DA 1DOMA 4NXMQ 3CCUA 4LF9L 3AFQA 1B3AA 4DK0A 5IGGA 1B7YB 1F2LA 1H9RA 1PH9A 4NB3A 4A93G 2IWHA 3H15A 1Y1WG 2PI2A 5G3LF 1NY4A 4DR6L 4JI1Q 2AQ2B 4KHVA 2EYPA 1RHPA 1VMPA 3A8JE 3DWPA 3HOWB 2Q8TA
chains in the Genus database with same CATH topology
1HUNA 4RGTA 5AFWA 4ODGA 2B39A 5JVH3 1F9RA 1T5EA 1R9TB 1ILQA 3OOCA 1XXGA 2LS01 5CBAE 1F2MA 1UNSA 4A3GB 2Y0SB 2JXMB 1EQTA 1TVXA 3R8BA 3K5NA 1SYCA 4J8QA 1PTOF 4HAEA 2BCOA 2PW5A 2Z4HA 5FKAC 1LT6D 4CKEA 2F0UA 4ABNA 5CC4A 3H0GB 2PO4A 1EFID 2EYHA 4GZYC 2B63B 4C3HG 2XN9C 5CV4A 2MPMA 5KEEA 1Q90A 2E74C 5C0XG 2VUMB 3CQZB 3HS0C 3GTKB 3OWFA 1PTOB 1CFMA 2N88A 1DOKA 3PO2B 2B2VA 2K6AA 1STNA 5I6YA 3T56B 1TWAB 4F7XA 2JA6B 1LV9A 4H7BA 1CK1A 4J1MA 4OGQC 2WKCA 2A68C 2BE5C 1RTNA 3VA5A 1QNKA 2F0QA 5K36G 2RDFA 2RVLA 2RA4A 1CZGA 2WAQB 3TP7A 4E6IA 1B1ZA 1CZWA 4CHTB 4QIWB 2A74C 1CTMA 5C4XB 3KBGA 2QF7A 1Q12A 1HTLD 1S4ZA 1YNND 2L9HA 4S3SA 4DAYA 1WTPA 2CQAA 1EL0A 3M85A 1SYDA 4WORA 3EVQA 4NP5A 4XYQA 4BA1I 1L0YB 2EE1A 4IUTA 4DAPA 4EVOA 2VB3X 4KJNA 3D4RA 1IKLA 5CBEE 3T13A 1QJOA 4A3IB 1TWCB 2G9HD 3OWEB 1PRTC 5DNFA 1BO0A 4DNTB 1SSOA 3A55A 2F0OA 5J22A 1F77A 1S5FD 5CORA 1EOTA 1D5ZC 2E76C 2NTTA 4RH6A 4FNFA 1A3TA 1NR4A 1AN8A 3I91A 1ICWA 2VB2X 2F0LA 4UAIA 3V05A 5C5LA 3H94A 2J4XA 4L8JA 2A69C 3A54A 3S14B 1TWHB 1PMRA 1BCPF 1DD2A 2NN6G 5TSSA 2E2JB 1OXSC 2JEAI 3M7NA 4ZQ3A 2X6GA 3GTGB 1ESFA 2YYZA 4ILWA 1TY0A 3EA6A 2F0JA 2KECA 2XSCA 2M2LA 5KIXA 4IZ8A 1BCPB 2F1MA 4DFAA 1D1IA 1EZ6A 5COYA 1FYCA 4BY1B 1Z7TA 3I73A 1CT1D 3D6WA 3S17B 4RHSA 3WOEA 3C2PA 1XWEA 3TP6A 1DCZA 3GV6A 1EY5A 3BZDB 2PNRC 5JEAJ 5T1IA 2F0EA 3PUYA 1CM9A 1JOKA 4CJ2C 4M8AA 1I3QB 2DN8A 1ZEQX 1HQRD 1C48A 1DM0B 4PNYA 5J1ZA 2R6GA 1WTXA 4KJOA 1I50B 1I4QA 4KY7A 1G2TA 1KLUD 3D4DA 2K32A 2WKDA 5D14A 3IKJA 2B2TC 3C1FA 2F0PA 4ME5A 5A2QE 4YIJA 4U673 5EPJA 4XXEA 1SDFA 4R9WA 4R8NA 1D6EC 3H3VC 1U4PA 4HTHA 4B9WA 3DXJC 4DU9A 3TP8A 3NUCA 3K5MA 1XYIA 3OW7A 3DHQA 2F0HA 1WTOA 3Q24A 2CW0C 2QCPX 1LTSD 2BDNA 2D62A 2IX0A 3GTJB 3S2HB 3HOUB 5BN4A 4BS9A 1KNAA 5ELFA 4FF1A 1H9SA 2EDGA 1W6JA 1K8OA 3VR2A 5T1GA 1G8ZD 1GJXA 4KY5A 2PZUA 1HQMC 1IHZA 1Q8IA 5I9PA 3I4MB 1RCVD 2F0IA 4KKTA 3KLSX 5EKKA 5KYIA 1EZ8A 1SNOA 2PYKA 4K6DA 4HSVA 2B2TA 1E0BA 1EU4A 4KTAA 1JQYD 4F8MA 3T53B 1CQVA 4XDXA 2I07B 5I9OA 3D3RA 3IL8A 1GHJA 1I4PA 3S15B 3P20A 3AMUA 4X3KA 3KUPA 4X3SA 2HCCA 2JYOA 2DNCA 1B53A 5DEHA 5IOCA 1WVLA 3L9AX 1IW7C 3VR3A 2A5HA 1YNJD 5CGKA 2F0KA 2HCIA 4H13C 4QF4A 4JK1C 1JORA 5D3IB 3S9WA 2DY7A 1F2ZA 3HZXA 2NN6I 1A2TA 1CHPD 1B9NA 3VYSA 3VYUA 1VCIA 3AU7A 5FK9C 2I46A 3EJIA 2EJMA 4QUFA 2RDHA 1I4RA 3BDCA 1JOQA 3T51B 1JC7A 3D6CA 2R61A 1EY6A 1H9MA 2WV6D 5ISRA 3Q6SA 2BA0A 1EY4A 1S5ED 2K1BA 2PZWA 1QNUA 1SYGA 1A3UA 3NE5B 3GQBA 1A15A 5C0XJ 2NTSA 3VYRA 1KABA 1EU3A 1A6XA 1B44D 4QUCA 4FVMA 4Q0FA 2ICEC 4PMBA 2E75C 1GUSA 3M4OB 4A3JB 1BDOA 5FO9B 2EJFC 5IGDA 3W3AA 4TRDA 2EYOA 1XTCD 1E2ZA 3FEWX 5M5XB 4K8IA 1SE3A 3E6ZX 2NVXB 4XIGS 1PZID 2ENBA 4ZK9B 1DZ1A 3SK4A 5FO8B 5HURA 3U9SA 2EYJA 4L63B 4A3DB 2EOTA 5A2QL 3DMUA 2L11A 4NKLA 3K0YA 4DXGA 2NB0A 3FPUB 3LX0A 3KK7A 2C9OA 2RQXA 4PMCA 4V0BA 1U4MA 1PTOH 3MWYW 2KUMA 3HP3A 4QB4A 4LMQD 1TIID 1WCMB 2M9VA 2PW7A 2Q8RE 4EQPA 2HDMA 1JWUD 4H0LC 3GTQB 1VF5C 3HKZB 3W2DA 1G2SA 2SNSA 5KNBA 2Z1CA 1SBBB 1BUVT 4C3IB 3MXGA 3J7AV 3R2IA 4QCLA 4IUQA 3URYA 1AFPA 1Q3LA 1HRJA 1QWYA 1STAA 4RCNA 2K01A 1TY2A 1OO9B 1TWFB 3CRKC 3DEPA 3QG1A 2WB1B 2RDGA 3IFDA 1Y8NB 4OO1I 4RKLA 1VDZA 2IX1A 1DYQA 4DA2A 1QG7A 1C8CA 5CV9A 1LABA 1G91A 5M5WB 1J9OA 1EWHA 4R8IA 5EGTA 3PUVA 3K57A 5JPNC 5JOBA 4IFDH 1G6ZA 1S5BD 3NTHA 2KVMA 1EY8A 2KCCA 2KJXA 1KTKA 2EYFA 3A8IE 2WIIB 3DUZA 3NBIA 4BA2I 2LKVA 1JWSD 3NTIA 2A68D 3MVVA 2BE5D 5CV5A 4CKBA 4KK7A 1U4LA 4K14A 1JICA 4MHEA 1SXTA 5E3FA 2EY6A 1V1PA 2B2WC 3I4NB 4CJ0B 1L0XB 2ZXPA 1Q1BA 4K6LA 4ZAIA 3J7YW 1NCVA 3BG3A 3OIQA 3BDLA 1GUWA 2XRSD 4RWSC 3MC0B 2RSOA 4TQUS 2JA8B 1WD1A 5EKLA 2RBMA 3LWUA 5KNCA 5IODA 4RCOA 3WDNA 2BOSA 4KKUA 1SNPA 1PRTD 3NQIA 3I4LA 3SEBA 1CA5A 4ZUIA 3ND8A 4FF3A 3OMCA 2AWOA 3Q0AA 4L6TB 1X3QA 1DJRD 4KI0A 1M4VA 1BOSA 1LTRD 3Q22A 3FRPB 3CU7A 1JE4A 4A3BB 2QKIC 2A69D 5LL6S 3MFGA 3SXHA 1SMYC 5M3FB 4DF7A 4C3JG 2B8FA 2KCNA 2PCFB 2NYZD 1DOLA 1OXUA 3HEJA 2O4XA 1CQFA 2IL8A 1O80A 3A56A 1VF7A 2R7ZB 1WTRA 1LT3D 5C4JB 3U9OA 3I72A 5C4ZA 1Y8PB 5C3WA 1DXMA 4PQXA 3TZDA 2L12A 4PV1C 5M5YB 2XNAC 2A6EC 2E2HB 3MXNA 1A3VA 2K05A 1KDAA 1UAPA 3PIP3 1HTPA 3S2DB 3FVQA 5G3LD 3K59A 1GXDC 2A6HD 4BWGB 3K5OA 1QILA 2KQ3A 1Z47A 1O7YA 2F3WA 2O5JC 1SYFA 2DNEA 1FNVA 2ZXRA 5BN5A 3GTOB 4ID6A 1QCBD 1BR9A 1WTWA 3SK6A 2R92B 2EJGC 5M3MB 1LLRD 2MP1A 1F2YA 3C1EA 1PZJD 4XYOA 1HA5A 1PFMA 2IX3A 1V1OA 4RA8A 2IT1A 1GOZA 2NUCA 3HOYB 3TZUA 4OHJA 1STYA 5C0XI 4A93B 2KOLA 3P75A 1Y1WB 1PTOC 1SJHD 1EIHA 1STHA 3RZDB 2F0FA 2CW0D 2X6LA 3TDQA 3GO5A 4C3IG 3KBXA 4K2KA 4RGNA 3DEOA 4OIJA 2EYLA 1GHKA 1TS2A 2F0GA 5LHY1 1H9KA 3D31A 2K33A 1RF2D 2TMPA 3FPPA 2Z4IA 4B08A 5EQ0A 4RGMA 3A7AB 3I70A 3PMFA 3TN2A 2NVQB 2E2IB 5EBCA 3SK8A 1G291 4KHZA 4TKOB 2M00A 2PZTA 3UI2A 2D5DA 2K04A 2K03A 5DM63 3LWEA 1VMCA 2NZ1D 1F9QA 2WP8J 1FD7D 3GTLB 2AUKA 3NPPA 2LMCB 2B2UC 1F9SA 1IW7D 2F0DA 4C56C 5ELCA 3S1RB 5I2XA 4IUPA 3MHBA 1JR0D 3LNNA 4XQNA 1D2BA 4KN4C 2RKSA 3TMEA 4O1NA 5IGBA 2BDOA 4JBWA 4C2MB 4QMGA 3PO3B 3WOFA 1ENAA 3ND9A 2XRQD 1I4XA 1PFNA 3M4YA 5JPMC 2AUJD 2K7VA 3NSWA 5JAVA 4C1NI 3EROA 5CMDA 2MGSA 1ET6A 2QILA 2EY1A 3OIPA 4AYBB 1MGSA 3BYYB 1QE6A 3KLSA 1BCPC 5CYUA 5EKIA 1XX8A 4RKBA 2EVBA 3PV0A 1EQVA 1TKWB 1MSGA 3O13A 2ZT9C 1RD9D 3CKIB 1EEFD 5I2YA 3X3MA 1OXTA 2K5DA 4IFDG 1S5CD 3BVGA 4P2CB 4V190 3MTSA 3HOXB 2OXPA 1W6KA 3A7LA 1OXVA 3CRLC 5J39A 4FYDA 2Z8LA 3IFTA 4RGOS 1II3A 2NWGA 3X3NA 3H6MA 3A8KE 3ITPA 5HGTA 1HPCA 1ENFA 1SAPA 4HSPA 4UDUC 2SOBA 2B2YC 4XT3B 3NWSA 4X3TA 1BF4A 3ERQA 2K5QA 4RFBA 1EEID 4G4KA 4IALA 3K6OA 4HMJA 2A73B 4B9XA 1R4QB 4G7OC 3NK9A 1DONA 1I4HA 1EWCA 1QB5D 1EY0A 1ZYRC 3EQLC 3SDZA 1LTAD 3NHHA 2NVYB 3J80E 5IIFA 1HA6A 4Y7NB 3I90A 2F0VA 5EPKA 1F9PA 1B50A 4DAVA 3C3LA 1UUPA 2RSNA 5KYLA 1ZXTA 1KLGD 2WINB 3SHLA 4HEDA 4DK1A 4KD3A 2F0SA 5FOBB 3VR5A 4EQNA 1EIGA 4I65A 2C5CA 4OO1H 3FKIB 2LFNA 1J8IA 1H9JA 1S5DD 4N9TA 3MEHA 1BBXC 2IW3A 2O2LD 1LO5D 4FO2A 4OIKA 3MFYA 1D1KA 1STEA 3S16B 3BYTB 3SVMA 1IYUA 5E4WC 3K7AB 2H1EA 2CHBD 4ZYSA 1R4PB 2B2VC 3MAQA 1FNUA 4FXKC 4IUVA 2KEEA 1LT5D 1LT4D 2L1BA 1JOOA 3OMGA 4MN3A 1SFOB 2MHVA 1BXTA 4ZKBB 1JWMD 5JEAH 5LL6X 2XWBB 5E1FA 1PLFA 2XVSA 5F2DA 5EJWA 3NQTA 1PZKD 1Q1EA 3PUXA 3TP5A 1H9SB 4CKCA 2L5TA 4XT1B 1PFBA 2EXZA 1GUTA 1I4GA 1Y8OB 3RLFA 1SYEA 4TSSA 4G7HC 4BBRB 3AB9A 3MXPA 4HR7B 3GTPB 3KF8A 4RHRA 1SJED 4XQQA 5K5PA 1IL8A 1STGA 5A35A 1NAPA 2XWJB 3C46A 3QOLA 5EPLA 1D5MC 1SNDA 4KMUC 3RMHA 3CHBD 1PDQA 2KHSA 4X3UA 4ZKCB 3L7ZC 3QO2A 4XTCS 4DGZA 5JJZA 1SE4A 2R3ZA 2ID0A 2MUYA 3QOJA 2J7ZA 3GTMB 2B8GA 2NBFA 4IFDI 3M3YB 1LTID 3SK5A 1AZQA 1TS4A 2FHTA 2HDLA 1NSNS 1SE2A 3G6JB 1Z6HA 2EZVA 1HCZA 1TS3A 3BS1A 2SEBD 3HG9A 4CJ1B 1X3PA 3M7GA 3OSOA 4CBVA 2FFKB 2KEDA 3K5LA 5CV6A 2FJ2A 5M9OA 1BQQT 1EY7A 3FMCA 5CV8A 1HFNA 2IPKD 2WACA 4A3EB 4FP5D 4ZRZA 1YNNC 4KKSA 2H4OA 1AEXA 4F88A 3DM1A 4FXGC 1K83B 5D3DA 2JE6I 3GV3A 4LAAA 3I8ZA 5C6AA 4Q5VA 1ILPA 1SMYD 5DM73 3HRZC 1KNEA 1ET9A 1LTBD 2B2WA 3BVZA 1ZKOA 5KGUA 4DN4M 1FNWA 3V96A 2OEOA 4WRDA 5NUCA 3F2UA 2JP1A 1ESRA 5I4DA 5IT9E 1JB3A 3DWQA 3FDTA 3J80L 1HFGA 3HGBA 3MZ5A 3TBIB 1KAAA 3HOVB 2JEBI 3BDOA 1EYAA 3NBHA 2EYMA 2SDFA 1KDBA 3R2TA 1K8MA 3I3CA 2A6ED 2F0WA 2HQEA 2V4DA 2FMMA 2OF1A 3VR4A 1A2UA 2JSOA 5JVG3 3PUWA 2EPBA 5CR3A 1RJTA 4J6HA 4A3KB 4BBSB 3S1NB 4F87A 3NTKA 4IUUA 4K8JA 1TR5A 1FGBD 1TQOA 4ZLTF 3KLRA 2AQ1B 2OT2A 4IQZA 5C0XH 2D9UA 3P7JA 4NDXA 1SNQA 1E2WA 3RZOB 3D4WA 1V8QA 4MIUA 2XIWA 3S1QB 1TWGB 1O7LA 3ONAB 3MA2B 1CI3M 4ULLA 4WJWA 1GUGA 5IGFA 2ZXOA 2J0TD 4FF2A 5I6WA 2F3VA 4XQJA 2A6HC 1WTVA 2G9DA 1PTOD 1UEAB 2MJ8A 3SR1A 5K36H 3BVMA 3J81E 4IFDJ 3G7LA 2X69A 4G7ZC 5EBDA 1AP0A 1RDPD 2TSSA 5ELDA 4I7ZC 2AQ3B 4FF4A 5KRUA 4WFN3 3PUZA 1V43A 4PMWA 2JA5B 2FINB 5FLXE 4BY7B 4NMZA 5C5MA 1B4OA 2IJ0A 2D2CC 3EFXD 3MXUA 4KY6A 5C3EB 1HUMA 2L55A 1SYBA 3TSSA 4CGYB 4IN3A 4C3HB 3RD4A 3T4AC 1OXXK 3QWNA 3JAME 3GD7A 1E2VA 2GA4B 3IAYA 1TS5A 3HOZB 1LACA 4KN7C 4IURA 5C3XA 1PXUA 2YU9B 4Z9CB 2O5IC 1IYVA 3NWTA 4RAUC 2EY2A 2PMZB 3QIAA 2BA1A 5C44B 5DAUA 2E2DC 1MSHA 3K58A 1O7ZA 2F0NA 2NN6H 1MBYA 1O78A 3R93A 1SNCA 1SEBD 5KNDA 2VXWA 1EYCA 2R93B 1SNMA 4G57A 2F03A 5ELBA 1FR3A 1AW7A 1GUNA 1V1PB 4N9PA 3NP8A 1NUCA 5BN3A 2PQEA 3VYTA 1PYWD 1IKMA 4K2LA 2FMCA 4OO1G 2EY5A 3T16A 4A3FB 1MI2A 2K28A 2QDBA 1Y69U 4U68A 3H91A 3N6RA 1BCPD 2JA7B 5IT9L 1RKNA 1YNJC 3QJYA 1AZPA 1CA6A 1STBA 1KDCA 4M1UB 3ZYYX 3L3OC 3J7AF 1EY9A 4DXFA 5IGCA 1LTTD 1TU2B 1B9MA 5JEAG 2F0MA 1HHVA 4ZUJA 2L0CA 2AWNA 4EGVA 4IUNA 2NVTB 5IGEA 5C4HA 2B2UA 2F4IA 1WTQA 3GP7A 5ELEA 1ONLA 3D8GA 2LY7A 4EQOA 1GUOA 3OHXC 3RUZA 1LTGD 4C3JB 3SE0A 1RTOA 5E4XA 5D65A 2KA7A 1CHQD 3OPOA 4A3MB 4DNRB 1BNZA 3NXWA 1WD0A 3Q23A 3P1HA 2DY8A 3S1MB 4HCSA 2HUGA 2QEJC 2F0TA 4LK1C 4K5XA 3V2TA 4K5VA 2N55A 4FXDA 1JCKB 2SNMA 4O42A 1ML0D 1C4QA 1PRTF 3VA7A 1ZYRD 3VR6A 4HN7A 3H09A 4NW2A 4C1NK 2Q8IB 1I6HB 3J81L 5FO7B 3PIO3 3QB3A 1T5XD 3DWAA 3R3OA 4K5WA 2ICIA 1Y1VB 1U4RA 4KV6A 2K5WA 1MD2D 4HMIA 1PRTB 3E0JA 1QOHA 1EYDA 3E5SA 1ENCA 1TT2A 3N52A 1HXYD 5FLXL 2L4NA 4OL7A 1NR2A 4HCEA 5CV7A 1B2TA 1X32A 4LJZC 1D5XC 4H44C 2PPBC 1I6VC 1M8AA 2B2YA 4KD4A 1RODA 2VNUD 2CVRA 3JAML 1U9RA 1DOMA 1B3AA 4DK0A 5IGGA 1F2LA 1H9RA 2IWHA 5G3LF 2AQ2B 4KHVA 2EYPA 1RHPA 1VMPA 3A8JE 3DWPA 3HOWB 2Q8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERO A;  3NHH A;  2EY6 A;  1SYD A;  4K5V A;  5IIF A;  4N9P A;  2EYL A;  2EY1 A;  3NP8 A;  1NUC A;  4WOR A;  4ODG A;  5EKK A;  2PQE A;  3EVQ A;  3TP6 A;  5KYI A;  2SNM A;  2PZW A;  2F0V A;  5KGU A;  1EZ8 A;  4NP5 A;  3U9O A;  5K5P A;  1STG A;  2OEO A;  4K2L A;  1SYG A;  4WRD A;  1A3U A;  1EY5 A;  2F0G A;  5NUC A;  5C4Z A;  1SNO A;  5C3W A;  4RKB A;  2PYK A;  4K6D A;  2EY5 A;  1KAB A;  4EVO A;  3QOL A;  2F0E A;  1EQV A;  1F2M A;  4KJN A;  5KYL A;  3T16 A;  1JOK A;  1STA A;  3MZ5 A;  1SND A;  3BDL A;  1A3V A;  3QB3 A;  4KTA A;  3SHL A;  4F8M A;  1KAA A;  2KHS A;  2QDB A;  5KRU A;  3R3O A;  4K5W A;  1KDA A;  4KD3 A;  4PMB A;  5I9O A;  2F0S A;  1SYC A;  3T13 A;  1EYA A;  4EQN A;  4I65 A;  3PMF A;  2EYM A;  4KV6 A;  4PNY A;  5J1Z A;  1KDB A;  4DGZ A;  4NMZ A;  2PW5 A;  4KJO A;  1RKN A;  4KY7 A;  4HMI A;  3QOJ A;  2F0U A;  5C5M A;  5CC4 A;  4N9T A;  3MEH A;  2F0W A;  5EKL A;  3D4D A;  5IGD A;  1EYD A;  2HQE A;  2RBM A;  3SK8 A;  3E5S A;  4RKL A;  2F0O A;  4TRD A;  1STB A;  1KDC A;  1ENC A;  1TT2 A;  2EYO A;  5IOD A;  2M00 A;  2PZT A;  2OF1 A;  4KY6 A;  2EYH A;  5J22 A;  2KQ3 A;  5DEH A;  3SK5 A;  5IOC A;  4K8I A;  1A2U A;  2F0P A;  3C1F A;  4ME5 A;  2F3W A;  5CR3 A;  5CV4 A;  1NSN S;  4J6H A;  4YIJ A;  1SYF A;  1EY9 A;  4OL7 A;  1A3T A;  1SNP A;  5CV9 A;  5I6Y A;  5IGC A;  2OXP A;  2ENB A;  5KEE A;  2F0M A;  3OWF A;  5CGK A;  2F0K A;  2F0L A;  5J39 A;  4ZUJ A;  4R8N A;  4K8J A;  1SYB A;  4ID6 A;  4ZUI A;  5C5L A;  3SK4 A;  4IUN A;  3TP8 A;  4QF4 A;  5EGT A;  3SK6 A;  5HUR A;  1TR5 A;  4HTH A;  4B9W A;  2EYJ A;  1II3 A;  3OMC A;  4DU9 A;  5IGE A;  1JOR A;  3S9W A;  1F2Y A;  1STN A;  1TQO A;  3C1E A;  3NUC A;  5CV7 A;  3OSO A;  1JOO A;  1F2Z A;  3HZX A;  3OMG A;  4F7X A;  5C4H A;  3H6M A;  1A2T A;  5JOB A;  3ITP A;  1EY8 A;  2F0D A;  5HGT A;  2NUC A;  5CV6 A;  3D8G A;  4H7B A;  4J1M A;  3DHQ A;  2F0H A;  3DMU A;  5M9O A;  4EQO A;  1STY A;  2EYF A;  4NKL A;  5C3X A;  1EY7 A;  2SOB A;  4NDX A;  5CV8 A;  1SNQ A;  2WAC A;  3MHB A;  4ZQ3 A;  5E1F A;  3RUZ A;  3VA5 A;  2F0Q A;  4KD4 A;  5F2D A;  2RDF A;  3D4W A;  3LX0 A;  3NQT A;  2EY2 A;  4MIU A;  3ERQ A;  3P75 A;  3EJI A;  5DAU A;  4IAL A;  3SXH A;  1U9R A;  2RKS A;  3TME A;  3TP7 A;  2F0J A;  3TP5 A;  4E6I A;  5IGB A;  2F0N A;  3BDC A;  4PMC A;  4IZ8 A;  5KIX A;  4DFA A;  1JOQ A;  2LKV A;  1STH A;  4DF7 A;  4HMJ A;  2EXZ A;  5IGF A;  4QMG A;  1EZ6 A;  1SNC A;  2F0F A;  3D6C A;  3MVV A;  5CV5 A;  5IGG A;  1SYE A;  1ENA A;  3NXW A;  4QB4 A;  4B9X A;  5I6W A;  1AEX A;  1EYC A;  2F3V A;  3P1H A;  2PW7 A;  1EY6 A;  3HEJ A;  3NK9 A;  4KY5 A;  4EQP A;  2O4X A;  5ISR A;  1SNM A;  3SR1 A;  4K14 A;  4KHV A;  4K2K A;  2PZU A;  4G57 A;  4LAA A;  3V2T A;  1EY0 A;  2F0T A;  1IHZ A;  2EYP A;  5C6A A;  5I9P A;  4S3S A;  2F0I A;  2SNS A;  1EY4 A;  5JAV A;  3MXP A;  5E3F A;  4K5X A; 
#chains in the Genus database with same CATH topology
 3E9H A;  1HUN A;  4RGT A;  5AFW A;  4ODG A;  3J80 i;  2B39 A;  5JVH 3;  3KLW A;  1F9R A;  4NXN L;  1LM0 A;  1T5E A;  1R9T B;  1ILQ A;  1VQG A;  3OOC A;  1XXG A;  3VDY A;  1B70 B;  2LS0 1;  2JA5 G;  5CBA E;  1F2M A;  1VQ6 A;  2QGQ A;  1UNS A;  4A3G B;  2Y0S B;  2JXM B;  1EQT A;  4DR5 L;  1JB7 A;  1TVX A;  3R8B A;  3K5N A;  4A75 A;  3D0F A;  5FJ8 G;  1SYC A;  2RHQ B;  4J8Q A;  1PTO F;  1E24 A;  3EN2 A;  4HAE A;  2BCO A;  2PW5 A;  4R4Q A;  2Z4H A;  5FKA C;  1LT6 D;  4CKE A;  2F0U A;  4ABN A;  5CC4 A;  4JCV E;  3H0G B;  3F8T A;  4CDD C;  4A3I H;  2ZM6 L;  1EIY B;  2PO4 A;  1EFI D;  1TWC H;  2EYH A;  1EQQ A;  4GZY C;  2B63 B;  4C3H G;  2XN9 C;  5CV4 A;  3CCE A;  2MPM A;  1X65 A;  5KEE A;  4GLV B;  5DLQ E;  1Q90 A;  2E74 C;  5C0X G;  2VUM B;  3CQZ B;  3HS0 C;  4YY3 Q;  3GTK B;  3OWF A;  3CP0 A;  1PTO B;  1CFM A;  2K5V A;  2PNH A;  3ZJY C;  2N88 A;  2CCZ A;  1DOK A;  3PO2 B;  2B2V A;  2K6A A;  3CPW A;  1STN A;  5I6Y A;  3T56 B;  1N9W A;  3CC2 A;  1TWA B;  4F7X A;  5H1S E;  2JA6 B;  2Z6K A;  3S14 H;  1TWH H;  1AE3 A;  1LV9 A;  4H7B A;  1CK1 A;  2JK8 A;  4J1M A;  4OGQ C;  4HIO A;  2WKC A;  2GVB A;  2A68 C;  2BE5 C;  1RTN A;  4OON A;  3VA5 A;  1QNK A;  3RN5 A;  2F0Q A;  2QEX A;  2E2J H;  5K36 G;  2RDF A;  2RVL A;  4N8F A;  5IP9 G;  2RA4 A;  4AQY L;  2R93 G;  1CZG A;  2WAQ B;  3TP7 A;  4E6I A;  3GTG H;  4ME3 A;  1B1Z A;  1CZW A;  1DGS A;  4CHT B;  4QIW B;  4DV6 Q;  1IBL L;  2A74 C;  4LF7 Q;  4OEL B;  2E5L Q;  1CTM A;  1HH2 P;  5C4X B;  3KBG A;  2QF7 A;  4O2D A;  1Q12 A;  1HTL D;  1S4Z A;  1AH9 A;  2K14 A;  1YNN D;  2L9H A;  4S3S A;  4DAY A;  1WTP A;  2CQA A;  1EL0 A;  3M85 A;  1SYD A;  3HKZ E;  2JN4 A;  3B6Y A;  4WOR A;  3EVQ A;  1PH3 A;  3KYH C;  5L37 A;  4NP5 A;  4LF5 Q;  3S17 H;  4XYQ A;  1D8L A;  1NNX A;  4P73 A;  4BA1 I;  1XPO A;  4HID A;  1L0Y B;  1TWG H;  2EE1 A;  1HR0 L;  4IUT A;  4DAP A;  4LUZ A;  4OWW B;  4EVO A;  1V1Q A;  2JA7 G;  2VB3 X;  4KJN A;  3D4R A;  4AYB G;  5GAD C;  3EBE A;  1HZC A;  1IKL A;  4DV0 L;  4UPA A;  5CBE E;  5J3B A;  2R7F A;  3T13 A;  2ZTC A;  1I3Q H;  1QJO A;  1VQ9 A;  4A3I B;  4Y52 H;  1TWC B;  2G9H D;  3OWE B;  1PRT C;  5DNF A;  1BO0 A;  4DNT B;  1SSO A;  3A55 A;  2F0O A;  1I50 H;  1XPR A;  5J22 A;  1F77 A;  1W2B A;  1S5F D;  1PH8 A;  5COR A;  1EOT A;  1D5Z C;  2E76 C;  4JG2 A;  2C35 B;  2NTT A;  4RH6 A;  4YCW A;  1VQO A;  4FNF A;  1A3T A;  1NR4 A;  3CMA A;  1AN8 A;  3I91 A;  1ICW A;  2VB2 X;  2F0L A;  4UAI A;  4DUZ Q;  2A1A A;  3V05 A;  5C5L A;  3H94 A;  2J4X A;  4L8J A;  2A69 C;  1O7I A;  3A54 A;  1TWH B;  3W5O A;  4DV3 Q;  3S14 B;  1PMR A;  1BCP F;  1DD2 A;  4JBJ A;  4BY7 H;  4JI5 L;  2NN6 G;  5TSS A;  2E2J B;  1OXS C;  4YHH L;  2ZJR A;  2JEA I;  3M7N A;  1VQ4 A;  4JI7 Q;  1UE5 A;  1GD7 A;  4ZQ3 A;  2X6G A;  3GTG B;  2E8G A;  1ESF A;  1U5K A;  2Z0S A;  3A5Z B;  5IYD G;  1E7Z A;  2YYZ A;  4ILW A;  4L5R C;  1MJE A;  1TY0 A;  3EA6 A;  4GLX A;  5IY0 A;  4PZ7 A;  2F0J A;  2KEC A;  4DPG A;  2XSC A;  2M2L A;  5KIX A;  4IZ8 A;  3PIO A;  1BCP B;  2F1M A;  4DFA A;  3GTJ H;  1VQ8 A;  1D1I A;  3S2H H;  3HOU H;  1EZ6 A;  5COY A;  1FYC A;  4BY1 B;  3QR8 A;  1XNR L;  1Z7T A;  3I73 A;  1CT1 D;  3NEM A;  3STB D;  4LF8 Q;  3D6W A;  4P72 A;  3S17 B;  1KRS A;  3HOZ H;  4RHS A;  3WOE A;  1S40 A;  3C2P A;  1XWE A;  3TP6 A;  3I4M H;  2OTJ A;  1DCZ A;  3GV6 A;  3TS0 A;  4K0K L;  1EY5 A;  4DR3 Q;  3BZD B;  5C44 H;  2PNR C;  5JEA J;  5T1I A;  1VQE A;  4DUY Q;  2F0E A;  3PUY A;  2UUA L;  4KHP L;  5LMU Q;  1CM9 A;  1JOK A;  1SRU A;  3CPF A;  4M8A A;  4CJ2 C;  1I3Q B;  3RLO A;  2DN8 A;  4PZ8 A;  1Q86 C;  1ZEQ X;  1HQR D;  4OWX B;  1C48 A;  1DM0 B;  3CCM A;  4PNY A;  5J1Z A;  2R6G A;  1WTX A;  4KJO A;  4JI6 L;  1I50 B;  1I4Q A;  4KY7 A;  1G2T A;  1KLU D;  3D4D A;  2K32 A;  3U50 C;  5FLM G;  1C0A A;  2WKD A;  4R4T A;  5D14 A;  3IKJ A;  3CD6 A;  2B2T C;  3C1F A;  2F0P A;  4ME5 A;  3FKI G;  5A2Q E;  4YIJ A;  4U67 3;  1BBW A;  5EPJ A;  4XXE A;  1OTC A;  1PH6 A;  1SDF A;  4R9W A;  1CSP A;  4R8N A;  1D6E C;  3H3V C;  1U4P A;  2OTL A;  4HTH A;  4B9W A;  3DXJ C;  1HR0 W;  4DU9 A;  4GOP B;  4JPB W;  1PV4 A;  3TP8 A;  3NUC A;  3K5M A;  4LF4 L;  1HNX L;  5IYB G;  1YEZ A;  3OTO Q;  3OW7 A;  1XYI A;  3DHQ A;  2F0H A;  1PH1 A;  5GAH C;  1WTO A;  3Q24 A;  2CW0 C;  5IYC G;  2QCP X;  1LTS D;  2BDN A;  5ELN A;  1D7Q A;  2D62 A;  2IX0 A;  4IPC A;  3GTJ B;  2MNA A;  2JA9 A;  3S2H B;  1XMQ L;  3HOU B;  5BN4 A;  1B8A A;  1KNA A;  2CH4 W;  4BS9 A;  5ELF A;  4FF1 A;  1H9S A;  2EDG A;  1W6J A;  1K8O A;  3M9B A;  3HOW G;  3VR2 A;  1WFQ A;  4GN5 A;  5T1G A;  1G8Z D;  1A62 A;  2G5D A;  1GJX A;  4KY5 A;  1G51 A;  5IP7 G;  2UXD Q;  2DUD A;  2PZU A;  1HQM C;  1IHZ A;  1Q8I A;  5I9P A;  3I4M B;  1RCV D;  2F0I A;  4KKT A;  3JC6 6;  3KLS X;  4DR4 L;  1YIT A;  1E3P A;  2KHI A;  1JJC B;  2NZH A;  5EKK A;  5KYI A;  3KF8 B;  4C3J H;  3IRB A;  1EZ8 A;  5GRO A;  1SNO A;  2PYK A;  4K6D A;  4LFC L;  1VQN A;  4DV7 Q;  2EQS A;  3OYY A;  2B2T A;  1E0B A;  4HSV A;  1EU4 A;  4A3M H;  4KTA A;  4DR2 L;  1JQY D;  4F8M A;  3T53 B;  1CQV A;  2KCT A;  3H0G G;  2A8V A;  4XDX A;  2I07 B;  5I9O A;  3D3R A;  3IL8 A;  1GHJ A;  4OXP A;  1I4P A;  4DV4 Q;  1VQK A;  2B63 G;  3S15 B;  3P20 A;  3AMU A;  4X3K A;  2VW9 A;  3KUP A;  4X3S A;  2HCC A;  2JYO A;  2DNC A;  2VUM G;  3M4O H;  4A3J H;  3RR5 A;  1B53 A;  5DEH A;  1X3G A;  5IOC A;  2ZTE A;  1WVL A;  3L9A X;  2RCN A;  1IYJ B;  1IW7 C;  4UP8 A;  3VR3 A;  1MIU A;  2A5H A;  4LF9 Q;  1YNJ D;  5CGK A;  5M5X H;  2GN5 A;  2F0K A;  2NZO A;  4NPS A;  1I6H H;  2HCI A;  2NVX H;  2VQE Q;  4H13 C;  4QF4 A;  4JK1 C;  1JOR A;  5D3I B;  3S9W A;  4A76 A;  3HZX A;  1L1O A;  1F2Z A;  2DY7 A;  2NN6 I;  1Y1V H;  3MEF A;  4P71 A;  3JAM i;  1A2T A;  1XTD A;  1EFW A;  1CHP D;  1B9N A;  3LGJ A;  3VYS A;  1SLJ A;  1VQ5 A;  4GKJ L;  3VYU A;  3KDF B;  1VCI A;  3AU7 A;  5FK9 C;  2I46 A;  3EJI A;  2EJM A;  4QUF A;  2RDH A;  5EAY A;  1I4R A;  2UUB L;  3BDC A;  1JOQ A;  3T51 B;  1IBK L;  1YJ9 A;  4A3E G;  1JC7 A;  3D6C A;  2UXB Q;  1HJP A;  2R61 A;  2UU9 L;  2HQL A;  1EY6 A;  1H9M A;  1YHQ A;  2WV6 D;  5ISR A;  2PI2 E;  3Q6S A;  2Z9H A;  2BA0 A;  1EY4 A;  4L5S A;  4BXX H;  2ZM6 Q;  5LMN L;  3GTQ H;  1S5E D;  2K1B A;  2PZW A;  1QNU A;  2A19 A;  1WJJ A;  1SYG A;  1A3U A;  3NE5 B;  4JW0 A;  3GQB A;  1A15 A;  5C0X J;  2NTS A;  3VYR A;  5BR8 L;  2F52 A;  4C3I H;  1KAB A;  1EU3 A;  1A6X A;  1B44 D;  4B3T Q;  4A3I G;  4QUC A;  4FVM A;  4Q0F A;  2ICE C;  4GKK L;  4PMB A;  2E75 C;  1GUS A;  3KJO A;  3NBH B;  3M4O B;  4A3J B;  1BDO A;  5FO9 B;  2LXJ A;  4A3L H;  1TWF H;  4JYA L;  2EJF C;  5IGD A;  3E3X A;  3HOV G;  3W3A A;  4TRD A;  4R4I A;  2EYO A;  1XTC D;  2HHH Q;  1E2Z A;  3FEW X;  5M5X B;  4K8I A;  1SE3 A;  3E6Z X;  2NVX B;  1IBM L;  4QQB X;  4XIG S;  1PZI D;  2ENB A;  4ZK9 B;  4X65 L;  4CDF C;  1IBL Q;  1DZ1 A;  4A3G H;  4GLA C;  1X9N A;  3SK4 A;  5FO8 B;  5HUR A;  3G4S A;  1X3F A;  1I5F A;  3U9S A;  4YWL A;  4GOP C;  2EYJ A;  4L63 B;  1EWI A;  4A3K G;  4HJ7 A;  4A3D B;  2EOT A;  2N78 A;  5A2Q L;  4HJ8 A;  3TEH B;  3FHW A;  3DMU A;  3EIV A;  1SN8 A;  2L11 A;  4NKL A;  3K0Y A;  2I5L X;  4DXG A;  2NB0 A;  3FPU B;  3LX0 A;  1NTG A;  4EQ5 A;  1HR0 Q;  3KK7 A;  4ZCK A;  2C9O A;  2RQX A;  4PMC A;  3CQZ H;  4V0B A;  3CME A;  3GTK H;  1VQI A;  1U4M A;  1VS0 A;  1PTO H;  3MWY W;  2KUM A;  4DV0 Q;  3HP3 A;  4QB4 A;  4LMQ D;  1TII D;  1WCM B;  1E1O A;  2M9V A;  2PW7 A;  2Q8R E;  3PO2 H;  4EQP A;  2ATW A;  3UE1 A;  1S3O A;  2HDM A;  1JWU D;  4H0L C;  3GTQ B;  1VF5 C;  3HKZ B;  3W2D A;  1G2S A;  2SNS A;  5KNB A;  2Z1C A;  4JC0 A;  4DKA C;  2IHF A;  1SBB B;  1BUV T;  1X6O A;  4C3I B;  3MXG A;  4DNI A;  3ER0 A;  4AYB E;  3J7A V;  3R2I A;  4QCL A;  4IJH A;  4IUQ A;  1Q82 C;  3I4N H;  3URY A;  3K81 C;  1AFP A;  1Q3L A;  1HRJ A;  1QWY A;  3F2B A;  1STA A;  4RCN A;  2K01 A;  1TY2 A;  1OO9 B;  1N32 L;  5C4X H;  1TWF B;  3CRK C;  3DEP A;  4X66 L;  4JI5 Q;  3QG1 A;  2WB1 B;  2RDG A;  3A74 A;  3IFD A;  2K5N A;  3KF6 B;  1Y8N B;  4YHH Q;  4JI8 L;  4A3C H;  4OO1 I;  3I55 A;  4RKL A;  3I56 A;  1VDZ A;  2LXK A;  3TQY A;  4BY7 G;  2IX1 A;  1DYQ A;  2XTI A;  3H3V I;  4DR7 L;  3UDF A;  4DA2 A;  1QG7 A;  1JMC A;  1C8C A;  5CV9 A;  1LAB A;  1G91 A;  5M5W B;  1J9O A;  5LMN W;  1EWH A;  1I94 L;  2VL6 A;  4R8I A;  4IPH A;  1XNR Q;  5EGT A;  3PUV A;  3K57 A;  3F2D A;  5JPN C;  5C3E G;  3DLL A;  5IT9 c;  5JOB A;  1MKH A;  4IFD H;  4GN4 B;  1G6Z A;  1S5B D;  1UE7 A;  3NTH A;  2KVM A;  1EY8 A;  1PH7 A;  2KCC A;  2KJX A;  2FXQ A;  1KTK A;  2EYF A;  1VQD A;  3A8I E;  2WII B;  1VQF A;  3DUZ A;  3ERS X;  3TRZ A;  4K0K Q;  4A3B H;  3PF5 A;  3NBI A;  3HOZ G;  2UUA Q;  4KHP Q;  4BA2 I;  2LKV A;  3W1G A;  1JWS D;  2N8N A;  4AH6 A;  3NTI A;  2A68 D;  3MVV A;  2BE5 D;  5CV5 A;  2PQA A;  4CKB A;  4KK7 A;  1U4L A;  5C44 G;  5M3F H;  4K14 A;  1JIC A;  4JI6 Q;  1XMO L;  4MHE A;  1SXT A;  5E3F A;  2EY6 A;  1V1P A;  4IPG A;  2B2W C;  3I4N B;  4CJ0 B;  1L0X B;  4LW1 A;  4QGU A;  2ZXP A;  2R7Z H;  1VQC A;  1KC8 C;  2KBN A;  3FP9 A;  1Q1B A;  5C4J H;  4K6L A;  4B3R L;  4ZAI A;  4B3S L;  3J7Y W;  1NCV A;  3BG3 A;  3OIQ A;  1K3R A;  3BDL A;  1GUW A;  3I4O A;  2XRS D;  4DK6 C;  5M5Y H;  2VZA A;  4BY1 H;  5HY6 A;  4RWS C;  3MC0 B;  1QZG A;  2RSO A;  4LF4 Q;  2E2H H;  4TQU S;  2JA8 B;  3AEV A;  3PCO B;  4A3F G;  1WD1 A;  3GDE A;  1GVP A;  5EKL A;  2RBM A;  3LWU A;  1QUQ A;  3S2D H;  5KNC A;  4DV5 Q;  5IOD A;  4RCO A;  3WDN A;  2AHO B;  2BOS A;  4FDB A;  2MQH A;  4JOI C;  4KKU A;  1SNP A;  4LUO A;  1PRT D;  3NQI A;  3I4L A;  1U0L A;  3SEB A;  1CA5 A;  4ZUI A;  3ND8 A;  4FF3 A;  1A0I A;  3OMC A;  2AWO A;  3Q0A A;  4L6T B;  1X3Q A;  1DJR D;  4KI0 A;  3GTO H;  1M4V A;  1W3S A;  1BOS A;  5M3M H;  1LTR D;  4DR4 Q;  4X6A H;  2CFM A;  3Q22 A;  3FRP B;  3CU7 A;  1JE4 A;  4A3B B;  2QKI C;  1PH4 A;  1CKN B;  4IJL A;  2A69 D;  3RLN A;  5FLX c;  2F4V L;  3HOY H;  5LL6 S;  4LF6 L;  3T1H Q;  3AQQ A;  3MFG A;  1XNQ L;  2VQF L;  4LFC Q;  2N49 A;  1HZA A;  3SXH A;  3E9I A;  5GQO A;  1SMY C;  4A93 H;  1J5E L;  3CXC A;  3U58 A;  1Y1W H;  1YJW A;  5M3F B;  4DF7 A;  4C3J G;  4CDC C;  1N34 L;  2B8F A;  2KCN A;  1YHB A;  2PCF B;  2NYZ D;  1DOL A;  1J6Q A;  1OXU A;  3HEJ A;  3RZD H;  2O4X A;  1CQF A;  2IL8 A;  2Y0S E;  1O80 A;  3A56 A;  1VF7 A;  4A3M G;  1V9P A;  4JI3 L;  2R7Z B;  1WTR A;  1LT3 D;  1LUZ A;  5C4J B;  3U9O A;  4HJ9 A;  3I72 A;  5C4Z A;  4RMF A;  3PQI A;  1NMG A;  1M90 C;  1Y8P B;  5C3W A;  1DXM A;  4PQX A;  3TZD A;  2L12 A;  4PV1 C;  3TS2 A;  5M5Y B;  2XNA C;  2A6E C;  4A3J G;  3T1Y L;  2E2H B;  1VQL A;  3MXN A;  1A3V A;  2K05 A;  2QDL A;  1KDA A;  1UAP A;  3L0O A;  3PIP 3;  1KQS A;  1GKH A;  1HTP A;  3DM3 A;  3S2D B;  3FVQ A;  5G3L D;  3K59 A;  1CSQ A;  1GXD C;  2A6H D;  4BWG B;  3K5O A;  1QIL A;  4R4C A;  3M4P A;  5GAE C;  2H5X A;  1Y1V G;  1Z47 A;  2KQ3 A;  2E2I H;  2ZJQ A;  4DR1 L;  1O7Y A;  2F3W A;  2O5J C;  1SYF A;  2UUB Q;  3RN2 A;  2DNE A;  1HNZ L;  3K7U C;  1FNV A;  1IBK Q;  2ZXR A;  5BN5 A;  3GTO B;  4ID6 A;  1QCB D;  1BR9 A;  1WTW A;  3SK6 A;  2R92 B;  2EJG C;  4GNX B;  4JV5 Q;  5M3M B;  1LLR D;  2MP1 A;  4LFA L;  1F2Y A;  3C1E A;  1YVC A;  1PZJ D;  4XYO A;  1HA5 A;  1PFM A;  2IX3 A;  1V1O A;  4RA8 A;  1RL2 A;  2IT1 A;  3GTL H;  1GOZ A;  2NUC A;  3HOY B;  3S15 H;  5LMN Q;  3TZU A;  4OHJ A;  1STY A;  2DGY A;  3SGI A;  1VQJ A;  4LNQ A;  5C0X I;  4A93 B;  2KOL A;  3S1R H;  2MO0 A;  3P75 A;  1Y1W B;  1K0S A;  1PTO C;  1SJH D;  2HIV A;  4BXX G;  1EIH A;  1STH A;  3RZD B;  1IXR A;  1PFS A;  2F0F A;  2CW0 D;  4JI0 L;  4GKK Q;  2X6L A;  3TDQ A;  3GO5 A;  1JJ2 A;  4P74 A;  4C3I G;  2KCM A;  4DV6 L;  3PO3 H;  3KBX A;  4K2K A;  4YCU A;  1X56 A;  4RGN A;  3DEO A;  4OIJ A;  2EYL A;  1PHJ A;  1GHK A;  3KFU A;  1C9O A;  1TS2 A;  2F0G A;  4WJ4 A;  1IBM Q;  2I5H A;  5LHY 1;  1FGU A;  1H9K A;  3D31 A;  4P75 A;  2WB1 G;  4LF5 L;  2K33 A;  1RF2 D;  2I5M X;  4DV2 L;  2OCE A;  2TMP A;  3FPP A;  4IPD A;  2Z4I A;  4B08 A;  1PH5 A;  5EQ0 A;  4RGM A;  4JI4 Q;  1BBU A;  3A7A B;  3I70 A;  3CCS A;  3PMF A;  3TN2 A;  3J81 i;  4A3G G;  4GS3 A;  2Y0S G;  2NVQ B;  2E2I B;  5EBC A;  2HIX A;  3SK8 A;  1G29 1;  4DV1 Q;  4KHZ A;  4TKO B;  2M00 A;  2PZT A;  3UI2 A;  2D5D A;  2K04 A;  4LUV A;  5ELO A;  2K03 A;  5DM6 3;  3LWE A;  2YV5 A;  1VMC A;  2NZ1 D;  1KRT A;  1F9Q A;  1GM5 A;  1Q8K A;  1P8L A;  2L15 A;  1EYG A;  2WP8 J;  3HOX H;  1FD7 D;  1E1T A;  3GTL B;  2AUK A;  1PYB A;  1YHA A;  2D0O A;  1FVI A;  3NPP A;  2LMC B;  4PG3 A;  2B2U C;  1F9S A;  1N36 Q;  2AKW B;  1IW7 D;  2F0D A;  4C56 C;  5ELC A;  1PYS B;  3S1R B;  5IYD H;  5I2X A;  4IUP A;  4WJ3 M;  1Q81 C;  3MHB A;  1JR0 D;  3PO2 G;  4GN3 B;  3J80 c;  4YCV A;  3LNN A;  4XQN A;  1D2B A;  2JA6 G;  2K4K A;  4KN4 C;  2RKS A;  3TME A;  4O1N A;  5IGB A;  2BDO A;  4R1J A;  4JBW A;  4C2M B;  4DR6 Q;  4QMG A;  3PO3 B;  3WOF A;  1N32 Q;  1ENA A;  3ULP A;  3I4N G;  3K0X A;  3ND9 A;  2XRQ D;  2WAQ G;  2ES2 A;  1I4X A;  2CQO A;  1PFN A;  3M4Y A;  2Q2U A;  5JPM C;  4A3D H;  4JI8 Q;  4DAY B;  4NXN Q;  2AUJ D;  2K7V A;  3NSW A;  5JAV A;  4HIM A;  4C1N I;  3ERO A;  5CMD A;  2MGS A;  1ET6 A;  2QIL A;  2EY1 A;  3OIP A;  4AYB B;  5C4X G;  1MGS A;  3BYY B;  1QE6 A;  2K75 A;  4QL5 A;  3KLS A;  1BCP C;  2NVY H;  4O0A A;  5CYU A;  5EKI A;  4DR5 Q;  1XX8 A;  4RKB A;  4Y7N H;  4A3C G;  2EVB A;  3PV0 A;  3PGZ A;  1EQV A;  1TKW B;  1MSG A;  4X64 L;  2LSS A;  3O13 A;  2ZT9 C;  1N8R C;  2Q2I A;  1WCM H;  5AJ3 L;  2QW7 A;  2D0P A;  3J7A 5;  2F3I A;  1S72 A;  5LMU L;  2HT1 A;  1RD9 D;  1H95 A;  1UEB A;  2MFI A;  3CKI B;  1YIJ A;  1EEF D;  3F1Z A;  5I2Y A;  3X3M A;  4ALP A;  1OXT A;  2K5D A;  4IFD G;  3CF5 A;  3J81 j;  1S5C D;  3BVG A;  4P2C B;  4V19 0;  3MTS A;  3HOX B;  2OXP A;  1W6K A;  3A7L A;  4UY8 C;  1JJG A;  1OXV A;  3CRL C;  5J39 A;  4L5Q A;  4LWC A;  4FYD A;  3S16 H;  2Z8L A;  3IFT A;  4A3B G;  4RGO S;  1II3 A;  2NWG A;  3X3N A;  3H6M A;  3A8K E;  3ITP A;  4X62 L;  5HGT A;  1HPC A;  1ENF A;  1SAP A;  3WWV A;  4HSP A;  4UDU C;  2UXC L;  4AQY Q;  2SOB A;  2B2Y C;  1SFO H;  4XT3 B;  3NWS A;  4X3T A;  1BF4 A;  5JJK A;  3ERQ A;  2K5Q A;  4RFB A;  1EEI D;  4G4K A;  4IAL A;  2KEN A;  2PMZ E;  3K6O A;  5M5W H;  4HMJ A;  2A73 B;  2DJG C;  5JJL A;  3PIP A;  4B9X A;  2R7Z G;  1C7Y A;  5IWA L;  1R4Q B;  4G7O C;  1FJG L;  3NK9 A;  1DON A;  1I4H A;  1VQH A;  2CWA A;  1EWC A;  1QB5 D;  1EY0 A;  1ZYR C;  3EQL C;  4OX9 L;  3SDZ A;  1LTA D;  3NHH A;  2NVY B;  3J80 E;  5IIF A;  1HA6 A;  4BBR H;  4BY1 G;  4Y7N B;  3I90 A;  2F0V A;  3G6E A;  5EPK A;  1F9P A;  4OEM B;  3K80 C;  1B50 A;  1VQ7 A;  3RNU A;  2IHE A;  4DAV A;  3C3L A;  1UUP A;  3U4V A;  3UDI A;  2R7D A;  2RSN A;  2OQK A;  4CDE C;  5KYL A;  1ZXT A;  2ZJP A;  1KLG D;  2WIN B;  3SHL A;  1K3B C;  4HED A;  4DK1 A;  4KD3 A;  4DV7 L;  2F0S A;  5FOB B;  3VR5 A;  4EQN A;  1EIG A;  4I65 A;  2C5C A;  1YNX A;  3A5U A;  4OO1 H;  3FKI B;  2LFN A;  1J8I A;  1H9J A;  1S5D D;  4N9T A;  3MEH A;  2CKZ B;  1BBX C;  2F4V Q;  2IW3 A;  2O2L D;  1LO5 D;  4LF6 Q;  3TRE A;  4FO2 A;  1XNQ Q;  2VQF Q;  4OIK A;  3MFY A;  1D1K A;  1STE A;  5M3M G;  1VQP A;  3S16 B;  3BYT B;  3SVM A;  1K8G A;  1J5E Q;  3M3Y H;  1IYU A;  5E4W C;  1LYL A;  3K7A B;  2KHJ A;  5HGQ A;  3AFP A;  3HOY G;  2H1E A;  2CHB D;  4ZYS A;  1R4P B;  2B2V C;  3CAM A;  1FNU A;  4FXK C;  3MAQ A;  4IUV A;  4GOP A;  2KEE A;  1LT5 D;  1LT4 D;  2L1B A;  1JOO A;  3OMG A;  4MN3 A;  3W1B A;  1NJI C;  2Z6K C;  2JA8 H;  2VQE L;  1SFO B;  4JI3 Q;  4TVA B;  2MHV A;  4EX5 A;  1BXT A;  4ZKB B;  1JWM D;  5JEA H;  5LL6 X;  2XWB B;  5E1F A;  1PLF A;  2XVS A;  3CCV A;  1X55 A;  1HNW L;  5F2D A;  5EJW A;  3NQT A;  4HJ5 A;  1KHI A;  1PZK D;  1Q1E A;  2P5Z X;  3ULL A;  3AYH B;  3PUX A;  1K8A C;  4A3E H;  3TP5 A;  1H9S B;  4CKC A;  2L5T A;  4XT1 B;  1PFB A;  3T1Y Q;  2EXZ A;  1GUT A;  1I4G A;  1Y8O B;  3E0E A;  3RLF A;  3L2P A;  1SYE A;  4TSS A;  3HOU G;  4G7H C;  4BBR B;  2UXB L;  3AB9 A;  3CCJ A;  3MXP A;  1K83 H;  1QVG A;  4HR7 B;  3GTP B;  3KF8 A;  4RHR A;  1SJE D;  1LTL A;  4XQQ A;  5K5P A;  1IL8 A;  1STG A;  5A35 A;  4DR1 Q;  2CH4 A;  1NAP A;  1QVC A;  3I4M G;  1HNZ Q;  2XWJ B;  3C46 A;  3QOL A;  3NEL A;  5EPL A;  2BH8 A;  1D5M C;  1SND A;  3HFZ B;  4KMU C;  3RMH A;  3CHB D;  3ULJ A;  1PDQ A;  2KHS A;  4X3U A;  4LFA Q;  4ZKC B;  1BKB A;  3L7Z C;  1HZ9 A;  3QO2 A;  1B3Q A;  1P16 A;  4B3T L;  1G6P A;  4XTC S;  1YJN A;  2UUC L;  3HOV H;  4DGZ A;  5JJZ A;  1SE4 A;  2R3Z A;  2ID0 A;  2MUY A;  3QOJ A;  2J7Z A;  3KJP A;  2ASB A;  1JT8 A;  4LFB L;  3BJU A;  1EIF A;  3GTM B;  2B8G A;  2NBF A;  4IFD I;  3M3Y B;  1LTI D;  1VQA A;  1SR3 A;  3SK5 A;  1AZQ A;  1TS4 A;  1WI5 A;  3NEN A;  2FHT A;  2HDL A;  1NSN S;  4B3M L;  1SE2 A;  3G6J B;  1Z6H A;  1UE6 A;  2EZV A;  2MO1 A;  3PF4 A;  2HHH L;  1HCZ A;  3KOJ A;  1TS3 A;  1HNX Q;  3BS1 A;  4JI0 Q;  4A3K H;  4BBS H;  3S1N H;  4MZ9 A;  2SEB D;  3HG9 A;  4CJ1 B;  1X3P A;  3M7G A;  4JI2 L;  3OSO A;  1L1O B;  4CBV A;  2FFK B;  2DJF C;  2KED A;  3K5L A;  5CV6 A;  4HJA A;  2FJ2 A;  2YTX A;  2JJQ A;  5M9O A;  1XMQ Q;  1BQQ T;  2OWO A;  1EY7 A;  3FMC A;  3KDF A;  5CV8 A;  2IPK D;  2WAC A;  1HFN A;  4A3E B;  4FP5 D;  3J81 c;  3PO3 G;  1IL2 A;  4ZRZ A;  1XPU A;  1YNN C;  4KKS A;  3RZO H;  4DV2 Q;  1M1K C;  3S1Q H;  2H4O A;  1AEX A;  2R92 H;  4F88 A;  3DM1 A;  2YTY A;  4FXG C;  1K83 B;  1RIP A;  5D3D A;  2JE6 I;  3GV3 A;  1CKM A;  1K0R A;  4LAA A;  3I8Z A;  5C6A A;  4Q5V A;  1ILP A;  3I2Z A;  1SMY D;  2N3S A;  5DM7 3;  1Q46 A;  1KNE A;  3HRZ C;  3K8A A;  1ET9 A;  2RCF A;  1LTB D;  2B2W A;  3BVZ A;  3M4Q A;  1ZKO A;  2WB1 E;  5KGU A;  4DN4 M;  1FNW A;  2CWP A;  3V96 A;  2OEO A;  4WRD A;  5NUC A;  2AMC B;  3F2U A;  4DR2 Q;  2JP1 A;  1ESR A;  5I4D A;  5IT9 E;  4UHV A;  1VQM A;  1N33 L;  1JB3 A;  3DWQ A;  4NXM L;  3FDT A;  3J80 L;  1HFG A;  3HGB A;  3MZ5 A;  3TBI B;  1KAA A;  3S24 A;  1KD1 C;  3HOV B;  2JEB I;  3BDO A;  3ICE A;  2RF4 A;  3CW2 C;  1EYA A;  3NBH A;  4JI1 L;  2EYM A;  2SDF A;  1KDB A;  3BU2 A;  4R4O A;  3JAM c;  3R2T A;  1K8M A;  3I3C A;  2JA5 H;  2A6E D;  2F0W A;  3HOX G;  2HQE A;  2V4D A;  4A4I A;  2FMM A;  4DAM A;  4OWT B;  2OF1 A;  3VR4 A;  1A2U A;  2JSO A;  5JVG 3;  3A0J A;  3PUW A;  2EPB A;  5CR3 A;  5FJ8 H;  1RJT A;  4J6H A;  4A3K B;  4BBS B;  3S1N B;  4JOI A;  1GO3 E;  4F87 A;  3NTK A;  1FL0 A;  5C3E H;  4YWM A;  4IUU A;  4K8J A;  1TR5 A;  1XJV A;  1FGB D;  1TQO A;  4ZLT F;  4GKJ Q;  2JQO A;  3KLR A;  4C3H H;  2AQ1 B;  2OT2 A;  4IQZ A;  2NVQ H;  5C0X H;  1A63 A;  2D9U A;  3P7J A;  2K52 A;  4NDX A;  1KIX A;  1SNQ A;  3CC4 A;  1E2W A;  1CKO A;  3RZO B;  3D4W A;  1V8Q A;  4A3D G;  4MIU A;  2XIW A;  3S1Q B;  1TWG B;  2HD3 A;  3STB C;  2YTV A;  2YU9 H;  1O7L A;  3ONA B;  3MA2 B;  1CI3 M;  2UU9 Q;  4X64 Q;  4ULL A;  5E7N A;  2WAQ E;  4WJW A;  5GAG C;  2EXD A;  1GUG A;  5IGF A;  4YY3 L;  1EQR A;  2QA4 A;  2ZXO A;  2J0T D;  1NBW A;  1WOC A;  4FF2 A;  4QIW E;  4HIK A;  5I6W A;  5AJ3 Q;  3OW2 A;  2F3V A;  4XQJ A;  2A6H C;  1Q7Y C;  1WTV A;  2G9D A;  1PTO D;  1UEA B;  1Y14 B;  2MJ8 A;  4UP9 A;  3SR1 A;  5K36 H;  4KLK A;  5IP9 H;  3BVM A;  3F2C A;  2R93 H;  1PVO A;  3J81 E;  1YI2 A;  5BR8 Q;  4IFD J;  3G7L A;  1WCM G;  2X69 A;  3U4Z A;  1EOV A;  4G7Z C;  5EBD A;  2XGT A;  1AP0 A;  4APV A;  3HKZ G;  1RDP D;  1T9H A;  2RHS B;  4MNO A;  2TSS A;  4H02 A;  5ELD A;  4I7Z C;  4C2M H;  1MHW C;  2AQ3 B;  4FF4 A;  4LF7 L;  1QVF A;  5KRU A;  4WFN 3;  2E5L L;  3PUZ A;  1V43 A;  4PMW A;  4JYA Q;  4A3F H;  2JA5 B;  2FIN B;  5FLX E;  4BY7 B;  2EIF A;  4X62 Q;  2ZTD A;  4NMZ A;  3KF6 A;  3G48 A;  2ALY B;  5C5M A;  2UXC Q;  2JA7 H;  1B4O A;  2IJ0 A;  4A3L G;  2BH2 A;  2D2C C;  3EFX D;  4X65 Q;  3MXU A;  4KY6 A;  5C3E B;  3I7F A;  1HUM A;  4DV5 L;  2IY5 B;  2L55 A;  1SYB A;  3TSS A;  4CGY B;  4IN3 A;  5IWA Q;  4C3H B;  4IOC A;  3RD4 A;  3T4A C;  1FJG Q;  1OXX K;  3QWN A;  3JAM E;  1L1O C;  1JE5 A;  3GD7 A;  1K9M C;  1E2V A;  2GA4 B;  3IAY A;  1WTH A;  4OX9 Q;  1TS5 A;  2NVT H;  2K5H A;  3HOZ B;  2OQ0 A;  1KXL A;  1LAC A;  4KN7 C;  4IUR A;  5C3X A;  1PXU A;  2YU9 B;  4Z9C B;  2O5I C;  1IYV A;  3NWT A;  4L5T A;  1CUK A;  4RAU C;  2EY2 A;  2PMZ B;  3QIA A;  1YZ6 A;  2BA1 A;  5C44 B;  5DAU A;  2E2D C;  1MSH A;  3K58 A;  1O7Z A;  2F0N A;  2NN6 H;  1MBY A;  1O78 A;  4BBR G;  4JBK A;  3T1H L;  3R93 A;  1SNC A;  1SEB D;  2PQA B;  5KND A;  1QZH A;  4DUZ L;  2VXW A;  1EYC A;  1HZB A;  2R93 B;  4DV3 L;  1SNM A;  4G57 A;  2F03 A;  5ELB A;  1FR3 A;  1AW7 A;  1YBY A;  3PSI A;  1GUN A;  3S1M H;  1V1P B;  4N9P A;  1NE3 A;  3NP8 A;  1NUC A;  5BN3 A;  2PQE A;  4JI7 L;  3VYT A;  1PYW D;  3CCR A;  1IKM A;  4RG1 A;  4K2L A;  2FMC A;  4PZ6 A;  3CCQ A;  4MTK A;  4OO1 G;  2EY5 A;  4X66 Q;  3T16 A;  4A3F B;  2Z6B A;  1MI2 A;  2K28 A;  2QDB A;  1Y69 U;  4U68 A;  1X3E A;  3H91 A;  1BCP D;  3N6R A;  2JA7 B;  5IT9 L;  4LF8 L;  1RKN A;  1YNJ C;  3QJY A;  1AZP A;  4DR7 Q;  2VY3 A;  1HNW Q;  1QUQ B;  1CA6 A;  1STB A;  1KDC A;  4M1U B;  1PA6 A;  3ZYY X;  2I0Q A;  1I94 Q;  2JA8 G;  1L2F A;  3L3O C;  4POG A;  4DR3 L;  3J7A F;  1EY9 A;  4DXF A;  5IGC A;  1LTT D;  1UWV A;  1TU2 B;  1B9M A;  5JEA G;  4DUY L;  2F0M A;  1HHV A;  4ZUJ A;  2L0C A;  2AWN A;  4EGV A;  4IUN A;  2WFW A;  2NVT B;  5FLM H;  5IGE A;  1ASZ A;  1K28 A;  1EUJ A;  5C4H A;  4MTN A;  2B2U A;  2F4I A;  1WTQ A;  3GP7 A;  5ELE A;  3FKI H;  4JV5 L;  1ONL A;  3D8G A;  5JJI A;  2LY7 A;  4EQO A;  1GUO A;  3OHX C;  3RUZ A;  1CKN A;  1LTG D;  4C3J B;  2Q2T A;  3SE0 A;  1RTO A;  5E4X A;  5D65 A;  2KA7 A;  1X54 A;  5IYB H;  4GNX C;  1CHQ D;  3OPO A;  3K7A H;  4A3M B;  4DNR B;  2K50 A;  1L0W A;  1BNZ A;  1XMO Q;  3NXW A;  4QJF A;  4JVZ A;  1WD0 A;  1KL9 A;  3Q23 A;  5IE8 A;  5IYC H;  3P1H A;  2DY8 A;  3S1M B;  3UDX A;  4HCS A;  2UUC Q;  2HUG A;  2QEJ C;  2F0T A;  4LK1 C;  5M3F G;  4J15 A;  2VS1 A;  3OTO L;  4K5X A;  3V2T A;  4LFB Q;  4AIM A;  4K5V A;  2N55 A;  3J7Z C;  1UE1 A;  4FXD A;  1BVS A;  1JCK B;  4DK3 C;  2SNM A;  4B3R Q;  3HOW H;  4O42 A;  3BZK A;  4B3S Q;  2V1C C;  3UDG A;  4IO9 A;  1ML0 D;  1C4Q A;  1PRT F;  1VQB A;  3VA7 A;  4B3M Q;  1K73 C;  2GVA A;  1SRO A;  4YWK A;  1ZYR D;  3VR6 A;  5IP7 H;  4HN7 A;  1ICF B;  3H09 A;  4NW2 A;  4C1N K;  2Q8I B;  1KAW A;  4QY7 A;  2B29 A;  1I6H B;  3J81 L;  5FO7 B;  1R9T H;  3PIO 3;  3MXN B;  3QB3 A;  1T5X D;  3DWA A;  3HKS A;  1NMF A;  3R3O A;  4K5W A;  2ICI A;  4JI2 Q;  4UP7 A;  1Y1V B;  1U4R A;  4KV6 A;  2UXD L;  2K5W A;  1MD2 D;  4HMI A;  4JI4 L;  1PRT B;  4BBS G;  3E0J A;  1QOH A;  1MJC A;  1EYD A;  3E5S A;  1A8V A;  1ENC A;  1TT2 A;  3GTP H;  1ASY A;  1IZ6 A;  3N52 A;  1HXY D;  3H0G H;  3UE0 A;  5FLX L;  2L4N A;  4OL7 A;  4DV1 L;  1NR2 A;  2B3G A;  1SE8 A;  2B63 H;  4HCE A;  3BZC A;  4IOA A;  2VUM H;  4GNX A;  1AE2 A;  1E22 A;  1TXY A;  1SMX A;  5CV7 A;  1PH2 A;  4I7A A;  1B2T A;  1X32 A;  3CC7 A;  4LJZ C;  1D5X C;  4JBM A;  3H3V H;  4DV4 L;  4H44 C;  2PPB C;  1I6V C;  1M8A A;  1TWA H;  4POF A;  2R92 G;  1N36 L;  2JA6 H;  3GTM H;  3G71 A;  2B2Y A;  4KD4 A;  1ROD A;  2VNU D;  1WYD A;  2CVR A;  3JAM L;  1Z9F A;  3CCL A;  4N8X 1;  2Q2H A;  1N34 Q;  1N33 Q;  1U9R A;  3Q8D A;  1DOM A;  4NXM Q;  3CCU A;  4LF9 L;  3AFQ A;  1B3A A;  4DK0 A;  5IGG A;  1B7Y B;  1F2L A;  1H9R A;  1PH9 A;  4NB3 A;  4A93 G;  2IWH A;  3H15 A;  1Y1W G;  2PI2 A;  5G3L F;  1NY4 A;  4DR6 L;  4JI1 Q;  2AQ2 B;  4KHV A;  2EYP A;  1RHP A;  1VMP A;  3A8J E;  3DWP A;  3HOW B;  2Q8T A; 
#chains in the Genus database with same CATH homology
 1HUN A;  4RGT A;  5AFW A;  4ODG A;  2B39 A;  5JVH 3;  1F9R A;  1T5E A;  1R9T B;  1ILQ A;  3OOC A;  1XXG A;  2LS0 1;  5CBA E;  1F2M A;  1UNS A;  4A3G B;  2Y0S B;  2JXM B;  1EQT A;  1TVX A;  3R8B A;  3K5N A;  1SYC A;  4J8Q A;  1PTO F;  4HAE A;  2BCO A;  2PW5 A;  2Z4H A;  5FKA C;  1LT6 D;  4CKE A;  2F0U A;  4ABN A;  5CC4 A;  3H0G B;  2PO4 A;  1EFI D;  2EYH A;  4GZY C;  2B63 B;  4C3H G;  2XN9 C;  5CV4 A;  2MPM A;  5KEE A;  1Q90 A;  2E74 C;  5C0X G;  2VUM B;  3CQZ B;  3HS0 C;  3GTK B;  3OWF A;  1PTO B;  1CFM A;  2N88 A;  1DOK A;  3PO2 B;  2B2V A;  2K6A A;  1STN A;  5I6Y A;  3T56 B;  1TWA B;  4F7X A;  2JA6 B;  1LV9 A;  4H7B A;  1CK1 A;  4J1M A;  4OGQ C;  2WKC A;  2A68 C;  2BE5 C;  1RTN A;  3VA5 A;  1QNK A;  2F0Q A;  5K36 G;  2RDF A;  2RVL A;  2RA4 A;  1CZG A;  2WAQ B;  3TP7 A;  4E6I A;  1B1Z A;  1CZW A;  4CHT B;  4QIW B;  2A74 C;  1CTM A;  5C4X B;  3KBG A;  2QF7 A;  1Q12 A;  1HTL D;  1S4Z A;  1YNN D;  2L9H A;  4S3S A;  4DAY A;  1WTP A;  2CQA A;  1EL0 A;  3M85 A;  1SYD A;  4WOR A;  3EVQ A;  4NP5 A;  4XYQ A;  4BA1 I;  1L0Y B;  2EE1 A;  4IUT A;  4DAP A;  4EVO A;  2VB3 X;  4KJN A;  3D4R A;  1IKL A;  5CBE E;  3T13 A;  1QJO A;  4A3I B;  1TWC B;  2G9H D;  3OWE B;  1PRT C;  5DNF A;  1BO0 A;  4DNT B;  1SSO A;  3A55 A;  2F0O A;  5J22 A;  1F77 A;  1S5F D;  5COR A;  1EOT A;  1D5Z C;  2E76 C;  2NTT A;  4RH6 A;  4FNF A;  1A3T A;  1NR4 A;  1AN8 A;  3I91 A;  1ICW A;  2VB2 X;  2F0L A;  4UAI A;  3V05 A;  5C5L A;  3H94 A;  2J4X A;  4L8J A;  2A69 C;  3A54 A;  3S14 B;  1TWH B;  1PMR A;  1BCP F;  1DD2 A;  2NN6 G;  5TSS A;  2E2J B;  1OXS C;  2JEA I;  3M7N A;  4ZQ3 A;  2X6G A;  3GTG B;  1ESF A;  2YYZ A;  4ILW A;  1TY0 A;  3EA6 A;  2F0J A;  2KEC A;  2XSC A;  2M2L A;  5KIX A;  4IZ8 A;  1BCP B;  2F1M A;  4DFA A;  1D1I A;  1EZ6 A;  5COY A;  1FYC A;  4BY1 B;  1Z7T A;  3I73 A;  1CT1 D;  3D6W A;  3S17 B;  4RHS A;  3WOE A;  3C2P A;  1XWE A;  3TP6 A;  1DCZ A;  3GV6 A;  1EY5 A;  3BZD B;  2PNR C;  5JEA J;  5T1I A;  2F0E A;  3PUY A;  1CM9 A;  1JOK A;  4CJ2 C;  4M8A A;  1I3Q B;  2DN8 A;  1ZEQ X;  1HQR D;  1C48 A;  1DM0 B;  4PNY A;  5J1Z A;  2R6G A;  1WTX A;  4KJO A;  1I50 B;  1I4Q A;  4KY7 A;  1G2T A;  1KLU D;  3D4D A;  2K32 A;  2WKD A;  5D14 A;  3IKJ A;  2B2T C;  3C1F A;  2F0P A;  4ME5 A;  5A2Q E;  4YIJ A;  4U67 3;  5EPJ A;  4XXE A;  1SDF A;  4R9W A;  4R8N A;  1D6E C;  3H3V C;  1U4P A;  4HTH A;  4B9W A;  3DXJ C;  4DU9 A;  3TP8 A;  3NUC A;  3K5M A;  1XYI A;  3OW7 A;  3DHQ A;  2F0H A;  1WTO A;  3Q24 A;  2CW0 C;  2QCP X;  1LTS D;  2BDN A;  2D62 A;  2IX0 A;  3GTJ B;  3S2H B;  3HOU B;  5BN4 A;  4BS9 A;  1KNA A;  5ELF A;  4FF1 A;  1H9S A;  2EDG A;  1W6J A;  1K8O A;  3VR2 A;  5T1G A;  1G8Z D;  1GJX A;  4KY5 A;  2PZU A;  1HQM C;  1IHZ A;  1Q8I A;  5I9P A;  3I4M B;  1RCV D;  2F0I A;  4KKT A;  3KLS X;  5EKK A;  5KYI A;  1EZ8 A;  1SNO A;  2PYK A;  4K6D A;  4HSV A;  2B2T A;  1E0B A;  1EU4 A;  4KTA A;  1JQY D;  4F8M A;  3T53 B;  1CQV A;  4XDX A;  2I07 B;  5I9O A;  3D3R A;  3IL8 A;  1GHJ A;  1I4P A;  3S15 B;  3P20 A;  3AMU A;  4X3K A;  3KUP A;  4X3S A;  2HCC A;  2JYO A;  2DNC A;  1B53 A;  5DEH A;  5IOC A;  1WVL A;  3L9A X;  1IW7 C;  3VR3 A;  2A5H A;  1YNJ D;  5CGK A;  2F0K A;  2HCI A;  4H13 C;  4QF4 A;  4JK1 C;  1JOR A;  5D3I B;  3S9W A;  2DY7 A;  1F2Z A;  3HZX A;  2NN6 I;  1A2T A;  1CHP D;  1B9N A;  3VYS A;  3VYU A;  1VCI A;  3AU7 A;  5FK9 C;  2I46 A;  3EJI A;  2EJM A;  4QUF A;  2RDH A;  1I4R A;  3BDC A;  1JOQ A;  3T51 B;  1JC7 A;  3D6C A;  2R61 A;  1EY6 A;  1H9M A;  2WV6 D;  5ISR A;  3Q6S A;  2BA0 A;  1EY4 A;  1S5E D;  2K1B A;  2PZW A;  1QNU A;  1SYG A;  1A3U A;  3NE5 B;  3GQB A;  1A15 A;  5C0X J;  2NTS A;  3VYR A;  1KAB A;  1EU3 A;  1A6X A;  1B44 D;  4QUC A;  4FVM A;  4Q0F A;  2ICE C;  4PMB A;  2E75 C;  1GUS A;  3M4O B;  4A3J B;  1BDO A;  5FO9 B;  2EJF C;  5IGD A;  3W3A A;  4TRD A;  2EYO A;  1XTC D;  1E2Z A;  3FEW X;  5M5X B;  4K8I A;  1SE3 A;  3E6Z X;  2NVX B;  4XIG S;  1PZI D;  2ENB A;  4ZK9 B;  1DZ1 A;  3SK4 A;  5FO8 B;  5HUR A;  3U9S A;  2EYJ A;  4L63 B;  4A3D B;  2EOT A;  5A2Q L;  3DMU A;  2L11 A;  4NKL A;  3K0Y A;  4DXG A;  2NB0 A;  3FPU B;  3LX0 A;  3KK7 A;  2C9O A;  2RQX A;  4PMC A;  4V0B A;  1U4M A;  1PTO H;  3MWY W;  2KUM A;  3HP3 A;  4QB4 A;  4LMQ D;  1TII D;  1WCM B;  2M9V A;  2PW7 A;  2Q8R E;  4EQP A;  2HDM A;  1JWU D;  4H0L C;  3GTQ B;  1VF5 C;  3HKZ B;  3W2D A;  1G2S A;  2SNS A;  5KNB A;  2Z1C A;  1SBB B;  1BUV T;  4C3I B;  3MXG A;  3J7A V;  3R2I A;  4QCL A;  4IUQ A;  3URY A;  1AFP A;  1Q3L A;  1HRJ A;  1QWY A;  1STA A;  4RCN A;  2K01 A;  1TY2 A;  1OO9 B;  1TWF B;  3CRK C;  3DEP A;  3QG1 A;  2WB1 B;  2RDG A;  3IFD A;  1Y8N B;  4OO1 I;  4RKL A;  1VDZ A;  2IX1 A;  1DYQ A;  4DA2 A;  1QG7 A;  1C8C A;  5CV9 A;  1LAB A;  1G91 A;  5M5W B;  1J9O A;  1EWH A;  4R8I A;  5EGT A;  3PUV A;  3K57 A;  5JPN C;  5JOB A;  4IFD H;  1G6Z A;  1S5B D;  3NTH A;  2KVM A;  1EY8 A;  2KCC A;  2KJX A;  1KTK A;  2EYF A;  3A8I E;  2WII B;  3DUZ A;  3NBI A;  4BA2 I;  2LKV A;  1JWS D;  3NTI A;  2A68 D;  3MVV A;  2BE5 D;  5CV5 A;  4CKB A;  4KK7 A;  1U4L A;  4K14 A;  1JIC A;  4MHE A;  1SXT A;  5E3F A;  2EY6 A;  1V1P A;  2B2W C;  3I4N B;  4CJ0 B;  1L0X B;  2ZXP A;  1Q1B A;  4K6L A;  4ZAI A;  3J7Y W;  1NCV A;  3BG3 A;  3OIQ A;  3BDL A;  1GUW A;  2XRS D;  4RWS C;  3MC0 B;  2RSO A;  4TQU S;  2JA8 B;  1WD1 A;  5EKL A;  2RBM A;  3LWU A;  5KNC A;  5IOD A;  4RCO A;  3WDN A;  2BOS A;  4KKU A;  1SNP A;  1PRT D;  3NQI A;  3I4L A;  3SEB A;  1CA5 A;  4ZUI A;  3ND8 A;  4FF3 A;  3OMC A;  2AWO A;  3Q0A A;  4L6T B;  1X3Q A;  1DJR D;  4KI0 A;  1M4V A;  1BOS A;  1LTR D;  3Q22 A;  3FRP B;  3CU7 A;  1JE4 A;  4A3B B;  2QKI C;  2A69 D;  5LL6 S;  3MFG A;  3SXH A;  1SMY C;  5M3F B;  4DF7 A;  4C3J G;  2B8F A;  2KCN A;  2PCF B;  2NYZ D;  1DOL A;  1OXU A;  3HEJ A;  2O4X A;  1CQF A;  2IL8 A;  1O80 A;  3A56 A;  1VF7 A;  2R7Z B;  1WTR A;  1LT3 D;  5C4J B;  3U9O A;  3I72 A;  5C4Z A;  1Y8P B;  5C3W A;  1DXM A;  4PQX A;  3TZD A;  2L12 A;  4PV1 C;  5M5Y B;  2XNA C;  2A6E C;  2E2H B;  3MXN A;  1A3V A;  2K05 A;  1KDA A;  1UAP A;  3PIP 3;  1HTP A;  3S2D B;  3FVQ A;  5G3L D;  3K59 A;  1GXD C;  2A6H D;  4BWG B;  3K5O A;  1QIL A;  2KQ3 A;  1Z47 A;  1O7Y A;  2F3W A;  2O5J C;  1SYF A;  2DNE A;  1FNV A;  2ZXR A;  5BN5 A;  3GTO B;  4ID6 A;  1QCB D;  1BR9 A;  1WTW A;  3SK6 A;  2R92 B;  2EJG C;  5M3M B;  1LLR D;  2MP1 A;  1F2Y A;  3C1E A;  1PZJ D;  4XYO A;  1HA5 A;  1PFM A;  2IX3 A;  1V1O A;  4RA8 A;  2IT1 A;  1GOZ A;  2NUC A;  3HOY B;  3TZU A;  4OHJ A;  1STY A;  5C0X I;  4A93 B;  2KOL A;  3P75 A;  1Y1W B;  1PTO C;  1SJH D;  1EIH A;  1STH A;  3RZD B;  2F0F A;  2CW0 D;  2X6L A;  3TDQ A;  3GO5 A;  4C3I G;  3KBX A;  4K2K A;  4RGN A;  3DEO A;  4OIJ A;  2EYL A;  1GHK A;  1TS2 A;  2F0G A;  5LHY 1;  1H9K A;  3D31 A;  2K33 A;  1RF2 D;  2TMP A;  3FPP A;  2Z4I A;  4B08 A;  5EQ0 A;  4RGM A;  3A7A B;  3I70 A;  3PMF A;  3TN2 A;  2NVQ B;  2E2I B;  5EBC A;  3SK8 A;  1G29 1;  4KHZ A;  4TKO B;  2M00 A;  2PZT A;  3UI2 A;  2D5D A;  2K04 A;  2K03 A;  5DM6 3;  3LWE A;  1VMC A;  2NZ1 D;  1F9Q A;  2WP8 J;  1FD7 D;  3GTL B;  2AUK A;  3NPP A;  2LMC B;  2B2U C;  1F9S A;  1IW7 D;  2F0D A;  4C56 C;  5ELC A;  3S1R B;  5I2X A;  4IUP A;  3MHB A;  1JR0 D;  3LNN A;  4XQN A;  1D2B A;  4KN4 C;  2RKS A;  3TME A;  4O1N A;  5IGB A;  2BDO A;  4JBW A;  4C2M B;  4QMG A;  3PO3 B;  3WOF A;  1ENA A;  3ND9 A;  2XRQ D;  1I4X A;  1PFN A;  3M4Y A;  5JPM C;  2AUJ D;  2K7V A;  3NSW A;  5JAV A;  4C1N I;  3ERO A;  5CMD A;  2MGS A;  1ET6 A;  2QIL A;  2EY1 A;  3OIP A;  4AYB B;  1MGS A;  3BYY B;  1QE6 A;  3KLS A;  1BCP C;  5CYU A;  5EKI A;  1XX8 A;  4RKB A;  2EVB A;  3PV0 A;  1EQV A;  1TKW B;  1MSG A;  3O13 A;  2ZT9 C;  1RD9 D;  3CKI B;  1EEF D;  5I2Y A;  3X3M A;  1OXT A;  2K5D A;  4IFD G;  1S5C D;  3BVG A;  4P2C B;  4V19 0;  3MTS A;  3HOX B;  2OXP A;  1W6K A;  3A7L A;  1OXV A;  3CRL C;  5J39 A;  4FYD A;  2Z8L A;  3IFT A;  4RGO S;  1II3 A;  2NWG A;  3X3N A;  3H6M A;  3A8K E;  3ITP A;  5HGT A;  1HPC A;  1ENF A;  1SAP A;  4HSP A;  4UDU C;  2SOB A;  2B2Y C;  4XT3 B;  3NWS A;  4X3T A;  1BF4 A;  3ERQ A;  2K5Q A;  4RFB A;  1EEI D;  4G4K A;  4IAL A;  3K6O A;  4HMJ A;  2A73 B;  4B9X A;  1R4Q B;  4G7O C;  3NK9 A;  1DON A;  1I4H A;  1EWC A;  1QB5 D;  1EY0 A;  1ZYR C;  3EQL C;  3SDZ A;  1LTA D;  3NHH A;  2NVY B;  3J80 E;  5IIF A;  1HA6 A;  4Y7N B;  3I90 A;  2F0V A;  5EPK A;  1F9P A;  1B50 A;  4DAV A;  3C3L A;  1UUP A;  2RSN A;  5KYL A;  1ZXT A;  1KLG D;  2WIN B;  3SHL A;  4HED A;  4DK1 A;  4KD3 A;  2F0S A;  5FOB B;  3VR5 A;  4EQN A;  1EIG A;  4I65 A;  2C5C A;  4OO1 H;  3FKI B;  2LFN A;  1J8I A;  1H9J A;  1S5D D;  4N9T A;  3MEH A;  1BBX C;  2IW3 A;  2O2L D;  1LO5 D;  4FO2 A;  4OIK A;  3MFY A;  1D1K A;  1STE A;  3S16 B;  3BYT B;  3SVM A;  1IYU A;  5E4W C;  3K7A B;  2H1E A;  2CHB D;  4ZYS A;  1R4P B;  2B2V C;  3MAQ A;  1FNU A;  4FXK C;  4IUV A;  2KEE A;  1LT5 D;  1LT4 D;  2L1B A;  1JOO A;  3OMG A;  4MN3 A;  1SFO B;  2MHV A;  1BXT A;  4ZKB B;  1JWM D;  5JEA H;  5LL6 X;  2XWB B;  5E1F A;  1PLF A;  2XVS A;  5F2D A;  5EJW A;  3NQT A;  1PZK D;  1Q1E A;  3PUX A;  3TP5 A;  1H9S B;  4CKC A;  2L5T A;  4XT1 B;  1PFB A;  2EXZ A;  1GUT A;  1I4G A;  1Y8O B;  3RLF A;  1SYE A;  4TSS A;  4G7H C;  4BBR B;  3AB9 A;  3MXP A;  4HR7 B;  3GTP B;  3KF8 A;  4RHR A;  1SJE D;  4XQQ A;  5K5P A;  1IL8 A;  1STG A;  5A35 A;  1NAP A;  2XWJ B;  3C46 A;  3QOL A;  5EPL A;  1D5M C;  1SND A;  4KMU C;  3RMH A;  3CHB D;  1PDQ A;  2KHS A;  4X3U A;  4ZKC B;  3L7Z C;  3QO2 A;  4XTC S;  4DGZ A;  5JJZ A;  1SE4 A;  2R3Z A;  2ID0 A;  2MUY A;  3QOJ A;  2J7Z A;  3GTM B;  2B8G A;  2NBF A;  4IFD I;  3M3Y B;  1LTI D;  3SK5 A;  1AZQ A;  1TS4 A;  2FHT A;  2HDL A;  1NSN S;  1SE2 A;  3G6J B;  1Z6H A;  2EZV A;  1HCZ A;  1TS3 A;  3BS1 A;  2SEB D;  3HG9 A;  4CJ1 B;  1X3P A;  3M7G A;  3OSO A;  4CBV A;  2FFK B;  2KED A;  3K5L A;  5CV6 A;  2FJ2 A;  5M9O A;  1BQQ T;  1EY7 A;  3FMC A;  5CV8 A;  1HFN A;  2IPK D;  2WAC A;  4A3E B;  4FP5 D;  4ZRZ A;  1YNN C;  4KKS A;  2H4O A;  1AEX A;  4F88 A;  3DM1 A;  4FXG C;  1K83 B;  5D3D A;  2JE6 I;  3GV3 A;  4LAA A;  3I8Z A;  5C6A A;  4Q5V A;  1ILP A;  1SMY D;  5DM7 3;  3HRZ C;  1KNE A;  1ET9 A;  1LTB D;  2B2W A;  3BVZ A;  1ZKO A;  5KGU A;  4DN4 M;  1FNW A;  3V96 A;  2OEO A;  4WRD A;  5NUC A;  3F2U A;  2JP1 A;  1ESR A;  5I4D A;  5IT9 E;  1JB3 A;  3DWQ A;  3FDT A;  3J80 L;  1HFG A;  3HGB A;  3MZ5 A;  3TBI B;  1KAA A;  3HOV B;  2JEB I;  3BDO A;  1EYA A;  3NBH A;  2EYM A;  2SDF A;  1KDB A;  3R2T A;  1K8M A;  3I3C A;  2A6E D;  2F0W A;  2HQE A;  2V4D A;  2FMM A;  2OF1 A;  3VR4 A;  1A2U A;  2JSO A;  5JVG 3;  3PUW A;  2EPB A;  5CR3 A;  1RJT A;  4J6H A;  4A3K B;  4BBS B;  3S1N B;  4F87 A;  3NTK A;  4IUU A;  4K8J A;  1TR5 A;  1FGB D;  1TQO A;  4ZLT F;  3KLR A;  2AQ1 B;  2OT2 A;  4IQZ A;  5C0X H;  2D9U A;  3P7J A;  4NDX A;  1SNQ A;  1E2W A;  3RZO B;  3D4W A;  1V8Q A;  4MIU A;  2XIW A;  3S1Q B;  1TWG B;  1O7L A;  3ONA B;  3MA2 B;  1CI3 M;  4ULL A;  4WJW A;  1GUG A;  5IGF A;  2ZXO A;  2J0T D;  4FF2 A;  5I6W A;  2F3V A;  4XQJ A;  2A6H C;  1WTV A;  2G9D A;  1PTO D;  1UEA B;  2MJ8 A;  3SR1 A;  5K36 H;  3BVM A;  3J81 E;  4IFD J;  3G7L A;  2X69 A;  4G7Z C;  5EBD A;  1AP0 A;  1RDP D;  2TSS A;  5ELD A;  4I7Z C;  2AQ3 B;  4FF4 A;  5KRU A;  4WFN 3;  3PUZ A;  1V43 A;  4PMW A;  2JA5 B;  2FIN B;  5FLX E;  4BY7 B;  4NMZ A;  5C5M A;  1B4O A;  2IJ0 A;  2D2C C;  3EFX D;  3MXU A;  4KY6 A;  5C3E B;  1HUM A;  2L55 A;  1SYB A;  3TSS A;  4CGY B;  4IN3 A;  4C3H B;  3RD4 A;  3T4A C;  1OXX K;  3QWN A;  3JAM E;  3GD7 A;  1E2V A;  2GA4 B;  3IAY A;  1TS5 A;  3HOZ B;  1LAC A;  4KN7 C;  4IUR A;  5C3X A;  1PXU A;  2YU9 B;  4Z9C B;  2O5I C;  1IYV A;  3NWT A;  4RAU C;  2EY2 A;  2PMZ B;  3QIA A;  2BA1 A;  5C44 B;  5DAU A;  2E2D C;  1MSH A;  3K58 A;  1O7Z A;  2F0N A;  2NN6 H;  1MBY A;  1O78 A;  3R93 A;  1SNC A;  1SEB D;  5KND A;  2VXW A;  1EYC A;  2R93 B;  1SNM A;  4G57 A;  2F03 A;  5ELB A;  1FR3 A;  1AW7 A;  1GUN A;  1V1P B;  4N9P A;  3NP8 A;  1NUC A;  5BN3 A;  2PQE A;  3VYT A;  1PYW D;  1IKM A;  4K2L A;  2FMC A;  4OO1 G;  2EY5 A;  3T16 A;  4A3F B;  1MI2 A;  2K28 A;  2QDB A;  1Y69 U;  4U68 A;  3H91 A;  3N6R A;  1BCP D;  2JA7 B;  5IT9 L;  1RKN A;  1YNJ C;  3QJY A;  1AZP A;  1CA6 A;  1STB A;  1KDC A;  4M1U B;  3ZYY X;  3L3O C;  3J7A F;  1EY9 A;  4DXF A;  5IGC A;  1LTT D;  1TU2 B;  1B9M A;  5JEA G;  2F0M A;  1HHV A;  4ZUJ A;  2L0C A;  2AWN A;  4EGV A;  4IUN A;  2NVT B;  5IGE A;  5C4H A;  2B2U A;  2F4I A;  1WTQ A;  3GP7 A;  5ELE A;  1ONL A;  3D8G A;  2LY7 A;  4EQO A;  1GUO A;  3OHX C;  3RUZ A;  1LTG D;  4C3J B;  3SE0 A;  1RTO A;  5E4X A;  5D65 A;  2KA7 A;  1CHQ D;  3OPO A;  4A3M B;  4DNR B;  1BNZ A;  3NXW A;  1WD0 A;  3Q23 A;  3P1H A;  2DY8 A;  3S1M B;  4HCS A;  2HUG A;  2QEJ C;  2F0T A;  4LK1 C;  4K5X A;  3V2T A;  4K5V A;  2N55 A;  4FXD A;  1JCK B;  2SNM A;  4O42 A;  1ML0 D;  1C4Q A;  1PRT F;  3VA7 A;  1ZYR D;  3VR6 A;  4HN7 A;  3H09 A;  4NW2 A;  4C1N K;  2Q8I B;  1I6H B;  3J81 L;  5FO7 B;  3PIO 3;  3QB3 A;  1T5X D;  3DWA A;  3R3O A;  4K5W A;  2ICI A;  1Y1V B;  1U4R A;  4KV6 A;  2K5W A;  1MD2 D;  4HMI A;  1PRT B;  3E0J A;  1QOH A;  1EYD A;  3E5S A;  1ENC A;  1TT2 A;  3N52 A;  1HXY D;  5FLX L;  2L4N A;  4OL7 A;  1NR2 A;  4HCE A;  5CV7 A;  1B2T A;  1X32 A;  4LJZ C;  1D5X C;  4H44 C;  2PPB C;  1I6V C;  1M8A A;  2B2Y A;  4KD4 A;  1ROD A;  2VNU D;  2CVR A;  3JAM L;  1U9R A;  1DOM A;  1B3A A;  4DK0 A;  5IGG A;  1F2L A;  1H9R A;  2IWH A;  5G3L F;  2AQ2 B;  4KHV A;  2EYP A;  1RHP A;  1VMP A;  3A8J E;  3DWP A;  3HOW B;  2Q8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...