4F8MA

Crystal structure of staphylococcal nuclease variant delta+phs v23i/i92v at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTIKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4f8mA00
3VA5A 3QOJA 3BDLA 4NP5A 2EYLA 2F0JA 3E5SA 2PYKA 2RBMA 3OMGA 3QB3A 4K2KA 3MVVA 4HTHA 4OL7A 4WORA 3SXHA 1IHZA 1F2ZA 1II3A 1KABA 1SNDA 4LAAA 3MXPA 2F0EA 3T16A 5C6AA 4KV6A 2ENBA 5CV7A 5IGFA 5J22A 4K5XA 2EY1A 3U9OA 5CV9A 4NDXA 5KGUA 3NXWA 4S3SA 4J6HA 4K14A 1EQVA 1U9RA 3SK4A 3T13A 4KY6A 4DF7A 5HGTA 2F0WA 1A3TA 3MZ5A 4PMBA 5EKKA 4RKBA 5IGCA 5KYLA 4PNYA 2EY5A 2F0LA 2F0TA 3C1EA 3S9WA 3P75A 4HMJA 2F0FA 1EZ8A 4HMIA 4KJNA 3SR1A 5IGBA 5KRUA 4E6IA 4RKLA 4K6DA 1EYAA 1A2UA 2EY6A 3D6CA 1A2TA 1EY5A 3EJIA 1KDAA 2EY2A 3P1HA 2F0DA 2O4XA 3HZXA 4NMZA 2F0PA 2KQ3A 3ITPA 1A3VA 3D8GA 3RUZA 4F7XA 1EYDA 2F0NA 2F0IA 2F0SA 2PZWA 3BDCA 3LX0A 5KYIA 3DHQA 5IGGA 5KEEA 4IZ8A 3NK9A 1STHA 4H7BA 5I9PA 5J1ZA 5KIXA 2OXPA 1EY8A 4WRDA 5CV4A 1ENCA 4ME5A 2KHSA 1JORA 2SOBA 3NQTA 2OF1A 2SNSA 4ZUIA 1EY7A 2HQEA 2EYOA 3NP8A 4KTAA 4EQNA 1ENAA 5C5MA 3ERQA 1JOOA 4KHVA 4R8NA 4K8IA 4ZQ3A 5HURA 5K5PA 4KD3A 1SYGA 2RKSA 3OSOA 5F2DA 3TP8A 3SK8A 5C4ZA 5C3WA 4YIJA 3OWFA 2RDFA 1F2MA 4ODGA 3HEJA 5IOCA 4QF4A 4N9TA 4NKLA 4EVOA 4ZUJA 3DMUA 1SYDA 5I9OA 4F8MA 3C1FA 4K8JA 5CGKA 2NUCA 2SNMA 3SK6A 4QB4A 2PW5A 4KJOA 1NSNS 5NUCA 1SYBA 3D4WA 5C5LA 1STAA 2F0UA 1SNMA 3D4DA 3NHHA 2EYJA 2EXZA 2F0OA 5DAUA 2QDBA 4PMCA 4KD4A 4N9PA 1A3UA 1RKNA 2F0VA 1SYCA 1EZ6A 1TR5A 2LKVA 4ID6A 4IALA 4J1MA 5DEHA 4DFAA 1SNQA 5C3XA 5CC4A 1JOQA 4DU9A 5M9OA 4K2LA 3H6MA 4QMGA 1F2YA 2OEOA 1STBA 3SK5A 3MEHA 4G57A 3SHLA 3NUCA 3QOLA 1KAAA 4MIUA 4B9WA 5CR3A 1SNOA 5ISRA 4KY7A 5CV5A 3R3OA 5CV6A 4EQPA 3TMEA 1EY4A 2EYHA 3TP5A 2EYPA 2PZUA 5EKLA 5IGDA 5IGEA 3OMCA 2PZTA 3EROA 1SYEA 5E3FA 1TT2A 5J39A 4K5VA 3TP6A 3MHBA 4I65A 1TQOA 1EY0A 3PMFA 3TP7A 5JAVA 3V2TA 1KDBA 1STYA 3EVQA 4B9XA 4DGZA 5IODA 1SNPA 2EYMA 5EGTA 1STGA 1NUCA 2F0MA 5I6WA 2M00A 1EYCA 1SNCA 1AEXA 2F3WA 4IUNA 2WACA 5IIFA 1STNA 2PW7A 2F0HA 5E1FA 2EYFA 5C4HA 1JOKA 1KDCA 2F3VA 4TRDA 5CV8A 5I6YA 4KY5A 4EQOA 5JOBA 2PQEA 1EY9A 4K5WA 1SYFA 2F0GA 2F0KA 2F0QA 1EY6A
chains in the Genus database with same CATH superfamily
1I4GA 1RCVD 4JV5L 4JW0A 3FKIH 4BBRG 1Z6HA 3Q23A 3H94A 1CA5A 1CUKA 2XGTA 2EIFA 4A76A 5E4WC 3J81i 4B08A 4C3HH 2ES2A 2EY1A 2IX0A 3NXWA 4RAUC 4S3SA 3X3MA 5JJIA 2LXKA 2RHSB 4YCWA 2EY6A 4LW1A 2EE1A 4DR2L 1A63A 3A5ZB 4IPHA 3BDCA 2ATWA 3CHBD 1N36L 2NTSA 1JJ2A 4C3JH 1STHA 4R8IA 1WTHA 4A3KB 4FXGC 2UXBQ 3RD4A 1VQ9A 1CT1D 1HTLD 2HQEA 1A15A 3NPPA 1VQCA 4HJAA 4BBSB 4KHVA 2ZM6Q 3TP8A 3HKSA 1FD7D 1H9SB 1S3OA 1GOZA 1H9RA 4IJLA 1V1PB 2EDGA 1HUMA 3RLNA 1DOLA 1UWVA 1JICA 2N55A 5DNFA 5CBAE 5M3FG 1SFOH 1SYDA 5D14A 1W2BA 1Q81C 3QR8A 4G4KA 1WOCA 1DXMA 3KDFB 5NUCA 2M2LA 1CI3M 2A6EC 4TKOB 2A68D 2K5WA 4O42A 4CJ2C 5JPMC 4BA1I 4R4CA 4DFAA 3CRLC 1CKOA 4RGMA 1JJCB 1SLJA 2RSOA 4IUPA 4Q5VA 1J5EL 1K3RA 2RA4A 1E2VA 3EN2A 5KNDA 1XMOQ 3BVGA 1EOVA 3K7UC 2G9HD 4PZ6A 1JMCA 1SYEA 2YTVA 3H3VI 4K5VA 3PUZA 3L3OC 4NW2A 3MXNA 2F3IA 4RMFA 1N32Q 1BCPF 1TS2A 1S5DD 2HUGA 4B3ML 4LJZC 3J7YW 1PRTF 2M00A 1Q3LA 4HIMA 3VYTA 1X56A 1YNXA 4C3JB 3WOFA 1XPUA 3QG1A 3GDEA 1FYCA 1EY9A 1O7LA 4K5WA 1EQRA 3DXJC 4A3BH 4I7ZC 4NKLA 3M7GA 4KKUA 2GVBA 3AMUA 4IFDH 2EYLA 3E5SA 4IPCA 2UU9Q 1ZEQX 1Q12A 5LHY1 5FJ8G 3K57A 5JVH3 1QZGA 1PTOF 2J0TD 1TWFH 1MD2D 4OWXB 2WP8J 2E2IH 1LTGD 4X3SA 2ZJQA 4GNXB 1AE3A 2IW3A 3VR6A 1KLUD 1Y14B 4HCSA 1I94Q 2F0TA 1HCZA 2L0CA 2LXJA 3K5NA 2ZJRA 3TRZA 1GUWA 3EJIA 5C3EB 1F9QA 1BDOA 2KQ3A 3PQIA 1IKLA 4H7BA 4R4QA 1I6VC 5H1SE 2XN9C 4AH6A 5ELOA 1P16A 1F9RA 3ND8A 1NAPA 3EIVA 3KDFA 3DUZA 1N34L 3C46A 3CCMA 5C5MA 1PYBA 1N33Q 4ZQ3A 1PH1A 2YTYA 5K5PA 1B7YB 5C4ZA 2VS1A 4XQQA 1J8IA 1HTPA 2PMZB 2RDFA 4Y52H 4HJ7A 2X69A 3I3CA 4HIOA 2VZAA 3M3YH 1WCMG 1S4ZA 4OWWB 3JC66 1SXTA 4JVZA 2NZ1D 4KD4A 2XIWA 2R3ZA 1HJPA 5C4JH 4J1MA 1VQAA 1SNQA 3MA2B 2UUBL 4RGOS 1N8RC 2OQKA 4KLKA 3QOLA 5ISRA 2UXCL 3F1ZA 3HRZC 1EY4A 3PO3H 2E2IB 2LMCB 1SMYC 4ZYSA 5CORA 3EBEA 5C44H 1SE2A 5JJLA 3S1MH 1IL2A 1KDBA 3CP0A 1V1QA 1Y1WG 1K0SA 3J80c 3L9AX 4FP5D 1KNAA 1AEXA 3NTIA 1GUGA 1HNWL 4TVAB 2F0HA 2NVQB 4C3IG 5AJ3Q 4DXGA 1PDQA 3GTKB 5DM63 3Q0AA 1UE6A 4GNXA 4CGYB 1FJGL 1KXLA 1BKBA 4LF7L 4OWTB 4WORA 5FLMH 3H3VH 3BG3A 5C6AA 5J22A 4FO2A 1QNUA 3EFXD 2ZXRA 4A3MH 3I55A 4A3FB 1K28A 2K5QA 1EOTA 4DK1A 4AQYL 3K5LA 1HNZL 4L5SA 4CDEC 3S9WA 4KJNA 4HMJA 1VCIA 3D31A 4E6IA 4RKLA 1FR3A 1A2TA 3J80L 1JC7A 1D7QA 3ZYYX 4JI6L 1EYDA 5GQOA 2F0IA 5J3BA 1B53A 3AB9A 4DUZQ 4AYBE 4CKBA 1U4MA 3CPFA 1MI2A 2F03A 4HIKA 4GNXC 1R4QB 1BBWA 1S5ED 3GTQH 1JORA 3S1NH 1ZYRD 2HIVA 4DN4M 5CYUA 1XNQL 3PO3B 1H95A 4HIDA 2C5CA 4H0LC 1MKHA 3FP9A 1QWYA 1STEA 4R8NA 1X3EA 4AYBG 5HURA 5C44B 3SK8A 4ZKCB 3CXCA 2AHOB 3VYRA 3PF4A 4R1JA 2K75A 4FXKC 1H9JA 1UE1A 2B2VA 4QUFA 1CQVA 3SVMA 3TQYA 4DR6L 3LNNA 4I7AA 1K8GA 3KBGA 3KF6B 4LF5Q 1SYBA 3J80i 4A3CG 1CHQD 2PNHA 2PCFB 1YNNC 4DV7L 2E2JH 2F4IA 4XYQA 1A62A 2EJMA 3OWEB 3VR4A 3PO2G 1HR0W 3T56B 1O7YA 1VQ7A 2WAQE 1Z47A 2BCOA 1KLGD 3IKJA 1VQHA 3J81E 5HGQA 2EYHA 5EBDA 3LGJA 1M8AA 4O2DA 3TREA 4MTKA 3TP6A 3KLWA 4I65A 5IYBH 2WAQG 3AEVA 3OIPA 4ZKBB 2K05A 1SNPA 2EYMA 1QILA 2E74C 4X3UA 2B2VC 5IY0A 3HOUH 3QIAA 5IIFA 3JAMi 4A93B 2MP1A 3A7AB 4V190 3GTQB 5K36G 3S1NB 2OCEA 1YEZA 3G48A 2IX1A 4RGNA 1BQQT 3QOJA 1H9KA 2FJ2A 4L5QA 4X62L 3MVVA 1EU3A 2VQEQ 3MWYW 2FFKB 1L0WA 2QEXA 4LAAA 1I50H 2UUBQ 4JI5L 2EXDA 1ESRA 1M1KC 5M5WH 3T1YQ 3PUVA 4H13C 2L9HA 4Y7NB 4JBMA 1FNUA 2BDNA 5C0XI 1WD1A 2NVTH 2AUKA 2Z6KA 2E2JB 4UY8C 1LTID 3E0EA 4JI7L 3I56A 2K5VA 4JYAL 3R93A 5I9PA 5J1ZA 2CVRA 2E76C 3A8JE 4U68A 1X3FA 1ENCA 3ULJA 1AP0A 4A3IG 3WOEA 1Y8NB 5D3DA 2E75C 5C4XH 2JA9A 3ERQA 3I2ZA 3ULPA 2JA5G 2CW0C 5A2QE 4FF1A 5BN4A 4LF7Q 1D1IA 2QW7A 1QB5D 2KCNA 4N9TA 2QEJC 5I4DA 3HOUB 2R92G 3GTGH 3BZCA 4LF4L 2JYOA 2NUCA 2D2CC 1NSNS 2QILA 3QWNA 3HG9A 4HAEA 3NBHB 2Y0SE 4AQYQ 1E2ZA 1HNZQ 3UDXA 4YWKA 1SNMA 5LMNQ 1KQSA 4DNRB 3CU7A 4U673 1EZ6A 1CK1A 3I4NB 1F9PA 1HZ9A 1K9MC 3IAYA 4NXML 2F52A 2Y0SG 1EWHA 4JI6Q 1K8MA 5M5WB 3R3OA 2LSSA 1X55A 2EYPA 2PZUA 2Z4IA 3FRPB 4OO1H 4IOAA 1SDFA 4B9XA 2K1BA 3PF5A 3Q24A 3RLOA 2R7FA 4BS9A 1EYGA 1HFNA 1STGA 1CKNB 2VXWA 1Q8IA 1GVPA 3CMEA 3T1HL 3TS0A 1SEBD 2K52A 3I4MB 4GKKL 4DAPA 3HOYB 4BY1H 3CQZH 1GUSA 1G6ZA 1JT8A 1J9OA 4DV3L 4BY7G 2RBMA 3SXHA 1AZPA 1WI5A 5G3LD 1KABA 2VY3A 5L37A 2MO1A 4RHSA 1M90C 1EIHA 4A3DH 3H0GG 1SJED 1GD7A 1PH6A 5FOBB 1SRUA 1EQVA 4FVMA 3E6ZX 1CQFA 2DJGC 1X9NA 1DGSA 2QCPX 3C1EA 1CZWA 3J7AV 2Z6BA 4DV1Q 1BCPB 2Z1CA 4K6DA 3GTOH 2R7ZG 3TS2A 1EY5A 4YHHL 3NELA 1QOHA 4EQNA 4A3EB 1PRTB 2CQAA 1PH8A 4WJ4A 4DV4L 3CCJA 1VQEA 4HCEA 1VQIA 4OEMB 2IPKD 1HXYD 1RODA 2NN6I 1VQ4A 4KKTA 1HFGA 1PFBA 4CBVA 1V43A 3NP8A 1PFSA 1RD9D 3NBHA 4DR7Q 1DJRD 1PTOB 3UDFA 2KJXA 5C0XH 3H09A 2BA1A 2HIXA 2IY5B 4HJ8A 5FO8B 2CH4W 3OW7A 2A5HA 1IBKL 3PUXA 1Y8OB 2KOLA 1E2WA 3SR1A 4BY1B 4M8AA 1YJ9A 4HSPA 5DEHA 1N9WA 3Q8DA 1K83B 1LT4D 2AKWB 5FLXc 1GUTA 1PH9A 4WJ3M 3CRKC 2B63B 3NUCA 4JI7Q 4JYAQ 1CKNA 4A3DB 2JEBI 1WTXA 2JA8G 4JI8L 4IQZA 3GTLB 2PQAB 4CHTB 4LF6Q 4FF2A 2A69D 1KIXA 3EVQA 2NTTA 1YHQA 4OIKA 1O78A 4LUOA 1VQ6A 4LFAQ 2KHJA 4DA2A 1P8LA 2K5HA 2N78A 2Q8RE 3ZJYC 3HOVB 3J7AF 5EQ0A 1DZ1A 3WWVA 2F0KA 2O2LD 1SJHD 4LK1C 1EY6A 4A3KH 1XNRQ 1Y1VG 4A3JB 1MJCA 4APVA 3HKZE 3STBD 1YNJD 4IFDI 4K2KA 2XWJB 3DWAA 3VYUA 4BBSH 4PZ7A 1II3A 1SROA 4C1NI 2D5DA 1IBLL 5BN3A 3IFDA 3ULLA 3HOWG 3HKZG 3SK4A 4KK7A 3IFTA 3C2PA 4RKBA 2KUMA 1LABA 2K14A 1EZ8A 3ND9A 2I5LX 4DR5L 2FMCA 4K6LA 2F0DA 2O4XA 3AU7A 4A4IA 3E0JA 2PZWA 2A8VA 2CKZB 4H44C 4BA2I 4R4IA 2VUMB 1PV4A 3MTSA 4DV5L 3MAQA 1K8AC 4A3GG 5LL6X 4DV2L 4ZUIA 1EY7A 5IYCG 2I5HA 2UUAL 2E2DC 1BCPC 1LLRD 3NQIA 5ELDA 1NY4A 4GN3B 1PRTC 2A6HD 2L15A 3VR5A 1A6XA 1FVIA 1JWMD 4ZUJA 4BBRB 5I9OA 2VB3X 2Q2HA 2EJGC 3EQLC 4QB4A 2PW5A 4CJ1B 3D4RA 3JAME 5I2XA 4DR1L 2JK8A 4GZYC 4V0BA 2Q2IA 4DUYL 5IWAL 4JI2L 3M7NA 4QGUA 1FGBD 3A0JA 1IXRA 2F0OA 2IL8A 2LFNA 2JA6G 4PMCA 2NN6H 3LWUA 3FHWA 4IALA 3F2UA 2PQAA 1PTOC 5JEAG 3VDYA 2JSOA 4C2MB 1PMRA 4ALPA 4KY7A 3NE5B 4B3SL 1I4HA 4F87A 4BWGB 1B3AA 3TP5A 2R93H 4FYDA 1VQPA 2WB1E 1LTTD 2UXDL 5IP9H 2H1EA 2HHHL 4LUZA 2HDMA 2P5ZX 1B44D 2XNAC 4CDDC 1VQFA 2EOTA 2CFMA 4DNIA 4X6AH 3W2DA 1YNND 2F0MA 2B2WA 2V1CC 4GLAC 1XWEA 5I6WA 5C3EH 2KBNA 1HH2P 2IHFA 3FKIG 2WB1G 2EYFA 3ONAB 4TRDA 1WTPA 1UUPA 1VMCA 4C3HG 5M3FB 4KN4C 3PUYA 3OMGA 3HOXH 1K73C 5D65A 1VQDA 1LO5D 3NWSA 3I70A 5IGFA 4CJ0B 4HJ9A 3SDZA 5KGUA 3Q22A 1LT6D 2ICIA 1IBML 1KTKA 1YBYA 1NR2A 4XIGS 2EY5A 2F0LA 2L12A 2YTXA 3BZKA 4OX9L 3S2HH 2JA7H 1X3GA 3OOCA 1XPRA 2MUYA 1EYAA 1AW7A 2B2WC 5TSSA 1OXUA 4NMZA 3HZXA 2KCCA 4KHPQ 1QVGA 3RN5A 1HA5A 1HNXL 1EY8A 1JWUD 4A75A 1UEBA 4RCOA 4OHJA 3DWQA 4XYOA 2R93B 5A35A 2L1BA 1ILPA 1ONLA 1EEID 4MZ9A 1GUNA 3HS0C 3KK7A 2JEAI 4JBWA 3K7AH 1G51A 4JI1Q 3RR5A 1HPCA 3T4AC 4JI0Q 3FVQA 1R4PB 4XDXA 3C1FA 2A19A 1YHAA 2BOSA 3F2DA 2NVQH 5EJWA 1H9SA 3GTKH 1V1PA 2K33A 2PMZE 5DAUA 1PH5A 2E8GA 1UE7A 5CC4A 2IWHA 5M9OA 3HOXB 4WJWA 1RF2D 1DONA 2G5DA 2BA0A 4DR5Q 3WDNA 4JV5Q 3Q6SA 1X65A 4JI3L 1XYIA 3TBIB 1AN8A 4K0KL 1RHPA 4A3FH 1BUVT 1LACA 2CQOA 3FPUB 5M5YH 1DD2A 1TQOA 1EY0A 3KLSX 3PMFA 1X3QA 3S2HB 2JA7B 1OO9B 2X6LA 1FNWA 4A3BG 1M4VA 1C0AA 2ZXPA 2B29A 4PZ8A 4IFDG 1MSHA 2KENA 1PZID 2OTJA 3S16B 5G3LF 4DR2Q 1FL0A 1UEAB 3W1GA 2XRQD 1N36Q 4B3RL 4DR1Q 1T5XD 3CKIB 3VYSA 1RIPA 3NTHA 1JJGA 2Q2UA 5IWAQ 1RL2A 4XT1B 5KNCA 2YYZA 3DM3A 4X64L 1XMQL 1WCMB 3K0XA 3K7AB 3L7ZC 1C9OA 3S14B 5IP7H 1DM0B 2Z9HA 2J7ZA 3AFQA 2Q8TA 3TN2A 2RSNA 3R8BA 2DGYA 4UPAA 3MZ5A 1ESFA 2O5IC 3N6RA 2XRSD 4O1NA 2B3GA 3GP7A 4KI0A 4DR4L 3QO2A 3NWTA 5IGGA 4X65L 3KJOA 1S5FD 4OIJA 1MSGA 2UUCL 1LT3D 2Z8LA 3S1QH 1PHJA 3I4OA 2ZTEA 1J5EQ 3HOZH 4MHEA 1G291 5GAHC 4JCVE 5M5YB 4C3IB 2A73B 2E5LL 1VQBA 4DV0L 1E3PA 2HCCA 1OXXK 1ENFA 3BDOA 1NTGA 2RDHA 2N3SA 3CC4A 2DY8A 4B3MQ 2JE6I 4HN7A 4HSVA 1B3QA 3R2TA 1OXTA 1ZXTA 1SE4A 3CW2C 2MHVA 3D4WA 4IURA 4ZK9B 4A93H 3SEBA 3PO3G 2BDOA 1EIGA 4EQOA 4JI4L 5IT9L 4OX9Q 4ULLA 2A74C 4K2LA 2ID0A 3K8AA 1IYJB 5CR3A 4PMWA 5CV6A 2OTLA 1GHJA 2I5MX 5IGDA 1K3BC 3S2DH 4FF4A 1TWAB 2TMPA 4OO1I 4P2CB 4Y7NH 1SMXA 1YVCA 2DN8A 1STYA 2G9DA 1PYWD 5CBEE 1V9PA 3PV0A 3TZUA 1JWSD 2IHEA 3NEMA 1F2LA 2D0PA 4IUUA 2NWGA 1ZKOA 2PW7A 4AYBB 5FLMG 2LY7A 3IRBA 1Q8KA 1SBBB 2DJFC 3S1QB 3R2IA 1TWHB 5FLXE 4A3MG 3HOZB 1I5FA 1DOMA 3DLLA 2RHQB 4OL7A 1SN8A 1VF7A 1SSOA 2A68C 2ZTDA 1N34Q 1EUJA 4RWSC 1PA6A 3K6OA 5CV9A 2JQOA 2OWOA 4K14A 1U9RA 4UAIA 3PO2B 4YCVA 5I2YA 1A3TA 1E7ZA 5KYLA 1WD0A 3MFYA 1EWIA 1X6OA 1TS3A 4JPBW 4DKAC 3TDQA 2ASBA 1A3VA 4UP9A 1U4RA 3I4NH 2WAQB 2V4DA 2L55A 1J6QA 1Z9FA 1Q1BA 2KHSA 3M85A 3K80C 2MGSA 3NENA 1JR0D 2HQLA 3S2DB 5IYDH 1PZKD 3E3XA 3A8IE 1QE6A 1UAPA 4POFA 2K7VA 2NYZD 4K8IA 2UXCQ 3ER0A 3AFPA 4X64Q 4EVOA 2HCIA 3I4LA 3GTPH 3E9HA 1EIFA 2SNMA 3I4MH 1SE3A 1STAA 2F0UA 3HOYH 3D4DA 3KOJA 4LF9L 1HNWQ 3CCSA 1LV9A 4N9PA 1IYUA 4B3TL 1X32A 3M4OB 3NTKA 4RCNA 3KF6A 4RGTA 1YITA 5IYBG 4YCUA 1FJGQ 1PYSB 4L8JA 4DR4Q 4MIUA 4LF8L 1L2FA 1C48A 5CV5A 3TMEA 4ZLTF 3W3AA 1LT5D 1O7IA 2DUDA 3HOUG 4J15A 1IL8A 3G7LA 2XVSA 1R9TB 2ICEC 2NVXH 4DK6C 1K0RA 4P73A 4A3IB 2RQXA 1G6PA 5FK9C 2B2YA 1WVLA 4A3EH 1MJEA 1VQLA 2H5XA 1NE3A 4UP7A 2JA5B 1JOKA 5I6YA 2NVYB 5JOBA 1EL0A 5JJZA 2F0GA 3S17B 4ME3A 2R92B 4DAYB 4OGQC 3TZDA 3BDLA 3HFZB 3C3LA 2SDFA 3OIQA 4DXFA 3H91A 4BXXH 1XNQQ 1UNSA 5BR8L 1SNDA 4DV6L 2R7ZH 1CTMA 1PTOH 2PI2A 2A6ED 1W3SA 1U4LA 1B4OA 4NDXA 4LFCL 3GTPB 4KY6A 2MFIA 3OYYA 3S15H 2Y0SB 4FDBA 2KVMA 4QIWE 4YWMA 2B2YC 1PH4A 5FO9B 4DR6Q 4F7XA 1QVFA 1VQMA 4EGVA 5KYIA 1K83H 1E24A 1PH7A 5C4XG 3VR2A 1C8CA 2B63H 4DV7Q 2KECA 3KLSA 3VR3A 4WRDA 5CV4A 3K5OA 4XQNA 4X3TA 1ENAA 4FF3A 1X3PA 3GTLH 4JOIA 2NVXB 3UDIA 4KHZA 1XXGA 3F8TA 4LWCA 1NJIC 1GJXA 4BY7B 1IW7C 1ET9A 4L5TA 1BOSA 1LTSD 4A3LH 1VDZA 1L1OB 2ZXOA 5EAYA 2IX3A 3HOVH 2AQ2B 3H0GB 3PUWA 2EXZA 1X54A 3T53B 4A3JH 1TY0A 3DEOA 2WKDA 3OPOA 3GTJB 2F4VL 2VQFL 4C56C 4FNFA 4OO1G 4QMGA 5EPLA 3KF8B 3GV3A 3MEHA 3SHLA 4B9WA 2R7ZB 1SNOA 1PH2A 1ICWA 2ZM6L 4X62Q 1ASYA 4GLXA 2EQSA 3EROA 4M1UB 5FO7B 3L2PA 4JI5Q 4JOIC 3MHBA 5M3MG 4UHVA 3F2CA 5EPKA 3P7JA 3S15B 4GN5A 5JAVA 1ZYRC 1FNVA 1A8VA 1Y1VH 2X6GA 4BY1G 4DAYA 1EYCA 1QUQB 4DAVA 3D0FA 5EBCA 5C4HA 3ICEA 5CV8A 3KFUA 2VUMH 2ALYB 4A3DG 4Q0FA 3NBIA 1B8AA 1JB7A 4HEDA 1O80A 2C9OA 2F0JA 4KN7C 4F8MA 3I72A 1IHZA 1F2ZA 4LF9Q 2K5DA 2RDGA 2TSSA 1KD1C 2K01A 3GV6A 1N32L 3GTMH 1B9NA 4CDCC 3J81c 4BBRH 5GROA 4JBJA 3OTOL 4IUVA 2F0FA 3PGZA 1HUNA 4A3GH 5LMNW 1A2UA 4LF4Q 1I3QH 2WV6D 4R4OA 4ZAIA 3CD6A 3V96A 1SMYD 4FXDA 3NK9A 4C2MH 2YU9B 4ME5A 5C0XG 1LTRD 4DK3C 3FPPA 4RA8A 2OT2A 4NXMQ 2EVBA 1L1OA 2L11A 3I73A 1SYGA 2VW9A 3J80E 2KCMA 1Y1VB 1I6HB 1G8ZD 1I94L 2DY7A 3HEJA 4C1NK 1VQNA 3J81L 4NPSA 1BBUA 1A0IA 2K5NA 3KF8A 3DM1A 3IL8A 1WYDA 4LFCQ 2O5JC 3RZOB 5ELNA 2AWNA 3HOWB 1Q90A 3HKZB 1HR0L 5M3FH 4GS3A 3T1HQ 1JOQA 3D6WA 1E0BA 3B6YA 4H02A 4GKKQ 3DWPA 1AH9A 3RZDB 3RMHA 3G6JB 1F2YA 4IOCA 3A7LA 3U58A 3D3RA 4DV3Q 1N33L 4MTNA 2XWBB 1QUQA 3GTMB 2B39A 1L1OC 1GO3E 2NBFA 2QDLA 5JEAJ 1C4QA 1GKHA 3J7ZC 4IUQA 2BE5C 4DGZA 4A3GB 1D5MC 4NXNL 5IODA 4A3KG 1KAWA 2K04A 1TVXA 1I3QB 1C7YA 2AQ3B 4IUNA 2RF4A 3F2BA 1K8OA 1VMPA 4BBSG 3I8ZA 4YHHQ 2AMCB 1OTCA 2MJ8A 2F0QA 4DV4Q 4DAMA 1FGUA 3VA5A 2CHBD 1Z7TA 4NP5A 3BJUA 1NMFA 1EEFD 1LTAD 5GADC 2LS01 2F4VQ 2VQFQ 2JA6B 4KV6A 2ENBA 1BBXC 3A55A 5T1IA 4ABNA 1BXTA 3U9OA 1ML0D 2R6GA 1Q1EA 1HZCA 4PV1C 2CH4A 5FJ8H 3AQQA 2AUJD 1GM5A 3AYHB 4AIMA 2MQHA 2HT1A 1F9SA 5A2QL 1T5EA 3RUZA 4DU9A 2N49A 2PO4A 5AJ3L 2I46A 4IO9A 1I4QA 1IBKQ 3J81j 1CA6A 5ELCA 2HD3A 2I0QA 3K81C 4IZ8A 3MEFA 2KHIA 3KBXA 1NR4A 1CSPA 3K58A 2EYOA 3FKIB 2WB1B 2VNUD 1TS4A 1RJTA 5F2DA 4C3JG 4JBKA 1I4PA 4X3KA 3L0OA 4JI8Q 4C3HB 4YIJA 4G7OC 2NN6G 2CWAA 2FXQA 4RHRA 2D0OA 4PQXA 3S16H 3TEHB 2D62A 1IZ6A 4DUZL 4GOPB 4RG1A 2K6AA 1DOKA 2QDBA 2Q8IB 3OTOQ 1MHWC 2R93G 2DNCA 5C3XA 2FHTA 1QVCA 2OEOA 1VQ8A 3SK5A 4XXEA 5IP9G 1EWCA 1NBWA 1WCMH 1KAAA 4N8FA 1JCKB 1UE5A 3S14H 4P72A 5C3EG 5IGEA 1Q7YC 1VS0A 5J39A 2NZHA 1IBLQ 3A54A 1E1TA 3PCOB 2JXMB 1TWGH 1MGSA 2B8GA 2CCZA 4DR3L 4XT3B 5FKAC 4LF5L 1KRSA 1TWCH 2OQ0A 1SFOB 1YI2A 3O13A 4PG3A 2WACA 3UI2A 3HOXG 1VQOA 1PH3A 1Q82C 4RH6A 1Y1WH 5EKIA 2CW0D 3MC0B 4JC0A 1XTCD 1KL9A 1BNZA 4IFDJ 4NB3A 1MBYA 2PYKA 1G2SA 1BVSA 1HR0Q 2MO0A 4DV5Q 4C3IH 4L63B 4DV2Q 2IT1A 2F0EA 2JA7G 3T16A 2UUAQ 1OXSC 1U4PA 1ILQA 2C35B 2WKCA 2KEDA 4XTCS 3URYA 5IGCA 3BS1A 4X66L 4ZRZA 1CM9A 5IGBA 1HZBA 5KRUA 2WINB 1JE5A 1Y8PB 2XTIA 3T13A 1B70B 2F0NA 2J4XA 4NXNQ 4DUYQ 2A69C 4JI2Q 1KNEA 1KC8C 1AFPA 4A3BB 2OXPA 2VQEL 3CCLA 2Q2TA 3PIP3 2GVAA 1WTQA 3K59A 3UE0A 2AQ1B 1BO0A 3T1YL 2Z4HA 2KEEA 1F77A 4B3SQ 1TWAH 1TWGB 4LMQD 4GOPA 1TWFB 1XJVA 1LTBD 4R9WA 3STBC 5C3WA 1YNJC 3PSIA 3OWFA 4WFN3 1TWCB 3RLFA 4YY3L 2UXDQ 1V1OA 3DMUA 5IT9c 3CCUA 3A56A 2HHHQ 5E7NA 4IPGA 3MFGA 1Y1WB 4IUTA 1DYQA 5C5LA 1TWHH 4HR7B 2LKVA 4A3FG 3H6MA 1RTOA 1YZ6A 4IN3A 2A1AA 4A3CH 4EX5A 1IYVA 5EKLA 2DNEA 2PZTA 5E3FA 1IW7D 2JN4A 3PO2H 4P74A 4GOPC 1T9HA 1CSQA 4ILWA 3V2TA 1SAPA 1IBMQ 2NZOA 1WTWA 1QNKA 5LMNL 1LYLA 5HY6A 1DCZA 1KDCA 2A6HC 3M3YB 4KY5A 5ELFA 5C44G 2QA4A 2L5TA 3JAMc 5IP7G 3PIO3 5C4JB 1GXDC 3J7A5 3G4SA 1B2TA 3T51B 4MN3A 5IE8A 3QB3A 1HNXQ 4HTHA 1RTNA 2F1MA 1VQKA 1KHIA 3MXPA 1LM0A 5K36H 1W6JA 4K5XA 4CKEA 2EPBA 2K32A 3M4YA 5ELBA 3SGIA 4J6HA 4OXPA 4DF7A 2SEBD 3S1MB 3P20A 1Q86C 1CHPD 1IKMA 3D6CA 3H15A 1EIYB 3GD7A 1VQ5A 1LUZA 2F0PA 3HOZG 5DLQE 3RN2A 1YIJA 3LX0A 4DR3Q 1MIUA 3M4OH 2PPBC 1XPOA 4QUCA 4ZCKA 3JAML 3M9BA 2SOBA 3VA7A 3CPWA 1AE2A 3RNUA 3BU2A 1WTVA 2OF1A 1RDPD 5LMUL 2PI2E 1O7ZA 2GA4B 4JI3Q 1D5ZC 2MNAA 3BZDB 1R9TH 4KD3A 2RKSA 3S1RH 4A93G 4K0KQ 4GKJL 4A3MB 4JG2A 1ICFB 5LL6S 3A74A 2EZVA 4DV1L 4A3IH 4P75A 2K4KA 1WFQA 4G7HC 4GN4B 3SK6A 1S40A 3I7FA 1TKWB 3S24A 1PFNA 2JA5H 2NVYH 1HHVA 4X66Q 2ZT9C 1BF4A 1RKNA 3S17H 1TR5A 1H9MA 2R92H 4RFBA 4DK0A 4XQJA 1B50A 1STBA 2NB0A 3LWEA 1OXVA 4B3RQ 1SR3A 2N88A 3ERSX 1JB3A 4DR7L 1GHKA 4EQPA 3GO5A 5AFWA 5KNBA 1XMQQ 3OMCA 3U4VA 1EQQA 1HZAA 1TT2A 4TSSA 2R7DA 1S5CD 4HJ5A 4UDUC 2YV5A 2RCNA 5EGTA 3A5UA 4Z9CB 3KYHC 1SNCA 3KJPA 1D8LA 1GUOA 2Z0SA 5E1FA 2E2HH 3OW2A 4YY3Q 1BCPD 1XTDA 1U5KA 3HGBA 5EPJA 1PRTD 4YWLA 5COYA 4X65Q 1CZGA 1S72A 3SE0A 1JQYD 4EQ5A 2UUCQ 5GAEC 3M4QA 1TY2A 3FMCA 3QJYA 3K5MA 2ZJPA 3S1RB 5JJKA 1D5XC 3A8KE 1VQJA 5CV7A 2BE5D 3UE1A 4LF6L 2E5LQ 4BY7H 4DV0Q 2F0WA 4LFAL 5EKKA 3I4NG 2K28A 4PNYA 5GAGC 4QL5A 1PTOD 4HMIA 3H0GH 3CCRA 1EU4A 2B2TA 3P1HA 3CC7A 4P71A 3D8GA 4CKCA 5IYDG 1PLFA 1XNRL 1U0LA 3GTJH 5KEEA 4G7ZC 2HDLA 5KIXA 2Z6KC 1E1OA 2WFWA 3PIPA 4JI4Q 1L0YB 2CWPA 3NQTA 4DPGA 2B2UA 4OONA 3W5OA 2K03A 2I07B 4KKSA 4LFBL 1I50B 2GN5A 3OSOA 1EFID 5T1GA 2N8NA 1D2BA 3I4MG 3BYYB 1D6EC 3HOYG 4IPDA 4LNQA 3W1BA 4ODGA 2ZTCA 2WIIB 5CGKA 1E22A 2E2HB 4KJOA 2KCTA 1I4XA 1SE8A 1HQMC 2NVTB 3V05A 2B2TC 3BVZA 2RVLA 1CFMA 3H3VC 3I90A 2EYJA 5HGTA 3MXUA 1NCVA 4ID6A 2R61A 4POGA 5M3MH 1S5BD 1QZHA 1NNXA 1TU2B 4G57A 1B1ZA 3CAMA 4KMUC 2B2UC 1QG7A 4UP8A 1HA6A 2K50A 3M4PA 4A3EG 4O0AA 4N8X1 3OHXC 5C4XB 5JVG3 4L6TB 5LMUQ 1LTLA 3TP7A 3CCEA 2H4OA 1TS5A 2RCFA 4QIWB 2IJ0A 2PNRC 3GTGB 2QKIC 2JA8H 3BVMA 4IJHA 2F3WA 1Q46A 4GKJQ 3TSSA 2UXBL 3CCVA 4BXXG 2F3VA 2VL6A 3CCQA 1PVOA 3KUPA 1YHBA 3DEPA 3I91A 3PIOA 5D3IB 1QJOA 1SYFA 3BYTB 2YU9H 3HP3A 1PFMA 1B9MA 5M5XH 2BH2A 5DM73 2AWOA 2FMMA 1G2TA 1L0XB 3GQBA 3MXGA 1I6HH 3CMAA 1WTRA 1TXYA 1HRJA 2D9UA 3CC2A 1ET6A 1D1KA 1EFWA 2B63G 3P75A 1V8QA 3RZOH 1KDAA 2EY2A 2JJQA 3HOWH 3ITPA 2EJFC 3G6EA 2F0SA 1XMOL 5M3MB 1JE4A 3DHQA 3RZDH 5BN5A 4L5RC 4B3TQ 3CQZB 1BR9A 1YJWA 3G71A 5CMDA 2SNSA 1ASZA 1CKMA 3E9IA 2MPMA 4KTAA 4LF8Q 1NMGA 4F88A 1JOOA 5E4XA 1YJNA 4A3LG 3KLRA 3HOVG 1KRTA 3EA6A 3UDGA 4DNTB 5C0XJ 1F2MA 1XX8A 3U50C 3FEWX 5IOCA 4QF4A 3CF5A 4A3JG 4QCLA 4QJFA 5ELEA 2JA8B 5IYCH 1TIID 3U4ZA 4K8JA 3N52A 4TQUS 4JK1C 1EQTA 3GTOB 2VB2X 2UU9L 4KHPL 2QGQA 3NHHA 4QY7A 1HQRD 4PMBA 1A3UA 2F0VA 1SYCA 1WJJA 1PXUA 5M5XB 1I4RA 4GLVB 1VF5C 1VQGA 2FINB 2B8FA 2JA6H 4R4TA 4MNOA 1AZQA 2QF7A 4JI1L 2M9VA 5BR8Q 5FLXL 4DV6Q 4QQBX 5JEAH 3NSWA 3X3NA 2KA7A 4JI0L 1WTOA 2BH8A 4OELB 3K0YA 4CDFC 5JPNC 2VUMG 5IT9E 2L4NA 1W6KA 1NUCA 4LUVA 4LFBQ 1G91A 1Y69U 3FDTA 1STNA 2XSCA 4J8QA 3U9SA 1PZJD 2PQEA 1QCBD 3MXNB 2JP1A
chains in the Genus database with same CATH topology
1I4GA 1RCVD 1Z6HA 3Q23A 3H94A 1CA5A 5E4WC 4B08A 2EY1A 2IX0A 3NXWA 4RAUC 4S3SA 3X3MA 2EY6A 2EE1A 3BDCA 3CHBD 2NTSA 1STHA 4R8IA 4A3KB 4FXGC 3RD4A 1CT1D 1HTLD 2HQEA 1A15A 3NPPA 4BBSB 4KHVA 3TP8A 1FD7D 1H9SB 1GOZA 1H9RA 1V1PB 2EDGA 1HUMA 5CBAE 1DOLA 2N55A 1JICA 5DNFA 1SYDA 5D14A 4G4KA 1DXMA 5NUCA 2M2LA 1CI3M 2A6EC 4TKOB 2A68D 2K5WA 4O42A 4CJ2C 5JPMC 4BA1I 4DFAA 3CRLC 4RGMA 4IUPA 2RSOA 4Q5VA 2RA4A 1E2VA 5KNDA 3BVGA 2G9HD 1SYEA 4K5VA 3PUZA 3L3OC 4NW2A 3MXNA 1BCPF 1TS2A 1S5DD 2HUGA 4LJZC 3J7YW 1PRTF 2M00A 1Q3LA 3VYTA 4C3JB 3WOFA 3QG1A 1FYCA 1EY9A 1O7LA 4K5WA 3DXJC 4I7ZC 4NKLA 3M7GA 4KKUA 3AMUA 4IFDH 2EYLA 3E5SA 1ZEQX 1Q12A 5LHY1 5JVH3 3K57A 1PTOF 2J0TD 1MD2D 2WP8J 1LTGD 4X3SA 2IW3A 3VR6A 1KLUD 4HCSA 2F0TA 1HCZA 2L0CA 3K5NA 1GUWA 3EJIA 5C3EB 1F9QA 1BDOA 2KQ3A 1IKLA 4H7BA 1I6VC 2XN9C 1F9RA 3ND8A 1NAPA 3DUZA 3C46A 5C5MA 4ZQ3A 5K5PA 5C4ZA 4XQQA 1J8IA 1HTPA 2PMZB 2RDFA 2X69A 3I3CA 1S4ZA 1SXTA 2NZ1D 4KD4A 2XIWA 2R3ZA 4J1MA 1SNQA 3MA2B 4RGOS 3QOLA 5ISRA 3HRZC 1EY4A 2E2IB 2LMCB 1SMYC 4ZYSA 5CORA 1SE2A 1KDBA 3L9AX 4FP5D 1KNAA 1AEXA 3NTIA 1GUGA 2F0HA 2NVQB 4C3IG 4DXGA 1PDQA 3GTKB 5DM63 3Q0AA 4CGYB 4WORA 3BG3A 5C6AA 5J22A 4FO2A 1QNUA 3EFXD 2ZXRA 4A3FB 2K5QA 1EOTA 4DK1A 3K5LA 3S9WA 4KJNA 4HMJA 1VCIA 3D31A 4E6IA 4RKLA 1FR3A 1A2TA 3J80L 1JC7A 3ZYYX 1EYDA 2F0IA 1B53A 3AB9A 4CKBA 1U4MA 1MI2A 2F03A 1R4QB 1S5ED 1JORA 1ZYRD 4DN4M 5CYUA 3PO3B 2C5CA 4H0LC 1QWYA 1STEA 4R8NA 5HURA 5C44B 3SK8A 4ZKCB 3VYRA 4FXKC 1H9JA 2B2VA 4QUFA 1CQVA 3SVMA 3LNNA 3KBGA 1SYBA 1CHQD 2PCFB 1YNNC 2F4IA 4XYQA 2EJMA 3OWEB 3VR4A 3T56B 1O7YA 1Z47A 2BCOA 1KLGD 3IKJA 3J81E 2EYHA 5EBDA 1M8AA 3TP6A 4I65A 4ZKBB 3OIPA 2K05A 1SNPA 2EYMA 1QILA 2E74C 4X3UA 2B2VC 3QIAA 5IIFA 4A93B 2MP1A 3A7AB 4V190 3GTQB 5K36G 3S1NB 2IX1A 4RGNA 1BQQT 3QOJA 1H9KA 2FJ2A 3MVVA 1EU3A 3MWYW 2FFKB 4LAAA 1ESRA 3PUVA 4H13C 2L9HA 4Y7NB 1FNUA 2BDNA 5C0XI 1WD1A 2AUKA 2E2JB 1LTID 3R93A 5I9PA 5J1ZA 2CVRA 2E76C 3A8JE 4U68A 1ENCA 1AP0A 3WOEA 1Y8NB 5D3DA 2E75C 3ERQA 2CW0C 5A2QE 4FF1A 5BN4A 1D1IA 1QB5D 2KCNA 4N9TA 2QEJC 5I4DA 3HOUB 2JYOA 2NUCA 2D2CC 1NSNS 2QILA 3QWNA 3HG9A 4HAEA 1E2ZA 1SNMA 4DNRB 3CU7A 4U673 1EZ6A 1CK1A 3I4NB 1F9PA 3IAYA 1EWHA 1K8MA 5M5WB 3R3OA 2EYPA 2PZUA 2Z4IA 3FRPB 4OO1H 1SDFA 4B9XA 2K1BA 3Q24A 4BS9A 1HFNA 1STGA 2VXWA 1Q8IA 1SEBD 3I4MB 4DAPA 3HOYB 1GUSA 1G6ZA 1J9OA 2RBMA 3SXHA 1AZPA 5G3LD 1KABA 4RHSA 1EIHA 1SJED 5FOBB 1EQVA 4FVMA 3E6ZX 1CQFA 2QCPX 3C1EA 1CZWA 3J7AV 1BCPB 2Z1CA 4K6DA 1EY5A 1QOHA 4EQNA 4A3EB 1PRTB 2CQAA 4HCEA 2IPKD 1HXYD 1RODA 2NN6I 4KKTA 1HFGA 1PFBA 4CBVA 1V43A 3NP8A 1RD9D 3NBHA 1DJRD 1PTOB 2KJXA 5C0XH 3H09A 2BA1A 5FO8B 3OW7A 2A5HA 3PUXA 1Y8OB 2KOLA 1E2WA 3SR1A 4BY1B 4M8AA 4HSPA 5DEHA 1K83B 1LT4D 1GUTA 3CRKC 2B63B 3NUCA 4A3DB 2JEBI 1WTXA 4IQZA 3GTLB 4CHTB 4FF2A 2A69D 3EVQA 2NTTA 4OIKA 1O78A 4DA2A 2Q8RE 3HOVB 3J7AF 5EQ0A 1DZ1A 2F0KA 2O2LD 1SJHD 4LK1C 1EY6A 4A3JB 1YNJD 4IFDI 4K2KA 2XWJB 3DWAA 3VYUA 1II3A 4C1NI 2D5DA 5BN3A 3IFDA 3SK4A 4KK7A 3IFTA 3C2PA 4RKBA 2KUMA 1LABA 1EZ8A 3ND9A 2FMCA 4K6LA 2F0DA 2O4XA 3AU7A 3E0JA 2PZWA 4H44C 4BA2I 2VUMB 3MTSA 3MAQA 5LL6X 4ZUIA 1EY7A 2E2DC 1BCPC 1LLRD 3NQIA 5ELDA 1PRTC 2A6HD 3VR5A 1A6XA 1JWMD 4ZUJA 4BBRB 5I9OA 2VB3X 2EJGC 3EQLC 4QB4A 2PW5A 4CJ1B 3D4RA 3JAME 5I2XA 4GZYC 4V0BA 3M7NA 1FGBD 2IL8A 2F0OA 2LFNA 4PMCA 2NN6H 3LWUA 4IALA 3F2UA 1PTOC 5JEAG 2JSOA 4C2MB 1PMRA 4KY7A 3NE5B 1I4HA 4F87A 4BWGB 1B3AA 3TP5A 4FYDA 1LTTD 2H1EA 2HDMA 1B44D 2XNAC 2EOTA 3W2DA 1YNND 2F0MA 2B2WA 5I6WA 1XWEA 2EYFA 3ONAB 4TRDA 1WTPA 1UUPA 1VMCA 4C3HG 5M3FB 4KN4C 3PUYA 3OMGA 5D65A 1LO5D 3NWSA 3I70A 5IGFA 4CJ0B 3SDZA 5KGUA 3Q22A 1LT6D 2ICIA 1KTKA 1NR2A 4XIGS 2EY5A 2F0LA 2L12A 3OOCA 2MUYA 1EYAA 1AW7A 2B2WC 5TSSA 1OXUA 4NMZA 3HZXA 2KCCA 1HA5A 1EY8A 1JWUD 4RCOA 4OHJA 3DWQA 4XYOA 2R93B 5A35A 2L1BA 1ILPA 1ONLA 1EEID 1GUNA 3HS0C 3KK7A 2JEAI 4JBWA 1HPCA 3T4AC 3FVQA 1R4PB 4XDXA 3C1FA 2BOSA 5EJWA 1H9SA 1V1PA 2K33A 5DAUA 5CC4A 2IWHA 5M9OA 3HOXB 4WJWA 1RF2D 1DONA 2BA0A 3WDNA 3Q6SA 1XYIA 3TBIB 1AN8A 1RHPA 1BUVT 1LACA 3FPUB 1DD2A 1TQOA 1EY0A 3KLSX 3PMFA 1X3QA 3S2HB 2JA7B 1OO9B 2X6LA 1FNWA 1M4VA 2ZXPA 4IFDG 1MSHA 1PZID 3S16B 5G3LF 1UEAB 2XRQD 1T5XD 3CKIB 3VYSA 3NTHA 4XT1B 5KNCA 2YYZA 1WCMB 3K7AB 3L7ZC 3S14B 1DM0B 2J7ZA 2Q8TA 3TN2A 2RSNA 3R8BA 3MZ5A 1ESFA 2O5IC 3N6RA 2XRSD 4O1NA 3GP7A 4KI0A 3QO2A 3NWTA 5IGGA 1S5FD 4OIJA 1MSGA 1LT3D 2Z8LA 4MHEA 1G291 5M5YB 4C3IB 2A73B 2HCCA 1OXXK 1ENFA 3BDOA 2RDHA 2DY8A 2JE6I 4HN7A 4HSVA 1OXTA 1ZXTA 1SE4A 3R2TA 4IURA 2MHVA 3D4WA 4ZK9B 3SEBA 2BDOA 1EIGA 4EQOA 5IT9L 4ULLA 2A74C 4K2LA 2ID0A 5CR3A 4PMWA 5CV6A 1GHJA 5IGDA 4FF4A 1TWAB 2TMPA 4OO1I 4P2CB 2DN8A 1STYA 2G9DA 1PYWD 5CBEE 3PV0A 3TZUA 1JWSD 1F2LA 4IUUA 2NWGA 1ZKOA 2PW7A 4AYBB 2LY7A 1SBBB 3S1QB 3R2IA 1TWHB 5FLXE 3HOZB 1DOMA 4OL7A 1VF7A 1SSOA 2A68C 4RWSC 3K6OA 5CV9A 4K14A 1U9RA 4UAIA 3PO2B 5I2YA 1A3TA 5KYLA 1WD0A 3MFYA 1TS3A 3TDQA 1A3VA 1U4RA 2WAQB 2V4DA 2L55A 1Q1BA 2KHSA 3M85A 2MGSA 1JR0D 3S2DB 1PZKD 3A8IE 1QE6A 1UAPA 2K7VA 2NYZD 4K8IA 4EVOA 2HCIA 3I4LA 2SNMA 1SE3A 1STAA 2F0UA 3D4DA 1LV9A 4N9PA 1IYUA 1X32A 3M4OB 3NTKA 4RCNA 4RGTA 4L8JA 4MIUA 1C48A 5CV5A 3TMEA 4ZLTF 3W3AA 1LT5D 1IL8A 3G7LA 2XVSA 1R9TB 2ICEC 4A3IB 2RQXA 5FK9C 2B2YA 1WVLA 2JA5B 1JOKA 5I6YA 2NVYB 5JOBA 1EL0A 5JJZA 2F0GA 3S17B 2R92B 4OGQC 3TZDA 3BDLA 3C3LA 2SDFA 3OIQA 4DXFA 3H91A 1UNSA 1SNDA 1CTMA 1PTOH 2A6ED 1U4LA 1B4OA 4NDXA 3GTPB 4KY6A 2Y0SB 2KVMA 2B2YC 5FO9B 4F7XA 4EGVA 5KYIA 3VR2A 1C8CA 2KECA 3KLSA 3VR3A 4WRDA 5CV4A 3K5OA 4XQNA 4X3TA 1ENAA 4FF3A 1X3PA 2NVXB 4KHZA 1XXGA 1GJXA 4BY7B 1IW7C 1ET9A 1BOSA 1LTSD 1VDZA 2ZXOA 2IX3A 2AQ2B 3H0GB 3PUWA 2EXZA 3T53B 1TY0A 3DEOA 2WKDA 3OPOA 3GTJB 4C56C 4FNFA 4OO1G 4QMGA 5EPLA 3MEHA 3GV3A 3SHLA 4B9WA 2R7ZB 1SNOA 1ICWA 3EROA 4M1UB 5FO7B 3MHBA 3S15B 5EPKA 3P7JA 5JAVA 1ZYRC 1FNVA 2X6GA 4DAYA 1EYCA 4DAVA 5EBCA 5C4HA 5CV8A 4Q0FA 3NBIA 4HEDA 1O80A 2C9OA 2F0JA 4KN7C 4F8MA 3I72A 1IHZA 1F2ZA 2K5DA 2RDGA 2TSSA 2K01A 3GV6A 1B9NA 4IUVA 2F0FA 1HUNA 1A2UA 2WV6D 4ZAIA 3V96A 1SMYD 4FXDA 3NK9A 2YU9B 4ME5A 5C0XG 1LTRD 3FPPA 4RA8A 2OT2A 2EVBA 2L11A 3I73A 1SYGA 3J80E 1Y1VB 1I6HB 1G8ZD 2DY7A 3HEJA 4C1NK 3J81L 3KF8A 3DM1A 3IL8A 2O5JC 3RZOB 2AWNA 3HOWB 1Q90A 3HKZB 1JOQA 3D6WA 1E0BA 3DWPA 3RZDB 3RMHA 3G6JB 1F2YA 3A7LA 3D3RA 2XWBB 3GTMB 2B39A 2NBFA 5JEAJ 1C4QA 4IUQA 2BE5C 4DGZA 4A3GB 1D5MC 5IODA 2K04A 1TVXA 1I3QB 2AQ3B 4IUNA 1K8OA 1VMPA 3I8ZA 2MJ8A 2F0QA 3VA5A 2CHBD 1Z7TA 4NP5A 1EEFD 1LTAD 2LS01 2JA6B 4KV6A 2ENBA 1BBXC 3A55A 5T1IA 4ABNA 1BXTA 3U9OA 1ML0D 2R6GA 1Q1EA 4PV1C 2AUJD 1F9SA 5A2QL 1T5EA 3RUZA 4DU9A 2PO4A 2I46A 1I4QA 1CA6A 5ELCA 4IZ8A 3KBXA 1NR4A 3K58A 2EYOA 3FKIB 2WB1B 2VNUD 1TS4A 1RJTA 5F2DA 4C3JG 1I4PA 4X3KA 4C3HB 4YIJA 4G7OC 2NN6G 4RHRA 4PQXA 2D62A 2K6AA 1DOKA 2QDBA 2Q8IB 2DNCA 5C3XA 2FHTA 2OEOA 3SK5A 4XXEA 1EWCA 1KAAA 1JCKB 5IGEA 5J39A 3A54A 2JXMB 1MGSA 2B8GA 4XT3B 5FKAC 1SFOB 3O13A 2WACA 3UI2A 4RH6A 5EKIA 2CW0D 3MC0B 1XTCD 1BNZA 4IFDJ 1MBYA 2PYKA 1G2SA 4L63B 2IT1A 2F0EA 3T16A 1OXSC 1U4PA 1ILQA 2WKCA 2KEDA 4XTCS 3URYA 5IGCA 3BS1A 4ZRZA 1CM9A 5IGBA 5KRUA 2WINB 1Y8PB 3T13A 2F0NA 2J4XA 2A69C 1KNEA 1AFPA 4A3BB 2OXPA 3PIP3 1WTQA 3K59A 2AQ1B 1BO0A 2Z4HA 2KEEA 1F77A 1TWGB 4LMQD 1TWFB 1LTBD 4R9WA 5C3WA 1YNJC 3OWFA 4WFN3 1TWCB 3RLFA 1V1OA 3DMUA 3A56A 3MFGA 1Y1WB 4IUTA 1DYQA 5C5LA 4HR7B 2LKVA 3H6MA 1RTOA 4IN3A 1IYVA 5EKLA 2DNEA 2PZTA 5E3FA 1IW7D 4ILWA 3V2TA 1SAPA 1WTWA 1QNKA 1DCZA 1KDCA 2A6HC 3M3YB 4KY5A 5ELFA 2L5TA 3PIO3 5C4JB 1GXDC 1B2TA 3T51B 4MN3A 3QB3A 4HTHA 1RTNA 2F1MA 3MXPA 5K36H 1W6JA 4K5XA 4CKEA 2EPBA 2K32A 3M4YA 5ELBA 4J6HA 4DF7A 2SEBD 3S1MB 3P20A 1CHPD 1IKMA 3D6CA 3GD7A 2F0PA 3LX0A 2PPBC 4QUCA 3JAML 2SOBA 3VA7A 1WTVA 2OF1A 1RDPD 1O7ZA 2GA4B 1D5ZC 3BZDB 4KD3A 2RKSA 4A3MB 2EZVA 5LL6S 4G7HC 3SK6A 1TKWB 1PFNA 1HHVA 2ZT9C 1BF4A 1RKNA 1TR5A 1H9MA 4RFBA 4DK0A 4XQJA 1B50A 1STBA 2NB0A 3LWEA 1OXVA 2N88A 1JB3A 1GHKA 4EQPA 3GO5A 5AFWA 5KNBA 3OMCA 1TT2A 4TSSA 1S5CD 4UDUC 5EGTA 4Z9CB 1SNCA 1GUOA 5E1FA 1BCPD 3HGBA 5EPJA 1PRTD 5COYA 1CZGA 3SE0A 1JQYD 1TY2A 3FMCA 3QJYA 3K5MA 3S1RB 1D5XC 3A8KE 5CV7A 2BE5D 2F0WA 5EKKA 2K28A 4PNYA 1PTOD 4HMIA 1EU4A 2B2TA 3P1HA 3D8GA 4CKCA 1PLFA 5KEEA 4G7ZC 2HDLA 5KIXA 1L0YB 3NQTA 2B2UA 2K03A 2I07B 4KKSA 1I50B 5T1GA 3OSOA 1EFID 1D2BA 3BYYB 1D6EC 4ODGA 2WIIB 5CGKA 2E2HB 4KJOA 1I4XA 1HQMC 2NVTB 3V05A 2B2TC 3BVZA 2RVLA 1CFMA 3H3VC 3I90A 2EYJA 5HGTA 3MXUA 1NCVA 4ID6A 2R61A 1S5BD 1TU2B 4G57A 1B1ZA 4KMUC 2B2UC 1QG7A 1HA6A 3OHXC 5C4XB 5JVG3 4L6TB 3TP7A 2H4OA 1TS5A 4QIWB 2IJ0A 2PNRC 3GTGB 2QKIC 3BVMA 2F3WA 3TSSA 2F3VA 3KUPA 3DEPA 3I91A 5D3IB 1QJOA 1SYFA 3BYTB 3HP3A 1PFMA 1B9MA 5DM73 2AWOA 2FMMA 1G2TA 1L0XB 3GQBA 3MXGA 1WTRA 1HRJA 2D9UA 1ET6A 1D1KA 3P75A 1V8QA 1KDAA 2EY2A 3ITPA 2EJFC 2F0SA 5M3MB 1JE4A 3DHQA 5BN5A 3CQZB 1BR9A 5CMDA 2SNSA 2MPMA 4KTAA 4F88A 1JOOA 5E4XA 3KLRA 3EA6A 4DNTB 5C0XJ 1F2MA 1XX8A 3FEWX 5IOCA 4QF4A 4QCLA 2JA8B 5ELEA 1TIID 4K8JA 3N52A 4TQUS 4JK1C 1EQTA 3GTOB 2VB2X 3NHHA 1HQRD 4PMBA 1A3UA 2F0VA 1SYCA 1PXUA 5M5XB 1I4RA 1VF5C 2FINB 2B8FA 1AZQA 2QF7A 2M9VA 5FLXL 5JEAH 3NSWA 3X3NA 2KA7A 1WTOA 3K0YA 5JPNC 5IT9E 2L4NA 1W6KA 1NUCA 1G91A 1Y69U 3FDTA 1STNA 2XSCA 4J8QA 3U9SA 1PZJD 2PQEA 1QCBD 2JP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VA5 A;  3QOJ A;  3BDL A;  4NP5 A;  2EYL A;  2F0J A;  3E5S A;  2PYK A;  2RBM A;  3OMG A;  3QB3 A;  4K2K A;  3MVV A;  4HTH A;  4OL7 A;  4WOR A;  3SXH A;  1IHZ A;  1F2Z A;  1II3 A;  1KAB A;  1SND A;  4LAA A;  3MXP A;  2F0E A;  3T16 A;  5C6A A;  4KV6 A;  2ENB A;  5CV7 A;  5IGF A;  5J22 A;  4K5X A;  2EY1 A;  3U9O A;  5CV9 A;  4NDX A;  5KGU A;  3NXW A;  4S3S A;  4J6H A;  4K14 A;  1EQV A;  1U9R A;  3SK4 A;  3T13 A;  4KY6 A;  4DF7 A;  5HGT A;  2F0W A;  1A3T A;  3MZ5 A;  4PMB A;  5EKK A;  4RKB A;  5IGC A;  5KYL A;  4PNY A;  2EY5 A;  2F0L A;  2F0T A;  3C1E A;  3S9W A;  3P75 A;  4HMJ A;  2F0F A;  1EZ8 A;  4HMI A;  4KJN A;  3SR1 A;  5IGB A;  5KRU A;  4E6I A;  4RKL A;  4K6D A;  1EYA A;  1A2U A;  2EY6 A;  3D6C A;  1A2T A;  1EY5 A;  3EJI A;  1KDA A;  2EY2 A;  3P1H A;  2F0D A;  2O4X A;  3HZX A;  4NMZ A;  2F0P A;  2KQ3 A;  3ITP A;  1A3V A;  3D8G A;  3RUZ A;  4F7X A;  1EYD A;  2F0N A;  2F0I A;  2F0S A;  2PZW A;  3BDC A;  3LX0 A;  5KYI A;  3DHQ A;  5IGG A;  5KEE A;  4IZ8 A;  3NK9 A;  1STH A;  4H7B A;  5I9P A;  5J1Z A;  5KIX A;  2OXP A;  1EY8 A;  4WRD A;  5CV4 A;  1ENC A;  4ME5 A;  2KHS A;  1JOR A;  2SOB A;  3NQT A;  2OF1 A;  2SNS A;  4ZUI A;  1EY7 A;  2HQE A;  2EYO A;  3NP8 A;  4KTA A;  4EQN A;  1ENA A;  5C5M A;  3ERQ A;  1JOO A;  4KHV A;  4R8N A;  4K8I A;  4ZQ3 A;  5HUR A;  5K5P A;  4KD3 A;  1SYG A;  2RKS A;  3OSO A;  5F2D A;  3TP8 A;  3SK8 A;  5C4Z A;  5C3W A;  4YIJ A;  3OWF A;  2RDF A;  1F2M A;  4ODG A;  3HEJ A;  5IOC A;  4QF4 A;  4N9T A;  4NKL A;  4EVO A;  4ZUJ A;  3DMU A;  1SYD A;  5I9O A;  4F8M A;  3C1F A;  4K8J A;  5CGK A;  2NUC A;  2SNM A;  3SK6 A;  4QB4 A;  2PW5 A;  4KJO A;  1NSN S;  5NUC A;  1SYB A;  3D4W A;  5C5L A;  1STA A;  2F0U A;  1SNM A;  3D4D A;  3NHH A;  2EYJ A;  2EXZ A;  2F0O A;  5DAU A;  2QDB A;  4PMC A;  4KD4 A;  4N9P A;  1A3U A;  1RKN A;  2F0V A;  1SYC A;  1EZ6 A;  1TR5 A;  2LKV A;  4ID6 A;  4IAL A;  4J1M A;  5DEH A;  4DFA A;  1SNQ A;  5C3X A;  5CC4 A;  1JOQ A;  4DU9 A;  5M9O A;  4K2L A;  3H6M A;  4QMG A;  1F2Y A;  2OEO A;  1STB A;  3SK5 A;  3MEH A;  4G57 A;  3SHL A;  3NUC A;  3QOL A;  1KAA A;  4MIU A;  4B9W A;  5CR3 A;  1SNO A;  5ISR A;  4KY7 A;  5CV5 A;  3R3O A;  5CV6 A;  4EQP A;  3TME A;  1EY4 A;  2EYH A;  3TP5 A;  2EYP A;  2PZU A;  5EKL A;  5IGD A;  5IGE A;  3OMC A;  2PZT A;  3ERO A;  1SYE A;  5E3F A;  1TT2 A;  5J39 A;  4K5V A;  3TP6 A;  3MHB A;  4I65 A;  1TQO A;  1EY0 A;  3PMF A;  3TP7 A;  5JAV A;  3V2T A;  1KDB A;  1STY A;  3EVQ A;  4B9X A;  4DGZ A;  5IOD A;  1SNP A;  2EYM A;  5EGT A;  1STG A;  1NUC A;  2F0M A;  5I6W A;  2M00 A;  1EYC A;  1SNC A;  1AEX A;  2F3W A;  4IUN A;  2WAC A;  5IIF A;  1STN A;  2PW7 A;  2F0H A;  5E1F A;  2EYF A;  5C4H A;  1JOK A;  1KDC A;  2F3V A;  4TRD A;  5CV8 A;  5I6Y A;  4KY5 A;  4EQO A;  5JOB A;  2PQE A;  1EY9 A;  4K5W A;  1SYF A;  2F0G A;  2F0K A;  2F0Q A;  1EY6 A; 
#chains in the Genus database with same CATH topology
 1I4G A;  1RCV D;  4JV5 L;  4JW0 A;  3FKI H;  4BBR G;  1Z6H A;  3Q23 A;  3H94 A;  1CA5 A;  1CUK A;  2XGT A;  2EIF A;  4A76 A;  5E4W C;  3J81 i;  4B08 A;  4C3H H;  2ES2 A;  2EY1 A;  2IX0 A;  3NXW A;  4RAU C;  4S3S A;  3X3M A;  5JJI A;  2LXK A;  2RHS B;  4YCW A;  2EY6 A;  4LW1 A;  2EE1 A;  4DR2 L;  1A63 A;  3A5Z B;  4IPH A;  3BDC A;  2ATW A;  3CHB D;  1N36 L;  2NTS A;  1JJ2 A;  4C3J H;  1STH A;  4R8I A;  1WTH A;  4A3K B;  4FXG C;  2UXB Q;  3RD4 A;  1VQ9 A;  1CT1 D;  1HTL D;  2HQE A;  1A15 A;  3NPP A;  1VQC A;  4HJA A;  4BBS B;  4KHV A;  2ZM6 Q;  3TP8 A;  3HKS A;  1FD7 D;  1H9S B;  1S3O A;  1GOZ A;  1H9R A;  4IJL A;  1V1P B;  2EDG A;  1HUM A;  3RLN A;  1DOL A;  1UWV A;  1JIC A;  2N55 A;  5DNF A;  5CBA E;  5M3F G;  1SFO H;  1SYD A;  5D14 A;  1W2B A;  1Q81 C;  3QR8 A;  4G4K A;  1WOC A;  1DXM A;  3KDF B;  5NUC A;  2M2L A;  1CI3 M;  2A6E C;  4TKO B;  2A68 D;  2K5W A;  4O42 A;  4CJ2 C;  5JPM C;  4BA1 I;  4R4C A;  4DFA A;  3CRL C;  1CKO A;  4RGM A;  1JJC B;  1SLJ A;  2RSO A;  4IUP A;  4Q5V A;  1J5E L;  1K3R A;  2RA4 A;  1E2V A;  3EN2 A;  5KND A;  1XMO Q;  3BVG A;  1EOV A;  3K7U C;  2G9H D;  4PZ6 A;  1JMC A;  1SYE A;  2YTV A;  3H3V I;  4K5V A;  3PUZ A;  3L3O C;  4NW2 A;  3MXN A;  2F3I A;  4RMF A;  1N32 Q;  1BCP F;  1TS2 A;  1S5D D;  2HUG A;  4B3M L;  4LJZ C;  3J7Y W;  1PRT F;  2M00 A;  1Q3L A;  4HIM A;  3VYT A;  1X56 A;  1YNX A;  4C3J B;  3WOF A;  1XPU A;  3QG1 A;  3GDE A;  1FYC A;  1EY9 A;  1O7L A;  4K5W A;  1EQR A;  3DXJ C;  4A3B H;  4I7Z C;  4NKL A;  3M7G A;  4KKU A;  2GVB A;  3AMU A;  4IFD H;  2EYL A;  3E5S A;  4IPC A;  2UU9 Q;  1ZEQ X;  1Q12 A;  5LHY 1;  5FJ8 G;  3K57 A;  5JVH 3;  1QZG A;  1PTO F;  2J0T D;  1TWF H;  1MD2 D;  4OWX B;  2WP8 J;  2E2I H;  1LTG D;  4X3S A;  2ZJQ A;  4GNX B;  1AE3 A;  2IW3 A;  3VR6 A;  1KLU D;  1Y14 B;  4HCS A;  1I94 Q;  2F0T A;  1HCZ A;  2L0C A;  2LXJ A;  3K5N A;  2ZJR A;  3TRZ A;  1GUW A;  3EJI A;  5C3E B;  1F9Q A;  1BDO A;  2KQ3 A;  3PQI A;  1IKL A;  4H7B A;  4R4Q A;  1I6V C;  5H1S E;  2XN9 C;  4AH6 A;  5ELO A;  1P16 A;  1F9R A;  3ND8 A;  1NAP A;  3EIV A;  3KDF A;  3DUZ A;  1N34 L;  3C46 A;  3CCM A;  5C5M A;  1PYB A;  1N33 Q;  4ZQ3 A;  1PH1 A;  2YTY A;  5K5P A;  1B7Y B;  5C4Z A;  2VS1 A;  4XQQ A;  1J8I A;  1HTP A;  2PMZ B;  2RDF A;  4Y52 H;  4HJ7 A;  2X69 A;  3I3C A;  4HIO A;  2VZA A;  3M3Y H;  1WCM G;  1S4Z A;  4OWW B;  3JC6 6;  1SXT A;  4JVZ A;  2NZ1 D;  4KD4 A;  2XIW A;  2R3Z A;  1HJP A;  5C4J H;  4J1M A;  1VQA A;  1SNQ A;  3MA2 B;  2UUB L;  4RGO S;  1N8R C;  2OQK A;  4KLK A;  3QOL A;  5ISR A;  2UXC L;  3F1Z A;  3HRZ C;  1EY4 A;  3PO3 H;  2E2I B;  2LMC B;  1SMY C;  4ZYS A;  5COR A;  3EBE A;  5C44 H;  1SE2 A;  5JJL A;  3S1M H;  1IL2 A;  1KDB A;  3CP0 A;  1V1Q A;  1Y1W G;  1K0S A;  3J80 c;  3L9A X;  4FP5 D;  1KNA A;  1AEX A;  3NTI A;  1GUG A;  1HNW L;  4TVA B;  2F0H A;  2NVQ B;  4C3I G;  5AJ3 Q;  4DXG A;  1PDQ A;  3GTK B;  5DM6 3;  3Q0A A;  1UE6 A;  4GNX A;  4CGY B;  1FJG L;  1KXL A;  1BKB A;  4LF7 L;  4OWT B;  4WOR A;  5FLM H;  3H3V H;  3BG3 A;  5C6A A;  5J22 A;  4FO2 A;  1QNU A;  3EFX D;  2ZXR A;  4A3M H;  3I55 A;  4A3F B;  1K28 A;  2K5Q A;  1EOT A;  4DK1 A;  4AQY L;  3K5L A;  1HNZ L;  4L5S A;  4CDE C;  3S9W A;  4KJN A;  4HMJ A;  1VCI A;  3D31 A;  4E6I A;  4RKL A;  1FR3 A;  1A2T A;  3J80 L;  1JC7 A;  1D7Q A;  3ZYY X;  4JI6 L;  1EYD A;  5GQO A;  2F0I A;  5J3B A;  1B53 A;  3AB9 A;  4DUZ Q;  4AYB E;  4CKB A;  1U4M A;  3CPF A;  1MI2 A;  2F03 A;  4HIK A;  4GNX C;  1R4Q B;  1BBW A;  1S5E D;  3GTQ H;  1JOR A;  3S1N H;  1ZYR D;  2HIV A;  4DN4 M;  5CYU A;  1XNQ L;  3PO3 B;  1H95 A;  4HID A;  2C5C A;  4H0L C;  1MKH A;  3FP9 A;  1QWY A;  1STE A;  4R8N A;  1X3E A;  4AYB G;  5HUR A;  5C44 B;  3SK8 A;  4ZKC B;  3CXC A;  2AHO B;  3VYR A;  3PF4 A;  4R1J A;  2K75 A;  4FXK C;  1H9J A;  1UE1 A;  2B2V A;  4QUF A;  1CQV A;  3SVM A;  3TQY A;  4DR6 L;  3LNN A;  4I7A A;  1K8G A;  3KBG A;  3KF6 B;  4LF5 Q;  1SYB A;  3J80 i;  4A3C G;  1CHQ D;  2PNH A;  2PCF B;  1YNN C;  4DV7 L;  2E2J H;  2F4I A;  4XYQ A;  1A62 A;  2EJM A;  3OWE B;  3VR4 A;  3PO2 G;  1HR0 W;  3T56 B;  1O7Y A;  1VQ7 A;  2WAQ E;  1Z47 A;  2BCO A;  1KLG D;  3IKJ A;  1VQH A;  3J81 E;  5HGQ A;  2EYH A;  5EBD A;  3LGJ A;  1M8A A;  4O2D A;  3TRE A;  4MTK A;  3TP6 A;  3KLW A;  4I65 A;  5IYB H;  2WAQ G;  3AEV A;  3OIP A;  4ZKB B;  2K05 A;  1SNP A;  2EYM A;  1QIL A;  2E74 C;  4X3U A;  2B2V C;  5IY0 A;  3HOU H;  3QIA A;  5IIF A;  3JAM i;  4A93 B;  2MP1 A;  3A7A B;  4V19 0;  3GTQ B;  5K36 G;  3S1N B;  2OCE A;  1YEZ A;  3G48 A;  2IX1 A;  4RGN A;  1BQQ T;  3QOJ A;  1H9K A;  2FJ2 A;  4L5Q A;  4X62 L;  3MVV A;  1EU3 A;  2VQE Q;  3MWY W;  2FFK B;  1L0W A;  2QEX A;  4LAA A;  1I50 H;  2UUB Q;  4JI5 L;  2EXD A;  1ESR A;  1M1K C;  5M5W H;  3T1Y Q;  3PUV A;  4H13 C;  2L9H A;  4Y7N B;  4JBM A;  1FNU A;  2BDN A;  5C0X I;  1WD1 A;  2NVT H;  2AUK A;  2Z6K A;  2E2J B;  4UY8 C;  1LTI D;  3E0E A;  4JI7 L;  3I56 A;  2K5V A;  4JYA L;  3R93 A;  5I9P A;  5J1Z A;  2CVR A;  2E76 C;  3A8J E;  4U68 A;  1X3F A;  1ENC A;  3ULJ A;  1AP0 A;  4A3I G;  3WOE A;  1Y8N B;  5D3D A;  2E75 C;  5C4X H;  2JA9 A;  3ERQ A;  3I2Z A;  3ULP A;  2JA5 G;  2CW0 C;  5A2Q E;  4FF1 A;  5BN4 A;  4LF7 Q;  1D1I A;  2QW7 A;  1QB5 D;  2KCN A;  4N9T A;  2QEJ C;  5I4D A;  3HOU B;  2R92 G;  3GTG H;  3BZC A;  4LF4 L;  2JYO A;  2NUC A;  2D2C C;  1NSN S;  2QIL A;  3QWN A;  3HG9 A;  4HAE A;  3NBH B;  2Y0S E;  4AQY Q;  1E2Z A;  1HNZ Q;  3UDX A;  4YWK A;  1SNM A;  5LMN Q;  1KQS A;  4DNR B;  3CU7 A;  4U67 3;  1EZ6 A;  1CK1 A;  3I4N B;  1F9P A;  1HZ9 A;  1K9M C;  3IAY A;  4NXM L;  2F52 A;  2Y0S G;  1EWH A;  4JI6 Q;  1K8M A;  5M5W B;  3R3O A;  2LSS A;  1X55 A;  2EYP A;  2PZU A;  2Z4I A;  3FRP B;  4OO1 H;  4IOA A;  1SDF A;  4B9X A;  2K1B A;  3PF5 A;  3Q24 A;  3RLO A;  2R7F A;  4BS9 A;  1EYG A;  1HFN A;  1STG A;  1CKN B;  2VXW A;  1Q8I A;  1GVP A;  3CME A;  3T1H L;  3TS0 A;  1SEB D;  2K52 A;  3I4M B;  4GKK L;  4DAP A;  3HOY B;  4BY1 H;  3CQZ H;  1GUS A;  1G6Z A;  1JT8 A;  1J9O A;  4DV3 L;  4BY7 G;  2RBM A;  3SXH A;  1AZP A;  1WI5 A;  5G3L D;  1KAB A;  2VY3 A;  5L37 A;  2MO1 A;  4RHS A;  1M90 C;  1EIH A;  4A3D H;  3H0G G;  1SJE D;  1GD7 A;  1PH6 A;  5FOB B;  1SRU A;  1EQV A;  4FVM A;  3E6Z X;  1CQF A;  2DJG C;  1X9N A;  1DGS A;  2QCP X;  3C1E A;  1CZW A;  3J7A V;  2Z6B A;  4DV1 Q;  1BCP B;  2Z1C A;  4K6D A;  3GTO H;  2R7Z G;  3TS2 A;  1EY5 A;  4YHH L;  3NEL A;  1QOH A;  4EQN A;  4A3E B;  1PRT B;  2CQA A;  1PH8 A;  4WJ4 A;  4DV4 L;  3CCJ A;  1VQE A;  4HCE A;  1VQI A;  4OEM B;  2IPK D;  1HXY D;  1ROD A;  2NN6 I;  1VQ4 A;  4KKT A;  1HFG A;  1PFB A;  4CBV A;  1V43 A;  3NP8 A;  1PFS A;  1RD9 D;  3NBH A;  4DR7 Q;  1DJR D;  1PTO B;  3UDF A;  2KJX A;  5C0X H;  3H09 A;  2BA1 A;  2HIX A;  2IY5 B;  4HJ8 A;  5FO8 B;  2CH4 W;  3OW7 A;  2A5H A;  1IBK L;  3PUX A;  1Y8O B;  2KOL A;  1E2W A;  3SR1 A;  4BY1 B;  4M8A A;  1YJ9 A;  4HSP A;  5DEH A;  1N9W A;  3Q8D A;  1K83 B;  1LT4 D;  2AKW B;  5FLX c;  1GUT A;  1PH9 A;  4WJ3 M;  3CRK C;  2B63 B;  3NUC A;  4JI7 Q;  4JYA Q;  1CKN A;  4A3D B;  2JEB I;  1WTX A;  2JA8 G;  4JI8 L;  4IQZ A;  3GTL B;  2PQA B;  4CHT B;  4LF6 Q;  4FF2 A;  2A69 D;  1KIX A;  3EVQ A;  2NTT A;  1YHQ A;  4OIK A;  1O78 A;  4LUO A;  1VQ6 A;  4LFA Q;  2KHJ A;  4DA2 A;  1P8L A;  2K5H A;  2N78 A;  2Q8R E;  3ZJY C;  3HOV B;  3J7A F;  5EQ0 A;  1DZ1 A;  3WWV A;  2F0K A;  2O2L D;  1SJH D;  4LK1 C;  1EY6 A;  4A3K H;  1XNR Q;  1Y1V G;  4A3J B;  1MJC A;  4APV A;  3HKZ E;  3STB D;  1YNJ D;  4IFD I;  4K2K A;  2XWJ B;  3DWA A;  3VYU A;  4BBS H;  4PZ7 A;  1II3 A;  1SRO A;  4C1N I;  2D5D A;  1IBL L;  5BN3 A;  3IFD A;  3ULL A;  3HOW G;  3HKZ G;  3SK4 A;  4KK7 A;  3IFT A;  3C2P A;  4RKB A;  2KUM A;  1LAB A;  2K14 A;  1EZ8 A;  3ND9 A;  2I5L X;  4DR5 L;  2FMC A;  4K6L A;  2F0D A;  2O4X A;  3AU7 A;  4A4I A;  3E0J A;  2PZW A;  2A8V A;  2CKZ B;  4H44 C;  4BA2 I;  4R4I A;  2VUM B;  1PV4 A;  3MTS A;  4DV5 L;  3MAQ A;  1K8A C;  4A3G G;  5LL6 X;  4DV2 L;  4ZUI A;  1EY7 A;  5IYC G;  2I5H A;  2UUA L;  2E2D C;  1BCP C;  1LLR D;  3NQI A;  5ELD A;  1NY4 A;  4GN3 B;  1PRT C;  2A6H D;  2L15 A;  3VR5 A;  1A6X A;  1FVI A;  1JWM D;  4ZUJ A;  4BBR B;  5I9O A;  2VB3 X;  2Q2H A;  2EJG C;  3EQL C;  4QB4 A;  2PW5 A;  4CJ1 B;  3D4R A;  3JAM E;  5I2X A;  4DR1 L;  2JK8 A;  4GZY C;  4V0B A;  2Q2I A;  4DUY L;  5IWA L;  4JI2 L;  3M7N A;  4QGU A;  1FGB D;  3A0J A;  1IXR A;  2F0O A;  2IL8 A;  2LFN A;  2JA6 G;  4PMC A;  2NN6 H;  3LWU A;  3FHW A;  4IAL A;  3F2U A;  2PQA A;  1PTO C;  5JEA G;  3VDY A;  2JSO A;  4C2M B;  1PMR A;  4ALP A;  4KY7 A;  3NE5 B;  4B3S L;  1I4H A;  4F87 A;  4BWG B;  1B3A A;  3TP5 A;  2R93 H;  4FYD A;  1VQP A;  2WB1 E;  1LTT D;  2UXD L;  5IP9 H;  2H1E A;  2HHH L;  4LUZ A;  2HDM A;  2P5Z X;  1B44 D;  2XNA C;  4CDD C;  1VQF A;  2EOT A;  2CFM A;  4DNI A;  4X6A H;  3W2D A;  1YNN D;  2F0M A;  2B2W A;  2V1C C;  4GLA C;  1XWE A;  5I6W A;  5C3E H;  2KBN A;  1HH2 P;  2IHF A;  3FKI G;  2WB1 G;  2EYF A;  3ONA B;  4TRD A;  1WTP A;  1UUP A;  1VMC A;  4C3H G;  5M3F B;  4KN4 C;  3PUY A;  3OMG A;  3HOX H;  1K73 C;  5D65 A;  1VQD A;  1LO5 D;  3NWS A;  3I70 A;  5IGF A;  4CJ0 B;  4HJ9 A;  3SDZ A;  5KGU A;  3Q22 A;  1LT6 D;  2ICI A;  1IBM L;  1KTK A;  1YBY A;  1NR2 A;  4XIG S;  2EY5 A;  2F0L A;  2L12 A;  2YTX A;  3BZK A;  4OX9 L;  3S2H H;  2JA7 H;  1X3G A;  3OOC A;  1XPR A;  2MUY A;  1EYA A;  1AW7 A;  2B2W C;  5TSS A;  1OXU A;  4NMZ A;  3HZX A;  2KCC A;  4KHP Q;  1QVG A;  3RN5 A;  1HA5 A;  1HNX L;  1EY8 A;  1JWU D;  4A75 A;  1UEB A;  4RCO A;  4OHJ A;  3DWQ A;  4XYO A;  2R93 B;  5A35 A;  2L1B A;  1ILP A;  1ONL A;  1EEI D;  4MZ9 A;  1GUN A;  3HS0 C;  3KK7 A;  2JEA I;  4JBW A;  3K7A H;  1G51 A;  4JI1 Q;  3RR5 A;  1HPC A;  3T4A C;  4JI0 Q;  3FVQ A;  1R4P B;  4XDX A;  3C1F A;  2A19 A;  1YHA A;  2BOS A;  3F2D A;  2NVQ H;  5EJW A;  1H9S A;  3GTK H;  1V1P A;  2K33 A;  2PMZ E;  5DAU A;  1PH5 A;  2E8G A;  1UE7 A;  5CC4 A;  2IWH A;  5M9O A;  3HOX B;  4WJW A;  1RF2 D;  1DON A;  2G5D A;  2BA0 A;  4DR5 Q;  3WDN A;  4JV5 Q;  3Q6S A;  1X65 A;  4JI3 L;  1XYI A;  3TBI B;  1AN8 A;  4K0K L;  1RHP A;  4A3F H;  1BUV T;  1LAC A;  2CQO A;  3FPU B;  5M5Y H;  1DD2 A;  1TQO A;  1EY0 A;  3KLS X;  3PMF A;  1X3Q A;  3S2H B;  2JA7 B;  1OO9 B;  2X6L A;  1FNW A;  4A3B G;  1M4V A;  1C0A A;  2ZXP A;  2B29 A;  4PZ8 A;  4IFD G;  1MSH A;  2KEN A;  1PZI D;  2OTJ A;  3S16 B;  5G3L F;  4DR2 Q;  1FL0 A;  1UEA B;  3W1G A;  2XRQ D;  1N36 Q;  4B3R L;  4DR1 Q;  1T5X D;  3CKI B;  3VYS A;  1RIP A;  3NTH A;  1JJG A;  2Q2U A;  5IWA Q;  1RL2 A;  4XT1 B;  5KNC A;  2YYZ A;  3DM3 A;  4X64 L;  1XMQ L;  1WCM B;  3K0X A;  3K7A B;  3L7Z C;  1C9O A;  3S14 B;  5IP7 H;  1DM0 B;  2Z9H A;  2J7Z A;  3AFQ A;  2Q8T A;  3TN2 A;  2RSN A;  3R8B A;  2DGY A;  4UPA A;  3MZ5 A;  1ESF A;  2O5I C;  3N6R A;  2XRS D;  4O1N A;  2B3G A;  3GP7 A;  4KI0 A;  4DR4 L;  3QO2 A;  3NWT A;  5IGG A;  4X65 L;  3KJO A;  1S5F D;  4OIJ A;  1MSG A;  2UUC L;  1LT3 D;  2Z8L A;  3S1Q H;  1PHJ A;  3I4O A;  2ZTE A;  1J5E Q;  3HOZ H;  4MHE A;  1G29 1;  5GAH C;  4JCV E;  5M5Y B;  4C3I B;  2A73 B;  2E5L L;  1VQB A;  4DV0 L;  1E3P A;  2HCC A;  1OXX K;  1ENF A;  3BDO A;  1NTG A;  2RDH A;  2N3S A;  3CC4 A;  2DY8 A;  4B3M Q;  2JE6 I;  4HN7 A;  4HSV A;  1B3Q A;  3R2T A;  1OXT A;  1ZXT A;  1SE4 A;  3CW2 C;  2MHV A;  3D4W A;  4IUR A;  4ZK9 B;  4A93 H;  3SEB A;  3PO3 G;  2BDO A;  1EIG A;  4EQO A;  4JI4 L;  5IT9 L;  4OX9 Q;  4ULL A;  2A74 C;  4K2L A;  2ID0 A;  3K8A A;  1IYJ B;  5CR3 A;  4PMW A;  5CV6 A;  2OTL A;  1GHJ A;  2I5M X;  5IGD A;  1K3B C;  3S2D H;  4FF4 A;  1TWA B;  2TMP A;  4OO1 I;  4P2C B;  4Y7N H;  1SMX A;  1YVC A;  2DN8 A;  1STY A;  2G9D A;  1PYW D;  5CBE E;  1V9P A;  3PV0 A;  3TZU A;  1JWS D;  2IHE A;  3NEM A;  1F2L A;  2D0P A;  4IUU A;  2NWG A;  1ZKO A;  2PW7 A;  4AYB B;  5FLM G;  2LY7 A;  3IRB A;  1Q8K A;  1SBB B;  2DJF C;  3S1Q B;  3R2I A;  1TWH B;  5FLX E;  4A3M G;  3HOZ B;  1I5F A;  1DOM A;  3DLL A;  2RHQ B;  4OL7 A;  1SN8 A;  1VF7 A;  1SSO A;  2A68 C;  2ZTD A;  1N34 Q;  1EUJ A;  4RWS C;  1PA6 A;  3K6O A;  5CV9 A;  2JQO A;  2OWO A;  4K14 A;  1U9R A;  4UAI A;  3PO2 B;  4YCV A;  5I2Y A;  1A3T A;  1E7Z A;  5KYL A;  1WD0 A;  3MFY A;  1EWI A;  1X6O A;  1TS3 A;  4JPB W;  4DKA C;  3TDQ A;  2ASB A;  1A3V A;  4UP9 A;  1U4R A;  3I4N H;  2WAQ B;  2V4D A;  2L55 A;  1J6Q A;  1Z9F A;  1Q1B A;  2KHS A;  3M85 A;  3K80 C;  2MGS A;  3NEN A;  1JR0 D;  2HQL A;  3S2D B;  5IYD H;  1PZK D;  3E3X A;  3A8I E;  1QE6 A;  1UAP A;  4POF A;  2K7V A;  2NYZ D;  4K8I A;  2UXC Q;  3ER0 A;  3AFP A;  4X64 Q;  4EVO A;  2HCI A;  3I4L A;  3GTP H;  3E9H A;  1EIF A;  2SNM A;  3I4M H;  1SE3 A;  1STA A;  2F0U A;  3HOY H;  3D4D A;  3KOJ A;  4LF9 L;  1HNW Q;  3CCS A;  1LV9 A;  4N9P A;  1IYU A;  4B3T L;  1X32 A;  3M4O B;  3NTK A;  4RCN A;  3KF6 A;  4RGT A;  1YIT A;  5IYB G;  4YCU A;  1FJG Q;  1PYS B;  4L8J A;  4DR4 Q;  4MIU A;  4LF8 L;  1L2F A;  1C48 A;  5CV5 A;  3TME A;  4ZLT F;  3W3A A;  1LT5 D;  1O7I A;  2DUD A;  3HOU G;  4J15 A;  1IL8 A;  3G7L A;  2XVS A;  1R9T B;  2ICE C;  2NVX H;  4DK6 C;  1K0R A;  4P73 A;  4A3I B;  2RQX A;  1G6P A;  5FK9 C;  2B2Y A;  1WVL A;  4A3E H;  1MJE A;  1VQL A;  2H5X A;  1NE3 A;  4UP7 A;  2JA5 B;  1JOK A;  5I6Y A;  2NVY B;  5JOB A;  1EL0 A;  5JJZ A;  2F0G A;  3S17 B;  4ME3 A;  2R92 B;  4DAY B;  4OGQ C;  3TZD A;  3BDL A;  3HFZ B;  3C3L A;  2SDF A;  3OIQ A;  4DXF A;  3H91 A;  4BXX H;  1XNQ Q;  1UNS A;  5BR8 L;  1SND A;  4DV6 L;  2R7Z H;  1CTM A;  1PTO H;  2PI2 A;  2A6E D;  1W3S A;  1U4L A;  1B4O A;  4NDX A;  4LFC L;  3GTP B;  4KY6 A;  2MFI A;  3OYY A;  3S15 H;  2Y0S B;  4FDB A;  2KVM A;  4QIW E;  4YWM A;  2B2Y C;  1PH4 A;  5FO9 B;  4DR6 Q;  4F7X A;  1QVF A;  1VQM A;  4EGV A;  5KYI A;  1K83 H;  1E24 A;  1PH7 A;  5C4X G;  3VR2 A;  1C8C A;  2B63 H;  4DV7 Q;  2KEC A;  3KLS A;  3VR3 A;  4WRD A;  5CV4 A;  3K5O A;  4XQN A;  4X3T A;  1ENA A;  4FF3 A;  1X3P A;  3GTL H;  4JOI A;  2NVX B;  3UDI A;  4KHZ A;  1XXG A;  3F8T A;  4LWC A;  1NJI C;  1GJX A;  4BY7 B;  1IW7 C;  1ET9 A;  4L5T A;  1BOS A;  1LTS D;  4A3L H;  1VDZ A;  1L1O B;  2ZXO A;  5EAY A;  2IX3 A;  3HOV H;  2AQ2 B;  3H0G B;  3PUW A;  2EXZ A;  1X54 A;  3T53 B;  4A3J H;  1TY0 A;  3DEO A;  2WKD A;  3OPO A;  3GTJ B;  2F4V L;  2VQF L;  4C56 C;  4FNF A;  4OO1 G;  4QMG A;  5EPL A;  3KF8 B;  3GV3 A;  3MEH A;  3SHL A;  4B9W A;  2R7Z B;  1SNO A;  1PH2 A;  1ICW A;  2ZM6 L;  4X62 Q;  1ASY A;  4GLX A;  2EQS A;  3ERO A;  4M1U B;  5FO7 B;  3L2P A;  4JI5 Q;  4JOI C;  3MHB A;  5M3M G;  4UHV A;  3F2C A;  5EPK A;  3P7J A;  3S15 B;  4GN5 A;  5JAV A;  1ZYR C;  1FNV A;  1A8V A;  1Y1V H;  2X6G A;  4BY1 G;  4DAY A;  1EYC A;  1QUQ B;  4DAV A;  3D0F A;  5EBC A;  5C4H A;  3ICE A;  5CV8 A;  3KFU A;  2VUM H;  2ALY B;  4A3D G;  4Q0F A;  3NBI A;  1B8A A;  1JB7 A;  4HED A;  1O80 A;  2C9O A;  2F0J A;  4KN7 C;  4F8M A;  3I72 A;  1IHZ A;  1F2Z A;  4LF9 Q;  2K5D A;  2RDG A;  2TSS A;  1KD1 C;  2K01 A;  3GV6 A;  1N32 L;  3GTM H;  1B9N A;  4CDC C;  3J81 c;  4BBR H;  5GRO A;  4JBJ A;  3OTO L;  4IUV A;  2F0F A;  3PGZ A;  1HUN A;  4A3G H;  5LMN W;  1A2U A;  4LF4 Q;  1I3Q H;  2WV6 D;  4R4O A;  4ZAI A;  3CD6 A;  3V96 A;  1SMY D;  4FXD A;  3NK9 A;  4C2M H;  2YU9 B;  4ME5 A;  5C0X G;  1LTR D;  4DK3 C;  3FPP A;  4RA8 A;  2OT2 A;  4NXM Q;  2EVB A;  1L1O A;  2L11 A;  3I73 A;  1SYG A;  2VW9 A;  3J80 E;  2KCM A;  1Y1V B;  1I6H B;  1G8Z D;  1I94 L;  2DY7 A;  3HEJ A;  4C1N K;  1VQN A;  3J81 L;  4NPS A;  1BBU A;  1A0I A;  2K5N A;  3KF8 A;  3DM1 A;  3IL8 A;  1WYD A;  4LFC Q;  2O5J C;  3RZO B;  5ELN A;  2AWN A;  3HOW B;  1Q90 A;  3HKZ B;  1HR0 L;  5M3F H;  4GS3 A;  3T1H Q;  1JOQ A;  3D6W A;  1E0B A;  3B6Y A;  4H02 A;  4GKK Q;  3DWP A;  1AH9 A;  3RZD B;  3RMH A;  3G6J B;  1F2Y A;  4IOC A;  3A7L A;  3U58 A;  3D3R A;  4DV3 Q;  1N33 L;  4MTN A;  2XWB B;  1QUQ A;  3GTM B;  2B39 A;  1L1O C;  1GO3 E;  2NBF A;  2QDL A;  5JEA J;  1C4Q A;  1GKH A;  3J7Z C;  4IUQ A;  2BE5 C;  4DGZ A;  4A3G B;  1D5M C;  4NXN L;  5IOD A;  4A3K G;  1KAW A;  2K04 A;  1TVX A;  1I3Q B;  1C7Y A;  2AQ3 B;  4IUN A;  2RF4 A;  3F2B A;  1K8O A;  1VMP A;  4BBS G;  3I8Z A;  4YHH Q;  2AMC B;  1OTC A;  2MJ8 A;  2F0Q A;  4DV4 Q;  4DAM A;  1FGU A;  3VA5 A;  2CHB D;  1Z7T A;  4NP5 A;  3BJU A;  1NMF A;  1EEF D;  1LTA D;  5GAD C;  2LS0 1;  2F4V Q;  2VQF Q;  2JA6 B;  4KV6 A;  2ENB A;  1BBX C;  3A55 A;  5T1I A;  4ABN A;  1BXT A;  3U9O A;  1ML0 D;  2R6G A;  1Q1E A;  1HZC A;  4PV1 C;  2CH4 A;  5FJ8 H;  3AQQ A;  2AUJ D;  1GM5 A;  3AYH B;  4AIM A;  2MQH A;  2HT1 A;  1F9S A;  5A2Q L;  1T5E A;  3RUZ A;  4DU9 A;  2N49 A;  2PO4 A;  5AJ3 L;  2I46 A;  4IO9 A;  1I4Q A;  1IBK Q;  3J81 j;  1CA6 A;  5ELC A;  2HD3 A;  2I0Q A;  3K81 C;  4IZ8 A;  3MEF A;  2KHI A;  3KBX A;  1NR4 A;  1CSP A;  3K58 A;  2EYO A;  3FKI B;  2WB1 B;  2VNU D;  1TS4 A;  1RJT A;  5F2D A;  4C3J G;  4JBK A;  1I4P A;  4X3K A;  3L0O A;  4JI8 Q;  4C3H B;  4YIJ A;  4G7O C;  2NN6 G;  2CWA A;  2FXQ A;  4RHR A;  2D0O A;  4PQX A;  3S16 H;  3TEH B;  2D62 A;  1IZ6 A;  4DUZ L;  4GOP B;  4RG1 A;  2K6A A;  1DOK A;  2QDB A;  2Q8I B;  3OTO Q;  1MHW C;  2R93 G;  2DNC A;  5C3X A;  2FHT A;  1QVC A;  2OEO A;  1VQ8 A;  3SK5 A;  4XXE A;  5IP9 G;  1EWC A;  1NBW A;  1WCM H;  1KAA A;  4N8F A;  1JCK B;  1UE5 A;  3S14 H;  4P72 A;  5C3E G;  5IGE A;  1Q7Y C;  1VS0 A;  5J39 A;  2NZH A;  1IBL Q;  3A54 A;  1E1T A;  3PCO B;  2JXM B;  1TWG H;  1MGS A;  2B8G A;  2CCZ A;  4DR3 L;  4XT3 B;  5FKA C;  4LF5 L;  1KRS A;  1TWC H;  2OQ0 A;  1SFO B;  1YI2 A;  3O13 A;  4PG3 A;  2WAC A;  3UI2 A;  3HOX G;  1VQO A;  1PH3 A;  1Q82 C;  4RH6 A;  1Y1W H;  5EKI A;  2CW0 D;  3MC0 B;  4JC0 A;  1XTC D;  1KL9 A;  1BNZ A;  4IFD J;  4NB3 A;  1MBY A;  2PYK A;  1G2S A;  1BVS A;  1HR0 Q;  2MO0 A;  4DV5 Q;  4C3I H;  4L63 B;  4DV2 Q;  2IT1 A;  2F0E A;  2JA7 G;  3T16 A;  2UUA Q;  1OXS C;  1U4P A;  1ILQ A;  2C35 B;  2WKC A;  2KED A;  4XTC S;  3URY A;  5IGC A;  3BS1 A;  4X66 L;  4ZRZ A;  1CM9 A;  5IGB A;  1HZB A;  5KRU A;  2WIN B;  1JE5 A;  1Y8P B;  2XTI A;  3T13 A;  1B70 B;  2F0N A;  2J4X A;  4NXN Q;  4DUY Q;  2A69 C;  4JI2 Q;  1KNE A;  1KC8 C;  1AFP A;  4A3B B;  2OXP A;  2VQE L;  3CCL A;  2Q2T A;  3PIP 3;  2GVA A;  1WTQ A;  3K59 A;  3UE0 A;  2AQ1 B;  1BO0 A;  3T1Y L;  2Z4H A;  2KEE A;  1F77 A;  4B3S Q;  1TWA H;  1TWG B;  4LMQ D;  4GOP A;  1TWF B;  1XJV A;  1LTB D;  4R9W A;  3STB C;  5C3W A;  1YNJ C;  3PSI A;  3OWF A;  4WFN 3;  1TWC B;  3RLF A;  4YY3 L;  2UXD Q;  1V1O A;  3DMU A;  5IT9 c;  3CCU A;  3A56 A;  2HHH Q;  5E7N A;  4IPG A;  3MFG A;  1Y1W B;  4IUT A;  1DYQ A;  5C5L A;  1TWH H;  4HR7 B;  2LKV A;  4A3F G;  3H6M A;  1RTO A;  1YZ6 A;  4IN3 A;  2A1A A;  4A3C H;  4EX5 A;  1IYV A;  5EKL A;  2DNE A;  2PZT A;  5E3F A;  1IW7 D;  2JN4 A;  3PO2 H;  4P74 A;  4GOP C;  1T9H A;  1CSQ A;  4ILW A;  3V2T A;  1SAP A;  1IBM Q;  2NZO A;  1WTW A;  1QNK A;  5LMN L;  1LYL A;  5HY6 A;  1DCZ A;  1KDC A;  2A6H C;  3M3Y B;  4KY5 A;  5ELF A;  5C44 G;  2QA4 A;  2L5T A;  3JAM c;  5IP7 G;  3PIO 3;  5C4J B;  1GXD C;  3J7A 5;  3G4S A;  1B2T A;  3T51 B;  4MN3 A;  5IE8 A;  3QB3 A;  1HNX Q;  4HTH A;  1RTN A;  2F1M A;  1VQK A;  1KHI A;  3MXP A;  1LM0 A;  5K36 H;  1W6J A;  4K5X A;  4CKE A;  2EPB A;  2K32 A;  3M4Y A;  5ELB A;  3SGI A;  4J6H A;  4OXP A;  4DF7 A;  2SEB D;  3S1M B;  3P20 A;  1Q86 C;  1CHP D;  1IKM A;  3D6C A;  3H15 A;  1EIY B;  3GD7 A;  1VQ5 A;  1LUZ A;  2F0P A;  3HOZ G;  5DLQ E;  3RN2 A;  1YIJ A;  3LX0 A;  4DR3 Q;  1MIU A;  3M4O H;  2PPB C;  1XPO A;  4QUC A;  4ZCK A;  3JAM L;  3M9B A;  2SOB A;  3VA7 A;  3CPW A;  1AE2 A;  3RNU A;  3BU2 A;  1WTV A;  2OF1 A;  1RDP D;  5LMU L;  2PI2 E;  1O7Z A;  2GA4 B;  4JI3 Q;  1D5Z C;  2MNA A;  3BZD B;  1R9T H;  4KD3 A;  2RKS A;  3S1R H;  4A93 G;  4K0K Q;  4GKJ L;  4A3M B;  4JG2 A;  1ICF B;  5LL6 S;  3A74 A;  2EZV A;  4DV1 L;  4A3I H;  4P75 A;  2K4K A;  1WFQ A;  4G7H C;  4GN4 B;  3SK6 A;  1S40 A;  3I7F A;  1TKW B;  3S24 A;  1PFN A;  2JA5 H;  2NVY H;  1HHV A;  4X66 Q;  2ZT9 C;  1BF4 A;  1RKN A;  3S17 H;  1TR5 A;  1H9M A;  2R92 H;  4RFB A;  4DK0 A;  4XQJ A;  1B50 A;  1STB A;  2NB0 A;  3LWE A;  1OXV A;  4B3R Q;  1SR3 A;  2N88 A;  3ERS X;  1JB3 A;  4DR7 L;  1GHK A;  4EQP A;  3GO5 A;  5AFW A;  5KNB A;  1XMQ Q;  3OMC A;  3U4V A;  1EQQ A;  1HZA A;  1TT2 A;  4TSS A;  2R7D A;  1S5C D;  4HJ5 A;  4UDU C;  2YV5 A;  2RCN A;  5EGT A;  3A5U A;  4Z9C B;  3KYH C;  1SNC A;  3KJP A;  1D8L A;  1GUO A;  2Z0S A;  5E1F A;  2E2H H;  3OW2 A;  4YY3 Q;  1BCP D;  1XTD A;  1U5K A;  3HGB A;  5EPJ A;  1PRT D;  4YWL A;  5COY A;  4X65 Q;  1CZG A;  1S72 A;  3SE0 A;  1JQY D;  4EQ5 A;  2UUC Q;  5GAE C;  3M4Q A;  1TY2 A;  3FMC A;  3QJY A;  3K5M A;  2ZJP A;  3S1R B;  5JJK A;  1D5X C;  3A8K E;  1VQJ A;  5CV7 A;  2BE5 D;  3UE1 A;  4LF6 L;  2E5L Q;  4BY7 H;  4DV0 Q;  2F0W A;  4LFA L;  5EKK A;  3I4N G;  2K28 A;  4PNY A;  5GAG C;  4QL5 A;  1PTO D;  4HMI A;  3H0G H;  3CCR A;  1EU4 A;  2B2T A;  3P1H A;  3CC7 A;  4P71 A;  3D8G A;  4CKC A;  5IYD G;  1PLF A;  1XNR L;  1U0L A;  3GTJ H;  5KEE A;  4G7Z C;  2HDL A;  5KIX A;  2Z6K C;  1E1O A;  2WFW A;  3PIP A;  4JI4 Q;  1L0Y B;  2CWP A;  3NQT A;  4DPG A;  2B2U A;  4OON A;  3W5O A;  2K03 A;  2I07 B;  4KKS A;  4LFB L;  1I50 B;  2GN5 A;  3OSO A;  1EFI D;  5T1G A;  2N8N A;  1D2B A;  3I4M G;  3BYY B;  1D6E C;  3HOY G;  4IPD A;  4LNQ A;  3W1B A;  4ODG A;  2ZTC A;  2WII B;  5CGK A;  1E22 A;  2E2H B;  4KJO A;  2KCT A;  1I4X A;  1SE8 A;  1HQM C;  2NVT B;  3V05 A;  2B2T C;  3BVZ A;  2RVL A;  1CFM A;  3H3V C;  3I90 A;  2EYJ A;  5HGT A;  3MXU A;  1NCV A;  4ID6 A;  2R61 A;  4POG A;  5M3M H;  1S5B D;  1QZH A;  1NNX A;  1TU2 B;  4G57 A;  1B1Z A;  3CAM A;  4KMU C;  2B2U C;  1QG7 A;  4UP8 A;  1HA6 A;  2K50 A;  3M4P A;  4A3E G;  4O0A A;  4N8X 1;  3OHX C;  5C4X B;  5JVG 3;  4L6T B;  5LMU Q;  1LTL A;  3TP7 A;  3CCE A;  2H4O A;  1TS5 A;  2RCF A;  4QIW B;  2IJ0 A;  2PNR C;  3GTG B;  2QKI C;  2JA8 H;  3BVM A;  4IJH A;  2F3W A;  1Q46 A;  4GKJ Q;  3TSS A;  2UXB L;  3CCV A;  4BXX G;  2F3V A;  2VL6 A;  3CCQ A;  1PVO A;  3KUP A;  1YHB A;  3DEP A;  3I91 A;  3PIO A;  5D3I B;  1QJO A;  1SYF A;  3BYT B;  2YU9 H;  3HP3 A;  1PFM A;  1B9M A;  5M5X H;  2BH2 A;  5DM7 3;  2AWO A;  2FMM A;  1G2T A;  1L0X B;  3GQB A;  3MXG A;  1I6H H;  3CMA A;  1WTR A;  1TXY A;  1HRJ A;  2D9U A;  3CC2 A;  1ET6 A;  1D1K A;  1EFW A;  2B63 G;  3P75 A;  1V8Q A;  3RZO H;  1KDA A;  2EY2 A;  2JJQ A;  3HOW H;  3ITP A;  2EJF C;  3G6E A;  2F0S A;  1XMO L;  5M3M B;  1JE4 A;  3DHQ A;  3RZD H;  5BN5 A;  4L5R C;  4B3T Q;  3CQZ B;  1BR9 A;  1YJW A;  3G71 A;  5CMD A;  2SNS A;  1ASZ A;  1CKM A;  3E9I A;  2MPM A;  4KTA A;  4LF8 Q;  1NMG A;  4F88 A;  1JOO A;  5E4X A;  1YJN A;  4A3L G;  3KLR A;  3HOV G;  1KRT A;  3EA6 A;  3UDG A;  4DNT B;  5C0X J;  1F2M A;  1XX8 A;  3U50 C;  3FEW X;  5IOC A;  4QF4 A;  3CF5 A;  4A3J G;  4QCL A;  4QJF A;  5ELE A;  2JA8 B;  5IYC H;  1TII D;  3U4Z A;  4K8J A;  3N52 A;  4TQU S;  4JK1 C;  1EQT A;  3GTO B;  2VB2 X;  2UU9 L;  4KHP L;  2QGQ A;  3NHH A;  4QY7 A;  1HQR D;  4PMB A;  1A3U A;  2F0V A;  1SYC A;  1WJJ A;  1PXU A;  5M5X B;  1I4R A;  4GLV B;  1VF5 C;  1VQG A;  2FIN B;  2B8F A;  2JA6 H;  4R4T A;  4MNO A;  1AZQ A;  2QF7 A;  4JI1 L;  2M9V A;  5BR8 Q;  5FLX L;  4DV6 Q;  4QQB X;  5JEA H;  3NSW A;  3X3N A;  2KA7 A;  4JI0 L;  1WTO A;  2BH8 A;  4OEL B;  3K0Y A;  4CDF C;  5JPN C;  2VUM G;  5IT9 E;  2L4N A;  1W6K A;  1NUC A;  4LUV A;  4LFB Q;  1G91 A;  1Y69 U;  3FDT A;  1STN A;  2XSC A;  4J8Q A;  3U9S A;  1PZJ D;  2PQE A;  1QCB D;  3MXN B;  2JP1 A; 
#chains in the Genus database with same CATH homology
 1I4G A;  1RCV D;  1Z6H A;  3Q23 A;  3H94 A;  1CA5 A;  5E4W C;  4B08 A;  2EY1 A;  2IX0 A;  3NXW A;  4RAU C;  4S3S A;  3X3M A;  2EY6 A;  2EE1 A;  3BDC A;  3CHB D;  2NTS A;  1STH A;  4R8I A;  4A3K B;  4FXG C;  3RD4 A;  1CT1 D;  1HTL D;  2HQE A;  1A15 A;  3NPP A;  4BBS B;  4KHV A;  3TP8 A;  1FD7 D;  1H9S B;  1GOZ A;  1H9R A;  1V1P B;  2EDG A;  1HUM A;  5CBA E;  1DOL A;  2N55 A;  1JIC A;  5DNF A;  1SYD A;  5D14 A;  4G4K A;  1DXM A;  5NUC A;  2M2L A;  1CI3 M;  2A6E C;  4TKO B;  2A68 D;  2K5W A;  4O42 A;  4CJ2 C;  5JPM C;  4BA1 I;  4DFA A;  3CRL C;  4RGM A;  4IUP A;  2RSO A;  4Q5V A;  2RA4 A;  1E2V A;  5KND A;  3BVG A;  2G9H D;  1SYE A;  4K5V A;  3PUZ A;  3L3O C;  4NW2 A;  3MXN A;  1BCP F;  1TS2 A;  1S5D D;  2HUG A;  4LJZ C;  3J7Y W;  1PRT F;  2M00 A;  1Q3L A;  3VYT A;  4C3J B;  3WOF A;  3QG1 A;  1FYC A;  1EY9 A;  1O7L A;  4K5W A;  3DXJ C;  4I7Z C;  4NKL A;  3M7G A;  4KKU A;  3AMU A;  4IFD H;  2EYL A;  3E5S A;  1ZEQ X;  1Q12 A;  5LHY 1;  5JVH 3;  3K57 A;  1PTO F;  2J0T D;  1MD2 D;  2WP8 J;  1LTG D;  4X3S A;  2IW3 A;  3VR6 A;  1KLU D;  4HCS A;  2F0T A;  1HCZ A;  2L0C A;  3K5N A;  1GUW A;  3EJI A;  5C3E B;  1F9Q A;  1BDO A;  2KQ3 A;  1IKL A;  4H7B A;  1I6V C;  2XN9 C;  1F9R A;  3ND8 A;  1NAP A;  3DUZ A;  3C46 A;  5C5M A;  4ZQ3 A;  5K5P A;  5C4Z A;  4XQQ A;  1J8I A;  1HTP A;  2PMZ B;  2RDF A;  2X69 A;  3I3C A;  1S4Z A;  1SXT A;  2NZ1 D;  4KD4 A;  2XIW A;  2R3Z A;  4J1M A;  1SNQ A;  3MA2 B;  4RGO S;  3QOL A;  5ISR A;  3HRZ C;  1EY4 A;  2E2I B;  2LMC B;  1SMY C;  4ZYS A;  5COR A;  1SE2 A;  1KDB A;  3L9A X;  4FP5 D;  1KNA A;  1AEX A;  3NTI A;  1GUG A;  2F0H A;  2NVQ B;  4C3I G;  4DXG A;  1PDQ A;  3GTK B;  5DM6 3;  3Q0A A;  4CGY B;  4WOR A;  3BG3 A;  5C6A A;  5J22 A;  4FO2 A;  1QNU A;  3EFX D;  2ZXR A;  4A3F B;  2K5Q A;  1EOT A;  4DK1 A;  3K5L A;  3S9W A;  4KJN A;  4HMJ A;  1VCI A;  3D31 A;  4E6I A;  4RKL A;  1FR3 A;  1A2T A;  3J80 L;  1JC7 A;  3ZYY X;  1EYD A;  2F0I A;  1B53 A;  3AB9 A;  4CKB A;  1U4M A;  1MI2 A;  2F03 A;  1R4Q B;  1S5E D;  1JOR A;  1ZYR D;  4DN4 M;  5CYU A;  3PO3 B;  2C5C A;  4H0L C;  1QWY A;  1STE A;  4R8N A;  5HUR A;  5C44 B;  3SK8 A;  4ZKC B;  3VYR A;  4FXK C;  1H9J A;  2B2V A;  4QUF A;  1CQV A;  3SVM A;  3LNN A;  3KBG A;  1SYB A;  1CHQ D;  2PCF B;  1YNN C;  2F4I A;  4XYQ A;  2EJM A;  3OWE B;  3VR4 A;  3T56 B;  1O7Y A;  1Z47 A;  2BCO A;  1KLG D;  3IKJ A;  3J81 E;  2EYH A;  5EBD A;  1M8A A;  3TP6 A;  4I65 A;  4ZKB B;  3OIP A;  2K05 A;  1SNP A;  2EYM A;  1QIL A;  2E74 C;  4X3U A;  2B2V C;  3QIA A;  5IIF A;  4A93 B;  2MP1 A;  3A7A B;  4V19 0;  3GTQ B;  5K36 G;  3S1N B;  2IX1 A;  4RGN A;  1BQQ T;  3QOJ A;  1H9K A;  2FJ2 A;  3MVV A;  1EU3 A;  3MWY W;  2FFK B;  4LAA A;  1ESR A;  3PUV A;  4H13 C;  2L9H A;  4Y7N B;  1FNU A;  2BDN A;  5C0X I;  1WD1 A;  2AUK A;  2E2J B;  1LTI D;  3R93 A;  5I9P A;  5J1Z A;  2CVR A;  2E76 C;  3A8J E;  4U68 A;  1ENC A;  1AP0 A;  3WOE A;  1Y8N B;  5D3D A;  2E75 C;  3ERQ A;  2CW0 C;  5A2Q E;  4FF1 A;  5BN4 A;  1D1I A;  1QB5 D;  2KCN A;  4N9T A;  2QEJ C;  5I4D A;  3HOU B;  2JYO A;  2NUC A;  2D2C C;  1NSN S;  2QIL A;  3QWN A;  3HG9 A;  4HAE A;  1E2Z A;  1SNM A;  4DNR B;  3CU7 A;  4U67 3;  1EZ6 A;  1CK1 A;  3I4N B;  1F9P A;  3IAY A;  1EWH A;  1K8M A;  5M5W B;  3R3O A;  2EYP A;  2PZU A;  2Z4I A;  3FRP B;  4OO1 H;  1SDF A;  4B9X A;  2K1B A;  3Q24 A;  4BS9 A;  1HFN A;  1STG A;  2VXW A;  1Q8I A;  1SEB D;  3I4M B;  4DAP A;  3HOY B;  1GUS A;  1G6Z A;  1J9O A;  2RBM A;  3SXH A;  1AZP A;  5G3L D;  1KAB A;  4RHS A;  1EIH A;  1SJE D;  5FOB B;  1EQV A;  4FVM A;  3E6Z X;  1CQF A;  2QCP X;  3C1E A;  1CZW A;  3J7A V;  1BCP B;  2Z1C A;  4K6D A;  1EY5 A;  1QOH A;  4EQN A;  4A3E B;  1PRT B;  2CQA A;  4HCE A;  2IPK D;  1HXY D;  1ROD A;  2NN6 I;  4KKT A;  1HFG A;  1PFB A;  4CBV A;  1V43 A;  3NP8 A;  1RD9 D;  3NBH A;  1DJR D;  1PTO B;  2KJX A;  5C0X H;  3H09 A;  2BA1 A;  5FO8 B;  3OW7 A;  2A5H A;  3PUX A;  1Y8O B;  2KOL A;  1E2W A;  3SR1 A;  4BY1 B;  4M8A A;  4HSP A;  5DEH A;  1K83 B;  1LT4 D;  1GUT A;  3CRK C;  2B63 B;  3NUC A;  4A3D B;  2JEB I;  1WTX A;  4IQZ A;  3GTL B;  4CHT B;  4FF2 A;  2A69 D;  3EVQ A;  2NTT A;  4OIK A;  1O78 A;  4DA2 A;  2Q8R E;  3HOV B;  3J7A F;  5EQ0 A;  1DZ1 A;  2F0K A;  2O2L D;  1SJH D;  4LK1 C;  1EY6 A;  4A3J B;  1YNJ D;  4IFD I;  4K2K A;  2XWJ B;  3DWA A;  3VYU A;  1II3 A;  4C1N I;  2D5D A;  5BN3 A;  3IFD A;  3SK4 A;  4KK7 A;  3IFT A;  3C2P A;  4RKB A;  2KUM A;  1LAB A;  1EZ8 A;  3ND9 A;  2FMC A;  4K6L A;  2F0D A;  2O4X A;  3AU7 A;  3E0J A;  2PZW A;  4H44 C;  4BA2 I;  2VUM B;  3MTS A;  3MAQ A;  5LL6 X;  4ZUI A;  1EY7 A;  2E2D C;  1BCP C;  1LLR D;  3NQI A;  5ELD A;  1PRT C;  2A6H D;  3VR5 A;  1A6X A;  1JWM D;  4ZUJ A;  4BBR B;  5I9O A;  2VB3 X;  2EJG C;  3EQL C;  4QB4 A;  2PW5 A;  4CJ1 B;  3D4R A;  3JAM E;  5I2X A;  4GZY C;  4V0B A;  3M7N A;  1FGB D;  2IL8 A;  2F0O A;  2LFN A;  4PMC A;  2NN6 H;  3LWU A;  4IAL A;  3F2U A;  1PTO C;  5JEA G;  2JSO A;  4C2M B;  1PMR A;  4KY7 A;  3NE5 B;  1I4H A;  4F87 A;  4BWG B;  1B3A A;  3TP5 A;  4FYD A;  1LTT D;  2H1E A;  2HDM A;  1B44 D;  2XNA C;  2EOT A;  3W2D A;  1YNN D;  2F0M A;  2B2W A;  5I6W A;  1XWE A;  2EYF A;  3ONA B;  4TRD A;  1WTP A;  1UUP A;  1VMC A;  4C3H G;  5M3F B;  4KN4 C;  3PUY A;  3OMG A;  5D65 A;  1LO5 D;  3NWS A;  3I70 A;  5IGF A;  4CJ0 B;  3SDZ A;  5KGU A;  3Q22 A;  1LT6 D;  2ICI A;  1KTK A;  1NR2 A;  4XIG S;  2EY5 A;  2F0L A;  2L12 A;  3OOC A;  2MUY A;  1EYA A;  1AW7 A;  2B2W C;  5TSS A;  1OXU A;  4NMZ A;  3HZX A;  2KCC A;  1HA5 A;  1EY8 A;  1JWU D;  4RCO A;  4OHJ A;  3DWQ A;  4XYO A;  2R93 B;  5A35 A;  2L1B A;  1ILP A;  1ONL A;  1EEI D;  1GUN A;  3HS0 C;  3KK7 A;  2JEA I;  4JBW A;  1HPC A;  3T4A C;  3FVQ A;  1R4P B;  4XDX A;  3C1F A;  2BOS A;  5EJW A;  1H9S A;  1V1P A;  2K33 A;  5DAU A;  5CC4 A;  2IWH A;  5M9O A;  3HOX B;  4WJW A;  1RF2 D;  1DON A;  2BA0 A;  3WDN A;  3Q6S A;  1XYI A;  3TBI B;  1AN8 A;  1RHP A;  1BUV T;  1LAC A;  3FPU B;  1DD2 A;  1TQO A;  1EY0 A;  3KLS X;  3PMF A;  1X3Q A;  3S2H B;  2JA7 B;  1OO9 B;  2X6L A;  1FNW A;  1M4V A;  2ZXP A;  4IFD G;  1MSH A;  1PZI D;  3S16 B;  5G3L F;  1UEA B;  2XRQ D;  1T5X D;  3CKI B;  3VYS A;  3NTH A;  4XT1 B;  5KNC A;  2YYZ A;  1WCM B;  3K7A B;  3L7Z C;  3S14 B;  1DM0 B;  2J7Z A;  2Q8T A;  3TN2 A;  2RSN A;  3R8B A;  3MZ5 A;  1ESF A;  2O5I C;  3N6R A;  2XRS D;  4O1N A;  3GP7 A;  4KI0 A;  3QO2 A;  3NWT A;  5IGG A;  1S5F D;  4OIJ A;  1MSG A;  1LT3 D;  2Z8L A;  4MHE A;  1G29 1;  5M5Y B;  4C3I B;  2A73 B;  2HCC A;  1OXX K;  1ENF A;  3BDO A;  2RDH A;  2DY8 A;  2JE6 I;  4HN7 A;  4HSV A;  1OXT A;  1ZXT A;  1SE4 A;  3R2T A;  4IUR A;  2MHV A;  3D4W A;  4ZK9 B;  3SEB A;  2BDO A;  1EIG A;  4EQO A;  5IT9 L;  4ULL A;  2A74 C;  4K2L A;  2ID0 A;  5CR3 A;  4PMW A;  5CV6 A;  1GHJ A;  5IGD A;  4FF4 A;  1TWA B;  2TMP A;  4OO1 I;  4P2C B;  2DN8 A;  1STY A;  2G9D A;  1PYW D;  5CBE E;  3PV0 A;  3TZU A;  1JWS D;  1F2L A;  4IUU A;  2NWG A;  1ZKO A;  2PW7 A;  4AYB B;  2LY7 A;  1SBB B;  3S1Q B;  3R2I A;  1TWH B;  5FLX E;  3HOZ B;  1DOM A;  4OL7 A;  1VF7 A;  1SSO A;  2A68 C;  4RWS C;  3K6O A;  5CV9 A;  4K14 A;  1U9R A;  4UAI A;  3PO2 B;  5I2Y A;  1A3T A;  5KYL A;  1WD0 A;  3MFY A;  1TS3 A;  3TDQ A;  1A3V A;  1U4R A;  2WAQ B;  2V4D A;  2L55 A;  1Q1B A;  2KHS A;  3M85 A;  2MGS A;  1JR0 D;  3S2D B;  1PZK D;  3A8I E;  1QE6 A;  1UAP A;  2K7V A;  2NYZ D;  4K8I A;  4EVO A;  2HCI A;  3I4L A;  2SNM A;  1SE3 A;  1STA A;  2F0U A;  3D4D A;  1LV9 A;  4N9P A;  1IYU A;  1X32 A;  3M4O B;  3NTK A;  4RCN A;  4RGT A;  4L8J A;  4MIU A;  1C48 A;  5CV5 A;  3TME A;  4ZLT F;  3W3A A;  1LT5 D;  1IL8 A;  3G7L A;  2XVS A;  1R9T B;  2ICE C;  4A3I B;  2RQX A;  5FK9 C;  2B2Y A;  1WVL A;  2JA5 B;  1JOK A;  5I6Y A;  2NVY B;  5JOB A;  1EL0 A;  5JJZ A;  2F0G A;  3S17 B;  2R92 B;  4OGQ C;  3TZD A;  3BDL A;  3C3L A;  2SDF A;  3OIQ A;  4DXF A;  3H91 A;  1UNS A;  1SND A;  1CTM A;  1PTO H;  2A6E D;  1U4L A;  1B4O A;  4NDX A;  3GTP B;  4KY6 A;  2Y0S B;  2KVM A;  2B2Y C;  5FO9 B;  4F7X A;  4EGV A;  5KYI A;  3VR2 A;  1C8C A;  2KEC A;  3KLS A;  3VR3 A;  4WRD A;  5CV4 A;  3K5O A;  4XQN A;  4X3T A;  1ENA A;  4FF3 A;  1X3P A;  2NVX B;  4KHZ A;  1XXG A;  1GJX A;  4BY7 B;  1IW7 C;  1ET9 A;  1BOS A;  1LTS D;  1VDZ A;  2ZXO A;  2IX3 A;  2AQ2 B;  3H0G B;  3PUW A;  2EXZ A;  3T53 B;  1TY0 A;  3DEO A;  2WKD A;  3OPO A;  3GTJ B;  4C56 C;  4FNF A;  4OO1 G;  4QMG A;  5EPL A;  3MEH A;  3GV3 A;  3SHL A;  4B9W A;  2R7Z B;  1SNO A;  1ICW A;  3ERO A;  4M1U B;  5FO7 B;  3MHB A;  3S15 B;  5EPK A;  3P7J A;  5JAV A;  1ZYR C;  1FNV A;  2X6G A;  4DAY A;  1EYC A;  4DAV A;  5EBC A;  5C4H A;  5CV8 A;  4Q0F A;  3NBI A;  4HED A;  1O80 A;  2C9O A;  2F0J A;  4KN7 C;  4F8M A;  3I72 A;  1IHZ A;  1F2Z A;  2K5D A;  2RDG A;  2TSS A;  2K01 A;  3GV6 A;  1B9N A;  4IUV A;  2F0F A;  1HUN A;  1A2U A;  2WV6 D;  4ZAI A;  3V96 A;  1SMY D;  4FXD A;  3NK9 A;  2YU9 B;  4ME5 A;  5C0X G;  1LTR D;  3FPP A;  4RA8 A;  2OT2 A;  2EVB A;  2L11 A;  3I73 A;  1SYG A;  3J80 E;  1Y1V B;  1I6H B;  1G8Z D;  2DY7 A;  3HEJ A;  4C1N K;  3J81 L;  3KF8 A;  3DM1 A;  3IL8 A;  2O5J C;  3RZO B;  2AWN A;  3HOW B;  1Q90 A;  3HKZ B;  1JOQ A;  3D6W A;  1E0B A;  3DWP A;  3RZD B;  3RMH A;  3G6J B;  1F2Y A;  3A7L A;  3D3R A;  2XWB B;  3GTM B;  2B39 A;  2NBF A;  5JEA J;  1C4Q A;  4IUQ A;  2BE5 C;  4DGZ A;  4A3G B;  1D5M C;  5IOD A;  2K04 A;  1TVX A;  1I3Q B;  2AQ3 B;  4IUN A;  1K8O A;  1VMP A;  3I8Z A;  2MJ8 A;  2F0Q A;  3VA5 A;  2CHB D;  1Z7T A;  4NP5 A;  1EEF D;  1LTA D;  2LS0 1;  2JA6 B;  4KV6 A;  2ENB A;  1BBX C;  3A55 A;  5T1I A;  4ABN A;  1BXT A;  3U9O A;  1ML0 D;  2R6G A;  1Q1E A;  4PV1 C;  2AUJ D;  1F9S A;  5A2Q L;  1T5E A;  3RUZ A;  4DU9 A;  2PO4 A;  2I46 A;  1I4Q A;  1CA6 A;  5ELC A;  4IZ8 A;  3KBX A;  1NR4 A;  3K58 A;  2EYO A;  3FKI B;  2WB1 B;  2VNU D;  1TS4 A;  1RJT A;  5F2D A;  4C3J G;  1I4P A;  4X3K A;  4C3H B;  4YIJ A;  4G7O C;  2NN6 G;  4RHR A;  4PQX A;  2D62 A;  2K6A A;  1DOK A;  2QDB A;  2Q8I B;  2DNC A;  5C3X A;  2FHT A;  2OEO A;  3SK5 A;  4XXE A;  1EWC A;  1KAA A;  1JCK B;  5IGE A;  5J39 A;  3A54 A;  2JXM B;  1MGS A;  2B8G A;  4XT3 B;  5FKA C;  1SFO B;  3O13 A;  2WAC A;  3UI2 A;  4RH6 A;  5EKI A;  2CW0 D;  3MC0 B;  1XTC D;  1BNZ A;  4IFD J;  1MBY A;  2PYK A;  1G2S A;  4L63 B;  2IT1 A;  2F0E A;  3T16 A;  1OXS C;  1U4P A;  1ILQ A;  2WKC A;  2KED A;  4XTC S;  3URY A;  5IGC A;  3BS1 A;  4ZRZ A;  1CM9 A;  5IGB A;  5KRU A;  2WIN B;  1Y8P B;  3T13 A;  2F0N A;  2J4X A;  2A69 C;  1KNE A;  1AFP A;  4A3B B;  2OXP A;  3PIP 3;  1WTQ A;  3K59 A;  2AQ1 B;  1BO0 A;  2Z4H A;  2KEE A;  1F77 A;  1TWG B;  4LMQ D;  1TWF B;  1LTB D;  4R9W A;  5C3W A;  1YNJ C;  3OWF A;  4WFN 3;  1TWC B;  3RLF A;  1V1O A;  3DMU A;  3A56 A;  3MFG A;  1Y1W B;  4IUT A;  1DYQ A;  5C5L A;  4HR7 B;  2LKV A;  3H6M A;  1RTO A;  4IN3 A;  1IYV A;  5EKL A;  2DNE A;  2PZT A;  5E3F A;  1IW7 D;  4ILW A;  3V2T A;  1SAP A;  1WTW A;  1QNK A;  1DCZ A;  1KDC A;  2A6H C;  3M3Y B;  4KY5 A;  5ELF A;  2L5T A;  3PIO 3;  5C4J B;  1GXD C;  1B2T A;  3T51 B;  4MN3 A;  3QB3 A;  4HTH A;  1RTN A;  2F1M A;  3MXP A;  5K36 H;  1W6J A;  4K5X A;  4CKE A;  2EPB A;  2K32 A;  3M4Y A;  5ELB A;  4J6H A;  4DF7 A;  2SEB D;  3S1M B;  3P20 A;  1CHP D;  1IKM A;  3D6C A;  3GD7 A;  2F0P A;  3LX0 A;  2PPB C;  4QUC A;  3JAM L;  2SOB A;  3VA7 A;  1WTV A;  2OF1 A;  1RDP D;  1O7Z A;  2GA4 B;  1D5Z C;  3BZD B;  4KD3 A;  2RKS A;  4A3M B;  2EZV A;  5LL6 S;  4G7H C;  3SK6 A;  1TKW B;  1PFN A;  1HHV A;  2ZT9 C;  1BF4 A;  1RKN A;  1TR5 A;  1H9M A;  4RFB A;  4DK0 A;  4XQJ A;  1B50 A;  1STB A;  2NB0 A;  3LWE A;  1OXV A;  2N88 A;  1JB3 A;  1GHK A;  4EQP A;  3GO5 A;  5AFW A;  5KNB A;  3OMC A;  1TT2 A;  4TSS A;  1S5C D;  4UDU C;  5EGT A;  4Z9C B;  1SNC A;  1GUO A;  5E1F A;  1BCP D;  3HGB A;  5EPJ A;  1PRT D;  5COY A;  1CZG A;  3SE0 A;  1JQY D;  1TY2 A;  3FMC A;  3QJY A;  3K5M A;  3S1R B;  1D5X C;  3A8K E;  5CV7 A;  2BE5 D;  2F0W A;  5EKK A;  2K28 A;  4PNY A;  1PTO D;  4HMI A;  1EU4 A;  2B2T A;  3P1H A;  3D8G A;  4CKC A;  1PLF A;  5KEE A;  4G7Z C;  2HDL A;  5KIX A;  1L0Y B;  3NQT A;  2B2U A;  2K03 A;  2I07 B;  4KKS A;  1I50 B;  5T1G A;  3OSO A;  1EFI D;  1D2B A;  3BYY B;  1D6E C;  4ODG A;  2WII B;  5CGK A;  2E2H B;  4KJO A;  1I4X A;  1HQM C;  2NVT B;  3V05 A;  2B2T C;  3BVZ A;  2RVL A;  1CFM A;  3H3V C;  3I90 A;  2EYJ A;  5HGT A;  3MXU A;  1NCV A;  4ID6 A;  2R61 A;  1S5B D;  1TU2 B;  4G57 A;  1B1Z A;  4KMU C;  2B2U C;  1QG7 A;  1HA6 A;  3OHX C;  5C4X B;  5JVG 3;  4L6T B;  3TP7 A;  2H4O A;  1TS5 A;  4QIW B;  2IJ0 A;  2PNR C;  3GTG B;  2QKI C;  3BVM A;  2F3W A;  3TSS A;  2F3V A;  3KUP A;  3DEP A;  3I91 A;  5D3I B;  1QJO A;  1SYF A;  3BYT B;  3HP3 A;  1PFM A;  1B9M A;  5DM7 3;  2AWO A;  2FMM A;  1G2T A;  1L0X B;  3GQB A;  3MXG A;  1WTR A;  1HRJ A;  2D9U A;  1ET6 A;  1D1K A;  3P75 A;  1V8Q A;  1KDA A;  2EY2 A;  3ITP A;  2EJF C;  2F0S A;  5M3M B;  1JE4 A;  3DHQ A;  5BN5 A;  3CQZ B;  1BR9 A;  5CMD A;  2SNS A;  2MPM A;  4KTA A;  4F88 A;  1JOO A;  5E4X A;  3KLR A;  3EA6 A;  4DNT B;  5C0X J;  1F2M A;  1XX8 A;  3FEW X;  5IOC A;  4QF4 A;  4QCL A;  2JA8 B;  5ELE A;  1TII D;  4K8J A;  3N52 A;  4TQU S;  4JK1 C;  1EQT A;  3GTO B;  2VB2 X;  3NHH A;  1HQR D;  4PMB A;  1A3U A;  2F0V A;  1SYC A;  1PXU A;  5M5X B;  1I4R A;  1VF5 C;  2FIN B;  2B8F A;  1AZQ A;  2QF7 A;  2M9V A;  5FLX L;  5JEA H;  3NSW A;  3X3N A;  2KA7 A;  1WTO A;  3K0Y A;  5JPN C;  5IT9 E;  2L4N A;  1W6K A;  1NUC A;  1G91 A;  1Y69 U;  3FDT A;  1STN A;  2XSC A;  4J8Q A;  3U9S A;  1PZJ D;  2PQE A;  1QCB D;  2JP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...