5C3WA

Crystal structure of staphylococcal nuclease variant delta+phs v66h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c3wA00
3OMGA 4DGZA 4EQPA 4E6IA 2EY5A 4J1MA 5M9OA 2F0JA 4NP5A 5CV9A 4N9PA 2SNMA 4K6DA 3TP6A 4HMIA 5I9PA 3U9OA 4K2LA 1STHA 5IIFA 1SYFA 3NHHA 4B9WA 1A2UA 1STAA 3EROA 4MIUA 1STYA 2F0SA 4PMCA 4IUNA 3SHLA 3VA5A 5CR3A 4PMBA 1A2TA 3H6MA 3SK5A 1SYDA 3D4DA 1JORA 4G57A 2ENBA 2OEOA 2LKVA 4KJNA 4PNYA 5HURA 2EXZA 3D8GA 1EY4A 3PMFA 5EKKA 1JOKA 5F2DA 4I65A 1AEXA 1EY0A 3EJIA 3NP8A 1SNPA 4KV6A 4KY6A 1EYDA 4YIJA 4K8JA 5E1FA 4ZUIA 3TP8A 3V2TA 1EY5A 3T13A 4R8NA 5ISRA 1F2ZA 2EYJA 3R3OA 3ERQA 4NMZA 5E3FA 2O4XA 4K5VA 2PZTA 4KHVA 5DAUA 3T16A 2KQ3A 1TR5A 3QOLA 4NDXA 3DMUA 5IODA 2F0QA 4ZQ3A 5NUCA 1KABA 5KYLA 5IGGA 1SNQA 5CGKA 5C3XA 3SK6A 5C4HA 3OMCA 1STNA 1KAAA 4ME5A 5KIXA 1EY7A 4HMJA 4K2KA 2F0LA 2M00A 4K5WA 5CV5A 4IALA 1F2YA 2PYKA 3C1FA 2KHSA 4QMGA 4EVOA 5I9OA 2F0GA 4RKLA 3BDLA 2EYFA 3E5SA 3EVQA 3SR1A 5KYIA 3S9WA 1NSNS 2F0MA 2EY2A 4RKBA 1KDCA 2PW7A 5IGDA 2F3VA 4LAAA 4QF4A 3NXWA 4KY7A 3ITPA 1SNMA 5CV7A 2EYHA 4IZ8A 4OL7A 4K5XA 5C4ZA 1EY6A 1KDAA 2EYOA 1A3UA 1JOOA 4K8IA 4QB4A 3SK4A 2EY1A 2OXPA 3NK9A 5C3WA 4S3SA 4NKLA 3SXHA 3NUCA 3OSOA 5C5LA 1A3TA 3MXPA 1II3A 1STGA 2RBMA 1SYEA 3HEJA 4J6HA 1RKNA 3DHQA 4TRDA 2F0IA 5I6YA 1STBA 3TP5A 2PZWA 5CC4A 3SK8A 5DEHA 3C1EA 2F0KA 1TT2A 2WACA 3MEHA 1KDBA 1NUCA 3HZXA 3OWFA 5EKLA 4DF7A 3MHBA 2RDFA 5J39A 1EZ8A 2F0PA 4K14A 5J22A 4EQOA 4DU9A 4KY5A 5IGCA 5K5PA 3QOJA 2F0UA 1EY8A 4WORA 5IGEA 1SNDA 3D6CA 2F0EA 3P1HA 1EY9A 1TQOA 1F2MA 2SNSA 4ZUJA 4F7XA 5IGBA 5J1ZA 1EYAA 2F0VA 1ENCA 1SYGA 1SNOA 5CV8A 3RUZA 2HQEA 4F8MA 1SNCA 2F0DA 3D4WA 3MZ5A 3QB3A 2EY6A 5KRUA 4KJOA 1SYCA 5JOBA 4B9XA 1JOQA 1EQVA 1EZ6A 2RKSA 4HTHA 5KGUA 1EYCA 4KTAA 1A3VA 5IGFA 1SYBA 2EYLA 4H7BA 3BDCA 3MVVA 2F0TA 3TMEA 3TP7A 2PZUA 4DFAA 4N9TA 2F0NA 2F3WA 2F0WA 4ID6A 5IOCA 5HGTA 2NUCA 1ENAA 3NQTA 1U9RA 2EYMA 4ODGA 4WRDA 5KEEA 4EQNA 2PW5A 2QDBA 3LX0A 2F0HA 2OF1A 2PQEA 4KD4A 5CV6A 5C6AA 5JAVA 2F0FA 2SOBA 5EGTA 2F0OA 5I6WA 1IHZA 4KD3A 3P75A 5CV4A 5C5MA 2EYPA
chains in the Genus database with same CATH superfamily
1VQNA 2L1BA 1B44D 1M4VA 5C0XJ 2SEBD 3PIP3 1U4PA 2R92H 1A15A 1JR0D 3U9OA 1TWGH 3RZOH 3D4RA 1N36Q 2HQLA 1DGSA 5IP7H 4A3KG 1MJCA 2A6EC 2NN6H 4B9WA 3JAMi 2IPKD 2KUMA 4MIUA 4IJHA 4AYBG 2LKVA 3IAYA 1IBMQ 4C3HB 2UXDL 1L1OA 3NP8A 1NTGA 4LFCL 4IFDJ 4K5VA 1JC7A 5DAUA 1TWHH 4DV2L 4GNXB 5KYLA 4RHRA 2YTXA 5FO7B 1STNA 4K6LA 2JA6B 1NR2A 5JJKA 3VR3A 1IKLA 4IALA 3C1FA 4CKBA 2F0GA 3EVQA 4JI6L 2E74C 4UY8C 4BS9A 4L5QA 2EY2A 1G6ZA 2JQOA 4XXEA 3M85A 4JBMA 2F3VA 3B6YA 2B8GA 1Q8KA 3K6OA 3NENA 2BE5D 3HKZB 4A3CH 1QOHA 2E2IB 4IPCA 2OWOA 2B2VC 1Y14B 1BBUA 1PRTD 1G2TA 2AWNA 3M7NA 4GOPA 2Z6KA 4GNXA 4DXGA 2D0PA 3MC0B 4DK6C 1TT2A 1CSPA 3UDFA 1KD1C 5LMNQ 4DV7Q 2NVQB 2CW0C 3ND8A 4ALPA 1GM5A 5C4XB 5FJ8H 3V05A 3VYSA 4DU9A 2I46A 2F0UA 2QW7A 1Q46A 3WWVA 4BBSB 1TQOA 1UE5A 3KLRA 1SNOA 1EYGA 3KJPA 1FJGQ 4F8MA 3J7AV 4JYAL 1BCPC 4PZ8A 4UAIA 4B08A 1QE6A 3UI2A 5IWAL 2Q2UA 3GTKH 3ERSX 3TRZA 1JE5A 2LXJA 4DAYB 3J80c 2NVYB 4GZYC 5IOCA 2VNUD 2MUYA 5IYDG 1J6QA 5TSSA 1EIFA 4X62L 5CV6A 1OXSC 1E3PA 4NW2A 2F0OA 3QWNA 1HA5A 2I0QA 2WAQG 2YYZA 1VQLA 4DKAC 2KJXA 3S1RB 1EQRA 2XIWA 2NB0A 2QILA 4RH6A 4IUTA 3IKJA 1G8ZD 1KNAA 4B3SL 5GQOA 4JBKA 1JT8A 1PDQA 2OEOA 1VQMA 1D5XC 1AN8A 2HIVA 2ATWA 5C5LA 1Y69U 1NJIC 3UDGA 3NSWA 4P75A 5LHY1 1E2VA 2QGQA 3K58A 1IL2A 2HCCA 3F1ZA 2EJGC 1Q1BA 3FHWA 4A3EG 1S4ZA 5M5YB 4IO9A 2G9HD 4LWCA 1KHIA 1KAAA 2V4DA 1SE3A 4DUYQ 4Y7NB 2M00A 1XMOQ 4HCEA 3K81C 4CDFC 1M90C 5C3EH 3S9WA 3ER0A 3CMEA 4N8FA 3TSSA 5FLXE 4BBSG 1D2BA 1C0AA 1I6HB 1PH7A 1CUKA 3S17H 2JEBI 1N32Q 2EYOA 2HDLA 4AYBE 1PVOA 2E2DC 2E2JB 4BY1G 4DR1Q 1R9TH 3QO2A 3M4OH 4LW1A 1GVPA 2K01A 3MEHA 2JJQA 4XQJA 2R7DA 3BVMA 1QNUA 1A6XA 4HCSA 1TWGB 3PCOB 1QVCA 4NXMQ 2L0CA 3E0JA 1TWFH 3RUZA 4KHZA 2LFNA 4JPBW 1YNNC 4UHVA 4DK0A 2KECA 5BN4A 3GP7A 1JWMD 1U4LA 5FKAC 5JVH3 1A0IA 3IFDA 3R93A 1SEBD 1IBML 3QG1A 1B9NA 1NMGA 1X55A 3J81E 2XWJB 4A3DH 2DN8A 1TWHB 4LF6Q 2VQFQ 1KRSA 4OHJA 3TZDA 1BF4A 5JEAG 4DR5Q 1XTDA 2IX1A 3EBEA 1TS5A 3TDQA 5GADC 5GAHC 3JC66 4IJLA 1JMCA 1MI2A 2F0JA 1JWSD 5M3FH 2CH4W 5H1SE 3HOUB 2K50A 3TREA 2XGTA 4RMFA 1UNSA 2Q2HA 2ZXOA 1PXUA 3H0GG 3CC7A 3SE0A 1Q81C 3K7AH 1A2TA 3P20A 1HFNA 3E0EA 1T9HA 4KJNA 1WCMG 4JI7Q 1X54A 1ESFA 1LV9A 5LMNW 2ZJRA 3CCEA 3T13A 4DR4Q 3DEOA 3KYHC 3MAQA 2EYJA 2NVXH 1KQSA 4PQXA 1VQHA 1HTPA 4FF1A 2ASBA 4MN3A 4HIDA 3I4MG 5LMNL 2WAQE 1TWCH 1B70B 3E5SA 1VQBA 2Q2TA 2A19A 4XIGS 4RKBA 1I94Q 1VMPA 4I7ZC 1FJGL 3GTKB 3I4NH 4OX9Q 3JAME 2AQ2B 1IW7D 2F1MA 4L5SA 4CJ1B 4LF5Q 4RG1A 1A3UA 2HD3A 3ZYYX 1YNJD 4A3BB 2B2UA 4JC0A 3P7JA 2VQEQ 2MQHA 2X69A 2A69C 2RBMA 2KCNA 4CBVA 3W2DA 1XNQL 3GTGH 1U4MA 4JI1Q 1ET6A 2NYZD 1H95A 2IX3A 4KKSA 3I70A 3LWEA 4ZCKA 5J39A 3ULJA 5K5PA 1Y1WG 2BA1A 1LYLA 1KLUD 4WORA 1F2MA 5J1ZA 2PI2E 1E2WA 3DM1A 3HOVH 1X3PA 2B2VA 2K75A 1SNCA 3ONAB 4L6TB 1PH3A 4IURA 2EY6A 1WTQA 1K9MC 2ES2A 5KRUA 1KXLA 1Y8PB 4U673 4KTAA 1EEID 2HUGA 3S1NH 5JJLA 4EGVA 5IP9H 2K33A 5HGQA 2F0NA 1AW7A 4HJ9A 4IN3A 4LF8L 1CA5A 4DA2A 5IYBH 3CU7A 2RDHA 1PFMA 1AH9A 5EGTA 3E6ZX 1SMYC 2AKWB 3TP6A 1ICWA 4X3KA 5M9OA 4Z9CB 4K6DA 4A3KH 4ILWA 1XXGA 4OWXB 1PFBA 3OOCA 2AUKA 1DYQA 3NHHA 3L7ZC 3PO3H 4YHHL 2F0SA 2UUCL 1B53A 1P16A 4JV5L 3M3YH 1C4QA 1N32L 2GVBA 1VCIA 2XVSA 4PNYA 1KRTA 1EY0A 4CKEA 1IZ6A 4G7ZC 4K8JA 1EY5A 4UP9A 4R8NA 2K04A 3ERQA 3U4ZA 3PIOA 4A3BG 3MXUA 2R7ZB 1J9OA 1G2SA 1HQRD 3GTPH 5JJIA 2JA7B 2A68D 1CI3M 2F4VL 4RFBA 4JI4Q 1LTAD 3VR4A 4NXML 3SR1A 1CM9A 4PZ6A 2F0MA 3M9BA 3EA6A 2GN5A 2R7FA 4GN4B 3ITPA 2NVTH 4UPAA 1EOVA 1ML0D 1Q86C 4I7AA 4QB4A 1HNWQ 3L2PA 2B2TC 1JICA 3NUCA 4A3MG 3RN2A 1PYWD 3OWFA 5M3FB 4DR5L 1V43A 4LNQA 3VYTA 1CKNB 4EQOA 1EFID 3K5LA 2F0EA 2JSOA 1FVIA 1PRTF 2HQEA 1HZAA 2Z9HA 2UXDQ 2D5DA 1YEZA 1OXXK 3KF8B 1SYCA 1RTOA 1CHPD 3H3VC 1IYJB 2F0TA 2NVXB 5IYDH 2PNRC 5CYUA 4C3HH 5BN3A 1K0SA 4OONA 3CP0A 1DONA 4R4CA 4X3TA 2KCTA 1CA6A 5JAVA 4DR2Q 3HRZC 3G71A 3KLSA 1JJGA 3CKIB 2N49A 2I5MX 4R4IA 2JA6H 1S5CD 5CV9A 2KEDA 1V1PB 2CKZB 4V190 3C46A 5IY0A 3KF8A 5E4WC 1YI2A 2WKCA 4OO1G 1H9MA 3LGJA 5ELFA 1GKHA 2PCFB 1H9RA 1STAA 5JVG3 1T5XD 4EX5A 4JI0Q 2HDMA 1K8AC 4OX9L 2E2IH 3H6MA 1JORA 3D4DA 2VB3X 3PMFA 2AWOA 2K7VA 4JI3L 3BU2A 4GKKL 5E1FA 3K57A 4LMQD 2O4XA 5KNCA 1CTMA 1X32A 1S5DD 1H9SB 2Q8RE 1PFNA 4JI1L 3NWTA 1MSHA 2NVQH 1E1OA 1V1PA 4BBRG 2M2LA 4OXPA 4R8IA 4K2KA 1B4OA 1EL0A 2BCOA 1VQ5A 2KCCA 4HR7B 4JYAQ 4RKLA 3GQBA 4BBSH 1YHQA 2UU9L 1L0YB 1BO0A 4A3IB 3L0OA 5A2QE 3GTLH 1HTLD 4OO1I 1DD2A 4BY1H 1H9KA 5E4XA 4X62Q 1PTOD 3SK4A 1VQGA 2RHQB 3MFGA 4HAEA 4X6AH 2QA4A 5AJ3L 4KLKA 3STBC 3HEJA 3DHQA 2EVBA 2F0IA 1VF5C 2ICEC 3A5ZB 3CPWA 3I73A 3HZXA 4MTNA 1PZID 5CMDA 3S1RH 2LY7A 4LF7L 1GUNA 4L5TA 4AYBB 1DOKA 2EE1A 1YVCA 4F7XA 2SNSA 5EPKA 2B63G 5IYCH 2K32A 3M3YB 3J81i 2JA8B 4RHSA 5EKIA 3PF5A 2RKSA 2AQ1B 5ISRA 1V1OA 3K5OA 1A3VA 2DJFC 5D3IB 3J81j 1HHVA 1B3AA 2ZTEA 1I4QA 2F3WA 3MXNB 3CF5A 2J4XA 4IFDG 2NZHA 1A62A 1E1TA 5DLQE 5G3LD 1FL0A 4A3JG 1V9PA 2PQEA 4CDEC 1BDOA 3IL8A 1PLFA 4RWSC 4O42A 4B3RQ 2EYPA 1M1KC 1I50H 2EY5A 4J1MA 4QL5A 4V0BA 4Y7NH 3PF4A 4QUCA 5FLMH 1O7YA 3PO2G 3PIPA 3WOEA 1TXYA 2JA9A 4C1NK 2ZTCA 1WCMH 4ZRZA 1I6HH 3GV6A 2R3ZA 5CR3A 4MTKA 1X65A 3SK5A 3RLNA 2J0TD 1L1OB 1GO3E 3G7LA 1Q8IA 4KN4C 3KBXA 3D0FA 3OPOA 4FXKC 1F2ZA 3I4MH 4IFDI 3K59A 4O0AA 3QOLA 1G291 4PMWA 1KABA 1ASYA 4YWLA 4XYOA 3K0YA 5EPJA 5ELNA 3OTOL 2K5VA 5CV5A 3J7AF 2KHSA 2BDOA 3CRKC 3RD4A 1W3SA 4A3GG 5GAGC 5GAEC 4A3FG 4DNIA 2EDGA 2IY5B 4GN3B 4ZK9B 2EYHA 2K6AA 3KDFA 3AMUA 2WAQB 4ULLA 5DNFA 1S5FD 2G9DA 2JA8G 4R4OA 4XT3B 4GOPB 2K28A 1UUPA 1V1QA 2I5HA 4DR2L 1CK1A 1Y1WH 3HOYG 1D5ZC 1ZXTA 1ENFA 5J22A 3QOJA 2A6ED 1SMXA 3EFXD 4FF2A 3P1HA 3K0XA 1EY9A 2H5XA 3HOUH 5IGBA 1DOMA 2V1CC 1SYGA 4KKUA 4PG3A 2B2TA 1C8CA 1WYDA 4JI0L 1GUOA 3W5OA 4A3EB 1Q82C 2Y0SB 4JK1C 1N33Q 4BWGB 1RODA 1WD1A 1XPUA 4H13C 1N34L 5HGTA 2NUCA 2OTLA 3U50C 4EQNA 4KD4A 1NE3A 5EAYA 2XTIA 5I6WA 1PH2A 2LSSA 2CQOA 2FJ2A 2NBFA 3UE1A 1ILQA 1DOLA 5M5WB 2Z0SA 2BH2A 3KLWA 1UE7A 1NBWA 3GD7A 4N9PA 2R93G 3GTLB 5IT9c 4LK1C 1NR4A 4OEMB 4BY1B 1IYUA 1IKMA 1SYFA 1P8LA 3KLSX 3CHBD 1PTOB 1Y1VG 1B8AA 3FPPA 1VQOA 3ND9A 4P73A 2RSNA 3D8GA 2PI2A 4XQNA 1XNQQ 1W6KA 4A3BH 1GHJA 1SNPA 1YIJA 2RDGA 3R2IA 1SJHD 1AZQA 2CW0D 2EOTA 2IHEA 2J7ZA 1XWEA 4UP7A 4RGMA 2RSOA 3MA2B 1DZ1A 4XQQA 5IGGA 5CGKA 3MWYW 1EY7A 1WJJA 1CHQD 4K5WA 1FD7D 3BYYB 4FNFA 3EQLC 3M4QA 4QMGA 1BCPD 5COYA 1BOSA 2C9OA 3PGZA 3T53B 2PW7A 1XMQQ 3TS2A 1BR9A 3PQIA 4OGQC 1SNMA 1SR3A 1GUGA 4Q0FA 1HR0Q 4LF8Q 5I2XA 1PH9A 2OXPA 5BR8L 3CCMA 2K5DA 4N8X1 3PUVA 2Y0SG 5FLXL 3VDYA 4DXFA 1II3A 2LXKA 1I50B 3H0GB 3A55A 4DV5Q 2OT2A 1B2TA 1TKWB 2JA5G 4J15A 4B3RL 1LACA 2OTJA 2QEJC 1O7LA 2JYOA 3TEHB 4YHHQ 1WCMB 1BUVT 1SNDA 4HN7A 1RD9D 1EIGA 2UUCQ 3J80i 4HSVA 4JV5Q 3CQZB 1LT6D 2KHJA 2ZXPA 3KOJA 2K4KA 1LTLA 2KA7A 4HTHA 3FDTA 1EYCA 1XX8A 3URYA 3I4MB 3ICEA 4DFAA 3RNUA 3HOWB 4LFAL 4JOIA 2PQAA 2XRQD 2X6LA 4ID6A 1TS3A 1ZYRC 4WRDA 1HXYD 4ODGA 2L55A 3AFQA 2NZ1D 2K5NA 5IYBG 2F4VQ 2R7ZH 4DK1A 3J81L 2UXCQ 4E6IA 2ZM6Q 3PSIA 2JA7H 2DGYA 2VUMG 1WVLA 4OO1H 1WTOA 2UXBL 5I9PA 4DUZQ 1K3RA 3U9SA 1PFSA 4RCNA 1I4GA 5ELOA 5FO9B 1YJNA 1DM0B 1HFGA 4DAMA 4IUVA 2I5LX 3RMHA 4O2DA 2B39A 1S5BD 4KK7A 5EKKA 3U4VA 2MJ8A 1AEXA 2PMZE 1KC8C 1Y1WB 3VR6A 3C2PA 4ZUIA 1K28A 2BDNA 1Y8NB 4YCWA 3VYRA 4KHVA 4BBRH 3H91A 3T16A 2KQ3A 1HA6A 3FRPB 3DMUA 5NUCA 2PPBC 3LNNA 5K36H 1LTID 1L0XB 4ZYSA 2CWAA 2EPBA 1B9MA 1SLJA 2K5WA 3BDLA 3S1MB 1YNND 1VQFA 3CCLA 4CGYB 1FGBD 3O13A 3NXWA 4KY7A 1D6EC 3CCVA 5M5XB 4WJ4A 1QVGA 4PV1C 5C4ZA 3F2BA 1EIHA 1N33L 5CORA 2B2WC 3PV0A 1S3OA 2LMCB 1PH4A 2BH8A 2IWHA 3TQYA 3CW2C 3JAML 1K73C 3HOWG 1AE3A 5I6YA 4FP5D 4DF7A 5LL6X 2WINB 3HGBA 3QR8A 1MD2D 3KBGA 2B63H 1EY8A 5IGEA 4CDCC 3I3CA 1SE4A 1OXVA 3D6CA 4CKCA 2R61A 1GUTA 4WFN3 2VL6A 1ENCA 2PO4A 3J7A5 3IRBA 2F0DA 2ZT9C 2MHVA 3AB9A 4JI3Q 4M1UB 4GKKQ 1ILPA 2GVAA 1HH2P 2IHFA 3GV3A 2BA0A 2PZUA 3I90A 4A3JH 2R92G 4FO2A 4FF4A 1X6OA 4NXNL 1AFPA 5IP7G 1BBXC 2Y0SE 5C4JH 3RLFA 2OF1A 2D0OA 3L9AX 3HOXG 4JBJA 4A93G 5LL6S 4IPDA 3S16H 1J5EL 4DK3C 2KBNA 1CKOA 1BCPB 2UU9Q 3CCRA 3DLLA 2A8VA 2SNMA 2K03A 1C48A 5D65A 2N78A 2A6HC 1UE1A 1HR0W 2DY7A 4A3MB 4JI5Q 5E7NA 2RHSB 1R4PB 3I2ZA 5IIFA 4B3ML 4A3IH 1XMQL 1VF7A 1B7YB 3ZJYC 4TKOB 4P71A 5G3LF 4BA2I 1CT1D 5AJ3Q 4HJ5A 1RIPA 1HR0L 4L5RC 2A69D 1EY4A 2Z1CA 5ELDA 3EJIA 4YIJA 3R2TA 1EYDA 2XNAC 4H0LC 3TN2A 4LF7Q 2DJGC 3S14H 1VDZA 2B2YC 3I91A 1XTCD 4RAUC 4DV5L 2HHHL 4CHTB 1SNQA 3BG3A 4A3FH 2CVRA 2I07B 3DXJC 1VQIA 2KEEA 4JI2L 4Q5VA 1OTCA 1SFOH 3GTQB 1YJWA 1HZCA 1LO5D 2F52A 1VQDA 5L37A 1K0RA 1KDCA 4APVA 3UE0A 3U58A 5CV7A 5FJ8G 2XRSD 2JA8H 1VS0A 2Z4HA 3OW2A 3L3OC 1ONLA 4OIJA 4P74A 4IUPA 4POFA 3DWQA 1SMYD 1G91A 1VQJA 3HOYH 1PZJD 4TRDA 3CCSA 1STBA 1KAWA 4OWWB 3C1EA 1XJVA 1KDBA 4C3JB 2YTYA 3MHBA 2UXCL 1CQFA 3W1GA 2ZM6L 1WTXA 4ZUJA 4DR3L 4DUZL 4RGTA 2N8NA 3K5MA 1PYSB 2NTTA 2G5DA 3FEWX 2CQAA 1R4QB 2OCEA 4AQYL 1SAPA 1HUMA 4RA8A 2LS01 1EQVA 1EZ6A 1WTPA 4DNRB 5IGFA 1GXDC 3TMEA 4TSSA 1YBYA 3RR5A 4BBRB 4JW0A 3FVQA 1F9RA 2OQKA 2Z6BA 2FMMA 5EJWA 4DV6L 1SROA 3LX0A 3OTOQ 1WFQA 2F0FA 5HY6A 5J3BA 2R93H 2X6GA 3Q22A 4ABNA 4X65Q 1RCVD 1F2LA 1Q12A 3E3XA 3I72A 4HMIA 3OHXC 4A3LG 3T51B 3J80E 2A73B 4K2LA 4GNXC 4HIOA 3GTJB 1LTSD 4HJ8A 4L8JA 1I6VC 2ID0A 4G57A 2ENBA 3HFZB 3NPPA 4J8QA 4KN7C 3TP8A 5FLXc 3NELA 1QNKA 1PYBA 1D1KA 2B63B 1E22A 3AQQA 4HIKA 1TR5A 1QVFA 1TY0A 1EWIA 1VQKA 3X3NA 2JXMB 2F0LA 3CRLC 2AMCB 3EIVA 3AYHB 4C3JG 4EVOA 1RHPA 5KYIA 1VQCA 4LUZA 4AH6A 5CBAE 2H4OA 3KF6B 4A3JB 1AE2A 1N34Q 4A3EH 2MNAA 1JOOA 5C4JB 2MO1A 3CCUA 5FO8B 2MGSA 1QB5D 2JN4A 2MFIA 4NKLA 4QIWE 3OSOA 3GO5A 3SXHA 4POGA 3S16B 3S1QB 1STGA 2JA5H 3PO2B 1U5KA 5A2QL 4DAPA 2D9UA 4RGNA 1HUNA 4BY7B 4HJAA 1BCPF 1UEAB 5M5WH 3J81c 2F0PA 4K14A 4A3DG 1NNXA 2F03A 5IGCA 4HSPA 1Q7YC 2RVLA 3KF6A 2CWPA 3FKIG 1LLRD 1I5FA 4G4KA 1A63A 2B2WA 3D4WA 4JI5L 5C44B 3T1HQ 4BXXG 3SEBA 4DV3L 1PTOH 5KGUA 2XWBB 3I55A 2EYLA 3S14B 2KVMA 1BVSA 1O7ZA 4C2MB 5FK9C 4A3GB 5C0XG 2VW9A 4A3FB 2K5QA 2QDBA 2Q8IB 2E5LL 2XSCA 3E9IA 5DM63 1SFOB 2YV5A 5C5MA 3DWAA 4X64Q 2WB1G 2RCNA 3N52A 2UUBL 2VB2X 1WI5A 2HCIA 2RA4A 1VQ8A 5BR8Q 4QCLA 4YY3L 1SRUA 2ICIA 1HJPA 1LT5D 4JI8L 5JEAH 1QCBD 3HOYB 3STBD 3TS0A 5ELCA 4CDDC 4QUFA 4KMUC 3JAMc 4GLAC 4Y52H 3H0GH 4NDXA 3HOZB 4TVAB 1GHKA 5C0XI 2A5HA 1ZEQX 2AQ3B 4LFBL 1MHWC 1XNRL 3J7YW 4HMJA 4BY7G 3QIAA 4IOAA 1J8IA 5JPNC 3A56A 2TMPA 3SDZA 2PMZB 5ELBA 1CSQA 2UUAL 4XYQA 4JCVE 1LT4D 3CQZH 4LFAQ 4U68A 3KDFB 1NY4A 4KKTA 1KDAA 1K3BC 1CQVA 1GUSA 5C44G 4FDBA 3T1YL 3HOWH 4NPSA 1IBKL 3NK9A 4LJZC 3CAMA 1KTKA 2R93B 4IUQA 1A3TA 3DWPA 1D7QA 1SYEA 1TY2A 4XT1B 4C3IB 2RQXA 2WACA 4H02A 1NUCA 2UXBQ 3Q8DA 1XPOA 1RTNA 3S2HH 3MFYA 1Y1VB 2QDLA 2Q8TA 4X65L 1GOZA 1HNZL 4KY5A 4A4IA 3J7ZC 1O78A 1EYAA 1FNVA 1QWYA 1YITA 3VR2A 2N88A 4ZKBB 4UP8A 5I4DA 3MZ5A 2A1AA 3G48A 4R4QA 4LF4L 5JOBA 1U4RA 4QQBX 1CFMA 1PA6A 2RF4A 1AP0A 1PH6A 3S2DB 3W1BA 4N9TA 1EFWA 2BE5C 3FMCA 3EN2A 2MO0A 3HOXH 1CZGA 4A93H 1EU4A 3NQTA 2IX0A 4JVZA 1HNXL 2KHIA 1NAPA 2SDFA 1FGUA 1HPCA 4IQZA 3PO3G 3F2UA 5GROA 2F0HA 1PRTC 1KNEA 1PZKD 1LUZA 5IE8A 3CC4A 3HKSA 4X3UA 2OQ0A 4EQPA 2GA4B 3S15B 5CBEE 3A5UA 3HOZG 2B2UC 3DEPA 2E75C 3S1MH 1C9OA 2KCMA 2IW3A 2VZAA 5BN5A 3HG9A 1HRJA 1ESRA 3DUZA 1RL2A 2B29A 3D3RA 1T5EA 3CXCA 3Q23A 2HT1A 5M5XH 4A75A 4PMBA 1DJRD 4PZ7A 4IPGA 4DR6Q 2JA5B 4XDXA 4JBWA 2CH4A 1X3FA 3V2TA 4C1NI 1QILA 3CD6A 1S5ED 4NMZA 4JG2A 4MNOA 5IODA 4FYDA 4YWMA 1WTVA 3D31A 4CJ0B 1G51A 4C3IG 1WTHA 1I3QB 3BZCA 3PUZA 2K52A 3V96A 1LM0A 2CCZA 1Q3LA 2KOLA 2WB1E 3CMAA 2N3SA 1NSNS 4ZLTF 1Z6HA 3AFPA 4G7HC 1ICFB 3Q0AA 3A54A 4M8AA 3T1HL 1MKHA 2EXDA 1PMRA 2KENA 1XYIA 1SN8A 4NXNQ 1FR3A 1EY6A 4ZAIA 2VUMB 3D6WA 1J5EQ 2IL8A 2IT1A 1D5MC 4J6HA 2NZOA 3RN5A 3S24A 1MJEA 1O80A 5CC4A 1WTWA 1X3GA 3T56B 1WTRA 4FXDA 4C3HG 3GDEA 1PH1A 4B3MQ 1CZWA 4DV0L 4OELB 4X64L 4OIKA 5CV8A 3ULPA 4A3MH 4B3TL 3C3LA 3OWEB 2JA6G 1Q1EA 2FMCA 1YNXA 1K83B 3E9HA 1I4PA 1Z7TA 4F87A 1XPRA 5M3MB 1FNUA 4HJ7A 2PQAB 2HHHQ 4DV1L 4DAYA 3DM3A 1ENAA 3CCQA 4UDUC 4G7OC 4GLXA 2PW5A 3HKZG 4IUUA 3NTHA 4LUVA 4JI2Q 1IHZA 2K14A 3P75A 2O5JC 4LUOA 3GTOH 4A3LH 3WOFA 4DAVA 3GTQH 3OIQA 4ME3A 5ELEA 3RLOA 4OWTB 2K05A 1FNWA 1QZHA 2ZXRA 4IUNA 5C4XG 3VA5A 2DNCA 3QJYA 2K5HA 2AHOB 1I4XA 2DY8A 3H3VI 2EXZA 4IPHA 4XTCS 1JOKA 1TIID 2JE6I 4I65A 2L4NA 1AZPA 3OIPA 3S2HB 3I4OA 5E3FA 4DV4L 1HCZA 1PH5A 3A7AB 1X3QA 2PNHA 2F0QA 1M8AA 3MTSA 4C3JH 4DR3Q 2E2HH 3PUXA 1GUWA 4IOCA 1F77A 2F3IA 4ME5A 4DR7Q 1KIXA 2FXQA 3MEFA 4AQYQ 1F2YA 5I9OA 4R9WA 1X56A 4LF9L 2R92B 5LMUL 1EWCA 3RZOB 1ET9A 5IGDA 2CHBD 1TU2B 1E0BA 4GKJQ 2R6GA 3HOXB 4A93B 1N36L 1ZYRD 4DV6Q 3G6JB 5IYCG 1VMCA 2QEXA 1QZGA 4YCUA 3MXPA 1L0WA 1LTRD 5M3MG 3A8IE 3A7LA 5DEHA 2B8FA 3SK8A 4DNTB 3F2CA 1H9JA 5EKLA 1JCKB 2Q2IA 2FHTA 3FKIH 1Z47A 2WKDA 3VR5A 4BXXH 1EQTA 4QIWB 2Z4IA 2BOSA 1K8MA 3GTJH 3Q24A 4KJOA 4B9XA 4HIMA 1UWVA 4L63B 1JOQA 3OW7A 5D14A 5FLMG 3BDCA 3MVVA 4CJ2C 1MSGA 4DR6L 5C0XH 3KK7A 1SE2A 1IW7C 3K8AA 1EEFD 1FYCA 3I8ZA 1LTGD 1PRTB 5KEEA 4FXGC 5FOBB 1JB7A 3NTKA 4X3SA 1ZKOA 1YNJC 1VQEA 3ULLA 2ZJQA 4KD3A 1OXUA 1PHJA 1PTOF 3OMGA 4DGZA 1F9QA 4DV7L 1E24A 4IFDH 2YTVA 1KL9A 1I4RA 3RZDH 1LABA 1A2UA 2FFKB 3EROA 3H94A 4PMCA 1STYA 2ALYB 5KNBA 3BJUA 2NN6G 4HEDA 5DM73 2WV6D 3BZDB 1PH8A 5F2DA 4P72A 4KV6A 3VA7A 3S1QH 4O1NA 3PO2H 3G6EA 3UDIA 4BY7H 4GLVB 4QY7A 3HKZE 2TSSA 3OMCA 1WOCA 5KIXA 2XN9C 1TS4A 5JEAJ 4DN4M 1CKMA 4DV3Q 2DUDA 2P5ZX 2HIXA 2QKIC 4X66Q 4EQ5A 4LAAA 3GTMH 3CC2A 5C44H 4K0KQ 2M9VA 3M4PA 2L12A 1GJXA 3CPFA 2EQSA 4K5XA 2E5LQ 3HOUG 2EY1A 2C5CA 4A3CG 5EQ0A 3AU7A 5C3WA 4S3SA 2NN6I 4NB3A 2MPMA 3R8BA 4C2MH 1VQAA 2ZTDA 4A3GH 3GTOB 1RKNA 1D1IA 3I7FA 2PZWA 2F0KA 1DCZA 2UUBQ 2A6HD 1EOTA 2CFMA 1B3QA 3A8JE 1PV4A 1LTTD 1SBBB 2O5IC 1TWAH 4YY3Q 5C3EB 2NWGA 1VQ4A 2F0VA 4JI8Q 1QJOA 2A68C 2EZVA 4DUYL 2D2CC 1XMOL 5JPMC 3QB3A 2FINB 2NTSA 3S17B 3N6RA 1WD0A 1SYBA 1EU3A 1STEA 1MBYA 4FF3A 2E76C 1IYVA 1F9SA 1YHAA 1D8LA 1W2BA 1X3EA 1R9TB 4LFBQ 2E2HB 3M4OB 1XNRQ 2O2LD 3X3MA 3I56A 5C6AA 1VQ6A 1L1OC 1VQPA 3HOZH 4MHEA 1QUQB 4DR1L 5CV4A 1IBLQ 1GD7A 2UUAQ 1DXMA 3M4YA 3TZUA 4DR7L 1E7ZA 4WJ3M 4NP5A 3IFTA 3FPUB 1HQMC 3UDXA 1EIYB 2YU9H 2EIFA 2B3GA 5D3DA 1IXRA 1TWFB 1YJ9A 4GN5A 1VQ7A 3T1YQ 5EBDA 1IBKQ 5IT9L 3SHLA 4GKJL 2RCFA 1N9WA 3H09A 2K1BA 3J80L 4A3DB 2D62A 3I4LA 5JJZA 2EJMA 1NMFA 1QUQA 3R3OA 3FKIB 3PUWA 5T1GA 5IT9E 1G6PA 2PZTA 3LWUA 4C3IH 1SXTA 3PIO3 1HNZQ 4KHPQ 2WIIB 1EWHA 1OXTA 3HS0C 4GS3A 3VYUA 4LF6L 2VQFL 3SK6A 5C4HA 4GOPC 2Z6KC 1Y1VH 2WFWA 3AEVA 4LF4Q 2JEAI 1O7IA 1S72A 3NEMA 3NWSA 1NCVA 1C7YA 4C56C 4QF4A 3K7AB 3OYYA 5C3EG 3NBIA 1JJCB 4OL7A 1U0LA 5EPLA 1QG7A 1HNXQ 3W3AA 4P2CB 4DPGA 1SDFA 3KJOA 4KI0A 1BNZA 3S2DH 1SSOA 1RF2D 4RCOA 3BS1A 4LFCQ 2WB1B 1EQQA 1YHBA 1B1ZA 1VQ9A 2JK8A 4JI7L 1JWUD 3TP5A 1JB3A 4DV2Q 1SE8A 5T1IA 4DR4L 2RDFA 1EZ8A 3K7UC 1TWCB 3H15A 1Q90A 3K80C 3F2DA 3S15H 3RZDB 4A76A 1CKNA 1BKBA 4WJWA 4JI6Q 1Z9FA 1BBWA 3H3VH 2F4IA 1UEBA 2R7ZG 2L5TA 1E2ZA 3I4NB 3BVGA 2Z8LA 1YZ6A 4MZ9A 2JA7G 4H7BA 1I94L 3TP7A 3F8TA 3PUYA 4RGOS 1Y8OB 1UE6A 4QJFA 2MP1A 2EYMA 1PTOC 4LF5L 4BA1I 1K8OA 5EBCA 1JQYD 3NBHB 1SJED 3GTGB 3BYTB 1N8RC 1TVXA 2VQEL 2C35B 1LTBD 1I3QH 2VY3A 3BZKA 3GTMB 5C4XH 1OO9B 3HOVB 1STHA 5KNDA 5M3FG 4X66L 5K36G 4K0KL 3BVZA 1TS2A 3CCJA 3S1NB 1SYDA 5IWAQ 5HURA 1JJ2A 3SVMA 2WP8J 3NBHA 1EUJA 4KY6A 2VUMH 3WDNA 1RJTA 1X9NA 4YWKA 4DV0Q 1F9PA 2NVYH 5AFWA 4ZQ3A 1H9SA 5A35A 1TWAB 5C3XA 3BDOA 3M7GA 1A8VA 4JOIC 2PYKA 4A3KB 4B3TQ 4TQUS 2EYFA 4YCVA 2AUJD 1K8GA 4ZKCB 2ZJPA 2IJ0A 2QCPX 3PO3B 3MXGA 4FVMA 4B3SQ 1MIUA 3K5NA 4DV1Q 4IZ8A 2VXWA 3A8KE 3FP9A 3SGIA 3I4NG 1K83H 1MGSA 4K8IA 1UAPA 3NE5B 5M3MH 3T4AC 1HZ9A 2E8GA 3NTIA 1BQQT 2L9HA 2L11A 2VS1A 2EJFC 3G4SA 2YU9B 3A74A 3A0JA 1S40A 1I4HA 1IBLL 3GTPB 1HZBA 2A74C 5M5YH 3KUPA 1RDPD 4H44C 4R1JA 1W6JA 4F88A 4QGUA 2DNEA 1B50A 4JI4L 2B2YA 3Q6SA 2NVTB 1V8QA 1BXTA 3HOVG 1JE4A 4R4TA 4DV4Q 1L2FA 3MXNA 2F0WA 2L15A 3TBIB 1KLGD 1U9RA 5IP9G 4A3IG 3KFUA 1IL8A 2QF7A 1ASZA 1HNWL 2H1EA 2SOBA 5I2YA 4AIMA 2E2JH 4KHPL 4LF9Q 2N55A 3NQIA 1LT3D 2JP1A 3HP3A 5LMUQ
chains in the Genus database with same CATH topology
2L1BA 1B44D 1M4VA 5C0XJ 2SEBD 3PIP3 1U4PA 1A15A 1JR0D 3U9OA 3D4RA 2A6EC 2NN6H 4B9WA 2IPKD 2KUMA 4MIUA 2LKVA 3IAYA 4C3HB 3NP8A 4IFDJ 4K5VA 1JC7A 5DAUA 5KYLA 4RHRA 5FO7B 1STNA 4K6LA 2JA6B 1NR2A 3VR3A 1IKLA 4IALA 3C1FA 4CKBA 2F0GA 3EVQA 2E74C 4BS9A 2EY2A 1G6ZA 4XXEA 3M85A 2F3VA 3K6OA 2B8GA 2BE5D 3HKZB 1QOHA 2E2IB 2B2VC 1PRTD 1G2TA 2AWNA 3M7NA 4DXGA 3MC0B 1TT2A 2NVQB 2CW0C 3ND8A 5C4XB 3V05A 3VYSA 4DU9A 2I46A 2F0UA 4BBSB 1TQOA 3KLRA 1SNOA 4F8MA 3J7AV 1BCPC 4UAIA 4B08A 1QE6A 3UI2A 2NVYB 4GZYC 5IOCA 2VNUD 2MUYA 5TSSA 5CV6A 1OXSC 4NW2A 2F0OA 3QWNA 1HA5A 2YYZA 3S1RB 2KJXA 2XIWA 2NB0A 2QILA 4RH6A 4IUTA 3IKJA 1G8ZD 1KNAA 1PDQA 2OEOA 1D5XC 1AN8A 5C5LA 1Y69U 3NSWA 5LHY1 1E2VA 3K58A 2HCCA 2EJGC 1Q1BA 1S4ZA 5M5YB 2G9HD 1KAAA 2V4DA 1SE3A 4Y7NB 2M00A 4HCEA 3S9WA 5FLXE 3TSSA 1D2BA 1I6HB 2JEBI 2EYOA 2HDLA 2E2DC 2E2JB 3QO2A 2K01A 3MEHA 4XQJA 3BVMA 1QNUA 1A6XA 4HCSA 1TWGB 2L0CA 3E0JA 3RUZA 4KHZA 2LFNA 1YNNC 4DK0A 5BN4A 2KECA 3GP7A 1JWMD 1U4LA 5FKAC 5JVH3 3IFDA 3R93A 1SEBD 3QG1A 1B9NA 3J81E 2XWJB 2DN8A 1TWHB 4OHJA 3TZDA 1BF4A 5JEAG 2IX1A 1TS5A 3TDQA 1MI2A 2F0JA 1JWSD 3HOUB 1UNSA 2ZXOA 1PXUA 3SE0A 1A2TA 3P20A 1HFNA 4KJNA 1ESFA 1LV9A 3T13A 3DEOA 3MAQA 2EYJA 4PQXA 1HTPA 4FF1A 4MN3A 3E5SA 4XIGS 4RKBA 1VMPA 4I7ZC 3GTKB 3JAME 2AQ2B 1IW7D 2F1MA 4CJ1B 1A3UA 3ZYYX 1YNJD 4A3BB 2B2UA 3P7JA 2X69A 2A69C 2RBMA 2KCNA 4CBVA 3W2DA 1U4MA 1ET6A 2NYZD 2IX3A 4KKSA 3I70A 3LWEA 5J39A 5K5PA 2BA1A 1KLUD 4WORA 1F2MA 5J1ZA 1E2WA 3DM1A 1X3PA 2B2VA 4L6TB 1SNCA 3ONAB 4IURA 2EY6A 1WTQA 5KRUA 1Y8PB 4U673 4KTAA 1EEID 2HUGA 4EGVA 2K33A 2F0NA 1AW7A 4IN3A 1CA5A 4DA2A 3CU7A 2RDHA 1PFMA 5EGTA 3E6ZX 1SMYC 3TP6A 1ICWA 4X3KA 5M9OA 4Z9CB 4K6DA 4ILWA 1XXGA 1PFBA 3OOCA 2AUKA 1DYQA 3NHHA 3L7ZC 2F0SA 1B53A 1C4QA 4PNYA 1VCIA 2XVSA 1EY0A 4CKEA 4G7ZC 4K8JA 1EY5A 4R8NA 2K04A 3ERQA 3MXUA 2R7ZB 1J9OA 1G2SA 1HQRD 2JA7B 2A68D 1CI3M 4RFBA 1LTAD 3VR4A 3SR1A 1CM9A 2F0MA 3EA6A 3ITPA 1ML0D 4QB4A 2B2TC 1JICA 3NUCA 1PYWD 3OWFA 5M3FB 1V43A 3VYTA 4EQOA 1EFID 3K5LA 2F0EA 2JSOA 1PRTF 2HQEA 2D5DA 1OXXK 1SYCA 1RTOA 1CHPD 3H3VC 2F0TA 2NVXB 2PNRC 5CYUA 5BN3A 1DONA 4X3TA 1CA6A 5JAVA 3HRZC 3KLSA 3CKIB 1S5CD 5CV9A 2KEDA 1V1PB 4V190 3C46A 3KF8A 5E4WC 2WKCA 4OO1G 1H9MA 5ELFA 2PCFB 1H9RA 1STAA 5JVG3 1T5XD 2HDMA 3H6MA 1JORA 3D4DA 2VB3X 3PMFA 2AWOA 2K7VA 5E1FA 3K57A 4LMQD 2O4XA 5KNCA 1CTMA 1X32A 1S5DD 1H9SB 2Q8RE 1PFNA 3NWTA 1MSHA 1V1PA 2M2LA 4R8IA 4K2KA 1B4OA 1EL0A 2BCOA 2KCCA 4HR7B 4RKLA 3GQBA 1L0YB 1BO0A 4A3IB 5A2QE 1HTLD 4OO1I 1DD2A 1H9KA 5E4XA 1PTOD 3SK4A 3MFGA 4HAEA 3HEJA 3DHQA 2EVBA 2F0IA 1VF5C 2ICEC 3I73A 3HZXA 1PZID 5CMDA 2LY7A 1GUNA 4AYBB 1DOKA 2EE1A 4F7XA 2SNSA 5EPKA 2K32A 3M3YB 2JA8B 4RHSA 5EKIA 2RKSA 2AQ1B 5ISRA 1V1OA 3K5OA 1A3VA 5D3IB 1HHVA 1B3AA 1I4QA 2F3WA 2J4XA 4IFDG 5G3LD 2PQEA 1BDOA 3IL8A 1PLFA 4RWSC 4O42A 2EYPA 2EY5A 4J1MA 4V0BA 4QUCA 1O7YA 3WOEA 4C1NK 4ZRZA 3GV6A 2R3ZA 5CR3A 3SK5A 2J0TD 3G7LA 1Q8IA 4KN4C 3KBXA 3OPOA 4FXKC 1F2ZA 4IFDI 3K59A 3QOLA 1G291 4PMWA 1KABA 4XYOA 3K0YA 5EPJA 5CV5A 3J7AF 2KHSA 2BDOA 3CRKC 3RD4A 2EDGA 4ZK9B 2EYHA 2K6AA 3AMUA 2WAQB 4ULLA 5DNFA 1S5FD 2G9DA 4XT3B 2K28A 1UUPA 1CK1A 1D5ZC 1ZXTA 1ENFA 5J22A 3QOJA 2A6ED 3EFXD 4FF2A 3P1HA 1EY9A 5IGBA 1DOMA 1SYGA 4KKUA 2B2TA 1C8CA 1GUOA 4A3EB 2Y0SB 4JK1C 4BWGB 1RODA 1WD1A 4H13C 5HGTA 2NUCA 4EQNA 4KD4A 5I6WA 2FJ2A 2NBFA 1ILQA 1DOLA 5M5WB 3GD7A 4N9PA 3GTLB 4LK1C 1NR4A 4BY1B 1IYUA 1IKMA 1SYFA 3KLSX 3CHBD 1PTOB 3FPPA 3ND9A 2RSNA 3D8GA 4XQNA 1W6KA 1GHJA 1SNPA 2RDGA 3R2IA 1SJHD 1AZQA 2CW0D 2EOTA 2J7ZA 1XWEA 4RGMA 2RSOA 3MA2B 1DZ1A 4XQQA 5IGGA 5CGKA 3MWYW 1EY7A 1CHQD 4K5WA 1FD7D 3BYYB 4FNFA 3EQLC 4QMGA 1BCPD 5COYA 1BOSA 2C9OA 3T53B 2PW7A 1BR9A 4OGQC 1SNMA 1GUGA 4Q0FA 5I2XA 2OXPA 2K5DA 3PUVA 5FLXL 4DXFA 1II3A 1I50B 3H0GB 3A55A 2OT2A 1B2TA 1TKWB 1LACA 2QEJC 1O7LA 2JYOA 1WCMB 1BUVT 1SNDA 4HN7A 1RD9D 1EIGA 4HSVA 3CQZB 1LT6D 2ZXPA 2KA7A 4HTHA 3FDTA 1EYCA 1XX8A 3URYA 3I4MB 3HOWB 4DFAA 2XRQD 2X6LA 4ID6A 1TS3A 1ZYRC 4WRDA 1HXYD 4ODGA 2L55A 2NZ1D 4DK1A 3J81L 4E6IA 1WVLA 4OO1H 1WTOA 5I9PA 3U9SA 4RCNA 1I4GA 5FO9B 1DM0B 1HFGA 4IUVA 3RMHA 2B39A 1S5BD 4KK7A 5EKKA 2MJ8A 1AEXA 1Y1WB 3VR6A 3C2PA 4ZUIA 2BDNA 1Y8NB 3VYRA 4KHVA 3H91A 3T16A 2KQ3A 1HA6A 3FRPB 3DMUA 5NUCA 2PPBC 3LNNA 5K36H 1LTID 1L0XB 4ZYSA 2EPBA 1B9MA 3S1MB 2K5WA 3BDLA 1YNND 4CGYB 1FGBD 3O13A 3NXWA 4KY7A 1D6EC 5M5XB 4PV1C 5C4ZA 1EIHA 5CORA 2B2WC 3PV0A 2LMCB 2IWHA 3JAML 5I6YA 4FP5D 4DF7A 5LL6X 2WINB 3HGBA 1MD2D 3KBGA 1EY8A 5IGEA 3I3CA 1SE4A 1OXVA 3D6CA 4CKCA 2R61A 1GUTA 4WFN3 1ENCA 2PO4A 2F0DA 2ZT9C 2MHVA 3AB9A 4M1UB 1ILPA 3GV3A 2BA0A 2PZUA 3I90A 4FO2A 4FF4A 1AFPA 1BBXC 3RLFA 2OF1A 3L9AX 5LL6S 1BCPB 2SNMA 2K03A 1C48A 5D65A 2A6HC 2DY7A 4A3MB 5IIFA 1R4PB 1VF7A 4TKOB 5G3LF 4BA2I 1CT1D 2A69D 1EY4A 2Z1CA 5ELDA 3EJIA 4YIJA 3R2TA 1EYDA 2XNAC 4H0LC 3TN2A 1VDZA 2B2YC 3I91A 1XTCD 4RAUC 4CHTB 1SNQA 3BG3A 2CVRA 2I07B 3DXJC 2KEEA 4Q5VA 3GTQB 1LO5D 1KDCA 5CV7A 2XRSD 2Z4HA 3L3OC 1ONLA 4OIJA 4IUPA 3DWQA 1SMYD 1G91A 1PZJD 4TRDA 1STBA 3C1EA 1KDBA 4C3JB 3MHBA 1CQFA 1WTXA 4ZUJA 4RGTA 3K5MA 2NTTA 3FEWX 2CQAA 1R4QB 1SAPA 1HUMA 4RA8A 2LS01 1EQVA 1EZ6A 1WTPA 4DNRB 5IGFA 1GXDC 3TMEA 4TSSA 4BBRB 3FVQA 1F9RA 2FMMA 5EJWA 3LX0A 2F0FA 2X6GA 3Q22A 4ABNA 1RCVD 1F2LA 1Q12A 3I72A 4HMIA 3OHXC 3T51B 3J80E 2A73B 4K2LA 3GTJB 1LTSD 4L8JA 1I6VC 2ID0A 4G57A 2ENBA 3NPPA 4J8QA 4KN7C 3TP8A 1QNKA 1D1KA 2B63B 1TR5A 1TY0A 3X3NA 2JXMB 2F0LA 3CRLC 4C3JG 4EVOA 1RHPA 5KYIA 5CBAE 2H4OA 4A3JB 1JOOA 5C4JB 5FO8B 2MGSA 1QB5D 4NKLA 3SXHA 3OSOA 3GO5A 3S16B 3S1QB 1STGA 3PO2B 5A2QL 4DAPA 2D9UA 4RGNA 1HUNA 4BY7B 1BCPF 1UEAB 2F0PA 4K14A 2F03A 5IGCA 4HSPA 2RVLA 1LLRD 4G4KA 2B2WA 3D4WA 5C44B 3SEBA 1PTOH 5KGUA 2XWBB 2EYLA 3S14B 2KVMA 1O7ZA 4C2MB 5FK9C 4A3GB 5C0XG 4A3FB 2K5QA 2QDBA 2Q8IB 2XSCA 5DM63 1SFOB 5C5MA 3DWAA 3N52A 2VB2X 2HCIA 2RA4A 4QCLA 2ICIA 1LT5D 5JEAH 1QCBD 3HOYB 5ELCA 4QUFA 4KMUC 1GHKA 4NDXA 3HOZB 5C0XI 2A5HA 1ZEQX 2AQ3B 3J7YW 4HMJA 3QIAA 1J8IA 5JPNC 3A56A 2TMPA 3SDZA 2PMZB 5ELBA 4XYQA 1LT4D 4U68A 4KKTA 1KDAA 1CQVA 1GUSA 3NK9A 4LJZC 1KTKA 2R93B 4IUQA 1A3TA 3DWPA 1SYEA 1TY2A 4XT1B 4C3IB 2RQXA 2WACA 1NUCA 1RTNA 3MFYA 1Y1VB 2Q8TA 1GOZA 4KY5A 1O78A 1EYAA 1FNVA 1QWYA 3VR2A 2N88A 4ZKBB 5I4DA 3MZ5A 5JOBA 1U4RA 1CFMA 1AP0A 3S2DB 4N9TA 2BE5C 3FMCA 1CZGA 1EU4A 3NQTA 2IX0A 1NAPA 2SDFA 1HPCA 4IQZA 3F2UA 2F0HA 1PRTC 1KNEA 1PZKD 4X3UA 4EQPA 2GA4B 3S15B 5CBEE 2B2UC 3DEPA 2E75C 2IW3A 5BN5A 3HG9A 1HRJA 1ESRA 3DUZA 3D3RA 1T5EA 3Q23A 4PMBA 1DJRD 2JA5B 4XDXA 4JBWA 3V2TA 4C1NI 1QILA 1S5ED 4NMZA 5IODA 4FYDA 1WTVA 3D31A 4CJ0B 4C3IG 1I3QB 3PUZA 3V96A 1Q3LA 2KOLA 1NSNS 4ZLTF 1Z6HA 4G7HC 3Q0AA 3A54A 4M8AA 1PMRA 1XYIA 1FR3A 1EY6A 4ZAIA 2VUMB 3D6WA 2IL8A 2IT1A 1D5MC 4J6HA 1O80A 5CC4A 1WTWA 3T56B 1WTRA 4FXDA 4C3HG 1CZWA 4OIKA 5CV8A 3C3LA 3OWEB 1Q1EA 2FMCA 1K83B 1I4PA 1Z7TA 4F87A 5M3MB 1FNUA 4DAYA 1ENAA 4UDUC 4G7OC 2PW5A 4IUUA 3NTHA 1IHZA 3P75A 2O5JC 3WOFA 4DAVA 3OIQA 5ELEA 2K05A 1FNWA 2ZXRA 4IUNA 3VA5A 2DNCA 3QJYA 1I4XA 2DY8A 2EXZA 4XTCS 1JOKA 1TIID 2JE6I 4I65A 2L4NA 1AZPA 3OIPA 3S2HB 5E3FA 1HCZA 3A7AB 1X3QA 2F0QA 1M8AA 3MTSA 3PUXA 1GUWA 1F77A 4ME5A 1F2YA 5I9OA 4R9WA 2R92B 1EWCA 3RZOB 1ET9A 5IGDA 2CHBD 1TU2B 1E0BA 2R6GA 3HOXB 4A93B 1ZYRD 3G6JB 1VMCA 3MXPA 1LTRD 3A8IE 3A7LA 5DEHA 4DNTB 2B8FA 3SK8A 1H9JA 5EKLA 1JCKB 2FHTA 1Z47A 2WKDA 3VR5A 1EQTA 4QIWB 2Z4IA 2BOSA 1K8MA 3Q24A 4KJOA 4B9XA 4L63B 1JOQA 3OW7A 5D14A 3BDCA 3MVVA 4CJ2C 1MSGA 5C0XH 3KK7A 1SE2A 1IW7C 1EEFD 1FYCA 3I8ZA 1LTGD 1PRTB 5KEEA 4FXGC 5FOBB 3NTKA 4X3SA 1ZKOA 1YNJC 4KD3A 1OXUA 1PTOF 3OMGA 4DGZA 1F9QA 4IFDH 1I4RA 1LABA 1A2UA 2FFKB 3EROA 3H94A 4PMCA 1STYA 5KNBA 2NN6G 4HEDA 5DM73 2WV6D 3BZDB 5F2DA 3VA7A 4KV6A 4O1NA 2TSSA 3OMCA 5KIXA 2XN9C 1TS4A 5JEAJ 4DN4M 2QKIC 4LAAA 2M9VA 2L12A 1GJXA 4K5XA 2EY1A 2C5CA 5EQ0A 3AU7A 5C3WA 4S3SA 2NN6I 3R8BA 2MPMA 3GTOB 1RKNA 1D1IA 2PZWA 2F0KA 1DCZA 2A6HD 1EOTA 3A8JE 1LTTD 1SBBB 2O5IC 5C3EB 2NWGA 2F0VA 1QJOA 2A68C 2EZVA 2D2CC 5JPMC 3QB3A 2FINB 2NTSA 3S17B 3N6RA 1WD0A 1SYBA 1EU3A 1STEA 1MBYA 4FF3A 2E76C 1IYVA 1F9SA 1R9TB 2E2HB 3M4OB 2O2LD 3X3MA 5C6AA 4MHEA 5CV4A 1DXMA 3M4YA 3TZUA 4NP5A 3IFTA 3FPUB 1HQMC 5D3DA 1TWFB 5EBDA 5IT9L 3SHLA 3H09A 2K1BA 3J80L 4A3DB 2D62A 3I4LA 5JJZA 2EJMA 3R3OA 5T1GA 3FKIB 3PUWA 5IT9E 2PZTA 3LWUA 3PIO3 1SXTA 2WIIB 1EWHA 1OXTA 3HS0C 3VYUA 3SK6A 5C4HA 2JEAI 3NWSA 1NCVA 4C56C 4QF4A 3K7AB 3NBIA 4OL7A 5EPLA 1QG7A 3W3AA 4P2CB 1SDFA 4KI0A 1BNZA 1SSOA 1RF2D 4RCOA 3BS1A 2WB1B 1B1ZA 1JWUD 3TP5A 1JB3A 5T1IA 2RDFA 1EZ8A 1TWCB 1Q90A 3RZDB 4WJWA 2F4IA 2L5TA 1E2ZA 3I4NB 3BVGA 2Z8LA 4H7BA 3TP7A 3PUYA 4RGOS 1Y8OB 2MP1A 2EYMA 1PTOC 4BA1I 1K8OA 5EBCA 1JQYD 1SJED 3GTGB 3BYTB 1TVXA 1LTBD 3GTMB 1OO9B 3HOVB 1STHA 5KNDA 5K36G 3BVZA 1TS2A 3S1NB 1SYDA 5HURA 3SVMA 2WP8J 3NBHA 4KY6A 3WDNA 1RJTA 1F9PA 5AFWA 4ZQ3A 1H9SA 5A35A 1TWAB 5C3XA 3BDOA 3M7GA 4A3KB 2PYKA 4TQUS 2EYFA 2AUJD 4ZKCB 2IJ0A 2QCPX 3PO3B 3MXGA 4FVMA 3K5NA 4IZ8A 2VXWA 3A8KE 1MGSA 4K8IA 1UAPA 3NE5B 3T4AC 3NTIA 1BQQT 2L9HA 2L11A 2EJFC 2YU9B 1I4HA 3GTPB 2A74C 3KUPA 1RDPD 4H44C 1W6JA 4F88A 1B50A 2DNEA 2B2YA 3Q6SA 2NVTB 1V8QA 1BXTA 1JE4A 3MXNA 2F0WA 3TBIB 1KLGD 1U9RA 1IL8A 2QF7A 2H1EA 2SOBA 5I2YA 2N55A 3NQIA 1LT3D 2JP1A 3HP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMG A;  4DGZ A;  4EQP A;  4E6I A;  2EY5 A;  4J1M A;  5M9O A;  2F0J A;  4NP5 A;  5CV9 A;  4N9P A;  2SNM A;  4K6D A;  3TP6 A;  4HMI A;  5I9P A;  3U9O A;  4K2L A;  1STH A;  5IIF A;  1SYF A;  3NHH A;  4B9W A;  1A2U A;  1STA A;  3ERO A;  4MIU A;  1STY A;  2F0S A;  4PMC A;  4IUN A;  3SHL A;  3VA5 A;  5CR3 A;  4PMB A;  1A2T A;  3H6M A;  3SK5 A;  1SYD A;  3D4D A;  1JOR A;  4G57 A;  2ENB A;  2OEO A;  2LKV A;  4KJN A;  4PNY A;  5HUR A;  2EXZ A;  3D8G A;  1EY4 A;  3PMF A;  5EKK A;  1JOK A;  5F2D A;  4I65 A;  1AEX A;  1EY0 A;  3EJI A;  3NP8 A;  1SNP A;  4KV6 A;  4KY6 A;  1EYD A;  4YIJ A;  4K8J A;  5E1F A;  4ZUI A;  3TP8 A;  3V2T A;  1EY5 A;  3T13 A;  4R8N A;  5ISR A;  1F2Z A;  2EYJ A;  3R3O A;  3ERQ A;  4NMZ A;  5E3F A;  2O4X A;  4K5V A;  2PZT A;  4KHV A;  5DAU A;  3T16 A;  2KQ3 A;  1TR5 A;  3QOL A;  4NDX A;  3DMU A;  5IOD A;  2F0Q A;  4ZQ3 A;  5NUC A;  1KAB A;  5KYL A;  5IGG A;  1SNQ A;  5CGK A;  5C3X A;  3SK6 A;  5C4H A;  3OMC A;  1STN A;  1KAA A;  4ME5 A;  5KIX A;  1EY7 A;  4HMJ A;  4K2K A;  2F0L A;  2M00 A;  4K5W A;  5CV5 A;  4IAL A;  1F2Y A;  2PYK A;  3C1F A;  2KHS A;  4QMG A;  4EVO A;  5I9O A;  2F0G A;  4RKL A;  3BDL A;  2EYF A;  3E5S A;  3EVQ A;  3SR1 A;  5KYI A;  3S9W A;  1NSN S;  2F0M A;  2EY2 A;  4RKB A;  1KDC A;  2PW7 A;  5IGD A;  2F3V A;  4LAA A;  4QF4 A;  3NXW A;  4KY7 A;  3ITP A;  1SNM A;  5CV7 A;  2EYH A;  4IZ8 A;  4OL7 A;  4K5X A;  5C4Z A;  1EY6 A;  1KDA A;  2EYO A;  1A3U A;  1JOO A;  4K8I A;  4QB4 A;  3SK4 A;  2EY1 A;  2OXP A;  3NK9 A;  5C3W A;  4S3S A;  4NKL A;  3SXH A;  3NUC A;  3OSO A;  5C5L A;  1A3T A;  3MXP A;  1II3 A;  1STG A;  2RBM A;  1SYE A;  3HEJ A;  4J6H A;  1RKN A;  3DHQ A;  4TRD A;  2F0I A;  5I6Y A;  1STB A;  3TP5 A;  2PZW A;  5CC4 A;  3SK8 A;  5DEH A;  3C1E A;  2F0K A;  1TT2 A;  2WAC A;  3MEH A;  1KDB A;  1NUC A;  3HZX A;  3OWF A;  5EKL A;  4DF7 A;  3MHB A;  2RDF A;  5J39 A;  1EZ8 A;  2F0P A;  4K14 A;  5J22 A;  4EQO A;  4DU9 A;  4KY5 A;  5IGC A;  5K5P A;  3QOJ A;  2F0U A;  1EY8 A;  4WOR A;  5IGE A;  1SND A;  3D6C A;  2F0E A;  3P1H A;  1EY9 A;  1TQO A;  1F2M A;  2SNS A;  4ZUJ A;  4F7X A;  5IGB A;  5J1Z A;  1EYA A;  2F0V A;  1ENC A;  1SYG A;  1SNO A;  5CV8 A;  3RUZ A;  2HQE A;  4F8M A;  1SNC A;  2F0D A;  3D4W A;  3MZ5 A;  3QB3 A;  2EY6 A;  5KRU A;  4KJO A;  1SYC A;  5JOB A;  4B9X A;  1JOQ A;  1EQV A;  1EZ6 A;  2RKS A;  4HTH A;  5KGU A;  1EYC A;  4KTA A;  1A3V A;  5IGF A;  1SYB A;  2EYL A;  4H7B A;  3BDC A;  3MVV A;  2F0T A;  3TME A;  3TP7 A;  2PZU A;  4DFA A;  4N9T A;  2F0N A;  2F3W A;  2F0W A;  4ID6 A;  5IOC A;  5HGT A;  2NUC A;  1ENA A;  3NQT A;  1U9R A;  2EYM A;  4ODG A;  4WRD A;  5KEE A;  4EQN A;  2PW5 A;  2QDB A;  3LX0 A;  2F0H A;  2OF1 A;  2PQE A;  4KD4 A;  5CV6 A;  5C6A A;  5JAV A;  2F0F A;  2SOB A;  5EGT A;  2F0O A;  5I6W A;  1IHZ A;  4KD3 A;  3P75 A;  5CV4 A;  5C5M A;  2EYP A; 
#chains in the Genus database with same CATH topology
 1VQN A;  2L1B A;  1B44 D;  1M4V A;  5C0X J;  2SEB D;  3PIP 3;  1U4P A;  2R92 H;  1A15 A;  1JR0 D;  3U9O A;  1TWG H;  3RZO H;  3D4R A;  1N36 Q;  2HQL A;  1DGS A;  5IP7 H;  4A3K G;  1MJC A;  2A6E C;  2NN6 H;  4B9W A;  3JAM i;  2IPK D;  2KUM A;  4MIU A;  4IJH A;  4AYB G;  2LKV A;  3IAY A;  1IBM Q;  4C3H B;  2UXD L;  1L1O A;  3NP8 A;  1NTG A;  4LFC L;  4IFD J;  4K5V A;  1JC7 A;  5DAU A;  1TWH H;  4DV2 L;  4GNX B;  5KYL A;  4RHR A;  2YTX A;  5FO7 B;  1STN A;  4K6L A;  2JA6 B;  1NR2 A;  5JJK A;  3VR3 A;  1IKL A;  4IAL A;  3C1F A;  4CKB A;  2F0G A;  3EVQ A;  4JI6 L;  2E74 C;  4UY8 C;  4BS9 A;  4L5Q A;  2EY2 A;  1G6Z A;  2JQO A;  4XXE A;  3M85 A;  4JBM A;  2F3V A;  3B6Y A;  2B8G A;  1Q8K A;  3K6O A;  3NEN A;  2BE5 D;  3HKZ B;  4A3C H;  1QOH A;  2E2I B;  4IPC A;  2OWO A;  2B2V C;  1Y14 B;  1BBU A;  1PRT D;  1G2T A;  2AWN A;  3M7N A;  4GOP A;  2Z6K A;  4GNX A;  4DXG A;  2D0P A;  3MC0 B;  4DK6 C;  1TT2 A;  1CSP A;  3UDF A;  1KD1 C;  5LMN Q;  4DV7 Q;  2NVQ B;  2CW0 C;  3ND8 A;  4ALP A;  1GM5 A;  5C4X B;  5FJ8 H;  3V05 A;  3VYS A;  4DU9 A;  2I46 A;  2F0U A;  2QW7 A;  1Q46 A;  3WWV A;  4BBS B;  1TQO A;  1UE5 A;  3KLR A;  1SNO A;  1EYG A;  3KJP A;  1FJG Q;  4F8M A;  3J7A V;  4JYA L;  1BCP C;  4PZ8 A;  4UAI A;  4B08 A;  1QE6 A;  3UI2 A;  5IWA L;  2Q2U A;  3GTK H;  3ERS X;  3TRZ A;  1JE5 A;  2LXJ A;  4DAY B;  3J80 c;  2NVY B;  4GZY C;  5IOC A;  2VNU D;  2MUY A;  5IYD G;  1J6Q A;  5TSS A;  1EIF A;  4X62 L;  5CV6 A;  1OXS C;  1E3P A;  4NW2 A;  2F0O A;  3QWN A;  1HA5 A;  2I0Q A;  2WAQ G;  2YYZ A;  1VQL A;  4DKA C;  2KJX A;  3S1R B;  1EQR A;  2XIW A;  2NB0 A;  2QIL A;  4RH6 A;  4IUT A;  3IKJ A;  1G8Z D;  1KNA A;  4B3S L;  5GQO A;  4JBK A;  1JT8 A;  1PDQ A;  2OEO A;  1VQM A;  1D5X C;  1AN8 A;  2HIV A;  2ATW A;  5C5L A;  1Y69 U;  1NJI C;  3UDG A;  3NSW A;  4P75 A;  5LHY 1;  1E2V A;  2QGQ A;  3K58 A;  1IL2 A;  2HCC A;  3F1Z A;  2EJG C;  1Q1B A;  3FHW A;  4A3E G;  1S4Z A;  5M5Y B;  4IO9 A;  2G9H D;  4LWC A;  1KHI A;  1KAA A;  2V4D A;  1SE3 A;  4DUY Q;  4Y7N B;  2M00 A;  1XMO Q;  4HCE A;  3K81 C;  4CDF C;  1M90 C;  5C3E H;  3S9W A;  3ER0 A;  3CME A;  4N8F A;  3TSS A;  5FLX E;  4BBS G;  1D2B A;  1C0A A;  1I6H B;  1PH7 A;  1CUK A;  3S17 H;  2JEB I;  1N32 Q;  2EYO A;  2HDL A;  4AYB E;  1PVO A;  2E2D C;  2E2J B;  4BY1 G;  4DR1 Q;  1R9T H;  3QO2 A;  3M4O H;  4LW1 A;  1GVP A;  2K01 A;  3MEH A;  2JJQ A;  4XQJ A;  2R7D A;  3BVM A;  1QNU A;  1A6X A;  4HCS A;  1TWG B;  3PCO B;  1QVC A;  4NXM Q;  2L0C A;  3E0J A;  1TWF H;  3RUZ A;  4KHZ A;  2LFN A;  4JPB W;  1YNN C;  4UHV A;  4DK0 A;  2KEC A;  5BN4 A;  3GP7 A;  1JWM D;  1U4L A;  5FKA C;  5JVH 3;  1A0I A;  3IFD A;  3R93 A;  1SEB D;  1IBM L;  3QG1 A;  1B9N A;  1NMG A;  1X55 A;  3J81 E;  2XWJ B;  4A3D H;  2DN8 A;  1TWH B;  4LF6 Q;  2VQF Q;  1KRS A;  4OHJ A;  3TZD A;  1BF4 A;  5JEA G;  4DR5 Q;  1XTD A;  2IX1 A;  3EBE A;  1TS5 A;  3TDQ A;  5GAD C;  5GAH C;  3JC6 6;  4IJL A;  1JMC A;  1MI2 A;  2F0J A;  1JWS D;  5M3F H;  2CH4 W;  5H1S E;  3HOU B;  2K50 A;  3TRE A;  2XGT A;  4RMF A;  1UNS A;  2Q2H A;  2ZXO A;  1PXU A;  3H0G G;  3CC7 A;  3SE0 A;  1Q81 C;  3K7A H;  1A2T A;  3P20 A;  1HFN A;  3E0E A;  1T9H A;  4KJN A;  1WCM G;  4JI7 Q;  1X54 A;  1ESF A;  1LV9 A;  5LMN W;  2ZJR A;  3CCE A;  3T13 A;  4DR4 Q;  3DEO A;  3KYH C;  3MAQ A;  2EYJ A;  2NVX H;  1KQS A;  4PQX A;  1VQH A;  1HTP A;  4FF1 A;  2ASB A;  4MN3 A;  4HID A;  3I4M G;  5LMN L;  2WAQ E;  1TWC H;  1B70 B;  3E5S A;  1VQB A;  2Q2T A;  2A19 A;  4XIG S;  4RKB A;  1I94 Q;  1VMP A;  4I7Z C;  1FJG L;  3GTK B;  3I4N H;  4OX9 Q;  3JAM E;  2AQ2 B;  1IW7 D;  2F1M A;  4L5S A;  4CJ1 B;  4LF5 Q;  4RG1 A;  1A3U A;  2HD3 A;  3ZYY X;  1YNJ D;  4A3B B;  2B2U A;  4JC0 A;  3P7J A;  2VQE Q;  2MQH A;  2X69 A;  2A69 C;  2RBM A;  2KCN A;  4CBV A;  3W2D A;  1XNQ L;  3GTG H;  1U4M A;  4JI1 Q;  1ET6 A;  2NYZ D;  1H95 A;  2IX3 A;  4KKS A;  3I70 A;  3LWE A;  4ZCK A;  5J39 A;  3ULJ A;  5K5P A;  1Y1W G;  2BA1 A;  1LYL A;  1KLU D;  4WOR A;  1F2M A;  5J1Z A;  2PI2 E;  1E2W A;  3DM1 A;  3HOV H;  1X3P A;  2B2V A;  2K75 A;  1SNC A;  3ONA B;  4L6T B;  1PH3 A;  4IUR A;  2EY6 A;  1WTQ A;  1K9M C;  2ES2 A;  5KRU A;  1KXL A;  1Y8P B;  4U67 3;  4KTA A;  1EEI D;  2HUG A;  3S1N H;  5JJL A;  4EGV A;  5IP9 H;  2K33 A;  5HGQ A;  2F0N A;  1AW7 A;  4HJ9 A;  4IN3 A;  4LF8 L;  1CA5 A;  4DA2 A;  5IYB H;  3CU7 A;  2RDH A;  1PFM A;  1AH9 A;  5EGT A;  3E6Z X;  1SMY C;  2AKW B;  3TP6 A;  1ICW A;  4X3K A;  5M9O A;  4Z9C B;  4K6D A;  4A3K H;  4ILW A;  1XXG A;  4OWX B;  1PFB A;  3OOC A;  2AUK A;  1DYQ A;  3NHH A;  3L7Z C;  3PO3 H;  4YHH L;  2F0S A;  2UUC L;  1B53 A;  1P16 A;  4JV5 L;  3M3Y H;  1C4Q A;  1N32 L;  2GVB A;  1VCI A;  2XVS A;  4PNY A;  1KRT A;  1EY0 A;  4CKE A;  1IZ6 A;  4G7Z C;  4K8J A;  1EY5 A;  4UP9 A;  4R8N A;  2K04 A;  3ERQ A;  3U4Z A;  3PIO A;  4A3B G;  3MXU A;  2R7Z B;  1J9O A;  1G2S A;  1HQR D;  3GTP H;  5JJI A;  2JA7 B;  2A68 D;  1CI3 M;  2F4V L;  4RFB A;  4JI4 Q;  1LTA D;  3VR4 A;  4NXM L;  3SR1 A;  1CM9 A;  4PZ6 A;  2F0M A;  3M9B A;  3EA6 A;  2GN5 A;  2R7F A;  4GN4 B;  3ITP A;  2NVT H;  4UPA A;  1EOV A;  1ML0 D;  1Q86 C;  4I7A A;  4QB4 A;  1HNW Q;  3L2P A;  2B2T C;  1JIC A;  3NUC A;  4A3M G;  3RN2 A;  1PYW D;  3OWF A;  5M3F B;  4DR5 L;  1V43 A;  4LNQ A;  3VYT A;  1CKN B;  4EQO A;  1EFI D;  3K5L A;  2F0E A;  2JSO A;  1FVI A;  1PRT F;  2HQE A;  1HZA A;  2Z9H A;  2UXD Q;  2D5D A;  1YEZ A;  1OXX K;  3KF8 B;  1SYC A;  1RTO A;  1CHP D;  3H3V C;  1IYJ B;  2F0T A;  2NVX B;  5IYD H;  2PNR C;  5CYU A;  4C3H H;  5BN3 A;  1K0S A;  4OON A;  3CP0 A;  1DON A;  4R4C A;  4X3T A;  2KCT A;  1CA6 A;  5JAV A;  4DR2 Q;  3HRZ C;  3G71 A;  3KLS A;  1JJG A;  3CKI B;  2N49 A;  2I5M X;  4R4I A;  2JA6 H;  1S5C D;  5CV9 A;  2KED A;  1V1P B;  2CKZ B;  4V19 0;  3C46 A;  5IY0 A;  3KF8 A;  5E4W C;  1YI2 A;  2WKC A;  4OO1 G;  1H9M A;  3LGJ A;  5ELF A;  1GKH A;  2PCF B;  1H9R A;  1STA A;  5JVG 3;  1T5X D;  4EX5 A;  4JI0 Q;  2HDM A;  1K8A C;  4OX9 L;  2E2I H;  3H6M A;  1JOR A;  3D4D A;  2VB3 X;  3PMF A;  2AWO A;  2K7V A;  4JI3 L;  3BU2 A;  4GKK L;  5E1F A;  3K57 A;  4LMQ D;  2O4X A;  5KNC A;  1CTM A;  1X32 A;  1S5D D;  1H9S B;  2Q8R E;  1PFN A;  4JI1 L;  3NWT A;  1MSH A;  2NVQ H;  1E1O A;  1V1P A;  4BBR G;  2M2L A;  4OXP A;  4R8I A;  4K2K A;  1B4O A;  1EL0 A;  2BCO A;  1VQ5 A;  2KCC A;  4HR7 B;  4JYA Q;  4RKL A;  3GQB A;  4BBS H;  1YHQ A;  2UU9 L;  1L0Y B;  1BO0 A;  4A3I B;  3L0O A;  5A2Q E;  3GTL H;  1HTL D;  4OO1 I;  1DD2 A;  4BY1 H;  1H9K A;  5E4X A;  4X62 Q;  1PTO D;  3SK4 A;  1VQG A;  2RHQ B;  3MFG A;  4HAE A;  4X6A H;  2QA4 A;  5AJ3 L;  4KLK A;  3STB C;  3HEJ A;  3DHQ A;  2EVB A;  2F0I A;  1VF5 C;  2ICE C;  3A5Z B;  3CPW A;  3I73 A;  3HZX A;  4MTN A;  1PZI D;  5CMD A;  3S1R H;  2LY7 A;  4LF7 L;  1GUN A;  4L5T A;  4AYB B;  1DOK A;  2EE1 A;  1YVC A;  4F7X A;  2SNS A;  5EPK A;  2B63 G;  5IYC H;  2K32 A;  3M3Y B;  3J81 i;  2JA8 B;  4RHS A;  5EKI A;  3PF5 A;  2RKS A;  2AQ1 B;  5ISR A;  1V1O A;  3K5O A;  1A3V A;  2DJF C;  5D3I B;  3J81 j;  1HHV A;  1B3A A;  2ZTE A;  1I4Q A;  2F3W A;  3MXN B;  3CF5 A;  2J4X A;  4IFD G;  2NZH A;  1A62 A;  1E1T A;  5DLQ E;  5G3L D;  1FL0 A;  4A3J G;  1V9P A;  2PQE A;  4CDE C;  1BDO A;  3IL8 A;  1PLF A;  4RWS C;  4O42 A;  4B3R Q;  2EYP A;  1M1K C;  1I50 H;  2EY5 A;  4J1M A;  4QL5 A;  4V0B A;  4Y7N H;  3PF4 A;  4QUC A;  5FLM H;  1O7Y A;  3PO2 G;  3PIP A;  3WOE A;  1TXY A;  2JA9 A;  4C1N K;  2ZTC A;  1WCM H;  4ZRZ A;  1I6H H;  3GV6 A;  2R3Z A;  5CR3 A;  4MTK A;  1X65 A;  3SK5 A;  3RLN A;  2J0T D;  1L1O B;  1GO3 E;  3G7L A;  1Q8I A;  4KN4 C;  3KBX A;  3D0F A;  3OPO A;  4FXK C;  1F2Z A;  3I4M H;  4IFD I;  3K59 A;  4O0A A;  3QOL A;  1G29 1;  4PMW A;  1KAB A;  1ASY A;  4YWL A;  4XYO A;  3K0Y A;  5EPJ A;  5ELN A;  3OTO L;  2K5V A;  5CV5 A;  3J7A F;  2KHS A;  2BDO A;  3CRK C;  3RD4 A;  1W3S A;  4A3G G;  5GAG C;  5GAE C;  4A3F G;  4DNI A;  2EDG A;  2IY5 B;  4GN3 B;  4ZK9 B;  2EYH A;  2K6A A;  3KDF A;  3AMU A;  2WAQ B;  4ULL A;  5DNF A;  1S5F D;  2G9D A;  2JA8 G;  4R4O A;  4XT3 B;  4GOP B;  2K28 A;  1UUP A;  1V1Q A;  2I5H A;  4DR2 L;  1CK1 A;  1Y1W H;  3HOY G;  1D5Z C;  1ZXT A;  1ENF A;  5J22 A;  3QOJ A;  2A6E D;  1SMX A;  3EFX D;  4FF2 A;  3P1H A;  3K0X A;  1EY9 A;  2H5X A;  3HOU H;  5IGB A;  1DOM A;  2V1C C;  1SYG A;  4KKU A;  4PG3 A;  2B2T A;  1C8C A;  1WYD A;  4JI0 L;  1GUO A;  3W5O A;  4A3E B;  1Q82 C;  2Y0S B;  4JK1 C;  1N33 Q;  4BWG B;  1ROD A;  1WD1 A;  1XPU A;  4H13 C;  1N34 L;  5HGT A;  2NUC A;  2OTL A;  3U50 C;  4EQN A;  4KD4 A;  1NE3 A;  5EAY A;  2XTI A;  5I6W A;  1PH2 A;  2LSS A;  2CQO A;  2FJ2 A;  2NBF A;  3UE1 A;  1ILQ A;  1DOL A;  5M5W B;  2Z0S A;  2BH2 A;  3KLW A;  1UE7 A;  1NBW A;  3GD7 A;  4N9P A;  2R93 G;  3GTL B;  5IT9 c;  4LK1 C;  1NR4 A;  4OEM B;  4BY1 B;  1IYU A;  1IKM A;  1SYF A;  1P8L A;  3KLS X;  3CHB D;  1PTO B;  1Y1V G;  1B8A A;  3FPP A;  1VQO A;  3ND9 A;  4P73 A;  2RSN A;  3D8G A;  2PI2 A;  4XQN A;  1XNQ Q;  1W6K A;  4A3B H;  1GHJ A;  1SNP A;  1YIJ A;  2RDG A;  3R2I A;  1SJH D;  1AZQ A;  2CW0 D;  2EOT A;  2IHE A;  2J7Z A;  1XWE A;  4UP7 A;  4RGM A;  2RSO A;  3MA2 B;  1DZ1 A;  4XQQ A;  5IGG A;  5CGK A;  3MWY W;  1EY7 A;  1WJJ A;  1CHQ D;  4K5W A;  1FD7 D;  3BYY B;  4FNF A;  3EQL C;  3M4Q A;  4QMG A;  1BCP D;  5COY A;  1BOS A;  2C9O A;  3PGZ A;  3T53 B;  2PW7 A;  1XMQ Q;  3TS2 A;  1BR9 A;  3PQI A;  4OGQ C;  1SNM A;  1SR3 A;  1GUG A;  4Q0F A;  1HR0 Q;  4LF8 Q;  5I2X A;  1PH9 A;  2OXP A;  5BR8 L;  3CCM A;  2K5D A;  4N8X 1;  3PUV A;  2Y0S G;  5FLX L;  3VDY A;  4DXF A;  1II3 A;  2LXK A;  1I50 B;  3H0G B;  3A55 A;  4DV5 Q;  2OT2 A;  1B2T A;  1TKW B;  2JA5 G;  4J15 A;  4B3R L;  1LAC A;  2OTJ A;  2QEJ C;  1O7L A;  2JYO A;  3TEH B;  4YHH Q;  1WCM B;  1BUV T;  1SND A;  4HN7 A;  1RD9 D;  1EIG A;  2UUC Q;  3J80 i;  4HSV A;  4JV5 Q;  3CQZ B;  1LT6 D;  2KHJ A;  2ZXP A;  3KOJ A;  2K4K A;  1LTL A;  2KA7 A;  4HTH A;  3FDT A;  1EYC A;  1XX8 A;  3URY A;  3I4M B;  3ICE A;  4DFA A;  3RNU A;  3HOW B;  4LFA L;  4JOI A;  2PQA A;  2XRQ D;  2X6L A;  4ID6 A;  1TS3 A;  1ZYR C;  4WRD A;  1HXY D;  4ODG A;  2L55 A;  3AFQ A;  2NZ1 D;  2K5N A;  5IYB G;  2F4V Q;  2R7Z H;  4DK1 A;  3J81 L;  2UXC Q;  4E6I A;  2ZM6 Q;  3PSI A;  2JA7 H;  2DGY A;  2VUM G;  1WVL A;  4OO1 H;  1WTO A;  2UXB L;  5I9P A;  4DUZ Q;  1K3R A;  3U9S A;  1PFS A;  4RCN A;  1I4G A;  5ELO A;  5FO9 B;  1YJN A;  1DM0 B;  1HFG A;  4DAM A;  4IUV A;  2I5L X;  3RMH A;  4O2D A;  2B39 A;  1S5B D;  4KK7 A;  5EKK A;  3U4V A;  2MJ8 A;  1AEX A;  2PMZ E;  1KC8 C;  1Y1W B;  3VR6 A;  3C2P A;  4ZUI A;  1K28 A;  2BDN A;  1Y8N B;  4YCW A;  3VYR A;  4KHV A;  4BBR H;  3H91 A;  3T16 A;  2KQ3 A;  1HA6 A;  3FRP B;  3DMU A;  5NUC A;  2PPB C;  3LNN A;  5K36 H;  1LTI D;  1L0X B;  4ZYS A;  2CWA A;  2EPB A;  1B9M A;  1SLJ A;  2K5W A;  3BDL A;  3S1M B;  1YNN D;  1VQF A;  3CCL A;  4CGY B;  1FGB D;  3O13 A;  3NXW A;  4KY7 A;  1D6E C;  3CCV A;  5M5X B;  4WJ4 A;  1QVG A;  4PV1 C;  5C4Z A;  3F2B A;  1EIH A;  1N33 L;  5COR A;  2B2W C;  3PV0 A;  1S3O A;  2LMC B;  1PH4 A;  2BH8 A;  2IWH A;  3TQY A;  3CW2 C;  3JAM L;  1K73 C;  3HOW G;  1AE3 A;  5I6Y A;  4FP5 D;  4DF7 A;  5LL6 X;  2WIN B;  3HGB A;  3QR8 A;  1MD2 D;  3KBG A;  2B63 H;  1EY8 A;  5IGE A;  4CDC C;  3I3C A;  1SE4 A;  1OXV A;  3D6C A;  4CKC A;  2R61 A;  1GUT A;  4WFN 3;  2VL6 A;  1ENC A;  2PO4 A;  3J7A 5;  3IRB A;  2F0D A;  2ZT9 C;  2MHV A;  3AB9 A;  4JI3 Q;  4M1U B;  4GKK Q;  1ILP A;  2GVA A;  1HH2 P;  2IHF A;  3GV3 A;  2BA0 A;  2PZU A;  3I90 A;  4A3J H;  2R92 G;  4FO2 A;  4FF4 A;  1X6O A;  4NXN L;  1AFP A;  5IP7 G;  1BBX C;  2Y0S E;  5C4J H;  3RLF A;  2OF1 A;  2D0O A;  3L9A X;  3HOX G;  4JBJ A;  4A93 G;  5LL6 S;  4IPD A;  3S16 H;  1J5E L;  4DK3 C;  2KBN A;  1CKO A;  1BCP B;  2UU9 Q;  3CCR A;  3DLL A;  2A8V A;  2SNM A;  2K03 A;  1C48 A;  5D65 A;  2N78 A;  2A6H C;  1UE1 A;  1HR0 W;  2DY7 A;  4A3M B;  4JI5 Q;  5E7N A;  2RHS B;  1R4P B;  3I2Z A;  5IIF A;  4B3M L;  4A3I H;  1XMQ L;  1VF7 A;  1B7Y B;  3ZJY C;  4TKO B;  4P71 A;  5G3L F;  4BA2 I;  1CT1 D;  5AJ3 Q;  4HJ5 A;  1RIP A;  1HR0 L;  4L5R C;  2A69 D;  1EY4 A;  2Z1C A;  5ELD A;  3EJI A;  4YIJ A;  3R2T A;  1EYD A;  2XNA C;  4H0L C;  3TN2 A;  4LF7 Q;  2DJG C;  3S14 H;  1VDZ A;  2B2Y C;  3I91 A;  1XTC D;  4RAU C;  4DV5 L;  2HHH L;  4CHT B;  1SNQ A;  3BG3 A;  4A3F H;  2CVR A;  2I07 B;  3DXJ C;  1VQI A;  2KEE A;  4JI2 L;  4Q5V A;  1OTC A;  1SFO H;  3GTQ B;  1YJW A;  1HZC A;  1LO5 D;  2F52 A;  1VQD A;  5L37 A;  1K0R A;  1KDC A;  4APV A;  3UE0 A;  3U58 A;  5CV7 A;  5FJ8 G;  2XRS D;  2JA8 H;  1VS0 A;  2Z4H A;  3OW2 A;  3L3O C;  1ONL A;  4OIJ A;  4P74 A;  4IUP A;  4POF A;  3DWQ A;  1SMY D;  1G91 A;  1VQJ A;  3HOY H;  1PZJ D;  4TRD A;  3CCS A;  1STB A;  1KAW A;  4OWW B;  3C1E A;  1XJV A;  1KDB A;  4C3J B;  2YTY A;  3MHB A;  2UXC L;  1CQF A;  3W1G A;  2ZM6 L;  1WTX A;  4ZUJ A;  4DR3 L;  4DUZ L;  4RGT A;  2N8N A;  3K5M A;  1PYS B;  2NTT A;  2G5D A;  3FEW X;  2CQA A;  1R4Q B;  2OCE A;  4AQY L;  1SAP A;  1HUM A;  4RA8 A;  2LS0 1;  1EQV A;  1EZ6 A;  1WTP A;  4DNR B;  5IGF A;  1GXD C;  3TME A;  4TSS A;  1YBY A;  3RR5 A;  4BBR B;  4JW0 A;  3FVQ A;  1F9R A;  2OQK A;  2Z6B A;  2FMM A;  5EJW A;  4DV6 L;  1SRO A;  3LX0 A;  3OTO Q;  1WFQ A;  2F0F A;  5HY6 A;  5J3B A;  2R93 H;  2X6G A;  3Q22 A;  4ABN A;  4X65 Q;  1RCV D;  1F2L A;  1Q12 A;  3E3X A;  3I72 A;  4HMI A;  3OHX C;  4A3L G;  3T51 B;  3J80 E;  2A73 B;  4K2L A;  4GNX C;  4HIO A;  3GTJ B;  1LTS D;  4HJ8 A;  4L8J A;  1I6V C;  2ID0 A;  4G57 A;  2ENB A;  3HFZ B;  3NPP A;  4J8Q A;  4KN7 C;  3TP8 A;  5FLX c;  3NEL A;  1QNK A;  1PYB A;  1D1K A;  2B63 B;  1E22 A;  3AQQ A;  4HIK A;  1TR5 A;  1QVF A;  1TY0 A;  1EWI A;  1VQK A;  3X3N A;  2JXM B;  2F0L A;  3CRL C;  2AMC B;  3EIV A;  3AYH B;  4C3J G;  4EVO A;  1RHP A;  5KYI A;  1VQC A;  4LUZ A;  4AH6 A;  5CBA E;  2H4O A;  3KF6 B;  4A3J B;  1AE2 A;  1N34 Q;  4A3E H;  2MNA A;  1JOO A;  5C4J B;  2MO1 A;  3CCU A;  5FO8 B;  2MGS A;  1QB5 D;  2JN4 A;  2MFI A;  4NKL A;  4QIW E;  3OSO A;  3GO5 A;  3SXH A;  4POG A;  3S16 B;  3S1Q B;  1STG A;  2JA5 H;  3PO2 B;  1U5K A;  5A2Q L;  4DAP A;  2D9U A;  4RGN A;  1HUN A;  4BY7 B;  4HJA A;  1BCP F;  1UEA B;  5M5W H;  3J81 c;  2F0P A;  4K14 A;  4A3D G;  1NNX A;  2F03 A;  5IGC A;  4HSP A;  1Q7Y C;  2RVL A;  3KF6 A;  2CWP A;  3FKI G;  1LLR D;  1I5F A;  4G4K A;  1A63 A;  2B2W A;  3D4W A;  4JI5 L;  5C44 B;  3T1H Q;  4BXX G;  3SEB A;  4DV3 L;  1PTO H;  5KGU A;  2XWB B;  3I55 A;  2EYL A;  3S14 B;  2KVM A;  1BVS A;  1O7Z A;  4C2M B;  5FK9 C;  4A3G B;  5C0X G;  2VW9 A;  4A3F B;  2K5Q A;  2QDB A;  2Q8I B;  2E5L L;  2XSC A;  3E9I A;  5DM6 3;  1SFO B;  2YV5 A;  5C5M A;  3DWA A;  4X64 Q;  2WB1 G;  2RCN A;  3N52 A;  2UUB L;  2VB2 X;  1WI5 A;  2HCI A;  2RA4 A;  1VQ8 A;  5BR8 Q;  4QCL A;  4YY3 L;  1SRU A;  2ICI A;  1HJP A;  1LT5 D;  4JI8 L;  5JEA H;  1QCB D;  3HOY B;  3STB D;  3TS0 A;  5ELC A;  4CDD C;  4QUF A;  4KMU C;  3JAM c;  4GLA C;  4Y52 H;  3H0G H;  4NDX A;  3HOZ B;  4TVA B;  1GHK A;  5C0X I;  2A5H A;  1ZEQ X;  2AQ3 B;  4LFB L;  1MHW C;  1XNR L;  3J7Y W;  4HMJ A;  4BY7 G;  3QIA A;  4IOA A;  1J8I A;  5JPN C;  3A56 A;  2TMP A;  3SDZ A;  2PMZ B;  5ELB A;  1CSQ A;  2UUA L;  4XYQ A;  4JCV E;  1LT4 D;  3CQZ H;  4LFA Q;  4U68 A;  3KDF B;  1NY4 A;  4KKT A;  1KDA A;  1K3B C;  1CQV A;  1GUS A;  5C44 G;  4FDB A;  3T1Y L;  3HOW H;  4NPS A;  1IBK L;  3NK9 A;  4LJZ C;  3CAM A;  1KTK A;  2R93 B;  4IUQ A;  1A3T A;  3DWP A;  1D7Q A;  1SYE A;  1TY2 A;  4XT1 B;  4C3I B;  2RQX A;  2WAC A;  4H02 A;  1NUC A;  2UXB Q;  3Q8D A;  1XPO A;  1RTN A;  3S2H H;  3MFY A;  1Y1V B;  2QDL A;  2Q8T A;  4X65 L;  1GOZ A;  1HNZ L;  4KY5 A;  4A4I A;  3J7Z C;  1O78 A;  1EYA A;  1FNV A;  1QWY A;  1YIT A;  3VR2 A;  2N88 A;  4ZKB B;  4UP8 A;  5I4D A;  3MZ5 A;  2A1A A;  3G48 A;  4R4Q A;  4LF4 L;  5JOB A;  1U4R A;  4QQB X;  1CFM A;  1PA6 A;  2RF4 A;  1AP0 A;  1PH6 A;  3S2D B;  3W1B A;  4N9T A;  1EFW A;  2BE5 C;  3FMC A;  3EN2 A;  2MO0 A;  3HOX H;  1CZG A;  4A93 H;  1EU4 A;  3NQT A;  2IX0 A;  4JVZ A;  1HNX L;  2KHI A;  1NAP A;  2SDF A;  1FGU A;  1HPC A;  4IQZ A;  3PO3 G;  3F2U A;  5GRO A;  2F0H A;  1PRT C;  1KNE A;  1PZK D;  1LUZ A;  5IE8 A;  3CC4 A;  3HKS A;  4X3U A;  2OQ0 A;  4EQP A;  2GA4 B;  3S15 B;  5CBE E;  3A5U A;  3HOZ G;  2B2U C;  3DEP A;  2E75 C;  3S1M H;  1C9O A;  2KCM A;  2IW3 A;  2VZA A;  5BN5 A;  3HG9 A;  1HRJ A;  1ESR A;  3DUZ A;  1RL2 A;  2B29 A;  3D3R A;  1T5E A;  3CXC A;  3Q23 A;  2HT1 A;  5M5X H;  4A75 A;  4PMB A;  1DJR D;  4PZ7 A;  4IPG A;  4DR6 Q;  2JA5 B;  4XDX A;  4JBW A;  2CH4 A;  1X3F A;  3V2T A;  4C1N I;  1QIL A;  3CD6 A;  1S5E D;  4NMZ A;  4JG2 A;  4MNO A;  5IOD A;  4FYD A;  4YWM A;  1WTV A;  3D31 A;  4CJ0 B;  1G51 A;  4C3I G;  1WTH A;  1I3Q B;  3BZC A;  3PUZ A;  2K52 A;  3V96 A;  1LM0 A;  2CCZ A;  1Q3L A;  2KOL A;  2WB1 E;  3CMA A;  2N3S A;  1NSN S;  4ZLT F;  1Z6H A;  3AFP A;  4G7H C;  1ICF B;  3Q0A A;  3A54 A;  4M8A A;  3T1H L;  1MKH A;  2EXD A;  1PMR A;  2KEN A;  1XYI A;  1SN8 A;  4NXN Q;  1FR3 A;  1EY6 A;  4ZAI A;  2VUM B;  3D6W A;  1J5E Q;  2IL8 A;  2IT1 A;  1D5M C;  4J6H A;  2NZO A;  3RN5 A;  3S24 A;  1MJE A;  1O80 A;  5CC4 A;  1WTW A;  1X3G A;  3T56 B;  1WTR A;  4FXD A;  4C3H G;  3GDE A;  1PH1 A;  4B3M Q;  1CZW A;  4DV0 L;  4OEL B;  4X64 L;  4OIK A;  5CV8 A;  3ULP A;  4A3M H;  4B3T L;  3C3L A;  3OWE B;  2JA6 G;  1Q1E A;  2FMC A;  1YNX A;  1K83 B;  3E9H A;  1I4P A;  1Z7T A;  4F87 A;  1XPR A;  5M3M B;  1FNU A;  4HJ7 A;  2PQA B;  2HHH Q;  4DV1 L;  4DAY A;  3DM3 A;  1ENA A;  3CCQ A;  4UDU C;  4G7O C;  4GLX A;  2PW5 A;  3HKZ G;  4IUU A;  3NTH A;  4LUV A;  4JI2 Q;  1IHZ A;  2K14 A;  3P75 A;  2O5J C;  4LUO A;  3GTO H;  4A3L H;  3WOF A;  4DAV A;  3GTQ H;  3OIQ A;  4ME3 A;  5ELE A;  3RLO A;  4OWT B;  2K05 A;  1FNW A;  1QZH A;  2ZXR A;  4IUN A;  5C4X G;  3VA5 A;  2DNC A;  3QJY A;  2K5H A;  2AHO B;  1I4X A;  2DY8 A;  3H3V I;  2EXZ A;  4IPH A;  4XTC S;  1JOK A;  1TII D;  2JE6 I;  4I65 A;  2L4N A;  1AZP A;  3OIP A;  3S2H B;  3I4O A;  5E3F A;  4DV4 L;  1HCZ A;  1PH5 A;  3A7A B;  1X3Q A;  2PNH A;  2F0Q A;  1M8A A;  3MTS A;  4C3J H;  4DR3 Q;  2E2H H;  3PUX A;  1GUW A;  4IOC A;  1F77 A;  2F3I A;  4ME5 A;  4DR7 Q;  1KIX A;  2FXQ A;  3MEF A;  4AQY Q;  1F2Y A;  5I9O A;  4R9W A;  1X56 A;  4LF9 L;  2R92 B;  5LMU L;  1EWC A;  3RZO B;  1ET9 A;  5IGD A;  2CHB D;  1TU2 B;  1E0B A;  4GKJ Q;  2R6G A;  3HOX B;  4A93 B;  1N36 L;  1ZYR D;  4DV6 Q;  3G6J B;  5IYC G;  1VMC A;  2QEX A;  1QZG A;  4YCU A;  3MXP A;  1L0W A;  1LTR D;  5M3M G;  3A8I E;  3A7L A;  5DEH A;  2B8F A;  3SK8 A;  4DNT B;  3F2C A;  1H9J A;  5EKL A;  1JCK B;  2Q2I A;  2FHT A;  3FKI H;  1Z47 A;  2WKD A;  3VR5 A;  4BXX H;  1EQT A;  4QIW B;  2Z4I A;  2BOS A;  1K8M A;  3GTJ H;  3Q24 A;  4KJO A;  4B9X A;  4HIM A;  1UWV A;  4L63 B;  1JOQ A;  3OW7 A;  5D14 A;  5FLM G;  3BDC A;  3MVV A;  4CJ2 C;  1MSG A;  4DR6 L;  5C0X H;  3KK7 A;  1SE2 A;  1IW7 C;  3K8A A;  1EEF D;  1FYC A;  3I8Z A;  1LTG D;  1PRT B;  5KEE A;  4FXG C;  5FOB B;  1JB7 A;  3NTK A;  4X3S A;  1ZKO A;  1YNJ C;  1VQE A;  3ULL A;  2ZJQ A;  4KD3 A;  1OXU A;  1PHJ A;  1PTO F;  3OMG A;  4DGZ A;  1F9Q A;  4DV7 L;  1E24 A;  4IFD H;  2YTV A;  1KL9 A;  1I4R A;  3RZD H;  1LAB A;  1A2U A;  2FFK B;  3ERO A;  3H94 A;  4PMC A;  1STY A;  2ALY B;  5KNB A;  3BJU A;  2NN6 G;  4HED A;  5DM7 3;  2WV6 D;  3BZD B;  1PH8 A;  5F2D A;  4P72 A;  4KV6 A;  3VA7 A;  3S1Q H;  4O1N A;  3PO2 H;  3G6E A;  3UDI A;  4BY7 H;  4GLV B;  4QY7 A;  3HKZ E;  2TSS A;  3OMC A;  1WOC A;  5KIX A;  2XN9 C;  1TS4 A;  5JEA J;  4DN4 M;  1CKM A;  4DV3 Q;  2DUD A;  2P5Z X;  2HIX A;  2QKI C;  4X66 Q;  4EQ5 A;  4LAA A;  3GTM H;  3CC2 A;  5C44 H;  4K0K Q;  2M9V A;  3M4P A;  2L12 A;  1GJX A;  3CPF A;  2EQS A;  4K5X A;  2E5L Q;  3HOU G;  2EY1 A;  2C5C A;  4A3C G;  5EQ0 A;  3AU7 A;  5C3W A;  4S3S A;  2NN6 I;  4NB3 A;  2MPM A;  3R8B A;  4C2M H;  1VQA A;  2ZTD A;  4A3G H;  3GTO B;  1RKN A;  1D1I A;  3I7F A;  2PZW A;  2F0K A;  1DCZ A;  2UUB Q;  2A6H D;  1EOT A;  2CFM A;  1B3Q A;  3A8J E;  1PV4 A;  1LTT D;  1SBB B;  2O5I C;  1TWA H;  4YY3 Q;  5C3E B;  2NWG A;  1VQ4 A;  2F0V A;  4JI8 Q;  1QJO A;  2A68 C;  2EZV A;  4DUY L;  2D2C C;  1XMO L;  5JPM C;  3QB3 A;  2FIN B;  2NTS A;  3S17 B;  3N6R A;  1WD0 A;  1SYB A;  1EU3 A;  1STE A;  1MBY A;  4FF3 A;  2E76 C;  1IYV A;  1F9S A;  1YHA A;  1D8L A;  1W2B A;  1X3E A;  1R9T B;  4LFB Q;  2E2H B;  3M4O B;  1XNR Q;  2O2L D;  3X3M A;  3I56 A;  5C6A A;  1VQ6 A;  1L1O C;  1VQP A;  3HOZ H;  4MHE A;  1QUQ B;  4DR1 L;  5CV4 A;  1IBL Q;  1GD7 A;  2UUA Q;  1DXM A;  3M4Y A;  3TZU A;  4DR7 L;  1E7Z A;  4WJ3 M;  4NP5 A;  3IFT A;  3FPU B;  1HQM C;  3UDX A;  1EIY B;  2YU9 H;  2EIF A;  2B3G A;  5D3D A;  1IXR A;  1TWF B;  1YJ9 A;  4GN5 A;  1VQ7 A;  3T1Y Q;  5EBD A;  1IBK Q;  5IT9 L;  3SHL A;  4GKJ L;  2RCF A;  1N9W A;  3H09 A;  2K1B A;  3J80 L;  4A3D B;  2D62 A;  3I4L A;  5JJZ A;  2EJM A;  1NMF A;  1QUQ A;  3R3O A;  3FKI B;  3PUW A;  5T1G A;  5IT9 E;  1G6P A;  2PZT A;  3LWU A;  4C3I H;  1SXT A;  3PIO 3;  1HNZ Q;  4KHP Q;  2WII B;  1EWH A;  1OXT A;  3HS0 C;  4GS3 A;  3VYU A;  4LF6 L;  2VQF L;  3SK6 A;  5C4H A;  4GOP C;  2Z6K C;  1Y1V H;  2WFW A;  3AEV A;  4LF4 Q;  2JEA I;  1O7I A;  1S72 A;  3NEM A;  3NWS A;  1NCV A;  1C7Y A;  4C56 C;  4QF4 A;  3K7A B;  3OYY A;  5C3E G;  3NBI A;  1JJC B;  4OL7 A;  1U0L A;  5EPL A;  1QG7 A;  1HNX Q;  3W3A A;  4P2C B;  4DPG A;  1SDF A;  3KJO A;  4KI0 A;  1BNZ A;  3S2D H;  1SSO A;  1RF2 D;  4RCO A;  3BS1 A;  4LFC Q;  2WB1 B;  1EQQ A;  1YHB A;  1B1Z A;  1VQ9 A;  2JK8 A;  4JI7 L;  1JWU D;  3TP5 A;  1JB3 A;  4DV2 Q;  1SE8 A;  5T1I A;  4DR4 L;  2RDF A;  1EZ8 A;  3K7U C;  1TWC B;  3H15 A;  1Q90 A;  3K80 C;  3F2D A;  3S15 H;  3RZD B;  4A76 A;  1CKN A;  1BKB A;  4WJW A;  4JI6 Q;  1Z9F A;  1BBW A;  3H3V H;  2F4I A;  1UEB A;  2R7Z G;  2L5T A;  1E2Z A;  3I4N B;  3BVG A;  2Z8L A;  1YZ6 A;  4MZ9 A;  2JA7 G;  4H7B A;  1I94 L;  3TP7 A;  3F8T A;  3PUY A;  4RGO S;  1Y8O B;  1UE6 A;  4QJF A;  2MP1 A;  2EYM A;  1PTO C;  4LF5 L;  4BA1 I;  1K8O A;  5EBC A;  1JQY D;  3NBH B;  1SJE D;  3GTG B;  3BYT B;  1N8R C;  1TVX A;  2VQE L;  2C35 B;  1LTB D;  1I3Q H;  2VY3 A;  3BZK A;  3GTM B;  5C4X H;  1OO9 B;  3HOV B;  1STH A;  5KND A;  5M3F G;  4X66 L;  5K36 G;  4K0K L;  3BVZ A;  1TS2 A;  3CCJ A;  3S1N B;  1SYD A;  5IWA Q;  5HUR A;  1JJ2 A;  3SVM A;  2WP8 J;  3NBH A;  1EUJ A;  4KY6 A;  2VUM H;  3WDN A;  1RJT A;  1X9N A;  4YWK A;  4DV0 Q;  1F9P A;  2NVY H;  5AFW A;  4ZQ3 A;  1H9S A;  5A35 A;  1TWA B;  5C3X A;  3BDO A;  3M7G A;  1A8V A;  4JOI C;  2PYK A;  4A3K B;  4B3T Q;  4TQU S;  2EYF A;  4YCV A;  2AUJ D;  1K8G A;  4ZKC B;  2ZJP A;  2IJ0 A;  2QCP X;  3PO3 B;  3MXG A;  4FVM A;  4B3S Q;  1MIU A;  3K5N A;  4DV1 Q;  4IZ8 A;  2VXW A;  3A8K E;  3FP9 A;  3SGI A;  3I4N G;  1K83 H;  1MGS A;  4K8I A;  1UAP A;  3NE5 B;  5M3M H;  3T4A C;  1HZ9 A;  2E8G A;  3NTI A;  1BQQ T;  2L9H A;  2L11 A;  2VS1 A;  2EJF C;  3G4S A;  2YU9 B;  3A74 A;  3A0J A;  1S40 A;  1I4H A;  1IBL L;  3GTP B;  1HZB A;  2A74 C;  5M5Y H;  3KUP A;  1RDP D;  4H44 C;  4R1J A;  1W6J A;  4F88 A;  4QGU A;  2DNE A;  1B50 A;  4JI4 L;  2B2Y A;  3Q6S A;  2NVT B;  1V8Q A;  1BXT A;  3HOV G;  1JE4 A;  4R4T A;  4DV4 Q;  1L2F A;  3MXN A;  2F0W A;  2L15 A;  3TBI B;  1KLG D;  1U9R A;  5IP9 G;  4A3I G;  3KFU A;  1IL8 A;  2QF7 A;  1ASZ A;  1HNW L;  2H1E A;  2SOB A;  5I2Y A;  4AIM A;  2E2J H;  4KHP L;  4LF9 Q;  2N55 A;  3NQI A;  1LT3 D;  2JP1 A;  3HP3 A;  5LMU Q; 
#chains in the Genus database with same CATH homology
 2L1B A;  1B44 D;  1M4V A;  5C0X J;  2SEB D;  3PIP 3;  1U4P A;  1A15 A;  1JR0 D;  3U9O A;  3D4R A;  2A6E C;  2NN6 H;  4B9W A;  2IPK D;  2KUM A;  4MIU A;  2LKV A;  3IAY A;  4C3H B;  3NP8 A;  4IFD J;  4K5V A;  1JC7 A;  5DAU A;  5KYL A;  4RHR A;  5FO7 B;  1STN A;  4K6L A;  2JA6 B;  1NR2 A;  3VR3 A;  1IKL A;  4IAL A;  3C1F A;  4CKB A;  2F0G A;  3EVQ A;  2E74 C;  4BS9 A;  2EY2 A;  1G6Z A;  4XXE A;  3M85 A;  2F3V A;  3K6O A;  2B8G A;  2BE5 D;  3HKZ B;  1QOH A;  2E2I B;  2B2V C;  1PRT D;  1G2T A;  2AWN A;  3M7N A;  4DXG A;  3MC0 B;  1TT2 A;  2NVQ B;  2CW0 C;  3ND8 A;  5C4X B;  3V05 A;  3VYS A;  4DU9 A;  2I46 A;  2F0U A;  4BBS B;  1TQO A;  3KLR A;  1SNO A;  4F8M A;  3J7A V;  1BCP C;  4UAI A;  4B08 A;  1QE6 A;  3UI2 A;  2NVY B;  4GZY C;  5IOC A;  2VNU D;  2MUY A;  5TSS A;  5CV6 A;  1OXS C;  4NW2 A;  2F0O A;  3QWN A;  1HA5 A;  2YYZ A;  3S1R B;  2KJX A;  2XIW A;  2NB0 A;  2QIL A;  4RH6 A;  4IUT A;  3IKJ A;  1G8Z D;  1KNA A;  1PDQ A;  2OEO A;  1D5X C;  1AN8 A;  5C5L A;  1Y69 U;  3NSW A;  5LHY 1;  1E2V A;  3K58 A;  2HCC A;  2EJG C;  1Q1B A;  1S4Z A;  5M5Y B;  2G9H D;  1KAA A;  2V4D A;  1SE3 A;  4Y7N B;  2M00 A;  4HCE A;  3S9W A;  5FLX E;  3TSS A;  1D2B A;  1I6H B;  2JEB I;  2EYO A;  2HDL A;  2E2D C;  2E2J B;  3QO2 A;  2K01 A;  3MEH A;  4XQJ A;  3BVM A;  1QNU A;  1A6X A;  4HCS A;  1TWG B;  2L0C A;  3E0J A;  3RUZ A;  4KHZ A;  2LFN A;  1YNN C;  4DK0 A;  5BN4 A;  2KEC A;  3GP7 A;  1JWM D;  1U4L A;  5FKA C;  5JVH 3;  3IFD A;  3R93 A;  1SEB D;  3QG1 A;  1B9N A;  3J81 E;  2XWJ B;  2DN8 A;  1TWH B;  4OHJ A;  3TZD A;  1BF4 A;  5JEA G;  2IX1 A;  1TS5 A;  3TDQ A;  1MI2 A;  2F0J A;  1JWS D;  3HOU B;  1UNS A;  2ZXO A;  1PXU A;  3SE0 A;  1A2T A;  3P20 A;  1HFN A;  4KJN A;  1ESF A;  1LV9 A;  3T13 A;  3DEO A;  3MAQ A;  2EYJ A;  4PQX A;  1HTP A;  4FF1 A;  4MN3 A;  3E5S A;  4XIG S;  4RKB A;  1VMP A;  4I7Z C;  3GTK B;  3JAM E;  2AQ2 B;  1IW7 D;  2F1M A;  4CJ1 B;  1A3U A;  3ZYY X;  1YNJ D;  4A3B B;  2B2U A;  3P7J A;  2X69 A;  2A69 C;  2RBM A;  2KCN A;  4CBV A;  3W2D A;  1U4M A;  1ET6 A;  2NYZ D;  2IX3 A;  4KKS A;  3I70 A;  3LWE A;  5J39 A;  5K5P A;  2BA1 A;  1KLU D;  4WOR A;  1F2M A;  5J1Z A;  1E2W A;  3DM1 A;  1X3P A;  2B2V A;  4L6T B;  1SNC A;  3ONA B;  4IUR A;  2EY6 A;  1WTQ A;  5KRU A;  1Y8P B;  4U67 3;  4KTA A;  1EEI D;  2HUG A;  4EGV A;  2K33 A;  2F0N A;  1AW7 A;  4IN3 A;  1CA5 A;  4DA2 A;  3CU7 A;  2RDH A;  1PFM A;  5EGT A;  3E6Z X;  1SMY C;  3TP6 A;  1ICW A;  4X3K A;  5M9O A;  4Z9C B;  4K6D A;  4ILW A;  1XXG A;  1PFB A;  3OOC A;  2AUK A;  1DYQ A;  3NHH A;  3L7Z C;  2F0S A;  1B53 A;  1C4Q A;  4PNY A;  1VCI A;  2XVS A;  1EY0 A;  4CKE A;  4G7Z C;  4K8J A;  1EY5 A;  4R8N A;  2K04 A;  3ERQ A;  3MXU A;  2R7Z B;  1J9O A;  1G2S A;  1HQR D;  2JA7 B;  2A68 D;  1CI3 M;  4RFB A;  1LTA D;  3VR4 A;  3SR1 A;  1CM9 A;  2F0M A;  3EA6 A;  3ITP A;  1ML0 D;  4QB4 A;  2B2T C;  1JIC A;  3NUC A;  1PYW D;  3OWF A;  5M3F B;  1V43 A;  3VYT A;  4EQO A;  1EFI D;  3K5L A;  2F0E A;  2JSO A;  1PRT F;  2HQE A;  2D5D A;  1OXX K;  1SYC A;  1RTO A;  1CHP D;  3H3V C;  2F0T A;  2NVX B;  2PNR C;  5CYU A;  5BN3 A;  1DON A;  4X3T A;  1CA6 A;  5JAV A;  3HRZ C;  3KLS A;  3CKI B;  1S5C D;  5CV9 A;  2KED A;  1V1P B;  4V19 0;  3C46 A;  3KF8 A;  5E4W C;  2WKC A;  4OO1 G;  1H9M A;  5ELF A;  2PCF B;  1H9R A;  1STA A;  5JVG 3;  1T5X D;  2HDM A;  3H6M A;  1JOR A;  3D4D A;  2VB3 X;  3PMF A;  2AWO A;  2K7V A;  5E1F A;  3K57 A;  4LMQ D;  2O4X A;  5KNC A;  1CTM A;  1X32 A;  1S5D D;  1H9S B;  2Q8R E;  1PFN A;  3NWT A;  1MSH A;  1V1P A;  2M2L A;  4R8I A;  4K2K A;  1B4O A;  1EL0 A;  2BCO A;  2KCC A;  4HR7 B;  4RKL A;  3GQB A;  1L0Y B;  1BO0 A;  4A3I B;  5A2Q E;  1HTL D;  4OO1 I;  1DD2 A;  1H9K A;  5E4X A;  1PTO D;  3SK4 A;  3MFG A;  4HAE A;  3HEJ A;  3DHQ A;  2EVB A;  2F0I A;  1VF5 C;  2ICE C;  3I73 A;  3HZX A;  1PZI D;  5CMD A;  2LY7 A;  1GUN A;  4AYB B;  1DOK A;  2EE1 A;  4F7X A;  2SNS A;  5EPK A;  2K32 A;  3M3Y B;  2JA8 B;  4RHS A;  5EKI A;  2RKS A;  2AQ1 B;  5ISR A;  1V1O A;  3K5O A;  1A3V A;  5D3I B;  1HHV A;  1B3A A;  1I4Q A;  2F3W A;  2J4X A;  4IFD G;  5G3L D;  2PQE A;  1BDO A;  3IL8 A;  1PLF A;  4RWS C;  4O42 A;  2EYP A;  2EY5 A;  4J1M A;  4V0B A;  4QUC A;  1O7Y A;  3WOE A;  4C1N K;  4ZRZ A;  3GV6 A;  2R3Z A;  5CR3 A;  3SK5 A;  2J0T D;  3G7L A;  1Q8I A;  4KN4 C;  3KBX A;  3OPO A;  4FXK C;  1F2Z A;  4IFD I;  3K59 A;  3QOL A;  1G29 1;  4PMW A;  1KAB A;  4XYO A;  3K0Y A;  5EPJ A;  5CV5 A;  3J7A F;  2KHS A;  2BDO A;  3CRK C;  3RD4 A;  2EDG A;  4ZK9 B;  2EYH A;  2K6A A;  3AMU A;  2WAQ B;  4ULL A;  5DNF A;  1S5F D;  2G9D A;  4XT3 B;  2K28 A;  1UUP A;  1CK1 A;  1D5Z C;  1ZXT A;  1ENF A;  5J22 A;  3QOJ A;  2A6E D;  3EFX D;  4FF2 A;  3P1H A;  1EY9 A;  5IGB A;  1DOM A;  1SYG A;  4KKU A;  2B2T A;  1C8C A;  1GUO A;  4A3E B;  2Y0S B;  4JK1 C;  4BWG B;  1ROD A;  1WD1 A;  4H13 C;  5HGT A;  2NUC A;  4EQN A;  4KD4 A;  5I6W A;  2FJ2 A;  2NBF A;  1ILQ A;  1DOL A;  5M5W B;  3GD7 A;  4N9P A;  3GTL B;  4LK1 C;  1NR4 A;  4BY1 B;  1IYU A;  1IKM A;  1SYF A;  3KLS X;  3CHB D;  1PTO B;  3FPP A;  3ND9 A;  2RSN A;  3D8G A;  4XQN A;  1W6K A;  1GHJ A;  1SNP A;  2RDG A;  3R2I A;  1SJH D;  1AZQ A;  2CW0 D;  2EOT A;  2J7Z A;  1XWE A;  4RGM A;  2RSO A;  3MA2 B;  1DZ1 A;  4XQQ A;  5IGG A;  5CGK A;  3MWY W;  1EY7 A;  1CHQ D;  4K5W A;  1FD7 D;  3BYY B;  4FNF A;  3EQL C;  4QMG A;  1BCP D;  5COY A;  1BOS A;  2C9O A;  3T53 B;  2PW7 A;  1BR9 A;  4OGQ C;  1SNM A;  1GUG A;  4Q0F A;  5I2X A;  2OXP A;  2K5D A;  3PUV A;  5FLX L;  4DXF A;  1II3 A;  1I50 B;  3H0G B;  3A55 A;  2OT2 A;  1B2T A;  1TKW B;  1LAC A;  2QEJ C;  1O7L A;  2JYO A;  1WCM B;  1BUV T;  1SND A;  4HN7 A;  1RD9 D;  1EIG A;  4HSV A;  3CQZ B;  1LT6 D;  2ZXP A;  2KA7 A;  4HTH A;  3FDT A;  1EYC A;  1XX8 A;  3URY A;  3I4M B;  3HOW B;  4DFA A;  2XRQ D;  2X6L A;  4ID6 A;  1TS3 A;  1ZYR C;  4WRD A;  1HXY D;  4ODG A;  2L55 A;  2NZ1 D;  4DK1 A;  3J81 L;  4E6I A;  1WVL A;  4OO1 H;  1WTO A;  5I9P A;  3U9S A;  4RCN A;  1I4G A;  5FO9 B;  1DM0 B;  1HFG A;  4IUV A;  3RMH A;  2B39 A;  1S5B D;  4KK7 A;  5EKK A;  2MJ8 A;  1AEX A;  1Y1W B;  3VR6 A;  3C2P A;  4ZUI A;  2BDN A;  1Y8N B;  3VYR A;  4KHV A;  3H91 A;  3T16 A;  2KQ3 A;  1HA6 A;  3FRP B;  3DMU A;  5NUC A;  2PPB C;  3LNN A;  5K36 H;  1LTI D;  1L0X B;  4ZYS A;  2EPB A;  1B9M A;  3S1M B;  2K5W A;  3BDL A;  1YNN D;  4CGY B;  1FGB D;  3O13 A;  3NXW A;  4KY7 A;  1D6E C;  5M5X B;  4PV1 C;  5C4Z A;  1EIH A;  5COR A;  2B2W C;  3PV0 A;  2LMC B;  2IWH A;  3JAM L;  5I6Y A;  4FP5 D;  4DF7 A;  5LL6 X;  2WIN B;  3HGB A;  1MD2 D;  3KBG A;  1EY8 A;  5IGE A;  3I3C A;  1SE4 A;  1OXV A;  3D6C A;  4CKC A;  2R61 A;  1GUT A;  4WFN 3;  1ENC A;  2PO4 A;  2F0D A;  2ZT9 C;  2MHV A;  3AB9 A;  4M1U B;  1ILP A;  3GV3 A;  2BA0 A;  2PZU A;  3I90 A;  4FO2 A;  4FF4 A;  1AFP A;  1BBX C;  3RLF A;  2OF1 A;  3L9A X;  5LL6 S;  1BCP B;  2SNM A;  2K03 A;  1C48 A;  5D65 A;  2A6H C;  2DY7 A;  4A3M B;  5IIF A;  1R4P B;  1VF7 A;  4TKO B;  5G3L F;  4BA2 I;  1CT1 D;  2A69 D;  1EY4 A;  2Z1C A;  5ELD A;  3EJI A;  4YIJ A;  3R2T A;  1EYD A;  2XNA C;  4H0L C;  3TN2 A;  1VDZ A;  2B2Y C;  3I91 A;  1XTC D;  4RAU C;  4CHT B;  1SNQ A;  3BG3 A;  2CVR A;  2I07 B;  3DXJ C;  2KEE A;  4Q5V A;  3GTQ B;  1LO5 D;  1KDC A;  5CV7 A;  2XRS D;  2Z4H A;  3L3O C;  1ONL A;  4OIJ A;  4IUP A;  3DWQ A;  1SMY D;  1G91 A;  1PZJ D;  4TRD A;  1STB A;  3C1E A;  1KDB A;  4C3J B;  3MHB A;  1CQF A;  1WTX A;  4ZUJ A;  4RGT A;  3K5M A;  2NTT A;  3FEW X;  2CQA A;  1R4Q B;  1SAP A;  1HUM A;  4RA8 A;  2LS0 1;  1EQV A;  1EZ6 A;  1WTP A;  4DNR B;  5IGF A;  1GXD C;  3TME A;  4TSS A;  4BBR B;  3FVQ A;  1F9R A;  2FMM A;  5EJW A;  3LX0 A;  2F0F A;  2X6G A;  3Q22 A;  4ABN A;  1RCV D;  1F2L A;  1Q12 A;  3I72 A;  4HMI A;  3OHX C;  3T51 B;  3J80 E;  2A73 B;  4K2L A;  3GTJ B;  1LTS D;  4L8J A;  1I6V C;  2ID0 A;  4G57 A;  2ENB A;  3NPP A;  4J8Q A;  4KN7 C;  3TP8 A;  1QNK A;  1D1K A;  2B63 B;  1TR5 A;  1TY0 A;  3X3N A;  2JXM B;  2F0L A;  3CRL C;  4C3J G;  4EVO A;  1RHP A;  5KYI A;  5CBA E;  2H4O A;  4A3J B;  1JOO A;  5C4J B;  5FO8 B;  2MGS A;  1QB5 D;  4NKL A;  3SXH A;  3OSO A;  3GO5 A;  3S16 B;  3S1Q B;  1STG A;  3PO2 B;  5A2Q L;  4DAP A;  2D9U A;  4RGN A;  1HUN A;  4BY7 B;  1BCP F;  1UEA B;  2F0P A;  4K14 A;  2F03 A;  5IGC A;  4HSP A;  2RVL A;  1LLR D;  4G4K A;  2B2W A;  3D4W A;  5C44 B;  3SEB A;  1PTO H;  5KGU A;  2XWB B;  2EYL A;  3S14 B;  2KVM A;  1O7Z A;  4C2M B;  5FK9 C;  4A3G B;  5C0X G;  4A3F B;  2K5Q A;  2QDB A;  2Q8I B;  2XSC A;  5DM6 3;  1SFO B;  5C5M A;  3DWA A;  3N52 A;  2VB2 X;  2HCI A;  2RA4 A;  4QCL A;  2ICI A;  1LT5 D;  5JEA H;  1QCB D;  3HOY B;  5ELC A;  4QUF A;  4KMU C;  1GHK A;  4NDX A;  3HOZ B;  5C0X I;  2A5H A;  1ZEQ X;  2AQ3 B;  3J7Y W;  4HMJ A;  3QIA A;  1J8I A;  5JPN C;  3A56 A;  2TMP A;  3SDZ A;  2PMZ B;  5ELB A;  4XYQ A;  1LT4 D;  4U68 A;  4KKT A;  1KDA A;  1CQV A;  1GUS A;  3NK9 A;  4LJZ C;  1KTK A;  2R93 B;  4IUQ A;  1A3T A;  3DWP A;  1SYE A;  1TY2 A;  4XT1 B;  4C3I B;  2RQX A;  2WAC A;  1NUC A;  1RTN A;  3MFY A;  1Y1V B;  2Q8T A;  1GOZ A;  4KY5 A;  1O78 A;  1EYA A;  1FNV A;  1QWY A;  3VR2 A;  2N88 A;  4ZKB B;  5I4D A;  3MZ5 A;  5JOB A;  1U4R A;  1CFM A;  1AP0 A;  3S2D B;  4N9T A;  2BE5 C;  3FMC A;  1CZG A;  1EU4 A;  3NQT A;  2IX0 A;  1NAP A;  2SDF A;  1HPC A;  4IQZ A;  3F2U A;  2F0H A;  1PRT C;  1KNE A;  1PZK D;  4X3U A;  4EQP A;  2GA4 B;  3S15 B;  5CBE E;  2B2U C;  3DEP A;  2E75 C;  2IW3 A;  5BN5 A;  3HG9 A;  1HRJ A;  1ESR A;  3DUZ A;  3D3R A;  1T5E A;  3Q23 A;  4PMB A;  1DJR D;  2JA5 B;  4XDX A;  4JBW A;  3V2T A;  4C1N I;  1QIL A;  1S5E D;  4NMZ A;  5IOD A;  4FYD A;  1WTV A;  3D31 A;  4CJ0 B;  4C3I G;  1I3Q B;  3PUZ A;  3V96 A;  1Q3L A;  2KOL A;  1NSN S;  4ZLT F;  1Z6H A;  4G7H C;  3Q0A A;  3A54 A;  4M8A A;  1PMR A;  1XYI A;  1FR3 A;  1EY6 A;  4ZAI A;  2VUM B;  3D6W A;  2IL8 A;  2IT1 A;  1D5M C;  4J6H A;  1O80 A;  5CC4 A;  1WTW A;  3T56 B;  1WTR A;  4FXD A;  4C3H G;  1CZW A;  4OIK A;  5CV8 A;  3C3L A;  3OWE B;  1Q1E A;  2FMC A;  1K83 B;  1I4P A;  1Z7T A;  4F87 A;  5M3M B;  1FNU A;  4DAY A;  1ENA A;  4UDU C;  4G7O C;  2PW5 A;  4IUU A;  3NTH A;  1IHZ A;  3P75 A;  2O5J C;  3WOF A;  4DAV A;  3OIQ A;  5ELE A;  2K05 A;  1FNW A;  2ZXR A;  4IUN A;  3VA5 A;  2DNC A;  3QJY A;  1I4X A;  2DY8 A;  2EXZ A;  4XTC S;  1JOK A;  1TII D;  2JE6 I;  4I65 A;  2L4N A;  1AZP A;  3OIP A;  3S2H B;  5E3F A;  1HCZ A;  3A7A B;  1X3Q A;  2F0Q A;  1M8A A;  3MTS A;  3PUX A;  1GUW A;  1F77 A;  4ME5 A;  1F2Y A;  5I9O A;  4R9W A;  2R92 B;  1EWC A;  3RZO B;  1ET9 A;  5IGD A;  2CHB D;  1TU2 B;  1E0B A;  2R6G A;  3HOX B;  4A93 B;  1ZYR D;  3G6J B;  1VMC A;  3MXP A;  1LTR D;  3A8I E;  3A7L A;  5DEH A;  4DNT B;  2B8F A;  3SK8 A;  1H9J A;  5EKL A;  1JCK B;  2FHT A;  1Z47 A;  2WKD A;  3VR5 A;  1EQT A;  4QIW B;  2Z4I A;  2BOS A;  1K8M A;  3Q24 A;  4KJO A;  4B9X A;  4L63 B;  1JOQ A;  3OW7 A;  5D14 A;  3BDC A;  3MVV A;  4CJ2 C;  1MSG A;  5C0X H;  3KK7 A;  1SE2 A;  1IW7 C;  1EEF D;  1FYC A;  3I8Z A;  1LTG D;  1PRT B;  5KEE A;  4FXG C;  5FOB B;  3NTK A;  4X3S A;  1ZKO A;  1YNJ C;  4KD3 A;  1OXU A;  1PTO F;  3OMG A;  4DGZ A;  1F9Q A;  4IFD H;  1I4R A;  1LAB A;  1A2U A;  2FFK B;  3ERO A;  3H94 A;  4PMC A;  1STY A;  5KNB A;  2NN6 G;  4HED A;  5DM7 3;  2WV6 D;  3BZD B;  5F2D A;  3VA7 A;  4KV6 A;  4O1N A;  2TSS A;  3OMC A;  5KIX A;  2XN9 C;  1TS4 A;  5JEA J;  4DN4 M;  2QKI C;  4LAA A;  2M9V A;  2L12 A;  1GJX A;  4K5X A;  2EY1 A;  2C5C A;  5EQ0 A;  3AU7 A;  5C3W A;  4S3S A;  2NN6 I;  3R8B A;  2MPM A;  3GTO B;  1RKN A;  1D1I A;  2PZW A;  2F0K A;  1DCZ A;  2A6H D;  1EOT A;  3A8J E;  1LTT D;  1SBB B;  2O5I C;  5C3E B;  2NWG A;  2F0V A;  1QJO A;  2A68 C;  2EZV A;  2D2C C;  5JPM C;  3QB3 A;  2FIN B;  2NTS A;  3S17 B;  3N6R A;  1WD0 A;  1SYB A;  1EU3 A;  1STE A;  1MBY A;  4FF3 A;  2E76 C;  1IYV A;  1F9S A;  1R9T B;  2E2H B;  3M4O B;  2O2L D;  3X3M A;  5C6A A;  4MHE A;  5CV4 A;  1DXM A;  3M4Y A;  3TZU A;  4NP5 A;  3IFT A;  3FPU B;  1HQM C;  5D3D A;  1TWF B;  5EBD A;  5IT9 L;  3SHL A;  3H09 A;  2K1B A;  3J80 L;  4A3D B;  2D62 A;  3I4L A;  5JJZ A;  2EJM A;  3R3O A;  5T1G A;  3FKI B;  3PUW A;  5IT9 E;  2PZT A;  3LWU A;  3PIO 3;  1SXT A;  2WII B;  1EWH A;  1OXT A;  3HS0 C;  3VYU A;  3SK6 A;  5C4H A;  2JEA I;  3NWS A;  1NCV A;  4C56 C;  4QF4 A;  3K7A B;  3NBI A;  4OL7 A;  5EPL A;  1QG7 A;  3W3A A;  4P2C B;  1SDF A;  4KI0 A;  1BNZ A;  1SSO A;  1RF2 D;  4RCO A;  3BS1 A;  2WB1 B;  1B1Z A;  1JWU D;  3TP5 A;  1JB3 A;  5T1I A;  2RDF A;  1EZ8 A;  1TWC B;  1Q90 A;  3RZD B;  4WJW A;  2F4I A;  2L5T A;  1E2Z A;  3I4N B;  3BVG A;  2Z8L A;  4H7B A;  3TP7 A;  3PUY A;  4RGO S;  1Y8O B;  2MP1 A;  2EYM A;  1PTO C;  4BA1 I;  1K8O A;  5EBC A;  1JQY D;  1SJE D;  3GTG B;  3BYT B;  1TVX A;  1LTB D;  3GTM B;  1OO9 B;  3HOV B;  1STH A;  5KND A;  5K36 G;  3BVZ A;  1TS2 A;  3S1N B;  1SYD A;  5HUR A;  3SVM A;  2WP8 J;  3NBH A;  4KY6 A;  3WDN A;  1RJT A;  1F9P A;  5AFW A;  4ZQ3 A;  1H9S A;  5A35 A;  1TWA B;  5C3X A;  3BDO A;  3M7G A;  4A3K B;  2PYK A;  4TQU S;  2EYF A;  2AUJ D;  4ZKC B;  2IJ0 A;  2QCP X;  3PO3 B;  3MXG A;  4FVM A;  3K5N A;  4IZ8 A;  2VXW A;  3A8K E;  1MGS A;  4K8I A;  1UAP A;  3NE5 B;  3T4A C;  3NTI A;  1BQQ T;  2L9H A;  2L11 A;  2EJF C;  2YU9 B;  1I4H A;  3GTP B;  2A74 C;  3KUP A;  1RDP D;  4H44 C;  1W6J A;  4F88 A;  1B50 A;  2DNE A;  2B2Y A;  3Q6S A;  2NVT B;  1V8Q A;  1BXT A;  1JE4 A;  3MXN A;  2F0W A;  3TBI B;  1KLG D;  1U9R A;  1IL8 A;  2QF7 A;  2H1E A;  2SOB A;  5I2Y A;  2N55 A;  3NQI A;  1LT3 D;  2JP1 A;  3HP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...