5C3XA

Crystal structure of staphylococcal nuclease variant delta+phs i72d/n100e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKDEVEFDKGQRTDKYGRGLAYIYADGKMVEEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I72D/N100E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c3xA00
1JOQA 1F2YA 3TP8A 2EYHA 5C5LA 3OMCA 3TP6A 5C5MA 5J39A 4N9PA 1F2MA 1AEXA 2EY5A 1F2ZA 3OSOA 5KGUA 2EY6A 4KY7A 3SK4A 1A3UA 3MZ5A 1STYA 3D4WA 4K5XA 1EY4A 3SXHA 4G57A 5I9OA 1SNDA 3V2TA 5IGBA 1NSNS 1TR5A 1EY8A 1ENCA 2LKVA 2F0JA 2EYFA 4PMCA 2SNMA 2F0WA 2QDBA 5NUCA 4IUNA 5CV7A 1JOKA 1STNA 4ME5A 2F0QA 4HTHA 3QOJA 1KDBA 4J6HA 4KJNA 4NKLA 4B9WA 3U9OA 2PQEA 4K14A 4DFAA 4EVOA 2F0MA 5EGTA 1EYDA 5HGTA 5C4HA 5C3XA 3SR1A 1SNPA 5IOCA 3BDLA 4IALA 1EY6A 2PZWA 2RDFA 3EVQA 1KDAA 4KV6A 2PYKA 3EROA 3C1FA 3PMFA 4R8NA 5DAUA 4ZQ3A 4F8MA 2F3WA 1SYBA 1EYAA 3T16A 4F7XA 5C6AA 4QF4A 2F0KA 3LX0A 1EY0A 3OWFA 5CV6A 4DGZA 5C3WA 3MVVA 2EYPA 2F0IA 2KHSA 1JORA 3T13A 5IGDA 4NMZA 5E3FA 1SNCA 2F0TA 5CV9A 3SK8A 1SNOA 5I6WA 1TT2A 3NUCA 5K5PA 2RBMA 5DEHA 5I6YA 3ERQA 1STGA 3DHQA 3HEJA 2O4XA 3P1HA 4K6DA 2EY2A 4KY5A 5F2DA 2EYMA 1A3VA 2F0LA 5JAVA 1U9RA 1A3TA 1JOOA 4IZ8A 5CV4A 5EKLA 1KDCA 3MHBA 3NQTA 3QB3A 2KQ3A 2PW7A 2EYOA 3OMGA 2F0OA 5CR3A 2F0HA 3SK5A 3EJIA 4KHVA 4PMBA 1RKNA 2F0SA 3E5SA 4QMGA 1STHA 1EQVA 4N9TA 4ODGA 3ITPA 2F0GA 3SHLA 5KIXA 1KAAA 2EY1A 4K8IA 2F0VA 4RKBA 3NHHA 5KRUA 2F0DA 2SNSA 4B9XA 1EY5A 4YIJA 3D4DA 5KYIA 4K5VA 4NP5A 1SNMA 1SNQA 1TQOA 2EYLA 2PW5A 4K5WA 1A2TA 4I65A 4DF7A 1EY9A 2F0PA 2PZTA 5IGGA 4OL7A 5J1ZA 3H6MA 3BDCA 4KY6A 3HZXA 2OXPA 3NP8A 5IGFA 4KJOA 1EZ8A 4NDXA 2F3VA 4PNYA 5JOBA 5CC4A 3VA5A 1EYCA 1STBA 4ID6A 3MEHA 5C4ZA 2ENBA 1ENAA 3D6CA 4EQPA 4LAAA 1EZ6A 4ZUIA 3RUZA 5IGCA 1NUCA 2RKSA 5CV5A 4EQNA 2PZUA 5ISRA 3NK9A 4H7BA 4J1MA 1IHZA 2OF1A 1EY7A 5IGEA 3R3OA 4QB4A 1KABA 5KYLA 1STAA 1SYEA 4WORA 3TP7A 4K8JA 2F0EA 4TRDA 5HURA 1II3A 4ZUJA 3SK6A 2SOBA 1SYFA 3D8GA 4HMIA 4MIUA 2WACA 3C1EA 4E6IA 4KD4A 2HQEA 4RKLA 3DMUA 3TMEA 4K2LA 4K2KA 5I9PA 5IIFA 4S3SA 3NXWA 5EKKA 1SYCA 1SYGA 2F0FA 4DU9A 1A2UA 5M9OA 3P75A 5IODA 4EQOA 3TP5A 2EXZA 2EYJA 2OEOA 3S9WA 4KTAA 3QOLA 4WRDA 5CV8A 3MXPA 5E1FA 4KD3A 5CGKA 2NUCA 5KEEA 2M00A 5J22A 2F0NA 4HMJA 2F0UA 1SYDA
chains in the Genus database with same CATH superfamily
4CJ0B 5LMNQ 1XMOQ 1AN8A 3IRBA 3U4VA 4FXGC 2A69C 4KY7A 4X66Q 4CHTB 4K5XA 4FVMA 1XTDA 2XWBB 1A62A 1JWMD 3UE0A 5LL6X 3TS0A 3T1HL 2VQFL 2X6GA 3FPUB 3S1MB 5KGUA 4KK7A 1O7ZA 3J7AV 3F2BA 1UEBA 5DNFA 4DR2Q 5IOCA 1VQOA 1LV9A 4IALA 1BR9A 1BVSA 3C1FA 3LX0A 4DR4Q 4UAIA 3KOJA 1M8AA 1EWCA 3D31A 3UE1A 1B2TA 5GAGC 2LXJA 1PH7A 1X65A 5CV9A 1CQFA 2QCPX 2RBMA 3DUZA 3QIAA 5I6YA 4LWCA 3I3CA 2ZM6Q 1XTCD 2YV5A 1A3VA 1PRTB 2F4VQ 2F03A 3MHBA 2NVQH 2KQ3A 4AQYQ 1K9MC 4LF8Q 3F1ZA 4ZRZA 1NR2A 3O13A 2UUAQ 3H3VH 3DXJC 2M9VA 1PLFA 5FLMH 5A2QL 2G9DA 4BBRG 1YZ6A 1HFGA 5IWAQ 3E0EA 1GUNA 4IOAA 5CBAE 4B3SL 2QW7A 1RJTA 4BBRB 2PZTA 1VF7A 3E6ZX 5J1ZA 1NJIC 3QO2A 1ZKOA 4C3HH 1CSQA 3RR5A 2MFIA 1HHVA 1TY2A 4LMQD 4YWMA 5IGCA 4XYQA 2J7ZA 1RL2A 3M85A 1IHZA 1JWUD 2H1EA 3CRKC 4LJZC 4G7OC 1B53A 1FJGQ 3TP7A 1BQQT 2E2IB 3WDNA 5IIFA 2VL6A 2EDGA 1DOMA 3SGIA 4X65Q 4IPDA 1WD1A 3CC7A 2EXZA 3CCJA 2UXDL 3HOUG 4KTAA 4O2DA 4R4OA 1PYBA 2WKDA 4L5TA 1SYDA 1SN8A 1XPUA 4JI6Q 3HOUB 3OHXC 1F2MA 3S1RB 5M5YB 2EY6A 3KF8B 5JPNC 2UUCQ 2ASBA 4A3GH 1A0IA 4J15A 1C9OA 3UDGA 3ZYYX 1ENFA 3CKIB 5LMUQ 1NSNS 1V8QA 1EY8A 2VW9A 4P75A 2UU9Q 2SNMA 3A56A 4BA1I 5IYCG 4IUVA 1V9PA 1KNAA 2K14A 4GN3B 4QY7A 3CD6A 4DV2Q 1RCVD 3CAMA 1Y69U 2RDFA 4C3IG 2ZT9C 1IBKL 4F8MA 3PMFA 5DAUA 1EYGA 3WOEA 3HOVG 1JE4A 2EQSA 3VR3A 3C3LA 5D3DA 4C3IB 2I5MX 3T13A 2E5LQ 3HOVB 2A1AA 5DEHA 3KF8A 1B3AA 1WCMG 5D14A 4YY3L 5IYBG 3A7AB 4O1NA 2QDLA 3HGBA 3NQTA 4DNIA 1WCMB 1R4QB 4JI1Q 4A3LH 3OMGA 2A6EC 2F0OA 1UNSA 3I4MG 1SROA 2B8GA 4FYDA 4FO2A 2A69D 2B63G 4K8IA 1S5CD 3NHHA 4XQQA 4K5VA 1BBWA 1SNQA 3I4MB 1A2TA 5M3FH 2B63B 1M90C 1Q1BA 1VQIA 1A15A 1EZ8A 3UI2A 4GNXB 1RTOA 2K04A 3S14B 3D6CA 1S5BD 1VQGA 1X3PA 1F9PA 2MHVA 3NK9A 5M5WB 1KAWA 2ZTDA 1Q8IA 1SJHD 4DUYQ 2XN9C 3Q0AA 2JA7H 4RKLA 1SFOH 1PVOA 1MGSA 3D4RA 2PMZE 4DR3Q 1EL0A 4A75A 4O42A 1WTPA 1BNZA 1Q3LA 5C3EH 4BY7H 1NMFA 1LUZA 4KD3A 5CGKA 1LABA 2IX3A 4L5QA 1JOQA 3S1NB 1SMYC 5C5LA 3SDZA 1PZID 4F87A 1IBMQ 3RNUA 3SE0A 1CKNB 3OSOA 4J8QA 3J7YW 2WB1G 2HD3A 1Q82C 2BH8A 1STYA 4LK1C 4IUQA 1V43A 2WB1B 5EBDA 2PQAB 1MBYA 4RGMA 4LF4L 4BBSH 4A3CH 3NELA 3S16H 2PQEA 2DNCA 3CRLC 1W3SA 2NN6H 3E0JA 4JCVE 1ASZA 4XT3B 1EQTA 2N49A 2O5JC 1KDAA 2PYKA 3PUZA 3CQZB 1KNEA 5C0XI 1D6EC 3KLSX 3GP7A 3GTGB 3KUPA 3VYUA 2L12A 3BZCA 3LWEA 3G6EA 3D6WA 1CKNA 3IFDA 4QIWB 1PV4A 2ICIA 1BCPF 4K6DA 3D3RA 2E2HH 4XT1B 3ICEA 3S2DH 3I8ZA 2CKZB 1X55A 4JI0L 1SSOA 2NYZD 1PH8A 4JI2Q 1WTXA 2AMCB 2E2DC 3HKZE 4PZ7A 1TWFH 2PQAA 1VQ9A 4PG3A 1N32L 3AQQA 4QMGA 1JICA 4C3JH 2C5CA 3G4SA 2KBNA 1EY5A 1KTKA 3H91A 4X3SA 1YI2A 2DY7A 4A4IA 3ULPA 3L9AX 3GTPB 3CMAA 2R7ZG 4JI7Q 4GKKL 1ENAA 3T4AC 3E3XA 1MKHA 4XQNA 2R7ZB 2D0OA 1ET9A 4OWTB 1AFPA 2V1CC 4MTNA 4BXXH 1STEA 1OXUA 3SK6A 5E4WC 2YU9B 3OPOA 1XNQQ 1VQLA 2R93H 4DAYB 1K83B 4XYOA 5EKKA 2SEBD 3DM1A 4TKOB 2P5ZX 1HUMA 3S1QH 4A3BG 2JXMB 4A3KH 5EJWA 5E1FA 2QEXA 1AZPA 3OWEB 4CKBA 2RHSB 1K8OA 4X6AH 4LUOA 4P74A 1L0XB 4A3BB 4HN7A 1EU3A 2A6ED 1LTAD 1RTNA 4N9PA 1GUSA 4JI5L 5FLXc 1JB3A 2JA6H 1IBLQ 3ULLA 1D5ZC 1KLUD 1XJVA 4DR5Q 5I2XA 1KXLA 1I94Q 3K6OA 2VUMH 2A68C 1EIYB 1XMQL 4I7ZC 1HNZQ 3GTMB 1TS5A 4KJNA 4DAYA 4DFAA 3CP0A 4P71A 1KLGD 1PDQA 1EYDA 1U4PA 1WTVA 3W2DA 1J8IA 2XVSA 1IW7C 3HP3A 4KV6A 4CJ1B 4ZQ3A 5C0XJ 1KD1C 1G291 1EYAA 4OIJA 3VR6A 1S3OA 1D1IA 1EY0A 3KBXA 3HOYH 5BN3A 1K0RA 4DUZL 1PH5A 4X64L 1BBXC 4DNTB 2F0TA 1Y1WG 2YTVA 3UDIA 1MJEA 4MNOA 4P72A 4A3IG 4KHPQ 2NVTB 2UXBL 2BE5C 4HEDA 1JWSD 1Y1WB 3CCLA 1LTGD 1I4QA 5E7NA 4A3IB 1X3GA 5JEAJ 1SMYD 4OGQC 3TZUA 4A3EG 1BXTA 1HR0Q 4OO1I 4IUUA 1ZEQX 5EPKA 1M4VA 2K05A 4N9TA 5AJ3L 4RA8A 3TQYA 4A3EB 4A93G 1XPRA 4RH6A 2Z4IA 5GADC 4DPGA 4BWGB 1O7YA 1G8ZD 1I4XA 1ET6A 1VF5C 2LS01 1GJXA 4A93B 2CCZA 2Q2HA 1IZ6A 1TWGB 3NP8A 4DV1L 2HUGA 3VA7A 2IX1A 4GLXA 1VQ5A 4ID6A 1SE8A 2KCNA 5IP9H 1UWVA 3BU2A 1HNWL 5IGEA 4QB4A 2NZ1D 5KYLA 4MIUA 1LT6D 2L1BA 1PH1A 2HQEA 2K32A 4EX5A 4DV7Q 1DCZA 3NEMA 4B3TQ 4GN4B 1H95A 1A2UA 2RVLA 5M9OA 3P75A 1WJJA 1PZKD 3H0GG 1H9RA 1OXVA 2HHHL 3GTQB 1B8AA 1ESRA 3H0GB 2E2IH 5C5MA 5J39A 5G3LD 2EY5A 1IYVA 1N36Q 2KUMA 2BOSA 3ZJYC 1VQCA 1EY4A 4G4KA 2WAQG 1V1QA 1HJPA 4LFAQ 3HOUH 1AP0A 1MD2D 2WAQB 3HKSA 4J6HA 5M5YH 4IPGA 4LF5L 5C0XG 2IWHA 1I3QH 5C3XA 3A54A 3G71A 1GVPA 1HPCA 4F7XA 3NPPA 2N88A 2R7FA 4GN5A 3IKJA 1ZYRD 4GS3A 3OWFA 2WINB 3BVMA 1EQRA 1TWAB 2PI2E 1GHKA 5COYA 1FL0A 1HCZA 1CK1A 1SMXA 4L5RC 2JJQA 2D9UA 2EPBA 5IYCH 1F77A 2AQ2B 2OQ0A 1EOTA 5JEAG 1DJRD 2NTSA 5CBEE 4IZ8A 4HSPA 3Q22A 4IJLA 2UXCL 4IQZA 2EYOA 2EXDA 2Y0SE 1K73C 1GKHA 3M7GA 4KHVA 4AIMA 4JV5L 1RKNA 1PH4A 3K5OA 4JVZA 3CXCA 2F3IA 3HOZG 1PRTF 1QZGA 5KRUA 4LF7L 1CFMA 3GV3A 4DV6L 2LSSA 3HOZB 2HCCA 3H6MA 4KY6A 2E75C 2K52A 4DK3C 2BDOA 3AYHB 4OHJA 4DR7Q 4X62Q 4HJ9A 4K6LA 1WD0A 1IW7D 3FHWA 1WTHA 3KBGA 2ATWA 4HCSA 2B63H 3H3VC 4JOIC 3GTOB 5C4JB 1BO0A 1VQBA 1ASYA 1TWCB 4IFDG 1DONA 2KENA 3K80C 2G5DA 3J81j 4JG2A 2EYJA 2BE5D 1GXDC 4HIKA 1Y1VH 3VR4A 5IT9E 3S2HB 2TSSA 1EEID 3K0XA 2ZJRA 1SNDA 2GN5A 3VDYA 3MWYW 3EA6A 2WKCA 3IAYA 2JA5G 1X9NA 2BH2A 1PFBA 3J7AF 1HQMC 2JA5B 1YNXA 4G57A 2NWGA 4GLAC 5IWAL 1F9SA 3V05A 3NWSA 1Q1EA 3S1NH 3HOWG 5IYDH 2GVBA 1PTOD 1SLJA 4CKEA 1X3FA 3HOWB 3ERSX 5C4XG 5HGTA 4I7AA 4GKJL 1MJCA 3U58A 4Q5VA 3SEBA 5C4XB 5CORA 1PYWD 4JBWA 2K03A 2N78A 4LF6Q 1A8VA 4OO1G 3PQIA 2IX0A 4OX9L 1BOSA 2CQAA 4DR1L 2BA1A 1WFQA 4UP8A 1U4RA 3GTGH 2IL8A 1S5DD 1XWEA 1EQVA 3VYRA 2PNHA 1V1PA 4IN3A 2NZOA 3I91A 5HGQA 4AYBE 3M3YH 4C2MB 3FKIG 4DV4Q 1ESFA 1MSHA 3F8TA 3OTOQ 1K8AC 3BDCA 1X3EA 3R2IA 1I50B 1YEZA 5TSSA 2F3VA 1AH9A 3FKIB 1BCPC 4DV3Q 4EQPA 4ABNA 4LFBQ 1NUCA 5CV5A 1D7QA 5DLQE 1TWHB 1UAPA 3PCOB 4FP5D 4R9WA 4ULLA 3D8GA 1SYFA 3CF5A 4HMIA 2RA4A 4KKUA 3GTPH 2HT1A 2XWJB 4RGOS 2XRQD 1LTTD 3PIO3 3TS2A 2R7ZH 3KJOA 3ULJA 3QOLA 1Y14B 2F0UA 2YU9H 4ALPA 2VXWA 2KCCA 1XYIA 2QKIC 1RDPD 4X3KA 1G2SA 3KLSA 5JJIA 3FMCA 3SXHA 3Q23A 5BN4A 4BY1G 3R93A 2VY3A 4IOCA 4FXDA 1HA5A 4YHHQ 2QILA 4A3BH 3H3VI 4CDDC 1LO5D 4CDFC 4BY1B 3QOJA 4RG1A 3AB9A 4ME3A 2FFKB 4NXNL 2NTTA 3CCMA 4WJ4A 4K0KQ 3BDLA 1LT3D 1JMCA 2K33A 1V1OA 3NTHA 4M8AA 1LTRD 2I0QA 2CFMA 4DUYL 1R9TB 1Z6HA 3X3MA 3K7AH 2KHJA 2YYZA 5ELEA 3T1HQ 3J80c 2VQFQ 5CMDA 3P1HA 2HDMA 1W6KA 4KKSA 2D0PA 1QG7A 3RZOH 4DNRB 1D1KA 4DV0L 4A3MG 1IKMA 1CTMA 4GOPA 3I4LA 3L2PA 3RD4A 2WP8J 3NENA 5JVH3 4A3MB 1FVIA 1STHA 1PFSA 4ZAIA 3ER0A 1RF2D 1SE4A 1X6OA 1Y1WH 3R8BA 4A3IH 4RGTA 1EQQA 2PPBC 1JJGA 2E8GA 1B1ZA 1U0LA 5EBCA 4NDXA 2MP1A 3FVQA 5AFWA 3K59A 5IP7G 4U673 2HCIA 2Z0SA 3ND8A 3K5MA 2OF1A 2FHTA 5DM63 1VQ6A 2EJGC 1HXYD 1SYEA 1TXYA 1QWYA 1WOCA 2IW3A 5HURA 4OWXB 4E6IA 2R61A 1YBYA 3HS0C 4B3SQ 4A93H 1J5EL 3MXNB 1TWGH 2B2UC 5EAYA 2L5TA 1F9RA 3CHBD 3P7JA 4RMFA 3F2DA 4B3RL 1F9QA 3I2ZA 2GVAA 5GQOA 4A3FG 3EQLC 2B39A 4RAUC 2NUCA 2EZVA 2TMPA 3FPPA 1PTOB 1Q8KA 3TP8A 4JI2L 4A3FB 2ZJQA 1Y8OB 3A8IE 3TP6A 2CWPA 3T1YL 2KA7A 1R4PB 3BS1A 1EU4A 4P2CB 1XNRL 4JI8L 2VB2X 3ND9A 4MZ9A 3QJYA 5FJ8H 5FO8B 2UXDQ 4FF4A 2QDBA 5CV7A 1DZ1A 3H0GH 1JCKB 1VS0A 3MXNA 5GAHC 4R4TA 2AHOB 1BCPD 3U9OA 4DR6L 4POFA 3Q8DA 1L1OC 1AE3A 5EGTA 3NWTA 4LW1A 2RDHA 2K5VA 3TSSA 2A6HC 3K5NA 2F3WA 1XPOA 4QF4A 2F0KA 5LHY1 4L6TB 2JA9A 3PSIA 2KHSA 2JYOA 5IGDA 2NBFA 4IUTA 1YJWA 1LTLA 1RHPA 1G2TA 2RCFA 1E1TA 1P8LA 2MUYA 1I4HA 2EYMA 2GA4B 4OXPA 3J81i 2O5IC 1U9RA 1JOOA 1YJNA 2PI2A 1E0BA 1IBKQ 2RQXA 2NVXH 1LYLA 5M5XH 3EJIA 3PIP3 3JAMc 3SHLA 1VQHA 2OCEA 1HNXL 4JBMA 3D4DA 1U5KA 2EYLA 3GTJB 4I65A 1CT1D 1QUQB 4YY3Q 2DJGC 4B3ML 3HZXA 4OWWB 4IURA 5M3MG 4LNQA 1WI5A 1Y8PB 3URYA 5IT9L 2CH4W 2WIIB 2OT2A 4XDXA 3EN2A 4BA2I 3KLRA 5M3MB 3KK7A 3M4QA 2JP1A 2CVRA 3I56A 3AEVA 4MHEA 2J4XA 5FK9C 4X3UA 1TS4A 2LFNA 2NN6I 1I6VC 2B3GA 3UDXA 1SYGA 3S15H 4DAMA 4HSVA 4IJHA 5IODA 3TP5A 1YNJC 3AMUA 3KYHC 3J7A5 4NXML 2K5NA 3RN5A 3W1BA 3C2PA 1N33L 2E2JH 3GTOH 5C4JH 1QUQA 3T56B 3WOFA 1K0SA 1T5XD 2A74C 2DGYA 4ILWA 1I6HB 4C1NI 4JC0A 3A7LA 3K81C 3V96A 1HR0L 5FLMG 2RCNA 4IFDH 4GOPC 4RWSC 1OXTA 2VQEL 1H9MA 4L5SA 4YWLA 4KKTA 1C4QA 2EYFA 3BVGA 1QVCA 1GD7A 1SE2A 2B2YC 1JOKA 4ZKBB 4V0BA 4C3HG 4ZLTF 3FP9A 3CC4A 5EQ0A 1K8MA 1E3PA 3Q6SA 1LTBD 2JA5H 2BA0A 3SR1A 2X69A 1F2LA 1S4ZA 4C3HB 2Q8RE 4AH6A 2F4IA 2A5HA 4LF9L 1PFMA 5D3IB 1EIHA 5C3WA 4FF3A 2CWAA 2EYPA 4PZ8A 4UHVA 1ILPA 4DV7L 4KLKA 4LF4Q 3NUCA 5C44H 1IYUA 1IKLA 2EY2A 3AU7A 3ONAB 2UUBL 1LM0A 5KNBA 2L11A 3RZDB 2K5HA 1KQSA 4JOIA 3KJPA 1CKOA 1TS3A 2KEDA 4HJAA 5D65A 1DOKA 1SAPA 1VDZA 5FKAC 4JI3L 3M4OB 4PMBA 4PMWA 1CZWA 1K8GA 4GLVB 3GTKB 2ES2A 4A3GG 2L0CA 4HJ7A 2WV6D 4Y7NB 4QGUA 1CUKA 1H9JA 3S1MH 4TVAB 5FLXE 3CU7A 3S17B 4A3GB 4LFAL 4FNFA 4DV5L 5BR8Q 3TDQA 2IHFA 4JI0Q 4CGYB 3J81c 4PNYA 3NSWA 1EYCA 3W5OA 4ZCKA 1G51A 1JT8A 1HZ9A 2BCOA 2Q2UA 1EZ6A 1HR0W 3RUZA 3I7FA 3MAQA 4KHZA 4J1MA 1LTID 1N32Q 4A3JG 1CSPA 2IT1A 2NVYB 4C2MH 4OEMB 1S72A 1II3A 1KRSA 4DU9A 3SVMA 4DKAC 1NMGA 1FGBD 2Z8LA 4A3JB 1IYJB 4FF2A 1S40A 5ELOA 3MFYA 3CCSA 2OEOA 4GKKQ 1CI3M 2JEBI 3CCEA 1FNWA 4A3LG 4OONA 5IY0A 3J81E 1CA5A 1BCPB 2AWNA 3VYTA 1ILQA 4KMUC 4BBRH 3L3OC 4LFCL 3K8AA 3RLNA 3D4WA 3BJUA 1SXTA 1PFNA 5IGBA 3RLFA 2Q8IB 4RHSA 5M3FG 2K5QA 1Q81C 1HTPA 2F0WA 1T5EA 3BYTB 2N8NA 4IUNA 2R7DA 2EE1A 4HTHA 5E4XA 2AQ3B 4H02A 5M3FB 3EFXD 5ELFA 1VMCA 5FOBB 5C4HA 4QJFA 4JI5Q 4FXKC 3A8JE 1B70B 4JYAQ 4POGA 1NCVA 5JVG3 2MO0A 3K7UC 5DM73 4R8NA 4C56C 1HQRD 2FMCA 3A5UA 1EWHA 4R4CA 2F0IA 2FJ2A 1AZQA 1SNCA 1Q7YC 3K57A 1SNOA 1YHAA 1CHQD 1XMQQ 1GUTA 1NR4A 1QJOA 1SFOB 1YNJD 4KY5A 4LUVA 5C3EG 1HZCA 1C7YA 2KCTA 5I2YA 3NBHB 3S1RH 2PW7A 4XTCS 5C3EB 3U50C 1QVFA 1N34L 2F0HA 1TY0A 4G7ZC 1NNXA 3G7LA 4DUZQ 4X64Q 4DN4M 2VZAA 1CQVA 1MI2A 4L63B 1SNMA 2MPMA 2JA8G 2UXBQ 1K28A 4V190 2HQLA 3BYYB 2OXPA 1X54A 5IGFA 2CW0C 2JA8B 3VA5A 1STBA 3PGZA 4A3MH 4A3CG 3N52A 2ENBA 1FYCA 4HIDA 4N8FA 1JJ2A 3MXGA 1GUWA 2JN4A 4RGNA 2NN6G 1AW7A 2DJFC 3T53B 1VQ8A 4C3IH 4A76A 1LT4D 3R3OA 5AJ3Q 3OOCA 5LMNL 1XMOL 4R4IA 5JPMC 3HOVH 5ELCA 3NBHA 1X56A 3MTSA 3TMEA 1Z7TA 4X66L 3RLOA 2PMZB 4DV1Q 3EIVA 2MO1A 1WCMH 1Z9FA 2VS1A 3PO2G 2Q8TA 2A68D 5IYBH 1VQKA 1QZHA 1FNVA 2F52A 2F0NA 1HNWQ 3PO2B 4IPCA 5G3LF 4U68A 2E2HB 3OMCA 1YHQA 3S2DB 4JI4Q 4DR2L 1JB7A 4HJ8A 3I4MH 4XQJA 1D5MC 1D2BA 4C3JG 1A3UA 5GAEC 2B2TC 3GDEA 2WB1E 4DR4L 4QCLA 2LKVA 4PMCA 2F0JA 3TEHB 4C3JB 3S14H 1PTOH 1Z47A 4A3FH 4QL5A 2HHHQ 1PYSB 3TRZA 1DM0B 5M5WH 2BDNA 4NKLA 2ZM6L 1IXRA 3VYSA 3I4NG 2K01A 3B6YA 1L0WA 2F0MA 2ZXPA 3CPFA 1GM5A 2F4VL 4AQYL 1SE3A 2EOTA 4LF8L 3I4NB 3GV6A 1H9SA 1JJCB 1SYBA 3TZDA 5C6AA 2XNAC 2UUAL 1WTQA 3HG9A 3PIOA 2R93G 3LWUA 4JBJA 5KIXA 1FNUA 2H5XA 3MXUA 1TT2A 4QIWE 3I90A 1CA6A 3FRPB 3ERQA 3M4PA 3J80i 3DHQA 3S24A 1PH6A 5ELNA 2R93B 3OIQA 1I4GA 1WYDA 2FMMA 4LF5Q 3HKZG 5EKLA 4Y52H 5LMNW 2B2WC 1BUVT 1VQNA 2MNAA 3S1QB 4A3KB 1V1PB 2B2UA 3HKZB 1L1OB 2JE6I 1NY4A 2L9HA 3I73A 1FJGL 2F0VA 1Y8NB 2RSNA 4FF1A 5KYIA 1TQOA 4Q0FA 5KNDA 5KNCA 4OL7A 2VUMG 3G48A 1GHJA 3DWPA 4RFBA 2UXCQ 4X65L 1IL8A 3LNNA 3NTKA 4KI0A 5ELBA 2MQHA 1JE5A 4LAAA 3GO5A 2VUMB 3CQZH 1G6PA 4JV5Q 3TBIB 4K0KL 4JI6L 3GTJH 4WORA 2JQOA 3N6RA 2SOBA 4LF7Q 3C1EA 3PV0A 2UUCL 1B44D 4DV6Q 3HOYG 4K2LA 4K2KA 2I07B 2V4DA 3PUVA 4S3SA 1UE5A 1SYCA 1HTLD 1L1OA 4G7HC 5LMUL 4EQOA 1ML0D 2ZJPA 2UU9L 5M3MH 3HOYB 4M1UB 1KHIA 1TU2B 3DWQA 1KIXA 2NZHA 1F2YA 2I5LX 1BBUA 4DV2L 2IHEA 4HCEA 1D5XC 1AEXA 1F2ZA 1LLRD 1QILA 2QA4A 1SEBD 1GO3E 4WFN3 1YJ9A 3F2CA 1GOZA 3V2TA 2NB0A 1TR5A 4DXGA 1PTOF 1HFNA 2CHBD 3HOXG 2E5LL 4R4QA 1U4LA 1I6HH 2AUKA 2CW0D 1KDBA 1W6JA 1N8RC 2PCFB 5IP9G 3HOXB 2DN8A 3T51B 4DK1A 3A0JA 1EY6A 4JI1L 4QUFA 1K83H 1ICFB 3T16A 1E2WA 3IFTA 3MVVA 4MTKA 4UP7A 4HR7B 5FLXL 4GOPB 2K28A 1HZBA 1J6QA 3PUWA 1A3TA 1KDCA 4GKJQ 1S5ED 1TKWB 1EIFA 1TIID 2C35B 3OIPA 5CR3A 2X6LA 1HA6A 2OWOA 4ODGA 4DK0A 3JAMi 3F2UA 2FXQA 4H44C 2SNSA 4O0AA 1N9WA 3GTMH 3RZDH 1EY9A 3CCQA 2D62A 1KL9A 4DR3L 4OX9Q 4KJOA 3M4OH 5JOBA 4DR1Q 2MGSA 4MN3A 3CCRA 4L8JA 3KDFB 3K0YA 4ZUIA 3GTKH 4RCNA 4QQBX 4Y7NH 2L4NA 5K36G 2XGTA 3J81L 3QWNA 3M7NA 1IBML 3S17H 1I3QB 1X3QA 3L0OA 2NVTH 3AFQA 2B2YA 2B2VC 2Q2TA 1HZAA 3D0FA 5I9PA 3C46A 5H1SE 1DYQA 5T1IA 3U9SA 4UP9A 3BVZA 3I55A 4X3TA 2ZXOA 3WWVA 5IE8A 5CV8A 2NVYH 2XSCA 1NTGA 1SBBB 5L37A 1M1KC 1ICWA 3OYYA 2ID0A 3J80E 1HRJA 3IL8A 4A3JH 3PIPA 2VB3X 3CW2C 4TSSA 4A3EH 1B4OA 3KDFA 3TN2A 1A63A 3PO3G 2E76C 1DXMA 1VQFA 5I9OA 2Z6KC 2XRSD 1Q90A 3DLLA 1O78A 2FINB 3PO3B 2WAQE 3U4ZA 2HDLA 1L2FA 3DWAA 2F0QA 4IO9A 1OTCA 4FDBA 2R92G 3M9BA 3EVQA 1Q12A 1QNKA 3H15A 2R92B 2KCMA 2C9OA 4CBVA 2DUDA 3VR2A 1JORA 1TS2A 3NQIA 1E7ZA 3SK8A 2QF7A 4EGVA 1VQJA 4NPSA 5I6WA 3GTQH 2EJFC 2M2LA 1LT5D 2RF4A 3R2TA 5F2DA 2EIFA 4NXNQ 2Y0SG 4HIOA 1SR3A 1Y1VG 3I72A 5CV4A 2K1BA 2O2LD 5T1GA 2IJ0A 4A3DG 3HRZC 4JI7L 2KECA 1WTWA 3DM3A 2Y0SB 1Y1VB 2G9HD 4A3DB 2F0SA 2R3ZA 2F0GA 1KAAA 4RKBA 2F0DA 1CM9A 4DAPA 1XNQL 2PW5A 1QNUA 1YVCA 2MJ8A 2F0PA 2CH4A 5IGGA 1NAPA 1PXUA 5IYDG 4DV0Q 5C4ZA 4R8IA 5C0XH 5JJZA 1NBWA 4YWKA 3PF4A 2PZUA 5ISRA 4CKCA 2JEAI 4GNXA 3L7ZC 3PUXA 4GZYC 1TWAH 2L55A 3GTLB 1EWIA 3X3NA 1FGUA 2YTXA 4DAVA 1B7YB 2A8VA 1G6ZA 5HY6A 2JA8H 2QGQA 2K50A 2ALYB 2AQ1B 3GQBA 1IBLL 5ELDA 4OIKA 2F0FA 1QCBD 1QB5D 4DR5L 3LGJA 4DA2A 2OQKA 4C1NK 1P16A 5JEAH 1I94L 3JC66 4WRDA 1KRTA 3MXPA 1VQ7A 5FO9B 5EKIA 2IPKD 1QOHA 1HNZL 4H13C 2K7VA 4HMJA 3QR8A 1JC7A 2WFWA 3FEWX 4XXEA 1YIJA 2RSOA 2SDFA 1J5EQ 1I5FA 3SK4A 1X32A 3H94A 3HOZH 2Z6BA 4ZKCB 3CCVA 2XTIA 3W3AA 3QG1A 4EQ5A 4B3RQ 1PRTC 3P20A 3JAME 3PO2H 1C8CA 1EEFD 1UEAB 4CJ2C 1C0AA 5BR8L 1STNA 4KHPL 3A5ZB 4B9WA 3M3YB 4LUZA 2A73B 2E74C 3M4YA 1T9HA 3T1YQ 2Z9HA 2PO4A 1TWCH 5CV6A 1OO9B 1TVXA 1XNRQ 2NVQB 1D8LA 4YCVA 2EJMA 4JI8Q 1QVGA 1SDFA 2KOLA 3S2HH 5E3FA 1O80A 2HIVA 1HUNA 2ZTCA 3HEJA 2O4XA 4DR6Q 2F0LA 4B08A 3I4NH 1YNNC 1C48A 3J7ZC 1PMRA 4F88A 4NW2A 3KFUA 3SK5A 3CPWA 2OTLA 1K3RA 4DK6C 2EVBA 1ZYRC 3ITPA 4AYBG 4XIGS 4UPAA 1OXXK 4YIJA 1Q86C 2KVMA 4JK1C 4AYBB 3HOWH 4B3TL 1YITA 4PQXA 1JQYD 3PUYA 3NTIA 4IFDI 1DOLA 2N3SA 2KHIA 1EOVA 5C4XH 1E24A 2B2TA 1PHJA 4JYAL 1KABA 2K6AA 1OXSC 5A2QE 1HNXQ 1JR0D 4K8JA 4YCUA 4ZUJA 2Z4HA 4TQUS 1N36L 2K4KA 1HH2P 1FD7D 1A6XA 3NXWA 4B3MQ 4HAEA 1EFWA 4OO1H 3K7AB 2ZXRA 4WJ3M 2JSOA 3MFGA 2LY7A 5KEEA 2M00A 1SRUA 1MSGA 4P73A 5BN5A 1NE3A 3G6JB 1BKBA 4IPHA 3RZOB 2R6GA 1VMPA 1RD9D 2A6HD 3UDFA 2VNUD 2LXKA 1DD2A 1I50H 2PNRC 1PZJD 3FKIH 2B2WA 1ENCA 3BG3A 4JPBW 4NXMQ 3K58A 4JW0A 1N33Q 1TWHH 3DEPA 4N8X1 2K5DA 2D5DA 3MA2B 3STBC 2DNEA 1SNPA 2AWOA 1ZXTA 4ZYSA 2RDGA 5J3BA 4RCOA 5CYUA 2VQEQ 1WTRA 2XIWA 3TREA 4DGZA 2HIXA 4NMZA 4GNXC 4DXFA 2CQOA 5EPJA 1KC8C 3HOXH 1S5FD 3CMEA 1MHWC 1I4PA 1PTOC 1STGA 4IUPA 4HIMA 1PH3A 1QE6A 1W2BA 4JBKA 3QB3A 3BZKA 4H0LC 4DR7L 4X62L 1AE2A 4LF9Q 3MC0B 3A55A 1B50A 4KN7C 3E5SA 4JI4L 2B29A 2EY1A 2LMCB 4BS9A 3BDOA 4HJ5A 1E2ZA 2JA7G 4BY1H 4NP5A 1CHPD 1LACA 4DF7A 1PRTD 3HFZB 5FJ8G 1GUOA 1UE6A 4IFDJ 2UUBQ 4WJWA 1PA6A 2JA7B 3NE5B 1E1OA 1XXGA 2KJXA 5CC4A 4YCWA 4ZK9B 3MEHA 4BY7G 3VR5A 1YHBA 4JI3Q 3J80L 5I4DA 3NBIA 4H7BA 1R9TH 4BY7B 1CKMA 1CZGA 4TRDA 4KN4C 5JJLA 2WACA 4KD4A 4OELB 2I5HA 3DMUA 2ICEC 5FO7B 4QUCA 4DV5Q 1VQMA 1UE7A 3EBEA 2QEJC 3W1GA 1I4RA 1WTOA 1FR3A 1UUPA 4BBSG 2AKWB 1YNND 4CDCC 3PF5A 4Z9CB 5K36H 2EYHA 4CDEC 2Z1CA 4BBSB 1EUJA 2H4OA 3S16B 3RN2A 2KEEA 3BZDB 1VQPA 1VQDA 1B9NA 3MZ5A 2F1MA 1IL2A 2NVXB 1U4MA 5M5XB 3H09A 3E9HA 3I4OA 3E9IA 4PZ6A 2D2CC 4LF6L 1EFID 5NUCA 5JJKA 1XX8A 4ME5A 4NB3A 4UY8C 1H9KA 4RHRA 1H9SB 1RODA 4K14A 4EVOA 5IP7H 3MEFA 2I46A 1BF4A 2A19A 2DY8A 4UDUC 2PZWA 3EROA 4LFCQ 3K5LA 3KLWA 5A35A 3PO3H 2IY5B 1WVLA 3Q24A 5IT9c 1TWFB 3GD7A 3RMHA 3CCUA 1O7LA 3OW2A 5K5PA 1VCIA 3KF6B 4DV4L 3OTOL 1B9MA 5JAVA 1PH2A 1RIPA 3S15B 1UE1A 2JK8A 4PV1C 1G91A 2J0TD 1L0YB 2R92H 4DV3L 4LFBL 2B2VA 3AFPA 3I70A 3A74A 1BDOA 3FDTA 2E2JB 1MIUA 4BXXG 2ZTEA 1SJED 4B9XA 4K5WA 2K75A 1ONLA 1B3QA 1DGSA 4R1JA 5EPLA 1E22A 2B8FA 2Q2IA 4A3DH 4A3KG 3CC2A 1N34Q 3STBD 2RKSA 4EQNA 3KF6A 2N55A 1EY7A 2RHQB 2Z6KA 3A8KE 1STAA 1O7IA 2F0EA 4APVA 3DEOA 1K3BC 1GUGA 2L15A 2JA6G 1Q46A 1LTSD 1PH9A 2YTYA 3OW7A 5GROA 2JA6B 5C44G 3JAML 2OTJA 1VQAA 4YHHL 2K5WA 5LL6S 3S9WA 1VQ4A 1VQEA 3GTLH 1EIGA 1J9OA 5C44B 5J22A 1E2VA 2AUJD
chains in the Genus database with same CATH topology
4CJ0B 1AN8A 4FXGC 2A69C 4KY7A 4CHTB 4K5XA 4FVMA 2XWBB 1JWMD 5LL6X 2X6GA 3FPUB 3S1MB 5KGUA 4KK7A 1O7ZA 3J7AV 5DNFA 5IOCA 1LV9A 4IALA 1BR9A 3C1FA 3LX0A 4UAIA 1M8AA 1EWCA 3D31A 1B2TA 5CV9A 1CQFA 2QCPX 2RBMA 3DUZA 3QIAA 5I6YA 3I3CA 1XTCD 1A3VA 1PRTB 2F03A 3MHBA 2KQ3A 4ZRZA 1NR2A 3O13A 3DXJC 2M9VA 1PLFA 5A2QL 2G9DA 1HFGA 1GUNA 5CBAE 1RJTA 4BBRB 2PZTA 1VF7A 3E6ZX 5J1ZA 3QO2A 1ZKOA 1HHVA 1TY2A 4LMQD 5IGCA 4XYQA 2J7ZA 3M85A 1IHZA 1JWUD 2H1EA 3CRKC 4LJZC 4G7OC 1B53A 3TP7A 1BQQT 2E2IB 3WDNA 5IIFA 2EDGA 1DOMA 1WD1A 2EXZA 4KTAA 2WKDA 1SYDA 3HOUB 3OHXC 1F2MA 3S1RB 5M5YB 2EY6A 5JPNC 3ZYYX 1ENFA 3CKIB 1NSNS 1V8QA 1EY8A 2SNMA 3A56A 4BA1I 4IUVA 1KNAA 1RCVD 1Y69U 2RDFA 4C3IG 2ZT9C 4F8MA 3PMFA 5DAUA 3WOEA 1JE4A 3VR3A 3C3LA 5D3DA 4C3IB 3T13A 3HOVB 5DEHA 3KF8A 1B3AA 5D14A 3A7AB 4O1NA 3HGBA 3NQTA 1WCMB 1R4QB 3OMGA 2A6EC 2F0OA 1UNSA 2B8GA 4FYDA 4FO2A 2A69D 4K8IA 1S5CD 3NHHA 4XQQA 4K5VA 1SNQA 3I4MB 1A2TA 2B63B 1Q1BA 1A15A 1EZ8A 3UI2A 1RTOA 2K04A 3S14B 3D6CA 1S5BD 1X3PA 1F9PA 2MHVA 3NK9A 5M5WB 1Q8IA 1SJHD 2XN9C 3Q0AA 4RKLA 1MGSA 3D4RA 1EL0A 4O42A 1WTPA 1BNZA 1Q3LA 4KD3A 5CGKA 1LABA 2IX3A 1JOQA 3S1NB 1SMYC 5C5LA 3SDZA 1PZID 4F87A 3SE0A 3OSOA 3J7YW 4J8QA 1STYA 4LK1C 4IUQA 1V43A 2WB1B 5EBDA 1MBYA 4RGMA 2PQEA 2DNCA 3CRLC 2NN6H 3E0JA 4XT3B 1EQTA 2O5JC 1KDAA 2PYKA 3PUZA 3CQZB 1KNEA 5C0XI 1D6EC 3KLSX 3GP7A 3GTGB 3KUPA 3VYUA 2L12A 3LWEA 3D6WA 3IFDA 4QIWB 2ICIA 1BCPF 4K6DA 3D3RA 4XT1B 3I8ZA 1SSOA 2NYZD 1WTXA 2E2DC 4QMGA 1JICA 2C5CA 1EY5A 1KTKA 3H91A 4X3SA 2DY7A 3L9AX 3GTPB 1ENAA 3T4AC 4XQNA 2R7ZB 1ET9A 1AFPA 1STEA 1OXUA 3SK6A 5E4WC 2YU9B 3OPOA 1K83B 4XYOA 5EKKA 2SEBD 3DM1A 4TKOB 1HUMA 2JXMB 5EJWA 5E1FA 1AZPA 3OWEB 4CKBA 1K8OA 4A3BB 1L0XB 4HN7A 1EU3A 2A6ED 1LTAD 1RTNA 4N9PA 1GUSA 1JB3A 1D5ZC 1KLUD 5I2XA 3K6OA 2A68C 4I7ZC 3GTMB 1TS5A 4KJNA 4DFAA 4DAYA 1KLGD 1PDQA 1EYDA 1U4PA 1WTVA 3W2DA 1J8IA 2XVSA 1IW7C 3HP3A 4KV6A 4CJ1B 4ZQ3A 5C0XJ 1G291 1EYAA 4OIJA 3VR6A 1D1IA 1EY0A 3KBXA 5BN3A 1BBXC 4DNTB 2F0TA 2NVTB 2BE5C 4HEDA 1JWSD 1Y1WB 1LTGD 1I4QA 4A3IB 5JEAJ 1SMYD 4OGQC 3TZUA 1BXTA 4OO1I 4IUUA 1ZEQX 5EPKA 1M4VA 2K05A 4N9TA 4RA8A 4A3EB 4RH6A 2Z4IA 4BWGB 1O7YA 1G8ZD 1I4XA 1ET6A 1VF5C 2LS01 1GJXA 4A93B 1TWGB 3NP8A 2HUGA 3VA7A 2IX1A 4ID6A 2KCNA 5IGEA 4QB4A 2NZ1D 5KYLA 4MIUA 1LT6D 2L1BA 2HQEA 2K32A 1DCZA 1A2UA 2RVLA 5M9OA 3P75A 1PZKD 1H9RA 1OXVA 3GTQB 1ESRA 3H0GB 5C5MA 5J39A 5G3LD 2EY5A 1IYVA 2KUMA 2BOSA 1EY4A 4G4KA 1AP0A 1MD2D 2WAQB 4J6HA 5C0XG 2IWHA 5C3XA 3A54A 1HPCA 4F7XA 3NPPA 2N88A 3IKJA 1ZYRD 3OWFA 2WINB 3BVMA 1TWAB 1GHKA 5COYA 1HCZA 1CK1A 2D9UA 2EPBA 1F77A 2AQ2B 1EOTA 5JEAG 1DJRD 2NTSA 5CBEE 4IZ8A 4HSPA 3Q22A 4IQZA 2EYOA 3M7GA 4KHVA 1RKNA 3K5OA 1PRTF 5KRUA 1CFMA 3GV3A 3HOZB 2HCCA 3H6MA 4KY6A 2E75C 2BDOA 4OHJA 4K6LA 1WD0A 1IW7D 3KBGA 4HCSA 3H3VC 3GTOB 5C4JB 1BO0A 1TWCB 4IFDG 1DONA 2EYJA 2BE5D 1GXDC 5IT9E 3VR4A 3S2HB 2TSSA 1EEID 1SNDA 3MWYW 3EA6A 2WKCA 3IAYA 1PFBA 3J7AF 1HQMC 2JA5B 4G57A 2NWGA 1F9SA 3V05A 3NWSA 1Q1EA 1PTOD 4CKEA 3HOWB 5HGTA 4Q5VA 3SEBA 5C4XB 5CORA 1PYWD 4JBWA 2K03A 4OO1G 2IX0A 1BOSA 2CQAA 2BA1A 1U4RA 2IL8A 1S5DD 1XWEA 1EQVA 3VYRA 1V1PA 4IN3A 3I91A 4C2MB 1ESFA 1MSHA 3BDCA 3R2IA 1I50B 5TSSA 2F3VA 3FKIB 1BCPC 4EQPA 4ABNA 1NUCA 5CV5A 1TWHB 1UAPA 4FP5D 4R9WA 4ULLA 3D8GA 1SYFA 4HMIA 2RA4A 4KKUA 2XWJB 4RGOS 2XRQD 1LTTD 3PIO3 3QOLA 2F0UA 2VXWA 2KCCA 1XYIA 2QKIC 1RDPD 4X3KA 1G2SA 3KLSA 3FMCA 3SXHA 3Q23A 5BN4A 3R93A 4FXDA 1HA5A 2QILA 1LO5D 4BY1B 3QOJA 3AB9A 2FFKB 2NTTA 3BDLA 1LT3D 2K33A 1V1OA 3NTHA 4M8AA 1LTRD 1R9TB 1Z6HA 3X3MA 2YYZA 5ELEA 5CMDA 3P1HA 2HDMA 1W6KA 4KKSA 1QG7A 4DNRB 1D1KA 1IKMA 1CTMA 3I4LA 3RD4A 2WP8J 5JVH3 4A3MB 1STHA 4ZAIA 1RF2D 1SE4A 3R8BA 4RGTA 2PPBC 1B1ZA 5EBCA 4NDXA 2MP1A 3FVQA 5AFWA 3K59A 4U673 2HCIA 3ND8A 3K5MA 2OF1A 2FHTA 5DM63 2EJGC 1HXYD 1SYEA 5HURA 1QWYA 2IW3A 4E6IA 2R61A 3HS0C 2B2UC 2L5TA 1F9RA 3CHBD 3P7JA 1F9QA 3EQLC 2B39A 4RAUC 2NUCA 2EZVA 2TMPA 3FPPA 1PTOB 3TP8A 4A3FB 1Y8OB 3A8IE 3TP6A 2KA7A 1R4PB 3BS1A 1EU4A 4P2CB 2VB2X 3ND9A 3QJYA 5FO8B 4FF4A 2QDBA 5CV7A 1DZ1A 1JCKB 3MXNA 1BCPD 3U9OA 5EGTA 3NWTA 2RDHA 3TSSA 2A6HC 3K5NA 2F3WA 4QF4A 2F0KA 5LHY1 4L6TB 2KHSA 2JYOA 5IGDA 2NBFA 4IUTA 1RHPA 1G2TA 2MUYA 1I4HA 2EYMA 2GA4B 2O5IC 1U9RA 1JOOA 1E0BA 2RQXA 3EJIA 3PIP3 3SHLA 3D4DA 2EYLA 3GTJB 4I65A 1CT1D 3HZXA 4IURA 1Y8PB 3URYA 5IT9L 2WIIB 2OT2A 4XDXA 4BA2I 3KLRA 5M3MB 3KK7A 2JP1A 2CVRA 4MHEA 2J4XA 5FK9C 4X3UA 1TS4A 2LFNA 2NN6I 1I6VC 1SYGA 4HSVA 5IODA 3TP5A 1YNJC 3AMUA 3C2PA 3T56B 3WOFA 1T5XD 2A74C 4ILWA 1I6HB 4C1NI 3A7LA 3V96A 4IFDH 4RWSC 1OXTA 1H9MA 4KKTA 1C4QA 2EYFA 3BVGA 1SE2A 2B2YC 1JOKA 4ZKBB 4V0BA 4C3HG 4ZLTF 5EQ0A 1K8MA 3Q6SA 1LTBD 2BA0A 3SR1A 2X69A 1F2LA 1S4ZA 4C3HB 2Q8RE 2F4IA 2A5HA 1PFMA 5D3IB 1EIHA 5C3WA 4FF3A 2EYPA 1ILPA 3NUCA 1IYUA 1IKLA 2EY2A 3AU7A 3ONAB 5KNBA 2L11A 3RZDB 2KEDA 1TS3A 5D65A 1DOKA 1SAPA 1VDZA 5FKAC 3M4OB 4PMBA 4PMWA 1CZWA 3GTKB 2L0CA 2WV6D 4Y7NB 1H9JA 5FLXE 3CU7A 3S17B 4A3GB 4FNFA 3TDQA 4CGYB 4PNYA 3NSWA 1EYCA 2BCOA 1EZ6A 3RUZA 3MAQA 4KHZA 4J1MA 1LTID 2IT1A 2NVYB 1II3A 4DU9A 3SVMA 1FGBD 2Z8LA 4A3JB 4FF2A 3MFYA 2OEOA 1CI3M 2JEBI 1FNWA 3J81E 1CA5A 1BCPB 2AWNA 3VYTA 1ILQA 4KMUC 3L3OC 3D4WA 1SXTA 1PFNA 5IGBA 3RLFA 2Q8IB 4RHSA 2K5QA 1HTPA 2F0WA 1T5EA 3BYTB 4IUNA 2EE1A 4HTHA 5E4XA 2AQ3B 5M3FB 3EFXD 5ELFA 1VMCA 5FOBB 5C4HA 4FXKC 3A8JE 1NCVA 5JVG3 5DM73 4R8NA 4C56C 1HQRD 2FMCA 1EWHA 2F0IA 2FJ2A 1AZQA 1SNCA 3K57A 1SNOA 1CHQD 1GUTA 1NR4A 1QJOA 1SFOB 1YNJD 4KY5A 5I2YA 2PW7A 4XTCS 5C3EB 2F0HA 1TY0A 4G7ZC 3G7LA 4DN4M 1CQVA 1MI2A 4L63B 1SNMA 2MPMA 4V190 3BYYB 2OXPA 5IGFA 2CW0C 2JA8B 3VA5A 1STBA 3N52A 2ENBA 1FYCA 3MXGA 1GUWA 4RGNA 2NN6G 1AW7A 3T53B 1LT4D 3R3OA 3OOCA 5JPMC 5ELCA 3NBHA 3MTSA 3TMEA 1Z7TA 2PMZB 2Q8TA 2A68D 1FNVA 2F0NA 3PO2B 5G3LF 4U68A 2E2HB 3OMCA 3S2DB 4XQJA 1D5MC 1D2BA 4C3JG 1A3UA 2B2TC 4QCLA 2LKVA 4PMCA 2F0JA 4C3JB 1PTOH 1Z47A 1DM0B 2BDNA 4NKLA 3VYSA 2K01A 2F0MA 2ZXPA 1SE3A 2EOTA 3I4NB 3GV6A 1H9SA 1SYBA 3TZDA 5C6AA 2XNAC 1WTQA 3HG9A 3LWUA 5KIXA 1FNUA 3MXUA 1TT2A 3I90A 1CA6A 3FRPB 3ERQA 3DHQA 2R93B 3OIQA 1I4GA 2FMMA 5EKLA 2B2WC 1BUVT 3S1QB 4A3KB 1V1PB 2B2UA 3HKZB 2JE6I 2L9HA 3I73A 2F0VA 1Y8NB 2RSNA 4FF1A 5KYIA 1TQOA 4Q0FA 5KNDA 5KNCA 4OL7A 1GHJA 3DWPA 4RFBA 1IL8A 3LNNA 3NTKA 4KI0A 5ELBA 4LAAA 3GO5A 2VUMB 3TBIB 4WORA 3N6RA 2SOBA 3C1EA 3PV0A 1B44D 4K2LA 4K2KA 2I07B 2V4DA 3PUVA 4S3SA 1SYCA 1HTLD 4G7HC 4EQOA 1ML0D 3HOYB 4M1UB 1TU2B 3DWQA 1F2YA 4HCEA 1D5XC 1AEXA 1F2ZA 1LLRD 1QILA 1SEBD 4WFN3 1GOZA 3V2TA 2NB0A 1TR5A 4DXGA 1PTOF 1HFNA 2CHBD 1U4LA 2AUKA 2CW0D 1KDBA 1W6JA 2PCFB 3HOXB 2DN8A 3T51B 4DK1A 1EY6A 4QUFA 3T16A 1E2WA 3IFTA 3MVVA 4HR7B 5FLXL 2K28A 3PUWA 1A3TA 1KDCA 1S5ED 1TKWB 1TIID 3OIPA 5CR3A 2X6LA 1HA6A 4ODGA 4DK0A 3F2UA 4H44C 2SNSA 1EY9A 2D62A 4KJOA 5JOBA 2MGSA 4MN3A 4L8JA 3K0YA 4ZUIA 4RCNA 2L4NA 5K36G 3J81L 3QWNA 3M7NA 1I3QB 1X3QA 2B2YA 2B2VC 5I9PA 3C46A 1DYQA 5T1IA 3U9SA 3BVZA 4X3TA 2ZXOA 5CV8A 2XSCA 1SBBB 1ICWA 3J80E 2ID0A 1HRJA 3IL8A 2VB3X 4TSSA 1B4OA 3TN2A 2E76C 1DXMA 5I9OA 2XRSD 1Q90A 1O78A 2FINB 3PO3B 2HDLA 3DWAA 2F0QA 3EVQA 1Q12A 1QNKA 2R92B 2C9OA 4CBVA 3VR2A 1JORA 1TS2A 3NQIA 3SK8A 2QF7A 4EGVA 5I6WA 2EJFC 2M2LA 1LT5D 3R2TA 5F2DA 5CV4A 3I72A 5T1GA 2K1BA 2O2LD 2IJ0A 3HRZC 2KECA 1WTWA 2Y0SB 1Y1VB 2G9HD 4A3DB 2F0SA 2R3ZA 2F0GA 1KAAA 4RKBA 2F0DA 1CM9A 4DAPA 2PW5A 1QNUA 2MJ8A 2F0PA 5IGGA 1NAPA 1PXUA 5C4ZA 4R8IA 5C0XH 5JJZA 2PZUA 5ISRA 4CKCA 2JEAI 3L7ZC 3PUXA 4GZYC 2L55A 3GTLB 3X3NA 4DAVA 1G6ZA 3GQBA 2AQ1B 5ELDA 4OIKA 2F0FA 1QCBD 1QB5D 4DA2A 4C1NK 5JEAH 4WRDA 3MXPA 5FO9B 5EKIA 2IPKD 1QOHA 4H13C 2K7VA 4HMJA 1JC7A 3FEWX 4XXEA 2RSOA 2SDFA 3SK4A 1X32A 3H94A 4ZKCB 3W3AA 3QG1A 1PRTC 3P20A 3JAME 1C8CA 1EEFD 1UEAB 4CJ2C 1STNA 4B9WA 3M3YB 2A73B 2E74C 3M4YA 2PO4A 5CV6A 1OO9B 1TVXA 2NVQB 2EJMA 1SDFA 2KOLA 5E3FA 1O80A 1HUNA 3HEJA 2O4XA 2F0LA 4B08A 1YNNC 1C48A 1PMRA 4F88A 4NW2A 3SK5A 2EVBA 1ZYRC 3ITPA 4XIGS 1OXXK 4YIJA 2KVMA 4JK1C 4AYBB 4PQXA 1JQYD 3PUYA 3NTIA 4IFDI 1DOLA 2B2TA 1KABA 2K6AA 1OXSC 5A2QE 1JR0D 4K8JA 4ZUJA 2Z4HA 4TQUS 1A6XA 1FD7D 3NXWA 4HAEA 4OO1H 3K7AB 2ZXRA 2JSOA 3MFGA 2LY7A 5KEEA 2M00A 1MSGA 5BN5A 3G6JB 3RZOB 2R6GA 1VMPA 1RD9D 2A6HD 2VNUD 1DD2A 2PNRC 1PZJD 2B2WA 1ENCA 3BG3A 3K58A 3DEPA 2K5DA 2D5DA 3MA2B 2DNEA 1SNPA 2AWOA 1ZXTA 4ZYSA 2RDGA 4RCOA 5CYUA 1WTRA 2XIWA 4DGZA 4NMZA 4DXFA 5EPJA 1S5FD 1I4PA 1PTOC 1STGA 4IUPA 1QE6A 3QB3A 4H0LC 3MC0B 3A55A 1B50A 4KN7C 3E5SA 2EY1A 2LMCB 4BS9A 3BDOA 1E2ZA 4NP5A 1CHPD 1LACA 4DF7A 1PRTD 1GUOA 4IFDJ 4WJWA 2JA7B 3NE5B 1XXGA 2KJXA 5CC4A 4ZK9B 3MEHA 3VR5A 3J80L 5I4DA 3NBIA 4H7BA 4BY7B 1CZGA 4TRDA 4KN4C 2WACA 4KD4A 3DMUA 2ICEC 5FO7B 4QUCA 2QEJC 1I4RA 1WTOA 1FR3A 1UUPA 1YNND 4Z9CB 5K36H 2EYHA 2Z1CA 4BBSB 2H4OA 3S16B 2KEEA 3BZDB 1B9NA 3MZ5A 2F1MA 2NVXB 1U4MA 5M5XB 3H09A 2D2CC 1EFID 5NUCA 1XX8A 4ME5A 1H9KA 4RHRA 1H9SB 1RODA 4K14A 4EVOA 2I46A 1BF4A 2DY8A 4UDUC 2PZWA 3EROA 3K5LA 5A35A 1WVLA 3Q24A 1TWFB 3GD7A 3RMHA 1O7LA 5K5PA 1VCIA 1B9MA 5JAVA 3S15B 4PV1C 1G91A 2J0TD 1L0YB 2B2VA 3I70A 1BDOA 3FDTA 2E2JB 1SJED 4B9XA 4K5WA 1ONLA 5EPLA 2B8FA 2RKSA 4EQNA 2N55A 1EY7A 3A8KE 1STAA 2F0EA 3DEOA 1GUGA 1LTSD 3OW7A 2JA6B 3JAML 2K5WA 5LL6S 3S9WA 1EIGA 1J9OA 5C44B 5J22A 1E2VA 2AUJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOQ A;  1F2Y A;  3TP8 A;  2EYH A;  5C5L A;  3OMC A;  3TP6 A;  5C5M A;  5J39 A;  4N9P A;  1F2M A;  1AEX A;  2EY5 A;  1F2Z A;  3OSO A;  5KGU A;  2EY6 A;  4KY7 A;  3SK4 A;  1A3U A;  3MZ5 A;  1STY A;  3D4W A;  4K5X A;  1EY4 A;  3SXH A;  4G57 A;  5I9O A;  1SND A;  3V2T A;  5IGB A;  1NSN S;  1TR5 A;  1EY8 A;  1ENC A;  2LKV A;  2F0J A;  2EYF A;  4PMC A;  2SNM A;  2F0W A;  2QDB A;  5NUC A;  4IUN A;  5CV7 A;  1JOK A;  1STN A;  4ME5 A;  2F0Q A;  4HTH A;  3QOJ A;  1KDB A;  4J6H A;  4KJN A;  4NKL A;  4B9W A;  3U9O A;  2PQE A;  4K14 A;  4DFA A;  4EVO A;  2F0M A;  5EGT A;  1EYD A;  5HGT A;  5C4H A;  5C3X A;  3SR1 A;  1SNP A;  5IOC A;  3BDL A;  4IAL A;  1EY6 A;  2PZW A;  2RDF A;  3EVQ A;  1KDA A;  4KV6 A;  2PYK A;  3ERO A;  3C1F A;  3PMF A;  4R8N A;  5DAU A;  4ZQ3 A;  4F8M A;  2F3W A;  1SYB A;  1EYA A;  3T16 A;  4F7X A;  5C6A A;  4QF4 A;  2F0K A;  3LX0 A;  1EY0 A;  3OWF A;  5CV6 A;  4DGZ A;  5C3W A;  3MVV A;  2EYP A;  2F0I A;  2KHS A;  1JOR A;  3T13 A;  5IGD A;  4NMZ A;  5E3F A;  1SNC A;  2F0T A;  5CV9 A;  3SK8 A;  1SNO A;  5I6W A;  1TT2 A;  3NUC A;  5K5P A;  2RBM A;  5DEH A;  5I6Y A;  3ERQ A;  1STG A;  3DHQ A;  3HEJ A;  2O4X A;  3P1H A;  4K6D A;  2EY2 A;  4KY5 A;  5F2D A;  2EYM A;  1A3V A;  2F0L A;  5JAV A;  1U9R A;  1A3T A;  1JOO A;  4IZ8 A;  5CV4 A;  5EKL A;  1KDC A;  3MHB A;  3NQT A;  3QB3 A;  2KQ3 A;  2PW7 A;  2EYO A;  3OMG A;  2F0O A;  5CR3 A;  2F0H A;  3SK5 A;  3EJI A;  4KHV A;  4PMB A;  1RKN A;  2F0S A;  3E5S A;  4QMG A;  1STH A;  1EQV A;  4N9T A;  4ODG A;  3ITP A;  2F0G A;  3SHL A;  5KIX A;  1KAA A;  2EY1 A;  4K8I A;  2F0V A;  4RKB A;  3NHH A;  5KRU A;  2F0D A;  2SNS A;  4B9X A;  1EY5 A;  4YIJ A;  3D4D A;  5KYI A;  4K5V A;  4NP5 A;  1SNM A;  1SNQ A;  1TQO A;  2EYL A;  2PW5 A;  4K5W A;  1A2T A;  4I65 A;  4DF7 A;  1EY9 A;  2F0P A;  2PZT A;  5IGG A;  4OL7 A;  5J1Z A;  3H6M A;  3BDC A;  4KY6 A;  3HZX A;  2OXP A;  3NP8 A;  5IGF A;  4KJO A;  1EZ8 A;  4NDX A;  2F3V A;  4PNY A;  5JOB A;  5CC4 A;  3VA5 A;  1EYC A;  1STB A;  4ID6 A;  3MEH A;  5C4Z A;  2ENB A;  1ENA A;  3D6C A;  4EQP A;  4LAA A;  1EZ6 A;  4ZUI A;  3RUZ A;  5IGC A;  1NUC A;  2RKS A;  5CV5 A;  4EQN A;  2PZU A;  5ISR A;  3NK9 A;  4H7B A;  4J1M A;  1IHZ A;  2OF1 A;  1EY7 A;  5IGE A;  3R3O A;  4QB4 A;  1KAB A;  5KYL A;  1STA A;  1SYE A;  4WOR A;  3TP7 A;  4K8J A;  2F0E A;  4TRD A;  5HUR A;  1II3 A;  4ZUJ A;  3SK6 A;  2SOB A;  1SYF A;  3D8G A;  4HMI A;  4MIU A;  2WAC A;  3C1E A;  4E6I A;  4KD4 A;  2HQE A;  4RKL A;  3DMU A;  3TME A;  4K2L A;  4K2K A;  5I9P A;  5IIF A;  4S3S A;  3NXW A;  5EKK A;  1SYC A;  1SYG A;  2F0F A;  4DU9 A;  1A2U A;  5M9O A;  3P75 A;  5IOD A;  4EQO A;  3TP5 A;  2EXZ A;  2EYJ A;  2OEO A;  3S9W A;  4KTA A;  3QOL A;  4WRD A;  5CV8 A;  3MXP A;  5E1F A;  4KD3 A;  5CGK A;  2NUC A;  5KEE A;  2M00 A;  5J22 A;  2F0N A;  4HMJ A;  2F0U A;  1SYD A; 
#chains in the Genus database with same CATH topology
 4CJ0 B;  5LMN Q;  1XMO Q;  1AN8 A;  3IRB A;  3U4V A;  4FXG C;  2A69 C;  4KY7 A;  4X66 Q;  4CHT B;  4K5X A;  4FVM A;  1XTD A;  2XWB B;  1A62 A;  1JWM D;  3UE0 A;  5LL6 X;  3TS0 A;  3T1H L;  2VQF L;  2X6G A;  3FPU B;  3S1M B;  5KGU A;  4KK7 A;  1O7Z A;  3J7A V;  3F2B A;  1UEB A;  5DNF A;  4DR2 Q;  5IOC A;  1VQO A;  1LV9 A;  4IAL A;  1BR9 A;  1BVS A;  3C1F A;  3LX0 A;  4DR4 Q;  4UAI A;  3KOJ A;  1M8A A;  1EWC A;  3D31 A;  3UE1 A;  1B2T A;  5GAG C;  2LXJ A;  1PH7 A;  1X65 A;  5CV9 A;  1CQF A;  2QCP X;  2RBM A;  3DUZ A;  3QIA A;  5I6Y A;  4LWC A;  3I3C A;  2ZM6 Q;  1XTC D;  2YV5 A;  1A3V A;  1PRT B;  2F4V Q;  2F03 A;  3MHB A;  2NVQ H;  2KQ3 A;  4AQY Q;  1K9M C;  4LF8 Q;  3F1Z A;  4ZRZ A;  1NR2 A;  3O13 A;  2UUA Q;  3H3V H;  3DXJ C;  2M9V A;  1PLF A;  5FLM H;  5A2Q L;  2G9D A;  4BBR G;  1YZ6 A;  1HFG A;  5IWA Q;  3E0E A;  1GUN A;  4IOA A;  5CBA E;  4B3S L;  2QW7 A;  1RJT A;  4BBR B;  2PZT A;  1VF7 A;  3E6Z X;  5J1Z A;  1NJI C;  3QO2 A;  1ZKO A;  4C3H H;  1CSQ A;  3RR5 A;  2MFI A;  1HHV A;  1TY2 A;  4LMQ D;  4YWM A;  5IGC A;  4XYQ A;  2J7Z A;  1RL2 A;  3M85 A;  1IHZ A;  1JWU D;  2H1E A;  3CRK C;  4LJZ C;  4G7O C;  1B53 A;  1FJG Q;  3TP7 A;  1BQQ T;  2E2I B;  3WDN A;  5IIF A;  2VL6 A;  2EDG A;  1DOM A;  3SGI A;  4X65 Q;  4IPD A;  1WD1 A;  3CC7 A;  2EXZ A;  3CCJ A;  2UXD L;  3HOU G;  4KTA A;  4O2D A;  4R4O A;  1PYB A;  2WKD A;  4L5T A;  1SYD A;  1SN8 A;  1XPU A;  4JI6 Q;  3HOU B;  3OHX C;  1F2M A;  3S1R B;  5M5Y B;  2EY6 A;  3KF8 B;  5JPN C;  2UUC Q;  2ASB A;  4A3G H;  1A0I A;  4J15 A;  1C9O A;  3UDG A;  3ZYY X;  1ENF A;  3CKI B;  5LMU Q;  1NSN S;  1V8Q A;  1EY8 A;  2VW9 A;  4P75 A;  2UU9 Q;  2SNM A;  3A56 A;  4BA1 I;  5IYC G;  4IUV A;  1V9P A;  1KNA A;  2K14 A;  4GN3 B;  4QY7 A;  3CD6 A;  4DV2 Q;  1RCV D;  3CAM A;  1Y69 U;  2RDF A;  4C3I G;  2ZT9 C;  1IBK L;  4F8M A;  3PMF A;  5DAU A;  1EYG A;  3WOE A;  3HOV G;  1JE4 A;  2EQS A;  3VR3 A;  3C3L A;  5D3D A;  4C3I B;  2I5M X;  3T13 A;  2E5L Q;  3HOV B;  2A1A A;  5DEH A;  3KF8 A;  1B3A A;  1WCM G;  5D14 A;  4YY3 L;  5IYB G;  3A7A B;  4O1N A;  2QDL A;  3HGB A;  3NQT A;  4DNI A;  1WCM B;  1R4Q B;  4JI1 Q;  4A3L H;  3OMG A;  2A6E C;  2F0O A;  1UNS A;  3I4M G;  1SRO A;  2B8G A;  4FYD A;  4FO2 A;  2A69 D;  2B63 G;  4K8I A;  1S5C D;  3NHH A;  4XQQ A;  4K5V A;  1BBW A;  1SNQ A;  3I4M B;  1A2T A;  5M3F H;  2B63 B;  1M90 C;  1Q1B A;  1VQI A;  1A15 A;  1EZ8 A;  3UI2 A;  4GNX B;  1RTO A;  2K04 A;  3S14 B;  3D6C A;  1S5B D;  1VQG A;  1X3P A;  1F9P A;  2MHV A;  3NK9 A;  5M5W B;  1KAW A;  2ZTD A;  1Q8I A;  1SJH D;  4DUY Q;  2XN9 C;  3Q0A A;  2JA7 H;  4RKL A;  1SFO H;  1PVO A;  1MGS A;  3D4R A;  2PMZ E;  4DR3 Q;  1EL0 A;  4A75 A;  4O42 A;  1WTP A;  1BNZ A;  1Q3L A;  5C3E H;  4BY7 H;  1NMF A;  1LUZ A;  4KD3 A;  5CGK A;  1LAB A;  2IX3 A;  4L5Q A;  1JOQ A;  3S1N B;  1SMY C;  5C5L A;  3SDZ A;  1PZI D;  4F87 A;  1IBM Q;  3RNU A;  3SE0 A;  1CKN B;  3OSO A;  4J8Q A;  3J7Y W;  2WB1 G;  2HD3 A;  1Q82 C;  2BH8 A;  1STY A;  4LK1 C;  4IUQ A;  1V43 A;  2WB1 B;  5EBD A;  2PQA B;  1MBY A;  4RGM A;  4LF4 L;  4BBS H;  4A3C H;  3NEL A;  3S16 H;  2PQE A;  2DNC A;  3CRL C;  1W3S A;  2NN6 H;  3E0J A;  4JCV E;  1ASZ A;  4XT3 B;  1EQT A;  2N49 A;  2O5J C;  1KDA A;  2PYK A;  3PUZ A;  3CQZ B;  1KNE A;  5C0X I;  1D6E C;  3KLS X;  3GP7 A;  3GTG B;  3KUP A;  3VYU A;  2L12 A;  3BZC A;  3LWE A;  3G6E A;  3D6W A;  1CKN A;  3IFD A;  4QIW B;  1PV4 A;  2ICI A;  1BCP F;  4K6D A;  3D3R A;  2E2H H;  4XT1 B;  3ICE A;  3S2D H;  3I8Z A;  2CKZ B;  1X55 A;  4JI0 L;  1SSO A;  2NYZ D;  1PH8 A;  4JI2 Q;  1WTX A;  2AMC B;  2E2D C;  3HKZ E;  4PZ7 A;  1TWF H;  2PQA A;  1VQ9 A;  4PG3 A;  1N32 L;  3AQQ A;  4QMG A;  1JIC A;  4C3J H;  2C5C A;  3G4S A;  2KBN A;  1EY5 A;  1KTK A;  3H91 A;  4X3S A;  1YI2 A;  2DY7 A;  4A4I A;  3ULP A;  3L9A X;  3GTP B;  3CMA A;  2R7Z G;  4JI7 Q;  4GKK L;  1ENA A;  3T4A C;  3E3X A;  1MKH A;  4XQN A;  2R7Z B;  2D0O A;  1ET9 A;  4OWT B;  1AFP A;  2V1C C;  4MTN A;  4BXX H;  1STE A;  1OXU A;  3SK6 A;  5E4W C;  2YU9 B;  3OPO A;  1XNQ Q;  1VQL A;  2R93 H;  4DAY B;  1K83 B;  4XYO A;  5EKK A;  2SEB D;  3DM1 A;  4TKO B;  2P5Z X;  1HUM A;  3S1Q H;  4A3B G;  2JXM B;  4A3K H;  5EJW A;  5E1F A;  2QEX A;  1AZP A;  3OWE B;  4CKB A;  2RHS B;  1K8O A;  4X6A H;  4LUO A;  4P74 A;  1L0X B;  4A3B B;  4HN7 A;  1EU3 A;  2A6E D;  1LTA D;  1RTN A;  4N9P A;  1GUS A;  4JI5 L;  5FLX c;  1JB3 A;  2JA6 H;  1IBL Q;  3ULL A;  1D5Z C;  1KLU D;  1XJV A;  4DR5 Q;  5I2X A;  1KXL A;  1I94 Q;  3K6O A;  2VUM H;  2A68 C;  1EIY B;  1XMQ L;  4I7Z C;  1HNZ Q;  3GTM B;  1TS5 A;  4KJN A;  4DAY A;  4DFA A;  3CP0 A;  4P71 A;  1KLG D;  1PDQ A;  1EYD A;  1U4P A;  1WTV A;  3W2D A;  1J8I A;  2XVS A;  1IW7 C;  3HP3 A;  4KV6 A;  4CJ1 B;  4ZQ3 A;  5C0X J;  1KD1 C;  1G29 1;  1EYA A;  4OIJ A;  3VR6 A;  1S3O A;  1D1I A;  1EY0 A;  3KBX A;  3HOY H;  5BN3 A;  1K0R A;  4DUZ L;  1PH5 A;  4X64 L;  1BBX C;  4DNT B;  2F0T A;  1Y1W G;  2YTV A;  3UDI A;  1MJE A;  4MNO A;  4P72 A;  4A3I G;  4KHP Q;  2NVT B;  2UXB L;  2BE5 C;  4HED A;  1JWS D;  1Y1W B;  3CCL A;  1LTG D;  1I4Q A;  5E7N A;  4A3I B;  1X3G A;  5JEA J;  1SMY D;  4OGQ C;  3TZU A;  4A3E G;  1BXT A;  1HR0 Q;  4OO1 I;  4IUU A;  1ZEQ X;  5EPK A;  1M4V A;  2K05 A;  4N9T A;  5AJ3 L;  4RA8 A;  3TQY A;  4A3E B;  4A93 G;  1XPR A;  4RH6 A;  2Z4I A;  5GAD C;  4DPG A;  4BWG B;  1O7Y A;  1G8Z D;  1I4X A;  1ET6 A;  1VF5 C;  2LS0 1;  1GJX A;  4A93 B;  2CCZ A;  2Q2H A;  1IZ6 A;  1TWG B;  3NP8 A;  4DV1 L;  2HUG A;  3VA7 A;  2IX1 A;  4GLX A;  1VQ5 A;  4ID6 A;  1SE8 A;  2KCN A;  5IP9 H;  1UWV A;  3BU2 A;  1HNW L;  5IGE A;  4QB4 A;  2NZ1 D;  5KYL A;  4MIU A;  1LT6 D;  2L1B A;  1PH1 A;  2HQE A;  2K32 A;  4EX5 A;  4DV7 Q;  1DCZ A;  3NEM A;  4B3T Q;  4GN4 B;  1H95 A;  1A2U A;  2RVL A;  5M9O A;  3P75 A;  1WJJ A;  1PZK D;  3H0G G;  1H9R A;  1OXV A;  2HHH L;  3GTQ B;  1B8A A;  1ESR A;  3H0G B;  2E2I H;  5C5M A;  5J39 A;  5G3L D;  2EY5 A;  1IYV A;  1N36 Q;  2KUM A;  2BOS A;  3ZJY C;  1VQC A;  1EY4 A;  4G4K A;  2WAQ G;  1V1Q A;  1HJP A;  4LFA Q;  3HOU H;  1AP0 A;  1MD2 D;  2WAQ B;  3HKS A;  4J6H A;  5M5Y H;  4IPG A;  4LF5 L;  5C0X G;  2IWH A;  1I3Q H;  5C3X A;  3A54 A;  3G71 A;  1GVP A;  1HPC A;  4F7X A;  3NPP A;  2N88 A;  2R7F A;  4GN5 A;  3IKJ A;  1ZYR D;  4GS3 A;  3OWF A;  2WIN B;  3BVM A;  1EQR A;  1TWA B;  2PI2 E;  1GHK A;  5COY A;  1FL0 A;  1HCZ A;  1CK1 A;  1SMX A;  4L5R C;  2JJQ A;  2D9U A;  2EPB A;  5IYC H;  1F77 A;  2AQ2 B;  2OQ0 A;  1EOT A;  5JEA G;  1DJR D;  2NTS A;  5CBE E;  4IZ8 A;  4HSP A;  3Q22 A;  4IJL A;  2UXC L;  4IQZ A;  2EYO A;  2EXD A;  2Y0S E;  1K73 C;  1GKH A;  3M7G A;  4KHV A;  4AIM A;  4JV5 L;  1RKN A;  1PH4 A;  3K5O A;  4JVZ A;  3CXC A;  2F3I A;  3HOZ G;  1PRT F;  1QZG A;  5KRU A;  4LF7 L;  1CFM A;  3GV3 A;  4DV6 L;  2LSS A;  3HOZ B;  2HCC A;  3H6M A;  4KY6 A;  2E75 C;  2K52 A;  4DK3 C;  2BDO A;  3AYH B;  4OHJ A;  4DR7 Q;  4X62 Q;  4HJ9 A;  4K6L A;  1WD0 A;  1IW7 D;  3FHW A;  1WTH A;  3KBG A;  2ATW A;  4HCS A;  2B63 H;  3H3V C;  4JOI C;  3GTO B;  5C4J B;  1BO0 A;  1VQB A;  1ASY A;  1TWC B;  4IFD G;  1DON A;  2KEN A;  3K80 C;  2G5D A;  3J81 j;  4JG2 A;  2EYJ A;  2BE5 D;  1GXD C;  4HIK A;  1Y1V H;  3VR4 A;  5IT9 E;  3S2H B;  2TSS A;  1EEI D;  3K0X A;  2ZJR A;  1SND A;  2GN5 A;  3VDY A;  3MWY W;  3EA6 A;  2WKC A;  3IAY A;  2JA5 G;  1X9N A;  2BH2 A;  1PFB A;  3J7A F;  1HQM C;  2JA5 B;  1YNX A;  4G57 A;  2NWG A;  4GLA C;  5IWA L;  1F9S A;  3V05 A;  3NWS A;  1Q1E A;  3S1N H;  3HOW G;  5IYD H;  2GVB A;  1PTO D;  1SLJ A;  4CKE A;  1X3F A;  3HOW B;  3ERS X;  5C4X G;  5HGT A;  4I7A A;  4GKJ L;  1MJC A;  3U58 A;  4Q5V A;  3SEB A;  5C4X B;  5COR A;  1PYW D;  4JBW A;  2K03 A;  2N78 A;  4LF6 Q;  1A8V A;  4OO1 G;  3PQI A;  2IX0 A;  4OX9 L;  1BOS A;  2CQA A;  4DR1 L;  2BA1 A;  1WFQ A;  4UP8 A;  1U4R A;  3GTG H;  2IL8 A;  1S5D D;  1XWE A;  1EQV A;  3VYR A;  2PNH A;  1V1P A;  4IN3 A;  2NZO A;  3I91 A;  5HGQ A;  4AYB E;  3M3Y H;  4C2M B;  3FKI G;  4DV4 Q;  1ESF A;  1MSH A;  3F8T A;  3OTO Q;  1K8A C;  3BDC A;  1X3E A;  3R2I A;  1I50 B;  1YEZ A;  5TSS A;  2F3V A;  1AH9 A;  3FKI B;  1BCP C;  4DV3 Q;  4EQP A;  4ABN A;  4LFB Q;  1NUC A;  5CV5 A;  1D7Q A;  5DLQ E;  1TWH B;  1UAP A;  3PCO B;  4FP5 D;  4R9W A;  4ULL A;  3D8G A;  1SYF A;  3CF5 A;  4HMI A;  2RA4 A;  4KKU A;  3GTP H;  2HT1 A;  2XWJ B;  4RGO S;  2XRQ D;  1LTT D;  3PIO 3;  3TS2 A;  2R7Z H;  3KJO A;  3ULJ A;  3QOL A;  1Y14 B;  2F0U A;  2YU9 H;  4ALP A;  2VXW A;  2KCC A;  1XYI A;  2QKI C;  1RDP D;  4X3K A;  1G2S A;  3KLS A;  5JJI A;  3FMC A;  3SXH A;  3Q23 A;  5BN4 A;  4BY1 G;  3R93 A;  2VY3 A;  4IOC A;  4FXD A;  1HA5 A;  4YHH Q;  2QIL A;  4A3B H;  3H3V I;  4CDD C;  1LO5 D;  4CDF C;  4BY1 B;  3QOJ A;  4RG1 A;  3AB9 A;  4ME3 A;  2FFK B;  4NXN L;  2NTT A;  3CCM A;  4WJ4 A;  4K0K Q;  3BDL A;  1LT3 D;  1JMC A;  2K33 A;  1V1O A;  3NTH A;  4M8A A;  1LTR D;  2I0Q A;  2CFM A;  4DUY L;  1R9T B;  1Z6H A;  3X3M A;  3K7A H;  2KHJ A;  2YYZ A;  5ELE A;  3T1H Q;  3J80 c;  2VQF Q;  5CMD A;  3P1H A;  2HDM A;  1W6K A;  4KKS A;  2D0P A;  1QG7 A;  3RZO H;  4DNR B;  1D1K A;  4DV0 L;  4A3M G;  1IKM A;  1CTM A;  4GOP A;  3I4L A;  3L2P A;  3RD4 A;  2WP8 J;  3NEN A;  5JVH 3;  4A3M B;  1FVI A;  1STH A;  1PFS A;  4ZAI A;  3ER0 A;  1RF2 D;  1SE4 A;  1X6O A;  1Y1W H;  3R8B A;  4A3I H;  4RGT A;  1EQQ A;  2PPB C;  1JJG A;  2E8G A;  1B1Z A;  1U0L A;  5EBC A;  4NDX A;  2MP1 A;  3FVQ A;  5AFW A;  3K59 A;  5IP7 G;  4U67 3;  2HCI A;  2Z0S A;  3ND8 A;  3K5M A;  2OF1 A;  2FHT A;  5DM6 3;  1VQ6 A;  2EJG C;  1HXY D;  1SYE A;  1TXY A;  1QWY A;  1WOC A;  2IW3 A;  5HUR A;  4OWX B;  4E6I A;  2R61 A;  1YBY A;  3HS0 C;  4B3S Q;  4A93 H;  1J5E L;  3MXN B;  1TWG H;  2B2U C;  5EAY A;  2L5T A;  1F9R A;  3CHB D;  3P7J A;  4RMF A;  3F2D A;  4B3R L;  1F9Q A;  3I2Z A;  2GVA A;  5GQO A;  4A3F G;  3EQL C;  2B39 A;  4RAU C;  2NUC A;  2EZV A;  2TMP A;  3FPP A;  1PTO B;  1Q8K A;  3TP8 A;  4JI2 L;  4A3F B;  2ZJQ A;  1Y8O B;  3A8I E;  3TP6 A;  2CWP A;  3T1Y L;  2KA7 A;  1R4P B;  3BS1 A;  1EU4 A;  4P2C B;  1XNR L;  4JI8 L;  2VB2 X;  3ND9 A;  4MZ9 A;  3QJY A;  5FJ8 H;  5FO8 B;  2UXD Q;  4FF4 A;  2QDB A;  5CV7 A;  1DZ1 A;  3H0G H;  1JCK B;  1VS0 A;  3MXN A;  5GAH C;  4R4T A;  2AHO B;  1BCP D;  3U9O A;  4DR6 L;  4POF A;  3Q8D A;  1L1O C;  1AE3 A;  5EGT A;  3NWT A;  4LW1 A;  2RDH A;  2K5V A;  3TSS A;  2A6H C;  3K5N A;  2F3W A;  1XPO A;  4QF4 A;  2F0K A;  5LHY 1;  4L6T B;  2JA9 A;  3PSI A;  2KHS A;  2JYO A;  5IGD A;  2NBF A;  4IUT A;  1YJW A;  1LTL A;  1RHP A;  1G2T A;  2RCF A;  1E1T A;  1P8L A;  2MUY A;  1I4H A;  2EYM A;  2GA4 B;  4OXP A;  3J81 i;  2O5I C;  1U9R A;  1JOO A;  1YJN A;  2PI2 A;  1E0B A;  1IBK Q;  2RQX A;  2NVX H;  1LYL A;  5M5X H;  3EJI A;  3PIP 3;  3JAM c;  3SHL A;  1VQH A;  2OCE A;  1HNX L;  4JBM A;  3D4D A;  1U5K A;  2EYL A;  3GTJ B;  4I65 A;  1CT1 D;  1QUQ B;  4YY3 Q;  2DJG C;  4B3M L;  3HZX A;  4OWW B;  4IUR A;  5M3M G;  4LNQ A;  1WI5 A;  1Y8P B;  3URY A;  5IT9 L;  2CH4 W;  2WII B;  2OT2 A;  4XDX A;  3EN2 A;  4BA2 I;  3KLR A;  5M3M B;  3KK7 A;  3M4Q A;  2JP1 A;  2CVR A;  3I56 A;  3AEV A;  4MHE A;  2J4X A;  5FK9 C;  4X3U A;  1TS4 A;  2LFN A;  2NN6 I;  1I6V C;  2B3G A;  3UDX A;  1SYG A;  3S15 H;  4DAM A;  4HSV A;  4IJH A;  5IOD A;  3TP5 A;  1YNJ C;  3AMU A;  3KYH C;  3J7A 5;  4NXM L;  2K5N A;  3RN5 A;  3W1B A;  3C2P A;  1N33 L;  2E2J H;  3GTO H;  5C4J H;  1QUQ A;  3T56 B;  3WOF A;  1K0S A;  1T5X D;  2A74 C;  2DGY A;  4ILW A;  1I6H B;  4C1N I;  4JC0 A;  3A7L A;  3K81 C;  3V96 A;  1HR0 L;  5FLM G;  2RCN A;  4IFD H;  4GOP C;  4RWS C;  1OXT A;  2VQE L;  1H9M A;  4L5S A;  4YWL A;  4KKT A;  1C4Q A;  2EYF A;  3BVG A;  1QVC A;  1GD7 A;  1SE2 A;  2B2Y C;  1JOK A;  4ZKB B;  4V0B A;  4C3H G;  4ZLT F;  3FP9 A;  3CC4 A;  5EQ0 A;  1K8M A;  1E3P A;  3Q6S A;  1LTB D;  2JA5 H;  2BA0 A;  3SR1 A;  2X69 A;  1F2L A;  1S4Z A;  4C3H B;  2Q8R E;  4AH6 A;  2F4I A;  2A5H A;  4LF9 L;  1PFM A;  5D3I B;  1EIH A;  5C3W A;  4FF3 A;  2CWA A;  2EYP A;  4PZ8 A;  4UHV A;  1ILP A;  4DV7 L;  4KLK A;  4LF4 Q;  3NUC A;  5C44 H;  1IYU A;  1IKL A;  2EY2 A;  3AU7 A;  3ONA B;  2UUB L;  1LM0 A;  5KNB A;  2L11 A;  3RZD B;  2K5H A;  1KQS A;  4JOI A;  3KJP A;  1CKO A;  1TS3 A;  2KED A;  4HJA A;  5D65 A;  1DOK A;  1SAP A;  1VDZ A;  5FKA C;  4JI3 L;  3M4O B;  4PMB A;  4PMW A;  1CZW A;  1K8G A;  4GLV B;  3GTK B;  2ES2 A;  4A3G G;  2L0C A;  4HJ7 A;  2WV6 D;  4Y7N B;  4QGU A;  1CUK A;  1H9J A;  3S1M H;  4TVA B;  5FLX E;  3CU7 A;  3S17 B;  4A3G B;  4LFA L;  4FNF A;  4DV5 L;  5BR8 Q;  3TDQ A;  2IHF A;  4JI0 Q;  4CGY B;  3J81 c;  4PNY A;  3NSW A;  1EYC A;  3W5O A;  4ZCK A;  1G51 A;  1JT8 A;  1HZ9 A;  2BCO A;  2Q2U A;  1EZ6 A;  1HR0 W;  3RUZ A;  3I7F A;  3MAQ A;  4KHZ A;  4J1M A;  1LTI D;  1N32 Q;  4A3J G;  1CSP A;  2IT1 A;  2NVY B;  4C2M H;  4OEM B;  1S72 A;  1II3 A;  1KRS A;  4DU9 A;  3SVM A;  4DKA C;  1NMG A;  1FGB D;  2Z8L A;  4A3J B;  1IYJ B;  4FF2 A;  1S40 A;  5ELO A;  3MFY A;  3CCS A;  2OEO A;  4GKK Q;  1CI3 M;  2JEB I;  3CCE A;  1FNW A;  4A3L G;  4OON A;  5IY0 A;  3J81 E;  1CA5 A;  1BCP B;  2AWN A;  3VYT A;  1ILQ A;  4KMU C;  4BBR H;  3L3O C;  4LFC L;  3K8A A;  3RLN A;  3D4W A;  3BJU A;  1SXT A;  1PFN A;  5IGB A;  3RLF A;  2Q8I B;  4RHS A;  5M3F G;  2K5Q A;  1Q81 C;  1HTP A;  2F0W A;  1T5E A;  3BYT B;  2N8N A;  4IUN A;  2R7D A;  2EE1 A;  4HTH A;  5E4X A;  2AQ3 B;  4H02 A;  5M3F B;  3EFX D;  5ELF A;  1VMC A;  5FOB B;  5C4H A;  4QJF A;  4JI5 Q;  4FXK C;  3A8J E;  1B70 B;  4JYA Q;  4POG A;  1NCV A;  5JVG 3;  2MO0 A;  3K7U C;  5DM7 3;  4R8N A;  4C56 C;  1HQR D;  2FMC A;  3A5U A;  1EWH A;  4R4C A;  2F0I A;  2FJ2 A;  1AZQ A;  1SNC A;  1Q7Y C;  3K57 A;  1SNO A;  1YHA A;  1CHQ D;  1XMQ Q;  1GUT A;  1NR4 A;  1QJO A;  1SFO B;  1YNJ D;  4KY5 A;  4LUV A;  5C3E G;  1HZC A;  1C7Y A;  2KCT A;  5I2Y A;  3NBH B;  3S1R H;  2PW7 A;  4XTC S;  5C3E B;  3U50 C;  1QVF A;  1N34 L;  2F0H A;  1TY0 A;  4G7Z C;  1NNX A;  3G7L A;  4DUZ Q;  4X64 Q;  4DN4 M;  2VZA A;  1CQV A;  1MI2 A;  4L63 B;  1SNM A;  2MPM A;  2JA8 G;  2UXB Q;  1K28 A;  4V19 0;  2HQL A;  3BYY B;  2OXP A;  1X54 A;  5IGF A;  2CW0 C;  2JA8 B;  3VA5 A;  1STB A;  3PGZ A;  4A3M H;  4A3C G;  3N52 A;  2ENB A;  1FYC A;  4HID A;  4N8F A;  1JJ2 A;  3MXG A;  1GUW A;  2JN4 A;  4RGN A;  2NN6 G;  1AW7 A;  2DJF C;  3T53 B;  1VQ8 A;  4C3I H;  4A76 A;  1LT4 D;  3R3O A;  5AJ3 Q;  3OOC A;  5LMN L;  1XMO L;  4R4I A;  5JPM C;  3HOV H;  5ELC A;  3NBH A;  1X56 A;  3MTS A;  3TME A;  1Z7T A;  4X66 L;  3RLO A;  2PMZ B;  4DV1 Q;  3EIV A;  2MO1 A;  1WCM H;  1Z9F A;  2VS1 A;  3PO2 G;  2Q8T A;  2A68 D;  5IYB H;  1VQK A;  1QZH A;  1FNV A;  2F52 A;  2F0N A;  1HNW Q;  3PO2 B;  4IPC A;  5G3L F;  4U68 A;  2E2H B;  3OMC A;  1YHQ A;  3S2D B;  4JI4 Q;  4DR2 L;  1JB7 A;  4HJ8 A;  3I4M H;  4XQJ A;  1D5M C;  1D2B A;  4C3J G;  1A3U A;  5GAE C;  2B2T C;  3GDE A;  2WB1 E;  4DR4 L;  4QCL A;  2LKV A;  4PMC A;  2F0J A;  3TEH B;  4C3J B;  3S14 H;  1PTO H;  1Z47 A;  4A3F H;  4QL5 A;  2HHH Q;  1PYS B;  3TRZ A;  1DM0 B;  5M5W H;  2BDN A;  4NKL A;  2ZM6 L;  1IXR A;  3VYS A;  3I4N G;  2K01 A;  3B6Y A;  1L0W A;  2F0M A;  2ZXP A;  3CPF A;  1GM5 A;  2F4V L;  4AQY L;  1SE3 A;  2EOT A;  4LF8 L;  3I4N B;  3GV6 A;  1H9S A;  1JJC B;  1SYB A;  3TZD A;  5C6A A;  2XNA C;  2UUA L;  1WTQ A;  3HG9 A;  3PIO A;  2R93 G;  3LWU A;  4JBJ A;  5KIX A;  1FNU A;  2H5X A;  3MXU A;  1TT2 A;  4QIW E;  3I90 A;  1CA6 A;  3FRP B;  3ERQ A;  3M4P A;  3J80 i;  3DHQ A;  3S24 A;  1PH6 A;  5ELN A;  2R93 B;  3OIQ A;  1I4G A;  1WYD A;  2FMM A;  4LF5 Q;  3HKZ G;  5EKL A;  4Y52 H;  5LMN W;  2B2W C;  1BUV T;  1VQN A;  2MNA A;  3S1Q B;  4A3K B;  1V1P B;  2B2U A;  3HKZ B;  1L1O B;  2JE6 I;  1NY4 A;  2L9H A;  3I73 A;  1FJG L;  2F0V A;  1Y8N B;  2RSN A;  4FF1 A;  5KYI A;  1TQO A;  4Q0F A;  5KND A;  5KNC A;  4OL7 A;  2VUM G;  3G48 A;  1GHJ A;  3DWP A;  4RFB A;  2UXC Q;  4X65 L;  1IL8 A;  3LNN A;  3NTK A;  4KI0 A;  5ELB A;  2MQH A;  1JE5 A;  4LAA A;  3GO5 A;  2VUM B;  3CQZ H;  1G6P A;  4JV5 Q;  3TBI B;  4K0K L;  4JI6 L;  3GTJ H;  4WOR A;  2JQO A;  3N6R A;  2SOB A;  4LF7 Q;  3C1E A;  3PV0 A;  2UUC L;  1B44 D;  4DV6 Q;  3HOY G;  4K2L A;  4K2K A;  2I07 B;  2V4D A;  3PUV A;  4S3S A;  1UE5 A;  1SYC A;  1HTL D;  1L1O A;  4G7H C;  5LMU L;  4EQO A;  1ML0 D;  2ZJP A;  2UU9 L;  5M3M H;  3HOY B;  4M1U B;  1KHI A;  1TU2 B;  3DWQ A;  1KIX A;  2NZH A;  1F2Y A;  2I5L X;  1BBU A;  4DV2 L;  2IHE A;  4HCE A;  1D5X C;  1AEX A;  1F2Z A;  1LLR D;  1QIL A;  2QA4 A;  1SEB D;  1GO3 E;  4WFN 3;  1YJ9 A;  3F2C A;  1GOZ A;  3V2T A;  2NB0 A;  1TR5 A;  4DXG A;  1PTO F;  1HFN A;  2CHB D;  3HOX G;  2E5L L;  4R4Q A;  1U4L A;  1I6H H;  2AUK A;  2CW0 D;  1KDB A;  1W6J A;  1N8R C;  2PCF B;  5IP9 G;  3HOX B;  2DN8 A;  3T51 B;  4DK1 A;  3A0J A;  1EY6 A;  4JI1 L;  4QUF A;  1K83 H;  1ICF B;  3T16 A;  1E2W A;  3IFT A;  3MVV A;  4MTK A;  4UP7 A;  4HR7 B;  5FLX L;  4GOP B;  2K28 A;  1HZB A;  1J6Q A;  3PUW A;  1A3T A;  1KDC A;  4GKJ Q;  1S5E D;  1TKW B;  1EIF A;  1TII D;  2C35 B;  3OIP A;  5CR3 A;  2X6L A;  1HA6 A;  2OWO A;  4ODG A;  4DK0 A;  3JAM i;  3F2U A;  2FXQ A;  4H44 C;  2SNS A;  4O0A A;  1N9W A;  3GTM H;  3RZD H;  1EY9 A;  3CCQ A;  2D62 A;  1KL9 A;  4DR3 L;  4OX9 Q;  4KJO A;  3M4O H;  5JOB A;  4DR1 Q;  2MGS A;  4MN3 A;  3CCR A;  4L8J A;  3KDF B;  3K0Y A;  4ZUI A;  3GTK H;  4RCN A;  4QQB X;  4Y7N H;  2L4N A;  5K36 G;  2XGT A;  3J81 L;  3QWN A;  3M7N A;  1IBM L;  3S17 H;  1I3Q B;  1X3Q A;  3L0O A;  2NVT H;  3AFQ A;  2B2Y A;  2B2V C;  2Q2T A;  1HZA A;  3D0F A;  5I9P A;  3C46 A;  5H1S E;  1DYQ A;  5T1I A;  3U9S A;  4UP9 A;  3BVZ A;  3I55 A;  4X3T A;  2ZXO A;  3WWV A;  5IE8 A;  5CV8 A;  2NVY H;  2XSC A;  1NTG A;  1SBB B;  5L37 A;  1M1K C;  1ICW A;  3OYY A;  2ID0 A;  3J80 E;  1HRJ A;  3IL8 A;  4A3J H;  3PIP A;  2VB3 X;  3CW2 C;  4TSS A;  4A3E H;  1B4O A;  3KDF A;  3TN2 A;  1A63 A;  3PO3 G;  2E76 C;  1DXM A;  1VQF A;  5I9O A;  2Z6K C;  2XRS D;  1Q90 A;  3DLL A;  1O78 A;  2FIN B;  3PO3 B;  2WAQ E;  3U4Z A;  2HDL A;  1L2F A;  3DWA A;  2F0Q A;  4IO9 A;  1OTC A;  4FDB A;  2R92 G;  3M9B A;  3EVQ A;  1Q12 A;  1QNK A;  3H15 A;  2R92 B;  2KCM A;  2C9O A;  4CBV A;  2DUD A;  3VR2 A;  1JOR A;  1TS2 A;  3NQI A;  1E7Z A;  3SK8 A;  2QF7 A;  4EGV A;  1VQJ A;  4NPS A;  5I6W A;  3GTQ H;  2EJF C;  2M2L A;  1LT5 D;  2RF4 A;  3R2T A;  5F2D A;  2EIF A;  4NXN Q;  2Y0S G;  4HIO A;  1SR3 A;  1Y1V G;  3I72 A;  5CV4 A;  2K1B A;  2O2L D;  5T1G A;  2IJ0 A;  4A3D G;  3HRZ C;  4JI7 L;  2KEC A;  1WTW A;  3DM3 A;  2Y0S B;  1Y1V B;  2G9H D;  4A3D B;  2F0S A;  2R3Z A;  2F0G A;  1KAA A;  4RKB A;  2F0D A;  1CM9 A;  4DAP A;  1XNQ L;  2PW5 A;  1QNU A;  1YVC A;  2MJ8 A;  2F0P A;  2CH4 A;  5IGG A;  1NAP A;  1PXU A;  5IYD G;  4DV0 Q;  5C4Z A;  4R8I A;  5C0X H;  5JJZ A;  1NBW A;  4YWK A;  3PF4 A;  2PZU A;  5ISR A;  4CKC A;  2JEA I;  4GNX A;  3L7Z C;  3PUX A;  4GZY C;  1TWA H;  2L55 A;  3GTL B;  1EWI A;  3X3N A;  1FGU A;  2YTX A;  4DAV A;  1B7Y B;  2A8V A;  1G6Z A;  5HY6 A;  2JA8 H;  2QGQ A;  2K50 A;  2ALY B;  2AQ1 B;  3GQB A;  1IBL L;  5ELD A;  4OIK A;  2F0F A;  1QCB D;  1QB5 D;  4DR5 L;  3LGJ A;  4DA2 A;  2OQK A;  4C1N K;  1P16 A;  5JEA H;  1I94 L;  3JC6 6;  4WRD A;  1KRT A;  3MXP A;  1VQ7 A;  5FO9 B;  5EKI A;  2IPK D;  1QOH A;  1HNZ L;  4H13 C;  2K7V A;  4HMJ A;  3QR8 A;  1JC7 A;  2WFW A;  3FEW X;  4XXE A;  1YIJ A;  2RSO A;  2SDF A;  1J5E Q;  1I5F A;  3SK4 A;  1X32 A;  3H94 A;  3HOZ H;  2Z6B A;  4ZKC B;  3CCV A;  2XTI A;  3W3A A;  3QG1 A;  4EQ5 A;  4B3R Q;  1PRT C;  3P20 A;  3JAM E;  3PO2 H;  1C8C A;  1EEF D;  1UEA B;  4CJ2 C;  1C0A A;  5BR8 L;  1STN A;  4KHP L;  3A5Z B;  4B9W A;  3M3Y B;  4LUZ A;  2A73 B;  2E74 C;  3M4Y A;  1T9H A;  3T1Y Q;  2Z9H A;  2PO4 A;  1TWC H;  5CV6 A;  1OO9 B;  1TVX A;  1XNR Q;  2NVQ B;  1D8L A;  4YCV A;  2EJM A;  4JI8 Q;  1QVG A;  1SDF A;  2KOL A;  3S2H H;  5E3F A;  1O80 A;  2HIV A;  1HUN A;  2ZTC A;  3HEJ A;  2O4X A;  4DR6 Q;  2F0L A;  4B08 A;  3I4N H;  1YNN C;  1C48 A;  3J7Z C;  1PMR A;  4F88 A;  4NW2 A;  3KFU A;  3SK5 A;  3CPW A;  2OTL A;  1K3R A;  4DK6 C;  2EVB A;  1ZYR C;  3ITP A;  4AYB G;  4XIG S;  4UPA A;  1OXX K;  4YIJ A;  1Q86 C;  2KVM A;  4JK1 C;  4AYB B;  3HOW H;  4B3T L;  1YIT A;  4PQX A;  1JQY D;  3PUY A;  3NTI A;  4IFD I;  1DOL A;  2N3S A;  2KHI A;  1EOV A;  5C4X H;  1E24 A;  2B2T A;  1PHJ A;  4JYA L;  1KAB A;  2K6A A;  1OXS C;  5A2Q E;  1HNX Q;  1JR0 D;  4K8J A;  4YCU A;  4ZUJ A;  2Z4H A;  4TQU S;  1N36 L;  2K4K A;  1HH2 P;  1FD7 D;  1A6X A;  3NXW A;  4B3M Q;  4HAE A;  1EFW A;  4OO1 H;  3K7A B;  2ZXR A;  4WJ3 M;  2JSO A;  3MFG A;  2LY7 A;  5KEE A;  2M00 A;  1SRU A;  1MSG A;  4P73 A;  5BN5 A;  1NE3 A;  3G6J B;  1BKB A;  4IPH A;  3RZO B;  2R6G A;  1VMP A;  1RD9 D;  2A6H D;  3UDF A;  2VNU D;  2LXK A;  1DD2 A;  1I50 H;  2PNR C;  1PZJ D;  3FKI H;  2B2W A;  1ENC A;  3BG3 A;  4JPB W;  4NXM Q;  3K58 A;  4JW0 A;  1N33 Q;  1TWH H;  3DEP A;  4N8X 1;  2K5D A;  2D5D A;  3MA2 B;  3STB C;  2DNE A;  1SNP A;  2AWO A;  1ZXT A;  4ZYS A;  2RDG A;  5J3B A;  4RCO A;  5CYU A;  2VQE Q;  1WTR A;  2XIW A;  3TRE A;  4DGZ A;  2HIX A;  4NMZ A;  4GNX C;  4DXF A;  2CQO A;  5EPJ A;  1KC8 C;  3HOX H;  1S5F D;  3CME A;  1MHW C;  1I4P A;  1PTO C;  1STG A;  4IUP A;  4HIM A;  1PH3 A;  1QE6 A;  1W2B A;  4JBK A;  3QB3 A;  3BZK A;  4H0L C;  4DR7 L;  4X62 L;  1AE2 A;  4LF9 Q;  3MC0 B;  3A55 A;  1B50 A;  4KN7 C;  3E5S A;  4JI4 L;  2B29 A;  2EY1 A;  2LMC B;  4BS9 A;  3BDO A;  4HJ5 A;  1E2Z A;  2JA7 G;  4BY1 H;  4NP5 A;  1CHP D;  1LAC A;  4DF7 A;  1PRT D;  3HFZ B;  5FJ8 G;  1GUO A;  1UE6 A;  4IFD J;  2UUB Q;  4WJW A;  1PA6 A;  2JA7 B;  3NE5 B;  1E1O A;  1XXG A;  2KJX A;  5CC4 A;  4YCW A;  4ZK9 B;  3MEH A;  4BY7 G;  3VR5 A;  1YHB A;  4JI3 Q;  3J80 L;  5I4D A;  3NBI A;  4H7B A;  1R9T H;  4BY7 B;  1CKM A;  1CZG A;  4TRD A;  4KN4 C;  5JJL A;  2WAC A;  4KD4 A;  4OEL B;  2I5H A;  3DMU A;  2ICE C;  5FO7 B;  4QUC A;  4DV5 Q;  1VQM A;  1UE7 A;  3EBE A;  2QEJ C;  3W1G A;  1I4R A;  1WTO A;  1FR3 A;  1UUP A;  4BBS G;  2AKW B;  1YNN D;  4CDC C;  3PF5 A;  4Z9C B;  5K36 H;  2EYH A;  4CDE C;  2Z1C A;  4BBS B;  1EUJ A;  2H4O A;  3S16 B;  3RN2 A;  2KEE A;  3BZD B;  1VQP A;  1VQD A;  1B9N A;  3MZ5 A;  2F1M A;  1IL2 A;  2NVX B;  1U4M A;  5M5X B;  3H09 A;  3E9H A;  3I4O A;  3E9I A;  4PZ6 A;  2D2C C;  4LF6 L;  1EFI D;  5NUC A;  5JJK A;  1XX8 A;  4ME5 A;  4NB3 A;  4UY8 C;  1H9K A;  4RHR A;  1H9S B;  1ROD A;  4K14 A;  4EVO A;  5IP7 H;  3MEF A;  2I46 A;  1BF4 A;  2A19 A;  2DY8 A;  4UDU C;  2PZW A;  3ERO A;  4LFC Q;  3K5L A;  3KLW A;  5A35 A;  3PO3 H;  2IY5 B;  1WVL A;  3Q24 A;  5IT9 c;  1TWF B;  3GD7 A;  3RMH A;  3CCU A;  1O7L A;  3OW2 A;  5K5P A;  1VCI A;  3KF6 B;  4DV4 L;  3OTO L;  1B9M A;  5JAV A;  1PH2 A;  1RIP A;  3S15 B;  1UE1 A;  2JK8 A;  4PV1 C;  1G91 A;  2J0T D;  1L0Y B;  2R92 H;  4DV3 L;  4LFB L;  2B2V A;  3AFP A;  3I70 A;  3A74 A;  1BDO A;  3FDT A;  2E2J B;  1MIU A;  4BXX G;  2ZTE A;  1SJE D;  4B9X A;  4K5W A;  2K75 A;  1ONL A;  1B3Q A;  1DGS A;  4R1J A;  5EPL A;  1E22 A;  2B8F A;  2Q2I A;  4A3D H;  4A3K G;  3CC2 A;  1N34 Q;  3STB D;  2RKS A;  4EQN A;  3KF6 A;  2N55 A;  1EY7 A;  2RHQ B;  2Z6K A;  3A8K E;  1STA A;  1O7I A;  2F0E A;  4APV A;  3DEO A;  1K3B C;  1GUG A;  2L15 A;  2JA6 G;  1Q46 A;  1LTS D;  1PH9 A;  2YTY A;  3OW7 A;  5GRO A;  2JA6 B;  5C44 G;  3JAM L;  2OTJ A;  1VQA A;  4YHH L;  2K5W A;  5LL6 S;  3S9W A;  1VQ4 A;  1VQE A;  3GTL H;  1EIG A;  1J9O A;  5C44 B;  5J22 A;  1E2V A;  2AUJ D; 
#chains in the Genus database with same CATH homology
 4CJ0 B;  1AN8 A;  4FXG C;  2A69 C;  4KY7 A;  4CHT B;  4K5X A;  4FVM A;  2XWB B;  1JWM D;  5LL6 X;  2X6G A;  3FPU B;  3S1M B;  5KGU A;  4KK7 A;  1O7Z A;  3J7A V;  5DNF A;  5IOC A;  1LV9 A;  4IAL A;  1BR9 A;  3C1F A;  3LX0 A;  4UAI A;  1M8A A;  1EWC A;  3D31 A;  1B2T A;  5CV9 A;  1CQF A;  2QCP X;  2RBM A;  3DUZ A;  3QIA A;  5I6Y A;  3I3C A;  1XTC D;  1A3V A;  1PRT B;  2F03 A;  3MHB A;  2KQ3 A;  4ZRZ A;  1NR2 A;  3O13 A;  3DXJ C;  2M9V A;  1PLF A;  5A2Q L;  2G9D A;  1HFG A;  1GUN A;  5CBA E;  1RJT A;  4BBR B;  2PZT A;  1VF7 A;  3E6Z X;  5J1Z A;  3QO2 A;  1ZKO A;  1HHV A;  1TY2 A;  4LMQ D;  5IGC A;  4XYQ A;  2J7Z A;  3M85 A;  1IHZ A;  1JWU D;  2H1E A;  3CRK C;  4LJZ C;  4G7O C;  1B53 A;  3TP7 A;  1BQQ T;  2E2I B;  3WDN A;  5IIF A;  2EDG A;  1DOM A;  1WD1 A;  2EXZ A;  4KTA A;  2WKD A;  1SYD A;  3HOU B;  3OHX C;  1F2M A;  3S1R B;  5M5Y B;  2EY6 A;  5JPN C;  3ZYY X;  1ENF A;  3CKI B;  1NSN S;  1V8Q A;  1EY8 A;  2SNM A;  3A56 A;  4BA1 I;  4IUV A;  1KNA A;  1RCV D;  1Y69 U;  2RDF A;  4C3I G;  2ZT9 C;  4F8M A;  3PMF A;  5DAU A;  3WOE A;  1JE4 A;  3VR3 A;  3C3L A;  5D3D A;  4C3I B;  3T13 A;  3HOV B;  5DEH A;  3KF8 A;  1B3A A;  5D14 A;  3A7A B;  4O1N A;  3HGB A;  3NQT A;  1WCM B;  1R4Q B;  3OMG A;  2A6E C;  2F0O A;  1UNS A;  2B8G A;  4FYD A;  4FO2 A;  2A69 D;  4K8I A;  1S5C D;  3NHH A;  4XQQ A;  4K5V A;  1SNQ A;  3I4M B;  1A2T A;  2B63 B;  1Q1B A;  1A15 A;  1EZ8 A;  3UI2 A;  1RTO A;  2K04 A;  3S14 B;  3D6C A;  1S5B D;  1X3P A;  1F9P A;  2MHV A;  3NK9 A;  5M5W B;  1Q8I A;  1SJH D;  2XN9 C;  3Q0A A;  4RKL A;  1MGS A;  3D4R A;  1EL0 A;  4O42 A;  1WTP A;  1BNZ A;  1Q3L A;  4KD3 A;  5CGK A;  1LAB A;  2IX3 A;  1JOQ A;  3S1N B;  1SMY C;  5C5L A;  3SDZ A;  1PZI D;  4F87 A;  3SE0 A;  3OSO A;  3J7Y W;  4J8Q A;  1STY A;  4LK1 C;  4IUQ A;  1V43 A;  2WB1 B;  5EBD A;  1MBY A;  4RGM A;  2PQE A;  2DNC A;  3CRL C;  2NN6 H;  3E0J A;  4XT3 B;  1EQT A;  2O5J C;  1KDA A;  2PYK A;  3PUZ A;  3CQZ B;  1KNE A;  5C0X I;  1D6E C;  3KLS X;  3GP7 A;  3GTG B;  3KUP A;  3VYU A;  2L12 A;  3LWE A;  3D6W A;  3IFD A;  4QIW B;  2ICI A;  1BCP F;  4K6D A;  3D3R A;  4XT1 B;  3I8Z A;  1SSO A;  2NYZ D;  1WTX A;  2E2D C;  4QMG A;  1JIC A;  2C5C A;  1EY5 A;  1KTK A;  3H91 A;  4X3S A;  2DY7 A;  3L9A X;  3GTP B;  1ENA A;  3T4A C;  4XQN A;  2R7Z B;  1ET9 A;  1AFP A;  1STE A;  1OXU A;  3SK6 A;  5E4W C;  2YU9 B;  3OPO A;  1K83 B;  4XYO A;  5EKK A;  2SEB D;  3DM1 A;  4TKO B;  1HUM A;  2JXM B;  5EJW A;  5E1F A;  1AZP A;  3OWE B;  4CKB A;  1K8O A;  4A3B B;  1L0X B;  4HN7 A;  1EU3 A;  2A6E D;  1LTA D;  1RTN A;  4N9P A;  1GUS A;  1JB3 A;  1D5Z C;  1KLU D;  5I2X A;  3K6O A;  2A68 C;  4I7Z C;  3GTM B;  1TS5 A;  4KJN A;  4DFA A;  4DAY A;  1KLG D;  1PDQ A;  1EYD A;  1U4P A;  1WTV A;  3W2D A;  1J8I A;  2XVS A;  1IW7 C;  3HP3 A;  4KV6 A;  4CJ1 B;  4ZQ3 A;  5C0X J;  1G29 1;  1EYA A;  4OIJ A;  3VR6 A;  1D1I A;  1EY0 A;  3KBX A;  5BN3 A;  1BBX C;  4DNT B;  2F0T A;  2NVT B;  2BE5 C;  4HED A;  1JWS D;  1Y1W B;  1LTG D;  1I4Q A;  4A3I B;  5JEA J;  1SMY D;  4OGQ C;  3TZU A;  1BXT A;  4OO1 I;  4IUU A;  1ZEQ X;  5EPK A;  1M4V A;  2K05 A;  4N9T A;  4RA8 A;  4A3E B;  4RH6 A;  2Z4I A;  4BWG B;  1O7Y A;  1G8Z D;  1I4X A;  1ET6 A;  1VF5 C;  2LS0 1;  1GJX A;  4A93 B;  1TWG B;  3NP8 A;  2HUG A;  3VA7 A;  2IX1 A;  4ID6 A;  2KCN A;  5IGE A;  4QB4 A;  2NZ1 D;  5KYL A;  4MIU A;  1LT6 D;  2L1B A;  2HQE A;  2K32 A;  1DCZ A;  1A2U A;  2RVL A;  5M9O A;  3P75 A;  1PZK D;  1H9R A;  1OXV A;  3GTQ B;  1ESR A;  3H0G B;  5C5M A;  5J39 A;  5G3L D;  2EY5 A;  1IYV A;  2KUM A;  2BOS A;  1EY4 A;  4G4K A;  1AP0 A;  1MD2 D;  2WAQ B;  4J6H A;  5C0X G;  2IWH A;  5C3X A;  3A54 A;  1HPC A;  4F7X A;  3NPP A;  2N88 A;  3IKJ A;  1ZYR D;  3OWF A;  2WIN B;  3BVM A;  1TWA B;  1GHK A;  5COY A;  1HCZ A;  1CK1 A;  2D9U A;  2EPB A;  1F77 A;  2AQ2 B;  1EOT A;  5JEA G;  1DJR D;  2NTS A;  5CBE E;  4IZ8 A;  4HSP A;  3Q22 A;  4IQZ A;  2EYO A;  3M7G A;  4KHV A;  1RKN A;  3K5O A;  1PRT F;  5KRU A;  1CFM A;  3GV3 A;  3HOZ B;  2HCC A;  3H6M A;  4KY6 A;  2E75 C;  2BDO A;  4OHJ A;  4K6L A;  1WD0 A;  1IW7 D;  3KBG A;  4HCS A;  3H3V C;  3GTO B;  5C4J B;  1BO0 A;  1TWC B;  4IFD G;  1DON A;  2EYJ A;  2BE5 D;  1GXD C;  5IT9 E;  3VR4 A;  3S2H B;  2TSS A;  1EEI D;  1SND A;  3MWY W;  3EA6 A;  2WKC A;  3IAY A;  1PFB A;  3J7A F;  1HQM C;  2JA5 B;  4G57 A;  2NWG A;  1F9S A;  3V05 A;  3NWS A;  1Q1E A;  1PTO D;  4CKE A;  3HOW B;  5HGT A;  4Q5V A;  3SEB A;  5C4X B;  5COR A;  1PYW D;  4JBW A;  2K03 A;  4OO1 G;  2IX0 A;  1BOS A;  2CQA A;  2BA1 A;  1U4R A;  2IL8 A;  1S5D D;  1XWE A;  1EQV A;  3VYR A;  1V1P A;  4IN3 A;  3I91 A;  4C2M B;  1ESF A;  1MSH A;  3BDC A;  3R2I A;  1I50 B;  5TSS A;  2F3V A;  3FKI B;  1BCP C;  4EQP A;  4ABN A;  1NUC A;  5CV5 A;  1TWH B;  1UAP A;  4FP5 D;  4R9W A;  4ULL A;  3D8G A;  1SYF A;  4HMI A;  2RA4 A;  4KKU A;  2XWJ B;  4RGO S;  2XRQ D;  1LTT D;  3PIO 3;  3QOL A;  2F0U A;  2VXW A;  2KCC A;  1XYI A;  2QKI C;  1RDP D;  4X3K A;  1G2S A;  3KLS A;  3FMC A;  3SXH A;  3Q23 A;  5BN4 A;  3R93 A;  4FXD A;  1HA5 A;  2QIL A;  1LO5 D;  4BY1 B;  3QOJ A;  3AB9 A;  2FFK B;  2NTT A;  3BDL A;  1LT3 D;  2K33 A;  1V1O A;  3NTH A;  4M8A A;  1LTR D;  1R9T B;  1Z6H A;  3X3M A;  2YYZ A;  5ELE A;  5CMD A;  3P1H A;  2HDM A;  1W6K A;  4KKS A;  1QG7 A;  4DNR B;  1D1K A;  1IKM A;  1CTM A;  3I4L A;  3RD4 A;  2WP8 J;  5JVH 3;  4A3M B;  1STH A;  4ZAI A;  1RF2 D;  1SE4 A;  3R8B A;  4RGT A;  2PPB C;  1B1Z A;  5EBC A;  4NDX A;  2MP1 A;  3FVQ A;  5AFW A;  3K59 A;  4U67 3;  2HCI A;  3ND8 A;  3K5M A;  2OF1 A;  2FHT A;  5DM6 3;  2EJG C;  1HXY D;  1SYE A;  5HUR A;  1QWY A;  2IW3 A;  4E6I A;  2R61 A;  3HS0 C;  2B2U C;  2L5T A;  1F9R A;  3CHB D;  3P7J A;  1F9Q A;  3EQL C;  2B39 A;  4RAU C;  2NUC A;  2EZV A;  2TMP A;  3FPP A;  1PTO B;  3TP8 A;  4A3F B;  1Y8O B;  3A8I E;  3TP6 A;  2KA7 A;  1R4P B;  3BS1 A;  1EU4 A;  4P2C B;  2VB2 X;  3ND9 A;  3QJY A;  5FO8 B;  4FF4 A;  2QDB A;  5CV7 A;  1DZ1 A;  1JCK B;  3MXN A;  1BCP D;  3U9O A;  5EGT A;  3NWT A;  2RDH A;  3TSS A;  2A6H C;  3K5N A;  2F3W A;  4QF4 A;  2F0K A;  5LHY 1;  4L6T B;  2KHS A;  2JYO A;  5IGD A;  2NBF A;  4IUT A;  1RHP A;  1G2T A;  2MUY A;  1I4H A;  2EYM A;  2GA4 B;  2O5I C;  1U9R A;  1JOO A;  1E0B A;  2RQX A;  3EJI A;  3PIP 3;  3SHL A;  3D4D A;  2EYL A;  3GTJ B;  4I65 A;  1CT1 D;  3HZX A;  4IUR A;  1Y8P B;  3URY A;  5IT9 L;  2WII B;  2OT2 A;  4XDX A;  4BA2 I;  3KLR A;  5M3M B;  3KK7 A;  2JP1 A;  2CVR A;  4MHE A;  2J4X A;  5FK9 C;  4X3U A;  1TS4 A;  2LFN A;  2NN6 I;  1I6V C;  1SYG A;  4HSV A;  5IOD A;  3TP5 A;  1YNJ C;  3AMU A;  3C2P A;  3T56 B;  3WOF A;  1T5X D;  2A74 C;  4ILW A;  1I6H B;  4C1N I;  3A7L A;  3V96 A;  4IFD H;  4RWS C;  1OXT A;  1H9M A;  4KKT A;  1C4Q A;  2EYF A;  3BVG A;  1SE2 A;  2B2Y C;  1JOK A;  4ZKB B;  4V0B A;  4C3H G;  4ZLT F;  5EQ0 A;  1K8M A;  3Q6S A;  1LTB D;  2BA0 A;  3SR1 A;  2X69 A;  1F2L A;  1S4Z A;  4C3H B;  2Q8R E;  2F4I A;  2A5H A;  1PFM A;  5D3I B;  1EIH A;  5C3W A;  4FF3 A;  2EYP A;  1ILP A;  3NUC A;  1IYU A;  1IKL A;  2EY2 A;  3AU7 A;  3ONA B;  5KNB A;  2L11 A;  3RZD B;  2KED A;  1TS3 A;  5D65 A;  1DOK A;  1SAP A;  1VDZ A;  5FKA C;  3M4O B;  4PMB A;  4PMW A;  1CZW A;  3GTK B;  2L0C A;  2WV6 D;  4Y7N B;  1H9J A;  5FLX E;  3CU7 A;  3S17 B;  4A3G B;  4FNF A;  3TDQ A;  4CGY B;  4PNY A;  3NSW A;  1EYC A;  2BCO A;  1EZ6 A;  3RUZ A;  3MAQ A;  4KHZ A;  4J1M A;  1LTI D;  2IT1 A;  2NVY B;  1II3 A;  4DU9 A;  3SVM A;  1FGB D;  2Z8L A;  4A3J B;  4FF2 A;  3MFY A;  2OEO A;  1CI3 M;  2JEB I;  1FNW A;  3J81 E;  1CA5 A;  1BCP B;  2AWN A;  3VYT A;  1ILQ A;  4KMU C;  3L3O C;  3D4W A;  1SXT A;  1PFN A;  5IGB A;  3RLF A;  2Q8I B;  4RHS A;  2K5Q A;  1HTP A;  2F0W A;  1T5E A;  3BYT B;  4IUN A;  2EE1 A;  4HTH A;  5E4X A;  2AQ3 B;  5M3F B;  3EFX D;  5ELF A;  1VMC A;  5FOB B;  5C4H A;  4FXK C;  3A8J E;  1NCV A;  5JVG 3;  5DM7 3;  4R8N A;  4C56 C;  1HQR D;  2FMC A;  1EWH A;  2F0I A;  2FJ2 A;  1AZQ A;  1SNC A;  3K57 A;  1SNO A;  1CHQ D;  1GUT A;  1NR4 A;  1QJO A;  1SFO B;  1YNJ D;  4KY5 A;  5I2Y A;  2PW7 A;  4XTC S;  5C3E B;  2F0H A;  1TY0 A;  4G7Z C;  3G7L A;  4DN4 M;  1CQV A;  1MI2 A;  4L63 B;  1SNM A;  2MPM A;  4V19 0;  3BYY B;  2OXP A;  5IGF A;  2CW0 C;  2JA8 B;  3VA5 A;  1STB A;  3N52 A;  2ENB A;  1FYC A;  3MXG A;  1GUW A;  4RGN A;  2NN6 G;  1AW7 A;  3T53 B;  1LT4 D;  3R3O A;  3OOC A;  5JPM C;  5ELC A;  3NBH A;  3MTS A;  3TME A;  1Z7T A;  2PMZ B;  2Q8T A;  2A68 D;  1FNV A;  2F0N A;  3PO2 B;  5G3L F;  4U68 A;  2E2H B;  3OMC A;  3S2D B;  4XQJ A;  1D5M C;  1D2B A;  4C3J G;  1A3U A;  2B2T C;  4QCL A;  2LKV A;  4PMC A;  2F0J A;  4C3J B;  1PTO H;  1Z47 A;  1DM0 B;  2BDN A;  4NKL A;  3VYS A;  2K01 A;  2F0M A;  2ZXP A;  1SE3 A;  2EOT A;  3I4N B;  3GV6 A;  1H9S A;  1SYB A;  3TZD A;  5C6A A;  2XNA C;  1WTQ A;  3HG9 A;  3LWU A;  5KIX A;  1FNU A;  3MXU A;  1TT2 A;  3I90 A;  1CA6 A;  3FRP B;  3ERQ A;  3DHQ A;  2R93 B;  3OIQ A;  1I4G A;  2FMM A;  5EKL A;  2B2W C;  1BUV T;  3S1Q B;  4A3K B;  1V1P B;  2B2U A;  3HKZ B;  2JE6 I;  2L9H A;  3I73 A;  2F0V A;  1Y8N B;  2RSN A;  4FF1 A;  5KYI A;  1TQO A;  4Q0F A;  5KND A;  5KNC A;  4OL7 A;  1GHJ A;  3DWP A;  4RFB A;  1IL8 A;  3LNN A;  3NTK A;  4KI0 A;  5ELB A;  4LAA A;  3GO5 A;  2VUM B;  3TBI B;  4WOR A;  3N6R A;  2SOB A;  3C1E A;  3PV0 A;  1B44 D;  4K2L A;  4K2K A;  2I07 B;  2V4D A;  3PUV A;  4S3S A;  1SYC A;  1HTL D;  4G7H C;  4EQO A;  1ML0 D;  3HOY B;  4M1U B;  1TU2 B;  3DWQ A;  1F2Y A;  4HCE A;  1D5X C;  1AEX A;  1F2Z A;  1LLR D;  1QIL A;  1SEB D;  4WFN 3;  1GOZ A;  3V2T A;  2NB0 A;  1TR5 A;  4DXG A;  1PTO F;  1HFN A;  2CHB D;  1U4L A;  2AUK A;  2CW0 D;  1KDB A;  1W6J A;  2PCF B;  3HOX B;  2DN8 A;  3T51 B;  4DK1 A;  1EY6 A;  4QUF A;  3T16 A;  1E2W A;  3IFT A;  3MVV A;  4HR7 B;  5FLX L;  2K28 A;  3PUW A;  1A3T A;  1KDC A;  1S5E D;  1TKW B;  1TII D;  3OIP A;  5CR3 A;  2X6L A;  1HA6 A;  4ODG A;  4DK0 A;  3F2U A;  4H44 C;  2SNS A;  1EY9 A;  2D62 A;  4KJO A;  5JOB A;  2MGS A;  4MN3 A;  4L8J A;  3K0Y A;  4ZUI A;  4RCN A;  2L4N A;  5K36 G;  3J81 L;  3QWN A;  3M7N A;  1I3Q B;  1X3Q A;  2B2Y A;  2B2V C;  5I9P A;  3C46 A;  1DYQ A;  5T1I A;  3U9S A;  3BVZ A;  4X3T A;  2ZXO A;  5CV8 A;  2XSC A;  1SBB B;  1ICW A;  3J80 E;  2ID0 A;  1HRJ A;  3IL8 A;  2VB3 X;  4TSS A;  1B4O A;  3TN2 A;  2E76 C;  1DXM A;  5I9O A;  2XRS D;  1Q90 A;  1O78 A;  2FIN B;  3PO3 B;  2HDL A;  3DWA A;  2F0Q A;  3EVQ A;  1Q12 A;  1QNK A;  2R92 B;  2C9O A;  4CBV A;  3VR2 A;  1JOR A;  1TS2 A;  3NQI A;  3SK8 A;  2QF7 A;  4EGV A;  5I6W A;  2EJF C;  2M2L A;  1LT5 D;  3R2T A;  5F2D A;  5CV4 A;  3I72 A;  5T1G A;  2K1B A;  2O2L D;  2IJ0 A;  3HRZ C;  2KEC A;  1WTW A;  2Y0S B;  1Y1V B;  2G9H D;  4A3D B;  2F0S A;  2R3Z A;  2F0G A;  1KAA A;  4RKB A;  2F0D A;  1CM9 A;  4DAP A;  2PW5 A;  1QNU A;  2MJ8 A;  2F0P A;  5IGG A;  1NAP A;  1PXU A;  5C4Z A;  4R8I A;  5C0X H;  5JJZ A;  2PZU A;  5ISR A;  4CKC A;  2JEA I;  3L7Z C;  3PUX A;  4GZY C;  2L55 A;  3GTL B;  3X3N A;  4DAV A;  1G6Z A;  3GQB A;  2AQ1 B;  5ELD A;  4OIK A;  2F0F A;  1QCB D;  1QB5 D;  4DA2 A;  4C1N K;  5JEA H;  4WRD A;  3MXP A;  5FO9 B;  5EKI A;  2IPK D;  1QOH A;  4H13 C;  2K7V A;  4HMJ A;  1JC7 A;  3FEW X;  4XXE A;  2RSO A;  2SDF A;  3SK4 A;  1X32 A;  3H94 A;  4ZKC B;  3W3A A;  3QG1 A;  1PRT C;  3P20 A;  3JAM E;  1C8C A;  1EEF D;  1UEA B;  4CJ2 C;  1STN A;  4B9W A;  3M3Y B;  2A73 B;  2E74 C;  3M4Y A;  2PO4 A;  5CV6 A;  1OO9 B;  1TVX A;  2NVQ B;  2EJM A;  1SDF A;  2KOL A;  5E3F A;  1O80 A;  1HUN A;  3HEJ A;  2O4X A;  2F0L A;  4B08 A;  1YNN C;  1C48 A;  1PMR A;  4F88 A;  4NW2 A;  3SK5 A;  2EVB A;  1ZYR C;  3ITP A;  4XIG S;  1OXX K;  4YIJ A;  2KVM A;  4JK1 C;  4AYB B;  4PQX A;  1JQY D;  3PUY A;  3NTI A;  4IFD I;  1DOL A;  2B2T A;  1KAB A;  2K6A A;  1OXS C;  5A2Q E;  1JR0 D;  4K8J A;  4ZUJ A;  2Z4H A;  4TQU S;  1A6X A;  1FD7 D;  3NXW A;  4HAE A;  4OO1 H;  3K7A B;  2ZXR A;  2JSO A;  3MFG A;  2LY7 A;  5KEE A;  2M00 A;  1MSG A;  5BN5 A;  3G6J B;  3RZO B;  2R6G A;  1VMP A;  1RD9 D;  2A6H D;  2VNU D;  1DD2 A;  2PNR C;  1PZJ D;  2B2W A;  1ENC A;  3BG3 A;  3K58 A;  3DEP A;  2K5D A;  2D5D A;  3MA2 B;  2DNE A;  1SNP A;  2AWO A;  1ZXT A;  4ZYS A;  2RDG A;  4RCO A;  5CYU A;  1WTR A;  2XIW A;  4DGZ A;  4NMZ A;  4DXF A;  5EPJ A;  1S5F D;  1I4P A;  1PTO C;  1STG A;  4IUP A;  1QE6 A;  3QB3 A;  4H0L C;  3MC0 B;  3A55 A;  1B50 A;  4KN7 C;  3E5S A;  2EY1 A;  2LMC B;  4BS9 A;  3BDO A;  1E2Z A;  4NP5 A;  1CHP D;  1LAC A;  4DF7 A;  1PRT D;  1GUO A;  4IFD J;  4WJW A;  2JA7 B;  3NE5 B;  1XXG A;  2KJX A;  5CC4 A;  4ZK9 B;  3MEH A;  3VR5 A;  3J80 L;  5I4D A;  3NBI A;  4H7B A;  4BY7 B;  1CZG A;  4TRD A;  4KN4 C;  2WAC A;  4KD4 A;  3DMU A;  2ICE C;  5FO7 B;  4QUC A;  2QEJ C;  1I4R A;  1WTO A;  1FR3 A;  1UUP A;  1YNN D;  4Z9C B;  5K36 H;  2EYH A;  2Z1C A;  4BBS B;  2H4O A;  3S16 B;  2KEE A;  3BZD B;  1B9N A;  3MZ5 A;  2F1M A;  2NVX B;  1U4M A;  5M5X B;  3H09 A;  2D2C C;  1EFI D;  5NUC A;  1XX8 A;  4ME5 A;  1H9K A;  4RHR A;  1H9S B;  1ROD A;  4K14 A;  4EVO A;  2I46 A;  1BF4 A;  2DY8 A;  4UDU C;  2PZW A;  3ERO A;  3K5L A;  5A35 A;  1WVL A;  3Q24 A;  1TWF B;  3GD7 A;  3RMH A;  1O7L A;  5K5P A;  1VCI A;  1B9M A;  5JAV A;  3S15 B;  4PV1 C;  1G91 A;  2J0T D;  1L0Y B;  2B2V A;  3I70 A;  1BDO A;  3FDT A;  2E2J B;  1SJE D;  4B9X A;  4K5W A;  1ONL A;  5EPL A;  2B8F A;  2RKS A;  4EQN A;  2N55 A;  1EY7 A;  3A8K E;  1STA A;  2F0E A;  3DEO A;  1GUG A;  1LTS D;  3OW7 A;  2JA6 B;  3JAM L;  2K5W A;  5LL6 S;  3S9W A;  1EIG A;  1J9O A;  5C44 B;  5J22 A;  1E2V A;  2AUJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...