5C4HA

Crystal structure of staphylococcal nuclease variant delta+phs i92h at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYHYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c4hA00
3T16A 5E1FA 3HEJA 3TMEA 5DEHA 2PZTA 2OF1A 3EROA 4K6DA 2F0TA 5IIFA 1NSNS 2KQ3A 1A2TA 1NUCA 2EYFA 3NK9A 4K8JA 4QB4A 2PZUA 4EQOA 3V2TA 3SXHA 5EGTA 1KDCA 2PW5A 2KHSA 3QOJA 5C3WA 4TRDA 2EYHA 3DMUA 4ZQ3A 3TP5A 3LX0A 3VA5A 1IHZA 2F0JA 5C3XA 1EYAA 1EY8A 2SOBA 2EY5A 5EKLA 3MVVA 5C4ZA 5I6YA 1F2YA 1SNDA 4K5WA 5IGBA 5KIXA 4QF4A 1EYDA 4DFAA 4F8MA 1A3TA 3OWFA 5C5LA 3D4DA 3MZ5A 3QB3A 5ISRA 3NHHA 3TP6A 5CV5A 1EY0A 3OMCA 4ME5A 2RKSA 4IALA 1F2ZA 5IGGA 1EZ6A 5KRUA 3ITPA 5J39A 1JORA 2EY1A 2HQEA 5K5PA 2EY2A 2WACA 1TR5A 3P75A 3TP7A 5CR3A 1A2UA 4ODGA 2F0OA 3MEHA 5CV4A 5J1ZA 2F0WA 5NUCA 3SK4A 2PQEA 3D4WA 4HTHA 5C6AA 3H6MA 4ZUIA 4KD4A 1II3A 1SNPA 3E5SA 5HURA 3SR1A 2F0IA 2F0UA 5CGKA 2F0PA 1EZ8A 3RUZA 4N9TA 1STGA 5JOBA 2F0LA 4DF7A 1JOKA 1AEXA 3S9WA 3MHBA 4KJNA 2PW7A 3BDCA 1SNCA 4B9WA 1SYEA 4K14A 4E6IA 2F0MA 4K5VA 4PNYA 5CC4A 4KY6A 4J6HA 3PMFA 4KD3A 5KGUA 2NUCA 2EYLA 5HGTA 4HMIA 5IGCA 2F3WA 1SYGA 5CV8A 1SNOA 3SK5A 2EYJA 3DHQA 1KABA 5JAVA 2F0EA 3ERQA 4PMBA 1SYCA 2LKVA 1STYA 3EJIA 2O4XA 4DGZA 5I9OA 2F0FA 1TQOA 2F0VA 4IUNA 3SK8A 2F3VA 5IGDA 3HZXA 1A3UA 4KV6A 2QDBA 2EYMA 3OSOA 4HMJA 3QOLA 4RKBA 4NDXA 5IOCA 2OXPA 5KYIA 5I6WA 2F0NA 4J1MA 5M9OA 4ZUJA 3D8GA 4KJOA 2OEOA 5CV6A 4QMGA 2ENBA 3U9OA 5C4HA 1RKNA 1KDAA 2EYPA 4KTAA 4N9PA 2F0KA 4S3SA 3P1HA 2EY6A 4K2LA 2SNMA 1ENAA 3C1EA 1EY5A 1EY9A 4WRDA 3NQTA 4KY5A 1ENCA 5IODA 1KDBA 4WORA 4I65A 2F0QA 3TP8A 5DAUA 4LAAA 3SK6A 4NP5A 2F0SA 2F0HA 2RBMA 1EQVA 3BDLA 3NP8A 4K5XA 4K8IA 2M00A 5CV9A 5I9PA 4IZ8A 1EY7A 2F0DA 1A3VA 5E3FA 3C1FA 4R8NA 1SYBA 2EYOA 4H7BA 3OMGA 1TT2A 5EKKA 4DU9A 2F0GA 4KHVA 5KYLA 1EYCA 1SNMA 4EQNA 1STBA 3EVQA 4NKLA 5CV7A 4ID6A 4MIUA 3T13A 4EVOA 1EY6A 2RDFA 1SNQA 3NUCA 2SNSA 4F7XA 3NXWA 4PMCA 4RKLA 5C5MA 4EQPA 4OL7A 1JOOA 4YIJA 3SHLA 5KEEA 1F2MA 1SYFA 3R3OA 1JOQA 1EY4A 2PYKA 1U9RA 4NMZA 5IGFA 4G57A 1STHA 5IGEA 4B9XA 1SYDA 3D6CA 4KY7A 5F2DA 3MXPA 1STAA 1STNA 4K2KA 5J22A 2PZWA 1KAAA 2EXZA
chains in the Genus database with same CATH superfamily
2WAQG 4DV2Q 3UDIA 1PH8A 2X69A 2O2LD 3GO5A 3OHXC 4R1JA 3PIO3 2BA1A 2KCCA 5CYUA 3Q8DA 4BBRH 2R93B 2AQ3B 5EKLA 2R92G 3KLSA 4A3LH 1GUWA 5FKAC 3D3RA 4DFAA 1PFMA 1V1QA 1UE1A 3MZ5A 4DXFA 1HNXL 2E76C 1HNZQ 1GVPA 3KYHC 3K7UC 2LS01 3I70A 4HJ7A 3I4NH 3HKZE 3PUYA 4DV4Q 3S14B 4KKUA 3S17H 4JG2A 1L0XB 2L9HA 3OW7A 4CDDC 4QL5A 4DAMA 1K9MC 2VY3A 3OPOA 4YY3L 2Q8TA 3I4MB 1VQ9A 4DV2L 1B9NA 1GOZA 2VL6A 5LHY1 2K1BA 2K32A 3I4MH 1STEA 1JOKA 3MHBA 1YBYA 4QIWB 4RGNA 1DGSA 2A6HC 1JJ2A 3SK8A 1HNZL 2CCZA 1KLGD 5I2YA 1U5KA 2WB1G 4P2CB 4DV4L 5C3EG 1DCZA 2B63B 5IYBG 3K7AH 1X3EA 1A63A 1CFMA 2OEOA 3VR3A 5T1IA 1TY0A 3S2HB 1KDAA 1W2BA 4A3GG 4K2LA 1RJTA 2H4OA 3CMAA 3VYRA 4KY5A 3D6WA 5ELNA 5FO9B 1LLRD 3H0GB 1DJRD 2MNAA 2ZXOA 2JA5B 2MPMA 5H1SE 1SMXA 3KFUA 1S5FD 3WWVA 5M3FH 1PXUA 2N55A 1BCPB 4H7BA 2HDMA 2ZM6Q 2F0GA 4O2DA 2RCNA 2K33A 4GLXA 1H9SB 3BS1A 4EVOA 2ZTEA 4UPAA 4A3MG 1CSQA 1NE3A 3NPPA 1SYFA 4LF9Q 1U9RA 1MSHA 2ZTCA 4DV0Q 2IHEA 1X55A 1STNA 5A35A 2EXZA 4C2MB 5DEHA 3ICEA 2KQ3A 1ASYA 3H3VH 5EGTA 1A0IA 4RH6A 4IURA 2LMCB 4B3SQ 2B2YA 4BBRG 4R8IA 2FJ2A 3T4AC 3NWSA 3MVVA 4PZ8A 4LUVA 1EYGA 2ZM6L 4DKAC 3AU7A 3RZDH 1FNWA 1LTSD 4M8AA 3OW2A 1S40A 4ME5A 4DR7Q 3UE0A 3I4NG 2K52A 3F2UA 2HQEA 5J3BA 1D1IA 4LF9L 4UP7A 1X54A 4DV0L 1PRTC 2F0WA 5JPNC 1HR0Q 2UXDQ 1SNPA 1X9NA 3KK7A 4HSVA 2BE5D 2F0UA 1N34Q 1K83B 4DAPA 1STGA 4IFDG 5C4XB 3W2DA 3RZOB 4YCUA 4OWWB 1HCZA 1SEBD 1LACA 4B3SL 1Q8KA 5D14A 5CC4A 1Q12A 1MJEA 4YWLA 2R7FA 1K0SA 3A7LA 4XQNA 1QZGA 1O80A 1D5MC 4XYQA 5C4XH 3SVMA 3RZOH 2SEBD 1PH5A 3VR2A 2QEJC 1T5XD 2VS1A 2KVMA 4RGOS 1VQIA 4PG3A 2IX0A 4C3HB 1TWAB 1XTCD 4DR7L 4K6LA 4JI6Q 4NDXA 1MI2A 3DUZA 5FLXL 4LF5Q 1HFNA 1EWHA 5IY0A 2ZXRA 4A3KB 1HR0L 2K5VA 1X56A 2UXDL 1N32Q 2K5QA 1BCPF 1Q90A 4BWGB 2A19A 4B3TQ 1N34L 1KNAA 3G7LA 2ZXPA 4OONA 4A3CH 4WORA 1F9RA 1PTOB 4HSPA 4NP5A 3RUZA 3BDLA 1LTAD 3CRKC 1PFSA 3T1HQ 3MFYA 3MXGA 1R9TH 4OELB 1VQ8A 4GNXB 3T13A 2E2IH 1J6QA 4JI6L 4WFN3 1JOOA 4Q5VA 1Y1WG 1CHQD 2L12A 3G6EA 1R4QB 3OYYA 2DJFC 5E7NA 2A73B 3BJUA 4LF5L 4ZKBB 3S1QB 5KNCA 1STAA 1N32L 1C7YA 2XWBB 2OF1A 2LSSA 4B3TL 3S1QH 3CMEA 3MXNA 2PZUA 3PUVA 4A3IG 4OHJA 2JEBI 4IJLA 2K7VA 4CGYB 2L4NA 1IHZA 2F0JA 2R7DA 1EYAA 4DAYA 1LTGD 2EY5A 4FF2A 3M4OB 2NZHA 3P7JA 1K8MA 3M4YA 3RLNA 3T1HL 3GTOB 1PH9A 1LTLA 3MWYW 4GN3B 1PTOD 2KECA 4P72A 3GTOH 2AKWB 4H0LC 1WTOA 2R7ZB 1JORA 1RL2A 1AFPA 1KLUD 2VB3X 2PI2E 1EIFA 3E0EA 3Q24A 1WTPA 4CDFC 3KDFB 3D4WA 3H6MA 3IAYA 1ZYRC 2K75A 1JQYD 1SE3A 4HJ5A 3NBHB 4DF7A 4X3UA 4B9WA 1SYEA 1SE2A 3U4VA 2B2TC 1VDZA 2MP1A 3I55A 2RCFA 5IGCA 1QB5D 2F3WA 2Q8IB 3FKIB 2LKVA 1GKHA 2F0VA 4IUNA 3HOZB 4EX5A 3D31A 1C8CA 4HMJA 1B1ZA 3VR5A 3FKIH 1EIYB 1VQKA 5GAHC 1EQQA 2F0NA 2D9UA 4TKOB 1PTOF 3G71A 3D8GA 3PO3B 3U9OA 3P1HA 3C1EA 3ERSX 3PO3H 3TS0A 4OGQC 2TSSA 3E9HA 4A3FG 2RDHA 3S1MH 1PDQA 1J8IA 4XYOA 2JQOA 5DAUA 5M3MB 1YHQA 1T5EA 5I9PA 1CZGA 3H15A 3EBEA 4A75A 1JICA 3C1FA 1JJCB 1AP0A 4BA1I 4KMUC 1TT2A 5KYLA 1QVFA 1EU3A 5E4XA 3J80L 2NN6H 3HOUG 1C4QA 4FXGC 3PUXA 1YHBA 4DR1Q 2YU9B 3NXWA 1TY2A 3TDQA 5C0XI 4OL7A 2RDGA 2DUDA 3GTPH 4IJHA 5C44G 4A3JG 1JJGA 1FNUA 5JJIA 1YITA 3U9SA 1DOLA 3T16A 1TWHB 2JP1A 2JA6B 4DV7Q 1NSNS 1CKNB 1VQAA 1SBBB 1TWHH 3NSWA 4TRDA 3QJYA 2XNAC 4XIGS 2ZJQA 4PZ7A 1YJNA 3K80C 2DJGC 5L37A 3CRLC 2OCEA 1HH2P 5BN5A 5FK9C 3HOWG 2PMZB 4KLKA 2XRSD 2PPBC 1V9PA 5IE8A 1E24A 4IO9A 2PQAB 1XX8A 5CR3A 4C1NI 3MEHA 2B2WC 2Z4IA 4IPHA 1L1OC 5HURA 1QNUA 3D4RA 4DV7L 2UXBQ 2XWJB 1N8RC 3ULJA 3NBIA 4POFA 2MUYA 2IL8A 1PH3A 4JCVE 1SNCA 3JC66 4Y7NB 4KD3A 3UE1A 5KGUA 2HQLA 1YEZA 4HMIA 2KOLA 5A2QE 2F1MA 2JA7B 1JB3A 4RCNA 1PH7A 2A68C 3ND9A 3IKJA 3GTLH 5IGDA 3AFQA 1V43A 4EQ5A 4QUFA 1DD2A 1SJHD 1I94Q 1GD7A 3KF8B 1WTQA 4LF7Q 2RSNA 1WD1A 1ET6A 1EY5A 3FHWA 2UXBL 3E0JA 1X3QA 1K3RA 1ENCA 2HDLA 2RHSB 3A8JE 5TSSA 2WFWA 3S15B 3S2DB 4J8QA 2DGYA 2I5MX 2RBMA 4WJ4A 1Y1VB 3G48A 2DY7A 5KNBA 5AFWA 2UU9Q 3GQBA 1JB7A 1AZPA 1HQMC 1ZKOA 4KHVA 1WTWA 2E2JB 4ALPA 3OWEB 4J15A 2K5NA 3A7AB 5M5WB 5C5MA 2BOSA 2K28A 4GKJQ 1I94L 1EUJA 1DYQA 1EFWA 3CXCA 4MZ9A 4LF7L 2FHTA 4A93B 4JI0Q 2IW3A 2RF4A 1X65A 1I4PA 3X3NA 1PA6A 3RMHA 4A93H 3R2TA 5IT9E 3J80i 2IJ0A 2CQOA 4P75A 1F2YA 2UU9L 1OXUA 1WCMB 1YVCA 3A5UA 3F2DA 4BY1B 1EEID 4RHSA 5ISRA 2J7ZA 1I6HH 4C3JG 4ZKCB 2GA4B 3NTKA 5CORA 5GADC 4GKJL 5EAYA 1HZAA 4OXPA 3GP7A 3E6ZX 5CV4A 4JOIA 2FINB 2MGSA 3OTOQ 4JI0L 2NVXB 1AE3A 2NTTA 5K36G 4A3DB 4BBSB 4YCVA 3PQIA 4N9TA 4CKBA 2NVXH 2F0LA 4KKSA 1Q86C 4BBSH 2WAQB 2CKZB 4RGMA 4BA2I 2XSCA 5LMUQ 2IY5B 4PNYA 1C9OA 4TSSA 3BZDB 2YYZA 1B44D 4DR4Q 2B2YC 3URYA 2BA0A 1X3FA 4HIKA 2O4XA 2R92B 5FJ8H 3BZKA 2IWHA 3KJOA 3CCLA 4KV6A 2KENA 3OSOA 2UUBQ 2OXPA 1Q81C 3TN2A 2ES2A 1ZYRD 3H3VC 3L3OC 3OTOL 2ENBA 1IL2A 3SEBA 2EYPA 4H44C 1CK1A 2D0OA 2HIXA 1LV9A 4OX9Q 2JE6I 1O7ZA 3NTHA 5D3IB 3WDNA 3BYYB 4WJ3M 5LMUL 4WJWA 4A3BG 2F0HA 4DR4L 1SYBA 5ELOA 1L2FA 3UI2A 2Q2TA 1XXGA 3QR8A 1K3BC 4C1NK 1WTRA 1F9SA 2B2UA 2MO0A 1JWUD 3K8AA 2WKCA 4F7XA 4A3EG 1RF2D 2I5HA 1LTTD 5E4WC 3J7ZC 1B53A 1Z9FA 1F2MA 3C2PA 1EY4A 4G57A 4GKKQ 3HOVB 1SE8A 1GUTA 5ELBA 1SJED 2Q8RE 4MTKA 2EJMA 3L7ZC 1LYLA 4BXXH 4K6DA 1PH6A 2K14A 4OX9L 1A2TA 4IUTA 3MAQA 2K50A 1XPOA 3DWQA 1IBKQ 4A3GB 1ESFA 1AZQA 5C4JH 5M5YH 2LXJA 3DMUA 3KLRA 3BVGA 1Y69U 2JA8G 2E5LQ 2Y0SB 4QJFA 3MTSA 4IPDA 2WB1E 3A8KE 3OWFA 4GOPA 5C5LA 2HIVA 2FMMA 1O7YA 1JCKB 3AQQA 1C0AA 1B3AA 3J81i 2IX3A 2K6AA 3ITPA 3TREA 1BF4A 4K0KQ 2HCCA 1H9MA 1I4QA 1S5ED 3CC4A 4JI7Q 1EWIA 3HGBA 3HP3A 4DK3C 1PV4A 4GKKL 4L5RC 2CWAA 4A3MB 1G2SA 5GAGC 3HKZB 3HOYH 1G91A 5FLMH 3RN5A 4RCOA 2MO1A 1YZ6A 1IBKL 1AEXA 3I73A 1KAWA 3G6JB 2R93H 1U4RA 4K14A 2R61A 1S72A 4DNTB 3GV3A 1HTLD 2E5LL 4C3IB 1SYGA 4ZAIA 4R4QA 1TQOA 2G5DA 2KCNA 1ENFA 1QUQB 4C3IH 1SSOA 3M7NA 3S14H 4N8X1 5IP9G 5KYIA 4ULLA 4K0KL 2AWOA 4JI7L 1FGUA 1OXSC 3M9BA 1IXRA 2V1CC 2AHOB 3DEPA 1CQVA 4C56C 4HJ8A 3QWNA 4FYDA 1BVSA 5EPJA 1WOCA 1DONA 2NVQB 3M4QA 1HXYD 1EQVA 3NP8A 1IW7C 2A68D 4L5TA 3PO2G 3PGZA 1EY7A 1EIHA 1YNJC 1KIXA 3OMGA 2NVQH 1TWFB 3T53B 2J4XA 1L0YB 2RSOA 4ID6A 3I7FA 2I46A 4IOAA 5IYDH 1ILQA 2PCFB 2Z1CA 4EQPA 3JAML 2B63H 3TRZA 1RCVD 1MBYA 1CZWA 4O1NA 3IFDA 3MXPA 5IYCG 4G7OC 3S2HH 2HT1A 1PVOA 1WJJA 1PYBA 1LTBD 5FO7B 2EYFA 3NK9A 1F77A 3DEOA 3H0GH 1F9PA 2JA5H 3QG1A 1WI5A 1VQGA 4ZQ3A 2QEXA 4FDBA 3IRBA 1E2VA 2VUMG 4FXDA 3NE5B 3KLSX 1OO9B 3M7GA 3CCUA 2HD3A 4JI2Q 2I5LX 2C9OA 2F4IA 5J39A 1JE4A 1ET9A 1XMOQ 1A2UA 4ODGA 3SK4A 3STBD 5NUCA 4XT3B 1Y1WB 4C2MH 2WIIB 2P5ZX 3M85A 1H9SA 3HFZB 1SDFA 4JPBW 4A3LG 2G9HD 3IL8A 2RQXA 2CWPA 1CQFA 1PH2A 4F88A 1VQNA 4A3IB 4LW1A 2BH2A 5ELFA 1BOSA 1SNOA 1DM0B 2F0EA 1SYCA 1KHIA 3S24A 1JT8A 4L5QA 5KNDA 2ASBA 4JI2L 3KBGA 4RA8A 3QOLA 1ESRA 3CHBD 1J5EQ 4R4TA 1QVGA 4IUVA 5M9OA 1XMOL 4AQYQ 2CH4A 2H5XA 1D5ZC 3A54A 1D7QA 3I4MG 1VQDA 3I72A 2B2VA 1G6PA 2SNMA 1ENAA 1LTID 1K83H 2EE1A 5C0XH 1VQPA 4X3SA 2ID0A 1X3GA 2K5WA 1N9WA 4X3KA 1DOMA 1UE7A 5G3LD 3E3XA 2CH4W 1EYCA 1STBA 1Z7TA 1RD9D 1H9KA 3CQZB 4MIUA 4C3HH 1TWAH 4R4OA 1MIUA 2G9DA 3HOXB 1J5EL 4RMFA 1QOHA 4YIJA 3CQZH 2PYKA 1LM0A 3HOXH 4AQYL 1VMPA 2XN9C 4NB3A 4A3KH 5IT9c 1O7IA 3I8ZA 1HQRD 3NTIA 2N88A 2QA4A 2F0TA 1EOVA 4JBKA 2LXKA 3M3YB 1EIGA 3X3MA 5M3FG 1B9MA 1PTOH 2ICIA 4AH6A 1CUKA 2Z6KA 3LX0A 1JMCA 1I4GA 5C4ZA 3JAMi 1SNDA 2LFNA 2PNRC 4K5WA 1CA5A 1H9JA 2EOTA 4IN3A 3W1GA 4DV3Q 1S5CD 2CFMA 3PIPA 3OMCA 1I3QB 1M8AA 1VF7A 5ELEA 3OIPA 3FVQA 3HOUB 3TP7A 3SDZA 2ZJPA 1HUMA 2F0OA 4OWTB 3SGIA 1YNND 4IFDI 4KD4A 1D2BA 1K8AC 3I2ZA 5I4DA 1E1TA 3TS2A 3BDOA 3LWEA 1E1OA 2EQSA 4U68A 1XTDA 5C44B 3EA6A 4GNXA 4A3JB 3N52A 3U4ZA 3KF6B 4BS9A 4E6IA 1EQRA 2D0PA 3M4OH 4KY6A 1W3SA 1KD1C 1LT4D 4CJ0B 5CV8A 4DV3L 2NTSA 1SE4A 1TVXA 4KK7A 3HZXA 2EYMA 1Q8IA 2R7ZH 4KN4C 3K57A 5ELDA 3H94A 4HCEA 1NCVA 1U0LA 1BDOA 2JYOA 3RLOA 3DXJC 4QMGA 1IKMA 4R4CA 4KTAA 4HCSA 5FLXE 4JI5Q 2K5HA 4NXNQ 4JOIC 1RIPA 3L9AX 3J81c 4NW2A 5C4XG 4A76A 4BY7B 1HR0W 2F0QA 1E3PA 3SK6A 3GTMB 3QIAA 2M00A 3F1ZA 3KDFA 2HCIA 4R8NA 4CHTB 4F87A 1U4PA 4JV5Q 1D5XC 3CC2A 3QO2A 1XYIA 1HTPA 3EVQA 3HOZH 1UE5A 2C35B 3NBHA 5CBAE 2GVBA 1ZXTA 5KEEA 4NXMQ 1XMQQ 3S16B 2X6GA 3IFTA 5IGFA 1HFGA 1STHA 3CPFA 1TS2A 3D6CA 1IZ6A 3H3VI 3MEFA 1PFNA 1JE5A 5E1FA 4OIJA 4NXNL 4JI5L 4A3CG 3D0FA 1IW7D 4QB4A 1XWEA 2A6HD 1VQ5A 3LGJA 3HRZC 1LT3D 5M3MH 2VB2X 4YCWA 3TP5A 1N36Q 1Q82C 1ASZA 2N8NA 3Q6SA 5LL6X 4JV5L 5HY6A 1BNZA 1V1PB 2L11A 3D4DA 1TXYA 3NHHA 2O5IC 2EIFA 1TWGB 2YU9H 2DNCA 4IALA 4FVMA 4NXML 1BKBA 2EY1A 3PIP3 1XMQL 1TR5A 2B2UC 1TWGH 4HIMA 5BN3A 1QNKA 2B8FA 5JPMC 2M2LA 1II3A 5EQ0A 1QCBD 3ONAB 2JA6H 4YHHQ 4QQBX 4FF3A 3E9IA 3HS0C 3W3AA 1PRTB 4H13C 1FVIA 2JA9A 4P71A 4X65Q 4OO1H 3NENA 5JJLA 1N36L 1A6XA 3CKIB 4DK6C 2ICEC 1TIID 2NUCA 2ZTDA 2A6EC 4PZ6A 3EJIA 4LFCQ 1PZJD 3EIVA 1WFQA 2F3VA 1CKNA 3CCEA 4GLVB 3PUWA 4GOPC 5C0XJ 3NEMA 4RFBA 5IWAL 1UUPA 1WTXA 3ND8A 1HHVA 2QCPX 5EBCA 4FP5D 4C3JB 3BVZA 1LABA 1LO5D 2K03A 5CV6A 3F2BA 3PUZA 4O0AA 4HIOA 1CKMA 4IUPA 4IUQA 2VXWA 2R3ZA 1EY9A 4YHHL 2EZVA 1NMGA 4I65A 4X65L 3K59A 3K0XA 4Y7NH 3VYUA 1HA6A 1KL9A 3KUPA 2PQAA 1A3VA 1GM5A 2JA7H 1PRTD 4OIKA 2ZJRA 4LFCL 3FKIG 1K8OA 2YV5A 5CV7A 3TZDA 2KCTA 4JW0A 4DPGA 4RHRA 3K5OA 4QGUA 1UWVA 1EY6A 1VQ7A 1SNQA 2ATWA 4RKLA 4LUZA 1W6KA 1YHAA 1G8ZD 3K5MA 3J80E 1BBUA 2K4KA 3J7AV 1D1KA 2OT2A 1B7YB 4B9XA 3PO3G 2L0CA 5IP7H 3DLLA 4K2KA 4DV6Q 1KAAA 1HNWQ 1UEBA 2JXMB 5JEAH 1CTMA 3R93A 4V190 5IIFA 3CCQA 5EPKA 5GQOA 4YWKA 1UE6A 2OTLA 3GTKB 4K8JA 2NVYB 3V2TA 1TS4A 4IUUA 3S15H 3S2DH 2RHQB 1PYWD 5K5PA 3CCRA 2FMCA 4P73A 1Y1VH 3KF8A 2JEAI 2K04A 2NN6G 3PF4A 4F8MA 4A3BB 5JVG3 5GAEC 4U673 2E2JH 1B4OA 1B3QA 1NR2A 2AQ1B 1EY0A 5M5WH 1PRTF 1NR4A 1O7LA 3P20A 3LNNA 1GO3E 1HZBA 4DV6L 1HNWL 5LMNQ 1Z47A 3E5SA 1PYSB 1GXDC 1YNXA 3DWPA 3PSIA 1OXTA 1Y8NB 1VQLA 2PW7A 4X66Q 4PMWA 3GTQB 2QKIC 1WCMH 2A69C 1Q1EA 4JBWA 2NZ1D 2KJXA 5CMDA 4BY1H 3SK5A 2L15A 3GTQH 3BYTB 3VYTA 3MA2B 2JA8B 2Z9HA 2JK8A 1GHKA 1SAPA 1CT1D 2A1AA 5JJZA 4H02A 1K73C 4ZUJA 1LT6D 5LMNL 4A3DH 2KEDA 1IYVA 1RTOA 3N6RA 1BCPC 3PIOA 1MJCA 2SDFA 2VNUD 4X66L 1ZEQX 2OWOA 5CV9A 1PZID 4AYBE 2EYOA 3FEWX 3PV0A 2BE5C 1QE6A 3J81j 2R92H 2NB0A 4CJ1B 4GN5A 2GN5A 2RDFA 2SNSA 2WV6D 3W5OA 2H1EA 2VW9A 3BU2A 4RWSC 2K5DA 4LK1C 3BVMA 1X6OA 1V8QA 2V4DA 4L63B 2QILA 4LMQD 5J22A 3CCJA 2B29A 3HEJA 3OIQA 3EROA 4LJZC 3FRPB 3ER0A 2B2VC 1KDCA 2PW5A 2M9VA 3J81E 5C3WA 5AJ3Q 2B3GA 4JVZA 5DLQE 2C5CA 3KJPA 1P8LA 1Y8PB 1BO0A 2AQ2B 1IYUA 4JBMA 1EOTA 3TP6A 2XVSA 1FJGQ 2WB1B 2RKSA 5C3EB 1NMFA 2YTYA 3J7A5 2WP8J 1KQSA 2EY2A 2WACA 2NBFA 2EPBA 3HOVH 1PZKD 1QJOA 2Q2IA 5C3EH 4A93G 1GHJA 5IYBH 2CW0C 3NELA 2I07B 1XNQQ 5JOBA 2OQKA 4A3GH 1PHJA 3UDXA 2NVTB 5AJ3L 1L1OB 2FFKB 4APVA 2NVTH 3CW2C 2EYLA 4NPSA 2VQEQ 4PV1C 4AYBG 2Z6KC 1BBXC 4PMBA 1STYA 1G2TA 2N78A 3S1NB 1SFOB 4DV5Q 1FJGL 4TVAB 5FLXc 2PO4A 1FNVA 1SFOH 4L5SA 4A3MH 1TWCB 5C4HA 1VQHA 1PTOC 4S3SA 4N9PA 2IHFA 3RR5A 4BBSG 1OXXK 4R4IA 2O5JC 1I4HA 4X62Q 1XNQL 1D8LA 5IODA 1G51A 2A6ED 4BBRB 3PF5A 2F0SA 4DN4M 4GNXC 2A8VA 3NQIA 1AH9A 5FJ8G 2Y0SE 2VQEL 4N8FA 3C3LA 4DU9A 1WVLA 1CSPA 3RD4A 4EQNA 4X6AH 3A55A 5JEAJ 3Q23A 4KKTA 4DV5L 2L55A 3GTJB 1DXMA 3I4NB 1DZ1A 3KLWA 1B8AA 3S17B 1BBWA 5BR8Q 1CHPD 2YTVA 2B39A 3GTJH 3K0YA 4KY7A 1H95A 3TQYA 1VS0A 1QILA 3TMEA 4X62L 4HR7B 1QUQA 5EKIA 4FXKC 4IOCA 3R8BA 1VQ4A 4KN7C 1M90C 4CJ2C 3W1BA 1XPRA 1WYDA 3CC7A 1EL0A 4G4KA 1S5DD 1BXTA 5C3XA 1EY8A 4IFDH 4DNRB 5KIXA 1A3TA 2Z6BA 1TWFH 3QB3A 3I91A 1G6ZA 3RLFA 3A74A 4FNFA 1SMYC 2CHBD 1GJXA 1WTVA 4XDXA 5BR8L 3K7AB 4BXXG 1QVCA 3HG9A 3HOVG 1NNXA 4ZUIA 1IL8A 5T1GA 3G4SA 2TMPA 3UDGA 2R6GA 3H09A 1BR9A 3I56A 2RA4A 1B2TA 4QIWE 2D62A 1VQCA 4Y52H 1ONLA 5GROA 3S1RB 5JVH3 5M3FB 2Y0SG 1J9OA 2I0QA 1H9RA 2QGQA 4Z9CB 3AFPA 3S1RH 1HZ9A 1ILPA 4ZK9B 4IPGA 1F9QA 3HOYG 5FLMG 3FP9A 2IX1A 4P74A 1VQEA 4KJOA 1GUOA 2K05A 4DR6Q 1Y1WH 3HKZG 1K0RA 2NYZD 2EY6A 4XT1B 1QG7A 4RAUC 2R93G 1S3OA 2A69D 3AYHB 4LAAA 1UEAB 5M5XB 1TS5A 2PNHA 4FO2A 4A3IH 1AW7A 3A0JA 3FDTA 1WTHA 4ZRZA 1YI2A 4C3IG 1NY4A 4V0BA 3AMUA 4O42A 5M5XH 4JI3Q 3J80c 3RZDB 1K8GA 2Q2HA 3KOJA 4DNIA 3SHLA 3JAME 4DR6L 1BCPD 1Q7YC 2PZWA 3BZCA 1O78A 1DOKA 1TS3A 1VQBA 3I90A 1GUNA 1B70B 1YJ9A 3SXHA 2UUAQ 4POGA 3VA5A 5CGKA 5I6YA 4XQQA 3BG3A 4JI3L 5EJWA 2KUMA 5IYDG 2B63G 2Q2UA 3MC0B 4OWXB 2QDLA 5LL6S 3V96A 4ZCKA 1WD0A 1EZ6A 1CM9A 4LF6Q 1VQJA 1M1KC 1HRJA 2NWGA 5J1ZA 4DK1A 4HAEA 2HHHQ 2E2DC 4FF4A 3TSSA 2XTIA 3H0GG 2MFIA 2F0IA 2MHVA 2JA5G 4A3FB 3M3YH 1IBLQ 3S9WA 2UUAL 5FOBB 4DR5Q 2ALYB 4A3FH 4J6HA 4GZYC 1PMRA 1P16A 1CI3M 1YIJA 5HGTA 3VR6A 5G3LF 2D5DA 5JJKA 1R9TB 2JSOA 3MXNB 1MD2D 1I3QH 3Q0AA 1Y14B 2E2IB 2KHIA 4LF6L 1M4VA 4DAYB 3HOUH 2CW0D 2EJFC 1TKWB 4HEDA 4JYAQ 3NWTA 3GTGB 2HHHL 2BH8A 2F0KA 3GV6A 5D65A 5C44H 4CDEC 4A3JH 3GTGH 3NQTA 1IBLL 2UXCQ 3CP0A 4M1UB 3WOFA 1HUNA 4JI1Q 1EEFD 3TZUA 4DR5L 1AE2A 3CD6A 3CPWA 4K5XA 2CVRA 3PCOB 3R2IA 3GD7A 4IZ8A 1I4RA 3FPPA 3CCSA 1L0WA 3T1YQ 2PI2A 4NKLA 3A8IE 1ICFB 2HUGA 4DAVA 4LWCA 4MNOA 3HOWB 1D6EC 3AB9A 3VR4A 3NUCA 5FO8B 3KF6A 2X6LA 3CCMA 1JOQA 4HJAA 3HOWH 4UP8A 5EPLA 4JYAL 5IGEA 1KRTA 2KCMA 4HIDA 5F2DA 4IFDJ 3I4LA 5C0XG 1HA5A 1JWMD 2WINB 4G7ZC 3DWAA 4A4IA 4EQOA 2UXCL 1IYJB 3EQLC 1KRSA 4BY7H 4JI1L 4XTCS 2F52A 3GTMH 2EYHA 1A8VA 1R4PB 3U50C 5IGBA 3VYSA 1A62A 3I4OA 4QF4A 1KTKA 4C3HG 3RN2A 3T1YL 2F3IA 1EFID 3HOXG 4A3KG 3S16H 3K5LA 3UDFA 3M4PA 3P75A 1PH1A 1B50A 3FPUB 5EBDA 5C6AA 1QWYA 3TEHB 1BUVT 1U4LA 1YNJD 4KHPQ 3SR1A 2E8GA 1HZCA 4CBVA 2F0PA 1EZ8A 3SE0A 3S1MB 4KJNA 1Z6HA 4QY7A 2F0MA 4K5VA 5A2QL 4B08A 3ULPA 1VQOA 3O13A 2F03A 4B3RQ 4JI4Q 2AUKA 2E2HB 3DHQA 1SMYD 2QW7A 5IWAQ 2JN4A 4AIMA 4DGZA 1ICWA 2F0FA 2E2HH 1SR3A 1A3UA 2EDGA 1X32A 2N3SA 3OOCA 5IOCA 1G291 4X64Q 2DNEA 4JC0A 2XIWA 4JBJA 1VQMA 1LTRD 3GTPB 2E75C 1T9HA 1Q46A 1RKNA 4R9WA 4KHPL 1EWCA 1V1PA 1VQFA 1AN8A 4LFAQ 4DR3Q 4WRDA 2EJGC 2EVBA 1UNSA 3J7YW 5COYA 4B3RL 4JI4L 1E0BA 2DY8A 3T56B 1NJIC 1JR0D 2XRQD 5EKKA 4ZYSA 4UP9A 2Z8LA 2R7ZG 5CBEE 2IPKD 3F8TA 1PLFA 3DM1A 1MHWC 4CKCA 2K01A 2J0TD 3K5NA 5DM73 4FF1A 2QF7A 1X3PA 4X64L 1EQTA 1FGBD 2B8GA 4GS3A 4C3JH 4MHEA 3CCVA 5I2XA 1N33Q 4DR1L 1SYDA 1LT5D 2AWNA 3WOEA 1MSGA 4CKEA 4DV1Q 5IT9L 2PZTA 1XPUA 1HPCA 4DR3L 4LFAL 1YJWA 5K36H 2KBNA 4LFBQ 1MKHA 4UAIA 4BY7G 1Y8OB 1MGSA 3EN2A 4LF8Q 3H91A 4HJ9A 2RVLA 1K28A 3HOZG 1EYDA 2PMZE 4RGTA 4DK0A 2JJQA 3GDEA 1FD7D 1S5BD 5CV5A 3GTLB 4DR2Q 1I6VC 3MFGA 1SLJA 2IT1A 1F2ZA 2DN8A 3HKSA 2BDOA 1N33L 3DM3A 2PQEA 1NAPA 4HTHA 4QCLA 2OTJA 4DV1L 3LWUA 3L2PA 4L8JA 5BN4A 4L6TB 3TBIB 5M3MG 4HN7A 3GTKH 2LY7A 2NVYH 4LF4Q 4LFBL 3CAMA 1KXLA 1RHPA 4I7ZC 4LF8L 4PQXA 3PMFA 4UY8C 3K81C 4A3BH 2EYJA 3ZYYX 4ME3A 4UHVA 5JAVA 1CA6A 5I9OA 4GN4B 3CU7A 1V1OA 1E2WA 4DR2L 2QDBA 4A3EB 3L0OA 1S4ZA 3Q22A 4MTNA 1FR3A 1Q3LA 1XNRQ 4A3EH 2KHJA 1GUSA 2JA6G 4GLAC 1SRUA 2FXQA 2KEEA 4IQZA 4QUCA 4OO1G 2XGTA 1RTNA 4ILWA 1OTCA 3I3CA 4LF4L 3F2CA 1KDBA 3TP8A 3J81L 4DUYQ 3STBC 4K8IA 2BDNA 1VMCA 4LUOA 3VA7A 4TQUS 3V05A 1I5FA 4XQJA 1E22A 5DNFA 1SNMA 3VDYA 3C46A 2JA8H 4OEMB 1W6JA 3JAMc 1I6HB 1KC8C 1KNEA 4AYBB 1CKOA 1XNRL 4PMCA 1F2LA 5ELCA 1IBMQ 4ABNA 4IPCA 1FL0A 1EU4A 4MN3A 1E7ZA 1I4XA 1JWSD 1NUCA 2B2TA 4UDUC 1LUZA 1TU2B 4EGVA 2NN6I 2KHSA 3QOJA 3B6YA 4G7HC 2Z4HA 4XXEA 4DUYL 2JA7G 1VQ6A 3EFXD 2SOBA 4YWMA 2F4VQ 2A74C 2Z0SA 2E74C 4DUZQ 1RDPD 4X3TA 2AMCB 2D2CC 2CQAA 3U58A 3K58A 1UAPA 5DM63 5KRUA 1XJVA 1JC7A 1OXVA 5IGGA 2L1BA 5IP7G 4ZLTF 5JEAG 3J7AF 1NBWA 5IP9H 1PH4A 1IBML 2WAQE 1VF5C 2NZOA 4JI8Q 2UUCQ 4OO1I 2BCOA 2AUJD 3AEVA 1Y1VG 2VQFQ 1E2ZA 2MJ8A 1IKLA 3BDCA 2YTXA 3K6OA 1PFBA 3PO2B 3MXUA 4CDCC 2F4VL 2GVAA 2VZAA 3ZJYC 2OQ0A 3ULLA 1Q1BA 1KABA 4DUZL 3A5ZB 3ERQA 1SXTA 3PO2H 2A5HA 3T51B 4DXGA 3A56A 4I7AA 4RKBA 4B3MQ 5I6WA 4KI0A 2MQHA 1U4MA 1QZHA 4JK1C 4J1MA 1C48A 4RG1A 2UUBL 4JI8L 4GOPB 2UUCL 3FMCA 1BQQT 5D3DA 5IYCH 2VQFL 1A15A 3RNUA 1WCMG 2KA7A 2N49A 4BY1G 5LMNW 1SN8A 5C4JB 5M5YB 2EXDA 2VUMB 1GUGA 1YNNC 1I50B 1VCIA 2F0DA 5E3FA 1HJPA 1RODA 1FYCA 4LNQA 2VUMH 4KHZA 1I50H 5HGQA 3CF5A 1ML0D 1HNXQ 3S1NH 2L5TA 2ZT9C 4B3ML 2B2WA 3R3OA 4A3DG 4NMZA 1L1OA 4Q0FA 4YY3Q 1TWCH 4DA2A 1NTGA 3KBXA 1SROA 2WKDA 3HOYB
chains in the Genus database with same CATH topology
2X69A 2O2LD 3GO5A 3OHXC 3PIO3 2BA1A 2KCCA 5CYUA 2R93B 2AQ3B 5EKLA 3KLSA 1GUWA 5FKAC 3D3RA 4DFAA 1PFMA 3MZ5A 4DXFA 2E76C 2LS01 3I70A 3PUYA 3S14B 4KKUA 1L0XB 2L9HA 3OW7A 3OPOA 2Q8TA 3I4MB 1B9NA 1GOZA 5LHY1 2K1BA 2K32A 1STEA 1JOKA 3MHBA 4QIWB 4RGNA 2A6HC 3SK8A 1KLGD 5I2YA 4P2CB 2B63B 1DCZA 1CFMA 2OEOA 3VR3A 5T1IA 1TY0A 3S2HB 1KDAA 4K2LA 1RJTA 2H4OA 3VYRA 4KY5A 3D6WA 5FO9B 1LLRD 3H0GB 1DJRD 2ZXOA 2JA5B 2MPMA 1S5FD 1PXUA 2N55A 1BCPB 4H7BA 2HDMA 2F0GA 2K33A 1H9SB 3BS1A 4EVOA 3NPPA 1SYFA 1U9RA 1MSHA 1STNA 5A35A 2EXZA 4C2MB 5DEHA 2KQ3A 5EGTA 4RH6A 4IURA 2LMCB 2B2YA 4R8IA 2FJ2A 3T4AC 3NWSA 3MVVA 3AU7A 1FNWA 1LTSD 4M8AA 4ME5A 3F2UA 2HQEA 1D1IA 1PRTC 2F0WA 5JPNC 1SNPA 3KK7A 4HSVA 2BE5D 2F0UA 1K83B 4DAPA 1STGA 4IFDG 5C4XB 3W2DA 3RZOB 1HCZA 1SEBD 1LACA 5D14A 5CC4A 1Q12A 3A7LA 4XQNA 1O80A 1D5MC 4XYQA 3SVMA 2SEBD 3VR2A 2QEJC 1T5XD 2KVMA 4RGOS 2IX0A 4C3HB 1TWAB 1XTCD 4K6LA 4NDXA 1MI2A 3DUZA 5FLXL 1HFNA 1EWHA 2ZXRA 4A3KB 2K5QA 1BCPF 1Q90A 4BWGB 1KNAA 3G7LA 2ZXPA 4WORA 1F9RA 1PTOB 4HSPA 4NP5A 3RUZA 3BDLA 1LTAD 3CRKC 3MFYA 3MXGA 3T13A 4WFN3 1JOOA 4Q5VA 1CHQD 2L12A 1R4QB 2A73B 4ZKBB 3S1QB 5KNCA 1STAA 2XWBB 2OF1A 3MXNA 2PZUA 3PUVA 4OHJA 2JEBI 2K7VA 4CGYB 2L4NA 1IHZA 2F0JA 4DAYA 1EYAA 3M4OB 1LTGD 2EY5A 4FF2A 3P7JA 1K8MA 3M4YA 3GTOB 3MWYW 1PTOD 2KECA 4H0LC 1WTOA 2R7ZB 1JORA 1AFPA 1KLUD 2VB3X 3Q24A 1WTPA 3D4WA 3H6MA 3IAYA 1ZYRC 1JQYD 1SE3A 4DF7A 4X3UA 4B9WA 1SYEA 1SE2A 2B2TC 1VDZA 2MP1A 5IGCA 1QB5D 2F3WA 2Q8IB 3FKIB 2LKVA 2F0VA 4IUNA 3HOZB 3D31A 1C8CA 4HMJA 1B1ZA 3VR5A 2F0NA 2D9UA 4TKOB 1PTOF 3D8GA 3PO3B 3U9OA 3P1HA 3C1EA 4OGQC 2TSSA 2RDHA 1PDQA 1J8IA 4XYOA 5DAUA 5M3MB 1T5EA 5I9PA 1CZGA 1JICA 3C1FA 1AP0A 4BA1I 4KMUC 1TT2A 5KYLA 1EU3A 5E4XA 3J80L 2NN6H 1C4QA 4FXGC 3PUXA 2YU9B 3NXWA 1TY2A 3TDQA 5C0XI 4OL7A 2RDGA 1FNUA 3U9SA 1DOLA 3T16A 1TWHB 2JP1A 2JA6B 1NSNS 1SBBB 3NSWA 4TRDA 3QJYA 2XNAC 4XIGS 3CRLC 5BN5A 5FK9C 2PMZB 2XRSD 2PPBC 1XX8A 5CR3A 4C1NI 3MEHA 2B2WC 2Z4IA 5HURA 1QNUA 3D4RA 2XWJB 3NBIA 2MUYA 2IL8A 1SNCA 4Y7NB 4KD3A 5KGUA 4HMIA 2KOLA 5A2QE 2F1MA 2JA7B 1JB3A 4RCNA 2A68C 3ND9A 3IKJA 5IGDA 1V43A 4QUFA 1DD2A 1SJHD 1WTQA 2RSNA 1WD1A 1ET6A 1EY5A 3E0JA 1X3QA 2HDLA 1ENCA 3A8JE 5TSSA 3S15B 3S2DB 4J8QA 2RBMA 1Y1VB 2DY7A 5KNBA 5AFWA 3GQBA 1AZPA 1HQMC 1ZKOA 4KHVA 1WTWA 2E2JB 3OWEB 3A7AB 5M5WB 5C5MA 2BOSA 2K28A 1DYQA 2FHTA 4A93B 2IW3A 1I4PA 3X3NA 3RMHA 3R2TA 5IT9E 2IJ0A 1F2YA 1OXUA 1WCMB 4BY1B 1EEID 4RHSA 5ISRA 2J7ZA 4C3JG 4ZKCB 2GA4B 3NTKA 5CORA 3GP7A 3E6ZX 5CV4A 2FINB 2MGSA 2NVXB 2NTTA 5K36G 4A3DB 4BBSB 4N9TA 4CKBA 2F0LA 4KKSA 2WAQB 4RGMA 4BA2I 2XSCA 4PNYA 4TSSA 3BZDB 2YYZA 1B44D 2B2YC 3URYA 2BA0A 2O4XA 2R92B 2IWHA 4KV6A 3OSOA 2OXPA 3TN2A 1ZYRD 3H3VC 3L3OC 2ENBA 3SEBA 2EYPA 4H44C 1CK1A 1LV9A 2JE6I 1O7ZA 3NTHA 5D3IB 3WDNA 3BYYB 4WJWA 2F0HA 1SYBA 3UI2A 1XXGA 4C1NK 1WTRA 1F9SA 2B2UA 1JWUD 2WKCA 4F7XA 1RF2D 1LTTD 5E4WC 1B53A 1F2MA 3C2PA 1EY4A 4G57A 3HOVB 1GUTA 5ELBA 1SJED 2Q8RE 2EJMA 3L7ZC 4K6DA 1A2TA 4IUTA 3MAQA 3DWQA 4A3GB 1ESFA 1AZQA 3DMUA 3KLRA 3BVGA 1Y69U 2Y0SB 3MTSA 3A8KE 3OWFA 5C5LA 2FMMA 1O7YA 1JCKB 1B3AA 2IX3A 2K6AA 3ITPA 1BF4A 2HCCA 1H9MA 1I4QA 1S5ED 3HGBA 3HP3A 4A3MB 1G2SA 3HKZB 1G91A 4RCOA 1AEXA 3I73A 3G6JB 1U4RA 4K14A 2R61A 4DNTB 3GV3A 1HTLD 4C3IB 1SYGA 4ZAIA 1TQOA 2KCNA 1ENFA 1SSOA 3M7NA 5KYIA 4ULLA 2AWOA 1OXSC 3DEPA 1CQVA 4C56C 3QWNA 4FYDA 5EPJA 1DONA 2NVQB 1HXYD 1EQVA 3NP8A 1IW7C 2A68D 1EY7A 1EIHA 1YNJC 3OMGA 1TWFB 3T53B 2J4XA 1L0YB 2RSOA 4ID6A 2I46A 1ILQA 2PCFB 2Z1CA 4EQPA 3JAML 1RCVD 1MBYA 1CZWA 4O1NA 3IFDA 3MXPA 4G7OC 1LTBD 5FO7B 2EYFA 3NK9A 1F77A 3DEOA 1F9PA 3QG1A 4ZQ3A 1E2VA 4FXDA 3NE5B 3KLSX 1OO9B 3M7GA 2C9OA 2F4IA 5J39A 1JE4A 1ET9A 1A2UA 4ODGA 3SK4A 5NUCA 4XT3B 1Y1WB 2WIIB 3M85A 1H9SA 1SDFA 2G9HD 3IL8A 2RQXA 1CQFA 4F88A 4A3IB 5ELFA 1BOSA 1SNOA 1DM0B 2F0EA 1SYCA 5KNDA 3KBGA 4RA8A 3QOLA 1ESRA 3CHBD 4IUVA 5M9OA 1D5ZC 3A54A 3I72A 2B2VA 2SNMA 1ENAA 1LTID 2EE1A 5C0XH 4X3SA 2ID0A 2K5WA 4X3KA 1DOMA 5G3LD 1EYCA 1STBA 1Z7TA 1RD9D 1H9KA 3CQZB 4MIUA 2G9DA 3HOXB 1QOHA 4YIJA 2PYKA 1VMPA 2XN9C 3I8ZA 1HQRD 3NTIA 2N88A 2F0TA 3M3YB 1EIGA 3X3MA 1B9MA 1PTOH 2ICIA 3LX0A 1I4GA 5C4ZA 1SNDA 2LFNA 2PNRC 4K5WA 1CA5A 1H9JA 2EOTA 4IN3A 1S5CD 3OMCA 1I3QB 1M8AA 1VF7A 5ELEA 3OIPA 3FVQA 3HOUB 3TP7A 3SDZA 1HUMA 2F0OA 1YNND 4IFDI 4KD4A 1D2BA 5I4DA 3BDOA 3LWEA 4U68A 5C44B 3EA6A 4A3JB 3N52A 4BS9A 4E6IA 4KY6A 1LT4D 4CJ0B 5CV8A 2NTSA 1SE4A 1TVXA 4KK7A 3HZXA 2EYMA 1Q8IA 4KN4C 3K57A 5ELDA 3H94A 4HCEA 1NCVA 2JYOA 1BDOA 3DXJC 4QMGA 1IKMA 4KTAA 4HCSA 5FLXE 3L9AX 4NW2A 4BY7B 2F0QA 3SK6A 3GTMB 3QIAA 2M00A 2HCIA 4R8NA 4CHTB 4F87A 1U4PA 1D5XC 3QO2A 1XYIA 1HTPA 3EVQA 3NBHA 5CBAE 1ZXTA 5KEEA 3S16B 2X6GA 3IFTA 5IGFA 1HFGA 1STHA 1TS2A 3D6CA 1PFNA 5E1FA 4OIJA 1IW7D 4QB4A 1XWEA 2A6HD 3HRZC 1LT3D 2VB2X 3TP5A 3Q6SA 5LL6X 1BNZA 1V1PB 2L11A 3D4DA 3NHHA 2O5IC 1TWGB 2DNCA 4IALA 4FVMA 2EY1A 3PIP3 1TR5A 2B2UC 5BN3A 1QNKA 2B8FA 5JPMC 2M2LA 1II3A 5EQ0A 1QCBD 3ONAB 4FF3A 3HS0C 3W3AA 1PRTB 4H13C 4OO1H 1A6XA 3CKIB 2ICEC 1TIID 2NUCA 2A6EC 3EJIA 1PZJD 2F3VA 3PUWA 5C0XJ 4RFBA 1UUPA 1WTXA 3ND8A 1HHVA 2QCPX 5EBCA 4FP5D 4C3JB 3BVZA 1LABA 1LO5D 2K03A 5CV6A 3PUZA 4IUPA 4IUQA 2VXWA 2R3ZA 1EY9A 2EZVA 4I65A 3K59A 3VYUA 1HA6A 3KUPA 1A3VA 1PRTD 4OIKA 1K8OA 5CV7A 3TZDA 4RHRA 3K5OA 1EY6A 1SNQA 4RKLA 1W6KA 3K5MA 1G8ZD 3J80E 3J7AV 1D1KA 2OT2A 4B9XA 2L0CA 4K2KA 1KAAA 5JEAH 2JXMB 1CTMA 3R93A 4V190 5IIFA 5EPKA 3GTKB 4K8JA 2NVYB 3V2TA 1TS4A 4IUUA 1PYWD 5K5PA 2FMCA 3KF8A 2JEAI 2K04A 2NN6G 4F8MA 4A3BB 5JVG3 4U673 1B4OA 1NR2A 2AQ1B 1EY0A 1PRTF 1NR4A 1O7LA 3P20A 3LNNA 1Z47A 3E5SA 1GXDC 3DWPA 1OXTA 1Y8NB 2PW7A 4PMWA 3GTQB 2QKIC 2A69C 1Q1EA 4JBWA 2NZ1D 2KJXA 5CMDA 3SK5A 3BYTB 3VYTA 3MA2B 2JA8B 1GHKA 1SAPA 1CT1D 5JJZA 4ZUJA 1LT6D 2KEDA 1IYVA 1RTOA 3N6RA 1BCPC 2SDFA 2VNUD 1ZEQX 5CV9A 1PZID 2EYOA 3FEWX 3PV0A 2BE5C 1QE6A 2NB0A 4CJ1B 2RDFA 2SNSA 2WV6D 2H1EA 4RWSC 2K5DA 4LK1C 3BVMA 1V8QA 2V4DA 4L63B 2QILA 4LMQD 5J22A 3HEJA 3EROA 3OIQA 4LJZC 3FRPB 2B2VC 1KDCA 2PW5A 2M9VA 3J81E 5C3WA 2C5CA 1Y8PB 1BO0A 2AQ2B 1IYUA 1EOTA 3TP6A 2XVSA 2WB1B 2RKSA 5C3EB 2WP8J 2EY2A 2WACA 2NBFA 2EPBA 1PZKD 1QJOA 1GHJA 2CW0C 2I07B 5JOBA 2NVTB 2FFKB 2EYLA 4PV1C 1BBXC 4PMBA 1STYA 1G2TA 3S1NB 1SFOB 2PO4A 1FNVA 1TWCB 5C4HA 1PTOC 4S3SA 4N9PA 1OXXK 2O5JC 1I4HA 5IODA 2A6ED 4BBRB 2F0SA 4DN4M 3NQIA 3C3LA 4DU9A 1WVLA 3RD4A 4EQNA 3A55A 5JEAJ 3Q23A 4KKTA 2L55A 3GTJB 1DXMA 3I4NB 1DZ1A 3S17B 1CHPD 2B39A 3K0YA 4KY7A 1QILA 3TMEA 4HR7B 5EKIA 4FXKC 3R8BA 4KN7C 4CJ2C 1EL0A 4G4KA 1S5DD 1BXTA 5C3XA 1EY8A 4IFDH 4DNRB 5KIXA 1A3TA 3QB3A 3I91A 1G6ZA 3RLFA 4FNFA 1SMYC 2CHBD 1GJXA 1WTVA 4XDXA 3K7AB 3HG9A 4ZUIA 1IL8A 5T1GA 2TMPA 2R6GA 3H09A 1BR9A 2RA4A 1B2TA 2D62A 1ONLA 3S1RB 5JVH3 5M3FB 1J9OA 1H9RA 4Z9CB 1ILPA 4ZK9B 1F9QA 2IX1A 4KJOA 1GUOA 2K05A 2NYZD 2EY6A 4XT1B 1QG7A 4RAUC 2A69D 4LAAA 1UEAB 5M5XB 1TS5A 4FO2A 1AW7A 3FDTA 4ZRZA 4C3IG 4V0BA 3AMUA 4O42A 3RZDB 3SHLA 3JAME 1BCPD 2PZWA 1O78A 1DOKA 1TS3A 3I90A 1GUNA 3SXHA 3VA5A 5CGKA 5I6YA 4XQQA 3BG3A 5EJWA 2KUMA 3MC0B 5LL6S 3V96A 1WD0A 1EZ6A 1CM9A 1HRJA 2NWGA 5J1ZA 4DK1A 4HAEA 2E2DC 4FF4A 3TSSA 2F0IA 2MHVA 4A3FB 3S9WA 5FOBB 4J6HA 4GZYC 1PMRA 1CI3M 5HGTA 3VR6A 5G3LF 2D5DA 1R9TB 2JSOA 1MD2D 3Q0AA 2E2IB 1M4VA 2CW0D 2EJFC 1TKWB 4HEDA 3NWTA 3GTGB 2F0KA 3GV6A 5D65A 3NQTA 4M1UB 3WOFA 1HUNA 3TZUA 1EEFD 4K5XA 2CVRA 3R2IA 3GD7A 4IZ8A 1I4RA 3FPPA 4NKLA 3A8IE 2HUGA 4DAVA 3HOWB 1D6EC 3AB9A 3VR4A 3NUCA 5FO8B 2X6LA 1JOQA 5EPLA 5IGEA 5F2DA 4IFDJ 3I4LA 5C0XG 1HA5A 1JWMD 2WINB 4G7ZC 3DWAA 4EQOA 3EQLC 4XTCS 2EYHA 1R4PB 5IGBA 3VYSA 4QF4A 1KTKA 4C3HG 1EFID 3K5LA 3P75A 1B50A 3FPUB 5EBDA 5C6AA 1QWYA 1BUVT 1U4LA 1YNJD 3SR1A 4CBVA 2F0PA 1EZ8A 3SE0A 3S1MB 4KJNA 1Z6HA 2F0MA 4K5VA 5A2QL 4B08A 3O13A 2F03A 2E2HB 2AUKA 3DHQA 1SMYD 4DGZA 1ICWA 2F0FA 1A3UA 2EDGA 1X32A 3OOCA 5IOCA 1G291 2DNEA 2XIWA 3GTPB 1LTRD 2E75C 1RKNA 4R9WA 1EWCA 1V1PA 1AN8A 4WRDA 2EJGC 2EVBA 1UNSA 3J7YW 5COYA 1E0BA 2DY8A 3T56B 4ZYSA 1JR0D 2XRQD 5EKKA 2Z8LA 5CBEE 2IPKD 1PLFA 3DM1A 4CKCA 2K01A 2J0TD 3K5NA 5DM73 4FF1A 2QF7A 1X3PA 1EQTA 1FGBD 2B8GA 4MHEA 5I2XA 1SYDA 1LT5D 2AWNA 3WOEA 1MSGA 4CKEA 5IT9L 2PZTA 1HPCA 5K36H 4UAIA 1Y8OB 1MGSA 3H91A 2RVLA 1EYDA 4RGTA 4DK0A 1FD7D 1S5BD 5CV5A 3GTLB 1I6VC 3MFGA 2IT1A 1F2ZA 2DN8A 2BDOA 2PQEA 1NAPA 4HTHA 4QCLA 3LWUA 4L8JA 5BN4A 4L6TB 3TBIB 4HN7A 2LY7A 1RHPA 4I7ZC 4PQXA 3PMFA 3ZYYX 2EYJA 5JAVA 1CA6A 5I9OA 3CU7A 1V1OA 1E2WA 2QDBA 4A3EB 1S4ZA 3Q22A 1FR3A 1Q3LA 1GUSA 2KEEA 4IQZA 4QUCA 4OO1G 1RTNA 4ILWA 3I3CA 1KDBA 3TP8A 3J81L 4K8IA 2BDNA 1VMCA 3VA7A 4TQUS 3V05A 4XQJA 5DNFA 1SNMA 3C46A 1W6JA 1I6HB 1KNEA 4AYBB 4PMCA 1F2LA 5ELCA 4ABNA 1EU4A 4MN3A 1I4XA 1JWSD 1NUCA 2B2TA 4UDUC 1TU2B 4EGVA 2NN6I 2KHSA 3QOJA 4G7HC 2Z4HA 4XXEA 3EFXD 2SOBA 2A74C 2E74C 1RDPD 4X3TA 2D2CC 2CQAA 3K58A 1UAPA 5DM63 5KRUA 1JC7A 1OXVA 5IGGA 2L1BA 4ZLTF 5JEAG 3J7AF 1VF5C 4OO1I 2BCOA 2AUJD 1E2ZA 2MJ8A 1IKLA 3BDCA 3K6OA 1PFBA 3PO2B 3MXUA 1Q1BA 1KABA 3ERQA 1SXTA 2A5HA 3T51B 4DXGA 3A56A 4RKBA 5I6WA 4KI0A 1U4MA 4JK1C 4J1MA 1C48A 3FMCA 1BQQT 5D3DA 1A15A 2KA7A 5C4JB 5M5YB 2VUMB 1GUGA 1YNNC 1I50B 1VCIA 2F0DA 5E3FA 1RODA 1FYCA 4KHZA 1ML0D 2L5TA 2ZT9C 2B2WA 3R3OA 4NMZA 4Q0FA 4DA2A 3KBXA 2WKDA 3HOYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T16 A;  5E1F A;  3HEJ A;  3TME A;  5DEH A;  2PZT A;  2OF1 A;  3ERO A;  4K6D A;  2F0T A;  5IIF A;  1NSN S;  2KQ3 A;  1A2T A;  1NUC A;  2EYF A;  3NK9 A;  4K8J A;  4QB4 A;  2PZU A;  4EQO A;  3V2T A;  3SXH A;  5EGT A;  1KDC A;  2PW5 A;  2KHS A;  3QOJ A;  5C3W A;  4TRD A;  2EYH A;  3DMU A;  4ZQ3 A;  3TP5 A;  3LX0 A;  3VA5 A;  1IHZ A;  2F0J A;  5C3X A;  1EYA A;  1EY8 A;  2SOB A;  2EY5 A;  5EKL A;  3MVV A;  5C4Z A;  5I6Y A;  1F2Y A;  1SND A;  4K5W A;  5IGB A;  5KIX A;  4QF4 A;  1EYD A;  4DFA A;  4F8M A;  1A3T A;  3OWF A;  5C5L A;  3D4D A;  3MZ5 A;  3QB3 A;  5ISR A;  3NHH A;  3TP6 A;  5CV5 A;  1EY0 A;  3OMC A;  4ME5 A;  2RKS A;  4IAL A;  1F2Z A;  5IGG A;  1EZ6 A;  5KRU A;  3ITP A;  5J39 A;  1JOR A;  2EY1 A;  2HQE A;  5K5P A;  2EY2 A;  2WAC A;  1TR5 A;  3P75 A;  3TP7 A;  5CR3 A;  1A2U A;  4ODG A;  2F0O A;  3MEH A;  5CV4 A;  5J1Z A;  2F0W A;  5NUC A;  3SK4 A;  2PQE A;  3D4W A;  4HTH A;  5C6A A;  3H6M A;  4ZUI A;  4KD4 A;  1II3 A;  1SNP A;  3E5S A;  5HUR A;  3SR1 A;  2F0I A;  2F0U A;  5CGK A;  2F0P A;  1EZ8 A;  3RUZ A;  4N9T A;  1STG A;  5JOB A;  2F0L A;  4DF7 A;  1JOK A;  1AEX A;  3S9W A;  3MHB A;  4KJN A;  2PW7 A;  3BDC A;  1SNC A;  4B9W A;  1SYE A;  4K14 A;  4E6I A;  2F0M A;  4K5V A;  4PNY A;  5CC4 A;  4KY6 A;  4J6H A;  3PMF A;  4KD3 A;  5KGU A;  2NUC A;  2EYL A;  5HGT A;  4HMI A;  5IGC A;  2F3W A;  1SYG A;  5CV8 A;  1SNO A;  3SK5 A;  2EYJ A;  3DHQ A;  1KAB A;  5JAV A;  2F0E A;  3ERQ A;  4PMB A;  1SYC A;  2LKV A;  1STY A;  3EJI A;  2O4X A;  4DGZ A;  5I9O A;  2F0F A;  1TQO A;  2F0V A;  4IUN A;  3SK8 A;  2F3V A;  5IGD A;  3HZX A;  1A3U A;  4KV6 A;  2QDB A;  2EYM A;  3OSO A;  4HMJ A;  3QOL A;  4RKB A;  4NDX A;  5IOC A;  2OXP A;  5KYI A;  5I6W A;  2F0N A;  4J1M A;  5M9O A;  4ZUJ A;  3D8G A;  4KJO A;  2OEO A;  5CV6 A;  4QMG A;  2ENB A;  3U9O A;  5C4H A;  1RKN A;  1KDA A;  2EYP A;  4KTA A;  4N9P A;  2F0K A;  4S3S A;  3P1H A;  2EY6 A;  4K2L A;  2SNM A;  1ENA A;  3C1E A;  1EY5 A;  1EY9 A;  4WRD A;  3NQT A;  4KY5 A;  1ENC A;  5IOD A;  1KDB A;  4WOR A;  4I65 A;  2F0Q A;  3TP8 A;  5DAU A;  4LAA A;  3SK6 A;  4NP5 A;  2F0S A;  2F0H A;  2RBM A;  1EQV A;  3BDL A;  3NP8 A;  4K5X A;  4K8I A;  2M00 A;  5CV9 A;  5I9P A;  4IZ8 A;  1EY7 A;  2F0D A;  1A3V A;  5E3F A;  3C1F A;  4R8N A;  1SYB A;  2EYO A;  4H7B A;  3OMG A;  1TT2 A;  5EKK A;  4DU9 A;  2F0G A;  4KHV A;  5KYL A;  1EYC A;  1SNM A;  4EQN A;  1STB A;  3EVQ A;  4NKL A;  5CV7 A;  4ID6 A;  4MIU A;  3T13 A;  4EVO A;  1EY6 A;  2RDF A;  1SNQ A;  3NUC A;  2SNS A;  4F7X A;  3NXW A;  4PMC A;  4RKL A;  5C5M A;  4EQP A;  4OL7 A;  1JOO A;  4YIJ A;  3SHL A;  5KEE A;  1F2M A;  1SYF A;  3R3O A;  1JOQ A;  1EY4 A;  2PYK A;  1U9R A;  4NMZ A;  5IGF A;  4G57 A;  1STH A;  5IGE A;  4B9X A;  1SYD A;  3D6C A;  4KY7 A;  5F2D A;  3MXP A;  1STA A;  1STN A;  4K2K A;  5J22 A;  2PZW A;  1KAA A;  2EXZ A; 
#chains in the Genus database with same CATH topology
 2WAQ G;  4DV2 Q;  3UDI A;  1PH8 A;  2X69 A;  2O2L D;  3GO5 A;  3OHX C;  4R1J A;  3PIO 3;  2BA1 A;  2KCC A;  5CYU A;  3Q8D A;  4BBR H;  2R93 B;  2AQ3 B;  5EKL A;  2R92 G;  3KLS A;  4A3L H;  1GUW A;  5FKA C;  3D3R A;  4DFA A;  1PFM A;  1V1Q A;  1UE1 A;  3MZ5 A;  4DXF A;  1HNX L;  2E76 C;  1HNZ Q;  1GVP A;  3KYH C;  3K7U C;  2LS0 1;  3I70 A;  4HJ7 A;  3I4N H;  3HKZ E;  3PUY A;  4DV4 Q;  3S14 B;  4KKU A;  3S17 H;  4JG2 A;  1L0X B;  2L9H A;  3OW7 A;  4CDD C;  4QL5 A;  4DAM A;  1K9M C;  2VY3 A;  3OPO A;  4YY3 L;  2Q8T A;  3I4M B;  1VQ9 A;  4DV2 L;  1B9N A;  1GOZ A;  2VL6 A;  5LHY 1;  2K1B A;  2K32 A;  3I4M H;  1STE A;  1JOK A;  3MHB A;  1YBY A;  4QIW B;  4RGN A;  1DGS A;  2A6H C;  1JJ2 A;  3SK8 A;  1HNZ L;  2CCZ A;  1KLG D;  5I2Y A;  1U5K A;  2WB1 G;  4P2C B;  4DV4 L;  5C3E G;  1DCZ A;  2B63 B;  5IYB G;  3K7A H;  1X3E A;  1A63 A;  1CFM A;  2OEO A;  3VR3 A;  5T1I A;  1TY0 A;  3S2H B;  1KDA A;  1W2B A;  4A3G G;  4K2L A;  1RJT A;  2H4O A;  3CMA A;  3VYR A;  4KY5 A;  3D6W A;  5ELN A;  5FO9 B;  1LLR D;  3H0G B;  1DJR D;  2MNA A;  2ZXO A;  2JA5 B;  2MPM A;  5H1S E;  1SMX A;  3KFU A;  1S5F D;  3WWV A;  5M3F H;  1PXU A;  2N55 A;  1BCP B;  4H7B A;  2HDM A;  2ZM6 Q;  2F0G A;  4O2D A;  2RCN A;  2K33 A;  4GLX A;  1H9S B;  3BS1 A;  4EVO A;  2ZTE A;  4UPA A;  4A3M G;  1CSQ A;  1NE3 A;  3NPP A;  1SYF A;  4LF9 Q;  1U9R A;  1MSH A;  2ZTC A;  4DV0 Q;  2IHE A;  1X55 A;  1STN A;  5A35 A;  2EXZ A;  4C2M B;  5DEH A;  3ICE A;  2KQ3 A;  1ASY A;  3H3V H;  5EGT A;  1A0I A;  4RH6 A;  4IUR A;  2LMC B;  4B3S Q;  2B2Y A;  4BBR G;  4R8I A;  2FJ2 A;  3T4A C;  3NWS A;  3MVV A;  4PZ8 A;  4LUV A;  1EYG A;  2ZM6 L;  4DKA C;  3AU7 A;  3RZD H;  1FNW A;  1LTS D;  4M8A A;  3OW2 A;  1S40 A;  4ME5 A;  4DR7 Q;  3UE0 A;  3I4N G;  2K52 A;  3F2U A;  2HQE A;  5J3B A;  1D1I A;  4LF9 L;  4UP7 A;  1X54 A;  4DV0 L;  1PRT C;  2F0W A;  5JPN C;  1HR0 Q;  2UXD Q;  1SNP A;  1X9N A;  3KK7 A;  4HSV A;  2BE5 D;  2F0U A;  1N34 Q;  1K83 B;  4DAP A;  1STG A;  4IFD G;  5C4X B;  3W2D A;  3RZO B;  4YCU A;  4OWW B;  1HCZ A;  1SEB D;  1LAC A;  4B3S L;  1Q8K A;  5D14 A;  5CC4 A;  1Q12 A;  1MJE A;  4YWL A;  2R7F A;  1K0S A;  3A7L A;  4XQN A;  1QZG A;  1O80 A;  1D5M C;  4XYQ A;  5C4X H;  3SVM A;  3RZO H;  2SEB D;  1PH5 A;  3VR2 A;  2QEJ C;  1T5X D;  2VS1 A;  2KVM A;  4RGO S;  1VQI A;  4PG3 A;  2IX0 A;  4C3H B;  1TWA B;  1XTC D;  4DR7 L;  4K6L A;  4JI6 Q;  4NDX A;  1MI2 A;  3DUZ A;  5FLX L;  4LF5 Q;  1HFN A;  1EWH A;  5IY0 A;  2ZXR A;  4A3K B;  1HR0 L;  2K5V A;  1X56 A;  2UXD L;  1N32 Q;  2K5Q A;  1BCP F;  1Q90 A;  4BWG B;  2A19 A;  4B3T Q;  1N34 L;  1KNA A;  3G7L A;  2ZXP A;  4OON A;  4A3C H;  4WOR A;  1F9R A;  1PTO B;  4HSP A;  4NP5 A;  3RUZ A;  3BDL A;  1LTA D;  3CRK C;  1PFS A;  3T1H Q;  3MFY A;  3MXG A;  1R9T H;  4OEL B;  1VQ8 A;  4GNX B;  3T13 A;  2E2I H;  1J6Q A;  4JI6 L;  4WFN 3;  1JOO A;  4Q5V A;  1Y1W G;  1CHQ D;  2L12 A;  3G6E A;  1R4Q B;  3OYY A;  2DJF C;  5E7N A;  2A73 B;  3BJU A;  4LF5 L;  4ZKB B;  3S1Q B;  5KNC A;  1STA A;  1N32 L;  1C7Y A;  2XWB B;  2OF1 A;  2LSS A;  4B3T L;  3S1Q H;  3CME A;  3MXN A;  2PZU A;  3PUV A;  4A3I G;  4OHJ A;  2JEB I;  4IJL A;  2K7V A;  4CGY B;  2L4N A;  1IHZ A;  2F0J A;  2R7D A;  1EYA A;  4DAY A;  1LTG D;  2EY5 A;  4FF2 A;  3M4O B;  2NZH A;  3P7J A;  1K8M A;  3M4Y A;  3RLN A;  3T1H L;  3GTO B;  1PH9 A;  1LTL A;  3MWY W;  4GN3 B;  1PTO D;  2KEC A;  4P72 A;  3GTO H;  2AKW B;  4H0L C;  1WTO A;  2R7Z B;  1JOR A;  1RL2 A;  1AFP A;  1KLU D;  2VB3 X;  2PI2 E;  1EIF A;  3E0E A;  3Q24 A;  1WTP A;  4CDF C;  3KDF B;  3D4W A;  3H6M A;  3IAY A;  1ZYR C;  2K75 A;  1JQY D;  1SE3 A;  4HJ5 A;  3NBH B;  4DF7 A;  4X3U A;  4B9W A;  1SYE A;  1SE2 A;  3U4V A;  2B2T C;  1VDZ A;  2MP1 A;  3I55 A;  2RCF A;  5IGC A;  1QB5 D;  2F3W A;  2Q8I B;  3FKI B;  2LKV A;  1GKH A;  2F0V A;  4IUN A;  3HOZ B;  4EX5 A;  3D31 A;  1C8C A;  4HMJ A;  1B1Z A;  3VR5 A;  3FKI H;  1EIY B;  1VQK A;  5GAH C;  1EQQ A;  2F0N A;  2D9U A;  4TKO B;  1PTO F;  3G71 A;  3D8G A;  3PO3 B;  3U9O A;  3P1H A;  3C1E A;  3ERS X;  3PO3 H;  3TS0 A;  4OGQ C;  2TSS A;  3E9H A;  4A3F G;  2RDH A;  3S1M H;  1PDQ A;  1J8I A;  4XYO A;  2JQO A;  5DAU A;  5M3M B;  1YHQ A;  1T5E A;  5I9P A;  1CZG A;  3H15 A;  3EBE A;  4A75 A;  1JIC A;  3C1F A;  1JJC B;  1AP0 A;  4BA1 I;  4KMU C;  1TT2 A;  5KYL A;  1QVF A;  1EU3 A;  5E4X A;  3J80 L;  2NN6 H;  3HOU G;  1C4Q A;  4FXG C;  3PUX A;  1YHB A;  4DR1 Q;  2YU9 B;  3NXW A;  1TY2 A;  3TDQ A;  5C0X I;  4OL7 A;  2RDG A;  2DUD A;  3GTP H;  4IJH A;  5C44 G;  4A3J G;  1JJG A;  1FNU A;  5JJI A;  1YIT A;  3U9S A;  1DOL A;  3T16 A;  1TWH B;  2JP1 A;  2JA6 B;  4DV7 Q;  1NSN S;  1CKN B;  1VQA A;  1SBB B;  1TWH H;  3NSW A;  4TRD A;  3QJY A;  2XNA C;  4XIG S;  2ZJQ A;  4PZ7 A;  1YJN A;  3K80 C;  2DJG C;  5L37 A;  3CRL C;  2OCE A;  1HH2 P;  5BN5 A;  5FK9 C;  3HOW G;  2PMZ B;  4KLK A;  2XRS D;  2PPB C;  1V9P A;  5IE8 A;  1E24 A;  4IO9 A;  2PQA B;  1XX8 A;  5CR3 A;  4C1N I;  3MEH A;  2B2W C;  2Z4I A;  4IPH A;  1L1O C;  5HUR A;  1QNU A;  3D4R A;  4DV7 L;  2UXB Q;  2XWJ B;  1N8R C;  3ULJ A;  3NBI A;  4POF A;  2MUY A;  2IL8 A;  1PH3 A;  4JCV E;  1SNC A;  3JC6 6;  4Y7N B;  4KD3 A;  3UE1 A;  5KGU A;  2HQL A;  1YEZ A;  4HMI A;  2KOL A;  5A2Q E;  2F1M A;  2JA7 B;  1JB3 A;  4RCN A;  1PH7 A;  2A68 C;  3ND9 A;  3IKJ A;  3GTL H;  5IGD A;  3AFQ A;  1V43 A;  4EQ5 A;  4QUF A;  1DD2 A;  1SJH D;  1I94 Q;  1GD7 A;  3KF8 B;  1WTQ A;  4LF7 Q;  2RSN A;  1WD1 A;  1ET6 A;  1EY5 A;  3FHW A;  2UXB L;  3E0J A;  1X3Q A;  1K3R A;  1ENC A;  2HDL A;  2RHS B;  3A8J E;  5TSS A;  2WFW A;  3S15 B;  3S2D B;  4J8Q A;  2DGY A;  2I5M X;  2RBM A;  4WJ4 A;  1Y1V B;  3G48 A;  2DY7 A;  5KNB A;  5AFW A;  2UU9 Q;  3GQB A;  1JB7 A;  1AZP A;  1HQM C;  1ZKO A;  4KHV A;  1WTW A;  2E2J B;  4ALP A;  3OWE B;  4J15 A;  2K5N A;  3A7A B;  5M5W B;  5C5M A;  2BOS A;  2K28 A;  4GKJ Q;  1I94 L;  1EUJ A;  1DYQ A;  1EFW A;  3CXC A;  4MZ9 A;  4LF7 L;  2FHT A;  4A93 B;  4JI0 Q;  2IW3 A;  2RF4 A;  1X65 A;  1I4P A;  3X3N A;  1PA6 A;  3RMH A;  4A93 H;  3R2T A;  5IT9 E;  3J80 i;  2IJ0 A;  2CQO A;  4P75 A;  1F2Y A;  2UU9 L;  1OXU A;  1WCM B;  1YVC A;  3A5U A;  3F2D A;  4BY1 B;  1EEI D;  4RHS A;  5ISR A;  2J7Z A;  1I6H H;  4C3J G;  4ZKC B;  2GA4 B;  3NTK A;  5COR A;  5GAD C;  4GKJ L;  5EAY A;  1HZA A;  4OXP A;  3GP7 A;  3E6Z X;  5CV4 A;  4JOI A;  2FIN B;  2MGS A;  3OTO Q;  4JI0 L;  2NVX B;  1AE3 A;  2NTT A;  5K36 G;  4A3D B;  4BBS B;  4YCV A;  3PQI A;  4N9T A;  4CKB A;  2NVX H;  2F0L A;  4KKS A;  1Q86 C;  4BBS H;  2WAQ B;  2CKZ B;  4RGM A;  4BA2 I;  2XSC A;  5LMU Q;  2IY5 B;  4PNY A;  1C9O A;  4TSS A;  3BZD B;  2YYZ A;  1B44 D;  4DR4 Q;  2B2Y C;  3URY A;  2BA0 A;  1X3F A;  4HIK A;  2O4X A;  2R92 B;  5FJ8 H;  3BZK A;  2IWH A;  3KJO A;  3CCL A;  4KV6 A;  2KEN A;  3OSO A;  2UUB Q;  2OXP A;  1Q81 C;  3TN2 A;  2ES2 A;  1ZYR D;  3H3V C;  3L3O C;  3OTO L;  2ENB A;  1IL2 A;  3SEB A;  2EYP A;  4H44 C;  1CK1 A;  2D0O A;  2HIX A;  1LV9 A;  4OX9 Q;  2JE6 I;  1O7Z A;  3NTH A;  5D3I B;  3WDN A;  3BYY B;  4WJ3 M;  5LMU L;  4WJW A;  4A3B G;  2F0H A;  4DR4 L;  1SYB A;  5ELO A;  1L2F A;  3UI2 A;  2Q2T A;  1XXG A;  3QR8 A;  1K3B C;  4C1N K;  1WTR A;  1F9S A;  2B2U A;  2MO0 A;  1JWU D;  3K8A A;  2WKC A;  4F7X A;  4A3E G;  1RF2 D;  2I5H A;  1LTT D;  5E4W C;  3J7Z C;  1B53 A;  1Z9F A;  1F2M A;  3C2P A;  1EY4 A;  4G57 A;  4GKK Q;  3HOV B;  1SE8 A;  1GUT A;  5ELB A;  1SJE D;  2Q8R E;  4MTK A;  2EJM A;  3L7Z C;  1LYL A;  4BXX H;  4K6D A;  1PH6 A;  2K14 A;  4OX9 L;  1A2T A;  4IUT A;  3MAQ A;  2K50 A;  1XPO A;  3DWQ A;  1IBK Q;  4A3G B;  1ESF A;  1AZQ A;  5C4J H;  5M5Y H;  2LXJ A;  3DMU A;  3KLR A;  3BVG A;  1Y69 U;  2JA8 G;  2E5L Q;  2Y0S B;  4QJF A;  3MTS A;  4IPD A;  2WB1 E;  3A8K E;  3OWF A;  4GOP A;  5C5L A;  2HIV A;  2FMM A;  1O7Y A;  1JCK B;  3AQQ A;  1C0A A;  1B3A A;  3J81 i;  2IX3 A;  2K6A A;  3ITP A;  3TRE A;  1BF4 A;  4K0K Q;  2HCC A;  1H9M A;  1I4Q A;  1S5E D;  3CC4 A;  4JI7 Q;  1EWI A;  3HGB A;  3HP3 A;  4DK3 C;  1PV4 A;  4GKK L;  4L5R C;  2CWA A;  4A3M B;  1G2S A;  5GAG C;  3HKZ B;  3HOY H;  1G91 A;  5FLM H;  3RN5 A;  4RCO A;  2MO1 A;  1YZ6 A;  1IBK L;  1AEX A;  3I73 A;  1KAW A;  3G6J B;  2R93 H;  1U4R A;  4K14 A;  2R61 A;  1S72 A;  4DNT B;  3GV3 A;  1HTL D;  2E5L L;  4C3I B;  1SYG A;  4ZAI A;  4R4Q A;  1TQO A;  2G5D A;  2KCN A;  1ENF A;  1QUQ B;  4C3I H;  1SSO A;  3M7N A;  3S14 H;  4N8X 1;  5IP9 G;  5KYI A;  4ULL A;  4K0K L;  2AWO A;  4JI7 L;  1FGU A;  1OXS C;  3M9B A;  1IXR A;  2V1C C;  2AHO B;  3DEP A;  1CQV A;  4C56 C;  4HJ8 A;  3QWN A;  4FYD A;  1BVS A;  5EPJ A;  1WOC A;  1DON A;  2NVQ B;  3M4Q A;  1HXY D;  1EQV A;  3NP8 A;  1IW7 C;  2A68 D;  4L5T A;  3PO2 G;  3PGZ A;  1EY7 A;  1EIH A;  1YNJ C;  1KIX A;  3OMG A;  2NVQ H;  1TWF B;  3T53 B;  2J4X A;  1L0Y B;  2RSO A;  4ID6 A;  3I7F A;  2I46 A;  4IOA A;  5IYD H;  1ILQ A;  2PCF B;  2Z1C A;  4EQP A;  3JAM L;  2B63 H;  3TRZ A;  1RCV D;  1MBY A;  1CZW A;  4O1N A;  3IFD A;  3MXP A;  5IYC G;  4G7O C;  3S2H H;  2HT1 A;  1PVO A;  1WJJ A;  1PYB A;  1LTB D;  5FO7 B;  2EYF A;  3NK9 A;  1F77 A;  3DEO A;  3H0G H;  1F9P A;  2JA5 H;  3QG1 A;  1WI5 A;  1VQG A;  4ZQ3 A;  2QEX A;  4FDB A;  3IRB A;  1E2V A;  2VUM G;  4FXD A;  3NE5 B;  3KLS X;  1OO9 B;  3M7G A;  3CCU A;  2HD3 A;  4JI2 Q;  2I5L X;  2C9O A;  2F4I A;  5J39 A;  1JE4 A;  1ET9 A;  1XMO Q;  1A2U A;  4ODG A;  3SK4 A;  3STB D;  5NUC A;  4XT3 B;  1Y1W B;  4C2M H;  2WII B;  2P5Z X;  3M85 A;  1H9S A;  3HFZ B;  1SDF A;  4JPB W;  4A3L G;  2G9H D;  3IL8 A;  2RQX A;  2CWP A;  1CQF A;  1PH2 A;  4F88 A;  1VQN A;  4A3I B;  4LW1 A;  2BH2 A;  5ELF A;  1BOS A;  1SNO A;  1DM0 B;  2F0E A;  1SYC A;  1KHI A;  3S24 A;  1JT8 A;  4L5Q A;  5KND A;  2ASB A;  4JI2 L;  3KBG A;  4RA8 A;  3QOL A;  1ESR A;  3CHB D;  1J5E Q;  4R4T A;  1QVG A;  4IUV A;  5M9O A;  1XMO L;  4AQY Q;  2CH4 A;  2H5X A;  1D5Z C;  3A54 A;  1D7Q A;  3I4M G;  1VQD A;  3I72 A;  2B2V A;  1G6P A;  2SNM A;  1ENA A;  1LTI D;  1K83 H;  2EE1 A;  5C0X H;  1VQP A;  4X3S A;  2ID0 A;  1X3G A;  2K5W A;  1N9W A;  4X3K A;  1DOM A;  1UE7 A;  5G3L D;  3E3X A;  2CH4 W;  1EYC A;  1STB A;  1Z7T A;  1RD9 D;  1H9K A;  3CQZ B;  4MIU A;  4C3H H;  1TWA H;  4R4O A;  1MIU A;  2G9D A;  3HOX B;  1J5E L;  4RMF A;  1QOH A;  4YIJ A;  3CQZ H;  2PYK A;  1LM0 A;  3HOX H;  4AQY L;  1VMP A;  2XN9 C;  4NB3 A;  4A3K H;  5IT9 c;  1O7I A;  3I8Z A;  1HQR D;  3NTI A;  2N88 A;  2QA4 A;  2F0T A;  1EOV A;  4JBK A;  2LXK A;  3M3Y B;  1EIG A;  3X3M A;  5M3F G;  1B9M A;  1PTO H;  2ICI A;  4AH6 A;  1CUK A;  2Z6K A;  3LX0 A;  1JMC A;  1I4G A;  5C4Z A;  3JAM i;  1SND A;  2LFN A;  2PNR C;  4K5W A;  1CA5 A;  1H9J A;  2EOT A;  4IN3 A;  3W1G A;  4DV3 Q;  1S5C D;  2CFM A;  3PIP A;  3OMC A;  1I3Q B;  1M8A A;  1VF7 A;  5ELE A;  3OIP A;  3FVQ A;  3HOU B;  3TP7 A;  3SDZ A;  2ZJP A;  1HUM A;  2F0O A;  4OWT B;  3SGI A;  1YNN D;  4IFD I;  4KD4 A;  1D2B A;  1K8A C;  3I2Z A;  5I4D A;  1E1T A;  3TS2 A;  3BDO A;  3LWE A;  1E1O A;  2EQS A;  4U68 A;  1XTD A;  5C44 B;  3EA6 A;  4GNX A;  4A3J B;  3N52 A;  3U4Z A;  3KF6 B;  4BS9 A;  4E6I A;  1EQR A;  2D0P A;  3M4O H;  4KY6 A;  1W3S A;  1KD1 C;  1LT4 D;  4CJ0 B;  5CV8 A;  4DV3 L;  2NTS A;  1SE4 A;  1TVX A;  4KK7 A;  3HZX A;  2EYM A;  1Q8I A;  2R7Z H;  4KN4 C;  3K57 A;  5ELD A;  3H94 A;  4HCE A;  1NCV A;  1U0L A;  1BDO A;  2JYO A;  3RLO A;  3DXJ C;  4QMG A;  1IKM A;  4R4C A;  4KTA A;  4HCS A;  5FLX E;  4JI5 Q;  2K5H A;  4NXN Q;  4JOI C;  1RIP A;  3L9A X;  3J81 c;  4NW2 A;  5C4X G;  4A76 A;  4BY7 B;  1HR0 W;  2F0Q A;  1E3P A;  3SK6 A;  3GTM B;  3QIA A;  2M00 A;  3F1Z A;  3KDF A;  2HCI A;  4R8N A;  4CHT B;  4F87 A;  1U4P A;  4JV5 Q;  1D5X C;  3CC2 A;  3QO2 A;  1XYI A;  1HTP A;  3EVQ A;  3HOZ H;  1UE5 A;  2C35 B;  3NBH A;  5CBA E;  2GVB A;  1ZXT A;  5KEE A;  4NXM Q;  1XMQ Q;  3S16 B;  2X6G A;  3IFT A;  5IGF A;  1HFG A;  1STH A;  3CPF A;  1TS2 A;  3D6C A;  1IZ6 A;  3H3V I;  3MEF A;  1PFN A;  1JE5 A;  5E1F A;  4OIJ A;  4NXN L;  4JI5 L;  4A3C G;  3D0F A;  1IW7 D;  4QB4 A;  1XWE A;  2A6H D;  1VQ5 A;  3LGJ A;  3HRZ C;  1LT3 D;  5M3M H;  2VB2 X;  4YCW A;  3TP5 A;  1N36 Q;  1Q82 C;  1ASZ A;  2N8N A;  3Q6S A;  5LL6 X;  4JV5 L;  5HY6 A;  1BNZ A;  1V1P B;  2L11 A;  3D4D A;  1TXY A;  3NHH A;  2O5I C;  2EIF A;  1TWG B;  2YU9 H;  2DNC A;  4IAL A;  4FVM A;  4NXM L;  1BKB A;  2EY1 A;  3PIP 3;  1XMQ L;  1TR5 A;  2B2U C;  1TWG H;  4HIM A;  5BN3 A;  1QNK A;  2B8F A;  5JPM C;  2M2L A;  1II3 A;  5EQ0 A;  1QCB D;  3ONA B;  2JA6 H;  4YHH Q;  4QQB X;  4FF3 A;  3E9I A;  3HS0 C;  3W3A A;  1PRT B;  4H13 C;  1FVI A;  2JA9 A;  4P71 A;  4X65 Q;  4OO1 H;  3NEN A;  5JJL A;  1N36 L;  1A6X A;  3CKI B;  4DK6 C;  2ICE C;  1TII D;  2NUC A;  2ZTD A;  2A6E C;  4PZ6 A;  3EJI A;  4LFC Q;  1PZJ D;  3EIV A;  1WFQ A;  2F3V A;  1CKN A;  3CCE A;  4GLV B;  3PUW A;  4GOP C;  5C0X J;  3NEM A;  4RFB A;  5IWA L;  1UUP A;  1WTX A;  3ND8 A;  1HHV A;  2QCP X;  5EBC A;  4FP5 D;  4C3J B;  3BVZ A;  1LAB A;  1LO5 D;  2K03 A;  5CV6 A;  3F2B A;  3PUZ A;  4O0A A;  4HIO A;  1CKM A;  4IUP A;  4IUQ A;  2VXW A;  2R3Z A;  1EY9 A;  4YHH L;  2EZV A;  1NMG A;  4I65 A;  4X65 L;  3K59 A;  3K0X A;  4Y7N H;  3VYU A;  1HA6 A;  1KL9 A;  3KUP A;  2PQA A;  1A3V A;  1GM5 A;  2JA7 H;  1PRT D;  4OIK A;  2ZJR A;  4LFC L;  3FKI G;  1K8O A;  2YV5 A;  5CV7 A;  3TZD A;  2KCT A;  4JW0 A;  4DPG A;  4RHR A;  3K5O A;  4QGU A;  1UWV A;  1EY6 A;  1VQ7 A;  1SNQ A;  2ATW A;  4RKL A;  4LUZ A;  1W6K A;  1YHA A;  1G8Z D;  3K5M A;  3J80 E;  1BBU A;  2K4K A;  3J7A V;  1D1K A;  2OT2 A;  1B7Y B;  4B9X A;  3PO3 G;  2L0C A;  5IP7 H;  3DLL A;  4K2K A;  4DV6 Q;  1KAA A;  1HNW Q;  1UEB A;  2JXM B;  5JEA H;  1CTM A;  3R93 A;  4V19 0;  5IIF A;  3CCQ A;  5EPK A;  5GQO A;  4YWK A;  1UE6 A;  2OTL A;  3GTK B;  4K8J A;  2NVY B;  3V2T A;  1TS4 A;  4IUU A;  3S15 H;  3S2D H;  2RHQ B;  1PYW D;  5K5P A;  3CCR A;  2FMC A;  4P73 A;  1Y1V H;  3KF8 A;  2JEA I;  2K04 A;  2NN6 G;  3PF4 A;  4F8M A;  4A3B B;  5JVG 3;  5GAE C;  4U67 3;  2E2J H;  1B4O A;  1B3Q A;  1NR2 A;  2AQ1 B;  1EY0 A;  5M5W H;  1PRT F;  1NR4 A;  1O7L A;  3P20 A;  3LNN A;  1GO3 E;  1HZB A;  4DV6 L;  1HNW L;  5LMN Q;  1Z47 A;  3E5S A;  1PYS B;  1GXD C;  1YNX A;  3DWP A;  3PSI A;  1OXT A;  1Y8N B;  1VQL A;  2PW7 A;  4X66 Q;  4PMW A;  3GTQ B;  2QKI C;  1WCM H;  2A69 C;  1Q1E A;  4JBW A;  2NZ1 D;  2KJX A;  5CMD A;  4BY1 H;  3SK5 A;  2L15 A;  3GTQ H;  3BYT B;  3VYT A;  3MA2 B;  2JA8 B;  2Z9H A;  2JK8 A;  1GHK A;  1SAP A;  1CT1 D;  2A1A A;  5JJZ A;  4H02 A;  1K73 C;  4ZUJ A;  1LT6 D;  5LMN L;  4A3D H;  2KED A;  1IYV A;  1RTO A;  3N6R A;  1BCP C;  3PIO A;  1MJC A;  2SDF A;  2VNU D;  4X66 L;  1ZEQ X;  2OWO A;  5CV9 A;  1PZI D;  4AYB E;  2EYO A;  3FEW X;  3PV0 A;  2BE5 C;  1QE6 A;  3J81 j;  2R92 H;  2NB0 A;  4CJ1 B;  4GN5 A;  2GN5 A;  2RDF A;  2SNS A;  2WV6 D;  3W5O A;  2H1E A;  2VW9 A;  3BU2 A;  4RWS C;  2K5D A;  4LK1 C;  3BVM A;  1X6O A;  1V8Q A;  2V4D A;  4L63 B;  2QIL A;  4LMQ D;  5J22 A;  3CCJ A;  2B29 A;  3HEJ A;  3OIQ A;  3ERO A;  4LJZ C;  3FRP B;  3ER0 A;  2B2V C;  1KDC A;  2PW5 A;  2M9V A;  3J81 E;  5C3W A;  5AJ3 Q;  2B3G A;  4JVZ A;  5DLQ E;  2C5C A;  3KJP A;  1P8L A;  1Y8P B;  1BO0 A;  2AQ2 B;  1IYU A;  4JBM A;  1EOT A;  3TP6 A;  2XVS A;  1FJG Q;  2WB1 B;  2RKS A;  5C3E B;  1NMF A;  2YTY A;  3J7A 5;  2WP8 J;  1KQS A;  2EY2 A;  2WAC A;  2NBF A;  2EPB A;  3HOV H;  1PZK D;  1QJO A;  2Q2I A;  5C3E H;  4A93 G;  1GHJ A;  5IYB H;  2CW0 C;  3NEL A;  2I07 B;  1XNQ Q;  5JOB A;  2OQK A;  4A3G H;  1PHJ A;  3UDX A;  2NVT B;  5AJ3 L;  1L1O B;  2FFK B;  4APV A;  2NVT H;  3CW2 C;  2EYL A;  4NPS A;  2VQE Q;  4PV1 C;  4AYB G;  2Z6K C;  1BBX C;  4PMB A;  1STY A;  1G2T A;  2N78 A;  3S1N B;  1SFO B;  4DV5 Q;  1FJG L;  4TVA B;  5FLX c;  2PO4 A;  1FNV A;  1SFO H;  4L5S A;  4A3M H;  1TWC B;  5C4H A;  1VQH A;  1PTO C;  4S3S A;  4N9P A;  2IHF A;  3RR5 A;  4BBS G;  1OXX K;  4R4I A;  2O5J C;  1I4H A;  4X62 Q;  1XNQ L;  1D8L A;  5IOD A;  1G51 A;  2A6E D;  4BBR B;  3PF5 A;  2F0S A;  4DN4 M;  4GNX C;  2A8V A;  3NQI A;  1AH9 A;  5FJ8 G;  2Y0S E;  2VQE L;  4N8F A;  3C3L A;  4DU9 A;  1WVL A;  1CSP A;  3RD4 A;  4EQN A;  4X6A H;  3A55 A;  5JEA J;  3Q23 A;  4KKT A;  4DV5 L;  2L55 A;  3GTJ B;  1DXM A;  3I4N B;  1DZ1 A;  3KLW A;  1B8A A;  3S17 B;  1BBW A;  5BR8 Q;  1CHP D;  2YTV A;  2B39 A;  3GTJ H;  3K0Y A;  4KY7 A;  1H95 A;  3TQY A;  1VS0 A;  1QIL A;  3TME A;  4X62 L;  4HR7 B;  1QUQ A;  5EKI A;  4FXK C;  4IOC A;  3R8B A;  1VQ4 A;  4KN7 C;  1M90 C;  4CJ2 C;  3W1B A;  1XPR A;  1WYD A;  3CC7 A;  1EL0 A;  4G4K A;  1S5D D;  1BXT A;  5C3X A;  1EY8 A;  4IFD H;  4DNR B;  5KIX A;  1A3T A;  2Z6B A;  1TWF H;  3QB3 A;  3I91 A;  1G6Z A;  3RLF A;  3A74 A;  4FNF A;  1SMY C;  2CHB D;  1GJX A;  1WTV A;  4XDX A;  5BR8 L;  3K7A B;  4BXX G;  1QVC A;  3HG9 A;  3HOV G;  1NNX A;  4ZUI A;  1IL8 A;  5T1G A;  3G4S A;  2TMP A;  3UDG A;  2R6G A;  3H09 A;  1BR9 A;  3I56 A;  2RA4 A;  1B2T A;  4QIW E;  2D62 A;  1VQC A;  4Y52 H;  1ONL A;  5GRO A;  3S1R B;  5JVH 3;  5M3F B;  2Y0S G;  1J9O A;  2I0Q A;  1H9R A;  2QGQ A;  4Z9C B;  3AFP A;  3S1R H;  1HZ9 A;  1ILP A;  4ZK9 B;  4IPG A;  1F9Q A;  3HOY G;  5FLM G;  3FP9 A;  2IX1 A;  4P74 A;  1VQE A;  4KJO A;  1GUO A;  2K05 A;  4DR6 Q;  1Y1W H;  3HKZ G;  1K0R A;  2NYZ D;  2EY6 A;  4XT1 B;  1QG7 A;  4RAU C;  2R93 G;  1S3O A;  2A69 D;  3AYH B;  4LAA A;  1UEA B;  5M5X B;  1TS5 A;  2PNH A;  4FO2 A;  4A3I H;  1AW7 A;  3A0J A;  3FDT A;  1WTH A;  4ZRZ A;  1YI2 A;  4C3I G;  1NY4 A;  4V0B A;  3AMU A;  4O42 A;  5M5X H;  4JI3 Q;  3J80 c;  3RZD B;  1K8G A;  2Q2H A;  3KOJ A;  4DNI A;  3SHL A;  3JAM E;  4DR6 L;  1BCP D;  1Q7Y C;  2PZW A;  3BZC A;  1O78 A;  1DOK A;  1TS3 A;  1VQB A;  3I90 A;  1GUN A;  1B70 B;  1YJ9 A;  3SXH A;  2UUA Q;  4POG A;  3VA5 A;  5CGK A;  5I6Y A;  4XQQ A;  3BG3 A;  4JI3 L;  5EJW A;  2KUM A;  5IYD G;  2B63 G;  2Q2U A;  3MC0 B;  4OWX B;  2QDL A;  5LL6 S;  3V96 A;  4ZCK A;  1WD0 A;  1EZ6 A;  1CM9 A;  4LF6 Q;  1VQJ A;  1M1K C;  1HRJ A;  2NWG A;  5J1Z A;  4DK1 A;  4HAE A;  2HHH Q;  2E2D C;  4FF4 A;  3TSS A;  2XTI A;  3H0G G;  2MFI A;  2F0I A;  2MHV A;  2JA5 G;  4A3F B;  3M3Y H;  1IBL Q;  3S9W A;  2UUA L;  5FOB B;  4DR5 Q;  2ALY B;  4A3F H;  4J6H A;  4GZY C;  1PMR A;  1P16 A;  1CI3 M;  1YIJ A;  5HGT A;  3VR6 A;  5G3L F;  2D5D A;  5JJK A;  1R9T B;  2JSO A;  3MXN B;  1MD2 D;  1I3Q H;  3Q0A A;  1Y14 B;  2E2I B;  2KHI A;  4LF6 L;  1M4V A;  4DAY B;  3HOU H;  2CW0 D;  2EJF C;  1TKW B;  4HED A;  4JYA Q;  3NWT A;  3GTG B;  2HHH L;  2BH8 A;  2F0K A;  3GV6 A;  5D65 A;  5C44 H;  4CDE C;  4A3J H;  3GTG H;  3NQT A;  1IBL L;  2UXC Q;  3CP0 A;  4M1U B;  3WOF A;  1HUN A;  4JI1 Q;  1EEF D;  3TZU A;  4DR5 L;  1AE2 A;  3CD6 A;  3CPW A;  4K5X A;  2CVR A;  3PCO B;  3R2I A;  3GD7 A;  4IZ8 A;  1I4R A;  3FPP A;  3CCS A;  1L0W A;  3T1Y Q;  2PI2 A;  4NKL A;  3A8I E;  1ICF B;  2HUG A;  4DAV A;  4LWC A;  4MNO A;  3HOW B;  1D6E C;  3AB9 A;  3VR4 A;  3NUC A;  5FO8 B;  3KF6 A;  2X6L A;  3CCM A;  1JOQ A;  4HJA A;  3HOW H;  4UP8 A;  5EPL A;  4JYA L;  5IGE A;  1KRT A;  2KCM A;  4HID A;  5F2D A;  4IFD J;  3I4L A;  5C0X G;  1HA5 A;  1JWM D;  2WIN B;  4G7Z C;  3DWA A;  4A4I A;  4EQO A;  2UXC L;  1IYJ B;  3EQL C;  1KRS A;  4BY7 H;  4JI1 L;  4XTC S;  2F52 A;  3GTM H;  2EYH A;  1A8V A;  1R4P B;  3U50 C;  5IGB A;  3VYS A;  1A62 A;  3I4O A;  4QF4 A;  1KTK A;  4C3H G;  3RN2 A;  3T1Y L;  2F3I A;  1EFI D;  3HOX G;  4A3K G;  3S16 H;  3K5L A;  3UDF A;  3M4P A;  3P75 A;  1PH1 A;  1B50 A;  3FPU B;  5EBD A;  5C6A A;  1QWY A;  3TEH B;  1BUV T;  1U4L A;  1YNJ D;  4KHP Q;  3SR1 A;  2E8G A;  1HZC A;  4CBV A;  2F0P A;  1EZ8 A;  3SE0 A;  3S1M B;  4KJN A;  1Z6H A;  4QY7 A;  2F0M A;  4K5V A;  5A2Q L;  4B08 A;  3ULP A;  1VQO A;  3O13 A;  2F03 A;  4B3R Q;  4JI4 Q;  2AUK A;  2E2H B;  3DHQ A;  1SMY D;  2QW7 A;  5IWA Q;  2JN4 A;  4AIM A;  4DGZ A;  1ICW A;  2F0F A;  2E2H H;  1SR3 A;  1A3U A;  2EDG A;  1X32 A;  2N3S A;  3OOC A;  5IOC A;  1G29 1;  4X64 Q;  2DNE A;  4JC0 A;  2XIW A;  4JBJ A;  1VQM A;  1LTR D;  3GTP B;  2E75 C;  1T9H A;  1Q46 A;  1RKN A;  4R9W A;  4KHP L;  1EWC A;  1V1P A;  1VQF A;  1AN8 A;  4LFA Q;  4DR3 Q;  4WRD A;  2EJG C;  2EVB A;  1UNS A;  3J7Y W;  5COY A;  4B3R L;  4JI4 L;  1E0B A;  2DY8 A;  3T56 B;  1NJI C;  1JR0 D;  2XRQ D;  5EKK A;  4ZYS A;  4UP9 A;  2Z8L A;  2R7Z G;  5CBE E;  2IPK D;  3F8T A;  1PLF A;  3DM1 A;  1MHW C;  4CKC A;  2K01 A;  2J0T D;  3K5N A;  5DM7 3;  4FF1 A;  2QF7 A;  1X3P A;  4X64 L;  1EQT A;  1FGB D;  2B8G A;  4GS3 A;  4C3J H;  4MHE A;  3CCV A;  5I2X A;  1N33 Q;  4DR1 L;  1SYD A;  1LT5 D;  2AWN A;  3WOE A;  1MSG A;  4CKE A;  4DV1 Q;  5IT9 L;  2PZT A;  1XPU A;  1HPC A;  4DR3 L;  4LFA L;  1YJW A;  5K36 H;  2KBN A;  4LFB Q;  1MKH A;  4UAI A;  4BY7 G;  1Y8O B;  1MGS A;  3EN2 A;  4LF8 Q;  3H91 A;  4HJ9 A;  2RVL A;  1K28 A;  3HOZ G;  1EYD A;  2PMZ E;  4RGT A;  4DK0 A;  2JJQ A;  3GDE A;  1FD7 D;  1S5B D;  5CV5 A;  3GTL B;  4DR2 Q;  1I6V C;  3MFG A;  1SLJ A;  2IT1 A;  1F2Z A;  2DN8 A;  3HKS A;  2BDO A;  1N33 L;  3DM3 A;  2PQE A;  1NAP A;  4HTH A;  4QCL A;  2OTJ A;  4DV1 L;  3LWU A;  3L2P A;  4L8J A;  5BN4 A;  4L6T B;  3TBI B;  5M3M G;  4HN7 A;  3GTK H;  2LY7 A;  2NVY H;  4LF4 Q;  4LFB L;  3CAM A;  1KXL A;  1RHP A;  4I7Z C;  4LF8 L;  4PQX A;  3PMF A;  4UY8 C;  3K81 C;  4A3B H;  2EYJ A;  3ZYY X;  4ME3 A;  4UHV A;  5JAV A;  1CA6 A;  5I9O A;  4GN4 B;  3CU7 A;  1V1O A;  1E2W A;  4DR2 L;  2QDB A;  4A3E B;  3L0O A;  1S4Z A;  3Q22 A;  4MTN A;  1FR3 A;  1Q3L A;  1XNR Q;  4A3E H;  2KHJ A;  1GUS A;  2JA6 G;  4GLA C;  1SRU A;  2FXQ A;  2KEE A;  4IQZ A;  4QUC A;  4OO1 G;  2XGT A;  1RTN A;  4ILW A;  1OTC A;  3I3C A;  4LF4 L;  3F2C A;  1KDB A;  3TP8 A;  3J81 L;  4DUY Q;  3STB C;  4K8I A;  2BDN A;  1VMC A;  4LUO A;  3VA7 A;  4TQU S;  3V05 A;  1I5F A;  4XQJ A;  1E22 A;  5DNF A;  1SNM A;  3VDY A;  3C46 A;  2JA8 H;  4OEM B;  1W6J A;  3JAM c;  1I6H B;  1KC8 C;  1KNE A;  4AYB B;  1CKO A;  1XNR L;  4PMC A;  1F2L A;  5ELC A;  1IBM Q;  4ABN A;  4IPC A;  1FL0 A;  1EU4 A;  4MN3 A;  1E7Z A;  1I4X A;  1JWS D;  1NUC A;  2B2T A;  4UDU C;  1LUZ A;  1TU2 B;  4EGV A;  2NN6 I;  2KHS A;  3QOJ A;  3B6Y A;  4G7H C;  2Z4H A;  4XXE A;  4DUY L;  2JA7 G;  1VQ6 A;  3EFX D;  2SOB A;  4YWM A;  2F4V Q;  2A74 C;  2Z0S A;  2E74 C;  4DUZ Q;  1RDP D;  4X3T A;  2AMC B;  2D2C C;  2CQA A;  3U58 A;  3K58 A;  1UAP A;  5DM6 3;  5KRU A;  1XJV A;  1JC7 A;  1OXV A;  5IGG A;  2L1B A;  5IP7 G;  4ZLT F;  5JEA G;  3J7A F;  1NBW A;  5IP9 H;  1PH4 A;  1IBM L;  2WAQ E;  1VF5 C;  2NZO A;  4JI8 Q;  2UUC Q;  4OO1 I;  2BCO A;  2AUJ D;  3AEV A;  1Y1V G;  2VQF Q;  1E2Z A;  2MJ8 A;  1IKL A;  3BDC A;  2YTX A;  3K6O A;  1PFB A;  3PO2 B;  3MXU A;  4CDC C;  2F4V L;  2GVA A;  2VZA A;  3ZJY C;  2OQ0 A;  3ULL A;  1Q1B A;  1KAB A;  4DUZ L;  3A5Z B;  3ERQ A;  1SXT A;  3PO2 H;  2A5H A;  3T51 B;  4DXG A;  3A56 A;  4I7A A;  4RKB A;  4B3M Q;  5I6W A;  4KI0 A;  2MQH A;  1U4M A;  1QZH A;  4JK1 C;  4J1M A;  1C48 A;  4RG1 A;  2UUB L;  4JI8 L;  4GOP B;  2UUC L;  3FMC A;  1BQQ T;  5D3D A;  5IYC H;  2VQF L;  1A15 A;  3RNU A;  1WCM G;  2KA7 A;  2N49 A;  4BY1 G;  5LMN W;  1SN8 A;  5C4J B;  5M5Y B;  2EXD A;  2VUM B;  1GUG A;  1YNN C;  1I50 B;  1VCI A;  2F0D A;  5E3F A;  1HJP A;  1ROD A;  1FYC A;  4LNQ A;  2VUM H;  4KHZ A;  1I50 H;  5HGQ A;  3CF5 A;  1ML0 D;  1HNX Q;  3S1N H;  2L5T A;  2ZT9 C;  4B3M L;  2B2W A;  3R3O A;  4A3D G;  4NMZ A;  1L1O A;  4Q0F A;  4YY3 Q;  1TWC H;  4DA2 A;  1NTG A;  3KBX A;  1SRO A;  2WKD A;  3HOY B; 
#chains in the Genus database with same CATH homology
 2X69 A;  2O2L D;  3GO5 A;  3OHX C;  3PIO 3;  2BA1 A;  2KCC A;  5CYU A;  2R93 B;  2AQ3 B;  5EKL A;  3KLS A;  1GUW A;  5FKA C;  3D3R A;  4DFA A;  1PFM A;  3MZ5 A;  4DXF A;  2E76 C;  2LS0 1;  3I70 A;  3PUY A;  3S14 B;  4KKU A;  1L0X B;  2L9H A;  3OW7 A;  3OPO A;  2Q8T A;  3I4M B;  1B9N A;  1GOZ A;  5LHY 1;  2K1B A;  2K32 A;  1STE A;  1JOK A;  3MHB A;  4QIW B;  4RGN A;  2A6H C;  3SK8 A;  1KLG D;  5I2Y A;  4P2C B;  2B63 B;  1DCZ A;  1CFM A;  2OEO A;  3VR3 A;  5T1I A;  1TY0 A;  3S2H B;  1KDA A;  4K2L A;  1RJT A;  2H4O A;  3VYR A;  4KY5 A;  3D6W A;  5FO9 B;  1LLR D;  3H0G B;  1DJR D;  2ZXO A;  2JA5 B;  2MPM A;  1S5F D;  1PXU A;  2N55 A;  1BCP B;  4H7B A;  2HDM A;  2F0G A;  2K33 A;  1H9S B;  3BS1 A;  4EVO A;  3NPP A;  1SYF A;  1U9R A;  1MSH A;  1STN A;  5A35 A;  2EXZ A;  4C2M B;  5DEH A;  2KQ3 A;  5EGT A;  4RH6 A;  4IUR A;  2LMC B;  2B2Y A;  4R8I A;  2FJ2 A;  3T4A C;  3NWS A;  3MVV A;  3AU7 A;  1FNW A;  1LTS D;  4M8A A;  4ME5 A;  3F2U A;  2HQE A;  1D1I A;  1PRT C;  2F0W A;  5JPN C;  1SNP A;  3KK7 A;  4HSV A;  2BE5 D;  2F0U A;  1K83 B;  4DAP A;  1STG A;  4IFD G;  5C4X B;  3W2D A;  3RZO B;  1HCZ A;  1SEB D;  1LAC A;  5D14 A;  5CC4 A;  1Q12 A;  3A7L A;  4XQN A;  1O80 A;  1D5M C;  4XYQ A;  3SVM A;  2SEB D;  3VR2 A;  2QEJ C;  1T5X D;  2KVM A;  4RGO S;  2IX0 A;  4C3H B;  1TWA B;  1XTC D;  4K6L A;  4NDX A;  1MI2 A;  3DUZ A;  5FLX L;  1HFN A;  1EWH A;  2ZXR A;  4A3K B;  2K5Q A;  1BCP F;  1Q90 A;  4BWG B;  1KNA A;  3G7L A;  2ZXP A;  4WOR A;  1F9R A;  1PTO B;  4HSP A;  4NP5 A;  3RUZ A;  3BDL A;  1LTA D;  3CRK C;  3MFY A;  3MXG A;  3T13 A;  4WFN 3;  1JOO A;  4Q5V A;  1CHQ D;  2L12 A;  1R4Q B;  2A73 B;  4ZKB B;  3S1Q B;  5KNC A;  1STA A;  2XWB B;  2OF1 A;  3MXN A;  2PZU A;  3PUV A;  4OHJ A;  2JEB I;  2K7V A;  4CGY B;  2L4N A;  1IHZ A;  2F0J A;  4DAY A;  1EYA A;  3M4O B;  1LTG D;  2EY5 A;  4FF2 A;  3P7J A;  1K8M A;  3M4Y A;  3GTO B;  3MWY W;  1PTO D;  2KEC A;  4H0L C;  1WTO A;  2R7Z B;  1JOR A;  1AFP A;  1KLU D;  2VB3 X;  3Q24 A;  1WTP A;  3D4W A;  3H6M A;  3IAY A;  1ZYR C;  1JQY D;  1SE3 A;  4DF7 A;  4X3U A;  4B9W A;  1SYE A;  1SE2 A;  2B2T C;  1VDZ A;  2MP1 A;  5IGC A;  1QB5 D;  2F3W A;  2Q8I B;  3FKI B;  2LKV A;  2F0V A;  4IUN A;  3HOZ B;  3D31 A;  1C8C A;  4HMJ A;  1B1Z A;  3VR5 A;  2F0N A;  2D9U A;  4TKO B;  1PTO F;  3D8G A;  3PO3 B;  3U9O A;  3P1H A;  3C1E A;  4OGQ C;  2TSS A;  2RDH A;  1PDQ A;  1J8I A;  4XYO A;  5DAU A;  5M3M B;  1T5E A;  5I9P A;  1CZG A;  1JIC A;  3C1F A;  1AP0 A;  4BA1 I;  4KMU C;  1TT2 A;  5KYL A;  1EU3 A;  5E4X A;  3J80 L;  2NN6 H;  1C4Q A;  4FXG C;  3PUX A;  2YU9 B;  3NXW A;  1TY2 A;  3TDQ A;  5C0X I;  4OL7 A;  2RDG A;  1FNU A;  3U9S A;  1DOL A;  3T16 A;  1TWH B;  2JP1 A;  2JA6 B;  1NSN S;  1SBB B;  3NSW A;  4TRD A;  3QJY A;  2XNA C;  4XIG S;  3CRL C;  5BN5 A;  5FK9 C;  2PMZ B;  2XRS D;  2PPB C;  1XX8 A;  5CR3 A;  4C1N I;  3MEH A;  2B2W C;  2Z4I A;  5HUR A;  1QNU A;  3D4R A;  2XWJ B;  3NBI A;  2MUY A;  2IL8 A;  1SNC A;  4Y7N B;  4KD3 A;  5KGU A;  4HMI A;  2KOL A;  5A2Q E;  2F1M A;  2JA7 B;  1JB3 A;  4RCN A;  2A68 C;  3ND9 A;  3IKJ A;  5IGD A;  1V43 A;  4QUF A;  1DD2 A;  1SJH D;  1WTQ A;  2RSN A;  1WD1 A;  1ET6 A;  1EY5 A;  3E0J A;  1X3Q A;  2HDL A;  1ENC A;  3A8J E;  5TSS A;  3S15 B;  3S2D B;  4J8Q A;  2RBM A;  1Y1V B;  2DY7 A;  5KNB A;  5AFW A;  3GQB A;  1AZP A;  1HQM C;  1ZKO A;  4KHV A;  1WTW A;  2E2J B;  3OWE B;  3A7A B;  5M5W B;  5C5M A;  2BOS A;  2K28 A;  1DYQ A;  2FHT A;  4A93 B;  2IW3 A;  1I4P A;  3X3N A;  3RMH A;  3R2T A;  5IT9 E;  2IJ0 A;  1F2Y A;  1OXU A;  1WCM B;  4BY1 B;  1EEI D;  4RHS A;  5ISR A;  2J7Z A;  4C3J G;  4ZKC B;  2GA4 B;  3NTK A;  5COR A;  3GP7 A;  3E6Z X;  5CV4 A;  2FIN B;  2MGS A;  2NVX B;  2NTT A;  5K36 G;  4A3D B;  4BBS B;  4N9T A;  4CKB A;  2F0L A;  4KKS A;  2WAQ B;  4RGM A;  4BA2 I;  2XSC A;  4PNY A;  4TSS A;  3BZD B;  2YYZ A;  1B44 D;  2B2Y C;  3URY A;  2BA0 A;  2O4X A;  2R92 B;  2IWH A;  4KV6 A;  3OSO A;  2OXP A;  3TN2 A;  1ZYR D;  3H3V C;  3L3O C;  2ENB A;  3SEB A;  2EYP A;  4H44 C;  1CK1 A;  1LV9 A;  2JE6 I;  1O7Z A;  3NTH A;  5D3I B;  3WDN A;  3BYY B;  4WJW A;  2F0H A;  1SYB A;  3UI2 A;  1XXG A;  4C1N K;  1WTR A;  1F9S A;  2B2U A;  1JWU D;  2WKC A;  4F7X A;  1RF2 D;  1LTT D;  5E4W C;  1B53 A;  1F2M A;  3C2P A;  1EY4 A;  4G57 A;  3HOV B;  1GUT A;  5ELB A;  1SJE D;  2Q8R E;  2EJM A;  3L7Z C;  4K6D A;  1A2T A;  4IUT A;  3MAQ A;  3DWQ A;  4A3G B;  1ESF A;  1AZQ A;  3DMU A;  3KLR A;  3BVG A;  1Y69 U;  2Y0S B;  3MTS A;  3A8K E;  3OWF A;  5C5L A;  2FMM A;  1O7Y A;  1JCK B;  1B3A A;  2IX3 A;  2K6A A;  3ITP A;  1BF4 A;  2HCC A;  1H9M A;  1I4Q A;  1S5E D;  3HGB A;  3HP3 A;  4A3M B;  1G2S A;  3HKZ B;  1G91 A;  4RCO A;  1AEX A;  3I73 A;  3G6J B;  1U4R A;  4K14 A;  2R61 A;  4DNT B;  3GV3 A;  1HTL D;  4C3I B;  1SYG A;  4ZAI A;  1TQO A;  2KCN A;  1ENF A;  1SSO A;  3M7N A;  5KYI A;  4ULL A;  2AWO A;  1OXS C;  3DEP A;  1CQV A;  4C56 C;  3QWN A;  4FYD A;  5EPJ A;  1DON A;  2NVQ B;  1HXY D;  1EQV A;  3NP8 A;  1IW7 C;  2A68 D;  1EY7 A;  1EIH A;  1YNJ C;  3OMG A;  1TWF B;  3T53 B;  2J4X A;  1L0Y B;  2RSO A;  4ID6 A;  2I46 A;  1ILQ A;  2PCF B;  2Z1C A;  4EQP A;  3JAM L;  1RCV D;  1MBY A;  1CZW A;  4O1N A;  3IFD A;  3MXP A;  4G7O C;  1LTB D;  5FO7 B;  2EYF A;  3NK9 A;  1F77 A;  3DEO A;  1F9P A;  3QG1 A;  4ZQ3 A;  1E2V A;  4FXD A;  3NE5 B;  3KLS X;  1OO9 B;  3M7G A;  2C9O A;  2F4I A;  5J39 A;  1JE4 A;  1ET9 A;  1A2U A;  4ODG A;  3SK4 A;  5NUC A;  4XT3 B;  1Y1W B;  2WII B;  3M85 A;  1H9S A;  1SDF A;  2G9H D;  3IL8 A;  2RQX A;  1CQF A;  4F88 A;  4A3I B;  5ELF A;  1BOS A;  1SNO A;  1DM0 B;  2F0E A;  1SYC A;  5KND A;  3KBG A;  4RA8 A;  3QOL A;  1ESR A;  3CHB D;  4IUV A;  5M9O A;  1D5Z C;  3A54 A;  3I72 A;  2B2V A;  2SNM A;  1ENA A;  1LTI D;  2EE1 A;  5C0X H;  4X3S A;  2ID0 A;  2K5W A;  4X3K A;  1DOM A;  5G3L D;  1EYC A;  1STB A;  1Z7T A;  1RD9 D;  1H9K A;  3CQZ B;  4MIU A;  2G9D A;  3HOX B;  1QOH A;  4YIJ A;  2PYK A;  1VMP A;  2XN9 C;  3I8Z A;  1HQR D;  3NTI A;  2N88 A;  2F0T A;  3M3Y B;  1EIG A;  3X3M A;  1B9M A;  1PTO H;  2ICI A;  3LX0 A;  1I4G A;  5C4Z A;  1SND A;  2LFN A;  2PNR C;  4K5W A;  1CA5 A;  1H9J A;  2EOT A;  4IN3 A;  1S5C D;  3OMC A;  1I3Q B;  1M8A A;  1VF7 A;  5ELE A;  3OIP A;  3FVQ A;  3HOU B;  3TP7 A;  3SDZ A;  1HUM A;  2F0O A;  1YNN D;  4IFD I;  4KD4 A;  1D2B A;  5I4D A;  3BDO A;  3LWE A;  4U68 A;  5C44 B;  3EA6 A;  4A3J B;  3N52 A;  4BS9 A;  4E6I A;  4KY6 A;  1LT4 D;  4CJ0 B;  5CV8 A;  2NTS A;  1SE4 A;  1TVX A;  4KK7 A;  3HZX A;  2EYM A;  1Q8I A;  4KN4 C;  3K57 A;  5ELD A;  3H94 A;  4HCE A;  1NCV A;  2JYO A;  1BDO A;  3DXJ C;  4QMG A;  1IKM A;  4KTA A;  4HCS A;  5FLX E;  3L9A X;  4NW2 A;  4BY7 B;  2F0Q A;  3SK6 A;  3GTM B;  3QIA A;  2M00 A;  2HCI A;  4R8N A;  4CHT B;  4F87 A;  1U4P A;  1D5X C;  3QO2 A;  1XYI A;  1HTP A;  3EVQ A;  3NBH A;  5CBA E;  1ZXT A;  5KEE A;  3S16 B;  2X6G A;  3IFT A;  5IGF A;  1HFG A;  1STH A;  1TS2 A;  3D6C A;  1PFN A;  5E1F A;  4OIJ A;  1IW7 D;  4QB4 A;  1XWE A;  2A6H D;  3HRZ C;  1LT3 D;  2VB2 X;  3TP5 A;  3Q6S A;  5LL6 X;  1BNZ A;  1V1P B;  2L11 A;  3D4D A;  3NHH A;  2O5I C;  1TWG B;  2DNC A;  4IAL A;  4FVM A;  2EY1 A;  3PIP 3;  1TR5 A;  2B2U C;  5BN3 A;  1QNK A;  2B8F A;  5JPM C;  2M2L A;  1II3 A;  5EQ0 A;  1QCB D;  3ONA B;  4FF3 A;  3HS0 C;  3W3A A;  1PRT B;  4H13 C;  4OO1 H;  1A6X A;  3CKI B;  2ICE C;  1TII D;  2NUC A;  2A6E C;  3EJI A;  1PZJ D;  2F3V A;  3PUW A;  5C0X J;  4RFB A;  1UUP A;  1WTX A;  3ND8 A;  1HHV A;  2QCP X;  5EBC A;  4FP5 D;  4C3J B;  3BVZ A;  1LAB A;  1LO5 D;  2K03 A;  5CV6 A;  3PUZ A;  4IUP A;  4IUQ A;  2VXW A;  2R3Z A;  1EY9 A;  2EZV A;  4I65 A;  3K59 A;  3VYU A;  1HA6 A;  3KUP A;  1A3V A;  1PRT D;  4OIK A;  1K8O A;  5CV7 A;  3TZD A;  4RHR A;  3K5O A;  1EY6 A;  1SNQ A;  4RKL A;  1W6K A;  3K5M A;  1G8Z D;  3J80 E;  3J7A V;  1D1K A;  2OT2 A;  4B9X A;  2L0C A;  4K2K A;  1KAA A;  5JEA H;  2JXM B;  1CTM A;  3R93 A;  4V19 0;  5IIF A;  5EPK A;  3GTK B;  4K8J A;  2NVY B;  3V2T A;  1TS4 A;  4IUU A;  1PYW D;  5K5P A;  2FMC A;  3KF8 A;  2JEA I;  2K04 A;  2NN6 G;  4F8M A;  4A3B B;  5JVG 3;  4U67 3;  1B4O A;  1NR2 A;  2AQ1 B;  1EY0 A;  1PRT F;  1NR4 A;  1O7L A;  3P20 A;  3LNN A;  1Z47 A;  3E5S A;  1GXD C;  3DWP A;  1OXT A;  1Y8N B;  2PW7 A;  4PMW A;  3GTQ B;  2QKI C;  2A69 C;  1Q1E A;  4JBW A;  2NZ1 D;  2KJX A;  5CMD A;  3SK5 A;  3BYT B;  3VYT A;  3MA2 B;  2JA8 B;  1GHK A;  1SAP A;  1CT1 D;  5JJZ A;  4ZUJ A;  1LT6 D;  2KED A;  1IYV A;  1RTO A;  3N6R A;  1BCP C;  2SDF A;  2VNU D;  1ZEQ X;  5CV9 A;  1PZI D;  2EYO A;  3FEW X;  3PV0 A;  2BE5 C;  1QE6 A;  2NB0 A;  4CJ1 B;  2RDF A;  2SNS A;  2WV6 D;  2H1E A;  4RWS C;  2K5D A;  4LK1 C;  3BVM A;  1V8Q A;  2V4D A;  4L63 B;  2QIL A;  4LMQ D;  5J22 A;  3HEJ A;  3ERO A;  3OIQ A;  4LJZ C;  3FRP B;  2B2V C;  1KDC A;  2PW5 A;  2M9V A;  3J81 E;  5C3W A;  2C5C A;  1Y8P B;  1BO0 A;  2AQ2 B;  1IYU A;  1EOT A;  3TP6 A;  2XVS A;  2WB1 B;  2RKS A;  5C3E B;  2WP8 J;  2EY2 A;  2WAC A;  2NBF A;  2EPB A;  1PZK D;  1QJO A;  1GHJ A;  2CW0 C;  2I07 B;  5JOB A;  2NVT B;  2FFK B;  2EYL A;  4PV1 C;  1BBX C;  4PMB A;  1STY A;  1G2T A;  3S1N B;  1SFO B;  2PO4 A;  1FNV A;  1TWC B;  5C4H A;  1PTO C;  4S3S A;  4N9P A;  1OXX K;  2O5J C;  1I4H A;  5IOD A;  2A6E D;  4BBR B;  2F0S A;  4DN4 M;  3NQI A;  3C3L A;  4DU9 A;  1WVL A;  3RD4 A;  4EQN A;  3A55 A;  5JEA J;  3Q23 A;  4KKT A;  2L55 A;  3GTJ B;  1DXM A;  3I4N B;  1DZ1 A;  3S17 B;  1CHP D;  2B39 A;  3K0Y A;  4KY7 A;  1QIL A;  3TME A;  4HR7 B;  5EKI A;  4FXK C;  3R8B A;  4KN7 C;  4CJ2 C;  1EL0 A;  4G4K A;  1S5D D;  1BXT A;  5C3X A;  1EY8 A;  4IFD H;  4DNR B;  5KIX A;  1A3T A;  3QB3 A;  3I91 A;  1G6Z A;  3RLF A;  4FNF A;  1SMY C;  2CHB D;  1GJX A;  1WTV A;  4XDX A;  3K7A B;  3HG9 A;  4ZUI A;  1IL8 A;  5T1G A;  2TMP A;  2R6G A;  3H09 A;  1BR9 A;  2RA4 A;  1B2T A;  2D62 A;  1ONL A;  3S1R B;  5JVH 3;  5M3F B;  1J9O A;  1H9R A;  4Z9C B;  1ILP A;  4ZK9 B;  1F9Q A;  2IX1 A;  4KJO A;  1GUO A;  2K05 A;  2NYZ D;  2EY6 A;  4XT1 B;  1QG7 A;  4RAU C;  2A69 D;  4LAA A;  1UEA B;  5M5X B;  1TS5 A;  4FO2 A;  1AW7 A;  3FDT A;  4ZRZ A;  4C3I G;  4V0B A;  3AMU A;  4O42 A;  3RZD B;  3SHL A;  3JAM E;  1BCP D;  2PZW A;  1O78 A;  1DOK A;  1TS3 A;  3I90 A;  1GUN A;  3SXH A;  3VA5 A;  5CGK A;  5I6Y A;  4XQQ A;  3BG3 A;  5EJW A;  2KUM A;  3MC0 B;  5LL6 S;  3V96 A;  1WD0 A;  1EZ6 A;  1CM9 A;  1HRJ A;  2NWG A;  5J1Z A;  4DK1 A;  4HAE A;  2E2D C;  4FF4 A;  3TSS A;  2F0I A;  2MHV A;  4A3F B;  3S9W A;  5FOB B;  4J6H A;  4GZY C;  1PMR A;  1CI3 M;  5HGT A;  3VR6 A;  5G3L F;  2D5D A;  1R9T B;  2JSO A;  1MD2 D;  3Q0A A;  2E2I B;  1M4V A;  2CW0 D;  2EJF C;  1TKW B;  4HED A;  3NWT A;  3GTG B;  2F0K A;  3GV6 A;  5D65 A;  3NQT A;  4M1U B;  3WOF A;  1HUN A;  3TZU A;  1EEF D;  4K5X A;  2CVR A;  3R2I A;  3GD7 A;  4IZ8 A;  1I4R A;  3FPP A;  4NKL A;  3A8I E;  2HUG A;  4DAV A;  3HOW B;  1D6E C;  3AB9 A;  3VR4 A;  3NUC A;  5FO8 B;  2X6L A;  1JOQ A;  5EPL A;  5IGE A;  5F2D A;  4IFD J;  3I4L A;  5C0X G;  1HA5 A;  1JWM D;  2WIN B;  4G7Z C;  3DWA A;  4EQO A;  3EQL C;  4XTC S;  2EYH A;  1R4P B;  5IGB A;  3VYS A;  4QF4 A;  1KTK A;  4C3H G;  1EFI D;  3K5L A;  3P75 A;  1B50 A;  3FPU B;  5EBD A;  5C6A A;  1QWY A;  1BUV T;  1U4L A;  1YNJ D;  3SR1 A;  4CBV A;  2F0P A;  1EZ8 A;  3SE0 A;  3S1M B;  4KJN A;  1Z6H A;  2F0M A;  4K5V A;  5A2Q L;  4B08 A;  3O13 A;  2F03 A;  2E2H B;  2AUK A;  3DHQ A;  1SMY D;  4DGZ A;  1ICW A;  2F0F A;  1A3U A;  2EDG A;  1X32 A;  3OOC A;  5IOC A;  1G29 1;  2DNE A;  2XIW A;  3GTP B;  1LTR D;  2E75 C;  1RKN A;  4R9W A;  1EWC A;  1V1P A;  1AN8 A;  4WRD A;  2EJG C;  2EVB A;  1UNS A;  3J7Y W;  5COY A;  1E0B A;  2DY8 A;  3T56 B;  4ZYS A;  1JR0 D;  2XRQ D;  5EKK A;  2Z8L A;  5CBE E;  2IPK D;  1PLF A;  3DM1 A;  4CKC A;  2K01 A;  2J0T D;  3K5N A;  5DM7 3;  4FF1 A;  2QF7 A;  1X3P A;  1EQT A;  1FGB D;  2B8G A;  4MHE A;  5I2X A;  1SYD A;  1LT5 D;  2AWN A;  3WOE A;  1MSG A;  4CKE A;  5IT9 L;  2PZT A;  1HPC A;  5K36 H;  4UAI A;  1Y8O B;  1MGS A;  3H91 A;  2RVL A;  1EYD A;  4RGT A;  4DK0 A;  1FD7 D;  1S5B D;  5CV5 A;  3GTL B;  1I6V C;  3MFG A;  2IT1 A;  1F2Z A;  2DN8 A;  2BDO A;  2PQE A;  1NAP A;  4HTH A;  4QCL A;  3LWU A;  4L8J A;  5BN4 A;  4L6T B;  3TBI B;  4HN7 A;  2LY7 A;  1RHP A;  4I7Z C;  4PQX A;  3PMF A;  3ZYY X;  2EYJ A;  5JAV A;  1CA6 A;  5I9O A;  3CU7 A;  1V1O A;  1E2W A;  2QDB A;  4A3E B;  1S4Z A;  3Q22 A;  1FR3 A;  1Q3L A;  1GUS A;  2KEE A;  4IQZ A;  4QUC A;  4OO1 G;  1RTN A;  4ILW A;  3I3C A;  1KDB A;  3TP8 A;  3J81 L;  4K8I A;  2BDN A;  1VMC A;  3VA7 A;  4TQU S;  3V05 A;  4XQJ A;  5DNF A;  1SNM A;  3C46 A;  1W6J A;  1I6H B;  1KNE A;  4AYB B;  4PMC A;  1F2L A;  5ELC A;  4ABN A;  1EU4 A;  4MN3 A;  1I4X A;  1JWS D;  1NUC A;  2B2T A;  4UDU C;  1TU2 B;  4EGV A;  2NN6 I;  2KHS A;  3QOJ A;  4G7H C;  2Z4H A;  4XXE A;  3EFX D;  2SOB A;  2A74 C;  2E74 C;  1RDP D;  4X3T A;  2D2C C;  2CQA A;  3K58 A;  1UAP A;  5DM6 3;  5KRU A;  1JC7 A;  1OXV A;  5IGG A;  2L1B A;  4ZLT F;  5JEA G;  3J7A F;  1VF5 C;  4OO1 I;  2BCO A;  2AUJ D;  1E2Z A;  2MJ8 A;  1IKL A;  3BDC A;  3K6O A;  1PFB A;  3PO2 B;  3MXU A;  1Q1B A;  1KAB A;  3ERQ A;  1SXT A;  2A5H A;  3T51 B;  4DXG A;  3A56 A;  4RKB A;  5I6W A;  4KI0 A;  1U4M A;  4JK1 C;  4J1M A;  1C48 A;  3FMC A;  1BQQ T;  5D3D A;  1A15 A;  2KA7 A;  5C4J B;  5M5Y B;  2VUM B;  1GUG A;  1YNN C;  1I50 B;  1VCI A;  2F0D A;  5E3F A;  1ROD A;  1FYC A;  4KHZ A;  1ML0 D;  2L5T A;  2ZT9 C;  2B2W A;  3R3O A;  4NMZ A;  4Q0F A;  4DA2 A;  3KBX A;  2WKD A;  3HOY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...