5C6AA

Crystal structure of staphylococcal nuclease variant delta+phs l25e / n100e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKEMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVEEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25E / N100E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c6aA00
5IODA 5IGDA 3DMUA 4H7BA 2F0OA 4WRDA 2NUCA 3C1FA 1KABA 1SYGA 2ENBA 4KY5A 4PMCA 5I9PA 4WORA 2F3WA 4KJOA 2F0WA 1RKNA 4DGZA 2KQ3A 2PZTA 4HMIA 4K2LA 5CV8A 1EY5A 2EYJA 4HTHA 3D4WA 3DHQA 5CV5A 3NP8A 4KHVA 3C1EA 3HZXA 4NMZA 4E6IA 2F0SA 4EQNA 5IGGA 4F8MA 5KRUA 5EKKA 1JORA 5HURA 1SNDA 2F0EA 3SK5A 1A2UA 3NUCA 1EYDA 2F0QA 4N9TA 1F2ZA 2EYOA 3D4DA 4K5VA 3MHBA 3SK8A 4DFAA 5I6WA 2EY2A 4G57A 5C4HA 2SNMA 4EVOA 3SR1A 5JAVA 2RBMA 4K2KA 5EGTA 4DU9A 1A3TA 2F0IA 1EZ6A 1F2YA 3ERQA 4ID6A 4KTAA 5IGBA 3MEHA 1EY7A 4B9WA 5KYIA 2M00A 5IGFA 5CGKA 2SNSA 5E3FA 3BDLA 5KIXA 2F0LA 1SNQA 1STYA 2F0GA 4F7XA 3EJIA 5KGUA 4QMGA 4ZUJA 2OF1A 2F0TA 1SYCA 3V2TA 4B9XA 5C4ZA 3OMGA 2LKVA 5C3XA 1SYBA 4EQOA 4TRDA 5IOCA 5J22A 3OMCA 4J6HA 1EYAA 4NKLA 3NXWA 2F0DA 2EY1A 5CV7A 1EY6A 3D6CA 5HGTA 2RDFA 2PW7A 3SHLA 1JOQA 4MIUA 3E5SA 5C3WA 5IIFA 1ENAA 4ODGA 4QF4A 2F0KA 2F0MA 3VA5A 1EY9A 2OXPA 2PW5A 2EYHA 5M9OA 2KHSA 1A3VA 3HEJA 4KV6A 4S3SA 3R3OA 5CV6A 4K8IA 1IHZA 1NUCA 3TP8A 2WACA 4K8JA 1KAAA 2F0VA 4N9PA 1EY8A 1KDBA 1TR5A 2F0PA 4QB4A 2QDBA 4RKLA 3RUZA 5IGEA 3TP6A 2F0UA 3NQTA 2F0JA 4KY7A 3S9WA 1SNCA 1STHA 2EYLA 1EZ8A 2PYKA 3ITPA 3PMFA 5I6YA 1ENCA 2EYPA 4K5WA 1SYDA 3MZ5A 4PMBA 1KDCA 4R8NA 3SXHA 1SYEA 1U9RA 4KD3A 5NUCA 3BDCA 4ZQ3A 5C5LA 1TT2A 2EYMA 5I9OA 5IGCA 5C5MA 1STBA 2EYFA 2F0HA 2HQEA 5JOBA 3LX0A 4DF7A 4KJNA 4NP5A 2SOBA 1A3UA 2F0NA 3P75A 3NHHA 4OL7A 1F2MA 3NK9A 1JOOA 1SNPA 2EXZA 3OWFA 4NDXA 5E1FA 1JOKA 5EKLA 3SK4A 1TQOA 2PZWA 2RKSA 5J39A 3EVQA 3U9OA 3P1HA 2OEOA 1STGA 4KD4A 2O4XA 4K6DA 3TP5A 3QOJA 4I65A 4IALA 3T13A 4K14A 3T16A 2F3VA 4IUNA 1EQVA 3QOLA 1STAA 1AEXA 5C6AA 5ISRA 4ME5A 2EY6A 4PNYA 3TMEA 4RKBA 5KYLA 5J1ZA 1SNOA 4YIJA 3QB3A 1A2TA 4LAAA 3EROA 4KY6A 5CV4A 5KEEA 5CR3A 2PZUA 3SK6A 1EY4A 4EQPA 3OSOA 1NSNS 3H6MA 4IZ8A 4ZUIA 3D8GA 3MVVA 3TP7A 4HMJA 1STNA 1EYCA 5CV9A 3MXPA 5DEHA 5K5PA 5F2DA 2EY5A 1SYFA 1II3A 2PQEA 5CC4A 2F0FA 1EY0A 1KDAA 4J1MA 1SNMA 4K5XA 5DAUA
chains in the Genus database with same CATH superfamily
4XT3B 4KHZA 2HHHL 3R93A 2WFWA 3K80C 2L9HA 3A8KE 2KCNA 4O2DA 4QJFA 1JWUD 5IGGA 3T56B 4E6IA 3KBGA 2YTXA 2Y0SE 1HUNA 3D4DA 2H5XA 3AU7A 1GUSA 3SR1A 4HJ5A 3I90A 3G71A 3MC0B 5FOBB 4XQNA 2H1EA 1EY7A 3A0JA 4BS9A 3AEVA 2E5LL 2JN4A 2UXBQ 2NZHA 1WVLA 4FXDA 2M9VA 2B8FA 3CCVA 1KL9A 1XPUA 1PZJD 4CDFC 1SYBA 2MO1A 1ESFA 1Y1WG 2VUMB 2IPKD 4DUYQ 1QZGA 4A93G 4A3DG 2Z6BA 4FF4A 1VQMA 2K1BA 4JI6L 3K5NA 1RTNA 3K0XA 2ALYB 1Q86C 1A3VA 1QE6A 4A3FB 1BXTA 3CMEA 4LFBQ 1PRTB 3WDNA 4K8JA 4A3GG 2YU9H 4GN3B 1V1OA 4JOIC 3F2BA 4UPAA 2F0JA 2I5LX 4EQ5A 1SEBD 4FNFA 3BDCA 1TVXA 4KHPL 3BVZA 5JOBA 4A3LH 1E2VA 2B63H 1N36L 2SOBA 5LL6S 1TWHH 3X3NA 4OL7A 1FYCA 4BXXG 3RZOH 4RMFA 1XPOA 4A3CH 3NWSA 1CA5A 2QGQA 4GS3A 3OHXC 5IODA 3J80L 1DCZA 2IWHA 4R9WA 3MXGA 1EQTA 3FMCA 1EIGA 3VYRA 4HIMA 4LAAA 2IW3A 1BNZA 3PIPA 1S72A 1SMXA 1NSNS 3H6MA 3MAQA 2C9OA 1EYCA 3VR4A 3HOVH 4C1NK 4C56C 2XRQD 2V4DA 2UU9L 2R61A 1EIFA 2NZOA 1DXMA 3C1FA 1SYGA 4C3JB 5CORA 1VQ7A 5FLXL 3JAMi 1HNXQ 1NBWA 2CWAA 2CQOA 3EFXD 2UXCQ 2UXDL 3H09A 2UXBL 5D65A 1B44D 1IBMQ 2RQXA 4G57A 5C4HA 2SNMA 4A3IB 3HGBA 2ES2A 3M3YH 3K81C 1I4QA 5JEAG 3M4OB 3BYYB 3CP0A 4C3IG 1DYQA 1I50B 2D0PA 3S17H 1H9JA 2OQKA 3UDXA 4C3IH 1B50A 1FGBD 4V190 4C2MB 3HS0C 2E2HB 1QNKA 3D6WA 1JJ2A 1C7YA 3T4AC 3KDFB 1XYIA 5IOCA 3KBXA 3T53B 1PV4A 4RHRA 4R1JA 3URYA 1WOCA 1LABA 2E2JH 4ULLA 1GKHA 3K7AH 4KLKA 4ODGA 5G3LD 2A69C 5HY6A 1B4OA 2IHFA 1Z9FA 3S1NH 1CM9A 1B3QA 1DONA 5LL6X 1G291 3PUZA 1PRTF 4BY1G 2PMZB 3GTGH 2F0PA 1JE5A 1SMYC 2Z0SA 4ZCKA 1VQBA 2WINB 1Q1EA 3FRPB 2XGTA 1K83B 4N8X1 1C9OA 4IUVA 4DV7Q 2X6GA 1KHIA 3UI2A 4A3JB 5ELEA 1G6PA 4FF2A 2KEEA 2WB1G 1S4ZA 2G5DA 5M5WH 4AIMA 4KK7A 3KJPA 5E4WC 1IW7C 1SFOB 1VQIA 1TXYA 4Y7NB 1K73C 4GN5A 5FLMG 1ZXTA 4OONA 3S2DB 4GOPA 2NVTH 1NR2A 2RF4A 1U5KA 3T16A 1B53A 4H44C 1EEFD 1G2SA 4UAIA 5BN5A 2B39A 2EE1A 3I73A 1K8AC 1NTGA 3EROA 4OWWB 1HQMC 1EYGA 4LUOA 1W3SA 3HOUG 3VR6A 1IBML 2VUMH 4A3KG 3DMUA 1V1PB 4H7BA 1PZID 5I9PA 5A2QE 1QVGA 5T1GA 2HIXA 3S1QH 1SLJA 5CV5A 2ZTDA 1PTOD 1L1OB 2A1AA 1ZYRD 3FHWA 3KLWA 4EQNA 2A6HD 2B2VC 4DV2L 1TIID 4G7HC 3J7AF 3M4QA 1QB5D 2RBMA 1L2FA 1X6OA 1LTGD 2D2CC 2R3ZA 1EZ6A 2PPBC 3ERQA 1EFID 4ID6A 4CJ0B 4IUUA 2JA6H 2K28A 5EBCA 3I7FA 1PH8A 4BA2I 1VF5C 2F0DA 3D0FA 2RDFA 5C4JB 3CKIB 3I91A 4WJ3M 1NAPA 5IIFA 1ENAA 5CYUA 3CCQA 4C3HH 2F0MA 1EIYB 4K0KQ 3MEFA 4DV7L 1I4RA 4X66Q 1HNWQ 2VW9A 1R4QB 4R4OA 5L37A 4FF1A 1ILQA 2QDBA 3GO5A 4JBJA 4KY7A 3UE1A 2K5NA 3S1RB 2N49A 2O5JC 2QA4A 3TN2A 3JAME 1HJPA 2E74C 2NVYB 4KKSA 3L7ZC 2EQSA 4C3JH 4JI3L 2RDGA 3EIVA 5ELOA 1Q82C 1XXGA 2ZTEA 1GHJA 4Q5VA 1E1TA 1SAPA 4ZKBB 4V0BA 3KLRA 2F4IA 2Z6KC 3T13A 4K14A 3V05A 1AEXA 1L0XB 1CKOA 1YVCA 4YY3L 2MNAA 2EZVA 1QG7A 4L5QA 1I50H 3NSWA 1YHQA 1WI5A 4DR3L 2JA7G 1U0LA 3W5OA 1CZGA 4C2MH 4LF8L 1I3QH 4PZ6A 2E2HH 1MHWC 3PUVA 1II3A 2PQEA 4JPBW 4P72A 4K5XA 5IGDA 3A74A 2I07B 4YHHL 3K59A 2X6LA 1MIUA 4KJOA 4P73A 1Q81C 2LS01 2OTLA 4AQYL 1EY5A 2C5CA 2F03A 1VQAA 1NE3A 1X3PA 2LFNA 3SK8A 4B3MQ 1WTWA 1YITA 2A19A 3MHBA 3H91A 3G6EA 2HCCA 5C0XI 4DR6L 1KXLA 1NMFA 2DJFC 1DD2A 4A3EB 1Y8PB 4LUZA 3PF4A 3BDLA 2R92B 1F2LA 5M3FB 4A3JH 3V2TA 4B9XA 2N78A 1EEID 3OMGA 3HOWB 1HFNA 1CQFA 4DK0A 2ZJRA 5IYDH 1EYAA 1XMQL 1QUQA 2J7ZA 2RSNA 5IE8A 5IYCG 2XNAC 5C3WA 2Z9HA 1PFMA 3I4MH 3S2DH 5ELBA 1J5EL 3M4YA 1V1QA 4DV5Q 1NR4A 1X65A 1UE6A 4GN4B 3BZDB 4LFCL 1BF4A 5CV6A 4KMUC 3CXCA 4DR5Q 3CC2A 2JXMB 2O5IC 1O80A 3T1HL 2JEBI 3IFTA 4KN7C 4UHVA 2MO0A 5COYA 3IFDA 4DV6Q 1OXXK 1IYJB 4CDEC 3I56A 2F52A 3STBC 1H9MA 1SYDA 1B8AA 2G9DA 4RGTA 3GTOH 2QILA 2FMMA 2CWPA 4OX9L 3I72A 4X65L 3SEBA 4BY7B 1L0WA 3A8IE 4J8QA 4MZ9A 4DXFA 4JI0Q 1A3UA 1VCIA 1QVFA 2XWBB 1JE4A 1R9TB 2KECA 4R8IA 1VQ5A 4UP8A 4RFBA 3TP5A 1Z7TA 4K6DA 2FJ2A 1E22A 2NVQB 1K0SA 1L1OC 2WAQG 1PRTD 4IPGA 2K5WA 4RH6A 1PH9A 2JEAI 1TWGB 3F1ZA 4RKBA 4DNIA 1TY0A 1WCMB 1HFGA 4LUVA 4DR4L 1KRSA 3L9AX 1EOTA 3OSOA 4DA2A 1X3QA 4ZUIA 4LF4L 1FJGQ 4HMJA 2EDGA 3OIQA 4DV4Q 1E2WA 4H02A 1TY2A 3RMHA 4JYAQ 3CC7A 2NWGA 1LTRD 2E2IH 3W1BA 1LTTD 1BCPD 3PO2B 3D4WA 5LHY1 1PH6A 4R4TA 4HR7B 4C1NI 5EKKA 2MQHA 2Z1CA 1MGSA 4K5VA 3A5UA 4BBSB 1BR9A 2EJFC 2HDLA 4DR7Q 4GKKQ 1B3AA 1X9NA 1TKWB 3I3CA 1Y1WB 1HNZQ 3S1RH 4KTAA 5IGBA 2IJ0A 1SE2A 4IJHA 5E3FA 2NVYH 4XT1B 2JJQA 2F0GA 2QF7A 5LMNW 4DV3L 4DV5L 1SE4A 5I2YA 4LF7L 4OWXB 1K8GA 2JYOA 2CH4A 1KD1C 4LFAL 2GN5A 3IL8A 4X3UA 1EIHA 3J80i 4MIUA 1LO5D 1TWCH 4OWTB 3VYUA 4GOPB 3CCEA 2B2YC 2HHHQ 4JI2Q 2O2LD 5BR8Q 4GLXA 5M5XB 1WFQA 4U673 1CSPA 4S3SA 3O13A 5K36G 1FNVA 5I4DA 4QUCA 3U50C 1SN8A 2NN6H 2LY7A 5AFWA 3BU2A 3PUXA 4QB4A 3NE5B 2AQ2B 4CDDC 5AJ3L 3NTIA 3EN2A 2FINB 1H9SB 2PYKA 3GTPB 4BBRG 1N33L 4PZ7A 2DGYA 1HUMA 5I9OA 4A3BB 4YWKA 2EYFA 1I4GA 4O42A 2E5LQ 3S14B 5H1SE 4O1NA 2JA8B 3I4OA 5J39A 1CK1A 4HIOA 3OTOL 4I65A 3HOYB 2F3VA 1KLUD 2K5VA 1UEBA 1HXYD 4JI6Q 5C3EB 2BE5D 4HEDA 4TKOB 1A6XA 1O78A 3Q0AA 4A3EH 2L11A 1PFNA 1MI2A 5M3FH 5DEHA 1BBWA 1STNA 3ICEA 4A4IA 1Q12A 3NELA 2DN8A 3HOWH 3KF6A 3GTQB 4DR7L 2KHJA 3KF8B 3HOZG 2K50A 3A5ZB 2BDNA 5DNFA 4KHPQ 1IBLQ 5FJ8G 2K33A 1N36Q 1VQCA 2JA5B 3FKIG 3K6OA 1O7LA 2NZ1D 2EYOA 3FKIH 2EY2A 5JVG3 1WTRA 5EGTA 2I0QA 3HOXG 3LWUA 3IAYA 1RL2A 3I2ZA 3PQIA 3TRZA 3I70A 1IYUA 2SNSA 5CGKA 1A0IA 3HFZB 4R4IA 4JI2L 1LV9A 1V9PA 5BR8L 4JBMA 1LTBD 4ZUJA 5C4ZA 4EQOA 4DXGA 1PH4A 3NXWA 2K5HA 4BY1B 3PCOB 5JPNC 2UU9Q 3BG3A 3H0GG 3J81j 1QVCA 1YNND 4HCEA 1YZ6A 4H0LC 1XJVA 1MJEA 1HR0W 3H0GH 2A68D 2NVQH 1LACA 1I94L 1TWGH 1V43A 3ND8A 1WCMH 3RR5A 1J8IA 1KAAA 2UXDQ 3H94A 3MWYW 2B2YA 1EL0A 3NWTA 4RHSA 1I4PA 1STHA 2M2LA 2XN9C 4JV5L 2D5DA 1X54A 5JVH3 4P74A 3OYYA 4M1UB 5ELDA 4PZ8A 2I46A 1ONLA 1EUJA 1MBYA 1PTOH 5GQOA 2UUAL 2EOTA 3PO2H 1A62A 1TWAB 1SNPA 4TQUS 1PTOC 5EKLA 2A73B 1ZYRC 3A55A 3HKZB 1AFPA 5LMNL 4BBSH 2RHQB 4HIDA 4B3RL 3CRLC 4A3KB 3QB3A 3E9IA 1F77A 4A3LG 1VMPA 4GNXA 2B63G 4IZ8A 3K5LA 2IX3A 3TP7A 2YYZA 1IBLL 3CAMA 1CKNA 1M8AA 3NEMA 1SYFA 4GLVB 2F0FA 3J80E 1ML0D 2J4XA 4A3CG 3SGIA 1BCPB 2E2DC 1AH9A 2XRSD 3DLLA 1HPCA 2B2TC 1TS5A 1SR3A 3DHQA 1B70B 5M5XH 3NP8A 4KHVA 2WAQE 2BH2A 2RVLA 1EWIA 5I6WA 2VXWA 2DY7A 2EVBA 1K3BC 1SSOA 2FMCA 3HOVG 1Y1VB 1T5XD 3K58A 1F2YA 5FLXE 4DN4M 1YNJD 1VQ6A 1JCKB 3GTPH 1H95A 2KVMA 1SROA 4B9WA 4CKEA 5IGFA 1GVPA 4L6TB 4A3BH 5D14A 4BWGB 1FR3A 1YHBA 5J22A 4TRDA 3I55A 2KA7A 3S14H 4NKLA 4NB3A 3IKJA 4KKUA 5HGTA 3QG1A 2UUBL 3U4VA 3SHLA 2JA8H 2B8GA 3EA6A 3R2IA 2E76C 4CKBA 2F0KA 1IKLA 4LF5L 3GTLH 2NYZD 5C3EH 2R7ZB 4U68A 3BZKA 1EY8A 4AYBB 2KBNA 2PQAA 4FVMA 2GVBA 4DV2Q 2KJXA 3S9WA 1SNCA 3CCSA 1FNWA 3C3LA 3LGJA 2EYLA 1Y14B 2RDHA 3PO3G 1GD7A 2WP8J 1TWFB 2EYPA 1VQPA 3M7NA 4IFDJ 1Y8OB 3SXHA 3ULJA 3RLFA 1WJJA 3H15A 3PO3H 3A56A 1O7ZA 4AH6A 3J7A5 4IFDH 3ER0A 2N8NA 5DM63 2OQ0A 4K6LA 1UUPA 4CKCA 4FYDA 2F1MA 4LK1C 3QJYA 3DWAA 2JA5H 5EAYA 4IN3A 3MXNA 4F88A 4IALA 1HHVA 1MJCA 4A3MB 3V96A 3GTMB 1VQLA 4PNYA 2PNHA 1SNOA 2AKWB 5GAHC 1X3EA 4H13C 1HR0L 1XMOQ 3AFPA 1KIXA 4JOIA 2JSOA 2P5ZX 2IY5B 1X56A 2Y0SB 4OXPA 2PI2A 4DR2L 1EY0A 1WTQA 4N9TA 1BCPF 5C4XB 1SXTA 1YIJA 3CU7A 2XTIA 2F3WA 2OWOA 2I5MX 4GLAC 1D5ZC 2EYJA 3DWPA 1ZKOA 4JI3Q 4NMZA 1DZ1A 4F8MA 2F0EA 3SK5A 2XWJB 3GP7A 2DNCA 3S2HB 2QCPX 2B2TA 2VUMG 3CW2C 3ULPA 4LJZC 5KIXA 1PDQA 4YY3Q 3RN5A 3EBEA 5IP7H 1AW7A 1I5FA 1G91A 4DAYB 1CZWA 1FGUA 1UEAB 4DR3Q 1RF2D 1N8RC 2ATWA 1A63A 4LF8Q 2GVAA 1TWAH 1EY6A 4A3FH 1Q46A 2K7VA 4IUQA 3NBHB 1IL2A 3CHBD 3HP3A 3KOJA 3UDFA 4YHHQ 4DAMA 3PUWA 4KV6A 1JT8A 4FF3A 1LT4D 1PRTC 4AQYQ 4FXKC 2JA6G 4N9PA 3E9HA 3RN2A 2A8VA 4DR1L 3LWEA 5IYBH 2V1CC 1PVOA 3FVQA 1VQ4A 1MKHA 3OW7A 2DUDA 4DR6Q 1SYEA 4XQJA 1CT1D 5C5MA 1STBA 2FXQA 4C3HG 5JJLA 3S15B 3T51B 3S1MB 3P75A 4DV0Q 1LT5D 1U4LA 5IT9c 3CCMA 2KCMA 3IRBA 1XMOL 4JBKA 4YCVA 1XMQQ 2ZJQA 4XIGS 2HCIA 2HT1A 1D7QA 5BN3A 1STAA 3M4PA 4IUPA 4GZYC 1Y1VH 4RCOA 1I6VC 4QIWE 1J5EQ 5KEEA 3DXJC 1BUVT 2PZUA 3SK6A 4C3JG 4LFCQ 1ICWA 4EQPA 4POFA 1I4XA 3RZDB 2BA1A 2EY5A 3T1HQ 3OIPA 2Q2HA 1LT3D 4WJWA 2ZT9C 4ZKCB 2F0OA 2PI2E 2IL8A 4APVA 2F0WA 1RKNA 1PA6A 3CCLA 4K2LA 1Y8NB 4OX9Q 1HZCA 3BDOA 4X65Q 5KNBA 4A3IH 1NNXA 4DUZL 3Q24A 3UE0A 1A2UA 3M4OH 2R7ZH 4NXML 3H3VH 4JVZA 4DFAA 1P8LA 5JAVA 4K2KA 4JI7L 3A7AB 3DUZA 1NY4A 3H3VC 4G4KA 2EPBA 2RSOA 3MEHA 5KYIA 1ILPA 3CQZB 3MA2B 3D4RA 1JICA 3DM1A 3TS2A 4DR4Q 4QGUA 5CBAE 4LF4Q 2OTJA 3G48A 3L2PA 5LMUL 1QZHA 5FKAC 2CHBD 4OO1H 1JOQA 2Q2TA 5IWAQ 4XDXA 3S16B 3D31A 1SJED 2R93B 5M9OA 4A3MH 3GTMH 2A6ED 3L3OC 1Z6HA 1K83H 1D6EC 1IHZA 2BE5C 5ELNA 2WACA 4A3JG 4GNXB 2B2VA 1D1IA 3KK7A 4DV0L 2WIIB 4Y52H 5IYDG 4JI8L 3VDYA 2L15A 4QL5A 1TT2A 1SFOH 5IGCA 5C4XH 5M5YB 2ZTCA 4B08A 4Y7NH 3I4MG 5BN4A 5M3MB 3C46A 1VQNA 1YJ9A 1C0AA 2QKIC 2L5TA 1BVSA 4DAPA 4DV3Q 1SE3A 2L4NA 4LF7Q 3SK4A 1E1OA 3BVMA 1TQOA 1YJWA 1O7YA 1XNQL 3PSIA 1FNUA 3EVQA 2N3SA 1HZ9A 2Q2UA 4LFAQ 1AP0A 2QDLA 1F9QA 4XYQA 3N52A 5J1ZA 4JI4L 3J7ZC 2DJGC 1JB7A 5GAEC 2MUYA 1DM0B 3CCUA 3KUPA 3SDZA 5F2DA 1ZEQX 1LTAD 4X64L 4J1MA 5AJ3Q 2TSSA 2MP1A 5DAUA 5EKIA 2NTTA 1W6KA 3FDTA 5C44B 2BDOA 2AHOB 4LW1A 2NUCA 1KNAA 1IBKL 4P2CB 1N33Q 2B29A 2JA9A 3LNNA 5FO7B 4DGZA 5CV8A 4IQZA 2Q8TA 3VA7A 3K5MA 4HTHA 2AWOA 1YNNC 3I4NB 2F0SA 2A68C 3KYHC 2C35B 3NUCA 2K05A 4EVOA 1IKMA 1Q3LA 4J15A 3K5OA 5FO9B 1O7IA 2Z6KA 4PQXA 1RDPD 2KOLA 1U4MA 3OTOQ 3QR8A 2HIVA 1AZQA 5IWAL 4JI5L 4XXEA 1SNQA 4BA1I 1VQFA 1Z47A 5C4JH 1C48A 3R2TA 3S15H 1RHPA 3S1MH 5C3XA 5C0XJ 4X3TA 1CKMA 5CV7A 3PIO3 2EY1A 3K7UC 1KLGD 4DV1L 1RTOA 4X62L 3G4SA 2K04A 2NVXB 3E5SA 4FO2A 1IYVA 4EX5A 1PH2A 3J81c 5C0XH 2VQEL 3T1YL 4DNRB 3KDFA 4KI0A 5EPKA 3HEJA 1X3GA 3WOFA 4LF9L 4HCSA 4A93B 3P20A 4A3DB 1BQQT 2N55A 3GV3A 4KKTA 3RZDH 3GDEA 1JR0D 4OELB 4JK1C 1WTPA 4NXNL 4JI1L 4KD3A 1U9RA 1CUKA 1XNRL 2UUCL 4A3GB 3TS0A 3QO2A 4A75A 3LX0A 3HKZE 2ZM6L 2YTVA 2Q8IB 3FPPA 2NN6G 1E0BA 3CRKC 1LT6D 2B63B 2PNRC 3AYHB 3EQLC 2Q8RE 3KJOA 2Z4IA 2D9UA 1DOMA 2MFIA 3SVMA 2DY8A 1S5BD 4KY6A 1OTCA 1YNJC 1ASYA 3CQZH 1I94Q 4B3TL 3TREA 3I4NG 5CV9A 3M85A 1S3OA 1JWSD 2KEDA 3QWNA 3K8AA 1PHJA 1PYSB 4IUTA 4IOCA 4JV5Q 1QILA 1B1ZA 4ALPA 5ELFA 3S16H 1PYWD 2RA4A 4HAEA 4JCVE 1ICFB 1W2BA 2QW7A 5EPJA 2WKDA 4A3EG 2UUAQ 5KRUA 4L5RC 4N8FA 1V1PA 5DM73 1F2ZA 2HD3A 1HCZA 5M3FG 1WTVA 4GKJL 1TS2A 1VQDA 3E0JA 2R92H 1RJTA 1H9RA 1GOZA 4RGMA 1UE7A 4R4CA 1PH1A 1PZKD 3HOWG 5LMNQ 2B3GA 1L1OA 2K32A 3CPFA 3BJUA 3GD7A 5M5YH 3K57A 4B3RQ 3DWQA 4UY8C 2AUJD 1D5MC 4RGOS 1SYCA 5M3MH 1PH5A 4XTCS 4C3IB 1M4VA 2WV6D 2ZXOA 3CC4A 5IP9H 3PF5A 4PMWA 3FPUB 2CCZA 3PV0A 4AYBE 5IT9E 1X55A 1N32L 2IX1A 5JPMC 3BS1A 2E2JB 2BOSA 3SE0A 2QEXA 3TP8A 2F0VA 5IT9L 1KDBA 2SDFA 3BVGA 1PXUA 3TP6A 1R4PB 2F0UA 1WTOA 4MNOA 1IL8A 4BY7H 1HZAA 1N9WA 1ENCA 4M8AA 2AWNA 1LTLA 1KDCA 2LSSA 2XVSA 5NUCA 4ZQ3A 2VL6A 5C5LA 4JW0A 4DK1A 5C44H 4LF6Q 1R9TH 3JAMc 2HQEA 1LTSD 4KJNA 3FEWX 1QWYA 2JP1A 2PMZE 4NP5A 2F4VL 1X32A 4X3SA 2H4OA 4HIKA 2EXZA 2F3IA 1WCMG 1LUZA 3I4NH 2EJGC 2SEBD 2VQFL 4DNTB 2KUMA 3P1HA 1VQEA 5M5WB 1VQGA 2UUBQ 4HSPA 2WB1B 1LLRD 1T9HA 1OXVA 4OGQC 5EJWA 3S24A 2AQ3B 4EGVA 4YIJA 1NMGA 4LF5Q 2NVTB 1F9SA 4ZK9B 3MVVA 1JJCB 1OO9B 4F87A 3PO2G 3E6ZX 3HG9A 1DJRD 3F2UA 2I5HA 3NPPA 2L0CA 2D0OA 3TBIB 4BBSG 4LMQD 2A6HC 3M7GA 2NVXH 4Z9CB 2XSCA 4IPCA 4FDBA 3HOUB 2VB3X 1GUOA 1WTXA 1E7ZA 3ULLA 3C1EA 1AZPA 3W1GA 4A76A 1Y1WH 4RWSC 5HURA 3AMUA 1VQ8A 2F0QA 4A93H 4CDCC 1EWHA 5D3DA 4A3DH 4IFDI 1V8QA 3S1QB 1N34L 1YJNA 2Z4HA 2G9HD 4G7ZC 4B3SL 1HTLD 3N6RA 2YTYA 1PH3A 3W2DA 1YHAA 1UE1A 3F8TA 4PG3A 1BBXC 1QUQB 2M00A 4A3GH 1STYA 4IO9A 4F7XA 5KGUA 4QMGA 3TDQA 1YI2A 5D3IB 1HR0Q 5TSSA 2NB0A 1EQRA 2JA6B 4FP5D 1UWVA 2PW7A 1UE5A 4IPHA 5A35A 4DR2Q 4GOPC 3OW2A 1JJGA 4X3KA 1KQSA 2CQAA 3NENA 1SRUA 2JE6I 2RCNA 3A54A 1CHPD 1XTCD 4YWLA 2L1BA 4LF6L 4ZAIA 1RODA 4DKAC 2K75A 4A3BG 4BXXH 4C3HB 1EOVA 5IGEA 5EBDA 1WD0A 3NQTA 4YCUA 2CKZB 1OXTA 3VR5A 3PMFA 3DEOA 4CHTB 5GADC 2IX0A 4R8NA 1Q7YC 2JA8G 1EWCA 2CW0D 4RCNA 3HOYG 4QY7A 2IT1A 3HOYH 3AFQA 1CTMA 5C3EG 1VQ9A 2R6GA 3TEHB 2BA0A 5EQ0A 3DM3A 2JK8A 4TSSA 2PZWA 1STGA 4L5TA 1STEA 5HGQA 5ISRA 3QIAA 3KLSX 4OHJA 1JB3A 4QCLA 1PH7A 1GUWA 1U4RA 3TMEA 3B6YA 5GAGC 3OPOA 1KRTA 3MFYA 1NJIC 4HJ9A 4RAUC 1EU4A 1J9OA 5JEAJ 3GTQH 1TU2B 5CBEE 4IFDG 5EPLA 1DGSA 2HQLA 3PIP3 4DUYL 5E7NA 3VR2A 2B2WC 4DR1Q 5CC4A 3PUYA 1M90C 1G8ZD 5JEAH 2JA5G 1KTKA 3Q23A 4WRDA 3TZUA 3RD4A 2JA7B 1I3QB 4IURA 2R7DA 4HMIA 4LFBL 1HA6A 1Q1BA 3HZXA 1JORA 4LNQA 3J81E 2A6EC 1VQKA 2PCFB 3U9SA 1A3TA 2K5QA 3J81L 3ZJYC 1RD9D 4CJ2C 1X3FA 3FP9A 3NQIA 4BY1H 3WWVA 4R4QA 4RA8A 3EJIA 1P16A 2AQ1B 2EXDA 1IZ6A 1S5CD 4IPDA 1PMRA 4HJ8A 2NBFA 1EY9A 1DOLA 4ABNA 2MPMA 1WYDA 3RLNA 2RHSB 5IP7G 1KC8C 3I4MB 5FLMH 4DUZQ 4UP9A 4NXMQ 1ENFA 4WFN3 3AQQA 1K0RA 2BCOA 4OIJA 1ASZA 4A3FG 4PMBA 4JI7Q 3H3VI 1HNXL 3HKZG 4JBWA 4CJ1B 4DF7A 2UXCL 3MTSA 4HJAA 3MXUA 3GTJB 3J7YW 4CGYB 1CSQA 1H9SA 1VMCA 2F0NA 3ND9A 3C2PA 3HOUH 1F2MA 3NK9A 3NTKA 1VF7A 5E1FA 2JQOA 3GTOB 2Q2IA 1JOKA 3TQYA 3RLOA 1JMCA 3TSSA 4A3KH 1ET6A 5IYBG 5LMUQ 3QOJA 4P71A 1EQVA 2HUGA 1F9PA 5A2QL 4RG1A 1ET9A 4OO1I 3KF6B 1JC7A 2E8GA 1QCBD 5CR3A 3K0YA 3D8GA 4KN4C 4O0AA 1KNEA 5K5PA 2MJ8A 2WAQB 1QNUA 3MFGA 1BCPC 4YCWA 2D62A 4YWMA 4JI8Q 3CMAA 4MHEA 1CI3M 1Y1VG 1UAPA 2B2WA 2OT2A 2ZJPA 2GA4B 1OXSC 1K8MA 2DNEA 1BDOA 2E2IB 3F2CA 2L55A 3KF8A 1QJOA 5E4XA 1PLFA 1GXDC 1FL0A 3E3XA 2CFMA 4DU9A 5DLQE 1GJXA 1XNQQ 3OOCA 4XYOA 4HJ7A 4RGNA 4UP7A 5ELCA 2AMCB 3NBIA 1FD7D 4HN7A 4JI4Q 1YBYA 1OXUA 2YV5A 1E2ZA 4A3IG 3Q8DA 2LKVA 4L63B 1C4QA 2MHVA 3OMCA 1GUNA 1BKBA 2R7ZG 4ZYSA 2ASBA 4AYBG 4X64Q 2RCFA 3GV6A 1E3PA 3VA5A 3JAML 1IBKQ 2OXPA 2EYHA 2KHSA 3VYSA 1TWFH 1TWCB 2VS1A 2BH8A 1TR5A 2A74C 2K14A 4ZLTF 2ZXRA 1EZ8A 4DK3C 3ITPA 3CD6A 4OO1G 1I6HB 2EYMA 2K5DA 2B2UC 2K03A 2JA7H 3KFUA 5JJKA 3CF5A 4JI5Q 4A3MG 1A8VA 2HDMA 4NW2A 4XQQA 1PFBA 1CHQD 4BBRB 3OWFA 4DAVA 4OEMB 2A69D 2OCEA 3VR3A 1XTDA 2LMCB 2OEOA 4KD4A 3JC66 5KNCA 4DV1Q 3QOLA 1W6JA 4X62Q 5CMDA 1CKNB 2Y0SG 5IY0A 3P7JA 2VQEQ 3T1YQ 3GTKB 2K4KA 1SMYD 5C4XG 4MTNA 1SJHD 3G7LA 4LF9Q 1SBBB 4MTKA 1HQRD 1GHKA 2IHEA 2K6AA 2ICIA 3W3AA 1KDAA 1SNMA 1YNXA 1HA5A 4WJ4A 3M9BA 3J80c 2ENBA 4KY5A 4PMCA 4K0KL 4NXNQ 1B9NA 4WORA 4JI1Q 4X66L 1HNWL 1U4PA 2KQ3A 2PZTA 2LXJA 2UUCQ 1XNRQ 1B7YB 1IW7D 4L5SA 3CPWA 3S2HH 1K9MC 1HZBA 1G6ZA 2AUKA 2ZM6Q 1SNDA 1SE8A 1HTPA 4L8JA 1LTID 3ZYYX 1H9KA 3PGZA 1Q8KA 1A15A 2MGSA 5IYCH 3HOZB 2ID0A 3ERSX 5KNDA 1BO0A 2F0IA 1S5ED 3Q6SA 1EU3A 1QOHA 5GROA 4IJLA 1TS4A 1AE2A 5FLXc 4P75A 3FKIB 1C8CA 2NN6I 1UNSA 3KLSA 1XPRA 2F0LA 4I7AA 1S40A 5FK9C 3Q22A 1GO3E 3PIOA 2OF1A 5JJZA 1D8LA 3GTJH 4B3TQ 3HOXB 4NPSA 5JJIA 1AE3A 3D6CA 2KENA 2K01A 1MSGA 1S5DD 1GM5A 2PQAB 1HH2P 4QF4A 5I2XA 2FHTA 3X3MA 1KAWA 2J0TD 4K8IA 2VY3A 1NUCA 1B9MA 5J3BA 3H0GB 4RKLA 3RUZA 3F2DA 3E0EA 3D3RA 1F9RA 4PV1C 4GKJQ 5I6YA 2KCTA 1WD1A 1K3RA 3I4LA 2PO4A 3UDIA 2TMPA 1DOKA 2F0HA 5C0XG 3MXNB 1VS0A 4QIWB 2WB1E 3NHHA 4B3ML 3AB9A 2LXKA 3ONAB 4JG2A 4X6AH 2CH4W 1PTOB 3U9OA 1CFMA 1RCVD 2B2UA 4DPGA 4IUNA 1EQQA 1K8OA 4ME5A 2EJMA 4JC0A 4DK6C 1N32Q 1A2TA 2YU9B 5CV4A 1EY4A 4G7OC 2N88A 1JQYD 4CBVA 1D1KA 3WOEA 3MXPA 1Q90A 2KHIA 2XIWA 1J6QA 2ZXPA 4HSVA 1CQVA 1RIPA 3R8BA 1KABA 1VQJA 2X69A 3OWEB 2Z8LA 1S5FD 5FO8B 1TWHB 2FFKB 4TVAB 2VB2X 4ILWA 4DR5L 3RNUA 5G3LF 3NTHA 2F4VQ 3RZOB 1VQOA 1B2TA 1EYDA 4DV6L 3GQBA 2K52A 2VQFQ 3CCRA 5T1IA 5K36H 1LM0A 1M1KC 3TZDA 2WKCA 3L0OA 4JI0L 1I6HH 1BOSA 1HRJA 1FVIA 2QEJC 1MD2D 1BBUA 2CW0C 2F0TA 3A8JE 1IXRA 2R93G 4ZRZA 2L12A 3HOVB 1G51A 2R93H 4ME3A 4J6HA 1GUTA 4BBRH 1YEZA 3VYTA 1XX8A 1XWEA 3HKSA 2R92G 1D5XC 1MSHA 4DAYA 1JWMD 2PW5A 4OIKA 1TS3A 4LWCA 1FJGL 3R3OA 4MN3A 3GTKH 4GNXC 1AN8A 1PYBA 3HRZC 4DV4L 4FXGC 2VNUD 1D2BA 3NBHA 1G2TA 3BZCA 5M3MG 4JYAL 3M3YB 3GTLB 4QUFA 3U58A 3S17B 2ICEC 2R7FA 1SDFA 1CA6A 4K5WA 1PFSA 3MZ5A 1N34Q 2A5HA 5IP9G 1NCVA 1VQHA 4B3SQ 2KCCA 4Q0FA 2NTSA 3A7LA 1K28A 2CVRA 1LYLA 4QQBX 3PO3B 1JOOA 4NDXA 4GKKL 2RKSA 1PTOF 3K7AB 1GUGA 4IOAA 1HNZL 1VDZA 2O4XA 1E24A 4I7ZC 1Y69U 4BY7G 5C6AA 1Q8IA 3HOZH 3J81i 4POGA 3G6JB 2E75C 3DEPA 3S1NB 2EY6A 3I8ZA 5KYLA 3CCJA 3UDGA 5FJ8H 5C44G 1L0YB 3U4ZA 3GTGB 1I4HA 2EIFA 3J7AV 2VZAA 4UDUC 3STBD 1EFWA 1T5EA 3HOXH 1WTHA 1ESRA 3BYTB
chains in the Genus database with same CATH topology
4XT3B 4KHZA 3R93A 2L9HA 3A8KE 2KCNA 1JWUD 5IGGA 3T56B 4E6IA 3KBGA 1HUNA 3D4DA 3AU7A 1GUSA 3SR1A 3I90A 3MC0B 5FOBB 4XQNA 2H1EA 1EY7A 4BS9A 1WVLA 4FXDA 2M9VA 2B8FA 1PZJD 1SYBA 1ESFA 2VUMB 2IPKD 4FF4A 2K1BA 3K5NA 1RTNA 1A3VA 1QE6A 4A3FB 1BXTA 1PRTB 3WDNA 4K8JA 1V1OA 2F0JA 1SEBD 4FNFA 3BDCA 1TVXA 3BVZA 5JOBA 1E2VA 2SOBA 5LL6S 3X3NA 4OL7A 1FYCA 3NWSA 1CA5A 3OHXC 5IODA 3J80L 1DCZA 2IWHA 4R9WA 3MXGA 1EQTA 3FMCA 1EIGA 3VYRA 4LAAA 2IW3A 1BNZA 1NSNS 3H6MA 3MAQA 2C9OA 1EYCA 3VR4A 4C1NK 4C56C 2XRQD 2V4DA 2R61A 1DXMA 3C1FA 1SYGA 4C3JB 5CORA 5FLXL 3EFXD 3H09A 5D65A 1B44D 2RQXA 4G57A 5C4HA 2SNMA 4A3IB 3HGBA 1I4QA 5JEAG 3M4OB 3BYYB 4C3IG 1DYQA 1I50B 1H9JA 1B50A 1FGBD 4V190 4C2MB 3HS0C 2E2HB 1QNKA 3D6WA 3T4AC 1XYIA 5IOCA 3KBXA 3T53B 4RHRA 3URYA 1LABA 4ULLA 4ODGA 5G3LD 2A69C 1B4OA 1CM9A 1DONA 5LL6X 1G291 3PUZA 1PRTF 2PMZB 2F0PA 1SMYC 2WINB 1Q1EA 3FRPB 1K83B 4IUVA 2X6GA 3UI2A 4A3JB 5ELEA 4FF2A 2KEEA 1S4ZA 4KK7A 5E4WC 1IW7C 1SFOB 4Y7NB 1ZXTA 3S2DB 1NR2A 3T16A 1B53A 4H44C 1EEFD 1G2SA 4UAIA 5BN5A 2B39A 2EE1A 3I73A 3EROA 1HQMC 3VR6A 3DMUA 1V1PB 4H7BA 1PZID 5I9PA 5A2QE 5T1GA 5CV5A 1PTOD 1ZYRD 4EQNA 2A6HD 2B2VC 1TIID 4G7HC 3J7AF 1QB5D 2RBMA 1LTGD 2D2CC 1EZ6A 2R3ZA 2PPBC 3ERQA 1EFID 4ID6A 4CJ0B 4IUUA 2K28A 5EBCA 4BA2I 1VF5C 2F0DA 2RDFA 5C4JB 3CKIB 3I91A 1NAPA 5IIFA 1ENAA 5CYUA 2F0MA 1I4RA 1R4QB 4FF1A 1ILQA 2QDBA 3GO5A 4KY7A 3S1RB 2O5JC 3TN2A 3JAME 2NVYB 2E74C 4KKSA 3L7ZC 2RDGA 1XXGA 1GHJA 4Q5VA 1SAPA 4ZKBB 4V0BA 3KLRA 2F4IA 3T13A 4K14A 3V05A 1AEXA 1L0XB 2EZVA 1QG7A 3NSWA 1CZGA 3PUVA 1II3A 2PQEA 4K5XA 5IGDA 2I07B 3K59A 2X6LA 4KJOA 2LS01 1EY5A 2C5CA 2F03A 1X3PA 2LFNA 3SK8A 1WTWA 3MHBA 3H91A 2HCCA 5C0XI 1DD2A 4A3EB 1Y8PB 3BDLA 2R92B 1F2LA 5M3FB 3V2TA 4B9XA 1EEID 3OMGA 3HOWB 1HFNA 1CQFA 4DK0A 1EYAA 2J7ZA 2RSNA 2XNAC 5C3WA 1PFMA 5ELBA 3M4YA 1NR4A 3BZDB 1BF4A 5CV6A 4KMUC 2JXMB 2O5IC 1O80A 2JEBI 3IFTA 4KN7C 5COYA 3IFDA 1OXXK 1H9MA 1SYDA 2G9DA 4RGTA 2QILA 2FMMA 3I72A 3SEBA 4BY7B 3A8IE 4J8QA 4DXFA 1A3UA 1VCIA 2XWBB 1JE4A 1R9TB 2KECA 4R8IA 4RFBA 3TP5A 1Z7TA 4K6DA 2FJ2A 2NVQB 1PRTD 2K5WA 4RH6A 2JEAI 1TWGB 4RKBA 1TY0A 1WCMB 1HFGA 3L9AX 3OSOA 1EOTA 4DA2A 1X3QA 4ZUIA 4HMJA 2EDGA 3OIQA 1E2WA 1TY2A 3RMHA 2NWGA 1LTRD 1LTTD 1BCPD 3PO2B 3D4WA 5LHY1 4HR7B 4C1NI 5EKKA 2Z1CA 1MGSA 4K5VA 4BBSB 1BR9A 2EJFC 2HDLA 1B3AA 1TKWB 3I3CA 1Y1WB 4KTAA 5IGBA 2IJ0A 1SE2A 5E3FA 4XT1B 2F0GA 2QF7A 1SE4A 5I2YA 2JYOA 3IL8A 4X3UA 1EIHA 4MIUA 1LO5D 3VYUA 2B2YC 2O2LD 5M5XB 4U673 4S3SA 3O13A 5K36G 1FNVA 5I4DA 4QUCA 2NN6H 2LY7A 5AFWA 3PUXA 4QB4A 3NE5B 2AQ2B 3NTIA 2FINB 1H9SB 2PYKA 3GTPB 1HUMA 5I9OA 4A3BB 2EYFA 1I4GA 4O42A 3S14B 4O1NA 2JA8B 5J39A 1CK1A 4I65A 3HOYB 2F3VA 1KLUD 1HXYD 5C3EB 2BE5D 4HEDA 4TKOB 1A6XA 1O78A 3Q0AA 2L11A 1PFNA 1MI2A 5DEHA 1STNA 1Q12A 2DN8A 3GTQB 2BDNA 5DNFA 2K33A 2JA5B 3K6OA 1O7LA 2NZ1D 2EYOA 2EY2A 5JVG3 1WTRA 5EGTA 3LWUA 3IAYA 3I70A 1IYUA 2SNSA 5CGKA 1LV9A 1LTBD 4ZUJA 5C4ZA 4EQOA 4DXGA 3NXWA 4BY1B 5JPNC 3BG3A 1YNND 4HCEA 4H0LC 2A68D 1LACA 1V43A 3ND8A 1J8IA 1KAAA 3H94A 3MWYW 2B2YA 1EL0A 3NWTA 4RHSA 1I4PA 1STHA 2M2LA 2XN9C 2D5DA 5JVH3 4M1UB 5ELDA 2I46A 1ONLA 1MBYA 1PTOH 2EOTA 1TWAB 1SNPA 4TQUS 1PTOC 5EKLA 2A73B 1ZYRC 3A55A 3HKZB 1AFPA 3CRLC 4A3KB 3QB3A 1F77A 1VMPA 4IZ8A 3K5LA 2IX3A 3TP7A 2YYZA 1M8AA 1SYFA 2F0FA 3J80E 1ML0D 2J4XA 1BCPB 2E2DC 2XRSD 1HPCA 2B2TC 1TS5A 3DHQA 3NP8A 4KHVA 2RVLA 5I6WA 2VXWA 2DY7A 2EVBA 1SSOA 2FMCA 1Y1VB 1T5XD 3K58A 1F2YA 5FLXE 4DN4M 1YNJD 1JCKB 2KVMA 4B9WA 4CKEA 5IGFA 4L6TB 5D14A 4BWGB 1FR3A 5J22A 4TRDA 2KA7A 4NKLA 3IKJA 4KKUA 5HGTA 3QG1A 3SHLA 2B8GA 3EA6A 3R2IA 2E76C 4CKBA 2F0KA 1IKLA 2NYZD 2R7ZB 4U68A 1EY8A 4AYBB 4FVMA 2KJXA 3S9WA 1SNCA 1FNWA 3C3LA 2EYLA 3M7NA 2RDHA 2WP8J 4IFDJ 1TWFB 2EYPA 1Y8OB 3SXHA 3RLFA 3A56A 1O7ZA 4IFDH 5DM63 4K6LA 1UUPA 4CKCA 4FYDA 2F1MA 4LK1C 3QJYA 3DWAA 4IN3A 4F88A 3MXNA 4IALA 1HHVA 4A3MB 3V96A 3GTMB 4PNYA 1SNOA 4H13C 2JSOA 2Y0SB 1WTQA 1EY0A 4N9TA 1BCPF 5C4XB 1SXTA 3CU7A 2F3WA 1D5ZC 2EYJA 3DWPA 1ZKOA 4NMZA 1DZ1A 4F8MA 2F0EA 3SK5A 2XWJB 3GP7A 2DNCA 3S2HB 2QCPX 2B2TA 4LJZC 5KIXA 1PDQA 1AW7A 1G91A 1CZWA 1UEAB 1RF2D 1EY6A 2K7VA 4IUQA 3CHBD 3HP3A 3PUWA 4KV6A 4FF3A 1LT4D 1PRTC 4FXKC 4N9PA 3LWEA 3FVQA 3OW7A 1SYEA 4XQJA 1CT1D 5C5MA 1STBA 4C3HG 3S15B 3T51B 3S1MB 3P75A 1LT5D 1U4LA 4XIGS 2HCIA 5BN3A 1STAA 4IUPA 4GZYC 4RCOA 1I6VC 5KEEA 3DXJC 1BUVT 4C3JG 2PZUA 3SK6A 1ICWA 4EQPA 1I4XA 3RZDB 2BA1A 2EY5A 3OIPA 1LT3D 4WJWA 4ZKCB 2ZT9C 2F0OA 2IL8A 2F0WA 1RKNA 4K2LA 1Y8NB 3BDOA 5KNBA 3Q24A 1A2UA 4DFAA 5JAVA 4K2KA 3A7AB 3DUZA 3H3VC 4G4KA 2EPBA 2RSOA 3MEHA 5KYIA 1ILPA 3CQZB 3MA2B 3D4RA 1JICA 3DM1A 5CBAE 5FKAC 2CHBD 4OO1H 1JOQA 4XDXA 3S16B 3D31A 1SJED 2R93B 5M9OA 2A6ED 3L3OC 1Z6HA 1D6EC 1IHZA 2BE5C 2WACA 2B2VA 1D1IA 3KK7A 2WIIB 1TT2A 5M5YB 5IGCA 4B08A 5BN4A 5M3MB 3C46A 2QKIC 2L5TA 4DAPA 1SE3A 2L4NA 3SK4A 3BVMA 1TQOA 1O7YA 1FNUA 3EVQA 1AP0A 1F9QA 4XYQA 3N52A 5J1ZA 2MUYA 1DM0B 3KUPA 3SDZA 5F2DA 1ZEQX 1LTAD 4J1MA 2TSSA 2MP1A 5DAUA 5EKIA 2NTTA 1W6KA 3FDTA 5C44B 2BDOA 2NUCA 1KNAA 4P2CB 3LNNA 5FO7B 4DGZA 5CV8A 4IQZA 2Q8TA 3VA7A 3K5MA 4HTHA 2AWOA 1YNNC 3I4NB 2F0SA 2A68C 3NUCA 2K05A 4EVOA 1IKMA 1Q3LA 3K5OA 5FO9B 4PQXA 1RDPD 2KOLA 1U4MA 1AZQA 4XXEA 1SNQA 4BA1I 1Z47A 1C48A 3R2TA 1RHPA 5C3XA 5C0XJ 4X3TA 5CV7A 3PIO3 2EY1A 1KLGD 1RTOA 2K04A 2NVXB 3E5SA 4FO2A 1IYVA 5C0XH 4DNRB 4KI0A 5EPKA 3HEJA 3WOFA 4HCSA 4A93B 3P20A 4A3DB 1BQQT 2N55A 3GV3A 4KKTA 1JR0D 4JK1C 1WTPA 4KD3A 1U9RA 4A3GB 3QO2A 3LX0A 2Q8IB 3FPPA 2NN6G 1E0BA 3CRKC 1LT6D 2B63B 2PNRC 3EQLC 2Q8RE 2Z4IA 2D9UA 1DOMA 3SVMA 2DY8A 1S5BD 4KY6A 1YNJC 5CV9A 3M85A 1JWSD 2KEDA 3QWNA 4IUTA 1QILA 1B1ZA 5ELFA 1PYWD 2RA4A 4HAEA 5EPJA 2WKDA 5KRUA 1V1PA 5DM73 1F2ZA 1HCZA 1WTVA 1TS2A 3E0JA 1RJTA 1H9RA 1GOZA 4RGMA 1PZKD 2K32A 3GD7A 3K57A 3DWQA 2AUJD 1D5MC 4RGOS 1SYCA 4XTCS 4C3IB 1M4VA 2WV6D 2ZXOA 4PMWA 3FPUB 3PV0A 5IT9E 2IX1A 5JPMC 3BS1A 2E2JB 2BOSA 3SE0A 3TP8A 2F0VA 5IT9L 1KDBA 2SDFA 3BVGA 1PXUA 3TP6A 1R4PB 2F0UA 1WTOA 1IL8A 1ENCA 4M8AA 2AWNA 1KDCA 2XVSA 5NUCA 4ZQ3A 5C5LA 4DK1A 2HQEA 1LTSD 4KJNA 3FEWX 1QWYA 2JP1A 4NP5A 1X32A 4X3SA 2H4OA 2EXZA 2EJGC 2SEBD 4DNTB 2KUMA 3P1HA 5M5WB 4HSPA 2WB1B 1LLRD 1OXVA 4OGQC 5EJWA 2AQ3B 4EGVA 4YIJA 2NVTB 1F9SA 4ZK9B 3MVVA 1OO9B 4F87A 3E6ZX 3HG9A 1DJRD 3F2UA 3NPPA 2L0CA 3TBIB 4LMQD 2A6HC 3M7GA 4Z9CB 2XSCA 3HOUB 2VB3X 1GUOA 1WTXA 3C1EA 1AZPA 4RWSC 5HURA 3AMUA 2F0QA 1EWHA 5D3DA 4IFDI 1V8QA 3S1QB 2Z4HA 2G9HD 4G7ZC 1HTLD 3N6RA 3W2DA 1BBXC 2M00A 1STYA 4F7XA 5KGUA 4QMGA 3TDQA 5D3IB 5TSSA 2NB0A 2JA6B 4FP5D 2PW7A 5A35A 4X3KA 2CQAA 2JE6I 3A54A 1CHPD 1XTCD 2L1BA 4ZAIA 1RODA 4C3HB 5IGEA 5EBDA 1WD0A 3NQTA 3VR5A 1OXTA 3DEOA 3PMFA 4CHTB 2IX0A 4R8NA 1EWCA 2CW0D 4RCNA 2IT1A 1CTMA 2R6GA 2BA0A 5EQ0A 4TSSA 2PZWA 1STGA 1STEA 5ISRA 3QIAA 3KLSX 4OHJA 1JB3A 4QCLA 1GUWA 1U4RA 3TMEA 3OPOA 3MFYA 4RAUC 1EU4A 1J9OA 5JEAJ 5CBEE 1TU2B 4IFDG 5EPLA 3PIP3 3VR2A 2B2WC 5CC4A 3PUYA 1G8ZD 5JEAH 1KTKA 3Q23A 4WRDA 3TZUA 3RD4A 2JA7B 1I3QB 4IURA 4HMIA 1HA6A 1Q1BA 3HZXA 1JORA 3J81E 2A6EC 2PCFB 3U9SA 1A3TA 2K5QA 3J81L 1RD9D 4CJ2C 3NQIA 4RA8A 3EJIA 2AQ1B 1S5CD 1PMRA 2NBFA 1EY9A 1DOLA 4ABNA 2MPMA 3I4MB 1ENFA 4WFN3 2BCOA 4OIJA 4PMBA 4JBWA 4CJ1B 4DF7A 3MTSA 3MXUA 3GTJB 3J7YW 4CGYB 3ND9A 1H9SA 1VMCA 2F0NA 3C2PA 1F2MA 3NK9A 3NTKA 1VF7A 5E1FA 3GTOB 1JOKA 3TSSA 1ET6A 3QOJA 1EQVA 2HUGA 1F9PA 5A2QL 1ET9A 4OO1I 1JC7A 1QCBD 5CR3A 3K0YA 3D8GA 4KN4C 5K5PA 1KNEA 2MJ8A 2WAQB 1QNUA 3MFGA 1BCPC 2D62A 4MHEA 1CI3M 1UAPA 2B2WA 2OT2A 2GA4B 1OXSC 1K8MA 2DNEA 1BDOA 2E2IB 2L55A 3KF8A 1QJOA 5E4XA 1PLFA 1GXDC 4DU9A 1GJXA 3OOCA 4XYOA 4RGNA 5ELCA 3NBIA 1FD7D 4HN7A 1OXUA 1E2ZA 2LKVA 4L63B 1C4QA 2MHVA 3OMCA 1GUNA 4ZYSA 3GV6A 3VA5A 3JAML 2OXPA 2EYHA 2KHSA 3VYSA 1TWCB 1TR5A 2A74C 4ZLTF 2ZXRA 1EZ8A 3ITPA 4OO1G 1I6HB 2EYMA 2K5DA 2B2UC 2K03A 2HDMA 4NW2A 4XQQA 1PFBA 1CHQD 4BBRB 3OWFA 4DAVA 2A69D 3VR3A 2LMCB 2OEOA 4KD4A 5KNCA 3QOLA 1W6JA 5CMDA 3P7JA 3GTKB 1SMYD 1SJHD 3G7LA 1SBBB 1HQRD 1GHKA 2K6AA 2ICIA 3W3AA 1KDAA 1SNMA 1HA5A 2ENBA 4KY5A 4PMCA 1B9NA 4WORA 1U4PA 2KQ3A 2PZTA 1IW7D 1G6ZA 2AUKA 1SNDA 4L8JA 1HTPA 3ZYYX 1LTID 1H9KA 1A15A 2MGSA 3HOZB 2ID0A 5KNDA 1BO0A 2F0IA 1S5ED 1EU3A 3Q6SA 1QOHA 1TS4A 1C8CA 3FKIB 2NN6I 1UNSA 3KLSA 2F0LA 5FK9C 3Q22A 2OF1A 5JJZA 3HOXB 3D6CA 2K01A 1MSGA 1S5DD 4QF4A 5I2XA 2FHTA 3X3MA 2J0TD 4K8IA 1NUCA 1B9MA 3H0GB 4RKLA 3RUZA 3D3RA 1F9RA 4PV1C 5I6YA 1WD1A 3I4LA 2PO4A 2TMPA 1DOKA 2F0HA 5C0XG 4QIWB 3NHHA 3AB9A 3ONAB 1PTOB 3U9OA 1CFMA 1RCVD 2B2UA 4IUNA 1K8OA 4ME5A 2EJMA 1A2TA 2YU9B 5CV4A 1EY4A 4G7OC 2N88A 1JQYD 4CBVA 1D1KA 3WOEA 3MXPA 1Q90A 2XIWA 2ZXPA 4HSVA 1CQVA 3R8BA 1KABA 2X69A 3OWEB 2Z8LA 1S5FD 5FO8B 1TWHB 2FFKB 2VB2X 4ILWA 5G3LF 3NTHA 3RZOB 1B2TA 1EYDA 3GQBA 5T1IA 5K36H 3TZDA 2WKCA 1BOSA 1HRJA 2QEJC 1MD2D 2CW0C 2F0TA 3A8JE 4ZRZA 2L12A 3HOVB 4J6HA 1GUTA 3VYTA 1XX8A 1XWEA 1D5XC 1MSHA 4DAYA 1JWMD 2PW5A 4OIKA 1TS3A 3R3OA 4MN3A 1AN8A 3HRZC 4FXGC 2VNUD 1D2BA 3NBHA 1G2TA 3M3YB 3GTLB 4QUFA 3S17B 2ICEC 1SDFA 1CA6A 4K5WA 3MZ5A 2A5HA 1NCVA 2KCCA 4Q0FA 2NTSA 3A7LA 2CVRA 3PO3B 1JOOA 4NDXA 2RKSA 1PTOF 3K7AB 1GUGA 1VDZA 2O4XA 4I7ZC 1Y69U 5C6AA 1Q8IA 3G6JB 2E75C 3DEPA 3S1NB 2EY6A 3I8ZA 5KYLA 1L0YB 3GTGB 1I4HA 3J7AV 4UDUC 1T5EA 1ESRA 3BYTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOD A;  5IGD A;  3DMU A;  4H7B A;  2F0O A;  4WRD A;  2NUC A;  3C1F A;  1KAB A;  1SYG A;  2ENB A;  4KY5 A;  4PMC A;  5I9P A;  4WOR A;  2F3W A;  4KJO A;  2F0W A;  1RKN A;  4DGZ A;  2KQ3 A;  2PZT A;  4HMI A;  4K2L A;  5CV8 A;  1EY5 A;  2EYJ A;  4HTH A;  3D4W A;  3DHQ A;  5CV5 A;  3NP8 A;  4KHV A;  3C1E A;  3HZX A;  4NMZ A;  4E6I A;  2F0S A;  4EQN A;  5IGG A;  4F8M A;  5KRU A;  5EKK A;  1JOR A;  5HUR A;  1SND A;  2F0E A;  3SK5 A;  1A2U A;  3NUC A;  1EYD A;  2F0Q A;  4N9T A;  1F2Z A;  2EYO A;  3D4D A;  4K5V A;  3MHB A;  3SK8 A;  4DFA A;  5I6W A;  2EY2 A;  4G57 A;  5C4H A;  2SNM A;  4EVO A;  3SR1 A;  5JAV A;  2RBM A;  4K2K A;  5EGT A;  4DU9 A;  1A3T A;  2F0I A;  1EZ6 A;  1F2Y A;  3ERQ A;  4ID6 A;  4KTA A;  5IGB A;  3MEH A;  1EY7 A;  4B9W A;  5KYI A;  2M00 A;  5IGF A;  5CGK A;  2SNS A;  5E3F A;  3BDL A;  5KIX A;  2F0L A;  1SNQ A;  1STY A;  2F0G A;  4F7X A;  3EJI A;  5KGU A;  4QMG A;  4ZUJ A;  2OF1 A;  2F0T A;  1SYC A;  3V2T A;  4B9X A;  5C4Z A;  3OMG A;  2LKV A;  5C3X A;  1SYB A;  4EQO A;  4TRD A;  5IOC A;  5J22 A;  3OMC A;  4J6H A;  1EYA A;  4NKL A;  3NXW A;  2F0D A;  2EY1 A;  5CV7 A;  1EY6 A;  3D6C A;  5HGT A;  2RDF A;  2PW7 A;  3SHL A;  1JOQ A;  4MIU A;  3E5S A;  5C3W A;  5IIF A;  1ENA A;  4ODG A;  4QF4 A;  2F0K A;  2F0M A;  3VA5 A;  1EY9 A;  2OXP A;  2PW5 A;  2EYH A;  5M9O A;  2KHS A;  1A3V A;  3HEJ A;  4KV6 A;  4S3S A;  3R3O A;  5CV6 A;  4K8I A;  1IHZ A;  1NUC A;  3TP8 A;  2WAC A;  4K8J A;  1KAA A;  2F0V A;  4N9P A;  1EY8 A;  1KDB A;  1TR5 A;  2F0P A;  4QB4 A;  2QDB A;  4RKL A;  3RUZ A;  5IGE A;  3TP6 A;  2F0U A;  3NQT A;  2F0J A;  4KY7 A;  3S9W A;  1SNC A;  1STH A;  2EYL A;  1EZ8 A;  2PYK A;  3ITP A;  3PMF A;  5I6Y A;  1ENC A;  2EYP A;  4K5W A;  1SYD A;  3MZ5 A;  4PMB A;  1KDC A;  4R8N A;  3SXH A;  1SYE A;  1U9R A;  4KD3 A;  5NUC A;  3BDC A;  4ZQ3 A;  5C5L A;  1TT2 A;  2EYM A;  5I9O A;  5IGC A;  5C5M A;  1STB A;  2EYF A;  2F0H A;  2HQE A;  5JOB A;  3LX0 A;  4DF7 A;  4KJN A;  4NP5 A;  2SOB A;  1A3U A;  2F0N A;  3P75 A;  3NHH A;  4OL7 A;  1F2M A;  3NK9 A;  1JOO A;  1SNP A;  2EXZ A;  3OWF A;  4NDX A;  5E1F A;  1JOK A;  5EKL A;  3SK4 A;  1TQO A;  2PZW A;  2RKS A;  5J39 A;  3EVQ A;  3U9O A;  3P1H A;  2OEO A;  1STG A;  4KD4 A;  2O4X A;  4K6D A;  3TP5 A;  3QOJ A;  4I65 A;  4IAL A;  3T13 A;  4K14 A;  3T16 A;  2F3V A;  4IUN A;  1EQV A;  3QOL A;  1STA A;  1AEX A;  5C6A A;  5ISR A;  4ME5 A;  2EY6 A;  4PNY A;  3TME A;  4RKB A;  5KYL A;  5J1Z A;  1SNO A;  4YIJ A;  3QB3 A;  1A2T A;  4LAA A;  3ERO A;  4KY6 A;  5CV4 A;  5KEE A;  5CR3 A;  2PZU A;  3SK6 A;  1EY4 A;  4EQP A;  3OSO A;  1NSN S;  3H6M A;  4IZ8 A;  4ZUI A;  3D8G A;  3MVV A;  3TP7 A;  4HMJ A;  1STN A;  1EYC A;  5CV9 A;  3MXP A;  5DEH A;  5K5P A;  5F2D A;  2EY5 A;  1SYF A;  1II3 A;  2PQE A;  5CC4 A;  2F0F A;  1EY0 A;  1KDA A;  4J1M A;  1SNM A;  4K5X A;  5DAU A; 
#chains in the Genus database with same CATH topology
 4XT3 B;  4KHZ A;  2HHH L;  3R93 A;  2WFW A;  3K80 C;  2L9H A;  3A8K E;  2KCN A;  4O2D A;  4QJF A;  1JWU D;  5IGG A;  3T56 B;  4E6I A;  3KBG A;  2YTX A;  2Y0S E;  1HUN A;  3D4D A;  2H5X A;  3AU7 A;  1GUS A;  3SR1 A;  4HJ5 A;  3I90 A;  3G71 A;  3MC0 B;  5FOB B;  4XQN A;  2H1E A;  1EY7 A;  3A0J A;  4BS9 A;  3AEV A;  2E5L L;  2JN4 A;  2UXB Q;  2NZH A;  1WVL A;  4FXD A;  2M9V A;  2B8F A;  3CCV A;  1KL9 A;  1XPU A;  1PZJ D;  4CDF C;  1SYB A;  2MO1 A;  1ESF A;  1Y1W G;  2VUM B;  2IPK D;  4DUY Q;  1QZG A;  4A93 G;  4A3D G;  2Z6B A;  4FF4 A;  1VQM A;  2K1B A;  4JI6 L;  3K5N A;  1RTN A;  3K0X A;  2ALY B;  1Q86 C;  1A3V A;  1QE6 A;  4A3F B;  1BXT A;  3CME A;  4LFB Q;  1PRT B;  3WDN A;  4K8J A;  4A3G G;  2YU9 H;  4GN3 B;  1V1O A;  4JOI C;  3F2B A;  4UPA A;  2F0J A;  2I5L X;  4EQ5 A;  1SEB D;  4FNF A;  3BDC A;  1TVX A;  4KHP L;  3BVZ A;  5JOB A;  4A3L H;  1E2V A;  2B63 H;  1N36 L;  2SOB A;  5LL6 S;  1TWH H;  3X3N A;  4OL7 A;  1FYC A;  4BXX G;  3RZO H;  4RMF A;  1XPO A;  4A3C H;  3NWS A;  1CA5 A;  2QGQ A;  4GS3 A;  3OHX C;  5IOD A;  3J80 L;  1DCZ A;  2IWH A;  4R9W A;  3MXG A;  1EQT A;  3FMC A;  1EIG A;  3VYR A;  4HIM A;  4LAA A;  2IW3 A;  1BNZ A;  3PIP A;  1S72 A;  1SMX A;  1NSN S;  3H6M A;  3MAQ A;  2C9O A;  1EYC A;  3VR4 A;  3HOV H;  4C1N K;  4C56 C;  2XRQ D;  2V4D A;  2UU9 L;  2R61 A;  1EIF A;  2NZO A;  1DXM A;  3C1F A;  1SYG A;  4C3J B;  5COR A;  1VQ7 A;  5FLX L;  3JAM i;  1HNX Q;  1NBW A;  2CWA A;  2CQO A;  3EFX D;  2UXC Q;  2UXD L;  3H09 A;  2UXB L;  5D65 A;  1B44 D;  1IBM Q;  2RQX A;  4G57 A;  5C4H A;  2SNM A;  4A3I B;  3HGB A;  2ES2 A;  3M3Y H;  3K81 C;  1I4Q A;  5JEA G;  3M4O B;  3BYY B;  3CP0 A;  4C3I G;  1DYQ A;  1I50 B;  2D0P A;  3S17 H;  1H9J A;  2OQK A;  3UDX A;  4C3I H;  1B50 A;  1FGB D;  4V19 0;  4C2M B;  3HS0 C;  2E2H B;  1QNK A;  3D6W A;  1JJ2 A;  1C7Y A;  3T4A C;  3KDF B;  1XYI A;  5IOC A;  3KBX A;  3T53 B;  1PV4 A;  4RHR A;  4R1J A;  3URY A;  1WOC A;  1LAB A;  2E2J H;  4ULL A;  1GKH A;  3K7A H;  4KLK A;  4ODG A;  5G3L D;  2A69 C;  5HY6 A;  1B4O A;  2IHF A;  1Z9F A;  3S1N H;  1CM9 A;  1B3Q A;  1DON A;  5LL6 X;  1G29 1;  3PUZ A;  1PRT F;  4BY1 G;  2PMZ B;  3GTG H;  2F0P A;  1JE5 A;  1SMY C;  2Z0S A;  4ZCK A;  1VQB A;  2WIN B;  1Q1E A;  3FRP B;  2XGT A;  1K83 B;  4N8X 1;  1C9O A;  4IUV A;  4DV7 Q;  2X6G A;  1KHI A;  3UI2 A;  4A3J B;  5ELE A;  1G6P A;  4FF2 A;  2KEE A;  2WB1 G;  1S4Z A;  2G5D A;  5M5W H;  4AIM A;  4KK7 A;  3KJP A;  5E4W C;  1IW7 C;  1SFO B;  1VQI A;  1TXY A;  4Y7N B;  1K73 C;  4GN5 A;  5FLM G;  1ZXT A;  4OON A;  3S2D B;  4GOP A;  2NVT H;  1NR2 A;  2RF4 A;  1U5K A;  3T16 A;  1B53 A;  4H44 C;  1EEF D;  1G2S A;  4UAI A;  5BN5 A;  2B39 A;  2EE1 A;  3I73 A;  1K8A C;  1NTG A;  3ERO A;  4OWW B;  1HQM C;  1EYG A;  4LUO A;  1W3S A;  3HOU G;  3VR6 A;  1IBM L;  2VUM H;  4A3K G;  3DMU A;  1V1P B;  4H7B A;  1PZI D;  5I9P A;  5A2Q E;  1QVG A;  5T1G A;  2HIX A;  3S1Q H;  1SLJ A;  5CV5 A;  2ZTD A;  1PTO D;  1L1O B;  2A1A A;  1ZYR D;  3FHW A;  3KLW A;  4EQN A;  2A6H D;  2B2V C;  4DV2 L;  1TII D;  4G7H C;  3J7A F;  3M4Q A;  1QB5 D;  2RBM A;  1L2F A;  1X6O A;  1LTG D;  2D2C C;  2R3Z A;  1EZ6 A;  2PPB C;  3ERQ A;  1EFI D;  4ID6 A;  4CJ0 B;  4IUU A;  2JA6 H;  2K28 A;  5EBC A;  3I7F A;  1PH8 A;  4BA2 I;  1VF5 C;  2F0D A;  3D0F A;  2RDF A;  5C4J B;  3CKI B;  3I91 A;  4WJ3 M;  1NAP A;  5IIF A;  1ENA A;  5CYU A;  3CCQ A;  4C3H H;  2F0M A;  1EIY B;  4K0K Q;  3MEF A;  4DV7 L;  1I4R A;  4X66 Q;  1HNW Q;  2VW9 A;  1R4Q B;  4R4O A;  5L37 A;  4FF1 A;  1ILQ A;  2QDB A;  3GO5 A;  4JBJ A;  4KY7 A;  3UE1 A;  2K5N A;  3S1R B;  2N49 A;  2O5J C;  2QA4 A;  3TN2 A;  3JAM E;  1HJP A;  2E74 C;  2NVY B;  4KKS A;  3L7Z C;  2EQS A;  4C3J H;  4JI3 L;  2RDG A;  3EIV A;  5ELO A;  1Q82 C;  1XXG A;  2ZTE A;  1GHJ A;  4Q5V A;  1E1T A;  1SAP A;  4ZKB B;  4V0B A;  3KLR A;  2F4I A;  2Z6K C;  3T13 A;  4K14 A;  3V05 A;  1AEX A;  1L0X B;  1CKO A;  1YVC A;  4YY3 L;  2MNA A;  2EZV A;  1QG7 A;  4L5Q A;  1I50 H;  3NSW A;  1YHQ A;  1WI5 A;  4DR3 L;  2JA7 G;  1U0L A;  3W5O A;  1CZG A;  4C2M H;  4LF8 L;  1I3Q H;  4PZ6 A;  2E2H H;  1MHW C;  3PUV A;  1II3 A;  2PQE A;  4JPB W;  4P72 A;  4K5X A;  5IGD A;  3A74 A;  2I07 B;  4YHH L;  3K59 A;  2X6L A;  1MIU A;  4KJO A;  4P73 A;  1Q81 C;  2LS0 1;  2OTL A;  4AQY L;  1EY5 A;  2C5C A;  2F03 A;  1VQA A;  1NE3 A;  1X3P A;  2LFN A;  3SK8 A;  4B3M Q;  1WTW A;  1YIT A;  2A19 A;  3MHB A;  3H91 A;  3G6E A;  2HCC A;  5C0X I;  4DR6 L;  1KXL A;  1NMF A;  2DJF C;  1DD2 A;  4A3E B;  1Y8P B;  4LUZ A;  3PF4 A;  3BDL A;  2R92 B;  1F2L A;  5M3F B;  4A3J H;  3V2T A;  4B9X A;  2N78 A;  1EEI D;  3OMG A;  3HOW B;  1HFN A;  1CQF A;  4DK0 A;  2ZJR A;  5IYD H;  1EYA A;  1XMQ L;  1QUQ A;  2J7Z A;  2RSN A;  5IE8 A;  5IYC G;  2XNA C;  5C3W A;  2Z9H A;  1PFM A;  3I4M H;  3S2D H;  5ELB A;  1J5E L;  3M4Y A;  1V1Q A;  4DV5 Q;  1NR4 A;  1X65 A;  1UE6 A;  4GN4 B;  3BZD B;  4LFC L;  1BF4 A;  5CV6 A;  4KMU C;  3CXC A;  4DR5 Q;  3CC2 A;  2JXM B;  2O5I C;  1O80 A;  3T1H L;  2JEB I;  3IFT A;  4KN7 C;  4UHV A;  2MO0 A;  5COY A;  3IFD A;  4DV6 Q;  1OXX K;  1IYJ B;  4CDE C;  3I56 A;  2F52 A;  3STB C;  1H9M A;  1SYD A;  1B8A A;  2G9D A;  4RGT A;  3GTO H;  2QIL A;  2FMM A;  2CWP A;  4OX9 L;  3I72 A;  4X65 L;  3SEB A;  4BY7 B;  1L0W A;  3A8I E;  4J8Q A;  4MZ9 A;  4DXF A;  4JI0 Q;  1A3U A;  1VCI A;  1QVF A;  2XWB B;  1JE4 A;  1R9T B;  2KEC A;  4R8I A;  1VQ5 A;  4UP8 A;  4RFB A;  3TP5 A;  1Z7T A;  4K6D A;  2FJ2 A;  1E22 A;  2NVQ B;  1K0S A;  1L1O C;  2WAQ G;  1PRT D;  4IPG A;  2K5W A;  4RH6 A;  1PH9 A;  2JEA I;  1TWG B;  3F1Z A;  4RKB A;  4DNI A;  1TY0 A;  1WCM B;  1HFG A;  4LUV A;  4DR4 L;  1KRS A;  3L9A X;  1EOT A;  3OSO A;  4DA2 A;  1X3Q A;  4ZUI A;  4LF4 L;  1FJG Q;  4HMJ A;  2EDG A;  3OIQ A;  4DV4 Q;  1E2W A;  4H02 A;  1TY2 A;  3RMH A;  4JYA Q;  3CC7 A;  2NWG A;  1LTR D;  2E2I H;  3W1B A;  1LTT D;  1BCP D;  3PO2 B;  3D4W A;  5LHY 1;  1PH6 A;  4R4T A;  4HR7 B;  4C1N I;  5EKK A;  2MQH A;  2Z1C A;  1MGS A;  4K5V A;  3A5U A;  4BBS B;  1BR9 A;  2EJF C;  2HDL A;  4DR7 Q;  4GKK Q;  1B3A A;  1X9N A;  1TKW B;  3I3C A;  1Y1W B;  1HNZ Q;  3S1R H;  4KTA A;  5IGB A;  2IJ0 A;  1SE2 A;  4IJH A;  5E3F A;  2NVY H;  4XT1 B;  2JJQ A;  2F0G A;  2QF7 A;  5LMN W;  4DV3 L;  4DV5 L;  1SE4 A;  5I2Y A;  4LF7 L;  4OWX B;  1K8G A;  2JYO A;  2CH4 A;  1KD1 C;  4LFA L;  2GN5 A;  3IL8 A;  4X3U A;  1EIH A;  3J80 i;  4MIU A;  1LO5 D;  1TWC H;  4OWT B;  3VYU A;  4GOP B;  3CCE A;  2B2Y C;  2HHH Q;  4JI2 Q;  2O2L D;  5BR8 Q;  4GLX A;  5M5X B;  1WFQ A;  4U67 3;  1CSP A;  4S3S A;  3O13 A;  5K36 G;  1FNV A;  5I4D A;  4QUC A;  3U50 C;  1SN8 A;  2NN6 H;  2LY7 A;  5AFW A;  3BU2 A;  3PUX A;  4QB4 A;  3NE5 B;  2AQ2 B;  4CDD C;  5AJ3 L;  3NTI A;  3EN2 A;  2FIN B;  1H9S B;  2PYK A;  3GTP B;  4BBR G;  1N33 L;  4PZ7 A;  2DGY A;  1HUM A;  5I9O A;  4A3B B;  4YWK A;  2EYF A;  1I4G A;  4O42 A;  2E5L Q;  3S14 B;  5H1S E;  4O1N A;  2JA8 B;  3I4O A;  5J39 A;  1CK1 A;  4HIO A;  3OTO L;  4I65 A;  3HOY B;  2F3V A;  1KLU D;  2K5V A;  1UEB A;  1HXY D;  4JI6 Q;  5C3E B;  2BE5 D;  4HED A;  4TKO B;  1A6X A;  1O78 A;  3Q0A A;  4A3E H;  2L11 A;  1PFN A;  1MI2 A;  5M3F H;  5DEH A;  1BBW A;  1STN A;  3ICE A;  4A4I A;  1Q12 A;  3NEL A;  2DN8 A;  3HOW H;  3KF6 A;  3GTQ B;  4DR7 L;  2KHJ A;  3KF8 B;  3HOZ G;  2K50 A;  3A5Z B;  2BDN A;  5DNF A;  4KHP Q;  1IBL Q;  5FJ8 G;  2K33 A;  1N36 Q;  1VQC A;  2JA5 B;  3FKI G;  3K6O A;  1O7L A;  2NZ1 D;  2EYO A;  3FKI H;  2EY2 A;  5JVG 3;  1WTR A;  5EGT A;  2I0Q A;  3HOX G;  3LWU A;  3IAY A;  1RL2 A;  3I2Z A;  3PQI A;  3TRZ A;  3I70 A;  1IYU A;  2SNS A;  5CGK A;  1A0I A;  3HFZ B;  4R4I A;  4JI2 L;  1LV9 A;  1V9P A;  5BR8 L;  4JBM A;  1LTB D;  4ZUJ A;  5C4Z A;  4EQO A;  4DXG A;  1PH4 A;  3NXW A;  2K5H A;  4BY1 B;  3PCO B;  5JPN C;  2UU9 Q;  3BG3 A;  3H0G G;  3J81 j;  1QVC A;  1YNN D;  4HCE A;  1YZ6 A;  4H0L C;  1XJV A;  1MJE A;  1HR0 W;  3H0G H;  2A68 D;  2NVQ H;  1LAC A;  1I94 L;  1TWG H;  1V43 A;  3ND8 A;  1WCM H;  3RR5 A;  1J8I A;  1KAA A;  2UXD Q;  3H94 A;  3MWY W;  2B2Y A;  1EL0 A;  3NWT A;  4RHS A;  1I4P A;  1STH A;  2M2L A;  2XN9 C;  4JV5 L;  2D5D A;  1X54 A;  5JVH 3;  4P74 A;  3OYY A;  4M1U B;  5ELD A;  4PZ8 A;  2I46 A;  1ONL A;  1EUJ A;  1MBY A;  1PTO H;  5GQO A;  2UUA L;  2EOT A;  3PO2 H;  1A62 A;  1TWA B;  1SNP A;  4TQU S;  1PTO C;  5EKL A;  2A73 B;  1ZYR C;  3A55 A;  3HKZ B;  1AFP A;  5LMN L;  4BBS H;  2RHQ B;  4HID A;  4B3R L;  3CRL C;  4A3K B;  3QB3 A;  3E9I A;  1F77 A;  4A3L G;  1VMP A;  4GNX A;  2B63 G;  4IZ8 A;  3K5L A;  2IX3 A;  3TP7 A;  2YYZ A;  1IBL L;  3CAM A;  1CKN A;  1M8A A;  3NEM A;  1SYF A;  4GLV B;  2F0F A;  3J80 E;  1ML0 D;  2J4X A;  4A3C G;  3SGI A;  1BCP B;  2E2D C;  1AH9 A;  2XRS D;  3DLL A;  1HPC A;  2B2T C;  1TS5 A;  1SR3 A;  3DHQ A;  1B70 B;  5M5X H;  3NP8 A;  4KHV A;  2WAQ E;  2BH2 A;  2RVL A;  1EWI A;  5I6W A;  2VXW A;  2DY7 A;  2EVB A;  1K3B C;  1SSO A;  2FMC A;  3HOV G;  1Y1V B;  1T5X D;  3K58 A;  1F2Y A;  5FLX E;  4DN4 M;  1YNJ D;  1VQ6 A;  1JCK B;  3GTP H;  1H95 A;  2KVM A;  1SRO A;  4B9W A;  4CKE A;  5IGF A;  1GVP A;  4L6T B;  4A3B H;  5D14 A;  4BWG B;  1FR3 A;  1YHB A;  5J22 A;  4TRD A;  3I55 A;  2KA7 A;  3S14 H;  4NKL A;  4NB3 A;  3IKJ A;  4KKU A;  5HGT A;  3QG1 A;  2UUB L;  3U4V A;  3SHL A;  2JA8 H;  2B8G A;  3EA6 A;  3R2I A;  2E76 C;  4CKB A;  2F0K A;  1IKL A;  4LF5 L;  3GTL H;  2NYZ D;  5C3E H;  2R7Z B;  4U68 A;  3BZK A;  1EY8 A;  4AYB B;  2KBN A;  2PQA A;  4FVM A;  2GVB A;  4DV2 Q;  2KJX A;  3S9W A;  1SNC A;  3CCS A;  1FNW A;  3C3L A;  3LGJ A;  2EYL A;  1Y14 B;  2RDH A;  3PO3 G;  1GD7 A;  2WP8 J;  1TWF B;  2EYP A;  1VQP A;  3M7N A;  4IFD J;  1Y8O B;  3SXH A;  3ULJ A;  3RLF A;  1WJJ A;  3H15 A;  3PO3 H;  3A56 A;  1O7Z A;  4AH6 A;  3J7A 5;  4IFD H;  3ER0 A;  2N8N A;  5DM6 3;  2OQ0 A;  4K6L A;  1UUP A;  4CKC A;  4FYD A;  2F1M A;  4LK1 C;  3QJY A;  3DWA A;  2JA5 H;  5EAY A;  4IN3 A;  3MXN A;  4F88 A;  4IAL A;  1HHV A;  1MJC A;  4A3M B;  3V96 A;  3GTM B;  1VQL A;  4PNY A;  2PNH A;  1SNO A;  2AKW B;  5GAH C;  1X3E A;  4H13 C;  1HR0 L;  1XMO Q;  3AFP A;  1KIX A;  4JOI A;  2JSO A;  2P5Z X;  2IY5 B;  1X56 A;  2Y0S B;  4OXP A;  2PI2 A;  4DR2 L;  1EY0 A;  1WTQ A;  4N9T A;  1BCP F;  5C4X B;  1SXT A;  1YIJ A;  3CU7 A;  2XTI A;  2F3W A;  2OWO A;  2I5M X;  4GLA C;  1D5Z C;  2EYJ A;  3DWP A;  1ZKO A;  4JI3 Q;  4NMZ A;  1DZ1 A;  4F8M A;  2F0E A;  3SK5 A;  2XWJ B;  3GP7 A;  2DNC A;  3S2H B;  2QCP X;  2B2T A;  2VUM G;  3CW2 C;  3ULP A;  4LJZ C;  5KIX A;  1PDQ A;  4YY3 Q;  3RN5 A;  3EBE A;  5IP7 H;  1AW7 A;  1I5F A;  1G91 A;  4DAY B;  1CZW A;  1FGU A;  1UEA B;  4DR3 Q;  1RF2 D;  1N8R C;  2ATW A;  1A63 A;  4LF8 Q;  2GVA A;  1TWA H;  1EY6 A;  4A3F H;  1Q46 A;  2K7V A;  4IUQ A;  3NBH B;  1IL2 A;  3CHB D;  3HP3 A;  3KOJ A;  3UDF A;  4YHH Q;  4DAM A;  3PUW A;  4KV6 A;  1JT8 A;  4FF3 A;  1LT4 D;  1PRT C;  4AQY Q;  4FXK C;  2JA6 G;  4N9P A;  3E9H A;  3RN2 A;  2A8V A;  4DR1 L;  3LWE A;  5IYB H;  2V1C C;  1PVO A;  3FVQ A;  1VQ4 A;  1MKH A;  3OW7 A;  2DUD A;  4DR6 Q;  1SYE A;  4XQJ A;  1CT1 D;  5C5M A;  1STB A;  2FXQ A;  4C3H G;  5JJL A;  3S15 B;  3T51 B;  3S1M B;  3P75 A;  4DV0 Q;  1LT5 D;  1U4L A;  5IT9 c;  3CCM A;  2KCM A;  3IRB A;  1XMO L;  4JBK A;  4YCV A;  1XMQ Q;  2ZJQ A;  4XIG S;  2HCI A;  2HT1 A;  1D7Q A;  5BN3 A;  1STA A;  3M4P A;  4IUP A;  4GZY C;  1Y1V H;  4RCO A;  1I6V C;  4QIW E;  1J5E Q;  5KEE A;  3DXJ C;  1BUV T;  2PZU A;  3SK6 A;  4C3J G;  4LFC Q;  1ICW A;  4EQP A;  4POF A;  1I4X A;  3RZD B;  2BA1 A;  2EY5 A;  3T1H Q;  3OIP A;  2Q2H A;  1LT3 D;  4WJW A;  2ZT9 C;  4ZKC B;  2F0O A;  2PI2 E;  2IL8 A;  4APV A;  2F0W A;  1RKN A;  1PA6 A;  3CCL A;  4K2L A;  1Y8N B;  4OX9 Q;  1HZC A;  3BDO A;  4X65 Q;  5KNB A;  4A3I H;  1NNX A;  4DUZ L;  3Q24 A;  3UE0 A;  1A2U A;  3M4O H;  2R7Z H;  4NXM L;  3H3V H;  4JVZ A;  4DFA A;  1P8L A;  5JAV A;  4K2K A;  4JI7 L;  3A7A B;  3DUZ A;  1NY4 A;  3H3V C;  4G4K A;  2EPB A;  2RSO A;  3MEH A;  5KYI A;  1ILP A;  3CQZ B;  3MA2 B;  3D4R A;  1JIC A;  3DM1 A;  3TS2 A;  4DR4 Q;  4QGU A;  5CBA E;  4LF4 Q;  2OTJ A;  3G48 A;  3L2P A;  5LMU L;  1QZH A;  5FKA C;  2CHB D;  4OO1 H;  1JOQ A;  2Q2T A;  5IWA Q;  4XDX A;  3S16 B;  3D31 A;  1SJE D;  2R93 B;  5M9O A;  4A3M H;  3GTM H;  2A6E D;  3L3O C;  1Z6H A;  1K83 H;  1D6E C;  1IHZ A;  2BE5 C;  5ELN A;  2WAC A;  4A3J G;  4GNX B;  2B2V A;  1D1I A;  3KK7 A;  4DV0 L;  2WII B;  4Y52 H;  5IYD G;  4JI8 L;  3VDY A;  2L15 A;  4QL5 A;  1TT2 A;  1SFO H;  5IGC A;  5C4X H;  5M5Y B;  2ZTC A;  4B08 A;  4Y7N H;  3I4M G;  5BN4 A;  5M3M B;  3C46 A;  1VQN A;  1YJ9 A;  1C0A A;  2QKI C;  2L5T A;  1BVS A;  4DAP A;  4DV3 Q;  1SE3 A;  2L4N A;  4LF7 Q;  3SK4 A;  1E1O A;  3BVM A;  1TQO A;  1YJW A;  1O7Y A;  1XNQ L;  3PSI A;  1FNU A;  3EVQ A;  2N3S A;  1HZ9 A;  2Q2U A;  4LFA Q;  1AP0 A;  2QDL A;  1F9Q A;  4XYQ A;  3N52 A;  5J1Z A;  4JI4 L;  3J7Z C;  2DJG C;  1JB7 A;  5GAE C;  2MUY A;  1DM0 B;  3CCU A;  3KUP A;  3SDZ A;  5F2D A;  1ZEQ X;  1LTA D;  4X64 L;  4J1M A;  5AJ3 Q;  2TSS A;  2MP1 A;  5DAU A;  5EKI A;  2NTT A;  1W6K A;  3FDT A;  5C44 B;  2BDO A;  2AHO B;  4LW1 A;  2NUC A;  1KNA A;  1IBK L;  4P2C B;  1N33 Q;  2B29 A;  2JA9 A;  3LNN A;  5FO7 B;  4DGZ A;  5CV8 A;  4IQZ A;  2Q8T A;  3VA7 A;  3K5M A;  4HTH A;  2AWO A;  1YNN C;  3I4N B;  2F0S A;  2A68 C;  3KYH C;  2C35 B;  3NUC A;  2K05 A;  4EVO A;  1IKM A;  1Q3L A;  4J15 A;  3K5O A;  5FO9 B;  1O7I A;  2Z6K A;  4PQX A;  1RDP D;  2KOL A;  1U4M A;  3OTO Q;  3QR8 A;  2HIV A;  1AZQ A;  5IWA L;  4JI5 L;  4XXE A;  1SNQ A;  4BA1 I;  1VQF A;  1Z47 A;  5C4J H;  1C48 A;  3R2T A;  3S15 H;  1RHP A;  3S1M H;  5C3X A;  5C0X J;  4X3T A;  1CKM A;  5CV7 A;  3PIO 3;  2EY1 A;  3K7U C;  1KLG D;  4DV1 L;  1RTO A;  4X62 L;  3G4S A;  2K04 A;  2NVX B;  3E5S A;  4FO2 A;  1IYV A;  4EX5 A;  1PH2 A;  3J81 c;  5C0X H;  2VQE L;  3T1Y L;  4DNR B;  3KDF A;  4KI0 A;  5EPK A;  3HEJ A;  1X3G A;  3WOF A;  4LF9 L;  4HCS A;  4A93 B;  3P20 A;  4A3D B;  1BQQ T;  2N55 A;  3GV3 A;  4KKT A;  3RZD H;  3GDE A;  1JR0 D;  4OEL B;  4JK1 C;  1WTP A;  4NXN L;  4JI1 L;  4KD3 A;  1U9R A;  1CUK A;  1XNR L;  2UUC L;  4A3G B;  3TS0 A;  3QO2 A;  4A75 A;  3LX0 A;  3HKZ E;  2ZM6 L;  2YTV A;  2Q8I B;  3FPP A;  2NN6 G;  1E0B A;  3CRK C;  1LT6 D;  2B63 B;  2PNR C;  3AYH B;  3EQL C;  2Q8R E;  3KJO A;  2Z4I A;  2D9U A;  1DOM A;  2MFI A;  3SVM A;  2DY8 A;  1S5B D;  4KY6 A;  1OTC A;  1YNJ C;  1ASY A;  3CQZ H;  1I94 Q;  4B3T L;  3TRE A;  3I4N G;  5CV9 A;  3M85 A;  1S3O A;  1JWS D;  2KED A;  3QWN A;  3K8A A;  1PHJ A;  1PYS B;  4IUT A;  4IOC A;  4JV5 Q;  1QIL A;  1B1Z A;  4ALP A;  5ELF A;  3S16 H;  1PYW D;  2RA4 A;  4HAE A;  4JCV E;  1ICF B;  1W2B A;  2QW7 A;  5EPJ A;  2WKD A;  4A3E G;  2UUA Q;  5KRU A;  4L5R C;  4N8F A;  1V1P A;  5DM7 3;  1F2Z A;  2HD3 A;  1HCZ A;  5M3F G;  1WTV A;  4GKJ L;  1TS2 A;  1VQD A;  3E0J A;  2R92 H;  1RJT A;  1H9R A;  1GOZ A;  4RGM A;  1UE7 A;  4R4C A;  1PH1 A;  1PZK D;  3HOW G;  5LMN Q;  2B3G A;  1L1O A;  2K32 A;  3CPF A;  3BJU A;  3GD7 A;  5M5Y H;  3K57 A;  4B3R Q;  3DWQ A;  4UY8 C;  2AUJ D;  1D5M C;  4RGO S;  1SYC A;  5M3M H;  1PH5 A;  4XTC S;  4C3I B;  1M4V A;  2WV6 D;  2ZXO A;  3CC4 A;  5IP9 H;  3PF5 A;  4PMW A;  3FPU B;  2CCZ A;  3PV0 A;  4AYB E;  5IT9 E;  1X55 A;  1N32 L;  2IX1 A;  5JPM C;  3BS1 A;  2E2J B;  2BOS A;  3SE0 A;  2QEX A;  3TP8 A;  2F0V A;  5IT9 L;  1KDB A;  2SDF A;  3BVG A;  1PXU A;  3TP6 A;  1R4P B;  2F0U A;  1WTO A;  4MNO A;  1IL8 A;  4BY7 H;  1HZA A;  1N9W A;  1ENC A;  4M8A A;  2AWN A;  1LTL A;  1KDC A;  2LSS A;  2XVS A;  5NUC A;  4ZQ3 A;  2VL6 A;  5C5L A;  4JW0 A;  4DK1 A;  5C44 H;  4LF6 Q;  1R9T H;  3JAM c;  2HQE A;  1LTS D;  4KJN A;  3FEW X;  1QWY A;  2JP1 A;  2PMZ E;  4NP5 A;  2F4V L;  1X32 A;  4X3S A;  2H4O A;  4HIK A;  2EXZ A;  2F3I A;  1WCM G;  1LUZ A;  3I4N H;  2EJG C;  2SEB D;  2VQF L;  4DNT B;  2KUM A;  3P1H A;  1VQE A;  5M5W B;  1VQG A;  2UUB Q;  4HSP A;  2WB1 B;  1LLR D;  1T9H A;  1OXV A;  4OGQ C;  5EJW A;  3S24 A;  2AQ3 B;  4EGV A;  4YIJ A;  1NMG A;  4LF5 Q;  2NVT B;  1F9S A;  4ZK9 B;  3MVV A;  1JJC B;  1OO9 B;  4F87 A;  3PO2 G;  3E6Z X;  3HG9 A;  1DJR D;  3F2U A;  2I5H A;  3NPP A;  2L0C A;  2D0O A;  3TBI B;  4BBS G;  4LMQ D;  2A6H C;  3M7G A;  2NVX H;  4Z9C B;  2XSC A;  4IPC A;  4FDB A;  3HOU B;  2VB3 X;  1GUO A;  1WTX A;  1E7Z A;  3ULL A;  3C1E A;  1AZP A;  3W1G A;  4A76 A;  1Y1W H;  4RWS C;  5HUR A;  3AMU A;  1VQ8 A;  2F0Q A;  4A93 H;  4CDC C;  1EWH A;  5D3D A;  4A3D H;  4IFD I;  1V8Q A;  3S1Q B;  1N34 L;  1YJN A;  2Z4H A;  2G9H D;  4G7Z C;  4B3S L;  1HTL D;  3N6R A;  2YTY A;  1PH3 A;  3W2D A;  1YHA A;  1UE1 A;  3F8T A;  4PG3 A;  1BBX C;  1QUQ B;  2M00 A;  4A3G H;  1STY A;  4IO9 A;  4F7X A;  5KGU A;  4QMG A;  3TDQ A;  1YI2 A;  5D3I B;  1HR0 Q;  5TSS A;  2NB0 A;  1EQR A;  2JA6 B;  4FP5 D;  1UWV A;  2PW7 A;  1UE5 A;  4IPH A;  5A35 A;  4DR2 Q;  4GOP C;  3OW2 A;  1JJG A;  4X3K A;  1KQS A;  2CQA A;  3NEN A;  1SRU A;  2JE6 I;  2RCN A;  3A54 A;  1CHP D;  1XTC D;  4YWL A;  2L1B A;  4LF6 L;  4ZAI A;  1ROD A;  4DKA C;  2K75 A;  4A3B G;  4BXX H;  4C3H B;  1EOV A;  5IGE A;  5EBD A;  1WD0 A;  3NQT A;  4YCU A;  2CKZ B;  1OXT A;  3VR5 A;  3PMF A;  3DEO A;  4CHT B;  5GAD C;  2IX0 A;  4R8N A;  1Q7Y C;  2JA8 G;  1EWC A;  2CW0 D;  4RCN A;  3HOY G;  4QY7 A;  2IT1 A;  3HOY H;  3AFQ A;  1CTM A;  5C3E G;  1VQ9 A;  2R6G A;  3TEH B;  2BA0 A;  5EQ0 A;  3DM3 A;  2JK8 A;  4TSS A;  2PZW A;  1STG A;  4L5T A;  1STE A;  5HGQ A;  5ISR A;  3QIA A;  3KLS X;  4OHJ A;  1JB3 A;  4QCL A;  1PH7 A;  1GUW A;  1U4R A;  3TME A;  3B6Y A;  5GAG C;  3OPO A;  1KRT A;  3MFY A;  1NJI C;  4HJ9 A;  4RAU C;  1EU4 A;  1J9O A;  5JEA J;  3GTQ H;  1TU2 B;  5CBE E;  4IFD G;  5EPL A;  1DGS A;  2HQL A;  3PIP 3;  4DUY L;  5E7N A;  3VR2 A;  2B2W C;  4DR1 Q;  5CC4 A;  3PUY A;  1M90 C;  1G8Z D;  5JEA H;  2JA5 G;  1KTK A;  3Q23 A;  4WRD A;  3TZU A;  3RD4 A;  2JA7 B;  1I3Q B;  4IUR A;  2R7D A;  4HMI A;  4LFB L;  1HA6 A;  1Q1B A;  3HZX A;  1JOR A;  4LNQ A;  3J81 E;  2A6E C;  1VQK A;  2PCF B;  3U9S A;  1A3T A;  2K5Q A;  3J81 L;  3ZJY C;  1RD9 D;  4CJ2 C;  1X3F A;  3FP9 A;  3NQI A;  4BY1 H;  3WWV A;  4R4Q A;  4RA8 A;  3EJI A;  1P16 A;  2AQ1 B;  2EXD A;  1IZ6 A;  1S5C D;  4IPD A;  1PMR A;  4HJ8 A;  2NBF A;  1EY9 A;  1DOL A;  4ABN A;  2MPM A;  1WYD A;  3RLN A;  2RHS B;  5IP7 G;  1KC8 C;  3I4M B;  5FLM H;  4DUZ Q;  4UP9 A;  4NXM Q;  1ENF A;  4WFN 3;  3AQQ A;  1K0R A;  2BCO A;  4OIJ A;  1ASZ A;  4A3F G;  4PMB A;  4JI7 Q;  3H3V I;  1HNX L;  3HKZ G;  4JBW A;  4CJ1 B;  4DF7 A;  2UXC L;  3MTS A;  4HJA A;  3MXU A;  3GTJ B;  3J7Y W;  4CGY B;  1CSQ A;  1H9S A;  1VMC A;  2F0N A;  3ND9 A;  3C2P A;  3HOU H;  1F2M A;  3NK9 A;  3NTK A;  1VF7 A;  5E1F A;  2JQO A;  3GTO B;  2Q2I A;  1JOK A;  3TQY A;  3RLO A;  1JMC A;  3TSS A;  4A3K H;  1ET6 A;  5IYB G;  5LMU Q;  3QOJ A;  4P71 A;  1EQV A;  2HUG A;  1F9P A;  5A2Q L;  4RG1 A;  1ET9 A;  4OO1 I;  3KF6 B;  1JC7 A;  2E8G A;  1QCB D;  5CR3 A;  3K0Y A;  3D8G A;  4KN4 C;  4O0A A;  1KNE A;  5K5P A;  2MJ8 A;  2WAQ B;  1QNU A;  3MFG A;  1BCP C;  4YCW A;  2D62 A;  4YWM A;  4JI8 Q;  3CMA A;  4MHE A;  1CI3 M;  1Y1V G;  1UAP A;  2B2W A;  2OT2 A;  2ZJP A;  2GA4 B;  1OXS C;  1K8M A;  2DNE A;  1BDO A;  2E2I B;  3F2C A;  2L55 A;  3KF8 A;  1QJO A;  5E4X A;  1PLF A;  1GXD C;  1FL0 A;  3E3X A;  2CFM A;  4DU9 A;  5DLQ E;  1GJX A;  1XNQ Q;  3OOC A;  4XYO A;  4HJ7 A;  4RGN A;  4UP7 A;  5ELC A;  2AMC B;  3NBI A;  1FD7 D;  4HN7 A;  4JI4 Q;  1YBY A;  1OXU A;  2YV5 A;  1E2Z A;  4A3I G;  3Q8D A;  2LKV A;  4L63 B;  1C4Q A;  2MHV A;  3OMC A;  1GUN A;  1BKB A;  2R7Z G;  4ZYS A;  2ASB A;  4AYB G;  4X64 Q;  2RCF A;  3GV6 A;  1E3P A;  3VA5 A;  3JAM L;  1IBK Q;  2OXP A;  2EYH A;  2KHS A;  3VYS A;  1TWF H;  1TWC B;  2VS1 A;  2BH8 A;  1TR5 A;  2A74 C;  2K14 A;  4ZLT F;  2ZXR A;  1EZ8 A;  4DK3 C;  3ITP A;  3CD6 A;  4OO1 G;  1I6H B;  2EYM A;  2K5D A;  2B2U C;  2K03 A;  2JA7 H;  3KFU A;  5JJK A;  3CF5 A;  4JI5 Q;  4A3M G;  1A8V A;  2HDM A;  4NW2 A;  4XQQ A;  1PFB A;  1CHQ D;  4BBR B;  3OWF A;  4DAV A;  4OEM B;  2A69 D;  2OCE A;  3VR3 A;  1XTD A;  2LMC B;  2OEO A;  4KD4 A;  3JC6 6;  5KNC A;  4DV1 Q;  3QOL A;  1W6J A;  4X62 Q;  5CMD A;  1CKN B;  2Y0S G;  5IY0 A;  3P7J A;  2VQE Q;  3T1Y Q;  3GTK B;  2K4K A;  1SMY D;  5C4X G;  4MTN A;  1SJH D;  3G7L A;  4LF9 Q;  1SBB B;  4MTK A;  1HQR D;  1GHK A;  2IHE A;  2K6A A;  2ICI A;  3W3A A;  1KDA A;  1SNM A;  1YNX A;  1HA5 A;  4WJ4 A;  3M9B A;  3J80 c;  2ENB A;  4KY5 A;  4PMC A;  4K0K L;  4NXN Q;  1B9N A;  4WOR A;  4JI1 Q;  4X66 L;  1HNW L;  1U4P A;  2KQ3 A;  2PZT A;  2LXJ A;  2UUC Q;  1XNR Q;  1B7Y B;  1IW7 D;  4L5S A;  3CPW A;  3S2H H;  1K9M C;  1HZB A;  1G6Z A;  2AUK A;  2ZM6 Q;  1SND A;  1SE8 A;  1HTP A;  4L8J A;  1LTI D;  3ZYY X;  1H9K A;  3PGZ A;  1Q8K A;  1A15 A;  2MGS A;  5IYC H;  3HOZ B;  2ID0 A;  3ERS X;  5KND A;  1BO0 A;  2F0I A;  1S5E D;  3Q6S A;  1EU3 A;  1QOH A;  5GRO A;  4IJL A;  1TS4 A;  1AE2 A;  5FLX c;  4P75 A;  3FKI B;  1C8C A;  2NN6 I;  1UNS A;  3KLS A;  1XPR A;  2F0L A;  4I7A A;  1S40 A;  5FK9 C;  3Q22 A;  1GO3 E;  3PIO A;  2OF1 A;  5JJZ A;  1D8L A;  3GTJ H;  4B3T Q;  3HOX B;  4NPS A;  5JJI A;  1AE3 A;  3D6C A;  2KEN A;  2K01 A;  1MSG A;  1S5D D;  1GM5 A;  2PQA B;  1HH2 P;  4QF4 A;  5I2X A;  2FHT A;  3X3M A;  1KAW A;  2J0T D;  4K8I A;  2VY3 A;  1NUC A;  1B9M A;  5J3B A;  3H0G B;  4RKL A;  3RUZ A;  3F2D A;  3E0E A;  3D3R A;  1F9R A;  4PV1 C;  4GKJ Q;  5I6Y A;  2KCT A;  1WD1 A;  1K3R A;  3I4L A;  2PO4 A;  3UDI A;  2TMP A;  1DOK A;  2F0H A;  5C0X G;  3MXN B;  1VS0 A;  4QIW B;  2WB1 E;  3NHH A;  4B3M L;  3AB9 A;  2LXK A;  3ONA B;  4JG2 A;  4X6A H;  2CH4 W;  1PTO B;  3U9O A;  1CFM A;  1RCV D;  2B2U A;  4DPG A;  4IUN A;  1EQQ A;  1K8O A;  4ME5 A;  2EJM A;  4JC0 A;  4DK6 C;  1N32 Q;  1A2T A;  2YU9 B;  5CV4 A;  1EY4 A;  4G7O C;  2N88 A;  1JQY D;  4CBV A;  1D1K A;  3WOE A;  3MXP A;  1Q90 A;  2KHI A;  2XIW A;  1J6Q A;  2ZXP A;  4HSV A;  1CQV A;  1RIP A;  3R8B A;  1KAB A;  1VQJ A;  2X69 A;  3OWE B;  2Z8L A;  1S5F D;  5FO8 B;  1TWH B;  2FFK B;  4TVA B;  2VB2 X;  4ILW A;  4DR5 L;  3RNU A;  5G3L F;  3NTH A;  2F4V Q;  3RZO B;  1VQO A;  1B2T A;  1EYD A;  4DV6 L;  3GQB A;  2K52 A;  2VQF Q;  3CCR A;  5T1I A;  5K36 H;  1LM0 A;  1M1K C;  3TZD A;  2WKC A;  3L0O A;  4JI0 L;  1I6H H;  1BOS A;  1HRJ A;  1FVI A;  2QEJ C;  1MD2 D;  1BBU A;  2CW0 C;  2F0T A;  3A8J E;  1IXR A;  2R93 G;  4ZRZ A;  2L12 A;  3HOV B;  1G51 A;  2R93 H;  4ME3 A;  4J6H A;  1GUT A;  4BBR H;  1YEZ A;  3VYT A;  1XX8 A;  1XWE A;  3HKS A;  2R92 G;  1D5X C;  1MSH A;  4DAY A;  1JWM D;  2PW5 A;  4OIK A;  1TS3 A;  4LWC A;  1FJG L;  3R3O A;  4MN3 A;  3GTK H;  4GNX C;  1AN8 A;  1PYB A;  3HRZ C;  4DV4 L;  4FXG C;  2VNU D;  1D2B A;  3NBH A;  1G2T A;  3BZC A;  5M3M G;  4JYA L;  3M3Y B;  3GTL B;  4QUF A;  3U58 A;  3S17 B;  2ICE C;  2R7F A;  1SDF A;  1CA6 A;  4K5W A;  1PFS A;  3MZ5 A;  1N34 Q;  2A5H A;  5IP9 G;  1NCV A;  1VQH A;  4B3S Q;  2KCC A;  4Q0F A;  2NTS A;  3A7L A;  1K28 A;  2CVR A;  1LYL A;  4QQB X;  3PO3 B;  1JOO A;  4NDX A;  4GKK L;  2RKS A;  1PTO F;  3K7A B;  1GUG A;  4IOA A;  1HNZ L;  1VDZ A;  2O4X A;  1E24 A;  4I7Z C;  1Y69 U;  4BY7 G;  5C6A A;  1Q8I A;  3HOZ H;  3J81 i;  4POG A;  3G6J B;  2E75 C;  3DEP A;  3S1N B;  2EY6 A;  3I8Z A;  5KYL A;  3CCJ A;  3UDG A;  5FJ8 H;  5C44 G;  1L0Y B;  3U4Z A;  3GTG B;  1I4H A;  2EIF A;  3J7A V;  2VZA A;  4UDU C;  3STB D;  1EFW A;  1T5E A;  3HOX H;  1WTH A;  1ESR A;  3BYT B; 
#chains in the Genus database with same CATH homology
 4XT3 B;  4KHZ A;  3R93 A;  2L9H A;  3A8K E;  2KCN A;  1JWU D;  5IGG A;  3T56 B;  4E6I A;  3KBG A;  1HUN A;  3D4D A;  3AU7 A;  1GUS A;  3SR1 A;  3I90 A;  3MC0 B;  5FOB B;  4XQN A;  2H1E A;  1EY7 A;  4BS9 A;  1WVL A;  4FXD A;  2M9V A;  2B8F A;  1PZJ D;  1SYB A;  1ESF A;  2VUM B;  2IPK D;  4FF4 A;  2K1B A;  3K5N A;  1RTN A;  1A3V A;  1QE6 A;  4A3F B;  1BXT A;  1PRT B;  3WDN A;  4K8J A;  1V1O A;  2F0J A;  1SEB D;  4FNF A;  3BDC A;  1TVX A;  3BVZ A;  5JOB A;  1E2V A;  2SOB A;  5LL6 S;  3X3N A;  4OL7 A;  1FYC A;  3NWS A;  1CA5 A;  3OHX C;  5IOD A;  3J80 L;  1DCZ A;  2IWH A;  4R9W A;  3MXG A;  1EQT A;  3FMC A;  1EIG A;  3VYR A;  4LAA A;  2IW3 A;  1BNZ A;  1NSN S;  3H6M A;  3MAQ A;  2C9O A;  1EYC A;  3VR4 A;  4C1N K;  4C56 C;  2XRQ D;  2V4D A;  2R61 A;  1DXM A;  3C1F A;  1SYG A;  4C3J B;  5COR A;  5FLX L;  3EFX D;  3H09 A;  5D65 A;  1B44 D;  2RQX A;  4G57 A;  5C4H A;  2SNM A;  4A3I B;  3HGB A;  1I4Q A;  5JEA G;  3M4O B;  3BYY B;  4C3I G;  1DYQ A;  1I50 B;  1H9J A;  1B50 A;  1FGB D;  4V19 0;  4C2M B;  3HS0 C;  2E2H B;  1QNK A;  3D6W A;  3T4A C;  1XYI A;  5IOC A;  3KBX A;  3T53 B;  4RHR A;  3URY A;  1LAB A;  4ULL A;  4ODG A;  5G3L D;  2A69 C;  1B4O A;  1CM9 A;  1DON A;  5LL6 X;  1G29 1;  3PUZ A;  1PRT F;  2PMZ B;  2F0P A;  1SMY C;  2WIN B;  1Q1E A;  3FRP B;  1K83 B;  4IUV A;  2X6G A;  3UI2 A;  4A3J B;  5ELE A;  4FF2 A;  2KEE A;  1S4Z A;  4KK7 A;  5E4W C;  1IW7 C;  1SFO B;  4Y7N B;  1ZXT A;  3S2D B;  1NR2 A;  3T16 A;  1B53 A;  4H44 C;  1EEF D;  1G2S A;  4UAI A;  5BN5 A;  2B39 A;  2EE1 A;  3I73 A;  3ERO A;  1HQM C;  3VR6 A;  3DMU A;  1V1P B;  4H7B A;  1PZI D;  5I9P A;  5A2Q E;  5T1G A;  5CV5 A;  1PTO D;  1ZYR D;  4EQN A;  2A6H D;  2B2V C;  1TII D;  4G7H C;  3J7A F;  1QB5 D;  2RBM A;  1LTG D;  2D2C C;  1EZ6 A;  2R3Z A;  2PPB C;  3ERQ A;  1EFI D;  4ID6 A;  4CJ0 B;  4IUU A;  2K28 A;  5EBC A;  4BA2 I;  1VF5 C;  2F0D A;  2RDF A;  5C4J B;  3CKI B;  3I91 A;  1NAP A;  5IIF A;  1ENA A;  5CYU A;  2F0M A;  1I4R A;  1R4Q B;  4FF1 A;  1ILQ A;  2QDB A;  3GO5 A;  4KY7 A;  3S1R B;  2O5J C;  3TN2 A;  3JAM E;  2NVY B;  2E74 C;  4KKS A;  3L7Z C;  2RDG A;  1XXG A;  1GHJ A;  4Q5V A;  1SAP A;  4ZKB B;  4V0B A;  3KLR A;  2F4I A;  3T13 A;  4K14 A;  3V05 A;  1AEX A;  1L0X B;  2EZV A;  1QG7 A;  3NSW A;  1CZG A;  3PUV A;  1II3 A;  2PQE A;  4K5X A;  5IGD A;  2I07 B;  3K59 A;  2X6L A;  4KJO A;  2LS0 1;  1EY5 A;  2C5C A;  2F03 A;  1X3P A;  2LFN A;  3SK8 A;  1WTW A;  3MHB A;  3H91 A;  2HCC A;  5C0X I;  1DD2 A;  4A3E B;  1Y8P B;  3BDL A;  2R92 B;  1F2L A;  5M3F B;  3V2T A;  4B9X A;  1EEI D;  3OMG A;  3HOW B;  1HFN A;  1CQF A;  4DK0 A;  1EYA A;  2J7Z A;  2RSN A;  2XNA C;  5C3W A;  1PFM A;  5ELB A;  3M4Y A;  1NR4 A;  3BZD B;  1BF4 A;  5CV6 A;  4KMU C;  2JXM B;  2O5I C;  1O80 A;  2JEB I;  3IFT A;  4KN7 C;  5COY A;  3IFD A;  1OXX K;  1H9M A;  1SYD A;  2G9D A;  4RGT A;  2QIL A;  2FMM A;  3I72 A;  3SEB A;  4BY7 B;  3A8I E;  4J8Q A;  4DXF A;  1A3U A;  1VCI A;  2XWB B;  1JE4 A;  1R9T B;  2KEC A;  4R8I A;  4RFB A;  3TP5 A;  1Z7T A;  4K6D A;  2FJ2 A;  2NVQ B;  1PRT D;  2K5W A;  4RH6 A;  2JEA I;  1TWG B;  4RKB A;  1TY0 A;  1WCM B;  1HFG A;  3L9A X;  3OSO A;  1EOT A;  4DA2 A;  1X3Q A;  4ZUI A;  4HMJ A;  2EDG A;  3OIQ A;  1E2W A;  1TY2 A;  3RMH A;  2NWG A;  1LTR D;  1LTT D;  1BCP D;  3PO2 B;  3D4W A;  5LHY 1;  4HR7 B;  4C1N I;  5EKK A;  2Z1C A;  1MGS A;  4K5V A;  4BBS B;  1BR9 A;  2EJF C;  2HDL A;  1B3A A;  1TKW B;  3I3C A;  1Y1W B;  4KTA A;  5IGB A;  2IJ0 A;  1SE2 A;  5E3F A;  4XT1 B;  2F0G A;  2QF7 A;  1SE4 A;  5I2Y A;  2JYO A;  3IL8 A;  4X3U A;  1EIH A;  4MIU A;  1LO5 D;  3VYU A;  2B2Y C;  2O2L D;  5M5X B;  4U67 3;  4S3S A;  3O13 A;  5K36 G;  1FNV A;  5I4D A;  4QUC A;  2NN6 H;  2LY7 A;  5AFW A;  3PUX A;  4QB4 A;  3NE5 B;  2AQ2 B;  3NTI A;  2FIN B;  1H9S B;  2PYK A;  3GTP B;  1HUM A;  5I9O A;  4A3B B;  2EYF A;  1I4G A;  4O42 A;  3S14 B;  4O1N A;  2JA8 B;  5J39 A;  1CK1 A;  4I65 A;  3HOY B;  2F3V A;  1KLU D;  1HXY D;  5C3E B;  2BE5 D;  4HED A;  4TKO B;  1A6X A;  1O78 A;  3Q0A A;  2L11 A;  1PFN A;  1MI2 A;  5DEH A;  1STN A;  1Q12 A;  2DN8 A;  3GTQ B;  2BDN A;  5DNF A;  2K33 A;  2JA5 B;  3K6O A;  1O7L A;  2NZ1 D;  2EYO A;  2EY2 A;  5JVG 3;  1WTR A;  5EGT A;  3LWU A;  3IAY A;  3I70 A;  1IYU A;  2SNS A;  5CGK A;  1LV9 A;  1LTB D;  4ZUJ A;  5C4Z A;  4EQO A;  4DXG A;  3NXW A;  4BY1 B;  5JPN C;  3BG3 A;  1YNN D;  4HCE A;  4H0L C;  2A68 D;  1LAC A;  1V43 A;  3ND8 A;  1J8I A;  1KAA A;  3H94 A;  3MWY W;  2B2Y A;  1EL0 A;  3NWT A;  4RHS A;  1I4P A;  1STH A;  2M2L A;  2XN9 C;  2D5D A;  5JVH 3;  4M1U B;  5ELD A;  2I46 A;  1ONL A;  1MBY A;  1PTO H;  2EOT A;  1TWA B;  1SNP A;  4TQU S;  1PTO C;  5EKL A;  2A73 B;  1ZYR C;  3A55 A;  3HKZ B;  1AFP A;  3CRL C;  4A3K B;  3QB3 A;  1F77 A;  1VMP A;  4IZ8 A;  3K5L A;  2IX3 A;  3TP7 A;  2YYZ A;  1M8A A;  1SYF A;  2F0F A;  3J80 E;  1ML0 D;  2J4X A;  1BCP B;  2E2D C;  2XRS D;  1HPC A;  2B2T C;  1TS5 A;  3DHQ A;  3NP8 A;  4KHV A;  2RVL A;  5I6W A;  2VXW A;  2DY7 A;  2EVB A;  1SSO A;  2FMC A;  1Y1V B;  1T5X D;  3K58 A;  1F2Y A;  5FLX E;  4DN4 M;  1YNJ D;  1JCK B;  2KVM A;  4B9W A;  4CKE A;  5IGF A;  4L6T B;  5D14 A;  4BWG B;  1FR3 A;  5J22 A;  4TRD A;  2KA7 A;  4NKL A;  3IKJ A;  4KKU A;  5HGT A;  3QG1 A;  3SHL A;  2B8G A;  3EA6 A;  3R2I A;  2E76 C;  4CKB A;  2F0K A;  1IKL A;  2NYZ D;  2R7Z B;  4U68 A;  1EY8 A;  4AYB B;  4FVM A;  2KJX A;  3S9W A;  1SNC A;  1FNW A;  3C3L A;  2EYL A;  3M7N A;  2RDH A;  2WP8 J;  4IFD J;  1TWF B;  2EYP A;  1Y8O B;  3SXH A;  3RLF A;  3A56 A;  1O7Z A;  4IFD H;  5DM6 3;  4K6L A;  1UUP A;  4CKC A;  4FYD A;  2F1M A;  4LK1 C;  3QJY A;  3DWA A;  4IN3 A;  4F88 A;  3MXN A;  4IAL A;  1HHV A;  4A3M B;  3V96 A;  3GTM B;  4PNY A;  1SNO A;  4H13 C;  2JSO A;  2Y0S B;  1WTQ A;  1EY0 A;  4N9T A;  1BCP F;  5C4X B;  1SXT A;  3CU7 A;  2F3W A;  1D5Z C;  2EYJ A;  3DWP A;  1ZKO A;  4NMZ A;  1DZ1 A;  4F8M A;  2F0E A;  3SK5 A;  2XWJ B;  3GP7 A;  2DNC A;  3S2H B;  2QCP X;  2B2T A;  4LJZ C;  5KIX A;  1PDQ A;  1AW7 A;  1G91 A;  1CZW A;  1UEA B;  1RF2 D;  1EY6 A;  2K7V A;  4IUQ A;  3CHB D;  3HP3 A;  3PUW A;  4KV6 A;  4FF3 A;  1LT4 D;  1PRT C;  4FXK C;  4N9P A;  3LWE A;  3FVQ A;  3OW7 A;  1SYE A;  4XQJ A;  1CT1 D;  5C5M A;  1STB A;  4C3H G;  3S15 B;  3T51 B;  3S1M B;  3P75 A;  1LT5 D;  1U4L A;  4XIG S;  2HCI A;  5BN3 A;  1STA A;  4IUP A;  4GZY C;  4RCO A;  1I6V C;  5KEE A;  3DXJ C;  1BUV T;  4C3J G;  2PZU A;  3SK6 A;  1ICW A;  4EQP A;  1I4X A;  3RZD B;  2BA1 A;  2EY5 A;  3OIP A;  1LT3 D;  4WJW A;  4ZKC B;  2ZT9 C;  2F0O A;  2IL8 A;  2F0W A;  1RKN A;  4K2L A;  1Y8N B;  3BDO A;  5KNB A;  3Q24 A;  1A2U A;  4DFA A;  5JAV A;  4K2K A;  3A7A B;  3DUZ A;  3H3V C;  4G4K A;  2EPB A;  2RSO A;  3MEH A;  5KYI A;  1ILP A;  3CQZ B;  3MA2 B;  3D4R A;  1JIC A;  3DM1 A;  5CBA E;  5FKA C;  2CHB D;  4OO1 H;  1JOQ A;  4XDX A;  3S16 B;  3D31 A;  1SJE D;  2R93 B;  5M9O A;  2A6E D;  3L3O C;  1Z6H A;  1D6E C;  1IHZ A;  2BE5 C;  2WAC A;  2B2V A;  1D1I A;  3KK7 A;  2WII B;  1TT2 A;  5M5Y B;  5IGC A;  4B08 A;  5BN4 A;  5M3M B;  3C46 A;  2QKI C;  2L5T A;  4DAP A;  1SE3 A;  2L4N A;  3SK4 A;  3BVM A;  1TQO A;  1O7Y A;  1FNU A;  3EVQ A;  1AP0 A;  1F9Q A;  4XYQ A;  3N52 A;  5J1Z A;  2MUY A;  1DM0 B;  3KUP A;  3SDZ A;  5F2D A;  1ZEQ X;  1LTA D;  4J1M A;  2TSS A;  2MP1 A;  5DAU A;  5EKI A;  2NTT A;  1W6K A;  3FDT A;  5C44 B;  2BDO A;  2NUC A;  1KNA A;  4P2C B;  3LNN A;  5FO7 B;  4DGZ A;  5CV8 A;  4IQZ A;  2Q8T A;  3VA7 A;  3K5M A;  4HTH A;  2AWO A;  1YNN C;  3I4N B;  2F0S A;  2A68 C;  3NUC A;  2K05 A;  4EVO A;  1IKM A;  1Q3L A;  3K5O A;  5FO9 B;  4PQX A;  1RDP D;  2KOL A;  1U4M A;  1AZQ A;  4XXE A;  1SNQ A;  4BA1 I;  1Z47 A;  1C48 A;  3R2T A;  1RHP A;  5C3X A;  5C0X J;  4X3T A;  5CV7 A;  3PIO 3;  2EY1 A;  1KLG D;  1RTO A;  2K04 A;  2NVX B;  3E5S A;  4FO2 A;  1IYV A;  5C0X H;  4DNR B;  4KI0 A;  5EPK A;  3HEJ A;  3WOF A;  4HCS A;  4A93 B;  3P20 A;  4A3D B;  1BQQ T;  2N55 A;  3GV3 A;  4KKT A;  1JR0 D;  4JK1 C;  1WTP A;  4KD3 A;  1U9R A;  4A3G B;  3QO2 A;  3LX0 A;  2Q8I B;  3FPP A;  2NN6 G;  1E0B A;  3CRK C;  1LT6 D;  2B63 B;  2PNR C;  3EQL C;  2Q8R E;  2Z4I A;  2D9U A;  1DOM A;  3SVM A;  2DY8 A;  1S5B D;  4KY6 A;  1YNJ C;  5CV9 A;  3M85 A;  1JWS D;  2KED A;  3QWN A;  4IUT A;  1QIL A;  1B1Z A;  5ELF A;  1PYW D;  2RA4 A;  4HAE A;  5EPJ A;  2WKD A;  5KRU A;  1V1P A;  5DM7 3;  1F2Z A;  1HCZ A;  1WTV A;  1TS2 A;  3E0J A;  1RJT A;  1H9R A;  1GOZ A;  4RGM A;  1PZK D;  2K32 A;  3GD7 A;  3K57 A;  3DWQ A;  2AUJ D;  1D5M C;  4RGO S;  1SYC A;  4XTC S;  4C3I B;  1M4V A;  2WV6 D;  2ZXO A;  4PMW A;  3FPU B;  3PV0 A;  5IT9 E;  2IX1 A;  5JPM C;  3BS1 A;  2E2J B;  2BOS A;  3SE0 A;  3TP8 A;  2F0V A;  5IT9 L;  1KDB A;  2SDF A;  3BVG A;  1PXU A;  3TP6 A;  1R4P B;  2F0U A;  1WTO A;  1IL8 A;  1ENC A;  4M8A A;  2AWN A;  1KDC A;  2XVS A;  5NUC A;  4ZQ3 A;  5C5L A;  4DK1 A;  2HQE A;  1LTS D;  4KJN A;  3FEW X;  1QWY A;  2JP1 A;  4NP5 A;  1X32 A;  4X3S A;  2H4O A;  2EXZ A;  2EJG C;  2SEB D;  4DNT B;  2KUM A;  3P1H A;  5M5W B;  4HSP A;  2WB1 B;  1LLR D;  1OXV A;  4OGQ C;  5EJW A;  2AQ3 B;  4EGV A;  4YIJ A;  2NVT B;  1F9S A;  4ZK9 B;  3MVV A;  1OO9 B;  4F87 A;  3E6Z X;  3HG9 A;  1DJR D;  3F2U A;  3NPP A;  2L0C A;  3TBI B;  4LMQ D;  2A6H C;  3M7G A;  4Z9C B;  2XSC A;  3HOU B;  2VB3 X;  1GUO A;  1WTX A;  3C1E A;  1AZP A;  4RWS C;  5HUR A;  3AMU A;  2F0Q A;  1EWH A;  5D3D A;  4IFD I;  1V8Q A;  3S1Q B;  2Z4H A;  2G9H D;  4G7Z C;  1HTL D;  3N6R A;  3W2D A;  1BBX C;  2M00 A;  1STY A;  4F7X A;  5KGU A;  4QMG A;  3TDQ A;  5D3I B;  5TSS A;  2NB0 A;  2JA6 B;  4FP5 D;  2PW7 A;  5A35 A;  4X3K A;  2CQA A;  2JE6 I;  3A54 A;  1CHP D;  1XTC D;  2L1B A;  4ZAI A;  1ROD A;  4C3H B;  5IGE A;  5EBD A;  1WD0 A;  3NQT A;  3VR5 A;  1OXT A;  3DEO A;  3PMF A;  4CHT B;  2IX0 A;  4R8N A;  1EWC A;  2CW0 D;  4RCN A;  2IT1 A;  1CTM A;  2R6G A;  2BA0 A;  5EQ0 A;  4TSS A;  2PZW A;  1STG A;  1STE A;  5ISR A;  3QIA A;  3KLS X;  4OHJ A;  1JB3 A;  4QCL A;  1GUW A;  1U4R A;  3TME A;  3OPO A;  3MFY A;  4RAU C;  1EU4 A;  1J9O A;  5JEA J;  5CBE E;  1TU2 B;  4IFD G;  5EPL A;  3PIP 3;  3VR2 A;  2B2W C;  5CC4 A;  3PUY A;  1G8Z D;  5JEA H;  1KTK A;  3Q23 A;  4WRD A;  3TZU A;  3RD4 A;  2JA7 B;  1I3Q B;  4IUR A;  4HMI A;  1HA6 A;  1Q1B A;  3HZX A;  1JOR A;  3J81 E;  2A6E C;  2PCF B;  3U9S A;  1A3T A;  2K5Q A;  3J81 L;  1RD9 D;  4CJ2 C;  3NQI A;  4RA8 A;  3EJI A;  2AQ1 B;  1S5C D;  1PMR A;  2NBF A;  1EY9 A;  1DOL A;  4ABN A;  2MPM A;  3I4M B;  1ENF A;  4WFN 3;  2BCO A;  4OIJ A;  4PMB A;  4JBW A;  4CJ1 B;  4DF7 A;  3MTS A;  3MXU A;  3GTJ B;  3J7Y W;  4CGY B;  3ND9 A;  1H9S A;  1VMC A;  2F0N A;  3C2P A;  1F2M A;  3NK9 A;  3NTK A;  1VF7 A;  5E1F A;  3GTO B;  1JOK A;  3TSS A;  1ET6 A;  3QOJ A;  1EQV A;  2HUG A;  1F9P A;  5A2Q L;  1ET9 A;  4OO1 I;  1JC7 A;  1QCB D;  5CR3 A;  3K0Y A;  3D8G A;  4KN4 C;  5K5P A;  1KNE A;  2MJ8 A;  2WAQ B;  1QNU A;  3MFG A;  1BCP C;  2D62 A;  4MHE A;  1CI3 M;  1UAP A;  2B2W A;  2OT2 A;  2GA4 B;  1OXS C;  1K8M A;  2DNE A;  1BDO A;  2E2I B;  2L55 A;  3KF8 A;  1QJO A;  5E4X A;  1PLF A;  1GXD C;  4DU9 A;  1GJX A;  3OOC A;  4XYO A;  4RGN A;  5ELC A;  3NBI A;  1FD7 D;  4HN7 A;  1OXU A;  1E2Z A;  2LKV A;  4L63 B;  1C4Q A;  2MHV A;  3OMC A;  1GUN A;  4ZYS A;  3GV6 A;  3VA5 A;  3JAM L;  2OXP A;  2EYH A;  2KHS A;  3VYS A;  1TWC B;  1TR5 A;  2A74 C;  4ZLT F;  2ZXR A;  1EZ8 A;  3ITP A;  4OO1 G;  1I6H B;  2EYM A;  2K5D A;  2B2U C;  2K03 A;  2HDM A;  4NW2 A;  4XQQ A;  1PFB A;  1CHQ D;  4BBR B;  3OWF A;  4DAV A;  2A69 D;  3VR3 A;  2LMC B;  2OEO A;  4KD4 A;  5KNC A;  3QOL A;  1W6J A;  5CMD A;  3P7J A;  3GTK B;  1SMY D;  1SJH D;  3G7L A;  1SBB B;  1HQR D;  1GHK A;  2K6A A;  2ICI A;  3W3A A;  1KDA A;  1SNM A;  1HA5 A;  2ENB A;  4KY5 A;  4PMC A;  1B9N A;  4WOR A;  1U4P A;  2KQ3 A;  2PZT A;  1IW7 D;  1G6Z A;  2AUK A;  1SND A;  4L8J A;  1HTP A;  3ZYY X;  1LTI D;  1H9K A;  1A15 A;  2MGS A;  3HOZ B;  2ID0 A;  5KND A;  1BO0 A;  2F0I A;  1S5E D;  1EU3 A;  3Q6S A;  1QOH A;  1TS4 A;  1C8C A;  3FKI B;  2NN6 I;  1UNS A;  3KLS A;  2F0L A;  5FK9 C;  3Q22 A;  2OF1 A;  5JJZ A;  3HOX B;  3D6C A;  2K01 A;  1MSG A;  1S5D D;  4QF4 A;  5I2X A;  2FHT A;  3X3M A;  2J0T D;  4K8I A;  1NUC A;  1B9M A;  3H0G B;  4RKL A;  3RUZ A;  3D3R A;  1F9R A;  4PV1 C;  5I6Y A;  1WD1 A;  3I4L A;  2PO4 A;  2TMP A;  1DOK A;  2F0H A;  5C0X G;  4QIW B;  3NHH A;  3AB9 A;  3ONA B;  1PTO B;  3U9O A;  1CFM A;  1RCV D;  2B2U A;  4IUN A;  1K8O A;  4ME5 A;  2EJM A;  1A2T A;  2YU9 B;  5CV4 A;  1EY4 A;  4G7O C;  2N88 A;  1JQY D;  4CBV A;  1D1K A;  3WOE A;  3MXP A;  1Q90 A;  2XIW A;  2ZXP A;  4HSV A;  1CQV A;  3R8B A;  1KAB A;  2X69 A;  3OWE B;  2Z8L A;  1S5F D;  5FO8 B;  1TWH B;  2FFK B;  2VB2 X;  4ILW A;  5G3L F;  3NTH A;  3RZO B;  1B2T A;  1EYD A;  3GQB A;  5T1I A;  5K36 H;  3TZD A;  2WKC A;  1BOS A;  1HRJ A;  2QEJ C;  1MD2 D;  2CW0 C;  2F0T A;  3A8J E;  4ZRZ A;  2L12 A;  3HOV B;  4J6H A;  1GUT A;  3VYT A;  1XX8 A;  1XWE A;  1D5X C;  1MSH A;  4DAY A;  1JWM D;  2PW5 A;  4OIK A;  1TS3 A;  3R3O A;  4MN3 A;  1AN8 A;  3HRZ C;  4FXG C;  2VNU D;  1D2B A;  3NBH A;  1G2T A;  3M3Y B;  3GTL B;  4QUF A;  3S17 B;  2ICE C;  1SDF A;  1CA6 A;  4K5W A;  3MZ5 A;  2A5H A;  1NCV A;  2KCC A;  4Q0F A;  2NTS A;  3A7L A;  2CVR A;  3PO3 B;  1JOO A;  4NDX A;  2RKS A;  1PTO F;  3K7A B;  1GUG A;  1VDZ A;  2O4X A;  4I7Z C;  1Y69 U;  5C6A A;  1Q8I A;  3G6J B;  2E75 C;  3DEP A;  3S1N B;  2EY6 A;  3I8Z A;  5KYL A;  1L0Y B;  3GTG B;  1I4H A;  3J7A V;  4UDU C;  1T5E A;  1ESR A;  3BYT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...