5CC4A

Crystal structure of staphylococcal nuclease variant delta+phs t62e/v66e at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFEKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62E/V66E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cc4A00
2QDBA 2RBMA 2EYMA 3MEHA 4NKLA 1ENCA 3SK5A 2F0IA 4N9TA 5CV6A 4EQOA 3DMUA 3ITPA 3SK4A 5IGBA 4G57A 3D4DA 4PMBA 2EYLA 2EXZA 4F8MA 1JOKA 3DHQA 2PQEA 2PYKA 4DGZA 1SYCA 1SNDA 1STNA 5IGEA 2SOBA 5JOBA 3OWFA 3U9OA 1EY9A 1STBA 4KD3A 2F0QA 2PW7A 4ODGA 1STHA 4I65A 3T16A 4N9PA 4B9WA 1JORA 1IHZA 5CV5A 2F3WA 1EY7A 1U9RA 3QOLA 5EKKA 2M00A 4ZUIA 3HZXA 5HURA 4KY5A 2EY2A 1II3A 4QMGA 5C5LA 4KD4A 2SNMA 4NDXA 2F0NA 1TQOA 5F2DA 1TT2A 4ME5A 5IOCA 1TR5A 5CGKA 1STGA 4K2LA 3EJIA 2OXPA 4LAAA 4H7BA 5IGFA 5IODA 1EQVA 2F3VA 3OMCA 3LX0A 2EYOA 4HMJA 2F0OA 2PZTA 4RKBA 1SYFA 2F0SA 2F0LA 3SK8A 3V2TA 5KGUA 5KYIA 1SNPA 1A3VA 3NK9A 5J22A 5CV7A 1EY6A 1SYDA 4K5XA 1EZ8A 2F0MA 2F0GA 3MVVA 4R8NA 3TP8A 5KEEA 5M9OA 3D6CA 2SNSA 3S9WA 1KDBA 1SNOA 2F0WA 3MXPA 3OSOA 1JOOA 4J1MA 4J6HA 5IIFA 3SR1A 5I9OA 3BDLA 5HGTA 5K5PA 2RKSA 5J39A 3NP8A 2PW5A 4PMCA 2KQ3A 1SYGA 2WACA 5C4HA 4MIUA 4EQNA 5EKLA 5KIXA 2OF1A 4WRDA 3C1FA 1EY5A 2OEOA 4K8IA 4KY7A 5ISRA 1RKNA 3SHLA 4OL7A 1F2MA 4YIJA 1F2ZA 4NMZA 4B9XA 1KAAA 2F0DA 3NHHA 4K2KA 1NUCA 2PZWA 3PMFA 1EZ6A 1AEXA 5IGGA 3TP5A 1EYDA 1NSNS 1JOQA 1EYAA 3D4WA 3H6MA 4DFAA 3TMEA 2EYPA 5E1FA 3NQTA 5DEHA 2EY5A 3T13A 4KY6A 1A3TA 1EY4A 3NUCA 4KHVA 2EYFA 3OMGA 1KDCA 2F0FA 5I6WA 1F2YA 3E5SA 5IGDA 5KRUA 5I6YA 2F0VA 4HMIA 4S3SA 1A2UA 2F0PA 5CV9A 5C3WA 1SNQA 3SXHA 1SNCA 3P75A 4IZ8A 4DF7A 4K14A 3QOJA 1A2TA 4K6DA 5C4ZA 3R3OA 3C1EA 4EVOA 2F0KA 4KTAA 3QB3A 5KYLA 2EY1A 3D8GA 5CR3A 5CV4A 2LKVA 4K5WA 1EY0A 4IALA 5C6AA 2F0HA 3EROA 3TP7A 5C3XA 3HEJA 4ZQ3A 5CV8A 5I9PA 4NP5A 3RUZA 3VA5A 1ENAA 2EYHA 2EY6A 3P1HA 4DU9A 2HQEA 4EQPA 1EY8A 4F7XA 2EYJA 3ERQA 1STYA 4KV6A 5C5MA 3MHBA 2KHSA 3NXWA 4ZUJA 1SYBA 4QF4A 4E6IA 3EVQA 1KABA 3MZ5A 5DAUA 2RDFA 3SK6A 2F0EA 2O4XA 1SYEA 2F0UA 5E3FA 1STAA 4HTHA 2PZUA 2ENBA 4IUNA 1A3UA 4WORA 2NUCA 4K5VA 5EGTA 3TP6A 4KJOA 1SNMA 5CC4A 4KJNA 5J1ZA 3BDCA 4ID6A 4TRDA 5JAVA 5NUCA 4PNYA 1EYCA 4QB4A 1KDAA 4RKLA 2F0TA 5IGCA 2F0JA 4K8JA
chains in the Genus database with same CATH superfamily
1FL0A 3OTOL 1IZ6A 1YNXA 2L9HA 1X32A 1FD7D 1CI3M 1QE6A 2KHIA 3JAMi 1D5XC 4G7OC 4BY1B 3T1YQ 3L2PA 1B70B 4ZK9B 3VYRA 3I70A 1LO5D 4XQQA 2B63B 3T16A 4XQNA 2N49A 4X62L 3TN2A 4QY7A 2PO4A 3K6OA 1PVOA 3RZOB 2K33A 4ZUIA 5FLXc 2DUDA 2E8GA 3G71A 3O13A 4NDXA 4X66L 4ALPA 3S1MH 4DR5L 4UAIA 3CMEA 4KN4C 3HOUG 1Q3LA 3EJIA 4HJAA 1GHKA 3S2DH 1YNNC 2C5CA 3HRZC 4HMJA 3OTOQ 4RKBA 5KYIA 4TSSA 1HA6A 1SNPA 4A3FG 3LGJA 1FNWA 2F0MA 1F9RA 1K83H 4FF3A 4BBRG 4B3MQ 3Q23A 4K0KL 1LTLA 5E4XA 1BCPB 1PZJD 5E4WC 1RHPA 1SJHD 1Q81C 4QIWB 1E0BA 1HNWQ 4MIUA 2CH4W 3HOZG 1YNND 4KY7A 2I0QA 4X66Q 3VR6A 4DR5Q 1KAAA 1VS0A 2ATWA 3L3OC 1M1KC 3TS2A 1EYDA 1EYAA 1TY0A 1JT8A 1G51A 4A3MG 5EBDA 3K5MA 2PI2A 1XXGA 1VQDA 1TWFH 4K0KQ 2JA7B 2C35B 5FLXL 1NR2A 4DUYL 3QOJA 4CKBA 4K6DA 3NBIA 3HGBA 2M2LA 4HJ9A 2C9OA 1CSPA 3K8AA 4ULLA 2CCZA 3FPUB 5EAYA 1V1PA 2MP1A 2XNAC 2RSNA 1JJGA 1WTHA 1I5FA 3VA5A 4CDDC 3F8TA 3ONAB 2HQEA 1XPRA 3S16B 3W5OA 2BA1A 1E3PA 3H09A 3KUPA 5AJ3L 1XPOA 3EVQA 4HJ5A 3M7NA 4M1UB 4KJOA 3T1HL 2XRSD 1S3OA 5C3EB 2B2TA 2R6GA 4JI5L 3BZKA 1PV4A 4DV6L 3PO2G 2VZAA 4NKLA 3SK5A 3PSIA 1IL2A 1PH2A 1YJWA 2EYLA 3E0JA 4IUUA 2PPBC 3FHWA 2PYKA 3HOWG 1PHJA 2Z1CA 3U9OA 1STBA 1A63A 3A7LA 3H94A 4I65A 1RIPA 1EU3A 2R3ZA 2L0CA 3PO3H 4KY5A 3OIQA 5C5LA 2F0NA 2MPMA 3BYYB 4JCVE 3T1HQ 4IFDG 2R93G 4C3HH 4DV6Q 3GTPH 2F1MA 4L5QA 5LL6X 3S1QH 1VQEA 5GADC 1NMFA 3TP8A 1TS4A 4K5XA 4N8FA 3J7YW 4IOCA 4C1NK 2L15A 3S1RB 1WTOA 1RD9D 1KDBA 3OSOA 3J81j 3I4NH 2XTIA 4EQ5A 5HGTA 3FDTA 5K5PA 1VCIA 1XTDA 5J39A 3C2PA 4A3EH 5A2QL 1SYGA 1L2FA 5EKLA 3AQQA 1VMCA 4H0LC 2A6HC 1CA5A 4LF5L 3HOVB 2HIXA 1Y8OB 2JK8A 2B8GA 3I2ZA 4O0AA 3C46A 2JA5B 5JEAG 1PH8A 4LUVA 2IW3A 3TQYA 2L12A 2WFWA 3A5UA 3B6YA 1HTPA 2J0TD 5JVG3 2K5HA 2QILA 5JJZA 1LM0A 1K8AC 2CW0D 1XNRL 1S5ED 1A2TA 1V43A 1KNEA 3M4YA 2OT2A 4BY1G 1KC8C 2NVXB 5D14A 4LF5Q 3TP7A 2B63G 3A8KE 2E2HH 2B2VC 2B2UA 4DAYB 1ENAA 2EYHA 4JPBW 4P75A 3CQZB 1NJIC 1EIGA 3K7AB 2SEBD 1VQNA 1I4HA 2CWPA 3NXWA 4TVAB 1V8QA 5DAUA 5FJ8H 1A0IA 2F0UA 1BDOA 5D65A 2VQFQ 3TZUA 2NVTH 2WV6D 1F2LA 1L0YB 2L4NA 3D6WA 2H4OA 1KQSA 2V1CC 2I5MX 5JJKA 1JOKA 3J80L 4DGZA 3R2TA 1STNA 3GTMH 2XRQD 5DM73 3A56A 4LFCL 4YHHL 1LT6D 4MNOA 2PW7A 1PRTF 4A3DB 2X69A 2QA4A 3PF4A 4I7ZC 4KI0A 5IYDH 3TEHB 4PZ8A 4ME5A 2VUMH 3ICEA 1EOVA 2K14A 4LAAA 3NBHB 2HD3A 4FF2A 1E2ZA 1Y8PB 5IP7H 4PV1C 2JA7G 1SYFA 3GTJB 3CCQA 3A55A 4FYDA 3VA7A 1B50A 3ND8A 1MSGA 3M4QA 3W1BA 4YHHQ 4LFCQ 1SSOA 3NP8A 4C3IH 4HR7B 3EIVA 4YCVA 2WACA 2B29A 4EQNA 1EY5A 5A35A 4K8IA 2KCNA 2HDLA 1KIXA 2L1BA 1EQQA 1B3QA 1OXVA 1XNQQ 2PZWA 3M4OH 4PG3A 4XXEA 3E9IA 4DKAC 4DFAA 3PIP3 4HJ7A 4KY6A 3VR5A 5C3EG 1Q90A 3AU7A 3OMGA 4RGTA 2ES2A 2A68D 2UU9L 2Z6KC 1ET6A 1CFMA 1A2UA 4DF7A 1J9OA 1Q8IA 3R3OA 2E2JH 2V4DA 3QB3A 4X64L 2EY1A 3KYHC 3NWTA 5M3MB 2UUCL 4JOIC 2EJFC 2HDMA 1SN8A 1ZKOA 1K8MA 1X3QA 1W6KA 2B2VA 2E75C 4CJ0B 3H0GB 2KHSA 4GLVB 3UDIA 1VQHA 2ZM6L 3ULJA 1UAPA 3I7FA 5G3LD 4C2MB 5E3FA 2RHQB 4IPGA 2UXBL 2NN6H 1E1TA 3UE0A 3NTHA 1H9SB 4ID6A 5JAVA 3EQLC 2GVBA 3T51B 2NN6I 3GTOH 1C48A 1AP0A 4L5RC 3S14H 3HOXB 3AMUA 2VS1A 1QUQA 2Z4IA 2K5VA 2H5XA 2UUCQ 1LTAD 1NR4A 3S1NH 1HHVA 1JB7A 2SOBA 3STBC 1H9KA 3OOCA 2UUAL 3BZCA 1HFNA 5C4XB 3I4OA 1LT4D 2HCIA 4ODGA 4TKOB 3T56B 1YNJD 3WDNA 2JA5G 2CKZB 1CT1D 2JEAI 2A5HA 2UXCL 2UXBQ 1II3A 3CRLC 4RFBA 1EWIA 3U50C 3M7GA 1EEFD 4OELB 2ZT9C 2F3IA 2Z6BA 1NY4A 3M3YH 1DGSA 5K36H 4AQYQ 2F0SA 4RAUC 1QCBD 4K6LA 3PV0A 1X54A 4BXXG 1VQGA 2N88A 1ILPA 3D6CA 1FJGQ 2UUAQ 3SEBA 1EFWA 4LFAL 3OPOA 2RDHA 4R1JA 1KRSA 1QOHA 2XVSA 1BNZA 2UXCQ 1HQMC 2OF1A 4DK1A 5BN4A 2HCCA 2BE5C 2G9HD 3S17H 1JWMD 1A6XA 4NMZA 5DNFA 4FXGC 2MUYA 1SFOH 1KXLA 1LABA 2K5QA 1KTKA 1HNXQ 1HTLD 5IT9c 3H6MA 1EIYB 2A69C 4OWWB 4A3BH 3UE1A 4XDXA 3PUYA 3GTKH 1A3TA 2XWBB 4JW0A 5I6YA 1JB3A 1C8CA 2DNCA 2BE5D 2Z6KA 1SEBD 4LFAQ 2RCFA 3NELA 2IPKD 4A3LG 4L5SA 2R92H 4IALA 3A5ZB 1I6HB 2A69D 2OTLA 1G291 2BH2A 1EU4A 4A3DG 1U5KA 4NP5A 4JOIA 4ME3A 4EGVA 2A73B 2JEBI 4GOPC 3GTLB 1KABA 3SK6A 3CCLA 1CK1A 1MBYA 5IP9G 2PNHA 3GD7A 1N8RC 3TP6A 5CC4A 1C7YA 1AE2A 4TRDA 4IUQA 4BBRB 1WCMH 1PFSA 3CW2C 1PFMA 3ULPA 1O7LA 2VB3X 2PI2E 1X3EA 4C1NI 4KKTA 5JJIA 4X3KA 5IT9L 3HOYH 2OQ0A 1VQCA 4A4IA 1IBKL 1PYBA 1SLJA 4JBJA 1JMCA 1IYVA 2NVQB 1DD2A 2JSOA 1DJRD 3M9BA 5EKKA 1PA6A 5L37A 1K0RA 2R7ZG 3Q8DA 5HURA 1SE4A 4BWGB 4HEDA 1HZAA 1Y1VB 1MI2A 1TQOA 1GVPA 1QVFA 2WB1E 3KOJA 1TR5A 1MKHA 4IPHA 2K28A 4BY7H 1XX8A 2M9VA 2EYOA 3NQIA 3DWAA 1CHPD 1HFGA 1A62A 4F87A 1UEAB 1EUJA 4LF6L 1IBKQ 2GN5A 2DN8A 5C0XH 1Q46A 2QKIC 4A93H 2Z4HA 1PRTB 1IKLA 1XTCD 2IJ0A 5C0XI 2PW5A 5M3MG 2K4KA 3H0GG 2OEOA 1X55A 3HOUH 5ISRA 4BBSG 3GTGB 4OL7A 1HR0W 3S15H 4JV5L 1NUCA 1VDZA 3GV6A 2A6EC 2EJMA 2AWOA 1XYIA 1AH9A 1QVCA 1ONLA 2A19A 4A76A 1TS5A 4KHVA 3PO2B 4LF6Q 1XPUA 3CXCA 1ASZA 5TSSA 2JA8H 3HOXG 1OXSC 3A7AB 1H95A 3U4VA 2JA6B 3HOWB 3PGZA 5KNDA 4JI6L 4V0BA 3VR2A 1YJNA 3EN2A 1V1PB 2BOSA 3RLFA 5C4XG 3NWSA 3E6ZX 4UP7A 3QWNA 4JV5Q 4Y7NH 2WB1B 1VQKA 3DM1A 1KLUD 5ELNA 1G6ZA 2EVBA 1ASYA 3RN5A 1A15A 1EIHA 4Q5VA 1IBLL 1PTOF 1VQ4A 2Q2UA 2L11A 4GOPA 1Q86C 2R93B 3K0YA 1UE5A 4GS3A 1I3QH 2N8NA 3KJOA 1TWGH 1Q1BA 2NUCA 1C4QA 1B4OA 4JI6Q 1TVXA 3EBEA 3G6JB 1VF7A 2NWGA 2XWJB 3MWYW 4A3GG 2X6GA 1ZYRD 2WIIB 4DAMA 1HA5A 5IYCH 3S1MB 3H91A 2VL6A 3CCJA 1EY9A 1IBLQ 3S2DB 4JC0A 2K52A 1L0WA 1PFBA 3J7ZC 1RJTA 1K83B 1MD2D 4KD4A 4KHZA 1E24A 2EXDA 1NTGA 5CGKA 1HR0Q 3KFUA 2KCMA 4G7ZC 3NTKA 2K05A 1GUWA 2AHOB 1GUOA 2RDGA 5CBAE 1EZ8A 4B3ML 1FGBD 2B3GA 5IIFA 1JOOA 3J7AV 1SDFA 1ET9A 1F9PA 2O5IC 1HNWL 3MC0B 4AIMA 4H13C 3WOEA 4O1NA 2L5TA 3KJPA 1RKNA 2ICIA 1TWFB 4QQBX 2KJXA 3IRBA 3D4RA 4G7HC 1G2SA 4DUZL 3MXGA 2EYPA 4H02A 2RHSB 5DEHA 1V1OA 4YY3L 3Q22A 2EYFA 1DOLA 4JI4Q 5IGDA 1IYJB 3MA2B 4OONA 1SNCA 3GP7A 5C4ZA 2KA7A 4KTAA 4RGMA 1YIJA 5FOBB 2YU9H 2LKVA 1D2BA 1UUPA 1HH2P 3HEJA 1D5ZC 4A3IH 1FVIA 4ZKBB 4DUZQ 4DU9A 4TQUS 1QVGA 1Y1VG 3Q6SA 4YY3Q 4FP5D 1DONA 1LTSD 4L63B 3I90A 2KCTA 1LV9A 4PQXA 1WI5A 4K5VA 5NUCA 1TWHH 3TREA 5IGCA 4RH6A 3DUZA 2B2UC 1GXDC 3PO3B 3K80C 1L1OB 3RZOH 3KDFA 2EXZA 2IX3A 2VQEL 2E2IH 4DR6L 2SDFA 3NE5B 2RSOA 4XQJA 4JBWA 3URYA 4C3HB 3RZDH 3GTPB 1KRTA 4QGUA 3K59A 1Y1WB 3S1QB 2BDOA 1RDPD 2M00A 2HT1A 2CQAA 1N32L 4H44C 1SE8A 2WAQE 4QMGA 4CJ1B 4GKJQ 3LWUA 3DEOA 4G4KA 3PUWA 1CQVA 5IGFA 1B1ZA 1LTID 2E74C 2F0OA 3KLSA 5KNCA 1VQLA 1GD7A 3OIPA 1FNUA 3FKIG 1BCPD 4Z9CB 2R7FA 3MAQA 3RN2A 3D0FA 2VQEQ 2JA6G 4DR6Q 3JAME 1YJ9A 1HUMA 2LXJA 3MXPA 2Q8TA 4DAVA 4J6HA 5M3FH 4GN5A 2RKSA 3A54A 2KQ3A 2WB1G 1YEZA 4IJHA 1PH9A 1N32Q 2CQOA 2XSCA 5LMNW 2Z8LA 3JC66 3TSSA 2KENA 4YIJA 1JR0D 4A3KH 1WYDA 1EZ6A 1N34L 2O5JC 5E1FA 1SR3A 2EY5A 1PDQA 4DR7L 4DA2A 1EIFA 1V9PA 5ELBA 2E2HB 4HMIA 3CHBD 1EQRA 1MGSA 1RTOA 1J5EL 3I3CA 1P16A 1PH3A 3CPFA 3J7AF 3RNUA 2ZJPA 4OEMB 2CW0C 2WAQB 3EROA 2A8VA 3MFYA 5IYBH 1X3PA 4DN4M 3BVMA 2EE1A 1K3RA 4J15A 4Y52H 4OHJA 3J80c 1N34Q 4IQZA 3MXNB 2UXDL 3FMCA 1A8VA 4DR7Q 3GQBA 1SBBB 1ZXTA 2H1EA 5FLXE 2OTJA 2PZUA 4FF1A 2ENBA 4XT1B 1PYSB 2VQFL 5LMNL 4NXML 1J5EQ 4PNYA 2VB2X 2RF4A 1KDAA 4RKLA 2NVYH 3BU2A 1K3BC 1SMYD 4UY8C 1I4RA 5CV6A 1ML0D 3ERSX 3L7ZC 3SK4A 4PMBA 2RVLA 1WD1A 4HSVA 3DHQA 3F2BA 2VUMB 1PTOB 4BS9A 5C4JH 4YWKA 2UXDQ 5M5YB 3DXJC 3HKSA 1CM9A 1SXTA 1U9RA 3FVQA 3QOLA 4UP9A 4LF7L 3BYTB 4JK1C 3L9AX 3BG3A 5ELFA 1NMGA 5LMNQ 4NXMQ 4R4IA 4B3RL 2OXPA 4H7BA 2JA9A 4KMUC 4C3IB 3J80i 1B44D 1E2VA 2F0LA 1J6QA 1O7ZA 1EY6A 2F0GA 1WTQA 2EZVA 2VXWA 3HOVH 3M4OB 1S5BD 3ZJYC 1MJCA 3CRKC 1HNZQ 4NXNQ 4LF7Q 3R8BA 4R4QA 2YYZA 5C44H 3CC4A 2JP1A 1NBWA 4X3SA 2KEDA 1QILA 1XNQL 2YTYA 4LJZC 4B3RQ 4YCUA 2VY3A 1N36L 5IGGA 2E2JB 4BA2I 1T5XD 1STEA 3CCSA 1K9MC 3TMEA 1SE2A 1ESRA 1U4LA 3D3RA 3J81c 2NVXH 4S3SA 4KK7A 5A2QE 3PO3G 1NNXA 3C1EA 1NAPA 4IUTA 2A68C 4B3TL 5CV4A 5GROA 3IL8A 4C3HG 3KBXA 3OHXC 1Y1WG 4DK6C 2R7ZB 1P8LA 1N36Q 1JWUD 3AB9A 1IW7D 1Q82C 3P7JA 4DV0L 3K81C 3GTOB 3QO2A 3K5LA 2HUGA 1SYBA 3S14B 3SGIA 3I4NG 1EQTA 4X3UA 2F0EA 4EX5A 3NSWA 1SYEA 3MFGA 1XMQL 4ILWA 4N8X1 4HTHA 4RGOS 4A3EG 4IUNA 3GO5A 3PIO3 4FVMA 1EWCA 4B3TQ 1X6OA 1PXUA 2RBMA 3DLLA 3IFTA 3BS1A 1H9JA 3W1GA 1SNDA 3SDZA 1HZCA 2E5LL 3PF5A 2X6LA 1I4GA 4BBSB 4DV0Q 3J81L 4IOAA 4B9WA 4DV7L 2MGSA 4N9PA 1IHZA 1GKHA 5KNBA 1XMQQ 2EY2A 4DV5L 3I4MH 2K04A 1PH5A 1O78A 1YNJC 1JE5A 1S5DD 1VMPA 4CDFC 5C0XJ 1TT2A 1QWYA 4OO1H 2G9DA 4AQYL 1R4PB 4OO1I 1TIID 4I7AA 1A3VA 3S17B 4R8NA 2FJ2A 1FJGL 1DYQA 2E5LQ 5FJ8G 1TY2A 3CCUA 2WAQG 3ULLA 2Q2IA 2PQAA 3VR3A 5ELDA 4DV7Q 2ZJRA 1FGUA 3WOFA 1KL9A 5KIXA 4WRDA 4DV5Q 3FPPA 3K5OA 3MEFA 1RL2A 4QL5A 3SHLA 3DM3A 3G6EA 4C3JH 1TWCB 1GJXA 5EKIA 2JYOA 1HNXL 4POFA 2QCPX 1JOQA 3BDOA 4CJ2C 3CD6A 3GTQH 2J7ZA 2JQOA 3RLOA 2R92B 2DNEA 2D5DA 2PMZE 2LXKA 4IJLA 1F2YA 4A3GB 5M5WB 4PZ6A 3IAYA 5M3MH 2IT1A 4IZ8A 2K32A 2K7VA 2R61A 3U58A 1HUNA 1M90C 1MJEA 2F0KA 5KYLA 2VUMG 2J4XA 2F0HA 3FP9A 4C2MH 2E2DC 5IP7G 1I94L 4A3CH 3BZDB 1OXTA 2EY6A 3P1HA 3H15A 1EY8A 4DXFA 2EYJA 3ERQA 2WKCA 4GOPB 3KF6A 4AH6A 3LNNA 3VYSA 3HOYB 3EA6A 4C3IG 1DOKA 3TS0A 1ESFA 1S72A 2WP8J 1EFID 1EL0A 1HZ9A 4LMQD 4IO9A 2CH4A 3MEHA 1VQIA 3VR4A 3NTIA 1N9WA 2F0IA 4LFBL 2BA0A 1M8AA 5IGBA 4A3JH 3D4DA 1I94Q 4ZAIA 1SYCA 3CCEA 3OW2A 5IGEA 4FDBA 2B2WC 4CKEA 4BY7B 3G7LA 3F2CA 1STHA 1DOMA 1EY7A 5I2XA 4KKUA 3VYTA 5FLMH 3UI2A 2ASBA 4MN3A 4DV1L 4A93B 3KF8A 5IOCA 3KK7A 1BBXC 4X3TA 2EDGA 5ELCA 5IODA 3OMCA 2NB0A 1YHQA 4LFBQ 3SK8A 1WTRA 5T1IA 1U4MA 1BOSA 1GOZA 3E0EA 5GQOA 5M5XH 1K8GA 1OXXK 1SRUA 1QB5D 2SNSA 3S9WA 1QZHA 4J1MA 2XGTA 3PIPA 3CC2A 1PLFA 4PMCA 2NN6G 1YHBA 2I5LX 1PZKD 4UHVA 4IPCA 5GAEC 1G2TA 2CFMA 3M85A 4DV1Q 2AUKA 1GO3E 2F0DA 2AQ2B 4K2KA 2MJ8A 4GN3B 1IKMA 2KUMA 3KBGA 1NE3A 1CA6A 3NUCA 3W3AA 4Y7NB 1SNQA 4K14A 1I50H 2LFNA 1CKNA 1W2BA 1QNUA 4JI7L 1Y14B 2Y0SE 3RLNA 1EY0A 4XT3B 4MZ9A 1TWGB 2ZTEA 4ZQ3A 1JQYD 4B3SL 5K36G 2AWNA 2GVAA 1GM5A 1WTWA 2JXMB 4HIDA 4A3FH 4HSPA 2A1AA 4R8IA 4OXPA 4KV6A 4RMFA 2K50A 4BBRH 4ZUJA 1CZGA 1TWAH 2I07B 4JYAL 2IX0A 5I2YA 1GHJA 1VQBA 5EQ0A 2MFIA 3FKIB 1VF5C 2ZTCA 5EGTA 4KJNA 5J1ZA 3BDCA 3HOZH 5EPLA 1DCZA 1GUTA 3PQIA 2Q2TA 2NBFA 3KLWA 4DR1Q 3BVZA 4JI7Q 1UNSA 1LTBD 3CPWA 4GLXA 3HKZE 2KOLA 2ZXPA 1RCVD 1YITA 5FO7B 3QIAA 4OWTB 4B3SQ 5DLQE 4JG2A 1B53A 4A3MH 1ZYRC 3T4AC 1PRTC 4AYBE 4DK3C 2B2WA 4GLAC 1XJVA 3V05A 4JYAQ 1UEBA 3AFQA 3HZXA 1KLGD 2MO0A 2DGYA 4NB3A 3ER0A 3S2HH 1CSQA 4JI3Q 1HR0L 3OYYA 5LHY1 2R92G 5IY0A 4GKKL 2F3VA 1JJCB 2BH8A 1WTVA 5IT9E 4HCEA 4R4OA 2MHVA 3P20A 4JBKA 1S5CD 2Y0SB 1PRTD 4APVA 4B08A 3I73A 3M4PA 3L0OA 1VQPA 3K58A 1U4PA 4FO2A 4RCOA 1AN8A 2O2LD 2LMCB 1MIUA 2ZTDA 1D1KA 5I9OA 1Z7TA 1JJ2A 1K73C 2F03A 2NTTA 1JC7A 4UPAA 4CBVA 2EQSA 1O80A 1BQQT 1SAPA 1WCMG 1VQ8A 1SROA 3PO2H 3RD4A 3NHHA 4GKKQ 3KLSX 3U4ZA 4GNXC 1R9TH 3HOYG 1LT3D 2D62A 4OX9L 3HOWH 3NQTA 1YZ6A 4DV2Q 3HKZB 4QIWE 1S40A 5IWAL 5I6WA 4JI4L 4A3IB 1ILQA 2BCOA 1F77A 3R2IA 5C3WA 3SXHA 1WJJA 4AYBB 4JI0Q 4L5TA 5G3LF 5FO9B 1EOTA 5CR3A 4IFDH 4BY7G 2R93H 4JI1L 5C3XA 5DM63 2LS01 4YWLA 4IFDI 4OGQC 4HJ8A 4EQPA 1TWHB 2HQLA 3JAML 5C0XG 4OX9Q 4X65L 4A93G 2JJQA 1UE6A 3MZ5A 5IWAQ 2PCFB 4QCLA 3G48A 2E2IB 3V96A 3ZYYX 1A3UA 1SNMA 3RZDB 4ZCKA 1K28A 4DV3L 3H3VC 3R93A 2OCEA 1E22A 1ENCA 3GDEA 4JI1Q 2Z9HA 3DMUA 5ELOA 3ITPA 4EQOA 5JEAH 4WFN3 4L8JA 1CKOA 4BA1I 1Z9FA 5IE8A 1LYLA 5LMUL 2CWAA 2NZHA 4X65Q 4X62Q 2JA8G 3H3VH 1K8OA 1HPCA 1F9QA 4R9WA 1B9MA 4GKJL 1LTRD 3PUZA 5I4DA 3H3VI 2YTXA 4A75A 5F2DA 3U9SA 1G91A 5M3FB 1STGA 4BY1H 1V1QA 2K6AA 1SMXA 4DV3Q 3LX0A 2B63H 1PH6A 2PZTA 3KLRA 4RHRA 5H1SE 3NK9A 5EBCA 5JJLA 3MVVA 1CUKA 3S24A 3ND9A 4A3KB 5BN5A 1TKWB 5LMUQ 1BCPC 4JI8L 2UUBL 4QJFA 1EEID 2NZOA 3W2DA 3CCRA 1CQFA 2ALYB 3MTSA 3CF5A 3DEPA 2FMMA 3I4NB 1F2ZA 4IN3A 1CHQD 1J8IA 4LK1C 2MQHA 3PMFA 4CHTB 4A3EB 2B39A 5IYCG 1DXMA 1NSNS 4GNXA 1AE3A 1HRJA 3N6RA 3Q24A 2K5WA 3E5SA 2ZXRA 5J3BA 3TDQA 4JI8Q 4DUYQ 3CCMA 2UUBQ 2ICEC 1BF4A 1B3AA 4FXDA 1X9NA 4KN7C 4IPDA 1L1OC 3IFDA 2JA7H 1IYUA 1SE3A 4CGYB 1OXUA 4KLKA 4F88A 2NVYB 1RF2D 5AJ3Q 1PH1A 3SVMA 1E1OA 4P71A 3F2UA 4WJ3M 1X3FA 5C4JB 2HHHL 1KD1C 2Y0SG 4HN7A 4DNTB 1EYCA 3S16H 3VYUA 1XWEA 2F0TA 4JI5Q 2F0JA 1LACA 4L6TB 3F2DA 1FR3A 1Y1WH 3E3XA 4X6AH 4DPGA 2FHTA 5GAGC 1IL8A 2PQEA 2NVTB 2K01A 1KHIA 1SMYC 4DR2L 3RR5A 5C3EH 2AMCB 2WINB 2DJGC 2F4IA 4FF4A 3I55A 1EWHA 3VDYA 1BXTA 4NPSA 2QEXA 4WJ4A 3PCOB 3GTMB 4XYOA 2HHHQ 3HKZG 4ABNA 5ELEA 1QUQB 1B9NA 4A3IG 3QJYA 3RMHA 3NEMA 2N78A 5C44B 2Q8RE 5J22A 4AYBG 1SYDA 4DR4L 4DNRB 4DR2Q 2F0WA 2PQAB 1HNZL 4NXNL 2D2CC 2A6HD 4CDEC 3I4LA 1D7QA 3EFXD 2AQ3B 5C4HA 4XYQA 1TU2B 4LUOA 1WTXA 1MHWC 3G4SA 1VQMA 1F2MA 4LF4L 3S1RH 5FK9C 1X65A 3J7A5 1AEXA 1VQJA 3TP5A 5BN3A 1KAWA 1JCKB 2KCCA 1BVSA 1PYWD 1ZEQX 2IL8A 4DR4Q 2CVRA 1N33L 4LUZA 2F0VA 4HAEA 2PNRC 1HZBA 3QR8A 2JA5H 3BJUA 1TS3A 4R4TA 1XNRQ 2LSSA 2BDNA 2F4VL 1BBWA 4DAPA 3D8GA 5EPKA 5D3IB 4RCNA 3GV3A 4K5WA 2I46A 5C6AA 4LF4Q 1D8LA 4V190 1HJPA 4KHPL 4HCSA 1L1OA 4HIKA 3KF6B 4JBMA 1PTOC 2EJGC 2KVMA 4F7XA 4GN4B 1WFQA 4BXXH 5C5MA 3BVGA 1VQ6A 1D6EC 1X56A 4E6IA 1G6PA 2G5DA 5D3DA 5M3FG 1FNVA 1L0XB 2O4XA 1N33Q 1IW7C 4RG1A 1STAA 2R7DA 1SJED 3UDXA 3CQZH 5EJWA 1PTOH 4P2CB 2F4VQ 3I72A 5BR8L 3K7AH 4A3KG 1PFNA 3CAMA 1PTOD 5M5YH 1MSHA 3SE0A 5CORA 3I4MB 3PUXA 1S5FD 4F8MA 4KHPQ 4DXGA 4ZRZA 3HS0C 3OWEB 1Q8KA 4KD3A 2F0QA 2N55A 1WD0A 1QZGA 4UDUC 2A74C 2GA4B 3HP3A 2RCNA 5JPMC 3S1NB 1LTGD 1C9OA 1LT5D 3KF8B 5EPJA 5FKAC 4WJWA 4PMWA 4LNQA 4A3LH 1I6VC 2B8FA 3TZDA 2P5ZX 1EQVA 5BR8Q 5IYBG 2XN9C 1PH7A 2DY7A 1TXYA 1JICA 4A3DH 4ZLTF 5KGUA 2ZXOA 1PMRA 3AFPA 1X3GA 5CV7A 3J81i 4OIJA 3MXUA 1DM0B 3A0JA 4C3JB 2YTVA 3WWVA 3BDLA 5IP9H 3M3YB 1RTNA 1I4QA 1TS2A 1YBYA 3GTQB 3DWPA 2EPBA 2FMCA 3GTJH 2I5HA 3C1FA 1UE7A 4ZYSA 4ZKCB 1AW7A 2F52A 1GUGA 4POGA 1I4XA 1BBUA 4HIOA 5AFWA 4MHEA 3J80E 3D4WA 3I56A 1CKMA 1OTCA 2Z0SA 2Q8IB 3MXNA 1SFOB 2B2YC 2K5NA 1JWSD 2UU9Q 1YVCA 1ICFB 2F0PA 5CV9A 1IBML 1Q1EA 1AZQA 4FXKC 3P75A 4XIGS 2R7ZH 1CKNB 2KHJA 4A3BB 3AYHB 3GTKB 4RHSA 2VW9A 2FINB 4X64Q 2ZJQA 3FEWX 2N3SA 5I9PA 3RUZA 2MNAA 1T9HA 2VNUD 3I8ZA 4RWSC 4DAYA 3N52A 1STYA 1RODA 1F9SA 3MHBA 1VQFA 4QF4A 1VQOA 4P73A 3HOVG 1WTPA 2ZM6Q 1VQ7A 4A3JB 2IX1A 3A8JE 4DV4L 3CCVA 1IBMQ 5C44G 5FO8B 3CP0A 2XIWA 5IYDG 1M4VA 3H0GH 3X3NA 4BBSH 4K8JA 2D0PA 1B8AA 2EYMA 3STBD 2EOTA 4LF8L 2TSSA 4XTCS 1E7ZA 3CC7A 1D1IA 4O2DA 5E7NA 3K7UC 1WCMB 4JI2L 4U673 1QJOA 1JORA 1BCPF 5CV5A 2LY7A 2F3WA 3CKIB 3X3MA 2L55A 3HOXH 2QEJC 4DV4Q 1O7IA 5M5XB 3CU7A 3T53B 1OO9B 4J8QA 4K2LA 5HGQA 3K0XA 3FRPB 4DK0A 1E2WA 2D9UA 1HCZA 5C4XH 1PH4A 2K5DA 3NBHA 4LF8Q 3V2TA 3I91A 4M8AA 4RGNA 1W6JA 3DWQA 5KEEA 3TRZA 1S4ZA 3J81E 1D5MC 4JI2Q 3HG9A 5HY6A 3AEVA 1TWCH 2KBNA 1I4PA 1QG7A 1R4QB 4DR3L 2PMZB 2ID0A 3HFZB 4JVZA 4A3GH 5M5WH 1HQRD 1K0SA 1I50B 1G8ZD 1ICWA 3PUVA 2FFKB 3HOUB 1EY4A 2Q2HA 4IFDJ 2F0FA 3S15B 3K5NA 4LW1A 4MTNA 5CYUA 2B2YA 2QW7A 4A3FB 1Q7YC 3I4MG 4QUFA 2D0OA 2IWHA 4DR3Q 1NCVA 4PZ7A 1TWAB 4OO1G 3A8IE 4CDCC 4P74A 2AQ1B 2JA8B 3PIOA 4U68A 1W3SA 5CV8A 3HOZB 2DJFC 4FNFA 1GUNA 2HIVA 1H9MA 1LUZA 4IUPA 1XMOL 2QDLA 1HXYD 2KECA 2RDFA 1FYCA 5JEAJ 1I6HH 1CTMA 3Q0AA 1WVLA 4WORA 4A3MB 4GZYC 4KKSA 5COYA 2TMPA 4QB4A 1H9SA 1Q12A 4DR1L 3GTLH 1DZ1A 2K1BA 2QDBA 4C3JG 1I3QB 2RQXA 4YCWA 1LTTD 4N9TA 4LF9L 4G57A 2IY5B 2YV5A 3S2HB 2NZ1D 3UDGA 1O7YA 1VQAA 5JOBA 3OWFA 1VQ9A 1XMOQ 4IURA 1LLRD 1UE1A 2QF7A 4OWXB 4O42A 3TBIB 5GAHC 2QGQA 2EIFA 1AZPA 2SNMA 4IUVA 4JI3L 1WOCA 2DY8A 2K03A 1Z47A 1YI2A 1BR9A 3LWEA 2NVQH 4A3CG 3E9HA 3KDFB 4RA8A 5LL6S 3C3LA 1KNAA 4LF9Q 1IXRA 4QUCA 2AKWB 4CKCA 4A3BG 5M9OA 2FXQA 1B2TA 2RA4A 1Y1VH 2NTSA 1SNOA 2CHBD 5CBEE 1B7YB 5T1GA 3SR1A 1R9TB 4DNIA 1YHAA 2OWOA 4Q0FA 1BKBA 1ENFA 2A6ED 1T5EA 2WKDA 3QG1A 2NYZD 2K75A 2MO1A 1BUVT 4B9XA 1U4RA 2OQKA 2IHFA 1VQ5A 4A3JG 4GNXB 3NPPA 1H9RA 4DV2L 5JPNC 1QNKA 3T13A 1Z6HA 1KDCA 3UDFA 4UP8A 3IKJA 5KRUA 3JAMc 2AUJD 3GTGH 4HIMA 3OW7A 5FLMG 4JI0L 4C56C 1JE4A 1Y69U 1U0LA 4EVOA 1PZID 2E76C 2JN4A 5CMDA 1Y8NB 4LWCA 3NENA 4P72A 1C0AA 1EYGA 3A74A 1AFPA 2KEEA 3FKIH 3K57A 4NW2A 3T1YL 2JA6H 2YU9B 5JVH3 1GUSA 3D31A 4R4CA 4OIKA 4YWMA 3F1ZA 3CMAA 1CZWA 2B2TC 1BO0A 2JE6I 1UWVA 4MTKA 2IHEA
chains in the Genus database with same CATH topology
2L9HA 1X32A 1FD7D 1CI3M 1QE6A 1D5XC 4G7OC 4BY1B 4ZK9B 3VYRA 3I70A 1LO5D 4XQQA 2B63B 3T16A 4XQNA 3TN2A 2PO4A 3K6OA 3RZOB 2K33A 4ZUIA 3O13A 4NDXA 4UAIA 4KN4C 1Q3LA 3EJIA 1GHKA 1YNNC 2C5CA 3HRZC 4HMJA 4RKBA 5KYIA 4TSSA 1HA6A 1SNPA 1FNWA 2F0MA 1F9RA 4FF3A 3Q23A 5E4XA 1BCPB 1PZJD 5E4WC 1RHPA 1SJHD 4QIWB 1E0BA 4MIUA 1YNND 4KY7A 3VR6A 1KAAA 3L3OC 1EYDA 1EYAA 1TY0A 5EBDA 3K5MA 1XXGA 2JA7B 5FLXL 1NR2A 3QOJA 4CKBA 4K6DA 3NBIA 3HGBA 2M2LA 2C9OA 4ULLA 3FPUB 1V1PA 2MP1A 2XNAC 2RSNA 3VA5A 3ONAB 2HQEA 3S16B 2BA1A 3H09A 3KUPA 3EVQA 3M7NA 4M1UB 4KJOA 2XRSD 5C3EB 2B2TA 2R6GA 4NKLA 3SK5A 2EYLA 3E0JA 4IUUA 2PPBC 2PYKA 2Z1CA 3U9OA 1STBA 3A7LA 3H94A 4I65A 1EU3A 2R3ZA 2L0CA 4KY5A 3OIQA 5C5LA 2F0NA 2MPMA 3BYYB 4IFDG 2F1MA 5LL6X 3TP8A 1TS4A 4K5XA 3J7YW 4C1NK 3S1RB 1WTOA 1RD9D 1KDBA 3OSOA 5HGTA 3FDTA 5K5PA 1VCIA 5J39A 3C2PA 5A2QL 1SYGA 5EKLA 1VMCA 4H0LC 2A6HC 1CA5A 3HOVB 1Y8OB 2B8GA 2JA5B 3C46A 5JEAG 2IW3A 2L12A 1HTPA 2J0TD 5JVG3 2QILA 5JJZA 2CW0D 1S5ED 1A2TA 1V43A 1KNEA 3M4YA 2OT2A 2NVXB 5D14A 3TP7A 3A8KE 2B2VC 2B2UA 1ENAA 2EYHA 3CQZB 1EIGA 3K7AB 2SEBD 1I4HA 3NXWA 1V8QA 5DAUA 2F0UA 1BDOA 5D65A 3TZUA 2WV6D 1F2LA 1L0YB 2L4NA 3D6WA 2H4OA 1JOKA 3J80L 4DGZA 3R2TA 1STNA 2XRQD 5DM73 3A56A 1LT6D 2PW7A 1PRTF 4A3DB 2X69A 4I7ZC 4KI0A 4ME5A 4LAAA 4FF2A 1E2ZA 1Y8PB 4PV1C 1SYFA 3GTJB 3A55A 4FYDA 3VA7A 1B50A 3ND8A 1MSGA 1SSOA 3NP8A 4HR7B 2WACA 4EQNA 1EY5A 5A35A 4K8IA 2KCNA 2HDLA 2L1BA 1OXVA 2PZWA 4XXEA 4DFAA 3PIP3 4KY6A 3VR5A 1Q90A 3AU7A 3OMGA 4RGTA 2A68D 1ET6A 1CFMA 1A2UA 4DF7A 1J9OA 1Q8IA 3R3OA 2V4DA 3QB3A 2EY1A 3NWTA 5M3MB 2EJFC 2HDMA 1ZKOA 1K8MA 1X3QA 1W6KA 2B2VA 2E75C 4CJ0B 3H0GB 2KHSA 1UAPA 5G3LD 4C2MB 5E3FA 2NN6H 3NTHA 1H9SB 4ID6A 5JAVA 3EQLC 3T51B 2NN6I 1C48A 1AP0A 3HOXB 3AMUA 2Z4IA 1LTAD 1NR4A 1HHVA 2SOBA 1H9KA 3OOCA 1HFNA 5C4XB 1LT4D 2HCIA 4ODGA 4TKOB 3T56B 1YNJD 3WDNA 1CT1D 2JEAI 2A5HA 1II3A 3CRLC 4RFBA 3M7GA 1EEFD 2ZT9C 5K36H 2F0SA 4RAUC 1QCBD 4K6LA 3PV0A 2N88A 1ILPA 3D6CA 3SEBA 3OPOA 2RDHA 1QOHA 2XVSA 1BNZA 1HQMC 2OF1A 4DK1A 5BN4A 2HCCA 2BE5C 2G9HD 1JWMD 1A6XA 4NMZA 5DNFA 4FXGC 2MUYA 1LABA 2K5QA 1KTKA 1HTLD 3H6MA 2A69C 4XDXA 3PUYA 1A3TA 2XWBB 5I6YA 1JB3A 1C8CA 2DNCA 2BE5D 1SEBD 2IPKD 4IALA 1I6HB 2A69D 1G291 1EU4A 4NP5A 4EGVA 2A73B 2JEBI 3GTLB 1KABA 3SK6A 1CK1A 1MBYA 3GD7A 3TP6A 5CC4A 4TRDA 4IUQA 4BBRB 1PFMA 1O7LA 2VB3X 4C1NI 4KKTA 4X3KA 5IT9L 1IYVA 1DD2A 2NVQB 2JSOA 1DJRD 5EKKA 5HURA 1SE4A 4BWGB 4HEDA 1Y1VB 1MI2A 1TQOA 1TR5A 2K28A 1XX8A 2M9VA 2EYOA 3NQIA 3DWAA 1CHPD 1HFGA 4F87A 1UEAB 2DN8A 5C0XH 2QKIC 2Z4HA 1PRTB 1IKLA 1XTCD 2IJ0A 5C0XI 2PW5A 2OEOA 5ISRA 3GTGB 4OL7A 1NUCA 1VDZA 3GV6A 2A6EC 2EJMA 2AWOA 1XYIA 1ONLA 1TS5A 4KHVA 3PO2B 5TSSA 1OXSC 3A7AB 3HOWB 2JA6B 5KNDA 4V0BA 3VR2A 1V1PB 2BOSA 3RLFA 3NWSA 3E6ZX 3QWNA 2WB1B 3DM1A 1KLUD 1G6ZA 2EVBA 1A15A 1EIHA 4Q5VA 1PTOF 2L11A 2R93B 3K0YA 1Q1BA 2NUCA 1C4QA 1B4OA 1TVXA 3G6JB 1VF7A 2NWGA 2XWJB 3MWYW 2X6GA 1ZYRD 2WIIB 1HA5A 3S1MB 3H91A 1EY9A 3S2DB 1PFBA 1RJTA 1K83B 1MD2D 4KD4A 4KHZA 5CGKA 4G7ZC 3NTKA 2K05A 1GUWA 1GUOA 2RDGA 5CBAE 1EZ8A 1FGBD 5IIFA 1JOOA 3J7AV 1SDFA 1ET9A 1F9PA 2O5IC 3MC0B 4H13C 3WOEA 4O1NA 2L5TA 1RKNA 2ICIA 1TWFB 2KJXA 3D4RA 4G7HC 1G2SA 3MXGA 2EYPA 5DEHA 1V1OA 3Q22A 2EYFA 1DOLA 5IGDA 3MA2B 1SNCA 3GP7A 5C4ZA 2KA7A 4KTAA 4RGMA 1D2BA 5FOBB 2LKVA 1UUPA 3HEJA 1D5ZC 4ZKBB 4DU9A 4TQUS 3Q6SA 4FP5D 1DONA 1LTSD 4L63B 3I90A 1LV9A 4PQXA 4K5VA 5NUCA 5IGCA 4RH6A 3DUZA 2B2UC 1GXDC 3PO3B 2IX3A 2EXZA 2SDFA 3NE5B 2RSOA 4XQJA 4JBWA 3URYA 4C3HB 3GTPB 3K59A 1Y1WB 3S1QB 2BDOA 1RDPD 2M00A 2CQAA 4H44C 4QMGA 4CJ1B 3LWUA 3DEOA 4G4KA 3PUWA 1CQVA 5IGFA 1B1ZA 1LTID 2E74C 2F0OA 3KLSA 5KNCA 1FNUA 3OIPA 1BCPD 4Z9CB 3MAQA 3JAME 1HUMA 3MXPA 2Q8TA 4DAVA 4J6HA 2RKSA 3A54A 2KQ3A 2XSCA 2Z8LA 3TSSA 4YIJA 1JR0D 1EZ6A 2O5JC 5E1FA 2EY5A 1PDQA 4DA2A 5ELBA 2E2HB 4HMIA 3CHBD 1MGSA 1RTOA 3I3CA 3J7AF 2CW0C 2WAQB 3EROA 3MFYA 1X3PA 4DN4M 3BVMA 2EE1A 4OHJA 4IQZA 3FMCA 3GQBA 1SBBB 1ZXTA 2H1EA 5FLXE 2PZUA 4FF1A 2ENBA 4XT1B 4PNYA 2VB2X 1KDAA 4RKLA 1SMYD 1I4RA 5CV6A 1ML0D 3L7ZC 3SK4A 4PMBA 2RVLA 1WD1A 4HSVA 3DHQA 2VUMB 1PTOB 4BS9A 5M5YB 3DXJC 3QOLA 1CM9A 1SXTA 1U9RA 3FVQA 3BYTB 4JK1C 3L9AX 3BG3A 5ELFA 2OXPA 4H7BA 4KMUC 4C3IB 1B44D 1E2VA 2F0LA 1O7ZA 1EY6A 2F0GA 1WTQA 2EZVA 2VXWA 3M4OB 1S5BD 3CRKC 3R8BA 2YYZA 2JP1A 4X3SA 2KEDA 1QILA 4LJZC 5IGGA 2E2JB 4BA2I 1T5XD 1STEA 3TMEA 1SE2A 1ESRA 1U4LA 3D3RA 4S3SA 4KK7A 5A2QE 3C1EA 1NAPA 4IUTA 2A68C 5CV4A 3IL8A 4C3HG 3KBXA 3OHXC 2R7ZB 1JWUD 3AB9A 1IW7D 3P7JA 3GTOB 3QO2A 3K5LA 2HUGA 1SYBA 3S14B 1EQTA 4X3UA 2F0EA 3NSWA 1SYEA 3MFGA 4ILWA 4RGOS 4HTHA 4IUNA 3GO5A 3PIO3 4FVMA 1EWCA 1PXUA 2RBMA 3IFTA 3BS1A 1H9JA 1SNDA 3SDZA 2X6LA 1I4GA 4BBSB 3J81L 4B9WA 2MGSA 4N9PA 1IHZA 5KNBA 2EY2A 2K04A 1O78A 1YNJC 1S5DD 1VMPA 5C0XJ 1TT2A 1QWYA 4OO1H 2G9DA 1R4PB 4OO1I 1TIID 1A3VA 3S17B 4R8NA 2FJ2A 1DYQA 1TY2A 3VR3A 5ELDA 3WOFA 5KIXA 4WRDA 3FPPA 3K5OA 3SHLA 1TWCB 1GJXA 5EKIA 2JYOA 2QCPX 1JOQA 3BDOA 4CJ2C 2J7ZA 2R92B 2DNEA 2D5DA 1F2YA 4A3GB 5M5WB 3IAYA 2IT1A 4IZ8A 2K32A 2K7VA 2R61A 1HUNA 2F0KA 5KYLA 2J4XA 2F0HA 2E2DC 3BZDB 1OXTA 2EY6A 3P1HA 1EY8A 4DXFA 2EYJA 3ERQA 2WKCA 3LNNA 3VYSA 3HOYB 3EA6A 4C3IG 1DOKA 1ESFA 2WP8J 1EFID 1EL0A 4LMQD 3MEHA 3VR4A 3NTIA 2F0IA 2BA0A 1M8AA 5IGBA 3D4DA 4ZAIA 1SYCA 5IGEA 2B2WC 4CKEA 4BY7B 3G7LA 1STHA 1DOMA 1EY7A 5I2XA 4KKUA 3VYTA 3UI2A 4MN3A 4A93B 3KF8A 5IOCA 3KK7A 1BBXC 4X3TA 2EDGA 5ELCA 5IODA 3OMCA 2NB0A 3SK8A 1WTRA 5T1IA 1U4MA 1BOSA 1GOZA 1OXXK 1QB5D 2SNSA 3S9WA 4J1MA 1PLFA 4PMCA 2NN6G 1PZKD 1G2TA 3M85A 2AUKA 2F0DA 2AQ2B 4K2KA 2MJ8A 1IKMA 2KUMA 3KBGA 1CA6A 3NUCA 3W3AA 4Y7NB 1SNQA 4K14A 2LFNA 1QNUA 1EY0A 4XT3B 1TWGB 4ZQ3A 1JQYD 5K36G 2AWNA 1WTWA 2JXMB 4HSPA 4R8IA 4KV6A 4ZUJA 1CZGA 2I07B 2IX0A 5I2YA 1GHJA 5EQ0A 3FKIB 1VF5C 5EGTA 4KJNA 5J1ZA 3BDCA 5EPLA 1DCZA 1GUTA 2NBFA 3BVZA 1UNSA 1LTBD 2KOLA 2ZXPA 1RCVD 5FO7B 3QIAA 1B53A 1ZYRC 3T4AC 1PRTC 2B2WA 3V05A 3HZXA 1KLGD 5LHY1 2F3VA 1WTVA 5IT9E 4HCEA 2MHVA 3P20A 1S5CD 2Y0SB 1PRTD 4B08A 3I73A 3K58A 1U4PA 4FO2A 4RCOA 1AN8A 2O2LD 2LMCB 1D1KA 5I9OA 1Z7TA 2F03A 2NTTA 1JC7A 4CBVA 1O80A 1BQQT 1SAPA 3RD4A 3NHHA 3KLSX 1LT3D 2D62A 3NQTA 3HKZB 5I6WA 4A3IB 1ILQA 2BCOA 1F77A 3R2IA 5C3WA 3SXHA 4AYBB 5G3LF 5FO9B 1EOTA 5CR3A 4IFDH 5C3XA 5DM63 2LS01 4IFDI 4OGQC 4EQPA 1TWHB 3JAML 5C0XG 3MZ5A 2PCFB 4QCLA 2E2IB 3V96A 3ZYYX 1A3UA 1SNMA 3RZDB 3H3VC 3R93A 1ENCA 4EQOA 3DMUA 5JEAH 3ITPA 4WFN3 4L8JA 4BA1I 1K8OA 1HPCA 1F9QA 4R9WA 1B9MA 1LTRD 3PUZA 5I4DA 5F2DA 3U9SA 1G91A 5M3FB 1STGA 2K6AA 3LX0A 2PZTA 3KLRA 4RHRA 3NK9A 5EBCA 3MVVA 3ND9A 4A3KB 5BN5A 1TKWB 1BCPC 1EEID 3W2DA 1CQFA 3MTSA 3DEPA 2FMMA 3I4NB 1F2ZA 4IN3A 1CHQD 1J8IA 4LK1C 3PMFA 4CHTB 4A3EB 2B39A 1DXMA 1NSNS 1HRJA 3N6RA 3Q24A 2K5WA 3E5SA 2ZXRA 3TDQA 2ICEC 1BF4A 1B3AA 4FXDA 4KN7C 3IFDA 1IYUA 1SE3A 4CGYB 1OXUA 4F88A 2NVYB 1RF2D 3SVMA 3F2UA 5C4JB 4HN7A 4DNTB 1EYCA 3VYUA 1XWEA 2F0TA 2F0JA 1LACA 4L6TB 1FR3A 2FHTA 1IL8A 2PQEA 2NVTB 2K01A 1SMYC 2WINB 2F4IA 4FF4A 1EWHA 1BXTA 3GTMB 4XYOA 4ABNA 5ELEA 1B9NA 3QJYA 3RMHA 5C44B 2Q8RE 5J22A 1SYDA 4DNRB 2F0WA 2D2CC 2A6HD 3I4LA 3EFXD 2AQ3B 5C4HA 4XYQA 1TU2B 1WTXA 1F2MA 5FK9C 1AEXA 3TP5A 5BN3A 1JCKB 2KCCA 1PYWD 1ZEQX 2IL8A 2CVRA 2F0VA 4HAEA 2PNRC 1TS3A 2BDNA 4DAPA 3D8GA 5EPKA 5D3IB 4RCNA 3GV3A 4K5WA 2I46A 5C6AA 4V190 4HCSA 1PTOC 2EJGC 2KVMA 4F7XA 5C5MA 3BVGA 1D6EC 4E6IA 5D3DA 1FNVA 1L0XB 2O4XA 1IW7C 1STAA 1SJED 5EJWA 1PTOH 4P2CB 3I72A 1PFNA 1PTOD 1MSHA 3SE0A 5CORA 3I4MB 3PUXA 1S5FD 4F8MA 4DXGA 4ZRZA 3HS0C 3OWEB 4KD3A 2F0QA 2N55A 1WD0A 4UDUC 2A74C 2GA4B 3HP3A 5JPMC 3S1NB 1LTGD 1LT5D 5EPJA 5FKAC 4WJWA 4PMWA 1I6VC 2B8FA 3TZDA 1EQVA 2XN9C 2DY7A 1JICA 4ZLTF 5KGUA 2ZXOA 1PMRA 5CV7A 4OIJA 3MXUA 1DM0B 4C3JB 3BDLA 3M3YB 1RTNA 1I4QA 1TS2A 3GTQB 3DWPA 2EPBA 2FMCA 3C1FA 4ZYSA 4ZKCB 1AW7A 1GUGA 1I4XA 5AFWA 4MHEA 3J80E 3D4WA 2Q8IB 3MXNA 1SFOB 2B2YC 1JWSD 2F0PA 5CV9A 1Q1EA 1AZQA 4FXKC 3P75A 4XIGS 4A3BB 3GTKB 4RHSA 2FINB 3FEWX 5I9PA 3RUZA 2VNUD 3I8ZA 4RWSC 4DAYA 3N52A 1STYA 1RODA 1F9SA 3MHBA 4QF4A 1WTPA 4A3JB 2IX1A 3A8JE 5FO8B 2XIWA 1M4VA 3X3NA 4K8JA 2EYMA 2EOTA 2TSSA 4XTCS 1D1IA 1WCMB 4U673 1QJOA 1JORA 1BCPF 5CV5A 2LY7A 2F3WA 3CKIB 3X3MA 2L55A 2QEJC 5M5XB 3CU7A 3T53B 1OO9B 4J8QA 4K2LA 3FRPB 4DK0A 1E2WA 2D9UA 1HCZA 2K5DA 3NBHA 3V2TA 3I91A 4M8AA 4RGNA 1W6JA 3DWQA 5KEEA 1S4ZA 3J81E 1D5MC 3HG9A 1I4PA 1QG7A 1R4QB 2PMZB 2ID0A 1HQRD 1I50B 1G8ZD 1ICWA 3PUVA 2FFKB 3HOUB 1EY4A 4IFDJ 2F0FA 3S15B 3K5NA 5CYUA 2B2YA 4A3FB 4QUFA 2IWHA 1NCVA 1TWAB 4OO1G 3A8IE 2AQ1B 2JA8B 4U68A 5CV8A 3HOZB 4FNFA 1GUNA 1H9MA 4IUPA 1HXYD 2KECA 2RDFA 1FYCA 5JEAJ 1CTMA 3Q0AA 1WVLA 4WORA 4A3MB 4GZYC 4KKSA 5COYA 2TMPA 4QB4A 1H9SA 1Q12A 1DZ1A 2K1BA 2QDBA 4C3JG 1I3QB 2RQXA 1LTTD 4N9TA 4G57A 3S2HB 2NZ1D 1O7YA 5JOBA 3OWFA 4IURA 1LLRD 2QF7A 4O42A 3TBIB 1AZPA 2SNMA 4IUVA 2DY8A 2K03A 1Z47A 1BR9A 3LWEA 4RA8A 5LL6S 3C3LA 1KNAA 4QUCA 4CKCA 5M9OA 1B2TA 2RA4A 2NTSA 1SNOA 2CHBD 5CBEE 5T1GA 3SR1A 1R9TB 4Q0FA 1ENFA 2A6ED 1T5EA 2WKDA 3QG1A 2NYZD 1BUVT 4B9XA 1U4RA 3NPPA 1H9RA 5JPNC 1QNKA 3T13A 1Z6HA 1KDCA 3IKJA 5KRUA 2AUJD 3OW7A 4C56C 1JE4A 1Y69U 4EVOA 1PZID 2E76C 5CMDA 1Y8NB 1AFPA 2KEEA 3K57A 4NW2A 2YU9B 5JVH3 1GUSA 3D31A 4OIKA 1CZWA 2B2TC 1BO0A 2JE6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDB A;  2RBM A;  2EYM A;  3MEH A;  4NKL A;  1ENC A;  3SK5 A;  2F0I A;  4N9T A;  5CV6 A;  4EQO A;  3DMU A;  3ITP A;  3SK4 A;  5IGB A;  4G57 A;  3D4D A;  4PMB A;  2EYL A;  2EXZ A;  4F8M A;  1JOK A;  3DHQ A;  2PQE A;  2PYK A;  4DGZ A;  1SYC A;  1SND A;  1STN A;  5IGE A;  2SOB A;  5JOB A;  3OWF A;  3U9O A;  1EY9 A;  1STB A;  4KD3 A;  2F0Q A;  2PW7 A;  4ODG A;  1STH A;  4I65 A;  3T16 A;  4N9P A;  4B9W A;  1JOR A;  1IHZ A;  5CV5 A;  2F3W A;  1EY7 A;  1U9R A;  3QOL A;  5EKK A;  2M00 A;  4ZUI A;  3HZX A;  5HUR A;  4KY5 A;  2EY2 A;  1II3 A;  4QMG A;  5C5L A;  4KD4 A;  2SNM A;  4NDX A;  2F0N A;  1TQO A;  5F2D A;  1TT2 A;  4ME5 A;  5IOC A;  1TR5 A;  5CGK A;  1STG A;  4K2L A;  3EJI A;  2OXP A;  4LAA A;  4H7B A;  5IGF A;  5IOD A;  1EQV A;  2F3V A;  3OMC A;  3LX0 A;  2EYO A;  4HMJ A;  2F0O A;  2PZT A;  4RKB A;  1SYF A;  2F0S A;  2F0L A;  3SK8 A;  3V2T A;  5KGU A;  5KYI A;  1SNP A;  1A3V A;  3NK9 A;  5J22 A;  5CV7 A;  1EY6 A;  1SYD A;  4K5X A;  1EZ8 A;  2F0M A;  2F0G A;  3MVV A;  4R8N A;  3TP8 A;  5KEE A;  5M9O A;  3D6C A;  2SNS A;  3S9W A;  1KDB A;  1SNO A;  2F0W A;  3MXP A;  3OSO A;  1JOO A;  4J1M A;  4J6H A;  5IIF A;  3SR1 A;  5I9O A;  3BDL A;  5HGT A;  5K5P A;  2RKS A;  5J39 A;  3NP8 A;  2PW5 A;  4PMC A;  2KQ3 A;  1SYG A;  2WAC A;  5C4H A;  4MIU A;  4EQN A;  5EKL A;  5KIX A;  2OF1 A;  4WRD A;  3C1F A;  1EY5 A;  2OEO A;  4K8I A;  4KY7 A;  5ISR A;  1RKN A;  3SHL A;  4OL7 A;  1F2M A;  4YIJ A;  1F2Z A;  4NMZ A;  4B9X A;  1KAA A;  2F0D A;  3NHH A;  4K2K A;  1NUC A;  2PZW A;  3PMF A;  1EZ6 A;  1AEX A;  5IGG A;  3TP5 A;  1EYD A;  1NSN S;  1JOQ A;  1EYA A;  3D4W A;  3H6M A;  4DFA A;  3TME A;  2EYP A;  5E1F A;  3NQT A;  5DEH A;  2EY5 A;  3T13 A;  4KY6 A;  1A3T A;  1EY4 A;  3NUC A;  4KHV A;  2EYF A;  3OMG A;  1KDC A;  2F0F A;  5I6W A;  1F2Y A;  3E5S A;  5IGD A;  5KRU A;  5I6Y A;  2F0V A;  4HMI A;  4S3S A;  1A2U A;  2F0P A;  5CV9 A;  5C3W A;  1SNQ A;  3SXH A;  1SNC A;  3P75 A;  4IZ8 A;  4DF7 A;  4K14 A;  3QOJ A;  1A2T A;  4K6D A;  5C4Z A;  3R3O A;  3C1E A;  4EVO A;  2F0K A;  4KTA A;  3QB3 A;  5KYL A;  2EY1 A;  3D8G A;  5CR3 A;  5CV4 A;  2LKV A;  4K5W A;  1EY0 A;  4IAL A;  5C6A A;  2F0H A;  3ERO A;  3TP7 A;  5C3X A;  3HEJ A;  4ZQ3 A;  5CV8 A;  5I9P A;  4NP5 A;  3RUZ A;  3VA5 A;  1ENA A;  2EYH A;  2EY6 A;  3P1H A;  4DU9 A;  2HQE A;  4EQP A;  1EY8 A;  4F7X A;  2EYJ A;  3ERQ A;  1STY A;  4KV6 A;  5C5M A;  3MHB A;  2KHS A;  3NXW A;  4ZUJ A;  1SYB A;  4QF4 A;  4E6I A;  3EVQ A;  1KAB A;  3MZ5 A;  5DAU A;  2RDF A;  3SK6 A;  2F0E A;  2O4X A;  1SYE A;  2F0U A;  5E3F A;  1STA A;  4HTH A;  2PZU A;  2ENB A;  4IUN A;  1A3U A;  4WOR A;  2NUC A;  4K5V A;  5EGT A;  3TP6 A;  4KJO A;  1SNM A;  5CC4 A;  4KJN A;  5J1Z A;  3BDC A;  4ID6 A;  4TRD A;  5JAV A;  5NUC A;  4PNY A;  1EYC A;  4QB4 A;  1KDA A;  4RKL A;  2F0T A;  5IGC A;  2F0J A;  4K8J A; 
#chains in the Genus database with same CATH topology
 1FL0 A;  3OTO L;  1IZ6 A;  1YNX A;  2L9H A;  1X32 A;  1FD7 D;  1CI3 M;  1QE6 A;  2KHI A;  3JAM i;  1D5X C;  4G7O C;  4BY1 B;  3T1Y Q;  3L2P A;  1B70 B;  4ZK9 B;  3VYR A;  3I70 A;  1LO5 D;  4XQQ A;  2B63 B;  3T16 A;  4XQN A;  2N49 A;  4X62 L;  3TN2 A;  4QY7 A;  2PO4 A;  3K6O A;  1PVO A;  3RZO B;  2K33 A;  4ZUI A;  5FLX c;  2DUD A;  2E8G A;  3G71 A;  3O13 A;  4NDX A;  4X66 L;  4ALP A;  3S1M H;  4DR5 L;  4UAI A;  3CME A;  4KN4 C;  3HOU G;  1Q3L A;  3EJI A;  4HJA A;  1GHK A;  3S2D H;  1YNN C;  2C5C A;  3HRZ C;  4HMJ A;  3OTO Q;  4RKB A;  5KYI A;  4TSS A;  1HA6 A;  1SNP A;  4A3F G;  3LGJ A;  1FNW A;  2F0M A;  1F9R A;  1K83 H;  4FF3 A;  4BBR G;  4B3M Q;  3Q23 A;  4K0K L;  1LTL A;  5E4X A;  1BCP B;  1PZJ D;  5E4W C;  1RHP A;  1SJH D;  1Q81 C;  4QIW B;  1E0B A;  1HNW Q;  4MIU A;  2CH4 W;  3HOZ G;  1YNN D;  4KY7 A;  2I0Q A;  4X66 Q;  3VR6 A;  4DR5 Q;  1KAA A;  1VS0 A;  2ATW A;  3L3O C;  1M1K C;  3TS2 A;  1EYD A;  1EYA A;  1TY0 A;  1JT8 A;  1G51 A;  4A3M G;  5EBD A;  3K5M A;  2PI2 A;  1XXG A;  1VQD A;  1TWF H;  4K0K Q;  2JA7 B;  2C35 B;  5FLX L;  1NR2 A;  4DUY L;  3QOJ A;  4CKB A;  4K6D A;  3NBI A;  3HGB A;  2M2L A;  4HJ9 A;  2C9O A;  1CSP A;  3K8A A;  4ULL A;  2CCZ A;  3FPU B;  5EAY A;  1V1P A;  2MP1 A;  2XNA C;  2RSN A;  1JJG A;  1WTH A;  1I5F A;  3VA5 A;  4CDD C;  3F8T A;  3ONA B;  2HQE A;  1XPR A;  3S16 B;  3W5O A;  2BA1 A;  1E3P A;  3H09 A;  3KUP A;  5AJ3 L;  1XPO A;  3EVQ A;  4HJ5 A;  3M7N A;  4M1U B;  4KJO A;  3T1H L;  2XRS D;  1S3O A;  5C3E B;  2B2T A;  2R6G A;  4JI5 L;  3BZK A;  1PV4 A;  4DV6 L;  3PO2 G;  2VZA A;  4NKL A;  3SK5 A;  3PSI A;  1IL2 A;  1PH2 A;  1YJW A;  2EYL A;  3E0J A;  4IUU A;  2PPB C;  3FHW A;  2PYK A;  3HOW G;  1PHJ A;  2Z1C A;  3U9O A;  1STB A;  1A63 A;  3A7L A;  3H94 A;  4I65 A;  1RIP A;  1EU3 A;  2R3Z A;  2L0C A;  3PO3 H;  4KY5 A;  3OIQ A;  5C5L A;  2F0N A;  2MPM A;  3BYY B;  4JCV E;  3T1H Q;  4IFD G;  2R93 G;  4C3H H;  4DV6 Q;  3GTP H;  2F1M A;  4L5Q A;  5LL6 X;  3S1Q H;  1VQE A;  5GAD C;  1NMF A;  3TP8 A;  1TS4 A;  4K5X A;  4N8F A;  3J7Y W;  4IOC A;  4C1N K;  2L15 A;  3S1R B;  1WTO A;  1RD9 D;  1KDB A;  3OSO A;  3J81 j;  3I4N H;  2XTI A;  4EQ5 A;  5HGT A;  3FDT A;  5K5P A;  1VCI A;  1XTD A;  5J39 A;  3C2P A;  4A3E H;  5A2Q L;  1SYG A;  1L2F A;  5EKL A;  3AQQ A;  1VMC A;  4H0L C;  2A6H C;  1CA5 A;  4LF5 L;  3HOV B;  2HIX A;  1Y8O B;  2JK8 A;  2B8G A;  3I2Z A;  4O0A A;  3C46 A;  2JA5 B;  5JEA G;  1PH8 A;  4LUV A;  2IW3 A;  3TQY A;  2L12 A;  2WFW A;  3A5U A;  3B6Y A;  1HTP A;  2J0T D;  5JVG 3;  2K5H A;  2QIL A;  5JJZ A;  1LM0 A;  1K8A C;  2CW0 D;  1XNR L;  1S5E D;  1A2T A;  1V43 A;  1KNE A;  3M4Y A;  2OT2 A;  4BY1 G;  1KC8 C;  2NVX B;  5D14 A;  4LF5 Q;  3TP7 A;  2B63 G;  3A8K E;  2E2H H;  2B2V C;  2B2U A;  4DAY B;  1ENA A;  2EYH A;  4JPB W;  4P75 A;  3CQZ B;  1NJI C;  1EIG A;  3K7A B;  2SEB D;  1VQN A;  1I4H A;  2CWP A;  3NXW A;  4TVA B;  1V8Q A;  5DAU A;  5FJ8 H;  1A0I A;  2F0U A;  1BDO A;  5D65 A;  2VQF Q;  3TZU A;  2NVT H;  2WV6 D;  1F2L A;  1L0Y B;  2L4N A;  3D6W A;  2H4O A;  1KQS A;  2V1C C;  2I5M X;  5JJK A;  1JOK A;  3J80 L;  4DGZ A;  3R2T A;  1STN A;  3GTM H;  2XRQ D;  5DM7 3;  3A56 A;  4LFC L;  4YHH L;  1LT6 D;  4MNO A;  2PW7 A;  1PRT F;  4A3D B;  2X69 A;  2QA4 A;  3PF4 A;  4I7Z C;  4KI0 A;  5IYD H;  3TEH B;  4PZ8 A;  4ME5 A;  2VUM H;  3ICE A;  1EOV A;  2K14 A;  4LAA A;  3NBH B;  2HD3 A;  4FF2 A;  1E2Z A;  1Y8P B;  5IP7 H;  4PV1 C;  2JA7 G;  1SYF A;  3GTJ B;  3CCQ A;  3A55 A;  4FYD A;  3VA7 A;  1B50 A;  3ND8 A;  1MSG A;  3M4Q A;  3W1B A;  4YHH Q;  4LFC Q;  1SSO A;  3NP8 A;  4C3I H;  4HR7 B;  3EIV A;  4YCV A;  2WAC A;  2B29 A;  4EQN A;  1EY5 A;  5A35 A;  4K8I A;  2KCN A;  2HDL A;  1KIX A;  2L1B A;  1EQQ A;  1B3Q A;  1OXV A;  1XNQ Q;  2PZW A;  3M4O H;  4PG3 A;  4XXE A;  3E9I A;  4DKA C;  4DFA A;  3PIP 3;  4HJ7 A;  4KY6 A;  3VR5 A;  5C3E G;  1Q90 A;  3AU7 A;  3OMG A;  4RGT A;  2ES2 A;  2A68 D;  2UU9 L;  2Z6K C;  1ET6 A;  1CFM A;  1A2U A;  4DF7 A;  1J9O A;  1Q8I A;  3R3O A;  2E2J H;  2V4D A;  3QB3 A;  4X64 L;  2EY1 A;  3KYH C;  3NWT A;  5M3M B;  2UUC L;  4JOI C;  2EJF C;  2HDM A;  1SN8 A;  1ZKO A;  1K8M A;  1X3Q A;  1W6K A;  2B2V A;  2E75 C;  4CJ0 B;  3H0G B;  2KHS A;  4GLV B;  3UDI A;  1VQH A;  2ZM6 L;  3ULJ A;  1UAP A;  3I7F A;  5G3L D;  4C2M B;  5E3F A;  2RHQ B;  4IPG A;  2UXB L;  2NN6 H;  1E1T A;  3UE0 A;  3NTH A;  1H9S B;  4ID6 A;  5JAV A;  3EQL C;  2GVB A;  3T51 B;  2NN6 I;  3GTO H;  1C48 A;  1AP0 A;  4L5R C;  3S14 H;  3HOX B;  3AMU A;  2VS1 A;  1QUQ A;  2Z4I A;  2K5V A;  2H5X A;  2UUC Q;  1LTA D;  1NR4 A;  3S1N H;  1HHV A;  1JB7 A;  2SOB A;  3STB C;  1H9K A;  3OOC A;  2UUA L;  3BZC A;  1HFN A;  5C4X B;  3I4O A;  1LT4 D;  2HCI A;  4ODG A;  4TKO B;  3T56 B;  1YNJ D;  3WDN A;  2JA5 G;  2CKZ B;  1CT1 D;  2JEA I;  2A5H A;  2UXC L;  2UXB Q;  1II3 A;  3CRL C;  4RFB A;  1EWI A;  3U50 C;  3M7G A;  1EEF D;  4OEL B;  2ZT9 C;  2F3I A;  2Z6B A;  1NY4 A;  3M3Y H;  1DGS A;  5K36 H;  4AQY Q;  2F0S A;  4RAU C;  1QCB D;  4K6L A;  3PV0 A;  1X54 A;  4BXX G;  1VQG A;  2N88 A;  1ILP A;  3D6C A;  1FJG Q;  2UUA Q;  3SEB A;  1EFW A;  4LFA L;  3OPO A;  2RDH A;  4R1J A;  1KRS A;  1QOH A;  2XVS A;  1BNZ A;  2UXC Q;  1HQM C;  2OF1 A;  4DK1 A;  5BN4 A;  2HCC A;  2BE5 C;  2G9H D;  3S17 H;  1JWM D;  1A6X A;  4NMZ A;  5DNF A;  4FXG C;  2MUY A;  1SFO H;  1KXL A;  1LAB A;  2K5Q A;  1KTK A;  1HNX Q;  1HTL D;  5IT9 c;  3H6M A;  1EIY B;  2A69 C;  4OWW B;  4A3B H;  3UE1 A;  4XDX A;  3PUY A;  3GTK H;  1A3T A;  2XWB B;  4JW0 A;  5I6Y A;  1JB3 A;  1C8C A;  2DNC A;  2BE5 D;  2Z6K A;  1SEB D;  4LFA Q;  2RCF A;  3NEL A;  2IPK D;  4A3L G;  4L5S A;  2R92 H;  4IAL A;  3A5Z B;  1I6H B;  2A69 D;  2OTL A;  1G29 1;  2BH2 A;  1EU4 A;  4A3D G;  1U5K A;  4NP5 A;  4JOI A;  4ME3 A;  4EGV A;  2A73 B;  2JEB I;  4GOP C;  3GTL B;  1KAB A;  3SK6 A;  3CCL A;  1CK1 A;  1MBY A;  5IP9 G;  2PNH A;  3GD7 A;  1N8R C;  3TP6 A;  5CC4 A;  1C7Y A;  1AE2 A;  4TRD A;  4IUQ A;  4BBR B;  1WCM H;  1PFS A;  3CW2 C;  1PFM A;  3ULP A;  1O7L A;  2VB3 X;  2PI2 E;  1X3E A;  4C1N I;  4KKT A;  5JJI A;  4X3K A;  5IT9 L;  3HOY H;  2OQ0 A;  1VQC A;  4A4I A;  1IBK L;  1PYB A;  1SLJ A;  4JBJ A;  1JMC A;  1IYV A;  2NVQ B;  1DD2 A;  2JSO A;  1DJR D;  3M9B A;  5EKK A;  1PA6 A;  5L37 A;  1K0R A;  2R7Z G;  3Q8D A;  5HUR A;  1SE4 A;  4BWG B;  4HED A;  1HZA A;  1Y1V B;  1MI2 A;  1TQO A;  1GVP A;  1QVF A;  2WB1 E;  3KOJ A;  1TR5 A;  1MKH A;  4IPH A;  2K28 A;  4BY7 H;  1XX8 A;  2M9V A;  2EYO A;  3NQI A;  3DWA A;  1CHP D;  1HFG A;  1A62 A;  4F87 A;  1UEA B;  1EUJ A;  4LF6 L;  1IBK Q;  2GN5 A;  2DN8 A;  5C0X H;  1Q46 A;  2QKI C;  4A93 H;  2Z4H A;  1PRT B;  1IKL A;  1XTC D;  2IJ0 A;  5C0X I;  2PW5 A;  5M3M G;  2K4K A;  3H0G G;  2OEO A;  1X55 A;  3HOU H;  5ISR A;  4BBS G;  3GTG B;  4OL7 A;  1HR0 W;  3S15 H;  4JV5 L;  1NUC A;  1VDZ A;  3GV6 A;  2A6E C;  2EJM A;  2AWO A;  1XYI A;  1AH9 A;  1QVC A;  1ONL A;  2A19 A;  4A76 A;  1TS5 A;  4KHV A;  3PO2 B;  4LF6 Q;  1XPU A;  3CXC A;  1ASZ A;  5TSS A;  2JA8 H;  3HOX G;  1OXS C;  3A7A B;  1H95 A;  3U4V A;  2JA6 B;  3HOW B;  3PGZ A;  5KND A;  4JI6 L;  4V0B A;  3VR2 A;  1YJN A;  3EN2 A;  1V1P B;  2BOS A;  3RLF A;  5C4X G;  3NWS A;  3E6Z X;  4UP7 A;  3QWN A;  4JV5 Q;  4Y7N H;  2WB1 B;  1VQK A;  3DM1 A;  1KLU D;  5ELN A;  1G6Z A;  2EVB A;  1ASY A;  3RN5 A;  1A15 A;  1EIH A;  4Q5V A;  1IBL L;  1PTO F;  1VQ4 A;  2Q2U A;  2L11 A;  4GOP A;  1Q86 C;  2R93 B;  3K0Y A;  1UE5 A;  4GS3 A;  1I3Q H;  2N8N A;  3KJO A;  1TWG H;  1Q1B A;  2NUC A;  1C4Q A;  1B4O A;  4JI6 Q;  1TVX A;  3EBE A;  3G6J B;  1VF7 A;  2NWG A;  2XWJ B;  3MWY W;  4A3G G;  2X6G A;  1ZYR D;  2WII B;  4DAM A;  1HA5 A;  5IYC H;  3S1M B;  3H91 A;  2VL6 A;  3CCJ A;  1EY9 A;  1IBL Q;  3S2D B;  4JC0 A;  2K52 A;  1L0W A;  1PFB A;  3J7Z C;  1RJT A;  1K83 B;  1MD2 D;  4KD4 A;  4KHZ A;  1E24 A;  2EXD A;  1NTG A;  5CGK A;  1HR0 Q;  3KFU A;  2KCM A;  4G7Z C;  3NTK A;  2K05 A;  1GUW A;  2AHO B;  1GUO A;  2RDG A;  5CBA E;  1EZ8 A;  4B3M L;  1FGB D;  2B3G A;  5IIF A;  1JOO A;  3J7A V;  1SDF A;  1ET9 A;  1F9P A;  2O5I C;  1HNW L;  3MC0 B;  4AIM A;  4H13 C;  3WOE A;  4O1N A;  2L5T A;  3KJP A;  1RKN A;  2ICI A;  1TWF B;  4QQB X;  2KJX A;  3IRB A;  3D4R A;  4G7H C;  1G2S A;  4DUZ L;  3MXG A;  2EYP A;  4H02 A;  2RHS B;  5DEH A;  1V1O A;  4YY3 L;  3Q22 A;  2EYF A;  1DOL A;  4JI4 Q;  5IGD A;  1IYJ B;  3MA2 B;  4OON A;  1SNC A;  3GP7 A;  5C4Z A;  2KA7 A;  4KTA A;  4RGM A;  1YIJ A;  5FOB B;  2YU9 H;  2LKV A;  1D2B A;  1UUP A;  1HH2 P;  3HEJ A;  1D5Z C;  4A3I H;  1FVI A;  4ZKB B;  4DUZ Q;  4DU9 A;  4TQU S;  1QVG A;  1Y1V G;  3Q6S A;  4YY3 Q;  4FP5 D;  1DON A;  1LTS D;  4L63 B;  3I90 A;  2KCT A;  1LV9 A;  4PQX A;  1WI5 A;  4K5V A;  5NUC A;  1TWH H;  3TRE A;  5IGC A;  4RH6 A;  3DUZ A;  2B2U C;  1GXD C;  3PO3 B;  3K80 C;  1L1O B;  3RZO H;  3KDF A;  2EXZ A;  2IX3 A;  2VQE L;  2E2I H;  4DR6 L;  2SDF A;  3NE5 B;  2RSO A;  4XQJ A;  4JBW A;  3URY A;  4C3H B;  3RZD H;  3GTP B;  1KRT A;  4QGU A;  3K59 A;  1Y1W B;  3S1Q B;  2BDO A;  1RDP D;  2M00 A;  2HT1 A;  2CQA A;  1N32 L;  4H44 C;  1SE8 A;  2WAQ E;  4QMG A;  4CJ1 B;  4GKJ Q;  3LWU A;  3DEO A;  4G4K A;  3PUW A;  1CQV A;  5IGF A;  1B1Z A;  1LTI D;  2E74 C;  2F0O A;  3KLS A;  5KNC A;  1VQL A;  1GD7 A;  3OIP A;  1FNU A;  3FKI G;  1BCP D;  4Z9C B;  2R7F A;  3MAQ A;  3RN2 A;  3D0F A;  2VQE Q;  2JA6 G;  4DR6 Q;  3JAM E;  1YJ9 A;  1HUM A;  2LXJ A;  3MXP A;  2Q8T A;  4DAV A;  4J6H A;  5M3F H;  4GN5 A;  2RKS A;  3A54 A;  2KQ3 A;  2WB1 G;  1YEZ A;  4IJH A;  1PH9 A;  1N32 Q;  2CQO A;  2XSC A;  5LMN W;  2Z8L A;  3JC6 6;  3TSS A;  2KEN A;  4YIJ A;  1JR0 D;  4A3K H;  1WYD A;  1EZ6 A;  1N34 L;  2O5J C;  5E1F A;  1SR3 A;  2EY5 A;  1PDQ A;  4DR7 L;  4DA2 A;  1EIF A;  1V9P A;  5ELB A;  2E2H B;  4HMI A;  3CHB D;  1EQR A;  1MGS A;  1RTO A;  1J5E L;  3I3C A;  1P16 A;  1PH3 A;  3CPF A;  3J7A F;  3RNU A;  2ZJP A;  4OEM B;  2CW0 C;  2WAQ B;  3ERO A;  2A8V A;  3MFY A;  5IYB H;  1X3P A;  4DN4 M;  3BVM A;  2EE1 A;  1K3R A;  4J15 A;  4Y52 H;  4OHJ A;  3J80 c;  1N34 Q;  4IQZ A;  3MXN B;  2UXD L;  3FMC A;  1A8V A;  4DR7 Q;  3GQB A;  1SBB B;  1ZXT A;  2H1E A;  5FLX E;  2OTJ A;  2PZU A;  4FF1 A;  2ENB A;  4XT1 B;  1PYS B;  2VQF L;  5LMN L;  4NXM L;  1J5E Q;  4PNY A;  2VB2 X;  2RF4 A;  1KDA A;  4RKL A;  2NVY H;  3BU2 A;  1K3B C;  1SMY D;  4UY8 C;  1I4R A;  5CV6 A;  1ML0 D;  3ERS X;  3L7Z C;  3SK4 A;  4PMB A;  2RVL A;  1WD1 A;  4HSV A;  3DHQ A;  3F2B A;  2VUM B;  1PTO B;  4BS9 A;  5C4J H;  4YWK A;  2UXD Q;  5M5Y B;  3DXJ C;  3HKS A;  1CM9 A;  1SXT A;  1U9R A;  3FVQ A;  3QOL A;  4UP9 A;  4LF7 L;  3BYT B;  4JK1 C;  3L9A X;  3BG3 A;  5ELF A;  1NMG A;  5LMN Q;  4NXM Q;  4R4I A;  4B3R L;  2OXP A;  4H7B A;  2JA9 A;  4KMU C;  4C3I B;  3J80 i;  1B44 D;  1E2V A;  2F0L A;  1J6Q A;  1O7Z A;  1EY6 A;  2F0G A;  1WTQ A;  2EZV A;  2VXW A;  3HOV H;  3M4O B;  1S5B D;  3ZJY C;  1MJC A;  3CRK C;  1HNZ Q;  4NXN Q;  4LF7 Q;  3R8B A;  4R4Q A;  2YYZ A;  5C44 H;  3CC4 A;  2JP1 A;  1NBW A;  4X3S A;  2KED A;  1QIL A;  1XNQ L;  2YTY A;  4LJZ C;  4B3R Q;  4YCU A;  2VY3 A;  1N36 L;  5IGG A;  2E2J B;  4BA2 I;  1T5X D;  1STE A;  3CCS A;  1K9M C;  3TME A;  1SE2 A;  1ESR A;  1U4L A;  3D3R A;  3J81 c;  2NVX H;  4S3S A;  4KK7 A;  5A2Q E;  3PO3 G;  1NNX A;  3C1E A;  1NAP A;  4IUT A;  2A68 C;  4B3T L;  5CV4 A;  5GRO A;  3IL8 A;  4C3H G;  3KBX A;  3OHX C;  1Y1W G;  4DK6 C;  2R7Z B;  1P8L A;  1N36 Q;  1JWU D;  3AB9 A;  1IW7 D;  1Q82 C;  3P7J A;  4DV0 L;  3K81 C;  3GTO B;  3QO2 A;  3K5L A;  2HUG A;  1SYB A;  3S14 B;  3SGI A;  3I4N G;  1EQT A;  4X3U A;  2F0E A;  4EX5 A;  3NSW A;  1SYE A;  3MFG A;  1XMQ L;  4ILW A;  4N8X 1;  4HTH A;  4RGO S;  4A3E G;  4IUN A;  3GO5 A;  3PIO 3;  4FVM A;  1EWC A;  4B3T Q;  1X6O A;  1PXU A;  2RBM A;  3DLL A;  3IFT A;  3BS1 A;  1H9J A;  3W1G A;  1SND A;  3SDZ A;  1HZC A;  2E5L L;  3PF5 A;  2X6L A;  1I4G A;  4BBS B;  4DV0 Q;  3J81 L;  4IOA A;  4B9W A;  4DV7 L;  2MGS A;  4N9P A;  1IHZ A;  1GKH A;  5KNB A;  1XMQ Q;  2EY2 A;  4DV5 L;  3I4M H;  2K04 A;  1PH5 A;  1O78 A;  1YNJ C;  1JE5 A;  1S5D D;  1VMP A;  4CDF C;  5C0X J;  1TT2 A;  1QWY A;  4OO1 H;  2G9D A;  4AQY L;  1R4P B;  4OO1 I;  1TII D;  4I7A A;  1A3V A;  3S17 B;  4R8N A;  2FJ2 A;  1FJG L;  1DYQ A;  2E5L Q;  5FJ8 G;  1TY2 A;  3CCU A;  2WAQ G;  3ULL A;  2Q2I A;  2PQA A;  3VR3 A;  5ELD A;  4DV7 Q;  2ZJR A;  1FGU A;  3WOF A;  1KL9 A;  5KIX A;  4WRD A;  4DV5 Q;  3FPP A;  3K5O A;  3MEF A;  1RL2 A;  4QL5 A;  3SHL A;  3DM3 A;  3G6E A;  4C3J H;  1TWC B;  1GJX A;  5EKI A;  2JYO A;  1HNX L;  4POF A;  2QCP X;  1JOQ A;  3BDO A;  4CJ2 C;  3CD6 A;  3GTQ H;  2J7Z A;  2JQO A;  3RLO A;  2R92 B;  2DNE A;  2D5D A;  2PMZ E;  2LXK A;  4IJL A;  1F2Y A;  4A3G B;  5M5W B;  4PZ6 A;  3IAY A;  5M3M H;  2IT1 A;  4IZ8 A;  2K32 A;  2K7V A;  2R61 A;  3U58 A;  1HUN A;  1M90 C;  1MJE A;  2F0K A;  5KYL A;  2VUM G;  2J4X A;  2F0H A;  3FP9 A;  4C2M H;  2E2D C;  5IP7 G;  1I94 L;  4A3C H;  3BZD B;  1OXT A;  2EY6 A;  3P1H A;  3H15 A;  1EY8 A;  4DXF A;  2EYJ A;  3ERQ A;  2WKC A;  4GOP B;  3KF6 A;  4AH6 A;  3LNN A;  3VYS A;  3HOY B;  3EA6 A;  4C3I G;  1DOK A;  3TS0 A;  1ESF A;  1S72 A;  2WP8 J;  1EFI D;  1EL0 A;  1HZ9 A;  4LMQ D;  4IO9 A;  2CH4 A;  3MEH A;  1VQI A;  3VR4 A;  3NTI A;  1N9W A;  2F0I A;  4LFB L;  2BA0 A;  1M8A A;  5IGB A;  4A3J H;  3D4D A;  1I94 Q;  4ZAI A;  1SYC A;  3CCE A;  3OW2 A;  5IGE A;  4FDB A;  2B2W C;  4CKE A;  4BY7 B;  3G7L A;  3F2C A;  1STH A;  1DOM A;  1EY7 A;  5I2X A;  4KKU A;  3VYT A;  5FLM H;  3UI2 A;  2ASB A;  4MN3 A;  4DV1 L;  4A93 B;  3KF8 A;  5IOC A;  3KK7 A;  1BBX C;  4X3T A;  2EDG A;  5ELC A;  5IOD A;  3OMC A;  2NB0 A;  1YHQ A;  4LFB Q;  3SK8 A;  1WTR A;  5T1I A;  1U4M A;  1BOS A;  1GOZ A;  3E0E A;  5GQO A;  5M5X H;  1K8G A;  1OXX K;  1SRU A;  1QB5 D;  2SNS A;  3S9W A;  1QZH A;  4J1M A;  2XGT A;  3PIP A;  3CC2 A;  1PLF A;  4PMC A;  2NN6 G;  1YHB A;  2I5L X;  1PZK D;  4UHV A;  4IPC A;  5GAE C;  1G2T A;  2CFM A;  3M85 A;  4DV1 Q;  2AUK A;  1GO3 E;  2F0D A;  2AQ2 B;  4K2K A;  2MJ8 A;  4GN3 B;  1IKM A;  2KUM A;  3KBG A;  1NE3 A;  1CA6 A;  3NUC A;  3W3A A;  4Y7N B;  1SNQ A;  4K14 A;  1I50 H;  2LFN A;  1CKN A;  1W2B A;  1QNU A;  4JI7 L;  1Y14 B;  2Y0S E;  3RLN A;  1EY0 A;  4XT3 B;  4MZ9 A;  1TWG B;  2ZTE A;  4ZQ3 A;  1JQY D;  4B3S L;  5K36 G;  2AWN A;  2GVA A;  1GM5 A;  1WTW A;  2JXM B;  4HID A;  4A3F H;  4HSP A;  2A1A A;  4R8I A;  4OXP A;  4KV6 A;  4RMF A;  2K50 A;  4BBR H;  4ZUJ A;  1CZG A;  1TWA H;  2I07 B;  4JYA L;  2IX0 A;  5I2Y A;  1GHJ A;  1VQB A;  5EQ0 A;  2MFI A;  3FKI B;  1VF5 C;  2ZTC A;  5EGT A;  4KJN A;  5J1Z A;  3BDC A;  3HOZ H;  5EPL A;  1DCZ A;  1GUT A;  3PQI A;  2Q2T A;  2NBF A;  3KLW A;  4DR1 Q;  3BVZ A;  4JI7 Q;  1UNS A;  1LTB D;  3CPW A;  4GLX A;  3HKZ E;  2KOL A;  2ZXP A;  1RCV D;  1YIT A;  5FO7 B;  3QIA A;  4OWT B;  4B3S Q;  5DLQ E;  4JG2 A;  1B53 A;  4A3M H;  1ZYR C;  3T4A C;  1PRT C;  4AYB E;  4DK3 C;  2B2W A;  4GLA C;  1XJV A;  3V05 A;  4JYA Q;  1UEB A;  3AFQ A;  3HZX A;  1KLG D;  2MO0 A;  2DGY A;  4NB3 A;  3ER0 A;  3S2H H;  1CSQ A;  4JI3 Q;  1HR0 L;  3OYY A;  5LHY 1;  2R92 G;  5IY0 A;  4GKK L;  2F3V A;  1JJC B;  2BH8 A;  1WTV A;  5IT9 E;  4HCE A;  4R4O A;  2MHV A;  3P20 A;  4JBK A;  1S5C D;  2Y0S B;  1PRT D;  4APV A;  4B08 A;  3I73 A;  3M4P A;  3L0O A;  1VQP A;  3K58 A;  1U4P A;  4FO2 A;  4RCO A;  1AN8 A;  2O2L D;  2LMC B;  1MIU A;  2ZTD A;  1D1K A;  5I9O A;  1Z7T A;  1JJ2 A;  1K73 C;  2F03 A;  2NTT A;  1JC7 A;  4UPA A;  4CBV A;  2EQS A;  1O80 A;  1BQQ T;  1SAP A;  1WCM G;  1VQ8 A;  1SRO A;  3PO2 H;  3RD4 A;  3NHH A;  4GKK Q;  3KLS X;  3U4Z A;  4GNX C;  1R9T H;  3HOY G;  1LT3 D;  2D62 A;  4OX9 L;  3HOW H;  3NQT A;  1YZ6 A;  4DV2 Q;  3HKZ B;  4QIW E;  1S40 A;  5IWA L;  5I6W A;  4JI4 L;  4A3I B;  1ILQ A;  2BCO A;  1F77 A;  3R2I A;  5C3W A;  3SXH A;  1WJJ A;  4AYB B;  4JI0 Q;  4L5T A;  5G3L F;  5FO9 B;  1EOT A;  5CR3 A;  4IFD H;  4BY7 G;  2R93 H;  4JI1 L;  5C3X A;  5DM6 3;  2LS0 1;  4YWL A;  4IFD I;  4OGQ C;  4HJ8 A;  4EQP A;  1TWH B;  2HQL A;  3JAM L;  5C0X G;  4OX9 Q;  4X65 L;  4A93 G;  2JJQ A;  1UE6 A;  3MZ5 A;  5IWA Q;  2PCF B;  4QCL A;  3G48 A;  2E2I B;  3V96 A;  3ZYY X;  1A3U A;  1SNM A;  3RZD B;  4ZCK A;  1K28 A;  4DV3 L;  3H3V C;  3R93 A;  2OCE A;  1E22 A;  1ENC A;  3GDE A;  4JI1 Q;  2Z9H A;  3DMU A;  5ELO A;  3ITP A;  4EQO A;  5JEA H;  4WFN 3;  4L8J A;  1CKO A;  4BA1 I;  1Z9F A;  5IE8 A;  1LYL A;  5LMU L;  2CWA A;  2NZH A;  4X65 Q;  4X62 Q;  2JA8 G;  3H3V H;  1K8O A;  1HPC A;  1F9Q A;  4R9W A;  1B9M A;  4GKJ L;  1LTR D;  3PUZ A;  5I4D A;  3H3V I;  2YTX A;  4A75 A;  5F2D A;  3U9S A;  1G91 A;  5M3F B;  1STG A;  4BY1 H;  1V1Q A;  2K6A A;  1SMX A;  4DV3 Q;  3LX0 A;  2B63 H;  1PH6 A;  2PZT A;  3KLR A;  4RHR A;  5H1S E;  3NK9 A;  5EBC A;  5JJL A;  3MVV A;  1CUK A;  3S24 A;  3ND9 A;  4A3K B;  5BN5 A;  1TKW B;  5LMU Q;  1BCP C;  4JI8 L;  2UUB L;  4QJF A;  1EEI D;  2NZO A;  3W2D A;  3CCR A;  1CQF A;  2ALY B;  3MTS A;  3CF5 A;  3DEP A;  2FMM A;  3I4N B;  1F2Z A;  4IN3 A;  1CHQ D;  1J8I A;  4LK1 C;  2MQH A;  3PMF A;  4CHT B;  4A3E B;  2B39 A;  5IYC G;  1DXM A;  1NSN S;  4GNX A;  1AE3 A;  1HRJ A;  3N6R A;  3Q24 A;  2K5W A;  3E5S A;  2ZXR A;  5J3B A;  3TDQ A;  4JI8 Q;  4DUY Q;  3CCM A;  2UUB Q;  2ICE C;  1BF4 A;  1B3A A;  4FXD A;  1X9N A;  4KN7 C;  4IPD A;  1L1O C;  3IFD A;  2JA7 H;  1IYU A;  1SE3 A;  4CGY B;  1OXU A;  4KLK A;  4F88 A;  2NVY B;  1RF2 D;  5AJ3 Q;  1PH1 A;  3SVM A;  1E1O A;  4P71 A;  3F2U A;  4WJ3 M;  1X3F A;  5C4J B;  2HHH L;  1KD1 C;  2Y0S G;  4HN7 A;  4DNT B;  1EYC A;  3S16 H;  3VYU A;  1XWE A;  2F0T A;  4JI5 Q;  2F0J A;  1LAC A;  4L6T B;  3F2D A;  1FR3 A;  1Y1W H;  3E3X A;  4X6A H;  4DPG A;  2FHT A;  5GAG C;  1IL8 A;  2PQE A;  2NVT B;  2K01 A;  1KHI A;  1SMY C;  4DR2 L;  3RR5 A;  5C3E H;  2AMC B;  2WIN B;  2DJG C;  2F4I A;  4FF4 A;  3I55 A;  1EWH A;  3VDY A;  1BXT A;  4NPS A;  2QEX A;  4WJ4 A;  3PCO B;  3GTM B;  4XYO A;  2HHH Q;  3HKZ G;  4ABN A;  5ELE A;  1QUQ B;  1B9N A;  4A3I G;  3QJY A;  3RMH A;  3NEM A;  2N78 A;  5C44 B;  2Q8R E;  5J22 A;  4AYB G;  1SYD A;  4DR4 L;  4DNR B;  4DR2 Q;  2F0W A;  2PQA B;  1HNZ L;  4NXN L;  2D2C C;  2A6H D;  4CDE C;  3I4L A;  1D7Q A;  3EFX D;  2AQ3 B;  5C4H A;  4XYQ A;  1TU2 B;  4LUO A;  1WTX A;  1MHW C;  3G4S A;  1VQM A;  1F2M A;  4LF4 L;  3S1R H;  5FK9 C;  1X65 A;  3J7A 5;  1AEX A;  1VQJ A;  3TP5 A;  5BN3 A;  1KAW A;  1JCK B;  2KCC A;  1BVS A;  1PYW D;  1ZEQ X;  2IL8 A;  4DR4 Q;  2CVR A;  1N33 L;  4LUZ A;  2F0V A;  4HAE A;  2PNR C;  1HZB A;  3QR8 A;  2JA5 H;  3BJU A;  1TS3 A;  4R4T A;  1XNR Q;  2LSS A;  2BDN A;  2F4V L;  1BBW A;  4DAP A;  3D8G A;  5EPK A;  5D3I B;  4RCN A;  3GV3 A;  4K5W A;  2I46 A;  5C6A A;  4LF4 Q;  1D8L A;  4V19 0;  1HJP A;  4KHP L;  4HCS A;  1L1O A;  4HIK A;  3KF6 B;  4JBM A;  1PTO C;  2EJG C;  2KVM A;  4F7X A;  4GN4 B;  1WFQ A;  4BXX H;  5C5M A;  3BVG A;  1VQ6 A;  1D6E C;  1X56 A;  4E6I A;  1G6P A;  2G5D A;  5D3D A;  5M3F G;  1FNV A;  1L0X B;  2O4X A;  1N33 Q;  1IW7 C;  4RG1 A;  1STA A;  2R7D A;  1SJE D;  3UDX A;  3CQZ H;  5EJW A;  1PTO H;  4P2C B;  2F4V Q;  3I72 A;  5BR8 L;  3K7A H;  4A3K G;  1PFN A;  3CAM A;  1PTO D;  5M5Y H;  1MSH A;  3SE0 A;  5COR A;  3I4M B;  3PUX A;  1S5F D;  4F8M A;  4KHP Q;  4DXG A;  4ZRZ A;  3HS0 C;  3OWE B;  1Q8K A;  4KD3 A;  2F0Q A;  2N55 A;  1WD0 A;  1QZG A;  4UDU C;  2A74 C;  2GA4 B;  3HP3 A;  2RCN A;  5JPM C;  3S1N B;  1LTG D;  1C9O A;  1LT5 D;  3KF8 B;  5EPJ A;  5FKA C;  4WJW A;  4PMW A;  4LNQ A;  4A3L H;  1I6V C;  2B8F A;  3TZD A;  2P5Z X;  1EQV A;  5BR8 Q;  5IYB G;  2XN9 C;  1PH7 A;  2DY7 A;  1TXY A;  1JIC A;  4A3D H;  4ZLT F;  5KGU A;  2ZXO A;  1PMR A;  3AFP A;  1X3G A;  5CV7 A;  3J81 i;  4OIJ A;  3MXU A;  1DM0 B;  3A0J A;  4C3J B;  2YTV A;  3WWV A;  3BDL A;  5IP9 H;  3M3Y B;  1RTN A;  1I4Q A;  1TS2 A;  1YBY A;  3GTQ B;  3DWP A;  2EPB A;  2FMC A;  3GTJ H;  2I5H A;  3C1F A;  1UE7 A;  4ZYS A;  4ZKC B;  1AW7 A;  2F52 A;  1GUG A;  4POG A;  1I4X A;  1BBU A;  4HIO A;  5AFW A;  4MHE A;  3J80 E;  3D4W A;  3I56 A;  1CKM A;  1OTC A;  2Z0S A;  2Q8I B;  3MXN A;  1SFO B;  2B2Y C;  2K5N A;  1JWS D;  2UU9 Q;  1YVC A;  1ICF B;  2F0P A;  5CV9 A;  1IBM L;  1Q1E A;  1AZQ A;  4FXK C;  3P75 A;  4XIG S;  2R7Z H;  1CKN B;  2KHJ A;  4A3B B;  3AYH B;  3GTK B;  4RHS A;  2VW9 A;  2FIN B;  4X64 Q;  2ZJQ A;  3FEW X;  2N3S A;  5I9P A;  3RUZ A;  2MNA A;  1T9H A;  2VNU D;  3I8Z A;  4RWS C;  4DAY A;  3N52 A;  1STY A;  1ROD A;  1F9S A;  3MHB A;  1VQF A;  4QF4 A;  1VQO A;  4P73 A;  3HOV G;  1WTP A;  2ZM6 Q;  1VQ7 A;  4A3J B;  2IX1 A;  3A8J E;  4DV4 L;  3CCV A;  1IBM Q;  5C44 G;  5FO8 B;  3CP0 A;  2XIW A;  5IYD G;  1M4V A;  3H0G H;  3X3N A;  4BBS H;  4K8J A;  2D0P A;  1B8A A;  2EYM A;  3STB D;  2EOT A;  4LF8 L;  2TSS A;  4XTC S;  1E7Z A;  3CC7 A;  1D1I A;  4O2D A;  5E7N A;  3K7U C;  1WCM B;  4JI2 L;  4U67 3;  1QJO A;  1JOR A;  1BCP F;  5CV5 A;  2LY7 A;  2F3W A;  3CKI B;  3X3M A;  2L55 A;  3HOX H;  2QEJ C;  4DV4 Q;  1O7I A;  5M5X B;  3CU7 A;  3T53 B;  1OO9 B;  4J8Q A;  4K2L A;  5HGQ A;  3K0X A;  3FRP B;  4DK0 A;  1E2W A;  2D9U A;  1HCZ A;  5C4X H;  1PH4 A;  2K5D A;  3NBH A;  4LF8 Q;  3V2T A;  3I91 A;  4M8A A;  4RGN A;  1W6J A;  3DWQ A;  5KEE A;  3TRZ A;  1S4Z A;  3J81 E;  1D5M C;  4JI2 Q;  3HG9 A;  5HY6 A;  3AEV A;  1TWC H;  2KBN A;  1I4P A;  1QG7 A;  1R4Q B;  4DR3 L;  2PMZ B;  2ID0 A;  3HFZ B;  4JVZ A;  4A3G H;  5M5W H;  1HQR D;  1K0S A;  1I50 B;  1G8Z D;  1ICW A;  3PUV A;  2FFK B;  3HOU B;  1EY4 A;  2Q2H A;  4IFD J;  2F0F A;  3S15 B;  3K5N A;  4LW1 A;  4MTN A;  5CYU A;  2B2Y A;  2QW7 A;  4A3F B;  1Q7Y C;  3I4M G;  4QUF A;  2D0O A;  2IWH A;  4DR3 Q;  1NCV A;  4PZ7 A;  1TWA B;  4OO1 G;  3A8I E;  4CDC C;  4P74 A;  2AQ1 B;  2JA8 B;  3PIO A;  4U68 A;  1W3S A;  5CV8 A;  3HOZ B;  2DJF C;  4FNF A;  1GUN A;  2HIV A;  1H9M A;  1LUZ A;  4IUP A;  1XMO L;  2QDL A;  1HXY D;  2KEC A;  2RDF A;  1FYC A;  5JEA J;  1I6H H;  1CTM A;  3Q0A A;  1WVL A;  4WOR A;  4A3M B;  4GZY C;  4KKS A;  5COY A;  2TMP A;  4QB4 A;  1H9S A;  1Q12 A;  4DR1 L;  3GTL H;  1DZ1 A;  2K1B A;  2QDB A;  4C3J G;  1I3Q B;  2RQX A;  4YCW A;  1LTT D;  4N9T A;  4LF9 L;  4G57 A;  2IY5 B;  2YV5 A;  3S2H B;  2NZ1 D;  3UDG A;  1O7Y A;  1VQA A;  5JOB A;  3OWF A;  1VQ9 A;  1XMO Q;  4IUR A;  1LLR D;  1UE1 A;  2QF7 A;  4OWX B;  4O42 A;  3TBI B;  5GAH C;  2QGQ A;  2EIF A;  1AZP A;  2SNM A;  4IUV A;  4JI3 L;  1WOC A;  2DY8 A;  2K03 A;  1Z47 A;  1YI2 A;  1BR9 A;  3LWE A;  2NVQ H;  4A3C G;  3E9H A;  3KDF B;  4RA8 A;  5LL6 S;  3C3L A;  1KNA A;  4LF9 Q;  1IXR A;  4QUC A;  2AKW B;  4CKC A;  4A3B G;  5M9O A;  2FXQ A;  1B2T A;  2RA4 A;  1Y1V H;  2NTS A;  1SNO A;  2CHB D;  5CBE E;  1B7Y B;  5T1G A;  3SR1 A;  1R9T B;  4DNI A;  1YHA A;  2OWO A;  4Q0F A;  1BKB A;  1ENF A;  2A6E D;  1T5E A;  2WKD A;  3QG1 A;  2NYZ D;  2K75 A;  2MO1 A;  1BUV T;  4B9X A;  1U4R A;  2OQK A;  2IHF A;  1VQ5 A;  4A3J G;  4GNX B;  3NPP A;  1H9R A;  4DV2 L;  5JPN C;  1QNK A;  3T13 A;  1Z6H A;  1KDC A;  3UDF A;  4UP8 A;  3IKJ A;  5KRU A;  3JAM c;  2AUJ D;  3GTG H;  4HIM A;  3OW7 A;  5FLM G;  4JI0 L;  4C56 C;  1JE4 A;  1Y69 U;  1U0L A;  4EVO A;  1PZI D;  2E76 C;  2JN4 A;  5CMD A;  1Y8N B;  4LWC A;  3NEN A;  4P72 A;  1C0A A;  1EYG A;  3A74 A;  1AFP A;  2KEE A;  3FKI H;  3K57 A;  4NW2 A;  3T1Y L;  2JA6 H;  2YU9 B;  5JVH 3;  1GUS A;  3D31 A;  4R4C A;  4OIK A;  4YWM A;  3F1Z A;  3CMA A;  1CZW A;  2B2T C;  1BO0 A;  2JE6 I;  1UWV A;  4MTK A;  2IHE A; 
#chains in the Genus database with same CATH homology
 2L9H A;  1X32 A;  1FD7 D;  1CI3 M;  1QE6 A;  1D5X C;  4G7O C;  4BY1 B;  4ZK9 B;  3VYR A;  3I70 A;  1LO5 D;  4XQQ A;  2B63 B;  3T16 A;  4XQN A;  3TN2 A;  2PO4 A;  3K6O A;  3RZO B;  2K33 A;  4ZUI A;  3O13 A;  4NDX A;  4UAI A;  4KN4 C;  1Q3L A;  3EJI A;  1GHK A;  1YNN C;  2C5C A;  3HRZ C;  4HMJ A;  4RKB A;  5KYI A;  4TSS A;  1HA6 A;  1SNP A;  1FNW A;  2F0M A;  1F9R A;  4FF3 A;  3Q23 A;  5E4X A;  1BCP B;  1PZJ D;  5E4W C;  1RHP A;  1SJH D;  4QIW B;  1E0B A;  4MIU A;  1YNN D;  4KY7 A;  3VR6 A;  1KAA A;  3L3O C;  1EYD A;  1EYA A;  1TY0 A;  5EBD A;  3K5M A;  1XXG A;  2JA7 B;  5FLX L;  1NR2 A;  3QOJ A;  4CKB A;  4K6D A;  3NBI A;  3HGB A;  2M2L A;  2C9O A;  4ULL A;  3FPU B;  1V1P A;  2MP1 A;  2XNA C;  2RSN A;  3VA5 A;  3ONA B;  2HQE A;  3S16 B;  2BA1 A;  3H09 A;  3KUP A;  3EVQ A;  3M7N A;  4M1U B;  4KJO A;  2XRS D;  5C3E B;  2B2T A;  2R6G A;  4NKL A;  3SK5 A;  2EYL A;  3E0J A;  4IUU A;  2PPB C;  2PYK A;  2Z1C A;  3U9O A;  1STB A;  3A7L A;  3H94 A;  4I65 A;  1EU3 A;  2R3Z A;  2L0C A;  4KY5 A;  3OIQ A;  5C5L A;  2F0N A;  2MPM A;  3BYY B;  4IFD G;  2F1M A;  5LL6 X;  3TP8 A;  1TS4 A;  4K5X A;  3J7Y W;  4C1N K;  3S1R B;  1WTO A;  1RD9 D;  1KDB A;  3OSO A;  5HGT A;  3FDT A;  5K5P A;  1VCI A;  5J39 A;  3C2P A;  5A2Q L;  1SYG A;  5EKL A;  1VMC A;  4H0L C;  2A6H C;  1CA5 A;  3HOV B;  1Y8O B;  2B8G A;  2JA5 B;  3C46 A;  5JEA G;  2IW3 A;  2L12 A;  1HTP A;  2J0T D;  5JVG 3;  2QIL A;  5JJZ A;  2CW0 D;  1S5E D;  1A2T A;  1V43 A;  1KNE A;  3M4Y A;  2OT2 A;  2NVX B;  5D14 A;  3TP7 A;  3A8K E;  2B2V C;  2B2U A;  1ENA A;  2EYH A;  3CQZ B;  1EIG A;  3K7A B;  2SEB D;  1I4H A;  3NXW A;  1V8Q A;  5DAU A;  2F0U A;  1BDO A;  5D65 A;  3TZU A;  2WV6 D;  1F2L A;  1L0Y B;  2L4N A;  3D6W A;  2H4O A;  1JOK A;  3J80 L;  4DGZ A;  3R2T A;  1STN A;  2XRQ D;  5DM7 3;  3A56 A;  1LT6 D;  2PW7 A;  1PRT F;  4A3D B;  2X69 A;  4I7Z C;  4KI0 A;  4ME5 A;  4LAA A;  4FF2 A;  1E2Z A;  1Y8P B;  4PV1 C;  1SYF A;  3GTJ B;  3A55 A;  4FYD A;  3VA7 A;  1B50 A;  3ND8 A;  1MSG A;  1SSO A;  3NP8 A;  4HR7 B;  2WAC A;  4EQN A;  1EY5 A;  5A35 A;  4K8I A;  2KCN A;  2HDL A;  2L1B A;  1OXV A;  2PZW A;  4XXE A;  4DFA A;  3PIP 3;  4KY6 A;  3VR5 A;  1Q90 A;  3AU7 A;  3OMG A;  4RGT A;  2A68 D;  1ET6 A;  1CFM A;  1A2U A;  4DF7 A;  1J9O A;  1Q8I A;  3R3O A;  2V4D A;  3QB3 A;  2EY1 A;  3NWT A;  5M3M B;  2EJF C;  2HDM A;  1ZKO A;  1K8M A;  1X3Q A;  1W6K A;  2B2V A;  2E75 C;  4CJ0 B;  3H0G B;  2KHS A;  1UAP A;  5G3L D;  4C2M B;  5E3F A;  2NN6 H;  3NTH A;  1H9S B;  4ID6 A;  5JAV A;  3EQL C;  3T51 B;  2NN6 I;  1C48 A;  1AP0 A;  3HOX B;  3AMU A;  2Z4I A;  1LTA D;  1NR4 A;  1HHV A;  2SOB A;  1H9K A;  3OOC A;  1HFN A;  5C4X B;  1LT4 D;  2HCI A;  4ODG A;  4TKO B;  3T56 B;  1YNJ D;  3WDN A;  1CT1 D;  2JEA I;  2A5H A;  1II3 A;  3CRL C;  4RFB A;  3M7G A;  1EEF D;  2ZT9 C;  5K36 H;  2F0S A;  4RAU C;  1QCB D;  4K6L A;  3PV0 A;  2N88 A;  1ILP A;  3D6C A;  3SEB A;  3OPO A;  2RDH A;  1QOH A;  2XVS A;  1BNZ A;  1HQM C;  2OF1 A;  4DK1 A;  5BN4 A;  2HCC A;  2BE5 C;  2G9H D;  1JWM D;  1A6X A;  4NMZ A;  5DNF A;  4FXG C;  2MUY A;  1LAB A;  2K5Q A;  1KTK A;  1HTL D;  3H6M A;  2A69 C;  4XDX A;  3PUY A;  1A3T A;  2XWB B;  5I6Y A;  1JB3 A;  1C8C A;  2DNC A;  2BE5 D;  1SEB D;  2IPK D;  4IAL A;  1I6H B;  2A69 D;  1G29 1;  1EU4 A;  4NP5 A;  4EGV A;  2A73 B;  2JEB I;  3GTL B;  1KAB A;  3SK6 A;  1CK1 A;  1MBY A;  3GD7 A;  3TP6 A;  5CC4 A;  4TRD A;  4IUQ A;  4BBR B;  1PFM A;  1O7L A;  2VB3 X;  4C1N I;  4KKT A;  4X3K A;  5IT9 L;  1IYV A;  1DD2 A;  2NVQ B;  2JSO A;  1DJR D;  5EKK A;  5HUR A;  1SE4 A;  4BWG B;  4HED A;  1Y1V B;  1MI2 A;  1TQO A;  1TR5 A;  2K28 A;  1XX8 A;  2M9V A;  2EYO A;  3NQI A;  3DWA A;  1CHP D;  1HFG A;  4F87 A;  1UEA B;  2DN8 A;  5C0X H;  2QKI C;  2Z4H A;  1PRT B;  1IKL A;  1XTC D;  2IJ0 A;  5C0X I;  2PW5 A;  2OEO A;  5ISR A;  3GTG B;  4OL7 A;  1NUC A;  1VDZ A;  3GV6 A;  2A6E C;  2EJM A;  2AWO A;  1XYI A;  1ONL A;  1TS5 A;  4KHV A;  3PO2 B;  5TSS A;  1OXS C;  3A7A B;  3HOW B;  2JA6 B;  5KND A;  4V0B A;  3VR2 A;  1V1P B;  2BOS A;  3RLF A;  3NWS A;  3E6Z X;  3QWN A;  2WB1 B;  3DM1 A;  1KLU D;  1G6Z A;  2EVB A;  1A15 A;  1EIH A;  4Q5V A;  1PTO F;  2L11 A;  2R93 B;  3K0Y A;  1Q1B A;  2NUC A;  1C4Q A;  1B4O A;  1TVX A;  3G6J B;  1VF7 A;  2NWG A;  2XWJ B;  3MWY W;  2X6G A;  1ZYR D;  2WII B;  1HA5 A;  3S1M B;  3H91 A;  1EY9 A;  3S2D B;  1PFB A;  1RJT A;  1K83 B;  1MD2 D;  4KD4 A;  4KHZ A;  5CGK A;  4G7Z C;  3NTK A;  2K05 A;  1GUW A;  1GUO A;  2RDG A;  5CBA E;  1EZ8 A;  1FGB D;  5IIF A;  1JOO A;  3J7A V;  1SDF A;  1ET9 A;  1F9P A;  2O5I C;  3MC0 B;  4H13 C;  3WOE A;  4O1N A;  2L5T A;  1RKN A;  2ICI A;  1TWF B;  2KJX A;  3D4R A;  4G7H C;  1G2S A;  3MXG A;  2EYP A;  5DEH A;  1V1O A;  3Q22 A;  2EYF A;  1DOL A;  5IGD A;  3MA2 B;  1SNC A;  3GP7 A;  5C4Z A;  2KA7 A;  4KTA A;  4RGM A;  1D2B A;  5FOB B;  2LKV A;  1UUP A;  3HEJ A;  1D5Z C;  4ZKB B;  4DU9 A;  4TQU S;  3Q6S A;  4FP5 D;  1DON A;  1LTS D;  4L63 B;  3I90 A;  1LV9 A;  4PQX A;  4K5V A;  5NUC A;  5IGC A;  4RH6 A;  3DUZ A;  2B2U C;  1GXD C;  3PO3 B;  2IX3 A;  2EXZ A;  2SDF A;  3NE5 B;  2RSO A;  4XQJ A;  4JBW A;  3URY A;  4C3H B;  3GTP B;  3K59 A;  1Y1W B;  3S1Q B;  2BDO A;  1RDP D;  2M00 A;  2CQA A;  4H44 C;  4QMG A;  4CJ1 B;  3LWU A;  3DEO A;  4G4K A;  3PUW A;  1CQV A;  5IGF A;  1B1Z A;  1LTI D;  2E74 C;  2F0O A;  3KLS A;  5KNC A;  1FNU A;  3OIP A;  1BCP D;  4Z9C B;  3MAQ A;  3JAM E;  1HUM A;  3MXP A;  2Q8T A;  4DAV A;  4J6H A;  2RKS A;  3A54 A;  2KQ3 A;  2XSC A;  2Z8L A;  3TSS A;  4YIJ A;  1JR0 D;  1EZ6 A;  2O5J C;  5E1F A;  2EY5 A;  1PDQ A;  4DA2 A;  5ELB A;  2E2H B;  4HMI A;  3CHB D;  1MGS A;  1RTO A;  3I3C A;  3J7A F;  2CW0 C;  2WAQ B;  3ERO A;  3MFY A;  1X3P A;  4DN4 M;  3BVM A;  2EE1 A;  4OHJ A;  4IQZ A;  3FMC A;  3GQB A;  1SBB B;  1ZXT A;  2H1E A;  5FLX E;  2PZU A;  4FF1 A;  2ENB A;  4XT1 B;  4PNY A;  2VB2 X;  1KDA A;  4RKL A;  1SMY D;  1I4R A;  5CV6 A;  1ML0 D;  3L7Z C;  3SK4 A;  4PMB A;  2RVL A;  1WD1 A;  4HSV A;  3DHQ A;  2VUM B;  1PTO B;  4BS9 A;  5M5Y B;  3DXJ C;  3QOL A;  1CM9 A;  1SXT A;  1U9R A;  3FVQ A;  3BYT B;  4JK1 C;  3L9A X;  3BG3 A;  5ELF A;  2OXP A;  4H7B A;  4KMU C;  4C3I B;  1B44 D;  1E2V A;  2F0L A;  1O7Z A;  1EY6 A;  2F0G A;  1WTQ A;  2EZV A;  2VXW A;  3M4O B;  1S5B D;  3CRK C;  3R8B A;  2YYZ A;  2JP1 A;  4X3S A;  2KED A;  1QIL A;  4LJZ C;  5IGG A;  2E2J B;  4BA2 I;  1T5X D;  1STE A;  3TME A;  1SE2 A;  1ESR A;  1U4L A;  3D3R A;  4S3S A;  4KK7 A;  5A2Q E;  3C1E A;  1NAP A;  4IUT A;  2A68 C;  5CV4 A;  3IL8 A;  4C3H G;  3KBX A;  3OHX C;  2R7Z B;  1JWU D;  3AB9 A;  1IW7 D;  3P7J A;  3GTO B;  3QO2 A;  3K5L A;  2HUG A;  1SYB A;  3S14 B;  1EQT A;  4X3U A;  2F0E A;  3NSW A;  1SYE A;  3MFG A;  4ILW A;  4RGO S;  4HTH A;  4IUN A;  3GO5 A;  3PIO 3;  4FVM A;  1EWC A;  1PXU A;  2RBM A;  3IFT A;  3BS1 A;  1H9J A;  1SND A;  3SDZ A;  2X6L A;  1I4G A;  4BBS B;  3J81 L;  4B9W A;  2MGS A;  4N9P A;  1IHZ A;  5KNB A;  2EY2 A;  2K04 A;  1O78 A;  1YNJ C;  1S5D D;  1VMP A;  5C0X J;  1TT2 A;  1QWY A;  4OO1 H;  2G9D A;  1R4P B;  4OO1 I;  1TII D;  1A3V A;  3S17 B;  4R8N A;  2FJ2 A;  1DYQ A;  1TY2 A;  3VR3 A;  5ELD A;  3WOF A;  5KIX A;  4WRD A;  3FPP A;  3K5O A;  3SHL A;  1TWC B;  1GJX A;  5EKI A;  2JYO A;  2QCP X;  1JOQ A;  3BDO A;  4CJ2 C;  2J7Z A;  2R92 B;  2DNE A;  2D5D A;  1F2Y A;  4A3G B;  5M5W B;  3IAY A;  2IT1 A;  4IZ8 A;  2K32 A;  2K7V A;  2R61 A;  1HUN A;  2F0K A;  5KYL A;  2J4X A;  2F0H A;  2E2D C;  3BZD B;  1OXT A;  2EY6 A;  3P1H A;  1EY8 A;  4DXF A;  2EYJ A;  3ERQ A;  2WKC A;  3LNN A;  3VYS A;  3HOY B;  3EA6 A;  4C3I G;  1DOK A;  1ESF A;  2WP8 J;  1EFI D;  1EL0 A;  4LMQ D;  3MEH A;  3VR4 A;  3NTI A;  2F0I A;  2BA0 A;  1M8A A;  5IGB A;  3D4D A;  4ZAI A;  1SYC A;  5IGE A;  2B2W C;  4CKE A;  4BY7 B;  3G7L A;  1STH A;  1DOM A;  1EY7 A;  5I2X A;  4KKU A;  3VYT A;  3UI2 A;  4MN3 A;  4A93 B;  3KF8 A;  5IOC A;  3KK7 A;  1BBX C;  4X3T A;  2EDG A;  5ELC A;  5IOD A;  3OMC A;  2NB0 A;  3SK8 A;  1WTR A;  5T1I A;  1U4M A;  1BOS A;  1GOZ A;  1OXX K;  1QB5 D;  2SNS A;  3S9W A;  4J1M A;  1PLF A;  4PMC A;  2NN6 G;  1PZK D;  1G2T A;  3M85 A;  2AUK A;  2F0D A;  2AQ2 B;  4K2K A;  2MJ8 A;  1IKM A;  2KUM A;  3KBG A;  1CA6 A;  3NUC A;  3W3A A;  4Y7N B;  1SNQ A;  4K14 A;  2LFN A;  1QNU A;  1EY0 A;  4XT3 B;  1TWG B;  4ZQ3 A;  1JQY D;  5K36 G;  2AWN A;  1WTW A;  2JXM B;  4HSP A;  4R8I A;  4KV6 A;  4ZUJ A;  1CZG A;  2I07 B;  2IX0 A;  5I2Y A;  1GHJ A;  5EQ0 A;  3FKI B;  1VF5 C;  5EGT A;  4KJN A;  5J1Z A;  3BDC A;  5EPL A;  1DCZ A;  1GUT A;  2NBF A;  3BVZ A;  1UNS A;  1LTB D;  2KOL A;  2ZXP A;  1RCV D;  5FO7 B;  3QIA A;  1B53 A;  1ZYR C;  3T4A C;  1PRT C;  2B2W A;  3V05 A;  3HZX A;  1KLG D;  5LHY 1;  2F3V A;  1WTV A;  5IT9 E;  4HCE A;  2MHV A;  3P20 A;  1S5C D;  2Y0S B;  1PRT D;  4B08 A;  3I73 A;  3K58 A;  1U4P A;  4FO2 A;  4RCO A;  1AN8 A;  2O2L D;  2LMC B;  1D1K A;  5I9O A;  1Z7T A;  2F03 A;  2NTT A;  1JC7 A;  4CBV A;  1O80 A;  1BQQ T;  1SAP A;  3RD4 A;  3NHH A;  3KLS X;  1LT3 D;  2D62 A;  3NQT A;  3HKZ B;  5I6W A;  4A3I B;  1ILQ A;  2BCO A;  1F77 A;  3R2I A;  5C3W A;  3SXH A;  4AYB B;  5G3L F;  5FO9 B;  1EOT A;  5CR3 A;  4IFD H;  5C3X A;  5DM6 3;  2LS0 1;  4IFD I;  4OGQ C;  4EQP A;  1TWH B;  3JAM L;  5C0X G;  3MZ5 A;  2PCF B;  4QCL A;  2E2I B;  3V96 A;  3ZYY X;  1A3U A;  1SNM A;  3RZD B;  3H3V C;  3R93 A;  1ENC A;  4EQO A;  3DMU A;  5JEA H;  3ITP A;  4WFN 3;  4L8J A;  4BA1 I;  1K8O A;  1HPC A;  1F9Q A;  4R9W A;  1B9M A;  1LTR D;  3PUZ A;  5I4D A;  5F2D A;  3U9S A;  1G91 A;  5M3F B;  1STG A;  2K6A A;  3LX0 A;  2PZT A;  3KLR A;  4RHR A;  3NK9 A;  5EBC A;  3MVV A;  3ND9 A;  4A3K B;  5BN5 A;  1TKW B;  1BCP C;  1EEI D;  3W2D A;  1CQF A;  3MTS A;  3DEP A;  2FMM A;  3I4N B;  1F2Z A;  4IN3 A;  1CHQ D;  1J8I A;  4LK1 C;  3PMF A;  4CHT B;  4A3E B;  2B39 A;  1DXM A;  1NSN S;  1HRJ A;  3N6R A;  3Q24 A;  2K5W A;  3E5S A;  2ZXR A;  3TDQ A;  2ICE C;  1BF4 A;  1B3A A;  4FXD A;  4KN7 C;  3IFD A;  1IYU A;  1SE3 A;  4CGY B;  1OXU A;  4F88 A;  2NVY B;  1RF2 D;  3SVM A;  3F2U A;  5C4J B;  4HN7 A;  4DNT B;  1EYC A;  3VYU A;  1XWE A;  2F0T A;  2F0J A;  1LAC A;  4L6T B;  1FR3 A;  2FHT A;  1IL8 A;  2PQE A;  2NVT B;  2K01 A;  1SMY C;  2WIN B;  2F4I A;  4FF4 A;  1EWH A;  1BXT A;  3GTM B;  4XYO A;  4ABN A;  5ELE A;  1B9N A;  3QJY A;  3RMH A;  5C44 B;  2Q8R E;  5J22 A;  1SYD A;  4DNR B;  2F0W A;  2D2C C;  2A6H D;  3I4L A;  3EFX D;  2AQ3 B;  5C4H A;  4XYQ A;  1TU2 B;  1WTX A;  1F2M A;  5FK9 C;  1AEX A;  3TP5 A;  5BN3 A;  1JCK B;  2KCC A;  1PYW D;  1ZEQ X;  2IL8 A;  2CVR A;  2F0V A;  4HAE A;  2PNR C;  1TS3 A;  2BDN A;  4DAP A;  3D8G A;  5EPK A;  5D3I B;  4RCN A;  3GV3 A;  4K5W A;  2I46 A;  5C6A A;  4V19 0;  4HCS A;  1PTO C;  2EJG C;  2KVM A;  4F7X A;  5C5M A;  3BVG A;  1D6E C;  4E6I A;  5D3D A;  1FNV A;  1L0X B;  2O4X A;  1IW7 C;  1STA A;  1SJE D;  5EJW A;  1PTO H;  4P2C B;  3I72 A;  1PFN A;  1PTO D;  1MSH A;  3SE0 A;  5COR A;  3I4M B;  3PUX A;  1S5F D;  4F8M A;  4DXG A;  4ZRZ A;  3HS0 C;  3OWE B;  4KD3 A;  2F0Q A;  2N55 A;  1WD0 A;  4UDU C;  2A74 C;  2GA4 B;  3HP3 A;  5JPM C;  3S1N B;  1LTG D;  1LT5 D;  5EPJ A;  5FKA C;  4WJW A;  4PMW A;  1I6V C;  2B8F A;  3TZD A;  1EQV A;  2XN9 C;  2DY7 A;  1JIC A;  4ZLT F;  5KGU A;  2ZXO A;  1PMR A;  5CV7 A;  4OIJ A;  3MXU A;  1DM0 B;  4C3J B;  3BDL A;  3M3Y B;  1RTN A;  1I4Q A;  1TS2 A;  3GTQ B;  3DWP A;  2EPB A;  2FMC A;  3C1F A;  4ZYS A;  4ZKC B;  1AW7 A;  1GUG A;  1I4X A;  5AFW A;  4MHE A;  3J80 E;  3D4W A;  2Q8I B;  3MXN A;  1SFO B;  2B2Y C;  1JWS D;  2F0P A;  5CV9 A;  1Q1E A;  1AZQ A;  4FXK C;  3P75 A;  4XIG S;  4A3B B;  3GTK B;  4RHS A;  2FIN B;  3FEW X;  5I9P A;  3RUZ A;  2VNU D;  3I8Z A;  4RWS C;  4DAY A;  3N52 A;  1STY A;  1ROD A;  1F9S A;  3MHB A;  4QF4 A;  1WTP A;  4A3J B;  2IX1 A;  3A8J E;  5FO8 B;  2XIW A;  1M4V A;  3X3N A;  4K8J A;  2EYM A;  2EOT A;  2TSS A;  4XTC S;  1D1I A;  1WCM B;  4U67 3;  1QJO A;  1JOR A;  1BCP F;  5CV5 A;  2LY7 A;  2F3W A;  3CKI B;  3X3M A;  2L55 A;  2QEJ C;  5M5X B;  3CU7 A;  3T53 B;  1OO9 B;  4J8Q A;  4K2L A;  3FRP B;  4DK0 A;  1E2W A;  2D9U A;  1HCZ A;  2K5D A;  3NBH A;  3V2T A;  3I91 A;  4M8A A;  4RGN A;  1W6J A;  3DWQ A;  5KEE A;  1S4Z A;  3J81 E;  1D5M C;  3HG9 A;  1I4P A;  1QG7 A;  1R4Q B;  2PMZ B;  2ID0 A;  1HQR D;  1I50 B;  1G8Z D;  1ICW A;  3PUV A;  2FFK B;  3HOU B;  1EY4 A;  4IFD J;  2F0F A;  3S15 B;  3K5N A;  5CYU A;  2B2Y A;  4A3F B;  4QUF A;  2IWH A;  1NCV A;  1TWA B;  4OO1 G;  3A8I E;  2AQ1 B;  2JA8 B;  4U68 A;  5CV8 A;  3HOZ B;  4FNF A;  1GUN A;  1H9M A;  4IUP A;  1HXY D;  2KEC A;  2RDF A;  1FYC A;  5JEA J;  1CTM A;  3Q0A A;  1WVL A;  4WOR A;  4A3M B;  4GZY C;  4KKS A;  5COY A;  2TMP A;  4QB4 A;  1H9S A;  1Q12 A;  1DZ1 A;  2K1B A;  2QDB A;  4C3J G;  1I3Q B;  2RQX A;  1LTT D;  4N9T A;  4G57 A;  3S2H B;  2NZ1 D;  1O7Y A;  5JOB A;  3OWF A;  4IUR A;  1LLR D;  2QF7 A;  4O42 A;  3TBI B;  1AZP A;  2SNM A;  4IUV A;  2DY8 A;  2K03 A;  1Z47 A;  1BR9 A;  3LWE A;  4RA8 A;  5LL6 S;  3C3L A;  1KNA A;  4QUC A;  4CKC A;  5M9O A;  1B2T A;  2RA4 A;  2NTS A;  1SNO A;  2CHB D;  5CBE E;  5T1G A;  3SR1 A;  1R9T B;  4Q0F A;  1ENF A;  2A6E D;  1T5E A;  2WKD A;  3QG1 A;  2NYZ D;  1BUV T;  4B9X A;  1U4R A;  3NPP A;  1H9R A;  5JPN C;  1QNK A;  3T13 A;  1Z6H A;  1KDC A;  3IKJ A;  5KRU A;  2AUJ D;  3OW7 A;  4C56 C;  1JE4 A;  1Y69 U;  4EVO A;  1PZI D;  2E76 C;  5CMD A;  1Y8N B;  1AFP A;  2KEE A;  3K57 A;  4NW2 A;  2YU9 B;  5JVH 3;  1GUS A;  3D31 A;  4OIK A;  1CZW A;  2B2T C;  1BO0 A;  2JE6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...