5CGKA

Crystal structure of staphylococcal nuclease variant delta+phs v66d/n100e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMDENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVEEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66D/N100E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cgkA00
3MZ5A 4K14A 1SNMA 4R8NA 4B9WA 5IGEA 3HZXA 4PMCA 3D8GA 2RBMA 1STAA 4KV6A 4OL7A 2PZUA 5C4ZA 5KYLA 4WORA 2PZTA 3RUZA 1A3VA 2F3WA 2PZWA 3NXWA 2EYOA 1EZ8A 3TP8A 4HMIA 1EY5A 4E6IA 1NSNS 1A3UA 2SNSA 1TR5A 1SYBA 3T13A 4DF7A 4EQOA 4KY7A 1EY6A 2F0FA 3V2TA 5C3WA 3EVQA 4S3SA 1KDBA 1SNPA 2EYHA 2LKVA 2O4XA 3SK4A 2F0NA 5C3XA 5KIXA 1KABA 2EYJA 1A2TA 3NUCA 1SYFA 4KJNA 2EXZA 5C5MA 1EY7A 4ZUIA 3OSOA 2F0QA 4K5WA 4K2LA 4KTAA 3DMUA 4ZQ3A 2M00A 1NUCA 2EYFA 2ENBA 5IGDA 1SNCA 3S9WA 2F0SA 2KQ3A 2F0PA 2PQEA 3ERQA 4H7BA 2F0DA 4IZ8A 3U9OA 5IGGA 4K2KA 4I65A 3NHHA 1RKNA 2F0HA 1EY9A 2RKSA 5CR3A 5IODA 5CV4A 5IGFA 4EQNA 5ISRA 1EQVA 4LAAA 1JORA 3EROA 1STNA 3D4WA 2WACA 2OF1A 4TRDA 1A2UA 4NDXA 3TP5A 3QB3A 1A3TA 3TP7A 4DGZA 2OXPA 4B9XA 2EY1A 4QF4A 5KGUA 4IUNA 3P1HA 1JOQA 2F0OA 1KDCA 2NUCA 3SXHA 3OWFA 4EQPA 5K5PA 3TP6A 2SOBA 1SNDA 4G57A 1F2YA 1ENCA 2F3VA 4N9TA 1JOKA 4K5XA 4K6DA 2HQEA 1JOOA 4K8JA 1SNOA 1STGA 1F2ZA 2EYMA 2F0GA 4K8IA 1STBA 4QMGA 2F0WA 1STYA 3VA5A 5EKLA 3BDLA 5I9PA 5CV6A 2KHSA 5IIFA 3D6CA 2PW5A 4RKBA 5HURA 4ZUJA 5I6WA 1SYDA 2OEOA 3NK9A 4ME5A 5C5LA 3LX0A 4NP5A 5I6YA 3T16A 3H6MA 4F7XA 3SHLA 3C1EA 3BDCA 4KY5A 5JAVA 3HEJA 3NQTA 2F0IA 5IGCA 5KRUA 2QDBA 1EZ6A 1SYCA 1AEXA 2PW7A 4KJOA 4KY6A 4PNYA 2F0VA 5EGTA 2F0KA 5NUCA 5I9OA 5M9OA 3D4DA 1SNQA 2F0EA 3EJIA 1STHA 3E5SA 1TT2A 4KD3A 1EY8A 2F0LA 3NP8A 4F8MA 5J1ZA 4HTHA 2EYPA 4WRDA 3QOLA 5CV9A 3SK8A 1U9RA 4DFAA 1II3A 3SK6A 5EKKA 5KEEA 1ENAA 4KHVA 4ID6A 3SR1A 4KD4A 1SYGA 3MEHA 1EYCA 4RKLA 1KAAA 5CV5A 1EYAA 5DAUA 1IHZA 4NKLA 1EY4A 5F2DA 5CC4A 5HGTA 5JOBA 1EY0A 1KDAA 4K5VA 3DHQA 5C6AA 2EY5A 4J6HA 3TMEA 3PMFA 4HMJA 4ODGA 3MVVA 5IGBA 2PYKA 3SK5A 5DEHA 1SYEA 4NMZA 1EYDA 5CV8A 3QOJA 3ITPA 2EY2A 4IALA 4YIJA 3OMGA 5J39A 4EVOA 3MXPA 5KYIA 5E1FA 5CGKA 2F0MA 4J1MA 1TQOA 1F2MA 2F0UA 2F0TA 2F0JA 2RDFA 3C1FA 3MHBA 4QB4A 4DU9A 4PMBA 5E3FA 5C4HA 4MIUA 2EY6A 2EYLA 3P75A 4N9PA 5IOCA 5CV7A 5J22A 2SNMA 3OMCA 3R3OA
chains in the Genus database with same CATH superfamily
3MZ5A 2DY7A 1KAWA 3F2CA 2Z6BA 1SDFA 1S4ZA 1TWHH 3KF6B 4BY1G 1A3VA 3S1MH 5C4JB 1EZ8A 4KK7A 2LFNA 4ABNA 3I4NB 5C0XH 3CPWA 1PV4A 1A3UA 1JWSD 1EY6A 1HTLD 1L1OB 1K8MA 2H1EA 2LKVA 3J7AV 4RCOA 2K7VA 1K73C 1A2TA 4CJ0B 4HSPA 3OSOA 2F0QA 2FINB 4ZQ3A 5IT9c 2EXDA 4B3SL 2Z8LA 2F0PA 4NW2A 5T1GA 3K7AH 3U9OA 2UXCQ 4RWSC 5IODA 3N6RA 2FMMA 1PTOD 1LABA 3HOUH 1WJJA 4U68A 3I3CA 2JA7B 3U9SA 1VQDA 5CBEE 3G71A 4OHJA 2OCEA 5ELOA 2ASBA 2JN4A 1IBKL 1VQKA 2KENA 4G57A 3UDXA 3H0GB 1SLJA 1ET6A 1JT8A 1CZWA 2K1BA 2X69A 1STYA 1MKHA 3BDLA 1SJED 3NQIA 2F4VL 4KMUC 3NK9A 1SBBB 4R4QA 3S1NB 2R7DA 4A3DB 1F77A 4GN3B 2J7ZA 4KY5A 1L0XB 3OTOQ 4JPBW 3TBIB 2XVSA 3S14B 2HDMA 1I94Q 3UDFA 4DV3L 1SN8A 3CAMA 4YWLA 3TDQA 2BH8A 3QOLA 2IL8A 2G9DA 3SR1A 2A6HC 3A8IE 3K5MA 1GXDC 4LF7Q 3LNNA 2LMCB 1VS0A 4J6HA 2AUKA 1K0RA 2LSSA 4DR3Q 4DUZQ 3I70A 1EIFA 1LT3D 4IUQA 3JAMi 2EY2A 3TREA 1Q86C 4HN7A 1JMCA 1Y1WG 2MHVA 3J7ZC 3CXCA 1ENFA 2PMZB 2EY6A 2EYLA 2NB0A 1DZ1A 1IYUA 2M9VA 4CBVA 4K14A 1BCPF 1PTOF 4DNIA 5CMDA 4J8QA 2XN9C 2H5XA 1S5BD 2RBMA 5C3EH 2KUMA 5FO8B 3RUZA 1GD7A 1PFSA 2I0QA 4CDFC 2R93G 1RCVD 1VCIA 3VYTA 1EEFD 1NSNS 2Y0SG 4IFDI 1XNQL 2B2VC 1EQTA 5M5XH 1WTWA 4QUCA 4JVZA 2EYHA 4UAIA 3S2DB 1G291 3H94A 4IFDG 4I7ZC 4A4IA 4GZYC 4ZUIA 3U4ZA 3DM3A 2Q8RE 4DAYB 2K14A 1EU4A 3GTQB 2PQEA 3CCEA 5CR3A 1EY9A 3B6YA 5KNBA 1PH3A 4JBMA 3GTOB 3PO3H 5IYDG 2WACA 1IBKQ 1J6QA 4ZCKA 1QUQA 3HOVG 4B9XA 3LWUA 4IUNA 1R9TB 2N3SA 1X3EA 3P1HA 1L2FA 1YNXA 1CZGA 3OWFA 1MBYA 3NPPA 1SNDA 2J0TD 3Q24A 1PRTD 2F3VA 1TS2A 1KHIA 2ICIA 1B53A 1TWGB 2JYOA 2CQAA 1X6OA 2F4VQ 2IY5B 1BKBA 4RG1A 1YI2A 1G51A 4C3JG 4POGA 1O80A 5BR8L 1QVFA 1OXSC 2JP1A 2HDLA 3HOZH 3S17B 2RHSB 2MJ8A 2GVBA 1VQ7A 1KRTA 5IWAL 2E2DC 1CSPA 3W1BA 1T5EA 5I6YA 3ICEA 3MWYW 1PYBA 1ASYA 3SVMA 1PLFA 1V1OA 1U4PA 1V1PB 1IKMA 1GUTA 3S2HB 3PCOB 3A7LA 2FJ2A 1S5FD 2N88A 1Q46A 1EY8A 3I4OA 4HTHA 3TN2A 3HOWG 5ELEA 2AMCB 3SK6A 4ZK9B 1Z9FA 1RF2D 4TSSA 3CCUA 1E2VA 4X64L 2CKZB 3C3LA 2UUBL 3HRZC 4LUOA 1GUOA 5C44G 4IQZA 1YVCA 3OIQA 4A3MH 1Q1BA 2QA4A 1MSGA 2F0UA 1YNND 4F88A 4LF5Q 3IRBA 1RL2A 3OIPA 1VQPA 3HKZE 4PZ6A 4GKKL 4R4CA 2CW0C 3KFUA 1LT5D 3R3OA 4O1NA 3NTIA 5C4ZA 1JCKB 1A8VA 1STAA 2E8GA 1EQRA 1XNQQ 3RN5A 1KD1C 5EQ0A 3KF6A 2KVMA 2YV5A 4P72A 3MFYA 4MTKA 3J7A5 2LS01 3DLLA 1XJVA 4GNXB 1JR0D 3V96A 4Y7NH 2EOTA 3M4OB 2E75C 4XYQA 4BBSB 1L1OA 2K4KA 1KIXA 4KJNA 4OWTB 1BF4A 1XPOA 5EAYA 4ZKBB 1LV9A 3KJOA 2KQ3A 4C3HG 2F0DA 3GQBA 1HZCA 1CHQD 5IYBG 4I65A 4B3TL 4KKSA 2RKSA 4LMQD 1J5EQ 2OF1A 1A2UA 1CQFA 2F1MA 1UE7A 4O2DA 1FNUA 4AQYL 3S1QB 1VQJA 1NCVA 3A8JE 2WP8J 2QF7A 3GTMB 1E2ZA 4OO1I 1C7YA 3PO2B 1E24A 5E4XA 2KOLA 3AYHB 2N8NA 2L12A 5BR8Q 3DXJC 1VQCA 3HOYG 2EYMA 2E2IB 4OO1G 5A35A 3GTKB 2WKCA 5I6WA 4FF1A 5JEAJ 5C5LA 2NVYB 3WWVA 1D5ZC 4HJ8A 5M5YH 1Y8PB 2QDBA 4KY6A 2ZJRA 3NENA 3E5SA 4P74A 1HPCA 2D62A 3NBIA 4R4IA 2UUBQ 3CRLC 4QQBX 4FNFA 2JA6H 4X62Q 5LL6X 1EY0A 2MNAA 3GD7A 4HMJA 3RZOB 4YCUA 2DNCA 1KTKA 3VDYA 1J9OA 3MXPA 3NELA 1MI2A 1N33L 5CGKA 3Q22A 4LF8L 3MHBA 5HGTA 5BN5A 4RHSA 1U4RA 4JK1C 5ELDA 2WIIB 1Q1EA 3U58A 4XXEA 2VW9A 3FKIG 3HZXA 3E0EA 1PRTB 3CCVA 1VDZA 2IT1A 2F3WA 4BXXG 2PZWA 1IYVA 4XTCS 3HFZB 2XTIA 3KBGA 1M4VA 4JI8L 1LUZA 1K8GA 4KY7A 4I7AA 1HCZA 2UUAL 2B63B 1QNUA 1X3GA 4JI5L 4DV5Q 1KDBA 3VR4A 4DAVA 1LTAD 4DR2Q 2PI2E 3HP3A 3S24A 5EJWA 1YHQA 2SEBD 4A3EH 2K03A 1YIJA 3MXUA 1IW7D 3PUVA 3J80i 4CHTB 1NAPA 2K5NA 5AJ3L 4JBWA 4AQYQ 2A69C 1XX8A 3HKZB 4DK6C 3CQZB 3AFQA 5M3MG 2NN6I 4A3FB 2A6ED 5FKAC 4ULLA 3I2ZA 4X66L 3QB3A 1A3TA 3E9IA 2A68D 2KHIA 2NN6G 1O7ZA 3DEPA 3W5OA 3HS0C 4B3ML 3S15H 2JEAI 4A3BG 3C2PA 4A3JB 3J81E 4C3IB 1STBA 5I9PA 1A62A 3VA5A 3BJUA 1HNXL 5IY0A 1WYDA 1VQLA 3NWSA 3PF5A 2R92H 3E6ZX 5ELFA 3R93A 2FHTA 4BY1H 5M3FB 1DXMA 2ZTEA 3H91A 4ME5A 4GLVB 4HIOA 1YJ9A 4OIJA 3A0JA 1HR0W 4NP5A 1JJCB 1YJWA 2NVXH 2Z0SA 1I4XA 2F0VA 1SNQA 1V1PA 4QGUA 2I5HA 3I4MB 3UI2A 1FNVA 1TWHB 1CKMA 1VQ8A 1GUGA 5CV9A 3S1MB 3CKIB 2R7ZG 3M7NA 1K0SA 4WJ3M 5G3LD 1N33Q 1BBWA 4NMZA 1EYDA 4GN4B 1BUVT 5KYIA 1B44D 1TQOA 2C35B 1YBYA 1CFMA 5J22A 1IBML 3K7AB 3A54A 3H0GG 4R4TA 2KJXA 1BBUA 1QOHA 1AZQA 3GTGH 3T1YQ 4YCWA 3G48A 4BY7G 4ME3A 4JI8Q 1KXLA 4GS3A 1NMGA 4JI5Q 1Z7TA 5IYCG 1TR5A 3GV3A 3EIVA 1JWUD 3L2PA 4BBRB 4CJ2C 1HXYD 4UP8A 1WVLA 1NJIC 4CDDC 4GNXA 2K5VA 1YNJD 1EIYB 1DGSA 2R7FA 1F9RA 4DR7L 3BZKA 3VR2A 2VUMB 4G7ZC 4CKCA 1Q90A 1JB3A 3JAMc 4B3RL 5D14A 2LY7A 4H02A 1Y8OB 3QIAA 4B3MQ 3TP7A 5KGUA 1SE8A 3BG3A 4HIDA 2Z6KA 3T1HL 4UPAA 5EPLA 5ELNA 1LT6D 1Y1WH 1G8ZD 3C46A 1T9HA 4JI0L 1WOCA 4K5XA 3S16H 1E2WA 2I07B 4OGQC 1C48A 1HZAA 4ZAIA 3BYTB 2PW5A 4IPGA 3LX0A 4TKOB 3DWQA 2UXCL 2R93H 3K0XA 3SHLA 4HIMA 4LK1C 3HEJA 3NQTA 3KLSA 4NB3A 3TEHB 5IGCA 2PW7A 3W3AA 2JXMB 3KF8B 1E3PA 3I7FA 5C3EB 3GO5A 2VXWA 2JK8A 2KA7A 3G4SA 4IN3A 4L6TB 4IFDH 2B2UC 3W1GA 3LWEA 1HNWL 3PUYA 1GUNA 1U5KA 2L15A 2OQKA 3MEHA 4XQJA 2VQEL 2NVQB 2V4DA 3RMHA 4Y52H 3RNUA 3DHQA 3CF5A 2B8GA 2N78A 1O78A 5M5XB 3K0YA 3NE5B 2B8FA 5DNFA 1EYGA 3I55A 1VQ5A 1H9JA 4BA2I 2F3IA 2DNEA 2PYKA 2OTJA 5DEHA 1UAPA 1EU3A 4IUVA 1VQFA 2CWPA 3QWNA 1LLRD 4C2MB 3HOVH 3AU7A 4JOIC 1WTOA 3P75A 3BVZA 5CV7A 2HIVA 3L9AX 3OTOL 4JC0A 3H3VI 1QCBD 1E1TA 3EBEA 3T53B 1I94L 2Q2HA 2HIXA 3OYYA 4X3TA 2EYOA 2B2YC 3K58A 4JV5L 4FYDA 2SNSA 3T13A 1SYBA 3ZYYX 3PIO3 4LF7L 4F87A 1SJHD 3V2TA 4XT1B 1BBXC 1GKHA 4DR7Q 2RDGA 4DR3L 5C3XA 3RZDH 4B3RQ 1RTNA 1JE4A 4K2LA 2B2TA 1ICFB 3DMUA 3RLFA 1Y1VG 1EFID 3S9WA 1M1KC 3LGJA 3I56A 2E2JH 2NWGA 3IL8A 1S5DD 3TZDA 2IX1A 5C44H 4DV4L 5ELBA 3CCLA 3T1HQ 1UE5A 1HR0L 1VF7A 4DGZA 4JI0Q 5FLXE 2F0OA 2X6LA 3TP6A 2K50A 4DR4L 3M7GA 1SNOA 4DPGA 4U673 2D0OA 3KLSX 1BCPC 1ESFA 1PTOC 3CRKC 4JBKA 1GHKA 1IYJB 2NTSA 2N55A 2H4OA 2NZ1D 2HHHL 1E22A 3C1EA 1TS3A 4FXDA 1SYCA 1KLGD 1WCMB 4LF4Q 3MAQA 1HNWQ 3D4DA 3P7JA 3EJIA 4KD3A 4BBSG 2PPBC 4OONA 2VQEQ 3D31A 3ERSX 1IBLL 3AMUA 5GAHC 4OELB 1JJ2A 4GOPC 1U9RA 4LFAQ 4LW1A 1IHZA 1ZXTA 3I90A 3S1RB 1DOLA 4QUFA 1KQSA 2GN5A 4IJLA 1G2SA 5IYBH 1EWHA 4DR1Q 3CPFA 1V1QA 2ZT9C 5K36G 5A2QE 2CVRA 5CBAE 2NYZD 1QB5D 1Q3LA 4JYAL 1BVSA 1D6EC 2JQOA 1J8IA 1EL0A 3MC0B 4RGMA 3PO2G 2SNMA 4Q5VA 1HFNA 2VL6A 4YHHL 4LWCA 2ZXRA 1B7YB 1F9QA 3D8GA 3D0FA 1EQQA 4JV5Q 3H09A 1PXUA 3MFGA 3TRZA 3HOYH 1N34Q 1UEAB 1H95A 4OO1H 1X3QA 2NBFA 3TP8A 4HMIA 3GTJH 2IPKD 3RLNA 4FO2A 4LFBL 1VQBA 1JICA 3VR6A 3J7YW 3PIOA 1RD9D 2OQ0A 2Z4IA 4A3IH 1O7IA 1XMQQ 3GTPB 5FJ8G 2L9HA 4IOAA 1S5ED 4NXNL 1PYWD 4A3CG 3DWPA 3PUZA 4EX5A 2CH4W 3Q0AA 1LTRD 4LF5L 1XPUA 1SE3A 2A6HD 4Q0FA 4DV4Q 1HR0Q 3BU2A 1TWAH 2E5LQ 5M5YB 4LJZC 4NDXA 1AW7A 1BQQT 2JA8H 5COYA 4CDCC 1EIHA 1SR3A 2CWAA 1CUKA 4DR4Q 5EBCA 1E7ZA 1K83H 1LYLA 3SEBA 3FHWA 4UY8C 4CGYB 3ULLA 1ENCA 1P16A 1BOSA 2L1BA 1F2ZA 1TS5A 4L5TA 1VQAA 1VQ6A 1B70B 5EKLA 3DWAA 5CV6A 2NZOA 2A73B 5E7NA 2HHHQ 5HURA 3NSWA 1X56A 4BXXH 2Z4HA 4IURA 4YWKA 2PI2A 1XMOL 1CA6A 1A6XA 2VB3X 2RSNA 1IBLQ 1LT4D 2CFMA 2K5WA 1WFQA 4N8X1 1J5EL 1DOMA 4C56C 3J80c 1GO3E 2CCZA 1TT2A 5J1ZA 3ND9A 3KF8A 5FLXL 4PQXA 4A3GG 1K8OA 2AQ3B 3DUZA 4RKLA 1KAAA 4NKLA 1EY4A 1C4QA 1KDAA 2BH2A 3HKZG 3PMFA 4A3KB 4LNQA 1SFOH 1QWYA 4JYAQ 3K5LA 1SYEA 3GTLH 3QOJA 4YIJA 5M3MH 1GHJA 2AWNA 3DM1A 4QB4A 4YHHQ 1AZPA 5E3FA 4A3EB 2NN6H 2PNHA 3WOFA 3PV0A 3CD6A 1NBWA 4R8NA 4B9WA 1S5CD 2B3GA 2ZTCA 4UHVA 3F1ZA 4A3BH 2BA1A 2PZUA 3ND8A 1I6HH 4LFBQ 4IPCA 2YU9B 1SE2A 3BVMA 4YY3Q 5M3FG 4X62L 1QE6A 5L37A 2GVAA 4HJ7A 1LTBD 2HQLA 4NXNQ 5FO7B 4DR5Q 2F0FA 5KNCA 1FJGQ 1TWCH 5A2QL 1MSHA 4G4KA 4JI6Q 2K32A 3NUCA 3I4MG 4L63B 3WOEA 1XXGA 2RDHA 4LF9Q 5I4DA 2R92B 2JSOA 4RH6A 1G91A 4BY1B 2Q2TA 1GM5A 4WJ4A 1Q82C 2R7ZH 1TVXA 2HD3A 4DAPA 5IP7H 2NVXB 1X32A 2WINB 4M8AA 2K01A 5ELCA 1PRTF 2IX3A 3J7AF 1Y14B 2I46A 4EGVA 4L8JA 2F4IA 3KJPA 3PSIA 1STEA 2KCNA 2CW0D 1PVOA 4DV5L 3EFXD 2F0GA 3VYRA 3T4AC 4DR2L 1WTHA 3IAYA 4G7OC 2HT1A 3FP9A 1XMOQ 4N8FA 2KHSA 1V43A 4BY7H 3CMEA 3EA6A 1QZGA 2BE5C 3AFPA 1H9KA 2D5DA 2RCFA 4BA1I 5IYCH 2MP1A 4LUZA 1XYIA 1WD0A 4BBRG 2VB2X 4RMFA 1ASZA 2F0EA 4WJWA 2G9HD 3CP0A 4UP9A 3CC2A 5FOBB 2VUMG 1ENAA 3CCRA 4ID6A 1EYCA 5DAUA 4IPDA 1AP0A 4RGOS 1IXRA 1I4GA 1EOTA 4K5VA 2SDFA 4DV6Q 1LTSD 2PO4A 3MVVA 1L0WA 3CCMA 3PIP3 5EPJA 1XPRA 3VA7A 3BVGA 5E1FA 4FXKC 4IUPA 2TSSA 4OXPA 4PMBA 2WV6D 5H1SE 1C9OA 1MD2D 3HOXH 4OWXB 1HA6A 2EJFC 1SRUA 4OWWB 1X3FA 5KYLA 1VQGA 1I4PA 4DR6Q 1EEID 1IZ6A 1ILPA 1OXXK 4P71A 1MHWC 2NTTA 4KHPQ 4X3SA 4EQOA 4WFN3 3K5OA 1Y1WB 1IL8A 3Q6SA 4JI7L 1ML0D 5C4XG 1HFGA 2K05A 4V0BA 1SYFA 5C3EG 1W6KA 1EY7A 4A3LH 2EYFA 2ENBA 3BZCA 5IGGA 5LMUL 1D8LA 3D4WA 3SDZA 3T1YL 1DOKA 3V05A 4HCSA 3E0JA 4AYBE 4QF4A 1B3QA 1RHPA 1TWFB 2D0PA 2X6GA 4APVA 4UDUC 1JOQA 1MJCA 4RAUC 1EOVA 4GLXA 4DNRB 4A93G 1X3PA 3GV6A 2JA5H 2B2WA 4HAEA 4K8JA 3SE0A 3U4VA 3STBD 4LUVA 2L4NA 4DAYA 1TWGH 1PZID 3URYA 1B3AA 4RKBA 1YZ6A 1Z47A 2B2UA 1DM0B 3HOVB 2E2HH 2IX0A 2Z1CA 4F7XA 4HJ5A 3Q8DA 1PHJA 5I9OA 5M9OA 1XNRL 1K3RA 5LL6S 3IFTA 3PUXA 5LMNQ 5KEEA 4ZLTF 5HGQA 1A15A 4CKEA 2UXDL 3FRPB 1Y1VH 1PH7A 3CC4A 1N32Q 1SROA 5HY6A 1QNKA 2A5HA 4KKUA 3I4NG 2HUGA 3QO2A 5JEAG 4IOCA 3ITPA 3VYSA 3PIPA 1JQYD 1Q8KA 3RZDB 4QL5A 2EVBA 1JE5A 3ER0A 4DV7L 1PTOH 4N9PA 1UE6A 3L0OA 1LM0A 4DAMA 3K5NA 2E2JB 4RFBA 1CK1A 1XTCD 3CHBD 2MQHA 5C44B 1B9NA 1T5XD 1N8RC 2OWOA 4X3KA 1L1OC 4JI7Q 2FMCA 5JJLA 3FMCA 3FPUB 2CQOA 2DJFC 2JA7G 4KHZA 5GADC 2LXKA 2O2LD 2WAQE 5EPKA 2WKDA 1WCMG 1CM9A 2ZTDA 3QG1A 1SMYC 2FXQA 2IW3A 1W2BA 5LMUQ 3PF4A 1DONA 3FEWX 4IJHA 4X65Q 2XGTA 1DD2A 3HOUB 1UE1A 2F0HA 1EWCA 2XWBB 2YTYA 1NR2A 1CT1D 3TP5A 5FO9B 2RQXA 3RR5A 2EY1A 4A3DG 3BYYB 4DK3C 3CCJA 5K36H 1H9MA 5D3IB 1YNJC 2NUCA 4HEDA 3SXHA 3S1QH 1ZYRC 2N49A 2BCOA 1BXTA 3PO2H 2OTLA 3L3OC 4JW0A 4JI4Q 2ZXOA 5IE8A 2E2IH 1ET9A 1XNRQ 3CMAA 2F0IA 4JI3L 1ZEQX 2A8VA 4K0KQ 3OPOA 3K6OA 1S72A 2UXDQ 4FVMA 2Q2UA 2EYPA 3HOYB 5FJ8H 5G3LF 5EKKA 4A3CH 1Y69U 4AYBB 4R8IA 3GTJB 1D1IA 5LHY1 1I4RA 2EY5A 4TVAB 3J81j 1X54A 2KHJA 4UP7A 2BDOA 4A3IB 1WTQA 3TQYA 4DV7Q 2PCFB 2WB1E 5J39A 4A76A 3RZOH 3X3MA 4NXMQ 1F2MA 1PH2A 1FGBD 1OXVA 3MXNB 4IZ8A 4FDBA 4P75A 3TS2A 3MEFA 5IGEA 4LF4L 4KV6A 4OL7A 4MHEA 4P73A 3X3NA 1I3QH 3NXWA 3J81L 4IO9A 2JA8B 4LFAL 3T56B 4JBJA 2CH4A 4IUTA 2XNAC 4XQQA 4YCVA 5IYDH 4ALPA 4DR1L 1GJXA 3OHXC 2BDNA 3I73A 5IP9G 2EYJA 3FVQA 4HCEA 1HJPA 3IFDA 1I5FA 4K5WA 2B2VA 4RGNA 1I4QA 3BS1A 4IPHA 4JG2A 2BOSA 1ESRA 4A3GH 2D2CC 3PO3B 3M85A 4K2KA 1VMCA 4DXFA 1CHPD 5IGFA 4EQNA 2MO1A 3Q23A 1JJGA 4A3KG 4C3JH 1QG7A 1HA5A 1O7YA 1N34L 1FNWA 2A19A 4C1NK 4OX9Q 2L55A 3CC7A 1HHVA 1AE2A 1YITA 3BDOA 4MTNA 2EZVA 2V1CC 2BA0A 3H3VC 4DUYQ 1HZBA 4K8IA 1XMQL 4QY7A 2ZJPA 1SFOB 3HOWH 3HOZB 2WAQB 3K57A 1H9SB 2QILA 5IIFA 2ZM6L 4AIMA 5M3MB 1FL0A 2K5QA 2JE6I 4JI3Q 1VQOA 4YWMA 3JAME 4DV2Q 3H6MA 5M3FH 4K6LA 2NVTH 2E5LL 1VQHA 2IWHA 2F0KA 3ONAB 4A3BB 2EDGA 3NP8A 4B08A 1I6HB 1Q12A 4WRDA 1NR4A 1II3A 2R92G 1RIPA 4KHVA 3I4MH 1UWVA 1Q8IA 3NBHB 1SYGA 2RA4A 1N36Q 4HIKA 4GKJL 4DV1L 1WD1A 4LF6Q 2RVLA 3G7LA 4A3MB 1U0LA 2XRSD 1BR9A 1ICWA 5JJZA 3F2BA 1PDQA 2RCNA 4R9WA 1TWCB 1Z6HA 2MPMA 4BS9A 1DYQA 1XTDA 2KCTA 1FVIA 4DNTB 4HJAA 4IFDJ 4DKAC 1W3SA 2F0TA 3C1FA 3M4PA 2R7ZB 2KCMA 2Z9HA 4RCNA 2IHEA 4WORA 5JPMC 1GUSA 5JPNC 1HZ9A 1BCPD 4C3HH 4GNXC 1EY5A 1KNEA 2QDLA 1KL9A 4Y7NB 2K52A 5EBDA 3G6JB 4PG3A 4X3UA 2RHQB 1SNPA 2O4XA 2R61A 3KDFB 3I91A 4KLKA 5GAGC 5KIXA 4BBRH 2D9UA 2I5MX 4NPSA 1JWMD 3A5ZB 3OOCA 3E3XA 4KTAA 3M4QA 5M5WH 1PH4A 2M00A 3NTKA 1NUCA 2WB1B 3ULPA 1MJEA 4BY7B 4BWGB 5LMNW 2UU9L 4DV0L 2VUMH 2E76C 1DCZA 2PQAB 2KECA 3GP7A 2Z6KC 1WTXA 4CKBA 1STNA 3EQLC 4DK0A 1OXUA 2J4XA 3A55A 3AB9A 4YY3L 3D3RA 4PZ7A 2K75A 2GA4B 4DR5L 2Q8TA 1B2TA 2VY3A 1FJGL 2ZM6Q 1G6ZA 3U50C 2UXBL 4XDXA 3M3YH 4QMGA 1GVPA 1PH5A 2EJGC 5C0XJ 5FLMG 1KLUD 4JI6L 4LF9L 4ZUJA 4KKTA 2K28A 2UUCL 1VQMA 1EIGA 3AQQA 4DXGA 3F2UA 3BDCA 5JAVA 3G6EA 3HOXB 1TXYA 2JJQA 2B29A 2DUDA 4KJOA 5I2XA 1VQNA 1XWEA 3P20A 2JA6B 4A75A 5C4XH 3H15A 5GQOA 4GKJQ 4DV1Q 2QEJC 2EQSA 1FD7D 4LFCL 1AFPA 2VS1A 2MFIA 3HGBA 1I6VC 3FKIH 2ES2A 1IKLA 4O0AA 2L0CA 2NVQH 5EKIA 5IT9E 1YEZA 5DM73 2QGQA 4IALA 3OMGA 2F0MA 2B63G 2ID0A 2F0JA 3JAML 1HQRD 4B3SQ 1PRTC 1SXTA 1CTMA 3MXNA 4P2CB 3KUPA 3KLRA 1I50H 4A93H 3KOJA 2AHOB 1H9RA 1MGSA 1K8AC 1Q7YC 2XWJB 4E6IA 3QJYA 1LTGD 2VZAA 4A3FG 4DF7A 2B2TC 2XIWA 1FGUA 1X55A 4DV6L 3A8KE 2JA5B 1AH9A 1VQ4A 4EQ5A 2UU9Q 4DV0Q 1SMXA 2L11A 2Y0SE 2O5IC 3D6WA 1QILA 2ZJQA 3VR3A 1PH6A 4A3JG 2QEXA 1SNCA 2F0SA 1LACA 4C2MH 4C3IG 4QJFA 1HQMC 1PYSB 1ZKOA 1WTPA 2E2HB 4XT3B 1F2LA 4HR7B 1RODA 1EQVA 2K5DA 4CDEC 3T51B 3VR5A 4DV3Q 3OWEB 4DR6L 4MNOA 5C4JH 3S15B 2LXJA 1YNNC 3I4NH 5JEAH 3KYHC 1NNXA 1YHBA 2UXBQ 4KHPL 3MA2B 1VQIA 2AKWB 2OT2A 1K3BC 3K7UC 5C0XI 1Y1VB 4K6DA 1STGA 2AWOA 1WTRA 1GUWA 2UUCQ 1C0AA 1TU2B 5CYUA 5C0XG 1D7QA 1SEBD 2RF4A 2K5HA 1SYDA 1H9SA 1BCPB 1PTOB 3HG9A 1PFNA 2IJ0A 3KBXA 1PZJD 1EFWA 2JA7H 5EGTA 5D65A 4LFCQ 1ILQA 3MTSA 1WCMH 4DA2A 2DGYA 4Z9CB 4KD4A 1QJOA 5GROA 3HOUG 3E9HA 5F2DA 4GOPB 3H0GH 3NBHA 2MGSA 4JI2L 3BZDB 4ODGA 3S1RH 3AEVA 1A0IA 1WTVA 2XRQD 4L5RC 2EE1A 1A63A 3FPPA 3S1NH 5CORA 1UUPA 4A3DH 1NE3A 4MIUA 1M8AA 2C9OA 3KK7A 4FF3A 3GTGB 2K04A 1SNMA 3S14H 2VNUD 3GDEA 2HCCA 1K28A 4ZRZA 5TSSA 1NMFA 3J80E 2R6GA 1SE4A 5LMNL 3OW2A 1X9NA 1UNSA 4ILWA 1FYCA 2EJMA 2BE5D 3J81c 1N32L 4PMWA 1HRJA 5IT9L 3EVQA 3SK4A 1TY0A 5C5MA 2EXZA 2M2LA 3KDFA 3GTPH 3D4RA 5JJKA 4RA8A 4H44C 4FF2A 1SSOA 4AYBG 5IWAQ 3NHHA 4LAAA 2YTXA 1G2TA 3PGZA 3R2TA 2G5DA 4TRDA 2PQAA 4A3IG 1HNZL 4G7HC 1V9PA 1P8LA 1TY2A 1B1ZA 1F9SA 4R4OA 2KBNA 3A5UA 3S16B 4GN5A 5FK9C 4EQPA 4X64Q 2SOBA 3S2DH 2NZHA 2TMPA 1LTLA 2R3ZA 2F0WA 3L7ZC 2YTVA 1QVCA 2R93B 2JA8G 2OEOA 4CJ1B 4X65L 3GTQH 2Y0SB 1U4LA 1N9WA 1S40A 1WI5A 4GKKQ 2KCCA 3T16A 4H13C 3GTOH 2L5TA 4J15A 5KRUA 3NTHA 2HCIA 2F0LA 2ZXPA 4F8MA 1R9TH 1UEBA 3STBC 5IP9H 1CKNB 1I3QB 1IW7C 1LO5D 1AE3A 4JI2Q 1C8CA 4PZ8A 1NTGA 3PO3G 5JJIA 5CC4A 5JOBA 4HJ9A 3UDGA 2O5JC 2A6EC 3TZUA 3F8TA 1CSQA 1D5XC 3SK5A 4JI4L 2A68C 4QIWE 2A1AA 3H3VH 4A3KH 4MZ9A 1AN8A 3S17H 4J1MA 4AH6A 1EUJA 1EWIA 3K80C 4R1JA 3TSSA 1JORA 4A3GB 1CQVA 4B3TQ 2QCPX 4OEMB 4DN4M 3S2HH 1FR3A 2MO0A 3A56A 4K0KL 3VYUA 4C3JB 3HOZG 3N52A 2PZTA 4JOIA 2WAQG 2KEEA 2I5LX 1VQEA 2A69D 5D3DA 5BN3A 1QVGA 2YU9H 1HH2P 5C3WA 4S3SA 4RHRA 1D2BA 3ULJA 2B2YA 2C5CA 2Q8IB 4JI1L 1PA6A 1KABA 3W2DA 4XYOA 3HOWB 4MN3A 2P5ZX 1JB7A 1IL2A 4NXML 2F03A 4GLAC 4M1UB 1F9PA 3WDNA 1E0BA 1X65A 1HNZQ 1RKNA 1R4QB 1SAPA 4A3MG 3EROA 2YYZA 1RTOA 4ZKCB 3J80L 2NVTB 1B4OA 1Q81C 3CU7A 5JVH3 1PMRA 2OXPA 2VQFL 1TKWB 2ATWA 3I4LA 3EN2A 1KDCA 2AQ2B 2RSOA 1RJTA 3I8ZA 4RGTA 4POFA 5J3BA 4N9TA 3HKSA 1JOKA 3M4OH 1JOOA 1KC8C 1BNZA 1YHAA 4BBSH 1QZHA 1B50A 5IP7G 2K33A 1E1OA 2A74C 3D6CA 4QCLA 1M90C 4LF8Q 4OIKA 4X6AH 4DK1A 3MXGA 4ZYSA 3CW2C 3SGIA 1ONLA 2AUJD 1PH1A 3KLWA 2K6AA 1U4MA 2JEBI 4C1NI 1CKOA 2ALYB 4PV1C 1EZ6A 4L5SA 2JA9A 4FF4A 1R4PB 1OTCA 1YJNA 2DJGC 4OX9L 1SMYD 3SK8A 1BDOA 5GAEC 3GTMH 3NWTA 2WB1G 4C3HB 3I72A 5CV5A 3RN2A 1G6PA 1I4HA 2UUAQ 2EPBA 3NEMA 4DUYL 3CCSA 4GOPA 2F52A 3GTKH 1PH9A 2MUYA 1MIUA 2E74C 3DEOA 5CV8A 5AFWA 1D1KA 5M5WB 2NVYH 1CI3M 4DU9A 5IOCA 5DLQE 4TQUS 5AJ3Q 4DV2L 4XIGS 1KRSA 1S3OA 1ZYRD 3J81i 1DJRD 1L0YB 4PMCA 3O13A 4HSVA 1HTPA 1O7LA 1Y8NB 4X66Q 4FP5D 3OW7A 4KN4C 4H0LC 5FLXc 4JCVE 1BO0A 1VF5C 5FLMH 1VMPA 5DM63 1N36L 4JI1Q 3K81C 4KN7C 4LF6L 4KI0A 3HOXG 2EIFA 4V190 3R2IA 3M3YB 2F0NA 4L5QA 1JC7A 3K8AA 1HNXQ 2JA6G 1K9MC 3UE0A 4QIWB 3M4YA 5IGDA 1TWAB 3ERQA 4H7BA 5ISRA 1B8AA 5CV4A 2VQFQ 2IHFA 1PFMA 1QUQB 1TIID 4FXGC 3PQIA 2DY8A 1PFBA 5I2YA 2B39A 1K83B 2B2WC 5C4XB 2CHBD 1B9MA 4A3LG 3A74A 2QKIC 1HUMA 3M9BA 5K5PA 5E4WC 3IKJA 1TWFH 2B63H 1F2YA 2HQEA 3FKIB 1LTID 4IUUA 3ZJYC 3RD4A 2PMZE 1TS4A 5KNDA 1KNAA 1RDPD 1PZKD 2DN8A 2Q2IA 5JVG3 1PH8A 1OO9B 1HUNA 1IBMQ 2ICEC 3CQZH 3QR8A 3CCQA 3R8BA 4A3FH 1AEXA 4PNYA 3K59A 5NUCA 1LTTD 2FFKB 2JA5G 1I50B 5BN4A 4A93B 1STHA 1GOZA 4A3EG 2AQ1B 1W6JA 2WFWA 4DFAA 3TS0A 3UDIA 1CKNA 1EYAA 2XSCA 4A3JH 4O42A 3FDTA 3GTLB 3A7AB 5C6AA 1OXTA 3TMEA 4C3IH 1NY4A 3F2DA 3PUWA 5IGBA 1VQ9A 2KEDA 4EVOA 1D5MC 2PNRC 1V8QA 2RDFA 5C4HA 4XQNA 3RLOA 4DUZL 2QW7A 3UE1A 1CA5A 5T1IA 3JC66 3OMCA
chains in the Genus database with same CATH topology
3MZ5A 2DY7A 1SDFA 1S4ZA 1A3VA 5C4JB 1EZ8A 4KK7A 2LFNA 4ABNA 3I4NB 5C0XH 1A3UA 1JWSD 1EY6A 1HTLD 1K8MA 2H1EA 2LKVA 3J7AV 4RCOA 2K7VA 1A2TA 4CJ0B 4HSPA 3OSOA 2F0QA 2FINB 4ZQ3A 2Z8LA 2F0PA 4NW2A 5T1GA 3U9OA 4RWSC 5IODA 3N6RA 2FMMA 1PTOD 1LABA 4U68A 3I3CA 2JA7B 3U9SA 5CBEE 4OHJA 4G57A 3H0GB 1ET6A 1CZWA 2K1BA 2X69A 1STYA 3BDLA 1SJED 3NQIA 4KMUC 3NK9A 1SBBB 3S1NB 4A3DB 1F77A 2J7ZA 4KY5A 1L0XB 3TBIB 2XVSA 3S14B 2HDMA 3TDQA 3QOLA 2IL8A 2G9DA 3SR1A 2A6HC 3A8IE 3K5MA 1GXDC 3LNNA 2LMCB 4J6HA 2AUKA 3I70A 1LT3D 4IUQA 2EY2A 4HN7A 2MHVA 1ENFA 2PMZB 2EY6A 2EYLA 2NB0A 1DZ1A 1IYUA 2M9VA 4CBVA 4K14A 1BCPF 1PTOF 5CMDA 4J8QA 2XN9C 2RBMA 1S5BD 2KUMA 5FO8B 3RUZA 1RCVD 1VCIA 3VYTA 1EEFD 1NSNS 4IFDI 2B2VC 1EQTA 1WTWA 4QUCA 2EYHA 4UAIA 3S2DB 1G291 3H94A 4IFDG 4I7ZC 4GZYC 4ZUIA 2Q8RE 1EU4A 3GTQB 2PQEA 5CR3A 1EY9A 5KNBA 3GTOB 2WACA 4B9XA 3LWUA 4IUNA 1R9TB 3P1HA 1CZGA 3OWFA 1MBYA 3NPPA 1SNDA 2J0TD 3Q24A 1PRTD 2F3VA 1TS2A 2ICIA 2JYOA 1B53A 1TWGB 2CQAA 4C3JG 1O80A 1OXSC 2JP1A 2HDLA 3S17B 2MJ8A 2E2DC 5I6YA 1T5EA 3MWYW 3SVMA 1PLFA 1V1OA 1U4PA 1V1PB 1IKMA 1GUTA 3S2HB 3A7LA 2FJ2A 1S5FD 2N88A 1EY8A 4HTHA 3TN2A 5ELEA 3SK6A 4ZK9B 1RF2D 4TSSA 1E2VA 3C3LA 3HRZC 1GUOA 4IQZA 3OIQA 1Q1BA 1MSGA 2F0UA 1YNND 4F88A 3OIPA 2CW0C 1LT5D 3R3OA 4O1NA 3NTIA 5C4ZA 1JCKB 1STAA 5EQ0A 2KVMA 3MFYA 2LS01 1JR0D 3V96A 3M4OB 2EOTA 2E75C 4XYQA 4BBSB 4KJNA 1BF4A 4ZKBB 1LV9A 2KQ3A 4C3HG 2F0DA 3GQBA 1CHQD 4I65A 4KKSA 2RKSA 4LMQD 2OF1A 1A2UA 1CQFA 2F1MA 1FNUA 3S1QB 1NCVA 3A8JE 2WP8J 2QF7A 3GTMB 1E2ZA 4OO1I 3PO2B 5E4XA 2KOLA 2L12A 3DXJC 2EYMA 2E2IB 4OO1G 5A35A 3GTKB 2WKCA 5I6WA 4FF1A 5JEAJ 5C5LA 2NVYB 1D5ZC 1Y8PB 2QDBA 4KY6A 3E5SA 1HPCA 2D62A 3NBIA 3CRLC 4FNFA 5LL6X 1EY0A 3GD7A 4HMJA 3RZOB 2DNCA 1KTKA 1J9OA 3MXPA 1MI2A 5CGKA 3Q22A 3MHBA 5HGTA 5BN5A 4RHSA 1U4RA 4JK1C 5ELDA 2WIIB 1Q1EA 4XXEA 3HZXA 1PRTB 1VDZA 2IT1A 2F3WA 2PZWA 1IYVA 4XTCS 3KBGA 1M4VA 4KY7A 1HCZA 2B63B 1QNUA 1KDBA 3VR4A 4DAVA 1LTAD 3HP3A 5EJWA 2SEBD 2K03A 3MXUA 1IW7D 3PUVA 4CHTB 1NAPA 4JBWA 2A69C 1XX8A 3HKZB 3CQZB 2NN6I 4A3FB 2A6ED 5FKAC 4ULLA 3QB3A 1A3TA 2A68D 2NN6G 1O7ZA 3DEPA 3HS0C 2JEAI 3C2PA 4A3JB 3J81E 4C3IB 1STBA 5I9PA 3VA5A 3NWSA 3E6ZX 5ELFA 3R93A 2FHTA 5M3FB 1DXMA 3H91A 4ME5A 4OIJA 4NP5A 1I4XA 2F0VA 1SNQA 1V1PA 3I4MB 3UI2A 1FNVA 1TWHB 1GUGA 5CV9A 3S1MB 3CKIB 3M7NA 5G3LD 4NMZA 1EYDA 1BUVT 5KYIA 1B44D 1TQOA 1CFMA 5J22A 3K7AB 3A54A 2KJXA 1QOHA 1AZQA 1Z7TA 1TR5A 3GV3A 1JWUD 4BBRB 4CJ2C 1HXYD 1WVLA 1YNJD 1F9RA 2VUMB 3VR2A 4G7ZC 4CKCA 1Q90A 1JB3A 5D14A 2LY7A 1Y8OB 3QIAA 3TP7A 5KGUA 3BG3A 5EPLA 1LT6D 1G8ZD 3C46A 4K5XA 1E2WA 2I07B 4OGQC 1C48A 4ZAIA 3BYTB 2PW5A 3LX0A 4TKOB 3DWQA 3SHLA 4LK1C 3HEJA 3NQTA 3KLSA 5IGCA 2PW7A 3W3AA 2JXMB 5C3EB 3GO5A 2VXWA 2KA7A 4IN3A 4L6TB 4IFDH 2B2UC 3LWEA 3PUYA 1GUNA 3MEHA 4XQJA 2NVQB 2V4DA 3RMHA 3DHQA 2B8GA 1O78A 5M5XB 3K0YA 3NE5B 2B8FA 5DNFA 4BA2I 1H9JA 2DNEA 2PYKA 5DEHA 1UAPA 1EU3A 4IUVA 3QWNA 1LLRD 3AU7A 1WTOA 3P75A 3BVZA 5CV7A 3L9AX 1QCBD 3T53B 4X3TA 2EYOA 2B2YC 3K58A 4FYDA 2SNSA 3T13A 1SYBA 3ZYYX 3PIO3 4F87A 1SJHD 3V2TA 4XT1B 1BBXC 2RDGA 5C3XA 1RTNA 1JE4A 4K2LA 2B2TA 3DMUA 3RLFA 1EFID 3S9WA 2NWGA 3IL8A 1S5DD 3TZDA 2IX1A 5ELBA 1VF7A 4DGZA 5FLXE 2F0OA 2X6LA 3TP6A 3M7GA 1SNOA 4U673 3KLSX 1BCPC 1ESFA 1PTOC 3CRKC 1GHKA 2NTSA 2N55A 2H4OA 2NZ1D 3C1EA 1TS3A 4FXDA 1SYCA 1KLGD 1WCMB 3MAQA 3D4DA 3P7JA 3EJIA 4KD3A 2PPBC 3D31A 3AMUA 1U9RA 1IHZA 1ZXTA 3I90A 3S1RB 1DOLA 4QUFA 1G2SA 1EWHA 2ZT9C 5K36G 5A2QE 2CVRA 5CBAE 2NYZD 1QB5D 1Q3LA 1D6EC 1J8IA 1EL0A 3MC0B 4RGMA 2SNMA 4Q5VA 1HFNA 2ZXRA 1F9QA 3D8GA 3H09A 1PXUA 3MFGA 1UEAB 4OO1H 1X3QA 2NBFA 3TP8A 4HMIA 2IPKD 4FO2A 1JICA 3VR6A 3J7YW 1RD9D 2Z4IA 3GTPB 2L9HA 1S5ED 1PYWD 3DWPA 3PUZA 3Q0AA 1LTRD 1SE3A 2A6HD 4Q0FA 5M5YB 4LJZC 4NDXA 1AW7A 1BQQT 5COYA 1EIHA 5EBCA 3SEBA 4CGYB 1ENCA 1BOSA 2L1BA 1F2ZA 1TS5A 5EKLA 3DWAA 5CV6A 2A73B 5HURA 3NSWA 2Z4HA 4IURA 1CA6A 1A6XA 2VB3X 2RSNA 1LT4D 2K5WA 1DOMA 4C56C 1TT2A 5J1ZA 3ND9A 3KF8A 5FLXL 4PQXA 1K8OA 2AQ3B 3DUZA 4RKLA 1KAAA 4NKLA 1EY4A 1C4QA 1KDAA 3PMFA 4A3KB 1QWYA 3K5LA 1SYEA 3QOJA 4YIJA 1GHJA 2AWNA 3DM1A 4QB4A 1AZPA 5E3FA 4A3EB 2NN6H 3WOFA 3PV0A 4R8NA 4B9WA 1S5CD 2BA1A 2PZUA 3ND8A 2YU9B 1SE2A 3BVMA 1QE6A 1LTBD 5FO7B 2F0FA 5KNCA 5A2QL 1MSHA 4G4KA 2K32A 3NUCA 4L63B 3WOEA 1XXGA 2RDHA 5I4DA 2R92B 2JSOA 4RH6A 1G91A 4BY1B 1TVXA 4DAPA 2NVXB 1X32A 2WINB 4M8AA 2K01A 5ELCA 1PRTF 2IX3A 3J7AF 2I46A 4EGVA 4L8JA 2F4IA 1STEA 2KCNA 2CW0D 3EFXD 2F0GA 3VYRA 3T4AC 3IAYA 4G7OC 2KHSA 1V43A 3EA6A 2BE5C 1H9KA 2D5DA 4BA1I 2MP1A 1XYIA 1WD0A 2VB2X 2F0EA 4WJWA 2G9HD 5FOBB 1ENAA 4ID6A 1EYCA 5DAUA 1AP0A 4RGOS 1I4GA 1EOTA 4K5VA 2SDFA 1LTSD 2PO4A 3MVVA 3PIP3 5EPJA 3VA7A 3BVGA 5E1FA 4FXKC 4IUPA 2TSSA 4PMBA 2WV6D 1MD2D 1HA6A 2EJFC 5KYLA 1I4PA 1EEID 1ILPA 1OXXK 2NTTA 4X3SA 4EQOA 4WFN3 3K5OA 1Y1WB 1IL8A 3Q6SA 1ML0D 1HFGA 2K05A 4V0BA 1SYFA 1W6KA 1EY7A 2EYFA 2ENBA 5IGGA 3D4WA 3SDZA 1DOKA 3V05A 4HCSA 3E0JA 4QF4A 1RHPA 1TWFB 2X6GA 4UDUC 1JOQA 4RAUC 4DNRB 1X3PA 3GV6A 2B2WA 4HAEA 4K8JA 3SE0A 2L4NA 4DAYA 1PZID 3URYA 1B3AA 4RKBA 1Z47A 2B2UA 1DM0B 3HOVB 2IX0A 2Z1CA 4F7XA 5I9OA 5M9OA 5LL6S 3IFTA 3PUXA 5KEEA 4ZLTF 1A15A 4CKEA 3FRPB 1QNKA 2A5HA 4KKUA 2HUGA 3QO2A 5JEAG 3ITPA 3VYSA 1JQYD 3RZDB 2EVBA 1PTOH 4N9PA 2E2JB 3K5NA 4RFBA 1CK1A 1XTCD 3CHBD 5C44B 1B9NA 1T5XD 4X3KA 2FMCA 3FMCA 3FPUB 4KHZA 2O2LD 5EPKA 2WKDA 1CM9A 3QG1A 1SMYC 2IW3A 1DONA 3FEWX 1DD2A 3HOUB 2F0HA 1EWCA 2XWBB 1NR2A 1CT1D 3TP5A 5FO9B 2RQXA 2EY1A 3BYYB 5K36H 1H9MA 5D3IB 1YNJC 2NUCA 4HEDA 3SXHA 1ZYRC 2BCOA 1BXTA 3L3OC 2ZXOA 1ET9A 2F0IA 1ZEQX 3OPOA 3K6OA 4FVMA 2EYPA 3HOYB 5G3LF 5EKKA 1Y69U 4AYBB 4R8IA 3GTJB 1D1IA 5LHY1 1I4RA 2EY5A 2BDOA 4A3IB 1WTQA 2PCFB 5J39A 3X3MA 1F2MA 1FGBD 1OXVA 4IZ8A 5IGEA 4KV6A 4OL7A 4MHEA 3X3NA 3NXWA 3J81L 2JA8B 3T56B 4IUTA 2XNAC 4XQQA 1GJXA 3OHXC 2BDNA 3I73A 2EYJA 3FVQA 4HCEA 3IFDA 4K5WA 2B2VA 4RGNA 1I4QA 3BS1A 2BOSA 1ESRA 2D2CC 3PO3B 3M85A 4K2KA 1VMCA 4DXFA 1CHPD 5IGFA 4EQNA 3Q23A 1QG7A 1HA5A 1O7YA 1FNWA 4C1NK 2L55A 1HHVA 3BDOA 2EZVA 2BA0A 3H3VC 4K8IA 1SFOB 3HOZB 2WAQB 3K57A 1H9SB 2QILA 5IIFA 5M3MB 2K5QA 2JE6I 3JAME 3H6MA 4K6LA 2IWHA 2F0KA 3ONAB 4A3BB 2EDGA 3NP8A 4B08A 1I6HB 1Q12A 4WRDA 1NR4A 1II3A 4KHVA 1Q8IA 1SYGA 2RA4A 1WD1A 2RVLA 3G7LA 4A3MB 2XRSD 1BR9A 1ICWA 5JJZA 1PDQA 4R9WA 4BS9A 1TWCB 1Z6HA 2MPMA 1DYQA 4DNTB 4IFDJ 2F0TA 3C1FA 2R7ZB 4RCNA 4WORA 5JPMC 1GUSA 5JPNC 1BCPD 1EY5A 1KNEA 4Y7NB 5EBDA 3G6JB 4X3UA 1SNPA 2O4XA 2R61A 3I91A 5KIXA 2D9UA 1JWMD 3OOCA 4KTAA 2M00A 3NTKA 1NUCA 2WB1B 4BY7B 4BWGB 2E76C 1DCZA 2KECA 3GP7A 1WTXA 4CKBA 1STNA 3EQLC 4DK0A 1OXUA 2J4XA 3A55A 3AB9A 3D3RA 2GA4B 2Q8TA 1B2TA 1G6ZA 4XDXA 4QMGA 2EJGC 5C0XJ 1KLUD 4ZUJA 4KKTA 2K28A 1EIGA 4DXGA 3F2UA 3BDCA 5JAVA 3HOXB 4KJOA 5I2XA 1XWEA 3P20A 2JA6B 2QEJC 1FD7D 1AFPA 3HGBA 1I6VC 1IKLA 2L0CA 5EKIA 5IT9E 5DM73 4IALA 3OMGA 2F0MA 2ID0A 2F0JA 3JAML 1HQRD 1PRTC 1SXTA 1CTMA 3MXNA 4P2CB 3KUPA 3KLRA 1H9RA 1MGSA 2XWJB 4E6IA 3QJYA 1LTGD 4DF7A 2B2TC 2XIWA 3A8KE 2JA5B 2L11A 2O5IC 3D6WA 1QILA 3VR3A 1SNCA 2F0SA 1LACA 4C3IG 1HQMC 1ZKOA 1WTPA 2E2HB 4XT3B 1F2LA 4HR7B 1RODA 1EQVA 2K5DA 3T51B 3VR5A 3OWEB 3S15B 1YNNC 5JEAH 3MA2B 2OT2A 5C0XI 1Y1VB 4K6DA 1STGA 2AWOA 1WTRA 1GUWA 1TU2B 5CYUA 5C0XG 1SEBD 1SYDA 1H9SA 1BCPB 1PTOB 3HG9A 1PFNA 2IJ0A 3KBXA 1PZJD 5EGTA 5D65A 1ILQA 3MTSA 4DA2A 4Z9CB 4KD4A 1QJOA 5F2DA 3NBHA 2MGSA 3BZDB 4ODGA 1WTVA 2XRQD 2EE1A 3FPPA 5CORA 1UUPA 4MIUA 1M8AA 2C9OA 3KK7A 4FF3A 3GTGB 2K04A 1SNMA 2VNUD 2HCCA 4ZRZA 5TSSA 3J80E 2R6GA 1SE4A 1UNSA 4ILWA 1FYCA 2EJMA 2BE5D 4PMWA 1HRJA 5IT9L 3EVQA 3SK4A 1TY0A 5C5MA 2EXZA 2M2LA 3D4RA 4RA8A 4H44C 4FF2A 1SSOA 3NHHA 4LAAA 1G2TA 3R2TA 4TRDA 4G7HC 1TY2A 1B1ZA 1F9SA 3S16B 5FK9C 4EQPA 2SOBA 2TMPA 3L7ZC 2R3ZA 2F0WA 2R93B 2OEOA 4CJ1B 2Y0SB 1U4LA 2KCCA 3T16A 4H13C 2L5TA 5KRUA 3NTHA 2HCIA 2F0LA 2ZXPA 4F8MA 1I3QB 1IW7C 1LO5D 1C8CA 5CC4A 5JOBA 2O5JC 2A6EC 3TZUA 1D5XC 3SK5A 2A68C 1AN8A 4J1MA 3TSSA 1JORA 4A3GB 1CQVA 2QCPX 4DN4M 1FR3A 3A56A 3VYUA 4C3JB 3N52A 2PZTA 2KEEA 2A69D 5D3DA 5BN3A 5C3WA 4S3SA 4RHRA 1D2BA 2B2YA 2C5CA 2Q8IB 1KABA 3W2DA 4XYOA 3HOWB 4MN3A 2F03A 4M1UB 1F9PA 3WDNA 1E0BA 1RKNA 1R4QB 1SAPA 3EROA 2YYZA 1RTOA 4ZKCB 3J80L 2NVTB 1B4OA 3CU7A 5JVH3 1PMRA 2OXPA 1TKWB 3I4LA 1KDCA 2AQ2B 2RSOA 1RJTA 3I8ZA 4RGTA 4N9TA 1JOKA 1JOOA 1BNZA 1B50A 2K33A 2A74C 3D6CA 4QCLA 4OIKA 4DK1A 3MXGA 4ZYSA 1ONLA 2AUJD 2K6AA 1U4MA 2JEBI 4C1NI 4PV1C 1EZ6A 4FF4A 1R4PB 1SMYD 3SK8A 1BDOA 3NWTA 4C3HB 3I72A 5CV5A 1I4HA 2EPBA 2MUYA 5CV8A 2E74C 3DEOA 5AFWA 1D1KA 5M5WB 1CI3M 4DU9A 5IOCA 4TQUS 4XIGS 1ZYRD 1DJRD 1L0YB 4PMCA 3O13A 4HSVA 1HTPA 1O7LA 1Y8NB 4FP5D 3OW7A 4KN4C 4H0LC 1BO0A 1VF5C 1VMPA 5DM63 4KN7C 4KI0A 4V190 3R2IA 3M3YB 2F0NA 1JC7A 4QIWB 3M4YA 5IGDA 1TWAB 3ERQA 4H7BA 5ISRA 5CV4A 1PFMA 1TIID 4FXGC 2DY8A 1PFBA 5I2YA 2B39A 1K83B 2B2WC 5C4XB 2CHBD 1B9MA 2QKIC 1HUMA 5K5PA 5E4WC 3IKJA 1F2YA 2HQEA 3FKIB 1LTID 4IUUA 3RD4A 1TS4A 5KNDA 1KNAA 1RDPD 1PZKD 2DN8A 5JVG3 1OO9B 1HUNA 2ICEC 3R8BA 1AEXA 4PNYA 3K59A 5NUCA 1LTTD 2FFKB 5BN4A 1I50B 4A93B 1STHA 1GOZA 2AQ1B 1W6JA 4DFAA 1EYAA 2XSCA 4O42A 3FDTA 3GTLB 3A7AB 5C6AA 1OXTA 3TMEA 3PUWA 5IGBA 2KEDA 4EVOA 1D5MC 2PNRC 1V8QA 2RDFA 5C4HA 4XQNA 1CA5A 5T1IA 4C2MB 3OMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZ5 A;  4K14 A;  1SNM A;  4R8N A;  4B9W A;  5IGE A;  3HZX A;  4PMC A;  3D8G A;  2RBM A;  1STA A;  4KV6 A;  4OL7 A;  2PZU A;  5C4Z A;  5KYL A;  4WOR A;  2PZT A;  3RUZ A;  1A3V A;  2F3W A;  2PZW A;  3NXW A;  2EYO A;  1EZ8 A;  3TP8 A;  4HMI A;  1EY5 A;  4E6I A;  1NSN S;  1A3U A;  2SNS A;  1TR5 A;  1SYB A;  3T13 A;  4DF7 A;  4EQO A;  4KY7 A;  1EY6 A;  2F0F A;  3V2T A;  5C3W A;  3EVQ A;  4S3S A;  1KDB A;  1SNP A;  2EYH A;  2LKV A;  2O4X A;  3SK4 A;  2F0N A;  5C3X A;  5KIX A;  1KAB A;  2EYJ A;  1A2T A;  3NUC A;  1SYF A;  4KJN A;  2EXZ A;  5C5M A;  1EY7 A;  4ZUI A;  3OSO A;  2F0Q A;  4K5W A;  4K2L A;  4KTA A;  3DMU A;  4ZQ3 A;  2M00 A;  1NUC A;  2EYF A;  2ENB A;  5IGD A;  1SNC A;  3S9W A;  2F0S A;  2KQ3 A;  2F0P A;  2PQE A;  3ERQ A;  4H7B A;  2F0D A;  4IZ8 A;  3U9O A;  5IGG A;  4K2K A;  4I65 A;  3NHH A;  1RKN A;  2F0H A;  1EY9 A;  2RKS A;  5CR3 A;  5IOD A;  5CV4 A;  5IGF A;  4EQN A;  5ISR A;  1EQV A;  4LAA A;  1JOR A;  3ERO A;  1STN A;  3D4W A;  2WAC A;  2OF1 A;  4TRD A;  1A2U A;  4NDX A;  3TP5 A;  3QB3 A;  1A3T A;  3TP7 A;  4DGZ A;  2OXP A;  4B9X A;  2EY1 A;  4QF4 A;  5KGU A;  4IUN A;  3P1H A;  1JOQ A;  2F0O A;  1KDC A;  2NUC A;  3SXH A;  3OWF A;  4EQP A;  5K5P A;  3TP6 A;  2SOB A;  1SND A;  4G57 A;  1F2Y A;  1ENC A;  2F3V A;  4N9T A;  1JOK A;  4K5X A;  4K6D A;  2HQE A;  1JOO A;  4K8J A;  1SNO A;  1STG A;  1F2Z A;  2EYM A;  2F0G A;  4K8I A;  1STB A;  4QMG A;  2F0W A;  1STY A;  3VA5 A;  5EKL A;  3BDL A;  5I9P A;  5CV6 A;  2KHS A;  5IIF A;  3D6C A;  2PW5 A;  4RKB A;  5HUR A;  4ZUJ A;  5I6W A;  1SYD A;  2OEO A;  3NK9 A;  4ME5 A;  5C5L A;  3LX0 A;  4NP5 A;  5I6Y A;  3T16 A;  3H6M A;  4F7X A;  3SHL A;  3C1E A;  3BDC A;  4KY5 A;  5JAV A;  3HEJ A;  3NQT A;  2F0I A;  5IGC A;  5KRU A;  2QDB A;  1EZ6 A;  1SYC A;  1AEX A;  2PW7 A;  4KJO A;  4KY6 A;  4PNY A;  2F0V A;  5EGT A;  2F0K A;  5NUC A;  5I9O A;  5M9O A;  3D4D A;  1SNQ A;  2F0E A;  3EJI A;  1STH A;  3E5S A;  1TT2 A;  4KD3 A;  1EY8 A;  2F0L A;  3NP8 A;  4F8M A;  5J1Z A;  4HTH A;  2EYP A;  4WRD A;  3QOL A;  5CV9 A;  3SK8 A;  1U9R A;  4DFA A;  1II3 A;  3SK6 A;  5EKK A;  5KEE A;  1ENA A;  4KHV A;  4ID6 A;  3SR1 A;  4KD4 A;  1SYG A;  3MEH A;  1EYC A;  4RKL A;  1KAA A;  5CV5 A;  1EYA A;  5DAU A;  1IHZ A;  4NKL A;  1EY4 A;  5F2D A;  5CC4 A;  5HGT A;  5JOB A;  1EY0 A;  1KDA A;  4K5V A;  3DHQ A;  5C6A A;  2EY5 A;  4J6H A;  3TME A;  3PMF A;  4HMJ A;  4ODG A;  3MVV A;  5IGB A;  2PYK A;  3SK5 A;  5DEH A;  1SYE A;  4NMZ A;  1EYD A;  5CV8 A;  3QOJ A;  3ITP A;  2EY2 A;  4IAL A;  4YIJ A;  3OMG A;  5J39 A;  4EVO A;  3MXP A;  5KYI A;  5E1F A;  5CGK A;  2F0M A;  4J1M A;  1TQO A;  1F2M A;  2F0U A;  2F0T A;  2F0J A;  2RDF A;  3C1F A;  3MHB A;  4QB4 A;  4DU9 A;  4PMB A;  5E3F A;  5C4H A;  4MIU A;  2EY6 A;  2EYL A;  3P75 A;  4N9P A;  5IOC A;  5CV7 A;  5J22 A;  2SNM A;  3OMC A;  3R3O A; 
#chains in the Genus database with same CATH topology
 3MZ5 A;  2DY7 A;  1KAW A;  3F2C A;  2Z6B A;  1SDF A;  1S4Z A;  1TWH H;  3KF6 B;  4BY1 G;  1A3V A;  3S1M H;  5C4J B;  1EZ8 A;  4KK7 A;  2LFN A;  4ABN A;  3I4N B;  5C0X H;  3CPW A;  1PV4 A;  1A3U A;  1JWS D;  1EY6 A;  1HTL D;  1L1O B;  1K8M A;  2H1E A;  2LKV A;  3J7A V;  4RCO A;  2K7V A;  1K73 C;  1A2T A;  4CJ0 B;  4HSP A;  3OSO A;  2F0Q A;  2FIN B;  4ZQ3 A;  5IT9 c;  2EXD A;  4B3S L;  2Z8L A;  2F0P A;  4NW2 A;  5T1G A;  3K7A H;  3U9O A;  2UXC Q;  4RWS C;  5IOD A;  3N6R A;  2FMM A;  1PTO D;  1LAB A;  3HOU H;  1WJJ A;  4U68 A;  3I3C A;  2JA7 B;  3U9S A;  1VQD A;  5CBE E;  3G71 A;  4OHJ A;  2OCE A;  5ELO A;  2ASB A;  2JN4 A;  1IBK L;  1VQK A;  2KEN A;  4G57 A;  3UDX A;  3H0G B;  1SLJ A;  1ET6 A;  1JT8 A;  1CZW A;  2K1B A;  2X69 A;  1STY A;  1MKH A;  3BDL A;  1SJE D;  3NQI A;  2F4V L;  4KMU C;  3NK9 A;  1SBB B;  4R4Q A;  3S1N B;  2R7D A;  4A3D B;  1F77 A;  4GN3 B;  2J7Z A;  4KY5 A;  1L0X B;  3OTO Q;  4JPB W;  3TBI B;  2XVS A;  3S14 B;  2HDM A;  1I94 Q;  3UDF A;  4DV3 L;  1SN8 A;  3CAM A;  4YWL A;  3TDQ A;  2BH8 A;  3QOL A;  2IL8 A;  2G9D A;  3SR1 A;  2A6H C;  3A8I E;  3K5M A;  1GXD C;  4LF7 Q;  3LNN A;  2LMC B;  1VS0 A;  4J6H A;  2AUK A;  1K0R A;  2LSS A;  4DR3 Q;  4DUZ Q;  3I70 A;  1EIF A;  1LT3 D;  4IUQ A;  3JAM i;  2EY2 A;  3TRE A;  1Q86 C;  4HN7 A;  1JMC A;  1Y1W G;  2MHV A;  3J7Z C;  3CXC A;  1ENF A;  2PMZ B;  2EY6 A;  2EYL A;  2NB0 A;  1DZ1 A;  1IYU A;  2M9V A;  4CBV A;  4K14 A;  1BCP F;  1PTO F;  4DNI A;  5CMD A;  4J8Q A;  2XN9 C;  2H5X A;  1S5B D;  2RBM A;  5C3E H;  2KUM A;  5FO8 B;  3RUZ A;  1GD7 A;  1PFS A;  2I0Q A;  4CDF C;  2R93 G;  1RCV D;  1VCI A;  3VYT A;  1EEF D;  1NSN S;  2Y0S G;  4IFD I;  1XNQ L;  2B2V C;  1EQT A;  5M5X H;  1WTW A;  4QUC A;  4JVZ A;  2EYH A;  4UAI A;  3S2D B;  1G29 1;  3H94 A;  4IFD G;  4I7Z C;  4A4I A;  4GZY C;  4ZUI A;  3U4Z A;  3DM3 A;  2Q8R E;  4DAY B;  2K14 A;  1EU4 A;  3GTQ B;  2PQE A;  3CCE A;  5CR3 A;  1EY9 A;  3B6Y A;  5KNB A;  1PH3 A;  4JBM A;  3GTO B;  3PO3 H;  5IYD G;  2WAC A;  1IBK Q;  1J6Q A;  4ZCK A;  1QUQ A;  3HOV G;  4B9X A;  3LWU A;  4IUN A;  1R9T B;  2N3S A;  1X3E A;  3P1H A;  1L2F A;  1YNX A;  1CZG A;  3OWF A;  1MBY A;  3NPP A;  1SND A;  2J0T D;  3Q24 A;  1PRT D;  2F3V A;  1TS2 A;  1KHI A;  2ICI A;  1B53 A;  1TWG B;  2JYO A;  2CQA A;  1X6O A;  2F4V Q;  2IY5 B;  1BKB A;  4RG1 A;  1YI2 A;  1G51 A;  4C3J G;  4POG A;  1O80 A;  5BR8 L;  1QVF A;  1OXS C;  2JP1 A;  2HDL A;  3HOZ H;  3S17 B;  2RHS B;  2MJ8 A;  2GVB A;  1VQ7 A;  1KRT A;  5IWA L;  2E2D C;  1CSP A;  3W1B A;  1T5E A;  5I6Y A;  3ICE A;  3MWY W;  1PYB A;  1ASY A;  3SVM A;  1PLF A;  1V1O A;  1U4P A;  1V1P B;  1IKM A;  1GUT A;  3S2H B;  3PCO B;  3A7L A;  2FJ2 A;  1S5F D;  2N88 A;  1Q46 A;  1EY8 A;  3I4O A;  4HTH A;  3TN2 A;  3HOW G;  5ELE A;  2AMC B;  3SK6 A;  4ZK9 B;  1Z9F A;  1RF2 D;  4TSS A;  3CCU A;  1E2V A;  4X64 L;  2CKZ B;  3C3L A;  2UUB L;  3HRZ C;  4LUO A;  1GUO A;  5C44 G;  4IQZ A;  1YVC A;  3OIQ A;  4A3M H;  1Q1B A;  2QA4 A;  1MSG A;  2F0U A;  1YNN D;  4F88 A;  4LF5 Q;  3IRB A;  1RL2 A;  3OIP A;  1VQP A;  3HKZ E;  4PZ6 A;  4GKK L;  4R4C A;  2CW0 C;  3KFU A;  1LT5 D;  3R3O A;  4O1N A;  3NTI A;  5C4Z A;  1JCK B;  1A8V A;  1STA A;  2E8G A;  1EQR A;  1XNQ Q;  3RN5 A;  1KD1 C;  5EQ0 A;  3KF6 A;  2KVM A;  2YV5 A;  4P72 A;  3MFY A;  4MTK A;  3J7A 5;  2LS0 1;  3DLL A;  1XJV A;  4GNX B;  1JR0 D;  3V96 A;  4Y7N H;  2EOT A;  3M4O B;  2E75 C;  4XYQ A;  4BBS B;  1L1O A;  2K4K A;  1KIX A;  4KJN A;  4OWT B;  1BF4 A;  1XPO A;  5EAY A;  4ZKB B;  1LV9 A;  3KJO A;  2KQ3 A;  4C3H G;  2F0D A;  3GQB A;  1HZC A;  1CHQ D;  5IYB G;  4I65 A;  4B3T L;  4KKS A;  2RKS A;  4LMQ D;  1J5E Q;  2OF1 A;  1A2U A;  1CQF A;  2F1M A;  1UE7 A;  4O2D A;  1FNU A;  4AQY L;  3S1Q B;  1VQJ A;  1NCV A;  3A8J E;  2WP8 J;  2QF7 A;  3GTM B;  1E2Z A;  4OO1 I;  1C7Y A;  3PO2 B;  1E24 A;  5E4X A;  2KOL A;  3AYH B;  2N8N A;  2L12 A;  5BR8 Q;  3DXJ C;  1VQC A;  3HOY G;  2EYM A;  2E2I B;  4OO1 G;  5A35 A;  3GTK B;  2WKC A;  5I6W A;  4FF1 A;  5JEA J;  5C5L A;  2NVY B;  3WWV A;  1D5Z C;  4HJ8 A;  5M5Y H;  1Y8P B;  2QDB A;  4KY6 A;  2ZJR A;  3NEN A;  3E5S A;  4P74 A;  1HPC A;  2D62 A;  3NBI A;  4R4I A;  2UUB Q;  3CRL C;  4QQB X;  4FNF A;  2JA6 H;  4X62 Q;  5LL6 X;  1EY0 A;  2MNA A;  3GD7 A;  4HMJ A;  3RZO B;  4YCU A;  2DNC A;  1KTK A;  3VDY A;  1J9O A;  3MXP A;  3NEL A;  1MI2 A;  1N33 L;  5CGK A;  3Q22 A;  4LF8 L;  3MHB A;  5HGT A;  5BN5 A;  4RHS A;  1U4R A;  4JK1 C;  5ELD A;  2WII B;  1Q1E A;  3U58 A;  4XXE A;  2VW9 A;  3FKI G;  3HZX A;  3E0E A;  1PRT B;  3CCV A;  1VDZ A;  2IT1 A;  2F3W A;  4BXX G;  2PZW A;  1IYV A;  4XTC S;  3HFZ B;  2XTI A;  3KBG A;  1M4V A;  4JI8 L;  1LUZ A;  1K8G A;  4KY7 A;  4I7A A;  1HCZ A;  2UUA L;  2B63 B;  1QNU A;  1X3G A;  4JI5 L;  4DV5 Q;  1KDB A;  3VR4 A;  4DAV A;  1LTA D;  4DR2 Q;  2PI2 E;  3HP3 A;  3S24 A;  5EJW A;  1YHQ A;  2SEB D;  4A3E H;  2K03 A;  1YIJ A;  3MXU A;  1IW7 D;  3PUV A;  3J80 i;  4CHT B;  1NAP A;  2K5N A;  5AJ3 L;  4JBW A;  4AQY Q;  2A69 C;  1XX8 A;  3HKZ B;  4DK6 C;  3CQZ B;  3AFQ A;  5M3M G;  2NN6 I;  4A3F B;  2A6E D;  5FKA C;  4ULL A;  3I2Z A;  4X66 L;  3QB3 A;  1A3T A;  3E9I A;  2A68 D;  2KHI A;  2NN6 G;  1O7Z A;  3DEP A;  3W5O A;  3HS0 C;  4B3M L;  3S15 H;  2JEA I;  4A3B G;  3C2P A;  4A3J B;  3J81 E;  4C3I B;  1STB A;  5I9P A;  1A62 A;  3VA5 A;  3BJU A;  1HNX L;  5IY0 A;  1WYD A;  1VQL A;  3NWS A;  3PF5 A;  2R92 H;  3E6Z X;  5ELF A;  3R93 A;  2FHT A;  4BY1 H;  5M3F B;  1DXM A;  2ZTE A;  3H91 A;  4ME5 A;  4GLV B;  4HIO A;  1YJ9 A;  4OIJ A;  3A0J A;  1HR0 W;  4NP5 A;  1JJC B;  1YJW A;  2NVX H;  2Z0S A;  1I4X A;  2F0V A;  1SNQ A;  1V1P A;  4QGU A;  2I5H A;  3I4M B;  3UI2 A;  1FNV A;  1TWH B;  1CKM A;  1VQ8 A;  1GUG A;  5CV9 A;  3S1M B;  3CKI B;  2R7Z G;  3M7N A;  1K0S A;  4WJ3 M;  5G3L D;  1N33 Q;  1BBW A;  4NMZ A;  1EYD A;  4GN4 B;  1BUV T;  5KYI A;  1B44 D;  1TQO A;  2C35 B;  1YBY A;  1CFM A;  5J22 A;  1IBM L;  3K7A B;  3A54 A;  3H0G G;  4R4T A;  2KJX A;  1BBU A;  1QOH A;  1AZQ A;  3GTG H;  3T1Y Q;  4YCW A;  3G48 A;  4BY7 G;  4ME3 A;  4JI8 Q;  1KXL A;  4GS3 A;  1NMG A;  4JI5 Q;  1Z7T A;  5IYC G;  1TR5 A;  3GV3 A;  3EIV A;  1JWU D;  3L2P A;  4BBR B;  4CJ2 C;  1HXY D;  4UP8 A;  1WVL A;  1NJI C;  4CDD C;  4GNX A;  2K5V A;  1YNJ D;  1EIY B;  1DGS A;  2R7F A;  1F9R A;  4DR7 L;  3BZK A;  3VR2 A;  2VUM B;  4G7Z C;  4CKC A;  1Q90 A;  1JB3 A;  3JAM c;  4B3R L;  5D14 A;  2LY7 A;  4H02 A;  1Y8O B;  3QIA A;  4B3M Q;  3TP7 A;  5KGU A;  1SE8 A;  3BG3 A;  4HID A;  2Z6K A;  3T1H L;  4UPA A;  5EPL A;  5ELN A;  1LT6 D;  1Y1W H;  1G8Z D;  3C46 A;  1T9H A;  4JI0 L;  1WOC A;  4K5X A;  3S16 H;  1E2W A;  2I07 B;  4OGQ C;  1C48 A;  1HZA A;  4ZAI A;  3BYT B;  2PW5 A;  4IPG A;  3LX0 A;  4TKO B;  3DWQ A;  2UXC L;  2R93 H;  3K0X A;  3SHL A;  4HIM A;  4LK1 C;  3HEJ A;  3NQT A;  3KLS A;  4NB3 A;  3TEH B;  5IGC A;  2PW7 A;  3W3A A;  2JXM B;  3KF8 B;  1E3P A;  3I7F A;  5C3E B;  3GO5 A;  2VXW A;  2JK8 A;  2KA7 A;  3G4S A;  4IN3 A;  4L6T B;  4IFD H;  2B2U C;  3W1G A;  3LWE A;  1HNW L;  3PUY A;  1GUN A;  1U5K A;  2L15 A;  2OQK A;  3MEH A;  4XQJ A;  2VQE L;  2NVQ B;  2V4D A;  3RMH A;  4Y52 H;  3RNU A;  3DHQ A;  3CF5 A;  2B8G A;  2N78 A;  1O78 A;  5M5X B;  3K0Y A;  3NE5 B;  2B8F A;  5DNF A;  1EYG A;  3I55 A;  1VQ5 A;  1H9J A;  4BA2 I;  2F3I A;  2DNE A;  2PYK A;  2OTJ A;  5DEH A;  1UAP A;  1EU3 A;  4IUV A;  1VQF A;  2CWP A;  3QWN A;  1LLR D;  4C2M B;  3HOV H;  3AU7 A;  4JOI C;  1WTO A;  3P75 A;  3BVZ A;  5CV7 A;  2HIV A;  3L9A X;  3OTO L;  4JC0 A;  3H3V I;  1QCB D;  1E1T A;  3EBE A;  3T53 B;  1I94 L;  2Q2H A;  2HIX A;  3OYY A;  4X3T A;  2EYO A;  2B2Y C;  3K58 A;  4JV5 L;  4FYD A;  2SNS A;  3T13 A;  1SYB A;  3ZYY X;  3PIO 3;  4LF7 L;  4F87 A;  1SJH D;  3V2T A;  4XT1 B;  1BBX C;  1GKH A;  4DR7 Q;  2RDG A;  4DR3 L;  5C3X A;  3RZD H;  4B3R Q;  1RTN A;  1JE4 A;  4K2L A;  2B2T A;  1ICF B;  3DMU A;  3RLF A;  1Y1V G;  1EFI D;  3S9W A;  1M1K C;  3LGJ A;  3I56 A;  2E2J H;  2NWG A;  3IL8 A;  1S5D D;  3TZD A;  2IX1 A;  5C44 H;  4DV4 L;  5ELB A;  3CCL A;  3T1H Q;  1UE5 A;  1HR0 L;  1VF7 A;  4DGZ A;  4JI0 Q;  5FLX E;  2F0O A;  2X6L A;  3TP6 A;  2K50 A;  4DR4 L;  3M7G A;  1SNO A;  4DPG A;  4U67 3;  2D0O A;  3KLS X;  1BCP C;  1ESF A;  1PTO C;  3CRK C;  4JBK A;  1GHK A;  1IYJ B;  2NTS A;  2N55 A;  2H4O A;  2NZ1 D;  2HHH L;  1E22 A;  3C1E A;  1TS3 A;  4FXD A;  1SYC A;  1KLG D;  1WCM B;  4LF4 Q;  3MAQ A;  1HNW Q;  3D4D A;  3P7J A;  3EJI A;  4KD3 A;  4BBS G;  2PPB C;  4OON A;  2VQE Q;  3D31 A;  3ERS X;  1IBL L;  3AMU A;  5GAH C;  4OEL B;  1JJ2 A;  4GOP C;  1U9R A;  4LFA Q;  4LW1 A;  1IHZ A;  1ZXT A;  3I90 A;  3S1R B;  1DOL A;  4QUF A;  1KQS A;  2GN5 A;  4IJL A;  1G2S A;  5IYB H;  1EWH A;  4DR1 Q;  3CPF A;  1V1Q A;  2ZT9 C;  5K36 G;  5A2Q E;  2CVR A;  5CBA E;  2NYZ D;  1QB5 D;  1Q3L A;  4JYA L;  1BVS A;  1D6E C;  2JQO A;  1J8I A;  1EL0 A;  3MC0 B;  4RGM A;  3PO2 G;  2SNM A;  4Q5V A;  1HFN A;  2VL6 A;  4YHH L;  4LWC A;  2ZXR A;  1B7Y B;  1F9Q A;  3D8G A;  3D0F A;  1EQQ A;  4JV5 Q;  3H09 A;  1PXU A;  3MFG A;  3TRZ A;  3HOY H;  1N34 Q;  1UEA B;  1H95 A;  4OO1 H;  1X3Q A;  2NBF A;  3TP8 A;  4HMI A;  3GTJ H;  2IPK D;  3RLN A;  4FO2 A;  4LFB L;  1VQB A;  1JIC A;  3VR6 A;  3J7Y W;  3PIO A;  1RD9 D;  2OQ0 A;  2Z4I A;  4A3I H;  1O7I A;  1XMQ Q;  3GTP B;  5FJ8 G;  2L9H A;  4IOA A;  1S5E D;  4NXN L;  1PYW D;  4A3C G;  3DWP A;  3PUZ A;  4EX5 A;  2CH4 W;  3Q0A A;  1LTR D;  4LF5 L;  1XPU A;  1SE3 A;  2A6H D;  4Q0F A;  4DV4 Q;  1HR0 Q;  3BU2 A;  1TWA H;  2E5L Q;  5M5Y B;  4LJZ C;  4NDX A;  1AW7 A;  1BQQ T;  2JA8 H;  5COY A;  4CDC C;  1EIH A;  1SR3 A;  2CWA A;  1CUK A;  4DR4 Q;  5EBC A;  1E7Z A;  1K83 H;  1LYL A;  3SEB A;  3FHW A;  4UY8 C;  4CGY B;  3ULL A;  1ENC A;  1P16 A;  1BOS A;  2L1B A;  1F2Z A;  1TS5 A;  4L5T A;  1VQA A;  1VQ6 A;  1B70 B;  5EKL A;  3DWA A;  5CV6 A;  2NZO A;  2A73 B;  5E7N A;  2HHH Q;  5HUR A;  3NSW A;  1X56 A;  4BXX H;  2Z4H A;  4IUR A;  4YWK A;  2PI2 A;  1XMO L;  1CA6 A;  1A6X A;  2VB3 X;  2RSN A;  1IBL Q;  1LT4 D;  2CFM A;  2K5W A;  1WFQ A;  4N8X 1;  1J5E L;  1DOM A;  4C56 C;  3J80 c;  1GO3 E;  2CCZ A;  1TT2 A;  5J1Z A;  3ND9 A;  3KF8 A;  5FLX L;  4PQX A;  4A3G G;  1K8O A;  2AQ3 B;  3DUZ A;  4RKL A;  1KAA A;  4NKL A;  1EY4 A;  1C4Q A;  1KDA A;  2BH2 A;  3HKZ G;  3PMF A;  4A3K B;  4LNQ A;  1SFO H;  1QWY A;  4JYA Q;  3K5L A;  1SYE A;  3GTL H;  3QOJ A;  4YIJ A;  5M3M H;  1GHJ A;  2AWN A;  3DM1 A;  4QB4 A;  4YHH Q;  1AZP A;  5E3F A;  4A3E B;  2NN6 H;  2PNH A;  3WOF A;  3PV0 A;  3CD6 A;  1NBW A;  4R8N A;  4B9W A;  1S5C D;  2B3G A;  2ZTC A;  4UHV A;  3F1Z A;  4A3B H;  2BA1 A;  2PZU A;  3ND8 A;  1I6H H;  4LFB Q;  4IPC A;  2YU9 B;  1SE2 A;  3BVM A;  4YY3 Q;  5M3F G;  4X62 L;  1QE6 A;  5L37 A;  2GVA A;  4HJ7 A;  1LTB D;  2HQL A;  4NXN Q;  5FO7 B;  4DR5 Q;  2F0F A;  5KNC A;  1FJG Q;  1TWC H;  5A2Q L;  1MSH A;  4G4K A;  4JI6 Q;  2K32 A;  3NUC A;  3I4M G;  4L63 B;  3WOE A;  1XXG A;  2RDH A;  4LF9 Q;  5I4D A;  2R92 B;  2JSO A;  4RH6 A;  1G91 A;  4BY1 B;  2Q2T A;  1GM5 A;  4WJ4 A;  1Q82 C;  2R7Z H;  1TVX A;  2HD3 A;  4DAP A;  5IP7 H;  2NVX B;  1X32 A;  2WIN B;  4M8A A;  2K01 A;  5ELC A;  1PRT F;  2IX3 A;  3J7A F;  1Y14 B;  2I46 A;  4EGV A;  4L8J A;  2F4I A;  3KJP A;  3PSI A;  1STE A;  2KCN A;  2CW0 D;  1PVO A;  4DV5 L;  3EFX D;  2F0G A;  3VYR A;  3T4A C;  4DR2 L;  1WTH A;  3IAY A;  4G7O C;  2HT1 A;  3FP9 A;  1XMO Q;  4N8F A;  2KHS A;  1V43 A;  4BY7 H;  3CME A;  3EA6 A;  1QZG A;  2BE5 C;  3AFP A;  1H9K A;  2D5D A;  2RCF A;  4BA1 I;  5IYC H;  2MP1 A;  4LUZ A;  1XYI A;  1WD0 A;  4BBR G;  2VB2 X;  4RMF A;  1ASZ A;  2F0E A;  4WJW A;  2G9H D;  3CP0 A;  4UP9 A;  3CC2 A;  5FOB B;  2VUM G;  1ENA A;  3CCR A;  4ID6 A;  1EYC A;  5DAU A;  4IPD A;  1AP0 A;  4RGO S;  1IXR A;  1I4G A;  1EOT A;  4K5V A;  2SDF A;  4DV6 Q;  1LTS D;  2PO4 A;  3MVV A;  1L0W A;  3CCM A;  3PIP 3;  5EPJ A;  1XPR A;  3VA7 A;  3BVG A;  5E1F A;  4FXK C;  4IUP A;  2TSS A;  4OXP A;  4PMB A;  2WV6 D;  5H1S E;  1C9O A;  1MD2 D;  3HOX H;  4OWX B;  1HA6 A;  2EJF C;  1SRU A;  4OWW B;  1X3F A;  5KYL A;  1VQG A;  1I4P A;  4DR6 Q;  1EEI D;  1IZ6 A;  1ILP A;  1OXX K;  4P71 A;  1MHW C;  2NTT A;  4KHP Q;  4X3S A;  4EQO A;  4WFN 3;  3K5O A;  1Y1W B;  1IL8 A;  3Q6S A;  4JI7 L;  1ML0 D;  5C4X G;  1HFG A;  2K05 A;  4V0B A;  1SYF A;  5C3E G;  1W6K A;  1EY7 A;  4A3L H;  2EYF A;  2ENB A;  3BZC A;  5IGG A;  5LMU L;  1D8L A;  3D4W A;  3SDZ A;  3T1Y L;  1DOK A;  3V05 A;  4HCS A;  3E0J A;  4AYB E;  4QF4 A;  1B3Q A;  1RHP A;  1TWF B;  2D0P A;  2X6G A;  4APV A;  4UDU C;  1JOQ A;  1MJC A;  4RAU C;  1EOV A;  4GLX A;  4DNR B;  4A93 G;  1X3P A;  3GV6 A;  2JA5 H;  2B2W A;  4HAE A;  4K8J A;  3SE0 A;  3U4V A;  3STB D;  4LUV A;  2L4N A;  4DAY A;  1TWG H;  1PZI D;  3URY A;  1B3A A;  4RKB A;  1YZ6 A;  1Z47 A;  2B2U A;  1DM0 B;  3HOV B;  2E2H H;  2IX0 A;  2Z1C A;  4F7X A;  4HJ5 A;  3Q8D A;  1PHJ A;  5I9O A;  5M9O A;  1XNR L;  1K3R A;  5LL6 S;  3IFT A;  3PUX A;  5LMN Q;  5KEE A;  4ZLT F;  5HGQ A;  1A15 A;  4CKE A;  2UXD L;  3FRP B;  1Y1V H;  1PH7 A;  3CC4 A;  1N32 Q;  1SRO A;  5HY6 A;  1QNK A;  2A5H A;  4KKU A;  3I4N G;  2HUG A;  3QO2 A;  5JEA G;  4IOC A;  3ITP A;  3VYS A;  3PIP A;  1JQY D;  1Q8K A;  3RZD B;  4QL5 A;  2EVB A;  1JE5 A;  3ER0 A;  4DV7 L;  1PTO H;  4N9P A;  1UE6 A;  3L0O A;  1LM0 A;  4DAM A;  3K5N A;  2E2J B;  4RFB A;  1CK1 A;  1XTC D;  3CHB D;  2MQH A;  5C44 B;  1B9N A;  1T5X D;  1N8R C;  2OWO A;  4X3K A;  1L1O C;  4JI7 Q;  2FMC A;  5JJL A;  3FMC A;  3FPU B;  2CQO A;  2DJF C;  2JA7 G;  4KHZ A;  5GAD C;  2LXK A;  2O2L D;  2WAQ E;  5EPK A;  2WKD A;  1WCM G;  1CM9 A;  2ZTD A;  3QG1 A;  1SMY C;  2FXQ A;  2IW3 A;  1W2B A;  5LMU Q;  3PF4 A;  1DON A;  3FEW X;  4IJH A;  4X65 Q;  2XGT A;  1DD2 A;  3HOU B;  1UE1 A;  2F0H A;  1EWC A;  2XWB B;  2YTY A;  1NR2 A;  1CT1 D;  3TP5 A;  5FO9 B;  2RQX A;  3RR5 A;  2EY1 A;  4A3D G;  3BYY B;  4DK3 C;  3CCJ A;  5K36 H;  1H9M A;  5D3I B;  1YNJ C;  2NUC A;  4HED A;  3SXH A;  3S1Q H;  1ZYR C;  2N49 A;  2BCO A;  1BXT A;  3PO2 H;  2OTL A;  3L3O C;  4JW0 A;  4JI4 Q;  2ZXO A;  5IE8 A;  2E2I H;  1ET9 A;  1XNR Q;  3CMA A;  2F0I A;  4JI3 L;  1ZEQ X;  2A8V A;  4K0K Q;  3OPO A;  3K6O A;  1S72 A;  2UXD Q;  4FVM A;  2Q2U A;  2EYP A;  3HOY B;  5FJ8 H;  5G3L F;  5EKK A;  4A3C H;  1Y69 U;  4AYB B;  4R8I A;  3GTJ B;  1D1I A;  5LHY 1;  1I4R A;  2EY5 A;  4TVA B;  3J81 j;  1X54 A;  2KHJ A;  4UP7 A;  2BDO A;  4A3I B;  1WTQ A;  3TQY A;  4DV7 Q;  2PCF B;  2WB1 E;  5J39 A;  4A76 A;  3RZO H;  3X3M A;  4NXM Q;  1F2M A;  1PH2 A;  1FGB D;  1OXV A;  3MXN B;  4IZ8 A;  4FDB A;  4P75 A;  3TS2 A;  3MEF A;  5IGE A;  4LF4 L;  4KV6 A;  4OL7 A;  4MHE A;  4P73 A;  3X3N A;  1I3Q H;  3NXW A;  3J81 L;  4IO9 A;  2JA8 B;  4LFA L;  3T56 B;  4JBJ A;  2CH4 A;  4IUT A;  2XNA C;  4XQQ A;  4YCV A;  5IYD H;  4ALP A;  4DR1 L;  1GJX A;  3OHX C;  2BDN A;  3I73 A;  5IP9 G;  2EYJ A;  3FVQ A;  4HCE A;  1HJP A;  3IFD A;  1I5F A;  4K5W A;  2B2V A;  4RGN A;  1I4Q A;  3BS1 A;  4IPH A;  4JG2 A;  2BOS A;  1ESR A;  4A3G H;  2D2C C;  3PO3 B;  3M85 A;  4K2K A;  1VMC A;  4DXF A;  1CHP D;  5IGF A;  4EQN A;  2MO1 A;  3Q23 A;  1JJG A;  4A3K G;  4C3J H;  1QG7 A;  1HA5 A;  1O7Y A;  1N34 L;  1FNW A;  2A19 A;  4C1N K;  4OX9 Q;  2L55 A;  3CC7 A;  1HHV A;  1AE2 A;  1YIT A;  3BDO A;  4MTN A;  2EZV A;  2V1C C;  2BA0 A;  3H3V C;  4DUY Q;  1HZB A;  4K8I A;  1XMQ L;  4QY7 A;  2ZJP A;  1SFO B;  3HOW H;  3HOZ B;  2WAQ B;  3K57 A;  1H9S B;  2QIL A;  5IIF A;  2ZM6 L;  4AIM A;  5M3M B;  1FL0 A;  2K5Q A;  2JE6 I;  4JI3 Q;  1VQO A;  4YWM A;  3JAM E;  4DV2 Q;  3H6M A;  5M3F H;  4K6L A;  2NVT H;  2E5L L;  1VQH A;  2IWH A;  2F0K A;  3ONA B;  4A3B B;  2EDG A;  3NP8 A;  4B08 A;  1I6H B;  1Q12 A;  4WRD A;  1NR4 A;  1II3 A;  2R92 G;  1RIP A;  4KHV A;  3I4M H;  1UWV A;  1Q8I A;  3NBH B;  1SYG A;  2RA4 A;  1N36 Q;  4HIK A;  4GKJ L;  4DV1 L;  1WD1 A;  4LF6 Q;  2RVL A;  3G7L A;  4A3M B;  1U0L A;  2XRS D;  1BR9 A;  1ICW A;  5JJZ A;  3F2B A;  1PDQ A;  2RCN A;  4R9W A;  1TWC B;  1Z6H A;  2MPM A;  4BS9 A;  1DYQ A;  1XTD A;  2KCT A;  1FVI A;  4DNT B;  4HJA A;  4IFD J;  4DKA C;  1W3S A;  2F0T A;  3C1F A;  3M4P A;  2R7Z B;  2KCM A;  2Z9H A;  4RCN A;  2IHE A;  4WOR A;  5JPM C;  1GUS A;  5JPN C;  1HZ9 A;  1BCP D;  4C3H H;  4GNX C;  1EY5 A;  1KNE A;  2QDL A;  1KL9 A;  4Y7N B;  2K52 A;  5EBD A;  3G6J B;  4PG3 A;  4X3U A;  2RHQ B;  1SNP A;  2O4X A;  2R61 A;  3KDF B;  3I91 A;  4KLK A;  5GAG C;  5KIX A;  4BBR H;  2D9U A;  2I5M X;  4NPS A;  1JWM D;  3A5Z B;  3OOC A;  3E3X A;  4KTA A;  3M4Q A;  5M5W H;  1PH4 A;  2M00 A;  3NTK A;  1NUC A;  2WB1 B;  3ULP A;  1MJE A;  4BY7 B;  4BWG B;  5LMN W;  2UU9 L;  4DV0 L;  2VUM H;  2E76 C;  1DCZ A;  2PQA B;  2KEC A;  3GP7 A;  2Z6K C;  1WTX A;  4CKB A;  1STN A;  3EQL C;  4DK0 A;  1OXU A;  2J4X A;  3A55 A;  3AB9 A;  4YY3 L;  3D3R A;  4PZ7 A;  2K75 A;  2GA4 B;  4DR5 L;  2Q8T A;  1B2T A;  2VY3 A;  1FJG L;  2ZM6 Q;  1G6Z A;  3U50 C;  2UXB L;  4XDX A;  3M3Y H;  4QMG A;  1GVP A;  1PH5 A;  2EJG C;  5C0X J;  5FLM G;  1KLU D;  4JI6 L;  4LF9 L;  4ZUJ A;  4KKT A;  2K28 A;  2UUC L;  1VQM A;  1EIG A;  3AQQ A;  4DXG A;  3F2U A;  3BDC A;  5JAV A;  3G6E A;  3HOX B;  1TXY A;  2JJQ A;  2B29 A;  2DUD A;  4KJO A;  5I2X A;  1VQN A;  1XWE A;  3P20 A;  2JA6 B;  4A75 A;  5C4X H;  3H15 A;  5GQO A;  4GKJ Q;  4DV1 Q;  2QEJ C;  2EQS A;  1FD7 D;  4LFC L;  1AFP A;  2VS1 A;  2MFI A;  3HGB A;  1I6V C;  3FKI H;  2ES2 A;  1IKL A;  4O0A A;  2L0C A;  2NVQ H;  5EKI A;  5IT9 E;  1YEZ A;  5DM7 3;  2QGQ A;  4IAL A;  3OMG A;  2F0M A;  2B63 G;  2ID0 A;  2F0J A;  3JAM L;  1HQR D;  4B3S Q;  1PRT C;  1SXT A;  1CTM A;  3MXN A;  4P2C B;  3KUP A;  3KLR A;  1I50 H;  4A93 H;  3KOJ A;  2AHO B;  1H9R A;  1MGS A;  1K8A C;  1Q7Y C;  2XWJ B;  4E6I A;  3QJY A;  1LTG D;  2VZA A;  4A3F G;  4DF7 A;  2B2T C;  2XIW A;  1FGU A;  1X55 A;  4DV6 L;  3A8K E;  2JA5 B;  1AH9 A;  1VQ4 A;  4EQ5 A;  2UU9 Q;  4DV0 Q;  1SMX A;  2L11 A;  2Y0S E;  2O5I C;  3D6W A;  1QIL A;  2ZJQ A;  3VR3 A;  1PH6 A;  4A3J G;  2QEX A;  1SNC A;  2F0S A;  1LAC A;  4C2M H;  4C3I G;  4QJF A;  1HQM C;  1PYS B;  1ZKO A;  1WTP A;  2E2H B;  4XT3 B;  1F2L A;  4HR7 B;  1ROD A;  1EQV A;  2K5D A;  4CDE C;  3T51 B;  3VR5 A;  4DV3 Q;  3OWE B;  4DR6 L;  4MNO A;  5C4J H;  3S15 B;  2LXJ A;  1YNN C;  3I4N H;  5JEA H;  3KYH C;  1NNX A;  1YHB A;  2UXB Q;  4KHP L;  3MA2 B;  1VQI A;  2AKW B;  2OT2 A;  1K3B C;  3K7U C;  5C0X I;  1Y1V B;  4K6D A;  1STG A;  2AWO A;  1WTR A;  1GUW A;  2UUC Q;  1C0A A;  1TU2 B;  5CYU A;  5C0X G;  1D7Q A;  1SEB D;  2RF4 A;  2K5H A;  1SYD A;  1H9S A;  1BCP B;  1PTO B;  3HG9 A;  1PFN A;  2IJ0 A;  3KBX A;  1PZJ D;  1EFW A;  2JA7 H;  5EGT A;  5D65 A;  4LFC Q;  1ILQ A;  3MTS A;  1WCM H;  4DA2 A;  2DGY A;  4Z9C B;  4KD4 A;  1QJO A;  5GRO A;  3HOU G;  3E9H A;  5F2D A;  4GOP B;  3H0G H;  3NBH A;  2MGS A;  4JI2 L;  3BZD B;  4ODG A;  3S1R H;  3AEV A;  1A0I A;  1WTV A;  2XRQ D;  4L5R C;  2EE1 A;  1A63 A;  3FPP A;  3S1N H;  5COR A;  1UUP A;  4A3D H;  1NE3 A;  4MIU A;  1M8A A;  2C9O A;  3KK7 A;  4FF3 A;  3GTG B;  2K04 A;  1SNM A;  3S14 H;  2VNU D;  3GDE A;  2HCC A;  1K28 A;  4ZRZ A;  5TSS A;  1NMF A;  3J80 E;  2R6G A;  1SE4 A;  5LMN L;  3OW2 A;  1X9N A;  1UNS A;  4ILW A;  1FYC A;  2EJM A;  2BE5 D;  3J81 c;  1N32 L;  4PMW A;  1HRJ A;  5IT9 L;  3EVQ A;  3SK4 A;  1TY0 A;  5C5M A;  2EXZ A;  2M2L A;  3KDF A;  3GTP H;  3D4R A;  5JJK A;  4RA8 A;  4H44 C;  4FF2 A;  1SSO A;  4AYB G;  5IWA Q;  3NHH A;  4LAA A;  2YTX A;  1G2T A;  3PGZ A;  3R2T A;  2G5D A;  4TRD A;  2PQA A;  4A3I G;  1HNZ L;  4G7H C;  1V9P A;  1P8L A;  1TY2 A;  1B1Z A;  1F9S A;  4R4O A;  2KBN A;  3A5U A;  3S16 B;  4GN5 A;  5FK9 C;  4EQP A;  4X64 Q;  2SOB A;  3S2D H;  2NZH A;  2TMP A;  1LTL A;  2R3Z A;  2F0W A;  3L7Z C;  2YTV A;  1QVC A;  2R93 B;  2JA8 G;  2OEO A;  4CJ1 B;  4X65 L;  3GTQ H;  2Y0S B;  1U4L A;  1N9W A;  1S40 A;  1WI5 A;  4GKK Q;  2KCC A;  3T16 A;  4H13 C;  3GTO H;  2L5T A;  4J15 A;  5KRU A;  3NTH A;  2HCI A;  2F0L A;  2ZXP A;  4F8M A;  1R9T H;  1UEB A;  3STB C;  5IP9 H;  1CKN B;  1I3Q B;  1IW7 C;  1LO5 D;  1AE3 A;  4JI2 Q;  1C8C A;  4PZ8 A;  1NTG A;  3PO3 G;  5JJI A;  5CC4 A;  5JOB A;  4HJ9 A;  3UDG A;  2O5J C;  2A6E C;  3TZU A;  3F8T A;  1CSQ A;  1D5X C;  3SK5 A;  4JI4 L;  2A68 C;  4QIW E;  2A1A A;  3H3V H;  4A3K H;  4MZ9 A;  1AN8 A;  3S17 H;  4J1M A;  4AH6 A;  1EUJ A;  1EWI A;  3K80 C;  4R1J A;  3TSS A;  1JOR A;  4A3G B;  1CQV A;  4B3T Q;  2QCP X;  4OEM B;  4DN4 M;  3S2H H;  1FR3 A;  2MO0 A;  3A56 A;  4K0K L;  3VYU A;  4C3J B;  3HOZ G;  3N52 A;  2PZT A;  4JOI A;  2WAQ G;  2KEE A;  2I5L X;  1VQE A;  2A69 D;  5D3D A;  5BN3 A;  1QVG A;  2YU9 H;  1HH2 P;  5C3W A;  4S3S A;  4RHR A;  1D2B A;  3ULJ A;  2B2Y A;  2C5C A;  2Q8I B;  4JI1 L;  1PA6 A;  1KAB A;  3W2D A;  4XYO A;  3HOW B;  4MN3 A;  2P5Z X;  1JB7 A;  1IL2 A;  4NXM L;  2F03 A;  4GLA C;  4M1U B;  1F9P A;  3WDN A;  1E0B A;  1X65 A;  1HNZ Q;  1RKN A;  1R4Q B;  1SAP A;  4A3M G;  3ERO A;  2YYZ A;  1RTO A;  4ZKC B;  3J80 L;  2NVT B;  1B4O A;  1Q81 C;  3CU7 A;  5JVH 3;  1PMR A;  2OXP A;  2VQF L;  1TKW B;  2ATW A;  3I4L A;  3EN2 A;  1KDC A;  2AQ2 B;  2RSO A;  1RJT A;  3I8Z A;  4RGT A;  4POF A;  5J3B A;  4N9T A;  3HKS A;  1JOK A;  3M4O H;  1JOO A;  1KC8 C;  1BNZ A;  1YHA A;  4BBS H;  1QZH A;  1B50 A;  5IP7 G;  2K33 A;  1E1O A;  2A74 C;  3D6C A;  4QCL A;  1M90 C;  4LF8 Q;  4OIK A;  4X6A H;  4DK1 A;  3MXG A;  4ZYS A;  3CW2 C;  3SGI A;  1ONL A;  2AUJ D;  1PH1 A;  3KLW A;  2K6A A;  1U4M A;  2JEB I;  4C1N I;  1CKO A;  2ALY B;  4PV1 C;  1EZ6 A;  4L5S A;  2JA9 A;  4FF4 A;  1R4P B;  1OTC A;  1YJN A;  2DJG C;  4OX9 L;  1SMY D;  3SK8 A;  1BDO A;  5GAE C;  3GTM H;  3NWT A;  2WB1 G;  4C3H B;  3I72 A;  5CV5 A;  3RN2 A;  1G6P A;  1I4H A;  2UUA Q;  2EPB A;  3NEM A;  4DUY L;  3CCS A;  4GOP A;  2F52 A;  3GTK H;  1PH9 A;  2MUY A;  1MIU A;  2E74 C;  3DEO A;  5CV8 A;  5AFW A;  1D1K A;  5M5W B;  2NVY H;  1CI3 M;  4DU9 A;  5IOC A;  5DLQ E;  4TQU S;  5AJ3 Q;  4DV2 L;  4XIG S;  1KRS A;  1S3O A;  1ZYR D;  3J81 i;  1DJR D;  1L0Y B;  4PMC A;  3O13 A;  4HSV A;  1HTP A;  1O7L A;  1Y8N B;  4X66 Q;  4FP5 D;  3OW7 A;  4KN4 C;  4H0L C;  5FLX c;  4JCV E;  1BO0 A;  1VF5 C;  5FLM H;  1VMP A;  5DM6 3;  1N36 L;  4JI1 Q;  3K81 C;  4KN7 C;  4LF6 L;  4KI0 A;  3HOX G;  2EIF A;  4V19 0;  3R2I A;  3M3Y B;  2F0N A;  4L5Q A;  1JC7 A;  3K8A A;  1HNX Q;  2JA6 G;  1K9M C;  3UE0 A;  4QIW B;  3M4Y A;  5IGD A;  1TWA B;  3ERQ A;  4H7B A;  5ISR A;  1B8A A;  5CV4 A;  2VQF Q;  2IHF A;  1PFM A;  1QUQ B;  1TII D;  4FXG C;  3PQI A;  2DY8 A;  1PFB A;  5I2Y A;  2B39 A;  1K83 B;  2B2W C;  5C4X B;  2CHB D;  1B9M A;  4A3L G;  3A74 A;  2QKI C;  1HUM A;  3M9B A;  5K5P A;  5E4W C;  3IKJ A;  1TWF H;  2B63 H;  1F2Y A;  2HQE A;  3FKI B;  1LTI D;  4IUU A;  3ZJY C;  3RD4 A;  2PMZ E;  1TS4 A;  5KND A;  1KNA A;  1RDP D;  1PZK D;  2DN8 A;  2Q2I A;  5JVG 3;  1PH8 A;  1OO9 B;  1HUN A;  1IBM Q;  2ICE C;  3CQZ H;  3QR8 A;  3CCQ A;  3R8B A;  4A3F H;  1AEX A;  4PNY A;  3K59 A;  5NUC A;  1LTT D;  2FFK B;  2JA5 G;  1I50 B;  5BN4 A;  4A93 B;  1STH A;  1GOZ A;  4A3E G;  2AQ1 B;  1W6J A;  2WFW A;  4DFA A;  3TS0 A;  3UDI A;  1CKN A;  1EYA A;  2XSC A;  4A3J H;  4O42 A;  3FDT A;  3GTL B;  3A7A B;  5C6A A;  1OXT A;  3TME A;  4C3I H;  1NY4 A;  3F2D A;  3PUW A;  5IGB A;  1VQ9 A;  2KED A;  4EVO A;  1D5M C;  2PNR C;  1V8Q A;  2RDF A;  5C4H A;  4XQN A;  3RLO A;  4DUZ L;  2QW7 A;  3UE1 A;  1CA5 A;  5T1I A;  3JC6 6;  3OMC A; 
#chains in the Genus database with same CATH homology
 3MZ5 A;  2DY7 A;  1SDF A;  1S4Z A;  1A3V A;  5C4J B;  1EZ8 A;  4KK7 A;  2LFN A;  4ABN A;  3I4N B;  5C0X H;  1A3U A;  1JWS D;  1EY6 A;  1HTL D;  1K8M A;  2H1E A;  2LKV A;  3J7A V;  4RCO A;  2K7V A;  1A2T A;  4CJ0 B;  4HSP A;  3OSO A;  2F0Q A;  2FIN B;  4ZQ3 A;  2Z8L A;  2F0P A;  4NW2 A;  5T1G A;  3U9O A;  4RWS C;  5IOD A;  3N6R A;  2FMM A;  1PTO D;  1LAB A;  4U68 A;  3I3C A;  2JA7 B;  3U9S A;  5CBE E;  4OHJ A;  4G57 A;  3H0G B;  1ET6 A;  1CZW A;  2K1B A;  2X69 A;  1STY A;  3BDL A;  1SJE D;  3NQI A;  4KMU C;  3NK9 A;  1SBB B;  3S1N B;  4A3D B;  1F77 A;  2J7Z A;  4KY5 A;  1L0X B;  3TBI B;  2XVS A;  3S14 B;  2HDM A;  3TDQ A;  3QOL A;  2IL8 A;  2G9D A;  3SR1 A;  2A6H C;  3A8I E;  3K5M A;  1GXD C;  3LNN A;  2LMC B;  4J6H A;  2AUK A;  3I70 A;  1LT3 D;  4IUQ A;  2EY2 A;  4HN7 A;  2MHV A;  1ENF A;  2PMZ B;  2EY6 A;  2EYL A;  2NB0 A;  1DZ1 A;  1IYU A;  2M9V A;  4CBV A;  4K14 A;  1BCP F;  1PTO F;  5CMD A;  4J8Q A;  2XN9 C;  2RBM A;  1S5B D;  2KUM A;  5FO8 B;  3RUZ A;  1RCV D;  1VCI A;  3VYT A;  1EEF D;  1NSN S;  4IFD I;  2B2V C;  1EQT A;  1WTW A;  4QUC A;  2EYH A;  4UAI A;  3S2D B;  1G29 1;  3H94 A;  4IFD G;  4I7Z C;  4GZY C;  4ZUI A;  2Q8R E;  1EU4 A;  3GTQ B;  2PQE A;  5CR3 A;  1EY9 A;  5KNB A;  3GTO B;  2WAC A;  4B9X A;  3LWU A;  4IUN A;  1R9T B;  3P1H A;  1CZG A;  3OWF A;  1MBY A;  3NPP A;  1SND A;  2J0T D;  3Q24 A;  1PRT D;  2F3V A;  1TS2 A;  2ICI A;  2JYO A;  1B53 A;  1TWG B;  2CQA A;  4C3J G;  1O80 A;  1OXS C;  2JP1 A;  2HDL A;  3S17 B;  2MJ8 A;  2E2D C;  5I6Y A;  1T5E A;  3MWY W;  3SVM A;  1PLF A;  1V1O A;  1U4P A;  1V1P B;  1IKM A;  1GUT A;  3S2H B;  3A7L A;  2FJ2 A;  1S5F D;  2N88 A;  1EY8 A;  4HTH A;  3TN2 A;  5ELE A;  3SK6 A;  4ZK9 B;  1RF2 D;  4TSS A;  1E2V A;  3C3L A;  3HRZ C;  1GUO A;  4IQZ A;  3OIQ A;  1Q1B A;  1MSG A;  2F0U A;  1YNN D;  4F88 A;  3OIP A;  2CW0 C;  1LT5 D;  3R3O A;  4O1N A;  3NTI A;  5C4Z A;  1JCK B;  1STA A;  5EQ0 A;  2KVM A;  3MFY A;  2LS0 1;  1JR0 D;  3V96 A;  3M4O B;  2EOT A;  2E75 C;  4XYQ A;  4BBS B;  4KJN A;  1BF4 A;  4ZKB B;  1LV9 A;  2KQ3 A;  4C3H G;  2F0D A;  3GQB A;  1CHQ D;  4I65 A;  4KKS A;  2RKS A;  4LMQ D;  2OF1 A;  1A2U A;  1CQF A;  2F1M A;  1FNU A;  3S1Q B;  1NCV A;  3A8J E;  2WP8 J;  2QF7 A;  3GTM B;  1E2Z A;  4OO1 I;  3PO2 B;  5E4X A;  2KOL A;  2L12 A;  3DXJ C;  2EYM A;  2E2I B;  4OO1 G;  5A35 A;  3GTK B;  2WKC A;  5I6W A;  4FF1 A;  5JEA J;  5C5L A;  2NVY B;  1D5Z C;  1Y8P B;  2QDB A;  4KY6 A;  3E5S A;  1HPC A;  2D62 A;  3NBI A;  3CRL C;  4FNF A;  5LL6 X;  1EY0 A;  3GD7 A;  4HMJ A;  3RZO B;  2DNC A;  1KTK A;  1J9O A;  3MXP A;  1MI2 A;  5CGK A;  3Q22 A;  3MHB A;  5HGT A;  5BN5 A;  4RHS A;  1U4R A;  4JK1 C;  5ELD A;  2WII B;  1Q1E A;  4XXE A;  3HZX A;  1PRT B;  1VDZ A;  2IT1 A;  2F3W A;  2PZW A;  1IYV A;  4XTC S;  3KBG A;  1M4V A;  4KY7 A;  1HCZ A;  2B63 B;  1QNU A;  1KDB A;  3VR4 A;  4DAV A;  1LTA D;  3HP3 A;  5EJW A;  2SEB D;  2K03 A;  3MXU A;  1IW7 D;  3PUV A;  4CHT B;  1NAP A;  4JBW A;  2A69 C;  1XX8 A;  3HKZ B;  3CQZ B;  2NN6 I;  4A3F B;  2A6E D;  5FKA C;  4ULL A;  3QB3 A;  1A3T A;  2A68 D;  2NN6 G;  1O7Z A;  3DEP A;  3HS0 C;  2JEA I;  3C2P A;  4A3J B;  3J81 E;  4C3I B;  1STB A;  5I9P A;  3VA5 A;  3NWS A;  3E6Z X;  5ELF A;  3R93 A;  2FHT A;  5M3F B;  1DXM A;  3H91 A;  4ME5 A;  4OIJ A;  4NP5 A;  1I4X A;  2F0V A;  1SNQ A;  1V1P A;  3I4M B;  3UI2 A;  1FNV A;  1TWH B;  1GUG A;  5CV9 A;  3S1M B;  3CKI B;  3M7N A;  5G3L D;  4NMZ A;  1EYD A;  1BUV T;  5KYI A;  1B44 D;  1TQO A;  1CFM A;  5J22 A;  3K7A B;  3A54 A;  2KJX A;  1QOH A;  1AZQ A;  1Z7T A;  1TR5 A;  3GV3 A;  1JWU D;  4BBR B;  4CJ2 C;  1HXY D;  1WVL A;  1YNJ D;  1F9R A;  2VUM B;  3VR2 A;  4G7Z C;  4CKC A;  1Q90 A;  1JB3 A;  5D14 A;  2LY7 A;  1Y8O B;  3QIA A;  3TP7 A;  5KGU A;  3BG3 A;  5EPL A;  1LT6 D;  1G8Z D;  3C46 A;  4K5X A;  1E2W A;  2I07 B;  4OGQ C;  1C48 A;  4ZAI A;  3BYT B;  2PW5 A;  3LX0 A;  4TKO B;  3DWQ A;  3SHL A;  4LK1 C;  3HEJ A;  3NQT A;  3KLS A;  5IGC A;  2PW7 A;  3W3A A;  2JXM B;  5C3E B;  3GO5 A;  2VXW A;  2KA7 A;  4IN3 A;  4L6T B;  4IFD H;  2B2U C;  3LWE A;  3PUY A;  1GUN A;  3MEH A;  4XQJ A;  2NVQ B;  2V4D A;  3RMH A;  3DHQ A;  2B8G A;  1O78 A;  5M5X B;  3K0Y A;  3NE5 B;  2B8F A;  5DNF A;  4BA2 I;  1H9J A;  2DNE A;  2PYK A;  5DEH A;  1UAP A;  1EU3 A;  4IUV A;  3QWN A;  1LLR D;  3AU7 A;  1WTO A;  3P75 A;  3BVZ A;  5CV7 A;  3L9A X;  1QCB D;  3T53 B;  4X3T A;  2EYO A;  2B2Y C;  3K58 A;  4FYD A;  2SNS A;  3T13 A;  1SYB A;  3ZYY X;  3PIO 3;  4F87 A;  1SJH D;  3V2T A;  4XT1 B;  1BBX C;  2RDG A;  5C3X A;  1RTN A;  1JE4 A;  4K2L A;  2B2T A;  3DMU A;  3RLF A;  1EFI D;  3S9W A;  2NWG A;  3IL8 A;  1S5D D;  3TZD A;  2IX1 A;  5ELB A;  1VF7 A;  4DGZ A;  5FLX E;  2F0O A;  2X6L A;  3TP6 A;  3M7G A;  1SNO A;  4U67 3;  3KLS X;  1BCP C;  1ESF A;  1PTO C;  3CRK C;  1GHK A;  2NTS A;  2N55 A;  2H4O A;  2NZ1 D;  3C1E A;  1TS3 A;  4FXD A;  1SYC A;  1KLG D;  1WCM B;  3MAQ A;  3D4D A;  3P7J A;  3EJI A;  4KD3 A;  2PPB C;  3D31 A;  3AMU A;  1U9R A;  1IHZ A;  1ZXT A;  3I90 A;  3S1R B;  1DOL A;  4QUF A;  1G2S A;  1EWH A;  2ZT9 C;  5K36 G;  5A2Q E;  2CVR A;  5CBA E;  2NYZ D;  1QB5 D;  1Q3L A;  1D6E C;  1J8I A;  1EL0 A;  3MC0 B;  4RGM A;  2SNM A;  4Q5V A;  1HFN A;  2ZXR A;  1F9Q A;  3D8G A;  3H09 A;  1PXU A;  3MFG A;  1UEA B;  4OO1 H;  1X3Q A;  2NBF A;  3TP8 A;  4HMI A;  2IPK D;  4FO2 A;  1JIC A;  3VR6 A;  3J7Y W;  1RD9 D;  2Z4I A;  3GTP B;  2L9H A;  1S5E D;  1PYW D;  3DWP A;  3PUZ A;  3Q0A A;  1LTR D;  1SE3 A;  2A6H D;  4Q0F A;  5M5Y B;  4LJZ C;  4NDX A;  1AW7 A;  1BQQ T;  5COY A;  1EIH A;  5EBC A;  3SEB A;  4CGY B;  1ENC A;  1BOS A;  2L1B A;  1F2Z A;  1TS5 A;  5EKL A;  3DWA A;  5CV6 A;  2A73 B;  5HUR A;  3NSW A;  2Z4H A;  4IUR A;  1CA6 A;  1A6X A;  2VB3 X;  2RSN A;  1LT4 D;  2K5W A;  1DOM A;  4C56 C;  1TT2 A;  5J1Z A;  3ND9 A;  3KF8 A;  5FLX L;  4PQX A;  1K8O A;  2AQ3 B;  3DUZ A;  4RKL A;  1KAA A;  4NKL A;  1EY4 A;  1C4Q A;  1KDA A;  3PMF A;  4A3K B;  1QWY A;  3K5L A;  1SYE A;  3QOJ A;  4YIJ A;  1GHJ A;  2AWN A;  3DM1 A;  4QB4 A;  1AZP A;  5E3F A;  4A3E B;  2NN6 H;  3WOF A;  3PV0 A;  4R8N A;  4B9W A;  1S5C D;  2BA1 A;  2PZU A;  3ND8 A;  2YU9 B;  1SE2 A;  3BVM A;  1QE6 A;  1LTB D;  5FO7 B;  2F0F A;  5KNC A;  5A2Q L;  1MSH A;  4G4K A;  2K32 A;  3NUC A;  4L63 B;  3WOE A;  1XXG A;  2RDH A;  5I4D A;  2R92 B;  2JSO A;  4RH6 A;  1G91 A;  4BY1 B;  1TVX A;  4DAP A;  2NVX B;  1X32 A;  2WIN B;  4M8A A;  2K01 A;  5ELC A;  1PRT F;  2IX3 A;  3J7A F;  2I46 A;  4EGV A;  4L8J A;  2F4I A;  1STE A;  2KCN A;  2CW0 D;  3EFX D;  2F0G A;  3VYR A;  3T4A C;  3IAY A;  4G7O C;  2KHS A;  1V43 A;  3EA6 A;  2BE5 C;  1H9K A;  2D5D A;  4BA1 I;  2MP1 A;  1XYI A;  1WD0 A;  2VB2 X;  2F0E A;  4WJW A;  2G9H D;  5FOB B;  1ENA A;  4ID6 A;  1EYC A;  5DAU A;  1AP0 A;  4RGO S;  1I4G A;  1EOT A;  4K5V A;  2SDF A;  1LTS D;  2PO4 A;  3MVV A;  3PIP 3;  5EPJ A;  3VA7 A;  3BVG A;  5E1F A;  4FXK C;  4IUP A;  2TSS A;  4PMB A;  2WV6 D;  1MD2 D;  1HA6 A;  2EJF C;  5KYL A;  1I4P A;  1EEI D;  1ILP A;  1OXX K;  2NTT A;  4X3S A;  4EQO A;  4WFN 3;  3K5O A;  1Y1W B;  1IL8 A;  3Q6S A;  1ML0 D;  1HFG A;  2K05 A;  4V0B A;  1SYF A;  1W6K A;  1EY7 A;  2EYF A;  2ENB A;  5IGG A;  3D4W A;  3SDZ A;  1DOK A;  3V05 A;  4HCS A;  3E0J A;  4QF4 A;  1RHP A;  1TWF B;  2X6G A;  4UDU C;  1JOQ A;  4RAU C;  4DNR B;  1X3P A;  3GV6 A;  2B2W A;  4HAE A;  4K8J A;  3SE0 A;  2L4N A;  4DAY A;  1PZI D;  3URY A;  1B3A A;  4RKB A;  1Z47 A;  2B2U A;  1DM0 B;  3HOV B;  2IX0 A;  2Z1C A;  4F7X A;  5I9O A;  5M9O A;  5LL6 S;  3IFT A;  3PUX A;  5KEE A;  4ZLT F;  1A15 A;  4CKE A;  3FRP B;  1QNK A;  2A5H A;  4KKU A;  2HUG A;  3QO2 A;  5JEA G;  3ITP A;  3VYS A;  1JQY D;  3RZD B;  2EVB A;  1PTO H;  4N9P A;  2E2J B;  3K5N A;  4RFB A;  1CK1 A;  1XTC D;  3CHB D;  5C44 B;  1B9N A;  1T5X D;  4X3K A;  2FMC A;  3FMC A;  3FPU B;  4KHZ A;  2O2L D;  5EPK A;  2WKD A;  1CM9 A;  3QG1 A;  1SMY C;  2IW3 A;  1DON A;  3FEW X;  1DD2 A;  3HOU B;  2F0H A;  1EWC A;  2XWB B;  1NR2 A;  1CT1 D;  3TP5 A;  5FO9 B;  2RQX A;  2EY1 A;  3BYY B;  5K36 H;  1H9M A;  5D3I B;  1YNJ C;  2NUC A;  4HED A;  3SXH A;  1ZYR C;  2BCO A;  1BXT A;  3L3O C;  2ZXO A;  1ET9 A;  2F0I A;  1ZEQ X;  3OPO A;  3K6O A;  4FVM A;  2EYP A;  3HOY B;  5G3L F;  5EKK A;  1Y69 U;  4AYB B;  4R8I A;  3GTJ B;  1D1I A;  5LHY 1;  1I4R A;  2EY5 A;  2BDO A;  4A3I B;  1WTQ A;  2PCF B;  5J39 A;  3X3M A;  1F2M A;  1FGB D;  1OXV A;  4IZ8 A;  5IGE A;  4KV6 A;  4OL7 A;  4MHE A;  3X3N A;  3NXW A;  3J81 L;  2JA8 B;  3T56 B;  4IUT A;  2XNA C;  4XQQ A;  1GJX A;  3OHX C;  2BDN A;  3I73 A;  2EYJ A;  3FVQ A;  4HCE A;  3IFD A;  4K5W A;  2B2V A;  4RGN A;  1I4Q A;  3BS1 A;  2BOS A;  1ESR A;  2D2C C;  3PO3 B;  3M85 A;  4K2K A;  1VMC A;  4DXF A;  1CHP D;  5IGF A;  4EQN A;  3Q23 A;  1QG7 A;  1HA5 A;  1O7Y A;  1FNW A;  4C1N K;  2L55 A;  1HHV A;  3BDO A;  2EZV A;  2BA0 A;  3H3V C;  4K8I A;  1SFO B;  3HOZ B;  2WAQ B;  3K57 A;  1H9S B;  2QIL A;  5IIF A;  5M3M B;  2K5Q A;  2JE6 I;  3JAM E;  3H6M A;  4K6L A;  2IWH A;  2F0K A;  3ONA B;  4A3B B;  2EDG A;  3NP8 A;  4B08 A;  1I6H B;  1Q12 A;  4WRD A;  1NR4 A;  1II3 A;  4KHV A;  1Q8I A;  1SYG A;  2RA4 A;  1WD1 A;  2RVL A;  3G7L A;  4A3M B;  2XRS D;  1BR9 A;  1ICW A;  5JJZ A;  1PDQ A;  4R9W A;  4BS9 A;  1TWC B;  1Z6H A;  2MPM A;  1DYQ A;  4DNT B;  4IFD J;  2F0T A;  3C1F A;  2R7Z B;  4RCN A;  4WOR A;  5JPM C;  1GUS A;  5JPN C;  1BCP D;  1EY5 A;  1KNE A;  4Y7N B;  5EBD A;  3G6J B;  4X3U A;  1SNP A;  2O4X A;  2R61 A;  3I91 A;  5KIX A;  2D9U A;  1JWM D;  3OOC A;  4KTA A;  2M00 A;  3NTK A;  1NUC A;  2WB1 B;  4BY7 B;  4BWG B;  2E76 C;  1DCZ A;  2KEC A;  3GP7 A;  1WTX A;  4CKB A;  1STN A;  3EQL C;  4DK0 A;  1OXU A;  2J4X A;  3A55 A;  3AB9 A;  3D3R A;  2GA4 B;  2Q8T A;  1B2T A;  1G6Z A;  4XDX A;  4QMG A;  2EJG C;  5C0X J;  1KLU D;  4ZUJ A;  4KKT A;  2K28 A;  1EIG A;  4DXG A;  3F2U A;  3BDC A;  5JAV A;  3HOX B;  4KJO A;  5I2X A;  1XWE A;  3P20 A;  2JA6 B;  2QEJ C;  1FD7 D;  1AFP A;  3HGB A;  1I6V C;  1IKL A;  2L0C A;  5EKI A;  5IT9 E;  5DM7 3;  4IAL A;  3OMG A;  2F0M A;  2ID0 A;  2F0J A;  3JAM L;  1HQR D;  1PRT C;  1SXT A;  1CTM A;  3MXN A;  4P2C B;  3KUP A;  3KLR A;  1H9R A;  1MGS A;  2XWJ B;  4E6I A;  3QJY A;  1LTG D;  4DF7 A;  2B2T C;  2XIW A;  3A8K E;  2JA5 B;  2L11 A;  2O5I C;  3D6W A;  1QIL A;  3VR3 A;  1SNC A;  2F0S A;  1LAC A;  4C3I G;  1HQM C;  1ZKO A;  1WTP A;  2E2H B;  4XT3 B;  1F2L A;  4HR7 B;  1ROD A;  1EQV A;  2K5D A;  3T51 B;  3VR5 A;  3OWE B;  3S15 B;  1YNN C;  5JEA H;  3MA2 B;  2OT2 A;  5C0X I;  1Y1V B;  4K6D A;  1STG A;  2AWO A;  1WTR A;  1GUW A;  1TU2 B;  5CYU A;  5C0X G;  1SEB D;  1SYD A;  1H9S A;  1BCP B;  1PTO B;  3HG9 A;  1PFN A;  2IJ0 A;  3KBX A;  1PZJ D;  5EGT A;  5D65 A;  1ILQ A;  3MTS A;  4DA2 A;  4Z9C B;  4KD4 A;  1QJO A;  5F2D A;  3NBH A;  2MGS A;  3BZD B;  4ODG A;  1WTV A;  2XRQ D;  2EE1 A;  3FPP A;  5COR A;  1UUP A;  4MIU A;  1M8A A;  2C9O A;  3KK7 A;  4FF3 A;  3GTG B;  2K04 A;  1SNM A;  2VNU D;  2HCC A;  4ZRZ A;  5TSS A;  3J80 E;  2R6G A;  1SE4 A;  1UNS A;  4ILW A;  1FYC A;  2EJM A;  2BE5 D;  4PMW A;  1HRJ A;  5IT9 L;  3EVQ A;  3SK4 A;  1TY0 A;  5C5M A;  2EXZ A;  2M2L A;  3D4R A;  4RA8 A;  4H44 C;  4FF2 A;  1SSO A;  3NHH A;  4LAA A;  1G2T A;  3R2T A;  4TRD A;  4G7H C;  1TY2 A;  1B1Z A;  1F9S A;  3S16 B;  5FK9 C;  4EQP A;  2SOB A;  2TMP A;  3L7Z C;  2R3Z A;  2F0W A;  2R93 B;  2OEO A;  4CJ1 B;  2Y0S B;  1U4L A;  2KCC A;  3T16 A;  4H13 C;  2L5T A;  5KRU A;  3NTH A;  2HCI A;  2F0L A;  2ZXP A;  4F8M A;  1I3Q B;  1IW7 C;  1LO5 D;  1C8C A;  5CC4 A;  5JOB A;  2O5J C;  2A6E C;  3TZU A;  1D5X C;  3SK5 A;  2A68 C;  1AN8 A;  4J1M A;  3TSS A;  1JOR A;  4A3G B;  1CQV A;  2QCP X;  4DN4 M;  1FR3 A;  3A56 A;  3VYU A;  4C3J B;  3N52 A;  2PZT A;  2KEE A;  2A69 D;  5D3D A;  5BN3 A;  5C3W A;  4S3S A;  4RHR A;  1D2B A;  2B2Y A;  2C5C A;  2Q8I B;  1KAB A;  3W2D A;  4XYO A;  3HOW B;  4MN3 A;  2F03 A;  4M1U B;  1F9P A;  3WDN A;  1E0B A;  1RKN A;  1R4Q B;  1SAP A;  3ERO A;  2YYZ A;  1RTO A;  4ZKC B;  3J80 L;  2NVT B;  1B4O A;  3CU7 A;  5JVH 3;  1PMR A;  2OXP A;  1TKW B;  3I4L A;  1KDC A;  2AQ2 B;  2RSO A;  1RJT A;  3I8Z A;  4RGT A;  4N9T A;  1JOK A;  1JOO A;  1BNZ A;  1B50 A;  2K33 A;  2A74 C;  3D6C A;  4QCL A;  4OIK A;  4DK1 A;  3MXG A;  4ZYS A;  1ONL A;  2AUJ D;  2K6A A;  1U4M A;  2JEB I;  4C1N I;  4PV1 C;  1EZ6 A;  4FF4 A;  1R4P B;  1SMY D;  3SK8 A;  1BDO A;  3NWT A;  4C3H B;  3I72 A;  5CV5 A;  1I4H A;  2EPB A;  2MUY A;  5CV8 A;  2E74 C;  3DEO A;  5AFW A;  1D1K A;  5M5W B;  1CI3 M;  4DU9 A;  5IOC A;  4TQU S;  4XIG S;  1ZYR D;  1DJR D;  1L0Y B;  4PMC A;  3O13 A;  4HSV A;  1HTP A;  1O7L A;  1Y8N B;  4FP5 D;  3OW7 A;  4KN4 C;  4H0L C;  1BO0 A;  1VF5 C;  1VMP A;  5DM6 3;  4KN7 C;  4KI0 A;  4V19 0;  3R2I A;  3M3Y B;  2F0N A;  1JC7 A;  4QIW B;  3M4Y A;  5IGD A;  1TWA B;  3ERQ A;  4H7B A;  5ISR A;  5CV4 A;  1PFM A;  1TII D;  4FXG C;  2DY8 A;  1PFB A;  5I2Y A;  2B39 A;  1K83 B;  2B2W C;  5C4X B;  2CHB D;  1B9M A;  2QKI C;  1HUM A;  5K5P A;  5E4W C;  3IKJ A;  1F2Y A;  2HQE A;  3FKI B;  1LTI D;  4IUU A;  3RD4 A;  1TS4 A;  5KND A;  1KNA A;  1RDP D;  1PZK D;  2DN8 A;  5JVG 3;  1OO9 B;  1HUN A;  2ICE C;  3R8B A;  1AEX A;  4PNY A;  3K59 A;  5NUC A;  1LTT D;  2FFK B;  5BN4 A;  1I50 B;  4A93 B;  1STH A;  1GOZ A;  2AQ1 B;  1W6J A;  4DFA A;  1EYA A;  2XSC A;  4O42 A;  3FDT A;  3GTL B;  3A7A B;  5C6A A;  1OXT A;  3TME A;  3PUW A;  5IGB A;  2KED A;  4EVO A;  1D5M C;  2PNR C;  1V8Q A;  2RDF A;  5C4H A;  4XQN A;  1CA5 A;  5T1I A;  4C2M B;  3OMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...